3K6OA

Crystal structure of protein of unknown function duf1344 (yp_001299214.1) from bacteroides vulgatus atcc 8482 at 2.00 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
b'TVTIAMATVEKQPQYDAPYLVLDNGEKLWVVQHIVPYRDLKAGERIFGNYSFLEAGESGFAYNIRLNDYTLVPVQKIIGLNPDNMDSIGNMKVQIKDMWPSDDYLNVRFMLNFPSPQKPILNLVVNEMIPWTKDGYAHLELRYNNNGSQGRLVPGMVSFKLDDYSPENSELKGIKVLVNPVDGEEKTYIFSYPLTGEDVPGFNPLDLAELK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein DUF1344
publication title Crystal structure of protein of unknown function DUF1344 (YP_001299214.1) from Bacteroides vulgatus ATCC 8482 at 2.00 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Structural genomics, unknown function
total genus 44
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3k6oA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3k6oA02
3NQIA 3QWNA 3K0YA 3K6OA 4PQXA 4J8QA
chains in the Genus database with same CATH superfamily
3RA7L 1GS8A 4FQXA 4GNXA 2DJUA 3T5WA 4C56D 3OF6A 2UUDK 4D9LH 3NFPA 5C09A 2Y2WA 5ENWA 4FX5A 4EOWL 3EXLA 4QXUL 2A83B 1U2HA 2ZTEA 1LT4D 1A1MB 2UV3A 3QFJD 2ZX5A 3VI3F 3HKZG 2HT4D 2PR4H 1D1IA 1PVOA 4FXGC 4P5MA 3HI5H 1XR9B 4LVHC 2DL2A 2W0FB 3MLWH 1WEJH 5DEZA 4G7ZC 1P0SE 3E2HB 3QIBA 5KYXA 4BKLB 5DJXB 4MJIA 5EWIH 1AS8A 5E9AA 4G57A 2WLYA 5F96L 4N6QA 3LQZA 2JEAI 2CHNA 5DJYA 1LE5A 4HWZA 3JUZA 2WUCL 3S1RB 4M8RA 1OHQA 2NUPA 4MTMA 4CSSA 2B2TA 2NCMA 2NR6A 3HI6L 4NO0D 4DN4H 5I1IH 5C86A 2ENBA 3AS0A 3NZ8B 1DBKH 3W2DA 1RUML 3D4CA 3L2LA 4XP5L 3FSVA 2QQNH 2ZOOA 3ARDA 2CQAA 2JXMB 4UP9A 1L5GB 3SDAD 2AV1A 3SDCD 2UXFA 3HLAA 5C2BH 3TPUA 3K58A 4DGYH 5GRVL 3WTUA 2DKUA 3RY6A 1EYGA 2NVXH 2GSGB 4K7PH 1LD9A 3P4NA 3FPXA 2DTML 1I4XA 2R7FA 1P2CB 1JXDA 5E8OB 4GW1A 1OAYH 3SE9H 2HQLA 1EFQA 4PV9A 1OB1B 2CO7B 5KVGH 5J6HB 2DLEA 5AW2B 3HOUH 3SDXF 5NUCA 3NFSL 5D2NB 2EY2A 3QQ4A 5HHPA 4FNLL 5C0RL 1I9JH 2YFOA 1NCWL 3ARQA 2Y07L 4XT1C 1U8CA 1J9CT 2Q2EB 3L7FA 2P4AB 4PI0A 3QDHA 4DEUA 1BG9A 5I8CB 3K7AB 3WDNA 2IGFL 3F05A 4HPHA 2YJLA 1ORQB 3RVVD 5I5MA 2VNCA 1IC7H 1FORL 3GXTA 2NTTA 1NGQH 3HAEA 3U1SL 3CHSA 3X13B 3T53B 4BCZA 4BA0A 1ODAA 3LMJL 4R4FH 2BY3A 4NP4L 4ZX3A 4DR2Q 5FO8A 4NENB 4WTXA 3S37L 3RFZC 2EDOA 2RBLA 4X7TB 3UBHA 1YCSA 1WGVA 1VACA 1X5XA 2YEZB 1Y1WG 1RLWA 3H0TB 4RAHA 1OAJA 2IFGA 2WVTA 3N1PC 1ND0A 3RWJA 2O6CA 4Q8BA 5D6DA 5C0JB 4L2YA 3S98A 2K75A 4PJDA 1GOZA 2NW3B 4CRPA 5IFJB 5AW7B 4TVAB 1F97A 4HGMA 4QF1B 3S37X 2DWTA 4LL1A 1Y1DA 1OGAE 4ZD3H 2BW4A 4RX4D 4XMKL 3GI8H 3ZUCA 3MA2B 1RJZB 5T1LA 2IADB 5DUPL 1CR9H 3LXAA 4EXPX 2QDVA 1KLUB 2X4TB 2XWEA 3LZQA 3VXOA 3WIIH 2I69A 1FGVH 3EBEA 5CV4A 3ECBA 3TFKD 4JFYB 3AU1A 3F5WA 4G8GE 2EDKA 3T04D 3MUHL 4M62H 3S5LA 2Q3ZA 5C6TH 3VH8B 2NNRA 5M3FG 4KTDH 4M1GH 3O2DA 4YZFF 4FFYL 4KKNA 1UTDA 2PNHA 3UDIA 2EUXA 2OZ4A 4P71A 5IWAL 4U0RB 4R4TA 3OC5A 4OF5A 4HJ9A 3H3VH 2QLYA 2GCYA 2W91A 3L3KA 1WAEA 1FV1A 1N9PA 1KEMH 4H1LG 3KGRA 4QHNA 3RU8H 1SSOA 2NQCA 1WD0A 5EH1A 1X3EA 1XSIA 1Z32X 1MD2D 1FL0A 3WS3B 3VWJA 1WZLA 1MHCB 3QO1A 1XGUB 2HFEA 5HHME 1GVPA 1WVLA 5KSAD 5KVDE 4HUVB 1L7IH 4FERA 5DS2A 3QUYA 4AQ8C 4NQDD 3UE0A 1AGFA 1VFMA 5JOFB 4KHPQ 3IBEA 1GUGA 3PAYA 3QQ9C 4FQPA 1I8AA 5E23A 1KDIA 2QPFA 3ISRA 4BYHA 4AM0Q 5D7EA 1K5NA 4LFBQ 5JIKA 4DK6C 3II3A 2R1WA 2V7NB 2VJXA 5COYA 1DSFH 1PLGH 2ZUYA 2X2YA 3FPPA 1NBWA 2IO5A 2CG9X 3N40P 1XB3A 5C0BB 3ULSB 5MERB 1VFAB 5B1KA 1LT5D 5KYNA 5M94B 2YU9H 1JF1B 1SJHA 1C0AA 1G7IA 4YSQA 2ED6A 2KI6A 5IYDH 2NZHA 2F15A 5E9DE 3QG1A 2XV3A 5MEPA 3Q9QA 5IVXE 3ESOA 4XBEL 4ODGA 1OSZB 2W0PA 1RZFL 2E7MA 4XXDB 2ZG1A 5CV6A 3BUQA 4QRPD 4M93B 4RA8A 3EJZD 4HYTB 4G4KA 1O7SA 1MWAH 5F8RC 4WWOA 1VDGA 2VLME 3C2AL 1FJ1B 1MLBB 4LKCA 1ETZB 3T3PB 3VFSB 1ZIBA 3FO0H 4N2NA 1W0VA 4IPGA 2PTVA 2YN3A 2XQYA 4X9IA 3TCXA 4IJHA 1OCWH 5B21A 5EMYA 5GGSY 3I02B 1MHEB 3DSNB 2F0VA 2KECA 5IP7G 4PJFB 1RP8A 2G4GA 4ODUB 4IKIA 5KS9B 3IBOA 4RISL 1HT6A 1JZ2A 4GKSA 1PXUA 1MI5A 4Z7WE 3VQ1C 3V2AR 1GGCH 4MNGA 4R6UA 4H8VA 4LWCA 2HVKA 2OR9H 5HGDB 1KBBA 4ZAIA 2C9UA 2Y4SA 1KCBA 3MLZH 4HK0B 3FU9A 3VXPB 4JI2Q 2NZ9C 4RWYL 1RU9L 1U95A 4XO8A 1J5CA 2CAKA 3HNVH 3BN9C 1RKNA 2CJTA 3F2UA 4X64L 5IKCB 2P5WB 4LSPH 2WHVA 5LDSA 1NDTA 5C4XH 4HUNB 3IDMA 3BC9A 4RH6A 1OW0A 2DQFA 3CDCA 3M88A 4JFXB 5MENE 4IALA 2AQ2A 3UAJA 1FLRL 3WHE0 2OR8A 4KQ4H 3DM1A 4MNQB 3NN8B 3PFQA 4RZKA 5DMKA 1N8RC 2XVSA 1EDHA 4BBRH 1GVIA 1X3PA 1E4HA 5ABDE 4FJYA 3BVGA 4C3IG 4D9QD 1T3FA 1JNJA 2VN6A 1EY6A 3WFBL 2J8HA 3FONB 4L1SA 1TMCB 3C09B 5DYOB 3L4UA 2HD3A 2IDTA 3NA4A 4FKEA 4GOSA 4UQDA 3GTKB 4AVKA 3IS1X 4LF5Q 4LRIC 1VQJA 2CUMA 1ZDQA 4AYSA 5ID1B 3MKKA 4YHLH 3HG0A 1TZIA 4BBSB 3LZOA 2FECI 2ZKWA 3GINA 5KEZA 2QQQA 2R69A 2RCSL 3NIFE 4ODXA 2VXQL 1XGPB 3MA7A 4JVPA 1A6WH 1YJDH 2FH6A 4M7LL 2YN5A 4DAVA 2VDMB 4P2QD 3K4DA 5CLWA 3UBXG 3GJEA 5HHQA 5LXGH 2NW2A 1Z2KA 3I6SA 3CH1B 1IGIH 4X9HA 5HGBB 4EUPA 1UT2A 1G9NC 4QJ3B 3TO2B 4XN8A 5EC2A 4APQD 1X5AA 3NYKA 1HSAA 2X2JA 2BDOA 3URYA 2WXGA 1A9VA 4U3CA 4R5XA 3W37A 4W68A 1Z7JA 2NOYA 4GYBA 4JJ5B 4CNIA 4MASA 1HHGB 4N0CC 1R3KB 2IQ9L 4NXMQ 3WFDL 1TQWA 2YA1A 3MRJB 3ZTNH 3H55A 4XXWA 2PYEA 3TESA 1F3DH 5E2JA 4EQOA 3OLIA 2BP5M 3L9YA 1MFCL 1QFWM 3S88L 2WAQG 2Y5EA 5IROD 