2RVLA

Solution structure of the chromodomain of hp1alpha with the n-terminal tail
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
83
Chain Sequence
b'GSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 5
publication title Extended string-like binding of the phosphorylated HP1 alpha N-terminal tail to the lysine 9-methylated histone H3 tail
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 9
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rvlA00
1MSGA 2L9HA 1NR2A 3DEPA 4IURA 1IKLA 1ZXTA 3R93A 2B2UA 1AZQA 5EPLA 5COYA 1B3AA 1E0BA 1F9QA 1PFNA 2M2LA 1BBXC 2N88A 1SDFA 1G6ZA 1F9SA 1WTRA 3ONAB 2B2UC 4OIJA 4UAIA 5EQ0A 1WTOA 1NCVA 1MGSA 1O80A 4ZLTF 5CBEE 3LWEA 4IUQA 1U4LA 1U4MA 1ILQA 1SAPA 4O42A 5DNFA 1G2TA 1DZ1A 1RODA 3N52A 3I90A 1BNZA 4DN4M 1EL0A 1NAPA 2NZ1D 5EJWA 1IL8A 3P7JA 3UI2A 2N55A 1EQTA 1PFBA 3FDTA 3MWYW 4RWSC 1F9PA 4X3KA 2NYZD 1AZPA 1X3QA 1SSOA 1B4OA 2KVMA 3I8ZA 1B2TA 1J8IA 1HHVA 3FPUB 2X6GA 5D65A 3F2UA 1GUWA 1HFNA 1PDQA 4QUFA 3I91A 3DEOA 4IUVA 1F2LA 1O7YA 5EPJA 5E4XA 1XYIA 2L1BA 1WD1A 5CMDA 4QUCA 4ZAIA 4CJ1B 4R8IA 2KUMA 1JE4A 1WTPA 1LV9A 1HFGA 2KOLA 2RVLA 3IL8A 1CA6A 2Q8RE 2SDFA 2IL8A 4NW2A 4LMQD 1Q3LA 4RAUC 3GV6A 3HP3A 3SVMA 4XT3B 1G91A 4X3SA 1DONA 1HA6A 2FJ2A 2JP1A 5D14A 2K04A 2MGSA 2VXWA 1NR4A 1RHPA 1F9RA 1MI2A 2K03A 1ICWA 1RTOA 2NWGA 5EKIA 1HRJA 2MP1A 1X3PA 2HCCA 1MSHA 3QO2A 4HEDA 4IUUA 2FINB 2B2WA 2Q8TA 2RA4A 1TVXA 1PFMA 2KEDA 1M8AA 1KNAA 1DOLA 5T1GA 1QG7A 4X3TA 5CORA 1BO0A 2B2WC 1HUMA 3GV3A 4XDXA 1ML0D 1EOTA 1U4PA 3I3CA 2MJ8A 1B53A 4RA8A 1AP0A 2FFKB 1EIHA 1XX8A 1S4ZA 2X69A 1C8CA 1RJTA 2CVRA 2HCIA 2K05A 1JICA 2EPBA 3TZDA 5AFWA 1WTWA 3IFDA 1KNEA 3D6WA 5EPKA 1RTNA 1WD0A 1BF4A 5T1IA 4CJ2C 4ZKCB 1CM9A 5JJZA 1QNKA 2KECA 4U68A 2XIWA 4HCSA 2MPMA 4X3UA 2DY7A 1J9OA 1U4RA 2EE1A 2K28A 2R3ZA 2L12A 4ZK9B 1EIGA 2BDNA 3G7LA 1WTQA 4OIKA 2KEEA 2HDLA 5E4WC 1B50A 1X32A 3MTSA 1A15A 1VMCA 4MHEA 3TN2A 2B2VA 4XT1B 2FMMA 3KBXA 4CJ0B 1QE6A 2B2YA 1WVLA 2HDMA 1DOKA 2JYOA 3H91A 2EOTA 4ZKBB 2D9UA 2L11A 2HUGA 2B2VC 1DOMA 2K1BA 4IUPA 5CBAE 2J7ZA 4IUTA 2K01A 2B2YC 2L4NA 1HUNA 3Q6SA 2RSOA 2X6LA 4HAEA 1G2SA 1CA5A 2B2TA 2RSNA 1WTVA 3DM1A 4MN3A 4R9WA 2FHTA 4HSVA 1IKMA 2H1EA 1ESRA 1WTXA 1VMPA 2DY8A 3KUPA 1ILPA 2B2TC 1O7ZA 1PLFA
chains in the Genus database with same CATH superfamily
1VCIA 4IURA 1UUPA 1GM5A 5EPLA 2IPKD 4YCVA 2NTTA 4JOIC 5C4XB 3WOEA 2F0QA 1SDFA 3OIPA 1NMFA 3OMCA 4UAIA 4DR5Q 1HJPA 3KDFA 1RKNA 1X55A 4N9PA 3CCEA 1E1OA 3F8TA 1BNZA 1HNXL 4XQNA 1TWCH 3M7GA 2EVBA 3S1QB 1J6QA 3MFGA 4RWSC 3UDGA 1SSOA 1TT2A 3U4ZA 3IFTA 4YWKA 4A3JH 4RMFA 4L63B 4YIJA 4DNTB 4O0AA 2WKCA 5IYDH 1JE4A 1M90C 4C3HH 4A93G 3PUXA 3NBHB 2IL8A 4ZYSA 4GN5A 1SJED 2I5LX 1IYVA 4DAYB 5JEAJ 1RTOA 3BVGA 1I6HH 1PYBA 4PZ6A 2RHSB 1TVXA 3DWAA 4CDDC 5IP7H 4ME3A 5DM63 4Q5VA 3A55A 2Z6KC 1YNXA 1GVPA 1LT4D 2CW0D 3J80L 4OL7A 4EQPA 5HGQA 1EOTA 1KDBA 2RDGA 3M4OB 1RJTA 1FR3A 2CVRA 2G5DA 1O7IA 3IFDA 1TWHH 5T1IA 3DMUA 2KECA 3S14B 2EE1A 1S40A 2E76C 3PGZA 4DR1Q 5ELOA 5F2DA 5EBDA 4DV7Q 1C0AA 1KLGD 4IPGA 4OX9L 2R93H 2B2VA 1VF5C 2WINB 5DM73 1W2BA 2PCFB 4A93B 1H9RA 4QQBX 2BOSA 5KYIA 5LMNW 3NSWA 1Q8KA 2HUGA 1AN8A 1NJIC 5I2XA 2K01A 4TQUS 1OO9B 5EGTA 4X64Q 2IHEA 1K73C 1CHQD 2X6LA 3GTLH 5ELFA 4RGTA 2OEOA 1ZYRC 4GNXB 2HIXA 2PMZE 1GD7A 2ZJPA 1T5XD 1HNZQ 1CSQA 3AB9A 4BXXH 2UUBL 4RH6A 1D8LA 2XVSA 3A5UA 1FJGQ 5C3XA 2VQEL 4LFBL 2L9HA 1D1IA 3GTKB 3OYYA 4JI1L 1LTID 1K28A 3ERQA 3W5OA 1PVOA 4A3DG 1XMQL 4JI7L 4EQOA 1G291 2K5QA 3KF8B 2UU9Q 3I4NG 4PV1C 1WYDA 3MWYW 2AUJD 4LF7Q 1HHVA 3NE5B 2E5LL 2ZM6Q 1GUSA 4NMZA 5KGUA 2ENBA 3G4SA 4P73A 1X9NA 3M4OH 3S16B 2KUMA 4LAAA 3L0OA 4K8IA 5IWAL 3BDCA 4Z9CB 3K0XA 3P75A 5IT9E 2XSCA 3B6YA 3S14H 1K8MA 1EUJA 2NWGA 4J1MA 1LACA 3V96A 1VQBA 2RA4A 4PG3A 4KTAA 4A93H 4KHPQ 3HG9A 1Y1VB 2RBMA 1SYFA 3BDLA 1PFSA 1KIXA 2B2WC 3K7AH 1J5EL 4JYAQ 3ER0A 2FFKB 2AQ2B 1S4ZA 1EY8A 1V1OA 3L7ZC 1JOKA 2K4KA 2A8VA 1KNEA 1PH3A 1B70B 1I4RA 1CM9A 4HCSA 1JJGA 4XQJA 4N8FA 2F0KA 4IN3A 4OIKA 3U9OA 4A3MB 4EX5A 1K83B 3KYHC 4K0KL 4DFAA 3GTPB 2PZUA 1GUGA 2NVTB 3WDNA 1Z7TA 3J81E 1H9JA 2L11A 5IGFA 2EJGC 2F0FA 2FMCA 2E2JH 3RZDB 1STBA 2EXZA 4C3IB 3M3YB 4O1NA 1XPUA 4YY3L 3PO2B 3BVMA 3OW7A 4NXNL 1V1PB 2B2TC 4WRDA 2P5ZX 4HIDA 4ZRZA 3S16H 2F0IA 1DD2A 3E3XA 2BH2A 1KDCA 1VQFA 2A6HC 4K5WA 4C2MB 3HOUG 4LF6Q 4KV6A 4DKAC 3MXNB 2R61A 4O42A 4OEMB 5TSSA 4BBRB 4KN7C 1HPCA 3N52A 1K3BC 1FNVA 1HZ9A 1YJ9A 3A7LA 1EQRA 4XTCS 1PZKD 1Q7YC 5FOBB 2E74C 4A3DH 1RCVD 3PQIA 2DGYA 5C44B 3A8IE 3I4NH 1PMRA 2SDFA 3J81j 5LMNL 1SE4A 3AFPA 2NVXB 1SJHD 3EBEA 1B3QA 2LXJA 3T1YL 2FJ2A 3H3VI 3OMGA 5IGGA 1Y1WG 2A68D 1NR4A 1N36L 2JA5G 4CBVA 4DV2L 5C4ZA 1YEZA 3AFQA 4RFBA 4IFDH 3H94A 5M5YB 4OX9Q 1I4XA 5EKKA 2IX1A 1DOLA 2NVTH 1B1ZA 3VR4A 4HR7B 3UDIA 1E22A 3FEWX 1WOCA 3T4AC 3HOUB 2YTXA 4DR7L 3RZDH 2UXCQ 5KRUA 1P16A 5E3FA 3M3YH 1NUCA 2F0NA 5CV4A 1QNUA 4YCWA 2K5HA 2DY7A 4V190 4IQZA 2RHQB 2UUBQ 2AUKA 3Q8DA 2EY6A 2G9HD 3VYUA 4IPHA 5G3LF 4A3GG 5M3MB 4LFCQ 1ENCA 3BZCA 2QDBA 4A75A 1SLJA 2N3SA 2D9UA 2AQ1B 2B2VC 4JI7Q 1KAWA 3HOXG 3S9WA 5FLMG 3S1MB 2WV6D 3QR8A 3GDEA 1PV4A 1KAAA 2NTSA 3RNUA 1SNQA 3AMUA 4UDUC 4R4OA 4HJ7A 3S17H 2H1EA 2PZTA 3K81C 4KY6A 4HCEA 2HIVA 1VDZA 1JC7A 5IYCG 5KNDA 3QB3A 2KENA 3F2BA 1B3AA 4OXPA 2NVXH 3BJUA 1PTOH 1XXGA 2N88A 1JT8A 3TZUA 5JJKA 4MNOA 4JBJA 1C48A 1E2ZA 2OTJA 1G2TA 5ELDA 3D4DA 4JBMA 4TRDA 1IW7C 5IT9L 1PFBA 4RGNA 1H9KA 2VQFQ 1F9PA 3I55A 4GN3B 3I4MB 3HOZB 1C9OA 3LX0A 3HOUH 4IUNA 1JOOA 1MJCA 1VQAA 1B7YB 3G48A 2RVLA 3U50C 2H4OA 3OW2A 3PV0A 4DV0L 3QJYA 4UY8C 1TY0A 4M8AA 1Q86C 1EEFD 3DWPA 1X3FA 3PUYA 3L3OC 2VXWA 3NENA 3PCOB 3QO2A 4IUUA 2PI2A 4XQQA 4K2KA 5GAGC 1PFMA 2HHHL 3CC4A 4K0KQ 4BWGB 2LKVA 4XDXA 1BCPF 1K8OA 4DNIA 1JWMD 2I07B 1Y1WH 3PIOA 2R7DA 2JA5H 1EEID 4DV1Q 3CRLC 4G7HC 3GTOH 3J81L 4ZKCB 2K5NA 4YY3Q 4LFAQ 3FP9A 2KJXA 2SOBA 1ASZA 4NXNQ 3D3RA 2IT1A 2F0TA 3X3NA 3HS0C 1PH4A 3SR1A 5C3EG 2B8GA 2WAQG 3GTJB 3MC0B 5FO8B 2B2YA 2IY5B 2UXDL 2B3GA 4DK3C 1VQ7A 1YNNC 2JYOA 1XTDA 1KRTA 1I4HA 1K0SA 3UE1A 4GNXC 3VR3A 1SBBB 1D5XC 1KABA 2XN9C 1YJWA 5IGCA 1WJJA 4HAEA 2C35B 5I6WA 3VR2A 5KEEA 1Q1EA 4UP7A 4A3GH 3PF5A 4L5TA 4B9XA 1ESRA 3KUPA 3LNNA 2JK8A 3OWFA 4BS9A 2UUAQ 2F3IA 1N34Q 1SYCA 1QVCA 4UHVA 4Q0FA 4LF4Q 3HOXH 2AWOA 5JJLA 2NVYB 4DAPA 5FLMH 4H44C 1F9QA 1EFID 3KK7A 2E2HB 3FMCA 4ZLTF 2JJQA 5E7NA 2K5WA 1U4MA 4HIOA 3C3LA 4RGOS 3AEVA 4K8JA 1N36Q 5IYCH 4FYDA 3M7NA 3T56B 2XTIA 4FXKC 1J8IA 5C3EB 4DR3Q 4GKJL 1BCPD 4JK1C 4DV7L 1F2LA 1I3QB 2F3VA 5C5LA 1AH9A 1PRTB 4HIMA 1WCMB 2A19A 4OGQC 2KOLA 2VZAA 1CA6A 5BN4A 4LMQD 4DK6C 2F0OA 1K8AC 2SNSA 3BYTB 1VQJA 1YZ6A 3H0GB 1AFPA 1PXUA 4X64L 2MGSA 4GKKQ 1ZKOA 3H3VH 1BDOA 2F0EA 3MXUA 2D0OA 4AYBG 3OSOA 1OXXK 4IZ8A 1IXRA 1I4GA 5M5XH 3T13A 1FJGL 4RHRA 3KDFB 3GTQB 5CV7A 1A63A 4G4KA 3MEFA 3J7ZC 2DJFC 2KCMA 2L55A 3PUWA 5LL6X 3MVVA 5EPKA 1BKBA 1HTPA 2EYMA 4CJ2C 1QOHA 5JJZA 5M9OA 4U68A 1FGUA 2OQKA 4O2DA 4R4QA 3C2PA 1GKHA 3KLSX 4NDXA 1JJCB 1XJVA 5KNCA 2EZVA 1Y14B 1I4QA 4B3TL 1TWCB 5C6AA 4K5XA 2MQHA 2E2HH 2FMMA 1PH1A 4CJ0B 3VYRA 4NKLA 3BDOA 5LL6S 4Y7NB 3MA2B 2K1BA 3U58A 1SNPA 1O78A 4CHTB 4ZUJA 2IX3A 3S24A 3TP8A 5GAEC 4LF5Q 4KJNA 3HKZE 2R92G 5C3EH 1QB5D 1FYCA 3DUZA 5D3DA 3U9SA 4K6LA 4J8QA 3M4QA 1CZWA 2RKSA 1I3QH 5EQ0A 4POFA 1BBUA 1D5MC 1XWEA 1CI3M 3DEPA 4A3IG 1X56A 3QOJA 3UDXA 3ULLA 3G6EA 3H09A 4JYAL 3DXJC 3ONAB 4HJ5A 4ZCKA 1VQ5A 3RUZA 2WB1G 3CU7A 1WTHA 5C0XJ 2I46A 2NZ1D 4IPCA 4APVA 1YHBA 3VYTA 1KL9A 1TWHB 4B08A 1JQYD 3R2IA 1B4OA 4YWLA 3SGIA 5M3FG 1HFNA 3F2UA 1H95A 4KK7A 1PDQA 3VR5A 3PIO3 2EYPA 2OWOA 2QW7A 1IBKQ 1PTOC 2IJ0A 2K52A 2R93B 2NB0A 2Y0SG 4BY1G 3TEHB 1Q3LA 4NPSA 2QEJC 1QWYA 3EJIA 4U673 1XNQL 3R8BA 2K04A 3GQBA 2HCCA 1EU4A 3GTLB 4B3SL 4A3IB 2NBFA 1JB7A 1D6EC 2A6HD 4A3KG 4AQYQ 4HMJA 3HKZB 4Y7NH 3CCLA 1Z6HA 2F3WA 3LWUA 2UXDQ 4JI8L 4UPAA 3CRKC 1OXVA 5M5WB 3I73A 3HOYG 4GN4B 2WB1B 1C4QA 1GHJA 4LF6L 3D4RA 1EWCA 5CC4A 1L2FA 2XIWA 5FO9B 4LF8L 2SNMA 4X3UA 5IP9G 4OO1I 3OIQA 2R3ZA 2BDNA 5M3FB 1LTTD 3MTSA 2NN6I 1EIFA 1ET9A 3HOVG 4N8X1 1WVLA 2AHOB 4UP9A 1NSNS 3KFUA 4JV5Q 4WJ4A 3AQQA 4LUVA 2B2YC 2HQLA 1TWAB 2ZTEA 1IZ6A 1ET6A 3CF5A 4HJAA 2I5MX 1Y8NB 4EGVA 1GO3E 2FHTA 2MUYA 1IKMA 3CKIB 3R2TA 1UAPA 1RF2D 2F0PA 4AIMA 4A3KB 3MAQA 1O7ZA 4GKJQ 2V4DA 2HT1A 1NE3A 1JMCA 3HOYB 1E0BA 4A3FG 5GADC 3CCJA 4DV3Q 1Q90A 2R92H 5IIFA 2BA1A 1WTOA 3K7AB 3BG3A 2UXCL 4WJ3M 3CHBD 4CDFC 1CSPA 1V43A 1SMXA 4FF4A 1ASYA 3K59A 2R7ZG 4A3IH 1YHAA 2Q8IB 4F7XA 4KD4A 1EQVA 2CKZB 3UDFA 1C7YA 2OQ0A 3J80i 1DGSA 2B8FA 3HOVB 1HZCA 