2RVLA

Solution structure of the chromodomain of hp1alpha with the n-terminal tail
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
83
Chain Sequence
b'GSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 5
molecule tags Transcription
source organism Mus musculus
publication title Extended string-like binding of the phosphorylated HP1 alpha N-terminal tail to the lysine 9-methylated histone H3 tail
pubmed doi rcsb
total genus 9
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rvlA00
2VXWA 1LV9A 1O80A 4HSVA 1CA6A 2RA4A 1BF4A 4IURA 2N88A 3DM1A 3GV3A 1F2LA 2FHTA 2FINB 5CMDA 1WTQA 1HA6A 2JYOA 1HRJA 5D14A 1NAPA 2MPMA 1C8CA 1SDFA 2IL8A 3DEOA 2B2TA 1F9QA 1U4RA 2MJ8A 3D6WA 4HCSA 4IUTA 4CJ2C 2KVMA 4ZK9B 2L4NA 2NZ1D 1EIGA 1SAPA 1WTWA 1CM9A 3DEPA 5EJWA 1S4ZA 1WTOA 4ZKBB 1X32A 5CORA 3TN2A 2DY8A 2MGSA 4RWSC 2KEEA 5AFWA 1WTVA 2HCIA 2FMMA 2Q8RE 3I8ZA 3SVMA 4X3SA 4X3KA 1VMPA 5E4XA 1WTPA 1QG7A 2B2YC 2K04A 1BBXC 5T1GA 1ZXTA 1MSHA 1U4MA 4XDXA 3TZDA 1M8AA 3Q6SA 4O42A 2L1BA 2FFKB 1PFBA 1ESRA 1RHPA 2X69A 4UAIA 4CJ1B 1JICA 2NYZD 2K01A 1B4OA 1F9SA 1X3PA 4HAEA 3G7LA 2L9HA 2JP1A 4MN3A 1MGSA 3UI2A 1B2TA 1WTRA 1G91A 3GV6A 4IUUA 4HEDA 4IUVA 4X3UA 2KOLA 2RVLA 1AZQA 4ZLTF 3H91A 4XT1B 1ILPA 5CBAE 3KUPA 2B2WA 2N55A 1NR2A 1E0BA 5EQ0A 3MWYW 3ONAB 3IL8A 2B2TC 4X3TA 4R8IA 1AP0A 1WTXA 1IKLA 2KUMA 2X6GA 1IKMA 1HHVA 1SSOA 1RTOA 2B2UA 3FDTA 4NW2A 1F9RA 1KNAA 3HP3A 1EL0A 5EPJA 2RSNA 1G6ZA 1WD1A 1BNZA 4RAUC 2BDNA 2KEDA 1CA5A 1G2TA 1J9OA 3FPUB 2B2VA 4ZAIA 1VMCA 1JE4A 4R9WA 3R93A 3QO2A 1U4LA 1NR4A 3IFDA 2HCCA 1ICWA 2HUGA 2M2LA 1TVXA 1B3AA 4U68A 5DNFA 2L11A 4MHEA 1ML0D 3I90A 3I91A 2Q8TA 4QUCA 2XIWA 1RODA 1G2SA 1B53A 2L12A 1BO0A 1RJTA 1PFMA 1HFGA 1U4PA 2FJ2A 2KECA 2B2VC 2EE1A 1PDQA 2K03A 5EPLA 1HFNA 4QUFA 5EPKA 1X3QA 2CVRA 2R3ZA 1KNEA 2DY7A 3F2UA 4OIJA 4RA8A 1MI2A 1XX8A 4CJ0B 1QE6A 3MTSA 5T1IA 4IUQA 4ZKCB 1EIHA 2X6LA 1MSGA 3I3CA 2B2YA 1IL8A 1F9PA 1QNKA 2HDMA 2J7ZA 1WVLA 4LMQD 1PLFA 1DOLA 1ILQA 3KBXA 3N52A 5CBEE 2HDLA 4XT3B 1J8IA 1Q3LA 2SDFA 1GUWA 4OIKA 2H1EA 4IUPA 1AZPA 5E4WC 3P7JA 1B50A 1A15A 2K1BA 1DZ1A 2K28A 2K05A 5D65A 5JJZA 5EKIA 1DOMA 2MP1A 2B2UC 1DONA 2NWGA 1PFNA 1EQTA 3LWEA 1EOTA 2RSOA 1O7ZA 5COYA 4DN4M 1HUMA 2EOTA 2EPBA 2B2WC 1DOKA 1WD0A 1NCVA 1O7YA 2D9UA 1RTNA 1XYIA 1HUNA
chains in the Genus database with same CATH superfamily
1SLJA 1KHIA 1FVIA 1VQLA 1MD2D 1NTGA 4NB3A 5HY6A 3GTJB 1XTCD 2O5IC 4CJ2C 2WKDA 1JWMD 1D6EC 2ZM6Q 1WTOA 5A2QE 1J6QA 1W6JA 4A3BG 3SVMA 2Y0SB 3L3OC 2WACA 3TQYA 3HKZB 4IJLA 4UDUC 1EYCA 1EUJA 4JPBW 2CFMA 1YITA 3V96A 3E9HA 4JI7Q 5GROA 4DV2L 3PIOA 4OX9L 1EWHA 3NEMA 4DR5Q 4DXGA 5JPNC 1V43A 1AE3A 1LTTD 4KD4A 3RLNA 2EQSA 5IODA 4DR4Q 2E2HH 3KUPA 3P20A 3UDGA 4RKBA 1II3A 1EU3A 3ZYYX 1OXXK 3F2BA 1AN8A 4NW2A 4JI1L 1PMRA 1EIYB 1BKBA 1V1PA 1E7ZA 1BNZA 1VQ7A 3A5UA 1SFOH 1I4GA 1LM0A 2F3WA 1XWEA 2IW3A 3ZJYC 4XYQA 5JEAJ 3AU7A 3MA2B 4C2MH 4DK1A 2HQEA 5FK9C 3A55A 1JB7A 2JA5B 2E2IH 3OTOL 1K28A 3NBIA 4AQYL 5JJKA 4FF3A 2EYHA 2A6HC 4G7ZC 3NK9A 5T1IA 4ZUIA 2R7ZH 2R92B 4DV3L 1Q86C 2F0WA 1SXTA 1ENCA 3T1HQ 4DV1L 2EDGA 2ZJQA 1I94Q 2VUMG 2GN5A 2V4DA 1RKNA 3SEBA 2JA8G 1X55A 2Y0SE 4JBWA 1VDZA 2XNAC 1F2YA 4PQXA 4LFAQ 3KLWA 2E5LQ 2Q2IA 1ESFA 4QY7A 3Q8DA 3OPOA 2HD3A 3K5OA 3I7FA 4H0LC 4V0BA 5I6WA 2VNUD 1DM0B 2QDLA 1HRJA 2A68C 3G48A 3DEOA 3TBIB 5JOBA 2NVXH 4DK3C 2B63H 1DD2A 1HQMC 2K50A 1XMOL 1HXYD 3BU2A 2C5CA 3S16B 1VQJA 4CGYB 2HHHL 4XDXA 4EX5A 1SMYD 1CSQA 4IPHA 2PW7A 4JI2L 3G7LA 3AMUA 3UI2A 5M3MG 4B3TQ 2RDFA 1S5CD 4WFN3 1YNXA 1VCIA 4DV5L 1XXGA 4A93H 2JA7H 1HCZA 5IGFA 3M7NA 4C3IH 4R4IA 3ONAB 3AFPA 4X3TA 5FJ8G 2OCEA 3GTMB 5JVG3 5ELFA 5C4JB 3VYSA 4DNRB 1GUGA 4R1JA 3D8GA 1K8MA 3S1RB 1RD9D 2JJQA 4O2DA 4DUZL 4JI3Q 4OGQC 2Z0SA 5FJ8H 3FPUB 4ZAIA 4DR2Q 1JMCA 1XNRQ 2ENBA 2IHFA 5KNBA 5IOCA 1U4LA 2CW0C 4HN7A 3PQIA 1U0LA 3ICEA 4KKSA 3ULLA 4FF4A 1GUSA 4UHVA 2Q8TA 4KLKA 4BY7B 3I4OA 1VQIA 3K0XA 3CRLC 5ELBA 2Z8LA 4CKCA 3CCJA 3J7A5 4IPCA 1Q12A 3NENA 1A3UA 5IYDG 1M4VA 1JC7A 1Q8KA 4XIGS 1I3QB 4GS3A 3CCQA 1TT2A 1BDOA 2CHBD 3PMFA 4M1UB 2ALYB 1KD1C 2G9DA 2HDLA 2JA9A 4RGOS 4X6AH 2RQXA 1A0IA 3J7AV 1B7YB 2NUCA 4Y52H 4JOIC 5COYA 1OTCA 4PMCA 4YIJA 4RHSA 2F0SA 5M5XB 3NTKA 3J80i 5JJIA 1XTDA 3BZKA 5C4HA 4LWCA 5FLXL 4IURA 2FINB 2JA6G 5C0XH 1SE3A 1N32L 4A3BB 4EVOA 2E2DC 2MJ8A 4ALPA 1PV4A 1UE5A 2AUJD 4N8X1 1KLUD 5C0XG 3D4WA 1SMYC 2PI2E 3H0GH 5C0XJ 5E4XA 2B2YC 1L1OC 3OW2A 3HOZH 3TREA 4A3EH 2JQOA 2F03A 2JEAI 2YYZA 3HOYG 3UDIA 4DUYL 2Z4HA 1PFBA 3D6CA 5JPMC 3NBHB 1F9SA 4HAEA 1CKOA 3PIPA 1QZHA 1UE7A 1WTRA 3HOUB 2PZUA 4YCWA 3HOXH 5IYBG 3ERQA 1EY9A 4LK1C 2WV6D 2ZXPA 1AZQA 1TS2A 3E0JA 3IRBA 1IKLA 1SE2A 4EQ5A 2EZVA 2PCFB 2DNEA 4K8JA 1YZ6A 3K6OA 4Y7NH 4LF5L 1QVCA 1G51A 3CF5A 3GD7A 1I6VC 4MTNA 4R9WA 5IE8A 2XWJB 5DEHA 3MXNA 1Z7TA 5M9OA 2OEOA 1A3VA 1B3AA 5CC4A 4A3IG 1QILA 4MHEA 3GTPH 2VY3A 3NPPA 4LF5Q 4JYAL 3KLSX 5BN5A 1Y1VB 1IBMQ 3DLLA 2O5JC 2IJ0A 4A3CG 2CVRA 1TWAH 4FNFA 1C7YA 4C2MB 4BBRB 3QB3A 1PTOB 5JEAG 1Y1VG 2LXJA 5IP9H 3CAMA 3KBXA 2EIFA 2WAQB 1EEFD 1S3OA 1NJIC 1F2MA 4IUPA 3P7JA 3WOFA 2ATWA 4BBRG 5HGQA 3LX0A 3PUZA 1B3QA 4DR3L 4DN4M 2PI2A 1YHBA 5M5WH 1CKNB 3TRZA 2UXCL 3DXJC 1LV9A 4KJNA 2A68D 1U5KA 1TWAB 3GTOB 1L0XB 1WCMG 3J7AF 3RN5A 1L1OB 3SGIA 4HIDA 3FRPB 3Q22A 2B3GA 2EXDA 1SDFA 2IL8A 2KBNA 2NB0A 3V05A 2IX3A 1BR9A 2RHQB 1I4QA 4G7HC 1PYBA 2K33A 2KEEA 2LXKA 4FYDA 5IIFA 2EJMA 4OWWB 3I4MH 1X3GA 2K04A 4U673 1K83B 3NHHA 4RH6A 1LT5D 3Q6SA 1LTGD 2NVXB 4JC0A 4NKLA 2K75A 1VQNA 4KV6A 1JJCB 1PZKD 5M5YH 1HNWQ 4C3HG 1G91A 3BVZA 4X3UA 2A6HD 1C48A 1TWGH 5DLQE 3VYRA 4RKLA 2P5ZX 4GN5A 4YWLA 4CDEC 4KD3A 2D2CC 1KDBA 4H13C 2F0KA 1PH3A 1XYIA 1KNAA 2H4OA 1LLRD 3K5MA 1KTKA 1G6ZA 1F2ZA 5M3FH 2K5HA 3HRZC 2B2VA 4N9PA 2Z9HA 1UNSA 4HR7B 1Z6HA 1N8RC 1PTOD 2M2LA 5LMUL 3LNNA 4K6LA 4KK7A 2K4KA 4J6HA 4XXEA 2AQ3B 4FXDA 2E5LL 1MKHA 3E5SA 1JCKB 3QWNA 1YNND 1PTOF 4DGZA 3MEFA 3K7UC 2D0OA 3BVMA 2D5DA 4RA8A 1MI2A 3HOVH 1RDPD 3ERSX 3SDZA 2VB2X 4LF9L 1R9TB 2HQLA 3OMGA 1WVLA 1TIID 3I56A 3H3VC 1K0RA 2EYOA 1JB3A 2EYJA 5M3FB 4BY7H 3N52A 1L2FA 3AB9A 1RF2D 1SR3A 1A15A 2E75C 3A0JA 4PV1C 5M5WB 1F77A 5L37A 1HNZL 4LF9Q 2R7DA 1C4QA 3S2HH 1VF7A 4DV7Q 2EY2A 1Y1WG 2NVTB 5C3WA 3A54A 1CHPD 1Y8OB 4ZRZA 2D9UA 2K5VA 4A76A 1NMFA 3PV0A 4DXFA 3K5NA 2RA4A 4PZ6A 3R3OA 1C8CA 4B3SQ 1R9TH 2B2TA 1GM5A 4R4OA 4DFAA 1FNUA 2RKSA 4WRDA 4JI0Q 1SYFA 2NBFA 5FO9B 1EY8A 4PZ8A 1D8LA 2HCIA 2N49A 4LFAL 3H09A 3W1BA 1JORA 1BBXC 4JI4L 4F87A 4DF7A 3CP0A 4KY5A 5J3BA 1EWIA 1XMQL 1ESRA 3K8AA 2NYZD 2MO1A 2UU9L 3CC2A 4C3JB 3S9WA 2Y0SG 3K5LA 2F4VQ 1GKHA 4ZYSA 2RVLA 4RGMA 1ASYA 3C2PA 2K7VA 4X64L 5CV5A 1CTMA 1ET9A 2HIXA 2E74C 4MNOA 2J4XA 5EKLA 2F4VL 4RAUC 2DJGC 2XWBB 3PF5A 3RZOB 1VQMA 3CQZB 1Z9FA 3GTOH 4B3MQ 1KLGD 2HUGA 3SK5A 3HOVB 1ZYRD 4DV0L 3BVGA 3I91A 2K32A 5AJ3L 4JG2A 1H95A 4UP8A 5H1SE 3G71A 4NXMQ 3N6RA 1PFMA 1HFGA 1HZAA 3A7LA 2MNAA 2EYMA 4LNQA 2R3ZA 3DUZA 3VYUA 1EEID 1PZID 3T51B 4Z9CB 2PZWA 3KLRA 2F0JA 1LABA 4QL5A 4GOPC 2A1AA 3I3CA 3A8IE 2ASBA 4DR1L 4OWXB 3PO2H 4E6IA 3M4OB 3WWVA 1YVCA 5CBEE 4C3IB 1UEAB 4QIWB 1GUWA 1GUTA 2DN8A 3GDEA 3KFUA 1IYUA 3RUZA 3KF8B 3D3RA 4BBSG 4JI8L 3S1MH 4RGTA 5KIXA 4C1NK 3PSIA 3ER0A 4IQZA 1JJ2A 3FHWA 1SE4A 1Q1BA 1BF4A 4JI0L 3MXNB 1TWHH 4X62L 1CA5A 4QGUA 1VQGA 3L0OA 1FJGL 2L4NA 1W2BA 2ZTEA 5EJWA 3I2ZA 5FLMG 3SK8A 3OHXC 3M3YB 4A3JH 1VS0A 4KHPL 1BBWA 2MGSA 1YJ9A 2QDBA 1X65A 4C3JG 4NXNQ 1IBLL 1AW7A 2KENA 2QGQA 3I72A 4APVA 3EBEA 5ELCA 3TZDA 3J81L 2VZAA 3LGJA 4DKAC 3K58A 1VQAA 2FFKB 3A8JE 4HIOA 3URYA 4C3JH 4B3TL 4IFDH 1UAPA 1IYVA 3NP8A 4DV3Q 3P75A 3L2PA 4L63B 2EY1A 4EQPA 1VQCA 2ID0A 1BCPB 1VQKA 2OF1A 1FGBD 2IWHA 1PRTD 2NTTA 1PZJD 4LUZA 4LFCL 2K5QA 3E0EA 3M4PA 5K5PA 1EQRA 5EPJA 3OW7A 1OXVA 2BDNA 2KEDA 1PH7A 2WKCA 1N9WA 2KCMA 4IJHA 3KYHC 1VQ9A 1A62A 1HTPA 1SYBA 2TMPA 5KGUA 2F0LA 3S15B 1D5ZC 4LAAA 4IALA 2L11A 2B29A 3FEWX 4TKOB 3G4SA 2WB1G 5IYDH 4QMGA 4WORA 1Q46A 3CCEA 1RODA 1I4RA 3E3XA 1ONLA 1WTWA 5C4XH 2RF4A 4V190 1UUPA 4QUFA 5EPKA 1DYQA 1X3QA 3F2UA 5KRUA 2D0PA 1GO3E 3VA7A 2JA5G 1A2UA 1SJED 4BY1H 1IYJB 2X6LA 4KMUC 3HOXB 5IP7G 1QNKA 2HDMA 2J7ZA 4OELB 1L0YB 1OO9B 4IOCA 2JA5H 4OIKA 4YY3L 5ISRA 2F3VA 4JI4Q 1I50H 5IGEA 2LKVA 2N78A 2NWGA 4PZ7A 4R4CA 2IY5B 4GNXC 1D1KA 2M00A 1I6HH 1CI3M 1WD0A 3GTPB 1N33Q 3KF6B 1O7YA 2B8GA 1SEBD 3GTQH 1DGSA 2Q8IB 4IFDI 5I9OA 4FXKC 3DM1A 3HKSA 3NSWA 5CMDA 3I73A 2J0TD 1HA6A 1TWHB 1NAPA 1TXYA 1P16A 4B9XA 4DAYB 3STBC 3MEHA 2BA1A 5GAHC 5E3FA 4LF7L 1SROA 3F1ZA 5CYUA 4ZKBB 2SNSA 3HOZG 4B3RL 4DA2A 1PH5A 2A69C 1S40A 