3K6OA

Crystal structure of protein of unknown function duf1344 (yp_001299214.1) from bacteroides vulgatus atcc 8482 at 2.00 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
TVTIAMATVEKQPQYDAPYLVLDNGEKLWVVQHIVPYRDLKAGERIFGNYSFLEAGESGFAYNIRLNDYTLVPVQKIIGLNPDNMDSIGNMKVQIKDMWPSDDYLNVRFMLNFPSPQKPILNLVVNEMIPWTKDGYAHLELRYNNNGSQGRLVPGMVSFKLDDYSPENSELKGIKVLVNPVDGEEKTYIFSYPLTGEDVPGFNPLDLAELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein DUF1344
publication title Crystal structure of protein of unknown function DUF1344 (YP_001299214.1) from Bacteroides vulgatus ATCC 8482 at 2.00 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Structural genomics, unknown function
total genus 44
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3k6oA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3k6oA02
4PQXA 4J8QA 3K6OA 3NQIA 3K0YA 3QWNA
chains in the Genus database with same CATH superfamily
1DOKA 2PW1A 3PJSA 1BEXA 4H26B 4JKPL 4DP9X 1XBRA 4YFEA 1GC1L 3KBPA 3PUYA 5IYCH 4QAWA 5KSVA 5KYUB 4FG6D 4YSSA 3DROA 4N0RA 5CWSA 1WZLA 4WI9A 3OC5A 3QUYB 3S4SA 4LF6Q 3W82A 2PTVA 4DKAA 3LY6A 3VWJC 1NMBH 3FTGB 1O5DT 1OF2B 3WIFA 3OF6D 1QPPA 4GB9A 2H26A 3CV5A 4P59H 4AL8C 3KLSX 3VD5A 5KVDE 3QI9A 3HB3C 1IFRA 1AXTH 2PLTA 4XCNB 5D7JD 3RX8A 3VCLB 1JNHB 2AQTA 4EQPA 1VCAA 1JRHI 3IAYA 1I94Q 1RPQA 1FDLL 2BX5A 5T5FA 2V4LA 4Q9CA 3MV01 3RKDC 1YEDA 4Z3FA 2B2VC 1A3RL 2X28A 2BNQB 4KI1A 1FGVH 3QNYA 3H9SE 2V9TA 4OCRL 5IW3A 1VQMA 3NPPA 2PYFA 3TEUA 4Y5YA 3QEQB 3BCFA 1RTOA 3LNHA 4PUBL 3EIFA 5DJ0B 3ARFB 1LNUB 1N6UA 1OQXA 4ZAIA 1NCGA 2VO5A 2XI9A 3DJTA 1G9HA 4LCCB 5I5RA 1YNKH 3C6LC 1JOQA 1E5ZA 5I6NA 1O78A 2EDOA 2WQWA 4P2RE 4O2EB 5CV4A 4WTZA 5F3HA 4ZYKA 3TFKD 3ULUC 3BRGC 3RI5K 3FHWA 3J80E 4NO5B 3CU7A 2F8IA 2OSYA 5E8OB 4FAAB 3OWEA 3EHBB 1ZKOA 2PZTA 5HYJA 2ATAA 1URZA 3HHMA 4HX1A 4KZEL 2JTDA 1KSRA 3Q0AA 2DDQL 1YEKH 1E1OA 1I1YA 2YN3A 2B1HH 4MA7H 4TSCL 5C0DA 3SQBB 4EF3A 4HLEA 4IHBA 3HG0A 4QXUH 4HKXB 1ZGLM 4HFUH 4OFYD 3ZOAA 2F7RA 3J7A5 5IEKA 2ZXDA 4FEIA 1NEPA 5HDBB 3VXSD 4PREA 4RMTA 2Z31D 2RCSL 5E99L 3MBXH 1GZQB 5JO5B 15C8L 1ROCA 5FYJD 3LV3A 4KKCD 4N5EC 5IUSA 2OMUB 1JZIA 1YPZB 2J4XA 3LEYH 3AZUA 4EQNA 3BPOC 2K78A 1MW2A 5DJZA 4FZEH 1XMQL 4IRZA 4YSDA 1G6RL 4HV8A 3WFHB 5F8QC 2H0EA 1G94A 5CSBA 3GTMB 1SN0A 1OT2A 3UO1L 5B4MC 2X4RA 4JY5L 2RDGA 3PSIA 3WDJA 4DUZL 1FIGL 4WSGA 5F1OB 2MQCA 4IK6A 4JFEE 4XMTA 2N3JA 3CXDH 2XWCA 3MGTB 3MBEC 2YLKA 4ZMQA 5JXAL 2K7VA 1I85C 5SWZA 3LS4H 3C5SB 2PQAA 2VJ8A 4GUQA 4QRTB 5DRWA 1EY4A 4F3FA 3ZYZA 4X3TA 4MNQB 1DUZA 4QKXB 4TUUA 1KEMH 4AM0B 2XTJC 2AI0L 4DHLA 4YXLL 3LKQB 1MCBA 3VD3A 1U8QB 3QO2A 4M6OH 1NPJA 2EDQA 4G7VH 1DL7L 1W72A 3HGBA 3AUVA 3GLAA 1C5DB 3IJHB 1A0QH 1AGBA 5DEHA 5E9AA 2F0LA 3TBVB 3JV6B 5JIPA 2COVD 3IDYB 4Q58C 2BCMA 2FXQA 5IQNA 4I3RL 4CNIB 1QB5D 3UAJD 5G5DB 4MXQD 3CHPA 2DL9A 2DUDA 3EIVA 4WO0A 4TUOB 4UTAA 3PHSA 4V1DD 4N0UB 1HCVA 4PWFA 3GEFA 4YDKL 3O0RH 2WVTA 4OZFB 4N8UA 4NQSB 3QR8A 5D6CA 4D0BA 1STAA 1MREL 4XPGL 4B95C 5HY9B 2VZVA 4DAMA 3A67H 4PW4A 1A66A 1XJVA 3D3VA 3TYGL 3IAGC 2KVMA 5ESVB 5JIHA 1FE8H 2R7EA 3VU2A 2HLFD 5EULV 3ARBD 1HNYA 1NCOA 4KI5D 4TRPL 1CIUA 4XBGB 1UADC 2D31A 3BAEL 3QWRA 5GRVK 2A0LC 2BXZA 2Y7LA 3IPFA 1G9MC 1S9WA 2HG0A 2DM4A 5E5UB 1NPUA 3VGDA 1KQSA 5CD3A 4LEEA 4EDWH 4YDIL 2FX9L 1INEL 1LTAD 4XP1L 2NVXB 4B9ZA 5IQ7L 5E08H 2K4KA 1E42A 4KRPC 3PWVA 5FFGA 1OAZH 5HGBB 4AM0Q 1TJIL 4N6QA 4A39A 4IS6B 4DEPC 4HHAB 2AEQL 4TSAH 4NQDA 4N26A 1DVFD 1LL1A 4YE0A 5TD4A 4EQOA 4Y9FA 5DRNA 5E00A 3PWNB 4GKLA 3T3PE 4X6DB 1UQSA 2PYEB 5IB5B 1DQML 2HDMA 3L7ZC 3ZDYB 4QR7A 1Q8MA 3L1GA 3GXMA 3GJFB 4DFAA 1SMAA 4NP4L 1DLHA 2DI8A 1F90L 2XG5A 3NRQA 5JJIA 4K8RH 4UF7C 4IRJA 3CPLA 3TL5A 4AXWB 4JJOA 1RU9L 2FFKB 4DR4Q 2R56L 4JI4Q 3GKZA 1CDHA 3D33A 3K8LA 5EU7E 4JQIA 3TIEA 4JI3L 3S14B 5ISZA 1D5MB 2O5ZL 2JXMB 2ADIB 5HGTA 1S3KL 3IU4L 1SYVB 5EF2A 2L15A 2UZXA 3HOYG 4BKTC 4JFFB 1XWVA 5JIIA 4JFHD 1DO5A 2BA0A 1MI5D 3SO5A 4QXGH 2ATKA 2WWMD 3RJDA 5F9JB 5DURB 4JI2Q 3VACA 4RNRB 2FO4B 1N32Q 4LFHG 4M6AA 2Y5TB 4ZJ9A 1CT1D 5CBEB 1UWFA 1Z7JA 3FO2A 5EEZA 1QLFB 4R0LB 3ZTJG 4HCSA 4FTVB 3TBTA 4ELMF 2N1KA 1IKNA 4BSJA 1EO8H 1A3LH 2CRYA 2RA1A 3ARQA 3KPRB 4UDUB 3UXFA 3U0PB 3UC2A 4F2FA 2Y25A 4GEIA 5F9OL 4HA1A 4R4NC 2DQUH 5D6DC 2NR6C 1MKHA 5L2KD 1OIOA 2CDEA 1J5HA 4ETQB 2YZ8A 2ZT9C 1I31A 1ADQH 1R3KB 3ZO0A 1CF8L 2Q8TA 4Y89A 3S96A 4PG2C 2K5QA 2CNZA 5IE8A 4LFCQ 3I4NH 1IILE 1PH5A 4XP9H 3OHXB 4FF3A 4CVZB 1SDAB 4KRLB 5K59E 1FVDB 1NSNH 2AHOB 4WKZA 4G8EA 3KPQB 3V0DA 3HE6B 2ZYSA 5I66B 3WY3A 1ZLSL 3M1BA 3R06B 3NIDB 4BY7B 2XXFA 1YEFH 4MCZA 5H35A 4LVHB 4X6CB 3WNIA 5A3ID 1S9YA 4JI0Q 4LCWA 2BHYA 3GUFA 1QBML 4LARH 5EU6B 3ZYIA 2MOGA 2E9BA 2PQEA 5HGDB 4BRVA 4WSJA 4XYOA 3CBRA 4FQQA 4RISH 1BWWA 4WUUD 2HJLB 3Q8AA 1Y0LA 1OCWL 3QJRB 1J6QA 3GSRA 4L8CB 3P1VA 1BZ7B 3SBWC 1IGIH 3BJLA 3QUYC 2B2UC 3E9HA 4FLQA 3VXUB 3BLBA 5LN8A 1NKRA 2DQJH 4LUVA 1A22B 1AFVH 5F7FA 3STZA 3VFWA 1H9RA 2HXAA 4HS8H 4NT6B 5D1ZD 4HIJB 2XN0A 4IOSA 4QHMA 3QUXC 4JX0A 5HP5A 3TM6A 5EBCA 3WAKA 4BKSC 2Z9TA 2JIXB 3BWAA 3RFZB 3DTDA 4DZ8A 4AH6A 1R6VA 5J1SC 2H2SC 4XRCA 3WO4B 5J13C 2AF2A 2KQ3A 