2RVLA

Solution structure of the chromodomain of hp1alpha with the n-terminal tail
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
83
Chain Sequence
GSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extended string-like binding of the phosphorylated HP1 alpha N-terminal tail to the lysine 9-methylated histone H3 tail
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Chromobox protein homolog 5
total genus 9
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rvlA00
5CMDA 1PFBA 2RVLA 3QO2A 3HP3A 5AFWA 2FMMA 4ZKBB 1X32A 1CM9A 2K01A 2X6LA 1F9QA 2B2YC 1BBXC 2DY8A 5EKIA 2SDFA 1PLFA 1ILQA 3KUPA 1HFNA 1EOTA 1DOLA 1JICA 1O80A 1RJTA 1B2TA 1E0BA 4NW2A 2B2UC 3TZDA 1G2SA 1U4RA 1HUMA 1MSHA 1Q3LA 2L11A 2RSNA 2X69A 1F9SA 3I90A 4QUCA 4R9WA 5CORA 4QUFA 4ZK9B 1HHVA 1SSOA 3TN2A 2CVRA 3F2UA 1B53A 1PFMA 1EIHA 1GUWA 5E4XA 1IL8A 1EQTA 4CJ2C 1BO0A 1DOMA 2N88A 4IUVA 1F2LA 2IL8A 2L9HA 5EPLA 4DN4M 1XX8A 5JJZA 3FDTA 4OIKA 1VMCA 4HAEA 1KNEA 5EQ0A 2H1EA 1WTWA 2MPMA 1XYIA 1RHPA 5EJWA 1TVXA 3DEOA 1QNKA 2K28A 1AP0A 4HEDA 2HCIA 2N55A 4XT1B 4CJ1B 1G2TA 1WTXA 2M2LA 1J8IA 2HCCA 2B2YA 3I91A 5T1IA 3GV3A 1MGSA 1NR4A 5EPKA 1B50A 3UI2A 2K04A 2B2WA 2EOTA 1G91A 2B2UA 1DONA 1ML0D 4U68A 4LMQD 4R8IA 1X3QA 2K03A 3KBXA 4IURA 2L12A 1LV9A 3Q6SA 1IKMA 1HRJA 3D6WA 1RTNA 1O7ZA 2FHTA 2K05A 2KOLA 1C8CA 2KVMA 4X3SA 2EE1A 1RODA 4X3UA 1WTOA 2Q8RE 1JE4A 1X3PA 2NWGA 1WTQA 1ZXTA 5D14A 1U4PA 1WTRA 2B2VA 3R93A 1CA6A 1KNAA 1BF4A 1PDQA 5CBAE 1U4LA 1DOKA 3I8ZA 3P7JA 1A15A 1MSGA 3SVMA 1EIGA 3DEPA 4MHEA 1NAPA 2FJ2A 2HDLA 5D65A 2JYOA 4ZKCB 1NCVA 2BDNA 1HUNA 2NYZD 2B2TC 4CJ0B 3I3CA 2VXWA 1SAPA 1QE6A 2EPBA 2R3ZA 4HSVA 1DZ1A 3IFDA 1IKLA 1RTOA 2J7ZA 2MP1A 1ESRA 2RSOA 3MWYW 4IUTA 4O42A 4ZLTF 2B2WC 5CBEE 1AZPA 2DY7A 5T1GA 1CA5A 4RA8A 5E4WC 4X3KA 1PFNA 3GV6A 2RA4A 1BNZA 2L4NA 4XDXA 1HA6A 3MTSA 5EPJA 1G6ZA 2X6GA 1ICWA 1M8AA 4RAUC 1O7YA 1J9OA 2FFKB 5COYA 3ONAB 3LWEA 3N52A 2KEDA 4IUPA 1WTPA 1F9RA 1HFGA 1S4ZA 3FPUB 4IUUA 2B2VC 3H91A 4XT3B 2NZ1D 1VMPA 2JP1A 1QG7A 2HUGA 4MN3A 2D9UA 1WD1A 1AZQA 2XIWA 2KECA 2MJ8A 1SDFA 2HDMA 1B4OA 1MI2A 1U4MA 4ZAIA 1WVLA 4UAIA 1F9PA 2KEEA 1B3AA 2KUMA 2MGSA 3G7LA 4IUQA 4RWSC 4X3TA 5DNFA 4HCSA 2B2TA 3DM1A 3IL8A 2K1BA 1WTVA 1EL0A 1WD0A 2Q8TA 2FINB 2L1BA 1ILPA 4OIJA 1NR2A
chains in the Genus database with same CATH superfamily
5CMDA 2F3VA 4K5VA 3HOVH 1PTOD 4C3JH 1BBXC 2NB0A 2E75C 4LF8Q 2JJQA 2LXKA 2EXZA 2RSNA 2OTJA 1Q3LA 4ZK9B 4PMWA 2UXBL 3TN2A 1HTLD 1JWSD 2CVRA 3NUCA 4DV6L 1K9MC 3AFQA 4QQBX 2Z1CA 2JXMB 2QILA 2LY7A 1UEBA 2F0UA 4TRDA 2MO0A 1LYLA 2B63G 1JMCA 1EY7A 1CSPA 1STHA 2BH2A 4RFBA 4DR7L 1TY2A 4LFAQ 4NXNL 1LTBD 2B3GA 2Y0SE 5M9OA 3VA5A 2CFMA 2ES2A 5BN4A 4IJHA 3FKIB 4B08A 1CUKA 4K6LA 2KCMA 1WTHA 5IE8A 2BA0A 3NTKA 3ICEA 1MBYA 4LMQD 2O2LD 2BE5D 5LMNL 1X65A 4DNRB 1XXGA 1RTNA 3BJUA 3NBHA 1D2BA 4KHPQ 2JN4A 1IBML 5IYDG 1WTOA 3KF6A 3BG3A 1V1PB 1QILA 1HNXQ 2PW5A 4A3BG 1I94L 1VQ5A 2VY3A 4A3GB 4JBKA 4IFDJ 1BKBA 1EIGA 4DR2Q 4LFAL 2MUYA 4L5SA 4IPDA 5IP7H 4CJ0B 1EEFD 4JOIA 3MHBA 3SEBA 4QIWB 5HGQA 4DV0L 4RHSA 2NVYB 4NDXA 1EQVA 1BBUA 1TY0A 1GKHA 1KDCA 4OX9Q 1H9SB 5DLQE 2KBNA 3PUVA 4K2LA 4H13C 4GLAC 5M3MH 4HCEA 4JYAQ 3CCVA 4IO9A 1D6EC 3URYA 3PIPA 1ASYA 1F9RA 3D4RA 3QR8A 4H44C 4BY7H 1STEA 3F2CA 5HURA 3B6YA 3TEHB 5JPMC 2KECA 4A3LG 2CW0C 4LW1A 1CKNB 2D0OA 2MGSA 2F0WA 1SE3A 4B3RL 3CC7A 1DXMA 4DK1A 4JI0L 1PH3A 5IT9c 1AW7A 4YHHQ 3TQYA 1SYDA 1LLRD 1R9TH 2R7DA 2Z6BA 3S16H 2F0LA 4A3LH 3F1ZA 4DV3L 4A3DH 2YU9H 4BY7G 2BOSA 1JOKA 4HMIA 5JVG3 3J7A5 1I4PA 3PO3B 4QUFA 3J81i 1SSOA 1YJ9A 5HGTA 4GNXB 3F2UA 1BXTA 2NVQH 1KQSA 2MQHA 4DAMA 1FGUA 1TS3A 3RN2A 2D5DA 4KV6A 1SE4A 4K8IA 1JQYD 4DN4M 1D8LA 4KN7C 4B3RQ 1IYVA 3PIOA 4FYDA 2RCNA 1N36Q 1XMOL 1VQLA 1RF2D 2PQAA 4DU9A 1RHPA 5LMNW 5M3FH 4A3FG 1OTCA 5K5PA 1XJVA 2PNRC 4GKKQ 5C4HA 2L55A 2HCCA 2A74C 5I4DA 1XNRL 2RF4A 3CRKC 4M8AA 4CDCC 2EOTA 3A56A 3E9HA 3CRLC 1L1OA 2KCCA 1PMRA 3KBXA 5BN5A 3JAME 5IYDH 4RCOA 3CCUA 2DN8A 3W1BA 4C2MB 1CZWA 2JSOA 1HA5A 2Q8IB 4OO1I 4A93B 3EQLC 2VS1A 1I5FA 2WAQB 3V05A 1U4PA 3VR2A 4JI0Q 3R93A 5LHY1 1RKNA 3RN5A 4C3IH 3DWAA 2K75A 2LFNA 2HDLA 1EY8A 4LK1C 2WP8J 1EZ8A 5C6AA 1AEXA 4YCVA 4JI7L 2NN6G 3L9AX 2RSOA 2F0MA 2TMPA 1U5KA 2B2WC 1TWFH 4DV3Q 5M5WB 5KYIA 2DNEA 2EY2A 1ET6A 3SK6A 4DAYA 1LT5D 5C44H 1E2ZA 3I70A 1O7YA 1VQEA 3NTIA 2FFKB 4TSSA 4GOPB 1Q8KA 1M1KC 4DR4L 1CK1A 2NUCA 3A0JA 4XT3B 3PUZA 4K5XA 1WD1A 4K8JA 3ULJA 3MZ5A 1FNVA 1WVLA 1SNQA 2A1AA 3DM1A 1EL0A 5ELNA 4GKKL 2HIVA 2OCEA 2F0NA 4JBJA 3PO2G 1X32A 5IGBA 2AUKA 2X6LA 3HOWB 2WFWA 1SYCA 2G9HD 3KLWA 5CV8A 4DV2L 1I6HB 1K8MA 2CWPA 1L1OC 2X69A 1N34Q 4R9WA 4BBRG 1W6JA 5KGUA 1HHVA 4QGUA 1XPRA 3PUXA 2QW7A 4KJOA 4L63B 3H0GH 4J1MA 3Q24A 1IXRA 1JJCB 3AMUA 2ASBA 1KDBA 2K52A 1HNZL 1TWHH 1TWCB 1GOZA 2F0DA 1LUZA 3GTLH 2I07B 2E2JB 4PMCA 3RNUA 2OQKA 1IL2A 1SYGA 2K7VA 1V1PA 4KHPL 1JCKB 2AQ2B 2NTSA 3S1MH 1UE5A 4DV6Q 1PH7A 2QEXA 2B2YA 2Z4IA 2XGTA 4LF9L 1H9RA 3E9IA 3NWSA 1I4HA 3UI2A 3J7AF 1DONA 1SE8A 1LV9A 2ZXRA 2FHTA 4A3CH 4GN4B 1C8CA 4A3CG 4LUOA 4J6HA 1H9SA 4X3UA 3OTOQ 1YVCA 1S72A 1XTDA 1ZXTA 2EXDA 3GTGH 4KLKA 1PDQA 3I8ZA 2J4XA 5KEEA 4JI3L 3NWTA 3L7ZC 4A3EB 3DWQA 1PXUA 4RH6A 3T1HQ 1XTCD 4A3IH 2E5LL 3S14B 4FF2A 1STBA 4C3HG 1SFOH 4DGZA 2JA6B 3I4NH 1PYWD 1Y8OB 4RA8A 2JEBI 4B3ML 3A7LA 4DXFA 1K73C 4IPCA 1I94Q 4LF5Q 4KMUC 3BS1A 2XWJB 1PH2A 1HH2P 3H0GG 1YJNA 1S3OA 1J9OA 3AFPA 1BCPD 3D8GA 2BDOA 2K5DA 5M5XH 3A5ZB 2UUBQ 4B3SL 1JB7A 3TREA 2JP1A 4WJ3M 3S1NH 3W5OA 1EYDA 1KL9A 1BUVT 4A3BH 2Z6KC 1UUPA 2F0KA 5IGEA 3GTKB 5JOBA 4DR6Q 3S17B 5IP9H 2K1BA 1K8AC 3I55A 1LTAD 5C5LA 2A6EC 5EKLA 3S24A 3ERQA 1BQQT 1Q90A 3HKZE 4L5TA 3RLNA 2K01A 1FNWA 2OQ0A 2RDFA 4EQOA 1F9QA 1YHAA 3ERSX 2PYKA 3MXPA 3KUPA 1DOLA 1S5BD 2Z4HA 1WYDA 1MSHA 1PRTB 1L0WA 2OF1A 5CORA 5K36G 1F2MA 4NXMQ 2XSCA 2R92H 1IBKL 1DGSA 2G5DA 3EN2A 4CJ2C 2CCZA 4DR6L 4IZ8A 3EIVA 3T16A 1W6KA 5D3DA 4H02A 3X3NA 1K8OA 1CQFA 1VMCA 1KNEA 2IHEA 3VYSA 2NN6H 2NVQB 3K0YA 5EAYA 1HZCA 4ME5A 4ME3A 1SNMA 2K5VA 2A6HC 3SK4A 5JEAJ 1TWFB 5M5WH 3E6ZX 1A3UA 4GN5A 4P2CB 5T1IA 4R1JA 3OIPA 4XTCS 1ML0D 4IURA 1IKMA 4LF4L 4IN3A 1G8ZD 5FLMH 2KOLA 3HEJA 1GUSA 2K5NA 2EE1A 4XYQA 4A3KB 3GQBA 2A6HD 1RD9D 4PZ7A 3NENA 4GLXA 2CWAA 1QB5D 3BYTB 3K81C 2Z6KA 3PUYA 3WDNA 3BVGA 3P75A 1HTPA 2F0PA 3JAML 4GNXC 2NYZD 1PRTF 2GVAA 2ZTEA 4ZUIA 3JAMc 1L0YB 2NVXB 2J7ZA 4XXEA 2R6GA 4ZLTF 4XQJA 4IUTA 4Q0FA 4XQNA 4UY8C 1M4VA 3KJPA 1I6HH 3GV6A 1K3RA 1LTGD 1IBKQ 2RBMA 3HKSA 4QMGA 1TT2A 4DXGA 2K33A 1SNDA 5IYBG 1JWMD 3GP7A 2MJ8A 3S2HB 1A6XA 1MI2A 2E2IH 1NSNS 2A19A 4LF9Q 4IFDI 1P16A 1PFSA 3IL8A 3HOXH 4M1UB 1E7ZA 3A8JE 1YNJC 3KF8A 4OIJA 1U9RA 3HOUB 2A69D 5GQOA 3QO2A 3LGJA 1H9KA 5AFWA 1R4QB 4ZKBB 4C1NI 2ZJQA 4KTAA 3K80C 1Q12A 4YIJA 5FLXL 4DR5L 4A3MH 4DV4L 4A3EG 3GTPB 5LMNQ 3I90A 4FF3A 5GADC 3CPWA 4JI7Q 1E2VA 5EKKA 2RKSA 1SMXA 4AQYQ 3HOZB 3BZKA 2P5ZX 4DV7Q 3GTGB 4FNFA 4C3HB 2JA6G 4B3TQ 4EVOA 4BY1B 1SYBA 4ZCKA 5DM63 4A3EH 1JOOA 5EQ0A 2H1EA 4XIGS 3TDQA 1WTWA 1GUNA 2EYMA 2ZXOA 4A3IB 1NNXA 3IAYA 1SR3A 4L8JA 3MVVA 4HEDA 3NSWA 1TWAH 1Z9FA 5FLXc 2A6ED 1VQHA 4IFDH 1CKOA 4O0AA 4YHHL 4A3KG 1F2YA 3M3YH 2Z0SA 4OONA 2BH8A 4KKSA 1JE5A 3E0JA 3IRBA 1HJPA 1XNRQ 1A8VA 2F4VL 3D6WA 3M4OB 1IYUA 2K05A 4G7OC 1EYGA 5C3EH 2KA7A 2KVMA 1FJGL 1AH9A 2C35B 4CBVA 3C3LA 3VR5A 1M90C 1TXYA 3RUZA 3A8KE 4UDUC 1LT4D 1OXSC 3CCLA 5FK9C 1RDPD 3K57A 3HOVB 1U4LA 1DM0B 4BXXH 3HGBA 4DV1L 1HNWL 2DGYA 1WI5A 1UE1A 1PYBA 1QE6A 4TVAB 4UP7A 3NBHB 4C1NK 3KOJA 1OXUA 3KF6B 2H5XA 2LSSA 4UPAA 3S14H 5L37A 5CV5A 1C9OA 1X55A 3LWEA 3PO2H 1EFWA 5ELFA 3J81j 4X66L 4IALA 3VR3A 2ICIA 1GO3E 3Q8DA 3G7LA 1QVCA 1LABA 1QWYA 1DJRD 2QCPX 2BA1A 4JI8L 2NZHA 3T53B 5A2QL 2VQEQ 2FMMA 1EEID 3HOYB 2Z8LA 1QVGA 5C3WA 5EKIA 3TRZA 2SDFA 4QY7A 5FOBB 1KRTA 1O80A 5TSSA 2JK8A 4HIDA 1HR0W 4DR1L 2D62A 1G2SA 1CKNA 1F9SA 4Q5VA 4DV7L 4A76A 3U50C 5E7NA 3EJIA 1I50B 4JPBW 3BZCA 1MKHA 4DR2L 1PRTD 3PO3H 2WB1G 4I7AA 2NN6I 1F2LA 1STNA 1N33Q 3CMEA 2MO1A 2R92B 2ZTCA 1TVXA 3ER0A 1UAPA 3VYTA 3T1YQ 1D5XC 2LMCB 1V1QA 2A69C 4QF4A 4IPHA 1IHZA 1MHWC 2K04A 1VCIA 1G91A 4OEMB 4EQNA 1OXTA 5BR8L 2DUDA 2F0VA 4E6IA 1HXYD 4JI5L 2R7ZG 1D5MC 4HJ8A 1G51A 4HN7A 3OOCA 3QWNA 2PQAB 1TIID 1JE4A 3K0XA 4TKOB 4LWCA 4POFA 5IY0A 1SN8A 3AB9A 1IBLQ 2PMZB 1A15A 1NBWA 3CHBD 2OWOA 3S1QB 2F0TA 1VQJA 2PO4A 2UXDL 4LFBQ 1VQAA 2QEJC 1ESRA 3U4VA 1SE2A 5LMUQ 3GTPH 1BNZA 4YWMA 3TMEA 2YU9B 2LXJA 2NVXH 4JV5Q 1V8QA 2X6GA 3G4SA 5JEAG 1N34L 2F0JA 1PTOC 1VQFA 4PG3A 1ESFA 2EVBA 2VQFL 1JC7A 4JG2A 3FVQA 4MN3A 2R7ZH 3GTQH 5J1ZA 