2RVLA

Solution structure of the chromodomain of hp1alpha with the n-terminal tail
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
83
Chain Sequence
GSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extended string-like binding of the phosphorylated HP1 alpha N-terminal tail to the lysine 9-methylated histone H3 tail
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Chromobox protein homolog 5
total genus 9
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rvlA00
1F9RA 1VMPA 2J7ZA 1NR4A 2HDLA 3I91A 1WTOA 1EL0A 1X3PA 4QUCA 1JICA 1Q3LA 3IL8A 5AFWA 2D9UA 1MI2A 5D65A 4X3UA 5EPKA 4ZAIA 2JYOA 2KUMA 1G6ZA 1EIGA 4CJ1B 1WTPA 3DM1A 2DY7A 3FPUB 2B2VA 2XIWA 4X3TA 3TN2A 2R3ZA 1PFBA 3LWEA 2MP1A 4RAUC 1AZPA 3H91A 1DONA 2KOLA 2EE1A 2B2WC 2K1BA 4XT1B 4DN4M 4IUPA 2IL8A 2X6LA 4U68A 1DZ1A 3DEOA 4IUUA 1O7YA 1HHVA 2N88A 1ML0D 4NW2A 1BNZA 3UI2A 2K05A 2NWGA 5T1IA 1WTRA 2L11A 4ZLTF 1PFMA 1PLFA 2HUGA 1B3AA 2L1BA 1MSGA 1RJTA 1RODA 1DOMA 3HP3A 1PDQA 4X3SA 3IFDA 2FFKB 4IURA 1RHPA 4MN3A 1EOTA 4O42A 1MSHA 1WVLA 4OIKA 1G2TA 4IUTA 2N55A 2X6GA 1IL8A 1NR2A 3MTSA 1WTQA 3F2UA 5COYA 2JP1A 4LMQD 4XDXA 4X3KA 1J8IA 3KUPA 2K01A 1HFNA 1BF4A 4ZKCB 4CJ2C 2KVMA 1TVXA 4IUVA 2B2TC 5JJZA 1AZQA 1B50A 3ONAB 3Q6SA 4XT3B 5EKIA 1F2LA 1DOKA 2VXWA 2EOTA 2HCCA 1QE6A 3R93A 2HCIA 2MPMA 1WD1A 2B2YC 2B2YA 2B2UA 1PFNA 2K28A 2RVLA 1SDFA 2HDMA 4QUFA 3I8ZA 1AP0A 1HA6A 4HSVA 5EPJA 1ICWA 1J9OA 2FMMA 1HFGA 1WTXA 1ILQA 1B4OA 1F9QA 1KNAA 1O7ZA 1RTOA 1S4ZA 2B2UC 2KECA 5DNFA 1NCVA 1SAPA 4ZK9B 5CBAE 4UAIA 3TZDA 1B53A 2H1EA 1U4MA 3MWYW 1XX8A 2FHTA 2KEEA 2X69A 4HEDA 5EPLA 5EQ0A 1XYIA 2L9HA 3D6WA 4HCSA 3SVMA 1IKLA 1DOLA 4R9WA 1QNKA 1CA5A 4HAEA 2K04A 1G2SA 2RSNA 4MHEA 5D14A 1LV9A 2NZ1D 1CA6A 2NYZD 1F9PA 1RTNA 1X3QA 1O80A 1QG7A 1X32A 1SSOA 1GUWA 2RA4A 2MJ8A 4IUQA 3GV3A 1NAPA 1KNEA 2L12A 4RA8A 1HUMA 1F9SA 4RWSC 5CBEE 2B2WA 1HUNA 1EQTA 2CVRA 5E4XA 1E0BA 3I90A 1B2TA 5CMDA 5CORA 2M2LA 1CM9A 1BBXC 1IKMA 2L4NA 1ZXTA 3KBXA 3P7JA 1JE4A 1EIHA 1BO0A 4CJ0B 3QO2A 1HRJA 2RSOA 2Q8TA 1C8CA 1U4LA 3GV6A 2EPBA 1ESRA 1M8AA 2SDFA 2B2VC 2KEDA 2MGSA 1WTWA 2FJ2A 5EJWA 2DY8A 5E4WC 3DEPA 2FINB 3G7LA 3N52A 1ILPA 1VMCA 3I3CA 4ZKBB 1G91A 5T1GA 1MGSA 1U4PA 4R8IA 3FDTA 1WTVA 1U4RA 1WD0A 2K03A 1A15A 2Q8RE 4OIJA 2BDNA 2B2TA
chains in the Genus database with same CATH superfamily
2L15A 5E7NA 4LUZA 3S15B 2F3IA 1I4GA 1E1OA 1A8VA 4PMWA 3DM1A 5KNCA 3NBHB 2M00A 5C0XG 5D3DA 2QA4A 4GNXB 5C3EH 1PFBA 1AZPA 4DK1A 4UHVA 4FYDA 2PQAB 2LFNA 2PYKA 3I70A 4IUUA 1LTBD 2BA0A 3UI2A 2NWGA 5GQOA 4DV5L 3AEVA 3NBIA 4KJOA 3F1ZA 1XNRL 4GN3B 4GOPA 4H13C 1K0RA 2FFKB 2UUAQ 1KLUD 4OIKA 5IYDH 4LF9L 2MUYA 2E75C 4CDDC 1KL9A 2I5HA 2K5QA 3BYTB 3M7NA 1D1KA 1PYBA 2A73B 3I73A 1FL0A 3KUPA 1V1OA 3CC4A 4HR7B 1DJRD 1NSNS 4P74A 5IE8A 2JA6H 2E2HB 5EKLA 1CHPD 2EYLA 2R7ZH 2A1AA 4PZ8A 2RCNA 5E3FA 2RDGA 3BDOA 3UDIA 1U9RA 4K6DA 4JBKA 4RKLA 2RDHA 5JAVA 2LY7A 2HIXA 3E6ZX 1WI5A 4OEMB 2KECA 4FF2A 4KK7A 3CCEA 3KLWA 3HGBA 4C3JB 1EEFD 1VQ4A 4OX9L 4DF7A 2PMZB 3I4NG 4CDEC 1PH3A 3QB3A 3SVMA 2QKIC 4LF9Q 1DOLA 3QOLA 3BZDB 2NVQB 2F3WA 4DV2Q 1VQ9A 5D14A 2NZ1D 3ERQA 2NVTB 4OWXB 1Y1WG 1A6XA 1MHWC 2ICIA 1CT1D 3QR8A 1CKMA 3UDXA 2CVRA 4UP8A 1VQ8A 4BA2I 3NTKA 2Q8IB 4NXMQ 5I2XA 2L4NA 1QJOA 1MKHA 2NBFA 4P71A 3TRZA 4A3CG 2JA7B 1BOSA 3UE0A 4AQYL 3V96A 1L1OB 4Q5VA 3N52A 3I3CA 3RLOA 2Z4IA 1FYCA 3KBGA 4KI0A 4CBVA 2JSOA 1E3PA 2K03A 4R4TA 2UUAL 3EA6A 5FOBB 3ERSX 4A93B 2F0GA 3PQIA 2F0JA 5M3FB 4X3UA 3WOEA 1TS5A 2KUMA 4K0KL 2F0EA 3RR5A 4OX9Q 4G7HC 2SNSA 5JEAH 4LFCL 3PGZA 4RH6A 2RHQB 1JC7A 3SK8A 1DONA 1PXUA 4RGOS 5EGTA 2UXBL 3EVQA 1KXLA 2F0QA 1V8QA 1PLFA 1Y1WB 1MSGA 2WB1E 1A62A 3CAMA 3E5SA 1MSHA 5C3EB 1V9PA 3VYTA 2JE6I 3IFTA 4A3JG 2AQ1B 4WJWA 3T51B 2E5LL 1EQQA 3P20A 4DV2L 4IPDA 1TVXA 2B2TC 2Q2IA 2B8FA 4LW1A 3CCVA 2CH4W 2E8GA 1Y8NB 2BH8A 3MFGA 1QCBD 1PH1A 3TSSA 2B2UA 4C1NK 1DD2A 1EZ6A 4CGYB 3PIP3 1YEZA 3GTPH 3S17H 1TIID 4GLAC 3SK6A 1TWAH 2K5VA 1C7YA 1S4ZA 1K3BC 4ZK9B 1N36Q 1K3RA 4Y7NB 1CK1A 1QVFA 2KEEA 2G9DA 5A2QE 1CA5A 3OMGA 3R3OA 3KF8A 2RSNA 2UXCQ 2N8NA 1CSPA 3S1QB 1I50H 1HZBA 2XWBB 2NN6G 2EYHA 3Q0AA 3T4AC 3AQQA 3BU2A 3J81E 4K14A 1KLGD 4A3EB 2UU9Q 2R93H 1AFPA 1SJED 1VQEA 1LM0A 1KDCA 2AQ3B 2KCTA 5ELBA 4B3TL 2EPBA 1GXDC 2F0OA 2FXQA 1TWGB 3L0OA 5G3LF 3S15H 3I56A 1EWCA 1PTOD 2P5ZX 4A3MG 1PYSB 1YHBA 5ELFA 4DV3Q 1IBLL 1WTOA 4RHRA 4JW0A 4DNRB 1NE3A 3ITPA 2HT1A 3E0JA 1D5MC 4HCEA 1YHQA 2JA6G 3CCLA 1DXMA 2B3GA 4DKAC 1N33Q 2OXPA 4LUVA 3PO2B 1Y8OB 5M5XB 2JEBI 1GJXA 3PMFA 4KY6A 3TN2A 2R3ZA 1LT4D 1X55A 4A3KH 4G57A 3UE1A 4DV0Q 4A93H 2F0VA 2WACA 3S16H 1ML0D 3M3YB 2L11A 4A3GG 2L1BA 1B3AA 2UUCQ 2QW7A 3BYYB 4L5RC 1L1OC 1HZ9A 3SXHA 2K52A 4DUZL 4AH6A 5KYIA 1B1ZA 1SYCA 3K5NA 1JWMD 2K33A 4RFBA 4B3RL 2EJGC 5JJIA 1GHJA 1B3QA 2E5LQ 1AZQA 5JJZA 2K75A 1B50A 5CV4A 2KCMA 3O13A 4PNYA 1F2LA 3RUZA 3HOVB 1LTGD 4DUYQ 3BDLA 3BZCA 3SK5A 3QG1A 5A35A 1PH9A 1Y1VG 1SE8A 1NJIC 2N78A 2K28A 3D4DA 1HZAA 1SN8A 4QUFA 4H0LC 1JJCB 1ICWA 1SE2A 1STYA 5M3FG 1T9HA 1W6JA 5BN3A 3PIO3 4LF7L 1PTOF 3K57A 4BY7G 3K7AB 1EYGA 3PO3B 2EYJA 1ONLA 2WKDA 1IKLA 2VS1A 3X3NA 2R7DA 1JOKA 4A3IH 2PCFB 5C3XA 4DAYB 1U0LA 2TSSA 3MEHA 3GTQB 1B9NA 1NAPA 2L12A 3DHQA 5CBEE 5AJ3L 2JA5G 4LF7Q 3HOXH 3HKZB 1A63A 1KD1C 3U9OA 3MC0B 3E3XA 1CHQD 4XQNA 5IT9E 3QO2A 3SGIA 4R4OA 1LTID 3VA5A 4HN7A 1EY4A 2MGSA 4JI7L 4CHTB 3GTKH 3DWQA 3MXUA 5JPMC 2JEAI 5AJ3Q 3TZUA 1VMCA 2Y0SE 1ILPA 4GKJL 4MTKA 3DWPA 1JR0D 3RZOH 4PMBA 1FGBD 4XTCS 1SYGA 1A15A 3S2DB 2BDNA 3I91A 3K0YA 1HNXL 4YWMA 5I2YA 1HR0Q 3VR6A 2F0SA 4H44C 4DR5Q 1EIGA 3C2PA 2WAQB 2XRSD 3HFZB 2NB0A 1SNMA 2L0CA 5E1FA 3A0JA 1VDZA 3PUZA 1Y14B 4ABNA 2CHBD 3GTMH 1IYUA 2Z6KA 3LNNA 4JI0Q 1JB3A 4RCNA 4GZYC 4TVAB 5M3MG 1MJCA 1XWEA 2K4KA 5J22A 2JA8B 3FPPA 4OGQC 1GUTA 1VQMA 1M1KC 4NKLA 1N36L 4B3SL 2QEJC 3HEJA 1SBBB 2OQ0A 4IPHA 4N9TA 1GO3E 4N8FA 2VB2X 4K5XA 4LK1C 1O7IA 1PYWD 2VW9A 4R4IA 4V0BA 2ZTCA 3KF6A 4DFAA 2FMMA 1A2UA 5M5WB 3PO2G 1LLRD 1RTOA 5DNFA 4YIJA 3D8GA 4GN4B 4TSSA 4A3FB 3S1RB 3VYRA 4EQOA 2I0QA 2PO4A 3BG3A 2C5CA 1PFSA 2F0PA 4JPBW 4KN7C 2GVAA 3K59A 3CMEA 1WJJA 4OONA 2ATWA 1AW7A 1X9NA 3HOZB 1TWHB 1GUGA 4IFDG 3ULLA 2Q8TA 2I07B 3F2BA 3K6OA 2XRQD 4HMIA 1SYDA 3URYA 1WTWA 1UEAB 4LF6Q 1KC8C 2FJ2A 3NWSA 5KEEA 1PH2A 4RG1A 3I7FA 1TWAB 3J7AV 1Q8IA 4KMUC 2B2TA 3GTLH 4ZQ3A 1HCZA 4C3JG 4C3HB 2JA5H 1EIFA 4JI3L 3IRBA 4IPGA 3K7UC 4EQ5A 3L2PA 3S14B 4RAUC 3S2DH 2R7ZB 3H91A 1PTOB 1TWFH 1WYDA 5LMNL 1SXTA 2A68D 2D62A 4U68A 3TS0A 2N88A 4NW2A 1XPOA 4LFBL 2MO0A 3LX0A 1I94L 1G51A 3MXGA 5IOCA 5CC4A 4DR5L 2KCCA 4ZUJA 4DNTB 1EYDA 1AE3A 4FDBA 1HNXQ 2JA7G 1F2YA 2F0DA 1CZWA 1EUJA 4PMCA 3DMUA 4AYBE 1S5BD 3H3VH 4B3SQ 1LYLA 4LJZC 2PQEA 2VUMB 3PUWA 2O2LD 4XT3B 3X3MA 2QGQA 4PQXA 2EY2A 4DAMA 2H4OA 1SE4A 4FNFA 1WD1A 3RD4A 4HJ8A 4DR7L 1E24A 1QZGA 5M9OA 3F8TA 1A0IA 1QILA 4DAPA 1LTRD 3T1HQ 1VQBA 1LT3D 4C3HG 4UAIA 1PRTF 1SR3A 1U4MA 1Q12A 5M3MH 4KJNA 4QJFA 1EWHA 3OOCA 5JVH3 1Y69U 1XNQQ 4F8MA 1QNKA 1MBYA 1YI2A 4BY1B 3CU7A 3SE0A 1LV9A 2VY3A 4DK3C 5C4JH 3PIPA 5KNBA 3HOWG 1YNXA 4LF8Q 4NB3A 4FF3A 1TT2A 1LABA 2E2JH 5JVG3 1S40A 2B29A 1VS0A 5HGTA 3HOUH 1CI3M 2CCZA 1SYEA 5JOBA 5CMDA 5CORA 3S9WA 5IGEA 1BBXC 1STHA 4LF5Q 2N3SA 2DUDA 5M3FH 3KJOA 3NELA 3HRZC 2NN6I 3ZJYC 5FLXL 2WIIB 3RMHA 2B2VC 2FMCA 5LHY1 1SE3A 1TWHH 2ZTEA 3FKIB 4X65L 4R8IA 1GUSA 4HSPA 3V2TA 2RF4A 4BS9A 1SFOB 5C4XB 1EL0A 4GKKQ 4QMGA 1XNRQ 3A8IE 1S72A 4RGMA 3EROA 3DXJC 5IT9c 1DM0B 3BVMA 2B63B 3U9SA 2QEXA 1VQAA 3MVVA 5J1ZA 4QIWE 4ALPA 1MJEA 3AU7A 2Z6BA 5FLMH 5GAGC 1AN8A 3HOWB 1TU2B 1RHPA 1R4PB 3A7AB 4TKOB 4LFAQ 2NTSA 1YNJD 3J81L 4Y7NH 4LF8L 3NENA 1PTOH 1TWFB 1G6PA 1DYQA 4LMQD 1LO5D 1JWSD 3I4MG 5M5WH 3EJIA 2JA9A 2K5HA 4WORA 4DV6Q 1RIPA 5DLQE 1BKBA 5EKIA 4HTHA 3IAYA 4A3FH 3S1RH 3CC2A 4QCLA 2HCIA 1TWCH 3UDGA 3M85A 4L5SA 2L5TA 1SDFA 4O0AA 2EY1A 4A3EH 5BN4A 1E22A 1WTXA 2O5JC 4A3GB 1PTOC 1Q81C 4KY7A 5C6AA 1RD9D 1GHKA 4UDUC 3PF4A 2ID0A 5CV7A 1HZCA 1S5DD 4JI6L 4JI7Q 4HEDA 2L9HA 4HCSA 3HKZE 4RCOA 3NQTA 2QCPX 2B63G 1K0SA 1D2BA 1YVCA 3C1FA 3FEWX 4JI0L 3PSIA 4CKCA 1JE5A 1EQRA 3H09A 5C5LA 4G4KA 4KD4A 4CKEA 3CMAA 4FO2A 5IP9H 1R9TH 4DV5Q 1VQNA 1IKMA 2LS01 3PUVA 4A3LH 4GNXA 1HR0L 3I55A 1ESRA 4BY7B 4C3HH 4B3TQ 2F4IA 2EQSA 3HOUB 4C1NI 5IP7G 3VA7A 1S5CD 5JEAJ 2VQEQ 2F0MA 4KD3A 3J80L 3TMEA 1IL2A 1F77A 2E2HH 4LNQA 3NXWA 1X3PA 2ZM6L 2Z6KC 5AFWA 4DNIA 2JQOA 1DCZA 1ZKOA 5D65A 4KKUA 3KLSA 3UDFA 2YTYA 2NVQH 2A6HD 1E1TA 2EJFC 1VQ6A 1JCKB 4DXGA 4LF4L 2XSCA 4B9WA 4FP5D 2X6LA 2OTLA 1IBMQ 1SMYD 3VR2A 4HJ5A 3E9IA 4XIGS 