4L6TB 1U4LA 4GI8A 4UCFA 5IHZA 1B1ZA 2P28B 3A5VA 2DYPD 3DDGA 1W72L 4LHJB 3ARFC 1PS3A 4Z7NB 1PA6A 2YEZA 1SHXA 1QI5A 2ZUTA 4IQHA 4R3SA 3AABA 4YQXH 3SDAB 1VQNA 1EEYB 5CCHE 5CBAA 5IESL 2X0VA 3MCLH 5IF0A 4JMXA 2H3KA 3SJVB 1N6QL 2ORBH 3QJSB 4UTAL 1MCWM 1CUKA 1NC2B 5CP3H 4CJ2C 4ODUA 1OOWA 3ASWA 5DJXB 1PY4A 1SUHA 4WY7H 4MRCA 1T1ZA 2O5YH 1MF2L 5TSSA 3I4LA 1P5VB 2VITA 2Y3NA 1JI1A 3KGTA 2JK8A 1S7RA 4XVSH 1P0SE 5CS7A 1D5ZB 4I1RA 3VG9C 3WN5C 3K5NA 3BQUA 1S5FD 2YD6A 5K1JA 4F8MA 4AYID 1A9VA 1B0WA 3AY2A 2WNXA 3M7OA 1ZAGA 3OC8A 1XF2B 2YA1A 1M53A 5MEQA 1PDKA 4WJ5B 2EJMA 4PB0H 3TT1H 1LDSA 1MI2A 4IKNA 4OM1L 4BA1I 4M3HA 1PZID 3KLRA 2ZP9A 5JLZB 5T1IA 2DQEL 1Q72L 1X9NA 1CA6A 2XA8H 4FQHB 4QMEA 4UTCA 5TDOA 4JYAL 4WDIB 4PJFA 4DF9A 1H6FA 3AFLA 1LMIA 1DANT 4IRSD 2B8GA 4O2FB 4K6LA 2N4IA 3M1OA 3MRKA 4BY1G 1EPFA 1HH9B 2YKLL 5FW7A 1L7TL 1SLUA 2VR4A 1CL7I 2EUVA 4K7PX 5KOVC 3U50C 1KGCE 4YFLI 5FA4B 4XN4A 4ZOAA 5CLWA 3T3MF 4G5ZH 1LE5A 3KXFD 5HVWA 2CDFA 3FQUB 4XWGL 3E3XA 1HHIA 3J07A 4NENB 4ZSOB 4RRPG 3EO0B 3ZE2E 3IDYC 4PLJD 5H4YA 4XTRC 4JQIL 4WGVB 4PJHE 1MNUL 2YSSA 3IFPA 1R0AH 1OGAE 1WBZA 3AT8A 4FDWA 5ALCH 2K45A 3QDHA 2XN9E 2YOAA 1QNUA 2X4PB 2E7LC 3NT0A 3PAYA 2A6IB 2WOYA 5E0QA 2O26U 2AK4B 3T04D 2G0LA 4YVUA 5LCVH 2R29H 4JHAL 3ZDWA 3A23A 3S37X 3AB0B 3P1HA 1DGSA 4PWGA 5T33L 3GTVA 4MAZA 4X0KB 4C1NI 1I9IL 1CFQA 1N59A 2HG5A 3H9ZA 4OCNC 3WEMA 1CFTA 4BKLA 2O6CA 4FF1A 5IQMA 4U6YA 4MHEA 1O7YA 2F0VA 1NEZG 5L2JB 3S1NH 3H85A 3CMGA 3QP3A 1AKJA 2F2HA 2JA6G 3H56A 5DD1L 3MJGX 3OSVA 1LO2H 4YBQD 5K9QI 1CM9A 4OX9Q 2EYRA 5KG9B 4RX4D 3DMUA 4ZRGA 5GGSY 2Q2EB 5TQ2L 1AXSB 3FTGA 3GO1L 5EZLB 2JA7G 3S9WA 4GXUM 1F3DH 3WTTA 2ZJRA 1I1AC 4UIKL 5C0ND 2XUWA 4WFFE 4YVNA 4PJ8B 1VEOA 2SDFA 5DWUH 1OP4A 5IM7A 1SNMA 4HUMB 4DGWC 2EEDA 3GSQB 2EEBA 1Y6MR 3MROA 2H8PB 2BFGA 5T3ZL 4JJ5B 5GSRB 6FABH 5IFHL 3DX0A 4F8PA 3RWEB 2GCYB 2YMTA 3DTXB 4ZUTA 4P5KA 4ZPTA 4ZBJA 4NWTH 2DJSA 1IQDA 4GAJL 1WFQA 1KG0A 1NBYB 1S9VB 2ALAA 2ZCLH 1CR9H 4Z0XB 1ESFA 5EEXA 2BY1A 1I9JH 4BZ2A 2YBRA 2ICES 3KUPA 1SM3H 4P2RA 4FMKA 4TMPA 2F18A 3OZ9L 2XKUA 4HMIA 2NNXA 4XCEB 1V54B 4TQEL 5DMKA 2YWYA 3QORB 3ECQA 1G5AA 4YHLH 5C97A 4P5RA 1AE2A 4DTGL 1E40A 3NSFA 4WFGE 1EEID 3KWXA 4HCRA 1I6VC 3G08B 1L9SA 2DY2A 5EO9B 3GMMA 2MTAA 4K0KL 3H4HA 1VQFA 4OCSL 4KKLD 1SMYC 4RMRA 5CEYB 1QTPA 3C3LA 3N40P 4PLKC 3V0VB 5KSAC 3MJ7A 3GRBA 4R97B 3ECWA 2CCVA 2NX5D 2XQYA 3L3KB 4UDUC 2PPBC 1IBML 3I3DA 3LKRA 4RGNC 3U2IA 2DKMA 4Z7UF 3O11B 3MXWH 5C0EB 2EYHA 3PHQA 4XMLH 3BKYH 3NFPA 4XNMA 5ACZB 2KHJA 1Y07A 3CWGA 3VG0H 1YNTA 1QR1A 2VZOA 4Z7QE 4WWKB 2B3IA 2JELH 2ZTEA 3D0FA 2WKOF 3TWCL 2IPKB 4LCYA 3V5HB 1SAPA 3FKIG 2MFNA 3OHXC 4Z3EA 1EQQA 4HWEL 4RKLA 4LVOC 5JXEA 1RULH 4H88H 1KPUB 3FYIB 1JWUD 2EYFA 1WICA 1A7OH 3L9RA 2NY4C 5FK9A 9CGTA 2D9QB 3HE6C 1IEHA 3JUZA 5AL8A 1IXRA 3L2NA 3U46A 1H5BB 3TJHC 3K80C 1XCQA 3S15H 4G72B 3OTTA 5JDSA 3VR6A 1NLDL 4DZBB 3VI4E 5KVFH 3N43B 5IVXE 2B9AA 2WBJA 4C8XA 2ZP8A 3I9PA 4POGA 5KBKA 3CVHH 1MFEL 4E0RA 1P4IL 1T04B 4PJ6A 2X4UA 3EJQA 2A19A 1A0IA 1DJWA 2QLYA 3GTQH 5G5DA 1IX2A 4H1LH 4U4IA 1VCIA 1G4MA 1YN7A 2DH2A 3B2UC 4JLRB 1IKFH 2J6EA 3BP6B 3C9NB 1CGSH 3Q8BA 1JGDA 2CQAA 2L3BA 4JZJC 2LE9A 3AREB 3QIWA 1MRCH 2R2BB 5C1MB 4H7VA 4JO2L 4N0CC 3QK0A 3B6YA 2MFIA 1FJ1A 4MZIA 1LM8V 3DWTA 4LF6L 5GAHC 32C2B 3MLUH 2A6DA 5ESVA 1M9WA 2YK1L 3RFZC 5M5XB 3Q01A 4S0HA 1MFUA 2O6FA 1U4MA 4PAZA 1I1RA 2V1CC 1FNEA 1NCAH 1Z32X 3HW7A 4ICWA 4Y2DB 3WO4C 4HJ7A 1KJVA 3CXCA 3G6JE 3WFCL 4HJ9A 1MW3A 3TRZA 3EYOB 3JTBA 3RP1A 1UA6L 2WJ7A 2JJTA 4PR5B 5EC1B 1V7NH 1I94L 3O3EB 2NSXA 4P2CG 4NSKA 4PRHE 2XSCA 1ML0D 2W9EH 1XBDA 3CBJB 4IMLB 1SVZA 4HEPG 3V4VH 3TA3D 2VB2X 2D7MA 4OJYA 4O4YL 2YR3A 3B2MA 3G5ZB 2OTWA 3GHEH 3P54A 4RMFA 3OMCA 4HWZA 4EI0A 2E2HB 2XV2A 1C12A 1S3RA 2ENJA 1DSWA 3CHOA 4XH2B 1VQAA 2D4DA 5IP7H 4NPYB 5E9DB 3ZR5A 2YPLD 5FECA 3VD7A 2O30A 3MO1A 1T1YA 2PYEA 5DUBA 1TITA 1WZAA 1U4PA 5BVJA 4QRRE 1D5ZC 3ME0A 3NN8B 1JOOA 1BSIA 4P57A 4FFVD 4O0AA 1T0NB 2F54B 3T16A 2AAVA 3FQTB 1IAIH 3LN4B 4GMSH 1AGEB 1BVNT 4I2XE 4QT5B 4X3SA 1PKQB 2A68C 5D7LA 3MTRA 3FCSA 3PPEA 1BX2B 3WNPA 2Q8RE 2NDGA 2NY0C 2NVTB 5KAQG 1RSYA 1CB4A 2CH8A 3Q8CA 3IVKB 3T0EB 2KCMA 1KCUH 2NY3B 2OT2A 3J7HA 4CMMB 5IBLD 2QVFB 4LVNC 3J80c 3VA5A 5EBMB 3ILPA 1N10A 1U0LA 2X1PA 3SKNB 3QJZA 1AR1B 3BUDA 3CDZA 4OGYL 4RZCB 1KXLA 5E2TH 3KCWA 3J81j 3WKNA 1A4JB 2XJKA 4H5SB 2BS8A 3VTAA 4C56B 4XQJA 1HX0A 2YD1A 4RIRB 4TNGA 3V0FA 4DWHA 1O6VA 4O58H 4TUKL 1FL0A 1UE6A 3L45A 2BSRA 4BIKA 4JO1L 1TZAA 5ADOH 1XGRA 5TH2A 3P9MB 3STLA 1KCWA 1J8HB 4KNQA 3FT9A 4BH8A 3X1EA 1FIEA 2IPUK 3MMEB 3F64A 1J48A 2BVOA 3BP7B 4MA3A 4R4FL 4ETQA 4Z7WF 4W70A 5JPMA 3J7AF 4NQCE 5E4WC 2HTKC 5GROA 3QJHB 2P45B 3SB3A 4KXBA 4EQ3A 4K23L 1LTTD 3KGUA 3VR3A 2CO4A 2CJUH 1KF9B 4YDJB 4J6RL 1Y18A 5D7SH 3WNJA 2AJXL 2J56A 5H94A 1U3HB 3AB0C 1VF5C 1UZ8A 1H8OA 5A35A 2OMVA 4LQFH 3O45B 3FHAA 5LGJB 1GS7A 1DM0B 3IXAA 3UTQB 1BVZA 1ET9A 4ZG1A 4P2QD 4P75A 3OX8B 1KB5B 4XMKH 3RGVC 1NWOA 4L3EE 4R8IA 2BZDA 4P9HL 4ZW8A 4DEWA 1R3IL 4FXTA 1S78C 1QBLL 2WKCA 4OONA 2VZ3A 4ORGA 3SDDB 1CURA 5I1IH 3IGAA 2E9IA 2E8YA 3HZKB 4M3KB 3TP6A 4XX5A 5ITFB 2CM5A 2FYYB 