5M5WH 3BS1A 4IUVA 1O7YA 4LWCA 1WD1A 2J4XA 1D2BA 4LFCL 4C1NK 5CGKA 3IL8A 4R1JA 4K6DA 5I4DA 4P2CB 3X3MA 2K33A 4JPBW 4X3SA 1U9RA 1TR5A 4I7ZC 2CFMA 3SHLA 2F0HA 5M3FH 4X62Q 5EKIA 1F9RA 1MSHA 4DK0A 2E2JB 4B3TQ 1N8RC 1KHIA 1HXYD 3W1BA 5HURA 4FP5D 2VUMG 4BY1H 4OELB 4XYQA 4A3FB 5CORA 1BO0A 4H7BA 3FPPA 5EKLA 1ENAA 4OO1G 1JR0D 4DUYQ 1V1QA 1TWAH 4JI6L 2HD3A 2HCIA 2CWPA 1TS2A 4JI5Q 3MFYA 1Q8IA 2NN6G 2XRQD 1WD0A 4B3MQ 3H3VC 1W6KA 1QNKA 4A3KH 1VQMA 3G7LA 3I70A 4QL5A 1S5DD 2VQFL 3HOYH 4F88A 2UUCQ 3KBGA 1QUQA 1DOKA 3I4LA 5JPNC 4ZKBB 4A3DB 3EIVA 4DR2L 4JW0A 5IP9H 3C46A 5LMUQ 2JN4A 4TKOB 1SE8A 5KIXA 1PH5A 3K8AA 4ZQ3A 3I4NB 2ZJQA 3P1HA 1A2TA 2D5DA 3DM1A 4JBKA 4R9WA 5JVH3 1LTRD 3JAMc 2EYHA 3HOVH 4E6IA 5CV6A 3TREA 2VUMB 5D3IB 4XXEA 2B2UA 4XYOA 1AZQA 3D6CA 1FGBD 2JA6G 4PZ7A 3S2HH 4QJFA 1F2MA 4LF9Q 1YJNA 1PH9A 3TP6A 5CBEE 5KNBA 2F4VQ 1U4LA 1B8AA 3M85A 1XNQQ 4XIGS 4DV1L 1VQ8A 3W3AA 5FLXc 5I9OA 1SNDA 1SNCA 4B3SQ 4LFAL 1PRTC 4X3KA 4A3FH 1U0LA 3FPUB 5D65A 2PI2E 4J15A 2MO1A 4JI8Q 2GA4B 1RIPA 2F0UA 1P8LA 3NTIA 2QDLA 4R8IA 3TP5A 1JB3A 3BYYB 5CV9A 5BN3A 1EYGA 1EY0A 1QJOA 3HP3A 3K5LA 1EY9A 4KKUA 3I56A 1ESFA 1QCBD 4FXGC 5GROA 4LF8Q 3T51B 3JAME 1LUZA 3HRZC 1NMGA 4N9TA 1S5FD 2A73B 3Q22A 4NXMQ 3SDZA 5A2QE 1KNAA 1KLUD 3S17B 4BY7G 2UUAL 2I5HA 1N34L 1PYSB 5AJ3Q 4LF4L 3I3CA 3UE0A 4FF3A 1C8CA 5AFWA 3HOWG 1PTOB 3S1RB 1YHQA 4MTNA 2DUDA 2WKDA 2VUMH 4QIWB 3SK5A 1UNSA 1GXDC 2K28A 2L15A 4YWMA 4PNYA 5H1SE 4OO1H 2JSOA 2OTLA 3IRBA 3G71A 1D1KA 4DR3L 4L8JA 2PQAA 1QE6A 2NN6H 1A62A 4FDBA 4CKEA 1BR9A 4DV5L 2EOTA 2CW0C 5NUCA 5CBAE 4P71A 3S2DH 1S72A 4DA2A 2E2IH 2JQOA 2RSNA 3TSSA 4IFDJ 1BOSA 1FNWA 1G51A 1V9PA 4GKKL 1KD1C 4X65Q 4YHHL 5IOCA 2N55A 4BY7B 1PLFA 4Y52H 1BXTA 3CMEA 4GOPB 1IKLA 3STBD 3GTGB 1CKNA 2EY1A 4ULLA 3N6RA 1EYCA 1H9MA 2BCOA 4OIJA 3DLLA 5ELNA 3LWEA 1T5EA 3KLSA 5DNFA 3FKIG 1Y1WB 1NNXA 2EYLA 3J7YW 1I5FA 1XPOA 4R4TA 2B29A 2JA5B 3UI2A 2LXKA 1K3RA 2JA6H 3A8KE 4DAVA 3GTOB 1UEAB 1O7LA 5CR3A 4GS3A 3K5MA 3MEHA 4QUFA 2EY2A 3HFZB 4G7OC 2F0DA 3PO3G 5FKAC 1V8QA 1Y8OB 3K0YA 2R7FA 4P74A 3A7AB 4ZAIA 4JI6Q 4IJLA 1VQOA 3PSIA 2JA7G 3S1RH 4R4CA 1B44D 4JI4L 4RAUC 1BUVT 4LUOA 3Q23A 4LF5L 4BA2I 4IOAA 1X3GA 2KHJA 3K58A 3NXWA 5IGBA 2KEDA 1TWFB 1VQEA 4A3GB 1ZEQX 1A6XA 4CGYB 4DV6L 1AE2A 5IYBG 3Q0AA 2OCEA 1L1OB 4HSPA 2MNAA 2PW7A 2EY5A 3K5OA 4DR2Q 3HOXB 5ELBA 3BVZA 3FKIB 3BZDB 3HZXA 3OTOL 1S5ED 2PQEA 3VA5A 5GQOA 2VL6A 5J3BA 2ES2A 2JA8G 4BY7H 3JC66 1EFWA 1LT6D 3GTGH 1H9SA 1STHA 2VY3A 1LTBD 3PO3B 1X32A 5ELEA 3CXCA 1VQGA 2AMCB 2LMCB 4LK1C 1VQCA 4NP5A 3HOWH 2HDMA 2VB3X 1IBKL 3OOCA 4L5SA 1NTGA 4B3RQ 4GOPA 2V1CC 1LT3D 5IGEA 3MXGA 4DGZA 2WAQE 2XGTA 1UE5A 1SRUA 1MBYA 3GO5A 3K80C 3J80c 5ISRA 1UWVA 2QILA 2I0QA 1HH2P 4BBSG 3KF6A 1NR2A 1VQLA 2ASBA 2K5VA 1HR0Q 3Q24A 4ME5A 4AQYL 4HJ9A 5KYLA 4KY7A 5M5XB 1G6ZA 1QILA 2B2UC 1EZ8A 4X66L 1MGSA 1LO5D 2HQEA 3KLRA 1FD7D 1FNUA 1DZ1A 4POGA 1CFMA 3CCMA 5E1FA 1EL0A 1TWFH 1OXTA 2D62A 2B63G 2L0CA 2JA9A 1SE2A 2F0WA 4KI0A 3F2CA 2NYZD 3EVQA 1AZPA 3RLOA 4GZYC 3W1GA 4A4IA 3I91A 5EPJA 1QVFA 3FKIH 5A2QL 2CQOA 2ATWA 2ICIA 2PO4A 4RKLA 4JV5L 3J81i 2VS1A 3ULPA 1HTLD 1L1OA 4QF4A 3KJOA 3PO3H 4HEDA 1A2UA 3SK6A 2JA7H 1UE6A 5ELCA 2NVQH 4S3SA 1QG7A 2WAQB 4UP8A 1JOQA 4DV5Q 3EA6A 4DF7A 3NHHA 4AYBE 1ZYRD 4FO2A 3S1NB 4DV3L 2KA7A 1JICA 3A54A 3NQIA 1BVSA 3EN2A 4OWTB 3NK9A 5EBCA 1L0XB 4YHHQ 1PH7A 1WFQA 5IYBH 1WTQA 2RCNA 2WACA 1B9NA 5J1ZA 3WWVA 4WFN3 5K5PA 1N32Q 4LJZC 1VMCA 1PZJD 4IPDA 5CV5A 1W3SA 1CQVA 1CKOA 5JEAG 1W6JA 3KLWA 2JA8H 3D0FA 4DNRB 3FRPB 2J7ZA 3ICEA 1LTAD 2C9OA 2PZWA 3RLNA 4JBWA 3Q6SA 1IYJB 2VB2X 3H6MA 2YV5A 4MN3A 3TMEA 5HY6A 3IAYA 2KHIA 4X62L 2K6AA 1SR3A 1L0WA 2KBNA 4A3BG 4ALPA 4H13C 1Q46A 1JORA 4OWWB 5COYA 3E0EA 1SFOH 4WORA 3GP7A 4JI4Q 4DUYL 4LNQA 4MIUA 1A3UA 2C5CA 4JI3L 2BH8A 3MZ5A 1LT5D 4JI5L 1RODA 1E2VA 4F87A 4BBSH 3J7AF 1VQHA 1NAPA 4B3ML 1EY4A 3P7JA 4A3EG 4AYBB 2EQSA 2ZTDA 4JI0L 3CC2A 1TY2A 3NELA 1HQRD 2WB1E 1GUWA 4DV6Q 5IGDA 1GHKA 1PH8A 2EJMA 2UUCL 3S1NH 1WTPA 1WI5A 1Z9FA 5C4XG 5BN5A 1S3OA 1AW7A 2PYKA 5I6YA 2F03A 3GV6A 4AH6A 3OTOQ 2B63H 1G91A 1DONA 1SEBD 3DWQA 5K36G 3RZOB 5LMUL 3G6JB 2MFIA 3VA7A 5C3WA 1UEBA 4KN4C 1X3PA 2Y0SE 3TS2A 3M4PA 2Z9HA 1CZGA 1FL0A 1Q12A 5T1GA 4DV4L 1K9MC 1VQ9A 1ICFB 1HUMA 1GUOA 1STEA 2EYOA 2WFWA 1II3A 3SEBA 1EIHA 2X69A 4LF9L 4DU9A 1KXLA 3FHWA 2DNEA 1PRTD 3D6WA 4YCUA 1XPRA 2R92B 2A69C 2F4VL 4A3EB 4RG1A 1STAA 2MPMA 3CP0A 2Q2UA 2GVBA 5C4HA 4R4IA 1U5KA 2DNCA 2KQ3A 2RDFA 1MKHA 3TP7A 3HEJA 3KBXA 3V2TA 1JJ2A 2F0VA 2NZHA 1PHJA 2O2LD 4G7ZC 4X66Q 2EYFA 5BR8Q 4C3JG 1CTMA 5A35A 4DR6Q 4GOPC 2XWBB 1VQ6A 1I6VC 5JEAH 1WTXA 1EY7A 2NZOA 4ILWA 1IHZA 1MSGA 4P75A 3CCVA 5IODA 3R93A 4NXML 1Z47A 1HR0W 1GJXA 1PFNA 2DJGC 2Y0SB 4BY1B 1KC8C 1TS4A 5AJ3L 1EWIA 1PYWD 3RZOH 4IUQA 3CMAA 2NUCA 1EWHA 3A8JE 2KCTA 3ITPA 4A3BH 3I90A 4IFDI 3I7FA 2LFNA 1I50H 4JC0A 1QUQB 1X3QA 2SEBD 4B9WA 2PNHA 2VW9A 1HA5A 1SNMA 1YBYA 1PH6A 5E4XA 3D4WA 1N33Q 3NPPA 2AWNA 4RKBA 4C3JB 4A3EH 2CQAA 4DPGA 3PMFA 4XT3B 3T16A 1A3TA 1GUTA 2K03A 4DK1A 1MI2A 3D8GA 1HNWQ 2QA4A 2PW5A 5IE8A 1VF7A 1L1OC 5C4XH 4X65L 1M8AA 5I2YA 2WIIB 3CQZB 1VQIA 2EXDA 4RCNA 3RMHA 1SYDA 3E0JA 1HCZA 2UXBQ 2QGQA 5FK9C 1CK1A 1ML0D 3AU7A 5K36H 4RA8A 3NTHA 1BCPC 4HN7A 2N8NA 2F1MA 2XNAC 3CPFA 4R8NA 5IT9c 3S2HB 4GLAC 3S1QH 4PMWA 4TSSA 3TDQA 4EVOA 2A74C 2XRSD 5JVG3 2A6EC 2L12A 1NY4A 3NBIA 1IL2A 1A8VA 5IY0A 2KEEA 5E4WC 2JXMB 2ALYB 3ZJYC 1Y1VG 5DAUA 3PIPA 2CH4A 3TBIB 1VQDA 4G57A 3H91A 1DOMA 1YNJC 1IW7D 1RL2A 5J39A 4JI3Q 1G8ZD 1HUNA 1VQKA 4L5QA 2R7ZB 3NBHA 1QZGA 1XNRQ 1BBWA 1ONLA 3GTMB 4JI0Q 4DXGA 3ULJA 1VQ4A 1Q1BA 4DAYA 4A3MG 4LUZA 4IFDG 4C3JH 3A56A 3K57A 2A5HA 1BBXC 2E2DC 3A74A 3J81c 1WTRA 3SE0A 4I65A 3MXPA 4ODGA 4KY5A 1SAPA 4C1NI 2RQXA 4V0BA 1SMYC 1E1TA 3OPOA 4IJHA 4C3IG 1SYBA 1TXYA 5JOBA 2K5DA 3CQZH 3D31A 2PQAB 1X65A 3PO2G 4PQXA 2RDHA 3I72A 4HIKA 2KVMA 5CYUA 4DV4Q 3LGJA 2OF1A 4QMGA 1JCKB 1VQNA 2PMZB 3CPWA 1QZHA 2BA0A 2N78A 3J7A5 4QIWE 1HFGA 3NP8A 3SVMA 3DHQA 4H0LC 3TS0A 1IBMQ 4B3RL 2E8GA 1EZ6A 3F1ZA 2JP1A 2BE5C 2F0LA 3BU2A 4OWXB 4BBRG 2EJFC 3S2DB 1HZBA 2A1AA 4DR4L 3AYHB 1JWSD 2FINB 1CKNB 3GTKH 2Q8TA 2E2IB 5JPMC 2K7VA 1YNND 1SROA 3J7AV 1LTLA 1IYUA 4GNXA 2PPBC 1IBLL 3PF4A 3GV3A 3I4OA 1HR0L 5C44G 1B53A 3CW2C 4KKSA 1CKMA 1CT1D 3NWTA 2R7ZH 3CCQA 3TZDA 2KCNA 3RLFA 1HNXQ 4EQNA 2H5XA 3GTMH 2RCFA 2K32A 3A5ZB 3ZYYX 3EFXD 2EDGA 2YU9B 3KF8A 3F2DA 1S5BD 1S5CD 1EY6A 1SE3A 2QKIC 3CC7A 1AE3A 4OHJA 2JA6B 1XMOL 1KDAA 1SNOA 4FF1A 4CDCC 1TS5A 4KKTA 1RDPD 1G6PA 4IUTA 4L6TB 3CD6A 3CCSA 1R4PB 4WJWA 1F77A 1CA5A 3KOJA 4FVMA 1E3PA 1YI2A 5FLXE 2IWHA 4HSVA 1Y1VH 1EY5A 4RCOA 1PZID 4GLXA 1VMPA 2DY8A 3NQTA 1ILPA 4MTKA 1HQMC 3C1EA 1ZXTA 1BQQT 5M3MG 2Q2TA 2M2LA 1STNA 1X3EA 3VDYA 1N9WA 2F0MA 2Q2HA 3RN5A 4DXFA 1Y8PB 1H9SB 4P72A 1CUKA 2KCCA 1MJEA 4ABNA 4DN4M 2JE6I 3TQYA 4H02A 4A3MH 1IL8A 1K83H 3E5SA 2YTVA 3L2PA 2GN5A 1AEXA 3GTPH 2AQ3B 2B39A 4EQ5A 1PTOF 4A3CG 3A0JA 1N32L 2O5IC 5CMDA 4QUCA 4K14A 3EQLC 1LV9A 3NWSA 2ZXPA 2K75A 2Q8RE 4C3IH 1TWGB 5EAYA 3OHXC 4NW2A 3HOWB 2D0PA 1R4QB 3PO2H 1HA6A 3PUZA 4LW1A 2YU9H 1T9HA 3KF6B 1CQFA 3VYSA 1ICWA 4X6AH 2MP1A 4PMCA 3WOFA 1X6OA 1EYDA 2PNRC 2VQEQ 4LFBQ 2WP8J 3FVQA 5I9PA 3PIP3 1SYGA 1VQPA 1LM0A 1R9TB 1L0YB 3I4MG 1VS0A 4KLKA 4JI1Q 3HOZG 4C2MH 2L5TA 2MJ8A 1V1PA 1D5ZC 2OT2A 3T53B 3KJPA 1XMQQ 4BBRH 2N49A 2EPBA 4IOCA 1WTWA 4FF2A 2IX0A 2QF7A 1JE5A 2YYZA 1Y69U 3I2ZA 1LTSD 5C0XI 1I4PA 2TSSA 1J9OA 1KRSA 1U4RA 2IHFA 1D7QA 3MXNA 1EIGA 2E5LQ 4A3LG 5C44H 1DYQA 3K5NA 2F0JA 2K50A 3P20A 4L5RC 5IWAQ 1OXSC 5GAHC 3T1HL 4ID6A 2O4XA 4JI2L 4IUPA 3SK8A 5JJIA 1ENFA 2RSOA 2AKWB 3O13A 2M9VA 1TS3A 4CKBA 3DM3A 1BCPB 5M5YH 1YITA 4KJOA 4JCVE 2GVAA 4JOIA 1PTOD 1UE7A 2R6GA 3E9HA 1Q81C 1LTGD 5L37A 2FXQA 1TQOA 1J5EQ 2DN8A 4DUZL 3S15B 1TWGH 2A69D 1I94L 4ZUIA 2JA7B 2D2CC 2NVQB 3RD4A 3EROA 1YIJA 1F9SA 3QIAA 1NCVA 4JVZA 3VR6A 4J6HA 2F52A 1STGA 3OWEB 4DR4Q 5EJWA 3H15A 2F0GA 3GD7A 4M1UB 3FDTA 1R9TH 5G3LD 5M3MH 1B9MA 4IO9A 3NEMA 2X6GA 4PMBA 5FJ8G 1IBLQ 1F2ZA 1XTCD 4NB3A 1LLRD 1YVCA 3S1MH 3MHBA 1OXUA 2LY7A 3M9BA 5HGTA 1DXMA 4DR5L 4CKCA 2E75C 3BZKA 5BR8L 2JA8B 3HKSA 1MD2D 2Z6KA 4A3CH 1EU3A 4QB4A 3CCUA 4DR6L 4JG2A 1RD9D 2VNUD 2KHSA 1STYA 5DLQE 3U4VA 2CCZA 3JAML 1DJRD 1GOZA 2JEBI 2Z6BA 1XMOQ 1E7ZA 5C0XG 2IW3A 1WCMG 1XX8A 3HGBA 1E24A 1KTKA 1SFOB 4RGMA 3E9IA 2K14A 4QCLA 1NBWA 3H0GG 4HMIA 3M4YA 3I4MH 5DEHA 3HOZH 3E6ZX 5C5MA 4ZK9B 2J0TD 3J80E 4QY7A 1DM0B 4BBSB 4F8MA 2Q2IA 1DCZA 2HDLA 4A76A 3S15H 5FLXL 4RHSA 1A15A 4MHEA 3TN2A 5C4JB 2MHVA 5LMNQ 1M4VA 1N33L 3K7UC 3NUCA 3T1YQ 2XWJB 2L4NA 1JWUD 4A3LH 3CCRA 1PH2A 1WTVA 1GUNA 4DV2Q 1TKWB 4MZ9A 3URYA 2B63B 4HTHA 2RF4A 2Z8LA 3JAMi 1A0IA 1A3VA 4DR1L 1HZAA 2CHBD 3RR5A 1HNWL 2OXPA 2A68C 2BDOA 4IALA 2EYJA 4FNFA 4DR7Q 2Z1CA 3W2DA 2UXBL 5J22A 2Z4HA 2ID0A 4A3JG 1E2WA 1O80A 2A6ED 4KD3A 2JEAI 1ILQA 5IYDG 1LABA 4C3HG 1QVGA 4KHVA 1KQSA 1PRTF 2QCPX 4PZ8A 1EQTA 1LYLA 1HNZL 3GTJH 2M00A 3I8ZA 4BA1I 1B2TA 4CDEC 1YNJD 4OONA 2EIFA 3DEOA 3TRZA 3IKJA 1XYIA 2L1BA 3V05A 4CJ1B 3ERSX 2ICEC 5IP7G 1MHWC 1X54A 3RN2A 3STBC 4GLVB 2ZXRA 3K6OA 5D14A 4C56C 4TVAB 2UU9L 1M1KC 1RHPA 1EYAA 5FJ8H 1HRJA 3SXHA 3CAMA 2B2WA 1Q82C 5C4JH 1XNRL 1SN8A 2ZJRA 2NVYH 4KMUC 4I7AA 5FO7B 1MIUA 3C1FA 1SXTA 4LF7L 1SYEA 2ZXOA 2F0SA 2ZM6L 2ZTCA 2LS01 4X3TA 5LHY1 3T1HQ 2QEXA 1U4PA 4JI2Q 2G9DA 4A3JB 1AP0A 2O5JC 3QG1A 1SMYD 3QWNA 2R93G 2Z0SA 3R3OA 2K05A 3ND9A 1PA6A 4C3HB 1UE1A 1K8GA 1RTNA 2YTYA 2F4IA 1BF4A 4FXDA 1EQQA 1F2YA 1EIYB 2ZT9C 5C0XH 1K0RA 3PUVA 4HJ8A 4A3BB 1EOVA 1I6HB 3L9AX 1WCMH 1B50A 3NTKA 4DUZQ 4KHPL 3SK4A 1I50B 4DAMA 3ND8A 4XT1B 1CHPD 1TIID 3HKZG 1I94Q 4BXXG 2LSSA 2BE5D 3QOLA 5CV8A 3H0GH 4DV0Q 4QGUA 2MO0A 4K2LA 2TMPA 1TU2B 2CH4W 1G2SA 2CWAA 5JAVA 2B2TA 1IBML 4K5VA 2HHHQ 1OTCA 2Z4IA 1FVIA 3GTQH 4KHZA
