2RVLA

Solution structure of the chromodomain of hp1alpha with the n-terminal tail
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
83
Chain Sequence
GSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromobox protein homolog 5
publication title Extended string-like binding of the phosphorylated HP1 alpha N-terminal tail to the lysine 9-methylated histone H3 tail
pubmed doi rcsb
source organism Mus musculus
total genus 9
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rvlA00
1VMPA 1ESRA 2KVMA 1RHPA 1B4OA 2EPBA 2RSNA 1DOKA 1O7ZA 4X3UA 4IUUA 4NW2A 1M8AA 1RTOA 2FINB 4X3TA 5E4XA 1G91A 1MGSA 3KUPA 5EJWA 2K04A 2FFKB 4IUTA 3TN2A 4RWSC 1MSGA 1AZPA 1NR4A 1HHVA 1HUNA 1CM9A 2L1BA 1PFNA 5JJZA 3MTSA 5CMDA 1U4MA 1EOTA 1KNAA 3I8ZA 1IKLA 1NCVA 2HUGA 3FDTA 4UAIA 1AZQA 2Q8RE 3LWEA 2D9UA 2RA4A 4HSVA 1ICWA 2B2WA 2DY7A 2K03A 1WD1A 1EQTA 1F9QA 2K28A 3DEOA 5T1IA 3HP3A 3IFDA 2KUMA 4CJ2C 1O7YA 1QG7A 1U4PA 1E0BA 1EIGA 1SSOA 2L11A 1Q3LA 1SDFA 2XIWA 2RVLA 3DM1A 3I3CA 5COYA 3D6WA 5CORA 1ILPA 2FMMA 2MP1A 1BBXC 2B2VA 4OIKA 4XT3B 2J7ZA 2IL8A 4OIJA 1F2LA 1JICA 2SDFA 1O80A 2L12A 1HUMA 5E4WC 2NZ1D 2HDMA 1CA5A 1AP0A 2KEDA 1A15A 1XX8A 3R93A 3ONAB 1EL0A 1B53A 1RODA 2B2WC 2JP1A 1G2TA 5DNFA 1DZ1A 1TVXA 4RAUC 1F9PA 2VXWA 1B2TA 2N55A 4CJ0B 2B2YA 1BO0A 1X3PA 4X3SA 1ML0D 3N52A 3UI2A 1HFNA 1WTVA 1PFMA 4X3KA 5EKIA 1NAPA 1JE4A 2B2UA 2NYZD 2H1EA 3I90A 4IUQA 5D14A 4HAEA 1WTQA 2B2TA 5T1GA 4HCSA 1KNEA 2B2VC 3FPUB 3KBXA 2JYOA 4ZKCB 1MI2A 2FHTA 3QO2A 1WTRA 1F9SA 4HEDA 1F9RA 1QNKA 1BF4A 2RSOA 3MWYW 1WTWA 2NWGA 2KOLA 3Q6SA 2R3ZA 1WTPA 2X6GA 1EIHA 3P7JA 4RA8A 2X6LA 2MJ8A 1XYIA 1U4LA 5AFWA 2MPMA 3H91A 3DEPA 2CVRA 4XDXA 2N88A 5CBEE 2B2YC 1B50A 1S4ZA 4ZK9B 2KECA 3IL8A 2HCIA 1U4RA 1DONA 1WTXA 1G6ZA 1SAPA 2X69A 2B2UC 2DY8A 3I91A 2K01A 2EE1A 1VMCA 1RTNA 2BDNA 1PDQA 2B2TC 5EPJA 1PFBA 4XT1B 5EPKA 1IKMA 1DOLA 3G7LA 1WD0A 1NR2A 1B3AA 2MGSA 4IURA 1HA6A 4R9WA 3GV6A 5EQ0A 4QUFA 5D65A 4ZLTF 4MN3A 1RJTA 4CJ1B 1G2SA 1X32A 3F2UA 1PLFA 1QE6A 2FJ2A 1IL8A 3SVMA 1MSHA 1ILQA 1J8IA 1X3QA 1J9OA 4ZAIA 1HRJA 2HCCA 4DN4M 5CBAE 4ZKBB 3TZDA 4O42A 1CA6A 2KEEA 2K1BA 2L4NA 4U68A 4IUPA 1HFGA 3GV3A 5EPLA 1WVLA 4R8IA 1BNZA 4QUCA 4IUVA 1ZXTA 2K05A 1C8CA 1GUWA 2M2LA 4MHEA 2Q8TA 1DOMA 2HDLA 2L9HA 1WTOA 1LV9A 4LMQD 2EOTA
chains in the Genus database with same CATH superfamily
1Q82C 4A3GG 3E0EA 1IYVA 1ENAA 1SE2A 3Q22A 2UXBQ 4KI0A 1G91A 2F4IA 4HIOA 1ONLA 1PYSB 3ERSX 4OWWB 3OWEB 4GKJQ 1MSGA 1NR4A 2JA5B 1PFNA 5JJKA 1EOTA 2F0IA 1CSQA 4JBWA 4DR6L 1NCVA 3HG9A 3K7AH 4CHTB 1AZQA 3M7NA 1DD2A 5FLMH 2VW9A 5BN5A 3PUWA 4FO2A 4YWMA 1KRTA 4BS9A 3U58A 3S1RB 1SYBA 1SMYC 4C1NI 2ZTEA 3S1MH 1II3A 2RF4A 4F7XA 3R2TA 3PSIA 1J8IA 4A3CG 5M3FH 2G9DA 4FYDA 1I4PA 2B2VA 1K8OA 3SGIA 2QA4A 1CKOA 3PO2B 1D5MC 2K33A 3CP0A 5ELOA 5C3EB 3W2DA 4LF7Q 4UDUC 2KEDA 3DWQA 5J1ZA 4IPHA 3T4AC 1NNXA 4A3MH 3J80c 1W3SA 4CGYB 2IX1A 3OSOA 5I4DA 1VS0A 1VQ9A 4BBSH 4YCVA 2C35B 2B8GA 1L1OA 1GUTA 1Y1WB 4ZKCB 3S14B 4I7ZC 5HURA 1WI5A 5C4ZA 1XMOQ 2L0CA 2UUAL 2WIIB 3WWVA 4H44C 1TWHB 5IYBG 3DMUA 5C0XH 1BUVT 1D5XC 2H4OA 4OX9L 5J39A 4A3JG 3PCOB 1K83H 1Z47A 5CV4A 2BDNA 5HY6A 1PFBA 4K8JA 4ALPA 3UDXA 1IKMA 5HGTA 1N33Q 2F52A 4DR5Q 4IURA 3J7ZC 1LT6D 1HR0W 1EOVA 4LF8Q 2CW0D 3S15H 4JI1Q 5C3WA 3KF8B 4EQNA 4DN4M 1CA6A 3UE0A 4IUPA 3PO2H 1CQVA 2J0TD 4MHEA 4K0KL 1Y8OB 1DOMA 3CQZB 2YYZA 2NTTA 4A3BB 2MFIA 2ZT9C 3IRBA 2YV5A 4GNXA 4MTNA 4IUTA 3TN2A 3S2HB 4KTAA 2CKZB 2BE5C 5BN4A 3S14H 2ALYB 3H0GG 2KCTA 3MXNA 4DUYQ 3FDTA 4HJAA 1L1OB 2JEAI 1UWVA 2CW0C 2KBNA 1JQYD 2RCNA 5M5WH 3RR5A 2JA6B 1EY6A 3K0XA 2PQAA 4ZUJA 2PPBC 5LL6X 4A3LH 4DUZQ 1EEID 1HNZQ 1N32Q 5CORA 2J4XA 3ERQA 1YJWA 1K3BC 1H9RA 4HR7B 2L12A 1SNQA 4DV0L 1A15A 3E0JA 5IODA 2F4VL 1IYJB 2EXDA 1RODA 4TVAB 1Q8IA 1D8LA 1I94Q 1DZ1A 1SNCA 5TSSA 4ZYSA 1RL2A 1A63A 2WV6D 1EYAA 5FKAC 1FYCA 2PMZE 4MTKA 3VR5A 4LUOA 3RD4A 4X64L 3U4VA 2OQKA 2KHIA 2H1EA 1C0AA 1GKHA 2E75C 3R3OA 2QEJC 1X9NA 4HEDA 1X54A 4HJ9A 3PF5A 4O2DA 1Q81C 4A3FH 5I9PA 3RZOH 4IN3A 4GOPA 4LFCQ 4BY1B 4G57A 3DLLA 4WJWA 1NY4A 4K14A 4A3KB 4LWCA 4HMJA 2K4KA 2A6EC 5EKLA 5JPNC 2DNEA 2HCIA 2O2LD 3M85A 1DONA 1G6PA 4LUZA 4DV1L 1KLGD 4WRDA 5D3DA 2F3IA 2K01A 1OXXK 4B08A 1RTNA 2NVXB 3A74A 3K5NA 5D3IB 2OCEA 4NXML 2B63G 1SFOB 1PVOA 5C0XI 5FLXE 1G2SA 4FXDA 2R93G 4A76A 2PQAB 4K5WA 4BXXG 3TZDA 1JJGA 5ELDA 3FPPA 1HFGA 3V2TA 1BCPF 4QGUA 2K05A 1RCVD 1Q90A 5NUCA 3I4MG 1WTOA 4GLXA 2UUBL 4JI8L 2MQHA 3FVQA 4NXNL 1QWYA 2RDGA 2F0GA 3HOXB 1Q1BA 3C46A 5EJWA 5FO7B 1SYDA 4DU9A 3QOJA 4KKUA 1KQSA 1AH9A 1A62A 1D6EC 1I50H 3EIVA 3TQYA 3W5OA 4NMZA 5BR8L 3QR8A 3HOZG 1X3EA 2O5JC 4XQNA 4GOPB 2JN4A 4X62L 3J81L 1EIGA 4NDXA 3VR6A 4DV6Q 3D6WA 2IY5B 4DV5Q 2M00A 3HS0C 1V9PA 1TY2A 4FP5D 3KK7A 3T13A 2R92G 2DJGC 3OMCA 4YWLA 4ZUIA 4EQOA 4HTHA 4UPAA 3R93A 3AFPA 3O13A 2HQLA 1E22A 5ELBA 3D0FA 5JPMC 1HQRD 4GN5A 2A74C 2QF7A 1AN8A 3MA2B 5LMNW 4NP5A 4DK0A 4XYQA 1LUZA 3GQBA 3I90A 2PNRC 3HOYG 5IP9G 3HOVB 3A7AB 1KLUD 3KLRA 3NXWA 5C4XB 3G6JB 3HKSA 3Q6SA 1GUGA 4DXGA 4OGQC 1CKMA 3P7JA 2D5DA 3HRZC 3MXPA 2JA7B 3S1NB 2CQAA 1BQQT 1S5FD 1S4ZA 2FMCA 3CMEA 3AU7A 1U5KA 4RGNA 2IWHA 4DNTB 2EE1A 1TR5A 4XTCS 4H0LC 1YJ9A 1EQVA 3NTHA 1QVFA 5AJ3Q 1ENFA 1VQAA 2PI2E 3TP6A 4R4OA 1A0IA 2V4DA 4JI0Q 2I5MX 2B8FA 2XNAC 5D65A 1N34L 3J7AV 5KGUA 1SYCA 1EZ6A 2A68D 5HGQA 3NQTA 4KMUC 5GQOA 5I2YA 1N36L 1C8CA 1SBBB 5IE8A 1HR0L 3JC66 1HA5A 1K8MA 3MWYW 2F0UA 3CU7A 1JMCA 4B3TL 3JAMc 1GD7A 2ID0A 3BYTB 4FDBA 4WORA 1FJGQ 4X66L 3EN2A 5KNCA 2KCMA 4FVMA 4ULLA 2H5XA 1GUSA 4RGMA 2RBMA 5FLXc 3HOUG 2VS1A 1QVGA 1U4MA 2TMPA 2ZXRA 4DR3Q 1E3PA 2DN8A 3MVVA 3HKZG 1BR9A 3D31A 5M3MB 1EQTA 4DR7Q 2ES2A 3DEOA 3GTGH 3GP7A 5T1IA 4IFDH 3S1NH 3K5LA 1WCMB 2KUMA 3W1BA 3CPWA 1STHA 3C1EA 5COYA 1ZEQX 2Z1CA 1SE3A 2A5HA 2TSSA 3RN2A 4A3DB 3NELA 1SRUA 4WJ3M 2G9HD 2IL8A 5C4JH 3J81E 4OEMB 4BBRB 3J80L 4A75A 3MXUA 4L8JA 2NZ1D 3BVGA 4PMWA 3FP9A 1G2TA 4HJ5A 1JJCB 1TQOA 2DGYA 4DR4L 2VUMG 5IGGA 3K6OA 1I6HH 2A1AA 2B2VC 4O1NA 3GTMH 3HGBA 4DV4L 1F9SA 4I65A 2R7ZH 1M4VA 1R9TB 5C44G 5KYLA 4FXGC 1JORA 4F88A 3H3VC 2MNAA 4BA2I 1VQCA 5JJLA 3K0YA 3VR4A 3AB9A 3TREA 3HEJA 1QJOA 4LF9Q 1KAAA 1Z7TA 2Q2IA 1IZ6A 4OL7A 3NEMA 1L1OC 4L63B 3ZJYC 4A93G 4TSSA 4K5VA 5ELEA 1WD0A 1K28A 2CH4A 2L55A 1ET6A 3NENA 4LJZC 1RJTA 1DXMA 3SVMA 4LF4L 1J9OA 3PO3G 3MEHA 3VA7A 4K8IA 1QZHA 1JB3A 4JI2Q 2KA7A 1WVLA 4C3HH 3ICEA 3OMGA 1XMQQ 2PMZB 4K5XA 4JG2A 4LMQD 4PNYA 2UU9Q 2CH4W 5E1FA 4OWXB 2RSNA 1QVCA 3BS1A 3KDFB 2AKWB 3S9WA 1M8AA 1MGSA 3SDZA 2HIVA 1EFID 1D1KA 4WJ4A 2NVQH 3T53B 5JJZA 4DV7Q 3ZYYX 4A3EB 2DY7A 3MEFA 3S1QH 4UHVA 3HP3A 1EY8A 3RZDB 1G51A 1PRTF 2K5VA 2L11A 2EYMA 4F8MA 4RFBA 4Y7NB 4GNXC 3IKJA 4AIMA 2QILA 3EA6A 3CCVA 1KXLA 4YHHQ 4C3JG 3S2DH 3TS0A 1CZGA 1H95A 1H9JA 1I4GA 4IZ8A 1CTMA 1TIID 4LF5Q 2VB2X 4IFDI 1YHAA 2R7FA 1TVXA 4KY7A 4RGOS 3J80E 1VQ6A 2HD3A 4LFAL 2AWNA 3I4NB 1LM0A 1E24A 2B2TA 3E6ZX 4R4QA 2JA8B 2GVAA 4C3IB 1V8QA 1VQJA 5LMNL 1HZBA 5M5YH 1IL2A 5IY0A 4TQUS 4RA8A 4KD3A 4HJ7A 1PH1A 2ASBA 2WKDA 1TT2A 1ZYRD 2QEXA 1G6ZA 1CSPA 3HOWG 1MJCA 5IP7H 2A6HC 1AE3A 2XWJB 1YEZA 4P73A 1S3OA 3P20A 4R9WA 1K0RA 5F2DA 3I72A 4GOPC 4YCWA 3F2UA 1C48A 3B6YA 1MSHA 2UXDL 5G3LD 4U68A 3MFYA 4A3GB 1B44D 4M8AA 1GVPA 4QUCA 1ZXTA 4KKSA 1YI2A 2RQXA 1GM5A 2EOTA 3BVZA 1ESRA 1I3QB 1SN8A 3MZ5A 1ZYRC 1RDPD 3KLWA 3J81i 3F2BA 2UXCQ 2FINB 5KNBA 4DK6C 4JOIA 5BN3A 2RHSB 4IJLA 3C1FA 2RHQB 3NBHB 1BBUA 2AQ1B 4JCVE 2PQEA 4C3IH 3Q0AA 4RH6A 4XQQA 3PIOA 4A3IH 1ENCA 3I8ZA 1C7YA 3LWEA 4BA1I 2LSSA 4V0BA 2B2WA 1DCZA 1LTLA 1WYDA 1IBML 5I9OA 1EY5A 5IWAL 4H02A 5J3BA 1EY7A 1NUCA 2JEBI 1CI3M 4FF4A 1STEA 1VF5C 1ILPA 4B3SQ 1EU4A 1HCZA 4KHZA 2LY7A 3GTJB 3RLFA 2EYJA 2VY3A 1PZKD 5IYCG 2NVYH 4R4TA 1SJED 3OTOQ 2JP1A 3ND8A 5FLMG 1QUQB 1K73C 4A3GH 2XVSA 1UEBA 1Q12A 3CW2C 1D5ZC 2R6GA 4FF1A 1JE4A 5JEAJ 1PZJD 5E7NA 1KNEA 2XSCA 3KBXA 3D4WA 5CV7A 5M3FG 1VQ8A 2YU9H 3GTLH 1PMRA 1PTOD 3D4RA 3HKZE 4A3JB 1FR3A 4IQZA 4JBKA 1XXGA 3NP8A 1XYIA 5AFWA 1G291 5JVH3 4JI4L 2N88A 1VDZA 3K81C 1EQRA 2MO1A 2Q2TA 1VQDA 1WTXA 2AHOB 1SAPA 4J8QA 4RHRA 2SOBA 3GTPB 4A3MG 3W1GA 1CQFA 4ODGA 3S17B 3GTQB 1TWGH 2Y0SG 1MD2D 4BBSG 1B3AA 2MGSA 2F0SA 5DEHA 5EBDA 4L5RC 1BDOA 3I4OA 1B1ZA 4C2MB 3TRZA 4Q0FA 4U673 1PH9A 4K2KA 5CBAE 3GDEA 1PRTD 1UAPA 3LNNA 1ESFA 3OWFA 3JAML 2K5HA 3GV3A 3Q24A 1B9NA 5C0XG 4KHPQ 1PTOC 2JA5H 1A3VA 1VMPA 4JYAQ 5LHY1 4JVZA 5FLXL 1EY4A 3H0GB 1XTCD 4H7BA 4X3UA 3I73A 3S1RH 1HNWL 2OQ0A 1IBKQ 3KUPA 1MIUA 3CC2A 1E1OA 1HHVA 1FNUA 2XWBB 3J80i 3FRPB 3MTSA 2G5DA 1IKLA 5C5MA 5K36H 5K5PA 4DAVA 