4A3DH 2UUBQ 4YHHQ 3NEMA 1SNPA 1Y1VB 3HP3A 2UUCL 2K5NA 2RCFA 1E2ZA 5GROA 3TDQA 2Q2UA 4MN3A 1STAA 4JYAQ 1LACA 3TS2A 3J81i 1C48A 1D6EC 2EXZA 1J8IA 2QDBA 4DV6L 2A6EC 3KLRA 4O2DA 2NTTA 3QWNA 4EQNA 2CWAA 1JB7A 1GD7A 3ONAB 3Q6SA 1KRTA 4IO9A 2EOTA 2IX3A 1X6OA 2Z1CA 1EEID 1PA6A 2MPMA 4JC0A 3HOYH 4DK0A 2F0HA 2ENBA 3DM3A 2C9OA 1H95A 2JA5B 1I6HB 2PZTA 4X62L 2E2DC 2ZXRA 2LXJA 1BQQT 5D3IB 1XTDA 1CTMA 1STEA 3SR1A 1BCPB 3OMCA 3W2DA 4UY8C 3CF5A 2LMCB 1H9JA 5EBCA 4JCVE 4JBMA 2RHSB 2K6AA 2NVYB 1CA6A 3CRKC 2EXDA 1X3QA 2K14A 2SNMA 2D0OA 2O4XA 2K7VA 1SSOA 5K36H 3K5LA 4WFN3 1F9SA 1NNXA 1B2TA 4AIMA 1WCMB 3FKIH 1ZXTA 3KBXA 1WFQA 3P7JA 2PI2E 4QB4A 4A3BH 3MXNB 5BN5A 3TP6A 2DY8A 3GTMB 5KGUA 4NXNL 3CCMA 4HJ7A 3FDTA 1K8OA 2R61A 1V1PA 2ZT9C 1L0WA 1JWUD 1ET9A 4DR6Q 2J7ZA 4YY3L 5TSSA 4HIDA 3RNUA 1YHAA 2VB3X 4GKKL 2IPKD 4BBSH 1IBML 4QL5A 4KKSA 4WRDA 1SMXA 2XN9C 3S2HH 1HQMC 1IBKL 2UU9L 3S1QH 1JOQA 2KOLA 2B2WC 4XT1B 2R92G 4IUPA 1DZ1A 3DEOA 3ZYYX 2XVSA 3T1HL 2YU9B 1DOMA 1HTLD 4TQUS 2AKWB 2SOBA 5DM63 1WVLA 1TWCB 4IUTA 2Y0SB 4AYBG 3SHLA 1W3SA 1F2ZA 4DR1L 3DUZA 1ESFA 4CJ2C 4A75A 2OWOA 2IY5B 1Y1VH 2RKSA 1HJPA 2EYFA 3Q23A 4DV4L 3C46A 4ZRZA 1TS4A 2R7ZG 1K83H 1SNQA 4XQQA 1OXSC 4ULLA 5IODA 1NTGA 4JOIC 4LUOA 1AP0A 3RZDH 1GOZA 1O7ZA 1XPRA 1N32Q 1FD7D 2F0IA 2A74C 3A54A 4I7AA 3JAML 2B63H 3J7AF 1XJVA 3H3VC 1HNZL 3QOJA 1JOOA 4R9WA 4HAEA 2MNAA 2MHVA 3PF5A 1UNSA 3NQIA 4OELB 3RN5A 2YYZA 4DGZA 4EX5A 4LF5L 4XYQA 3M3YH 1XMOQ 1XTCD 2HHHL 1O80A 4GN5A 3U58A 3BVGA 3J7YW 1GUWA 4HIKA 5IP9G 1RCVD 1Q46A 4DR2Q 2UXDL 4XQJA 1CUKA 1TQOA 1C9OA 4GLVB 1HR0W 1E7ZA 1Z9FA 5CYUA 2F3VA 4RHSA 3GTJB 4JK1C 1EIHA 4CJ0B 3CCQA 1PZJD 2VUMG 2AWOA 4DV0L 4B9XA 1B9MA 2KEDA 4FF1A 3K5OA 4A3DG 4DAYA 1PZID 1N34L 3OW7A 3CCRA 1H9KA 4M8AA 1ASZA 5EBDA 1VCIA 1M90C 3CW2C 3EIVA 1FNWA 2NVXH 1UAPA 2KENA 4OIJA 1V1QA 3CP0A 3NTIA 2EY6A 3PO3G 4X6AH 1CSQA 1Q3LA 2CWPA 2XWJB 1YJNA 4JI6Q 4MIUA 5EPKA 1KTKA 3V05A 1WTPA 4CKBA 1EIYB 4KHPQ 2EY5A 1Z7TA 3CD6A 1VQCA 3J7A5 4J6HA 3NUCA 3R2TA 1Q7YC 2AUKA 5JEAG 4RKBA 2EYPA 3T1YL 5IGDA 4DV1L 5I4DA 2HD3A 1RJTA 1C4QA 1VQ7A 4X3SA 4DPGA 5BR8Q 4B3MQ 1R9TB 4JI1Q 1H9SA 2G9HD 4K5WA 4JI2Q 5CV9A 1BF4A 4K6LA 1LTAD 3KDFB 2YU9H 1SLJA 5FO7B 3RLNA 2VXWA 5K36G 4G7OC 3CHBD 4CDFC 1YIJA 1I4XA 2RBMA 1K8MA 5IGCA 1BUVT 1NMGA 2NVYH 1KNAA 4P73A 4BA1I 5CBAE 3BJUA 1I4QA 4QF4A 3K8AA 2H1EA 3MWYW 4X64L 1LTTD 3LWUA 4PV1C 1YNJC 1UE7A 4IOAA 2K04A 1WCMH 2K5WA 5IGFA 4MHEA 3B6YA 4DA2A 3HOXG 4ME5A 1BBUA 1QG7A 2MFIA 3ULJA 4RA8A 4B08A 1HUMA 1HUNA 1NMFA 1QB5D 4J8QA 3HOYG 1YNND 2Y0SG 4BBSG 3T53B 4Y52H 2HHHQ 3K81C 3I4NB 2N49A 2VL6A 3S1NB 4BWGB 1JE4A 1AE2A 4IQZA 1VQKA 1C8CA 4HIOA 1ENCA 1L0YB 5C3WA 3JAMc 2I5LX 4L6TB 3S17B 2RQXA 3J7ZC 3OIPA 3ER0A 5EJWA 2KQ3A 5GAEC 4JI4Q 1VQGA 1BVSA 2GA4B 4ZKBB 1A3TA 3I4OA 5T1GA 2PNHA 1JJ2A 4GOPC 2CKZB 1N34Q 2ES2A 4POFA 1F9RA 1PH8A 1XNQL 1RF2D 4JG2A 1I50B 1UEBA 2F52A 5A2QL 4DV7L 4XXEA 4X65Q 1S3OA 1CKNA 2H5XA 3BS1A 3FPUB 4UPAA 2ALYB 5JPNC 4IFDH 2UXDQ 4LAAA 1KDBA 3H6MA 3HZXA 1PV4A 4ILWA 2EE1A 1JT8A 3U4VA 4A3BG 4L5QA 4R4CA 3A5ZB 4DAVA 4F88A 1WTRA 5ISRA 1KDAA 1LTLA 5CGKA 1OO9B 4H02A 4NMZA 2R7FA 1PDQA 2QF7A 3FVQA 3H0GB 1N33L 4I65A 2TMPA 4A3GH 3GO5A 2N55A 2M9VA 1PRTD 3PO3H 1FR3A 2YTXA 1I3QB 3RZDB 1ENFA 2BA1A 5J3BA 4BBRG 1K9MC 2DNEA 2HCCA 4L5TA 4A3IB 5ELNA 3R93A 2OF1A 4FVMA 5C0XI 1EYAA 3FHWA 2JXMB 1PFNA 4KLKA 1J5EL 1K73C 2VQFQ 3AYHB 1ILQA 2F0FA 2CFMA 1NCVA 3G71A 5C4ZA 1B53A 1VQDA 4DR7Q 2FHTA 5I9PA 1BCPF 3GDEA 1KIXA 3S2HB 1TS3A 3S14H 3BDCA 2RDFA 4BY7H 4DU9A 3OTOQ 1P16A 4N8X1 2EYMA 5NUCA 3GTKB 4J15A 4K5VA 1KHIA 2RA4A 3C1EA 1LT5D 1QNUA 3HOVG 5IWAQ 3RZOB 1M4VA 1N32L 1EQTA 4LF6L 2VZAA 3RN2A 3H0GG 3CC7A 1EU4A 4JVZA 3KYHC 4S3SA 1IZ6A 3PV0A 3MEFA 1M8AA 4YCUA 3EBEA 1L1OA 1LUZA 3HG9A 2IX0A 1GVPA 5E4WC 1UWVA 3L9AX 3K7AH 3HS0C 1U4RA 1Q1BA 1MIUA 4KHVA 1X3FA 5HGQA 3OPOA 1L0XB 3CKIB 1VMPA 1TKWB 1VQJA 3TP8A 3P1HA 4P2CB 3MAQA 2F4VL 1EY8A 1EQVA 1RDPD 4JI5L 3CPFA 3D4RA 1HNZQ 3E9HA 1MI2A 4C3IB 4IALA 3GTQH 3CQZB 3VDYA 2KBNA 2A6ED 2F0KA 2XIWA 3HOXB 4B3RQ 2K50A 2MP1A 4K8IA 4GNXC 3FP9A 4EVOA 1JORA 5C0XH 4A3MB 4KY5A 2UXBQ 2YV5A 5LL6S 3K58A 2AMCB 3HOYB 1BNZA 2AUJD 5T1IA 1YJ9A 3PUXA 3EFXD 1BDOA 5IIFA 3FMCA 4DR2L 4IFDJ 4X66Q 2C35B 2EDGA 1YITA 4U673 4KHZA 4QGUA 5IYBG 5JJKA 3MTSA 1Q86C 4JI8Q 1QZHA 1EY0A 5I6WA 3LGJA 1MD2D 3Q24A 4GOPB 1Q82C 5C44B 2KVMA 1RL2A 2KHIA 3S1MH 2E2IB 2ZXOA 2OEOA 2IT1A 1QE6A 3BVZA 4NPSA 1XXGA 3M4YA 2B2YC 2B2YA 2IJ0A 1SFOH 1IBLQ 1TWGH 4WJ4A 3FRPB 1HNWQ 4KV6A 5I6YA 2K32A 1H9MA 2DNCA 1FJGQ 2A5HA 3TZDA 4C2MB 4APVA 3AFPA 1WCMG 2VQFL 3W3AA 4JYAL 1TY0A 1X3GA 2QILA 4A3BB 2A69C 4DR6L 1X56A 3I4NH 1BR9A 1NBWA 2BOSA 5FKAC 1XPUA 2LKVA 1S5FD 2CQOA 3JAMi 3L7ZC 5IGGA 4BBRH 3GV3A 2NUCA 1FNUA 2ZJQA 2BDOA 3GTPB 1D5ZC 3DWAA 3AMUA 5IYCH 1CM9A 1OXUA 1GM5A 4XYOA 4IUNA 4F7XA 3C3LA 2NZOA 5L37A 1B8AA 3E0EA 1BCPD 1KABA 1KRSA 1SYFA 4DR3L 2PPBC 5FO8B 1VQHA 5C44G 4V190 3DEPA 4BXXH 1G91A 2WV6D 1XMQQ 1FVIA 1IW7D 3I4LA 1EFWA 2PW7A 2MO1A 4YY3Q 3TREA 1FNVA 3HOVH 3SDZA 1QVGA 4OO1I 3K0XA 4FXKC 2B2VA 3KF8B 1K28A 1HNWL 3JAME 4EQPA 2DGYA 1L2FA 5FLMG 1ENAA 5C4HA 1EU3A 1Q8KA 5EKKA 4JBWA 3T16A 5LMNQ 1O7YA 4JV5Q 5JJLA 1K83B 2Z0SA 1PFMA 1RODA 2OT2A 2CW0C 2ASBA 1G2TA 2Q2HA 4R8NA 3Q22A 2X6GA 3OW2A 3F2UA 2ZXPA 4A3FG 2BE5D 2F1MA 4QY7A 1HXYD 1QVCA 1RKNA 4P72A 3KF6B 1Q1EA 3A8JE 3S16B 5C4JB 3HKZG 3CCUA 2WINB 4E6IA 2RVLA 2HDMA 1HA6A 4HSVA 2F0TA 1K8AC 2EVBA 4LFBQ 4FXGC 2E2IH 3MZ5A 3BZKA 1PRTC 1CKOA 1PVOA 5FLXc 1XX8A 2EIFA 1PMRA 1D1IA 1HQRD 5FO9B 4A3DB 3JC66 4OXPA 1X32A 1Y8PB 3H94A 4M1UB 4IJLA 3CXCA 1AH9A 3H0GH 1STNA 1PH7A 1Y1WH 1W6KA 3OWEB 3QJYA 4OHJA 4IFDI 2OQKA 1VQIA 1KAAA 1SNDA 4YHHL 4DR4L 1BO0A 1I3QH 2D2CC 4H7BA 2WB1G 5H1SE 1PH6A 3DLLA 5LL6X 3R2IA 2SDFA 1A3UA 2LSSA 3WOFA 2BE5C 3G7LA 1I4PA 2I5MX 3NE5B 4PZ6A 4BY1G 5CV6A 3PCOB 5M3MB 1SROA 3KJPA 1WD0A 1I6HH 1I5FA 2Q8RE 3J80c 1VF7A 4LFAL 3NK9A 1LT6D 1NR4A 4YCVA 3M4OB 3S24A 5C5MA 4DV3L 2CQAA 4HMJA 4OWWB 4QQBX 4CJ1B 3VYSA 5ELCA 4X3TA 3KFUA 2R93B 3LWEA 3A5UA 4DN4M 2V1CC 1G291 4K2KA 1VQPA 5C44H 1W2BA 3OWFA 1FGUA 4N9PA 3T1YQ 1N9WA 1U5KA 2A68C 3GTOB 5F2DA 1NR2A 5FLXE 3M4QA 1NY4A 2JP1A 5LMUL 4C56C 5CR3A 5G3LD 2NN6H 1IHZA 4R4QA 5M5YH 3GQBA 5DM73 3TQYA 3D3RA 3PO2H 2PI2A 4Q0FA 5M5XH 3NPPA 2R92H 4PZ7A 2ZJRA 3K5MA 3U50C 3CCJA 1J9OA 4KN4C 1HFGA 1F9QA 2DN8A 4A3KB 1QOHA 4RGTA 2IX1A 4BBSB 4C3IH 2MQHA 4YWKA 2PQAA 1IXRA 2X69A 1BCPC 3CRLC 4IPCA 4ME3A 2JA6B 2Z8LA 1G2SA 3PUYA 4A3MH 5IY0A 2OTJA 2NYZD 5IYCG 3VR3A 4A3IG 1ASYA 3FKIG 4QIWB 4DR1Q 1E0BA 1ET6A 2BH2A 4J1MA 1EFID 4JI3Q 1STGA 4L8JA 4YCWA 1HPCA 3D31A 1DGSA 1E2WA 1JJGA 2A19A 2Q2TA 1I4HA 4NXML 3R8BA 3WDNA 4LFCQ 3A8KE 4TRDA 1UUPA 1EY7A 5CV5A 4IOCA 3OHXC 1VQOA 3VR4A 4JI8L 3HOZH 3OIQA 4QUCA 3TBIB 3GTGB 3J80i 5HURA 2D9UA 2HQLA 2WKCA 2AHOB 1J6QA 3VYUA 5KNDA 2JYOA 5DAUA 5CV8A 2XGTA 4JI4L 1ZYRD 4IZ8A 2A8VA 3I4MB 3F2CA 2XNAC 1XMQL 3SK4A 1E2VA 3CPWA 3OSOA 4BBRB 1KAWA 1OXVA 2CH4A 1HH2P 5C4XG 4A93G 3M9BA 5K5PA 3G4SA 4IURA 2A69D 2WB1B 3A74A 2KHSA 4UP7A 2R6GA 5LMUQ 2AWNA 1IYJB 3NHHA 4XDXA 4X3KA 2PZUA 2WFWA 1ZEQX 4A76A 5C0XJ 4ODGA 3T13A 4HJAA 1QUQB 4OWTB 1CKNB 5GADC 4CDCC 1GUNA 2AQ2B 3KLSX 2JN4A 5GAHC 4HIMA 3H15A 1VQ5A 1EY5A 1VF5C 2VQEL 1SNCA 4MNOA 5KYLA 3GTOH 1II3A 1N8RC 1SEBD 5LMNW 3P75A 3ND8A 1T5EA 4IJHA 3I8ZA 3J80E 5EPJA 3EQLC 2UUBL 4MTNA 3ULPA 4GKJQ 2Z4HA 1OXTA 2SEBD 5ELEA 3NP8A 2DJFC 1XYIA 2OCEA 1PH4A 1K8GA 3D6CA 4RMFA 4OL7A 5IWAL 3NWTA 4R1JA 2Z9HA 2WAQG 1PH5A 3HOUG 4YWLA 5I9OA 1QWYA 3G48A 4OO1H 4P75A 2B2WA 4JI1L 4FXDA 1CQFA 4DXFA 3NSWA 1G8ZD 2M2LA 3KDFA 1O7LA 3MA2B 2BCOA 3KOJA 4DV1Q 5C3EG 1AEXA 3CQZH 2JA8G 1EZ8A 3MXPA 3MHBA 4A3JB 4C3IG 2HQEA 4JOIA 5ELOA 1Q90A 4O1NA 4BY1H 4POGA 2J0TD 4KHPL 1NUCA 4ZUIA 1U4PA 1V43A 2ZJPA 3D0FA 1XMOL 2E2JB 1ZYRC 2KJXA 1EWIA 3W1BA 1VQLA 4ID6A 4MZ9A 3IL8A 4JI5Q 5KRUA 2F03A 3TEHB 1OXXK 1WOCA 4ZAIA 1G6ZA 2GVBA 3STBD 3I2ZA 3D4WA 3J81c 2IW3A 2IHEA 4GS3A 3T56B 1JQYD 1D5XC 1HTPA 1C0AA 3GP7A 1H9SB 3PIOA 4DUZQ 2EZVA 5FJ8H 3ICEA 2NVTH 2K05A 1TXYA 1YZ6A 3A55A 4ZLTF 3GD7A 3SEBA 1EY9A 1LTSD 3L3OC 2O5IC 1VQFA 3IFDA 1T5XD 4K0KQ 1EOTA 4DV7Q 3M7GA 1SYBA 3I4MH 5FK9C 3ND9A 1GKHA 4C2MH 1WTQA 4FF4A 3HOZG 4Z9CB 5IT9L 1TY2A 1B7YB 1D8LA 2V4DA 3GTLB 1D7QA 2KHJA 2JA7H 1DOKA 4DR3Q 2EYOA 3A56A 1HA5A 2ZTDA 1EYCA 4A3EG 2F4VQ 3WWVA 1SJHD 4AQYQ 2WAQE 3RLFA 1SRUA 1IBKQ 3M4OH 1B4OA 2B2UC 2KA7A 4A3CH 1SAPA 2E74C 2J4XA 3GTJH 3OYYA 2K5DA 1BBWA 2LXKA 5EPLA 3Q8DA 5EQ0A 2JK8A 2XTIA 3HKSA 3F2DA 2PNRC 4K8JA 3G6EA 1PHJA 4C3JH 5J39A 1YNNC 4ZYSA 1SMYC 1TS2A 4IUQA 4RWSC 2GN5A 1STBA 1OTCA 4NXNQ 1FJGL 2NVXB 4UP9A 1WTHA 1A3VA 4LWCA 4A3LG 2VNUD 3N6RA 2KCNA 2A6HC 1R4QB 2NZHA 1ICFB 2F0WA 4JV5L 1JMCA 1SNOA 1HRJA 1CQVA 5IP7H 2RSOA 3OTOL 2ZM6Q 1U4LA 3TP7A 3AFQA 5M5YB 3MFYA 3TP5A 5IGBA 3IKJA 2VUMH 1BXTA 2FINB 3H3VI 1X65A 2R92B 5DEHA 1WTVA 5IYDG 1GUOA 3VR5A 4F87A 2B39A 1B44D 4A3JH 4EGVA 3NTHA 2HDLA 4OO1G 1JICA 1X3EA 4I7ZC 3AB9A 4NDXA 1S5ED 3NBHA 1A2TA 1PRTB 3U4ZA 2DY7A 2B8GA 1PZKD 1TR5A 3G6JB 4AYBB 3EN2A 4NP5A 1I6VC 4DK6C 2K1BA 2DJGC 2IL8A 2F0NA 2PMZE 5ELDA 1HHVA 2CW0D 2D0PA 3K80C 1EOVA 2HUGA 3W1GA 2HIVA 2G5DA 5IYBH 4GLXA 1YJWA 2F0UA 1YBYA 4O42A 2IHFA 4L63B 3MXNA 1IL8A 4HJ9A 3CCSA 5COYA 2K01A 4KKTA 1HFNA 2PW5A 4ZKCB 3A7LA 1UE5A 4IUVA 1P8LA 1UE1A 1UE6A 3STBC 4JBJA 1B70B 1EY6A 4JI2L 1O78A 2I46A 1IYVA 3KK7A 2R93G 2F0LA 5KIXA 2QDLA 5HY6A 5BR8L 2EJMA 4B3ML 4X62Q 1V1PB 5FJ8G 1IW7C 4K2LA 2YTVA 3GTGH 2PZWA 4DR4Q 2JA8H 4RGNA 5C4XH 1I4RA 4WJ3M 3S1NH 1Z47A 1CZGA 3D6WA 4DUYL 1X54A 5EAYA 2UXCL 2D5DA 1CFMA 1F9PA 1RTNA 2MJ8A 3I72A 1KNEA 1F2MA 4ZCKA 4X66L 3HOWH 5E4XA 1Z6HA 4G7ZC 1J5EQ 3I90A 2ICEC 2WP8J 1KQSA 3M4PA 1H9RA 4A3KG 4KTAA 3GV6A 4BXXG 1QUQA 1I94Q 4LF4Q 4X64Q 3QIAA 4IN3A 2L55A 3J81j 2IWHA 2JJQA 4DV4Q 3W5OA 1MGSA 4PG3A 4A4IA 2E76C 3S1MB
chains in the Genus database with same CATH topology
3S15B 1I4GA 4PMWA 3DM1A 5KNCA 2M00A 5C0XG 5D3DA 1PFBA 1AZPA 4DK1A 4FYDA 2LFNA 2PYKA 3I70A 4IUUA 1LTBD 2BA0A 3UI2A 2NWGA 3NBIA 4KJOA 4H13C 2FFKB 1KLUD 4OIKA 2MUYA 2E75C 2K5QA 3BYTB 3M7NA 1D1KA 3I73A 2A73B 3KUPA 1V1OA 4HR7B 1DJRD 1NSNS 2E2HB 5EKLA 1CHPD 2EYLA 5E3FA 2RDGA 3BDOA 1U9RA 4K6DA 4RKLA 2RDHA 5JAVA 2LY7A 3E6ZX 2KECA 4FF2A 4KK7A 3HGBA 4C3JB 1EEFD 4DF7A 2PMZB 3QB3A 3SVMA 2QKIC 1DOLA 3QOLA 3BZDB 2NVQB 2F3WA 5D14A 2NZ1D 3ERQA 2NVTB 1A6XA 2ICIA 1CT1D 2CVRA 4BA2I 3NTKA 2Q8IB 5I2XA 2L4NA 1QJOA 2NBFA 2JA7B 1BOSA 3V96A 4Q5VA 3N52A 3I3CA 2Z4IA 1FYCA 3KBGA 4KI0A 4CBVA 2JSOA 2K03A 3EA6A 5FOBB 4A93B 2F0GA 2F0JA 5M3FB 4X3UA 3WOEA 1TS5A 2KUMA 2F0EA 4G7HC 2SNSA 5JEAH 4RH6A 3SK8A 1JC7A 1DONA 1PXUA 4RGOS 5EGTA 3EVQA 2F0QA 1V8QA 1PLFA 1Y1WB 1MSGA 3E5SA 1MSHA 5C3EB 3VYTA 2JE6I 3IFTA 2AQ1B 4WJWA 3T51B 3P20A 1TVXA 2B2TC 2B8FA 1Y8NB 3MFGA 1QCBD 3TSSA 2B2UA 4C1NK 1DD2A 1EZ6A 4CGYB 3PIP3 1TIID 3SK6A 1S4ZA 4ZK9B 4Y7NB 1CK1A 2KEEA 2G9DA 5A2QE 1CA5A 3OMGA 3R3OA 3KF8A 2RSNA 3S1QB 2XWBB 2NN6G 2EYHA 3Q0AA 3T4AC 3J81E 4K14A 1KLGD 4A3EB 1AFPA 1SJED 1KDCA 2AQ3B 5ELBA 2EPBA 1GXDC 2F0OA 1TWGB 5G3LF 1EWCA 1PTOD 5ELFA 1WTOA 4RHRA 4DNRB 3ITPA 3E0JA 1D5MC 4HCEA 1DXMA 2OXPA 3PO2B 1Y8OB 5M5XB 2JEBI 1GJXA 3PMFA 4KY6A 3TN2A 2R3ZA 1LT4D 4G57A 2F0VA 2WACA 1ML0D 3M3YB 2L11A 2L1BA 1B3AA 3BYYB 3SXHA 5KYIA 1B1ZA 1SYCA 3K5NA 1JWMD 2K33A 4RFBA 2EJGC 1GHJA 1AZQA 5JJZA 1B50A 5CV4A 3O13A 4PNYA 1F2LA 3RUZA 3HOVB 1LTGD 3BDLA 3SK5A 3QG1A 5A35A 2K28A 3D4DA 4QUFA 4H0LC 1ICWA 1SE2A 1STYA 1W6JA 5BN3A 3PIO3 1PTOF 3K57A 3K7AB 3PO3B 2EYJA 1ONLA 2WKDA 1IKLA 3X3NA 1JOKA 2PCFB 5C3XA 2TSSA 3MEHA 3GTQB 1B9NA 1NAPA 2L12A 3DHQA 5CBEE 3HKZB 3U9OA 3MC0B 1CHQD 4XQNA 5IT9E 3QO2A 3VA5A 1LTID 4HN7A 1EY4A 2MGSA 4CHTB 2JEAI 3DWQA 3MXUA 5JPMC 3TZUA 1VMCA 1ILPA 3DWPA 1JR0D 4PMBA 1FGBD 4XTCS 1SYGA 1A15A 3S2DB 2BDNA 3I91A 3K0YA 5I2YA 3VR6A 2F0SA 4H44C 1EIGA 3C2PA 2WAQB 2XRSD 2NB0A 1SNMA 2L0CA 5E1FA 1VDZA 3PUZA 4ABNA 2CHBD 1IYUA 3LNNA 1JB3A 4RCNA 4GZYC 1XWEA 5J22A 2JA8B 3FPPA 4OGQC 1GUTA 4NKLA 2QEJC 3HEJA 1SBBB 4N9TA 2VB2X 4K5XA 4LK1C 1PYWD 4V0BA 4DFAA 2FMMA 1A2UA 5M5WB 1LLRD 1RTOA 5DNFA 4YIJA 3D8GA 4TSSA 4A3FB 3S1RB 3VYRA 4EQOA 2PO4A 3BG3A 2C5CA 2F0PA 4KN7C 3K59A 1AW7A 3HOZB 1TWHB 1GUGA 4IFDG 2Q8TA 2I07B 3K6OA 2XRQD 4HMIA 1SYDA 3URYA 1WTWA 1UEAB 2FJ2A 3NWSA 5KEEA 1TWAB 3J7AV 1Q8IA 4KMUC 2B2TA 4ZQ3A 1HCZA 4C3JG 4C3HB 3S14B 4RAUC 2R7ZB 3H91A 1PTOB 1SXTA 2A68D 2D62A 4U68A 2N88A 4NW2A 3LX0A 3MXGA 5IOCA 5CC4A 2KCCA 4ZUJA 4DNTB 1EYDA 1F2YA 2F0DA 1CZWA 4PMCA 3DMUA 1S5BD 4LJZC 2PQEA 2VUMB 3X3MA 2O2LD 3PUWA 4XT3B 4PQXA 2EY2A 2H4OA 1SE4A 4FNFA 1WD1A 3RD4A 5M9OA 1QILA 4DAPA 1LTRD 1LT3D 4C3HG 4UAIA 1PRTF 1U4MA 1Q12A 4KJNA 1EWHA 3OOCA 5JVH3 1Y69U 4F8MA 1QNKA 1MBYA 4BY1B 3CU7A 3SE0A 1LV9A 5KNBA 4FF3A 1TT2A 1LABA 5JVG3 5HGTA 1CI3M 1SYEA 5JOBA 5CMDA 5CORA 3S9WA 5IGEA 1BBXC 1STHA 3HRZC 2NN6I 5FLXL 2WIIB 3RMHA 2B2VC 2FMCA 5LHY1 1SE3A 3FKIB 4R8IA 1GUSA 4HSPA 3V2TA 4BS9A 1SFOB 5C4XB 1EL0A 4QMGA 3A8IE 4RGMA 3EROA 3DXJC 1DM0B 3BVMA 2B63B 3U9SA 3MVVA 5J1ZA 3AU7A 1AN8A 3HOWB 1TU2B 1RHPA 1R4PB 3A7AB 4TKOB 2NTSA 1YNJD 3J81L 1PTOH 1TWFB 1DYQA 4LMQD 1LO5D 1JWSD 3EJIA 4WORA 5EKIA 4HTHA 3IAYA 4QCLA 2HCIA 3M85A 2L5TA 1SDFA 2EY1A 5BN4A 1WTXA 2O5JC 4A3GB 1PTOC 4KY7A 5C6AA 1RD9D 1GHKA 4UDUC 2ID0A 5CV7A 1S5DD 4HEDA 2L9HA 4HCSA 4RCOA 3NQTA 2QCPX 1D2BA 3C1FA 3FEWX 4CKCA 3H09A 5C5LA 4G4KA 4KD4A 4CKEA 4FO2A 1IKMA 2LS01 3PUVA 1ESRA 4BY7B 2F4IA 3HOUB 4C1NI 3VA7A 1S5CD 5JEAJ 2F0MA 4KD3A 3J80L 3TMEA 1F77A 3NXWA 1X3PA 5AFWA 1DCZA 1ZKOA 5D65A 4KKUA 3KLSA 2A6HD 2EJFC 1JCKB 4DXGA 2XSCA 4B9WA 4FP5D 2X6LA 1SMYD 3VR2A 4XIGS 1SNPA 1Y1VB 3HP3A 1E2ZA 3TDQA 4MN3A 1STAA 1LACA 1C48A 1D6EC 2EXZA 1J8IA 2QDBA 2A6EC 3KLRA 4EQNA 2NTTA 3QWNA 3ONAB 3Q6SA 2EOTA 2IX3A 2Z1CA 1EEID 2MPMA 4DK0A 2F0HA 2ENBA 2C9OA 2JA5B 1I6HB 2PZTA 2E2DC 2ZXRA 1BQQT 5D3IB 1CTMA 1STEA 3SR1A 1BCPB 3OMCA 3W2DA 2LMCB 1H9JA 5EBCA 2K6AA 2NVYB 1CA6A 2SNMA 3CRKC 1X3QA 2O4XA 2K7VA 1SSOA 5K36H 3K5LA 4WFN3 1F9SA 1B2TA 1WCMB 1ZXTA 3KBXA 3P7JA 4QB4A 5BN5A 3TP6A 2DY8A 3GTMB 5KGUA 3FDTA 1K8OA 2R61A 1V1PA 2ZT9C 1JWUD 1ET9A 2J7ZA 5TSSA 2VB3X 2IPKD 4KKSA 4WRDA 2XN9C 1HQMC 1JOQA 2KOLA 2B2WC 4XT1B 4IUPA 1DZ1A 3DEOA 3ZYYX 2XVSA 2YU9B 1DOMA 1HTLD 4TQUS 2SOBA 5DM63 1WVLA 1TWCB 4IUTA 2Y0SB 3SHLA 1F2ZA 3DUZA 1ESFA 4CJ2C 2RKSA 2EYFA 3Q23A 3C46A 4ZRZA 1TS4A 1SNQA 4XQQA 1OXSC 4ULLA 5IODA 1AP0A 1GOZA 1O7ZA 1FD7D 2F0IA 2A74C 3A54A 3JAML 3J7AF 3H3VC 3QOJA 1JOOA 4R9WA 4HAEA 2MHVA 1UNSA 3NQIA 2YYZA 4DGZA 4XYQA 1XTCD 1O80A 3BVGA 3J7YW 1GUWA 1RCVD 4XQJA 1TQOA 5CYUA 2F3VA 4RHSA 3GTJB 4JK1C 1EIHA 4CJ0B 1PZJD 2AWOA 4B9XA 1B9MA 2KEDA 4FF1A 3K5OA 4DAYA 1PZID 3OW7A 1H9KA 4M8AA 5EBDA 1VCIA 1FNWA 1UAPA 4OIJA 3NTIA 2EY6A 1Q3LA 2XWJB 4MIUA 5EPKA 1KTKA 3V05A 1WTPA 4CKBA 2EY5A 1Z7TA 4J6HA 3NUCA 3R2TA 2AUKA 5JEAG 4RKBA 2EYPA 5IGDA 5I4DA 1RJTA 1C4QA 4X3SA 1R9TB 1H9SA 2G9HD 4K5WA 5CV9A 1BF4A 4K6LA 1LTAD 5FO7B 5K36G 2VXWA 4G7OC 3CHBD 1I4XA 2RBMA 1K8MA 5IGCA 1BUVT 1KNAA 4BA1I 5CBAE 1I4QA 4QF4A 2H1EA 3MWYW 1LTTD 3LWUA 4PV1C 1YNJC 2K04A 2K5WA 5IGFA 4MHEA 4DA2A 4ME5A 1QG7A 4RA8A 4B08A 1HUMA 1HUNA 1QB5D 4J8QA 1YNND 3T53B 3I4NB 3S1NB 4BWGB 1JE4A 4IQZA 1C8CA 1ENCA 1L0YB 5C3WA 4L6TB 3S17B 2RQXA 3OIPA 5EJWA 2KQ3A 2GA4B 4ZKBB 1A3TA 5T1GA 1F9RA 1RF2D 1I50B 5A2QL 4XXEA 3BS1A 3FPUB 5JPNC 4IFDH 4LAAA 1KDBA 3H6MA 3HZXA 4ILWA 2EE1A 4DAVA 4F88A 1WTRA 5ISRA 1KDAA 5CGKA 1OO9B 4NMZA 1PDQA 2QF7A 3FVQA 3H0GB 4I65A 2TMPA 3GO5A 2N55A 2M9VA 1PRTD 1FR3A 1I3QB 3RZDB 1ENFA 2BA1A 2DNEA 2HCCA 4A3IB 3R93A 2OF1A 4FVMA 5C0XI 1EYAA 2JXMB 1PFNA 1ILQA 2F0FA 1NCVA 5C4ZA 1B53A 2FHTA 5I9PA 1BCPF 3S2HB 1TS3A 3BDCA 2RDFA 4DU9A 2EYMA 5NUCA 3GTKB 4K5VA 2RA4A 3C1EA 1LT5D 1QNUA 3RZOB 1M4VA 1EQTA 1EU4A 4S3SA 3PV0A 1M8AA 3HG9A 2IX0A 5E4WC 3L9AX 3HS0C 1U4RA 1Q1BA 4KHVA 3OPOA 1L0XB 3CKIB 1VMPA 1TKWB 3TP8A 3MAQA 3P1HA 4P2CB 1EY8A 1EQVA 1RDPD 3D4RA 1MI2A 4C3IB 4IALA 3CQZB 2A6ED 2F0KA 2XIWA 3HOXB 2MP1A 4K8IA 4EVOA 1JORA 5C0XH 4A3MB 4KY5A 5LL6S 3K58A 3HOYB 1BNZA 2AUJD 5T1IA 3PUXA 3EFXD 1BDOA 5IIFA 3FMCA 4IFDJ 2EDGA 4U673 4KHZA 3MTSA 1EY0A 5I6WA 1MD2D 3Q24A 5C44B 2KVMA 2E2IB 2ZXOA 2OEOA 2IT1A 1QE6A 3BVZA 1XXGA 3M4YA 2B2YC 2B2YA 2IJ0A 3FRPB 4KV6A 5I6YA 2K32A 1H9MA 2DNCA 2A5HA 3TZDA 4C2MB 3W3AA 1TY0A 2QILA 4A3BB 2A69C 1BR9A 2BOSA 5FKAC 2LKVA 1S5FD 3L7ZC 5IGGA 3GV3A 2NUCA 1FNUA 2BDOA 3GTPB 1D5ZC 3DWAA 3AMUA 1CM9A 1OXUA 4XYOA 4IUNA 4F7XA 3C3LA 1BCPD 1KABA 2PPBC 1SYFA 5FO8B 4V190 3DEPA 1G91A 2WV6D 1IW7D 3I4LA 2PW7A 1FNVA 3SDZA 4OO1I 4FXKC 2B2VA 3JAME 4EQPA 1ENAA 5C4HA 1EU3A 5EKKA 4JBWA 3T16A 1O7YA 1K83B 1PFMA 1RODA 2OT2A 2CW0C 1G2TA 4R8NA 3Q22A 2X6GA 3F2UA 2ZXPA 2BE5D 2F1MA 1HXYD 1RKNA 1Q1EA 3A8JE 3S16B 5C4JB 2WINB 4E6IA 2RVLA 2HDMA 1HA6A 4HSVA 2F0TA 2EVBA 4FXGC 3MZ5A 1PRTC 1XX8A 1PMRA 1D1IA 1HQRD 5FO9B 4A3DB 1X32A 1Y8PB 3H94A 4M1UB 1STNA 1W6KA 3OWEB 3QJYA 4OHJA 4IFDI 1KAAA 1SNDA 1BO0A 4H7BA 2D2CC 5LL6X 3R2IA 2SDFA 1A3UA 3WOFA 2BE5C 3G7LA 1I4PA 3NE5B 5CV6A 5M3MB 1WD0A 2Q8RE 1VF7A 3NK9A 1LT6D 1NR4A 3M4OB 5C5MA 2CQAA 4HMJA 4CJ1B 3VYSA 5ELCA 4X3TA 2R93B 3LWEA 4DN4M 1G291 4K2KA 3OWFA 4N9PA 2A68C 3GTOB 5F2DA 1NR2A 5FLXE 2JP1A 4C56C 5CR3A 5G3LD 