5IB5B 2NYYC 3TZUA 2D7TL 2NN6I 4GZYC 3B9KD 3IF1B 1EDQA 2ENSA 4FOMA 5AB1A 5LWYL 4A7SA 4DFAA 1HRJA 3QEHA 5F3HB 1YHBA 4GI8A 4XMLH 1A7NH 2E9GA 4EIZC 2R23A 3AZUA 4G7VH 4IRZH 5I8KH 2AKRA 4HF5L 1J1OL 4JG1L 3PO2B 2HCIA 3OVUB 2F54A 3QWOA 5GHWH 4ELME 3CHPA 4EDXB 4ZYKA 1KYOK 4ODTL 1NUNB 4Z7OE 2RDGA 4X66Q 2P5EA 5L2KA 3MOAL 1B4TA 2FO1A 2UUAL 3MV9E 5CYUA 2DEWX 4TLUA 3GUTB 3TBSA 4MJ5A 1QLFA 3CFQA 2WXJA 3PG2A 3G7TA 4QXGH 4PWGA 1KY6A 3KHOA 3M45A 1TIID 2IBZX 3M1BB 4K07A 2K0RA 1U3HC 3PWPA 3E6ZX 2AJVL 4JM2F 4NDXA 3QIWB 2GUOB 3LX0A 3TBWB 2J55A 4LSUH 3EZJB 3WDHA 4GUPA 4I0PA 3DPBB 4PJ7F 4R4OA 3OPZL 2WP3O 3B43A 2Z7WA 2P46B 5CZKA 2CO2A 1U8PA 3QI9C 4GKZA 4B9XA 2IANA 4C83A 5CMDA 2JJUA 1BWWA 2ZXRA 2AABH 2CK2A 1T0OA 4KTEH 4QMEA 1FVDB 2ZUWA 5M5WB 1XH3B 1RIUL 5C0CA 1TZ8A 4PJ5A 2MCPL 3C5SB 3OQ3B 4K8RC 1PW3A 1BOGB 1LGVA 1WTWA 1JK8B 2FO4B 2FIKB 2VR3A 4XVJL 2XBTA 5JHDB 2GIYA 4N3UA 1JZ5A 3HZYB 4V33A 4ZAKA 1UM5L 4D7PA 1J05B 3E38A 3KAAA 4PLJD 3DHPA 5INCB 4DGIH 2K7QA 1OB0A 2UXDL 2PTTA 4CAGA 5H4YA 3HOXH 4P75A 4DV4Q 4EJ1C 4QLWA 1B50A 2X1PA 4QEGA 3RLNA 5MEOB 3HNTH 5G3LD 4JI7Q 2CK0L 3IU3B 2O1AA 3CK0H 3P4OB 3S4SG 2UXBQ 1NQBA 3VXMA 4AK1A 1EJ6A 3IJSB 5GGRA 3MLXH 3CFCH 5MHSE 2J2ZA 3QCUL 43CAA 1G7HB 1P7HL 2EUVA 1Y1VB 2B14A 4J3OH 5B39A 2BY0A 3T8XA 3PXLA 1U2CA 1A02N 4OZIF 3MRLB 3SBQA 3R06B 3NCFB 1HYSD 1GR7A 3A23A 3V0IA 4UTAH 3K80C 1DVYA 4S3SA 1UJ3C 2DMKA 2HKHL 2V8LA 3CMOH 3KLDA 35C8H 3ETSA 4ODHH 1NDGA 1HFNA 1XF1A 5GS0C 5LQBH 4KJWD 4UQIM 4BBWA 1LLAA 4KK6D 4ZUVB 1KYAA 4ZMVA 3C6EA 1HNGA 3F83A 4IPDA 5I76A 5CBAE 4AIZB 1XB6A 3PDOB 4BXSV 4K14A 1T4KB 5I9OA 1TT2A 4LLWA 4A3FH 5HXMA 4M3HA 4UM8B 3HOVH 3SGJC 1CK0H 1X7QB 4LLYB 3TZVA 5I1GL 4L8CA 2NNXA 2F7PA 4OY9A 1I8IA 2VCOA 2EJMA 1JWUB 2QSCH 1TIUA 4CVUA 2DQCH 4RFNB 1PF3A 4Y4HA 1TMQA 3ESNA 1L7TL 5L8KB 3T1YL 2GI0A 3IXAA 3C5ZA 4QRRE 3N0AA 3FFDA 4ZTEA 2UWEA 1WITA 5IB3B 5EU6B 4XP9H 3TEHB 2A6DA 1QYGH 4DN3H 4RMWA 5LUMA 4JGNA 5C3LD 2FDBP 1NCBL 5EKKA 2B2YA 3VGBA 5E1GA 4KUCD 4TLTA 1BHGA 1PH2A 1KGWA 2EIBA 5K69A 1RZKC 1PAMA 3PHSA 3BXNB 5KVDH 5F8QC 3PQYB 1GCFA 3SPJA 1J10A 1WJJA 4PMCA 2R6GA 4HBQA 3CN1A 3GM0A 3MYJA 4Z78A 5DDHA 5E6YA 2X5PA 2EDXA 1IFHL 3LXUX 1YNTF 1RZ8A 1T0MA 5ELBA 1S7WB 5JIHA 5C0FA 3U4KA 3K81A 1HL5A 2B3RA 3GMNB 5L4MA 1H15B 2XZCH 3FFCA 4JDZA 4XI5C 2WMPA 1RZIB 3BWUF 1PMYA 2ERJC 2GEQA 3F7LA 1A9EA 4KK7A 3QBTB 5GS1C 1KTKA 1KLUD 2Y5TB 1HKLH 1F6LL 1V55B 5DWUH 5K93A 5F6IB 1R34A 4PUBL 4A3JH 2DWXA 5D3IB 4FLQA 3AYHB 4OLYH 4BFRA 2ORBL 3MZGB 3TBTB 1KJMA 1WWBX 4BH8B 1FZJB 3B6SA 1UD6A 3OMZA 3C6SA 3X3MA 3KG5A 2K01A 5HHNB 5EOCH 2ZOKA 4PV8B 4CDHA 4Z3TA 3K6SA 4L48A 3P73B 3FQTB 1XMOQ 4JM4L 3SBRA 2OWOA 3CQZH 4AG4L 3DXAE 5IJKA 1LO4H 2AJUL 2MTAA 3WOFA 1NANI 1CDHA 1Q9LA 3FN9A 4IGBA 3A0OA 4LSSH 5D8JL 4P46C 1SEBB 4WJ4A 4ETQA 4RMSA 4H8WC 5ALBL 3UYPB 3I6LE 3RMHA 1HH9A 1MJJB 1PIGA 2JB6A 3IK2A 3BW9A 3EO9H 3OXRA 4U6VH 4DZBB 3QB3A 1WF5A 3VXQA 2AS5M 3VI4F 3HE7B 3QISA 1MFEL 1FQ9C 3W1GA 4IUVA 3QPXL 3SJVA 1KMGA 2KUTA 4X62L 4PPTA 3T0AA 5C8JA 5HSFA 3L3OC 4XE0A 2F2HA 4DV2Q 2OXHB 2F0LA 2WYTA 2BDNH 3WJJA 3RNUA 5C0BD 2YPLB 1TR5A 3E8UH 1IKNC 3HS9A 3I50H 3FCSA 3P3UA 3QDGB 3O8XA 4YK4B 1MXDA 4OGAD 5AB2A 3RY4A 4ZG1A 3GTPB 1AHWC 1BZ7B 4IJ3B 4WSGA 2BIQA 3RWEB 5IMLB 3BRFA 5F2DA 1NNXA 1QUNA 2LHAA 3OHXC 3PL6C 2Z7YA 4V190 4BY1H 2X1XR 3SOBL 4B08A 2EE6A 4XB3A 5J1AB 1QFHA 2R0KH 4J3SA 4RRPA 4LF4L 3QQ3A 3T0WA 4ANVA 3T3MF 4WI4A 4S2SB 1EHNA 2VUYA 4RIRA 1N6QH 2JEBI 2HMIC 4KI1A 1R9TH 3LVTA 1FDLL 2G9HA 3E80A 4M7KH 4MS6A 4O5LH 4YGVA 5DMIH 3QARA 1MAKA 4NI6A 4GINA 1D9KC 1QASA 3TP8A 3BZDB 3AABA 1DLHB 1M05B 3BZEB 2CXGA 4AJVA 1DCEA 2FATH 4P9HH 5HDBE 2JQOA 3K6IA 2Q8TA 3MRPA 4PZ6A 4P99A 1CICA 4LGPB 5CV5A 4YCWA 1FL3B 1SVBA 3IRBA 1GUWA 3LSOA 4PLOB 2EC9T 1FJGL 4N8VA 1U58B 4YDVB 4YQXH 2HUGA 1CGSL 5H1SE 1NC2B 2K32A 3ZQ9A 2HFGH 3U46A 4MD5A 1WFMA 5KSUA 5BV7L 1BDOA 1A4JA 2AVFA 3TTSA 2AQNA 1UWXK 2GK0A 4JI6Q 3O4LA 4KOBA 1RPKA 1YMHA 4HUCA 2DQ6A 3OC8A 3F58H 4FF4A 4ZKCB 4LSDA 2PN5A 5HJ3B 3WFEL 4M7JH 1GMEA 2VW4A 2NSMA 3GMQB 2WLIB 4P4RA 1VGKB 3FCBA 5JUEL 3RGBA 4Z7QE 4R3SB 2P5WD 2BVOA 1LO2H 2HT2D 4GAGL 1XNQQ 4G6JH 2FCBA 4IM8A 5I19L 5K9KB 2XKNA 4WTZG 3V5DB 2Z1CA 1NMCC 2XA8L 4MNQD 4LUOA 1DEDA 5DF0A 1RZ7H 4JVWA 1V1PA 1NMFA 2COVD 3QR0A 4YHMH 4ZO6A 4A7UA 4BRVA 4QTIH 3KJOA 7TAAA 4UYQA 4DR1L 5ABZA 5ITBH 2P28B 2OMUB 4WI9A 4L18A 3HI1B 3EBIA 4D9RD 4FQ2L 1O7ZA 2NVXB 4CL7A 3NIGF 4U6TA 3CP0A 4R0LC 4M1DH 1NBQA 3ZE1F 4OGXH 4F33B 1UOVA 4UI2A 1IM9B 1IX2A 5A40E 4ZFGH 4PCTA 5EKLA 1QSZA 4JV5L 4CMMB 2N1KA 3HOUB 3EJYD 4QCIB 3SPIA 1PIFA 5IHUL 3VU2A 1NL0L 2AAAA 1H3PH 2H26B 5IBLD 3U2JA 2F7RA 3GXMA 3KPNA 4FNUA 4XNUH 1U8JA 4A3KH 2VE6A 3IRPX 5I30H 1KBVA 4JYAQ 1H8SA 2FQFA 5DS8A 2UZYB 4UV7H 5EAYA 4NXNL 5GISL 1R0AL 5CN1A 3IMTA 4R4BA 4U3HA 1PFOA 3ZRCC 5KYXB 3EGSB 1STYA 3KPOA 2HQEA 4KAQH 4WNQB 1MCWM 1PKQB 5DJYB 1YC7A 1G7LA 3DV6A 3ZYZA 3CXHK 4M6AA 4HIIA 2PMZB 5DC4B 4K3HA 3MOBL 4IOFD 3SKUD 2AWNA 1T1YB 5DAUA 2VW6A 3WY2A 1ROCA 1E4WH 2FH8A 5HI5D 3ZT5A 3EUUA 5D5ME 2BZDA 1ZCRA 3BP5B 1UH3A 4AMWA 2FJHA 5SWSB 4KI5D 1GJWA 4PYHA 1WBYA 1XZ0A 3SE4C 2Q8IB 3TQYA 1AXTH 2VDOH 4OZGA 4RGMB 1E30A 3P4NB 5JQ6L 