4K94H 5H2BB 5C0AB 1F2XK 4IALA 5F71A 1DE4A 3UBFA 2IJ0C 3NACL 3BUYA 1PLCA 5L8LB 2CJ3A 3QPQC 1QYGH 3HG1B 2YXMA 3VO0A 1CSQA 2R0ZL 3D5OF 2E5EA 4ZFGH 3MJ6A 3NIFF 4G6ML 3KWTA 3MHZA 3FXIC 4W1TA 4A7TA 4EMZA 1E5YA 5IGCA 1XPUA 1L6ZA 4K5WA 2YD3A 5TE6L 3EOBA 4NC0B 1XPOA 4QAMB 5D5MA 4PV9A 4MCMA 5D1QC 4IDJH 5F9WB 3GTOB 5DNFA 2OW7A 3DRQA 3ZYOA 1N5YH 3OGOE 5ITBH 4C3HB 4ES8A 2Q2LA 4JRYE 4LO9A 5FCSH 1ETJA 2BNRE 5CLTA 4W9ZA 3AT0A 5JIKA 3QWQB 1JPGA 4NCDA 5IP9G 1PFSA 5F88A 4QO1A 1A4CA 3QAQA 3AMLA 1UB5B 4DAYB 3FT3B 2J6EL 1UJ3C 4M56A 5IMMB 4S1SL 3LGJA 4ABWA 3VRLE 3NRPA 1ILQA 2L55A 4QF4A 3C2PA 4JI4L 4DR4L 1DANU 1T83A 3EGXB 3EG9A 1M05B 1IJNA 4OLZH 1B9KA 3DEOA 1G6PA 3KM2A 4G8FA 2V6HA 2LSSA 3OKNB 3FU0A 4HS6B 3PG2A 4XN1A 3ZR6A 3T71A 1CLZH 1HTPA 2BWQA 2J71A 3BAXA 3W2DH 2W8CA 2ZPKH 2A9MH 1DFXA 1WG3A 2IH3A 3OR6A 2QR0A 1JE4A 4U1GB 4YWGL 4NXNQ 4NZUH 1SDDA 3NIGE 3VD9A 2FCBA 4KU1A 2JJSA 3CRKC 4JI2L 4R9WA 4NO2A 2F19H 2VC2H 3LKSA 1N32L 1DQQA 3B6SA 1WBXA 5GZNC 1SZNA 3FAWA 5IQ9A 4F8NA 2EDBA 2RFXA 4PGBB 5IB1A 1Y6NR 4MX7A 3T1FA 4FQ1L 4WWKC 3WNMA 4JDTL 3P30H 4A2EA 2JP1A 1E27A 3HP3A 3IS0X 5C0GA 1AY1H 1RIHH 1F6FB 4XNYH 1SE8A 2NY5H 3RDTC 5ECJE 1CBVL 2H1PH 3CC4A 2W9DL 1IGMH 4XXWA 3HOWG 5AZEL 4OLVL 2EDJA 4JDVA 1TIUA 2QVTA 2YAQA 4ZX6A 1H5BC 1IZ6A 1Y1DA 2I5YH 3GSXA 5E2UL 4KDVA 2AGJH 3CCEA 1CYXA 4DO4A 4LFCL 4LLVA 3N41F 4NGHL 4QHUA 3VFRB 5L6YL 5LAXA 5DA4A 4MKMA 4G82A 3D7PA 2YMOA 1BBWA 1QZ1A 3MRLA 3ULVL 2IAAC 3K2IA 1ZK9A 3TN0C 4U7SA 1I7UB 4IPGA 2GC4C 2N01B 3H42L 4PG3A 1SYSB 4J23A 3LSOA 1S7UA 4JI0L 3APMA 2APBA 1JV2A 2XN9A 4ALAL 3HNSH 4HUVB 3IDIB 1AI1H 3IDNB 2N3SA 2NNFA 5FUCC 1FH5H 4NNYA 1QFHA 3RIFK 3AREC 3V7AG 2P52A 4UQEA 1LT6D 4NQED 2C1PB 1CDJA 2ILLA 2ITDB 5DS2A 5AB0A 2D62A 3CFCL 4YN3A 3ZVVA 1XR9B 3CIQA 1QO3A 2I27N 4OEMB 3KWWA 1X7TA 5D7JB 4ZNEA 2LY7A 1TEYA 2JJWA 4Y2DC 4MNHA 4AE0A 4X4YA 5I71B 2P5ZX 1TG8A 1FNVA 3VUAA 5ALBH 1A7QH 3FO9B 3QRBA 4GG8A 2Q8BL 2PTUA 1AD9B 3PIO3 1W0WA 2GY5A 4OLWH 3H9HA 4DGYH 1JZ8A 1J0HA 3UJTH 3F1ZA 2RD0A 4HWUA 1ZPUA 4LESA 5E8NB 2WLKA 2HFEA 3FTWA 4K3JH 4BFKA 3KYMA 3T2PA 2H1EA 1JHTA 3TBWB 1KCLA 4JY4B 5J0BA 4ACTA 3T0VA 4LDCA 3TZVC 4R8WL 4N0FA 5CCGE 1TDQA 2R2CA 2I9TA 4Y9BA 5LGHH 3PF2A 2GCYA 5EF0A 1KDCA 1DJXA 1JGLH 3VJ6B 1NDGA 4P5MA 1RZGA 4XBEH 3G71A 1EFWA 4HMEA 1D6EB 4CILA 1N4XH 2DWXA 3T2QA 3TNMA 4A67A 2FUQA 1IYVA 1QUQB 4E9VA 4TVPD 1BAFH 3S16H 3ZT5A 1QE6A 3UTPE 1XF4B 4CGTA 1W16A 4JREB 1SJEA 4PRDB 4PTTB 3VSUA 3NCBB 4GZYC 1HSAB 2VUOA 3UBXA 5LWYH 3VXSB 1NCCL 1EUJA 3T0EC 3HBGA 2Z31B 4KKAD 2Q3XA 1JWSD 3KDFA 3QG6A 1LP9E 2WB7A 2DM7A 2EH8L 4PJEB 4KHXL 3S24A 3P11H 4NMZA 5K5PA 1TQCC 3CXFA 5DHVH 4I0PD 5J1TC 3VW3H 3P4LA 2PPCA 2XPYA 4NJAH 1AR1C 3H4FA 2VUKA 1G9NH 3MRQA 1ACZA 4F27A 1M3IA 1TFHA 4K3EH 1J8IA 2F15A 3IDMA 1NTDA 2G60L 5M5WB 2QSCL 4M61A 4YPGA 1U41A 4KZ0A 5AVWB 4QHNA 3ARSA 5EPKA 4Y4HD 1FFOB 5K5YA 1ZT7B 3DVNB 3VI3B 1JCKA 4ZFFB 5TPWH 2MP1A 4PJFF 2RF4A 1H3TA 1G7JA 4HPYL 3P4MB 3SDXB 1VQIA 1BA9A 5HJ3B 3H3VC 1F56A 2VMEA 3NCFB 3B9KB 4ISVA 5IJKC 2X4TA 3KG5A 4JFZH 1BPVA 4YHML 1T03L 5LGYA 4EI5B 4PNYA 1OW0C 4S11A 3VXMD 4ZUJA 2LMCB 4DPRA 3PAVA 5AKVA 3OTOQ 1MFDH 4PRPA 1K3IA 1USZA 2ICWJ 4G6JH 2DGYA 4LHUD 2VXQA 3SGDH 1IGTB 3OR7B 3EN2A 3ILQC 5H4ZA 2WZ6A 4CDDC 1SFHA 5CV9A 3N2JA 3SE3A 1H3PL 2X6MA 4GN5A 2XWXA 3HLAA 3NTCH 3PUCA 1MJ7L 2I5MX 1RUMH 1Z9PA 2I69A 2RALA 3IEAA 4R8NA 1RZIB 1RD9D 3L3IA 3RNUA 1B4JH 1LEGB 3GKWH 4V1DB 4FE9A 4JQXA 3F01A 3OV6A 4NHCH 4ZXBD 2AK1L 3LPGA 5GS1A 3O6LH 4AUJA 1SJVA 3C8HA 1WYJA 5KVDH 2FNWA 3VFVA 1P2CB 3VI4A 4RWSC 1KIRA 5IVXA 3HG4A 2AXHA 4X8CA 3S34H 2B29A 1AE6L 4J3OH 2L12A 1TKWA 3UPRA 1BXVA 1XCTA 1WCBA 5LLIC 2IDQA 2B63H 2EKSA 2V2WA 2GSGB 2VWEC 4FXGB 4AYEC 1OXXK 2WTRB 4TTGA 3M8OL 3X12A 2FWOB 3R0MA 2ZKHH 1C1EH 2XVLA 3M4YA 4N24A 3NJXA 4GBXB 2C3VB 2MO1A 3GNML 3JUYA 4LHUG 1A6TB 3QEHA 4JDEA 2VZ1A 4GRMB 1DBMH 1I7ZA 1A5FH 5K69A 3BUTA 2Q76B 4F80A 4JE4B 4KD4A 3SKMA 4A3FG 1S7TB 4LSUL 4LBAA 1BXTA 2WJ5A 3MA7A 4B7IA 1HHHA 3E6FA 4LP8A 5C7XL 4LLDB 1X3DA 1BJ1H 1DVFB 2JEAI 4RH4A 2AXFA 5F1KC 3DUSA 1N8RC 4F2ME 2EXYD 3I75B 4PR5A 5C2BL 4TNWF 5CR3A 1CT8B 3FFCE 3A56A 3UZQB 1PG7X 4M6MH 1MPAL 3GEWB 1IT9L 3INOA 2BZ7A 2ESVE 3IKKA 4DO5A 3QRLA 4J3OF 5I6LA 2AXGA 1WTWA 1F2ZA 1BFVH 1ANUA 1ZPLA 2LVEA 2L9HA 1UH4A 5C09D 5GS0H 3B1UA 5BV7B 2EXZA 3D39E 1G5GA 4F57L 5IVZA 2DNEA 2A6HD 4ZQ3A 3NJNA 3VRIB 5E7NA 2YQGA 5HGQA 1EOTA 3AXLA 2AZUA 2MHAA 3F83A 3HKFA 4KQ3H 2ZJQA 3L3GA 3QUKB 3NK3A 2JTYA 4QOKA 4QRRA 4Z5RA 4B3MQ 1TCRB 4Y2NA 1T7XA 4F37F 4AY0A 1MI5B 3BH9A 3NCJH 2NT1A 5B8CA 1KJMA 1E50A 2VDOB 2AS5M 1GTNA 1O7DC 2JJQA 1O6SB 4U1GC 1ZVNA 3DV6A 1BX2A 1MFCL 1XH3A 5F7LB 1ONQB 3JTSB 1Y1WG 3V2AR 2AJ3A 1B0RA 1ZWIB 2HRLA 3ECBB 3OKDB 4L4VD 1BQHA 4P74A 1F02I 3GTKH 1PHJA 3FN0H 5E8EB 4R90L 4UOW0 1MD2D 1YEJH 4MTNA 3VE0A 1I4FA 1HHKB 3TH2T 5IFAH 1BOSA 5L2KB 1DSYA 3D1MC 1KWGA 4DGVH 1CI3M 4JGMA 3RU8H 3KBHE 1SEBB 2OMXB 5FO7B 4PMBA 3ULUE 3TEHB 3KWVA 3LNIA 4PJIA 3MLPA 3URYA 3T2NH 3QEGL 3FCUB 4KOBA 5F6IC 1NSNS 1X9LA 1XF5A 3V5DB 1F4YL 4FXKB 3L16A 4A75A 1NAMB 3T65A 3QG7H 1Z47A 4PS8A 1KIQA 2XPGA 4HFWA 3GRWL 4POYA 2VLJE 4JM4L 4LOFA 1Z9NA 4PJBB 4WFEE 5LUMA 1G8ZD 