2NN6H 1IHZA 3GQBA 5DM73 3D3RA 4Q0FA 3NPPA 3K5MA 1J9OA 4KN4C 1HFGA 1F9QA 2DN8A 4A3KB 1QOHA 4RGTA 2IX1A 4BBSB 2X69A 1BCPC 3CRLC 2JA6B 2Z8LA 1G2SA 3PUYA 2NYZD 3VR3A 4QIWB 1E0BA 1ET6A 4J1MA 1EFID 1STGA 4L8JA 1HPCA 3D31A 1E2WA 1I4HA 3R8BA 3WDNA 3A8KE 4TRDA 1UUPA 1EY7A 5CV5A 3OHXC 3VR4A 3OIQA 4QUCA 3TBIB 3GTGB 5HURA 2D9UA 2WKCA 3VYUA 5KNDA 2JYOA 5DAUA 5CV8A 1ZYRD 4IZ8A 3I4MB 2XNAC 3SK4A 1E2VA 3OSOA 4BBRB 1OXVA 5K5PA 4IURA 2A69D 2WB1B 2KHSA 2R6GA 2AWNA 3NHHA 4XDXA 4X3KA 2PZUA 1ZEQX 5C0XJ 4ODGA 3T13A 1GUNA 2AQ2B 3KLSX 1EY5A 1VF5C 1SNCA 5KYLA 1II3A 1SEBD 3P75A 3ND8A 1T5EA 3I8ZA 3J80E 5EPJA 3EQLC 2Z4HA 1OXTA 2SEBD 5ELEA 3NP8A 1XYIA 3D6CA 4OL7A 3NWTA 5I9OA 1QWYA 4OO1H 2B2WA 4FXDA 1CQFA 4DXFA 3NSWA 1G8ZD 2M2LA 1O7LA 3MA2B 2BCOA 1AEXA 1EZ8A 3MXPA 4A3JB 3MHBA 4C3IG 2HQEA 1Q90A 4O1NA 2J0TD 1NUCA 4ZUIA 1U4PA 1V43A 2E2JB 1ZYRC 2KJXA 4ID6A 3IL8A 5KRUA 2F03A 1OXXK 4ZAIA 1G6ZA 3D4WA 2IW3A 3T56B 1JQYD 1D5XC 1HTPA 3GP7A 1H9SB 2EZVA 2K05A 3A55A 4ZLTF 3GD7A 3SEBA 1EY9A 1LTSD 3L3OC 2O5IC 3IFDA 1T5XD 1EOTA 3M7GA 1SYBA 5FK9C 3ND9A 1WTQA 4FF4A 4Z9CB 5IT9L 1TY2A 2V4DA 3GTLB 1DOKA 2EYOA 3A56A 1HA5A 1EYCA 1SJHD 3RLFA 1B4OA 2B2UC 2KA7A 1SAPA 2E74C 2J4XA 2K5DA 5EPLA 5EQ0A 2PNRC 4K8JA 5J39A 4ZYSA 1YNNC 1SMYC 4RWSC 1TS2A 4IUQA 2NVXB 1STBA 1A3VA 2VNUD 3N6RA 2KCNA 2A6HC 1R4QB 2F0WA 1SNOA 1HRJA 1CQVA 2RSOA 1U4LA 3TP7A 5M5YB 3MFYA 3TP5A 5IGBA 3IKJA 1BXTA 2FINB 2R92B 5DEHA 1WTVA 1GUOA 3VR5A 4F87A 2B39A 1B44D 4EGVA 3NTHA 2HDLA 4OO1G 1JICA 4I7ZC 3AB9A 4NDXA 1S5ED 3NBHA 1A2TA 1PRTB 2DY7A 2B8GA 1PZKD 1TR5A 4AYBB 3G6JB 4NP5A 1I6VC 2K1BA 2IL8A 2F0NA 5ELDA 1HHVA 2CW0D 2HUGA 2F0UA 4O42A 4L63B 3MXNA 1IL8A 5COYA 2K01A 4KKTA 1HFNA 2PW5A 4ZKCB 3A7LA 4IUVA 1EY6A 1O78A 2I46A 1IYVA 3KK7A 2F0LA 5KIXA 2EJMA 1V1PB 1IW7C 4K2LA 2PZWA 4RGNA 1I4RA 1Z47A 1CZGA 3D6WA 2D5DA 1CFMA 1F9PA 1RTNA 2MJ8A 3I72A 1KNEA 1F2MA 5E4XA 1Z6HA 4G7ZC 3I90A 2ICEC 2WP8J 1H9RA 4KTAA 3GV6A 3QIAA 4IN3A 2L55A 2IWHA 1MGSA 2E76C 3S1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9R A;  1VMP A;  2J7Z A;  1NR4 A;  2HDL A;  3I91 A;  1WTO A;  1EL0 A;  1X3P A;  4QUC A;  1JIC A;  1Q3L A;  3IL8 A;  5AFW A;  2D9U A;  1MI2 A;  5D65 A;  4X3U A;  5EPK A;  4ZAI A;  2JYO A;  2KUM A;  1G6Z A;  1EIG A;  4CJ1 B;  1WTP A;  3DM1 A;  2DY7 A;  3FPU B;  2B2V A;  2XIW A;  4X3T A;  3TN2 A;  2R3Z A;  1PFB A;  3LWE A;  2MP1 A;  4RAU C;  1AZP A;  3H91 A;  1DON A;  2KOL A;  2EE1 A;  2B2W C;  2K1B A;  4XT1 B;  4DN4 M;  4IUP A;  2IL8 A;  2X6L A;  4U68 A;  1DZ1 A;  3DEO A;  4IUU A;  1O7Y A;  1HHV A;  2N88 A;  1ML0 D;  4NW2 A;  1BNZ A;  3UI2 A;  2K05 A;  2NWG A;  5T1I A;  1WTR A;  2L11 A;  4ZLT F;  1PFM A;  1PLF A;  2HUG A;  1B3A A;  2L1B A;  1MSG A;  1RJT A;  1ROD A;  1DOM A;  3HP3 A;  1PDQ A;  4X3S A;  3IFD A;  2FFK B;  4IUR A;  1RHP A;  4MN3 A;  1EOT A;  4O42 A;  1MSH A;  1WVL A;  4OIK A;  1G2T A;  4IUT A;  2N55 A;  2X6G A;  1IL8 A;  1NR2 A;  3MTS A;  1WTQ A;  3F2U A;  5COY A;  2JP1 A;  4LMQ D;  4XDX A;  4X3K A;  1J8I A;  3KUP A;  2K01 A;  1HFN A;  1BF4 A;  4ZKC B;  4CJ2 C;  2KVM A;  1TVX A;  4IUV A;  2B2T C;  5JJZ A;  1AZQ A;  1B50 A;  3ONA B;  3Q6S A;  4XT3 B;  5EKI A;  1F2L A;  1DOK A;  2VXW A;  2EOT A;  2HCC A;  1QE6 A;  3R93 A;  2HCI A;  2MPM A;  1WD1 A;  2B2Y C;  2B2Y A;  2B2U A;  1PFN A;  2K28 A;  2RVL A;  1SDF A;  2HDM A;  4QUF A;  3I8Z A;  1AP0 A;  1HA6 A;  4HSV A;  5EPJ A;  1ICW A;  1J9O A;  2FMM A;  1HFG A;  1WTX A;  1ILQ A;  1B4O A;  1F9Q A;  1KNA A;  1O7Z A;  1RTO A;  1S4Z A;  2B2U C;  2KEC A;  5DNF A;  1NCV A;  1SAP A;  4ZK9 B;  5CBA E;  4UAI A;  3TZD A;  1B53 A;  2H1E A;  1U4M A;  3MWY W;  1XX8 A;  2FHT A;  2KEE A;  2X69 A;  4HED A;  5EPL A;  5EQ0 A;  1XYI A;  2L9H A;  3D6W A;  4HCS A;  3SVM A;  1IKL A;  1DOL A;  4R9W A;  1QNK A;  1CA5 A;  4HAE A;  2K04 A;  1G2S A;  2RSN A;  4MHE A;  5D14 A;  1LV9 A;  2NZ1 D;  1CA6 A;  2NYZ D;  1F9P A;  1RTN A;  1X3Q A;  1O80 A;  1QG7 A;  1X32 A;  1SSO A;  1GUW A;  2RA4 A;  2MJ8 A;  4IUQ A;  3GV3 A;  1NAP A;  1KNE A;  2L12 A;  4RA8 A;  1HUM A;  1F9S A;  4RWS C;  5CBE E;  2B2W A;  1HUN A;  1EQT A;  2CVR A;  5E4X A;  1E0B A;  3I90 A;  1B2T A;  5CMD A;  5COR A;  2M2L A;  1CM9 A;  1BBX C;  1IKM A;  2L4N A;  1ZXT A;  3KBX A;  3P7J A;  1JE4 A;  1EIH A;  1BO0 A;  4CJ0 B;  3QO2 A;  1HRJ A;  2RSO A;  2Q8T A;  1C8C A;  1U4L A;  3GV6 A;  2EPB A;  1ESR A;  1M8A A;  2SDF A;  2B2V C;  2KED A;  2MGS A;  1WTW A;  2FJ2 A;  5EJW A;  2DY8 A;  5E4W C;  3DEP A;  2FIN B;  3G7L A;  3N52 A;  1ILP A;  1VMC A;  3I3C A;  4ZKB B;  1G91 A;  5T1G A;  1MGS A;  1U4P A;  4R8I A;  3FDT A;  1WTV A;  1U4R A;  1WD0 A;  2K03 A;  1A15 A;  2Q8R E;  4OIJ A;  2BDN A;  2B2T A; 
#chains in the Genus database with same CATH topology
 2L15 A;  5E7N A;  4LUZ A;  3S15 B;  2F3I A;  1I4G A;  1E1O A;  1A8V A;  4PMW A;  3DM1 A;  5KNC A;  3NBH B;  2M00 A;  5C0X G;  5D3D A;  2QA4 A;  4GNX B;  5C3E H;  1PFB A;  1AZP A;  4DK1 A;  4UHV A;  4FYD A;  2PQA B;  2LFN A;  2PYK A;  3I70 A;  4IUU A;  1LTB D;  2BA0 A;  3UI2 A;  2NWG A;  5GQO A;  4DV5 L;  3AEV A;  3NBI A;  4KJO A;  3F1Z A;  1XNR L;  4GN3 B;  4GOP A;  4H13 C;  1K0R A;  2FFK B;  2UUA Q;  1KLU D;  4OIK A;  5IYD H;  4LF9 L;  2MUY A;  2E75 C;  4CDD C;  1KL9 A;  2I5H A;  2K5Q A;  3BYT B;  3M7N A;  1D1K A;  1PYB A;  2A73 B;  3I73 A;  1FL0 A;  3KUP A;  1V1O A;  3CC4 A;  4HR7 B;  1DJR D;  1NSN S;  4P74 A;  5IE8 A;  2JA6 H;  2E2H B;  5EKL A;  1CHP D;  2EYL A;  2R7Z H;  2A1A A;  4PZ8 A;  2RCN A;  5E3F A;  2RDG A;  3BDO A;  3UDI A;  1U9R A;  4K6D A;  4JBK A;  4RKL A;  2RDH A;  5JAV A;  2LY7 A;  2HIX A;  3E6Z X;  1WI5 A;  4OEM B;  2KEC A;  4FF2 A;  4KK7 A;  3CCE A;  3KLW A;  3HGB A;  4C3J B;  1EEF D;  1VQ4 A;  4OX9 L;  4DF7 A;  2PMZ B;  3I4N G;  4CDE C;  1PH3 A;  3QB3 A;  3SVM A;  2QKI C;  4LF9 Q;  1DOL A;  3QOL A;  3BZD B;  2NVQ B;  2F3W A;  4DV2 Q;  1VQ9 A;  5D14 A;  2NZ1 D;  3ERQ A;  2NVT B;  4OWX B;  1Y1W G;  1A6X A;  1MHW C;  2ICI A;  1CT1 D;  3QR8 A;  1CKM A;  3UDX A;  2CVR A;  4UP8 A;  1VQ8 A;  4BA2 I;  3NTK A;  2Q8I B;  4NXM Q;  5I2X A;  2L4N A;  1QJO A;  1MKH A;  2NBF A;  4P71 A;  3TRZ A;  4A3C G;  2JA7 B;  1BOS A;  3UE0 A;  4AQY L;  3V96 A;  1L1O B;  4Q5V A;  3N52 A;  3I3C A;  3RLO A;  2Z4I A;  1FYC A;  3KBG A;  4KI0 A;  4CBV A;  2JSO A;  1E3P A;  2K03 A;  4R4T A;  2UUA L;  3EA6 A;  5FOB B;  3ERS X;  4A93 B;  2F0G A;  3PQI A;  2F0J A;  5M3F B;  4X3U A;  3WOE A;  1TS5 A;  2KUM A;  4K0K L;  2F0E A;  3RR5 A;  4OX9 Q;  4G7H C;  2SNS A;  5JEA H;  4LFC L;  3PGZ A;  4RH6 A;  2RHQ B;  1JC7 A;  3SK8 A;  1DON A;  1PXU A;  4RGO S;  5EGT A;  2UXB L;  3EVQ A;  1KXL A;  2F0Q A;  1V8Q A;  1PLF A;  1Y1W B;  1MSG A;  2WB1 E;  1A62 A;  3CAM A;  3E5S A;  1MSH A;  5C3E B;  1V9P A;  3VYT A;  2JE6 I;  3IFT A;  4A3J G;  2AQ1 B;  4WJW A;  3T51 B;  2E5L L;  1EQQ A;  3P20 A;  4DV2 L;  4IPD A;  1TVX A;  2B2T C;  2Q2I A;  2B8F A;  4LW1 A;  3CCV A;  2CH4 W;  2E8G A;  1Y8N B;  2BH8 A;  3MFG A;  1QCB D;  1PH1 A;  3TSS A;  2B2U A;  4C1N K;  1DD2 A;  1EZ6 A;  4CGY B;  3PIP 3;  1YEZ A;  3GTP H;  3S17 H;  1TII D;  4GLA C;  3SK6 A;  1TWA H;  2K5V A;  1C7Y A;  1S4Z A;  1K3B C;  4ZK9 B;  1N36 Q;  1K3R A;  4Y7N B;  1CK1 A;  1QVF A;  2KEE A;  2G9D A;  5A2Q E;  1CA5 A;  3OMG A;  3R3O A;  3KF8 A;  2RSN A;  2UXC Q;  2N8N A;  1CSP A;  3S1Q B;  1I50 H;  1HZB A;  2XWB B;  2NN6 G;  2EYH A;  3Q0A A;  3T4A C;  3AQQ A;  3BU2 A;  3J81 E;  4K14 A;  1KLG D;  4A3E B;  2UU9 Q;  2R93 H;  1AFP A;  1SJE D;  1VQE A;  1LM0 A;  1KDC A;  2AQ3 B;  2KCT A;  5ELB A;  4B3T L;  2EPB A;  1GXD C;  2F0O A;  2FXQ A;  1TWG B;  3L0O A;  5G3L F;  3S15 H;  3I56 A;  1EWC A;  1PTO D;  2P5Z X;  4A3M G;  1PYS B;  1YHB A;  5ELF A;  4DV3 Q;  1IBL L;  1WTO A;  4RHR A;  4JW0 A;  4DNR B;  1NE3 A;  3ITP A;  2HT1 A;  3E0J A;  1D5M C;  4HCE A;  1YHQ A;  2JA6 G;  3CCL A;  1DXM A;  2B3G A;  4DKA C;  1N33 Q;  2OXP A;  4LUV A;  3PO2 B;  1Y8O B;  5M5X B;  2JEB I;  1GJX A;  3PMF A;  4KY6 A;  3TN2 A;  2R3Z A;  1LT4 D;  1X55 A;  4A3K H;  4G57 A;  3UE1 A;  4DV0 Q;  4A93 H;  2F0V A;  2WAC A;  3S16 H;  1ML0 D;  3M3Y B;  2L11 A;  4A3G G;  2L1B A;  1B3A A;  2UUC Q;  2QW7 A;  3BYY B;  4L5R C;  1L1O C;  1HZ9 A;  3SXH A;  2K52 A;  4DUZ L;  4AH6 A;  5KYI A;  1B1Z A;  1SYC A;  3K5N A;  1JWM D;  2K33 A;  4RFB A;  4B3R L;  2EJG C;  5JJI A;  1GHJ A;  1B3Q A;  2E5L Q;  1AZQ A;  5JJZ A;  2K75 A;  1B50 A;  5CV4 A;  2KCM A;  3O13 A;  4PNY A;  1F2L