4IJLA

Fragment-based discovery of protein-protein interaction inhibitors of replication protein a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
SHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of Protein-Protein Interaction Inhibitors of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
total genus 33
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ijlA00
2DGYA 2A1AA 4EX5A 2QA4A 2N78A 5M5YH 2ZM6Q 2VUMH 3TRZA 2D0PA 1S3OA 1Y1VH 1KHIA 1OXVA 1XNQL 4DR6L 1SR3A 2K50A 5M3FG 1X6OA 1Q12A 2MFIA 2GVAA 2K5VA 3E0EA 3KJPA 3CCSA 4JI3L 2Q2TA 1AH9A 4YHHQ 2NZOA 1X9NA 2XGTA 4KHZA 3STBC 4WJ4A 1PH8A 1YEZA 4KLKA 3F2DA 2R93H 2Q2UA 4A3GG 4PZ7A 3CC7A 2NVQH 3H0GG 3KLWA 4UPAA 1UE5A 3UDIA 3A74A 4FDBA 4XTCS 2UUCL 2JA7H 2JA5G 4A3BG 3F2BA 3CW2C 1LYLA 1X55A 2VY3A 3T1HQ 1XNRQ 2KENA 2UUBL 4R1JA 2I0QA 3EN2A 1TXYA 4GOPB 5AJ3L 2E8GA 3FKIG 1QUQB 1R9TH 1E1OA 2H5XA 3BU2A 4A3LH 1KD1C 5EAYA 3CCVA 1IBMQ 2EQSA 4P74A 3HOYH 1P16A 1A8VA 1UEBA 4ME3A 4JI5Q 2R6GA 4YCUA 4A3EH 1SMXA 3UE0A 1NMFA 4HJAA 4YHHL 4JCVE 3K7AH 4DAMA 2AHOB 3GO5A 5C0XJ 3F2CA 3PUYA 3CD6A 4K0KQ 4DV5Q 2Q2IA 2K75A 3PSIA 3I4OA 5FLMH 4C2MH 4GN5A 3M9BA 5C4XH 1W2BA 3A5UA 4A3KH 1YITA 4BY7G 1YHQA 3E9HA 3T1HL 1I50H 3HOXG 1V43A 1KC8C 1XNRL 2YTYA 1YVCA 1Y14B 4IFDG 1WCMG 1VQ7A 2AWOA 1IBML 5IP7G 4JOIC 3CCQA 1V1QA 3PV0A 3UDFA 4B3MQ 3JC66 4O2DA 3AFQA 4JI5L 1UE1A 1QUQA 1RL2A 2UU9Q 1HNXQ 3I4NH 1KAWA 4APVA 2C35B 5IY0A 4GLXA 4JI7Q 2EXDA 4BBSG 1N36Q 1V9PA 3PF4A 4LUOA 2QEXA 4DR1Q 5HGQA 4DV7Q 2B3GA 3CP0A 1QVFA 3CCRA 4GNXC 1I94Q 1SROA 1JMCA 3AEVA 4A3GH 4AQYQ 1D7QA 5DLQE 3BZKA 4DV5L 3W1GA 4IOCA 2JA5H 4A3BH 1PH3A 4GOPC 4JBKA 4LF5Q 3UE1A 2ZJPA 1YHBA 1ASZA 4UP8A 1L2FA 3HOZH 1VCIA 2CFMA 5IYBG 4A93G 4LF8Q 1BBWA 4A3IH 1WJJA 5GQOA 3A0JA 2VQEQ 2BA0A 2PNHA 3JAMc 5FJ8G 1XPUA 4LUVA 4UY8C 1XPRA 1VQAA 2ZTCA 1Q7YC 2YU9H 4B3ML 1Q86C 5M5XH 4L5RC 1HNZQ 2MQHA 2XTIA 1ASYA 2UU9L 1HNXL 3NELA 4R4OA 3J80c 3HOVG 5GADC 4JI7L 4JBJA 3CC4A 1YHAA 1N36L 1BKBA 4JBWA 3K8AA 3M4QA 4DR1L 4A76A 1JE5A 4IJLA 4DV7L 1VQ6A 1I94L 4X65Q 1GO3E 4AQYL 4A3FG 1PYBA 4IPGA 4GN4B 5JEAG 5C3EH 2A19A 2HHHL 1MJCA 3JAMi 1I5FA 3ICEA 1SLJA 1VQDA 2YV5A 5ELOA 1J5EQ 2JA8G 4OXPA 3HOXH 4LF9Q 4NXNQ 3OW2A 4LF5L 2KCTA 2NVTH 1X3FA 1K83H 2ZTDA 2N8NA 2L15A 4IPCA 1CKNA 5IYCH 1JB7A 1VQ5A 3J80i 4DR2Q 4LF8L 3H3VI 5M5WH 2WAQE 2VQEL 1MJEA 3KYHC 4DV4Q 3HOUG 4BA2I 2Z0SA 2R92H 3S1MH 3K80C 3KF6B 2CWPA 5IWAQ 1HR0Q 3PO2H 2AKWB 1PHJA 1E1TA 1A62A 5H1SE 4GKJQ 1JJGA 1Y1WG 2CWAA 1HNZL 4IFDI 1VQ4A 1OTCA 1PH2A 2DUDA 2F3IA 1PH7A 3WWVA 4QGUA 1CKMA 2WFWA 1VQLA 2I5HA 4JG2A 4KHPQ 2B63G 4A3CG 4JV5Q 5GAHC 3PO3H 2NN6G 2WP8J 4C3JH 1VQKA 4AYBG 4H02A 4YWKA 5LMNQ 1LTLA 3ULJA 2GN5A 3M4PA 4UP7A 3AFPA 2CCZA 1HH2P 1J5EL 2JA6G 4A93H 1TWFH 4NXNL 4NPSA 2JA9A 3EBEA 1NTGA 1OXXK 2FXQA 4DV0L 2WB1E 2PI2E 3F1ZA 2E5LQ 4NXMQ 3E9IA 4DV4L 3NBHB 4BXXH 1BBUA 2I5LX 2YTVA 4A3MG 3RLOA 5IWAL 1WOCA 1HR0L 3I4MH 3RR5A 4QIWE 3VDYA 4JBMA 1WI5A 1IBLQ 1B7YB 4GN3B 1KQSA 3KF6A 2E2IH 1D8LA 4KHPL 1Q8KA 2OQKA 4A3FH 4MTNA 1QZGA 4JV5L 4DUZQ 4LWCA 1NMGA 2VL6A 1SFOH 2VS1A 2ZM6L 3BZCA 3W1BA 3TQYA 2ATWA 1WYDA 5M3MH 4YCVA 1DGSA 2PQAA 4JI0Q 1JT8A 2ASBA 5LMNL 4WJ3M 3CMEA 4HIMA 2IX1A 3HKZG 3BJUA 4LW1A 3U4VA 3Q8DA 4GLVB 1EOVA 5C0XG 4R4TA 3PCOB 2E5LL 4A75A 2ZTEA 4NXML 2D62A 2D0OA 3GTQH 2N49A 1I6HH 1YZ6A 1Y1WH 2V1CC 1MKHA 3RLNA 4X62Q 2F52A 3CPWA 4IO9A 3RNUA 2Z6KA 1K3RA 1K8GA 1N33Q 4HJ7A 1X3EA 1IBLL 2Q2HA 5LMUQ 1E3PA 3FP9A 1UE7A 3U4ZA 1VQMA 1GM5A 4A3CH 2PI2A 3KOJA 3I2ZA 3H15A 3LGJA 3L2PA 1W3SA 4DUZL 4HIKA 1Q1EA 1X3GA 4OWWB 1L1OA 1YJ9A 2IHFA 4A3DG 4JI0L 5M3FH 1N34Q 1C0AA 1EQRA 4JI8Q 1PYSB 4HJ8A 5C44G 3CC2A 2NVYH 3DM3A 3PUXA 4PG3A 3G71A 2NN6I 4RMFA 2JEAI 3AYHB 4HIDA 3OTOQ 3S16H 1CSQA 1XMQQ 1Q1BA 2Y0SG 1P8LA 1QZHA 3S14H 4GKKQ 3H0GH 1L0WA 4K0KL 4R4QA 1CKNB 4POFA 3TEHB 2MNAA 3RZDH 1WFQA 1B8AA 1NBWA 1I3QH 4AH6A 3S2HH 2HQLA 4PZ6A 4QJFA 1E22A 2OCEA 1QVCA 5GAGC 5IYDG 5LMNW 2MO0A 2K5HA 2E2HH 3FKIH 1N33L 1YIJA 3UDGA 3G48A 5LMUL 1SE8A 1EQQA 1HZBA 4BY1G 1FJGQ 2K52A 1A63A 1H95A 1PH1A 2ZJQA 1CSPA 1VQPA 4B3SQ 3CQZH 3B6YA 3PIPA 2ZJRA 1YJNA 3IRBA 3PIOA 2CQOA 1N34L 2JEBI 1XTDA 1HZAA 2JE6I 1Q82C 2UXBQ 4LUZA 2I5MX 4XIGS 1PA6A 1E7ZA 4BBRG 4HJ9A 4LFAQ 1Y1VG 3GTMH 3OTOL 1VQEA 2LSSA 1XMQL 3H3VH 4GKKL 1U0LA 4JI6Q 3GTLH 3HOWG 4BY7H 1A0IA 3W5OA 5C0XI 3A5ZB 1NJIC 4MZ9A 2R93G 3KF8B 4PZ8A 1WCMH 4JYAQ 3TS0A 3CCEA 4KI0A 5IP7H 1FJGL 4IJHA 4BA1I 4DR5Q 2JA7G 4P73A 5J3BA 3L0OA 3MEFA 4HJ5A 4B3SL 3M7NA 1FVIA 1SN8A 2RHSB 4R4IA 1YNXA 4L5QA 5GROA 1OXSC 2NVXH 2N3SA 4A3LG 4Y52H 4YCWA 4JI2Q 1C7YA 1AE3A 3GD7A 4BBSH 3S1QH 2PQAB 3ZJYC 1VQOA 1LM0A 2LXJA 2ALYB 3KDFA 3CMAA 3CCUA 1PH6A 1VQ8A 1X56A 1YI2A 4LF4Q 4LFAL 2YTXA 4OO1I 3I7FA 4X65L 4GS3A 1UE6A 3TS2A 1IXRA 1EUJA 4DAYB 4YY3Q 3STBD 5IE8A 1CUKA 3PUZA 3PF5A 3S1NH 2RF4A 1LUZA 1N8RC 2UXDQ 4POGA 1PH5A 3S15H 5IYBH 4LF9L 5K36G 3M4OH 3SGIA 2K4KA 4LFCQ 4A3JG 3DLLA 1TWGH 4JYAL 1X65A 1Z9FA 2HIXA 4P71A 5FJ8H 4DR2L 2UUBQ 4DR5L 3CF5A 4A3KG 1OXTA 1N9WA 1U5KA 4TVAB 1QVGA 1VS0A 3U50C 1X54A 5IP9G 4GKJL 4DR3Q 3HOVH 4JI2L 4DNIA 1AE2A 3L7ZC 4LF7Q 4BBRH 1L1OB 1VQCA 3OYYA 1NY4A 3RLFA 3GTKH 4DUYQ 1J6QA 2EIFA 4LF4L 5HY6A 2R7DA 4DKAC 3I4NG 2E2JH 4LF6Q 3HOWH 4DPGA 2MO1A 4YY3L 2JA8H 2YYZA 4IPHA 3GTGH 2UXDL 3HKSA 1TWCH 1VQBA 1EIYB 4MNOA 4LFCL 4GNXB 2IX0A 3J7ZC 2F4VQ 3HOUH 1HNWQ 3T1YQ 4L5SA 2JJQA 1VQGA 2LXKA 1BVSA 1VQHA 2OQ0A 3S24A 1K9MC 1JJ2A 2BH2A 3KFUA 1G6PA 3CPFA 4OONA 2IHEA 3PUWA 3CCMA 1YJWA 3HOZG 2CKZB 3K7UC 4DR4Q 1VQIA 2VNUD 5ELNA 4A4IA 2OTLA 2PMZE 4A3IG 3PGZA 4B3TQ 1TWAH 4J15A 4DR3L 1K8AC 4LF7L 2ES2A 4DK6C 2R7ZG 2AWNA 4NB3A 3ULLA 2B63H 2OTJA 4X6AH 4PMWA 2AMCB 4DUYL 3PUVA 2GVBA 1EFWA 2WAQG 4Y7NH 1FGUA 1KRSA 3HFZB 4DK3C 1B70B 2JQOA 4LF6L 4RG1A 1M1KC 3KJOA 5JJLA 4OO1G 4X64Q 2JA6H 1HR0W 2BH8A 4JOIA 1MIUA 2Z6KC 4A3JH 1PV4A 3K81C 1HZ9A 1VQJA 4OWXB 5GAEC 5C3EG 2F4VL 1HNWL 4UP9A 3RN2A 1XMOQ 3T1YL 1EYGA 2IY5B 2K5NA 4A3MH 1KIXA 1EWIA 4HIOA 4DR4L 4JI1Q 2JK8A 1C9OA 1L1OC 2KHJA 5IP9H 3M85A 4DV1Q 3NEMA 5IYCG 4OWTB 4GNXA 2HT1A 4X62L 1KXLA 4B3TL 3AQQA 4IFDJ 2NZHA 1IZ6A 4AYBE 1UWVA 1PH9A 2R92G 5BR8Q 3G6EA 1G291 1T9HA 4DR7Q 2VQFQ 2VW9A 4GOPA 1GVPA 3MXNB 4OX9Q 2KCMA 1IBKQ 3PO2G 4R4CA 2WB1G 3J81c 3CXCA 2B29A 4YWMA 3KDFB 3HOYG 4X66Q 1HZCA 1Q46A 1CKOA 4O0AA 5E7NA 1GD7A 4X64L 3I55A 1Q81C 1RIPA 2A8VA 4JI8L 4QL5A 3PO3G 3J81j 2HHHQ 1K0RA 2IT1A 2K14A 1G51A 4IOAA 4EQ5A 4ALPA 5FLXc 2KBNA 4B3RQ 4QQBX 1N32Q 3GTPH 3M3YH 4LNQA 1XMOL 3CCLA 3S17H 4DV6Q 3GTJH 3ERSX 3I56A 3J81i 4JI1L 2UUAQ 4C3IH 4DV1L 4DV2Q 3UDXA 2UXCQ 3S1RH 1E24A 3J7A5 2QGQA 4P75A 3ULPA 1O7IA 2R7ZH 4JI4Q 1PVOA 4BXXG 3D31A 5C4JH 5BR8L 4DR7L 2VQFL 4OX9L 1S40A 3HKZE 3NENA 1IBKL 1Z47A 1HJPA 3RN5A 2VZAA 2RHQB 3CAMA 3I4MG 1KL9A 1YBYA 2BA1A 1XJVA 3G4SA 1K73C 1VQ9A 4A3DH 4LFBQ 1JJCB 1IYJB 3K0XA 4X66L 4DV3Q 4QY7A 2VUMG 3ER0A 4L5TA 5C44H 1S72A 3GTOH 1TWHH 4IPDA 4GLAC 2UXBL 4TQUS 3U58A 1IL2A 1XNQQ 3TREA 4DR6Q 5M3MG 2R7FA 4AIMA 4B3RL 5JEAJ 1N32L 1PH4A 2RCNA 2OWOA 4JI3Q 4DV0Q 4A3EG 4DV6L 4JI6L 1FL0A 2HIVA 5IYDH 1OXUA 1M90C 2UUAL 1EIFA 4YWLA 1GKHA 1PFSA 4DV2L 4P72A 2UXCL 3EIVA 3D0FA 4JI4L 4BY1H 2UUCQ 3FHWA 5FLMG 3RZOH 4JC0A 5C4XG 5IT9c 5JJIA 1VQFA 1KRTA 2ID0A 3CCJA 1VQNA 3S2DH 1XPOA 3F8TA 4C3HH 5AJ3Q 5JJKA 2KHIA 1SRUA 3GDEA 4LFBL 1NE3A 4DV3L 2Y0SE
chains in the Genus database with same CATH superfamily
1B3QA 2QA4A 4QMGA 5M5YH 3TRZA 3D8GA 4V190 1SR3A 1Q12A 2K05A 4RWSC 2Q2TA 2EYOA 4A93B 5EBCA 1WTWA 1TY2A 3Q23A 1PH8A 4KLKA 3F2DA 5IT9L 1LABA 3KLWA 2PQEA 3QG1A 4FDBA 1DYQA 2WACA 3H09A 3CW2C 1XNRQ 2KENA 2UUBL 1TXYA 4GOPB 1R9TH 3FKIG 1JC7A 5EAYA 3M4YA 3CCVA 2HDLA 3PMFA 1PZKD 2EYFA 4ME3A 2R6GA 1EZ6A 3I8ZA 2E2JB 4A3EH 3GTGB 1L0YB 4YHHL 4DAVA 1BO0A 4LFBL 2XN9C 2AHOB 3F2CA 2Q2IA 2B2UA 2HCIA 3EQLC 1I50H 2YTYA 5I2XA 1YVCA 3NBHA 4HEDA 2D5DA 1F2MA 3T16A 2AWOA 1IBML 5CMDA 4OGQC 2F0OA 2WKDA 3K5MA 4JI5L 1QUQA 1RL2A 1HNXQ 3I3CA 2EXDA 3FPPA 1N36Q 2JA6B 3PF4A 2QEXA 1V1PA 2AQ3B 1JMCA 4A3GH 1SROA 2OXPA 5KNDA 1QG7A 5BN4A 3NBIA 1PH3A 3A55A 4GOPC 4A3MB 3E6ZX 3V05A 1ASZA 4XYQA 2CFMA 1I4HA 2VQEQ 2BA0A 3NE5B 1XPUA 1XPRA 2YU9H 4L5RC 3DWPA 4PQXA 3T51B 2UU9L 3NELA 4OEMB 1DJRD 4ODGA 1VQ6A 1GO3E 4A3FG 1PYBA 2R61A 4IPGA 2HHHL 1MJCA 1AN8A 2YV5A 5ELOA 2JA8G 3NSWA 5I6YA 4OXPA 4LF9Q 1H9KA 5E3FA 3OW2A 1D1IA 3T13A 2L15A 1CKNA 4RHSA 2B8FA 3HOUG 1L0XB 4BA2I 4DV4Q 2EJFC 2R92H 3K80C 1E2WA 2K5QA 5IWAQ 1F2ZA 2JXMB 1DOKA 2F0PA 1VQ4A 2F3IA 5C44B 1EEID 2WFWA 4JG2A 3PO3H 1J9OA 5KNBA 1XWEA 4AYBG 4H02A 5A35A 1LTLA 1H9SA 1HH2P 1J5EL 2A74C 4NPSA 3BVGA 3EBEA 1K3BC 1NTGA 1OXXK 5DAUA 3G7LA 2IX3A 2WB1E 4X3KA 2KVMA 3D4DA 5FK9C 2YTVA 2B2YC 4ZLTF 4QIWE 4JBMA 2K5DA 1B7YB 3FVQA 1TU2B 4X3SA 1V1OA 4FF2A 3PIP3 4KHPL 1Q8KA 4DUZQ 1STYA 2VL6A 1SFOH 1U4MA 3BZCA 3BDCA 3W1BA 1JT8A 1QE6A 3HOWB 4GLVB 2ZT9C 3SHLA 2KCCA 1TWCB 2G9HD 2D0OA 2N49A 3A8JE 1YZ6A 4LK1C 2V1CC 1MKHA 3RLNA 4C3IG 1N33Q 1F9SA 1PTOB 4HMIA 1GM5A 2NZ1D 1TWAB 5IGCA 3I4LA 5LL6S 3LGJA 1W3SA 1EWHA 1C0AA 1B3AA 1FYCA 1AEXA 1NR2A 4JI8Q 2TSSA 2NVYH 2F0GA 1ENFA 2PW5A 2JEAI 3AYHB 4HIDA 1G2SA 3S16H 4BS9A 1Q1BA 2OF1A 2DNCA 4XQNA 4C2MB 1L0WA 4K0KL 5I9OA 4G4KA 3TEHB 2MNAA 3RZDH 1BXTA 2HQLA 2A68D 5GAGC 1E22A 2OCEA 2MO0A 2K5HA 1A6XA 4M1UB 3UDGA 1Q3LA 1SE8A 4DK1A 4BY1G 1EQQA 1TQOA 2ZJQA 1TS3A 2ZJRA 1YJNA 2OT2A 2JEBI 2H1EA 3VR4A 2JE6I 4LUZA 3K5NA 5CC4A 4XIGS 3D6WA 2XRQD 1PA6A 1E7ZA 1KAAA 3OTOL 1VQEA 4FYDA 