4NQQA 3KOJA 4QRPE 5E1FA 2IGFH 5CSGA 3DETD 1CFSA 3VDYA 4GP5B 1M71B 3BS1A 3P0VL 4GKOA 1JZ3A 1QRNE 4FNPA 4NQCA 4WUUB 3WEXA 2XZQH 5D14A 1VQ6A 3PGDA 4WHCA 1WBYA 2WXRA 3LXUX 4M62L 1S5IL 1A6AA 3FTZA 5HHPB 4LF8Q 4G9FE 4UM8B 1XIWB 3QRFM 1TTFA 2SNSA 4NO0A 1BYOA 4DVRL 2Q5BA 3FW6A 4JANA 3HKZG 1XWEA 4E6IA 3CKIB 3NBNA 2MEJB 3NZ8A 3L3JB 5D1ZB 2AQ2A 1ZLDA 1OXUA 2A73A 1FZMA 1UACH 3K6IA 4KJYA 4UILL 3UG5A 4ENZA 1BHGA 3OAYK 3K2KA 1GMEA 4HK3J 5EBGA 4L3EA 3JBG7 3ATEA 4LMQE 4GLXA 5GJSH 2CUMA 3QDGD 2EDMA 4DUVA 5ILTL 1XAUA 1E3XA 1OTUD 3O9WA 2M9VA 5EU5B 3Q05A 1SN8A 1I6HH 5KN5A 4XC3H 2P8PA 2XTJE 1L9QA 5HHMB 4AJWA 1XZWA 4CGUB 1NQBA 4LOUC 4E36A 2TRHA 4IFDG 3FZUD 3QDJA 3WHE0 4AC2A 2FL5B 1OB1A 2F5BL 5DUPL 5LNGA 1DEDA 5K36G 3OXSA 5DJ2A 1BG9A 5TF0A 3PQIA 2AQ1A 2B5IC 4MDJB 2ZOLB 3DUHA 3O8XD 4KUZH 3U36A 4G9DA 2BINA 1TY0A 5F3BB 1F13A 3L2LA 3QWNA 1TENA 5JHDE 3V96A 1DO6A 4Y4FC 1MJEA 5J6SA 4BY1B 3A4EA 3KD4A 4CN4A 3IB4A 1CXKA 3GI9L 5DR5H 2UXTA 3PREA 1JNNH 1SJHA 2CR0A 3KPMB 1F58H 4FFWC 5DFVC 3OMGA 1LQBC 3BMWA 5I1HH 1UXMA 1ZVYA 2B1AL 1LLRD 2XWTA 2GAZB 3I3BA 3WXVL 3W5MA 4PGCB 3KL3A 3QCTL 1ZXQA 4N9GB 4YE4H 2CKBB 5EU4A 4XHQA 5PCYA 2BSDA 3QCUH 3GPSA 4N9TA 3L3DA 4WTQA 1CK0L 2W0FB 5IMOA 3ML9A 1VKXB 1IKMA 1HOCB 2D73A 1NOFA 1T21B 3F5WB 3RL2B 3TPUB 3ZKMC 1ZTXE 2DN8A 3NABH 1A6ZB 3PO2G 2OMWB 2KEDA 1IRAY 3L95B 5BNXD 4MD4B 2F74B 2JA5B 1J9CT 1LEKA 4HPHA 4GMTH 3NCXA 2QADB 1PH4A 2XWBB 2XLLA 4FNUA 2NNRA 1RUQH 5LAPA 3CU1A 3SGJC 5I1AB 1BF5A 2Y3AA 5CMAB 1KULA 5AYTA 5I15L 1NBCA 1XD0A 4XCYA 5M3FG 5K93A 2HT1A 5AKSA 4HUWA 2G3NA 1NGWA 3B9KC 3VXRB 4PTUB 2WSPA 4EI5C 2PPFA 2ZQKA 2BSTB 4K5XA 3QS3A 3NEEA 35C8L 5CHNB 3BI9X 4FZ8L 5DK3A 3CLEL 3E1ZA 3MV8E 2DOCA 5L4FA 4A63A 4HOZA 4WWID 3M7FB 1YHBA 1HQMC 2F4VQ 2AXWA 2NY7H 1I7RB 2JH2A 4YHPA 3D87B 2KHSA 1PD0A 3HZYA 4F1ZA 3FT1A 2V9QA 1CICD 4HAEA 2KCNA 4H25B 3BP4A 4PP1D 4XNBA 1PX3A 4JG2A 2HWZH 3CLFH 4KI0A 1TTGA 2ITCA 4OZ4A 5I1LA 2WV3A 7PCYA 1CXLA 1W6WA 3LZRA 3J27A 1NM4A 5MEPA 2YRLA 3FSVA 4R5VA 3US0A 5DAUA 4DR1Q 1MN4A 1ESRA 1N9PA 4N8X1 3TV8A 5K59F 1UD6A 1NFDB 3P4OA 2KBGA 4BFJA 1O9WA 4JR9H 3TVMA 2XZCL 1N0XL 2DQGH 3DM1A 3HC4L 5I82A 4HUVA 2QQKH 1FNUA 4E9WA 4Q9QH 2CPCA 2WIIB 4GBXC 4TVAB 1SLXA 3HAEB 5D72H 3L2PA 3N04A 4XPAL 3FRUA 3G5VB 4A7QA 3ZDZE 1RIVL 3OF6A 4FA7B 3L3HA 1N26A 5CIPA 1ZA3B 5KVGE 3U4EA 3HMWH 1J5DA 3C5ZD 5F72S 1DBBH 4ZUSB 2BSBA 3HR5B 4XX1G 2CAKA 2WYZA 4P9ML 4J2QA 4MRBA 3G5YA 2CO6B 1VDZA 1RJLB 1KNOA 4EI6B 1TLKA 2QTEA 4HU8A 3K59A 2B2YA 3GTPH 3HCVA 4WHDA 1CI5A 4KGJA 3VWKA 3MV7D 1PH3A 3NCYS 4IU2B 2K04A 4HZLA 2ARJB 3WS6C 3QCVH 4BXVA 4OI8A 5C6WH 3PDDA 3QR0A 5IHUH 4MCYA 3T2OA 4WORA 1AGFA 2VXUH 4OCLC 4HWBH 1CFNA 2W38A 3TBWA 1FG2A 3S1RH 3B9VA 3OPOA 2JKSA 3HRZA 1JJ2A 1VFUA 2F0HA 3W9EA 1XB6A 2FD6H 5C0XH 3C8KB 1TS5A 1BYPA 2EZVA 1KLGD 5KYXA 1P4LB 4BQ8A 3IDJB 2B4CC 5C4XB 2LXKA 3UJIH 1DJRD 2EIMB 4FG4A 2J7LA 2VLRB 3LPWA 5C08D 3FF8A 1KB5L 4L8DA 1I3QB 4PMWA 3GSNA 4X65Q 1QUQA 2F1AA 4HEME 1B3AA 4OFYA 2H47C 3ZE0B 1T7YA 5KSBB 2JLLA 3KVQA 5J6GA 2NUPB 1F4WH 1OB0A 2BNQE 2FBJH 2Q3ZA 4XMPH 5DT1H 3KPPA 3FNKA 3QAZB 1YEHH 4DGIH 1H6TA 4X6EB 1CTNA 1S7VA 2AW2A 3CZGA 3SVMA 1LP9A 3BSGA 3MLYH 4JG0L 2VZTA 3O0LA 3U4BH 4NXNL 5CGMA 2I07A 3PFQA 3GBNH 1ZS8B 5MEND 2Z35A 2BW5A 4GLRH 1C0AA 3D12B 1T5XD 4N2OA 1HI6A 1HPCA 1PZ2A 3GFUA 2KECA 4NKOA 4R4BB 2CH4A 3AEVA 4OI7A 1W8OA 4OGAC 3MUY1 3PWJA 5CGYD 3NDYE 1K4CA 4HAFA 2Y7QA 4C47A 2WLIB 1KXVA 5ELOA 1ET5A 2ZX5A 1NTGA 3P77B 1XXGA 4KVCH 4ZMPA 1U30A 4PW9A 4YHIA 4GRWB 1EJOH 4PJ5B 2AEPH 3PDOA 2Q6WA 1CQYA 1RODA 1LD9B 1XSOA 5A3IC 2XQBH 3IJYA 4Z9CB 5B38G 5C3WA 4X66Q 2FECI 1HILB 1C8CA 4L18A 5GHWH 4GAYB 3W3AA 3SXHA 2H32B 4YGVA 5CC4A 5DRXA 5BO1H 4U6XA 5EN2B 3C12A 3SDYL 3HMXA 4KPHL 4XVUD 3UAJA 1XIWC 5E3FA 4Q56A 1YPZE 5JEAG 3LNNA 1EMTL 5GGQH 3SD2A 2IMNA 3RTQD 1YJDH 2BMKB 2DJUA 3ZE2F 4E9SA 1A6WH 2G30A 1FZJB 4WU7B 4I8DA 4PJHF 4IFDJ 4XE0A 2FT8A 3OQ3B 2WQXA 1V7ML 5AOZA 4CU6A 1VZHA 2R2HB 3VA7A 1VF7A 3AUWB 3CNKA 3BD4A 3BVUA 4I3SH 4PS4H 5EWIL 4TSBH 3ARBA 4OLXH 3TPKA 5FS5A 4JFDE 5EFIB 3V7MA 3Q22A 1AJ7H 4GQPH 2F9BT 2IFFL 4LBEB 5KYNA 1UFGA 3GTNA 4KK8D 2CRIA 2OR7A 4TLUA 4FABH 3NBHB 3T13A 4M5YL 1BQLL 4MNQE 5FM4A 3QQ9D 1ZSHA 4M48L 5IEHB 3KW8A 4DP0X 2A5HA 1CD8A 2VDPB 3MJ9A 3LEVH 1QLEB 3GB7B 4H2AA 5LBSL 4MWFA 5KS9B 1G1CA 3TA3B 3K81A 1ETB1 4FLOA 4HC1A 3VMOA 3MXNA 1UATA 2HT3D 4LIQL 4QY8B 4UQAA 5LN4A 3RNQB 1FNSH 4Z78B 4ODSH 1DDHB 2P46B 4R84A 4RMBA 4YDJA 1NZRA 5HGAA 1IU1A 3EJYD 1HOEA 1ZHKA 2WKGA 1R3LB 1H95A 5AAWA 2YPLB 2NVYH 4X4XA 1U8KA 4F2MA 1BZDA 1QQDB 1IC5H 3J81E 3ARPA 3I74A 1JXDA 5F1SA 3FFCA 2E8ZA 3RUGE 5CEZD 1QABA 3R4RA 2EE6A 4RMUA 3BXNA 4OF3A 5AG8A 2B16A 3QIUA 1SUJA 5ETUB 4AZUA 1D5XA 1X9UA 4U49A 3QFJD 4DJMA 1AC6A 4M7JL 4L8JA 1TNMA 3MGOB 3MOAH 5DJAA 4XVJL 5CGKA 1HL9A 3H0GG 1IIKA 2HAZA 2XT1B 2EE9A 1HR0Q 3JWDL 3LCYA 5TDPB 4CBZA 3HBPA 4I3GA 4M5ZH 3PIP3 3KK7A 1ZT1B 5KOMC 1OLLA 3O4LD 3P9LB 3OLGA 4RHRA 2CCWA 2GJJA 4BZ1A 3FUEA 3VWJA 3VDBA 5ESAA 1IAOB 3LOWA 4XO4A 2B14A 5SWSD 2O5XH 4PG9A 2XC8A 4MAYD 2QADC 3HEIB 3L1OH 4NN5B 1QVOA 1F6LL 2ZSVB 4MJJA 4O1NA 3DX3A 1MHWC 4M1GL 1GGCL 4TLSA 3FOLB 2R93H 4KKQA 5KBLA 1D5IH 2WQSA 