2Q8RE 2ZJQA 1TWAB 4IPGA 5C3EH 2Z6KA 4PZ7A 3NHHA 3IFDA 3GTOB 1HXYD 1U4PA 3DM1A 3QB3A 2BDOA 4J15A 2E8GA 2K6AA 1JCKB 3CXCA 3CC7A 4GKKL 2MO0A 1LACA 1PFSA 4CDEC 3U9SA 1PH8A 4EGVA 3NPPA 1Y1WH 4A4IA 4P2CB 3A5ZB 2E2HB 4JI7Q 2GVBA 4RAUC 3A56A 3A7LA 4CJ0B 1GJXA 2L5TA 1TWHH 3BDOA 1B8AA 3UI2A 1CKNA 3J7AF 1PFMA 2EQSA 3G71A 3P1HA 4QCLA 4DV2Q 3AMUA 5LMUL 2JK8A 1KIXA 4DV3Q 1JT8A 4R4CA 2A19A 3WOFA 2SEBD 4LF6L 4A3LG 1WTWA 2VQFQ 2R3ZA 2E2JB 2VQEQ 4YCUA 4AQYQ 4DR2Q 3FMCA 2R61A 2PW5A 1E2VA 4XDXA 5GROA 5LL6S 1T9HA 1FGBD 2EDGA 3RN5A 3D8GA 1K9MC 1FL0A 2B63B 5E3FA 4B9WA 1S5ED 2F0OA 3SR1A 1SMXA 3KOJA 4I7AA 4LFAQ 4LFBL 2R93B 1SNMA 4DNRB 2EY5A 1DOLA 1TKWB 1KAWA 3GTOH 1I5FA 3CQZH 4MN3A 3TBIB 4JV5Q 1Z6HA 3EJIA 3I4MB 1L2FA 4A3FG 4A3BH 5C5LA 4V190 1SYEA 1UE1A 1PA6A 4B3ML 3I56A 5EPLA 4L6TB 3HFZB 3T1YQ 3S2HH 3Q23A 3CCLA 3I4LA 2NN6G 2OWOA 4GNXB 4DF7A 3KF6A 2E2HH 3JAME 4YY3Q 1XNQL 3BYYB 1IBLL 2O5IC 4CKBA 1O7ZA 4IUUA 2UUCQ 3MXNB 2JA6H 1S72A 1JE5A 2E5LQ 1QNUA 2K04A 3RUZA 1A3UA 4P72A 3HOZB 1AE2A 4JI5Q 2HHHQ 2E2DC 1JOOA 1JWUD 1XPOA 2PCFB 3M4OB 2PW7A 2E2JH 2HUGA 1WFQA 4JI3L 3TDQA 4ABNA 1SEBD 2RA4A 3NBIA 5KIXA 4DR1L 2IX0A 3OPOA 1VQHA 4NKLA 5FK9C 2Q2UA 1RKNA 1HZAA 2R92B 4JC0A 3SK4A 4KV6A 4JK1C 1XNRL 1H9SA 4DK1A 1BBXC 1C9OA 3CD6A 1S5BD 4PMBA 4KN4C 3CAMA 4DAYA 1U9RA 5I6WA 4X65Q 3T1HL 4G4KA 1UEAB 2K7VA 3OOCA 3I55A 3HOYB 1EL0A 2Z4IA 1B7YB 5JEAG 2DNCA 2ZM6L 1BVSA 1D1IA 2N55A 5DAUA 4BY1H 2WB1G 1D2BA 4X3KA 4A3KH 2IHFA 1SYFA 3QIAA 3E9HA 5CYUA 4XQJA 5GAGC 1ZKOA 2I5LX 1C4QA 2FXQA 2NVXH 2F03A 1WTPA 2CWPA 2WAQG 2X6LA 3DHQA 3G6EA 2QW7A 1Y1VG 1YVCA 2EXZA 3CKIB 5C4HA 1UE5A 1SFOH 2PZWA 5CBEE 3WOEA 4DR6Q 4BY7G 1UE6A 2DY8A 3SK5A 5IYDH 1E7ZA 4XXEA 2B2TC 5J22A 3SE0A 1TWFB 1IHZA 5DM63 2Q2HA 3SEBA 2RKSA 4CJ1B 1NE3A 1EEFD 1TXYA 3VA5A 3MFGA 4QF4A 3KJPA 3HOXH 4O42A 1VQ4A 2KEEA 2K5NA 4PQXA 4MZ9A 3AQQA 2Z6BA 2E76C 4IUVA 1IW7D 3VYTA 1YNXA 3R2IA 3CHBD 3K8AA 3NTKA 5IP9H 2IJ0A 4DAMA 1YIJA 1RHPA 2V1CC 3HOUB 1DOKA 3ULPA 1J5EL 4HCEA 4NW2A 4K2LA 1I4QA 4X3TA 2XRQD 4LUVA 5E4XA 3MHBA 3HKZB 5JOBA 1GUOA 2R7DA 1X3GA 4L5SA 1HH2P 2ICIA 3U9OA 2UUAQ 1V1OA 4UAIA 1GHJA 2Y0SE 1BOSA 2CCZA 4OX9Q 1F9QA 1EQQA 3N6RA 5M9OA 1KC8C 2AUJD 2CHBD 1LYLA 4KLKA 1Q3LA 1SDFA 2ZTCA 4B3RL 4JOIC 2FMMA 2MP1A 2F0WA 4OO1H 4R8NA 1LTTD 1Y8NB 3GO5A 2VUMB 3HOVH 3L7ZC 4EQ5A 4LAAA 5C4XH 5KYIA 2B2WC 4IJHA 1KDAA 2Z8LA 5L37A 4JI6L 3E5SA 4IALA 1OXUA 3NWTA 4QMGA 4X3SA 5C44B 4K0KQ 4LK1C 2JA7H 2E2IB 2B2UA 3NSWA 4IFDG 2A68C 2F3VA 2D2CC 2KJXA 2UXBL 3KFUA 2XGTA 1NBWA 3TSSA 3M7GA 3CCEA 1QCBD 2KOLA 3F2CA 3NTIA 3FKIB 1PTOB 3CCUA 1SJHD 4A93B 4OELB 1ASYA 1B50A 3JAMi 3OW2A 1KHIA 5CR3A 3W3AA 1VQ7A 5EPJA 2NUCA 3PO3B 2ICEC 1BCPD 1EYGA 5EQ0A 4ZLTF 1XWEA 4LF6Q 1YITA 2R7ZG 4LF7L 1ILQA 1X3QA 4ZAIA 4L5QA 2O4XA 2HIXA 2OT2A 4DV0Q 4G7OC 2F4VQ 5CV8A 1X3FA 2AWOA 4J1MA 3FKIG 3CPFA 1B4OA 4X64Q 4ZCKA 4HSPA 4H13C 4PG3A 5M3MH 1CK1A 3OW7A 1GOZA 2QGQA 1F2YA 1MBYA 1A8VA 1WCMH 3FHWA 1XMOL 2E2IH 1VQKA 2LXKA 4RCOA 2A69D 2RDFA 3NQIA 4KHVA 4A3DH 1LLRD 2B3GA 4QB4A 4RHSA 2MUYA 4DNIA 1BCPC 4BBRH 2BOSA 3TZUA 4C3HG 1QOHA 1VQGA 4FF2A 1YJNA 4C3JB 3GTKB 4DV1Q 4CJ2C 1N33L 1SSOA 4DR5L 1YZ6A 2KCNA 5ELNA 4AH6A 2ZJRA 1XJVA 5C0XJ 1LO5D 4NXMQ 4LF8L 4JI1L 4AYBG 2F0VA 1HUMA 2K5WA 5E4WC 3J81j 3OYYA 4YIJA 1STGA 2JQOA 2M9VA 3VYRA 1R9TH 2Z6KC 3M3YB 1MJEA 1VQIA 2ZJPA 1EIFA 1JWMD 3DXJC 3N52A 4OO1I 2NYZD 3K57A 2L15A 2UUBQ 3BJUA 4JI8Q 5T1GA 5IGFA 4NXNQ 2FHTA 4L5TA 1Y8PB 3VDYA 1QNKA 2RSOA 1SROA 4HJ8A 4UP7A 3HOWB 4KY6A 4DUYL 2MJ8A 1SE8A 3DEPA 5I6YA 3ULJA 4ZRZA 2JXMB 5BR8Q 2F0MA 3NUCA 3I91A 4RKLA 3RLOA 2EJGC 1PDQA 2ENBA 1YBYA 5IGEA 3VR2A 1HNZL 1N32L 3PUVA 4XT1B 4X62Q 3G7LA 4O0AA 3CRKC 1KABA 1SYGA 3TP7A 4CBVA 2K75A 1VQBA 1A2UA 2K50A 1HTPA 1OTCA 4ZKBB 3U4ZA 2WB1E 1I94L 4ME3A 4CDCC 5IGCA 5JAVA 4XYOA 1TWCB 5JJIA 2K5QA 3AFQA 3A54A 5M5XB 1S5DD 5IP7G 2K5DA 4A3EH 2VZAA 2NB0A 2F3WA 4PV1C 4DK3C 1RTOA 3PIPA 1S40A 2EYOA 5DM73 3RZDH 4LFCL 2JJQA 3STBD 5A35A 1AZPA 4Y7NH 1EY9A 5CMDA 1GUNA 4IPDA 4PMCA 3GD7A 1JWSD 3R8BA 2BA0A 1WD1A 5JVG3 4B9XA 2I07B 4OWTB 2XRSD 2EVBA 3PV0A 4XT3B 4OXPA 3PGZA 3I4NH 3K7AB 3A8IE 5CV9A 1N34Q 4RMFA 2JA8H 1I4XA 1STAA 1IXRA 2HQEA 2AMCB 1N9WA 3S1MB 1KTKA 1B70B 4A3IG 2N8NA 2EYPA 5M3FB 1W6KA 5FJ8H 1N36Q 1ML0D 3BZDB 1W2BA 2A8VA 2NZHA 1HR0Q 3G4SA 2AQ3B 1NAPA 2NZOA 5D14A 3I7FA 2EYFA 4CKEA 4DXFA 4B3TQ 3FPUB 1MI2A 4X66Q 3TS2A 4DAPA 1EWCA 3S16B 2NWGA 3KJOA 1LABA 4EQPA 4A3MB 3PMFA 5IT9c 1U4LA 1TU2B 3IAYA 4MIUA 2Y0SB 4BBSB 2GA4B 3A55A 1QILA 1R4PB 5CV5A 1SXTA 4HIDA 4QQBX 3NE5B 4C56C 4EVOA 1ASZA 1HZCA 2OTJA 5CGKA 2LKVA 4DV6L 4G7ZC 4DV5L 2LMCB 3H09A 4IO9A 1EYDA 1T5EA 4CKCA 3URYA 1F2MA 3HZXA 2VL6A 3GV6A 3A5UA 2QCPX 1I3QH 1PLFA 2SNSA 2OXPA 5IYCH 4DA2A 4Q5VA 1HRJA 2HCCA 1K83B 1HNXL 1EYCA 4M1UB 4IOAA 2YTYA 4R8IA 3RLNA 1E1TA 2HDLA 3KF8A 2PO4A 3S24A 4DR4Q 3E3XA 3PUZA 2KVMA 4A3CH 2NBFA 4PZ6A 3S15B 4N9TA 2B29A 4QL5A 1X65A 1I4HA 2EY1A 1A2TA 4DV4Q 4RWSC 3I70A 1CM9A 2CFMA 3S16H 2F1MA 1HJPA 3GTJH 4QIWE 1ICWA 3K7UC 1F77A 1STNA 3M4PA 1FGUA 4MNOA 1CHPD 2JA5G 2RDHA 5AJ3L 1QG7A 5CC4A 3SK6A 3CRLC 4JI0L 4OIKA 3EBEA 2E74C 3SXHA 1HTLD 3V05A 5IGDA 3EVQA 5IYBH 5M5WB 3AEVA 1ET9A 4LF4Q 1MKHA 4APVA 5KEEA 4YWKA 3QJYA 4A3JH 3C3LA 5K36G 1EU3A 5IGBA 3PO2G 1HPCA 1BO0A 2B2YA 5C3EG 3A8KE 2OTLA 1FJGL 3L9AX 4DGZA 5EKIA 1K8AC 2BE5D 1PRTC 2LFNA 4IUQA 4K6DA 3SHLA 2AUKA 4UP9A 1WTQA 3DWAA 2ZXOA 4HCSA 3BDLA 2F0KA 3GTPH 3S17H 3KLSX 3GTQH 1L0XB 4JW0A 1DJRD 4KK7A 1HQMC 3L0OA 3H91A 4DR3L 1Y1WG 4C2MH 4GN4B 4IOCA 5H1SE 4DR7L 3IL8A 3TP8A 2F0FA 2B2UC 1E2WA 4TRDA 1X6OA 4AYBE 2Q8IB 3C2PA 4A3FB 3RZOB 5EPKA 1FVIA 2WINB 2K14A 3BZKA 2YTVA 1RD9D 3E9IA 1X32A 3H0GH 1BCPB 4IFDJ 1VQ5A 1L0WA 1EZ8A 2EZVA 2I0QA 1PH3A 2OF1A 2KQ3A 2L9HA 1KDCA 1NSNS 3H15A 1BXTA 1SNPA 1VCIA 2EPBA 1W6JA 1WTHA 1TWAH 1LTID 1LTAD 1JOKA 2A6ED 4NB3A 1M1KC 4OONA 3LX0A 5LMNQ 3KLSA 2QKIC 5GAHC 3BG3A 1DGSA 3H3VH 3SK8A 4LF9L 4A3BG 1K3RA 2CWAA 5KNDA 3VYSA 2YTXA 3P75A 3OHXC 1VQNA 3ITPA 3KYHC 2A73B 5EGTA 2F0QA 4HIMA 1I4RA 3RMHA 4JBJA 2RVLA 3OIQA 3IFTA 2F0PA 2F0JA 2JA6G 1I50B 1B9MA 1F2LA 4BWGB 1JICA 1NMGA 3F1ZA 2NVTB 2D62A 1CA5A 1AP0A 2WB1B 4GS3A 1CKNB 2UXDQ 4JI2L 1LTBD 1XMQL 2NN6H 1SNDA 3F2DA 4X6AH 2ZXPA 2UU9L 3TP5A 3K5MA 1VQLA 2AQ2B 1WTVA 1KRSA 2WAQB 2Z0SA 3A8JE 3K80C 4HAEA 1Y1VB 5C6AA 2B63H 4KJOA 1VQMA 1WTRA 4HIKA 1B3QA 1BF4A 3FEWX 2HT1A 4BY7B 1SE4A 1XTDA 2R93H 4BXXH 1EIHA 3ND9A 1GO3E 4DV7L 3UE1A 2KENA 3J7YW 2N78A 3VYUA 1BKBA 4N8FA 1V1PA 2KECA 3I4MH 3LWUA 3DM3A 5C3XA 1Q7YC 4BY1G 1VMCA 2VB3X 3Q8DA 1IBMQ 4A3KG 5IWAQ 1P8LA 1X56A 1VQPA 1PH7A 2BH8A 2N3SA 3NK9A 2WFWA 1NR2A 3CCJA 2D0OA 4P74A 1HA6A 4YHHL 3CCSA 1QE6A 5A2QL 4LF5L 5JEAH 3KF6B 1DYQA 3BDCA 2L4NA 1E2ZA 3QOLA 2QDLA 1D7QA 2JA9A 2NVTH 3HOZH 2M2LA 2Q8TA 3UDIA 1Q86C 3M4OH 4OIJA 3M9BA 5IYDG 1ICFB 2LXJA 4WFN3 5EAYA 2IX3A 1QB5D 1A3TA 4S3SA 2ATWA 2K52A 2R92H 1Y1VH 5DLQE 3K58A 2F0EA 4QY7A 1HUNA 2L1BA 5FO9B 3HOXG 4BY7H 2DUDA 1HNXQ 3VR3A 4JI4Q 4HSVA 1H9SB 1CFMA 4P71A 2K28A 4KKTA 1DM0B 3X3NA 4DAYB 1YNJD 3HOYH 1UNSA 2EY2A 2F0DA 1PV4A 1PHJA 1TS3A 3H3VI 1V1PB 2J7ZA 1OXTA 1F2ZA 2DJFC 1CZWA 1O80A 3D4DA 3GTGB 1NTGA 1XX8A 3ONAB 2VNUD 1EWHA 1PYWD 1Y14B 3CF5A 3ULLA 4DKAC 1HZ9A 1HFNA 1EUJA 1GXDC 5C4JB 2UXCL 1A6XA 5IT9L 3ER0A 4GLAC 1XPUA 2JYOA 4OHJA 5GADC 1NMFA 1LT3D 1IW7C 1WJJA 4KN7C 1HNWQ 3M4YA 4KD4A 1YNJC 1VF7A 4OO1G 4DPGA 2NN6I 3U50C 1TWFH 4J6HA 4P75A 1XPRA 1I6HB 3DUZA 3HOVG 1I6VC 2Z4HA 5C4XG 4PZ8A 5CV6A 4ZK9B 4QIWB 4EX5A 3GTMB 4LW1A 3L3OC 3RNUA 2R7ZB 5I2XA 2BCOA 4QJFA 1OO9B 2JA7G 1SNOA 4B3SL 2CQOA 3UDFA 4POFA 2Z9HA 1OXSC 4CDFC 4QUFA 4UP8A 5EBCA 4ZQ3A 3HOUH 4GKJL 2FJ2A 3BVMA 1IL8A 4GKKQ 2GN5A 1PH4A 3OTOL 1FNWA 2KHJA 2N49A 2EIFA 3V96A 3MXGA 3KBGA 1TS5A 5KRUA 1H9MA 1GUWA 2WP8J 1STBA 5A2QE 1KD1C 1CT1D 1Q1EA 2ZTDA 2P5ZX 1O7LA 3D6CA 5G3LF 2KHSA 2K32A 1N8RC 3TEHB 5LMUQ 1STYA 2OEOA 4ME5A 1P16A 5ELCA 1MHWC 3WDNA 4C3HB 3EQLC 2C9OA 3G48A 4Z9CB 1VQEA 3KDFA 4IUNA 1KNAA 4G7HC 1JC7A 2I46A 2VUMH 2F0HA 1PRTB 1Q46A 2IW3A 2JSOA 4TKOB 4HMIA 4ILWA 2RCFA 1WOCA 1JJ2A 1PZID 1UE7A 4AYBB 4GLVB 1O7YA 1AW7A 2XIWA 2NVQB 2C5CA 4R4IA 1KL9A 4LFBQ 3DWPA 3PQIA 1EWIA 4JPBW 5ELFA 5C44H 3QWNA 4C1NK 5M3MG 4RGTA 2LS01 3BU2A 4RKBA 1UUPA 1WCMG 3MAQA 2BA1A 1AEXA 1T5XD 4ID6A 1CHQD 4Y52H 3S1QB 4KHPL 4A3DG 2PYKA 4GZYC 5DNFA 1JR0D 4B3MQ 1F9PA 1H9KA 3AYHB 1RIPA 2JE6I 2SNMA 3FKIH 1PTOH 4BBRG 3CCMA 4JYAL 4A93H 2D0PA 3K5OA 2PZUA 3S2DB 1XNQQ 1LT5D 1IBKL 4XIGS 1IBLQ 5EKKA 2XN9C 1BBWA 1PH5A 3CMAA 5IT9E 2X6GA 3PO3H 2MPMA 1OXVA 2CVRA 3NWSA 4FXKC 4K6LA 2IPKD 4NPSA 3H6MA 4R1JA 2B2YC 1SR3A 1S5CD 1PTOF 1TY0A 1U4RA 4JI3Q 1LTRD 2X69A 3CC4A 2F0LA 2QDBA 4DR1Q 2A69C 1KDBA 5GAEC 3F8TA 4UY8C 1L0YB 5M5YB 2XTIA 3PIP3 1EY0A 2MHVA 1O7IA 1VQFA 1Z9FA 1XNRQ 1K0SA 1M90C 1YHBA 2IT1A 2EJMA 1LTGD 1V43A 1EFWA 4LNQA 1V1QA 2F0NA 4JI7L 3T1HQ 3EROA 1BNZA 2F0TA 1YNND 1Q8KA 3A0JA 2WACA 2B39A 2ZM6Q 1TS4A 4F87A 4DV2L 2IHEA 1EIYB 4DFAA 4DV3L 3BZCA 4DUZL 4N9PA 2VQFL 4GN3B 4C3JH 3GTKH 1FD7D 2VQEL 1O78A 2FFKB 4FF3A 3PIO3 4KJNA 4AQYL 4DR2L 3L2PA 2WKCA 2A6HD 1IYUA 4RG1A 3T16A 4RCNA 3UDGA 2D9UA 3NBHA 2K03A 1U0LA 2PNHA 1E0BA 3LGJA 5ISRA 3I3CA 3M3YH 2WAQE 1YNNC 4IPCA 1VQOA 4A3EG 4JV5L 1FNVA 2EYHA 3PUXA 4A3IB 1PXUA 1X55A 3EFXD 3CCQA 5IOCA 1SLJA 1AFPA 3H94A 3OIPA 2SDFA 1CUKA 3D3RA 3J81c 1YHQA 2HDMA 3MC0B 1RF2D 2PI2A 4N8X1 1GHKA 3T1YL 1B53A 2VXWA 1B2TA 3HOWH 3PF4A 1X3PA 4YY3L 1J6QA 1LTSD 3K59A 2UUCL 2I5HA 3TMEA 2E5LL 5FO8B 3QO2A 1J5EQ 1QUQA 1F9RA 2NVYB 4CDDC 4JI5L 2NTSA 2HHHL 4POGA 3CCRA 3I4NG 3QG1A 1JB7A 2JA8G 2KCCA 4C3IG 1QZGA 4JBMA 1LT4D 3PUYA 5FOBB 1JOQA 1NJIC 3X3MA 3STBC 4KY5A 5FJ8G 2PZTA 2YU9B 3GTLB 1PH6A 1PYBA 3J7A5 1TWCH 1Y69U 1PH2A 1G8ZD 2EY6A 3T56B 4X65L 4FNFA 4E6IA 5M5XH 1K8GA 2BH2A 4B3RQ 1TS2A 1SMYD 1R4QB 4HN7A 2EYLA 2K1BA 5IIFA 3T51B 2EJFC 1TWGB 3M4QA 4JI6Q 1LV9A 3I2ZA