1QKZL 5T33L 5AD0B 5HPMA 1M1XA 4UAIA 3D12B 4GW1B 4G2AA 1Q7YC 1XMQL 5DRZA 1QSEB 5I75B 1MUJA 5FK9C 1GZPB 1T66D 4P3DB 3ORJA 2H3XC 3Q6FB 4HJ5A 3F7YA 3IFDA 4WI7A 3A6CL 1G2SA 4YDJB 1KXLA 2HZHA 3L7FB 1KCUL 5AKVA 1QSFE 2XOTA 3QIWD 4U1GB 4NPJA 2NYZD 1SLVA 3AQYA 3F8UB 1EH9A 2J1YA 1EY0A 4NO3A 4JZOA 4M4PA 5EBGA 4WI8A 2IALB 3L4CA 1G5GA 4BZ2H 2GA4B 2VC2L 3WXWL 1TCMA 1YAIA 2AP2A 2IPKB 1DZBA 2A99A 3UACA 1N5YH 4R96A 5DZ9A 1MJ7L 1PZID 3CN0A 3WFCH 3PPEA 1CDUA 4S0HA 2GY5A 2X0WA 2ZJQA 1I7ZA 3N44F 1DN0A 4UAHA 1A6UL 2X6BA 3LKRA 1TZOA 4NZ8A 5AW9B 1ZLEA 1X7SA 3JZYA 1UEBA 2XY2A 1AXSA 5AJ3Q 5I8OL 2Y22A 5JHDD 2HX7A 5BR8Q 2P9RA 4DUYQ 1JGVL 2X2IA 1X5FA 1FG2B 4KWUA 2CO6A 3I4MH 1U8HB 3I74A 4MXVE 3TIDA 4XP6H 1OY3B 1Q0XH 1U42A 2LU3A 2Y6TE 1QJOA 4OM0H 4GS7B 1F4YL 5KUMA 5I1DA 4NYLB 3A54A 4X5RA 2QGEA 3I9PA 2BNRB 5TE4L 1A3RH 2MO1A 2YU9B 3WHXB 4NN7C 1RJTA 1AI1L 3QWRA 4YFLI 3CCMA 4R1JA 5E6IB 3QUZA 1BG1A 2MHVA 1AJ7H 1D5IL 2HIXA 4PGEB 1NFDE 4Y2LA 1F0LA 4Y19E 3RL1B 4DP9X 4E9WA 5C3IA 2NZ1D 4X6CF 3VFRB 4U05A 5ESAA 3UTSE 3KYKH 1VF5C 2DN8A 2VDRL 3TV8A 5EFIA 3ETBJ 1KLGB 5ISZE 5I6KA 2LVEA 3GNML 1PZJD 2CWRA 2X69A 1MWAB 2YLHA 4KO7A 5E5RB 1ONQA 1KAAA 3EYFB 3OKMA 1ZMYA 5F9WB 4NKIL 1AGDB 1YMMA 2GCYB 4Y5YC 1FV1B 3IETA 1JHLH 2ITDB 1HIMH 4PBXA 5E2TL 5HDOA 1C16A 3TWCH 3BVNB 5AEAA 3V5HA 2EY1A 1I5FA 1RMFL 5BN4A 2HFEB 3Q3GA 1CXKA 1JTOA 4F5CA 4AIOA 1O7VA 1AZZC 4YOKA 4NRXA 3FU7B 1JWUD 1MJCA 3RWIA 1WSST 3EIFA 1GTFA 4GW4A 3THML 2E8GA 2KHAA 3FSZA 4AYBG 5EU6D 3L54A 2VMDA 3OKYA 1UM4H 2R39A 1U93B 3DUSB 2YRZA 1YHAA 3QK0A 4ZTOH 3BSHA 4RFOL 3TS8A 4PVNA 5JNYA 2CBPA 2OQJA 4Q6IA 4F88A 1QBBA 3PQYD 1LTLA 5FKAC 5IF0B 5C4XB 2BRRL 3WEOA 5EEWA 5FWQA 1K5WA 4CDEC 3KWWA 5F21B 2W88A 1TXYA 4L9DA 3ZN6A 43C9A 4JCMA 4OD1H 4GT0A 3ZE2E 4A39A 3FOMB 1DUZB 1R5WB 3H56A 4BBRB 2N4IA 2X9ZA 5EEXA 5CJQL 1OAZH 4HH9A 3K2KA 3C9NA 4MD0B 2CBMA 3HVNA 3ERXA 3OKNA 4G7SB 1RUPL 4DP0X 4OKVB 1KJ2L 1XIWB 2VLJB 4MMXA 4OLXH 3RE0A 2I46A 1RULL 1JHKL 2PWHA 3GSVA 2FT8A 2BC4A 4FNTA 4F2ME 3N42F 2F3VA 2H2PD 5GGRY 2O4XA 3I9AA 1CDCA 4PJXF 1STHA 4X4XB 4HIMA 2IDSA 4DSYA 4KD4A 1BZ9B 2OYPA 2YQ3A 1SM3H 4DVRH 3UYOD 2XVBA 3EYSH 3FRPB 5F97E 5FB8B 3S36H 1CC3A 4FLHA 5FXCH 3UYRL 1TWAB 2XTSA 4XNDA 4HCFA 5I28A 3SCMC 4HEDA 2Y7OA 2Z1KA 1D5RA 3IM1A 4WVRA 4UIMB 2Q2LA 2X1WL 2ZKXA 2I32A 5HYSG 3CMEA 2B63G 2EUWA 1P7KB 5FECA 1A3QA 4PG9A 1SEBD 4K0KL 4JLRB 1S40A 5CP3A 3T2NL 3L2PA 2N1TE 2G5BA 1ZVNA 3WN6A 2XX1A 3NABL 1ESOA 5EPKA 1MFDH 3E3QC 4GRLB 1U0QA 4XWGL 5IM7A 3HE7D 3L5WA 5B38G 2ATKB 4D2NA 4H88L 4OX9L 3HE6B 4JKPH 3VFVA 1SYBA 1TXKA 3BOVA 5D70L 5CEZL 2MPMA 3AMUA 5DJ0A 2A6IA 3HUJB 3O6KH 1K4CB 2AK4E 3J7ZC 3RIAF 4Z95H 4DF7A 4TTDC 2MJWA 1RL2A 3IFNH 3ILEA 3ZQWA 2YPLD 3BLBA 4KH2A 4JI3L 2BY2A 4QMGA 1E9QB 3QDGD 1S7RA 4PJGB 5GRWA 1TJXA 4KY1H 1D6EB 2B7DT 5C0DB 1PSKH 1ZE3C 2JJTA 1TPXB 5IGXL 1LTSD 5E8DH 3HOWH 1ZEAH 5J13C 3I91A 3WE1A 1INQA 3IAPA 4XPHH 4UOJA 2CMRL 4F7MB 1CTOA 1TZIB 4A6YA 5DS1A 3S14H 3SKOB 3RUGF 3PGCB 1DD2A 3ZXAC 4QHKI 4PB0L 5EU3B 4AUJA 4Z7VA 2N78A 3ULVD 3DRTA 4C57C 5IHZB 1AFVH 1Q1JH 3KE0A 1RXLA 1HNFA 3X2QB 5GGVL 1BBDH 1HH6A 1UHVA 1N67A 5F9JA 4C58B 1N33Q 5FCUH 2AQ1B 1EAQA 4N1CA 4DP4X 4HJ1A 3MRCB 2LKVA 1P1ZB 1XL6A 1I85C 1NCAH 1T5EA 3NEXA 1K3BC 3G3LA 3A74A 2EYTB 5BVJA 4HIEB 4Y9EA 4OVUA 2WWKT 2EQDA 3RB7A 2QZ5A 2ZWYA 3H0GH 3R7RA 1NC2D 5IY0A 4IZ8A 4LSVH 3EH3B 2BOLA 2IDUA 4RMTA 3FQ4A 3ZYOA 2R29L 2PYEB 4WHYG 4QB4A 4K8RH 1EHLH 2J6EA 4HJTA 3I84A 1RKRA 1XH0A 1X54A 2Z93B 1KDAA 1A65A 3DMMB 4ZMPA 3FTUA 1URZA 3D2UB 4L29A 4GMSH 2ATPA 1ZXKA 2A9DA 4KKPA 1DQKA 2Y9RT 4PVBA 5E00B 2OXPA 2O5XH 2VXTH 3QEHB 2CH4A 2BFGA 3QG7H 1MEXH 3LKOB 4TKOB 3VA7A 3HOXB 2KLTA 4IK6A 4PJCE 2AKRB 2R7EB 2B59B 3QWOB 4WW1B 3SO5A 4BK8A 3FSAA 1S9YB 4R9WA 4ZI8A 4LLUB 3CCUA 2E3VA 2W60A 2CIIA 1U8OA 2HT3C 2WLNA 3FKUS 1FN4B 3RGVC 1IKFL 1N18A 3CE1A 3LIUA 4I3SL 4O2CB 4AQ1A 1HVXA 3HRZA 4NOFA 4JANA 4MJ5B 4FXLA 4YXHH 1PZ5A 3MRGB 3RBGA 3X3GL 1GKOA 5EOQH 4MQSB 5H37A 2QTEA 3OX8A 4PSPA 1CLZL 1W72A 2PZWA 1IM9D 1OGAB 4WNSA 3G6DH 2X1OA 3CXDH 4S11A 3ZZSA 3HHSA 2DH3A 3BDYL 4JPKH 1U8PB 5BUPA 4J1UA 4O2DA 3VCLB 2WM0A 4XDXA 2JA7G 2EYPA 3ARBC 3V0VB 4DW2L 3NAAH 3EO1A 4GKNB 2ZWNA 3GSRB 4IIQB 1I7TA 3MXVL 4X7EC 1SBSH 3SODB 3C46A 1IYUA 5LBSH 2DJFC 2DYSB 3B7RL 1WFIA 4A3FB 2CRMA 4KUZH 4WRLA 3LIZH 4X98B 3C5JA 3HOVB 5CKAA 5JZ7C 3EFFA 4L8SC 2JA5G 3A55A 4HLZG 3PIQA 4WU7A 3GD7A 4DFHA 1BO0A 4FQHA 4CDDC 3TWYA 2QKIA 3MLVH 5DVPA 3JBG7 3NCJL 5E2WL 5TFSL 5C7XL 2HWZL 1FIGH 4BQ8A 5J6GA 5KSBE 2GJ6B 3BP6B 4EI5B 4X0KB 2SNSA 1MWOA 1TVDA 3US9A 1T03H 4KV5F 1VFOA 1CDIA 1I1AA 3MV7E 1SMDA 4AK2A 3UGEA 3GMLB 1AQDA 5K36H 3ATBA 3IU4L 4NN5C 1RZKH 1X5YA 2F0IA 2NY4B 4DCQA 3FN0H 2ZXBA 4WI6A 1FZOB 4OLWL 5E03A 1VZIA 2JSFA 1KTJA 5FUCC 1MFAH 1NM9A 4U1KB 2M2DA 4MNHA 2K5HA 3RKDD 3P9MA 2IHEA 1E3FA 3VR6A 4LF9L 2BW5A 5SWSD 5DHXB 1UT9A 4UT7L 1G87A 4LAAA 5D71L 4B9CA 2AJSL 3OIPA 5I1CH 1K8GA 4XNZB 3BWZA 3VYPA 2X88A 3GHBH 4R7NA 3ZDZF 3B2UD 2XNAB 2F8XC 3L5JA 3NIDE 3QRLA 2N3JA 4X9GA 3L9BA 3SY0A 1QSED 3QJYA 1W6WA 2NX5A 5D9SA 1RK1A 1UE5A 2JQZA 3U9PL 5L2JA 2TRHA 3WN5C 3ARPA 4A3JB 5E9DB 1HZKA 5FYKL 5B1CA 3KF6A 5IVXB 2BNQA 4W9KC 