4IJLA

Fragment-based discovery of protein-protein interaction inhibitors of replication protein a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
SHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Protein-Protein Interaction Inhibitors of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 33
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ijlA00
1VQ6A 1VQEA 3STBD 2H5XA 3HOXG 3W5OA 4OONA 1B8AA 1XNQL 2IY5B 3FP9A 2WB1E 1K9MC 2IT1A 1NE3A 3EIVA 1VQ5A 5AJ3L 3UDIA 2QEXA 4YCVA 4BBRH 3KF6B 3L0OA 1PH5A 1HZ9A 1UE7A 4GLVB 4B3MQ 2R6GA 4KHPQ 4P71A 4GKKQ 3ER0A 1IBLL 1AE3A 4JI5Q 3HOYG 1YHAA 3FKIG 4RG1A 1RL2A 4NXNL 3HOZH 2EXDA 4R4IA 4JI3Q 1XNQQ 3U58A 1YVCA 2A1AA 1UE1A 4IO9A 1L1OA 5C3EH 1PH1A 2BH8A 5M5YH 3H15A 1EIYB 3I4MG 4QY7A 3K7UC 3JAMi 5M3FH 1XMOL 3HOVG 1UEBA 3I7FA 1IL2A 1MJCA 3CCMA 1GM5A 4C3HH 1VQ8A 3GTMH 3ZJYC 1C0AA 4GOPB 5DLQE 4UP8A 1OXXK 3SGIA 1CKNB 4AQYQ 3HKZG 4WJ3M 2I5MX 5FJ8H 4LUOA 1SROA 3PUZA 2HHHQ 4DV2Q 1N8RC 2LSSA 1CKMA 3EN2A 2DUDA 3UE1A 4P72A 4B3RL 1PA6A 4PZ7A 2E2IH 4LF8L 3S24A 5IWAL 2KCTA 3PUWA 3HOWG 2F3IA 1VQFA 5C4XG 4H02A 1A8VA 2HIVA 3CC4A 3F8TA 3U4ZA 2HIXA 3CC7A 5HGQA 5LMUL 2JA6G 4GOPC 4OO1G 1KAWA 4PZ6A 2CWAA 1KQSA 3RN2A 1X3GA 4YHHQ 1K8AC 2HQLA 5H1SE 4OX9L 4A3DH 4A93G 1KRSA 1V43A 1CSQA 1XTDA 4UPAA 4A3IH 2KENA 4NB3A 3UDGA 2B29A 1SRUA 4DAMA 2PNHA 4DR6Q 1YJWA 2AWNA 4LF4L 3CPWA 4DV7Q 3OTOQ 3K7AH 4C2MH 1FL0A 1QUQA 1Y1VH 3PUVA 1Q1BA 3E9IA 3PUXA 4DV6L 2IHEA 2ATWA 2HT1A 2R7ZH 4GLAC 1LUZA 3M4OH 1YBYA 1QZGA 1I50H 2NN6G 4UP7A 3WWVA 4LNQA 5LMNQ 1IZ6A 2N49A 4QL5A 1EWIA 5EAYA 1WOCA 1OXSC 3EBEA 4APVA 4EQ5A 1R9TH 2AHOB 1KC8C 2MQHA 3U50C 3NBHB 5M3MG 4HIOA 4AQYL 4DV6Q 3GTOH 2N3SA 1YIJA 3CXCA 3OTOL 4DV7L 2F52A 3CMAA 1KRTA 1P16A 4LF4Q 1KL9A 2UUCQ 2VY3A 5C44H 2UUBL 4DR6L 2Y0SG 1PVOA 3PF4A 2JQOA 2RF4A 1HR0Q 1NTGA 3D31A 1TWGH 3I4NH 3RZOH 5JEAJ 1VQJA 1G291 1P8LA 4BY1G 1Y1WH 3H0GG 3CP0A 3PGZA 4LFCQ 4JI8Q 2AMCB 2I0QA 2Q2UA 4B3SQ 2JA7H 1I94Q 2JEAI 3TRZA 4TVAB 3S14H 4JI5L 2JK8A 1YI2A 1YZ6A 4HJ8A 3KJOA 1T9HA 1HZBA 1VQLA 2B63H 1EFWA 2BA1A 4LWCA 2Z0SA 3STBC 1VQKA 1PH4A 4WJ4A 5IYDH 4XTCS 3JC66 2UUCL 3KDFA 1TWAH 1IBML 4DUZL 4GOPA 3KDFB 1PV4A 3I2ZA 4X66L 1A62A 1H95A 3T1YL 1VQIA 3CW2C 3ULPA 3OYYA 3W1BA 4GNXB 3BZCA 4B3RQ 2R92H 4DV2L 2IHFA 2R92G 3CMEA 3S15H 4A3GG 1W2BA 4IOCA 1HH2P 2FXQA 2KBNA 1QZHA 3KFUA 2ID0A 2OQ0A 1YNXA 4DR1L 1S40A 4C3IH 3RNUA 4DAYB 2YTXA 4X66Q 4DR2L 5IYDG 2LXJA 2ZJRA 1N9WA 4DV0L 4R4CA 2WB1G 1SE8A 4POGA 1X65A 2D0OA 4X65L 4NXMQ 4LW1A 3AFPA 4JI6L 3BZKA 2F4VQ 1K0RA 1AH9A 4PG3A 3GDEA 3TEHB 4GKJL 5IP7G 2BH2A 3HOUH 4DR3Q 1SLJA 1VQPA 1BKBA 4R4OA 4JI3L 1JB7A 1QUQB 2NVTH 3S1MH 1Y1WG 2RCNA 3J80c 3HFZB 3IRBA 4BY1H 4A75A 3PSIA 2VUMG 4A3MG 5GROA 1HR0L 4A3MH 4LF6Q 2UUAQ 4JBMA 1N33L 1N34Q 1HNXQ 3GTQH 2N8NA 4YWLA 5AJ3Q 3F2CA 2ZTDA 3TS0A 3OW2A 2YU9H 1VQOA 1E24A 1U0LA 4IPCA 1C7YA 1D7QA 4AIMA 5IT9c 1E3PA 4O0AA 4TQUS 2B63G 3RLNA 1VQHA 2LXKA 1KIXA 3PV0A 3J81c 4DR7Q 2YV5A 4LF7L 3NEMA 4R1JA 2HHHL 4L5SA 5LMNL 2IX1A 4KHPL 4K0KQ 1YHBA 4DNIA 1WCMH 2B3GA 2KHJA 4JG2A 1VCIA 5IY0A 4IFDG 2GVBA 1TXYA 3T1HL 1J5EQ 1K73C 3HOUG 1C9OA 3PO3H 1W3SA 2E5LQ 4P74A 1X6OA 1GD7A 1WI5A 3M4PA 4DV3Q 3ICEA 5GADC 4R4TA 2DGYA 1BVSA 4A76A 4DV5L 2ZJPA 1UE6A 2PQAA 4B3TQ 5IYCH 4DR7L 3K80C 4JC0A 1MIUA 2PQAB 3E0EA 3I4NG 2C35B 2JA5H 2Y0SE 4LFBQ 1WFQA 2MO1A 3JAMc 2Z6KA 2NVXH 3G71A 4YY3Q 1B70B 3M3YH 1V9PA 1VQGA 2ZM6Q 1PH3A 1PH7A 3S1RH 1PYSB 2JJQA 1FJGL 2L15A 4JI2Q 2XTIA 5C0XJ 4LF5L 5JJIA 4JBWA 1VQ4A 1PHJA 1Q1EA 2VNUD 1K8GA 4LFBL 5IYCG 4JCVE 1A0IA 1I3QH 3H0GH 4KLKA 2JA5G 5JJKA 1K83H 5ELNA 4ME3A 5GAHC 1PYBA 1UE5A 2Z6KC 1VQ7A 1FVIA 1Y14B 2YYZA 3LGJA 3RZDH 2WP8J 1X9NA 2K50A 4JI1L 3KYHC 1BBUA 1TWFH 1CUKA 2PMZE 4JI0L 3M7NA 1GKHA 1Y1VG 4MTNA 4DV4Q 1E7ZA 3AFQA 3CCEA 3I4OA 1VQCA 1CSPA 4DPGA 4DR1Q 4HJ7A 3B6YA 2VZAA 1QVCA 5GQOA 4JI1Q 4HIMA 1Q82C 1Q86C 4JBKA 3L2PA 1KXLA 1VQAA 3KLWA 2MFIA 1PH2A 1HJPA 3H3VI 2JA9A 5JJLA 1XMQL 4IJLA 1PH6A 4DK6C 1VQNA 3PUYA 1L1OB 4P75A 5M5XH 4DUYQ 3DLLA 2UU9L 2I5HA 3J81j 4DV1Q 4A3BG 2ALYB 4DUZQ 1WYDA 4NXNQ 1TWHH 4LUZA 3PIOA 1X56A 3A5UA 5FJ8G 1YHQA 1ASYA 1N33Q 4YCWA 1E1TA 1HNZQ 4B3ML 4GKKL 1FJGQ 3TREA 4LFAQ 5JEAG 1U5KA 4XIGS 5FLMG 1Q81C 3KF6A 3TS2A 5C4XH 2VQFQ 4OWTB 4MZ9A 2GN5A 5FLXc 5BR8Q 1JE5A 1XMQQ 1KHIA 4JV5L 3UE0A 4JOIA 1X3EA 2CCZA 1OXUA 4X65Q 4X62L 4NXML 3GTKH 1N32Q 1CKNA 5M3FG 3F2DA 3FHWA 4QQBX 4DR2Q 4A3IG 4JI7L 4Y52H 2E5LL 1LTLA 4GN3B 4UY8C 3PO2H 3S2HH 2VL6A 4A3FG 2R7DA 5M3MH 4IFDI 3FKIH 3CPFA 4BBRG 3HOZG 4K0KL 2UXDQ 1G51A 4J15A 2K14A 2K5HA 2ES2A 1IBKL 2K5NA 2UXCL 1MJEA 3T1YQ 3HOWH 2JA7G 3S2DH 1XNRL 4A3EH 1IBMQ 4P73A 4AH6A 1NMGA 1HR0W 3HOVH 1HZCA 4OWXB 4R4QA 3HOXH 4L5TA 4L5RC 4LF5Q 5IE8A 4JI2L 4OWWB 2N78A 1RIPA 3HKZE 2QA4A 4BA2I 4BY7H 1GVPA 2ZTEA 2K4KA 5C3EG 3I4MH 2GVAA 2ZM6L 1SN8A 3M85A 4YY3L 4A3BH 3K0XA 4OX9Q 4X64Q 2CKZB 4A93H 5E7NA 4A3DG 2VQEL 4GKJQ 4YHHL 2UXBL 3RN5A 3HOYH 3GD7A 1L0WA 3M9BA 1K3RA 1GO3E 2AWOA 4DV0Q 4A3KG 1EIFA 3A74A 4KHZA 1M1KC 3KOJA 1XPOA 1XPRA 4OXPA 5K36G 2RHQB 3T1HQ 5IWAQ 2I5LX 1J5EL 4GNXC 2V1CC 4PZ8A 2BA0A 4FDBA 2VW9A 1N36Q 4BBSH 2JA6H 2MNAA 3PCOB 3GO5A 1SMXA 1L1OC 1SR3A 2KHIA 3GTLH 2R93G 3MEFA 1JT8A 3CCQA 4A3LH 4IFDJ 1G6PA 4A4IA 3CQZH 2OTJA 4BA1I 4QJFA 3CAMA 4EX5A 5IP7H 1VQMA 1VS0A 4Y7NH 4UP9A 4QGUA 2UUAL 2OWOA 5IYBH 2PI2A 3PIPA 1NJIC 4JYAL 2VS1A 5LMNW 1S3OA 1I6HH 1EQRA 4GN5A 1LM0A 2NZHA 2AKWB 5BR8L 2E2JH 4DR4L 2ZJQA 3S17H 3KJPA 1IXRA 2WAQE 1I94L 3BJUA 1JJGA 4DKAC 2VQFL 1EUJA 4B3SL 4GLXA 2A8VA 4JI8L 2CQOA 3K8AA 4JOIC 2CFMA 1WJJA 4LFCL 3ULLA 4DR4Q 4LFAL 1LYLA 3W1GA 4HIDA 2F4VL 4JYAQ 1MKHA 4O2DA 2KCMA 4POFA 4JI6Q 1JJ2A 1NMFA 4BY7G 5LMUQ 3DM3A 4MNOA 4YWKA 3CCUA 4YCUA 1PH8A 1NBWA 3CCLA 3A0JA 4YWMA 4HIKA 2EIFA 4HJ5A 3J81i 1KD1C 1OXTA 3PO3G 2Q2IA 4LF8Q 1IBKQ 1Q8KA 3G6EA 1M90C 1E1OA 1Q46A 2K75A 4IJHA 3CD6A 3TQYA 1VQ9A 2R7FA 3CCRA 1L2FA 1IYJB 4RMFA 1NY4A 2JEBI 3GTGH 4A3LG 4C3JH 2JA8G 1XMOQ 3RLFA 3I56A 2NZOA 1PFSA 4JV5Q 3M4QA 1SFOH 4GNXA 3K81C 1YITA 1X55A 1JJCB 3CCVA 4A3FH 5C44G 1X3FA 1JMCA 4X64L 1EQQA 2RHSB 3UDXA 4QIWE 3GTJH 4A3CG 3BU2A 4GS3A 2IX0A 1YJ9A 4ALPA 1V1QA 2JE6I 5ELOA 4AYBG 3L7ZC 1PH9A 3NENA 5IYBG 2K5VA 2MO0A 3Q8DA 2VUMH 1YEZA 4OO1I 1I5FA 4A3JH 1E22A 3KF8B 2UUBQ 3PF5A 1A63A 1B7YB 1FGUA 1DGSA 4X6AH 4DK3C 2UU9Q 3J7A5 4IPGA 1BBWA 2OTLA 1J6QA 2OCEA 2YTYA 5IP9H 1QVGA 1QVFA 1X54A 3RR5A 4AYBE 2NVQH 4DR5Q 2UXDL 4LUVA 3F2BA 1HZAA 2E8GA 1N36L 4BXXH 4DV5Q 3HKSA 4A3CH 2JA8H 3S1NH 3I55A 2D0PA 4DV3L 4IOAA 2WFWA 3J7ZC 2E2HH 5J3BA 5M5WH 3VDYA 5C0XG 4A3KH 4JI0Q 1ASZA 1Q12A 3CC2A 2WAQG 1N32L 4IPHA 4A3GH 4DR5L 1YJNA 5HY6A 3AYHB 1XJVA 1HNWQ 1VQBA 1S72A 2R7ZG 1CKOA 1VQDA 3G4SA 2VQEQ 5IP9G 4LF9L 2UXBQ 2Q2TA 1EYGA 4JI4L 3UDFA 3ERSX 4A3EG 2YTVA 4GN4B 1OXVA 5FLMH 5C4JH 2OQKA 1WCMG 4NPSA 1N34L 1HNXL 1IBLQ 1D8LA 1Z47A 4LF6L 3H3VH 3A5ZB 1HNZL 4LF7Q 3MXNB 2K52A 2NVYH 3U4VA 1UWVA 2CWPA 3AEVA 1TWCH 3D0FA 4BBSG 4IPDA 3CF5A 3AQQA 1XNRQ 4DV1L 4JI4Q 4JBJA 3G48A 4DUYL 1EOVA 2QGQA 4DR3L 4L5QA 3S16H 3CCJA 4LF9Q 4A3JG 3PO2G 2UXCQ 2ASBA 2XGTA 1HNWL 3S1QH 4B3TL 1AE2A 5GAGC 4HJAA 1XPUA 2PI2E 5GAEC 2NN6I 3E9HA 2A19A 5C0XI 3RLOA 3J80i 2D62A 4PMWA 3CCSA 2EQSA 3NELA 4DV4L 2Q2HA 3F1ZA 4KI0A 3ULJA 4JI7Q 4BXXG 3GTPH 1Q7YC 1OTCA 1O7IA 2ZTCA 4X62Q 1Z9FA 2R93H 4HJ9A
chains in the Genus database with same CATH superfamily
2F0UA 2A69D 3STBD 2H5XA 1B8AA 5CORA 5J22A 1XNQL 1F9SA 2WB1E 1A2TA 1SNQA 3L0OA 5M9OA 4GLVB 4IURA 3Q24A 1FD7D 4P71A 4GKKQ 1IBLL 4A3MB 1YHAA 2GA4B 1XNQQ 4CBVA 2A1AA 4UAIA 4A3GB 2X6LA 3I4MG 2BH8A 3H15A 1EIYB 2C9OA 3JAMi 2B2UC 1DCZA 2PQEA 4MHEA 1C0AA 1STAA 3VR4A 1CKNB 4AQYQ 4WJ3M 2NVQB 1A2UA 3PUZA 3TN2A 1N8RC 1PA6A 3S24A 1FYCA 1ET6A 1A8VA 1XXGA 3J7YW 5HGQA 5LMUL 4GOPC 3X3NA 4ME5A 1KAWA 1SAPA 3RN2A 1X3GA 1K8AC 3A56A 4DGZA 3X3MA 1LT3D 3C2PA 3M3YB 5EPLA 1JC7A 2KENA 4DAMA 2PNHA 4DR6Q 3IFTA 3TP7A 2R61A 4C2MH 1QUQA 5T1IA 2IHEA 1WTXA 4ZYSA 1YBYA 2DY7A 2EPBA 3GTOB 4QL5A 5IOCA 4LF7Q 1OXSC 2AHOB 3TBIB 3NBHB 5M3MG 1LTSD 2N3SA 4LJZC 3CXCA 1KL9A 4DR6L 1PVOA 2Y0SG 3PF4A 2JQOA 1F2LA 1O7LA 3KBGA 1NTGA 3I4NH 1S5BD 1PRTF 4ULLA 3H0GG 3BYYB 2K5WA 4B3SQ 4BY1B 1RODA 4A3DB 3TRZA 3L3OC 3NTIA 1YI2A 4HJ8A 3D4DA 1T9HA 1VQLA 1TS2A 2Z0SA 1LACA 3JAML 2UUCL 5CV9A 3KDFB 4X66L 1H9JA 3T1YL 1AW7A 1H9RA 3CW2C 4RCOA 4X3KA 2IHFA 3BVMA 4IOCA 2FXQA 3KFUA 2E75C 4IUVA 1GXDC 4K14A 4XXEA 5JOBA 2HD3A 2WB1G 3FDTA 2D0OA 2RCFA 4NXMQ 3QR8A 3SVMA 4JI6L 2F4VQ 1K0RA 4A93B 1AH9A 4GKJL 4DR3Q 4R4OA 2ZT9C 2IX3A 5C3EB 1JB7A 4FF1A 2PO4A 1B50A 1JOKA 4CGYB 4BY1H 4LF6Q 4JBMA 1SJED 3D8GA 5E3FA 1N34Q 3F2CA 4IUPA 2HCCA 1U0LA 4TQUS 4O0AA 1PYWD 4DR7Q 1GUNA 1YHBA 5EKIA 4IFDG 2P5ZX 3IFDA 1Y69U 2O5JC 1J5EQ 3HOUG 5CV5A 3PO3H 1Y8NB 3URYA 1X6OA 3GTKB 2V4DA 5GADC 3EQLC 1HXYD 1EWCA 4DV5L 4A76A 1QG7A 4B3TQ 4JC0A 3VA5A 1F2YA 2RDGA 2F0NA 2BOSA 3SK8A 1D5ZC 3G71A 3M3YH 1RF2D 3TMEA 4G7HC 5C0XJ 4LF5L 1TWCB 5CGKA 4J1MA 1VQ4A 3U9SA 3OOCA 1EYDA 1Q1EA 2VNUD 4QCLA 3A8KE 3VR3A 5IYCG 3R3OA 5GAHC 1PYBA 2HUGA 2Z6KC 2JN4A 1Y14B 3LGJA 2B2WC 2WP8J 1O7YA 1B9NA 2F0GA 2F0DA 3KLRA 1GKHA 1Y1VG 4RGOS 3AFQA 1I6VC 1CSPA 4HJ7A 4MIUA 1Q82C 1HJPA 4X3UA 2JA9A 1BDOA 3PUYA 1L1OB 4P75A 5M5XH 2UU9L 1GUOA 3K57A 2I5HA 3J81j 3NTKA 1MI2A 1WYDA 4LUZA 4L63B 1X56A 5FJ8G 4PMCA 1N33Q 1E1TA 3NE5B 4B3ML 1EY8A 2XRQD 1EIGA 3IAYA 2EVBA 5FLMG 4XIGS 1LTID 2VUMB 1GUWA 3PMFA 4DNRB 2VQFQ 3RZOB 3I4NB 1BBXC 5EKLA 5E4XA 4JV5L 