A;  3RUZ A;  3HOV B;  1LTG D;  4DUY Q;  3BDL A;  3BZC A;  3SK5 A;  3QG1 A;  5A35 A;  1PH9 A;  1Y1V G;  1SE8 A;  1NJI C;  2N78 A;  2K28 A;  3D4D A;  1HZA A;  1SN8 A;  4QUF A;  4H0L C;  1JJC B;  1ICW A;  1SE2 A;  1STY A;  5M3F G;  1T9H A;  1W6J A;  5BN3 A;  3PIO 3;  4LF7 L;  1PTO F;  3K57 A;  4BY7 G;  3K7A B;  1EYG A;  3PO3 B;  2EYJ A;  1ONL A;  2WKD A;  1IKL A;  2VS1 A;  3X3N A;  2R7D A;  1JOK A;  4A3I H;  2PCF B;  5C3X A;  4DAY B;  1U0L A;  2TSS A;  3MEH A;  3GTQ B;  1B9N A;  1NAP A;  2L12 A;  3DHQ A;  5CBE E;  5AJ3 L;  2JA5 G;  4LF7 Q;  3HOX H;  3HKZ B;  1A63 A;  1KD1 C;  3U9O A;  3MC0 B;  3E3X A;  1CHQ D;  4XQN A;  5IT9 E;  3QO2 A;  3SGI A;  4R4O A;  1LTI D;  3VA5 A;  4HN7 A;  1EY4 A;  2MGS A;  4JI7 L;  4CHT B;  3GTK H;  3DWQ A;  3MXU A;  5JPM C;  2JEA I;  5AJ3 Q;  3TZU A;  1VMC A;  2Y0S E;  1ILP A;  4GKJ L;  4MTK A;  3DWP A;  1JR0 D;  3RZO H;  4PMB A;  1FGB D;  4XTC S;  1SYG A;  1A15 A;  3S2D B;  2BDN A;  3I91 A;  3K0Y A;  1HNX L;  4YWM A;  5I2Y A;  1HR0 Q;  3VR6 A;  2F0S A;  4H44 C;  4DR5 Q;  1EIG A;  3C2P A;  2WAQ B;  2XRS D;  3HFZ B;  2NB0 A;  1SNM A;  2L0C A;  5E1F A;  3A0J A;  1VDZ A;  3PUZ A;  1Y14 B;  4ABN A;  2CHB D;  3GTM H;  1IYU A;  2Z6K A;  3LNN A;  4JI0 Q;  1JB3 A;  4RCN A;  4GZY C;  4TVA B;  5M3M G;  1MJC A;  1XWE A;  2K4K A;  5J22 A;  2JA8 B;  3FPP A;  4OGQ C;  1GUT A;  1VQM A;  1M1K C;  4NKL A;  1N36 L;  4B3S L;  2QEJ C;  3HEJ A;  1SBB B;  2OQ0 A;  4IPH A;  4N9T A;  1GO3 E;  4N8F A;  2VB2 X;  4K5X A;  4LK1 C;  1O7I A;  1PYW D;  2VW9 A;  4R4I A;  4V0B A;  2ZTC A;  3KF6 A;  4DFA A;  2FMM A;  1A2U A;  5M5W B;  3PO2 G;  1LLR D;  1RTO A;  5DNF A;  4YIJ A;  3D8G A;  4GN4 B;  4TSS A;  4A3F B;  3S1R B;  3VYR A;  4EQO A;  2I0Q A;  2PO4 A;  3BG3 A;  2C5C A;  1PFS A;  2F0P A;  4JPB W;  4KN7 C;  2GVA A;  3K59 A;  3CME A;  1WJJ A;  4OON A;  2ATW A;  1AW7 A;  1X9N A;  3HOZ B;  1TWH B;  1GUG A;  4IFD G;  3ULL A;  2Q8T A;  2I07 B;  3F2B A;  3K6O A;  2XRQ D;  4HMI A;  1SYD A;  3URY A;  1WTW A;  1UEA B;  4LF6 Q;  1KC8 C;  2FJ2 A;  3NWS A;  5KEE A;  1PH2 A;  4RG1 A;  3I7F A;  1TWA B;  3J7A V;  1Q8I A;  4KMU C;  2B2T A;  3GTL H;  4ZQ3 A;  1HCZ A;  4C3J G;  4C3H B;  2JA5 H;  1EIF A;  4JI3 L;  3IRB A;  4IPG A;  3K7U C;  4EQ5 A;  3L2P A;  3S14 B;  4RAU C;  3S2D H;  2R7Z B;  3H91 A;  1PTO B;  1TWF H;  1WYD A;  5LMN L;  1SXT A;  2A68 D;  2D62 A;  4U68 A;  3TS0 A;  2N88 A;  4NW2 A;  1XPO A;  4LFB L;  2MO0 A;  3LX0 A;  1I94 L;  1G51 A;  3MXG A;  5IOC A;  5CC4 A;  4DR5 L;  2KCC A;  4ZUJ A;  4DNT B;  1EYD A;  1AE3 A;  4FDB A;  1HNX Q;  2JA7 G;  1F2Y A;  2F0D A;  1CZW A;  1EUJ A;  4PMC A;  3DMU A;  4AYB E;  1S5B D;  3H3V H;  4B3S Q;  1LYL A;  4LJZ C;  2PQE A;  2VUM B;  3PUW A;  2O2L D;  4XT3 B;  3X3M A;  2QGQ A;  4PQX A;  2EY2 A;  4DAM A;  2H4O A;  1SE4 A;  4FNF A;  1WD1 A;  3RD4 A;  4HJ8 A;  4DR7 L;  1E24 A;  1QZG A;  5M9O A;  3F8T A;  1A0I A;  1QIL A;  4DAP A;  1LTR D;  3T1H Q;  1VQB A;  1LT3 D;  4C3H G;  4UAI A;  1PRT F;  1SR3 A;  1U4M A;  1Q12 A;  5M3M H;  4KJN A;  4QJF A;  1EWH A;  3OOC A;  5JVH 3;  1Y69 U;  1XNQ Q;  4F8M A;  1QNK A;  1MBY A;  1YI2 A;  4BY1 B;  3CU7 A;  3SE0 A;  1LV9 A;  2VY3 A;  4DK3 C;  5C4J H;  3PIP A;  5KNB A;  3HOW G;  1YNX A;  4LF8 Q;  4NB3 A;  4FF3 A;  1TT2 A;  1LAB A;  2E2J H;  5JVG 3;  1S40 A;  2B29 A;  1VS0 A;  5HGT A;  3HOU H;  1CI3 M;  2CCZ A;  1SYE A;  5JOB A;  5CMD A;  5COR A;  3S9W A;  5IGE A;  1BBX C;  1STH A;  4LF5 Q;  2N3S A;  2DUD A;  5M3F H;  3KJO A;  3NEL A;  3HRZ C;  2NN6 I;  3ZJY C;  5FLX L;  2WII B;  3RMH A;  2B2V C;  2FMC A;  5LHY 1;  1SE3 A;  1TWH H;  2ZTE A;  3FKI B;  4X65 L;  4R8I A;  1GUS A;  4HSP A;  3V2T A;  2RF4 A;  4BS9 A;  1SFO B;  5C4X B;  1EL0 A;  4GKK Q;  4QMG A;  1XNR Q;  3A8I E;  1S72 A;  4RGM A;  3ERO A;  3DXJ C;  5IT9 c;  1DM0 B;  3BVM A;  2B63 B;  3U9S A;  2QEX A;  1VQA A;  3MVV A;  5J1Z A;  4QIW E;  4ALP A;  1MJE A;  3AU7 A;  2Z6B A;  5FLM H;  5GAG C;  1AN8 A;  3HOW B;  1TU2 B;  1RHP A;  1R4P B;  3A7A B;  4TKO B;  4LFA Q;  2NTS A;  1YNJ D;  3J81 L;  4Y7N H;  4LF8 L;  3NEN A;  1PTO H;  1TWF B;  1G6P A;  1DYQ A;  4LMQ D;  1LO5 D;  1JWS D;  3I4M G;  5M5W H;  3EJI A;  2JA9 A;  2K5H A;  4WOR A;  4DV6 Q;  1RIP A;  5DLQ E;  1BKB A;  5EKI A;  4HTH A;  3IAY A;  4A3F H;  3S1R H;  3CC2 A;  4QCL A;  2HCI A;  1TWC H;  3UDG A;  3M85 A;  4L5S A;  2L5T A;  1SDF A;  4O0A A;  2EY1 A;  4A3E H;  5BN4 A;  1E22 A;  1WTX A;  2O5J C;  4A3G B;  1PTO C;  1Q81 C;  4KY7 A;  5C6A A;  1RD9 D;  1GHK A;  4UDU C;  3PF4 A;  2ID0 A;  5CV7 A;  1HZC A;  1S5D D;  4JI6 L;  4JI7 Q;  4HED A;  2L9H A;  4HCS A;  3HKZ E;  4RCO A;  3NQT A;  2QCP X;  2B63 G;  1K0S A;  1D2B A;  1YVC A;  3C1F A;  3FEW X;  4JI0 L;  3PSI A;  4CKC A;  1JE5 A;  1EQR A;  3H09 A;  5C5L A;  4G4K A;  4KD4 A;  4CKE A;  3CMA A;  4FO2 A;  5IP9 H;  1R9T H;  4DV5 Q;  1VQN A;  1IKM A;  2LS0 1;  3PUV A;  4A3L H;  4GNX A;  1HR0 L;  3I55 A;  1ESR A;  4BY7 B;  4C3H H;  4B3T Q;  2F4I A;  2EQS A;  3HOU B;  4C1N I;  5IP7 G;  3VA7 A;  1S5C D;  5JEA J;  2VQE Q;  2F0M A;  4KD3 A;  3J80 L;  3TME A;  1IL2 A;  1F77 A;  2E2H H;  4LNQ A;  3NXW A;  1X3P A;  2ZM6 L;  2Z6K C;  5AFW A;  4DNI A;  2JQO A;  1DCZ A;  1ZKO A;  5D65 A;  4KKU A;  3KLS A;  3UDF A;  2YTY A;  2NVQ H;  2A6H D;  1E1T A;  2EJF C;  1VQ6 A;  1JCK B;  4DXG A;  4LF4 L;  2XSC A;  4B9W A;  4FP5 D;  2X6L A;  2OTL A;  1IBM Q;  1SMY D;  3VR2 A;  4HJ5 A;  3E9I A;  4XIG S;  4A3D H;  2UUB Q;  4YHH Q;  3NEM A;  1SNP A;  1Y1V B;  3HP3 A;  2UUC L;  2K5N A;  2RCF A;  1E2Z A;  5GRO A;  3TDQ A;  2Q2U A;  4MN3 A;  1STA A;  4JYA Q;  1LAC A;  3TS2 A;  3J81 i;  1C48 A;  1D6E C;  2EXZ A;  1J8I A;  2QDB A;  4DV6 L;  2A6E C;  3KLR A;  4O2D A;  2NTT A;  3QWN A;  4EQN A;  2CWA A;  1JB7 A;  1GD7 A;  3ONA B;  3Q6S A;  1KRT A;  4IO9 A;  2EOT A;  2IX3 A;  1X6O A;  2Z1C A;  1EEI D;  1PA6 A;  2MPM A;  4JC0 A;  3HOY H;  4DK0 A;  2F0H A;  2ENB A;  3DM3 A;  2C9O A;  1H95 A;  2JA5 B;  1I6H B;  2PZT A;  4X62 L;  2E2D C;  2ZXR A;  2LXJ A;  1BQQ T;  5D3I B;  1XTD A;  1CTM A;  1STE A;  3SR1 A;  1BCP B;  3OMC A;  3W2D A;  4UY8 C;  3CF5 A;  2LMC B;  1H9J A;  5EBC A;  4JCV E;  4JBM A;  2RHS B;  2K6A A;  2NVY B;  1CA6 A;  3CRK C;  2EXD A;  1X3Q A;  2K14 A;  2SNM A;  2D0O A;  2O4X A;  2K7V A;  1SSO A;  5K36 H;  3K5L A;  4WFN 3;  1F9S A;  1NNX A;  1B2T A;  4AIM A;  1WCM B;  3FKI H;  1ZXT A;  3KBX A;  1WFQ A;  3P7J A;  2PI2 E;  4QB4 A;  4A3B H;  3MXN B;  5BN5 A;  3TP6 A;  2DY8 A;  3GTM B;  5KGU A;  4NXN L;  3CCM A;  4HJ7 A;  3FDT A;  1K8O A;  2R61 A;  1V1P A;  2ZT9 C;  1L0W A;  1JWU D;  1ET9 A;  4DR6 Q;  2J7Z A;  4YY3 L;  5TSS A;  4HID A;  3RNU A;  1YHA A;  2VB3 X;  4GKK L;  2IPK D;  4BBS H;  1IBM L;  4QL5 A;  4KKS A;  4WRD A;  1SMX A;  2XN9 C;  3S2H H;  1HQM C;  1IBK L;  2UU9 L;  3S1Q H;  1JOQ A;  2KOL A;  2B2W C;  4XT1 B;  2R92 G;  4IUP A;  1DZ1 A;  3DEO A;  3ZYY X;  2XVS A;  3T1H L;  2YU9 B;  1DOM A;  1HTL D;  4TQU S;  2AKW B;  2SOB A;  5DM6 3;  1WVL A;  1TWC B;  4IUT A;  2Y0S B;  4AYB G;  3SHL A;  1W3S A;  1F2Z A;  4DR1 L;  3DUZ A;  1ESF A;  4CJ2 C;  4A75 A;  2OWO A;  2IY5 B;  1Y1V H;  2RKS A;  1HJP A;  2EYF A;  3Q23 A;  4DV4 L;  3C46 A;  4ZRZ A;  1TS4 A;  2R7Z G;  1K83 H;  1SNQ A;  4XQQ A;  1OXS C;  4ULL A;  5IOD A;  1NTG A;  4JOI C;  4LUO A;  1AP0 A;  3RZD H;  1GOZ A;  1O7Z A;  1XPR A;  1N32 Q;  1FD7 D;  2F0I A;  2A74 C;  3A54 A;  4I7A A;  3JAM L;  2B63 H;  3J7A F;  1XJV A;  3H3V C;  1HNZ L;  3QOJ A;  1JOO A;  4R9W A;  4HAE A;  2MNA A;  2MHV A;  3PF5 A;  1UNS A;  3NQI A;  4OEL B;  3RN5 A;  2YYZ A;  4DGZ A;  4EX5 A;  4LF5 L;  4XYQ A;  3M3Y H;  1XMO Q;  1XTC D;  2HHH L;  1O80 A;  4GN5 A;  3U58 A;  3BVG A;  3J7Y W;  1GUW A;  4HIK A;  5IP9 G;  1RCV D;  1Q46 A;  4DR2 Q;  2UXD L;  4XQJ A;  1CUK A;  1TQO A;  1C9O A;  4GLV B;  1HR0 W;  1E7Z A;  1Z9F A;  5CYU A;  2F3V A;  4RHS A;  3GTJ B;  4JK1 C;  1EIH A;  4CJ0 B;  3CCQ A;  1PZJ D;  2VUM G;  2AWO A;  4DV0 L;  4B9X A;  1B9M A;  2KED A;  4FF1 A;  3K5O A;  4A3D G;  4DAY A;  1PZI D;  1N34 L;  3OW7 A;  3CCR A;  1H9K A;  4M8A A;  1ASZ A;  5EBD A;  1VCI A;  1M90 C;  3CW2 C;  3EIV A;  1FNW A;  2NVX H;  1UAP A;  2KEN A;  4OIJ A;  1V1Q A;  3CP0 A;  3NTI A;  2EY6 A;  3PO3 G;  4X6A H;  1CSQ A;  1Q3L A;  2CWP A;  2XWJ B;  1YJN A;  4JI6 Q;  4MIU A;  5EPK A;  1KTK A;  3V05 A;  1WTP A;  4CKB A;  1EIY B;  4KHP Q;  2EY5 A;  1Z7T A;  3CD6 A;  1VQC A;  3J7A 5;  4J6H