3HPJB 5CMAA 2RHQB 1ZHNB 5CD3A 1AZUA 1DDHB 4O4YH 4DUZL 4LIQL 3CQZB 1OXXK 2IPKD 2B2WC 4HMCA 3REWA 3STLA 4CILA 1KSRA 1QVOB 2B1AL 3FFDB 1NR4A 3EYUL 1PV4A 1YDPB 1RURH 4JN2A 1BVSA 2JELL 4X65L 5AWNL 4FFZH 4AV5A 4OJFL 4S0TD 2ATWA 1XGTA 4V0BA 1MRDH 1T2XA 2LT9A 3WXVL 1NAMA 1FNGB 3AGWA 4M48L 3MLYL 1G9HA 5I1EH 3WTSA 1MHHA 4H8QA 3VJ6B 4ERSH 2HP4A 2Q0ZX 3UDWA 4NC0B 1I9IH 2FL5B 1RUAL 1ZANL 3CZNA 1XD1A 1T7WA 1V7NL 1V3LA 1N2RA 3FQXA 3S9WA 2X9WA 1ZOXA 1RZ8B 1T0MB 5I66A 2I5MX 3OJMB 4OJAA 1GUTA 2Y0SB 2F53E 2GTZA 4HEPG 2P8PA 3KPTA 4F1SA 5JIIA 5ELIA 4OIJA 5I6YA 4TSSA 2BNRD 2O5ZH 3FK3A 4MD4A 3IJYA 1Q81C 1EIGA 5E6ID 5ILTL 2BSRA 4PWKA 1SOQA 3WBDA 3RN2A 1XF4A 5CILL 3H6MA 3QORB 1ITCA 4FFWD 4BY1B 3CMGA 1XCTB 2GIMA 4DQAA 1CE6B 4X42A 5HYJA 3WLBB 5I0WA 2WZ6A 2HYMA 5MENB 1DGSA 2WXNA 2HVJB 4AVJA 1G1OA 1OAXH 4X5WA 1WWWX 2F68X 4XPGL 2L7JA 2CA3A 1N0XL 4RQQB 1A15A 1KLGD 4YJZL 1I3UA 5EBWA 1WI5A 1R9TB 3O3AB 5E8PB 3K6SB 3BGMB 4N8X1 1J9RA 4CJ2C 2AGJH 2CO3A 3PY9A 3BKML 2XVKA 2AITA 3VH8G 1B0IA 2VL6A 1KT2A 4QY7A 2OM5A 4XZ4A 4EI6A 3TO4A 2H45A 1E2VA 4RWSC 3ZZQA 3VRIB 3MJ6A 3MC0B 2WLLB 2XTIA 1GA2A 3V4PL 4B0MM 4ETQB 5D2LB 3VYRA 4BFNA 3E3QE 2H6PB 4CMHC 5CJOL 3WNPA 4FTVE 3T0EC 1KIRB 3NIFB 1NJIC 4ZUJA 3A7LA 1HFUA 1CHPD 1MPAL 3BW9B 1UFUA 4G7YL 5DZOA 1QWNA 1N8ZA 1ZHKA 1FFPB 1MG2C 5E8NA 5I82A 2OA9A 2GJJA 2WQXA 3W9DB 1HL8A 4MZIA 3NE5B 1P4BL 3A0JA 3HMWH 4G82A 4FXGB 5LGHH 1MCSA 3E0EA 3IN0A 12E8L 1JCVA 5IP9H 2XSKA 3H42H 1WGOA 3QUMA 3OHMB 1ZLVH 4J6IA 5T1KA 3V4VA 3KMDA 1OGSA 3QUKB 1YPZA 4PJHA 3ZHNA 2NY3C 1NAPA 4R97C 3AEVA 2FGZA 2N8NA 1JFHA 3LJ3A 1JOKA 4QR7A 4HLEA 3U6XS 2M9VA 2NTSP 3BQUC 3HBGA 4E42A 3GXUB 4H8PA 5E4EC 2QILA 2KLSA 4Z8FL 2KCCA 1QA9B 5H2BB 2GJZA 3ZX1A 4LCWA 1TWFH 2FECL 4LW1A 5I6PA 2ADIB 2MCG1 2QF7A 2EDMA 4Y1AE 2WXPA 5G3LF 1IBGL 4OLZH 1IBML 1FNFA 5ADPH 1XIWD 2VLJD 2YD0A 4OZHE 3CZGA 2WP8J 2A77H 2JK5A 1S5BD 1XEDA 3QULA 4OLEA 4XVTL 5F7FA 1QI4A 1VAHA 3V52L 1L4IA 3FTVA 3D06A 1JVLA 2FX8H 4QKTA 4OQTL 4YHKL 1R1CA 4WUKL 3GHPA 4GG8B 4PH8A 4AJ0A 3A4EA 4G6KH 4A2LA 1CICB 3CCHB 5A3ID 3SYQA 4XT1B 2PW2A 3LSOB 5TE6L 4N8VB 2M1KA 1MCCA 2QPDB 2UY6A 2CGRH 4A3KB 4U6HA 1OLLA 4F2FA 3BVZA 1WAAF 3EYOB 1IBBA 2ALWA 2GK0B 3GSWA 3O4LB 2AEPH 3QIAA 1ORSA 1HZHH 1TEYA 2K9UA 3QUMH 1S9KC 3P75A 2WGNB 4GSXA 3MRKB 3S35L 5FM8A 1ZA3B 2BP8B 3KDPB 1J1XL 4PJ8B 2AKWB 9PCYA 3RKPA 3R4DA 3UTPE 4Z7UE 2BVOB 1F58H 4GRLD 2XX0A 5EKIA 5DFVC 4QYOA 3HE6D 2EPBA 3WELA 4BFIA 5JLZB 1B8AA 1WTVA 5GGTL 2OL3L 4DR2L 3JV6B 3KLLA 2ZSWA 4LPCA 4YWGH 1NM4A 5CR3A 4KUCF 3LZPA 3KPSE 4N8CH 1V1PB 4K5NA 3AGVA 2IPUG 4Q7DA 5I71C 3S35X 2H4EA 5CC4A 2A3TA 4UOZA 1A5FH 1CZ8L 3BPLB 4GW5A 4RDBA 1IGCH 2FB4L 1RDPD 2WWNA 2VDOB 3TBBA 1AD0B 1SJMA 2ENJA 2PXYC 5D6CB 2UYLA 5KEEA 5AOIA 2O2LD 2ZNWA 4X7SL 1W15A 5IESL 2HRLA 3GTNA 2MO0A 4N9TA 1E5ZA 1E7VA 4CBZA 5I0ZA 4O02L 3PF4A 2YAOA 4U0QB 5JMOC 3FT9A 4L8BA 4LSRL 5CD5D 5A35A 4TXVB 1JN6A 3AMKA 3C2PA 2KZKA 3KVQA 4M4RA 3ARYA 5FA3B 4G9DA 5C3TA 1IAOB 3OKDB 4UNIA 5BZZA 1TTAA 2WXHA 3KPNB 3VM5A 2F74B 2CLRA 3UGUA 1EQQA 3D08A 4G7QB 4AEHH 2KBNA 1BJ1J 3ECUA 3GRGA 2WIIB 5J57B 2WWMC 1HSBB 3OKOB 5EF1A 4UWQB 4FS0A 1PLFA 1BAGA 1P84K 2BWDA 3D50A 3LNDA 4FLRA 4L5FL 2J88H 4O2EB 3C3LA 4PWIA 4W4OA 3FEWX 5HGTA 4TSBL 4LCYA 3CZEA 1JJCB 3ZO9A 5CBAB 1TTFA 2BIMA 3FUEA 1BEXA 2PYED 1UEMA 1WH0A 2ADYA 2V0AA 5LAXA 1R3HA 5FUCE 3D8GA 3IGKA 3STBD 1M7XA 5BW7C 3DMMD 2CDEA 4EOWH 2YD8A 3D2UD 4HLJA 3D7PA 2KLRA 4KKSA 3CN4A 3P77A 4X8JA 3I4MB 4UQ3A 4QRRB 5BV7C 1BVOA 1HK6A 3UPCA 4B5ZA 4EAEA 2BCKA 3GRWL 5C0NC 1M2OA 2XICA 4OZGB 2P7TB 1MCHA 5CSGA 4LFBL 4ZDHA 3ZMRA 1KDJA 3QIUA 4KITB 4L6TB 5F96H 5EIQA 5D7KD 2BFVH 2XG5A 4KVNL 2ETWA 1KABA 2I7OA 4ODVL 4GAYA 4GQQA 3P1VA 4P9ML 2E8YA 4OBRA 3PO2G 3ABMB 3INUH 4G7HC 1L0XA 5B8CA 2JJVA 5HGQA 2BP0B 4J3OD 5DHEA 3UBFA 3F7YB 2YBGA 3QA3B 2KC0A 4KJYA 4XP5H 1OANA 5IJDC 3OSVA 5CP7A 4IEFB 2B2VC 1QTSA 4XH2A 5T1IA 2E74C 1OGAD 4JO3L 4ONFL 2AANA 4LF3B 15C8L 4HUMB 5GIRB 1U3ZA 3CFTA 5KNDA 3Q24A 4DGVL 5D72L 1A2TA 2MKWA 2COQA 2P24B 5BO1L 2WSKA 2WXOA 3P3YA 5TQ0L 1TF4A 2YAQA 1IEBB 2GVAA 1L9QA 2OSXA 5DZLA 1TS4A 3V6OC 3T3PF 2NY7L 1BJ8A 1Q12A 4WHTA 4KMUC 5L37A 3HR5B 1ET8A 4FQCL 1WTRA 3QVAA 3NFSH 1P16A 2A74C 2WNWA 2EYSA 2VSKB 4N2FA 4OF6A 4OD3L 1NCWH 4Q2ZA 2ZKHL 4HGWA 5CO1A 3DTXB 1TVBA 4PJFF 3HKZE 4TQEL 1UA6L 5KNCA 1NE3A 2GJ6D 4FG2A 4MA8H 3DXAB 4CW1B 4EI5D 3L3DB 5KS9F 2CO6B 1F13A 4JREC 4P48A 2YJQA 4QLRA 4U1SA 1MLCB 2F19H 2NY4D 5ERWA 3HOZH 2C4FU 3GZQA 2Y25A 5GZNC 4QRUA 1QTYT 2OTUB 3MRMA 1EVUA 4L2LA 4OLVL 4UT9L 4HIHB 1KTLA 4XNAA 3LMJH 4M1CD 2PYKA 4NP4H 1DBAL 1UZ6E 1WFNA 3CXFA 4NZRH 1VHPA 1AOZA 3RFRA 3HN8A 3ETTA 1BZQK 4Y5VC 3O6FC 1LDPL 4JFEA 1BQHA 3G6JA 2EDFA 4K7FB 4QOKE 3GI9L 5IG7B 1QNZL 3L95B 5JIPA 1WFQA 1TCRB 1ENFA 4DGZA 5F0LB 1IAKA 4KXBA 2APWA 1GHFL 4GLRH 4E9YA 2VABB 4MXQD 1Y1VG 2A69C 3GO5A 5E9DD 4XMKH 1OXVA 1B3JA 3G08B 4QXVA 1A62A 1IKLA 2CLZA 1R24A 3T0EE 2RDFA 3CKIB 4RHSA 3BIBX 4GIAA 3RWFB 5CBEA 2X6CA 4PJBA 2X4OB 2OI9C 1KL9A 3FQUB 5HHVL 4WW2A 3CFBA 2Z4QB 3U4ZA 5I6WA 1LP9A 2BHYA 3CVIL 4JRXE 1ACXA 4GW4B 4L4JA 3V4UL 4BFKA 3DTUB 4MA7L 5AYQA 5CZRA 2QVKA 4CKBA 3DOHA 4FFYH 4PHXA 3FB7B 5CNHA 