1BQQT

Crystal structure of the mt1-mmp--timp-2 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
184
structure length
184
Chain Sequence
b'CSCSPVHPQQAFCNADIVIRAKAVNKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEYLIAGKAEGNGNMHITLCDFIVPWDTLSATQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MEMBRANE-TYPE MATRIX METALLOPROTEINASE
publication title Crystal structure of the complex formed by the membrane type 1-matrix metalloproteinase with the tissue inhibitor of metalloproteinases-2, the soluble progelatinase A receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 31
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 1998-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bqqT02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 1bqqT01
3OHXC 3HRZC 5FO9B 2I07B 2A73B 1BQQT 3I70A 1JB3A 5FO7B 2TMPA 2QKIC 3L3OC 5JPMC 3CU7A 2ICEC 2WINB 3HS0C 3G6JB 2E2DC 2A74C 1D2BA 5JPNC 2J0TD 1BUVT 1UAPA 1GXDC 3V96A 5FOBB 1OO9B 4FXKC 2XWBB 2XWJB 3MA2B 1PXUA 3FRPB 3T4AC 1XWEA 2B39A 1BR9A 1JC7A 4FXGC 2WIIB 1UEAB 3CKIB 3KLSA 4ILWA 5FO8B
chains in the Genus database with same CATH superfamily
3GTPB 1UWVA 1JB7A 1RD9D 3VR6A 3K5NA 3HEJA 1A8VA 2JSOA 2BDNA 2EE1A 4TVAB 1IL8A 1PH4A 2AUJD 1TY0A 2RDGA 2RBMA 4IPHA 1WTWA 2OTLA 1CA5A 1CFMA 1G2TA 4DV3L 3I4NG 4JI5Q 4AH6A 4DK3C 4L63B 2PW5A 1VQ5A 3SK5A 4JI0L 4K8IA 4OL7A 2HIXA 4ZRZA 4DR2L 1R9TB 2A69D 2WACA 1TS4A 3A5ZB 2KJXA 3TP5A 1SNPA 4DUZQ 2RKSA 2F0IA 4DAMA 2E2JH 1IYJB 4A3GB 5M3MB 3HOVG 3RZOH 1PH1A 4FXKC 1MI2A 2FXQA 1SSOA 3PO2H 3NBHB 2ATWA 1BR9A 3HP3A 2JEBI 3HG9A 3T56B 4OO1H 3KJOA 5JEAG 2UUAQ 2QILA 3ULJA 5DM73 2EY1A 2OCEA 4DGZA 4ZKBB 1VMCA 3KYHC 1ESRA 1TY2A 2BOSA 3VR2A 3EIVA 1A2TA 3S17B 3NSWA 3A55A 1F9QA 1I4XA 1SYFA 4M1UB 4DF7A 4QIWB 1YNNC 4TKOB 5DNFA 1C7YA 3H09A 1JC7A 3MAQA 3WOFA 4DNRB 1OXVA 2WAQG 1IKMA 3PIP3 2N8NA 3GV3A 3CCQA 3AFQA 