4IJLA

Fragment-based discovery of protein-protein interaction inhibitors of replication protein a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
SHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of Protein-Protein Interaction Inhibitors of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ijlA00
2UUAQ 4DR7Q 5JJLA 4DK6C 1BKBA 3Q8DA 1D7QA 5EAYA 4X64Q 2I5HA 2RCNA 3J80i 3ULJA 1VQJA 3W1GA 5GAGC 5AJ3L 4A3EG 1KQSA 2VUMG 4KHPL 1JT8A 1X55A 2VL6A 1A8VA 4DR3Q 1LUZA 1SROA 4PZ8A 1ASZA 2EIFA 4RG1A 3CCRA 4OO1G 3U4VA 4A93G 1VQIA 5AJ3Q 4JYAL 3J7A5 5IYCG 3KOJA 2WB1G 4OX9L 1WCMH 5IYDG 3RN5A 4DR6L 4OWWB 3BZCA 5C0XI 1PH7A 3AQQA 4NXML 2A8VA 1VQ7A 4XTCS 3PIOA 4UPAA 1Z47A 4YCUA 4A3KG 1L1OA 4JI2L 2BH2A 4QQBX 1VQOA 3OTOL 1VQ5A 2BA1A 4LFCL 3HOWG 4JYAQ 5IP7G 2Q2IA 3DM3A 2OTLA 4OX9Q 5M5WH 4DR6Q 4NXMQ 3GTPH 1Y1VH 2JA7H 1MJCA 1L1OB 1VQMA 2JA6H 1AH9A 1H95A 5IY0A 4C3JH 1PH5A 4LW1A 4JI2Q 2GVBA 4LFBL 3KF6A 3OTOQ 3GTJH 4KLKA 4C3HH 4LFCQ 1L1OC 2ZTEA 4YY3L 5C3EG 2K5VA 4A3EH 2YU9H 2VUMH 3TREA 1YIJA 3JAMc 2NZOA 1EQRA 4LUZA 5C4JH 1Y14B 4WJ4A 1NBWA 1A63A 3KF6B 3RLOA 1XMOL 1I5FA 1G6PA 3PGZA 5C4XG 2WAQE 1OXXK 1FL0A 1TWFH 2D62A 2MNAA 2E2HH 4A93H 3S2DH 5IT9c 2KENA 4YY3Q 3T1HL 2Q2HA 1KL9A 4IFDJ 5IYCH 5IYDH 2KCMA 1FGUA 4JBKA 5JJIA 3TEHB 3S15H 1WI5A 1JJGA 1XMOQ 4HJ7A 2IT1A 3KDFA 1ASYA 5FJ8G 1NJIC 3CCUA 2VW9A 4A3KH 4LFBQ 3PO2G 1XPRA 1QVCA 3T1HQ 1NMGA 2K75A 1E3PA 3HOWH 3L2PA 5IP7H 5M3FG 2D0OA 1N33L 4B3ML 4DAMA 1UEBA 3ICEA 4BA1I 5GAHC 2MO0A 1EYGA 2VZAA 3KDFB 1MJEA 3GTLH 1X9NA 4DV0L 3CP0A 4OWXB 4TVAB 3AFPA 3S1QH 4QGUA 2HIXA 1HH2P 2D0PA 1KC8C 5C3EH 1K73C 4PMWA 4X62L 1RL2A 4MZ9A 4B3MQ 1N33Q 3GTGH 2KHIA 4PG3A 5M3MG 5BR8L 4UP7A 1E1TA 4DV0Q 4GLXA 3U58A 3PIPA 1FVIA 4DK3C 2PQAA 1VQHA 4QIWE 1E7ZA 5C44G 5C4XH 1XPUA 2XTIA 1MKHA 4LF5L 3PUXA 3AEVA 4X62Q 3K7UC 1LTLA 1D8LA 1JE5A 1V9PA 3M4PA 5BR8Q 2PQAB 1YJ9A 4GN3B 3CMEA 1GM5A 2UXBL 3H0GG 5FJ8H 4BY1H 4A3GH 3PO2H 2NN6G 4DR5L 1N8RC 4LF5Q 1Q7YC 2YTXA 1YEZA 2IHEA 2LXKA 5M3FH 1PH6A 4J15A 4A4IA 1EWIA 1IBML 1VQ9A 1PH8A 4LUVA 2H5XA 4LUOA 3PV0A 3GO5A 2VQFL 2CCZA 2UXBQ 1EQQA 1I94L 1YNXA 1Q1EA 2NZHA 4GOPA 1O7IA 5C0XJ 3CC7A 2Z0SA 4DR5Q 2F3IA 4A3IH 1PFSA 2JQOA 1IBMQ 1TWGH 3ZJYC 2E5LL 3GTKH 1XTDA 2CWPA 2VY3A 1NE3A 2VQFQ 4QL5A 4GOPB 1I94Q 1W2BA 1N34L 4R4TA 3J81i 1LM0A 4UY8C 4LWCA 2K50A 1T9HA 4HJAA 4GOPC 1JJCB 1Q12A 3EBEA 4DV1L 3CXCA 1K9MC 4GKKL 2UUCL 2E5LQ 1XNRL 3ULPA 5LMUL 1Q86C 3GTOH 1WOCA 2K4KA 1N34Q 3E9IA 1VCIA 1KD1C 1UE7A 3H0GH 1K8AC 1Q8KA 5JEAJ 1HZAA 2DUDA 3CCSA 4DV1Q 2NVXH 1JJ2A 2L15A 4PZ6A 5GQOA 2UUCQ 4GKKQ 1XNRQ 1M90C 1HR0L 2N78A 3F1ZA 4C3IH 5LMUQ 3M7NA 1GD7A 4KHZA 1OTCA 1PH3A 2IY5B 3UDIA 3IRBA 3BZKA 1B70B 4JC0A 3MXNB 1SFOH 1HNXL 3I4MG 1R9TH 3H3VH 1TWHH 3J80c 1VQ8A 1TWAH 1HR0Q 3A5ZB 2EQSA 3K81C 1CSQA 3CW2C 3SGIA 2AMCB 3ERSX 4HIMA 2IX1A 3A5UA 1HNXQ 1PV4A 3S16H 4NB3A 2ES2A 2V1CC 5IWAL 3CC2A 4OO1I 1HZ9A 1SLJA 2JEBI 1P16A 2WAQG 4JCVE 1M1KC 4GLAC 2AKWB 4DV4L 1WFQA 2NVQH 2B29A 4JBJA 2OWOA 2KHJA 1N36L 3S1RH 1PYBA 4A3FG 3STBD 1YVCA 4EX5A 4P71A 2K5HA 1WJJA 1NY4A 5ELNA 1E24A 5IWAQ 1UE1A 4IJLA 1XJVA 2JA8G 4BBSH 4DV4Q 2Q2TA 1VQDA 1YHQA 4K0KL 1N36Q 1V43A 4JG2A 4PZ7A 4QJFA 2C35B 1X6OA 2B63G 3K7AH 4HIOA 3RNUA 1X3GA 3GTQH 2R6GA 4DV6L 4DR2L 1XPOA 3I4MH 3EIVA 2A1AA 3CAMA 1LYLA 2N49A 3FP9A 3UDXA 4BY1G 1L0WA 4DUYL 2ASBA 4A3GG 3K80C 1L2FA 3ER0A 4HJ8A 4B3TL 4K0KQ 4DV2L 3HOVG 1G291 4IPHA 5H1SE 4DV7L 1U5KA 4O0AA 4DV6Q 4DR2Q 2ID0A 4C2MH 1EIYB 2AWOA 4DUYQ 2PMZE 4DNIA 4B3TQ 2GVAA 2CFMA 4UP9A 2ZTCA 4DV2Q 4A3IG 1K8GA 1BVSA 4A3FH 1AE2A 3I4OA 4UP8A 1CSPA 2ZJRA 4DV7Q 1XNQL 1X3FA 4AYBE 3UDGA 1HNZL 3PUWA 3CQZH 4YWLA 4JI7L 4BA2I 2JA9A 5DLQE 2VNUD 2MO1A 5GAEC 1X56A 3I56A 2JA8H 1HZBA 4B3SL 4X6AH 1HR0W 4IFDG 1MIUA 2R7FA 1S3OA 5LMNW 1PVOA 1HJPA 2YTYA 1IBLL 1XNQQ 1E1OA 1HZCA 2Y0SE 4OXPA 3G6EA 1W3SA 1HNZQ 3CCLA 4JI7Q 2B63H 2HT1A 1GKHA 1PYSB 4A3MG 3VDYA 2R7DA 1PHJA 4BY7G 1JMCA 1U0LA 1SE8A 3M4QA 4OWTB 4B3SQ 4BBRG 1Y1WG 5GADC 3BJUA 4AQYL 5ELOA 3AFQA 3HKSA 3AYHB 1Q1BA 3KJOA 1FJGL 3HOVH 1G51A 4JI0L 1IBLQ 1IBKL 1IYJB 1VQNA 2YV5A 3F2BA 3M3YH 5M5XH 1Q82C 4JI1L 1PH2A 3CCEA 2FXQA 3M9BA 4YCVA 4AQYQ 4P72A 4LF7L 1I50H 1K83H 1S40A 1FJGQ 4A3JG 1SN8A 1VQ6A 1YHBA 4JI0Q 2K14A 3CD6A 4P74A 1IBKQ 3S17H 2OQ0A 1VQLA 3CPFA 4POFA 4JV5L 1IL2A 4JI1Q 4ME3A 3U50C 3GTMH 1KRSA 2WFWA 3K8AA 1YI2A 1EUJA 4JBMA 1I6HH 3GDEA 2JEAI 4LF7Q 2UUBL 2ZJQA 4A3LG 1X54A 1CKNA 2ALYB 2PNHA 3HOUH 4TQUS 1JB7A 3HFZB 3UE0A 3PO3G 1CKOA 3STBC 1I3QH 1UE5A 4JV5Q 2OTJA 3FHWA 3F2DA 1Z9FA 2CKZB 3I7FA 4A3MH 4IOAA 2PI2E 1VQEA 4BY7H 4FDBA 1CKNB 4A3DG 3UE1A 4IJHA 1N9WA 3B6YA 3PSIA 2UUBQ 2R7ZH 4DUZL 4BBRH 1Y1WH 4DAYB 2B3GA 5FLXc 2R92H 4LF9L 4HIKA 4ALPA 3EN2A 3NEMA 4A3CG 4L5QA 1PH1A 3PF4A 4BBSG 1HNWL 1WYDA 1TWCH 1V1QA 1J6QA 3K0XA 3RR5A 2Q2UA 1QUQA 3CCVA 4GS3A 3RZDH 5LMNL 2I5MX 1A0IA 2BH8A 1DGSA 2VQEQ 4R4QA 3TRZA 1S72A 4DUZQ 2IX0A 5C0XG 3NELA 3CCMA 4L5RC 4YHHL 1QVFA 4R4CA 4LF9Q 3F2CA 1QZGA 4XIGS 3G71A 4A3JH 1YHAA 4LF8L 1HNWQ 4DV5L 1QUQB 2I5LX 4JI8L 3KJPA 3T1YL 2LXJA 1OXSC 2E2IH 3HOXG 1EFWA 5LMNQ 3PUZA 4JI4L 3W1BA 2HHHL 1J5EL 3DLLA 4YHHQ 4A3LH 5IP9G 3CMAA 4JOIA 4LF8Q 3TS0A 2RF4A 3HOYG 3JC66 2DGYA 4DV5Q 4MNOA 1SMXA 3BU2A 3WWVA 4HIDA 4JI8Q 3PO3H 3T1YQ 3PF5A 4KHPQ 1NMFA 2JA5G 2UXDL 1YITA 1VQ4A 4JI5L 4JI4Q 4DV3L 1VQPA 3CF5A 1OXUA 1VQFA 2BA0A 1J5EQ 2HHHQ 4A3DH 4A75A 3HOZH 3S1NH 4AH6A 3D31A 3JAMi 5JEAG 4KI0A 4AIMA 4A3CH 4JOIC 4EQ5A 3J81j 4IO9A 5IYBH 1PH9A 2UXDQ 1KAWA 1YZ6A 4JI5Q 1GVPA 4DV3Q 3TS2A 2WB1E 3A0JA 3L0OA 1UWVA 1X65A 5GROA 1N32L 2NVTH 1VQBA 4OONA 4JI6L 2VS1A 2K52A 2CQOA 1GO3E 2AWNA 3CPWA 1OXVA 2I0QA 3HOXH 1IXRA 1VS0A 4A3BG 5HGQA 2OCEA 4DR4L 2YYZA 4AYBG 1EIFA 1N32Q 5IP9H 4GN5A 4JI6Q 4NXNL 2RHQB 2QEXA 4O2DA 3HOYH 2NVYH 1SRUA 2OQKA 2UU9L 3S14H 4LFAL 4Y52H 1CKMA 1BBWA 2JK8A 2HIVA 2MFIA 1RIPA 1XMQL 2JA5H 4BXXG 5J3BA 4DR4Q 2Y0SG 4L5TA 1C0AA 4B3RL 2XGTA 4P75A 4POGA 2ZTDA 2UXCL 5FLMG 2N3SA 4QY7A 4X66L 1UE6A 1YJNA 2CWAA 3U4ZA 4LF6L 3RN2A 2UU9Q 4NXNQ 2KBNA 4LFAQ 1PH4A 3S24A 1B7YB 2LSSA 2E2JH 3A74A 3UDFA 4DPGA 2EXDA 2KCTA 2ZJPA 1XMQQ 1OXTA 4GN4B 2MQHA 3HOUG 2HQLA 1VQCA 1VQAA 3I55A 3PCOB 4L5SA 2IHFA 4B3RQ 2A19A 2UXCQ 4DKAC 4X66Q 4Y7NH 3D0FA 4LF6Q 1QVGA 2ATWA 2JJQA 2R7ZG 1E22A 3I2ZA 4P73A 1YBYA 4JBWA 4R4IA 1Q81C 2R92G 4MTNA 4GNXA 4YCWA 4A3BH 3I4NH 1P8LA 2F52A 3CC4A 1C9OA 3GD7A 3M4OH 4YWMA 4GKJL 3NBHB 4IPGA 1TXYA 1SR3A 2WP8J 1YJWA 3FKIG 4NPSA 4LNQA 3RZOH 2R93G 4GNXB 4IFDI 3HKZG 2ZM6L 4BXXH 1KXLA 3OYYA 1AE3A 3I4NG 2N8NA 4IPCA 4GNXC 4GKJQ 2E8GA 2QGQA 1CUKA 5FLMH 1K3RA 3PUYA 4IOCA 3OW2A 4APVA 3CCJA 4IPDA 4R4OA 3W5OA 1QZHA 1VQKA 3E0EA 1KIXA 2K5NA 4X65L 3M85A 4WJ3M 3H15A 2YTVA 4A76A 2NN6I 3KF8B 1Q46A 2ZM6Q 2F4VL 4YWKA 4LF4L 3NENA 3HKZE 4R1JA 1K0RA 4GLVB 2JE6I 1NTGA 1B8AA 4RMFA 3G4SA 2QA4A 5M5YH 1EOVA 3MEFA 3E9HA 5HY6A 1WCMG 3RLFA 4HJ9A 3L7ZC 1C7YA 5IE8A 2Z6KA 3LGJA 4X65Q 1KHIA 3RLNA 2VQEL 4JI3L 4HJ5A 4DR1L 3HOZG 1IZ6A 1KRTA 2F4VQ 1BBUA 2RHSB 3H3VI 4LF4Q 4H02A 2UUAL 4DR7L 2AHOB 5JJKA 1X3EA 3ULLA 3J7ZC 3F8TA 3KFUA 5IYBG 5M3MH 4X64L 3TQYA 3KYHC 3S1MH 3J81c 5K36G 2PI2A 5E7NA 3S2HH 3CCQA 4DR1Q 5C44H 3PUVA 3FKIH 2GN5A 4JI3Q 2R93H 4DR3L 1Y1VG 1A62A 1PA6A 3KLWA 2JA7G 2JA6G 1VQGA 2Z6KC 3G48A
chains in the Genus database with same CATH superfamily
2UUAQ 4DK6C 3NQIA 3Q8DA 2EVBA 1WTQA 1D7QA 4C3HG 4X64Q 3J7AF 2RCNA 4KHPL 1VQJA 1JT8A 4HR7B 4MIUA 1ZEQX 2VL6A 1CT1D 1EOTA 1JB3A 4A93G 4DR6L 3HOZB 1PH7A 4NXML 1UAPA 1VQ7A 2Z1CA 2A8VA 4A3KG 4JI2L 2RSNA 4ZKBB 1B1ZA 4OX9Q 2EOTA 2M00A 5M5WH 3GTPH 4EQPA 1A2UA 1SNDA 2B2UC 3KF6A 3GTJH 3J81E 1JR0D 3T51B 1L1OC 4YY3L 3HOXB 3TREA 4WORA 4LUZA 1EQRA 3H6MA 1Y14B 5FO9B 3KF6B 1XMOL 3Q22A 1I5FA 3S14B 1G6PA 3C1EA 3PGZA 2WAQE 3M7GA 1PFBA 3FMCA 3QG1A 3V2TA 4JVZA 1EY6A 3TP6A 5IYCH 2X6GA 2KVMA 5IYDH 3TEHB 3KBXA 1ICFB 5FLXL 5CMDA 1RODA 5FJ8G 3CCUA 1H9RA 1WTRA 1PRTB 5M3FG 5IP7H 1EQTA 4K5VA 4BA1I 2MO0A 3GTLH 5IGDA 1MJEA 4DV0L 2PMZB 1G2TA 3SDZA 2D0PA 1WTHA 1KC8C 1K73C 4PMWA 4IUTA 4B3MQ 4A3BB 4ODGA 2B2VA 3NTKA 4K6LA 4PG3A 5M3MG 3U58A 3PIPA 4DK3C 2J0TD 3SK8A 1MKHA 1STGA 1R4QB 4LF5L 1JE5A 3M4PA 4DF7A 5BR8Q 1I4QA 2HD3A 1GM5A 3IAYA 3H0GG 4MTKA 1LTID 3EFXD 1PRTF 3VR6A 4DR5L 1N8RC 1U4RA 2YTXA 4K5XA 2LXKA 2NBFA 1VQ9A 4FNFA 5M5YB 1EQQA 1ICWA 1I94L 5C0XJ 2FHTA 1PFMA 3W3AA 1PFSA 2JQOA 1D5XC 1XTDA 4P2CB 4CJ1B 1W2BA 4R4TA 1Z7TA 1PZID 5C44B 3J81i 1G91A 4ZK9B 3CXCA 2B2WA 2EYJA 2ICEC 3K5MA 1EZ6A 4DNRB 1WOCA 2NB0A 1KD1C 1UE7A 3KLRA 1DOKA 4DK0A 2F0LA 4DV1Q 2L12A 4GKKQ 1JJ2A 4PZ6A 2UUCQ 5FO8B 1EY0A 1M90C 1IYVA 3F1ZA 5LMUQ 1E2WA 1WCMB 3C3LA 2IY5B 2AQ3B 3BZKA 1B70B 1SFOH 1HNXL 2K6AA 1R9TH 1TR5A 2AQ2B 2EJFC 1TWHH 4K8IA 5EBCA 3TSSA 3TZUA 2O5IC 2NZ1D 3HP3A 4XQNA 2EQSA 3S16H 5DEHA 2ES2A 2V1CC 1F9QA 4OO1I 1SLJA 2JEBI 1SE3A 2AKWB 2RCFA 1WFQA 2F0NA 3PQIA 2KHJA 4L8JA 3FVQA 1N36L 2YU9B 2VUMB 4A3FG 4NKLA 4FVMA 1XTCD 4IJLA 2RSOA 1XWEA 5F2DA 2E2HB 1PTOH 3S2DB 1QJOA 4K8JA 5E1FA 4K0KL 1WTXA 2BE5C 4PZ7A 2CW0D 4DGZA 1DOLA 3K7AH 4WRDA 1X3GA 4DNTB 4DV6L 1XPOA 1B9MA 1VDZA 1LYLA 3FP9A 3DXJC 3I4LA 1SDFA 3I72A 1NCVA 4DV2L 4OL7A 1G291 4IPHA 4EVOA 5K5PA 2HDMA 3GV3A 4DR2Q 3BDOA 2KUMA 4C2MH 4DUYQ 4UP9A 2HCCA 1MSHA 3I4OA 1CSPA 3NE5B 4AYBE 1HNZL 3PUWA 2MP1A 4BA2I 3NUCA 4MN3A 1ML0D 3WDNA 2VNUD 1X56A 3I56A 1PZJD 2MPMA 3H91A 4G57A 1MIUA 1S3OA 3BYYB 1HJPA 1IBLL 1HZCA 1SNOA 3G6EA 2B63H 4JI7Q 3WOFA 1FYCA 1PHJA 4BY7G 1PTOD 