3K6OA

Crystal structure of protein of unknown function duf1344 (yp_001299214.1) from bacteroides vulgatus atcc 8482 at 2.00 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
TVTIAMATVEKQPQYDAPYLVLDNGEKLWVVQHIVPYRDLKAGERIFGNYSFLEAGESGFAYNIRLNDYTLVPVQKIIGLNPDNMDSIGNMKVQIKDMWPSDDYLNVRFMLNFPSPQKPILNLVVNEMIPWTKDGYAHLELRYNNNGSQGRLVPGMVSFKLDDYSPENSELKGIKVLVNPVDGEEKTYIFSYPLTGEDVPGFNPLDLAELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein DUF1344
publication title Crystal structure of protein of unknown function DUF1344 (YP_001299214.1) from Bacteroides vulgatus ATCC 8482 at 2.00 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Structural genomics, unknown function
total genus 44
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3k6oA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3k6oA02
4PQXA 4J8QA 3NQIA 3QWNA 3K6OA 3K0YA
chains in the Genus database with same CATH superfamily
3HG1B 3G7TA 4I85A 1MPAL 2FL5A 3U2JA 3H3VC 4A3LH 3CC2A 2ADIB 3QUYB 5KYNA 1YY9D 4XNXL 3MGTB 3K6SB 4O2FA 2OSWA 4UWQB 3J81i 1IM3A 4E9SA 2UY7B 1BGXH 1UM6L 2MQ0A 2ARJB 5JQ6L 2ED7A 3OLDA 4Y88A 3LN5A 5IOPA 2Y7SA 3BXNA 2BVUA 3VVWA 2AJXH 2WJ5A 4CJ1B 2IQ9L 4YXKL 4XBMA 2FGZA 1WWAX 1XHHA 1U41A 3HKFA 5HYQB 3QCVH 5DMIL 1B8AA 1TWAH 2FGWL 5TDOA 3G48A 1DSFL 3QJVB 2SOBA 1QZGA 1K83B 1LEGA 2J6EA 3LPWA 3WTSA 5KYLA 4LF8L 5I24A 4JO2L 3GTKB 4JS7A 1I7ZA 4L8DB 3HOVG 1DQQA 2O5NA 5DVOA 3LY6A 4XO4A 2X4OB 1NFAA 5HHPB 1ZKOA 2PO6D 4QRUB 1RHFA 1ORSA 5T3XD 1ZLSL 1NAML 1KY7A 3HNVH 3MLYL 1CUKA 3A55A 1EY9A 2QT6A 4DOHB 2QSCL 3JAMc 1R3IL 3KXFE 1CA5A 3V4VA 2CJTA 3SBWA 3S48A 5B8CC 2ROXA 1OTSD 2VDKB 4OZIF 1E27A 4XMKL 3FQTB 3TBYA 1ADQH 1LV9A 2HCCA 1EUTA 3PWVB 4PI0A 4R5TA 5B39G 5TPWL 3FRPG 1GD7A 1AW7A 2NT0A 4R83A 3T4AA 5FFLA 4DAYA 4MQXD 4JO1L 3B9AA 1QWYA 4JFYA 1BQ5A 1HN1A 4KLKA 3QQ9C 1X5IA 4OFQA 2XVKA 3BPCA 8FABB 1OCWL 3QISA 2HUGA 1J18A 5GRUH 2CDGB 1G7QB 4TLKA 4IRZL 1EDHA 3FFCD 3V96A 3BWUC 3KPSE 4QTHA 1PGRB 3LIUA 2NY1C 4KY1L 3TVMB 2DQJH 3MFFB 5H37H 3NPSC 4TNVK 4C59B 4LW1A 1VKXA 5FOJA 1YYLH 2NVXH 3PIQB 4DQAA 4A7GA 4YC2B 5E6IB 4ZXBB 1ZMYA 2IF7A 3PQIA 5IMOA 3ESOA 3PWLA 1CR9L 1SDAB 2Y36H 5CKAA 2F3VA 2JA8B 4G80A 3RU8L 5EUOB 4A37A 4FX5A 4P9HL 1QX1A 2ATWA 3AWGA 1J8KA 4TQ8A 2XPGB 2WINB 1DVTA 3MSPA 5C6WH 4YE0A 1QSFB 4Y4FC 4A04A 3RVWC 3V9FA 4XCNA 3G5VA 1H9DA 1HR0Q 1N0XH 2AGJL 4PNYA 1OAJA 5JA8B 3M07A 5KJRL 3F7RA 2KLRA 2A9DA 2H45A 3OKLA 2RCFA 4H7VA 7PCYA 2JKLA 4RGMB 1J7VR 4JFWA 2F53E 3ULJA 4DN3L 4V190 1TU2B 3CAMA 1O9VA 1ESFA 1M6OB 3KW8A 2A9MH 3FMGH 5DQ9B 4IK7A 4QKXB 5ENWA 1KSRA 2F0MA 3P9LA 3C46A 1WBYA 5C07D 4AGNA 1OLZA 1NPUA 2NTSP 3GNMH 2EEBA 3MLWL 4UQIM 3WLWC 3ZT5A 1WFTA 3EGDA 1AQDA 1KPRB 3FCBA 1A6AA 1E28B 1JD7A 3C6LD 1NBYB 3S9WA 4KRPD 3QIUC 3I4MG 3B8SA 1FDLH 3K4ZA 5D7JC 3VSVA 3UJJL 4YAQA 1I9JL 4YWMA 3DMMD 4DP2X 4Z7OF 4WKZB 3BKJH 4GEIA 5DK2B 2XTJD 3MXGA 5FJ8H 2X1PA 4F9LA 1TIUA 5JJLA 4EKJA 1I8IB 4F80A 5KEZA 4JBJA 3WNJA 2Y06H 5E00A 2EY6A 1IEAA 1QI3A 4I18B 4YBLC 5FO7B 3B43A 2XQYA 2EEFA 4TM9A 1S5IL 1X7QA 2IAAC 4DGYL 4HF5L 1XF3B 3L4WA 2Y3NA 3W57A 2F58H 3B2MA 2FEEL 2PMZA 2FSEB 3L3OC 2OL3L 2XSKA 3QDMD 1MQ8A 4LPCA 3HR6A 3V7MA 2VLKA 3KGTA 3EH2A 4MJ5A 4HKZB 3PUWA 1RK0B 1RMFH 4H02A 3U9PL 4HSAC 4ZQKB 3C08H 2N4IA 1G9NC 3DX6A 4K5OA 4WJ5B 3HEJA 5FF6B 5K9KA 2DWEA 4FQJL 4L6TB 4BCYA 5EOCH 3A3YB 4DP4X 2PCFB 4GP5B 2XT1B 1KB9K 5HJBA 2EDKA 1WJ3A 3URYA 2XQYK 4BFOA 1OT4A 2BHYA 3D39A 3OV6A 5KJ4A 4BSWA 4M56A 1TZIB 3EHBD 3H0TA 2F15A 2C9SA 2VLJE 4WGVB 4N8VB 1QPKA 2HD3A 2FJ2A 2VZUA 2ATPA 4F33B 1PG7H 5I30H 4UOZA 4MDRA 4CGYB 2JJVA 3I4MH 1JXKA 4P9ML 1D5BA 4QY8A 5EHFA 1RIUH 4PJ7F 4NCC2 3U4EA 4CJ0B 4R7LA 2E6JA 3V6BR 1T7WA 1T2QH 3M85A 3A6BH 2W65A 4Y5VC 3RY6C 4OUOA 5AW4B 1NMAH 1YN6A 2ENYA 2HVJB 1NC2B 3JVGA 3QSKB 3L7FA 5CFHA 2CLRB 1FAIH 2HLFD 5FKAC 4M5SA 5ISZD 1KGCD 1B0WA 4AGPA 1N32L 1U93B 3MU3A 4RMUA 3AVEA 3PDGA 5DAUA 3PHQA 1K4DA 3LHPH 2VDRH 4X5XA 4YHOL 3LTVA 4Q2ZA 4YCWA 4OIKA 3D0LB 4DV3L 2NLJB 3HZYA 3MJ8B 1ZHLA 3FB7B 5KSAB 1QD0A 2ZTEA 4TSCL 4ERSL 2BVEA 2V1CC 5K59E 3FQRA 2RJMA 4JI1L 2F1MA 4OONA 3PWPE 5FLVA 1O5PA 1YEWA 1EFXD 5GGSA 4FABH 4HIDA 3MLPA 3BQVA 2EC9T 3KPSB 3DO3A 2VN4A 4UQDA 4HJ9A 1KGUA 4HJ1A 1PKOA 4GAFB 5I2YA 2CCVA 3MREB 1I3QH 1SUHA 2Y4SA 3MV8D 3ARSA 1A3RL 3IDUA 4EJ1C 2P5EE 2Z1KA 1KTLA 2WCPA 4I4WA 3F7VA 4K55A 3MGOA 4WEBL 3MUHL 2Z4QB 4XCEB 5IQ9A 5JHDA 3WYRA 3IFPB 4DV5L 3PU7A 4JO3L 5HHXL 1LTBD 2OTPA 4UBDD 4XWOD 4BY1G 3F2CA 1JFHA 1G6VK 4RMVA 5DEGA 1DEEB 3AG4B 3ULUH 4GQPH 2RHSB 2JB5H 4XMLL 4Z7NF 3QO2A 2VDMB 1OF0A 4Q52A 3PQYE 4C83A 4H20H 2G9DA 4FTVA 4HJIA 4IRSD 2F61A 3S35L 3IJYA 3T9WA 3CPLB 5FPIA 2NX5A 5CM1A 3ECBA 4PJGA 3KUPA 2FRGP 4UDUC 2MSPA 2LE9A 3DHUA 1QFWI 3GMQA 3MRKA 5IUCA 5MP6L 2IEPA 4WI4A 5D7EA 3F64A 4AI7A 2YZ8A 4NZUH 2ZNWA 2M26A 1S8DB 2EXDA 2QCPX 2KJXA 1U2CA 2XBDA 1OGAA 1QKZL 2Z31C 3QQ3B 4CVWA 3SE9H 2AZUA 3IFOB 2N49A 4GQ9H 5TE4L 2V5YA 2PXYB 3R4RA 4FD0A 2L4NA 2EAEA 3EYSL 4X7DC 5FOBB 5DD3L 3NGBB 3CRLC 2O4EA 4GSDH 1NCBL 3KE0A 2L9HA 3A8IE 3O2VL 3MXWL 1QFWH 4ZAKC 1CD0A 1X5KA 1CIUA 4IURA 1CFNA 2J6EH 4OELB 1KDIA 4G72B 3JAME 3HUJF 1QCBD 4JKWA 5BOZG 2FQDA 