1DCZA

Biotin carboxyl carrier domain of transcarboxylase (tc 1.3s)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
77
structure length
77
Chain Sequence
AGAGKAGEGEIPAPLAGTVSKILVKEGDTVKAGQTVLVLEAMKMETEINAPTDGKVEKVLVKERDAVQGGQGLIKIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TRANSCARBOXYLASE 1.3S SUBUNIT
publication title High resolution solution structure of the 1.3S subunit of transcarboxylase from Propionibacterium shermanii.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
total genus 9
structure length 77
sequence length 77
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dczA00
1YNNC 3OOCA 1Z6HA 4L8JA 1CI3M 3PUZA 3TZUA 2NN6H 1Q12A 3BDOA 1T5EA 2A69C 3VR2A 1B9MA 2JXMB 3P20A 2D2CC 4HR7B 1H9SA 4KKTA 3OW7A 2O5IC 2A6EC 3I72A 1TKWB 1ZKOA 3LNNA 2BA0A 1OXSC 2YYZA 2EDGA 4DK1A 5KNBA 3M85A 2ZT9C 4KN7C 1HPCA 1ZYRC 4GZYC 3VR6A 1E2VA 2DN8A 1H9KA 2E76C 5JEAG 3N6RA 4TQUS 2EJMA 3A7AB 4RCNA 2JEAI 1V8QA 3CRKC 3M4YA 1H9SB 1E2ZA 3I73A 2EJFC 3QG1A 2AUKA 1EWHA 3U9SA 2A68D 3RLFA 1Z7TA 3VR4A 3MFYA 1IW7D 1VF5C 2IT1A 3M7NA 2BE5D 3I4LA 3AB9A 4OO1H 1CFMA 4XTCS 1O7LA 2V4DA 1Y69U 1GUOA 1ONLA 3T53B 2EVBA 2A68C 5BN5A 5C0XH 3QJYA 1I6VC 1VDZA 1Y8OB 2L5TA 2CW0C 5K36H 3LWUA 4LK1C 4IFDH 4KKSA 1IYUA 2NN6I 1Q90A 2AUJD 4I7ZC 4KMUC 3SDZA 3T51B 1OXVA 1OXXK 2EJGC 2BA1A 4JK1C 1IYVA 4LJZC 5A35A 3FPPA 3MXUA 3PUVA 3GQBA 3SE0A 1GHJA 1GUGA 2AWOA 3GD7A 1VF7A 2DNCA 4IQZA 3PUXA 4PV1C 2NN6G 3A7LA 2JEBI 2DNEA 1HTPA 1E2WA 1QJOA 2A6HD 4KI0A 2D62A 2B8FA 3W3AA 2LMCB 3L7ZC 4JBWA 1GHKA 1K8MA 1GJXA 2E74C 3IFTA 3PUYA 2F1MA 4DK0A 4G7HC 3WDNA 2B8GA 3A8IE 3A8KE 3QIAA 1V43A 3ND8A 3OPOA 4KHZA 1DD2A 1GUSA 3HGBA 2JE6I 1OXUA 1IW7C 1TU2B 2Q8IB 2BE5C 3D4RA 2PNRC 4BA1I 5KNCA 1B9NA 2QF7A 4TKOB 1Q1BA 4KN4C 3A8JE 4G7OC 2BDOA 2A69D 5JEAH 3KLRA 1PMRA 3VR3A 4H0LC 5KNDA 2PPBC 2KCCA 1BDOA 4H13C 5BN3A 2A6ED 1H9RA 4XIGS 3VA7A 4KKUA 1LACA 3IKJA 3ND9A 4OO1G 3D31A 1OXTA 3BG3A 5BN4A 1YNJC 3PUWA 1A6XA 1FR3A 1FYCA 1CTMA 2K32A 5C0XG 1K8OA 1G291 1O78A 1Y8PB 2PCFB 5K36G 2K7VA 4IFDG 2KA7A 1SMYC 1Q1EA 2D5DA 3EQLC 2A6HC 2O5JC 1GUNA 3NE5B 4OGQC 1GUTA 1Y8NB 4DNTB 1H9MA 3PV0A 1DCZA 1HQMC 4DNRB 4BA2I 3T56B 1LABA 1VCIA 4H44C 3DXJC 2K33A 3FMCA 2E75C 3CRLC 2R6GA 3H94A 4G7ZC 3VR5A 1H9JA 1DXMA 1HCZA
chains in the Genus database with same CATH superfamily
4GOPB 5EQ0A 3X3MA 1VS0A 4JC0A 3VR2A 3HOVB 4BY7H 3S1NH 1HZ9A 1TWGB 2PYKA 4A3FH 2WV6D 3J81j 3FHWA 5KNBA 1HPCA 2JJQA 2P5ZX 4A3EG 3GTOH 1Q8IA 4GNXB 1Q46A 1L2FA 3HOZB 4RCNA 1E0BA 3GV6A 2EQSA 1IBLQ 3J80i 4DA2A 2WINB 1IW7D 1V1PA 3FRPB 3TEHB 1SROA 2SNMA 4OEMB 5C0XH 4ID6A 2YTXA 4FXGC 1C0AA 1PFNA 5EPKA 2H5XA 1EQVA 1XJVA 1M8AA 1X3GA 3KF8A 4GOPC 1SDFA 1TWAB 3I4NB 1C48A 3QOJA 1YHQA 5I9PA 5CV9A 1K8GA 1CHPD 2NN6G 5EGTA 1WCMB 4KI0A 4NPSA 4YY3L 1UUPA 1YVCA 4K2LA 1Z9FA 4L63B 4BY7B 1JT8A 2CKZB 3S1NB 3A8KE 4GNXC 2B2VC 1DM0B 1DJRD 5IE8A 4A3FB 2QW7A 4A3DG 4OO1I 3T1YQ 1LTID 2AMCB 3FEWX 4YIJA 1DOKA 3I91A 5C3EH 1WTVA 2FJ2A 3VR3A 3EIVA 4A3BH 4IFDI 1PTOF 5JOBA 3HP3A 1U9RA 1QUQB 3H0GH 1PH5A 1XX8A 3D31A 1J6QA 5KYLA 1JOKA 5J39A 4DV3L 4A3GG 1RKNA 2A5HA 1ICFB 1X65A 2F0VA 4GLAC 3A55A 2VQEL 2MHVA 3D3RA 3K0YA 1DCZA 4LAAA 4P2CB 1CQVA 5D3DA 2NZHA 3CRLC 1PH7A 1PTOD 2RF4A 3QOLA 3K59A 3LGJA 3HOUG 4HJ9A 1YIJA 1CI3M 5C3XA 3F2BA 4X3TA 4CJ1B 4ZYSA 2ZTCA 3R2TA 2EXDA 2PQAA 3UE0A 3QWNA 2L12A 2QILA 2EDGA 1Y14B 4KN7C 2GN5A 2MP1A 4Y7NH 3N6RA 2XRSD 4L5TA 1XNQL 4A3BB 3C1EA 1EQRA 1FJGL 1LV9A 5EBDA 2F52A 4LF6L 1EWHA 2PW7A 3TP8A 5BR8Q 1N34Q 3H0GB 4APVA 2EYJA 2ZTDA 3AMUA 3GDEA 5JVH3 5EJWA 5EBCA 3W1GA 1CFMA 2KHJA 1LYLA 2V4DA 3FKIG 1O7IA 3M3YH 4DR6L 2L5TA 1KDCA 2IHFA 5CR3A 2JA5H 1WTXA 1OXVA 1OXXK 4UP8A 1MJCA 5C0XI 4X3SA 2KENA 5GAEC 1X9NA 3MXUA 3SE0A 1YNJD 4BY1G 2EY6A 4HN7A 2UUBQ 3C1FA 4TSSA 2K75A 3VA5A 3NK9A 5KRUA 3BVMA 1CT1D 1E22A 2E8GA 1B1ZA 4G7HC 4PZ8A 1RIPA 3K58A 4ULLA 1EQQA 4K5VA 2RDGA 3IAYA 3CCLA 1C4QA 2M00A 3D4RA 4IPHA 1VQ4A 1D7QA 1ET6A 1PYWD 1E24A 4C3IH 4Y7NB 1DOMA 3R3OA 2UXCQ 3K80C 4NXMQ 3R93A 3A74A 1IL8A 1BO0A 1N9WA 2B2WA 4JW0A 4DV1Q 1F77A 4DV7L 2B29A 4JPBW 3J81L 4JI7Q 3J7ZC 2K05A 3PF5A 3S2HB 3M3YB 5C5MA 2OT2A 1HNXL 2KBNA 3S24A 2LKVA 3CMEA 2PQEA 4RKLA 1FGBD 2K03A 2JA5B 2MO0A 2JA9A 3G6EA 3W2DA 5C3WA 2K33A 5K5PA 2RBMA 3VR5A 1KXLA 4UPAA 4KTAA 3A56A 1LTTD 2VL6A 1WTRA 4X66L 4DV2Q 4B9WA 1B3QA 3NBIA 1WTWA 3HKSA 2KEDA 4CKEA 1JJCB 1LTLA 1ZKOA 1L0XB 4LF9Q 3T1HL 2O2LD 4DK1A 3GTJH 3J7AV 1G6ZA 4B9XA 3A5UA 4R4QA 3MWYW 2RCNA 1N33L 4KK7A 1TT2A 3KJPA 4C3IB 2R7ZG 4JYAQ 5IYCG 1CA6A 4JV5L 2CWAA 2Z8LA 2A8VA 3M4YA 1VMPA 1E2ZA 2K04A 2AUKA 1I50H 2F4IA 2XIWA 3BVZA 1XTDA 4FXDA 2EYPA 2XTIA 1PXUA 2A68C 1BBXC 2I5LX 3F1ZA 4ZQ3A 1J9OA 1PTOH 1VQFA 3OW2A 3PF4A 1NR2A 4J15A 2AQ3B 3Q22A 3PSIA 3DWAA 2C5CA 1A3TA 5IT9L 4FNFA 4DNIA 4R8IA 3J80L 2E2JH 2VB2X 2R7FA 3VYTA 1E1OA 4KY6A 3HOWH 4HMJA 2YU9H 2AWNA 2DJGC 2VS1A 2D62A 1MGSA 1UAPA 1GJXA 1K8MA 1FNVA 3GP7A 4O42A 1DONA 2H1EA 1JE4A 1VQAA 5H1SE 1SSOA 1IW7C 1JICA 2YTYA 3DMUA 4DUZQ 2WACA 2XVSA 1CZWA 3CCUA 4V0BA 3OIPA 3GTJB 2X6GA 4RGMA 3MXPA 4MNOA 3ERQA 2BH8A 2JA7G 1BKBA 2NTTA 5M3FH 4KHPQ 2K5DA 4GN5A 1JJGA 1I50B 2IW3A 3CPWA 2MJ8A 2K1BA 3UE1A 2JA8G 2K32A 1F9QA 4Q0FA 3PIO3 4V190 5IGBA 3TBIB 3BU2A 1IBLL 3AFQA 1PTOB 1PDQA 1EY5A 4B3RL 5IYBH 2CQOA 5ISRA 4H02A 2KCTA 3DWQA 3H94A 4A4IA 2OQ0A 5COYA 5D14A 4DV6Q 2B39A 5ELBA 4IZ8A 1RDPD 3HOYH 2R93H 4L5RC 3HOWB 3DEOA 5EKKA 2F0KA 1MJEA 3BDLA 3NELA 4PMCA 1OO9B 2EYOA 1FVIA 4ZKCB 1IKLA 4EX5A 3NTHA 1TIID 5FOBB 2Q2IA 4HSPA 2FFKB 5GAGC 1O7YA 4A3LG 2D0OA 5CBEE 2HT1A 1II3A 3HKZB 1M4VA 1EYAA 5M3FB 2VY3A 4QUFA 4BY1B 5G3LF 2F0SA 4C1NI 3OTOL 3CC7A 4BBRH 4K5WA 4F8MA 3T1YL 4DR7Q 1S5BD 1PTOC 4IOCA 5C44H 1Y69U 5BN5A 4IUQA 5IYDH 1IYJB 1KHIA 4LF7L 1QOHA 3EVQA 1Q90A 2ZM6Q 4KMUC 2FHTA 3CCMA 3EA6A 2RCFA 1T9HA 3KOJA 4XQJA 2D0PA 3KF6B 1QVGA 5ELCA 5I9OA 4IALA 2FMMA 1SMXA 1OTCA 2R93B 5I6YA 2MFIA 2E74C 1SNPA 4BBSG 2OCEA 2UU9Q 1W3SA 3WDNA 3DEPA 2E2IH 4NXNQ 1ET9A 1XTCD 1OXUA 5CYUA 3TRZA 1VMCA 1X3FA 3NEMA 1B9NA 4TKOB 1EYCA 4KN4C 4R4OA 5JEAH 5KNDA 2B2YC 4H0LC 2JQOA 2HHHQ 1XPOA 5JJKA 4JI4Q 4H13C 4JI8L 1CQFA 1F9SA 3KDFA 1N32Q 1UWVA 1JR0D 5CGKA 3O13A 4OO1G 1RHPA 1YNJC 3K6OA 1SFOH 1YHAA 2Q8TA 4BBRB 1CTMA 5C44B 4HJAA 2BCOA 3ULPA 1D1KA 4IFDG 2KA7A 2RSNA 1I94Q 3KBGA 1SN8A 2KEEA 3CD6A 4P73A 1A15A 3CC4A 5CV5A 1GUTA 5BR8L 2F0NA 2RDFA 1HQRD 4B3ML 3Q0AA 2IL8A 4LF4L 3DHQA 4XXEA 4QF4A 4KKTA 4IUNA 2QGQA 5LMNW 1Y1WG 1ESRA 3BZCA 5JPMC 1N36Q 3BDOA 2MNAA 4K0KQ 1K28A 1S40A 2KCNA 4DAYA 4IUVA 3TS2A 2E2IB 4BS9A 4G57A 1C7YA 3HZXA 2UUBL 4X64Q 1AFPA 4POGA 3GTPH 3VR6A 3ICEA 1U5KA 1G8ZD 1IZ6A 1VQOA 2JEAI 1LO5D 2QCPX 1NR4A 2UXDQ 1WOCA 3CQZH 3MA2B 5LL6X 2N3SA 1RTOA 3UI2A 1S5CD 4OX9Q 4A3JH 1BXTA 2XNAC 4XTCS 1GD7A 3F8TA 3VYUA 3NQTA 5K36H 4ZKBB 5FLMG 3K5NA 4NXML 3L0OA 2F4VQ 2KOLA 3H91A 1F9PA 1UE7A 5CV8A 3U4VA 3VYSA 4DV1L 4HJ7A 2Z6KA 2BA1A 4B3TQ 5A35A 1U4PA 1V1PB 4LUVA 1Y1VH 3NUCA 3ULJA 2HCIA 2F0WA 2VB3X 4KD3A 4A3CG 1KNEA 1X3PA 2DUDA 5DEHA 1TS4A 2K5NA 3I90A 1VQPA 2ID0A 2L55A 1TR5A 2WAQE 3KF8B 1STAA 2Z9HA 2QKIC 3A5ZB 2HIVA 3ND8A 1DD2A 1YEZA 4PG3A 1WTOA 2Q8IB 3J7AF 1STGA 4LF5L 2PNRC 3GTPB 5KNCA 2QF7A 4NMZA 1S5ED 5EAYA 5FK9C 1KIXA 4FF4A 3ZYYX 1DZ1A 4O0AA 5IIFA 3CQZB 4LF9L 3VDYA 1W6KA 2PI2A 4J1MA 1SE8A 4AQYQ 4EVOA 2BOSA 1ILPA 1I4RA 3HOVH 4A3JB 4GKJQ 1Y8PB 2PCFB 4JYAL 3BZKA 1NCVA 4N9TA 4IJHA 5FLXL 4ZUIA 1JB3A 2V1CC 3V2TA 3HRZC 4DV5L 4JI6Q 4RGOS 4UAIA 1EL0A 3S17B 3R2IA 5FLXc 4DUYQ 1SE3A 1HQMC 2K5VA 1M1KC 3PCOB 1SYBA 5HGQA 4UP7A 5A2QE 1Y1VB 4QGUA 5IP7H 1DXMA 1X6OA 1HCZA 2RVLA 5CC4A 1H95A 4JVZA 4K8IA 1T5XD 2YTVA 1HRJA 1T5EA 1B9MA 4C2MH 1QCBD 2Z1CA 2ATWA 4OIKA 4PQXA 5C4XG 3NENA 4IPCA 3I72A 3U4ZA 4ZK9B 2R92H 4CGYB 2NWGA 4M8AA 4DN4M 1G91A 5LMUQ 2ZT9C 1VQNA 1EOVA 1YI2A 1DOLA 1I4GA 3UDGA 4EQNA 2DN8A 4A3IG 1YJNA 3A7AB 4RMFA 1HA5A 5GQOA 3CRKC 4X62Q 3D8GA 3JAME 2A68D 2F3IA 1L0WA 4DR1Q 3C2PA 1WCMH 2IT1A 4F7XA 2AQ1B 4KD4A 2E5LQ 1U4MA 4R1JA 4IPDA 3BJUA 3NHHA 1PFBA 3RN2A 4KHPL 4JCVE 3C3LA 2UXBQ 3K5OA 1STNA 1V1OA 1K8AC 4K2KA 1PH6A 1VQ5A 3D6WA 3K8AA 1LTRD 5IY0A 1SE4A 4ABNA 4M1UB 1GHJA 4A3MH 3I4OA 4WORA 4JI1L 1EIYB 2ASBA 4DR2Q 4K5XA 1YITA 2WIIB 1I4HA 1QJOA 3HG9A 2B8FA 3AFPA 4C2MB 4LFBL 3X3NA 1HNZQ 2JK8A 1SAPA 5L37A 2R92B 1G6PA 2PI2E 1HA6A 2L15A 5AJ3Q 5EKIA 3RZDH 1XWEA 3MXGA 2LXJA 3A8JE 5DM63 2A69D 1NUCA 3GTKH 3S16H 4YWKA 3CAMA 3LWEA 3NBHA 5EPLA 4XQQA 2VNUD 1HUNA 1N8RC 3RD4A 1FR3A 1NTGA 2F0TA 4IO9A 2Z4HA 3AU7A 2QEXA 3GTQB 3JC66 3OSOA 1B2TA 4KJNA 4OGQC 1VQDA 3F2UA 5HY6A 