1KLGD 3DUZA 2NTSA 2FMMA 3GTLH 1CI3M 5KRUA 1NJIC 1WCMH 4JYAQ 2BOSA 3W3AA 4ZAIA 3S1RB 3C3LA 2R7ZB 1DZ1A 4IJHA 4BA1I 4DR5Q 1Q90A 1SMYC 4B3SL 3M7NA 3BYTB 1SN8A 4R4IA 5GROA 2NVXH 4HCEA 4K5VA 1C7YA 2PZWA 3GD7A 3Q24A 2PQAB 2B2TA 1LM0A 2ALYB 1PH6A 1VQ8A 4LF4Q 3SXHA 1EEFD 2EXZA 5C3EB 3CU7A 2PPBC 4GS3A 2Z4HA 5IE8A 3S1NH 2DNEA 2RF4A 1LUZA 2UXDQ 1JICA 2FHTA 3S15H 4HMJA 4ZYSA 4K6LA 3VYUA 1SEBD 1S5FD 4DR2L 5JOBA 3CF5A 3PO2B 2WB1B 4CBVA 3RZOB 5C4ZA 1BCPF 3U50C 1X54A 2F0NA 4GKJL 4N9PA 4DR3Q 3L7ZC 1YNNC 2B8GA 4LF7Q 1NY4A 4WJWA 4QIWB 3IFDA 5M5YB 2F3VA 4R8NA 1JCKB 2DY8A 4DKAC 5JEAH 2E2JH 5IGFA 2MO1A 3ND8A 1KTKA 1KNAA 3FDTA 3GTGH 2Z1CA 1UUPA 1FNWA 2IX0A 3J7ZC 2F4VQ 3ND9A 3KK7A 3BZDB 1U4RA 1JJ2A 1K9MC 2LY7A 3CPFA 3CCMA 3QJYA 2LS01 3OW7A 5D3IB 2NB0A 2OTLA 2VNUD 2PMZE 4B3TQ 1R9TB 5AFWA 3FMCA 2E2IB 2DJGC 2OTJA 2AMCB 1HFGA 1SDFA 2CW0D 2WAQG 3AB9A 1FGUA 1KRSA 5EKIA 4Y7NH 4ZKCB 4RG1A 4OO1G 4A3EB 2JA6H 4HAEA 4IUVA 3BVZA 3R93A 4A3JH 2Z6KC 1PV4A 1HZ9A 1S5ED 3GTQB 3TZDA 3OSOA 1LTTD 1EYGA 5C4HA 4A3MH 2MGSA 4HIOA 1C9OA 4K14A 1I50B 2HT1A 4X62L 1SNMA 4DGZA 1O80A 1NSNS 2R92G 1G291 2VQFQ 1EWCA 4GOPA 2ZXPA 2KCMA 1IBKQ 4R4CA 2PCFB 4YWMA 3SK8A 4RH6A 1Q46A 5IGBA 3VYSA 1RIPA 2A8VA 1I4PA 3PO3G 4JW0A 1A3VA 1K0RA 4LAAA 4IOAA 4A3GB 3CCLA 3HZXA 4KY7A 1I3QB 4IZ8A 3GTJH 2MPMA 4DV1L 2QGQA 1PVOA 3D31A 1CTMA 5D14A 1HFNA 5BR8L 1STAA 1A2UA 1JOKA 2YU9B 1K73C 2BCOA 2L12A 4DA2A 2WAQB 4DV3Q 1C48A 3QWNA 4L5TA 5C44H 5J22A 5FLXL 5CV7A 5LHY1 2IL8A 3DEOA 4XDXA 4TQUS 4DR6Q 3TREA 2A73B 2R7FA 4B3RL 4IN3A 1B9NA 5JEAJ 1N32L 1SBBB 3OIPA 4BY7B 3E0JA 3NTKA 2F4IA 1M90C 1W6KA 2UUAL 1EIFA 4DV2L 1PFSA 1DXMA 4J8QA 3V96A 4JI4L 1STBA 3FHWA 4X3UA 5C4XG 1ET9A 1KRTA 1SE3A 3OWFA 1XPOA 1HUMA 4C3HH 3DWAA 1NE3A 4BBSB 4JVZA 2A1AA 3A8IE 3KBGA 4RFBA 2B2YA 2ZM6Q 2D0PA 1S3OA 1XNQL 2K50A 5I9PA 5I6WA 3E0EA 3WOFA 5TSSA 4JI3L 1AH9A 3QOLA 2NZOA 4KHZA 3C46A 3M4OB 2QILA 4PMBA 1TWGB 4TRDA 5CBEE 1UE5A 3A74A 2JA7H 2K28A 4A3BG 3F2BA 2VY3A 3ERQA 3NQIA 3T1HQ 4H0LC 1GHJA 4K5WA 4IQZA 4A3LH 2E8GA 2R3ZA 1PTOH 1KD1C 2WIIB 5JAVA 2MHVA 2QDBA 2KOLA 3GTKB 2PMZB 5BN3A 1P16A 1ENAA 2HCCA 3D3RA 2PNRC 1SFOB 1G6ZA 3UE0A 1NMFA 1HHVA 3NXWA 2XWJB 1BBXC 4KJOA 4DAMA 2EDGA 1RD9D 3GO5A 3PUYA 5FLMH 4C2MH 4GN5A 3M9BA 3BYYB 3A5UA 1W2BA 3EVQA 1YITA 3E9HA 1XNRL 1EYCA 1SYEA 3QR8A 3TBIB 1ZXTA 4OL7A 1WCMG 1FNVA 3P1HA 2O2LD 5CGKA 3CCQA 4ZUJA 2L11A 3AFQA 1UE1A 1IW7C 1MI2A 5BN5A 5IOCA 5IY0A 4L63B 1MHWC 4DR1Q 5JVH3 1I4GA 2B3GA 5CR3A 4CDEC 2NVYB 3CCRA 1I94Q 1ESRA 1PTOD 3BZKA 3S16B 2JA5H 1KDCA 5A2QE 3SVMA 4LF5Q 3E3XA 3UE1A 3RZDB 2KHSA 1L2FA 5EBDA 1FGBD 1VCIA 4A93G 4LF8Q 1JWUD 1R4QB 4MTKA 3A0JA 3JAMc 1TIID 1K28A 1EFID 2K32A 1VQAA 1Q7YC 5JVG3 5M5XH 1HNZQ 4JK1C 2XTIA 1JR0D 1HNXL 3J80c 5GADC 5CV4A 3SEBA 1N36L 1BKBA 4A76A 4X65Q 3A7AB 5JEAG 5C3EH 4DU9A 3JAMi 4B08A 1SLJA 1VQDA 1PTOF 2B2WC 5FOBB 3HOXH 1ICWA 3GTLB 4Q0FA 3H91A 1K83H 3W2DA 4IPCA 3J80i 2VQEL 1EU4A 3KYHC 3NTIA 4KV6A 3KF6B 3PO2H 1JJGA 1PHJA 5H1SE 2CWAA 4CGYB 4A3DB 2NVXB 1PH7A 1VQLA 1SNQA 3GTOB 1TWHB 2I5HA 3UI2A 4A3CG 4JV5Q 5GAHC 2G5DA 2A6HD 1SSOA 1VQKA 3CRLC 4YWKA 3ULJA 2GN5A 3M4PA 4UP7A 1EL0A 2JA6G 3S1NB 4DXGA 3S15B 2PI2E 1BF4A 3RUZA 3E9IA 4DV4L 4BXXH 4A3MG 2NYZD 3DM1A 2J7ZA 5IWAL 4KD3A 3S2DB 4RAUC 4NW2A 1WI5A 2F1MA 2L9HA 3IKJA 5KIXA 4GN3B 1KQSA 4G7OC 4K8JA 2E2IH 1D8LA 1YNJD 5ELBA 4L8JA 1Y1VB 1NMGA 4OELB 2VS1A 1NCVA 1DGSA 2PQAA 2ASBA 3CMEA 4HIMA 3BJUA 2F0EA 3DWQA 3BS1A 1EOVA 2F0LA 4R4TA 1CK1A 3PCOB 3S9WA 4A75A 3GTQH 3BDLA 2JYOA 4XXEA 1Y1WH 2WV6D 3HEJA 3P20A 3RNUA 2Z6KA 1K8GA 4CJ1B 4HJ7A 1X3EA 2Q2HA 2K1BA 1BR9A 1UE7A 3FP9A 1LT6D 1RHPA 3KOJA 1CA6A 2NBFA 4DUZL 4HIKA 1Q1EA 1X3GA 3K58A 1SYCA 3ONAB 2IHFA 5EPLA 1N34Q 4Y7NB 1EYDA 1WTVA 2I46A 5C44G 3KLSX 2CW0C 3G71A 4A3JB 4O42A 4QUCA 4CHTB 1XMQQ 1QZHA 4A3KB 1EOTA 5KYIA 1I3QH 4CDFC 1U9RA 2EJGC 1QVCA 1WTRA 1N33L 3DXJC 1H95A 1HZBA 2K52A 1PH1A 4ILWA 1IKMA 2L1BA 3TP6A 1VQPA 3CQZH 3B6YA 3PIOA 4FXDA 1I6VC 1ET6A 3Q6SA 1XTDA 1HZAA 2F0QA 2AUKA 2F0MA 2Q8IB 4IURA 2SOBA 4LFAQ 1DD2A 2LSSA 3H3VH 1AZPA 2M00A 5I2YA 3HOWG 4BY7H 1A0IA 1CFMA 2KEEA 3W5OA 4RGNA 4MZ9A 3GTJB 3D4WA 1SJED 1D1KA 2KCNA 4K5XA 3TS0A 1TS4A 1LTID 3A7LA 3CCEA 2JA7G 4KD4A 3DMUA 1RF2D 3OOCA 3MEFA 4HJ5A 2RHSB 1YNXA 4L5QA 4A3LG 4BBSH 3S1QH 1VQOA 3R3OA 3CMAA 1JOQA 1YI2A 1LO5D 1UE6A 4DAYB 1I4RA 1CA5A 1HCZA 1N8RC 5K36G 3M4OH 3SGIA 2K4KA 3VR5A 1TWGH 4JYAL 2QEJC 1X65A 1GUGA 2HIXA 4P71A 5FJ8H 2UUBQ 4FO2A 4DR5L 4C1NK 3NP8A 2EYMA 1N9WA 4MHEA 5LL6X 1QVGA 5COYA 4C3HB 2CH4A 1AE2A 4BBRH 3AU7A 4JPBW 3P75A 1RTOA 3GTKH 4DUYQ 2EIFA 2EYLA 3A54A 4LF4L 4C3JB 1EY6A 2R7DA 4Z9CB 1HQRD 4PV1C 2YYZA 4IPHA 4HCSA 5FO7B 2UXDL 1E2ZA 1HRJA 2K01A 2L5TA 1F2LA 5NUCA 4GNXB 1SE4A 1HNWQ 2JJQA 1VQGA 5G3LD 2OQ0A 3S24A 1G6PA 4C56C 4OONA 2IHEA 3MFGA 3PUWA 4X3TA 1YJWA 2CKZB 4DN4M 2FJ2A 1EY8A 2KJXA 1WTXA 5ELNA 4A4IA 1SNOA 3AMUA 4DR3L 1K8AC 4LF7L 2R7ZG 2AWNA 4NB3A 5DNFA 2L4NA 4X6AH 1IW7D 4KHVA 1GUNA 2NN6H 2GVBA 3MHBA 1EFWA 5M3MB 1B70B 2JQOA 2FFKB 1M1KC 2EOTA 3JAME 1XX8A 1S4ZA 3K81C 4RA8A 4OWXB 5C3EG 2F4VL 1K8MA 2K5NA 5G3LF 3T53B 4JI1Q 1LV9A 5IP9H 2FMCA 3I91A 2O5IC 1KXLA 4OWTB 2K6AA 3MC0B 4B3TL 1IZ6A 4KKUA 1PH9A 4DR7Q 2KEDA 4OX9Q 4QF4A 3WOEA 4YIJA 3PO2G 2KA7A 2VB3X 2WB1G 1PRTB 3J81c 3MVVA 4OHJA 3EFXD 4FF3A 2MP1A 5M3FB 1HZCA 2EE1A 1Q81C 3OMCA 1CHQD 5C0XH 2HHHQ 2K14A 2Q8RE 2D2CC 4EQ5A 2KBNA 3H0GB 3K5LA 1X32A 2JA5B 4DV6Q 3S2HB 3R2IA 3M7GA 1PTOC 3J81i 1C8CA 1Y8OB 1CM9A 1E24A 1EU3A 3J7A5 3ULPA 1O7IA 4BXXG 5CV5A 3R2TA 5ELDA 2B2WA 2VQFL 1PYWD 3HKZE 3NENA 1IBKL 1Z47A 3RN5A 3CAMA 2RHQB 1KL9A 1YBYA 5M5XB 5IGEA 4A3DH 1JJCB 3K0XA 3QIAA 3GTOH 3MXNA 1TWHH 4IPDA 2F0VA 2UXBL 3GTMB 2NTTA 2E74C 4AIMA 2FINB 2HD3A 1PH4A 2RCNA 3VR3A 4WRDA 1O78A 4A3EG 4KY5A 4KN4C 2Z9HA 4JI6L 1FL0A 2RSNA 3HOXB 1K83B 2XVSA 3EIVA 1PRTC 1B44D 2UUCQ 4JC0A 5IT9c 1VQFA 1WVLA 3S2DH 5CV9A 3F8TA 5AJ3Q 1ILPA 1PFBA 4DF7A 4ZKBB 1X3PA 3GDEA 5DM73 4WORA 2Y0SE 4DV3L 2DGYA 4HSPA 4EX5A 1SE2A 1VMCA 2N78A 3HGBA 3SDZA 3EJIA 1GUWA 4PMCA 1Y1VH 3CKIB 1KHIA 4DR6L 3P7JA 1STNA 2MFIA 2GVAA 3CCSA 2A6HC 2XGTA 3STBC 1YEZA 2Q2UA 4A3GG 3CC7A 3UDIA 1KABA 2RDGA 2RDHA 4XTCS 1O7YA 1QCBD 3SR1A 3EN2A 3VR2A 2VUMH 5EPKA 2KECA 1QUQB 1RCVD 1E1OA 2H5XA 3BU2A 4B9WA 3DEPA 5IGDA 1KDAA 4P74A 2PZUA 3HOYH 1HXYD 1A8VA 2IJ0A 4I7ZC 4YCUA 1E2VA 4IUTA 1XTCD 1YNJC 3KLRA 4JCVE 1B4OA 3LWUA 1F9QA 5C0XJ 3CD6A 4K0KQ 3MZ5A 4DV5Q 3I4OA 5M9OA 3C1EA 4A3KH 4BY7G 1YHQA 4ZRZA 4WFN3 3T1HL 1Y1WB 5CYUA 1V43A 1KC8C 1ENCA 3MXGA 3DHQA 3GV6A 3LWEA 5D65A 1VQ7A 4OIJA 1V1QA 3PV0A 3UDFA 4B3MQ 3QO2A 1LACA 4O2DA 3HG9A 4APVA 4GLXA 1HTLD 2L55A 4JI7Q 4BBSG 4LUOA 1LTGD 5HGQA 1LTSD 3CP0A 4DV7Q 1QVFA 3AEVA 4CDDC 4AQYQ 4F87A 2RQXA 4HN7A 1ML0D 4XYOA 2K33A 2ZJPA 1YHBA 4EVOA 3N6RA 1S5CD 4XT3B 1WJJA 2K7VA 5GQOA 2PNHA 1B53A 2QKIC 5FJ8G 4UY8C 1Q86C 2LMCB 3MXUA 3CQZB 1ASYA 4OIKA 4R4OA 3I70A 1SNPA 3HKZB 2EJMA 3K8AA 3M4QA 4DR1L 2PO4A 1JE5A 4IJLA 2XRSD 4ULLA 1I94L 1PXUA 4GN4B 1J8IA 2C9OA 1I5FA 1E0BA 3S17B 1S5BD 3TP5A 4NXNQ 4LF5L 2KCTA 5HGTA 1UAPA 1VDZA 1X3FA 2NVTH 4LF8L 4DR2Q 4I65A 3H3VI 1MJEA 3S1MH 5C4JB 1ZYRC 2CWPA 1HR0Q 1QOHA 1E1TA 1A62A 1LLRD 1U4LA 4GKJQ 4RHRA 2F3WA 1HNZL 3NWSA 3FRPB 1LTRD 2DUDA 3NTHA 3WWVA 4QGUA 1CKMA 5FO8B 3S1QB 1B2TA 1TS2A 2NN6G 2WP8J 1T5EA 1Z6HA 5E4XA 2Y0SB 3NPPA 1BOSA 4C3JH 1UNSA 5LMNQ 2DY7A 2CCZA 2G9DA 2JA9A 1SJHD 2NUCA 2Q8TA 4DV0L 2Z8LA 2E5LQ 1MGSA 1O7LA 4QUFA 4NXMQ 2I5LX 4K2KA 3I73A 1JWMD 3URYA 3VDYA 1BNZA 1IBLQ 1BDOA 2A69D 3PIO3 1QB5D 1SXTA 4BBRB 1RTNA 2OQKA 4A3FH 4MTNA 5ELEA 1QZGA 4JV5L 1MD2D 3H3VC 1MSGA 1LT5D 5C3WA 3TQYA 2ATWA 5M3MH 2ICEC 4JI0Q 4R8IA 4WJ3M 2IX1A 3FEWX 4LW1A 3U4VA 4CJ2C 5EGTA 5C0XG 2R93B 4DAYA 1IYVA 4KKSA 3RD4A 2ZTEA 3J81E 3GP7A 1I6HH 2F0IA 3RMHA 4X62Q 4EQPA 2F52A 4IO9A 1K3RA 5LMUQ 1LTBD 1EZ8A 2PI2A 1KDBA 4DXFA 1PFMA 5CV8A 1BQQT 3QOJA 1NUCA 4OWWB 2MJ8A 4A3DG 2PYKA 5M3FH 1GUOA 3CC2A 4DK0A 3PUXA 4PG3A 2M2LA 3K7AB 2NN6I 2SDFA 4RMFA 4GZYC 2VXWA 4J1MA 4GKKQ 2QCPX 4H13C 3H0GH 1FR3A 1NAPA 1B8AA 5DM63 2AQ2B 4TKOB 3S2HH 4PZ6A 4ALPA 2JSOA 5LMNW 1A15A 1YIJA 3T4AC 4QB4A 1FJGQ 1CSPA 3K0YA 2IPKD 3IRBA 2RKSA 1N34L 1GXDC 1Q82C 1BCPB 2A5HA 4HJ9A 1HQMC 1Y1VG 5IT9E 3GTMH 2DJFC 1XMQL 2EYHA 5CBAE 3J7YW 1B50A 5C0XI 3WDNA 1PRTD 4RCNA 3KF8B 1AP0A 4IFDH 2RVLA 3CRKC 3HS0C 4KI0A 5IP7H 1SAPA 1TY0A 4P73A 5J3BA 3L0OA 1FVIA 3K6OA 4K8IA 1JWSD 1OXSC 4YCWA 4JI2Q 1EY9A 1EY5A 2EVBA 5KNCA 2RDFA 4NP5A 2LXJA 3HOYG 5D3DA 1X56A 4LFAL 2YTXA 5IIFA 3O13A 3TS2A 1IXRA 1EUJA 4YY3Q 1HUNA 3STBD 4FNFA 2CVRA 3PUZA 2CHBD 4CKEA 2Z6BA 5IYBH 4LF9L 2EZVA 4LFCQ 4G7ZC 4A3JG 3DLLA 4DR4Q 1AW7A 2V4DA 3J7AF 1PRTF 1EY7A 3X3MA 4FF4A 1HA6A 1PLFA 5J1ZA 4A3KG 5A2QL 1OXTA 4EQNA 4TVAB 3GV3A 3NUCA 3HOVH 4CJ0B 1L1OB 1VQCA 2DN8A 2F0JA 3OYYA 5FO9B 3RLFA 2N55A 1DOLA 5HY6A 4FF1A 4LF6Q 3KUPA 3VA7A 1TWFB 5FKAC 1RJTA 3HKSA 1LTAD 1D5MC 1O7ZA 1VQBA 2K5WA 1XYIA 1EIYB 1VMPA 2SNMA 3T1YQ 2BH2A 1PZJD 2LXKA 1CT1D 5T1GA 1DOMA 3TN2A 3I4MB 3K7UC 4G7HC 4CKCA 2B39A 1VQIA 5E4WC 2F0UA 3PGZA 2VUMB 4J15A 2AUJD 5F2DA 4DK6C 1A2TA 2B63H 4PMWA 3NHHA 4DUYL 3HOYB 3HFZB 5DEHA 2XSCA 5JJLA 2WKCA 1EQVA 4X64Q 2BE5C 1AFPA 4KJNA 5ISRA 1FNUA 2F0HA 1GUSA 1VQJA 5GAEC 1Y69U 2VB2X 1HNWL 3RN2A 1XMOQ 2NWGA 4HTHA 2IY5B 1KIXA 1EWIA 4DR4L 1L1OC 1CZGA 3M85A 3IFTA 3NEMA 1SNDA 3AQQA 4IFDJ 2NZHA 4AYBE 1D6EC 1F77A 3G6JB 1GVPA 2J4XA 4LMQD 2JP1A 1FD7D 1XXGA 3CXCA 1D2BA 2F0SA 3KDFB 4BWGB 4X66Q 2BDNA 