3K6OA

Crystal structure of protein of unknown function duf1344 (yp_001299214.1) from bacteroides vulgatus atcc 8482 at 2.00 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
TVTIAMATVEKQPQYDAPYLVLDNGEKLWVVQHIVPYRDLKAGERIFGNYSFLEAGESGFAYNIRLNDYTLVPVQKIIGLNPDNMDSIGNMKVQIKDMWPSDDYLNVRFMLNFPSPQKPILNLVVNEMIPWTKDGYAHLELRYNNNGSQGRLVPGMVSFKLDDYSPENSELKGIKVLVNPVDGEEKTYIFSYPLTGEDVPGFNPLDLAELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein DUF1344
publication title Crystal structure of protein of unknown function DUF1344 (YP_001299214.1) from Bacteroides vulgatus ATCC 8482 at 2.00 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
total genus 44
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3k6oA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3k6oA02
3K0YA 3QWNA 3K6OA 3NQIA 4PQXA 4J8QA
chains in the Genus database with same CATH superfamily
2EZVA 5CEYB 4YR6B 3S0PA 4NCDA 5JW3H 1OM9A 1UB5B 4J3OH 5DEGB 4OBRA 1IE5A 4XI5D 2GJPA 4PZ8A 4HCSA 1QAWA 4MZIA 4PLKC 3EROA 4PJEE 3PO2B 1IBGL 3RY6A 2PZUA 1HEZA 2X6LA 5IYBH 1IAIL 1NANH 3RL2B 4NQEE 1PD6A 1IHZA 2H3KA 4IMKA 5A7BA 2NQDA 4DR2L 4A3CH 2VL5B 2AK1H 3PHQA 1SEBB 2G2RB 2D0HA 3FKIB 3U9PL 3WLWC 1IEAB 1JZ6A 3HE6B 1SLJA 1PCXA 1KIXA 3HI6H 3KL0A 3MJ9H 2BNQE 3NRQA 1KENH 2K7PA 3ABGA 3KCPB 3PWLA 4BSVB 3F7YA 4D0CB 2GJJA 4W9JC 4HIIB 2APTA 5D7JA 1VCBC 2YN3A 1C4QA 4HG4J 3FUHA 2G5UA 2OMBA 1HR0W 5LXVA 4XMVA 3OKKA 4FA6A 4FERA 3CMEA 1A4BA 2ADGA 4QGYA 2EIZA 2MO0A 3DIVA 2X12A 4XCFL 4XRCB 5DTFB 3EDJA 1TS3A 3L1OL 1UJ3A 1ZWIA 2WLYA 2VC2B 3P9MB 3PABB 4W70A 3S3SA 2A6HD 3BUIA 3N50A 5IIFA 1HQ4B 1OT2A 2R51A 5B8CA 1AZVA 4AV0A 4OO1I 3V7AE 5DJCB 1KBBA 3NSCA 1GH7A 3O11B 4ODSL 2PZTA 5A40E 1OAUH 5HYJD 4KKZA 5CLTA 3L5WA 3CFDB 1X4ZA 1TG8A 2FK9A 2X89A 1S46A 4LPWA 4YN3A 4MD5A 4G8EA 3TV3H 4G6MH 5CLWA 2Y06H 3GLDA 2Q87A 4GRWH 1QRNA 3MCG1 3MNMA 1A6TB 3ULUE 1SF3A 2Q2LA 4TV3A 4NS0A 4UINH 4K14A 2UZPA 2K6AA 1AS7A 1YO4A 4V33A 2XWTB 5DS2A 3PHAA 1WZMA 4LGRB 5DAUA 1Q1PA 2EKJA 4LHQB 5CUSH 1QQDB 1JNLH 2PF6A 1IL1B 1CBJA 3Q43A 1J12A 2P42B 1B3JA 2C9AA 4FFYL 5L9DL 1I9RH 4A3GG 1R3LB 2DW5A 2R2BB 4A04A 2HKAA 4G8AC 5CGYC 2AITA 3V0WL 5F7HA 3AY4C 4W4OC 4XBPB 5C0XG 3TBIB 2RFXA 3KR3L 1OXXK 3IDXH 3KPNA 2KL6A 4XT3B 1KCSL 5D7KE 4TULL 4RQQA 4M62H 2F3IA 1MVYA 3NZUA 5JO5B 3IFDA 1J1OH 3APCA 5IWAQ 4E2OA 1KGWA 2GVYA 3HZKB 2ASBA 1S7UA 1OE3A 2A19A 1A64A 3FH5A 2EO7A 2AZAA 3GPSA 4HF5H 4HXBL 1TJIH 3ISWA 2IX0A 4YHZL 2PETA 5DJYB 4P46A 1AQ8A 1FGNH 3DM3A 2QF7A 1R9TH 3DX6A 2BP8B 3DECA 4N22A 4WEMB 4EI6A 1KGXA 3CDCA 4WHYG 3E7JA 4Y1AA 1GS8A 5SWQA 4IPDA 3IDNA 3RAJH 5FR3A 2EYPA 5F1IB 3PXLA 4ZRGA 4RAUC 1GGIH 5H4YA 2HFGH 2WQSA 1EGJA 1B2WH 3P4OB 3SKOA 5J13C 3E5SA 2VR7A 2FE0A 4XMLH 5IGXL 5KZCB 3SO3C 5J89A 5DHVH 3L4VA 4Z8FH 4LF3A 3FF7A 1DL7L 1WIOA 4PJAF 3K5NA 1NOAA 1AKJB 3KLDA 3MNZB 4R96B 2YFOA 3S2CA 1BW8A 3AMUA 1P7QD 1UWYA 1F58L 3UL4A 3ME0A 3VO0A 1DJWA 4DO5A 4F2MA 2AHOB 1ED3A 4ZFOA 3C9NB 5C3EH 1N0LB 3RZOH 3CSPA 3LRLA 4HEMA 4KKCC 2TRHA 3MBEC 3MRIA 5DU7A 1VFOA 3C5ZA 4JN2A 2R23A 5HD8D 3L7ZC 5K59F 5JHAA 1KLFB 3DHJA 5HDQH 4KK5D 4HSCX 1TVBA 5J9PA 4LGSB 5IOKA 4MMXC 4UBDC 1XDTT 4N68A 2EXDA 5J3HC 1UNSA 3WO3B 4A75A 1KC5H 2MQCA 4F8NA 4QPEA 3MRLB 3D34A 5BV7B 2HZHA 4ZSOB 1UE1A 3BESR 2XKSA 4OAWB 3D3VE 3G5ZA 4JCWA 5I6XC 3WS6C 2EYMA 5E9DB 1HE7A 4X5QA 1L9TA 3PWPB 5I6MA 2H32A 1YMHB 2IDFA 5C09D 1S7QB 2HYMA 1EYDA 4XTCS 3HTLX 4M8QB 5CINH 2B2VC 4HCGA 2ZM6L 1L7TH 3S8FB 2WQWA 4XT1B 1CDYA 4IIQC 2A4CA 3VFSB 3FUFA 4TXVB 4ZO7A 1TCRA 3D6CA 3VA7A 1S7TB 4MQTB 3GMRA 5MENE 1NBZB 2KCMA 2IFGA 2X44D 2X4OA 2RDHA 2Z7WA 3GMMB 2PKDA 3KLAB 4NRYA 4O5LH 4Z7UE 3QHZH 3M4PA 1K4CA 5D7EA 4ANWA 3HW7A 3QDGA 1A6VH 1QE6A 3FN0H 4XXDA 4YO0B 3RZCB 4JZNA 4LESA 1RIUH 5IYDH 3LPGA 4L8CA 2VZUA 2F4VQ 1WISA 3EGDA 3IS0X 4KKAD 5JTWA 2K4KA 4YWGH 4K2UH 5C0NC 5HHNA 1KDBA 3CC5B 3Q3GB 1W72A 1PG7W 3QZWA 5GIRB 3TO2B 2PYED 2HRHA 4BWTA 3EBIA 2BIMA 2XFGB 3KPPA 4HJJL 3MJ7A 4D9LH 3SY0B 3MUY1 4XYQA 4N8X1 1CGVA 3QCTH 5JA8B 4LPXA 1K83B 4L3EB 1CLZH 2XU9A 2ZJSH 1GIGH 4KV6A 2YPLA 3BAXA 2A74C 4FNTA 4V2BA 3CBKB 3A22A 5AVWB 1NSNL 3HOWG 4H1LG 4RHRA 3BVVA 2XYBA 1EIBA 1JR0D 1X9NA 3W9DA 3M1BB 3QQDB 1NGWB 1G291 2ZKHL 2ZOUA 1PQZB 1L0QA 4JFDE 3Q48A 1U8LB 5IQLA 3BKJH 3TBYB 3P77B 3E38A 2DLGA 3QZNA 2ADFH 2B4CH 2FVNA 3SDCB 3VW3H 4NNXA 1S9WB 4X6EA 4FQHA 4I48A 1XD1A 1TTFA 4QRTB 5I23A 4OIFA 1ASQA 2KC0A 1D9KC 4K3HA 4PWIA 2JMRA 4MTNA 4X7SH 2OTLA 4F92B 3ML9A 4XNZB 5L6YL 1MFAH 2J1WA 5I5RA 4B3SL 3HP3A 5I1JH 5EGTA 2ZCKH 4UTAL 1JZ2A 3ZN6A 4QXGH 3GLAA 4U1HA 1EYGA 3TNNB 4YXHH 5IQ7H 3SE3C 4ZMPA 4F87A 3SKMA 4BFRA 4A3LG 5C0XI 5DR5H 3WIHL 3ZR5A 3PPSA 1O7YA 1XT5A 2KDGA 1ZHBB 4YDKL 3WJMB 3QXTA 2MCAA 5FLXc 1XEUA 2BJMH 2BSTB 5GZNA 5ESQB 4RMVA 1YITA 3KLRA 2YD7A 5DMIH 4XQQA 3SDAC 2X4UB 5DMKA 4I18C 3GHBL 4WWKB 3X17A 4J3UA 5KOVC 3DLLA 1CZWA 2Z8VC 1HH2P 4XDXA 3FQ4A 1I85C 4YO0A 2AGJH 1JV5A 4PS4H 3P30H 3KPQA 3MRBA 5BPPA 4EQPA 3AMKA 4HSAC 4XPTH 4WTXA 5EFIB 5TH2B 4MRBA 1ZGLM 5GS0H 1NFIB 1QVGA 2GIXA 4QAMB 1YVLA 1ACYH 4RG1A 4EQNA 4NKDA 1IW7C 1YJWA 2UUCQ 3BUQA 5ANMB 1OXVA 4OF0A 4UV7H 3T4AC 2E7DA 4UTCA 4BBWA 1FC1A 