3JZ7A 3RDTB 3KCPB 4DZBB 5I2XA 4FFVD 4HTHA 4G7RB 3PO3H 4A38A 4R8WH 2EY1A 1XR8A 2FZ3A 1SFHA 4XNZB 4WW1B 4ID6A 2ZXDA 3FQUB 3PP3K 5JMOC 4NZRL 2X4UB 1X9QA 2FO4A 3V4VH 3B9KD 4CUCA 1I4FA 4ZFOB 3FHEA 2J8HA 1Z3GH 5MHSE 5L9DL 1KTDB 1DGSA 4FXGC 3HOUB 3EJPA 3U0WL 4F93B 3SK4A 4FCAA 5IMMB 2Y7MA 3EO0A 1QFUL 1H9VA 2VERN 1XIWA 5CKGA 1XV8A 1KJVA 4JVUA 3U30C 3ISWA 4KNTA 3WS3B 4P59L 4NHCH 5AQ0A 4IBZA 5DK0A 5BS0A 2VLJB 2IJ0C 3N52A 3GMOA 3MKKA 3DXJC 2GI0A 2YU9H 3MXPA 4ZUTB 3ZKXB 1FJGL 4OCNC 3AG1B 4OLWH 5HGBB 5LAPA 1VADB 2Y7OA 5ABAA 1RJLB 4WWKC 1PTOC 3OG6B 1WAAE 4MCYA 1HUMA 1OVZA 4OLZL 2H32B 2FJFB 3G5ZB 2X4PA 1H19A 4M8VA 3CCHA 9PCYA 1QWNA 5GS1C 4YE4L 3BGFB 2F9BT 3FN0H 4W6WB 3ZE0F 3VXMA 3S1MH 3QJYA 4FXKC 1FF5A 4DGUA 1FFOA 4PRPD 3U1SH 3NUCA 3OW7A 2JKTM 4JI4Q 4L18A 1A6WL 5IF0A 4FG2A 4HGKC 3D12B 4AE0A 2F0UA 2DQ6A 1UA7A 3BN9C 3VRJA 4K5PA 1M8AA 1P5VB 4M7ZC 2G5BB 3ZIMA 4KGJA 2WUCL 2VMDA 1IV8A 2MOVA 1SLJA 1WD8A 5JPMC 1LTAD 1GYUA 1HZLA 2C7UB 4HJTA 5GRYA 2EPBA 2XN9E 3NJVA 4L5TA 3KZ8A 1XTMA 1B0RB 4YFLF 3GLAA 4ODHH 4YNYA 1MCWM 1I1YA 4ODSH 4HG4K 2ZOKB 2ZWZA 1BMZA 3Q8AA 3CDCA 4M62L 3CSGA 1C5CL 1DQTA 2YN5A 4ODBD 4IOAA 3REVA 5B8CA 4PJ5D 1IU1A 1I1CA 2XTIA 1BBXC 1HWWA 1TENA 4KDVA 1C12A 3U9OA 3BRFA 3JWDH 3GXIA 3KPNB 2HKAA 4LMQE 5EU3B 4G1MA 2PTTA 4AYMC 2K4KA 1BG9A 1ZA6A 2CJSA 3I9PA 1YPZE 3L9BA 3P3TA 3QFDA 2HHHQ 1RCVD 3QCTH 3ZDYE 1HCFX 2QTVA 4N28A 5ALCL 4APXA 2EY5A 5J6HA 4OV5A 2UXBL 3DX0A 4N2DA 1W2KT 3V4UL 3KF8A 1AFVL 3CMGA 4D0DB 2CW0D 1RLBA 2A9AA 3DO4A 4LLVB 4TPRH 2NY4C 3TASA 5IFAH 2YRBA 1CDCA 3NXWA 4J4PC 3QORD 2FIKB 4A4IA 4JI2L 4QO1A 1XCTA 1DBBH 5D1QC 4N0UB 1ECZA 4XCYA 1CYGA 1UXWB 4JW3A 5LKNA 1FFQA 3WJJC 3CJJA 2CVRA 1U3JA 1ZJBA 3U4AA 1ZV2A 4DEUA 4I65A 1EXHA 3RN2A 2P52A 3SD2A 3RWEB 3D6GA 3IJSA 4LEXL 3QZWB 4X80H 4ENED 5DMJB 2CBOA 4LVHB 3LNFA 3D4RA 4MZ2A 1G0XA 1ACCA 5EDSA 3D3VA 1E8WA 1X4YA 3MUGB 2CG9X 3U2SB 4CVZA 2OQJA 5B7FA 3MTRA 2ADFL 4YDKL 2QVMA 3M1BB 4JM4L 4L1HA 2IPTH 1CQKA 1TFPA 5KN5A 3IE9A 1PQZB 1TOXA 3JZYA 2AXHA 3T0WA 1TEFA 2OA9A 3WEOA 4AQ1A 4JN2B 3Q23A 3SDDC 3RGVD 2F19L 3P9MB 4YHKL 5KZCD 3BJ91 4JFEE 1A2YA 1NAKH 2ZTDA 1V3LA 3MXUA 2ORBL 3HS8A 5TF1H 3TZVC 3VFOB 3FF7A 1T20B 1JPGB 5C44B 4KKAD 2X1XR 1XT5A 5MEPB 1RF2D 1S7XA 4MMZB 4KY5A 1NH6A 25C8L 3QIUA 3TS2A 4KK8C 4ZOCA 5E1IA 3ZYIA 2Y69B 3R2TA 1YEEL 3P75A 2BVOA 3CUPB 1LO4H 2XIBA 2X1OA 4FC3E 4CVXB 2HJKB 1JGUH 1KIUA 2Y1VA 3VW3L 4PJXF 2YD8A 4MJIE 3MEHA 3IFTA 2Y1ZA 4XT1C 3QFJE 1OB1A 5I15H 4ZFFB 3BH8B 1I3GH 4DXGA 3VI3F 1CGTA 3BWSA 4D7PA 1AO7E 3ASWA 3GBMH 3CFDA 1HDMA 4LPWA 4LSQL 1HILB 3LEXB 2O5ZH 3S15H 1ML0D 4HEMA 3VCLB 2R93B 1YEDA 4AIOA 2JKNA 4A7TA 1JK9B 1SROA 4RLDA 3AS1A 3L3OA 2H1EA 2DZEA 1NNXA 5D1ZB 2R0ZL 1XF5B 5F70A 3I4NB 4G9DA 5F71A 5CEXA 1WK0A 1M53A 1SJMA 1UWEL 1Q9OB 3AMKA 5T1LA 2P45B 4F8PA 2F68X 5BQDA 3I72A 1FBIH 3QIBB 4P2QD 1OB0A 4NZJA 4DPGA 5JW3L 4E9RA 2YMOA 2XXCB 3E9TA 5JOPE 1I94Q 3A5VA 4JKMA 4MNQE 3FAWA 2VDNH 3ECQA 2R9HD 1TTRA 4P5MA 1BZDA 4RBPH 2FBOJ 1ITBB 4EUPB 2MQGA 2KUTA 2BK8A 2L7JA 3BLBA 4ALAH 1A62A 4JBMA 3N9GL 5GADC 1KTKE 2DJFC 5A16A 4E68A 1VCIA 3ZBMA 1TQBC 2DQFA 3WENA 5ICXB 2HQEA 1CSQA 1A14H 3EBAA 1N33Q 3SCMD 1DXMA 4LBEA 4QYOA 5CFAA 3G04A 3U25A 3L6FA 1WA0X 2DD8H 1I8LA 2IO5A 2HCIA 4LF6L 4Y5VA 3VR6A 3RY6A 5DS1A 3C09B 4LQFH 4XDXA 2XN9B 4TVPL 5BOJA 5L0QC 1XF2A 3Q6FA 4PY7B 1U91B 2N0KA 2VN3A 3QXUA 4JUSA 3QA3A 1QR4A 5FKAA 4E9VA 2E74C 3H15A 1H15B 1WWCA 4JO4L 3V4UH 1TQTA 3SKNA 5F1NA 1F3JB 3PP3H 2BE5C 4ETQA 1IGMH 4NKIH 2WLHA 2QMJA 3T0ED 4P9HC 1DDTA 4LKXA 1F86A 5T3XH 2JE6I 1STAA 2KERA 3IFLL 1ETZB 1G51A 2RGSA 3QCUL 1MZZA 2BOCA 4YUEL 1YPZB 1A4AA 3BUBA 3ZDYB 4ADJA 2N1KA 1NOFA 4BWWA 3GSQB 5DO8A 2Z92A 2BIIA 4JFDE 2JK8A 5JHMA 3QJFA 1KCVL 3IL8A 2YPKB 3OZ9H 4F8MA 1VQGA 3HI1A 3TA3C 1KPUA 2UWEF 2IH9A 4HHAB 5LNEA 3WN5C 1B9KA 2GBVA 4KHVA 1R75A 2NUPB 4U2YA 5D9SA 5JYLA 1HVXA 5I9QB 2JQMA 1SNMA 4Q9RH 1V3KA 3L1FA 3RNQB 1WPCA 2CR0A 5AW5B 2KDGA 4UU9B 1WS7A 3EFDL 2J44A 1I7UB 4NQDA 3F05A 5JYMA 4QUFA 2LQRA 2XJLA 3TCTA 2OQ0A 2WKLA 4MBRA 3RIFF 1RIVH 2YD0A 3KLQA 4FLOA 3TP4A 5C0DB 2GY5A 3CD4A 3MRFB 4G8IA 3H85A 4IK6A 4RAVA 1J8RA 1JG9A 3QXAB 3KLHD 1KIPA 2A0LC 3VWKC 1PF3A 4RGNA 3TZUA 1NEZG 3O11B 3H9HA 2F18A 4UM8B 5ECJE 4Y9GA 3VFUB 3LRSB 5KVDL 2OMBA 3P4NB 3BIBX 4Z5RB 3RWGB 3DURA 3KDMA 4Z3FA 3INUH 1Q1JL 1J9RA 2UUBQ 3NIGF 5I8OH 2BP3A 2QKSA 2X6LA 3TBSB 1U3HD 1MAML 4FNUA 1D9KC 3E6HA 3PGDA 1BREA 1EO8L 4UDUA 4GKKL 2O4XA 4GJTB 3A67H 1PZ5B 1YEKH 2ESVB 5EIVA 3X3GL 3WTXA 1F4YL 3IDXL 5DURB 3LPOA 4DV0Q 2Z31A 5IYDG 1YNKL 4U0QB 3UTSE 3EYOB 1HL5A 2JK5B 2CRZA 3HR5B 2BHUA 5DJDB 1Q4NX 1PZJD 1GVPA 4RGOL 3VFNA 3UPCA 5FYKE 5FB8A 1FNFA 4K14A 1IT9L 1K3ZA 1R5IA 4KTDL 1DL7H 4ZS6C 2BOLA 1C08A 3ZE2B 4BIKA 1G6ZA 4L2LA 2CD0A 1AS8A 5F88B 4OZIE 4XNQB 5F7EL 3RMHA 1M7DA 2J2ZA 4ZO8A 3WUWA 3SZKC 4XVSH 3PWNA 2YMXH 4YXHH 3QFJB 4G42B 4DV7L 1GGCL 5EBWB 1JVOA 4S1QH 3AROA 3TYFA 4B08A 3SEBA 3LMJH 4ZMLA 4J15A 4LVOC 5IB3A 4TLSA 1XF1A 1M56B 5IK3A 2VQ4A 4MJ6B 5EU5A 5DUPH 1HHKA 3PF5A 1EU4A 4QPEA 1D1KA 1J5IA 4I2XB 3WIHH 1Y0LA 5I71C 4FXGA 5AENA 4AM0A 4Y1AE 4PBDA 4FQIL 4JCWA 2Y5TB 4MD5A 1Q94B 3O9WB 2XETA 1CDBA 4M4RA 1GCYA 4APQD 