1DCZA

Biotin carboxyl carrier domain of transcarboxylase (tc 1.3s)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
77
structure length
77
Chain Sequence
AGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCARBOXYLASE 1.3S SUBUNIT
publication title High resolution solution structure of the 1.3S subunit of transcarboxylase from Propionibacterium shermanii.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Transferase
total genus 9
structure length 77
sequence length 77
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dczA00
2B8GA 1H9SA 3EQLC 1DXMA 4G7OC 1H9MA 5A35A 1GUNA 1CTMA 3PUYA 3MXUA 2F1MA 1K8OA 2A6EC 3CRLC 2D5DA 2ZT9C 3IFTA 3CRKC 1I6VC 1GHKA 1Z6HA 3BG3A 4TQUS 2EDGA 1VF7A 3LNNA 2L5TA 1GUOA 3M85A 5K36H 1IYUA 1HQMC 3IKJA 3TZUA 2K32A 4G7HC 3WDNA 1ZKOA 2PCFB 4GZYC 2NN6I 1G291 2V4DA 2A69D 2E75C 3A7LA 4DK1A 3I73A 2K7VA 3I4LA 3PUXA 5KNCA 1O7LA 1YNJC 4JBWA 2A68D 3SDZA 4IQZA 1LACA 3NE5B 2PNRC 5C0XH 3P20A 4KN7C 3AB9A 2DNCA 1GUTA 4XTCS 4H44C 2AWOA 3A8JE 2EVBA 3HGBA 5K36G 3L7ZC 2D62A 3U9SA 3FPPA 1T5EA 2A69C 3KLRA 3QG1A 4HR7B 4KN4C 1O78A 4LK1C 5JEAH 2PPBC 3A8IE 5BN4A 2A68C 3LWUA 1A6XA 1DD2A 3MFYA 3A8KE 1Y8NB 2EJFC 4OGQC 2O5IC 4BA2I 2AUKA 4OO1H 3W3AA 1ZYRC 1GUGA 3DXJC 1CFMA 2A6HD 3N6RA 3T56B 1GHJA 1CI3M 4LJZC 1BDOA 3OW7A 4RCNA 1HPCA 2KA7A 2JE6I 2K33A 3D31A 2IT1A 3PUZA 3SE0A 4KMUC 1Q12A 1H9RA 1E2ZA 1Q90A 1OXXK 3VR4A 1SMYC 1LABA 2DN8A 4IFDH 4DNTB 1Q1BA 5KNDA 4KKUA 1FR3A 5JEAG 1Z7TA 2CW0C 3H94A 4I7ZC 3BDOA 3FMCA 1V8QA 4JK1C 2D2CC 5KNBA 4OO1G 1H9JA 1OXVA 4XIGS 2BDOA 4BA1I 3I72A 1V43A 3VR5A 2A6ED 1IW7D 2DNEA 2E74C 2NN6H 3OOCA 4KHZA 2AUJD 4L8JA 3VR2A 2Q8IB 2KCCA 1B9MA 1VCIA 2EJMA 4H13C 3GD7A 3VR3A 3QJYA 5C0XG 1HTPA 1QJOA 1B9NA 2E76C 2JXMB 1TKWB 4DNRB 1IYVA 1H9KA 3OPOA 3T51B 1GJXA 4TKOB 1Y8PB 1E2VA 2EJGC 1H9SB 3RLFA 2B8FA 4G7ZC 1PMRA 1FYCA 1IW7C 1TU2B 1Y69U 1ONLA 4KKSA 2BA1A 3GQBA 1GUSA 3VA7A 2A6HC 2BE5D 5BN3A 1OXUA 5BN5A 3ND8A 1Y8OB 3QIAA 1OXSC 4KKTA 2NN6G 3M7NA 1HCZA 3PUVA 3M4YA 1VDZA 1E2WA 1Q1EA 1OXTA 2LMCB 2JEAI 3ND9A 4KI0A 3A7AB 3D4RA 3PUWA 2QF7A 4PV1C 3T53B 1EWHA 2YYZA 2O5JC 3VR6A 1YNNC 1K8MA 4H0LC 1DCZA 1VF5C 4DK0A 2BE5C 2JEBI 4IFDG 3PV0A 2BA0A 2R6GA
chains in the Genus database with same CATH superfamily
1HUMA 3GDEA 2PQEA 3MXUA 4DF7A 1BNZA 4G4KA 3TSSA 2JYOA 4POGA 1TS4A 3O13A 4K0KQ 4PQXA 5JPNC 2LFNA 1PA6A 4FNFA 3KUPA 1N33Q 3CCLA 3J81c 3TRZA 4O42A 3OTOQ 1PH7A 4IPCA 4KY7A 4WORA 2NN6I 2V4DA 4DR1Q 5I4DA 2RCFA 4NB3A 3DM1A 4JI3L 1YNJC 2NVXH 1NNXA 1D6EC 3MEHA 5T1IA 5EBDA 2JN4A 1GUTA 3WOFA 1PDQA 1YITA 1YHBA 1B8AA 2AWOA 3H6MA 1GUWA 5LL6X 2UUBL 2F0HA 1VQMA 4K5WA 5M5YH 3CXCA 2NVXB 4LK1C 4BBSH 1PH6A 2YV5A 1N36L 1IZ6A 5BN4A 5JVG3 5C4XH 4BA2I 2BCOA 3OWFA 4C3HG 4LUZA 1U0LA 3W3AA 2ES2A 4IPGA 3HOYH 1EIFA 2WAQE 1HHVA 3U4VA 3WWVA 4HSPA 3NP8A 4UP8A 1CQFA 4IALA 1F2MA 2F0DA 3A56A 1H9RA 5C4XB 4DR5Q 4C3IB 1EYGA 5IT9c 4WJ4A 1Q1BA 4JI6L 3HOYB 3I8ZA 5IY0A 5FO8B 1F9QA 5IP7H 2QCPX 4HJ5A 1KAAA 2BDOA 3OOCA 3J7AF 5C44G 3Q23A 1Q86C 4LF5L 2FJ2A 2XWBB 4NMZA 4DNRB 2D0OA 1WYDA 2FFKB 2F0KA 1PXUA 3V96A 1BCPC 1KDBA 1SR3A 2MO1A 4IURA 4JV5L 3K7UC 3R2TA 2WP8J 1EZ6A 3E6ZX 3DEPA 3EIVA 3D6CA 3M4YA 2NZHA 4GNXA 2LMCB 2MPMA 4ZUJA 2R7ZH 2VQEL 4KV6A 2MUYA 2NZOA 1RJTA 5ELOA 1VQ9A 4C1NK 1DCZA 1V9PA 3BVGA 2WB1B 1HZCA 2IHFA 1KRTA 4R8NA 3TS0A 2R7ZB 5FK9C 4HN7A 4LF4L 3HOZB 3VYUA 1AE2A 3CRKC 4JC0A 1VQ6A 3UI2A 4ZUIA 2Y0SE 2EXZA 1TQOA 3C1FA 2EE1A 3WOEA 3M3YH 4C2MB 1D5ZC 1I3QH 2PMZB 2VXWA 1WCMG 1E22A 1LTBD 5E4WC 3P20A 4CDCC 1TIID 5I2YA 3M3YB 4RA8A 4DR2L 3K59A 1I3QB 1LTRD 3S1MH 1HNZQ 2D62A 5KRUA 2ATWA 4X64Q 4CBVA 4IO9A 1RKNA 3LWUA 1GD7A 4K5XA 1SAPA 1N32L 4RCNA 3S1MB 1NCVA 2RBMA 1U4RA 1W3SA 1L1OC 1CSPA 1ZXTA 1UE1A 2K5QA 1Y14B 1GM5A 1TS2A 1CKNB 4DV2L 1U4MA 1VQ8A 2SNMA 1I4QA 4RGNA 4C3JG 2XIWA 2KVMA 1V8QA 2CWPA 2RQXA 1LUZA 3A54A 4LUOA 3JC66 3HFZB 2EYLA 4X65Q 2EY1A 1O7IA 3GTMH 2Q8IB 1HR0Q 3GD7A 4ZAIA 4BS9A 2I5HA 1D5XC 1LM0A 4J8QA 4KLKA 1JWSD 1E2VA 1T9HA 2WAQB 3GTMB 2AMCB 4P74A 4JW0A 2TMPA 3QWNA 2BA1A 1TXYA 4A3BG 2BE5D 5BN5A 4OXPA 2NWGA 3NPPA 1WTVA 1S3OA 5EKLA 1EYCA 5FO7B 5KEEA 3S9WA 1NMFA 2NVYH 2ZJRA 2J4XA 1SRUA 3T53B 4A3KH 3DHQA 4BBRH 2DY7A 4UPAA 2JA6H 2EOTA 1QILA 1VQNA 2UXCQ 1NY4A 3H3VC 3GTQB 3E0EA 1CZWA 1JJ2A 4QB4A 3HOVH 2JA6B 1I6VC 2QW7A 3EJIA 3NSWA 3LNNA 2L5TA 1G2TA 4IOCA 4GKKQ 1PH2A 4IUPA 4JBJA 2K7VA 2K50A 3KF8A 3BDLA 3S16H 1NAPA 4UY8C 1MJEA 1HZAA 5FLMH 1Q81C 3D6WA 4GN5A 5HGQA 3I4NH 4ZLTF 2Z6BA 2DGYA 2HHHL 1S4ZA 3J81j 2JA5B 3S16B 3GTPH 3E9HA 1AN8A 1SYGA 2F0FA 1X32A 1IBLQ 4JI0Q 1PV4A 4LAAA 3DXJC 4X66L 4QUCA 2CH4A 3I4NB 4HMIA 3I55A 2ENBA 2Y0SB 3GTPB 4FF4A 5M3FH 1X3QA 2F4IA 2YTXA 4DAMA 3KFUA 3HS0C 4DR7L 3S1QH 3CKIB 2E2DC 3H94A 4FDBA 2L1BA 4JK1C 3I56A 3G48A 1VS0A 3CQZB 2NVTH 2OQKA 1L0XB 3I4MG 1WTWA 4DV4Q 1N8RC 5TSSA 1STBA 2YTVA 2XRSD 1SNMA 3J7YW 4JOIA 4E6IA 1PTOB 2K4KA 2NVTB 3CP0A 3BJUA 2VW9A 1QNUA 4A3IG 4QUFA 2K01A 2OTJA 5KYIA 4RH6A 1MIUA 3HEJA 1QWYA 3PIO3 3MZ5A 4LF8L 2B63G 3TP7A 1IW7C 3KJOA 1KAWA 3CU7A 2ZJQA 1JJCB 2R92H 1VQOA 1TWCH 1HCZA 1CKMA 3EROA 4LF9Q 1OXTA 2JEAI 4B3RL 3A0JA 2IX1A 4QJFA 3KK7A 4PV1C 2YYZA 2R92B 4A3GB 1TWCB 3TP8A 3F2CA 3KF6A 1IKMA 4IUTA 4PNYA 4MN3A 5BR8Q 5M3MH 2K52A 2MHVA 1WTPA 4B3TQ 1FJGL 5I6YA 5IYCH 4GOPB 3P7JA 4M1UB 1VQIA 3RN5A 4OELB 4QMGA 4Z9CB 1GUOA 4A93H 2DY8A 2QKIC 2JK8A 2EYHA 4O2DA 4A3JH 1UE5A 4A75A 1R9TH 1B3QA 3VDYA 3K5NA 3M7GA 4GS3A 5C0XH 2HCIA 4A93B 4ZCKA 1G51A 2RDFA 3J7A5 2VUMG 1NSNS 4WFN3 1DM0B 5K36G 2FXQA 3FPPA 3KLRA 1DGSA 1Q82C 1PZJD 5GAHC 2B2VA 1RCVD 3CPFA 4X62Q 1EEID 1EY8A 4FF3A 1UWVA 3NELA 1E0BA 1EWCA 2B2WC 3SE0A 1U4LA 1VQHA 4HMJA 2KQ3A 2E8GA 1NR4A 4KKUA 1PFSA 2EY2A 2F0NA 5IWAL 1XMOQ 4XQJA 2XWJB 3NQIA 3SGIA 4OO1G 2PO4A 5IYDH 3RR5A 3HZXA 4TVAB 3KLSX 1C8CA 1LLRD 4A3MH 4H13C 1I4HA 1FNVA 1GJXA 1LTID 1SE4A 3NBIA 3PF4A 2EYOA 3OMCA 4DAYB 4A3MB 1JJGA 1EIGA 1YNND 1XMQQ 3PUVA 4HSVA 3DWAA 3G6EA 1M1KC 4OO1I 5IOCA 3Q0AA 3F2DA 1EWHA 4XYQA 3VR6A 1VF5C 3R8BA 3OYYA 2JEBI 2OEOA 3T1HQ 4A3CH 1EUJA 2LKVA 2E2JB 1H9MA 5A35A 1PTOD 4G7OC 1CTMA 1FGUA 3UDIA 1K73C 2K05A 1BCPB 2JA8G 4PZ6A 1AE3A 4ZYSA 3AYHB 3BG3A 3G4SA 2MFIA 3Q6SA 1DONA 4UAIA 1D1IA 2L11A 2ICEC 1QG7A 4GZYC 2Z0SA 2OTLA 1CT1D 3JAML 5ELNA 1JB3A 4PG3A 5DM63 4RCOA 2N3SA 2A68D 1Z9FA 4IQZA 2RDGA 5I6WA 3CCUA 2Z6KC 2B2WA 1MD2D 2O2LD 1TY0A 1ENFA 2PW5A 3JAME 4OX9L 1LTTD 4JI3Q 1NE3A 1X54A 3D8GA 4KN4C 3HRZC 3AFQA 2PPBC 3J81E 4DR6L 4F8MA 1Y1VH 2O5IC 1GOZA 3OHXC 2CW0D 2UUBQ 1HNXL 2NTTA 1ICFB 1O7YA 2TSSA 1PVOA 1N36Q 1G8ZD 4KMUC 1Q90A 1I4PA 1Y1VB 3STBC 1YJ9A 5GQOA 5CC4A 1V1PA 4RMFA 1VQ4A 5KNDA 4R8IA 2I46A 2KHIA 5EPKA 3QOLA 5C4ZA 1Z7TA 3V05A 5C4XG 4C3IG 4H7BA 1O7ZA 1OXVA 4NKLA 2HT1A 5IT9L 1RODA 1SEBD 4DUYL 3HOYG 1M90C 3HOWH 3PQIA 4JI6Q 1KLGD 1SYCA 2CHBD 2K5NA 3S14H 1TWHB 3OPOA 3W2DA 5I2XA 5IT9E 1Y1WH 1L1OB 1MSHA 4AIMA 3A55A 4LF6L 4S3SA 1V1QA 4LF5Q 1FNUA 5BN3A 1C9OA 1OXUA 3S14B 5J3BA 1Y1WB 4F87A 4JYAL 2XVSA 1LTLA 2NUCA 4LFAL 1M8AA 4DV7L 2R61A 4JV5Q 4DR4L 1IYJB 2F4VL 2R6GA 4L5RC 2MQHA 4KK7A 1A63A 2KENA 5DLQE 3JAMi 2LXJA 5KIXA 1QZHA 2VQEQ 1H95A 4L6TB 2A6EC 1C0AA 2WB1G 1E24A 4OIJA 3J81i 3IFTA 1STEA 1W2BA 1Z6HA 2Q2UA 4RGMA 3M4OH 2R7ZG 4DV5L 4JI1Q 2Q2IA 4FF1A 4HIOA 3EVQA 1HA6A 5AJ3L 3HOZG 4LF4Q 3H3VH 4ZKBB 4LFCL 2A8VA 2PCFB 4JG2A 2F3IA 2A69D 4NXNL 1CHPD 1TR5A 4P73A 5H1SE 2VQFQ 3M4OB 2UUAL 4RGTA 5EKIA 1PFBA 3ZJYC 3HGBA 1PYWD 3K81C 1EU3A 3D4WA 3JAMc 4WRDA 3L0OA 4GNXC 1HFGA 1BCPD 3MFYA 1XNRL 3BZDB 3H91A 1F2ZA 3FKIH 4OL7A 1GUGA 4DR2Q 2LS01 1CI3M 4LJZC 2QDBA 1D5MC 3NEMA 2K6AA 2F3VA 5C4JH 3I4OA 4XYOA 5G3LD 4PZ8A 1N32Q 4RAUC 1T5XD 4CDFC 2ZTCA 2ZXOA 3I70A 2K5WA 2R93H 1KNAA 3DWQA 3CF5A 2UU9L 4DV2Q 4N8X1 1X3GA 3CCQA 1SBBB 2AUJD 4LUVA 4PZ7A 1RD9D 4RGOS 3VA5A 3VR3A 1TWGH 5M5YB 4BBSB 1LO5D 3GV3A 2HDLA 4JI8Q 4TKOB 2D0PA 4PMCA 1H9SB 2B8FA 1BBUA 5EAYA 2IX0A 2JA7H 2M00A 3K7AH 2PQAB 2SEBD 3NTKA 3KLWA 1TWGB 5LMNL 4CGYB 1OTCA 5FLXL 3RMHA 2WAQG 4KKTA 2N8NA 4DV6L 1PTOF 1VDZA 3PO3H 2H5XA 1ILQA 3NWSA 4HJ8A 2F0IA 3K7AB 4LWCA 5E4XA 1WI5A 2QF7A 5E1FA 2MO0A 2O5JC 2RCNA 1EL0A 1KD1C 5FLXE 1EY5A 4OIKA 1FD7D 2A1AA 1QCBD 3IRBA 3PO3B 2L15A 3OIQA 4R4QA 3BDCA 4AYBE 4IN3A 1V1OA 5EQ0A 4GOPA 3HKZG 1PRTB 4A3DH 5J39A 1CHQD 1BKBA 2VB2X 4XQNA 3ERSX 1JMCA 5CV8A 2AKWB 1HTLD 1YHAA 1TWFH 3WDNA 2JA6G 1ZKOA 1A2UA 1G291 5NUCA 2E75C 2CWAA 3ULLA 1I50H 2FINB 2NYZD 3CMEA 5FJ8G 3H09A 1CSQA 1NBWA 4GLVB 4K14A 1TWFB 4QGUA 1KRSA 2CKZB 3U9OA 1A0IA 1EOTA 3F2BA 2L0CA 3T1YL 1N34L 4Y52H 3UE0A 1I50B 3H0GH 4NDXA 