3OWEB 3MXNB 1F9PA 1J8IA 4O1NA 1SLJA 3SE0A 4IUNA 2NVTH 4YY3Q 1WD0A 3JC66 3QOJA 3NP8A 4JOIC 4DAYB 2EIFA 1TKWB 4JI1Q 4ZQ3A 3M3YB 5E3FA 4QIWE 4GOPA 1ZEQX 1YNXA 1GD7A 2N78A 5F2DA 4A3JH 1K0RA 4R4IA 3A54A 1EYAA 1RL2A 5CGKA 2WIIB 2CH4A 2KCTA 1NJIC 1KABA 2AMCB 1EOVA 3SK5A 1O7IA 4LF8L 2PPBC 1OXXK 1BCPF 3PO3G 4QCLA 1XYIA 2PQEA 1XNQQ 1JWUD 1VQGA 2HCIA 1G2TA 1VQMA 1B1ZA 2R93B 4A75A 3U4ZA 4DAPA 1V43A 4DK0A 1MGSA 1NR4A 4JC0A 1LTLA 3HKZB 1O7LA 3TP8A 4EGVA 4A3FB 1E2WA 3A8IE 5C4JB 4NXNQ 4L6TB 2ALYB 4MNOA 4CKBA 1SXTA 2E74C 4DV5L 1AFPA 4B9WA 4IOAA 4RMFA 3S2HH 5C3EB 3D31A 3K6OA 3RD4A 3CC2A 2JYOA 4K0KQ 1HUNA 3S15B 1BCPC 5HY6A 5KYLA 3CU7A 4HSVA 3IFDA 4APVA 2MP1A 1PYSB 3SXHA 3HOWH 3U58A 3V96A 1VF7A 5E4WC 3NQIA 2J0TD 2RA4A 3BDLA 4GOPC 5JVH3 3OIQA 4BXXG 1B70B 5K36H 2EYLA 4X62L 4DF7A 4YWLA 1HFGA 2QDBA 1Y69U 2R93G 2SNMA 2HUGA 1QVFA 2F0SA 5I9PA 3ULPA 1U4MA 3J80c 2F4VQ 4OWXB 1WTVA 3DHQA 2K5HA 3I56A 1EUJA 3GTKH 4WJWA 1GUTA 3S1MB 3AEVA 4OXPA 2B2YC 3UDGA 2PZTA 5GAGC 1HFNA 1EOTA 5BN3A 1E0BA 4NW2A 1ENFA 1L0XB 3BU2A 3DMUA 2N3SA 2YTXA 4AQYL 1PTOF 4N9PA 3I4LA 1LTSD 2L9HA 3I2ZA 4GZYC 3I7FA 1SFOB 2JA6H 2Q2IA 4HAEA 3EFXD 3HKZG 4KK7A 1CI3M 3MXGA 2HD3A 3H0GB 2UUCL 5CR3A 3E3XA 2N55A 4XT1B 1I6VC 3PV0A 2JA7G 2CH4W 2I0QA 2I5LX 2F0GA 4V190 4U68A 1SJHD 1X3QA 5IWAQ 4A3BB 1HRJA 4A3GG 1O7ZA 4JBWA 2VB2X 2JQOA 1MJEA 1SNPA 3FKIH 4X3SA 4NP5A 4JI6Q 3G6EA 3PO2B 1WFQA 5H1SE 1QOHA 1X3FA 1KAWA 3IKJA 5M3MG 3SVMA 4P71A 2TSSA 1VQKA 4Y7NH 1FVIA 5D65A 4MHEA 2K6AA 2ZJRA 1F77A 1HNXL 3S2DH 4NKLA 1ASZA 4AH6A 1ZYRC 3KFUA 1SAPA 5C0XJ 4DR4Q 3MXNA 2D2CC 4LFCQ 4BBSB 2XWBB 2AQ3B 1JJ2A 1XMQL 2I46A 1FL0A 2RHQB 3FEWX 2CQAA 4HMJA 3NTHA 1ICFB 2QGQA 1XPUA 2AQ1B 4NXML 2B39A 3OHXC 1PA6A 1QZGA 3F2DA 3MXUA 4IPGA 2UUAL 1NUCA 2B2VC 1OXVA 3P20A 3IFTA 1B4OA 4ZAIA 1EY6A 2XTIA 4BWGB 2ZT9C 1EQQA 3F8TA 4LAAA 4BY7B 3E0EA 5C4XG 2XVSA 1Q86C 4WFN3 1CM9A 3KBGA 3G48A 2WV6D 1NMGA 3D6CA 3KDFB 3JAMi 1JB3A 3TP5A 5CYUA 4DUYL 5A35A 2VQEL 3KLRA 3I91A 4UP8A 2EQSA 1AZQA 1D7QA 3UDIA 2B29A 2F0OA 3HOYG 3HRZC 4EX5A 1EIHA 5NUCA 3A7AB 4JI1L 4AYBG 1EQRA 3KF8B 1RIPA 3K8AA 5JJZA 3WOEA 2NTTA 2A68D 3RZDH 4DV2Q 2R61A 1BOSA 3ULLA 5G3LF 1PTOB 2K28A 1KC8C 1HZBA 3CW2C 2WB1B 1O78A 4I7ZC 3NQTA 2O4XA 3UE0A 4LF4Q 3C46A 4C3IG 1Q46A 2B2WA 2JA9A 4DR5Q 5M3FB 4U673 1IW7C 3GTOH 2QA4A 3G71A 1CZGA 2K50A 5KNDA 2HHHL 1X54A 1FR3A 1YZ6A 5D14A 1D1KA 1PH8A 3J81L 2VL6A 3KJOA 4IFDG 2E2IB 4PQXA 2RCFA 4KD4A 1Z6HA 1NAPA 2IJ0A 2VUMB 1DD2A 1NCVA 1Q1EA 2XRSD 3C2PA 3I4NG 3CPFA 3I3CA 2VXWA 1T9HA 2F0EA 1XMOQ 5CBEE 3QJYA 2QDLA 5ELDA 3LX0A 4CDFC 4C3HH 4HTHA 1JOQA 4ALPA 1PH4A 1A62A 3ITPA 4JI3Q 4RAUC 3FMCA 1A3VA 1IBMQ 1S5DD 4V0BA 1CQVA 5JAVA 1UWVA 2JA7B 2EJGC 2JA5H 1TWAB 1TWGB 3BDCA 2QKIC 1BR9A 5AJ3Q 2EYPA 2EY1A 5DNFA 5KIXA 3R2TA 4BA2I 1EIYB 3W3AA 4UP9A 2UUBL 4CKEA 4KHZA 2PZUA 1I4RA 5ELOA 3CMAA 3HP3A 4LF7L 4DV4Q 3RZOB 4P75A 1KLGD 1B2TA 1GHKA 5IYBH 2E2HB 1E24A 3C1EA 3FRPB 2FXQA 4KY6A 4F8MA 1S5ED 2VUMG 1HZAA 4X6AH 4HR7B 1CFMA 1SNCA 3UDXA 2XN9C 2Q2TA 3PMFA 2Y0SG 2IX1A 2MHVA 1BO0A 2EYJA 1SMYD 1HZ9A 2N49A 2MPMA 3HS0C 4HJ9A 1LO5D 1GVPA 3S15H 1P8LA 4LNQA 4BY1G 1YIJA 2JA8B 4GKJQ 5ELEA 2HQEA 3OMCA 3EBEA 2B2UA 2UU9L 1ENCA 3M4YA 1J5EQ 5J39A 1II3A 3A74A 3EROA 4R8IA 1PH9A 1FJGQ 2LKVA 2KENA 3ND8A 4BA1I 1VQIA 3PQIA 5GROA 2BCOA 3BDOA 3CAMA 4DK3C 1NMFA 2NWGA 1VQBA 3QG1A 5ISRA 3DXJC 5IOCA 1CA6A 1KNAA 3RLOA 2UXCQ 1TS4A 4CGYB 3SK8A 4RHRA 2K4KA 1K83H 3K5MA 4HSPA 3ZJYC 1SMYC 1C0AA 3W2DA 2F52A 3SGIA 3HOZG 2F0HA 1DZ1A 1G6PA 4Y52H 3J80L 3H94A 1B9NA 4G4KA 4CKCA 3HOYH 2WB1E 2HT1A 2UU9Q 4RGOS 5JJLA 3HFZB 5EPJA 2PW7A 2R92G 2YTVA 4BBSH 4FVMA 3K58A 2VB3X 4J15A 3D4DA 4HIMA 3ONAB 1WTPA 1GM5A 3CQZB 4IUUA 5DAUA 4DNTB 2NZ1D 2AWOA 1QG7A 3NEMA 2V1CC 5AJ3L 1QNUA 4RGMA 2OT2A 2ATWA 4X64Q 4DUYQ 3M85A 1H95A 4X62Q 4HCSA 1SROA 2B2TA 4GKJL 3GTQB 2R7ZB 1KD1C 2L5TA 3S1NB 4AIMA 1CT1D 3D3RA 3TBIB 4IOCA 1RCVD 3S17H 5JPNC 1PLFA 1SYFA 1YNND 3Q23A 1YITA 4K5WA 1A3TA 2AHOB 1B53A 1PFMA 1K3BC 1IL8A 1E22A 1YBYA 2V4DA 3OW2A 1EWIA 2ENBA 1DOMA 4X64L 5FJ8G 4RGNA 3STBD 1VQPA 3OPOA 2VUMH 1A0IA 2HQLA 3K5OA 4EQPA 5I6WA 1UE7A 3QOLA 4DR3Q 4LFBL 1I3QB 2ID0A 3NK9A 4L5QA 1AP0A 3V2TA 2GA4B 1QUQA 2KHJA 4RG1A 4B3TL 5CV4A 4C2MH 4L5RC 4FXKC 1WCMG 1XWEA 3SHLA 1B50A 5EGTA 4DV1Q 4B3MQ 1W2BA 3WOFA 5FKAC 4R8NA 4P72A 3CCSA 4C56C 1FYCA 2OXPA 4DR7Q 1B8AA 2NZOA 4ZRZA 3KYHC 5JJKA 1Y14B 1PH6A 2JA7H 4PV1C 1KRSA 2C5CA 4DFAA 1ONLA 3KLSA 1TWGH 1WTRA 2KQ3A 5J3BA 5JEAH 1BF4A 3RR5A 5GAEC 2UXBQ 4JBMA 4ZKCB 2NVTB 3STBC 2B2TC 1EFID 1H9MA 2EPBA 2R3ZA 3RZOH 1K0SA 3MWYW 3NELA 5IP7G 4NPSA 4QL5A 1QZHA 2F4IA 4FXGC 2SNSA 3U9OA 1AE3A 4WORA 5EBCA 1HA6A 2YTYA 1CSQA 1M8AA 3N6RA 1S5FD 1UE6A 2F03A 1Q7YC 1AN8A 1TQOA 4N8FA 1VMPA 1WCMB 2ZTDA 2XIWA 3I4OA 1SDFA 1VQ6A 1FD7D 4Z9CB 1SJED 4LUZA 4UAIA 2ZJPA 1VQ9A 3S1RB 4K0KL 2EY5A 1F2ZA 2WINB 2Q8TA 3RZDB 1J5EL 4K6DA 4JI2L 3SR1A 1B7YB 2RVLA 5C4JH 1CHPD 2R93H 1WJJA 1FGBD 3J81c 3J7AV 1MIUA 2IPKD 4JI4L 4KI0A 1SBBB 1PH5A 1TWCH 1TWHB 2L11A 4DUZL 4QUCA 3DM3A 3HOWG 1GUWA 2ZM6Q 5E4XA 4OO1H 3QB3A 3O13A 4GN3B 3GO5A 1PV4A 4IUVA 2E76C 1HR0L 1VQCA 1BDOA 2IL8A 1G291 4A3JB 3UE1A 3T1HL 3J80i 1YNNC 3SDZA 2F0QA 4KD3A 3HOZH 1KXLA 1A2TA 3OW7A 4RGTA 4WJ4A 1WTXA 1KIXA 1Y1VB 1Y1WB 2E2DC 4RKLA 1SNOA 2SEBD 2IWHA 3K7AB 1STAA 2L12A 3HOVG 3Q6SA 4DK6C 2UXDQ 1EU3A 5C4XH 2JA8H 4DV5Q 4ZYSA 3TZUA 1EIFA 1PVOA 1ZKOA 4KY5A 5CV7A 3WWVA 4POGA 1R4PB 1W3SA 1LT3D 4GLVB 5JJIA 3T4AC 2K14A 4CDEC 3Q0AA 2RQXA 4MTKA 5DM73 4FP5D 1EZ6A 2IHFA 4RCNA 4NMZA 1IKLA 1EYCA 2A68C 4O42A 4F7XA 2PI2A 4KJNA 1N8RC 3F2BA 3MA2B 4X3KA 4R4OA 4A3JG 2ZM6L 1K8GA 3L0OA 3DLLA 1X3GA 3D0FA 3H15A 1STYA 1ICWA 1BBWA 5COYA 4B9XA 4DAVA 3EA6A 5KNBA 1J6QA 4JVZA 4OL7A 4A3DG 3FKIG 2HHHQ 4H0LC 1ENAA 5CV9A 1Q8IA 4A3GH 3J7YW 4IUQA 1B3AA 2KUMA 4HJ5A 2M9VA 2PNHA 3K59A 5I2XA 4FDBA 4ULLA 2FINB 1G6ZA 3VR4A 5KNCA 3NHHA 1PZKD 2WKCA 1E1OA 1XMQQ 4JW0A 2WAQG 3M4QA 4JI4Q 2IY5B 1MD2D 2JE6I 3VYRA 3U9SA 4R4TA 1JICA 4A4IA 4DUZQ 1VQ7A 4DNIA 1DCZA 1QUQB 2EDGA 1U4RA 1HUMA 1GUGA 1QCBD 4OGQC 5CV6A 1D1IA 4YCUA 1LTID 2NVYH 2E8GA 1VS0A 2WAQE 3CF5A 3GTMH 1MJCA 2DJGC 4R4CA 2F3IA 2XNAC 1X6OA 2Q2UA 2ICEC 5C0XH 3L2PA 4PZ8A 4OIKA 4X66Q 2EYOA 3KDFA 5FO8B 3M7NA 4MIUA 1I50H 2Z9HA 3DEOA 3CD6A 2O5IC 3I73A 5FO9B 3S2DB 2VQFQ 3NPPA 2VW9A 1D5ZC 3M4PA 4LF6L 1LTTD 5FO7B 2HIXA 2IX0A 3T1YL 5IODA 2I5HA 4KHVA 3PIP3 1EY4A 2WACA 3LNNA 2D0PA 4DR1Q 1GHJA 2MFIA 4DR3L 2I5MX 3PGZA 2EYFA 5IT9L 1LM0A 1Z47A 1WCMH 1A63A 3K7UC 1X3PA 2XRQD 1NY4A 4XQQA 2B2VA 1K28A 3TSSA 1NTGA 2IX3A 2O5JC 3HG9A 4HIKA 2JEAI 5FJ8H 2AUJD 3LWUA 1PRTC 4LF6Q 5IYCG 1N36L 3R8BA 4AYBE 2B63H 4G7ZC 5M3MB 1Y8PB 1E3PA 4Y7NB 5C5MA 3PF4A 2L4NA 4DKAC 3KLSX 2DJFC 5ELCA 2AKWB 1VQNA 2PCFB 1CKMA 2FMCA 2NBFA 2PI2E 3L3OC 1Y1VG 1Y1WG 3HOUH 1PZID 5KRUA 2B8GA 1YHBA 2HDMA 4CDDC 1TS5A 2YV5A 1X56A 3BZDB 4GNXA 1HQMC 1U0LA 1IBLL 1N33L 3S16B 2K5WA 4A93H 2CW0D 5D3IB 5IGFA 4A3MB 1KAAA 4H7BA 1SEBD 4FF1A 2B8FA 1Y1VH 3GDEA 1Y1WH 3GTOB 3OSOA 4O2DA 2BE5C 4OELB 2KHIA 4WRDA 3TP6A 3CP0A 4JI6L 4DPGA 1ILQA 5I6YA 5DEHA 3BYYB 4X65L 5LMUL 4F87A 1L2FA 5C4XB 1BCPB 4BY1H 1LT6D 5CBAE 3J7ZC 2ZXPA 3G6JB 1EQTA 1L1OB 2RDHA 1XX8A 3MFYA 1T5XD 3NE5B 4OHJA 4B3SQ 5IWAL 2H4OA 4P74A 4DA2A 3X3MA 4AYBB 4CJ1B 4C3JB 2QF7A 3HZXA 5E1FA 4YY3L 1Z7TA 5IGGA 4FXDA 4N9TA 3BVZA 4I65A 2K03A 1PTOH 3PSIA 2JA5B 1ET9A 5C3EG 4PMBA 3T56B 3KK7A 4C3IB 4LFCL 2LS01 1KHIA 2VNUD 1TR5A 5J22A 5M3FG 4A3FH 3GTJB 4FF4A 2A8VA 1I4XA 3PCOB 1CHQD 3GTLB 2E2JH 1A2UA 2DNCA 4YWKA 4BBRB 3I4MB 4OX9L 1PH1A 3CCMA 1HPCA 4X65Q 3NXWA 2CQOA 4JCVE 3CCQA 5C44B 2Y0SB 1N9WA 5T1GA 2GVBA 2RHSB 5C0XG 1X9NA 3QIAA 5G3LD 5I2YA 1PFNA 4JYAL 2E2HH 2F1MA 3VDYA 3N52A 2KEDA 3RMHA 4NB3A 4MTNA 4A3MG 3VR6A 3OYYA 3HOXG 4UHVA 4X3TA 1V1OA 4LF7Q 1S5CD 3A5UA 4LUVA 2JA5G 2L1BA 1ILPA 2A5HA 2KJXA 4JI2Q 4EQ5A 2DY8A 5LL6S 3RLFA 1UEAB 2E5LQ 1JJGA 4KKUA 2B2UC 2IW3A 4HJ7A 3CC4A 5M5YH 3VA7A 2EY6A 3I4NB 3A55A 1EY5A 4HJAA 1SRUA 4GS3A 1KLUD 1H9JA 3Q22A 4K2KA 2PMZE 4RKBA 3H3VH 2VZAA 1VQ4A 2N88A 2F0IA 5EPLA 4F88A 4ODGA 3D4WA 1HR0Q 5FLXE 3GTMB 2F3WA 1CTMA 1TU2B 1KTKA 2IT1A 1R9TB 1Q81C 2CHBD 3K5NA 4HIOA 2PZWA 3J81E 3EVQA 1T5EA 3TS2A 3GV3A 3CCRA 2EZVA 1B9MA 4A93G 1V9PA 4JV5L 2L0CA 1GXDC 4TQUS 4LF5L 4OWTB 2N8NA 1YNJD 3AYHB 3S1QH 2JA8G 3HOUG 4DV0Q 3CQZH 3E5SA 2Q8RE 3I72A 4KKTA 3MEHA 4QJFA 3H3VC 3OWFA 4BBSG 5C44G 2RDGA 3TS0A 4LJZC 2FJ2A 2BDNA 1LACA 1I4GA 3OMGA 3H3VI 3CCJA 5IT9E 4K14A 3T13A 4QB4A 1HNWQ 1QJOA 1K83B 3T51B 5M5XB 1C4QA 2MNAA 2KCNA 4XDXA 4G57A 4OO1G 1HCZA 4MZ9A 5IYCH 1NE3A 1Q1BA 1AE2A 1HQRD 4C3JG 1B3QA 1S4ZA 3TP7A 3DWPA 1EY0A 5GAHC 1EWCA 3MAQA 4PNYA 5LL6X 3CXCA 1XNQL 3UDFA 3VYUA 2L15A 1JORA 4KN4C 1X3EA 2KEEA 2UUAQ 3M9BA 5IP9G 2R7FA 1C7YA 4A3KH 5BR8Q 4P73A 1S40A 2Q2HA 4PZ6A 4A3DB 1NR2A 2G9DA 2EJMA 3FHWA 3W1GA 1PFBA 2AWNA 3S1RH 4IJLA 1E1TA 1B44D 1JT8A 3AQQA 3GD7A 4S3SA 1RJTA 1DYQA 1EWHA 3AU7A 3TZDA 1C48A 3I4MG 2CKZB 2KHSA 1VF5C 4IQZA 4JI8Q 5IGDA 2YYZA 2OTLA 3ND9A 4ABNA 3ZYYX 3GTJH 4A3IG 5A2QE 3MC0B 2SOBA 3CKIB 4ID6A 4JK1C 1LTRD 2K5QA 1KDAA 3BVMA 3PF5A 3FDTA 2C9OA 4J8QA 1YHQA 5EJWA 1QNKA 2F0FA 4FO2A 4XYOA 2M2LA 1YI2A 3C1FA 1STGA 5C4ZA 3NBIA 5EPKA 2B63B 4KY7A 5I9OA 3HOXB 1BVSA 5C0XI 3PIO3 3MFGA 1IW7D 3CCEA 3M7GA 1N32L 1FNUA 1I3QH 2GN5A 4ZUJA 4OWWB 3OTOL 3K5LA 4G7HC 3J80E 1IYJB 1RODA 3K7AH 1PHJA 2OEOA 1WTQA 3R3OA 3PUWA 1OO9B 2A73B 1DOKA 1EU4A 3P7JA 1VQOA 1MSGA 3DEPA 1SYEA 5IIFA 3MEFA 1UNSA 3H09A 2K32A 4CHTB 1GJXA 1EY9A 3FPPA 1XPOA 3P1HA 5EBDA 4BS9A 1GUOA 1RTOA 1YEZA 1AZPA 4YCWA 5CC4A 1ZYRD 2DY7A 3H6MA 4N8X1 1CA5A 4BBRH 5M5YB 3I4MH 4ILWA 1N32Q 2UXCL 3MTSA 1HNZQ 3FP9A 3M4OH 1Y8NB 5C3XA 1IZ6A 1VQDA 4IUPA 2EJFC 3FPUB 3DUZA 1Q82C 1JR0D 2M00A 3H91A 1PZJD 2WKDA 3S9WA 2D9UA 5ELBA 2UUCQ 5FLMG 1TS2A 1WOCA 1VQ8A 1VDZA 4JI5Q 1YJWA 1I4QA 4RWSC 2EYHA 4R4QA 3R2IA 5IGCA