4DUYQ 2K5QA 1KQSA 2DY8A 3CU7A 5CORA 3UDFA 2ICEC 2JJQA 2PNHA 2YTYA 4GKJQ 3AMUA 2RDHA 1PZJD 3I4MB 3PSIA 2NVYH 4BS9A 2Z4IA 4DXGA 3BDCA 3I4NH 1NSNS 1SE4A 2IHFA 4K2LA 1VQJA 1VCIA 5LL6X 1K8MA 1SNMA 2F4VL 4A3CG 1BCPF 1L2FA 3I70A 3A8KE 1HQRD 1UEBA 1BBUA 1SJHD 5CBAE 3JC66 1A63A 2K5VA 4R8IA 3HOVH 1NBWA 1Y8PB 5L37A 5GAHC 4IFDG 2EY5A 2ID0A 4DU9A 2PMZE 1IBLQ 3JAML 2FHTA 1LTID 2WB1G 4P71A 4TRDA 3RLNA 3OW2A 3ULPA 5JEAH 4C1NK 1V1PA 2K6AA 3F1ZA 4GNXA 1E1TA 3F8TA 2F1MA 2F0OA 4RA8A 4XYQA 5EJWA 2L1BA 1L0WA 5LMNQ 3L3OC 3MXUA 1XMQQ 1EY7A 4QUCA 5M3MG 2NWGA 3NWTA 5E3FA 4BBRB 1CUKA 1MHWC 1BNZA 2LKVA 3DUZA 1PTOH 5EKKA 1PYWD 1I4PA 4IPGA 4RG1A 1VF5C 1XNQQ 2D0PA 4LFCL 4DNIA 2JA7B 2F0MA 2I07B 1HZCA 1Y1VB 1I50B 4WJWA 1JOQA 4GN5A 1EY8A 3CMEA 4AIMA 5JVH3 2K14A 4X65Q 5AJ3L 3K81C 1PH6A 3BVMA 3K57A 1X65A 4KKSA 2KVMA 1Q8KA 4DV5Q 2EY2A 5NUCA 3I56A 3GTPH 1NCVA 2KQ3A 3E6ZX 4UAIA 5DEHA 4KHVA 3FHWA 4BA2I 4A3CH 2WIIB 3SXHA 4R4IA 5BR8Q 4OX9Q 3K59A 4A3IB 5EPJA 4ZLTF 1X32A 3S2HB 2MP1A 3I4MG 4IQZA 1SFOH 4P73A 4IFDH 2K4KA 4DV1Q 5I2YA 5ELBA 1EWIA 4N8X1 4R4TA 1F2YA 2E74C 5IODA 3KLWA 2NYZD 1IW7C 3HOZB 3GTKB 1CM9A 3NELA 1R9TH 3SK8A 2F0TA 5M3FG 3LNNA 4CKEA 1PFMA 3M4OB 3J7YW 2ZXPA 3TS0A 2NVQH 1E2VA 3DXJC 2F0LA 4RMFA 1QNKA 5M3MH 1V1PB 1K3BC 4GN3B 3NWSA 4GNXB 3B6YA 3NTIA 2UUCQ 3BJUA 5ISRA 3J81c 4GLXA 4FNFA 3J80c 3ONAB 3H94A 1L0YB 4C3JB 2YTVA 4LF9L 4JI6Q 3S24A 1RF2D 1NTGA 3TRZA 2XRSD 2JA5G 3RLFA 4DR7L 2N78A 1Q1EA 1FNWA 2K50A 4NP5A 3I91A 2Y0SG 3KDFA 3PIO3 1B3QA 2RHSB 3D6WA 5CV8A 4HSPA 2C5CA 2F0PA 3BYYB 1EQQA 1D5ZC 4KN7C 5GAGC 2NTTA 1F2MA 1GUWA 2C9OA 1CKOA 5AFWA 5LHY1 5JJIA 1VQLA 2MO0A 2UXBL 1EFID 4AYBB 1O7IA 4L8JA 4DV0L 2JA6B 3I4MH 3KBXA 4C3HB 3I55A 4RKLA 5D65A 1H9RA 2KHIA 2NB0A 3I2ZA 3H3VH 1O7YA 4LUZA 3RN2A 5IOCA 1JOOA 2PPBC 1BCPC 5M3FH 2NVXH 1MSHA 2PZUA 1O7LA 3Q23A 3J81L 4OIJA 2PYKA 1J5EQ 2Z8LA 3R3OA 2QEJC 4EGVA 3J80L 