4A75A 4C3HG 1BQQT 1YBYA 2NVXH 1I6HH 4XYQA 3PIOA 1EYDA 4X6AH 2L0CA 3FMCA 4HCEA 4CDDC 2EYFA 4DR7L 4A3MB 1A2UA 1LTAD 5IODA 4G7ZC 4A3KG 5I2XA 1VQCA 3H6MA 3CKIB 3K57A 2ZM6L 4H7BA 3SEBA 2N88A 2JXMB 2DY7A 2JP1A 3DM1A 3Q24A 1EZ8A 1K3RA 2HQEA 2LS01 2K6AA 1K3BC 3HOXG 2WAQG 3RZDB 2Q8RE 1VQ8A 1TS3A 3M4PA 4GKKL 1EY9A 3GTKB 1ICWA 1HUMA 1JQYD 2UU9L 2K5QA 1E7ZA 5M3MG 3S16B 3EN2A 4DR4Q 4LFAQ 3M7NA 3I4MG 1IBKL 3IRBA 1JJ2A 1NSNS 1ML0D 1D5ZC 2HHHL 1QB5D 4JI4L 4R8NA 2AUJD 3ER0A 1KLUD 3ITPA 1N32L 4JK1C 2NVXB 5AFWA 1I6HB 4WJ3M 1VF7A 1AN8A 1GUWA 2NZOA 5LMNQ 2LFNA 1CKOA 4CDCC 1Q8KA 1EU3A 1STHA 3Q8DA 3S2DB 3AYHB 1D6EC 4FVMA 1PH3A 2C35B 3S2HH 1XPRA 4KY7A 4FF2A 2NVTH 4QMGA 1N36L 1AZPA 4K0KL 4A3EH 2H4OA 4IOAA 1ENAA 1CM9A 1A3VA 1J5EQ 2B2TC 2VQFQ 1SNQA 3RNUA 2Q2TA 4X64L 3BS1A 3PUWA 4X65Q 3C46A 3UDIA 5FJ8G 3D4WA 2SEBD 2HDMA 3MXNA 5C4XB 3EQLC 3CXCA 1EZ6A 4L6TB 5ELDA 4KY5A 4DPGA 1DGSA 1PH1A 4JI0Q 1LT3D 3SK4A 4BA2I 4IPGA 1VQHA 3KYHC 2F0EA 1KD1C 2LSSA 3TSSA 1F2ZA 1EU4A 2CW0D 1JB7A 1KDAA 1WTHA 1NE3A 2NN6H 3N52A 4QL5A 1PH8A 4FDBA 4HR7B 4B3TL 2JN4A 3QR8A 3H09A 3M7GA 1PLFA 3TP5A 2NVTB 4A3DH 2K5HA 4GZYC 1B4OA 2RA4A 2Q2UA 4A3EB 1Q82C 2VUMG 1BNZA 1V8QA 5E3FA 1QZHA 3U9SA 3MZ5A 1C9OA 1VQEA 3RLFA 3MFYA 1EY8A 2F0MA 1EUJA 1HXYD 1Z47A 1QUQA 2MUYA 3OWEB 2I0QA 2ZJQA 4A3GH 3T53B 1X56A 2WB1G 2NB0A 2BH2A 3S15H 2TMPA 4QB4A 3A0JA 1ZXTA 5KEEA 4DR3Q 1HZCA 4CDFC 5C4JB 1I3QB 4AQYL 5IP9G 1VQKA 3AQQA 1GUGA 3E0JA 2FMCA 1PFMA 3GD7A 1AP0A 2IJ0A 2L11A 4IQZA 3NTIA 2Y0SG 2N78A 3HOUH 1SMYD 1PZID 1E3PA 2A6HD 1MSHA 4JI6L 2KCMA 4YCVA 1BUVT 2GA4B 2GVBA 1R4PB 3EJIA 1NNXA 2K01A 3ZJYC 4A3DB 4LF8Q 4RFBA 2BDOA 4LMQD 1TY2A 3H15A 1WTPA 3KLSX 1HZAA 1H9RA 4C3JG 2HCCA 4DFAA 2EY1A 1KRSA 3ULLA 2IHEA 2WP8J 4DXGA 3BG3A 1YJ9A 2B2UA 5IGGA 4A3GB 3PO3G 3FKIH 1Q1EA 1QVFA 4X62L 3S15B 1NY4A 5M9OA 4AYBG 4DNTB 4A93G 3M4QA 2WAQB 1UE6A 3OIQA 3KDFB 3BYTB 1XPUA 1BF4A 4WJWA 2PZWA 3RUZA 3KBXA 2Q2HA 3W5OA 2E5LL 4KV6A 1H9JA 2WKCA 4DV0Q 4P75A 5M3MB 3HOUB 4BY1H 3CCRA 3RMHA 1UEAB 1CUKA 2A69C 4JOIC 3P20A 5D3IB 2O5IC 2B63G 3SK8A 3TDQA 3LNNA 1YHBA 1WTQA 4DR2L 1JOOA 1RL2A 1XMOQ 4G4KA 3M9BA 3J81E 2NZ1D 1TWCH 4DAYB 3KLWA 3VR4A 2A73B 2QEJC 4E6IA 3AEVA 1RD9D 1VF5C 3A54A 4HIOA 4NB3A 2PZTA 4IUTA 2EXZA 1JOQA 1JE5A 3FKIB 5FKAC 1Y8OB 2MQHA 2F0GA 5GAHC 1QVCA 3WOEA 4IUPA 2NVYH 1K0SA 3S1RH 3PO2G 1IYVA 3MAQA 4HIKA 2PMZE 3FPPA 4LFCQ 2AWOA 1VQLA 5JJLA 4PMWA 2JA6G 3SR1A 3RR5A 2DNEA 1VQJA 3L7ZC 3PUYA 4KLKA 3SK6A 4PZ7A 2KECA 1L1OA 2M9VA 3STBD 3U9OA 3QIAA 4KHZA 4QCLA 4WRDA 1FNWA 5CMDA 3G48A 1SJED 3K7UC 2F0JA 1GKHA 4FF1A 1RODA 2R7ZH 2RHSB 3V05A 5IYCH 2QA4A 1EY7A 4GN3B 3EBEA 1TWCB 2RDHA 3P1HA 1OXTA 2F0PA 1W2BA 3L9AX 2IWHA 1O78A 4R9WA 1TQOA 2EYHA 1VQMA 5IT9E 1Q7YC 1Y8NB 2N55A 4DV4Q 2NVYB 3J80E 3D0FA 3S1RB 2OTLA 4HTHA 2L4NA 3DLLA 1BBUA 4ZUJA 4LFAL 5EPJA 3BYYB 3SVMA 2E75C 1XYIA 3NWTA 2VQEQ 2Z6KC 4ME5A 5FO9B 4P74A 2R3ZA 3KJOA 4EQPA 1A2TA 1Q12A 1SYDA 1CZGA 4X3KA 3KFUA 5T1GA 4AIMA 1I4XA 2IX3A 1B3AA 2QDLA 4POFA 4XQNA 2RSOA 2XGTA 3HOZG 1N34L 1CSPA 1SEBD 1HR0W 1G51A 2JA7H 2R7ZB 2ZTEA 3K81C 4NW2A 4WJ4A 3E9IA 1EY0A 2ES2A 4IFDJ 2K28A 1QNKA 1XNQQ 1LTGD 2I5HA 3TN2A 4Y52H 2JA8H 2CCZA 1SNMA 5E7NA 4LF6Q 1KAAA 1CHQD 2CW0C 2ENBA 2R7DA 4KKSA 5M5XH 1J5EL 5HURA 1SNDA 3Q6SA 1XXGA 5GROA 1PHJA 3I4NG 5T1IA 4DR6Q 3GTGH 4X65L 1YJWA 1KQSA 4O1NA 1MSGA 2NBFA 4TVAB 3H3VH 1QILA 1QG7A 2HD3A 1HTPA 2EE1A 4BY7G 4N8X1 1KDBA 2F1MA 3FPUB 4A3FG 1HTLD 4JBKA 1V43A 1YNXA 2UXCL 2CVRA 1YNND 3S17H 1Q86C 4A3LH 1SR3A 4JI7L 2JA7B 2ALYB 3CU7A 2PW5A 2TSSA 4DAPA 5BN4A 4ALPA 1Q81C 5C0XG 2O4XA 4IURA 2JA8B 1EIGA 3P75A 1SMYC 2IX1A 4YHHQ 1MBYA 2A6HC 2CH4A 5M5XB 3TS0A 1H9MA 3JAMc 3ONAB 4RHRA 3K5LA 3T13A 1VCIA 3GTGB 4DV2L 5ELEA 3F2DA 2ICEC 5C0XJ 2F0LA 2E2HH 3KF6A 3PUZA 3CMAA 1LLRD 2OEOA 3NPPA 4DR3L 5IOCA 1IKMA 3URYA 2Z0SA 1D5MC 4BBSH 4CKBA 4MIUA 1OXSC 2YYZA 4X66Q 4K6LA 3G4SA 4QUCA 1PYBA 5C3EG 1E2VA 4A3BG 2EY5A 1KNAA 3T1HQ 1U4LA 4OWXB 4ZAIA 4CJ2C 1LUZA 2EJFC 3H0GG 1TWHH 4OELB 2JA6B 1VQGA 4F87A 4O2DA 2VZAA 4U673 3CCEA 4JV5Q 1ESFA 4OO1H 1PZKD 2N49A 3E5SA 3QJYA 1I6VC 1VDZA 2EYLA 4LK1C 4IFDH 4I7ZC 2PZUA 2EJGC 2KHIA 3H3VC 1GVPA 5IGDA 4R4TA 1TXYA 4RG1A 2G5DA 4OWTB 2DJFC 5FO8B 4A76A 2E2HB 2JEBI 5IWAQ 4EQ5A 1GM5A 1Y1WH 2PQAB 4DUZL 3IL8A 2WFWA 1SLJA 3A8IE 3GTQH 4RHSA 4BBSB 1PRTF 3SGIA 2K50A 5HGTA 5IGEA 3TP7A 4RCOA 1FNUA 4DV0L 2X6LA 1Q1BA 2KQ3A 3GO5A 4RWSC 3RLOA 4N9PA 4MZ9A 1GOZA 1HFNA 4HAEA 2FXQA 1M90C 1TWHB 2ZXOA 2IX0A 3ND9A 1MD2D 1WD0A 3NXWA 1PH9A 1PVOA 1F2LA 1I4PA 1AE2A 5IGFA 2K7VA 2IPKD 2EIFA 1XMOL 1CKNA 1HH2P 1PRTD 5E4XA 1JC7A 5FLMH 2JA5G 4DV6L 1G2SA 1BCPD 2CQAA 2CFMA 3STBC 5JJZA 1WJJA 2XWBB 4U68A 3DUZA 2JYOA 1S4ZA 4B3RQ 3MXNB 2MGSA 4EQOA 4UDUC 1A8VA 4A3CH 1A62A 5CBAE 1JMCA 2WB1E 1Y1WB 5JVG3 2ICIA 2D2CC 1H9SA 2BDNA 2LXKA 5C4HA 3OW7A 1O7ZA 4LFCL 3E0EA 5CV6A 3PIPA 1PZJD 3FVQA 1STEA 4EGVA 2BA0A 4ODGA 2NUCA 1STYA 4P72A 3DWPA 5FO7B 2ZJRA 4RAUC 1Q3LA 2AQ2B 4C3IG 4J8QA 4QIWE 1K83H 2Y0SE 1BVSA 4RGTA 2PNHA 1ZEQX 4HCSA 3TREA 1LT5D 5M5WH 4Z9CB 1NMFA 3AB9A 4NDXA 4IN3A 4LNQA 5FLXE 3S2DH 2EVBA 2UUCQ 3T16A 1KTKA 1C8CA 3OTOQ 2FINB 4L5QA 4FP5D 3SDZA 5CV7A 3T51B 3GTOB 5TSSA 1SJHD 4S3SA 1AEXA 4LF7Q 4JI3Q 1VQ9A 5ELNA 5DLQE 1VQIA 3PUXA 1K73C 4QQBX 2KHSA 4NXNL 2NYZD 1IBMQ 3Q23A 2SDFA 1WYDA 4DV4L 1GHKA 3P7JA 4AYBE 2F0UA 4DGZA 2EPBA 3CF5A 1ASYA 3D4DA 2B2WC 5C4XH 2JE6I 1D2BA 1NAPA 1RJTA 4JI2Q 1HR0Q 1K83B 1AZQA 2J0TD 4TRDA 4A3IH 3KLRA 1PH2A 1EWIA 5J3BA 1BR9A 5BN3A 3VA7A 1FL0A 4KKUA 1I94L 4WFN3 3E9HA 3PGZA 2IY5B 2PMZB 5M5WB 1XNRQ 2F3WA 4GOPA 3BVGA 4PMBA 4JI8Q 3TMEA 4RGNA 4DF7A 3CCJA 3S14H 1RTNA 5C5LA 5JJIA 5C4ZA 2RHQB 5C3EB 1LABA 3DXJC 1SRUA 1PA6A 3GTLH 1YNNC 2MPMA 3OOCA 1Z6HA 3HOWG 4GNXA 4L8JA 2B2VA 1F2MA 4B3MQ 4Q5VA 2XRQD 4LF4Q 4OWWB 4HSVA 5LHY1 1EIFA 1EIHA 3MHBA 2L9HA 3M85A 2UXDL 1W6JA 1B8AA 1KL9A 1ZYRC 5C6AA 5C4JH 1JWUD 1I3QH 1H9KA 3HKZG 2EJMA 1D5XC 2UUAQ 4A3IB 5M3FG 1D8LA 4OX9L 4B08A 3W1BA 1X54A 3G7LA 1E1TA 3J7A5 2CWPA 2F4VL 4LW1A 2BE5D 4J6HA 1WD1A 3I70A 2G9HD 5JPNC 1GUOA 1ONLA 1CSQA 4LWCA 1AW7A 1F2YA 1FGUA 4CJ0B 1A0IA 2B2UC 1LT6D 2NTSA 5IYBG 3S14B 1TVXA 2NVQH 2D9UA 4C3HH 5KYIA 1U0LA 1FD7D 3L3OC 2EZVA 1HNWQ 1VQBA 3HOYG 2HUGA 2R93G 3TQYA 3GTLB 4A3KH 1MIUA 4YHHL 4DR5Q 5KGUA 3NQIA 1WFQA 4C56C 4B3SQ 2LMCB 4OHJA 1SXTA 2JSOA 4DK0A 3JAMi 3TP6A 1IHZA 4HIDA 3BDCA 1TS2A 3WWVA 4K14A 3L2PA 3E6ZX 3S1QH 3HOXH 2OTJA 2K4KA 1GXDC 1HFGA 2L1BA 2F03A 3MVVA 3I55A 2RQXA 1BDOA 4LF5Q 1X3EA 1TWFH 5CORA 4GKJL 2A6ED 2RKSA 2F0HA 4XIGS 2HQLA 5M3MH 1L1OB 1PRTB 4BBRG 2DY8A 1SYGA 3HEJA 5C44G 5IYDG 1B7YB 4DUYL 3I4MH 1BCPB 3KK7A 4YCUA 1PH4A 2B2TA 1XMQQ 3J81c 1DYQA 3PV0A 2NVQB 4JI5Q 3OWFA 3PMFA 4C3HB 4BXXG 4QJFA 1I4QA 1JWSD 3NTKA 4OL7A 4DV5Q 3CCSA 1EFID 4OXPA 4A3KB 5DAUA 4OIJA 4PZ6A 2KUMA 3G71A 1X32A 5LMUL 1SBBB 2EYMA 4HJ8A 4L5SA 1TKWB 3EROA 1O80A 3RZOH 1V9PA 5IWAL 2G9DA 4DR1L 1VQ6A 3S1QB 5JEAG 3HOXB 2E76C 1L1OC 1KABA 4DAVA 2J7ZA 2QDBA 1PRTC 3SXHA 2K5WA 4F88A 1V1QA 5J22A 2F0DA 1TWFB 2XSCA 2GVAA 4HEDA 1WVLA 3PIP3 1BCPC 1Z7TA 1ENCA 1K0RA 2F0IA 4JBJA 1CKMA 4YWMA 2UXBL 5FJ8H 3I4MB 5JEAJ 4RH6A 4ZLTF 1IYUA 2NN6I 1B70B 3CCQA 3PQIA 4DXFA 1QZGA 4I7AA 2I46A 1MHWC 3PUVA 2DNCA 1HNZL 1S72A 3S9WA 3I3CA 1PFSA 2K14A 3CCVA 1EY4A 1KAWA 1BOSA 3K7AH 5IT9c 4FXKC 2WKDA 5AJ3L 4OONA 3WOFA 3J80c 3IFTA 4JI1Q 2KVMA 4UHVA 5M5YH 1HZBA 1KLGD 1EOTA 1EEFD 3BZDB 3CPFA 1SNCA 4XYOA 5ELOA 3I7FA 3RZOB 4LFBQ 2EY2A 4BA1I 4G7OC 3R8BA 2E2JB 3J7YW 2VUMH 2OQKA 3SK5A 1R9TH 3MC0B 4YCWA 3UDFA 4GS3A 3V96A 4RA8A 2YU9B 2I07B 4NKLA 1LACA 1L0YB 3OHXC 4A3JG 1CA5A 5E4WC 1A6XA 1FYCA 4R4IA 1G291 5K36G 1RF2D 3KLSA 4CHTB 4HIMA 3OMCA 1EYGA 1X55A 2KJXA 5F2DA 3NE5B 4YY3Q 5I6WA 3K5MA 3F2CA 5D65A 4C1NK 1Y1VG 4H44C 1SE2A 2OXPA 2A19A 3MFGA 1ENFA 2R6GA 5IP9H 4QY7A 2UUCL 3DM3A 4LUOA 2I5MX 1UEBA 1PV4A 1ILQA 4JBMA 3K7AB 4ZCKA 5I4DA 2F0QA 1CK1A 3GTMH 5J1ZA 3I8ZA 5DM73 1SYEA 3CHBD 5M5YB 4JI3L 1WI5A 2AKWB 1UNSA 4MHEA 4DV3Q 1IBML 1KRTA 2E2DC 4LUZA 4DR4L 1D1IA 4TQUS 4JOIA 1U4RA 4BXXH 2VUMB 2C9OA 1R9TB 4HJ5A 3I73A 3QG1A 3HOYB 1EY6A 1LTSD 5G3LD 4GLXA 1RCVD 2B3GA 2XWJB 4C3JH 3D6CA 1LM0A 1EQTA 3HOVG 2VXWA 3M4OH 3NP8A 3RLNA 4GKKQ 1AE3A 4JI2L 1HR0L 1O7LA 2SOBA 3U50C 4CBVA 1P8LA 1HHVA 1QWYA 1R4QB 3PO3H 2WB1B 2N8NA 1LTBD 1I5FA 4NP5A 5LMNL 1IBKQ 4A93H 4DK6C 4LJZC 3TZDA 1XNRL 5IP7G 3FDTA 2CHBD 1EFWA 5A2QL 1ASZA 4QIWB 3A7LA 1TY0A 2Y0SB 2DGYA 3RN5A 1K9MC 2HDLA 4KJOA 1A3UA 4GN4B 3G6JB 3HFZB 3GTMB 2R92G 1FJGQ 3FP9A 2B63H 3OPOA 2Z6BA 3HGBA 4K6DA 4FO2A 1TS5A 1JCKB 2BE5C 3GV3A 2VQFL 3OYYA 