5T1DH 1EWHA 3BP5B 4L8BA 4I0CC 3IGFA 3QVAA 4X6DE 4D8PA 5IW6A 3HNTH 2BSEA 2NLJB 5DCCA 3TFBA 4CADB 1PZUB 1HUMA 4KQ4L 4MQXD 5DUMH 3ETSA 3ZDYE 4JE0A 2GIMA 3IF1A 1ETZB 4A3GB 4XP4L 3SSGA 3IJSA 1TQBB 3MV9D 4XAWL 3C6LA 4V190 4QGYA 5F7YC 1ICWA 3HOUH 2R2EA 1VFBB 5D2NA 1U92A 5HYQB 4IBYA 4HKJA 5HVHB 1RFDH 3OTOL 1PLFA 4MTKA 3QQ3B 3DX7B 3PLYA 4XGZA 3ARDD 5JYMA 2IVFC 3LQAL 1F11A 4NLHA 2AJUH 2G4EA 4JFFE 4Z7QF 2Q2UA 5HHXL 3DXAD 1A47A 1TZIB 3A22A 4DKTA 1IAKB 4P2QB 5T3XD 5FECB 2CW0C 3L81A 3DOIA 2CDGB 4K8RC 1KXHA 4WEEA 5CBEE 5I76A 4YLBA 3ZZQA 1MELA 2H41A 1JOKA 4Y5XB 5FYJL 1T1WB 1BQRA 4GN3B 1DCEA 3TBYA 4Z7OB 2ATPB 5C6TL 3VI4F 2GT9B 4RGNE 4G9FA 2WKLA 5IVXF 1AOZA 2NYYD 3MRBB 2VXTH 2XICA 3R0NA 2IANB 5FLMG 1BCPD 3PWUA 1LE9A 2GJZB 2BH0A 2K6ZA 1OM3H 2ED8A 3O3DB 3WJMB 3PIQA 3NEOA 4LLAA 4B9FA 2X4NB 1F4XH 4UY8C 5HD8D 4OO1I 3O2WH 2ZKMX 4LEXL 4DUWA 3DX9B 2DMCA 2XTIA 5I8CB 1L5GA 1M6OB 5DZJA 1G0DA 2ADGB 3NIDE 2DYPA 4I88A 1U95B 6PCYA 3GMRB 2Q7YA 5AWNH 3BZEA 5EU6E 2C4XA 5IYCG 1WVZA 2A2QT 1UM5L 1YZZA 2R69L 2QV4A 4ZT1A 3G6JF 2Q2HA 1S2EA 2FIKA 3HMXL 4R4IA 3ZTCC 4DN4H 1X5XA 3FCBA 4MDJA 1T3FB 4QY7A 1N3NB 4FFYH 4ZMLA 1XL6A 1A8ZA 4CDHA 4L1HA 4DP1X 4L9LA 2GK0A 2OQ0A 5JHDA 4Z23A 2R51A 3PYCA 1J12A 5DVMA 1EFXD 1S7QB 1OO9B 2BA1A 1JPFA 4UQ3B 1LDPL 3B8YA 4LSRL 1U8JA 1YSOA 2VIRA 4KHTL 3T4AB 1NFIA 4OQ1A 2E2IH 2IQAB 1GSMA 2Z64C 2I26N 3QH3A 4B3ML 1CE6B 5BQ7A 1ICFB 3QAZC 1NCUA 4M8RA 4UT7H 3IFOB 1R5WA 1E28B 4X6AH 3WIAA 5JNYB 4RRPA 4N90D 3MKKA 1UD4A 7CGTA 4OZIB 4Z7NE 1KYOJ 3QQ4A 4EN3D 2V5SA 1A6ZA 2FEDC 4GQRA 1PQZA 4QB4A 2O5JC 3QYMA 3OSOA 1MUJA 4HC1L 1JE5A 3MFGB 4MB4A 5DZPA 1WEJH 4C83B 4IRSA 4AGOA 4OAWA 2OYMA 4AWJC 4IO9A 4JPBW 2MMXA 3SJVE 3CMAA 5F7EL 2NXZD 4X0NA 3O2VL 1KABA 1GC1H 1MRFH 2WYHA 3N52A 3KH3A 4OZHE 1BD2D 3FKUS 3HFML 3G9AB 2VN6A 5JEAJ 1YAZA 1N5AB 2B2XL 2OEOA 4LFBQ 1NEZA 2FTAA 3ABLB 5FYKU 1JNLL 4KK5D 3PQYD 1UA7A 2Z4HA 4HLJA 4LL4A 4P5TC 3KXFA 4U1KA 1I3RA 1RK0A 2H6PB 3U9SA 3SDCC 2BOSA 4JO8A 4AW7A 5BV7L 1U8HA 2VDRL 5FFLA 3NSYA 4L29B 1WCMB 5EC2B 1U8PB 2D5DA 2NCEA 3FRPB 3I6GB 1RUAL 5E6ID 1NEUA 3DX1A 3G5XA 2ZSWA 1XGYL 4YDMA 4AQ1A 3AB9A 4H8WC 1BLNA 2Q2IA 1MCEA 1A3RH 4BZ1L 4HG4J 3AWEA 3HHSB 2E56A 4HKZA 4JRXD 1S8DB 2ZWYA 4ZX4A 4N1HB 4UAOB 3K2UL 4NQEB 4PUBH 5COYA 5DRZB 1JHLH 2VDOL 4LF8L 3W39B 3T3PF 3CZSA 4RA0C 1HINL 2YQ2A 3L4WA 4XOEA 4HQQL 1D1KA 3OKKB 1NIBA 2MOQA 5GGSB 5I19L 3P73B 5FCUH 1JK9B 3NSXA 1USQA 5AVYB 4TRDA 1KTJA 4FQLL 5FO2A 2BH2A 1VQPA 4Q6IC 3U9UB 3X17A 1MSHA 2KDGA 2K33A 5EZIH 1BYNA 4FQXC 3PXLA 2YD9A 5BQDA 1P69B 4RX4A 4KZEH 4P4KD 4OBRA 4MJ5A 5JOPE 4EDXA 2GC7C 2F53D 1GA2A 1TETL 4HJEA 1NMCC 1FO0H 3FU7B 4XXCC 2WZ0A 4P23B 4TSCH 4ZSOE 3TA3C 1CCZA 2VLME 3ZHNA 1BVOA 2NR6A 2W65A 3U2SB 5DLML 2JE6I 2BIPA 4ORZC 1EY6A 1I75A 4TVSa 3RVUC 4CJ0A 1R3JA 4FYTA 2D7PA 3GTGB 1J1OH 4WO4D 5CM1A 2YMXL 1MCKA 2IGLA 3TA4D 2AK4E 1NAML 3X1GA 5ABZA 2QGQA 5E99H 1BG1A 1KLFA 2AEIT 15C8H 1L2FA 1CKOA 2Y1ZA 3F8UB 1DBKL 4PGDB 4QHLB 1EYCA 3OG6B 1RVFL 3MWYW 1I1FB 3DJZA 1OGTA 5C3EH 1K0SA 4QTFA 1IV8A 1PEWA 1N34Q 1MJJA 5HYSG 5C3XA 1KBGH 3K7UC 2LR4A 1SNPA 4YWLA 2OMTB 3UO1H 4J1UB 1CXFA 5DC4B 3DVIA 1CDGA 3F6IA 4LLYA 5TK2A 1DCZA 2X05A 4ODHL 5JXAH 2VGLM 5BXFB 1MCSA 3LIZL 2B2UA 4GKNB 4JL1A 4RAVB 1YQVL 3WFBH 1OARL 2J88L 3QJFB 2ZUYA 3LRMA 1UH2A 4L1SA 4YXLH 2BOCA 4WFHE 4I0PB 3A6CL 4UU9B 3S3JA 4QRBA 3A5UA 1DL7H 4NN5C 3X3GH 3RWHA 4YX2L 4BELD 2X2IA 2NXYD 4LLQB 7TAAA 5E23A 4HIEB 4AH2B 3FQWB 4F7EB 2X2JA 3QUXA 1FSKB 4MMZB 3TIDB 3VRLF 3O6MH 3HPJB 4YL9A 4QIRA 3VB9A 1JCVA 3PUUA 2A99A 4A3DG 5JQ6H 1F42A 2BRRL 1X5KA 1MVFA 5C6PB 5GGVY 3R8BB 2NX5A 3SKUD 1XR8A 4L4TD 4F87A 2DQTH 4YDKH 5D1QE 4LASH 5AVSB 3RIAF 3L2MA 3PV6B 2MWCA 3E0GA 1LM0A 1HEZA 3VXMB 1SXBA 3NIGF 5F7WC 2QKSA 4QIWE 3HOZH 1N6VA 1PX4A 4U2ZA 3MTSA 5CLXA 2VMCA 4F7MB 2KERA 1HL8A 1NANH 3NA9L 2L4NA 3EJZC 4K71B 4BDVA 4YHYB 3VXOA 4QYOB 1A9EB 1JWUA 4HSAC 3QZMA 3VXTA 3MQIA 3N9GH 2F4VL 3MNWA 2CK2A 5AVUB 2XYBA 4A3FB 1PG7H 2QW7A 3MPCA 4G7YL 5K39B 4JZNB 2H1XA 2PO6C 4WW2B 4X9HA 1MCNA 1P9MA 1PSKL 4A3IG 2VM3A 4HH8A 1YMMD 4U1MA 4XNUL 3RRQA 1CZ8H 3SKJH 4FNTA 3EXJA 1EH9A 2CKBL 3WN5A 5IW1A 2FX7L 1HWWA 1FZKB 1TVHA 1B53A 4Y5XC 2DJMA 4U7KA 1SVCP 2MOVA 4HJGB 1GL4B 1BVSA 1X4ZA 3I4MH 2H3NB 3IDGB 3NZSA 1E6JL 4HEPA 2C9SA 3PGFL 3HUJA 4Q0XH 4DR1L 4ZQKA 5AQ0A 1JZEA 1GZPB 5BCAA 3HG2A 1Q9KA 3NDZE 3SKOA 1BIHA 5EIIG 1I3GL 2GB2A 1AO7E 3OWRA 4ZCKA 3KFUA 4BQ6A 3UROR 2DLEA 3H8NA 4KJNA 3FUMA 4R26L 4BZYA 4Y5VA 1PJWA 1S7XA 3B5HA 1B4TA 2GUOA 5J11B 3BUPA 4Y7NB 5EFIA 3B7UX 4NPKA 4JFDA 1L9MA 2AJYH 4DR7Q 1JGEA 2APVA 3C08L 4AC4A 3L6FA 2O5ZH 1EZVY 3ATBA 4WI6A 5EEWA 1E0BA 1SYBA 1SYCA 2A83B 4X5XB 4E9RA 1R3HA 3JWNG 1ORQB 5I1GL 2ZXBA 5E4IA 5ELCA 4JM2B 3GSNH 4PPTA 2XRQD 2NZ1A 4XQNA 5MI0C 5KTEL 2QHLA 4MJID 1YC7A 4PJDE 5AAPA 5JJZA 3D3RA 5DQ9A 5ANME 1ZHBA 4Y4KC 1U4RA 3GTLH 3GS7A 5I9PA 5M5YB 3DMMD 3CX5K 5BRPA 1VQ9A 4KMQA 1SXTA 1E1TA 2VZSA 3MUGB 4M1CD 5AOLA 3EYFB 3SE9H 5FUCE 1MDTA 2NY6D 1J9OA 3CQZH 2H9GA 2F0CA 3DSFL 2QLVB 1JN6B 2F3VA 3BDOA 1O7SA 3RUGA 4OLUH 5F9OH 1RMFL 3RN2A 4HUXB 1PYSB 1AZPA 3TP5A 3O13A 1D7DA 4Y16B 3T4AC 4UMSA 1TWHB 3CPUA 4UM9D 3B83A 1EERB 2KQNA 3JT0A 