chains in the Genus database with same CATH topology
1IYVA 1ENAA 1SE2A 3Q22A 4KI0A 1G91A 2F4IA 1ONLA 3OWEB 1MSGA 1NR4A 2JA5B 1PFNA 1EOTA 2F0IA 4JBWA 1NCVA 3HG9A 4CHTB 1AZQA 3M7NA 1DD2A 5BN5A 3PUWA 4FO2A 4BS9A 3S1RB 1SYBA 1SMYC 4C1NI 1II3A 4F7XA 3R2TA 1J8IA 2G9DA 4FYDA 1I4PA 2B2VA 1K8OA 3PO2B 1D5MC 2K33A 5C3EB 3W2DA 4UDUC 2KEDA 3DWQA 5J1ZA 3T4AC 4CGYB 2IX1A 3OSOA 5I4DA 2B8GA 1GUTA 1Y1WB 4ZKCB 3S14B 4I7ZC 5HURA 5C4ZA 2L0CA 2WIIB 4H44C 1TWHB 3DMUA 5C0XH 1BUVT 1D5XC 2H4OA 5J39A 1Z47A 5CV4A 2BDNA 1PFBA 4K8JA 1IKMA 5HGTA 4IURA 1LT6D 2CW0D 5C3WA 4EQNA 4DN4M 1CA6A 4IUPA 1CQVA 2J0TD 4MHEA 1Y8OB 1DOMA 3CQZB 2YYZA 2NTTA 4A3BB 2ZT9C 4IUTA 3TN2A 3S2HB 4KTAA 2BE5C 5BN4A 3MXNA 3FDTA 2JEAI 2CW0C 2JA6B 1JQYD 1EY6A 4ZUJA 2PPBC 5LL6X 1EEID 5CORA 2J4XA 3ERQA 1H9RA 4HR7B 2L12A 1SNQA 1A15A 3E0JA 5IODA 1RODA 1Q8IA 1DZ1A 1SNCA 5TSSA 4ZYSA 2WV6D 1EYAA 5FKAC 1FYCA 3VR5A 3RD4A 2H1EA 2E75C 3R3OA 2QEJC 4HEDA 5I9PA 4IN3A 4BY1B 4G57A 4WJWA 4K14A 4A3KB 4HMJA 2A6EC 5EKLA 5JPNC 2DNEA 2HCIA 2O2LD 3M85A 1DONA 5D3DA 1KLGD 4B08A 2K01A 4WRDA 1OXXK 2NVXB 1RTNA 3K5NA 5D3IB 1SFOB 5C0XI 5FLXE 1G2SA 4FXDA 4K5WA 3TZDA 5ELDA 3FPPA 1HFGA 3V2TA 1BCPF 2K05A 1RCVD 1Q90A 5NUCA 1WTOA 3FVQA 1QWYA 2RDGA 2F0GA 3HOXB 1Q1BA 3C46A 5EJWA 5FO7B 1SYDA 4DU9A 3QOJA 4KKUA 1D6EC 4NMZA 2O5JC 4XQNA 3J81L 1EIGA 4NDXA 3VR6A 3D6WA 2M00A 3HS0C 1TY2A 4FP5D 3KK7A 3T13A 3OMCA 4EQOA 4ZUIA 4HTHA 3R93A 3O13A 5ELBA 5JPMC 1HQRD 2A74C 2QF7A 1AN8A 3MA2B 4NP5A 4DK0A 4XYQA 3GQBA 3I90A 2PNRC 3HOVB 3A7AB 1KLUD 3KLRA 3NXWA 5C4XB 3G6JB 3Q6SA 4DXGA 1GUGA 4OGQC 3P7JA 2D5DA 3HRZC 3MXPA 2JA7B 3S1NB 2CQAA 1BQQT 1S5FD 1S4ZA 2FMCA 3AU7A 4RGNA 2IWHA 4DNTB 2EE1A 1TR5A 4XTCS 4H0LC 1EQVA 3NTHA 1ENFA 3TP6A 2V4DA 2XNAC 2B8FA 5D65A 3J7AV 5KGUA 1SYCA 1EZ6A 2A68D 3NQTA 4KMUC 5I2YA 1C8CA 1SBBB 1HA5A 1K8MA 3MWYW 2F0UA 3CU7A 3BYTB 2ID0A 4WORA 5KNCA 4FVMA 4ULLA 1GUSA 4RGMA 2RBMA 1U4MA 2TMPA 2ZXRA 2DN8A 3MVVA 1BR9A 3D31A 5M3MB 1EQTA 3DEOA 3GP7A 5T1IA 4IFDH 3K5LA 1WCMB 2KUMA 1STHA 3C1EA 5COYA 1ZEQX 2Z1CA 1SE3A 2A5HA 2TSSA 4A3DB 2G9HD 2IL8A 3J81E 4BBRB 3J80L 3MXUA 4L8JA 2NZ1D 3BVGA 4PMWA 1G2TA 1TQOA 5IGGA 3K6OA 2B2VC 4O1NA 3HGBA 1F9SA 4I65A 1M4VA 1R9TB 5KYLA 4FXGC 1JORA 4F88A 3H3VC 4BA2I 3K0YA 3VR4A 3AB9A 3HEJA 1QJOA 1KAAA 1Z7TA 4OL7A 4L63B 4TSSA 4K5VA 5ELEA 1WD0A 2L55A 1ET6A 4LJZC 1RJTA 1DXMA 3SVMA 1J9OA 3MEHA 3VA7A 4K8IA 1JB3A 1WVLA 2KA7A 3OMGA 2PMZB 4K5XA 4LMQD 4PNYA 5E1FA 2RSNA 3BS1A 3S9WA 1M8AA 1MGSA 3SDZA 1EFID 1D1KA 3T53B 5JJZA 3ZYYX 4A3EB 2DY7A 3HP3A 1EY8A 3RZDB 1PRTF 2L11A 2EYMA 4F8MA 4RFBA 4Y7NB 3IKJA 2QILA 3EA6A 4C3JG 1CZGA 1H9JA 1I4GA 4IZ8A 1CTMA 1TIID 2VB2X 4IFDI 1TVXA 4KY7A 4RGOS 3J80E 2AWNA 3I4NB 2B2TA 3E6ZX 2JA8B 4C3IB 1V8QA 4TQUS 4RA8A 4KD3A 2WKDA 1TT2A 1ZYRD 1G6ZA 2A6HC 2XWJB 3P20A 4R9WA 5F2DA 3I72A 3F2UA 1C48A 1MSHA 5G3LD 4U68A 3MFYA 4A3GB 1B44D 4M8AA 4QUCA 1ZXTA 4KKSA 2RQXA 2EOTA 3BVZA 1ESRA 1I3QB 3MZ5A 1ZYRC 1RDPD 2FINB 5KNBA 5BN3A 3C1FA 2AQ1B 2PQEA 3Q0AA 4RH6A 4XQQA 1ENCA 3I8ZA 3LWEA 4BA1I 4V0BA 2B2WA 1DCZA 5I9OA 1EY5A 1EY7A 1NUCA 2JEBI 1CI3M 4FF4A 1STEA 1VF5C 1ILPA 1EU4A 1HCZA 4KHZA 2LY7A 3GTJB 3RLFA 2EYJA 1PZKD 1SJED 2JP1A 3ND8A 2XVSA 1Q12A 1D5ZC 2R6GA 4FF1A 1JE4A 5JEAJ 1PZJD 1KNEA 2XSCA 3KBXA 3D4WA 5CV7A 1PMRA 1PTOD 3D4RA 4A3JB 1FR3A 4IQZA 1XXGA 3NP8A 1XYIA 5AFWA 1G291 5JVH3 2N88A 1VDZA 1WTXA 4J8QA 1SAPA 4RHRA 2SOBA 3GTPB 1CQFA 4ODGA 3S17B 3GTQB 1MD2D 1B3AA 2MGSA 2F0SA 5DEHA 5EBDA 1BDOA 4C2MB 1B1ZA 4Q0FA 4U673 4K2KA 5CBAE 1PRTD 1UAPA 3LNNA 1ESFA 3OWFA 3JAML 3GV3A 3Q24A 1B9NA 5C0XG 1PTOC 1A3VA 1VMPA 5LHY1 5FLXL 1EY4A 3H0GB 1XTCD 4H7BA 4X3UA 3I73A 3KUPA 1HHVA 1FNUA 2XWBB 3FRPB 3MTSA 1IKLA 5C5MA 5K36H 5K5PA 4DAVA 2Q8RE 1TWAB 3NHHA 3IFDA 3GTOB 1HXYD 1U4PA 3DM1A 3QB3A 2BDOA 2K6AA 1JCKB 1LACA 3U9SA 4EGVA 3NPPA 4P2CB 2E2HB 4RAUC 3A56A 3A7LA 4CJ0B 1GJXA 2L5TA 3BDOA 3UI2A 3J7AF 4QCLA 1PFMA 3P1HA 3AMUA 3WOFA 2SEBD 1WTWA 2E2JB 2R3ZA 3FMCA 2R61A 2PW5A 1E2VA 4XDXA 5LL6S 1FGBD 2EDGA 3D8GA 2B63B 5E3FA 4B9WA 1S5ED 2F0OA 3SR1A 2R93B 1SNMA 4DNRB 2EY5A 1DOLA 1TKWB 4MN3A 3TBIB 1Z6HA 3EJIA 3I4MB 5C5LA 4V190 1SYEA 5EPLA 4L6TB 3Q23A 3I4LA 2NN6G 4DF7A 3JAME 3BYYB 2O5IC 4CKBA 1O7ZA 4IUUA 1QNUA 2K04A 3RUZA 1A3UA 3HOZB 2E2DC 1JOOA 1JWUD 2PCFB 3M4OB 2PW7A 2HUGA 3TDQA 4ABNA 1SEBD 2RA4A 3NBIA 5KIXA 2IX0A 3OPOA 4NKLA 5FK9C 1RKNA 2R92B 3SK4A 4KV6A 4JK1C 1H9SA 4DK1A 1BBXC 1S5BD 4PMBA 4KN4C 4DAYA 1U9RA 5I6WA 4G4KA 1UEAB 2K7VA 3OOCA 3HOYB 1EL0A 2Z4IA 5JEAG 2DNCA 1D1IA 2N55A 5DAUA 1D2BA 4X3KA 1SYFA 3QIAA 5CYUA 4XQJA 1ZKOA 1C4QA 2F03A 1WTPA 2X6LA 3DHQA 2EXZA 3CKIB 5C4HA 2PZWA 5CBEE 3WOEA 2DY8A 3SK5A 4XXEA 2B2TC 5J22A 3SE0A 1TWFB 1IHZA 5DM63 3SEBA 2RKSA 4CJ1B 1EEFD 3VA5A 3MFGA 4QF4A 4O42A 2KEEA 4PQXA 2E76C 4IUVA 1IW7D 3VYTA 3R2IA 3CHBD 3NTKA 2IJ0A 1RHPA 3HOUB 1DOKA 4HCEA 4NW2A 4K2LA 1I4QA 4X3TA 2XRQD 5E4XA 3MHBA 3HKZB 5JOBA 1GUOA 2ICIA 3U9OA 1V1OA 4UAIA 1GHJA 1BOSA 1F9QA 3N6RA 5M9OA 2AUJD 2CHBD 1Q3LA 1SDFA 2FMMA 2MP1A 2F0WA 4OO1H 4R8NA 1LTTD 1Y8NB 3GO5A 2VUMB 3L7ZC 4LAAA 5KYIA 2B2WC 1KDAA 2Z8LA 3E5SA 4IALA 1OXUA 3NWTA 4QMGA 4X3SA 5C44B 4LK1C 2E2IB 2B2UA 3NSWA 4IFDG 2A68C 2F3VA 2D2CC 2KJXA 3TSSA 3M7GA 1QCBD 2KOLA 3NTIA 3FKIB 1PTOB 1SJHD 4A93B 1B50A 5CR3A 3W3AA 5EPJA 2NUCA 3PO3B 2ICEC 1BCPD 5EQ0A 4ZLTF 1XWEA 1ILQA 1X3QA 4ZAIA 2O4XA 2OT2A 4G7OC 5CV8A 2AWOA 4J1MA 1B4OA 4HSPA 4H13C 1CK1A 3OW7A 1GOZA 1F2YA 1MBYA 4RCOA 2A69D 2RDFA 3NQIA 4KHVA 1LLRD 4QB4A 4RHSA 2MUYA 1BCPC 2BOSA 3TZUA 4C3HG 1QOHA 4FF2A 4C3JB 3GTKB 4CJ2C 1SSOA 2KCNA 5C0XJ 1LO5D 2F0VA 1HUMA 2K5WA 5E4WC 4YIJA 1STGA 2M9VA 3VYRA 3M3YB 1JWMD 3DXJC 3N52A 4OO1I 2NYZD 3K57A 5T1GA 5IGFA 2FHTA 1Y8PB 1QNKA 2RSOA 3HOWB 4KY6A 2MJ8A 3DEPA 5I6YA 4ZRZA 2JXMB 2F0MA 3NUCA 3I91A 4RKLA 2EJGC 1PDQA 2ENBA 5IGEA 3VR2A 3PUVA 4XT1B 3G7LA 3CRKC 1KABA 1SYGA 3TP7A 4CBVA 1A2UA 1HTPA 4ZKBB 5IGCA 5JAVA 4XYOA 1TWCB 2K5QA 3A54A 5M5XB 1S5DD 2K5DA 2NB0A 2F3WA 4PV1C 1RTOA 2EYOA 5DM73 5A35A 1AZPA 1EY9A 5CMDA 1GUNA 4PMCA 3GD7A 1JWSD 3R8BA 2BA0A 1WD1A 5JVG3 4B9XA 2I07B 2XRSD 2EVBA 3PV0A 4XT3B 3K7AB 3A8IE 5CV9A 1I4XA 1STAA 2HQEA 3S1MB 1KTKA 2EYPA 5M3FB 1W6KA 1ML0D 3BZDB 2AQ3B 1NAPA 5D14A 2EYFA 4CKEA 4DXFA 3FPUB 1MI2A 4DAPA 1EWCA 3S16B 2NWGA 1LABA 4EQPA 4A3MB 3PMFA 1U4LA 1TU2B 3IAYA 4MIUA 2Y0SB 4BBSB 2GA4B 1QILA 3A55A 1R4PB 5CV5A 1SXTA 3NE5B 4C56C 4EVOA 5CGKA 2LKVA 4G7ZC 2LMCB 3H09A 1EYDA 1T5EA 4CKCA 3URYA 1F2MA 3HZXA 3GV6A 2QCPX 1PLFA 2SNSA 2OXPA 4DA2A 4Q5VA 1HRJA 2HCCA 1K83B 1EYCA 4M1UB 4R8IA 2HDLA 3KF8A 2PO4A 3PUZA 2KVMA 2NBFA 3S15B 4N9TA 1I4HA 2EY1A 1A2TA 4RWSC 3I70A 1CM9A 2F1MA 1ICWA 1F77A 1STNA 1CHPD 2RDHA 1QG7A 5CC4A 3SK6A 3CRLC 4OIKA 2E74C 3SXHA 1HTLD 3V05A 5IGDA 3EVQA 5M5WB 1ET9A 5KEEA 3QJYA 3C3LA 5K36G 1EU3A 5IGBA 1HPCA 1BO0A 2B2YA 3A8KE 3L9AX 4DGZA 5EKIA 2BE5D 1PRTC 2LFNA 4IUQA 4K6DA 3SHLA 2AUKA 1WTQA 3DWAA 2ZXOA 4HCSA 3BDLA 2F0KA 3KLSX 1L0XB 1DJRD 4KK7A 1HQMC 3H91A 3IL8A 3TP8A 2F0FA 2B2UC 1E2WA 4TRDA 2Q8IB 3C2PA 4A3FB 3RZOB 5EPKA 2WINB 1RD9D 1X32A 1BCPB 4IFDJ 1EZ8A 2EZVA 2OF1A 2L9HA 1KDCA 1NSNS 1BXTA 1SNPA 1VCIA 2EPBA 1W6JA 1LTID 1LTAD 1JOKA 2A6ED 3LX0A 3KLSA 2QKIC 3BG3A 3SK8A 5KNDA 3VYSA 3P75A 3OHXC 3ITPA 2A73B 5EGTA 2F0QA 1I4RA 3RMHA 2RVLA 3OIQA 3IFTA 2F0PA 2F0JA 1I50B 1B9MA 1F2LA 4BWGB 1JICA 2NVTB 2D62A 