1VMPA 1ZXTA 1EYDA 3EQLC 1MSHA 3CMAA 1AFPA 1Y69U 1NUCA 4R4TA 1STGA 2I5HA 4BWGB 4OO1G 1LT4D 4MN3A 3GQBA 2ZTCA 1B8AA 4HEDA 1PFSA 2XGTA 4OO1I 2KOLA 5M3MB 3CW2C 2IX1A 3I4NH 4DR5L 2QILA 3PUVA 4LF6L 5EGTA 4G57A 3IL8A 1BUVT 1IBLQ 3W2DA 4DV4L 1JOOA 1XMOQ 2V1CC 1WOCA 3PUYA 3T53B 1TWCH 4JV5Q 3H94A 5EBDA 1QJOA 3VR3A 5LMUQ 1PH4A 1JT8A 1X3FA 4L5SA 1GXDC 4A3IH 4TVAB 2RBMA 2K5DA 4PMBA 3R93A 5K36G 1E2ZA 3IFDA 2HCCA 1UWVA 1Q1EA 5BR8L 4DR7Q 5D3IB 4A3CH 5DNFA 3ND9A 2F0TA 1PH2A 1AE2A 5K36H 1B53A 2L12A 4JCVE 3TZUA 5JEAH 1Y1VH 4DAMA 4A3JB 2VUMH 3GTLH 4CBVA 1WI5A 4N8FA 1GUOA 1K8OA 1MSGA 5F2DA 4JI1Q 1EU4A 3JAMc 1YJWA 2CH4A 1S5DD 4ME3A 2EY6A 4DV1Q 4GZYC 1EY5A 4KKUA 1B50A 3EJIA 3NBHA 5JVH3 2K28A 3M9BA 3S17H 1DONA 4OL7A 1PFNA 1KC8C 1STEA 3S1QB 3CU7A 2E2JB 4I7AA 3H3VH 3VYTA 2F0IA 1G8ZD 2UXBL 1O80A 3ND8A 5LL6X 4NMZA 4LUOA 4ZCKA 2B63G 1EFWA 3A56A 1VQ5A 3PUWA 1IW7D 3HOWG 2R93G 1HQRD 1O7IA 2NZ1D 3PO3H 1VQFA 4Y7NB 2UXBQ 5IT9E 3TN2A 1PXUA 2SEBD 1R4PB 2NN6G 4I7ZC 5CR3A 2YU9B 2R93H 4A3GH 1BXTA 3BYTB 4O1NA 4XYOA 4Q0FA 5FKAC 4F8MA 1WTPA 1JOKA 3HOZB 1BOSA 1SN8A 1C9OA 5M3MH 3I4NB 1M8AA 1YNJD 4K2KA 2WINB 1EY4A 5E7NA 1HR0W 4GKJQ 1FNVA 1I5FA 3HZXA 3X3NA 4LF6Q 5M5YB 2XRQD 2DUDA 2AQ2B 4PMWA 1SYGA 3HEJA 1Q7YC 3MXUA 4XT1B 3NWTA 4HMIA 2B2TC 4GKJL 1O7LA 3J7YW 4J1MA 4QIWE 2RCNA 4B9WA 1X9NA 4P72A 3H6MA 2AWNA 4DAVA 4X62Q 1Y8PB 3CCRA 3C1FA 4KY7A 4DV0Q 3AEVA 1J9OA 5AJ3Q 3CCMA 4KHZA 2F0VA 4A3FH 4QQBX 1DXMA 4NXML 2EYPA 1SFOB 1SBBB 1QNUA 3I90A 5ELEA 4HJAA 4A3FG 1HNZQ 1ZEQX 4LFCQ 3WOEA 3S1MB 1HFNA 2I46A 2R6GA 4PNYA 5A35A 2R61A 2KCTA 1VQEA 3TDQA 4ID6A 3NXWA 5GADC 3M7GA 1HZ9A 1ILQA 1NMGA 2K14A 3JAML 2F0PA 4LF8L 2R92H 1E2VA 2R7ZB 3D4DA 3PCOB 3S17B 1IL2A 2B2UC 1QWYA 2YTXA 5C4ZA 1EQTA 1EOTA 1SYCA 1QUQB 2A6ED 1YEZA 3BJUA 1SMXA 4JBKA 2AQ1B 1PTOH 1OXUA 2FMMA 4JW0A 1B1ZA 4HSVA 4A3DB 4P74A 4JBJA 2JYOA 4J8QA 4L5RC 1WCMB 2MPMA 2CQOA 2H5XA 3A8KE 4NPSA 4DK6C 2R93B 3D6WA 3CCUA 3HKZE 3DWPA 1LTBD 2A69D 1EIGA 3TSSA 1PYSB 1FYCA 4GN3B 4A3EB 2CQAA 2ZM6L 3OYYA 4X65L 1SYEA 4P2CB 4A3GB 4A4IA 4FP5D 2Q8RE 1B9MA 3I8ZA 2L15A 5JJLA 4EQOA 2A5HA 5T1GA 1U4MA 5IYBH 1G291 3Q0AA 3S14H 2KCCA 2L55A 4JI7L 3NQTA 4CJ1B 1H9JA 3QOJA 3FKIG 4H7BA 2XSCA 3J81j 4GN4B 2XRSD 4A3EG 4ZUJA 3GV6A 4KTAA 3B6YA 3KOJA 4H02A 1QB5D 2JSOA 2XTIA 2BCOA 3HOXG 2X6GA 4P73A 5ELOA 5BN4A 4TSSA 1EYGA 1IKMA 1HHVA 3IFTA 1E2WA 3M3YH 5HGTA 3OTOQ 3K7AB 1PH8A 2OXPA 1G6PA 3CD6A 4B3RQ 1HH2P 3CHBD 1P8LA 1Y14B 2IHEA 4HIKA 2RDGA 3V2TA 2EYLA 3CMEA 2BE5D 1LTLA 3L9AX 1ML0D 1A3TA 3E6ZX 1ASZA 3S2DB 4A3MH 4OHJA 1TKWB 2GVAA 3GTQB 1KABA 3RR5A 4RCNA 3KK7A 4CKBA 3GP7A 1HPCA 2G9HD 4X66L 4ABNA 1ENFA 2ZJPA 1J5EQ 2AKWB 2CWPA 2UUCL 1LT3D 1WCMH 1CFMA 4F88A 4JI6L 4JYAQ 1RTNA 3CCSA 5KEEA 4DNTB 1TWFB 1GD7A 1HR0Q 4JVZA 5C44G 1CHQD 3I55A 3RMHA 4ME5A 3AFQA 3CRKC 3OSOA 1GJXA 4BXXH 1KAAA 3I4MG 3CCVA 3DEPA 4L5TA 2OTJA 1YHQA 1X32A 5C4JH 3BYYB 1L1OA 4GNXB 1H9SB 1T5XD 2DY8A 2IX0A 4YWKA 2NZHA 2WB1E 3CQZH 2PMZB 4X3SA 3QR8A 4C56C 3GTKH 1LUZA 3VR4A 1I4HA 1RL2A 3EA6A 1QVGA 4LF4Q 3S14B 1LTRD 5CGKA 1ET6A 2Z6BA 5NUCA 4UAIA 2RDHA 5J39A 3SHLA 5C5MA 5KNDA 1KRSA 1Y8NB 1BCPC 2PYKA 4UY8C 4FDBA 4RHRA 2VQFL 5I2YA 1Z47A 1E24A 4MTKA 3OOCA 3OWEB 2B2WA 1LYLA 2EJFC 3PIP3 4K0KQ 4R8IA 2DJFC 1EIFA 4KN4C 3W1GA 1WTXA 5I4DA 1TY0A 5CV8A 2BDOA 3UDFA 3FDTA 2WAQE 1SNCA 3AQQA 3C3LA 1W6KA 3KLSA 4A3DG 3Q23A 1WJJA 5EBCA 1BCPF 3E9IA 1JE4A 3EVQA 3NUCA 4RG1A 1IBML 4A3DH 2KHSA 2MUYA 2JE6I 3MHBA 3NWSA 1XNQL 5HURA 5M3FG 4H44C 1X54A 3NTHA 3OMCA 3K81C 3A7AB 3DWAA 3TP7A 4CJ0B 1U4PA 4AYBE 3S2HB 2JN4A 2Z1CA 2EJGC 1ENAA 4JI8Q 5I6YA 2F0FA 2ZT9C 4HSPA 4DV4Q 1EFID 1LACA 1B9NA 4A3KH 3GTMH 3FVQA 4LMQD 1WYDA 4KJOA 4LFBQ 1DJRD 5IGDA 4XT3B 1Y1WH 3S1RH 4A3KG 1DZ1A 3EN2A 1D1IA 1DCZA 2F4IA 5D65A 3T13A 3JAMi 4LUVA 1X6OA 4R8NA 5LMNL 4UP9A 1K8AC 2YU9H 5DM63 1GOZA 1VQBA 2K6AA 5BN3A 1DOKA 4A3IB 2XN9C 1CSPA 2NVQB 1HUNA 4DK0A 1I4PA 2B8FA 4F7XA 1WTQA 2ZXOA 3FKIB 2FHTA 1NSNS 4B3ML 2MO0A 1MJEA 1TS4A 1F9QA 3PF4A 1LTAD 4MIUA 4FXGC 3K59A 2I5MX 3HOWB 1Y1WB 3S16H 4QF4A 4K5WA 4OXPA 3W3AA 1LO5D 1XPOA 1HZBA 2K5NA 3J81c 3A5ZB 2CW0D 3P1HA 3KBGA 3W5OA 4DR6Q 2HIVA 3I4NG 1SNMA 1AH9A 2VQFQ 1B70B 3GTJH 2GA4B 4A3FB 1E1TA 2R7FA 1VQPA 5JAVA 1B2TA 3CXCA 1ICFB 1OXTA 4ZLTF 1MIUA 4ODGA 4G4KA 4P71A 1E0BA 3MWYW 4FF2A 1CK1A 2VL6A 4GLXA 3RZOH 3HG9A 4DNIA 3S1NH 3CPWA 1N32Q 2RSNA 4JK1C 1TWCB 2KHJA 2I07B 5CV7A 4TRDA 1V1QA 1FJGQ 1I6HB 1YHAA 1T5EA 4IPGA 2NVYH 3HOUG 2Q2UA 1SJHD 4AYBB 1YNNC 3UE0A 4U68A 5C3EB 3TP6A 1XNRL 4KHVA 3DWQA 1FNWA 1U9RA 2F0GA 5EAYA 3HOUH 2KECA 4PG3A 3PO2B 1M90C 1PDQA 5J22A 1I4XA 4AYBG 1BCPD 1XX8A 1GHJA 1QE6A 2JA8H 5IT9L 4A3LG 3KDFA 2KA7A 3GTKB 5C0XI 4BBSB 1FGUA 4XTCS 1PLFA 2MFIA 4FVMA 2OWOA 2PQAA 3SE0A 1Q3LA 4A3LH 5E4WC 2R7ZG 4KN7C 4LW1A 4RFBA 1DOMA 5KYIA 3LWEA 2RSOA 2E76C 2YTVA 1D7QA 3HOWH 2VXWA 4KHPQ 3GTGB 1EQQA 2EXZA 1TU2B 2N88A 3G6EA 1UEBA 3T56B 4K14A 1H9RA 1UE6A 4IUTA 4JBMA 1CM9A 1S4ZA 2WB1B 2KJXA 1KDCA 5CORA 3IAYA 4AH6A 5IWAQ 1HNXL 2PW5A 3STBD 4JI6Q 1E3PA 1FD7D 2F0EA 4HJ5A 2B63B 1V8QA 4A3JG 3TMEA 2OT2A 3S24A 1HR0L 2QA4A 5FLXE 3ULJA 4KI0A 1FR3A 3X3MA 5I2XA 3BS1A 2VS1A 1JICA 4DV6L 5LMNQ 3M4OH 1B4OA 1CT1D 4YY3Q 2JP1A 2RHSB 4GLAC 4DV7L 2EVBA 2LY7A 3CC4A 1HNWL 4GOPA 1Q90A 2UXDQ 1BVSA 5C6AA 3H91A 2PO4A 1C0AA 3MXGA 5EQ0A 1S5BD 1AEXA 4HJ9A 1QCBD 4DR6L 1SSOA 3CKIB 4A93G 2JA7G 3EROA 1A63A 2E2JH 2VW9A 2NTSA 3VA5A 3PGZA 5G3LD 1TR5A 2QKIC 1E1OA 4RGNA 5G3LF 2LMCB 3HS0C 3JAME 2XIWA 4CDDC 5EPLA 3J7ZC 4MZ9A 2CCZA 2DY7A 1TWGB 2JA8B 2R92G 1TWFH 1CUKA 1H9MA 2B2YA 1F9PA 1CZWA 4WJWA 5LL6S 4X64Q 3KJPA 4JI5Q 1NE3A 1X3EA 4BA1I 2L5TA 2MQHA 1N36Q 1IBKQ 3K7AH 4BY1G 1WFQA 2PMZE 2UUBL 1N34L 2JXMB 3K80C 4XQJA 2Z6KA 3F2DA 4A75A 2I0QA 2K52A 4OX9Q 2BH8A 1SRUA 1CA6A 1EY6A 1H9KA 1CQVA 5IYCG 2ICEC 4POGA 3DMUA 1TQOA 5LHY1 2QF7A 4ZK9B 1HNXQ 4NP5A 3JC66 4CHTB 1VQHA 4X65Q 1PH6A 3QJYA 5IYCH 1GHKA 3WDNA 2OQ0A 3SK6A 1SNQA 1LTID 5C4XB 3KDFB 4HMJA 4YWMA 1WTVA 1VQ6A 2OQKA 4IUNA 1IZ6A 3FKIH 2A73B 1STYA 1T9HA 1V9PA 3TS0A 2L1BA 4EGVA 2X69A 1XMQQ 4A3BH 1EY0A 3PIO3 2BOSA 4GOPB 1YI2A 1KAWA 4IPDA 1HTLD 4WJ4A 2QEJC 3HOYH 1MBYA 2E2HB 2PNHA 4DR1Q 3NE5B 4HCEA 2PPBC 4OO1H 1JWSD 3H0GB 3SR1A 2KUMA 2F0DA 1V1OA 3BG3A 5GAEC 4B3SL 1EWCA 4O0AA 4JI2Q 1G2TA 1BQQT 1A8VA 3CCLA 3FPPA 1VMCA 5GAGC 4FO2A 5IY0A 5KNCA 5FLXc 3GTGH 4G7OC 4TQUS 4A3MG 4NXNL 4DR3Q 2NN6I 3GTLB 1HA5A 2LFNA 2VUMB 3S1NB 1JJGA 3U58A 2C9OA 3D31A 3MC0B 3T16A 3U4VA 3VDYA 1S5FD 4K5VA 1VQ8A 1R4QB 2FJ2A 1RJTA 1J8IA 4JOIA 1NNXA 3RN2A 4S3SA 1KNEA 3T4AC 2VQEQ 2NVQH 3I70A 5IGCA 1JWUD 5M5XH 1JQYD 5DAUA 1IL8A 1K3RA 2Q2HA 3M4YA 1VF5C 4WJ3M 1J5EL 1WTHA 3M85A 4CDCC 1AZPA 4IZ8A 1IHZA 3MFGA 4I65A 1H9SA 5C5LA 2K05A 3TP8A 3UE1A 1XJVA 1KRTA 5CV6A 2JK8A 5FOBB 1K8GA 3EFXD 4YHHQ 4K6DA 4BBRH 1NCVA 1IW7C 2F0UA 5IWAL 5LMNW 2IPKD 3PO3G 3I4LA 1RCVD 2LS01 3QOLA 2G5DA 1F2LA 5D14A 2PZTA 2NN6H 1EZ6A 1BBUA 1CZGA 1HJPA 2CWAA 1CQFA 1SAPA 2F3IA 5C3XA 1Q8IA 3NQIA 1QUQA 2ZTDA 1SNPA 5AFWA 4JI3L 3SK4A 4DUZQ 1Q81C 3O13A 4IOAA 3NELA 4X3KA 2E2IB 2AWOA 3VR5A 2ZXRA 4C3HH 4P75A 5ELNA 1EOVA 3S15H 2F52A 1VQ4A 2BE5C 3MVVA 1O78A 4DV6Q 2A74C 3QG1A 5C3EG 4A3GG 1ZYRC 5CV4A 1D5XC 1KQSA 2UUBQ 3MAQA 3I4MB 3K0YA 2E8GA 1X3PA 2KCNA 2L9HA 2M9VA 2JA7B 5C3EH 2A8VA 5CBAE 4DV2Q 2WP8J 3F2CA 3R2IA 3BZCA 1F9RA 3VR2A 2JEBI 4C3IG 1PRTC 2ZJRA 3U4ZA 1WD1A 3RLOA 3RLFA 4C3HB 4LF7Q 4L5QA 1L0WA 4DAPA 1EZ8A 3T1YL 3J80E 3QO2A 1JE5A 5J1ZA 1PRTB 2O4XA 4GKKQ 2YV5A 1ZKOA 4HTHA 3R2TA 2MHVA 4UP7A 3HOVG 1YIJA 4EQNA 1A6XA 3EIVA 1PTOC 2B2VC 2EE1A 4L8JA 3T1YQ 4R4QA 5FO7B 4OIJA 2F1MA 1PA6A 2I5LX 3KF8A 4ZQ3A 3MTSA 2UXDL 4XQNA 3RZDB 2AMCB 1CKNA 2TSSA 5GQOA 4DU9A 5IGGA 5TSSA 1DOLA 1TS5A 3OIPA 1V1PB 4CDFC 3R8BA 2SDFA 2JA6B 2H1EA 1KIXA 2XVSA 3ITPA 2K1BA 2MP1A 1HZCA 5KYLA 1N34Q 4DUYQ 2ICIA 1FL0A 4YCUA 4RCOA 3SXHA 1O7ZA 2Z6KC 3TP5A 1HUMA 3OIQA 5D3DA 2ES2A 2B2WC 2SNMA 3QIAA 2IT1A 2KQ3A 2EYFA 4C1NI 1K83H 3GV3A 2AHOB 1MJCA 1S5ED 2EY5A 1GUNA 2BA0A 4IO9A 5CV9A 1E22A 1NBWA 3F8TA 4Q5VA 1D5MC 2KVMA 4BA2I 1VQOA 5C44B 2PNRC 1D2BA 2JA6H 2NVTH 5FO8B 4GNXA 3H3VI 5BR8Q 4DR7L 3C46A 4QJFA 1S72A 1I50B 1SE8A 2RCFA 3DM3A 3NTIA 1N36L 3H0GG 4ULLA 2K01A 4BS9A 2HT1A 4KKTA 1EQVA 3C1EA 4JV5L 1MGSA 4HJ8A 4IUUA 1I3QH 2PQAB 1SNDA 2QEXA 3BZDB 4LFBL 3G6JB 1ILPA 2N55A 2VB3X 2O2LD 1K9MC 1AP0A 1XPRA 4RMFA 4GLVB 5DM73 2F0NA 2Z4IA 3CPFA 4UPAA 3U9OA 3HOYB 4K2LA 3FP9A 2UUAL 1B44D 3S2DH 4J15A 3S1QH 2A6EC 1N33L 3K57A 3PUXA 1TVXA 1LT6D 2A19A 4HIMA 1QVFA 1YNJC 2CH4W 3OWFA 4DR2L 3BDCA 5A2QL 1SNOA 1X56A 3U50C 3CC7A 1STBA 2K03A 4M8AA 3LWUA 3RD4A 3HFZB 4DAYA 3HKZG 1K73C 3PO3B 4IUQA 2QCPX 2PQEA 5I9PA 1CKMA 1JOQA 4K8IA 3H15A 2F0HA 4BBSH 1W3SA 3KF6A 2F0MA 1I94L 3IKJA 2KHIA 4KY6A 3U9SA 4K0KL 1PRTF 3A74A 1KDAA 3MXPA 5EKIA 5JJZA 2B39A 3J80c 1PH9A 3PO2G 3KJOA 5IP9G 1KXLA 1PYWD 4IN3A 2K5WA 4CKEA 2BH2A 4A3KB 4IFDJ 2WFWA 3GO5A 1K3BC 1QOHA 2N3SA 2FMCA 4BXXG 1Q82C 4YCVA 4L6TB 1STAA 1PHJA 1PVOA 1IXRA 5FLMH 1EYAA 2C35B 2YTYA 2SOBA 2F0OA 4HCSA 1U4RA 4QB4A 3UDXA 4B08A 3D4RA 1LTSD 5E1FA 5C44H 3VR6A 2D62A 4N9TA 3Q24A 1PH1A 1KL9A 4RWSC 4A3MB 4DR4L 2NVYB 1XPUA 4K5XA 3HGBA 4DPGA 1A2TA 1QG7A 4A93B 2NZOA 2UUCQ 1EY7A 2F0QA 4O42A 4YHHL 4LJZC 1SYDA 2UUAQ 1RHPA 1M1KC 5IGBA 4XQQA 1YJNA 3MZ5A 4IUVA 3RZDH 1GVPA 1JR0D 1TY2A 4X66Q 4FF1A 2L0CA 1VQDA 3TS2A 3ULPA 4IFDG 5EKKA 4OWTB 4ILWA 3T1HL 1NR2A 3BDOA 4LF8Q 2GVBA 1STNA 2DGYA 3J81i 2VQEL 4OEMB 1RTOA 2B2UA 2N8NA 1OXSC 3HP3A 4AQYQ 1XNQQ 1EL0A 4AIMA 1YBYA 1UE1A 4OONA 4LF4L 1TS3A 4GKKL 3RNUA 2HHHQ 1NR4A 1ICWA 1NY4A 5C4XG 5IT9c 2LSSA 3FMCA 3TEHB 2CKZB 3BDLA 4QUCA 1K0SA 1G2SA 1BO0A 5IP7H 2Q2TA 4QCLA 2UXCQ 2WIIB 2QW7A 3J80L 3J81E 4DV5Q 2OTLA 3D0FA 1RIPA 2FXQA 4JI5L 4ZKCB 4HJ7A 1EIHA 1STHA 1IBKL 2WAQG 4POFA 2DNCA 3M4QA 3MFYA 3L7ZC 3DHQA 1QZGA 3AYHB 4BY7G 2EOTA 2UU9Q 2EPBA 1MHWC 4NDXA 4BY1B 2AUKA 5ELDA