chains in the Genus database with same CATH topology
5CMDA 2F3VA 4K5VA 1PTOD 1BBXC 2NB0A 2E75C 2EXZA 2RSNA 1Q3LA 4ZK9B 4PMWA 3TN2A 1HTLD 1JWSD 2CVRA 3NUCA 2Z1CA 2JXMB 2QILA 2LY7A 2F0UA 4TRDA 1EY7A 1STHA 4RFBA 1TY2A 1LTBD 5M9OA 3VA5A 5BN4A 3FKIB 4B08A 4K6LA 2BA0A 3NTKA 1MBYA 4LMQD 2O2LD 2BE5D 4DNRB 1XXGA 1RTNA 3NBHA 1D2BA 1WTOA 3BG3A 1V1PB 1QILA 2PW5A 4A3GB 4IFDJ 1EIGA 2MUYA 4CJ0B 1EEFD 3MHBA 3SEBA 4QIWB 4RHSA 2NVYB 4NDXA 1EQVA 1TY0A 1KDCA 1H9SB 3PUVA 4K2LA 4H13C 4HCEA 1D6EC 3URYA 1F9RA 3D4RA 4H44C 1STEA 5HURA 5JPMC 2KECA 2CW0C 2MGSA 2F0WA 1SE3A 1DXMA 4DK1A 1AW7A 1SYDA 1LLRD 2F0LA 2BOSA 5JVG3 1JOKA 4HMIA 1I4PA 3PO3B 4QUFA 1SSOA 5HGTA 3F2UA 1BXTA 1TS3A 2D5DA 4KV6A 1SE4A 4K8IA 1JQYD 4DN4M 4KN7C 1IYVA 4FYDA 1RF2D 4DU9A 1RHPA 5K5PA 2PNRC 5C4HA 2L55A 2HCCA 2A74C 5I4DA 3CRKC 4M8AA 2EOTA 3A56A 3CRLC 2KCCA 1PMRA 3KBXA 5BN5A 3JAME 4RCOA 2DN8A 4C2MB 1CZWA 2JSOA 1HA5A 2Q8IB 4OO1I 4A93B 3EQLC 2WAQB 3V05A 1U4PA 3VR2A 3R93A 5LHY1 1RKNA 3DWAA 2LFNA 2HDLA 1EY8A 4LK1C 2WP8J 1EZ8A 5C6AA 1AEXA 2NN6G 3L9AX 2RSOA 2F0MA 2TMPA 2B2WC 5M5WB 5KYIA 2DNEA 2EY2A 1ET6A 3SK6A 4DAYA 1LT5D 1E2ZA 3I70A 1O7YA 3NTIA 2FFKB 4TSSA 1CK1A 2NUCA 4XT3B 3PUZA 4K5XA 1WD1A 4K8JA 3MZ5A 1FNVA 1WVLA 1SNQA 3DM1A 1EL0A 2F0NA 1X32A 5IGBA 2AUKA 2X6LA 3HOWB 1SYCA 2G9HD 5CV8A 1I6HB 1K8MA 2X69A 4R9WA 5KGUA 1W6JA 1HHVA 3PUXA 4L63B 4KJOA 4J1MA 3Q24A 3AMUA 1KDBA 1TWCB 1GOZA 2F0DA 2I07B 2E2JB 4PMCA 1SYGA 2K7VA 1V1PA 1JCKB 2AQ2B 2NTSA 2B2YA 2Z4IA 1H9RA 3UI2A 3NWSA 3J7AF 1I4HA 1DONA 1LV9A 2ZXRA 2FHTA 1C8CA 4J6HA 1H9SA 4X3UA 1ZXTA 1PDQA 3I8ZA 2J4XA 5KEEA 3NWTA 3L7ZC 4A3EB 3DWQA 1PXUA 4RH6A 3S14B 1XTCD 4FF2A 1STBA 4C3HG 2JA6B 4DGZA 1PYWD 1Y8OB 4RA8A 2JEBI 3A7LA 4DXFA 4KMUC 3BS1A 2XWJB 1J9OA 1BCPD 3D8GA 2BDOA 2K5DA 2JP1A 1EYDA 1BUVT 5IGEA 1UUPA 2F0KA 3GTKB 5JOBA 3S17B 2K1BA 1LTAD 5C5LA 2A6EC 5EKLA 3ERQA 1BQQT 1Q90A 2K01A 1FNWA 2RDFA 4EQOA 1F9QA 2PYKA 3MXPA 3KUPA 1DOLA 1S5BD 2Z4HA 1MSHA 1PRTB 2OF1A 5CORA 5K36G 1F2MA 2XSCA 4CJ2C 4IZ8A 3T16A 1W6KA 5D3DA 3X3NA 1K8OA 1CQFA 1VMCA 1KNEA 3VYSA 2NN6H 2NVQB 3K0YA 4ME5A 1SNMA 2A6HC 3SK4A 5JEAJ 1TWFB 3E6ZX 1A3UA 4P2CB 5T1IA 3OIPA 4XTCS 1ML0D 4IURA 1IKMA 4IN3A 1G8ZD 2KOLA 3HEJA 1GUSA 2EE1A 4XYQA 4A3KB 3GQBA 2A6HD 1RD9D 1QB5D 3BYTB 3PUYA 3WDNA 3BVGA 3P75A 1HTPA 2F0PA 3JAML 2NYZD 1PRTF 4ZUIA 1L0YB 2NVXB 4XXEA 2J7ZA 4ZLTF 2R6GA 4XQJA 4IUTA 4Q0FA 4XQNA 1M4VA 3GV6A 1LTGD 2RBMA 4QMGA 1TT2A 4DXGA 2K33A 1SNDA 1JWMD 3GP7A 2MJ8A 3S2HB 1A6XA 1MI2A 1NSNS 4IFDI 3IL8A 4M1UB 3A8JE 1YNJC 3KF8A 4OIJA 1U9RA 3HOUB 2A69D 3QO2A 1H9KA 5AFWA 1R4QB 4ZKBB 4C1NI 4KTAA 1Q12A 4YIJA 5FLXL 3GTPB 4FF3A 3I90A 1E2VA 5EKKA 2RKSA 3HOZB 3GTGB 4FNFA 4C3HB 4EVOA 4BY1B 1SYBA 5DM63 1JOOA 5EQ0A 2H1EA 4XIGS 3TDQA 1WTWA 1GUNA 2EYMA 2ZXOA 4A3IB 3IAYA 4HEDA 4L8JA 3MVVA 3NSWA 2A6ED 4IFDH 1F2YA 4KKSA 3E0JA 3M4OB 3D6WA 1IYUA 2K05A 4G7OC 2KA7A 2KVMA 4CBVA 3C3LA 3VR5A 3RUZA 3A8KE 4UDUC 1LT4D 1OXSC 5FK9C 1RDPD 3K57A 3HOVB 1U4LA 1DM0B 3HGBA 1QE6A 4C1NK 1OXUA 5CV5A 3LWEA 5ELFA 4IALA 3VR3A 2ICIA 3G7LA 1LABA 1QWYA 1DJRD 2QCPX 2BA1A 3T53B 5A2QL 2FMMA 1EEID 3HOYB 2Z8LA 5C3WA 5EKIA 2SDFA 5FOBB 1O80A 5TSSA 2D62A 1G2SA 1F9SA 4Q5VA 3EJIA 1I50B 1PRTD 2NN6I 1F2LA 1STNA 2R92B 1TVXA 1UAPA 3VYTA 1D5XC 2LMCB 2A69C 4QF4A 1IHZA 2K04A 1VCIA 1G91A 4EQNA 1OXTA 2F0VA 4E6IA 1HXYD 1D5MC 4HN7A 3OOCA 3QWNA 1TIID 1JE4A 4TKOB 3AB9A 2PMZB 1A15A 3CHBD 3S1QB 2F0TA 2PO4A 2QEJC 1ESRA 1SE2A 1BNZA 3TMEA 2YU9B 1V8QA 2X6GA 5JEAG 2F0JA 1PTOC 1ESFA 2EVBA 1JC7A 3FVQA 4MN3A 5J1ZA 3OWEB 1F9PA 1J8IA 4O1NA 3SE0A 4IUNA 1WD0A 3QOJA 3NP8A 1TKWB 4ZQ3A 3M3YB 5E3FA 1ZEQX 5F2DA 3A54A 1EYAA 5CGKA 2WIIB 1KABA 3SK5A 2PPBC 1OXXK 1BCPF 4QCLA 1XYIA 2PQEA 1JWUD 2HCIA 1G2TA 1B1ZA 2R93B 4DAPA 4DK0A 1V43A 1MGSA 1NR4A 3HKZB 1O7LA 3TP8A 4EGVA 4A3FB 1E2WA 3A8IE 5C4JB 4L6TB 4CKBA 1SXTA 2E74C 1AFPA 4B9WA 5C3EB 3D31A 3K6OA 3RD4A 2JYOA 1HUNA 3S15B 1BCPC 5KYLA 3CU7A 4HSVA 3IFDA 2MP1A 3SXHA 3V96A 1VF7A 5E4WC 3NQIA 2J0TD 2RA4A 3BDLA 5JVH3 3OIQA 5K36H 2EYLA 4DF7A 1HFGA 2QDBA 1Y69U 2SNMA 2HUGA 2F0SA 5I9PA 1U4MA 1WTVA 3DHQA 4WJWA 1GUTA 3S1MB 2B2YC 2PZTA 1HFNA 1EOTA 5BN3A 1E0BA 4NW2A 1ENFA 1L0XB 3DMUA 1PTOF 4N9PA 3I4LA 1LTSD 2L9HA 4GZYC 1SFOB 4HAEA 3EFXD 4KK7A 1CI3M 3MXGA 3H0GB 5CR3A 2N55A 4XT1B 1I6VC 3PV0A 2F0GA 4V190 4U68A 1SJHD 1X3QA 4A3BB 1HRJA 1O7ZA 4JBWA 2VB2X 1SNPA 4X3SA 4NP5A 3PO2B 1QOHA 3IKJA 3SVMA 2TSSA 5D65A 4MHEA 2K6AA 1F77A 4NKLA 1ZYRC 1SAPA 5C0XJ 3MXNA 2D2CC 4BBSB 2XWBB 2AQ3B 2I46A 3FEWX 2CQAA 4HMJA 3NTHA 2AQ1B 2B39A 3OHXC 3MXUA 1NUCA 2B2VC 1OXVA 3P20A 3IFTA 1B4OA 4ZAIA 1EY6A 4BWGB 2ZT9C 4LAAA 4BY7B 2XVSA 4WFN3 1CM9A 3KBGA 2WV6D 3D6CA 1JB3A 3TP5A 5CYUA 5A35A 3KLRA 3I91A 1AZQA 2F0OA 3HRZC 1EIHA 5NUCA 3A7AB 5JJZA 3WOEA 2NTTA 2A68D 2R61A 1BOSA 5G3LF 1PTOB 2K28A 2WB1B 1O78A 4I7ZC 3NQTA 2O4XA 3C46A 4C3IG 2B2WA 5M3FB 4U673 1IW7C 1CZGA 5KNDA 1FR3A 5D14A 1D1KA 3J81L 4IFDG 2E2IB 4PQXA 4KD4A 1Z6HA 1NAPA 2IJ0A 2VUMB 1DD2A 1NCVA 1Q1EA 2XRSD 3C2PA 3I3CA 2VXWA 2F0EA 5CBEE 3QJYA 5ELDA 3LX0A 1JOQA 4HTHA 3ITPA 4RAUC 3FMCA 1A3VA 1S5DD 4V0BA 1CQVA 5JAVA 2JA7B 2EJGC 1TWAB 1TWGB 3BDCA 2QKIC 1BR9A 2EYPA 2EY1A 5DNFA 5KIXA 3R2TA 4BA2I 3W3AA 4CKEA 4KHZA 2PZUA 1I4RA 3HP3A 3RZOB 1KLGD 1B2TA 1GHKA 2E2HB 3C1EA 3FRPB 4KY6A 4F8MA 1S5ED 4HR7B 1CFMA 1SNCA 2XN9C 3PMFA 2IX1A 2MHVA 1BO0A 2EYJA 1SMYD 2MPMA 3HS0C 1LO5D 2JA8B 5ELEA 2HQEA 3OMCA 2B2UA 1ENCA 3M4YA 5J39A 1II3A 3EROA 4R8IA 2LKVA 3ND8A 4BA1I 2BCOA 3BDOA 2NWGA 3QG1A 5ISRA 3DXJC 5IOCA 1CA6A 1KNAA 1TS4A 4CGYB 3SK8A 4RHRA 3K5MA 4HSPA 1SMYC 3W2DA 2F0HA 1DZ1A 3J80L 3H94A 1B9NA 4G4KA 4CKCA 4RGOS 5EPJA 2PW7A 4FVMA 3K58A 2VB3X 3D4DA 3ONAB 1WTPA 3CQZB 4IUUA 5DAUA 4DNTB 2NZ1D 2AWOA 1QG7A 1QNUA 4RGMA 2OT2A 3M85A 4HCSA 2B2TA 3GTQB 2R7ZB 2L5TA 3S1NB 1CT1D 3D3RA 3TBIB 1RCVD 5JPNC 1PLFA 1SYFA 1YNND 3Q23A 4K5WA 1A3TA 1B53A 1PFMA 1IL8A 2V4DA 2ENBA 1DOMA 4RGNA 3OPOA 3K5OA 4EQPA 5I6WA 3QOLA 1I3QB 2ID0A 3NK9A 1AP0A 3V2TA 2GA4B 5CV4A 4FXKC 1XWEA 3SHLA 1B50A 5EGTA 3WOFA 5FKAC 4R8NA 4C56C 1FYCA 2OXPA 4ZRZA 4PV1C 2C5CA 4DFAA 1ONLA 3KLSA 1WTRA 2KQ3A 5JEAH 1BF4A 4ZKCB 2NVTB 2B2TC 1EFID 1H9MA 2EPBA 2R3ZA 3MWYW 2F4IA 4FXGC 2SNSA 3U9OA 4WORA 5EBCA 1HA6A 1M8AA 3N6RA 1S5FD 2F03A 1AN8A 1TQOA 1VMPA 1WCMB 2XIWA 1SDFA 1FD7D 4Z9CB 1SJED 4UAIA 3S1RB 2EY5A 1F2ZA 2WINB 2Q8TA 3RZDB 4K6DA 3SR1A 2RVLA 1CHPD 1FGBD 3J7AV 2IPKD 4KI0A 1SBBB 1TWHB 2L11A 4QUCA 1GUWA 5E4XA 4OO1H 3QB3A 3O13A 3GO5A 2E76C 4IUVA 2IL8A 1BDOA 1G291 4A3JB 1YNNC 3SDZA 2F0QA 4KD3A 1A2TA 3OW7A 4RGTA 1WTXA 1Y1VB 1Y1WB 2E2DC 4RKLA 1SNOA 2SEBD 2IWHA 3K7AB 1STAA 2L12A 3Q6SA 1EU3A 4ZYSA 3TZUA 1ZKOA 4KY5A 5CV7A 1R4PB 1LT3D 3T4AC 3Q0AA 2RQXA 5DM73 4FP5D 1EZ6A 4RCNA 4NMZA 1IKLA 1EYCA 2A68C 4O42A 4F7XA 4KJNA 3MA2B 4X3KA 1STYA 1ICWA 5COYA 4B9XA 4DAVA 3EA6A 5KNBA 4OL7A 4H0LC 1ENAA 5CV9A 1Q8IA 3J7YW 4IUQA 1B3AA 2KUMA 2M9VA 3K59A 5I2XA 4ULLA 2FINB 1G6ZA 3VR4A 5KNCA 3NHHA 1PZKD 2WKCA 1MD2D 2JE6I 3VYRA 3U9SA 1JICA 1DCZA 2EDGA 1U4RA 1HUMA 1GUGA 1QCBD 4OGQC 5CV6A 1D1IA 1LTID 2XNAC 2ICEC 5C0XH 4OIKA 2EYOA 5FO8B 3M7NA 4MIUA 3DEOA 2O5IC 3I73A 5FO9B 3S2DB 3NPPA 1D5ZC 1LTTD 5FO7B 2IX0A 5IODA 4KHVA 3PIP3 1EY4A 2WACA 3LNNA 1GHJA 2EYFA 5IT9L 1Z47A 1X3PA 2XRQD 4XQQA 2B2VA 3TSSA 2O5JC 2IX3A 3HG9A 2JEAI 2AUJD 3LWUA 1PRTC 3R8BA 4G7ZC 5M3MB 