1DCZA

Biotin carboxyl carrier domain of transcarboxylase (tc 1.3s)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
77
structure length
77
Chain Sequence
b'AGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCARBOXYLASE 1.3S SUBUNIT
publication title High resolution solution structure of the 1.3S subunit of transcarboxylase from Propionibacterium shermanii.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Transferase
total genus 9
structure length 77
sequence length 77
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dczA00
2R6GA 4H44C 3EQLC 1OXUA 3QG1A 5C0XH 1OXXK 2CW0C 1DD2A 1IW7D 2D62A 3PUVA 4L8JA 2EDGA 2PPBC 4KKUA 3NE5B 4XIGS 1HTPA 1OXSC 3SDZA 4JK1C 4BA1I 1HPCA 3GD7A 2YYZA 1GUOA 2A68D 1BDOA 3MFYA 3HGBA 1IW7C 3I4LA 2A69D 3CRLC 1FYCA 1HCZA 2DNEA 3DXJC 3PUXA 2K33A 1G291 2A6HD 2Q8IB 1SMYC 3P20A 1EWHA 4KI0A 3IFTA 4I7ZC 2A68C 5KNDA 1B9MA 1VDZA 3BDOA 3GQBA 1B9NA 4HR7B 4IQZA 4LJZC 3T53B 3VR2A 3VR6A 1E2WA 2A69C 3BG3A 2L5TA 3A8KE 1Q12A 3QIAA 1V8QA 1OXTA 4XTCS 1Y8PB 2JXMB 1LACA 2A6HC 3I72A 5BN4A 2B8FA 4IFDH 3M85A 3H94A 4G7OC 1QJOA 2O5IC 2AWOA 1FR3A 2DNCA 3IKJA 3PUYA 2DN8A 1VF7A 4DNRB 4OO1H 3PV0A 3VR5A 2NN6I 3LNNA 2BA0A 2F1MA 3M4YA 1Y8OB 5BN5A 4KKSA 2QF7A 1PMRA 1IYUA 1GHJA 1YNNC 2EJMA 4JBWA 1GHKA 4OGQC 3A7AB 3AB9A 4RCNA 3VR4A 3RLFA 1IYVA 2EJFC 4DNTB 1H9SB 1DXMA 1V43A 2BA1A 2AUKA 4TQUS 5JEAG 3OOCA 3M7NA 3FPPA 1A6XA 1OXVA 2NN6G 3A7LA 1GUGA 1K8MA 2E75C 1VCIA 2K7VA 2LMCB 4PV1C 4KMUC 1GUTA 1HQMC 1ONLA 2D2CC 1H9KA 4H0LC 2JE6I 2E74C 2ZT9C 3L7ZC 1LABA 1O78A 2A6ED 4G7ZC 1H9SA 4KN4C 4G7HC 1Y69U 3A8IE 2BE5D 3PUWA 3U9SA 2K32A 4DK1A 2NN6H 2PNRC 3VR3A 3ND8A 3SE0A 2D5DA 3OPOA 1Q1BA 3TZUA 1H9RA 1O7LA 2A6EC 2E76C 3W3AA 2EVBA 1VF5C 1T5EA 2KCCA 1Y8NB 2BDOA 2BE5C 3KLRA 2KA7A 1DCZA 2B8GA 3FMCA 1CI3M 2PCFB 1Q1EA 1ZYRC 1GJXA 2IT1A 2EJGC 3A8JE 5K36G 5KNBA 2V4DA 3WDNA 1H9JA 4DK0A 1Q90A 1TKWB 4LK1C 1I6VC 4KKTA 1H9MA 4TKOB 4GZYC 1ZKOA 2JEAI 4BA2I 3VA7A 1CTMA 3N6RA 1K8OA 1GUNA 3QJYA 3ND9A 1E2ZA 1Z7TA 5C0XG 2O5JC 1Z6HA 2JEBI 3D4RA 5BN3A 5A35A 5KNCA 4IFDG 3OW7A 1GUSA 3CRKC 5JEAH 5K36H 3PUZA 3MXUA 1CFMA 1E2VA 3LWUA 3D31A 4KN7C 4OO1G 4H13C 3T51B 1TU2B 1YNJC 3I73A 2AUJD 3T56B 4KHZA
chains in the Genus database with same CATH superfamily
3UI2A 4HJ9A 1UUPA 4HMIA 5HGTA 3NHHA 1NR4A 2PNHA 4JI3L 4MNOA 2CW0C 4POGA 3MAQA 1DD2A 2ATWA 3DMUA 2J7ZA 4NKLA 4MTKA 4BA1I 1E0BA 4KHVA 2GVAA 2KUMA 2ZM6Q 1F2YA 4IOAA 2B2UC 3HRZC 3CRLC 3S1NH 2XRSD 1L0WA 1J5EQ 3M4OH 4DR1Q 4A3DH 5JPMC 4PMWA 4B08A 4B3SQ 1JORA 1V8QA 5KEEA 4QMGA 2EZVA 2UXDL 2R7ZH 2L1BA 1PDQA 2DY7A 2L4NA 1PTOF 5A2QE 1TQOA 2N55A 1KNAA 3UDFA 2XNAC 2ES2A 2HHHL 5FO9B 1SR3A 2E5LQ 3E0JA 1RL2A 3CXCA 4X65L 4ZAIA 4OGQC 2Q2IA 4RCNA 2JA7G 1DXMA 3V2TA 4HAEA 1FGUA 4PMBA 4DV7Q 3I55A 3F1ZA 4JI0Q 2KQ3A 1RD9D 5LMUQ 3GTMB 5CV7A 2O2LD 4QL5A 1JJGA 4R4QA 1HFGA 1PZKD 4G57A 1SE2A 1GD7A 2NZOA 4IUQA 2CFMA 1SYCA 2A6ED 4A3BB 4X62L 3H09A 3NBIA 3HOYG 2VB2X 1K8GA 4IPCA 3JAMi 2NBFA 5JVG3 1M90C 2RHSB 2CW0D 1PTOH 1L1OB 4JI1Q 3CCQA 4DR6Q 1I4QA 2KHIA 1VQHA 4U673 4ZYSA 1IBLQ 4DR3L 1FJGL 1XNRQ 2B8GA 2EPBA 5CC4A 2XWBB 3E5SA 5M5XH 4A3GG 1ESRA 1EY4A 1G2SA 1E3PA 3T16A 4DK0A 3CHBD 1EQTA 3M7GA 4DV5Q 2MP1A 4HJ7A 2K5VA 4LFCL 4XXEA 1PH8A 4AQYL 4O42A 1SNDA 4RAUC 1VQOA 1HRJA 2YV5A 1D8LA 2PW7A 4DV4L 3NQIA 1OO9B 2B2TA 4N9TA 1E2VA 1SBBB 4KN7C 1M1KC 4FYDA 4C3JG 3PO3B 1TU2B 4DV3L 5I4DA 2EYOA 1MIUA 5FJ8H 1OXUA 4LF4Q 5C3EB 2ZXPA 3OWEB 3PQIA 4K5WA 4X3TA 5EBDA 2ALYB 3MEHA 1HPCA 5LL6S 4K0KL 5I2YA 3W5OA 1YEZA 2ZTDA 4A3LH 3DUZA 4C1NK 3HZXA 1STBA 1GXDC 1BCPB 2K33A 1G291 1UEBA 5T1GA 5DM73 5KRUA 3K8AA 3AFPA 2RHQB 3PCOB 3J80E 1Q8IA 1B9NA 2K5NA 1Y1WH 1B4OA 5ISRA 5M3MB 1KXLA 1IKMA 4P72A 4EGVA 1A63A 1E24A 4JBMA 1QNUA 2XGTA 1FR3A 3H0GG 1I3QB 1KHIA 4J1MA 1VQAA 4U68A 5IP9G 3LNNA 2OF1A 2ZM6L 3MXPA 2NVTB 1YI2A 4YHHQ 1A0IA 2KVMA 4N8FA 5IP7H 1D2BA 1XPRA 2EYLA 4DR1L 3A54A 3RN5A 2OT2A 2L0CA 2Q2HA 3GTMH 2WV6D 3W1GA 2FHTA 4B3SL 1V1OA 4BY1B 2I0QA 2LY7A 3K59A 5IGEA 3BZKA 5ELNA 2KCMA 3JAML 1EU4A 2PQAB 4TSSA 3S24A 3FDTA 1YJ9A 2Z8LA 5BR8Q 2BDOA 1R4QB 5G3LF 1ZYRC 1GVPA 4DV7L 4B3MQ 4JI0L 1TKWB 5LMUL 1X3EA 3BZDB 4Y52H 4EQOA 4CKBA 1S40A 4BA2I 3VA7A 1EZ8A 2BH8A 3TP8A 2F0KA 3PIPA 1DOLA 3FKIB 3A55A 4IFDG 4DF7A 2XVSA 1ENCA 4A3BG 4P74A 3NK9A 4HIMA 3PO3H 1YNJC 4JI1L 4DR6L 3GTLH 1MD2D 1IBLL 2NZ1D 5C3EH 2N49A 1OXXK 1IW7D 2EYPA 3L0OA 4LF8Q 2B63G 1TWAH 5D14A 1FGBD 5ELOA 3GD7A 4NPSA 3PGZA 3E3XA 4DV5L 2F3IA 3S15H 3U58A 1HA6A 3TS2A 1XMOQ 1CKOA 4CBVA 1FNUA 2E2HB 2PQEA 4L5TA 3OYYA 2I5MX 1W2BA 2Y0SB 1QOHA 4DR2Q 4TRDA 4ZCKA 1JMCA 5IYCH 1I94Q 4KD4A 4X3KA 1J8IA 4Y7NH 5M3MH 1Y8PB 2A6HC 4LF4L 5E3FA 4LUOA 2IX1A 4OWWB 3S1RB 2O5IC 3TMEA 3IKJA 2IPKD 3GV6A 3T13A 4DR7Q 4CKCA 4IFDJ 2NVYH 4A75A 2BCOA 1Y8OB 3HOVG 1SEBD 1GHJA 2I46A 1E1TA 2EYMA 1VQDA 3DWPA 4IUTA 4LF9Q 2EQSA 3IAYA 2R93B 1CUKA 2F0WA 5C3WA 1FNVA 3QB3A 3R2IA 4A3KG 1BVSA 3J7YW 1D5MC 4ODGA 1XX8A 4X64Q 3JAMc 3ZYYX 1W6KA 1SYBA 3E9IA 3RNUA 1JOKA 4KN4C 1YNJD 5LMNQ 1YBYA 1X3GA 1T5XD 2VXWA 2Z6KA 1NJIC 3F2BA 2RVLA 3OIQA 2IJ0A 3OPOA 4YHHL 5GAHC 3BU2A 1Z9FA 2BE5C 3SEBA 1LM0A 5JJKA 1EY8A 4P2CB 1X65A 3FP9A 4RFBA 1PFMA 1PFSA 3I70A 1KLUD 4GKKQ 4KTAA 1L1OA 1L0XB 4DUZQ 3MWYW 4QY7A 1HNZQ 2EY5A 4GS3A 4BBRH 2C35B 2IX3A 4BY1G 1AH9A 1VQNA 4FO2A 5K36H 3W1BA 5L37A 5M5WH 4IPDA 4EVOA 2NTTA 2JA8H 3I73A 2ZJQA 3HFZB 2PZUA 1P8LA 1ZEQX 1JR0D 4GN4B 4J8QA 3VDYA 2DUDA 3J81j 2IHEA 2J4XA 1C8CA 5TSSA 2UXCQ 3WOFA 4RH6A 5E4XA 4DK3C 4HEDA 4B3ML 2YYZA 3GTJB 3MEFA 3HOUG 4C3IB 3HGBA 1WD0A 3HKZG 2AWNA 1EY5A 1RF2D 2RKSA 2L55A 4A4IA 4QQBX 2Q8IB 5E7NA 5IT9L 2FMCA 3R3OA 2R7DA 3FKIG 3S9WA 2Z0SA 1XPOA 2K5HA 3T4AC 4LJZC 2J0TD 1VQ8A 1CSQA 2I5LX 3J7ZC 4A93H 3X3NA 2MNAA 4K2KA 3PO2H 5IGGA 3S14H 4DK6C 3I4NB 4YWLA 4MTNA 2PZTA 2QKIC 1F9PA 4LF8L 3I4MB 4NP5A 1K83H 1BBWA 1WTWA 1S5FD 1A2TA 3CW2C 5ELCA 2QEXA 3F2UA 3A7AB 5IGFA 5J3BA 3QWNA 1STHA 1S3OA 3OHXC 1SE3A 5HGQA 2BA1A 2R93H 3E6ZX 4DR2L 3SHLA 3L9AX 1OXVA 1I94L 4A76A 4DA2A 4GNXB 3VYRA 1PRTC 1AEXA 2ZXOA 4F88A 2E74C 2K03A 4HTHA 3GDEA 4IZ8A 1HQRD 3A8IE 2F0UA 5C6AA 2K4KA 4DR7L 1EL0A 1LO5D 1SNMA 2NVQB 3L3OC 4C3HB 3RZOB 3ULLA 2VB3X 1VF5C 3CPWA 5EQ0A 1Q8KA 4LF9L 1STNA 1LT4D 2RA4A 2SEBD 2E2IH 1KDCA 3NPPA 2D0PA 2EIFA 1TY2A 2AMCB 1C7YA 2PQAA 1QVGA 4A3JB 5ELDA 1H9MA 3MFGA 4C2MB 1S4ZA 1B53A 4X64L 3NXWA 2JA9A 1XYIA 1Z6HA 1V9PA 1TWGH 3KLSA 5LMNL 4CJ0B 3NTIA 1EQRA 1TWCB 4UDUC 2A8VA 4H13C 5HY6A 1NUCA 2F0PA 3GTGH 1EYCA 1UE1A 4KHZA 1QB5D 2VUMB 3RLOA 4GOPB 2L11A 2RCNA 3QG1A 1SNOA 4A3MH 2UXBQ 4XDXA 5C0XJ 1I6HB 5EAYA 2B2TC 1IKLA 1HUNA 2YTYA 4R8NA 4RKLA 4GKKL 5IT9c 1HNZL 4DUZL 3KF6B 1GUOA 3CCEA 4LWCA 4B9XA 1JB3A 2HDMA 3U50C 2DNEA 1PRTD 3DM3A 4I7ZC 1LTBD 4G7OC 3GQBA 1YHAA 3DWQA 4BBSB 3EVQA 2K5QA 3MTSA 2H1EA 4F7XA 3BG3A 1WTPA 1D6EC 1JICA 4FF2A 4A3FB 3FRPB 1HA5A 1A3VA 1PH5A 1V1PA 1Z47A 1UE5A 2XSCA 3I4NH 3BYTB 3OMCA 2NN6I 3BVMA 1U9RA 3EROA 4KKSA 1PRTF 2JA5G 2N8NA 4ILWA 5EGTA 3S1NB 3BVGA 3K5MA 3M4OB 4A3DB 5FLMH 2EJFC 4APVA 2CQOA 4FXGC 2AUKA 2IW3A 5JEAG 3HG9A 2PMZB 2RDGA 2NYZD 1VQLA 2LMCB 4PV1C 4UP8A 1YIJA 2R7ZB 1PYBA 2H4OA 1Q46A 4CJ1B 2SNSA 4G7HC 3FPUB 3ERSX 3K7AH 5C4JH 4FF1A 1QNKA 3M3YH 2RF4A 5COYA 3V96A 2NVQH 4DK1A 2NN6H 3VR3A 1NTGA 1CM9A 1KDBA 1SLJA 3A0JA 3SE0A 5GAEC 1WJJA 3IL8A 4IOCA 4R4TA 3STBC 1VQ6A 1RDPD 1SYEA 1CHQD 2PCFB 1JOQA 1NMGA 5C4XG 3BS1A 1JT8A 4WJWA 3S16H 1LV9A 2F0FA 1TS5A 3I90A 3KJOA 2MFIA 1K8OA 1YJWA 1CTMA 3CMEA 2O4XA 2B2WA 4DNIA 4FF4A 1LUZA 3D4RA 3G7LA 3A5UA 4EQPA 1GUSA 3KOJA 3NBHB 1PTOB 1TWCH 1QG7A 4A3EH 1XXGA 1A62A 2KEDA 4OIJA 3G6JB 1VQJA 2MO0A 4C3HG 1MSGA 5M5XB 2QW7A 3Q24A 4KKUA 2CWAA 1PYSB 1EIYB 3CCJA 1C0AA 1M4VA 4IUNA 5AJ3Q 1JE5A 3I8ZA 4H7BA 3G71A 3TSSA 3DXJC 3PUXA 1CSPA 4KY6A 3KF8B 1SE8A 4KI0A 4O1NA 3VR2A 5EKKA 3K57A 4RG1A 4GLXA 4XTCS 1NE3A 2D9UA 2WACA 2IY5B 4A3FH 3GP7A 1CK1A 3TREA 3U4ZA 3K0XA 1KAWA 2UXBL 2WAQB 4OL7A 4YCVA 3CCLA 3PUYA 3UDIA 5IYBG 4RHSA 4QJFA 2KHJA 4HIDA 3BYYB 1PTOD 1NAPA 1MI2A 3PIOA 1DONA 2KECA 1GHKA 1B70B 2K5DA 2WKDA 1V43A 4CGYB 2M9VA 5JJZA 2K6AA 3OOCA 3GTPH 1STEA 1CQFA 1Y1WB 3UDXA 2K7VA 2K14A 3J81L 2QA4A 2R92H 3JAME 4BBSG 4FP5D 2JA7H 2N3SA 3NSWA 2LFNA 1J9OA 4GNXA 4X3UA 3FVQA 5C44B 2L12A 2PYKA 3KLWA 1K8AC 1D5ZC 3RMHA 4XT1B 3KBGA 2JYOA 3EN2A 4A3DG 2Z6KC 4RMFA 2K28A 3ICEA 5C4HA 1QZHA 4KKTA 1VS0A 1WTRA 3QJYA 5FK9C 1D5XC 4S3SA 5A35A 1AE2A 2PMZE 4XQNA 3D4WA 1L1OC 2RDFA 1LTSD 3NENA 3GTKH 4OHJA 1TWHH 1S5DD 2WINB 1XTCD 1ET9A 2Q2UA 4IJLA 1KD1C 1BO0A 1PH7A 3SGIA 4CDEC 3K5OA 1F9RA 3NEMA 