2CCZA 1OXUA 1CKNA 3P75A 1F9RA 4X3SA 4QQBX 4UY8C 3E0JA 2FMMA 2RDHA 3CPFA 2L0CA 5FLXL 2ES2A 2K14A 3R8BA 1MJEA 3IL8A 2JA7G 3S2DH 1JE4A 4HR7B 1IBMQ 3J81E 1NMGA 3HOVH 3MVVA 4CDEC 3MEHA 5IE8A 4JI2L 4OWWB 3HKZE 4BA2I 1CZGA 1DOKA 2ZTEA 2GVAA 3NUCA 2ZM6L 5KEEA 3M85A 2CKZB 4DN4M 1SE3A 2UXBL 4GKJQ 4K2KA 3HOYH 1PTOD 1G6ZA 3S17B 3M9BA 4G7ZC 1GO3E 1CK1A 5EPJA 1M1KC 3KOJA 4OXPA 4A3KB 5K36G 3T1HQ 5IWAQ 2I5LX 3C3LA 2QF7A 2R92B 4PZ8A 2BA0A 5I9OA 2JA6H 1SNOA 3GTLH 2NWGA 3CCQA 5I2YA 4IFDJ 4A4IA 3VYTA 1FNWA 4BA1I 5ISRA 1QNUA 1F2ZA 1ESRA 3QOLA 1SYFA 4KN7C 2PI2A 5CBEE 3HRZC 1LM0A 5AFWA 2J4XA 2EYLA 1JJGA 4DKAC 2VQFL 1EUJA 1X3PA 1LV9A 4B3SL 2A8VA 1Q8IA 2X6GA 4BBRB 2WV6D 4O2DA 2KCMA 3V05A 4POFA 4A3FB 3DM3A 4MNOA 3CCLA 4HJ5A 5ELCA 1DD2A 4K5VA 1OXTA 2Q2IA 3FPPA 4LF8Q 1Q8KA 3G6EA 3M7GA 1M90C 1I50B 5ELDA 3CD6A 3FKIB 1L2FA 3T51B 1VDZA 3P20A 3I3CA 5IGBA 2K28A 2NZOA 3S16B 1L0XB 2Q8IB 1X55A 1HUNA 1DOMA 4QIWE 1DM0B 4A3CG 3BU2A 4GS3A 1KTKA 4HMIA 4CDDC 1GHKA 4OEMB 1V1QA 5ELOA 2K5VA 1A3VA 2VUMH 4OO1I 2NTTA 2EXZA 1E22A 1I6HB 3KF8B 5CC4A 1AFPA 3EROA 1SNPA 4CDCC 2E2IB 3K5LA 4R8NA 1WTWA 2OTLA 1EU4A 1A3UA 5IP9H 1QVGA 3NK9A 3VR2A 3RR5A 3DM1A 2UXDL 3A54A 3OPOA 4LUVA 1HZAA 1N36L 4DV5Q 3GTMB 2Z8LA 3I55A 1SNDA 4BS9A 3H09A 4OGQC 2E2HH 3AU7A 1E2ZA 1HFNA 2CQAA 4JI0Q 1ASZA 3GQBA 2WACA 2LMCB 4DR5L 1JICA 1XJVA 1HNWQ 3S9WA 4XT3B 2R7ZG 1CKOA 3NQTA 4LF9L 1E0BA 3QIAA 2D9UA 5FLMH 1OXVA 4C1NK 1PTOH 1FNUA 5C4JH 2OQKA 4NPSA 1WTPA 3D6WA 3LNNA 1N34L 1IBLQ 4LF6L 4CKBA 3H3VH 5CV8A 1EQTA 2K52A 3U4VA 3MWYW 3DXJC 2A6HC 4IPDA 3CF5A 4JW0A 3HOXB 4JBJA 1HPCA 4DR3L 3CCJA 4LF9Q 4A3EB 2UXCQ 2B2VA 2AQ1B 1HNWL 5GAGC 1D5MC 2NN6I 3RLOA 4PMWA 1TR5A 3OMCA 3K5NA 1EZ8A 4ODGA 3ULJA 1R4PB 4IALA 1OTCA 5IT9L 1DONA 2R93H 2A6EC 4HJ9A 4RHRA 2PW7A 1VQEA 5K5PA 4MN3A 1B3AA 3HOXG 3W5OA 3TP8A 1BXTA 3FP9A 2IT1A 1NE3A 1VQ5A 2QEXA 2B2UA 4BBRH 3KF6B 1UE7A 3E6ZX 1SYCA 2ZXOA 1VMPA 1STYA 2R6GA 2K6AA 1MHWC 4RG1A 4NXNL 2EXDA 4R4IA 4JI3Q 2E76C 1TWHB 1YVCA 3LWUA 5C3EH 3NBIA 4HTHA 1ICFB 4Y7NB 3K7UC 4M8AA 5M3FH 1W6JA 5KYLA 5I2XA 1UEBA 3I7FA 1MJCA 5CMDA 4B9WA 1GM5A 3CRKC 5DLQE 4UP8A 2EYFA 4LUOA 2HHHQ 2VXWA 1ML0D 1CKMA 4B3RL 3KLSX 2NUCA 3A8JE 4LF8L 3S15B 2G9HD 2WKDA 1VF5C 2KCTA 3TZDA 1VQFA 1V1PB 5K36H 1O80A 2KHSA 1EY0A 2X69A 4OO1H 4OO1G 1IHZA 4PZ6A 2CWAA 1KQSA 1JB3A 3WDNA 2HQLA 5H1SE 4OX9L 5FO7B 4A3DH 4A93G 2F1MA 1KRSA 4CKCA 4TSSA 1CSQA 4UPAA 3UDGA 4WRDA 2B29A 1EY6A 1YJWA 2AWNA 4LF4L 1K3BC 4DV7Q 3OTOQ 1Q1BA 4J6HA 4FXGC 2HT1A 1PXUA 1TT2A 3NWSA 4UP7A 5LMNQ 1EU3A 5FO8B 2N49A 4APVA 5EAYA 2K01A 1EYCA 1KC8C 3U50C 2F0QA 4AQYL 2WB1B 1ILPA 5I6WA 1IKLA 4EGVA 1M8AA 2M2LA 1PMRA 2F52A 1KRTA 1P16A 1RDPD 1T5EA 1CA5A 1VMCA 1HR0Q 3D31A 3RZOH 5JEAJ 1GHJA 5C4XB 1CHQD 1NCVA 4TVAB 1JR0D 2JK8A 4OL7A 2EY6A 2KEDA 1EFWA 2BA1A 5IYDH 1XTCD 1VQKA 4WJ4A 4HN7A 1IBML 2PCFB 5KYIA 3I2ZA 5HGTA 2A68D 1H95A 2NYZD 1ENAA 3MXPA 5DNFA 4GNXB 4ZCKA 2E74C 2R92G 3MFYA 2PZTA 3CMEA 3S15H 1T5XD 1W2BA 1HH2P 1HCZA 2SOBA 5G3LD 2ID0A 1TQOA 3RNUA 2YTXA 4QF4A 3KF8A 1TS5A 4RWSC 2ENBA 2KJXA 5D3IB 1N9WA 4R4CA 4POGA 2F0TA 4FF3A 3AFPA 2A6HD 3SK5A 4PG3A 3E5SA 3HOUH 2IPKD 3I4MB 1BKBA 4PMBA 1QUQB 2NVTH 1Y1WG 3J80c 3HFZB 3PSIA 4C3IG 2VUMG 2AQ2B 4A3MG 1HR0L 4A3MH 4KJNA 2UUAQ 1N33L 4HSVA 3VYUA 5AJ3Q 3TS0A 4DAYA 4FF4A 1E24A 5NUCA 1GUSA 1VQHA 1K8MA 1MD2D 2YV5A 3NEMA 4FXKC 4R1JA 4RAUC 5LMNL 4L5SA 4HCSA 4K0KQ 4FO2A 3K58A 1WCMH 2B3GA 2KHJA 4JG2A 1R9TB 1NUCA 1TXYA 3GV6A 1C9OA 2MHVA 1BR9A 1GD7A 3ZYYX 3ICEA 1O7ZA 2ZXPA 1Y1VB 1U4MA 2SNMA 5KGUA 5COYA 2PQAA 1G2TA 5IYCH 2L1BA 3K80C 1MIUA 2PQAB 5JAVA 2C35B 3MTSA 2JA5H 2Y0SE 2MO1A 1ILQA 2Z6KA 4YY3Q 1B70B 1EFID 5EQ0A 1WTHA 2KVMA 1PH3A 1PH7A 3S1RH 2JJQA 2F0MA 2L15A 5JJIA 1B1ZA 5CYUA 2F03A 4RA8A 1CZWA 2NN6H 2ICIA 3N52A 1K8GA 1DYQA 2F0FA 4KLKA 3HGBA 2WINB 4XQNA 3RZDH 4O42A 1TY2A 2F0HA 4JI1L 2F0OA 1TU2B 3KK7A 1E7ZA 2BE5C 3CCEA 3I4OA 2G9DA 3HS0C 5IT9E 4JBKA 1QVCA 2AUKA 5ELBA 3L2PA 3KLWA 1PH2A 2QDBA 1CQFA 4GZYC 1Q90A 2NTSA 3D3RA 1XMQL 1PH6A 4DK6C 3FVQA 4DUYQ 1SEBD 3DLLA 2H1EA 4A3BG 4KN4C 4NXNQ 2F0JA 3A5UA 1YHQA 1ASYA 4YCWA 2QILA 4RCNA 3TREA 1U5KA 1STBA 1Q81C 3CU7A 3C46A 4FVMA 1TWGB 1B9MA 5IGCA 4OWTB 1KDCA 2GN5A 1IYVA 1LTRD 3UE0A 1Z6HA 5C44B 1X3EA 4NXML 2L9HA 2QKIC 4K2LA 1SFOB 3FHWA 1G2SA 1SDFA 2E5LL 3GTGB 3PO2H 5EKKA 2Q8TA 3S2HH 4C56C 2R7DA 5M3MH 4IFDI 4XYQA 3FKIH 3Q22A 4BBRG 3HOZG 2QEJC 1BQQT 1E2WA 2K5HA 1HQRD 3I72A 3QO2A 1IBKL 1CM9A 2UXCL 3HOWH 3T1YQ 3DEPA 3T53B 1PTOC 4NW2A 4L5TA 4N8FA 3J7AF 3MFGA 2JSOA 3A7LA 5J39A 1RIPA 2NVTB 4U68A 5C3EG 1HTLD 2XWJB 4A3BH 4OX9Q 3BDCA 3KBXA 2EE1A 3GD7A 5JJZA 3AMUA 3IKJA 2B8FA 4CJ0B 2WKCA 4C3IB 1XPRA 4KK7A 2CW0C 2V1CC 2A74C 3NSWA 4FDBA 1N36Q 4BBSH 2R93G 1SR3A 3MEFA 4A3LH 2IW3A 3OIQA 4QJFA 1ZYRC 1VF7A 2LFNA 5IP7H 2Z6BA 2L12A 4UP9A 4QGUA 5LL6X 1NJIC 2CH4W 2NB0A 2N88A 4JYAL 1EQRA 4GN5A 3PIP3 2E2JH 2JYOA 2ZJQA 3S17H 3KJPA 3GP7A 1I94L 4JOIC 2CQOA 2EJFC 1WJJA 4LFCL 2EOTA 4LFAL 1LYLA 4HIDA 4JYAQ 3H91A 5J1ZA 1JJ2A 4RKLA 4BY7G 5LMUQ 4YCUA 1K8OA 5C5LA 4LK1C 3BZDB 4ZQ3A 3HOVB 4C3HG 3NP8A 3S2DB 1M4VA 3CKIB 1Q46A 1KNAA 1UNSA 2K75A 2OF1A 3OSOA 2EJMA 4KY6A 5CR3A 2MGSA 4KKSA 2FMCA 1BO0A 2CW0D 3I56A 2M00A 4GNXA 3QB3A 1YITA 1JJCB 3MAQA 4G57A 5C44G 3CCVA 4EQOA 1JMCA 1EQQA 4DXFA 1B53A 1YJ9A 3CRLC 4CJ1B 3NENA 1PTOF 2UUBQ 3R2IA 1QB5D 2B2YC 2FFKB 1H9MA 3PF5A 1B7YB 1FGUA 4ZK9B 5JVH3 1A6XA 1C8CA 5A35A 2HDMA 2OCEA 1I4QA 1QVFA 1X54A 1AEXA 4H0LC 4DR5Q 1BCPF 2XWBB 2R3ZA 5KIXA 3S1NH 5JVG3 4DV3L 3J7ZC 4B08A 2HCIA 1Q12A 1LABA 2JP1A 3DWPA 2SEBD 1YJNA 3UI2A 4G7OC 1VQBA 1BCPD 2UXBQ 1IL8A 3K6OA 1I3QB 1S5CD 3ERSX 3UDFA 4A3JB 2YTVA 5JEAH 4LAAA 1UUPA 2JXMB 4K8IA 1Z47A 1CI3M 3BVGA 4TKOB 3A5ZB 4HAEA 1GOZA 1EIHA 1GUGA 1TWCH 4XQJA 2QCPX 4JI4Q 4DUYL 1EOVA 3RMHA 1I4GA 2PI2E 5GAEC 2K32A 5IGDA 1DOLA 2O4XA 3E9HA 2WAQB 4H13C 3NELA 5KNCA 4BXXG 3S2HB 5FK9C 5CV7A 3O13A 1TKWB 2BE5D 2CH4A 4FP5D 2C5CA 1VQ6A 1FR3A 4OONA 5C6AA 4DAVA 4QIWB 5IODA 2IY5B 3EIVA 2KCCA 4F8MA 4YCVA 1PH5A 2YU9B 3BVZA 4B3MQ 2L11A 4JI5Q 3I8ZA 3HOYG 1EEID 1SE4A 2L4NA 3J80L 3U58A 1SNMA 5C5MA 1UE1A 1DXMA 1F9PA 3Q23A 1PH1A 5M5YH 5E4WC 4E6IA 5FKAC 2N55A 1XMOL 3JAME 2E2HB 3HOVG 3BS1A 3HZXA 1IL2A 1SYDA 5IGFA 4C3HH 1Q3LA 1VQ8A 3ZJYC 3SE0A 3GTMH 1ONLA 4ABNA 2EY1A 2F0EA 2I5MX 5FJ8H 4DV2Q 2DUDA 4P72A 1I4HA 4YIJA 2E2IH 5IWAL 1K83B 2F3IA 3H0GB 3H94A 2HQEA 4H02A 3VYRA 2HIVA 4KV6A 3CC4A 3U4ZA 3CC7A 3MZ5A 3AB9A 3C1FA 3I73A 4PQXA 4OELB 1WVLA 1Y8PB 4XDXA 1XTDA 4IUNA 4ID6A 3TP5A 2XSCA 1SRUA 1STEA 4IN3A 5L37A 1L0YB 1AZPA 1KLUD 3LX0A 1Y1VH 3PUVA 3E9IA 2ATWA 3PUXA 4DV6L 4DNTB 1JOQA 2R7ZH 4GLAC 1LUZA 3M4OH 1AN8A 3WWVA 4LNQA 1CQVA 1KAAA 1C4QA 1EWIA 1R9TH 1WOCA 3EBEA 2MQHA 4X3TA 4PNYA 5C3XA 1DZ1A 4DV6Q 3GTOH 1YIJA 1HA5A 3CMAA 2M9VA 2VY3A 2UUBL 4I7AA 4I65A 1RTNA 3FMCA 2EYMA 1P8LA 1G291 1Y1WH 4JI8Q 2AMCB 1AZQA 3I4LA 1EQVA 3S1MB 4DXGA 1HUMA 3KJOA 2DNCA 4KY5A 3STBC 3P1HA 1PH4A 5A2QL 3KDFA 1TWAH 2Z4HA 4EQPA 1V1PA 3GTLB 4IUUA 1GJXA 3RD4A 1VQIA 3W1BA 2VB2X 4DV2L 3K0YA 1MSHA 4K5XA 4A3GG 4RKBA 1SSOA 2KOLA 2XIWA 4JPBW 3SHLA 4U673 4C3IH 4F88A 3DHQA 4X66Q 1RKNA 2ZJRA 1SBBB 4DV0L 1B3QA 1SE8A 5I4DA 5DAUA 1F9QA 4A3BB 2XRSD 1BCPC 1SLJA 2A69C 3NTHA 3S1MH 3IRBA 1JCKB 2NVXB 1HNXQ 3GTQH 1Y8OB 3HOWB 4YWLA 1FGBD 1E2VA 3OW2A 4IPCA 1D7QA 4HCEA 4AIMA 5IT9c 1PZID 4DA2A 1KIXA 4DF7A 4F7XA 1RCVD 2KCNA 2HHHL 4LF7L 4KKUA 3PO2B 1HRJA 1VCIA 2GVBA 2KEEA 4RGMA 3T16A 1K73C 3NWTA 1WI5A 3M4PA 4B9XA 4R4TA 2DGYA 3VR6A 1BVSA 2QDLA 1KDBA 1UE6A 2K1BA 2E2DC 2Z1CA 4DR7L 2EY2A 2G5DA 1VQGA 1FJGL 1EZ6A 1PFMA 2XTIA 5LL6S 2F0KA 1EY7A 1U4RA 4OIKA 4WFN3 4FNFA 1PHJA 2AUJD 3D4RA 5CV4A 2RQXA 4LFBL 4JCVE 2J0TD 1HTPA 3H0GH 2JA5G 1K83H 4PV1C 5ELNA 4ME3A 1UE5A 1VQ7A 1FVIA 1F77A 3BYTB 3KYHC 1TWFH 3M7NA 2PMZE 4K6LA 4MTNA 3E3XA 3T4AC 2ZXRA 1YNNC 4DPGA 5M5WB 1G91A 4HIMA 1SYGA 1XYIA 1Q86C 1KXLA 2MFIA 1V1OA 5JJLA 3H3VC 1LTGD 4S3SA 1TWAB 5M5YB 1STGA 2B63B 1TWHH 1H9SA 3K5OA 1ZYRD 4GKKL 4R9WA 3GV3A 1FJGQ 4LMQD 2DN8A 3KF6A 2JA5B 1Y1WB 1PLFA 2B2TA 3GTJB 5BR8Q 1JE5A 1XMQQ 2O5IC 3RUZA 1KHIA 2KUMA 4RH6A 4X65Q 5M3FG 1II3A 4DR2Q 4Y52H 1WCMB 1LTLA 4GN3B 1G8ZD 2VL6A 1UAPA 4I7ZC 2R7ZB 2MPMA 2UXDQ 1D1IA 2K5NA 3DUZA 2RKSA 3I70A 1B4OA 1XNRL 3NPPA 3J81L 4A3EH 4P73A 1YNND 5IIFA 1LT6D 1JQYD 1A3TA 1HZCA 2O2LD 4L6TB 4R4QA 4OWXB 5BN5A 4AYBB 5EGTA 1WD1A 4BY7H 1GVPA 2K4KA 3I4MH 1KABA 4IQZA 1TS4A 2B39A 4YY3L 3EJIA 3K0XA 1QE6A 5C4JB 1SJHD 3OWEB 2F4IA 1RD9D 1K3RA 2AWOA 4DV0Q 1EIFA 3A74A 2DY8A 1CA6A 3EFXD 3OIPA 4GNXC 1V8QA 3PCOB 2K04A 3GO5A 1L1OC 2KHIA 3KUPA 3VYSA 4V190 1G6PA 3CQZH 2HDLA 1RTOA 4EX5A 1VQMA 2OWOA 1U4PA 2KQ3A 2UUAL 4IUTA 4DK0A 2K03A 3WOEA 3PIPA 1TVXA 2VS1A 3OWFA 1CT1D 2AKWB 5BR8L 2LY7A 1IXRA 2WAQE 4KTAA 2RSOA 5I6YA 4GLXA 4JI8L 3ULLA 2D5DA 1EYAA 4FF2A 1MKHA 1NMFA 3WOFA 4YWKA 2FHTA 4J8QA 4K8JA 1J8IA 4XT1B 1PH8A 2EIFA 3PO3G 2F3VA 2MP1A 1IBKQ 3DEOA 4XQQA 1QOHA 3VR5A 1KLGD 5I9PA 3TQYA 4K5WA 4QMGA 1WTRA 2KECA 4KD4A 3W2DA 2R7FA 4O1NA 5EBDA 3CCRA 2OXPA 1IYJB 1NY4A 2Q8RE 4C3JH 2JA8G 3RLFA 2LS01 5T1GA 4JK1C 3LWEA 4F87A 4R8IA 4Z9CB 1UEAB 4A3FH 1X3FA 2SNSA 1W6KA 3A7AB 2EY5A 2XN9C 4ALPA 4AYBG 1PH9A 3L7ZC 2IL8A 3Q8DA 2E2JB 1STHA 2EYOA 3K59A 2I46A 4X6AH 1DGSA 1RJTA 4DK3C 3J7A5 5CV6A 2AQ3B 3J7AV 4IPGA 1BBWA 2EDGA 2YTYA 3K5MA 4HMJA 3SK6A 1CFMA 2NVQH 3HKSA 3KLSA 4DAPA 1QCBD 4IOAA 4BBSB 2WFWA 2F0SA 5J3BA 1ET9A 5M5WH 5M3FB 1HHVA 2RA4A 3VDYA 5C0XG 1S5FD 3CC2A 4K6DA 