A;  3NUC A;  3R2T A;  1Q7Y C;  2AUK A;  5JEA G;  4RKB A;  2EYP A;  3T1Y L;  5IGD A;  4DV1 L;  5I4D A;  2HD3 A;  1RJT A;  1C4Q A;  1VQ7 A;  4X3S A;  4DPG A;  5BR8 Q;  4B3M Q;  1R9T B;  4JI1 Q;  1H9S A;  2G9H D;  4K5W A;  4JI2 Q;  5CV9 A;  1BF4 A;  4K6L A;  1LTA D;  3KDF B;  2YU9 H;  1SLJ A;  5FO7 B;  3RLN A;  2VXW A;  5K36 G;  4G7O C;  3CHB D;  4CDF C;  1YIJ A;  1I4X A;  2RBM A;  1K8M A;  5IGC A;  1BUV T;  1NMG A;  2NVY H;  1KNA A;  4P73 A;  4BA1 I;  5CBA E;  3BJU A;  1I4Q A;  4QF4 A;  3K8A A;  2H1E A;  3MWY W;  4X64 L;  1LTT D;  3LWU A;  4PV1 C;  1YNJ C;  1UE7 A;  4IOA A;  2K04 A;  1WCM H;  2K5W A;  5IGF A;  4MHE A;  3B6Y A;  4DA2 A;  3HOX G;  4ME5 A;  1BBU A;  1QG7 A;  2MFI A;  3ULJ A;  4RA8 A;  4B08 A;  1HUM A;  1HUN A;  1NMF A;  1QB5 D;  4J8Q A;  3HOY G;  1YNN D;  2Y0S G;  4BBS G;  3T53 B;  4Y52 H;  2HHH Q;  3K81 C;  3I4N B;  2N49 A;  2VL6 A;  3S1N B;  4BWG B;  1JE4 A;  1AE2 A;  4IQZ A;  1VQK A;  1C8C A;  4HIO A;  1ENC A;  1L0Y B;  5C3W A;  3JAM c;  2I5L X;  4L6T B;  3S17 B;  2RQX A;  3J7Z C;  3OIP A;  3ER0 A;  5EJW A;  2KQ3 A;  5GAE C;  4JI4 Q;  1VQG A;  1BVS A;  2GA4 B;  4ZKB B;  1A3T A;  3I4O A;  5T1G A;  2PNH A;  1JJ2 A;  4GOP C;  2CKZ B;  1N34 Q;  2ES2 A;  4POF A;  1F9R A;  1PH8 A;  1XNQ L;  1RF2 D;  4JG2 A;  1I50 B;  1UEB A;  2F52 A;  5A2Q L;  4DV7 L;  4XXE A;  4X65 Q;  1S3O A;  1CKN A;  2H5X A;  3BS1 A;  3FPU B;  4UPA A;  2ALY B;  5JPN C;  4IFD H;  2UXD Q;  4LAA A;  1KDB A;  3H6M A;  3HZX A;  1PV4 A;  4ILW A;  2EE1 A;  1JT8 A;  3U4V A;  4A3B G;  4L5Q A;  4R4C A;  3A5Z B;  4DAV A;  4F88 A;  1WTR A;  5ISR A;  1KDA A;  1LTL A;  5CGK A;  1OO9 B;  4H02 A;  4NMZ A;  2R7F A;  1PDQ A;  2QF7 A;  3FVQ A;  3H0G B;  1N33 L;  4I65 A;  2TMP A;  4A3G H;  3GO5 A;  2N55 A;  2M9V A;  1PRT D;  3PO3 H;  1FR3 A;  2YTX A;  1I3Q B;  3RZD B;  1ENF A;  2BA1 A;  5J3B A;  4BBR G;  1K9M C;  2DNE A;  2HCC A;  4L5T A;  4A3I B;  5ELN A;  3R93 A;  2OF1 A;  4FVM A;  5C0X I;  1EYA A;  3FHW A;  2JXM B;  1PFN A;  4KLK A;  1J5E L;  1K73 C;  2VQF Q;  3AYH B;  1ILQ A;  2F0F A;  2CFM A;  1NCV A;  3G71 A;  5C4Z A;  1B53 A;  1VQD A;  4DR7 Q;  2FHT A;  5I9P A;  1BCP F;  3GDE A;  1KIX A;  3S2H B;  1TS3 A;  3S14 H;  3BDC A;  2RDF A;  4BY7 H;  4DU9 A;  3OTO Q;  1P16 A;  4N8X 1;  2EYM A;  5NUC A;  3GTK B;  4J15 A;  4K5V A;  1KHI A;  2RA4 A;  3C1E A;  1LT5 D;  1QNU A;  3HOV G;  5IWA Q;  3RZO B;  1M4V A;  1N32 L;  1EQT A;  4LF6 L;  2VZA A;  3RN2 A;  3H0G G;  3CC7 A;  1EU4 A;  4JVZ A;  3KYH C;  4S3S A;  1IZ6 A;  3PV0 A;  3MEF A;  1M8A A;  4YCU A;  3EBE A;  1L1O A;  1LUZ A;  3HG9 A;  2IX0 A;  1GVP A;  5E4W C;  1UWV A;  3L9A X;  3K7A H;  3HS0 C;  1U4R A;  1Q1B A;  1MIU A;  4KHV A;  1X3F A;  5HGQ A;  3OPO A;  1L0X B;  3CKI B;  1VMP A;  1TKW B;  1VQJ A;  3TP8 A;  3P1H A;  4P2C B;  3MAQ A;  2F4V L;  1EY8 A;  1EQV A;  1RDP D;  4JI5 L;  3CPF A;  3D4R A;  1HNZ Q;  3E9H A;  1MI2 A;  4C3I B;  4IAL A;  3GTQ H;  3CQZ B;  3VDY A;  2KBN A;  2A6E D;  2F0K A;  2XIW A;  3HOX B;  4B3R Q;  2K50 A;  2MP1 A;  4K8I A;  4GNX C;  3FP9 A;  4EVO A;  1JOR A;  5C0X H;  4A3M B;  4KY5 A;  2UXB Q;  2YV5 A;  5LL6 S;  3K58 A;  2AMC B;  3HOY B;  1BNZ A;  2AUJ D;  5T1I A;  1YJ9 A;  3PUX A;  3EFX D;  1BDO A;  5IIF A;  3FMC A;  4DR2 L;  4IFD J;  4X66 Q;  2C35 B;  2EDG A;  1YIT A;  4U67 3;  4KHZ A;  4QGU A;  5IYB G;  5JJK A;  3MTS A;  1Q86 C;  4JI8 Q;  1QZH A;  1EY0 A;  5I6W A;  3LGJ A;  1MD2 D;  3Q24 A;  4GOP B;  1Q82 C;  5C44 B;  2KVM A;  1RL2 A;  2KHI A;  3S1M H;  2E2I B;  2ZXO A;  2OEO A;  2IT1 A;  1QE6 A;  3BVZ A;  4NPS A;  1XXG A;  3M4Y A;  2B2Y C;  2B2Y A;  2IJ0 A;  1SFO H;  1IBL Q;  1TWG H;  4WJ4 A;  3FRP B;  1HNW Q;  4KV6 A;  5I6Y A;  2K32 A;  1H9M A;  2DNC A;  1FJG Q;  2A5H A;  3TZD A;  4C2M B;  4APV A;  3AFP A;  1WCM G;  2VQF L;  3W3A A;  4JYA L;  1TY0 A;  1X3G A;  2QIL A;  4A3B B;  2A69 C;  4DR6 L;  1X56 A;  3I4N H;  1BR9 A;  1NBW A;  2BOS A;  5FKA C;  1XPU A;  2LKV A;  1S5F D;  2CQO A;  3JAM i;  3L7Z C;  5IGG A;  4BBR H;  3GV3 A;  2NUC A;  1FNU A;  2ZJQ A;  2BDO A;  3GTP B;  1D5Z C;  3DWA A;  3AMU A;  5IYC H;  1CM9 A;  1OXU A;  1GM5 A;  4XYO A;  4IUN A;  4F7X A;  3C3L A;  2NZO A;  5L37 A;  1B8A A;  3E0E A;  1BCP D;  1KAB A;  1KRS A;  1SYF A;  4DR3 L;  2PPB C;  5FO8 B;  1VQH A;  5C44 G;  4V19 0;  3DEP A;  4BXX H;  1G91 A;  2WV6 D;  1XMQ Q;  1FVI A;  1IW7 D;  3I4L A;  1EFW A;  2PW7 A;  2MO1 A;  4YY3 Q;  3TRE A;  1FNV A;  3HOV H;  3SDZ A;  1QVG A;  4OO1 I;  3K0X A;  4FXK C;  2B2V A;  3KF8 B;  1K28 A;  1HNW L;  3JAM E;  4EQP A;  2DGY A;  1L2F A;  5FLM G;  1ENA A;  5C4H A;  1EU3 A;  1Q8K A;  5EKK A;  4JBW A;  3T16 A;  5LMN Q;  1O7Y A;  4JV5 Q;  5JJL A;  1K83 B;  2Z0S A;  1PFM A;  1ROD A;  2OT2 A;  2CW0 C;  2ASB A;  1G2T A;  2Q2H A;  4R8N A;  3Q22 A;  2X6G A;  3OW2 A;  3F2U A;  2ZXP A;  4A3F G;  2BE5 D;  2F1M A;  4QY7 A;  1HXY D;  1QVC A;  1RKN A;  4P72 A;  3KF6 B;  1Q1E A;  3A8J E;  3S16 B;  5C4J B;  3HKZ G;  3CCU A;  2WIN B;  4E6I A;  2RVL A;  2HDM A;  1HA6 A;  4HSV A;  2F0T A;  1K8A C;  2EVB A;  4LFB Q;  4FXG C;  2E2I H;  3MZ5 A;  3BZK A;  1PRT C;  1CKO A;  1PVO A;  5FLX c;  1XX8 A;  2EIF A;  1PMR A;  1D1I A;  1HQR D;  5FO9 B;  4A3D B;  3JC6 6;  4OXP A;  1X32 A;  1Y8P B;  3H94 A;  4M1U B;  4IJL A;  3CXC A;  1AH9 A;  3H0G H;  1STN A;  1PH7 A;  1Y1W H;  1W6K A;  3OWE B;  3QJY A;  4OHJ A;  4IFD I;  2OQK A;  1VQI A;  1KAA A;  1SND A;  4YHH L;  4DR4 L;  1BO0 A;  1I3Q H;  2D2C C;  4H7B A;  2WB1 G;  5H1S E;  1PH6 A;  3DLL A;  5LL6 X;  3R2I A;  2SDF A;  1A3U A;  2LSS A;  3WOF A;  2BE5 C;  3G7L A;  1I4P A;  2I5M X;  3NE5 B;  4PZ6 A;  4BY1 G;  5CV6 A;  3PCO B;  5M3M B;  1SRO A;  3KJP A;  1WD0 A;  1I6H H;  1I5F A;  2Q8R E;  3J80 c;  1VF7 A;  4LFA L;  3NK9 A;  1LT6 D;  1NR4 A;  4YCV A;  3M4O B;  3S24 A;  5C5M A;  4DV3 L;  2CQA A;  4HMJ A;  4OWW B;  4QQB X;  4CJ1 B;  3VYS A;  5ELC A;  4X3T A;  3KFU A;  2R93 B;  3LWE A;  3A5U A;  4DN4 M;  2V1C C;  1G29 1;  4K2K A;  1VQP A;  5C44 H;  1W2B A;  3OWF A;  1FGU A;  4N9P A;  3T1Y Q;  1N9W A;  1U5K A;  2A68 C;  3GTO B;  5F2D A;  1NR2 A;  5FLX E;  3M4Q A;  1NY4 A;  2JP1 A;  5LMU L;  4C56 C;  5CR3 A;  5G3L D;  2NN6 H;  1IHZ A;  4R4Q A;  5M5Y H;  3GQB A;  5DM7 3;  3TQY A;  3D3R A;  3PO2 H;  2PI2 A;  4Q0F A;  5M5X H;  3NPP A;  2R92 H;  4PZ7 A;  2ZJR A;  3K5M A;  3U50 C;  3CCJ A;  1J9O A;  4KN4 C;  1HFG A;  1F9Q A;  2DN8 A;  4A3K B;  1QOH A;  4RGT A;  2IX1 A;  4BBS B;  4C3I H;  2MQH A;  4YWK A;  2PQA A;  1IXR A;  2X69 A;  1BCP C;  3CRL C;  4IPC A;  4ME3 A;  2JA6 B;  2Z8L A;  1G2S A;  3PUY A;  4A3M H;  5IY0 A;  2OTJ A;  2NYZ D;  5IYC G;  3VR3 A;  4A3I G;  1ASY A;  3FKI G;  4QIW B;  4DR1 Q;  1E0B A;  1ET6 A;  2BH2 A;  4J1M A;  1EFI D;  4JI3 Q;  1STG A;  4L8J A;  4YCW A;  1HPC A;  3D31 A;  1DGS A;  1E2W A;  1JJG A;  2A19 A;  2Q2T A;  1I4H A;  4NXM L;  3R8B A;  3WDN A;  4LFC Q;  3A8K E;  4TRD A;  1UUP A;  1EY7 A;  5CV5 A;  4IOC A;  3OHX C;  1VQO A;  3VR4 A;  4JI8 L;  3HOZ H;  3OIQ A;  4QUC A;  3TBI B;  3GTG B;  3J80 i;  5HUR A;  2D9U A;  2HQL A;  2WKC A;  2AHO B;  1J6Q A;  3VYU A;  5KND A;  2JYO A;  5DAU A;  5CV8 A;  2XGT A;  4JI4 L;  1ZYR D;  4IZ8 A;  2A8V A;  3I4M B;  3F2C A;  2XNA C;  1XMQ L;  3SK4 A;  1E2V A;  3CPW A;  3OSO A;  4BBR B;  1KAW A;  1OXV A;  2CH4 A;  1HH2 P;  5C4X G;  4A93 G;  3M9B A;  5K5P A;  3G4S A;  4IUR A;  2A69 D;  2WB1 B;  3A74 A;  2KHS A;  4UP7 A;  2R6G A;  5LMU Q;  2AWN A;  1IYJ B;  3NHH A;  4XDX A;  4X3K A;  2PZU A;  2WFW A;  1ZEQ X;  4A76 A;  5C0X J;  4ODG A;  3T13 A;  4HJA A;  1QUQ B;  4OWT B;  1CKN B;  5GAD C;  4CDC C;  1GUN A;  2AQ2 B;  3KLS X;  2JN4 A;  5GAH C;  4HIM A;  3H15 A;  1VQ5 A;  1EY5 A;  1VF5 C;  2VQE L;  1SNC A;  4MNO A;  5KYL A;  3GTO H;  1II3 A;  1N8R C;  1SEB D;  5LMN W;  3P75 A;  3ND8 A;  1T5E A;  4IJH A;  3I8Z A;  3J80 E;  5EPJ A;  3EQL C;  2UUB L;  4MTN A;  3ULP A;  4GKJ Q;  2Z4H A;  1OXT A;  2SEB D;  5ELE A;  3NP8 A;  2DJF C;  1XYI A;  2OCE A;  1PH4 A;  1K8G A;  3D6C A;  4RMF A;  4OL7 A;  5IWA L;  3NWT A;  4R1J A;  2Z9H A;  2WAQ G;  1PH5 A;  3HOU G;  4YWL A;  5I9O A;  1QWY A;  3G48 A;  4OO1 H;  4P75 A;  2B2W A;  4JI1 L;  4FXD A;  1CQF A;  4DXF A;  3NSW A;  1G8Z D;  2M2L A;  3KDF A;  1O7L A;  3MA2 B;  2BCO A;  3KOJ A;  4DV1 Q;  5C3E G;  1AEX A;  3CQZ H;  2JA8 G;  1EZ8 A;  3MXP A;  3MHB A;  4A3J B;  4C3I G;  2HQE A;  4JOI A;  5ELO A;  1Q90 A;  4O1N A;  4BY1 H;  4POG A;  2J0T