4MZ9A 2UUBQ 2G9DA 3AEVA 2OWOA 4C3JH 1I4XA 1E1OA 1WI5A 1BDOA 3KDFA 2F03A 5AFWA 4GOPA 1FYCA 3CQZH 2N88A 2UUCQ 1SMYC 1IXRA 2Z4HA 1WD1A 1EWHA 3BDOA 3TN2A 4ID6A 3NQTA 4HJ5A 3H15A 3GTLB 4F8MA 4GKJQ 1W3SA 4DV0Q 1SFOB 4K8JA 2JXMB 4B3TQ 4KLKA 1T9HA 3M85A 1QJOA 1SDFA 4EQNA 1PVOA 1TWAB 2DNCA 1ASZA 2EYJA 2Q8RE 1AZQA 1KAAA 4JG2A 1WCMG 3CMAA 2HD3A 4HCEA 2C5CA 2M2LA 2WB1B 3S15B 2QDBA 1QWYA 4KV6A 5AJ3L 4DXFA 3RLFA 1C9OA 4E6IA 1BCPC 4YCWA 4DNTB 3J81c 2NVXB 4ALPA 4RGTA 1FNWA 3H0GH 1I4HA 5IP9H 4OWXB 1GUWA 4Y7NB 2CCZA 1AP0A 5C3XA 5FLXL 1DZ1A 1PFBA 1BR9A 4WJ3M 2NVYB 1KRTA 4A3CH 1UE6A 2GVBA 4K5VA 1QVCA 1QUQB 1HUMA 4HIKA 2PNRC 1CKNA 1PXUA 4OIKA 3KBXA 4UAIA 5C44H 3W2DA 4A3LG 5ELEA 1J5EL 2AKWB 3URYA 2F0EA 3HOZH 2IT1A 1MBYA 3WDNA 4QIWB 1A3UA 3LWEA 5G3LD 4EQ5A 4GZYC 3B6YA 1SMYD 1ZKOA 1UEAB 4HIOA 1Y1WG 5KNCA 3DEPA 2HCCA 2XRQD 3ULPA 2E5LL 1SNCA 3MVVA 2OTLA 1D1KA 1BF4A 1AE3A 2DJGC 4M1UB 3I91A 3PUVA 2EDGA 4HSVA 1STGA 4FDBA 5IP7G 4OO1I 5EPJA 3H91A 2EXZA 3J7AV 3P7JA 1KABA 4UHVA 4DAMA 4DV6Q 4BBRB 1IYJB 2FINB 2V1CC 3TP6A 4LUVA 5A2QL 3D3RA 1LT6D 1U4MA 1L2FA 4QF4A 5M5WB 4IJHA 1I5FA 3K7UC 2A68C 1B9MA 1XJVA 2EYHA 4IQZA 2JA8B 3NTHA 2A69C 3A8KE 1Q12A 1ENAA 1DJRD 1B44D 1ESFA 1SFOH 1XNRL 3NWSA 1IL2A 1MKHA 3JC66 3CCMA 4POFA 4DNRB 4OO1H 4O0AA 3EA6A 2F0OA 1X56A 5JVH3 2UUBL 3C2PA 2VL6A 2UXDQ 4DFAA 1IYUA 4DKAC 1VQMA 2F0SA 5FLXc 2NVXH 2UUCL 1I50H 4YWKA 1XTDA 1JWUD 4A93B 3DEOA 4OELB 4KMUC 3HOVH 1HHVA 4GKJL 3PO3G 1ET6A 1X32A 5FO8B 3PO2B 4DV0L 3S14B 4B3TL 4R4CA 5C3EG 2KBNA 3CD6A 1SE4A 5GAGC 3U9SA 1K28A 1K83B 1SNPA 1ZYRD 3VA5A 2F4VQ 3ND8A 4A3KH 3TBIB 2G5DA 2VQEQ 2L9HA 1JB7A 3BZCA 2SOBA 1O7IA 2WB1G 1UWVA 1AFPA 2B2YA 3FMCA 1M8AA 1RHPA 2ZXRA 1LYLA 3SK4A 2BDNA 4UP7A 2KOLA 1JQYD 4DAYB 2WB1E 1F2ZA 3CU7A 5IYCG 1VQEA 2DJFC 2JEAI 4J15A 3ND9A 3S17H 2SDFA 5M3MG 3CC2A 3CCSA 2GN5A 2XIWA 1B7YB 2K01A 3R93A 2F0LA 2X69A 2OQKA 1KRSA 4OEMB 4DAPA 1X3FA 2F3VA 3CCUA 2RSNA 3DHQA 2JQOA 2E2IB 2B2WC 3HP3A 3J80L 5I9PA 3NE5B 4XIGS 3X3MA 1QZGA 3SDZA 1U5KA 4GLAC 1GO3E 1QILA 1MJEA 2LKVA 1O80A 4DAVA 1R9TH 1X6OA 2XTIA 1KL9A 4BXXH 1TWGB 3I4LA 2I5HA 1JJCB 4V0BA 2A6HD 1N9WA 5EJWA 4MIUA 4L5QA 3HOWH 3GTGB 2L15A 2N78A 3VR6A 3O13A 1WVLA 4Q5VA 2WP8J 5M3FH 2L5TA 3QIAA 3HOUH 5BR8L 4A3MB 4H02A 4F87A 3H94A 1BBXC 4OXPA 1VF7A 2OEOA 1ICWA 1X3QA 1X55A 1A15A 1B2TA 1X9NA 5CV8A 4DV6L 1WTHA 1YNNC 2EJMA 2P5ZX 1Y1VH 1AZPA 4BBRG 1VMPA 3VR4A 1SNQA 2LXKA 4IURA 4N9PA 3RLNA 3H3VC 1H9SB 1BXTA 3OTOQ 1EWIA 1NSNS 1U4PA 3VYUA 4TQUS 1EFID 3CF5A 2F0HA 1UNSA 2B2VA 4HJAA 3FEWX 1O7YA 5IYDG 5GADC 1ONLA 1QVFA 5GQOA 1Q82C 4QUCA 1JWMD 2BE5D 4BWGB 5EKLA 4HN7A 1WOCA 1JC7A 4DGZA 2D5DA 4RGMA 3E9HA 4KD3A 2QDLA 3TZUA 5I2XA 2VQFQ 4QCLA 2HCIA 3RZDH 1G8ZD 1XMOL 2M00A 2YTXA 1ILQA 2E8GA 4ZLTF 1TIID 2Y0SG 4K6DA 3OWFA 2A19A 3SK8A 4GNXC 2XN9C 3K5NA 2Y0SE 1EEID 3HEJA 3BJUA 1X3PA 4BY7H 4ME5A 5C0XG 3K7AB 4OONA 5C4JB 3M3YB 1G2TA 3T1YQ 4RWSC 3PO2G 4LF7Q 1C4QA 1I4GA 3LX0A 3HOXB 3AQQA 2FFKB 5CV4A 2ZTEA 1EFWA 2F4VL 2VQEL 1HR0W 1BBUA 1PRTB 1DOMA 1R4PB 5CV6A 2B3GA 4ZKCB 1WFQA 4CDDC 2LXJA 1FVIA 3AFQA 1XMQQ 1IBKQ 4HJ8A 3S16B 1IBMQ 2R93G 3ONAB 5M5YB 4A3IB 5LMNW 5JAVA 4DU9A 3MFYA 4JV5Q 5J22A 1CT1D 1EY0A 3G6EA 1K9MC 2R3ZA 4IO9A 2NWGA 2ZJPA 3VYTA 1ML0D 4A3EB 4LF5Q 4TVAB 3DWAA 1KIXA 1K0RA 1ICFB 1STAA 4EX5A 2JSOA 2TSSA 4PZ6A 4GOPC 5BN4A 2B8FA 2KHSA 1TT2A 3SVMA 1KC8C 2F0NA 4R8IA 1AN8A 5KIXA 3Q23A 3H3VI 3TEHB 3SR1A 4DV1Q 3D6WA 3PIP3 1VQFA 4OWTB 5DLQE 4NB3A 1S72A 1NBWA 5IWAQ 2LS01 3Q8DA 4JOIA 1TS4A 4KHPQ 1EY6A 3FPPA 2A74C 3GV3A 1K8MA 4XT3B 4JBKA 5IODA 2D2CC 3NUCA 1H9KA 4WJ4A 2ZT9C 1ZXTA 2AQ1B 2UXCL 2UU9Q 4A3MG 2Z1CA 3UDGA 3H3VH 3S1MH 1CZWA 1PH1A 1HXYD 1SXTA 1Q1BA 1A8VA 2MO1A 4C3IG 2AHOB 2QILA 4JI7Q 1TR5A 3QR8A 1TS2A 3G4SA 2F4IA 1EU3A 4BS9A 3OTOL 1GOZA 3GTPB 2ID0A 4KY5A 2JA6H 3J81i 5DEHA 5CGKA 2R92B 2MHVA 4LUZA 1TWFH 5CORA 2JA7B 3N6RA 4X65Q 1E22A 5DNFA 1EZ6A 4KK7A 4ME3A 4AYBB 3BVZA 4PQXA 5CBEE 3P75A 3WWVA 2MPMA 3HOXH 3I4NG 5CYUA 5C4XH 4L63B 3I4MG 4FF3A 1PHJA 3WOEA 4MN3A 3S2HB 1SJHD 4L5SA 3HOYB 5KYIA 5FLMG 2HUGA 1N8RC 1TXYA 4CHTB 4JC0A 3MXGA 5M5YH 4A3IH 1PYWD 4IUVA 4WRDA 1MHWC 1A2UA 1KTKA 3T1YL 5F2DA 4P71A 2F0QA 1LT3D 5J39A 4LF7L 1FL0A 5KNDA 1VDZA 1N34Q 1JOOA 3GTKB 1HJPA 1TWHB 3TQYA 2FMMA 1XMQL 4C3JB 1IBKL 5LHY1 1IBML 2MGSA 4L6TB 4JW0A 4ZQ3A 1PMRA 4A3JG 4JPBW 1WYDA 3CQZB 4UP9A 5KYLA 4JV5L 1D7QA 4MHEA 4Z9CB 3N52A 2YU9H 4OX9Q 4CDCC 5D3DA 4LF5L 4ULLA 3AMUA 2B39A 5I9OA 3F2DA 4A3EG 1OTCA 1HQMC 2B29A 4C1NI 1EWCA 1LTID 1EYDA 1LABA 1W6JA 2VUMG 4G7ZC 1H9SA 4FVMA 4IALA 3ULJA 3STBD 1KQSA 2BOSA 4DV1L 1YHQA 2A6EC 1O7LA 2E76C 1PLFA 1T5EA 1DM0B 1WTQA 3PF4A 2OXPA 3H0GB 5IWAL 1EY7A 2RDHA 1VQCA 3R8BA 1HNWQ 4KHPL 3MZ5A 1Q90A 1TVXA 4LK1C 1V1QA 1I4PA 1EY9A 1N36Q 1GUNA 1J6QA 1SJED 2RCFA 1Z7TA 4YY3Q 2O5JC 1BQQT 1YVCA 2JEBI 3QOLA 4A3FG 3OIPA 2B2YC 1PZJD 2UU9L 3S1QH 1NCVA 4FXKC 1EQQA 3LWUA 2E2JH 3GO5A 1K0SA 1BKBA 4B9WA 2RBMA 3U9OA 2EY2A 1PH3A 2K05A 4YCUA 5CMDA 3F2CA 4X66Q 3HOZB 1ILPA 4JI7L 3S2HH 2Z4IA 3UE1A 3HOYH 2Q8TA 4L8JA 4PZ8A 1I4RA 4K8IA 2CH4A 4PZ7A 4JYAQ 5I6WA 3MC0B 4AIMA 1Q86C 2R7ZG 2R92G 4A3GH 3VYSA 1F2MA 5ELBA 4IPHA 3GTOH 2H5XA 2F0VA 1SMXA 2R7FA 4AYBG 3I72A 2PI2E 4AYBE 5IIFA 3A5ZB 3C3LA 1PZID 4CDFC 2AWOA 1EYAA 1BNZA 3PV0A 5BN5A 2F1MA 3L2PA 1UAPA 3AB9A 1IYVA 3CAMA 5CV9A 2B63B 1WTXA 5CBAE 1MJCA 2A73B 3KF6A 3M7NA 1N34L 1SRUA 1WCMH 2EYFA 3RR5A 1VCIA 5CV5A 1YZ6A 4P75A 3ZJYC 5IOCA 3C1EA 1ENFA 2CH4W 3CC4A 2B2VC 2VZAA 1H9RA 3W3AA 1CKMA 1Q7YC 1Y8NB 1I50B 2K75A 2JN4A 4OX9L 2DGYA 1K3BC 3A8JE 5KNBA 3HOVB 1CZGA 3NP8A 1I6VC 3D6CA 3Q6SA 5FJ8G 1B3QA 2ICEC 4IUUA 4G4KA 5FKAC 3V05A 4FNFA 5BN3A 3K5LA 5E1FA 2WAQG 4KJNA 2EY6A 4A3KB 4ZK9B 4O2DA 4Q0FA 1LT5D 4P73A 2WAQE 4PNYA 2R6GA 1RIPA 2A5HA 4IFDI 1F9SA 2PI2A 1HZ9A 2PPBC 2VY3A 2QGQA 1HNWL 2WIIB 4XQJA 1SSOA 3SXHA 3CCRA 1SYDA 1U4RA 1U4LA 3S17B 2ICIA 1IW7C 1N36L 3C46A 2F0DA 1MSHA 2F0JA 4YY3L 5D65A 1SYFA 3MA2B 3TRZA 4A3CG 1RJTA 3CCVA 1S5BD 2Z9HA 4NXNQ 4LFBQ 3DLLA 2WFWA 1PH9A 5C44G 3P1HA 1GKHA 3EJIA 3J80i 2KJXA 4X66L 3A56A 4IFDH 4IN3A 4R4IA 3I7FA 3NBHA 1EEFD 5JPNC 4A3BH 3HOZG 1BCPD 3Q22A 2K52A 3NTKA 5IT9E 1R9TB 5IGCA 5T1IA 4JI4Q 4LF6Q 1EIGA 4DN4M 2K5WA 4JYAL 4JI8Q 4B3RQ 4IPGA 2B63H 3HOWB 1LTAD 1BUVT 5M3FB 3A7LA 4KJOA 3HOUB 4R4OA 1UE7A 4DXGA 2RSOA 1GUTA 4DR4Q 1BCPF 1VQ5A 4H0LC 3HKZB 1G6PA 2K50A 3I2ZA 4CJ2C 1WTVA 2BH2A 1O78A 3BDCA 3KF8A 1LTRD 3S2DB 4JOIC 1VQBA 1RTOA 4GLVB 1RKNA 4JI6Q 1Y1VB 5CR3A 3M4PA 2KCCA 1VQ7A 1JWSD 5E4WC 4J6HA 4NXMQ 1VQKA 3A74A 3K81C 1EIFA 2V4DA 2JP1A 4UY8C 1IL8A 1U0LA 4RA8A 1DGSA 4M8AA 3LGJA 1XPUA 1E2ZA 4C56C 1K73C 3OMGA 4LAAA 1G91A 1EUJA 1N33Q 3PIO3 1O7ZA 1V1PB 1MGSA 4OO1G 1JJ2A 2B2UA 3RZDB 3KYHC 2AUJD 4DR5Q 2NTSA 4YIJA 4XQQA 1STYA 4JI2Q 2NUCA 3EFXD 3TP7A 5EPKA 1EOTA 2F0GA 3RN2A 4K6LA 1LLRD 1CQVA 1OXSC 4JCVE 2FXQA 1I3QH 4GN5A 1D1IA 2A68D 1S5CD 4BY7B 2ASBA 1Q81C 2EY1A 2NVTH 2A69D 3KUPA 2JK8A 3GTQB 4R9WA 3D8GA 3TZDA 3RD4A 1HR0Q 3QOJA 3T53B 1E2WA 1K3RA 3DM1A 2JJQA 1IZ6A 4BY1H 2PW5A 1AW7A 4K2LA 4JBJA 2F0TA 3EIVA 3ITPA 3VR5A 5JJLA 3M4YA 4RGNA 1BOSA 5I6YA 2QF7A 3TS0A 3K0YA 4KY7A 1B1ZA 4DUYQ 1JCKB 1LTLA 4QIWE 2IX0A 1NMFA 5IGBA 1B50A 2QCPX 1A6XA 1CHPD 4NXNL 4LFBL 3PMFA 1A3TA 2MUYA 5K5PA 3EBEA 2JE6I 4AH6A 2IHFA 4X6AH 5J1ZA 3Q0AA 1VMCA 1DYQA 2FJ2A 4V190 3S2DH 3PUWA 3FKIH 1YNXA 2K32A 3F8TA 1SAPA 2IWHA 4JI4L 4LF6L 4QGUA 2D0OA 3I3CA 1EYGA 5IYDH 1SROA 3MXNB 4JI8L 2EVBA 3K58A 5C0XI 2DY8A 4BXXG 3KLRA 1QE6A 2KA7A 4B3RL 1ASYA 3R2TA 1Q1EA 4LMQD 3AU7A 1KDAA 5K36G 1KLGD 1XNQQ 1H9JA 2JA5B 3HOWG 1HFNA 2JA8G 1HZBA 4DR4L 5M3FG 4ABNA 4PMCA 3OW7A 2E2DC 2PZWA 2E2HH 3S1MB 5EKIA 2KENA 1CFMA 2AQ2B 2F52A 2R61A 3D31A 1VQ4A 3T51B 3HKZE 4HSPA 4JI6L 2KEEA 2MJ8A 3BDLA 1EOVA 3ER0A 3TDQA 1Y1VG 5NUCA 1HNXQ 5C0XH 2CWPA 4NXML 2K1BA 2D62A 2VNUD 2JA6B 1QUQA 2NZHA 1NR2A 2HDLA 2RQXA 5IE8A 3S1RH 1HTPA 2KCTA 4JK1C 1TWFB 4RHRA 1DOKA 4LFAQ 3I4OA 4A93G 4YWMA 3T1HQ 2ZTCA 1S5ED 4JVZA 1RODA 1EIHA 1HCZA 4JI5Q 1PV4A 3GTQH 3UE0A 5C4XB 1B3AA 3J80c 3P20A 1N33L 3IFTA 4WFN3 3G48A 4HR7B 4ZUIA 4LW1A 4DR5L 1OXTA 3KJPA 4PG3A 1LACA 4JI2L 2OTJA 1YNND 5LL6X 2ZJRA 2CQAA 1X54A 2Z6BA 3IFDA 1IHZA 2DN8A 3M9BA 4IUPA 3K6OA 4ZRZA 5GROA 2BA0A 3M4QA 3KK7A 3J7A5 4QUFA 4DV2Q 2ENBA 1HTLD 5C4ZA 1CA5A 5IGDA 2IL8A 4BY7G 2SNMA 1B8AA 2X6GA 1TY0A 1LTGD 1VQIA 2UUAQ 1TS3A 1HR0L 1QCBD 2LSSA 4FXDA 5FO7B 1YHBA 3NELA 3L7ZC 4RCOA 2PO4A 1Y69U 3ERQA 4CKEA 4UPAA 1F2LA 1N32Q 1JE4A 4NMZA 4RGOS 3TP5A 2QEJC 3J81E 3KDFB 2EE1A 4DUYL 5DM63 2YU9B 4JI3Q 1II3A 1CI3M 5C5MA 2I07B 1C48A 4DPGA 4ZUJA 1F9QA 2F0MA 4X3SA 1F77A 4XYQA 1CA6A 2JA5H 1Q3LA 1G51A 4TKOB 2C9OA 2OCEA 3SK5A 5KGUA 3GTJH 4NDXA 1HZAA 3E0EA 4C3IH 1P16A 3D4DA 2HIXA 4RKBA 1NY4A 5JEAH 2EXDA 1G6ZA 2F3WA 3MXUA 3PUZA 4NW2A 4N8X1 3FHWA 5HURA 3T56B 1PA6A 3K80C 4H44C 3EQLC 3U4VA 3CC7A 4I7AA 1KNEA 1VQPA 2VW9A 1RTNA 2K04A 2HHHQ 1XNQL 1YJNA 1HH2P 2HIVA 3I4MH 2AQ3B 4LNQA 2VS1A 2CVRA 5IY0A 3KLSX 3IRBA 3S1QB 4DAYA 4HCSA 2E2JB 5D3IB 5EBCA 1PH6A 3H6MA 3AYHB 3CP0A 5DAUA 2VQFL 3OW2A 1SN8A 3QO2A 4GN3B 1CKNB 1VQGA 1HNXL 2KCNA 1FD7D 1YITA 3CKIB 4X62Q 3D0FA 1VQ9A 2JA6G 1GM5A 3J7AF 4LFAL 3KFUA 4C3HH 4JBWA 2TMPA 4A3GB 3T1HL 3RZOH 4DR3Q 1FJGQ 5EPLA 2G9HD 3C1FA 4JI5L 1Y14B 3HKSA 3GTOB 3PSIA 3HS0C 5M9OA 1PTOC 5JOBA 2HQLA 3HOXG 2NN6G 2YTVA 1GUGA 2E75C 1PH2A 4R1JA 4LFCQ 1NNXA 5C5LA 1PFNA 4A3JH 4C2MH 4AQYQ 2MQHA 2CKZB 3CPFA 4DV4Q 1XWEA 1EQVA 1WTOA 3I56A 4DV3Q 3OSOA 4HMJA 5JEAJ 4DV2L 4A3IG 1L0YB 2HT1A 1SYGA 5FLXE 1DCZA 1LTTD 2VUMH 1H95A 1GJXA 4QB4A 4I65A 5IYBH 4K14A 2EJGC 1PH4A 1WCMB 4WORA 4ZKBB 5ELFA 3RUZA 2UUAL 4K0KQ 1I6HH 5JJIA 4L5RC 4K5XA 2CHBD 2OQ0A 2A1AA 3MXNA 2X6LA 2EOTA 3NWTA 5H1SE 1E7ZA 2Q2TA 2GA4B 2HQEA 2WKCA 1HZCA 3SK6A 1RCVD 3CRKC 5FOBB 2NB0A 1N32L 2F0IA 4XYOA 3PF5A 2XWJB 3MHBA 4BBSH