2A1AA 3H6MA 5IYBG 4FP5D 1KLGD 1TWGB 3EQLC 1S5CD 3HS0C 5C3WA 3D6CA 1K8AC 1HZ9A 1G6PA 1BF4A 2O4XA 1U4LA 1YZ6A 1SMYC 1B9MA 3TMEA 3OSOA 4IUQA 4KHPQ 1UE5A 4U673 2L0CA 2V1CC 3GTLB 2OQ0A 4A3FB 2UUBL 5EPLA 5IWAQ 1OXUA 5IYDG 1PFBA 4N9TA 2QEXA 5I6WA 1EU4A 1LTSD 1VQBA 4YWKA 1N34Q 2J4XA 2L9HA 1DCZA 3TBIB 2L15A 1PZKD 1JMCA 1LTTD 1AZPA 2K28A 3RZDB 1TWFB 1TXYA 1I5FA 3D8GA 3ULLA 2JA7H 3KDFB 2RCFA 3MFYA 2RF4A 1I50H 5FKAC 4KTAA 2A69C 3HKZB 1JJGA 4FDBA 2XVSA 2B63G 3VYRA 3K6OA 1EIFA 5FJ8G 4LF6Q 3N52A 2Z6KC 2WAQE 4JI5L 5KYIA 1W6JA 2NN6G 1F77A 3LX0A 1WTPA 1IBKQ 5EAYA 4Q0FA 3C3LA 2FINB 3D31A 5IYCG 2B2VC 1QB5D 4HCEA 2IWHA 4DUZL 5IYBH 2GA4B 2KCNA 3FVQA 3Q22A 4FYDA 2UU9Q 3UDGA 5ELNA 5IT9c 3F2BA 3GTKH 4L6TB 3NUCA 5BN5A 1ET9A 2JK8A 1WI5A 1XMOQ 5K36G 4A3JG 1H9JA 3DLLA 4C3IB 2PO4A 2O5JC 4DR3Q 3S9WA 3KUPA 3SK6A 4A3EG 4PNYA 2UUAL 4MHEA 1K83H 3M4OH 1I94Q 2UXCQ 1PH3A 2VQFL 2B2WA 3OIQA 4KMUC 4EQOA 4O42A 2B29A 2WB1E 2L5TA 2BE5D 1NY4A 4ME3A 2AQ1B 5EKLA 1PH7A 5DM63 2RHQB 1ENAA 1TU2B 5E4XA 5I9PA 1F9SA 2WP8J 4YIJA 3S2DB 4K8JA 5KNBA 5C4HA 3K8AA 3F2UA 1D2BA 1Y1WB 1GUNA 4DUYL 2EJGC 4CDFC 3I90A 4A3DB 2K33A 4U68A 2JA9A 4OONA 3TZUA 1KRTA 1LT6D 2B63H 1TS5A 1UE6A 2E2HH 5FJ8H 1E1OA 1NUCA 1HCZA 2EYJA 4UP9A 3HOXG 3L0OA 2JA8G 3K0XA 2B2UA 4A3KG 3R8BA 3VR4A 4DV4Q 5IT9L 1AZQA 5IYCH 4OHJA 3OW7A 3EROA 3D3RA 4OIKA 2JA6H 4LK1C 1WD1A 4FO2A 3G7LA 1LT3D 3S1QH 1PTOC 5GROA 2IJ0A 4WJ3M 1IBLL 2ENBA 3SK4A 3CPWA 1C8CA 5K36H 1X3GA 5J3BA 3S14B 2LSSA 3KLSX 5GADC 4A3EH 2R93G 1WCMB 1YJ9A 1EYCA 1JWSD 4OWXB 2CH4A 2KCTA 3K80C 2Z6BA 5LMNL 2A6EC 4QUFA 1XMQL 4DR4Q 4FXDA 5IP9G 1TWGH 3STBD 2F0JA 4XQNA 1SYEA 1D6EC 2EYHA 3S16B 1V8QA 1GOZA 2FJ2A 3DM3A 2K5NA 4LAAA 4DR6Q 1GVPA 4ME5A 4A3FH 1M1KC 2OF1A 1PRTB 1XNQL 5KGUA 1E22A 1KTKA 3A8IE 3P75A 1M8AA 1BUVT 2Q8IB 3E0JA 4IJHA 1T5XD 1IL2A 4X65L 1UE7A 3M7GA 4GKKQ 4PQXA 3HOXH 4DV5L 4LF8Q 1QUQA 5I6YA 2N49A 4QB4A 