chains in the Genus database with same CATH topology
1VCIA 4IURA 1UUPA 5EPLA 2IPKD 2NTTA 5C4XB 3WOEA 2F0QA 1SDFA 3OIPA 3OMCA 4UAIA 1RKNA 4N9PA 1BNZA 4XQNA 3M7GA 2EVBA 3S1QB 3MFGA 4RWSC 1SSOA 1TT2A 3IFTA 4L63B 4YIJA 4DNTB 2WKCA 1JE4A 3PUXA 2IL8A 4ZYSA 1SJED 1IYVA 5JEAJ 1RTOA 3BVGA 1TVXA 3DWAA 5DM63 4Q5VA 3A55A 1LT4D 2CW0D 3J80L 4OL7A 4EQPA 1EOTA 1KDBA 2RDGA 3M4OB 1RJTA 1FR3A 2CVRA 3IFDA 5T1IA 3DMUA 2KECA 3S14B 2EE1A 2E76C 5F2DA 5EBDA 1KLGD 2B2VA 1VF5C 2WINB 5DM73 2PCFB 4A93B 1H9RA 2BOSA 5KYIA 3NSWA 2HUGA 1AN8A 5I2XA 2K01A 4TQUS 1OO9B 5EGTA 1CHQD 2X6LA 5ELFA 4RGTA 2OEOA 1ZYRC 1T5XD 3AB9A 4RH6A 2XVSA 5C3XA 2L9HA 1D1IA 3GTKB 1LTID 3ERQA 4EQOA 1G291 2K5QA 4PV1C 3MWYW 2AUJD 1HHVA 3NE5B 1GUSA 4NMZA 5KGUA 2ENBA 3S16B 2KUMA 4LAAA 4K8IA 3BDCA 4Z9CB 3P75A 5IT9E 2XSCA 1K8MA 2NWGA 4J1MA 1LACA 3V96A 2RA4A 4KTAA 3HG9A 1Y1VB 2RBMA 1SYFA 3BDLA 2B2WC 2FFKB 2AQ2B 1S4ZA 1EY8A 1V1OA 3L7ZC 1JOKA 1KNEA 1I4RA 1CM9A 4HCSA 4XQJA 2F0KA 4IN3A 4OIKA 3U9OA 4A3MB 1K83B 4DFAA 3GTPB 2PZUA 1GUGA 2NVTB 3WDNA 1Z7TA 3J81E 1H9JA 2L11A 5IGFA 2EJGC 2F0FA 2FMCA 3RZDB 1STBA 2EXZA 4C3IB 3M3YB 4O1NA 3PO2B 3BVMA 3OW7A 1V1PB 2B2TC 4WRDA 4ZRZA 2F0IA 1DD2A 1KDCA 2A6HC 4K5WA 4C2MB 4KV6A 2R61A 4O42A 5TSSA 4BBRB 4KN7C 1HPCA 3N52A 1FNVA 3A7LA 4XTCS 1PZKD 5FOBB 2E74C 1RCVD 5C44B 3A8IE 1PMRA 2SDFA 1SE4A 2NVXB 1SJHD 2FJ2A 3OMGA 5IGGA 2A68D 1NR4A 4CBVA 5C4ZA 4RFBA 4IFDH 3H94A 5M5YB 1I4XA 5EKKA 2IX1A 1DOLA 1B1ZA 3VR4A 4HR7B 3FEWX 3T4AC 3HOUB 5KRUA 5E3FA 1NUCA 2F0NA 5CV4A 1QNUA 2DY7A 4V190 4IQZA 2AUKA 2EY6A 2G9HD 3VYUA 5G3LF 5M3MB 1ENCA 2QDBA 2D9UA 2AQ1B 2B2VC 3S9WA 3S1MB 2WV6D 1KAAA 2NTSA 1SNQA 3AMUA 4UDUC 2H1EA 2PZTA 4KY6A 4HCEA 1VDZA 1JC7A 5KNDA 3QB3A 1B3AA 1PTOH 1XXGA 2N88A 3TZUA 1C48A 1E2ZA 1G2TA 5ELDA 3D4DA 4TRDA 1IW7C 5IT9L 1PFBA 4RGNA 1H9KA 1F9PA 3I4MB 3HOZB 3LX0A 4IUNA 1JOOA 2RVLA 2H4OA 3PV0A 3QJYA 1TY0A 4M8AA 1EEFD 3DWPA 3PUYA 3L3OC 2VXWA 3QO2A 4IUUA 4XQQA 4K2KA 1PFMA 4BWGB 2LKVA 4XDXA 1BCPF 1K8OA 1JWMD 2I07B 1EEID 3CRLC 4G7HC 3J81L 4ZKCB 2KJXA 2SOBA 3D3RA 2IT1A 2F0TA 3X3NA 3HS0C 3SR1A 2B8GA 3GTJB 3MC0B 5FO8B 2B2YA 1YNNC 2JYOA 1I4HA 3VR3A 1SBBB 1D5XC 1KABA 2XN9C 5IGCA 4HAEA 5I6WA 3VR2A 5KEEA 1Q1EA 4B9XA 1ESRA 3KUPA 3LNNA 4BS9A 3OWFA 1SYCA 4Q0FA 2AWOA 2NVYB 4DAPA 4H44C 1F9QA 1EFID 3KK7A 2E2HB 3FMCA 4ZLTF 2K5WA 1U4MA 3C3LA 4RGOS 4K8JA 4FYDA 3M7NA 3T56B 4FXKC 1J8IA 5C3EB 1BCPD 4JK1C 1F2LA 1I3QB 2F3VA 5C5LA 1PRTB 1WCMB 4OGQC 2KOLA 1CA6A 5BN4A 4LMQD 2F0OA 2SNSA 3BYTB 3H0GB 1AFPA 1PXUA 2MGSA 1ZKOA 1BDOA 2F0EA 3MXUA 3OSOA 1OXXK 4IZ8A 1I4GA 3T13A 4RHRA 3GTQB 5CV7A 4G4KA 2L55A 5LL6X 3PUWA 3MVVA 5EPKA 1HTPA 2EYMA 4CJ2C 1QOHA 5JJZA 5M9OA 4U68A 3C2PA 3KLSX 4NDXA 5KNCA 2EZVA 1I4QA 1TWCB 5C6AA 4K5XA 2FMMA 4CJ0B 3VYRA 4NKLA 3BDOA 5LL6S 4Y7NB 3MA2B 2K1BA 1SNPA 1O78A 4CHTB 4ZUJA 2IX3A 3TP8A 4KJNA 1QB5D 1FYCA 3DUZA 5D3DA 3U9SA 4K6LA 4J8QA 1CZWA 2RKSA 5EQ0A 1D5MC 1XWEA 1CI3M 3DEPA 3QOJA 3H09A 3DXJC 3ONAB 3RUZA 3CU7A 5C0XJ 2I46A 2NZ1D 3VYTA 1TWHB 4B08A 1JQYD 3R2IA 1B4OA 1HFNA 3F2UA 4KK7A 1PDQA 3VR5A 3PIO3 2EYPA 1PTOC 2IJ0A 2R93B 2NB0A 1Q3LA 2QEJC 1QWYA 3EJIA 4U673 3R8BA 2K04A 3GQBA 2HCCA 1EU4A 3GTLB 4A3IB 2NBFA 1D6EC 2A6HD 4HMJA 3HKZB 1Z6HA 2F3WA 3LWUA 3CRKC 1OXVA 5M5WB 3I73A 2WB1B 1C4QA 1GHJA 3D4RA 1EWCA 5CC4A 2XIWA 5FO9B 2SNMA 4X3UA 4OO1I 3OIQA 2R3ZA 2BDNA 5M3FB 1LTTD 3MTSA 2NN6I 1ET9A 1WVLA 1NSNS 2B2YC 1TWAB 1ET6A 1Y8NB 4EGVA 2FHTA 2MUYA 1IKMA 3CKIB 3R2TA 1UAPA 1RF2D 2F0PA 4A3KB 3MAQA 1O7ZA 2V4DA 3HOYB 1E0BA 1Q90A 5IIFA 2BA1A 1WTOA 3K7AB 3BG3A 3CHBD 1V43A 4FF4A 3K59A 2Q8IB 4F7XA 4KD4A 1EQVA 2B8FA 3HOVB 3BS1A 4IUVA 1O7YA 1WD1A 2J4XA 1D2BA 5CGKA 4C1NK 3IL8A 4K6DA 5I4DA 4P2CB 3X3MA 2K33A 4X3SA 1U9RA 1TR5A 4I7ZC 3SHLA 2F0HA 5EKIA 1F9RA 1MSHA 4DK0A 2E2JB 1HXYD 5HURA 4FP5D 4XYQA 4A3FB 5CORA 1BO0A 4H7BA 3FPPA 5EKLA 1ENAA 4OO1G 1JR0D 2HCIA 1TS2A 3MFYA 1Q8IA 2NN6G 2XRQD 1WD0A 3H3VC 1W6KA 1QNKA 3G7LA 3I70A 1S5DD 4F88A 3KBGA 1DOKA 3I4LA 5JPNC 4ZKBB 4A3DB 3C46A 4TKOB 5KIXA 4ZQ3A 3I4NB 3P1HA 1A2TA 2D5DA 3DM1A 4R9WA 5JVH3 1LTRD 2EYHA 4E6IA 5CV6A 2VUMB 5D3IB 4XXEA 2B2UA 4XYOA 1AZQA 3D6CA 1FGBD 1F2MA 3TP6A 5CBEE 5KNBA 1U4LA 3M85A 4XIGS 3W3AA 5I9OA 1SNDA 1SNCA 1PRTC 4X3KA 3FPUB 5D65A 2GA4B 2F0UA 3NTIA 4R8IA 3TP5A 1JB3A 3BYYB 5CV9A 5BN3A 1EY0A 1QJOA 3HP3A 3K5LA 1EY9A 4KKUA 1ESFA 1QCBD 4FXGC 3T51B 3JAME 3HRZC 4N9TA 1S5FD 2A73B 3Q22A 3SDZA 5A2QE 1KNAA 1KLUD 3S17B 3I3CA 4FF3A 1C8CA 5AFWA 1PTOB 3S1RB 2WKDA 4QIWB 3SK5A 1UNSA 1GXDC 2K28A 4PNYA 4OO1H 2JSOA 1D1KA 4L8JA 1QE6A 2NN6H 4CKEA 1BR9A 2EOTA 2CW0C 5NUCA 5CBAE 4DA2A 2RSNA 3TSSA 4IFDJ 1BOSA 1FNWA 5IOCA 2N55A 4BY7B 1PLFA 1BXTA 1IKLA 3GTGB 2EY1A 4ULLA 3N6RA 1EYCA 1H9MA 2BCOA 4OIJA 3LWEA 1T5EA 3KLSA 5DNFA 1Y1WB 2EYLA 3J7YW 2JA5B 3UI2A 3A8KE 4DAVA 3GTOB 1UEAB 1O7LA 5CR3A 3K5MA 3MEHA 4QUFA 2EY2A 4G7OC 2F0DA 5FKAC 1V8QA 1Y8OB 3K0YA 4ZAIA 3A7AB 1B44D 4RAUC 1BUVT 3Q23A 4BA2I 3K58A 3NXWA 5IGBA 2KEDA 1TWFB 4A3GB 1ZEQX 1A6XA 4CGYB 3Q0AA 4HSPA 2PW7A 2EY5A 3K5OA 3HOXB 5ELBA 3BVZA 3FKIB 3BZDB 3HZXA 1S5ED 2PQEA 3VA5A 1LT6D 1H9SA 1STHA 1LTBD 3PO3B 1X32A 5ELEA 4LK1C 2LMCB 4NP5A 2HDMA 2VB3X 3OOCA 1LT3D 5IGEA 3MXGA 4DGZA 1MBYA 3GO5A 5ISRA 2QILA 1NR2A 3Q24A 4ME5A 5KYLA 4KY7A 5M5XB 1G6ZA 1QILA 2B2UC 1EZ8A 1MGSA 1LO5D 2HQEA 3KLRA 1FD7D 1FNUA 1DZ1A 1CFMA 5E1FA 1EL0A 1OXTA 2D62A 2L0CA 1SE2A 2F0WA 4KI0A 2NYZD 3EVQA 1AZPA 4GZYC 3I91A 5EPJA 5A2QL 2ICIA 2PO4A 4RKLA 1HTLD 4QF4A 4HEDA 1A2UA 3SK6A 5ELCA 4S3SA 1QG7A 2WAQB 1JOQA 3EA6A 4DF7A 3NHHA 1ZYRD 4FO2A 3S1NB 2KA7A 1JICA 3A54A 3NQIA 3NK9A 5EBCA 1L0XB 1WTQA 2WACA 1B9NA 5J1ZA 4WFN3 5K5PA 4LJZC 1VMCA 1PZJD 5CV5A 1CQVA 5JEAG 1W6JA 4DNRB 3FRPB 2J7ZA 1LTAD 2C9OA 2PZWA 4JBWA 3Q6SA 2VB2X 3H6MA 4MN3A 3TMEA 3IAYA 2K6AA 4H13C 1JORA 5COYA 4WORA 3GP7A 4MIUA 1A3UA 2C5CA 3MZ5A 1LT5D 1RODA 1E2VA 4F87A 3J7AF 1NAPA 1EY4A 3P7JA 4AYBB 1TY2A 1HQRD 1GUWA 5IGDA 1GHKA 2EJMA 1WTPA 5BN5A 1AW7A 2PYKA 5I6YA 2F03A 3GV6A 1G91A 1DONA 1SEBD 3DWQA 5K36G 3RZOB 3G6JB 3VA7A 5C3WA 4KN4C 1X3PA 1CZGA 1Q12A 5T1GA 1HUMA 1GUOA 1STEA 2EYOA 1II3A 3SEBA 1EIHA 2X69A 4DU9A 2DNEA 1PRTD 3D6WA 2R92B 2A69C 4A3EB 1STAA 2MPMA 5C4HA 2DNCA 2KQ3A 2RDFA 3TP7A 3HEJA 3KBXA 3V2TA 2F0VA 2O2LD 4G7ZC 2EYFA 4C3JG 1CTMA 5A35A 2XWBB 1I6VC 5JEAH 1WTXA 1EY7A 4ILWA 1IHZA 1MSGA 5IODA 3R93A 1Z47A 1GJXA 1PFNA 2Y0SB 4BY1B 1TS4A 1PYWD 4IUQA 2NUCA 1EWHA 3A8JE 3ITPA 3I90A 4IFDI 2LFNA 1X3QA 2SEBD 4B9WA 1HA5A 1SNMA 5E4XA 3D4WA 3NPPA 2AWNA 4RKBA 4C3JB 2CQAA 3PMFA 4XT3B 3T16A 1A3TA 1GUTA 2K03A 4DK1A 1MI2A 3D8GA 2PW5A 1VF7A 1M8AA 5I2YA 2WIIB 3CQZB 4RCNA 3RMHA 1SYDA 3E0JA 1HCZA 5FK9C 1CK1A 1ML0D 3AU7A 5K36H 4RA8A 3NTHA 1BCPC 4HN7A 2F1MA 2XNAC 4R8NA 3S2HB 4PMWA 4TSSA 3TDQA 4EVOA 2A74C 2XRSD 5JVG3 2A6EC 2L12A 3NBIA 2KEEA 5E4WC 2JXMB 5DAUA 3TBIB 4G57A 3H91A 1DOMA 1YNJC 1IW7D 5J39A 1G8ZD 1HUNA 2R7ZB 3NBHA 1ONLA 3GTMB 4DXGA 1Q1BA 4DAYA 4IFDG 3A56A 3K57A 2A5HA 1BBXC 2E2DC 1WTRA 3SE0A 4I65A 3MXPA 4ODGA 4KY5A 1SAPA 4C1NI 2RQXA 4V0BA 1SMYC 3OPOA 4C3IG 1SYBA 5JOBA 2K5DA 3D31A 4PQXA 2RDHA 3I72A 2KVMA 5CYUA 2OF1A 4QMGA 1JCKB 2PMZB 2BA0A 1HFGA 3NP8A 3SVMA 3DHQA 4H0LC 1EZ6A 2JP1A 2BE5C 2F0LA 2EJFC 3S2DB 1JWSD 2FINB 2Q8TA 2E2IB 5JPMC 2K7VA 1YNND 3J7AV 1IYUA 2PPBC 3GV3A 1B53A 4KKSA 1CT1D 3NWTA 3TZDA 2KCNA 3RLFA 4EQNA 2K32A 3ZYYX 3EFXD 2EDGA 