chains in the Genus database with same CATH topology
3UI2A 1UUPA 4HMIA 5HGTA 3NHHA 1NR4A 2CW0C 1DD2A 3MAQA 3DMUA 2J7ZA 4NKLA 4BA1I 1E0BA 4KHVA 2KUMA 1F2YA 2B2UC 3HRZC 3CRLC 2XRSD 5JPMC 4PMWA 4B08A 1JORA 1V8QA 5KEEA 4QMGA 2EZVA 2L1BA 1PDQA 2DY7A 2L4NA 1PTOF 5A2QE 1TQOA 2N55A 1KNAA 2XNAC 5FO9B 3E0JA 4ZAIA 4OGQC 4RCNA 1DXMA 3V2TA 4HAEA 4PMBA 2KQ3A 1RD9D 3GTMB 5CV7A 2O2LD 1HFGA 1PZKD 4G57A 1SE2A 4IUQA 1SYCA 2A6ED 4A3BB 3H09A 3NBIA 2VB2X 2NBFA 5JVG3 2CW0D 1PTOH 1I4QA 4U673 4ZYSA 2B8GA 2EPBA 5CC4A 2XWBB 3E5SA 1ESRA 1EY4A 1G2SA 3T16A 4DK0A 3CHBD 1EQTA 3M7GA 2MP1A 4XXEA 4O42A 1SNDA 4RAUC 1HRJA 2PW7A 3NQIA 1OO9B 2B2TA 4N9TA 1E2VA 1SBBB 4KN7C 4FYDA 4C3JG 3PO3B 1TU2B 5I4DA 2EYOA 1OXUA 5C3EB 2ZXPA 3OWEB 4K5WA 4X3TA 5EBDA 3MEHA 1HPCA 5LL6S 5I2YA 3DUZA 4C1NK 3HZXA 1STBA 1GXDC 1BCPB 2K33A 1G291 5T1GA 5DM73 5KRUA 3J80E 1Q8IA 1B9NA 1B4OA 5ISRA 5M3MB 1IKMA 4EGVA 1QNUA 1FR3A 1I3QB 4J1MA 4U68A 3LNNA 2OF1A 3MXPA 2NVTB 2KVMA 1D2BA 2EYLA 3A54A 2OT2A 2L0CA 2WV6D 2FHTA 4BY1B 1V1OA 2LY7A 3K59A 5IGEA 3JAML 1EU4A 4TSSA 3FDTA 2Z8LA 2BDOA 1R4QB 5G3LF 1ZYRC 1TKWB 3BZDB 4EQOA 4CKBA 4BA2I 3VA7A 1EZ8A 3TP8A 2F0KA 1DOLA 3FKIB 3A55A 4IFDG 4DF7A 2XVSA 1ENCA 3NK9A 1YNJC 1MD2D 2NZ1D 1OXXK 1IW7D 2EYPA 5D14A 1FGBD 3GD7A 1HA6A 4CBVA 1FNUA 2E2HB 2PQEA 2Y0SB 1QOHA 4TRDA 4KD4A 4X3KA 1J8IA 1Y8PB 2A6HC 5E3FA 2IX1A 3S1RB 2O5IC 3TMEA 3IKJA 2IPKD 3GV6A 3T13A 4CKCA 4IFDJ 2BCOA 1Y8OB 1SEBD 1GHJA 2I46A 2EYMA 3DWPA 4IUTA 3IAYA 2R93B 2F0WA 5C3WA 1FNVA 3QB3A 3R2IA 3J7YW 1D5MC 4ODGA 1XX8A 3ZYYX 1W6KA 1SYBA 1JOKA 4KN4C 1YNJD 1T5XD 2VXWA 2RVLA 3OIQA 2IJ0A 3OPOA 2BE5C 3SEBA 1EY8A 4P2CB 4RFBA 1PFMA 3I70A 1KLUD 4KTAA 1L0XB 3MWYW 2EY5A 2IX3A 4FO2A 5K36H 4EVOA 2NTTA 3I73A 2PZUA 1ZEQX 1JR0D 4J8QA 2J4XA 1C8CA 5TSSA 3WOFA 4RH6A 5E4XA 4HEDA 2YYZA 3GTJB 4C3IB 3HGBA 1WD0A 2AWNA 1EY5A 1RF2D 2RKSA 2L55A 2Q8IB 5IT9L 2FMCA 3R3OA 3S9WA 3T4AC 4LJZC 2J0TD 3X3NA 4K2KA 5IGGA 3I4NB 2PZTA 2QKIC 1F9PA 3I4MB 4NP5A 1WTWA 1S5FD 1A2TA 5ELCA 3F2UA 3A7AB 5IGFA 3QWNA 1STHA 3OHXC 1SE3A 2BA1A 3E6ZX 3SHLA 3L9AX 1OXVA 4DA2A 3VYRA 1PRTC 1AEXA 2ZXOA 4F88A 2E74C 2K03A 4HTHA 4IZ8A 1HQRD 3A8IE 2F0UA 5C6AA 1EL0A 1LO5D 1SNMA 2NVQB 3L3OC 4C3HB 3RZOB 2VB3X 1VF5C 5EQ0A 1STNA 1LT4D 2RA4A 2SEBD 1KDCA 3NPPA 1TY2A 4A3JB 5ELDA 1H9MA 3MFGA 4C2MB 1S4ZA 1B53A 3NXWA 1XYIA 1Z6HA 3KLSA 4CJ0B 3NTIA 1TWCB 4UDUC 4H13C 1NUCA 2F0PA 1EYCA 4KHZA 1QB5D 2VUMB 2L11A 3QG1A 1SNOA 4XDXA 5C0XJ 1I6HB 2B2TC 1IKLA 1HUNA 4RKLA 4R8NA 1GUOA 4B9XA 1JB3A 2HDMA 2DNEA 1PRTD 4I7ZC 1LTBD 4G7OC 3GQBA 3DWQA 4BBSB 3EVQA 2K5QA 3MTSA 2H1EA 4F7XA 3BG3A 1WTPA 1D6EC 1JICA 4FF2A 4A3FB 3FRPB 1HA5A 1A3VA 1V1PA 1Z47A 2XSCA 3BYTB 3OMCA 2NN6I 3BVMA 1U9RA 3EROA 4KKSA 1PRTF 4ILWA 5EGTA 3S1NB 3BVGA 3K5MA 3M4OB 4A3DB 2EJFC 4FXGC 2AUKA 2IW3A 5JEAG 3HG9A 2PMZB 2RDGA 2NYZD 2LMCB 4PV1C 2R7ZB 2H4OA 4CJ1B 2SNSA 4G7HC 3FPUB 4FF1A 1QNKA 5COYA 3V96A 4DK1A 2NN6H 3VR3A 1CM9A 1KDBA 3SE0A 3IL8A 1RDPD 1SYEA 1CHQD 2PCFB 1JOQA 3BS1A 4WJWA 1LV9A 2F0FA 1TS5A 3I90A 1K8OA 1CTMA 2O4XA 2B2WA 4FF4A 3D4RA 3G7LA 4EQPA 1GUSA 1PTOB 1QG7A 1XXGA 2KEDA 4OIJA 3G6JB 4C3HG 1MSGA 5M5XB 3Q24A 4KKUA 1M4VA 4IUNA 3I8ZA 4H7BA 3TSSA 3DXJC 3PUXA 4KY6A 4KI0A 4O1NA 3VR2A 5EKKA 3K57A 4XTCS 2D9UA 2WACA 3GP7A 1CK1A 2WAQB 4OL7A 3PUYA 4RHSA 3BYYB 1PTOD 1NAPA 1MI2A 1DONA 2KECA 1GHKA 2K5DA 2WKDA 1V43A 4CGYB 2M9VA 5JJZA 2K6AA 3OOCA 1STEA 1CQFA 1Y1WB 2K7VA 3J81L 3JAME 4FP5D 3NSWA 2LFNA 1J9OA 4X3UA 3FVQA 5C44B 2L12A 2PYKA 1D5ZC 3RMHA 4XT1B 3KBGA 2JYOA 2K28A 5C4HA 4KKTA 1WTRA 3QJYA 5FK9C 1D5XC 5A35A 4S3SA 4XQNA 3D4WA 2RDFA 1LTSD 4OHJA 1S5DD 2WINB 1XTCD 1ET9A 1BO0A 3K5OA 1F9RA 2G9DA 1I4XA 1BDOA 2F03A 5AFWA 1FYCA 2N88A 1SMYC 2Z4HA 1WD1A 1EWHA 3BDOA 3TN2A 4ID6A 3NQTA 3GTLB 4F8MA 1SFOB 4K8JA 2JXMB 3M85A 1QJOA 1SDFA 4EQNA 1TWAB 2DNCA 2EYJA 2Q8RE 1AZQA 1KAAA 4HCEA 2C5CA 2M2LA 2WB1B 3S15B 2QDBA 1QWYA 4KV6A 4DXFA 3RLFA 4E6IA 1BCPC 4DNTB 2NVXB 4RGTA 1FNWA 1I4HA 1GUWA 4Y7NB 1AP0A 5C3XA 5FLXL 1DZ1A 1PFBA 1BR9A 2NVYB 4K5VA 1HUMA 2PNRC 1PXUA 4OIKA 3KBXA 4UAIA 3W2DA 5ELEA 3URYA 2F0EA 2IT1A 1MBYA 3WDNA 4QIWB 1A3UA 3LWEA 5G3LD 4GZYC 1SMYD 1ZKOA 1UEAB 5KNCA 3DEPA 2HCCA 2XRQD 1SNCA 3MVVA 1D1KA 1BF4A 4M1UB 3I91A 3PUVA 2EDGA 4HSVA 1STGA 4OO1I 5EPJA 3H91A 2EXZA 3J7AV 3P7JA 1KABA 4BBRB 2FINB 3TP6A 5A2QL 3D3RA 1LT6D 1U4MA 4QF4A 5M5WB 2A68C 2JA8B 1B9MA 2EYHA 4IQZA 3NTHA 2A69C 3A8KE 1Q12A 1ENAA 1DJRD 1B44D 1ESFA 3NWSA 4DNRB 4OO1H 3EA6A 2F0OA 5JVH3 3C2PA 4DFAA 1IYUA 2F0SA 1JWUD 4A93B 3DEOA 4KMUC 1HHVA 1ET6A 1X32A 5FO8B 3PO2B 3S14B 1SE4A 3U9SA 1K83B 1SNPA 1ZYRD 3VA5A 3ND8A 3TBIB 2L9HA 2SOBA 1AFPA 2B2YA 3FMCA 1M8AA 1RHPA 2ZXRA 3SK4A 2BDNA 2KOLA 1JQYD 1F2ZA 3CU7A 2JEAI 3ND9A 2SDFA 2XIWA 2K01A 3R93A 2F0LA 2X69A 4DAPA 2F3VA 2RSNA 3DHQA 2E2IB 2B2WC 3HP3A 3J80L 5I9PA 3NE5B 4XIGS 3X3MA 3SDZA 1QILA 2LKVA 1O80A 4DAVA 1TWGB 3I4LA 4V0BA 2A6HD 5EJWA 4MIUA 3GTGB 3VR6A 3O13A 1WVLA 4Q5VA 2WP8J 2L5TA 3QIAA 4A3MB 4F87A 3H94A 1BBXC 1VF7A 2OEOA 1ICWA 1X3QA 1A15A 1B2TA 5CV8A 1YNNC 2EJMA 1AZPA 1VMPA 3VR4A 1SNQA 4IURA 4N9PA 3H3VC 1H9SB 1BXTA 1NSNS 1U4PA 3VYUA 4TQUS 1EFID 2F0HA 1UNSA 2B2VA 3FEWX 1O7YA 1ONLA 4QUCA 1JWMD 2BE5D 4BWGB 5EKLA 4HN7A 1JC7A 4DGZA 2D5DA 4RGMA 5I2XA 4KD3A 3TZUA 4QCLA 2HCIA 1G8ZD 2M00A 1ILQA 4ZLTF 1TIID 4K6DA 3OWFA 3SK8A 2XN9C 3K5NA 1EEID 3HEJA 1X3PA 4ME5A 5C0XG 3K7AB 5C4JB 3M3YB 1G2TA 4RWSC 1C4QA 1I4GA 3LX0A 3HOXB 2FFKB 5CV4A 1PRTB 1DOMA 1R4PB 5CV6A 4ZKCB 3S16B 3ONAB 5M5YB 4A3IB 5JAVA 4DU9A 3MFYA 5J22A 1CT1D 1EY0A 2R3ZA 2NWGA 3VYTA 1ML0D 4A3EB 3DWAA 1STAA 2JSOA 2TSSA 5BN4A 2B8FA 2KHSA 1TT2A 3SVMA 2F0NA 4R8IA 1AN8A 5KIXA 3Q23A 3SR1A 3D6WA 3PIP3 2LS01 1TS4A 1EY6A 3FPPA 2A74C 3GV3A 1K8MA 4XT3B 5IODA 2D2CC 3NUCA 1H9KA 2ZT9C 1ZXTA 2AQ1B 2Z1CA 1CZWA 1HXYD 1SXTA 1Q1BA 4C3IG 2QILA 1TR5A 1TS2A 2F4IA 1EU3A 4BS9A 1GOZA 3GTPB 2ID0A 4KY5A 5DEHA 5CGKA 2R92B 2MHVA 5CORA 2JA7B 3N6RA 5DNFA 1EZ6A 4KK7A 4AYBB 3BVZA 4PQXA 5CBEE 3P75A 2MPMA 5CYUA 4L63B 4FF3A 3WOEA 4MN3A 3S2HB 1SJHD 3HOYB 5KYIA 2HUGA 4CHTB 3MXGA 1PYWD 4IUVA 4WRDA 1A2UA 1KTKA 5F2DA 2F0QA 1LT3D 5J39A 5KNDA 1VDZA 1JOOA 3GTKB 1TWHB 2FMMA 4C3JB 5LHY1 2MGSA 4L6TB 4ZQ3A 1PMRA 3CQZB 5KYLA 4MHEA 4Z9CB 3N52A 5D3DA 4ULLA 3AMUA 2B39A 5I9OA 1HQMC 4C1NI 1EWCA 1LTID 1EYDA 1LABA 1W6JA 4G7ZC 1H9SA 4FVMA 4IALA 2BOSA 2A6EC 1O7LA 2E76C 1PLFA 1T5EA 1DM0B 1WTQA 2OXPA 3H0GB 1EY7A 2RDHA 3R8BA 3MZ5A 1Q90A 1TVXA 4LK1C 1I4PA 1EY9A 1GUNA 1SJED 1Z7TA 2O5JC 1BQQT 3QOLA 2JEBI 3OIPA 2B2YC 1PZJD 1NCVA 4FXKC 3LWUA 3GO5A 4B9WA 2RBMA 3U9OA 2EY2A 2K05A 5CMDA 3HOZB 1ILPA 2Z4IA 2Q8TA 4L8JA 1I4RA 4K8IA 5I6WA 3MC0B 3VYSA 1F2MA 5ELBA 2F0VA 3I72A 5IIFA 3C3LA 1PZID 2AWOA 1EYAA 1BNZA 3PV0A 5BN5A 2F1MA 1UAPA 3AB9A 1IYVA 5CV9A 2B63B 1WTXA 5CBAE 2A73B 3M7NA 2EYFA 1VCIA 5CV5A 5IOCA 3C1EA 1ENFA 2B2VC 1H9RA 3W3AA 1Y8NB 1I50B 3A8JE 5KNBA 3HOVB 1CZGA 3NP8A 1I6VC 3D6CA 3Q6SA 2ICEC 4IUUA 4G4KA 5FKAC 3V05A 4FNFA 5BN3A 3K5LA 5E1FA 4KJNA 2EY6A 4A3KB 4ZK9B 4Q0FA 1LT5D 4PNYA 2R6GA 2A5HA 4IFDI 1F9SA 2PPBC 2WIIB 4XQJA 1SSOA 3SXHA 1SYDA 1U4RA 1U4LA 3S17B 2ICIA 1IW7C 3C46A 2F0DA 1MSHA 2F0JA 5D65A 1SYFA 3MA2B 1RJTA 1S5BD 3P1HA 3EJIA 2KJXA 4IFDH 3A56A 4IN3A 3NBHA 1EEFD 5JPNC 1BCPD 3Q22A 1R9TB 3NTKA 5IT9E 5IGCA 5T1IA 1EIGA 4DN4M 2K5WA 3HOWB 1LTAD 