4O0AA 1D5XC 3TDQA 4C3HG 5E7NA 1EY4A 1NNXA 2EY2A 1GD7A 1HTPA 5EQ0A 4JI8L 5KEEA 3OIQA 5CV6A 3J81j 4RCOA 1G51A 4C3JG 3S14B 5FLXc 2C5CA 4QQBX 3GTPH 4DAPA 4LNQA 2EY6A 3S17H 2B2VC 2SEBD 3I56A 3ZYYX 4JI1L 2E2HB 3FKIB 3UDXA 2UXCQ 1ZYRD 4P75A 2JA7B 2QF7A 5C4JH 1ZEQX 4DR7L 2LKVA 4OX9L 3OPOA 1HJPA 1H9MA 2VZAA 3C1FA 2BA1A 3EROA 1XJVA 1VQ9A 3G4SA 2EYJA 4OO1H 1T5XD 2RCFA 4LFBQ 1STHA 4KTAA 2XNAC 2HQEA 4KK7A 1S72A 1H9RA 2XWBB 4F7XA 1EIHA 4RGOS 1U4PA 2X6LA 1ZKOA 4FP5D 4CDCC 5C5LA 5M3MG 2OWOA 4M8AA 4HSVA 4DV6L 2P5ZX 1AZQA 2HIVA 5IYDH 1OXUA 1GKHA 2NVTB 4P72A 3D0FA 3IL8A 5EPJA 3SK5A 5E1FA 4U673 5FLMG 3S1MB 1QNUA 1VQNA 4NMZA 3SK4A 5KYLA 2KHIA 1SRUA 3KLSA 4ZCKA 1T9HA 5ELCA 1SYDA 4TSSA 2Z4IA 5IODA 2F0FA 4R9WA 3PQIA 1OXVA 2ZXOA 3FPUB 1X6OA 5M3FG 4G57A 2K5VA 3KJPA 4YHHQ 1X9NA 3F2UA 4WJ4A 4KN7C 2R93H 2ICIA 4PZ7A 3TP8A 2NVQH 5I4DA 1W6JA 3H0GG 4UPAA 2UUCL 1QILA 2JA5G 3SK6A 1LYLA 1X55A 2TMPA 4R1JA 1IKLA 3NWTA 2I0QA 4CKBA 5AJ3L 5C5MA 4UAIA 3BG3A 1IBMQ 1ILQA 4IALA 4XQJA 2EQSA 3OHXC 3KBXA 3HP3A 1UEBA 1TR5A 4A3FB 4JI5Q 3A8KE 2A69C 4NDXA 2JA8B 1SMXA 2WINB 4HJAA 3TSSA 3D4RA 4IUPA 3K7AH 5EJWA 2RSOA 4J6HA 3HOUB 2K75A 4MN3A 3PSIA 4ZQ3A 1HPCA 5C4XH 4S3SA 1I6HB 1K8OA 5K5PA 3LX0A 3J80E 2M9VA 3HOXG 2F0KA 4KMUC 4HR7B 1Y14B 3TMEA 1WD1A 4IFDG 3V2TA 1TT2A 2J0TD 5IP7G 4JOIC 1CQFA 1RKNA 3JC66 2UU9Q 3I4NH 4AYBB 2ZXRA 1KAWA 2C35B 1KNEA 5T1IA 1JOOA 1V9PA 3K57A 4GNXC 1D7QA 1SYGA 1I4XA 4N9TA 5DLQE 3W1GA 4DV5L 4IOCA 4A3BH 4QCLA 4JBKA 3VA5A 3CHBD 2X69A 4UP8A 3HOZH 1EQTA 1DONA 5IYBG 1BBWA 4A3IH 4K2LA 4V0BA 2F0TA 3MXPA 1X3QA 5IGGA 4LUVA 4B3ML 2ZTCA 2MQHA 3HOVG 3MWYW 4JI7L 4JBJA 3CC4A 1YHAA 4JBWA 4MIUA 1WTQA 1WTHA 4DV7L 3BVMA 3TZUA 4AQYL 1GJXA 3ICEA 2A19A 3M3YB 1J5EQ 2EY1A 4F88A 4H7BA 3JAML 4C3IB 2ZTDA 2N8NA 5IYCH 1VQ5A 1JB7A 3NQTA 5M5WH 1BUVT 2WAQE 4KY6A 2L0CA 2KUMA 1A3UA 1R4PB 2Z0SA 1BCPD 3J80L 4C1NI 4I7AA 2AKWB 2O5JC 2SNSA 2E76C 1Y1WG 1CZWA 1EYAA 1GUTA 4IFDI 1OTCA 1PH2A 1S5DD 4KHPQ 2B63G 1IHZA 2F0DA 3AFPA 4PNYA 4A93H 1TWFH 4NXNL 2ENBA 2FXQA 2O4XA 1NR4A 3F1ZA 4BY1B 3NBHB 4FXKC 1BBUA 4ZUIA 3RLOA 3KF8A 1WOCA 1HR0L 3I4MH 3RR5A 1GHKA 3VYRA 1C4QA 3ITPA 2HDMA 3HOVB 3KF6A 2A6EC 3TP7A 4O1NA 4EQOA 3HRZC 4LWCA 1V1PB 4IUNA 2ZM6L 2BE5D 4FVMA 1WYDA 4YCVA 4DNTB 1Q8IA 3R8BA 5LMNL 1JE4A 3HKZG 5JPMC 3Q8DA 5HURA 3T56B 2E5LL 4NXML 2D62A 4E6IA 1Y8NB 3CPWA 5JJZA 1IBLL 1E3PA 4NKLA 3U4ZA 1VQMA 1TVXA 1CHPD 5FLXE 4EGVA 4A3CH 4ZK9B 3I2ZA 3H15A 3Q22A 1VF5C 2QW7A 2B63B 3L2PA 1PDQA 1PFNA 3H6MA 1L1OA 1SYBA 1YJ9A 2LFNA 1V8QA 2EY5A 4JI0L 1IL8A 2B2UC 1EQRA 2OEOA 1PYSB 4HJ8A 3DM3A 3J7AV 3OTOQ 1CSQA 1K0SA 2Y0SG 1P8LA 3S14H 4R4QA 1CKNB 4POFA 1WFQA 1NBWA 2K04A 4AH6A 4QJFA 5IYDG 3BDOA 2IWHA 1WTOA 2E2HH 3FKIH 3L9AX 3G48A 5LMUL 2CQAA 1A63A 3GQBA 2B2VA 4B3SQ 1OO9B 3PIPA 1EIGA 2CQOA 2UXBQ 2E75C 1JQYD 2I5MX 1JORA 4BBRG 1H9SB 3Q0AA 4GKKL 1U0LA 3MTSA 1STGA 4JI6Q 3OMGA 3K59A 3GTPB 2RBMA 5J39A 4RKLA 3MA2B 3A5ZB 1PMRA 5EKLA 2R93G 4PZ8A 1FJGL 1G8ZD 4H44C 4F8MA 1MSHA 3A56A 1UEAB 4B9XA 2HUGA 3MEHA 4XQQA 2N3SA 4Y52H 3QB3A 1AE3A 1DCZA 3ZJYC 1TS5A 3U9SA 3CCUA 3KDFA 4L6TB 1A3TA 4OO1I 3I7FA 1WD0A 3MFYA 4X65L 3X3NA 2F0WA 4N8X1 1QNKA 1CUKA 3PF5A 3MAQA 5ELFA 2N88A 1IYUA 4POGA 1PH5A 1M8AA 3E5SA 1Z9FA 2R92B 2EPBA 3K5OA 2XIWA 2QDLA 1U5KA 1VS0A 5IP9G 2H4OA 4JI2L 1G91A 4DNIA 4LJZC 1ESFA 3PO3B 1J6QA 1WTPA 1EY0A 3I4NG 3HOWH 2PZTA 4DPGA 4YY3L 2JA8H 2AQ1B 1TWCH 4MNOA 4LFCL 3D6CA 3HOUH 3SE0A 4Q5VA 1ICFB 4L5SA 2NVQB 1BVSA 1VQHA 1SNCA 3KFUA 3HOZG 5C3XA 3H94A 1G2TA 3U9OA 4A3IG 4FXGC 1TWAH 3EA6A 2I07B 1RODA 2ES2A 3NK9A 3ULLA 2MUYA 3PUVA 4ID6A 1M4VA 4DK3C 4LF6L 4DNRB 3KJOA 5K36H 1LT3D 1HR0W 1QWYA 2BH8A 4JOIA 1MIUA 4K6DA 2KQ3A 4P2CB 5KGUA 1STEA 1H9JA 4U68A 4UP9A 4XT1B 2GA4B 3T1YL 5C4XB 1TKWB 1KLUD 2JK8A 2D9UA 2KHJA 1F2YA 4DV1Q 4GNXA 3VR6A 5IYCG 1RDPD 2IW3A 1UWVA 5BR8Q 1MBYA 3G6EA 4IUUA 2VW9A 3MXNB 1F9PA 2B29A 4N8FA 3I4NB 1CKOA 1SYFA 4UDUC 2CH4W 4X64L 3I55A 4ABNA 2BDOA 2K03A 4QL5A 3I72A 1HA5A 2IT1A 4RGTA 3IAYA 1CQVA 4B3RQ 1N32Q 1GOZA 3M3YH 1Y8PB 3VYTA 1PZID 1XMOL 4DFAA 4A3BB 5EKKA 3ERSX 2UUAQ 1QJOA 4C3IH 4DV2Q 3HOZB 2RA4A 3S1RH 1I4QA 1SMYD 2R7ZH 2A68C 2X6GA 4UHVA 4A3IB 1VF7A 4JI4Q 3J81L 1Z7TA 5CORA 1S40A 1II3A 3I4MG 4RGMA 1DM0B 4RKBA 1IYJB 4X66L 5L37A 4KKTA 4QY7A 2VUMG 3ER0A 1F9RA 5C6AA 3I90A 3OWEB 2JN4A 4GLAC 2PW7A 3U58A 1IL2A 1XNQQ 3LNNA 4JI3Q 4DV0Q 1B9MA 1LT4D 4YWLA 1ONLA 1WCMB 5JPNC 2UXCL 1B1ZA 2F03A 4BY1H 5M5WB 3N52A 2B2TC 2EYPA 3L3OC 4ME5A 3C2PA 4IUQA 3RZOH 5JJIA 1YNND 1D5ZC 3CCJA 2ID0A 5JJKA 1JB3A 2A6ED 1BCPC 2E2DC
chains in the Genus database with same CATH topology
2DGYA 2A1AA 4EX5A 2QA4A 2N78A 5M5YH 2ZM6Q 2VUMH 3TRZA 2D0PA 1S3OA 1Y1VH 1KHIA 1OXVA 1XNQL 4DR6L 1SR3A 2K50A 5M3FG 1X6OA 1Q12A 2MFIA 2GVAA 2K5VA 3E0EA 3KJPA 3CCSA 4JI3L 2Q2TA 1AH9A 4YHHQ 2NZOA 1X9NA 2XGTA 4KHZA 3STBC 4WJ4A 1PH8A 1YEZA 4KLKA 3F2DA 2R93H 2Q2UA 4A3GG 4PZ7A 3CC7A 2NVQH 3H0GG 3KLWA 4UPAA 1UE5A 3UDIA 3A74A 4FDBA 4XTCS 2UUCL 2JA7H 2JA5G 4A3BG 3F2BA 3CW2C 1LYLA 1X55A 2VY3A 3T1HQ 1XNRQ 2KENA 2UUBL 4R1JA 2I0QA 3EN2A 1TXYA 4GOPB 5AJ3L 2E8GA 3FKIG 1QUQB 1R9TH 1E1OA 2H5XA 3BU2A 4A3LH 1KD1C 5EAYA 3CCVA 1IBMQ 2EQSA 4P74A 3HOYH 1P16A 1A8VA 1UEBA 4ME3A 4JI5Q 2R6GA 4YCUA 4A3EH 1SMXA 3UE0A 1NMFA 4HJAA 4YHHL 4JCVE 3K7AH 4DAMA 2AHOB 3GO5A 5C0XJ 3F2CA 3PUYA 3CD6A 4K0KQ 4DV5Q 2Q2IA 2K75A 3PSIA 3I4OA 5FLMH 4C2MH 4GN5A 3M9BA 5C4XH 1W2BA 3A5UA 4A3KH 1YITA 4BY7G 1YHQA 3E9HA 3T1HL 1I50H 3HOXG 1V43A 1KC8C 1XNRL 2YTYA 1YVCA 1Y14B 4IFDG 1WCMG 1VQ7A 2AWOA 1IBML 5IP7G 4JOIC 3CCQA 1V1QA 3PV0A 3UDFA 4B3MQ 3JC66 4O2DA 3AFQA 4JI5L 1UE1A 1QUQA 1RL2A 2UU9Q 1HNXQ 3I4NH 1KAWA 4APVA 2C35B 5IY0A 4GLXA 4JI7Q 2EXDA 4BBSG 1N36Q 1V9PA 3PF4A 4LUOA 2QEXA 4DR1Q 5HGQA 4DV7Q 2B3GA 3CP0A 1QVFA 3CCRA 4GNXC 1I94Q 1SROA 1JMCA 3AEVA 4A3GH 4AQYQ 1D7QA 5DLQE 3BZKA 4DV5L 3W1GA 4IOCA 2JA5H 4A3BH 1PH3A 4GOPC 4JBKA 4LF5Q 3UE1A 2ZJPA 1YHBA 1ASZA 4UP8A 1L2FA 3HOZH 1VCIA 2CFMA 5IYBG 4A93G 4LF8Q 1BBWA 4A3IH 1WJJA 5GQOA 3A0JA 2VQEQ 2BA0A 2PNHA 3JAMc 5FJ8G 1XPUA 4LUVA 4UY8C 1XPRA 1VQAA 2ZTCA 1Q7YC 2YU9H 4B3ML 1Q86C 5M5XH 4L5RC 1HNZQ 2MQHA 2XTIA 1ASYA 2UU9L 1HNXL 3NELA 4R4OA 3J80c 3HOVG 5GADC 4JI7L 4JBJA 3CC4A 1YHAA 1N36L 1BKBA 4JBWA 3K8AA 3M4QA 4DR1L 4A76A 1JE5A 4IJLA 4DV7L 1VQ6A 1I94L 4X65Q 1GO3E 4AQYL 4A3FG 1PYBA 4IPGA 4GN4B 5JEAG 5C3EH 2A19A 2HHHL 1MJCA 3JAMi 1I5FA 3ICEA 1SLJA 1VQDA 2YV5A 5ELOA 1J5EQ 2JA8G 4OXPA 3HOXH 4LF9Q 4NXNQ 3OW2A 4LF5L 2KCTA 2NVTH 1X3FA 1K83H 2ZTDA 2N8NA 2L15A 4IPCA 1CKNA 5IYCH 1JB7A 1VQ5A 3J80i 4DR2Q 4LF8L 3H3VI 5M5WH 2WAQE 2VQEL 1MJEA 3KYHC 4DV4Q 3HOUG 4BA2I 2Z0SA 2R92H 3S1MH 3K80C 3KF6B 2CWPA 5IWAQ 1HR0Q 3PO2H 2AKWB 1PHJA 1E1TA 1A62A 5H1SE 4GKJQ 1JJGA 1Y1WG 2CWAA 1HNZL 4IFDI 1VQ4A 1OTCA 1PH2A 2DUDA 2F3IA 1PH7A 3WWVA 4QGUA 1CKMA 2WFWA 1VQLA 2I5HA 4JG2A 4KHPQ 2B63G 4A3CG 4JV5Q 5GAHC 3PO3H 2NN6G 2WP8J 4C3JH 1VQKA 4AYBG 4H02A 4YWKA 5LMNQ 1LTLA 3ULJA 2GN5A 3M4PA 4UP7A 3AFPA 2CCZA 1HH2P 1J5EL 2JA6G 4A93H 1TWFH 4NXNL 4NPSA 2JA9A 3EBEA 1NTGA 1OXXK 2FXQA 4DV0L 2WB1E 2PI2E 3F1ZA 2E5LQ 4NXMQ 3E9IA 4DV4L 3NBHB 4BXXH 1BBUA 2I5LX 2YTVA 4A3MG 3RLOA 5IWAL 1WOCA 1HR0L 3I4MH 3RR5A 4QIWE 3VDYA 4JBMA 1WI5A 1IBLQ 1B7YB 4GN3B 1KQSA 3KF6A 2E2IH 1D8LA 4KHPL 1Q8KA 2OQKA 4A3FH 4MTNA 1QZGA 4JV5L 4DUZQ 4LWCA 1NMGA 2VL6A 1SFOH 2VS1A 2ZM6L 3BZCA 3W1BA 3TQYA 2ATWA 1WYDA 5M3MH 4YCVA 1DGSA 2PQAA 4JI0Q 1JT8A 2ASBA 5LMNL 4WJ3M 3CMEA 4HIMA 2IX1A 3HKZG 3BJUA 4LW1A 3U4VA 3Q8DA 4GLVB 1EOVA 5C0XG 4R4TA 3PCOB 2E5LL 4A75A 2ZTEA 4NXML 2D62A 2D0OA 3GTQH 2N49A 1I6HH 1YZ6A 1Y1WH 2V1CC 1MKHA 3RLNA 4X62Q 2F52A 3CPWA 4IO9A 3RNUA 2Z6KA 1K3RA 1K8GA 1N33Q 4HJ7A 1X3EA 1IBLL 2Q2HA 5LMUQ 1E3PA 3FP9A 1UE7A 3U4ZA 1VQMA 1GM5A 4A3CH 2PI2A 3KOJA 3I2ZA 3H15A 3LGJA 3L2PA 1W3SA 4DUZL 4HIKA 1Q1EA 1X3GA 4OWWB 1L1OA 1YJ9A 2IHFA 4A3DG 4JI0L 5M3FH 1N34Q 1C0AA 1EQRA 4JI8Q 1PYSB 4HJ8A 5C44G 3CC2A 2NVYH 3DM3A 3PUXA 4PG3A 3G71A 2NN6I 4RMFA 2JEAI 3AYHB 4HIDA 3OTOQ 3S16H 1CSQA 1XMQQ 1Q1BA 2Y0SG 1P8LA 1QZHA 3S14H 4GKKQ 3H0GH 1L0WA 4K0KL 4R4QA 1CKNB 4POFA 3TEHB 2MNAA 3RZDH 1WFQA 1B8AA 1NBWA 1I3QH 4AH6A 3S2HH 2HQLA 4PZ6A 4QJFA 1E22A 2OCEA 1QVCA 5GAGC 5IYDG 5LMNW 2MO0A 2K5HA 2E2HH 3FKIH 1N33L 1YIJA 3UDGA 3G48A 5LMUL 1SE8A 1EQQA 1HZBA 4BY1G 1FJGQ 2K52A 1A63A 1H95A 1PH1A 2ZJQA 1CSPA 1VQPA 4B3SQ 3CQZH 3B6YA 3PIPA 2ZJRA 1YJNA 3IRBA 3PIOA 2CQOA 1N34L 2JEBI 1XTDA 1HZAA 2JE6I 1Q82C 2UXBQ 4LUZA 2I5MX 4XIGS 1PA6A 1E7ZA 4BBRG 4HJ9A 4LFAQ 1Y1VG 3GTMH 3OTOL 1VQEA 2LSSA 1XMQL 3H3VH 4GKKL 1U0LA 4JI6Q 3GTLH 3HOWG 4BY7H 1A0IA 3W5OA 5C0XI 3A5ZB 1NJIC 4MZ9A 2R93G 3KF8B 4PZ8A 1WCMH 4JYAQ 3TS0A 3CCEA 4KI0A 5IP7H 1FJGL 4IJHA 4BA1I 4DR5Q 2JA7G 4P73A 5J3BA 3L0OA 3MEFA 4HJ5A 4B3SL 3M7NA 1FVIA 1SN8A 2RHSB 4R4IA 1YNXA 4L5QA 5GROA 1OXSC 2NVXH 2N3SA 4A3LG 4Y52H 4YCWA 4JI2Q 1C7YA 1AE3A 3GD7A 4BBSH 3S1QH 2PQAB 3ZJYC 1VQOA 1LM0A 2LXJA 2ALYB 3KDFA 3CMAA 3CCUA 1PH6A 1VQ8A 1X56A 1YI2A 4LF4Q 4LFAL 2YTXA 4OO1I 3I7FA 4X65L 4GS3A 1UE6A 3TS2A 1IXRA 1EUJA 4DAYB 4YY3Q 3STBD 5IE8A 1CUKA 3PUZA 3PF5A 3S1NH 2RF4A 1LUZA 1N8RC 2UXDQ 4POGA 1PH5A 3S15H 5IYBH 4LF9L 5K36G 3M4OH 3SGIA 2K4KA 4LFCQ 4A3JG 3DLLA 1TWGH 4JYAL 1X65A 1Z9FA 2HIXA 4P71A 5FJ8H 4DR2L 2UUBQ 4DR5L 3CF5A 4A3KG 1OXTA 1N9WA 1U5KA 4TVAB 1QVGA 1VS0A 3U50C 1X54A 5IP9G 4GKJL 4DR3Q 3HOVH 4JI2L 4DNIA 1AE2A 3L7ZC 4LF7Q 4BBRH 1L1OB 1VQCA 3OYYA 1NY4A 3RLFA 3GTKH 4DUYQ 1J6QA 2EIFA 4LF4L 5HY6A 2R7DA 4DKAC 