1T5EA 4IJHA 4B08A 4DFAA 1DD2A 2KCTA 1YBYA 2JA5G 2AQ2B 3KOJA 1BDOA 4HIKA 2JSOA 2HHHQ 1HPCA 2I5LX 5FLMG 2KBNA 1VQDA 2A5HA 1SROA 1MJCA 2KUMA 4IFDH 1EY0A 3P1HA 4X66Q 3I4NG 4B9XA 5IGBA 1SN8A 2Y0SG 3W5OA 4HTHA 1SNCA 1EQRA 4J1MA 5EGTA 2LY7A 5DEHA 5HY6A 4YCVA 2VY3A 4DR7Q 1STNA 2E5LL 1BO0A 3VR2A 3BYTB 2WFWA 3CCJA 2N49A 2UXDL 1J5EL 1IYVA 2JXMB 1G6ZA 1NR2A 3RLFA 1XTCD 1FYCA 1QB5D 1XNQL 2F0MA 1S72A 1E7ZA 1YEZA 5LMNW 2A6HC 3KBGA 1Y8OB 1XPUA 3TREA 5C0XJ 1X9NA 3CD6A 4OWWB 2RA4A 4LF8Q 4KI0A 3MFGA 1AP0A 1WVLA 4NW2A 4LF7L 4C3HH 4PMWA 4Q0FA 2B2TC 2F0PA 1OO9B 1TY2A 1K8MA 1X65A 4KY6A 3W1BA 3HOUH 2BA0A 2XTIA 5FLXc 3G7LA 2P5ZX 1MBYA 4B3RQ 4Y7NH 3S2DH 2R92G 2HUGA 2IPKD 3C2PA 4A3GG 1ET9A 4AQYL 2HCCA 1GKHA 2OQ0A 1JORA 3RLNA 2ZT9C 1MHWC 1EYAA 3K8AA 5FO9B 1AZQA 3HOUB 3IAYA 2B39A 4CKEA 1IYUA 2BDNA 1U4PA 3S2DB 4IZ8A 2KHJA 4RWSC 5IGCA 3SHLA 4DV0L 4V190 1FJGQ 2EZVA 4K8JA 4WJ3M 4JOIC 5C44H 2K28A 4DK1A 1HZBA 3PUXA 4YIJA 4JBWA 2PNRC 1A15A 2AWNA 2DNCA 5CV9A 3S17H 5AFWA 4HIDA 2NVYB 5ELCA 1HNWL 1IKLA 1RTNA 5C5MA 4FP5D 1O80A 4A3KB 2RSNA 3RUZA 4BBRB 2Z1CA 2KCMA 1A3VA 2QA4A 4B3SL 4A93G 2OT2A 3A8IE 3MXNB 4AYBB 1SMYD 5G3LF 1VQCA 4CDDC 1Q3LA 1PRTD 1XJVA 1Y8NB 2PZWA 4X3SA 3K5LA 4QF4A 2OWOA 1EEFD 4LFBL 3FPUB 4R4IA 3HOVB 3N52A 1EU4A 1RHPA 1BVSA 1RIPA 3D0FA 2FMMA 3VR4A 3CMAA 1LABA 2C35B 1SMXA 1FR3A 2OF1A 4H02A 1X3FA 1B7YB 1GVPA 2BH2A 2HDMA 3I7FA 1H9JA 5DNFA 3GTKH 1UEBA 3TZDA 2CQOA 3LWEA 3GTOH 2A19A 1HZ9A 5IWAQ 4X3KA 3J7AV 2B2UA 1HTPA 1VQAA 2B2TA 1Z47A 3GTKB 3K0YA 3L3OC 4KHVA 5CMDA 1PH9A 3PIPA 1KIXA 1QUQA 2PI2A 2PNHA 4NXML 4JI2L 5CBAE 3X3NA 1ONLA 4NPSA 1F9RA 4V0BA 5IYDG 3NWTA 2HQLA 1J6QA 5JPMC 1OXSC 1PH3A 1QOHA 5M3FB 3GV6A 2B2VC 4A3MG 1E2WA 1VMCA 3K0XA 1EFWA 5EJWA 3S1QB 2EY6A 2ZXPA 1D7QA 2KCNA 1A2TA 3FP9A 3MVVA 1PZID 2BE5C 2BOSA 4BY7H 3GTLH 4DV1L 1I6HH 1IBML 5E7NA 2RDHA 1SYEA 3AU7A 3S15H 3CRLC 1I5FA 3BZKA 4DK3C 1LTAD 4C3JH 4A3FH 2HD3A 4BXXH 4BY7B 5ELEA 3H15A 3M9BA 3GTLB 4A4IA 3TZUA 1I6HB 5A2QL 2K75A 5GAEC 5M5WH 3SK6A 3S15B 3ULPA 2XGTA 4A3FB 4A3LG 1Y69U 4A3CG 4ABNA 1K9MC 4C56C 1VQBA 2F0EA 4KN7C 5A2QE 1EQQA 1IL8A 4XTCS 2R3ZA 4A76A 1HQRD 1DOKA 5M5XH 5M5WB 1AW7A 5D3DA 2AHOB 1B53A 3I91A 1A6XA 1S5BD 4O0AA 5M3MB 1PH8A 5M5XB 4OX9Q 1DYQA 1VQJA 1P16A 1J9OA 1JE4A 5JAVA 4YWMA 2F0SA 1HRJA 4DR6Q 2QEXA 1KDCA 2EYPA 1B44D 2WIIB 2F3WA 5JJZA 4JI4L 1HNXQ 1L0YB 3BZCA 4A3JB 3E9IA 1R9TB 4DUZL 4I7ZC 4X6AH 2EXDA 1UNSA 2KEEA 5D14A 1F2YA 1NJIC 2G9DA 4KHPL 1DZ1A 3VR5A 3R3OA 4KHZA 3PO2H 2I0QA 1HUNA 1Q7YC 2KCCA 4M8AA 4KJOA 2GN5A 1G6PA 2EYMA 1B9NA 4RKBA 4ZKCB 3T51B 4DUYQ 4J6HA 1ML0D 2EJGC 1IXRA 4OEMB 2UUCL 4G7ZC 2PQAA 3PO2B 3G6JB 3CCMA 2L12A 2FMCA 2CVRA 1AEXA 1C48A 4JCVE 3ND8A 2L9HA 4DV3L 1SYDA 3ITPA 2QGQA 4LF6Q 3V2TA 3ULJA 3D4RA 3PUWA 2C5CA 2BH8A 2MGSA 1YHQA 4EQOA 1JICA 1Y1WG 1GXDC 2XSCA 1B2TA 1WFQA 4DK0A 3AQQA 3RLOA 4A3EH 4JYAQ 4MTKA 4K8IA 4P72A 3T16A 4LMQD 4LFAQ 4F88A 3I90A 4DV7Q 5E3FA 1U5KA 5M9OA 3KDFB 4DR4Q 4TQUS 2F4VQ 4A3EB 1VF7A 4XXEA 4DN4M 2MP1A 2B2YA 1I94L 5ELFA 2KEDA 3P75A 3OSOA 3NHHA 1S5DD 3SR1A 1CQVA 5J1ZA 1C7YA 4IUUA 3MEFA 1VQ5A 1TT2A 1PRTF 4DV5Q 3HG9A 1LACA 1WTXA 1VMPA 5AJ3Q 1E1OA 3AB9A 4N9TA 1ZYRD 1B50A 4LFCQ 2I07B 2NB0A 2J0TD 4NXNQ 1VQ7A 2K04A 4CDEC 3NTIA 5ELBA 4GKJL 1O78A 2UUAQ 1KQSA 2F0LA 3ERQA 3FVQA 1EY4A 3K5OA 1MKHA 3OW7A 1S40A 3R2IA 4BY1H 1A3UA 1I4RA 2IWHA 1E2ZA 1Q12A 1XNRQ 5JJLA 2CQAA 5IP9H 4DNIA 1B1ZA 2K5HA 4BY1B 1E3PA 3KJPA 5CYUA 3X3MA 4QQBX 2A6ED 1QNKA 1SLJA 1R4PB 2EPBA 1VCIA 1ENCA 3H3VI 1PZKD 1A8VA 4X3TA 1TKWB 2UU9Q 2CH4W 3SEBA 3F2UA 5CGKA 1CKNA 2I5MX 5DAUA 1K8AC 2IY5B 1E1TA 1YVCA 2Q8RE 3KBXA 4BBSG 3T13A 4ODGA 2DJFC 1BF4A 1ASYA 1BQQT 2KOLA 1RL2A 1K3RA 4EVOA 2K1BA 5LMNQ 2CCZA 2ALYB 1YNNC 1KHIA 2K5VA 4DV6Q 2B8GA 1DXMA 1VQEA 3EA6A 3HOWB 3LGJA 4R4OA 3E0JA 1K8OA 2B29A 2VL6A 1YJWA 3FHWA 1XTDA 1YNJD 5IP7G 3PO3G 1K3BC 2EDGA 2N88A 1X3PA 3PSIA 4JI7L 4P2CB 4DU9A 2RHQB 1D2BA 1B70B 4IFDJ 1PTOC 2VNUD 4JBKA 1JOQA 1TVXA 3A7LA 1PH5A 3CC2A 5L37A 1IBKL 1ILPA 2RHSB 4IOAA 5FOBB 2RF4A 4QIWE 1LTSD 2F0UA 3L9AX 1GO3E 1ENAA 3ER0A 1F9PA 1FNWA 1JWMD 3T4AC 2XNAC 3L7ZC 3BS1A 4R4TA 3QG1A 2IL8A 5CV7A 2A68C 2FHTA 4MIUA 3UDGA 1K0SA 3A8KE 1I4GA 1SJED 2RVLA 3T56B 4KD3A 3T1YQ 3RZOH 1GHJA 1N34Q 2YU9H 2SOBA 2CFMA 1XMQL 2HIXA 1SNDA 1FGBD 2VS1A 4DR3L 3C1EA 3M4QA 4GOPC 3RZOB 3MTSA 5I9OA 2CW0C 1PHJA 1N9WA 2SNSA 3RN2A 5KNBA 3U50C 2Z4IA 1WTQA 2F0VA 1D8LA 4RHRA 3VYSA 4DAPA 1WTOA 3SXHA 2E74C 4KTAA 3TP5A 2IW3A 4L8JA 2Z4HA 3CW2C 3CCVA 1D1KA 3NQTA 1B9MA 3FRPB 4KJNA 4FXDA 1H9KA 1LTGD 2ID0A 4K2LA 1IHZA 1Y8PB 3KF6B 4R9WA 2E2IH 2E5LQ 2GVBA 2ZJPA 1BUVT 1BXTA 5IODA 3FKIB 1JT8A 2UXDQ 1J5EQ 1SE3A 3VA7A 3K58A 3HOXH 5C4JB 2E2IB 3ND9A 4JI5L 1XNQQ 3A7AB 2ICIA 3RD4A 3ONAB 4KY5A 3SK5A 4ALPA 1YZ6A 2M2LA 1SNPA 3HOXB 3CC4A 3BVZA 1PFNA 2R93B 4YHHL 4I7AA 2EQSA 1AFPA 4LW1A 4LF7Q 2K5DA 1EIYB 1JR0D 3MXPA 2EIFA 4IFDI 2R7DA 1SYFA 1BBXC 1DOLA 2OCEA 5CR3A 1JOKA 1GHKA 5T1GA 2QILA 4C3IH 5IYBH 5C3EH 1JQYD 4JVZA 1SNQA 4AQYQ 2JA7B 4YY3L 3HOUG 3EBEA 1WD0A 5EKKA 3I4LA 1EIHA 3CCSA 2Z9HA 2X69A 5ISRA 5C3EB 1QVCA 4DV0Q 3A8JE 3UE1A 1YJNA 3U9SA 2A69C 4RHSA 5JEAH 2N78A 2ZM6L 3HKZE 4ZQ3A 4OGQC 2AUKA 1HNWQ 4A3KG 4IPDA 4BBRG 2A6HD 3N6RA 4AYBG 1SE2A 4B3SQ 4A3DB 2JE6I 1MI2A 1ZEQX 3GTJH 1C4QA 2JA9A 3QB3A 3KLSA 1KL9A 3HOVG 5J22A 2A74C 4LFBQ 1SE8A 3U58A 4IUVA 5CBEE 4QIWB 3ZYYX 3D3RA 2IJ0A 3GTJB 1K0RA 1S5ED 2SDFA 3TN2A 3I72A 1RF2D 2NN6H 1L2FA 3HOZH 3QJYA 5CV4A 3H0GB 3PIOA 4L63B 5LMUL 1PLFA 3E3XA 4JI1L 3PF5A 1ESFA 1CA6A 2ZTDA 3FEWX 4C2MH 4B3ML 5I9PA 1K8GA 2UXBL 2VQFL 5C3XA 3RZDH 2VZAA 5CV5A 4NXMQ 4JI2Q 1AZPA 1KLUD 2G9HD 4ZRZA 3S24A 5M3FG 1BOSA 2PW7A 3B6YA 2KHSA 4K0KL 3RZDB 4O1NA 1SNOA 2Q2HA 1N33L 4DAYA 1GUNA 3MHBA 1PFMA 3OTOL 4DK6C 3KDFA 2JP1A 4ME3A 4OHJA 4DR1L 3NBHB 3SK4A 1ESRA 3L2PA 5IGGA 1UUPA 4DV1Q 1HQMC 3IKJA 1IBMQ 4ID6A 2KJXA 4G7HC 4DXFA 2R7FA 4EX5A 4OONA 2B2UC 4BY7G 1LT4D 3AMUA 1HA5A 2D9UA 5COYA 3SDZA 3NE5B 3NXWA 1STGA 4DAVA 1II3A 4HAEA 1S5FD 5GADC 3TQYA 1V1PB 4A3FG 3TS2A 4BXXG 4C3HB 1NTGA 3PCOB 3DEOA 2H4OA 1F77A 4JI8L 1R4QB 1LT3D 4YCWA 4ZK9B 4HIMA 1UEAB 4DR5L 2MNAA 4Y7NB 1G91A 4DKAC 1SDFA 2K33A 5C6AA 1CUKA 5M3MG 1BCPF 3D4DA 2AQ1B 4OWXB 4CJ1B 4DNTB 1CZGA 4UP7A 2EYFA 5IYCG 1LT5D 3DUZA 5C44B 1UAPA 3Q22A 1B4OA 5CORA 1F9SA 3MXGA 4QY7A 3GTQH 4XIGS 5F2DA 4BA1I 4A3JG 4JI4Q 1EQTA 1IW7D 2WINB 3S17B 4DUZQ 3URYA 3BVMA 4TRDA 3IFDA 4AH6A 3HKZB 4BWGB 5C0XG 3S2HH 5HGTA 2ASBA 4KHPQ 3OMGA 5FJ8H 2XN9C 1CA5A 2EYJA 2G5DA 3MAQA 4XT1B 2NTSA 1HH2P 4RKLA 3S2HB 5KYLA 3NK9A 3QIAA 1Q46A 5IE8A 4N9PA 3F8TA 3PO2G 2UUCQ 1M4VA 5FKAC 1STHA 3R93A 2HIVA 3MWYW 3SVMA 2O4XA 4DV3Q 1K83H 2JA5H 1DJRD 3A5ZB 4FYDA 1L1OA 3SK8A 4EQ5A 1A62A 1WCMH 4UDUC 5C0XI 5IGEA 1P8LA 3GTOB 2K14A 1XPRA 1W6JA 3Q8DA 4FXKC 1K83B 2D5DA 1VQPA 4MNOA 4F7XA 1WCMB 1YI2A 1PYBA 2K32A 3BU2A 2QDLA 5GAGC 3OWEB 3J80L 4A3EG 3QO2A 1DOMA 3I73A 3KYHC 1HNZL 3CQZH 4X64L 1BR9A 1W6KA 4B9WA 2X6GA 1I94Q 1XX8A 4X3UA 2KECA 2C9OA 1HJPA 4HJ9A 4EQPA 5ELDA 3K57A 1MGSA 2LSSA 3J80E 3J7ZC 3TBIB 1PTOH 2OXPA 3BYYB 4K2KA 4UHVA 4U673 3TEHB 1EY7A 2YTYA 4HCEA 4U68A 2K03A 2WACA 5EPJA 1XXGA 4MHEA 3TMEA 1VQFA 4GKJQ 1YIJA 2RKSA 4C3JB 3PMFA 3CHBD 3D31A 4QCLA 2WV6D 5C5LA 1SYBA 1SMYC 5GROA 1PRTC 1K28A 4X65L 1HR0L 4A3GH 1XWEA 3QOJA 3M4PA 3G71A 4KD4A 1JWUD 2B2YC 4A3BH 4QL5A 3UDXA 4BY1G 4CHTB 2EJMA 1KTKA 1LT6D 1X6OA 1QJOA 2E2HH 3K6OA 1ASZA 1J8IA 5IP9G 4A3BB 4MZ9A 1KXLA 4EGVA 4GN3B 3DM3A 4JBMA 2IHEA 3S1NH 3AFPA 4KKSA 2LXKA 2Q8TA 1GUSA 3A5UA 4GLXA 2E2HB 1HFNA 2JQOA 3S1RH 1Y1VG 1UE7A 3M7NA 4R4CA 2UXCL 4WJWA 1Q1EA 4IPHA 4GNXB 2X6LA 4IUNA 3S1NB 4R1JA 3AEVA 2M9VA 4YCUA 3S1RB 4H0LC 5D3IB 1H9SA 3EQLC 3E5SA 5DM73 3J80i 5JVH3 1X56A 2ZXRA 4GKKL 4IJLA 3QR8A 1WTHA 2DUDA 4ME5A 4XQQA 2B3GA 4POFA 4L5SA 2F52A 3Q24A 4GLAC 1JE5A 3HOWG 3M85A 3OW2A 2F0WA 4L5QA 3CPWA 4HJ7A 1QE6A 4IUQA 3K80C 2PI2E 3NTHA 5KNCA 1STYA 2HQEA 5C3WA 1O7LA 1QVGA 1AH9A 1NMGA 4JI7Q 4YWKA 1NUCA 2F0OA 1EOVA 1Q8IA 1PYSB 3HKSA 4H44C 4FXGC 1IBLL 4JI0L 5EBCA 1IBKQ 2JJQA 4HR7B 2F0GA 3J80c 3STBD 4OWTB 1QVFA 2V1CC 4DA2A 4HEDA 3I4MH 4YWLA 4N8FA 3LX0A 2A73B 1EWIA 3DLLA 4HJAA 1OXXK 5KGUA 1XPOA 3MC0B 2PZTA 1JOOA 2DN8A 1VQKA 4DV4L 4A3IH 3I4MB 4CJ2C 1HR0W 1CKOA 3GP7A 2B63H 4FVMA 1PH4A 1FVIA 2J7ZA 3BDOA 3FMCA 5LL6S 1YNXA 4RG1A 2Q2TA 4DR3Q 3EN2A 2L4NA 5LHY1 1MSGA 2E2JH 4A3IB 1SFOH 3F1ZA 4CKCA 4NP5A 2QEJC 1EQVA 1F2LA 3CC7A 4J15A 2B63B 1XYIA 3RNUA 1RDPD 4A3LH 1I4XA 3HP3A 3PGZA 3K5MA 2N55A 3A74A 3EFXD 4LF9L 2ZTEA 1SFOB 4Q5VA 3NUCA 1TU2B 1X55A 4L5TA 3VYTA 4EQNA 3PIP3 2VB3X 1RTOA 2F0QA 1QZGA 3CCRA 3FKIG 5BR8L 2Z8LA 4B3TL 4XT3B 2XRQD 4GN4B 2WKDA 3J81L 5JEAJ 4DPGA 2DJGC 4JI5Q 2EY5A 1TS3A 3TP6A 2PYKA 1JB7A 3PUYA 3I3CA 2F1MA 3HOXG 3NBHA 3VYRA 1TWAH 2VUMH 4FF2A 1A3TA 2WKCA 2R93G 2F03A 1KNEA 4PMBA 4YHHQ 5K36H 4ILWA 4ULLA 3CAMA 1VQGA 4FO2A 4LNQA 5JOBA 4APVA 1ET6A 1EY6A 1TWAB 2VUMB 4P71A 3UDFA 3GO5A 4CJ0B 3C46A 1LV9A 4DGZA 4K5VA 2F0TA 3DMUA 3KF8B 2F0JA 2L55A 5EPLA 2JA7G 4DXGA 1TS5A 4YY3Q 2EVBA 2NVQH 2GA4B 1CM9A 4X62L 1CK1A 1UE6A 5HURA 5IYBG 4G57A 5C3EG 1IL2A 1TWHH 1FL0A 4I65A 2RSOA 1SSOA 3OIPA 2EJFC 4OO1H 1EYDA 1ZYRC 4HCSA 2NVQB 1CFMA 4RFBA 1EZ8A 2ZM6Q 1XMOL 1EFID 3PUZA 2IT1A 4CKBA 5IGDA 4P75A 2H1EA 2IX3A 1L0WA 1Q8KA 2GVAA 1QUQB 4A3DG 5JEAG 1G2SA 1WTRA 4C1NI 5D65A 3W1GA 1WD1A 3MXNA 2D2CC 1WOCA 3U4ZA 1V43A 3TDQA 2WB1E 2MJ8A 2DNEA 3ICEA 2NBFA 1ICWA 4XDXA 1U9RA 3DWPA 5IGFA 1KC8C 1STAA 3C3LA 2E76C 1LYLA 1KDAA 3MA2B 1JCKB 2Z6KA 1BBWA 2AQ3B 5K5PA 1PMRA 1SXTA 1B3AA 3H0GG 1SJHD 2YU9B 1S5CD 3GQBA 3GTGH 1JC7A 1VQLA 2NZ1D 1HXYD 3FDTA 4UP9A 1PH1A 4TSSA 4MTNA 3CCEA 5LMUQ 2NN6G 2JA8H 5JJKA 2PMZE 5IIFA 2PZUA 4K6LA 3T1HL 3NENA 5JJIA 1KABA 4B3MQ 1X3EA 1EY9A 5C4HA 1WJJA 3GTGB 2UXBQ 3I2ZA 3IL8A 5CV6A 4JPBW 2JA8B 4IFDG 4K6DA 3PV0A 2KA7A
