3SK8A

Crystal structure of staphylococcal nuclease variant delta+phs m98g apo protein at cryogenic temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKGVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS M98G apo protein at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 38
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk8A00
2ENBA 2F0NA 3OSOA 2F0UA 1EZ6A 3QOLA 4K2LA 1A3TA 2EYFA 4ID6A 5NUCA 3TP8A 2F3WA 5C4HA 4EQNA 3OWFA 4J1MA 4K5VA 5IIFA 2EY1A 2EYPA 3C1FA 1JOKA 3NK9A 4MIUA 5I9PA 3PMFA 1SNMA 2WACA 5JOBA 3SK4A 4HTHA 5CC4A 5IGGA 3NQTA 2M00A 4TRDA 5J1ZA 1ENCA 5CR3A 1TQOA 4B9XA 3EJIA 4J6HA 5CV9A 3QOJA 1SYEA 4I65A 1SYFA 1EY9A 3T16A 1STYA 3TP5A 5J22A 1SNPA 2F0JA 2PYKA 1IHZA 2F0EA 1STBA 5IODA 1ENAA 4K6DA 5CV5A 1SYBA 3MXPA 5KYIA 3DHQA 1JOQA 5F2DA 4EQPA 3D8GA 4YIJA 3EVQA 5KGUA 4PNYA 4ZQ3A 4IUNA 2EYJA 4KTAA 3MEHA 5CV4A 4ME5A 5HGTA 1STNA 3BDCA 3P1HA 4RKLA 4EVOA 1A2TA 2F0FA 2HQEA 1TT2A 5IOCA 4PMBA 1SNDA 5HURA 5CGKA 5J39A 1SNQA 1KABA 4WORA 3BDLA 5C6AA 2F0WA 3ERQA 2NUCA 2PZUA 2RKSA 4NKLA 1KAAA 4KV6A 4S3SA 2PZWA 2F0GA 1F2MA 3D4DA 3OMGA 4KY6A 4ODGA 4ZUJA 2QDBA 1RKNA 4LAAA 4E6IA 4QF4A 3VA5A 5I9OA 5KRUA 5DAUA 3TMEA 2F0OA 1SYDA 3U9OA 2PZTA 5IGCA 2OXPA 4K2KA 1NSNS 2EYLA 3SR1A 5KYLA 1F2ZA 3ITPA 4F8MA 4H7BA 4K5XA 2F0TA 1KDBA 5CV8A 1KDCA 5JAVA 4QB4A 3NP8A 5C3WA 3S9WA 2EY2A 5C4ZA 2F3VA 4KJOA 2OEOA 5C5MA 2SNMA 3SK8A 3D4WA 3TP6A 3H6MA 2EYMA 5KIXA 1EYAA 5M9OA 4K8JA 3EROA 2F0VA 4G57A 2OF1A 4R8NA 4ZUIA 3TP7A 1JOOA 2F0KA 3SHLA 4HMIA 5CV7A 1EYDA 1EQVA 2PW5A 4N9TA 3NHHA 4NDXA 3OMCA 4OL7A 4IZ8A 1AEXA 1JORA 2RDFA 1EY5A 2SOBA 4WRDA 1STHA 1SYCA 5I6WA 1EZ8A 2F0HA 5CV6A 1KDAA 1EY8A 1SNOA 3HEJA 1EY6A 2PQEA 1A3UA 4K5WA 5IGFA 1II3A 1EY7A 4KY5A 5IGEA 2KQ3A 2EY6A 1EY0A 2PW7A 3HZXA 4B9WA 3LX0A 1EY4A 4F7XA 1SNCA 5C3XA 1STGA 1TR5A 2F0QA 3DMUA 3P75A 4KD4A 3SK6A 4K8IA 4PMCA 4RKBA 2O4XA 2F0MA 4DFAA 1NUCA 3NXWA 4NMZA 5ISRA 2EYHA 4DF7A 2EY5A 3MVVA 2F0LA 3NUCA 2EXZA 3MZ5A 5E1FA 4NP5A 5I6YA 5DEHA 3D6CA 4IALA 3E5SA 3RUZA 4KHVA 1STAA 5EGTA 3SXHA 1U9RA 5EKLA 1A3VA 2F0DA 4KY7A 4HMJA 1A2UA 4QMGA 4KJNA 2RBMA 5C5LA 3SK5A 2SNSA 4EQOA 5E3FA 5EKKA 5IGDA 5K5PA 4DGZA 2F0SA 5KEEA 3QB3A 4N9PA 2KHSA 3C1EA 1F2YA 5IGBA 4DU9A 4K14A 1EYCA 2LKVA 4KD3A 2F0PA 3V2TA 2EYOA 3R3OA 1SYGA 3T13A 3MHBA 2F0IA
chains in the Genus database with same CATH superfamily
2VW9A 5JVH3 1DXMA 4EQNA 5IP9H 2CCZA 3NK9A 3PMFA 2WACA 5DLQE 2Z6KC 2IT1A 3M9BA 3SK4A 2ZT9C 5IT9c 2EOTA 5CC4A 2A73B 5ELOA 5FO8B 1QJOA 2M00A 5IT9E 4PZ6A 5EAYA 3FMCA 5M5WB 1HNWQ 2R92H 1WTHA 3QO2A 1U4LA 3G6EA 3PV0A 1B3AA 4IUTA 4I65A 5J22A 5JPNC 5IYCG 3I4NG 3RMHA 2GN5A 2K5VA 1IBLL 2JA7B 3PO3B 1UE7A 1TWCH 2NN6I 3PF5A 3E9IA 4A3GB 1RODA 2UUBL 1LTRD 4FXGC 1VQDA 2BA0A 4BBSG 3P1HA 2E2JH 4ZKCB 1O7LA 3E0EA 1JWSD 3ERQA 1BXTA 1VQ9A 1CQFA 3A5ZB 2L15A 2P5ZX 1CZGA 3T1HL 2OXPA 1F2ZA 2BH8A 3FPUB 3UDIA 4WFN3 3S16H 2EY2A 4R4QA 3TZDA 2K52A 4ZKBB 2WAQB 1LT6D 2UXDL 1HZAA 2UUAQ 4A3LH 3H09A 2A68C 2F0VA 3MTSA 4J15A 4BY7H 1JORA 2Z4HA 2Z1CA 1G6ZA 3H94A 2B2WC 4DR2L 4GLXA 1EY8A 1SLJA 4P72A 4RH6A 4K5WA 1X6OA 1XTCD 3V05A 4KY5A 4LFCQ 3OHXC 4OO1H 4YCWA 2CH4A 1JC7A 1XYIA 2EZVA 1VQAA 3GTPH 1LTAD 1RL2A 4A3EB 2BE5D 3Q23A 4NXNL 4TKOB 2WINB 1Y8OB 5D3DA 2EPBA 1XMQQ 2CH4W 4DK1A 1SN8A 1O7ZA 4DGZA 3QB3A 4N9PA 1KNAA 5FLMG 1X56A 3C1EA 4DA2A 1LT5D 2QDLA 2BA1A 3CPFA 1TWCB 3R3OA 2F0IA 1BCPB 1A3TA 4ID6A 4A3BG 2F3WA 3HOXB 2IHEA 1F9PA 2WB1E 1WTXA 3RLNA 4CDFC 2NTTA 4DV0Q 4LUZA 4RFBA 3DWPA 1Q1EA 3DEOA 3CCJA 4CHTB 4TRDA 1N34Q 3FPPA 3TZUA 4A3FH 4J6HA 5FOBB 4HR7B 3I2ZA 1S3OA 3G48A 4HIMA 1BKBA 3S16B 1ICWA 1GO3E 1PLFA 2C35B 3CCUA 2VS1A 3H91A 3M4YA 4CJ0B 3A8JE 3T51B 5IOCA 3BDOA 2QILA 3GDEA 5C6AA 1OXSC 2KCCA 1KAAA 2MPMA 2EE1A 4MNOA 1KD1C 4AYBG 4DKAC 1KRTA 2VQFL 4K2KA 1HRJA 2XRSD 3KDFA 2B2TC 1CUKA 3GQBA 1V1PB 3VR4A 1BCPC 5CV8A 4X64L 1W2BA 3GTPB 4K0KQ 2UXBL 4FF4A 2XWJB 1BQQT 4DR5Q 4YHHL 3TP6A 1EYAA 1GKHA 1QWYA 4K8JA 1VQ6A 3HOWG 3KF8A 3A54A 4RA8A 3NHHA 1VQMA 1F9QA 1IZ6A 2VUMB 1E2VA 1PFBA 5JEAG 4Y7NH 1O7YA 1TWAB 3S2HB 1PFMA 1D6EC 1IKLA 1UE1A 3N6RA 2NVYB 4O2DA 2GA4B 3LX0A 4QY7A 3T1YL 3A0JA 4K8IA 4B3SL 3NXWA 3IFDA 2QKIC 4LK1C 2EY5A 5BN4A 2F0LA 1X65A 4C3IB 5DEHA 1WD1A 1M90C 1PH4A 2JQOA 1J8IA 2HHHL 1I94L 1SSOA 4KJNA 3T1HQ 5EKKA 4CBVA 3NPPA 1XMOL 1VQPA 4JI5L 1FD7D 2E5LQ 2ES2A 1WVLA 3RN2A 2YU9H 3U4ZA 1I4PA 2M9VA 2X69A 3V2TA 5AJ3Q 1MJEA 1X3EA 1HPCA 1LABA 4JI1L 4HJ7A 1XNQL 4AYBB 5BR8L 1QILA 1WCMH 3GTLB 3RR5A 2AQ1B 5M3MH 1C9OA 4ZCKA 4IFDH 3PUWA 1O78A 4DV6Q 1XTDA 3I90A 3HKZB 2PCFB 3QOJA 5IYBH 4A3DG 3K0XA 1SROA 1ILQA 3HOZG 3TBIB 1X3PA 4I7AA 1QUQB 3KLSX 1HTPA 3EVQA 3DWQA 1FNUA 1RJTA 2PQAA 1CKOA 1VCIA 4A3MH 1O7IA 3QJYA 1KABA 3AU7A 2I46A 3PUZA 4LJZC 4PG3A 4NKLA 3BYTB 5LL6S 1Q46A 3ND8A 4OELB 1RKNA 4FVMA 5JEAJ 3VA5A 1Q86C 1G2TA 1PZID 1HZ9A 1XPRA 3I4MH 3BJUA 2E2IB 4DV2L 1VQ7A 2D62A 2WV6D 1XPUA 4IOCA 1H9KA 1E7ZA 5C5MA 1RTNA 2VZAA 1VQGA 4KI0A 1Q8IA 1DJRD 4R8NA 1QB5D 3SHLA 3GTJB 3HOYH 4QGUA 3B6YA 2A19A 1EY5A 3K7AB 5ELBA 2IJ0A 4CJ1B 1F9RA 1XX8A 1EZ8A 3NQIA 1KL9A 4BA1I 4IO9A 3AB9A 4A93G 2EQSA 2NVQB 1PZJD 1ZYRD 2JA8B 1SNCA 1PTOF 1STGA 2F0QA 3HG9A 1BBXC 1I4QA 4M1UB 4PMCA 2K1BA 1Y1WG 3Q0AA 2XWBB 2EYHA 2B8FA 3MVVA 1VQHA 2JA5H 2K05A 1X55A 3ND9A 3GP7A 3HOZB 3J7AV 3E5SA 2Q2TA 2N8NA 2MFIA 1I4HA 4POGA 4AYBE 2VQFQ 4A3JH 1OXVA 4X64Q 4JI6L 2ZM6L 4YHHQ 4LF6Q 3T13A 5JOBA 4DR7L 1Y1VH 1EZ6A 3S15B 3CC2A 3NSWA 1Y8NB 4YWLA 4BY1H 2I0QA 3DEPA 2EYPA 2L0CA 3R2TA 1PTOD 1H95A 1WOCA 3OIPA 1CT1D 4HAEA 5LMUL 1JB3A 1Y8PB 3S1RH 4C3JG 3VYTA 4K6DA 5GAGC 3TSSA 1SYBA 1K8AC 1HR0W 3F2DA 5F2DA 2RHSB 3D8GA 3T53B 3S1QH 2F4VQ 2I5LX 1LTID 2HHHQ 1K8GA 1A8VA 1WTRA 2RQXA 1MIUA 5IY0A 4WORA 2CW0D 4KMUC 4R4CA 1XMOQ 4JI5Q 1UE5A 2CHBD 2Z6KA 4KY6A 3PIOA 1VQBA 1YJWA 4E6IA 1ML0D 1CFMA 4LF4L 3STBD 3K5MA 3SR1A 3EIVA 1B1ZA 2E8GA 4H7BA 4K6LA 4DUYQ 3SEBA 1XNQQ 2EJMA 3M3YH 3PO2H 5C3WA 2SNMA 2YTXA 3BU2A 1YIJA 1JOOA 2F0KA 2R6GA 4DK0A 1B4OA 3OMCA 3AYHB 1QOHA 4HJ8A 5CV6A 4LF8Q 5IGFA 1PH8A 1A6XA 2E2HB 1TKWB 1U4RA 5CMDA 1DOLA 3DMUA 3P75A 1HXYD 2RSOA 4QUFA 1DOMA 2ATWA 4JVZA 3K7UC 1U4PA 1D8LA 2DY8A 4JK1C 1RTOA 3CP0A 1HJPA 2JEAI 3QG1A 4LW1A 4KY7A 2HQLA 1KHIA 2B2YA 3IFTA 1H9MA 3CKIB 5E3FA 4OX9L 5KNBA 1MHWC 1Y14B 2R7ZB 1B8AA 1I4RA 2B2WA 4BXXH 5IGBA 1N36L 2FFKB 2QGQA 4JYAL 1DYQA 3S1QB 5HGQA 5E4WC 3QOLA 3H3VH 2EYFA 2K4KA 4UP9A 2E75C 4K5VA 4XQJA 3FRPB 3F2UA 3Q8DA 3Q22A 4DR3L 1KQSA 4AQYL 1TS4A 4P73A 4GOPA 4JI0L 2MHVA 3EN2A 3NTIA 1SYEA 2RCNA 3T16A 4B3TQ 2LFNA 3M3YB 5EBCA 2WKDA 3K5NA 2R7DA 1WTOA 1V43A 3BVMA 3UI2A 3WOEA 4QIWE 2UU9L 4DV4L 5HGTA 1Z7TA 3PUVA 3GTKH 1Q1BA 2Q2HA 3LNNA 1SBBB 1R9TH 1IBKQ 1TT2A 1XJVA 5HURA 5CGKA 1EYGA 3C3LA 2MJ8A 1I6HH 5KNDA 3PUXA 2PZUA 1I4GA 4S3SA 2B39A 4F88A 4R8IA 2QA4A 2JA6G 3T56B 4JI4L 3FDTA 5I9OA 4QF4A 1K83B 4A75A 3H0GH 1D2BA 2IW3A 4DR7Q 5C0XI 2NVXH 5JJKA 4RCNA 4C56C 4B08A 3CCSA 2WFWA 4JI8L 3EFXD 2PI2A 5FO7B 4KJOA 5ELCA 3S1NB 4PZ7A 1L0WA 1F77A 4BWGB 1LTSD 3J80L 2PW5A 1VQEA 2EVBA 4OL7A 3I56A 1WTVA 1LTBD 5LMUQ 2DJFC 1FGUA 1PVOA 2HIXA 4NW2A 4KN7C 5CBEE 4ME3A 1V9PA 4X3TA 3CD6A 5KNCA 2L5TA 1EY0A 2R7ZG 4X3KA 4POFA 2B2TA 2MGSA 2OCEA 2CKZB 2L11A 1Q3LA 1DCZA 3M4OH 1U5KA 1WTQA 3JAMc 4EQ5A 2ZXRA 5FO9B 4IQZA 1OXXK 1PYSB 5TSSA 3K58A 2B2VC 1RIPA 4FF1A 1YBYA 2R93H 4C2MB 1KIXA 1NR2A 2JA7G 3KLWA 3ULLA 1RDPD 3PO3G 5C0XG 1PH3A 4A3GG 3R8BA 1Q81C 3S2DB 2E76C 5IT9L 4QL5A 4KK7A 3H15A 3I72A 3A5UA 4ZRZA 1EIYB 3E6ZX 3J80E 2X6LA 5NUCA 4NXMQ 5LMNL 4LF5Q 5DM63 2VB2X 4XYQA 1CKNB 1IYUA 4JI2L 2A68D 4R4OA 4BBRH 4DPGA 1U0LA 2B63B 1L2FA 3K0YA 5J1ZA 1KXLA 1Q8KA 4B9XA 2WAQG 4CKCA 1KTKA 3S1MB 3S17H 1STYA 5C4JH 3DLLA 1SFOH 1V1PA 3DHQA 4APVA 1OTCA 4DN4M 4PNYA 4IPDA 1AZQA 5IWAL 3OTOL 4JOIC 1FR3A 4ME5A 5C3EH 1STNA 2QF7A 4RKLA 4RGNA 1EL0A 5IYDH 4ALPA 2OQ0A 5M3FG 3HOVB 3OMGA 4OHJA 2NZOA 1N36Q 1KRSA 2RA4A 2CQOA 4A3EG 4RHSA 1JJGA 1H9JA 4QCLA 3GTQH 4IN3A 4G7HC 2R92G 4JPBW 1ASZA 2IX0A 3H6MA 3M4OB 4Q5VA 4DV5Q 4DR3Q 4HCSA 3GO5A 4BS9A 5IYCH 3I4NH 2B29A 4JI0Q 3CHBD 1EQVA 1G291 4GOPB 2N55A 3LGJA 4L8JA 2SOBA 4WRDA 4BBSH 4P75A 3HOXG 3WWVA 1DM0B 1PRTB 3G7LA 1A3UA 1GD7A 3HOUH 1H9SA 2PMZE 1VQLA 1P8LA 3J81c 2KQ3A 4L5TA 4QUCA 3J81E 3UDFA 3CMAA 2UU9Q 3TDQA 4DV4Q 2MO0A 3CQZB 3VDYA 3ONAB 3RN5A 5E4XA 2KVMA 3C46A 2F0MA 4RAUC 4NMZA 4G7ZC 3CU7A 1QVGA 4NP5A 5GADC 4JI4Q 2B2YC 3HFZB 5C4XB 3GTGH 2ZTDA 5K36H 2ZJRA 4KHPL 2JEBI 4DV7L 1PYBA 3FKIH 4DUZL 1MBYA 1IYVA 3L0OA 2FMMA 4P71A 1UUPA 5C4JB 1TIID 4WJ4A 4LFBL 1F2YA 4K14A 5M3FB 3S14H 2F0PA 3CCRA 1DD2A 1BCPD 4B3MQ 3MHBA 5L37A 1QUQA 1IBML 1K3RA 3J7ZC 5C3EB 3K6OA 