3OKLB 2B9BA 4KTDL 4ZO6A 4L5FL 3UMNA 1ZKAA 4X65L 3GXDA 3GIVB 2A77L 1Y1VB 3C2AH 4K15A 4RESB 4WNJA 5A16A 3A7AB 4I48A 5EZOL 4BWTA 4D7PA 3WTVA 1W80A 2YAOA 3VGHA 1BOGA 5DHXB 4PSRA 3EYVB 1I1AA 4V33A 3MLRL 3HC2A 1XH1A 1QBMH 2KQMA 5DU7A 2QGCA 2ZE0A 2DWSA 3REVB 4ENEC 2OPCA 4LRIC 4N5UA 3QYNA 1FNLA 3B9AA 1LP9F 4W4OA 2X3AA 3L5WB 5AYUH 4L05A 3FC8A 1OCWH 4JZOB 4HIQA 3T6WA 1RI8A 1DSFL 3L9YA 3KPSB 3MN8A 2R0WH 2WW8A 1G7QA 3EBEA 1EYAA 1OAXL 2JEBI 1DFBH 3BW9A 4ABNA 2R0KL 5BN5A 1HH6A 2ICWA 1L0XB 1S40A 2A6JB 1AP2B 1LTXA 3DHUA 1ORSB 1AGDB 1XSJA 3FQXB 1U8MB 3RX5A 3RVTC 4AX3A 4U1LA 2VDLL 2K7QA 5ID1B 1N12A 1BF8A 1PKQE 4LCUB 4JGNA 2QELA 2YD4A 5FGBA 5KNDA 3L5HA 3QC6X 3B2XA 3K71A 3MJWA 2BIMA 1I4RA 2IXQA 5FYLE 4X66L 5IFJB 3N55A 2ZTCA 4APQD 5ID0B 4DAPA 1F6AB 3DV4A 3T0EE 4X7EC 4AGLA 4KHZA 3UTZA 3WS3B 4HUUA 1EEUA 3DPBB 1KTLB 1WIOA 4UAOC 1QUNA 3RVVD 2D7TL 5AJ3Q 1MWAH 5F1NA 3RD4A 5GIRB 1QBAA 1MFAL 3NFSH 4NKDB 4QF1A 4DP4X 3IDXL 4JAMA 1JT8A 1ED3B 1IAKA 5FOJA 4FTDA 3V4PA 3WHXB 4AGPA 2A9CA 1CG9B 2HYMA 3E38A 4AMKH 3MRCA 1CUOA 2Y0SG 3CFTA 4P2OD 4GS3A 5IESH 2DMBA 3R2IA 1P7QD 1EBPA 3D2UD 3FVQA 4U1IB 5IMLB 3MNZA 1QSFE 2P9RA 3APFA 5KSAA 4IHOA 3QDGB 5T8IA 2P5WE 2HQEA 3IU3A 2ATPA 5AFAA 1DYQA 1UEYA 3WIHA 2UUDK 3AU0A 3RB7A 3V52H 1J8HE 2J44A 2WBKA 4RGNA 1C48A 3LH2H 4P23C 1K5NB 2EDDA 4PGEA 3UJJH 2G9HD 4KKTA 5AZ2H 4AIZB 4Z95L 3ITPA 4LEOB 2HN7B 3FSWA 3PGCB 1CLCA 2PWEA 4UP9A 4W9FC 3WJJC 1RSFA 4WNQA 3NQTA 3TREA 2X7LB 1IEAB 3OJVC 1UXWA 1UASA 3O8XB 2BFVH 4A93H 4YDZA 3QUMB 1QEWB 1YHQA 2CLVA 4GNXB 1O5PA 1GHKA 5I23A 3DX9A 3SCMD 4U1JA 5CJBA 3H9YA 4JCWA 1U33A 3QIBC 3K80A 4AL8H 3CZNA 2V5TA 1KEGL 3MRDB 5JZ7D 2BH8A 1GO3E 1E9PA 3IRCA 3TX4A 3K6SB 1A63A 4NFCA 1UKSA 3GV6A 4CVXA 4E42B 2FAUA 4KO9A 2CIIB 3JWOL 4X6BB 5D70L 5EO0B 5B21A 4AT6A 2GVAA 2E7MA 4DR3Q 3LTVA 5DK2A 1LHZA 2VWEE 4A3KH 4CDGC 4YHOH 2OSLA 4LLMB 5C0AE 4NNXB 1KN4L 2ZXAA 3CC7A 4HLZH 3VA6A 1HR0L 2ZTBA 3JVFC 3HG1E 1BREA 1KLUA 4JZJA 1FGUA 2IH1B 1EIYB 1FSKC 4GXUN 3WKML 4MMZC 5MP6H 3J81c 3CJJA 4JQVC 3RG1C 3I6KA 3U7YL 1KPVA 1MNUH 1T1XB 5GZOC 3E6HB 1EHNA 1KDAA 2DWEA 5C4JB 1T66D 1C16A 2JB5H 2X2YA 1AQKH 2YAFA 4ONGL 5DK0A 4X5WB 1A3TA 1NH6A 1FL5A 4K94C 1IYUA 3VNZA 3I70A 5E94B 2FR4A 2BM3A 2IAMB 4UV7L 5CJQH 3BDYL 1AZNA 1DQIA 4PJAB 5I75B 3D4DA 1AZCA 3SY0A 5BOPA 2Z65C 3KYHC 1AQ8A 2LVCA 2X5PA 3NPZB 4PRBA 2WANA 5CFHA 4K71C 4C57C 4YHYC 1NLBL 1UWXH 1BBXC 4X62Q 4GKZA 5C4ZA 2EVHA 1HEJC 1WUNT 4OZHA 2Y24A 4HK0A 3UBXI 5KBDA 5FWRA 2BVPB 2Z3FA 1CLVA 3H2PA 2BP8A 4N8VG 1MJUH 3J7ZC 4B41A 4X5RA 1IBGL 2UUDH 2EIBA 3GO1H 4J28A 3VU1A 2A4EA 5FOBB 2Y7OA 1MJCA 3O6KL 4B3TQ 1X5GA 3ULUF 4G8AC 1MEXH 1VZGA 3SK6A 4OFDA 4Q4IA 4PRID 1ZEQX 1U3YA 5AVVB 1NL0H 5E56A 2X69A 2LFNA 2Q86A 1KGWA 2GITA 3BO8A 1TYEB 4X7TA 4J3WA 5FJ8H 3BGFC 5JHLL 3GSOB 2FJFA 3CHBD 1AC0A 4OQTA 3FO0L 3NBIA 4FYRA 3ULPA 1SR3A 3H6MA 1QKZL 3U58A 4OJFL 4KUCF 4MD5B 1C08A 5DQJA 1ZGLP 3MKGA 2DI7A 4NKLA 3QZBA 3V0HA 2DWDB 4U6VL 1QZGA 3EKCA 4Y1AA 3MNVB 5D1XA 3UADA 2Y06L 1DEEB 1ACCA 5J11C 3IWVA 2JQOA 2ZIDA 5AW0B 2C34A 2A9BA 3GIZH 1SMOA 3F58H 3IKCA 3MOQA 4AV4A 2R8SL 4CKEA 3LPFA 4IUNA 1WTXA 5IIEB 5IR1B 1AIFA 1OTTC 3ULLA 4TQEH 3DRTA 3TO4D 1T0OA 4E5XB 2YTXA 5FLVA 2E2JB 4WCYH 2DTML 3Q44A 4JM2C 3TTYA 4EN2A 4HF5L 5JA8B 1K6QL 5G3LD 4PZ8A 4HIXL 3DBXB 3SPCA 4H1LG 1MHHA 2X0UA 1OF0A 4QWWD 3BZ4B 3L9AX 5I8EA 1DJYA 4YIQB 2HJKB 2NY5C 1G87A 1PFCA 2KZBA 2BY0A 2Y1VA 3DHMA 3LXBA 1BVLA 3MA9L 3NAAH 1EGJL 1VPOH 4OZGE 4P46A 4WTZG 3TC9A 1ZTXH 3H55A 4NQXA 1N19A 2W07B 1YJNA 5C08B 1PH6A 4XB8A 4LSVL 5C92A 3HN3A 2E74C 4P0DA 4Y16C 3WY4A 1EEZA 4IIQC 1T5KA 1CDIA 4M8AA 2J4WH 1YYLH 4AYBG 4I4WB 4WHTB 4L1TA 4DVBB 4Q2ZB 3RGVA 3NK9A 4UYPA 1W91A 1C9SA 2E6QA 4FF9A 2QZ5A 1RUKL 4LZKA 3WIHL 5JIDA 1OAJA 4HWEH 4NRXB 1TQTA 1H9SB 3DGCR 4S1QL 4MLSA 5SWZD 2EDXA 2AQNA 2OI9C 2X41A 4E41D 1JWSA 2JI1A 4L9DA 4GP4B 3A8KE 2E9JA 1LV9A 3BVZA 1ZT4B 4OFPA 2X70A 1LTRD 2IJ0A 3OVUB 1U8NA 4RMQA 2FWSA 5CR8A 1B2YA 5C0FB 2EQSA 5IP7G 4B6ZA 4TTDC 3JTTA 1MFEH 1MG3C 1T5XB 2FJGB 2EPBA 5ESQA 3FDWA 4AEHH 3L7EB 2X6LA 4Y4HA 3FQ2A 2K50A 3TGXA 5FDWA 1K83H 1HYRC 3HI5H 4DKFH 3QPXL 4MYPA 4UQIM 1QILA 4AITA 2NT0A 5D1QA 4OJEH 2W94A 5D7KE 4M9OA 3RWCB 3TURA 2D0FA 2L7EA 3FB7B 3VXMA 4LFBL 3CPFA 1FD7D 4EUPB 1FGNL 1CO1A 4Z8FL 4JHBA 2XJLA 3KYKH 3H7BA 2R92H 4HJ0C 3NCCB 4LHUA 1IC1A 2R59A 1IQWH 3N85L 4QCIA 2W81C 3KJ4C 1UJ3A 2BOBB 4PJEE 3EA6A 1UA6H 3BE1L 1PZ5A 5HHNB 2OJEA 3L7FB 5AW3B 3RTQB 3MNMA 1SROA 4GUCA 3MUHL 4QRAA 1AD0A 5IVOA 4ZXBA 5KVGH 3TSSA 1E9QA 2ZCKH 4JB9H 1WWBX 1KZQA 4PD4K 1U3JA 2XXMB 3ZL1A 3TCLA 4N4YB 4O4YH 1KJ2B 2GSMB 3HE7C 1WA2X 5LMUQ 4NQDD 4W6WB 2DMHA 4FI6A 3GHBL 1UC6A 2J8UE 3DGDA 1DJZA 3SDXE 2OCJA 3WD5H 5EPLA 4HJ5A 4LNRA 2AQSA 2R23A 3GMNB 4JFPB 3HZMB 5GZNA 4URKA 3FZUC 4ODWA 1FNAA 5CR1A 4PJ9D 2ENBA 3BEWB 1ZLWK 4YNYA 4UV4L 4MB3A 4IRJD 5CJ8A 3M7GA 3CFJB 2EXWD 1KPRA 5FO8B 4NZRH 3RDTA 3ROOB 5IHWA 4GNXC 5ISZD 4GUPB 3ZDZF 4G6KH 4MAUL 4FFZL 4HOWA 1S5DD 1IEBB 4V1DE 3SQOL 4K5OA 4XAKE 2G9KA 4QJ4B 3SK5A 2GIYA 3EJUA 2CBQA 4TSSA 1U58A 2GUYA 3FFDB 2EO7A 4GS7B 4IGBC 2IDSA 2WLNA 3RZCB 5EOCJ 2QCPX 4K7PY 1U3NA 1BM7A 3S2CA 4XPTL 3E3QC 4BBSG 4CU8A 3SE8L 4OQTL 