chains in the Genus database with same CATH topology
1MD2D 3GTJB 1XTCD 2O5IC 4CJ2C 2WKDA 1JWMD 1D6EC 1WTOA 5A2QE 1W6JA 3SVMA 2Y0SB 3L3OC 2WACA 3HKZB 4UDUC 1EYCA 3V96A 1EWHA 4DXGA 5JPNC 1V43A 4KD4A 1LTTD 5IODA 3KUPA 3P20A 4RKBA 1II3A 1EU3A 3ZYYX 1OXXK 1AN8A 4NW2A 1PMRA 1V1PA 1BNZA 1I4GA 2F3WA 1XWEA 2IW3A 4XYQA 5JEAJ 3AU7A 3MA2B 4DK1A 2HQEA 5FK9C 3A55A 2JA5B 3NBIA 4FF3A 2EYHA 2A6HC 4G7ZC 3NK9A 5T1IA 4ZUIA 2R92B 2F0WA 1SXTA 1ENCA 2EDGA 2V4DA 1RKNA 3SEBA 4JBWA 1VDZA 2XNAC 1F2YA 4PQXA 1ESFA 3OPOA 3K5OA 4H0LC 4V0BA 5I6WA 2VNUD 1DM0B 1HRJA 2A68C 3DEOA 3TBIB 5JOBA 1DD2A 1HQMC 1HXYD 2C5CA 3S16B 4CGYB 4XDXA 1SMYD 2PW7A 3G7LA 3AMUA 3UI2A 2RDFA 1S5CD 4WFN3 1VCIA 1XXGA 3M7NA 1HCZA 5IGFA 3ONAB 4X3TA 3GTMB 5JVG3 5ELFA 5C4JB 3VYSA 4DNRB 1GUGA 3D8GA 1K8MA 3S1RB 1RD9D 4OGQC 3FPUB 4ZAIA 2ENBA 5KNBA 5IOCA 1U4LA 2CW0C 4HN7A 4KKSA 4FF4A 1GUSA 2Q8TA 4BY7B 3CRLC 5ELBA 2Z8LA 4CKCA 1Q12A 1A3UA 1M4VA 1JC7A 4XIGS 1I3QB 1TT2A 1BDOA 2CHBD 3PMFA 4M1UB 2G9DA 2HDLA 4RGOS 2RQXA 3J7AV 2NUCA 5COYA 4PMCA 4YIJA 4RHSA 2F0SA 5M5XB 3NTKA 5C4HA 5FLXL 4IURA 2FINB 5C0XH 1SE3A 4A3BB 4EVOA 2E2DC 2MJ8A 2AUJD 1KLUD 5C0XG 3D4WA 1SMYC 5C0XJ 5E4XA 2B2YC 2F03A 2JEAI 2YYZA 2Z4HA 1PFBA 3D6CA 5JPMC 1F9SA 4HAEA 3HOUB 1WTRA 2PZUA 3ERQA 1EY9A 4LK1C 2WV6D 2ZXPA 1AZQA 1TS2A 3E0JA 1IKLA 1SE2A 2EZVA 2PCFB 2DNEA 4K8JA 3K6OA 3GD7A 1I6VC 4R9WA 2XWJB 5DEHA 3MXNA 1Z7TA 5M9OA 2OEOA 1A3VA 1B3AA 5CC4A 1QILA 4MHEA 3NPPA 3KLSX 5BN5A 1Y1VB 2O5JC 2IJ0A 2CVRA 4FNFA 4C2MB 4BBRB 3QB3A 1PTOB 5JEAG 3KBXA 2WAQB 1EEFD 1F2MA 4IUPA 3P7JA 3WOFA 3LX0A 3PUZA 4DN4M 3DXJC 1LV9A 4KJNA 3GTOB 2A68D 1TWAB 1L0XB 3J7AF 3FRPB 3Q22A 1SDFA 2IL8A 2NB0A 3V05A 2IX3A 1BR9A 1I4QA 4G7HC 2K33A 2KEEA 4FYDA 5IIFA 2EJMA 2K04A 4U673 1K83B 3NHHA 4RH6A 1LT5D 3Q6SA 1LTGD 2NVXB 4NKLA 4KV6A 1PZKD 4C3HG 1G91A 3BVZA 4X3UA 2A6HD 1C48A 3VYRA 4RKLA 4KD3A 2D2CC 1KDBA 4H13C 2F0KA 1KNAA 2H4OA 1LLRD 3K5MA 1KTKA 1G6ZA 1F2ZA 3HRZC 2B2VA 4N9PA 1UNSA 4HR7B 1Z6HA 1PTOD 2M2LA 3LNNA 4K6LA 4KK7A 4J6HA 4XXEA 2AQ3B 4FXDA 3E5SA 1JCKB 3QWNA 1YNND 1PTOF 4DGZA 3BVMA 2D5DA 4RA8A 1MI2A 1RDPD 3SDZA 2VB2X 1R9TB 1WVLA 3OMGA 1TIID 3H3VC 2EYOA 1JB3A 2EYJA 5M3FB 3N52A 3AB9A 1RF2D 1A15A 2E75C 5M5WB 4PV1C 1F77A 1C4QA 1VF7A 2EY2A 2NVTB 5C3WA 1CHPD 3A54A 1Y8OB 4ZRZA 2D9UA 3PV0A 4DXFA 3K5NA 2RA4A 3R3OA 1C8CA 2B2TA 4DFAA 1FNUA 2RKSA 4WRDA 1SYFA 2NBFA 5FO9B 1EY8A 2HCIA 3H09A 1JORA 1BBXC 4F87A 4DF7A 4KY5A 1ESRA 2NYZD 4C3JB 3S9WA 3K5LA 4ZYSA 2RVLA 4RGMA 3C2PA 2K7VA 5CV5A 1CTMA 1ET9A 2E74C 2J4XA 5EKLA 4RAUC 2XWBB 3RZOB 3CQZB 1KLGD 2HUGA 3SK5A 3HOVB 1ZYRD 3BVGA 3I91A 2K32A 3N6RA 1PFMA 1HFGA 3A7LA 2EYMA 2R3ZA 3DUZA 3VYUA 1EEID 1PZID 3T51B 4Z9CB 2PZWA 3KLRA 2F0JA 1LABA 3I3CA 3A8IE 4E6IA 3M4OB 5CBEE 4C3IB 1UEAB 4QIWB 1GUWA 1GUTA 2DN8A 1IYUA 3RUZA 3D3RA 4RGTA 5KIXA 4C1NK 4IQZA 1SE4A 1Q1BA 1BF4A 1CA5A 2L4NA 5EJWA 3SK8A 3OHXC 3M3YB 2MGSA 2QDBA 4C3JG 1AW7A 3I72A 5ELCA 3TZDA 3J81L 3K58A 2FFKB 3A8JE 4IFDH 3URYA 1IYVA 1UAPA 3NP8A 3P75A 4L63B 2EY1A 4EQPA 2ID0A 1BCPB 2OF1A 1FGBD 2IWHA 1PRTD 2NTTA 1PZJD 2K5QA 5K5PA 5EPJA 3OW7A 1OXVA 2BDNA 2KEDA 2WKCA 1HTPA 1SYBA 2TMPA 5KGUA 2F0LA 3S15B 1D5ZC 4LAAA 4IALA 2L11A 3FEWX 4TKOB 4QMGA 4WORA 1RODA 1I4RA 1ONLA 1WTWA 4V190 1UUPA 4QUFA 5EPKA 1DYQA 1X3QA 3F2UA 5KRUA 3VA7A 1A2UA 1SJED 2X6LA 4KMUC 3HOXB 1QNKA 2HDMA 2J7ZA 1L0YB 1OO9B 4OIKA 5ISRA 2F3VA 5IGEA 2LKVA 2NWGA 1D1KA 2M00A 1CI3M 1WD0A 3GTPB 1O7YA 2B8GA 1SEBD 2Q8IB 4IFDI 5I9OA 4FXKC 3DM1A 5CMDA 3NSWA 1HA6A 3I73A 2J0TD 1TWHB 1NAPA 4B9XA 3MEHA 2BA1A 5E3FA 5CYUA 4ZKBB 2SNSA 4DA2A 2A69C 1VMPA 1ZXTA 1EYDA 3EQLC 1MSHA 1AFPA 1Y69U 1NUCA 1STGA 4BWGB 4OO1G 1LT4D 4MN3A 3GQBA 4HEDA 4OO1I 2KOLA 5M3MB 2IX1A 2QILA 3PUVA 5EGTA 4G57A 3IL8A 1BUVT 3W2DA 1JOOA 3PUYA 3T53B 3H94A 5EBDA 1QJOA 3VR3A 1GXDC 2RBMA 2K5DA 4PMBA 3R93A 5K36G 1E2ZA 3IFDA 2HCCA 1Q1EA 5D3IB 5DNFA 3ND9A 2F0TA 5K36H 1B53A 2L12A 3TZUA 5JEAH 4A3JB 4CBVA 1GUOA 1K8OA 1MSGA 5F2DA 1EU4A 1S5DD 2EY6A 4GZYC 1EY5A 4KKUA 1B50A 3EJIA 3NBHA 5JVH3 2K28A 1DONA 4OL7A 1PFNA 1STEA 3S1QB 3CU7A 2E2JB 3VYTA 2F0IA 1G8ZD 1O80A 3ND8A 5LL6X 4NMZA 3A56A 3PUWA 1IW7D 1HQRD 2NZ1D 4Y7NB 5IT9E 3TN2A 1PXUA 2SEBD 1R4PB 2NN6G 4I7ZC 5CR3A 2YU9B 1BXTA 3BYTB 4O1NA 1WTPA 4Q0FA 4XYOA 4F8MA 5FKAC 1JOKA 1BOSA 3I4NB 1M8AA 1YNJD 4K2KA 2WINB 1EY4A 1FNVA 3HZXA 3X3NA 5M5YB 2XRQD 2AQ2B 4PMWA 1SYGA 3HEJA 3MXUA 4XT1B 3NWTA 4HMIA 2B2TC 1O7LA 3J7YW 4J1MA 4B9WA 3H6MA 2AWNA 4DAVA 1Y8PB 3C1FA 4KY7A 1J9OA 4KHZA 2F0VA 1DXMA 2EYPA 1SFOB 1SBBB 1QNUA 3I90A 5ELEA 1ZEQX 3WOEA 3S1MB 1HFNA 2I46A 2R6GA 4PNYA 5A35A 2R61A 3TDQA 4ID6A 3NXWA 3M7GA 1ILQA 3JAML 2F0PA 2R7ZB 1E2VA 3D4DA 3S17B 2B2UC 1QWYA 5C4ZA 1EQTA 1EOTA 1SYCA 2A6ED 2AQ1B 1PTOH 1OXUA 2FMMA 1B1ZA 4HSVA 4A3DB 2JYOA 4J8QA 1WCMB 2MPMA 3A8KE 2R93B 3D6WA 3DWPA 1LTBD 2A69D 1EIGA 3TSSA 1FYCA 4A3EB 2CQAA 1SYEA 4P2CB 4A3GB 4FP5D 2Q8RE 1B9MA 3I8ZA 4EQOA 2A5HA 5T1GA 1U4MA 1G291 3Q0AA 2KCCA 2L55A 3NQTA 4CJ1B 1H9JA 3QOJA 4H7BA 2XSCA 2XRSD 4ZUJA 3GV6A 4KTAA 1QB5D 2JSOA 2BCOA 2X6GA 5BN4A 4TSSA 1IKMA 1HHVA 3IFTA 1E2WA 5HGTA 3K7AB 2OXPA 3CHBD 2RDGA 3V2TA 2EYLA 2BE5D 3L9AX 1ML0D 1A3TA 3E6ZX 3S2DB 4OHJA 1TKWB 3GTQB 1KABA 4RCNA 3KK7A 4CKBA 3GP7A 1HPCA 2G9HD 4ABNA 1ENFA 1LT3D 1CFMA 4F88A 1RTNA 5KEEA 4DNTB 1TWFB 1CHQD 3RMHA 4ME5A 3CRKC 3OSOA 1GJXA 1KAAA 3DEPA 1X32A 3BYYB 1H9SB 1T5XD 2DY8A 2IX0A 2PMZB 4X3SA 4C56C 3VR4A 1I4HA 3EA6A 3S14B 1LTRD 5CGKA 1ET6A 5NUCA 4UAIA 2RDHA 5J39A 3SHLA 5C5MA 5KNDA 1Y8NB 1BCPC 2PYKA 4RHRA 5I2YA 1Z47A 3OOCA 3OWEB 2B2WA 2EJFC 3PIP3 4R8IA 4KN4C 1WTXA 5I4DA 1TY0A 5CV8A 2BDOA 3FDTA 1SNCA 3C3LA 1W6KA 3KLSA 3Q23A 5EBCA 1BCPF 1JE4A 3EVQA 3NUCA 2KHSA 2MUYA 2JE6I 3MHBA 3NWSA 5HURA 4H44C 3NTHA 3OMCA 3A7AB 3DWAA 3TP7A 4CJ0B 1U4PA 3S2HB 2Z1CA 2EJGC 5I6YA 1ENAA 2F0FA 2ZT9C 4HSPA 1EFID 1LACA 1B9NA 3FVQA 4LMQD 4KJOA 1DJRD 5IGDA 4XT3B 1DZ1A 3HOZB 1D1IA 1DCZA 2F4IA 5D65A 3T13A 4R8NA 5DM63 1GOZA 2K6AA 5BN3A 5ELDA 1DOKA 4A3IB 2XN9C 2NVQB 1HUNA 4DK0A 1I4PA 2B8FA 4F7XA 1WTQA 3FKIB 2FHTA 2ZXOA 1NSNS 1TS4A 1F9QA 1LTAD 4MIUA 4FXGC 3K59A 3HOWB 1Y1WB 4QF4A 4K5WA 3W3AA 1LO5D 2CW0D 3P1HA 3KBGA 1SNMA 2GA4B 4A3FB 5JAVA 1B2TA 1OXTA 4ZLTF 4ODGA 4G4KA 1E0BA 3MWYW 4FF2A 1CK1A 3HG9A 2RSNA 4JK1C 1TWCB 2I07B 5CV7A 4TRDA 1I6HB 1T5EA 1SJHD 4AYBB 1YNNC 4U68A 5C3EB 3TP6A 4KHVA 3DWQA 1FNWA 1U9RA 2F0GA 2KECA 3PO2B 1PDQA 5J22A 1I4XA 1BCPD 1XX8A 1GHJA 1QE6A 5IT9L 2KA7A 3GTKB 5C0XI 4BBSB 4XTCS 1PLFA 4FVMA 3SE0A 1Q3LA 5E4WC 4KN7C 4RFBA 1DOMA 5KYIA 3LWEA 2RSOA 2E76C 2VXWA 3GTGB 2EXZA 1TU2B 2N88A 3T56B 4K14A 1H9RA 4IUTA 1CM9A 1S4ZA 2WB1B 2KJXA 1KDCA 5CORA 3IAYA 2PW5A 1FD7D 2F0EA 2B63B 1V8QA 3TMEA 2OT2A 5FLXE 4KI0A 1FR3A 3X3MA 5I2XA 3BS1A 1JICA 1B4OA 1CT1D 2JP1A 2EVBA 2LY7A 1Q90A 5C6AA 3H91A 2PO4A 3MXGA 5EQ0A 1S5BD 1AEXA 1QCBD 1SSOA 3CKIB 3EROA 2NTSA 3VA5A 5G3LD 1TR5A 2QKIC 4RGNA 3JAME 2LMCB 3HS0C 5G3LF 2XIWA 5EPLA 2DY7A 1TWGB 2JA8B 1H9MA 2B2YA 1F9PA 1CZWA 4WJWA 5LL6S 4BA1I 2L5TA 2JXMB 4XQJA 1CA6A 1EY6A 1H9KA 1CQVA 2ICEC 3DMUA 1TQOA 5LHY1 2QF7A 4ZK9B 4NP5A 4CHTB 3QJYA 1GHKA 3WDNA 3SK6A 1SNQA 1LTID 5C4XB 4HMJA 1WTVA 4IUNA 2A73B 1STYA 2L1BA 4EGVA 2X69A 1EY0A 3PIO3 2BOSA 1HTLD 2QEJC 1MBYA 2E2HB 3NE5B 4HCEA 2PPBC 4OO1H 1JWSD 3H0GB 3SR1A 2KUMA 2F0DA 1V1OA 3BG3A 1EWCA 1G2TA 1BQQT 3FPPA 