1Y8PB 4Y7NB 5C5MA 2L4NA 3KLSX 5ELCA 2PCFB 2FMCA 2NBFA 3L3OC 1PZID 5KRUA 2B8GA 2HDMA 1TS5A 3BZDB 1HQMC 3S16B 2K5WA 2CW0D 5D3IB 5IGFA 4A3MB 1KAAA 4H7BA 1SEBD 4FF1A 2B8FA 3GTOB 3OSOA 2BE5C 4WRDA 3TP6A 1ILQA 5I6YA 5DEHA 3BYYB 4F87A 5C4XB 1BCPB 1LT6D 5CBAE 2ZXPA 3G6JB 1EQTA 2RDHA 1XX8A 3MFYA 1T5XD 3NE5B 4OHJA 2H4OA 4DA2A 3X3MA 4AYBB 4CJ1B 4C3JB 2QF7A 3HZXA 5E1FA 1Z7TA 5IGGA 4FXDA 4N9TA 3BVZA 4I65A 2K03A 1PTOH 2JA5B 1ET9A 4PMBA 3T56B 3KK7A 4C3IB 2LS01 2VNUD 1TR5A 5J22A 3GTJB 4FF4A 1I4XA 1CHQD 3GTLB 1A2UA 2DNCA 4BBRB 3I4MB 1HPCA 3NXWA 5C44B 2Y0SB 5T1GA 5C0XG 3QIAA 5G3LD 5I2YA 1PFNA 2F1MA 3N52A 2KEDA 3RMHA 3VR6A 4X3TA 1V1OA 1S5CD 2L1BA 1ILPA 2A5HA 2KJXA 2DY8A 5LL6S 3RLFA 1UEAB 4KKUA 2B2UC 2IW3A 3VA7A 2EY6A 3I4NB 3A55A 1EY5A 1KLUD 1H9JA 3Q22A 4K2KA 4RKBA 2N88A 2F0IA 5EPLA 4F88A 4ODGA 3D4WA 5FLXE 3GTMB 2F3WA 1CTMA 1TU2B 1KTKA 2IT1A 1R9TB 2CHBD 3K5NA 2PZWA 3J81E 3EVQA 1T5EA 3GV3A 2EZVA 1B9MA 2L0CA 1GXDC 4TQUS 1YNJD 3E5SA 2Q8RE 3I72A 4KKTA 3MEHA 3H3VC 3OWFA 2RDGA 4LJZC 2FJ2A 2BDNA 1LACA 1I4GA 3OMGA 5IT9E 4K14A 3T13A 4QB4A 1QJOA 1K83B 3T51B 5M5XB 1C4QA 2KCNA 4XDXA 4G57A 4OO1G 1HCZA 1Q1BA 1HQRD 4C3JG 1S4ZA 3TP7A 3DWPA 1EY0A 1EWCA 3MAQA 4PNYA 5LL6X 3VYUA 1JORA 4KN4C 2KEEA 4A3DB 1NR2A 2G9DA 2EJMA 1PFBA 2AWNA 1B44D 3GD7A 4S3SA 1RJTA 1DYQA 1EWHA 3AU7A 3TZDA 1C48A 4IQZA 2KHSA 1VF5C 5IGDA 2YYZA 3ND9A 4ABNA 3ZYYX 5A2QE 3MC0B 2SOBA 3CKIB 1LTRD 4JK1C 4ID6A 2K5QA 1KDAA 3BVMA 3FDTA 2C9OA 4J8QA 5EJWA 1QNKA 2F0FA 4FO2A 4XYOA 2M2LA 3C1FA 1STGA 5C4ZA 3NBIA 5EPKA 2B63B 4KY7A 5I9OA 3HOXB 5C0XI 3PIO3 3MFGA 1IW7D 3M7GA 1FNUA 4ZUJA 3K5LA 4G7HC 3J80E 1RODA 2OEOA 1WTQA 3R3OA 1OO9B 2A73B 1DOKA 3PUWA 1EU4A 3P7JA 1MSGA 3DEPA 1SYEA 5IIFA 1UNSA 3H09A 2K32A 4CHTB 1GJXA 1EY9A 3FPPA 3P1HA 5EBDA 4BS9A 1GUOA 1RTOA 1AZPA 5CC4A 1ZYRD 2DY7A 3H6MA 1CA5A 5M5YB 4ILWA 3MTSA 1Y8NB 5C3XA 4IUPA 2EJFC 3FPUB 3DUZA 1JR0D 2M00A 3H91A 1PZJD 2WKDA 3S9WA 2D9UA 5ELBA 1TS2A 1VDZA 1I4QA 4RWSC 2EYHA 3R2IA 5IGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMD A;  1PFB A;  2RVL A;  3QO2 A;  3HP3 A;  5AFW A;  2FMM A;  4ZKB B;  1X32 A;  1CM9 A;  2K01 A;  2X6L A;  1F9Q A;  2B2Y C;  1BBX C;  2DY8 A;  5EKI A;  2SDF A;  1PLF A;  1ILQ A;  3KUP A;  1HFN A;  1EOT A;  1DOL A;  1JIC A;  1O80 A;  1RJT A;  1B2T A;  1E0B A;  4NW2 A;  2B2U C;  3TZD A;  1G2S A;  1U4R A;  1HUM A;  1MSH A;  1Q3L A;  2L11 A;  2RSN A;  2X69 A;  1F9S A;  3I90 A;  4QUC A;  4R9W A;  5COR A;  4QUF A;  4ZK9 B;  1HHV A;  1SSO A;  3TN2 A;  2CVR A;  3F2U A;  1B53 A;  1PFM A;  1EIH A;  1GUW A;  5E4X A;  1IL8 A;  1EQT A;  4CJ2 C;  1BO0 A;  1DOM A;  2N88 A;  4IUV A;  1F2L A;  2IL8 A;  2L9H A;  5EPL A;  4DN4 M;  1XX8 A;  5JJZ A;  3FDT A;  4OIK A;  1VMC A;  4HAE A;  1KNE A;  5EQ0 A;  2H1E A;  1WTW A;  2MPM A;  1XYI A;  1RHP A;  5EJW A;  1TVX A;  3DEO A;  1QNK A;  2K28 A;  1AP0 A;  4HED A;  2HCI A;  2N55 A;  4XT1 B;  4CJ1 B;  1G2T A;  1WTX A;  2M2L A;  1J8I A;  2HCC A;  2B2Y A;  3I91 A;  5T1I A;  3GV3 A;  1MGS A;  1NR4 A;  5EPK A;  1B50 A;  3UI2 A;  2K04 A;  2B2W A;  2EOT A;  1G91 A;  2B2U A;  1DON A;  1ML0 D;  4U68 A;  4LMQ D;  4R8I A;  1X3Q A;  2K03 A;  3KBX A;  4IUR A;  2L12 A;  1LV9 A;  3Q6S A;  1IKM A;  1HRJ A;  3D6W A;  1RTN A;  1O7Z A;  2FHT A;  2K05 A;  2KOL A;  1C8C A;  2KVM A;  4X3S A;  2EE1 A;  1ROD A;  4X3U A;  1WTO A;  2Q8R E;  1JE4 A;  1X3P A;  2NWG A;  1WTQ A;  1ZXT A;  5D14 A;  1U4P A;  1WTR A;  2B2V A;  3R93 A;  1CA6 A;  1KNA A;  1BF4 A;  1PDQ A;  5CBA E;  1U4L A;  1DOK A;  3I8Z A;  3P7J A;  1A15 A;  1MSG A;  3SVM A;  1EIG A;  3DEP A;  4MHE A;  1NAP A;  2FJ2 A;  2HDL A;  5D65 A;  2JYO A;  4ZKC B;  1NCV A;  2BDN A;  1HUN A;  2NYZ D;  2B2T C;  4CJ0 B;  3I3C A;  2VXW A;  1SAP A;  1QE6 A;  2EPB A;  2R3Z A;  4HSV A;  1DZ1 A;  3IFD A;  1IKL A;  1RTO A;  2J7Z A;  2MP1 A;  1ESR A;  2RSO A;  3MWY W;  4IUT A;  4O42 A;  4ZLT F;  2B2W C;  5CBE E;  1AZP A;  2DY7 A;  5T1G A;  1CA5 A;  4RA8 A;  5E4W C;  4X3K A;  1PFN A;  3GV6 A;  2RA4 A;  1BNZ A;  2L4N A;  4XDX A;  1HA6 A;  3MTS A;  5EPJ A;  1G6Z A;  2X6G A;  1ICW A;  1M8A A;  4RAU C;  1O7Y A;  1J9O A;  2FFK B;  5COY A;  3ONA B;  3LWE A;  3N52 A;  2KED A;  4IUP A;  1WTP A;  1F9R A;  1HFG A;  1S4Z A;  3FPU B;  4IUU A;  2B2V C;  3H91 A;  4XT3 B;  2NZ1 D;  1VMP A;  2JP1 A;  1QG7 A;  2HUG A;  4MN3 A;  2D9U A;  1WD1 A;  1AZQ A;  2XIW A;  2KEC A;  2MJ8 A;  1SDF A;  2HDM A;  1B4O A;  1MI2 A;  1U4M A;  4ZAI A;  1WVL A;  4UAI A;  1F9P A;  2KEE A;  1B3A A;  2KUM A;  2MGS A;  3G7L A;  4IUQ A;  4RWS C;  4X3T A;  5DNF A;  4HCS A;  2B2T A;  3DM1 A;  3IL8 A;  2K1B A;  1WTV A;  1EL0 A;  1WD0 A;  2Q8T A;  2FIN B;  2L1B A;  1ILP A;  4OIJ A;  1NR2 A; 
#chains in the Genus database with same CATH topology
 5CMD A;  2F3V A;  4K5V A;  3HOV H;  1PTO D;  4C3J H;  1BBX C;  2NB0 A;  2E75 C;  4LF8 Q;  2JJQ A;  2LXK A;  2EXZ A;  2RSN A;  2OTJ A;  1Q3L A;  4ZK9 B;  4PMW A;  2UXB L;  3TN2 A;  1HTL D;  1JWS D;  2CVR A;  3NUC A;  4DV6 L;  1K9M C;  3AFQ A;  4QQB X;  2Z1C A;  2JXM B;  2QIL A;  2LY7 A;  1UEB A;  2F0U A;  4TRD A;  2MO0 A;  1LYL A;  2B63 G;  1JMC A;  1EY7 A;  1CSP A;  1STH A;  2BH2 A;  4RFB A;  4DR7 L;  1TY2 A;  4LFA Q;  4NXN L;  1LTB D;  2B3G A;  2Y0S E;  5M9O A;  3VA5 A;  2CFM A;  2ES2 A;  5BN4 A;  4IJH A;  3FKI B;  4B08 A;  1CUK A;  4K6L A;  2KCM A;  1WTH A;  5IE8 A;  2BA0 A;  3NTK A;  3ICE A;  1MBY A;  4LMQ D;  2O2L D;  2BE5 D;  5LMN L;  1X65 A;  4DNR B;  1XXG A;  1RTN A;  3BJU A;  3NBH A;  1D2B A;  4KHP Q;  2JN4 A;  1IBM L;  5IYD G;  1WTO A;  3KF6 A;  3BG3 A;  1V1P B;  1QIL A;  1HNX Q;  2PW5 A;  4A3B G;  1I94 L;  1VQ5 A;  2VY3 A;  4A3G B;  4JBK A;  4IFD J;  1BKB A;  1EIG A;  4DR2 Q;  4LFA L;  2MUY A;  4L5S A;  4IPD A;  5IP7 H;  4CJ0 B;  1EEF D;  4JOI A;  3MHB A;  3SEB A;  4QIW B;  5HGQ A;  4DV0 L;  4RHS A;  2NVY B;  4NDX A;  1EQV A;  1BBU A;  1TY0 A;  1GKH A;  1KDC A;  4OX9 Q;  1H9S B;  5DLQ E;  2KBN A;  3PUV A;  4K2L A;  4H13 C;  4GLA C;  5M3M H;  4HCE A;  4JYA Q;  3CCV A;  4IO9 A;  1D6E C;  3URY A;  3PIP A;  1ASY A;  1F9R A;  3D4R A;  3QR8 A;  4H44 C;  4BY7 H;  1STE A;  3F2C A;  5HUR A;  3B6Y A;  3TEH B;  5JPM C;  2KEC A;  4A3L G;  2CW0 C;  4LW1 A;  1CKN B;  2D0O A;  2MGS A;  2F0W A;  1SE3 A;  4B3R L;  3CC7 A;  1DXM A;  4DK1 A;  4JI0 L;  1PH3 A;  5IT9 c;  1AW7 A;  4YHH Q;  3TQY A;  1SYD A;  1LLR D;  1R9T H;  2R7D A;  2Z6B A;  3S16 H;  2F0L A;  4A3L H;  3F1Z A;  4DV3 L;  4A3D H;  2YU9 H;  4BY7 G;  2BOS A;  1JOK A;  4HMI A;  5JVG 3;  3J7A 5;  1I4P A;  3PO3 B;  4QUF A;  3J81 i;  1SSO A;  1YJ9 A;  5HGT A;  4GNX B;  3F2U A;  1BXT A;  2NVQ H;  1KQS A;  2MQH A;  4DAM A;  1FGU A;  1TS3 A;  3RN2 A;  2D5D A;  4KV6 A;  1SE4 A;  4K8I A;  1JQY D;  4DN4 M;  1D8L A;  4KN7 C;  4B3R Q;  1IYV A;  3PIO A;  4FYD A;  2RCN A;  1N36 Q;  1XMO L;  1VQL A;  1RF2 D;  2PQA A;  4DU9 A;  1RHP A;  5LMN W;  5M3F H;  4A3F G;  1OTC A;  5K5P A;  1XJV A;  2PNR C;  4GKK Q;  5C4H A;  2L55 A;  2HCC A;  2A74 C;  5I4D A;  1XNR L;  2RF4 A;  3CRK C;  4M8A A;  4CDC C;  2EOT A;  3A56 A;  3E9H A;  3CRL C;  1L1O A;  2KCC A;  1PMR A;  3KBX A;  5BN5 A;  3JAM E;  5IYD H;  4RCO A;  3CCU A;  2DN8 A;  3W1B A;  4C2M B;  1CZW A;  2JSO A;  1HA5 A;  2Q8I B;  4OO1 I;  4A93 B;  3EQL C;  2VS1 A;  1I5F A;  2WAQ B;  3V05 A;  1U4P A;  3VR2 A;  4JI0 Q;  3R93 A;  5LHY 1;  1RKN A;  3RN5 A;  4C3I H;  3DWA A;  2K75 A;  2LFN A;  2HDL A;  1EY8 A;  4LK1 C;  2WP8 J;  1EZ8 A;  5C6A A;  1AEX A;  4YCV A;  4JI7 L;  2NN6 G;  3L9A X;  2RSO A;  2F0M A;  2TMP A;  1U5K A;  2B2W C;  1TWF H;  4DV3 Q;  5M5W B;  5KYI A;  2DNE A;  2EY2 A;  1ET6 A;  3SK6 A;  4DAY A;  1LT5 D;  5C44 H;  1E2Z A;  3I70 A;  1O7Y A;  1VQE A;  3NTI A;  2FFK B;  4TSS A;  4GOP B;  1Q8K A;  1M1K C;  4DR4 L;  1CK1 A;  2NUC A;  3A0J A;  4XT3 B;  3PUZ A;  4K5X A;  1WD1 A;  4K8J A;  3ULJ A;  3MZ5 A;  1FNV A;  1WVL A;  1SNQ A;  2A1A A;  3DM1 A;  1EL0 A;  5ELN A;  4GKK L;  2HIV A;  2OCE A;  2F0N A;  4JBJ A;  3PO2 G;  1X32 A;  5IGB A;  2AUK A;  2X6L A;  3HOW B;  2WFW A;  1SYC A;  2G9H D;  3KLW A;  5CV8 A;  4DV2 L;  1I6H B;  1K8M A;  2CWP A;  1L1O C;  2X69 A;  1N34 Q;  4R9W A;  4BBR G;  1W6J A;  5KGU A;  1HHV A;  4QGU A;  1XPR A;  3PUX A;  2QW7 A;  4KJO A;  4L63 B;  3H0G H;  4J1M A;  3Q24 A;  1IXR A;  1JJC B;  3AMU A;  2ASB A;  1KDB A;  2K52 A;  1HNZ L;  1TWH H;  1TWC B;  1GOZ A;  2F0D A;  1LUZ A;  3GTL H;  2I07 B;  2E2J B;  4PMC A;  3RNU A;  2OQK A;  1IL2 A;  1SYG