5HY6A 3FPUB 1TWFB 1BUVT 3BDOA 1VQDA 3G4SA 2VQEQ 4ZRZA 3TSSA 2Q2TA 4A3EG 5BN4A 1WCMG 1HNXL 3L9AX 3MXNB 2NVYH 1UWVA 3AEVA 2PYKA 3D0FA 4BBSG 3G48A 1I4RA 1IW7D 3W3AA 2QGQA 2EZVA 2ASBA 3TDQA 2K05A 1AE2A 1XPUA 2A68C 3BDLA 1ENCA 3VA7A 3DMUA 4JVZA 1H9SB 2A19A 3SEBA 3CCSA 4JI7Q 2EYHA 3TP6A 1O7IA 4X62Q 1Z9FA 4WORA 2EJGC 5TSSA 5LHY1 1SMYD 2CHBD 4N9TA 5G3LF 1K9MC 5IGGA 2NBFA 5AJ3L 1KNEA 3UDIA 2B2WA 3F2UA 1HZ9A 1PTOB 2F0IA 5IGEA 1PRTD 1O78A 3ER0A 4ZKCB 1AE3A 3FKIG 3HOZH 1EY9A 1RL2A 2MJ8A 1EL0A 5EPKA 2NZ1D 4IO9A 1L1OA 3EA6A 4QY7A 1PFBA 1EWHA 1BCPB 1NNXA 3CQZB 3MC0B 3CCMA 2BDNA 2JA8B 4GOPB 4KMUC 1OXXK 2LKVA 3SGIA 3HKZG 4MTKA 2DJGC 1OO9B 1SROA 2LSSA 3EN2A 2PNRC 3UE1A 1HFGA 1EOTA 4PZ7A 2K33A 1D5XC 3PUWA 3HOWG 5C4XG 4N9PA 3NXWA 3PQIA 1D2BA 2XVSA 3F8TA 2HIXA 3ITPA 1ZEQX 1ZKOA 2JA6G 4P2CB 4RFBA 4ZUJA 5JPNC 4YHHQ 4FXDA 1WD0A 4CHTB 2EYPA 2SDFA 2OEOA 4DFAA 1V43A 1PFNA 2PZWA 4A3IH 4NB3A 3C1EA 5EBCA 5EJWA 2F0VA 3CPWA 3K7AH 1FL0A 2KA7A 1XX8A 1HQMC 1QZGA 1I50H 4ZAIA 1F2MA 2NN6G 5M3MB 1IZ6A 4KHPQ 1C48A 4EQ5A 4KJOA 2RDFA 3I91A 2TMPA 4HIOA 4N8X1 1WTVA 3M4OB 3OTOL 4DV7L 5FLXE 4LF4Q 2UUCQ 1EY5A 4Q0FA 5C44H 1NSNS 5DM63 3K7AB 2RF4A 1TS3A 1TWGH 4C1NI 1VQJA 4BY1G 1PRTB 3CP0A 3PGZA 4LFCQ 4CDFC 1S5DD 2I0QA 2Q2UA 2JA7H 4NDXA 1I94Q 2A6ED 2MUYA 2JEAI 2FINB 3S14H 4JI5L 2F3WA 1YZ6A 1HZBA 1JORA 4RHSA 3HKZB 2B63H 1K0SA 4OHJA 4LWCA 4XTCS 2BDOA 2K7VA 3JC66 4DUZL 1ENFA 4GOPA 1NAPA 1PV4A 1MBYA 5F2DA 1A62A 3ULPA 3OYYA 3BZCA 3QWNA 2R92H 4B3RQ 1U4LA 2KBNA 1QZHA 3MHBA 2OQ0A 1YNXA 4DR1L 2QW7A 1S40A 4DAYB 2B2TC 2Y0SB 4KY7A 3R93A 1X32A 1EEFD 4DR2L 3RZDB 4ZUIA 2B2YA 5IYDG 1SYEA 2LXJA 2PMZB 4G4KA 1X65A 4X65L 4LW1A 2IWHA 3BZKA 3GDEA 3TEHB 2D2CC 5IP7G 2BH2A 3G7LA 1LTBD 1VQPA 4JI3L 1B44D 5FOBB 2RCNA 1BF4A 4A75A 1QILA 5GROA 3M4YA 3A55A 1JWMD 2N8NA 1YNJD 4ILWA 2ZTDA 2YU9H 3HG9A 1VQOA 2DJFC 2F0PA 3CHBD 4KHVA 3U9OA 1C7YA 1Z7TA 1S5ED 1E3PA 2B63G 4CKEA 3RLNA 1BNZA 2LXKA 3PV0A 3P7JA 3J81c 4KHPL 4EVOA 2IX1A 1IW7C 4DNIA 5IY0A 5C3WA 3T1HL 1HA6A 1W3SA 2E5LQ 4P74A 4DV3Q 4OIJA 3SDZA 3V96A 2Z4IA 2ZJPA 1FNVA 1XWEA 3I4NG 3E0EA 1SXTA 3NHHA 4LFBQ 1WFQA 3GTQB 1ESFA 3JAMc 2NVXH 2CVRA 2PZUA 2WIIB 1V9PA 1LTTD 2ZM6Q 1QJOA 1PYSB 1WTQA 3DWAA 4JI2Q 1X3QA 4JBWA 2NVYB 4RGNA 1KDAA 4KKTA 3MA2B 5M5XB 3HOUB 3Q6SA 3H6MA 2F0WA 1GUTA 5ELEA 3DWQA 3HP3A 1A0IA 1I3QH 5JJKA 1CTMA 2YYZA 1X9NA 2RBMA 2K50A 2FJ2A 1BBUA 4JI0L 1CUKA 5ELFA 4DV4Q 1D6EC 4M1UB 5C4ZA 4DR1Q 1VQCA 3B6YA 2VZAA 4V0BA 5GQOA 4JI1Q 4Q5VA 4IFDH 1A15A 4UDUC 2Z9HA 1VQAA 1LTAD 3H3VI 1TIID 5C0XH 4IJLA 1VQNA 1WTOA 4NP5A 5DEHA 4DV1Q 4NKLA 2ALYB 4DUZQ 1NR2A 2J7ZA 1SE2A 3PIOA 1HNZQ 2L5TA 1RHPA 4LFAQ 5JEAG 4IUQA 3TS2A 5C4XH 4CJ2C 3T13A 4MZ9A 3NBHA 5FLXc 4JOIA 4X62L 5D14A 3GTKH 1N32Q 1IYUA 1H9KA 3F2DA 3A8IE 3PO3B 4NMZA 1R4QB 4A3IG 4JI7L 4C3JB 1B2TA 4A3FG 1JOOA 5E1FA 1LT5D 4K0KL 3SXHA 1G51A 4J15A 2EYJA 1DJRD 3S1QB 4H7BA 2PPBC 4AH6A 1HR0W 2IJ0A 3ND8A 3T56B 4L5RC 3HOXH 1CHPD 4LF5Q 3FEWX 2N78A 2QA4A 4DK1A 3V2TA 2B2VC 1SN8A 5CBAE 5KNDA 2L55A 2H4OA 4X64Q 4A93H 5E7NA 4A3DG 1S4ZA 2VQEL 2I07B 4YHHL 5HURA 3RN5A 4QB4A 4EQNA 4IZ8A 1L0WA 1YNJC 2OT2A 3D4WA 4A3KG 4KHZA 4XYOA 1XPOA 1I4XA 1IKMA 1TY0A 2RHQB 1J5EL 4WJWA 3PIO3 2VW9A 2MNAA 3I90A 1BOSA 1SMXA 1JT8A 3QJYA 4C3HB 2OTJA 4QUFA 2K5QA 3CAMA 1LO5D 1ICWA 1VS0A 4Y7NH 3S14B 5IYBH 5LMNW 1S3OA 1I6HH 4DR4L 2NZHA 2JA7B 2VB3X 3BJUA 1AP0A 3K8AA 1D1KA 2CFMA 4RGTA 4DR4Q 3J80E 3W1GA 2F4VL 3OMGA 4JI6Q 3CCUA 4BY7B 2PW5A 1NBWA 5A2QE 3A0JA 4YWMA 4HIKA 3J81i 1KD1C 2R93B 3OHXC 1E1OA 4IJHA 4C2MB 1VQ9A 4BWGB 3N6RA 3MXGA 1PDQA 1ZXTA 4RMFA 2JEBI 3TZUA 5KRUA 3GTGH 4A3LG 4A3IB 1XMOQ 5FO9B 1PFSA 2F0LA 4JV5Q 3M4QA 1SFOH 3K81C 2TSSA 4X64L 5C4HA 2RHSB 4DU9A 3UDXA 3GTJH 3NQIA 4HSPA 2IX0A 3QG1A 1JWUD 2JE6I 2A73B 5IYBG 2MO0A 1YEZA 1I5FA 1SYBA 5D3DA 4A3JH 1LT4D 3EVQA 1A63A 2UU9Q 1J6QA 3FRPB 5JPMC 3G6JB 2BCOA 3SK4A 4AYBE 1SNCA 3F2BA 4H44C 2E8GA 3HEJA 2RSNA 3MXNA 4BXXH 3ONAB 4A3CH 4C3JG 2JA8H 2D0PA 2JA6B 3S1NB 1I4PA 5BN3A 1U9RA 2DNEA 1NR4A 1EY4A 2RVLA 4A3KH 2WAQG 4L8JA 1N32L 4IPHA 4A3GH 1K28A 1MGSA 3R2TA 1QWYA 3AYHB 4ZKBB 1JWSD 1S72A 4HEDA 3MXUA 3OW7A 5IP9G 1LLRD 3HOZB 4TRDA 1EYGA 4JI4L 2A5HA 3Q0AA 3HOYB 4GN4B 4ZLTF 4UHVA 1J9OA 1D8LA 5DM73 1PZJD 1HNZL 3D6CA 2CWPA 3BG3A 2K5DA 3AQQA 1XNRQ 4DV1L 1MSGA 2B8GA 3ND9A 3S1RB 4QUCA 3S16H 4L5QA 3PO2G 4A3JG 2ICEC 2XGTA 3ERQA 1STNA 3S1QH 4B3TL 4HJAA 5D65A 2XNAC 1QNKA 3GTPB 1PZKD 1PRTC 5KNBA 5C0XI 3J80i 2D62A 4DV4L 2EQSA 3SR1A 2Q2HA 3F1ZA 3QOJA 4KI0A 3GTPH 1Q7YC 4FYDA 1SMYC 2ZTCA 4KD3A
chains in the Genus database with same CATH topology
1VQ6A 1VQEA 3STBD 2H5XA 3HOXG 3W5OA 4OONA 1B8AA 1XNQL 2IY5B 3FP9A 2WB1E 1K9MC 2IT1A 1NE3A 3EIVA 1VQ5A 5AJ3L 3UDIA 2QEXA 4YCVA 4BBRH 3KF6B 3L0OA 1PH5A 1HZ9A 1UE7A 4GLVB 4B3MQ 2R6GA 4KHPQ 4P71A 4GKKQ 3ER0A 1IBLL 1AE3A 4JI5Q 3HOYG 1YHAA 3FKIG 4RG1A 1RL2A 4NXNL 3HOZH 2EXDA 4R4IA 4JI3Q 1XNQQ 3U58A 1YVCA 2A1AA 1UE1A 4IO9A 1L1OA 5C3EH 1PH1A 2BH8A 5M5YH 3H15A 1EIYB 3I4MG 4QY7A 3K7UC 3JAMi 5M3FH 1XMOL 3HOVG 1UEBA 3I7FA 1IL2A 1MJCA 3CCMA 1GM5A 4C3HH 1VQ8A 3GTMH 3ZJYC 1C0AA 4GOPB 5DLQE 4UP8A 1OXXK 3SGIA 1CKNB 4AQYQ 3HKZG 4WJ3M 2I5MX 5FJ8H 4LUOA 1SROA 3PUZA 2HHHQ 4DV2Q 1N8RC 2LSSA 1CKMA 3EN2A 2DUDA 3UE1A 4P72A 4B3RL 1PA6A 4PZ7A 2E2IH 4LF8L 3S24A 5IWAL 2KCTA 3PUWA 3HOWG 2F3IA 1VQFA 5C4XG 4H02A 1A8VA 2HIVA 3CC4A 3F8TA 3U4ZA 2HIXA 3CC7A 5HGQA 5LMUL 2JA6G 4GOPC 4OO1G 1KAWA 4PZ6A 2CWAA 1KQSA 3RN2A 1X3GA 4YHHQ 1K8AC 2HQLA 5H1SE 4OX9L 4A3DH 4A93G 1KRSA 1V43A 1CSQA 1XTDA 4UPAA 4A3IH 2KENA 4NB3A 3UDGA 2B29A 1SRUA 4DAMA 2PNHA 4DR6Q 1YJWA 2AWNA 4LF4L 3CPWA 4DV7Q 3OTOQ 3K7AH 4C2MH 1FL0A 1QUQA 1Y1VH 3PUVA 1Q1BA 3E9IA 3PUXA 4DV6L 2IHEA 2ATWA 2HT1A 2R7ZH 4GLAC 1LUZA 3M4OH 1YBYA 1QZGA 1I50H 2NN6G 4UP7A 3WWVA 4LNQA 5LMNQ 1IZ6A 2N49A 4QL5A 1EWIA 5EAYA 1WOCA 1OXSC 3EBEA 4APVA 4EQ5A 1R9TH 2AHOB 1KC8C 2MQHA 3U50C 3NBHB 5M3MG 4HIOA 4AQYL 4DV6Q 3GTOH 2N3SA 1YIJA 3CXCA 3OTOL 4DV7L 2F52A 3CMAA 1KRTA 1P16A 4LF4Q 1KL9A 2UUCQ 2VY3A 5C44H 2UUBL 4DR6L 2Y0SG 1PVOA 3PF4A 2JQOA 2RF4A 1HR0Q 1NTGA 3D31A 1TWGH 3I4NH 3RZOH 5JEAJ 1VQJA 1G291 1P8LA 4BY1G 1Y1WH 3H0GG 3CP0A 3PGZA 4LFCQ 4JI8Q 2AMCB 2I0QA 2Q2UA 4B3SQ 2JA7H 1I94Q 2JEAI 3TRZA 4TVAB 3S14H 4JI5L 2JK8A 1YI2A 1YZ6A 4HJ8A 3KJOA 1T9HA 1HZBA 1VQLA 2B63H 1EFWA 2BA1A 4LWCA 2Z0SA 3STBC 1VQKA 1PH4A 4WJ4A 5IYDH 4XTCS 3JC66 2UUCL 3KDFA 1TWAH 1IBML 4DUZL 4GOPA 3KDFB 1PV4A 3I2ZA 4X66L 1A62A 1H95A 3T1YL 1VQIA 3CW2C 3ULPA 3OYYA 3W1BA 4GNXB 3BZCA 4B3RQ 2R92H 4DV2L 2IHFA 2R92G 3CMEA 3S15H 4A3GG 1W2BA 4IOCA 1HH2P 2FXQA 2KBNA 1QZHA 3KFUA 2ID0A 2OQ0A 1YNXA 4DR1L 1S40A 4C3IH 3RNUA 4DAYB 2YTXA 4X66Q 4DR2L 5IYDG 2LXJA 2ZJRA 1N9WA 4DV0L 4R4CA 2WB1G 1SE8A 4POGA 1X65A 2D0OA 4X65L 4NXMQ 4LW1A 3AFPA 4JI6L 3BZKA 2F4VQ 1K0RA 1AH9A 4PG3A 3GDEA 3TEHB 4GKJL 5IP7G 2BH2A 3HOUH 4DR3Q 1SLJA 1VQPA 1BKBA 4R4OA 4JI3L 1JB7A 1QUQB 2NVTH 3S1MH 1Y1WG 2RCNA 3J80c 3HFZB 3IRBA 4BY1H 4A75A 3PSIA 2VUMG 4A3MG 5GROA 1HR0L 4A3MH 4LF6Q 2UUAQ 4JBMA 1N33L 1N34Q 1HNXQ 3GTQH 2N8NA 4YWLA 5AJ3Q 3F2CA 2ZTDA 3TS0A 3OW2A 2YU9H 1VQOA 1E24A 1U0LA 4IPCA 1C7YA 1D7QA 4AIMA 5IT9c 1E3PA 4O0AA 4TQUS 2B63G 3RLNA 1VQHA 2LXKA 1KIXA 3PV0A 3J81c 4DR7Q 2YV5A 4LF7L 3NEMA 4R1JA 2HHHL 4L5SA 5LMNL 2IX1A 4KHPL 4K0KQ 1YHBA 4DNIA 1WCMH 2B3GA 2KHJA 4JG2A 1VCIA 5IY0A 4IFDG 2GVBA 1TXYA 3T1HL 1J5EQ 1K73C 3HOUG 1C9OA 3PO3H 1W3SA 2E5LQ 4P74A 1X6OA 1GD7A 1WI5A 3M4PA 4DV3Q 3ICEA 5GADC 4R4TA 2DGYA 1BVSA 4A76A 4DV5L 2ZJPA 1UE6A 2PQAA 4B3TQ 5IYCH 4DR7L 3K80C 4JC0A 1MIUA 2PQAB 3E0EA 3I4NG 2C35B 2JA5H 2Y0SE 4LFBQ 1WFQA 2MO1A 3JAMc 2Z6KA 2NVXH 3G71A 4YY3Q 1B70B 3M3YH 1V9PA 1VQGA 2ZM6Q 1PH3A 1PH7A 3S1RH 1PYSB 2JJQA 1FJGL 2L15A 4JI2Q 2XTIA 5C0XJ 4LF5L 5JJIA 4JBWA 1VQ4A 1PHJA 1Q1EA 2VNUD 1K8GA 4LFBL 5IYCG 4JCVE 1A0IA 1I3QH 3H0GH 4KLKA 2JA5G 5JJKA 1K83H 5ELNA 4ME3A 5GAHC 1PYBA 1UE5A 2Z6KC 1VQ7A 1FVIA 1Y14B 2YYZA 3LGJA 3RZDH 2WP8J 1X9NA 2K50A 4JI1L 3KYHC 1BBUA 1TWFH 1CUKA 2PMZE 4JI0L 3M7NA 1GKHA 1Y1VG 4MTNA 4DV4Q 1E7ZA 3AFQA 3CCEA 3I4OA 1VQCA 1CSPA 4DPGA 4DR1Q 4HJ7A 3B6YA 2VZAA 1QVCA 5GQOA 4JI1Q 4HIMA 1Q82C 1Q86C 4JBKA 3L2PA 1KXLA 1VQAA 3KLWA 2MFIA 1PH2A 1HJPA 3H3VI 2JA9A 5JJLA 1XMQL 4IJLA 1PH6A 4DK6C 1VQNA 3PUYA 1L1OB 4P75A 5M5XH 4DUYQ 3DLLA 2UU9L 2I5HA 3J81j 4DV1Q 4A3BG 2ALYB 4DUZQ 1WYDA 4NXNQ 1TWHH 4LUZA 3PIOA 1X56A 3A5UA 5FJ8G 1YHQA 1ASYA 1N33Q 4YCWA 1E1TA 1HNZQ 4B3ML 4GKKL 1FJGQ 3TREA 4LFAQ 5JEAG 1U5KA 4XIGS 5FLMG 1Q81C 3KF6A 3TS2A 5C4XH 2VQFQ 4OWTB 4MZ9A 2GN5A 5FLXc 5BR8Q 1JE5A 1XMQQ 1KHIA 4JV5L 3UE0A 4JOIA 1X3EA 2CCZA 1OXUA 4X65Q 4X62L 4NXML 3GTKH 1N32Q 1CKNA 5M3FG 3F2DA 3FHWA 4QQBX 4DR2Q 4A3IG 4JI7L 4Y52H 2E5LL 1LTLA 4GN3B 4UY8C 3PO2H 3S2HH 2VL6A 4A3FG 2R7DA 5M3MH 4IFDI 3FKIH 3CPFA 4BBRG 3HOZG 4K0KL 2UXDQ 1G51A 4J15A 2K14A 2K5HA 2ES2A 1IBKL 2K5NA 2UXCL 1MJEA 3T1YQ 3HOWH 2JA7G 3S2DH 1XNRL 4A3EH 1IBMQ 4P73A 4AH6A 1NMGA 1HR0W 3HOVH 1HZCA 4OWXB 4R4QA 3HOXH 4L5TA 4L5RC 4LF5Q 5IE8A 4JI2L 4OWWB 2N78A 1RIPA 3HKZE 2QA4A 4BA2I 4BY7H 1GVPA 2ZTEA 2K4KA 5C3EG 3I4MH 2GVAA 2ZM6L 1SN8A 3M85A 4YY3L 4A3BH 3K0XA 4OX9Q 4X64Q 2CKZB 4A93H 5E7NA 4A3DG 2VQEL 4GKJQ 4YHHL 2UXBL 3RN5A 3HOYH 3GD7A 1L0WA 3M9BA 1K3RA 1GO3E 2AWOA 4DV0Q 4A3KG 1EIFA 3A74A 4KHZA 1M1KC 3KOJA 1XPOA 1XPRA 4OXPA 5K36G 2RHQB 3T1HQ 5IWAQ 2I5LX 1J5EL 4GNXC 2V1CC 4PZ8A 2BA0A 4FDBA 2VW9A 1N36Q 4BBSH 2JA6H 2MNAA 3PCOB 3GO5A 1SMXA 1L1OC 1SR3A 2KHIA 3GTLH 2R93G 