1VMCA 4FO2A 5KNCA 4G7OC 4TQUS 2NN6I 3GTLB 1HA5A 2LFNA 2VUMB 3S1NB 2C9OA 3D31A 3MC0B 3T16A 1S5FD 4K5VA 1R4QB 2FJ2A 1RJTA 1J8IA 4S3SA 1KNEA 3T4AC 3I70A 5IGCA 1JWUD 1JQYD 5DAUA 1IL8A 3M4YA 1VF5C 3M85A 1AZPA 4IZ8A 1IHZA 3MFGA 4I65A 1H9SA 5C5LA 2K05A 3TP8A 5CV6A 5FOBB 3EFXD 4K6DA 1NCVA 1IW7C 2F0UA 2IPKD 3I4LA 1RCVD 2LS01 3QOLA 1F2LA 5D14A 2PZTA 2NN6H 1EZ6A 1CZGA 1CQFA 1SAPA 5C3XA 1Q8IA 3NQIA 5AFWA 1SNPA 3SK4A 3O13A 4X3KA 2E2IB 2AWOA 3VR5A 2ZXRA 2BE5C 3MVVA 1O78A 2A74C 3QG1A 1ZYRC 5CV4A 1D5XC 3MAQA 3I4MB 3K0YA 1X3PA 2KCNA 2L9HA 2M9VA 2JA7B 5CBAE 2WP8J 3R2IA 1F9RA 3VR2A 2JEBI 4C3IG 1PRTC 1WD1A 3RLFA 4C3HB 4DAPA 1EZ8A 3J80E 3QO2A 5J1ZA 1PRTB 2O4XA 1ZKOA 4HTHA 3R2TA 2MHVA 4EQNA 1A6XA 1PTOC 2B2VC 2EE1A 4L8JA 5FO7B 4OIJA 2F1MA 3KF8A 4ZQ3A 3MTSA 4XQNA 3RZDB 2TSSA 4DU9A 5IGGA 5TSSA 1DOLA 1TS5A 3OIPA 1V1PB 3R8BA 2SDFA 2JA6B 2H1EA 2XVSA 3ITPA 2K1BA 2MP1A 5KYLA 2ICIA 4RCOA 3SXHA 1O7ZA 3TP5A 1HUMA 3OIQA 5D3DA 2B2WC 2SNMA 3QIAA 2IT1A 2KQ3A 2EYFA 4C1NI 3GV3A 1S5ED 2EY5A 1GUNA 2BA0A 5CV9A 4Q5VA 1D5MC 2KVMA 4BA2I 5C44B 2PNRC 1D2BA 5FO8B 3C46A 1I50B 3NTIA 4ULLA 2K01A 4BS9A 4KKTA 1EQVA 3C1EA 1MGSA 4IUUA 1SNDA 3BZDB 3G6JB 1ILPA 2N55A 2VB3X 2O2LD 1AP0A 5DM73 2F0NA 2Z4IA 3U9OA 3HOYB 4K2LA 1B44D 2A6EC 3K57A 3PUXA 1TVXA 1LT6D 1YNJC 3OWFA 3BDCA 5A2QL 1SNOA 1STBA 2K03A 4M8AA 3LWUA 3RD4A 4DAYA 3PO3B 4IUQA 2QCPX 2PQEA 5I9PA 1JOQA 4K8IA 2F0HA 2F0MA 3IKJA 4KY6A 3U9SA 1PRTF 1KDAA 3MXPA 5EKIA 5JJZA 2B39A 1PYWD 4IN3A 2K5WA 4CKEA 4A3KB 4IFDJ 3GO5A 1QOHA 2FMCA 4L6TB 1STAA 1EYAA 2SOBA 2F0OA 4HCSA 1U4RA 4QB4A 4B08A 3D4RA 1LTSD 5E1FA 3VR6A 2D62A 4N9TA 3Q24A 4RWSC 4A3MB 2NVYB 4K5XA 3HGBA 1A2TA 1QG7A 4A93B 1EY7A 2F0QA 4O42A 4LJZC 1SYDA 1RHPA 5IGBA 4XQQA 3MZ5A 4IUVA 1JR0D 1TY2A 4FF1A 2L0CA 4IFDG 5EKKA 4ILWA 1NR2A 3BDOA 1STNA 1RTOA 2B2UA 1OXSC 3HP3A 1EL0A 1TS3A 1NR4A 1ICWA 3FMCA 3BDLA 4QUCA 1G2SA 1BO0A 4QCLA 2WIIB 3J80L 3J81E 4ZKCB 1EIHA 1STHA 2DNCA 3MFYA 3L7ZC 3DHQA 2EOTA 2EPBA 4NDXA 4BY1B 2AUKA 1XYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXW A;  1LV9 A;  1O80 A;  4HSV A;  1CA6 A;  2RA4 A;  1BF4 A;  4IUR A;  2N88 A;  3DM1 A;  3GV3 A;  1F2L A;  2FHT A;  2FIN B;  5CMD A;  1WTQ A;  1HA6 A;  2JYO A;  1HRJ A;  5D14 A;  1NAP A;  2MPM A;  1C8C A;  1SDF A;  2IL8 A;  3DEO A;  2B2T A;  1F9Q A;  1U4R A;  2MJ8 A;  3D6W A;  4HCS A;  4IUT A;  4CJ2 C;  2KVM A;  4ZK9 B;  2L4N A;  2NZ1 D;  1EIG A;  1SAP A;  1WTW A;  1CM9 A;  3DEP A;  5EJW A;  1S4Z A;  1WTO A;  4ZKB B;  1X32 A;  5COR A;  3TN2 A;  2DY8 A;  2MGS A;  4RWS C;  2KEE A;  5AFW A;  1WTV A;  2HCI A;  2FMM A;  2Q8R E;  3I8Z A;  3SVM A;  4X3S A;  4X3K A;  1VMP A;  5E4X A;  1WTP A;  1QG7 A;  2B2Y C;  2K04 A;  1BBX C;  5T1G A;  1ZXT A;  1MSH A;  1U4M A;  4XDX A;  3TZD A;  1M8A A;  3Q6S A;  4O42 A;  2L1B A;  2FFK B;  1PFB A;  1ESR A;  1RHP A;  2X69 A;  4UAI A;  4CJ1 B;  1JIC A;  2NYZ D;  2K01 A;  1B4O A;  1F9S A;  1X3P A;  4HAE A;  3G7L A;  2L9H A;  2JP1 A;  4MN3 A;  1MGS A;  3UI2 A;  1B2T A;  1WTR A;  1G91 A;  3GV6 A;  4IUU A;  4HED A;  4IUV A;  4X3U A;  2KOL A;  2RVL A;  1AZQ A;  4ZLT F;  3H91 A;  4XT1 B;  1ILP A;  5CBA E;  3KUP A;  2B2W A;  2N55 A;  1NR2 A;  1E0B A;  5EQ0 A;  3MWY W;  3ONA B;  3IL8 A;  2B2T C;  4X3T A;  4R8I A;  1AP0 A;  1WTX A;  1IKL A;  2KUM A;  2X6G A;  1IKM A;  1HHV A;  1SSO A;  1RTO A;  2B2U A;  3FDT A;  4NW2 A;  1F9R A;  1KNA A;  3HP3 A;  1EL0 A;  5EPJ A;  2RSN A;  1G6Z A;  1WD1 A;  1BNZ A;  4RAU C;  2BDN A;  2KED A;  1CA5 A;  1G2T A;  1J9O A;  3FPU B;  2B2V A;  4ZAI A;  1VMC A;  1JE4 A;  4R9W A;  3R93 A;  3QO2 A;  1U4L A;  1NR4 A;  3IFD A;  2HCC A;  1ICW A;  2HUG A;  2M2L A;  1TVX A;  1B3A A;  4U68 A;  5DNF A;  2L11 A;  4MHE A;  1ML0 D;  3I90 A;  3I91 A;  2Q8T A;  4QUC A;  2XIW A;  1ROD A;  1G2S A;  1B53 A;  2L12 A;  1BO0 A;  1RJT A;  1PFM A;  1HFG A;  1U4P A;  2FJ2 A;  2KEC A;  2B2V C;  2EE1 A;  1PDQ A;  2K03 A;  5EPL A;  1HFN A;  4QUF A;  5EPK A;  1X3Q A;  2CVR A;  2R3Z A;  1KNE A;  2DY7 A;  3F2U A;  4OIJ A;  4RA8 A;  1MI2 A;  1XX8 A;  4CJ0 B;  1QE6 A;  3MTS A;  5T1I A;  4IUQ A;  4ZKC B;  1EIH A;  2X6L A;  1MSG A;  3I3C A;  2B2Y A;  1IL8 A;  1F9P A;  1QNK A;  2HDM A;  2J7Z A;  1WVL A;  4LMQ D;  1PLF A;  1DOL A;  1ILQ A;  3KBX A;  3N52 A;  5CBE E;  2HDL A;  4XT3 B;  1J8I A;  1Q3L A;  2SDF A;  1GUW A;  4OIK A;  2H1E A;  4IUP A;  1AZP A;  5E4W C;  3P7J A;  1B50 A;  1A15 A;  2K1B A;  1DZ1 A;  2K28 A;  2K05 A;  5D65 A;  5JJZ A;  5EKI A;  1DOM A;  2MP1 A;  2B2U C;  1DON A;  2NWG A;  1PFN A;  1EQT A;  3LWE A;  1EOT A;  2RSO A;  1O7Z A;  5COY A;  4DN4 M;  1HUM A;  2EOT A;  2EPB A;  2B2W C;  1DOK A;  1WD0 A;  1NCV A;  1O7Y A;  2D9U A;  1RTN A;  1XYI A;  1HUN A; 
#chains in the Genus database with same CATH topology
 1SLJ A;  1KHI A;  1FVI A;  1VQL A;  1MD2 D;  1NTG A;  4NB3 A;  5HY6 A;  3GTJ B;  1XTC D;  2O5I C;  4CJ2 C;  2WKD A;  1JWM D;  1D6E C;  2ZM6 Q;  1WTO A;  5A2Q E;  1J6Q A;  1W6J A;  4A3B G;  3SVM A;  2Y0S B;  3L3O C;  2WAC A;  3TQY A;  3HKZ B;  4IJL A;  4UDU C;  1EYC A;  1EUJ A;  4JPB W;  2CFM A;  1YIT A;  3V96 A;  3E9H A;  4JI7 Q;  5GRO A;  4DV2 L;  3PIO A;  4OX9 L;  1EWH A;  3NEM A;  4DR5 Q;  4DXG A;  5JPN C;  1V43 A;  1AE3 A;  1LTT D;  4KD4 A;  3RLN A;  2EQS A;  5IOD A;  4DR4 Q;  2E2H H;  3KUP A;  3P20 A;  3UDG A;  4RKB A;  1II3 A;  1EU3 A;  3ZYY X;  1OXX K;  3F2B A;  1AN8 A;  4NW2 A;  4JI1 L;  1PMR A;  1EIY B;  1BKB A;  1V1P A;  1E7Z A;  1BNZ A;  1VQ7 A;  3A5U A;  1SFO H;  1I4G A;  1LM0 A;  2F3W A;  1XWE A;  2IW3 A;  3ZJY C;  4XYQ A;  5JEA J;  3AU7 A;  3MA2 B;  4C2M H;  4DK1 A;  2HQE A;  5FK9 C;  3A55 A;  1JB7 A;  2JA5 B;  2E2I H;  3OTO L;  1K28 A;  3NBI A;  4AQY L;  5JJK A;  4FF3 A;  2EYH A;  2A6H C;  4G7Z C;  3NK9 A;  5T1I A;  4ZUI A;  2R7Z H;  2R92 B;  4DV3 L;  1Q86 C;  2F0W A;  1SXT A;  1ENC A;  3T1H Q;  4DV1 L;  2EDG A;  2ZJQ A;  1I94 Q;  2VUM G;  2GN5 A;  2V4D A;  1RKN A;  3SEB A;  2JA8 G;  1X55 A;  2Y0S E;  4JBW A;  1VDZ A;  2XNA C;  1F2Y A;  4PQX A;  4LFA Q;  3KLW A;  2E5L Q;  2Q2I A;  1ESF A;  4QY7 A;  3Q8D A;  3OPO A;  2HD3 A;  3K5O A;  3I7F A;  4H0L C;  4V0B A;  5I6W A;  2VNU D;  1DM0 B;  2QDL A;  1HRJ A;  2A68 C;  3G48 A;  3DEO A;  3TBI B;  5JOB A;  2NVX H;  4DK3 C;  2B63 H;  1DD2 A;  1HQM C;  2K50 A;  1XMO L;  1HXY D;  3BU2 A;  2C5C A;  3S16 B;  1VQJ A;  4CGY B;  2HHH L;  4XDX A;  4EX5 A;  1SMY D;  1CSQ A;  4IPH A;  2PW7 A;  4JI2 L;  3G7L A;  3AMU A;  3UI2 A;  5M3M G;  4B3T Q;  2RDF A;  1S5C D;  4WFN 3;  1YNX A;  1VCI A;  4DV5 L;  1XXG A;  4A93 H;  2JA7 H;  1HCZ A;  5IGF A;  3M7N A;  4C3I H;  4R4I A;  3ONA B;  3AFP A;  4X3T A;  5FJ8 G;  2OCE A;  3GTM B;  5JVG 3;  5ELF A;  5C4J B;  3VYS A;  4DNR B;  1GUG A;  4R1J A;  3D8G A;  1K8M A;  3S1R B;  1RD9 D;  2JJQ A;  4O2D A;  4DUZ L;  4JI3 Q;  4OGQ C;  2Z0S A;  5FJ8 H;  3FPU B;  4ZAI A;  4DR2 Q;  1JMC A;  1XNR Q;  2ENB A;  2IHF A;  5KNB A;  5IOC A;  1U4L A;  2CW0 C;  4HN7 A;  3PQI A;  1U0L A;  3ICE A;  4KKS A;  3ULL A;  4FF4 A;  1GUS A;  4UHV A;  2Q8T A;  4KLK A;  4BY7 B;  3I4O A;  1VQI A;  3K0X A;  3CRL C;  5ELB A;  2Z8L A;  4CKC A;  3CCJ A;  3J7A 5;  4IPC A;  1Q12 A;  3NEN A;  1A3U A;  5IYD G;  1M4V A;  1JC7 A;  1Q8K A;  4XIG S;  1I3Q B;  4GS3 A;  3CCQ A;  1TT2 A;  1BDO A;  2CHB D;  3PMF A;  4M1U B;  2ALY B;  1KD1 C;  2G9D A;  2HDL A;  2JA9 A;  4RGO S;  4X6A H;  2RQX A;  1A0I A;  3J7A V;  1B7Y B;  2NUC A;  4Y52 H;  4JOI C;  5COY A;  1OTC A;  4PMC A;  4YIJ A;  4RHS A;  2F0S A;  5M5X B;  3NTK A;  3J80 i;  5JJI A;  1XTD A;  3BZK A;  5C4H A;  4LWC A;  5FLX L;  4IUR A;  2FIN B;  2JA6 G;  5C0X H;  1SE3 A;  1N32 L;  4A3B B;  4EVO A;  2E2D C;  2MJ8 A;  4ALP A;  1PV4 A;  1UE5 A;  2AUJ D;  4N8X 1;  1KLU D;  5C0X G;  3D4W A;  1SMY C;  2PI2 E;  3H0G H;  5C0X J;  5E4X A;  2B2Y C;  1L1O C;  3OW2 A;  3HOZ H;  3TRE A;  4A3E H;  2JQO A;  2F03 A;  2JEA I;  2YYZ A;  3HOY G;  3UDI A;  4DUY L;  2Z4H A;  1PFB A;  3D6C A;  5JPM C;  3NBH B;  1F9S A;  4HAE A;  1CKO A;  3PIP A;  1QZH A;  1UE7 A;  1WTR A;  3HOU B;  2PZU A;  4YCW A;  3HOX H;  5IYB G;  3ERQ A;  1EY9 A;  4LK1 C;  2WV6 D;  2ZXP A;  1AZQ A;  1TS2 A;  3E0J A;  3IRB A;  1IKL A;  1SE2 A;  4EQ5 A;  2EZV A;  2PCF B;  2DNE A;  4K8J A;  1YZ6 A;  3K6O A;  4Y7N H;  4LF5 L;  1QVC A;  1G51 A;  3CF5 A;  3GD7 A;  1I6V C;  4MTN A;  4R9W A;  5IE8 A;  2XWJ B;  5DEH A;  3MXN A;  1Z7T A;  5M9O A;  2OEO A;  1A3V A;  1B3A A;  5CC4 A;  4A3I G;  1QIL A;  4MHE A;  3GTP H;  