3MRGB 3SE4A 3RN5A 2IJ0A 3RGHA 5C86A 1LP9A 1SQ2N 3IJ8A 1A3QA 5D14A 1IL2A 2IAMA 3GKZA 1SLXA 4K7PH 5IYDH 2GAZB 4P3CL 5JDJA 1R3HB 1CKNB 1N68A 1YN7A 4M1CC 2HKHH 5SWZB 1Z5LB 5HVGB 1KG0A 4WRLA 4C1NK 2WLIA 5JIIA 1Q82C 4OZ4A 5HYJE 2VXSL 3FT9A 5GS1A 1IZJA 4FI7A 2V4DA 4ANUA 2YXVA 1SBSH 3IBOA 3HPJB 3AADB 3BYTA 2YKKA 1NCGA 4RNRA 3EOTL 3S7GA 5C4JH 4FXKA 4EIGB 3RL2A 3QVAA 1IARB 4UAOB 4RFEB 4OV6F 3ML8A 3DX1A 5DD6A 4DT2A 5DJAA 4DR4Q 3BQUC 3L48A 4RWYL 3BWAA 3PO2H 1PX8A 3GYRA 5DJ6B 1H9SA 3AUWB 2XG5A 2OJEA 5JPMA 4BFEA 4QRTB 1NGXA 4Z7OE 4LNRB 3S36H 1WFQA 5C3EB 4YXLL 1A7PH 4GSXA 4YZWA 3BZ4A 3FTXA 4DH2A 2BNQA 1ETB1 4R4NC 3J80i 3EF7A 4JFDB 4M5YL 3IDMA 4H0GA 3RX9A 4ODWB 3NPZB 5BJTB 3MRIB 4HIXL 4X6CA 1EIHA 2XKUA 5ESVB 4G8EB 1P1VA 2PWFA 2VERA 4H5SB 4Y4HC 2LGNA 3WFDH 4HIIA 4EN3B 3MV9E 4R90L 3KPOB 3WFBL 5KYUA 3WY3A 1CXKA 3P2BA 5IGXL 3ULAB 1KLUB 3BEWB 2PZUA 2EXWD 4PMEA 1CWVA 2ZKYA 2SEBA 4QDGA 1QI5A 2FJGB 2ZAGA 2EVJA 2P8MB 5KVDE 2DTMH 2OCFD 4J4PA 1RZ8A 1ZLEA 4H40A 4DR5Q 1GY2A 4TNFA 3TN0D 3PAZA 3LSOA 4Q4EA 1IM9B 1UTDA 1AR1D 3PHOB 3IVKA 1BLNB 1MFBH 3LH9A 3V4PB 1TPXC 5EC2A 1VFAA 3WJJA 5K9OA 2A6HC 1OE3A 3MCLL 1G9NH 4FNLL 5FHAH 2YAOA 2F74B 2AK1H 4MAUL 5EUKB 2HUHA 1RJTA 4FJYA 5M3MB 3ZL4L 3A0JA 1L9QA 2H0FA 1SYFA 5FGCE 1JWUA 3H0GB 1HZ9A 4MRCA 5IQOA 4OD1H 1J1OH 6PAZA 1TQVA 2IOOA 3BSZL 5DVMA 3MRHA 5C0RH 1KELL 3E1ZA 4MD0B 1ZGLA 3OLIA 3ZDXF 4G6JH 3HE6C 5D7LA 4NNPH 3MXNB 3CTTA 4P2YA 1CD1B 3O6FD 1JERA 4OZIB 1JWSA 3QO1B 4Z7UA 4OZFA 4KN4C 2F7RA 3OM3B 3VG0L 4PG9A 4OM0H 3RWDA 4TUJB 3TZVA 2OX5A 3FC8A 4FQCH 4KH9A 5HJ3B 3RUGB 4L8CA 3LQZA 3CMAA 1UB6B 2VDLH 4LHUA 5JLZA 2YAPA 1S5HB 5E08L 3QDAA 2YLKA 1HYSC 3G6JA 2Y22A 1RIPA 4TUOB 4OL7A 5BV7C 5K36G 4AQAA 1BLIA 3MLXH 2XWCA 4B9ZA 3UC0H 1O6SA 2EP6A 5DQDL 2J4WH 3GJFB 4ICWA 2JTDA 1WBZB 3LQAC 1WCMG 3CBRA 5IHBA 4KK5C 4FF1A 3F6IA 3MBXH 4V2CB 2D3LA 1IX2A 3IN2A 3I9IA 4WI2A 1NGYB 4Y19B 3QHTC 4GNXB 2ADJA 3C87A 4PJAA 1ASQA 3Q6SA 5IB1A 1T80A 4GI6A 3V0HA 4AQ8C 4DP6X 2WLNA 3GO1L 5CJBA 2GN5A 3QI9B 4IEFB 3P73A 5TQ2H 3DJTA 1O9WA 5J3HD 2QJDA 5DWPA 3FRUB 3O6KH 1S6NA 5BO0D 2OTUA 4HK0B 2DLFH 1GZPB 4X6EA 5EA0L 5F7FA 1UVQA 1TWFB 2VYRE 1HEJC 2KCCA 1BD2D 1A6TA 1A5FH 1EBPA 2AAAA 3U79A 2EILB 5D6CA 4DR3L 2BS9A 1GKHA 3A22A 3M1OA 1A7BA 2K14A 2EEAA 1DJHA 1E5AA 4Y9FA 5HD8C 3DO7A 3E0JA 2EDHA 3V0VA 2FCBA 4XZ4A 3WO4B 2XVGA 1LVEA 1IKMA 1RUPL 3HNSH 2EABA 4NQCE 1ZXQA 3US1A 3AU1B 5C0JB 5LDSA 3OTTA 1TKWA 1OGTB 4U1SA 1L9OA 1XCWA 3O4OB 4IFDJ 1DYZA 3GK8L 1HFUA 2I60H 2J20A 43C9B 4LJZC 1CYWA 2DQIH 4OTXL 1J87A 4ZODA 4BQCA 1B4JL 2AEIT 3QUMA 4Z7VB 4Z7OB 4LBAA 1XR9A 1ICFB 1L7TL 3HUJE 4O02B 3X1GA 5J06A 5JAVA 2UYLB 2YWYA 4RDQG 2FJHA 2WV3A 4KITB 4PYHA 2NVTB 3EGXA 3H9YA 1BQLL 5DO2C 5AW7B 4MMXC 4H44C 3TP6A 1RTOA 5L2KD 3U6XA 1WBXB 3ERSX 2VY3A 2FX8L 3MRBB 3VA5A 2IGLA 2XV6B 3MV9B 1LGVA 4RA8A 3OGCB 3GUTB 1W6WA 4XHJC 1HNZQ 1HQRA 1X6OA 4A3FH 1OSEA 2DH2A 4OQTA 5J4MA 4L4VB 3CCLA 1FCGA 2HLEB 3DUSA 3PJSB 4FNRA 4X7TA 5EB9A 2B9BA 4XN4A 1IBMQ 3K2IA 2R4RL 4H1LB 1F9SA 4QHUB 1NEUA 1TNNA 2E6QA 4HKJA 4M48L 3WN5A 4EQ3A 1SFDA 4G6MH 1UATA 1P2CA 3K5MA 3D2UD 4DFAA 1R17A 5JEAG 4U7MA 1AE6H 4L8JA 4WO4D 2IQAA 2Q10A 4MNOA 2A9NL 1GW6A 5IT2H 5C3WA 2MCG1 2LHAA 2JVUA 4O0AA 1N34L 2HUEA 2Z8RA 4OGXH 3QHZH 4F15B 4L4TE 1P4BH 4OX9L 1Y6NR 5C92A 4DV1L 4K8RC 2VDOL 3ELAT 3VWKA 4EDWL 5LXGL 3EVQA 1JGDA 3MA7A 1A1OA 4H4NA 5AB0A 2NVQB 2HPTA 1F18A 2DMCA 2F0JA 1UH4A 3FPPA 2WOBA 3CIAA 2L7QA 2AXFA 2AKWB 2ENJA 1TWCH 2FQGA 3R7QA 2ALYB 2ICES 5I6XB 5FA4B 4HDIB 1TT6A 3A7AB 4FHJA 1PTOH 3KLWA 1WFUA 1WTPA 5DZ9A 1C48A 3JV0A 2C34A 2X2YA 3KDPB 4XBPB 1D9KA 2PYFA 1JHKL 4NUPA 4P2CG 3A4EA 1X5JA 4YGVB 5BUGA 4P5TC 1Y6MR 5GS2D 1FLRL 2C3WA 2C8NA 1UHVA 1IBDA 2W07B 1UUNA 2FBJH 3MRLB 3KF6A 5AW6B 4MJJA 3OIQA 2YD1A 2FD6L 3FQXB 5CMAA 2WBWB 5C09D 2ZCKH 4ZUSB 3HOZG 2ZONA 1YNND 1A7OL 2EC8A 2W60B 3Q5OA 4UTAA 3R3OA 1T1ZB 2UZIL 4RSYA 3C2AL 1SYEA 3K7AH 2NUTB 1DVFC 3HFMH 2A9CA 5EBDA 2H3KA 2Y0SA 2VKWA 4NKLA 1A1MB 1T04A 3DIVA 4WKXA 5K39B 4B97A 5DYOA 1UWXK 2NYYD 4P46D 2HMIC 3IFNL 1G6RA 3ZHDA 3L9YA 5FW6A 1BQSA 1PY0A 3VD5A 2DIBA 3LB6C 1ODAA 1WG3A 1HNGA 1YNTF 2VW6A 2BH8A 3SBQA 1OAYL 3EZ8A 4G8GD 3VXPA 3PPEA 2XCMC 2NXZC 3P9WB 4IUPA 3V7AG 1DONA 5CGMA 5D55A 3IS0X 2FB4H 3SJVD 3A8KE 4TF4A 1CFSA 2EYLA 4ZKBB 4LCCB 4IGBC 1E6JL 1Q0YH 2AEQL 3VFGH 4Z78B 4PJFA 4Y8DC 2E9JA 5GIRA 5J8OA 4GOPB 2WTRB 1LK2A 1ZA3B 2DAVA 1LT6D 2V7NB 5AALA 1HCVA 3SY0B 1JPTH 5C7XH 5L4JA 1P7QD 1T0MA 2CCLA 4FFYL 2CIIB 2G2RA 4HJGB 3VMPA 4DGWC 1FGBD 3KJ4B 3CU7A 2JA6B 3P4OA 5AFAA 1Y8PB 3I6KA 5AKTA 2IOMA 4PJCA 5DJZB 5KSVA 1X5LA 4OCSH 1MVUB 4ZJ9A 4AL8C 1PKQE 1ND0A 3WV0A 2APVA 3RPBA 1TWHB 4P5KA 3V6OA 1ZT1B 5KYWB 1PCSA 3ZTNL 1IQDA 2DNCA 1NGQH 3L3KA 4JRXA 1N3NB 2AXGA 5FM8A 4ZMPA 4G7ZC 3W0WA 1VB9A 1DBJH 1X9RA 4ZFZA 4HIHA 2ZOLB 4D3CH 4XTRD 3FFDA 3HUJB 1AXSA 2XV3A 2WP3O 4JQVA 4JZJB 2Y1YA 1BF8A 1KCBA 1R5VB 3L45A 4XMXA 1P8LA 4ZSOA 2OP4L 3CZUB 5JORB 2EXTA 4U6YB 1GR7A 3T3MF 3H42L 5A2QL 4OCWH 4BE5A 4PJBA 3F58L 1BM7A 2X41A 4KOBA 4QJ4B 5ISRA 3EYQD 3MODH 5HGDB 5H4YA 1WHOA 3BW9B 3C60B 1SGKA 1IBLL 1NMBL 4OZFH 2PI2E 2Z6KC 1BFVH 4NFDA 4ZDHA 4JN1L 3SYAA 4PJXE 4EQ5A 2PPCA 