1CA5A 1AP0A 2WB1B 1LTBD 2NN6H 1SNDA 2ZXPA 3TP5A 3K5MA 2AQ2B 1WTVA 2WAQB 3A8JE 4HAEA 1Y1VB 5C6AA 4KJOA 1WTRA 1BF4A 3FEWX 4BY7B 1SE4A 1EIHA 3ND9A 3J7YW 3VYUA 1V1PA 2KECA 3LWUA 5C3XA 1VMCA 2VB3X 3NK9A 1NR2A 1HA6A 1QE6A 5A2QL 5JEAH 1DYQA 3BDCA 2L4NA 1E2ZA 3QOLA 2M2LA 2Q8TA 4OIJA 4WFN3 2IX3A 1QB5D 1A3TA 4S3SA 3K58A 2F0EA 1HUNA 2L1BA 5FO9B 3VR3A 4HSVA 1H9SB 1CFMA 2K28A 4KKTA 1DM0B 3X3NA 1YNJD 1UNSA 2EY2A 2F0DA 1TS3A 1V1PB 2J7ZA 1F2ZA 1OXTA 1CZWA 1O80A 3D4DA 3GTGB 1XX8A 3ONAB 2VNUD 1EWHA 1PYWD 1HFNA 1GXDC 5C4JB 1A6XA 5IT9L 2JYOA 4OHJA 1LT3D 1IW7C 4KN7C 3M4YA 4KD4A 1YNJC 1VF7A 4OO1G 2NN6I 4J6HA 1I6HB 3DUZA 1I6VC 2Z4HA 5CV6A 4ZK9B 4QIWB 3GTMB 3L3OC 2R7ZB 5I2XA 2BCOA 1OO9B 1SNOA 1OXSC 4QUFA 5EBCA 4ZQ3A 2FJ2A 3BVMA 1IL8A 1FNWA 3V96A 3MXGA 3KBGA 1TS5A 5KRUA 1H9MA 1GUWA 2WP8J 1STBA 5A2QE 1CT1D 1Q1EA 1O7LA 3D6CA 5G3LF 2KHSA 2K32A 1STYA 2OEOA 4ME5A 5ELCA 3WDNA 4C3HB 3EQLC 2C9OA 4Z9CB 4IUNA 1KNAA 4G7HC 1JC7A 2I46A 2F0HA 1PRTB 2IW3A 2JSOA 4TKOB 4HMIA 4ILWA 1PZID 4AYBB 1O7YA 1AW7A 2XIWA 2NVQB 2C5CA 3DWPA 5ELFA 3QWNA 4C1NK 4RGTA 2LS01 4RKBA 1UUPA 3MAQA 2BA1A 1AEXA 1T5XD 4ID6A 1CHQD 3S1QB 2PYKA 4GZYC 5DNFA 1JR0D 1F9PA 1H9KA 2JE6I 2SNMA 1PTOH 3K5OA 2PZUA 3S2DB 1LT5D 4XIGS 5EKKA 2XN9C 5IT9E 2X6GA 2MPMA 1OXVA 2CVRA 3NWSA 4FXKC 4K6LA 2IPKD 3H6MA 2B2YC 1S5CD 1PTOF 1TY0A 1U4RA 1LTRD 2X69A 2F0LA 2QDBA 2A69C 1KDBA 1L0YB 5M5YB 3PIP3 1EY0A 2MHVA 2IT1A 2EJMA 1LTGD 1V43A 2F0NA 3EROA 1BNZA 2F0TA 1YNND 2WACA 2B39A 1TS4A 4F87A 4DFAA 4N9PA 1FD7D 1O78A 2FFKB 4FF3A 3PIO3 4KJNA 2WKCA 2A6HD 1IYUA 3T16A 4RCNA 2D9UA 3NBHA 2K03A 1E0BA 5ISRA 3I3CA 1YNNC 1FNVA 2EYHA 3PUXA 4A3IB 1PXUA 3EFXD 5IOCA 1AFPA 3H94A 3OIPA 2SDFA 3D3RA 2HDMA 3MC0B 1RF2D 1GHKA 1B53A 2VXWA 1B2TA 1X3PA 1LTSD 3K59A 3TMEA 5FO8B 3QO2A 1F9RA 2NVYB 2NTSA 3QG1A 2KCCA 4C3IG 1LT4D 3PUYA 5FOBB 1JOQA 3X3MA 4KY5A 2PZTA 2YU9B 3GTLB 1Y69U 1G8ZD 2EY6A 3T56B 4FNFA 4E6IA 1TS2A 1SMYD 1R4QB 4HN7A 2EYLA 2K1BA 5IIFA 3T51B 2EJFC 1TWGB 1LV9A 2KQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VMP A;  1ESR A;  2KVM A;  1RHP A;  1B4O A;  2EPB A;  2RSN A;  1DOK A;  1O7Z A;  4X3U A;  4IUU A;  4NW2 A;  1M8A A;  1RTO A;  2FIN B;  4X3T A;  5E4X A;  1G91 A;  1MGS A;  3KUP A;  5EJW A;  2K04 A;  2FFK B;  4IUT A;  3TN2 A;  4RWS C;  1MSG A;  1AZP A;  1NR4 A;  1HHV A;  1HUN A;  1CM9 A;  2L1B A;  1PFN A;  5JJZ A;  3MTS A;  5CMD A;  1U4M A;  1EOT A;  1KNA A;  3I8Z A;  1IKL A;  1NCV A;  2HUG A;  3FDT A;  4UAI A;  1AZQ A;  2Q8R E;  3LWE A;  2D9U A;  2RA4 A;  4HSV A;  1ICW A;  2B2W A;  2DY7 A;  2K03 A;  1WD1 A;  1EQT A;  1F9Q A;  2K28 A;  3DEO A;  5T1I A;  3HP3 A;  3IFD A;  2KUM A;  4CJ2 C;  1O7Y A;  1QG7 A;  1U4P A;  1E0B A;  1EIG A;  1SSO A;  2L11 A;  1Q3L A;  1SDF A;  2XIW A;  2RVL A;  3DM1 A;  3I3C A;  5COY A;  3D6W A;  5COR A;  1ILP A;  2FMM A;  2MP1 A;  1BBX C;  2B2V A;  4OIK A;  4XT3 B;  2J7Z A;  2IL8 A;  4OIJ A;  1F2L A;  1JIC A;  2SDF A;  1O80 A;  2L12 A;  1HUM A;  5E4W C;  2NZ1 D;  2HDM A;  1CA5 A;  1AP0 A;  2KED A;  1A15 A;  1XX8 A;  3R93 A;  3ONA B;  1EL0 A;  1B53 A;  1ROD A;  2B2W C;  2JP1 A;  1G2T A;  5DNF A;  1DZ1 A;  1TVX A;  4RAU C;  1F9P A;  2VXW A;  1B2T A;  2N55 A;  4CJ0 B;  2B2Y A;  1BO0 A;  1X3P A;  4X3S A;  1ML0 D;  3N52 A;  3UI2 A;  1HFN A;  1WTV A;  1PFM A;  4X3K A;  5EKI A;  1NAP A;  1JE4 A;  2B2U A;  2NYZ D;  2H1E A;  3I90 A;  4IUQ A;  5D14 A;  4HAE A;  1WTQ A;  2B2T A;  5T1G A;  4HCS A;  1KNE A;  2B2V C;  3FPU B;  3KBX A;  2JYO A;  4ZKC B;  1MI2 A;  2FHT A;  3QO2 A;  1WTR A;  1F9S A;  4HED A;  1F9R A;  1QNK A;  1BF4 A;  2RSO A;  3MWY W;  1WTW A;  2NWG A;  2KOL A;  3Q6S A;  2R3Z A;  1WTP A;  2X6G A;  1EIH A;  3P7J A;  4RA8 A;  2X6L A;  2MJ8 A;  1XYI A;  1U4L A;  5AFW A;  2MPM A;  3H91 A;  3DEP A;  2CVR A;  4XDX A;  2N88 A;  5CBE E;  2B2Y C;  1B50 A;  1S4Z A;  4ZK9 B;  2KEC A;  3IL8 A;  2HCI A;  1U4R A;  1DON A;  1WTX A;  1G6Z A;  1SAP A;  2X69 A;  2B2U C;  2DY8 A;  3I91 A;  2K01 A;  2EE1 A;  1VMC A;  1RTN A;  2BDN A;  1PDQ A;  2B2T C;  5EPJ A;  1PFB A;  4XT1 B;  5EPK A;  1IKM A;  1DOL A;  3G7L A;  1WD0 A;  1NR2 A;  1B3A A;  2MGS A;  4IUR A;  1HA6 A;  4R9W A;  3GV6 A;  5EQ0 A;  4QUF A;  5D65 A;  4ZLT F;  4MN3 A;  1RJT A;  4CJ1 B;  1G2S A;  1X32 A;  3F2U A;  1PLF A;  1QE6 A;  2FJ2 A;  1IL8 A;  3SVM A;  1MSH A;  1ILQ A;  1J8I A;  1X3Q A;  1J9O A;  4ZAI A;  1HRJ A;  2HCC A;  4DN4 M;  5CBA E;  4ZKB B;  3TZD A;  4O42 A;  1CA6 A;  2KEE A;  2K1B A;  2L4N A;  4U68 A;  4IUP A;  1HFG A;  3GV3 A;  5EPL A;  1WVL A;  4R8I A;  1BNZ A;  4QUC A;  4IUV A;  1ZXT A;  2K05 A;  1C8C A;  1GUW A;  2M2L A;  4MHE A;  2Q8T A;  1DOM A;  2HDL A;  2L9H A;  1WTO A;  1LV9 A;  4LMQ D;  2EOT A; 
#chains in the Genus database with same CATH topology
 1Q82 C;  4A3G G;  3E0E A;  1IYV A;  1ENA A;  1SE2 A;  3Q22 A;  2UXB Q;  4KI0 A;  1G91 A;  2F4I A;  4HIO A;  1ONL A;  1PYS B;  3ERS X;  4OWW B;  3OWE B;  4GKJ Q;  1MSG A;  1NR4 A;  2JA5 B;  1PFN A;  5JJK A;  1EOT A;  2F0I A;  1CSQ A;  4JBW A;  4DR6 L;  1NCV A;  3HG9 A;  3K7A H;  4CHT B;  1AZQ A;  3M7N A;  1DD2 A;  5FLM H;  2VW9 A;  5BN5 A;  3PUW A;  4FO2 A;  4YWM A;  1KRT A;  4BS9 A;  3U58 A;  3S1R B;  1SYB A;  1SMY C;  4C1N I;  2ZTE A;  3S1M H;  1II3 A;  2RF4 A;  4F7X A;  3R2T A;  3PSI A;  1J8I A;  4A3C G;  5M3F H;  2G9D A;  4FYD A;  1I4P A;  2B2V A;  1K8O A;  3SGI A;  2QA4 A;  1CKO A;  3PO2 B;  1D5M C;  2K33 A;  3CP0 A;  5ELO A;  5C3E B;  3W2D A;  4LF7 Q;  4UDU C;  2KED A;  3DWQ A;  5J1Z A;  4IPH A;  3T4A C;  1NNX A;  4A3M H;  3J80 c;  1W3S A;  4CGY B;  2IX1 A;  3OSO A;  5I4D A;  1VS0 A;  1VQ9 A;  4BBS H;  4YCV A;  2C35 B;  2B8G A;  1L1O A;  1GUT A;  1Y1W B;  4ZKC B;  3S14 B;  4I7Z C;  5HUR A;  1WI5 A;  5C4Z A;  1XMO Q;  2L0C A;  2UUA L;  2WII B;  3WWV A;  4H44 C;  1TWH B;  5IYB G;  3DMU A;  5C0X H;  1BUV T;  1D5X C;  2H4O A;  4OX9 L;  5J39 A;  4A3J G;  3PCO B;  1K83 H;  1Z47 A;  5CV4 A;  2BDN A;  5HY6 A;  1PFB A;  4K8J A;  4ALP A;  3UDX A;  1IKM A;  5HGT A;  1N33 Q;  2F52 A;  4DR5 Q;  4IUR A;  3J7Z C;  1LT6 D;  1HR0 W;  1EOV A;  4LF8 Q;  2CW0 D;  3S15 H;  4JI1 Q;  5C3W A;  3KF8 B;  4EQN A;  4DN4 M;  1CA6 A;  3UE0 A;  4IUP A;  3PO2 H;  1CQV A;  2J0T D;  4MHE A;  4K0K L;  1Y8O B;  1DOM A;  3CQZ B;  2YYZ A;  2NTT A;  4A3B B;  2MFI A;  2ZT9 C;  3IRB A;  2YV5 A;  4GNX A;  4MTN A;  4IUT A;  3TN2 A;  3S2H B;  4KTA A;  2CKZ B;  2BE5 C;  5BN4 A;  3S14 H;  2ALY B;  3H0G G;  2KCT A;  3MXN A;  4DUY Q;  3FDT A;  4HJA A;  1L1O B;  2JEA I;  1UWV A;  2CW0 C;  2KBN A;  1JQY D;  2RCN A;  5M5W H;  3RR5 A;  2JA6 B;  1EY6 A;  3K0X A;  2PQA A;  4ZUJ A;  2PPB C;  5LL6 X;  4A3L H;  4DUZ Q;  1EEI D;  1HNZ Q;  1N32 Q;  5COR A;  2J4X A;  3ERQ A;  1YJW A;  1K3B C;  1H9R A;  4HR7 B;  2L12 A;  1SNQ A;  4DV0 L;  1A15 A;  3E0J A;  5IOD A;  2F4V L;  1IYJ B;  2EXD A;  1ROD A;  4TVA B;  1Q8I A;  1D8L A;  1I94 Q;  1DZ1 A;  1SNC A;  5TSS A;  4ZYS A;  1RL2 A;  1A63 A;  2WV6 D;  1EYA A;  5FKA C;  1FYC A;  2PMZ E;  4MTK A;  3VR5 A;  4LUO A;  3RD4 A;  4X64 L;  3U4V A;  2OQK A;  2KHI A;  2H1E A;  1C0A A;  1GKH A;  2E75 C;  3R3O A;  2QEJ C;  1X9N A;  4HED A;  1X54 A;  4HJ9 A;  3PF5 A;  4O2D A;  1Q81 C;  4A3F H;  5I9P A;  3RZO H;  4IN3 A;  4GOP A;  4LFC Q;  4BY1 B;  4G57 A;  3DLL A;  4WJW A;  1NY4 A;  4K14 A;  4A3K B;  4LWC A;  4HMJ A;  2K4K A;  2A6E C;  5EKL A;  5JPN C;  2DNE A;  2HCI A;  2O2L D;  3M85 A;  1DON A;  1G6P A;  4LUZ A;  4DV1 L;  1KLG D;  4WRD A;  5D3D A;  2F3I A;  2K01 A;  1OXX K;  4B08 A;  1RTN A;  2NVX B;  3A74 A;  3K5N A;  5D3I B;  2OCE A;  4NXM L;  2B63 G;  1SFO B;  1PVO A;  5C0X I;  5FLX E;  1G2S A;  4FXD A;  2R93 G;  4A76 A;  2PQA B;  4K5W A;  4BXX G;  3TZD A;  1JJG A;  5ELD A;  3FPP A;  1HFG A;  3V2T A;  1BCP F;  4QGU A;  2K05 A;  1RCV D;  1Q90 A;  5NUC A;  3I4M G;  1WTO A;  4GLX A;  2UUB L;  4JI8 L;  2MQH A;  3FVQ A;  4NXN L;  1QWY A;  2RDG A;  2F0G A;  3HOX B;  1Q1B A;  3C46 A;  5EJW A;  5FO7 B;  1SYD A;  4DU9 A;  3QOJ A;  4KKU A;  1KQS A;  1AH9 A;  1A62 A;  1D6E C;  1I50 H;  3EIV A;  3TQY A;  3W5O A;  4NMZ A;  5BR8 L;  3QR8 A;  3HOZ G;  1X3E A;  2O5J C;  4XQN A;  4GOP B;  2JN4 A;  4X62 L;  3J81 L;  1EIG A;  4NDX A;  3VR6 A;  4DV6 Q;  3D6W A;  2IY5 B;  4DV5 Q;  2M00 A;  3HS0 C;  1V9P A;  1TY2 A;  4FP5 D;  3KK7 A;  3T13 A;  2R92 G;  2DJG C;  3OMC A;  4YWL A;  4ZUI A;  4EQO A;  4HTH A;  4UPA A;  3R93 A;  3AFP A;  3O13 A;  2HQL A;  1E22 A;  5ELB A;  3D0F A;  5JPM C;  