4XMWA 1EGJA 1MIML 4N26A 5ANHA 4Z5RA 3WCYA 3DMUA 5L6YL 1D6VL 4ZMTA 1R75A 3FN3A 3IDXH 2IFFL 2FJGA 3Q01A 5L4JA 3CFEB 3RWDB 3RWCA 3NG5A 5I2XA 3DVNB 4NC1E 1E6JH 2G75B 4JI8Q 2WB1A 1E9PA 5F9DC 4A04A 1LV9A 5CZXC 4NXML 4BCYA 1YJWA 1C08A 1XMEB 4EIBA 5E5MB 2D0FA 2KZ1B 3PJLA 5DD0H 3QJUB 3M7GA 3PV0A 5INDA 1QVFA 1TJMA 5EN3A 2VRQA 3VFNB 1ZE3H 3KJ4B 4OIFA 4FYRA 1Q86C 3HOWB 5DK0A 5FHAL 5LO7A 3QORD 4KX8A 3U7WL 2HG5A 3LZLA 5MEND 4KI5F 3S14B 5FYLL 5HI3C 4P3CL 2YZ8A 2G9KA 3OG4B 3L9RA 2R61A 3MZ5A 1PZ2A 1QBMH 1SY6L 1UVQB 2LR4A 2ZCKL 2FVNA 3CFIC 4OZ4B 4CC1A 1MI2A 2I25N 1C5BL 4ZTPH 5KANI 2E5LQ 2XWDA 2R0WL 1O7YA 2ROXA 2ZOUA 3VRLF 1FGUA 1YN7A 1RZFH 1Q8IA 1SXSA 1TEFA 3BPNC 2AW2A 3MJGX 5ECGA 3RWGA 5KSVB 4JHZA 2CJUL 1PYSB 2KCMA 2IJ0C 5JHLA 4WFEE 3NK3A 1OM3L 3H9YA 4HJUA 1NWPA 4AZUA 2A5HA 4N2IA 4BFFA 1DQDL 3PGFL 4A3IH 2WQVA 4JQIA 4JC0A 1AE3A 1KPUA 3SKMB 4ZO8A 5DEFA 5IM7B 5ADOH 4G11A 1AIFA 1FFOA 5JXED 4YNYA 4K5PA 2CO1A 4QUFA 4BY7H 2D0GA 2DLTA 5DU7A 4LOUD 2HT1A 3W1BA 1DVFA 1JXKA 1TO5A 3OSOA 4HCRL 3ZSSA 3DM3A 3UZVA 2XN9C 2HJFA 3RX9A 5HDQL 4KX9A 4R2GB 4HFWB 2WKDA 1S7RB 3LH2L 4L1HA 2L4OA 2FNBA 3FYEB 3II2A 4LLVB 4B9ZA 3AW5A 4UM9A 1KOAA 4IFDG 2C7UB 5ICZA 4EN3A 1RU9H 5IQLA 2O72A 1QZGA 4NUGH 1SVCP 4IOSA 5JMRA 1K8IA 4FEIA 2FEJA 1I6VC 2HIVA 3NPSC 4N0FA 5KNBA 4K3JH 3TIEA 2ZE0A 2WO2B 3LPFA 3UL4A 3WE6A 4AXWB 3MR9B 3CDFA 2MPAL 4O00A 4HZLA 4U1NB 1NMBL 1FLRH 4BXXG 2WBJC 1WZAA 1YEFL 1ZS8A 4Y5XA 3QXDA 2HLAB 5FUOL 2OR7A 1YQVL 5KBLA 5IJCC 1UJ3B 1HZLA 4X8XA 2XZZA 1E27B 4WFHE 1RI8A 4QRQB 3VSQA 5KVMC 1G84A 4NM4L 3BUPA 3Q8BA 4ALPA 4OB5L 3WFBH 2FJFA 1A3VA 2D0OA 3P69A 2QV2A 4ODSH 1T7XA 3DJSA 4XN7A 3IKCA 5JHLH 3IWVA 1CICD 3BVDB 4FZEL 4DUVA 1MBYA 4WJ5A 4RMRA 1UB5A 4Z7IA 3K2IA 3NP8A 4LGSB 4HUXB 4B9GA 1D3CA 2I0QA 1M42A 1LUZA 3VNZA 1QSFB 3VR2A 2CM6A 5DRXA 1HJBC 2UUCQ 2H41A 3O4LD 4MZ2A 3V0FA 4M7LH 4NLHA 4NQQA 3EFOA 3K1DA 3PIO3 2F8VA 3BUYB 3DUUB 4JFDE 5IW3A 5LXVA 1ECYA 1ED3A 4EDWH 1IBHA 4PJ8D 2F0QA 1OWWA 4WI5A 2Z6KA 1KACB 2F4VQ 3OW7A 2Q9OA 1EY7A 1E50A 4NO5A 1AKJA 4JK1C 1J11A 4I0KA 2B8OT 4YX2L 3UZQA 3LKSA 2H6UA 4B9FA 4HHAA 1MCPH 3ZYYX 3ISYA 4MXWH 5J11C 2A6HC 4IBYA 4Z23A 1WFUA 4JANB 3OWEA 3F85A 4KPHL 4TTGA 2BVUA 3DOIA 2FWOB 3OX8B 3S88H 5FLMH 1BFOB 1P5UB 4OFQA 5JDSA 4M5SA 1WJ3A 2ZCZA 2WIMA 1OSPL 3QCVL 3D4GA 4FXKA 4G5AA 1FYTE 3QNXA 3W39B 2ESVB 4IDJL 4JO4L 5E2VH 2DJ4A 5DD1L 4DP2X 5ABAA 3PP3H 3EOTH 4HF5H 4JG1H 5MHSD 3V6OE 4XMXA 4X2UA 2EE3A 5DK3A 1C1EL 2CHBD 2RQEA 4Y19B 5EO9A 3APFA 3JSSA 5JIDA 4FG6C 1CUKA 3MOAH 3I6GA 3U1PA 3UTSB 1SDAB 1H5BA 3HOUG 4FP8L 2MH4A 2WBKA 1E4XI 2YGPA 4G8GA 4PRPE 2ZAIA 1U36A 5EF3A 5ISZB 1GUNA 4WU7B 4B3SQ 2K33A 2VDML 4KVPA 3W0WE 4FE9A 1TVXA 5CV9A 4TNWK 1HCFX 4OIIL 4PS4L 2GHWB 3RYMA 4DR5Q 2AJVH 4ME5A 5IMOB 2AK1H 1RSFA 3U0PA 3CFJB 1XMOL 3CDGA 4HEME 3SEPA 4B9PA 1Y14B 4LFCQ 2P52A 3OPZH 4P23A 3WEMA 5M5XH 1H3TA 4B9KC 1DVSA 1L9RA 4DPAX 1RZGA 2AWOA 3CHXA 3QCTL 1H9SA 4JFFE 3U7YL 3MYZA 3QQ9D 3VAEA 3TT1L 1UGKA 1PH3A 3R3OA 1IFRA 4H40A 4Y16A 3GMRB 5DYFA 4LF8L 3SE3A 1GYUA 1OVZA 1TEGA 1ZV2A 3PF2A 4L8DA 4NRYB 4MNHB 3FULA 5F9OH 3UTZA 4Y4KA 4QRRD 1B0RA 4ZPVA 4ZO9A 4AH2A 4OCSL 1ASYA 1PCXA 4EBQL 4X7FC 5EIIA 4NSKB 2YXFA 2O26U 4R7NB 1NGPL 2VB2X 2FNWA 1AHWB 2QVIA 1KIPA 4YFEA 1AC0A 4L8JA 1NUCA 3AROA 4I1PA 1SLWA 3L1EA 5D9SB 2CRZA 4UQ2A 3UTQB 3C08L 5JORB 2XRSD 1ZD6A 2DNCA 1JYVA 3FSOA 3T6ZA 1JGDB 1ASZA 2J7LA 3ERQA 4KJNA 1Z9MA 2CK0H 3ZE2B 4ENZA 3SPVB 1XX9C 2ZX8A 3CFUA 3GZKA 3MBXL 2R2HA 3DJZA 3RDTC 3A47A 3L1OH 3V0EA 3VU1A 4JN1L 2JA6H 1L0YA 1R9FA 1QW8A 3DX6B 3HOGA 3NJNA 4BDVA 2C1OB 3ULVF 2YUWA 1YEZA 4ZMYA 4L3CA 5F7UA 5F72S 2OJZL 2AQRA 4KH9A 1NOFA 2C1PB 2HKHH 2C3VB 3Q2WA 4WTQA 3I4NH 3GTJH 4BSVA 1PFBA 1EL0A 4ORGB 3GTMH 1VQ7A 2DS4A 3N50A 5DRWA 3M85A 5EPMB 5HY9A 2MQ3A 4UBDD 4MX7B 4X3TA 2XWTB 1J9TA 3OMCA 5IBUB 2WNKA 2A1AA 3I4LA 1LEIB 4F8PA 4HWBA 4ELKB 4F7TA 2NY1B 4PAZA 5C0AA 3PIP3 3DXAD 5F88A 5B3SB 4Z7WA 1PYWB 2NZ9D 5D4QA 1XT5A 3FAXA 4XB8A 4C56C 2XI9A 1HZ9A 3HHRB 1B4JL 2BINA 4PJIA 4P2RE 3I2CL 3BN9D 2GTZB 4HC1L 2P8PB 5GJSL 3CCVA 1L7TH 3RL2A 4OF0A 3J8F7 2HT4C 3SGDI 5C07B 1BBWA 1X7TA 1NCBH 3CUPB 3Q1SL 3L3HA 3NDZE 3ZSTA 1TLKA 4A3BH 3ASNB 2R1XA 3LS4L 3CC4A 3GIVB 2C9OA 4JFSA 1XNQL 4W9CC 5FPIA 5JPNC 3CD6A 5I1LA 1TWFB 2AK4B 4DOHE 4DKEL 5IHLB 3CFKB 5IYDG 1QFOA 3SPHA 4NQSB 3IDGA 4K5XA 3TXAA 1IFHH 5MEQA 4JL1A 3Q05A 3B7UX 2RFXB 3UGXA 1B88A 1EO8L 1OPOA 4KTAA 3FCGA 1A9BB 1X5MA 3GS7A 2XXGA 4E9QA 1SN2A 5DD6A 4DK3A 4XX1G 5LMNQ 1I8KB 4JY5H 2HSIA 5FKPA 3ILPB 4QRFA 1CL7I 3I3DA 4TN9A 2YMTA 3W5MA 5F3BB 1SEQH 1I7RB 5MP6L 4WLCA 3ZU8A 3MNWB 3L5HA 4PUBH 1PZ3A 3UP6A 3MFGA 3GWJA 1VFBB 1QRNA 1U33A 2XN9E 3NSWA 3P2TA 4P2OA 2WAHA 3NBNA 1SDDB 3J07A 3QUMB 5E51A 3T9WA 4BZ1A 4LLDB 4HVBA 1KB5L 2KERA 4J4PC 1S9XA 3F7PC 2KENA 3GJFA 3VTTA 1JV5A 1UKTA 3M86A 5EZIL 4ORZC 4AG4H 4YMPA 4Y4FB 1T2QL 1KCRH 4NQEE 3BVVA 1M2VA 1P8LA 5D8JH 4TUKL 3GPEA 5EZOH 1X6NA 3RVVC 1JZ7A 4L4TB 5ALBH 2C8NA 1UUNA 2WNGA 3JWNC 5L88L 2NRDA 2H0JA 2SODB 3DECA 3MLTB 1IBKL 3VFPA 1M7IB 2GJZB 2EEAA 3KS0J 4Q89A 5J56B 5LNGA 5C4XG 3IJEA 4GOPA 5JPMB 1Q8KA 4XYQA 1JV2B 2VISB 4H25B 3RTQC 3MV8A 5C0XH 3QPXH 3OD3A 1FNAA 3CBKB 