3MEFA 1JT8A 3CCQA 4A3LH 4IFDJ 1G6PA 4A4IA 3CQZH 2OTJA 4BA1I 4QJFA 3CAMA 4EX5A 5IP7H 1VQMA 1VS0A 4Y7NH 4UP9A 4QGUA 2UUAL 2OWOA 5IYBH 2PI2A 3PIPA 1NJIC 4JYAL 2VS1A 5LMNW 1S3OA 1I6HH 1EQRA 4GN5A 1LM0A 2NZHA 2AKWB 5BR8L 2E2JH 4DR4L 2ZJQA 3S17H 3KJPA 1IXRA 2WAQE 1I94L 3BJUA 1JJGA 4DKAC 2VQFL 1EUJA 4B3SL 4GLXA 2A8VA 4JI8L 2CQOA 3K8AA 4JOIC 2CFMA 1WJJA 4LFCL 3ULLA 4DR4Q 4LFAL 1LYLA 3W1GA 4HIDA 2F4VL 4JYAQ 1MKHA 4O2DA 2KCMA 4POFA 4JI6Q 1JJ2A 1NMFA 4BY7G 5LMUQ 3DM3A 4MNOA 4YWKA 3CCUA 4YCUA 1PH8A 1NBWA 3CCLA 3A0JA 4YWMA 4HIKA 2EIFA 4HJ5A 3J81i 1KD1C 1OXTA 3PO3G 2Q2IA 4LF8Q 1IBKQ 1Q8KA 3G6EA 1M90C 1E1OA 1Q46A 2K75A 4IJHA 3CD6A 3TQYA 1VQ9A 2R7FA 3CCRA 1L2FA 1IYJB 4RMFA 1NY4A 2JEBI 3GTGH 4A3LG 4C3JH 2JA8G 1XMOQ 3RLFA 3I56A 2NZOA 1PFSA 4JV5Q 3M4QA 1SFOH 4GNXA 3K81C 1YITA 1X55A 1JJCB 3CCVA 4A3FH 5C44G 1X3FA 1JMCA 4X64L 1EQQA 2RHSB 3UDXA 4QIWE 3GTJH 4A3CG 3BU2A 4GS3A 2IX0A 1YJ9A 4ALPA 1V1QA 2JE6I 5ELOA 4AYBG 3L7ZC 1PH9A 3NENA 5IYBG 2K5VA 2MO0A 3Q8DA 2VUMH 1YEZA 4OO1I 1I5FA 4A3JH 1E22A 3KF8B 2UUBQ 3PF5A 1A63A 1B7YB 1FGUA 1DGSA 4X6AH 4DK3C 2UU9Q 3J7A5 4IPGA 1BBWA 2OTLA 1J6QA 2OCEA 2YTYA 5IP9H 1QVGA 1QVFA 1X54A 3RR5A 4AYBE 2NVQH 4DR5Q 2UXDL 4LUVA 3F2BA 1HZAA 2E8GA 1N36L 4BXXH 4DV5Q 3HKSA 4A3CH 2JA8H 3S1NH 3I55A 2D0PA 4DV3L 4IOAA 2WFWA 3J7ZC 2E2HH 5J3BA 5M5WH 3VDYA 5C0XG 4A3KH 4JI0Q 1ASZA 1Q12A 3CC2A 2WAQG 1N32L 4IPHA 4A3GH 4DR5L 1YJNA 5HY6A 3AYHB 1XJVA 1HNWQ 1VQBA 1S72A 2R7ZG 1CKOA 1VQDA 3G4SA 2VQEQ 5IP9G 4LF9L 2UXBQ 2Q2TA 1EYGA 4JI4L 3UDFA 3ERSX 4A3EG 2YTVA 4GN4B 1OXVA 5FLMH 5C4JH 2OQKA 1WCMG 4NPSA 1N34L 1HNXL 1IBLQ 1D8LA 1Z47A 4LF6L 3H3VH 3A5ZB 1HNZL 4LF7Q 3MXNB 2K52A 2NVYH 3U4VA 1UWVA 2CWPA 3AEVA 1TWCH 3D0FA 4BBSG 4IPDA 3CF5A 3AQQA 1XNRQ 4DV1L 4JI4Q 4JBJA 3G48A 4DUYL 1EOVA 2QGQA 4DR3L 4L5QA 3S16H 3CCJA 4LF9Q 4A3JG 3PO2G 2UXCQ 2ASBA 2XGTA 1HNWL 3S1QH 4B3TL 1AE2A 5GAGC 4HJAA 1XPUA 2PI2E 5GAEC 2NN6I 3E9HA 2A19A 5C0XI 3RLOA 3J80i 2D62A 4PMWA 3CCSA 2EQSA 3NELA 4DV4L 2Q2HA 3F1ZA 4KI0A 3ULJA 4JI7Q 4BXXG 3GTPH 1Q7YC 1OTCA 1O7IA 2ZTCA 4X62Q 1Z9FA 2R93H 4HJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 A;  1VQE A;  3STB D;  2H5X A;  3HOX G;  3W5O A;  4OON A;  1B8A A;  1XNQ L;  2IY5 B;  3FP9 A;  2WB1 E;  1K9M C;  2IT1 A;  1NE3 A;  3EIV A;  1VQ5 A;  5AJ3 L;  3UDI A;  2QEX A;  4YCV A;  4BBR H;  3KF6 B;  3L0O A;  1PH5 A;  1HZ9 A;  1UE7 A;  4GLV B;  4B3M Q;  2R6G A;  4KHP Q;  4P71 A;  4GKK Q;  3ER0 A;  1IBL L;  1AE3 A;  4JI5 Q;  3HOY G;  1YHA A;  3FKI G;  4RG1 A;  1RL2 A;  4NXN L;  3HOZ H;  2EXD A;  4R4I A;  4JI3 Q;  1XNQ Q;  3U58 A;  1YVC A;  2A1A A;  1UE1 A;  4IO9 A;  1L1O A;  5C3E H;  1PH1 A;  2BH8 A;  5M5Y H;  3H15 A;  1EIY B;  3I4M G;  4QY7 A;  3K7U C;  3JAM i;  5M3F H;  1XMO L;  3HOV G;  1UEB A;  3I7F A;  1IL2 A;  1MJC A;  3CCM A;  1GM5 A;  4C3H H;  1VQ8 A;  3GTM H;  3ZJY C;  1C0A A;  4GOP B;  5DLQ E;  4UP8 A;  1OXX K;  3SGI A;  1CKN B;  4AQY Q;  3HKZ G;  4WJ3 M;  2I5M X;  5FJ8 H;  4LUO A;  1SRO A;  3PUZ A;  2HHH Q;  4DV2 Q;  1N8R C;  2LSS A;  1CKM A;  3EN2 A;  2DUD A;  3UE1 A;  4P72 A;  4B3R L;  1PA6 A;  4PZ7 A;  2E2I H;  4LF8 L;  3S24 A;  5IWA L;  2KCT A;  3PUW A;  3HOW G;  2F3I A;  1VQF A;  5C4X G;  4H02 A;  1A8V A;  2HIV A;  3CC4 A;  3F8T A;  3U4Z A;  2HIX A;  3CC7 A;  5HGQ A;  5LMU L;  2JA6 G;  4GOP C;  4OO1 G;  1KAW A;  4PZ6 A;  2CWA A;  1KQS A;  3RN2 A;  1X3G A;  4YHH Q;  1K8A C;  2HQL A;  5H1S E;  4OX9 L;  4A3D H;  4A93 G;  1KRS A;  1V43 A;  1CSQ A;  1XTD A;  4UPA A;  4A3I H;  2KEN A;  4NB3 A;  3UDG A;  2B29 A;  1SRU A;  4DAM A;  2PNH A;  4DR6 Q;  1YJW A;  2AWN A;  4LF4 L;  3CPW A;  4DV7 Q;  3OTO Q;  3K7A H;  4C2M H;  1FL0 A;  1QUQ A;  1Y1V H;  3PUV A;  1Q1B A;  3E9I A;  3PUX A;  4DV6 L;  2IHE A;  2ATW A;  2HT1 A;  2R7Z H;  4GLA C;  1LUZ A;  3M4O H;  1YBY A;  1QZG A;  1I50 H;  2NN6 G;  4UP7 A;  3WWV A;  4LNQ A;  5LMN Q;  1IZ6 A;  2N49 A;  4QL5 A;  1EWI A;  5EAY A;  1WOC A;  1OXS C;  3EBE A;  4APV A;  4EQ5 A;  1R9T H;  2AHO B;  1KC8 C;  2MQH A;  3U50 C;  3NBH B;  5M3M G;  4HIO A;  4AQY L;  4DV6 Q;  3GTO H;  2N3S A;  1YIJ A;  3CXC A;  3OTO L;  4DV7 L;  2F52 A;  3CMA A;  1KRT A;  1P16 A;  4LF4 Q;  1KL9 A;  2UUC Q;  2VY3 A;  5C44 H;  2UUB L;  4DR6 L;  2Y0S G;  1PVO A;  3PF4 A;  2JQO A;  2RF4 A;  1HR0 Q;  1NTG A;  3D31 A;  1TWG H;  3I4N H;  3RZO H;  5JEA J;  1VQJ A;  1G29 1;  1P8L A;  4BY1 G;  1Y1W H;  3H0G G;  3CP0 A;  3PGZ A;  4LFC Q;  4JI8 Q;  2AMC B;  2I0Q A;  2Q2U A;  4B3S Q;  2JA7 H;  1I94 Q;  2JEA I;  3TRZ A;  4TVA B;  3S14 H;  4JI5 L;  2JK8 A;  1YI2 A;  1YZ6 A;  4HJ8 A;  3KJO A;  1T9H A;  1HZB A;  1VQL A;  2B63 H;  1EFW A;  2BA1 A;  4LWC A;  2Z0S A;  3STB C;  1VQK A;  1PH4 A;  4WJ4 A;  5IYD H;  4XTC S;  3JC6 6;  2UUC L;  3KDF A;  1TWA H;  1IBM L;  4DUZ L;  4GOP A;  3KDF B;  1PV4 A;  3I2Z A;  4X66 L;  1A62 A;  1H95 A;  3T1Y L;  1VQI A;  3CW2 C;  3ULP A;  3OYY A;  3W1B A;  4GNX B;  3BZC A;  4B3R Q;  2R92 H;  4DV2 L;  2IHF A;  2R92 G;  3CME A;  3S15 H;  4A3G G;  1W2B A;  4IOC A;  1HH2 P;  2FXQ A;  2KBN A;  1QZH A;  3KFU A;  2ID0 A;  2OQ0 A;  1YNX A;  4DR1 L;  1S40 A;  4C3I H;  3RNU A;  4DAY B;  2YTX A;  4X66 Q;  4DR2 L;  5IYD G;  2LXJ A;  2ZJR A;  1N9W A;  4DV0 L;  4R4C A;  2WB1 G;  1SE8 A;  4POG A;  1X65 A;  2D0O A;  4X65 L;  4NXM Q;  4LW1 A;  3AFP A;  4JI6 L;  3BZK A;  2F4V Q;  1K0R A;  1AH9 A;  4PG3 A;  3GDE A;  3TEH B;  4GKJ L;  5IP7 G;  2BH2 A;  3HOU H;  4DR3 Q;  1SLJ A;  1VQP A;  1BKB A;  4R4O A;  4JI3 L;  1JB7 A;  1QUQ B;  2NVT H;  3S1M H;  1Y1W G;  2RCN A;  3J80 c;  3HFZ B;  3IRB A;  4BY1 H;  4A75 A;  3PSI A;  2VUM G;  4A3M G;  5GRO A;  1HR0 L;  4A3M H;  4LF6 Q;  2UUA Q;  4JBM A;  1N33 L;  1N34 Q;  1HNX Q;  3GTQ H;  2N8N A;  4YWL A;  5AJ3 Q;  3F2C A;  2ZTD A;  3TS0 A;  3OW2 A;  2YU9 H;  1VQO A;  1E24 A;  1U0L A;  4IPC A;  1C7Y A;  1D7Q A;  4AIM A;  5IT9 c;  1E3P A;  4O0A A;  4TQU S;  2B63 G;  3RLN A;  1VQH A;  2LXK A;  1KIX A;  3PV0 A;  3J81 c;  4DR7 Q;  2YV5 A;  4LF7 L;  3NEM A;  4R1J A;  2HHH L;  4L5S A;  5LMN L;  2IX1 A;  4KHP L;  4K0K Q;  1YHB A;  4DNI A;  1WCM H;  2B3G A;  2KHJ A;  4JG2 A;  1VCI A;  5IY0 A;  4IFD G;  2GVB A;  1TXY A;  3T1H L;  1J5E Q;  1K73 C;  3HOU G;  1C9O A;  3PO3 H;  1W3S A;  2E5L Q;  4P74 A;  1X6O A;  1GD7 A;  1WI5 A;  3M4P A;  4DV3 Q;  3ICE A;  5GAD C;  4R4T A;  2DGY A;  1BVS A;  4A76 A;  4DV5 L;  2ZJP A;  1UE6 A;  2PQA A;  4B3T Q;  5IYC H;  4DR7 L;  3K80 C;  4JC0 A;  1MIU A;  2PQA B;  3E0E A;  3I4N G;  2C35 B;  2JA5 H;  2Y0S E;  4LFB Q;  1WFQ A;  2MO1 A;  3JAM c;  2Z6K A;  2NVX H;  3G71 A;  4YY3 Q;  1B70 B;  3M3Y H;  1V9P A;  1VQG A;  2ZM6 Q;  1PH3 A;  1PH7 A;  3S1R H;  1PYS B;  2JJQ A;  1FJG L;  2L15 A;  4JI2 Q;  2XTI A;  5C0X J;  4LF5 L;  5JJI A;  4JBW A;  1VQ4 A;  1PHJ A;  1Q1E A;  2VNU D;  1K8G A;  4LFB L;  5IYC G;  4JCV E;  1A0I A;  1I3Q H;  3H0G H;  4KLK A;  2JA5 G;  5JJK A;  1K83 H;  5ELN A;  4ME3 A;  5GAH C;  1PYB A;  1UE5 A;  2Z6K C;  1VQ7 A;  1FVI A;  1Y14 B;  2YYZ A;  3LGJ A;  3RZD H;  2WP8 J;  1X9N A;  2K50 A;  4JI1 L;  3KYH C;  1BBU A;  1TWF H;  1CUK A;  2PMZ E;  4JI0 L;  3M7N A;  1GKH A;  1Y1V G;  4MTN A;  4DV4 Q;  1E7Z A;  3AFQ A;  3CCE A;  3I4O A;  1VQC A;  1CSP A;  4DPG A;  4DR1 Q;  4HJ7 A;  3B6Y A;  2VZA A;  1QVC A;  5GQO A;  4JI1 Q;  4HIM A;  1Q82 C;  1Q86 C;  4JBK A;  3L2P A;  1KXL A;  1VQA A;  3KLW A;  2MFI A;  1PH2 A;  1HJP A;  3H3V I;  2JA9 A;  5JJL A;  1XMQ L;  4IJL A;  1PH6 A;  4DK6 C;  1VQN A;  3PUY A;  1L1O B;  4P75 A;  5M5X H;  4DUY Q;  3DLL A;  2UU9 L;  2I5H A;  3J81 j;  4DV1 Q;  4A3B G;  2ALY B;  4DUZ Q;  1WYD A;  4NXN Q;  1TWH H;  4LUZ A;  3PIO A;  1X56 A;  3A5U A;  5FJ8 G;  1YHQ A;  1ASY A;  1N33 Q;  4YCW A;  1E1T A;  1HNZ Q;  4B3M L;  4GKK L;  1FJG Q;  3TRE A;  4LFA Q;  5JEA G;  1U5K A;  4XIG S;  5FLM G;  1Q81 C;  3KF6 A;  3TS2 A;  5C4X H;  2VQF Q;  4OWT B;  4MZ9 A;  2GN5 A;  5FLX c;  5BR8 Q;  1JE5 A;  1XMQ Q;  1KHI A;  4JV5 L;  3UE0 A;  4JOI A;  1X3E A;  2CCZ A;  1OXU A;  4X65 Q;  4X62 L;  4NXM L;  3GTK H;  1N32 Q;  1CKN A;  5M3F G;  3F2D A;  3FHW A;  4QQB X;  4DR2 Q;  4A3I G;  4JI7 L;  4Y52 H;  2E5L L;  1LTL A;  4GN3 B;  4UY8 C;  3PO2 H;  3S2H H;  2VL6 A;  4A3F G;  2R7D A;  5M3M H;  4IFD I;  3FKI H;  3CPF A;  4BBR G;  3HOZ G;  4K0K L;  2UXD Q;  1G51 A;  4J15 A;  2K14 A;  2K5H A;  2ES2 A;  1IBK L;  2K5N A;  2UXC L;  1MJE A;  3T1Y Q;  3HOW H;  2JA7 G;  3S2D H;  1XNR L;  4A3E H;  1IBM Q;  4P73 A;  4AH6 A;  1NMG A;  1HR0 W;  3HOV H;  1HZC A;  4OWX B;  4R4Q A;  3HOX H;  4L5T A;  4L5R C;  4LF5 Q;  5IE8 A;  4JI2 L;  4OWW B;  2N78 A;  1RIP A;  3HKZ E;  2QA4 A;  4BA2 I;  4BY7 H;  1GVP A;  2ZTE A;  2K4K A;  5C3E G;  3I4M H;  2GVA A;  2ZM6 L;  1SN8 A;  3M85 A;  4YY3 L;  4A3B H;  3K0X A;  4OX9 Q;  4X64 Q;  2CKZ B;  4A93 H;  5E7N A;  4A3D G;  2VQE L;  4GKJ Q;  4YHH L;  2UXB L;  3RN5 A;  3HOY H;  3GD7 A;  1L0W A;  3M9B A;  1K3R A;  1GO3 E;  2AWO A;  4DV0 Q;  4A3K G;  1EIF A;  3A74 A;  4KHZ A;  1M1K C;  3KOJ A;  1XPO A;  1XPR A;  4OXP A;  5K36 G;  2RHQ B;  3T1H Q;  5IWA Q;  2I5L X;  1J5E L;  4GNX C;  2V1C C;  4PZ8 A;  2BA0 A;  4FDB A;  2VW9 A;  1N36 Q;  4BBS H;  2JA6 H;  2MNA A;  3PCO B;  3GO5 A;  1SMX A;  1L1O C;  1SR3 A;  2KHI A;  3GTL H;  2R93 G;  3MEF A;  1JT8 A;  3CCQ A;  4A3L H;  4IFD J;  1G6P A;  