1HQR D;  4GN5 A;  2A74 C;  2QF7 A;  1AN8 A;  3MA2 B;  5LMN W;  4NP5 A;  4DK0 A;  4XYQ A;  1LUZ A;  3GQB A;  3I90 A;  2PNR C;  3HOY G;  5IP9 G;  3HOV B;  3A7A B;  1KLU D;  3KLR A;  3NXW A;  5C4X B;  3G6J B;  3HKS A;  3Q6S A;  1GUG A;  4DXG A;  4OGQ C;  1CKM A;  3P7J A;  2D5D A;  3HRZ C;  3MXP A;  2JA7 B;  3S1N B;  2CQA A;  1BQQ T;  1S5F D;  1S4Z A;  2FMC A;  3CME A;  3AU7 A;  1U5K A;  4RGN A;  2IWH A;  4DNT B;  2EE1 A;  1TR5 A;  4XTC S;  4H0L C;  1YJ9 A;  1EQV A;  3NTH A;  1QVF A;  5AJ3 Q;  1ENF A;  1VQA A;  2PI2 E;  3TP6 A;  4R4O A;  1A0I A;  2V4D A;  4JI0 Q;  2I5M X;  2B8F A;  2XNA C;  5D65 A;  1N34 L;  3J7A V;  5KGU A;  1SYC A;  1EZ6 A;  2A68 D;  5HGQ A;  3NQT A;  4KMU C;  5GQO A;  5I2Y A;  1N36 L;  1C8C A;  1SBB B;  5IE8 A;  1HR0 L;  3JC6 6;  1HA5 A;  1K8M A;  3MWY W;  2F0U A;  3CU7 A;  1JMC A;  4B3T L;  3JAM c;  1GD7 A;  2ID0 A;  3BYT B;  4FDB A;  4WOR A;  1FJG Q;  4X66 L;  3EN2 A;  5KNC A;  2KCM A;  4FVM A;  4ULL A;  2H5X A;  1GUS A;  4RGM A;  2RBM A;  5FLX c;  3HOU G;  2VS1 A;  1QVG A;  1U4M A;  2TMP A;  2ZXR A;  4DR3 Q;  1E3P A;  2DN8 A;  3MVV A;  3HKZ G;  1BR9 A;  3D31 A;  5M3M B;  1EQT A;  4DR7 Q;  2ES2 A;  3DEO A;  3GTG H;  3GP7 A;  5T1I A;  4IFD H;  3S1N H;  3K5L A;  1WCM B;  2KUM A;  3W1B A;  3CPW A;  1STH A;  3C1E A;  5COY A;  1ZEQ X;  2Z1C A;  1SE3 A;  2A5H A;  2TSS A;  3RN2 A;  4A3D B;  3NEL A;  1SRU A;  4WJ3 M;  2G9H D;  2IL8 A;  5C4J H;  3J81 E;  4OEM B;  4BBR B;  3J80 L;  4A75 A;  3MXU A;  4L8J A;  2NZ1 D;  3BVG A;  4PMW A;  3FP9 A;  1G2T A;  4HJ5 A;  1JJC B;  1TQO A;  2DGY A;  4DR4 L;  2VUM G;  5IGG A;  3K6O A;  1I6H H;  2A1A A;  2B2V C;  4O1N A;  3GTM H;  3HGB A;  4DV4 L;  1F9S A;  4I65 A;  2R7Z H;  1M4V A;  1R9T B;  5C44 G;  5KYL A;  4FXG C;  1JOR A;  4F88 A;  3H3V C;  2MNA A;  4BA2 I;  1VQC A;  5JJL A;  3K0Y A;  3VR4 A;  3AB9 A;  3TRE A;  3HEJ A;  1QJO A;  4LF9 Q;  1KAA A;  1Z7T A;  2Q2I A;  1IZ6 A;  4OL7 A;  3NEM A;  1L1O C;  4L63 B;  3ZJY C;  4A93 G;  4TSS A;  4K5V A;  5ELE A;  1WD0 A;  1K28 A;  2CH4 A;  2L55 A;  1ET6 A;  3NEN A;  4LJZ C;  1RJT A;  1DXM A;  3SVM A;  4LF4 L;  1J9O A;  3PO3 G;  3MEH A;  3VA7 A;  4K8I A;  1QZH A;  1JB3 A;  4JI2 Q;  2KA7 A;  1WVL A;  4C3H H;  3ICE A;  3OMG A;  1XMQ Q;  2PMZ B;  4K5X A;  4JG2 A;  4LMQ D;  4PNY A;  2UU9 Q;  2CH4 W;  5E1F A;  4OWX B;  2RSN A;  1QVC A;  3BS1 A;  3KDF B;  2AKW B;  3S9W A;  1M8A A;  1MGS A;  3SDZ A;  2HIV A;  1EFI D;  1D1K A;  4WJ4 A;  2NVQ H;  3T53 B;  5JJZ A;  4DV7 Q;  3ZYY X;  4A3E B;  2DY7 A;  3MEF A;  3S1Q H;  4UHV A;  3HP3 A;  1EY8 A;  3RZD B;  1G51 A;  1PRT F;  2K5V A;  2L11 A;  2EYM A;  4F8M A;  4RFB A;  4Y7N B;  4GNX C;  3IKJ A;  4AIM A;  2QIL A;  3EA6 A;  3CCV A;  1KXL A;  4YHH Q;  4C3J G;  3S2D H;  3TS0 A;  1CZG A;  1H95 A;  1H9J A;  1I4G A;  4IZ8 A;  1CTM A;  1TII D;  4LF5 Q;  2VB2 X;  4IFD I;  1YHA A;  2R7F A;  1TVX A;  4KY7 A;  4RGO S;  3J80 E;  1VQ6 A;  2HD3 A;  4LFA L;  2AWN A;  3I4N B;  1LM0 A;  1E24 A;  2B2T A;  3E6Z X;  4R4Q A;  2JA8 B;  2GVA A;  4C3I B;  1V8Q A;  1VQJ A;  5LMN L;  1HZB A;  5M5Y H;  1IL2 A;  5IY0 A;  4TQU S;  4RA8 A;  4KD3 A;  4HJ7 A;  1PH1 A;  2ASB A;  2WKD A;  1TT2 A;  1ZYR D;  2QEX A;  1G6Z A;  1CSP A;  3HOW G;  1MJC A;  5IP7 H;  2A6H C;  1AE3 A;  2XWJ B;  1YEZ A;  4P73 A;  1S3O A;  3P20 A;  4R9W A;  1K0R A;  5F2D A;  3I72 A;  4GOP C;  4YCW A;  3F2U A;  1C48 A;  3B6Y A;  1MSH A;  2UXD L;  5G3L D;  4U68 A;  3MFY A;  4A3G B;  1B44 D;  4M8A A;  1GVP A;  4QUC A;  1ZXT A;  4KKS A;  1YI2 A;  2RQX A;  1GM5 A;  2EOT A;  3BVZ A;  1ESR A;  1I3Q B;  1SN8 A;  3MZ5 A;  1ZYR C;  1RDP D;  3KLW A;  3J81 i;  3F2B A;  2UXC Q;  2FIN B;  5KNB A;  4DK6 C;  4JOI A;  5BN3 A;  2RHS B;  4IJL A;  3C1F A;  2RHQ B;  3NBH B;  1BBU A;  2AQ1 B;  4JCV E;  2PQE A;  4C3I H;  3Q0A A;  4RH6 A;  4XQQ A;  3PIO A;  4A3I H;  1ENC A;  3I8Z A;  1C7Y A;  3LWE A;  4BA1 I;  2LSS A;  4V0B A;  2B2W A;  1DCZ A;  1LTL A;  1WYD A;  1IBM L;  5I9O A;  1EY5 A;  5IWA L;  4H02 A;  5J3B A;  1EY7 A;  1NUC A;  2JEB I;  1CI3 M;  4FF4 A;  1STE A;  1VF5 C;  1ILP A;  4B3S Q;  1EU4 A;  1HCZ A;  4KHZ A;  2LY7 A;  3GTJ B;  3RLF A;  2EYJ A;  2VY3 A;  1PZK D;  5IYC G;  2NVY H;  4R4T A;  1SJE D;  3OTO Q;  2JP1 A;  3ND8 A;  5FLM G;  1QUQ B;  1K73 C;  4A3G H;  2XVS A;  1UEB A;  1Q12 A;  3CW2 C;  1D5Z C;  2R6G A;  4FF1 A;  1JE4 A;  5JEA J;  1PZJ D;  5E7N A;  1KNE A;  2XSC A;  3KBX A;  3D4W A;  5CV7 A;  5M3F G;  1VQ8 A;  2YU9 H;  3GTL H;  1PMR A;  1PTO D;  3D4R A;  3HKZ E;  4A3J B;  1FR3 A;  4IQZ A;  4JBK A;  1XXG A;  3NP8 A;  1XYI A;  5AFW A;  1G29 1;  5JVH 3;  4JI4 L;  2N88 A;  1VDZ A;  3K81 C;  1EQR A;  2MO1 A;  2Q2T A;  1VQD A;  1WTX A;  2AHO B;  1SAP A;  4J8Q A;  4RHR A;  2SOB A;  3GTP B;  4A3M G;  3W1G A;  1CQF A;  4ODG A;  3S17 B;  3GTQ B;  1TWG H;  2Y0S G;  1MD2 D;  4BBS G;  1B3A A;  2MGS A;  2F0S A;  5DEH A;  5EBD A;  4L5R C;  1BDO A;  3I4O A;  1B1Z A;  4C2M B;  3TRZ A;  4Q0F A;  4U67 3;  1PH9 A;  4K2K A;  5CBA E;  3GDE A;  1PRT D;  1UAP A;  3LNN A;  1ESF A;  3OWF A;  3JAM L;  2K5H A;  3GV3 A;  3Q24 A;  1B9N A;  5C0X G;  4KHP Q;  1PTO C;  2JA5 H;  1A3V A;  1VMP A;  4JYA Q;  5LHY 1;  4JVZ A;  5FLX L;  1EY4 A;  3H0G B;  1XTC D;  4H7B A;  4X3U A;  3I73 A;  3S1R H;  1HNW L;  2OQ0 A;  1IBK Q;  3KUP A;  1MIU A;  3CC2 A;  1E1O A;  1HHV A;  1FNU A;  2XWB B;  3J80 i;  3FRP B;  3MTS A;  2G5D A;  1IKL A;  5C5M A;  5K36 H;  5K5P A;  4DAV A;  2Q8R E;  2ZJQ A;  1TWA B;  4IPG A;  5C3E H;  2Z6K A;  4PZ7 A;  3NHH A;  3IFD A;  3GTO B;  1HXY D;  1U4P A;  3DM1 A;  3QB3 A;  2BDO A;  4J15 A;  2E8G A;  2K6A A;  1JCK B;  3CXC A;  3CC7 A;  4GKK L;  2MO0 A;  1LAC A;  1PFS A;  4CDE C;  3U9S A;  1PH8 A;  4EGV A;  3NPP A;  1Y1W H;  4A4I A;  4P2C B;  3A5Z B;  2E2H B;  4JI7 Q;  2GVB A;  4RAU C;  3A56 A;  3A7L A;  4CJ0 B;  1GJX A;  2L5T A;  1TWH H;  3BDO A;  1B8A A;  3UI2 A;  1CKN A;  3J7A F;  1PFM A;  2EQS A;  3G71 A;  3P1H A;  4QCL A;  4DV2 Q;  3AMU A;  5LMU L;  2JK8 A;  1KIX A;  4DV3 Q;  1JT8 A;  4R4C A;  2A19 A;  3WOF A;  2SEB D;  4LF6 L;  4A3L G;  1WTW A;  2VQF Q;  2R3Z A;  2E2J B;  2VQE Q;  4YCU A;  4AQY Q;  4DR2 Q;  3FMC A;  2R61 A;  2PW5 A;  1E2V A;  4XDX A;  5GRO A;  5LL6 S;  1T9H A;  1FGB D;  2EDG A;  3RN5 A;  3D8G A;  1K9M C;  1FL0 A;  2B63 B;  5E3F A;  4B9W A;  1S5E D;  2F0O A;  3SR1 A;  1SMX A;  3KOJ A;  4I7A A;  4LFA Q;  4LFB L;  2R93 B;  1SNM A;  4DNR B;  2EY5 A;  1DOL A;  1TKW B;  1KAW A;  3GTO H;  1I5F A;  3CQZ H;  4MN3 A;  3TBI B;  4JV5 Q;  1Z6H A;  3EJI A;  3I4M B;  1L2F A;  4A3F G;  4A3B H;  5C5L A;  4V19 0;  1SYE A;  1UE1 A;  1PA6 A;  4B3M L;  3I56 A;  5EPL A;  4L6T B;  3HFZ B;  3T1Y Q;  3S2H H;  3Q23 A;  3CCL A;  3I4L A;  2NN6 G;  2OWO A;  4GNX B;  4DF7 A;  3KF6 A;  2E2H H;  3JAM E;  4YY3 Q;  1XNQ L;  3BYY B;  1IBL L;  2O5I C;  4CKB A;  1O7Z A;  4IUU A;  2UUC Q;  3MXN B;  2JA6 H;  1S72 A;  1JE5 A;  2E5L Q;  1QNU A;  2K04 A;  3RUZ A;  1A3U A;  4P72 A;  3HOZ B;  1AE2 A;  4JI5 Q;  2HHH Q;  2E2D C;  1JOO A;  1JWU D;  1XPO A;  2PCF B;  3M4O B;  2PW7 A;  2E2J H;  2HUG A;  1WFQ A;  4JI3 L;  3TDQ A;  4ABN A;  1SEB D;  2RA4 A;  3NBI A;  5KIX A;  4DR1 L;  2IX0 A;  3OPO A;  1VQH A;  4NKL A;  5FK9 C;  2Q2U A;  1RKN A;  1HZA A;  2R92 B;  4JC0 A;  3SK4 A;  4KV6 A;  4JK1 C;  1XNR L;  1H9S A;  4DK1 A;  1BBX C;  1C9O A;  3CD6 A;  1S5B D;  4PMB A;  4KN4 C;  3CAM A;  4DAY A;  1U9R A;  5I6W A;  4X65 Q;  3T1H L;  4G4K A;  1UEA B;  2K7V A;  3OOC A;  3I55 A;  3HOY B;  1EL0 A;  2Z4I A;  1B7Y B;  5JEA G;  2DNC A;  2ZM6 L;  1BVS A;  1D1I A;  2N55 A;  5DAU A;  4BY1 H;  2WB1 G;  1D2B A;  4X3K A;  4A3K H;  2IHF A;  1SYF A;  3QIA A;  3E9H A;  5CYU A;  4XQJ A;  5GAG C;  1ZKO A;  2I5L X;  1C4Q A;  2FXQ A;  2NVX H;  2F03 A;  1WTP A;  2CWP A;  2WAQ G;  2X6L A;  3DHQ A;  3G6E A;  2QW7 A;  1Y1V G;  1YVC A;  2EXZ A;  3CKI B;  5C4H A;  1UE5 A;  1SFO H;  2PZW A;  5CBE E;  3WOE A;  4DR6 Q;  4BY7 G;  1UE6 A;  2DY8 A;  3SK5 A;  5IYD H;  1E7Z A;  4XXE A;  2B2T C;  5J22 A;  3SE0 A;  1TWF B;  1IHZ A;  5DM6 3;  2Q2H A;  3SEB A;  2RKS A;  4CJ1 B;  1NE3 A;  1EEF D;  1TXY A;  3VA5 A;  3MFG A;  4QF4 A;  3KJP A;  3HOX H;  4O42 A;  1VQ4 A;  2KEE A;  2K5N A;  4PQX A;  4MZ9 A;  3AQQ A;  2Z6B A;  2E76 C;  4IUV A;  1IW7 D;  3VYT A;  1YNX A;  3R2I A;  3CHB D;  3K8A A;  3NTK A;  5IP9 H;  2IJ0 A;  4DAM A;  1YIJ A;  1RHP A;  2V1C C;  3HOU B;  1DOK A;  3ULP A;  1J5E L;  4HCE A;  4NW2 A;  4K2L