4J1MA 5KYLA 2D2CC 4HJ9A 4JI7L 5FKAC 4GN3B 1J5EL 2KEEA 3KF6B 2NN6H 4GOPC 2R92B 1LTLA 3IL8A 4DR6Q 4XQNA 1PRTC 5CV9A 1S4ZA 2HIVA 4DR4L 3CF5A 4LF9Q 4R4TA 3FHWA 5IODA 4ABNA 3BVGA 2I5HA 2VUMG 1C0AA 4IUNA 2EYJA 5FLMH 2E2JB 1M4VA 2HQEA 4LMQD 4PMBA 2KHIA 1D7QA 3AFPA 2XNAC 4XIGS 1CZWA 3K5LA 4KV6A 5COYA 1ESFA 1F2MA 2F0GA 4A3BH 1BUVT 5EQ0A 2BOSA 4ODGA 3E3XA 1YJNA 3HOUB 3TMEA 1SYDA 1NJIC 4K5XA 3HGBA 2PPBC 1VQKA 2AMCB 4C3IG 2Y0SB 2F03A 2EJGC 4CKEA 2RF4A 3LWEA 3NTHA 4A3FG 2EYMA 2XTIA 5I2YA 4WJ3M 1CI3M 1LTTD 2UXCQ 4YY3Q 1HNXL 2F3IA 1Q82C 3DXJC 5EPJA 4BY7B 2WAQE 3W1GA 3NE5B 1XXGA 1D1KA 3CMEA 4FNFA 3IKJA 1C48A 1ASYA 5IP7H 1QZHA 1BVSA 4A3KH 5IWAQ 3OTOQ 4KKUA 1G51A 1YNND 4GNXA 2IPKD 2NVTH 1YZ6A 1NUCA 1R4PB 3HKZG 4DK6C 5E1FA 1I3QH 1MSGA 1L0XB 1YVCA 1VMCA 2PI2E 2C5CA 3RUZA 1STAA 1VDZA 1TWFH 1HFNA 5IGDA 4GLAC 3RLFA 1JJCB 4YWKA 2XN9C 1STEA 3Q24A 2A6ED 1LT3D 1EWCA 2VY3A 1IBLQ 3HOWH 3M4PA 3VYRA 4K2LA 5JEAH 2UUBQ 2DUDA 2EY1A 5I9PA 1BBWA 5BN5A 2K14A 2ICEC 3KK7A 2AWNA 2XRQD 4X66L 3I4OA 1GUGA 1HQMC 1ENCA 1WJJA 3CC7A 4A3FB 2ASBA 4A3CG 1S5ED 1TQOA 2KJXA 2K5QA 2K5NA 1H9SB 2JA9A 1L1OB 2PYKA 3I73A 2H4OA 3KUPA 1ENAA 1IKMA 3U58A 1TS3A 2UXDQ 1TWGH 1A15A 3U4VA 4EQPA 3CCLA 4RGOS 4B3RL 4DV7Q 1SNQA 3A8IE 3D4DA 5CORA 2JA8G 4DR2Q 2K32A 4LAAA 5GAHC 1QNUA 1WCMG 2Z4IA 4AIMA 1B9MA 1P16A 4A3KB 4ZAIA 1KDBA 2MNAA 1IBMQ 4IFDG 1FYCA 4GN4B 2LY7A 5M5XH 1YNNC 2O2LD 1NNXA 4A3DH 5AFWA 4JW0A 4NXNQ 2X6GA 3K57A 4FF2A 2KCTA 1LACA 3D0FA 2AHOB 4PV1C 4N9TA 3VA7A 1SE3A 4C3HH 1Z6HA 2JE6I 4Y7NB 1PH6A 3ULJA 4OXPA 3HEJA 2PQEA 4G4KA 4A3MG 2I5MX 1II3A 2A6EC 3HZXA 4B9WA 4F7XA 4RGTA 3AFQA 1BDOA 1UEBA 1ET9A 4MN3A 1G91A 4X3UA 1SEBD 2K7VA 2VL6A 4RMFA 5ELNA 2E74C 4DAPA 2F0DA 1TWHH 3D4RA 4DNIA 3SE0A 4PZ8A 3MFGA 2YU9B 4X65L 4KD3A 1EUJA 1SYGA 1WTPA 2F0UA 1XNRL 3K8AA 5H1SE 2R7FA 2RHQB 4IPCA 1WCMB 1HNXQ 3RZOH 2IY5B 4A93H 4L6TB 5M3MB 1YHQA 1D5XC 3RZDH 1GHKA 5DM73 1GUTA 4GZYC 3K81C 1Y1WH 2VQEL 1R4QB 2B2VA 1Q12A 4OIJA 1PTOH 4N8X1 3KLRA 4GKKL 1SNPA 2NTSA 2UXBQ 4NPSA 2F0EA 1GVPA 5CV5A 1NCVA 4OEMB 4GNXB 2OT2A 3HKZE 3BYYB 4DV3L 4KTAA 1ZXTA 4A3MB 2TMPA 4N8FA 3D3RA 2EJFC 2PZWA 1AN8A 3BG3A 4ZUJA 1XPOA 1K28A 2JN4A 2F0OA 3I4MB 1FVIA 3T1YQ 1IL8A 2F0TA 1SRUA 1KDCA 4DV1L 5JAVA 4UPAA 3S9WA 3W3AA 4B3SQ 1GXDC 4FP5D 2K5HA 2LS01 4C3JH 3GTOH 4FYDA 1NMGA 4G57A 4CDEC 1I94Q 4HJ5A 2WP8J 1CKMA 4JOIA 3HOYB 2HUGA 4IZ8A 4TQUS 2RDFA 1N32L 3GTMH 2ZTEA 2F0HA 3E0JA 1EY6A 2O5JC 3SVMA 2NZHA 2PW7A 4GNXC 5D14A 5FJ8G 4JI1Q 1KLGD 5BR8Q 4IOAA 3I8ZA 3MXNB 4RHRA 2JA5B 4A3IH 2EXZA 3M4QA 3EQLC 1D5ZC 1AP0A 1CKNA 4ZLTF 4Z9CB 4C1NI 4V0BA 3PO2G 1A3VA 1WD0A 2MQHA 2KENA 2DJGC 5K5PA 3I91A 1PTOB 2O5IC 3KYHC 4A3JB 3SGIA 1F2LA 1C4QA 3MWYW 2EIFA 4IUVA 1Y1VB 3TP8A 1B53A 4BY1B 1DONA 3OWFA 4JG2A 3GV6A 4DAYB 3BS1A 1K73C 3J80i 1PFSA 4UY8C 4QJFA 1MKHA 1G2SA 2CFMA 4EX5A 2B2UA 3QWNA 1A63A 3TREA 1DZ1A 2UUCL 4DR1L 2RSNA 1QVCA 3J7A5 3S1RB 4DV2Q 1AE2A 4FXKC 4XT1B 2IHFA 2BDNA 1GUNA 2KEDA 1AZPA 1HA5A 3U9SA 1JMCA 3GTOB 2OQKA 1V8QA 1B44D 4JV5L 1A2TA 4BXXG 1I50H 2Z9HA 3M7GA 1S72A 1E3PA 2K75A 1IW7C 2YYZA 2QDBA 4IUUA 1HNWL 2I07B 4KKTA 1K9MC 1JR0D 1IL2A 2KOLA 1PZKD 5T1GA 4F8MA 1XNRQ 1A0IA 1NMFA 3PO2B 2K5DA 1E1OA 3AEVA 4R1JA 1VQFA 4L5SA 1EQTA 4A3IB 3L7ZC 2KA7A 4X6AH 3NTKA 1FL0A 5M9OA 4KKSA 1GHJA 1GUSA 3NELA 1EIGA 4XT3B 3HP3A 4HMIA 5LL6X 3NEMA 4OONA 3W5OA 5A35A 1OXTA 3A55A 5JJIA 4GKKQ 4JI6Q 4UHVA 2ZM6Q 1KDAA 1CQVA 3JAML 4KLKA 3Q6SA 2QEXA 4DV3Q 2B63G 1B3QA 2A69D 1S40A 4UP7A 1O80A 1HA6A 4UDUC 3J81i 4MTNA 1MD2D 1JICA 1WI5A 5ISRA 2TSSA 2G9DA 2IX3A 1PHJA 2UUAL 3VYUA 3BZDB 3KF6A 1YJ9A 3W2DA 4UP8A 2BDOA 2FHTA 3NWTA 5KEEA 5C44H 1LTGD 5GROA 2DN8A 4GS3A 5FLXc 1JT8A 1EEID 4CDDC 1EYCA 1KAWA 1PH2A 4IJHA 1NE3A 5D3IB 3MAQA 3HOVG 1AE3A 3CXCA 1K0SA 1MGSA 1YNJC 2KCNA 1BO0A 1G8ZD 3P20A 2F52A 4ZK9B 1QVFA 1T9HA 3JAME 2R7ZH 3UDXA 2LSSA 2LXJA 5M5WH 4FO2A 2CWAA 1C8CA 5CR3A 4H02A 4LF4Q 3TRZA 1XMQL 3VR5A 2KCMA 4H13C 2KHJA 1EU3A 2JSOA 2LXKA 3MXPA 4HN7A 1JOQA 3UE1A 2KBNA 3PO3H 4ZQ3A 4A3GH 2G5DA 1HR0L 3GTKB 1R9TB 4MTKA 3BDCA 4XDXA 4Q0FA 1I6HB 3N52A 2DNEA 3MC0B 5G3LD 2F0WA 3DM3A 1CHPD 4KN4C 3H0GB 1N34L 4P2CB 1AW7A 3A7LA 2PZTA 5JPMC 2NVXB 1NSNS 1E1TA 1EIHA 3CC4A 3H3VC 4OWTB 1JWMD 1GUWA 2D5DA 5A2QE 4QB4A 5C4XG 2A69C 2R61A 2D0PA 4V190 4XYOA 1I4XA 3KJOA 3TP7A 4HIKA 4U673 2CWPA 1AFPA 4HSVA 3J81L 4LUVA 2AQ2B 4FF3A 1GJXA 1C7YA 2UUCQ 4OX9Q 4NDXA 3FP9A 3DWAA 2RVLA 3U50C 3K59A 4J8QA 1PRTD 1TS2A 3CCEA 1BOSA 3CW2C 5IP9G 4HEDA 5C3EG 3T4AC 1NBWA 4XXEA 4JYAQ 2F1MA 4H44C 2IWHA 1VQ4A 4JV5Q 4K0KL 4RKBA 1VQIA 1WYDA 2DY7A 4DR5L 5I2XA 4A3EH 1CTMA 3MZ5A 4AQYQ 1TU2B 4FDBA 1BCPF 2K28A 5ELEA 5BN3A 3WDNA 2R93B 1X3GA 4HMJA 5C3XA 3IRBA 2OWOA 1LLRD 4OO1I 4HIDA 2ZXOA 1VF7A 4JBWA 2WB1B 5C0XJ 1L1OA 2B8GA 1GM5A 4JBMA 2ENBA 4XQQA 2M2LA 1S5CD 4EGVA 3KBXA 5C4HA 4OWWB 3X3NA 1N33L 4H0LC 3HOXH 4C1NK 1EFWA 1JE5A 1HTLD 2B2UC 4CGYB 4BBRB 3NENA 1X3QA 4PQXA 3HOUG 1N8RC 3TS2A 2JJQA 3I4LA 1JQYD 3NQTA 3R2IA 3A74A 1H9RA 2MP1A 3OOCA 2Y0SG 1VQCA 3S17B 1SYFA 3OW7A 4A3LG 1HQRD 2E5LL 2VXWA 4JI8Q 1IHZA 2C9OA 1SFOB 5K36G 4CKBA 2KECA 1SMYC 4YIJA 3FKIG 5AJ3L 5KGUA 4BY7G 1E2ZA 2NZ1D 2PNHA 4DNTB 2Q2IA 1SNDA 1EIFA 5DNFA 2EXDA 2J7ZA 4OO1G 3CCQA 3MA2B 4DV6L 4U68A 1SAPA 2A6HD 3G71A 1PH1A 1DGSA 1B7YB 1YHAA 2A5HA 2NN6G 2YTVA 3NBHB 4ULLA 3GTQB 4JI3L 3OIQA 1GUOA 1EEFD 4ILWA 1OO9B 2JXMB 4G7OC 1QE6A 2K5WA 3I4NB 3EROA 1NR4A 2OF1A 2K04A 2MO1A 2V1CC 1EYDA 2ZTCA 5JJZA 1AEXA 1PMRA 3ZJYC 2VUMH 1I6VC 4P74A 1SYCA 4BBSB 1TWAH 4BA2I 3S2HH 2HT1A 5CYUA 4KHZA 3VR6A 2NVYH 1EY4A 1HR0Q 1X9NA 3SK6A 5LMNQ 3VYSA 1EU4A 4JI2Q 4M8AA 5I6YA 5M5YH 4C3IH 1JE4A 5FK9C 3GTGB 3FKIB 1PH9A 4EQOA 2SNSA 3I55A 3EA6A 3PQIA 2F0SA 2QW7A 2KHSA 4L5QA 3RNUA 1U4MA 2K33A 4RGMA 3S14B 1TVXA 3PIP3 3TS0A 3OSOA 1CHQD 1E22A 2CQAA 3OPOA 2BH2A 3C1FA 4HSPA 5IP7G 3GTLH 2SEBD 3CPWA 1ZEQX 4A3KG 1PYWD 1MJCA 1K8OA 2LMCB 1ICFB 1LV9A 2A6HC 1EY9A 1HZCA 1SE2A 1KNEA 1B50A 2Z6BA 1STBA 2VNUD 1QNKA 5KYIA 3GV3A 3SDZA 1RCVD 1VQ5A 4LF6L 4IFDI 3MEHA 1FJGL 1HFGA 2EDGA 2BE5C 5JJLA 2K6AA 4A3BB 3UDGA 1JB7A 2A8VA 5KRUA 3AQQA 3NWSA 1DOKA 3WOFA 5GAEC 1CK1A 4HCEA 2E2IH 1UAPA 1N33Q 1HNZL 4RCOA 4CDCC 2F3VA 1LM0A 4A3CH 5ELFA 4O0AA 1QZGA 5KIXA 1Z47A 2F4VL 5CBAE 3MXNA 2A1AA 5M5YB 1D1IA 3VR3A 1CSQA 1EQQA 1W6JA 4KHPQ 2K03A 1PV4A 2Y0SE 2L4NA 3GTJH 3R93A 4DUZQ 1HUMA 5EPKA 3K7AH 1STHA 4LFBQ 3L3OC 1A62A 1G6PA 3FEWX 5IE8A 4LNQA 1EY7A 3CAMA 1J9OA 1X32A 5M3MG 2YTYA 4YCUA 2NVQH 2MUYA 4DUYL 2JA8H 1TR5A 2NVTB 1XWEA 2HDMA 4LWCA 4JI7Q 1BBUA 1J5EQ 3A56A 1CSPA 5IYBG 1I3QB 1VMPA 4DAYA 3NUCA 1HCZA 1TY2A 2L55A 3I7FA 1LT4D 4RG1A 3HOZH 1TWFB 3SXHA 3SK5A 4QMGA 2XIWA 1EFID 4YCVA 1SMXA 3PGZA 4DR4Q 2F4IA 4OIKA 1L1OC 3F2BA 4JBKA 4JI3Q 3HOWB 4LF8L 2WKCA 2D9UA 2F0NA 2N78A 4C3HG 1X3FA 1OXUA 3S15H 1V1OA 2HCIA 1F9SA 3HRZC 4OWXB 1SNMA 2BCOA 3I4MG 4HTHA 2ICIA 4NB3A 1VQNA 1E2WA 3X3MA 1J6QA 3ZYYX 1TXYA 1WTWA 3BVZA 2KUMA 2F0JA 4GKJL 2HD3A 2R3ZA 1TWGB 3HOYG 4O42A 4CJ2C 3MXGA 1Q7YC 4ZYSA 4TSSA 3F2CA 2F0FA 3TN2A 5J39A 5EKIA 2E2DC 3RD4A 4LF7L 2OTJA 1VQ8A 1SJED 2FINB 3ULPA 1NY4A 2XVSA 4QQBX 2JA5G 3ITPA 2AUJD 3PSIA 1CM9A 1N9WA 4B3TL 1VF5C 2FMCA 3L2PA 5M5XB 1S5DD 2OEOA 4IFDJ 1QG7A 3SK8A 1TS5A 3A7AB 3D4WA 4A3DB 4AH6A 3F1ZA 4A3JG 3L9AX 3PF4A 5EBDA 1T5EA 1I5FA 1IBKL 4L63B 4C3HB 1K0RA 1Y1VG 2YV5A 1PH7A 1BNZA 1BR9A 4BY1G 1MI2A 2J0TD 2JK8A 3KDFB 4TVAB 1JCKB 2ID0A 2L12A 2ZJQA 2NWGA 2EY6A 3G6JB 2E2HH 2ZJPA 3J7YW 4X62L 1FJGQ 4FXDA 3E9HA 1EOVA 1FGBD 4JC0A 2PNRC 4O1NA 3KF8B 4IPGA 4IALA 4KHVA 4X66Q 5EGTA 1TWHB 4X3SA 4DNRB 3GD7A 1A2UA 5LHY1 1IW7D 3MEFA 2DNCA 4DXFA 3M85A 3CCVA 1LYLA 3A8KE 1LO5D 1HUNA 1TY0A 1HNZQ 2H1EA 4DU9A 2N3SA 1SE4A 2N49A 5EKLA 1GOZA 5DAUA 5LMNW 5J3BA 5C4ZA 2PO4A 3IAYA 4I7ZC 2WIIB 3RZOB 4B3RQ 5IIFA 4IJLA 4A93B 4LFAL 1JOKA 4MIUA 3RZDB 5IGGA 5FJ8H 2FJ2A 2RDHA 1Z9FA 1Q90A 1Y69U 1Y1WB 3QR8A 3M7NA 3JAMi 1W3SA 3EJIA 2L1BA 4QIWB 1CA6A 3H3VI 3RLOA 4A3IG 2ALYB 1FNWA 2V4DA 1SE8A 2GVBA 1SXTA 1ZYRC 5I4DA 2K50A 4IURA 1MSHA 4NXML 1M8AA 4EVOA 4LF5L 2AWOA 4GN5A 3BDLA 3KJPA 4R4IA 3OWEB 4OGQC 1KC8C 1HHVA 3S24A 2CVRA 4DK3C 1UE6A 1NAPA 1K83H 2QEJC 3U9OA 2Q8RE 2Q8IB 1M1KC 2Z8LA 1E24A 4YWMA 5ELDA 4JBJA 3TQYA 1ONLA 2PQAB 1YITA 1YNJD 1V1QA 3CRLC 1ENFA 4C3JB 3S1NH 1SR3A 1D5MC 1EWIA 3DUZA 2NYZD 4MHEA 1EWHA 2RCFA 1E0BA 2GVAA 3I3CA 1QCBD 2JYOA 1PTOC 3DM1A 3GTMB 3HKSA 3EBEA 5I6WA 3QIAA 4GKJQ 1UNSA 4X65Q 1SDFA 4F87A 2VB3X 2XGTA 4GLVB 4Y52H 3AMUA 5D65A 1WFQA 3J7AF 4XTCS 3UE0A 3KFUA 3D31A 1B9NA 4DFAA 2QCPX 4DF7A 4LF7Q 1PA6A 5FLXL 4DV5L 2NBFA 2K01A 3D6WA 2CW0C 4RWSC 1YI2A 3ER0A 1U9RA 4PMWA 5JVG3 2VQEQ 2RBMA 4DAMA 4C2MH 1FNVA 5T1IA 3STBC 1PXUA 2Q8TA 2G9HD 1IXRA 5HY6A 1YEZA 2ZXPA 4MZ9A 3V96A 3S2DH 2DGYA 2EYOA 1RHPA 2JA6H 4A76A 3ERSX 1ESRA 1JWUD 2AUKA 2HDLA 3H0GG 4JCVE 2B63H 1EQRA 1IYJB 3URYA 2Z0SA 3O13A 1T5XD 2L9HA 4DAVA 3MXUA 3JC66 3CCMA 2H5XA 3S1MH 3TP5A 2J4XA 4X62Q 4DV1Q 2B3GA 5G3LF 1SJHD 1PH5A 5FLXE 3NBHA 1L0YB 4B3ML 4LFCL 5CV4A 2AQ3B 3BZKA 5C44G 1S5FD 2OTLA 1K8MA 1RD9D 2FXQA 1X54A 3ICEA 1I50B 3OYYA 3KLSA 4IPHA 1UWVA 5A2QL 1N32Q 2NUCA 4L5RC 2RKSA 3HOVH 1W6KA 1S5BD 3K80C 4DR6L 2IL8A 4A4IA 5IGCA 1HH2P 1HZBA 1UEAB 3VR2A 2EYLA 3I70A 3MFYA 3G4SA 3C2PA 1AH9A 4WJWA 5GQOA 5EPLA 2XSCA 4HIOA 3NP8A 4LF9L 4IUPA 4LFAQ 1ET6A 2R93G 3TEHB 2RDGA 2JA7H 1ILPA 1PRTF 3KBGA 5C0XH 3PIPA 1KLUD 4ZUIA 4DXGA 2IX1A 3K5OA 2PMZB 2WB1G 5CV7A 1VQJA 1VQOA 4DV0L 3PCOB 1VS0A 3P7JA 3FVQA 2N88A 1SNOA 1ZKOA 4BBRG 5IGEA 1JJ2A 2JA6B 3J80c 1RF2D 3F8TA 4KD4A 5EJWA 1B2TA 1BF4A 1SMYD 3CQZH 2SDFA 2O4XA 3OW2A 1CA5A 4UAIA 3PIO3 1K3BC 1YNXA 1EOTA 4IUQA 3LWUA 3D6CA 1B70B 2Q2UA 2A74C 1YHBA 5E7NA 4HJAA 3CRKC 4R9WA 3W1BA 2UXCL 5C4XH 4YY3L 4DR1Q 4LUOA 5C5LA 5C44B 3BZCA 3PUYA 2AKWB 2JP1A 1LUZA 2HCCA 1PDQA 3NBIA 3HS0C 2LKVA 3J81j 1NTGA 2D0OA 5IYDG 5M3FH 2NB0A 3KOJA 1PFNA
chains in the Genus database with same CATH topology
5JVH3 1DXMA 4EQNA 3NK9A 3PMFA 2WACA 2IT1A 3SK4A 2R7ZB 2ZT9C 2EOTA 5CC4A 2A73B 5FO8B 5IT9E 1QJOA 2M00A 3FMCA 5M5WB 3QO2A 1U4LA 3PV0A 1B3AA 4IUTA 4I65A 5J22A 5JPNC 3RMHA 2JA7B 3PO3B 2NN6I 4A3GB 1RODA 1LTRD 4FXGC 2BA0A 3P1HA 4ZKCB 1O7LA 1JWSD 3ERQA 1BXTA 1CQFA 1CZGA 2OXPA 1F2ZA 3FPUB 4WFN3 2EY2A 3TZDA 4ZKBB 2WAQB 1LT6D 3H09A 2A68C 2F0VA 3MTSA 1JORA 2Z4HA 2Z1CA 1G6ZA 3H94A 2B2WC 1EY8A 4RH6A 4K5WA 1XTCD 3V05A 4KY5A 3OHXC 4OO1H 1JC7A 1XYIA 2EZVA 1LTAD 4A3EB 2BE5D 3Q23A 4TKOB 2WINB 1Y8OB 5D3DA 2EPBA 4DK1A 1O7ZA 4DGZA 3QB3A 4N9PA 1KNAA 3C1EA 4DA2A 1LT5D 2BA1A 3R3OA 1TWCB 2F0IA 1BCPB 1A3TA 4ID6A 2F3WA 3HOXB 1F9PA 1WTXA 2NTTA 4RFBA 3DWPA 1Q1EA 3DEOA 4CHTB 4TRDA 3FPPA 3TZUA 4J6HA 5FOBB 4HR7B 3S16B 1ICWA 1PLFA 3H91A 3M4YA 4CJ0B 3A8JE 3T51B 5IOCA 3BDOA 2QILA 5C6AA 1OXSC 2KCCA 1KAAA 2MPMA 2EE1A 1HRJA 4K2KA 2XRSD 2B2TC 3GQBA 1V1PB 3VR4A 1BCPC 5CV8A 3GTPB 4FF4A 2XWJB 1BQQT 3TP6A 1EYAA 1QWYA 4K8JA 3KF8A 3A54A 4RA8A 3NHHA 2VUMB 1F9QA 1E2VA 1PFBA 5JEAG 1O7YA 1TWAB 3S2HB 1PFMA 1D6EC 1IKLA 3N6RA 2NVYB 2GA4B 3LX0A 4K8IA 3NXWA 3IFDA 2QKIC 4LK1C 2EY5A 5BN4A 2F0LA 4C3IB 5DEHA 1WD1A 1J8IA 1SSOA 4KJNA 5EKKA 4CBVA 3NPPA 1FD7D 1WVLA 1I4PA 2M9VA 2X69A 3V2TA 1HPCA 1LABA 4AYBB 1QILA 3GTLB 2AQ1B 4IFDH 3PUWA 1O78A 3I90A 3HKZB 2PCFB 3QOJA 1ILQA 3TBIB 1X3PA 3KLSX 1HTPA 3EVQA 3DWQA 1FNUA 1RJTA 1VCIA 3QJYA 1KABA 3AU7A 2I46A 3PUZA 4LJZC 4NKLA 3BYTB 5LL6S 3ND8A 1RKNA 4FVMA 5JEAJ 3VA5A 1G2TA 1PZID 2E2IB 2D62A 2WV6D 1H9KA 5C5MA 1RTNA 4KI0A 1Q8IA 1DJRD 4R8NA 1QB5D 3SHLA 3GTJB 5ELBA 1EY5A 3K7AB 2IJ0A 4CJ1B 1F9RA 1XX8A 1EZ8A 3NQIA 4BA1I 3AB9A 2NVQB 1PZJD 1ZYRD 2JA8B 1SNCA 1PTOF 1STGA 2F0QA 3HG9A 1BBXC 1I4QA 4M1UB 4PMCA 2K1BA 3Q0AA 2XWBB 2EYHA 2B8FA 3MVVA 2K05A 3ND9A 3GP7A 3HOZB 3J7AV 3E5SA 1I4HA 1OXVA 3T13A 5JOBA 1EZ6A 3S15B 3NSWA 1Y8NB 2L0CA 2EYPA 3DEPA 3R2TA 1PTOD 3OIPA 1CT1D 4HAEA 1JB3A 1Y8PB 4C3JG 3VYTA 4K6DA 3TSSA 1SYBA 5F2DA 3D8GA 3T53B 1LTID 1WTRA 2RQXA 4WORA 2CW0D 4KMUC 2CHBD 4KY6A 4E6IA 1ML0D 1CFMA 3K5MA 3SR1A 1B1ZA 4H7BA 4K6LA 3SEBA 2EJMA 5C3WA 2SNMA 1JOOA 2F0KA 2R6GA 4DK0A 1B4OA 3OMCA 1QOHA 5CV6A 5IGFA 1A6XA 2E2HB 1TKWB 1U4RA 5CMDA 1DOLA 3DMUA 3P75A 1HXYD 2RSOA 4QUFA 1DOMA 1U4PA 2DY8A 4JK1C 1RTOA 2JEAI 3QG1A 4KY7A 2B2YA 3IFTA 1H9MA 3CKIB 5E3FA 5KNBA 1I4RA 2B2WA 5IGBA 2FFKB 1DYQA 3S1QB 5E4WC 3QOLA 2EYFA 2E75C 4K5VA 4XQJA 3FRPB 3F2UA 3Q22A 1TS4A 2MHVA 3NTIA 1SYEA 3T16A 2LFNA 3M3YB 5EBCA 2WKDA 3K5NA 1WTOA 1V43A 3BVMA 3UI2A 3WOEA 5HGTA 1Z7TA 3PUVA 1Q1BA 3LNNA 1SBBB 1TT2A 5HURA 5CGKA 3C3LA 2MJ8A 5KNDA 3PUXA 2PZUA 1I4GA 4S3SA 2B39A 4F88A 4R8IA 3T56B 3FDTA 5I9OA 4QF4A 1K83B 1D2BA 2IW3A 5C0XI 4RCNA 4C56C 4B08A 3EFXD 5FO7B 4KJOA 5ELCA 3S1NB 1F77A 4BWGB 1LTSD 3J80L 2PW5A 2EVBA 4OL7A 1WTVA 1LTBD 5CBEE 4NW2A 4KN7C 4X3TA 5KNCA 2L5TA 1EY0A 4X3KA 2B2TA 2MGSA 2L11A 1Q3LA 1DCZA 1WTQA 2ZXRA 5FO9B 4IQZA 1OXXK 5TSSA 3K58A 2B2VC 4FF1A 4C2MB 1NR2A 1RDPD 5C0XG 3R8BA 3S2DB 2E76C 5IT9L 4KK7A 3I72A 4ZRZA 3E6ZX 3J80E 2X6LA 5NUCA 5DM63 2VB2X 4XYQA 1IYUA 2A68D 2B63B 3K0YA 5J1ZA 4B9XA 4CKCA 1KTKA 3S1MB 1STYA 1V1PA 3DHQA 4DN4M 4PNYA 1AZQA 1FR3A 4ME5A 1STNA 2QF7A 4RKLA 4RGNA 1EL0A 3HOVB 3OMGA 4OHJA 2RA4A 4RHSA 1H9JA 4QCLA 4IN3A 4G7HC 2IX0A 3H6MA 3M4OB 4Q5VA 4HCSA 3GO5A 4BS9A 3CHBD 1EQVA 1G291 2N55A 4L8JA 2SOBA 4WRDA 1DM0B 1PRTB 3G7LA 1A3UA 1H9SA 2KQ3A 4QUCA 3J81E 3TDQA 3CQZB 3ONAB 5E4XA 2KVMA 3C46A 2F0MA 4RAUC 4NMZA 4G7ZC 3CU7A 4NP5A 2B2YC 5C4XB 5K36H 2JEBI 1MBYA 1IYVA 2FMMA 1UUPA 5C4JB 1TIID 1F2YA 4K14A 5M3FB 1DD2A 2F0PA 1BCPD 3MHBA 5C3EB 3K6OA 4J1MA 5KYLA 2D2CC 5FKAC 2KEEA 2NN6H 2R92B 3IL8A 4XQNA 1PRTC 5CV9A 1S4ZA 5IODA 4ABNA 3BVGA 4IUNA 2EYJA 2E2JB 1M4VA 2HQEA 4LMQD 4PMBA 2XNAC 4XIGS 1CZWA 3K5LA 4KV6A 5COYA 1ESFA 1F2MA 2F0GA 1BUVT 5EQ0A 2BOSA 4ODGA 3HOUB 3TMEA 1SYDA 4K5XA 3HGBA 2PPBC 4C3IG 2Y0SB 2F03A 2EJGC 4CKEA 3LWEA 3NTHA 2EYMA 5I2YA 1CI3M 1LTTD 3DXJC 5EPJA 4BY7B 3NE5B 1XXGA 1D1KA 4FNFA 3IKJA 1C48A 4KKUA 1YNND 2IPKD 1NUCA 1R4PB 5E1FA 1MSGA 1L0XB 1VMCA 3RUZA 2C5CA 1STAA 1VDZA 1HFNA 5IGDA 3RLFA 2XN9C 1STEA 3Q24A 2A6ED 1LT3D 1EWCA 3VYRA 4K2LA 5JEAH 5I9PA 2EY1A 5BN5A 2ICEC 3KK7A 2AWNA 2XRQD 1GUGA 1HQMC 1ENCA 4A3FB 1S5ED 1TQOA 2KJXA 2K5QA 1H9SB 2PYKA 3I73A 2H4OA 3KUPA 1ENAA 1IKMA 1TS3A 1A15A 4EQPA 4RGOS 1SNQA 3A8IE 3D4DA 5CORA 2K32A 4LAAA 1QNUA 2Z4IA 1B9MA 4A3KB 4ZAIA 1KDBA 4IFDG 1FYCA 2LY7A 1YNNC 2O2LD 5AFWA 2X6GA 3K57A 4FF2A 1LACA 4PV1C 4N9TA 3VA7A 1SE3A 4Y7NB 1Z6HA 2JE6I 3HEJA 2PQEA 4G4KA 1II3A 2A6EC 3HZXA 4B9WA 4F7XA 4RGTA 1BDOA 1ET9A 4MN3A 1G91A 4X3UA 1SEBD 2K7VA 2E74C 4DAPA 2F0DA 3D4RA 3SE0A 3MFGA 2YU9B 4KD3A 1SYGA 1WTPA 2F0UA 1WCMB 4L6TB 5M3MB 1D5XC 1GHKA 5DM73 1GUTA 4GZYC 1R4QB 2B2VA 1Q12A 4OIJA 1PTOH 3KLRA 1SNPA 2NTSA 2F0EA 5CV5A 1NCVA 2OT2A 3BYYB 4KTAA 1ZXTA 4A3MB 2TMPA 3D3RA 2EJFC 2PZWA 1AN8A 3BG3A 4ZUJA 2F0OA 3I4MB 1IL8A 2F0TA 1KDCA 5JAVA 3S9WA 3W3AA 1GXDC 4FP5D 2LS01 4FYDA 4G57A 2WP8J 3HOYB 2HUGA 4IZ8A 4TQUS 2RDFA 2F0HA 3E0JA 1EY6A 2O5JC 3SVMA 2PW7A 5D14A 1KLGD 3I8ZA 4RHRA 2JA5B 2EXZA 3EQLC 1D5ZC 1AP0A 4ZLTF 4Z9CB 4C1NI 4V0BA 1A3VA 1WD0A 5K5PA 3I91A 1PTOB 2O5IC 4A3JB 1F2LA 1C4QA 3MWYW 4IUVA 1Y1VB 3TP8A 1B53A 4BY1B 1DONA 3OWFA 3GV6A 3BS1A 1G2SA 2B2UA 3QWNA 1DZ1A 2RSNA 3S1RB 4FXKC 4XT1B 2BDNA 1GUNA 2KEDA 1AZPA 1HA5A 3U9SA 3GTOB 1V8QA 1B44D 1A2TA 3M7GA 1IW7C 2YYZA 2QDBA 4IUUA 2I07B 4KKTA 1JR0D 2KOLA 1PZKD 5T1GA 4F8MA 3PO2B 2K5DA 1EQTA 4A3IB 3L7ZC 2KA7A 3NTKA 5M9OA 4KKSA 1GHJA 1GUSA 1EIGA 4XT3B 3HP3A 4HMIA 5LL6X 5A35A 1OXTA 3A55A 1KDAA 1CQVA 3JAML 3Q6SA 2A69D 1O80A 1HA6A 4UDUC 1MD2D 1JICA 5ISRA 2TSSA 2G9DA 2IX3A 3VYUA 3BZDB 3W2DA 2BDOA 2FHTA 3NWTA 5KEEA 1LTGD 2DN8A 1EEID 1EYCA 5D3IB 3MAQA 1MGSA 1YNJC 2KCNA 1BO0A 1G8ZD 3P20A 4ZK9B 3JAME 4FO2A 1C8CA 5CR3A 3VR5A 4H13C 1EU3A 2JSOA 3MXPA 4HN7A 1JOQA 4ZQ3A 3GTKB 1R9TB 3BDCA 4XDXA 4Q0FA 1I6HB 3N52A 2DNEA 3MC0B 5G3LD 2F0WA 1CHPD 4KN4C 3H0GB 4P2CB 1AW7A 3A7LA 2PZTA 5JPMC 2NVXB 1NSNS 1EIHA 3H3VC 1JWMD 1GUWA 2D5DA 5A2QE 4QB4A 2A69C 2R61A 4V190 4XYOA 1I4XA 3TP7A 4U673 1AFPA 4HSVA 3J81L 2AQ2B 4FF3A 1GJXA 4NDXA 3DWAA 2RVLA 3K59A 4J8QA 1PRTD 1TS2A 1BOSA 4HEDA 3T4AC 4XXEA 2F1MA 4H44C 2IWHA 4RKBA 2DY7A 5I2XA 1CTMA 3MZ5A 1TU2B 1BCPF 2K28A 5ELEA 5BN3A 3WDNA 2R93B 4HMJA 5C3XA 1LLRD 4OO1I 2ZXOA 1VF7A 4JBWA 2WB1B 5C0XJ 2B8GA 2ENBA 4XQQA 2M2LA 1S5CD 4EGVA 3KBXA 5C4HA 3X3NA 4H0LC 4C1NK 1HTLD 2B2UC 4CGYB 4BBRB 4PQXA 1X3QA 3I4LA 1JQYD 3NQTA 3R2IA 1H9RA 2MP1A 3OOCA 3S17B 1SYFA 3OW7A 1HQRD 2VXWA 1IHZA 2C9OA 1SFOB 5K36G 4CKBA 2KECA 1SMYC 4YIJA 5KGUA 1E2ZA 2NZ1D 4DNTB 1SNDA 5DNFA 2J7ZA 4OO1G 3MA2B 4U68A 1SAPA 2A6HD 2A5HA 2NN6G 4ULLA 3GTQB 3OIQA 1GUOA 1EEFD 4ILWA 1OO9B 2JXMB 4G7OC 1QE6A 2K5WA 3I4NB 3EROA 1NR4A 2OF1A 2K04A 1EYDA 5JJZA 1AEXA 1PMRA 1I6VC 1SYCA 4BBSB 4BA2I 5CYUA 4KHZA 3VR6A 1EY4A 3SK6A 3VYSA 1EU4A 4M8AA 5I6YA 1JE4A 5FK9C 3GTGB 3FKIB 4EQOA 2SNSA 3EA6A 2F0SA 2KHSA 1U4MA 2K33A 4RGMA 3S14B 1TVXA 3PIP3 3OSOA 1CHQD 2CQAA 3OPOA 3C1FA 4HSPA 2SEBD 1ZEQX 1PYWD 1K8OA 2LMCB 1LV9A 2A6HC 1EY9A 1SE2A 1KNEA 1B50A 2VNUD 1STBA 1QNKA 5KYIA 3GV3A 3SDZA 1RCVD 4IFDI 3MEHA 1HFGA 2EDGA 2BE5C 2K6AA 4A3BB 5KRUA 3NWSA 1DOKA 3WOFA 1CK1A 4HCEA 1UAPA 4RCOA 2F3VA 5ELFA 5KIXA 1Z47A 5CBAE 3MXNA 5M5YB 1D1IA 3VR3A 1W6JA 2K03A 2L4NA 3R93A 1HUMA 5EPKA 1STHA 3L3OC 3FEWX 1EY7A 1J9OA 1X32A 2MUYA 1TR5A 2NVTB 