3I4NG 2E2JH 4LF6Q 3HOWH 4DPGA 2MO1A 4YY3L 2JA8H 2YYZA 4IPHA 3GTGH 2UXDL 3HKSA 1TWCH 1VQBA 1EIYB 4MNOA 4LFCL 4GNXB 2IX0A 3J7ZC 2F4VQ 3HOUH 1HNWQ 3T1YQ 4L5SA 2JJQA 1VQGA 2LXKA 1BVSA 1VQHA 2OQ0A 3S24A 1K9MC 1JJ2A 2BH2A 3KFUA 1G6PA 3CPFA 4OONA 2IHEA 3PUWA 3CCMA 1YJWA 3HOZG 2CKZB 3K7UC 4DR4Q 1VQIA 2VNUD 5ELNA 4A4IA 2OTLA 2PMZE 4A3IG 3PGZA 4B3TQ 1TWAH 4J15A 4DR3L 1K8AC 4LF7L 2ES2A 4DK6C 2R7ZG 2AWNA 4NB3A 3ULLA 2B63H 2OTJA 4X6AH 4PMWA 2AMCB 4DUYL 3PUVA 2GVBA 1EFWA 2WAQG 4Y7NH 1FGUA 1KRSA 3HFZB 4DK3C 1B70B 2JQOA 4LF6L 4RG1A 1M1KC 3KJOA 5JJLA 4OO1G 4X64Q 2JA6H 1HR0W 2BH8A 4JOIA 1MIUA 2Z6KC 4A3JH 1PV4A 3K81C 1HZ9A 1VQJA 4OWXB 5GAEC 5C3EG 2F4VL 1HNWL 4UP9A 3RN2A 1XMOQ 3T1YL 1EYGA 2IY5B 2K5NA 4A3MH 1KIXA 1EWIA 4HIOA 4DR4L 4JI1Q 2JK8A 1C9OA 1L1OC 2KHJA 5IP9H 3M85A 4DV1Q 3NEMA 5IYCG 4OWTB 4GNXA 2HT1A 4X62L 1KXLA 4B3TL 3AQQA 4IFDJ 2NZHA 1IZ6A 4AYBE 1UWVA 1PH9A 2R92G 5BR8Q 3G6EA 1G291 1T9HA 4DR7Q 2VQFQ 2VW9A 4GOPA 1GVPA 3MXNB 4OX9Q 2KCMA 1IBKQ 3PO2G 4R4CA 2WB1G 3J81c 3CXCA 2B29A 4YWMA 3KDFB 3HOYG 4X66Q 1HZCA 1Q46A 1CKOA 4O0AA 5E7NA 1GD7A 4X64L 3I55A 1Q81C 1RIPA 2A8VA 4JI8L 4QL5A 3PO3G 3J81j 2HHHQ 1K0RA 2IT1A 2K14A 1G51A 4IOAA 4EQ5A 4ALPA 5FLXc 2KBNA 4B3RQ 4QQBX 1N32Q 3GTPH 3M3YH 4LNQA 1XMOL 3CCLA 3S17H 4DV6Q 3GTJH 3ERSX 3I56A 3J81i 4JI1L 2UUAQ 4C3IH 4DV1L 4DV2Q 3UDXA 2UXCQ 3S1RH 1E24A 3J7A5 2QGQA 4P75A 3ULPA 1O7IA 2R7ZH 4JI4Q 1PVOA 4BXXG 3D31A 5C4JH 5BR8L 4DR7L 2VQFL 4OX9L 1S40A 3HKZE 3NENA 1IBKL 1Z47A 1HJPA 3RN5A 2VZAA 2RHQB 3CAMA 3I4MG 1KL9A 1YBYA 2BA1A 1XJVA 3G4SA 1K73C 1VQ9A 4A3DH 4LFBQ 1JJCB 1IYJB 3K0XA 4X66L 4DV3Q 4QY7A 2VUMG 3ER0A 4L5TA 5C44H 1S72A 3GTOH 1TWHH 4IPDA 4GLAC 2UXBL 4TQUS 3U58A 1IL2A 1XNQQ 3TREA 4DR6Q 5M3MG 2R7FA 4AIMA 4B3RL 5JEAJ 1N32L 1PH4A 2RCNA 2OWOA 4JI3Q 4DV0Q 4A3EG 4DV6L 4JI6L 1FL0A 2HIVA 5IYDH 1OXUA 1M90C 2UUAL 1EIFA 4YWLA 1GKHA 1PFSA 4DV2L 4P72A 2UXCL 3EIVA 3D0FA 4JI4L 4BY1H 2UUCQ 3FHWA 5FLMG 3RZOH 4JC0A 5C4XG 5IT9c 5JJIA 1VQFA 1KRTA 2ID0A 3CCJA 1VQNA 3S2DH 1XPOA 3F8TA 4C3HH 5AJ3Q 5JJKA 2KHIA 1SRUA 3GDEA 4LFBL 1NE3A 4DV3L 2Y0SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGY A;  2A1A A;  4EX5 A;  2QA4 A;  2N78 A;  5M5Y H;  2ZM6 Q;  2VUM H;  3TRZ A;  2D0P A;  1S3O A;  1Y1V H;  1KHI A;  1OXV A;  1XNQ L;  4DR6 L;  1SR3 A;  2K50 A;  5M3F G;  1X6O A;  1Q12 A;  2MFI A;  2GVA A;  2K5V A;  3E0E A;  3KJP A;  3CCS A;  4JI3 L;  2Q2T A;  1AH9 A;  4YHH Q;  2NZO A;  1X9N A;  2XGT A;  4KHZ A;  3STB C;  4WJ4 A;  1PH8 A;  1YEZ A;  4KLK A;  3F2D A;  2R93 H;  2Q2U A;  4A3G G;  4PZ7 A;  3CC7 A;  2NVQ H;  3H0G G;  3KLW A;  4UPA A;  1UE5 A;  3UDI A;  3A74 A;  4FDB A;  4XTC S;  2UUC L;  2JA7 H;  2JA5 G;  4A3B G;  3F2B A;  3CW2 C;  1LYL A;  1X55 A;  2VY3 A;  3T1H Q;  1XNR Q;  2KEN A;  2UUB L;  4R1J A;  2I0Q A;  3EN2 A;  1TXY A;  4GOP B;  5AJ3 L;  2E8G A;  3FKI G;  1QUQ B;  1R9T H;  1E1O A;  2H5X A;  3BU2 A;  4A3L H;  1KD1 C;  5EAY A;  3CCV A;  1IBM Q;  2EQS A;  4P74 A;  3HOY H;  1P16 A;  1A8V A;  1UEB A;  4ME3 A;  4JI5 Q;  2R6G A;  4YCU A;  4A3E H;  1SMX A;  3UE0 A;  1NMF A;  4HJA A;  4YHH L;  4JCV E;  3K7A H;  4DAM A;  2AHO B;  3GO5 A;  5C0X J;  3F2C A;  3PUY A;  3CD6 A;  4K0K Q;  4DV5 Q;  2Q2I A;  2K75 A;  3PSI A;  3I4O A;  5FLM H;  4C2M H;  4GN5 A;  3M9B A;  5C4X H;  1W2B A;  3A5U A;  4A3K H;  1YIT A;  4BY7 G;  1YHQ A;  3E9H A;  3T1H L;  1I50 H;  3HOX G;  1V43 A;  1KC8 C;  1XNR L;  2YTY A;  1YVC A;  1Y14 B;  4IFD G;  1WCM G;  1VQ7 A;  2AWO A;  1IBM L;  5IP7 G;  4JOI C;  3CCQ A;  1V1Q A;  3PV0 A;  3UDF A;  4B3M Q;  3JC6 6;  4O2D A;  3AFQ A;  4JI5 L;  1UE1 A;  1QUQ A;  1RL2 A;  2UU9 Q;  1HNX Q;  3I4N H;  1KAW A;  4APV A;  2C35 B;  5IY0 A;  4GLX A;  4JI7 Q;  2EXD A;  4BBS G;  1N36 Q;  1V9P A;  3PF4 A;  4LUO A;  2QEX A;  4DR1 Q;  5HGQ A;  4DV7 Q;  2B3G A;  3CP0 A;  1QVF A;  3CCR A;  4GNX C;  1I94 Q;  1SRO A;  1JMC A;  3AEV A;  4A3G H;  4AQY Q;  1D7Q A;  5DLQ E;  3BZK A;  4DV5 L;  3W1G A;  4IOC A;  2JA5 H;  4A3B H;  1PH3 A;  4GOP C;  4JBK A;  4LF5 Q;  3UE1 A;  2ZJP A;  1YHB A;  1ASZ A;  4UP8 A;  1L2F A;  3HOZ H;  1VCI A;  2CFM A;  5IYB G;  4A93 G;  4LF8 Q;  1BBW A;  4A3I H;  1WJJ A;  5GQO A;  3A0J A;  2VQE Q;  2BA0 A;  2PNH A;  3JAM c;  5FJ8 G;  1XPU A;  4LUV A;  4UY8 C;  1XPR A;  1VQA A;  2ZTC A;  1Q7Y C;  2YU9 H;  4B3M L;  1Q86 C;  5M5X H;  4L5R C;  1HNZ Q;  2MQH A;  2XTI A;  1ASY A;  2UU9 L;  1HNX L;  3NEL A;  4R4O A;  3J80 c;  3HOV G;  5GAD C;  4JI7 L;  4JBJ A;  3CC4 A;  1YHA A;  1N36 L;  1BKB A;  4JBW A;  3K8A A;  3M4Q A;  4DR1 L;  4A76 A;  1JE5 A;  4IJL A;  4DV7 L;  1VQ6 A;  1I94 L;  4X65 Q;  1GO3 E;  4AQY L;  4A3F G;  1PYB A;  4IPG A;  4GN4 B;  5JEA G;  5C3E H;  2A19 A;  2HHH L;  1MJC A;  3JAM i;  1I5F A;  3ICE A;  1SLJ A;  1VQD A;  2YV5 A;  5ELO A;  1J5E Q;  2JA8 G;  4OXP A;  3HOX H;  4LF9 Q;  4NXN Q;  3OW2 A;  4LF5 L;  2KCT A;  2NVT H;  1X3F A;  1K83 H;  2ZTD A;  2N8N A;  2L15 A;  4IPC A;  1CKN A;  5IYC H;  1JB7 A;  1VQ5 A;  3J80 i;  4DR2 Q;  4LF8 L;  3H3V I;  5M5W H;  2WAQ E;  2VQE L;  1MJE A;  3KYH C;  4DV4 Q;  3HOU G;  4BA2 I;  2Z0S A;  2R92 H;  3S1M H;  3K80 C;  3KF6 B;  2CWP A;  5IWA Q;  1HR0 Q;  3PO2 H;  2AKW B;  1PHJ A;  1E1T A;  1A62 A;  5H1S E;  4GKJ Q;  1JJG A;  1Y1W G;  2CWA A;  1HNZ L;  4IFD I;  1VQ4 A;  1OTC A;  1PH2 A;  2DUD A;  2F3I A;  1PH7 A;  3WWV A;  4QGU A;  1CKM A;  2WFW A;  1VQL A;  2I5H A;  4JG2 A;  4KHP Q;  2B63 G;  4A3C G;  4JV5 Q;  5GAH C;  3PO3 H;  2NN6 G;  2WP8 J;  4C3J H;  1VQK A;  4AYB G;  4H02 A;  4YWK A;  5LMN Q;  1LTL A;  3ULJ A;  2GN5 A;  3M4P A;  4UP7 A;  3AFP A;  2CCZ A;  1HH2 P;  1J5E L;  2JA6 G;  4A93 H;  1TWF H;  4NXN L;  4NPS A;  2JA9 A;  3EBE A;  1NTG A;  1OXX K;  2FXQ A;  4DV0 L;  2WB1 E;  2PI2 E;  3F1Z A;  2E5L Q;  4NXM Q;  3E9I A;  4DV4 L;  3NBH B;  4BXX H;  1BBU A;  2I5L X;  2YTV A;  4A3M G;  3RLO A;  5IWA L;  1WOC A;  1HR0 L;  3I4M H;  3RR5 A;  4QIW E;  3VDY A;  4JBM A;  1WI5 A;  1IBL Q;  1B7Y B;  4GN3 B;  1KQS A;  3KF6 A;  2E2I H;  1D8L A;  4KHP L;  1Q8K A;  2OQK A;  4A3F H;  4MTN A;  1QZG A;  4JV5 L;  4DUZ Q;  4LWC A;  1NMG A;  2VL6 A;  1SFO H;  2VS1 A;  2ZM6 L;  3BZC A;  3W1B A;  3TQY A;  2ATW A;  1WYD A;  5M3M H;  4YCV A;  1DGS A;  2PQA A;  4JI0 Q;  1JT8 A;  2ASB A;  5LMN L;  4WJ3 M;  3CME A;  4HIM A;  2IX1 A;  3HKZ G;  3BJU A;  4LW1 A;  3U4V A;  3Q8D A;  4GLV B;  1EOV A;  5C0X G;  4R4T A;  3PCO B;  2E5L L;  4A75 A;  2ZTE A;  4NXM L;  2D62 A;  2D0O A;  3GTQ H;  2N49 A;  1I6H H;  1YZ6 A;  1Y1W H;  2V1C C;  1MKH A;  3RLN A;  4X62 Q;  2F52 A;  3CPW A;  4IO9 A;  3RNU A;  2Z6K A;  1K3R A;  1K8G A;  1N33 Q;  4HJ7 A;  1X3E A;  1IBL L;  2Q2H A;  5LMU Q;  1E3P A;  3FP9 A;  1UE7 A;  3U4Z A;  1VQM A;  1GM5 A;  4A3C H;  2PI2 A;  3KOJ A;  3I2Z A;  3H15 A;  3LGJ A;  3L2P A;  1W3S A;  4DUZ L;  4HIK A;  1Q1E A;  1X3G A;  4OWW B;  1L1O A;  1YJ9 A;  2IHF A;  4A3D G;  4JI0 L;  5M3F H;  1N34 Q;  1C0A A;  1EQR A;  4JI8 Q;  1PYS B;  4HJ8 A;  5C44 G;  3CC2 A;  2NVY H;  3DM3 A;  3PUX A;  4PG3 A;  3G71 A;  2NN6 I;  4RMF A;  2JEA I;  3AYH B;  4HID A;  3OTO Q;  3S16 H;  1CSQ A;  1XMQ Q;  1Q1B A;  2Y0S G;  1P8L A;  1QZH A;  3S14 H;  4GKK Q;  3H0G H;  1L0W A;  4K0K L;  4R4Q A;  1CKN B;  4POF A;  3TEH B;  2MNA A;  3RZD H;  1WFQ A;  1B8A A;  1NBW A;  1I3Q H;  4AH6 A;  3S2H H;  2HQL A;  4PZ6 A;  4QJF A;  1E22 A;  2OCE A;  1QVC A;  5GAG C;  5IYD G;  5LMN W;  2MO0 A;  2K5H A;  2E2H H;  3FKI H;  1N33 L;  1YIJ A;  3UDG A;  3G48 A;  5LMU L;  1SE8 A;  1EQQ A;  1HZB A;  4BY1 G;  1FJG Q;  2K52 A;  1A63 A;  1H95 A;  1PH1 A;  2ZJQ A;  1CSP A;  1VQP A;  4B3S Q;  3CQZ H;  3B6Y A;  3PIP A;  2ZJR A;  1YJN A;  3IRB A;  3PIO A;  2CQO A;  1N34 L;  2JEB I;  1XTD A;  1HZA A;  2JE6 I;  1Q82 C;  2UXB Q;  4LUZ A;  2I5M X;  4XIG S;  1PA6 A;  1E7Z A;  4BBR G;  4HJ9 A;  4LFA Q;  1Y1V G;  3GTM H;  3OTO L;  1VQE A;  2LSS A;  1XMQ L;  3H3V H;  4GKK L;  1U0L A;  4JI6 Q;  3GTL H;  3HOW G;  4BY7 H;  1A0I A;  3W5O A;  5C0X I;  3A5Z B;  1NJI C;  4MZ9 A;  2R93 G;  3KF8 B;  4PZ8 A;  1WCM H;  4JYA Q;  3TS0 A;  3CCE A;  4KI0 A;  5IP7 H;  1FJG L;  4IJH A;  4BA1 I;  4DR5 Q;  2JA7 G;  4P73 A;  5J3B A;  3L0O A;  3MEF A;  4HJ5 A;  4B3S L;  3M7N A;  1FVI A;  1SN8 A;  2RHS B;  4R4I A;  1YNX A;  4L5Q A;  5GRO A;  1OXS C;  2NVX H;  2N3S A;  4A3L G;  4Y52 H;  4YCW A;  4JI2 Q;  1C7Y A;  1AE3 A;  3GD7 A;  4BBS H;  3S1Q H;  2PQA B;  3ZJY C;  1VQO A;  1LM0 A;  2LXJ A;  2ALY B;  3KDF A;  3CMA A;  3CCU A;  1PH6 A;  1VQ8 A;  1X56 A;  1YI2 A;  4LF4 Q;  4LFA L;  2YTX A;  4OO1 I;  3I7F A;  4X65 L;  4GS3 A;  1UE6 A;  3TS2 A;  1IXR A;  1EUJ A;  4DAY B;  4YY3 Q;  3STB D;  5IE8 A;  1CUK A;  3PUZ A;  3PF5 A;  3S1N H;  2RF4 A;  1LUZ A;  1N8R C;  2UXD Q;  4POG A;  1PH5 A;  3S15 H;  5IYB H;  4LF9 L;  5K36 G;  3M4O H;  3SGI A;  2K4K A;  4LFC Q;  4A3J G;  3DLL A;  1TWG H;  4JYA L;  1X65 A;  1Z9F A;  2HIX A;  4P71 A;  5FJ8 H;  4DR2 L;  2UUB Q;  4DR5 L;  3CF5 A;  4A3K G;  1OXT A;  1N9W A;  1U5K A;  4TVA B;  1QVG A;  1VS0 A;  3U50 C;  1X54 A;  5IP9 G;  4GKJ L;  4DR3 Q;  3HOV H;  4JI2 L;  4DNI A;  1AE2 A;  3L7Z C;  4LF7 Q;  4BBR H;  1L1O B;  1VQC A;  3OYY A;  1NY4 A;  3RLF A;  3GTK H;  4DUY Q;  1J6Q A;  2EIF A;  4LF4 L;  5HY6 A;  2R7D A;  4DKA C;  3I4N G;  2E2J H;  4LF6 Q;  3HOW H;  4DPG A;  2MO1 A;  