3B7YA 3T1HQ 2RSOA 3AREB 1JORA 4C4KO 3S98A 2PW2B 1D6EC 3GUFA 4NOFA 3WEXA 5C08E 4C56C 4ELKA 4Y7NB 3BPLB 2Z93B 3L0OA 1HNXQ 4NENB 1HQ4B 2MHAA 2CQOA 2D03L 1SNRA 2WXRA 5IOCA 5JW4R 1J0YA 5DJCA 1LO5D 4LSTL 3V0WL 3FBQA 3I7FA 3OXRB 4XOEA 4Y4HA 3I3BA 2E5EA 2ROYA 2RALA 1E42A 1UA6L 3QHFH 4H8HA 2NB0A 4XX1E 2WB1E 2UU9Q 1I8MB 2YS4A 4WI3A 4XXCC 4UYPA 2KA7A 1G43A 4IFDG 4H2CA 4L4TB 5DJ8B 1JFQL 2EICA 5FV1L 5AWNH 4ODVL 5E9NA 1T1YA 3LHAA 4X9HA 1UH2A 1MRCL 4AMXA 4CN4A 3GMRA 4ZD3H 1JVLA 3A56A 2R61A 2J3SA 2OTWA 3F7YA 3IYLW 5FWRA 3DTXB 4RX4A 4HAEA 4I3SL 4YDLC 3RZCB 4CILA 4IJHA 1BIIB 1DM0B 3H3PH 1IEHA 1Q7YC 4L63B 1A7RL 4LSSH 3WI9A 3UAJD 4DETA 1PZUB 1UGKA 2W0KA 4P4KB 1TWGB 2B0SL 4KKLC 1SXCA 1UM4L 2VGLM 3NA9H 4LB8A 1LO3L 1YEGH 2GCYB 3S2HB 5I19L 3TRZA 1KBWA 32C2A 3BDYL 5IV2B 4J27A 1TYRA 1T5XD 1FYTE 1QEWA 3NH7L 1TETL 4KJQD 5AZUA 1JCKA 3RNUA 2HJLA 5ID0B 3BP4A 5BVJB 3W82A 5EFIA 4AQOA 5D1XC 5CD3B 5I5RA 1VENA 4IKIA 1TS2A 3BRDA 1D2PA 3BD4A 2ZUQB 5DEFA 2NOYA 4I0CC 4WFGD 2NY0C 3JTSB 2V5TA 4XMZA 1XF4B 4LF8Q 2HJFB 1BFSA 4JDEA 3SB3A 1FZMB 3AQDA 3ZXAC 4TOYH 3FT2A 3QUMH 1INDL 2AVFA 4NP5A 4A3DG 1AI1H 1J8HD 1HNYA 2N7SA 2NRDA 3ASNB 4I0PD 4M7LH 4MBOA 1E4XI 2AQ2A 4GKOA 2VLME 4IFDH 4Y2OA 3QEQA 3RG1C 3SPIA 4KBPA 5B38G 1YMMD 4RCAA 2ED8A 4F7CA 1BJ8A 4L3CA 5INCA 4ZRZA 1G0YR 1CDUA 5M95B 2DWXA 3QNXA 1K9MC 4XVTL 4MA1C 2OMTB 2DQUH 5JO5B 2UWEE 2OMWB 3QXVA 1T7ZA 3IRBA 5IW3A 3E8UL 1F2YA 1IQWH 1E4XH 1NZRA 3NCCB 3T8XA 3BT0A 4C3HG 2EQSA 5E9DD 1OAXL 3CXDL 4NHUA 4OQTH 3SZ6A 3S4SG 3KBEA 2QFRA 2ZOTA 3ORJA 4AQ8A 5D2NE 1PPIA 2WZAA 1A64A 3KBXA 1ZGLP 1ANUA 1S46A 2IH1B 1OAQH 4X0NA 5KSBA 5L8KB 2O61B 1W8OA 1A4BA 2YQBA 3U9WA 1M2VA 1MHHB 4HUUA 5FUZL 4RQQB 1AP2A 1V43A 4YHPA 3SK8A 1MJ8H 3BWZA 3K5NA 2UZYA 3DLQR 1CA6A 2OYMA 1I31A 1EMTL 3MNVA 4ZMAT 4XGZA 4NN7B 5LGJA 1ET7A 1TVHB 4FS0A 1F3RB 4YPJA 4FJZA 1MZYA 5TDNB 4JNXA 4YX2L 4LAQH 1NCOA 1BBDH 2KQNA 3DRQB 4J3OH 5EZJB 1N4XH 5AVZB 3SKJH 3TP7A 5BV7L 2Y72A 2QPEB 4HAGA 5J5EA 1A3LH 1BAGA 2FECL 5A2QE 1EY8A 1ZT4B 2AJZB 3CMOH 4KUZL 5E8EB 5CBAB 4UT9L 3EJJX 2XWBB 5IT9c 4HLJA 3C8KA 7PAZA 4Z3JA 4C54A 4KI5E 3F7QA 2L3BA 2DPKA 4TTGA 1B1ZA 1UWXH 2EIZA 3EW3B 3NSJA 4FN0A 1HHIA 4NBXB 5EPJA 1T22B 3LRGA 3PFQA 5C08B 4B9YA 2EYMA 4YVUA 1DUYB 1BBJA 3A74A 2QDWA 4LF5L 3ARZA 4MMXA 3L7EB 4UTAH 2Y3AA 4WIQA 3SO3C 1XCQA 3ZKND 4ATWA 5FECA 2QR0B 5EWIL 3GTPH 3T2PA 4Z9KB 4RMFA 1E4KC 4A2HA 5C0EA 3EH1A 3VG9B 3GMLB 4EQOA 2B2YC 1A6UL 1YCSA 2WB1B 1G9MH 1U6AH 4OIBA 2GSIB 1QLEL 1Z9NA 4HCSA 4LLUA 5F9DC 5A2IH 2YQ2A 1G6RH 2YLHA 4NQSA 4UNIA 3HOYG 2VABA 4HD9A 3LV3A 2QLVB 4K3GA 4KX7A 3RJOA 4M6OL 5JMRA 5LLIC 2Q2TA 3DSFL 4PRAB 5HSFA 2MPVA 1VQDA 3T13A 3FF8A 4A68A 4EZKA 4NZDA 4RKLA 4X5QA 2Z3FA 4JQIA 2BS71 5AYUH 3ZMNA 2G9HB 5CEZL 5AVUB 3P3SA 1C7SA 3IDNA 5D70H 1JV2B 3PS6A 4HGWA 3NZHL 4L1LA 2RQXA 2CHBD 3ARGD 5FYJL 4KZEH 1HU8A 4S1SL 3D85D 2G5DA 2JXMB 1FYTB 3ESPA 1ZEAH 2VAAA 4ALPA 4LU5H 1PH9A 3I6SA 2BDOA 1B0GB 1WP6A 4R7DB 3K71A 2AQQA 3DJ9A 4AVHA 1FP5A 1K4CB 3DDGA 3HOWH 3ARTA 3PGCA 4AITA 3F3HA 4HT1L 4B0MB 2PR4H 1QFOA 3CH8A 2G3XA 1JJCB 2A74A 2GK2A 2IGTA 4MDIB 5AG8A 2BW5A 5GS0C 3BRGC 4M1DH 1QR1A 4PCSA 4KQ4L 2X1WL 4OFYA 4LAAA 4P07A 1G0DA 4P5TA 2R39A 5LNGA 3HRZA 2DN8A 1FL3B 2B59A 4O1NA 1TCMA 2HPOA 2V2WB 4GAJH 5K1JA 5EQ0A 1H8LA 1FN4B 2YXMA 2X7LB 1EEYA 3CZNA 5TD4A 4E9LA 1N32Q 3CHSA 2WWNA 1FO0L 1SMDA 2B2UC 3NCFB 5IFHL 1SZNA 3HOYH 4KTEL 3TJPA 2BSSA 2C9UA 3HOVB 4OJFL 3TEYA 1DVFA 1EAJA 4DV3Q 4EI5D 4F91B 1OY3B 2VZ1A 3SGEI 3GTJH 4BINA 1JUFA 3IT8D 1M7IB 4HWUA 3P4MA 1N5AA 3UBHA 4JI1Q 4I88A 3PUCA 4MA7L 3DGCR 4KKPA 4KQ3H 5K9QG 5E7FA 4QWWC 4PS3A 4DGIH 2B1HH 2OTJA 1CQVA 1BVZA 5D2NB 4KH2A 1UM5H 5B39B 3SGEH 3FRPB 1IC7L 1BBUA 1X3GA 3DPBA 2I5YH 2W38A 3FQNB 3S37X 1XGPA 1SBBB 1E9PB 2V9TA 3VH8G 4LLMA 4YEEA 4KZDL 1MSHA 1A7QH 2A1WL 2MNJB 1BIHA 3IDIB 5C0CB 2K45A 3GRWH 4XI5C 5LWYH 4IGBA 1Q81C 3QULB 1IHZA 4MA8L 3SGKC 3PRZA 4DV5Q 3JWOL 1NEPA 1U8KA 2Q3XA 4IDJH 1BZEA 4XO8A 5SX5H 2CH4W 5TJWK 3T65A 3GZQA 1EZVX 3DXAA 5I6OA 2DWDA 2ALAA 4EI0A 5PCYA 4KO6A 3U4BL 3ZTEA 3TEHB 1S7UB 2XG4A 3QR1A 3H56A 2HRLA 1T1XB 4TRPL 3TESA 5M5YB 4GINA 1MIEH 4OLYL 2EUVA 1ZHNB 4JB9L 4LSRH 5I17B 3G08B 2O5XL 2Y5QA 1PH2A 1IRAY 4U1HB 4I5BA 1AY1H 5DDHB 1G1OA 3FO2B 1KJ2H 1A6XA 3ZDXE 1YDPA 1XYIA 4JY4B 3LZQA 2NXYB 2ZXRA 1DJSA 2QQLH 1T66D 3QG6B 5DJXB 1TS4A 2WBJC 3NN8B 2IANE 4N2KA 1MCCA 5I8EA 5KVGE 4DP0X 2VR7A 1J9OA 5DGQA 3NZSA 1DQML 3P2DA 3V0FA 4A1RA 4YSDA 3WY1A 1LEIA 1BCPB 2VR6A 4GRWF 4CBZA 3VXRA 3BZDA 4QNPF 4U1GB 2AJUH 1RSYA 1ZK9A 2EE2A 1JZ3A 3FKIH 4KKCD 3TH4T 4A66A 1RZGB 3H3KA 1YITA 5AJ3L 1JGLL 4JG1L 5FK9B 4A6YA 2PYKA 5IMKA 2WAQE 1FIGH 5C6AA 3LN4A 2KHAA 5T1KA 4LF4L 5DWUL 1SMAA 2Z6KA 5DMGC 5CO1A 3N0AA 4UM9B 3S17B 2EYSB 1SMYC 4XBGB 3P0YL 4PIBA 3BUTA 3N41F 2F5AH 1D6EA 2EUWA 1MY5A 4IUNA 2ATKB 1CHPD 1J5DA 4QOKE 2W1NA 1AN8A 3EAKA 3KPMB 3TDQA 2FNBA 2F0EA 2PWEA 4PSPA 3CLWA 4JG0L 2YKLL 1UENA 1HA6A 2B7DT 3VTTA 4RDQF 5DMYA 4C4BA 5CEZE 1ESRA 5BUAA 4EGVA 4Q97A 1RZ7L 3DVNB 4HS3A 5AVXB 2ADYA 3BP7B 3QOJA 1H3UA 4DP5X 3LQAH 5FYJE 3L95B 4XXCA 2GEQA 3Q2NA 4PJ9C 3UG3A 3EYFB 4X3TA 2O1AA 4Q9QL 1Q0EA 3A8JE 3VXNB 1BXTA 1S7SB 2FYYB 2R1XB 