chains in the Genus database with same CATH topology
1HUMA 2PQEA 3MXUA 4DF7A 1BNZA 4G4KA 3TSSA 2JYOA 1TS4A 3O13A 4PQXA 5JPNC 2LFNA 4FNFA 3KUPA 4O42A 4KY7A 4WORA 2NN6I 2V4DA 5I4DA 3DM1A 1YNJC 1D6EC 3MEHA 5T1IA 5EBDA 1GUTA 3WOFA 1PDQA 2AWOA 3H6MA 1GUWA 5LL6X 2F0HA 4K5WA 2NVXB 4LK1C 5BN4A 5JVG3 4BA2I 2BCOA 3OWFA 4C3HG 3W3AA 1HHVA 4HSPA 3NP8A 1CQFA 4IALA 1F2MA 2F0DA 3A56A 1H9RA 5C4XB 4C3IB 1Q1BA 3HOYB 3I8ZA 5FO8B 1F9QA 2QCPX 1KAAA 2BDOA 3OOCA 3J7AF 3Q23A 2FJ2A 2XWBB 4NMZA 4DNRB 2FFKB 2F0KA 1PXUA 3V96A 1BCPC 1KDBA 4IURA 3R2TA 2WP8J 1EZ6A 3E6ZX 3DEPA 3D6CA 3M4YA 2LMCB 2MPMA 4ZUJA 4KV6A 2MUYA 1RJTA 4C1NK 1DCZA 3BVGA 2WB1B 4R8NA 2R7ZB 5FK9C 4HN7A 3HOZB 3VYUA 3CRKC 3UI2A 4ZUIA 2EXZA 1TQOA 3C1FA 2EE1A 3WOEA 4C2MB 1D5ZC 2PMZB 2VXWA 1LTBD 5E4WC 3P20A 1TIID 5I2YA 3M3YB 4RA8A 3K59A 1I3QB 1LTRD 2D62A 5KRUA 4CBVA 1RKNA 3LWUA 4K5XA 1SAPA 4RCNA 3S1MB 1NCVA 2RBMA 1U4RA 1ZXTA 2K5QA 1TS2A 1U4MA 2SNMA 1I4QA 4RGNA 4C3JG 2XIWA 2KVMA 1V8QA 2RQXA 3A54A 2EYLA 2EY1A 2Q8IB 3GD7A 4ZAIA 4BS9A 1D5XC 4J8QA 1JWSD 1E2VA 2WAQB 3GTMB 2TMPA 3QWNA 2BA1A 2BE5D 5BN5A 2NWGA 3NPPA 1WTVA 5EKLA 1EYCA 5FO7B 5KEEA 3S9WA 2J4XA 3T53B 3DHQA 2DY7A 2EOTA 1QILA 3H3VC 3GTQB 1CZWA 4QB4A 2JA6B 1I6VC 3EJIA 3NSWA 3LNNA 2L5TA 1G2TA 4IUPA 2K7VA 3KF8A 3BDLA 1NAPA 3D6WA 4ZLTF 1S4ZA 2JA5B 3S16B 1AN8A 1SYGA 2F0FA 1X32A 4LAAA 3DXJC 4QUCA 3I4NB 4HMIA 2ENBA 2Y0SB 3GTPB 4FF4A 1X3QA 2F4IA 3HS0C 3CKIB 2E2DC 3H94A 2L1BA 4JK1C 3CQZB 1L0XB 1WTWA 5TSSA 1STBA 2XRSD 1SNMA 3J7YW 4E6IA 1PTOB 2NVTB 1QNUA 4QUFA 2K01A 5KYIA 4RH6A 3HEJA 1QWYA 3PIO3 3MZ5A 3TP7A 1IW7C 3CU7A 1HCZA 2JEAI 3EROA 1OXTA 2IX1A 3KK7A 4PV1C 2YYZA 2R92B 4A3GB 1TWCB 3TP8A 1IKMA 4IUTA 4PNYA 4MN3A 2MHVA 1WTPA 5I6YA 3P7JA 4M1UB 4Z9CB 4QMGA 1GUOA 2DY8A 2QKIC 2EYHA 3K5NA 3M7GA 5C0XH 2HCIA 4A93B 2RDFA 1NSNS 4WFN3 1DM0B 5K36G 3FPPA 3KLRA 1PZJD 2B2VA 1RCVD 1EEID 1EY8A 4FF3A 1E0BA 1EWCA 2B2WC 3SE0A 1U4LA 4HMJA 2KQ3A 1NR4A 4KKUA 2EY2A 2F0NA 4XQJA 2XWJB 3NQIA 4OO1G 2PO4A 3HZXA 3KLSX 1C8CA 1LLRD 4H13C 1I4HA 1FNVA 1GJXA 1LTID 1SE4A 3NBIA 2EYOA 3OMCA 4A3MB 1EIGA 1YNND 3PUVA 4HSVA 3DWAA 4OO1I 5IOCA 3Q0AA 1EWHA 4XYQA 3VR6A 1VF5C 3R8BA 2JEBI 2OEOA 2LKVA 4G7OC 2E2JB 1H9MA 5A35A 1PTOD 1CTMA 2K05A 1BCPB 4ZYSA 3BG3A 3Q6SA 1DONA 4UAIA 1D1IA 2L11A 2ICEC 1QG7A 4GZYC 1CT1D 3JAML 1JB3A 5DM63 4RCOA 2A68D 4IQZA 2RDGA 5I6WA 2B2WA 1MD2D 2O2LD 1TY0A 1ENFA 2PW5A 3JAME 1LTTD 3D8GA 4KN4C 3HRZC 2PPBC 3J81E 4F8MA 2O5IC 1GOZA 3OHXC 2CW0D 2NTTA 2TSSA 1O7YA 1G8ZD 4KMUC 1Q90A 1I4PA 1Y1VB 5CC4A 1V1PA 5KNDA 4R8IA 2I46A 5EPKA 5C4ZA 3QOLA 1Z7TA 3V05A 4C3IG 4H7BA 1O7ZA 1OXVA 4NKLA 5IT9L 1RODA 1SEBD 1KLGD 1SYCA 2CHBD 1TWHB 3OPOA 3W2DA 5I2XA 5IT9E 1MSHA 3A55A 4S3SA 1FNUA 5BN3A 1OXUA 3S14B 1Y1WB 4F87A 2XVSA 2NUCA 1M8AA 2R61A 2R6GA 4KK7A 5KIXA 4L6TB 2A6EC 4OIJA 3IFTA 1STEA 1Z6HA 4RGMA 4FF1A 3EVQA 1HA6A 4ZKBB 2PCFB 2A69D 1CHPD 1TR5A 3M4OB 4RGTA 5EKIA 1PFBA 3HGBA 1PYWD 1EU3A 3D4WA 4WRDA 1HFGA 1BCPD 3MFYA 3BZDB 3H91A 1F2ZA 4OL7A 1GUGA 2LS01 1CI3M 4LJZC 2QDBA 1D5MC 2K6AA 2F3VA 4XYOA 5G3LD 4RAUC 1T5XD 2ZXOA 3I70A 2K5WA 1KNAA 3DWQA 1SBBB 2AUJD 1RD9D 4RGOS 3VA5A 3VR3A 5M5YB 4BBSB 1LO5D 3GV3A 2HDLA 4TKOB 4PMCA 1H9SB 2B8FA 2IX0A 2M00A 2SEBD 3NTKA 1TWGB 4CGYB 5FLXL 3RMHA 4KKTA 1PTOF 1VDZA 1ILQA 3NWSA 2F0IA 3K7AB 5E4XA 2QF7A 5E1FA 2O5JC 1EL0A 5FLXE 1EY5A 4OIKA 1FD7D 1QCBD 3PO3B 3OIQA 3BDCA 4IN3A 1V1OA 5EQ0A 1PRTB 5J39A 1CHQD 2VB2X 4XQNA 5CV8A 1HTLD 3WDNA 1ZKOA 1A2UA 1G291 5NUCA 2E75C 2FINB 2NYZD 3H09A 4K14A 1TWFB 3U9OA 1EOTA 2L0CA 1I50B 4NDXA 1T5EA 4B08A 4DFAA 1DD2A 2AQ2B 1BDOA 2JSOA 1HPCA 2A5HA 2KUMA 4IFDH 1EY0A 3P1HA 4B9XA 5IGBA 4HTHA 1SNCA 4J1MA 5EGTA 2LY7A 5DEHA 1STNA 1BO0A 3VR2A 3BYTB 1IYVA 2JXMB 1G6ZA 1NR2A 3RLFA 1XTCD 1FYCA 1QB5D 2F0MA 2A6HC 3KBGA 1Y8OB 5C0XJ 2RA4A 4KI0A 3MFGA 1AP0A 1WVLA 4NW2A 4PMWA 4Q0FA 2B2TC 2F0PA 1OO9B 1TY2A 1K8MA 4KY6A 2BA0A 3G7LA 1MBYA 2HUGA 2IPKD 3C2PA 1ET9A 2HCCA 1JORA 2ZT9C 1EYAA 5FO9B 1AZQA 3HOUB 3IAYA 2B39A 4CKEA 1IYUA 2BDNA 1U4PA 3S2DB 4IZ8A 4RWSC 5IGCA 3SHLA 4V190 2EZVA 4K8JA 2K28A 4DK1A 3PUXA 4YIJA 4JBWA 2PNRC 1A15A 2AWNA 2DNCA 5CV9A 5AFWA 2NVYB 5ELCA 1IKLA 1RTNA 5C5MA 4FP5D 1O80A 4A3KB 2RSNA 3RUZA 4BBRB 2Z1CA 1A3VA 2OT2A 3A8IE 4AYBB 1SMYD 5G3LF 1Q3LA 1PRTD 1Y8NB 2PZWA 4X3SA 3K5LA 4QF4A 1EEFD 3FPUB 3HOVB 3N52A 1EU4A 1RHPA 2FMMA 3VR4A 1LABA 1FR3A 2OF1A 2HDMA 1H9JA 5DNFA 3TZDA 3LWEA 4X3KA 3J7AV 2B2UA 1HTPA 2B2TA 1Z47A 3GTKB 3K0YA 3L3OC 4KHVA 5CMDA 5CBAE 3X3NA 1ONLA 4V0BA 1F9RA 3NWTA 5JPMC 1OXSC 1QOHA 5M3FB 3GV6A 2B2VC 1E2WA 1VMCA 5EJWA 3S1QB 2EY6A 2ZXPA 2KCNA 1A2TA 3MVVA 1PZID 2BE5C 2BOSA 2RDHA 1SYEA 3AU7A 3CRLC 1LTAD 4BY7B 5ELEA 3GTLB 3TZUA 1I6HB 5A2QL 3SK6A 3S15B 4A3FB 1Y69U 4ABNA 4C56C 2F0EA 4KN7C 5A2QE 1IL8A 4XTCS 2R3ZA 1HQRD 1DOKA 5M5WB 1AW7A 5D3DA 1B53A 3I91A 1A6XA 1S5BD 5M3MB 5M5XB 1DYQA 1J9OA 1JE4A 5JAVA 2F0SA 1HRJA 1KDCA 2EYPA 1B44D 2WIIB 2F3WA 5JJZA 1L0YB 4A3JB 1R9TB 4I7ZC 1UNSA 2KEEA 5D14A 1F2YA 2G9DA 1DZ1A 3VR5A 3R3OA 4KHZA 1HUNA 2KCCA 4M8AA 4KJOA 2EYMA 1B9NA 4RKBA 4ZKCB 3T51B 4J6HA 1ML0D 2EJGC 4G7ZC 3PO2B 3G6JB 2L12A 2FMCA 2CVRA 1AEXA 1C48A 3ND8A 2L9HA 1SYDA 3ITPA 3V2TA 3D4RA 3PUWA 2C5CA 2MGSA 4EQOA 1JICA 1GXDC 2XSCA 1B2TA 4DK0A 4K8IA 3T16A 4LMQD 4F88A 3I90A 5E3FA 5M9OA 4TQUS 4A3EB 1VF7A 4XXEA 4DN4M 2MP1A 2B2YA 5ELFA 2KEDA 3P75A 3OSOA 3NHHA 1S5DD 3SR1A 1CQVA 5J1ZA 4IUUA 1TT2A 1PRTF 3HG9A 1LACA 1WTXA 1VMPA 3AB9A 4N9TA 1B50A 1ZYRD 2I07B 2NB0A 2J0TD 2K04A 3NTIA 5ELBA 1O78A 2F0LA 3ERQA 3FVQA 1EY4A 3K5OA 3OW7A 3R2IA 1A3UA 1I4RA 2IWHA 1E2ZA 1Q12A 2CQAA 1B1ZA 4BY1B 5CYUA 3X3MA 2A6ED 1QNKA 1R4PB 2EPBA 1VCIA 1ENCA 1PZKD 4X3TA 1TKWB 3SEBA 3F2UA 5CGKA 5DAUA 2Q8RE 3KBXA 3T13A 4ODGA 1BF4A 1BQQT 2KOLA 4EVOA 2K1BA 1YNNC 2B8GA 1DXMA 3EA6A 3HOWB 3E0JA 1K8OA 1YNJD 2EDGA 2N88A 1X3PA 4P2CB 4DU9A 1D2BA 4IFDJ 1PTOC 2VNUD 1JOQA 1TVXA 3A7LA 1ILPA 5FOBB 1LTSD 2F0UA 3L9AX 1ENAA 1F9PA 1FNWA 1JWMD 3T4AC 2XNAC 3L7ZC 3BS1A 3QG1A 2IL8A 5CV7A 2A68C 2FHTA 4MIUA 3A8KE 1I4GA 1SJED 2RVLA 3T56B 4KD3A 1GHJA 2SOBA 1SNDA 1FGBD 3C1EA 3RZOB 3MTSA 5I9OA 2CW0C 2SNSA 5KNBA 2Z4IA 1WTQA 2F0VA 4RHRA 3VYSA 4DAPA 1WTOA 3SXHA 2E74C 4KTAA 3TP5A 2IW3A 4L8JA 2Z4HA 1D1KA 3NQTA 1B9MA 3FRPB 4KJNA 4FXDA 1H9KA 1LTGD 2ID0A 4K2LA 1IHZA 1Y8PB 4R9WA 1BUVT 1BXTA 5IODA 3FKIB 1SE3A 3VA7A 3K58A 5C4JB 2E2IB 3ND9A 3A7AB 2ICIA 3RD4A 3ONAB 4KY5A 3SK5A 2M2LA 1SNPA 3HOXB 3BVZA 1PFNA 2R93B 1AFPA 2K5DA 1JR0D 3MXPA 4IFDI 1SYFA 1BBXC 1DOLA 5CR3A 1JOKA 1GHKA 5T1GA 2QILA 1JQYD 1SNQA 2JA7B 1WD0A 5EKKA 3I4LA 1EIHA 2X69A 5ISRA 5C3EB 3A8JE 3U9SA 2A69C 4RHSA 5JEAH 4ZQ3A 4OGQC 2AUKA 2A6HD 3N6RA 1SE2A 4A3DB 2JE6I 1MI2A 1ZEQX 1C4QA 3QB3A 3KLSA 5J22A 2A74C 4IUVA 5CBEE 4QIWB 3ZYYX 3D3RA 2IJ0A 3GTJB 1S5ED 2SDFA 3TN2A 3I72A 1RF2D 2NN6H 3QJYA 5CV4A 3H0GB 4L63B 1PLFA 1ESFA 1CA6A 3FEWX 5I9PA 5C3XA 5CV5A 1AZPA 1KLUD 2G9HD 4ZRZA 1BOSA 2PW7A 2KHSA 3RZDB 4O1NA 1SNOA 4DAYA 1GUNA 3MHBA 1PFMA 2JP1A 4OHJA 3SK4A 1ESRA 5IGGA 1UUPA 1HQMC 3IKJA 4ID6A 2KJXA 4G7HC 4DXFA 2B2UC 1LT4D 3AMUA 1HA5A 2D9UA 5COYA 3SDZA 3NE5B 3NXWA 1STGA 4DAVA 1II3A 4HAEA 1S5FD 1V1PB 4C3HB 3DEOA 2H4OA 1F77A 1R4QB 1LT3D 4ZK9B 1UEAB 4Y7NB 1G91A 1SDFA 2K33A 5C6AA 1BCPF 3D4DA 2AQ1B 4CJ1B 4DNTB 1CZGA 2EYFA 1LT5D 3DUZA 5C44B 1UAPA 3Q22A 1B4OA 5CORA 