1BUVT 5M3FB 3A7LA 4KJOA 3HOUB 4DXGA 2RSOA 1GUTA 1BCPF 4H0LC 3HKZB 4CJ2C 1WTVA 1O78A 3BDCA 3KF8A 1LTRD 3S2DB 1RTOA 1RKNA 1Y1VB 5CR3A 2KCCA 1JWSD 5E4WC 4J6HA 2V4DA 2JP1A 1IL8A 4RA8A 4M8AA 1E2ZA 4C56C 3OMGA 4LAAA 1G91A 3PIO3 1O7ZA 1V1PB 1MGSA 4OO1G 2B2UA 3RZDB 2AUJD 2NTSA 4YIJA 4XQQA 1STYA 2NUCA 3EFXD 3TP7A 5EPKA 1EOTA 2F0GA 4K6LA 1LLRD 1CQVA 1OXSC 1D1IA 2A68D 1S5CD 4BY7B 2EY1A 2A69D 3KUPA 3GTQB 4R9WA 3D8GA 3TZDA 3RD4A 3QOJA 3T53B 1E2WA 3DM1A 2PW5A 1AW7A 4K2LA 2F0TA 3VR5A 3ITPA 3M4YA 4RGNA 1BOSA 5I6YA 2QF7A 3K0YA 4KY7A 1B1ZA 1JCKB 2IX0A 5IGBA 1B50A 2QCPX 1A6XA 1CHPD 3PMFA 1A3TA 2MUYA 5K5PA 2JE6I 5J1ZA 3Q0AA 1VMCA 1DYQA 2FJ2A 4V190 3PUWA 2K32A 1SAPA 2IWHA 3I3CA 2EVBA 3K58A 5C0XI 2DY8A 3KLRA 1QE6A 2KA7A 3R2TA 1Q1EA 4LMQD 3AU7A 1KDAA 5K36G 1KLGD 1H9JA 2JA5B 1HFNA 4ABNA 4PMCA 3OW7A 2E2DC 2PZWA 3S1MB 5EKIA 2R61A 1CFMA 2AQ2B 3D31A 3T51B 4HSPA 2KEEA 2MJ8A 3BDLA 3TDQA 5NUCA 5C0XH 2K1BA 2D62A 2VNUD 2JA6B 2RQXA 1NR2A 2HDLA 1HTPA 4JK1C 1TWFB 4RHRA 1DOKA 1S5ED 1RODA 1EIHA 1HCZA 5C4XB 1B3AA 3P20A 3IFTA 4WFN3 4HR7B 4ZUIA 1OXTA 1LACA 1YNND 5LL6X 2CQAA 3IFDA 1IHZA 2DN8A 4IUPA 3K6OA 4ZRZA 2BA0A 3KK7A 4QUFA 2ENBA 1HTLD 5C4ZA 1CA5A 5IGDA 2IL8A 2SNMA 2X6GA 1TY0A 1LTGD 1TS3A 1QCBD 4FXDA 5FO7B 3L7ZC 4RCOA 2PO4A 1Y69U 3ERQA 4CKEA 1F2LA 1JE4A 4NMZA 4RGOS 3TP5A 2QEJC 3J81E 2EE1A 2YU9B 5DM63 1II3A 1CI3M 5C5MA 2I07B 1C48A 4ZUJA 1F9QA 2F0MA 4X3SA 1F77A 4XYQA 1CA6A 1Q3LA 4TKOB 2C9OA 3SK5A 5KGUA 4NDXA 3D4DA 4RKBA 5JEAH 1G6ZA 2F3WA 3MXUA 3PUZA 4NW2A 5HURA 3T56B 4H44C 3EQLC 1KNEA 1RTNA 2K04A 2AQ3B 2CVRA 3KLSX 3S1QB 4DAYA 4HCSA 2E2JB 5D3IB 5EBCA 3H6MA 5DAUA 3QO2A 2KCNA 1FD7D 3CKIB 3J7AF 4JBWA 2TMPA 4A3GB 5EPLA 2G9HD 3C1FA 3GTOB 3HS0C 5M9OA 1PTOC 5JOBA 2NN6G 1GUGA 2E75C 5C5LA 1PFNA 1XWEA 1EQVA 1WTOA 3OSOA 4HMJA 5JEAJ 1L0YB 1SYGA 5FLXE 1DCZA 1LTTD 1GJXA 4QB4A 4I65A 4K14A 2EJGC 1WCMB 4WORA 4ZKBB 5ELFA 3RUZA 4K5XA 2CHBD 3MXNA 2X6LA 2EOTA 3NWTA 2GA4B 2HQEA 2WKCA 3SK6A 1RCVD 3CRKC 5FOBB 2NB0A 2F0IA 4XYOA 2XWJB 3MHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R6G A;  4H44 C;  3EQL C;  1OXU A;  3QG1 A;  5C0X H;  1OXX K;  2CW0 C;  1DD2 A;  1IW7 D;  2D62 A;  3PUV A;  4L8J A;  2EDG A;  2PPB C;  4KKU A;  3NE5 B;  4XIG S;  1HTP A;  1OXS C;  3SDZ A;  4JK1 C;  4BA1 I;  1HPC A;  3GD7 A;  2YYZ A;  1GUO A;  2A68 D;  1BDO A;  3MFY A;  3HGB A;  1IW7 C;  3I4L A;  2A69 D;  3CRL C;  1FYC A;  1HCZ A;  2DNE A;  3DXJ C;  3PUX A;  2K33 A;  1G29 1;  2A6H D;  2Q8I B;  1SMY C;  3P20 A;  1EWH A;  4KI0 A;  3IFT A;  4I7Z C;  2A68 C;  5KND A;  1B9M A;  1VDZ A;  3BDO A;  3GQB A;  1B9N A;  4HR7 B;  4IQZ A;  4LJZ C;  3T53 B;  3VR2 A;  3VR6 A;  1E2W A;  2A69 C;  3BG3 A;  2L5T A;  3A8K E;  1Q12 A;  3QIA A;  1V8Q A;  1OXT A;  4XTC S;  1Y8P B;  2JXM B;  1LAC A;  2A6H C;  3I72 A;  5BN4 A;  2B8F A;  4IFD H;  3M85 A;  3H94 A;  4G7O C;  1QJO A;  2O5I C;  2AWO A;  1FR3 A;  2DNC A;  3IKJ A;  3PUY A;  2DN8 A;  1VF7 A;  4DNR B;  4OO1 H;  3PV0 A;  3VR5 A;  2NN6 I;  3LNN A;  2BA0 A;  2F1M A;  3M4Y A;  1Y8O B;  5BN5 A;  4KKS A;  2QF7 A;  1PMR A;  1IYU A;  1GHJ A;  1YNN C;  2EJM A;  4JBW A;  1GHK A;  4OGQ C;  3A7A B;  3AB9 A;  4RCN A;  3VR4 A;  3RLF A;  1IYV A;  2EJF C;  4DNT B;  1H9S B;  1DXM A;  1V43 A;  2BA1 A;  2AUK A;  4TQU S;  5JEA G;  3OOC A;  3M7N A;  3FPP A;  1A6X A;  1OXV A;  2NN6 G;  3A7L A;  1GUG A;  1K8M A;  2E75 C;  1VCI A;  2K7V A;  2LMC B;  4PV1 C;  4KMU C;  1GUT A;  1HQM C;  1ONL A;  2D2C C;  1H9K A;  4H0L C;  2JE6 I;  2E74 C;  2ZT9 C;  3L7Z C;  1LAB A;  1O78 A;  2A6E D;  4G7Z C;  1H9S A;  4KN4 C;  4G7H C;  1Y69 U;  3A8I E;  2BE5 D;  3PUW A;  3U9S A;  2K32 A;  4DK1 A;  2NN6 H;  2PNR C;  3VR3 A;  3ND8 A;  3SE0 A;  2D5D A;  3OPO A;  1Q1B A;  3TZU A;  1H9R A;  1O7L A;  2A6E C;  2E76 C;  3W3A A;  2EVB A;  1VF5 C;  1T5E A;  2KCC A;  1Y8N B;  2BDO A;  2BE5 C;  3KLR A;  2KA7 A;  1DCZ A;  2B8G A;  3FMC A;  1CI3 M;  2PCF B;  1Q1E A;  1ZYR C;  1GJX A;  2IT1 A;  2EJG C;  3A8J E;  5K36 G;  5KNB A;  2V4D A;  3WDN A;  1H9J A;  4DK0 A;  1Q90 A;  1TKW B;  4LK1 C;  1I6V C;  4KKT A;  1H9M A;  4TKO B;  4GZY C;  1ZKO A;  2JEA I;  4BA2 I;  3VA7 A;  1CTM A;  3N6R A;  1K8O A;  1GUN A;  3QJY A;  3ND9 A;  1E2Z A;  1Z7T A;  5C0X G;  2O5J C;  1Z6H A;  2JEB I;  3D4R A;  5BN3 A;  5A35 A;  5KNC A;  4IFD G;  3OW7 A;  1GUS A;  3CRK C;  5JEA H;  5K36 H;  3PUZ A;  3MXU A;  1CFM A;  1E2V A;  3LWU A;  3D31 A;  4KN7 C;  4OO1 G;  4H13 C;  3T51 B;  1TU2 B;  1YNJ C;  3I73 A;  2AUJ D;  3T56 B;  4KHZ A; 
#chains in the Genus database with same CATH topology
 3UI2 A;  4HJ9 A;  1UUP A;  4HMI A;  5HGT A;  3NHH A;  1NR4 A;  2PNH A;  4JI3 L;  4MNO A;  2CW0 C;  4POG A;  3MAQ A;  1DD2 A;  2ATW A;  3DMU A;  2J7Z A;  4NKL A;  4MTK A;  4BA1 I;  1E0B A;  4KHV A;  2GVA A;  2KUM A;  2ZM6 Q;  1F2Y A;  4IOA A;  2B2U C;  3HRZ C;  3CRL C;  3S1N H;  2XRS D;  1L0W A;  1J5E Q;  3M4O H;  4DR1 Q;  4A3D H;  5JPM C;  4PMW A;  4B08 A;  4B3S Q;  1JOR A;  1V8Q A;  5KEE A;  4QMG A;  2EZV A;  2UXD L;  2R7Z H;  2L1B A;  1PDQ A;  2DY7 A;  2L4N A;  1PTO F;  5A2Q E;  1TQO A;  2N55 A;  1KNA A;  3UDF A;  2XNA C;  2ES2 A;  2HHH L;  5FO9 B;  1SR3 A;  2E5L Q;  3E0J A;  1RL2 A;  3CXC A;  4X65 L;  4ZAI A;  4OGQ C;  2Q2I A;  4RCN A;  2JA7 G;  1DXM A;  3V2T A;  4HAE A;  1FGU A;  4PMB A;  4DV7 Q;  3I55 A;  3F1Z A;  4JI0 Q;  2KQ3 A;  1RD9 D;  5LMU Q;  3GTM B;  5CV7 A;  2O2L D;  4QL5 A;  1JJG A;  4R4Q A;  1HFG A;  1PZK D;  4G57 A;  1SE2 A;  1GD7 A;  2NZO A;  4IUQ A;  2CFM A;  1SYC A;  2A6E D;  4A3B B;  4X62 L;  3H09 A;  3NBI A;  3HOY G;  2VB2 X;  1K8G A;  4IPC A;  3JAM i;  2NBF A;  5JVG 3;  1M90 C;  2RHS B;  2CW0 D;  1PTO H;  1L1O B;  4JI1 Q;  3CCQ A;  4DR6 Q;  1I4Q A;  2KHI A;  1VQH A;  4U67 3;  4ZYS A;  1IBL Q;  4DR3 L;  1FJG L;  1XNR Q;  2B8G A;  2EPB A;  5CC4 A;  2XWB B;  3E5S A;  5M5X H;  4A3G G;  1ESR A;  1EY4 A;  1G2S A;  1E3P A;  3T16 A;  4DK0 A;  3CHB D;  1EQT A;  3M7G A;  4DV5 Q;  2MP1 A;  4HJ7 A;  2K5V A;  4LFC L;  4XXE A;  1PH8 A;  4AQY L;  4O42 A;  1SND A;  4RAU C;  1VQO A;  1HRJ A;  2YV5 A;  1D8L A;  2PW7 A;  4DV4 L;  3NQI A;  1OO9 B;  2B2T A;  4N9T A;  1E2V A;  1SBB B;  4KN7 C;  1M1K C;  4FYD A;  4C3J G;  3PO3 B;  1TU2 B;  4DV3 L;  5I4D A;  2EYO A;  1MIU A;  5FJ8 H;  1OXU A;  4LF4 Q;  5C3E B;  2ZXP A;  3OWE B;  3PQI A;  4K5W A;  4X3T A;  5EBD A;  2ALY B;  3MEH A;  1HPC A;  5LL6 S;  4K0K L;  5I2Y A;  3W5O A;  1YEZ A;  2ZTD A;  4A3L H;  3DUZ A;  4C1N K;  3HZX A;  1STB A;  1GXD C;  1BCP B;  2K33 A;  1G29 1;  1UEB A;  5T1G A;  5DM7 3;  5KRU A;  3K8A A;  3AFP A;  2RHQ B;  3PCO B;  3J80 E;  1Q8I A;  1B9N A;  2K5N A;  1Y1W H;  1B4O A;  5ISR A;  5M3M B;  1KXL A;  1IKM A;  4P72 A;  4EGV A;  1A63 A;  1E24 A;  4JBM A;  1QNU A;  2XGT A;  1FR3 A;  3H0G G;  1I3Q B;  1KHI A;  4J1M A;  1VQA A;  4U68 A;  5IP9 G;  3LNN A;  2OF1 A;  2ZM6 L;  3MXP A;  2NVT B;  1YI2 A;  4YHH Q;  1A0I A;  2KVM A;  4N8F A;  5IP7 H;  1D2B A;  1XPR A;  2EYL A;  4DR1 L;  3A54 A;  3RN5 A;  2OT2 A;  2L0C A;  2Q2H A;  3GTM H;  2WV6 D;  3W1G A;  2FHT A;  4B3S L;  1V1O A;  4BY1 B;  2I0Q A;  2LY7 A;  3K59 A;  5IGE A;  3BZK A;  5ELN A;  2KCM A;  3JAM L;  1EU4 A;  2PQA B;  4TSS A;  3S24 A;  3FDT A;  1YJ9 A;  2Z8L A;  5BR8 Q;  2BDO A;  1R4Q B;  5G3L F;  1ZYR C;  1GVP A;  4DV7 L;  4B3M Q;  4JI0 L;  1TKW B;  5LMU L;  1X3E A;  3BZD B;  4Y52 H;  4EQO A;  4CKB A;  1S40 A;  4BA2 I;  3VA7 A;  1EZ8 A;  2BH8 A;  3TP8 A;  2F0K A;  3PIP A;  1DOL A;  3FKI B;  3A55 A;  4IFD G;  4DF7 A;  2XVS A;  1ENC A;  4A3B G;  4P74 A;  3NK9 A;  4HIM A;  3PO3 H;  1YNJ C;  4JI1 L;  4DR6 L;  3GTL H;  1MD2 D;  1IBL L;  2NZ1 D;  5C3E H;  2N49 A;  1OXX K;  1IW7 D;  2EYP A;  3L0O A;  4LF8 Q;  2B63 G;  1TWA H;  5D14 A;  1FGB D;  5ELO A;  3GD7 A;  4NPS A;  3PGZ A;  3E3X A;  4DV5 L;  2F3I A;  3S15 H;  3U58 A;  1HA6 A;  3TS2 A;  1XMO Q;  1CKO A;  4CBV A;  1FNU A;  2E2H B;  2PQE A;  4L5T A;  3OYY A;  2I5M X;  1W2B A;  2Y0S B;  1QOH A;  4DR2 Q;  4TRD A;  4ZCK A;  1JMC A;  5IYC H;  1I94 Q;  4KD4 A;  4X3K A;  1J8I A;  4Y7N H;  5M3M H;  1Y8P B;  2A6H C;  4LF4 L;  5E3F A;  4LUO A;  2IX1 A;  4OWW B;  3S1R B;  2O5I C;  3TME A;  3IKJ A;  2IPK D;  3GV6 A;  3T13 A;  4DR7 Q;  4CKC A;  4IFD J;  2NVY H;  4A75 A;  2BCO A;  1Y8O B;  3HOV G;  1SEB D;  1GHJ A;  2I46 A;  1E1T A;  2EYM A;  1VQD A;  3DWP A;  4IUT A;  4LF9 Q;  2EQS A;  3IAY A;  2R93 B;  1CUK A;  2F0W A;  5C3W A;  1FNV