3FO9B 1AZCA 1PFOA 2A6DB 3B56A 1EJ6A 3QUYC 2YPLD 1ETJA 3VXUD 3PNWB 4JRLA 4FEMA 4LPTA 5F9WB 1VQBA 5CLZA 1WTQA 1L9NA 1FJGQ 2YSTA 2J7LA 3GMNA 4F1SA 2NY1D 1KXVC 3NBHA 4FFZH 3TTYA 4Y8AA 3KPTA 3Q5TA 1VHPA 4HUKB 5IB5A 4V2BA 2JJTC 5HGGS 3MLZL 1I4GA 3FUMA 3AQYA 1L9TA 3BD3A 1Q1EA 4JFFD 1AGFA 2GI7A 1SY6L 1I3QB 3PAUA 4I1RA 1MWOA 4IUVA 4JE0A 4X7SL 5DJYA 4DKAC 1SEQH 2F7QA 1KYAA 5J11B 5HYSB 3MBEB 4XMPH 4X8JA 5IT9E 3L3HB 2NTTA 3M9BA 2QSTA 4G3YH 4LCIH 4YDIL 4KPHL 1B2WL 3T77A 4BCXA 3UTSD 3TT3H 5CBEB 5JXEC 2HT3C 2NY5L 2UY6B 1HIML 4Y4FD 3RVWD 4RRPG 5H94B 4WUUD 4C55A 1H95A 4F7EB 2DLGA 1X3PA 3FU8A 1WIUA 3JQOB 4A3GG 4CKBA 2QGCA 2YPVL 3SIKA 3OL2A 2BDNL 5JHLA 1MRDH 1KTJA 4QRPE 3MLSL 3I91A 1MW0A 5EC1B 1CFTA 2B20A 4NIYE 4MSWA 4BA8A 3O3BB 4N8UA 4NO3A 2BNRA 4IW4C 5FKPB 2XVSA 1J5OH 1CKOA 3RWFA 1T83C 2COQA 5D6DC 4UB0L 4K5WA 4JFZL 1PYWA 4GH7B 4YH6A 5L4IA 1AHWC 5I1KL 1F1GA 1TVBB 1XGTA 3L13A 4X5WA 5D7JD 5DRNA 1SF5A 3VDCA 3DV6A 4HPHA 4OWTB 4KO9A 4L3EE 2W9DH 2BH2A 2J5LB 2E27H 3VQ1C 3UBXG 4JRYD 3BH4A 3DX9B 1RZKC 1TZHA 4LCWE 2LAGB 2XI9A 4HQQL 4YC2C 4ZXBC 5ESAB 3AU7A 3ULPA 1P1ZA 2UXBQ 4KROD 2QSQA 2QEXA 1R4XA 1Q9WB 3S1NH 3LKNB 4HZAA 1UGNA 3CVBA 4JI2Q 4M02A 4OAWA 4GT0A 2NY6B 3LKQA 2ZTBA 3EXJA 3GLDA 4WTZG 5DR5L 5B1JC 1RZFH 2BZCA 4FF9A 3ZO0A 2I26N 5A3ID 2J0TD 4BY1B 3OAZH 4U3SA 5EBGA 1T3FB 2VXTL 5I18L 1L0YB 1KIXA 3OR7A 4WJWA 2ITDA 2WKGA 4KRNA 2AJYL 4RGMC 5GISH 4DK3C 1XMWA 4QMEA 2FEJA 5EPLA 3MMEA 4K8RH 1WTHA 4A3MH 5FDWA 2DQHH 3PF4A 2LVEA 4FP8H 4C3IG 4YSSA 4WSKA 4NMZA 2CNZA 1I7TB 4HCRL 1BQRA 5I5JA 5E99L 4CNIA 1HR0W 4V1DA 4BA2I 5DHVB 4YHIA 2IBZX 3PSIA 2F5BH 3DX8A 4G9FE 4HW6A 5JW4N 5IJKA 3O4LB 2YGOA 4NXML 3HG9A 4HJ7A 5C0AE 2BOSA 4OFPA 4UILL 1YNLH 3RAJH 4NQED 3SKOB 4H0IA 2ICEB 1V27A 4BKLA 3QEUB 3K6DA 4QLWA 5ICYA 1W15A 1EEZA 3BSGA 3GP7A 1SJEA 4QOKB 2ZXOA 1GM5A 4NSKA 3SHSA 4HLZG 3QIWB 2DH3A 3H9SA 1AP0A 1JYXA 1KNOA 3OF6D 4TULH 3RYMA 2NQDA 2ITCB 1QZHA 1J0IA 2H41A 5HY6A 1J9TA 3MZTA 4KKTA 4PB0L 2UUCL 3TM6A 1EJ8A 5G3LD 2B2YA 2OR9L 3E9UA 3JUZA 2YC1A 3UYRH 2HB0A 1I6VC 1IKOP 1RUML 5B3SB 5GSVB 3IU3A 1PH8A 3CH1B 4GIOA 1NCJA 2MQ3A 3NTKA 4U1NA 4KNSA 4XP6L 1UJ3B 5DHYB 1KFAH 4I13B 2Q87A 2BIQA 3R7RA 2C4FU 3NFNA 1HZAA 1JK8A 1I3RB 1U8HA 3I4OA 4G6KH 2WO3B 2CJUL 4NKOA 4K3EL 3TOPA 1WIPA 4WAFA 4IQHA 3OKOA 3EYVB 2UXFA 4HJ8A 1NSNH 3WFCL 5L2JB 5E1AB 2HLAA 5EEUA 5DRWA 2AK4E 4CSZA 4NQDD 3UACA 1CFBA 4IPGA 1U58A 1KB5A 1VGEH 2X40A 2ZXAA 3X11A 3B2VH 4GW1B 5F89A 2WQWA 1IGTA 4J1UA 4DAGL 3TO4B 4CC4C 4OVVA 3L9EA 2IBGA 3H3BC 3JV6A 4PTTB 5IHLB 3T0BA 1K8DA 1I1AB 4M4PA 1ZT7B 5AOKA 4AL8H 3O45A 2HX9A 3NCJH 2VUMG 2O6DA 1FZJA 2J6WA 2QQNL 4DERA 1WCBA 4KGLA 5HI3D 2XQYG 2ZZUT 2IW3A 4JDZA 1HAUA 4A76A 2NDGA 1MJEA 3A21A 3ARDC 3RIKA 4KKUA 4R2GC 3T3ME 4K8IA 4LF6Q 4FQ2H 5FUCE 4WU5B 4QRPB 1Y8OB 3PV0A 4U1IA 5DD1H 1DVUA 3PABA 1N7ML 1JWMA 4ANXA 2N3JA 1L5GB 2YARA 3FFCE 1WA1X 3FCSA 4K5MA 3MA9L 3EJCA 4N0RA 5D2LF 4FQ1L 2WGNB 1RJZB 3MRRB 2QEJC 4M3HA 4OGYL 3S88L 1W80A 4TLUA 3CMEA 5E3FA 2DLHA 3G7LA 4X4XB 4PBXA 5I8KL 3VR4A 1DO6A 1G7MA 3Q8BA 4NP4H 3AXLB 1JGVL 5C71A 1KYFA 4ZAKD 3ENEA 3VE0B 4W9HC 4YWGL 3VXQB 1QACA 3Q24A 5G55A 4Z77B 1CT8A 1CZ8H 1R3LB 3J7AV 1S78C 3OKNB 1OP9A 4LCWB 4P2AA 1DHKA 1W72L 3GSRA 4G7VL 1FNSH 1JZHA 1WT5C 4PR5A 1QHOA 3AY4C 4UMSA 4N0FA 1LT5D 2ZX9A 2OSLB 5E51A 3I73A 4WRDA 2VLRB 3DOSA 3SE8H 3U9UB 4A63A 5IKCB 4M7KL 3QYNA 1STEA 4ZOEA 1K3IA 5FO8B 1GUNA 2Q7YA 2V8LA 1LO2H 3IDJA 2PCYA 1KPVA 1GJUA 1L9PA 4LF3A 4YLCA 3PPSA 1B7YB 2BW4A 3CW2C 5IROC 3AGVA 1MAJA 2OMYB 3H2QA 3SGKA 3WXWL 2VKXA 4IIQB 2XWDA 2P5WA 1CBVL 4L1DA 1BQHG 3GGWB 1VFBB 2O26U 2WP3T 1OZUA 5DTFB 2YEZB 1VMPA 1P4LB 2Z4HA 3HE7B 1QSEA 3MHZA 2FE0A 4WY7L 5JOFB 3TNMB 4MAYC 3AQXA 1G5AA 3CQPA 2NCMA 4YDVA 1HSAA 4H8UA 2DIEA 1RJYA 4X6FA 2B2XH 1AIFB 4CMMA 1V05A 1LHZA 3RLOA 3S1RB 3QFGA 1FZOB 12E8H 2WLLA 4NCC1 4G9FB 5GGVL 3I6GB 3VU1A 3BUDA 2EINB 4WWKD 2PXYC 3C12A 5JR1L 2XTJE 3OTOL 1S3KL 4R8IA 1XX9C 2WBJA 1PA6A 3CFNA 3QDGB 4JPWH 1NC2D 4GKKQ 4C4KT 4A93G 2EOTA 2PQEA 2ZT9C 1CVRA 2E2DC 4WWNA 4BZ2A 4E9TA 4FFWC 4HCEA 1ZD6A 1U8CB 2OXHA 3FHQA 3KXFD 1MWAA 4ZK9B 4AIZB 4M9OA 1XGYH 3LOWA 5BVPL 3CVHL 1IVTA 1TJGL 5IVOA 5KSAD 1YNTB 4IS6B 4L23A 1AGCB 2PYEA 4HFUH 3W39A 4N9OB 1LK3L 3BAYA 2VC2H 3PAVA 3BN9D 4BQBA 3WAKA 1A66A 3W2DH 3PWUB 4EQNA 2CNYA 3U46B 1YNJC 2X44D 3L5WB 5JHLH 5IR1B 3MFGA 1IC5L 2FHTA 1AQKH 1OSPL 4DV7Q 1UA3A 4H8QA 3LRMA 4NUGH 2W91A 1L0PA 4U6VL 1YNXA 4JANB 1KEML 3VYPA 4GAGL 1N6VA 3WGUB 3NSYA 1HZHH 4YQXH 1I3UA 2JLPA 3TV3L 1SNCA 1NIAA 5IZ7A 3KG5A 1JF1B 4ISVB 3ATBA 2PQAA 2R69L 3RPKA 4IUUA 2DYPA 4W9FC 4PB9H 1W16A 1OARH 4MD4A 4N8CL 4XO5A 2AK4B 1NBZA 1BFTA 1IGYA 4PJ9A 4CKVX 4PRNA 3WIIL 2VRAA 1TQSA 1BA9A 2LKVA 2PO6B 3HG1A 1NCDH 4XVUC 1JNNL 2ADIA 2YD6A 5DLMH 3QUYA 2ARWA 1KGCE 3MGTA 4HAKA 3L16A 3VJ6B 2K6WA 2SEBD 2E7MA 2ZKHH 3K6IA 2UY7A 2NCEA 5TK2A 1KXVA 2ARJA 4DUZL 3CV5A 1U8NB 2VT0A 2EYJA 1D5RA 2F53D 2G2PA 3TXAA 5D1QD 2JJTA 5T5FA 1VPOL 4KXBA 3ISRA 3T3MB 4HUCA 4WUKL 1P7KB 5AAMC 2X2JA 2VDPB 4BQ8A 3RVUC 1O6TA 5ALBH 3RLSA 4Z3TA 1HH9A 1SXBA 5TQ0H 4ZFGH 4OLEA 1D5XB 1Q90A 5IBLC 4I3GA 2KT6A 3FFCB 2X28A 4L8DA 5GHWH 5JXEA 1JWUD 2MNWA 1YUHB 