2XVBA 1JJGA 5ANMA 2Z4TA 5C09A 3L3OC 1Y14B 3TN0A 4JFQB 2OMYA 1MQ8A 1N34L 3EYQC 3GM8A 3I9AA 1JD9A 2D8KA 2EEFA 4JPIB 2BNUB 1QW9A 2VDKB 3CK0L 4JO1H 3ZSSA 5C3TA 5I2YA 1KC5H 2J8OA 3SBRA 1G7IA 2N55A 3BVXA 1G4RA 2CUIA 3WOEA 5CINL 2WAQG 4DR2Q 3WOFA 1K28A 1SFOB 1ULVA 3U2JA 5K9KB 5SWSB 3FT4B 5CXPA 2R0LL 4MAYB 5JPNB 1SLVA 2MTPA 1G7PB 1V1PA 2TSAA 1M6UA 5C0BD 2QL1A 3AQQA 3TDQA 3TMEA 5AVRB 5HHVH 3FDTA 4K23H 1RLWA 1TT6A 1ND0B 1EAQA 1I8LC 5IJVB 4J6RH 3L5JA 1F8TL 3E8UL 1ASPA 3PCYA 4L4VA 5E2VH 3V55A 5AD0B 5I1CL 4DFHA 1UT1A 3DI3B 2QVMA 1NGZB 3QA3A 4OM0L 2QPUA 4PYGA 5LQBL 1ZANH 2Z6KA 5T1GA 2IAMC 5J12B 1NCWL 1NIDA 1RUPL 3B56A 4LCWD 3U1QA 4JV5Q 4OWTB 3TWYA 1BVKB 2F0QA 1WITA 3GO5A 4HMDA 3A24A 4GOSA 5I5IA 1XXFC 1HJBC 2DIEA 5C6AA 3TZVA 3B3BA 3LHPL 3HKZA 3EOTH 2Z8SA 5CAYB 1DVYA 2FGZA 2YUVA 2NY2B 3CFBA 2C3HA 3GJFK 4DK1A 3NRFA 5KANI 1YNJD 1LO5A 2HVKA 3ARDB 2HT4C 5B1JC 2IPUG 4BEIA 5AW8B 5EEUA 1VJSA 2A6JA 1IGYB 3G6AB 3FO1B 3KLAB 3NACH 3DXAB 3FQXA 4QLRA 4IOSD 4TVPL 3WY2A 1JV5A 2OK0H 4HPOL 4NJ9L 1U42A 1IKOP 1STHA 2XNAB 4Y8DC 4GKJQ 5DZAA 1KT2B 4JG1L 3EFXD 2R0ZH 3KPNB 5D7EA 4CN1A 1WA0X 4G6MH 4EIGB 3LNGA 3P9WB 5GS0C 3MI6A 3K4AA 5JW5A 1MZZA 5BUAA 5HPMA 4HH9B 5HI4D 5AFWA 2E8GA 3G48A 1I8IB 4HWNA 1MLCA 2CIKA 3LXCA 3R7QA 4YMPA 3H53A 3WN6A 5IB2A 4PRNA 3K4ZA 2AV7B 1JRHL 1ECYA 5CV5A 2C5CA 3QFGA 4FNLH 3D0VB 2K5NA 2PO4A 4WU5A 3FH5A 1BCPB 4BH7B 1MHCA 2UX7A 4O5LL 5HHOB 2QQLH 1YPZF 4NAMA 3ZIYA 4PCKA 1ASZA 3OGCB 3TH3T 1CTMA 5JYLA 3PUZA 3VR2A 2MO0A 3CC1A 1QSFA 2P5WA 5I74B 5EHFA 2WAHA 2PCPA 3M17A 4BSVA 1IL1B 3OOCA 1OSZA 1XFPA 4U1SB 2A69C 4DETA 43CAB 2B59A 2N7SA 4E9TA 4DR7L 5IJKA 3P0YL 4GFXA 1EK3A 4XO5A 2P43B 4XI5D 1RPUA 3FHQA 6TAAA 3BQUD 1I9RL 2P47B 3M4OB 1VFAB 4BA2I 4HXAH 3CFKB 1K8GA 3IMBA 5FUOL 1HJCA 3EYUH 1CHQD 5FEBA 3QHZL 1QASA 1FBIL 1GGBL 3MLSH 1CFMA 3ZKND 4IU3A 5KAQF 4LDOB 2VKXA 2FQFA 5J3HD 4F7TB 2NVXH 3S98A 5IGFA 2CJSA 4B96A 3GSWA 3O3AA 4OB5H 3K6SA 1J05A 1A9BB 4JDTH 4XB7A 4ZLTF 1WLHA 4B9JA 4U3SA 1UWEL 2JKRM 2UY7A 3CHRA 1H0DA 2ICEA 1MIEH 5AZEH 4OLVH 4FP8L 4NP5A 2VR6A 3RUGF 1JXGA 1GPOH 2BZCA 1HNXQ 8FABA 3DIVA 3CFEB 5DJ8A 3D69A 5HHME 5KBMA 1E9OB 3GJFH 1RZFH 3JZYA 4WIQA 1EQRA 4NGHH 4EN3B 2ZJSL 4HDIB 2IADB 5DMIL 2K5HA 3TNNA 1COBA 1DVXA 2UY6A 4WI0B 1JSYA 2UZYA 3FH7A 2IDTA 3S14H 2AQRA 3GSUA 3H42H 4IUUA 5DLQE 2NXZB 4Z6AT 2D0GA 3FB6B 5AAMA 3DHQA 5K9OA 2OL3A 1BD2B 4JPQA 4UYQA 1TZ8A 4AEIL 2X87A 2ED7A 3GHPA 1XB8A 1CGUA 2ISDA 2A6EC 4JS7A 5DVKA 3UDFA 2BSSB 2OV0A 2Z91B 3BSZA 5LBSA 4QCLA 4PEEA 4YIJA 3LPPA 2P5EB 3CFCH 3DUZA 2P8LB 5DTFA 3BRDA 2ICCA 3CUPB 3NJFA 3HC0B 4X6DF 2F0FA 5GSVB 2ADFL 2FJ2A 2NN6H 4GH7B 1VFMA 4MZ3A 1JF1B 3ZDYF 3KLHD 1CICA 5FKAB 2FX8L 7PAZA 2Q8BH 3IJEA 4KNTA 2EE3A 1CZWA 4PFEA 3RTQC 1B9NA 2M2DA 4R7NA 4K5NA 4GW1B 3VFTA 1J88A 4JRXB 4UANA 1G1OA 5CCKH 1G7MB 25C8H 1XX8A 4KO5A 3QO1A 2ARWA 3LEXB 43C9A 4BCXA 5AJ3L 1VGEH 1EEQA 4ACPA 4KGLA 4N25A 1EA9C 2CO7B 5ADPH 3BFWA 2HJFA 2PTTB 1RIUL 3DVGB 5ICXA 1T89A 5HYSB 3D6CA 4P4KB 3ZQWA 2UU9Q 3VXRE 2VDQL 1QFWH 5AL0A 4BY7H 2F53B 2KS0A 3TTSA 1MVYA 2DWDA 4NZTL 3EF7A 2DY7A 3FBQA 2G5BA 3GWJA 5DMJB 4N2LA 3RE0A 4Z7IA 1HESA 1OVZA 3C5ZA 1MSGA 3BWSA 4OF8A 1WD8A 3GJEB 3ZIMA 2R9HC 3QEUA 4OVUA 4P2RD 4U6HA 2NW3B 4O51B 4S2SB 4XCCL 4QJ3B 3UBGA 1YYML 4WO4B 4KKNA 4NKIL 4A3MB 3BZFB 2WMPB 4D8OA 1Y8NB 3F12A 5A2KH 2PXYB 2X4SA 3CSPA 2OTUA 4G8GB 1I50B 2B8FA 3GM0A 3MV7A 4F33A 2EH8H 2PWFA 4GS7C 3RZCC 1VFOA 3DBSA 4G1MA 4YDVB 1HU8A 4Z0BH 4D9QE 5HPOA 2DLFL 1W0YT 3GSVA 2W9LA 3ARGC 4J3OG 4EZMA 3BH8A 2L5TA 1NE3A 1TLMA 4A3DB 2P24B 2JK5A 1CTOA 4UHVA 5TDNA 2QPFA 3QFDB 1CXHA 3INUL 1MCPL 2FYVA 2UZIL 3I6LE 3NIDF 1KHIA 3OIPA 1LK2B 2XSKA 5INDA 3BN3B 4BBRB 2N56A 1KLGA 4JFXA 4LE8A 1E6OL 3V2TA 1DR9A 1UYWL 4OZGA 2NUTA 4HPYH 1DJHA 1HCZA 2FK9A 4DR3L 2FHCA 3K1KC 4H0IA 4ZPVA 3FB5A 5C08A 3VGEA 5FB8B 5HDQL 5E7BA 4JN1L 4JPKL 3RWGB 1HTLD 1RK1A 3LHAA 1T03H 5JPNC 3KJPA 1PFOA 1R47A 2VQ4A 1FYTA 4I4WA 1WVLA 1ENCA 4BK5C 2R83A 1NGPH 2O4XA 5AOKA 2VQ1B 3X14B 4O42A 1CLOL 2XQ0A 4D7BA 5D71L 4JFED 5BOJA 5B38A 4A3IB 2G75A 2ODHA 1PG7W 3VGAC 4KJPD 3CG8A 1IE5A 3MLTA 1M1XB 1MJ7H 1RY7B 3RURA 4AVJA 5BUGA 1WHOA 1WI5A 5F7AA 5A7EA 5IWLA 1T22B 1C5CL 4YHZL 2AK1H 4L2LA 1BQKA 3T8XA 4UTBA 1JF5A 2PP7A 2WXFA 5I6PA 4IKIA 2V2XB 1Q1JL 5MENA 1YEEH 3ZL4L 3FYEB 3ABGA 3Q6GL 1I3VA 4JOIA 3VXQA 1A4KB 4Z7NF 1NDMB 1OOAA 2NY2C 4X4ME 3GTJB 1Q0EA 2VE6B 3ARDC 1D5RA 1Z0NA 1HDMA 2FLRT 3JVGC 5CZRA 2VLRE 4IBVA 1O75A 2QDVA 3V6ZB 3K5OA 3OKMB 3FPXA 2TAAA 1OXYA 4X62L 1SEQH 4L5RC 3QIWD 4Y4FA 3RHWK 4UPAA 3BRFA 4RHSA 2XNAC 3B2VL 2GEQA 1B9ZA 1GZHA 5HHQB 4G57A 1YMMB 1KIPA 4OZHF 4Y1TA 4B9PA 4NX0A 2VRAA 4QRQA 4Z7VB 1YNLH 5B1KA 1VGKB 4B3TL 4AJVA 4R7DA 2OYKA 1IZJA 3HS0B 4QDGA 1STNA 1SBSL 4DPGA 1JIBA 2AV1B 3EYSL 5DJYB 4ZFZB 2Q1EA 4NI6A 5C2BH 1Q1PA 2X88A 3D06A 4AQ8C 1KCVH 2UWEB 1EWCA 1R33A 1BXXA 1II4E 1MPAH 1D6VL 1Z2KA 1B3QA 1BCPC 4LSSH 1KFAH 4ZUUA 4N8CH 4O02A 5KYLA 4HU2A 4ONFL 3IL8A 2P8MB 1OCZB 5FLUA 1EY7A 1O7IA 2YOCA 3QUZD 1JGVL 3AJ7A 4A3BB 3SGJA 5JR1L 3CMOL 2BVTA 5FO9B 3FT2A 5KVEL 1Z3GL 3T51B 1AH9A 1NBZA 4FQIL 2J55A 2J8UA 1RJZB 2WYTA 1KGIA 4GRWE 4PJ5E 3GBLA 5FGRA 4F9LC 5I26A 4QRSA 