1D7CA 3A5UA 1IM9B 2OTUB 3ESNA 4F7MB 4HULB 4HJEA 2GYSA 1T1WB 2H9GA 1CQKA 1TQTA 2NXYD 3BVXA 4UTBH 4DEWA 2VJ8A 1WWCA 4Z7VE 2L11A 1QW9A 1N59B 2EDXA 4G1EB 2L04A 3GXFA 4R0LA 5HI5C 4M7ZB 2HN7A 2MQ0A 4PJBA 1E65A 1P7HL 1XF4B 4M1UB 4GKJQ 2WQUA 4J8QA 2JE6I 5C7XL 4IGBA 1EBPA 1MHPH 1QLEL 1RP8A 4KAQH 3DOHA 3TSSA 4NZUL 2AJZA 3PS6A 1FPTL 3F5WA 4EN3C 2W07B 3BP7B 1YDPB 5LL6S 1GYUA 1N7MH 4DV7Q 2NY0D 2XSKA 3QIBD 4C4KO 5DURD 2ITFA 1AANA 2PPFA 2DQMA 5C44G 2IAMA 2XA8H 5C4JH 2WIMA 1IC1A 3U0PB 5F7AA 4FYSA 2A9NH 4ZDHB 4DKFH 1RZ8B 3O4LA 1NBCA 4KUCF 2WPGA 4EQ3A 1F4WL 1A7RL 2VUMH 1I94Q 3INUH 3KXFA 2HPTA 2K14A 3V96A 2BY3A 2CHWA 3OAUL 4NZRH 3CXDH 5DRNA 3I02B 4M1CD 2Z8RA 4CDGC 4KHVA 3VQ2C 5KTEH 3T1HL 4TSAL 1X3DA 5JHDA 2XDHA 1ES0A 3HJ0A 4S1DD 5IZ7A 4JI2Q 4L5FE 1KSRA 4QGUA 4I8DA 3WHE0 1NAKL 2HB0A 3VTTA 1YI2A 1A02N 2VKXA 2WB1E 4A3EH 2HG0A 1AYRA 4WF7A 1PH3A 4X9IA 3SBWC 1Q90A 2EKSB 5HPOA 2AWNA 3C09C 4ZNEE 1GZHC 4Q6IC 4YHOH 2CBQA 1BJ1J 2HTLD 3JWDL 3UTTB 4P71A 4H25A 4H1LH 5EEXA 1QBAA 3FQRB 3FT9A 3OGOE 1G7LA 1OKEA 4N8VA 1AOZA 2EJFC 3VE0B 4NQSA 2CCLA 2WUBL 3FRPA 4HPYL 2RQ8A 4WRDA 4NQDE 1YNKL 1PZ3A 4FYRA 4U3CA 1PTOC 4N2KA 1AXTL 2ZUYA 4RGOH 3H9SE 4KKSA 3OW2A 1USQA 5BUGA 3RWIB 1ANUA 1JPSH 3WHXA 3ZTCC 1EGJL 1PLBA 1MFEH 4Y4KC 1INQA 1G87A 3WU1A 1ADQA 1PU0A 1XF3B 4JRWA 4KRLB 4BY1B 4YDMA 1FWXA 3AQDA 5LN4A 1RI8A 2JEAI 3MJGX 3L95A 1BJ8A 2L7QA 5IJVB 4FG6D 5IGCA 4A3LH 3WFHA 1EEID 1QPXA 2WW8A 4HAGA 2WBJC 1ENFA 1VA9A 3NJGA 3VXSD 1KEML 1JXGA 3M7OA 2BHYA 1ZLWK 5HGDB 3CQZB 1STHA 4Y52H 1A1MB 5FO7A 1XR8A 3CP0A 4X99A 3GM0A 1STGA 4LKXB 2KQ3A 4ZQ3A 3MYZA 2Q6WA 1PZUB 1U8NA 1GAFH 2VW4A 2H6UA 3LN4B 4W9DC 2QA4A 1IFHH 2PO4A 1YZZA 1YYCA 1QPKA 1RPQA 8CGTA 4M3JA 2E4TA 3HKZE 1S2EA 2KUMA 2Q20A 3DVGB 3AFPA 3VR4A 1KBKA 1OSYA 2JJTC 4PTUA 3QUYB 2V2WA 1ID5I 1YSOA 4RETB 3S1MB 2F1AA 1G7PB 3D4WA 3JTSA 2Z35A 3LH2L 5E24E 1R24B 3LRHA 3ECWA 4Y19A 1S3RA 3KPMA 4KXAA 4UQDA 5AUMB 4GP5B 2HCCA 2OXHB 3MSPA 3U1SL 4CMHB 3TLRA 5CS7A 1GOZA 2CW0C 1DP0A 1CGWA 1L0PA 4K0OA 5IB4A 1X65A 3VR2A 4NIYE 5JDSB 4RCNA 1CXLA 2YQBA 1NUFA 3CW2C 4AXWA 2O30A 2DBLH 3RTQB 4IRJA 1MY5A 4FS0A 1J5OH 1EHAA 3D4DA 1MF2H 1J0HA 1T5WA 1OLLA 3IFNL 3LPWA 1AE3A 3VFTB 3ZDYE 4CKVX 3GXDA 2P8LA 2FR4B 4ZFGL 4UP8A 2DMCA 1M1SA 3A23A 1F4YH 1TNMA 3ATBA 3GSXB 4NPJA 3WD5H 5CF3A 5I2IB 4K8RL 5IV2A 1MCEA 1O6SA 4JN1L 3BGMB 5EZLB 4BZ2A 4G7SB 4MNQD 2V17L 4ZAKD 1OGTA 3SK6A 1TETH 2KENA 5IB1B 1GW0A 2GAZA 5D1XD 5IW3A 4QB4A 2WC7A 3OGCA 4X5WB 1HX0A 3UC2A 4X6CE 1DDHB 4AYDC 5IMKA 2FWOA 1R3JB 1JOQA 1W72L 4V1DA 6CGTA 4R2GB 1DLHA 4IKNA 1MGSA 4UM9A 3QGVA 3W56A 4BFGA 3OWEA 4LASL 5EOCH 3WN5B 3MLRH 4P04A 1EANA 1MCSA 1AGEA 2GC7C 3GSNA 2P5WB 3O2DH 4LVNC 4IDLA 5E2UH 3WBDA 4WKZA 3D25A 4PSPA 3SDYL 5BQ7A 4JANB 3L8QA 3A6BH 3QJQB 1JN6A 2EYHA 1FZMA 1EHLL 1MY7A 2ROXA 3DSFL 4PJHA 1QZ1A 4PJBF 5IHUH 1HZAA 1RUAL 1U8PB 4BA1I 3E8UL 4G9DB 4I2XE 4I3GA 5INCB 3NAAL 4Y9CA 1IARB 3W5MA 3W0WA 1B3QA 2A77H 4GXVL 1JZ5A 1V1OA 4EOWH 1HZLA 4ZYSA 3P20A 1NPUA 3QA3A 4YC2B 5EORL 1SEQH 3WKQA 1LEIA 2ITDB 5T3ZD 2BVYA 1U4EA 4KJPD 1N9PA 1Y1UA 4KMTL 4RGMB 5H2BA 4PJGA 2FO4B 2IF7A 1RFDL 3EDEA 3H6JA 2JI2A 1PXUA 5EBWA 1MBYA 2AFNA 3KLQA 3AWFA 4FTVB 3L3DA 3NUCA 2F0CA 3TA3C 4A3FG 2OW6A 1R5WB 1QYGH 1UGKA 4HIOA 2EACA 3MMEB 4PJ8A 4WGKA 1FFNA 3FU6A 1S7RA 3IETA 2IANE 4ODHH 1G94A 3O4OB 3EJQA 3B9EA 4PJ7B 4Y5YB 5J12B 1ETZB 2I85A 3T51B 1TTRA 3UAAA 1QZNA 1QLFB 3DUUA 5K9KB 4G9FB 2MFNA 5CSGA 1ET5A 3UABA 2B8GA 1F11B 1KTDB 3VWJB 1G7HB 2BMKA 3CBJB 2XC8A 3D12B 1YNND 3CUPB 1XF5A 1PX4A 4HFWA 4J8RA 2X87A 4MD4B 1L1OC 3MRRA 4GOPC 4MCZB 4HSVA 1IXRA 2J8UF 4JBWA 1DSYA 2V6HA 3CFKA 2W0FA 4NO0A 4XMKL 2E27H 1A6XA 5L4JA 1JORA 2X3BA 5TDOB 1VCIA 1EJ8A 3ZKXC 3S14B 5D96B 2NSXA 5I1EL 1A2TA 4P49A 4NQCB 4WJG3 3MA2B 3PQIA 1VQNA 1DBAH 1O7DE 3EBHA 2J6EA 1UE5A 4YHHL 5CJOH 1ZLVH 3B3IA 2MCMA 4AWJC 4EX5A 2M2DA 5JHLA 4OZIA 1JRHH 3V4PA 1R9FA 3BEWA 1FE8H 5H4ZA 2BFVH 4P5SA 1V3JA 3JV4B 4KQ4H 1S7WB 2R69L 1RJLB 2EDEA 3IJYB 2ZX9A 4TUKH 2F9BT 3NSXA 1T04A 2WXQA 1WTOA 2PCPA 1DQDL 5IESL 3AADB 2QR0B 3D39A 3LS5H 1FFPA 3JYCA 4AZ8A 1RLWA 3D50A 4GP4B 1T2QH 5CD3A 2UWEB 5IREA 1JXDA 2RCNA 3L4CA 4U2ZA 3IKKA 3AFLA 5B3JF 3S8WA 3QDJD 5JR1H 3GSVA 3II2A 1MHCB 1UT9A 5KUMA 5JHMA 5M7QA 3EF7A 2NY3B 3DRTB 3V5KB 4NO2B 4MJ4A 2AXWA 2OP4H 5D4QA 1SBBA 4JO4L 4DT2A 3RGVC 1WFNA 1MFDL 2IV8A 3PDGA 1E4WH 3NJLA 3DXAA 3JYBA 4IU3B 3NWSA 4MAYB 12E8L 4ICXA 1NMFA 1HQRA 3BUYB 1EK3A 2CM6A 2CU9A 3RVTC 1U3HB 3VD2A 3L0OA 2ZXGA 1JRHI 2BNRD 4POYA 3GGWB 5SX5H 1S5HB 1CE1H 1T3FB 4FQ2L 1K3BC 3HOXG 5KSBE 3NIFB 1PD0A 1Y1DA 3N40F 4LPVA 2D03H 3AXLA 3HN5A 4P3DB 3D0AA 1YC7A 4LLWB 2IQ9H 2W65B 2PUQT 5D93C 4YXLH 5TK2A 3RNQB 3CFIC 1UUPA 1IC5L 1QUPA 5I1DB 1QOKA 2EO9A 1CU4L 2ATKB 2KA7A 4JRFA 4PUBL 2ZUQC 1RTNA 3Q8AA 1F41A 4IK6A 1IEBA 4MBRA 1CXIA 4QNPE 1RUPL 1I3RA 4ODWA 1JJ2A 2FJFA 5AALA 5EU4B 3STZB 5MEPB 3MKGA 1Z2KA 3KLKA 3QZOA 4Q56A 3KPLA 3BAIA 5F88B 1GCYA 1ADQL 2HKHL 3MROA 4LARH 3OAWA 4AT6A 1I50H 4PGDB 3IN2A 4IS6A 3OOCA 4UV4H 2DKMA 4IMLA 4QOKE 3NENA 2D7TH 2X2YA 3FUMA 4ME3A 3I9PA 3VXUE 3VYNA 1ASZA 1VDGA 3MJ9A 2XKNA 4YOKA 4ZBJA 3AITA 4NQED 3QQ9D 2GJ6A 2WXHA 4S0HA 4GBXB 4L5SA 