3X12A 2X4OA 3G9VA 5HHPA 3LZFL 4QRUA 5DD5H 3NTHA 3H09A 4X6DF 5M5XH 3SQOH 4CKEA 1QUQA 3P11L 3T8MA 4JVPA 3RDTD 4XXEA 4UQBA 5KJ7E 1LE5B 1C9OA 2DM4A 5DS8B 3TT1L 3FQTA 4N20A 3PWVA 3O2WL 3SDDD 1X5ZA 2AMCB 4ZW7A 3J8F7 4PI2A 5EZOH 3TZVD 4JX0A 3T2NL 2VITA 3AT0A 3BJUA 1TSHA 3IKJA 5CCHE 3C6SB 3BKYL 3CFIC 1T83A 5E6YA 8FABA 1M2OA 5D6DA 1JB7A 2HFFB 2JTYA 2LU7A 5EBLB 2GA4B 4L5FL 1AHWA 2CDGA 4KK8D 2Z8WC 1MJ7H 3MV7E 4X5PA 1TTFA 2R92H 3U83A 2MWCA 3L3GB 2CWRA 4ZS7H 1R9TH 4I9WE 2FYVA 2CM5A 5FO2A 2D0GA 5C07B 5E6IA 4ZXBA 3KLRA 2VLJD 4PJDF 1KB3A 4UV7L 2OR7A 4OB5L 1X9UA 1GUTA 2D3VA 1X9NA 5JW5B 3QZLA 4KRPB 2E8ZA 3BVNB 2XPGA 2WINA 2ZSVA 3QYCA 5B1JA 1N59B 4BY7H 1XGQB 5GGSY 5GRWA 4QUOA 1QSFA 4WENB 3UERA 3KEDA 3DMMB 4U673 4Y5YB 2FT6A 4OIIH 3POCA 1QLRB 2XTJB 5F6HJ 1NEZB 5HDQL 2DI8A 4LNQA 2H2SC 3AFPA 3L1OH 2EVGA 1KULA 1U3YA 3PL6D 4OFIA 4RGMA 1R5WB 1KB5H 2A2QT 3S34H 2YOAA 5IEKB 1M6OA 4NP9A 1A4JB 2I5LX 3U7AA 4AT6B 4GLVB 1Y69U 4ELMB 1AZQA 3SHLA 1CIDA 2EH8L 2PPEA 3QDMB 3VFRB 5KS9B 1E28A 4M6NH 4XH2B 4NQQA 2Z9TA 1NBYA 2EYPA 2AQ3A 3DHJA 3Q2VA 5GS0H 5I8CB 3QJOA 3ZT6A 3Q05A 1WV7T 3PWPD 5GAHC 3ZTCC 4YO0B 4FMFA 4ZMYA 2ADGA 2IPKB 3BVDB 4QXGH 2HKFL 3QW9A 5DI8A 3O0LA 4YSUA 3ASOB 5GAGC 1TZ8A 2JA5H 3EHBB 2X2UA 4HJEA 4BFGA 1E9OB 2FO8A 2WXMA 3D18B 4I18A 3PWJA 3J81j 4A3BH 2O6FA 3GTLH 4PY8I 2P5ED 5F96H 1CLCA 5FYJU 3C1FA 3C5XA 3JBG7 4XB7A 4MB3A 1BX2A 3OLGA 2FSEA 3REWB 4J2QA 4GKJL 2OMNA 1VQ6A 1SEBA 1L0XB 4GLRI 4HKZA 1PFMA 1RK0A 4H0LC 2NY5C 3CN0A 4CN6A 2VXWA 4ZQKA 4PVMA 4WJ5A 2R15A 3FL7A 1RD6A 5BRZE 3II3A 3PQYD 1B53A 2Z7WA 4PW3A 5ISZB 4HSVA 2LR4A 2PCFA 1MELA 1YSOA 4HWBA 5C0DA 3TA3D 1TZIA 1TTBA 4XPAH 2L11A 1MHPH 4GLRH 4U1LB 5IESH 3KJPA 3ABLB 4WHCA 3HAEG 4NAMA 3GSNA 1QABA 3FONB 4XPBH 2B2VC 2DJUA 1UUSA 2K0RA 3D25B 3N2JA 4G8AC 5D7IE 3EFXD 4DR3Q 2Y07H 2CKBB 4ONGL 4WORA 4MKTA 1NLBH 2OEOA 2ZCLL 4P23D 4CJ0A 4ATTA 1EFXB 4AYBG 3HBZA 4CC4A 4Z76B 3ETBJ 4UMGA 1KQSA 3VWKD 1S5BD 2P4AB 1W0WB 3C09C 1OXSC 3FQ4A 5F6IB 1U4MA 4PJ5E 2HVJA 2CLRA 1QRND 3L5HA 4GRWE 3VFVA 4AEHL 3ZJAA 4QNPE 4PVBA 3MV8B 5LCVL 5CCGE 5ELCA 3ARDA 1SMOA 1SOXA 1QNKA 3LXUX 2B63G 1QOKA 1QILA 3D0LA 4PQXA 2NLJA 1P6WA 1ZKAA 3O6ML 3K2KA 1BVNP 3FB7A 1QVCA 3MJ8A 5KYYA 1LLAA 3BZKA 3D4ZA 4UZGA 5MEOB 1TJXA 2PNDA 4KJYB 1Q8MA 1K28A 2WQAA 1Z7TA 4TQHA 5F7MC 3DROB 2TMPA 1MWAH 4R96B 5T33L 4WI7A 5DLLA 3AG2B 2A77H 4L5FE 5FW7A 3VFMB 1HTLD 5MHSD 2Z1CA 2B16A 1VQAA 2WNWA 4IRSB 2BSDA 1GUWA 3GSUB 3TIDB 2DTSA 2VR4A 3KPSA 4LRNL 5HDWA 3CFBB 3QWOB 4WW2F 4WHDA 3JXAA 4NXSA 4JM2F 3MREA 2N88A 1FVEA 2HH0L 3ULUF 1EVTC 1WT5A 3HC3L 1L1OB 1E5UI 1S5DD 3OHXB 5HGTA 4JHAL 2Z4QA 3AY4A 4XCEA 3TJEH 4PREB 3RZDH 1ZV9A 3MBWB 4PZ8A 4OCXL 3ARRA 5JIKA 1NCTA 2Q6WB 4KC3B 1DEEA 2PP8A 2WWMC 5ABDE 4NZFA 3VACA 1AYOA 3ZKSD 1K73C 1PVOA 3PLYA 3QIBD 2H26B 5IROA 1RVFH 4QQBX 2F7IA 3FT4B 4JPBW 3HVNA 1N34Q 4WEMB 2LW3A 3HKZG 1BWWA 4QHPA 2CQAA 5CJ5A 2EVFA 3CPLA 4JPKH 4PP1C 4OX9Q 1IKFH 4DR1L 1SDFA 4DV1Q 1MJJB 4P4RB 4KAQL 5SWSE 1KJMB 3BC9A 1F2LA 3O41B 4MAYA 5EU4B 3FUJA 4QHMA 3CXHJ 2PPBC 1UD6A 4MLSA 1N18A 1S8DA 1C5DB 4XHQA 1KEGH 3QQ3A 3B9KB 3TF7C 5C97A 1MHWC 3QAQA 3ZZQA 3IFOA 2B1AL 3J07A 2A38A 4M1CD 5T5FH 2PXYA 4K7PY 4BA0A 2IALB 5JJIA 2XN9D 2QPDB 2XZAL 4LPVA 4Y16C 4CDDC 4JY5H 1N0LA 1TQUA 5DRZA 5LGKA 2GEEA 4XQQA 4N8PA 4YPGB 3F2BA 1ZJAA 1MEXH 2EDEA 3M8OL 4ANKA 5DEJA 1S7QA 2X0VA 4ACTA 1K83H 1RHPA 4M7LT 4U1MA 3O3EB 5EORL 4BH8B 3GTKH 5M94B 1S3OA 4ZLTF 2BY1A 3D0AA 4XT3B 4TNVF 2F0IA 5EZIL 1LNUB 2VWEC 2XTSA 1HINL 1MI5E 3BQUD 1SDYA 4WW1A 5C2BL 3FQUA 1I8UA 4YLQT 1ZPUA 2YMTA 3G6AB 5KTEL 3Q8DA 1CL7I 3KLAB 1IJ9A 5AOJA 4XPGL 1KTDA 1U0QA 3GXUB 4GB9A 4PRPB 3MRNA 4YSQA 4DKFH 5IP4A 3WNIA 2WKCA 1MNUL 4Q89A 2XYCA 3LNHA 3O9WC 1WCMB 2ZCHH 2J4XA 1GC1L 4Q9BA 2R1YB 4YIQB 3SOBL 4A7GF 2GT9A 3WS3A 1VEOA 3FN9A 3BKCL 1OEZW 1ORQB 1K8AC 1G2SA 1MKFA 3EJYC 3LVEA 3JTTB 2K6AA 5D7IB 1H0DA 5HGBA 2EDXA 1RJLA 2O30A 3OLEA 1RZKH 1RP9A 1UH3A 2ZPKH 4ES8A 3V7AE 1IAII 1EIGA 1E6OH 2FJFA 2H32A 2QHRL 3G5ZA 4X5LA 5F0LB 1AACA 2ZKMX 4LLQB 1AEXA 4G7YL 2QKIC 4PH8A 4PJ5B 4WJG3 3ZK0A 4WCYL 4NUMA 2IL8A 4GRWB 3SXHA 1ZGLM 3GHBL 5HYEA 4N0YL 3UYPA 5F6HI 3KLSX 1RFDH 3L4ZA 2E47A 1IAIH 4UAOC 4JFED 5AAMA 1NUCA 5ID1B 1MW3A 1VQ4A 2A6HD 1CXIA 1ZS8B 4CDEC 3D4GA 3P69A 1H6TA 3S8FB 1P5VA 3APCA 4XNUH 3U82B 2G5BA 2BJML 2EC9U 4WO0A 3N5AA 4X4KA 5GZNC 3MO1B 4IJLA 4CSSA 4IHOB 2B4CC 2BXZA 4N0CD 4D9LL 5J13C 1MXDA 4IMLB 5DMKB 4YK4B 2C7UA 2IVFC 1N6QH 4KKRA 5HHNB 1B0RA 3F2DA 1AC0A 1CXEA 2NY2D 2YYZA 1BECA 2ZOKA 3GTMB 3Q1SL 4N8VG 4PV9A 5D96B 3UO8B 4MJID 3WXVH 3D50A 3HE6D 1RU9L 1VGKB 5JUEL 5BNXD 4FKKA 4PV8B 5BZDB 5IB4B 4HWEL 4L0ZA 1WYJA 5I73B 5FUOL 1CFVH 5IVXB 1S9KC 1IBLQ 5F7NC 4MHHG 2F0KA 2BY2A 1AO7D 5KVFH 2HAZA 1L6XA 1X5MA 3LDBC 3ZKMD 2MCPL 1TEGA 1EAOA 4JBSA 1UACH 1W9XA 2NYKA 3FCTB 5EU3A 4EN3C 2XN1A 2IPUG 4HK3J 4WI6A 1F2XK 4MYPA 5ADPH 4X4ZA 3U4KA 3GQFA 3L3JA 5CILH 1HYSD 1OCRB 3CFCH 3MLTA 4E9XA 2I07B 5D4HA 1LTGD 3GEWB 2VXVL 4W93A 1UJTA 1RURH 4HC1A 4XAWL 1NL0H 1TJHL 2L8AA 4LLVA 2XHNA 5JIPA 2WCSA 5H2BB 3X1BA 1HOCB 2MKWA 2DQGH 2FIKA 3VNZA 3ZE1F 3NZUA 1AG0A 4R5XA 3EGSA 4MNQD 4N0UA 3RGVB 5JOPD 5KZCB 1U8QA 4ICXA 5AUMB 1NGZB 