4AEFA 4GN4B 5HHOE 3NIGE 1TVHB 3L9AX 3APMA 4PJCB 4BBRG 3LNGA 1SYEA 2IH1B 3I7FA 3BKJL 4LF6L 3LRKA 5ITFA 3V7AG 4CVZB 4FA7B 3L8QA 4G80A 4FXDA 2H0PA 4LP4A 4ELMA 2WC7A 4NKOB 4U673 5AOKA 2IMNA 4FEMA 1ZLVK 3KGUA 2H8PA 1UWEL 3MV9A 1CMOA 3VXSB 2MNAA 5TK2A 1EFXB 1TJHL 4FO2A 3SOBH 5ISRA 2MKLC 4RA0C 3U4AA 1IL1A 3UPRA 3R8BA 5D1XA 4E41A 2V17H 1BYPA 1S46A 3IDYC 4OH2A 2DQTL 2X7LB 3FRPG 4BA8A 5C3XA 1R3JB 3FH7A 2RCFA 4H7BA 2YTXA 3B1UA 2A8VA 5F93C 4JI4Q 4K8RD 3RFZA 5IOPA 3LQMA 5KJRH 5CINL 3N1QC 1AR1C 5GRXG 1MQKL 5HD8C 3P0VH 4L5RC 4FI8A 3BJUA 4I1NB 1CGSH 3BDXA 3MRQA 4ISVB 4S1SL 3HC4L 5A7EA 2A4EA 5BJTB 5CEZE 1FVIA 4LNQA 1RLBA 5BV7H 5FF6A 4R2GD 5AJ3L 4GW5B 4D0DB 5KSAC 2G3MA 5MENA 5C9KA 5BR8L 1F90L 4FP5D 4DUYL 2P42B 3KL5A 3RWHB 4WF7A 3WFEH 3ZQXA 4ATWA 4NN7B 3BEVA 1SLUA 2R2BB 5IW1A 5DHYA 4GAGH 4PBDA 2D0HA 3HB3C 3DRQA 2LXJA 4L8BB 3G04A 4FQIL 1PH5A 3U36A 1QLEL 5I19H 1CG9A 4RAUB 5TTRA 1IFGA 4I2XA 4M4RB 1HEZA 4I18C 4G9DB 2R2EB 3I9GL 5ELCA 3ZKND 4LVOC 3U0WL 3GK8L 3HN5A 1XYIA 1CVSC 1C4QA 4O58L 2JYOA 3QHZH 4BCXA 2CR0A 2RSOA 1BBJB 2FLMA 4KFZC 1Z3GH 5I16B 4YUEL 4YPJA 3WEXA 1UXSB 2B5IB 3WO4B 3ME0B 2NPLX 4QWWD 3ES6B 2NNAA 2BERA 3WD5L 1KG0B 2UUBQ 1KGYE 4W9FC 3MUY1 1JGLH 1K3IA 3TN0A 1A6AA 1ULVA 1KB3A 1R3LB 4L37B 4K94L 3T6QC 3R7QA 1BX2A 1J5OH 1QSFD 5IHUH 5LAXB 2HHHL 3GMPA 5AAMC 1NL0H 4MQ7A 1H95A 4QAWA 3GFUA 3VXNB 4DH2A 2OTLA 1DSYA 3G5VA 2EH8H 5FR3A 3NJXA 1ZT7B 1XH1A 1B4RA 1D5ZB 2CDEB 4MJ2A 5D7IE 2X0UA 5C44H 1R4XA 4X8JB 2R93H 1AIZA 4PM1A 4ZXBA 1AR2A 4J8RB 3ARFC 1MJEA 4KROB 2BCKB 5GISH 3ZYJA 1R0AH 3DIFB 5D1QA 3HOZB 3T4YA 4Y9FA 1D2BA 1U5KA 3T1HL 4B96A 3MCG1 3KBGA 1OGTB 2VL5A 3D39E 3HOXG 4YPGB 4DN4L 4HG4J 3O11A 1INDL 1DBKL 1S5CD 1FNEB 1SF5A 2QQNL 3MOBH 3TA3C 1AEXA 5JW4M 2VZSA 4GRWH 1UD4A 1N3NA 2WZPD 5C2BL 3FBQA 4PP1C 2D03H 2F53B 1TWHH 1D2OA 2XYBA 2YD9A 1VQBA 2CIKB 1SJXA 3GLEA 4JPWH 2VGLM 2I9TB 4J3OG 2ESVD 2CO4A 3O4OB 3Q7JA 4K7PL 1JVOA 3SE8H 4AKQA 4X6FA 3D25B 1F2XK 3VXRE 4MAZA 5EBMA 2JJQA 4Q9RL 1QKZH 5T33H 4Y19D 2UZPA 1FAIL 1K3RA 1P4IL 1VZHA 3FPUB 2N56A 1A14L 3UTSD 2HJLA 2BOBA 4UQCA 5EORH 1OE2A 1ENCA 4JJHA 1I9JL 1AGCA 3GGWA 5ISZD 1EHAA 2V37A 2SNMA 4K7PX 3SCMB 5GROA 1CVRA 1U4RA 3WSQH 1TVBB 4A3FG 4JRLA 2VZUA 2J1WA 4OAWA 5ACMA 4Z3IA 3HOVG 1HAUA 1KCUH 4PBVC 4C56E 2VMEA 2GTWB 3LQAL 4DGWC 1T5KA 3MMEB 2AVGA 4HDIA 2Z65C 5DD5L 1IC7L 3D85A 4B3TQ 1BVLB 1OALA 2M8XA 3GXPA 4RGNC 4JOIC 2R4RL 4QGYA 5DJZB 4Y2DB 3UERA 3EFDH 2F8OA 1NBZA 1ML0D 3DX8A 4R4FL 4PJAA 1MJ7H 1J6QA 4PGZA 1SR3A 4AL8L 4GG6E 4APQC 4DA2A 1GCYA 4B9YA 2L11A 4KJQD 1MZYA 2ZXAA 1A6UH 5GRVK 3FRUA 3UPAA 3W2DL 1KLFA 1UCTA 4YH6A 4AT6B 3LB6C 5I17B 3G6JB 4AYMC 3NP3A 5JW5A 1XF2A 2CXKA 3M17A 1H9RA 4JCVE 1N0LA 3G5XB 1S7VB 3HUJF 4IOIA 5LNDA 4MNOA 3WOVA 5J13B 2R7DA 5T8IA 2YRPA 2WLJA 4JZJC 5C08A 2VW9A 1YAZA 2JTYA 1TQOA 5JJIA 1D7BA 3IDIA 2NY5L 1NEZB 4LRIA 1CR9L 4PJGF 3VXUA 2F0JA 4A3CH 3HS0C 5G5DA 1IGFL 1SXCA 5TE4H 1OT4A 2E4TA 2MMXA 5GSRA 2KYIA 4HW6A 3US1A 1AI1H 3DETC 3T2OA 1BXUA 2WV6D 3CFDB 1FGVL 1NCJA 2HMID 4DKAC 3WMSA 1D5IH 1HNZL 3CU7A 4LL9A 5FYKE 3NESA 4Y1AB 4FCAA 4AV0A 4UDUA 4A3JG 5CBEB 4IO9A 1EIHA 2NT0A 3IKKA 3QE5A 1U92B 4M62L 4OZHB 5C6TL 1BV8A 1ES0B 1KBGH 1VZGA 2F1EA 2J25A 2VDRH 1JZ8A 1EQVA 1I4QA 4B41A 5DZJA 2ZYHA 4ZFFB 1IM3A 5TD4A 5LDUA 5J9PA 4LIQE 3VGFA 1UM6L 3AMLA 4IUQA 4GQZA 4HU2A 5L8JB 4NKIH 3N52A 3GMOB 2Q8BL 1CLYL 3V5KA 2JIXB 4A3IB 2PPBC 5CGYD 2YSSB 5FA4B 4MDJA 3AS3A 4Q0XL 1A6PA 3JWNE 5E1IA 4BY7B 2EDLA 2NY1D 5JA8B 1L7IL 4OO1H 1WFOA 1PYWD 2Q5BA 3KPMB 1B0WA 4WSKA 4CVXB 3CSGA 2QV4A 2B8GA 1G0DA 3VD0A 5DJ6B 2XC8A 4AVIA 1J8SA 3OL2A 3WJLC 5IMMA 4F7PB 5INDB 1PLGL 2BIOA 4IRSC 4AQAA 1PAZA 2XFXB 5C07D 4Z7UB 3IPFA 1T0NA 3KM2A 1NGZB 1XGYH 5EU4A 1YBYA 4AIMA 1TYRA 2Y0SG 1YVLA 4RFOH 4UT6H 3A8IE 2FFKB 4W9EC 2D9UA 2BOSA 3C12A 2AK4D 3RUGE 4PLJC 1JXGA 2BRRH 2VY3A 3J7AV 2NZOA 4X6BB 4A76A 4D0BB 1IXRA 3B1TA 1Y18B 2OJEA 2VR5A 3SSGA 3TCLB 4BY1G 2ZICA 4AIXA 1U3HA 1JD9A 4APXA 1WCBB 1OXUA 3G9VA 4R4CA 3TCTA 3HJEA 3SXHA 3I3BA 1EYCA 4UV4H 1MWAL 4J3OF 5CJQH 3O2DL 1CD1B 1K8DB 1RUPH 3L7EB 2EXTA 3QI9A 3QG6A 2Z0UA 3FO0L 5KRUA 4X5XA 4AGMA 1RULH 3QJZA 1JHKH 3BIAX 5DEGA 2ARWA 3UROR 2KCTA 1HYSC 1BF8A 2A2QT 4N85A 2PYFB 4L8SB 2Z4HA 3KK7A 3GKWL 4K6LA 3B2XA 1QPPA 2H0FA 5EC1B 1DQQB 1FVCB 3SYPA 1PG7L 2BWIA 4KJWC 5D2NC 1DVFB 4KY7A 3A5VA 1CT1D 1HDMA 2V7HA 2GN5A 3UYRH 3UZVB 4AYBE 1GGCL 2CJ3A 5E1AA 1VADB 3TASA 2OR9L 4G70B 1B6UA 2CPUA 2BVQA 1BCPC 1ZK5A 3EIVA 4NQDE 4AMKL 2BOCA 3BD4A 2VERN 2Q10A 4Y4FD 4NNYA 1KTDA 4PLKD 1OK8A 3T2NH 2YD1A 4L4TD 1NGYA 2K6YA 3KYHC 4UU9B 3WAKA 3FDWA 3U4BH 3SQBB 2MFIA 3CLFL 3QH3A 4MCYA 5E6SB 3QXUA 2A0LC 4XWGH 3AWGA 1QZ1A 3T0DA 3NK9A 4S1RH 1S72A 1TETL 2IXQA 4H88H 4KQ4L 4YFDB 4OEMB 2KEEA 2I5LX 3O9WB 1X6OA 4ZQKB 2W65B 2HKAA 4Y5XB 4IBQA 3CAMA 4LEOB 3FQRA 3E6FA 3GS4A 4XBMA 2X6VA 1D5MA 5F0MB 1G6RA 3IJ9A 1LT3D 5LGJA 3BU2A 1WT5A 1NFIA 4CJ1A 3LKNA 4QRPE 1SLJA 1CFVL 5I5JA 5C4JH 1E5UI 4LLMA 1BNZA 2ZG2A 3S16H 4MHHI 4MVBC 3BSZA 3OXSA 5IGXH 3CTTA 3S3JA 3VXSD 5KOMC 1EFXD 3MFFB 4YDKH 4KMTH 1AGBA 1XJVA 1W2KT 2CCLA 2NTFA 4JGMA 1A6WL 1F45A 4PB0H 4YSPA 5T3ZL 4RLDA 5DURB 5DRXB 2HFFB 3IEAA 1EZVY 5IVXF 