2VY3 A;  3NPP A;  4LF5 Q;  4JYA L;  3KLS X;  5BN5 A;  1Y1V B;  1IBM Q;  3DLL A;  2O5J C;  2IJ0 A;  4A3C G;  2CVR A;  1TWA H;  4FNF A;  1C7Y A;  4C2M B;  4BBR B;  3QB3 A;  1PTO B;  5JEA G;  1Y1V G;  2LXJ A;  5IP9 H;  3CAM A;  3KBX A;  2EIF A;  2WAQ B;  1EEF D;  1S3O A;  1NJI C;  1F2M A;  4IUP A;  3P7J A;  3WOF A;  2ATW A;  4BBR G;  5HGQ A;  3LX0 A;  3PUZ A;  1B3Q A;  4DR3 L;  4DN4 M;  2PI2 A;  1YHB A;  5M5W H;  1CKN B;  3TRZ A;  2UXC L;  3DXJ C;  1LV9 A;  4KJN A;  2A68 D;  1U5K A;  1TWA B;  3GTO B;  1L0X B;  1WCM G;  3J7A F;  3RN5 A;  1L1O B;  3SGI A;  4HID A;  3FRP B;  3Q22 A;  2B3G A;  2EXD A;  1SDF A;  2IL8 A;  2KBN A;  2NB0 A;  3V05 A;  2IX3 A;  1BR9 A;  2RHQ B;  1I4Q A;  4G7H C;  1PYB A;  2K33 A;  2KEE A;  2LXK A;  4FYD A;  5IIF A;  2EJM A;  4OWW B;  3I4M H;  1X3G A;  2K04 A;  4U67 3;  1K83 B;  3NHH A;  4RH6 A;  1LT5 D;  3Q6S A;  1LTG D;  2NVX B;  4JC0 A;  4NKL A;  2K75 A;  1VQN A;  4KV6 A;  1JJC B;  1PZK D;  5M5Y H;  1HNW Q;  4C3H G;  1G91 A;  3BVZ A;  4X3U A;  2A6H D;  1C48 A;  1TWG H;  5DLQ E;  3VYR A;  4RKL A;  2P5Z X;  4GN5 A;  4YWL A;  4CDE C;  4KD3 A;  2D2C C;  1KDB A;  4H13 C;  2F0K A;  1PH3 A;  1XYI A;  1KNA A;  2H4O A;  1LLR D;  3K5M A;  1KTK A;  1G6Z A;  1F2Z A;  5M3F H;  2K5H A;  3HRZ C;  2B2V A;  4N9P A;  2Z9H A;  1UNS A;  4HR7 B;  1Z6H A;  1N8R C;  1PTO D;  2M2L A;  5LMU L;  3LNN A;  4K6L A;  4KK7 A;  2K4K A;  4J6H A;  4XXE A;  2AQ3 B;  4FXD A;  2E5L L;  1MKH A;  3E5S A;  1JCK B;  3QWN A;  1YNN D;  1PTO F;  4DGZ A;  3MEF A;  3K7U C;  2D0O A;  3BVM A;  2D5D A;  4RA8 A;  1MI2 A;  3HOV H;  1RDP D;  3ERS X;  3SDZ A;  2VB2 X;  4LF9 L;  1R9T B;  2HQL A;  3OMG A;  1WVL A;  1TII D;  3I56 A;  3H3V C;  1K0R A;  2EYO A;  1JB3 A;  2EYJ A;  5M3F B;  4BY7 H;  3N52 A;  1L2F A;  3AB9 A;  1RF2 D;  1SR3 A;  1A15 A;  2E75 C;  3A0J A;  4PV1 C;  5M5W B;  1F77 A;  5L37 A;  1HNZ L;  4LF9 Q;  2R7D A;  1C4Q A;  3S2H H;  1VF7 A;  4DV7 Q;  2EY2 A;  1Y1W G;  2NVT B;  5C3W A;  3A54 A;  1CHP D;  1Y8O B;  4ZRZ A;  2D9U A;  2K5V A;  4A76 A;  1NMF A;  3PV0 A;  4DXF A;  3K5N A;  2RA4 A;  4PZ6 A;  3R3O A;  1C8C A;  4B3S Q;  1R9T H;  2B2T A;  1GM5 A;  4R4O A;  4DFA A;  1FNU A;  2RKS A;  4WRD A;  4JI0 Q;  1SYF A;  2NBF A;  5FO9 B;  1EY8 A;  4PZ8 A;  1D8L A;  2HCI A;  2N49 A;  4LFA L;  3H09 A;  3W1B A;  1JOR A;  1BBX C;  4JI4 L;  4F87 A;  4DF7 A;  3CP0 A;  4KY5 A;  5J3B A;  1EWI A;  1XMQ L;  1ESR A;  3K8A A;  2NYZ D;  2MO1 A;  2UU9 L;  3CC2 A;  4C3J B;  3S9W A;  2Y0S G;  3K5L A;  2F4V Q;  1GKH A;  4ZYS A;  2RVL A;  4RGM A;  1ASY A;  3C2P A;  2K7V A;  4X64 L;  5CV5 A;  1CTM A;  1ET9 A;  2HIX A;  2E74 C;  4MNO A;  2J4X A;  5EKL A;  2F4V L;  4RAU C;  2DJG C;  2XWB B;  3PF5 A;  3RZO B;  1VQM A;  3CQZ B;  1Z9F A;  3GTO H;  4B3M Q;  1KLG D;  2HUG A;  3SK5 A;  3HOV B;  1ZYR D;  4DV0 L;  3BVG A;  3I91 A;  2K32 A;  5AJ3 L;  4JG2 A;  1H95 A;  4UP8 A;  5H1S E;  3G71 A;  4NXM Q;  3N6R A;  1PFM A;  1HFG A;  1HZA A;  3A7L A;  2MNA A;  2EYM A;  4LNQ A;  2R3Z A;  3DUZ A;  3VYU A;  1EEI D;  1PZI D;  3T51 B;  4Z9C B;  2PZW A;  3KLR A;  2F0J A;  1LAB A;  4QL5 A;  4GOP C;  2A1A A;  3I3C A;  3A8I E;  2ASB A;  4DR1 L;  4OWX B;  3PO2 H;  4E6I A;  3M4O B;  3WWV A;  1YVC A;  5CBE E;  4C3I B;  1UEA B;  4QIW B;  1GUW A;  1GUT A;  2DN8 A;  3GDE A;  3KFU A;  1IYU A;  3RUZ A;  3KF8 B;  3D3R A;  4BBS G;  4JI8 L;  3S1M H;  4RGT A;  5KIX A;  4C1N K;  3PSI A;  3ER0 A;  4IQZ A;  1JJ2 A;  3FHW A;  1SE4 A;  1Q1B A;  1BF4 A;  4JI0 L;  3MXN B;  1TWH H;  4X62 L;  1CA5 A;  4QGU A;  1VQG A;  3L0O A;  1FJG L;  2L4N A;  1W2B A;  2ZTE A;  5EJW A;  3I2Z A;  5FLM G;  3SK8 A;  3OHX C;  3M3Y B;  4A3J H;  1VS0 A;  4KHP L;  1BBW A;  2MGS A;  1YJ9 A;  2QDB A;  1X65 A;  4C3J G;  4NXN Q;  1IBL L;  1AW7 A;  2KEN A;  2QGQ A;  3I72 A;  4APV A;  3EBE A;  5ELC A;  3TZD A;  3J81 L;  2VZA A;  3LGJ A;  4DKA C;  3K58 A;  1VQA A;  2FFK B;  3A8J E;  4HIO A;  3URY A;  4C3J H;  4B3T L;  4IFD H;  1UAP A;  1IYV A;  3NP8 A;  4DV3 Q;  3P75 A;  3L2P A;  4L63 B;  2EY1 A;  4EQP A;  1VQC A;  2ID0 A;  1BCP B;  1VQK A;  2OF1 A;  1FGB D;  2IWH A;  1PRT D;  2NTT A;  1PZJ D;  4LUZ A;  4LFC L;  2K5Q A;  3E0E A;  3M4P A;  5K5P A;  1EQR A;  5EPJ A;  3OW7 A;  1OXV A;  2BDN A;  2KED A;  1PH7 A;  2WKC A;  1N9W A;  2KCM A;  4IJH A;  3KYH C;  1VQ9 A;  1A62 A;  1HTP A;  1SYB A;  2TMP A;  5KGU A;  2F0L A;  3S15 B;  1D5Z C;  4LAA A;  4IAL A;  2L11 A;  2B29 A;  3FEW X;  4TKO B;  3G4S A;  2WB1 G;  5IYD H;  4QMG A;  4WOR A;  1Q46 A;  3CCE A;  1ROD A;  1I4R A;  3E3X A;  1ONL A;  1WTW A;  5C4X H;  2RF4 A;  4V19 0;  1UUP A;  4QUF A;  5EPK A;  1DYQ A;  1X3Q A;  3F2U A;  5KRU A;  2D0P A;  1GO3 E;  3VA7 A;  2JA5 G;  1A2U A;  1SJE D;  4BY1 H;  1IYJ B;  2X6L A;  4KMU C;  3HOX B;  5IP7 G;  1QNK A;  2HDM A;  2J7Z A;  4OEL B;  1L0Y B;  1OO9 B;  4IOC A;  2JA5 H;  4OIK A;  4YY3 L;  5ISR A;  2F3V A;  4JI4 Q;  1I50 H;  5IGE A;  2LKV A;  2N78 A;  2NWG A;  4PZ7 A;  4R4C A;  2IY5 B;  4GNX C;  1D1K A;  2M00 A;  1I6H H;  1CI3 M;  1WD0 A;  3GTP B;  1N33 Q;  3KF6 B;  1O7Y A;  2B8G A;  1SEB D;  3GTQ H;  1DGS A;  2Q8I B;  4IFD I;  5I9O A;  4FXK C;  3DM1 A;  3HKS A;  3NSW A;  5CMD A;  3I73 A;  2J0T D;  1HA6 A;  1TWH B;  1NAP A;  1TXY A;  1P16 A;  4B9X A;  4DAY B;  3STB C;  3MEH A;  2BA1 A;  5GAH C;  5E3F A;  4LF7 L;  1SRO A;  3F1Z A;  5CYU A;  4ZKB B;  2SNS A;  3HOZ G;  4B3R L;  4DA2 A;  1PH5 A;  2A69 C;  1S40 A;  1VMP A;  1ZXT A;  1EYD A;  3EQL C;  1MSH A;  3CMA A;  1AFP A;  1Y69 U;  1NUC A;  4R4T A;  1STG A;  2I5H A;  4BWG B;  4OO1 G;  1LT4 D;  4MN3 A;  3GQB A;  2ZTC A;  1B8A A;  4HED A;  1PFS A;  2XGT A;  4OO1 I;  2KOL A;  5M3M B;  3CW2 C;  2IX1 A;  3I4N H;  4DR5 L;  2QIL A;  3PUV A;  4LF6 L;  5EGT A;  4G57 A;  3IL8 A;  1BUV T;  1IBL Q;  3W2D A;  4DV4 L;  1JOO A;  1XMO Q;  2V1C C;  1WOC A;  3PUY A;  3T53 B;  1TWC H;  4JV5 Q;  3H94 A;  5EBD A;  1QJO A;  3VR3 A;  5LMU Q;  1PH4 A;  1JT8 A;  1X3F A;  4L5S A;  1GXD C;  4A3I H;  4TVA B;  2RBM A;  2K5D A;  4PMB A;  3R93 A;  5K36 G;  1E2Z A;  3IFD A;  2HCC A;  1UWV A;  1Q1E A;  5BR8 L;  4DR7 Q;  5D3I B;  4A3C H;  5DNF A;  3ND9 A;  2F0T A;  1PH2 A;  1AE2 A;  5K36 H;  1B53 A;  2L12 A;  4JCV E;  3TZU A;  5JEA H;  1Y1V H;  4DAM A;  4A3J B;  2VUM H;  3GTL H;  4CBV A;  1WI5 A;  4N8F A;  1GUO A;  1K8O A;  1MSG A;  5F2D A;  4JI1 Q;  1EU4 A;  3JAM c;  1YJW A;  2CH4 A;  1S5D D;  4ME3 A;  2EY6 A;  4DV1 Q;  4GZY C;  1EY5 A;  4KKU A;  1B50 A;  3EJI A;  3NBH A;  5JVH 3;  2K28 A;  3M9B A;  3S17 H;  1DON A;  4OL7 A;  1PFN A;  1KC8 C;  1STE A;  3S1Q B;  3CU7 A;  2E2J B;  4I7A A;  3H3V H;  3VYT A;  2F0I A;  1G8Z D;  2UXB L;  1O80 A;  3ND8 A;  5LL6 X;  4NMZ A;  4LUO A;  4ZCK A;  2B63 G;  1EFW A;  3A56 A;  1VQ5 A;  3PUW A;  1IW7 D;  3HOW G;  2R93 G;  1HQR D;  1O7I A;  2NZ1 D;  3PO3 H;  1VQF A;  4Y7N B;  2UXB Q;  5IT9 E;  3TN2 A;  1PXU A;  2SEB D;  1R4P B;  2NN6 G;  4I7Z C;  5CR3 A;  2YU9 B;  2R93 H;  4A3G H;  1BXT A;  3BYT B;  4O1N A;  4XYO A;  4Q0F A;  5FKA C;  4F8M A;  1WTP A;  1JOK A;  3HOZ B;  1BOS A;  1SN8 A;  1C9O A;  5M3M H;  3I4N B;  1M8A A;  1YNJ D;  4K2K A;  2WIN B;  1EY4 A;  5E7N A;  1HR0 W;  4GKJ Q;  1FNV A;  1I5F A;  3HZX A;  3X3N A;  4LF6 Q;  5M5Y B;  2XRQ D;  2DUD A;  2AQ2 B;  4PMW A;  1SYG A;  3HEJ A;  1Q7Y C;  3MXU A;  4XT1 B;  3NWT A;  4HMI A;  2B2T C;  4GKJ L;  1O7L A;  3J7Y W;  4J1M A;  4QIW E;  2RCN A;  4B9W A;  1X9N A;  4P72 A;  3H6M A;  2AWN A;  4DAV A;  4X62 Q;  1Y8P B;  3CCR A;  3C1F A;  4KY7 A;  4DV0 Q;  3AEV A;  1J9O A;  5AJ3 Q;  3CCM A;  4KHZ A;  2F0V A;  4A3F H;  4QQB X;  1DXM A;  4NXM L;  2EYP A;  1SFO B;  1SBB B;  1QNU A;  3I90 A;  5ELE A;  4HJA A;  4A3F G;  1HNZ Q;  1ZEQ X;  4LFC Q;  3WOE A;  3S1M B;  1HFN A;  2I46 A;  2R6G A;  4PNY A;  5A35 A;  2R61 A;  2KCT A;  1VQE A;  3TDQ A;  4ID6 A;  3NXW A;  5GAD C;  3M7G A;  1HZ9 A;  1ILQ A;  1NMG A;  2K14 A;  3JAM L;  2F0P A;  4LF8 L;  2R92 H;  1E2V A;  2R7Z B;  3D4D A;  3PCO B;  3S17 B;  1IL2 A;  2B2U C;  1QWY A;  2YTX A;  5C4Z A;  1EQT A;  1EOT A;  1SYC A;  1QUQ B;  2A6E D;  1YEZ A;  3BJU A;  1SMX A;  4JBK A;  2AQ1 B;  1PTO H;  1OXU A;  2FMM A;  4JW0 A;  1B1Z A;  4HSV A;  4A3D B;  4P74 A;  4JBJ A;  2JYO A;  4J8Q A;  4L5R C;  1WCM B;  2MPM A;  2CQO A;  2H5X A;  3A8K E;  4NPS A;  4DK6 C;  2R93 B;  3D6W A;  3CCU A;  3HKZ E;  3DWP A;  1LTB D;  2A69 D;  1EIG A;  3TSS A;  1PYS B;  1FYC A;  4GN3 B;  4A3E B;  2CQA A;  