2YU9B 3KF8A 1S5BD 1S5CD 1EY6A 1SE3A 2QKIC 4OHJA 2JA6B 1KDAA 1SNOA 4FF1A 1TS5A 4KKTA 1RDPD 4IUTA 4L6TB 1R4PB 4WJWA 1F77A 1CA5A 4FVMA 5FLXE 2IWHA 4HSVA 1EY5A 4RCOA 1PZID 1VMPA 2DY8A 3NQTA 1ILPA 1HQMC 3C1EA 1ZXTA 1BQQT 2M2LA 1STNA 2F0MA 4DXFA 1Y8PB 1H9SB 2KCCA 4ABNA 4DN4M 2JE6I 1IL8A 3E5SA 1AEXA 2AQ3B 2B39A 1PTOF 2O5IC 5CMDA 4QUCA 4K14A 3EQLC 1LV9A 3NWSA 2ZXPA 2Q8RE 1TWGB 3OHXC 4NW2A 3HOWB 1R4QB 1HA6A 3PUZA 3VYSA 1CQFA 1ICWA 2MP1A 4PMCA 3WOFA 1EYDA 2PNRC 2WP8J 3FVQA 5I9PA 3PIP3 1SYGA 1R9TB 1L0YB 2L5TA 2MJ8A 1V1PA 1D5ZC 2OT2A 3T53B 2EPBA 1WTWA 4FF2A 2IX0A 2QF7A 2YYZA 1Y69U 1LTSD 5C0XI 1I4PA 2TSSA 1J9OA 1U4RA 3MXNA 1EIGA 1DYQA 3K5NA 2F0JA 3P20A 1OXSC 4ID6A 2O4XA 4IUPA 3SK8A 1ENFA 2RSOA 3O13A 2M9VA 1TS3A 4CKBA 1BCPB 4KJOA 1PTOD 2R6GA 1LTGD 1TQOA 2DN8A 3S15B 2A69D 2JA7B 4ZUIA 2D2CC 2NVQB 3RD4A 3EROA 1F9SA 3QIAA 1NCVA 3VR6A 4J6HA 1STGA 3OWEB 5EJWA 2F0GA 3GD7A 4M1UB 3FDTA 5G3LD 1B9MA 2X6GA 4PMBA 1F2ZA 1XTCD 1LLRD 3MHBA 1OXUA 2LY7A 5HGTA 1DXMA 4CKCA 2E75C 2JA8B 1MD2D 1EU3A 4QB4A 1RD9D 2VNUD 2KHSA 1STYA 3JAML 1DJRD 1GOZA 2JEBI 5C0XG 2IW3A 1XX8A 3HGBA 1KTKA 1SFOB 4RGMA 4QCLA 4HMIA 3M4YA 5DEHA 3E6ZX 5C5MA 4ZK9B 2J0TD 3J80E 1DM0B 4BBSB 4F8MA 1DCZA 2HDLA 5FLXL 4RHSA 1A15A 4MHEA 3TN2A 5C4JB 2MHVA 1M4VA 3NUCA 2XWJB 2L4NA 1JWUD 1WTVA 1GUNA 1TKWB 3URYA 2B63B 4HTHA 2Z8LA 1A3VA 2CHBD 2OXPA 2A68C 2BDOA 4IALA 2EYJA 4FNFA 2Z1CA 3W2DA 5J22A 2Z4HA 2ID0A 1E2WA 1O80A 2A6ED 4KD3A 2JEAI 1ILQA 1LABA 4C3HG 4KHVA 1PRTF 2QCPX 1EQTA 2M00A 3I8ZA 4BA1I 1B2TA 1YNJD 3DEOA 3IKJA 1XYIA 2L1BA 3V05A 4CJ1B 2ICEC 2ZXRA 3K6OA 5D14A 4C56C 1RHPA 1EYAA 1HRJA 3SXHA 2B2WA 4KMUC 5FO7B 3C1FA 1SXTA 1SYEA 2ZXOA 2F0SA 2LS01 4X3TA 5LHY1 1U4PA 2G9DA 4A3JB 1AP0A 2O5JC 3QG1A 1SMYD 3QWNA 3R3OA 2K05A 3ND9A 4C3HB 1RTNA 2F4IA 1BF4A 4FXDA 1F2YA 2ZT9C 5C0XH 4A3BB 3PUVA 1I6HB 3L9AX 1B50A 3NTKA 3SK4A 1I50B 3ND8A 4XT1B 1CHPD 1TIID 2BE5D 3QOLA 5CV8A 4K2LA 2TMPA 1TU2B 1G2SA 5JAVA 2B2TA 4K5VA 2Z4IA 4KHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSG A;  2L9H A;  1NR2 A;  3DEP A;  4IUR A;  1IKL A;  1ZXT A;  3R93 A;  2B2U A;  1AZQ A;  5EPL A;  5COY A;  1B3A A;  1E0B A;  1F9Q A;  1PFN A;  2M2L A;  1BBX C;  2N88 A;  1SDF A;  1G6Z A;  1F9S A;  1WTR A;  3ONA B;  2B2U C;  4OIJ A;  4UAI A;  5EQ0 A;  1WTO A;  1NCV A;  1MGS A;  1O80 A;  4ZLT F;  5CBE E;  3LWE A;  4IUQ A;  1U4L A;  1U4M A;  1ILQ A;  1SAP A;  4O42 A;  5DNF A;  1G2T A;  1DZ1 A;  1ROD A;  3N52 A;  3I90 A;  1BNZ A;  4DN4 M;  1EL0 A;  1NAP A;  2NZ1 D;  5EJW A;  1IL8 A;  3P7J A;  3UI2 A;  2N55 A;  1EQT A;  1PFB A;  3FDT A;  3MWY W;  4RWS C;  1F9P A;  4X3K A;  2NYZ D;  1AZP A;  1X3Q A;  1SSO A;  1B4O A;  2KVM A;  3I8Z A;  1B2T A;  1J8I A;  1HHV A;  3FPU B;  2X6G A;  5D65 A;  3F2U A;  1GUW A;  1HFN A;  1PDQ A;  4QUF A;  3I91 A;  3DEO A;  4IUV A;  1F2L A;  1O7Y A;  5EPJ A;  5E4X A;  1XYI A;  2L1B A;  1WD1 A;  5CMD A;  4QUC A;  4ZAI A;  4CJ1 B;  4R8I A;  2KUM A;  1JE4 A;  1WTP A;  1LV9 A;  1HFG A;  2KOL A;  2RVL A;  3IL8 A;  1CA6 A;  2Q8R E;  2SDF A;  2IL8 A;  4NW2 A;  4LMQ D;  1Q3L A;  4RAU C;  3GV6 A;  3HP3 A;  3SVM A;  4XT3 B;  1G91 A;  4X3S A;  1DON A;  1HA6 A;  2FJ2 A;  2JP1 A;  5D14 A;  2K04 A;  2MGS A;  2VXW A;  1NR4 A;  1RHP A;  1F9R A;  1MI2 A;  2K03 A;  1ICW A;  1RTO A;  2NWG A;  5EKI A;  1HRJ A;  2MP1 A;  1X3P A;  2HCC A;  1MSH A;  3QO2 A;  4HED A;  4IUU A;  2FIN B;  2B2W A;  2Q8T A;  2RA4 A;  1TVX A;  1PFM A;  2KED A;  1M8A A;  1KNA A;  1DOL A;  5T1G A;  1QG7 A;  4X3T A;  5COR A;  1BO0 A;  2B2W C;  1HUM A;  3GV3 A;  4XDX A;  1ML0 D;  1EOT A;  1U4P A;  3I3C A;  2MJ8 A;  1B53 A;  4RA8 A;  1AP0 A;  2FFK B;  1EIH A;  1XX8 A;  1S4Z A;  2X69 A;  1C8C A;  1RJT A;  2CVR A;  2HCI A;  2K05 A;  1JIC A;  2EPB A;  3TZD A;  5AFW A;  1WTW A;  3IFD A;  1KNE A;  3D6W A;  5EPK A;  1RTN A;  1WD0 A;  1BF4 A;  5T1I A;  4CJ2 C;  4ZKC B;  1CM9 A;  5JJZ A;  1QNK A;  2KEC A;  4U68 A;  2XIW A;  4HCS A;  2MPM A;  4X3U A;  2DY7 A;  1J9O A;  1U4R A;  2EE1 A;  2K28 A;  2R3Z A;  2L12 A;  4ZK9 B;  1EIG A;  2BDN A;  3G7L A;  1WTQ A;  4OIK A;  2KEE A;  2HDL A;  5E4W C;  1B50 A;  1X32 A;  3MTS A;  1A15 A;  1VMC A;  4MHE A;  3TN2 A;  2B2V A;  4XT1 B;  2FMM A;  3KBX A;  4CJ0 B;  1QE6 A;  2B2Y A;  1WVL A;  2HDM A;  1DOK A;  2JYO A;  3H91 A;  2EOT A;  4ZKB B;  2D9U A;  2L11 A;  2HUG A;  2B2V C;  1DOM A;  2K1B A;  4IUP A;  5CBA E;  2J7Z A;  4IUT A;  2K01 A;  2B2Y C;  2L4N A;  1HUN A;  3Q6S A;  2RSO A;  2X6L A;  4HAE A;  1G2S A;  1CA5 A;  2B2T A;  2RSN A;  1WTV A;  3DM1 A;  4MN3 A;  4R9W A;  2FHT A;  4HSV A;  1IKM A;  2H1E A;  1ESR A;  1WTX A;  1VMP A;  2DY8 A;  3KUP A;  1ILP A;  2B2T C;  1O7Z A;  1PLF A; 
#chains in the Genus database with same CATH topology
 1VCI A;  4IUR A;  1UUP A;  1GM5 A;  5EPL A;  2IPK D;  4YCV A;  2NTT A;  4JOI C;  5C4X B;  3WOE A;  2F0Q A;  1SDF A;  3OIP A;  1NMF A;  3OMC A;  4UAI A;  4DR5 Q;  1HJP A;  3KDF A;  1RKN A;  1X55 A;  4N9P A;  3CCE A;  1E1O A;  3F8T A;  1BNZ A;  1HNX L;  4XQN A;  1TWC H;  3M7G A;  2EVB A;  3S1Q B;  1J6Q A;  3MFG A;  4RWS C;  3UDG A;  1SSO A;  1TT2 A;  3U4Z A;  3IFT A;  4YWK A;  4A3J H;  4RMF A;  4L63 B;  4YIJ A;  4DNT B;  4O0A A;  2WKC A;  5IYD H;  1JE4 A;  1M90 C;  4C3H H;  4A93 G;  3PUX A;  3NBH B;  2IL8 A;  4ZYS A;  4GN5 A;  1SJE D;  2I5L X;  1IYV A;  4DAY B;  5JEA J;  1RTO A;  3BVG A;  1I6H H;  1PYB A;  4PZ6 A;  2RHS B;  1TVX A;  3DWA A;  4CDD C;  5IP7 H;  4ME3 A;  5DM6 3;  4Q5V A;  3A55 A;  2Z6K C;  1YNX A;  1GVP A;  1LT4 D;  2CW0 D;  3J80 L;  4OL7 A;  4EQP A;  5HGQ A;  1EOT A;  1KDB A;  2RDG A;  3M4O B;  1RJT A;  1FR3 A;  2CVR A;  2G5D A;  1O7I A;  3IFD A;  1TWH H;  5T1I A;  3DMU A;  2KEC A;  3S14 B;  2EE1 A;  1S40 A;  2E76 C;  3PGZ A;  4DR1 Q;  5ELO A;  5F2D A;  5EBD A;  4DV7 Q;  1C0A A;  1KLG D;  4IPG A;  4OX9 L;  2R93 H;  2B2V A;  1VF5 C;  2WIN B;  5DM7 3;  1W2B A;  2PCF B;  4A93 B;  1H9R A;  4QQB X;  2BOS A;  5KYI A;  5LMN W;  3NSW A;  1Q8K A;  2HUG A;  1AN8 A;  1NJI C;  5I2X A;  2K01 A;  4TQU S;  1OO9 B;  5EGT A;  4X64 Q;  2IHE A;  1K73 C;  1CHQ D;  2X6L A;  3GTL H;  5ELF A;  4RGT A;  2OEO A;  1ZYR C;  4GNX B;  2HIX A;  2PMZ E;  1GD7 A;  2ZJP A;  1T5X D;  1HNZ Q;  1CSQ A;  3AB9 A;  4BXX H;  2UUB L;  4RH6 A;  1D8L A;  2XVS A;  3A5U A;  1FJG Q;  5C3X A;  2VQE L;  4LFB L;  2L9H A;  1D1I A;  3GTK B;  3OYY A;  4JI1 L;  1LTI D;  1K28 A;  3ERQ A;  3W5O A;  1PVO A;  4A3D G;  1XMQ L;  4JI7 L;  4EQO A;  1G29 1;  2K5Q A;  3KF8 B;  2UU9 Q;  3I4N G;  4PV1 C;  1WYD A;  3MWY W;  2AUJ D;  4LF7 Q;  1HHV A;  3NE5 B;  2E5L L;  2ZM6 Q;  1GUS A;  4NMZ A;  5KGU A;  2ENB A;  3G4S A;  4P73 A;  1X9N A;  3M4O H;  3S16 B;  2KUM A;  4LAA A;  3L0O A;  4K8I A;  5IWA L;  3BDC A;  4Z9C B;  3K0X A;  3P75 A;  5IT9 E;  2XSC A;  3B6Y A;  3S14 H;  1K8M A;  1EUJ A;  2NWG A;  4J1M A;  1LAC A;  3V96 A;  1VQB A;  2RA4 A;  4PG3 A;  4KTA A;  4A93 H;  4KHP Q;  3HG9 A;  1Y1V B;  2RBM A;  1SYF A;  3BDL A;  1PFS A;  1KIX A;  2B2W C;  3K7A H;  1J5E L;  4JYA Q;  3ER0 A;  2FFK B;  2AQ2 B;  1S4Z A;  1EY8 A;  1V1O A;  3L7Z C;  1JOK A;  2K4K A;  2A8V A;  1KNE A;  1PH3 A;  1B70 B;  1I4R A;  1CM9 A;  4HCS A;  1JJG A;  4XQJ A;  4N8F A;  2F0K A;  4IN3 A;  4OIK A;  3U9O A;  4A3M B;  4EX5 A;  1K83 B;  3KYH C;  4K0K L;  4DFA A;  3GTP B;  2PZU A;  1GUG A;  2NVT B;  3WDN A;  1Z7T A;  3J81 E;  1H9J A;  2L11 A;  5IGF A;  2EJG C;  2F0F A;  2FMC A;  2E2J H;  3RZD B;  1STB A;  2EXZ A;  4C3I B;  3M3Y B;  4O1N A;  1XPU A;  4YY3 L;  3PO2 B;  3BVM A;  3OW7 A;  4NXN L;  1V1P B;  2B2T C;  4WRD A;  2P5Z X;  4HID A;  4ZRZ A;  3S16 H;  2F0I A;  1DD2 A;  3E3X A;  2BH2 A;  1KDC A;  1VQF A;  2A6H C;  4K5W A;  4C2M B;  3HOU G;  4LF6 Q;  4KV6 A;  4DKA C;  3MXN B;  2R61 A;  4O42 A;  4OEM B;  5TSS A;  4BBR B;  4KN7 C;  1HPC A;  3N52 A;  1K3B C;  1FNV A;  1HZ9 A;  1YJ9 A;  3A7L A;  1EQR A;  4XTC S;  1PZK D;  1Q7Y C;  5FOB B;  2E74 C;  4A3D H;  1RCV D;  3PQI A;  2DGY A;  5C44 B;  3A8I E;  3I4N H;  1PMR A;  2SDF A;  3J81 j;  5LMN L;  1SE4 A;  3AFP A;  2NVX B;  1SJH D;  3EBE A;  1B3Q A;  2LXJ A;  3T1Y L;  2FJ2 A;  3H3V I;  3OMG A;  5IGG A;  1Y1W G;  2A68 D;  1NR4 A;  1N36 L;  2JA5 G;  4CBV A;  4DV2 L;  5C4Z A;  1YEZ A;  3AFQ A;  4RFB A;  4IFD H;  3H94 A;  5M5Y B;  4OX9 Q;  1I4X A;  5EKK A;  2IX1 A;  1DOL A;  2NVT H;  1B1Z A;  3VR4 A;  4HR7 B;  3UDI A;  1E22 A;  3FEW X;  1WOC A;  3T4A C;  3HOU B;  2YTX A;  4DR7 L;  3RZD H;  2UXC Q;  5KRU