4YY3 L;  2JA8 H;  2YYZ A;  4IPH A;  3GTG H;  2UXD L;  3HKS A;  1TWC H;  1VQB A;  1EIY B;  4MNO A;  4LFC L;  4GNX B;  2IX0 A;  3J7Z C;  2F4V Q;  3HOU H;  1HNW Q;  3T1Y Q;  4L5S A;  2JJQ A;  1VQG A;  2LXK A;  1BVS A;  1VQH A;  2OQ0 A;  3S24 A;  1K9M C;  1JJ2 A;  2BH2 A;  3KFU A;  1G6P A;  3CPF A;  4OON A;  2IHE A;  3PUW A;  3CCM A;  1YJW A;  3HOZ G;  2CKZ B;  3K7U C;  4DR4 Q;  1VQI A;  2VNU D;  5ELN A;  4A4I A;  2OTL A;  2PMZ E;  4A3I G;  3PGZ A;  4B3T Q;  1TWA H;  4J15 A;  4DR3 L;  1K8A C;  4LF7 L;  2ES2 A;  4DK6 C;  2R7Z G;  2AWN A;  4NB3 A;  3ULL A;  2B63 H;  2OTJ A;  4X6A H;  4PMW A;  2AMC B;  4DUY L;  3PUV A;  2GVB A;  1EFW A;  2WAQ G;  4Y7N H;  1FGU A;  1KRS A;  3HFZ B;  4DK3 C;  1B70 B;  2JQO A;  4LF6 L;  4RG1 A;  1M1K C;  3KJO A;  5JJL A;  4OO1 G;  4X64 Q;  2JA6 H;  1HR0 W;  2BH8 A;  4JOI A;  1MIU A;  2Z6K C;  4A3J H;  1PV4 A;  3K81 C;  1HZ9 A;  1VQJ A;  4OWX B;  5GAE C;  5C3E G;  2F4V L;  1HNW L;  4UP9 A;  3RN2 A;  1XMO Q;  3T1Y L;  1EYG A;  2IY5 B;  2K5N A;  4A3M H;  1KIX A;  1EWI A;  4HIO A;  4DR4 L;  4JI1 Q;  2JK8 A;  1C9O A;  1L1O C;  2KHJ A;  5IP9 H;  3M85 A;  4DV1 Q;  3NEM A;  5IYC G;  4OWT B;  4GNX A;  2HT1 A;  4X62 L;  1KXL A;  4B3T L;  3AQQ A;  4IFD J;  2NZH A;  1IZ6 A;  4AYB E;  1UWV A;  1PH9 A;  2R92 G;  5BR8 Q;  3G6E A;  1G29 1;  1T9H A;  4DR7 Q;  2VQF Q;  2VW9 A;  4GOP A;  1GVP A;  3MXN B;  4OX9 Q;  2KCM A;  1IBK Q;  3PO2 G;  4R4C A;  2WB1 G;  3J81 c;  3CXC A;  2B29 A;  4YWM A;  3KDF B;  3HOY G;  4X66 Q;  1HZC A;  1Q46 A;  1CKO A;  4O0A A;  5E7N A;  1GD7 A;  4X64 L;  3I55 A;  1Q81 C;  1RIP A;  2A8V A;  4JI8 L;  4QL5 A;  3PO3 G;  3J81 j;  2HHH Q;  1K0R A;  2IT1 A;  2K14 A;  1G51 A;  4IOA A;  4EQ5 A;  4ALP A;  5FLX c;  2KBN A;  4B3R Q;  4QQB X;  1N32 Q;  3GTP H;  3M3Y H;  4LNQ A;  1XMO L;  3CCL A;  3S17 H;  4DV6 Q;  3GTJ H;  3ERS X;  3I56 A;  3J81 i;  4JI1 L;  2UUA Q;  4C3I H;  4DV1 L;  4DV2 Q;  3UDX A;  2UXC Q;  3S1R H;  1E24 A;  3J7A 5;  2QGQ A;  4P75 A;  3ULP A;  1O7I A;  2R7Z H;  4JI4 Q;  1PVO A;  4BXX G;  3D31 A;  5C4J H;  5BR8 L;  4DR7 L;  2VQF L;  4OX9 L;  1S40 A;  3HKZ E;  3NEN A;  1IBK L;  1Z47 A;  1HJP A;  3RN5 A;  2VZA A;  2RHQ B;  3CAM A;  3I4M G;  1KL9 A;  1YBY A;  2BA1 A;  1XJV A;  3G4S A;  1K73 C;  1VQ9 A;  4A3D H;  4LFB Q;  1JJC B;  1IYJ B;  3K0X A;  4X66 L;  4DV3 Q;  4QY7 A;  2VUM G;  3ER0 A;  4L5T A;  5C44 H;  1S72 A;  3GTO H;  1TWH H;  4IPD A;  4GLA C;  2UXB L;  4TQU S;  3U58 A;  1IL2 A;  1XNQ Q;  3TRE A;  4DR6 Q;  5M3M G;  2R7F A;  4AIM A;  4B3R L;  5JEA J;  1N32 L;  1PH4 A;  2RCN A;  2OWO A;  4JI3 Q;  4DV0 Q;  4A3E G;  4DV6 L;  4JI6 L;  1FL0 A;  2HIV A;  5IYD H;  1OXU A;  1M90 C;  2UUA L;  1EIF A;  4YWL A;  1GKH A;  1PFS A;  4DV2 L;  4P72 A;  2UXC L;  3EIV A;  3D0F A;  4JI4 L;  4BY1 H;  2UUC Q;  3FHW A;  5FLM G;  3RZO H;  4JC0 A;  5C4X G;  5IT9 c;  5JJI A;  1VQF A;  1KRT A;  2ID0 A;  3CCJ A;  1VQN A;  3S2D H;  1XPO A;  3F8T A;  4C3H H;  5AJ3 Q;  5JJK A;  2KHI A;  1SRU A;  3GDE A;  4LFB L;  1NE3 A;  4DV3 L;  2Y0S E; 
#chains in the Genus database with same CATH topology
 1B3Q A;  2QA4 A;  4QMG A;  5M5Y H;  3TRZ A;  3D8G A;  4V19 0;  1SR3 A;  1Q12 A;  2K05 A;  4RWS C;  2Q2T A;  2EYO A;  4A93 B;  5EBC A;  1WTW A;  1TY2 A;  3Q23 A;  1PH8 A;  4KLK A;  3F2D A;  5IT9 L;  1LAB A;  3KLW A;  2PQE A;  3QG1 A;  4FDB A;  1DYQ A;  2WAC A;  3H09 A;  3CW2 C;  1XNR Q;  2KEN A;  2UUB L;  1TXY A;  4GOP B;  1R9T H;  3FKI G;  1JC7 A;  5EAY A;  3M4Y A;  3CCV A;  2HDL A;  3PMF A;  1PZK D;  2EYF A;  4ME3 A;  2R6G A;  1EZ6 A;  3I8Z A;  2E2J B;  4A3E H;  3GTG B;  1L0Y B;  4YHH L;  4DAV A;  1BO0 A;  4LFB L;  2XN9 C;  2AHO B;  3F2C A;  2Q2I A;  2B2U A;  2HCI A;  3EQL C;  1I50 H;  2YTY A;  5I2X A;  1YVC A;  3NBH A;  4HED A;  2D5D A;  1F2M A;  3T16 A;  2AWO A;  1IBM L;  5CMD A;  4OGQ C;  2F0O A;  2WKD A;  3K5M A;  4JI5 L;  1QUQ A;  1RL2 A;  1HNX Q;  3I3C A;  2EXD A;  3FPP A;  1N36 Q;  2JA6 B;  3PF4 A;  2QEX A;  1V1P A;  2AQ3 B;  1JMC A;  4A3G H;  1SRO A;  2OXP A;  5KND A;  1QG7 A;  5BN4 A;  3NBI A;  1PH3 A;  3A55 A;  4GOP C;  4A3M B;  3E6Z X;  3V05 A;  1ASZ A;  4XYQ A;  2CFM A;  1I4H A;  2VQE Q;  2BA0 A;  3NE5 B;  1XPU A;  1XPR A;  2YU9 H;  4L5R C;  3DWP A;  4PQX A;  3T51 B;  2UU9 L;  3NEL A;  4OEM B;  1DJR D;  4ODG A;  1VQ6 A;  1GO3 E;  4A3F G;  1PYB A;  2R61 A;  4IPG A;  2HHH L;  1MJC A;  1AN8 A;  2YV5 A;  5ELO A;  2JA8 G;  3NSW A;  5I6Y A;  4OXP A;  4LF9 Q;  1H9K A;  5E3F A;  3OW2 A;  1D1I A;  3T13 A;  2L15 A;  1CKN A;  4RHS A;  2B8F A;  3HOU G;  1L0X B;  4BA2 I;  4DV4 Q;  2EJF C;  2R92 H;  3K80 C;  1E2W A;  2K5Q A;  5IWA Q;  1F2Z A;  2JXM B;  1DOK A;  2F0P A;  1VQ4 A;  2F3I A;  5C44 B;  1EEI D;  2WFW A;  4JG2 A;  3PO3 H;  1J9O A;  5KNB A;  1XWE A;  4AYB G;  4H02 A;  5A35 A;  1LTL A;  1H9S A;  1HH2 P;  1J5E L;  2A74 C;  4NPS A;  3BVG A;  3EBE A;  1K3B C;  1NTG A;  1OXX K;  5DAU A;  3G7L A;  2IX3 A;  2WB1 E;  4X3K A;  2KVM A;  3D4D A;  5FK9 C;  2YTV A;  2B2Y C;  4ZLT F;  4QIW E;  4JBM A;  2K5D A;  1B7Y B;  3FVQ A;  1TU2 B;  4X3S A;  1V1O A;  4FF2 A;  3PIP 3;  4KHP L;  1Q8K A;  4DUZ Q;  1STY A;  2VL6 A;  1SFO H;  1U4M A;  3BZC A;  3BDC A;  3W1B A;  1JT8 A;  1QE6 A;  3HOW B;  4GLV B;  2ZT9 C;  3SHL A;  2KCC A;  1TWC B;  2G9H D;  2D0O A;  2N49 A;  3A8J E;  1YZ6 A;  4LK1 C;  2V1C C;  1MKH A;  3RLN A;  4C3I G;  1N33 Q;  1F9S A;  1PTO B;  4HMI A;  1GM5 A;  2NZ1 D;  1TWA B;  5IGC A;  3I4L A;  5LL6 S;  3LGJ A;  1W3S A;  1EWH A;  1C0A A;  1B3A A;  1FYC A;  1AEX A;  1NR2 A;  4JI8 Q;  2TSS A;  2NVY H;  2F0G A;  1ENF A;  2PW5 A;  2JEA I;  3AYH B;  4HID A;  1G2S A;  3S16 H;  4BS9 A;  1Q1B A;  2OF1 A;  2DNC A;  4XQN A;  4C2M B;  1L0W A;  4K0K L;  5I9O A;  4G4K A;  3TEH B;  2MNA A;  3RZD H;  1BXT A;  2HQL A;  2A68 D;  5GAG C;  1E22 A;  2OCE A;  2MO0 A;  2K5H A;  1A6X A;  4M1U B;  3UDG A;  1Q3L A;  1SE8 A;  4DK1 A;  4BY1 G;  1EQQ A;  1TQO A;  2ZJQ A;  1TS3 A;  2ZJR A;  1YJN A;  2OT2 A;  2JEB I;  2H1E A;  3VR4 A;  2JE6 I;  4LUZ A;  3K5N A;  5CC4 A;  4XIG S;  3D6W A;  2XRQ D;  1PA6 A;  1E7Z A;  1KAA A;  3OTO L;  1VQE A;  4FYD A;  1KLG D;  3DUZ A;  2NTS A;  2FMM A;  3GTL H;  1CI3 M;  5KRU A;  1NJI C;  1WCM H;  4JYA Q;  2BOS A;  3W3A A;  4ZAI A;  3S1R B;  3C3L A;  2R7Z B;  1DZ1 A;  4IJH A;  4BA1 I;  4DR5 Q;  1Q90 A;  1SMY C;  4B3S L;  3M7N A;  3BYT B;  1SN8 A;  4R4I A;  5GRO A;  2NVX H;  4HCE A;  4K5V A;  1C7Y A;  2PZW A;  3GD7 A;  3Q24 A;  2PQA B;  2B2T A;  1LM0 A;  2ALY B;  1PH6 A;  1VQ8 A;  4LF4 Q;  3SXH A;  1EEF D;  2EXZ A;  5C3E B;  3CU7 A;  2PPB C;  4GS3 A;  2Z4H A;  5IE8 A;  3S1N H;  2DNE A;  2RF4 A;  1LUZ A;  2UXD Q;  1JIC A;  2FHT A;  3S15 H;  4HMJ A;  4ZYS A;  4K6L A;  3VYU A;  1SEB D;  1S5F D;  4DR2 L;  5JOB A;  3CF5 A;  3PO2 B;  2WB1 B;  4CBV A;  3RZO B;  5C4Z A;  1BCP F;  3U50 C;  1X54 A;  2F0N A;  4GKJ L;  4N9P A;  4DR3 Q;  3L7Z C;  1YNN C;  2B8G A;  4LF7 Q;  1NY4 A;  4WJW A;  4QIW B;  3IFD A;  5M5Y B;  2F3V A;  4R8N A;  1JCK B;  2DY8 A;  4DKA C;  5JEA H;  2E2J H;  5IGF A;  2MO1 A;  3ND8 A;  1KTK A;  1KNA A;  3FDT A;  3GTG H;  2Z1C A;  1UUP A;  1FNW A;  2IX0 A;  3J7Z C;  2F4V Q;  3ND9 A;  3KK7 A;  3BZD B;  1U4R A;  1JJ2 A;  1K9M C;  2LY7 A;  3CPF A;  3CCM A;  3QJY A;  2LS0 1;  3OW7 A;  5D3I B;  2NB0 A;  2OTL A;  2VNU D;  2PMZ E;  4B3T Q;  1R9T B;  5AFW A;  3FMC A;  2E2I B;  2DJG C;  2OTJ A;  2AMC B;  1HFG A;  1SDF A;  2CW0 D;  2WAQ G;  3AB9 A;  1FGU A;  1KRS A;  5EKI A;  4Y7N H;  4ZKC B;  4RG1 A;  4OO1 G;  4A3E B;  2JA6 H;  4HAE A;  4IUV A;  3BVZ A;  3R93 A;  4A3J H;  2Z6K C;  1PV4 A;  1HZ9 A;  1S5E D;  3GTQ B;  3TZD A;  3OSO A;  1LTT D;  1EYG A;  5C4H A;  4A3M H;  2MGS A;  4HIO A;  1C9O A;  4K14 A;  1I50 B;  2HT1 A;  4X62 L;  1SNM A;  4DGZ A;  1O80 A;  1NSN S;  2R92 G;  1G29 1;  2VQF Q;  1EWC A;  4GOP A;  2ZXP A;  2KCM A;  1IBK Q;  4R4C A;  2PCF B;  4YWM A;  3SK8 A;  4RH6 A;  1Q46 A;  5IGB A;  3VYS A;  1RIP A;  2A8V A;  1I4P A;  3PO3 G;  4JW0 A;  1A3V A;  1K0R A;  4LAA A;  4IOA A;  4A3G B;  3CCL A;  3HZX A;  4KY7 A;  1I3Q B;  4IZ8 A;  3GTJ H;  2MPM A;  4DV1 L;  2QGQ A;  1PVO A;  3D31 A;  1CTM A;  5D14 A;  1HFN A;  5BR8 L;  1STA A;  1A2U A;  1JOK A;  2YU9 B;  1K73 C;  2BCO A;  2L12 A;  4DA2 A;  2WAQ B;  4DV3 Q;  1C48 A;  3QWN A;  4L5T A;  5C44 H;  5J22 A;  5FLX L;  5CV7 A;  5LHY 1;  2IL8 A;  3DEO A;  4XDX A;  4TQU S;  4DR6 Q;  3TRE A;  2A73 B;  2R7F A;  4B3R L;  4IN3 A;  1B9N A;  5JEA J;  1N32 L;  1SBB B;  3OIP A;  4BY7 B;  3E0J A;  3NTK A;  2F4I A;  1M90 C;  1W6K A;  2UUA L;  1EIF A;  4DV2 L;  1PFS A;  1DXM A;  4J8Q A;  3V96 A;  4JI4 L;  1STB A;  3FHW A;  4X3U A;  5C4X G;  1ET9 A;  1KRT A;  1SE3 A;  3OWF A;  1XPO A;  1HUM A;  4C3H H;  3DWA A;  1NE3 A;  4BBS B;  4JVZ A;  2A1A A;  3A8I E;  3KBG A;  4RFB A;  2B2Y A;  2ZM6 Q;  2D0P A;  1S3O A;  1XNQ L;  2K50 A;  5I9P A;  5I6W A;  3E0E A;  3WOF A;  5TSS A;  4JI3 L;  1AH9 A;  3QOL A;  2NZO A;  4KHZ A;  3C46 A;  3M4O B;  2QIL A;  4PMB A;  1TWG B;  4TRD A;  5CBE E;  1UE5 A;  3A74 A;  2JA7 H;  2K28 A;  4A3B G;  3F2B A;  2VY3 A;  3ERQ A;  3NQI A;  3T1H Q;  4H0L C;  1GHJ A;  4K5W A;  4IQZ A;  4A3L H;  2E8G A;  2R3Z A;  1PTO H;  1KD1 C;  2WII B;  5JAV A;  2MHV A;  2QDB A;  2KOL A;  3GTK B;  2PMZ B;  5BN3 A;  