1XWEA 2HDMA 3A56A 1I3QB 1VMPA 4DAYA 3NUCA 1HCZA 1TY2A 2L55A 1LT4D 1TWFB 3SXHA 3SK5A 4QMGA 2XIWA 1EFID 2F4IA 4OIKA 3HOWB 2WKCA 2D9UA 2F0NA 4C3HG 1OXUA 1V1OA 2HCIA 1F9SA 3HRZC 1SNMA 2BCOA 4HTHA 2ICIA 1E2WA 3X3MA 3ZYYX 1WTWA 3BVZA 2KUMA 2F0JA 2R3ZA 1TWGB 4O42A 4CJ2C 3MXGA 4ZYSA 4TSSA 2F0FA 3TN2A 5J39A 5EKIA 2E2DC 3RD4A 1SJED 2FINB 2XVSA 3ITPA 2AUJD 1CM9A 1VF5C 2FMCA 5M5XB 1S5DD 2OEOA 4IFDJ 1QG7A 3SK8A 1TS5A 3A7AB 3D4WA 4A3DB 3L9AX 5EBDA 1T5EA 4L63B 4C3HB 1BNZA 1BR9A 1MI2A 2J0TD 1JCKB 2ID0A 2L12A 2NWGA 2EY6A 3G6JB 3J7YW 4FXDA 1FGBD 2PNRC 4O1NA 4IALA 4KHVA 5EGTA 1TWHB 4X3SA 4DNRB 3GD7A 1A2UA 5LHY1 1IW7D 2DNCA 4DXFA 3M85A 3A8KE 1LO5D 1HUNA 1TY0A 2H1EA 4DU9A 1SE4A 5EKLA 1GOZA 5DAUA 5C4ZA 2PO4A 3IAYA 4I7ZC 2WIIB 3RZOB 5IIFA 4A93B 1JOKA 4MIUA 3RZDB 5IGGA 2FJ2A 2RDHA 1Q90A 1Y69U 1Y1WB 3M7NA 3EJIA 2L1BA 4QIWB 1CA6A 1FNWA 2V4DA 1SXTA 1ZYRC 5I4DA 4IURA 1MSHA 1M8AA 4EVOA 2AWOA 3BDLA 3OWEB 4OGQC 1HHVA 2CVRA 1NAPA 2QEJC 3U9OA 2Q8RE 2Q8IB 2Z8LA 5ELDA 1ONLA 1YNJD 3CRLC 4C3JB 1ENFA 1D5MC 3DUZA 2NYZD 4MHEA 1EWHA 1E0BA 3I3CA 1QCBD 2JYOA 1PTOC 3DM1A 3GTMB 5I6WA 3QIAA 1UNSA 1SDFA 4F87A 2VB3X 3AMUA 5D65A 3J7AF 4XTCS 3D31A 1B9NA 4DFAA 2QCPX 4DF7A 5FLXL 2NBFA 2K01A 3D6WA 2CW0C 4RWSC 1U9RA 4PMWA 5JVG3 2RBMA 1FNVA 5T1IA 1PXUA 2Q8TA 2G9HD 3V96A 2ZXPA 2EYOA 1RHPA 1ESRA 1JWUD 2AUKA 2HDLA 3URYA 3O13A 1T5XD 2L9HA 4DAVA 3MXUA 3TP5A 2J4XA 5G3LF 1SJHD 5FLXE 3NBHA 1L0YB 5CV4A 2AQ3B 1S5FD 1K8MA 1RD9D 1I50B 3KLSA 5A2QL 2NUCA 2RKSA 1W6KA 1S5BD 2IL8A 5IGCA 1UEAB 3VR2A 2EYLA 3I70A 3MFYA 3C2PA 4WJWA 5EPLA 2XSCA 3NP8A 4IUPA 1ET6A 2RDGA 1ILPA 1PRTF 3KBGA 5C0XH 1KLUD 4ZUIA 4DXGA 2IX1A 3K5OA 2PMZB 5CV7A 3P7JA 3FVQA 2N88A 1SNOA 1ZKOA 5IGEA 2JA6B 1RF2D 4KD4A 5EJWA 1B2TA 1BF4A 1SMYD 2SDFA 2O4XA 1CA5A 4UAIA 3PIO3 4IUQA 1EOTA 3LWUA 3D6CA 2A74C 3CRKC 4R9WA 5C5LA 5C44B 3PUYA 2JP1A 2HCCA 1PDQA 3NBIA 3HS0C 2LKVA 2NB0A 1PFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENB A;  2F0N A;  3OSO A;  2F0U A;  1EZ6 A;  3QOL A;  4K2L A;  1A3T A;  2EYF A;  4ID6 A;  5NUC A;  3TP8 A;  2F3W A;  5C4H A;  4EQN A;  3OWF A;  4J1M A;  4K5V A;  5IIF A;  2EY1 A;  2EYP A;  3C1F A;  1JOK A;  3NK9 A;  4MIU A;  5I9P A;  3PMF A;  1SNM A;  2WAC A;  5JOB A;  3SK4 A;  4HTH A;  5CC4 A;  5IGG A;  3NQT A;  2M00 A;  4TRD A;  5J1Z A;  1ENC A;  5CR3 A;  1TQO A;  4B9X A;  3EJI A;  4J6H A;  5CV9 A;  3QOJ A;  1SYE A;  4I65 A;  1SYF A;  1EY9 A;  3T16 A;  1STY A;  3TP5 A;  5J22 A;  1SNP A;  2F0J A;  2PYK A;  1IHZ A;  2F0E A;  1STB A;  5IOD A;  1ENA A;  4K6D A;  5CV5 A;  1SYB A;  3MXP A;  5KYI A;  3DHQ A;  1JOQ A;  5F2D A;  4EQP A;  3D8G A;  4YIJ A;  3EVQ A;  5KGU A;  4PNY A;  4ZQ3 A;  4IUN A;  2EYJ A;  4KTA A;  3MEH A;  5CV4 A;  4ME5 A;  5HGT A;  1STN A;  3BDC A;  3P1H A;  4RKL A;  4EVO A;  1A2T A;  2F0F A;  2HQE A;  1TT2 A;  5IOC A;  4PMB A;  1SND A;  5HUR A;  5CGK A;  5J39 A;  1SNQ A;  1KAB A;  4WOR A;  3BDL A;  5C6A A;  2F0W A;  3ERQ A;  2NUC A;  2PZU A;  2RKS A;  4NKL A;  1KAA A;  4KV6 A;  4S3S A;  2PZW A;  2F0G A;  1F2M A;  3D4D A;  3OMG A;  4KY6 A;  4ODG A;  4ZUJ A;  2QDB A;  1RKN A;  4LAA A;  4E6I A;  4QF4 A;  3VA5 A;  5I9O A;  5KRU A;  5DAU A;  3TME A;  2F0O A;  1SYD A;  3U9O A;  2PZT A;  5IGC A;  2OXP A;  4K2K A;  1NSN S;  2EYL A;  3SR1 A;  5KYL A;  1F2Z A;  3ITP A;  4F8M A;  4H7B A;  4K5X A;  2F0T A;  1KDB A;  5CV8 A;  1KDC A;  5JAV A;  4QB4 A;  3NP8 A;  5C3W A;  3S9W A;  2EY2 A;  5C4Z A;  2F3V A;  4KJO A;  2OEO A;  5C5M A;  2SNM A;  3SK8 A;  3D4W A;  3TP6 A;  3H6M A;  2EYM A;  5KIX A;  1EYA A;  5M9O A;  4K8J A;  3ERO A;  2F0V A;  4G57 A;  2OF1 A;  4R8N A;  4ZUI A;  3TP7 A;  1JOO A;  2F0K A;  3SHL A;  4HMI A;  5CV7 A;  1EYD A;  1EQV A;  2PW5 A;  4N9T A;  3NHH A;  4NDX A;  3OMC A;  4OL7 A;  4IZ8 A;  1AEX A;  1JOR A;  2RDF A;  1EY5 A;  2SOB A;  4WRD A;  1STH A;  1SYC A;  5I6W A;  1EZ8 A;  2F0H A;  5CV6 A;  1KDA A;  1EY8 A;  1SNO A;  3HEJ A;  1EY6 A;  2PQE A;  1A3U A;  4K5W A;  5IGF A;  1II3 A;  1EY7 A;  4KY5 A;  5IGE A;  2KQ3 A;  2EY6 A;  1EY0 A;  2PW7 A;  3HZX A;  4B9W A;  3LX0 A;  1EY4 A;  4F7X A;  1SNC A;  5C3X A;  1STG A;  1TR5 A;  2F0Q A;  3DMU A;  3P75 A;  4KD4 A;  3SK6 A;  4K8I A;  4PMC A;  4RKB A;  2O4X A;  2F0M A;  4DFA A;  1NUC A;  3NXW A;  4NMZ A;  5ISR A;  2EYH A;  4DF7 A;  2EY5 A;  3MVV A;  2F0L A;  3NUC A;  2EXZ A;  3MZ5 A;  5E1F A;  4NP5 A;  5I6Y A;  5DEH A;  3D6C A;  4IAL A;  3E5S A;  3RUZ A;  4KHV A;  1STA A;  5EGT A;  3SXH A;  1U9R A;  5EKL A;  1A3V A;  2F0D A;  4KY7 A;  4HMJ A;  1A2U A;  4QMG A;  4KJN A;  2RBM A;  5C5L A;  3SK5 A;  2SNS A;  4EQO A;  5E3F A;  5EKK A;  5IGD A;  5K5P A;  4DGZ A;  2F0S A;  5KEE A;  3QB3 A;  4N9P A;  2KHS A;  3C1E A;  1F2Y A;  5IGB A;  4DU9 A;  4K14 A;  1EYC A;  2LKV A;  4KD3 A;  2F0P A;  3V2T A;  2EYO A;  3R3O A;  1SYG A;  3T13 A;  3MHB A;  2F0I A; 
#chains in the Genus database with same CATH topology
 2VW9 A;  5JVH 3;  1DXM A;  4EQN A;  5IP9 H;  2CCZ A;  3NK9 A;  3PMF A;  2WAC A;  5DLQ E;  2Z6K C;  2IT1 A;  3M9B A;  3SK4 A;  2ZT9 C;  5IT9 c;  2EOT A;  5CC4 A;  2A73 B;  5ELO A;  5FO8 B;  1QJO A;  2M00 A;  5IT9 E;  4PZ6 A;  5EAY A;  3FMC A;  5M5W B;  1HNW Q;  2R92 H;  1WTH A;  3QO2 A;  1U4L A;  3G6E A;  3PV0 A;  1B3A A;  4IUT A;  4I65 A;  5J22 A;  5JPN C;  5IYC G;  3I4N G;  3RMH A;  2GN5 A;  2K5V A;  1IBL L;  2JA7 B;  3PO3 B;  1UE7 A;  1TWC H;  2NN6 I;  3PF5 A;  3E9I A;  4A3G B;  1ROD A;  2UUB L;  1LTR D;  4FXG C;  1VQD A;  2BA0 A;  4BBS G;  3P1H A;  2E2J H;  4ZKC B;  1O7L A;  3E0E A;  1JWS D;  3ERQ A;  1BXT A;  1VQ9 A;  1CQF A;  3A5Z B;  2L15 A;  2P5Z X;  1CZG A;  3T1H L;  2OXP A;  1F2Z A;  2BH8 A;  3FPU B;  3UDI A;  4WFN 3;  3S16 H;  2EY2 A;  4R4Q A;  3TZD A;  2K52 A;  4ZKB B;  2WAQ B;  1LT6 D;  2UXD L;  1HZA A;  2UUA Q;  4A3L H;  3H09 A;  2A68 C;  2F0V A;  3MTS A;  4J15 A;  4BY7 H;  1JOR A;  2Z4H A;  2Z1C A;  1G6Z A;  3H94 A;  2B2W C;  4DR2 L;  4GLX A;  1EY8 A;  1SLJ A;  4P72 A;  4RH6 A;  4K5W A;  1X6O A;  1XTC D;  3V05 A;  4KY5 A;  4LFC Q;  3OHX C;  4OO1 H;  4YCW A;  2CH4 A;  1JC7 A;  1XYI A;  2EZV A;  1VQA A;  3GTP H;  1LTA D;  1RL2 A;  4A3E B;  2BE5 D;  3Q23 A;  4NXN L;  4TKO B;  2WIN B;  1Y8O B;  5D3D A;  2EPB A;  1XMQ Q;  2CH4 W;  4DK1 A;  1SN8 A;  1O7Z A;  4DGZ A;  3QB3 A;  4N9P A;  1KNA A;  5FLM G;  1X56 A;  3C1E A;  4DA2 A;  1LT5 D;  2QDL A;  2BA1 A;  3CPF A;  1TWC B;  3R3O A;  2F0I A;  1BCP B;  1A3T A;  4ID6 A;  4A3B G;  2F3W A;  3HOX B;  2IHE A;  1F9P A;  2WB1 E;  1WTX A;  3RLN A;  4CDF C;  2NTT A;  4DV0 Q;  4LUZ A;  4RFB A;  3DWP A;  1Q1E A;  3DEO A;  3CCJ A;  4CHT B;  4TRD A;  1N34 Q;  3FPP A;  3TZU A;  4A3F H;  4J6H A;  5FOB B;  4HR7 B;  3I2Z A;  1S3O A;  3G48 A;  4HIM A;  1BKB A;  3S16 B;  1ICW A;  1GO3 E;  1PLF A;  2C35 B;  3CCU A;  2VS1 A;  3H91 A;  3M4Y A;  4CJ0 B;  3A8J E;  3T51 B;  5IOC A;  3BDO A;  2QIL A;  3GDE A;  5C6A A;  1OXS C;  2KCC A;  1KAA A;  2MPM A;  2EE1 A;  4MNO A;  1KD1 C;  4AYB G;  4DKA C;  1KRT A;  2VQF L;  4K2K A;  1HRJ A;  2XRS D;  3KDF A;  2B2T C;  1CUK A;  3GQB A;  1V1P B;  3VR4 A;  1BCP C;  5CV8 A;  4X64 L;  1W2B A;  3GTP B;  4K0K Q;  2UXB L;  4FF4 A;  2XWJ B;  1BQQ T;  4DR5 Q;  4YHH L;  3TP6 A;  1EYA A;  1GKH A;  1QWY A;  4K8J A;  1VQ6 A;  3HOW G;  3KF8 A;  3A54 A;  4RA8 A;  3NHH A;  1VQM A;  1F9Q A;  1IZ6 A;  2VUM B;  1E2V A;  1PFB A;  5JEA G;  4Y7N H;  1O7Y A;  1TWA B;  3S2H B;  1PFM A;  1D6E C;  1IKL A;  1UE1 A;  3N6R A;  2NVY B;  4O2D A;  2GA4 B;  3LX0 A;  4QY7 A;  3T1Y L;  3A0J A;  4K8I A;  4B3S L;  3NXW A;  3IFD A;  2QKI C;  4LK1 C;  2EY5 A;  5BN4 A;  2F0L A;  1X65 A;  4C3I B;  5DEH A;  1WD1 A;  1M90 C;  1PH4 A;  2JQO A;  1J8I A;  2HHH L;  1I94 L;  1SSO A;  4KJN A;  3T1H Q;  5EKK A;  4CBV A;  3NPP A;  1XMO L;  1VQP A;  4JI5 L;  1FD7 D;  2E5L Q;  2ES2 A;  1WVL A;  3RN2 A;  2YU9 H;  3U4Z A;  1I4P A;  2M9V A;  2X69 A;  3V2T A;  5AJ3 Q;  1MJE A;  1X3E A;  1HPC A;  1LAB A;  4JI1 L;  4HJ7 A;  1XNQ L;  4AYB B;  5BR8 L;  1QIL A;  1WCM H;  3GTL B;  3RR5 A;  2AQ1 B;  5M3M H;  1C9O A;  4ZCK A;  4IFD H;  3PUW A;  1O78 A;  4DV6 Q;  1XTD A;  3I90 A;  3HKZ B;  2PCF B;  3QOJ A;  5IYB H;  4A3D G;  3K0X A;  1SRO A;  1ILQ A;  3HOZ G;  3TBI B;  1X3P A;  4I7A A;  1QUQ B;  3KLS X;  1HTP A;  3EVQ A;  3DWQ A;  1FNU A;  1RJT A;  2PQA A;  1CKO A;  1VCI A;  4A3M H;  1O7I A;  3QJY A;  1KAB A;  3AU7 A;  2I46 A;  3PUZ A;  4LJZ C;  4PG3 A;  4NKL A;  3BYT B;  5LL6 S;  1Q46 A;  3ND8 A;  4OEL B;  1RKN A;  4FVM A;  5JEA