A;  1P16 A;  5E3F A;  3M3Y H;  1NUC A;  2F0N A;  5CV4 A;  1QNU A;  4YCW A;  2K5H A;  2DY7 A;  4V19 0;  4IQZ A;  2RHQ B;  2UUB Q;  2AUK A;  3Q8D A;  2EY6 A;  2G9H D;  3VYU A;  4IPH A;  5G3L F;  4A3G G;  5M3M B;  4LFC Q;  1ENC A;  3BZC A;  2QDB A;  4A75 A;  1SLJ A;  2N3S A;  2D9U A;  2AQ1 B;  2B2V C;  4JI7 Q;  1KAW A;  3HOX G;  3S9W A;  5FLM G;  3S1M B;  2WV6 D;  3QR8 A;  3GDE A;  1PV4 A;  1KAA A;  2NTS A;  3RNU A;  1SNQ A;  3AMU A;  4UDU C;  4R4O A;  4HJ7 A;  3S17 H;  2H1E A;  2PZT A;  3K81 C;  4KY6 A;  4HCE A;  2HIV A;  1VDZ A;  1JC7 A;  5IYC G;  5KND A;  3QB3 A;  2KEN A;  3F2B A;  1B3A A;  4OXP A;  2NVX H;  3BJU A;  1PTO H;  1XXG A;  2N88 A;  1JT8 A;  3TZU A;  5JJK A;  4MNO A;  4JBJ A;  1C48 A;  1E2Z A;  2OTJ A;  1G2T A;  5ELD A;  3D4D A;  4JBM A;  4TRD A;  1IW7 C;  5IT9 L;  1PFB A;  4RGN A;  1H9K A;  2VQF Q;  1F9P A;  3I55 A;  4GN3 B;  3I4M B;  3HOZ B;  1C9O A;  3LX0 A;  3HOU H;  4IUN A;  1JOO A;  1MJC A;  1VQA A;  1B7Y B;  3G48 A;  2RVL A;  3U50 C;  2H4O A;  3OW2 A;  3PV0 A;  4DV0 L;  3QJY A;  4UY8 C;  1TY0 A;  4M8A A;  1Q86 C;  1EEF D;  3DWP A;  1X3F A;  3PUY A;  3L3O C;  2VXW A;  3NEN A;  3PCO B;  3QO2 A;  4IUU A;  2PI2 A;  4XQQ A;  4K2K A;  5GAG C;  1PFM A;  2HHH L;  3CC4 A;  4K0K Q;  4BWG B;  2LKV A;  4XDX A;  1BCP F;  1K8O A;  4DNI A;  1JWM D;  2I07 B;  1Y1W H;  3PIO A;  2R7D A;  2JA5 H;  1EEI D;  4DV1 Q;  3CRL C;  4G7H C;  3GTO H;  3J81 L;  4ZKC B;  2K5N A;  4YY3 Q;  4LFA Q;  3FP9 A;  2KJX A;  2SOB A;  1ASZ A;  4NXN Q;  3D3R A;  2IT1 A;  2F0T A;  3X3N A;  3HS0 C;  1PH4 A;  3SR1 A;  5C3E G;  2B8G A;  2WAQ G;  3GTJ B;  3MC0 B;  5FO8 B;  2B2Y A;  2IY5 B;  2UXD L;  2B3G A;  4DK3 C;  1VQ7 A;  1YNN C;  2JYO A;  1XTD A;  1KRT A;  1I4H A;  1K0S A;  3UE1 A;  4GNX C;  3VR3 A;  1SBB B;  1D5X C;  1KAB A;  2XN9 C;  1YJW A;  5IGC A;  1WJJ A;  4HAE A;  2C35 B;  5I6W A;  3VR2 A;  5KEE A;  1Q1E A;  4UP7 A;  4A3G H;  3PF5 A;  4L5T A;  4B9X A;  1ESR A;  3KUP A;  3LNN A;  2JK8 A;  3OWF A;  4BS9 A;  2UUA Q;  2F3I A;  1N34 Q;  1SYC A;  1QVC A;  4UHV A;  4Q0F A;  4LF4 Q;  3HOX H;  2AWO A;  5JJL A;  2NVY B;  4DAP A;  5FLM H;  4H44 C;  1F9Q A;  1EFI D;  3KK7 A;  2E2H B;  3FMC A;  4ZLT F;  2JJQ A;  5E7N A;  2K5W A;  1U4M A;  4HIO A;  3C3L A;  4RGO S;  3AEV A;  4K8J A;  1N36 Q;  5IYC H;  4FYD A;  3M7N A;  3T56 B;  2XTI A;  4FXK C;  1J8I A;  5C3E B;  4DR3 Q;  4GKJ L;  1BCP D;  4JK1 C;  4DV7 L;  1F2L A;  1I3Q B;  2F3V A;  5C5L A;  1AH9 A;  1PRT B;  4HIM A;  1WCM B;  2A19 A;  4OGQ C;  2KOL A;  2VZA A;  1CA6 A;  5BN4 A;  4LMQ D;  4DK6 C;  2F0O A;  1K8A C;  2SNS A;  3BYT B;  1VQJ A;  1YZ6 A;  3H0G B;  1AFP A;  1PXU A;  4X64 L;  2MGS A;  4GKK Q;  1ZKO A;  3H3V H;  1BDO A;  2F0E A;  3MXU A;  2D0O A;  4AYB G;  3OSO A;  1OXX K;  4IZ8 A;  1IXR A;  1I4G A;  5M5X H;  3T13 A;  1FJG L;  4RHR A;  3KDF B;  3GTQ B;  5CV7 A;  1A63 A;  4G4K A;  3MEF A;  3J7Z C;  2DJF C;  2KCM A;  2L55 A;  3PUW A;  5LL6 X;  3MVV A;  5EPK A;  1BKB A;  1HTP A;  2EYM A;  4CJ2 C;  1QOH A;  5JJZ A;  5M9O A;  4U68 A;  1FGU A;  2OQK A;  4O2D A;  4R4Q A;  3C2P A;  1GKH A;  3KLS X;  4NDX A;  1JJC B;  1XJV A;  5KNC A;  2EZV A;  1Y14 B;  1I4Q A;  4B3T L;  1TWC B;  5C6A A;  4K5X A;  2MQH A;  2E2H H;  2FMM A;  1PH1 A;  4CJ0 B;  3VYR A;  4NKL A;  3BDO A;  5LL6 S;  4Y7N B;  3MA2 B;  2K1B A;  3U58 A;  1SNP A;  1O78 A;  4CHT B;  4ZUJ A;  2IX3 A;  3S24 A;  3TP8 A;  5GAE C;  4LF5 Q;  4KJN A;  3HKZ E;  2R92 G;  5C3E H;  1QB5 D;  1FYC A;  3DUZ A;  5D3D A;  3U9S A;  4K6L A;  4J8Q A;  3M4Q A;  1CZW A;  2RKS A;  1I3Q H;  5EQ0 A;  4POF A;  1BBU A;  1D5M C;  1XWE A;  1CI3 M;  3DEP A;  4A3I G;  1X56 A;  3QOJ A;  3UDX A;  3ULL A;  3G6E A;  3H09 A;  4JYA L;  3DXJ C;  3ONA B;  4HJ5 A;  4ZCK A;  1VQ5 A;  3RUZ A;  2WB1 G;  3CU7 A;  1WTH A;  5C0X J;  2I46 A;  2NZ1 D;  4IPC A;  4APV A;  1YHB A;  3VYT A;  1KL9 A;  1TWH B;  4B08 A;  1JQY D;  3R2I A;  1B4O A;  4YWL A;  3SGI A;  5M3F G;  1HFN A;  3F2U A;  1H95 A;  4KK7 A;  1PDQ A;  3VR5 A;  3PIO 3;  2EYP A;  2OWO A;  2QW7 A;  1IBK Q;  1PTO C;  2IJ0 A;  2K52 A;  2R93 B;  2NB0 A;  2Y0S G;  4BY1 G;  3TEH B;  1Q3L A;  4NPS A;  2QEJ C;  1QWY A;  3EJI A;  4U67 3;  1XNQ L;  3R8B A;  2K04 A;  3GQB A;  2HCC A;  1EU4 A;  3GTL B;  4B3S L;  4A3I B;  2NBF A;  1JB7 A;  1D6E C;  2A6H D;  4A3K G;  4AQY Q;  4HMJ A;  3HKZ B;  4Y7N H;  3CCL A;  1Z6H A;  2F3W A;  3LWU A;  2UXD Q;  4JI8 L;  4UPA A;  3CRK C;  1OXV A;  5M5W B;  3I73 A;  3HOY G;  4GN4 B;  2WB1 B;  1C4Q A;  1GHJ A;  4LF6 L;  3D4R A;  1EWC A;  5CC4 A;  1L2F A;  2XIW A;  5FO9 B;  4LF8 L;  2SNM A;  4X3U A;  5IP9 G;  4OO1 I;  3OIQ A;  2R3Z A;  2BDN A;  5M3F B;  1LTT D;  3MTS A;  2NN6 I;  1EIF A;  1ET9 A;  3HOV G;  4N8X 1;  1WVL A;  2AHO B;  4UP9 A;  1NSN S;  3KFU A;  4JV5 Q;  4WJ4 A;  3AQQ A;  4LUV A;  2B2Y C;  2HQL A;  1TWA B;  2ZTE A;  1IZ6 A;  1ET6 A;  3CF5 A;  4HJA A;  2I5M X;  1Y8N B;  4EGV A;  1GO3 E;  2FHT A;  2MUY A;  1IKM A;  3CKI B;  3R2T A;  1UAP A;  1RF2 D;  2F0P A;  4AIM A;  4A3K B;  3MAQ A;  1O7Z A;  4GKJ Q;  2V4D A;  2HT1 A;  1NE3 A;  1JMC A;  3HOY B;  1E0B A;  4A3F G;  5GAD C;  3CCJ A;  4DV3 Q;  1Q90 A;  2R92 H;  5IIF A;  2BA1 A;  1WTO A;  3K7A B;  3BG3 A;  2UXC L;  4WJ3 M;  3CHB D;  4CDF C;  1CSP A;  1V43 A;  1SMX A;  4FF4 A;  1ASY A;  3K59 A;  2R7Z G;  4A3I H;  1YHA A;  2Q8I B;  4F7X A;  4KD4 A;  1EQV A;  2CKZ B;  3UDF A;  1C7Y A;  2OQ0 A;  3J80 i;  1DGS A;  2B8F A;  3HOV B;  1HZC A;  5M5W H;  3BS1 A;  4IUV A;  1O7Y A;  4LWC A;  1WD1 A;  2J4X A;  1D2B A;  4LFC L;  4C1N K;  5CGK A;  3IL8 A;  4R1J A;  4K6D A;  5I4D A;  4P2C B;  3X3M A;  2K33 A;  4JPB W;  4X3S A;  1U9R A;  1TR5 A;  4I7Z C;  2CFM A;  3SHL A;  2F0H A;  5M3F H;  4X62 Q;  5EKI A;  1F9R A;  1MSH A;  4DK0 A;  2E2J B;  4B3T Q;  1N8R C;  1KHI A;  1HXY D;  3W1B A;  5HUR A;  4FP5 D;  2VUM G;  4BY1 H;  4OEL B;  4XYQ A;  4A3F B;  5COR A;  1BO0 A;  4H7B A;  3FPP A;  5EKL A;  1ENA A;  4OO1 G;  1JR0 D;  4DUY Q;  1V1Q A;  1TWA H;  4JI6 L;  2HD3 A;  2HCI A;  2CWP A;  1TS2 A;  4JI5 Q;  3MFY A;  1Q8I A;  2NN6 G;  2XRQ D;  1WD0 A;  4B3M Q;  3H3V C;  1W6K A;  1QNK A;  4A3K H;  1VQM A;  3G7L A;  3I70 A;  4QL5 A;  1S5D D;  2VQF L;  3HOY H;  4F88 A;  2UUC Q;  3KBG A;  1QUQ A;  1DOK A;  3I4L A;  5JPN C;  4ZKB B;  4A3D B;  3EIV A;  4DR2 L;  4JW0 A;  5IP9 H;  3C46 A;  5LMU Q;  2JN4 A;  4TKO B;  1SE8 A;  5KIX A;  1PH5 A;  3K8A A;  4ZQ3 A;  3I4N B;  2ZJQ A;  3P1H A;  1A2T A;  2D5D A;  3DM1 A;  4JBK A;  4R9W A;  5JVH 3;  1LTR D;  3JAM c;  2EYH A;  3HOV H;  4E6I A;  5CV6 A;  3TRE A;  2VUM B;  5D3I B;  4XXE A;  2B2U A;  4XYO A;  1AZQ A;  3D6C A;  1FGB D;  2JA6 G;  4PZ7 A;  3S2H H;  4QJF A;  1F2M A;  4LF9 Q;  1YJN A;  1PH9 A;  3TP6 A;  5CBE E;  5KNB A;  2F4V Q;  1U4L A;  1B8A A;  3M85 A;  1XNQ Q;  4XIG S;  4DV1 L;  1VQ8 A;  3W3A A;  5FLX c;  5I9O A;  1SND A;  1SNC A;  4B3S Q;  4LFA L;  1PRT C;  4X3K A;  4A3F H;  1U0L A;  3FPU B;  5D65 A;  2PI2 E;  4J15 A;  2MO1 A;  4JI8 Q;  2GA4 B;  1RIP A;  2F0U A;  1P8L A;  3NTI A;  2QDL A;  4R8I A;  3TP5 A;  1JB3 A;  3BYY B;  5CV9 A;  5BN3 A;  1EYG A;  1EY0 A;  1QJO A;  3HP3 A;  3K5L A;  1EY9 A;  4KKU A;  3I56 A;  1ESF A;  1QCB D;  4FXG C;  5GRO A;  4LF8 Q;  3T51 B;  3JAM E;  1LUZ A;  3HRZ C;  1NMG A;  4N9T A;  1S5F D;  2A73 B;  3Q22 A;  4NXM Q;  3SDZ A;  5A2Q E;  1KNA A;  1KLU D;  3S17 B;  4BY7 G;  2UUA L;  2I5H A;  1N34 L;  1PYS B;  5AJ3 Q;  4LF4 L;  3I3C A;  3UE0 A;  4FF3 A;  1C8C A;  5AFW A;  3HOW G;  1PTO B;  3S1R B;  1YHQ A;  4MTN A;  2DUD A;  2WKD A;  2VUM H;  4QIW B;  3SK5 A;  1UNS A;  1GXD C;  2K28 A;  2L15 A;  4YWM A;  4PNY A;  5H1S E;  4OO1 H;  2JSO A;  2OTL A;  3IRB A;  3G71 A;  1D1K A;  4DR3 L;  4L8J A;  2PQA A;  1QE6 A;  2NN6 H;  1A62 A;  4FDB A;  4CKE A;  1BR9 A;  4DV5 L;  2EOT A;  2CW0 C;  5NUC A;  5CBA E;  4P71 A;  3S2D H;  1S72 A;  4DA2 A;  2E2I H;  2JQO A;  2RSN A;  3TSS A;  4IFD J;  1BOS A;  1FNW A;  1G51 A;  1V9P A;  4GKK L;  1KD1 C;  4X65 Q;  4YHH L;  5IOC A;  2N55 A;  4BY7 B;  1PLF A;  4Y52 H;  1BXT A;  3CME A;  4GOP B;  1IKL A;  3STB D;  3GTG B;  1CKN A;  2EY1 A;  4ULL A;  3N6R A;  1EYC A;  1H9M A;  2BCO A;  4OIJ A;  3DLL A;  5ELN A;  3LWE A;  1T5E A;  3KLS A;  5DNF A;  3FKI G;  1Y1W B;  1NNX A;  2EYL A;  3J7Y W;  1I5F A;  1XPO A;  4R4T A;  2B29 A;  2JA5 B;  3UI2 A;  2LXK A;  1K3R A;  2JA6 H;  3A8K E;  4DAV A;  3GTO B;  1UEA B;  1O7L A;  5CR3 A;  4GS3 A;  3K5M A;  3MEH