1P16 A;  1ENA A;  2HCC A;  3D3R A;  2PNR C;  1SFO B;  1G6Z A;  3UE0 A;  1NMF A;  1HHV A;  3NXW A;  2XWJ B;  1BBX C;  4KJO A;  4DAM A;  2EDG A;  1RD9 D;  3GO5 A;  3PUY A;  5FLM H;  4C2M H;  4GN5 A;  3M9B A;  3BYY B;  3A5U A;  1W2B A;  3EVQ A;  1YIT A;  3E9H A;  1XNR L;  1EYC A;  1SYE A;  3QR8 A;  3TBI B;  1ZXT A;  4OL7 A;  1WCM G;  1FNV A;  3P1H A;  2O2L D;  5CGK A;  3CCQ A;  4ZUJ A;  2L11 A;  3AFQ A;  1UE1 A;  1IW7 C;  1MI2 A;  5BN5 A;  5IOC A;  5IY0 A;  4L63 B;  1MHW C;  4DR1 Q;  5JVH 3;  1I4G A;  2B3G A;  5CR3 A;  4CDE C;  2NVY B;  3CCR A;  1I94 Q;  1ESR A;  1PTO D;  3BZK A;  3S16 B;  2JA5 H;  1KDC A;  5A2Q E;  3SVM A;  4LF5 Q;  3E3X A;  3UE1 A;  3RZD B;  2KHS A;  1L2F A;  5EBD A;  1FGB D;  1VCI A;  4A93 G;  4LF8 Q;  1JWU D;  1R4Q B;  4MTK A;  3A0J A;  3JAM c;  1TII D;  1K28 A;  1EFI D;  2K32 A;  1VQA A;  1Q7Y C;  5JVG 3;  5M5X H;  1HNZ Q;  4JK1 C;  2XTI A;  1JR0 D;  1HNX L;  3J80 c;  5GAD C;  5CV4 A;  3SEB A;  1N36 L;  1BKB A;  4A76 A;  4X65 Q;  3A7A B;  5JEA G;  5C3E H;  4DU9 A;  3JAM i;  4B08 A;  1SLJ A;  1VQD A;  1PTO F;  2B2W C;  5FOB B;  3HOX H;  1ICW A;  3GTL B;  4Q0F A;  3H91 A;  1K83 H;  3W2D A;  4IPC A;  3J80 i;  2VQE L;  1EU4 A;  3KYH C;  3NTI A;  4KV6 A;  3KF6 B;  3PO2 H;  1JJG A;  1PHJ A;  5H1S E;  2CWA A;  4CGY B;  4A3D B;  2NVX B;  1PH7 A;  1VQL A;  1SNQ A;  3GTO B;  1TWH B;  2I5H A;  3UI2 A;  4A3C G;  4JV5 Q;  5GAH C;  2G5D A;  2A6H D;  1SSO A;  1VQK A;  3CRL C;  4YWK A;  3ULJ A;  2GN5 A;  3M4P A;  4UP7 A;  1EL0 A;  2JA6 G;  3S1N B;  4DXG A;  3S15 B;  2PI2 E;  1BF4 A;  3RUZ A;  3E9I A;  4DV4 L;  4BXX H;  4A3M G;  2NYZ D;  3DM1 A;  2J7Z A;  5IWA L;  4KD3 A;  3S2D B;  4RAU C;  4NW2 A;  1WI5 A;  2F1M A;  2L9H A;  3IKJ A;  5KIX A;  4GN3 B;  1KQS A;  4G7O C;  4K8J A;  2E2I H;  1D8L A;  1YNJ D;  5ELB A;  4L8J A;  1Y1V B;  1NMG A;  4OEL B;  2VS1 A;  1NCV A;  1DGS A;  2PQA A;  2ASB A;  3CME A;  4HIM A;  3BJU A;  2F0E A;  3DWQ A;  3BS1 A;  1EOV A;  2F0L A;  4R4T A;  1CK1 A;  3PCO B;  3S9W A;  4A75 A;  3GTQ H;  3BDL A;  2JYO A;  4XXE A;  1Y1W H;  2WV6 D;  3HEJ A;  3P20 A;  3RNU A;  2Z6K A;  1K8G A;  4CJ1 B;  4HJ7 A;  1X3E A;  2Q2H A;  2K1B A;  1BR9 A;  1UE7 A;  3FP9 A;  1LT6 D;  1RHP A;  3KOJ A;  1CA6 A;  2NBF A;  4DUZ L;  4HIK A;  1Q1E A;  1X3G A;  3K58 A;  1SYC A;  3ONA B;  2IHF A;  5EPL A;  1N34 Q;  4Y7N B;  1EYD A;  1WTV A;  2I46 A;  5C44 G;  3KLS X;  2CW0 C;  3G71 A;  4A3J B;  4O42 A;  4QUC A;  4CHT B;  1XMQ Q;  1QZH A;  4A3K B;  1EOT A;  5KYI A;  1I3Q H;  4CDF C;  1U9R A;  2EJG C;  1QVC A;  1WTR A;  1N33 L;  3DXJ C;  1H95 A;  1HZB A;  2K52 A;  1PH1 A;  4ILW A;  1IKM A;  2L1B A;  3TP6 A;  1VQP A;  3CQZ H;  3B6Y A;  3PIO A;  4FXD A;  1I6V C;  1ET6 A;  3Q6S A;  1XTD A;  1HZA A;  2F0Q A;  2AUK A;  2F0M A;  2Q8I B;  4IUR A;  2SOB A;  4LFA Q;  1DD2 A;  2LSS A;  3H3V H;  1AZP A;  2M00 A;  5I2Y A;  3HOW G;  4BY7 H;  1A0I A;  1CFM A;  2KEE A;  3W5O A;  4RGN A;  4MZ9 A;  3GTJ B;  3D4W A;  1SJE D;  1D1K A;  2KCN A;  4K5X A;  3TS0 A;  1TS4 A;  1LTI D;  3A7L A;  3CCE A;  2JA7 G;  4KD4 A;  3DMU A;  1RF2 D;  3OOC A;  3MEF A;  4HJ5 A;  2RHS B;  1YNX A;  4L5Q A;  4A3L G;  4BBS H;  3S1Q H;  1VQO A;  3R3O A;  3CMA A;  1JOQ A;  1YI2 A;  1LO5 D;  1UE6 A;  4DAY B;  1I4R A;  1CA5 A;  1HCZ A;  1N8R C;  5K36 G;  3M4O H;  3SGI A;  2K4K A;  3VR5 A;  1TWG H;  4JYA L;  2QEJ C;  1X65 A;  1GUG A;  2HIX A;  4P71 A;  5FJ8 H;  2UUB Q;  4FO2 A;  4DR5 L;  4C1N K;  3NP8 A;  2EYM A;  1N9W A;  4MHE A;  5LL6 X;  1QVG A;  5COY A;  4C3H B;  2CH4 A;  1AE2 A;  4BBR H;  3AU7 A;  4JPB W;  3P75 A;  1RTO A;  3GTK H;  4DUY Q;  2EIF A;  2EYL A;  3A54 A;  4LF4 L;  4C3J B;  1EY6 A;  2R7D A;  4Z9C B;  1HQR D;  4PV1 C;  2YYZ A;  4IPH A;  4HCS A;  5FO7 B;  2UXD L;  1E2Z A;  1HRJ A;  2K01 A;  2L5T A;  1F2L A;  5NUC A;  4GNX B;  1SE4 A;  1HNW Q;  2JJQ A;  1VQG A;  5G3L D;  2OQ0 A;  3S24 A;  1G6P A;  4C56 C;  4OON A;  2IHE A;  3MFG A;  3PUW A;  4X3T A;  1YJW A;  2CKZ B;  4DN4 M;  2FJ2 A;  1EY8 A;  2KJX A;  1WTX A;  5ELN A;  4A4I A;  1SNO A;  3AMU A;  4DR3 L;  1K8A C;  4LF7 L;  2R7Z G;  2AWN A;  4NB3 A;  5DNF A;  2L4N A;  4X6A H;  1IW7 D;  4KHV A;  1GUN A;  2NN6 H;  2GVB A;  3MHB A;  1EFW A;  5M3M B;  1B70 B;  2JQO A;  2FFK B;  1M1K C;  2EOT A;  3JAM E;  1XX8 A;  1S4Z A;  3K81 C;  4RA8 A;  4OWX B;  5C3E G;  2F4V L;  1K8M A;  2K5N A;  5G3L F;  3T53 B;  4JI1 Q;  1LV9 A;  5IP9 H;  2FMC A;  3I91 A;  2O5I C;  1KXL A;  4OWT B;  2K6A A;  3MC0 B;  4B3T L;  1IZ6 A;  4KKU A;  1PH9 A;  4DR7 Q;  2KED A;  4OX9 Q;  4QF4 A;  3WOE A;  4YIJ A;  3PO2 G;  2KA7 A;  2VB3 X;  2WB1 G;  1PRT B;  3J81 c;  3MVV A;  4OHJ A;  3EFX D;  4FF3 A;  2MP1 A;  5M3F B;  1HZC A;  2EE1 A;  1Q81 C;  3OMC A;  1CHQ D;  5C0X H;  2HHH Q;  2K14 A;  2Q8R E;  2D2C C;  4EQ5 A;  2KBN A;  3H0G B;  3K5L A;  1X32 A;  2JA5 B;  4DV6 Q;  3S2H B;  3R2I A;  3M7G A;  1PTO C;  3J81 i;  1C8C A;  1Y8O B;  1CM9 A;  1E24 A;  1EU3 A;  3J7A 5;  3ULP A;  1O7I A;  4BXX G;  5CV5 A;  3R2T A;  5ELD A;  2B2W A;  2VQF L;  1PYW D;  3HKZ E;  3NEN A;  1IBK L;  1Z47 A;  3RN5 A;  3CAM A;  2RHQ B;  1KL9 A;  1YBY A;  5M5X B;  5IGE A;  4A3D H;  1JJC B;  3K0X A;  3QIA A;  3GTO H;  3MXN A;  1TWH H;  4IPD A;  2F0V A;  2UXB L;  3GTM B;  2NTT A;  2E74 C;  4AIM A;  2FIN B;  2HD3 A;  1PH4 A;  2RCN A;  3VR3 A;  4WRD A;  1O78 A;  4A3E G;  4KY5 A;  4KN4 C;  2Z9H A;  4JI6 L;  1FL0 A;  2RSN A;  3HOX B;  1K83 B;  2XVS A;  3EIV A;  1PRT C;  1B44 D;  2UUC Q;  4JC0 A;  5IT9 c;  1VQF A;  1WVL A;  3S2D H;  5CV9 A;  3F8T A;  5AJ3 Q;  1ILP A;  1PFB A;  4DF7 A;  4ZKB B;  1X3P A;  3GDE A;  5DM7 3;  4WOR A;  2Y0S E;  4DV3 L;  2DGY A;  4HSP A;  4EX5 A;  1SE2 A;  1VMC A;  2N78 A;  3HGB A;  3SDZ A;  3EJI A;  1GUW A;  4PMC A;  1Y1V H;  3CKI B;  1KHI A;  4DR6 L;  3P7J A;  1STN A;  2MFI A;  2GVA A;  3CCS A;  2A6H C;  2XGT A;  3STB C;  1YEZ A;  2Q2U A;  4A3G G;  3CC7 A;  3UDI A;  1KAB A;  2RDG A;  2RDH A;  4XTC S;  1O7Y A;  1QCB D;  3SR1 A;  3EN2 A;  3VR2 A;  2VUM H;  5EPK A;  2KEC A;  1QUQ B;  1RCV D;  1E1O A;  2H5X A;  3BU2 A;  4B9W A;  3DEP A;  5IGD A;  1KDA A;  4P74 A;  2PZU A;  3HOY H;  1HXY D;  1A8V A;  2IJ0 A;  4I7Z C;  4YCU A;  1E2V A;  4IUT A;  1XTC D;  1YNJ C;  3KLR A;  4JCV E;  1B4O A;  3LWU A;  1F9Q A;  5C0X J;  3CD6 A;  4K0K Q;  3MZ5 A;  4DV5 Q;  3I4O A;  5M9O A;  3C1E A;  4A3K H;  4BY7 G;  1YHQ A;  4ZRZ A;  4WFN 3;  3T1H L;  1Y1W B;  5CYU A;  1V43 A;  1KC8 C;  1ENC A;  3MXG A;  3DHQ A;  3GV6 A;  3LWE A;  5D65 A;  1VQ7 A;  4OIJ A;  1V1Q A;  3PV0 A;  3UDF A;  4B3M Q;  3QO2 A;  1LAC A;  4O2D A;  3HG9 A;  4APV A;  4GLX A;  1HTL D;  2L55 A;  4JI7 Q;  4BBS G;  4LUO A;  1LTG D;  5HGQ A;  1LTS D;  3CP0 A;  4DV7 Q;  1QVF A;  3AEV A;  4CDD C;  4AQY Q;  4F87 A;  2RQX A;  4HN7 A;  1ML0 D;  4XYO A;  2K33 A;  2ZJP A;  1YHB A;  4EVO A;  3N6R A;  1S5C D;  4XT3 B;  1WJJ A;  2K7V A;  5GQO A;  2PNH A;  1B53 A;  2QKI C;  5FJ8 G;  4UY8 C;  1Q86 C;  2LMC B;  3MXU A;  3CQZ B;  1ASY A;  4OIK A;  4R4O A;  3I70 A;  1SNP A;  3HKZ B;  2EJM A;  3K8A A;  3M4Q A;  4DR1 L;  2PO4 A;  1JE5 A;  4IJL A;  2XRS D;  4ULL A;  1I94 L;  1PXU A;  4GN4 B;  1J8I A;  2C9O A;  1I5F A;  1E0B A;  3S17 B;  1S5B D;  3TP5 A;  4NXN Q;  4LF5 L;  2KCT A;  5HGT A;  1UAP A;  1VDZ A;  1X3F A;  2NVT H;  4LF8 L;  4DR2 Q;  4I65 A;  3H3V I;  1MJE A;  3S1M H;  5C4J B;  1ZYR C;  2CWP A;  1HR0 Q;  1QOH A;  1E1T A;  1A62 A;  1LLR D;  1U4L A;  4GKJ Q;  4RHR A;  2F3W A;  1HNZ L;  3NWS A;  3FRP B;  1LTR D;  2DUD A;  3NTH A;  3WWV A;  4QGU A;  1CKM A;  5FO8 B;  3S1Q B;  1B2T A;  1TS2 A;  2NN6 G;  2WP8 J;  1T5E A;  1Z6H A;  5E4X A;  2Y0S B;  3NPP A;  1BOS A;  4C3J H;  1UNS A;  5LMN Q;  2DY7 A;  2CCZ A;  2G9D A;  2JA9 A;  1SJH D;  2NUC A;  2Q8T A;  4DV0 L;  2Z8L A;  2E5L Q;  1MGS A;  1O7L A;  4QUF A;  4NXM Q;  2I5L X;  4K2K A;  3I73 A;  1JWM D;  3URY A;  3VDY A;  1BNZ A;  1IBL Q;  1BDO A;  2A69 D;  3PIO 3;  1QB5 D;  1SXT A;  4BBR B;  1RTN A;  2OQK A;  4A3F H;  4MTN A;  5ELE A;  1QZG A;  4JV5 L;  1MD2 D;  3H3V C;  1MSG A;  1LT5 D;  5C3W A;  3TQY A;  2ATW A;  5M3M H;  2ICE C;  4JI0 Q;  4R8I A;  4WJ3 M;  2IX1 A;  3FEW X;  4LW1 A;  3U4V A;  4CJ2 C;  5EGT A;  5C0X G;  2R93 B;  4DAY A;  1IYV A;  4KKS A;  3RD4 A;  2ZTE A;  3J81 E;  3GP7 A;  1I6H H;  2F0I A;  3RMH A;  4X62 Q;  4EQP A;  2F52 A;  4IO9 A;  1K3R A;  5LMU Q;  1LTB D;  1EZ8 A;  2PI2 A;  1KDB A;  4DXF A;  1PFM A;  5CV8 A;  1BQQ T;  3QOJ A;  1NUC A;  4OWW B;  2MJ8 A;  4A3D G;  2PYK A;  5M3F H;  1GUO A;  3CC2 A;  4DK0 A;  3PUX A;  4PG3 A;  2M2L A;  3K7A B;  2NN6 I;  2SDF A;  4RMF A;  4GZY C;  2VXW A;  4J1M A;  4GKK Q;  2QCP X;  4H13 C;  3H0G H;  1FR3 A;  1NAP A;  1B8A A;  5DM6 3;  2AQ2 B;  4TKO B;  3S2H H;  4PZ6 A;  4ALP A;  2JSO A;  5LMN W;  1A15 A;  1YIJ A;  3T4A C;  4QB4 A;  1FJG Q;  1CSP A;  3K0Y A;  2IPK D;  3IRB A;  2RKS A;  1N34 L;  1GXD C;  1Q82 C;  1BCP B;  2A5H A;  4HJ9 A;  1HQM C;  1Y1V G;  5IT9 E;  3GTM H;  2DJF C;  1XMQ L;  2EYH A;  5CBA E;  3J7Y W;  1B50 A;  5C0X I;  3WDN A;  1PRT D;  4RCN A;  3KF8 B;  1AP0 A;  4IFD H;  2RVL A;  3CRK C;  3HS0 C;  4KI0 A;  5IP7 H;  1SAP A;  1TY0 A;  4P73 A;  5J3B A;  3L0O A;  1FVI A;  3K6O A;  4K8I A;  1JWS D;  1OXS C;  4YCW A;  4JI2 Q;  1EY9 A;  1EY5 A;  2EVB A;  