4A4I A;  3CQZ H;  2OTJ A;  4BA1 I;  4QJF A;  3CAM A;  4EX5 A;  5IP7 H;  1VQM A;  1VS0 A;  4Y7N H;  4UP9 A;  4QGU A;  2UUA L;  2OWO A;  5IYB H;  2PI2 A;  3PIP A;  1NJI C;  4JYA L;  2VS1 A;  5LMN W;  1S3O A;  1I6H H;  1EQR A;  4GN5 A;  1LM0 A;  2NZH A;  2AKW B;  5BR8 L;  2E2J H;  4DR4 L;  2ZJQ A;  3S17 H;  3KJP A;  1IXR A;  2WAQ E;  1I94 L;  3BJU A;  1JJG A;  4DKA C;  2VQF L;  1EUJ A;  4B3S L;  4GLX A;  2A8V A;  4JI8 L;  2CQO A;  3K8A A;  4JOI C;  2CFM A;  1WJJ A;  4LFC L;  3ULL A;  4DR4 Q;  4LFA L;  1LYL A;  3W1G A;  4HID A;  2F4V L;  4JYA Q;  1MKH A;  4O2D A;  2KCM A;  4POF A;  4JI6 Q;  1JJ2 A;  1NMF A;  4BY7 G;  5LMU Q;  3DM3 A;  4MNO A;  4YWK A;  3CCU A;  4YCU A;  1PH8 A;  1NBW A;  3CCL A;  3A0J A;  4YWM A;  4HIK A;  2EIF A;  4HJ5 A;  3J81 i;  1KD1 C;  1OXT A;  3PO3 G;  2Q2I A;  4LF8 Q;  1IBK Q;  1Q8K A;  3G6E A;  1M90 C;  1E1O A;  1Q46 A;  2K75 A;  4IJH A;  3CD6 A;  3TQY A;  1VQ9 A;  2R7F A;  3CCR A;  1L2F A;  1IYJ B;  4RMF A;  1NY4 A;  2JEB I;  3GTG H;  4A3L G;  4C3J H;  2JA8 G;  1XMO Q;  3RLF A;  3I56 A;  2NZO A;  1PFS A;  4JV5 Q;  3M4Q A;  1SFO H;  4GNX A;  3K81 C;  1YIT A;  1X55 A;  1JJC B;  3CCV A;  4A3F H;  5C44 G;  1X3F A;  1JMC A;  4X64 L;  1EQQ A;  2RHS B;  3UDX A;  4QIW E;  3GTJ H;  4A3C G;  3BU2 A;  4GS3 A;  2IX0 A;  1YJ9 A;  4ALP A;  1V1Q A;  2JE6 I;  5ELO A;  4AYB G;  3L7Z C;  1PH9 A;  3NEN A;  5IYB G;  2K5V A;  2MO0 A;  3Q8D A;  2VUM H;  1YEZ A;  4OO1 I;  1I5F A;  4A3J H;  1E22 A;  3KF8 B;  2UUB Q;  3PF5 A;  1A63 A;  1B7Y B;  1FGU A;  1DGS A;  4X6A H;  4DK3 C;  2UU9 Q;  3J7A 5;  4IPG A;  1BBW A;  2OTL A;  1J6Q A;  2OCE A;  2YTY A;  5IP9 H;  1QVG A;  1QVF A;  1X54 A;  3RR5 A;  4AYB E;  2NVQ H;  4DR5 Q;  2UXD L;  4LUV A;  3F2B A;  1HZA A;  2E8G A;  1N36 L;  4BXX H;  4DV5 Q;  3HKS A;  4A3C H;  2JA8 H;  3S1N H;  3I55 A;  2D0P A;  4DV3 L;  4IOA A;  2WFW A;  3J7Z C;  2E2H H;  5J3B A;  5M5W H;  3VDY A;  5C0X G;  4A3K H;  4JI0 Q;  1ASZ A;  1Q12 A;  3CC2 A;  2WAQ G;  1N32 L;  4IPH A;  4A3G H;  4DR5 L;  1YJN A;  5HY6 A;  3AYH B;  1XJV A;  1HNW Q;  1VQB A;  1S72 A;  2R7Z G;  1CKO A;  1VQD A;  3G4S A;  2VQE Q;  5IP9 G;  4LF9 L;  2UXB Q;  2Q2T A;  1EYG A;  4JI4 L;  3UDF A;  3ERS X;  4A3E G;  2YTV A;  4GN4 B;  1OXV A;  5FLM H;  5C4J H;  2OQK A;  1WCM G;  4NPS A;  1N34 L;  1HNX L;  1IBL Q;  1D8L A;  1Z47 A;  4LF6 L;  3H3V H;  3A5Z B;  1HNZ L;  4LF7 Q;  3MXN B;  2K52 A;  2NVY H;  3U4V A;  1UWV A;  2CWP A;  3AEV A;  1TWC H;  3D0F A;  4BBS G;  4IPD A;  3CF5 A;  3AQQ A;  1XNR Q;  4DV1 L;  4JI4 Q;  4JBJ A;  3G48 A;  4DUY L;  1EOV A;  2QGQ A;  4DR3 L;  4L5Q A;  3S16 H;  3CCJ A;  4LF9 Q;  4A3J G;  3PO2 G;  2UXC Q;  2ASB A;  2XGT A;  1HNW L;  3S1Q H;  4B3T L;  1AE2 A;  5GAG C;  4HJA A;  1XPU A;  2PI2 E;  5GAE C;  2NN6 I;  3E9H A;  2A19 A;  5C0X I;  3RLO A;  3J80 i;  2D62 A;  4PMW A;  3CCS A;  2EQS A;  3NEL A;  4DV4 L;  2Q2H A;  3F1Z A;  4KI0 A;  3ULJ A;  4JI7 Q;  4BXX G;  3GTP H;  1Q7Y C;  1OTC A;  1O7I A;  2ZTC A;  4X62 Q;  1Z9F A;  2R93 H;  4HJ9 A; 
#chains in the Genus database with same CATH topology
 2F0U A;  2A69 D;  3STB D;  2H5X A;  1B8A A;  5COR A;  5J22 A;  1XNQ L;  1F9S A;  2WB1 E;  1A2T A;  1SNQ A;  3L0O A;  5M9O A;  4GLV B;  4IUR A;  3Q24 A;  1FD7 D;  4P71 A;  4GKK Q;  1IBL L;  4A3M B;  1YHA A;  2GA4 B;  1XNQ Q;  4CBV A;  2A1A A;  4UAI A;  4A3G B;  2X6L A;  3I4M G;  2BH8 A;  3H15 A;  1EIY B;  2C9O A;  3JAM i;  2B2U C;  1DCZ A;  2PQE A;  4MHE A;  1C0A A;  1STA A;  3VR4 A;  1CKN B;  4AQY Q;  4WJ3 M;  2NVQ B;  1A2U A;  3PUZ A;  3TN2 A;  1N8R C;  1PA6 A;  3S24 A;  1FYC A;  1ET6 A;  1A8V A;  1XXG A;  3J7Y W;  5HGQ A;  5LMU L;  4GOP C;  3X3N A;  4ME5 A;  1KAW A;  1SAP A;  3RN2 A;  1X3G A;  1K8A C;  3A56 A;  4DGZ A;  3X3M A;  1LT3 D;  3C2P A;  3M3Y B;  5EPL A;  1JC7 A;  2KEN A;  4DAM A;  2PNH A;  4DR6 Q;  3IFT A;  3TP7 A;  2R61 A;  4C2M H;  1QUQ A;  5T1I A;  2IHE A;  1WTX A;  4ZYS A;  1YBY A;  2DY7 A;  2EPB A;  3GTO B;  4QL5 A;  5IOC A;  4LF7 Q;  1OXS C;  2AHO B;  3TBI B;  3NBH B;  5M3M G;  1LTS D;  2N3S A;  4LJZ C;  3CXC A;  1KL9 A;  4DR6 L;  1PVO A;  2Y0S G;  3PF4 A;  2JQO A;  1F2L A;  1O7L A;  3KBG A;  1NTG A;  3I4N H;  1S5B D;  1PRT F;  4ULL A;  3H0G G;  3BYY B;  2K5W A;  4B3S Q;  4BY1 B;  1ROD A;  4A3D B;  3TRZ A;  3L3O C;  3NTI A;  1YI2 A;  4HJ8 A;  3D4D A;  1T9H A;  1VQL A;  1TS2 A;  2Z0S A;  1LAC A;  3JAM L;  2UUC L;  5CV9 A;  3KDF B;  4X66 L;  1H9J A;  3T1Y L;  1AW7 A;  1H9R A;  3CW2 C;  4RCO A;  4X3K A;  2IHF A;  3BVM A;  4IOC A;  2FXQ A;  3KFU A;  2E75 C;  4IUV A;  1GXD C;  4K14 A;  4XXE A;  5JOB A;  2HD3 A;  2WB1 G;  3FDT A;  2D0O A;  2RCF A;  4NXM Q;  3QR8 A;  3SVM A;  4JI6 L;  2F4V Q;  1K0R A;  4A93 B;  1AH9 A;  4GKJ L;  4DR3 Q;  4R4O A;  2ZT9 C;  2IX3 A;  5C3E B;  1JB7 A;  4FF1 A;  2PO4 A;  1B50 A;  1JOK A;  4CGY B;  4BY1 H;  4LF6 Q;  4JBM A;  1SJE D;  3D8G A;  5E3F A;  1N34 Q;  3F2C A;  4IUP A;  2HCC A;  1U0L A;  4TQU S;  4O0A A;  1PYW D;  4DR7 Q;  1GUN A;  1YHB A;  5EKI A;  4IFD G;  2P5Z X;  3IFD A;  1Y69 U;  2O5J C;  1J5E Q;  3HOU G;  5CV5 A;  3PO3 H;  1Y8N B;  3URY A;  1X6O A;  3GTK B;  2V4D A;  5GAD C;  3EQL C;  1HXY D;  1EWC A;  4DV5 L;  4A76 A;  1QG7 A;  4B3T Q;  4JC0 A;  3VA5 A;  1F2Y A;  2RDG A;  2F0N A;  2BOS A;  3SK8 A;  1D5Z C;  3G71 A;  3M3Y H;  1RF2 D;  3TME A;  4G7H C;  5C0X J;  4LF5 L;  1TWC B;  5CGK A;  4J1M A;  1VQ4 A;  3U9S A;  3OOC A;  1EYD A;  1Q1E A;  2VNU D;  4QCL A;  3A8K E;  3VR3 A;  5IYC G;  3R3O A;  5GAH C;  1PYB A;  2HUG A;  2Z6K C;  2JN4 A;  1Y14 B;  3LGJ A;  2B2W C;  2WP8 J;  1O7Y A;  1B9N A;  2F0G A;  2F0D A;  3KLR A;  1GKH A;  1Y1V G;  4RGO S;  3AFQ A;  1I6V C;  1CSP A;  4HJ7 A;  4MIU A;  1Q82 C;  1HJP A;  4X3U A;  2JA9 A;  1BDO A;  3PUY A;  1L1O B;  4P75 A;  5M5X H;  2UU9 L;  1GUO A;  3K57 A;  2I5H A;  3J81 j;  3NTK A;  1MI2 A;  1WYD A;  4LUZ A;  4L63 B;  1X56 A;  5FJ8 G;  4PMC A;  1N33 Q;  1E1T A;  3NE5 B;  4B3M L;  1EY8 A;  2XRQ D;  1EIG A;  3IAY A;  2EVB A;  5FLM G;  4XIG S;  1LTI D;  2VUM B;  1GUW A;  3PMF A;  4DNR B;  2VQF Q;  3RZO B;  3I4N B;  1BBX C;  5EKL A;  5E4X A;  4JV5 L;  2CCZ A;  1OXU A;  1CKN A;  3P75 A;  1F9R A;  4X3S A;  4QQB X;  4UY8 C;  3E0J A;  2FMM A;  2RDH A;  3CPF A;  2L0C A;  5FLX L;  2ES2 A;  2K14 A;  3R8B A;  1MJE A;  3IL8 A;  2JA7 G;  3S2D H;  1JE4 A;  4HR7 B;  1IBM Q;  3J81 E;  1NMG A;  3HOV H;  3MVV A;  4CDE C;  3MEH A;  5IE8 A;  4JI2 L;  4OWW B;  3HKZ E;  4BA2 I;  1CZG A;  1DOK A;  2ZTE A;  2GVA A;  3NUC A;  2ZM6 L;  5KEE A;  3M85 A;  2CKZ B;  4DN4 M;  1SE3 A;  2UXB L;  4GKJ Q;  4K2K A;  3HOY H;  1PTO D;  1G6Z A;  3S17 B;  3M9B A;  4G7Z C;  1GO3 E;  1CK1 A;  5EPJ A;  1M1K C;  3KOJ A;  4OXP A;  4A3K B;  5K36 G;  3T1H Q;  5IWA Q;  2I5L X;  3C3L A;  2QF7 A;  2R92 B;  4PZ8 A;  2BA0 A;  5I9O A;  2JA6 H;  1SNO A;  3GTL H;  2NWG A;  3CCQ A;  5I2Y A;  4IFD J;  4A4I A;  3VYT A;  1FNW A;  4BA1 I;  5ISR A;  1QNU A;  1F2Z A;  1ESR A;  3QOL A;  1SYF A;  4KN7 C;  2PI2 A;  5CBE E;  3HRZ C;  1LM0 A;  5AFW A;  2J4X A;  2EYL A;  1JJG A;  4DKA C;  2VQF L;  1EUJ A;  1X3P A;  1LV9 A;  4B3S L;  2A8V A;  1Q8I A;  2X6G A;  4BBR B;  2WV6 D;  4O2D A;  2KCM A;  3V05 A;  4POF A;  4A3F B;  3DM3 A;  4MNO A;  3CCL A;  4HJ5 A;  5ELC A;  1DD2 A;  4K5V A;  1OXT A;  2Q2I A;  3FPP A;  4LF8 Q;  1Q8K A;  3G6E A;  3M7G A;  1M90 C;  1I50 B;  5ELD A;  3CD6 A;  3FKI B;  1L2F A;  3T51 B;  1VDZ A;  3P20 A;  3I3C A;  5IGB A;  2K28 A;  2NZO A;  3S16 B;  1L0X B;  2Q8I B;  1X55 A;  1HUN A;  1DOM A;  4QIW E;  1DM0 B;  4A3C G;  3BU2 A;  4GS3 A;  1KTK A;  4HMI A;  4CDD C;  1GHK A;  4OEM B;  1V1Q A;  5ELO A;  2K5V A;  1A3V A;  2VUM H;  4OO1 I;  2NTT A;  2EXZ A;  1E22 A;  1I6H B;  3KF8 B;  5CC4 A;  1AFP A;  3ERO A;  1SNP A;  4CDC C;  2E2I B;  3K5L A;  4R8N A;  1WTW A;  2OTL A;  1EU4 A;  1A3U A;  5IP9 H;  1QVG A;  3NK9 A;  3VR2 A;  3RR5 A;  3DM1 A;  2UXD L;  3A54 A;  3OPO A;  4LUV A;  1HZA A;  1N36 L;  4DV5 Q;  3GTM B;  2Z8L A;  3I55 A;  1SND A;  4BS9 A;  3H09 A;  4OGQ C;  2E2H H;  3AU7 A;  1E2Z A;  1HFN A;  2CQA A;  4JI0 Q;  1ASZ A;  3GQB A;  2WAC A;  2LMC B;  4DR5 L;  1JIC A;  1XJV A;  1HNW Q;  3S9W A;  4XT3 B;  2R7Z G;  1CKO A;  3NQT A;  4LF9 L;  1E0B A;  3QIA A;  2D9U A;  5FLM H;  1OXV A;  4C1N K;  1PTO H;  1FNU A;  5C4J H;  2OQK A;  4NPS A;  1WTP A;  3D6W A;  3LNN A;  1N34 L;  1IBL Q;  4LF6 L;  4CKB A;  3H3V H;  5CV8 A;  1EQT A;  2K52 A;  3U4V A;  3MWY W;  3DXJ C;  2A6H C;  4IPD A;  3CF5 A;  4JW0 A;  3HOX B;  4JBJ A;  1HPC A;  4DR3 L;  3CCJ A;  4LF9 Q;  4A3E B;  2UXC Q;  2B2V A;  2AQ1 B;  1HNW L;  5GAG C;  1D5M C;  2NN6 I;  3RLO A;  4PMW A;  1TR5 A;  3OMC A;  3K5N A;  1EZ8 A;  4ODG A;  3ULJ A;  1R4P B;  4IAL A;  1OTC A;  5IT9 L;  1DON A;  2R93 H;  2A6E C;  4HJ9 A;  4RHR A;  2PW7 A;  1VQE A;  5K5P A;  4MN3 A;  1B3A A;  3HOX G;  3W5O A;  3TP8 A;  1BXT A;  3FP9 A;  2IT1 A;  1NE3 A;  1VQ5 A;  2QEX A;  2B2U A;  4BBR H;  3KF6 B;  1UE7 A;  3E6Z X;  1SYC A;  2ZXO A;  1VMP A;  1STY A;  2R6G A;  2K6A A;  1MHW C;  4RG1 A;  4NXN L;  2EXD A;  4R4I A;  4JI3 Q;  2E76 C;  1TWH B;  1YVC A;  3LWU A;  5C3E H;  3NBI A;  4HTH A;  1ICF B;  4Y7N B;  3K7U C;  4M8A A;  5M3F H;  1W6J A;  5KYL A;  5I2X A;  1UEB A;  3I7F A;  1MJC A;  5CMD A;  4B9W