1MW3A 5F3BA 2LKVA 3CVIL 4A3FH 4N0CC 1UUSA 4PS7A 1IKFH 2KHSA 1FUNA 4WJ5A 1DFBL 3FONA 4LB8A 4EVOA 3L4ZA 3P0GB 3UJJH 4A2EA 1DQQA 1NGQL 2OM5A 4XWGL 5LXGL 4YVUA 4HLJA 2ESVA 2V37A 2R1WA 1KPRB 4AGNA 1DVUA 3T6XA 1O7LA 2NY4C 3LGJA 1KCUL 2JKXA 2KEEA 3RNKB 1EO5A 3ARDB 2F0HA 4LAJH 3WIIL 3IVKB 1MLCA 3HVNA 1SMAA 5E70A 4Q14A 4NZDA 1MIEH 4ALAH 3M8OL 1DZ0A 4NJAL 1JPEA 4TSSA 1Q12A 2N0MA 4TTDC 2WZ6A 1FFQA 1U93B 4XPGH 3T08A 4AW4A 1BOGB 1FL3A 3BXNB 1QUNB 2CGRH 5DD1L 2FIKA 4LSSH 2RH0A 2VO5A 4BE6A 1YQVL 4YLCA 1KYAA 4Q4IA 5I1LB 3VD1A 4NENB 4PMCA 5C0FA 5FAAA 2ZKXA 1KXHA 4PJGF 5I19H 2VXVH 1NLDL 3TC9A 1YN6A 2VZOA 2K28A 1QVFA 4PLJD 4HCEA 2F08A 3O6FC 3S3DB 4DESA 1IUZA 2NVQB 3W82A 4D8PA 5I8OL 2I5HA 3ARVA 4S2SA 4HWNA 2YEQA 4Y4HD 2J6WA 2P28B 3SE4A 2V7NA 3B7RL 3RA7H 3QO0A 4BZ2L 5D6CA 4HH9A 2ZWYA 3QXDB 3C87A 2NW3B 2HQEA 1CFQB 2A69D 1A22B 4MMZA 3QRGL 5HHQA 1WTRA 5B21A 4JBMA 2JK8A 1OPGH 3PUCA 4AMWA 4W81A 2B2XH 5CSZB 3ZQ9A 1FNGB 4S1SL 3BGFC 3ICEA 4M5TA 2XRSD 1BD2D 4HGMA 1FLRL 3NIGF 3WL9A 4P59H 1JNHB 3GSNL 2F5BH 3QB3A 1AXSB 1BX2A 1KJMB 1LK3L 1J5EQ 4IBQA 3WI9A 3EYFB 1XH0A 2HH0L 5E1IA 3TEUA 1ZHKB 4PJXA 1IKLA 4B3TL 2RQXA 3I6SA 1NCOA 4CU7A 4ZUIA 4TVUA 4GYBA 5DK3A 3HOXH 5EU6D 4GUOA 3QJFB 1T66C 4JPWH 4F3FA 4AL8L 4L18A 4KJQD 1WCBB 3FH7A 5C0BB 1E6JL 3MRNB 4BHUI 5A3ID 3VFPA 2ZPKH 3PIQB 1QFWH 1E28B 3Q6FA 4FABL 5IEHA 5DHVA 1JYNA 2J71A 2AK4A 5L0QB 4XX1E 2MNJB 4JAMB 3ZKNC 4OZIF 4HIEB 4NQQA 4NFDA 5IHZA 1JZJA 4DV4L 1TENA 2DJSA 4WV1A 4ERSL 3DA0A 3O9WD 2C7UB 3FW6A 5CEXB 3C1FA 1K8OA 4XC1L 4DKEH 2IQAB 2IH3A 4FQCL 3IGAA 3DX7B 2Y3AA 3BP5B 5EUOA 3I56A 1QBMH 3ILEA 4P5KB 4JI5Q 4OVVA 1TPXC 1UOKA 4HUWB 1PLGL 4PJAB 3QZMA 3JAML 4PSRA 5IBUG 1RZFH 5EOQH 4HOXA 4OJEH 3T4YB 1N0XH 3F6IA 5JYLA 1H3UA 5IW6B 4DUZQ 3OW7A 3MC0A 5SWSD 1P53A 4BFBD 2DY8A 1I8AA 3NPZB 5D14A 1OW0A 3UDFA 2XIIA 4GXUM 1S5FD 1P7QA 2G3NA 3ESVF 1U8IA 3ZT7A 1KEGH 4YFLI 3NYKA 1XZ0A 4DKTA 4OFPA 3ESOA 4JX0A 1LO4H 3CF5A 4EMZA 5AAWA 1NCAH 3IJSB 1TFHA 5IB2B 3MRGB 2Q1EA 2D31B 2I69A 4N24A 4XH2A 2HG5A 2QFRA 2DQTL 1AIFB 3VFVA 2BA0A 2D0GA 2W60A 3T6ZA 3HC3H 1A8JH 1SFHA 4J3OF 3GK8H 4WFEE 2D4DA 4TPRH 4DKAA 4JRYE 5DJ8B 3ILQC 1G4MA 5KYUB 1JWSD 5FOJA 5BS0E 3S88H 1S7VA 3F3HA 4ZG1A 3B9KC 4R7DB 5E8DL 5M3MH 4AQ1C 3C6LC 3TASA 2V0AA 5C09A 1B0GB 1F86A 5K5PA 2A0LD 4HIHA 1IC4L 4PBVC 1SXCA 4DP7X 5MEND 5CCKL 3ZJYC 1IVLA 3SYAA 4S1QL 1NWOA 1E5UI 4KQ0A 1GKHA 4LRIA 4C3HB 2PTTA 1HEZB 3TS0A 5AL0A 4PMBA 3ARGD 4MXWH 5D1ZB 5DHEA 4WSJA 3I2CL 1GL4B 1X4YA 2PWHA 4XTRD 1EAPB 3E0GA 2ROYA 2FATL 3PHQB 4GSQA 2KQNA 4L4VD 1BXAA 3MRRB 4XMUA 3VXMA 4PGEA 1BF2A 5LAPA 4DUXA 2CH8A 1YMMD 1FVCB 2O4EA 1HINH 1VGEL 1LP9E 4HPOH 4ORZC 3U6XA 4RA8A 4QDGA 1NBWA 1F2XK 1FRGH 1TXKA 3PWLB 3F7YB 4NSKA 1T20B 4KRPD 2PPCA 3X3GH 1BQKA 4YSDA 4B9ZA 5GXBB 2OK0L 2WZPD 5D2NC 1ZANH 3OKKB 5DJAA 1N34Q 3FO2A 5ENWA 2E9IA 2MKLC 3GTPH 1DJSA 4RMRA 1VACB 3FQTA 1UJ3B 3LNIA 3PHOA 4JDEA 4WFGD 4TUJA 5E4OA 3LQAC 5MP6H 3HG1D 5LWYH 2DKUA 3GC3A 4WI3A 5B8CB 3HI5H 2YD9A 5KSUA 1XSOA 4F27A 2UXFA 3M6DA 1EZLA 2KEDA 2GSIB 1H6EA 4QEGA 4XN5A 5AOMA 2WB1G 2X4NA 5JW3L 1G84A 2DMKA 2NNCA 1F9QA 1QLEB 2HVJA 4TNGA 4XPFL 2EVFA 1EO7A 1DJXA 3RVVC 4MD5B 4G8EB 1WFJA 5HDBE 4ZUSA 1YNLH 3BWAA 3ERQA 1RTOA 4AYBE 3IKCB 2ALAA 5FS5A 2G5BA 5CM1A 8FABA 2DQDH 3QJVB 1JP5A 1WTHA 3PV7A 5AVQB 4CGUB 1YHQA 2XA3A 1A6ZA 5C0JB 3HI6L 5CBAE 3BIBX 3EH5B 3U79A 1IM3A 2X6BA 1KENL 1FIGL 5BRZB 3CU7A 1HPCA 4QUOA 4Y8AA 1JAEA 2F0FA 3D69A 1HJCA 4YAQA 2P5EA 4GY4A 1SYEA 5IEKB 4IZ8A 3SQBB 2AEPH 4PJDA 3FXIC 3RUGA 3TN0D 3L5JA 4AM0B 4UQ9A 5BRPA 3OKEA 3L4XA 2VDOH 3KPNB 4UTBA 2ZJPA 2ZYIA 5IVXA 4PJ6A 4C8XA 4ENZA 4PJXF 5LMNW 3MRHA 1GSMA 3GTKB 1S7UB 3C5XA 3V7MA 3VNYA 5CORA 2AMGA 5LDSA 4TL4A 3QFJE 2BHFA 4JI8L 1F4HA 2K5QA 2ID5A 3RWDA 2Q3ZA 1IYUA 2VQEL 1JG9A 2BIPA 2PNDA 4P46B 2IC2A 4Z0BL 4IOIA 1OSZA 2WAQA 1OAXH 2P9RA 2F6AA 4JYAQ 4JUSA 4KNTA 1X3GA 1AP2A 3CFCH 1AJ7H 4Z7WA 3TV3L 4EI6B 4HUUB 1J5HA 1TO4A 2Y06L 2NR6D 1OXUA 3NCYS 1YY9C 4K9EH 1OD9A 1FFTB 1PIGA 4UT9H 3UAJA 4FZEH 1WP6A 5JIPA 4NJ9H 1W8NA 1U5KA 3SKOB 3IU4L 1TZAA 2BSED 3WSQH 4TQ8A 5EUOF 5CUSL 3VI3A 2LVCA 1WD0A 5F0JB 1J8SA 4CC1A 2WGNB 1JNLL 4LF3B 2E2IB 3OMCA 2LS01 1T22A 4P2QE 5IB5B 1I9RL 5FGRA 3RGHA 2BIHA 2QSVA 1F18A 4YQXL 1ROCA 3TWYA 3MDJA 4YIJA 4PB9H 2XV3A 4E9RA 3X1BA 4Z23A 1BREA 5IFJB 3BGAA 2R0WH 2R7EA 3MGTA 3ME0B 3QPQD 3U9WA 4F2MB 4A3KH 3VFRB 4BSWA 1ED3B 3IDXL 3ATEA 4ZFOB 5FGSA 2DJFC 1AGFB 3I9GH 4H5SA 1J1OL 4EIGB 5EWIH 4P48A 1AE2A 2R23B 4C47A 4JBJA 3RFZC 4JY5H 3O0LA 4H1LA 4HF5L 5J9PB 3ZOAA 3FB6A 3S96A 1Y8PB 3HE7D 2MNWA 1LK2A 4AV4A 5EN3A 4BFFA 3TRZA 1RUQH 1PKOA 1SXSA 4FQQA 4LNVA 1FGNL 4ZD3H 3LVEA 4OT1H 3BZ4B 3A7LA 1ZA6B 2NN6G 2XY2A 1A5FH 4HGWA 2J20A 1KPUA 1OF0A 3GT6A 3RAJL 5E03A 1ML0A 1IT9L 3KW7A 1FYCA 1GGIL 4K5NA 4DCQB 2APSA 2HFGL 3JBG7 1B2WL 3R4DA 1CD9B 1D7FA 3KD4A 4XXCC 3WELA 1EAOA 4FHKA 4ID6A 2FSEB 4XMLL 3H9SD 4Z8FL 4CN1A 4JQIH 1JNJA 2B1HH 1TCRB 3GMRB 4KDTA 5F89B 4NRYB 2B5IB 1MOEA 1K4CB 5EJWA 2BHUA 2EQSA 1ENCA 1TJGL 3QDGB 2EYRA 3GMOA 4XXDB 4DK6C 3OG4B 2I60H 2V5SA 4JZNB 2BVUA 4L8CB 2I46A 2JWYA 3AS3A 3EGDB 1THAA 3T2QA 1CKMA 3M07A 4F1ZA 5HHNB 1C48A 5B1BB 5M95B 