4FYDA 1A63A 2PPBC 2F0OA 5JAVA 3I2ZA 1LT4D 2KCCA 4XT3B 2HIXA 1J8IA 3MEHA 1WCMG 4C3JB 3NSWA 3CC2A 1SYFA 3M4OB 4I65A 3JAML 2LY7A 4GLVB 4ME3A 4JI0L 2F0FA 2PO4A 2UUAL 1NJIC 2D5DA 3PO3B 3S1MH 2VW9A 3UDXA 2O5JC 3EFXD 1GUNA 3HS0C 4AYBB 5NUCA 2Z4IA 3U58A 4A93B 3PO2H 4DNRB 4A3MG 1G2TA 1BBWA 4BWGB 3MEFA 1AH9A 1QNUA 4XDXA 4CDEC 5IGCA 2JA6H 4UY8C 4MTNA 1CKNB 3TZUA 4AH6A 4DK3C 1SFOB 3VYRA 1ZYRD 5EKLA 2A6EC 3QO2A 2ZXRA 4HMIA 4DAMA 4ILWA 4UP9A 1UE5A 2B63B 1NMGA 2B2YA 2J4XA 1HNWL 1EWCA 2CH4W 4P71A 4DV7Q 2AHOB 4RKBA 4DU9A 4PNYA 3LX0A 4DR5L 4B3SL 3NBHB 3K0XA 5LL6S 1HNXQ 1H9SB 2YV5A 3SHLA 3I56A 4N8FA 1B50A 4DKAC 5GADC 5KIXA 1YZ6A 3I4LA 4R4CA 5E1FA 1GO3E 1S5FD 4JG2A 1P16A 1JORA 3LWUA 3S1MB 2K52A 4IJLA 3OMGA 1JWMD 2XN9C 3CP0A 5I2YA 3PO2B 2MO1A 3GQBA 4YWLA 1F9RA 4X3UA 3ERSX 4PV1C 2A74C 3IFDA 1SYCA 1E2WA 1N33Q 1XMQL 3W3AA 4JBWA 2ZJPA 4JI5L 3J81i 1IXRA 1PYSB 1TWGH 4LF8L 2B8GA 1B53A 1GUSA 1TU2B 1STBA 2F3VA 2SNSA 3MTSA 1IL2A 2OF1A 2R61A 4XT1B 2M2LA 1QE6A 1B44D 1EEID 1S3OA 3HOZH 3E3XA 1S5DD 4MTKA 4FF3A 1PMRA 3B6YA 5ELFA 1X3QA 3KUPA 2EOTA 2X69A 3IKJA 4MN3A 4ZRZA 3T4AC 1KC8C 3QB3A 1K8OA 1SNOA 3H3VI 1HJPA 3NWSA 3HKZE 1UE1A 1MI2A 5CV4A 3CW2C 1NBWA 4KHVA 1TWAH 2ZXPA 1VQ7A 2A1AA 5DNFA 1BCPF 3T56B 2OWOA 3I4NH 1MKHA 4IUUA 4K8JA 4CKCA
chains in the Genus database with same CATH topology
5EQ0A 3X3MA 3VR2A 3HOVB 1TWGB 2PYKA 2WV6D 5KNBA 1HPCA 1Q8IA 3HOZB 4RCNA 1E0BA 3GV6A 4DA2A 2WINB 1IW7D 1V1PA 3FRPB 2SNMA 5C0XH 4ID6A 4FXGC 1PFNA 5EPKA 1EQVA 1M8AA 3KF8A 1SDFA 1TWAB 3I4NB 1C48A 3QOJA 5I9PA 5CV9A 1CHPD 2NN6G 5EGTA 1WCMB 4KI0A 1UUPA 4K2LA 4BY7B 4L63B 3S1NB 3A8KE 2B2VC 1DM0B 1DJRD 4A3FB 4OO1I 1LTID 4YIJA 3FEWX 1DOKA 3I91A 1WTVA 2FJ2A 3VR3A 4IFDI 1PTOF 5JOBA 3HP3A 1U9RA 1XX8A 3D31A 5KYLA 1JOKA 5J39A 1RKNA 2A5HA 2F0VA 3A55A 2MHVA 3D3RA 3K0YA 1DCZA 4LAAA 4P2CB 1CQVA 5D3DA 3CRLC 1PTOD 3QOLA 3K59A 1CI3M 5C3XA 4X3TA 4CJ1B 4ZYSA 3R2TA 3QWNA 2L12A 2QILA 2EDGA 4KN7C 2MP1A 3N6RA 2XRSD 4A3BB 3C1EA 1LV9A 5EBDA 1EWHA 2PW7A 3TP8A 3H0GB 2EYJA 3AMUA 5JVH3 5EJWA 5EBCA 1CFMA 2V4DA 2L5TA 1KDCA 5CR3A 1WTXA 1OXVA 1OXXK 5C0XI 4X3SA 3MXUA 3SE0A 1YNJD 2EY6A 4HN7A 3C1FA 4TSSA 3VA5A 3NK9A 5KRUA 3BVMA 1CT1D 1B1ZA 4G7HC 3K58A 4ULLA 4K5VA 2RDGA 3IAYA 1C4QA 2M00A 3D4RA 1ET6A 1PYWD 4Y7NB 1DOMA 3R3OA 3R93A 1IL8A 1BO0A 2B2WA 1F77A 3J81L 2K05A 3S2HB 3M3YB 5C5MA 2OT2A 2LKVA 2PQEA 4RKLA 1FGBD 2K03A 2JA5B 3W2DA 5C3WA 2K33A 5K5PA 2RBMA 3VR5A 4KTAA 3A56A 1LTTD 1WTRA 4B9WA 3NBIA 1WTWA 2KEDA 4CKEA 1ZKOA 1L0XB 2O2LD 4DK1A 3J7AV 1G6ZA 4B9XA 3MWYW 4KK7A 1TT2A 4C3IB 1CA6A 2Z8LA 3M4YA 1VMPA 1E2ZA 2K04A 2AUKA 2F4IA 2XIWA 3BVZA 4FXDA 2EYPA 1PXUA 2A68C 1BBXC 4ZQ3A 1J9OA 1PTOH 1NR2A 2AQ3B 3Q22A 3DWAA 2C5CA 1A3TA 5IT9L 4FNFA 4R8IA 3J80L 2VB2X 3VYTA 4KY6A 4HMJA 2AWNA 2D62A 1MGSA 1UAPA 1GJXA 1K8MA 1FNVA 3GP7A 4O42A 1DONA 2H1EA 1JE4A 1SSOA 1IW7C 1JICA 3DMUA 2WACA 2XVSA 1CZWA 4V0BA 3OIPA 3GTJB 2X6GA 4RGMA 3MXPA 3ERQA 2NTTA 2K5DA 1I50B 2IW3A 2MJ8A 2K1BA 2K32A 1F9QA 4Q0FA 3PIO3 4V190 5IGBA 3TBIB 1PTOB 1PDQA 1EY5A 5ISRA 3DWQA 3H94A 5COYA 5D14A 2B39A 5ELBA 4IZ8A 1RDPD 3HOWB 3DEOA 5EKKA 2F0KA 3BDLA 4PMCA 1OO9B 2EYOA 4ZKCB 1IKLA 3NTHA 1TIID 5FOBB 4HSPA 2FFKB 1O7YA 5CBEE 1II3A 3HKZB 1M4VA 1EYAA 5M3FB 4QUFA 4BY1B 5G3LF 2F0SA 4C1NI 4F8MA 4K5WA 1S5BD 1PTOC 1Y69U 5BN5A 4IUQA 1QOHA 3EVQA 1Q90A 4KMUC 2FHTA 3EA6A 4XQJA 5ELCA 5I9OA 4IALA 2FMMA 2R93B 5I6YA 2E74C 1SNPA 3WDNA 3DEPA 1ET9A 1XTCD 1OXUA 5CYUA 1VMCA 1B9NA 4TKOB 1EYCA 4KN4C 5JEAH 5KNDA 2B2YC 4H0LC 4H13C 1CQFA 1F9SA 1JR0D 5CGKA 3O13A 4OO1G 1RHPA 1YNJC 3K6OA 2Q8TA 4BBRB 1CTMA 5C44B 2BCOA 1D1KA 4IFDG 2KA7A 2RSNA 3KBGA 2KEEA 1A15A 5CV5A 1GUTA 2F0NA 2RDFA 1HQRD 3Q0AA 2IL8A 3DHQA 4XXEA 4QF4A 4KKTA 4IUNA 1ESRA 5JPMC 3BDOA 2KCNA 4DAYA 4IUVA 2E2IB 4BS9A 4G57A 3HZXA 1AFPA 3VR6A 1G8ZD 2JEAI 1LO5D 2QCPX 1NR4A 3MA2B 5LL6X 1RTOA 3UI2A 1S5CD 1BXTA 2XNAC 4XTCS 3VYUA 3NQTA 5K36H 4ZKBB 3K5NA 2KOLA 3H91A 1F9PA 5CV8A 3VYSA 2BA1A 5A35A 1U4PA 1V1PB 3NUCA 2HCIA 2F0WA 2VB3X 4KD3A 1KNEA 1X3PA 5DEHA 1TS4A 3I90A 2ID0A 2L55A 1TR5A 1STAA 2QKIC 3ND8A 1DD2A 1WTOA 2Q8IB 3J7AF 1STGA 2PNRC 3GTPB 5KNCA 2QF7A 4NMZA 1S5ED 5FK9C 4FF4A 3ZYYX 1DZ1A 5IIFA 3CQZB 1W6KA 4J1MA 4EVOA 2BOSA 1ILPA 1I4RA 4A3JB 1Y8PB 2PCFB 1NCVA 4N9TA 5FLXL 4ZUIA 1JB3A 3V2TA 3HRZC 4RGOS 4UAIA 1EL0A 3S17B 3R2IA 1SE3A 1HQMC 1SYBA 5A2QE 1Y1VB 1DXMA 1HCZA 2RVLA 5CC4A 4K8IA 1T5XD 1HRJA 1T5EA 1B9MA 1QCBD 2Z1CA 4OIKA 4PQXA 3I72A 4ZK9B 4CGYB 2NWGA 4M8AA 4DN4M 1G91A 2ZT9C 1DOLA 1I4GA 4EQNA 2DN8A 3A7AB 1HA5A 3CRKC 3D8GA 3JAME 2A68D 3C2PA 2IT1A 4F7XA 2AQ1B 4KD4A 1U4MA 3NHHA 1PFBA 3C3LA 3K5OA 1STNA 1V1OA 4K2KA 3D6WA 1LTRD 1SE4A 4ABNA 4M1UB 1GHJA 4WORA 4K5XA 2WIIB 1I4HA 1QJOA 3HG9A 2B8FA 4C2MB 3X3NA 1SAPA 2R92B 1HA6A 5EKIA 1XWEA 3MXGA 3A8JE 5DM63 2A69D 1NUCA 3LWEA 3NBHA 5EPLA 4XQQA 2VNUD 1HUNA 3RD4A 1FR3A 2F0TA 2Z4HA 3AU7A 3GTQB 3OSOA 1B2TA 4KJNA 4OGQC 3F2UA 4C3HG 1BQQT 4XYQA 1EYDA 2L0CA 3FMCA 4HCEA 2EYFA 4A3MB 1A2UA 1LTAD 5IODA 4G7ZC 5I2XA 3H6MA 3CKIB 3K57A 4H7BA 3SEBA 2N88A 2JXMB 2DY7A 2JP1A 3DM1A 3Q24A 1EZ8A 2HQEA 2LS01 2K6AA 3RZDB 2Q8RE 1TS3A 1EY9A 3GTKB 1ICWA 1HUMA 1JQYD 2K5QA 3S16B 3M7NA 1NSNS 1ML0D 1D5ZC 1QB5D 4R8NA 2AUJD 1KLUD 3ITPA 4JK1C 2NVXB 5AFWA 1I6HB 1VF7A 1AN8A 1GUWA 2LFNA 1EU3A 1STHA 3S2DB 1D6EC 4FVMA 4KY7A 4FF2A 4QMGA 1AZPA 2H4OA 1ENAA 1CM9A 1A3VA 2B2TC 1SNQA 3BS1A 3PUWA 3C46A 3D4WA 2SEBD 2HDMA 3MXNA 5C4XB 3EQLC 1EZ6A 4L6TB 5ELDA 4KY5A 1LT3D 3SK4A 4BA2I 2F0EA 3TSSA 1F2ZA 1EU4A 2CW0D 1KDAA 2NN6H 3N52A 4HR7B 3H09A 3M7GA 1PLFA 3TP5A 2NVTB 4GZYC 1B4OA 2RA4A 4A3EB 1BNZA 1V8QA 5E3FA 3U9SA 3MZ5A 3RLFA 3MFYA 1EY8A 2F0MA 1HXYD 1Z47A 2MUYA 3OWEB 3T53B 2NB0A 2TMPA 4QB4A 1ZXTA 5KEEA 5C4JB 1I3QB 1GUGA 3E0JA 2FMCA 1PFMA 3GD7A 1AP0A 2IJ0A 2L11A 4IQZA 3NTIA 1SMYD 1PZID 2A6HD 1MSHA 1BUVT 2GA4B 1R4PB 3EJIA 2K01A 4A3DB 4RFBA 2BDOA 4LMQD 1TY2A 1WTPA 3KLSX 1H9RA 4C3JG 2HCCA 4DFAA 2EY1A 4DXGA 2WP8J 3BG3A 2B2UA 5IGGA 4A3GB 1Q1EA 3S15B 5M9OA 4DNTB 2WAQB 3OIQA 3BYTB 1BF4A 4WJWA 2PZWA 3RUZA 3KBXA 4KV6A 1H9JA 2WKCA 5M3MB 3HOUB 3RMHA 1UEAB 2A69C 3P20A 5D3IB 2O5IC 3SK8A 3TDQA 3LNNA 1WTQA 1JOOA 4G4KA 3J81E 2NZ1D 3VR4A 2A73B 2QEJC 4E6IA 1RD9D 1VF5C 3A54A 2PZTA 4IUTA 2EXZA 1JOQA 3FKIB 5FKAC 1Y8OB 2F0GA 3WOEA 4IUPA 1IYVA 3MAQA 3FPPA 2AWOA 4PMWA 3SR1A 2DNEA 3L7ZC 3PUYA 3SK6A 2KECA 2M9VA 3U9OA 3QIAA 4KHZA 4QCLA 4WRDA 1FNWA 5CMDA 1SJED 2F0JA 4FF1A 1RODA 3V05A 1EY7A 1TWCB 2RDHA 3P1HA 1OXTA 2F0PA 3L9AX 2IWHA 1O78A 4R9WA 1TQOA 2EYHA 5IT9E 1Y8NB 2N55A 2NVYB 3J80E 3S1RB 4HTHA 2L4NA 4ZUJA 5EPJA 3BYYB 3SVMA 2E75C 1XYIA 3NWTA 4ME5A 5FO9B 2R3ZA 4EQPA 1A2TA 1Q12A 1SYDA 1CZGA 4X3KA 5T1GA 1I4XA 2IX3A 1B3AA 4XQNA 2RSOA 1SEBD 2R7ZB 4NW2A 1EY0A 4IFDJ 2K28A 1QNKA 1LTGD 3TN2A 1SNMA 1KAAA 1CHQD 2CW0C 2ENBA 4KKSA 5HURA 1SNDA 3Q6SA 1XXGA 5T1IA 4O1NA 1MSGA 2NBFA 1QILA 1QG7A 1HTPA 2EE1A 1KDBA 2F1MA 3FPUB 1HTLD 1V43A 2CVRA 1YNND 2JA7B 3CU7A 2PW5A 2TSSA 4DAPA 5BN4A 5C0XG 2O4XA 4IURA 2JA8B 1EIGA 3P75A 1SMYC 2IX1A 1MBYA 2A6HC 5M5XB 1H9MA 3ONAB 4RHRA 3K5LA 3T13A 1VCIA 3GTGB 5ELEA 2ICEC 5C0XJ 2F0LA 3PUZA 1LLRD 2OEOA 3NPPA 5IOCA 1IKMA 3URYA 1D5MC 4CKBA 4MIUA 1OXSC 2YYZA 4K6LA 4QUCA 1E2VA 2EY5A 1KNAA 1U4LA 4CJ2C 4ZAIA 2EJFC 2JA6B 4F87A 4U673 1ESFA 4OO1H 1PZKD 3E5SA 3QJYA 1I6VC 1VDZA 2EYLA 4LK1C 4IFDH 4I7ZC 2PZUA 2EJGC 3H3VC 5IGDA 5FO8B 2E2HB 2JEBI 3IL8A 3A8IE 4RHSA 4BBSB 1PRTF 5IGEA 5HGTA 3TP7A 4RCOA 1FNUA 2X6LA 1Q1BA 2KQ3A 3GO5A 4RWSC 4N9PA 1GOZA 1HFNA 4HAEA 1TWHB 2ZXOA 2IX0A 3ND9A 1MD2D 1WD0A 3NXWA 1F2LA 1I4PA 5IGFA 2K7VA 2IPKD 1PRTD 5E4XA 1JC7A 1G2SA 1BCPD 2CQAA 5JJZA 2XWBB 4U68A 3DUZA 2JYOA 1S4ZA 2MGSA 4EQOA 4UDUC 5CBAE 1Y1WB 5JVG3 2ICIA 2D2CC 1H9SA 2BDNA 5C4HA 3OW7A 1O7ZA 5CV6A 1PZJD 3FVQA 1STEA 4EGVA 2BA0A 4ODGA 2NUCA 1STYA 3DWPA 5FO7B 4RAUC 1Q3LA 2AQ2B 4C3IG 4J8QA 4RGTA 1ZEQX 4HCSA 1LT5D 4Z9CB 3AB9A 4NDXA 4IN3A 5FLXE 2EVBA 3T16A 1KTKA 1C8CA 2FINB 3SDZA 4FP5D 5CV7A 3T51B 3GTOB 5TSSA 1SJHD 4S3SA 1AEXA 3PUXA 2KHSA 2NYZD 3Q23A 2SDFA 1GHKA 3P7JA 2F0UA 4DGZA 2EPBA 3D4DA 2B2WC 2JE6I 1D2BA 1NAPA 1RJTA 1K83B 1AZQA 2J0TD 4TRDA 3KLRA 1BR9A 5BN3A 3VA7A 4KKUA 4WFN3 2PMZB 5M5WB 2F3WA 3BVGA 4PMBA 3TMEA 4RGNA 4DF7A 1RTNA 5C5LA 5C4ZA 5C3EB 1LABA 3DXJC 1YNNC 2MPMA 3OOCA 1Z6HA 4L8JA 2B2VA 1F2MA 4Q5VA 2XRQD 4HSVA 5LHY1 1EIHA 3MHBA 2L9HA 3M85A 1W6JA 1ZYRC 5C6AA 1JWUD 1H9KA 2EJMA 1D5XC 4A3IB 4B08A 3G7LA 2BE5D 4J6HA 1WD1A 3I70A 2G9HD 5JPNC 1GUOA 1ONLA 1AW7A 1F2YA 4CJ0B 2B2UC 1LT6D 2NTSA 3S14B 1TVXA 2D9UA 5KYIA 1FD7D 3L3OC 2EZVA 2HUGA 3GTLB 