5KNC A;  2RDF A;  4NP5 A;  2LXJ A;  3HOY G;  5D3D A;  1X56 A;  4LFA L;  2YTX A;  5IIF A;  3O13 A;  3TS2 A;  1IXR A;  1EUJ A;  4YY3 Q;  1HUN A;  3STB D;  4FNF A;  2CVR A;  3PUZ A;  2CHB D;  4CKE A;  2Z6B A;  5IYB H;  4LF9 L;  2EZV A;  4LFC Q;  4G7Z C;  4A3J G;  3DLL A;  4DR4 Q;  1AW7 A;  2V4D A;  3J7A F;  1PRT F;  1EY7 A;  3X3M A;  4FF4 A;  1HA6 A;  1PLF A;  5J1Z A;  4A3K G;  5A2Q L;  1OXT A;  4EQN A;  4TVA B;  3GV3 A;  3NUC A;  3HOV H;  4CJ0 B;  1L1O B;  1VQC A;  2DN8 A;  2F0J A;  3OYY A;  5FO9 B;  3RLF A;  2N55 A;  1DOL A;  5HY6 A;  4FF1 A;  4LF6 Q;  3KUP A;  3VA7 A;  1TWF B;  5FKA C;  1RJT A;  3HKS A;  1LTA D;  1D5M C;  1O7Z A;  1VQB A;  2K5W A;  1XYI A;  1EIY B;  1VMP A;  2SNM A;  3T1Y Q;  2BH2 A;  1PZJ D;  2LXK A;  1CT1 D;  5T1G A;  1DOM A;  3TN2 A;  3I4M B;  3K7U C;  4G7H C;  4CKC A;  2B39 A;  1VQI A;  5E4W C;  2F0U A;  3PGZ A;  2VUM B;  4J15 A;  2AUJ D;  5F2D A;  4DK6 C;  1A2T A;  2B63 H;  4PMW A;  3NHH A;  4DUY L;  3HOY B;  3HFZ B;  5DEH A;  2XSC A;  5JJL A;  2WKC A;  1EQV A;  4X64 Q;  2BE5 C;  1AFP A;  4KJN A;  5ISR A;  1FNU A;  2F0H A;  1GUS A;  1VQJ A;  5GAE C;  1Y69 U;  2VB2 X;  1HNW L;  3RN2 A;  1XMO Q;  2NWG A;  4HTH A;  2IY5 B;  1KIX A;  1EWI A;  4DR4 L;  1L1O C;  1CZG A;  3M85 A;  3IFT A;  3NEM A;  1SND A;  3AQQ A;  4IFD J;  2NZH A;  4AYB E;  1D6E C;  1F77 A;  3G6J B;  1GVP A;  2J4X A;  4LMQ D;  2JP1 A;  1FD7 D;  1XXG A;  3CXC A;  1D2B A;  2F0S A;  3KDF B;  4BWG B;  4X66 Q;  2BDN A;  4O0A A;  1D5X C;  3TDQ A;  4C3H G;  5E7N A;  1EY4 A;  1NNX A;  2EY2 A;  1GD7 A;  1HTP A;  5EQ0 A;  4JI8 L;  5KEE A;  3OIQ A;  5CV6 A;  3J81 j;  4RCO A;  1G51 A;  4C3J G;  3S14 B;  5FLX c;  2C5C A;  4QQB X;  3GTP H;  4DAP A;  4LNQ A;  2EY6 A;  3S17 H;  2B2V C;  2SEB D;  3I56 A;  3ZYY X;  4JI1 L;  2E2H B;  3FKI B;  3UDX A;  2UXC Q;  1ZYR D;  4P75 A;  2JA7 B;  2QF7 A;  5C4J H;  1ZEQ X;  4DR7 L;  2LKV A;  4OX9 L;  3OPO A;  1HJP A;  1H9M A;  2VZA A;  3C1F A;  2BA1 A;  3ERO A;  1XJV A;  1VQ9 A;  3G4S A;  2EYJ A;  4OO1 H;  1T5X D;  2RCF A;  4LFB Q;  1STH A;  4KTA A;  2XNA C;  2HQE A;  4KK7 A;  1S72 A;  1H9R A;  2XWB B;  4F7X A;  1EIH A;  4RGO S;  1U4P A;  2X6L A;  1ZKO A;  4FP5 D;  4CDC C;  5C5L A;  5M3M G;  2OWO A;  4M8A A;  4HSV A;  4DV6 L;  2P5Z X;  1AZQ A;  2HIV A;  5IYD H;  1OXU A;  1GKH A;  2NVT B;  4P72 A;  3D0F A;  3IL8 A;  5EPJ A;  3SK5 A;  5E1F A;  4U67 3;  5FLM G;  3S1M B;  1QNU A;  1VQN A;  4NMZ A;  3SK4 A;  5KYL A;  2KHI A;  1SRU A;  3KLS A;  4ZCK A;  1T9H A;  5ELC A;  1SYD A;  4TSS A;  2Z4I A;  5IOD A;  2F0F A;  4R9W A;  3PQI A;  1OXV A;  2ZXO A;  3FPU B;  1X6O A;  5M3F G;  4G57 A;  2K5V A;  3KJP A;  4YHH Q;  1X9N A;  3F2U A;  4WJ4 A;  4KN7 C;  2R93 H;  2ICI A;  4PZ7 A;  3TP8 A;  2NVQ H;  5I4D A;  1W6J A;  3H0G G;  4UPA A;  2UUC L;  1QIL A;  2JA5 G;  3SK6 A;  1LYL A;  1X55 A;  2TMP A;  4R1J A;  1IKL A;  3NWT A;  2I0Q A;  4CKB A;  5AJ3 L;  5C5M A;  4UAI A;  3BG3 A;  1IBM Q;  1ILQ A;  4IAL A;  4XQJ A;  2EQS A;  3OHX C;  3KBX A;  3HP3 A;  1UEB A;  1TR5 A;  4A3F B;  4JI5 Q;  3A8K E;  2A69 C;  4NDX A;  2JA8 B;  1SMX A;  2WIN B;  4HJA A;  3TSS A;  3D4R A;  4IUP A;  3K7A H;  5EJW A;  2RSO A;  4J6H A;  3HOU B;  2K75 A;  4MN3 A;  3PSI A;  4ZQ3 A;  1HPC A;  5C4X H;  4S3S A;  1I6H B;  1K8O A;  5K5P A;  3LX0 A;  3J80 E;  2M9V A;  3HOX G;  2F0K A;  4KMU C;  4HR7 B;  1Y14 B;  3TME A;  1WD1 A;  4IFD G;  3V2T A;  1TT2 A;  2J0T D;  5IP7 G;  4JOI C;  1CQF A;  1RKN A;  3JC6 6;  2UU9 Q;  3I4N H;  4AYB B;  2ZXR A;  1KAW A;  2C35 B;  1KNE A;  5T1I A;  1JOO A;  1V9P A;  3K57 A;  4GNX C;  1D7Q A;  1SYG A;  1I4X A;  4N9T A;  5DLQ E;  3W1G A;  4DV5 L;  4IOC A;  4A3B H;  4QCL A;  4JBK A;  3VA5 A;  3CHB D;  2X69 A;  4UP8 A;  3HOZ H;  1EQT A;  1DON A;  5IYB G;  1BBW A;  4A3I H;  4K2L A;  4V0B A;  2F0T A;  3MXP A;  1X3Q A;  5IGG A;  4LUV A;  4B3M L;  2ZTC A;  2MQH A;  3HOV G;  3MWY W;  4JI7 L;  4JBJ A;  3CC4 A;  1YHA A;  4JBW A;  4MIU A;  1WTQ A;  1WTH A;  4DV7 L;  3BVM A;  3TZU A;  4AQY L;  1GJX A;  3ICE A;  2A19 A;  3M3Y B;  1J5E Q;  2EY1 A;  4F88 A;  4H7B A;  3JAM L;  4C3I B;  2ZTD A;  2N8N A;  5IYC H;  1VQ5 A;  1JB7 A;  3NQT A;  5M5W H;  1BUV T;  2WAQ E;  4KY6 A;  2L0C A;  2KUM A;  1A3U A;  1R4P B;  2Z0S A;  1BCP D;  3J80 L;  4C1N I;  4I7A A;  2AKW B;  2O5J C;  2SNS A;  2E76 C;  1Y1W G;  1CZW A;  1EYA A;  1GUT A;  4IFD I;  1OTC A;  1PH2 A;  1S5D D;  4KHP Q;  2B63 G;  1IHZ A;  2F0D A;  3AFP A;  4PNY A;  4A93 H;  1TWF H;  4NXN L;  2ENB A;  2FXQ A;  2O4X A;  1NR4 A;  3F1Z A;  4BY1 B;  3NBH B;  4FXK C;  1BBU A;  4ZUI A;  3RLO A;  3KF8 A;  1WOC A;  1HR0 L;  3I4M H;  3RR5 A;  1GHK A;  3VYR A;  1C4Q A;  3ITP A;  2HDM A;  3HOV B;  3KF6 A;  2A6E C;  3TP7 A;  4O1N A;  4EQO A;  3HRZ C;  4LWC A;  1V1P B;  4IUN A;  2ZM6 L;  2BE5 D;  4FVM A;  1WYD A;  4YCV A;  4DNT B;  1Q8I A;  3R8B A;  5LMN L;  1JE4 A;  3HKZ G;  5JPM C;  3Q8D A;  5HUR A;  3T56 B;  2E5L L;  4NXM L;  2D62 A;  4E6I A;  1Y8N B;  3CPW A;  5JJZ A;  1IBL L;  1E3P A;  4NKL A;  3U4Z A;  1VQM A;  1TVX A;  1CHP D;  5FLX E;  4EGV A;  4A3C H;  4ZK9 B;  3I2Z A;  3H15 A;  3Q22 A;  1VF5 C;  2QW7 A;  2B63 B;  3L2P A;  1PDQ A;  1PFN A;  3H6M A;  1L1O A;  1SYB A;  1YJ9 A;  2LFN A;  1V8Q A;  2EY5 A;  4JI0 L;  1IL8 A;  2B2U C;  1EQR A;  2OEO A;  1PYS B;  4HJ8 A;  3DM3 A;  3J7A V;  3OTO Q;  1CSQ A;  1K0S A;  2Y0S G;  1P8L A;  3S14 H;  4R4Q A;  1CKN B;  4POF A;  1WFQ A;  1NBW A;  2K04 A;  4AH6 A;  4QJF A;  5IYD G;  3BDO A;  2IWH A;  1WTO A;  2E2H H;  3FKI H;  3L9A X;  3G48 A;  5LMU L;  2CQA A;  1A63 A;  3GQB A;  2B2V A;  4B3S Q;  1OO9 B;  3PIP A;  1EIG A;  2CQO A;  2UXB Q;  2E75 C;  1JQY D;  2I5M X;  1JOR A;  4BBR G;  1H9S B;  3Q0A A;  4GKK L;  1U0L A;  3MTS A;  1STG A;  4JI6 Q;  3OMG A;  3K59 A;  3GTP B;  2RBM A;  5J39 A;  4RKL A;  3MA2 B;  3A5Z B;  1PMR A;  5EKL A;  2R93 G;  4PZ8 A;  1FJG L;  1G8Z D;  4H44 C;  4F8M A;  1MSH A;  3A56 A;  1UEA B;  4B9X A;  2HUG A;  3MEH A;  4XQQ A;  2N3S A;  4Y52 H;  3QB3 A;  1AE3 A;  1DCZ A;  3ZJY C;  1TS5 A;  3U9S A;  3CCU A;  3KDF A;  4L6T B;  1A3T A;  4OO1 I;  3I7F A;  1WD0 A;  3MFY A;  4X65 L;  3X3N A;  2F0W A;  4N8X 1;  1QNK A;  1CUK A;  3PF5 A;  3MAQ A;  5ELF A;  2N88 A;  1IYU A;  4POG A;  1PH5 A;  1M8A A;  3E5S A;  1Z9F A;  2R92 B;  2EPB A;  3K5O A;  2XIW A;  2QDL A;  1U5K A;  1VS0 A;  5IP9 G;  2H4O A;  4JI2 L;  1G91 A;  4DNI A;  4LJZ C;  1ESF A;  3PO3 B;  1J6Q A;  1WTP A;  1EY0 A;  3I4N G;  3HOW H;  2PZT A;  4DPG A;  4YY3 L;  2JA8 H;  2AQ1 B;  1TWC H;  4MNO A;  4LFC L;  3D6C A;  3HOU H;  3SE0 A;  4Q5V A;  1ICF B;  4L5S A;  2NVQ B;  1BVS A;  1VQH A;  1SNC A;  3KFU A;  3HOZ G;  5C3X A;  3H94 A;  1G2T A;  3U9O A;  4A3I G;  4FXG C;  1TWA H;  3EA6 A;  2I07 B;  1ROD A;  2ES2 A;  3NK9 A;  3ULL A;  2MUY A;  3PUV A;  4ID6 A;  1M4V A;  4DK3 C;  4LF6 L;  4DNR B;  3KJO A;  5K36 H;  1LT3 D;  1HR0 W;  1QWY A;  2BH8 A;  4JOI A;  1MIU A;  4K6D A;  2KQ3 A;  4P2C B;  5KGU A;  1STE A;  1H9J A;  4U68 A;  4UP9 A;  4XT1 B;  2GA4 B;  3T1Y L;  5C4X B;  1TKW B;  1KLU D;  2JK8 A;  2D9U A;  2KHJ A;  1F2Y A;  4DV1 Q;  4GNX A;  3VR6 A;  5IYC G;  1RDP D;  2IW3 A;  1UWV A;  5BR8 Q;  1MBY A;  3G6E A;  4IUU A;  2VW9 A;  3MXN B;  1F9P A;  2B29 A;  4N8F A;  3I4N B;  1CKO A;  1SYF A;  4UDU C;  2CH4 W;  4X64 L;  3I55 A;  4ABN A;  2BDO A;  2K03 A;  4QL5 A;  3I72 A;  1HA5 A;  2IT1 A;  4RGT A;  3IAY A;  1CQV A;  4B3R Q;  1N32 Q;  1GOZ A;  3M3Y H;  1Y8P B;  3VYT A;  1PZI D;  1XMO L;  4DFA A;  4A3B B;  5EKK A;  3ERS X;  2UUA Q;  1QJO A;  4C3I H;  4DV2 Q;  3HOZ B;  2RA4 A;  3S1R H;  1I4Q A;  1SMY D;  2R7Z H;  2A68 C;  2X6G A;  4UHV A;  4A3I B;  1VF7 A;  4JI4 Q;  3J81 L;  1Z7T A;  5COR A;  1S40 A;  1II3 A;  3I4M G;  4RGM A;  1DM0 B;  4RKB A;  1IYJ B;  4X66 L;  5L37 A;  4KKT A;  4QY7 A;  2VUM G;  3ER0 A;  1F9R A;  5C6A A;  3I90 A;  3OWE B;  2JN4 A;  4GLA C;  2PW7 A;  3U58 A;  1IL2 A;  1XNQ Q;  3LNN A;  4JI3 Q;  4DV0 Q;  1B9M A;  1LT4 D;  4YWL A;  1ONL A;  1WCM B;  5JPN C;  2UXC L;  1B1Z A;  2F03 A;  4BY1 H;  5M5W B;  3N52 A;  2B2T C;  2EYP A;  3L3O C;  4ME5 A;  3C2P A;  4IUQ A;  3RZO H;  5JJI A;  1YNN D;  1D5Z C;  3CCJ A;  2ID0 A;  5JJK A;  1JB3 A;  2A6E D;  1BCP C;  2E2D C; 
#chains in the Genus database with same CATH homology