5J6GA 5HDQL 1W72B 3QZWB 1DONA 3I84A 2AQ2A 4EIZC 3Q8BA 1Q46A 3ZGIA 2JYOA 3LKRA 3MJ7B 5IK3A 1JOKA 2KUTA 1KC5L 5C0CE 3VXSA 2XOTA 4MD0B 1MHWC 4JFUA 2E56A 1AO7A 3SOTA 4JFHD 4WK0B 4KFZC 5EU3A 2YPLB 3ZQWA 1BVOA 2LLNA 3TZUA 1F3RB 2E7LC 2X4TA 2LFNA 4I7AA 2JIXB 4JFZH 1IAOA 3W9DB 5KYWA 3OMIB 5ESAA 4NQTA 1F4XL 3K8AA 3WTVA 1L7TL 3KLSX 2W38A 1P16A 5BW7C 5D2LE 5IHWA 1STBA 4NNXB 4X6EB 4I48B 4O5LL 5C7ZA 1QLRA 2CUAA 2X4RA 4C4UA 3QHZL 3BYTB 3D6WA 4E9QA 1A6VL 1A4JA 3FN0L 4MB4A 2WJ7A 4AVJA 4E9WA 3EH1A 4L8BB 4FX5A 4LXFA 4NN5C 3TT3L 2EPBA 1RIUL 2Z9TA 4LFBL 4PRBB 3CBRA 4W68A 2O61A 3SKMB 1M1XA 5L8JB 4LLAA 3GV3A 1MFBH 1HZ9A 1G0XA 3OXRA 2C9UA 5EC2A 1BVZA 3FN9A 4FQ1H 5E0FA 1C7YA 4D9LL 5I15L 1FYTB 5D2NE 1UD2A 4G5AA 3J81j 3QCTL 2DICA 2OCJA 3CDGA 3JT0A 1VFMA 3O2DA 4TNEA 3RZCC 4AX3A 1KG0B 1CCZA 1CLZL 2HIVA 1WT5C 1EFWA 2ED6A 1LTSD 1GIGL 2BE5D 1JV5B 2MUYA 2B8OT 2HT3C 2P1YA 4YXKL 3RUGF 3KPQB 2YC1A 3MRBB 4AQOA 2WYZA 5IVXF 3ZO9A 4LT7A 4DGIL 2E2JB 3L5HA 2VLME 1Z9NA 4CC4C 1N6QL 4TS6A 4NKDB 1KTBA 1Z7JA 2JB5L 2YMXH 4NC1E 2UV3A 1FGVH 3BKJL 2VYRE 5JPNA 3VW3L 2ZWSA 1XGPA 2ADFL 2B4CL 3DGDA 4GO6B 4YNYA 1KYUA 2K6ZA 4AEEA 1X9RA 2RKSA 2FRGP 2H9GB 5EBGA 5F7EL 5KN5A 2NN6H 1AS8A 4Z7WF 1QILA 3DURA 4BIKA 4X7SL 3ULVH 2VLJE 4WO0A 3BW9A 4R0LB 1MFAL 3VFUB 5I1JL 4LIQE 1AZBA 2ZCKL 1WTXA 4PJBB 2XZCH 3KPRB 3GB7A 3PF2A 4M93B 4QXGL 3S17H 4YXHL 1T5EA 3GLZA 5IQ7L 1JTPA 4NWTH 1Y8OB 1KTRL 4H8QA 4IGBB 5AVUB 4LL9A 4ZUJA 4YLBA 5DR5L 3SGIA 5TK4A 3C08H 5IVNA 5J22A 3SDCC 2VN6A 1LE5A 3F5WB 2BJML 5K9OA 5F93C 5EOCJ 3GBMH 3EYQC 5DMIL 4XBGA 3U4ZA 2EJ1A 1RURH 4YFEA 1FR3A 2V2TA 2IAMB 3KHQA 1A25A 3WDNA 1SYGA 5IP7G 5A2QL 1IYVA 1PNDA 2AGJL 3O4LB 2LE9A 4RLDA 5DVOA 9PCYA 2EVJA 4PS4L 1ZJAA 3P30L 2C5CA 3FTYA 4P74A 4XPTL 3KXFB 1A9EB 2ZKWA 2B2WC 5GS0L 1HHVA 2NN6I 2P5ZX 1X32A 4MCYA 1JV2A 2D3NA 4UV7L 5JHDB 5IJKC 1ES0B 2ADIB 4YHIA 1NUGA 3FSOA 2F4IA 3LOWA 1KXVA 1AZRA 3QUZA 5T1MA 4YSSA 1JPST 4PJDF 4AY0A 3B2UD 5I73B 1F6AB 3VFOA 4UTBL 4HIDA 3FPUB 4PS3A 4F7EA 3B3BA 4KD4A 3WFEH 1FAIH 2BVEA 4AUJA 1XX8A 2J0TD 4LFAQ 1G7LB 2NX5A 4TNVF 2ATPA 2J8UB 3FHEA 3GUTB 2EYLA 1MHPL 2CBPA 4NC0B 3FRPB 3VGHA 3KJ4B 1J8IA 1BQHG 5K9JH 1FCGA 4KAQL 5MERB 3RI5K 2R6GA 4S10A 1B2YA 4XNBA 3HNSH 1O7VA 3GXTA 3H55A 4RESB 4OIIH 3R7QA 4GS7B 4A6YB 4ELKA 1G6RH 1N7ML 4A93G 3TH4T 1X7SA 2BZ7A 2XA8L 3WHXB 1G9NL 4M7ZC 3DGCR 2A9NL 4JV5Q 1ZV5A 4NBZB 3RY5A 4OLEA 4DKFL 4M56A 5I82A 5FLXL 4UANA 5M5XH 4GT0A 4KTYA 3X3FH 4QRAA 1ILPA 3L95B 4K94H 4NZRL 3U6XS 3CXDL 4MJ6A 3G6DL 3GTLH 3WFHB 2AABH 4U7SA 1TWHB 1AY1H 2R56H 1B7YB 3PE9A 4OFIA 5KTEL 1BF4A 4XHJD 1JWMD 1VQ6A 4WWOA 2Z8SA 1CLYH 2NNRA 2QVMA 3L45A 5KVEH 1TWAH 1ASOA 2BPBA 1X7TA 2FEEI 4RRPG 1EFQA 1XR8B 4X99B 5C0RH 2Q2EB 4ZUTA 2YA0A 3EG9A 1MSGA 1CK1A 1U8NB 3CHBD 4CADA 4Z7OE 1RMFH 2CDFA 1N33Q 3QDJA 1ZLSH 4IRSA 1YJNA 1X3EA 4FL4B 2J21A 1ZLWH 1KLGD 1ZE3C 4IPGA 2E4FA 3H42H 2V2WB 5IBTH 4Y5VA 1YNJD 1E50A 1ONQA 4J4PD 3R3OA 3QJZA 4HKJA 4YHPA 3QR1A 4RGOL 3JTSB 4Q5VA 5F0LB 2I9TA 2P43B 4DEUA 4Y19B 3KPMB 3M86A 1HNWQ 1X6LA 2BNRA 1JPSL 3W11C 5CFAA 5IB4B 3OPUA 3IXAA 3OIPA 4PP2B 3WN6A 2HIXA 4O9HH 4AEHH 4HH8A 1Y1VH 1PH2A 5DRZA 2VLKA 1Q72H 3P3YA 5F1SA 1A14L 2W88A 3PO3H 1M7DB 1UE7A 2R4SH 5KVDH 4PVMA 4HJ9A 3E3QC 3M88A 1T5WB 1FZOA 4DFAA 1K2DA 2XG5A 5DVKA 1OAKH 2P8LB 1KIPA 1CD1A 3OF6D 3QJHA 3MV7D 1E5BA 5T1KD 3PCYA 5AW2B 4CSTA 2OJZH 1FIEA 3CTTA 5EU7C 4QOKD 4IM8A 5G4MA 4Q9CA 5IV2B 2EJMA 3VGDA 1O6SB 3IFLH 3CZUB 5LVEA 3HBQA 4XX1G 2MTPA 2ZP9A 5C0AD 1Z5HA 5IP7H 2NZIA 1VZIA 3D1MC 4NPYA 4C3JG 3OGCB 2WGXA 2ZXQA 5IMKB 3LMJH 1IFHL 2AQ3A 2FWOB 2YS4A 4V1DB 5TQ2L 4AYSA 4N26A 1DLHB 2DEXX 3FFCD 4JPBW 1V7NL 4H8VA 2WXNA 2VDMB 2WMPB 5EEYA 1AGEB 3J80E 3S2DH 1RK7A 2ZOWA 3AB0B 3D25B 4WKZB 3ES6B 3NVQA 3BRDA 1XIWA 1BECA 3HR6A 5BZWA 3UG3A 1DVQA 3TONA 1R17A 1BYPA 4FTDA 5E9DE 5AW3B 3PWPE 5SWZA 2WVVA 1KABA 1M8AA 1FZMB 1EQVA 5ICUA 1I8LA 4F93B 3F7VA 4X3KA 3V0JA 3PAYA 5B4MC 5KBLA 2DBLL 3B8SA 4NUQA 1J5OL 2E2DC 3HPLA 3QUYC 4PCYA 5AW1B 1MF2L 1ITBB 3AAZB 1TTCA 1F2ZA 4LPYA 1A3LL 4NPKA 2AHIA 1HIMH 3SCMD 1M7XA 1LEIB 2EVIA 2UXTA 2X09A 1F4YL 4BA2I 4CMHC 2IOMA 2MGSA 3WD5L 2EP6A 4LE8A 5KVGE 5HXMA 1IBLL 2UXDL 4BHUA 1TDQA 5H2BB 4PJGB 1TETL 5EBWB 1VQLA 4HUXA 2QQKH 2JB6A 5F7YC 1TR7A 1VEPA 2P5PA 3OIQA 4XPBH 3L3DB 2UUDH 3BO8A 4PJ8B 2FQDA 3SGDH 4DK5A 4DFIA 4FFZH 1QP1A 2DY2A 2NRDA 2NBFA 1XMQL 1S7RB 3IETB 3VD3A 5EOCL 4PCTA 2ALWA 4RMSA 3S35H 3U7AA 1F8TL 2X4PA 3O2DL 4JK1C 3G5YB 4N1EA 4L29B 1A3TA 3NQIA 4L3EE 1CYXA 1P5VA 1NEUA 3S16B 1R5IA 3FO9A 3O41A 4N9TA 1S9VA 2IALA 3DUUB 4QTIH 4RGOS 3A6BL 2DAVA 4JKKA 3FMCA 1DANU 2MEJB 2WY3B 1MHEB 4ZLTF 4HIXH 2BMKB 5GQBA 3ILPA 2EE0A 3QWRA 4R2GC 3NIGB 1XF5B 3RX9A 5IHUL 4J8RB 1A21A 3H9HB 5FYJH 4F8MA 3D48R 5BUPA 1TKWA 1IRAY 1MSPA 1V7MH 2WXOA 3IBOA 2IBZY 1BD2A 1T1YA 3LQMA 2JA5H 3NFSH 3WN5C 3CFKB 2W0FB 3WOVA 1IGTA 4WU7B 3L3JA 3FCTA 3VGGA 1B70B 5AFWA 1K0SA 5JJLA 4EOWL 4YX2H 3SBRA 3WEMA 1SEQL 3WIAA 4R3SA 3SGDI 2NSQA 3ARQA 1A4AA 4DR4Q 1XB3A 4PREB 2O26U 1PVOA 2N56A 1D5ZA 5EU6A 3PUXA 4WRLA 3FT3B 1C5CH 1KHIA 3B3IB 4OZIB 3V4PB 4DV6L 5A6IA 4Q2ZA 1QYGL 1DQMH 4GRLB 1I82A 4MX7A 4BQBA 4G7ZC 1T04B 2K78A 4ODHL 