J;  3VA5 A;  1Q86 C;  1G2T A;  1PZI D;  1HZ9 A;  1XPR A;  3I4M H;  3BJU A;  2E2I B;  4DV2 L;  1VQ7 A;  2D62 A;  2WV6 D;  1XPU A;  4IOC A;  1H9K A;  1E7Z A;  5C5M A;  1RTN A;  2VZA A;  1VQG A;  4KI0 A;  1Q8I A;  1DJR D;  4R8N A;  1QB5 D;  3SHL A;  3GTJ B;  3HOY H;  4QGU A;  3B6Y A;  2A19 A;  1EY5 A;  3K7A B;  5ELB A;  2IJ0 A;  4CJ1 B;  1F9R A;  1XX8 A;  1EZ8 A;  3NQI A;  1KL9 A;  4BA1 I;  4IO9 A;  3AB9 A;  4A93 G;  2EQS A;  2NVQ B;  1PZJ D;  1ZYR D;  2JA8 B;  1SNC A;  1PTO F;  1STG A;  2F0Q A;  3HG9 A;  1BBX C;  1I4Q A;  4M1U B;  4PMC A;  2K1B A;  1Y1W G;  3Q0A A;  2XWB B;  2EYH A;  2B8F A;  3MVV A;  1VQH A;  2JA5 H;  2K05 A;  1X55 A;  3ND9 A;  3GP7 A;  3HOZ B;  3J7A V;  3E5S A;  2Q2T A;  2N8N A;  2MFI A;  1I4H A;  4POG A;  4AYB E;  2VQF Q;  4A3J H;  1OXV A;  4X64 Q;  4JI6 L;  2ZM6 L;  4YHH Q;  4LF6 Q;  3T13 A;  5JOB A;  4DR7 L;  1Y1V H;  1EZ6 A;  3S15 B;  3CC2 A;  3NSW A;  1Y8N B;  4YWL A;  4BY1 H;  2I0Q A;  3DEP A;  2EYP A;  2L0C A;  3R2T A;  1PTO D;  1H95 A;  1WOC A;  3OIP A;  1CT1 D;  4HAE A;  5LMU L;  1JB3 A;  1Y8P B;  3S1R H;  4C3J G;  3VYT A;  4K6D A;  5GAG C;  3TSS A;  1SYB A;  1K8A C;  1HR0 W;  3F2D A;  5F2D A;  2RHS B;  3D8G A;  3T53 B;  3S1Q H;  2F4V Q;  2I5L X;  1LTI D;  2HHH Q;  1K8G A;  1A8V A;  1WTR A;  2RQX A;  1MIU A;  5IY0 A;  4WOR A;  2CW0 D;  4KMU C;  4R4C A;  1XMO Q;  4JI5 Q;  1UE5 A;  2CHB D;  2Z6K A;  4KY6 A;  3PIO A;  1VQB A;  1YJW A;  4E6I A;  1ML0 D;  1CFM A;  4LF4 L;  3STB D;  3K5M A;  3SR1 A;  3EIV A;  1B1Z A;  2E8G A;  4H7B A;  4K6L A;  4DUY Q;  3SEB A;  1XNQ Q;  2EJM A;  3M3Y H;  3PO2 H;  5C3W A;  2SNM A;  2YTX A;  3BU2 A;  1YIJ A;  1JOO A;  2F0K A;  2R6G A;  4DK0 A;  1B4O A;  3OMC A;  3AYH B;  1QOH A;  4HJ8 A;  5CV6 A;  4LF8 Q;  5IGF A;  1PH8 A;  1A6X A;  2E2H B;  1TKW B;  1U4R A;  5CMD A;  1DOL A;  3DMU A;  3P75 A;  1HXY D;  2RSO A;  4QUF A;  1DOM A;  2ATW A;  4JVZ A;  3K7U C;  1U4P A;  1D8L A;  2DY8 A;  4JK1 C;  1RTO A;  3CP0 A;  1HJP A;  2JEA I;  3QG1 A;  4LW1 A;  4KY7 A;  2HQL A;  1KHI A;  2B2Y A;  3IFT A;  1H9M A;  3CKI B;  5E3F A;  4OX9 L;  5KNB A;  1MHW C;  1Y14 B;  2R7Z B;  1B8A A;  1I4R A;  2B2W A;  4BXX H;  5IGB A;  1N36 L;  2FFK B;  2QGQ A;  4JYA L;  1DYQ A;  3S1Q B;  5HGQ A;  5E4W C;  3QOL A;  3H3V H;  2EYF A;  2K4K A;  4UP9 A;  2E75 C;  4K5V A;  4XQJ A;  3FRP B;  3F2U A;  3Q8D A;  3Q22 A;  4DR3 L;  1KQS A;  4AQY L;  1TS4 A;  4P73 A;  4GOP A;  4JI0 L;  2MHV A;  3EN2 A;  3NTI A;  1SYE A;  2RCN A;  3T16 A;  4B3T Q;  2LFN A;  3M3Y B;  5EBC A;  2WKD A;  3K5N A;  2R7D A;  1WTO A;  1V43 A;  3BVM A;  3UI2 A;  3WOE A;  4QIW E;  2UU9 L;  4DV4 L;  5HGT A;  1Z7T A;  3PUV A;  3GTK H;  1Q1B A;  2Q2H A;  3LNN A;  1SBB B;  1R9T H;  1IBK Q;  1TT2 A;  1XJV A;  5HUR A;  5CGK A;  1EYG A;  3C3L A;  2MJ8 A;  1I6H H;  5KND A;  3PUX A;  2PZU A;  1I4G A;  4S3S A;  2B39 A;  4F88 A;  4R8I A;  2QA4 A;  2JA6 G;  3T56 B;  4JI4 L;  3FDT A;  5I9O A;  4QF4 A;  1K83 B;  4A75 A;  3H0G H;  1D2B A;  2IW3 A;  4DR7 Q;  5C0X I;  2NVX H;  5JJK A;  4RCN A;  4C56 C;  4B08 A;  3CCS A;  2WFW A;  4JI8 L;  3EFX D;  2PI2 A;  5FO7 B;  4KJO A;  5ELC A;  3S1N B;  4PZ7 A;  1L0W A;  1F77 A;  4BWG B;  1LTS D;  3J80 L;  2PW5 A;  1VQE A;  2EVB A;  4OL7 A;  3I56 A;  1WTV A;  1LTB D;  5LMU Q;  2DJF C;  1FGU A;  1PVO A;  2HIX A;  4NW2 A;  4KN7 C;  5CBE E;  4ME3 A;  1V9P A;  4X3T A;  3CD6 A;  5KNC A;  2L5T A;  1EY0 A;  2R7Z G;  4X3K A;  4POF A;  2B2T A;  2MGS A;  2OCE A;  2CKZ B;  2L11 A;  1Q3L A;  1DCZ A;  3M4O H;  1U5K A;  1WTQ A;  3JAM c;  4EQ5 A;  2ZXR A;  5FO9 B;  4IQZ A;  1OXX K;  1PYS B;  5TSS A;  3K58 A;  2B2V C;  1RIP A;  4FF1 A;  1YBY A;  2R93 H;  4C2M B;  1KIX A;  1NR2 A;  2JA7 G;  3KLW A;  3ULL A;  1RDP D;  3PO3 G;  5C0X G;  1PH3 A;  4A3G G;  3R8B A;  1Q81 C;  3S2D B;  2E76 C;  5IT9 L;  4QL5 A;  4KK7 A;  3H15 A;  3I72 A;  3A5U A;  4ZRZ A;  1EIY B;  3E6Z X;  3J80 E;  2X6L A;  5NUC A;  4NXM Q;  5LMN L;  4LF5 Q;  5DM6 3;  2VB2 X;  4XYQ A;  1CKN B;  1IYU A;  4JI2 L;  2A68 D;  4R4O A;  4BBR H;  4DPG A;  1U0L A;  2B63 B;  1L2F A;  3K0Y A;  5J1Z A;  1KXL A;  1Q8K A;  4B9X A;  2WAQ G;  4CKC A;  1KTK A;  3S1M B;  3S17 H;  1STY A;  5C4J H;  3DLL A;  1SFO H;  1V1P A;  3DHQ A;  4APV A;  1OTC A;  4DN4 M;  4PNY A;  4IPD A;  1AZQ A;  5IWA L;  3OTO L;  4JOI C;  1FR3 A;  4ME5 A;  5C3E H;  1STN A;  2QF7 A;  4RKL A;  4RGN A;  1EL0 A;  5IYD H;  4ALP A;  2OQ0 A;  5M3F G;  3HOV B;  3OMG A;  4OHJ A;  2NZO A;  1N36 Q;  1KRS A;  2RA4 A;  2CQO A;  4A3E G;  4RHS A;  1JJG A;  1H9J A;  4QCL A;  3GTQ H;  4IN3 A;  4G7H C;  2R92 G;  4JPB W;  1ASZ A;  2IX0 A;  3H6M A;  3M4O B;  4Q5V A;  4DV5 Q;  4DR3 Q;  4HCS A;  3GO5 A;  4BS9 A;  5IYC H;  3I4N H;  2B29 A;  4JI0 Q;  3CHB D;  1EQV A;  1G29 1;  4GOP B;  2N55 A;  3LGJ A;  4L8J A;  2SOB A;  4WRD A;  4BBS H;  4P75 A;  3HOX G;  3WWV A;  1DM0 B;  1PRT B;  3G7L A;  1A3U A;  1GD7 A;  3HOU H;  1H9S A;  2PMZ E;  1VQL A;  1P8L A;  3J81 c;  2KQ3 A;  4L5T A;  4QUC A;  3J81 E;  3UDF A;  3CMA A;  2UU9 Q;  3TDQ A;  4DV4 Q;  2MO0 A;  3CQZ B;  3VDY A;  3ONA B;  3RN5 A;  5E4X A;  2KVM A;  3C46 A;  2F0M A;  4RAU C;  4NMZ A;  4G7Z C;  3CU7 A;  1QVG A;  4NP5 A;  5GAD C;  4JI4 Q;  2B2Y C;  3HFZ B;  5C4X B;  3GTG H;  2ZTD A;  5K36 H;  2ZJR A;  4KHP L;  2JEB I;  4DV7 L;  1PYB A;  3FKI H;  4DUZ L;  1MBY A;  1IYV A;  3L0O A;  2FMM A;  4P71 A;  1UUP A;  5C4J B;  1TII D;  4WJ4 A;  4LFB L;  1F2Y A;  4K14 A;  5M3F B;  3S14 H;  2F0P A;  3CCR A;  1DD2 A;  1BCP D;  4B3M Q;  3MHB A;  5L37 A;  1QUQ A;  1IBM L;  1K3R A;  3J7Z C;  5C3E B;  3K6O A;  4J1M A;  5KYL A;  2D2C C;  4HJ9 A;  4JI7 L;  5FKA C;  4GN3 B;  1J5E L;  2KEE A;  3KF6 B;  2NN6 H;  4GOP C;  2R92 B;  1LTL A;  3IL8 A;  4DR6 Q;  4XQN A;  1PRT C;  5CV9 A;  1S4Z A;  2HIV A;  4DR4 L;  3CF5 A;  4LF9 Q;  4R4T A;  3FHW A;  5IOD A;  4ABN A;  3BVG A;  2I5H A;  2VUM G;  1C0A A;  4IUN A;  2EYJ A;  5FLM H;  2E2J B;  1M4V A;  2HQE A;  4LMQ D;  4PMB A;  2KHI A;  1D7Q A;  3AFP A;  2XNA C;  4XIG S;  1CZW A;  3K5L A;  4KV6 A;  5COY A;  1ESF A;  1F2M A;  2F0G A;  4A3B H;  1BUV T;  5EQ0 A;  2BOS A;  4ODG A;  3E3X A;  1YJN A;  3HOU B;  3TME A;  1SYD A;  1NJI C;  4K5X A;  3HGB A;  2PPB C;  1VQK A;  2AMC B;  4C3I G;  2Y0S B;  2F03 A;  2EJG C;  4CKE A;  2RF4 A;  3LWE A;  3NTH A;  4A3F G;  2EYM A;  2XTI A;  5I2Y A;  4WJ3 M;  1CI3 M;  1LTT D;  2UXC Q;  4YY3 Q;  1HNX L;  2F3I A;  1Q82 C;  3DXJ C;  5EPJ A;  4BY7 B;  2WAQ E;  3W1G A;  3NE5 B;  1XXG A;  1D1K A;  3CME A;  4FNF A;  3IKJ A;  1C48 A;  1ASY A;  5IP7 H;  1QZH A;  1BVS A;  4A3K H;  5IWA Q;  3OTO Q;  4KKU A;  1G51 A;  1YNN D;  4GNX A;  2IPK D;  2NVT H;  1YZ6 A;  1NUC A;  1R4P B;  3HKZ G;  4DK6 C;  5E1F A;  1I3Q H;  1MSG A;  1L0X B;  1YVC A;  1VMC A;  2PI2 E;  2C5C A;  3RUZ A;  1STA A;  1VDZ A;  1TWF H;  1HFN A;  5IGD A;  4GLA C;  3RLF A;  1JJC B;  4YWK A;  2XN9 C;  1STE A;  3Q24 A;  2A6E D;  1LT3 D;  1EWC A;  2VY3 A;  1IBL Q;  3HOW H;  3M4P A;  3VYR A;  4K2L A;  5JEA H;  2UUB Q;  2DUD A;  2EY1 A;  5I9P A;  1BBW A;  5BN5 A;  2K14 A;  2ICE C;  3KK7 A;  2AWN A;  2XRQ D;  4X66 L;  3I4O A;  1GUG A;  1HQM C;  1ENC A;  1WJJ A;  3CC7 A;  4A3F B;  2ASB A;  4A3C G;  1S5E D;  1TQO A;  2KJX A;  2K5Q A;  2K5N A;  1H9S B;  2JA9 A;  1L1O B;  2PYK A;  3I73 A;  2H4O A;  3KUP A;  1ENA A;  1IKM A;  3U58 A;  1TS3 A;  2UXD Q;  1TWG H;  1A15 A;  3U4V A;  4EQP A;  3CCL A;  4RGO S;  4B3R L;  4DV7 Q;  1SNQ A;  3A8I E;  3D4D A;  5COR A;  2JA8 G;  4DR2 Q;  2K32 A;  4LAA A;  5GAH C;  1QNU A;  1WCM G;  2Z4I A;  4AIM A;  1B9M A;  1P16 A;  4A3K B;  4ZAI A;  1KDB A;  2MNA A;  1IBM Q;  4IFD G;  1FYC A;  4GN4 B;  2LY7 A;  5M5X H;  1YNN C;  2O2L D;  1NNX A;  4A3D H;  5AFW A;  4JW0 A;  4NXN Q;  2X6G A;  3K57 A;  4FF2 A;  2KCT A;  1LAC A;  3D0F A;  2AHO B;  4PV1 C;  4N9T A;  3VA7 A;  1SE3 A;  4C3H H;  1Z6H A;  2JE6 I;  4Y7N B;  1PH6 A;  3ULJ A;  4OXP A;  3HEJ A;  2PQE A;  4G4K A;  4A3M G;  2I5M X;  1II3 A;  2A6E C;  3HZX A;  4B9W A;  4F7X A;  4RGT A;  3AFQ A;  1BDO A;  1UEB A;  1ET9 A;  4MN3 A;  1G91 A;  4X3U A;  1SEB D;  2K7V A;  2VL6 A;  4RMF A;  5ELN A;  2E74 C;  4DAP A;  2F0D A;  1TWH H;  3D4R A;  4DNI A;  3SE0 A;  4PZ8 A;  3MFG A;  2YU9 B;  4X65 L;  4KD3 A;  1EUJ A;  1SYG A;  1WTP A;  2F0U A;  1XNR L;  3K8A A;  5H1S E;  2R7F A;  2RHQ B;  4IPC A;  1WCM B;  1HNX Q;  3RZO H;  2IY5 B;  4A93 H;  4L6T B;  5M3M B;  1YHQ A;  1D5X C;  3RZD H;  1GHK A;  5DM7 3;  1GUT A;  4GZY