A;  1I4Q A;  4X3T A;  2XRQ D;  4LUV A;  5E4X A;  3MHB A;  3HKZ B;  5JOB A;  1GUO A;  2R7D A;  1X3G A;  4L5S A;  1HH2 P;  2ICI A;  3U9O A;  2UUA Q;  1V1O A;  4UAI A;  1GHJ A;  2Y0S E;  1BOS A;  2CCZ A;  4OX9 Q;  1F9Q A;  1EQQ A;  3N6R A;  5M9O A;  1KC8 C;  2AUJ D;  2CHB D;  1LYL A;  4KLK A;  1Q3L A;  1SDF A;  2ZTC A;  4B3R L;  4JOI C;  2FMM A;  2MP1 A;  2F0W A;  4OO1 H;  4R8N A;  1LTT D;  1Y8N B;  3GO5 A;  2VUM B;  3HOV H;  3L7Z C;  4EQ5 A;  4LAA A;  5C4X H;  5KYI A;  2B2W C;  4IJH A;  1KDA A;  2Z8L A;  5L37 A;  4JI6 L;  3E5S A;  4IAL A;  1OXU A;  3NWT A;  4QMG A;  4X3S A;  5C44 B;  4K0K Q;  4LK1 C;  2JA7 H;  2E2I B;  2B2U A;  3NSW A;  4IFD G;  2A68 C;  2F3V A;  2D2C C;  2KJX A;  2UXB L;  3KFU A;  2XGT A;  1NBW A;  3TSS A;  3M7G A;  3CCE A;  1QCB D;  2KOL A;  3F2C A;  3NTI A;  3FKI B;  1PTO B;  3CCU A;  1SJH D;  4A93 B;  4OEL B;  1ASY A;  1B50 A;  3JAM i;  3OW2 A;  1KHI A;  5CR3 A;  3W3A A;  1VQ7 A;  5EPJ A;  2NUC A;  3PO3 B;  2ICE C;  1BCP D;  1EYG A;  5EQ0 A;  4ZLT F;  1XWE A;  4LF6 Q;  1YIT A;  2R7Z G;  4LF7 L;  1ILQ A;  1X3Q A;  4ZAI A;  4L5Q A;  2O4X A;  2HIX A;  2OT2 A;  4DV0 Q;  4G7O C;  2F4V Q;  5CV8 A;  1X3F A;  2AWO A;  4J1M A;  3FKI G;  3CPF A;  1B4O A;  4X64 Q;  4ZCK A;  4HSP A;  4H13 C;  4PG3 A;  5M3M H;  1CK1 A;  3OW7 A;  1GOZ A;  2QGQ A;  1F2Y A;  1MBY A;  1A8V A;  1WCM H;  3FHW A;  1XMO L;  2E2I H;  1VQK A;  2LXK A;  4RCO A;  2A69 D;  2RDF A;  3NQI A;  4KHV A;  4A3D H;  1LLR D;  2B3G A;  4QB4 A;  4RHS A;  2MUY A;  4DNI A;  1BCP C;  4BBR H;  2BOS A;  3TZU A;  4C3H G;  1QOH A;  1VQG A;  4FF2 A;  1YJN A;  4C3J B;  3GTK B;  4DV1 Q;  4CJ2 C;  1N33 L;  1SSO A;  4DR5 L;  1YZ6 A;  2KCN A;  5ELN A;  4AH6 A;  2ZJR A;  1XJV A;  5C0X J;  1LO5 D;  4NXM Q;  4LF8 L;  4JI1 L;  4AYB G;  2F0V A;  1HUM A;  2K5W A;  5E4W C;  3J81 j;  3OYY A;  4YIJ A;  1STG A;  2JQO A;  2M9V A;  3VYR A;  1R9T H;  2Z6K C;  3M3Y B;  1MJE A;  1VQI A;  2ZJP A;  1EIF A;  1JWM D;  3DXJ C;  3N52 A;  4OO1 I;  2NYZ D;  3K57 A;  2L15 A;  2UUB Q;  3BJU A;  4JI8 Q;  5T1G A;  5IGF A;  4NXN Q;  2FHT A;  4L5T A;  1Y8P B;  3VDY A;  1QNK A;  2RSO A;  1SRO A;  4HJ8 A;  4UP7 A;  3HOW B;  4KY6 A;  4DUY L;  2MJ8 A;  1SE8 A;  3DEP A;  5I6Y A;  3ULJ A;  4ZRZ A;  2JXM B;  5BR8 Q;  2F0M A;  3NUC A;  3I91 A;  4RKL A;  3RLO A;  2EJG C;  1PDQ A;  2ENB A;  1YBY A;  5IGE A;  3VR2 A;  1HNZ L;  1N32 L;  3PUV A;  4XT1 B;  4X62 Q;  3G7L A;  4O0A A;  3CRK C;  1KAB A;  1SYG A;  3TP7 A;  4CBV A;  2K75 A;  1VQB A;  1A2U A;  2K50 A;  1HTP A;  1OTC A;  4ZKB B;  3U4Z A;  2WB1 E;  1I94 L;  4ME3 A;  4CDC C;  5IGC A;  5JAV A;  4XYO A;  1TWC B;  5JJI A;  2K5Q A;  3AFQ A;  3A54 A;  5M5X B;  1S5D D;  5IP7 G;  2K5D A;  4A3E H;  2VZA A;  2NB0 A;  2F3W A;  4PV1 C;  4DK3 C;  1RTO A;  3PIP A;  1S40 A;  2EYO A;  5DM7 3;  3RZD H;  4LFC L;  2JJQ A;  3STB D;  5A35 A;  1AZP A;  4Y7N H;  1EY9 A;  5CMD A;  1GUN A;  4IPD A;  4PMC A;  3GD7 A;  1JWS D;  3R8B A;  2BA0 A;  1WD1 A;  5JVG 3;  4B9X A;  2I07 B;  4OWT B;  2XRS D;  2EVB A;  3PV0 A;  4XT3 B;  4OXP A;  3PGZ A;  3I4N H;  3K7A B;  3A8I E;  5CV9 A;  1N34 Q;  4RMF A;  2JA8 H;  1I4X A;  1STA A;  1IXR A;  2HQE A;  2AMC B;  1N9W A;  3S1M B;  1KTK A;  1B70 B;  4A3I G;  2N8N A;  2EYP A;  5M3F B;  1W6K A;  5FJ8 H;  1N36 Q;  1ML0 D;  3BZD B;  1W2B A;  2A8V A;  2NZH A;  1HR0 Q;  3G4S A;  2AQ3 B;  1NAP A;  2NZO A;  5D14 A;  3I7F A;  2EYF A;  4CKE A;  4DXF A;  4B3T Q;  3FPU B;  1MI2 A;  4X66 Q;  3TS2 A;  4DAP A;  1EWC A;  3S16 B;  2NWG A;  3KJO A;  1LAB A;  4EQP A;  4A3M B;  3PMF A;  5IT9 c;  1U4L A;  1TU2 B;  3IAY A;  4MIU A;  2Y0S B;  4BBS B;  2GA4 B;  3A55 A;  1QIL A;  1R4P B;  5CV5 A;  1SXT A;  4HID A;  4QQB X;  3NE5 B;  4C56 C;  4EVO A;  1ASZ A;  1HZC A;  2OTJ A;  5CGK A;  2LKV A;  4DV6 L;  4G7Z C;  4DV5 L;  2LMC B;  3H09 A;  4IO9 A;  1EYD A;  1T5E A;  4CKC A;  3URY A;  1F2M A;  3HZX A;  2VL6 A;  3GV6 A;  3A5U A;  2QCP X;  1I3Q H;  1PLF A;  2SNS A;  2OXP A;  5IYC H;  4DA2 A;  4Q5V A;  1HRJ A;  2HCC A;  1K83 B;  1HNX L;  1EYC A;  4M1U B;  4IOA A;  2YTY A;  4R8I A;  3RLN A;  1E1T A;  2HDL A;  3KF8 A;  2PO4 A;  3S24 A;  4DR4 Q;  3E3X A;  3PUZ A;  2KVM A;  4A3C H;  2NBF A;  4PZ6 A;  3S15 B;  4N9T A;  2B29 A;  4QL5 A;  1X65 A;  1I4H A;  2EY1 A;  1A2T A;  4DV4 Q;  4RWS C;  3I70 A;  1CM9 A;  2CFM A;  3S16 H;  2F1M A;  1HJP A;  3GTJ H;  4QIW E;  1ICW A;  3K7U C;  1F77 A;  1STN A;  3M4P A;  1FGU A;  4MNO A;  1CHP D;  2JA5 G;  2RDH A;  5AJ3 L;  1QG7 A;  5CC4 A;  3SK6 A;  3CRL C;  4JI0 L;  4OIK A;  3EBE A;  2E74 C;  3SXH A;  1HTL D;  3V05 A;  5IGD A;  3EVQ A;  5IYB H;  5M5W B;  3AEV A;  1ET9 A;  4LF4 Q;  1MKH A;  4APV A;  5KEE A;  4YWK A;  3QJY A;  4A3J H;  3C3L A;  5K36 G;  1EU3 A;  5IGB A;  3PO2 G;  1HPC A;  1BO0 A;  2B2Y A;  5C3E G;  3A8K E;  2OTL A;  1FJG L;  3L9A X;  4DGZ A;  5EKI A;  1K8A C;  2BE5 D;  1PRT C;  2LFN A;  4IUQ A;  4K6D A;  3SHL A;  2AUK A;  4UP9 A;  1WTQ A;  3DWA A;  2ZXO A;  4HCS A;  3BDL A;  2F0K A;  3GTP H;  3S17 H;  3KLS X;  3GTQ H;  1L0X B;  4JW0 A;  1DJR D;  4KK7 A;  1HQM C;  3L0O A;  3H91 A;  4DR3 L;  1Y1W G;  4C2M H;  4GN4 B;  4IOC A;  5H1S E;  4DR7 L;  3IL8 A;  3TP8 A;  2F0F A;  2B2U C;  1E2W A;  4TRD A;  1X6O A;  4AYB E;  2Q8I B;  3C2P A;  4A3F B;  3RZO B;  5EPK A;  1FVI A;  2WIN B;  2K14 A;  3BZK A;  2YTV A;  1RD9 D;  3E9I A;  1X32 A;  3H0G H;  1BCP B;  4IFD J;  1VQ5 A;  1L0W A;  1EZ8 A;  2EZV A;  2I0Q A;  1PH3 A;  2OF1 A;  2KQ3 A;  2L9H A;  1KDC A;  1NSN S;  3H15 A;  1BXT A;  1SNP A;  1VCI A;  2EPB A;  1W6J A;  1WTH A;  1TWA H;  1LTI D;  1LTA D;  1JOK A;  2A6E D;  4NB3 A;  1M1K C;  4OON A;  3LX0 A;  5LMN Q;  3KLS A;  2QKI C;  5GAH C;  3BG3 A;  1DGS A;  3H3V H;  3SK8 A;  4LF9 L;  4A3B G;  1K3R A;  2CWA A;  5KND A;  3VYS A;  2YTX A;  3P75 A;  3OHX C;  1VQN A;  3ITP A;  3KYH C;  2A73 B;  5EGT A;  2F0Q A;  4HIM A;  1I4R A;  3RMH A;  4JBJ A;  2RVL A;  3OIQ A;  3IFT A;  2F0P A;  2F0J A;  2JA6 G;  1I50 B;  1B9M A;  1F2L A;  4BWG B;  1JIC A;  1NMG A;  3F1Z A;  2NVT B;  2D62 A;  1CA5 A;  1AP0 A;  2WB1 B;  4GS3 A;  1CKN B;  2UXD Q;  4JI2 L;  1LTB D;  1XMQ L;  2NN6 H;  1SND A;  3F2D A;  4X6A H;  2ZXP A;  2UU9 L;  3TP5 A;  3K5M A;  1VQL A;  2AQ2 B;  1WTV A;  1KRS A;  2WAQ B;  2Z0S A;  3A8J E;  3K80 C;  4HAE A;  1Y1V B;  5C6A A;  2B63 H;  4KJO A;  1VQM A;  1WTR A;  4HIK A;  1B3Q A;  1BF4 A;  3FEW X;  2HT1 A;  4BY7 B;  1SE4 A;  1XTD A;  2R93 H;  4BXX H;  1EIH A;  3ND9 A;  1GO3 E;  4DV7 L;  3UE1 A;  2KEN A;  3J7Y W;  2N78 A;  3VYU A;  1BKB A;  4N8F A;  1V1P A;  2KEC A;  3I4M H;  3LWU A;  3DM3 A;  5C3X A;  1Q7Y C;  4BY1 G;  1VMC A;  2VB3 X;  3Q8D A;  1IBM Q;  4A3K G;  5IWA Q;  1P8L A;  1X56 A;  1VQP A;  1PH7 A;  2BH8 A;  2N3S A;  3NK9 A;  2WFW A;  1NR2 A;  3CCJ A;  2D0O A;  4P74 A;  1HA6 A;  4YHH L;  3CCS A;  1QE6 A;  5A2Q L;  4LF5 L;  5JEA H;  3KF6 B;  1DYQ A;  3BDC A;  2L4N A;  1E2Z A;  3QOL A;  2QDL A;  1D7Q A;  2JA9 A;  2NVT H;  3HOZ H;  2M2L A;  2Q8T A;  3UDI A;  1Q86 C;  3M4O H;  4OIJ A;  3M9B A;  5IYD G;  1ICF B;  2LXJ A;  4WFN 3;  5EAY A;  2IX3 A;  1QB5 D;  1A3T A;  4S3S A;  2ATW A;  2K52 A;  2R92 H;  1Y1V H;  5DLQ E;  3K58 A;  2F0E A;  4QY7 A;  1HUN A;  2L1B A;  5FO9 B;  3HOX G;  4BY7 H;  2DUD A;  1HNX Q;  3VR3 A;  4JI4 Q;  4HSV A;  1H9S B;  1CFM A;  4P71 A;  2K28 A;  4KKT A;  1DM0 B;  3X3N A;  4DAY B;  1YNJ D;  3HOY H;  1UNS A;  2EY2 A;  2F0D A;  1PV4 A;  1PHJ A;  1TS3 A;  3H3V I;  1V1P B;  2J7Z A;  1OXT A;  1F2Z A;  2DJF C;  1CZW A;  1O80 A;  3D4D A;  3GTG B;  1NTG A;  1XX8 A;  3ONA B;  2VNU D;  1EWH A;  1PYW D;  1Y14 B;  3CF5 A;  3ULL A;  4DKA C;  1HZ9 A;  1HFN A;  1EUJ A;  1GXD C;  5C4J B;  2UXC L;  1A6X A;  5IT9 L;  3ER0 A;  4GLA C;  1XPU A;  2JYO A;  4OHJ A;  5GAD C;  1NMF A;  1LT3 D;  1IW7 C;  1WJJ A;  4KN7 C;  1HNW Q;  3M4Y A;  4KD4 A;  1YNJ C;  1VF7 A;  4OO1 G;  4DPG A;  2NN6 I;  3U50 C;  1TWF H;  4J6H A;  4P75 A;  1XPR A;  1I6H B;  3DUZ A;  3HOV G;  1I6V C;  2Z4H A;  5C4X G;  4PZ8 A;  5CV6 A;  4ZK9 B;  4QIW B;  4EX5 A;  3GTM B;  4LW1 A;  3L3O C;  3RNU A;  2R7Z B;  5I2X A;  2BCO A;  4QJF A;  1OO9 B;  2JA7 G;  1SNO A;  4B3S L;  2CQO A;  3UDF A;  4POF A;  2Z9H A;  1OXS C;  4CDF C;  4QUF A;  4UP8 A;  5EBC A;  4ZQ3 A;  3HOU H;  4GKJ L;  2FJ2 A;  3BVM A;  1IL8 A;  4GKK Q;  2GN5 A;  1PH4 A;  3OTO L;  1FNW A;  2KHJ A;  2N49 A;  2EIF A;  3V96 A;  3MXG A;  3KBG A;  1TS5 A;  5KRU A;  1H9M A;  1GUW