4YC2C 2KZ1B 2YGNA 1G0DA 1K3ZA 3NTCH 3CCVA 1XTCD 1FFPB 2C9RA 2EABA 3D39B 4J2QA 5HGBB 4AZ8B 4EDWH 4ZMTA 5CD3B 4OD1H 4RGMC 4ZW6A 2BY2A 1RQ5A 3CCQA 5JOBA 1ADWA 3GSVB 3T3MF 2D9CA 5JOPE 2FNWA 4C3JH 1YN7A 4M4RA 5ANME 2J8OA 2JLPA 4CGYB 4K5LA 5DCCA 4NXML 3LX9A 3HZYA 3K2IA 4B6ZA 1NEZG 3P75A 4BFJA 1SBBB 4TQEH 3TCXA 5SWSA 1WTVA 4KY2A 4F7XA 2A5UA 3UTSA 3DXAB 5JXED 1VEOA 3I50H 5KG9B 4Y5YC 5J12C 1Q0YH 1HQRB 4QTHB 3AWGA 2CAKA 2IV9A 1KB9J 4GINA 4K71B 5D6DC 2VMFA 1W80A 1LNUB 3MO1A 3RIAF 1DHKA 5FA4B 1GJIA 3RHWK 4JFOA 3VWJC 4PLOB 5FYKE 1DBML 3M3YB 5JAVA 1DBAL 3MI6A 3P40A 5E4IA 3TNMA 1FVEA 3B2MA 3GS7A 3HEJA 2CZNA 4JMXA 4JFYA 1K8DB 1SSOA 1JRHL 2CALA 5DJXA 1FE8L 1T83C 1H9SA 4DAPA 2LTQC 2PPEA 1A9VA 4KQ4L 3JSSA 2DS4A 1RZPA 4U6YA 5FFLA 2ARJB 2IY5B 4TUKL 2PTUA 4RWYL 1V1QA 3UPCA 4ODWB 2FJFB 1XV8A 5D96C 1OVZA 3EGXA 3S35X 2G9HA 4TRDA 2G4GA 1DQJA 2PP7A 1T2QL 3MROB 4AT6B 2OMTA 3HG9A 1FO0H 2AVFA 3IDUA 4IMLB 3JWNH 1XVSA 4QRPE 1BSIA 2XKNB 5FDWB 3MACH 4X9FA 2GJ6B 1HN1A 5CJQL 1S3KL 5TDNB 5F3BB 5JW4M 1XNRQ 2XZZA 1U4LA 2J57A 4MAUL 1C5BH 5KBMA 2OP4L 3FONB 4GQZA 3ARGA 3BYYA 2X6MA 2SEBA 3CAFA 5GZOA 1M7UA 3L3IA 5E5LA 3S2HB 6FABL 1GC1H 3IPEA 3TTSA 4HS8H 2ESVB 3BWUC 4OU3A 2R1WB 1CE1L 4G8GA 1E1TA 1OT1A 3UTTE 1YMMA 1SE8A 2VIRA 1CICD 2D03L 1MLCB 3FTSA 4WSGA 1UKQA 4P2OD 2NY3C 2EQDA 1UQSA 4AGOA 2B77A 2IQ9L 4XNQB 4YXLL 2VWEC 3CZFB 4GAGH 1D7BA 5IVOA 4L23A 2QVTA 2K4AA 4JKLA 1G9MC 1FL3B 4X7TA 5CO1A 2FIKB 4XE0A 1VQJA 4IJ3B 5EU7E 1GM5A 3UTPE 3TP7A 5TJWK 1I4HA 3OHXA 2YUWA 3KWVA 4PGCA 3SZKC 2WB7A 3OLIA 1S9KC 4FQPA 5E99L 5C0FB 3MRQA 5TSSA 4UV4L 3SK5A 3QHFH 1YQ2A 3T3PF 4NLHA 2F0KA 2NLJA 1YN6B 3CMOH 4PGBA 4NYLA 3S3BB 2B3GA 2R27A 4D8PB 2DYPD 4BY7H 4S2SB 1UASA 2AKRB 2CKBB 2GUOA 3MV8D 2OR8A 1GCFA 1FL5A 4F5CA 3QO0B 4L63B 5T1DH 5D6CB 3IDJA 4HH9B 2L5TA 3T2PA 2K5VA 5BJTA 3IDIA 4K7PL 4RA3A 1PD1A 1DYQA 4HKZA 4MMZB 4RNRA 5HHQB 1U58A 2A6DA 1UWEH 1U0LA 1T2XA 1LHZA 2E86A 3AGVA 1BM3H 3QI9D 1E67A 5HHVH 1MIEL 4ALAL 1VJSA 3SPIA 1XX9C 2KLSA 3WL9B 4JPSA 3LH8A 2EH7H 4XPGL 1BX2B 1HKLH 1W6LA 3DI2B 4WSKA 1HESA 3TN0A 1OHZA 3QIUD 4YFLF 2CO6A 1HCYA 1P6AB 2YFNA 4PJXB 4Z1PA 3TTYA 3NG5A 2JKTM 5FHBH 3QFJD 4UT9A 1WD1A 3ARDC 4Q4EA 5DEJA 1JZDC 4EZKA 1JZHA 1AGCB 1U8MA 1UFUA 3PNRB 4F3FB 3KYAA 5C3LD 3KLSA 1CK0L 3VFPB 1U30A 3TBVA 5FX3A 2EH8L 4ABVA 1B9KA 2XVGA 5IHZB 1JFHA 1NNXA 2R92G 3H09A 3A3YB 2NR6A 4A66A 3RA7L 4UNVA 3IGAB 4NKMA 5F7FA 5EUOB 3QVAA 3BVZA 5C3EB 5IT9E 1ZYRD 1ACCA 4A63A 5E5RB 3GDEA 4OF7A 4IKJA 1OPGL 2GTZA 4NRZA 4Z95H 2B2XL 3A67H 3IBEA 1JZ3A 2O6EA 43C9A 1VESA 3MUGB 1VLXA 4KMQA 3MC0B 1SJHD 5ABAA 5D5MA 4U1SB 4QJFA 3QFDA 4P59L 3PL6D 1HUMA 4UOW1 2P5WE 2A68C 2F5BL 2IBZX 4WTZG 1P7QB 3BS1A 4GOSA 4XP1H 2ZJRA 2J88L 1BQRA 4X3UA 4PWHA 1U8IB 1TJHH 5CGBA 3TEZA 1XZ0B 1G9EA 4R7LA 4EQ5A 4IO9A 4ZS7H 3OJ2C 4R90L 4ZX5A 3T6QC 4JPWL 3UO1H 1TZGL 2L8AA 2GEEA 4M6OH 2HG5B 2ZPKL 1WTPA 1QFWL 4RMTA 4F7PA 2F5AH 2ZUVA 2W60B 4JQIA 1HCFX 1SJED 5CR1A 2ZF9A 1E5CA 1ICTA 2FB4L 4KZDH 4WTWA 1X5AA 5EIVA 1BLIA 1NCCH 5DFWH 2CGZA 4XWOC 4DK3A 3TYGL 3UI2A 1S7VB 5DEHA 4DKEL 1PH9A 5IOPA 3BAWA 3MJWA 3UC0H 1EEYA 4GO8A 1QBML 1OOWA 2FECL 3KLHC 3VCLA 5C09B 5FK9A 4HIHB 1PV4A 2VDQH 4FTVE 1RZFL 1T6VN 5EOQL 5C6TH 4OJAA 2WKCA 4GKNA 4MQSB 5I8CA 1N0XL 5ABZA 3ZRFC 2AF2A 1OTSD 5L0QC 3T0EA 3E9IA 1I1AC 2PTTB 4PG2C 3TT1H 1DN2A 4WI0A 5AVTB 4PJ7E 1KL9A 1Q9KA 5CR3A 3PWNB 1H8OA 2AJVH 3PJSB 4WWNA 1M05B 4G9FE 1KEGL 4PGEB 2WZAA 3LDBB 5TDPB 1NR4A 4BRVA 3L3HA 3STLA 1XSKA 2Q8RE 1RSYA 2ZSVA 3VR5A 5T3XH 4UQAA 5KIXA 1NQBA 2ICWI 3J27A 4PVBA 3ASWA 5I24A 3D33A 2JKWA 2C3VB 3WO4B 2EUVA 4MA3A 2HJFA 1WS7A 4H0LC 1PH7A 3HC3L 4U3SB 5FYLD 5DJAB 4XCNA 3I70A 2OX5B 3FO2B 3GK8L 3QUHA 5F3FA 5BRQA 5ENWB 4EI0A 4F15B 2VJXA 4NQCE 4PD4K 3PHOB 1IL2A 4JDEB 4ZFFB 4Z3FA 4TUJB 3CN3A 1B9MA 4WEBH 2VAJA 4L4TA 3QWNA 3A7AB 3ELAT 5KSUB 3UP1A 1LE9B 3CVBA 5I9OA 1MCWM 2X4NB 4JFED 3VD4A 2FL5A 3Q05A 2L15A 3GS4A 3Q9QA 2ZXRA 4JRXD 4Y16D 1IBBA 4EEEA 5FYLH 1FV1A 3FPYA 3ZW3A 3F83A 3BWAB 3TXAA 4P9MH 1T89C 2XQYK 4QHKI 3QZLA 1SXZA 2UWEE 1BQ5A 2G5BB 2F0UA 3MBWA 4ELMA 4X66L 1OCOB 5TQ0H 1CI5A 2CO3A 3BDYH 4WJ4A 2ZYHA 1A6ZB 1JL8A 2QTEA 1JMCA 2RSNA 2DQHH 1IM3B 3GTGH 4KO7A 3OKYA 1YPZA 3VVWA 3D69B 3RY6C 1DVFD 2VWEE 4YAQB 2EYTA 5D1ZC 3X3GL 5EN2A 3O3BA 1P8LA 3SE9H 4I4WA 4ILWA 1PS3A 1M56B 2W1NA 2Y6SC 5CU5A 1PZKD 1VGKA 3N9GL 4IMKC 3DBXA 1ZHNA 4PJDB 2IPKD 2FT8A 2BIIA 5TFSH 3RUGB 5EEZA 1ET6A 4NX0A 3RX5A 4XP4H 3NIFE 5IVXB 2AANA 3V8CA 5MP6L 2OPCA 1W8OA 2D4FA 4FG2A 2CUHA 2C4XA 4JBSA 3NEXA 4FHJA 1M3IA 3MRHB 4ANVA 2V5TA 4E42B 3HI5L 3WAJA 4N6RA 2F1MA 4WUUD 1B50A 2YAQA 3L7EB 3RWDB 4L1DA 4HG4K 1AACA 3BQUC 4XAWH 4LCCA 4YY3Q 1OSZB 4IOIB 1GA2A 2Z6FA 2VLJD 3HCVA 4BBRH 2PABA 3H54A 4N0FA 4N0YH 4P2YA 3UTQB 3ZHDA 4Z7WB 4L4JA 2NVTB 2F0MA 4KHXH 2NXYB 4M7KH 1SNOA 1DQLH 2QBWA 4Q58C 1X3QA 1O6TA 1UJ3C 3NQTA 5C9JA 4DUYQ 1OWRM 1KC8C 4ZKCB 1AEXA 5B8CC 2SNSA 3QAQA 1HQMC 4DR6Q 2VDRH 3CHSA 3GJFK 1GMEA 4D9QD 4NDXA 4BWGB 3BAYA 3H4FA 1PTZA 2VUMB 2XWRA 4JPKL 4A7VA 3QNZB 4FJ6A 2APVA 1JXFA 1X55A 1D6EA 3N1MC 2BWDA 3DVNA 3HE6D 2QPEB 3ZKMC 2ODHA 4WVRA 2NY0B 4UMSA 3SKNA 2AEPL 5KS9A 2R7EB 4PJFA 5D5MF 4K07A 4BSWB 