1F9SA 3MXGA 4XIGS 5F2DA 4BA1I 1EQTA 1IW7D 2WINB 3S17B 3URYA 3BVMA 4TRDA 3IFDA 3HKZB 4BWGB 5C0XG 5HGTA 3OMGA 2XN9C 1CA5A 2EYJA 3MAQA 4XT1B 2NTSA 4RKLA 3S2HB 5KYLA 3NK9A 3QIAA 4N9PA 1M4VA 5FKAC 1STHA 3R93A 3MWYW 3SVMA 2O4XA 1DJRD 4FYDA 3SK8A 4UDUC 5C0XI 5IGEA 3GTOB 1W6JA 4FXKC 1K83B 2D5DA 4F7XA 1WCMB 2K32A 3OWEB 3J80L 3QO2A 1DOMA 3I73A 1BR9A 1W6KA 4B9WA 2X6GA 1XX8A 4X3UA 2KECA 2C9OA 4EQPA 5ELDA 3K57A 1MGSA 3J80E 3TBIB 1PTOH 2OXPA 3BYYB 4K2KA 4U673 1EY7A 4U68A 4HCEA 2K03A 2WACA 5EPJA 1XXGA 4MHEA 3TMEA 2RKSA 4C3JB 3PMFA 3CHBD 3D31A 4QCLA 2WV6D 5C5LA 1SYBA 1SMYC 1PRTC 1XWEA 3QOJA 4KD4A 1JWUD 2B2YC 4CHTB 2EJMA 1KTKA 1LT6D 1QJOA 3K6OA 1J8IA 4A3BB 4EGVA 4KKSA 2Q8TA 1GUSA 2E2HB 1HFNA 3M7NA 4WJWA 1Q1EA 2X6LA 4IUNA 3S1NB 2M9VA 3S1RB 4H0LC 5D3IB 1H9SA 3EQLC 3E5SA 5DM73 5JVH3 2ZXRA 4ME5A 4XQQA 3Q24A 3M85A 2F0WA 1QE6A 4IUQA 3NTHA 5KNCA 1STYA 2HQEA 5C3WA 1O7LA 1NUCA 2F0OA 1Q8IA 4H44C 4FXGC 5EBCA 4HR7B 2F0GA 4DA2A 4HEDA 3LX0A 2A73B 1OXXK 5KGUA 3MC0B 2PZTA 1JOOA 2DN8A 3I4MB 4CJ2C 3GP7A 4FVMA 2J7ZA 3BDOA 3FMCA 5LL6S 2L4NA 5LHY1 1MSGA 4A3IB 4CKCA 4NP5A 2QEJC 1EQVA 1F2LA 2B63B 1XYIA 1RDPD 1I4XA 3HP3A 3K5MA 2N55A 3EFXD 1SFOB 4Q5VA 3NUCA 1TU2B 3VYTA 4EQNA 3PIP3 2VB3X 1RTOA 2F0QA 2Z8LA 4XT3B 2XRQD 2WKDA 3J81L 5JEAJ 2EY5A 1TS3A 3TP6A 2PYKA 3PUYA 3I3CA 2F1MA 3NBHA 3VYRA 4FF2A 1A3TA 2WKCA 2F03A 1KNEA 4PMBA 5K36H 4ILWA 4ULLA 4FO2A 5JOBA 1ET6A 1EY6A 1TWAB 2VUMB 3GO5A 4CJ0B 3C46A 1LV9A 4DGZA 4K5VA 2F0TA 3DMUA 5EPLA 2F0JA 2L55A 4DXGA 1TS5A 2EVBA 2GA4B 1CM9A 1CK1A 5HURA 4G57A 4I65A 2RSOA 1SSOA 3OIPA 2EJFC 4OO1H 1EYDA 1ZYRC 4HCSA 2NVQB 1CFMA 4RFBA 1EZ8A 1EFID 4CKBA 2IT1A 3PUZA 5IGDA 2H1EA 2IX3A 5JEAG 1G2SA 1WTRA 4C1NI 5D65A 1WD1A 3MXNA 2D2CC 1V43A 3TDQA 2MJ8A 2DNEA 2NBFA 1ICWA 4XDXA 1U9RA 3DWPA 5IGFA 1STAA 3C3LA 2E76C 1KDAA 3MA2B 1JCKB 2AQ3B 5K5PA 1PMRA 1SXTA 1B3AA 1SJHD 2YU9B 1S5CD 3GQBA 1JC7A 2NZ1D 1HXYD 3FDTA 4TSSA 2NN6G 5IIFA 2PZUA 4K6LA 1KABA 1EY9A 5C4HA 3GTGB 3IL8A 5CV6A 2JA8B 4IFDG 4K6DA 3PV0A 2KA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8G A;  1H9S A;  3EQL C;  1DXM A;  4G7O C;  1H9M A;  5A35 A;  1GUN A;  1CTM A;  3PUY A;  3MXU A;  2F1M A;  1K8O A;  2A6E C;  3CRL C;  2D5D A;  2ZT9 C;  3IFT A;  3CRK C;  1I6V C;  1GHK A;  1Z6H A;  3BG3 A;  4TQU S;  2EDG A;  1VF7 A;  3LNN A;  2L5T A;  1GUO A;  3M85 A;  5K36 H;  1IYU A;  1HQM C;  3IKJ A;  3TZU A;  2K32 A;  4G7H C;  3WDN A;  1ZKO A;  2PCF B;  4GZY C;  2NN6 I;  1G29 1;  2V4D A;  2A69 D;  2E75 C;  3A7L A;  4DK1 A;  3I73 A;  2K7V A;  3I4L A;  3PUX A;  5KNC A;  1O7L A;  1YNJ C;  4JBW A;  2A68 D;  3SDZ A;  4IQZ A;  1LAC A;  3NE5 B;  2PNR C;  5C0X H;  3P20 A;  4KN7 C;  3AB9 A;  2DNC A;  1GUT A;  4XTC S;  4H44 C;  2AWO A;  3A8J E;  2EVB A;  3HGB A;  5K36 G;  3L7Z C;  2D62 A;  3U9S A;  3FPP A;  1T5E A;  2A69 C;  3KLR A;  3QG1 A;  4HR7 B;  4KN4 C;  1O78 A;  4LK1 C;  5JEA H;  2PPB C;  3A8I E;  5BN4 A;  2A68 C;  3LWU A;  1A6X A;  1DD2 A;  3MFY A;  3A8K E;  1Y8N B;  2EJF C;  4OGQ C;  2O5I C;  4BA2 I;  2AUK A;  4OO1 H;  3W3A A;  1ZYR C;  1GUG A;  3DXJ C;  1CFM A;  2A6H D;  3N6R A;  3T56 B;  1GHJ A;  1CI3 M;  4LJZ C;  1BDO A;  3OW7 A;  4RCN A;  1HPC A;  2KA7 A;  2JE6 I;  2K33 A;  3D31 A;  2IT1 A;  3PUZ A;  3SE0 A;  4KMU C;  1Q12 A;  1H9R A;  1E2Z A;  1Q90 A;  1OXX K;  3VR4 A;  1SMY C;  1LAB A;  2DN8 A;  4IFD H;  4DNT B;  1Q1B A;  5KND A;  4KKU A;  1FR3 A;  5JEA G;  1Z7T A;  2CW0 C;  3H94 A;  4I7Z C;  3BDO A;  3FMC A;  1V8Q A;  4JK1 C;  2D2C C;  5KNB A;  4OO1 G;  1H9J A;  1OXV A;  4XIG S;  2BDO A;  4BA1 I;  3I72 A;  1V43 A;  3VR5 A;  2A6E D;  1IW7 D;  2DNE A;  2E74 C;  2NN6 H;  3OOC A;  4KHZ A;  2AUJ D;  4L8J A;  3VR2 A;  2Q8I B;  2KCC A;  1B9M A;  1VCI A;  2EJM A;  4H13 C;  3GD7 A;  3VR3 A;  3QJY A;  5C0X G;  1HTP A;  1QJO A;  1B9N A;  2E76 C;  2JXM B;  1TKW B;  4DNR B;  1IYV A;  1H9K A;  3OPO A;  3T51 B;  1GJX A;  4TKO B;  1Y8P B;  1E2V A;  2EJG C;  1H9S B;  3RLF A;  2B8F A;  4G7Z C;  1PMR A;  1FYC A;  1IW7 C;  1TU2 B;  1Y69 U;  1ONL A;  4KKS A;  2BA1 A;  3GQB A;  1GUS A;  3VA7 A;  2A6H C;  2BE5 D;  5BN3 A;  1OXU A;  5BN5 A;  3ND8 A;  1Y8O B;  3QIA A;  1OXS C;  4KKT A;  2NN6 G;  3M7N A;  1HCZ A;  3PUV A;  3M4Y A;  1VDZ A;  1E2W A;  1Q1E A;  1OXT A;  2LMC B;  2JEA I;  3ND9 A;  4KI0 A;  3A7A B;  3D4R A;  3PUW A;  2QF7 A;  4PV1 C;  3T53 B;  1EWH A;  2YYZ A;  2O5J C;  3VR6 A;  1YNN C;  1K8M A;  4H0L C;  1DCZ A;  1VF5 C;  4DK0 A;  2BE5 C;  2JEB I;  4IFD G;  3PV0 A;  2BA0 A;  2R6G A; 
#chains in the Genus database with same CATH topology
 1HUM A;  3GDE A;  2PQE A;  3MXU A;  4DF7 A;  1BNZ A;  4G4K A;  3TSS A;  2JYO A;  4POG A;  1TS4 A;  3O13 A;  4K0K Q;  4PQX A;  5JPN C;  2LFN A;  1PA6 A;  4FNF A;  3KUP A;  1N33 Q;  3CCL A;  3J81 c;  3TRZ A;  4O42 A;  3OTO Q;  1PH7 A;  4IPC A;  4KY7 A;  4WOR A;  2NN6 I;  2V4D A;  4DR1 Q;  5I4D A;  2RCF A;  4NB3 A;  3DM1 A;  4JI3 L;  1YNJ C;  2NVX H;  1NNX A;  1D6E C;  3MEH A;  5T1I A;  5EBD A;  2JN4 A;  1GUT A;  3WOF A;  1PDQ A;  1YIT A;  1YHB A;  1B8A A;  2AWO A;  3H6M A;  1GUW A;  5LL6 X;  2UUB L;  2F0H A;  1VQM A;  4K5W A;  5M5Y H;  3CXC A;  2NVX B;  4LK1 C;  4BBS H;  1PH6 A;  2YV5 A;  1N36 L;  1IZ6 A;  5BN4 A;  5JVG 3;  5C4X H;  4BA2 I;  2BCO A;  3OWF A;  4C3H G;  4LUZ A;  1U0L A;  3W3A A;  2ES2 A;  4IPG A;  3HOY H;  1EIF A;  2WAQ E;  1HHV A;  3U4V A;  3WWV A;  4HSP A;  3NP8 A;  4UP8 A;  1CQF A;  4IAL A;  1F2M A;  2F0D A;  3A56 A;  1H9R A;  5C4X B;  4DR5 Q;  4C3I B;  1EYG A;  5IT9 c;  4WJ4 A;  1Q1B A;  4JI6 L;  3HOY B;  3I8Z A;  5IY0 A;  5FO8 B;  1F9Q A;  5IP7 H;  2QCP X;  4HJ5 A;  1KAA A;  2BDO A;  3OOC A;  3J7A F;  5C44 G;  3Q23 A;  1Q86 C;  4LF5 L;  2FJ2 A;  2XWB B;  4NMZ A;  4DNR B;  2D0O A;  1WYD A;  2FFK B;  2F0K A;  1PXU A;  3V96 A;  1BCP C;  1KDB A;  1SR3 A;  2MO1 A;  4IUR A;  4JV5 L;  3K7U C;  3R2T A;  2WP8 J;  1EZ6 A;  3E6Z X;  3DEP A;  3EIV A;  3D6C A;  3M4Y A;  2NZH A;  4GNX A;  2LMC B;  2MPM A;  4ZUJ A;  2R7Z H;  2VQE L;  4KV6 A;  2MUY A;  2NZO A;  1RJT A;  5ELO A;  1VQ9 A;  4C1N K;  1DCZ A;  1V9P A;  3BVG A;  2WB1 B;  1HZC A;  2IHF A;  1KRT A;  4R8N A;  3TS0 A;  2R7Z B;  5FK9 C;  4HN7 A;  4LF4 L;  3HOZ B;  3VYU A;  1AE2 A;  3CRK C;  4JC0 A;  1VQ6 A;  3UI2 A;  4ZUI A;  2Y0S E;  2EXZ A;  1TQO A;  3C1F A;  2EE1 A;  3WOE A;  3M3Y H;  4C2M B;  1D5Z C;  1I3Q H;  2PMZ B;  2VXW A;  1WCM G;  1E22 A;  1LTB D;  5E4W C;  3P20 A;  4CDC C;  1TII D;  5I2Y A;  3M3Y B;  4RA8 A;  4DR2 L;  3K59 A;  1I3Q B;  1LTR D;  3S1M H;  1HNZ Q;  2D62 A;  5KRU A;  2ATW A;  4X64 Q;  4CBV A;  4IO9 A;  1RKN A;  3LWU A;  1GD7 A;  4K5X A;  1SAP A;  1N32 L;  4RCN A;  3S1M B;  1NCV A;  2RBM A;  1U4R A;  1W3S A;  1L1O C;  1CSP A;  1ZXT A;  1UE1 A;  2K5Q A;  1Y14 B;  1GM5 A;  1TS2 A;  1CKN B;  4DV2 L;  1U4M A;  1VQ8 A;  2SNM A;  1I4Q A;  4RGN A;  4C3J G;  2XIW A;  2KVM A;  1V8Q A;  2CWP A;  2RQX A;  1LUZ A;  3A54 A;  4LUO A;  3JC6 6;  3HFZ B;  2EYL A;  4X65 Q;  2EY1 A;  1O7I A;  3GTM H;  2Q8I B;  1HR0 Q;  3GD7 A;  4ZAI A;  4BS9 A;  2I5H A;  1D5X C;  1LM0 A;  4J8Q A;  4KLK A;  1JWS D;  1E2V A;  1T9H A;  2WAQ B;  3GTM B;  2AMC B;  4P74 A;  4JW0 A;  2TMP A;  3QWN A;  2BA1 A;  1TXY A;  4A3B G;  2BE5 D;  5BN5 A;  4OXP A;  2NWG A;  3NPP A;  1WTV A;  1S3O A;  5EKL A;  1EYC A;  5FO7 B;  5KEE A;  3S9W A;  1NMF A;  2NVY H;  2ZJR A;  2J4X A;  1SRU A;  3T53 B;  4A3K H;  3DHQ A;  4BBR H;  2DY7 A;  4UPA A;  2JA6 H;  2EOT A;  1QIL A;  1VQN A;  2UXC Q;  1NY4 A;  3H3V C;  3GTQ B;  3E0E A;  1CZW A;  1JJ2 A;  4QB4 A;  3HOV H;  2JA6 B;  1I6V C;  2QW7 A;  3EJI A;  3NSW A;  3LNN A;  2L5T A;  1G2T A;  4IOC A;  4GKK Q;  1PH2 A;  4IUP A;  4JBJ A;  2K7V A;  2K50 A;  3KF8 A;  3BDL A;  3S16 H;  1NAP A;  4UY8 C;  1MJE A;  1HZA A;  5FLM H;  1Q81 C;  3D6W A;  4GN5 A;  5HGQ A;  3I4N H;  4ZLT F;  2Z6B A;  2DGY A;  2HHH L;  1S4Z A;  3J81 j;  2JA5 B;  3S16 B;  3GTP H;  3E9H A;  1AN8 A;  1SYG A;  2F0F A;  1X32 A;  1IBL Q;  4JI0 Q;  1PV4 A;  4LAA A;  3DXJ C;  4X66 L;  4QUC A;  2CH4 A;  3I4N B;  4HMI A;  3I55 A;  2ENB A;  2Y0S B;  3GTP B;  4FF4 A;  5M3F H;  1X3Q A;  2F4I A;  2YTX A;  4DAM A;  3KFU A;  3HS0 C;  4DR7 L;  3S1Q H;  3CKI B;  2E2D C;  3H94 A;  4FDB A;  2L1B A;  4JK1 C;  3I56 A;  3G48 A;  1VS0 A;  3CQZ B;  2NVT H;  2OQK A;  1L0X B;  3I4M G;  1WTW A;  4DV4 Q;  1N8R C;  5TSS A;  1STB A;  2YTV A;  2XRS D;  1SNM A;  3J7Y W;  4JOI A;  4E6I A;  1PTO