A;  4QUF A;  2EY2 A;  3HFZ B;  4G7O C;  2F0D A;  3PO3 G;  5FKA C;  1V8Q A;  1Y8O B;  3K0Y A;  2R7F A;  4P74 A;  3A7A B;  4ZAI A;  4JI6 Q;  4IJL A;  1VQO A;  3PSI A;  2JA7 G;  3S1R H;  4R4C A;  1B44 D;  4JI4 L;  4RAU C;  1BUV T;  4LUO A;  3Q23 A;  4LF5 L;  4BA2 I;  4IOA A;  1X3G A;  2KHJ A;  3K58 A;  3NXW A;  5IGB A;  2KED A;  1TWF B;  1VQE A;  4A3G B;  1ZEQ X;  1A6X A;  4CGY B;  4DV6 L;  1AE2 A;  5IYB G;  3Q0A A;  2OCE A;  1L1O B;  4HSP A;  2MNA A;  2PW7 A;  2EY5 A;  3K5O A;  4DR2 Q;  3HOX B;  5ELB A;  3BVZ A;  3FKI B;  3BZD B;  3HZX A;  3OTO L;  1S5E D;  2PQE A;  3VA5 A;  5GQO A;  2VL6 A;  5J3B A;  2ES2 A;  2JA8 G;  4BY7 H;  3JC6 6;  1EFW A;  1LT6 D;  3GTG H;  1H9S A;  1STH A;  2VY3 A;  1LTB D;  3PO3 B;  1X32 A;  5ELE A;  3CXC A;  1VQG A;  2AMC B;  2LMC B;  4LK1 C;  1VQC A;  4NP5 A;  3HOW H;  2HDM A;  2VB3 X;  1IBK L;  3OOC A;  4L5S A;  1NTG A;  4B3R Q;  4GOP A;  2V1C C;  1LT3 D;  5IGE A;  3MXG A;  4DGZ A;  2WAQ E;  2XGT A;  1UE5 A;  1SRU A;  1MBY A;  3GO5 A;  3K80 C;  3J80 c;  5ISR A;  1UWV A;  2QIL A;  2I0Q A;  1HH2 P;  4BBS G;  3KF6 A;  1NR2 A;  1VQL A;  2ASB A;  2K5V A;  1HR0 Q;  3Q24 A;  4ME5 A;  4AQY L;  4HJ9 A;  5KYL A;  4KY7 A;  5M5X B;  1G6Z A;  1QIL A;  2B2U C;  1EZ8 A;  4X66 L;  1MGS A;  1LO5 D;  2HQE A;  3KLR A;  1FD7 D;  1FNU A;  1DZ1 A;  4POG A;  1CFM A;  3CCM A;  5E1F A;  1EL0 A;  1TWF H;  1OXT A;  2D62 A;  2B63 G;  2L0C A;  2JA9 A;  1SE2 A;  2F0W A;  4KI0 A;  3F2C A;  2NYZ D;  3EVQ A;  1AZP A;  3RLO A;  4GZY C;  3W1G A;  4A4I A;  3I91 A;  5EPJ A;  1QVF A;  3FKI H;  5A2Q L;  2CQO A;  2ATW A;  2ICI A;  2PO4 A;  4RKL A;  4JV5 L;  3J81 i;  2VS1 A;  3ULP A;  1HTL D;  1L1O A;  4QF4 A;  3KJO A;  3PO3 H;  4HED A;  1A2U A;  3SK6 A;  2JA7 H;  1UE6 A;  5ELC A;  2NVQ H;  4S3S A;  1QG7 A;  2WAQ B;  4UP8 A;  1JOQ A;  4DV5 Q;  3EA6 A;  4DF7 A;  3NHH A;  4AYB E;  1ZYR D;  4FO2 A;  3S1N B;  4DV3 L;  2KA7 A;  1JIC A;  3A54 A;  3NQI A;  1BVS A;  3EN2 A;  4OWT B;  3NK9 A;  5EBC A;  1L0X B;  4YHH Q;  1PH7 A;  1WFQ A;  5IYB H;  1WTQ A;  2RCN A;  2WAC A;  1B9N A;  5J1Z A;  3WWV A;  4WFN 3;  5K5P A;  1N32 Q;  4LJZ C;  1VMC A;  1PZJ D;  4IPD A;  5CV5 A;  1W3S A;  1CQV A;  1CKO A;  5JEA G;  1W6J A;  3KLW A;  2JA8 H;  3D0F A;  4DNR B;  3FRP B;  2J7Z A;  3ICE A;  1LTA D;  2C9O A;  2PZW A;  3RLN A;  4JBW A;  3Q6S A;  1IYJ B;  2VB2 X;  3H6M A;  2YV5 A;  4MN3 A;  3TME A;  5HY6 A;  3IAY A;  2KHI A;  4X62 L;  2K6A A;  1SR3 A;  1L0W A;  2KBN A;  4A3B G;  4ALP A;  4H13 C;  1Q46 A;  1JOR A;  4OWW B;  5COY A;  3E0E A;  1SFO H;  4WOR A;  3GP7 A;  4JI4 Q;  4DUY L;  4LNQ A;  4MIU A;  1A3U A;  2C5C A;  4JI3 L;  2BH8 A;  3MZ5 A;  1LT5 D;  4JI5 L;  1ROD A;  1E2V A;  4F87 A;  4BBS H;  3J7A F;  1VQH A;  1NAP A;  4B3M L;  1EY4 A;  3P7J A;  4A3E G;  4AYB B;  2EQS A;  2ZTD A;  4JI0 L;  3CC2 A;  1TY2 A;  3NEL A;  1HQR D;  2WB1 E;  1GUW A;  4DV6 Q;  5IGD A;  1GHK A;  1PH8 A;  2EJM A;  2UUC L;  3S1N H;  1WTP A;  1WI5 A;  1Z9F A;  5C4X G;  5BN5 A;  1S3O A;  1AW7 A;  2PYK A;  5I6Y A;  2F03 A;  3GV6 A;  4AH6 A;  3OTO Q;  2B63 H;  1G91 A;  1DON A;  1SEB D;  3DWQ A;  5K36 G;  3RZO B;  5LMU L;  3G6J B;  2MFI A;  3VA7 A;  5C3W A;  1UEB A;  4KN4 C;  1X3P A;  2Y0S E;  3TS2 A;  3M4P A;  2Z9H A;  1CZG A;  1FL0 A;  1Q12 A;  5T1G A;  4DV4 L;  1K9M C;  1VQ9 A;  1ICF B;  1HUM A;  1GUO A;  1STE A;  2EYO A;  2WFW A;  1II3 A;  3SEB A;  1EIH A;  2X69 A;  4LF9 L;  4DU9 A;  1KXL A;  3FHW A;  2DNE A;  1PRT D;  3D6W A;  4YCU A;  1XPR A;  2R92 B;  2A69 C;  2F4V L;  4A3E B;  4RG1 A;  1STA A;  2MPM A;  3CP0 A;  2Q2U A;  2GVB A;  5C4H A;  4R4I A;  1U5K A;  2DNC A;  2KQ3 A;  2RDF A;  1MKH A;  3TP7 A;  3HEJ A;  3KBX A;  3V2T A;  1JJ2 A;  2F0V A;  2NZH A;  1PHJ A;  2O2L D;  4G7Z C;  4X66 Q;  2EYF A;  5BR8 Q;  4C3J G;  1CTM A;  5A35 A;  4DR6 Q;  4GOP C;  2XWB B;  1VQ6 A;  1I6V C;  5JEA H;  1WTX A;  1EY7 A;  2NZO A;  4ILW A;  1IHZ A;  1MSG A;  4P75 A;  3CCV A;  5IOD A;  3R93 A;  4NXM L;  1Z47 A;  1HR0 W;  1GJX A;  1PFN A;  2DJG C;  2Y0S B;  4BY1 B;  1KC8 C;  1TS4 A;  5AJ3 L;  1EWI A;  1PYW D;  3RZO H;  4IUQ A;  3CMA A;  2NUC A;  1EWH A;  3A8J E;  2KCT A;  3ITP A;  4A3B H;  3I90 A;  4IFD I;  3I7F A;  2LFN A;  1I50 H;  4JC0 A;  1QUQ B;  1X3Q A;  2SEB D;  4B9W A;  2PNH A;  2VW9 A;  1HA5 A;  1SNM A;  1YBY A;  1PH6 A;  5E4X A;  3D4W A;  1N33 Q;  3NPP A;  2AWN A;  4RKB A;  4C3J B;  4A3E H;  2CQA A;  4DPG A;  3PMF A;  4XT3 B;  3T16 A;  1A3T A;  1GUT A;  2K03 A;  4DK1 A;  1MI2 A;  3D8G A;  1HNW Q;  2QA4 A;  2PW5 A;  5IE8 A;  1VF7 A;  1L1O C;  5C4X H;  4X65 L;  1M8A A;  5I2Y A;  2WII B;  3CQZ B;  1VQI A;  2EXD A;  4RCN A;  3RMH A;  1SYD A;  3E0J A;  1HCZ A;  2UXB Q;  2QGQ A;  5FK9 C;  1CK1 A;  1ML0 D;  3AU7 A;  5K36 H;  4RA8 A;  3NTH A;  1BCP C;  4HN7 A;  2N8N A;  2F1M A;  2XNA C;  3CPF A;  4R8N A;  5IT9 c;  3S2H B;  4GLA C;  3S1Q H;  4PMW A;  4TSS A;  3TDQ A;  4EVO A;  2A74 C;  2XRS D;  5JVG 3;  2A6E C;  2L12 A;  1NY4 A;  3NBI A;  1IL2 A;  1A8V A;  5IY0 A;  2KEE A;  5E4W C;  2JXM B;  2ALY B;  3ZJY C;  1Y1V G;  5DAU A;  3PIP A;  2CH4 A;  3TBI B;  1VQD A;  4G57 A;  3H91 A;  1DOM A;  1YNJ C;  1IW7 D;  1RL2 A;  5J39 A;  4JI3 Q;  1G8Z D;  1HUN A;  1VQK A;  4L5Q A;  2R7Z B;  3NBH A;  1QZG A;  1XNR Q;  1BBW A;  1ONL A;  3GTM B;  4JI0 Q;  4DXG A;  3ULJ A;  1VQ4 A;  1Q1B A;  4DAY A;  4A3M G;  4LUZ A;  4IFD G;  4C3J H;  3A56 A;  3K57 A;  2A5H A;  1BBX C;  2E2D C;  3A74 A;  3J81 c;  1WTR A;  3SE0 A;  4I65 A;  3MXP A;  4ODG A;  4KY5 A;  1SAP A;  4C1N I;  2RQX A;  4V0B A;  1SMY C;  1E1T A;  3OPO A;  4IJH A;  4C3I G;  1SYB A;  1TXY A;  5JOB A;  2K5D A;  3CQZ H;  3D31 A;  2PQA B;  1X65 A;  3PO2 G;  4PQX A;  2RDH A;  3I72 A;  4HIK A;  2KVM A;  5CYU A;  4DV4 Q;  3LGJ A;  2OF1 A;  4QMG A;  1JCK B;  1VQN A;  2PMZ B;  3CPW A;  1QZH A;  2BA0 A;  2N78 A;  3J7A 5;  4QIW E;  1HFG A;  3NP8 A;  3SVM A;  3DHQ A;  4H0L C;  3TS0 A;  1IBM Q;  4B3R L;  2E8G A;  1EZ6 A;  3F1Z A;  2JP1 A;  2BE5 C;  2F0L A;  3BU2 A;  4OWX B;  4BBR G;  2EJF C;  3S2D B;  1HZB A;  2A1A A;  4DR4 L;  3AYH B;  1JWS D;  2FIN B;  1CKN B;  3GTK H;  2Q8T A;  2E2I B;  5JPM C;  2K7V A;  1YNN D;  1SRO A;  3J7A V;  1LTL A;  1IYU A;  4GNX A;  2PPB C;  1IBL L;  3PF4 A;  3GV3 A;  3I4O A;  1HR0 L;  5C44 G;  1B53 A;  3CW2 C;  4KKS A;  1CKM A;  1CT1 D;  3NWT A;  2R7Z H;  3CCQ A;  3TZD A;  2KCN A;  3RLF A;  1HNX Q;  4EQN A;  2H5X A;  3GTM H;  2RCF A;  2K32 A;  3A5Z B;  3ZYY X;  3EFX D;  2EDG A;  2YU9 B;  3KF8 A;  3F2D A;  1S5B D;  1S5C D;  1EY6 A;  1SE3 A;  2QKI C;  3CC7 A;  1AE3 A;  4OHJ A;  2JA6 B;  1XMO L;  1KDA A;  1SNO A;  4FF1 A;  4CDC C;  1TS5 A;  4KKT A;  1RDP D;  1G6P A;  4IUT A;  4L6T B;  3CD6 A;  3CCS A;  1R4P B;  4WJW A;  1F77 A;  1CA5 A;  3KOJ A;  4FVM A;  1E3P A;  1YI2 A;  5FLX E;  2IWH A;  4HSV A;  1Y1V H;  1EY5 A;  4RCO A;  1PZI D;  4GLX A;  1VMP A;  2DY8 A;  3NQT A;  1ILP A;  4MTK A;  1HQM C;  3C1E A;  1ZXT A;  1BQQ T;  5M3M G;  2Q2T A;  2M2L A;  1STN A;  1X3E A;  3VDY A;  1N9W A;  2F0M A;  2Q2H A;  3RN5 A;  4DXF A;  1Y8P B;  1H9S B;  4P72 A;  1CUK A;  2KCC A;  1MJE A;  4ABN A;  4DN4 M;  2JE6 I;  3TQY A;  4H02 A;  4A3M H;  1IL8 A;  1K83 H;  3E5S A;  2YTV A;  3L2P A;  2GN5 A;  1AEX A;  3GTP H;  2AQ3 B;  2B39 A;  4EQ5 A;  1PTO F;  4A3C G;  3A0J A;  1N32 L;  2O5I C;  5CMD A;  4QUC A;  4K14 A;  3EQL C;  1LV9 A;  3NWS A;  2ZXP A;  2K75 A;  2Q8R E;  4C3I H;  1TWG B;  5EAY A;  3OHX C;  4NW2 A;  3HOW B;  2D0P A;  1R4Q B;  3PO2 H;  1HA6 A;  3PUZ A;  4LW1 A;  2YU9 H;  1T9H A;  3KF6 B;  1CQF A;  3VYS A;  1ICW A;  4X6A H;  2MP1 A;  4PMC A;  3WOF A;  1X6O A;  1EYD A;  2PNR C;  2VQE Q;  4LFB Q;  2WP8 J;  3FVQ A;  5I9P A;  3PIP 3;  1SYG A;  1VQP A;  1LM0 A;  1R9T B;  1L0Y B;  3I4M G;  1VS0 A;  4KLK A;  4JI1 Q;  3HOZ G;  4C2M H;  2L5T A;  2MJ8 A;  1V1P A;  1D5Z C;  2OT2 A;  3T53 B;  3KJP A;  1XMQ Q;  4BBR H;  2N49 A;  2EPB A;  4IOC A;  1WTW A;  4FF2 A;  2IX0 A;  2QF7 A;  1JE5 A;  2YYZ A;  1Y69 U;  3I2Z A;  1LTS D;  5C0X I;  1I4P A;  2TSS A;  1J9O A;  1KRS A;  1U4R A;  2IHF A;  1D7Q A;  3MXN A;  1EIG A;  2E5L Q;  4A3L G;  5C44 H;  1DYQ A;  3K5N A;  2F0J A;  2K50 A;  3P20 A;  4L5R C;  5IWA Q;  1OXS C;  5GAH C;  3T1H L;  4ID6 A;  2O4X A;  4JI2 L;  4IUP A;  3SK8 A;  5JJI A;  1ENF A;  2RSO A;  2AKW B;  3O13 A;  2M9V A;  1TS3 A;  4CKB A;  3DM3 A;  1BCP B;  5M5Y H;  1YIT A;  4KJO A;  4JCV E;  2GVA A;  4JOI A;  1PTO D;  