5KGUA 3NQIA 4C56C 2LMCB 4OHJA 1SXTA 2JSOA 4DK0A 3TP6A 1IHZA 3BDCA 1TS2A 4K14A 3E6ZX 1GXDC 1HFGA 2L1BA 2F03A 3MVVA 2RQXA 1BDOA 5CORA 2A6ED 2RKSA 2F0HA 4XIGS 1PRTB 2DY8A 1SYGA 3HEJA 1BCPB 3KK7A 2B2TA 1DYQA 3PV0A 2NVQB 3OWFA 3PMFA 4C3HB 1I4QA 1JWSD 3NTKA 4OL7A 1EFID 4A3KB 5DAUA 4OIJA 2KUMA 1X32A 1SBBB 2EYMA 1TKWB 3EROA 1O80A 2G9DA 3S1QB 5JEAG 3HOXB 2E76C 1KABA 4DAVA 2J7ZA 2QDBA 1PRTC 3SXHA 2K5WA 4F88A 5J22A 2F0DA 1TWFB 2XSCA 4HEDA 1WVLA 3PIP3 1BCPC 1Z7TA 1ENCA 2F0IA 3I4MB 5JEAJ 4RH6A 4ZLTF 1IYUA 2NN6I 4DXFA 2I46A 3PUVA 2DNCA 3S9WA 3I3CA 1EY4A 1BOSA 4FXKC 2WKDA 3WOFA 3IFTA 2KVMA 1KLGD 1EOTA 1EEFD 3BZDB 4XYOA 1SNCA 3RZOB 2EY2A 4BA1I 4G7OC 3R8BA 2E2JB 3J7YW 3SK5A 3MC0B 3V96A 4RA8A 2YU9B 2I07B 4NKLA 1LACA 1L0YB 3OHXC 1CA5A 5E4WC 1A6XA 1FYCA 1G291 5K36G 1RF2D 3KLSA 4CHTB 3OMCA 2KJXA 5F2DA 3NE5B 5I6WA 3K5MA 5D65A 4C1NK 4H44C 1SE2A 2OXPA 3MFGA 1ENFA 2R6GA 1ILQA 3K7AB 5I4DA 2F0QA 1CK1A 5J1ZA 3I8ZA 5DM73 1SYEA 3CHBD 5M5YB 1UNSA 4MHEA 2E2DC 1D1IA 4TQUS 1U4RA 2VUMB 2C9OA 1R9TB 3I73A 3QG1A 3HOYB 1EY6A 1LTSD 5G3LD 1RCVD 2XWJB 3D6CA 1EQTA 2VXWA 3NP8A 1O7LA 2SOBA 4CBVA 1HHVA 1QWYA 1R4QB 2WB1B 1LTBD 4NP5A 4LJZC 3TZDA 3FDTA 2CHBD 5A2QL 4QIWB 3A7LA 1TY0A 2Y0SB 2HDLA 4KJOA 1A3UA 3G6JB 3GTMB 3OPOA 3HGBA 4K6DA 4FO2A 1TS5A 1JCKB 2BE5C 3GV3A 4FYDA 2PPBC 2F0OA 5JAVA 1LT4D 2KCCA 4XT3B 1J8IA 3MEHA 4C3JB 3NSWA 1SYFA 3M4OB 4I65A 3JAML 2LY7A 2F0FA 2PO4A 2D5DA 3PO3B 2O5JC 3EFXD 1GUNA 3HS0C 4AYBB 5NUCA 2Z4IA 4A93B 4DNRB 1G2TA 4BWGB 1QNUA 4XDXA 5IGCA 3TZUA 1SFOB 3VYRA 1ZYRD 5EKLA 2A6EC 3QO2A 2ZXRA 4HMIA 4ILWA 2B63B 2B2YA 2J4XA 1EWCA 4RKBA 4DU9A 4PNYA 3LX0A 5LL6S 1H9SB 3SHLA 1B50A 5KIXA 3I4LA 5E1FA 1S5FD 1JORA 3LWUA 3S1MB 3OMGA 1JWMD 2XN9C 5I2YA 3PO2B 3GQBA 1F9RA 4X3UA 4PV1C 2A74C 3IFDA 1SYCA 1E2WA 3W3AA 4JBWA 2B8GA 1B53A 1GUSA 1TU2B 1STBA 2F3VA 2SNSA 3MTSA 2OF1A 2R61A 4XT1B 2M2LA 1QE6A 1B44D 1EEID 1S5DD 4FF3A 1PMRA 5ELFA 1X3QA 3KUPA 2EOTA 2X69A 3IKJA 4MN3A 4ZRZA 3T4AC 3QB3A 1K8OA 1SNOA 3NWSA 1MI2A 5CV4A 4KHVA 2ZXPA 5DNFA 3T56B 1BCPF 4IUUA 4K8JA 4CKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNN C;  3OOC A;  1Z6H A;  4L8J A;  1CI3 M;  3PUZ A;  3TZU A;  2NN6 H;  1Q12 A;  3BDO A;  1T5E A;  2A69 C;  3VR2 A;  1B9M A;  2JXM B;  3P20 A;  2D2C C;  4HR7 B;  1H9S A;  4KKT A;  3OW7 A;  2O5I C;  2A6E C;  3I72 A;  1TKW B;  1ZKO A;  3LNN A;  2BA0 A;  1OXS C;  2YYZ A;  2EDG A;  4DK1 A;  5KNB A;  3M85 A;  2ZT9 C;  4KN7 C;  1HPC A;  1ZYR C;  4GZY C;  3VR6 A;  1E2V A;  2DN8 A;  1H9K A;  2E76 C;  5JEA G;  3N6R A;  4TQU S;  2EJM A;  3A7A B;  4RCN A;  2JEA I;  1V8Q A;  3CRK C;  3M4Y A;  1H9S B;  1E2Z A;  3I73 A;  2EJF C;  3QG1 A;  2AUK A;  1EWH A;  3U9S A;  2A68 D;  3RLF A;  1Z7T A;  3VR4 A;  3MFY A;  1IW7 D;  1VF5 C;  2IT1 A;  3M7N A;  2BE5 D;  3I4L A;  3AB9 A;  4OO1 H;  1CFM A;  4XTC S;  1O7L A;  2V4D A;  1Y69 U;  1GUO A;  1ONL A;  3T53 B;  2EVB A;  2A68 C;  5BN5 A;  5C0X H;  3QJY A;  1I6V C;  1VDZ A;  1Y8O B;  2L5T A;  2CW0 C;  5K36 H;  3LWU A;  4LK1 C;  4IFD H;  4KKS A;  1IYU A;  2NN6 I;  1Q90 A;  2AUJ D;  4I7Z C;  4KMU C;  3SDZ A;  3T51 B;  1OXV A;  1OXX K;  2EJG C;  2BA1 A;  4JK1 C;  1IYV A;  4LJZ C;  5A35 A;  3FPP A;  3MXU A;  3PUV A;  3GQB A;  3SE0 A;  1GHJ A;  1GUG A;  2AWO A;  3GD7 A;  1VF7 A;  2DNC A;  4IQZ A;  3PUX A;  4PV1 C;  2NN6 G;  3A7L A;  2JEB I;  2DNE A;  1HTP A;  1E2W A;  1QJO A;  2A6H D;  4KI0 A;  2D62 A;  2B8F A;  3W3A A;  2LMC B;  3L7Z C;  4JBW A;  1GHK A;  1K8M A;  1GJX A;  2E74 C;  3IFT A;  3PUY A;  2F1M A;  4DK0 A;  4G7H C;  3WDN A;  2B8G A;  3A8I E;  3A8K E;  3QIA A;  1V43 A;  3ND8 A;  3OPO A;  4KHZ A;  1DD2 A;  1GUS A;  3HGB A;  2JE6 I;  1OXU A;  1IW7 C;  1TU2 B;  2Q8I B;  2BE5 C;  3D4R A;  2PNR C;  4BA1 I;  5KNC A;  1B9N A;  2QF7 A;  4TKO B;  1Q1B A;  4KN4 C;  3A8J E;  4G7O C;  2BDO A;  2A69 D;  5JEA H;  3KLR A;  1PMR A;  3VR3 A;  4H0L C;  5KND A;  2PPB C;  2KCC A;  1BDO A;  4H13 C;  5BN3 A;  2A6E D;  1H9R A;  4XIG S;  3VA7 A;  4KKU A;  1LAC A;  3IKJ A;  3ND9 A;  4OO1 G;  3D31 A;  1OXT A;  3BG3 A;  5BN4 A;  1YNJ C;  3PUW A;  1A6X A;  1FR3 A;  1FYC A;  1CTM A;  2K32 A;  5C0X G;  1K8O A;  1G29 1;  1O78 A;  1Y8P B;  2PCF B;  5K36 G;  2K7V A;  4IFD G;  2KA7 A;  1SMY C;  1Q1E A;  2D5D A;  3EQL C;  2A6H C;  2O5J C;  1GUN A;  3NE5 B;  4OGQ C;  1GUT A;  1Y8N B;  4DNT B;  1H9M A;  3PV0 A;  1DCZ A;  1HQM C;  4DNR B;  4BA2 I;  3T56 B;  1LAB A;  1VCI A;  4H44 C;  3DXJ C;  2K33 A;  3FMC A;  2E75 C;  3CRL C;  2R6G A;  3H94 A;  4G7Z C;  3VR5 A;  1H9J A;  1DXM A;  1HCZ A; 
#chains in the Genus database with same CATH topology
 4GOP B;  5EQ0 A;  3X3M A;  1VS0 A;  4JC0 A;  3VR2 A;  3HOV B;  4BY7 H;  3S1N H;  1HZ9 A;  1TWG B;  2PYK A;  4A3F H;  2WV6 D;  3J81 j;  3FHW A;  5KNB A;  1HPC A;  2JJQ A;  2P5Z X;  4A3E G;  3GTO H;  1Q8I A;  4GNX B;  1Q46 A;  1L2F A;  3HOZ B;  4RCN A;  1E0B A;  3GV6 A;  2EQS A;  1IBL Q;  3J80 i;  4DA2 A;  2WIN B;  1IW7 D;  1V1P A;  3FRP B;  3TEH B;  1SRO A;  2SNM A;  4OEM B;  5C0X H;  4ID6 A;  2YTX A;  4FXG C;  1C0A A;  1PFN A;  5EPK A;  2H5X A;  1EQV A;  1XJV A;  1M8A A;  1X3G A;  3KF8 A;  4GOP C;  1SDF A;  1TWA B;  3I4N B;  1C48 A;  3QOJ A;  1YHQ A;  5I9P A;  5CV9 A;  1K8G A;  1CHP D;  2NN6 G;  5EGT A;  1WCM B;  4KI0 A;  4NPS A;  4YY3 L;  1UUP A;  1YVC A;  4K2L A;  1Z9F A;  4L63 B;  4BY7 B;  1JT8 A;  2CKZ B;  3S1N B;  3A8K E;  4GNX C;  2B2V C;  1DM0 B;  1DJR D;  5IE8 A;  4A3F B;  2QW7 A;  4A3D G;  4OO1 I;  3T1Y Q;  1LTI D;  2AMC B;  3FEW X;  4YIJ A;  1DOK A;  3I91 A;  5C3E H;  1WTV A;  2FJ2 A;  3VR3 A;  3EIV A;  4A3B H;  4IFD I;  1PTO F;  5JOB A;  3HP3 A;  1U9R A;  1QUQ B;  3H0G H;  1PH5 A;  1XX8 A;  3D31 A;  1J6Q A;  5KYL A;  1JOK A;  5J39 A;  4DV3 L;  4A3G G;  1RKN A;  2A5H A;  1ICF B;  1X65 A;  2F0V A;  4GLA C;  3A55 A;  2VQE L;  2MHV A;  3D3R A;  3K0Y A;  1DCZ A;  4LAA A;  4P2C B;  1CQV A;  5D3D A;  2NZH A;  3CRL C;  1PH7 A;  1PTO D;  2RF4 A;  3QOL A;  3K59 A;  3LGJ A;  3HOU G;  4HJ9 A;  1YIJ A;  1CI3 M;  5C3X A;  3F2B A;  4X3T A;  4CJ1 B;  4ZYS A;  2ZTC A;  3R2T A;  2EXD A;  2PQA A;  3UE0 A;  3QWN A;  2L12 A;  2QIL A;  2EDG A;  1Y14 B;  4KN7 C;  2GN5 A;  2MP1 A;  4Y7N H;  3N6R A;  2XRS D;  4L5T A;  1XNQ L;  4A3B B;  3C1E A;  1EQR A;  1FJG L;  1LV9 A;  5EBD A;  2F52 A;  4LF6 L;  1EWH A;  2PW7 A;  3TP8 A;  5BR8 Q;  1N34 Q;  3H0G B;  4APV A;  2EYJ A;  2ZTD A;  3AMU A;  3GDE A;  5JVH 3;  5EJW A;  5EBC A;  3W1G A;  1CFM A;  2KHJ A;  1LYL A;  2V4D A;  3FKI G;  1O7I A;  3M3Y H;  4DR6 L;  2L5T A;  1KDC A;  2IHF A;  5CR3 A;  2JA5 H;  1WTX A;  1OXV A;  1OXX K;  4UP8 A;  1MJC A;  5C0X I;  4X3S A;  2KEN A;  5GAE C;  1X9N A;  3MXU A;  3SE0 A;  1YNJ D;  4BY1 G;  2EY6 A;  4HN7 A;  2UUB Q;  3C1F A;  4TSS A;  2K75 A;  3VA5 A;  3NK9 A;  5KRU A;  3BVM A;  1CT1 D;  1E22 A;  2E8G A;  1B1Z A;  4G7H C;  4PZ8 A;  1RIP A;  3K58 A;  4ULL A;  1EQQ A;  4K5V A;  2RDG A;  3IAY A;  3CCL A;  1C4Q A;  2M00 A;  3D4R A;  4IPH A;  1VQ4 A;  1D7Q A;  1ET6 A;  1PYW D;  1E24 A;  4C3I H;  4Y7N B;  1DOM A;  3R3O A;  2UXC Q;  3K80 C;  4NXM Q;  3R93 A;  3A74 A;  1IL8 A;  1BO0 A;  1N9W A;  2B2W A;  4JW0 A;  4DV1 Q;  1F77 A;  4DV7 L;  2B29 A;  4JPB W;  3J81 L;  4JI7 Q;  3J7Z C;  2K05 A;  3PF5 A;  3S2H B;  3M3Y B;  5C5M A;  2OT2 A;  1HNX L;  2KBN A;  3S24 A;  2LKV A;  3CME A;  2PQE A;  4RKL A;  1FGB D;  2K03 A;  2JA5 B;  2MO0 A;  2JA9 A;  3G6E A;  3W2D A;  5C3W A;  2K33 A;  5K5P A;  2RBM A;  3VR5 A;  1KXL A;  4UPA A;  4KTA A;  3A56 A;  1LTT D;  2VL6 A;  1WTR A;  4X66 L;  4DV2 Q;  4B9W A;  1B3Q A;  3NBI A;  1WTW A;  3HKS A;  2KED A;  4CKE A;  1JJC B;  1LTL A;  1ZKO A;  1L0X B;  4LF9 Q;  3T1H L;  2O2L D;  4DK1 A;  3GTJ H;  3J7A V;  1G6Z A;  4B9X A;  3A5U A;  4R4Q A;  3MWY W;  2RCN A;  1N33 L;  4KK7 A;  1TT2 A;  3KJP A;  4C3I B;  2R7Z G;  4JYA Q;  5IYC G;  1CA6 A;  4JV5 L;  2CWA A;  2Z8L A;  2A8V A;  3M4Y A;  1VMP A;  1E2Z A;  2K04 A;  2AUK A;  1I50 H;  2F4I A;  2XIW A;  3BVZ A;  1XTD A;  4FXD A;  2EYP A;  2XTI A;  1PXU A;  2A68 C;  1BBX C;  2I5L X;  3F1Z A;  4ZQ3 A;  1J9O A;  1PTO H;  1VQF A;  3OW2 A;  3PF4 A;  1NR2 A;  4J15 A;  2AQ3 B;  3Q22 A;  3PSI A;  3DWA A;  2C5C A;  1A3T A;  5IT9 L;  4FNF A;  4DNI A;  4R8I A;  3J80 L;  2E2J H;  2VB2 X;  2R7F A;  3VYT A;  1E1O A;  4KY6 A;  3HOW H;  4HMJ A;  2YU9 H;  2AWN A;  2DJG C;  2VS1 A;  2D62 A;  1MGS A;  1UAP A;  1GJX A;  1K8M A;  1FNV A;  3GP7 A;  4O42 A;  