A;  3QB3 A;  3R2I A;  4A3K G;  1BVS A;  3J7Y W;  1D5M C;  4ODG A;  1XX8 A;  4X64 Q;  3JAM c;  3ZYY X;  1W6K A;  1SYB A;  3E9I A;  3RNU A;  1JOK A;  4KN4 C;  1YNJ D;  5LMN Q;  1YBY A;  1X3G A;  1T5X D;  2VXW A;  2Z6K A;  1NJI C;  3F2B A;  2RVL A;  3OIQ A;  2IJ0 A;  3OPO A;  4YHH L;  5GAH C;  3BU2 A;  1Z9F A;  2BE5 C;  3SEB A;  1LM0 A;  5JJK A;  1EY8 A;  4P2C B;  1X65 A;  3FP9 A;  4RFB A;  1PFM A;  1PFS A;  3I70 A;  1KLU D;  4GKK Q;  4KTA A;  1L1O A;  1L0X B;  4DUZ Q;  3MWY W;  4QY7 A;  1HNZ Q;  2EY5 A;  4GS3 A;  4BBR H;  2C35 B;  2IX3 A;  4BY1 G;  1AH9 A;  1VQN A;  4FO2 A;  5K36 H;  3W1B A;  5L37 A;  5M5W H;  4IPD A;  4EVO A;  2NTT A;  2JA8 H;  3I73 A;  2ZJQ A;  3HFZ B;  2PZU A;  1P8L A;  1ZEQ X;  1JR0 D;  4GN4 B;  4J8Q A;  3VDY A;  2DUD A;  3J81 j;  2IHE A;  2J4X A;  1C8C A;  5TSS A;  2UXC Q;  3WOF A;  4RH6 A;  5E4X A;  4DK3 C;  4HED A;  4B3M L;  2YYZ A;  3GTJ B;  3MEF A;  3HOU G;  4C3I B;  3HGB A;  1WD0 A;  3HKZ G;  2AWN A;  1EY5 A;  1RF2 D;  2RKS A;  2L55 A;  4A4I A;  4QQB X;  2Q8I B;  5E7N A;  5IT9 L;  2FMC A;  3R3O A;  2R7D A;  3FKI G;  3S9W A;  2Z0S A;  1XPO A;  2K5H A;  3T4A C;  4LJZ C;  2J0T D;  1VQ8 A;  1CSQ A;  2I5L X;  3J7Z C;  4A93 H;  3X3N A;  2MNA A;  4K2K A;  3PO2 H;  5IGG A;  3S14 H;  4DK6 C;  3I4N B;  4YWL A;  4MTN A;  2PZT A;  2QKI C;  1F9P A;  4LF8 L;  3I4M B;  4NP5 A;  1K83 H;  1BBW A;  1WTW A;  1S5F D;  1A2T A;  3CW2 C;  5ELC A;  2QEX A;  3F2U A;  3A7A B;  5IGF A;  5J3B A;  3QWN A;  1STH A;  1S3O A;  3OHX C;  1SE3 A;  5HGQ A;  2BA1 A;  2R93 H;  3E6Z X;  4DR2 L;  3SHL A;  3L9A X;  1OXV A;  1I94 L;  4A76 A;  4DA2 A;  4GNX B;  3VYR A;  1PRT C;  1AEX A;  2ZXO A;  4F88 A;  2E74 C;  2K03 A;  4HTH A;  3GDE A;  4IZ8 A;  1HQR D;  3A8I E;  2F0U A;  5C6A A;  2K4K A;  4DR7 L;  1EL0 A;  1LO5 D;  1SNM A;  2NVQ B;  3L3O C;  4C3H B;  3RZO B;  3ULL A;  2VB3 X;  1VF5 C;  3CPW A;  5EQ0 A;  1Q8K A;  4LF9 L;  1STN A;  1LT4 D;  2RA4 A;  2SEB D;  2E2I H;  1KDC A;  3NPP A;  2D0P A;  2EIF A;  1TY2 A;  2AMC B;  1C7Y A;  2PQA A;  1QVG A;  4A3J B;  5ELD A;  1H9M A;  3MFG A;  4C2M B;  1S4Z A;  1B53 A;  4X64 L;  3NXW A;  2JA9 A;  1XYI A;  1Z6H A;  1V9P A;  1TWG H;  3KLS A;  5LMN L;  4CJ0 B;  3NTI A;  1EQR A;  1TWC B;  4UDU C;  2A8V A;  4H13 C;  5HY6 A;  1NUC A;  2F0P A;  3GTG H;  1EYC A;  1UE1 A;  4KHZ A;  1QB5 D;  2VUM B;  3RLO A;  4GOP B;  2L11 A;  2RCN A;  3QG1 A;  1SNO A;  4A3M H;  2UXB Q;  4XDX A;  5C0X J;  1I6H B;  5EAY A;  2B2T C;  1IKL A;  1HUN A;  2YTY A;  4R8N A;  4RKL A;  4GKK L;  5IT9 c;  1HNZ L;  4DUZ L;  3KF6 B;  1GUO A;  3CCE A;  4LWC A;  4B9X A;  1JB3 A;  2HDM A;  3U50 C;  2DNE A;  1PRT D;  3DM3 A;  4I7Z C;  1LTB D;  4G7O C;  3GQB A;  1YHA A;  3DWQ A;  4BBS B;  3EVQ A;  2K5Q A;  3MTS A;  2H1E A;  4F7X A;  3BG3 A;  1WTP A;  1D6E C;  1JIC A;  4FF2 A;  4A3F B;  3FRP B;  1HA5 A;  1A3V A;  1PH5 A;  1V1P A;  1Z47 A;  1UE5 A;  2XSC A;  3I4N H;  3BYT B;  3OMC A;  2NN6 I;  3BVM A;  1U9R A;  3ERO A;  4KKS A;  1PRT F;  2JA5 G;  2N8N A;  4ILW A;  5EGT A;  3S1N B;  3BVG A;  3K5M A;  3M4O B;  4A3D B;  5FLM H;  2EJF C;  4APV A;  2CQO A;  4FXG C;  2AUK A;  2IW3 A;  5JEA G;  3HG9 A;  2PMZ B;  2RDG A;  2NYZ D;  1VQL A;  2LMC B;  4PV1 C;  4UP8 A;  1YIJ A;  2R7Z B;  1PYB A;  2H4O A;  1Q46 A;  4CJ1 B;  2SNS A;  4G7H C;  3FPU B;  3ERS X;  3K7A H;  5C4J H;  4FF1 A;  1QNK A;  3M3Y H;  2RF4 A;  5COY A;  3V96 A;  2NVQ H;  4DK1 A;  2NN6 H;  3VR3 A;  1NTG A;  1CM9 A;  1KDB A;  1SLJ A;  3A0J A;  3SE0 A;  5GAE C;  1WJJ A;  3IL8 A;  4IOC A;  4R4T A;  3STB C;  1VQ6 A;  1RDP D;  1SYE A;  1CHQ D;  2PCF B;  1JOQ A;  1NMG A;  5C4X G;  3BS1 A;  1JT8 A;  4WJW A;  3S16 H;  1LV9 A;  2F0F A;  1TS5 A;  3I90 A;  3KJO A;  2MFI A;  1K8O A;  1YJW A;  1CTM A;  3CME A;  2O4X A;  2B2W A;  4DNI A;  4FF4 A;  1LUZ A;  3D4R A;  3G7L A;  3A5U A;  4EQP A;  1GUS A;  3KOJ A;  3NBH B;  1PTO B;  1TWC H;  1QG7 A;  4A3E H;  1XXG A;  1A62 A;  2KED A;  4OIJ A;  3G6J B;  1VQJ A;  2MO0 A;  4C3H G;  1MSG A;  5M5X B;  2QW7 A;  3Q24 A;  4KKU A;  2CWA A;  1PYS B;  1EIY B;  3CCJ A;  1C0A A;  1M4V A;  4IUN A;  5AJ3 Q;  1JE5 A;  3I8Z A;  4H7B A;  3G71 A;  3TSS A;  3DXJ C;  3PUX A;  1CSP A;  4KY6 A;  3KF8 B;  1SE8 A;  4KI0 A;  4O1N A;  3VR2 A;  5EKK A;  3K57 A;  4RG1 A;  4GLX A;  4XTC S;  1NE3 A;  2D9U A;  2WAC A;  2IY5 B;  4A3F H;  3GP7 A;  1CK1 A;  3TRE A;  3U4Z A;  3K0X A;  1KAW A;  2UXB L;  2WAQ B;  4OL7 A;  4YCV A;  3CCL A;  3PUY A;  3UDI A;  5IYB G;  4RHS A;  4QJF A;  2KHJ A;  4HID A;  3BYY B;  1PTO D;  1NAP A;  1MI2 A;  3PIO A;  1DON A;  2KEC A;  1GHK A;  1B70 B;  2K5D A;  2WKD A;  1V43 A;  4CGY B;  2M9V A;  5JJZ A;  2K6A A;  3OOC A;  3GTP H;  1STE A;  1CQF A;  1Y1W B;  3UDX A;  2K7V A;  2K14 A;  3J81 L;  2QA4 A;  2R92 H;  3JAM E;  4BBS G;  4FP5 D;  2JA7 H;  2N3S A;  3NSW A;  2LFN A;  1J9O A;  4GNX A;  4X3U A;  3FVQ A;  5C44 B;  2L12 A;  2PYK A;  3KLW A;  1K8A C;  1D5Z C;  3RMH A;  4XT1 B;  3KBG A;  2JYO A;  3EN2 A;  4A3D G;  2Z6K C;  4RMF A;  2K28 A;  3ICE A;  5C4H A;  1QZH A;  4KKT A;  1VS0 A;  1WTR A;  3QJY A;  5FK9 C;  1D5X C;  4S3S A;  5A35 A;  1AE2 A;  2PMZ E;  4XQN A;  3D4W A;  1L1O C;  2RDF A;  1LTS D;  3NEN A;  3GTK H;  4OHJ A;  1TWH H;  1S5D D;  2WIN B;  1XTC D;  1ET9 A;  2Q2U A;  4IJL A;  1KD1 C;  1BO0 A;  1PH7 A;  3SGI A;  4CDE C;  3K5O A;  1F9R A;  3NEM A;  4MZ9 A;  2UUB Q;  2G9D A;  3AEV A;  2OWO A;  4C3J H;  1I4X A;  1E1O A;  1WI5 A;  1BDO A;  3KDF A;  2F03 A;  5AFW A;  4GOP A;  1FYC A;  3CQZ H;  2N88 A;  2UUC Q;  1SMY C;  1IXR A;  2Z4H A;  1WD1 A;  1EWH A;  3BDO A;  3TN2 A;  4ID6 A;  3NQT A;  4HJ5 A;  3H15 A;  3GTL B;  4F8M A;  4GKJ Q;  1W3S A;  4DV0 Q;  1SFO B;  4K8J A;  2JXM B;  4B3T Q;  4KLK A;  1T9H A;  3M85 A;  1QJO A;  1SDF A;  4EQN A;  1PVO A;  1TWA B;  2DNC A;  1ASZ A;  2EYJ A;  2Q8R E;  1AZQ A;  1KAA A;  4JG2 A;  1WCM G;  3CMA A;  2HD3 A;  4HCE A;  2C5C A;  2M2L A;  2WB1 B;  3S15 B;  2QDB A;  1QWY A;  4KV6 A;  5AJ3 L;  4DXF A;  3RLF A;  1C9O A;  4E6I A;  1BCP C;  4YCW A;  4DNT B;  3J81 c;  2NVX B;  4ALP A;  4RGT A;  1FNW A;  3H0G H;  1I4H A;  5IP9 H;  4OWX B;  1GUW A;  4Y7N B;  2CCZ A;  1AP0 A;  5C3X A;  5FLX L;  1DZ1 A;  1PFB A;  1BR9 A;  4WJ3 M;  2NVY B;  1KRT A;  4A3C H;  1UE6 A;  2GVB A;  4K5V A;  1QVC A;  1QUQ B;  1HUM A;  4HIK A;  2PNR C;  1CKN A;  1PXU A;  4OIK A;  3KBX A;  4UAI A;  5C44 H;  3W2D A;  4A3L G;  5ELE A;  1J5E L;  2AKW B;  3URY A;  2F0E A;  3HOZ H;  2IT1 A;  1MBY A;  3WDN A;  4QIW B;  1A3U A;  3LWE A;  5G3L D;  4EQ5 A;  4GZY C;  3B6Y A;  1SMY D;  1ZKO A;  1UEA B;  4HIO A;  1Y1W G;  5KNC A;  3DEP A;  2HCC A;  2XRQ D;  3ULP A;  2E5L L;  1SNC A;  3MVV A;  2OTL A;  1D1K A;  1BF4 A;  1AE3 A;  2DJG C;  4M1U B;  3I91 A;  3PUV A;  2EDG A;  4HSV A;  1STG A;  4FDB A;  5IP7 G;  4OO1 I;  5EPJ A;  3H91 A;  2EXZ A;  3J7A V;  3P7J A;  1KAB A;  4UHV A;  4DAM A;  4DV6 Q;  4BBR B;  1IYJ B;  2FIN B;  2V1C C;  3TP6 A;  4LUV A;  5A2Q L;  3D3R A;  1LT6 D;  1U4M A;  1L2F A;  4QF4 A;  5M5W B;  4IJH A;  1I5F A;  3K7U C;  2A68 C;  1B9M A;  1XJV A;  2EYH A;  4IQZ A;  2JA8 B;  3NTH A;  2A69 C;  3A8K E;  1Q12 A;  1ENA A;  1DJR D;  1B44 D;  1ESF A;  1SFO H;  1XNR L;  3NWS A;  1IL2 A;  1MKH A;  3JC6 6;  3CCM A;  4POF A;  4DNR B;  4OO1 H;  4O0A A;  3EA6 A;  2F0O A;  1X56 A;  5JVH 3;  2UUB L;  3C2P A;  2VL6 A;  2UXD Q;  4DFA A;  1IYU A;  4DKA C;  1VQM A;  2F0S A;  5FLX c;  2NVX H;  2UUC L;  1I50 H;  4YWK A;  1XTD A;  1JWU D;  4A93 B;  3DEO A;  4OEL B;  4KMU C;  3HOV H;  1HHV A;  4GKJ L;  3PO3 G;  1ET6 A;  1X32 A;  5FO8 B;  3PO2 B;  4DV0 L;  3S14 B;  4B3T L;  4R4C A;  5C3E G;  2KBN A;  3CD6 A;  1SE4 A;  5GAG C;  3U9S A;  1K28 A;  1K83 B;  1SNP A;  1ZYR D;  3VA5 A;  2F4V Q;  3ND8 A;  4A3K H;  3TBI B;  2G5D A;  2VQE Q;  2L9H A;  1JB7 A;  3BZC A;  2SOB A;  1O7I A;  2WB1 G;  1UWV A;  1AFP A;  2B2Y A;  3FMC A;  1M8A A;  1RHP A;  2ZXR A;  1LYL A;  3SK4 A;  2BDN A;  4UP7 A;  2KOL A;  1JQY D;  4DAY B;  2WB1 E;  1F2Z A;  3CU7 A;  5IYC G;  1VQE A;  2DJF C;  2JEA I;  4J15 A;  3ND9 A;  3S17 H;  2SDF A;  5M3M G;  3CC2 A;  3CCS A;  2GN5 A;  2XIW A;  1B7Y B;  2K01 A;  3R93 A;  2F0L A;  2X69 A;  2OQK A;  1KRS A;  4OEM B;  4DAP A;  1X3F A;  2F3V A;  3CCU A;  2RSN A;  3DHQ A;  2JQO A;  2E2I B;  2B2W C;  3HP3 A;  3J80 L;  5I9P A;  3NE5 B;  4XIG S;  3X3M A;  1QZG A;  3SDZ A;  1U5K A;  4GLA C;  1GO3 E;  1QIL