A;  2K7V A;  1V1P A;  4KHP L;  1JCK B;  2AQ2 B;  2NTS A;  3S1M H;  1UE5 A;  4DV6 Q;  1PH7 A;  2QEX A;  2B2Y A;  2Z4I A;  2XGT A;  4LF9 L;  1H9R A;  3E9I A;  3NWS A;  1I4H A;  3UI2 A;  3J7A F;  1DON A;  1SE8 A;  1LV9 A;  2ZXR A;  2FHT A;  4A3C H;  4GN4 B;  1C8C A;  4A3C G;  4LUO A;  4J6H A;  1H9S A;  4X3U A;  3OTO Q;  1YVC A;  1S72 A;  1XTD A;  1ZXT A;  2EXD A;  3GTG H;  4KLK A;  1PDQ A;  3I8Z A;  2J4X A;  5KEE A;  4JI3 L;  3NWT A;  3L7Z C;  4A3E B;  3DWQ A;  1PXU A;  4RH6 A;  3T1H Q;  1XTC D;  4A3I H;  2E5L L;  3S14 B;  4FF2 A;  1STB A;  4C3H G;  1SFO H;  4DGZ A;  2JA6 B;  3I4N H;  1PYW D;  1Y8O B;  4RA8 A;  2JEB I;  4B3M L;  3A7L A;  4DXF A;  1K73 C;  4IPC A;  1I94 Q;  4LF5 Q;  4KMU C;  3BS1 A;  2XWJ B;  1PH2 A;  1HH2 P;  3H0G G;  1YJN A;  1S3O A;  1J9O A;  3AFP A;  1BCP D;  3D8G A;  2BDO A;  2K5D A;  5M5X H;  3A5Z B;  2UUB Q;  4B3S L;  1JB7 A;  3TRE A;  2JP1 A;  4WJ3 M;  3S1N H;  3W5O A;  1EYD A;  1KL9 A;  1BUV T;  4A3B H;  2Z6K C;  1UUP A;  2F0K A;  5IGE A;  3GTK B;  5JOB A;  4DR6 Q;  3S17 B;  5IP9 H;  2K1B A;  1K8A C;  3I55 A;  1LTA D;  5C5L A;  2A6E C;  5EKL A;  3S24 A;  3ERQ A;  1BQQ T;  1Q90 A;  3HKZ E;  4L5T A;  3RLN A;  2K01 A;  1FNW A;  2OQ0 A;  2RDF A;  4EQO A;  1F9Q A;  1YHA A;  3ERS X;  2PYK A;  3MXP A;  3KUP A;  1DOL A;  1S5B D;  2Z4H A;  1WYD A;  1MSH A;  1PRT B;  1L0W A;  2OF1 A;  5COR A;  5K36 G;  1F2M A;  4NXM Q;  2XSC A;  2R92 H;  1IBK L;  1DGS A;  2G5D A;  3EN2 A;  4CJ2 C;  2CCZ A;  4DR6 L;  4IZ8 A;  3EIV A;  3T16 A;  1W6K A;  5D3D A;  4H02 A;  3X3N A;  1K8O A;  1CQF A;  1VMC A;  1KNE A;  2IHE A;  3VYS A;  2NN6 H;  2NVQ B;  3K0Y A;  5EAY A;  1HZC A;  4ME5 A;  4ME3 A;  1SNM A;  2K5V A;  2A6H C;  3SK4 A;  5JEA J;  1TWF B;  5M5W H;  3E6Z X;  1A3U A;  4GN5 A;  4P2C B;  5T1I A;  4R1J A;  3OIP A;  4XTC S;  1ML0 D;  4IUR A;  1IKM A;  4LF4 L;  4IN3 A;  1G8Z D;  5FLM H;  2KOL A;  3HEJ A;  1GUS A;  2K5N A;  2EE1 A;  4XYQ A;  4A3K B;  3GQB A;  2A6H D;  1RD9 D;  4PZ7 A;  3NEN A;  4GLX A;  2CWA A;  1QB5 D;  3BYT B;  3K81 C;  2Z6K A;  3PUY A;  3WDN A;  3BVG A;  3P75 A;  1HTP A;  2F0P A;  3JAM L;  4GNX C;  2NYZ D;  1PRT F;  2GVA A;  2ZTE A;  4ZUI A;  3JAM c;  1L0Y B;  2NVX B;  2J7Z A;  4XXE A;  2R6G A;  4ZLT F;  4XQJ A;  4IUT A;  4Q0F A;  4XQN A;  4UY8 C;  1M4V A;  3KJP A;  1I6H H;  3GV6 A;  1K3R A;  1LTG D;  1IBK Q;  2RBM A;  3HKS A;  4QMG A;  1TT2 A;  4DXG A;  2K33 A;  1SND A;  5IYB G;  1JWM D;  3GP7 A;  2MJ8 A;  3S2H B;  1A6X A;  1MI2 A;  2E2I H;  1NSN S;  2A19 A;  4LF9 Q;  4IFD I;  1P16 A;  1PFS A;  3IL8 A;  3HOX H;  4M1U B;  1E7Z A;  3A8J E;  1YNJ C;  3KF8 A;  4OIJ A;  1U9R A;  3HOU B;  2A69 D;  5GQO A;  3QO2 A;  3LGJ A;  1H9K A;  5AFW A;  1R4Q B;  4ZKB B;  4C1N I;  2ZJQ A;  4KTA A;  3K80 C;  1Q12 A;  4YIJ A;  5FLX L;  4DR5 L;  4A3M H;  4DV4 L;  4A3E G;  3GTP B;  5LMN Q;  3I90 A;  4FF3 A;  5GAD C;  3CPW A;  4JI7 Q;  1E2V A;  5EKK A;  2RKS A;  1SMX A;  4AQY Q;  3HOZ B;  3BZK A;  2P5Z X;  4DV7 Q;  3GTG B;  4FNF A;  4C3H B;  2JA6 G;  4B3T Q;  4EVO A;  4BY1 B;  1SYB A;  4ZCK A;  5DM6 3;  4A3E H;  1JOO A;  5EQ0 A;  2H1E A;  4XIG S;  3TDQ A;  1WTW A;  1GUN A;  2EYM A;  2ZXO A;  4A3I B;  1NNX A;  3IAY A;  1SR3 A;  4L8J A;  3MVV A;  4HED A;  3NSW A;  1TWA H;  1Z9F A;  5FLX c;  2A6E D;  1VQH A;  4IFD H;  1CKO A;  4O0A A;  4YHH L;  4A3K G;  1F2Y A;  3M3Y H;  2Z0S A;  4OON A;  2BH8 A;  4KKS A;  1JE5 A;  3E0J A;  3IRB A;  1HJP A;  1XNR Q;  1A8V A;  2F4V L;  3D6W A;  3M4O B;  1IYU A;  2K05 A;  4G7O C;  1EYG A;  5C3E H;  2KA7 A;  2KVM A;  1FJG L;  1AH9 A;  2C35 B;  4CBV A;  3C3L A;  3VR5 A;  1M90 C;  1TXY A;  3RUZ A;  3A8K E;  4UDU C;  1LT4 D;  1OXS C;  3CCL A;  5FK9 C;  1RDP D;  3K57 A;  3HOV B;  1U4L A;  1DM0 B;  4BXX H;  3HGB A;  4DV1 L;  1HNW L;  2DGY A;  1WI5 A;  1UE1 A;  1PYB A;  1QE6 A;  4TVA B;  4UP7 A;  3NBH B;  4C1N K;  3KOJ A;  1OXU A;  3KF6 B;  2H5X A;  2LSS A;  4UPA A;  3S14 H;  5L37 A;  5CV5 A;  1C9O A;  1X55 A;  3LWE A;  3PO2 H;  1EFW A;  5ELF A;  3J81 j;  4X66 L;  4IAL A;  3VR3 A;  2ICI A;  1GO3 E;  3Q8D A;  3G7L A;  1QVC A;  1LAB A;  1QWY A;  1DJR D;  2QCP X;  2BA1 A;  4JI8 L;  2NZH A;  3T53 B;  5A2Q L;  2VQE Q;  2FMM A;  1EEI D;  3HOY B;  2Z8L A;  1QVG A;  5C3W A;  5EKI A;  3TRZ A;  2SDF A;  4QY7 A;  5FOB B;  1KRT A;  1O80 A;  5TSS A;  2JK8 A;  4HID A;  1HR0 W;  4DR1 L;  2D62 A;  1G2S A;  1CKN A;  1F9S A;  4Q5V A;  4DV7 L;  4A76 A;  3U50 C;  5E7N A;  3EJI A;  1I50 B;  4JPB W;  3BZC A;  1MKH A;  4DR2 L;  1PRT D;  3PO3 H;  2WB1 G;  4I7A A;  2NN6 I;  1F2L A;  1STN A;  1N33 Q;  3CME A;  2MO1 A;  2R92 B;  2ZTC A;  1TVX A;  3ER0 A;  1UAP A;  3VYT A;  3T1Y Q;  1D5X C;  2LMC B;  1V1Q A;  2A69 C;  4QF4 A;  4IPH A;  1IHZ A;  1MHW C;  2K04 A;  1VCI A;  1G91 A;  4OEM B;  4EQN A;  1OXT A;  5BR8 L;  2DUD A;  2F0V A;  4E6I A;  1HXY D;  4JI5 L;  2R7Z G;  1D5M C;  4HJ8 A;  1G51 A;  4HN7 A;  3OOC A;  3QWN A;  2PQA B;  1TII D;  1JE4 A;  3K0X A;  4TKO B;  4LWC A;  4POF A;  5IY0 A;  1SN8 A;  3AB9 A;  1IBL Q;  2PMZ B;  1A15 A;  1NBW A;  3CHB D;  2OWO A;  3S1Q B;  2F0T A;  1VQJ A;  2PO4 A;  2UXD L;  4LFB Q;  1VQA A;  2QEJ C;  1ESR A;  3U4V A;  1SE2 A;  5LMU Q;  3GTP H;  1BNZ A;  4YWM A;  3TME A;  2YU9 B;  2LXJ A;  2NVX H;  4JV5 Q;  1V8Q A;  2X6G A;  3G4S A;  5JEA G;  1N34 L;  2F0J A;  1PTO C;  1VQF A;  4PG3 A;  1ESF A;  2EVB A;  2VQF L;  1JC7 A;  4JG2 A;  3FVQ A;  4MN3 A;  2R7Z H;  3GTQ H;  5J1Z A;  3OWE B;  3MXN B;  1F9P A;  1J8I A;  4O1N A;  1SLJ A;  3SE0 A;  4IUN A;  2NVT H;  4YY3 Q;  1WD0 A;  3JC6 6;  3QOJ A;  3NP8 A;  4JOI C;  4DAY B;  2EIF A;  1TKW B;  4JI1 Q;  4ZQ3 A;  3M3Y B;  5E3F A;  4QIW E;  4GOP A;  1ZEQ X;  1YNX A;  1GD7 A;  2N78 A;  5F2D A;  4A3J H;  1K0R A;  4R4I A;  3A54 A;  1EYA A;  1RL2 A;  5CGK A;  2WII B;  2CH4 A;  2KCT A;  1NJI C;  1KAB A;  2AMC B;  1EOV A;  3SK5 A;  1O7I A;  4LF8 L;  2PPB C;  1OXX K;  1BCP F;  3PO3 G;  4QCL A;  1XYI A;  2PQE A;  1XNQ Q;  1JWU D;  1VQG A;  2HCI A;  1G2T A;  1VQM A;  1B1Z A;  2R93 B;  4A75 A;  3U4Z A;  4DAP A;  1V43 A;  4DK0 A;  1MGS A;  1NR4 A;  4JC0 A;  1LTL A;  3HKZ B;  1O7L A;  3TP8 A;  4EGV A;  4A3F B;  1E2W A;  3A8I E;  5C4J B;  4NXN Q;  4L6T B;  2ALY B;  4MNO A;  4CKB A;  1SXT A;  2E74 C;  4DV5 L;  1AFP A;  4B9W A;  4IOA A;  4RMF A;  3S2H H;  5C3E B;  3D31 A;  3K6O A;  3RD4 A;  3CC2 A;  2JYO A;  4K0K Q;  1HUN A;  3S15 B;  1BCP C;  5HY6 A;  5KYL A;  3CU7 A;  4HSV A;  3IFD A;  4APV A;  2MP1 A;  1PYS B;  3SXH A;  3HOW H;  3U58 A;  3V96 A;  1VF7 A;  5E4W C;  3NQI A;  2J0T D;  2RA4 A;  3BDL A;  4GOP C;  5JVH 3;  3OIQ A;  4BXX G;  1B70 B;  5K36 H;  2EYL A;  4X62 L;  4DF7 A;  4YWL A;  1HFG A;  2QDB A;  1Y69 U;  2R93 G;  2SNM A;  2HUG A;  1QVF A;  2F0S A;  5I9P A;  3ULP A;  1U4M A;  3J80 c;  2F4V Q;  4OWX B;  1WTV A;  3DHQ A;  2K5H A;  3I56 A;  1EUJ A;  3GTK H;  4WJW A;  1GUT A;  3S1M B;  3AEV A;  4OXP A;  2B2Y C;  3UDG A;  2PZT A;  5GAG C;  1HFN A;  1EOT A;  5BN3 A;  1E0B A;  4NW2 A;  1ENF A;  1L0X B;  3BU2 A;  3DMU A;  2N3S A;  2YTX A;  4AQY L;  1PTO F;  4N9P A;  3I4L A;  1LTS D;  2L9H A;  3I2Z A;  4GZY C;  3I7F A;  1SFO B;  2JA6 H;  2Q2I A;  4HAE A;  3EFX D;  3HKZ G;  4KK7 A;  1CI3 M;  3MXG A;  2HD3 A;  3H0G B;  2UUC L;  5CR3 A;  3E3X A;  2N55 A;  4XT1 B;  1I6V C;  3PV0 A;  2JA7 G;  2CH4 W;  2I0Q A;  2I5L X;  2F0G A;  4V19 0;  4U68 A;  1SJH D;  1X3Q A;  5IWA Q;  4A3B B;  1HRJ A;  4A3G G;  1O7Z A;  4JBW A;  2VB2 X;  2JQO A;  1MJE A;  1SNP A;  3FKI H;  4X3S A;  4NP5 A;  4JI6 Q;  3G6E A;  3PO2 B;  1WFQ A;  5H1S E;  1QOH A;  1X3F A;  1KAW A;  3IKJ A;  5M3M G;  3SVM A;  4P71 A;  2TSS A;  1VQK A;  4Y7N H;  1FVI A;  5D65 A;  4MHE A;  2K6A A;  2ZJR A;  1F77 A;  1HNX L;  3S2D H;  4NKL A;  1ASZ A;  4AH6 A;  1ZYR C;  3KFU A;  1SAP A;  5C0X J;  4DR4 Q;  3MXN A;  2D2C C;  4LFC Q;  4BBS B;  2XWB B;  2AQ3 B;  1JJ2 A;  1XMQ L;  2I46 A;  1FL0 A;  2RHQ B;  3FEW X;  2CQA A;  4HMJ A;  3NTH A;  1ICF B;  2QGQ A;  1XPU A;  2AQ1 B;  4NXM L;  2B39 A;  3OHX C;  1PA6 A;  1QZG A;  3F2D A;  3MXU A;  4IPG A;  2UUA L;  1NUC A;  2B2V C;  1OXV A;  3P20 A;  3IFT A;  1B4O A;  4ZAI A;  1EY6 A;  2XTI A;  4BWG B;  2ZT9 C;  1EQQ A;  3F8T A;  4LAA A;  4BY7 B;  3E0E A;  5C4X G;  2XVS A;  1Q86 C;  4WFN 3;  1CM9 A;  3KBG A;  3G48 A;  2WV6 D;  1NMG A;  3D6C A;  3KDF B;  3JAM i;  1JB3 A;  3TP5 A;  5CYU A;  4DUY L;  5A35 A;  2VQE L;  3KLR A;  3I91 A;  4UP8 A;  2EQS A;  1AZQ A;  1D7Q A;  3UDI A;  2B29 A;  2F0O A;  3HOY G;  3HRZ C;  4EX5 A;  1EIH A;  5NUC A;  3A7A B;  4JI1 L;  4AYB G;  1EQR A;  3KF8 B;  1RIP A;  3K8A A;  5JJZ A;  3WOE A;  2NTT A;  2A68 D;  3RZD H;  4DV2 Q;  2R61 A;  1BOS A;  3ULL A;  5G3L F;  1PTO B;  2K28 A;  1KC8 C;  1HZB A;  3CW2 C;  2WB1 B;  1O78 A;  4I7Z C;  3NQT A;  2O4X A;  3UE0 A;  4LF4 Q;  3C46 A;  4C3I G;  1Q46 A;  2B2W A;  2JA9 A;  4DR5 Q;  5M3F B;  4U67 3;  1IW7 C;  3GTO H;  2QA4 A;  3G71 A;  1CZG A;  2K50 A;  5KND A;  2HHH L;  1X54 A;  1FR3 A;  1YZ6 A;  5D14 A;  1D1K A;  1PH8 A;  3J81 L;  2VL6 A;  3KJO A;  4IFD G;  2E2I B;  4PQX A;  2RCF A;  4KD4 A;  1Z6H A;  1NAP A;  2IJ0 A;  2VUM B;  1DD2 A;  1NCV A;  1Q1E A;  2XRS D;  3C2P A;  3I4N G;  3CPF A;  3I3C A;  2VXW A;  1T9H A;  2F0E A;  1XMO Q;  5CBE E;  3QJY A;  2QDL A;  5ELD A;  3LX0 A;  4CDF C;  4C3H H;  4HTH A;  1JOQ A;  4ALP A;  1PH4 A;  1A62 A;  3ITP A;  4JI3 Q;  4RAU C;  3FMC A;  1A3V A;  1IBM Q;  1S5D D;  4V0B A;  1CQV A;  5JAV A;  1UWV A;  2JA7 B;  2EJG C;  2JA5 H;  1TWA B;  1TWG B;  3BDC A;  2QKI C;  1BR9 A;  5AJ3 Q;  2EYP A;  2EY1 A;  5DNF A;  5KIX A;  3R2T A;  4BA2 I;  1EIY B;  3W3A A;  4UP9 A;  2UUB L;  4CKE A;  4KHZ A;  2PZU A;  1I4R A;  5ELO A;  3CMA A;  3HP3 A;  4LF7 L;  4DV4 Q;  3RZO B;  4P75 A;  1KLG D;  1B2T A;  1GHK A;  5IYB H;  2E2H B;  1E24 A;  3C1E A;  3FRP B;  2FXQ A;  4KY6 A;  4F8M A;  1S5E D;  2VUM G;  1HZA A;  4X6A H;  4HR7 B;  1CFM A;  1SNC A;  3UDX A;  2XN9 C;  2Q2T A;  3PMF A;  2Y0S G;  2IX1 A;  2MHV A;  1BO0 A;  2EYJ A;  1SMY D;  1HZ9 A;  2N49 A;  2MPM A;  3HS0 C;  4HJ9 A;  1LO5 D;  1GVP A;  3S15 H;  1P8L A;  4LNQ A;  4BY1 G;  1YIJ A;  2JA8 B;  4GKJ Q;  5ELE A;  2HQE A;  3OMC A;  3EBE A;  2B2U A;  2UU9 L;  1ENC A;  3M4Y A;  1J5E Q;  5J39 A;  1II3 A;  3A74 A;  3ERO A;  4R8I A;  1PH9 A;  1FJG Q;  2LKV A;  2KEN A;  3ND8 A;  4BA1 I;  1VQI A;  3PQI A;  5GRO A;  2BCO A;  3BDO A;  3CAM A;  4DK3 C;  1NMF A;  2NWG A;  1VQB A;  3QG1 A;  5ISR A;  3DXJ C;  5IOC A;  1CA6 A;  1KNA A;  3RLO A;  2UXC Q;  1TS4 A;  4CGY B;  3SK8 A;  4RHR A;  2K4K A;  1K83 H;  3K5M A;  4HSP A;  3ZJY C;  1SMY C;  1C0A A;  3W2D A;  2F52 A;  3SGI A;  3HOZ G;  2F0H A;  1DZ1 A;  1G6P A;  4Y52 H;  3J80 L;  3H94 A;  1B9N A;  4G4K A;  4CKC A;  3HOY H;  2WB1 E;  2HT1 A;  2UU9 Q;  4RGO S;  5JJL A;  3HFZ B;  5EPJ A;  2PW7 A;  2R92 G;  2YTV A;  4BBS H;  4FVM A;  3K58 A;  2VB3 X;  4J15 A;  3D4D A;  4HIM A;  3ONA B;  1WTP A;  1GM5 A;  3CQZ B;  4IUU A;  5DAU A;  4DNT B;  2NZ1 D;  2AWO A;  1QG7 A;  3NEM A;  2V1C C;  5AJ3 L;  1QNU A;  4RGM A;  2OT2 A;  2ATW A;  4X64 Q;  4DUY Q;  3M85 A;  1H95 A;  4X62 Q;  4HCS A;  1SRO A;  2B2T A;  4GKJ L;  3GTQ B;  2R7Z B;  1KD1 C;  2L5T A;  3S1N B;  4AIM A;  1CT1 D;  3D3R A;  3TBI B;  4IOC A;  1RCV D;  3S17 H;  5JPN C;  1PLF A;  1SYF A;  1YNN D;  3Q23 A;  1YIT A;  4K5W A;  1A3T A;  2AHO B;  1B53 A;  1PFM A;  1K3B C;  1IL8 A;  1E22 A;  1YBY A;  2V4D A;  3OW2 A;  1EWI A;  2ENB A;  1DOM A;  4X64 L;  5FJ8 G;  4RGN A;  3STB D;  1VQP A;  3OPO A;  2VUM H;  1A0I A;  2HQL A;  3K5O A;  4EQP A;  5I6W A;  1UE7 A;  3QOL A;  4DR3 Q;  4LFB L;  1I3Q B;  2ID0 A;  3NK9 A;  4L5Q A;  1AP0 A;  3V2T A;  2GA4 B;  1QUQ A;  2KHJ A;  4RG1 A;  4B3T L;  5CV4 A;  4C2M H;  4L5R C;  4FXK C;  1WCM G;  1XWE A;  3SHL A;  1B50 A;  5EGT A;  4DV1 Q;  4B3M Q;  1W2B A;  3WOF A;  5FKA C;  4R8N A;  4P72 A;  3CCS A;  4C56 C;  1FYC A;  2OXP A;  4DR7 Q;  1B8A A;  2NZO A;  4ZRZ A;  3KYH C;  5JJK A;  1Y14 B;  1PH6 A;  2JA7 H;  4PV1 C;  1KRS A;  2C5C A;  4DFA A;  1ONL A;  3KLS A;  1TWG H;  1WTR A;  2KQ3 A;  5J3B A;  5JEA H;  1BF4 A;  3RR5 A;  5GAE C;  2UXB Q;  4JBM A;  4ZKC B;  2NVT B;  3STB C;  2B2T C;  1EFI D;  1H9M A;  2EPB A;  2R3Z A;  3RZO H;  1K0S A;  3MWY W;  3NEL A;  5IP7 G;  4NPS A;  4QL5 A;  1QZH A;  2F4I A;  4FXG C;  2SNS A;  3U9O A;  1AE3 A;  4WOR A;  5EBC A;  1HA6 A;  2YTY A;  1CSQ A;  1M8A A;  3N6R A;  1S5F D;  1UE6 A;  2F03 A;  1Q7Y C;  1AN8 A;  1TQO A;  4N8F A;  1VMP A;  1WCM B;  2ZTD A;  2XIW A;  3I4O A;  1SDF A;  1VQ6 A;  1FD7 D;  4Z9C B;  1SJE D;  4LUZ A;  4UAI A;  2ZJP A;  1VQ9 A;  3S1R B;  4K0K L;  2EY5 A;  1F2Z A;  2WIN B;  2Q8T A;  3RZD B;  1J5E L;  4K6D A;  4JI2 L;  3SR1 A;  1B7Y B;  2RVL A;  5C4J H;  1CHP D;  2R93 H;  1WJJ A;  1FGB D;  3J81 c;  3J7A V;  1MIU A;  2IPK D;  4JI4 L;  4KI0 A;  1SBB B;  1PH5 A;  1TWC H;  1TWH B;  2L11 A;  4DUZ L;  4QUC A;  3DM3 A;  3HOW G;  1GUW A;  2ZM6 Q;  5E4X A;  4OO1 H;  3QB3 A;  3O13 A;  4GN3 B;  3GO5 A;  1PV4 A;  4IUV A;  2E76 C;  1HR0 L;  1VQC A;  1BDO A;  2IL8 A;  1G29 1;  4A3J B;  3UE1 A;  3T1H L;  3J80 i;  1YNN C;  3SDZ A;  2F0Q A;  4KD3 A;  3HOZ H;  1KXL A;  1A2T A;  3OW7 A;  4RGT A;  4WJ4 A;  1WTX A;  1KIX A;  1Y1V B;  1Y1W B;  2E2D C;  4RKL A;  1SNO A;  2SEB D;  2IWH A;  3K7A B;  1STA A;  2L12 A;  3HOV G;  3Q6S A;  4DK6 C;  2UXD Q;  1EU3 A;  5C4X H;  2JA8 H;  4DV5 Q;  4ZYS A;  3TZU A;  1EIF A;  1PVO A;  1ZKO A;  4KY5 A;  5CV7 A;  3WWV A;  4POG A;  1R4P B;  1W3S A;  1LT3 D;  4GLV B;  5JJI A;  3T4A C;  2K14 A;  4CDE C;  3Q0A A;  2RQX A;  4MTK A;  5DM7 3;  4FP5 D;  1EZ6 A;  2IHF A;  4RCN A;  4NMZ A;  1IKL A;  1EYC A;  2A68 C;  4O42 A;  4F7X A;  2PI2 A;  4KJN A;  1N8R C;  3F2B A;  3MA2 B;  4X3K A;  4R4O A;  4A3J G;  2ZM6 L;  1K8G A;  3L0O A;  3DLL A;  1X3G A;  3D0F A;  3H15 A;  1STY A;  1ICW A;  1BBW A;  5COY A;  4B9X A;  4DAV A;  3EA6 A;  5KNB A;  1J6Q A;  4JVZ A;  4OL7 A;  4A3D G;  3FKI G;  2HHH Q;  4H0L C;  1ENA A;  5CV9 A;  1Q8I A;  4A3G H;  3J7Y W;  4IUQ A;  1B3A A;  2KUM A;  4HJ5 A;  2M9V A;  2PNH A;  3K59 A;  5I2X A;  4FDB A;  4ULL A;  2FIN B;  1G6Z A;  3VR4 A;  5KNC A;  3NHH A;  1PZK D;  2WKC A;  1E1O A;  1XMQ Q;  4JW0 A;  2WAQ G;  3M4Q A;  4JI4 Q;  2IY5 B;  1MD2 D;  2JE6 I;  3VYR A;  3U9S A;  4R4T A;  1JIC A;  4A4I A;  4DUZ Q;  1VQ7 A;  4DNI A;  1DCZ A;  1QUQ B;  2EDG A;  1U4R A;  1HUM A;  1GUG A;  1QCB D;  4OGQ C;  5CV6 A;  1D1I A;  4YCU A;  1LTI D;  2NVY H;  2E8G A;  1VS0 A;  2WAQ E;  3CF5 A;  3GTM H;  1MJC A;  2DJG C;  4R4C A;  2F3I A;  2XNA C;  1X6O A;  2Q2U A;  2ICE C;  5C0X H;  3L2P A;  4PZ8 A;  4OIK A;  4X66 Q;  2EYO A;  3KDF A;  5FO8 B;  3M7N A;  4MIU A;  1I50 H;  2Z9H A;  3DEO A;  3CD6 A;  2O5I C;  3I73 A;  5FO9 B;  3S2D B;  2VQF Q;  3NPP A;  2VW9 A;  1D5Z C;  3M4P A;  4LF6 L;  1LTT D;  5FO7 B;  2HIX A;  2IX0 A;  3T1Y L;  5IOD A;  2I5H A;  4KHV A;  3PIP 3;  1EY4 A;  2WAC A;  3LNN A;  2D0P A;  4DR1 Q;  1GHJ A;  2MFI A;  4DR3 L;  2I5M X;  3PGZ A;  2EYF A;  5IT9 L;  1LM0 A;  1Z47 A;  1WCM H;  1A63 A;  3K7U C;  1X3P A;  2XRQ D;  1NY4 A;  4XQQ A;  2B2V A;  1K28 A;  3TSS A;  1NTG A;  2IX3 A;  2O5J C;  3HG9 A;  4HIK A;  2JEA I;  5FJ8 H;  2AUJ D;  3LWU A;  1PRT C;  4LF6 Q;  5IYC G;  1N36 L;  3R8B A;  4AYB E;  2B63 H;  4G7Z C;  5M3M B;  1Y8P B;  1E3P A;  4Y7N B;  5C5M A;  3PF4 A;  2L4N A;  4DKA C;  3KLS X;  2DJF C;  5ELC A;  2AKW B;  1VQN A;  2PCF B;  1CKM A;  2FMC A;  2NBF A;  2PI2 E;  3L3O C;  1Y1V G;  1Y1W G;  3HOU H;  1PZI D;  5KRU A;  2B8G A;  1YHB A;  2HDM A;  4CDD C;  1TS5 A;  2YV5 A;  1X56 A;  3BZD B;  4GNX A;  1HQM C;  1U0L A;  1IBL L;  1N33 L;  3S16 B;  2K5W A;  4A93 H;  2CW0 D;  5D3I B;  5IGF A;  4A3M B;  1KAA A;  4H7B A;  1SEB D;  4FF1 A;  2B8F A;  1Y1V H;  3GDE A;  1Y1W H;  3GTO B;  3OSO A;  4O2D A;  2BE5 C;  4OEL B;  2KHI A;  4WRD A;  3TP6 A;  3CP0 A;  4JI6 L;  4DPG A;  1ILQ A;  5I6Y A;  5DEH A;  3BYY B;  4X65 L;  5LMU L;  4F87 A;  1L2F A;  5C4X B;  1BCP B;  4BY1 H;  1LT6 D;  5CBA E;  3J7Z C;  2ZXP A;  3G6J B;  1EQT A;  1L1O B;  2RDH A;  1XX8 A;  3MFY A;  1T5X D;  3NE5 B;  4OHJ A;  4B3S Q;  5IWA L;  2H4O A;  4P74 A;  4DA2 A;  3X3M A;  4AYB B;  4CJ1 B;  4C3J B;  2QF7 A;  3HZX A;  5E1F A;  4YY3 L;  1Z7T A;  5IGG A;  4FXD A;  4N9T A;  3BVZ A;  4I65 A;  2K03 A;  1PTO H;  3PSI A;  2JA5 B;  1ET9 A;  5C3E G;  4PMB A;  3T56 B;  3KK7 A;  4C3I B;  4LFC L;  2LS0 1;  1KHI A;  2VNU D;  1TR5 A;  5J22 A;  5M3F G;  4A3F H;  3GTJ B;  4FF4 A;  2A8V A;  1I4X A;  3PCO B;  1CHQ D;  3GTL B;  2E2J H;  1A2U A;  2DNC A;  4YWK A;  4BBR B;  3I4M B;  4OX9 L;  1PH1 A;  3CCM A;  1HPC A;  4X65 Q;  3NXW A;  2CQO A;  4JCV E;  3CCQ A;  5C44 B;  2Y0S B;  1N9W A;  5T1G A;  2GVB A;  2RHS B;  5C0X G;  1X9N A;  3QIA A;  5G3L D;  5I2Y A;  1PFN A;  4JYA L;  2E2H H;  2F1M A;  3VDY A;  3N52 A;  2KED A;  3RMH A;  4NB3 A;  4MTN A;  4A3M G;  3VR6 A;  3OYY A;  3HOX