1DON A;  2H1E A;  1JE4 A;  1VQA A;  5H1S E;  1SSO A;  1IW7 C;  1JIC A;  2YTY A;  3DMU A;  4DUZ Q;  2WAC A;  2XVS A;  1CZW A;  3CCU A;  4V0B A;  3OIP A;  3GTJ B;  2X6G A;  4RGM A;  3MXP A;  4MNO A;  3ERQ A;  2BH8 A;  2JA7 G;  1BKB A;  2NTT A;  5M3F H;  4KHP Q;  2K5D A;  4GN5 A;  1JJG A;  1I50 B;  2IW3 A;  3CPW A;  2MJ8 A;  2K1B A;  3UE1 A;  2JA8 G;  2K32 A;  1F9Q A;  4Q0F A;  3PIO 3;  4V19 0;  5IGB A;  3TBI B;  3BU2 A;  1IBL L;  3AFQ A;  1PTO B;  1PDQ A;  1EY5 A;  4B3R L;  5IYB H;  2CQO A;  5ISR A;  4H02 A;  2KCT A;  3DWQ A;  3H94 A;  4A4I A;  2OQ0 A;  5COY A;  5D14 A;  4DV6 Q;  2B39 A;  5ELB A;  4IZ8 A;  1RDP D;  3HOY H;  2R93 H;  4L5R C;  3HOW B;  3DEO A;  5EKK A;  2F0K A;  1MJE A;  3BDL A;  3NEL A;  4PMC A;  1OO9 B;  2EYO A;  1FVI A;  4ZKC B;  1IKL A;  4EX5 A;  3NTH A;  1TII D;  5FOB B;  2Q2I A;  4HSP A;  2FFK B;  5GAG C;  1O7Y A;  4A3L G;  2D0O A;  5CBE E;  2HT1 A;  1II3 A;  3HKZ B;  1M4V A;  1EYA A;  5M3F B;  2VY3 A;  4QUF A;  4BY1 B;  5G3L F;  2F0S A;  4C1N I;  3OTO L;  3CC7 A;  4BBR H;  4K5W A;  4F8M A;  3T1Y L;  4DR7 Q;  1S5B D;  1PTO C;  4IOC A;  5C44 H;  1Y69 U;  5BN5 A;  4IUQ A;  5IYD H;  1IYJ B;  1KHI A;  4LF7 L;  1QOH A;  3EVQ A;  1Q90 A;  2ZM6 Q;  4KMU C;  2FHT A;  3CCM A;  3EA6 A;  2RCF A;  1T9H A;  3KOJ A;  4XQJ A;  2D0P A;  3KF6 B;  1QVG A;  5ELC A;  5I9O A;  4IAL A;  2FMM A;  1SMX A;  1OTC A;  2R93 B;  5I6Y A;  2MFI A;  2E74 C;  1SNP A;  4BBS G;  2OCE A;  2UU9 Q;  1W3S A;  3WDN A;  3DEP A;  2E2I H;  4NXN Q;  1ET9 A;  1XTC D;  1OXU A;  5CYU A;  3TRZ A;  1VMC A;  1X3F A;  3NEM A;  1B9N A;  4TKO B;  1EYC A;  4KN4 C;  4R4O A;  5JEA H;  5KND A;  2B2Y C;  4H0L C;  2JQO A;  2HHH Q;  1XPO A;  5JJK A;  4JI4 Q;  4H13 C;  4JI8 L;  1CQF A;  1F9S A;  3KDF A;  1N32 Q;  1UWV A;  1JR0 D;  5CGK A;  3O13 A;  4OO1 G;  1RHP A;  1YNJ C;  3K6O A;  1SFO H;  1YHA A;  2Q8T A;  4BBR B;  1CTM A;  5C44 B;  4HJA A;  2BCO A;  3ULP A;  1D1K A;  4IFD G;  2KA7 A;  2RSN A;  1I94 Q;  3KBG A;  1SN8 A;  2KEE A;  3CD6 A;  4P73 A;  1A15 A;  3CC4 A;  5CV5 A;  1GUT A;  5BR8 L;  2F0N A;  2RDF A;  1HQR D;  4B3M L;  3Q0A A;  2IL8 A;  4LF4 L;  3DHQ A;  4XXE A;  4QF4 A;  4KKT A;  4IUN A;  2QGQ A;  5LMN W;  1Y1W G;  1ESR A;  3BZC A;  5JPM C;  1N36 Q;  3BDO A;  2MNA A;  4K0K Q;  1K28 A;  1S40 A;  2KCN A;  4DAY A;  4IUV A;  3TS2 A;  2E2I B;  4BS9 A;  4G57 A;  1C7Y A;  3HZX A;  2UUB L;  4X64 Q;  1AFP A;  4POG A;  3GTP H;  3VR6 A;  3ICE A;  1U5K A;  1G8Z D;  1IZ6 A;  1VQO A;  2JEA I;  1LO5 D;  2QCP X;  1NR4 A;  2UXD Q;  1WOC A;  3CQZ H;  3MA2 B;  5LL6 X;  2N3S A;  1RTO A;  3UI2 A;  1S5C D;  4OX9 Q;  4A3J H;  1BXT A;  2XNA C;  4XTC S;  1GD7 A;  3F8T A;  3VYU A;  3NQT A;  5K36 H;  4ZKB B;  5FLM G;  3K5N A;  4NXM L;  3L0O A;  2F4V Q;  2KOL A;  3H91 A;  1F9P A;  1UE7 A;  5CV8 A;  3U4V A;  3VYS A;  4DV1 L;  4HJ7 A;  2Z6K A;  2BA1 A;  4B3T Q;  5A35 A;  1U4P A;  1V1P B;  4LUV A;  1Y1V H;  3NUC A;  3ULJ A;  2HCI A;  2F0W A;  2VB3 X;  4KD3 A;  4A3C G;  1KNE A;  1X3P A;  2DUD A;  5DEH A;  1TS4 A;  2K5N A;  3I90 A;  1VQP A;  2ID0 A;  2L55 A;  1TR5 A;  2WAQ E;  3KF8 B;  1STA A;  2Z9H A;  2QKI C;  3A5Z B;  2HIV A;  3ND8 A;  1DD2 A;  1YEZ A;  4PG3 A;  1WTO A;  2Q8I B;  3J7A F;  1STG A;  4LF5 L;  2PNR C;  3GTP B;  5KNC A;  2QF7 A;  4NMZ A;  1S5E D;  5EAY A;  5FK9 C;  1KIX A;  4FF4 A;  3ZYY X;  1DZ1 A;  4O0A A;  5IIF A;  3CQZ B;  4LF9 L;  3VDY A;  1W6K A;  2PI2 A;  4J1M A;  1SE8 A;  4AQY Q;  4EVO A;  2BOS A;  1ILP A;  1I4R A;  3HOV H;  4A3J B;  4GKJ Q;  1Y8P B;  2PCF B;  4JYA L;  3BZK A;  1NCV A;  4N9T A;  4IJH A;  5FLX L;  4ZUI A;  1JB3 A;  2V1C C;  3V2T A;  3HRZ C;  4DV5 L;  4JI6 Q;  4RGO S;  4UAI A;  1EL0 A;  3S17 B;  3R2I A;  5FLX c;  4DUY Q;  1SE3 A;  1HQM C;  2K5V A;  1M1K C;  3PCO B;  1SYB A;  5HGQ A;  4UP7 A;  5A2Q E;  1Y1V B;  4QGU A;  5IP7 H;  1DXM A;  1X6O A;  1HCZ A;  2RVL A;  5CC4 A;  1H95 A;  4JVZ A;  4K8I A;  1T5X D;  2YTV A;  1HRJ A;  1T5E A;  1B9M A;  4C2M H;  1QCB D;  2Z1C A;  2ATW A;  4OIK A;  4PQX A;  5C4X G;  3NEN A;  4IPC A;  3I72 A;  3U4Z A;  4ZK9 B;  2R92 H;  4CGY B;  2NWG A;  4M8A A;  4DN4 M;  1G91 A;  5LMU Q;  2ZT9 C;  1VQN A;  1EOV A;  1YI2 A;  1DOL A;  1I4G A;  3UDG A;  4EQN A;  2DN8 A;  4A3I G;  1YJN A;  3A7A B;  4RMF A;  1HA5 A;  5GQO A;  3CRK C;  4X62 Q;  3D8G A;  3JAM E;  2A68 D;  2F3I A;  1L0W A;  4DR1 Q;  3C2P A;  1WCM H;  2IT1 A;  4F7X A;  2AQ1 B;  4KD4 A;  2E5L Q;  1U4M A;  4R1J A;  4IPD A;  3BJU A;  3NHH A;  1PFB A;  3RN2 A;  4KHP L;  4JCV E;  3C3L A;  2UXB Q;  3K5O A;  1STN A;  1V1O A;  1K8A C;  4K2K A;  1PH6 A;  1VQ5 A;  3D6W A;  3K8A A;  1LTR D;  5IY0 A;  1SE4 A;  4ABN A;  4M1U B;  1GHJ A;  4A3M H;  3I4O A;  4WOR A;  4JI1 L;  1EIY B;  2ASB A;  4DR2 Q;  4K5X A;  1YIT A;  2WII B;  1I4H A;  1QJO A;  3HG9 A;  2B8F A;  3AFP A;  4C2M B;  4LFB L;  3X3N A;  1HNZ Q;  2JK8 A;  1SAP A;  5L37 A;  2R92 B;  1G6P A;  2PI2 E;  1HA6 A;  2L15 A;  5AJ3 Q;  5EKI A;  3RZD H;  1XWE A;  3MXG A;  2LXJ A;  3A8J E;  5DM6 3;  2A69 D;  1NUC A;  3GTK H;  3S16 H;  4YWK A;  3CAM A;  3LWE A;  3NBH A;  5EPL A;  4XQQ A;  2VNU D;  1HUN A;  1N8R C;  3RD4 A;  1FR3 A;  1NTG A;  2F0T A;  4IO9 A;  2Z4H A;  3AU7 A;  2QEX A;  3GTQ B;  3JC6 6;  3OSO A;  1B2T A;  4KJN A;  4OGQ C;  1VQD A;  3F2U A;  5HY6 A;  4A75 A;  4C3H G;  1BQQ T;  1YBY A;  2NVX H;  1I6H H;  4XYQ A;  3PIO A;  1EYD A;  4X6A H;  2L0C A;  3FMC A;  4HCE A;  4CDD C;  2EYF A;  4DR7 L;  4A3M B;  1A2U A;  1LTA D;  5IOD A;  4G7Z C;  4A3K G;  5I2X A;  1VQC A;  3H6M A;  3CKI B;  3K57 A;  2ZM6 L;  4H7B A;  3SEB A;  2N88 A;  2JXM B;  2DY7 A;  2JP1 A;  3DM1 A;  3Q24 A;  1EZ8 A;  1K3R A;  2HQE A;  2LS0 1;  2K6A A;  1K3B C;  3HOX G;  2WAQ G;  3RZD B;  2Q8R E;  1VQ8 A;  1TS3 A;  3M4P A;  4GKK L;  1EY9 A;  3GTK B;  1ICW A;  1HUM A;  1JQY D;  2UU9 L;  2K5Q A;  1E7Z A;  5M3M G;  3S16 B;  3EN2 A;  4DR4 Q;  4LFA Q;  3M7N A;  3I4M G;  1IBK L;  3IRB A;  1JJ2 A;  1NSN S;  1ML0 D;  1D5Z C;  2HHH L;  1QB5 D;  4JI4 L;  4R8N A;  2AUJ D;  3ER0 A;  1KLU D;  3ITP A;  1N32 L;  4JK1 C;  2NVX B;  5AFW A;  1I6H B;  4WJ3 M;  1VF7 A;  1AN8 A;  1GUW A;  2NZO A;  5LMN Q;  2LFN A;  1CKO A;  4CDC C;  1Q8K A;  1EU3 A;  1STH A;  3Q8D A;  3S2D B;  3AYH B;  1D6E C;  4FVM A;  1PH3 A;  2C35 B;  3S2H H;  1XPR A;  4KY7 A;  4FF2 A;  2NVT H;  4QMG A;  1N36 L;  1AZP A;  4K0K L;  4A3E H;  2H4O A;  4IOA A;  1ENA A;  1CM9 A;  1A3V A;  1J5E Q;  2B2T C;  2VQF Q;  1SNQ A;  3RNU A;  2Q2T A;  4X64 L;  3BS1 A;  3PUW A;  4X65 Q;  3C46 A;  3UDI A;  5FJ8 G;  3D4W A;  2SEB D;  2HDM A;  3MXN A;  5C4X B;  3EQL C;  3CXC A;  1EZ6 A;  4L6T B;  5ELD A;  4KY5 A;  4DPG A;  1DGS A;  1PH1 A;  4JI0 Q;  1LT3 D;  3SK4 A;  4BA2 I;  4IPG A;  1VQH A;  3KYH C;  2F0E A;  1KD1 C;  2LSS A;  3TSS A;  1F2Z A;  1EU4 A;  2CW0 D;  1JB7 A;  1KDA A;  1WTH A;  1NE3 A;  2NN6 H;  3N52 A;  4QL5 A;  1PH8 A;  4FDB A;  4HR7 B;  4B3T L;  2JN4 A;  3QR8 A;  3H09 A;  3M7G A;  1PLF A;  3TP5 A;  2NVT B;  4A3D H;  2K5H A;  4GZY C;  1B4O A;  2RA4 A;  2Q2U A;  4A3E B;  1Q82 C;  2VUM G;  1BNZ A;  1V8Q A;  5E3F A;  1QZH A;  3U9S A;  3MZ5 A;  1C9O A;  1VQE A;  3RLF A;  3MFY A;  1EY8 A;  2F0M A;  1EUJ A;  1HXY D;  1Z47 A;  1QUQ A;  2MUY A;  3OWE B;  2I0Q A;  2ZJQ A;  4A3G H;  3T53 B;  1X56 A;  2WB1 G;  2NB0 A;  2BH2 A;  3S15 H;  2TMP A;  4QB4 A;  3A0J A;  1ZXT A;  5KEE A;  4DR3 Q;  1HZC A;  4CDF C;  5C4J B;  1I3Q B;  4AQY L;  5IP9 G;  1VQK A;  3AQQ A;  1GUG A;  3E0J A;  2FMC A;  1PFM A;  3GD7 A;  1AP0 A;  2IJ0 A;  2L11 A;  4IQZ A;  3NTI A;  2Y0S G;  2N78 A;  3HOU H;  1SMY D;  1PZI D;  1E3P A;  2A6H D;  1MSH A;  4JI6 L;  2KCM A;  4YCV A;  1BUV T;  2GA4 B;  2GVB A;  1R4P B;  3EJI A;  1NNX A;  2K01 A;  3ZJY C;  4A3D B;  4LF8 Q;  4RFB A;  2BDO A;  4LMQ D;  1TY2 A;  3H15 A;  1WTP A;  3KLS X;  1HZA A;  1H9R A;  4C3J G;  2HCC A;  4DFA A;  2EY1 A;  1KRS A;  3ULL A;  2IHE A;  2WP8 J;  4DXG A;  3BG3 A;  1YJ9 A;  2B2U A;  5IGG A;  4A3G B;  3PO3 G;  3FKI H;  1Q1E A;  1QVF A;  4X62 L;  3S15 B;  1NY4 A;  5M9O A;  4AYB G;  4DNT B;  4A93 G;  3M4Q A;  2WAQ B;  1UE6 A;  3OIQ A;  3KDF B;  3BYT B;  1XPU A;  1BF4 A;  4WJW A;  2PZW A;  3RUZ A;  3KBX A;  2Q2H A;  3W5O A;  2E5L L;  4KV6 A;  1H9J A;  2WKC A;  4DV0 Q;  4P75 A;  5M3M B;  3HOU B;  4BY1 H;  3CCR A;  3RMH A;  1UEA B;  1CUK A;  2A69 C;  4JOI C;  3P20 A;  5D3I B;  2O5I C;  2B63 G;  3SK8 A;  3TDQ A;  3LNN A;  1YHB A;  1WTQ A;  4DR2 L;  1JOO A;  1RL2 A;  1XMO Q;  4G4K A;  3M9B A;  3J81 E;  2NZ1 D;  1TWC H;  4DAY B;  3KLW A;  3VR4 A;  2A73 B;  2QEJ C;  4E6I A;  3AEV A;  1RD9 D;  1VF5 C;  3A54 A;  4HIO A;  4NB3 A;  2PZT A;  4IUT A;  2EXZ A;  1JOQ A;  1JE5 A;  3FKI B;  5FKA C;  1Y8O B;  2MQH A;  2F0G A;  5GAH C;  1QVC A;  3WOE A;  4IUP A;  2NVY H;  1K0S A;  3S1R H;  3PO2 G;  1IYV A;  3MAQ A;  4HIK A;  2PMZ E;  3FPP A;  4LFC Q;  2AWO A;  1VQL A;  5JJL A;  4PMW A;  2JA6 G;  3SR1 A;  3RR5 A;  2DNE A;  1VQJ A;  3L7Z C;  3PUY A;  4KLK A;  3SK6 A;  4PZ7 A;  2KEC A;  1L1O A;  2M9V A;  3STB D;  3U9O A;  3QIA A;  4KHZ A;  4QCL A;  4WRD A;  1FNW A;  5CMD A;  3G48 A;  1SJE D;  3K7U C;  2F0J A;  1GKH A;  4FF1 A;  1ROD A;  2R7Z H;  2RHS B;  3V05 A;  5IYC H;  2QA4 A;  1EY7 A;  4GN3 B;  3EBE A;  1TWC B;  2RDH A;  3P1H A;  1OXT A;  2F0P A;  1W2B A;  3L9A X;  2IWH A;  1O78 A;  4R9W A;  1TQO A;  2EYH A;  1VQM A;  5IT9 E;  1Q7Y C;  1Y8N B;  2N55 A;  4DV4 Q;  2NVY B;  3J80 E;  3D0F A;  3S1R B;  2OTL A;  4HTH A;  2L4N A;  3DLL A;  1BBU A;  4ZUJ A;  4LFA L;  5EPJ A;  3BYY B;  3SVM A;  2E75 C;  1XYI A;  3NWT A;  2VQE Q;  2Z6K C;  4ME5 A;  5FO9 B;  4P74 A;  2R3Z A;  3KJO A;  4EQP A;  1A2T A;  1Q12 A;  1SYD A;  1CZG A;  4X3K A;  3KFU A;  5T1G A;  4AIM A;  1I4X A;  2IX3 A;  1B3A A;  2QDL A;  4POF A;  4XQN A;  2RSO A;  2XGT A;  3HOZ G;  1N34 L;  1CSP A;  1SEB D;  1HR0 W;  1G51 A;  2JA7 H;  2R7Z B;  2ZTE A;  3K81 C;  4NW2 A;  4WJ4 A;  3E9I A;  1EY0 A;  2ES2 A;  4IFD J;  2K28 A;  1QNK A;  1XNQ Q;  1LTG D;  2I5H A;  3TN2 A;  4Y52 H;  2JA8 H;  2CCZ A;  1SNM A;  5E7N A;  4LF6 Q;  1KAA A;  1CHQ D;  2CW0 C;  2ENB A;  2R7D A;  4KKS A;  5M5X H;  1J5E L;  5HUR A;  1SND A;  3Q6S A;  1XXG A;  5GRO A;  1PHJ A;  3I4N G;  5T1I A;  4DR6 Q;  3GTG H;  4X65 L;  1YJW A;  1KQS A;  4O1N A;  1MSG A;  2NBF A;  4TVA B;  3H3V H;  1QIL A;  1QG7 A;  2HD3 A;  1HTP A;  2EE1 A;  4BY7 G;  4N8X 1;  1KDB A;  2F1M A;  3FPU B;  4A3F G;  1HTL D;  4JBK A;  1V43 A;  1YNX A;  2UXC L;  2CVR A;  1YNN D;  3S17 H;  1Q86 C;  4A3L H;  1SR3 A;  4JI7 L;  2JA7 B;  2ALY B;  3CU7 A;  2PW5 A;  2TSS A;  4DAP A;  5BN4 A;  4ALP A;  1Q81 C;  5C0X G;  2O4X A;  4IUR A;  2JA8 B;  1EIG A;  3P75 A;  1SMY C;  2IX1 A;  4YHH Q;  1MBY A;  2A6H C;  2CH4 A;  5M5X B;  3TS0 A;  1H9M A;  3JAM c;  3ONA B;  4RHR A;  3K5L A;  3T13 A;  1VCI A;  3GTG B;  4DV2 L;  5ELE A;  3F2D A;  2ICE C;  5C0X J;  2F0L A;  2E2H H;  3KF6 A;  3PUZ A;  3CMA A;  1LLR D;  2OEO A;  3NPP A;  4DR3 L;  5IOC A;  1IKM A;  3URY A;  2Z0S A;  1D5M C;  4BBS H;  4CKB A;  4MIU A;  1OXS C;  2YYZ A;  4X66 Q;  4K6L A;  3G4S A;  4QUC A;  1PYB A;  5C3E G;  1E2V A;  4A3B G;  2EY5 A;  1KNA A;  3T1H Q;  1U4L A;  4OWX B;  4ZAI A;  4CJ2 C;  1LUZ A;  2EJF C;  3H0G G;  1TWH H;  4OEL B;  2JA6 B;  1VQG A;  4F87 A;  4O2D A;  2VZA A;  4U67 3;  3CCE A;  4JV5 Q;  1ESF A;  4OO1 H;  1PZK D;  2N49 A;  3E5S A;  3QJY A;  1I6V C;  1VDZ A;  2EYL A;  4LK1 C;  4IFD H;  4I7Z C;  2PZU A;  2EJG C;  2KHI A;  3H3V C;  1GVP A;  5IGD A;  4R4T A;  1TXY A;  4RG1 A;  2G5D A;  4OWT B;  2DJF C;  5FO8 B;  4A76 A;  2E2H B;  2JEB I;  5IWA Q;  4EQ5 A;  1GM5 A;  1Y1W H;  2PQA B;  4DUZ L;  3IL8 A;  2WFW A;  1SLJ A;  3A8I E;  3GTQ H;  4RHS A;  4BBS B;  1PRT F;  3SGI A;  2K50 A;  5HGT A;  5IGE A;  3TP7 A;  4RCO A;  1FNU A;  4DV0 L;  2X6L A;  1Q1B A;  2KQ3 A;  3GO5 A;  4RWS C;  3RLO A;  4N9P A;  4MZ9 A;  1GOZ A;  1HFN A;  4HAE A;  2FXQ A;  1M90 C;  1TWH B;  2ZXO A;  2IX0 A;  3ND9 A;  1MD2 D;  1WD0 A;  3NXW A;  1PH9 A;  1PVO A;  1F2L A;  1I4P A;  1AE2 A;  5IGF A;  2K7V A;  2IPK D;  2EIF A;  1XMO L;  1CKN A;  1HH2 P;  1PRT D;  5E4X A;  1JC7 A;  5FLM H;  2JA5 G;  4DV6 L;  1G2S A;  1BCP D;  2CQA A;  2CFM A;  3STB C;  5JJZ A;  1WJJ A;  2XWB B;  4U68 A;  3DUZ A;  2JYO A;  1S4Z A;  4B3R Q;  3MXN B;  2MGS A;  4EQO A;  4UDU C;  1A8V A;  4A3C H;  1A62 A;  5CBA E;  1JMC A;  2WB1 E;  1Y1W B;  5JVG 3;  2ICI A;  2D2C C;  1H9S A;  2BDN A;  2LXK A;  5C4H A;  3OW7 A;  1O7Z A;  4LFC L;  3E0E A;  5CV6 A;  3PIP A;  1PZJ D;  3FVQ A;  1STE A;  4EGV A;  2BA0 A;  4ODG A;  2NUC A;  1STY A;  4P72 A;  3DWP A;  5FO7 B;  2ZJR A;  4RAU C;  1Q3L A;  2AQ2 B;  4C3I G;  4J8Q A;  4QIW E;  1K83 H;  2Y0S E;  1BVS A;  4RGT A;  2PNH A;  1ZEQ X;  4HCS A;  3TRE A;  1LT5 D;  5M5W H;  4Z9C B;  1NMF A;  3AB9 A;  4NDX A;  4IN3 A;  4LNQ A;  5FLX E;  3S2D H;  2EVB A;  2UUC Q;  3T16 A;  1KTK A;  1C8C A;  3OTO Q;  2FIN B;  4L5Q A;  4FP5 D;  3SDZ A;  5CV7 A;  3T51 B;  3GTO B;  5TSS A;  1SJH D;  4S3S A;  1AEX A;  4LF7 Q;  4JI3 Q;  1VQ9 A;  5ELN A;  5DLQ E;  1VQI A;  3PUX A;  1K73 C;  4QQB X;  2KHS A;  4NXN L;  2NYZ D;  1IBM Q;  3Q23 A;  2SDF A;  1WYD A;  4DV4 L;  1GHK A;  3P7J A;  4AYB E;  2F0U A;  4DGZ A;  2EPB A;  3CF5 A;  1ASY A;  3D4D A;  2B2W C;  5C4X H;  2JE6 I;  1D2B A;  1NAP A;  1RJT A;  4JI2 Q;  1HR0 Q;  1K83 B;  1AZQ A;  2J0T D;  4TRD A;  4A3I H;  3KLR A;  1PH2 A;  1EWI A;  5J3B A;  1BR9 A;  5BN3 A;  3VA7 A;  1FL0 A;  4KKU A;  1I94 L;  4WFN 3;  3E9H A;  3PGZ A;  2IY5 B;  2PMZ B;  5M5W B;  1XNR Q;  2F3W A;  4GOP A;  3BVG A;  4PMB A;  4JI8 Q;  3TME A;  4RGN A;  4DF7 A;  3CCJ A;  3S14 H;  1RTN A;  5C5L A;  5JJI A;  5C4Z A;  2RHQ B;  5C3E B;  1LAB A;  3DXJ C;  1SRU A;  1PA6 A;  3GTL H;  1YNN C;  2MPM A;  3OOC A;  1Z6H A;  3HOW G;  4GNX A;  4L8J A;  2B2V A;  1F2M A;  4B3M Q;  4Q5V A;  2XRQ D;  4LF4 Q;  4OWW B;  4HSV A;  5LHY 1;  1EIF A;  1EIH A;  3MHB A;  2L9H A;  3M85 A;  2UXD L;  1W6J A;  1B8A A;  1KL9 A;  1ZYR C;  5C6A A;  5C4J H;  1JWU D;  1I3Q H;  1H9K A;  3HKZ G;  2EJM A;  1D5X C;  2UUA Q;  4A3I B;  5M3F G;  1D8L A;  4OX9 L;  4B08 A;  3W1B A;  1X54 A;  3G7L A;  1E1T A;  3J7A 5;  2CWP A;  2F4V L;  4LW1 A;  2BE5 D;  4J6H A;  1WD1 A;  3I70 A;  2G9H D;  5JPN C;  1GUO A;  1ONL A;  1CSQ A;  4LWC A;  1AW7 A;  1F2Y A;  1FGU A;  4CJ0 B;  1A0I A;  2B2U C;  1LT6 D;  2NTS A;  5IYB G;  3S14 B;  1TVX A;  2NVQ H;  2D9U A;  4C3H H;  5KYI A;  1U0L A;  1FD7 D;  3L3O C;  2EZV A;  1HNW Q;  1VQB A;  3HOY G;  2HUG A;  2R93 G;  3TQY A;  3GTL B;  4A3K H;  1MIU A;  4YHH L;  4DR5 Q;  5KGU A;  3NQI A;  1WFQ A;  4C56 C;  4B3S Q;  2LMC B;  4OHJ A;  1SXT A;  2JSO A;  4DK0 A;  3JAM i;  3TP6 A;  1IHZ A;  4HID A;  3BDC A;  1TS2 A;  3WWV A;  4K14 A;  3L2P A;  3E6Z X;  3S1Q H;  3HOX H;  2OTJ A;  2K4K A;  1GXD C;  1HFG A;  2L1B A;  2F03 A;  3MVV A;  3I55 A;  2RQX A;  1BDO A;  4LF5 Q;  1X3E A;  1TWF H;  5COR A;  4GKJ L;  2A6E D;  2RKS A;  2F0H A;  4XIG S;  2HQL A;  5M3M H;  1L1O B;  1PRT B;  4BBR G;  2DY8 A;  1SYG A;  3HEJ A;  5C44 G;  5IYD G;  1B7Y B;  4DUY L;  3I4M H;  1BCP B;  3KK7 A;  4YCU A;  1PH4 A;  2B2T A;  1XMQ Q;  3J81 c;  1DYQ A;  3PV0 A;  2NVQ B;  4JI5 Q;  3OWF A;  3PMF A;  4C3H B;  4BXX G;  4QJF A;  1I4Q A;  1JWS D;  3NTK A;  4OL7 A;  4DV5 Q;  3CCS A;  1EFI D;  4OXP A;  4A3K B;  5DAU A;  4OIJ A;  4PZ6 A;  2KUM A;  3G71 A;  1X32 A;  5LMU L;  1SBB B;  2EYM A;  4HJ8 A;  4L5S A;  1TKW B;  3ERO A;  1O80 A;  3RZO H;  1V9P A;  5IWA L;  2G9D A;  4DR1 L;  1VQ6 A;  3S1Q B;  5JEA G;  3HOX B;  2E76 C;  1L1O C;  1KAB A;  4DAV A;  2J7Z A;  2QDB A;  1PRT C;  3SXH A;  2K5W A;  4F88 A;  1V1Q A;  5J22 A;  2F0D A;  1TWF B;  2XSC A;  2GVA A;  4HED A;  1WVL A;  3PIP 3;  1BCP C;  1Z7T A;  1ENC A;  1K0R A;  2F0I A;  4JBJ A;  1CKM A;  4YWM A;  2UXB L;  5FJ8 H;  3I4M B;  5JEA J;  4RH6 A;  4ZLT F;  1IYU A;  2NN6 I;  1B70 B;  3CCQ A;  3PQI A;  4DXF A;  1QZG A;  4I7A A;  2I46 A;  1MHW C;  3PUV A;  2DNC A;  1HNZ L;  1S72 A;  3S9W A;  3I3C A;  1PFS A;  2K14 A;  3CCV A;  1EY4 A;  1KAW A;  1BOS A;  3K7A H;  5IT9 c;  4FXK C;  2WKD A;  5AJ3 L;  4OON A;  3WOF A;  3J80 c;  3IFT A;  4JI1 Q;  2KVM A;  4UHV A;  5M5Y H;  1HZB A;  1KLG D;  1EOT A;  1EEF D;  3BZD B;  3CPF A;  1SNC A;  4XYO A;  5ELO A;  3I7F A;  3RZO B;  4LFB Q;  2EY2 A;  4BA1 I;  4G7O C;  3R8B A;  2E2J B;  3J7Y W;  2VUM H;  2OQK A;  3SK5 A;  1R9T H;  3MC0 B;  4YCW A;  3UDF A;  4GS3 A;  3V96 A;  4RA8 A;  2YU9 B;  2I07 B;  4NKL A;  1LAC A;  1L0Y B;  3OHX C;  4A3J G;  1CA5 A;  5E4W C;  1A6X A;  1FYC A;  4R4I A;  1G29 1;  5K36 G;  1RF2 D;  3KLS A;  4CHT B;  4HIM A;  3OMC A;  1EYG A;  1X55 A;  2KJX A;  5F2D A;  3NE5 B;  4YY3 Q;  5I6W A;  3K5M A;  3F2C A;  5D65 A;  4C1N K;  1Y1V G;  4H44 C;  1SE2 A;  2OXP A;  2A19 A;  3MFG A;  1ENF A;  2R6G A;  5IP9 H;  4QY7 A;  2UUC L;  3DM3 A;  