D;  4KHP L;  1NUC A;  4ZUI A;  1U4P A;  1V43 A;  2ZJP A;  3D0F A;  1XMO L;  2E2J B;  1ZYR C;  2KJX A;  1EWI A;  3W1B A;  1VQL A;  4ID6 A;  4MZ9 A;  3IL8 A;  4JI5 Q;  5KRU A;  2F03 A;  3TEH B;  1OXX K;  1WOC A;  4ZAI A;  1G6Z A;  2GVB A;  3STB D;  3I2Z A;  3D4W A;  3J81 c;  2IW3 A;  2IHE A;  4GS3 A;  3T56 B;  1JQY D;  1D5X C;  1HTP A;  1C0A A;  3GP7 A;  1H9S B;  3PIO A;  4DUZ Q;  2EZV A;  5FJ8 H;  3ICE A;  2NVT H;  2K05 A;  1TXY A;  1YZ6 A;  3A55 A;  4ZLT F;  3GD7 A;  3SEB A;  1EY9 A;  1LTS D;  3L3O C;  2O5I C;  1VQF A;  3IFD A;  1T5X D;  4K0K Q;  1EOT A;  4DV7 Q;  3M7G A;  1SYB A;  3I4M H;  5FK9 C;  3ND9 A;  1GKH A;  4C2M H;  1WTQ A;  4FF4 A;  3HOZ G;  4Z9C B;  5IT9 L;  1TY2 A;  1B7Y B;  1D8L A;  2V4D A;  3GTL B;  1D7Q A;  2KHJ A;  2JA7 H;  1DOK A;  4DR3 Q;  2EYO A;  3A56 A;  1HA5 A;  2ZTD A;  1EYC A;  4A3E G;  2F4V Q;  3WWV A;  1SJH D;  4AQY Q;  2WAQ E;  3RLF A;  1SRU A;  1IBK Q;  3M4O H;  1B4O A;  2B2U C;  2KA7 A;  4A3C H;  1SAP A;  2E74 C;  2J4X A;  3GTJ H;  3OYY A;  2K5D A;  1BBW A;  2LXK A;  5EPL A;  3Q8D A;  5EQ0 A;  2JK8 A;  2XTI A;  3HKS A;  3F2D A;  2PNR C;  4K8J A;  3G6E A;  1PHJ A;  4C3J H;  5J39 A;  1YNN C;  4ZYS A;  1SMY C;  1TS2 A;  4IUQ A;  4RWS C;  2GN5 A;  1STB A;  1OTC A;  4NXN Q;  1FJG L;  2NVX B;  4UP9 A;  1WTH A;  1A3V A;  4LWC A;  4A3L G;  2VNU D;  3N6R A;  2KCN A;  2A6H C;  1R4Q B;  2NZH A;  1ICF B;  2F0W A;  4JV5 L;  1JMC A;  1SNO A;  1HRJ A;  1CQV A;  5IP7 H;  2RSO A;  3OTO L;  2ZM6 Q;  1U4L A;  3TP7 A;  3AFQ A;  5M5Y B;  3MFY A;  3TP5 A;  5IGB A;  3IKJ A;  2VUM H;  1BXT A;  2FIN B;  3H3V I;  1X65 A;  2R92 B;  5DEH A;  1WTV A;  5IYD G;  1GUO A;  3VR5 A;  4F87 A;  2B39 A;  1B44 D;  4A3J H;  4EGV A;  3NTH A;  2HDL A;  4OO1 G;  1JIC A;  1X3E A;  4I7Z C;  3AB9 A;  4NDX A;  1S5E D;  3NBH A;  1A2T A;  1PRT B;  3U4Z A;  2DY7 A;  2B8G A;  1PZK D;  1TR5 A;  3G6J B;  4AYB B;  3EN2 A;  4NP5 A;  1I6V C;  4DK6 C;  2K1B A;  2DJG C;  2IL8 A;  2F0N A;  2PMZ E;  5ELD A;  1HHV A;  2CW0 D;  2D0P A;  3K80 C;  1EOV A;  2HUG A;  3W1G A;  2HIV A;  2G5D A;  5IYB H;  4GLX A;  1YJW A;  2F0U A;  1YBY A;  4O42 A;  2IHF A;  4L63 B;  3MXN A;  1IL8 A;  4HJ9 A;  3CCS A;  5COY A;  2K01 A;  4KKT A;  1HFN A;  2PW5 A;  4ZKC B;  3A7L A;  1UE5 A;  4IUV A;  1P8L A;  1UE1 A;  1UE6 A;  3STB C;  4JBJ A;  1B70 B;  1EY6 A;  4JI2 L;  1O78 A;  2I46 A;  1IYV A;  3KK7 A;  2R93 G;  2F0L A;  5KIX A;  2QDL A;  5HY6 A;  5BR8 L;  2EJM A;  4B3M L;  4X62 Q;  1V1P B;  5FJ8 G;  1IW7 C;  4K2L A;  2YTV A;  3GTG H;  2PZW A;  4DR4 Q;  2JA8 H;  4RGN A;  5C4X H;  1I4R A;  4WJ3 M;  3S1N H;  1Z47 A;  1CZG A;  3D6W A;  4DUY L;  1X54 A;  5EAY A;  2UXC L;  2D5D A;  1CFM A;  1F9P A;  1RTN A;  2MJ8 A;  3I72 A;  1KNE A;  1F2M A;  4ZCK A;  4X66 L;  3HOW H;  5E4X A;  1Z6H A;  4G7Z C;  1J5E Q;  3I90 A;  2ICE C;  2WP8 J;  1KQS A;  3M4P A;  1H9R A;  4A3K G;  4KTA A;  3GV6 A;  4BXX G;  1QUQ A;  1I94 Q;  4LF4 Q;  4X64 Q;  3QIA A;  4IN3 A;  2L55 A;  3J81 j;  2IWH A;  2JJQ A;  4DV4 Q;  3W5O A;  1MGS A;  4PG3 A;  4A4I A;  2E76 C;  3S1M B; 
#chains in the Genus database with same CATH homology
 3S15 B;  1I4G A;  4PMW A;  3DM1 A;  5KNC A;  2M00 A;  5C0X G;  5D3D A;  1PFB A;  1AZP A;  4DK1 A;  4FYD A;  2LFN A;  2PYK A;  3I70 A;  4IUU A;  1LTB D;  2BA0 A;  3UI2 A;  2NWG A;  3NBI A;  4KJO A;  4H13 C;  2FFK B;  1KLU D;  4OIK A;  2MUY A;  2E75 C;  2K5Q A;  3BYT B;  3M7N A;  1D1K A;  3I73 A;  2A73 B;  3KUP A;  1V1O A;  4HR7 B;  1DJR D;  1NSN S;  2E2H B;  5EKL A;  1CHP D;  2EYL A;  5E3F A;  2RDG A;  3BDO A;  1U9R A;  4K6D A;  4RKL A;  2RDH A;  5JAV A;  2LY7 A;  3E6Z X;  2KEC A;  4FF2 A;  4KK7 A;  3HGB A;  4C3J B;  1EEF D;  4DF7 A;  2PMZ B;  3QB3 A;  3SVM A;  2QKI C;  1DOL A;  3QOL A;  3BZD B;  2NVQ B;  2F3W A;  5D14 A;  2NZ1 D;  3ERQ A;  2NVT B;  1A6X A;  2ICI A;  1CT1 D;  2CVR A;  4BA2 I;  3NTK A;  2Q8I B;  5I2X A;  2L4N A;  1QJO A;  2NBF A;  2JA7 B;  1BOS A;  3V96 A;  4Q5V A;  3N52 A;  3I3C A;  2Z4I A;  1FYC A;  3KBG A;  4KI0 A;  4CBV A;  2JSO A;  2K03 A;  3EA6 A;  5FOB B;  4A93 B;  2F0G A;  2F0J A;  5M3F B;  4X3U A;  3WOE A;  1TS5 A;  2KUM A;  2F0E A;  4G7H C;  2SNS A;  5JEA H;  4RH6 A;  3SK8 A;  1JC7 A;  1DON A;  1PXU A;  4RGO S;  5EGT A;  3EVQ A;  2F0Q A;  1V8Q A;  1PLF A;  1Y1W B;  1MSG A;  3E5S A;  1MSH A;  5C3E B;  3VYT A;  2JE6 I;  3IFT A;  2AQ1 B;  4WJW A;  3T51 B;  3P20 A;  1TVX A;  2B2T C;  2B8F A;  1Y8N B;  3MFG A;  1QCB D;  3TSS A;  2B2U A;  4C1N K;  1DD2 A;  1EZ6 A;  4CGY B;  3PIP 3;  1TII D;  3SK6 A;  1S4Z A;  4ZK9 B;  4Y7N B;  1CK1 A;  2KEE A;  2G9D A;  5A2Q E;  1CA5 A;  3OMG A;  3R3O A;  3KF8 A;  2RSN A;  3S1Q B;  2XWB B;  2NN6 G;  2EYH A;  3Q0A A;  3T4A C;  3J81 E;  4K14 A;  1KLG D;  4A3E B;  1AFP A;  1SJE D;  1KDC A;  2AQ3 B;  5ELB A;  2EPB A;  1GXD C;  2F0O A;  1TWG B;  5G3L F;  1EWC A;  1PTO D;  5ELF A;  1WTO A;  4RHR A;  4DNR B;  3ITP A;  3E0J A;  1D5M C;  4HCE A;  1DXM A;  2OXP A;  3PO2 B;  1Y8O B;  5M5X B;  2JEB I;  1GJX A;  3PMF A;  4KY6 A;  3TN2 A;  2R3Z A;  1LT4 D;  4G57 A;  2F0V A;  2WAC A;  1ML0 D;  3M3Y B;  2L11 A;  2L1B A;  1B3A A;  3BYY B;  3SXH A;  5KYI A;  1B1Z A;  1SYC A;  3K5N A;  1JWM D;  2K33 A;  4RFB A;  2EJG C;  1GHJ A;  1AZQ A;  5JJZ A;  1B50 A;  5CV4 A;  3O13 A;  4PNY A;  1F2L A;  3RUZ A;  3HOV B;  1LTG D;  3BDL A;  3SK5 A;  3QG1 A;  5A35 A;  2K28 A;  3D4D A;  4QUF A;  4H0L C;  1ICW A;  1SE2 A;  1STY A;  1W6J A;  5BN3 A;  3PIO 3;  1PTO F;  3K57 A;  3K7A B;  3PO3 B;  2EYJ A;  1ONL A;  2WKD A;  1IKL A;  3X3N A;  1JOK A;  2PCF B;  5C3X A;  2TSS A;  3MEH A;  3GTQ B;  1B9N A;  1NAP A;  2L12 A;  3DHQ A;  5CBE E;  3HKZ B;  3U9O A;  3MC0 B;  1CHQ D;  4XQN A;  5IT9 E;  3QO2 A;  3VA5 A;  1LTI D;  4HN7 A;  1EY4 A;  2MGS A;  4CHT B;  2JEA I;  3DWQ A;  3MXU A;  5JPM C;  3TZU A;  1VMC A;  1ILP A;  3DWP A;  1JR0 D;  4PMB A;  1FGB D;  4XTC S;  1SYG A;  1A15 A;  3S2D B;  2BDN A;  3I91 A;  3K0Y A;  5I2Y A;  3VR6 A;  2F0S A;  4H44 C;  1EIG A;  3C2P A;  2WAQ B;  2XRS D;  2NB0 A;  1SNM A;  2L0C A;  5E1F A;  1VDZ A;  3PUZ A;  4ABN A;  2CHB D;  1IYU A;  3LNN A;  1JB3 A;  4RCN A;  4GZY C;  1XWE A;  5J22 A;  2JA8 B;  3FPP A;  4OGQ C;  1GUT A;  4NKL A;  2QEJ C;  3HEJ A;  1SBB B;  4N9T A;  2VB2 X;  4K5X A;  4LK1 C;  1PYW D;  4V0B A;  4DFA A;  2FMM A;  1A2U A;  5M5W B;  1LLR D;  1RTO A;  5DNF A;  4YIJ A;  3D8G A;  4TSS A;  4A3F B;  3S1R B;  3VYR A;  4EQO A;  2PO4 A;  3BG3 A;  2C5C A;  2F0P A;  4KN7 C;  3K59 A;  1AW7 A;  3HOZ B;  1TWH B;  1GUG A;  4IFD G;  2Q8T A;  2I07 B;  3K6O A;  2XRQ D;  4HMI A;  1SYD A;  3URY A;  1WTW A;  1UEA B;  2FJ2 A;  3NWS A;  5KEE A;  1TWA B;  3J7A V;  1Q8I A;  4KMU C;  2B2T A;  4ZQ3 A;  1HCZ A;  4C3J G;  4C3H B;  3S14 B;  4RAU C;  2R7Z B;  3H91 A;  1PTO B;  1SXT A;  2A68 D;  2D62 A;  4U68 A;  2N88 A;  4NW2 A;  3LX0 A;  3MXG A;  5IOC A;  5CC4 A;  2KCC A;  4ZUJ A;  4DNT B;  1EYD A;  1F2Y A;  2F0D A;  1CZW A;  4PMC A;  3DMU A;  1S5B D;  4LJZ C;  2PQE A;  2VUM B;  3X3M A;  2O2L D;  3PUW A;  4XT3 B;  4PQX A;  2EY2 A;  2H4O A;  1SE4 A;  4FNF A;  1WD1 A;  3RD4 A;  5M9O A;  1QIL A;  4DAP A;  1LTR D;  1LT3 D;  4C3H G;  4UAI A;  1PRT F;  1U4M A;  1Q12 A;  4KJN A;  1EWH A;  3OOC A;  5JVH 3;  1Y69 U;  4F8M A;  1QNK A;  1MBY A;  4BY1 B;  3CU7 A;  3SE0 A;  1LV9 A;  5KNB A;  4FF3 A;  1TT2 A;  1LAB A;  5JVG 3;  5HGT A;  1CI3 M;  1SYE A;  5JOB A;  5CMD A;  5COR A;  3S9W A;  5IGE A;  1BBX C;  1STH A;  3HRZ C;  2NN6 I;  5FLX L;  2WII B;  3RMH A;  2B2V C;  2FMC A;  5LHY 1;  1SE3 A;  3FKI B;  4R8I A;  1GUS A;  4HSP A;  3V2T A;  4BS9 A;  1SFO B;  5C4X B;  1EL0 A;  4QMG A;  3A8I E;  4RGM A;  3ERO A;  3DXJ C;  1DM0 B;  3BVM A;  2B63 B;  3U9S A;  3MVV A;  5J1Z A;  3AU7 A;  1AN8 A;  3HOW B;  1TU2 B;  1RHP A;  1R4P B;  3A7A B;  4TKO B;  2NTS A;  1YNJ D;  3J81 L;  1PTO H;  1TWF B;  1DYQ A;  4LMQ D;  1LO5 D;  1JWS D;  3EJI A;  4WOR A;  5EKI A;  4HTH A;  3IAY A;  4QCL A;  2HCI A;  3M85 A;  2L5T A;  1SDF A;  2EY1 A;  5BN4 A;  1WTX A;  2O5J C;  4A3G B;  1PTO C;  4KY7 A;  5C6A A;  1RD9 D;  1GHK A;  4UDU C;  2ID0 A;  5CV7 A;  1S5D D;  4HED A;  2L9H A;  4HCS A;  4RCO A;  3NQT A;  2QCP X;  1D2B A;  3C1F A;  3FEW X;  4CKC A;  3H09 A;  5C5L A;  4G4K A;  4KD4 A;  4CKE A;  4FO2 A;  1IKM A;  2LS0 1;  3PUV A;  1ESR A;  4BY7 B;  2F4I A;  3HOU B;  4C1N I;  3VA7 A;  1S5C D;  5JEA J;  2F0M A;  4KD3 A;  3J80 L;  3TME A;  1F77 A;  3NXW A;  1X3P