1JMCA 4BY1B 4A3GB 1U0LA 4OWTB 1D2BA 4KTAA 5GADC 4EQNA 1KDAA 4XT1B 1QB5D 2EDGA 3G6JB 2F03A 1O7YA 1TS2A 4C3IG 2YV5A 3F2BA 2EE1A 3M9BA 3OW7A 5EKKA 5LL6S 1A2TA 4LF7L 1I50H 1S40A 1B9NA 1SN8A 3GTKB 4JV5L 1IL2A 1RJTA 1SNMA 4JI1Q 3SR1A 4JBMA 2WFWA 3K8AA 2ZJQA 1B3AA 4IALA 3STBC 2OTJA 2F0EA 1GHJA 4A3MH 2PI2E 1QG7A 4FDBA 1N9WA 3PSIA 2UUBQ 4DUZL 4BBRH 1Y1WH 4MHEA 2B3GA 2B2YC 1HNWL 2NWGA 1TT2A 2Q2UA 3K0XA 3NP8A 4B9WA 4X3SA 1SYEA 3CCVA 1W6KA 1SJHD 4DA2A 3TRZA 5CV7A 1O7LA 3CHBD 5C0XG 3NELA 3CCMA 2XIWA 1YHAA 4Q0FA 1FNVA 3KJPA 4CKEA 2QKIC 4JI4L 1HTPA 4TKOB 4YHHQ 1BDOA 4JOIA 2K1BA 3TS0A 2RF4A 4LF8Q 3HOYG 4DV5Q 1AW7A 2JA5G 2UXDL 1CHPD 4JI5L 2PZUA 4KY7A 4DV3L 2HHHQ 2BA0A 3HOZH 3D31A 5KYIA 2F4IA 3LWUA 4BBSB 1V8QA 3J81j 5IYBH 4K14A 1PH9A 3PIP3 1I4XA 1YZ6A 2WB1E 3L0OA 3GTQB 1N32L 1RHPA 5D14A 4WFN3 1GO3E 2AWNA 2K28A 4M8AA 4B08A 3HOXH 1EFID 1GXDC 4DR4L 2O5JC 1GJXA 4KJNA 4JI6Q 4NXNL 2WAQB 4Y52H 2OQKA 2EYHA 3S14H 2WINB 3RUZA 4OIKA 1XMQL 2PPBC 4BXXG 3EROA 2Y0SG 5JOBA 2CVRA 1SYCA 1PFNA 4POGA 1STHA 2UXCL 2NTTA 4X66L 1UE6A 5KNBA 5JEAH 1YJNA 4ZUIA 2UU9Q 2JA8B 1RKNA 5A2QL 2KCTA 3HG9A 1OXTA 2XRSD 4GN4B 1VQCA 2JSOA 4RCOA 2GA4B 1YNJD 3I55A 5T1GA 4L5SA 4B3RQ 3OMCA 2WV6D 3D0FA 4C1NI 4LF6Q 2ATWA 2JJQA 3SK4A 2O4XA 5E3FA 4P73A 4R4IA 3K59A 3HOVB 1UNSA 4GNXA 4A3BH 2OF1A 3R93A 2WKDA 4BS9A 3GD7A 3M3YB 1WVLA 4IPGA 2F0QA 2WP8J 4J6HA 4HN7A 2R93G 1K83B 4GNXB 5IGCA 1ET6A 3HKZG 4HSVA 1STBA 3S17B 2N8NA 4DU9A 1CUKA 2ZXRA 1K3RA 5FLMH 1I4HA 2F0IA 4APVA 3CCJA 1C8CA 1LTTD 2K5NA 5EKIA 4A76A 2ZM6Q 4LF4L 1I3QB 1NTGA 3G4SA 1GUNA 2F0WA 5M5YH 3K58A 2Q8TA 3MEFA 3IFTA 5IE8A 5EBDA 1PRTD 2A68C 1BBUA 3H3VI 3A55A 4H02A 2UUAL 5JJKA 1X3EA 4M1UB 3ULLA 2QILA 2IPKD 4CGYB 4X64L 3KYHC 3K5NA 5CV9A 3CCQA 4DR1Q 5C44H 3VA5A 4JI3Q 2Z6KC 3G48A 1NAPA 3R8BA 4DR7Q 4RGNA 1BKBA 1SJED 2EJGC 2I5HA 1XXGA 4KMUC 4CDCC 1LTRD 1Y8PB 3NTIA 4DR3Q 3N52A 3V05A 4PZ8A 1HRJA 2FMMA 4HSPA 4RG1A 1AN8A 1VQIA 3MVVA 1DXMA 5IYCG 1T5EA 4OX9L 4IN3A 1WCMH 5IYDG 3G7LA 4A3DB 4OWWB 1FGBD 1O78A 1U9RA 2K33A 3R2IA 2B2UA 1ET9A 1H9SA 3PIOA 1K8OA 1L0YB 4CDDC 1L1OA 4QQBX 1TS3A 2XRQD 1TQOA 4XXEA 3QWNA 5JVG3 4JYAQ 3OMGA 5IP7G 5K36H 4IUPA 2RDGA 4XYQA 4F87A 4H13C 2JA6B 2NVTB 1MJCA 1L1OB 4O1NA 1VQMA 2D5DA 1HTLD 2GVBA 4RGTA 3TP8A 3OTOQ 1LACA 2SNMA 1QOHA 2YU9H 3KBGA 1MD2D 2VUMH 3JAMc 2F0MA 4ABNA 2K5QA 1B44D 4PMBA 1NBWA 3I90A 2KA7A 1GUSA 4LJZC 2EY2A 4OO1H 2E2HH 3S2DH 5IT9c 4KY5A 1JE4A 1A15A 1KL9A 1TY0A 1ZXTA 4JBKA 5JJIA 1WI5A 3X3MA 1PTOF 4FXDA 1H9MA 1EU4A 2QW7A 4FP5D 1DJRD 1NMGA 3T1HQ 1E3PA 2Z6BA 2D0OA 4B3ML 4KN7C 1UEBA 3ICEA 3MFGA 5E4XA 1EEFD 2VZAA 4F8MA 3CP0A 2MUYA 4R9WA 1F2YA 4PMCA 4QGUA 2HIXA 3HS0C 1N33Q 1EYDA 3NSWA 4NW2A 1LT6D 4DXFA 5BR8L 4GLXA 1FVIA 1XPUA 1LTLA 4G7HC 3OSOA 5CORA 3C2PA 3HZXA 2FMCA 4BY1H 4A3GH 1X3PA 1YEZA 2IHEA 2K5WA 3VYRA 4LUVA 2H5XA 1ESRA 2CHBD 4N9TA 2CCZA 4OHJA 1YNXA 1Q1EA 1AEXA 1ZYRD 1YNNC 5KGUA 3ZJYC 3GTKH 2CWPA 3D4RA 5M3MB 3S1MB 2VQFQ 1RDPD 2PW7A 3SK6A 3FKIB 1LTGD 3DEOA 2F0PA 3U9SA 1V1OA 2K50A 4LWCA 4IFDH 1T9HA 4HJAA 2H1EA 4GOPC 4DV1L 4GKKL 2MGSA 4U68A 2UUCL 2E5LQ 4X3TA 3J7AV 5LMUL 4F7XA 4DN4M 2K4KA 1N34Q 1HPCA 3E9IA 2EYFA 1O7ZA 2NN6H 2DUDA 5JEAJ 4G7ZC 4F88A 3MXNA 3OOCA 5GQOA 1XNRQ 1GHKA 2B39A 2N78A 1HA6A 1OTCA 1A3VA 3IRBA 2LFNA 3MXNB 2IJ0A 2PNRC 4FF2A 1WTVA 1VQ8A 2EY6A 3A5ZB 4Q5VA 2AMCB 5G3LF 2IX1A 3A5UA 1PV4A 1Y1VB 4ZLTF 4C3JB 1SE2A 5CC4A 3AB9A 2B29A 2KJXA 2OWOA 2A6HD 2Q8IB 3MEHA 4A3EB 2VB2X 1PLFA 1YVCA 4EX5A 5BN5A 2K5HA 3H94A 1NY4A 1UE1A 1MSGA 4QUFA 2D9UA 1TWFB 4DV4Q 2Q2TA 4BBSH 1VQDA 1YHQA 4IURA 1GUWA 3ND9A 1Q3LA 3OHXC 2CQAA 5D3DA 2C5CA 2WB1B 4JG2A 1VMPA 2B63G 3GTQH 3S15B 4DR2L 2A1AA 3CAMA 1ONLA 4DUYL 3HOWB 4HJ8A 3GV6A 3VYSA 3J81L 5H1SE 3S9WA 4N9PA 2SEBD 1WTOA 1EIYB 3S1QB 2EPBA 1H9JA 2I07B 1JOOA 4HMJA 2ZTCA 1ENAA 5C3EB 4A3IG 4V0BA 3D3RA 1K8GA 2RDHA 1TS4A 4DV7Q 3DMUA 3D4DA 4JI7L 1RTOA 1BCPC 2JA9A 5C4XB 2MO1A 3T13A 5GAEC 2JA8H 3MC0B 1HR0W 5CBAE 5I6WA 1CZWA 1E1OA 3CRLC 3F2UA 1W3SA 1TKWB 2L5TA 4A3MG 3FEWX 1QE6A 2P5ZX 4B3SQ 1F2ZA 4BBRG 1Y1WG 1Y8NB 3PO2B 5ELOA 3HKSA 3AYHB 3HOVH 1G51A 5ELBA 1VQNA 1CHQD 3M3YH 4R8NA 4JI1L 2A69D 2K7VA 4YCVA 4AQYQ 4P72A 1K83H 2DNEA 1FJGQ 1VQ6A 1CFMA 2EYOA 4JI0Q 2K14A 3S17H 2OQ0A 5L37A 4POFA 1SMYD 2HCIA 1KDBA 2N88A 2UUBL 5KNCA 1X54A 1CKNA 2B2YA 2ALYB 1WD1A 4TQUS 1JB7A 3O13A 4ULLA 1CKOA 1I3QH 1IW7C 5DM73 3QR8A 1CKNB 4IJHA 5FLXc 1RCVD 1HXYD 4BWGB 2NVXB 4HIKA 2F0UA 3EN2A 3NEMA 1HQMC 2EY5A 1QILA 1WYDA 1I6VC 4C3IB 1F9SA 3MAQA 2Z4IA 1WD0A 2VXWA 2L0CA 2IX0A 1X3QA 4YHHL 3DEPA 4R4CA 4LF9Q 2PYKA 1SYDA 3F2CA 3G71A 4LF8L 2ZT9C 4DV5L 4IUVA 4S3SA 3HOXG 5LMNQ 2A5HA 3OPOA 3LWEA 4KKSA 1SSOA 4QUCA 2HHHL 3OWEB 1JCKB 4A3LH 3BU2A 3WWVA 4HIDA 4KHPQ 3PF5A 1D5MC 3S1RB 1A6XA 3CF5A 1OXUA 1J5EQ 4A3DH 1BR9A 3K0YA 2L1BA 3NQTA 5JEAG 4AIMA 4A3CH 1SEBD 3TS2A 1QCBD 1UWVA 1EU3A 3LX0A 3RD4A 2RVLA 3I4MB 2NVTH 4JI6L 2VS1A 2K52A 2CQOA 1S5FD 4DXGA 4CJ0B 4OEMB 1VS0A 4A3BG 1PYWD 1EIFA 5IP9H 4GN5A 1LT5D 1D1IA 4ZKCB 2AQ1B 3J80E 2QEXA 2UU9L 2JK8A 2HIVA 4L5TA 2J4XA 4B3RL 2XWBB 3CQZB 2ZTDA 5FLMG 3U4ZA 4LF6L 4UAIA 2QDLA 2KBNA 2BCOA 4DPGA 2EXDA 3HOUG 1FR3A 2MQHA 5TSSA 5BN4A 1VQAA 3T53B 3PCOB 4KV6A 5I6YA 4NDXA 4DKAC 1KLGD 2R7ZG 1CA5A 3J80L 3I2ZA 1YBYA 1FNWA 4OELB 1Y69U 2R92G 3VR4A 5I2XA 1P8LA 2F52A 3CC4A 1C9OA 2HQEA 4QCLA 2NYZD 4NPSA 3KLSA 3RZOH 3U9OA 1JOKA 4IFDI 2ZM6L 2Y0SB 3KF8A 5EJWA 4KD4A 3GTMB 3W5OA 1XX8A 2KEEA 1QZHA 4CDFC 1MI2A 3EA6A 4WJ3M 5LHY1 4NP5A 1QNKA 2NN6I 1Q46A 3KF8B 4YWKA 2PCFB 1Q90A 4RMFA 2JE6I 1B8AA 2Z4HA 3QJYA 1WCMG 4HJ9A 1XYIA 4DR1L 2Z6KA 3LGJA 4X65Q 2VQEL 4HJ5A 4JI3L 2Z8LA 1CTMA 1KRTA 2RHSB 1BO0A 4DR7L 3J7ZC 1U4MA 3F8TA 2O2LD 5M3MH 3RZDB 3I70A 3TQYA 3S1MH 3E3XA 5K36G 1J9OA 5E7NA 1FD7D 4RGOS 3PUVA 3FKIH 2GN5A 4DR3L 1PA6A 3KLWA 2F0SA 4LMQD 4K2LA 5IGGA 2X6LA 4IQZA 4A3JB 1SYGA 3J80i 5GAGC 2E2IB 2KEDA 2VUMG 4UHVA 1GUOA 5FKAC 1X55A 1A8VA 1PZKD 1LUZA 1ASZA 1GUTA 3PO3B 1BQQT 1IHZA 2OT2A 2TMPA 4OO1G 4LAAA 5AJ3Q 1ILPA 4JYAL 2E74C 1SAPA 4RKBA 5IOCA 1KAAA 1LT3D 3AQQA 1S5ED 3VYTA 1SNCA 1C4QA 4UPAA 1Z47A 2BH2A 4EQOA 3OTOL 1VQ5A 2BA1A 4ZCKA 1EYCA 4KK7A 1Y1VH 3FRPB 1H95A 1AH9A 5IY0A 4C3JH 1EY9A 4KKUA 3VR5A 5DNFA 4LFBL 1VF5C 2Q8RE 4DK1A 4LFCQ 1KNEA 2ZTEA 3TBIB 2K01A 2K05A 4A3EH 4RCNA 2ENBA 1YIJA 5G3LD 2NZOA 2H4OA 5E4WC 3RLOA 2NVYB 4CJ2C 2HDLA 1FL0A 1TWFH 2D62A 2KENA 5IODA 3T1HL 2Q2HA 2KCMA 4FXKC 3P75A 3S15H 3E5SA 1JJGA 2PZWA 3KDFA 1NJIC 2VW9A 5C4HA 1XPRA 2K75A 3HOWH 2LKVA 1N33L 4DAMA 3KDFB 1X9NA 4Y7NB 4ZRZA 4FF1A 4OWXB 4TVAB 2M9VA 3AFPA 1RD9D 3S1QH 4YIJA 1HH2P 5C3EH 4MZ9A 2OEOA 1K3BC 3M4OB 2HUGA 2KHIA 1E1TA 2A73B 5CGKA 2TSSA 2PQAA 3ND8A 4QIWE 2ZXPA 5C4XH 5FOBB 3JAME 3PUXA 3AEVA 4X62Q 3MFYA 1PXUA 3K7UC 1D8LA 1CI3M 3MHBA 1SXTA 2PQAB 1UUPA 2BE5D 1YJ9A 3CMEA 2L9HA 5IT9E 3P7JA 4OIJA 3SHLA 4FYDA 3PO2H 1Y8OB 2NN6G 1Q7YC 2KOLA 4J8QA 4J15A 4A4IA 1EWIA 3ITPA 5CBEE 1PH8A 3SE0A 4RAUC 1B4OA 3PV0A 3GO5A 2VQFL 2UXBQ 1B2TA 3MXPA 4GOPA 1O7IA 5I9OA 2F3IA 3URYA 2A6ED 2XWJB 5J1ZA 3TDQA 1IBMQ 2E5LL 4GZYC 1DCZA 1NR2A 2LMCB 4QL5A 4GOPB 1N34L 3C46A 1SYFA 1LM0A 4H7BA 1J8IA 3MA2B 1KABA 2A6HC 2IL8A 1LT4D 3EBEA 4DAYA 1K9MC 5I2YA 3QIAA 3NXWA 1XNRL 4ZQ3A 3I4NB 2B2TC 3MTSA 1VCIA 1K8AC 4O42A 5CYUA 1Q8KA 3J7YW 3NBIA 2RQXA 2NVXH 4L6TB 3NWSA 5IGEA 4C3IH 1ILQA 3M7NA 1GD7A 4X3UA 4KHZA 1LO5D 5KEEA 1DYQA 2PQEA 3DHQA 4JC0A 5KRUA 4PQXA 1EYAA 2XN9C 1HR0Q 1DONA 4L63B 3CW2C 3HGBA 2Z9HA 1A3UA 3BS1A 4HIMA 1MHWC 2JA7B 1H9SB 2RBMA 2JN4A 2DNCA 3NWTA 5HURA 1HZ9A 2WAQG 3A8KE 1M1KC 4GLAC 4DV4L 4C3HB 4JBJA 3BDCA 3P20A 3S1RH 1PYBA 3STBD 5C4JB 1WJJA 5DAUA 5IWAQ 4FF4A 1KTKA 1XJVA 2JA8G 4I7ZC 4A93B 3ONAB 2NUCA 1HQRD 1TY2A 3L3OC 4KKTA 4QJFA 1SYBA 1X6OA 4HIOA 3I4MH 2N49A 5CR3A 3UDXA 3OWFA 4A3KB 1L0WA 3K80C 1JC7A 3HOVG 3LNNA 2ZXOA 4R8IA 4DV7L 4QMGA 2ID0A 4N8X1 2AWOA 1KNAA 4DNIA 4B3TQ 2GVAA 2CFMA 5C3XA 3GTGB 1BCPB 1LLRD 4UP8A 2XVSA 3UDGA 4YWLA 3CQZH 3T4AC 4DFAA 5DLQE 1HZBA 4B3SL 1G2SA 5IIFA 2L4NA 2F0HA 3A8IE 1PVOA 1XNQQ 1G8ZD 2Y0SE 4OXPA 2SDFA 2HT1A 1PYSB 3E6ZX 1SE8A 3M4QA 1JWSD 2MJ8A 4AQYL 5EKLA 1Q1BA 5M3FB 1FJGL 4DAPA 4JI0L 1LV9A 1NSNS 1RTNA 1Q82C 1PH2A 2FXQA 2F0FA 5EQ0A 3PMFA 4HTHA 4A3IB 1EY4A 5KIXA 2F0KA 4FXGC 1YHBA 1TWGB 3CD6A 1IBKQ 4XT3B 2CH4W 2K04A 4HMIA 4ME3A 3U50C 3GTMH 1KRSA 2M2LA 3GDEA 4A3LG 2DN8A 2I46A 2IX3A 2EYLA 2BDOA 2A74C 3HFZB 2BDNA 1K0SA 1UE5A 4PV1C 5C3WA 3CKIB 3FHWA 3GTOB 4G7OC 1Z9FA 3I7FA 2PO4A 4IUUA 4IOAA 3H0GB 4A3DG 3UE1A 2E76C 3UI2A 4UDUC 2PW5A 2KCCA 4LF9L 4ALPA 4A3CG 4L5QA 3PF4A 2CW0C 1V1QA 4V190 1J6QA 3RR5A 3RZDH 5LMNL 1A0IA 1DGSA 4R4QA 3FDTA 3EQLC 4NMZA 1AZQA 4L5RC 1QZGA 4A3JH 1K8MA 1TWAB 5HGTA 1T5XD 3OIPA 3H3VC 1OXSC 2E2IH 1EFWA 3PUZA 3W1BA 1J5EL 4WJWA 5IP9G 3CMAA 3I73A 1RF2D 3JC66 3PO3H 4MNOA 1SMXA 4JI8Q 2NVQB 3T1YQ 1HFNA 1NMFA 1YITA 5NUCA 1VQ4A 2J7ZA 1H9KA 4A75A 1KDCA 1KLUD 1SE4A 2L11A 4AH6A 2EZVA 1R4PB 1DOMA 4KI0A 3D4WA 3R3OA 4EQ5A 3SVMA 2A68D 1KAWA 1X32A 3TN2A 3T56B 4EGVA 3SXHA 3D8GA 1GVPA 1PTOC 5FLXE 5EGTA 1X65A 3L9AX 2FJ2A 2L55A 1NR4A 1OXVA 2DJFC 3IKJA 3TP7A 1IXRA 5FO7B 4AYBG 1BUVT 5C4ZA 2RHQB 3EJIA 2NVYH 1CKMA 1BBWA 2MFIA 5C6AA 1DZ1A 2SOBA 4A3FB 4XQJA 3VR2A 1M4VA 4E6IA 2N3SA 2R3ZA 1V1PA 1TVXA 3RN2A 4LFAQ 1B7YB 2LSSA 3A74A 3I8ZA 3UDFA 2HQLA 2QCPX 1V1PB 2IHFA 1GOZA 2A19A 2JYOA 1EQVA 3FPPA 3HRZC 4HCSA 4Y7NH 1QVGA 3SK5A 2XSCA 5J22A 3KLSX 1Q81C 4JBWA 1STAA 1I4RA 1K28A 1VF7A 3M4OH 5M5XB 4QIWB 4IUNA 