A;  1MJE A;  2LKV A;  1O80 A;  4DAV A;  1R9T H;  1X6O A;  2XTI A;  1KL9 A;  4BXX H;  1TWG B;  3I4L A;  2I5H A;  1JJC B;  4V0B A;  2A6H D;  1N9W A;  5EJW A;  4MIU A;  4L5Q A;  3HOW H;  3GTG B;  2L15 A;  2N78 A;  3VR6 A;  3O13 A;  1WVL A;  4Q5V A;  2WP8 J;  5M3F H;  2L5T A;  3QIA A;  3HOU H;  5BR8 L;  4A3M B;  4H02 A;  4F87 A;  3H94 A;  1BBX C;  4OXP A;  1VF7 A;  2OEO A;  1ICW A;  1X3Q A;  1X55 A;  1A15 A;  1B2T A;  1X9N A;  5CV8 A;  4DV6 L;  1WTH A;  1YNN C;  2EJM A;  2P5Z X;  1Y1V H;  1AZP A;  4BBR G;  1VMP A;  3VR4 A;  1SNQ A;  2LXK A;  4IUR A;  4N9P A;  3RLN A;  3H3V C;  1H9S B;  1BXT A;  3OTO Q;  1EWI A;  1NSN S;  1U4P A;  3VYU A;  4TQU S;  1EFI D;  3CF5 A;  2F0H A;  1UNS A;  2B2V A;  4HJA A;  3FEW X;  1O7Y A;  5IYD G;  5GAD C;  1ONL A;  1QVF A;  5GQO A;  1Q82 C;  4QUC A;  1JWM D;  2BE5 D;  4BWG B;  5EKL A;  4HN7 A;  1WOC A;  1JC7 A;  4DGZ A;  2D5D A;  4RGM A;  3E9H A;  4KD3 A;  2QDL A;  3TZU A;  5I2X A;  2VQF Q;  4QCL A;  2HCI A;  3RZD H;  1G8Z D;  1XMO L;  2M00 A;  2YTX A;  1ILQ A;  2E8G A;  4ZLT F;  1TII D;  2Y0S G;  4K6D A;  3OWF A;  2A19 A;  3SK8 A;  4GNX C;  2XN9 C;  3K5N A;  2Y0S E;  1EEI D;  3HEJ A;  3BJU A;  1X3P A;  4BY7 H;  4ME5 A;  5C0X G;  3K7A B;  4OON A;  5C4J B;  3M3Y B;  1G2T A;  3T1Y Q;  4RWS C;  3PO2 G;  4LF7 Q;  1C4Q A;  1I4G A;  3LX0 A;  3HOX B;  3AQQ A;  2FFK B;  5CV4 A;  2ZTE A;  1EFW A;  2F4V L;  2VQE L;  1HR0 W;  1BBU A;  1PRT B;  1DOM A;  1R4P B;  5CV6 A;  2B3G A;  4ZKC B;  1WFQ A;  4CDD C;  2LXJ A;  1FVI A;  3AFQ A;  1XMQ Q;  1IBK Q;  4HJ8 A;  3S16 B;  1IBM Q;  2R93 G;  3ONA B;  5M5Y B;  4A3I B;  5LMN W;  5JAV A;  4DU9 A;  3MFY A;  4JV5 Q;  5J22 A;  1CT1 D;  1EY0 A;  3G6E A;  1K9M C;  2R3Z A;  4IO9 A;  2NWG A;  2ZJP A;  3VYT A;  1ML0 D;  4A3E B;  4LF5 Q;  4TVA B;  3DWA A;  1KIX A;  1K0R A;  1ICF B;  1STA A;  4EX5 A;  2JSO A;  2TSS A;  4PZ6 A;  4GOP C;  5BN4 A;  2B8F A;  2KHS A;  1TT2 A;  3SVM A;  1KC8 C;  2F0N A;  4R8I A;  1AN8 A;  5KIX A;  3Q23 A;  3H3V I;  3TEH B;  3SR1 A;  4DV1 Q;  3D6W A;  3PIP 3;  1VQF A;  4OWT B;  5DLQ E;  4NB3 A;  1S72 A;  1NBW A;  5IWA Q;  2LS0 1;  3Q8D A;  4JOI A;  1TS4 A;  4KHP Q;  1EY6 A;  3FPP A;  2A74 C;  3GV3 A;  1K8M A;  4XT3 B;  4JBK A;  5IOD A;  2D2C C;  3NUC A;  1H9K A;  4WJ4 A;  2ZT9 C;  1ZXT A;  2AQ1 B;  2UXC L;  2UU9 Q;  4A3M G;  2Z1C A;  3UDG A;  3H3V H;  3S1M H;  1CZW A;  1PH1 A;  1HXY D;  1SXT A;  1Q1B A;  1A8V A;  2MO1 A;  4C3I G;  2AHO B;  2QIL A;  4JI7 Q;  1TR5 A;  3QR8 A;  1TS2 A;  3G4S A;  2F4I A;  1EU3 A;  4BS9 A;  3OTO L;  1GOZ A;  3GTP B;  2ID0 A;  4KY5 A;  2JA6 H;  3J81 i;  5DEH A;  5CGK A;  2R92 B;  2MHV A;  4LUZ A;  1TWF H;  5COR A;  2JA7 B;  3N6R A;  4X65 Q;  1E22 A;  5DNF A;  1EZ6 A;  4KK7 A;  4ME3 A;  4AYB B;  3BVZ A;  4PQX A;  5CBE E;  3P75 A;  3WWV A;  2MPM A;  3HOX H;  3I4N G;  5CYU A;  5C4X H;  4L63 B;  3I4M G;  4FF3 A;  1PHJ A;  3WOE A;  4MN3 A;  3S2H B;  1SJH D;  4L5S A;  3HOY B;  5KYI A;  5FLM G;  2HUG A;  1N8R C;  1TXY A;  4CHT B;  4JC0 A;  3MXG A;  5M5Y H;  4A3I H;  1PYW D;  4IUV A;  4WRD A;  1MHW C;  1A2U A;  1KTK A;  3T1Y L;  5F2D A;  4P71 A;  2F0Q A;  1LT3 D;  5J39 A;  4LF7 L;  1FL0 A;  5KND A;  1VDZ A;  1N34 Q;  1JOO A;  3GTK B;  1HJP A;  1TWH B;  3TQY A;  2FMM A;  1XMQ L;  4C3J B;  1IBK L;  5LHY 1;  1IBM L;  2MGS A;  4L6T B;  4JW0 A;  4ZQ3 A;  1PMR A;  4A3J G;  4JPB W;  1WYD A;  3CQZ B;  4UP9 A;  5KYL A;  4JV5 L;  1D7Q A;  4MHE A;  4Z9C B;  3N52 A;  2YU9 H;  4OX9 Q;  4CDC C;  5D3D A;  4LF5 L;  4ULL A;  3AMU A;  2B39 A;  5I9O A;  3F2D A;  4A3E G;  1OTC A;  1HQM C;  2B29 A;  4C1N I;  1EWC A;  1LTI D;  1EYD A;  1LAB A;  1W6J A;  2VUM G;  4G7Z C;  1H9S A;  4FVM A;  4IAL A;  3ULJ A;  3STB D;  1KQS A;  2BOS A;  4DV1 L;  1YHQ A;  2A6E C;  1O7L A;  2E76 C;  1PLF A;  1T5E A;  1DM0 B;  1WTQ A;  3PF4 A;  2OXP A;  3H0G B;  5IWA L;  1EY7 A;  2RDH A;  1VQC A;  3R8B A;  1HNW Q;  4KHP L;  3MZ5 A;  1Q90 A;  1TVX A;  4LK1 C;  1V1Q A;  1I4P A;  1EY9 A;  1N36 Q;  1GUN A;  1J6Q A;  1SJE D;  2RCF A;  1Z7T A;  4YY3 Q;  2O5J C;  1BQQ T;  1YVC A;  2JEB I;  3QOL A;  4A3F G;  3OIP A;  2B2Y C;  1PZJ D;  2UU9 L;  3S1Q H;  1NCV A;  4FXK C;  1EQQ A;  3LWU A;  2E2J H;  3GO5 A;  1K0S A;  1BKB A;  4B9W A;  2RBM A;  3U9O A;  2EY2 A;  1PH3 A;  2K05 A;  4YCU A;  5CMD A;  3F2C A;  4X66 Q;  3HOZ B;  1ILP A;  4JI7 L;  3S2H H;  2Z4I A;  3UE1 A;  3HOY H;  2Q8T A;  4L8J A;  4PZ8 A;  1I4R A;  4K8I A;  2CH4 A;  4PZ7 A;  4JYA Q;  5I6W A;  3MC0 B;  4AIM A;  1Q86 C;  2R7Z G;  2R92 G;  4A3G H;  3VYS A;  1F2M A;  5ELB A;  4IPH A;  3GTO H;  2H5X A;  2F0V A;  1SMX A;  2R7F A;  4AYB G;  3I72 A;  2PI2 E;  4AYB E;  5IIF A;  3A5Z B;  3C3L A;  1PZI D;  4CDF C;  2AWO A;  1EYA A;  1BNZ A;  3PV0 A;  5BN5 A;  2F1M A;  3L2P A;  1UAP A;  3AB9 A;  1IYV A;  3CAM A;  5CV9 A;  2B63 B;  1WTX A;  5CBA E;  1MJC A;  2A73 B;  3KF6 A;  3M7N A;  1N34 L;  1SRU A;  1WCM H;  2EYF A;  3RR5 A;  1VCI A;  5CV5 A;  1YZ6 A;  4P75 A;  3ZJY C;  5IOC A;  3C1E A;  1ENF A;  2CH4 W;  3CC4 A;  2B2V C;  2VZA A;  1H9R A;  3W3A A;  1CKM A;  1Q7Y C;  1Y8N B;  1I50 B;  2K75 A;  2JN4 A;  4OX9 L;  2DGY A;  1K3B C;  3A8J E;  5KNB A;  3HOV B;  1CZG A;  3NP8 A;  1I6V C;  3D6C A;  3Q6S A;  5FJ8 G;  1B3Q A;  2ICE C;  4IUU A;  4G4K A;  5FKA C;  3V05 A;  4FNF A;  5BN3 A;  3K5L A;  5E1F A;  2WAQ G;  4KJN A;  2EY6 A;  4A3K B;  4ZK9 B;  4O2D A;  4Q0F A;  1LT5 D;  4P73 A;  2WAQ E;  4PNY A;  2R6G A;  1RIP A;  2A5H A;  4IFD I;  1F9S A;  2PI2 A;  1HZ9 A;  2PPB C;  2VY3 A;  2QGQ A;  1HNW L;  2WII B;  4XQJ A;  1SSO A;  3SXH A;  3CCR A;  1SYD A;  1U4R A;  1U4L A;  3S17 B;  2ICI A;  1IW7 C;  1N36 L;  3C46 A;  2F0D A;  1MSH A;  2F0J A;  4YY3 L;  5D65 A;  1SYF A;  3MA2 B;  3TRZ A;  4A3C G;  1RJT A;  3CCV A;  1S5B D;  2Z9H A;  4NXN Q;  4LFB Q;  3DLL A;  2WFW A;  1PH9 A;  5C44 G;  3P1H A;  1GKH A;  3EJI A;  3J80 i;  2KJX A;  4X66 L;  3A56 A;  4IFD H;  4IN3 A;  4R4I A;  3I7F A;  3NBH A;  1EEF D;  5JPN C;  4A3B H;  3HOZ G;  1BCP D;  3Q22 A;  2K52 A;  3NTK A;  5IT9 E;  1R9T B;  5IGC A;  5T1I A;  4JI4 Q;  4LF6 Q;  1EIG A;  4DN4 M;  2K5W A;  4JYA L;  4JI8 Q;  4B3R Q;  4IPG A;  2B63 H;  3HOW B;  1LTA D;  1BUV T;  5M3F B;  3A7L A;  4KJO A;  3HOU B;  4R4O A;  1UE7 A;  4DXG A;  2RSO A;  1GUT A;  4DR4 Q;  1BCP F;  1VQ5 A;  4H0L C;  3HKZ B;  1G6P A;  2K50 A;  3I2Z A;  4CJ2 C;  1WTV A;  2BH2 A;  1O78 A;  3BDC A;  3KF8 A;  1LTR D;  3S2D B;  4JOI C;  1VQB A;  1RTO A;  4GLV B;  1RKN A;  4JI6 Q;  1Y1V B;  5CR3 A;  3M4P A;  2KCC A;  1VQ7 A;  1JWS D;  5E4W C;  4J6H A;  4NXM Q;  1VQK A;  3A74 A;  3K81 C;  1EIF A;  2V4D A;  2JP1 A;  4UY8 C;  1IL8 A;  1U0L A;  4RA8 A;  1DGS A;  4M8A A;  3LGJ A;  1XPU A;  1E2Z A;  4C56 C;  1K73 C;  3OMG A;  4LAA A;  1G91 A;  1EUJ A;  1N33 Q;  3PIO 3;  1O7Z A;  1V1P B;  1MGS A;  4OO1 G;  1JJ2 A;  2B2U A;  3RZD B;  3KYH C;  2AUJ D;  4DR5 Q;  2NTS A;  4YIJ A;  4XQQ A;  1STY A;  4JI2 Q;  2NUC A;  3EFX D;  3TP7 A;  5EPK A;  1EOT A;  2F0G A;  3RN2 A;  4K6L A;  1LLR D;  1CQV A;  1OXS C;  4JCV E;  2FXQ A;  1I3Q H;  4GN5 A;  1D1I A;  2A68 D;  1S5C D;  4BY7 B;  2ASB A;  1Q81 C;  2EY1 A;  2NVT H;  2A69 D;  3KUP A;  2JK8 A;  3GTQ B;  4R9W A;  3D8G A;  3TZD A;  3RD4 A;  1HR0 Q;  3QOJ A;  3T53 B;  1E2W A;  1K3R A;  3DM1 A;  2JJQ A;  1IZ6 A;  4BY1 H;  2PW5 A;  1AW7 A;  4K2L A;  4JBJ A;  2F0T A;  3EIV A;  3ITP A;  3VR5 A;  5JJL A;  3M4Y A;  4RGN A;  1BOS A;  5I6Y A;  2QF7 A;  3TS0 A;  3K0Y A;  4KY7 A;  1B1Z A;  4DUY Q;  1JCK B;  1LTL A;  4QIW E;  2IX0 A;  1NMF A;  5IGB A;  1B50 A;  2QCP X;  1A6X A;  1CHP D;  4NXN L;  4LFB L;  3PMF A;  1A3T A;  2MUY A;  5K5P A;  3EBE A;  2JE6 I;  4AH6 A;  2IHF A;  4X6A H;  5J1Z A;  3Q0A A;  1VMC A;  1DYQ A;  2FJ2 A;  4V19 0;  3S2D H;  3PUW A;  3FKI H;  1YNX A;  2K32 A;  3F8T A;  1SAP A;  2IWH A;  4JI4 L;  4LF6 L;  4QGU A;  2D0O A;  3I3C A;  1EYG A;  5IYD H;  1SRO A;  3MXN B;  4JI8 L;  2EVB A;  3K58 A;  5C0X I;  2DY8 A;  4BXX G;  3KLR A;  1QE6 A;  2KA7 A;  4B3R L;  1ASY A;  3R2T A;  1Q1E A;  4LMQ D;  3AU7 A;  1KDA A;  5K36 G;  1KLG D;  1XNQ Q;  1H9J A;  2JA5 B;  3HOW G;  1HFN A;  2JA8 G;  1HZB A;  4DR4 L;  5M3F G;  4ABN A;  4PMC A;  3OW7 A;  2E2D C;  2PZW A;  2E2H H;  3S1M B;  5EKI A;  2KEN A;  1CFM A;  2AQ2 B;  2F52 A;  2R61 A;  3D31 A;  1VQ4 A;  3T51 B;  3HKZ E;  4HSP A;  4JI6 L;  2KEE A;  2MJ8 A;  3BDL A;  1EOV A;  3ER0 A;  3TDQ A;  1Y1V G;  5NUC A;  1HNX Q;  5C0X H;  2CWP A;  4NXM L;  2K1B A;  2D62 A;  2VNU D;  2JA6 B;  1QUQ A;  2NZH A;  1NR2 A;  2HDL A;  2RQX A;  5IE8 A;  3S1R H;  1HTP A;  2KCT A;  4JK1 C;  1TWF B;  4RHR A;  1DOK A;  4LFA Q;  3I4O A;  4A93 G;  4YWM A;  3T1H Q;  2ZTC A;  1S5E D;  4JVZ A;  1ROD A;  1EIH A;  1HCZ A;  4JI5 Q;  1PV4 A;  3GTQ H;  3UE0 A;  5C4X B;  1B3A A;  3J80 c;  3P20 A;  1N33 L;  3IFT A;  4WFN 3;  3G48 A;  4HR7 B;  4ZUI A;  4LW1 A;  4DR5 L;  1OXT A;  3KJP A;  4PG3 A;  1LAC A;  4JI2 L;  2OTJ A;  1YNN D;  5LL6 X;  2ZJR A;  2CQA A;  1X54 A;  2Z6B A;  3IFD A;  1IHZ A;  2DN8 A;  3M9B A;  4IUP A;  3K6O A;  4ZRZ A;  5GRO A;  2BA0 A;  3M4Q A;  3KK7 A;  3J7A 5;  4QUF A;  4DV2 Q;  2ENB A;  1HTL D;  5C4Z A;  1CA5 A;  5IGD A;  2IL8 A;  4BY7 G;  2SNM A;  1B8A A;  2X6G A;  1TY0 A;  1LTG D;  1VQI A;  2UUA Q;  1TS3 A;  1HR0 L;  1QCB D;  2LSS A;  4FXD A;  5FO7 B;  1YHB A;  3NEL A;  3L7Z C;  4RCO A;  2PO4 A;  1Y69 U;  3ERQ A;  4CKE A;  4UPA A;  1F2L A;  1N32 Q;  1JE4 A;  4NMZ A;  4RGO S;  3TP5 A;  2QEJ C;  3J81 E;  3KDF B;  2EE1 A;  4DUY L;  5DM6 3;  2YU9 B;  4JI3 Q;  1II3 A;  1CI3 M;  5C5M A;  2I07 B;  1C48 A;  4DPG A;  4ZUJ A;  1F9Q A;  2F0M A;  4X3S A;  1F77 A;  4XYQ A;  1CA6 A;  2JA5 H;  1Q3L A;  1G51 A;  4TKO B;  2C9O A;  2OCE A;  3SK5 A;  5KGU A;  3GTJ H;  4NDX A;  1HZA A;  3E0E A;  4C3I H;  1P16 A;  3D4D A;  2HIX A;  4RKB A;  1NY4 A;  5JEA H;  2EXD A;  1G6Z A;  2F3W A;  3MXU A;  3PUZ A;  4NW2 A;  4N8X 1;  3FHW A;  5HUR A;  3T56 B;  1PA6 A;  3K80 C;  4H44 C;  3EQL C;  3U4V A;  3CC7 A;  4I7A A;  1KNE A;  1VQP A;  2VW9 A;  1RTN A;  2K04 A;  2HHH Q;  1XNQ L;  1YJN A;  1HH2 P;  2HIV A;  3I4M H;  2AQ3 B;  4LNQ A;  2VS1 A;  2CVR A;  5IY0 A;  3KLS X;  3IRB A;  3S1Q B;  4DAY A;  4HCS A;  2E2J B;  5D3I B;  5EBC A;  1PH6 A;  3H6M A;  3AYH B;  3CP0 A;  5DAU A;  2VQF L;  3OW2 A;  1SN8 A;  3QO2 A;  4GN3 B;  1CKN B;  1VQG A;  1HNX L;  2KCN A;  1FD7 D;  1YIT A;  3CKI B;  4X62 Q;  3D0F A;  1VQ9 A;  2JA6 G;  1GM5 A;  3J7A F;  4LFA L;  3KFU A;  4C3H H;  4JBW A;  2TMP A;  4A3G B;  3T1H L;  3RZO H;  4DR3 Q;  1FJG Q;  5EPL A;  2G9H D;  3C1F A;  4JI5 L;  1Y14 B;  3HKS A;  3GTO B;  3PSI A;  3HS0 C;  5M9O A;  1PTO C;  5JOB A;  2HQL A;  3HOX G;  2NN6 G;  2YTV A;  1GUG A;  2E75 C;  1PH2 A;  4R1J A;  4LFC Q;  1NNX A;  5C5L A;  1PFN A;  4A3J H;  4C2M H;  4AQY Q;  2MQH A;  2CKZ B;  3CPF A;  4DV4 Q;  1XWE A;  1EQV A;  1WTO A;  3I56 A;  4DV3 Q;  3OSO A;  4HMJ A;  5JEA J;  4DV2 L;  4A3I G;  1L0Y B;  2HT1 A;  1SYG A;  5FLX E;  1DCZ A;  1LTT D;  2VUM H;  1H95 A;  1GJX A;  4QB4 A;  4I65 A;  5IYB H;  4K14 A;  2EJG C;  1PH4 A;  1WCM B;  4WOR A;  4ZKB B;  5ELF A;  3RUZ A;  2UUA L;  4K0K Q;  1I6H H;  5JJI A;  4L5R C;  4K5X A;  2CHB D;  2OQ0 A;  2A1A A;  3MXN A;  2X6L A;  2EOT A;  3NWT A;  5H1S E;  1E7Z A;  2Q2T A;  2GA4 B;  2HQE A;  2WKC A;  1HZC A;  3SK6 A;  1RCV D;  3CRK C;  5FOB B;  2NB0 A;  1N32 L;  2F0I A;  4XYO A;  3PF5 A;  2XWJ B;  3MHB A;  4BBS H; 
#chains in the Genus database with same CATH homology
 3UI2 A;  1UUP A;  4HMI A;  5HGT A;  3NHH A;  1NR4 A;  2CW0 C;  1DD2 A;  3MAQ A;  3DMU A;  2J7Z A;  4NKL A;  4BA1 I;  1E0B A;  4KHV A;  2KUM A;  1F2Y A;  2B2U C;  3HRZ C;  3CRL C;  2XRS D;  5JPM C;  4PMW A;  4B08 A;  1JOR A;  1V8Q A;  5KEE A;  4QMG A;  2EZV A;  2L1B A;  1PDQ A;  2DY7 A;  2L4N A;  1PTO F;  5A2Q E;  1TQO A;  2N55 A;  1KNA A;  2XNA C;  5FO9 B;  3E0J A;  4ZAI A;  4OGQ C;  4RCN A;  1DXM A;  3V2T A;  4HAE A;  4PMB A;  2KQ3 A;  1RD9 D;  3GTM B;  5CV7 A;  2O2L D;  1HFG A;  1PZK D;  4G57 A;  1SE2 A;  4IUQ A;  1SYC A;  2A6E D;  4A3B B;  3H09 A;  3NBI A;  2VB2 X;  2NBF A;  5JVG 3;  2CW0 D;  1PTO H;  1I4Q A;  4U67 3;  4ZYS A;  2B8G A;  2EPB A;  5CC4 A;  2XWB B;  3E5S A;  1ESR A;  1EY4 A;  1G2S A;  3T16 A;  4DK0 A;  3CHB D;  1EQT A;  3M7G A;  2MP1 A;  4XXE A;  4O42 A;  1SND A;  4RAU C;  1HRJ A;  2PW7 A;  3NQI A;  1OO9 B;  2B2T A;  4N9T A;  1E2V A;  1SBB B;  4KN7 C;  4FYD A;  4C3J G;  3PO3 B;  1TU2 B;  5I4D A;  2EYO A;  1OXU A;  5C3E B;  2ZXP A;  3OWE B;  4K5W A;  4X3T A;  5EBD A;  3MEH A;  1HPC A;  5LL6 S;  5I2Y A;  3DUZ A;  4C1N K;  3HZX A;  1STB A;  1GXD C;  1BCP B;  2K33 A;  1G29 1;  5T1G A;  5DM7 3;  5KRU A;  3J80 E;  1Q8I A;  1B9N A;  1B4O A;  5ISR A;  5M3M B;  1IKM A;  4EGV A;  1QNU A;  1FR3 A;  1I3Q B;  4J1M A;  4U68 A;  3LNN A;  2OF1 A;  3MXP A;  2NVT B;  2KVM A;  1D2B A;  2EYL A;  3A54 A;  2OT2 A;  2L0C A;  2WV6 D;  2FHT A;  4BY1 B;  1V1O A;  2LY7 A;  3K59 A;  5IGE A;  3JAM L;  1EU4 A;  4TSS A;  3FDT A;  2Z8L A;  2BDO A;  1R4Q B;  5G3L F;  1ZYR C;  1TKW B;  3BZD B;  4EQO A;  4CKB A;  4BA2 I;  3VA7 A;  1EZ8 A;  3TP8 A;  2F0K A;  1DOL A;  3FKI B;  3A55 A;  4IFD G;  4DF7 A;  2XVS A;  1ENC A;  3NK9 A;  1YNJ C;  1MD2 D;  2NZ1 D;  1OXX K;  1IW7 D;  2EYP A;  5D14 A;  1FGB D;  3GD7 A;  1HA6 A;  4CBV A;  1FNU A;  2E2H B;  2PQE A;  2Y0S B;  1QOH A;  4TRD A;  4KD4 A;  4X3K A;  1J8I A;  1Y8P B;  2A6H C;  5E3F A;  2IX1 A;  3S1R B;  2O5I C;  3TME A;  3IKJ A;  2IPK D;  3GV6 A;  3T13 A;  4CKC A;  4IFD J;  2BCO A;  1Y8O B;  1SEB D;  1GHJ A;  2I46 A;  2EYM A;  3DWP A;  4IUT A;  3IAY A;  2R93 B;  2F0W A;  5C3W A;  1FNV A;  3QB3 A;  3R2I A;  3J7Y W;  1D5M C;  4ODG A;  1XX8 A;  3ZYY X;  1W6K A;  1SYB A;  1JOK A;  4KN4 C;  1YNJ D;  1T5X D;  2VXW A;  2RVL A;  3OIQ A;  2IJ0 A;  3OPO A;  2BE5 C;  3SEB A;  1EY8 A;  4P2C B;  4RFB A;  1PFM A;  3I70 A;  1KLU D;  4KTA A;  1L0X B;  3MWY W;  2EY5 A;  2IX3 A;  4FO2 A;  5K36 H;  4EVO A;  2NTT A;  3I73 A;  2PZU A;  1ZEQ X;  1JR0 D;  4J8Q A;  2J4X A;  1C8C A;  5TSS A;  3WOF A;  4RH6 A;  5E4X A;  4HED A;  2YYZ A;  3GTJ B;  4C3I B;  3HGB A;  1WD0 A;  2AWN A;  1EY5 A;  1RF2 D;  2RKS A;  2L55 A;  2Q8I B;  5IT9 L;  2FMC A;  3R3O A;  3S9W A;  3T4A C;  4LJZ C;  2J0T D;  3X3N A;  4K2K A;  5IGG A;  3I4N B;  2PZT A;  2QKI C;  1F9P A;  3I4M B;  4NP5 A;  1WTW A;  1S5F D;  1A2T A;  5ELC A;  3F2U A;  3A7A B;  5IGF A;  3QWN A;  1STH A;  3OHX C;  1SE3 A;  2BA1 A;  3E6Z X;  3SHL A;  3L9A X;  1OXV A;  4DA2 A;  3VYR A;  1PRT C;  1AEX A;  2ZXO A;  4F88 A;  2E74 C;  2K03 A;  4HTH A;  4IZ8 A;  1HQR D;  3A8I E;  2F0U A;  5C6A A;  1EL0 A;  1LO5 D;  1SNM A;  2NVQ B;  3L3O C;  4C3H B;  3RZO B;  2VB3 X;  1VF5 C;  5EQ0 A;  1STN A;  1LT4 D;  2RA4 A;  2SEB D;  1KDC A;  3NPP A;  1TY2 A;  4A3J B;  5ELD A;  1H9M A;  3MFG A;  4C2M B;  1S4Z A;  1B53 A;  3NXW A;  1XYI A;  1Z6H A;  3KLS A;  4CJ0 B;  3NTI A;  1TWC B;  4UDU C;  4H13 C;  1NUC A;  2F0P A;  1EYC A;  4KHZ A;  1QB5 D;  2VUM B;  2L11 A;  3QG1 A;  1SNO A;  4XDX A;  5C0X J;  1I6H B;  2B2T C;  1IKL A;  1HUN A;  4RKL A;  4R8N A;  1GUO A;  4B9X A;  1JB3 A;  2HDM A;  2DNE A;  1PRT D;  4I7Z C;  1LTB D;  4G7O C;  3GQB A;  3DWQ A;  4BBS B;  3EVQ A;  2K5Q A;  3MTS A;  2H1E A;  4F7X A;  3BG3 A;  1WTP A;  1D6E C;  1JIC A;  4FF2 A;  4A3F B;  3FRP B;  1HA5 A;  1A3V A;  1V1P A;  1Z47 A;  2XSC A;  3BYT B;  3OMC A;  2NN6 I;  3BVM A;  1U9R A;  3ERO A;  4KKS A;  1PRT F;  4ILW A;  5EGT A;  3S1N B;  3BVG A;  3K5M A;  3M4O B;  4A3D B;  2EJF C;  4FXG C;  2AUK A;  2IW3 A;  5JEA G;  3HG9 A;  2PMZ B;  2RDG A;  2NYZ D;  2LMC B;  4PV1 C;  2R7Z B;  2H4O A;  4CJ1 B;  2SNS A;  4G7H C;  3FPU B;  4FF1 A;  1QNK A;  5COY A;  3V96 A;  4DK1 A;  2NN6 H;  3VR3 A;  1CM9 A;  1KDB A;  3SE0 A;  3IL8 A;  1RDP D;  1SYE A;  1CHQ D;  2PCF B;  1JOQ A;  3BS1 A;  4WJW A;  1LV9 A;  2F0F A;  1TS5 A;  3I90 A;  1K8O A;  1CTM A;  2O4X A;  2B2W A;  4FF4 A;  3D4R A;  3G7L A;  4EQP A;  1GUS A;  1PTO B;  1QG7 A;  1XXG A;  2KED A;  4OIJ A;  3G6J B;  4C3H G;  1MSG A;  5M5X B;  3Q24 A;  4KKU A;  1M4V A;  4IUN A;  3I8Z A;  4H7B A;  3TSS A;  3DXJ C;  3PUX A;  4KY6 A;  4KI0 A;  4O1N A;  3VR2 A;  5EKK A;  3K57 A;  4XTC S;  2D9U A;  2WAC A;  3GP7 A;  1CK1 A;  2WAQ B;  4OL7 A;  3PUY A;  4RHS A;  3BYY B;  1PTO D;  1NAP A;  1MI2 A;  1DON A;  2KEC A;  1GHK A;  2K5D A;  2WKD A;  1V43 A;  4CGY B;  2M9V A;  5JJZ A;  2K6A A;  3OOC A;  1STE A;  1CQF A;  1Y1W B;  2K7V A;  3J81 L;  3JAM E;  4FP5 D;  3NSW A;  2LFN A;  1J9O A;  4X3U A;  3FVQ A;  5C44 B;  2L12 A;  2PYK A;  1D5Z C;  3RMH A;  4XT1 B;  3KBG A;  2JYO A;  2K28 A;  5C4H A;  4KKT A;  1WTR A;  3QJY A;  5FK9 C;  1D5X C;  5A35 A;  4S3S A;  4XQN A;  3D4W A;  2RDF A;  1LTS D;  4OHJ A;  1S5D D;  2WIN B;  1XTC D;  1ET9 A;  1BO0 A;  3K5O A;  1F9R A;  2G9D