2ZM6 L;  3OYY A;  4X65 L;  1SYE A;  4P2C B;  4A3G B;  4A4I A;  4FP5 D;  2Q8R E;  1B9M A;  3I8Z A;  2L15 A;  5JJL A;  4EQO A;  2A5H A;  5T1G A;  1U4M A;  5IYB H;  1G29 1;  3Q0A A;  3S14 H;  2KCC A;  2L55 A;  4JI7 L;  3NQT A;  4CJ1 B;  1H9J A;  3QOJ A;  3FKI G;  4H7B A;  2XSC A;  3J81 j;  4GN4 B;  2XRS D;  4A3E G;  4ZUJ A;  3GV6 A;  4KTA A;  3B6Y A;  3KOJ A;  4H02 A;  1QB5 D;  2JSO A;  2XTI A;  2BCO A;  3HOX G;  2X6G A;  4P73 A;  5ELO A;  5BN4 A;  4TSS A;  1EYG A;  1IKM A;  1HHV A;  3IFT A;  1E2W A;  3M3Y H;  5HGT A;  3OTO Q;  3K7A B;  1PH8 A;  2OXP A;  1G6P A;  3CD6 A;  4B3R Q;  1HH2 P;  3CHB D;  1P8L A;  1Y14 B;  2IHE A;  4HIK A;  2RDG A;  3V2T A;  2EYL A;  3CME A;  2BE5 D;  1LTL A;  3L9A X;  1ML0 D;  1A3T A;  3E6Z X;  1ASZ A;  3S2D B;  4A3M H;  4OHJ A;  1TKW B;  2GVA A;  3GTQ B;  1KAB A;  3RR5 A;  4RCN A;  3KK7 A;  4CKB A;  3GP7 A;  1HPC A;  2G9H D;  4X66 L;  4ABN A;  1ENF A;  2ZJP A;  1J5E Q;  2AKW B;  2CWP A;  2UUC L;  1LT3 D;  1WCM H;  1CFM A;  4F88 A;  4JI6 L;  4JYA Q;  1RTN A;  3CCS A;  5KEE A;  4DNT B;  1TWF B;  1GD7 A;  1HR0 Q;  4JVZ A;  5C44 G;  1CHQ D;  3I55 A;  3RMH A;  4ME5 A;  3AFQ A;  3CRK C;  3OSO A;  1GJX A;  4BXX H;  1KAA A;  3I4M G;  3CCV A;  3DEP A;  4L5T A;  2OTJ A;  1YHQ A;  1X32 A;  5C4J H;  3BYY B;  1L1O A;  4GNX B;  1H9S B;  1T5X D;  2DY8 A;  2IX0 A;  4YWK A;  2NZH A;  2WB1 E;  3CQZ H;  2PMZ B;  4X3S A;  3QR8 A;  4C56 C;  3GTK H;  1LUZ A;  3VR4 A;  1I4H A;  1RL2 A;  3EA6 A;  1QVG A;  4LF4 Q;  3S14 B;  1LTR D;  5CGK A;  1ET6 A;  2Z6B A;  5NUC A;  4UAI A;  2RDH A;  5J39 A;  3SHL A;  5C5M A;  5KND A;  1KRS A;  1Y8N B;  1BCP C;  2PYK A;  4UY8 C;  4FDB A;  4RHR A;  2VQF L;  5I2Y A;  1Z47 A;  1E24 A;  4MTK A;  3OOC A;  3OWE B;  2B2W A;  1LYL A;  2EJF C;  3PIP 3;  4K0K Q;  4R8I A;  2DJF C;  1EIF A;  4KN4 C;  3W1G A;  1WTX A;  5I4D A;  1TY0 A;  5CV8 A;  2BDO A;  3UDF A;  3FDT A;  2WAQ E;  1SNC A;  3AQQ A;  3C3L A;  1W6K A;  3KLS A;  4A3D G;  3Q23 A;  1WJJ A;  5EBC A;  1BCP F;  3E9I A;  1JE4 A;  3EVQ A;  3NUC A;  4RG1 A;  1IBM L;  4A3D H;  2KHS A;  2MUY A;  2JE6 I;  3MHB A;  3NWS A;  1XNQ L;  5HUR A;  5M3F G;  4H44 C;  1X54 A;  3NTH A;  3OMC A;  3K81 C;  3A7A B;  3DWA A;  3TP7 A;  4CJ0 B;  1U4P A;  4AYB E;  3S2H B;  2JN4 A;  2Z1C A;  2EJG C;  1ENA A;  4JI8 Q;  5I6Y A;  2F0F A;  2ZT9 C;  4HSP A;  4DV4 Q;  1EFI D;  1LAC A;  1B9N A;  4A3K H;  3GTM H;  3FVQ A;  4LMQ D;  1WYD A;  4KJO A;  4LFB Q;  1DJR D;  5IGD A;  4XT3 B;  1Y1W H;  3S1R H;  4A3K G;  1DZ1 A;  3EN2 A;  1D1I A;  1DCZ A;  2F4I A;  5D65 A;  3T13 A;  3JAM i;  4LUV A;  1X6O A;  4R8N A;  5LMN L;  4UP9 A;  1K8A C;  2YU9 H;  5DM6 3;  1GOZ A;  1VQB A;  2K6A A;  5BN3 A;  1DOK A;  4A3I B;  2XN9 C;  1CSP A;  2NVQ B;  1HUN A;  4DK0 A;  1I4P A;  2B8F A;  4F7X A;  1WTQ A;  2ZXO A;  3FKI B;  2FHT A;  1NSN S;  4B3M L;  2MO0 A;  1MJE A;  1TS4 A;  1F9Q A;  3PF4 A;  1LTA D;  4MIU A;  4FXG C;  3K59 A;  2I5M X;  3HOW B;  1Y1W B;  3S16 H;  4QF4 A;  4K5W A;  4OXP A;  3W3A A;  1LO5 D;  1XPO A;  1HZB A;  2K5N A;  3J81 c;  3A5Z B;  2CW0 D;  3P1H A;  3KBG A;  3W5O A;  4DR6 Q;  2HIV A;  3I4N G;  1SNM A;  1AH9 A;  2VQF Q;  1B70 B;  3GTJ H;  2GA4 B;  4A3F B;  1E1T A;  2R7F A;  1VQP A;  5JAV A;  1B2T A;  3CXC A;  1ICF B;  1OXT A;  4ZLT F;  1MIU A;  4ODG A;  4G4K A;  4P71 A;  1E0B A;  3MWY W;  4FF2 A;  1CK1 A;  2VL6 A;  4GLX A;  3RZO H;  3HG9 A;  4DNI A;  3S1N H;  3CPW A;  1N32 Q;  2RSN A;  4JK1 C;  1TWC B;  2KHJ A;  2I07 B;  5CV7 A;  4TRD A;  1V1Q A;  1FJG Q;  1I6H B;  1YHA A;  1T5E A;  4IPG A;  2NVY H;  3HOU G;  2Q2U A;  1SJH D;  4AYB B;  1YNN C;  3UE0 A;  4U68 A;  5C3E B;  3TP6 A;  1XNR L;  4KHV A;  3DWQ A;  1FNW A;  1U9R A;  2F0G A;  5EAY A;  3HOU H;  2KEC A;  4PG3 A;  3PO2 B;  1M90 C;  1PDQ A;  5J22 A;  1I4X A;  4AYB G;  1BCP D;  1XX8 A;  1GHJ A;  1QE6 A;  2JA8 H;  5IT9 L;  4A3L G;  3KDF A;  2KA7 A;  3GTK B;  5C0X I;  4BBS B;  1FGU A;  4XTC S;  1PLF A;  2MFI A;  4FVM A;  2OWO A;  2PQA A;  3SE0 A;  1Q3L A;  4A3L H;  5E4W C;  2R7Z G;  4KN7 C;  4LW1 A;  4RFB A;  1DOM A;  5KYI A;  3LWE A;  2RSO A;  2E76 C;  2YTV A;  1D7Q A;  3HOW H;  2VXW A;  4KHP Q;  3GTG B;  1EQQ A;  2EXZ A;  1TU2 B;  2N88 A;  3G6E A;  1UEB A;  3T56 B;  4K14 A;  1H9R A;  1UE6 A;  4IUT A;  4JBM A;  1CM9 A;  1S4Z A;  2WB1 B;  2KJX A;  1KDC A;  5COR A;  3IAY A;  4AH6 A;  5IWA Q;  1HNX L;  2PW5 A;  3STB D;  4JI6 Q;  1E3P A;  1FD7 D;  2F0E A;  4HJ5 A;  2B63 B;  1V8Q A;  4A3J G;  3TME A;  2OT2 A;  3S24 A;  1HR0 L;  2QA4 A;  5FLX E;  3ULJ A;  4KI0 A;  1FR3 A;  3X3M A;  5I2X A;  3BS1 A;  2VS1 A;  1JIC A;  4DV6 L;  5LMN Q;  3M4O H;  1B4O A;  1CT1 D;  4YY3 Q;  2JP1 A;  2RHS B;  4GLA C;  4DV7 L;  2EVB A;  2LY7 A;  3CC4 A;  1HNW L;  4GOP A;  1Q90 A;  2UXD Q;  1BVS A;  5C6A A;  3H91 A;  2PO4 A;  1C0A A;  3MXG A;  5EQ0 A;  1S5B D;  1AEX A;  4HJ9 A;  1QCB D;  4DR6 L;  1SSO A;  3CKI B;  4A93 G;  2JA7 G;  3ERO A;  1A63 A;  2E2J H;  2VW9 A;  2NTS A;  3VA5 A;  3PGZ A;  5G3L D;  1TR5 A;  2QKI C;  1E1O A;  4RGN A;  5G3L F;  2LMC B;  3HS0 C;  3JAM E;  2XIW A;  4CDD C;  5EPL A;  3J7Z C;  4MZ9 A;  2CCZ A;  2DY7 A;  1TWG B;  2JA8 B;  2R92 G;  1TWF H;  1CUK A;  1H9M A;  2B2Y A;  1F9P A;  1CZW A;  4WJW A;  5LL6 S;  4X64 Q;  3KJP A;  4JI5 Q;  1NE3 A;  1X3E A;  4BA1 I;  2L5T A;  2MQH A;  1N36 Q;  1IBK Q;  3K7A H;  4BY1 G;  1WFQ A;  2PMZ E;  2UUB L;  1N34 L;  2JXM B;  3K80 C;  4XQJ A;  2Z6K A;  3F2D A;  4A75 A;  2I0Q A;  2K52 A;  4OX9 Q;  2BH8 A;  1SRU A;  1CA6 A;  1EY6 A;  1H9K A;  1CQV A;  5IYC G;  2ICE C;  4POG A;  3DMU A;  1TQO A;  5LHY 1;  2QF7 A;  4ZK9 B;  1HNX Q;  4NP5 A;  3JC6 6;  4CHT B;  1VQH A;  4X65 Q;  1PH6 A;  3QJY A;  5IYC H;  1GHK A;  3WDN A;  2OQ0 A;  3SK6 A;  1SNQ A;  1LTI D;  5C4X B;  3KDF B;  4HMJ A;  4YWM A;  1WTV A;  1VQ6 A;  2OQK A;  4IUN A;  1IZ6 A;  3FKI H;  2A73 B;  1STY A;  1T9H A;  1V9P A;  3TS0 A;  2L1B A;  4EGV A;  2X69 A;  1XMQ Q;  4A3B H;  1EY0 A;  3PIO 3;  2BOS A;  4GOP B;  1YI2 A;  1KAW A;  4IPD A;  1HTL D;  4WJ4 A;  2QEJ C;  3HOY H;  1MBY A;  2E2H B;  2PNH A;  4DR1 Q;  3NE5 B;  4HCE A;  2PPB C;  4OO1 H;  1JWS D;  3H0G B;  3SR1 A;  2KUM A;  2F0D A;  1V1O A;  3BG3 A;  5GAE C;  4B3S L;  1EWC A;  4O0A A;  4JI2 Q;  1G2T A;  1BQQ T;  1A8V A;  3CCL A;  3FPP A;  1VMC A;  5GAG C;  4FO2 A;  5IY0 A;  5KNC A;  5FLX c;  3GTG H;  4G7O C;  4TQU S;  4A3M G;  4NXN L;  4DR3 Q;  2NN6 I;  3GTL B;  1HA5 A;  2LFN A;  2VUM B;  3S1N B;  1JJG A;  3U58 A;  2C9O A;  3D31 A;  3MC0 B;  3T16 A;  3U4V A;  3VDY A;  1S5F D;  4K5V A;  1VQ8 A;  1R4Q B;  2FJ2 A;  1RJT A;  1J8I A;  4JOI A;  1NNX A;  3RN2 A;  4S3S A;  1KNE A;  3T4A C;  2VQE Q;  2NVQ H;  3I70 A;  5IGC A;  1JWU D;  5M5X H;  1JQY D;  5DAU A;  1IL8 A;  1K3R A;  2Q2H A;  3M4Y A;  1VF5 C;  4WJ3 M;  1J5E L;  1WTH A;  3M85 A;  4CDC C;  1AZP A;  4IZ8 A;  1IHZ A;  3MFG A;  4I65 A;  1H9S A;  5C5L A;  2K05 A;  3TP8 A;  3UE1 A;  1XJV A;  1KRT A;  5CV6 A;  2JK8 A;  5FOB B;  1K8G A;  3EFX D;  4YHH Q;  4K6D A;  4BBR H;  1NCV A;  1IW7 C;  2F0U A;  5IWA L;  5LMN W;  2IPK D;  3PO3 G;  3I4L A;  1RCV D;  2LS0 1;  3QOL A;  2G5D A;  1F2L A;  5D14 A;  2PZT A;  2NN6 H;  1EZ6 A;  1BBU A;  1CZG A;  1HJP A;  2CWA A;  1CQF A;  1SAP A;  2F3I A;  5C3X A;  1Q8I A;  3NQI A;  1QUQ A;  2ZTD A;  1SNP A;  5AFW A;  4JI3 L;  3SK4 A;  4DUZ Q;  1Q81 C;  3O13 A;  4IOA A;  3NEL A;  4X3K A;  2E2I B;  2AWO A;  3VR5 A;  2ZXR A;  4C3H H;  4P75 A;  5ELN A;  1EOV A;  3S15 H;  2F52 A;  1VQ4 A;  2BE5 C;  3MVV A;  1O78 A;  4DV6 Q;  2A74 C;  3QG1 A;  5C3E G;  4A3G G;  1ZYR C;  5CV4 A;  1D5X C;  1KQS A;  2UUB Q;  3MAQ A;  3I4M B;  3K0Y A;  2E8G A;  1X3P A;  2KCN A;  2L9H A;  2M9V A;  2JA7 B;  5C3E H;  2A8V A;  5CBA E;  4DV2 Q;  2WP8 J;  3F2C A;  3R2I A;  3BZC A;  1F9R A;  3VR2 A;  2JEB I;  4C3I G;  1PRT C;  2ZJR A;  3U4Z A;  1WD1 A;  3RLO A;  3RLF A;  4C3H B;  4LF7 Q;  4L5Q A;  1L0W A;  4DAP A;  1EZ8 A;  3T1Y L;  3J80 E;  3QO2 A;  1JE5 A;  5J1Z A;  1PRT B;  2O4X A;  4GKK Q;  2YV5 A;  1ZKO A;  4HTH A;  3R2T A;  2MHV A;  4UP7 A;  3HOV G;  1YIJ A;  4EQN A;  1A6X A;  3EIV A;  1PTO C;  2B2V C;  2EE1 A;  4L8J A;  3T1Y Q;  4R4Q A;  5FO7 B;  4OIJ A;  2F1M A;  1PA6 A;  2I5L X;  3KF8 A;  4ZQ3 A;  3MTS A;  2UXD L;  4XQN A;  3RZD B;  2AMC B;  1CKN A;  2TSS A;  5GQO A;  4DU9 A;  5IGG A;  5TSS A;  1DOL A;  1TS5 A;  3OIP A;  1V1P B;  4CDF C;  3R8B A;  2SDF A;  2JA6 B;  2H1E A;  1KIX A;  2XVS A;  3ITP