1UXWA 4HH8A 4KK5D 3T0XA 3W38A 3WEBA 4OCMC 5SWSB 3VQMA 1E1OA 1CHQD 1UE6A 1UOWA 4ZG1A 4UQ9A 1BGXL 2JIXA 4FHBD 3ARBC 1CF8L 2N7AA 2YAHA 4MNGA 3QZWA 1QLFB 3QZPA 1A8JH 1MQKH 4XNMA 2AJXL 4JBWA 2HVBA 2NZ9D 1VQJA 3QB7C 3F8UB 4GLXA 4YDNA 4GG6B 1UXSB 3U2SA 3MUGA 4KVNH 2J72A 2Q2HA 3J7ZC 1HJPA 2EY2A 1U8JB 3QCVL 1JPEA 4DUWA 3M1BA 3HLAA 2ZJPA 5B1KA 2CO6B 2ZF8A 3ZOAA 3IXAB 3EDFA 3K80C 3HZVB 1NCCL 4JN2A 4NI3A 5GRVL 1GXDC 3P9MA 4UTBH 2R0WH 5CGTA 3HMXA 2PETA 1CU4H 3NCWA 1ROCA 3UI2A 1YEHH 1EZVY 3HNVL 4OLXH 3UFIA 3PUVA 1T20A 1JPGA 2WXOA 1ZK5A 3TFBA 4P2CB 3NSWA 3X2QB 5MEPA 4AG4H 3OMGA 5D2LE 2XRAL 5CWSB 1F4HA 2BMKB 4U33A 4FNPA 4JPIA 4X7CC 1U8OB 1JN6B 1QG3A 1ADQL 4L05A 2FO1A 2FT7A 3H54A 3EO1B 2WXKA 4KHZA 3CUPA 4P2QB 3HOZB 5GGRB 4JFDD 3VXOA 2TRYA 4Z7WB 2HJKA 5FLMG 2ZG1A 1PJ9A 4HJ0D 2KS0A 1RK1B 3GT6A 1PLAA 2B2TA 1QTSA 1Z3RA 5EKIA 2ZOWA 2PN5A 2R23B 1KXQE 1YQ2A 5GRUL 3BH8A 4HKBB 4JGUA 4ZFFA 3BDOA 4U4IA 5ETUB 2H6OA 2X4NB 4J23A 1STGA 4GNXC 1NAPA 2H7WA 3MNZA 1BO0A 1EGJA 1FJ1A 2DQJL 3O0RH 4A3JG 2XNAB 3LEXA 4ADIA 3QI9C 5F7KC 2QDVA 3ILPB 1JK9A 3FB5B 1KLUD 2QQKH 3FU9A 4Y4KC 3LN9A 4F8QA 1F4WL 4AYEC 3G5YB 2VZTA 1XF5A 4N25A 5D1ZA 2Y36L 3EDDA 3GXFA 4KRMB 1Q9OA 3WTYA 1KLFA 4J3TA 4XPFH 4HWZB 4RMRA 1TYJA 3GLEA 1AGDB 2ILLA 1BF2A 1G87A 2X4TB 4NLAA 1JNJA 2ZYHA 4H88H 5HYIA 2WTOA 1D5MB 4KKBC 3T0EB 3WO4C 1H8OA 4PJ6A 4PJGF 4U05A 4PUBH 2VDMH 2KHJA 1BPVA 1TZAA 3HHMA 4QB4A 1F4AA 2ITEA 1XGUB 5M9OA 5ICXA 5EMYA 4MXWH 4JGJA 2A9ML 1O7IA 3FMGL 3KH4A 5JZ7C 1OO2A 1PIGA 2XZQH 2X4QB 3BN3B 1QE6A 5AL0A 2K1MA 2I69A 1SXNA 1LXMA 3GNML 2OYKA 4FKHA 1BMWA 2H4OA 4OF8A 4GKNB 2EXYC 2RD0A 3ZYYX 2Z6BA 1U91A 2C1PB 4L0PB 4PY7A 2F1EA 4PWGA 1STHA 1P4IH 2EDDA 1XGZA 3C2SA 1A3ZA 1H15A 3KHQA 4R26L 4F7PB 4GUCA 1MCFA 3MRDB 3NIDB 4FG4A 1ZY9A 3MEFA 1LYQA 2WKOA 5C0XJ 4KHTL 5L88H 2VTFA 2Y06L 1ILUA 4FI6A 2I32A 4U6XB 3UO1H 1ETZA 3HG5A 5C0IB 4LF5Q 3GBNH 3WJLC 1YPZA 4LSPH 2F58L 4JO8A 1KGWA 3GSQA 3AABA 3KS0J 1HXYD 4LASH 3TBIB 3UDGA 2GC4C 1NFIB 4Y1AD 4H2AA 3LZLA 3DWTA 4HHAA 1U3HB 2NUPA 4QGUA 2FX7L 3C08L 3HC4H 3HFZB 3E3QE 3KGSA 4HXBH 3RNQA 2WYTA 4UU9A 2ZYRA 1XL6A 5EOCL 3OR6B 3QP3A 1SN0A 1I7UA 3ESMA 2BFGA 3BLPX 3STLB 4A7SA 4ULLA 3HOUH 3L3DB 5ES4B 3MZGB 4PJIB 3BH9B 1B90A 4BGDA 4F15C 1P7HL 1USZA 3F6LA 4RH4A 5HGAB 3MRFA 3GTGB 1F0LA 1UM6H 3QXAA 1JTPA 4MA3B 5AL8A 3BEVB 3O11A 1PG7L 5HYJD 5DRXB 4UM8A 4N26A 4X3KA 3VB8A 1O7VA 3VFUA 4TVPD 2IQ9H 3LRSA 4YXKH 3VI4B 5IYBH 4Z5RA 1N8ZB 1RIUL 4WDIB 1FVCB 2XRQD 4P2RE 4XPTH 2FGWH 1T2QL 1A3VA 1DSFH 4FE9A 4GKSB 1P9MC 3A6BL 3POHA 3MJ7B 4PAZA 3RP1A 4B41A 1G7JA 2GQHA 2H32H 4JO2H 1W0YT 2K7QA 1FAIL 1LQSR 1PZ5A 2WHVA 1JZGA 1MLCA 2ESVA 1EZUA 1QPPA 1UD8A 1DBAH 1ZLSH 2MMXA 1Z9OA 2J1KA 2JK5A 3HR5A 3OC8A 5DJDA 3LHPL 4QRAA 3OKDB 4X6DE 3S3BB 4MTMA 4ZX4A 3GHEH 4JKKA 5GGRY 5C0GB 1HZCA 3BUPA 3UG4A 3QEHB 2HVKB 3WMSA 2Z0UA 4OU3A 4XNQA 3OPZH 3O2DA 4B3SL 2EE6A 2JE8A 4APQB 1M3IA 1YY8B 3GXDA 3NJKA 4GKZA 3QFJA 4KK9C 3CFEB 4FABL 4G42A 3JWNC 1OCWH 3QDJE 4JRFA 3ZKQD 5EBWA 2MO1A 1URZA 2WYIA 4PGDB 4KY1H 4A3DB 1T7XA 5AZ2L 3I02B 4LDLB 1UE7A 2K04A 3PMFA 2QPUA 3F84A 3IMBA 1AKJD 3GXPA 5B38B 4MJ6A 4KUCF 2XZCH 2YXWA 1ZTXL 5J89A 3FT1A 3SY6A 4I2XA 1EWIA 3GTVA 3VFPB 1RV6X 3T56B 2Z9HA 1ZVHA 2F4IA 2X6UA 2XX1A 1JYNA 3H91A 2HDLA 2H1PH 4RCOA 3ZQWA 5C44G 4PJDE 4FMVA 4GOPC 3MJ9A 1G2TA 4KKNA 2N56A 2Y5TA 4LSVH 3O9WA 4C56D 1F2QA 3ULUL 4ONHB 2L12A 4C3HB 3GTOH 4KVPA 5BMFH 1IAKB 1GGBH 1KCSL 4H20L 3FUDA 3MRGA 3V9CA 4HC1H 3KJ4C 4NYLB 3S4SB 2NNRA 3AGWA 4GO9A 4UOQA 4IBVA 2R2HB 4L9LB 4XYQA 1CKNA 2ICWB 4M6MH 2DQEH 4JFOB 5SWZA 2K5WA 1Z5LA 3K6FA 4KKZA 3WS6C 1TTAA 3LEVH 4WJKB 2BIMA 1YYCA 1JPFB 2QLYA 4NZUL 4X4YB 3G9AB 2MH4A 2QKIA 3SE9L 1VAHA 3MLWH 4GQ9L 2UXDL 3RPIA 3T2LA 4AC2A 4YDMA 3CFJB 4UQ3B 2YTXA 1EY6A 4K2KA 4GSDL 4JZJC 1YI2A 4RFEA 3K5LA 5KAQG 1QFWL 5F7UA 3GDEA 2J25A 5C4XG 5IJBC 5EZLB 2J6EL 1YYML 2XDHA 1MJCA 5GZNA 3RGBA 3X1EA 2FEEI 2GUOB 1CDYA 1TDQA 4GIPD 5DJ6A 1JJUA 3C60C 4XWGH 3QJUB 4FNTA 5F9AC 5HHQA 4QRTA 2EDYA 1F00I 4R8WL 3KWWB 5ITFB 3ME0B 2D7TH 3WOFA 5D1XD 3AREC 1OIOA 4NXNL 3TN0B 4P72A 5C44H 1AR1B 5IVNA 4DGYH 4Z3IA 3OAWA 5AJ3Q 4OIJA 5E6RB 3V4VL 2C26A 3MRIA 4G7QB 4F8LA 1OTTC 4LF4Q 2NY0D 3H55A 3LZPA 3PUUA 4O9HH 2XFGB 3NJLA 2XN0A 4Q56A 5ESVA 4LVNC 5KNDA 2WLZA 4H5SA 4EN3A 3KPOA 2EIKB 4OUUA 5MI0C 3IETA 5EO1A 3RJQB 3QG7H 1GMIA 1R3JB 2RQEA 3FT0A 4A39A 5IW1B 1JB3A 1E67A 4NC0B 5D1ZI 3EBIA 2DYRB 5IYCG 1FFNB 3BEWA 3AQZA 1UT9A 4DA2A 2R2EA 3QWQB 3QUZB 2BVPA 3T1WA 1O7DC 3LKRB 1EGJH 2FJGA 4PG2A 2K78A 2LFEA 3F65A 4WGWB 4UCFA 3BIKB 3O6FB 4OLWL 4XBEH 5G4NA 3UTQB 5F7YC 4FA6A 2R93H 3DUUB 1PEWA 3O8XB 5ANMA 4GXVH 1IM9A 2WXLA 1E8XA 4PBWD 5LBSA 3PHOA 3UTTE 4PGEB 3JVFC 4H26A 2CSPA 1ZE3C 4P9MH 3BVZA 5LN4A 3I4NH 3V4PA 3QR2A 4BFRA 3FN0L 2CA3A 5G5DA 4HS6A 4NQCD 2WXHA 5C0XG 1U4RA 4GY4A 2E7DA 4LAJH 4POZC 2BLFA 1KBGL 2CMRH 3U1SL 2CGZA 3CG8A 4RZKA 3L2NA 2A5HA 5I28A 2YR3A 2VQUA 3BLKA 3IK2A 3UGEA 3D33A 4EUPH 5I1AB 2OKMA 3V0GA 4JHUA 5I6NA 5EF2A 4X6DB 4B3ML 1MN4A 4O58H 4QHKJ 1VQEA 3W5NA 1CD1A 5LHY1 1UEBA 2YAFA 1VQNA 4POUB 3K80A 3QJTB 3V6ZB 3HS0B 4ODHL 5MERA 5IGCA 4MB4A 1MUJA 1C8QA 1CGVA 4ODSL 3DM3A 1PNDA 4TSCH 