C;  3K81 C;  1Y1W H;  2VQE L;  1R4Q B;  2B2V A;  1Q12 A;  4OIJ A;  1PTO H;  4N8X 1;  3KLR A;  4GKK L;  1SNP A;  2NTS A;  2UXB Q;  4NPS A;  2F0E A;  1GVP A;  5CV5 A;  1NCV A;  4OEM B;  4GNX B;  2OT2 A;  3HKZ E;  3BYY B;  4DV3 L;  4KTA A;  1ZXT A;  4A3M B;  2TMP A;  4N8F A;  3D3R A;  2EJF C;  2PZW A;  1AN8 A;  3BG3 A;  4ZUJ A;  1XPO A;  1K28 A;  2JN4 A;  2F0O A;  3I4M B;  1FVI A;  3T1Y Q;  1IL8 A;  2F0T A;  1SRU A;  1KDC A;  4DV1 L;  5JAV A;  4UPA A;  3S9W A;  3W3A A;  4B3S Q;  1GXD C;  4FP5 D;  2K5H A;  2LS0 1;  4C3J H;  3GTO H;  4FYD A;  1NMG A;  4G57 A;  4CDE C;  1I94 Q;  4HJ5 A;  2WP8 J;  1CKM A;  4JOI A;  3HOY B;  2HUG A;  4IZ8 A;  4TQU S;  2RDF A;  1N32 L;  3GTM H;  2ZTE A;  2F0H A;  3E0J A;  1EY6 A;  2O5J C;  3SVM A;  2NZH A;  2PW7 A;  4GNX C;  5D14 A;  5FJ8 G;  4JI1 Q;  1KLG D;  5BR8 Q;  4IOA A;  3I8Z A;  3MXN B;  4RHR A;  2JA5 B;  4A3I H;  2EXZ A;  3M4Q A;  3EQL C;  1D5Z C;  1AP0 A;  1CKN A;  4ZLT F;  4Z9C B;  4C1N I;  4V0B A;  3PO2 G;  1A3V A;  1WD0 A;  2MQH A;  2KEN A;  2DJG C;  5K5P A;  3I91 A;  1PTO B;  2O5I C;  3KYH C;  4A3J B;  3SGI A;  1F2L A;  1C4Q A;  3MWY W;  2EIF A;  4IUV A;  1Y1V B;  3TP8 A;  1B53 A;  4BY1 B;  1DON A;  3OWF A;  4JG2 A;  3GV6 A;  4DAY B;  3BS1 A;  1K73 C;  3J80 i;  1PFS A;  4UY8 C;  4QJF A;  1MKH A;  1G2S A;  2CFM A;  4EX5 A;  2B2U A;  3QWN A;  1A63 A;  3TRE A;  1DZ1 A;  2UUC L;  4DR1 L;  2RSN A;  1QVC A;  3J7A 5;  3S1R B;  4DV2 Q;  1AE2 A;  4FXK C;  4XT1 B;  2IHF A;  2BDN A;  1GUN A;  2KED A;  1AZP A;  1HA5 A;  3U9S A;  1JMC A;  3GTO B;  2OQK A;  1V8Q A;  1B44 D;  4JV5 L;  1A2T A;  4BXX G;  1I50 H;  2Z9H A;  3M7G A;  1S72 A;  1E3P A;  2K75 A;  1IW7 C;  2YYZ A;  2QDB A;  4IUU A;  1HNW L;  2I07 B;  4KKT A;  1K9M C;  1JR0 D;  1IL2 A;  2KOL A;  1PZK D;  5T1G A;  4F8M A;  1XNR Q;  1A0I A;  1NMF A;  3PO2 B;  2K5D A;  1E1O A;  3AEV A;  4R1J A;  1VQF A;  4L5S A;  1EQT A;  4A3I B;  3L7Z C;  2KA7 A;  4X6A H;  3NTK A;  1FL0 A;  5M9O A;  4KKS A;  1GHJ A;  1GUS A;  3NEL A;  1EIG A;  4XT3 B;  3HP3 A;  4HMI A;  5LL6 X;  3NEM A;  4OON A;  3W5O A;  5A35 A;  1OXT A;  3A55 A;  5JJI A;  4GKK Q;  4JI6 Q;  4UHV A;  2ZM6 Q;  1KDA A;  1CQV A;  3JAM L;  4KLK A;  3Q6S A;  2QEX A;  4DV3 Q;  2B63 G;  1B3Q A;  2A69 D;  1S40 A;  4UP7 A;  1O80 A;  1HA6 A;  4UDU C;  3J81 i;  4MTN A;  1MD2 D;  1JIC A;  1WI5 A;  5ISR A;  2TSS A;  2G9D A;  2IX3 A;  1PHJ A;  2UUA L;  3VYU A;  3BZD B;  3KF6 A;  1YJ9 A;  3W2D A;  4UP8 A;  2BDO A;  2FHT A;  3NWT A;  5KEE A;  5C44 H;  1LTG D;  5GRO A;  2DN8 A;  4GS3 A;  5FLX c;  1JT8 A;  1EEI D;  4CDD C;  1EYC A;  1KAW A;  1PH2 A;  4IJH A;  1NE3 A;  5D3I B;  3MAQ A;  3HOV G;  1AE3 A;  3CXC A;  1K0S A;  1MGS A;  1YNJ C;  2KCN A;  1BO0 A;  1G8Z D;  3P20 A;  2F52 A;  4ZK9 B;  1QVF A;  1T9H A;  3JAM E;  2R7Z H;  3UDX A;  2LSS A;  2LXJ A;  5M5W H;  4FO2 A;  2CWA A;  1C8C A;  5CR3 A;  4H02 A;  4LF4 Q;  3TRZ A;  1XMQ L;  3VR5 A;  2KCM A;  4H13 C;  2KHJ A;  1EU3 A;  2JSO A;  2LXK A;  3MXP A;  4HN7 A;  1JOQ A;  3UE1 A;  2KBN A;  3PO3 H;  4ZQ3 A;  4A3G H;  2G5D A;  1HR0 L;  3GTK B;  1R9T B;  4MTK A;  3BDC A;  4XDX A;  4Q0F A;  1I6H B;  3N52 A;  2DNE A;  3MC0 B;  5G3L D;  2F0W A;  3DM3 A;  1CHP D;  4KN4 C;  3H0G B;  1N34 L;  4P2C B;  1AW7 A;  3A7L A;  2PZT A;  5JPM C;  2NVX B;  1NSN S;  1E1T A;  1EIH A;  3CC4 A;  3H3V C;  4OWT B;  1JWM D;  1GUW A;  2D5D A;  5A2Q E;  4QB4 A;  5C4X G;  2A69 C;  2R61 A;  2D0P A;  4V19 0;  4XYO A;  1I4X A;  3KJO A;  3TP7 A;  4HIK A;  4U67 3;  2CWP A;  1AFP A;  4HSV A;  3J81 L;  4LUV A;  2AQ2 B;  4FF3 A;  1GJX A;  1C7Y A;  2UUC Q;  4OX9 Q;  4NDX A;  3FP9 A;  3DWA A;  2RVL A;  3U50 C;  3K59 A;  4J8Q A;  1PRT D;  1TS2 A;  3CCE A;  1BOS A;  3CW2 C;  5IP9 G;  4HED A;  5C3E G;  3T4A C;  1NBW A;  4XXE A;  4JYA Q;  2F1M A;  4H44 C;  2IWH A;  1VQ4 A;  4JV5 Q;  4K0K L;  4RKB A;  1VQI A;  1WYD A;  2DY7 A;  4DR5 L;  5I2X A;  4A3E H;  1CTM A;  3MZ5 A;  4AQY Q;  1TU2 B;  4FDB A;  1BCP F;  2K28 A;  5ELE A;  5BN3 A;  3WDN A;  2R93 B;  1X3G A;  4HMJ A;  5C3X A;  3IRB A;  2OWO A;  1LLR D;  4OO1 I;  4HID A;  2ZXO A;  1VF7 A;  4JBW A;  2WB1 B;  5C0X J;  1L1O A;  2B8G A;  1GM5 A;  4JBM A;  2ENB A;  4XQQ A;  2M2L A;  1S5C D;  4EGV A;  3KBX A;  5C4H A;  4OWW B;  3X3N A;  1N33 L;  4H0L C;  3HOX H;  4C1N K;  1EFW A;  1JE5 A;  1HTL D;  2B2U C;  4CGY B;  4BBR B;  3NEN A;  1X3Q A;  4PQX A;  3HOU G;  1N8R C;  3TS2 A;  2JJQ A;  3I4L A;  1JQY D;  3NQT A;  3R2I A;  3A74 A;  1H9R A;  2MP1 A;  3OOC A;  2Y0S G;  1VQC A;  3S17 B;  1SYF A;  3OW7 A;  4A3L G;  1HQR D;  2E5L L;  2VXW A;  4JI8 Q;  1IHZ A;  2C9O A;  1SFO B;  5K36 G;  4CKB A;  2KEC A;  1SMY C;  4YIJ A;  3FKI G;  5AJ3 L;  5KGU A;  4BY7 G;  1E2Z A;  2NZ1 D;  2PNH A;  4DNT B;  2Q2I A;  1SND A;  1EIF A;  5DNF A;  2EXD A;  2J7Z A;  4OO1 G;  3CCQ A;  3MA2 B;  4DV6 L;  4U68 A;  1SAP A;  2A6H D;  3G71 A;  1PH1 A;  1DGS A;  1B7Y B;  1YHA A;  2A5H A;  2NN6 G;  2YTV A;  3NBH B;  4ULL A;  3GTQ B;  4JI3 L;  3OIQ A;  1GUO A;  1EEF D;  4ILW A;  1OO9 B;  2JXM B;  4G7O C;  1QE6 A;  2K5W A;  3I4N B;  3ERO A;  1NR4 A;  2OF1 A;  2K04 A;  2MO1 A;  2V1C C;  1EYD A;  2ZTC A;  5JJZ A;  1AEX A;  1PMR A;  3ZJY C;  2VUM H;  1I6V C;  4P74 A;  1SYC A;  4BBS B;  1TWA H;  4BA2 I;  3S2H H;  2HT1 A;  5CYU A;  4KHZ A;  3VR6 A;  2NVY H;  1EY4 A;  1HR0 Q;  1X9N A;  3SK6 A;  5LMN Q;  3VYS A;  1EU4 A;  4JI2 Q;  4M8A A;  5I6Y A;  5M5Y H;  4C3I H;  1JE4 A;  5FK9 C;  3GTG B;  3FKI B;  1PH9 A;  4EQO A;  2SNS A;  3I55 A;  3EA6 A;  3PQI A;  2F0S A;  2QW7 A;  2KHS A;  4L5Q A;  3RNU A;  1U4M A;  2K33 A;  4RGM A;  3S14 B;  1TVX A;  3PIP 3;  3TS0 A;  3OSO A;  1CHQ D;  1E22 A;  2CQA A;  3OPO A;  2BH2 A;  3C1F A;  4HSP A;  5IP7 G;  3GTL H;  2SEB D;  3CPW A;  1ZEQ X;  4A3K G;  1PYW D;  1MJC A;  1K8O A;  2LMC B;  1ICF B;  1LV9 A;  2A6H C;  1EY9 A;  1HZC A;  1SE2 A;  1KNE A;  1B50 A;  2Z6B A;  1STB A;  2VNU D;  1QNK A;  5KYI A;  3GV3 A;  3SDZ A;  1RCV D;  1VQ5 A;  4LF6 L;  4IFD I;  3MEH A;  1FJG L;  1HFG A;  2EDG A;  2BE5 C;  5JJL A;  2K6A A;  4A3B B;  3UDG A;  1JB7 A;  2A8V A;  5KRU A;  3AQQ A;  3NWS A;  1DOK A;  3WOF A;  5GAE C;  1CK1 A;  4HCE A;  2E2I H;  1UAP A;  1N33 Q;  1HNZ L;  4RCO A;  4CDC C;  2F3V A;  1LM0 A;  4A3C H;  5ELF A;  4O0A A;  1QZG A;  5KIX A;  1Z47 A;  2F4V L;  5CBA E;  3MXN A;  2A1A A;  5M5Y B;  1D1I A;  3VR3 A;  1CSQ A;  1EQQ A;  1W6J A;  4KHP Q;  2K03 A;  1PV4 A;  2Y0S E;  2L4N A;  3GTJ H;  3R93 A;  4DUZ Q;  1HUM A;  5EPK A;  3K7A H;  1STH A;  4LFB Q;  3L3O C;  1A62 A;  1G6P A;  3FEW X;  5IE8 A;  4LNQ A;  1EY7 A;  3CAM A;  1J9O A;  1X32 A;  5M3M G;  2YTY A;  4YCU A;  2NVQ H;  2MUY A;  4DUY L;  2JA8 H;  1TR5 A;  2NVT B;  1XWE A;  2HDM A;  4LWC A;  4JI7 Q;  1BBU A;  1J5E Q;  3A56 A;  1CSP A;  5IYB G;  1I3Q B;  1VMP A;  4DAY A;  3NUC A;  1HCZ A;  1TY2 A;  2L55 A;  3I7F A;  1LT4 D;  4RG1 A;  3HOZ H;  1TWF B;  3SXH A;  3SK5 A;  4QMG A;  2XIW A;  1EFI D;  4YCV A;  1SMX A;  3PGZ A;  4DR4 Q;  2F4I A;  4OIK A;  1L1O C;  3F2B A;  4JBK A;  4JI3 Q;  3HOW B;  4LF8 L;  2WKC A;  2D9U A;  2F0N A;  2N78 A;  4C3H G;  1X3F A;  1OXU A;  3S15 H;  1V1O A;  2HCI A;  1F9S A;  3HRZ C;  4OWX B;  1SNM A;  2BCO A;  3I4M G;  4HTH A;  2ICI A;  4NB3 A;  1VQN A;  1E2W A;  3X3M A;  1J6Q A;  3ZYY X;  1TXY A;  1WTW A;  3BVZ A;  2KUM A;  2F0J A;  4GKJ L;  2HD3 A;  2R3Z A;  1TWG B;  3HOY G;  4O42 A;  4CJ2 C;  3MXG A;  1Q7Y C;  4ZYS A;  4TSS A;  3F2C A;  2F0F A;  3TN2 A;  5J39 A;  5EKI A;  2E2D C;  3RD4 A;  4LF7 L;  2OTJ A;  1VQ8 A;  1SJE D;  2FIN B;  3ULP A;  1NY4 A;  2XVS A;  4QQB X;  2JA5 G;  3ITP A;  2AUJ D;  3PSI A;  1CM9 A;  1N9W A;  4B3T L;  1VF5 C;  2FMC A;  3L2P A;  5M5X B;  1S5D D;  2OEO A;  4IFD J;  1QG7 A;  3SK8 A;  1TS5 A;  3A7A B;  3D4W A;  4A3D B;  4AH6 A;  3F1Z A;  4A3J G;  3L9A X;  3PF4 A;  5EBD A;  1T5E A;  1I5F A;  1IBK L;  4L63 B;  4C3H B;  1K0R A;  1Y1V G;  2YV5 A;  1PH7 A;  1BNZ A;  1BR9 A;  4BY1 G;  1MI2 A;  2J0T D;  2JK8 A;  3KDF B;  4TVA B;  1JCK B;  2ID0 A;  2L12 A;  2ZJQ A;  2NWG A;  2EY6 A;  3G6J B;  2E2H H;  2ZJP A;  3J7Y W;  4X62 L;  1FJG Q;  4FXD A;  3E9H A;  1EOV A;  1FGB D;  4JC0 A;  2PNR C;  4O1N A;  3KF8 B;  4IPG A;  4IAL A;  4KHV A;  4X66 Q;  5EGT A;  1TWH B;  4X3S A;  4DNR B;  3GD7 A;  1A2U A;  5LHY 1;  1IW7 D;  3MEF A;  2DNC A;  4DXF A;  3M85 A;  3CCV A;  1LYL A;  3A8K E;  1LO5 D;  1HUN A;  1TY0 A;  1HNZ Q;  2H1E A;  4DU9 A;  2N3S A;  1SE4 A;  2N49 A;  5EKL A;  