1YJWA 4RA8A 3FKIG 3AMUA 4FO2A 4LNQA 4OGQC 4I65A 5J39A 3OYYA 3K6OA 1AE3A 4IPCA 3AU7A 4GKJQ 2E8GA 2QGQA 3PIO3 3OW2A 3PUYA 1JICA 1I6HB 4ZAIA 1VQKA 3E0EA 1KIXA 4X65L 3E0JA 3VR3A 3HOUB 2YTVA 4TRDA 3NENA 1K0RA 4TSSA 3RLFA 3E9HA 4BY7B 1D6EC 2V4DA 3L7ZC 2R7ZB 1KHIA 4QB4A 3HOZG 5ELFA 1IZ6A 1SNPA 3FPUB 2F4VQ 2R92B 2AHOB 4HCEA 4RKLA 2QF7A 2F0JA 1TWCB 3KFUA 5IGFA 4ID6A 5IYBG 4KN4C 3D6WA 3J81c 2JXMB 1Q8IA 1A62A 1Y1VG 1VQGA 4KHVA 4C3JG 5JJLA 2WKCA 4XYOA 2F0GA 5ELDA 1ENCA 5EAYA 3I4NH 3ULJA 3W1GA 5AJ3L 1KQSA 4A3EG 3BVMA 2QEJC 1Z6HA 2F0DA 3VYUA 2IW3A 1SROA 2EIFA 1MGSA 3GP7A 3CCRA 4K5WA 3U4VA 3K57A 1A3TA 4LK1C 3DWPA 3J7A5 1EZ8A 3KOJA 3KUPA 2K03A 2WB1G 3RN5A 3NHHA 3BZCA 3S1NB 5C0XI 4XTCS 4YCUA 1YNJC 1VQOA 3HOWG 4LFCL 3TZDA 1YNND 4CKCA 2Q2IA 3DM3A 2OTLA 3QOJA 4DR6Q 2AUJD 4NXMQ 2JA7H 3A8JE 1TS5A 2JA6H 1PH5A 1LTSD 5KNDA 4LW1A 4JI2Q 3MXUA 1EY8A 4KLKA 4C3HH 5C3EG 2K5VA 3A54A 5C4JH 4WJ4A 1A63A 4JPBW 5EPKA 3HOYB 2F3WA 2WIIB 3R2TA 5C4XG 1OXXK 2MNAA 4A93H 2JA5B 4IFDJ 4YY3Q 4C56C 1I4PA 1LABA 2BOSA 1FGUA 1HUMA 2F3VA 4IZ8A 1XMOQ 4Z9CB 4HJ7A 2IT1A 1ASYA 1JWMD 4A3KH 2E2JB 3PO2G 1W6JA 3QB3A 1QVCA 3Q6SA 3A56A 3L2PA 2RKSA 1BNZA 5GAHC 1EYGA 1PRTC 1JQYD 2A6EC 3QO2A 1HA5A 3GTGH 4X62L 2XNAC 1RL2A 5T1IA 4ME5A 3Q23A 4UP7A 4DV0Q 1UEAB 1VQHA 1E7ZA 2G9DA 5C44G 2XTIA 5I9PA 1OO9B 4HEDA 1EY7A 1V9PA 1D5ZC 4B9XA 1IYUA 2B2VC 4GN3B 1M8AA 2UXBL 1U4PA 5FJ8H 1U4LA 3H3VH 2LY7A 1CZGA 4LF5Q 5M3FH 1PH6A 1F2LA 2SNSA 3VA7A 1IBML 1JORA 1AP0A 3BZDB 4LUOA 3X3NA 3MZ5A 1HUNA 2NZHA 2OXPA 3CC7A 2Z0SA 4DR5Q 4A3IH 3V96A 2B2TA 1TWGH 2VY3A 1NE3A 5CV6A 3DM1A 5IGBA 1I94Q 3S2HB 2EYPA 1E0BA 2R93B 1CK1A 4UY8C 1I4GA 4I7AA 1BCPD 3HKZB 4CDEC 1JJCB 1Q12A 5LL6X 2F0TA 5JPNC 2EJMA 2QDBA 3ULPA 3GTOH 1STYA 1Q86C 4XQQA 2IWHA 2PZTA 5AFWA 3H0GH 2DJGC 2F0OA 2RDFA 1HZAA 3CCSA 2L15A 1HR0L 1HCZA 2B2WC 4X3KA 5D65A 5KYLA 1PH3A 3DWQA 3I4MG 3DWAA 5D3IB 3J80c 1TWAH 1PMRA 4K2KA 3A7LA 3K81C 1IKLA 1CSQA 5M5WB 3SGIA 1L0XB 3ERSX 4RHRA 3GTPB 1HNXQ 4NB3A 1F9PA 5IWAL 3CC2A 5CV4A 4JCVE 4RWSC 1P16A 5EPJA 3TP5A 3GTJB 5CV5A 2NVQH 1SNQA 1F77A 2FINB 3CU7A 1IKMA 1IW7D 4P71A 5ELNA 1E24A 1FNUA 5DM63 4KJOA 1CA6A 3BVZA 2B8GA 4CHTB 3P1HA 3H09A 1N36Q 1V43A 2C35B 3RNUA 5ELEA 2R6GA 5A2QE 1DM0B 1AFPA 1MBYA 3EIVA 4RHSA 1G6ZA 4BY1G 4A3GG 2ASBA 1EWCA 1L2FA 3ER0A 3NTHA 4B3TL 4K0KQ 2VB3X 1BXTA 3GTLB 1ZYRC 1D1KA 1U5KA 4O0AA 5FK9C 4DV6Q 3MXGA 1AZPA 3IFDA 2PMZE 1E2ZA 4DV2Q 4FF3A 1BVSA 4A3FH 1AE2A 3K5LA 2ZJRA 1EEID 1O80A 1XNQL 1X3FA 5M9OA 1E2VA 1PDQA 1S5BD 5JVH3 1S5DD 3K5OA 4X6AH 4HAEA 3M4YA 1CQVA 4KY6A 2R7FA 4IFDG 5LMNW 2FFKB 2YTYA 1ESFA 3CCLA 1HNZQ 1GKHA 5C5MA 3VDYA 2R7DA 5BN3A 2DY8A 3ERQA 3BJUA 4J1MA 3AFQA 3KJOA 3GQBA 4RGMA 4IUQA 4RFBA 1IBLQ 1IBKL 1IYJB 5M5XH 2DY7A 3CCEA 4ILWA 4CBVA 1S4ZA 4A3JG 1VMCA 4P74A 2D2CC 3IL8A 1VQLA 3CPFA 1TU2B 3JAML 1HHVA 1LTAD 1YI2A 2EY1A 1I6HH 1EUJA 3W2DA 2JEAI 2G9HD 4LF7Q 3HOUH 1S5CD 2PNHA 3UE0A 1EWHA 3D6CA 5IT9L 4JW0A 3PO3G 1BF4A 2F1MA 4JV5Q 3F2DA 1EIHA 1F9RA 2CKZB 2ICIA 1WTWA 4BY7H 1VQEA 3B6YA 2R7ZH 4DAYB 3BYTB 2AUKA 2R92H 2KECA 4RH6A 1BBXC 1PH1A 4BBSG 1TWCH 4K6DA 4QF4A 1QUQA 4GS3A 2I5MX 2BH8A 2VQEQ 3RMHA 1S72A 1SFOB 4DUZQ 1QVFA 2LS01 1C48A 1R9TB 1TWHB 4XIGS 3Q24A 3WOEA 2EYMA 1HNWQ 1QUQB 2I5LX 3NK9A 4JI8L 3T1YL 2LXJA 2CH4A 2N55A 1DD2A 5ELCA 1WTPA 3S16B 3DLLA 5JPMC 1STNA 2DGYA 3NPPA 4DAVA 3TMEA 1LTBD 1II3A 4KD3A 4JI4Q 1VQPA 1VQFA 3S1NH 1JOQA 3JAMi 1PTOB 2WACA 4JOIC 4IO9A 1EIGA 3A7AB 2UXDQ 2KHSA 2JP1A 4JI5Q 4DV3Q 5CV8A 3A0JA 1F2MA 3K7AB 1NUCA 5JAVA 3SEBA 2E75C 5GROA 5C0XH 1B50A 1VQBA 4OONA 3MWYW 3CPWA 4U673 5I4DA 2K32A 2I0QA 4H44C 1GUGA 5HGQA 2OCEA 2A69C 2G5DA 2YYZA 2RA4A 1N32Q 1BOSA 2KQ3A 4C2MB 3BDLA 4LFBQ 3HOYH 4O2DA 3CRKC 1SRUA 1EL0A 4LFAL 1CQFA 5C5LA 3BG3A 1RIPA 2JA5H 1SMYC 5J3BA 2MHVA 2KCNA 4DR4Q 5COYA 1C0AA 2XGTA 4P75A 3QOLA 3C1FA 4QY7A 1EY5A 3I3CA 3T16A 4NXNQ 2CWAA 2K5DA 2F0VA 1CM9A 1PH4A 1QNUA 3S24A 2E2JH 2B8FA 4N8FA 2ZJPA 1XMQQ 3EVQA 4XDXA 2X69A 3I91A 4PNYA 2B63B 2UXCQ 4X66Q 1TIID 3NBHA 3N6RA 3ZYYX 5A35A 1E22A 1HFGA 1STEA 5JJZA 2E2DC 4MTNA 4ZUJA 4YCWA 4AYBB 4YWMA 4GKJL 1QWYA 3NBHB 1TXYA 1SR3A 1ZKOA 3RZOB 4JK1C 1I50B 1BCPF 4BXXH 1KXLA 3KK7A 3I4NG 4GNXC 5EPLA 4IOCA 2EXZA 4IPDA 4R4OA 1IL8A 1B53A 3HEJA 3M85A 3H15A 1ENFA 2F4VL 1JWUD 3BVGA 3HKZE 4R1JA 4GLVB 4ZYSA 2QA4A 4C1NK 1B3QA 1EOVA 4A3MB 5HY6A 1NNXA 1C7YA 3Q0AA 3RLNA 4BBRB 1Y1WB 4LF4Q 5ISRA 2C9OA 2R61A 4CKBA 4G4KA 2NTSA 2PI2A 3S2HH 4H0LC 1SBBB 3DUZA 2R93H 3OIQA 2JA7G 2JA6G 3UDIA
chains in the Genus database with same CATH topology
2UUAQ 4DR7Q 5JJLA 4DK6C 1BKBA 3Q8DA 1D7QA 5EAYA 4X64Q 2I5HA 2RCNA 3J80i 3ULJA 1VQJA 3W1GA 5GAGC 5AJ3L 4A3EG 1KQSA 2VUMG 4KHPL 1JT8A 1X55A 2VL6A 1A8VA 4DR3Q 1LUZA 1SROA 4PZ8A 1ASZA 2EIFA 4RG1A 3CCRA 4OO1G 3U4VA 4A93G 1VQIA 5AJ3Q 4JYAL 3J7A5 5IYCG 3KOJA 2WB1G 4OX9L 1WCMH 5IYDG 3RN5A 4DR6L 4OWWB 3BZCA 5C0XI 1PH7A 3AQQA 4NXML 2A8VA 1VQ7A 4XTCS 3PIOA 4UPAA 1Z47A 4YCUA 4A3KG 1L1OA 4JI2L 2BH2A 4QQBX 1VQOA 3OTOL 1VQ5A 2BA1A 4LFCL 3HOWG 4JYAQ 5IP7G 2Q2IA 3DM3A 2OTLA 4OX9Q 5M5WH 4DR6Q 4NXMQ 3GTPH 1Y1VH 2JA7H 1MJCA 1L1OB 1VQMA 2JA6H 1AH9A 1H95A 5IY0A 4C3JH 1PH5A 4LW1A 4JI2Q 2GVBA 4LFBL 3KF6A 3OTOQ 3GTJH 4KLKA 4C3HH 4LFCQ 1L1OC 2ZTEA 4YY3L 5C3EG 2K5VA 4A3EH 2YU9H 2VUMH 3TREA 1YIJA 3JAMc 2NZOA 1EQRA 4LUZA 5C4JH 1Y14B 4WJ4A 1NBWA 1A63A 3KF6B 3RLOA 1XMOL 1I5FA 1G6PA 3PGZA 5C4XG 2WAQE 1OXXK 1FL0A 1TWFH 2D62A 2MNAA 2E2HH 4A93H 3S2DH 5IT9c 2KENA 4YY3Q 3T1HL 2Q2HA 1KL9A 4IFDJ 5IYCH 5IYDH 2KCMA 1FGUA 4JBKA 5JJIA 3TEHB 3S15H 1WI5A 1JJGA 1XMOQ 4HJ7A 2IT1A 3KDFA 1ASYA 5FJ8G 1NJIC 3CCUA 2VW9A 4A3KH 4LFBQ 3PO2G 1XPRA 1QVCA 3T1HQ 1NMGA 2K75A 1E3PA 3HOWH 3L2PA 5IP7H 5M3FG 2D0OA 1N33L 4B3ML 4DAMA 1UEBA 3ICEA 4BA1I 5GAHC 2MO0A 1EYGA 2VZAA 3KDFB 1MJEA 3GTLH 1X9NA 4DV0L 3CP0A 4OWXB 4TVAB 3AFPA 3S1QH 4QGUA 2HIXA 1HH2P 2D0PA 1KC8C 5C3EH 1K73C 4PMWA 4X62L 1RL2A 4MZ9A 4B3MQ 1N33Q 3GTGH 2KHIA 4PG3A 5M3MG 5BR8L 4UP7A 1E1TA 4DV0Q 4GLXA 3U58A 3PIPA 1FVIA 4DK3C 2PQAA 1VQHA 4QIWE 1E7ZA 5C44G 5C4XH 1XPUA 2XTIA 1MKHA 4LF5L 3PUXA 3AEVA 4X62Q 3K7UC 1LTLA 1D8LA 1JE5A 1V9PA 3M4PA 5BR8Q 2PQAB 1YJ9A 4GN3B 3CMEA 1GM5A 2UXBL 3H0GG 5FJ8H 4BY1H 4A3GH 3PO2H 2NN6G 4DR5L 1N8RC 4LF5Q 1Q7YC 2YTXA 1YEZA 2IHEA 2LXKA 5M3FH 1PH6A 4J15A 4A4IA 1EWIA 1IBML 1VQ9A 1PH8A 4LUVA 2H5XA 4LUOA 3PV0A 3GO5A 2VQFL 2CCZA 2UXBQ 1EQQA 1I94L 1YNXA 1Q1EA 2NZHA 4GOPA 1O7IA 5C0XJ 3CC7A 2Z0SA 4DR5Q 2F3IA 4A3IH 1PFSA 2JQOA 1IBMQ 1TWGH 3ZJYC 2E5LL 3GTKH 1XTDA 2CWPA 2VY3A 1NE3A 2VQFQ 4QL5A 4GOPB 1I94Q 1W2BA 1N34L 4R4TA 3J81i 1LM0A 4UY8C 4LWCA 2K50A 1T9HA 4HJAA 4GOPC 1JJCB 1Q12A 3EBEA 4DV1L 3CXCA 1K9MC 4GKKL 2UUCL 2E5LQ 1XNRL 3ULPA 5LMUL 1Q86C 3GTOH 1WOCA 2K4KA 1N34Q 3E9IA 1VCIA 1KD1C 1UE7A 3H0GH 1K8AC 1Q8KA 5JEAJ 1HZAA 2DUDA 3CCSA 4DV1Q 2NVXH 1JJ2A 2L15A 4PZ6A 5GQOA 2UUCQ 4GKKQ 1XNRQ 1M90C 1HR0L 2N78A 3F1ZA 4C3IH 5LMUQ 3M7NA 1GD7A 4KHZA 1OTCA 1PH3A 2IY5B 3UDIA 3IRBA 3BZKA 1B70B 4JC0A 3MXNB 1SFOH 1HNXL 3I4MG 1R9TH 3H3VH 1TWHH 3J80c 1VQ8A 1TWAH 1HR0Q 3A5ZB 2EQSA 3K81C 1CSQA 3CW2C 3SGIA 2AMCB 3ERSX 4HIMA 2IX1A 3A5UA 1HNXQ 1PV4A 3S16H 4NB3A 2ES2A 2V1CC 5IWAL 3CC2A 4OO1I 1HZ9A 1SLJA 2JEBI 1P16A 2WAQG 4JCVE 1M1KC 4GLAC 2AKWB 4DV4L 1WFQA 2NVQH 2B29A 4JBJA 2OWOA 2KHJA 1N36L 3S1RH 1PYBA 4A3FG 3STBD 1YVCA 4EX5A 4P71A 2K5HA 1WJJA 1NY4A 5ELNA 1E24A 5IWAQ 1UE1A 4IJLA 1XJVA 2JA8G 4BBSH 4DV4Q 2Q2TA 1VQDA 1YHQA 4K0KL 1N36Q 1V43A 4JG2A 4PZ7A 4QJFA 2C35B 1X6OA 2B63G 3K7AH 4HIOA 3RNUA 1X3GA 3GTQH 2R6GA 4DV6L 4DR2L 1XPOA 3I4MH 3EIVA 2A1AA 3CAMA 1LYLA 2N49A 3FP9A 3UDXA 4BY1G 1L0WA 4DUYL 2ASBA 4A3GG 3K80C 1L2FA 3ER0A 4HJ8A 4B3TL 4K0KQ 4DV2L 3HOVG 1G291 4IPHA 5H1SE 4DV7L 1U5KA 4O0AA 4DV6Q 4DR2Q 2ID0A 4C2MH 1EIYB 2AWOA 4DUYQ 2PMZE 4DNIA 4B3TQ 2GVAA 2CFMA 4UP9A 2ZTCA 4DV2Q 4A3IG 1K8GA 1BVSA 4A3FH 1AE2A 3I4OA 4UP8A 1CSPA 2ZJRA 4DV7Q 1XNQL 1X3FA 4AYBE 3UDGA 1HNZL 3PUWA 3CQZH 4YWLA 4JI7L 4BA2I 2JA9A 5DLQE 2VNUD 2MO1A 5GAEC 1X56A 3I56A 2JA8H 1HZBA 4B3SL 4X6AH 1HR0W 4IFDG 1MIUA 2R7FA 1S3OA 5LMNW 1PVOA 1HJPA 2YTYA 1IBLL 1XNQQ 1E1OA 1HZCA 2Y0SE 4OXPA 3G6EA 1W3SA 1HNZQ 3CCLA 4JI7Q 2B63H 2HT1A 1GKHA 1PYSB 4A3MG 3VDYA 2R7DA 1PHJA 4BY7G 1JMCA 1U0LA 1SE8A 3M4QA 4OWTB 4B3SQ 4BBRG 1Y1WG 5GADC 3BJUA 4AQYL 5ELOA 3AFQA 3HKSA 3AYHB 1Q1BA 3KJOA 1FJGL 3HOVH 1G51A 4JI0L 1IBLQ 1IBKL 1IYJB 1VQNA 2YV5A 3F2BA 3M3YH 5M5XH 1Q82C 4JI1L 1PH2A 3CCEA 2FXQA 3M9BA 4YCVA 4AQYQ 4P72A 4LF7L 1I50H 1K83H 1S40A 1FJGQ 4A3JG 1SN8A 1VQ6A 1YHBA 4JI0Q 2K14A 3CD6A 4P74A 1IBKQ 3S17H 2OQ0A 1VQLA 3CPFA 4POFA 4JV5L 1IL2A 4JI1Q 4ME3A 3U50C 3GTMH 1KRSA 2WFWA 3K8AA 1YI2A 1EUJA 4JBMA 1I6HH 3GDEA 2JEAI 4LF7Q 2UUBL 2ZJQA 4A3LG 1X54A 1CKNA 2ALYB 2PNHA 3HOUH 4TQUS 1JB7A 3HFZB 3UE0A 3PO3G 1CKOA 3STBC 1I3QH 1UE5A 4JV5Q 2OTJA 3FHWA 3F2DA 1Z9FA 2CKZB 3I7FA 4A3MH 4IOAA 2PI2E 1VQEA 4BY7H 4FDBA 1CKNB 4A3DG 3UE1A 4IJHA 1N9WA 3B6YA 3PSIA 2UUBQ 2R7ZH 4DUZL 4BBRH 1Y1WH 4DAYB 2B3GA 5FLXc 2R92H 4LF9L 4HIKA 4ALPA 3EN2A 3NEMA 4A3CG 4L5QA 1PH1A 3PF4A 4BBSG 1HNWL 1WYDA 1TWCH 1V1QA 1J6QA 3K0XA 3RR5A 2Q2UA 1QUQA 3CCVA 4GS3A 3RZDH 5LMNL 2I5MX 1A0IA 2BH8A 1DGSA 2VQEQ 4R4QA 3TRZA 1S72A 4DUZQ 2IX0A 5C0XG 3NELA 3CCMA 4L5RC 4YHHL 1QVFA 4R4CA 4LF9Q 3F2CA 1QZGA 4XIGS 3G71A 4A3JH 1YHAA 4LF8L 1HNWQ 4DV5L 1QUQB 2I5LX 4JI8L 3KJPA 3T1YL 2LXJA 1OXSC 2E2IH 3HOXG 1EFWA 5LMNQ 3PUZA 4JI4L 3W1BA 2HHHL 1J5EL 3DLLA 4YHHQ 4A3LH 5IP9G 3CMAA 4JOIA 4LF8Q 3TS0A 