4LUO A;  2I5M X;  1UEB A;  1PV4 A;  1ILQ A;  4JBM A;  3K7A B;  4ZCK A;  5I4D A;  2F0Q A;  1CK1 A;  3GTM H;  5J1Z A;  3I8Z A;  5DM7 3;  1SYE A;  3CHB D;  5M5Y B;  4JI3 L;  1WI5 A;  2AKW B;  1UNS A;  4MHE A;  4DV3 Q;  1IBM L;  1KRT A;  2E2D C;  4LUZ A;  4DR4 L;  1D1I A;  4TQU S;  4JOI A;  1U4R A;  4BXX H;  2VUM B;  2C9O A;  1R9T B;  4HJ5 A;  3I73 A;  3QG1 A;  3HOY B;  1EY6 A;  1LTS D;  5G3L D;  4GLX A;  1RCV D;  2B3G A;  2XWJ B;  4C3J H;  3D6C A;  1LM0 A;  1EQT A;  3HOV G;  2VXW A;  3M4O H;  3NP8 A;  3RLN A;  4GKK Q;  1AE3 A;  4JI2 L;  1HR0 L;  1O7L A;  2SOB A;  3U50 C;  4CBV A;  1P8L A;  1HHV A;  1QWY A;  1R4Q B;  3PO3 H;  2WB1 B;  2N8N A;  1LTB D;  1I5F A;  4NP5 A;  5LMN L;  1IBK Q;  4A93 H;  4DK6 C;  4LJZ C;  3TZD A;  1XNR L;  5IP7 G;  3FDT A;  2CHB D;  1EFW A;  5A2Q L;  1ASZ A;  4QIW B;  3A7L A;  1TY0 A;  2Y0S B;  2DGY A;  3RN5 A;  1K9M C;  2HDL A;  4KJO A;  1A3U A;  4GN4 B;  3G6J B;  3HFZ B;  3GTM B;  2R92 G;  1FJG Q;  3FP9 A;  2B63 H;  3OPO A;  2Z6B A;  3HGB A;  4K6D A;  4FO2 A;  1TS5 A;  1JCK B;  2BE5 C;  3GV3 A;  2VQF L;  3OYY A;  4FYD A;  1A63 A;  2PPB C;  2F0O A;  5JAV A;  3I2Z A;  1LT4 D;  2KCC A;  4XT3 B;  2HIX A;  1J8I A;  3MEH A;  1WCM G;  4C3J B;  3NSW A;  3CC2 A;  1SYF A;  3M4O B;  4I65 A;  3JAM L;  2LY7 A;  4GLV B;  4ME3 A;  4JI0 L;  2F0F A;  2PO4 A;  2UUA L;  1NJI C;  2D5D A;  3PO3 B;  3S1M H;  2VW9 A;  3UDX A;  2O5J C;  3EFX D;  1GUN A;  3HS0 C;  4AYB B;  5NUC A;  2Z4I A;  3U58 A;  4A93 B;  3PO2 H;  4DNR B;  4A3M G;  1G2T A;  1BBW A;  4BWG B;  3MEF A;  1AH9 A;  1QNU A;  4XDX A;  4CDE C;  5IGC A;  2JA6 H;  4UY8 C;  4MTN A;  1CKN B;  3TZU A;  4AH6 A;  4DK3 C;  1SFO B;  3VYR A;  1ZYR D;  5EKL A;  2A6E C;  3QO2 A;  2ZXR A;  4HMI A;  4DAM A;  4ILW A;  4UP9 A;  1UE5 A;  2B63 B;  1NMG A;  2B2Y A;  2J4X A;  1HNW L;  1EWC A;  2CH4 W;  4P71 A;  4DV7 Q;  2AHO B;  4RKB A;  4DU9 A;  4PNY A;  3LX0 A;  4DR5 L;  4B3S L;  3NBH B;  3K0X A;  5LL6 S;  1HNX Q;  1H9S B;  2YV5 A;  3SHL A;  3I56 A;  4N8F A;  1B50 A;  4DKA C;  5GAD C;  5KIX A;  1YZ6 A;  3I4L A;  4R4C A;  5E1F A;  1GO3 E;  1S5F D;  4JG2 A;  1P16 A;  1JOR A;  3LWU A;  3S1M B;  2K52 A;  4IJL A;  3OMG A;  1JWM D;  2XN9 C;  3CP0 A;  5I2Y A;  3PO2 B;  2MO1 A;  3GQB A;  4YWL A;  1F9R A;  4X3U A;  3ERS X;  4PV1 C;  2A74 C;  3IFD A;  1SYC A;  1E2W A;  1N33 Q;  1XMQ L;  3W3A A;  4JBW A;  2ZJP A;  4JI5 L;  3J81 i;  1IXR A;  1PYS B;  1TWG H;  4LF8 L;  2B8G A;  1B53 A;  1GUS A;  1TU2 B;  1STB A;  2F3V A;  2SNS A;  3MTS A;  1IL2 A;  2OF1 A;  2R61 A;  4XT1 B;  2M2L A;  1QE6 A;  1B44 D;  1EEI D;  1S3O A;  3HOZ H;  3E3X A;  1S5D D;  4MTK A;  4FF3 A;  1PMR A;  3B6Y A;  5ELF A;  1X3Q A;  3KUP A;  2EOT A;  2X69 A;  3IKJ A;  4MN3 A;  4ZRZ A;  3T4A C;  1KC8 C;  3QB3 A;  1K8O A;  1SNO A;  3H3V I;  1HJP A;  3NWS A;  3HKZ E;  1UE1 A;  1MI2 A;  5CV4 A;  3CW2 C;  1NBW A;  4KHV A;  1TWA H;  2ZXP A;  1VQ7 A;  2A1A A;  5DNF A;  1BCP F;  3T56 B;  2OWO A;  3I4N H;  1MKH A;  4IUU A;  4K8J A;  4CKC A; 
#chains in the Genus database with same CATH homology
 5EQ0 A;  3X3M A;  3VR2 A;  3HOV B;  1TWG B;  2PYK A;  2WV6 D;  5KNB A;  1HPC A;  1Q8I A;  3HOZ B;  4RCN A;  1E0B A;  3GV6 A;  4DA2 A;  2WIN B;  1IW7 D;  1V1P A;  3FRP B;  2SNM A;  5C0X H;  4ID6 A;  4FXG C;  1PFN A;  5EPK A;  1EQV A;  1M8A A;  3KF8 A;  1SDF A;  1TWA B;  3I4N B;  1C48 A;  3QOJ A;  5I9P A;  5CV9 A;  1CHP D;  2NN6 G;  5EGT A;  1WCM B;  4KI0 A;  1UUP A;  4K2L A;  4BY7 B;  4L63 B;  3S1N B;  3A8K E;  2B2V C;  1DM0 B;  1DJR D;  4A3F B;  4OO1 I;  1LTI D;  4YIJ A;  3FEW X;  1DOK A;  3I91 A;  1WTV A;  2FJ2 A;  3VR3 A;  4IFD I;  1PTO F;  5JOB A;  3HP3 A;  1U9R A;  1XX8 A;  3D31 A;  5KYL A;  1JOK A;  5J39 A;  1RKN A;  2A5H A;  2F0V A;  3A55 A;  2MHV A;  3D3R A;  3K0Y A;  1DCZ A;  4LAA A;  4P2C B;  1CQV A;  5D3D A;  3CRL C;  1PTO D;  3QOL A;  3K59 A;  1CI3 M;  5C3X A;  4X3T A;  4CJ1 B;  4ZYS A;  3R2T A;  3QWN A;  2L12 A;  2QIL A;  2EDG A;  4KN7 C;  2MP1 A;  3N6R A;  2XRS D;  4A3B B;  3C1E A;  1LV9 A;  5EBD A;  1EWH A;  2PW7 A;  3TP8 A;  3H0G B;  2EYJ A;  3AMU A;  5JVH 3;  5EJW A;  5EBC A;  1CFM A;  2V4D A;  2L5T A;  1KDC A;  5CR3 A;  1WTX A;  1OXV A;  1OXX K;  5C0X I;  4X3S A;  3MXU A;  3SE0 A;  1YNJ D;  2EY6 A;  4HN7 A;  3C1F A;  4TSS A;  3VA5 A;  3NK9 A;  5KRU A;  3BVM A;  1CT1 D;  1B1Z A;  4G7H C;  3K58 A;  4ULL A;  4K5V A;  2RDG A;  3IAY A;  1C4Q A;  2M00 A;  3D4R A;  1ET6 A;  1PYW D;  4Y7N B;  1DOM A;  3R3O A;  3R93 A;  1IL8 A;  1BO0 A;  2B2W A;  1F77 A;  3J81 L;  2K05 A;  3S2H B;  3M3Y B;  5C5M A;  2OT2 A;  2LKV A;  2PQE A;  4RKL A;  1FGB D;  2K03 A;  2JA5 B;  3W2D A;  5C3W A;  2K33 A;  5K5P A;  2RBM A;  3VR5 A;  4KTA A;  3A56 A;  1LTT D;  1WTR A;  4B9W A;  3NBI A;  1WTW A;  2KED A;  4CKE A;  1ZKO A;  1L0X B;  2O2L D;  4DK1 A;  3J7A V;  1G6Z A;  4B9X A;  3MWY W;  4KK7 A;  1TT2 A;  4C3I B;  1CA6 A;  2Z8L A;  3M4Y A;  1VMP A;  1E2Z A;  2K04 A;  2AUK A;  2F4I A;  2XIW A;  3BVZ A;  4FXD A;  2EYP A;  1PXU A;  2A68 C;  1BBX C;  4ZQ3 A;  1J9O A;  1PTO H;  1NR2 A;  2AQ3 B;  3Q22 A;  3DWA A;  2C5C A;  1A3T A;  5IT9 L;  4FNF A;  4R8I A;  3J80 L;  2VB2 X;  3VYT A;  4KY6 A;  4HMJ A;  2AWN A;  2D62 A;  1MGS A;  1UAP A;  1GJX A;  1K8M A;  1FNV A;  3GP7 A;  4O42 A;  1DON A;  2H1E A;  1JE4 A;  1SSO A;  1IW7 C;  1JIC A;  3DMU A;  2WAC A;  2XVS A;  1CZW A;  4V0B A;  3OIP A;  3GTJ B;  2X6G A;  4RGM A;  3MXP A;  3ERQ A;  2NTT A;  2K5D A;  1I50 B;  2IW3 A;  2MJ8 A;  2K1B A;  2K32 A;  1F9Q A;  4Q0F A;  3PIO 3;  4V19 0;  5IGB A;  3TBI B;  1PTO B;  1PDQ A;  1EY5 A;  5ISR A;  3DWQ A;  3H94 A;  5COY A;  5D14 A;  2B39 A;  5ELB A;  4IZ8 A;  1RDP D;  3HOW B;  3DEO A;  5EKK A;  2F0K A;  3BDL A;  4PMC A;  1OO9 B;  2EYO A;  4ZKC B;  1IKL A;  3NTH A;  1TII D;  5FOB B;  4HSP A;  2FFK B;  1O7Y A;  5CBE E;  1II3 A;  3HKZ B;  1M4V A;  1EYA A;  5M3F B;  4QUF A;  4BY1 B;  5G3L F;  2F0S A;  4C1N I;  4F8M A;  4K5W A;  1S5B D;  1PTO C;  1Y69 U;  5BN5 A;  4IUQ A;  1QOH A;  3EVQ A;  1Q90 A;  4KMU C;  2FHT A;  3EA6 A;  4XQJ A;  5ELC A;  5I9O A;  4IAL A;  2FMM A;  2R93 B;  5I6Y A;  2E74 C;  1SNP A;  3WDN A;  3DEP A;  1ET9 A;  1XTC D;  1OXU A;  5CYU A;  1VMC A;  1B9N A;  4TKO B;  1EYC A;  4KN4 C;  5JEA H;  5KND A;  2B2Y C;  4H0L C;  4H13 C;  1CQF A;  1F9S A;  1JR0 D;  5CGK A;  3O13 A;  4OO1 G;  1RHP A;  1YNJ C;  3K6O A;  2Q8T A;  4BBR B;  1CTM A;  5C44 B;  2BCO A;  1D1K A;  4IFD G;  2KA7 A;  2RSN A;  3KBG A;  2KEE A;  1A15 A;  5CV5 A;  1GUT A;  2F0N A;  2RDF A;  1HQR D;  3Q0A A;  2IL8 A;  3DHQ A;  4XXE A;  4QF4 A;  4KKT A;  4IUN A;  1ESR A;  5JPM C;  3BDO A;  2KCN A;  4DAY A;  4IUV A;  2E2I B;  4BS9 A;  4G57 A;  3HZX A;  1AFP A;  3VR6 A;  1G8Z D;  2JEA I;  1LO5 D;  2QCP X;  1NR4 A;  3MA2 B;  5LL6 X;  1RTO A;  3UI2 A;  1S5C D;  1BXT A;  2XNA C;  4XTC S;  3VYU A;  3NQT A;  5K36 H;  4ZKB B;  3K5N A;  2KOL A;  3H91 A;  1F9P A;  5CV8 A;  3VYS A;  2BA1 A;  5A35 A;  1U4P A;  1V1P B;  3NUC A;  2HCI A;  2F0W A;  2VB3 X;  4KD3 A;  1KNE A;  1X3P A;  5DEH A;  1TS4 A;  3I90 A;  2ID0 A;  2L55 A;  1TR5 A;  1STA A;  2QKI C;  3ND8 A;  1DD2 A;  1WTO A;  2Q8I B;  3J7A F;  1STG A;  2PNR C;  3GTP B;  5KNC A;  2QF7 A;  4NMZ A;  1S5E D;  5FK9 C;  4FF4 A;  3ZYY X;  1DZ1 A;  5IIF A;  3CQZ B;  1W6K A;  4J1M A;  4EVO A;  2BOS A;  1ILP A;  1I4R A;  4A3J B;  1Y8P B;  2PCF B;  1NCV A;  4N9T A;  5FLX L;  4ZUI A;  1JB3 A;  3V2T A;  3HRZ C;  4RGO S;  4UAI A;  1EL0 A;  3S17 B;  3R2I A;  1SE3 A;  1HQM C;  1SYB A;  5A2Q E;  1Y1V B;  1DXM A;  1HCZ A;  2RVL A;  5CC4 A;  4K8I A;  1T5X D;  1HRJ A;  1T5E A;  1B9M A;  1QCB D;  2Z1C A;  4OIK A;  4PQX A;  3I72 A;  4ZK9 B;  4CGY B;  2NWG A;  4M8A A;  4DN4 M;  1G91 A;  2ZT9 C;  1DOL A;  1I4G A;  4EQN A;  2DN8 A;  3A7A B;  1HA5 A;  3CRK C;  3D8G A;  3JAM E;  2A68 D;  3C2P A;  2IT1 A;  4F7X A;  2AQ1 B;  4KD4 A;  1U4M A;  3NHH A;  1PFB A;  3C3L A;  3K5O A;  1STN A;  1V1O A;  4K2K A;  3D6W A;  1LTR D;  1SE4 A;  4ABN A;  4M1U B;  1GHJ A;  4WOR A;  4K5X A;  2WII B;  1I4H A;  1QJO A;  3HG9 A;  2B8F A;  4C2M B;  3X3N A;  1SAP A;  2R92 B;  1HA6 A;  5EKI A;  1XWE A;  3MXG A;  3A8J E;  5DM6 3;  2A69 D;  1NUC A;  3LWE A;  3NBH A;  5EPL A;  4XQQ A;  2VNU D;  1HUN A;  3RD4 A;  1FR3 A;  2F0T A;  2Z4H A;  3AU7 A;  3GTQ B;  3OSO A;  1B2T A;  4KJN A;  4OGQ C;  3F2U A;  4C3H G;  1BQQ T;  4XYQ A;  1EYD A;  2L0C A;  3FMC