A;  1GM5 A;  3CRK C;  5DLQ E;  4UP8 A;  2EYF A;  4LUO A;  2HHH Q;  2VXW A;  1ML0 D;  1CKM A;  4B3R L;  3KLS X;  2NUC A;  3A8J E;  4LF8 L;  3S15 B;  2G9H D;  2WKD A;  1VF5 C;  2KCT A;  3TZD A;  1VQF A;  1V1P B;  5K36 H;  1O80 A;  2KHS A;  1EY0 A;  2X69 A;  4OO1 H;  4OO1 G;  1IHZ A;  4PZ6 A;  2CWA A;  1KQS A;  1JB3 A;  3WDN A;  2HQL A;  5H1S E;  4OX9 L;  5FO7 B;  4A3D H;  4A93 G;  2F1M A;  1KRS A;  4CKC A;  4TSS A;  1CSQ A;  4UPA A;  3UDG A;  4WRD A;  2B29 A;  1EY6 A;  1YJW A;  2AWN A;  4LF4 L;  1K3B C;  4DV7 Q;  3OTO Q;  1Q1B A;  4J6H A;  4FXG C;  2HT1 A;  1PXU A;  1TT2 A;  3NWS A;  4UP7 A;  5LMN Q;  1EU3 A;  5FO8 B;  2N49 A;  4APV A;  5EAY A;  2K01 A;  1EYC A;  1KC8 C;  3U50 C;  2F0Q A;  4AQY L;  2WB1 B;  1ILP A;  5I6W A;  1IKL A;  4EGV A;  1M8A A;  2M2L A;  1PMR A;  2F52 A;  1KRT A;  1P16 A;  1RDP D;  1T5E A;  1CA5 A;  1VMC A;  1HR0 Q;  3D31 A;  3RZO H;  5JEA J;  1GHJ A;  5C4X B;  1CHQ D;  1NCV A;  4TVA B;  1JR0 D;  2JK8 A;  4OL7 A;  2EY6 A;  2KED A;  1EFW A;  2BA1 A;  5IYD H;  1XTC D;  1VQK A;  4WJ4 A;  4HN7 A;  1IBM L;  2PCF B;  5KYI A;  3I2Z A;  5HGT A;  2A68 D;  1H95 A;  2NYZ D;  1ENA A;  3MXP A;  5DNF A;  4GNX B;  4ZCK A;  2E74 C;  2R92 G;  3MFY A;  2PZT A;  3CME A;  3S15 H;  1T5X D;  1W2B A;  1HH2 P;  1HCZ A;  2SOB A;  5G3L D;  2ID0 A;  1TQO A;  3RNU A;  2YTX A;  4QF4 A;  3KF8 A;  1TS5 A;  4RWS C;  2ENB A;  2KJX A;  5D3I B;  1N9W A;  4R4C A;  4POG A;  2F0T A;  4FF3 A;  3AFP A;  2A6H D;  3SK5 A;  4PG3 A;  3E5S A;  3HOU H;  2IPK D;  3I4M B;  1BKB A;  4PMB A;  1QUQ B;  2NVT H;  1Y1W G;  3J80 c;  3HFZ B;  3PSI A;  4C3I G;  2VUM G;  2AQ2 B;  4A3M G;  1HR0 L;  4A3M H;  4KJN A;  2UUA Q;  1N33 L;  4HSV A;  3VYU A;  5AJ3 Q;  3TS0 A;  4DAY A;  4FF4 A;  1E24 A;  5NUC A;  1GUS A;  1VQH A;  1K8M A;  1MD2 D;  2YV5 A;  3NEM A;  4FXK C;  4R1J A;  4RAU C;  5LMN L;  4L5S A;  4HCS A;  4K0K Q;  4FO2 A;  3K58 A;  1WCM H;  2B3G A;  2KHJ A;  4JG2 A;  1R9T B;  1NUC A;  1TXY A;  3GV6 A;  1C9O A;  2MHV A;  1BR9 A;  1GD7 A;  3ZYY X;  3ICE A;  1O7Z A;  2ZXP A;  1Y1V B;  1U4M A;  2SNM A;  5KGU A;  5COY A;  2PQA A;  1G2T A;  5IYC H;  2L1B A;  3K80 C;  1MIU A;  2PQA B;  5JAV A;  2C35 B;  3MTS A;  2JA5 H;  2Y0S E;  2MO1 A;  1ILQ A;  2Z6K A;  4YY3 Q;  1B70 B;  1EFI D;  5EQ0 A;  1WTH A;  2KVM A;  1PH3 A;  1PH7 A;  3S1R H;  2JJQ A;  2F0M A;  2L15 A;  5JJI A;  1B1Z A;  5CYU A;  2F03 A;  4RA8 A;  1CZW A;  2NN6 H;  2ICI A;  3N52 A;  1K8G A;  1DYQ A;  2F0F A;  4KLK A;  3HGB A;  2WIN B;  4XQN A;  3RZD H;  4O42 A;  1TY2 A;  2F0H A;  4JI1 L;  2F0O A;  1TU2 B;  3KK7 A;  1E7Z A;  2BE5 C;  3CCE A;  3I4O A;  2G9D A;  3HS0 C;  5IT9 E;  4JBK A;  1QVC A;  2AUK A;  5ELB A;  3L2P A;  3KLW A;  1PH2 A;  2QDB A;  1CQF A;  4GZY C;  1Q90 A;  2NTS A;  3D3R A;  1XMQ L;  1PH6 A;  4DK6 C;  3FVQ A;  4DUY Q;  1SEB D;  3DLL A;  2H1E A;  4A3B G;  4KN4 C;  4NXN Q;  2F0J A;  3A5U A;  1YHQ A;  1ASY A;  4YCW A;  2QIL A;  4RCN A;  3TRE A;  1U5K A;  1STB A;  1Q81 C;  3CU7 A;  3C46 A;  4FVM A;  1TWG B;  1B9M A;  5IGC A;  4OWT B;  1KDC A;  2GN5 A;  1IYV A;  1LTR D;  3UE0 A;  1Z6H A;  5C44 B;  1X3E A;  4NXM L;  2L9H A;  2QKI C;  4K2L A;  1SFO B;  3FHW A;  1G2S A;  1SDF A;  2E5L L;  3GTG B;  3PO2 H;  5EKK A;  2Q8T A;  3S2H H;  4C56 C;  2R7D A;  5M3M H;  4IFD I;  4XYQ A;  3FKI H;  3Q22 A;  4BBR G;  3HOZ G;  2QEJ C;  1BQQ T;  1E2W A;  2K5H A;  1HQR D;  3I72 A;  3QO2 A;  1IBK L;  1CM9 A;  2UXC L;  3HOW H;  3T1Y Q;  3DEP A;  3T53 B;  1PTO C;  4NW2 A;  4L5T A;  4N8F A;  3J7A F;  3MFG A;  2JSO A;  3A7L A;  5J39 A;  1RIP A;  2NVT B;  4U68 A;  5C3E G;  1HTL D;  2XWJ B;  4A3B H;  4OX9 Q;  3BDC A;  3KBX A;  2EE1 A;  3GD7 A;  5JJZ A;  3AMU A;  3IKJ A;  2B8F A;  4CJ0 B;  2WKC A;  4C3I B;  1XPR A;  4KK7 A;  2CW0 C;  2V1C C;  2A74 C;  3NSW A;  4FDB A;  1N36 Q;  4BBS H;  2R93 G;  1SR3 A;  3MEF A;  4A3L H;  2IW3 A;  3OIQ A;  4QJF A;  1ZYR C;  1VF7 A;  2LFN A;  5IP7 H;  2Z6B A;  2L12 A;  4UP9 A;  4QGU A;  5LL6 X;  1NJI C;  2CH4 W;  2NB0 A;  2N88 A;  4JYA L;  1EQR A;  4GN5 A;  3PIP 3;  2E2J H;  2JYO A;  2ZJQ A;  3S17 H;  3KJP A;  3GP7 A;  1I94 L;  4JOI C;  2CQO A;  2EJF C;  1WJJ A;  4LFC L;  2EOT A;  4LFA L;  1LYL A;  4HID A;  4JYA Q;  3H91 A;  5J1Z A;  1JJ2 A;  4RKL A;  4BY7 G;  5LMU Q;  4YCU A;  1K8O A;  5C5L A;  4LK1 C;  3BZD B;  4ZQ3 A;  3HOV B;  4C3H G;  3NP8 A;  3S2D B;  1M4V A;  3CKI B;  1Q46 A;  1KNA A;  1UNS A;  2K75 A;  2OF1 A;  3OSO A;  2EJM A;  4KY6 A;  5CR3 A;  2MGS A;  4KKS A;  2FMC A;  1BO0 A;  2CW0 D;  3I56 A;  2M00 A;  4GNX A;  3QB3 A;  1YIT A;  1JJC B;  3MAQ A;  4G57 A;  5C44 G;  3CCV A;  4EQO A;  1JMC A;  1EQQ A;  4DXF A;  1B53 A;  1YJ9 A;  3CRL C;  4CJ1 B;  3NEN A;  1PTO F;  2UUB Q;  3R2I A;  1QB5 D;  2B2Y C;  2FFK B;  1H9M A;  3PF5 A;  1B7Y B;  1FGU A;  4ZK9 B;  5JVH 3;  1A6X A;  1C8C A;  5A35 A;  2HDM A;  2OCE A;  1I4Q A;  1QVF A;  1X54 A;  1AEX A;  4H0L C;  4DR5 Q;  1BCP F;  2XWB B;  2R3Z A;  5KIX A;  3S1N H;  5JVG 3;  4DV3 L;  3J7Z C;  4B08 A;  2HCI A;  1Q12 A;  1LAB A;  2JP1 A;  3DWP A;  2SEB D;  1YJN A;  3UI2 A;  4G7O C;  1VQB A;  1BCP D;  2UXB Q;  1IL8 A;  3K6O A;  1I3Q B;  1S5C D;  3ERS X;  3UDF A;  4A3J B;  2YTV A;  5JEA H;  4LAA A;  1UUP A;  2JXM B;  4K8I A;  1Z47 A;  1CI3 M;  3BVG A;  4TKO B;  3A5Z B;  4HAE A;  1GOZ A;  1EIH A;  1GUG A;  1TWC H;  4XQJ A;  2QCP X;  4JI4 Q;  4DUY L;  1EOV A;  3RMH A;  1I4G A;  2PI2 E;  5GAE C;  2K32 A;  5IGD A;  1DOL A;  2O4X A;  3E9H A;  2WAQ B;  4H13 C;  3NEL A;  5KNC A;  4BXX G;  3S2H B;  5FK9 C;  5CV7 A;  3O13 A;  1TKW B;  2BE5 D;  2CH4 A;  4FP5 D;  2C5C A;  1VQ6 A;  1FR3 A;  4OON A;  5C6A A;  4DAV A;  4QIW B;  5IOD A;  2IY5 B;  3EIV A;  2KCC A;  4F8M A;  4YCV A;  1PH5 A;  2YU9 B;  3BVZ A;  4B3M Q;  2L11 A;  4JI5 Q;  3I8Z A;  3HOY G;  1EEI D;  1SE4 A;  2L4N A;  3J80 L;  3U58 A;  1SNM A;  5C5M A;  1UE1 A;  1DXM A;  1F9P A;  3Q23 A;  1PH1 A;  5M5Y H;  5E4W C;  4E6I A;  5FKA C;  2N55 A;  1XMO L;  3JAM E;  2E2H B;  3HOV G;  3BS1 A;  3HZX A;  1IL2 A;  1SYD A;  5IGF A;  4C3H H;  1Q3L A;  1VQ8 A;  3ZJY C;  3SE0 A;  3GTM H;  1ONL A;  4ABN A;  2EY1 A;  2F0E A;  2I5M X;  5FJ8 H;  4DV2 Q;  2DUD A;  4P72 A;  1I4H A;  4YIJ A;  2E2I H;  5IWA L;  1K83 B;  2F3I A;  3H0G B;  3H94 A;  2HQE A;  4H02 A;  3VYR A;  2HIV A;  4KV6 A;  3CC4 A;  3U4Z A;  3CC7 A;  3MZ5 A;  3AB9 A;  3C1F A;  3I73 A;  4PQX A;  4OEL B;  1WVL A;  1Y8P B;  4XDX A;  1XTD A;  4IUN A;  4ID6 A;  3TP5 A;  2XSC A;  1SRU A;  1STE A;  4IN3 A;  5L37 A;  1L0Y B;  1AZP A;  1KLU D;  3LX0 A;  1Y1V H;  3PUV A;  3E9I A;  2ATW A;  3PUX A;  4DV6 L;  4DNT B;  1JOQ A;  2R7Z H;  4GLA C;  1LUZ A;  3M4O H;  1AN8 A;  3WWV A;  4LNQ A;  1CQV A;  1KAA A;  1C4Q A;  1EWI A;  1R9T H;  1WOC A;  3EBE A;  2MQH A;  4X3T A;  4PNY A;  5C3X A;  1DZ1 A;  4DV6 Q;  3GTO H;  1YIJ A;  1HA5 A;  3CMA A;  2M9V A;  2VY3 A;  2UUB L;  4I7A A;  4I65 A;  1RTN A;  3FMC A;  2EYM A;  1P8L A;  1G29 1;  1Y1W H;  4JI8 Q;  2AMC B;  1AZQ A;  3I4L A;  1EQV A;  3S1M B;  4DXG A;  1HUM A;  3KJO A;  2DNC A;  4KY5 A;  3STB C;  3P1H A;  1PH4 A;  5A2Q L;  3KDF A;  1TWA H;  2Z4H A;  4EQP A;  1V1P A;  3GTL B;  4IUU A;  1GJX A;  3RD4 A;  1VQI A;  3W1B A;  2VB2 X;  4DV2 L;  3K0Y A;  1MSH A;  4K5X A;  4A3G G;  4RKB A;  1SSO A;  2KOL A;  2XIW A;  4JPB W;  3SHL A;  4U67 3;  4C3I H;  4F88 A;  3DHQ A;  4X66 Q;  1RKN A;  2ZJR A;  1SBB B;  4DV0 L;  1B3Q A;  1SE8 A;  5I4D A;  5DAU A;  1F9Q A;  4A3B B;  2XRS D;  1BCP C;  1SLJ A;  2A69 C;  3NTH A;  3S1M H;  3IRB A;  1JCK B;  2NVX B;  1HNX Q;  3GTQ H;  1Y8O B;  3HOW B;  4YWL A;  1FGB D;  1E2V A;  3OW2 A;  4IPC A;  1D7Q A;  4HCE A;  4AIM A;  5IT9 c;  1PZI D;  4DA2 A;  1KIX A;  4DF7 A;  4F7X A;  1RCV D;  2KCN A;  2HHH L;  4LF7 L;  4KKU A;  3PO2 B;  1HRJ A;  1VCI A;  2GVB A;  2KEE A;  4RGM A;  3T16 A;  1K73 C;  3NWT A;  1WI5 A;  3M4P A;  4B9X A;  4R4T A;  2DGY A;  3VR6 A;  1BVS A;  2QDL A;  1KDB A;  1UE6 A;  2K1B A;  2E2D C;  2Z1C A;  4DR7 L;  2EY2 A;  2G5D A;  1VQG A;  1FJG L;  1EZ6 A;  1PFM A;  2XTI A;  5LL6 S;  2F0K A;  1EY7 A;  1U4R A;  4OIK A;  4WFN 3;  4FNF A;  1PHJ A;  2AUJ D;  3D4R A;  5CV4 A;  2RQX A;  4LFB L;  4JCV E;  2J0T D;  1HTP A;  3H0G H;  2JA5 G;  1K83 H;  4PV1 C;  5ELN A;  4ME3 A;  1UE5 A;  1VQ7 A;  1FVI A;  1F77 A;  3BYT B;  3KYH C;  1TWF H;  3M7N A;  2PMZ E;  4K6L A;  4MTN A;  3E3X A;  3T4A C;  2ZXR A;  1YNN C;  4DPG A;  5M5W B;  1G91 A;  4HIM A;  1SYG A;  1XYI A;  1Q86 C;  1KXL A;  2MFI A;  1V1O A;  5JJL A;  3H3V C;  1LTG D;  4S3S A;  1TWA B;  5M5Y B;  1STG A;  2B63 B;  1TWH H;  1H9S A;  3K5O A;  1ZYR D;  4GKK L;  4R9W A;  3GV3 A;  1FJG Q;  4LMQ D;  2DN8 A;  3KF6 A;  2JA5 B;  1Y1W B;  1PLF A;  2B2T A;  3GTJ B;  5BR8 Q;  1JE5 A;  1XMQ Q;  2O5I C;  3RUZ A;  1KHI A;  2KUM A;  4RH6 A;  4X65 Q;  5M3F G;  1II3 A;  4DR2 Q;  4Y52 H;  1WCM B;  1LTL A;  4GN3 B;  1G8Z D;  2VL6 A;  1UAP A;  4I7Z C;  2R7Z B;  2MPM A;  2UXD Q;  1D1I A;  2K5N A;  3DUZ A;  2RKS A;  3I70 A;  1B4O A;  1XNR L;  3NPP A;  3J81 L;  4A3E H;  4P73 A;  1YNN D;  5IIF A;  1LT6 D;  1JQY D;  1A3T A;  1HZC A;  2O2L D;  4L6T B;  4R4Q A;  4OWX B;  5BN5 A;  4AYB B;  5EGT A;  1WD1 A;  4BY7 H;  1GVP A;  2K4K A;  3I4M H;  1KAB A;  4IQZ A;  1TS4 A;  2B39 A;  4YY3 L;  3EJI A;  3K0X