B;  2K4K A;  2NVT B;  3CP0 A;  3BJU A;  2VW9 A;  1QNU A;  4A3I G;  4QUF A;  2K01 A;  2OTJ A;  5KYI A;  4RH6 A;  1MIU A;  3HEJ A;  1QWY A;  3PIO 3;  3MZ5 A;  4LF8 L;  2B63 G;  3TP7 A;  1IW7 C;  3KJO A;  1KAW A;  3CU7 A;  2ZJQ A;  1JJC B;  2R92 H;  1VQO A;  1TWC H;  1HCZ A;  1CKM A;  3ERO A;  4LF9 Q;  1OXT A;  2JEA I;  4B3R L;  3A0J A;  2IX1 A;  4QJF A;  3KK7 A;  4PV1 C;  2YYZ A;  2R92 B;  4A3G B;  1TWC B;  3TP8 A;  3F2C A;  3KF6 A;  1IKM A;  4IUT A;  4PNY A;  4MN3 A;  5BR8 Q;  5M3M H;  2K52 A;  2MHV A;  1WTP A;  4B3T Q;  1FJG L;  5I6Y A;  5IYC H;  4GOP B;  3P7J A;  4M1U B;  1VQI A;  3RN5 A;  4OEL B;  4QMG A;  4Z9C B;  1GUO A;  4A93 H;  2DY8 A;  2QKI C;  2JK8 A;  2EYH A;  4O2D A;  4A3J H;  1UE5 A;  4A75 A;  1R9T H;  1B3Q A;  3VDY A;  3K5N A;  3M7G A;  4GS3 A;  5C0X H;  2HCI A;  4A93 B;  4ZCK A;  1G51 A;  2RDF A;  3J7A 5;  2VUM G;  1NSN S;  4WFN 3;  1DM0 B;  5K36 G;  2FXQ A;  3FPP A;  3KLR A;  1DGS A;  1Q82 C;  1PZJ D;  5GAH C;  2B2V A;  1RCV D;  3CPF A;  4X62 Q;  1EEI D;  1EY8 A;  4FF3 A;  1UWV A;  3NEL A;  1E0B A;  1EWC A;  2B2W C;  3SE0 A;  1U4L A;  1VQH A;  4HMJ A;  2KQ3 A;  2E8G A;  1NR4 A;  4KKU A;  1PFS A;  2EY2 A;  2F0N A;  5IWA L;  1XMO Q;  4XQJ A;  2XWJ B;  3NQI A;  3SGI A;  4OO1 G;  2PO4 A;  5IYD H;  3RR5 A;  3HZX A;  4TVA B;  3KLS X;  1C8C A;  1LLR D;  4A3M H;  4H13 C;  1I4H A;  1FNV A;  1GJX A;  1LTI D;  1SE4 A;  3NBI A;  3PF4 A;  2EYO A;  3OMC A;  4DAY B;  4A3M B;  1JJG A;  1EIG A;  1YNN D;  1XMQ Q;  3PUV A;  4HSV A;  3DWA A;  3G6E A;  1M1K C;  4OO1 I;  5IOC A;  3Q0A A;  3F2D A;  1EWH A;  4XYQ A;  3VR6 A;  1VF5 C;  3R8B A;  3OYY A;  2JEB I;  2OEO A;  3T1H Q;  4A3C H;  1EUJ A;  2LKV A;  2E2J B;  1H9M A;  5A35 A;  1PTO D;  4G7O C;  1CTM A;  1FGU A;  3UDI A;  1K73 C;  2K05 A;  1BCP B;  2JA8 G;  4PZ6 A;  1AE3 A;  4ZYS A;  3AYH B;  3BG3 A;  3G4S A;  2MFI A;  3Q6S A;  1DON A;  4UAI A;  1D1I A;  2L11 A;  2ICE C;  1QG7 A;  4GZY C;  2Z0S A;  2OTL A;  1CT1 D;  3JAM L;  5ELN A;  1JB3 A;  4PG3 A;  5DM6 3;  4RCO A;  2N3S A;  2A68 D;  1Z9F A;  4IQZ A;  2RDG A;  5I6W A;  3CCU A;  2Z6K C;  2B2W A;  1MD2 D;  2O2L D;  1TY0 A;  1ENF A;  2PW5 A;  3JAM E;  4OX9 L;  1LTT D;  4JI3 Q;  1NE3 A;  1X54 A;  3D8G A;  4KN4 C;  3HRZ C;  3AFQ A;  2PPB C;  3J81 E;  4DR6 L;  4F8M A;  1Y1V H;  2O5I C;  1GOZ A;  3OHX C;  2CW0 D;  2UUB Q;  1HNX L;  2NTT A;  1ICF B;  1O7Y A;  2TSS A;  1PVO A;  1N36 Q;  1G8Z D;  4KMU C;  1Q90 A;  1I4P A;  1Y1V B;  3STB C;  1YJ9 A;  5GQO A;  5CC4 A;  1V1P A;  4RMF A;  1VQ4 A;  5KND A;  4R8I A;  2I46 A;  2KHI A;  5EPK A;  3QOL A;  5C4Z A;  1Z7T A;  3V05 A;  5C4X G;  4C3I G;  4H7B A;  1O7Z A;  1OXV A;  4NKL A;  2HT1 A;  5IT9 L;  1ROD A;  1SEB D;  4DUY L;  3HOY G;  1M90 C;  3HOW H;  3PQI A;  4JI6 Q;  1KLG D;  1SYC A;  2CHB D;  2K5N A;  3S14 H;  1TWH B;  3OPO A;  3W2D A;  5I2X A;  5IT9 E;  1Y1W H;  1L1O B;  1MSH A;  4AIM A;  3A55 A;  4LF6 L;  4S3S A;  1V1Q A;  4LF5 Q;  1FNU A;  5BN3 A;  1C9O A;  1OXU A;  3S14 B;  5J3B A;  1Y1W B;  4F87 A;  4JYA L;  2XVS A;  1LTL A;  2NUC A;  4LFA L;  1M8A A;  4DV7 L;  2R61 A;  4JV5 Q;  4DR4 L;  1IYJ B;  2F4V L;  2R6G A;  4L5R C;  2MQH A;  4KK7 A;  1A63 A;  2KEN A;  5DLQ E;  3JAM i;  2LXJ A;  5KIX A;  1QZH A;  2VQE Q;  1H95 A;  4L6T B;  2A6E C;  1C0A A;  2WB1 G;  1E24 A;  4OIJ A;  3J81 i;  3IFT A;  1STE A;  1W2B A;  1Z6H A;  2Q2U A;  4RGM A;  3M4O H;  2R7Z G;  4DV5 L;  4JI1 Q;  2Q2I A;  4FF1 A;  4HIO A;  3EVQ A;  1HA6 A;  5AJ3 L;  3HOZ G;  4LF4 Q;  3H3V H;  4ZKB B;  4LFC L;  2A8V A;  2PCF B;  4JG2 A;  2F3I A;  2A69 D;  4NXN L;  1CHP D;  1TR5 A;  4P73 A;  5H1S E;  2VQF Q;  3M4O B;  2UUA L;  4RGT A;  5EKI A;  1PFB A;  3ZJY C;  3HGB A;  1PYW D;  3K81 C;  1EU3 A;  3D4W A;  3JAM c;  4WRD A;  3L0O A;  4GNX C;  1HFG A;  1BCP D;  3MFY A;  1XNR L;  3BZD B;  3H91 A;  1F2Z A;  3FKI H;  4OL7 A;  1GUG A;  4DR2 Q;  2LS0 1;  1CI3 M;  4LJZ C;  2QDB A;  1D5M C;  3NEM A;  2K6A A;  2F3V A;  5C4J H;  3I4O A;  4XYO A;  5G3L D;  4PZ8 A;  1N32 Q;  4RAU C;  1T5X D;  4CDF C;  2ZTC A;  2ZXO A;  3I70 A;  2K5W A;  2R93 H;  1KNA A;  3DWQ A;  3CF5 A;  2UU9 L;  4DV2 Q;  4N8X 1;  1X3G A;  3CCQ A;  1SBB B;  2AUJ D;  4LUV A;  4PZ7 A;  1RD9 D;  4RGO S;  3VA5 A;  3VR3 A;  1TWG H;  5M5Y B;  4BBS B;  1LO5 D;  3GV3 A;  2HDL A;  4JI8 Q;  4TKO B;  2D0P A;  4PMC A;  1H9S B;  2B8F A;  1BBU A;  5EAY A;  2IX0 A;  2JA7 H;  2M00 A;  3K7A H;  2PQA B;  2SEB D;  3NTK A;  3KLW A;  1TWG B;  5LMN L;  4CGY B;  1OTC A;  5FLX L;  3RMH A;  2WAQ G;  4KKT A;  2N8N A;  4DV6 L;  1PTO F;  1VDZ A;  3PO3 H;  2H5X A;  1ILQ A;  3NWS A;  4HJ8 A;  2F0I A;  3K7A B;  4LWC A;  5E4X A;  1WI5 A;  2QF7 A;  5E1F A;  2MO0 A;  2O5J C;  2RCN A;  1EL0 A;  1KD1 C;  5FLX E;  1EY5 A;  4OIK A;  1FD7 D;  2A1A A;  1QCB D;  3IRB A;  3PO3 B;  2L15 A;  3OIQ A;  4R4Q A;  3BDC A;  4AYB E;  4IN3 A;  1V1O A;  5EQ0 A;  4GOP A;  3HKZ G;  1PRT B;  4A3D H;  5J39 A;  1CHQ D;  1BKB A;  2VB2 X;  4XQN A;  3ERS X;  1JMC A;  5CV8 A;  2AKW B;  1HTL D;  1YHA A;  1TWF H;  3WDN A;  2JA6 G;  1ZKO A;  1A2U A;  1G29 1;  5NUC A;  2E75 C;  2CWA A;  3ULL A;  1I50 H;  2FIN B;  2NYZ D;  3CME A;  5FJ8 G;  3H09 A;  1CSQ A;  1NBW A;  4GLV B;  4K14 A;  1TWF B;  4QGU A;  1KRS A;  2CKZ B;  3U9O A;  1A0I A;  1EOT A;  3F2B A;  2L0C A;  3T1Y L;  1N34 L;  4Y52 H;  3UE0 A;  1I50 B;  3H0G H;  4NDX A;  1T5E A;  4IJH A;  4B08 A;  4DFA A;  1DD2 A;  2KCT A;  1YBY A;  2JA5 G;  2AQ2 B;  3KOJ A;  1BDO A;  4HIK A;  2JSO A;  2HHH Q;  1HPC A;  2I5L X;  5FLM G;  2KBN A;  1VQD A;  2A5H A;  1SRO A;  1MJC A;  2KUM A;  4IFD H;  1EY0 A;  3P1H A;  4X66 Q;  3I4N G;  4B9X A;  5IGB A;  1SN8 A;  2Y0S G;  3W5O A;  4HTH A;  1SNC A;  1EQR A;  4J1M A;  5EGT A;  2LY7 A;  5DEH A;  5HY6 A;  4YCV A;  2VY3 A;  4DR7 Q;  1STN A;  2E5L L;  1BO0 A;  3VR2 A;  3BYT B;  2WFW A;  3CCJ A;  2N49 A;  2UXD L;  1J5E L;  1IYV A;  2JXM B;  1G6Z A;  1NR2 A;  3RLF A;  1XTC D;  1FYC A;  1QB5 D;  1XNQ L;  2F0M A;  1S72 A;  1E7Z A;  1YEZ A;  5LMN W;  2A6H C;  3KBG A;  1Y8O B;  1XPU A;  3TRE A;  5C0X J;  1X9N A;  3CD6 A;  4OWW B;  2RA4 A;  4LF8 Q;  4KI0 A;  3MFG A;  1AP0 A;  1WVL A;  4NW2 A;  4LF7 L;  4C3H H;  4PMW A;  4Q0F A;  2B2T C;  2F0P A;  1OO9 B;  1TY2 A;  1K8M A;  1X65 A;  4KY6 A;  3W1B A;  3HOU H;  2BA0 A;  2XTI A;  5FLX c;  3G7L A;  2P5Z X;  1MBY A;  4B3R Q;  4Y7N H;  3S2D H;  2R92 G;  2HUG A;  2IPK D;  3C2P A;  4A3G G;  1ET9 A;  4AQY L;  2HCC A;  1GKH A;  2OQ0 A;  1JOR A;  3RLN A;  2ZT9 C;  1MHW C;  1EYA A;  3K8A A;  5FO9 B;  1AZQ A;  3HOU B;  3IAY A;  2B39 A;  4CKE A;  1IYU A;  2BDN A;  1U4P A;  3S2D B;  4IZ8 A;  2KHJ A;  4RWS C;  5IGC A;  3SHL A;  4DV0 L;  4V19 0;  1FJG Q;  2EZV A;  4K8J A;  4WJ3 M;  4JOI C;  5C44 H;  2K28 A;  4DK1 A;  1HZB A;  3PUX A;  4YIJ A;  4JBW A;  2PNR C;  1A15 A;  2AWN A;  2DNC A;  5CV9 A;  3S17 H;  5AFW A;  4HID A;  2NVY B;  5ELC A;  1HNW L;  1IKL A;  1RTN A;  5C5M A;  4FP5 D;  1O80 A;  4A3K B;  2RSN A;  3RUZ A;  4BBR B;  2Z1C A;  2KCM A;  1A3V A;  2QA4 A;  4B3S L;  4A93 G;  2OT2 A;  3A8I E;  3MXN B;  4AYB B;  1SMY D;  5G3L F;  1VQC A;  4CDD C;  1Q3L A;  1PRT D;  1XJV A;  1Y8N B;  2PZW A;  4X3S A;  3K5L A;  4QF4 A;  2OWO A;  1EEF D;  4LFB L;  3FPU B;  4R4I A;  3HOV B;  3N52 A;  1EU4 A;  1RHP A;  1BVS A;  1RIP A;  3D0F A;  2FMM A;  3VR4 A;  3CMA A;  1LAB A;  2C35 B;  1SMX A;  1FR3 A;  2OF1 A;  4H02 A;  1X3F A;  1B7Y B;  1GVP A;  2BH2 A;  2HDM A;  3I7F A;  1H9J A;  5DNF A;  3GTK H;  1UEB A;  3TZD A;  2CQO A;  3LWE A;  3GTO H;  2A19 A;  1HZ9 A;  5IWA Q;  4X3K A;  3J7A V;  2B2U A;  1HTP A;  1VQA A;  2B2T A;  1Z47 A;  3GTK B;  3K0Y A;  3L3O C;  4KHV A;  5CMD A;  1PH9 A;  3PIP A;  1KIX A;  1QUQ A;  2PI2 A;  2PNH A;  4NXM L;  4JI2 L;  5CBA E;  3X3N A;  1ONL A;  4NPS A;  1F9R A;  4V0B A;  5IYD G;  3NWT A;  2HQL A;  1J6Q A;  5JPM C;  1OXS C;  1PH3 A;  1QOH A;  5M3F B;  3GV6 A;  2B2V C;  4A3M G;  1E2W A;  1VMC A;  3K0X A;  1EFW A;  5EJW A;  3S1Q B;  2EY6 A;  2ZXP A;  1D7Q A;  2KCN A;  1A2T A;  3FP9 A;  3MVV A;  1PZI D;  2BE5 C;  2BOS A;  4BY7 H;  3GTL H;  4DV1 L;  1I6H H;  1IBM L;  5E7N A;  2RDH A;  1SYE A;  3AU7 A;  3S15 H;  3CRL C;  1I5F A;  3BZK A;  4DK3 C;  1LTA D;  4C3J H;  4A3F H;  2HD3 A;  4BXX H;  4BY7 B;  5ELE A;  3H15 A;  3M9B A;  3GTL B;  4A4I A;  3TZU A;  1I6H B;  5A2Q L;  2K75 A;  5GAE C;  5M5W H;  3SK6 A;  3S15 B;  3ULP A;  2XGT A;  4A3F