2JWYA 1JPGA 2ITCA 4PRHA 3G5YA 5GGVH 1IGIL 4A3KG 1E67A 5AW0B 4DU9A 1ED3B 5HYEA 2LAAA 2ID0A 4AENA 5KVFL 4OKDA 4G42A 5M5XB 1WIOA 2CUIA 2Q8RE 2GVBA 2FLBT 5D7JA 2Y1ZA 4HKZA 2WZ5A 3E9TA 4U0RC 1EZSA 1OSEA 4JKWA 1KULA 3ZTNL 3NPZB 4OFPA 1VQIA 4G8IB 4QIRA 5T3XL 3A4DA 1M57B 3RX7A 4ZUWB 1KC8C 2ZTCA 4FHKA 4AQEB 3NWTA 3EOAA 3T65A 5FGRA 2IW3A 1LWJA 3OWEB 2X4UA 3EGXA 2IGTA 4F9LA 1ZGLM 1A1OB 3VFTB 1X3FA 5IB2A 3HZ3A 2OT2A 1N32L 1A6XA 3AAZA 4XMLL 1JZIA 1A7NL 4NW2A 1WLHA 2IGLA 4G7VL 4MKTA 5I8KL 1SRDA 3NH7H 2Q3XA 3QUXB 5GHWL 5DUBA 5K1VA 4P4KA 2WNXA 3VFWB 5AFAA 5GS1A 4NNPL 2VJ8A 5LCVA 3GB7A 4ONHB 2E9IA 3RZDH 3IFPA 5ESQA 5KG9A 2O5IC 3FB6B 3M07A 4QO1A 4FI7A 3QFDA 2XWCA 3HPLB 4LDEB 2FYYA 1SF3A 4XQJA 4PGBB 3UCRA 5BZDA 3MTXA 2XLLA 4I3SH 3ABGA 4OGAC 3VA6A 2AQSA 1LK2A 3WFZA 2R69L 2WQRA 3ABZA 3X3GH 3N43B 1Q9WB 3C75A 1I3GL 1EY8A 2L1BA 1IGYA 1CLZH 1WA2X 1ZLWH 3S7GA 2VQTA 4LSUL 5C7ZA 3D0LA 1UUPA 2PQAA 5AAWC 3AUVA 3VB8A 2WLMA 4XTCS 3RNQA 3NSYA 1OCZB 4U3XA 4RGNE 1M1SA 1MAMH 3CDGB 4U1JA 4P8QA 4P46A 4CMHB 3I4NB 3GTJB 3S17H 1OGPA 4L5FE 3GTMB 1EFWA 2AABL 1G8ZD 1R33A 2WLKA 4XHJD 4XVOA 3O3DB 4DW2H 4KTEL 3JT0A 1O6SA 3MXVH 2D31A 2OMTA 2CVRA 3FTXA 4Y7MA 4WO4A 4UZGA 4YSTA 4QCLA 5D2LF 4Y16B 3SB3A 1ADQA 3QZWB 5E94A 1K0RA 2VDNL 1BIIB 3DBXA 3NIFF 4JEGB 4Y4KB 5JO5B 3PP3K 4B60A 5DQJB 7PAZA 4KROD 3L3OA 2A7BA 3NCJH 5E2WH 2HWZH 1FO0A 4R97B 3NTCL 3MLSH 4CN6A 2Z91B 2KH2B 4WK2B 4XBPB 6CGTA 3I4MG 1F4AA 3VMOA 4X64Q 1JGEB 1VCIA 1HHHB 4KXZI 5E4EB 3U2SA 1B4LA 4A3BB 3HG1A 4OI7A 2JKIS 4NQVA 1KYDA 4FLSA 4UQ2B 3V0GA 4OFKA 3BDBA 3PL6A 5E5LA 3BPCA 3L4WA 3PWLB 1RZPA 3FH8A 1EMTL 1I4FB 3CFCL 3MLXL 1AO7B 5IMKA 1RF2D 2GAZA 5DRNB 2F53D 4BQ9A 3MO1B 4RDQG 5DJDA 4A3LH 2E59A 3KCPA 4JFOA 1XCWA 4W9JC 1K28A 5K1NA 1INEL 3FO9A 1CA5A 4UT7H 4WV1A 1AKPA 1NIBA 5D71H 3T6VA 4X50A 4PRDA 1GGBH 2FT7A 1OQXA 1ENAA 2I5HA 4HR7B 1ASPA 1YEIH 1ZAGA 4DV5L 4PHZA 2K6WA 1DN2A 4NGHH 4NJAH 3U9PH 4IHOB 1K72A 4XMUA 3Q8FA 3SCMD 2RD0A 5FYKH 4KKAD 3MROA 4KDTC 5FWRA 4AYFA 1SXZA 2XV2A 3F00A 4F7TB 5A6IA 3BH8A 5C0AB 1WZ1L 4I48B 3S96A 1G7MA 5E0FA 4MWFB 4M8AA 2QSCL 3OTOQ 4GP5B 3NCCB 4GB9A 3MBEA 2YRBA 4LIQH 3X11B 4AKPA 4FHJA 4PY8J 4Y2DD 5ALCH 4XP9L 2BSEA 1QYGL 1OE1A 1R5IA 2B1OA 4DN3L 1QI5A 3A8KE 1MZZA 3EYUH 5KJ4A 3KDFB 3D6GA 5AWNH 4OJFH 3JWNH 4J3XA 1AXIB 3WXVH 1N10A 1JQYD 4Q0FA 2JJSC 4M48H 4IMLA 2OYMA 3L17A 4JO1L 4MB4A 4OXPA 4TTDD 3KPRE 1HQ4B 5I71B 3O0RL 2YAPA 4YXKL 1CUOA 4HPYL 1VQOA 2ZXQA 3ALXA 1A3ZA 5IJVB 1SYVA 1JNLH 1ZANH 4LNVA 5EDXA 1V7NH 2PXYB 2JTDA 1S7TA 4IOFC 1OO2A 2XZCL 4LOEA 1XXGA 4U3SA 3HZKB 1U8LA 4E5XB 4DVBB 5CFHA 5GQBA 1ZTXH 4EXKA 1K83H 4JM0A 1OIOA 3D87B 1T1WB 5TH2B 1HKLL 4FNPA 5DWUL 1FC1A 1WBXA 3IE4A 4HUUB 1QATA 5IESH 4Y1AD 3L3JA 4MSWA 5FYJH 1C12A 3N2JA 4H4NA 5IWLC 2K04A 3CX5K 1WAAE 2F8IA 5D2NE 4GLRI 4ZMAT 1A25A 2F0GA 4KVCL 1N0XH 3EO0A 3N85H 1LEGB 3K0YA 2ID5A 5TPWL 2OX5A 5FLUA 3WDJA 5KYUA 1GW6A 1SPDA 2Q76B 4A3MH 3SBWC 2R56L 2AV7B 3SYOA 2JIXD 4D0CA 3BKMH 2BE5C 4FF2A 1XCQB 1PL3A 3RZCA 1ZPLA 2VSCA 1R4PB 2Z34A 2W38A 4M56A 4AWJC 3SGKA 4ZPTA 3V4PH 4P57A 5B1JC 2HJKB 4UOQA 5CJOH 1CE1H 4U6VL 4GQ9L 1FCGA 1P53A 1MPAH 4G7YH 2K6ZA 4EGVA 4LFAQ 4A4IA 4IBWA 4GOPB 5BV7B 2NXZC 3W5OA 1K2DB 1MH5A 1P4BH 1DO6A 2F5AL 1D5XA 2RALA 5BZXA 3NCMA 4XCYA 4JL2A 4Z77A 3SE4A 2KMWA 3LY6A 2UXDQ 1JT8A 1ET6A 4J3BA 5GZOA 3EBAA 4CGUB 1CXLA 1GGIL 3NEEA 4MMZB 1PMRA 3CV5A 3SDDA 1TNNA 4U1MA 1QOHA 3V05A 2DKSA 3HMXA 4OZGF 3HA0A 4NDMA 5BQDA 5K9OB 1I50H 3ARXA 5FK9A 3HOWG 5LLIC 3Q43A 4DKDC 4Z8FH 5FYLE 1W0WA 2R0KL 1CK1A 4Y2NA 4GKJL 3J81c 3GSNA 2RIKA 3H91A 3JQOB 5DC0A 4NZUL 2XWZA 4RDQF 2Y2YA 5I6MA 1N70A 3L2NA 3WIHH 1P84J 4NB7A 1N6QL 3SK8A 5ETUA 1IBGH 3TNNA 4FKHA 2HX9A 1UYWH 2YFNA 4B7IA 4DZ8A 3V6ZA 1B9NA 1M6OA 1X3GA 4KFMA 4XVTH 2FATL 1I7UA 5A16B 3V52H 2G2PA 4P9HL 5E1QA 3VYOA 1IBLQ 2DLFL 2CKBA 5F71A 3JTTA 1UB6B 4OQTH 2VLRB 4YHKH 3O13A 1HXMB 3JVGA 2V4LA 3EG9A 4KNUA 4QT5B 3F2DA 1N19A 4PRPB 4XZUA 4YQXL 3L9EA 1DVFD 2PCFA 3H0GG 4KHTL 1E3XA 2HFGL 4LBEA 1NIFA 5TE6H 3W0WB 3P3SA 5I9QC 2H6OA 1DZ1A 2K8QA 2V2WA 32C2A 5C44B 3W11D 3OGCB 4HT1H 5ACZA 3MRBA 2R93B 3T1YQ 2VQEQ 3CC5A 1OP3H 4M61B 1VQKA 2LAGB 2IT1A 4ZNEA 4DO5A 3GHEH 4HSPA 3LRGA 4M7JL 2EYRA 5HYIA 1SFHA 3VFOB 4X9YA 3HFMH 3JC66 3U9SA 1EZ8A 1LO2L 2WXLA 3BEVB 3MV7A 2NN6H 1N36Q 1I3RA 4X6EB 1J1XH 4JFFB 2JK8A 1CLVA 5IW1B 5H8DA 5AKRA 4ZJ9A 5FC9A 1CFTB 4Y8DC 4GMTL 3P7JA 3AS2A 2ADFL 4K3DL 3DJ9A 4Y5VB 5ICUA 5C0BE 4PREA 1P4LB 4E9TA 5HPOA 3TEZA 2E6JA 1U4PA 3O9WD 2OL3H 4D8PB 4NWUL 5EF0A 1ZK9A 4GRWB 5H4ZA 2ODIA 4IBUA 2ICIA 3D8MA 1TWHB 3ARGA 4IS6A 1E4XL 5AW8B 1JMZA 3BAJA 2H47C 3QNYA 1ZWIA 1CZ8H 4WQOA 4FN0A 2FB4H 1XD0A 3IFLL 1MCNA 3C6LB 3IWUA 4KRMB 4Y5YA 1K0SA 4GEJA 4ZFGL 2QDBA 5CEXA 4X7SH 4HWEL 4PGCA 5CU5A 5FDWB 4IKJA 4IBVA 1KJVA 1G5AA 4O02H 5KN5A 3F12A 4LSQL 5BQ7B 1H3PL 3L4YA 4XODA 3SN6N 4PVMA 3N40F 3U0TA 5D93C 5DURD 3CQQA 4MQ7B 1AG6A 1KELL 5DT1L 2L12A 1Y0LA 1HHKA 2FTAA 2HVBA 3Q6GL 4PJFE 2YQBA 3F7KA 1QNUA 2X4RA 3VDCA 1NMGA 1KXVC 5DEJA 3RPIA 1HCZA 1RVFL 5JEAJ 3QR1A 2YEVB 5T5FH 3MRIA 2AJZB 3OB8A 1B3QA 5KW9H 4JY6A 4TOYH 1YYLL 1X9LA 1NAKL 2X4PB 3N04A 4KK8C 5D1QB 1WC7B 3AB0C 5LG1A 1AP2A 4KAQL 