3RZDH 1EYGA 2AHOB 1E3PA 3E5SA 1G8ZD 4PV1C 4CBVA 4A3KH 4JCVE 1NNXA 3SHLA 4A3BB 3T1HQ 5EBCA 2RSOA 1EY4A 5BR8L 2K5WA 3CCEA 4OX9L 2IX1A 1CK1A 5JPNC 2KUMA 2Y0SE 3GTGH 3EJIA 4GZYC 2XWBB 3FRPB 3T4AC 4V190 2IY5B 4B9XA 1SROA 1VDZA 4DV1L 3HOUB 4LUOA 1TWAB 4ID6A 3J80i 1K73C 1XNRQ 3PGZA 1EEID 1STHA 5ELDA 2G9HD 4DR5Q 1A15A 4OO1G 1EOVA 1VQGA 3SE0A 3ITPA 3PO3B 3CCMA 4P2CB 4C2MB 3SR1A 4RFBA 2NTSA 3PUZA 1A2UA 3VR5A 5JAVA 1LUZA 3MEHA 1C48A 4CJ1B 5IGEA 3PIPA 4JOIA 4BA1I 4BXXH 3PV0A 4X3UA 4HIDA 1HNXQ 1TIID 2UUCL 4GOPA 2OQKA 4C3IH 1SEBD 1SNCA 2CH4W 2K5HA 2OXPA 1QVCA 4B3MQ 2I5MX 1PYBA 4JI6L 4L5TA 2R61A 2NVTB 3MXPA 3OMCA 4HAEA 4IUUA 1K28A 1EL0A 1ZEQX 5CC4A 2E8GA 3GTMB 1U4PA 1K3RA 1FGBD 1B1ZA 2F0DA 3GTQB 2IL8A 4PZ7A 2N3SA 1MBYA 4BY7G 4XQJA 3PUXA 2Z4HA 5FLXc 4DK0A 2B2YC 1QZGA 3H3VC 3S2DH 3EN2A 4K6LA 1Y1WH 4KD3A 4A75A 1E2ZA 2B2TA 4A3DH 2HQEA 2OT2A 4F7XA 1QUQB 1G2SA 2E75C 3BYTB 3M4YA 5C4ZA 4LFBQ 4GLVB 3ND9A 2ZJRA 2MNAA 1GKHA 1EQTA 1ILPA 2PI2A 1BVSA 3M3YH 1X3EA 1C0AA 2DJFC 1SE2A 1Q8IA 5ELCA 1TKWB 3MTSA 1L1OC 1HNWQ 1AW7A 1HFGA 1CKNB 4HMJA 4JI7Q 4WRDA 3S1NB 5HGTA 2A74C 3AQQA 3K5OA 4M8AA 1J5EL 1MJCA 3VR3A 4ZUJA 1LV9A 1P16A 1WTHA 2XWJB 2XIWA 5GAEC 5JJZA 4V0BA 2KEEA 2PCFB 3CP0A 4KHPL 4DV6Q 4RGOS 1VF7A 4I65A 5IWAL 2JQOA 2VZAA 4ZQ3A 5BN4A 4GOPB 1KNEA 1VQPA 1N34L 2CFMA 1JJ2A 4JYAQ 4QF4A 1OXSC 1PHJA 5JOBA 2NZHA 4KK7A 1IYVA 3S16H 3LWUA 1I3QB 3IL8A 4J6HA 2B8GA 1PXUA 1LT5D 4BY7H 3S1MB 1ML0D 4FXGC 3IFDA 3U9SA 1EIGA 5FO9B 4A3LG 2LY7A 5IP7G 5FO7B 2F0GA 3GP7A 4NXNQ 3M7NA 2AMCB 4G7HC 3QJYA 2AKWB 5CBEE 2EJMA 1RCVD 5C0XJ 3RR5A 4MZ9A 3A74A 2IX0A 4A4IA 3OTOQ 4IALA 2PZTA 1FNUA 4RGNA 4K5WA 4BBSB 4LF6L 2VUMB 1QZHA 1I4QA 3K0YA 1WJJA 2CW0D 4I7AA 4X3TA 2AUKA 3V05A 1IBKL 3F2CA 4NDXA 4CDCC 4DV7Q 1HZBA 1T9HA 1DXMA 1PTOD 2E2DC 2P5ZX 3AU7A 4A3GG 3MC0B 1E2WA 1PFNA 4KV6A 1TWAH 4A93B 2F0FA 2UU9L 3DM1A 1GHKA 5A2QL 2BE5C 1CQFA 3FEWX 