3RVXC 2H1XA 2VDOL 2Q8IB 1VB9A 2PWGA 3GFUA 4K3DH 2Z6KA 4A3EB 4H5SB 4MZ2A 3S7GA 4ZX6A 5CLZA 3AU1A 2XWJA 1TQVA 2F58H 4PZ6A 4FLRA 3TA4D 3Q2WA 4H1LB 5ICYB 4QXUH 4C2MH 3FB6B 2FLRT 3S96B 4QJ4B 1LM0A 4NAMA 1LK2B 4PEEA 4XNDA 2UX6A 4FQQB 3OB8A 1DVZA 1OAXL 2HCZX 1AJ7L 3FU5A 4LSRL 1KPUB 2XV0A 1G6RA 2FLBT 3SY6A 1EHXA 4R4OA 2P52A 1F00I 4UT9L 3MLTA 3EFFA 3JVFC 4YHYB 4NN6B 3A8IE 3MBXH 4C54A 3WS6A 3SK4A 3HOVG 3Q13A 2DQIH 5HDLA 3WSQL 1MAMH 2F68X 3IWUA 4JPIB 2TMPA 5CEZE 5J11B 4N28A 4BSJA 4P46C 4N5UA 3QUXA 3U9SA 5FJ8H 3S37X 5AKTA 2UU9Q 3TM6A 3K71B 4KV5F 1Z3GH 1JZEA 4PB9L 4WUKH 5K1VA 2IBGA 4ME5A 2R0WL 3P73A 3UTZA 2EYRB 3GMOB 3L3OA 5AKSA 3I9GL 4B3MQ 3QJUB 1SN2A 3P7JA 2CKNA 5A2LH 4FQJH 5EWIL 4X4YA 3FMGH 4O0AA 1TSHA 3EA6A 5J6GB 4JY5L 2CHBD 2P3YA 4CVWA 4ZI8A 2RBLA 1FORH 2F0JA 1NIBA 2AQ2B 4Z77A 1J0KA 1JWMA 1RUQL 4ZD3L 1YAIA 2QLYA 4KNSA 3EO0A 4OT1L 3VXSB 2EIEA 3BVUA 1D3CA 2OCEA 2Y07L 3ZUCA 2I24N 4GUPA 2BOBA 3UJTH 4J6RH 5EU3B 4JM0A 4AYID 2X4TB 2IWGA 5H37G 3V05A 3W5NA 5HJ3B 3NIDF 4OCXL 4A2MA 1PEZA 1IAOB 1O7ZA 1D2PA 1X9UA 2Y4SA 4PYHA 5ESAB 5C0BE 1SBSH 2LOEA 4WW1A 1T21B 3HOYG 4G11A 4CN4A 4X9GA 3E0JA 3OWRA 4LZKA 4FEMA 4JQIL 5AJ3Q 2B1HL 2ENYA 3FSWA 5BR8L 4A2HA 1CDHA 3DX8A 4J4PA 3HC4H 1QLRB 4FF3A 3O6LH 1ZEAL 1IMHC 1G43A 2NY5C 5BOPA 4W6YB 4GIPD 3CVCA 4YSEA 3MNWA 1A4JB 5DD5L 4BK5A 5C9KA 3AUWB 3MOBL 2I27N 2YAMA 4HJ7A 1F1AA 4UZSA 2O61B 1MPAL 3LZRA 1M1XB 2EDTA 2VLLB 3AG4B 4KI5F 3ZDYF 3K7AH 1GOGA 3OXRB 4GG8A 3VXPA 5EC2B 2VXQH 1IAMA 2B5IC 3DETD 3INOA 2EICA 1YPZF 2DUDA 3MV7A 4M9OA 5FF6A 4HK3J 4XN7A 4C56C 1J11A 2AP2A 3CDGB 4NRXA 3ABZA 4YWMA 3SBQA 4H02A 4JFVA 5K59E 4MNQB 4DTGH 4ZAKB 2F0TA 4YCVA 4GQ9L 5CZXD 1YEIH 2E74C 2HXAA 3QULA 2DLEA 4JFZL 5HHMB 3ULVF 2WLHA 2BO0A 1QEXA 3GD1C 4JFFA 3GRBA 3BE1H 2ZXAA 1E30A 3FFCA 1IX2A 5JPNB 1XGPB 5E00A 5CCGE 4YNYB 5GGQH 2CHXA 1S78C 2C3WA 1VHPA 2OSLA 5KN5B 4CJ1A 1CDBA 3DURB 4TVPD 4RWHA 1WA1X 5F9AC 2J73A 3MCYA 4HUMB 4JZOB 4DQAA 4DGYH 1SROA 3R7RA 3HOVH 3PGFH 4MXQD 3NSDA 2UY7A 4PRPD 4OJFL 1LE5B 3EJYD 4W1TA 4IKLA 5HJDA 4FFZA 3DMMC 4FXTA 4FQ1L 4XBGB 1WFMA 3K74B 4OJDH 1L4IA 2C9OA 3SCMA 3V6OA 2QKIA 3UXFA 2V2TB 1VQFA 4PJFF 4XP5L 2H0FA 4PVLA 4DP9X 4ADIA 2Q10A 1GUOA 3K46A 3QUML 4XO9A 4WK4B 4U673 2OSWA 4B27A 5J7CC 2XVSA 1SXAA 4NP4L 3ZHLA 4MCYB 1JV2B 2RB8A 4DA2A 1HYRC 2CMRH 1AC6A 1FGVL 2WD0A 4ONGH 4GH7B 4K8IA 5T1MB 3ULJA 1DFXA 2X3AA 2XYCA 3QYMA 3VFOB 4XOCA 4GQPH 1JOOA 1NGZA 4F7EB 1H15A 2YKKA 3ULVL 3Q01A 3ULUH 2N7SA 3GTJH 5T1JA 1TWCB 3S1QB 1JJGA 1W9XA 4GIOA 2XZCL 4FA7B 4G6AD 2PCFB 2JKSA 2ZP8A 3W2DH 5JQIB 4I3SL 4NWTL 3TFKC 2ATPB 1MJ7H 1JC7A 35C8H 4QHUA 4G4KA 1E7ZA 4L5TA 5LGYA 3KBPA 3HOYH 4B96A 2JJQA 1H0DB 1KRTA 3GBML 1SE3A 1YHPA 3EUDA 3NSJA 4ELKB 1RURL 1UVQA 4HUCA 5CMAA 1QRNE 1CVSC 3NGBB 2A9MH 3WUWG 3B6YA 2X6CA 1TYJA 1J1XH 2VQFQ 1R3IH 2WLIA 3D9AL 3IF1B 4M93C 1SNDA 3APNA 2HPOA 1GHFH 1CHPD 2CR0A 3QIWD 4IGBC 5BO1H 2C9XA 5BRZE 4WWKD 1A1NB 3EYUH 5TE6H 4MJ6B 4PU2A 3Q1EA 3J7AV 1A2YA 4PV9B 1V8QA 2KECA 3K6SA 2X1OA 4LW1A 5BVPH 3POHA 5ES4B 1IGFH 2X6UA 4RMWA 2JXMA 2IAMC 2CVRA 4LDEB 2DM2A 5FXCH 1M1KC 2ZG3A 4XNYH 5BNXD 3T3MB 3BP6B 4KNUA 5DGRA 4P9HC 3RVWC 5E6ZA 5F3HB 2B2YA 3FZUC 4CADB 1SHXA 1FAIL 1XL6A 2I5YL 3DPBA 1IM9D 1TTGA 3QDJB 3QUGA 4OI8A 3IE4A 1AQKH 4LF4Q 5LO7A 3UZVA 5K9JL 3OQ3B 2F52A 4Y5VB 1B44D 3HNSL 4IJLA 3OJDA 4FCAA 4HKJB 4YHPB 4OIIL 3EO9L 2C1PA 1G6RL 2I9TB 1IE4A 2AXGB 5K36H 2BNRB 3O8XD 1DCEA 2XVKA 1KFGA 3MNDA 4YHNB 3NTIA 1DQKA 1CLCA 5D4HA 1O5DT 4MJIA 4MS6A 5DRZB 1KLUD 2YK1H 2OXPA 3FVQA 3DIDA 1FO0A 1YYLL 3X3FL 2QPDB 5AENA 1REIA 2EVBA 3KJ4C 4K9JA 2AABL 1SFOH 1RU9H 1AY1L 1U8JA 2W59A 2OMUB 1K2DB 2XG5B 1BVNP 3DROA 3GEFA 4PP1D 3VUAA 3QJHB 1KIPB 1CD1B 4GS7C 4A3FB 4UYPA 4G82A 5KVEL 1SNCA 4GP8B 1NTDA 2DWEB 2FWSA 3U7YH 4F2ME 4AK2A 3ZGHA 2OQJA 4L6TB 4KKLC 1WAEA 2HTKC 1Q0XH 5CMDA 1XJVA 2ICEA 1PFCA 2J43A 3K2MC 3TCLB 1NFDA 4ZX3A 2P4AB 4QRUA 4UT6L 2ALYB 3H0TA 1GGTA 1X5HA 1HRJA 4NPYB 5IROA 4U6HA 3MLUH 1RMFL 3IRPX 5IHBA 1J8HD 1ZLSL 2E7HA 3OAZK 3V4VH 3OXSA 5C0EB 5E1AB 4KGJA 4H8PA 4YJZL 4X64Q 3CK0H 5IBTL 1IKNC 1Y18B 2L7UA 3LKNA 4JM2D 2R7ZG 3MTXA 2JKIS 4RIRA 1I1YA 3CD6A 4FN0A 3K6IA 4XNMA 3TF7C 5EC1A 4AIZA 5BUAA 5E6RB 3B1UA 4HIQA 3W38A 2N7AA 4AG4H 4XN9A 3FAWA 4LSTH 2WVVB 5C07D 3DEPA 4K3JH 4O9HL 2G3XA 4AVKA 2O5YH 3T71A 5FB8A 2JP1A 3F7VB 2F4VL 4FL4C 1PLFA 3Q1SH 3AYHB 3OSKA 4GXFA 5ELFA 3T77A 2B0SH 2R4SL 5KVDL 2Y3NA 3HPLB 2Y0SG 2UXCQ 3CCUA 2WTPA 4MKTA 2AJUH 4ILDA 4HAEA 2OCFD 4U1LA 2E76C 3HKFA 4X0KB 3V0AC 1ZY9A 3KNBB 5I1CL 4PMWA 3TU6A 4GKKL 2OJZL 3QDGE 3SPVA 4R4QA 3IFLL 2ENQA 3WMPA 3NE5B 3EW3B 3T3PB 4HUXB 1I6VC 1E24A 2IDUA 3MAWA 3T0WA 1OB0A 4K5MA 3LMJL 3GTMH 4CW1B 3BO8B 2VRAA 3Q8CA 5DZJA 4WJWA 1RF2D 5HGGS 1G2SA 1M57B 2FJHA 2A6EC 2DYPA 2JI1A 4BBSG 4TLKA 3X12A 1OK8A 5D9SA 5ELEA 4G8IA 3SO5A 5GAHC 4U7KA 3S36H 3MV8A 2X4PB 3WGUB 4BCYA 1NEZA 4XMTA 1P5VB 1UEYA 2YPLE 3BLBA 1NINA 4K55A 4PRAA 1S9VB 5C2UB 4I65A 2XQBH 1NDMA 3BN9C 3EOTH 1ZGLP 2VT0A 1H9KA 4KN7C 3ILPB 3HOXB 3OTTA 1WHOA 1SXTA 4QHLA 1DCLA 2LU4A 3KL3A 3AW5A 4HBCH 5D1QA 2AEQL 1UURA 1M7IA 1BD2B 1T1YB 3MRFB 4I87A 4Y4FD 4HN7A 1IGTB 2HRPL 3L3JB 1R3HA 3FCTB 3L1FA 