A;  4HCE A;  2EYF A;  4A3M B;  1A2U A;  1LTA D;  5IOD A;  4G7Z C;  5I2X A;  3H6M A;  3CKI B;  3K57 A;  4H7B A;  3SEB A;  2N88 A;  2JXM B;  2DY7 A;  2JP1 A;  3DM1 A;  3Q24 A;  1EZ8 A;  2HQE A;  2LS0 1;  2K6A A;  3RZD B;  2Q8R E;  1TS3 A;  1EY9 A;  3GTK B;  1ICW A;  1HUM A;  1JQY D;  2K5Q A;  3S16 B;  3M7N A;  1NSN S;  1ML0 D;  1D5Z C;  1QB5 D;  4R8N A;  2AUJ D;  1KLU D;  3ITP A;  4JK1 C;  2NVX B;  5AFW A;  1I6H B;  1VF7 A;  1AN8 A;  1GUW A;  2LFN A;  1EU3 A;  1STH A;  3S2D B;  1D6E C;  4FVM A;  4KY7 A;  4FF2 A;  4QMG A;  1AZP A;  2H4O A;  1ENA A;  1CM9 A;  1A3V A;  2B2T C;  1SNQ A;  3BS1 A;  3PUW A;  3C46 A;  3D4W A;  2SEB D;  2HDM A;  3MXN A;  5C4X B;  3EQL C;  1EZ6 A;  4L6T B;  5ELD A;  4KY5 A;  1LT3 D;  3SK4 A;  4BA2 I;  2F0E A;  3TSS A;  1F2Z A;  1EU4 A;  2CW0 D;  1KDA A;  2NN6 H;  3N52 A;  4HR7 B;  3H09 A;  3M7G A;  1PLF A;  3TP5 A;  2NVT B;  4GZY C;  1B4O A;  2RA4 A;  4A3E B;  1BNZ A;  1V8Q A;  5E3F A;  3U9S A;  3MZ5 A;  3RLF A;  3MFY A;  1EY8 A;  2F0M A;  1HXY D;  1Z47 A;  2MUY A;  3OWE B;  3T53 B;  2NB0 A;  2TMP A;  4QB4 A;  1ZXT A;  5KEE A;  5C4J B;  1I3Q B;  1GUG A;  3E0J A;  2FMC A;  1PFM A;  3GD7 A;  1AP0 A;  2IJ0 A;  2L11 A;  4IQZ A;  3NTI A;  1SMY D;  1PZI D;  2A6H D;  1MSH A;  1BUV T;  2GA4 B;  1R4P B;  3EJI A;  2K01 A;  4A3D B;  4RFB A;  2BDO A;  4LMQ D;  1TY2 A;  1WTP A;  3KLS X;  1H9R A;  4C3J G;  2HCC A;  4DFA A;  2EY1 A;  4DXG A;  2WP8 J;  3BG3 A;  2B2U A;  5IGG A;  4A3G B;  1Q1E A;  3S15 B;  5M9O A;  4DNT B;  2WAQ B;  3OIQ A;  3BYT B;  1BF4 A;  4WJW A;  2PZW A;  3RUZ A;  3KBX A;  4KV6 A;  1H9J A;  2WKC A;  5M3M B;  3HOU B;  3RMH A;  1UEA B;  2A69 C;  3P20 A;  5D3I B;  2O5I C;  3SK8 A;  3TDQ A;  3LNN A;  1WTQ A;  1JOO A;  4G4K A;  3J81 E;  2NZ1 D;  3VR4 A;  2A73 B;  2QEJ C;  4E6I A;  1RD9 D;  1VF5 C;  3A54 A;  2PZT A;  4IUT A;  2EXZ A;  1JOQ A;  3FKI B;  5FKA C;  1Y8O B;  2F0G A;  3WOE A;  4IUP A;  1IYV A;  3MAQ A;  3FPP A;  2AWO A;  4PMW A;  3SR1 A;  2DNE A;  3L7Z C;  3PUY A;  3SK6 A;  2KEC A;  2M9V A;  3U9O A;  3QIA A;  4KHZ A;  4QCL A;  4WRD A;  1FNW A;  5CMD A;  1SJE D;  2F0J A;  4FF1 A;  1ROD A;  3V05 A;  1EY7 A;  1TWC B;  2RDH A;  3P1H A;  1OXT A;  2F0P A;  3L9A X;  2IWH A;  1O78 A;  4R9W A;  1TQO A;  2EYH A;  5IT9 E;  1Y8N B;  2N55 A;  2NVY B;  3J80 E;  3S1R B;  4HTH A;  2L4N A;  4ZUJ A;  5EPJ A;  3BYY B;  3SVM A;  2E75 C;  1XYI A;  3NWT A;  4ME5 A;  5FO9 B;  2R3Z A;  4EQP A;  1A2T A;  1Q12 A;  1SYD A;  1CZG A;  4X3K A;  5T1G A;  1I4X A;  2IX3 A;  1B3A A;  4XQN A;  2RSO A;  1SEB D;  2R7Z B;  4NW2 A;  1EY0 A;  4IFD J;  2K28 A;  1QNK A;  1LTG D;  3TN2 A;  1SNM A;  1KAA A;  1CHQ D;  2CW0 C;  2ENB A;  4KKS A;  5HUR A;  1SND A;  3Q6S A;  1XXG A;  5T1I A;  4O1N A;  1MSG A;  2NBF A;  1QIL A;  1QG7 A;  1HTP A;  2EE1 A;  1KDB A;  2F1M A;  3FPU B;  1HTL D;  1V43 A;  2CVR A;  1YNN D;  2JA7 B;  3CU7 A;  2PW5 A;  2TSS A;  4DAP A;  5BN4 A;  5C0X G;  2O4X A;  4IUR A;  2JA8 B;  1EIG A;  3P75 A;  1SMY C;  2IX1 A;  1MBY A;  2A6H C;  5M5X B;  1H9M A;  3ONA B;  4RHR A;  3K5L A;  3T13 A;  1VCI A;  3GTG B;  5ELE A;  2ICE C;  5C0X J;  2F0L A;  3PUZ A;  1LLR D;  2OEO A;  3NPP A;  5IOC A;  1IKM A;  3URY A;  1D5M C;  4CKB A;  4MIU A;  1OXS C;  2YYZ A;  4K6L A;  4QUC A;  1E2V A;  2EY5 A;  1KNA A;  1U4L A;  4CJ2 C;  4ZAI A;  2EJF C;  2JA6 B;  4F87 A;  4U67 3;  1ESF A;  4OO1 H;  1PZK D;  3E5S A;  3QJY A;  1I6V C;  1VDZ A;  2EYL A;  4LK1 C;  4IFD H;  4I7Z C;  2PZU A;  2EJG C;  3H3V C;  5IGD A;  5FO8 B;  2E2H B;  2JEB I;  3IL8 A;  3A8I E;  4RHS A;  4BBS B;  1PRT F;  5IGE A;  5HGT A;  3TP7 A;  4RCO A;  1FNU A;  2X6L A;  1Q1B A;  2KQ3 A;  3GO5 A;  4RWS C;  4N9P A;  1GOZ A;  1HFN A;  4HAE A;  1TWH B;  2ZXO A;  2IX0 A;  3ND9 A;  1MD2 D;  1WD0 A;  3NXW A;  1F2L A;  1I4P A;  5IGF A;  2K7V A;  2IPK D;  1PRT D;  5E4X A;  1JC7 A;  1G2S A;  1BCP D;  2CQA A;  5JJZ A;  2XWB B;  4U68 A;  3DUZ A;  2JYO A;  1S4Z A;  2MGS A;  4EQO A;  4UDU C;  5CBA E;  1Y1W B;  5JVG 3;  2ICI A;  2D2C C;  1H9S A;  2BDN A;  5C4H A;  3OW7 A;  1O7Z A;  5CV6 A;  1PZJ D;  3FVQ A;  1STE A;  4EGV A;  2BA0 A;  4ODG A;  2NUC A;  1STY A;  3DWP A;  5FO7 B;  4RAU C;  1Q3L A;  2AQ2 B;  4C3I G;  4J8Q A;  4RGT A;  1ZEQ X;  4HCS A;  1LT5 D;  4Z9C B;  3AB9 A;  4NDX A;  4IN3 A;  5FLX E;  2EVB A;  3T16 A;  1KTK A;  1C8C A;  2FIN B;  3SDZ A;  4FP5 D;  5CV7 A;  3T51 B;  3GTO B;  5TSS A;  1SJH D;  4S3S A;  1AEX A;  3PUX A;  2KHS A;  2NYZ D;  3Q23 A;  2SDF A;  1GHK A;  3P7J A;  2F0U A;  4DGZ A;  2EPB A;  3D4D A;  2B2W C;  2JE6 I;  1D2B A;  1NAP A;  1RJT A;  1K83 B;  1AZQ A;  2J0T D;  4TRD A;  3KLR A;  1BR9 A;  5BN3 A;  3VA7 A;  4KKU A;  4WFN 3;  2PMZ B;  5M5W B;  2F3W A;  3BVG A;  4PMB A;  3TME A;  4RGN A;  4DF7 A;  1RTN A;  5C5L A;  5C4Z A;  5C3E B;  1LAB A;  3DXJ C;  1YNN C;  2MPM A;  3OOC A;  1Z6H A;  4L8J A;  2B2V A;  1F2M A;  4Q5V A;  2XRQ D;  4HSV A;  5LHY 1;  1EIH A;  3MHB A;  2L9H A;  3M85 A;  1W6J A;  1ZYR C;  5C6A A;  1JWU D;  1H9K A;  2EJM A;  1D5X C;  4A3I B;  4B08 A;  3G7L A;  2BE5 D;  4J6H A;  1WD1 A;  3I70 A;  2G9H D;  5JPN C;  1GUO A;  1ONL A;  1AW7 A;  1F2Y A;  4CJ0 B;  2B2U C;  1LT6 D;  2NTS A;  3S14 B;  1TVX A;  2D9U A;  5KYI A;  1FD7 D;  3L3O C;  2EZV A;  2HUG A;  3GTL B;  5KGU A;  3NQI A;  4C56 C;  2LMC B;  4OHJ A;  1SXT A;  2JSO A;  4DK0 A;  3TP6 A;  1IHZ A;  3BDC A;  1TS2 A;  4K14 A;  3E6Z X;  1GXD C;  1HFG A;  2L1B A;  2F03 A;  3MVV A;  2RQX A;  1BDO A;  5COR A;  2A6E D;  2RKS A;  2F0H A;  4XIG S;  1PRT B;  2DY8 A;  1SYG A;  3HEJ A;  1BCP B;  3KK7 A;  2B2T A;  1DYQ A;  3PV0 A;  2NVQ B;  3OWF A;  3PMF A;  4C3H B;  1I4Q A;  1JWS D;  3NTK A;  4OL7 A;  1EFI D;  4A3K B;  5DAU A;  4OIJ A;  2KUM A;  1X32 A;  1SBB B;  2EYM A;  1TKW B;  3ERO A;  1O80 A;  2G9D A;  3S1Q B;  5JEA G;  3HOX B;  2E76 C;  1KAB A;  4DAV A;  2J7Z A;  2QDB A;  1PRT C;  3SXH A;  2K5W A;  4F88 A;  5J22 A;  2F0D A;  1TWF B;  2XSC A;  4HED A;  1WVL A;  3PIP 3;  1BCP C;  1Z7T A;  1ENC A;  2F0I A;  3I4M B;  5JEA J;  4RH6 A;  4ZLT F;  1IYU A;  2NN6 I;  4DXF A;  2I46 A;  3PUV A;  2DNC A;  3S9W A;  3I3C A;  1EY4 A;  1BOS A;  4FXK C;  2WKD A;  3WOF A;  3IFT A;  2KVM A;  1KLG D;  1EOT A;  1EEF D;  3BZD B;  4XYO A;  1SNC A;  3RZO B;  2EY2 A;  4BA1 I;  4G7O C;  3R8B A;  2E2J B;  3J7Y W;  3SK5 A;  3MC0 B;  3V96 A;  4RA8 A;  2YU9 B;  2I07 B;  4NKL A;  1LAC A;  1L0Y B;  3OHX C;  1CA5 A;  5E4W C;  1A6X A;  1FYC A;  1G29 1;  5K36 G;  1RF2 D;  3KLS A;  4CHT B;  3OMC A;  2KJX A;  5F2D A;  3NE5 B;  5I6W A;  3K5M A;  5D65 A;  4C1N K;  4H44 C;  1SE2 A;  2OXP A;  3MFG A;  1ENF A;  2R6G A;  1ILQ A;  3K7A B;  5I4D A;  2F0Q A;  1CK1 A;  5J1Z A;  3I8Z A;  5DM7 3;  1SYE A;  3CHB D;  5M5Y B;  1UNS A;  4MHE A;  2E2D C;  1D1I A;  4TQU S;  1U4R A;  2VUM B;  2C9O A;  1R9T B;  3I73 A;  3QG1 A;  3HOY B;  1EY6 A;  1LTS D;  5G3L D;  1RCV D;  2XWJ B;  3D6C A;  1EQT A;  2VXW A;  3NP8 A;  1O7L A;  2SOB A;  4CBV A;  1HHV A;  1QWY A;  1R4Q B;  2WB1 B;  1LTB D;  4NP5 A;  4LJZ C;  3TZD A;  3FDT A;  2CHB D;  5A2Q L;  4QIW B;  3A7L A;  1TY0 A;  2Y0S B;  2HDL A;  4KJO A;  1A3U A;  3G6J B;  3GTM B;  3OPO A;  3HGB A;  4K6D A;  4FO2 A;  1TS5 A;  1JCK B;  2BE5 C;  3GV3 A;  4FYD A;  2PPB C;  2F0O A;  5JAV A;  1LT4 D;  2KCC A;  4XT3 B;  1J8I A;  3MEH A;  4C3J B;  3NSW A;  1SYF A;  3M4O B;  4I65 A;  3JAM L;  2LY7 A;  2F0F A;  2PO4 A;  2D5D A;  3PO3 B;  2O5J C;  3EFX D;  1GUN A;  3HS0 C;  4AYB B;  5NUC A;  2Z4I A;  4A93 B;  4DNR B;  1G2T A;  4BWG B;  1QNU A;  4XDX A;  5IGC A;  3TZU A;  1SFO B;  3VYR A;  1ZYR D;  5EKL A;  2A6E C;  3QO2 A;  2ZXR A;  4HMI A;  4ILW A;  2B63 B;  2B2Y A;  2J4X A;  1EWC A;  4RKB A;  4DU9 A;  4PNY A;  3LX0 A;  5LL6 S;  1H9S B;  3SHL A;  1B50 A;  5KIX A;  3I4L A;  5E1F A;  1S5F D;  1JOR A;  3LWU A;  3S1M B;  3OMG A;  1JWM D;  2XN9 C;  5I2Y A;  3PO2 B;  3GQB A;  1F9R A;  4X3U A;  4PV1 C;  2A74 C;  3IFD A;  1SYC A;  1E2W A;  3W3A A;  4JBW A;  2B8G A;  1B53 A;  1GUS A;  1TU2 B;  1STB A;  2F3V A;  2SNS A;  3MTS A;  2OF1 A;  2R61 A;  4XT1 B;  2M2L A;  1QE6 A;  1B44 D;  1EEI D;  1S5D D;  4FF3 A;  1PMR A;  5ELF A;  1X3Q A;  3KUP A;  2EOT A;  2X69 A;  3IKJ A;  4MN3 A;  4ZRZ A;  3T4A C;  3QB3 A;  1K8O A;  1SNO A;  3NWS A;  1MI2 A;  5CV4 A;  4KHV A;  2ZXP A;  5DNF A;  3T56 B;  1BCP F;  4IUU A;  4K8J A;  4CKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...