3TCXA 4EJ1C 4NZJA 5EBLA 5F96H 3VFSA 4CKQA 3ERQA 2RVLA 3V0EA 1MFMA 4KDTC 4PV8A 2OXGA 1KBVA 4DP7X 4YEFA 1B90A 1P6WA 1RZJC 4JKNA 4MJIB 5C44B 5DEGB 3RPKA 5CD5C 1GUOA 1VMPA 1EAPA 4LKXA 1PL3A 3LXAA 4XO9A 2JI2A 5E6RB 5EA0L 2VL4A 5D2LE 5EU3A 1MFCH 3DMMB 2NOYA 2O93L 2VH5H 1FFNB 2WCGA 4MMXB 2A1WL 4MNGB 4IJHA 4Y2OA 5D7IA 3WFEH 4IPHA 2FSEA 1D5BA 1JJUA 2NW2A 4MQ7B 3JV0A 4V2BA 3SO3B 5DHEA 5I0XA 4XBMA 4R90H 1T2JA 4NKMB 5L9DH 1U8CA 2WXGA 3CCHB 2N8NA 4HIOA 4KH2A 2F0PA 3II3A 3WLBA 4HIIB 3T3MB 4G70B 2WQUA 1HZCA 3QFJA 2IGTA 4UM9B 3RZOB 5CZXC 2LLNA 2LW3A 3RY6A 3F65A 4NS0A 1MHPL 4JHVA 1RZ8A 2AJZB 4XP6H 4XVTL 2LU4A 1TWCB 3F04A 4DK0A 3N44F 3QEGH 3RA7L 4A4IA 1W6LA 4M7LL 4B0MB 3LN9A 1NMFA 1V27A 2EDGA 1F4YH 3O4LA 3FUHA 4EN3C 3Q6SA 3S1QB 4JFSA 3O41A 2QVIA 3UEZA 1PZJD 3EJJX 1YJDC 3GRWH 4I13B 4JM4H 3GYRA 3Q43A 3HN5A 1KYFA 3IFDA 2ZCHL 1V43A 5DQDH 5KS9E 3MCG1 2BDNL 4A6YA 4YXKL 5E6UB 4LLWA 1CL7L 4EEEA 2G3MA 1DLFH 1Q7YC 1JK8B 1FV1B 3E9IA 3MEFA 4Q52A 2V7HA 3P0VH 3P3YA 4Q9RL 1JGUL 1AACA 5H37H 4ZDHA 1IC4H 2EZ0C 3D09A 3THML 1ZYRC 4U1HB 2O61B 4ANVA 5E5MB 1P4BH 1XGQB 2VLKB 3U4AA 3BD5A 4DPBX 1SGKA 3OLEA 3ZY7A 3OIQA 4K3DL 2Q2TA 1NGZA 2R1XA 1UOLA 5JW4M 1A1OB 1UEBA 4KX9A 1FZOB 3E80A 3EJSA 5AB2A 3Q48A 1LO0L 3VFNB 3MRJB 2EIJB 3QJOA 5IGXL 4GQ9L 1EIHA 4AQAB 1JWMB 4BUGA 4J3UA 3CVIL 4HIHA 3MV9A 3QUYD 2EYSB 2GBUA 2NZ9D 3MREB 5EH1A 3SZKC 1UCBL 1MLBB 4F58L 4DAGL 5FKAC 1AE3A 2NWGA 2AKRA 5TGBA 5B1BB 4APQB 5C0CB 5DDHA 2B2TA 3DWPA 5KZCD 3ZHKA 1P84K 1AQDA 4LCVA 4LF9Q 4O2CA 3RWIB 3V79C 5T1LA 3RHWF 4PJXE 4GG6B 3ASNB 1IGJB 1VZIA 1IYJB 4HT1L 1IHZA 2CO3A 2VXVL 4KO7A 4DR6Q 3GMPA 5FM5M 1KT2A 3OJDB 4PY7A 3STBA 5FLXL 1G6RB 2QTVA 4BM7A 1K4DA 2PKDA 3A21A 3GT6A 4P2OB 4UP7A 1L1OC 2CWAA 2WY3B 5I1JL 1P7QB 5I73B 3D2UB 5DD3L 3L5IA 4JBMA 4P4KC 2Y5EA 2SEBD 2FWLB 3AITA 1BBDH 2KMWA 3BISA 3EDEA 2VDML 3GC3A 3QSKB 3RNKB 4XNDA 4R96B 1Z9OA 2CBPA 4UTBL 5LMUL 1R9FA 1J18A 4HJIA 4M00A 4OD3L 2YZ1A 2ZKYA 3T4YA 2QQQA 1XGPB 2XN1A 3ZQXA 2B0SL 4JCVE 3GI9H 1U9KA 1CMOA 2EC8A 2G9HB 4R2GC 2C4FT 1MIUA 1ZSDB 1ZXTA 4U31A 1THAA 4JO4H 4K14A 4JUTA 4H13C 2WTPA 3F7PC 3FQ1A 3FU3A 1JUFA 3WXVH 2DQCH 2C7FA 3QO0A 4P04A 3C1FA 2PXYC 4AKPA 1WTOA 5I17A 4XTCS 2H7WA 1T6WA 2EVFA 1T0MA 2YRBA 4GW4A 2IHFA 3UC0L 4LK4A 1M9SA 3VYRA 1UWGH 1S9XB 1RL2A 2W0KA 1A02N 4P2QE 3GZPA 2RSOA 5M5XH 3TYFA 1BJ1J 4Z7UE 2A74B 1CFVL 1W0VA 5EUOB 3S36L 2BP0A 3WKPA 4AW4A 4XPFH 1YEGL 1WAAE 1UJTA 1S7SB 3ROLB 4A2GA 3NG5A 1YAIA 3D4CA 4LF3B 4XPHH 3X11B 4Z7OE 3U7WL 4X42A 1JZ2A 4GP8B 5T1KA 3FQRA 4FL4B 1OP5K 5I18L 3K8KA 3D25A 2FNBA 3TN2A 3ETBJ 1MGSA 4LLUA 4PJDF 1CZGA 1DQDL 1GYUA 1E4WH 1KTRL 2IANE 4UUJA 1P5UB 2IWEA 1VSCA 1W2BA 1KJ2L 1YA5A 2OXHA 2YQ3A 1EFXA 35C8H 4X2UA 5HI3D 1R46A 1DBAL 3B4NA 3CLEH 1J1PL 2CO2A 1XEUA 1VQHA 2E2HH 3HOXB 1QHQA 3QJXA 4XC1H 4FG2A 1DQJA 3AG4B 4DR2L 2QKIB 5HDLA 3PNWA 2MCMA 3BZEB 3KJ6L 3AU7A 2PCXA 2WUBH 2PMZA 2K6YA 1KXTB 1KGCD 2QEXA 2E3VA 3O4OB 3OWFA 2OA9A 1NJ9B 3AQXA 1HNZQ 4X83A 4XXDA 3T1WA 3VD0A 5E7FA 3VFOB 3MBWB 4WI0A 5GJTL 3FP9A 4JI5Q 1DQKA 2PW1B 2NVTH 3PJSB 4IKKA 4EPSA 2I60L 1NKOA 3IPBA 1R5IA 1FG9C 1OGAD 1PNCA 3SGEH 3TS0A 4CA4A 1QOHA 2XN9D 4JV5L 5KSVB 5ABAA 3VXNA 3DROB 5CWSB 1NUFA 2XWJA 1N0XH 2VTFA 2XZCH 3HC4H 4OIKA 3S4SB 5CEZL 1YNXA 5BN3A 1B50A 1HFGA 1A8JH 3BVDB 4XPAH 5E8PA 1KRTA 3PQYA 3WIFB 3SBQA 2H26B 2HT2C 1RIVH 2ENSA 5EN3A 2IBGA 3S15B 1TT2A 4C3JG 1IC7L 3VXNB 4ZMZA 1VQOA 5IMKA 5KVFE 3L1FA 1ZMYA 1BGXL 1RKNA 3QI9B 4WFN3 3MLWH 2G3XA 2Q8AL 1P8LA 4MD0A 5E6IA 1OTSD 2AVFA 5I1DA 2F1BA 5IJCC 4OLYL 4GKJL 1YEDB 1TR7A 1WH0A 1NAKL 3LZLA 5DUJA 3T0XA 5L4JA 4OZIE 1DVTA 1HL5A 5FDYA 3QNYB 4QUOA 3H3VH 1LT3D 2VABA 1K9MC 2PYFB 5EB9A 4Y5YB 4A6YL 1LUZA 5I6XC 2JJVA 2PR4L 4F5CE 3BX7C 3U0WH 4WFFD 1TEGA 4NNPH 1DQLL 4KFMA 1IAIM 5ENWA 4ZYKB 2XVGA 3QDME 5F3HB 4HUKB 1TXKA 4QTIH 2W91A 4PGJA 1GKOA 3OWEB 3BMVA 1SQMA 2CCLA 5HYJB 4HX1B 5L88L 3CSYA 1A1NA 2EUZA 3CDCA 1I1YB 3WOVA 1LO3L 1OP5H 2XACC 5HI5C 1J10A 1SE4A 3IFLL 4NCC1 4NN6B 4DIXA 1SXSA 1KB5H 5C0DB 4PCTA 4M7ZB 1Q9WB 4K9EL 2AQQA 2MCPL 4LWCA 4C3IB 5EDSA 1GS8A 2OR9L 4IJ3C 2MKWA 3CGTA 4MMXC 4ZS6C 4X80H 2FMMA 3O6FD 2XBTA 2E9GA 4PREB 1GC1C 3S35L 2WLLA 4XHJC 4M1CC 5EPMA 4KKBC 5JIMA 1A7RL 3LZFL 3LV3B 3SO3C 5LDUA 2K05A 2WB1E 3GPEA 4B27A 2YC1A 4PU2A 4WFGD 3RL1A 2L0DA 4WTWA 5DJZB 3PL6D 5T3XL 5IYDH 4ELMA 3ERSX 4HV8B 2E7DA 4A37A 4WI8A 5E4EC 5DGQA 2ZXQA 3ABMB 2QGBA 2K01A 4WJ3M 1HZBA 1IW7D 1K0RA 3RZDH 4J8RA 2X4RB 5E1GA 4BCZA 4NM4H 1AHWA 4KLKA 1TWFB 1VB9A 1Z9SA 1Z3RA 3UYRH 4OF7A 1I4GA 2F5AL 3RMHA 3LKNA 2DICA 2C3WA 5SWZB 2PQAB 1G0YR 5DRWB 4F3FB 5I0YA 5M3MB 3GTOH 3BSZH 4RCAA 1DUZB 1HHVA 4P59L 2PW2A 4C3HH 4TUJA 3U9WA 1KRSA 2K7PA 3EFOA 1W72B 4G7HC 4ZMNA 4NO3A 3IM1A 1AXTL 1AGBB 1HNXL 3L4VA 5L4IA 2UX6A 4M1UB 3O2DH 3N1GC 1ID2A 4YGAB 1GJWA 2NB0A 2HTLD 3ATFA 1FNGA 3SQRA 3VAEA 4F9PC 3SDYH 3AAZA 3QJYA 3QQXA 3SBPA 1HNWQ 5JJLA 3W11D 4L4TA 1EMTH 2BCKA 5MHSD 5CGTA 5D6CB 2ZOKA 4D0BB 2UXGA 4CW1A 3S5LG 4JO5A 1AR2A 1RZJL 3EGDA 1Q94B 3PDGA 2FEEI 3D3VB 2R7EB 4Y7OC 1GAFH 4CC4C 2E47A 1ADQA 2DMGA 5EIIA 2D31B 4APQC 2CBTA 2UUCQ 2IFFH 1C7TA 1NC4A 1S9WB 2HVJA 1YEKL 2TSBA 1LACA 3NA4A 3NIFE 4OD1L 1OTCA