4CGYB 2ASBA 1AH9A 2QGQA 2PZWA 3RNUA 3L2PA 1SRUA 3IFTA 4DR3L 1CHQD 2A6ED 3A7AB 4HR7B 2UXCL 1EFWA 2JXMB 3K5LA 5KEEA 1C9OA 1VQDA 3UDXA 1HA6A 4JI1Q 2KA7A 3VYUA 2KEDA 4JV5Q 3TS2A 2K7VA 4RGMA 2VW9A 1OO9B 1QOHA 1PH5A 1PZID 3BDOA 1VQCA 4IUNA 5I9OA 3CQZB 4A3LH 2GVBA 5IP7H 5FO8B 4HTHA 2NVTH 3GD7A 3FDTA 2DNCA 3MFGA 1X3FA 3CPFA 1TS3A 1HHVA 4TSSA 1DJRD 4LFAQ 1Y8NB 2LFNA 2HDMA 2KHSA 2L4NA 4L5RC 1JJCB 4F8MA 4AQYQ 3MEFA 4IUTA 4ZAIA 2IX3A 3CKIB 4HEDA 1KHIA 4MNOA 4NB3A 4Y52H 1IBMQ 1OXXK 4CJ0B 1VMPA 3G71A 3GTJB 2CHBD 1LTGD 4A3GH 3HOYB 2R92B 1NMFA 2C35B 1QJOA 1XXGA 1B70B 2DNEA 3A56A 4HJ8A 1DOKA 3W3AA 4WJ4A 2L12A 2M00A 4EQPA 3STBC 1WTVA 2EPBA 3PUYA 4FF3A 3S1NH 2CQOA 4K0KQ 3OWEB 1B4OA 3H0GB 1PV4A 2Q2TA 4XXEA 4O2DA 3S17H 3Q6SA 1STBA 3NTHA 4F87A 2EIFA 4QJFA 1AFPA 2A6HD 4A93G 1V9PA 4DR4L 4BBRG 1PH8A 5D14A 4DR1Q 4LJZC 1PDQA 5H1SE 1I4HA 4MIUA 2YU9B 4JI8Q 4DR6L 1G91A 4HJ5A 1TWCB 2JA7G 1I6VC 1Y1VG 1A0IA 1KIXA 2N88A 1A3TA 2L11A 4NKLA 1WD0A 1F9RA 1KDCA 4ABNA 4FF2A 1KABA 1S5FD 1AEXA 1VQNA 1NJIC 3NTKA 2ZM6Q 4B3TQ 4GKKL 1YBYA 1PH2A 1FR3A 1PTOF 1RL2A 4JG2A 1JWUD 1SDFA 1LTAD 2QCPX 1KLUD 4LF8L 5J1ZA 3M4QA 4CKCA 4Q5VA 2RDFA 1DM0B 4S3SA 3QWNA 1LM0A 3T1HL 4ALPA 1DGSA 5M9OA 2QF7A 2BH8A 4A3IG 1VQKA 1Z7TA 1ILQA 1CI3M 2TSSA 4APVA 4RCNA 2Q2IA 2N55A 1N9WA 4CKBA 2DGYA 2ZXOA 3MXNB 3QIAA 4LUVA 5JVG3 3ERQA 2K01A 5I4DA 3HOZG 5C4XB 5C3EB 1KRSA 4DA2A 1XNRL 2VS1A 3R2IA 4YCWA 4DR5L 4P74A 5CGKA 4LW1A 3Q24A 4R4QA 2M9VA 3VDYA 1F9PA 3TP6A 4XQQA 1RKNA 1N33Q 3FKIB 1HFNA 1Y8OB 3PF4A 2XNAC 4H02A 3ZJYC 4KKUA 2EJFC 1SNQA 3HOWB 3OOCA 4A93H 2TMPA 3D0FA 4BBRH 5KRUA 1FJGQ 1LABA 2JN4A 3IRBA 2PMZB 4QCLA 1A3UA 1ZKOA 1HNXL 1GJXA 2DN8A 4RWSC 3MHBA 4OWTB 4HIKA 2I46A 4C3JG 1EQVA 1KC8C 3U4VA 2ZJPA 3J7A5 4B3ML 2R6GA 1Y1VH 2VXWA 3H0GG 2JEAI 4P72A 1I4GA 1Z6HA 4A3MB 3HRZC 4QQBX 1WYDA 4X64Q 4DFAA 1KXLA 2O2LD 4BY1B 3HOYG 1STAA 1AN8A 1SYBA 4UP8A 3T16A 