2RF4A 3HOYG 3JC66 2DGYA 4DV5Q 4MNOA 1SMXA 3BU2A 3WWVA 4HIDA 4JI8Q 3PO3H 3T1YQ 3PF5A 4KHPQ 1NMFA 2JA5G 2UXDL 1YITA 1VQ4A 4JI5L 4JI4Q 4DV3L 1VQPA 3CF5A 1OXUA 1VQFA 2BA0A 1J5EQ 2HHHQ 4A3DH 4A75A 3HOZH 3S1NH 4AH6A 3D31A 3JAMi 5JEAG 4KI0A 4AIMA 4A3CH 4JOIC 4EQ5A 3J81j 4IO9A 5IYBH 1PH9A 2UXDQ 1KAWA 1YZ6A 4JI5Q 1GVPA 4DV3Q 3TS2A 2WB1E 3A0JA 3L0OA 1UWVA 1X65A 5GROA 1N32L 2NVTH 1VQBA 4OONA 4JI6L 2VS1A 2K52A 2CQOA 1GO3E 2AWNA 3CPWA 1OXVA 2I0QA 3HOXH 1IXRA 1VS0A 4A3BG 5HGQA 2OCEA 4DR4L 2YYZA 4AYBG 1EIFA 1N32Q 5IP9H 4GN5A 4JI6Q 4NXNL 2RHQB 2QEXA 4O2DA 3HOYH 2NVYH 1SRUA 2OQKA 2UU9L 3S14H 4LFAL 4Y52H 1CKMA 1BBWA 2JK8A 2HIVA 2MFIA 1RIPA 1XMQL 2JA5H 4BXXG 5J3BA 4DR4Q 2Y0SG 4L5TA 1C0AA 4B3RL 2XGTA 4P75A 4POGA 2ZTDA 2UXCL 5FLMG 2N3SA 4QY7A 4X66L 1UE6A 1YJNA 2CWAA 3U4ZA 4LF6L 3RN2A 2UU9Q 4NXNQ 2KBNA 4LFAQ 1PH4A 3S24A 1B7YB 2LSSA 2E2JH 3A74A 3UDFA 4DPGA 2EXDA 2KCTA 2ZJPA 1XMQQ 1OXTA 4GN4B 2MQHA 3HOUG 2HQLA 1VQCA 1VQAA 3I55A 3PCOB 4L5SA 2IHFA 4B3RQ 2A19A 2UXCQ 4DKAC 4X66Q 4Y7NH 3D0FA 4LF6Q 1QVGA 2ATWA 2JJQA 2R7ZG 1E22A 3I2ZA 4P73A 1YBYA 4JBWA 4R4IA 1Q81C 2R92G 4MTNA 4GNXA 4YCWA 4A3BH 3I4NH 1P8LA 2F52A 3CC4A 1C9OA 3GD7A 3M4OH 4YWMA 4GKJL 3NBHB 4IPGA 1TXYA 1SR3A 2WP8J 1YJWA 3FKIG 4NPSA 4LNQA 3RZOH 2R93G 4GNXB 4IFDI 3HKZG 2ZM6L 4BXXH 1KXLA 3OYYA 1AE3A 3I4NG 2N8NA 4IPCA 4GNXC 4GKJQ 2E8GA 2QGQA 1CUKA 5FLMH 1K3RA 3PUYA 4IOCA 3OW2A 4APVA 3CCJA 4IPDA 4R4OA 3W5OA 1QZHA 1VQKA 3E0EA 1KIXA 2K5NA 4X65L 3M85A 4WJ3M 3H15A 2YTVA 4A76A 2NN6I 3KF8B 1Q46A 2ZM6Q 2F4VL 4YWKA 4LF4L 3NENA 3HKZE 4R1JA 1K0RA 4GLVB 2JE6I 1NTGA 1B8AA 4RMFA 3G4SA 2QA4A 5M5YH 1EOVA 3MEFA 3E9HA 5HY6A 1WCMG 3RLFA 4HJ9A 3L7ZC 1C7YA 5IE8A 2Z6KA 3LGJA 4X65Q 1KHIA 3RLNA 2VQEL 4JI3L 4HJ5A 4DR1L 3HOZG 1IZ6A 1KRTA 2F4VQ 1BBUA 2RHSB 3H3VI 4LF4Q 4H02A 2UUAL 4DR7L 2AHOB 5JJKA 1X3EA 3ULLA 3J7ZC 3F8TA 3KFUA 5IYBG 5M3MH 4X64L 3TQYA 3KYHC 3S1MH 3J81c 5K36G 2PI2A 5E7NA 3S2HH 3CCQA 4DR1Q 5C44H 3PUVA 3FKIH 2GN5A 4JI3Q 2R93H 4DR3L 1Y1VG 1A62A 1PA6A 3KLWA 2JA7G 2JA6G 1VQGA 2Z6KC 3G48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA Q;  4DR7 Q;  5JJL A;  4DK6 C;  1BKB A;  3Q8D A;  1D7Q A;  5EAY A;  4X64 Q;  2I5H A;  2RCN A;  3J80 i;  3ULJ A;  1VQJ A;  3W1G A;  5GAG C;  5AJ3 L;  4A3E G;  1KQS A;  2VUM G;  4KHP L;  1JT8 A;  1X55 A;  2VL6 A;  1A8V A;  4DR3 Q;  1LUZ A;  1SRO A;  4PZ8 A;  1ASZ A;  2EIF A;  4RG1 A;  3CCR A;  4OO1 G;  3U4V A;  4A93 G;  1VQI A;  5AJ3 Q;  4JYA L;  3J7A 5;  5IYC G;  3KOJ A;  2WB1 G;  4OX9 L;  1WCM H;  5IYD G;  3RN5 A;  4DR6 L;  4OWW B;  3BZC A;  5C0X I;  1PH7 A;  3AQQ A;  4NXM L;  2A8V A;  1VQ7 A;  4XTC S;  3PIO A;  4UPA A;  1Z47 A;  4YCU A;  4A3K G;  1L1O A;  4JI2 L;  2BH2 A;  4QQB X;  1VQO A;  3OTO L;  1VQ5 A;  2BA1 A;  4LFC L;  3HOW G;  4JYA Q;  5IP7 G;  2Q2I A;  3DM3 A;  2OTL A;  4OX9 Q;  5M5W H;  4DR6 Q;  4NXM Q;  3GTP H;  1Y1V H;  2JA7 H;  1MJC A;  1L1O B;  1VQM A;  2JA6 H;  1AH9 A;  1H95 A;  5IY0 A;  4C3J H;  1PH5 A;  4LW1 A;  4JI2 Q;  2GVB A;  4LFB L;  3KF6 A;  3OTO Q;  3GTJ H;  4KLK A;  4C3H H;  4LFC Q;  1L1O C;  2ZTE A;  4YY3 L;  5C3E G;  2K5V A;  4A3E H;  2YU9 H;  2VUM H;  3TRE A;  1YIJ A;  3JAM c;  2NZO A;  1EQR A;  4LUZ A;  5C4J H;  1Y14 B;  4WJ4 A;  1NBW A;  1A63 A;  3KF6 B;  3RLO A;  1XMO L;  1I5F A;  1G6P A;  3PGZ A;  5C4X G;  2WAQ E;  1OXX K;  1FL0 A;  1TWF H;  2D62 A;  2MNA A;  2E2H H;  4A93 H;  3S2D H;  5IT9 c;  2KEN A;  4YY3 Q;  3T1H L;  2Q2H A;  1KL9 A;  4IFD J;  5IYC H;  5IYD H;  2KCM A;  1FGU A;  4JBK A;  5JJI A;  3TEH B;  3S15 H;  1WI5 A;  1JJG A;  1XMO Q;  4HJ7 A;  2IT1 A;  3KDF A;  1ASY A;  5FJ8 G;  1NJI C;  3CCU A;  2VW9 A;  4A3K H;  4LFB Q;  3PO2 G;  1XPR A;  1QVC A;  3T1H Q;  1NMG A;  2K75 A;  1E3P A;  3HOW H;  3L2P A;  5IP7 H;  5M3F G;  2D0O A;  1N33 L;  4B3M L;  4DAM A;  1UEB A;  3ICE A;  4BA1 I;  5GAH C;  2MO0 A;  1EYG A;  2VZA A;  3KDF B;  1MJE A;  3GTL H;  1X9N A;  4DV0 L;  3CP0 A;  4OWX B;  4TVA B;  3AFP A;  3S1Q H;  4QGU A;  2HIX A;  1HH2 P;  2D0P A;  1KC8 C;  5C3E H;  1K73 C;  4PMW A;  4X62 L;  1RL2 A;  4MZ9 A;  4B3M Q;  1N33 Q;  3GTG H;  2KHI A;  4PG3 A;  5M3M G;  5BR8 L;  4UP7 A;  1E1T A;  4DV0 Q;  4GLX A;  3U58 A;  3PIP A;  1FVI A;  4DK3 C;  2PQA A;  1VQH A;  4QIW E;  1E7Z A;  5C44 G;  5C4X H;  1XPU A;  2XTI A;  1MKH A;  4LF5 L;  3PUX A;  3AEV A;  4X62 Q;  3K7U C;  1LTL A;  1D8L A;  1JE5 A;  1V9P A;  3M4P A;  5BR8 Q;  2PQA B;  1YJ9 A;  4GN3 B;  3CME A;  1GM5 A;  2UXB L;  3H0G G;  5FJ8 H;  4BY1 H;  4A3G H;  3PO2 H;  2NN6 G;  4DR5 L;  1N8R C;  4LF5 Q;  1Q7Y C;  2YTX A;  1YEZ A;  2IHE A;  2LXK A;  5M3F H;  1PH6 A;  4J15 A;  4A4I A;  1EWI A;  1IBM L;  1VQ9 A;  1PH8 A;  4LUV A;  2H5X A;  4LUO A;  3PV0 A;  3GO5 A;  2VQF L;  2CCZ A;  2UXB Q;  1EQQ A;  1I94 L;  1YNX A;  1Q1E A;  2NZH A;  4GOP A;  1O7I A;  5C0X J;  3CC7 A;  2Z0S A;  4DR5 Q;  2F3I A;  4A3I H;  1PFS A;  2JQO A;  1IBM Q;  1TWG H;  3ZJY C;  2E5L L;  3GTK H;  1XTD A;  2CWP A;  2VY3 A;  1NE3 A;  2VQF Q;  4QL5 A;  4GOP B;  1I94 Q;  1W2B A;  1N34 L;  4R4T A;  3J81 i;  1LM0 A;  4UY8 C;  4LWC A;  2K50 A;  1T9H A;  4HJA A;  4GOP C;  1JJC B;  1Q12 A;  3EBE A;  4DV1 L;  3CXC A;  1K9M C;  4GKK L;  2UUC L;  2E5L Q;  1XNR L;  3ULP A;  5LMU L;  1Q86 C;  3GTO H;  1WOC A;  2K4K A;  1N34 Q;  3E9I A;  1VCI A;  1KD1 C;  1UE7 A;  3H0G H;  1K8A C;  1Q8K A;  5JEA J;  1HZA A;  2DUD A;  3CCS A;  4DV1 Q;  2NVX H;  1JJ2 A;  2L15 A;  4PZ6 A;  5GQO A;  2UUC Q;  4GKK Q;  1XNR Q;  1M90 C;  1HR0 L;  2N78 A;  3F1Z A;  4C3I H;  5LMU Q;  3M7N A;  1GD7 A;  4KHZ A;  1OTC A;  1PH3 A;  2IY5 B;  3UDI A;  3IRB A;  3BZK A;  1B70 B;  4JC0 A;  3MXN B;  1SFO H;  1HNX L;  3I4M G;  1R9T H;  3H3V H;  1TWH H;  3J80 c;  1VQ8 A;  1TWA H;  1HR0 Q;  3A5Z B;  2EQS A;  3K81 C;  1CSQ A;  3CW2 C;  3SGI A;  2AMC B;  3ERS X;  4HIM A;  2IX1 A;  3A5U A;  1HNX Q;  1PV4 A;  3S16 H;  4NB3 A;  2ES2 A;  2V1C C;  5IWA L;  3CC2 A;  4OO1 I;  1HZ9 A;  1SLJ A;  2JEB I;  1P16 A;  2WAQ G;  4JCV E;  1M1K C;  4GLA C;  2AKW B;  4DV4 L;  1WFQ A;  2NVQ H;  2B29 A;  4JBJ A;  2OWO A;  2KHJ A;  1N36 L;  3S1R H;  1PYB A;  4A3F G;  3STB D;  1YVC A;  4EX5 A;  4P71 A;  2K5H A;  1WJJ A;  1NY4 A;  5ELN A;  1E24 A;  5IWA Q;  1UE1 A;  4IJL A;  1XJV A;  2JA8 G;  4BBS H;  4DV4 Q;  2Q2T A;  1VQD A;  1YHQ A;  4K0K L;  1N36 Q;  1V43 A;  4JG2 A;  4PZ7 A;  4QJF A;  2C35 B;  1X6O A;  2B63 G;  3K7A H;  4HIO A;  3RNU A;  1X3G A;  3GTQ H;  2R6G A;  4DV6 L;  4DR2 L;  1XPO A;  3I4M H;  3EIV A;  2A1A A;  3CAM A;  1LYL A;  2N49 A;  3FP9 A;  3UDX A;  4BY1 G;  1L0W A;  4DUY L;  2ASB A;  4A3G G;  3K80 C;  1L2F A;  3ER0 A;  4HJ8 A;  4B3T L;  4K0K Q;  4DV2 L;  3HOV G;  1G29 1;  4IPH A;  5H1S E;  4DV7 L;  1U5K A;  4O0A A;  4DV6 Q;  4DR2 Q;  2ID0 A;  4C2M H;  1EIY B;  2AWO A;  4DUY Q;  2PMZ E;  4DNI A;  4B3T Q;  2GVA A;  2CFM A;  4UP9 A;  2ZTC A;  4DV2 Q;  4A3I G;  1K8G A;  1BVS A;  4A3F H;  1AE2 A;  3I4O A;  4UP8 A;  1CSP A;  2ZJR A;  4DV7 Q;  1XNQ L;  1X3F A;  4AYB E;  3UDG A;  1HNZ L;  3PUW A;  3CQZ H;  4YWL A;  4JI7 L;  4BA2 I;  2JA9 A;  5DLQ E;  2VNU D;  2MO1 A;  5GAE C;  1X56 A;  3I56 A;  2JA8 H;  1HZB A;  4B3S L;  4X6A H;  1HR0 W;  4IFD G;  1MIU A;  2R7F A;  1S3O A;  5LMN W;  1PVO A;  1HJP A;  2YTY A;  1IBL L;  1XNQ Q;  1E1O A;  1HZC A;  2Y0S E;  4OXP A;  3G6E A;  1W3S A;  1HNZ Q;  3CCL A;  4JI7 Q;  2B63 H;  2HT1 A;  1GKH A;  1PYS B;  4A3M G;  3VDY A;  2R7D A;  1PHJ A;  4BY7 G;  1JMC A;  1U0L A;  1SE8 A;  3M4Q A;  4OWT B;  4B3S Q;  4BBR G;  1Y1W G;  5GAD C;  3BJU A;  4AQY L;  5ELO A;  3AFQ A;  3HKS A;  3AYH B;  1Q1B A;  3KJO A;  1FJG L;  3HOV H;  1G51 A;  4JI0 L;  1IBL Q;  1IBK L;  1IYJ B;  1VQN A;  2YV5 A;  3F2B A;  3M3Y H;  5M5X H;  1Q82 C;  4JI1 L;  1PH2 A;  3CCE A;  2FXQ A;  3M9B A;  4YCV A;  4AQY Q;  4P72 A;  4LF7 L;  1I50 H;  1K83 H;  1S40 A;  1FJG Q;  4A3J G;  1SN8 A;  1VQ6 A;  1YHB A;  4JI0 Q;  2K14 A;  3CD6 A;  4P74 A;  1IBK Q;  3S17 H;  2OQ0 A;  1VQL A;  3CPF A;  4POF A;  4JV5 L;  1IL2 A;  4JI1 Q;  4ME3 A;  3U50 C;  3GTM H;  1KRS A;  2WFW A;  3K8A A;  1YI2 A;  1EUJ A;  4JBM A;  1I6H H;  3GDE A;  2JEA I;  4LF7 Q;  2UUB L;  2ZJQ A;  4A3L G;  1X54 A;  1CKN A;  2ALY B;  2PNH A;  3HOU H;  4TQU S;  1JB7 A;  3HFZ B;  3UE0 A;  3PO3 G;  1CKO A;  3STB C;  1I3Q H;  1UE5 A;  4JV5 Q;  2OTJ A;  3FHW A;  3F2D A;  1Z9F A;  2CKZ B;  3I7F A;  4A3M H;  4IOA A;  2PI2 E;  1VQE A;  4BY7 H;  4FDB A;  1CKN B;  4A3D G;  3UE1 A;  4IJH A;  1N9W A;  3B6Y A;  3PSI A;  2UUB Q;  2R7Z H;  4DUZ L;  4BBR H;  1Y1W H;  4DAY B;  2B3G A;  5FLX c;  2R92 H;  4LF9 L;  4HIK A;  4ALP A;  3EN2 A;  3NEM A;  4A3C G;  4L5Q A;  1PH1 A;  3PF4 A;  4BBS G;  1HNW L;  1WYD A;  1TWC H;  1V1Q A;  1J6Q A;  3K0X A;  3RR5 A;  2Q2U A;  1QUQ A;  3CCV A;  4GS3 A;  3RZD H;  5LMN L;  2I5M X;  1A0I A;  2BH8 A;  1DGS A;  2VQE Q;  4R4Q A;  3TRZ A;  1S72 A;  4DUZ Q;  2IX0 A;  5C0X G;  3NEL A;  3CCM A;  4L5R C;  4YHH L;  1QVF A;  4R4C A;  4LF9 Q;  3F2C A;  1QZG A;  4XIG S;  3G71 A;  4A3J H;  1YHA A;  4LF8 L;  1HNW Q;  4DV5 L;  1QUQ B;  2I5L X;  4JI8 L;  3KJP A;  3T1Y L;  2LXJ A;  1OXS C;  2E2I H;  3HOX G;  1EFW A;  5LMN Q;  3PUZ A;  4JI4 L;  3W1B A;  2HHH L;  1J5E L;  3DLL A;  4YHH Q;  4A3L H;  5IP9 G;  3CMA A;  4JOI A;  4LF8 Q;  3TS0 A;  2RF4 A;  3HOY G;  3JC6 6;  