B;  4A3L G;  1Y69 U;  4A3C G;  4ABN A;  1K9M C;  4C56 C;  1VQB A;  2F0E A;  4KN7 C;  5A2Q E;  1EQQ A;  1IL8 A;  4XTC S;  2R3Z A;  4A76 A;  1HQR D;  1DOK A;  5M5X H;  5M5W B;  1AW7 A;  5D3D A;  2AHO B;  1B53 A;  3I91 A;  1A6X A;  1S5B D;  4O0A A;  5M3M B;  1PH8 A;  5M5X B;  4OX9 Q;  1DYQ A;  1VQJ A;  1P16 A;  1J9O A;  1JE4 A;  5JAV A;  4YWM A;  2F0S A;  1HRJ A;  4DR6 Q;  2QEX A;  1KDC A;  2EYP A;  1B44 D;  2WII B;  2F3W A;  5JJZ A;  4JI4 L;  1HNX Q;  1L0Y B;  3BZC A;  4A3J B;  3E9I A;  1R9T B;  4DUZ L;  4I7Z C;  4X6A H;  2EXD A;  1UNS A;  2KEE A;  5D14 A;  1F2Y A;  1NJI C;  2G9D A;  4KHP L;  1DZ1 A;  3VR5 A;  3R3O A;  4KHZ A;  3PO2 H;  2I0Q A;  1HUN A;  1Q7Y C;  2KCC A;  4M8A A;  4KJO A;  2GN5 A;  1G6P A;  2EYM A;  1B9N A;  4RKB A;  4ZKC B;  3T51 B;  4DUY Q;  4J6H A;  1ML0 D;  2EJG C;  1IXR A;  4OEM B;  2UUC L;  4G7Z C;  2PQA A;  3PO2 B;  3G6J B;  3CCM A;  2L12 A;  2FMC A;  2CVR A;  1AEX A;  1C48 A;  4JCV E;  3ND8 A;  2L9H A;  4DV3 L;  1SYD A;  3ITP A;  2QGQ A;  4LF6 Q;  3V2T A;  3ULJ A;  3D4R A;  3PUW A;  2C5C A;  2BH8 A;  2MGS A;  1YHQ A;  4EQO A;  1JIC A;  1Y1W G;  1GXD C;  2XSC A;  1B2T A;  1WFQ A;  4DK0 A;  3AQQ A;  3RLO A;  4A3E H;  4JYA Q;  4MTK A;  4K8I A;  4P72 A;  3T16 A;  4LMQ D;  4LFA Q;  4F88 A;  3I90 A;  4DV7 Q;  5E3F A;  1U5K A;  5M9O A;  3KDF B;  4DR4 Q;  4TQU S;  2F4V Q;  4A3E B;  1VF7 A;  4XXE A;  4DN4 M;  2MP1 A;  2B2Y A;  1I94 L;  5ELF A;  2KED A;  3P75 A;  3OSO A;  3NHH A;  1S5D D;  3SR1 A;  1CQV A;  5J1Z A;  1C7Y A;  4IUU A;  3MEF A;  1VQ5 A;  1TT2 A;  1PRT F;  4DV5 Q;  3HG9 A;  1LAC A;  1WTX A;  1VMP A;  5AJ3 Q;  1E1O A;  3AB9 A;  4N9T A;  1ZYR D;  1B50 A;  4LFC Q;  2I07 B;  2NB0 A;  2J0T D;  4NXN Q;  1VQ7 A;  2K04 A;  4CDE C;  3NTI A;  5ELB A;  4GKJ L;  1O78 A;  2UUA Q;  1KQS A;  2F0L A;  3ERQ A;  3FVQ A;  1EY4 A;  3K5O A;  1MKH A;  3OW7 A;  1S40 A;  3R2I A;  4BY1 H;  1A3U A;  1I4R A;  2IWH A;  1E2Z A;  1Q12 A;  1XNR Q;  5JJL A;  2CQA A;  5IP9 H;  4DNI A;  1B1Z A;  2K5H A;  4BY1 B;  1E3P A;  3KJP A;  5CYU A;  3X3M A;  4QQB X;  2A6E D;  1QNK A;  1SLJ A;  1R4P B;  2EPB A;  1VCI A;  1ENC A;  3H3V I;  1PZK D;  1A8V A;  4X3T A;  1TKW B;  2UU9 Q;  2CH4 W;  3SEB A;  3F2U A;  5CGK A;  1CKN A;  2I5M X;  5DAU A;  1K8A C;  2IY5 B;  1E1T A;  1YVC A;  2Q8R E;  3KBX A;  4BBS G;  3T13 A;  4ODG A;  2DJF C;  1BF4 A;  1ASY A;  1BQQ T;  2KOL A;  1RL2 A;  1K3R A;  4EVO A;  2K1B A;  5LMN Q;  2CCZ A;  2ALY B;  1YNN C;  1KHI A;  2K5V A;  4DV6 Q;  2B8G A;  1DXM A;  1VQE A;  3EA6 A;  3HOW B;  3LGJ A;  4R4O A;  3E0J A;  1K8O A;  2B29 A;  2VL6 A;  1YJW A;  3FHW A;  1XTD A;  1YNJ D;  5IP7 G;  3PO3 G;  1K3B C;  2EDG A;  2N88 A;  1X3P A;  3PSI A;  4JI7 L;  4P2C B;  4DU9 A;  2RHQ B;  1D2B A;  1B70 B;  4IFD J;  1PTO C;  2VNU D;  4JBK A;  1JOQ A;  1TVX A;  3A7L A;  1PH5 A;  3CC2 A;  5L37 A;  1IBK L;  1ILP A;  2RHS B;  4IOA A;  5FOB B;  2RF4 A;  4QIW E;  1LTS D;  2F0U A;  3L9A X;  1GO3 E;  1ENA A;  3ER0 A;  1F9P A;  1FNW A;  1JWM D;  3T4A C;  2XNA C;  3L7Z C;  3BS1 A;  4R4T A;  3QG1 A;  2IL8 A;  5CV7 A;  2A68 C;  2FHT A;  4MIU A;  3UDG A;  1K0S A;  3A8K E;  1I4G A;  1SJE D;  2RVL A;  3T56 B;  4KD3 A;  3T1Y Q;  3RZO H;  1GHJ A;  1N34 Q;  2YU9 H;  2SOB A;  2CFM A;  1XMQ L;  2HIX A;  1SND A;  1FGB D;  2VS1 A;  4DR3 L;  3C1E A;  3M4Q A;  4GOP C;  3RZO B;  3MTS A;  5I9O A;  2CW0 C;  1PHJ A;  1N9W A;  2SNS A;  3RN2 A;  5KNB A;  3U50 C;  2Z4I A;  1WTQ A;  2F0V A;  1D8L A;  4RHR A;  3VYS A;  4DAP A;  1WTO A;  3SXH A;  2E74 C;  4KTA A;  3TP5 A;  2IW3 A;  4L8J A;  2Z4H A;  3CW2 C;  3CCV A;  1D1K A;  3NQT A;  1B9M A;  3FRP B;  4KJN A;  4FXD A;  1H9K A;  1LTG D;  2ID0 A;  4K2L A;  1IHZ A;  1Y8P B;  3KF6 B;  4R9W A;  2E2I H;  2E5L Q;  2GVB A;  2ZJP A;  1BUV T;  1BXT A;  5IOD A;  3FKI B;  1JT8 A;  2UXD Q;  1J5E Q;  1SE3 A;  3VA7 A;  3K58 A;  3HOX H;  5C4J B;  2E2I B;  3ND9 A;  4JI5 L;  1XNQ Q;  3A7A B;  2ICI A;  3RD4 A;  3ONA B;  4KY5 A;  3SK5 A;  4ALP A;  1YZ6 A;  2M2L A;  1SNP A;  3HOX B;  3CC4 A;  3BVZ A;  1PFN A;  2R93 B;  4YHH L;  4I7A A;  2EQS A;  1AFP A;  4LW1 A;  4LF7 Q;  2K5D A;  1EIY B;  1JR0 D;  3MXP A;  2EIF A;  4IFD I;  2R7D A;  1SYF A;  1BBX C;  1DOL A;  2OCE A;  5CR3 A;  1JOK A;  1GHK A;  5T1G A;  2QIL A;  4C3I H;  5IYB H;  5C3E H;  1JQY D;  4JVZ A;  1SNQ A;  4AQY Q;  2JA7 B;  4YY3 L;  3HOU G;  3EBE A;  1WD0 A;  5EKK A;  3I4L A;  1EIH A;  3CCS A;  2Z9H A;  2X69 A;  5ISR A;  5C3E B;  1QVC A;  4DV0 Q;  3A8J E;  3UE1 A;  1YJN A;  3U9S A;  2A69 C;  4RHS A;  5JEA H;  2N78 A;  2ZM6 L;  3HKZ E;  4ZQ3 A;  4OGQ C;  2AUK A;  1HNW Q;  4A3K G;  4IPD A;  4BBR G;  2A6H D;  3N6R A;  4AYB G;  1SE2 A;  4B3S Q;  4A3D B;  2JE6 I;  1MI2 A;  1ZEQ X;  3GTJ H;  1C4Q A;  2JA9 A;  3QB3 A;  3KLS A;  1KL9 A;  3HOV G;  5J22 A;  2A74 C;  4LFB Q;  1SE8 A;  3U58 A;  4IUV A;  5CBE E;  4QIW B;  3ZYY X;  3D3R A;  2IJ0 A;  3GTJ B;  1K0R A;  1S5E D;  2SDF A;  3TN2 A;  3I72 A;  1RF2 D;  2NN6 H;  1L2F A;  3HOZ H;  3QJY A;  5CV4 A;  3H0G B;  3PIO A;  4L63 B;  5LMU L;  1PLF A;  3E3X A;  4JI1 L;  3PF5 A;  1ESF A;  1CA6 A;  2ZTD A;  3FEW X;  4C2M H;  4B3M L;  5I9P A;  1K8G A;  2UXB L;  2VQF L;  5C3X A;  3RZD H;  2VZA A;  5CV5 A;  4NXM Q;  4JI2 Q;  1AZP A;  1KLU D;  2G9H D;  4ZRZ A;  3S24 A;  5M3F G;  1BOS A;  2PW7 A;  3B6Y A;  2KHS A;  4K0K L;  3RZD B;  4O1N A;  1SNO A;  2Q2H A;  1N33 L;  4DAY A;  1GUN A;  3MHB A;  1PFM A;  3OTO L;  4DK6 C;  3KDF A;  2JP1 A;  4ME3 A;  4OHJ A;  4DR1 L;  3NBH B;  3SK4 A;  1ESR A;  3L2P A;  5IGG A;  1UUP A;  4DV1 Q;  1HQM C;  3IKJ A;  1IBM Q;  4ID6 A;  2KJX A;  4G7H C;  4DXF A;  2R7F A;  4EX5 A;  4OON A;  2B2U C;  4BY7 G;  1LT4 D;  3AMU A;  1HA5 A;  2D9U A;  5COY A;  3SDZ A;  3NE5 B;  3NXW A;  1STG A;  4DAV A;  1II3 A;  4HAE A;  1S5F D;  5GAD C;  3TQY A;  1V1P B;  4A3F G;  3TS2 A;  4BXX G;  4C3H B;  1NTG A;  3PCO B;  3DEO A;  2H4O A;  1F77 A;  4JI8 L;  1R4Q B;  1LT3 D;  4YCW A;  4ZK9 B;  4HIM A;  1UEA B;  4DR5 L;  2MNA A;  4Y7N B;  1G91 A;  4DKA C;  1SDF A;  2K33 A;  5C6A A;  1CUK A;  5M3M G;  1BCP F;  3D4D A;  2AQ1 B;  4OWX B;  4CJ1 B;  4DNT B;  1CZG A;  4UP7 A;  2EYF A;  5IYC G;  1LT5 D;  3DUZ A;  5C44 B;  1UAP A;  3Q22 A;  1B4O A;  5COR A;  1F9S A;  3MXG A;  4QY7 A;  3GTQ H;  4XIG S;  5F2D A;  4BA1 I;  4A3J G;  4JI4 Q;  1EQT A;  1IW7 D;  2WIN B;  3S17 B;  4DUZ Q;  3URY A;  3BVM A;  4TRD A;  3IFD A;  4AH6 A;  3HKZ B;  4BWG B;  5C0X G;  3S2H H;  5HGT A;  2ASB A;  4KHP Q;  3OMG A;  5FJ8 H;  2XN9 C;  1CA5 A;  2EYJ A;  2G5D A;  3MAQ A;  4XT1 B;  2NTS A;  1HH2 P;  4RKL A;  3S2H B;  5KYL A;  3NK9 A;  3QIA A;  1Q46 A;  5IE8 A;  4N9P A;  3F8T A;  3PO2 G;  2UUC Q;  1M4V A;  5FKA C;  1STH A;  3R93 A;  2HIV A;  3MWY W;  3SVM A;  2O4X A;  4DV3 Q;  1K83 H;  2JA5 H;  1DJR D;  3A5Z B;  4FYD A;  1L1O A;  3SK8 A;  4EQ5 A;  1A62 A;  1WCM H;  4UDU C;  5C0X I;  5IGE A;  1P8L A;  3GTO B;  2K14 A;  1XPR A;  1W6J A;  3Q8D A;  4FXK C;  1K83 B;  2D5D A;  1VQP A;  4MNO A;  4F7X A;  1WCM B;  1YI2 A;  1PYB A;  2K32 A;  3BU2 A;  2QDL A;  5GAG C;  3OWE B;  3J80 L;  4A3E G;  3QO2 A;  1DOM A;  3I73 A;  3KYH C;  1HNZ L;  3CQZ H;  4X64 L;  1BR9 A;  1W6K A;  4B9W A;  2X6G A;  1I94 Q;  1XX8 A;  4X3U A;  2KEC A;  2C9O A;  1HJP A;  4HJ9 A;  4EQP A;  5ELD A;  3K57 A;  1MGS A;  2LSS A;  3J80 E;  3J7Z C;  3TBI B;  1PTO H;  2OXP A;  3BYY B;  4K2K A;  4UHV A;  4U67 3;  3TEH B;  1EY7 A;  2YTY A;  4HCE A;  4U68 A;  2K03 A;  2WAC A;  5EPJ A;  1XXG A;  4MHE A;  3TME A;  1VQF A;  4GKJ Q;  1YIJ A;  2RKS A;  4C3J B;  3PMF A;  3CHB D;  3D31 A;  4QCL A;  2WV6 D;  5C5L A;  1SYB A;  1SMY C;  5GRO A;  1PRT C;  1K28 A;  4X65 L;  1HR0 L;  4A3G H;  1XWE A;  3QOJ A;  3M4P A;  3G71 A;  4KD4 A;  1JWU D;  2B2Y C;  4A3B H;  4QL5 A;  3UDX A;  4BY1 G;  4CHT B;  2EJM A;  1KTK A;  1LT6 D;  1X6O A;  1QJO A;  2E2H H;  3K6O A;  1ASZ A;  1J8I A;  5IP9 G;  4A3B B;  4MZ9 A;  1KXL A;  4EGV A;  4GN3 B;  3DM3 A;  4JBM A;  2IHE A;  3S1N H;  3AFP A;  4KKS A;  2LXK A;  2Q8T A;  1GUS A;  3A5U A;  4GLX A;  2E2H B;  1HFN A;  2JQO A;  3S1R H;  1Y1V G;  1UE7 A;  3M7N A;  4R4C A;  2UXC L;  4WJW A;  1Q1E A;  4IPH A;  4GNX B;  2X6L A;  4IUN A;  3S1N B;  4R1J A;  3AEV A;  2M9V A;  4YCU A;  3S1R B;  4H0L C;  5D3I B;  1H9S A;  3EQL C;  3E5S A;  5DM7 3;  3J80 i;  5JVH 3;  1X56 A;  2ZXR A;  4GKK L;  4IJL A;  3QR8 A;  1WTH A;  2DUD A;  4ME5 A;  4XQQ A;  2B3G A;  4POF A;  4L5S A;  2F52 A;  3Q24 A;  4GLA C;  1JE5 A;  3HOW G;  3M85 A;  3OW2 A;  2F0W A;  4L5Q A;  3CPW A;  4HJ7 A;  1QE6 A;  4IUQ A;  3K80 C;  2PI2 E;  3NTH A;  5KNC A;  1STY A;  2HQE A;  5C3W A;  1O7L A;  1QVG A;  1AH9 A;  1NMG A;  4JI7 Q;  4YWK A;  1NUC A;  2F0O A;  1EOV A;  1Q8I A;  1PYS B;  3HKS A;  4H44 C;  4FXG C;  1IBL L;  4JI0 L;  5EBC A;  1IBK Q;  2JJQ A;  4HR7 B;  2F0G A;  3J80 c;  3STB D;  4OWT B;  1QVF A;  2V1C C;  4DA2 A;  4HED A;  3I4M H;  4YWL A;  4N8F A;  3LX0 A;  2A73 B;  1EWI A;  3DLL A;  4HJA A;  1OXX K;  5KGU A;  1XPO A;  3MC0 B;  2PZT A;  1JOO A;  2DN8 A;  1VQK A;  4DV4 L;  4A3I H;  3I4M B;  4CJ2 C;  1HR0 W;  1CKO A;  3GP7 A;  2B63 H;  4FVM A;  1PH4 A;  1FVI A;  2J7Z A;  3BDO A;  3FMC A;  5LL6 S;  1YNX A;  4RG1 A;  2Q2T A;  4DR3 Q;  3EN2 A;  2L4N A;  5LHY 1;  1MSG A;  2E2J H;  4A3I B;  1SFO H;  3F1Z A;  4CKC A;  4NP5 A;  2QEJ C;  1EQV A;  1F2L A;  3CC7 A;  4J15 A;  2B63 B;  1XYI A;  3RNU A;  1RDP D;  4A3L H;  1I4X A;  3HP3 A;  3PGZ A;  3K5M A;  2N55 A;  3A74 A;  3EFX D;  4LF9 L;  2ZTE A;  1SFO B;  4Q5V A;  3NUC A;  1TU2 B;  1X55 A;  4L5T A;  3VYT A;  4EQN A;  3PIP 3;  2VB3 X;  1RTO A;  2F0Q A;  1QZG A;  3CCR A;  3FKI G;  5BR8 L;  2Z8L A;  4B3T L;  4XT3 B;  2XRQ D;  4GN4 B;  2WKD A;  3J81 L;  5JEA J;  4DPG A;  2DJG C;  4JI5 Q;  2EY5 A;  1TS3 A;  3TP6 A;  2PYK A;  1JB7 A;  3PUY A;  3I3C A;  2F1M A;  3HOX G;  3NBH A;  3VYR A;  1TWA H;  2VUM H;  4FF2 A;  1A3T A;  2WKC A;  2R93 G;  2F03 A;  1KNE A;  4PMB A;  4YHH Q;  5K36 H;  4ILW A;  4ULL A;  3CAM A;  1VQG A;  4FO2 A;  4LNQ A;  5JOB A;  4APV A;  1ET6 A;  1EY6 A;  1TWA B;  2VUM B;  4P71 A;  3UDF A;  3GO5 A;  4CJ0 B;  3C46 A;  1LV9 A;  4DGZ A;  4K5V A;  2F0T A;  3DMU A;  3KF8 B;  2F0J A;  2L55 A;  5EPL A;  2JA7 G;  4DXG A;  1TS5 A;  4YY3 Q;  2EVB A;  2NVQ H;  2GA4 B;  1CM9 A;  4X62 L;  1CK1 A;  1UE6 A;  5HUR A;  5IYB G;  4G57 A;  5C3E G;  1IL2 A;  1TWH H;  1FL0 A;  4I65 A;  2RSO A;  1SSO A;  3OIP A;  2EJF C;  4OO1 H;  1EYD A;  1ZYR C;  4HCS A;  2NVQ B;  1CFM A;  4RFB A;  1EZ8 A;  2ZM6 Q;  1XMO L;  1EFI D;  3PUZ A;  2IT1 A;  4CKB A;  5IGD A;  4P75 A;  2H1E A;  2IX3 A;  1L0W A;  1Q8K A;  2GVA A;  1QUQ B;  4A3D G;  5JEA G;  1G2S A;  1WTR A;  4C1N I;  5D65 A;  3W1G A;  1WD1 A;  3MXN A;  2D2C C;  1WOC A;  3U4Z A;  1V43 A;  3TDQ A;  2WB1 E;  2MJ8 A;  2DNE A;  3ICE A;  2NBF A;  1ICW A;  4XDX A;  1U9R A;  3DWP A;  5IGF A;  1KC8 C;  1STA A;  3C3L A;  2E76 C;  1LYL A;  1KDA A;  3MA2 B;  1JCK B;  2Z6K A;  1BBW A;  2AQ3 B;  5K5P A;  1PMR A;  1SXT A;  1B3A A;  3H0G G;  1SJH D;  2YU9 B;  1S5C D;  3GQB A;  3GTG H;  1JC7 A;  1VQL A;  2NZ1 D;  1HXY D;  3FDT A;  4UP9 A;  1PH1 A;  4TSS A;  4MTN A;  3CCE A;  5LMU Q;  2NN6 G;  2JA8 H;  5JJK A;  2PMZ E;  5IIF A;  2PZU A;  4K6L A;  3T1H L;  3NEN A;  5JJI A;  1KAB A;  4B3M Q;  1X3E A;  1EY9 A;  5C4H A;  1WJJ A;  3GTG B;  2UXB Q;  3I2Z A;  3IL8 A;  5CV6 A;  4JPB W;  2JA8 B;  4IFD G;  4K6D A;  3PV0 A;  2KA7 A; 
#chains in the Genus database with same CATH homology
 1HUM A;  2PQE A;  3MXU A;  4DF7 A;  1BNZ A;  4G4K A;  3TSS A;  2JYO A;  1TS4 A;  3O13 A;  4PQX A;  5JPN C;  2LFN A;  4FNF A;  3KUP A;  4O42 A;  4KY7 A;  4WOR A;  2NN6 I;  2V4D A;  5I4D A;  3DM1 A;  1YNJ C;  1D6E C;  3MEH A;  5T1I A;  5EBD A;  1GUT A;  3WOF A;  1PDQ A;  2AWO A;  3H6M A;  1GUW A;  5LL6 X;  2F0H A;  4K5W A;  2NVX B;  4LK1 C;  5BN4 A;  5JVG 3;  4BA2 I;  2BCO A;  3OWF A;  4C3H G;  3W3A A;  1HHV A;  4HSP A;  3NP8 A;  1CQF A;  4IAL A;  1F2M A;  2F0D A;  3A56 A;  1H9R A;  5C4X B;  4C3I B;  1Q1B A;  3HOY B;  3I8Z A;  5FO8 B;  1F9Q A;  2QCP X;  1KAA A;  2BDO A;  3OOC A;  3J7A F;  3Q23 A;  2FJ2 A;  2XWB B;  4NMZ A;  4DNR B;  2FFK B;  2F0K A;  1PXU A;  3V96 A;  1BCP C;  1KDB A;  4IUR A;  3R2T A;  2WP8 J;  1EZ6 A;  3E6Z X;  3DEP A;  3D6C A;  3M4Y A;  2LMC B;  2MPM A;  4ZUJ A;  4KV6 A;  2MUY A;  1RJT A;  4C1N K;  1DCZ A;  3BVG A;  2WB1 B;  4R8N A;  2R7Z B;  5FK9 C;  4HN7 A;  3HOZ B;  3VYU A;  3CRK C;  3UI2 A;  4ZUI A;  2EXZ A;  1TQO A;  3C1F A;  2EE1 A;  3WOE A;  4C2M B;  1D5Z C;  2PMZ B;  2VXW A;  1LTB D;  5E4W C;  3P20 A;  1TII D;  5I2Y A;  3M3Y B;  4RA8 A;  3K59 A;  1I3Q B;  1LTR D;  2D62 A;  5KRU A;  4CBV A;  1RKN A;  3LWU A;  4K5X A;  1SAP A;  4RCN A;  3S1M B;  1NCV A;  2RBM A;  1U4R A;  1ZXT A;  2K5Q A;  1TS2 A;  1U4M A;  2SNM A;  1I4Q A;  4RGN A;  4C3J G;  2XIW A;  2KVM A;  1V8Q A;  2RQX A;  3A54 A;  2EYL A;  2EY1 A;  2Q8I B;  3GD7 A;  4ZAI A;  4BS9 A;  1D5X C;  4J8Q A;  1JWS D;  1E2V A;  2WAQ B;  3GTM B;  2TMP A;  3QWN A;  2BA1 A;  2BE5 D;  5BN5 A;  2NWG A;  3NPP A;  1WTV A;  5EKL A;  1EYC A;  5FO7 B;  5KEE A;  3S9W A;  2J4X A;  3T53 B;  3DHQ A;  2DY7 A;  2EOT A;  1QIL A;  3H3V C;  3GTQ B;  1CZW A;  4QB4 A;  2JA6 B;  1I6V C;  3EJI A;  3NSW A;  3LNN A;  2L5T A;  1G2T A;  4IUP A;  2K7V A;  3KF8 A;  3BDL A;  1NAP A;  3D6W A;  4ZLT F;  1S4Z A;  2JA5 B;  3S16 B;  1AN8 A;  1SYG A;  2F0F A;  1X32 A;  4LAA A;  3DXJ C;  4QUC A;  3I4N B;  4HMI A;  2ENB A;  2Y0S B;  3GTP B;  4FF4 A;  1X3Q A;  2F4I A;  3HS0 C;  3CKI B;  2E2D C;  3H94 A;  2L1B A;  4JK1 C;  3CQZ B;  1L0X B;  1WTW A;  5TSS A;  1STB A;  2XRS D;  1SNM A;  3J7Y W;  4E6I A;  1PTO B;  2NVT B;  1QNU A;  4QUF A;  2K01 A;  5KYI A;  4RH6 A;  3HEJ A;  1QWY A;  3PIO 3;  3MZ5 A;  3TP7 A;  1IW7 C;  3CU7 A;  1HCZ A;  2JEA I;  3ERO A;  1OXT A;  2IX1 A;  3KK7 A;  4PV1 C;  2YYZ A;  2R92 B;  4A3G B;  1TWC B;  3TP8 A;  1IKM A;  4IUT A;  4PNY A;  4MN3 A;  2MHV A;  1WTP A;  5I6Y A;  3P7J A;  4M1U B;  4Z9C B;  4QMG A;  1GUO A;  2DY8 A;  2QKI C;  2EYH A;  3K5N A;  3M7G A;  5C0X H;  2HCI A;  4A93 B;  2RDF A;  1NSN S;  4WFN 3;  1DM0 B;  5K36 G;  3FPP A;  3KLR A;  1PZJ D;  2B2V A;  1RCV D;  1EEI D;  1EY8 A;  4FF3 A;  1E0B A;  1EWC A;  2B2W C;  3SE0 A;  1U4L A;  4HMJ A;  2KQ3 A;  1NR4 A;  4KKU A;  2EY2 A;  2F0N A;  4XQJ A;  2XWJ B;  3NQI A;  4OO1 G;  2PO4 A;  3HZX A;  3KLS X;  1C8C A;  1LLR D;  4H13 C;  1I4H A;  1FNV A;  1GJX A;  1LTI D;  1SE4 A;  3NBI A;  2EYO A;  3OMC A;  4A3M B;  1EIG A;  1YNN D;  3PUV A;  4HSV A;  3DWA A;  4OO1 I;  5IOC A;  3Q0A A;  1EWH A;  4XYQ A;  3VR6 A;  1VF5 C;  3R8B A;  2JEB I;  2OEO A;  2LKV A;  4G7O C;  2E2J B;  1H9M A;  5A35 A;  1PTO D;  1CTM A;  2K05 A;  1BCP B;  4ZYS A;  3BG3 A;  3Q6S A;  1DON A;  4UAI A;  1D1I A;  2L11 A;  2ICE C;  1QG7 A;  4GZY C;  1CT1 D;  3JAM L;  1JB3 A;  5DM6 3;  4RCO A;  2A68 D;  4IQZ A;  2RDG A;  5I6W A;  2B2W A;  1MD2 D;  2O2L D;  1TY0 A;  1ENF A;  2PW5 A;  3JAM E;  1LTT D;  3D8G A;  4KN4 C;  3HRZ C;  2PPB C;  3J81 E;  4F8M A;  2O5I C;  1GOZ A;  3OHX C;  2CW0 D;  2NTT A;  2TSS A;  1O7Y A;  1G8Z D;  4KMU C;  1Q90 A;  1I4P A;  1Y1V B;  5CC4 A;  1V1P A;  5KND A;  4R8I A;  2I46 A;  5EPK A;  5C4Z A;  3QOL A;  1Z7T A;  3V05 A;  4C3I G;  4H7B A;  1O7Z A;  1OXV A;  4NKL A;  5IT9 L;  1ROD A;  1SEB D;  1KLG D;  1SYC A;  2CHB D;  1TWH B;  3OPO A;  3W2D A;  5I2X A;  5IT9 E;  1MSH A;  3A55 A;  4S3S A;  1FNU A;  5BN3 A;  1OXU A;  3S14 B;  1Y1W B;  4F87 A;  2XVS A;  2NUC A;  1M8A A;  2R61 A;  2R6G A;  4KK7 A;  5KIX A;  4L6T B;  2A6E C;  4OIJ A;  3IFT A;  1STE A;  1Z6H A;  4RGM A;  4FF1 A;  3EVQ A;  1HA6 A;  4ZKB B;  2PCF B;  2A69 D;  1CHP D;  1TR5 A;  3M4O B;  4RGT A;  5EKI A;  1PFB A;  3HGB A;  1PYW D;  1EU3 A;  3D4W A;  4WRD A;  1HFG A;  1BCP D;  3MFY A;  3BZD B;  3H91 A;  1F2Z A;  4OL7 A;  1GUG A;  2LS0 1;  1CI3 M;  4LJZ C;  2QDB A;  1D5M C;  2K6A A;  2F3V A;  4XYO A;  5G3L D;  4RAU C;  1T5X D;  2ZXO A;  3I70 A;  2K5W A;  1KNA A;  3DWQ A;  1SBB B;  2AUJ D;  1RD9 D;  4RGO S;  3VA5 A;  3VR3 A;  5M5Y B;  4BBS B;  1LO5 D;  3GV3 A;  2HDL A;  4TKO B;  4PMC A;  1H9S B;  2B8F A;  2IX0 A;  2M00 A;  2SEB D;  3NTK A;  1TWG B;  4CGY B;  5FLX L;  3RMH A;  4KKT A;  1PTO F;  1VDZ A;  1ILQ A;  3NWS A;  2F0I A;  3K7A B;  5E4X A;  2QF7 A;  5E1F A;  2O5J C;  1EL0 A;  5FLX E;  1EY5 A;  4OIK A;  1FD7 D;  1QCB D;  3PO3 B;  3OIQ A;  3BDC A;  4IN3 A;  1V1O A;  5EQ0 A;  1PRT B;  5J39 A;  1CHQ D;  2VB2 X;  4XQN A;  5CV8 A;  1HTL D;  3WDN A;  1ZKO A;  1A2U A;  1G29 1;  5NUC A;  2E75 C;  2FIN B;  2NYZ D;  3H09 A;  4K14 A;  1TWF B;  3U9O A;  1EOT A;  2L0C A;  1I50 B;  4NDX A;  1T5E A;  4B08 A;  4DFA A;  1DD2 A;  2AQ2 B;  1BDO A;  2JSO A;  1HPC A;  2A5H A;  2KUM A;  4IFD H;  1EY0 A;  3P1H A;  4B9X A;  5IGB A;  4HTH A;  1SNC