A;  1QE6 A;  5C4J B;  1SJH D;  3OWE B;  2F4I A;  1RD9 D;  1K3R A;  2AWO A;  4DV0 Q;  1EIF A;  3A74 A;  2DY8 A;  1CA6 A;  3EFX D;  3OIP A;  4GNX C;  1V8Q A;  3PCO B;  2K04 A;  3GO5 A;  1L1O C;  2KHI A;  3KUP A;  3VYS A;  4V19 0;  1G6P A;  3CQZ H;  2HDL A;  1RTO A;  4EX5 A;  1VQM A;  2OWO A;  1U4P A;  2KQ3 A;  2UUA L;  4IUT A;  4DK0 A;  2K03 A;  3WOE A;  3PIP A;  1TVX A;  2VS1 A;  3OWF A;  1CT1 D;  2AKW B;  5BR8 L;  2LY7 A;  1IXR A;  2WAQ E;  4KTA A;  2RSO A;  5I6Y A;  4GLX A;  4JI8 L;  3ULL A;  2D5D A;  1EYA A;  4FF2 A;  1MKH A;  1NMF A;  3WOF A;  4YWK A;  2FHT A;  4J8Q A;  4K8J A;  1J8I A;  4XT1 B;  1PH8 A;  2EIF A;  3PO3 G;  2F3V A;  2MP1 A;  1IBK Q;  3DEO A;  4XQQ A;  1QOH A;  3VR5 A;  1KLG D;  5I9P A;  3TQY A;  4K5W A;  4QMG A;  1WTR A;  2KEC A;  4KD4 A;  3W2D A;  2R7F A;  4O1N A;  5EBD A;  3CCR A;  2OXP A;  1IYJ B;  1NY4 A;  2Q8R E;  4C3J H;  2JA8 G;  3RLF A;  2LS0 1;  5T1G A;  4JK1 C;  3LWE A;  4F87 A;  4R8I A;  4Z9C B;  1UEA B;  4A3F H;  1X3F A;  2SNS A;  1W6K A;  3A7A B;  2EY5 A;  2XN9 C;  4ALP A;  4AYB G;  1PH9 A;  3L7Z C;  2IL8 A;  3Q8D A;  2E2J B;  1STH A;  2EYO A;  3K59 A;  2I46 A;  4X6A H;  1DGS A;  1RJT A;  4DK3 C;  3J7A 5;  5CV6 A;  2AQ3 B;  3J7A V;  4IPG A;  1BBW A;  2EDG A;  2YTY A;  3K5M A;  4HMJ A;  3SK6 A;  1CFM A;  2NVQ H;  3HKS A;  3KLS A;  4DAP A;  1QCB D;  4IOA A;  4BBS B;  2WFW A;  2F0S A;  5J3B A;  1ET9 A;  5M5W H;  5M3F B;  1HHV A;  2RA4 A;  3VDY A;  5C0X G;  1S5F D;  3CC2 A;  4K6D A;  5HY6 A;  3FPU B;  1TWF B;  1BUV T;  3BDO A;  1VQD A;  3G4S A;  2VQE Q;  4ZRZ A;  3TSS A;  2Q2T A;  4A3E G;  5BN4 A;  1WCM G;  1HNX L;  3L9A X;  3MXN B;  2NVY H;  1UWV A;  3AEV A;  2PYK A;  3D0F A;  4BBS G;  3G48 A;  1I4R A;  1IW7 D;  3W3A A;  2QGQ A;  2EZV A;  2ASB A;  3TDQ A;  2K05 A;  1AE2 A;  1XPU A;  2A68 C;  3BDL A;  1ENC A;  3VA7 A;  3DMU A;  4JVZ A;  1H9S B;  2A19 A;  3SEB A;  3CCS A;  4JI7 Q;  2EYH A;  3TP6 A;  1O7I A;  4X62 Q;  1Z9F A;  4WOR A;  2EJG C;  5TSS A;  5LHY 1;  1SMY D;  2CHB D;  4N9T A;  5G3L F;  1K9M C;  5IGG A;  2NBF A;  5AJ3 L;  1KNE A;  3UDI A;  2B2W A;  3F2U A;  1HZ9 A;  1PTO B;  2F0I A;  5IGE A;  1PRT D;  1O78 A;  3ER0 A;  4ZKC B;  1AE3 A;  3FKI G;  3HOZ H;  1EY9 A;  1RL2 A;  2MJ8 A;  1EL0 A;  5EPK A;  2NZ1 D;  4IO9 A;  1L1O A;  3EA6 A;  4QY7 A;  1PFB A;  1EWH A;  1BCP B;  1NNX A;  3CQZ B;  3MC0 B;  3CCM A;  2BDN A;  2JA8 B;  4GOP B;  4KMU C;  1OXX K;  2LKV A;  3SGI A;  3HKZ G;  4MTK A;  2DJG C;  1OO9 B;  1SRO A;  2LSS A;  3EN2 A;  2PNR C;  3UE1 A;  1HFG A;  1EOT A;  4PZ7 A;  2K33 A;  1D5X C;  3PUW A;  3HOW G;  5C4X G;  4N9P A;  3NXW A;  3PQI A;  1D2B A;  2XVS A;  3F8T A;  2HIX A;  3ITP A;  1ZEQ X;  1ZKO A;  2JA6 G;  4P2C B;  4RFB A;  4ZUJ A;  5JPN C;  4YHH Q;  4FXD A;  1WD0 A;  4CHT B;  2EYP A;  2SDF A;  2OEO A;  4DFA A;  1V43 A;  1PFN A;  2PZW A;  4A3I H;  4NB3 A;  3C1E A;  5EBC A;  5EJW A;  2F0V A;  3CPW A;  3K7A H;  1FL0 A;  2KA7 A;  1XX8 A;  1HQM C;  1QZG A;  1I50 H;  4ZAI A;  1F2M A;  2NN6 G;  5M3M B;  1IZ6 A;  4KHP Q;  1C48 A;  4EQ5 A;  4KJO A;  2RDF A;  3I91 A;  2TMP A;  4HIO A;  4N8X 1;  1WTV A;  3M4O B;  3OTO L;  4DV7 L;  5FLX E;  4LF4 Q;  2UUC Q;  1EY5 A;  4Q0F A;  5C44 H;  1NSN S;  5DM6 3;  3K7A B;  2RF4 A;  1TS3 A;  1TWG H;  4C1N I;  1VQJ A;  4BY1 G;  1PRT B;  3CP0 A;  3PGZ A;  4LFC Q;  4CDF C;  1S5D D;  2I0Q A;  2Q2U A;  2JA7 H;  4NDX A;  1I94 Q;  2A6E D;  2MUY A;  2JEA I;  2FIN B;  3S14 H;  4JI5 L;  2F3W A;  1YZ6 A;  1HZB A;  1JOR A;  4RHS A;  3HKZ B;  2B63 H;  1K0S A;  4OHJ A;  4LWC A;  4XTC S;  2BDO A;  2K7V A;  3JC6 6;  4DUZ L;  1ENF A;  4GOP A;  1NAP A;  1PV4 A;  1MBY A;  5F2D A;  1A62 A;  3ULP A;  3OYY A;  3BZC A;  3QWN A;  2R92 H;  4B3R Q;  1U4L A;  2KBN A;  1QZH A;  3MHB A;  2OQ0 A;  1YNX A;  4DR1 L;  2QW7 A;  1S40 A;  4DAY B;  2B2T C;  2Y0S B;  4KY7 A;  3R93 A;  1X32 A;  1EEF D;  4DR2 L;  3RZD B;  4ZUI A;  2B2Y A;  5IYD G;  1SYE A;  2LXJ A;  2PMZ B;  4G4K A;  1X65 A;  4X65 L;  4LW1 A;  2IWH A;  3BZK A;  3GDE A;  3TEH B;  2D2C C;  5IP7 G;  2BH2 A;  3G7L A;  1LTB D;  1VQP A;  4JI3 L;  1B44 D;  5FOB B;  2RCN A;  1BF4 A;  4A75 A;  1QIL A;  5GRO A;  3M4Y A;  3A55 A;  1JWM D;  2N8N A;  1YNJ D;  4ILW A;  2ZTD A;  2YU9 H;  3HG9 A;  1VQO A;  2DJF C;  2F0P A;  3CHB D;  4KHV A;  3U9O A;  1C7Y A;  1Z7T A;  1S5E D;  1E3P A;  2B63 G;  4CKE A;  3RLN A;  1BNZ A;  2LXK A;  3PV0 A;  3P7J A;  3J81 c;  4KHP L;  4EVO A;  2IX1 A;  1IW7 C;  4DNI A;  5IY0 A;  5C3W A;  3T1H L;  1HA6 A;  1W3S A;  2E5L Q;  4P74 A;  4DV3 Q;  4OIJ A;  3SDZ A;  3V96 A;  2Z4I A;  2ZJP A;  1FNV A;  1XWE A;  3I4N G;  3E0E A;  1SXT A;  3NHH A;  4LFB Q;  1WFQ A;  3GTQ B;  1ESF A;  3JAM c;  2NVX H;  2CVR A;  2PZU A;  2WII B;  1V9P A;  1LTT D;  2ZM6 Q;  1QJO A;  1PYS B;  1WTQ A;  3DWA A;  4JI2 Q;  1X3Q A;  4JBW A;  2NVY B;  4RGN A;  1KDA A;  4KKT A;  3MA2 B;  5M5X B;  3HOU B;  3Q6S A;  3H6M A;  2F0W A;  1GUT A;  5ELE A;  3DWQ A;  3HP3 A;  1A0I A;  1I3Q H;  5JJK A;  1CTM A;  2YYZ A;  1X9N A;  2RBM A;  2K50 A;  2FJ2 A;  1BBU A;  4JI0 L;  1CUK A;  5ELF A;  4DV4 Q;  1D6E C;  4M1U B;  5C4Z A;  4DR1 Q;  1VQC A;  3B6Y A;  2VZA A;  4V0B A;  5GQO A;  4JI1 Q;  4Q5V A;  4IFD H;  1A15 A;  4UDU C;  2Z9H A;  1VQA A;  1LTA D;  3H3V I;  1TII D;  5C0X H;  4IJL A;  1VQN A;  1WTO A;  4NP5 A;  5DEH A;  4DV1 Q;  4NKL A;  2ALY B;  4DUZ Q;  1NR2 A;  2J7Z A;  1SE2 A;  3PIO A;  1HNZ Q;  2L5T A;  1RHP A;  4LFA Q;  5JEA G;  4IUQ A;  3TS2 A;  5C4X H;  4CJ2 C;  3T13 A;  4MZ9 A;  3NBH A;  5FLX c;  4JOI A;  4X62 L;  5D14 A;  3GTK H;  1N32 Q;  1IYU A;  1H9K A;  3F2D A;  3A8I E;  3PO3 B;  4NMZ A;  1R4Q B;  4A3I G;  4JI7 L;  4C3J B;  1B2T A;  4A3F G;  1JOO A;  5E1F A;  1LT5 D;  4K0K L;  3SXH A;  1G51 A;  4J15 A;  2EYJ A;  1DJR D;  3S1Q B;  4H7B A;  2PPB C;  4AH6 A;  1HR0 W;  2IJ0 A;  3ND8 A;  3T56 B;  4L5R C;  3HOX H;  1CHP D;  4LF5 Q;  3FEW X;  2N78 A;  2QA4 A;  4DK1 A;  3V2T A;  2B2V C;  1SN8 A;  5CBA E;  5KND A;  2L55 A;  2H4O A;  4X64 Q;  4A93 H;  5E7N A;  4A3D G;  1S4Z A;  2VQE L;  2I07 B;  4YHH L;  5HUR A;  3RN5 A;  4QB4 A;  4EQN A;  4IZ8 A;  1L0W A;  1YNJ C;  2OT2 A;  3D4W A;  4A3K G;  4KHZ A;  4XYO A;  1XPO A;  1I4X A;  1IKM A;  1TY0 A;  2RHQ B;  1J5E L;  4WJW A;  3PIO 3;  2VW9 A;  2MNA A;  3I90 A;  1BOS A;  1SMX A;  1JT8 A;  3QJY A;  4C3H B;  2OTJ A;  4QUF A;  2K5Q A;  3CAM A;  1LO5 D;  1ICW A;  1VS0 A;  4Y7N H;  3S14 B;  5IYB H;  5LMN W;  1S3O A;  1I6H H;  4DR4 L;  2NZH A;  2JA7 B;  2VB3 X;  3BJU A;  1AP0 A;  3K8A A;  1D1K A;  2CFM A;  4RGT A;  4DR4 Q;  3J80 E;  3W1G A;  2F4V L;  3OMG A;  4JI6 Q;  3CCU A;  4BY7 B;  2PW5 A;  1NBW A;  5A2Q E;  3A0J A;  4YWM A;  4HIK A;  3J81 i;  1KD1 C;  2R93 B;  3OHX C;  1E1O A;  4IJH A;  4C2M B;  1VQ9 A;  4BWG B;  3N6R A;  3MXG A;  1PDQ A;  1ZXT A;  4RMF A;  2JEB I;  3TZU A;  5KRU A;  3GTG H;  4A3L G;  4A3I B;  1XMO Q;  5FO9 B;  1PFS A;  2F0L A;  4JV5 Q;  3M4Q A;  1SFO H;  3K81 C;  2TSS A;  4X64 L;  5C4H A;  2RHS B;  4DU9 A;  3UDX A;  3GTJ H;  3NQI A;  4HSP A;  2IX0 A;  3QG1 A;  1JWU D;  2JE6 I;  2A73 B;  5IYB G;  2MO0 A;  1YEZ A;  1I5F A;  1SYB A;  5D3D A;  4A3J H;  1LT4 D;  3EVQ A;  1A63 A;  2UU9 Q;  1J6Q A;  3FRP B;  5JPM C;  3G6J B;  2BCO A;  3SK4 A;  4AYB E;  1SNC A;  3F2B A;  4H44 C;  2E8G A;  3HEJ A;  2RSN A;  3MXN A;  4BXX H;  3ONA B;  4A3C H;  4C3J G;  2JA8 H;  2D0P A;  2JA6 B;  3S1N B;  1I4P A;  5BN3 A;  1U9R A;  2DNE A;  1NR4 A;  1EY4 A;  2RVL A;  4A3K H;  2WAQ G;  4L8J A;  1N32 L;  4IPH A;  4A3G H;  1K28 A;  1MGS A;  3R2T A;  1QWY A;  3AYH B;  4ZKB B;  1JWS D;  1S72 A;  4HED A;  3MXU A;  3OW7 A;  5IP9 G;  1LLR D;  3HOZ B;  4TRD A;  1EYG A;  4JI4 L;  2A5H A;  3Q0A A;  3HOY B;  4GN4 B;  4ZLT F;  4UHV A;  1J9O A;  1D8L A;  5DM7 3;  1PZJ D;  1HNZ L;  3D6C A;  2CWP A;  3BG3 A;  2K5D A;  3AQQ A;  1XNR Q;  4DV1 L;  1MSG A;  2B8G A;  3ND9 A;  3S1R B;  4QUC A;  3S16 H;  4L5Q A;  3PO2 G;  4A3J G;  2ICE C;  2XGT A;  3ERQ A;  1STN A;  3S1Q H;  4B3T L;  4HJA A;  5D65 A;  2XNA C;  1QNK A;  3GTP B;  1PZK D;  1PRT C;  5KNB A;  5C0X I;  3J80 i;  2D62 A;  4DV4 L;  2EQS A;  3SR1 A;  2Q2H A;  3F1Z A;  3QOJ A;  4KI0 A;  3GTP H;  1Q7Y C;  4FYD A;  1SMY C;  2ZTC A;  4KD3 A; 
#chains in the Genus database with same CATH homology