2DGY A;  4DV5 Q;  4MNO A;  1SMX A;  3BU2 A;  3WWV A;  4HID A;  4JI8 Q;  3PO3 H;  3T1Y Q;  3PF5 A;  4KHP Q;  1NMF A;  2JA5 G;  2UXD L;  1YIT A;  1VQ4 A;  4JI5 L;  4JI4 Q;  4DV3 L;  1VQP A;  3CF5 A;  1OXU A;  1VQF A;  2BA0 A;  1J5E Q;  2HHH Q;  4A3D H;  4A75 A;  3HOZ H;  3S1N H;  4AH6 A;  3D31 A;  3JAM i;  5JEA G;  4KI0 A;  4AIM A;  4A3C H;  4JOI C;  4EQ5 A;  3J81 j;  4IO9 A;  5IYB H;  1PH9 A;  2UXD Q;  1KAW A;  1YZ6 A;  4JI5 Q;  1GVP A;  4DV3 Q;  3TS2 A;  2WB1 E;  3A0J A;  3L0O A;  1UWV A;  1X65 A;  5GRO A;  1N32 L;  2NVT H;  1VQB A;  4OON A;  4JI6 L;  2VS1 A;  2K52 A;  2CQO A;  1GO3 E;  2AWN A;  3CPW A;  1OXV A;  2I0Q A;  3HOX H;  1IXR A;  1VS0 A;  4A3B G;  5HGQ A;  2OCE A;  4DR4 L;  2YYZ A;  4AYB G;  1EIF A;  1N32 Q;  5IP9 H;  4GN5 A;  4JI6 Q;  4NXN L;  2RHQ B;  2QEX A;  4O2D A;  3HOY H;  2NVY H;  1SRU A;  2OQK A;  2UU9 L;  3S14 H;  4LFA L;  4Y52 H;  1CKM A;  1BBW A;  2JK8 A;  2HIV A;  2MFI A;  1RIP A;  1XMQ L;  2JA5 H;  4BXX G;  5J3B A;  4DR4 Q;  2Y0S G;  4L5T A;  1C0A A;  4B3R L;  2XGT A;  4P75 A;  4POG A;  2ZTD A;  2UXC L;  5FLM G;  2N3S A;  4QY7 A;  4X66 L;  1UE6 A;  1YJN A;  2CWA A;  3U4Z A;  4LF6 L;  3RN2 A;  2UU9 Q;  4NXN Q;  2KBN A;  4LFA Q;  1PH4 A;  3S24 A;  1B7Y B;  2LSS A;  2E2J H;  3A74 A;  3UDF A;  4DPG A;  2EXD A;  2KCT A;  2ZJP A;  1XMQ Q;  1OXT A;  4GN4 B;  2MQH A;  3HOU G;  2HQL A;  1VQC A;  1VQA A;  3I55 A;  3PCO B;  4L5S A;  2IHF A;  4B3R Q;  2A19 A;  2UXC Q;  4DKA C;  4X66 Q;  4Y7N H;  3D0F A;  4LF6 Q;  1QVG A;  2ATW A;  2JJQ A;  2R7Z G;  1E22 A;  3I2Z A;  4P73 A;  1YBY A;  4JBW A;  4R4I A;  1Q81 C;  2R92 G;  4MTN A;  4GNX A;  4YCW A;  4A3B H;  3I4N H;  1P8L A;  2F52 A;  3CC4 A;  1C9O A;  3GD7 A;  3M4O H;  4YWM A;  4GKJ L;  3NBH B;  4IPG A;  1TXY A;  1SR3 A;  2WP8 J;  1YJW A;  3FKI G;  4NPS A;  4LNQ A;  3RZO H;  2R93 G;  4GNX B;  4IFD I;  3HKZ G;  2ZM6 L;  4BXX H;  1KXL A;  3OYY A;  1AE3 A;  3I4N G;  2N8N A;  4IPC A;  4GNX C;  4GKJ Q;  2E8G A;  2QGQ A;  1CUK A;  5FLM H;  1K3R A;  3PUY A;  4IOC A;  3OW2 A;  4APV A;  3CCJ A;  4IPD A;  4R4O A;  3W5O A;  1QZH A;  1VQK A;  3E0E A;  1KIX A;  2K5N A;  4X65 L;  3M85 A;  4WJ3 M;  3H15 A;  2YTV A;  4A76 A;  2NN6 I;  3KF8 B;  1Q46 A;  2ZM6 Q;  2F4V L;  4YWK A;  4LF4 L;  3NEN A;  3HKZ E;  4R1J A;  1K0R A;  4GLV B;  2JE6 I;  1NTG A;  1B8A A;  4RMF A;  3G4S A;  2QA4 A;  5M5Y H;  1EOV A;  3MEF A;  3E9H A;  5HY6 A;  1WCM G;  3RLF A;  4HJ9 A;  3L7Z C;  1C7Y A;  5IE8 A;  2Z6K A;  3LGJ A;  4X65 Q;  1KHI A;  3RLN A;  2VQE L;  4JI3 L;  4HJ5 A;  4DR1 L;  3HOZ G;  1IZ6 A;  1KRT A;  2F4V Q;  1BBU A;  2RHS B;  3H3V I;  4LF4 Q;  4H02 A;  2UUA L;  4DR7 L;  2AHO B;  5JJK A;  1X3E A;  3ULL A;  3J7Z C;  3F8T A;  3KFU A;  5IYB G;  5M3M H;  4X64 L;  3TQY A;  3KYH C;  3S1M H;  3J81 c;  5K36 G;  2PI2 A;  5E7N A;  3S2H H;  3CCQ A;  4DR1 Q;  5C44 H;  3PUV A;  3FKI H;  2GN5 A;  4JI3 Q;  2R93 H;  4DR3 L;  1Y1V G;  1A62 A;  1PA6 A;  3KLW A;  2JA7 G;  2JA6 G;  1VQG A;  2Z6K C;  3G48 A; 
#chains in the Genus database with same CATH topology
 2UUA Q;  4DK6 C;  3NQI A;  3Q8D A;  2EVB A;  1WTQ A;  1D7Q A;  4C3H G;  4X64 Q;  3J7A F;  2RCN A;  4KHP L;  1VQJ A;  1JT8 A;  4HR7 B;  4MIU A;  1ZEQ X;  2VL6 A;  1CT1 D;  1EOT A;  1JB3 A;  4A93 G;  4DR6 L;  3HOZ B;  1PH7 A;  4NXM L;  1UAP A;  1VQ7 A;  2Z1C A;  2A8V A;  4A3K G;  4JI2 L;  2RSN A;  4ZKB B;  1B1Z A;  4OX9 Q;  2EOT A;  2M00 A;  5M5W H;  3GTP H;  4EQP A;  1A2U A;  1SND A;  2B2U C;  3KF6 A;  3GTJ H;  3J81 E;  1JR0 D;  3T51 B;  1L1O C;  4YY3 L;  3HOX B;  3TRE A;  4WOR A;  4LUZ A;  1EQR A;  3H6M A;  1Y14 B;  5FO9 B;  3KF6 B;  1XMO L;  3Q22 A;  1I5F A;  3S14 B;  1G6P A;  3C1E A;  3PGZ A;  2WAQ E;  3M7G A;  1PFB A;  3FMC A;  3QG1 A;  3V2T A;  4JVZ A;  1EY6 A;  3TP6 A;  5IYC H;  2X6G A;  2KVM A;  5IYD H;  3TEH B;  3KBX A;  1ICF B;  5FLX L;  5CMD A;  1ROD A;  5FJ8 G;  3CCU A;  1H9R A;  1WTR A;  1PRT B;  5M3F G;  5IP7 H;  1EQT A;  4K5V A;  4BA1 I;  2MO0 A;  3GTL H;  5IGD A;  1MJE A;  4DV0 L;  2PMZ B;  1G2T A;  3SDZ A;  2D0P A;  1WTH A;  1KC8 C;  1K73 C;  4PMW A;  4IUT A;  4B3M Q;  4A3B B;  4ODG A;  2B2V A;  3NTK A;  4K6L A;  4PG3 A;  5M3M G;  3U58 A;  3PIP A;  4DK3 C;  2J0T D;  3SK8 A;  1MKH A;  1STG A;  1R4Q B;  4LF5 L;  1JE5 A;  3M4P A;  4DF7 A;  5BR8 Q;  1I4Q A;  2HD3 A;  1GM5 A;  3IAY A;  3H0G G;  4MTK A;  1LTI D;  3EFX D;  1PRT F;  3VR6 A;  4DR5 L;  1N8R C;  1U4R A;  2YTX A;  4K5X A;  2LXK A;  2NBF A;  1VQ9 A;  4FNF A;  5M5Y B;  1EQQ A;  1ICW A;  1I94 L;  5C0X J;  2FHT A;  1PFM A;  3W3A A;  1PFS A;  2JQO A;  1D5X C;  1XTD A;  4P2C B;  4CJ1 B;  1W2B A;  4R4T A;  1Z7T A;  1PZI D;  5C44 B;  3J81 i;  1G91 A;  4ZK9 B;  3CXC A;  2B2W A;  2EYJ A;  2ICE C;  3K5M A;  1EZ6 A;  4DNR B;  1WOC A;  2NB0 A;  1KD1 C;  1UE7 A;  3KLR A;  1DOK A;  4DK0 A;  2F0L A;  4DV1 Q;  2L12 A;  4GKK Q;  1JJ2 A;  4PZ6 A;  2UUC Q;  5FO8 B;  1EY0 A;  1M90 C;  1IYV A;  3F1Z A;  5LMU Q;  1E2W A;  1WCM B;  3C3L A;  2IY5 B;  2AQ3 B;  3BZK A;  1B70 B;  1SFO H;  1HNX L;  2K6A A;  1R9T H;  1TR5 A;  2AQ2 B;  2EJF C;  1TWH H;  4K8I A;  5EBC A;  3TSS A;  3TZU A;  2O5I C;  2NZ1 D;  3HP3 A;  4XQN A;  2EQS A;  3S16 H;  5DEH A;  2ES2 A;  2V1C C;  1F9Q A;  4OO1 I;  1SLJ A;  2JEB I;  1SE3 A;  2AKW B;  2RCF A;  1WFQ A;  2F0N A;  3PQI A;  2KHJ A;  4L8J A;  3FVQ A;  1N36 L;  2YU9 B;  2VUM B;  4A3F G;  4NKL A;  4FVM A;  1XTC D;  4IJL A;  2RSO A;  1XWE A;  5F2D A;  2E2H B;  1PTO H;  3S2D B;  1QJO A;  4K8J A;  5E1F A;  4K0K L;  1WTX A;  2BE5 C;  4PZ7 A;  2CW0 D;  4DGZ A;  1DOL A;  3K7A H;  4WRD A;  1X3G A;  4DNT B;  4DV6 L;  1XPO A;  1B9M A;  1VDZ A;  1LYL A;  3FP9 A;  3DXJ C;  3I4L A;  1SDF A;  3I72 A;  1NCV A;  4DV2 L;  4OL7 A;  1G29 1;  4IPH A;  4EVO A;  5K5P A;  2HDM A;  3GV3 A;  4DR2 Q;  3BDO A;  2KUM A;  4C2M H;  4DUY Q;  4UP9 A;  2HCC A;  1MSH A;  3I4O A;  1CSP A;  3NE5 B;  4AYB E;  1HNZ L;  3PUW A;  2MP1 A;  4BA2 I;  3NUC A;  4MN3 A;  1ML0 D;  3WDN A;  2VNU D;  1X56 A;  3I56 A;  1PZJ D;  2MPM A;  3H91 A;  4G57 A;  1MIU A;  1S3O A;  3BYY B;  1HJP A;  1IBL L;  1HZC A;  1SNO A;  3G6E A;  2B63 H;  4JI7 Q;  3WOF A;  1FYC A;  1PHJ A;  4BY7 G;  1PTO D;  1JMC A;  4BY1 B;  4A3G B;  1U0L A;  4OWT B;  1D2B A;  4KTA A;  5GAD C;  4EQN A;  1KDA A;  4XT1 B;  1QB5 D;  2EDG A;  3G6J B;  2F03 A;  1O7Y A;  1TS2 A;  4C3I G;  2YV5 A;  3F2B A;  2EE1 A;  3M9B A;  3OW7 A;  5EKK A;  5LL6 S;  1A2T A;  4LF7 L;  1I50 H;  1S40 A;  1B9N A;  1SN8 A;  3GTK B;  4JV5 L;  1IL2 A;  1RJT A;  1SNM A;  4JI1 Q;  3SR1 A;  4JBM A;  2WFW A;  3K8A A;  2ZJQ A;  1B3A A;  4IAL A;  3STB C;  2OTJ A;  2F0E A;  1GHJ A;  4A3M H;  2PI2 E;  1QG7 A;  4FDB A;  1N9W A;  3PSI A;  2UUB Q;  4DUZ L;  4BBR H;  1Y1W H;  4MHE A;  2B3G A;  2B2Y C;  1HNW L;  2NWG A;  1TT2 A;  2Q2U A;  3K0X A;  3NP8 A;  4B9W A;  4X3S A;  1SYE A;  3CCV A;  1W6K A;  1SJH D;  4DA2 A;  3TRZ A;  5CV7 A;  1O7L A;  3CHB D;  5C0X G;  3NEL A;  3CCM A;  2XIW A;  1YHA A;  4Q0F A;  1FNV A;  3KJP A;  4CKE A;  2QKI C;  4JI4 L;  1HTP A;  4TKO B;  4YHH Q;  1BDO A;  4JOI A;  2K1B A;  3TS0 A;  2RF4 A;  4LF8 Q;  3HOY G;  4DV5 Q;  1AW7 A;  2JA5 G;  2UXD L;  1CHP D;  4JI5 L;  2PZU A;  4KY7 A;  4DV3 L;  2HHH Q;  2BA0 A;  3HOZ H;  3D31 A;  5KYI A;  2F4I A;  3LWU A;  4BBS B;  1V8Q A;  3J81 j;  5IYB H;  4K14 A;  1PH9 A;  3PIP 3;  1I4X A;  1YZ6 A;  2WB1 E;  3L0O A;  3GTQ B;  1N32 L;  1RHP A;  5D14 A;  4WFN 3;  1GO3 E;  2AWN A;  2K28 A;  4M8A A;  4B08 A;  3HOX H;  1EFI D;  1GXD C;  4DR4 L;  2O5J C;  1GJX A;  4KJN A;  4JI6 Q;  4NXN L;  2WAQ B;  4Y52 H;  2OQK A;  2EYH A;  3S14 H;  2WIN B;  3RUZ A;  4OIK A;  1XMQ L;  2PPB C;  4BXX G;  3ERO A;  2Y0S G;  5JOB A;  2CVR A;  1SYC A;  1PFN A;  4POG A;  1STH A;  2UXC L;  2NTT A;  4X66 L;  1UE6 A;  5KNB A;  5JEA H;  1YJN A;  4ZUI A;  2UU9 Q;  2JA8 B;  1RKN A;  5A2Q L;  2KCT A;  3HG9 A;  1OXT A;  2XRS D;  4GN4 B;  1VQC A;  2JSO A;  4RCO A;  2GA4 B;  1YNJ D;  3I55 A;  5T1G A;  4L5S A;  4B3R Q;  3OMC A;  2WV6 D;  3D0F A;  4C1N I;  4LF6 Q;  2ATW A;  2JJQ A;  3SK4 A;  2O4X A;  5E3F A;  4P73 A;  4R4I A;  3K59 A;  3HOV B;  1UNS A;  4GNX A;  4A3B H;  2OF1 A;  3R93 A;  2WKD A;  4BS9 A;  3GD7 A;  3M3Y B;  1WVL A;  4IPG A;  2F0Q A;  2WP8 J;  4J6H A;  4HN7 A;  2R93 G;  1K83 B;  4GNX B;  5IGC A;  1ET6 A;  3HKZ G;  4HSV A;  1STB A;  3S17 B;  2N8N A;  4DU9 A;  1CUK A;  2ZXR A;  1K3R A;  5FLM H;  1I4H A;  2F0I A;  4APV A;  3CCJ A;  1C8C A;  1LTT D;  2K5N A;  5EKI A;  4A76 A;  2ZM6 Q;  4LF4 L;  1I3Q B;  1NTG A;  3G4S A;  1GUN A;  2F0W A;  5M5Y H;  3K58 A;  2Q8T A;  3MEF A;  3IFT A;  5IE8 A;  5EBD A;  1PRT D;  2A68 C;  1BBU A;  3H3V I;  3A55 A;  4H02 A;  2UUA L;  5JJK A;  1X3E A;  4M1U B;  3ULL A;  2QIL A;  2IPK D;  4CGY B;  4X64 L;  3KYH C;  3K5N A;  5CV9 A;  3CCQ A;  4DR1 Q;  5C44 H;  3VA5 A;  4JI3 Q;  2Z6K C;  3G48 A;  1NAP A;  3R8B A;  4DR7 Q;  4RGN A;  1BKB A;  1SJE D;  2EJG C;  2I5H A;  1XXG A;  4KMU C;  4CDC C;  1LTR D;  1Y8P B;  3NTI A;  4DR3 Q;  3N52 A;  3V05 A;  4PZ8 A;  1HRJ A;  2FMM A;  4HSP A;  4RG1 A;  1AN8 A;  1VQI A;  3MVV A;  1DXM A;  5IYC G;  1T5E A;  4OX9 L;  4IN3 A;  1WCM H;  5IYD G;  3G7L A;  4A3D B;  4OWW B;  1FGB D;  1O78 A;  1U9R A;  2K33 A;  3R2I A;  2B2U A;  1ET9 A;  1H9S A;  