3QP3A 1YYMH 1M7DB 3G6AB 1E2ZA 1I8LA 4TSBH 1U4LA 4W93A 1NCTA 2LV4A 5DJCB 1FFTB 4LEBA 5K36G 1KEGH 1J7VR 2Z31C 1FL6B 1T89C 2AJXH 5DJ8B 1J9OA 3ULLA 3IB4A 1A7PH 1HZAA 3DO4A 3IE9A 1E4WL 4LCCA 3CXCA 1TQBC 1Z5LA 2QGDA 4P2RB 2DWSA 3ZKQD 1SNDA 4JE0A 4MNQE 2P80D 5HGHB 1TZGL 4R8NA 2LU5A 2VDOL 3QUXD 1KZYA 2IOIA 4I9WE 2XQ0A 4KU1A 1II3A 4F58L 4GS3A 1D7QA 2NQDA 4K5OA 4YE4L 4D9RE 1V7MH 3RB5A 3H2QA 1XPRA 5H94B 3MXNB 1RZJC 5IB1B 4NZDA 1YEDB 3GSQA 4WFFE 4LF4Q 5E95B 4MBRA 4P9MH 2PLTA 4DOHB 1YY9C 2BSSA 4IJ3C 3APDA 3GGWB 3T4AA 2KQMA 3CBJB 4HSQA 4PBWD 3TC9A 4CC4A 4ACPA 1Z9FA 4NFCA 1ZHBB 3BPNB 3G5ZA 2D7MA 2VDRB 1SYGA 1HE8A 3QUGA 4NXKA 4OAWB 3VE0A 4DP7X 2VIRB 2E5LL 1BXXA 1MN4A 3IFOA 2H5XA 15C8H 2J6WA 3VXTA 3NJMA 4DGVH 5D72H 5TQ0H 4ZS7L 7PCYA 4GRMA 2OSWA 4TNGA 4PJAB 2FBRA 4LHUA 4Y16D 4FTVA 2ZXGA 1BFTA 2NY7H 2F5BH 1G7JA 4YBLC 4U2ZA 3FRUB 3OKEB 4FQCH 4K94C 4MQTB 4Y4KD 3D0VA 2XN9B 2HX8A 3UEQA 5DVKA 2LY7A 3CZSA 2ZKHH 3DUHA 3FJTA 2AEIT 1PZDA 4TQEH 1UA6H 1A6ZB 2DYPB 3GBNL 1JZ3A 5BRZB 5DEHA 1A4AA 4IOIB 3OR6B 4XP6L 4X83A 4R8IA 2KVMA 1U8QA 4Y9CA 1RCVD 2WFWA 4OELB 1Q82C 4NQEB 1MHPH 5C08B 4U7KA 1W3SA 4KHVA 5J22A 3AG1B 3H9HA 3IDIB 1A3RL 4KK9D 1B6DA 5LGKA 2RCNA 4NRZA 3NPSB 5G5DB 1EXGA 2D9CA 4WTWA 1G1CA 1AO7D 4X5LA 2OTWB 5GSRB 1BFVL 4TNWF 2C7FA 1Q3LA 2J8UA 1L0QA 2QR0A 3E8VA 4BH7A 3KYKL 4UDUB 3ZLQC 4JPVL 1PDKB 1LDPH 3EADA 4JDVA 3VRLE 8FABA 4HCEA 3ZKSD 4LUZA 1QNZH 1SN5A 3MPCA 1TT6A 2Q6WA 3P4MA 5D5MF 3TFBA 1IM3B 4NQCB 5CZVH 1IW7D 1I85A 1J5DA 4ZOCA 3P30H 3CVHA 1DFXA 2J5LB 1EEZB 1JHLL 2CSPA 2A4CA 3ARTA 5EUKA 2VRAA 4DO4A 3V5KB 4F87A 3S3PA 3QS3A 1SFDA 3QJFA 4QTHA 3H7BA 2H3NB 3W5NA 3B4NA 1NANH 1RFDH 3C5XA 1FZMB 2YC1A 4HMDA 4B3ML 4OI9A 4U1HB 5C0AD 4A2FA 3BCDA 2UX7A 2L0CA 3MRHA 4H8HA 4FQXC 3DX4A 4E6IA 1EOVA 1WCMH 4GEIA 4P59L 3VI3A 4NXNQ 5BOZG 2X6AA 3M4PA 5IBUG 5HHVH 3GTGH 5KYIA 3QEUB 3KLHD 4WFED 1QEWA 1FLTX 2UUCL 1S7SA 1V3MA 3CVIH 4K3GA 3V4UH 2FR4A 1DBML 1TITA 4MA7H 5IP9G 4AQAB 4ZTOL 1D7CA 3PXHA 4H8UA 3LQAC 5JHDE 4PCYA 5IQMA 3EGDA 2OMBA 3M7OA 4L4VE 2OYLA 2QW7A 4ZFZA 1MIMH 2XWBA 5L6YH 3ZGIA 1D6VH 1Q46A 3QIBC 2D4FA 5CJXA 3RGVA 2XGTA 2NVQH 4XB7A 5J11B 5DHVH 2MEJB 2ALYB 2YWZA 3EQLC 4A2GA 4AL8C 4AZ8B 2R0LL 4Z0XA 1S9VA 3ULUH 1BP3B 1QRKA 4ZUTA 2B2TC 5E6UB 2PXYD 5IYCH 1S8DA 4APXB 1B0GA 3NACH 2SEBB 3EKCA 1T21B 3ARDC 1SHWA 4O2FA 3NMEA 2L4NA 4OLXL 1J8HB 1F11A 3RKDC 2ZUQB 3CCLA 3MAWA 2EDEA 3LZRA 5JOEA 2DWDB 5C4JB 1M71B 3CVHH 3RY6C 4FNSA 3CSPA 5FHAH 3T0XA 1C7SA 2AQQA 1E0BA 2NQ3A 1UXWB 3U7WH 3SDXA 4D3CL 2NY5C 1ZA6B 5FYLH 1HESA 3BE1L 4P3CH 2NUTB 4N0RA 3QJHA 2BH8A 2XRAL 3HCVB 1I9EA 5F2FA 1SM3L 4BHUA 4IUNA 4YIJA 2EXWC 2ZCKH 1L1OA 3S36L 4PY8I 3WKML 1SBBA 3HEJA 4MFHA 5FM5O 1NCOA 1K9TA 4M6OL 1EIBA 4Y7OC 3ZHDA 5MI0C 3CVDA 3K5RA 4CJ0B 4EX5A 4DR5L 1F5WA 1ZIAA 2BPBA 2YD3A 1BSIA 3H8NA 1I8UA 3H3VC 1OM3H 3JYBA 4XR8C 2X38A 1DUYA 5EU6E 3MWYW 3S36X 4R5VA 4HJSA 4IBLT 1PZAA 1DQDH 3PGFH 2ARJA 1JYXA 2YK1L 2PWEA 2YPKA 4R7VA 2NLJB 4N0UA 1NICA 1P1VA 2O6PA 3B7YA 2MNJB 5D7IB 4JBMA 3FO1A 1FNVA 1DONA 4K5LA 3SPCA 5C0ND 4L23A 4X6DB 4Z95L 3NSDA 4DN4M 3LZFH 4LRNH 3FTWA 2FINB 4FQJL 2IHFA 4DT2A 4G6AC 1A2YB 1CZWA 2NDGA 5CLXA 4JFQB 5D6DC 1ICWA 2PPDA 5HDQH 4RGTA 2WKOF 3Q2NA 4H7VA 2YZ1A 2XTLA 2Z92B 5LGJB 2QEJA 1CQKA 4CJ1B 1NFIB 1HQRB 3D39B 4IYKA 1U8KB 4GLXA 4XPHL 2G0LA 3KPLA 5E9NA 3FTGB 5EOTA 1S5HB 3WN5A 4TLSA 3K0XA 4YLBA 3TNMB 2BH2A 1DZ0A 1G7QA 4PTTA 5D1ZA 1T04A 3DLLA 4MA3A 3RDTB 2D3NA 1AFVL 1Q1JL 4XNXL 3ZE2F 4OFYD 3F62A 3IJ7A 4HKJA 1NMBH 5KYYB 5IVZB 1QBLL 2ITCB 3ZE0B 1NOLA 5IQ9B 5J1SC 3WNKA 5FUOH 1YQVH 2X10A 4BWTA 3KVDD 3M46A 4MDIB 2K1MA 3S17B 4FF3A 3H6AA 4KKLD 2VLRD 2J1XA 5B3JE 5F9WC 3BFWA 1LM8V 1W8OA 2DI8A 1JUFA 4PRPD 4C4UA 3UZEC 3MNVB 1X6LA 4FZEH 4NZFA 5HHXH 1KCLA 3OWRA 3KNBB 3W0WD 3MJ8B 5IEKA 5CU9A 4YSDA 1JHTA 4DKTA 4K8RL 5LBGA 3VWJC 3HFZB 5BMFL 1EHLL 4KZEH 3HKZA 1AMYA 3NRFA 3QUYC 2VQUA 4GN5A 2Y2TA 2PKDA 2UX6A 4CUCA 1B90A 4H0GA 1GHJA 3L2MA 3MTRA 4XNQA 1GJIA 3NFNB 2OMVA 1ZSDB 1UH4A 1SNQA 4JFFD 3SIKA 4E9VA 1HINH 4XRCA 4P4KB 1WTLA 5K59E 4GG6B 2IBBA 2YPLE 3X12A 2EYOA 1OAUH 2WBXA 3QDGE 5KG9B 2RQ8A 1DEEB 5ESQB 4YX2H 2JB5H 4LPXA 3QFDB 3KJPA 5ESVB 5G4NA 1QVGA 3U50C 3SE6A 1PTOH 3VFMA 2A38A 1CU4H 4FAAB 2C9AA 3BMWA 1DVXA 1GH7A 1LK2B 2QSQA 3MXPA 2GSIA 5EOQL 2X6GA 2E2IH 3S3CB 1V54B 2EXDA 1BVKB 3TBYA 3C6LD 2RJMA 2FQEA 1JC7A 3QCVH 4WDIB 5IV2B 4DEWA 1U8NA 4XPTH 2YHGA 3CFNA 4N5ED 4IDJH 3S6CA 3OJVC 5DD1H 1IHZA 3OZ9H 3PWVA 2ZKYA 5LBSL 3AM8A 3B2DC 2R1YA 3L16A 4E68A 1O6SB 1C1EH 2D31B 4NFBA 3PP4L 1IQDA 5HDWA 2BLFA 3BZ4B 4BBSH 4WO4B 2BIPA 1OHZA 4N20A 2EADA 2RB8A 4FP8H 5F1IA 5CCKL 4I5BB 4FHBD 5A3IC 2PO6A 1FIGL 4AE1A 2IQAB 3CMAA 3DIVA 4WAFA 4PS4H 5D1QD 3G48A 2B20A 4OD2B 1F18A 2WY3B 3MNMA 5D7SH 2BMKA 4PP2B 4E0RB 1DL7L 1T03L 2C34A 4CDFC 3BQUA 3HKSA 3EH5B 3HG1B 1J0ZA 3HOZG 1TOXA 4Q52A 5DD3H 4OX9Q 1VQCA 3KWVA 2FBOJ 1ZLWK 1T9HA 1HTLD 3QCTH 2EE0A 2ZAHA 1QFPA 3TT1H 3QJSB 4LQFH 1IZ6A 1OD9A 1BECA 1LTRD 3NRQA 4P04A 1OK0A 3RTQB 4GRLC 1WBZA 4MS8D 4WY7L 4FULA 1YN6A 2AXFB 4P2RD 1XX8A 5D7LE 3KCPB 3MBWB 3A24A 1RIPA 3HN3A 3UAJC 1DCZA 2K78A 4FYDA 4TQIA 4WV1B 1W72L 1XBRA 4OCSH 2JF1A 4EBQH 3VG9B