 1VQ6 A;  1VQE A;  3STB D;  2H5X A;  3HOX G;  3W5O A;  4OON A;  1B8A A;  1XNQ L;  2IY5 B;  3FP9 A;  2WB1 E;  1K9M C;  2IT1 A;  1NE3 A;  3EIV A;  1VQ5 A;  5AJ3 L;  3UDI A;  2QEX A;  4YCV A;  4BBR H;  3KF6 B;  3L0O A;  1PH5 A;  1HZ9 A;  1UE7 A;  4GLV B;  4B3M Q;  2R6G A;  4KHP Q;  4P71 A;  4GKK Q;  3ER0 A;  1IBL L;  1AE3 A;  4JI5 Q;  3HOY G;  1YHA A;  3FKI G;  4RG1 A;  1RL2 A;  4NXN L;  3HOZ H;  2EXD A;  4R4I A;  4JI3 Q;  1XNQ Q;  3U58 A;  1YVC A;  2A1A A;  1UE1 A;  4IO9 A;  1L1O A;  5C3E H;  1PH1 A;  2BH8 A;  5M5Y H;  3H15 A;  1EIY B;  3I4M G;  4QY7 A;  3K7U C;  3JAM i;  5M3F H;  1XMO L;  3HOV G;  1UEB A;  3I7F A;  1IL2 A;  1MJC A;  3CCM A;  1GM5 A;  4C3H H;  1VQ8 A;  3GTM H;  3ZJY C;  1C0A A;  4GOP B;  5DLQ E;  4UP8 A;  1OXX K;  3SGI A;  1CKN B;  4AQY Q;  3HKZ G;  4WJ3 M;  2I5M X;  5FJ8 H;  4LUO A;  1SRO A;  3PUZ A;  2HHH Q;  4DV2 Q;  1N8R C;  2LSS A;  1CKM A;  3EN2 A;  2DUD A;  3UE1 A;  4P72 A;  4B3R L;  1PA6 A;  4PZ7 A;  2E2I H;  4LF8 L;  3S24 A;  5IWA L;  2KCT A;  3PUW A;  3HOW G;  2F3I A;  1VQF A;  5C4X G;  4H02 A;  1A8V A;  2HIV A;  3CC4 A;  3F8T A;  3U4Z A;  2HIX A;  3CC7 A;  5HGQ A;  5LMU L;  2JA6 G;  4GOP C;  4OO1 G;  1KAW A;  4PZ6 A;  2CWA A;  1KQS A;  3RN2 A;  1X3G A;  4YHH Q;  1K8A C;  2HQL A;  5H1S E;  4OX9 L;  4A3D H;  4A93 G;  1KRS A;  1V43 A;  1CSQ A;  1XTD A;  4UPA A;  4A3I H;  2KEN A;  4NB3 A;  3UDG A;  2B29 A;  1SRU A;  4DAM A;  2PNH A;  4DR6 Q;  1YJW A;  2AWN A;  4LF4 L;  3CPW A;  4DV7 Q;  3OTO Q;  3K7A H;  4C2M H;  1FL0 A;  1QUQ A;  1Y1V H;  3PUV A;  1Q1B A;  3E9I A;  3PUX A;  4DV6 L;  2IHE A;  2ATW A;  2HT1 A;  2R7Z H;  4GLA C;  1LUZ A;  3M4O H;  1YBY A;  1QZG A;  1I50 H;  2NN6 G;  4UP7 A;  3WWV A;  4LNQ A;  5LMN Q;  1IZ6 A;  2N49 A;  4QL5 A;  1EWI A;  5EAY A;  1WOC A;  1OXS C;  3EBE A;  4APV A;  4EQ5 A;  1R9T H;  2AHO B;  1KC8 C;  2MQH A;  3U50 C;  3NBH B;  5M3M G;  4HIO A;  4AQY L;  4DV6 Q;  3GTO H;  2N3S A;  1YIJ A;  3CXC A;  3OTO L;  4DV7 L;  2F52 A;  3CMA A;  1KRT A;  1P16 A;  4LF4 Q;  1KL9 A;  2UUC Q;  2VY3 A;  5C44 H;  2UUB L;  4DR6 L;  2Y0S G;  1PVO A;  3PF4 A;  2JQO A;  2RF4 A;  1HR0 Q;  1NTG A;  3D31 A;  1TWG H;  3I4N H;  3RZO H;  5JEA J;  1VQJ A;  1G29 1;  1P8L A;  4BY1 G;  1Y1W H;  3H0G G;  3CP0 A;  3PGZ A;  4LFC Q;  4JI8 Q;  2AMC B;  2I0Q A;  2Q2U A;  4B3S Q;  2JA7 H;  1I94 Q;  2JEA I;  3TRZ A;  4TVA B;  3S14 H;  4JI5 L;  2JK8 A;  1YI2 A;  1YZ6 A;  4HJ8 A;  3KJO A;  1T9H A;  1HZB A;  1VQL A;  2B63 H;  1EFW A;  2BA1 A;  4LWC A;  2Z0S A;  3STB C;  1VQK A;  1PH4 A;  4WJ4 A;  5IYD H;  4XTC S;  3JC6 6;  2UUC L;  3KDF A;  1TWA H;  1IBM L;  4DUZ L;  4GOP A;  3KDF B;  1PV4 A;  3I2Z A;  4X66 L;  1A62 A;  1H95 A;  3T1Y L;  1VQI A;  3CW2 C;  3ULP A;  3OYY A;  3W1B A;  4GNX B;  3BZC A;  4B3R Q;  2R92 H;  4DV2 L;  2IHF A;  2R92 G;  3CME A;  3S15 H;  4A3G G;  1W2B A;  4IOC A;  1HH2 P;  2FXQ A;  2KBN A;  1QZH A;  3KFU A;  2ID0 A;  2OQ0 A;  1YNX A;  4DR1 L;  1S40 A;  4C3I H;  3RNU A;  4DAY B;  2YTX A;  4X66 Q;  4DR2 L;  5IYD G;  2LXJ A;  2ZJR A;  1N9W A;  4DV0 L;  4R4C A;  2WB1 G;  1SE8 A;  4POG A;  1X65 A;  2D0O A;  4X65 L;  4NXM Q;  4LW1 A;  3AFP A;  4JI6 L;  3BZK A;  2F4V Q;  1K0R A;  1AH9 A;  4PG3 A;  3GDE A;  3TEH B;  4GKJ L;  5IP7 G;  2BH2 A;  3HOU H;  4DR3 Q;  1SLJ A;  1VQP A;  1BKB A;  4R4O A;  4JI3 L;  1JB7 A;  1QUQ B;  2NVT H;  3S1M H;  1Y1W G;  2RCN A;  3J80 c;  3HFZ B;  3IRB A;  4BY1 H;  4A75 A;  3PSI A;  2VUM G;  4A3M G;  5GRO A;  1HR0 L;  4A3M H;  4LF6 Q;  2UUA Q;  4JBM A;  1N33 L;  1N34 Q;  1HNX Q;  3GTQ H;  2N8N A;  4YWL A;  5AJ3 Q;  3F2C A;  2ZTD A;  3TS0 A;  3OW2 A;  2YU9 H;  1VQO A;  1E24 A;  1U0L A;  4IPC A;  1C7Y A;  1D7Q A;  4AIM A;  5IT9 c;  1E3P A;  4O0A A;  4TQU S;  2B63 G;  3RLN A;  1VQH A;  2LXK A;  1KIX A;  3PV0 A;  3J81 c;  4DR7 Q;  2YV5 A;  4LF7 L;  3NEM A;  4R1J A;  2HHH L;  4L5S A;  5LMN L;  2IX1 A;  4KHP L;  4K0K Q;  1YHB A;  4DNI A;  1WCM H;  2B3G A;  2KHJ A;  4JG2 A;  1VCI A;  5IY0 A;  4IFD G;  2GVB A;  1TXY A;  3T1H L;  1J5E Q;  1K73 C;  3HOU G;  1C9O A;  3PO3 H;  1W3S A;  2E5L Q;  4P74 A;  1X6O A;  1GD7 A;  1WI5 A;  3M4P A;  4DV3 Q;  3ICE A;  5GAD C;  4R4T A;  2DGY A;  1BVS A;  4A76 A;  4DV5 L;  2ZJP A;  1UE6 A;  2PQA A;  4B3T Q;  5IYC H;  4DR7 L;  3K80 C;  4JC0 A;  1MIU A;  2PQA B;  3E0E A;  3I4N G;  2C35 B;  2JA5 H;  2Y0S E;  4LFB Q;  1WFQ A;  2MO1 A;  3JAM c;  2Z6K A;  2NVX H;  3G71 A;  4YY3 Q;  1B70 B;  3M3Y H;  1V9P A;  1VQG A;  2ZM6 Q;  1PH3 A;  1PH7 A;  3S1R H;  1PYS B;  2JJQ A;  1FJG L;  2L15 A;  4JI2 Q;  2XTI A;  5C0X J;  4LF5 L;  5JJI A;  4JBW A;  1VQ4 A;  1PHJ A;  1Q1E A;  2VNU D;  1K8G A;  4LFB L;  5IYC G;  4JCV E;  1A0I A;  1I3Q H;  3H0G H;  4KLK A;  2JA5 G;  5JJK A;  1K83 H;  5ELN A;  4ME3 A;  5GAH C;  1PYB A;  1UE5 A;  2Z6K C;  1VQ7 A;  1FVI A;  1Y14 B;  2YYZ A;  3LGJ A;  3RZD H;  2WP8 J;  1X9N A;  2K50 A;  4JI1 L;  3KYH C;  1BBU A;  1TWF H;  1CUK A;  2PMZ E;  4JI0 L;  3M7N A;  1GKH A;  1Y1V G;  4MTN A;  4DV4 Q;  1E7Z A;  3AFQ A;  3CCE A;  3I4O A;  1VQC A;  1CSP A;  4DPG A;  4DR1 Q;  4HJ7 A;  3B6Y A;  2VZA A;  1QVC A;  5GQO A;  4JI1 Q;  4HIM A;  1Q82 C;  1Q86 C;  4JBK A;  3L2P A;  1KXL A;  1VQA A;  3KLW A;  2MFI A;  1PH2 A;  1HJP A;  3H3V I;  2JA9 A;  5JJL A;  1XMQ L;  4IJL A;  1PH6 A;  4DK6 C;  1VQN A;  3PUY A;  1L1O B;  4P75 A;  5M5X H;  4DUY Q;  3DLL A;  2UU9 L;  2I5H A;  3J81 j;  4DV1 Q;  4A3B G;  2ALY B;  4DUZ Q;  1WYD A;  4NXN Q;  1TWH H;  4LUZ A;  3PIO A;  1X56 A;  3A5U A;  5FJ8 G;  1YHQ A;  1ASY A;  1N33 Q;  4YCW A;  1E1T A;  1HNZ Q;  4B3M L;  4GKK L;  1FJG Q;  3TRE A;  4LFA Q;  5JEA G;  1U5K A;  4XIG S;  5FLM G;  1Q81 C;  3KF6 A;  3TS2 A;  5C4X H;  2VQF Q;  4OWT B;  4MZ9 A;  2GN5 A;  5FLX c;  5BR8 Q;  1JE5 A;  1XMQ Q;  1KHI A;  4JV5 L;  3UE0 A;  4JOI A;  1X3E A;  2CCZ A;  1OXU A;  4X65 Q;  4X62 L;  4NXM L;  3GTK H;  1N32 Q;  1CKN A;  5M3F G;  3F2D A;  3FHW A;  4QQB X;  4DR2 Q;  4A3I G;  4JI7 L;  4Y52 H;  2E5L L;  1LTL A;  4GN3 B;  4UY8 C;  3PO2 H;  3S2H H;  2VL6 A;  4A3F G;  2R7D A;  5M3M H;  4IFD I;  3FKI H;  3CPF A;  4BBR G;  3HOZ G;  4K0K L;  2UXD Q;  1G51 A;  4J15 A;  2K14 A;  2K5H A;  2ES2 A;  1IBK L;  2K5N A;  2UXC L;  1MJE A;  3T1Y Q;  3HOW H;  2JA7 G;  3S2D H;  1XNR L;  4A3E H;  1IBM Q;  4P73 A;  4AH6 A;  1NMG A;  1HR0 W;  3HOV H;  1HZC A;  4OWX B;  4R4Q A;  3HOX H;  4L5T A;  4L5R C;  4LF5 Q;  5IE8 A;  4JI2 L;  4OWW B;  2N78 A;  1RIP A;  3HKZ E;  2QA4 A;  4BA2 I;  4BY7 H;  1GVP A;  2ZTE A;  2K4K A;  5C3E G;  3I4M H;  2GVA A;  2ZM6 L;  1SN8 A;  3M85 A;  4YY3 L;  4A3B H;  3K0X A;  4OX9 Q;  4X64 Q;  2CKZ B;  4A93 H;  5E7N A;  4A3D G;  2VQE L;  4GKJ Q;  4YHH L;  2UXB L;  3RN5 A;  3HOY H;  3GD7 A;  1L0W A;  3M9B A;  1K3R A;  1GO3 E;  2AWO A;  4DV0 Q;  4A3K G;  1EIF A;  3A74 A;  4KHZ A;  1M1K C;  3KOJ A;  1XPO A;  1XPR A;  4OXP A;  5K36 G;  2RHQ B;  3T1H Q;  5IWA Q;  2I5L X;  1J5E L;  4GNX C;  2V1C C;  4PZ8 A;  2BA0 A;  4FDB A;  2VW9 A;  1N36 Q;  4BBS H;  2JA6 H;  2MNA A;  3PCO B;  3GO5 A;  1SMX A;  1L1O C;  1SR3 A;  2KHI A;  3GTL H;  2R93 G;  3MEF A;  1JT8 A;  3CCQ A;  4A3L H;  4IFD J;  1G6P A;  4A4I A;  3CQZ H;  2OTJ A;  4BA1 I;  4QJF A;  3CAM A;  4EX5 A;  5IP7 H;  1VQM A;  1VS0 A;  4Y7N H;  4UP9 A;  4QGU A;  2UUA L;  2OWO A;  5IYB H;  2PI2 A;  3PIP A;  1NJI C;  4JYA L;  2VS1 A;  5LMN W;  1S3O A;  1I6H H;  1EQR A;  4GN5 A;  1LM0 A;  2NZH A;  2AKW B;  5BR8 L;  2E2J H;  4DR4 L;  2ZJQ A;  3S17 H;  3KJP A;  1IXR A;  2WAQ E;  1I94 L;  3BJU A;  1JJG A;  4DKA C;  2VQF L;  1EUJ A;  4B3S L;  4GLX A;  2A8V A;  4JI8 L;  2CQO A;  3K8A A;  4JOI C;  2CFM A;  1WJJ A;  4LFC L;  3ULL A;  4DR4 Q;  4LFA L;  1LYL A;  3W1G A;  4HID A;  2F4V L;  4JYA Q;  1MKH A;  4O2D A;  2KCM A;  4POF A;  4JI6 Q;  1JJ2 A;  1NMF A;  4BY7 G;  5LMU Q;  3DM3 A;  4MNO A;  4YWK A;  3CCU A;  4YCU A;  1PH8 A;  1NBW A;  3CCL A;  3A0J A;  4YWM A;  4HIK A;  2EIF A;  4HJ5 A;  3J81 i;  1KD1 C;  1OXT A;  3PO3 G;  2Q2I A;  4LF8 Q;  1IBK Q;  1Q8K A;  3G6E A;  1M90 C;  1E1O A;  1Q46 A;  2K75 A;  4IJH A;  3CD6 A;  3TQY A;  1VQ9 A;  2R7F A;  3CCR A;  1L2F A;  1IYJ B;  4RMF A;  1NY4 A;  2JEB I;  3GTG H;  4A3L G;  4C3J H;  2JA8 G;  1XMO Q;  3RLF A;  3I56 A;  2NZO A;  1PFS A;  4JV5 Q;  3M4Q A;  1SFO H;  4GNX A;  3K81 C;  1YIT A;  1X55 A;  1JJC B;  3CCV A;  4A3F H;  5C44 G;  1X3F A;  1JMC A;  4X64 L;  1EQQ A;  2RHS B;  3UDX A;  4QIW E;  3GTJ H;  4A3C G;  3BU2 A;  4GS3 A;  2IX0 A;  1YJ9 A;  4ALP A;  1V1Q A;  2JE6 I;  5ELO A;  4AYB G;  3L7Z C;  1PH9 A;  3NEN A;  5IYB G;  2K5V A;  2MO0 A;  3Q8D A;  2VUM H;  1YEZ A;  4OO1 I;  1I5F A;  4A3J H;  1E22 A;  3KF8 B;  2UUB Q;  3PF5 A;  1A63 A;  1B7Y B;  1FGU A;  1DGS A;  4X6A H;  4DK3 C;  2UU9 Q;  3J7A 5;  4IPG A;  1BBW A;  2OTL A;  1J6Q A;  2OCE A;  2YTY A;  5IP9 H;  1QVG A;  1QVF A;  1X54 A;  3RR5 A;  4AYB E;  2NVQ H;  4DR5 Q;  2UXD L;  4LUV A;  3F2B A;  1HZA A;  2E8G A;  1N36 L;  4BXX H;  4DV5 Q;  3HKS A;  4A3C H;  2JA8 H;  3S1N H;  3I55 A;  2D0P A;  4DV3 L;  4IOA A;  2WFW A;  3J7Z C;  2E2H H;  5J3B A;  5M5W H;  3VDY A;  5C0X G;  4A3K H;  4JI0 Q;  1ASZ A;  1Q12 A;  3CC2 A;  2WAQ G;  1N32 L;  4IPH A;  4A3G H;  4DR5 L;  1YJN A;  5HY6 A;  3AYH B;  1XJV A;  1HNW Q;  1VQB A;  1S72 A;  2R7Z G;  1CKO A;  1VQD A;  3G4S A;  2VQE Q;  5IP9 G;  4LF9 L;  2UXB Q;  2Q2T A;  1EYG A;  4JI4 L;  3UDF A;  3ERS X;  4A3E G;  2YTV A;  4GN4 B;  1OXV A;  5FLM H;  5C4J H;  2OQK A;  1WCM G;  4NPS A;  1N34 L;  1HNX L;  1IBL Q;  1D8L A;  1Z47 A;  4LF6 L;  3H3V H;  3A5Z B;  1HNZ L;  4LF7 Q;  3MXN B;  2K52 A;  2NVY H;  3U4V A;  1UWV A;  2CWP A;  3AEV A;  1TWC H;  3D0F A;  4BBS G;  4IPD A;  3CF5 A;  3AQQ A;  1XNR Q;  4DV1 L;  4JI4 Q;  4JBJ A;  3G48 A;  4DUY L;  1EOV A;  2QGQ A;  4DR3 L;  4L5Q A;  3S16 H;  3CCJ A;  4LF9 Q;  4A3J G;  3PO2 G;  2UXC Q;  2ASB A;  2XGT A;  1HNW L;  3S1Q H;  4B3T L;  1AE2 A;  5GAG C;  4HJA A;  1XPU A;  2PI2 E;  5GAE C;  2NN6 I;  3E9H A;  2A19 A;  5C0X I;  3RLO A;  3J80 i;  2D62 A;  4PMW A;  3CCS A;  2EQS A;  3NEL A;  4DV4 L;  2Q2H A;  3F1Z A;  4KI0 A;  3ULJ A;  4JI7 Q;  4BXX G;  3GTP H;  1Q7Y C;  1OTC A;  1O7I A;  2ZTC A;  4X62 Q;  1Z9F A;  2R93 H;  4HJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...