1GOZ A;  5DAU A;  5LMN W;  5J3B A;  5C4Z A;  2PO4 A;  3IAY A;  4I7Z C;  2WII B;  3RZO B;  4B3R Q;  5IIF A;  4IJL A;  4A93 B;  4LFA L;  1JOK A;  4MIU A;  3RZD B;  5IGG A;  5FJ8 H;  2FJ2 A;  2RDH A;  1Z9F A;  1Q90 A;  1Y69 U;  1Y1W B;  3QR8 A;  3M7N A;  3JAM i;  1W3S A;  3EJI A;  2L1B A;  4QIW B;  1CA6 A;  3H3V I;  3RLO A;  4A3I G;  2ALY B;  1FNW A;  2V4D A;  1SE8 A;  2GVB A;  1SXT A;  1ZYR C;  5I4D A;  2K50 A;  4IUR A;  1MSH A;  4NXM L;  1M8A A;  4EVO A;  4LF5 L;  2AWO A;  4GN5 A;  3BDL A;  3KJP A;  4R4I A;  3OWE B;  4OGQ C;  1KC8 C;  1HHV A;  3S24 A;  2CVR A;  4DK3 C;  1UE6 A;  1NAP A;  1K83 H;  2QEJ C;  3U9O A;  2Q8R E;  2Q8I B;  1M1K C;  2Z8L A;  1E24 A;  4YWM A;  5ELD A;  4JBJ A;  3TQY A;  1ONL A;  2PQA B;  1YIT A;  1YNJ D;  1V1Q A;  3CRL C;  1ENF A;  4C3J B;  3S1N H;  1SR3 A;  1D5M C;  1EWI A;  3DUZ A;  2NYZ D;  4MHE A;  1EWH A;  2RCF A;  1E0B A;  2GVA A;  3I3C A;  1QCB D;  2JYO A;  1PTO C;  3DM1 A;  3GTM B;  3HKS A;  3EBE A;  5I6W A;  3QIA A;  4GKJ Q;  1UNS A;  4X65 Q;  1SDF A;  4F87 A;  2VB3 X;  2XGT A;  4GLV B;  4Y52 H;  3AMU A;  5D65 A;  1WFQ A;  3J7A F;  4XTC S;  3UE0 A;  3KFU A;  3D31 A;  1B9N A;  4DFA A;  2QCP X;  4DF7 A;  4LF7 Q;  1PA6 A;  5FLX L;  4DV5 L;  2NBF A;  2K01 A;  3D6W A;  2CW0 C;  4RWS C;  1YI2 A;  3ER0 A;  1U9R A;  4PMW A;  5JVG 3;  2VQE Q;  2RBM A;  4DAM A;  4C2M H;  1FNV A;  5T1I A;  3STB C;  1PXU A;  2Q8T A;  2G9H D;  1IXR A;  5HY6 A;  1YEZ A;  2ZXP A;  4MZ9 A;  3V96 A;  3S2D H;  2DGY A;  2EYO A;  1RHP A;  2JA6 H;  4A76 A;  3ERS X;  1ESR A;  1JWU D;  2AUK A;  2HDL A;  3H0G G;  4JCV E;  2B63 H;  1EQR A;  1IYJ B;  3URY A;  2Z0S A;  3O13 A;  1T5X D;  2L9H A;  4DAV A;  3MXU A;  3JC6 6;  3CCM A;  2H5X A;  3S1M H;  3TP5 A;  2J4X A;  4X62 Q;  4DV1 Q;  2B3G A;  5G3L F;  1SJH D;  1PH5 A;  5FLX E;  3NBH A;  1L0Y B;  4B3M L;  4LFC L;  5CV4 A;  2AQ3 B;  3BZK A;  5C44 G;  1S5F D;  2OTL A;  1K8M A;  1RD9 D;  2FXQ A;  1X54 A;  3ICE A;  1I50 B;  3OYY A;  3KLS A;  4IPH A;  1UWV A;  5A2Q L;  1N32 Q;  2NUC A;  4L5R C;  2RKS A;  3HOV H;  1W6K A;  1S5B D;  3K80 C;  4DR6 L;  2IL8 A;  4A4I A;  5IGC A;  1HH2 P;  1HZB A;  1UEA B;  3VR2 A;  2EYL A;  3I70 A;  3MFY A;  3G4S A;  3C2P A;  1AH9 A;  4WJW A;  5GQO A;  5EPL A;  2XSC A;  4HIO A;  3NP8 A;  4LF9 L;  4IUP A;  4LFA Q;  1ET6 A;  2R93 G;  3TEH B;  2RDG A;  2JA7 H;  1ILP A;  1PRT F;  3KBG A;  5C0X H;  3PIP A;  1KLU D;  4ZUI A;  4DXG A;  2IX1 A;  3K5O A;  2PMZ B;  2WB1 G;  5CV7 A;  1VQJ A;  1VQO A;  4DV0 L;  3PCO B;  1VS0 A;  3P7J A;  3FVQ A;  2N88 A;  1SNO A;  1ZKO A;  4BBR G;  5IGE A;  1JJ2 A;  2JA6 B;  3J80 c;  1RF2 D;  3F8T A;  4KD4 A;  5EJW A;  1B2T A;  1BF4 A;  1SMY D;  3CQZ H;  2SDF A;  2O4X A;  3OW2 A;  1CA5 A;  4UAI A;  3PIO 3;  1K3B C;  1YNX A;  1EOT A;  4IUQ A;  3LWU A;  3D6C A;  1B70 B;  2Q2U A;  2A74 C;  1YHB A;  5E7N A;  4HJA A;  3CRK C;  4R9W A;  3W1B A;  2UXC L;  5C4X H;  4YY3 L;  4DR1 Q;  4LUO A;  5C5L A;  5C44 B;  3BZC A;  3PUY A;  2AKW B;  2JP1 A;  1LUZ A;  2HCC A;  1PDQ A;  3NBI A;  3HS0 C;  2LKV A;  3J81 j;  1NTG A;  2D0O A;  5IYD G;  5M3F H;  2NB0 A;  3KOJ A;  1PFN A; 
#chains in the Genus database with same CATH homology
 5JVH 3;  1DXM A;  4EQN A;  3NK9 A;  3PMF A;  2WAC A;  2IT1 A;  3SK4 A;  2R7Z B;  2ZT9 C;  2EOT A;  5CC4 A;  2A73 B;  5FO8 B;  5IT9 E;  1QJO A;  2M00 A;  3FMC A;  5M5W B;  3QO2 A;  1U4L A;  3PV0 A;  1B3A A;  4IUT A;  4I65 A;  5J22 A;  5JPN C;  3RMH A;  2JA7 B;  3PO3 B;  2NN6 I;  4A3G B;  1ROD A;  1LTR D;  4FXG C;  2BA0 A;  3P1H A;  4ZKC B;  1O7L A;  1JWS D;  3ERQ A;  1BXT A;  1CQF A;  1CZG A;  2OXP A;  1F2Z A;  3FPU B;  4WFN 3;  2EY2 A;  3TZD A;  4ZKB B;  2WAQ B;  1LT6 D;  3H09 A;  2A68 C;  2F0V A;  3MTS A;  1JOR A;  2Z4H A;  2Z1C A;  1G6Z A;  3H94 A;  2B2W C;  1EY8 A;  4RH6 A;  4K5W A;  1XTC D;  3V05 A;  4KY5 A;  3OHX C;  4OO1 H;  1JC7 A;  1XYI A;  2EZV A;  1LTA D;  4A3E B;  2BE5 D;  3Q23 A;  4TKO B;  2WIN B;  1Y8O B;  5D3D A;  2EPB A;  4DK1 A;  1O7Z A;  4DGZ A;  3QB3 A;  4N9P A;  1KNA A;  3C1E A;  4DA2 A;  1LT5 D;  2BA1 A;  3R3O A;  1TWC B;  2F0I A;  1BCP B;  1A3T A;  4ID6 A;  2F3W A;  3HOX B;  1F9P A;  1WTX A;  2NTT A;  4RFB A;  3DWP A;  1Q1E A;  3DEO A;  4CHT B;  4TRD A;  3FPP A;  3TZU A;  4J6H A;  5FOB B;  4HR7 B;  3S16 B;  1ICW A;  1PLF A;  3H91 A;  3M4Y A;  4CJ0 B;  3A8J E;  3T51 B;  5IOC A;  3BDO A;  2QIL A;  5C6A A;  1OXS C;  2KCC A;  1KAA A;  2MPM A;  2EE1 A;  1HRJ A;  4K2K A;  2XRS D;  2B2T C;  3GQB A;  1V1P B;  3VR4 A;  1BCP C;  5CV8 A;  3GTP B;  4FF4 A;  2XWJ B;  1BQQ T;  3TP6 A;  1EYA A;  1QWY A;  4K8J A;  3KF8 A;  3A54 A;  4RA8 A;  3NHH A;  2VUM B;  1F9Q A;  1E2V A;  1PFB A;  5JEA G;  1O7Y A;  1TWA B;  3S2H B;  1PFM A;  1D6E C;  1IKL A;  3N6R A;  2NVY B;  2GA4 B;  3LX0 A;  4K8I A;  3NXW A;  3IFD A;  2QKI C;  4LK1 C;  2EY5 A;  5BN4 A;  2F0L A;  4C3I B;  5DEH A;  1WD1 A;  1J8I A;  1SSO A;  4KJN A;  5EKK A;  4CBV A;  3NPP A;  1FD7 D;  1WVL A;  1I4P A;  2M9V A;  2X69 A;  3V2T A;  1HPC A;  1LAB A;  4AYB B;  1QIL A;  3GTL B;  2AQ1 B;  4IFD H;  3PUW A;  1O78 A;  3I90 A;  3HKZ B;  2PCF B;  3QOJ A;  1ILQ A;  3TBI B;  1X3P A;  3KLS X;  1HTP A;  3EVQ A;  3DWQ A;  1FNU A;  1RJT A;  1VCI A;  3QJY A;  1KAB A;  3AU7 A;  2I46 A;  3PUZ A;  4LJZ C;  4NKL A;  3BYT B;  5LL6 S;  3ND8 A;  1RKN A;  4FVM A;  5JEA J;  3VA5 A;  1G2T A;  1PZI D;  2E2I B;  2D62 A;  2WV6 D;  1H9K A;  5C5M A;  1RTN A;  4KI0 A;  1Q8I A;  1DJR D;  4R8N A;  1QB5 D;  3SHL A;  3GTJ B;  5ELB A;  1EY5 A;  3K7A B;  2IJ0 A;  4CJ1 B;  1F9R A;  1XX8 A;  1EZ8 A;  3NQI A;  4BA1 I;  3AB9 A;  2NVQ B;  1PZJ D;  1ZYR D;  2JA8 B;  1SNC A;  1PTO F;  1STG A;  2F0Q A;  3HG9 A;  1BBX C;  1I4Q A;  4M1U B;  4PMC A;  2K1B A;  3Q0A A;  2XWB B;  2EYH A;  2B8F A;  3MVV A;  2K05 A;  3ND9 A;  3GP7 A;  3HOZ B;  3J7A V;  3E5S A;  1I4H A;  1OXV A;  3T13 A;  5JOB A;  1EZ6 A;  3S15 B;  3NSW A;  1Y8N B;  2L0C A;  2EYP A;  3DEP A;  3R2T A;  1PTO D;  3OIP A;  1CT1 D;  4HAE A;  1JB3 A;  1Y8P B;  4C3J G;  3VYT A;  4K6D A;  3TSS A;  1SYB A;  5F2D A;  3D8G A;  3T53 B;  1LTI D;  1WTR A;  2RQX A;  4WOR A;  2CW0 D;  4KMU C;  2CHB D;  4KY6 A;  4E6I A;  1ML0 D;  1CFM A;  3K5M A;  3SR1 A;  1B1Z A;  4H7B A;  4K6L A;  3SEB A;  2EJM A;  5C3W A;  2SNM A;  1JOO A;  2F0K A;  2R6G A;  4DK0 A;  1B4O A;  3OMC A;  1QOH A;  5CV6 A;  5IGF A;  1A6X A;  2E2H B;  1TKW B;  1U4R A;  5CMD A;  1DOL A;  3DMU A;  3P75 A;  1HXY D;  2RSO A;  4QUF A;  1DOM A;  1U4P A;  2DY8 A;  4JK1 C;  1RTO A;  2JEA I;  3QG1 A;  4KY7 A;  2B2Y A;  3IFT A;  1H9M A;  3CKI B;  5E3F A;  5KNB A;  1I4R A;  2B2W A;  5IGB A;  2FFK B;  1DYQ A;  3S1Q B;  5E4W C;  3QOL A;  2EYF A;  2E75 C;  4K5V A;  4XQJ A;  3FRP B;  3F2U A;  3Q22 A;  1TS4 A;  2MHV A;  3NTI A;  1SYE A;  3T16 A;  2LFN A;  3M3Y B;  5EBC A;  2WKD A;  3K5N A;  1WTO A;  1V43 A;  3BVM A;  3UI2 A;  3WOE A;  5HGT A;  1Z7T A;  3PUV A;  1Q1B A;  3LNN A;  1SBB B;  1TT2 A;  5HUR A;  5CGK A;  3C3L A;  2MJ8 A;  5KND A;  3PUX A;  2PZU A;  1I4G A;  4S3S A;  2B39 A;  4F88 A;  4R8I A;  3T56 B;  3FDT A;  5I9O A;  4QF4 A;  1K83 B;  1D2B A;  2IW3 A;  5C0X I;  4RCN A;  4C56 C;  4B08 A;  3EFX D;  5FO7 B;  4KJO A;  5ELC A;  3S1N B;  1F77 A;  4BWG B;  1LTS D;  3J80 L;  2PW5 A;  2EVB A;  4OL7 A;  1WTV A;  1LTB D;  5CBE E;  4NW2 A;  4KN7 C;  4X3T A;  5KNC A;  2L5T A;  1EY0 A;  4X3K A;  2B2T A;  2MGS A;  2L11 A;  1Q3L A;  1DCZ A;  1WTQ A;  2ZXR A;  5FO9 B;  4IQZ A;  1OXX K;  5TSS A;  3K58 A;  2B2V C;  4FF1 A;  4C2M B;  1NR2 A;  1RDP D;  5C0X G;  3R8B A;  3S2D B;  2E76 C;  5IT9 L;  4KK7 A;  3I72 A;  4ZRZ A;  3E6Z X;  3J80 E;  2X6L A;  5NUC A;  5DM6 3;  2VB2 X;  4XYQ A;  1IYU A;  2A68 D;  2B63 B;  3K0Y A;  5J1Z A;  4B9X A;  4CKC A;  1KTK A;  3S1M B;  1STY A;  1V1P A;  3DHQ A;  4DN4 M;  4PNY A;  1AZQ A;  1FR3 A;  4ME5 A;  1STN A;  2QF7 A;  4RKL A;  4RGN A;  1EL0 A;  3HOV B;  3OMG A;  4OHJ A;  2RA4 A;  4RHS A;  1H9J A;  4QCL A;  4IN3 A;  4G7H C;  2IX0 A;  3H6M A;  3M4O B;  4Q5V A;  4HCS A;  3GO5 A;  4BS9 A;  3CHB D;  1EQV A;  1G29 1;  2N55 A;  4L8J A;  2SOB A;  4WRD A;  1DM0 B;  1PRT B;  3G7L A;  1A3U A;  1H9S A;  2KQ3 A;  4QUC A;  3J81 E;  3TDQ A;  3CQZ B;  3ONA B;  5E4X A;  2KVM A;  3C46 A;  2F0M A;  4RAU C;  4NMZ A;  4G7Z C;  3CU7 A;  4NP5 A;  2B2Y C;  5C4X B;  5K36 H;  2JEB I;  1MBY A;  1IYV A;  2FMM A;  1UUP A;  5C4J B;  1TII D;  1F2Y A;  4K14 A;  5M3F B;  1DD2 A;  2F0P A;  1BCP D;  3MHB A;  5C3E B;  