A;  2WP8 J;  1STB A;  5A2Q E;  1KD1 C;  1CT1 D;  1Q1E A;  2ZTD A;  2P5Z X;  1O7L A;  3D6C A;  5G3L F;  2KHS A;  2K32 A;  1N8R C;  3TEH B;  5LMU Q;  1STY A;  2OEO A;  4ME5 A;  1P16 A;  5ELC A;  1MHW C;  3WDN A;  4C3H B;  3EQL C;  2C9O A;  3G48 A;  4Z9C B;  1VQE A;  3KDF A;  4IUN A;  1KNA A;  4G7H C;  1JC7 A;  2I46 A;  2VUM H;  2F0H A;  1PRT B;  1Q46 A;  2IW3 A;  2JSO A;  4TKO B;  4HMI A;  4ILW A;  2RCF A;  1WOC A;  1JJ2 A;  1PZI D;  1UE7 A;  4AYB B;  4GLV B;  1O7Y A;  1AW7 A;  2XIW A;  2NVQ B;  2C5C A;  4R4I A;  1KL9 A;  4LFB Q;  3DWP A;  3PQI A;  1EWI A;  4JPB W;  5ELF A;  5C44 H;  3QWN A;  4C1N K;  5M3M G;  4RGT A;  2LS0 1;  3BU2 A;  4RKB A;  1UUP A;  1WCM G;  3MAQ A;  2BA1 A;  1AEX A;  1T5X D;  4ID6 A;  1CHQ D;  4Y52 H;  3S1Q B;  4KHP L;  4A3D G;  2PYK A;  4GZY C;  5DNF A;  1JR0 D;  4B3M Q;  1F9P A;  1H9K A;  3AYH B;  1RIP A;  2JE6 I;  2SNM A;  3FKI H;  1PTO H;  4BBR G;  3CCM A;  4JYA L;  4A93 H;  2D0P A;  3K5O A;  2PZU A;  3S2D B;  1XNQ Q;  1LT5 D;  1IBK L;  4XIG S;  1IBL Q;  5EKK A;  2XN9 C;  1BBW A;  1PH5 A;  3CMA A;  5IT9 E;  2X6G A;  3PO3 H;  2MPM A;  1OXV A;  2CVR A;  3NWS A;  4FXK C;  4K6L A;  2IPK D;  4NPS A;  3H6M A;  4R1J A;  2B2Y C;  1SR3 A;  1S5C D;  1PTO F;  1TY0 A;  1U4R A;  4JI3 Q;  1LTR D;  2X69 A;  3CC4 A;  2F0L A;  2QDB A;  4DR1 Q;  2A69 C;  1KDB A;  5GAE C;  3F8T A;  4UY8 C;  1L0Y B;  5M5Y B;  2XTI A;  3PIP 3;  1EY0 A;  2MHV A;  1O7I A;  1VQF A;  1Z9F A;  1XNR Q;  1K0S A;  1M90 C;  1YHB A;  2IT1 A;  2EJM A;  1LTG D;  1V43 A;  1EFW A;  4LNQ A;  1V1Q A;  2F0N A;  4JI7 L;  3T1H Q;  3ERO A;  1BNZ A;  2F0T A;  1YNN D;  1Q8K A;  3A0J A;  2WAC A;  2B39 A;  2ZM6 Q;  1TS4 A;  4F87 A;  4DV2 L;  2IHE A;  1EIY B;  4DFA A;  4DV3 L;  3BZC A;  4DUZ L;  4N9P A;  2VQF L;  4GN3 B;  4C3J H;  3GTK H;  1FD7 D;  2VQE L;  1O78 A;  2FFK B;  4FF3 A;  3PIO 3;  4KJN A;  4AQY L;  4DR2 L;  3L2P A;  2WKC A;  2A6H D;  1IYU A;  4RG1 A;  3T16 A;  4RCN A;  3UDG A;  2D9U A;  3NBH A;  2K03 A;  1U0L A;  2PNH A;  1E0B A;  3LGJ A;  5ISR A;  3I3C A;  3M3Y H;  2WAQ E;  1YNN C;  4IPC A;  1VQO A;  4A3E G;  4JV5 L;  1FNV A;  2EYH A;  3PUX A;  4A3I B;  1PXU A;  1X55 A;  3EFX D;  3CCQ A;  5IOC A;  1SLJ A;  1AFP A;  3H94 A;  3OIP A;  2SDF A;  1CUK A;  3D3R A;  3J81 c;  1YHQ A;  2HDM A;  3MC0 B;  1RF2 D;  2PI2 A;  4N8X 1;  1GHK A;  3T1Y L;  1B53 A;  2VXW A;  1B2T A;  3HOW H;  3PF4 A;  1X3P A;  4YY3 L;  1J6Q A;  1LTS D;  3K59 A;  2UUC L;  2I5H A;  3TME A;  2E5L L;  5FO8 B;  3QO2 A;  1J5E Q;  1QUQ A;  1F9R A;  2NVY B;  4CDD C;  4JI5 L;  2NTS A;  2HHH L;  4POG A;  3CCR A;  3I4N G;  3QG1 A;  1JB7 A;  2JA8 G;  2KCC A;  4C3I G;  1QZG A;  4JBM A;  1LT4 D;  3PUY A;  5FOB B;  1JOQ A;  1NJI C;  3X3M A;  3STB C;  4KY5 A;  5FJ8 G;  2PZT A;  2YU9 B;  3GTL B;  1PH6 A;  1PYB A;  3J7A 5;  1TWC H;  1Y69 U;  1PH2 A;  1G8Z D;  2EY6 A;  3T56 B;  4X65 L;  4FNF A;  4E6I A;  5M5X H;  1K8G A;  2BH2 A;  4B3R Q;  1TS2 A;  1SMY D;  1R4Q B;  4HN7 A;  2EYL A;  2K1B A;  5IIF A;  3T51 B;  2EJF C;  1TWG B;  3M4Q A;  4JI6 Q;  1LV9 A;  3I2Z A; 
#chains in the Genus database with same CATH homology
 1IYV A;  1ENA A;  1SE2 A;  3Q22 A;  4KI0 A;  1G91 A;  2F4I A;  1ONL A;  3OWE B;  1MSG A;  1NR4 A;  2JA5 B;  1PFN A;  1EOT A;  2F0I A;  4JBW A;  1NCV A;  3HG9 A;  4CHT B;  1AZQ A;  3M7N A;  1DD2 A;  5BN5 A;  3PUW A;  4FO2 A;  4BS9 A;  3S1R B;  1SYB A;  1SMY C;  4C1N I;  1II3 A;  4F7X A;  3R2T A;  1J8I A;  2G9D A;  4FYD A;  1I4P A;  2B2V A;  1K8O A;  3PO2 B;  1D5M C;  2K33 A;  5C3E B;  3W2D A;  4UDU C;  2KED A;  3DWQ A;  5J1Z A;  3T4A C;  4CGY B;  2IX1 A;  3OSO A;  5I4D A;  2B8G A;  1GUT A;  1Y1W B;  4ZKC B;  3S14 B;  4I7Z C;  5HUR A;  5C4Z A;  2L0C A;  2WII B;  4H44 C;  1TWH B;  3DMU A;  5C0X H;  1BUV T;  1D5X C;  2H4O A;  5J39 A;  1Z47 A;  5CV4 A;  2BDN A;  1PFB A;  4K8J A;  1IKM A;  5HGT A;  4IUR A;  1LT6 D;  2CW0 D;  5C3W A;  4EQN A;  4DN4 M;  1CA6 A;  4IUP A;  1CQV A;  2J0T D;  4MHE A;  1Y8O B;  1DOM A;  3CQZ B;  2YYZ A;  2NTT A;  4A3B B;  2ZT9 C;  4IUT A;  3TN2 A;  3S2H B;  4KTA A;  2BE5 C;  5BN4 A;  3MXN A;  3FDT A;  2JEA I;  2CW0 C;  2JA6 B;  1JQY D;  1EY6 A;  4ZUJ A;  2PPB C;  5LL6 X;  1EEI D;  5COR A;  2J4X A;  3ERQ A;  1H9R A;  4HR7 B;  2L12 A;  1SNQ A;  1A15 A;  3E0J A;  5IOD A;  1ROD A;  1Q8I A;  1DZ1 A;  1SNC A;  5TSS A;  4ZYS A;  2WV6 D;  1EYA A;  5FKA C;  1FYC A;  3VR5 A;  3RD4 A;  2H1E A;  2E75 C;  3R3O A;  2QEJ C;  4HED A;  5I9P A;  4IN3 A;  4BY1 B;  4G57 A;  4WJW A;  4K14 A;  4A3K B;  4HMJ A;  2A6E C;  5EKL A;  5JPN C;  2DNE A;  2HCI A;  2O2L D;  3M85 A;  1DON A;  5D3D A;  1KLG D;  4B08 A;  2K01 A;  4WRD A;  1OXX K;  2NVX B;  1RTN A;  3K5N A;  5D3I B;  1SFO B;  5C0X I;  5FLX E;  1G2S A;  4FXD A;  4K5W A;  3TZD A;  5ELD A;  3FPP A;  1HFG A;  3V2T A;  1BCP F;  2K05 A;  1RCV D;  1Q90 A;  5NUC A;  1WTO A;  3FVQ A;  1QWY A;  2RDG A;  2F0G A;  3HOX B;  1Q1B A;  3C46 A;  5EJW A;  5FO7 B;  1SYD A;  4DU9 A;  3QOJ A;  4KKU A;  1D6E C;  4NMZ A;  2O5J C;  4XQN A;  3J81 L;  1EIG A;  4NDX A;  3VR6 A;  3D6W A;  2M00 A;  3HS0 C;  1TY2 A;  4FP5 D;  3KK7 A;  3T13 A;  3OMC A;  4EQO A;  4ZUI A;  4HTH A;  3R93 A;  3O13 A;  5ELB A;  5JPM C;  1HQR D;  2A74 C;  2QF7 A;  1AN8 A;  3MA2 B;  4NP5 A;  4DK0 A;  4XYQ A;  3GQB A;  3I90 A;  2PNR C;  3HOV B;  3A7A B;  1KLU D;  3KLR A;  3NXW A;  5C4X B;  3G6J B;  3Q6S A;  4DXG A;  1GUG A;  4OGQ C;  3P7J A;  2D5D A;  3HRZ C;  3MXP A;  2JA7 B;  3S1N B;  2CQA A;  1BQQ T;  1S5F D;  1S4Z A;  2FMC A;  3AU7 A;  4RGN A;  2IWH A;  4DNT B;  2EE1 A;  1TR5 A;  4XTC S;  4H0L C;  1EQV A;  3NTH A;  1ENF A;  3TP6 A;  2V4D A;  2XNA C;  2B8F A;  5D65 A;  3J7A V;  5KGU A;  1SYC A;  1EZ6 A;  2A68 D;  3NQT A;  4KMU C;  5I2Y A;  1C8C A;  1SBB B;  1HA5 A;  1K8M A;  3MWY W;  2F0U A;  3CU7 A;  3BYT B;  2ID0 A;  4WOR A;  5KNC A;  4FVM A;  4ULL A;  1GUS A;  4RGM A;  2RBM A;  1U4M A;  2TMP A;  2ZXR A;  2DN8 A;  3MVV A;  1BR9 A;  3D31 A;  5M3M B;  1EQT A;  3DEO A;  3GP7 A;  5T1I A;  4IFD H;  3K5L A;  1WCM B;  2KUM A;  1STH A;  3C1E A;  5COY A;  1ZEQ X;  2Z1C A;  1SE3 A;  2A5H A;  2TSS A;  4A3D B;  2G9H D;  2IL8 A;  3J81 E;  4BBR B;  3J80 L;  3MXU A;  4L8J A;  2NZ1 D;  3BVG A;  4PMW A;  1G2T A;  1TQO A;  5IGG A;  3K6O A;  2B2V C;  4O1N A;  3HGB A;  1F9S A;  4I65 A;  1M4V A;  1R9T B;  5KYL A;  4FXG C;  1JOR A;  4F88 A;  3H3V C;  4BA2 I;  3K0Y A;  3VR4 A;  3AB9 A;  3HEJ A;  1QJO A;  1KAA A;  1Z7T A;  4OL7 A;  4L63 B;  4TSS A;  4K5V A;  5ELE A;  1WD0 A;  2L55 A;  1ET6 A;  4LJZ C;  1RJT A;  1DXM A;  3SVM A;  1J9O A;  3MEH A;  3VA7 A;  4K8I A;  1JB3 A;  1WVL A;  2KA7 A;  3OMG A;  2PMZ B;  4K5X A;  4LMQ D;  4PNY A;  5E1F A;  2RSN A;  3BS1 A;  3S9W A;  1M8A A;  1MGS A;  3SDZ A;  1EFI D;  1D1K A;  3T53 B;  5JJZ A;  3ZYY X;  4A3E B;  2DY7 A;  3HP3 A;  1EY8 A;  3RZD B;  1PRT F;  2L11 A;  2EYM A;  4F8M A;  4RFB A;  4Y7N B;  3IKJ A;  2QIL A;  3EA6 A;  4C3J G;  1CZG A;  1H9J A;  1I4G A;  4IZ8 A;  1CTM A;  1TII D;  2VB2 X;  4IFD I;  1TVX A;  4KY7 A;  4RGO S;  3J80 E;  2AWN A;  3I4N B;  2B2T A;  3E6Z X;  2JA8 B;  4C3I B;  1V8Q A;  4TQU S;  4RA8 A;  4KD3 A;  2WKD A;  1TT2 A;  1ZYR D;  1G6Z A;  2A6H C;  2XWJ B;  3P20 A;  4R9W A;  5F2D A;  3I72 A;  3F2U A;  1C48 A;  1MSH A;  5G3L D;  4U68 A;  3MFY A;  4A3G B;  1B44 D;  4M8A A;  4QUC A;  1ZXT A;  4KKS A;  2RQX A;  2EOT A;  3BVZ A;  1ESR A;  1I3Q B;  3MZ5 A;  1ZYR C;  1RDP D;  2FIN B;  5KNB A;  5BN3 A;  3C1F A;  2AQ1 B;  2PQE A;  3Q0A A;  4RH6 A;  4XQQ A;  1ENC A;  3I8Z A;  3LWE A;  4BA1 I;  4V0B A;  2B2W A;  1DCZ A;  5I9O A;  1EY5 A;  1EY7 A;  1NUC A;  2JEB I;  1CI3 M;  4FF4 A;  1STE A;  1VF5 C;  1ILP A;  1EU4 A;  1HCZ A;  4KHZ A;  2LY7 A;  3GTJ B;  3RLF A;  2EYJ A;  1PZK D;  1SJE D;  2JP1 A;  3ND8 A;  2XVS A;  1Q12 A;  1D5Z C;  2R6G A;  4FF1 A;  1JE4 A;  5JEA J;  1PZJ D;  1KNE A;  2XSC A;  3KBX A;  3D4W A;  5CV7 A;  1PMR A;  1PTO D;  3D4R A;  4A3J B;  1FR3 A;  4IQZ A;  1XXG A;  3NP8 A;  1XYI A;  5AFW A;  1G29 1;  5JVH 3;  2N88 A;  1VDZ A;  1WTX A;  4J8Q A;  1SAP A;  4RHR A;  2SOB A;  3GTP B;  1CQF A;  4ODG A;  3S17 B;  3GTQ B;  1MD2 D;  1B3A A;  2MGS A;  2F0S A;  5DEH A;  5EBD A;  1BDO A;  4C2M B;  1B1Z A;  4Q0F A;  4U67 3;  4K2K A;  5CBA E;  1PRT D;  1UAP A;  3LNN A;  1ESF A;  3OWF A;  3JAM L;  3GV3 A;  3Q24 A;  1B9N A;  5C0X G;  1PTO C;  1A3V A;  1VMP A;  5LHY 1;  5FLX L;  1EY4 A;  3H0G B;  1XTC D;  4H7B