A;  2K1B A;  2MP1 A;  1HZC A;  5KYL A;  1N34 Q;  4DUY Q;  2ICI A;  1FL0 A;  4YCU A;  4RCO A;  3SXH A;  1O7Z A;  2Z6K C;  3TP5 A;  1HUM A;  3OIQ A;  5D3D A;  2ES2 A;  2B2W C;  2SNM A;  3QIA A;  2IT1 A;  2KQ3 A;  2EYF A;  4C1N I;  1K83 H;  3GV3 A;  2AHO B;  1MJC A;  1S5E D;  2EY5 A;  1GUN A;  2BA0 A;  4IO9 A;  5CV9 A;  1E22 A;  1NBW A;  3F8T A;  4Q5V A;  1D5M C;  2KVM A;  4BA2 I;  1VQO A;  5C44 B;  2PNR C;  1D2B A;  2JA6 H;  2NVT H;  5FO8 B;  4GNX A;  3H3V I;  5BR8 Q;  4DR7 L;  3C46 A;  4QJF A;  1S72 A;  1I50 B;  1SE8 A;  2RCF A;  3DM3 A;  3NTI A;  1N36 L;  3H0G G;  4ULL A;  2K01 A;  4BS9 A;  2HT1 A;  4KKT A;  1EQV A;  3C1E A;  4JV5 L;  1MGS A;  4HJ8 A;  4IUU A;  1I3Q H;  2PQA B;  1SND A;  2QEX A;  3BZD B;  4LFB L;  3G6J B;  1ILP A;  2N55 A;  2VB3 X;  2O2L D;  1K9M C;  1AP0 A;  1XPR A;  4RMF A;  4GLV B;  5DM7 3;  2F0N A;  2Z4I A;  3CPF A;  4UPA A;  3U9O A;  3HOY B;  4K2L A;  3FP9 A;  2UUA L;  1B44 D;  3S2D H;  4J15 A;  3S1Q H;  2A6E C;  1N33 L;  3K57 A;  3PUX A;  1TVX A;  1LT6 D;  2A19 A;  4HIM A;  1QVF A;  1YNJ C;  2CH4 W;  3OWF A;  4DR2 L;  3BDC A;  5A2Q L;  1SNO A;  1X56 A;  3U50 C;  3CC7 A;  1STB A;  2K03 A;  4M8A A;  3LWU A;  3RD4 A;  3HFZ B;  4DAY A;  3HKZ G;  1K73 C;  3PO3 B;  4IUQ A;  2QCP X;  2PQE A;  5I9P A;  1CKM A;  1JOQ A;  4K8I A;  3H15 A;  2F0H A;  4BBS H;  1W3S A;  3KF6 A;  2F0M A;  1I94 L;  3IKJ A;  2KHI A;  4KY6 A;  3U9S A;  4K0K L;  1PRT F;  3A74 A;  1KDA A;  3MXP A;  5EKI A;  5JJZ A;  2B39 A;  3J80 c;  1PH9 A;  3PO2 G;  3KJO A;  5IP9 G;  1KXL A;  1PYW D;  4IN3 A;  2K5W A;  4CKE A;  2BH2 A;  4A3K B;  4IFD J;  2WFW A;  3GO5 A;  1K3B C;  1QOH A;  2N3S A;  2FMC A;  4BXX G;  1Q82 C;  4YCV A;  4L6T B;  1STA A;  1PHJ A;  1PVO A;  1IXR A;  5FLM H;  1EYA A;  2C35 B;  2YTY A;  2SOB A;  2F0O A;  4HCS A;  1U4R A;  4QB4 A;  3UDX A;  4B08 A;  3D4R A;  1LTS D;  5E1F A;  5C44 H;  3VR6 A;  2D62 A;  4N9T A;  3Q24 A;  1PH1 A;  1KL9 A;  4RWS C;  4A3M B;  4DR4 L;  2NVY B;  1XPU A;  4K5X A;  3HGB A;  4DPG A;  1A2T A;  1QG7 A;  4A93 B;  2NZO A;  2UUC Q;  1EY7 A;  2F0Q A;  4O42 A;  4YHH L;  4LJZ C;  1SYD A;  2UUA Q;  1RHP A;  1M1K C;  5IGB A;  4XQQ A;  1YJN A;  3MZ5 A;  4IUV A;  3RZD H;  1GVP A;  1JR0 D;  1TY2 A;  4X66 Q;  4FF1 A;  2L0C A;  1VQD A;  3TS2 A;  3ULP A;  4IFD G;  5EKK A;  4OWT B;  4ILW A;  3T1H L;  1NR2 A;  3BDO A;  4LF8 Q;  2GVB A;  1STN A;  2DGY A;  3J81 i;  2VQE L;  4OEM B;  1RTO A;  2B2U A;  2N8N A;  1OXS C;  3HP3 A;  4AQY Q;  1XNQ Q;  1EL0 A;  4AIM A;  1YBY A;  1UE1 A;  4OON A;  4LF4 L;  1TS3 A;  4GKK L;  3RNU A;  2HHH Q;  1NR4 A;  1ICW A;  1NY4 A;  5C4X G;  5IT9 c;  2LSS A;  3FMC A;  3TEH B;  2CKZ B;  3BDL A;  4QUC A;  1K0S A;  1G2S A;  1BO0 A;  5IP7 H;  2Q2T A;  4QCL A;  2UXC Q;  2WII B;  2QW7 A;  3J80 L;  3J81 E;  4DV5 Q;  2OTL A;  3D0F A;  1RIP A;  2FXQ A;  4JI5 L;  4ZKC B;  4HJ7 A;  1EIH A;  1STH A;  1IBK L;  2WAQ G;  4POF A;  2DNC A;  3M4Q A;  3MFY A;  3L7Z C;  3DHQ A;  1QZG A;  3AYH B;  4BY7 G;  2EOT A;  2UU9 Q;  2EPB A;  1MHW C;  4NDX A;  4BY1 B;  2AUK A;  5ELD A; 
#chains in the Genus database with same CATH homology
 1MD2 D;  3GTJ B;  1XTC D;  2O5I C;  4CJ2 C;  2WKD A;  1JWM D;  1D6E C;  1WTO A;  5A2Q E;  1W6J A;  3SVM A;  2Y0S B;  3L3O C;  2WAC A;  3HKZ B;  4UDU C;  1EYC A;  3V96 A;  1EWH A;  4DXG A;  5JPN C;  1V43 A;  4KD4 A;  1LTT D;  5IOD A;  3KUP A;  3P20 A;  4RKB A;  1II3 A;  1EU3 A;  3ZYY X;  1OXX K;  1AN8 A;  4NW2 A;  1PMR A;  1V1P A;  1BNZ A;  1I4G A;  2F3W A;  1XWE A;  2IW3 A;  4XYQ A;  5JEA J;  3AU7 A;  3MA2 B;  4DK1 A;  2HQE A;  5FK9 C;  3A55 A;  2JA5 B;  3NBI A;  4FF3 A;  2EYH A;  2A6H C;  4G7Z C;  3NK9 A;  5T1I A;  4ZUI A;  2R92 B;  2F0W A;  1SXT A;  1ENC A;  2EDG A;  2V4D A;  1RKN A;  3SEB A;  4JBW A;  1VDZ A;  2XNA C;  1F2Y A;  4PQX A;  1ESF A;  3OPO A;  3K5O A;  4H0L C;  4V0B A;  5I6W A;  2VNU D;  1DM0 B;  1HRJ A;  2A68 C;  3DEO A;  3TBI B;  5JOB A;  1DD2 A;  1HQM C;  1HXY D;  2C5C A;  3S16 B;  4CGY B;  4XDX A;  1SMY D;  2PW7 A;  3G7L A;  3AMU A;  3UI2 A;  2RDF A;  1S5C D;  4WFN 3;  1VCI A;  1XXG A;  3M7N A;  1HCZ A;  5IGF A;  3ONA B;  4X3T A;  3GTM B;  5JVG 3;  5ELF A;  5C4J B;  3VYS A;  4DNR B;  1GUG A;  3D8G A;  1K8M A;  3S1R B;  1RD9 D;  4OGQ C;  3FPU B;  4ZAI A;  2ENB A;  5KNB A;  5IOC A;  1U4L A;  2CW0 C;  4HN7 A;  4KKS A;  4FF4 A;  1GUS A;  2Q8T A;  4BY7 B;  3CRL C;  5ELB A;  2Z8L A;  4CKC A;  1Q12 A;  1A3U A;  1M4V A;  1JC7 A;  4XIG S;  1I3Q B;  1TT2 A;  1BDO A;  2CHB D;  3PMF A;  4M1U B;  2G9D A;  2HDL A;  4RGO S;  2RQX A;  3J7A V;  2NUC A;  5COY A;  4PMC A;  4YIJ A;  4RHS A;  2F0S A;  5M5X B;  3NTK A;  5C4H A;  5FLX L;  4IUR A;  2FIN B;  5C0X H;  1SE3 A;  4A3B B;  4EVO A;  2E2D C;  2MJ8 A;  2AUJ D;  1KLU D;  5C0X G;  3D4W A;  1SMY C;  5C0X J;  5E4X A;  2B2Y C;  2F03 A;  2JEA I;  2YYZ A;  2Z4H A;  1PFB A;  3D6C A;  5JPM C;  1F9S A;  4HAE A;  3HOU B;  1WTR A;  2PZU A;  3ERQ A;  1EY9 A;  4LK1 C;  2WV6 D;  2ZXP A;  1AZQ A;  1TS2 A;  3E0J A;  1IKL A;  1SE2 A;  2EZV A;  2PCF B;  2DNE A;  4K8J A;  3K6O A;  3GD7 A;  1I6V C;  4R9W A;  2XWJ B;  5DEH A;  3MXN A;  1Z7T A;  5M9O A;  2OEO A;  1A3V A;  1B3A A;  5CC4 A;  1QIL A;  4MHE A;  3NPP A;  3KLS X;  5BN5 A;  1Y1V B;  2O5J C;  2IJ0 A;  2CVR A;  4FNF A;  4C2M B;  4BBR B;  3QB3 A;  1PTO B;  5JEA G;  3KBX A;  2WAQ B;  1EEF D;  1F2M A;  4IUP A;  3P7J A;  3WOF A;  3LX0 A;  3PUZ A;  4DN4 M;  3DXJ C;  1LV9 A;  4KJN A;  3GTO B;  2A68 D;  1TWA B;  1L0X B;  3J7A F;  3FRP B;  3Q22 A;  1SDF A;  2IL8 A;  2NB0 A;  3V05 A;  2IX3 A;  1BR9 A;  1I4Q A;  4G7H C;  2K33 A;  2KEE A;  4FYD A;  5IIF A;  2EJM A;  2K04 A;  4U67 3;  1K83 B;  3NHH A;  4RH6 A;  1LT5 D;  3Q6S A;  1LTG D;  2NVX B;  4NKL A;  4KV6 A;  1PZK D;  4C3H G;  1G91 A;  3BVZ A;  4X3U A;  2A6H D;  1C48 A;  3VYR A;  4RKL A;  4KD3 A;  2D2C C;  1KDB A;  4H13 C;  2F0K A;  1KNA A;  2H4O A;  1LLR D;  3K5M A;  1KTK A;  1G6Z A;  1F2Z A;  3HRZ C;  2B2V A;  4N9P A;  1UNS A;  4HR7 B;  1Z6H A;  1PTO D;  2M2L A;  3LNN A;  4K6L A;  4KK7 A;  4J6H A;  4XXE A;  2AQ3 B;  4FXD A;  3E5S A;  1JCK B;  3QWN A;  1YNN D;  1PTO F;  4DGZ A;  3BVM A;  2D5D A;  4RA8 A;  1MI2 A;  1RDP D;  3SDZ A;  2VB2 X;  1R9T B;  1WVL A;  3OMG A;  1TII D;  3H3V C;  2EYO A;  1JB3 A;  2EYJ A;  5M3F B;  3N52 A;  3AB9 A;  1RF2 D;  1A15 A;  2E75 C;  5M5W B;  4PV1 C;  1F77 A;  1C4Q A;  1VF7 A;  2EY2 A;  2NVT B;  5C3W A;  1CHP D;  3A54 A;  1Y8O B;  4ZRZ A;  2D9U A;  3PV0 A;  4DXF A;  3K5N A;  2RA4 A;  3R3O A;  1C8C A;  2B2T A;  4DFA A;  1FNU A;  2RKS A;  4WRD A;  1SYF A;  2NBF A;  5FO9 B;  1EY8 A;  2HCI A;  3H09 A;  1JOR A;  1BBX C;  4F87 A;  4DF7 A;  4KY5 A;  1ESR A;  2NYZ D;  4C3J B;  3S9W A;  3K5L A;  4ZYS A;  2RVL A;  4RGM A;  3C2P A;  2K7V A;  5CV5 A;  1CTM A;  1ET9 A;  2E74 C;  2J4X A;  5EKL A;  4RAU C;  2XWB B;  3RZO B;  3CQZ B;  1KLG D;  2HUG A;  3SK5 A;  3HOV B;  1ZYR D;  3BVG A;  3I91 A;  2K32 A;  3N6R A;  1PFM A;  1HFG A;  3A7L A;  2EYM A;  2R3Z A;  3DUZ A;  3VYU A;  1EEI D;  1PZI D;  3T51 B;  4Z9C B;  2PZW A;  3KLR A;  2F0J A;  1LAB A;  3I3C A;  3A8I E;  4E6I A;  3M4O B;  5CBE E;  4C3I B;  1UEA B;  4QIW B;  1GUW A;  1GUT A;  2DN8 A;  1IYU A;  3RUZ A;  3D3R A;  4RGT A;  5KIX A;  4C1N K;  4IQZ A;  1SE4 A;  1Q1B A;  1BF4 A;  1CA5 A;  2L4N A;  5EJW A;  3SK8 A;  3OHX C;  3M3Y B;  2MGS A;  2QDB A;  4C3J G;  1AW7 A;  3I72 A;  5ELC A;  3TZD A;  3J81 L;  3K58 A;  2FFK B;  3A8J E;  4IFD H;  3URY A;  1IYV A;  1UAP A;  3NP8 A;  3P75 A;  4L63 B;  2EY1 A;  4EQP A;  2ID0 A;  1BCP B;  2OF1 A;  1FGB D;  2IWH A;  1PRT D;  2NTT A;  1PZJ D;  2K5Q A;  5K5P A;  5EPJ A;  3OW7 A;  1OXV A;  2BDN A;  2KED A;  2WKC A;  1HTP A;  1SYB A;  2TMP A;  5KGU A;  2F0L A;  3S15 B;  1D5Z C;  4LAA A;  4IAL A;  2L11 A;  3FEW X;  4TKO B;  4QMG A;  4WOR A;  1ROD A;  1I4R A;  1ONL A;  1WTW A;  4V19 0;  1UUP A;  4QUF A;  5EPK A;  1DYQ A;  1X3Q A;  3F2U A;  5KRU A;  3VA7 A;  1A2U A;  1SJE D;  2X6L A;  4KMU C;  3HOX B;  1QNK A;  2HDM A;  2J7Z A;  1L0Y B;  1OO9 B;  4OIK A;  5ISR A;  2F3V A;  5IGE A;  2LKV A;  2NWG A;  1D1K A;  2M00 A;  1CI3 M;  1WD0 A;  3GTP B;  1O7Y A;  2B8G A;  1SEB D;  2Q8I B;  4IFD I;  5I9O A;  4FXK C;  3DM1 A;  5CMD A;  3NSW A;  1HA6 A;  3I73 A;  2J0T D;  1TWH B;  1NAP A;  4B9X A;  3MEH A;  2BA1 A;  5E3F A;  5CYU A;  4ZKB B;  2SNS A;  4DA2 A;  2A69 C;  1VMP A;  1ZXT A;  1EYD A;  3EQL C;  1MSH A;  1AFP A;  1Y69 