A;  5AFW A;  1DCZ A;  1ZKO A;  5D65 A;  4KKU A;  3KLS A;  2A6H D;  2EJF C;  1JCK B;  4DXG A;  2XSC A;  4B9W A;  4FP5 D;  2X6L A;  1SMY D;  3VR2 A;  4XIG S;  1SNP A;  1Y1V B;  3HP3 A;  1E2Z A;  3TDQ A;  4MN3 A;  1STA A;  1LAC A;  1C48 A;  1D6E C;  2EXZ A;  1J8I A;  2QDB A;  2A6E C;  3KLR A;  4EQN A;  2NTT A;  3QWN A;  3ONA B;  3Q6S A;  2EOT A;  2IX3 A;  2Z1C A;  1EEI D;  2MPM A;  4DK0 A;  2F0H A;  2ENB A;  2C9O A;  2JA5 B;  1I6H B;  2PZT A;  2E2D C;  2ZXR A;  1BQQ T;  5D3I B;  1CTM A;  1STE A;  3SR1 A;  1BCP B;  3OMC A;  3W2D A;  2LMC B;  1H9J A;  5EBC A;  2K6A A;  2NVY B;  1CA6 A;  2SNM A;  3CRK C;  1X3Q A;  2O4X A;  2K7V A;  1SSO A;  5K36 H;  3K5L A;  4WFN 3;  1F9S A;  1B2T A;  1WCM B;  1ZXT A;  3KBX A;  3P7J A;  4QB4 A;  5BN5 A;  3TP6 A;  2DY8 A;  3GTM B;  5KGU A;  3FDT A;  1K8O A;  2R61 A;  1V1P A;  2ZT9 C;  1JWU D;  1ET9 A;  2J7Z A;  5TSS A;  2VB3 X;  2IPK D;  4KKS A;  4WRD A;  2XN9 C;  1HQM C;  1JOQ A;  2KOL A;  2B2W C;  4XT1 B;  4IUP A;  1DZ1 A;  3DEO A;  3ZYY X;  2XVS A;  2YU9 B;  1DOM A;  1HTL D;  4TQU S;  2SOB A;  5DM6 3;  1WVL A;  1TWC B;  4IUT A;  2Y0S B;  3SHL A;  1F2Z A;  3DUZ A;  1ESF A;  4CJ2 C;  2RKS A;  2EYF A;  3Q23 A;  3C46 A;  4ZRZ A;  1TS4 A;  1SNQ A;  4XQQ A;  1OXS C;  4ULL A;  5IOD A;  1AP0 A;  1GOZ A;  1O7Z A;  1FD7 D;  2F0I A;  2A74 C;  3A54 A;  3JAM L;  3J7A F;  3H3V C;  3QOJ A;  1JOO A;  4R9W A;  4HAE A;  2MHV A;  1UNS A;  3NQI A;  2YYZ A;  4DGZ A;  4XYQ A;  1XTC D;  1O80 A;  3BVG A;  3J7Y W;  1GUW A;  1RCV D;  4XQJ A;  1TQO A;  5CYU A;  2F3V A;  4RHS A;  3GTJ B;  4JK1 C;  1EIH A;  4CJ0 B;  1PZJ D;  2AWO A;  4B9X A;  1B9M A;  2KED A;  4FF1 A;  3K5O A;  4DAY A;  1PZI D;  3OW7 A;  1H9K A;  4M8A A;  5EBD A;  1VCI A;  1FNW A;  1UAP A;  4OIJ A;  3NTI A;  2EY6 A;  1Q3L A;  2XWJ B;  4MIU A;  5EPK A;  1KTK A;  3V05 A;  1WTP A;  4CKB A;  2EY5 A;  1Z7T A;  4J6H A;  3NUC A;  3R2T A;  2AUK A;  5JEA G;  4RKB A;  2EYP A;  5IGD A;  5I4D A;  1RJT A;  1C4Q A;  4X3S A;  1R9T B;  1H9S A;  2G9H D;  4K5W A;  5CV9 A;  1BF4 A;  4K6L A;  1LTA D;  5FO7 B;  5K36 G;  2VXW A;  4G7O C;  3CHB D;  1I4X A;  2RBM A;  1K8M A;  5IGC A;  1BUV T;  1KNA A;  4BA1 I;  5CBA E;  1I4Q A;  4QF4 A;  2H1E A;  3MWY W;  1LTT D;  3LWU A;  4PV1 C;  1YNJ C;  2K04 A;  2K5W A;  5IGF A;  4MHE A;  4DA2 A;  4ME5 A;  1QG7 A;  4RA8 A;  4B08 A;  1HUM A;  1HUN A;  1QB5 D;  4J8Q A;  1YNN D;  3T53 B;  3I4N B;  3S1N B;  4BWG B;  1JE4 A;  4IQZ A;  1C8C A;  1ENC A;  1L0Y B;  5C3W A;  4L6T B;  3S17 B;  2RQX A;  3OIP A;  5EJW A;  2KQ3 A;  2GA4 B;  4ZKB B;  1A3T A;  5T1G A;  1F9R A;  1RF2 D;  1I50 B;  5A2Q L;  4XXE A;  3BS1 A;  3FPU B;  5JPN C;  4IFD H;  4LAA A;  1KDB A;  3H6M A;  3HZX A;  4ILW A;  2EE1 A;  4DAV A;  4F88 A;  1WTR A;  5ISR A;  1KDA A;  5CGK A;  1OO9 B;  4NMZ A;  1PDQ A;  2QF7 A;  3FVQ A;  3H0G B;  4I65 A;  2TMP A;  3GO5 A;  2N55 A;  2M9V A;  1PRT D;  1FR3 A;  1I3Q B;  3RZD B;  1ENF A;  2BA1 A;  2DNE A;  2HCC A;  4A3I B;  3R93 A;  2OF1 A;  4FVM A;  5C0X I;  1EYA A;  2JXM B;  1PFN A;  1ILQ A;  2F0F A;  1NCV A;  5C4Z A;  1B53 A;  2FHT A;  5I9P A;  1BCP F;  3S2H B;  1TS3 A;  3BDC A;  2RDF A;  4DU9 A;  2EYM A;  5NUC A;  3GTK B;  4K5V A;  2RA4 A;  3C1E A;  1LT5 D;  1QNU A;  3RZO B;  1M4V A;  1EQT A;  1EU4 A;  4S3S A;  3PV0 A;  1M8A A;  3HG9 A;  2IX0 A;  5E4W C;  3L9A X;  3HS0 C;  1U4R A;  1Q1B A;  4KHV A;  3OPO A;  1L0X B;  3CKI B;  1VMP A;  1TKW B;  3TP8 A;  3MAQ A;  3P1H A;  4P2C B;  1EY8 A;  1EQV A;  1RDP D;  3D4R A;  1MI2 A;  4C3I B;  4IAL A;  3CQZ B;  2A6E D;  2F0K A;  2XIW A;  3HOX B;  2MP1 A;  4K8I A;  4EVO A;  1JOR A;  5C0X H;  4A3M B;  4KY5 A;  5LL6 S;  3K58 A;  3HOY B;  1BNZ A;  2AUJ D;  5T1I A;  3PUX A;  3EFX D;  1BDO A;  5IIF A;  3FMC A;  4IFD J;  2EDG A;  4U67 3;  4KHZ A;  3MTS A;  1EY0 A;  5I6W A;  1MD2 D;  3Q24 A;  5C44 B;  2KVM A;  2E2I B;  2ZXO A;  2OEO A;  2IT1 A;  1QE6 A;  3BVZ A;  1XXG A;  3M4Y A;  2B2Y C;  2B2Y A;  2IJ0 A;  3FRP B;  4KV6 A;  5I6Y A;  2K32 A;  1H9M A;  2DNC A;  2A5H A;  3TZD A;  4C2M B;  3W3A A;  1TY0 A;  2QIL A;  4A3B B;  2A69 C;  1BR9 A;  2BOS A;  5FKA C;  2LKV A;  1S5F D;  3L7Z C;  5IGG A;  3GV3 A;  2NUC A;  1FNU A;  2BDO A;  3GTP B;  1D5Z C;  3DWA A;  3AMU A;  1CM9 A;  1OXU A;  4XYO A;  4IUN A;  4F7X A;  3C3L A;  1BCP D;  1KAB A;  2PPB C;  1SYF A;  5FO8 B;  4V19 0;  3DEP A;  1G91 A;  2WV6 D;  1IW7 D;  3I4L A;  2PW7 A;  1FNV A;  3SDZ A;  4OO1 I;  4FXK C;  2B2V A;  3JAM E;  4EQP A;  1ENA A;  5C4H A;  1EU3 A;  5EKK A;  4JBW A;  3T16 A;  1O7Y A;  1K83 B;  1PFM A;  1ROD A;  2OT2 A;  2CW0 C;  1G2T A;  4R8N A;  3Q22 A;  2X6G A;  3F2U A;  2ZXP A;  2BE5 D;  2F1M A;  1HXY D;  1RKN A;  1Q1E A;  3A8J E;  3S16 B;  5C4J B;  2WIN B;  4E6I A;  2RVL A;  2HDM A;  1HA6 A;  4HSV A;  2F0T A;  2EVB A;  4FXG C;  3MZ5 A;  1PRT C;  1XX8 A;  1PMR A;  1D1I A;  1HQR D;  5FO9 B;  4A3D B;  1X32 A;  1Y8P B;  3H94 A;  4M1U B;  1STN A;  1W6K A;  3OWE B;  3QJY A;  4OHJ A;  4IFD I;  1KAA A;  1SND A;  1BO0 A;  4H7B A;  2D2C C;  5LL6 X;  3R2I A;  2SDF A;  1A3U A;  3WOF A;  2BE5 C;  3G7L A;  1I4P A;  3NE5 B;  5CV6 A;  5M3M B;  1WD0 A;  2Q8R E;  1VF7 A;  3NK9 A;  1LT6 D;  1NR4 A;  3M4O B;  5C5M A;  2CQA A;  4HMJ A;  4CJ1 B;  3VYS A;  5ELC A;  4X3T A;  2R93 B;  3LWE A;  4DN4 M;  1G29 1;  4K2K A;  3OWF A;  4N9P A;  2A68 C;  3GTO B;  5F2D A;  1NR2 A;  5FLX E;  2JP1 A;  4C56 C;  5CR3 A;  5G3L D;  2NN6 H;  1IHZ A;  3GQB A;  5DM7 3;  3D3R A;  4Q0F A;  3NPP A;  3K5M A;  1J9O A;  4KN4 C;  1HFG A;  1F9Q A;  2DN8 A;  4A3K B;  1QOH A;  4RGT A;  2IX1 A;  4BBS B;  2X69 A;  1BCP C;  3CRL C;  2JA6 B;  2Z8L A;  1G2S A;  3PUY A;  2NYZ D;  3VR3 A;  4QIW B;  1E0B A;  1ET6 A;  4J1M A;  1EFI D;  1STG A;  4L8J A;  1HPC A;  3D31 A;  1E2W A;  1I4H A;  3R8B A;  3WDN A;  3A8K E;  4TRD A;  1UUP A;  1EY7 A;  5CV5 A;  3OHX C;  3VR4 A;  3OIQ A;  4QUC A;  3TBI B;  3GTG B;  5HUR A;  2D9U A;  2WKC A;  3VYU A;  5KND A;  2JYO A;  5DAU A;  5CV8 A;  1ZYR D;  4IZ8 A;  3I4M B;  2XNA C;  3SK4 A;  1E2V A;  3OSO A;  4BBR B;  1OXV A;  5K5P A;  4IUR A;  2A69 D;  2WB1 B;  2KHS A;  2R6G A;  2AWN A;  3NHH A;  4XDX A;  4X3K A;  2PZU A;  1ZEQ X;  5C0X J;  4ODG A;  3T13 A;  1GUN A;  2AQ2 B;  3KLS X;  1EY5 A;  1VF5 C;  1SNC A;  5KYL A;  1II3 A;  1SEB D;  3P75 A;  3ND8 A;  1T5E A;  3I8Z A;  3J80 E;  5EPJ A;  3EQL C;  2Z4H A;  1OXT A;  2SEB D;  5ELE A;  3NP8 A;  1XYI A;  3D6C A;  4OL7 A;  3NWT A;  5I9O A;  1QWY A;  4OO1 H;  2B2W A;  4FXD A;  1CQF A;  4DXF A;  3NSW A;  1G8Z D;  2M2L A;  1O7L A;  3MA2 B;  2BCO A;  1AEX A;  1EZ8 A;  3MXP A;  4A3J B;  3MHB A;  4C3I G;  2HQE A;  1Q90 A;  4O1N A;  2J0T D;  1NUC A;  4ZUI A;  1U4P A;  1V43 A;  2E2J B;  1ZYR C;  2KJX A;  4ID6 A;  3IL8 A;  5KRU A;  2F03 A;  1OXX K;  4ZAI A;  1G6Z A;  3D4W A;  2IW3 A;  3T56 B;  1JQY D;  1D5X C;  1HTP A;  3GP7 A;  1H9S B;  2EZV A;  2K05 A;  3A55 A;  4ZLT F;  3GD7 A;  3SEB A;  1EY9 A;  1LTS D;  3L3O C;  2O5I C;  3IFD A;  1T5X D;  1EOT A;  3M7G A;  1SYB A;  5FK9 C;  3ND9 A;  1WTQ A;  4FF4 A;  4Z9C B;  5IT9 L;  1TY2 A;  2V4D A;  3GTL B;  1DOK A;  2EYO A;  3A56 A;  1HA5 A;  1EYC A;  1SJH D;  3RLF A;  1B4O A;  2B2U C;  2KA7 A;  1SAP A;  2E74 C;  2J4X A;  2K5D A;  5EPL A;  5EQ0 A;  2PNR C;  4K8J A;  5J39 A;  4ZYS A;  1YNN C;  1SMY C;  4RWS C;  1TS2 A;  4IUQ A;  2NVX B;  1STB A;  1A3V A;  2VNU D;  3N6R A;  2KCN A;  2A6H C;  1R4Q B;  2F0W A;  1SNO A;  1HRJ A;  1CQV A;  2RSO A;  1U4L A;  3TP7 A;  5M5Y B;  3MFY A;  3TP5 A;  5IGB A;  3IKJ A;  1BXT A;  2FIN B;  2R92 B;  5DEH A;  1WTV A;  1GUO A;  3VR5 A;  4F87 A;  2B39 A;  1B44 D;  4EGV A;  3NTH A;  2HDL A;  4OO1 G;  1JIC A;  4I7Z C;  3AB9 A;  4NDX A;  1S5E D;  3NBH A;  1A2T A;  1PRT B;  2DY7 A;  2B8G A;  1PZK D;  1TR5 A;  4AYB B;  3G6J B;  4NP5 A;  1I6V C;  2K1B A;  2IL8 A;  2F0N A;  5ELD A;  1HHV A;  2CW0 D;  2HUG A;  2F0U A;  4O42 A;  4L63 B;  3MXN A;  1IL8 A;  5COY A;  2K01 A;  4KKT A;  1HFN A;  2PW5 A;  4ZKC B;  3A7L A;  4IUV A;  1EY6 A;  1O78 A;  2I46 A;  1IYV A;  3KK7 A;  2F0L A;  5KIX A;  2EJM A;  1V1P B;  1IW7 C;  4K2L A;  2PZW A;  4RGN A;  1I4R A;  1Z47 A;  1CZG A;  3D6W A;  2D5D A;  1CFM A;  1F9P A;  1RTN A;  2MJ8 A;  3I72 A;  1KNE A;  1F2M A;  5E4X A;  1Z6H A;  4G7Z C;  3I90 A;  2ICE C;  2WP8 J;  1H9R A;  4KTA A;  3GV6 A;  3QIA A;  4IN3 A;  2L55 A;  2IWH A;  1MGS A;  2E76 C;  3S1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...