A;  4X3U A;  3I73 A;  3KUP A;  1HHV A;  1FNU A;  2XWB B;  3FRP B;  3MTS A;  1IKL A;  5C5M A;  5K36 H;  5K5P A;  4DAV A;  2Q8R E;  1TWA B;  3NHH A;  3IFD A;  3GTO B;  1HXY D;  1U4P A;  3DM1 A;  3QB3 A;  2BDO A;  2K6A A;  1JCK B;  1LAC A;  3U9S A;  4EGV A;  3NPP A;  4P2C B;  2E2H B;  4RAU C;  3A56 A;  3A7L A;  4CJ0 B;  1GJX A;  2L5T A;  3BDO A;  3UI2 A;  3J7A F;  4QCL A;  1PFM A;  3P1H A;  3AMU A;  3WOF A;  2SEB D;  1WTW A;  2E2J B;  2R3Z A;  3FMC A;  2R61 A;  2PW5 A;  1E2V A;  4XDX A;  5LL6 S;  1FGB D;  2EDG A;  3D8G A;  2B63 B;  5E3F A;  4B9W A;  1S5E D;  2F0O A;  3SR1 A;  2R93 B;  1SNM A;  4DNR B;  2EY5 A;  1DOL A;  1TKW B;  4MN3 A;  3TBI B;  1Z6H A;  3EJI A;  3I4M B;  5C5L A;  4V19 0;  1SYE A;  5EPL A;  4L6T B;  3Q23 A;  3I4L A;  2NN6 G;  4DF7 A;  3JAM E;  3BYY B;  2O5I C;  4CKB A;  1O7Z A;  4IUU A;  1QNU A;  2K04 A;  3RUZ A;  1A3U A;  3HOZ B;  2E2D C;  1JOO A;  1JWU D;  2PCF B;  3M4O B;  2PW7 A;  2HUG A;  3TDQ A;  4ABN A;  1SEB D;  2RA4 A;  3NBI A;  5KIX A;  2IX0 A;  3OPO A;  4NKL A;  5FK9 C;  1RKN A;  2R92 B;  3SK4 A;  4KV6 A;  4JK1 C;  1H9S A;  4DK1 A;  1BBX C;  1S5B D;  4PMB A;  4KN4 C;  4DAY A;  1U9R A;  5I6W A;  4G4K A;  1UEA B;  2K7V A;  3OOC A;  3HOY B;  1EL0 A;  2Z4I A;  5JEA G;  2DNC A;  1D1I A;  2N55 A;  5DAU A;  1D2B A;  4X3K A;  1SYF A;  3QIA A;  5CYU A;  4XQJ A;  1ZKO A;  1C4Q A;  2F03 A;  1WTP A;  2X6L A;  3DHQ A;  2EXZ A;  3CKI B;  5C4H A;  2PZW A;  5CBE E;  3WOE A;  2DY8 A;  3SK5 A;  4XXE A;  2B2T C;  5J22 A;  3SE0 A;  1TWF B;  1IHZ A;  5DM6 3;  3SEB A;  2RKS A;  4CJ1 B;  1EEF D;  3VA5 A;  3MFG A;  4QF4 A;  4O42 A;  2KEE A;  4PQX A;  2E76 C;  4IUV A;  1IW7 D;  3VYT A;  3R2I A;  3CHB D;  3NTK A;  2IJ0 A;  1RHP A;  3HOU B;  1DOK A;  4HCE A;  4NW2 A;  4K2L A;  1I4Q A;  4X3T A;  2XRQ D;  5E4X A;  3MHB A;  3HKZ B;  5JOB A;  1GUO A;  2ICI A;  3U9O A;  1V1O A;  4UAI A;  1GHJ A;  1BOS A;  1F9Q A;  3N6R A;  5M9O A;  2AUJ D;  2CHB D;  1Q3L A;  1SDF A;  2FMM A;  2MP1 A;  2F0W A;  4OO1 H;  4R8N A;  1LTT D;  1Y8N B;  3GO5 A;  2VUM B;  3L7Z C;  4LAA A;  5KYI A;  2B2W C;  1KDA A;  2Z8L A;  3E5S A;  4IAL A;  1OXU A;  3NWT A;  4QMG A;  4X3S A;  5C44 B;  4LK1 C;  2E2I B;  2B2U A;  3NSW A;  4IFD G;  2A68 C;  2F3V A;  2D2C C;  2KJX A;  3TSS A;  3M7G A;  1QCB D;  2KOL A;  3NTI A;  3FKI B;  1PTO B;  1SJH D;  4A93 B;  1B50 A;  5CR3 A;  3W3A A;  5EPJ A;  2NUC A;  3PO3 B;  2ICE C;  1BCP D;  5EQ0 A;  4ZLT F;  1XWE A;  1ILQ A;  1X3Q A;  4ZAI A;  2O4X A;  2OT2 A;  4G7O C;  5CV8 A;  2AWO A;  4J1M A;  1B4O A;  4HSP A;  4H13 C;  1CK1 A;  3OW7 A;  1GOZ A;  1F2Y A;  1MBY A;  4RCO A;  2A69 D;  2RDF A;  3NQI A;  4KHV A;  1LLR D;  4QB4 A;  4RHS A;  2MUY A;  1BCP C;  2BOS A;  3TZU A;  4C3H G;  1QOH A;  4FF2 A;  4C3J B;  3GTK B;  4CJ2 C;  1SSO A;  2KCN A;  5C0X J;  1LO5 D;  2F0V A;  1HUM A;  2K5W A;  5E4W C;  4YIJ A;  1STG A;  2M9V A;  3VYR A;  3M3Y B;  1JWM D;  3DXJ C;  3N52 A;  4OO1 I;  2NYZ D;  3K57 A;  5T1G A;  5IGF A;  2FHT A;  1Y8P B;  1QNK A;  2RSO A;  3HOW B;  4KY6 A;  2MJ8 A;  3DEP A;  5I6Y A;  4ZRZ A;  2JXM B;  2F0M A;  3NUC A;  3I91 A;  4RKL A;  2EJG C;  1PDQ A;  2ENB A;  5IGE A;  3VR2 A;  3PUV A;  4XT1 B;  3G7L A;  3CRK C;  1KAB A;  1SYG A;  3TP7 A;  4CBV A;  1A2U A;  1HTP A;  4ZKB B;  5IGC A;  5JAV A;  4XYO A;  1TWC B;  2K5Q A;  3A54 A;  5M5X B;  1S5D D;  2K5D A;  2NB0 A;  2F3W A;  4PV1 C;  1RTO A;  2EYO A;  5DM7 3;  5A35 A;  1AZP A;  1EY9 A;  5CMD A;  1GUN A;  4PMC A;  3GD7 A;  1JWS D;  3R8B A;  2BA0 A;  1WD1 A;  5JVG 3;  4B9X A;  2I07 B;  2XRS D;  2EVB A;  3PV0 A;  4XT3 B;  3K7A B;  3A8I E;  5CV9 A;  1I4X A;  1STA A;  2HQE A;  3S1M B;  1KTK A;  2EYP A;  5M3F B;  1W6K A;  1ML0 D;  3BZD B;  2AQ3 B;  1NAP A;  5D14 A;  2EYF A;  4CKE A;  4DXF A;  3FPU B;  1MI2 A;  4DAP A;  1EWC A;  3S16 B;  2NWG A;  1LAB A;  4EQP A;  4A3M B;  3PMF A;  1U4L A;  1TU2 B;  3IAY A;  4MIU A;  2Y0S B;  4BBS B;  2GA4 B;  1QIL A;  3A55 A;  1R4P B;  5CV5 A;  1SXT A;  3NE5 B;  4C56 C;  4EVO A;  5CGK A;  2LKV A;  4G7Z C;  2LMC B;  3H09 A;  1EYD A;  1T5E A;  4CKC A;  3URY A;  1F2M A;  3HZX A;  3GV6 A;  2QCP X;  1PLF A;  2SNS A;  2OXP A;  4DA2 A;  4Q5V A;  1HRJ A;  2HCC A;  1K83 B;  1EYC A;  4M1U B;  4R8I A;  2HDL A;  3KF8 A;  2PO4 A;  3PUZ A;  2KVM A;  2NBF A;  3S15 B;  4N9T A;  1I4H A;  2EY1 A;  1A2T A;  4RWS C;  3I70 A;  1CM9 A;  2F1M A;  1ICW A;  1F77 A;  1STN A;  1CHP D;  2RDH A;  1QG7 A;  5CC4 A;  3SK6 A;  3CRL C;  4OIK A;  2E74 C;  3SXH A;  1HTL D;  3V05 A;  5IGD A;  3EVQ A;  5M5W B;  1ET9 A;  5KEE A;  3QJY A;  3C3L A;  5K36 G;  1EU3 A;  5IGB A;  1HPC A;  1BO0 A;  2B2Y A;  3A8K E;  3L9A X;  4DGZ A;  5EKI A;  2BE5 D;  1PRT C;  2LFN A;  4IUQ A;  4K6D A;  3SHL A;  2AUK A;  1WTQ A;  3DWA A;  2ZXO A;  4HCS A;  3BDL A;  2F0K A;  3KLS X;  1L0X B;  1DJR D;  4KK7 A;  1HQM C;  3H91 A;  3IL8 A;  3TP8 A;  2F0F A;  2B2U C;  1E2W A;  4TRD A;  2Q8I B;  3C2P A;  4A3F B;  3RZO B;  5EPK A;  2WIN B;  1RD9 D;  1X32 A;  1BCP B;  4IFD J;  1EZ8 A;  2EZV A;  2OF1 A;  2L9H A;  1KDC A;  1NSN S;  1BXT A;  1SNP A;  1VCI A;  2EPB A;  1W6J A;  1LTI D;  1LTA D;  1JOK A;  2A6E D;  3LX0 A;  3KLS A;  2QKI C;  3BG3 A;  3SK8 A;  5KND A;  3VYS A;  3P75 A;  3OHX C;  3ITP A;  2A73 B;  5EGT A;  2F0Q A;  1I4R A;  3RMH A;  2RVL A;  3OIQ A;  3IFT A;  2F0P A;  2F0J A;  1I50 B;  1B9M A;  1F2L A;  4BWG B;  1JIC A;  2NVT B;  2D62 A;  1CA5 A;  1AP0 A;  2WB1 B;  1LTB D;  2NN6 H;  1SND A;  2ZXP A;  3TP5 A;  3K5M A;  2AQ2 B;  1WTV A;  2WAQ B;  3A8J E;  4HAE A;  1Y1V B;  5C6A A;  4KJO A;  1WTR A;  1BF4 A;  3FEW X;  4BY7 B;  1SE4 A;  1EIH A;  3ND9 A;  3J7Y W;  3VYU A;  1V1P A;  2KEC A;  3LWU A;  5C3X A;  1VMC A;  2VB3 X;  3NK9 A;  1NR2 A;  1HA6 A;  1QE6 A;  5A2Q L;  5JEA H;  1DYQ A;  3BDC A;  2L4N A;  1E2Z A;  3QOL A;  2M2L A;  2Q8T A;  4OIJ A;  4WFN 3;  2IX3 A;  1QB5 D;  1A3T A;  4S3S A;  3K58 A;  2F0E A;  1HUN A;  2L1B A;  5FO9 B;  3VR3 A;  4HSV A;  1H9S B;  1CFM A;  2K28 A;  4KKT A;  1DM0 B;  3X3N A;  1YNJ D;  1UNS A;  2EY2 A;  2F0D A;  1TS3 A;  1V1P B;  2J7Z A;  1F2Z A;  1OXT A;  1CZW A;  1O80 A;  3D4D A;  3GTG B;  1XX8 A;  3ONA B;  2VNU D;  1EWH A;  1PYW D;  1HFN A;  1GXD C;  5C4J B;  1A6X A;  5IT9 L;  2JYO A;  4OHJ A;  1LT3 D;  1IW7 C;  4KN7 C;  3M4Y A;  4KD4 A;  1YNJ C;  1VF7 A;  4OO1 G;  2NN6 I;  4J6H A;  1I6H B;  3DUZ A;  1I6V C;  2Z4H A;  5CV6 A;  4ZK9 B;  4QIW B;  3GTM B;  3L3O C;  2R7Z B;  5I2X A;  2BCO A;  1OO9 B;  1SNO A;  1OXS C;  4QUF A;  5EBC A;  4ZQ3 A;  2FJ2 A;  3BVM A;  1IL8 A;  1FNW A;  3V96 A;  3MXG A;  3KBG A;  1TS5 A;  5KRU A;  1H9M A;  1GUW A;  2WP8 J;  1STB A;  5A2Q E;  1CT1 D;  1Q1E A;  1O7L A;  3D6C A;  5G3L F;  2KHS A;  2K32 A;  1STY A;  2OEO A;  4ME5 A;  5ELC A;  3WDN A;  4C3H B;  3EQL C;  2C9O A;  4Z9C B;  4IUN A;  1KNA A;  4G7H C;  1JC7 A;  2I46 A;  2F0H A;  1PRT B;  2IW3 A;  2JSO A;  4TKO B;  4HMI A;  4ILW A;  1PZI D;  4AYB B;  1O7Y A;  1AW7 A;  2XIW A;  2NVQ B;  2C5C A;  3DWP A;  5ELF A;  3QWN A;  4C1N K;  4RGT A;  2LS0 1;  4RKB A;  1UUP A;  3MAQ A;  2BA1 A;  1AEX A;  1T5X D;  4ID6 A;  1CHQ D;  3S1Q B;  2PYK A;  4GZY C;  5DNF A;  1JR0 D;  1F9P A;  1H9K A;  2JE6 I;  2SNM A;  1PTO H;  3K5O A;  2PZU A;  3S2D B;  1LT5 D;  4XIG S;  5EKK A;  2XN9 C;  5IT9 E;  2X6G A;  2MPM A;  1OXV A;  2CVR A;  3NWS A;  4FXK C;  4K6L A;  2IPK D;  3H6M A;  2B2Y C;  1S5C D;  1PTO F;  1TY0 A;  1U4R A;  1LTR D;  2X69 A;  2F0L A;  2QDB A;  2A69 C;  1KDB A;  1L0Y B;  5M5Y B;  3PIP 3;  1EY0 A;  2MHV A;  2IT1 A;  2EJM A;  1LTG D;  1V43 A;  2F0N A;  3ERO A;  1BNZ A;  2F0T A;  1YNN D;  2WAC A;  2B39 A;  1TS4 A;  4F87 A;  4DFA A;  4N9P A;  1FD7 D;  1O78 A;  2FFK B;  4FF3 A;  3PIO 3;  4KJN A;  2WKC A;  2A6H D;  1IYU A;  3T16 A;  4RCN A;  2D9U A;  3NBH A;  2K03 A;  1E0B A;  5ISR A;  3I3C A;  1YNN C;  1FNV A;  2EYH A;  3PUX A;  4A3I B;  1PXU A;  3EFX D;  5IOC A;  1AFP A;  3H94 A;  3OIP A;  2SDF A;  3D3R A;  2HDM A;  3MC0 B;  1RF2 D;  1GHK A;  1B53 A;  2VXW A;  1B2T A;  1X3P A;  1LTS D;  3K59 A;  3TME A;  5FO8 B;  3QO2 A;  1F9R A;  2NVY B;  2NTS A;  3QG1 A;  2KCC A;  4C3I G;  1LT4 D;  3PUY A;  5FOB B;  1JOQ A;  3X3M A;  4KY5 A;  2PZT A;  2YU9 B;  3GTL B;  1Y69 U;  1G8Z D;  2EY6 A;  3T56 B;  4FNF A;  4E6I A;  1TS2 A;  1SMY D;  1R4Q B;  4HN7 A;  2EYL A;  2K1B A;  5IIF A;  3T51 B;  2EJF C;  1TWG B;  1LV9 A;  2KQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...