U;  1NUC A;  1STG A;  4BWG B;  4OO1 G;  1LT4 D;  4MN3 A;  3GQB A;  4HED A;  4OO1 I;  2KOL A;  5M3M B;  2IX1 A;  2QIL A;  3PUV A;  5EGT A;  4G57 A;  3IL8 A;  1BUV T;  3W2D A;  1JOO A;  3PUY A;  3T53 B;  3H94 A;  5EBD A;  1QJO A;  3VR3 A;  1GXD C;  2RBM A;  2K5D A;  4PMB A;  3R93 A;  5K36 G;  1E2Z A;  3IFD A;  2HCC A;  1Q1E A;  5D3I B;  5DNF A;  3ND9 A;  2F0T A;  5K36 H;  1B53 A;  2L12 A;  3TZU A;  5JEA H;  4A3J B;  4CBV A;  1GUO A;  1K8O A;  1MSG A;  5F2D A;  1EU4 A;  1S5D D;  2EY6 A;  4GZY C;  1EY5 A;  4KKU A;  1B50 A;  3EJI A;  3NBH A;  5JVH 3;  2K28 A;  1DON A;  4OL7 A;  1PFN A;  1STE A;  3S1Q B;  3CU7 A;  2E2J B;  3VYT A;  2F0I A;  1G8Z D;  1O80 A;  3ND8 A;  5LL6 X;  4NMZ A;  3A56 A;  3PUW A;  1IW7 D;  1HQR D;  2NZ1 D;  4Y7N B;  5IT9 E;  3TN2 A;  1PXU A;  2SEB D;  1R4P B;  2NN6 G;  4I7Z C;  5CR3 A;  2YU9 B;  1BXT A;  3BYT B;  4O1N A;  1WTP A;  4Q0F A;  4XYO A;  4F8M A;  5FKA C;  1JOK A;  1BOS A;  3I4N B;  1M8A A;  1YNJ D;  4K2K A;  2WIN B;  1EY4 A;  1FNV A;  3HZX A;  3X3N A;  5M5Y B;  2XRQ D;  2AQ2 B;  4PMW A;  1SYG A;  3HEJ A;  3MXU A;  4XT1 B;  3NWT A;  4HMI A;  2B2T C;  1O7L A;  3J7Y W;  4J1M A;  4B9W A;  3H6M A;  2AWN A;  4DAV A;  1Y8P B;  3C1F A;  4KY7 A;  1J9O A;  4KHZ A;  2F0V A;  1DXM A;  2EYP A;  1SFO B;  1SBB B;  1QNU A;  3I90 A;  5ELE A;  1ZEQ X;  3WOE A;  3S1M B;  1HFN A;  2I46 A;  2R6G A;  4PNY A;  5A35 A;  2R61 A;  3TDQ A;  4ID6 A;  3NXW A;  3M7G A;  1ILQ A;  3JAM L;  2F0P A;  2R7Z B;  1E2V A;  3D4D A;  3S17 B;  2B2U C;  1QWY A;  5C4Z A;  1EQT A;  1EOT A;  1SYC A;  2A6E D;  2AQ1 B;  1PTO H;  1OXU A;  2FMM A;  1B1Z A;  4HSV A;  4A3D B;  2JYO A;  4J8Q A;  1WCM B;  2MPM A;  3A8K E;  2R93 B;  3D6W A;  3DWP A;  1LTB D;  2A69 D;  1EIG A;  3TSS A;  1FYC A;  4A3E B;  2CQA A;  1SYE A;  4P2C B;  4A3G B;  4FP5 D;  2Q8R E;  1B9M A;  3I8Z A;  4EQO A;  2A5H A;  5T1G A;  1U4M A;  1G29 1;  3Q0A A;  2KCC A;  2L55 A;  3NQT A;  4CJ1 B;  1H9J A;  3QOJ A;  4H7B A;  2XSC A;  2XRS D;  4ZUJ A;  3GV6 A;  4KTA A;  1QB5 D;  2JSO A;  2BCO A;  2X6G A;  5BN4 A;  4TSS A;  1IKM A;  1HHV A;  3IFT A;  1E2W A;  5HGT A;  3K7A B;  2OXP A;  3CHB D;  2RDG A;  3V2T A;  2EYL A;  2BE5 D;  3L9A X;  1ML0 D;  1A3T A;  3E6Z X;  3S2D B;  4OHJ A;  1TKW B;  3GTQ B;  1KAB A;  4RCN A;  3KK7 A;  4CKB A;  3GP7 A;  1HPC A;  2G9H D;  4ABN A;  1ENF A;  1LT3 D;  1CFM A;  4F88 A;  1RTN A;  5KEE A;  4DNT B;  1TWF B;  1CHQ D;  3RMH A;  4ME5 A;  3CRK C;  3OSO A;  1GJX A;  1KAA A;  3DEP A;  1X32 A;  3BYY B;  1H9S B;  1T5X D;  2DY8 A;  2IX0 A;  2PMZ B;  4X3S A;  4C56 C;  3VR4 A;  1I4H A;  3EA6 A;  3S14 B;  1LTR D;  5CGK A;  1ET6 A;  5NUC A;  4UAI A;  2RDH A;  5J39 A;  3SHL A;  5C5M A;  5KND A;  1Y8N B;  1BCP C;  2PYK A;  4RHR A;  5I2Y A;  1Z47 A;  3OOC A;  3OWE B;  2B2W A;  2EJF C;  3PIP 3;  4R8I A;  4KN4 C;  1WTX A;  5I4D A;  1TY0 A;  5CV8 A;  2BDO A;  3FDT A;  1SNC A;  3C3L A;  1W6K A;  3KLS A;  3Q23 A;  5EBC A;  1BCP F;  1JE4 A;  3EVQ A;  3NUC A;  2KHS A;  2MUY A;  2JE6 I;  3MHB A;  3NWS A;  5HUR A;  4H44 C;  3NTH A;  3OMC A;  3A7A B;  3DWA A;  3TP7 A;  4CJ0 B;  1U4P A;  3S2H B;  2Z1C A;  2EJG C;  5I6Y A;  1ENA A;  2F0F A;  2ZT9 C;  4HSP A;  1EFI D;  1LAC A;  1B9N A;  3FVQ A;  4LMQ D;  4KJO A;  1DJR D;  5IGD A;  4XT3 B;  1DZ1 A;  3HOZ B;  1D1I A;  1DCZ A;  2F4I A;  5D65 A;  3T13 A;  4R8N A;  5DM6 3;  1GOZ A;  2K6A A;  5BN3 A;  5ELD A;  1DOK A;  4A3I B;  2XN9 C;  2NVQ B;  1HUN A;  4DK0 A;  1I4P A;  2B8F A;  4F7X A;  1WTQ A;  3FKI B;  2FHT A;  2ZXO A;  1NSN S;  1TS4 A;  1F9Q A;  1LTA D;  4MIU A;  4FXG C;  3K59 A;  3HOW B;  1Y1W B;  4QF4 A;  4K5W A;  3W3A A;  1LO5 D;  2CW0 D;  3P1H A;  3KBG A;  1SNM A;  2GA4 B;  4A3F B;  5JAV A;  1B2T A;  1OXT A;  4ZLT F;  4ODG A;  4G4K A;  1E0B A;  3MWY W;  4FF2 A;  1CK1 A;  3HG9 A;  2RSN A;  4JK1 C;  1TWC B;  2I07 B;  5CV7 A;  4TRD A;  1I6H B;  1T5E A;  1SJH D;  4AYB B;  1YNN C;  4U68 A;  5C3E B;  3TP6 A;  4KHV A;  3DWQ A;  1FNW A;  1U9R A;  2F0G A;  2KEC A;  3PO2 B;  1PDQ A;  5J22 A;  1I4X A;  1BCP D;  1XX8 A;  1GHJ A;  1QE6 A;  5IT9 L;  2KA7 A;  3GTK B;  5C0X I;  4BBS B;  4XTC S;  1PLF A;  4FVM A;  3SE0 A;  1Q3L A;  5E4W C;  4KN7 C;  4RFB A;  1DOM A;  5KYI A;  3LWE A;  2RSO A;  2E76 C;  2VXW A;  3GTG B;  2EXZ A;  1TU2 B;  2N88 A;  3T56 B;  4K14 A;  1H9R A;  4IUT A;  1CM9 A;  1S4Z A;  2WB1 B;  2KJX A;  1KDC A;  5COR A;  3IAY A;  2PW5 A;  1FD7 D;  2F0E A;  2B63 B;  1V8Q A;  3TME A;  2OT2 A;  5FLX E;  4KI0 A;  1FR3 A;  3X3M A;  5I2X A;  3BS1 A;  1JIC A;  1B4O A;  1CT1 D;  2JP1 A;  2EVB A;  2LY7 A;  1Q90 A;  5C6A A;  3H91 A;  2PO4 A;  3MXG A;  5EQ0 A;  1S5B D;  1AEX A;  1QCB D;  1SSO A;  3CKI B;  3ERO A;  2NTS A;  3VA5 A;  5G3L D;  1TR5 A;  2QKI C;  4RGN A;  3JAM E;  2LMC B;  3HS0 C;  5G3L F;  2XIW A;  5EPL A;  2DY7 A;  1TWG B;  2JA8 B;  1H9M A;  2B2Y A;  1F9P A;  1CZW A;  4WJW A;  5LL6 S;  4BA1 I;  2L5T A;  2JXM B;  4XQJ A;  1CA6 A;  1EY6 A;  1H9K A;  1CQV A;  2ICE C;  3DMU A;  1TQO A;  5LHY 1;  2QF7 A;  4ZK9 B;  4NP5 A;  4CHT B;  3QJY A;  1GHK A;  3WDN A;  3SK6 A;  1SNQ A;  1LTI D;  5C4X B;  4HMJ A;  1WTV A;  4IUN A;  2A73 B;  1STY A;  2L1B A;  4EGV A;  2X69 A;  1EY0 A;  3PIO 3;  2BOS A;  1HTL D;  2QEJ C;  1MBY A;  2E2H B;  3NE5 B;  4HCE A;  2PPB C;  4OO1 H;  1JWS D;  3H0G B;  3SR1 A;  2KUM A;  2F0D A;  1V1O A;  3BG3 A;  1EWC A;  1G2T A;  1BQQ T;  3FPP A;  1VMC A;  4FO2 A;  5KNC A;  4G7O C;  4TQU S;  2NN6 I;  3GTL B;  1HA5 A;  2LFN A;  2VUM B;  3S1N B;  2C9O A;  3D31 A;  3MC0 B;  3T16 A;  1S5F D;  4K5V A;  1R4Q B;  2FJ2 A;  1RJT A;  1J8I A;  4S3S A;  1KNE A;  3T4A C;  3I70 A;  5IGC A;  1JWU D;  1JQY D;  5DAU A;  1IL8 A;  3M4Y A;  1VF5 C;  3M85 A;  1AZP A;  4IZ8 A;  1IHZ A;  3MFG A;  4I65 A;  1H9S A;  5C5L A;  2K05 A;  3TP8 A;  5CV6 A;  5FOB B;  3EFX D;  4K6D A;  1NCV A;  1IW7 C;  2F0U A;  2IPK D;  3I4L A;  1RCV D;  2LS0 1;  3QOL A;  1F2L A;  5D14 A;  2PZT A;  2NN6 H;  1EZ6 A;  1CZG A;  1CQF A;  1SAP A;  5C3X A;  1Q8I A;  3NQI A;  5AFW A;  1SNP A;  3SK4 A;  3O13 A;  4X3K A;  2E2I B;  2AWO A;  3VR5 A;  2ZXR A;  2BE5 C;  3MVV A;  1O78 A;  2A74 C;  3QG1 A;  1ZYR C;  5CV4 A;  1D5X C;  3MAQ A;  3I4M B;  3K0Y A;  1X3P A;  2KCN A;  2L9H A;  2M9V A;  2JA7 B;  5CBA E;  2WP8 J;  3R2I A;  1F9R A;  3VR2 A;  2JEB I;  4C3I G;  1PRT C;  1WD1 A;  3RLF A;  4C3H B;  4DAP A;  1EZ8 A;  3J80 E;  3QO2 A;  5J1Z A;  1PRT B;  2O4X A;  1ZKO A;  4HTH A;  3R2T A;  2MHV A;  4EQN A;  1A6X A;  1PTO C;  2B2V C;  2EE1 A;  4L8J A;  5FO7 B;  4OIJ A;  2F1M A;  3KF8 A;  4ZQ3 A;  3MTS A;  4XQN A;  3RZD B;  2TSS A;  4DU9 A;  5IGG A;  5TSS A;  1DOL A;  1TS5 A;  3OIP A;  1V1P B;  3R8B A;  2SDF A;  2JA6 B;  2H1E A;  2XVS A;  3ITP A;  2K1B A;  2MP1 A;  5KYL A;  2ICI A;  4RCO A;  3SXH A;  1O7Z A;  3TP5 A;  1HUM A;  3OIQ A;  5D3D A;  2B2W C;  2SNM A;  3QIA A;  2IT1 A;  2KQ3 A;  2EYF A;  4C1N I;  3GV3 A;  1S5E D;  2EY5 A;  1GUN A;  2BA0 A;  5CV9 A;  4Q5V A;  1D5M C;  2KVM A;  4BA2 I;  5C44 B;  2PNR C;  1D2B A;  5FO8 B;  3C46 A;  1I50 B;  3NTI A;  4ULL A;  2K01 A;  4BS9 A;  4KKT A;  1EQV A;  3C1E A;  1MGS A;  4IUU A;  1SND A;  3BZD B;  3G6J B;  1ILP A;  2N55 A;  2VB3 X;  2O2L D;  1AP0 A;  5DM7 3;  2F0N A;  2Z4I A;  3U9O A;  3HOY B;  4K2L A;  1B44 D;  2A6E C;  3K57 A;  3PUX A;  1TVX A;  1LT6 D;  1YNJ C;  3OWF A;  3BDC A;  5A2Q L;  1SNO A;  1STB A;  2K03 A;  4M8A A;  3LWU A;  3RD4 A;  4DAY A;  3PO3 B;  4IUQ A;  2QCP X;  2PQE A;  5I9P A;  1JOQ A;  4K8I A;  2F0H A;  2F0M A;  3IKJ A;  4KY6 A;  3U9S A;  1PRT F;  1KDA A;  3MXP A;  5EKI A;  5JJZ A;  2B39 A;  1PYW D;  4IN3 A;  2K5W A;  4CKE A;  4A3K B;  4IFD J;  3GO5 A;  1QOH A;  2FMC A;  4L6T B;  1STA A;  1EYA A;  2SOB A;  2F0O A;  4HCS A;  1U4R A;  4QB4 A;  4B08 A;  3D4R A;  1LTS D;  5E1F A;  3VR6 A;  2D62 A;  4N9T A;  3Q24 A;  4RWS C;  4A3M B;  2NVY B;  4K5X A;  3HGB A;  1A2T A;  1QG7 A;  4A93 B;  1EY7 A;  2F0Q A;  4O42 A;  4LJZ C;  1SYD A;  1RHP A;  5IGB A;  4XQQ A;  3MZ5 A;  4IUV A;  1JR0 D;  1TY2 A;  4FF1 A;  2L0C A;  4IFD G;  5EKK A;  4ILW A;  1NR2 A;  3BDO A;  1STN A;  1RTO A;  2B2U A;  1OXS C;  3HP3 A;  1EL0 A;  1TS3 A;  1NR4 A;  1ICW A;  3FMC A;  3BDL A;  4QUC A;  1G2S A;  1BO0 A;  4QCL A;  2WII B;  3J80 L;  3J81 E;  4ZKC B;  1EIH A;  1STH A;  2DNC A;  3MFY A;  3L7Z C;  3DHQ A;  2EOT A;  2EPB A;  4NDX A;  4BY1 B;  2AUK A;  1XYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...