2DWYA 1DLFH 3AB0C 3ARBA 4H8WC 3V0HA 2FTAA 4IIZA 3VFWA 1LABA 2D9UA 4R3SB 3RTQD 4HLZG 5TF0A 1SDAB 4NQVA 1D5ZB 5EU6B 3VRLF 5EO1A 3GMPB 2DN8A 1HOEA 1IGYA 5EMYA 3UPRA 3UDXA 1VADA 4XPBL 2PZWA 1A6AA 4HYTB 3R2TA 5CV9A 5B3NA 2UUCL 3HG4A 4Q2ZB 4FFZL 2HT2D 4PBDA 4DGWC 2MOGA 1FYTE 1N36Q 1A4KA 4MX7B 2XTIA 3HAEH 1JE4A 3SE6A 2QLVB 1QSZA 1LTXA 3O9WB 4JO2H 4W6WB 5DJ2A 3MCLL 1ACZA 5BO0D 4LLUA 3AS1A 2VLRA 4HDIA 3C2SA 1D5BA 4N9OB 4QTIL 1LLAA 3U4BH 2IOIA 4X65Q 1XR9A 2EE3A 3FQUA 4GKJL 1UT2A 1U8HB 4P72A 1MVUA 1YN7B 2R2HA 5TF1H 3ATDA 2X3CA 4LCIH 4LU5L 2F1BA 4BFOA 3KPTA 2IMNA 5FLMH 3A8KE 2OZ4H 5FYJL 4D7BA 4Y1SA 3HZYB 3LCYA 2I9LA 2JJSC 2WLZA 1SJHA 5SWSB 3A0JA 3QO2A 3QJOA 1DM0B 2IH1A 2OJ1A 2QGCA 4DV7L 3E1F1 1OZUA 4OB5H 4J1UA 1UCBH 3T1YQ 2E59A 2JK5A 3TO4D 4Y9EA 4IBVA 2ICWA 4OX9L 5I5MA 1KV7A 2GKIA 4N2NA 3MO1B 5L4FA 3WTTA 3GTOH 4PJBE 3DWTA 4JFOB 3KPRE 5DD0H 4FJYA 4NZ8A 1SDFA 5CKGA 4F8OA 1S9YA 2X7LA 4F7CA 5EDXA 3K57A 2WCPA 4PMFA 1C5CL 4JW3A 4U1JA 1XGQA 2AAAA 4IBUA 5DJXB 4M1GH 1H9SB 3GWJA 1DQML 1F5WA 4HKXA 4U6YB 3ZHKA 4RDBA 4JI2L 3CSGA 1BCPF 1NJ9A 3MV9A 5I1KH 5DZAA 3PV6A 5EAYA 3OKNA 3NTCL 3EGXB 3RWFA 2G9HB 3S36X 1JWSB 1GGBL 2K3HA 2KZKA 3DX9B 4FTVD 1DQJB 3O4LE 3K5RA 4TLSA 5F44A 4OD1L 1EFXD 1PZID 2GVAA 2OMTB 2KBNA 1KCKA 2F7PA 3D4ZA 1Y07A 3KXFE 3QE5A 1NFDF 3LXUX 3MBED 1H9VA 3CSFA 3LAFA 5FYKU 4ZXBD 3D0FA 3BIKB 5I28A 3PXJA 5MENB 3V0FA 1JWUA 4GRLC 1KOAA 1X5FA 2CCZA 2M1KA 4PGZA 5JHDE 1S5DD 3QRBA 3GTVA 3K3QA 1E4KA 3L9RA 2YAHA 4TQEL 3ARGB 3BYYB 3DJRA 4ZMWA 4BBSH 8PAZA 3GKWH 1HR0Q 3L3IB 4JOIA 2HX9A 3B4NA 2ICWJ 1Q0YL 4UIKH 2JTDA 5CWSA 4HJTA 2HMIC 1DN0A 1L7IH 4ULLA 4NO5B 4IPCA 4NKOA 4L4VB 5DD3H 4L37A 3GTPB 1GOFA 2VQTA 4A2DA 4BRJA 3W57A 5FECB 2VAAB 5LGJA 1J0ZA 1YMMB 3LNFA 4XO4A 5KGUA 1F3JA 2J8UE 5DHMC 3VAEA 3VDBA 3O6KH 4KRPB 1GW6A 1KGJA 2WXGA 3HFFA 2E47A 3H7BA 2XZAL 3KG5A 5KWYC 3AROA 4R8IA 1G6PA 1UA3A 4X7TB 1KULA 3BKMH 4JBKA 2NTFA 1RZIB 4ZTEA 4ABQA 4K71C 3CPUA 5HI4D 1NGYA 3OHXB 1D1KA 2COQA 4FHBD 1V1PA 5J4MA 1MW2A 3O81A 4ZOBA 1NAML 4HLZH 3AQYA 3HG1B 1JNNH 3MRQB 4L0PB 4OCRH 4EIUA 3AZUA 3C8KA 5KW9H 3C1EA 4BQCA 2QILA 2NLJB 2R1XA 4JVPA 4U1IA 5DC9B 4JFEA 1S7XA 3ALWA 4QRPD 1TITA 2F19H 4IEFB 3T04D 4JRXA 5HJGA 4NKLA 5AL8A 1A7QH 1C5BL 2NY7H 3F2DA 4MZ3A 1HNXQ 3H8NA 1BZOA 1FL5B 1W6WA 2C9VA 3EUUA 5B3JE 4LF5Q 1GY1A 1GC1L 2N1KA 2NW2A 4IQHA 3G6AA 4PFEA 2YXMA 3RB5A 2ZYRA 2CIKB 5DC4B 2VDOB 1AS6A 1AGDA 5JNYB 5GS2D 3SPHA 4A3BH 4HKZB 4RNRB 5JIHA 1T7YA 3OC5A 1LO5D 1U58B 2A6DB 3MZTA 5J1SC 3MAQA 3MLYL 3P4LA 3E9TA 1U3NA 4GXUN 4MAYD 4XI5C 1R4QB 4HPHA 5B39A 4XGZA 1R5VA 1U3HD 1U4FA 3II3A 4IBYA 1P9MA 4ODXB 1A3QA 1EBAA 2EE6A 4GAGL 5E6ID 2D7PA 3ZQXA 4KX8A 2F53D 1KGUA 2LR4A 3TN0B 2IPKA 4G59C 4DZ8A 2CO6B 4Y19E 3SD2A 4YEFA 4KWUA 2MCPL 1AR1B 3ZZLA 2FYVA 3QBTB 3PIPA 3CX5K 3V2AR 3BJLA 4NCC2 5LB1A 1VQMA 1GRWA 3OKLA 4PW3A 1OGSA 4OCYH 1U8MB 1ZMYA 2CO7A 4I1NB 1CIDA 4JFXB 1MIMH 4N6QA 4X98B 4ZTPH 1UWXK 3KPSA 3QHFL 4H2AA 3O3EA 3CMOL 4FFWD 5F8RC 4TL5A 4IFDG 3TBVB 2MO1A 3K8MA 4UHVA 1KXQA 3MRJB 3IXTA 3TP5A 4ADGA 1IAII 4IJ3C 1FFRA 4B08A 5EDSA 3MYJA 2WLMA 5T1DL 2ZJQA 1TCMA 1WAAA 4WI2A 1EIYB 5DO2D 2HWZH 3S5ZA 2A6HC 3IMVA 2F0IA 4HCFA 5ADPH 3QJYA 4DN4M 4DP1X 1OLZA 3I4MG 4JFPA 1UWEL 3EIFA 4V1DE 3WTUA 3ER0A 3QG6B 1BM3L 3QORA 5HHVL 2XQYG 1EERB 43C9B 4UDUA 4LFHG 1EPFA 1Z5YD 5D5MB 1XNQQ 2E0PA 4MDIB 4E9VA 2WLKA 3BQVA 2EH7L 3SE4C 5ALBH 1HKLL 4QRRD 4B9PA 2L3BA 1OM3H 3SHSA 2LAGB 4YBLB 5C08A 1ZSHA 2VS1A 2EILB 1NCWH 4MMZC 5FHBL 4HMCA 1N70A 4H7BA 2RAMA 5F6IB 1L5GB 1TZOA 4HK0A 3UROR 1JZIA 3HE7B 4PGJA 4F7PB 4AIOA 5FA3A 3CFBB 1YA5A 1UA7A 3JVGC 2OA9A 3ETSA 4IK7A 3HG3A 3UADA 4FXLA 5IOPB 1RJCA 4DQOL 4PJGE 2NDGA 3ATFA 2PO6D 2ICES 5FK9B 4QT5A 2ADYA 4L5RC 3JAME 4GKNB 4HX1B 1HL5A 1QTYT 1XB6A 2EDJA 2FO8A 3A67L 4ODBD 3T0EB 1WFQA 5DT1L 5B38A 5I8CB 3GO1H 1QWUA 1IQDA 5KVFH 1U3YA 3RB7A 5JW4R 2GK0B 1ICWA 1Q82C 1VQIA 3TCTA 1ULVA 3P1VA 2W80C 3FF8A 1Q9KB 3UP6A 1Z1WA 4N25A 1P84K 5IGXH 2EEFA 4JPVH 1TJHL 4P06A 4DUVA 1DL7H 3STLB 1FVDA 4GQQA 4OFKA 2ZSVB 5DJZA 5EG6C 2HFFA 2VDKL 4OJCA 2XTLA 4XYOA 3NP3A 3OBAA 4ZS7L 3CDYA 3QISA 2VERA 3NIGE 4L0YA 2VDPL 1KTCA 5EV7A 2KS0A 3FCBA 4C4BA 4JREB 4W9LC 4M6OL 1HHKA 2HJFB 4R7VA 2WKDA 1JDDA 3GQFA 1LO3L 4I77H 2FZ3A 1OW0C 2F5AL 3VR6A 3D07A 4KMLB 4ABNA 3UYOD 4XCNB 1N6UA 1E2ZA 1NEPA 4QCIA 3U46B 3U4VA 4KZDL 1NCCL 4FNFA 3NIDB 4DV5Q 4I13B 4IQZA 3ZYYX 4QRQB 2BHZA 5C0BD 4JHBA 5AAWC 2D2OA 5JEAG 1XH3B 1E42A 5HD8C 5B3SB 5EBDA 2HDMA 2M2LA 1WA2X 3SXHA 2MOVA 2VDQL 3MA7A 4KK5C 5FUZH 4AVIA 4DF9A 5J1AA 4OZIE 2N55A 2FL5B 5DDHB 1CZ8H 4UCFA 3KYNA 5K69A 4IFDH 5DVNA 1FV1B 3HOGA 2APWA 3UZQB 5IHHA 3ZTEA 2YTXA 3EBEA 1PTOH 1T1XA 4LFHD 2VXQA 2Z34A 1BMGA 3H56A 2YGQA 3U9UA 3W1ZA 4QQBX 2B16A 2BSRA 3D39E 4F1SA 1ND0A 3FL7A 1B0IA 1JPGB 4DFHA 2E8YA 2AJVL 5D7LD 1DJIA 3IDYB 1O6VA 1KDCA 3IGUA 4JO8A 1JHKH 4PRDA 5T3XL 3P3RA 1IIIA 3ZDYB 1WJJA 2J12B 5EPLA 2CDEA 1YEKH 1OAQH 2D0FA 1XCXA 3BPCA 2X0WA 3MRDB 3S15B 2BOSA 3QHTC 1EU3A 3I4MH 1TMCB 1YPZB 4P99A 3MRCB 1SN5A 1KNEA 1UD5A 1XH1A 2EYTB 3HS9A 2ZONA 3O3BB 1MSHA 3NEMA 4XPHH 5EN2B 2CWAA 3DXAE 1VGKB 4PJEA 2CRZA 1B90A 1ZHNB 1J18A 2RTTA 3DBXB 1IBML 