3PIO A;  1K8O A;  1L0Y B;  4CDD C;  1L1O A;  4QQB X;  1TS3 A;  2XRQ D;  1TQO A;  4XXE A;  3QWN A;  5JVG 3;  4JYA Q;  3OMG A;  5IP7 G;  5K36 H;  4IUP A;  2RDG A;  4XYQ A;  4F87 A;  4H13 C;  2JA6 B;  2NVT B;  1MJC A;  1L1O B;  4O1N A;  1VQM A;  2D5D A;  1HTL D;  2GVB A;  4RGT A;  3TP8 A;  3OTO Q;  1LAC A;  2SNM A;  1QOH A;  2YU9 H;  3KBG A;  1MD2 D;  2VUM H;  3JAM c;  2F0M A;  4ABN A;  2K5Q A;  1B44 D;  4PMB A;  1NBW A;  3I90 A;  2KA7 A;  1GUS A;  4LJZ C;  2EY2 A;  4OO1 H;  2E2H H;  3S2D H;  5IT9 c;  4KY5 A;  1JE4 A;  1A15 A;  1KL9 A;  1TY0 A;  1ZXT A;  4JBK A;  5JJI A;  1WI5 A;  3X3M A;  1PTO F;  4FXD A;  1H9M A;  1EU4 A;  2QW7 A;  4FP5 D;  1DJR D;  1NMG A;  3T1H Q;  1E3P A;  2Z6B A;  2D0O A;  4B3M L;  4KN7 C;  1UEB A;  3ICE A;  3MFG A;  5E4X A;  1EEF D;  2VZA A;  4F8M A;  3CP0 A;  2MUY A;  4R9W A;  1F2Y A;  4PMC A;  4QGU A;  2HIX A;  3HS0 C;  1N33 Q;  1EYD A;  3NSW A;  4NW2 A;  1LT6 D;  4DXF A;  5BR8 L;  4GLX A;  1FVI A;  1XPU A;  1LTL A;  4G7H C;  3OSO A;  5COR A;  3C2P A;  3HZX A;  2FMC A;  4BY1 H;  4A3G H;  1X3P A;  1YEZ A;  2IHE A;  2K5W A;  3VYR A;  4LUV A;  2H5X A;  1ESR A;  2CHB D;  4N9T A;  2CCZ A;  4OHJ A;  1YNX A;  1Q1E A;  1AEX A;  1ZYR D;  1YNN C;  5KGU A;  3ZJY C;  3GTK H;  2CWP A;  3D4R A;  5M3M B;  3S1M B;  2VQF Q;  1RDP D;  2PW7 A;  3SK6 A;  3FKI B;  1LTG D;  3DEO A;  2F0P A;  3U9S A;  1V1O A;  2K50 A;  4LWC A;  4IFD H;  1T9H A;  4HJA A;  2H1E A;  4GOP C;  4DV1 L;  4GKK L;  2MGS A;  4U68 A;  2UUC L;  2E5L Q;  4X3T A;  3J7A V;  5LMU L;  4F7X A;  4DN4 M;  2K4K A;  1N34 Q;  1HPC A;  3E9I A;  2EYF A;  1O7Z A;  2NN6 H;  2DUD A;  5JEA J;  4G7Z C;  4F88 A;  3MXN A;  3OOC A;  5GQO A;  1XNR Q;  1GHK A;  2B39 A;  2N78 A;  1HA6 A;  1OTC A;  1A3V A;  3IRB A;  2LFN A;  3MXN B;  2IJ0 A;  2PNR C;  4FF2 A;  1WTV A;  1VQ8 A;  2EY6 A;  3A5Z B;  4Q5V A;  2AMC B;  5G3L F;  2IX1 A;  3A5U A;  1PV4 A;  1Y1V B;  4ZLT F;  4C3J B;  1SE2 A;  5CC4 A;  3AB9 A;  2B29 A;  2KJX A;  2OWO A;  2A6H D;  2Q8I B;  3MEH A;  4A3E B;  2VB2 X;  1PLF A;  1YVC A;  4EX5 A;  5BN5 A;  2K5H A;  3H94 A;  1NY4 A;  1UE1 A;  1MSG A;  4QUF A;  2D9U A;  1TWF B;  4DV4 Q;  2Q2T A;  4BBS H;  1VQD A;  1YHQ A;  4IUR A;  1GUW A;  3ND9 A;  1Q3L A;  3OHX C;  2CQA A;  5D3D A;  2C5C A;  2WB1 B;  4JG2 A;  1VMP A;  2B63 G;  3GTQ H;  3S15 B;  4DR2 L;  2A1A A;  3CAM A;  1ONL A;  4DUY L;  3HOW B;  4HJ8 A;  3GV6 A;  3VYS A;  3J81 L;  5H1S E;  3S9W A;  4N9P A;  2SEB D;  1WTO A;  1EIY B;  3S1Q B;  2EPB A;  1H9J A;  2I07 B;  1JOO A;  4HMJ A;  2ZTC A;  1ENA A;  5C3E B;  4A3I G;  4V0B A;  3D3R A;  1K8G A;  2RDH A;  1TS4 A;  4DV7 Q;  3DMU A;  3D4D A;  4JI7 L;  1RTO A;  1BCP C;  2JA9 A;  5C4X B;  2MO1 A;  3T13 A;  5GAE C;  2JA8 H;  3MC0 B;  1HR0 W;  5CBA E;  5I6W A;  1CZW A;  1E1O A;  3CRL C;  3F2U A;  1W3S A;  1TKW B;  2L5T A;  4A3M G;  3FEW X;  1QE6 A;  2P5Z X;  4B3S Q;  1F2Z A;  4BBR G;  1Y1W G;  1Y8N B;  3PO2 B;  5ELO A;  3HKS A;  3AYH B;  3HOV H;  1G51 A;  5ELB A;  1VQN A;  1CHQ D;  3M3Y H;  4R8N A;  4JI1 L;  2A69 D;  2K7V A;  4YCV A;  4AQY Q;  4P72 A;  1K83 H;  2DNE A;  1FJG Q;  1VQ6 A;  1CFM A;  2EYO A;  4JI0 Q;  2K14 A;  3S17 H;  2OQ0 A;  5L37 A;  4POF A;  1SMY D;  2HCI A;  1KDB A;  2N88 A;  2UUB L;  5KNC A;  1X54 A;  1CKN A;  2B2Y A;  2ALY B;  1WD1 A;  4TQU S;  1JB7 A;  3O13 A;  4ULL A;  1CKO A;  1I3Q H;  1IW7 C;  5DM7 3;  3QR8 A;  1CKN B;  4IJH A;  5FLX c;  1RCV D;  1HXY D;  4BWG B;  2NVX B;  4HIK A;  2F0U A;  3EN2 A;  3NEM A;  1HQM C;  2EY5 A;  1QIL A;  1WYD A;  1I6V C;  4C3I B;  1F9S A;  3MAQ A;  2Z4I A;  1WD0 A;  2VXW A;  2L0C A;  2IX0 A;  1X3Q A;  4YHH L;  3DEP A;  4R4C A;  4LF9 Q;  2PYK A;  1SYD A;  3F2C A;  3G71 A;  4LF8 L;  2ZT9 C;  4DV5 L;  4IUV A;  4S3S A;  3HOX G;  5LMN Q;  2A5H A;  3OPO A;  3LWE A;  4KKS A;  1SSO A;  4QUC A;  2HHH L;  3OWE B;  1JCK B;  4A3L H;  3BU2 A;  3WWV A;  4HID A;  4KHP Q;  3PF5 A;  1D5M C;  3S1R B;  1A6X A;  3CF5 A;  1OXU A;  1J5E Q;  4A3D H;  1BR9 A;  3K0Y A;  2L1B A;  3NQT A;  5JEA G;  4AIM A;  4A3C H;  1SEB D;  3TS2 A;  1QCB D;  1UWV A;  1EU3 A;  3LX0 A;  3RD4 A;  2RVL A;  3I4M B;  2NVT H;  4JI6 L;  2VS1 A;  2K52 A;  2CQO A;  1S5F D;  4DXG A;  4CJ0 B;  4OEM B;  1VS0 A;  4A3B G;  1PYW D;  1EIF A;  5IP9 H;  4GN5 A;  1LT5 D;  1D1I A;  4ZKC B;  2AQ1 B;  3J80 E;  2QEX A;  2UU9 L;  2JK8 A;  2HIV A;  4L5T A;  2J4X A;  4B3R L;  2XWB B;  3CQZ B;  2ZTD A;  5FLM G;  3U4Z A;  4LF6 L;  4UAI A;  2QDL A;  2KBN A;  2BCO A;  4DPG A;  2EXD A;  3HOU G;  1FR3 A;  2MQH A;  5TSS A;  5BN4 A;  1VQA A;  3T53 B;  3PCO B;  4KV6 A;  5I6Y A;  4NDX A;  4DKA C;  1KLG D;  2R7Z G;  1CA5 A;  3J80 L;  3I2Z A;  1YBY A;  1FNW A;  4OEL B;  1Y69 U;  2R92 G;  3VR4 A;  5I2X A;  1P8L A;  2F52 A;  3CC4 A;  1C9O A;  2HQE A;  4QCL A;  2NYZ D;  4NPS A;  3KLS A;  3RZO H;  3U9O A;  1JOK A;  4IFD I;  2ZM6 L;  2Y0S B;  3KF8 A;  5EJW A;  4KD4 A;  3GTM B;  3W5O A;  1XX8 A;  2KEE A;  1QZH A;  4CDF C;  1MI2 A;  3EA6 A;  4WJ3 M;  5LHY 1;  4NP5 A;  1QNK A;  2NN6 I;  1Q46 A;  3KF8 B;  4YWK A;  2PCF B;  1Q90 A;  4RMF A;  2JE6 I;  1B8A A;  2Z4H A;  3QJY A;  1WCM G;  4HJ9 A;  1XYI A;  4DR1 L;  2Z6K A;  3LGJ A;  4X65 Q;  2VQE L;  4HJ5 A;  4JI3 L;  2Z8L A;  1CTM A;  1KRT A;  2RHS B;  1BO0 A;  4DR7 L;  3J7Z C;  1U4M A;  3F8T A;  2O2L D;  5M3M H;  3RZD B;  3I70 A;  3TQY A;  3S1M H;  3E3X A;  5K36 G;  1J9O A;  5E7N A;  1FD7 D;  4RGO S;  3PUV A;  3FKI H;  2GN5 A;  4DR3 L;  1PA6 A;  3KLW A;  2F0S A;  4LMQ D;  4K2L A;  5IGG A;  2X6L A;  4IQZ A;  4A3J B;  1SYG A;  3J80 i;  5GAG C;  2E2I B;  2KED A;  2VUM G;  4UHV A;  1GUO A;  5FKA C;  1X55 A;  1A8V A;  1PZK D;  1LUZ A;  1ASZ A;  1GUT A;  3PO3 B;  1BQQ T;  1IHZ A;  2OT2 A;  2TMP A;  4OO1 G;  4LAA A;  5AJ3 Q;  1ILP A;  4JYA L;  2E74 C;  1SAP A;  4RKB A;  5IOC A;  1KAA A;  1LT3 D;  3AQQ A;  1S5E D;  3VYT A;  1SNC A;  1C4Q A;  4UPA A;  1Z47 A;  2BH2 A;  4EQO A;  3OTO L;  1VQ5 A;  2BA1 A;  4ZCK A;  1EYC A;  4KK7 A;  1Y1V H;  3FRP B;  1H95 A;  1AH9 A;  5IY0 A;  4C3J H;  1EY9 A;  4KKU A;  3VR5 A;  5DNF A;  4LFB L;  1VF5 C;  2Q8R E;  4DK1 A;  4LFC Q;  1KNE A;  2ZTE A;  3TBI B;  2K01 A;  2K05 A;  4A3E H;  4RCN A;  2ENB A;  1YIJ A;  5G3L D;  2NZO A;  2H4O A;  5E4W C;  3RLO A;  2NVY B;  4CJ2 C;  2HDL A;  1FL0 A;  1TWF H;  2D62 A;  2KEN A;  5IOD A;  3T1H L;  2Q2H A;  2KCM A;  4FXK C;  3P75 A;  3S15 H;  3E5S A;  1JJG A;  2PZW A;  3KDF A;  1NJI C;  2VW9 A;  5C4H A;  1XPR A;  2K75 A;  3HOW H;  2LKV A;  1N33 L;  4DAM A;  3KDF B;  1X9N A;  4Y7N B;  4ZRZ A;  4FF1 A;  4OWX B;  4TVA B;  2M9V A;  3AFP A;  1RD9 D;  3S1Q H;  4YIJ A;  1HH2 P;  5C3E H;  4MZ9 A;  2OEO A;  1K3B C;  3M4O B;  2HUG A;  2KHI A;  1E1T A;  2A73 B;  5CGK A;  2TSS A;  2PQA A;  3ND8 A;  4QIW E;  2ZXP A;  5C4X H;  5FOB B;  3JAM E;  3PUX A;  3AEV A;  4X62 Q;  3MFY A;  1PXU A;  3K7U C;  1D8L A;  1CI3 M;  3MHB A;  1SXT A;  2PQA B;  1UUP A;  2BE5 D;  1YJ9 A;  3CME A;  2L9H A;  5IT9 E;  3P7J A;  4OIJ A;  3SHL A;  4FYD A;  3PO2 H;  1Y8O B;  2NN6 G;  1Q7Y C;  2KOL A;  4J8Q A;  4J15 A;  4A4I A;  1EWI A;  3ITP A;  5CBE E;  1PH8 A;  3SE0 A;  4RAU C;  1B4O A;  3PV0 A;  3GO5 A;  2VQF L;  2UXB Q;  1B2T A;  3MXP A;  4GOP A;  1O7I A;  5I9O A;  2F3I A;  3URY A;  2A6E D;  2XWJ B;  5J1Z A;  3TDQ A;  1IBM Q;  2E5L L;  4GZY C;  1DCZ A;  1NR2 A;  2LMC B;  4QL5 A;  4GOP B;  1N34 L;  3C46 A;  1SYF A;  1LM0 A;  4H7B A;  1J8I A;  3MA2 B;  1KAB A;  2A6H C;  2IL8 A;  1LT4 D;  3EBE A;  4DAY A;  1K9M C;  5I2Y A;  3QIA A;  3NXW A;  1XNR L;  4ZQ3 A;  3I4N B;  2B2T C;  3MTS A;  1VCI A;  1K8A C;  4O42 A;  5CYU A;  1Q8K A;  3J7Y W;  3NBI A;  2RQX A;  2NVX H;  4L6T B;  3NWS A;  5IGE A;  4C3I H;  1ILQ A;  3M7N A;  1GD7 A;  4X3U A;  4KHZ A;  1LO5 D;  5KEE A;  1DYQ A;  2PQE A;  3DHQ A;  4JC0 A;  5KRU A;  4PQX A;  1EYA A;  2XN9 C;  1HR0 Q;  1DON A;  4L63 B;  3CW2 C;  3HGB A;  2Z9H A;  1A3U A;  3BS1 A;  4HIM A;  1MHW C;  2JA7 B;  1H9S B;  2RBM A;  2JN4 A;  2DNC A;  3NWT A;  5HUR A;  1HZ9 A;  2WAQ G;  3A8K E;  1M1K C;  4GLA C;  4DV4 L;  4C3H B;  4JBJ A;  3BDC A;  3P20 A;  3S1R H;  1PYB A;  3STB D;  5C4J B;  1WJJ A;  5DAU A;  5IWA Q;  4FF4 A;  1KTK A;  1XJV A;  2JA8 G;  4I7Z C;  4A93 B;  3ONA B;  2NUC A;  1HQR D;  1TY2 A;  3L3O C;  4KKT A;  4QJF A;  1SYB A;  1X6O A;  4HIO A;  3I4M H;  2N49 A;  5CR3 A;  3UDX A;  3OWF A;  4A3K B;  1L0W A;  3K80 C;  1JC7 A;  3HOV G;  3LNN A;  2ZXO A;  4R8I A;  4DV7 L;  4QMG A;  2ID0 A;  4N8X 1;  2AWO A;  1KNA A;  4DNI A;  4B3T Q;  2GVA A;  2CFM A;  5C3X A;  3GTG B;  1BCP B;  1LLR D;  4UP8 A;  2XVS A;  3UDG A;  4YWL A;  3CQZ H;  3T4A C;  4DFA A;  5DLQ E;  1HZB A;  4B3S L;  1G2S A;  5IIF A;  2L4N A;  2F0H A;  3A8I E;  1PVO A;  1XNQ Q;  1G8Z D;  2Y0S E;  4OXP A;  2SDF A;  2HT1 A;  1PYS B;  3E6Z X;  1SE8 A;  3M4Q A;  1JWS D;  2MJ8 A;  4AQY L;  5EKL A;  1Q1B A;  5M3F B;  1FJG L;  4DAP A;  4JI0 L;  1LV9 A;  1NSN S;  1RTN A;  1Q82 C;  1PH2 A;  2FXQ A;  2F0F A;  5EQ0 A;  3PMF A;  4HTH A;  4A3I B;  1EY4 A;  5KIX A;  2F0K A;  4FXG C;  1YHB A;  1TWG B;  3CD6 A;  1IBK Q;  4XT3 B;  2CH4 W;  2K04 A;  4HMI A;  4ME3 A;  3U50 C;  3GTM H;  1KRS A;  2M2L A;  3GDE A;  4A3L G;  2DN8 A;  2I46 A;  2IX3 A;  2EYL A;  2BDO A;  2A74 C;  3HFZ B;  2BDN A;  1K0S A;  