G;  4UHV A;  4X3T A;  1V1O A;  4LF7 Q;  1S5C D;  3A5U A;  4LUV A;  2JA5 G;  2L1B A;  1ILP A;  2A5H A;  2KJX A;  4JI2 Q;  4EQ5 A;  2DY8 A;  5LL6 S;  3RLF A;  1UEA B;  2E5L Q;  1JJG A;  4KKU A;  2B2U C;  2IW3 A;  4HJ7 A;  3CC4 A;  5M5Y H;  3VA7 A;  2EY6 A;  3I4N B;  3A55 A;  1EY5 A;  4HJA A;  1SRU A;  4GS3 A;  1KLU D;  1H9J A;  3Q22 A;  4K2K A;  2PMZ E;  4RKB A;  3H3V H;  2VZA A;  1VQ4 A;  2N88 A;  2F0I A;  5EPL A;  4F88 A;  4ODG A;  3D4W A;  1HR0 Q;  5FLX E;  3GTM B;  2F3W A;  1CTM A;  1TU2 B;  1KTK A;  2IT1 A;  1R9T B;  1Q81 C;  2CHB D;  3K5N A;  4HIO A;  2PZW A;  3J81 E;  3EVQ A;  1T5E A;  3TS2 A;  3GV3 A;  3CCR A;  2EZV A;  1B9M A;  4A93 G;  1V9P A;  4JV5 L;  2L0C A;  1GXD C;  4TQU S;  4LF5 L;  4OWT B;  2N8N A;  1YNJ D;  3AYH B;  3S1Q H;  2JA8 G;  3HOU G;  4DV0 Q;  3CQZ H;  3E5S A;  2Q8R E;  3I72 A;  4KKT A;  3MEH A;  4QJF A;  3H3V C;  3OWF A;  4BBS G;  5C44 G;  2RDG A;  3TS0 A;  4LJZ C;  2FJ2 A;  2BDN A;  1LAC A;  1I4G A;  3OMG A;  3H3V I;  3CCJ A;  5IT9 E;  4K14 A;  3T13 A;  4QB4 A;  1HNW Q;  1QJO A;  1K83 B;  3T51 B;  5M5X B;  1C4Q A;  2MNA A;  2KCN A;  4XDX A;  4G57 A;  4OO1 G;  1HCZ A;  4MZ9 A;  5IYC H;  1NE3 A;  1Q1B A;  1AE2 A;  1HQR D;  4C3J G;  1B3Q A;  1S4Z A;  3TP7 A;  3DWP A;  1EY0 A;  5GAH C;  1EWC A;  3MAQ A;  4PNY A;  5LL6 X;  3CXC A;  1XNQ L;  3UDF A;  3VYU A;  2L15 A;  1JOR A;  4KN4 C;  1X3E A;  2KEE A;  2UUA Q;  3M9B A;  5IP9 G;  2R7F A;  1C7Y A;  4A3K H;  5BR8 Q;  4P73 A;  1S40 A;  2Q2H A;  4PZ6 A;  4A3D B;  1NR2 A;  2G9D A;  2EJM A;  3FHW A;  3W1G A;  1PFB A;  2AWN A;  3S1R H;  4IJL A;  1E1T A;  1B44 D;  1JT8 A;  3AQQ A;  3GD7 A;  4S3S A;  1RJT A;  1DYQ A;  1EWH A;  3AU7 A;  3TZD A;  1C48 A;  3I4M G;  2CKZ B;  2KHS A;  1VF5 C;  4IQZ A;  4JI8 Q;  5IGD A;  2YYZ A;  2OTL A;  3ND9 A;  4ABN A;  3ZYY X;  3GTJ H;  4A3I G;  5A2Q E;  3MC0 B;  2SOB A;  3CKI B;  4ID6 A;  4JK1 C;  1LTR D;  2K5Q A;  1KDA A;  3BVM A;  3PF5 A;  3FDT A;  2C9O A;  4J8Q A;  1YHQ A;  5EJW A;  1QNK A;  2F0F A;  4FO2 A;  4XYO A;  2M2L A;  1YI2 A;  3C1F A;  1STG A;  5C4Z A;  3NBI A;  5EPK A;  2B63 B;  4KY7 A;  5I9O A;  3HOX B;  1BVS A;  5C0X I;  3PIO 3;  3MFG A;  1IW7 D;  3CCE A;  3M7G A;  1N32 L;  1FNU A;  1I3Q H;  2GN5 A;  4ZUJ A;  4OWW B;  3OTO L;  3K5L A;  4G7H C;  3J80 E;  1IYJ B;  1ROD A;  3K7A H;  1PHJ A;  2OEO A;  1WTQ A;  3R3O A;  3PUW A;  1OO9 B;  2A73 B;  1DOK A;  1EU4 A;  3P7J A;  1VQO A;  1MSG A;  3DEP A;  1SYE A;  5IIF A;  3MEF A;  1UNS A;  3H09 A;  2K32 A;  4CHT B;  1GJX A;  1EY9 A;  3FPP A;  1XPO A;  3P1H A;  5EBD A;  4BS9 A;  1GUO A;  1RTO A;  1YEZ A;  1AZP A;  4YCW A;  5CC4 A;  1ZYR D;  2DY7 A;  3H6M A;  4N8X 1;  1CA5 A;  4BBR H;  5M5Y B;  3I4M H;  4ILW A;  1N32 Q;  2UXC L;  3MTS A;  1HNZ Q;  3FP9 A;  3M4O H;  1Y8N B;  5C3X A;  1IZ6 A;  1VQD A;  4IUP A;  2EJF C;  3FPU B;  3DUZ A;  1Q82 C;  1JR0 D;  2M00 A;  3H91 A;  1PZJ D;  2WKD A;  3S9W A;  2D9U A;  5ELB A;  2UUC Q;  5FLM G;  1TS2 A;  1WOC A;  1VQ8 A;  1VDZ A;  4JI5 Q;  1YJW A;  1I4Q A;  4RWS C;  2EYH A;  4R4Q A;  3R2I A;  5IGC A; 
#chains in the Genus database with same CATH homology
 5CMD A;  2F3V A;  4K5V A;  1PTO D;  1BBX C;  2NB0 A;  2E75 C;  2EXZ A;  2RSN A;  1Q3L A;  4ZK9 B;  4PMW A;  3TN2 A;  1HTL D;  1JWS D;  2CVR A;  3NUC A;  2Z1C A;  2JXM B;  2QIL A;  2LY7 A;  2F0U A;  4TRD A;  1EY7 A;  1STH A;  4RFB A;  1TY2 A;  1LTB D;  5M9O A;  3VA5 A;  5BN4 A;  3FKI B;  4B08 A;  4K6L A;  2BA0 A;  3NTK A;  1MBY A;  4LMQ D;  2O2L D;  2BE5 D;  4DNR B;  1XXG A;  1RTN A;  3NBH A;  1D2B A;  1WTO A;  3BG3 A;  1V1P B;  1QIL A;  2PW5 A;  4A3G B;  4IFD J;  1EIG A;  2MUY A;  4CJ0 B;  1EEF D;  3MHB A;  3SEB A;  4QIW B;  4RHS A;  2NVY B;  4NDX A;  1EQV A;  1TY0 A;  1KDC A;  1H9S B;  3PUV A;  4K2L A;  4H13 C;  4HCE A;  1D6E C;  3URY A;  1F9R A;  3D4R A;  4H44 C;  1STE A;  5HUR A;  5JPM C;  2KEC A;  2CW0 C;  2MGS A;  2F0W A;  1SE3 A;  1DXM A;  4DK1 A;  1AW7 A;  1SYD A;  1LLR D;  2F0L A;  2BOS A;  5JVG 3;  1JOK A;  4HMI A;  1I4P A;  3PO3 B;  4QUF A;  1SSO A;  5HGT A;  3F2U A;  1BXT A;  1TS3 A;  2D5D A;  4KV6 A;  1SE4 A;  4K8I A;  1JQY D;  4DN4 M;  4KN7 C;  1IYV A;  4FYD A;  1RF2 D;  4DU9 A;  1RHP A;  5K5P A;  2PNR C;  5C4H A;  2L55 A;  2HCC A;  2A74 C;  5I4D A;  3CRK C;  4M8A A;  2EOT A;  3A56 A;  3CRL C;  2KCC A;  1PMR A;  3KBX A;  5BN5 A;  3JAM E;  4RCO A;  2DN8 A;  4C2M B;  1CZW A;  2JSO A;  1HA5 A;  2Q8I B;  4OO1 I;  4A93 B;  3EQL C;  2WAQ B;  3V05 A;  1U4P A;  3VR2 A;  3R93 A;  5LHY 1;  1RKN A;  3DWA A;  2LFN A;  2HDL A;  1EY8 A;  4LK1 C;  2WP8 J;  1EZ8 A;  5C6A A;  1AEX A;  2NN6 G;  3L9A X;  2RSO A;  2F0M A;  2TMP A;  2B2W C;  5M5W B;  5KYI A;  2DNE A;  2EY2 A;  1ET6 A;  3SK6 A;  4DAY A;  1LT5 D;  1E2Z A;  3I70 A;  1O7Y A;  3NTI A;  2FFK B;  4TSS A;  1CK1 A;  2NUC A;  4XT3 B;  3PUZ A;  4K5X A;  1WD1 A;  4K8J A;  3MZ5 A;  1FNV A;  1WVL A;  1SNQ A;  3DM1 A;  1EL0 A;  2F0N A;  1X32 A;  5IGB A;  2AUK A;  2X6L A;  3HOW B;  1SYC A;  2G9H D;  5CV8 A;  1I6H B;  1K8M A;  2X69 A;  4R9W A;  5KGU A;  1W6J A;  1HHV A;  3PUX A;  4L63 B;  4KJO A;  4J1M A;  3Q24 A;  3AMU A;  1KDB A;  1TWC B;  1GOZ A;  2F0D A;  2I07 B;  2E2J B;  4PMC A;  1SYG A;  2K7V A;  1V1P A;  1JCK B;  2AQ2 B;  2NTS A;  2B2Y A;  2Z4I A;  1H9R A;  3UI2 A;  3NWS A;  3J7A F;  1I4H A;  1DON A;  1LV9 A;  2ZXR A;  2FHT A;  1C8C A;  4J6H A;  1H9S A;  4X3U A;  1ZXT A;  1PDQ A;  3I8Z A;  2J4X A;  5KEE A;  3NWT A;  3L7Z C;  4A3E B;  3DWQ A;  1PXU A;  4RH6 A;  3S14 B;  1XTC D;  4FF2 A;  1STB A;  4C3H G;  2JA6 B;  4DGZ A;  1PYW D;  1Y8O B;  4RA8 A;  2JEB I;  3A7L A;  4DXF A;  4KMU C;  3BS1 A;  2XWJ B;  1J9O A;  1BCP D;  3D8G A;  2BDO A;  2K5D A;  2JP1 A;  1EYD A;  1BUV T;  5IGE A;  1UUP A;  2F0K A;  3GTK B;  5JOB A;  3S17 B;  2K1B A;  1LTA D;  5C5L A;  2A6E C;  5EKL A;  3ERQ A;  1BQQ T;  1Q90 A;  2K01 A;  1FNW A;  2RDF A;  4EQO A;  1F9Q A;  2PYK A;  3MXP A;  3KUP A;  1DOL A;  1S5B D;  2Z4H A;  1MSH A;  1PRT B;  2OF1 A;  5COR A;  5K36 G;  1F2M A;  2XSC A;  4CJ2 C;  4IZ8 A;  3T16 A;  1W6K A;  5D3D A;  3X3N A;  1K8O A;  1CQF A;  1VMC A;  1KNE A;  3VYS A;  2NN6 H;  2NVQ B;  3K0Y A;  4ME5 A;  1SNM A;  2A6H C;  3SK4 A;  5JEA J;  1TWF B;  3E6Z X;  1A3U A;  4P2C B;  5T1I A;  3OIP A;  4XTC S;  1ML0 D;  4IUR A;  1IKM A;  4IN3 A;  1G8Z D;  2KOL A;  3HEJ A;  1GUS A;  2EE1 A;  4XYQ A;  4A3K B;  3GQB A;  2A6H D;  1RD9 D;  1QB5 D;  3BYT B;  3PUY A;  3WDN A;  3BVG A;  3P75 A;  1HTP A;  2F0P A;  3JAM L;  2NYZ D;  1PRT F;  4ZUI A;  1L0Y B;  2NVX B;  4XXE A;  2J7Z A;  4ZLT F;  2R6G A;  4XQJ A;  4IUT A;  4Q0F A;  4XQN A;  1M4V A;  3GV6 A;  1LTG D;  2RBM A;  4QMG A;  1TT2 A;  4DXG A;  2K33 A;  1SND A;  1JWM D;  3GP7 A;  2MJ8 A;  3S2H B;  1A6X A;  1MI2 A;  1NSN S;  4IFD I;  3IL8 A;  4M1U B;  3A8J E;  1YNJ C;  3KF8 A;  4OIJ A;  1U9R A;  3HOU B;  2A69 D;  3QO2 A;  1H9K A;  5AFW A;  1R4Q B;  4ZKB B;  4C1N I;  4KTA A;  1Q12 A;  4YIJ A;  5FLX L;  3GTP B;  4FF3 A;  3I90 A;  1E2V A;  5EKK A;  2RKS A;  3HOZ B;  3GTG B;  4FNF A;  4C3H B;  4EVO A;  4BY1 B;  1SYB A;  5DM6 3;  1JOO A;  5EQ0 A;  2H1E A;  4XIG S;  3TDQ A;  1WTW A;  1GUN A;  2EYM A;  2ZXO A;  4A3I B;  3IAY A;  4HED A;  4L8J A;  3MVV A;  3NSW A;  2A6E D;  4IFD H;  1F2Y A;  4KKS A;  3E0J A;  3M4O B;  3D6W A;  1IYU A;  2K05 A;  4G7O C;  2KA7 A;  2KVM A;  4CBV A;  3C3L A;  3VR5 A;  3RUZ A;  3A8K E;  4UDU C;  1LT4 D;  1OXS C;  5FK9 C;  1RDP D;  3K57 A;  3HOV B;  1U4L A;  1DM0 B;  3HGB A;  1QE6 A;  4C1N K;  1OXU A;  5CV5 A;  3LWE A;  5ELF A;  4IAL A;  3VR3 A;  2ICI A;  3G7L A;  1LAB A;  1QWY A;  1DJR D;  2QCP X;  2BA1 A;  3T53 B;  5A2Q L;  2FMM A;  1EEI D;  3HOY B;  2Z8L A;  5C3W A;  5EKI A;  2SDF A;  5FOB B;  1O80 A;  5TSS A;  2D62 A;  1G2S A;  1F9S A;  4Q5V A;  3EJI A;  1I50 B;  1PRT D;  2NN6 I;  1F2L A;  1STN A;  2R92 B;  1TVX A;  1UAP A;  3VYT A;  1D5X C;  2LMC B;  2A69 C;  4QF4 A;  1IHZ A;  2K04 A;  1VCI A;  1G91 A;  4EQN A;  1OXT A;  2F0V A;  4E6I A;  1HXY D;  1D5M C;  4HN7 A;  3OOC A;  3QWN A;  1TII D;  1JE4 A;  4TKO B;  3AB9 A;  2PMZ B;  1A15 A;  3CHB D;  3S1Q B;  2F0T A;  2PO4 A;  2QEJ C;  1ESR A;  1SE2 A;  1BNZ A;  3TME A;  2YU9 B;  1V8Q A;  2X6G A;  5JEA G;  2F0J A;  1PTO C;  1ESF A;  2EVB A;  1JC7 A;  3FVQ A;  4MN3 A;  5J1Z A;  3OWE B;  1F9P A;  1J8I A;  4O1N A;  3SE0 A;  4IUN A;  1WD0 A;  3QOJ A;  3NP8 A;  1TKW B;  4ZQ3 A;  3M3Y B;  5E3F A;  1ZEQ X;  5F2D