3HNVH 5IM7A 1J6QA 1P1ZA 3LDBC 2H2PD 3RR5A 4QHNA 4IFDI 2KKQA 3Q06A 2BNUA 3EJIA 4KKAC 4WEBL 1B6UA 3TL5A 2F74A 3U1QA 4KHZA 4N6RB 1J48A 5FO2A 3WO4C 3B2VH 4YEEA 3MRPA 2K4WA 3MLXH 1IVTA 4CHTB 4DXGA 4R4ND 4NGHH 2VZAA 1C5DA 4L2LA 4LCCB 1J9OA 1FL0A 4U1NB 4BFIA 2VSCA 4RAHA 3HCVB 4CDDC 1PZCA 2JA6G 1T6BX 1D1IA 2CR3A 3NEOA 4HKBA 4FXDA 2HJLA 3EJSA 3OMGA 2Z7UA 1EZSA 2ZKMX 1EIGA 3ZE2F 4P9ML 4F15C 1RJZB 2ZCZA 3I6LE 2D3LA 3FQXA 4ZODA 5FYLL 4DR2Q 4JQXA 3RP1A 2DKSA 2GC4C 5C9JB 1BPVA 2ETWA 2NNAA 2YR3A 2L0CA 2RA4A 4OTXH 4DETA 3X1GA 1WAAF 3BDYL 5EO0A 3UZEA 3DK2A 1X3FA 4DW2H 4QLWA 1QA9A 3NELA 3EJPA 5AWNH 2DQHL 2QW7A 3QYCA 4WI7A 3D8GA 2GJ6E 4PRPA 4A38A 2X2UA 1N8OE 4HUNB 5IGEA 3N85H 4Z3JA 4P5TA 1S5ED 1K6QL 1D6EB 4JJOA 1KIUA 4R97B 4K2LA 1DEEB 3PGCA 4OKDA 3SKNB 5TFSL 4PJFB 2AKWB 4M43L 1H3PH 4KKUA 5EEUA 3G48A 2AXHA 2ESVE 3HHMA 3GHEL 5A2JH 3WIHH 3VQ1C 2YKLH 2JELH 3CVDA 3GJFH 3N2JA 1RZKC 4LOFA 3G5XA 4XP4L 2VDNH 5D7JD 3AU1B 2XWJB 1OANA 3WGVB 1B0WA 1YECL 2QQNL 4LEXH 3RKDD 1TSRA 3I2ZA 3W2DA 2EADA 3PLYA 1A6UL 1NLBH 1WVLA 4JO1H 4G83A 4XAWL 3QZPA 2FWLB 3PYCA 3ASOB 4EVNB 1PH8A 4PJCA 3TURA 5I16A 1A8VA 3CSYA 2E6JA 4Q9BA 2VB2X 1G6RB 4M7KL 3VXQB 1ZV9A 3MLTB 3EFFB 3UGEA 3FO1A 3X11A 3ROOB 5I75B 5CCJA 4R8NA 2EE2A 3K58A 5JEAH 4YPJA 2ZAIA 3OX8A 5E4WC 4Z78A 1S5CD 2JLLA 1EEUA 2X6VA 4OI7A 3BIAX 1QRND 2FLMA 3QUXB 4KZ0A 5E7NA 3KYMB 2LXKA 2EJGC 5DUJA 5FM5O 3F00A 3IM1A 4I7ZC 3ERXA 1DBJH 2NXYC 2E75C 1QG7A 1DJGA 1RIHH 2VMDA 3P73B 3UTZB 1UH3A 3DRQA 1TWAB 3KHOA 3L3OB 3A4EA 4YLQT 2VDLB 5C7XH 3MXUA 2Q2HA 1ZXQA 4X4YB 4AGQA 1LJMA 2V5YA 2F58L 2XPZA 3VH8B 2AW2A 2DEWX 4YK4B 2IJ0C 2Y7MA 1ILSA 4UM8A 3GTQH 2E5LL 4QXUL 3D85D 3II1A 4AJVA 1JWMB 4UQ2A 5CIPH 4IJTA 4B7IA 3EO0B 2NY0C 1ZLDA 1TT6A 2Y7NA 3QIBC 5CYUA 1TQOA 3T6VA 3BZKA 4WO4D 1F4WH 5EU5B 2BOBB 4PJXE 2GSGA 3OAUH 4C57C 4NZFA 2V9RA 4Z7OF 1UB6A 3MBXL 2YOAA 4V0BA 1PW3A 4WW2A 4ZUVB 4KY6A 4FP8H 1Y1VB 2DQIL 4Y1AD 4M1CC 4MTMA 2H7WA 4DWHA 5D7IA 5AVRB 1EY5A 3NJJA 3PO3B 4C83A 4F33A 1KLGB 2FX9H 4A2GA 3CFUA 4DUZL 3QO1A 4P4KA 5CGKA 4S1DC 4LP8A 3NFNA 3DX8B 3PP4L 1XO8A 4QXVA 4RSYA 4WUKL 2JA6H 3JWDH 1DBBH 1TTAA 4MCNA 1IGCL 1B3AA 2WKGA 3NA9L 4YHYC 3MNWB 2Y2YA 3O8XA 5EUOE 3QXUA 4YBQD 2HTLC 4NXSA 4MJ5B 2GJZA 1G6VK 4FQJL 2E8ZA 3M7GA 1KLUA 1AXTH 4LBEA 3FUIA 2JA7G 1RK1B 4AGMA 4CN6A 5J11C 5KYYA 2P80A 3HFZB 2AJYL 2H1PH 2Q2UA 1U8KA 3V4VA 3X3NA 2D2CC 1VQ5A 2GSMB 2H5UA 2UVFA 1CM9A 4GLVB 2YSSA 3LZLA 4KDTC 3VXPB 3ULLA 1IGIH 3MV7B 2FMCA 5T1KB 3CCMA 2MWCA 1K5NA 3C5ZD 4NDMB 1OD7A 4Z7UA 4TVAB 1AR2A 3S2DB 4HUKB 3UJTL 4J6RL 1D7QA 2WIIA 4KKTA 3OPOA 4AKPA 5C0AB 1BPLB 4XCCH 1AKPA 4X9BA 3TBBA 1RP9A 3FBQA 4AC2A 4UQBA 3QULB 4XBMA 4U1KA 1KEMH 1KT2B 2HHHQ 3CZGA 4FG6C 1OTTD 3FFCB 1FNWA 1G7JA 1KMGA 3ENEA 4DAYA 2EDQA 4KK6D 1MWOA 4OGQC 2EXWD 3EYOA 5E00B 5I66A 3L9BA 4WWPA 2K5DA 4XZUA 1BZ8A 4YSAA 3ZE0F 2OSLB 3HC4L 3O6LL 3MCKA 3G6JA 4CJ1B 1DSWA 2DJUA 1M2OA 4X5LA 4FYDA 1NMAH 5FO9A 4A93B 4Z0XA 1F0LA 4AMKL 3LV3B 3APDA 1ZVSA 3WUWA 3TIEA 1TJXA 1U8QA 5C09E 4A7GF 2Y7SA 5ELBA 3B2XA 4K5VA 4E9SA 1T5XA 1SOKA 2YHGA 2UY7B 3OD3A 3WJLC 4F2EA 4J3TA 3LH2H 3LS4H 1QI5A 1ZT1A 3H3KA 4TMPA 4O02A 1S9XA 2DDQH 4HQQL 3U1SH 4K8RD 3RN2A 1P7KB 2QVFB 3GSRA 3PWJB 3DVIA 2OTWB 2X2IA 4GSDH 1N34L 1EQTA 2B3IA 2QKIB 3RWJA 3SCMB 3OLEA 2XPGA 1KCVL 2X70B 4DEPB 4WLCA 3LNDA 4ODUA 3VXME 3P02A 4POGA 4XOEA 3I6GA 3ZZ1A 4DTGL 2E9JA 2FMMA 3IFNH 3ZSSA 1S3OA 1DTUA 2HRLA 2IGLA 5I0ZA 5LUMA 4L05A 4JG1H 3RX8A 2OMYA 3CVHH 2HLAA 4R5VA 2KHAA 4BDVA 2PWEA 1VQDA 1MFNA 3BE1L 3U36A 4NO3B 2NY1D 3BPLB 4GLXA 3OAYH 3W39A 1RV6X 4O2CA 2VNUD 2XBDA 3EOAA 4OWWB 1C8PA 4PJCF 1E4XL 1NGZB 1F6FB 5EA0H 4HIKA 1H15B 2ZOLA 4JJ5B 5IMOA 2H2SD 4IALA 4WENB 4ZAKC 2F03A 1UD3A 3BAJA 2DWDA 4B3SQ 5D1XC 1HU8A 3KDMA 3UIYA 4DGYL 2Z7YA 3PGFL 4K0KL 2HX8A 1J10A 1L9SA 4DP5X 3ARWA 4CJ2C 3T0VA 3QWOA 5H35A 1KXTA 4G6JL 4KJOA 4HOZA 4ZAIA 4N8VG 1KB5L 4NBYB 1UVQB 4F8TA 5CMAB 4KXCA 3PNWA 5I5JA 5KYXA 3HAEA 1JGLL 4QGTA 3K4DA 1ZTMA 2WLIB 5A2QE 1CKNA 5T1IA 3NHHA 1BGXL 1Q0EA 5SX4I 1RUAH 3E8UH 4JCVE 5GZND 1BLNA 1B9ZA 2B14A 1W3SA 3ISRA 2CBOA 3UFIA 2OMZA 2FINB 1VQ9A 2CO2A 1PH5A 4ZZKA 5KBDA 4D0BA 1OOAA 1VZHA 1HWGB 3QCUH 3RTLA 1MKHA 4C3JB 1JD7A 4NXKA 3MOQA 5CSBA 5JZ7D 2OZ4A 2CMRL 3EBAA 4ONGL 1BVLB 4Y5XC 5C2BH 3K6SB 1PZBA 2TRYA 1PIFA 1SF5A 4JYAL 3C5SA 4KMTH 4PJDE 5DZLA 3RUGE 2JXMB 1TWGH 2OXGA 3AY4A 4W4OA 4KJPC 3KH3A 5IVXE 3E6FA 3Q7JA 2EECA 3ULUL 2AMUA 2P49B 3ZRSA 3IGLA 1H8NA 5EBCA 3DPBB 2CLRA 1SZNA 2K7QA 3BSZA 4GT7A 1R3KA 3D0VA 3PU7A 1DUZB 2O93L 4QR7A 1MJ7L 3B56A 35C8L 4WW2F 2A4ZA 1FSKB 3UZVB 1X5JA 3DWAA 4UAOB 5D7IF 1KXVC 4YIQB 3OJDB 4Z7WE 1A47A 1EXGA 3AFQA 2V7HA 3FT1A 1SJXA 2XXCB 1OE1A 1WV7T 3DOSB 1THCA 4OCSL 1WI5A 4L3CA 2A9ML 3TIDA 1PJWA 4N2HA 3M46A 3E9UA 4PHXA 1PGRB 4RAUA 2BVTA 4MQXD 4IDJH 4D0DB 2DMGA 2UZYA 1Z9MA 2NUTB 2ZX6A 1YNNC 1FO0B 3OB0K 4IKKA 1DUYA 4XVJH 2JKRM 5BO1L 5IMLB 1CFMA 1S40A 1VERA 3EYUL 4HWZB 5TE6L 3SVMA 3IFPA 3MGOB 3DROB 1QR4A 1U8JB 2NY2D 2B7DT 1BCPB 3FCUB 5I1EH 2EC8A 4G80B 1EQWA 4OFQA 5BVPL 1IGFL 1NDGA 3NGBC 1BJ1H 4AM0Q 4N2EA 2DWTA 2OQJB 1X5GA 3NUKA 4XNYL 4R4FH 1JK8A 2ICEB 2W8CA 1NFDB 1EFXA 1PSKL 3CC4A 4QRUB 1OXTA