1OXTA 2F0SA 1N32Q 2D9UA 3CQZH 4ULLA 1HXYD 4PG3A 1LO5D 1Y14B 2CKZB 4B3SQ 2XTIA 1TQOA 2VL6A 4A3IH 1RIPA 5E7NA 3S2HH 2F0HA 4AYBG 2JA6G 2Z6KA 5JEAJ 4JI2Q 4C3HG 3S15B 2Z9HA 2X6GA 4X6AH 3CCUA 4XIGS 2EZVA 2HDLA 4LFBL 1AP0A 3HOZH 2Q2UA 3BZKA 2V4DA 3NK9A 4DV2Q 2ES2A 1KL9A 1ZYRC 1HNWL 1BCPB 3GDEA 1EOTA 2IT1A 4JI7L 1S72A 2H5XA 1KAAA 3CHBD 5DAUA 3MWYW 5M5XB 2YTXA 2VB3X 2EXZA 4PZ6A 1HNZQ 1J9OA 3C1FA 1ONLA 1BDOA 4GS3A 4HN7A 4KLKA 2XSCA 2Q2HA 1PRTC 4DK1A 1HRJA 4C3JH 2F03A 3ND8A 4A3FG 3NBIA 4L5SA 1TR5A 2HUGA 3FKIG 4CDDC 3VA7A 4DV6L 3H0GH 3M85A 1YITA 4CDEC 3VA5A 1Q81C 1M4VA 2UXDQ 3W1BA 1EY6A 3I3CA 4G4KA 3SEBA 1HTLD 4GKJL 3OHXC 3TREA 4DAVA 2R7ZB 4KY6A 1NE3A 1GD7A 1YVCA 5E4WC 1WTRA 3IAYA 3C46A 2HHHQ 1QWYA 3RLOA 4B3RQ 1A3VA 2MUYA 3O13A 2RVLA 2ALYB 2AQ2B 4RAUC 4OEMB 1CZWA 1MKHA 2KECA 4IFDJ 1RDPD 3P7JA 1LTLA 5M5WB 4NW2A 2B2UC 2BDOA 4NXNL 2EYFA 4FVMA 4QL5A 1K8GA 4QY7A 3DWPA 2CW0C 4QIWE 3HKZG 4C3HH 2E2JB 4BY1G 4DAYA 1Q82C 1ENFA 5IGFA 3JAME 3CD6A 3TZDA 3OTOL 3RZOB 1BQQT 3K58A 3PO2B 2EY6A 2WFWA 2KENA 4ODGA 3EFXD 1B50A 4PMCA 1E0BA 3M4PA 2X6LA 3KK7A 4EQNA 4WFN3 3NQTA 5C44B 2FMCA 4N9PA 1LTBD 2MFIA 2ZJQA 2MJ8A 3S1RB 4JVZA 1VQ9A 3V96A 1Q90A 3CMAA 4DV7L 2LXJA 5K5PA 3ICEA 5GQOA 2EXDA 4HIOA 1Q86C 2BCOA 2D62A 4O0AA 4BXXG 3NHHA 4XDXA 5A2QE 3U50C 1R4PB 4MN3A 5CMDA 3A7LA 4MTNA 3MXGA 1NMGA 1L0XB 3I73A 3W1GA 4C3IG 2WINB 2OWOA 1XPRA 3GTLH 1VQFA 3I4LA 1JE4A 3FKIH 5HGQA 4MTKA 3CXCA 1B7YB 4C1NI 1EWHA 3BZCA 5J39A 1I6HB 1EYDA 4JI1L 4LWCA 4JV5L 3K7AB 1G51A 3A0JA 4RH6A 2F0VA 1RHPA 3RMHA 3I4NB 4LMQD 1PYSB 1TWFH 3FPPA 4EX5A 2KOLA 1DOLA 2ZTDA 1Y1WG 4NXMQ 3BDLA 1VQMA 4A3DG 3RD4A 2X69A 3CCVA 4DV0Q 1HH2P 4A3MH 4QGUA 1UAPA 4DAPA 2EYPA 2QDLA 4IZ8A 1EEFD 1NR2A 2B8FA 4IURA 4BY1H 1PMRA 3T1YQ 1YEZA 2RSNA 1X6OA 1XTCD 1CKNA 3AEVA 4LFAL 1PVOA 1QILA 5CV4A 1K8OA 2F3IA 3D4RA 3W2DA 3X3MA 3CC7A 2RCNA 4DAYB 4AQYL 2NZOA 3K5MA 4ZKCB 