A;  3A54 A;  1EYA A;  5CGK A;  2WII B;  1KAB A;  3SK5 A;  2PPB C;  1OXX K;  1BCP F;  4QCL A;  1XYI A;  2PQE A;  1JWU D;  2HCI A;  1G2T A;  1B1Z A;  2R93 B;  4DAP A;  4DK0 A;  1V43 A;  1MGS A;  1NR4 A;  3HKZ B;  1O7L A;  3TP8 A;  4EGV A;  4A3F B;  1E2W A;  3A8I E;  5C4J B;  4L6T B;  4CKB A;  1SXT A;  2E74 C;  1AFP A;  4B9W A;  5C3E B;  3D31 A;  3K6O A;  3RD4 A;  2JYO A;  1HUN A;  3S15 B;  1BCP C;  5KYL A;  3CU7 A;  4HSV A;  3IFD A;  2MP1 A;  3SXH A;  3V96 A;  1VF7 A;  5E4W C;  3NQI A;  2J0T D;  2RA4 A;  3BDL A;  5JVH 3;  3OIQ A;  5K36 H;  2EYL A;  4DF7 A;  1HFG A;  2QDB A;  1Y69 U;  2SNM A;  2HUG A;  2F0S A;  5I9P A;  1U4M A;  1WTV A;  3DHQ A;  4WJW A;  1GUT A;  3S1M B;  2B2Y C;  2PZT A;  1HFN A;  1EOT A;  5BN3 A;  1E0B A;  4NW2 A;  1ENF A;  1L0X B;  3DMU A;  1PTO F;  4N9P A;  3I4L A;  1LTS D;  2L9H A;  4GZY C;  1SFO B;  4HAE A;  3EFX D;  4KK7 A;  1CI3 M;  3MXG A;  3H0G B;  5CR3 A;  2N55 A;  4XT1 B;  1I6V C;  3PV0 A;  2F0G A;  4V19 0;  4U68 A;  1SJH D;  1X3Q A;  4A3B B;  1HRJ A;  1O7Z A;  4JBW A;  2VB2 X;  1SNP A;  4X3S A;  4NP5 A;  3PO2 B;  1QOH A;  3IKJ A;  3SVM A;  2TSS A;  5D65 A;  4MHE A;  2K6A A;  1F77 A;  4NKL A;  1ZYR C;  1SAP A;  5C0X J;  3MXN A;  2D2C C;  4BBS B;  2XWB B;  2AQ3 B;  2I46 A;  3FEW X;  2CQA A;  4HMJ A;  3NTH A;  2AQ1 B;  2B39 A;  3OHX C;  3MXU A;  1NUC A;  2B2V C;  1OXV A;  3P20 A;  3IFT A;  1B4O A;  4ZAI A;  1EY6 A;  4BWG B;  2ZT9 C;  4LAA A;  4BY7 B;  2XVS A;  4WFN 3;  1CM9 A;  3KBG A;  2WV6 D;  3D6C A;  1JB3 A;  3TP5 A;  5CYU A;  5A35 A;  3KLR A;  3I91 A;  1AZQ A;  2F0O A;  3HRZ C;  1EIH A;  5NUC A;  3A7A B;  5JJZ A;  3WOE A;  2NTT A;  2A68 D;  2R61 A;  1BOS A;  5G3L F;  1PTO B;  2K28 A;  2WB1 B;  1O78 A;  4I7Z C;  3NQT A;  2O4X A;  3C46 A;  4C3I G;  2B2W A;  5M3F B;  4U67 3;  1IW7 C;  1CZG A;  5KND A;  1FR3 A;  5D14 A;  1D1K A;  3J81 L;  4IFD G;  2E2I B;  4PQX A;  4KD4 A;  1Z6H A;  1NAP A;  2IJ0 A;  2VUM B;  1DD2 A;  1NCV A;  1Q1E A;  2XRS D;  3C2P A;  3I3C A;  2VXW A;  2F0E A;  5CBE E;  3QJY A;  5ELD A;  3LX0 A;  1JOQ A;  4HTH A;  3ITP A;  4RAU C;  3FMC A;  1A3V A;  1S5D D;  4V0B A;  1CQV A;  5JAV A;  2JA7 B;  2EJG C;  1TWA B;  1TWG B;  3BDC A;  2QKI C;  1BR9 A;  2EYP A;  2EY1 A;  5DNF A;  5KIX A;  3R2T A;  4BA2 I;  3W3A A;  4CKE A;  4KHZ A;  2PZU A;  1I4R A;  3HP3 A;  3RZO B;  1KLG D;  1B2T A;  1GHK A;  2E2H B;  3C1E A;  3FRP B;  4KY6 A;  4F8M A;  1S5E D;  4HR7 B;  1CFM A;  1SNC A;  2XN9 C;  3PMF A;  2IX1 A;  2MHV A;  1BO0 A;  2EYJ A;  1SMY D;  2MPM A;  3HS0 C;  1LO5 D;  2JA8 B;  5ELE A;  2HQE A;  3OMC A;  2B2U A;  1ENC A;  3M4Y A;  5J39 A;  1II3 A;  3ERO A;  4R8I A;  2LKV A;  3ND8 A;  4BA1 I;  2BCO A;  3BDO A;  2NWG A;  3QG1 A;  5ISR A;  3DXJ C;  5IOC A;  1CA6 A;  1KNA A;  1TS4 A;  4CGY B;  3SK8 A;  4RHR A;  3K5M A;  4HSP A;  1SMY C;  3W2D A;  2F0H A;  1DZ1 A;  3J80 L;  3H94 A;  1B9N A;  4G4K A;  4CKC A;  4RGO S;  5EPJ A;  2PW7 A;  4FVM A;  3K58 A;  2VB3 X;  3D4D A;  3ONA B;  1WTP A;  3CQZ B;  4IUU A;  5DAU A;  4DNT B;  2NZ1 D;  2AWO A;  1QG7 A;  1QNU A;  4RGM A;  2OT2 A;  3M85 A;  4HCS A;  2B2T A;  3GTQ B;  2R7Z B;  2L5T A;  3S1N B;  1CT1 D;  3D3R A;  3TBI B;  1RCV D;  5JPN C;  1PLF A;  1SYF A;  1YNN D;  3Q23 A;  4K5W A;  1A3T A;  1B53 A;  1PFM A;  1IL8 A;  2V4D A;  2ENB A;  1DOM A;  4RGN A;  3OPO A;  3K5O A;  4EQP A;  5I6W A;  3QOL A;  1I3Q B;  2ID0 A;  3NK9 A;  1AP0 A;  3V2T A;  2GA4 B;  5CV4 A;  4FXK C;  1XWE A;  3SHL A;  1B50 A;  5EGT A;  3WOF A;  5FKA C;  4R8N A;  4C56 C;  1FYC A;  2OXP A;  4ZRZ A;  4PV1 C;  2C5C A;  4DFA A;  1ONL A;  3KLS A;  1WTR A;  2KQ3 A;  5JEA H;  1BF4 A;  4ZKC B;  2NVT B;  2B2T C;  1EFI D;  1H9M A;  2EPB A;  2R3Z A;  3MWY W;  2F4I A;  4FXG C;  2SNS A;  3U9O A;  4WOR A;  5EBC A;  1HA6 A;  1M8A A;  3N6R A;  1S5F D;  2F03 A;  1AN8 A;  1TQO A;  1VMP A;  1WCM B;  2XIW A;  1SDF A;  1FD7 D;  4Z9C B;  1SJE D;  4UAI A;  3S1R B;  2EY5 A;  1F2Z A;  2WIN B;  2Q8T A;  3RZD B;  4K6D A;  3SR1 A;  2RVL A;  1CHP D;  1FGB D;  3J7A V;  2IPK D;  4KI0 A;  1SBB B;  1TWH B;  2L11 A;  4QUC A;  1GUW A;  5E4X A;  4OO1 H;  3QB3 A;  3O13 A;  3GO5 A;  2E76 C;  4IUV A;  2IL8 A;  1BDO A;  1G29 1;  4A3J B;  1YNN C;  3SDZ A;  2F0Q A;  4KD3 A;  1A2T A;  3OW7 A;  4RGT A;  1WTX A;  1Y1V B;  1Y1W B;  2E2D C;  4RKL A;  1SNO A;  2SEB D;  2IWH A;  3K7A B;  1STA A;  2L12 A;  3Q6S A;  1EU3 A;  4ZYS A;  3TZU A;  1ZKO A;  4KY5 A;  5CV7 A;  1R4P B;  1LT3 D;  3T4A C;  3Q0A A;  2RQX A;  5DM7 3;  4FP5 D;  1EZ6 A;  4RCN A;  4NMZ A;  1IKL A;  1EYC A;  2A68 C;  4O42 A;  4F7X A;  4KJN A;  3MA2 B;  4X3K A;  1STY A;  1ICW A;  5COY A;  4B9X A;  4DAV A;  3EA6 A;  5KNB A;  4OL7 A;  4H0L C;  1ENA A;  5CV9 A;  1Q8I A;  3J7Y W;  4IUQ A;  1B3A A;  2KUM A;  2M9V A;  3K59 A;  5I2X A;  4ULL A;  2FIN B;  1G6Z A;  3VR4 A;  5KNC A;  3NHH A;  1PZK D;  2WKC A;  1MD2 D;  2JE6 I;  3VYR A;  3U9S A;  1JIC A;  1DCZ A;  2EDG A;  1U4R A;  1HUM A;  1GUG A;  1QCB D;  4OGQ C;  5CV6 A;  1D1I A;  1LTI D;  2XNA C;  2ICE C;  5C0X H;  4OIK A;  2EYO A;  5FO8 B;  3M7N A;  4MIU A;  3DEO A;  2O5I C;  3I73 A;  5FO9 B;  3S2D B;  3NPP A;  1D5Z C;  1LTT D;  5FO7 B;  2IX0 A;  5IOD A;  4KHV A;  3PIP 3;  1EY4 A;  2WAC A;  3LNN A;  1GHJ A;  2EYF A;  5IT9 L;  1Z47 A;  1X3P A;  2XRQ D;  4XQQ A;  2B2V A;  3TSS A;  2O5J C;  2IX3 A;  3HG9 A;  2JEA I;  2AUJ D;  3LWU A;  1PRT C;  3R8B A;  4G7Z C;  5M3M B;  1Y8P B;  4Y7N B;  5C5M A;  2L4N A;  3KLS X;  5ELC A;  2PCF B;  2FMC A;  2NBF A;  3L3O C;  1PZI D;  5KRU A;  2B8G A;  2HDM A;  1TS5 A;  3BZD B;  1HQM C;  3S16 B;  2K5W A;  2CW0 D;  5D3I B;  5IGF A;  4A3M B;  1KAA A;  4H7B A;  1SEB D;  4FF1 A;  2B8F A;  3GTO B;  3OSO A;  2BE5 C;  4WRD A;  3TP6 A;  1ILQ A;  5I6Y A;  5DEH A;  3BYY B;  4F87 A;  5C4X B;  1BCP B;  1LT6 D;  5CBA E;  2ZXP A;  3G6J B;  1EQT A;  2RDH A;  1XX8 A;  3MFY A;  1T5X D;  3NE5 B;  4OHJ A;  2H4O A;  4DA2 A;  3X3M A;  4AYB B;  4CJ1 B;  4C3J B;  2QF7 A;  3HZX A;  5E1F A;  1Z7T A;  5IGG A;  4FXD A;  4N9T A;  3BVZ A;  4I65 A;  2K03 A;  1PTO H;  2JA5 B;  1ET9 A;  4PMB A;  3T56 B;  3KK7 A;  4C3I B;  2LS0 1;  2VNU D;  1TR5 A;  5J22 A;  3GTJ B;  4FF4 A;  1I4X A;  1CHQ D;  3GTL B;  1A2U A;  2DNC A;  4BBR B;  3I4M B;  1HPC A;  3NXW A;  5C44 B;  2Y0S B;  5T1G A;  5C0X G;  3QIA A;  5G3L D;  5I2Y A;  1PFN A;  2F1M A;  3N52 A;  2KED A;  3RMH A;  3VR6 A;  4X3T A;  1V1O A;  1S5C D;  2L1B A;  1ILP A;  2A5H A;  2KJX A;  2DY8 A;  5LL6 S;  3RLF A;  1UEA B;  4KKU A;  2B2U C;  2IW3 A;  3VA7 A;  2EY6 A;  3I4N B;  3A55 A;  1EY5 A;  1KLU D;  1H9J A;  3Q22 A;  4K2K A;  4RKB A;  2N88 A;  2F0I A;  5EPL A;  4F88 A;  4ODG A;  3D4W A;  5FLX E;  3GTM B;  2F3W A;  1CTM A;  1TU2 B;  1KTK A;  2IT1 A;  1R9T B;  2CHB D;  3K5N A;  2PZW A;  3J81 E;  3EVQ A;  1T5E A;  3GV3 A;  2EZV A;  1B9M A;  2L0C A;  1GXD C;  4TQU S;  1YNJ D;  3E5S A;  2Q8R E;  3I72 A;  4KKT A;  3MEH A;  3H3V C;  3OWF A;  2RDG A;  4LJZ C;  2FJ2 A;  2BDN A;  1LAC A;  1I4G A;  3OMG A;  5IT9 E;  4K14 A;  3T13 A;  4QB4 A;  1QJO A;  1K83 B;  3T51 B;  5M5X B;  1C4Q A;  2KCN A;  4XDX A;  4G57 A;  4OO1 G;  1HCZ A;  1Q1B A;  1HQR D;  4C3J G;  1S4Z A;  3TP7 A;  3DWP A;  1EY0 A;  1EWC A;  3MAQ A;  4PNY A;  5LL6 X;  3VYU A;  1JOR A;  4KN4 C;  2KEE A;  4A3D B;  1NR2 A;  2G9D A;  2EJM A;  1PFB A;  2AWN A;  1B44 D;  3GD7 A;  4S3S A;  1RJT A;  1DYQ A;  1EWH A;  3AU7 A;  3TZD A;  1C48 A;  4IQZ A;  2KHS A;  1VF5 C;  5IGD A;  2YYZ A;  3ND9 A;  4ABN A;  3ZYY X;  5A2Q E;  3MC0 B;  2SOB A;  3CKI B;  1LTR D;  4JK1 C;  4ID6 A;  2K5Q A;  1KDA A;  3BVM A;  3FDT A;  2C9O A;  4J8Q A;  5EJW A;  1QNK A;  2F0F A;  4FO2 A;  4XYO A;  2M2L A;  3C1F A;  1STG A;  5C4Z A;  3NBI A;  5EPK A;  2B63 B;  4KY7 A;  5I9O A;  3HOX B;  5C0X I;  3PIO 3;  3MFG A;  1IW7 D;  3M7G A;  1FNU A;  4ZUJ A;  3K5L A;  4G7H C;  3J80 E;  1ROD A;  2OEO A;  1WTQ A;  3R3O A;  1OO9 B;  2A73 B;  1DOK A;  3PUW A;  1EU4 A;  3P7J A;  1MSG A;  3DEP A;  1SYE A;  5IIF A;  1UNS A;  3H09 A;  2K32 A;  4CHT B;  1GJX A;  1EY9 A;  3FPP A;  3P1H A;  5EBD A;  4BS9 A;  1GUO A;  1RTO A;  1AZP A;  5CC4 A;  1ZYR D;  2DY7 A;  3H6M A;  1CA5 A;  5M5Y B;  4ILW A;  3MTS A;  1Y8N B;  5C3X A;  4IUP A;  2EJF C;  3FPU B;  3DUZ A;  1JR0 D;  2M00 A;  3H91 A;  1PZJ D;  2WKD A;  3S9W A;  2D9U A;  5ELB A;  1TS2 A;  1VDZ A;  1I4Q A;  4RWS C;  2EYH A;  3R2I A;  5IGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...