3K6O A;  4J1M A;  5KYL A;  2D2C C;  5FKA C;  2KEE A;  2NN6 H;  2R92 B;  3IL8 A;  4XQN A;  1PRT C;  5CV9 A;  1S4Z A;  5IOD A;  4ABN A;  3BVG A;  4IUN A;  2EYJ A;  2E2J B;  1M4V A;  2HQE A;  4LMQ D;  4PMB A;  2XNA C;  4XIG S;  1CZW A;  3K5L A;  4KV6 A;  5COY A;  1ESF A;  1F2M A;  2F0G A;  1BUV T;  5EQ0 A;  2BOS A;  4ODG A;  3HOU B;  3TME A;  1SYD A;  4K5X A;  3HGB A;  2PPB C;  4C3I G;  2Y0S B;  2F03 A;  2EJG C;  4CKE A;  3LWE A;  3NTH A;  2EYM A;  5I2Y A;  1CI3 M;  1LTT D;  3DXJ C;  5EPJ A;  4BY7 B;  3NE5 B;  1XXG A;  1D1K A;  4FNF A;  3IKJ A;  1C48 A;  4KKU A;  1YNN D;  2IPK D;  1NUC A;  1R4P B;  5E1F A;  1MSG A;  1L0X B;  1VMC A;  3RUZ A;  2C5C A;  1STA A;  1VDZ A;  1HFN A;  5IGD A;  3RLF A;  2XN9 C;  1STE A;  3Q24 A;  2A6E D;  1LT3 D;  1EWC A;  3VYR A;  4K2L A;  5JEA H;  5I9P A;  2EY1 A;  5BN5 A;  2ICE C;  3KK7 A;  2AWN A;  2XRQ D;  1GUG A;  1HQM C;  1ENC A;  4A3F B;  1S5E D;  1TQO A;  2KJX A;  2K5Q A;  1H9S B;  2PYK A;  3I73 A;  2H4O A;  3KUP A;  1ENA A;  1IKM A;  1TS3 A;  1A15 A;  4EQP A;  4RGO S;  1SNQ A;  3A8I E;  3D4D A;  5COR A;  2K32 A;  4LAA A;  1QNU A;  2Z4I A;  1B9M A;  4A3K B;  4ZAI A;  1KDB A;  4IFD G;  1FYC A;  2LY7 A;  1YNN C;  2O2L D;  5AFW A;  2X6G A;  3K57 A;  4FF2 A;  1LAC A;  4PV1 C;  4N9T A;  3VA7 A;  1SE3 A;  4Y7N B;  1Z6H A;  2JE6 I;  3HEJ A;  2PQE A;  4G4K A;  1II3 A;  2A6E C;  3HZX A;  4B9W A;  4F7X A;  4RGT A;  1BDO A;  1ET9 A;  4MN3 A;  1G91 A;  4X3U A;  1SEB D;  2K7V A;  2E74 C;  4DAP A;  2F0D A;  3D4R A;  3SE0 A;  3MFG A;  2YU9 B;  4KD3 A;  1SYG A;  1WTP A;  2F0U A;  1WCM B;  4L6T B;  5M3M B;  1D5X C;  1GHK A;  5DM7 3;  1GUT A;  4GZY C;  1R4Q B;  2B2V A;  1Q12 A;  4OIJ A;  1PTO H;  3KLR A;  1SNP A;  2NTS A;  2F0E A;  5CV5 A;  1NCV A;  2OT2 A;  3BYY B;  4KTA A;  1ZXT A;  4A3M B;  2TMP A;  3D3R A;  2EJF C;  2PZW A;  1AN8 A;  3BG3 A;  4ZUJ A;  2F0O A;  3I4M B;  1IL8 A;  2F0T A;  1KDC A;  5JAV A;  3S9W A;  3W3A A;  1GXD C;  4FP5 D;  2LS0 1;  4FYD A;  4G57 A;  2WP8 J;  3HOY B;  2HUG A;  4IZ8 A;  4TQU S;  2RDF A;  2F0H A;  3E0J A;  1EY6 A;  2O5J C;  3SVM A;  2PW7 A;  5D14 A;  1KLG D;  3I8Z A;  4RHR A;  2JA5 B;  2EXZ A;  3EQL C;  1D5Z C;  1AP0 A;  4ZLT F;  4Z9C B;  4C1N I;  4V0B A;  1A3V A;  1WD0 A;  5K5P A;  3I91 A;  1PTO B;  2O5I C;  4A3J B;  1F2L A;  1C4Q A;  3MWY W;  4IUV A;  1Y1V B;  3TP8 A;  1B53 A;  4BY1 B;  1DON A;  3OWF A;  3GV6 A;  3BS1 A;  1G2S A;  2B2U A;  3QWN A;  1DZ1 A;  2RSN A;  3S1R B;  4FXK C;  4XT1 B;  2BDN A;  1GUN A;  2KED A;  1AZP A;  1HA5 A;  3U9S A;  3GTO B;  1V8Q A;  1B44 D;  1A2T A;  3M7G A;  1IW7 C;  2YYZ A;  2QDB A;  4IUU A;  2I07 B;  4KKT A;  1JR0 D;  2KOL A;  1PZK D;  5T1G A;  4F8M A;  3PO2 B;  2K5D A;  1EQT A;  4A3I B;  3L7Z C;  2KA7 A;  3NTK A;  5M9O A;  4KKS A;  1GHJ A;  1GUS A;  1EIG A;  4XT3 B;  3HP3 A;  4HMI A;  5LL6 X;  5A35 A;  1OXT A;  3A55 A;  1KDA A;  1CQV A;  3JAM L;  3Q6S A;  2A69 D;  1O80 A;  1HA6 A;  4UDU C;  1MD2 D;  1JIC A;  5ISR A;  2TSS A;  2G9D A;  2IX3 A;  3VYU A;  3BZD B;  3W2D A;  2BDO A;  2FHT A;  3NWT A;  5KEE A;  1LTG D;  2DN8 A;  1EEI D;  1EYC A;  5D3I B;  3MAQ A;  1MGS A;  1YNJ C;  2KCN A;  1BO0 A;  1G8Z D;  3P20 A;  4ZK9 B;  3JAM E;  4FO2 A;  1C8C A;  5CR3 A;  3VR5 A;  4H13 C;  1EU3 A;  2JSO A;  3MXP A;  4HN7 A;  1JOQ A;  4ZQ3 A;  3GTK B;  1R9T B;  3BDC A;  4XDX A;  4Q0F A;  1I6H B;  3N52 A;  2DNE A;  3MC0 B;  5G3L D;  2F0W A;  1CHP D;  4KN4 C;  3H0G B;  4P2C B;  1AW7 A;  3A7L A;  2PZT A;  5JPM C;  2NVX B;  1NSN S;  1EIH A;  3H3V C;  1JWM D;  1GUW A;  2D5D A;  5A2Q E;  4QB4 A;  2A69 C;  2R61 A;  4V19 0;  4XYO A;  1I4X A;  3TP7 A;  4U67 3;  1AFP A;  4HSV A;  3J81 L;  2AQ2 B;  4FF3 A;  1GJX A;  4NDX A;  3DWA A;  2RVL A;  3K59 A;  4J8Q A;  1PRT D;  1TS2 A;  1BOS A;  4HED A;  3T4A C;  4XXE A;  2F1M A;  4H44 C;  2IWH A;  4RKB A;  2DY7 A;  5I2X A;  1CTM A;  3MZ5 A;  1TU2 B;  1BCP F;  2K28 A;  5ELE A;  5BN3 A;  3WDN A;  2R93 B;  4HMJ A;  5C3X A;  1LLR D;  4OO1 I;  2ZXO A;  1VF7 A;  4JBW A;  2WB1 B;  5C0X J;  2B8G A;  2ENB A;  4XQQ A;  2M2L A;  1S5C D;  4EGV A;  3KBX A;  5C4H A;  3X3N A;  4H0L C;  4C1N K;  1HTL D;  2B2U C;  4CGY B;  4BBR B;  4PQX A;  1X3Q A;  3I4L A;  1JQY D;  3NQT A;  3R2I A;  1H9R A;  2MP1 A;  3OOC A;  3S17 B;  1SYF A;  3OW7 A;  1HQR D;  2VXW A;  1IHZ A;  2C9O A;  1SFO B;  5K36 G;  4CKB A;  2KEC A;  1SMY C;  4YIJ A;  5KGU A;  1E2Z A;  2NZ1 D;  4DNT B;  1SND A;  5DNF A;  2J7Z A;  4OO1 G;  3MA2 B;  4U68 A;  1SAP A;  2A6H D;  2A5H A;  2NN6 G;  4ULL A;  3GTQ B;  3OIQ A;  1GUO A;  1EEF D;  4ILW A;  1OO9 B;  2JXM B;  4G7O C;  1QE6 A;  2K5W A;  3I4N B;  3ERO A;  1NR4 A;  2OF1 A;  2K04 A;  1EYD A;  5JJZ A;  1AEX A;  1PMR A;  1I6V C;  1SYC A;  4BBS B;  4BA2 I;  5CYU A;  4KHZ A;  3VR6 A;  1EY4 A;  3SK6 A;  3VYS A;  1EU4 A;  4M8A A;  5I6Y A;  1JE4 A;  5FK9 C;  3GTG B;  3FKI B;  4EQO A;  2SNS A;  3EA6 A;  2F0S A;  2KHS A;  1U4M A;  2K33 A;  4RGM A;  3S14 B;  1TVX A;  3PIP 3;  3OSO A;  1CHQ D;  2CQA A;  3OPO A;  3C1F A;  4HSP A;  2SEB D;  1ZEQ X;  1PYW D;  1K8O A;  2LMC B;  1LV9 A;  2A6H C;  1EY9 A;  1SE2 A;  1KNE A;  1B50 A;  2VNU D;  1STB A;  1QNK A;  5KYI A;  3GV3 A;  3SDZ A;  1RCV D;  4IFD I;  3MEH A;  1HFG A;  2EDG A;  2BE5 C;  2K6A A;  4A3B B;  5KRU A;  3NWS A;  1DOK A;  3WOF A;  1CK1 A;  4HCE A;  1UAP A;  4RCO A;  2F3V A;  5ELF A;  5KIX A;  1Z47 A;  5CBA E;  3MXN A;  5M5Y B;  1D1I A;  3VR3 A;  1W6J A;  2K03 A;  2L4N A;  3R93 A;  1HUM A;  5EPK A;  1STH A;  3L3O C;  3FEW X;  1EY7 A;  1J9O A;  1X32 A;  2MUY A;  1TR5 A;  2NVT B;  1XWE A;  2HDM A;  3A56 A;  1I3Q B;  1VMP A;  4DAY A;  3NUC A;  1HCZ A;  1TY2 A;  2L55 A;  1LT4 D;  1TWF B;  3SXH A;  3SK5 A;  4QMG A;  2XIW A;  1EFI D;  2F4I A;  4OIK A;  3HOW B;  2WKC A;  2D9U A;  2F0N A;  4C3H G;  1OXU A;  1V1O A;  2HCI A;  1F9S A;  3HRZ C;  1SNM A;  2BCO A;  4HTH A;  2ICI A;  1E2W A;  3X3M A;  3ZYY X;  1WTW A;  3BVZ A;  2KUM A;  2F0J A;  2R3Z A;  1TWG B;  4O42 A;  4CJ2 C;  3MXG A;  4ZYS A;  4TSS A;  2F0F A;  3TN2 A;  5J39 A;  5EKI A;  2E2D C;  3RD4 A;  1SJE D;  2FIN B;  2XVS A;  3ITP A;  2AUJ D;  1CM9 A;  1VF5 C;  2FMC A;  5M5X B;  1S5D D;  2OEO A;  4IFD J;  1QG7 A;  3SK8 A;  1TS5 A;  3A7A B;  3D4W A;  4A3D B;  3L9A X;  5EBD A;  1T5E A;  4L63 B;  4C3H B;  1BNZ A;  1BR9 A;  1MI2 A;  2J0T D;  1JCK B;  2ID0 A;  2L12 A;  2NWG A;  2EY6 A;  3G6J B;  3J7Y W;  4FXD A;  1FGB D;  2PNR C;  4O1N A;  4IAL A;  4KHV A;  5EGT A;  1TWH B;  4X3S A;  4DNR B;  3GD7 A;  1A2U A;  5LHY 1;  1IW7 D;  2DNC A;  4DXF A;  3M85 A;  3A8K E;  1LO5 D;  1HUN A;  1TY0 A;  2H1E A;  4DU9 A;  1SE4 A;  5EKL A;  1GOZ A;  5DAU A;  5C4Z A;  2PO4 A;  3IAY A;  4I7Z C;  2WII B;  3RZO B;  5IIF A;  4A93 B;  1JOK A;  4MIU A;  3RZD B;  5IGG A;  2FJ2 A;  2RDH A;  1Q90 A;  1Y69 U;  1Y1W B;  3M7N A;  3EJI A;  2L1B A;  4QIW B;  1CA6 A;  1FNW A;  2V4D A;  1SXT A;  1ZYR C;  5I4D A;  4IUR A;  1MSH A;  1M8A A;  4EVO A;  2AWO A;  3BDL A;  3OWE B;  4OGQ C;  1HHV A;  2CVR A;  1NAP A;  2QEJ C;  3U9O A;  2Q8R E;  2Q8I B;  2Z8L A;  5ELD A;  1ONL A;  1YNJ D;  3CRL C;  4C3J B;  1ENF A;  1D5M C;  3DUZ A;  2NYZ D;  4MHE A;  1EWH A;  1E0B A;  3I3C A;  1QCB D;  2JYO A;  1PTO C;  3DM1 A;  3GTM B;  5I6W A;  3QIA A;  1UNS A;  1SDF A;  4F87 A;  2VB3 X;  3AMU A;  5D65 A;  3J7A F;  4XTC S;  3D31 A;  1B9N A;  4DFA A;  2QCP X;  4DF7 A;  5FLX L;  2NBF A;  2K01 A;  3D6W A;  2CW0 C;  4RWS C;  1U9R A;  4PMW A;  5JVG 3;  2RBM A;  1FNV A;  5T1I A;  1PXU A;  2Q8T A;  2G9H D;  3V96 A;  2ZXP A;  2EYO A;  1RHP A;  1ESR A;  1JWU D;  2AUK A;  2HDL A;  3URY A;  3O13 A;  1T5X D;  2L9H A;  4DAV A;  3MXU A;  3TP5 A;  2J4X A;  5G3L F;  1SJH D;  5FLX E;  3NBH A;  1L0Y B;  5CV4 A;  2AQ3 B;  1S5F D;  1K8M A;  1RD9 D;  1I50 B;  3KLS A;  5A2Q L;  2NUC A;  2RKS A;  1W6K A;  1S5B D;  2IL8 A;  5IGC A;  1UEA B;  3VR2 A;  2EYL A;  3I70 A;  3MFY A;  3C2P A;  4WJW A;  5EPL A;  2XSC A;  3NP8 A;  4IUP A;  1ET6 A;  2RDG A;  1ILP A;  1PRT F;  3KBG A;  5C0X H;  1KLU D;  4ZUI A;  4DXG A;  2IX1 A;  3K5O A;  2PMZ B;  5CV7 A;  3P7J A;  3FVQ A;  2N88 A;  1SNO A;  1ZKO A;  5IGE A;  2JA6 B;  1RF2 D;  4KD4 A;  5EJW A;  1B2T A;  1BF4 A;  1SMY D;  2SDF A;  2O4X A;  1CA5 A;  4UAI A;  3PIO 3;  4IUQ A;  1EOT A;  3LWU A;  3D6C A;  2A74 C;  3CRK C;  4R9W A;  5C5L A;  5C44 B;  3PUY A;  2JP1 A;  2HCC A;  1PDQ A;  3NBI A;  3HS0 C;  2LKV A;  2NB0 A;  1PFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...