4TUJA 5E2WL 4D9RD 1TQCB 3RUGA 3QDJB 2P24B 5AB1A 1UB6A 2HFTA 4LMQI 2V7HB 3SJVE 4S1RH 4TUOA 1C16B 3IJHA 4I48B 1JOQA 1B2TA 3JWDL 1BD2B 1ZTXE 2JV6A 4NZTL 4WF7A 1A47A 3O3AB 5EO9B 1MGSA 4XRCB 1JZ7A 2JCWA 4PCYA 4WEBH 1WBZA 3QCTL 4YBHA 2AERT 2H47C 2WVTA 2OT2A 3FUEA 3GXNA 5DZOA 3ULUE 4ETYA 5KEEA 3VYTA 4Y19A 1XB8A 1NFDB 4GNXA 1SYSB 4TPRL 1SM3H 3NACH 3MXVH 3QI9A 2WBXA 1DBBL 4XMLH 2ZE0A 4TNWK 4HU8A 4MKMA 4Y4KA 4L4TD 4O2DA 2HCZX 4JRWA 4A3KG 1YJNA 3FRUA 3TO2B 4BK5A 4JG9A 3NSFA 2EDNA 4HK0A 1GZPA 1JF5A 3MNDA 3KS0H 1HKLH 1QHPA 1GYWA 3VH8B 2RVLA 2AI0H 3OOCA 4ZK8A 4IJ3B 3ZDZB 1OPGL 3K6OA 1GJXA 1FPTL 1UYWL 5MP6H 1JTOA 5DSCB 3BCFA 4HISA 4P4KD 4X6BB 3N44F 4YN3A 4ZX3A 5TE4H 2IPTL 4N4YB 1Y1VG 1OCZB 3EYSH 5T1GA 5E2UL 1YEJH 3AU1A 2B08A 3MQIA 5C0JA 4UHVA 4DUVA 2I7OA 4C4UA 5J1SC 2WVVB 1M4KA 2AV1B 43C9A 1NICA 1NAKL 5TF1L 2C9QA 2DQCH 3FSAA 3TBWB 2Q9OA 4Z7VA 3PJNA 4PLKC 5JOEA 2LT9A 4UINH 2A4EA 1CJYA 3K72B 1LDSA 2WSDA 4O02A 1XMOL 5DFVC 2NPLX 3D2UB 3CPWA 1DBMH 3RQ3A 3NTIA 4WO4B 1PYSB 2X4RB 1LO4L 4NXMQ 1Y1DA 2EYHA 1Q1BA 4FF2A 3B2UD 3HGBA 1JGUL 1M05B 3KPRA 2I9TB 1H9MA 1KDCA 2WZPD 5CU9A 4HFWB 1AMXA 1E1TA 4WHYH 4BQ9A 5I15L 1EJOH 4UF7C 1OP5H 3MRBA 1I3GL 3MV9A 3QNZA 3VG9C 3GUTA 4K5XA 1UQSB 3GBML 1BDYA 3WJLA 1BEYH 3SGJA 1SAPA 1M1SA 3R1GL 4L4VA 3GS4A 1T03H 2KEDA 2ZP9A 3PJSA 3FU6A 4RWSC 4EBQH 1LACA 2K5DA 2UUCQ 4JMNA 4H1LA 4BUQA 4QHUA 4DP7X 1B4RA 3OMNB 3ERXA 5I2IB 4NIKB 5EV7A 3UTTB 4LOUD 3NRPA 1PH4A 1WGOA 4FLQA 1FBIL 3MCKB 2Y6SC 4OLZH 5EOQL 5C3EG 2M2DA 4QWWD 3TJHD 3E2HC 1Q0XL 1LP9F 3WDHA 4XZUB 1JPSH 1KIRA 4JO5A 2VDNL 4NO0D 1S7TB 4FQXC 2OSXA 3MJ9H 4J28A 2NMSA 1PTOF 4ALAL 3FMCA 2EVIA 1SYBA 2XXMB 4IIZA 5EPKA 1M4VA 4WFGE 4G1EB 3GSXB 1CDGA 3ZHKA 1C0AA 1A14L 1FFPB 2KQ3A 3VTAA 1PZKD 2O2LD 4K9EC 2PWHA 2YD5A 3EFOB 4P46B 4J5VA 2VO8A 4HDIA 2D2CC 1XNQL 2AJVH 2ZG3A 1T7YA 2DD8L 1IBKL 1GMEA 1EH9A 2JJWA 1N5YL 4NJ9H 3EUUA 3RVTC 4DO6A 4LQFL 4XBPA 5CP7B 3TONA 3ZRFC 4YGVA 3ROOB 3WIFB 4G43B 4FZEL 4G8GB 3LD8C 2W07A 3MRLA 4Z3HA 1RZPA 5KNBA 4PWHA 4U6HB 3SJVB 5INDB 5IIFA 3FQXA 3E6ZX 1IGML 4LEEA 2W60A 4NKIL 3RA7H 2GG1A 4TNEA 2AUKA 3WNNA 5DZLA 5A35A 2DQDL 4Q6IC 5E9DE 3JTBA 2NUTA 3AT8A 3OX8A 4IOSA 3WE6A 1A1MA 2EVHA 2ZP8A 5K39A 1P7QB 2WM0A 2B4CH 4GRMB 1WAEA 4YSAA 1ID2A 1VQMA 4XQNA 4X6CF 4G7HC 1DO5A 1C1EL 2BSED 5C3EH 4A3GB 2OSYA 2XWJA 4P05A 5ALCH 4F3FB 5L4FA 1IO4C 2PMZE 4DCQB 3ZO9A 5JIQA 2OAAA 3V8OA 2PYED 2VLKE 4Q9RL 3UH8A 1MCHA 5CV8A 4ODGA 3HVDA 4KJWC 3UGXA 2WNKA 5LG6A 1GIGL 5T3ZL 2Q8TA 1HQMC 4E42B 5DMGD 5DA4A 2CO3A 3O6LH 2X2HA 4FQLL 4O2FB 4ORGB 1FL5A 5FLXL 1XGRB 3D39E 4PTUA 3ZTJG 1HI6B 4GOPA 2WTRA 1BVNT 4LEXH 4PRHA 1ZA3A 4WNQB 5A7EA 2VNUD 2V7NA 3SY0A 4AX3A 1RSFA 3UBXB 2IWHA 3AMUA 4HJGA 2CIIA 2CPCA 3S97C 2KZKA 3NP4A 2F54A 4R84A 3INUL 5TE6H 5DJZA 3EIFA 1CICC 5TDOB 2FATL 5BR8L 5I8OL 2DLEA 3OKEB 1F90H 4HZ1A 1E3FA 5LBSH 5DGRA 4PJHB 1ADWA 1ZT1A 3VGDA 2NYZD 2O5YH 4BK8A 2NY3D 2XWEA 3V4PH 1WTXA 3A67L 3BFQG 1N3NA 4HKXB 1YEKL 4NBYB 3E0EA 4P2OC 3L4XA 2F19H 2LFGA 3GSWB 5T1JA 1VQ8A 1GSMA 2EH7L 2VUOA 4V33A 3AMLA 4DK1A 2ZOLA 2ORBH 2W9EH 5M3MH 2JJSA 3U36A 5EO0B 3H0GH 1LO5B 3TFKC 3ZYOA 5D7SL 3WNPA 1RD9D 4JZJA 5CGYD 3M4QA 1DL7L 4Z7UF 5HHOA 1BCPC 1E27B 5E1HB 3OTOQ 4B60A 4U1GC 5JORA 3UEZA 4U6YA 4DW2H 4OO1I 5FYKH 3QYMA 1CE1L 4FNFA 4C3IB 3UMNA 2VLMD 3ARFD 4JFYB 4XVSL 4YXHL 4CADB 2H9GB 2ID5A 5HGDA 2QVFB 3BW9A 3C60A 3QUXC 1FLTX 3M4PA 3G6JF 3QQXA 4XNYL 5F3BB 1CB4A 3HC0B 4I77H 2A6KB 5TDPA 4S1QL 1WFOA 1O75A 2I27N 1OT2A 1WFNA 3AREA 3GJEB 4LOVA 4N5EC 4QTHB 1ZHBA 3LMJL 2HT3D 4OO1H 4UIMB 3QXDB 3T08A 4XQJA 4GG8A 1Q9KB 2V17H 1DP0A 2Z93A 3QQNA 4HIJB 4TTDC 5DUPL 1HQ4A 4HSQA 3DPDA 4PCTA 4ANWA 5IMOB 4H25A 3BP6B 4PS4L 2R0ZH 4YWLA 2VXQA 3OXRA 3EJIA 5GGUB 5JHDE 1T5XB 4PJAF 2A69C 5CR8A 2YD9A 3GJFH 5ITBH 3NJNA 5A40E 1I8MA 2EACA 4JR9L 4NM4H 3MUJA 5DJ8A 3N43B 1H8SA 3CPUA 5EBCA 2XJKA 3SODB 1V1QA 2NDFA 2GK0B 1B3JA 4QR7A 2CRMA 3ALPA 4K7PL 5CSBA 4FTVE 2VQFL 3DTXA 2NW2B 3WL9B 1UKQA 2EE3A 5F9WC 5I6PA 3RZCA 3OKLB 1NA8A 1DOKA 3CDGB 3IWVA 1M1XA 4XP4L 1X65A 3F00A 4PJGE 3S5LG 3B2DC 4I0PB 1J8HB 1K3BC 1SBSL 1TWFH 1WBYB 5GSRA 2W0LA 4H7BA 5JPNB 2GCYA 4YY3L 5IV2A 1YMMB 1FHNA 2GJ6A 1OGAE 4XX5A 1A6AB 2OLDA 4DUZQ 2NZ1D 4JHBA 1PLGH 2D0OA 1E3XA 2J56A 3MGAA 5J11C 5ID0A 3UZQA 2CPUA 2RHEA 5BVJA 2IH8A 1KGIA 4JO4H 2BRQA 4GRLC 4NO2A 1EPFA 3THML 4PLJD 2KLSA 3VSTA 4XP5L 2B8FA 1X5GA 3ARXA 1Q8KA 5E9DB 5FR3A 1TO4A 2P8LB 2IY5B 3C5ZC 3NQKA 3JTSA 3S36L 1XF4A 2OI9B 2HJFA 3BZFB 2VUMB 1A7PL 3FK3A 3IFLH 3SVMA 1FZMA 5GGQH 3QCUH 1ET8A 4Z6AT 1X7QB 4F1ZA 2FTAA 1AXTH 1OSZB 3A24A 4WTWA 4QD2E 1F2MA 4ZTEA 4OQ1A 2O6CA 4O02H 3HZXA 1KCRH 1PH6A 1BF5A 1S7WB 2ZUTA 1I9EA 5TGBB 5F9JB 2DJGC 2NVTH 4OKVB 3JC66 5T3ZE 1J0HA 5I9OA 3WFDL 3DX6B 5K9KB 2VUYA 5JO5A 2OMWA 2R2BA 2DWEB 4LSDA 2IOIA 5FA3B 4IZ8A 5FLXE 1N64H 1IW7C 1YHAA 5ACMA 3V79C 3D39B 4QT5A 3UYOD 1FG2A 3EDJA 1INQB 3QNYB 5D7HA 4NOBA 1JZ4A 5FHBH 5B22A 1Z32X 2C4FT 4F7XA 3CZEA 1OWRM 2Y25A 2IH1A 2FXQA 1NGPH 4H1LH 3J81L 5KVDH 2O61A 1UUPA 1BW8A 4IJTA 1D5BB 3TEXA 5DA0B 3U4EB 1G9NL 1KHIA 1MHHA 2XIDA 4ODXB 4RQQA 5FHAL 1DUZA 3M7NA 3TLRA 2AK1L 3V5KB 2NW3B 3SYCA 1MAMH 4E41A 3L5IA 4U1JB