1UE7 A;  2R6G A;  3E9H A;  1Q81 C;  1LTG D;  5L37 A;  2FXQ A;  1TQO A;  1J5E Q;  2DN8 A;  4DUZ L;  3S15 B;  1TWG H;  2A69 D;  1I94 L;  4ZUI A;  2JA7 B;  2D2C C;  2NVQ B;  3RD4 A;  3ERO A;  1YIJ A;  1F9S A;  3QIA A;  1NCV A;  4JVZ A;  3VR6 A;  4J6H A;  2F52 A;  1STG A;  3OWE B;  4DR4 Q;  5EJW A;  3H15 A;  2F0G A;  3GD7 A;  4M1U B;  3FDT A;  1R9T H;  5G3L D;  5M3M H;  1B9M A;  4IO9 A;  3NEM A;  2X6G A;  4PMB A;  5FJ8 G;  1IBL Q;  1F2Z A;  1XTC D;  4NB3 A;  1LLR D;  1YVC A;  3S1M H;  3MHB A;  1OXU A;  2LY7 A;  3M9B A;  5HGT A;  1DXM A;  4DR5 L;  4CKC A;  2E75 C;  3BZK A;  5BR8 L;  2JA8 B;  3HKS A;  1MD2 D;  2Z6K A;  4A3C H;  1EU3 A;  4QB4 A;  3CCU A;  4DR6 L;  4JG2 A;  1RD9 D;  2VNU D;  2KHS A;  1STY A;  5DLQ E;  3U4V A;  2CCZ A;  3JAM L;  1DJR D;  1GOZ A;  2JEB I;  2Z6B A;  1XMO Q;  1E7Z A;  5C0X G;  2IW3 A;  1WCM G;  1XX8 A;  3HGB A;  1E24 A;  1KTK A;  1SFO B;  4RGM A;  3E9I A;  2K14 A;  4QCL A;  1NBW A;  3H0G G;  4HMI A;  3M4Y A;  3I4M H;  5DEH A;  3HOZ H;  3E6Z X;  5C5M A;  4ZK9 B;  2J0T D;  3J80 E;  4QY7 A;  1DM0 B;  4BBS B;  4F8M A;  2Q2I A;  1DCZ A;  2HDL A;  4A76 A;  3S15 H;  5FLX L;  4RHS A;  1A15 A;  4MHE A;  3TN2 A;  5C4J B;  2MHV A;  5LMN Q;  1M4V A;  1N33 L;  3K7U C;  3NUC A;  3T1Y Q;  2XWJ B;  2L4N A;  1JWU D;  4A3L H;  3CCR A;  1PH2 A;  1WTV A;  1GUN A;  4DV2 Q;  1TKW B;  4MZ9 A;  3URY A;  2B63 B;  4HTH A;  2RF4 A;  2Z8L A;  3JAM i;  1A0I A;  1A3V A;  4DR1 L;  1HZA A;  2CHB D;  3RR5 A;  1HNW L;  2OXP A;  2A68 C;  2BDO A;  4IAL A;  2EYJ A;  4FNF A;  4DR7 Q;  2Z1C A;  3W2D A;  2UXB L;  5J22 A;  2Z4H A;  2ID0 A;  4A3J G;  1E2W A;  1O80 A;  2A6E D;  4KD3 A;  2JEA I;  1ILQ A;  5IYD G;  1LAB A;  4C3H G;  1QVG A;  4KHV A;  1KQS A;  1PRT F;  2QCP X;  4PZ8 A;  1EQT A;  1LYL A;  1HNZ L;  3GTJ H;  2M00 A;  3I8Z A;  4BA1 I;  1B2T A;  4CDE C;  1YNJ D;  4OON A;  2EIF A;  3DEO A;  3TRZ A;  3IKJ A;  1XYI A;  2L1B A;  3V05 A;  4CJ1 B;  3ERS X;  2ICE C;  5IP7 G;  1MHW C;  1X54 A;  3RN2 A;  3STB C;  4GLV B;  2ZXR A;  3K6O A;  5D14 A;  4C56 C;  4TVA B;  2UU9 L;  1M1K C;  1RHP A;  1EYA A;  5FJ8 H;  1HRJ A;  3SXH A;  3CAM A;  2B2W A;  1Q82 C;  5C4J H;  1XNR L;  1SN8 A;  2ZJR A;  2NVY H;  4KMU C;  4I7A A;  5FO7 B;  1MIU A;  3C1F A;  1SXT A;  4LF7 L;  1SYE A;  2ZXO A;  2F0S A;  2ZM6 L;  2ZTC A;  2LS0 1;  4X3T A;  5LHY 1;  3T1H Q;  2QEX A;  1U4P A;  4JI2 Q;  2G9D A;  4A3J B;  1AP0 A;  2O5J C;  3QG1 A;  1SMY D;  3QWN A;  2R93 G;  2Z0S A;  3R3O A;  2K05 A;  3ND9 A;  1PA6 A;  4C3H B;  1UE1 A;  1K8G A;  1RTN A;  2YTY A;  2F4I A;  1BF4 A;  4FXD A;  1EQQ A;  1F2Y A;  1EIY B;  2ZT9 C;  5C0X H;  1K0R A;  3PUV A;  4HJ8 A;  4A3B B;  1EOV A;  1I6H B;  3L9A X;  1WCM H;  1B50 A;  3NTK A;  4DUZ Q;  4KHP L;  3SK4 A;  1I50 B;  4DAM A;  3ND8 A;  4XT1 B;  1CHP D;  1TII D;  3HKZ G;  1I94 Q;  4BXX G;  2LSS A;  2BE5 D;  3QOL A;  5CV8 A;  3H0G H;  4DV0 Q;  4QGU A;  2MO0 A;  4K2L A;  2TMP A;  1TU2 B;  2CH4 W;  1G2S A;  2CWA A;  5JAV A;  2B2T A;  1IBM L;  4K5V A;  2HHH Q;  1OTC A;  2Z4I A;  1FVI A;  3GTQ H;  4KHZ A; 
#chains in the Genus database with same CATH homology
 1VCI A;  4IUR A;  1UUP A;  5EPL A;  2IPK D;  2NTT A;  5C4X B;  3WOE A;  2F0Q A;  1SDF A;  3OIP A;  3OMC A;  4UAI A;  1RKN A;  4N9P A;  1BNZ A;  4XQN A;  3M7G A;  2EVB A;  3S1Q B;  3MFG A;  4RWS C;  1SSO A;  1TT2 A;  3IFT A;  4L63 B;  4YIJ A;  4DNT B;  2WKC A;  1JE4 A;  3PUX A;  2IL8 A;  4ZYS A;  1SJE D;  1IYV A;  5JEA J;  1RTO A;  3BVG A;  1TVX A;  3DWA A;  5DM6 3;  4Q5V A;  3A55 A;  1LT4 D;  2CW0 D;  3J80 L;  4OL7 A;  4EQP A;  1EOT A;  1KDB A;  2RDG A;  3M4O B;  1RJT A;  1FR3 A;  2CVR A;  3IFD A;  5T1I A;  3DMU A;  2KEC A;  3S14 B;  2EE1 A;  2E76 C;  5F2D A;  5EBD A;  1KLG D;  2B2V A;  1VF5 C;  2WIN B;  5DM7 3;  2PCF B;  4A93 B;  1H9R A;  2BOS A;  5KYI A;  3NSW A;  2HUG A;  1AN8 A;  5I2X A;  2K01 A;  4TQU S;  1OO9 B;  5EGT A;  1CHQ D;  2X6L A;  5ELF A;  4RGT A;  2OEO A;  1ZYR C;  1T5X D;  3AB9 A;  4RH6 A;  2XVS A;  5C3X A;  2L9H A;  1D1I A;  3GTK B;  1LTI D;  3ERQ A;  4EQO A;  1G29 1;  2K5Q A;  4PV1 C;  3MWY W;  2AUJ D;  1HHV A;  3NE5 B;  1GUS A;  4NMZ A;  5KGU A;  2ENB A;  3S16 B;  2KUM A;  4LAA A;  4K8I A;  3BDC A;  4Z9C B;  3P75 A;  5IT9 E;  2XSC A;  1K8M A;  2NWG A;  4J1M A;  1LAC A;  3V96 A;  2RA4 A;  4KTA A;  3HG9 A;  1Y1V B;  2RBM A;  1SYF A;  3BDL A;  2B2W C;  2FFK B;  2AQ2 B;  1S4Z A;  1EY8 A;  1V1O A;  3L7Z C;  1JOK A;  1KNE A;  1I4R A;  1CM9 A;  4HCS A;  4XQJ A;  2F0K A;  4IN3 A;  4OIK A;  3U9O A;  4A3M B;  1K83 B;  4DFA A;  3GTP B;  2PZU A;  1GUG A;  2NVT B;  3WDN A;  1Z7T A;  3J81 E;  1H9J A;  2L11 A;  5IGF A;  2EJG C;  2F0F A;  2FMC A;  3RZD B;  1STB A;  2EXZ A;  4C3I B;  3M3Y B;  4O1N A;  3PO2 B;  3BVM A;  3OW7 A;  1V1P B;  2B2T C;  4WRD A;  4ZRZ A;  2F0I A;  1DD2 A;  1KDC A;  2A6H C;  4K5W A;  4C2M B;  4KV6 A;  2R61 A;  4O42 A;  5TSS A;  4BBR B;  4KN7 C;  1HPC A;  3N52 A;  1FNV A;  3A7L A;  4XTC S;  1PZK D;  5FOB B;  2E74 C;  1RCV D;  5C44 B;  3A8I E;  1PMR A;  2SDF A;  1SE4 A;  2NVX B;  1SJH D;  2FJ2 A;  3OMG A;  5IGG A;  2A68 D;  1NR4 A;  4CBV A;  5C4Z A;  4RFB A;  4IFD H;  3H94 A;  5M5Y B;  1I4X A;  5EKK A;  2IX1 A;  1DOL A;  1B1Z A;  3VR4 A;  4HR7 B;  3FEW X;  3T4A C;  3HOU B;  5KRU A;  5E3F A;  1NUC A;  2F0N A;  5CV4 A;  1QNU A;  2DY7 A;  4V19 0;  4IQZ A;  2AUK A;  2EY6 A;  2G9H D;  3VYU A;  5G3L F;  5M3M B;  1ENC A;  2QDB A;  2D9U A;  2AQ1 B;  2B2V C;  3S9W A;  3S1M B;  2WV6 D;  1KAA A;  2NTS A;  1SNQ A;  3AMU A;  4UDU C;  2H1E A;  2PZT A;  4KY6 A;  4HCE A;  1VDZ A;  1JC7 A;  5KND A;  3QB3 A;  1B3A A;  1PTO H;  1XXG A;  2N88 A;  3TZU A;  1C48 A;  1E2Z A;  1G2T A;  5ELD A;  3D4D A;  4TRD A;  1IW7 C;  5IT9 L;  1PFB A;  4RGN A;  1H9K A;  1F9P A;  3I4M B;  3HOZ B;  3LX0 A;  4IUN A;  1JOO A;  2RVL A;  2H4O A;  3PV0 A;  3QJY A;  1TY0 A;  4M8A A;  1EEF D;  3DWP A;  3PUY A;  3L3O C;  2VXW A;  3QO2 A;  4IUU A;  4XQQ A;  4K2K A;  1PFM A;  4BWG B;  2LKV A;  4XDX A;  1BCP F;  1K8O A;  1JWM D;  2I07 B;  1EEI D;  3CRL C;  4G7H C;  3J81 L;  4ZKC B;  2KJX A;  2SOB A;  3D3R A;  2IT1 A;  2F0T A;  3X3N A;  3HS0 C;  3SR1 A;  2B8G A;  3GTJ B;  3MC0 B;  5FO8 B;  2B2Y A;  1YNN C;  2JYO A;  1I4H A;  3VR3 A;  1SBB B;  1D5X C;  1KAB A;  2XN9 C;  5IGC A;  4HAE A;  5I6W A;  3VR2 A;  5KEE A;  1Q1E A;  4B9X A;  1ESR A;  3KUP A;  3LNN A;  4BS9 A;  3OWF A;  1SYC A;  4Q0F A;  2AWO A;  2NVY B;  4DAP A;  4H44 C;  1F9Q A;  1EFI D;  3KK7 A;  2E2H B;  3FMC A;  4ZLT F;  2K5W A;  1U4M A;  3C3L A;  4RGO S;  4K8J A;  4FYD A;  3M7N A;  3T56 B;  4FXK C;  1J8I A;  5C3E B;  1BCP D;  4JK1 C;  1F2L A;  1I3Q B;  2F3V A;  5C5L A;  1PRT B;  1WCM B;  4OGQ C;  2KOL A;  1CA6 A;  5BN4 A;  4LMQ D;  2F0O A;  2SNS A;  3BYT B;  3H0G B;  1AFP A;  1PXU A;  2MGS A;  1ZKO A;  1BDO A;  2F0E A;  3MXU A;  3OSO A;  1OXX K;  4IZ8 A;  1I4G A;  3T13 A;  4RHR A;  3GTQ B;  5CV7 A;  4G4K A;  2L55 A;  5LL6 X;  3PUW A;  3MVV A;  5EPK A;  1HTP A;  2EYM A;  4CJ2 C;  1QOH A;  5JJZ A;  5M9O A;  4U68 A;  3C2P A;  3KLS X;  4NDX A;  5KNC A;  2EZV A;  1I4Q A;  1TWC B;  5C6A A;  4K5X A;  2FMM A;  4CJ0 B;  3VYR A;  4NKL A;  3BDO A;  5LL6 S;  4Y7N B;  3MA2 B;  2K1B A;  1SNP A;  1O78 A;  4CHT B;  4ZUJ A;  2IX3 A;  3TP8 A;  4KJN A;  1QB5 D;  1FYC A;  3DUZ A;  5D3D A;  3U9S A;  4K6L A;  4J8Q A;  1CZW A;  2RKS A;  5EQ0 A;  1D5M C;  1XWE A;  1CI3 M;  3DEP A;  3QOJ A;  3H09 A;  3DXJ C;  3ONA B;  3RUZ A;  3CU7 A;  5C0X J;  2I46 A;  2NZ1 D;  3VYT A;  1TWH B;  4B08 A;  1JQY D;  3R2I A;  1B4O A;  1HFN A;  3F2U A;  4KK7 A;  1PDQ A;  3VR5 A;  3PIO 3;  2EYP A;  1PTO C;  2IJ0 A;  2R93 B;  2NB0 A;  1Q3L A;  2QEJ C;  1QWY A;  3EJI A;  4U67 3;  3R8B A;  2K04 A;  3GQB A;  2HCC A;  1EU4 A;  3GTL B;  4A3I B;  2NBF A;  1D6E C;  2A6H D;  4HMJ A;  3HKZ B;  1Z6H A;  2F3W A;  3LWU A;  3CRK C;  1OXV A;  5M5W B;  3I73 A;  2WB1 B;  1C4Q A;  1GHJ A;  3D4R A;  1EWC A;  5CC4 A;  2XIW A;  5FO9 B;  2SNM A;  4X3U A;  4OO1 I;  3OIQ A;  2R3Z A;  2BDN A;  5M3F B;  1LTT D;  3MTS A;  2NN6 I;  1ET9 A;  1WVL A;  1NSN S;  2B2Y C;  1TWA B;  1ET6 A;  1Y8N B;  4EGV A;  2FHT A;  2MUY A;  1IKM A;  3CKI B;  3R2T A;  1UAP A;  1RF2 D;  2F0P A;  4A3K B;  3MAQ A;  1O7Z A;  2V4D A;  3HOY B;  1E0B A;  1Q90 A;  5IIF A;  2BA1 A;  1WTO A;  3K7A B;  3BG3 A;  3CHB D;  1V43 A;  4FF4 A;  3K59 A;  2Q8I B;  4F7X A;  4KD4 A;  1EQV A;  2B8F A;  3HOV B;  3BS1 A;  4IUV A;  