A;  4J1M A;  5EGT A;  2LY7 A;  5DEH A;  1STN A;  1BO0 A;  3VR2 A;  3BYT B;  1IYV A;  2JXM B;  1G6Z A;  1NR2 A;  3RLF A;  1XTC D;  1FYC A;  1QB5 D;  2F0M A;  2A6H C;  3KBG A;  1Y8O B;  5C0X J;  2RA4 A;  4KI0 A;  3MFG A;  1AP0 A;  1WVL A;  4NW2 A;  4PMW A;  4Q0F A;  2B2T C;  2F0P A;  1OO9 B;  1TY2 A;  1K8M A;  4KY6 A;  2BA0 A;  3G7L A;  1MBY A;  2HUG A;  2IPK D;  3C2P A;  1ET9 A;  2HCC A;  1JOR A;  2ZT9 C;  1EYA A;  5FO9 B;  1AZQ A;  3HOU B;  3IAY A;  2B39 A;  4CKE A;  1IYU A;  2BDN A;  1U4P A;  3S2D B;  4IZ8 A;  4RWS C;  5IGC A;  3SHL A;  4V19 0;  2EZV A;  4K8J A;  2K28 A;  4DK1 A;  3PUX A;  4YIJ A;  4JBW A;  2PNR C;  1A15 A;  2AWN A;  2DNC A;  5CV9 A;  5AFW A;  2NVY B;  5ELC A;  1IKL A;  1RTN A;  5C5M A;  4FP5 D;  1O80 A;  4A3K B;  2RSN A;  3RUZ A;  4BBR B;  2Z1C A;  1A3V A;  2OT2 A;  3A8I E;  4AYB B;  1SMY D;  5G3L F;  1Q3L A;  1PRT D;  1Y8N B;  2PZW A;  4X3S A;  3K5L A;  4QF4 A;  1EEF D;  3FPU B;  3HOV B;  3N52 A;  1EU4 A;  1RHP A;  2FMM A;  3VR4 A;  1LAB A;  1FR3 A;  2OF1 A;  2HDM A;  1H9J A;  5DNF A;  3TZD A;  3LWE A;  4X3K A;  3J7A V;  2B2U A;  1HTP A;  2B2T A;  1Z47 A;  3GTK B;  3K0Y A;  3L3O C;  4KHV A;  5CMD A;  5CBA E;  3X3N A;  1ONL A;  4V0B A;  1F9R A;  3NWT A;  5JPM C;  1OXS C;  1QOH A;  5M3F B;  3GV6 A;  2B2V C;  1E2W A;  1VMC A;  5EJW A;  3S1Q B;  2EY6 A;  2ZXP A;  2KCN A;  1A2T A;  3MVV A;  1PZI D;  2BE5 C;  2BOS A;  2RDH A;  1SYE A;  3AU7 A;  3CRL C;  1LTA D;  4BY7 B;  5ELE A;  3GTL B;  3TZU A;  1I6H B;  5A2Q L;  3SK6 A;  3S15 B;  4A3F B;  1Y69 U;  4ABN A;  4C56 C;  2F0E A;  4KN7 C;  5A2Q E;  1IL8 A;  4XTC S;  2R3Z A;  1HQR D;  1DOK A;  5M5W B;  1AW7 A;  5D3D A;  1B53 A;  3I91 A;  1A6X A;  1S5B D;  5M3M B;  5M5X B;  1DYQ A;  1J9O A;  1JE4 A;  5JAV A;  2F0S A;  1HRJ A;  1KDC A;  2EYP A;  1B44 D;  2WII B;  2F3W A;  5JJZ A;  1L0Y B;  4A3J B;  1R9T B;  4I7Z C;  1UNS A;  2KEE A;  5D14 A;  1F2Y A;  2G9D A;  1DZ1 A;  3VR5 A;  3R3O A;  4KHZ A;  1HUN A;  2KCC A;  4M8A A;  4KJO A;  2EYM A;  1B9N A;  4RKB A;  4ZKC B;  3T51 B;  4J6H A;  1ML0 D;  2EJG C;  4G7Z C;  3PO2 B;  3G6J B;  2L12 A;  2FMC A;  2CVR A;  1AEX A;  1C48 A;  3ND8 A;  2L9H A;  1SYD A;  3ITP A;  3V2T A;  3D4R A;  3PUW A;  2C5C A;  2MGS A;  4EQO A;  1JIC A;  1GXD C;  2XSC A;  1B2T A;  4DK0 A;  4K8I A;  3T16 A;  4LMQ D;  4F88 A;  3I90 A;  5E3F A;  5M9O A;  4TQU S;  4A3E B;  1VF7 A;  4XXE A;  4DN4 M;  2MP1 A;  2B2Y A;  5ELF A;  2KED A;  3P75 A;  3OSO A;  3NHH A;  1S5D D;  3SR1 A;  1CQV A;  5J1Z A;  4IUU A;  1TT2 A;  1PRT F;  3HG9 A;  1LAC A;  1WTX A;  1VMP A;  3AB9 A;  4N9T A;  1B50 A;  1ZYR D;  2I07 B;  2NB0 A;  2J0T D;  2K04 A;  3NTI A;  5ELB A;  1O78 A;  2F0L A;  3ERQ A;  3FVQ A;  1EY4 A;  3K5O A;  3OW7 A;  3R2I A;  1A3U A;  1I4R A;  2IWH A;  1E2Z A;  1Q12 A;  2CQA A;  1B1Z A;  4BY1 B;  5CYU A;  3X3M A;  2A6E D;  1QNK A;  1R4P B;  2EPB A;  1VCI A;  1ENC A;  1PZK D;  4X3T A;  1TKW B;  3SEB A;  3F2U A;  5CGK A;  5DAU A;  2Q8R E;  3KBX A;  3T13 A;  4ODG A;  1BF4 A;  1BQQ T;  2KOL A;  4EVO A;  2K1B A;  1YNN C;  2B8G A;  1DXM A;  3EA6 A;  3HOW B;  3E0J A;  1K8O A;  1YNJ D;  2EDG A;  2N88 A;  1X3P A;  4P2C B;  4DU9 A;  1D2B A;  4IFD J;  1PTO C;  2VNU D;  1JOQ A;  1TVX A;  3A7L A;  1ILP A;  5FOB B;  1LTS D;  2F0U A;  3L9A X;  1ENA A;  1F9P A;  1FNW A;  1JWM D;  3T4A C;  2XNA C;  3L7Z C;  3BS1 A;  3QG1 A;  2IL8 A;  5CV7 A;  2A68 C;  2FHT A;  4MIU A;  3A8K E;  1I4G A;  1SJE D;  2RVL A;  3T56 B;  4KD3 A;  1GHJ A;  2SOB A;  1SND A;  1FGB D;  3C1E A;  3RZO B;  3MTS A;  5I9O A;  2CW0 C;  2SNS A;  5KNB A;  2Z4I A;  1WTQ A;  2F0V A;  4RHR A;  3VYS A;  4DAP A;  1WTO A;  3SXH A;  2E74 C;  4KTA A;  3TP5 A;  2IW3 A;  4L8J A;  2Z4H A;  1D1K A;  3NQT A;  1B9M A;  3FRP B;  4KJN A;  4FXD A;  1H9K A;  1LTG D;  2ID0 A;  4K2L A;  1IHZ A;  1Y8P B;  4R9W A;  1BUV T;  1BXT A;  5IOD A;  3FKI B;  1SE3 A;  3VA7 A;  3K58 A;  5C4J B;  2E2I B;  3ND9 A;  3A7A B;  2ICI A;  3RD4 A;  3ONA B;  4KY5 A;  3SK5 A;  2M2L A;  1SNP A;  3HOX B;  3BVZ A;  1PFN A;  2R93 B;  1AFP A;  2K5D A;  1JR0 D;  3MXP A;  4IFD I;  1SYF A;  1BBX C;  1DOL A;  5CR3 A;  1JOK A;  1GHK A;  5T1G A;  2QIL A;  1JQY D;  1SNQ A;  2JA7 B;  1WD0 A;  5EKK A;  3I4L A;  1EIH A;  2X69 A;  5ISR A;  5C3E B;  3A8J E;  3U9S A;  2A69 C;  4RHS A;  5JEA H;  4ZQ3 A;  4OGQ C;  2AUK A;  2A6H D;  3N6R A;  1SE2 A;  4A3D B;  2JE6 I;  1MI2 A;  1ZEQ X;  1C4Q A;  3QB3 A;  3KLS A;  5J22 A;  2A74 C;  4IUV A;  5CBE E;  4QIW B;  3ZYY X;  3D3R A;  2IJ0 A;  3GTJ B;  1S5E D;  2SDF A;  3TN2 A;  3I72 A;  1RF2 D;  2NN6 H;  3QJY A;  5CV4 A;  3H0G B;  4L63 B;  1PLF A;  1ESF A;  1CA6 A;  3FEW X;  5I9P A;  5C3X A;  5CV5 A;  1AZP A;  1KLU D;  2G9H D;  4ZRZ A;  1BOS A;  2PW7 A;  2KHS A;  3RZD B;  4O1N A;  1SNO A;  4DAY A;  1GUN A;  3MHB A;  1PFM A;  2JP1 A;  4OHJ A;  3SK4 A;  1ESR A;  5IGG A;  1UUP A;  1HQM C;  3IKJ A;  4ID6 A;  2KJX A;  4G7H C;  4DXF A;  2B2U C;  1LT4 D;  3AMU A;  1HA5 A;  2D9U A;  5COY A;  3SDZ A;  3NE5 B;  3NXW A;  1STG A;  4DAV A;  1II3 A;  4HAE A;  1S5F D;  1V1P B;  4C3H B;  3DEO A;  2H4O A;  1F77 A;  1R4Q B;  1LT3 D;  4ZK9 B;  1UEA B;  4Y7N B;  1G91 A;  1SDF A;  2K33 A;  5C6A A;  1BCP F;  3D4D A;  2AQ1 B;  4CJ1 B;  4DNT B;  1CZG A;  2EYF A;  1LT5 D;  3DUZ A;  5C44 B;  1UAP A;  3Q22 A;  1B4O A;  5COR A;  1F9S A;  3MXG A;  4XIG S;  5F2D A;  4BA1 I;  1EQT A;  1IW7 D;  2WIN B;  3S17 B;  3URY A;  3BVM A;  4TRD A;  3IFD A;  3HKZ B;  4BWG B;  5C0X G;  5HGT A;  3OMG A;  2XN9 C;  1CA5 A;  2EYJ A;  3MAQ A;  4XT1 B;  2NTS A;  4RKL A;  3S2H B;  5KYL A;  3NK9 A;  3QIA A;  4N9P A;  1M4V A;  5FKA C;  1STH A;  3R93 A;  3MWY W;  3SVM A;  2O4X A;  1DJR D;  4FYD A;  3SK8 A;  4UDU C;  5C0X I;  5IGE A;  3GTO B;  1W6J A;  4FXK C;  1K83 B;  2D5D A;  4F7X A;  1WCM B;  2K32 A;  3OWE B;  3J80 L;  3QO2 A;  1DOM A;  3I73 A;  1BR9 A;  1W6K A;  4B9W A;  2X6G A;  1XX8 A;  4X3U A;  2KEC A;  2C9O A;  4EQP A;  5ELD A;  3K57 A;  1MGS A;  3J80 E;  3TBI B;  1PTO H;  2OXP A;  3BYY B;  4K2K A;  4U67 3;  1EY7 A;  4U68 A;  4HCE A;  2K03 A;  2WAC A;  5EPJ A;  1XXG A;  4MHE A;  3TME A;  2RKS A;  4C3J B;  3PMF A;  3CHB D;  3D31 A;  4QCL A;  2WV6 D;  5C5L A;  1SYB A;  1SMY C;  1PRT C;  1XWE A;  3QOJ A;  4KD4 A;  1JWU D;  2B2Y C;  4CHT B;  2EJM A;  1KTK A;  1LT6 D;  1QJO A;  3K6O A;  1J8I A;  4A3B B;  4EGV A;  4KKS A;  2Q8T A;  1GUS A;  2E2H B;  1HFN A;  3M7N A;  4WJW A;  1Q1E A;  2X6L A;  4IUN A;  3S1N B;  2M9V A;  3S1R B;  4H0L C;  5D3I B;  1H9S A;  3EQL C;  3E5S A;  5DM7 3;  5JVH 3;  2ZXR A;  4ME5 A;  4XQQ A;  3Q24 A;  3M85 A;  2F0W A;  1QE6 A;  4IUQ A;  3NTH A;  5KNC A;  1STY A;  2HQE A;  5C3W A;  1O7L A;  1NUC A;  2F0O A;  1Q8I A;  4H44 C;  4FXG C;  5EBC A;  4HR7 B;  2F0G A;  4DA2 A;  4HED A;  3LX0 A;  2A73 B;  1OXX K;  5KGU A;  3MC0 B;  2PZT A;  1JOO A;  2DN8 A;  3I4M B;  4CJ2 C;  3GP7 A;  4FVM A;  2J7Z A;  3BDO A;  3FMC A;  5LL6 S;  2L4N A;  5LHY 1;  1MSG A;  4A3I B;  4CKC A;  4NP5 A;  2QEJ C;  1EQV A;  1F2L A;  2B63 B;  1XYI A;  1RDP D;  1I4X A;  3HP3 A;  3K5M A;  2N55 A;  3EFX D;  1SFO B;  4Q5V A;  3NUC A;  1TU2 B;  3VYT A;  4EQN A;  3PIP 3;  2VB3 X;  1RTO A;  2F0Q A;  2Z8L A;  4XT3 B;  2XRQ D;  2WKD A;  3J81 L;  5JEA J;  2EY5 A;  1TS3 A;  3TP6 A;  2PYK A;  3PUY A;  3I3C A;  2F1M A;  3NBH A;  3VYR A;  4FF2 A;  1A3T A;  2WKC A;  2F03 A;  1KNE A;  4PMB A;  5K36 H;  4ILW A;  4ULL A;  4FO2 A;  5JOB A;  1ET6 A;  1EY6 A;  1TWA B;  2VUM B;  3GO5 A;  4CJ0 B;  3C46 A;  1LV9 A;  4DGZ A;  4K5V A;  2F0T A;  3DMU A;  5EPL A;  2F0J A;  2L55 A;  4DXG A;  1TS5 A;  2EVB A;  2GA4 B;  1CM9 A;  1CK1 A;  5HUR A;  4G57 A;  4I65 A;  2RSO A;  1SSO A;  3OIP A;  2EJF C;  4OO1 H;  1EYD A;  1ZYR C;  4HCS A;  2NVQ B;  1CFM A;  4RFB A;  1EZ8 A;  1EFI D;  4CKB A;  2IT1 A;  3PUZ A;  5IGD A;  2H1E A;  2IX3 A;  5JEA G;  1G2S A;  1WTR A;  4C1N I;  5D65 A;  1WD1 A;  3MXN A;  2D2C C;  1V43 A;  3TDQ A;  2MJ8 A;  2DNE A;  2NBF A;  1ICW A;  4XDX A;  1U9R A;  3DWP A;  5IGF A;  1STA A;  3C3L A;  2E76 C;  1KDA A;  3MA2 B;  1JCK B;  2AQ3 B;  5K5P A;  1PMR A;  1SXT A;  1B3A A;  1SJH D;  2YU9 B;  1S5C D;  3GQB A;  1JC7 A;  2NZ1 D;  1HXY D;  3FDT A;  4TSS A;  2NN6 G;  5IIF A;  2PZU A;  4K6L A;  1KAB A;  1EY9 A;  5C4H A;  3GTG B;  3IL8 A;  5CV6 A;  2JA8 B;  4IFD G;  4K6D A;  3PV0 A;  2KA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...