1UE5 A;  4PV1 C;  5C3W A;  3CKI B;  3FHW A;  3GTO B;  4G7O C;  1Z9F A;  3I7F A;  2PO4 A;  4IUU A;  4IOA A;  3H0G B;  4A3D G;  3UE1 A;  2E76 C;  3UI2 A;  4UDU C;  2PW5 A;  2KCC A;  4LF9 L;  4ALP A;  4A3C G;  4L5Q A;  3PF4 A;  2CW0 C;  1V1Q A;  4V19 0;  1J6Q A;  3RR5 A;  3RZD H;  5LMN L;  1A0I A;  1DGS A;  4R4Q A;  3FDT A;  3EQL C;  4NMZ A;  1AZQ A;  4L5R C;  1QZG A;  4A3J H;  1K8M A;  1TWA B;  5HGT A;  1T5X D;  3OIP A;  3H3V C;  1OXS C;  2E2I H;  1EFW A;  3PUZ A;  3W1B A;  1J5E L;  4WJW A;  5IP9 G;  3CMA A;  3I73 A;  1RF2 D;  3JC6 6;  3PO3 H;  4MNO A;  1SMX A;  4JI8 Q;  2NVQ B;  3T1Y Q;  1HFN A;  1NMF A;  1YIT A;  5NUC A;  1VQ4 A;  2J7Z A;  1H9K A;  4A75 A;  1KDC A;  1KLU D;  1SE4 A;  2L11 A;  4AH6 A;  2EZV A;  1R4P B;  1DOM A;  4KI0 A;  3D4W A;  3R3O A;  4EQ5 A;  3SVM A;  2A68 D;  1KAW A;  1X32 A;  3TN2 A;  3T56 B;  4EGV A;  3SXH A;  3D8G A;  1GVP A;  1PTO C;  5FLX E;  5EGT A;  1X65 A;  3L9A X;  2FJ2 A;  2L55 A;  1NR4 A;  1OXV A;  2DJF C;  3IKJ A;  3TP7 A;  1IXR A;  5FO7 B;  4AYB G;  1BUV T;  5C4Z A;  2RHQ B;  3EJI A;  2NVY H;  1CKM A;  1BBW A;  2MFI A;  5C6A A;  1DZ1 A;  2SOB A;  4A3F B;  4XQJ A;  3VR2 A;  1M4V A;  4E6I A;  2N3S A;  2R3Z A;  1V1P A;  1TVX A;  3RN2 A;  4LFA Q;  1B7Y B;  2LSS A;  3A74 A;  3I8Z A;  3UDF A;  2HQL A;  2QCP X;  1V1P B;  2IHF A;  1GOZ A;  2A19 A;  2JYO A;  1EQV A;  3FPP A;  3HRZ C;  4HCS A;  4Y7N H;  1QVG A;  3SK5 A;  2XSC A;  5J22 A;  3KLS X;  1Q81 C;  4JBW A;  1STA A;  1I4R A;  1K28 A;  1VF7 A;  3M4O H;  5M5X B;  4QIW B;  4IUN A;  1YJW A;  4RA8 A;  3FKI G;  3AMU A;  4FO2 A;  4LNQ A;  4OGQ C;  4I65 A;  5J39 A;  3OYY A;  3K6O A;  1AE3 A;  4IPC A;  3AU7 A;  4GKJ Q;  2E8G A;  2QGQ A;  3PIO 3;  3OW2 A;  3PUY A;  1JIC A;  1I6H B;  4ZAI A;  1VQK A;  3E0E A;  1KIX A;  4X65 L;  3E0J A;  3VR3 A;  3HOU B;  2YTV A;  4TRD A;  3NEN A;  1K0R A;  4TSS A;  3RLF A;  3E9H A;  4BY7 B;  1D6E C;  2V4D A;  3L7Z C;  2R7Z B;  1KHI A;  4QB4 A;  3HOZ G;  5ELF A;  1IZ6 A;  1SNP A;  3FPU B;  2F4V Q;  2R92 B;  2AHO B;  4HCE A;  4RKL A;  2QF7 A;  2F0J A;  1TWC B;  3KFU A;  5IGF A;  4ID6 A;  5IYB G;  4KN4 C;  3D6W A;  3J81 c;  2JXM B;  1Q8I A;  1A62 A;  1Y1V G;  1VQG A;  4KHV A;  4C3J G;  5JJL A;  2WKC A;  4XYO A;  2F0G A;  5ELD A;  1ENC A;  5EAY A;  3I4N H;  3ULJ A;  3W1G A;  5AJ3 L;  1KQS A;  4A3E G;  3BVM A;  2QEJ C;  1Z6H A;  2F0D A;  3VYU A;  2IW3 A;  1SRO A;  2EIF A;  1MGS A;  3GP7 A;  3CCR A;  4K5W A;  3U4V A;  3K57 A;  1A3T A;  4LK1 C;  3DWP A;  3J7A 5;  1EZ8 A;  3KOJ A;  3KUP A;  2K03 A;  2WB1 G;  3RN5 A;  3NHH A;  3BZC A;  3S1N B;  5C0X I;  4XTC S;  4YCU A;  1YNJ C;  1VQO A;  3HOW G;  4LFC L;  3TZD A;  1YNN D;  4CKC A;  2Q2I A;  3DM3 A;  2OTL A;  3QOJ A;  4DR6 Q;  2AUJ D;  4NXM Q;  2JA7 H;  3A8J E;  1TS5 A;  2JA6 H;  1PH5 A;  1LTS D;  5KND A;  4LW1 A;  4JI2 Q;  3MXU A;  1EY8 A;  4KLK A;  4C3H H;  5C3E G;  2K5V A;  3A54 A;  5C4J H;  4WJ4 A;  1A63 A;  4JPB W;  5EPK A;  3HOY B;  2F3W A;  2WII B;  3R2T A;  5C4X G;  1OXX K;  2MNA A;  4A93 H;  2JA5 B;  4IFD J;  4YY3 Q;  4C56 C;  1I4P A;  1LAB A;  2BOS A;  1FGU A;  1HUM A;  2F3V A;  4IZ8 A;  1XMO Q;  4Z9C B;  4HJ7 A;  2IT1 A;  1ASY A;  1JWM D;  4A3K H;  2E2J B;  3PO2 G;  1W6J A;  3QB3 A;  1QVC A;  3Q6S A;  3A56 A;  3L2P A;  2RKS A;  1BNZ A;  5GAH C;  1EYG A;  1PRT C;  1JQY D;  2A6E C;  3QO2 A;  1HA5 A;  3GTG H;  4X62 L;  2XNA C;  1RL2 A;  5T1I A;  4ME5 A;  3Q23 A;  4UP7 A;  4DV0 Q;  1UEA B;  1VQH A;  1E7Z A;  2G9D A;  5C44 G;  2XTI A;  5I9P A;  1OO9 B;  4HED A;  1EY7 A;  1V9P A;  1D5Z C;  4B9X A;  1IYU A;  2B2V C;  4GN3 B;  1M8A A;  2UXB L;  1U4P A;  5FJ8 H;  1U4L A;  3H3V H;  2LY7 A;  1CZG A;  4LF5 Q;  5M3F H;  1PH6 A;  1F2L A;  2SNS A;  3VA7 A;  1IBM L;  1JOR A;  1AP0 A;  3BZD B;  4LUO A;  3X3N A;  3MZ5 A;  1HUN A;  2NZH A;  2OXP A;  3CC7 A;  2Z0S A;  4DR5 Q;  4A3I H;  3V96 A;  2B2T A;  1TWG H;  2VY3 A;  1NE3 A;  5CV6 A;  3DM1 A;  5IGB A;  1I94 Q;  3S2H B;  2EYP A;  1E0B A;  2R93 B;  1CK1 A;  4UY8 C;  1I4G A;  4I7A A;  1BCP D;  3HKZ B;  4CDE C;  1JJC B;  1Q12 A;  5LL6 X;  2F0T A;  5JPN C;  2EJM A;  2QDB A;  3ULP A;  3GTO H;  1STY A;  1Q86 C;  4XQQ A;  2IWH A;  2PZT A;  5AFW A;  3H0G H;  2DJG C;  2F0O A;  2RDF A;  1HZA A;  3CCS A;  2L15 A;  1HR0 L;  1HCZ A;  2B2W C;  4X3K A;  5D65 A;  5KYL A;  1PH3 A;  3DWQ A;  3I4M G;  3DWA A;  5D3I B;  3J80 c;  1TWA H;  1PMR A;  4K2K A;  3A7L A;  3K81 C;  1IKL A;  1CSQ A;  5M5W B;  3SGI A;  1L0X B;  3ERS X;  4RHR A;  3GTP B;  1HNX Q;  4NB3 A;  1F9P A;  5IWA L;  3CC2 A;  5CV4 A;  4JCV E;  4RWS C;  1P16 A;  5EPJ A;  3TP5 A;  3GTJ B;  5CV5 A;  2NVQ H;  1SNQ A;  1F77 A;  2FIN B;  3CU7 A;  1IKM A;  1IW7 D;  4P71 A;  5ELN A;  1E24 A;  1FNU A;  5DM6 3;  4KJO A;  1CA6 A;  3BVZ A;  2B8G A;  4CHT B;  3P1H A;  3H09 A;  1N36 Q;  1V43 A;  2C35 B;  3RNU A;  5ELE A;  2R6G A;  5A2Q E;  1DM0 B;  1AFP A;  1MBY A;  3EIV A;  4RHS A;  1G6Z A;  4BY1 G;  4A3G G;  2ASB A;  1EWC A;  1L2F A;  3ER0 A;  3NTH A;  4B3T L;  4K0K Q;  2VB3 X;  1BXT A;  3GTL B;  1ZYR C;  1D1K A;  1U5K A;  4O0A A;  5FK9 C;  4DV6 Q;  3MXG A;  1AZP A;  3IFD A;  2PMZ E;  1E2Z A;  4DV2 Q;  4FF3 A;  1BVS A;  4A3F H;  1AE2 A;  3K5L A;  2ZJR A;  1EEI D;  1O80 A;  1XNQ L;  1X3F A;  5M9O A;  1E2V A;  1PDQ A;  1S5B D;  5JVH 3;  1S5D D;  3K5O A;  4X6A H;  4HAE A;  3M4Y A;  1CQV A;  4KY6 A;  2R7F A;  4IFD G;  5LMN W;  2FFK B;  2YTY A;  1ESF A;  3CCL A;  1HNZ Q;  1GKH A;  5C5M A;  3VDY A;  2R7D A;  5BN3 A;  2DY8 A;  3ERQ A;  3BJU A;  4J1M A;  3AFQ A;  3KJO A;  3GQB A;  4RGM A;  4IUQ A;  4RFB A;  1IBL Q;  1IBK L;  1IYJ B;  5M5X H;  2DY7 A;  3CCE A;  4ILW A;  4CBV A;  1S4Z A;  4A3J G;  1VMC A;  4P74 A;  2D2C C;  3IL8 A;  1VQL A;  3CPF A;  1TU2 B;  3JAM L;  1HHV A;  1LTA D;  1YI2 A;  2EY1 A;  1I6H H;  1EUJ A;  3W2D A;  2JEA I;  2G9H D;  4LF7 Q;  3HOU H;  1S5C D;  2PNH A;  3UE0 A;  1EWH A;  3D6C A;  5IT9 L;  4JW0 A;  3PO3 G;  1BF4 A;  2F1M A;  4JV5 Q;  3F2D A;  1EIH A;  1F9R A;  2CKZ B;  2ICI A;  1WTW A;  4BY7 H;  1VQE A;  3B6Y A;  2R7Z H;  4DAY B;  3BYT B;  2AUK A;  2R92 H;  2KEC A;  4RH6 A;  1BBX C;  1PH1 A;  4BBS G;  1TWC H;  4K6D A;  4QF4 A;  1QUQ A;  4GS3 A;  2I5M X;  2BH8 A;  2VQE Q;  3RMH A;  1S72 A;  1SFO B;  4DUZ Q;  1QVF A;  2LS0 1;  1C48 A;  1R9T B;  1TWH B;  4XIG S;  3Q24 A;  3WOE A;  2EYM A;  1HNW Q;  1QUQ B;  2I5L X;  3NK9 A;  4JI8 L;  3T1Y L;  2LXJ A;  2CH4 A;  2N55 A;  1DD2 A;  5ELC A;  1WTP A;  3S16 B;  3DLL A;  5JPM C;  1STN A;  2DGY A;  3NPP A;  4DAV A;  3TME A;  1LTB D;  1II3 A;  4KD3 A;  4JI4 Q;  1VQP A;  1VQF A;  3S1N H;  1JOQ A;  3JAM i;  1PTO B;  2WAC A;  4JOI C;  4IO9 A;  1EIG A;  3A7A B;  2UXD Q;  2KHS A;  2JP1 A;  4JI5 Q;  4DV3 Q;  5CV8 A;  3A0J A;  1F2M A;  3K7A B;  1NUC A;  5JAV A;  3SEB A;  2E75 C;  5GRO A;  5C0X H;  1B50 A;  1VQB A;  4OON A;  3MWY W;  3CPW A;  4U67 3;  5I4D A;  2K32 A;  2I0Q A;  4H44 C;  1GUG A;  5HGQ A;  2OCE A;  2A69 C;  2G5D A;  2YYZ A;  2RA4 A;  1N32 Q;  1BOS A;  2KQ3 A;  4C2M B;  3BDL A;  4LFB Q;  3HOY H;  4O2D A;  3CRK C;  1SRU A;  1EL0 A;  4LFA L;  1CQF A;  5C5L A;  3BG3 A;  1RIP A;  2JA5 H;  1SMY C;  5J3B A;  2MHV A;  2KCN A;  4DR4 Q;  5COY A;  1C0A A;  2XGT A;  4P75 A;  3QOL A;  3C1F A;  4QY7 A;  1EY5 A;  3I3C A;  3T16 A;  4NXN Q;  2CWA A;  2K5D A;  2F0V A;  1CM9 A;  1PH4 A;  1QNU A;  3S24 A;  2E2J H;  2B8F A;  4N8F A;  2ZJP A;  1XMQ Q;  3EVQ A;  4XDX A;  2X69 A;  3I91 A;  4PNY A;  2B63 B;  2UXC Q;  4X66 Q;  1TII D;  3NBH A;  3N6R A;  3ZYY X;  5A35 A;  1E22 A;  1HFG A;  1STE A;  5JJZ A;  2E2D C;  4MTN A;  4ZUJ A;  4YCW A;  4AYB B;  4YWM A;  4GKJ L;  1QWY A;  3NBH B;  1TXY A;  1SR3 A;  1ZKO A;  3RZO B;  4JK1 C;  1I50 B;  1BCP F;  4BXX H;  1KXL A;  3KK7 A;  3I4N G;  4GNX C;  5EPL A;  4IOC A;  2EXZ A;  4IPD A;  4R4O A;  1IL8 A;  1B53 A;  3HEJ A;  3M85 A;  3H15 A;  1ENF A;  2F4V L;  1JWU D;  3BVG A;  3HKZ E;  4R1J A;  4GLV B;  4ZYS A;  2QA4 A;  4C1N K;  1B3Q A;  1EOV A;  4A3M B;  5HY6 A;  1NNX A;  1C7Y A;  3Q0A A;  3RLN A;  4BBR B;  1Y1W B;  4LF4 Q;  5ISR A;  2C9O A;  2R61 A;  4CKB A;  4G4K A;  2NTS A;  2PI2 A;  3S2H H;  4H0L C;  1SBB B;  3DUZ A;  2R93 H;  3OIQ A;  2JA7 G;  2JA6 G;  3UDI A; 
#chains in the Genus database with same CATH homology