1O7Y A;  1WD1 A;  2J4X A;  1D2B A;  5CGK A;  4C1N K;  3IL8 A;  4K6D A;  5I4D A;  4P2C B;  3X3M A;  2K33 A;  4X3S A;  1U9R A;  1TR5 A;  4I7Z C;  3SHL A;  2F0H A;  5EKI A;  1F9R A;  1MSH A;  4DK0 A;  2E2J B;  1HXY D;  5HUR A;  4FP5 D;  4XYQ A;  4A3F B;  5COR A;  1BO0 A;  4H7B A;  3FPP A;  5EKL A;  1ENA A;  4OO1 G;  1JR0 D;  2HCI A;  1TS2 A;  3MFY A;  1Q8I A;  2NN6 G;  2XRQ D;  1WD0 A;  3H3V C;  1W6K A;  1QNK A;  3G7L A;  3I70 A;  1S5D D;  4F88 A;  3KBG A;  1DOK A;  3I4L A;  5JPN C;  4ZKB B;  4A3D B;  3C46 A;  4TKO B;  5KIX A;  4ZQ3 A;  3I4N B;  3P1H A;  1A2T A;  2D5D A;  3DM1 A;  4R9W A;  5JVH 3;  1LTR D;  2EYH A;  4E6I A;  5CV6 A;  2VUM B;  5D3I B;  4XXE A;  2B2U A;  4XYO A;  1AZQ A;  3D6C A;  1FGB D;  1F2M A;  3TP6 A;  5CBE E;  5KNB A;  1U4L A;  3M85 A;  4XIG S;  3W3A A;  5I9O A;  1SND A;  1SNC A;  1PRT C;  4X3K A;  3FPU B;  5D65 A;  2GA4 B;  2F0U A;  3NTI A;  4R8I A;  3TP5 A;  1JB3 A;  3BYY B;  5CV9 A;  5BN3 A;  1EY0 A;  1QJO A;  3HP3 A;  3K5L A;  1EY9 A;  4KKU A;  1ESF A;  1QCB D;  4FXG C;  3T51 B;  3JAM E;  3HRZ C;  4N9T A;  1S5F D;  2A73 B;  3Q22 A;  3SDZ A;  5A2Q E;  1KNA A;  1KLU D;  3S17 B;  3I3C A;  4FF3 A;  1C8C A;  5AFW A;  1PTO B;  3S1R B;  2WKD A;  4QIW B;  3SK5 A;  1UNS A;  1GXD C;  2K28 A;  4PNY A;  4OO1 H;  2JSO A;  1D1K A;  4L8J A;  1QE6 A;  2NN6 H;  4CKE A;  1BR9 A;  2EOT A;  2CW0 C;  5NUC A;  5CBA E;  4DA2 A;  2RSN A;  3TSS A;  4IFD J;  1BOS A;  1FNW A;  5IOC A;  2N55 A;  4BY7 B;  1PLF A;  1BXT A;  1IKL A;  3GTG B;  2EY1 A;  4ULL A;  3N6R A;  1EYC A;  1H9M A;  2BCO A;  4OIJ A;  3LWE A;  1T5E A;  3KLS A;  5DNF A;  1Y1W B;  2EYL A;  3J7Y W;  2JA5 B;  3UI2 A;  3A8K E;  4DAV A;  3GTO B;  1UEA B;  1O7L A;  5CR3 A;  3K5M A;  3MEH A;  4QUF A;  2EY2 A;  4G7O C;  2F0D A;  5FKA C;  1V8Q A;  1Y8O B;  3K0Y A;  4ZAI A;  3A7A B;  1B44 D;  4RAU C;  1BUV T;  3Q23 A;  4BA2 I;  3K58 A;  3NXW A;  5IGB A;  2KED A;  1TWF B;  4A3G B;  1ZEQ X;  1A6X A;  4CGY B;  3Q0A A;  4HSP A;  2PW7 A;  2EY5 A;  3K5O A;  3HOX B;  5ELB A;  3BVZ A;  3FKI B;  3BZD B;  3HZX A;  1S5E D;  2PQE A;  3VA5 A;  1LT6 D;  1H9S A;  1STH A;  1LTB D;  3PO3 B;  1X32 A;  5ELE A;  4LK1 C;  2LMC B;  4NP5 A;  2HDM A;  2VB3 X;  3OOC A;  1LT3 D;  5IGE A;  3MXG A;  4DGZ A;  1MBY A;  3GO5 A;  5ISR A;  2QIL A;  1NR2 A;  3Q24 A;  4ME5 A;  5KYL A;  4KY7 A;  5M5X B;  1G6Z A;  1QIL A;  2B2U C;  1EZ8 A;  1MGS A;  1LO5 D;  2HQE A;  3KLR A;  1FD7 D;  1FNU A;  1DZ1 A;  1CFM A;  5E1F A;  1EL0 A;  1OXT A;  2D62 A;  2L0C A;  1SE2 A;  2F0W A;  4KI0 A;  2NYZ D;  3EVQ A;  1AZP A;  4GZY C;  3I91 A;  5EPJ A;  5A2Q L;  2ICI A;  2PO4 A;  4RKL A;  1HTL D;  4QF4 A;  4HED A;  1A2U A;  3SK6 A;  5ELC A;  4S3S A;  1QG7 A;  2WAQ B;  1JOQ A;  3EA6 A;  4DF7 A;  3NHH A;  1ZYR D;  4FO2 A;  3S1N B;  2KA7 A;  1JIC A;  3A54 A;  3NQI A;  3NK9 A;  5EBC A;  1L0X B;  1WTQ A;  2WAC A;  1B9N A;  5J1Z A;  4WFN 3;  5K5P A;  4LJZ C;  1VMC A;  1PZJ D;  5CV5 A;  1CQV A;  5JEA G;  1W6J A;  4DNR B;  3FRP B;  2J7Z A;  1LTA D;  2C9O A;  2PZW A;  4JBW A;  3Q6S A;  2VB2 X;  3H6M A;  4MN3 A;  3TME A;  3IAY A;  2K6A A;  4H13 C;  1JOR A;  5COY A;  4WOR A;  3GP7 A;  4MIU A;  1A3U A;  2C5C A;  3MZ5 A;  1LT5 D;  1ROD A;  1E2V A;  4F87 A;  3J7A F;  1NAP A;  1EY4 A;  3P7J A;  4AYB B;  1TY2 A;  1HQR D;  1GUW A;  5IGD A;  1GHK A;  2EJM A;  1WTP A;  5BN5 A;  1AW7 A;  2PYK A;  5I6Y A;  2F03 A;  3GV6 A;  1G91 A;  1DON A;  1SEB D;  3DWQ A;  5K36 G;  3RZO B;  3G6J B;  3VA7 A;  5C3W A;  4KN4 C;  1X3P A;  1CZG A;  1Q12 A;  5T1G A;  1HUM A;  1GUO A;  1STE A;  2EYO A;  1II3 A;  3SEB A;  1EIH A;  2X69 A;  4DU9 A;  2DNE A;  1PRT D;  3D6W A;  2R92 B;  2A69 C;  4A3E B;  1STA A;  2MPM A;  5C4H A;  2DNC A;  2KQ3 A;  2RDF A;  3TP7 A;  3HEJ A;  3KBX A;  3V2T A;  2F0V A;  2O2L D;  4G7Z C;  2EYF A;  4C3J G;  1CTM A;  5A35 A;  2XWB B;  1I6V C;  5JEA H;  1WTX A;  1EY7 A;  4ILW A;  1IHZ A;  1MSG A;  5IOD A;  3R93 A;  1Z47 A;  1GJX A;  1PFN A;  2Y0S B;  4BY1 B;  1TS4 A;  1PYW D;  4IUQ A;  2NUC A;  1EWH A;  3A8J E;  3ITP A;  3I90 A;  4IFD I;  2LFN A;  1X3Q A;  2SEB D;  4B9W A;  1HA5 A;  1SNM A;  5E4X A;  3D4W A;  3NPP A;  2AWN A;  4RKB A;  4C3J B;  2CQA A;  3PMF A;  4XT3 B;  3T16 A;  1A3T A;  1GUT A;  2K03 A;  4DK1 A;  1MI2 A;  3D8G A;  2PW5 A;  1VF7 A;  1M8A A;  5I2Y A;  2WII B;  3CQZ B;  4RCN A;  3RMH A;  1SYD A;  3E0J A;  1HCZ A;  5FK9 C;  1CK1 A;  1ML0 D;  3AU7 A;  5K36 H;  4RA8 A;  3NTH A;  1BCP C;  4HN7 A;  2F1M A;  2XNA C;  4R8N A;  3S2H B;  4PMW A;  4TSS A;  3TDQ A;  4EVO A;  2A74 C;  2XRS D;  5JVG 3;  2A6E C;  2L12 A;  3NBI A;  2KEE A;  5E4W C;  2JXM B;  5DAU A;  3TBI B;  4G57 A;  3H91 A;  1DOM A;  1YNJ C;  1IW7 D;  5J39 A;  1G8Z D;  1HUN A;  2R7Z B;  3NBH A;  1ONL A;  3GTM B;  4DXG A;  1Q1B A;  4DAY A;  4IFD G;  3A56 A;  3K57 A;  2A5H A;  1BBX C;  2E2D C;  1WTR A;  3SE0 A;  4I65 A;  3MXP A;  4ODG A;  4KY5 A;  1SAP A;  4C1N I;  2RQX A;  4V0B A;  1SMY C;  3OPO A;  4C3I G;  1SYB A;  5JOB A;  2K5D A;  3D31 A;  4PQX A;  2RDH A;  3I72 A;  2KVM A;  5CYU A;  2OF1 A;  4QMG A;  1JCK B;  2PMZ B;  2BA0 A;  1HFG A;  3NP8 A;  3SVM A;  3DHQ A;  4H0L C;  1EZ6 A;  2JP1 A;  2BE5 C;  2F0L A;  2EJF C;  3S2D B;  1JWS D;  2FIN B;  2Q8T A;  2E2I B;  5JPM C;  2K7V A;  1YNN D;  3J7A V;  1IYU A;  2PPB C;  3GV3 A;  1B53 A;  4KKS A;  1CT1 D;  3NWT A;  3TZD A;  2KCN A;  3RLF A;  4EQN A;  2K32 A;  3ZYY X;  3EFX D;  2EDG A;  2YU9 B;  3KF8 A;  1S5B D;  1S5C D;  1EY6 A;  1SE3 A;  2QKI C;  4OHJ A;  2JA6 B;  1KDA A;  1SNO A;  4FF1 A;  1TS5 A;  4KKT A;  1RDP D;  4IUT A;  4L6T B;  1R4P B;  4WJW A;  1F77 A;  1CA5 A;  4FVM A;  5FLX E;  2IWH A;  4HSV A;  1EY5 A;  4RCO A;  1PZI D;  1VMP A;  2DY8 A;  3NQT A;  1ILP A;  1HQM C;  3C1E A;  1ZXT A;  1BQQ T;  2M2L A;  1STN A;  2F0M A;  4DXF A;  1Y8P B;  1H9S B;  2KCC A;  4ABN A;  4DN4 M;  2JE6 I;  1IL8 A;  3E5S A;  1AEX A;  2AQ3 B;  2B39 A;  1PTO F;  2O5I C;  5CMD A;  4QUC A;  4K14 A;  3EQL C;  1LV9 A;  3NWS A;  2ZXP A;  2Q8R E;  1TWG B;  3OHX C;  4NW2 A;  3HOW B;  1R4Q B;  1HA6 A;  3PUZ A;  3VYS A;  1CQF A;  1ICW A;  2MP1 A;  4PMC A;  3WOF A;  1EYD A;  2PNR C;  2WP8 J;  3FVQ A;  5I9P A;  3PIP 3;  1SYG A;  1R9T B;  1L0Y B;  2L5T A;  2MJ8 A;  1V1P A;  1D5Z C;  2OT2 A;  3T53 B;  2EPB A;  1WTW A;  4FF2 A;  2IX0 A;  2QF7 A;  2YYZ A;  1Y69 U;  1LTS D;  5C0X I;  1I4P A;  2TSS A;  1J9O A;  1U4R A;  3MXN A;  1EIG A;  1DYQ A;  3K5N A;  2F0J A;  3P20 A;  1OXS C;  4ID6 A;  2O4X A;  4IUP A;  3SK8 A;  1ENF A;  2RSO A;  3O13 A;  2M9V A;  1TS3 A;  4CKB A;  1BCP B;  4KJO A;  1PTO D;  2R6G A;  1LTG D;  1TQO A;  2DN8 A;  3S15 B;  2A69 D;  2JA7 B;  4ZUI A;  2D2C C;  2NVQ B;  3RD4 A;  3ERO A;  1F9S A;  3QIA A;  1NCV A;  3VR6 A;  4J6H A;  1STG A;  3OWE B;  5EJW A;  2F0G A;  3GD7 A;  4M1U B;  3FDT A;  5G3L D;  1B9M A;  2X6G A;  4PMB A;  1F2Z A;  1XTC D;  1LLR D;  3MHB A;  1OXU A;  2LY7 A;  5HGT A;  1DXM A;  4CKC A;  2E75 C;  2JA8 B;  1MD2 D;  1EU3 A;  4QB4 A;  1RD9 D;  2VNU D;  2KHS A;  1STY A;  3JAM L;  1DJR D;  1GOZ A;  2JEB I;  5C0X G;  2IW3 A;  1XX8 A;  3HGB A;  1KTK A;  1SFO B;  4RGM A;  4QCL A;  4HMI A;  3M4Y A;  5DEH A;  3E6Z X;  5C5M A;  4ZK9 B;  2J0T D;  3J80 E;  1DM0 B;  4BBS B;  4F8M A;  1DCZ A;  2HDL A;  5FLX L;  4RHS A;  1A15 A;  4MHE A;  3TN2 A;  5C4J B;  2MHV A;  1M4V A;  3NUC A;  2XWJ B;  2L4N A;  1JWU D;  1WTV A;  1GUN A;  1TKW B;  3URY A;  2B63 B;  4HTH A;  2Z8L A;  1A3V A;  2CHB D;  2OXP A;  2A68 C;  2BDO A;  4IAL A;  2EYJ A;  4FNF A;  2Z1C A;  3W2D A;  5J22 A;  2Z4H A;  2ID0 A;  1E2W A;  1O80 A;  2A6E D;  4KD3 A;  2JEA I;  1ILQ A;  1LAB A;  4C3H G;  4KHV A;  1PRT F;  2QCP X;  1EQT A;  2M00 A;  3I8Z A;  4BA1 I;  1B2T A;  1YNJ D;  3DEO A;  3IKJ A;  1XYI A;  2L1B A;  3V05 A;  4CJ1 B;  2ICE C;  2ZXR A;  3K6O A;  5D14 A;  4C56 C;  1RHP A;  1EYA A;  1HRJ A;  3SXH A;  2B2W A;  4KMU C;  5FO7 B;  3C1F A;  1SXT A;  1SYE A;  2ZXO A;  2F0S A;  2LS0 1;  4X3T A;  5LHY 1;  1U4P A;  2G9D A;  4A3J B;  1AP0 A;  2O5J C;  3QG1 A;  1SMY D;  3QWN A;  3R3O A;  2K05 A;  3ND9 A;  4C3H B;  1RTN A;  2F4I A;  1BF4 A;  4FXD A;  1F2Y A;  2ZT9 C;  5C0X H;  4A3B B;  3PUV A;  1I6H B;  3L9A X;  1B50 A;  3NTK A;  3SK4 A;  1I50 B;  3ND8 A;  4XT1 B;  1CHP D;  1TII D;  2BE5 D;  3QOL A;  5CV8 A;  4K2L A;  2TMP A;  1TU2 B;  1G2S A;  5JAV A;  2B2T A;  4K5V A;  2Z4I A;  4KHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...