 2DGY A;  2A1A A;  4EX5 A;  2QA4 A;  2N78 A;  5M5Y H;  2ZM6 Q;  2VUM H;  3TRZ A;  2D0P A;  1S3O A;  1Y1V H;  1KHI A;  1OXV A;  1XNQ L;  4DR6 L;  1SR3 A;  2K50 A;  5M3F G;  1X6O A;  1Q12 A;  2MFI A;  2GVA A;  2K5V A;  3E0E A;  3KJP A;  3CCS A;  4JI3 L;  2Q2T A;  1AH9 A;  4YHH Q;  2NZO A;  1X9N A;  2XGT A;  4KHZ A;  3STB C;  4WJ4 A;  1PH8 A;  1YEZ A;  4KLK A;  3F2D A;  2R93 H;  2Q2U A;  4A3G G;  4PZ7 A;  3CC7 A;  2NVQ H;  3H0G G;  3KLW A;  4UPA A;  1UE5 A;  3UDI A;  3A74 A;  4FDB A;  4XTC S;  2UUC L;  2JA7 H;  2JA5 G;  4A3B G;  3F2B A;  3CW2 C;  1LYL A;  1X55 A;  2VY3 A;  3T1H Q;  1XNR Q;  2KEN A;  2UUB L;  4R1J A;  2I0Q A;  3EN2 A;  1TXY A;  4GOP B;  5AJ3 L;  2E8G A;  3FKI G;  1QUQ B;  1R9T H;  1E1O A;  2H5X A;  3BU2 A;  4A3L H;  1KD1 C;  5EAY A;  3CCV A;  1IBM Q;  2EQS A;  4P74 A;  3HOY H;  1P16 A;  1A8V A;  1UEB A;  4ME3 A;  4JI5 Q;  2R6G A;  4YCU A;  4A3E H;  1SMX A;  3UE0 A;  1NMF A;  4HJA A;  4YHH L;  4JCV E;  3K7A H;  4DAM A;  2AHO B;  3GO5 A;  5C0X J;  3F2C A;  3PUY A;  3CD6 A;  4K0K Q;  4DV5 Q;  2Q2I A;  2K75 A;  3PSI A;  3I4O A;  5FLM H;  4C2M H;  4GN5 A;  3M9B A;  5C4X H;  1W2B A;  3A5U A;  4A3K H;  1YIT A;  4BY7 G;  1YHQ A;  3E9H A;  3T1H L;  1I50 H;  3HOX G;  1V43 A;  1KC8 C;  1XNR L;  2YTY A;  1YVC A;  1Y14 B;  4IFD G;  1WCM G;  1VQ7 A;  2AWO A;  1IBM L;  5IP7 G;  4JOI C;  3CCQ A;  1V1Q A;  3PV0 A;  3UDF A;  4B3M Q;  3JC6 6;  4O2D A;  3AFQ A;  4JI5 L;  1UE1 A;  1QUQ A;  1RL2 A;  2UU9 Q;  1HNX Q;  3I4N H;  1KAW A;  4APV A;  2C35 B;  5IY0 A;  4GLX A;  4JI7 Q;  2EXD A;  4BBS G;  1N36 Q;  1V9P A;  3PF4 A;  4LUO A;  2QEX A;  4DR1 Q;  5HGQ A;  4DV7 Q;  2B3G A;  3CP0 A;  1QVF A;  3CCR A;  4GNX C;  1I94 Q;  1SRO A;  1JMC A;  3AEV A;  4A3G H;  4AQY Q;  1D7Q A;  5DLQ E;  3BZK A;  4DV5 L;  3W1G A;  4IOC A;  2JA5 H;  4A3B H;  1PH3 A;  4GOP C;  4JBK A;  4LF5 Q;  3UE1 A;  2ZJP A;  1YHB A;  1ASZ A;  4UP8 A;  1L2F A;  3HOZ H;  1VCI A;  2CFM A;  5IYB G;  4A93 G;  4LF8 Q;  1BBW A;  4A3I H;  1WJJ A;  5GQO A;  3A0J A;  2VQE Q;  2BA0 A;  2PNH A;  3JAM c;  5FJ8 G;  1XPU A;  4LUV A;  4UY8 C;  1XPR A;  1VQA A;  2ZTC A;  1Q7Y C;  2YU9 H;  4B3M L;  1Q86 C;  5M5X H;  4L5R C;  1HNZ Q;  2MQH A;  2XTI A;  1ASY A;  2UU9 L;  1HNX L;  3NEL A;  4R4O A;  3J80 c;  3HOV G;  5GAD C;  4JI7 L;  4JBJ A;  3CC4 A;  1YHA A;  1N36 L;  1BKB A;  4JBW A;  3K8A A;  3M4Q A;  4DR1 L;  4A76 A;  1JE5 A;  4IJL A;  4DV7 L;  1VQ6 A;  1I94 L;  4X65 Q;  1GO3 E;  4AQY L;  4A3F G;  1PYB A;  4IPG A;  4GN4 B;  5JEA G;  5C3E H;  2A19 A;  2HHH L;  1MJC A;  3JAM i;  1I5F A;  3ICE A;  1SLJ A;  1VQD A;  2YV5 A;  5ELO A;  1J5E Q;  2JA8 G;  4OXP A;  3HOX H;  4LF9 Q;  4NXN Q;  3OW2 A;  4LF5 L;  2KCT A;  2NVT H;  1X3F A;  1K83 H;  2ZTD A;  2N8N A;  2L15 A;  4IPC A;  1CKN A;  5IYC H;  1JB7 A;  1VQ5 A;  3J80 i;  4DR2 Q;  4LF8 L;  3H3V I;  5M5W H;  2WAQ E;  2VQE L;  1MJE A;  3KYH C;  4DV4 Q;  3HOU G;  4BA2 I;  2Z0S A;  2R92 H;  3S1M H;  3K80 C;  3KF6 B;  2CWP A;  5IWA Q;  1HR0 Q;  3PO2 H;  2AKW B;  1PHJ A;  1E1T A;  1A62 A;  5H1S E;  4GKJ Q;  1JJG A;  1Y1W G;  2CWA A;  1HNZ L;  4IFD I;  1VQ4 A;  1OTC A;  1PH2 A;  2DUD A;  2F3I A;  1PH7 A;  3WWV A;  4QGU A;  1CKM A;  2WFW A;  1VQL A;  2I5H A;  4JG2 A;  4KHP Q;  2B63 G;  4A3C G;  4JV5 Q;  5GAH C;  3PO3 H;  2NN6 G;  2WP8 J;  4C3J H;  1VQK A;  4AYB G;  4H02 A;  4YWK A;  5LMN Q;  1LTL A;  3ULJ A;  2GN5 A;  3M4P A;  4UP7 A;  3AFP A;  2CCZ A;  1HH2 P;  1J5E L;  2JA6 G;  4A93 H;  1TWF H;  4NXN L;  4NPS A;  2JA9 A;  3EBE A;  1NTG A;  1OXX K;  2FXQ A;  4DV0 L;  2WB1 E;  2PI2 E;  3F1Z A;  2E5L Q;  4NXM Q;  3E9I A;  4DV4 L;  3NBH B;  4BXX H;  1BBU A;  2I5L X;  2YTV A;  4A3M G;  3RLO A;  5IWA L;  1WOC A;  1HR0 L;  3I4M H;  3RR5 A;  4QIW E;  3VDY A;  4JBM A;  1WI5 A;  1IBL Q;  1B7Y B;  4GN3 B;  1KQS A;  3KF6 A;  2E2I H;  1D8L A;  4KHP L;  1Q8K A;  2OQK A;  4A3F H;  4MTN A;  1QZG A;  4JV5 L;  4DUZ Q;  4LWC A;  1NMG A;  2VL6 A;  1SFO H;  2VS1 A;  2ZM6 L;  3BZC A;  3W1B A;  3TQY A;  2ATW A;  1WYD A;  5M3M H;  4YCV A;  1DGS A;  2PQA A;  4JI0 Q;  1JT8 A;  2ASB A;  5LMN L;  4WJ3 M;  3CME A;  4HIM A;  2IX1 A;  3HKZ G;  3BJU A;  4LW1 A;  3U4V A;  3Q8D A;  4GLV B;  1EOV A;  5C0X G;  4R4T A;  3PCO B;  2E5L L;  4A75 A;  2ZTE A;  4NXM L;  2D62 A;  2D0O A;  3GTQ H;  2N49 A;  1I6H H;  1YZ6 A;  1Y1W H;  2V1C C;  1MKH A;  3RLN A;  4X62 Q;  2F52 A;  3CPW A;  4IO9 A;  3RNU A;  2Z6K A;  1K3R A;  1K8G A;  1N33 Q;  4HJ7 A;  1X3E A;  1IBL L;  2Q2H A;  5LMU Q;  1E3P A;  3FP9 A;  1UE7 A;  3U4Z A;  1VQM A;  1GM5 A;  4A3C H;  2PI2 A;  3KOJ A;  3I2Z A;  3H15 A;  3LGJ A;  3L2P A;  1W3S A;  4DUZ L;  4HIK A;  1Q1E A;  1X3G A;  4OWW B;  1L1O A;  1YJ9 A;  2IHF A;  4A3D G;  4JI0 L;  5M3F H;  1N34 Q;  1C0A A;  1EQR A;  4JI8 Q;  1PYS B;  4HJ8 A;  5C44 G;  3CC2 A;  2NVY H;  3DM3 A;  3PUX A;  4PG3 A;  3G71 A;  2NN6 I;  4RMF A;  2JEA I;  3AYH B;  4HID A;  3OTO Q;  3S16 H;  1CSQ A;  1XMQ Q;  1Q1B A;  2Y0S G;  1P8L A;  1QZH A;  3S14 H;  4GKK Q;  3H0G H;  1L0W A;  4K0K L;  4R4Q A;  1CKN B;  4POF A;  3TEH B;  2MNA A;  3RZD H;  1WFQ A;  1B8A A;  1NBW A;  1I3Q H;  4AH6 A;  3S2H H;  2HQL A;  4PZ6 A;  4QJF A;  1E22 A;  2OCE A;  1QVC A;  5GAG C;  5IYD G;  5LMN W;  2MO0 A;  2K5H A;  2E2H H;  3FKI H;  1N33 L;  1YIJ A;  3UDG A;  3G48 A;  5LMU L;  1SE8 A;  1EQQ A;  1HZB A;  4BY1 G;  1FJG Q;  2K52 A;  1A63 A;  1H95 A;  1PH1 A;  2ZJQ A;  1CSP A;  1VQP A;  4B3S Q;  3CQZ H;  3B6Y A;  3PIP A;  2ZJR A;  1YJN A;  3IRB A;  3PIO A;  2CQO A;  1N34 L;  2JEB I;  1XTD A;  1HZA A;  2JE6 I;  1Q82 C;  2UXB Q;  4LUZ A;  2I5M X;  4XIG S;  1PA6 A;  1E7Z A;  4BBR G;  4HJ9 A;  4LFA Q;  1Y1V G;  3GTM H;  3OTO L;  1VQE A;  2LSS A;  1XMQ L;  3H3V H;  4GKK L;  1U0L A;  4JI6 Q;  3GTL H;  3HOW G;  4BY7 H;  1A0I A;  3W5O A;  5C0X I;  3A5Z B;  1NJI C;  4MZ9 A;  2R93 G;  3KF8 B;  4PZ8 A;  1WCM H;  4JYA Q;  3TS0 A;  3CCE A;  4KI0 A;  5IP7 H;  1FJG L;  4IJH A;  4BA1 I;  4DR5 Q;  2JA7 G;  4P73 A;  5J3B A;  3L0O A;  3MEF A;  4HJ5 A;  4B3S L;  3M7N A;  1FVI A;  1SN8 A;  2RHS B;  4R4I A;  1YNX A;  4L5Q A;  5GRO A;  1OXS C;  2NVX H;  2N3S A;  4A3L G;  4Y52 H;  4YCW A;  4JI2 Q;  1C7Y A;  1AE3 A;  3GD7 A;  4BBS H;  3S1Q H;  2PQA B;  3ZJY C;  1VQO A;  1LM0 A;  2LXJ A;  2ALY B;  3KDF A;  3CMA A;  3CCU A;  1PH6 A;  1VQ8 A;  1X56 A;  1YI2 A;  4LF4 Q;  4LFA L;  2YTX A;  4OO1 I;  3I7F A;  4X65 L;  4GS3 A;  1UE6 A;  3TS2 A;  1IXR A;  1EUJ A;  4DAY B;  4YY3 Q;  3STB D;  5IE8 A;  1CUK A;  3PUZ A;  3PF5 A;  3S1N H;  2RF4 A;  1LUZ A;  1N8R C;  2UXD Q;  4POG A;  1PH5 A;  3S15 H;  5IYB H;  4LF9 L;  5K36 G;  3M4O H;  3SGI A;  2K4K A;  4LFC Q;  4A3J G;  3DLL A;  1TWG H;  4JYA L;  1X65 A;  1Z9F A;  2HIX A;  4P71 A;  5FJ8 H;  4DR2 L;  2UUB Q;  4DR5 L;  3CF5 A;  4A3K G;  1OXT A;  1N9W A;  1U5K A;  4TVA B;  1QVG A;  1VS0 A;  3U50 C;  1X54 A;  5IP9 G;  4GKJ L;  4DR3 Q;  3HOV H;  4JI2 L;  4DNI A;  1AE2 A;  3L7Z C;  4LF7 Q;  4BBR H;  1L1O B;  1VQC A;  3OYY A;  1NY4 A;  3RLF A;  3GTK H;  4DUY Q;  1J6Q A;  2EIF A;  4LF4 L;  5HY6 A;  2R7D A;  4DKA C;  3I4N G;  2E2J H;  4LF6 Q;  3HOW H;  4DPG A;  2MO1 A;  4YY3 L;  2JA8 H;  2YYZ A;  4IPH A;  3GTG H;  2UXD L;  3HKS A;  1TWC H;  1VQB A;  1EIY B;  4MNO A;  4LFC L;  4GNX B;  2IX0 A;  3J7Z C;  2F4V Q;  3HOU H;  1HNW Q;  3T1Y Q;  4L5S A;  2JJQ A;  1VQG A;  2LXK A;  1BVS A;  1VQH A;  2OQ0 A;  3S24 A;  1K9M C;  1JJ2 A;  2BH2 A;  3KFU A;  1G6P A;  3CPF A;  4OON A;  2IHE A;  3PUW A;  3CCM A;  1YJW A;  3HOZ G;  2CKZ B;  3K7U C;  4DR4 Q;  1VQI A;  2VNU D;  5ELN A;  4A4I A;  2OTL A;  2PMZ E;  4A3I G;  3PGZ A;  4B3T Q;  1TWA H;  4J15 A;  4DR3 L;  1K8A C;  4LF7 L;  2ES2 A;  4DK6 C;  2R7Z G;  2AWN A;  4NB3 A;  3ULL A;  2B63 H;  2OTJ A;  4X6A H;  4PMW A;  2AMC B;  4DUY L;  3PUV A;  2GVB A;  1EFW A;  2WAQ G;  4Y7N H;  1FGU A;  1KRS A;  3HFZ B;  4DK3 C;  1B70 B;  2JQO A;  4LF6 L;  4RG1 A;  1M1K C;  3KJO A;  5JJL A;  4OO1 G;  4X64 Q;  2JA6 H;  1HR0 W;  2BH8 A;  4JOI A;  1MIU A;  2Z6K C;  4A3J H;  1PV4 A;  3K81 C;  1HZ9 A;  1VQJ A;  4OWX B;  5GAE C;  5C3E G;  2F4V L;  1HNW L;  4UP9 A;  3RN2 A;  1XMO Q;  3T1Y L;  1EYG A;  2IY5 B;  2K5N A;  4A3M H;  1KIX A;  1EWI A;  4HIO A;  4DR4 L;  4JI1 Q;  2JK8 A;  1C9O A;  1L1O C;  2KHJ A;  5IP9 H;  3M85 A;  4DV1 Q;  3NEM A;  5IYC G;  4OWT B;  4GNX A;  2HT1 A;  4X62 L;  1KXL A;  4B3T L;  3AQQ A;  4IFD J;  2NZH A;  1IZ6 A;  4AYB E;  1UWV A;  1PH9 A;  2R92 G;  5BR8 Q;  3G6E A;  1G29 1;  1T9H A;  4DR7 Q;  2VQF Q;  2VW9 A;  4GOP A;  1GVP A;  3MXN B;  4OX9 Q;  2KCM A;  1IBK Q;  3PO2 G;  4R4C A;  2WB1 G;  3J81 c;  3CXC A;  2B29 A;  4YWM A;  3KDF B;  3HOY G;  4X66 Q;  1HZC A;  1Q46 A;  1CKO A;  4O0A A;  5E7N A;  1GD7 A;  4X64 L;  3I55 A;  1Q81 C;  1RIP A;  2A8V A;  4JI8 L;  4QL5 A;  3PO3 G;  3J81 j;  2HHH Q;  1K0R A;  2IT1 A;  2K14 A;  1G51 A;  4IOA A;  4EQ5 A;  4ALP A;  5FLX c;  2KBN A;  4B3R Q;  4QQB X;  1N32 Q;  3GTP H;  3M3Y H;  4LNQ A;  1XMO L;  3CCL A;  3S17 H;  4DV6 Q;  3GTJ H;  3ERS X;  3I56 A;  3J81 i;  4JI1 L;  2UUA Q;  4C3I H;  4DV1 L;  4DV2 Q;  3UDX A;  2UXC Q;  3S1R H;  1E24 A;  3J7A 5;  2QGQ A;  4P75 A;  3ULP A;  1O7I A;  2R7Z H;  4JI4 Q;  1PVO A;  4BXX G;  3D31 A;  5C4J H;  5BR8 L;  4DR7 L;  2VQF L;  4OX9 L;  1S40 A;  3HKZ E;  3NEN A;  1IBK L;  1Z47 A;  1HJP A;  3RN5 A;  2VZA A;  2RHQ B;  3CAM A;  3I4M G;  1KL9 A;  1YBY A;  2BA1 A;  1XJV A;  3G4S A;  1K73 C;  1VQ9 A;  4A3D H;  4LFB Q;  1JJC B;  1IYJ B;  3K0X A;  4X66 L;  4DV3 Q;  4QY7 A;  2VUM G;  3ER0 A;  4L5T A;  5C44 H;  1S72 A;  3GTO H;  1TWH H;  4IPD A;  4GLA C;  2UXB L;  4TQU S;  3U58 A;  1IL2 A;  1XNQ Q;  3TRE A;  4DR6 Q;  5M3M G;  2R7F A;  4AIM A;  4B3R L;  5JEA J;  1N32 L;  1PH4 A;  2RCN A;  2OWO A;  4JI3 Q;  4DV0 Q;  4A3E G;  4DV6 L;  4JI6 L;  1FL0 A;  2HIV A;  5IYD H;  1OXU A;  1M90 C;  2UUA L;  1EIF A;  4YWL A;  1GKH A;  1PFS A;  4DV2 L;  4P72 A;  2UXC L;  3EIV A;  3D0F A;  4JI4 L;  4BY1 H;  2UUC Q;  3FHW A;  5FLM G;  3RZO H;  4JC0 A;  5C4X G;  5IT9 c;  5JJI A;  1VQF A;  1KRT A;  2ID0 A;  3CCJ A;  1VQN A;  3S2D H;  1XPO A;  3F8T A;  4C3H H;  5AJ3 Q;  5JJK A;  2KHI A;  1SRU A;  3GDE A;  4LFB L;  1NE3 A;  4DV3 L;  2Y0S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...