 2UUA Q;  4DR7 Q;  5JJL A;  4DK6 C;  1BKB A;  3Q8D A;  1D7Q A;  5EAY A;  4X64 Q;  2I5H A;  2RCN A;  3J80 i;  3ULJ A;  1VQJ A;  3W1G A;  5GAG C;  5AJ3 L;  4A3E G;  1KQS A;  2VUM G;  4KHP L;  1JT8 A;  1X55 A;  2VL6 A;  1A8V A;  4DR3 Q;  1LUZ A;  1SRO A;  4PZ8 A;  1ASZ A;  2EIF A;  4RG1 A;  3CCR A;  4OO1 G;  3U4V A;  4A93 G;  1VQI A;  5AJ3 Q;  4JYA L;  3J7A 5;  5IYC G;  3KOJ A;  2WB1 G;  4OX9 L;  1WCM H;  5IYD G;  3RN5 A;  4DR6 L;  4OWW B;  3BZC A;  5C0X I;  1PH7 A;  3AQQ A;  4NXM L;  2A8V A;  1VQ7 A;  4XTC S;  3PIO A;  4UPA A;  1Z47 A;  4YCU A;  4A3K G;  1L1O A;  4JI2 L;  2BH2 A;  4QQB X;  1VQO A;  3OTO L;  1VQ5 A;  2BA1 A;  4LFC L;  3HOW G;  4JYA Q;  5IP7 G;  2Q2I A;  3DM3 A;  2OTL A;  4OX9 Q;  5M5W H;  4DR6 Q;  4NXM Q;  3GTP H;  1Y1V H;  2JA7 H;  1MJC A;  1L1O B;  1VQM A;  2JA6 H;  1AH9 A;  1H95 A;  5IY0 A;  4C3J H;  1PH5 A;  4LW1 A;  4JI2 Q;  2GVB A;  4LFB L;  3KF6 A;  3OTO Q;  3GTJ H;  4KLK A;  4C3H H;  4LFC Q;  1L1O C;  2ZTE A;  4YY3 L;  5C3E G;  2K5V A;  4A3E H;  2YU9 H;  2VUM H;  3TRE A;  1YIJ A;  3JAM c;  2NZO A;  1EQR A;  4LUZ A;  5C4J H;  1Y14 B;  4WJ4 A;  1NBW A;  1A63 A;  3KF6 B;  3RLO A;  1XMO L;  1I5F A;  1G6P A;  3PGZ A;  5C4X G;  2WAQ E;  1OXX K;  1FL0 A;  1TWF H;  2D62 A;  2MNA A;  2E2H H;  4A93 H;  3S2D H;  5IT9 c;  2KEN A;  4YY3 Q;  3T1H L;  2Q2H A;  1KL9 A;  4IFD J;  5IYC H;  5IYD H;  2KCM A;  1FGU A;  4JBK A;  5JJI A;  3TEH B;  3S15 H;  1WI5 A;  1JJG A;  1XMO Q;  4HJ7 A;  2IT1 A;  3KDF A;  1ASY A;  5FJ8 G;  1NJI C;  3CCU A;  2VW9 A;  4A3K H;  4LFB Q;  3PO2 G;  1XPR A;  1QVC A;  3T1H Q;  1NMG A;  2K75 A;  1E3P A;  3HOW H;  3L2P A;  5IP7 H;  5M3F G;  2D0O A;  1N33 L;  4B3M L;  4DAM A;  1UEB A;  3ICE A;  4BA1 I;  5GAH C;  2MO0 A;  1EYG A;  2VZA A;  3KDF B;  1MJE A;  3GTL H;  1X9N A;  4DV0 L;  3CP0 A;  4OWX B;  4TVA B;  3AFP A;  3S1Q H;  4QGU A;  2HIX A;  1HH2 P;  2D0P A;  1KC8 C;  5C3E H;  1K73 C;  4PMW A;  4X62 L;  1RL2 A;  4MZ9 A;  4B3M Q;  1N33 Q;  3GTG H;  2KHI A;  4PG3 A;  5M3M G;  5BR8 L;  4UP7 A;  1E1T A;  4DV0 Q;  4GLX A;  3U58 A;  3PIP A;  1FVI A;  4DK3 C;  2PQA A;  1VQH A;  4QIW E;  1E7Z A;  5C44 G;  5C4X H;  1XPU A;  2XTI A;  1MKH A;  4LF5 L;  3PUX A;  3AEV A;  4X62 Q;  3K7U C;  1LTL A;  1D8L A;  1JE5 A;  1V9P A;  3M4P A;  5BR8 Q;  2PQA B;  1YJ9 A;  4GN3 B;  3CME A;  1GM5 A;  2UXB L;  3H0G G;  5FJ8 H;  4BY1 H;  4A3G H;  3PO2 H;  2NN6 G;  4DR5 L;  1N8R C;  4LF5 Q;  1Q7Y C;  2YTX A;  1YEZ A;  2IHE A;  2LXK A;  5M3F H;  1PH6 A;  4J15 A;  4A4I A;  1EWI A;  1IBM L;  1VQ9 A;  1PH8 A;  4LUV A;  2H5X A;  4LUO A;  3PV0 A;  3GO5 A;  2VQF L;  2CCZ A;  2UXB Q;  1EQQ A;  1I94 L;  1YNX A;  1Q1E A;  2NZH A;  4GOP A;  1O7I A;  5C0X J;  3CC7 A;  2Z0S A;  4DR5 Q;  2F3I A;  4A3I H;  1PFS A;  2JQO A;  1IBM Q;  1TWG H;  3ZJY C;  2E5L L;  3GTK H;  1XTD A;  2CWP A;  2VY3 A;  1NE3 A;  2VQF Q;  4QL5 A;  4GOP B;  1I94 Q;  1W2B A;  1N34 L;  4R4T A;  3J81 i;  1LM0 A;  4UY8 C;  4LWC A;  2K50 A;  1T9H A;  4HJA A;  4GOP C;  1JJC B;  1Q12 A;  3EBE A;  4DV1 L;  3CXC A;  1K9M C;  4GKK L;  2UUC L;  2E5L Q;  1XNR L;  3ULP A;  5LMU L;  1Q86 C;  3GTO H;  1WOC A;  2K4K A;  1N34 Q;  3E9I A;  1VCI A;  1KD1 C;  1UE7 A;  3H0G H;  1K8A C;  1Q8K A;  5JEA J;  1HZA A;  2DUD A;  3CCS A;  4DV1 Q;  2NVX H;  1JJ2 A;  2L15 A;  4PZ6 A;  5GQO A;  2UUC Q;  4GKK Q;  1XNR Q;  1M90 C;  1HR0 L;  2N78 A;  3F1Z A;  4C3I H;  5LMU Q;  3M7N A;  1GD7 A;  4KHZ A;  1OTC A;  1PH3 A;  2IY5 B;  3UDI A;  3IRB A;  3BZK A;  1B70 B;  4JC0 A;  3MXN B;  1SFO H;  1HNX L;  3I4M G;  1R9T H;  3H3V H;  1TWH H;  3J80 c;  1VQ8 A;  1TWA H;  1HR0 Q;  3A5Z B;  2EQS A;  3K81 C;  1CSQ A;  3CW2 C;  3SGI A;  2AMC B;  3ERS X;  4HIM A;  2IX1 A;  3A5U A;  1HNX Q;  1PV4 A;  3S16 H;  4NB3 A;  2ES2 A;  2V1C C;  5IWA L;  3CC2 A;  4OO1 I;  1HZ9 A;  1SLJ A;  2JEB I;  1P16 A;  2WAQ G;  4JCV E;  1M1K C;  4GLA C;  2AKW B;  4DV4 L;  1WFQ A;  2NVQ H;  2B29 A;  4JBJ A;  2OWO A;  2KHJ A;  1N36 L;  3S1R H;  1PYB A;  4A3F G;  3STB D;  1YVC A;  4EX5 A;  4P71 A;  2K5H A;  1WJJ A;  1NY4 A;  5ELN A;  1E24 A;  5IWA Q;  1UE1 A;  4IJL A;  1XJV A;  2JA8 G;  4BBS H;  4DV4 Q;  2Q2T A;  1VQD A;  1YHQ A;  4K0K L;  1N36 Q;  1V43 A;  4JG2 A;  4PZ7 A;  4QJF A;  2C35 B;  1X6O A;  2B63 G;  3K7A H;  4HIO A;  3RNU A;  1X3G A;  3GTQ H;  2R6G A;  4DV6 L;  4DR2 L;  1XPO A;  3I4M H;  3EIV A;  2A1A A;  3CAM A;  1LYL A;  2N49 A;  3FP9 A;  3UDX A;  4BY1 G;  1L0W A;  4DUY L;  2ASB A;  4A3G G;  3K80 C;  1L2F A;  3ER0 A;  4HJ8 A;  4B3T L;  4K0K Q;  4DV2 L;  3HOV G;  1G29 1;  4IPH A;  5H1S E;  4DV7 L;  1U5K A;  4O0A A;  4DV6 Q;  4DR2 Q;  2ID0 A;  4C2M H;  1EIY B;  2AWO A;  4DUY Q;  2PMZ E;  4DNI A;  4B3T Q;  2GVA A;  2CFM A;  4UP9 A;  2ZTC A;  4DV2 Q;  4A3I G;  1K8G A;  1BVS A;  4A3F H;  1AE2 A;  3I4O A;  4UP8 A;  1CSP A;  2ZJR A;  4DV7 Q;  1XNQ L;  1X3F A;  4AYB E;  3UDG A;  1HNZ L;  3PUW A;  3CQZ H;  4YWL A;  4JI7 L;  4BA2 I;  2JA9 A;  5DLQ E;  2VNU D;  2MO1 A;  5GAE C;  1X56 A;  3I56 A;  2JA8 H;  1HZB A;  4B3S L;  4X6A H;  1HR0 W;  4IFD G;  1MIU A;  2R7F A;  1S3O A;  5LMN W;  1PVO A;  1HJP A;  2YTY A;  1IBL L;  1XNQ Q;  1E1O A;  1HZC A;  2Y0S E;  4OXP A;  3G6E A;  1W3S A;  1HNZ Q;  3CCL A;  4JI7 Q;  2B63 H;  2HT1 A;  1GKH A;  1PYS B;  4A3M G;  3VDY A;  2R7D A;  1PHJ A;  4BY7 G;  1JMC A;  1U0L A;  1SE8 A;  3M4Q A;  4OWT B;  4B3S Q;  4BBR G;  1Y1W G;  5GAD C;  3BJU A;  4AQY L;  5ELO A;  3AFQ A;  3HKS A;  3AYH B;  1Q1B A;  3KJO A;  1FJG L;  3HOV H;  1G51 A;  4JI0 L;  1IBL Q;  1IBK L;  1IYJ B;  1VQN A;  2YV5 A;  3F2B A;  3M3Y H;  5M5X H;  1Q82 C;  4JI1 L;  1PH2 A;  3CCE A;  2FXQ A;  3M9B A;  4YCV A;  4AQY Q;  4P72 A;  4LF7 L;  1I50 H;  1K83 H;  1S40 A;  1FJG Q;  4A3J G;  1SN8 A;  1VQ6 A;  1YHB A;  4JI0 Q;  2K14 A;  3CD6 A;  4P74 A;  1IBK Q;  3S17 H;  2OQ0 A;  1VQL A;  3CPF A;  4POF A;  4JV5 L;  1IL2 A;  4JI1 Q;  4ME3 A;  3U50 C;  3GTM H;  1KRS A;  2WFW A;  3K8A A;  1YI2 A;  1EUJ A;  4JBM A;  1I6H H;  3GDE A;  2JEA I;  4LF7 Q;  2UUB L;  2ZJQ A;  4A3L G;  1X54 A;  1CKN A;  2ALY B;  2PNH A;  3HOU H;  4TQU S;  1JB7 A;  3HFZ B;  3UE0 A;  3PO3 G;  1CKO A;  3STB C;  1I3Q H;  1UE5 A;  4JV5 Q;  2OTJ A;  3FHW A;  3F2D A;  1Z9F A;  2CKZ B;  3I7F A;  4A3M H;  4IOA A;  2PI2 E;  1VQE A;  4BY7 H;  4FDB A;  1CKN B;  4A3D G;  3UE1 A;  4IJH A;  1N9W A;  3B6Y A;  3PSI A;  2UUB Q;  2R7Z H;  4DUZ L;  4BBR H;  1Y1W H;  4DAY B;  2B3G A;  5FLX c;  2R92 H;  4LF9 L;  4HIK A;  4ALP A;  3EN2 A;  3NEM A;  4A3C G;  4L5Q A;  1PH1 A;  3PF4 A;  4BBS G;  1HNW L;  1WYD A;  1TWC H;  1V1Q A;  1J6Q A;  3K0X A;  3RR5 A;  2Q2U A;  1QUQ A;  3CCV A;  4GS3 A;  3RZD H;  5LMN L;  2I5M X;  1A0I A;  2BH8 A;  1DGS A;  2VQE Q;  4R4Q A;  3TRZ A;  1S72 A;  4DUZ Q;  2IX0 A;  5C0X G;  3NEL A;  3CCM A;  4L5R C;  4YHH L;  1QVF A;  4R4C A;  4LF9 Q;  3F2C A;  1QZG A;  4XIG S;  3G71 A;  4A3J H;  1YHA A;  4LF8 L;  1HNW Q;  4DV5 L;  1QUQ B;  2I5L X;  4JI8 L;  3KJP A;  3T1Y L;  2LXJ A;  1OXS C;  2E2I H;  3HOX G;  1EFW A;  5LMN Q;  3PUZ A;  4JI4 L;  3W1B A;  2HHH L;  1J5E L;  3DLL A;  4YHH Q;  4A3L H;  5IP9 G;  3CMA A;  4JOI A;  4LF8 Q;  3TS0 A;  2RF4 A;  3HOY G;  3JC6 6;  2DGY A;  4DV5 Q;  4MNO A;  1SMX A;  3BU2 A;  3WWV A;  4HID A;  4JI8 Q;  3PO3 H;  3T1Y Q;  3PF5 A;  4KHP Q;  1NMF A;  2JA5 G;  2UXD L;  1YIT A;  1VQ4 A;  4JI5 L;  4JI4 Q;  4DV3 L;  1VQP A;  3CF5 A;  1OXU A;  1VQF A;  2BA0 A;  1J5E Q;  2HHH Q;  4A3D H;  4A75 A;  3HOZ H;  3S1N H;  4AH6 A;  3D31 A;  3JAM i;  5JEA G;  4KI0 A;  4AIM A;  4A3C H;  4JOI C;  4EQ5 A;  3J81 j;  4IO9 A;  5IYB H;  1PH9 A;  2UXD Q;  1KAW A;  1YZ6 A;  4JI5 Q;  1GVP A;  4DV3 Q;  3TS2 A;  2WB1 E;  3A0J A;  3L0O A;  1UWV A;  1X65 A;  5GRO A;  1N32 L;  2NVT H;  1VQB A;  4OON A;  4JI6 L;  2VS1 A;  2K52 A;  2CQO A;  1GO3 E;  2AWN A;  3CPW A;  1OXV A;  2I0Q A;  3HOX H;  1IXR A;  1VS0 A;  4A3B G;  5HGQ A;  2OCE A;  4DR4 L;  2YYZ A;  4AYB G;  1EIF A;  1N32 Q;  5IP9 H;  4GN5 A;  4JI6 Q;  4NXN L;  2RHQ B;  2QEX A;  4O2D A;  3HOY H;  2NVY H;  1SRU A;  2OQK A;  2UU9 L;  3S14 H;  4LFA L;  4Y52 H;  1CKM A;  1BBW A;  2JK8 A;  2HIV A;  2MFI A;  1RIP A;  1XMQ L;  2JA5 H;  4BXX G;  5J3B A;  4DR4 Q;  2Y0S G;  4L5T A;  1C0A A;  4B3R L;  2XGT A;  4P75 A;  4POG A;  2ZTD A;  2UXC L;  5FLM G;  2N3S A;  4QY7 A;  4X66 L;  1UE6 A;  1YJN A;  2CWA A;  3U4Z A;  4LF6 L;  3RN2 A;  2UU9 Q;  4NXN Q;  2KBN A;  4LFA Q;  1PH4 A;  3S24 A;  1B7Y B;  2LSS A;  2E2J H;  3A74 A;  3UDF A;  4DPG A;  2EXD A;  2KCT A;  2ZJP A;  1XMQ Q;  1OXT A;  4GN4 B;  2MQH A;  3HOU G;  2HQL A;  1VQC A;  1VQA A;  3I55 A;  3PCO B;  4L5S A;  2IHF A;  4B3R Q;  2A19 A;  2UXC Q;  4DKA C;  4X66 Q;  4Y7N H;  3D0F A;  4LF6 Q;  1QVG A;  2ATW A;  2JJQ A;  2R7Z G;  1E22 A;  3I2Z A;  4P73 A;  1YBY A;  4JBW A;  4R4I A;  1Q81 C;  2R92 G;  4MTN A;  4GNX A;  4YCW A;  4A3B H;  3I4N H;  1P8L A;  2F52 A;  3CC4 A;  1C9O A;  3GD7 A;  3M4O H;  4YWM A;  4GKJ L;  3NBH B;  4IPG A;  1TXY A;  1SR3 A;  2WP8 J;  1YJW A;  3FKI G;  4NPS A;  4LNQ A;  3RZO H;  2R93 G;  4GNX B;  4IFD I;  3HKZ G;  2ZM6 L;  4BXX H;  1KXL A;  3OYY A;  1AE3 A;  3I4N G;  2N8N A;  4IPC A;  4GNX C;  4GKJ Q;  2E8G A;  2QGQ A;  1CUK A;  5FLM H;  1K3R A;  3PUY A;  4IOC A;  3OW2 A;  4APV A;  3CCJ A;  4IPD A;  4R4O A;  3W5O A;  1QZH A;  1VQK A;  3E0E A;  1KIX A;  2K5N A;  4X65 L;  3M85 A;  4WJ3 M;  3H15 A;  2YTV A;  4A76 A;  2NN6 I;  3KF8 B;  1Q46 A;  2ZM6 Q;  2F4V L;  4YWK A;  4LF4 L;  3NEN A;  3HKZ E;  4R1J A;  1K0R A;  4GLV B;  2JE6 I;  1NTG A;  1B8A A;  4RMF A;  3G4S A;  2QA4 A;  5M5Y H;  1EOV A;  3MEF A;  3E9H A;  5HY6 A;  1WCM G;  3RLF A;  4HJ9 A;  3L7Z C;  1C7Y A;  5IE8 A;  2Z6K A;  3LGJ A;  4X65 Q;  1KHI A;  3RLN A;  2VQE L;  4JI3 L;  4HJ5 A;  4DR1 L;  3HOZ G;  1IZ6 A;  1KRT A;  2F4V Q;  1BBU A;  2RHS B;  3H3V I;  4LF4 Q;  4H02 A;  2UUA L;  4DR7 L;  2AHO B;  5JJK A;  1X3E A;  3ULL A;  3J7Z C;  3F8T A;  3KFU A;  5IYB G;  5M3M H;  4X64 L;  3TQY A;  3KYH C;  3S1M H;  3J81 c;  5K36 G;  2PI2 A;  5E7N A;  3S2H H;  3CCQ A;  4DR1 Q;  5C44 H;  3PUV A;  3FKI H;  2GN5 A;  4JI3 Q;  2R93 H;  4DR3 L;  1Y1V G;  1A62 A;  1PA6 A;  3KLW A;  2JA7 G;  2JA6 G;  1VQG A;  2Z6K C;  3G48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...