A;  1I4X A;  1BDO A;  2F03 A;  5AFW A;  1FYC A;  2N88 A;  1SMY C;  2Z4H A;  1WD1 A;  1EWH A;  3BDO A;  3TN2 A;  4ID6 A;  3NQT A;  3GTL B;  4F8M A;  1SFO B;  4K8J A;  2JXM B;  3M85 A;  1QJO A;  1SDF A;  4EQN A;  1TWA B;  2DNC A;  2EYJ A;  2Q8R E;  1AZQ A;  1KAA A;  4HCE A;  2C5C A;  2M2L A;  2WB1 B;  3S15 B;  2QDB A;  1QWY A;  4KV6 A;  4DXF A;  3RLF A;  4E6I A;  1BCP C;  4DNT B;  2NVX B;  4RGT A;  1FNW A;  1I4H A;  1GUW A;  4Y7N B;  1AP0 A;  5C3X A;  5FLX L;  1DZ1 A;  1PFB A;  1BR9 A;  2NVY B;  4K5V A;  1HUM A;  2PNR C;  1PXU A;  4OIK A;  3KBX A;  4UAI A;  3W2D A;  5ELE A;  3URY A;  2F0E A;  2IT1 A;  1MBY A;  3WDN A;  4QIW B;  1A3U A;  3LWE A;  5G3L D;  4GZY C;  1SMY D;  1ZKO A;  1UEA B;  5KNC A;  3DEP A;  2HCC A;  2XRQ D;  1SNC A;  3MVV A;  1D1K A;  1BF4 A;  4M1U B;  3I91 A;  3PUV A;  2EDG A;  4HSV A;  1STG A;  4OO1 I;  5EPJ A;  3H91 A;  2EXZ A;  3J7A V;  3P7J A;  1KAB A;  4BBR B;  2FIN B;  3TP6 A;  5A2Q L;  3D3R A;  1LT6 D;  1U4M A;  4QF4 A;  5M5W B;  2A68 C;  2JA8 B;  1B9M A;  2EYH A;  4IQZ A;  3NTH A;  2A69 C;  3A8K E;  1Q12 A;  1ENA A;  1DJR D;  1B44 D;  1ESF A;  3NWS A;  4DNR B;  4OO1 H;  3EA6 A;  2F0O A;  5JVH 3;  3C2P A;  4DFA A;  1IYU A;  2F0S A;  1JWU D;  4A93 B;  3DEO A;  4KMU C;  1HHV A;  1ET6 A;  1X32 A;  5FO8 B;  3PO2 B;  3S14 B;  1SE4 A;  3U9S A;  1K83 B;  1SNP A;  1ZYR D;  3VA5 A;  3ND8 A;  3TBI B;  2L9H A;  2SOB A;  1AFP A;  2B2Y A;  3FMC A;  1M8A A;  1RHP A;  2ZXR A;  3SK4 A;  2BDN A;  2KOL A;  1JQY D;  1F2Z A;  3CU7 A;  2JEA I;  3ND9 A;  2SDF A;  2XIW A;  2K01 A;  3R93 A;  2F0L A;  2X69 A;  4DAP A;  2F3V A;  2RSN A;  3DHQ A;  2E2I B;  2B2W C;  3HP3 A;  3J80 L;  5I9P A;  3NE5 B;  4XIG S;  3X3M A;  3SDZ A;  1QIL A;  2LKV A;  1O80 A;  4DAV A;  1TWG B;  3I4L A;  4V0B A;  2A6H D;  5EJW A;  4MIU A;  3GTG B;  3VR6 A;  3O13 A;  1WVL A;  4Q5V A;  2WP8 J;  2L5T A;  3QIA A;  4A3M B;  4F87 A;  3H94 A;  1BBX C;  1VF7 A;  2OEO A;  1ICW A;  1X3Q A;  1A15 A;  1B2T A;  5CV8 A;  1YNN C;  2EJM A;  1AZP A;  1VMP A;  3VR4 A;  1SNQ A;  4IUR A;  4N9P A;  3H3V C;  1H9S B;  1BXT A;  1NSN S;  1U4P A;  3VYU A;  4TQU S;  1EFI D;  2F0H A;  1UNS A;  2B2V A;  3FEW X;  1O7Y A;  1ONL A;  4QUC A;  1JWM D;  2BE5 D;  4BWG B;  5EKL A;  4HN7 A;  1JC7 A;  4DGZ A;  2D5D A;  4RGM A;  5I2X A;  4KD3 A;  3TZU A;  4QCL A;  2HCI A;  1G8Z D;  2M00 A;  1ILQ A;  4ZLT F;  1TII D;  4K6D A;  3OWF A;  3SK8 A;  2XN9 C;  3K5N A;  1EEI D;  3HEJ A;  1X3P A;  4ME5 A;  5C0X G;  3K7A B;  5C4J B;  3M3Y B;  1G2T A;  4RWS C;  1C4Q A;  1I4G A;  3LX0 A;  3HOX B;  2FFK B;  5CV4 A;  1PRT B;  1DOM A;  1R4P B;  5CV6 A;  4ZKC B;  3S16 B;  3ONA B;  5M5Y B;  4A3I B;  5JAV A;  4DU9 A;  3MFY A;  5J22 A;  1CT1 D;  1EY0 A;  2R3Z A;  2NWG A;  3VYT A;  1ML0 D;  4A3E B;  3DWA A;  1STA A;  2JSO A;  2TSS A;  5BN4 A;  2B8F A;  2KHS A;  1TT2 A;  3SVM A;  2F0N A;  4R8I A;  1AN8 A;  5KIX A;  3Q23 A;  3SR1 A;  3D6W A;  3PIP 3;  2LS0 1;  1TS4 A;  1EY6 A;  3FPP A;  2A74 C;  3GV3 A;  1K8M A;  4XT3 B;  5IOD A;  2D2C C;  3NUC A;  1H9K A;  2ZT9 C;  1ZXT A;  2AQ1 B;  2Z1C A;  1CZW A;  1HXY D;  1SXT A;  1Q1B A;  4C3I G;  2QIL A;  1TR5 A;  1TS2 A;  2F4I A;  1EU3 A;  4BS9 A;  1GOZ A;  3GTP B;  2ID0 A;  4KY5 A;  5DEH A;  5CGK A;  2R92 B;  2MHV A;  5COR A;  2JA7 B;  3N6R A;  5DNF A;  1EZ6 A;  4KK7 A;  4AYB B;  3BVZ A;  4PQX A;  5CBE E;  3P75 A;  2MPM A;  5CYU A;  4L63 B;  4FF3 A;  3WOE A;  4MN3 A;  3S2H B;  1SJH D;  3HOY B;  5KYI A;  2HUG A;  4CHT B;  3MXG A;  1PYW D;  4IUV A;  4WRD A;  1A2U A;  1KTK A;  5F2D A;  2F0Q A;  1LT3 D;  5J39 A;  5KND A;  1VDZ A;  1JOO A;  3GTK B;  1TWH B;  2FMM A;  4C3J B;  5LHY 1;  2MGS A;  4L6T B;  4ZQ3 A;  1PMR A;  3CQZ B;  5KYL A;  4MHE A;  4Z9C B;  3N52 A;  5D3D A;  4ULL A;  3AMU A;  2B39 A;  5I9O A;  1HQM C;  4C1N I;  1EWC A;  1LTI D;  1EYD A;  1LAB A;  1W6J A;  4G7Z C;  1H9S A;  4FVM A;  4IAL A;  2BOS A;  2A6E C;  1O7L A;  2E76 C;  1PLF A;  1T5E A;  1DM0 B;  1WTQ A;  2OXP A;  3H0G B;  1EY7 A;  2RDH A;  3R8B A;  3MZ5 A;  1Q90 A;  1TVX A;  4LK1 C;  1I4P A;  1EY9 A;  1GUN A;  1SJE D;  1Z7T A;  2O5J C;  1BQQ T;  3QOL A;  2JEB I;  3OIP A;  2B2Y C;  1PZJ D;  1NCV A;  4FXK C;  3LWU A;  3GO5 A;  4B9W A;  2RBM A;  3U9O A;  2EY2 A;  2K05 A;  5CMD A;  3HOZ B;  1ILP A;  2Z4I A;  2Q8T A;  4L8J A;  1I4R A;  4K8I A;  5I6W A;  3MC0 B;  3VYS A;  1F2M A;  5ELB A;  2F0V A;  3I72 A;  5IIF A;  3C3L A;  1PZI D;  2AWO A;  1EYA A;  1BNZ A;  3PV0 A;  5BN5 A;  2F1M A;  1UAP A;  3AB9 A;  1IYV A;  5CV9 A;  2B63 B;  1WTX A;  5CBA E;  2A73 B;  3M7N A;  2EYF A;  1VCI A;  5CV5 A;  5IOC A;  3C1E A;  1ENF A;  2B2V C;  1H9R A;  3W3A A;  1Y8N B;  1I50 B;  3A8J E;  5KNB A;  3HOV B;  1CZG A;  3NP8 A;  1I6V C;  3D6C A;  3Q6S A;  2ICE C;  4IUU A;  4G4K A;  5FKA C;  3V05 A;  4FNF A;  5BN3 A;  3K5L A;  5E1F A;  4KJN A;  2EY6 A;  4A3K B;  4ZK9 B;  4Q0F A;  1LT5 D;  4PNY A;  2R6G A;  2A5H A;  4IFD I;  1F9S A;  2PPB C;  2WII B;  4XQJ A;  1SSO A;  3SXH A;  1SYD A;  1U4R A;  1U4L A;  3S17 B;  2ICI A;  1IW7 C;  3C46 A;  2F0D A;  1MSH A;  2F0J A;  5D65 A;  1SYF A;  3MA2 B;  1RJT A;  1S5B D;  3P1H A;  3EJI A;  2KJX A;  4IFD H;  3A56 A;  4IN3 A;  3NBH A;  1EEF D;  5JPN C;  1BCP D;  3Q22 A;  1R9T B;  3NTK A;  5IT9 E;  5IGC A;  5T1I A;  1EIG A;  4DN4 M;  2K5W A;  3HOW B;  1LTA D;  1BUV T;  5M3F B;  3A7L A;  4KJO A;  3HOU B;  4DXG A;  2RSO A;  1GUT A;  1BCP F;  4H0L C;  3HKZ B;  4CJ2 C;  1WTV A;  1O78 A;  3BDC A;  3KF8 A;  1LTR D;  3S2D B;  1RTO A;  1RKN A;  1Y1V B;  5CR3 A;  2KCC A;  1JWS D;  5E4W C;  4J6H A;  2V4D A;  2JP1 A;  1IL8 A;  4RA8 A;  4M8A A;  1E2Z A;  4C56 C;  3OMG A;  4LAA A;  1G91 A;  3PIO 3;  1O7Z A;  1V1P B;  1MGS A;  4OO1 G;  2B2U A;  3RZD B;  2AUJ D;  2NTS A;  4YIJ A;  4XQQ A;  1STY A;  2NUC A;  3EFX D;  3TP7 A;  5EPK A;  1EOT A;  2F0G A;  4K6L A;  1LLR D;  1CQV A;  1OXS C;  1D1I A;  2A68 D;  1S5C D;  4BY7 B;  2EY1 A;  2A69 D;  3KUP A;  3GTQ B;  4R9W A;  3D8G A;  3TZD A;  3RD4 A;  3QOJ A;  3T53 B;  1E2W A;  3DM1 A;  2PW5 A;  1AW7 A;  4K2L A;  2F0T A;  3VR5 A;  3ITP A;  3M4Y A;  4RGN A;  1BOS A;  5I6Y A;  2QF7 A;  3K0Y A;  4KY7 A;  1B1Z A;  1JCK B;  2IX0 A;  5IGB A;  1B50 A;  2QCP X;  1A6X A;  1CHP D;  3PMF A;  1A3T A;  2MUY A;  5K5P A;  2JE6 I;  5J1Z A;  3Q0A A;  1VMC A;  1DYQ A;  2FJ2 A;  4V19 0;  3PUW A;  2K32 A;  1SAP A;  2IWH A;  3I3C A;  2EVB A;  3K58 A;  5C0X I;  2DY8 A;  3KLR A;  1QE6 A;  2KA7 A;  3R2T A;  1Q1E A;  4LMQ D;  3AU7 A;  1KDA A;  5K36 G;  1KLG D;  1H9J A;  2JA5 B;  1HFN A;  4ABN A;  4PMC A;  3OW7 A;  2E2D C;  2PZW A;  3S1M B;  5EKI A;  2R61 A;  1CFM A;  2AQ2 B;  3D31 A;  3T51 B;  4HSP A;  2KEE A;  2MJ8 A;  3BDL A;  3TDQ A;  5NUC A;  5C0X H;  2K1B A;  2D62 A;  2VNU D;  2JA6 B;  2RQX A;  1NR2 A;  2HDL A;  1HTP A;  4JK1 C;  1TWF B;  4RHR A;  1DOK A;  1S5E D;  1ROD A;  1EIH A;  1HCZ A;  5C4X B;  1B3A A;  3P20 A;  3IFT A;  4WFN 3;  4HR7 B;  4ZUI A;  1OXT A;  1LAC A;  1YNN D;  5LL6 X;  2CQA A;  3IFD A;  1IHZ A;  2DN8 A;  4IUP A;  3K6O A;  4ZRZ A;  2BA0 A;  3KK7 A;  4QUF A;  2ENB A;  1HTL D;  5C4Z A;  1CA5 A;  5IGD A;  2IL8 A;  2SNM A;  2X6G A;  1TY0 A;  1LTG D;  1TS3 A;  1QCB D;  4FXD A;  5FO7 B;  3L7Z C;  4RCO A;  2PO4 A;  1Y69 U;  3ERQ A;  4CKE A;  1F2L A;  1JE4 A;  4NMZ A;  4RGO S;  3TP5 A;  2QEJ C;  3J81 E;  2EE1 A;  2YU9 B;  5DM6 3;  1II3 A;  1CI3 M;  5C5M A;  2I07 B;  1C48 A;  4ZUJ A;  1F9Q A;  2F0M A;  4X3S A;  1F77 A;  4XYQ A;  1CA6 A;  1Q3L A;  4TKO B;  2C9O A;  3SK5 A;  5KGU A;  4NDX A;  3D4D A;  4RKB A;  5JEA H;  1G6Z A;  2F3W A;  3MXU A;  3PUZ A;  4NW2 A;  5HUR A;  3T56 B;  4H44 C;  3EQL C;  1KNE A;  1RTN A;  2K04 A;  2AQ3 B;  2CVR A;  3KLS X;  3S1Q B;  4DAY A;  4HCS A;  2E2J B;  5D3I B;  5EBC A;  3H6M A;  5DAU A;  3QO2 A;  2KCN A;  1FD7 D;  3CKI B;  3J7A F;  4JBW A;  2TMP A;  4A3G B;  5EPL A;  2G9H D;  3C1F A;  3GTO B;  3HS0 C;  5M9O A;  1PTO C;  5JOB A;  2NN6 G;  1GUG A;  2E75 C;  5C5L A;  1PFN A;  1XWE A;  1EQV A;  1WTO A;  3OSO A;  4HMJ A;  5JEA J;  1L0Y B;  1SYG A;  5FLX E;  1DCZ A;  1LTT D;  1GJX A;  4QB4 A;  4I65 A;  4K14 A;  2EJG C;  1WCM B;  4WOR A;  4ZKB B;  5ELF A;  3RUZ A;  4K5X A;  2CHB D;  3MXN A;  2X6L A;  2EOT A;  3NWT A;  2GA4 B;  2HQE A;  2WKC A;  3SK6 A;  1RCV D;  3CRK C;  5FOB B;  2NB0 A;  2F0I A;  4XYO A;  2XWJ B;  3MHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...