5FK9C 2O5IC 1A62A 3FPUB 1CQVA 3HGBA 2ICIA 1VQEA 1X3PA 2XGTA 4LF7Q 4H44C 3S15H 3CCLA 1IBML 1Q12A 2D5DA 2F0UA 3AB9A 1XWEA 2K32A 2WKDA 1STGA 1XPUA 3ERSX 1K0RA 2HIVA 3J7AF 3L7ZC 2A19A 1WTXA 1N36Q 2A6HC 1AE2A 1QE6A 2EYLA 1EQRA 3CAMA 2K5DA 3CCJA 1H95A 2EYMA 4JOIC 2WAQB 4LF4Q 1STNA 1EIHA 3OYYA 1U4MA 1SMXA 1WCMG 1FVIA 4JBWA 1F2LA 2R7FA 2FFKB 4K0KL 5M5XH 1VQ4A 3NP8A 4HJ7A 2VY3A 5KNDA 1B44D 3KFUA 1EUJA 3NEMA 1PH9A 3IKJA 1YNJD 4DR1L 4UY8C 2A73B 4IOCA 5C4JB 4IUPA 1Q3LA 4JI8L 1A6XA 4KJOA 4IPCA 1PLFA 4DXFA 4K6DA 1YIJA 3KF6A 3DWAA 3PQIA 3SDZA 1D5MC 3E9IA 4B9WA 1KAWA 2NZ1D 2Z0SA 2B2YA 2R7ZH 1JICA 2B2TC 1GUGA 4X62Q 3NE5B 1SFOB 1TWHB 1FD7D 1HQMC 4KY7A 4RGTA 4B3TL 2ZM6L 2KHJA 2WB1B 3QR8A 1S5BD 2BH2A 4EVOA 4PMWA 1YJWA 1R4QB 1P8LA 3DEPA 3C1EA 3GQBA 5M5WH 4JW0A 1G291 5IGGA 4A3BG 3WOEA 1YHBA 2QA4A 3J81E 3GTOB 1D1IA 2HCCA 4IUVA 1WVLA 3J80E 2NVQB 4RHSA 3G6EA 1M90C 3A54A 3HOUG 1L1OA 3DHQA 3WDNA 2XN9C 1B8AA 4XT1B 4YWMA 1ZYRD 3S14H 1JT8A 2E76C 2BA1A 5C44H 1WCMH 3DMUA 3FP9A 3T51B 5LMUQ 3I8ZA 3KJPA 2VQFQ 3S1RH 3JAMc 3PO3G 1QG7A 3HKSA 4AYBE 4HJAA 1N33L 1CHPD 4G7OC 5FLXL 1S40A 4X3SA 3J81j 1GUOA 4J1MA 1RTOA 2VQEQ 4HCSA 2IHEA 3NPPA 1YHQA 2LS01 1PRTD 1GO3E 2EVBA 3E3XA 1JE5A 4H0LC 4K5VA 1FJGL 3V2TA 3ER0A 2G5DA 1QVGA 1KD1C 1CT1D 1S5DD 2BA0A 1NR4A 1JWMD 4IFDI 4XYOA 1I4RA 5JPMC 1DZ1A 1SBBB 3Q8DA 1B2TA 1WTQA 1B9NA 1I6HH 4GN4B 3OIPA 1FL0A 3K7AH 1HR0Q 4X64L 4LF5Q 1SNDA 2JP1A 3KF6B 1BBXC 3U4ZA 1EZ8A 3CC2A 3FMCA 1LYLA 5COYA 2KCCA 1MIUA 1N32L 4A3BH 1F2ZA 5M3FB 4IPDA 2NVXB 4JI3Q 1JB3A 4JPBW 3UI2A 4BWGB 4B3SL 1CTMA 1RODA 4GNXC 4ZCKA 4JI2L 4QMGA 3HOUH 1SXTA 2QW7A 2ZT9C 4P75A 2PQAA 2SNSA 1S5ED 1JCKB 4OWWB 1V43A 2YV5A 3PCOB 5C6AA 2B39A 2Q8RE 1WFQA 3L9AX 3BU2A 4NPSA 1EWCA 1XMOL 4K2KA 4DV2L 3TDQA 4Y7NB 3PO3H 2D2CC 4FF4A 1L1OB 4YCVA 4OGQC 4H13C 4C2MH 1HUNA 2SDFA 4JI4Q 3HKZE 3PIOA 1I94L 2JA5B 3OWFA 2WV6D 3PUVA 1V1QA 2CWPA 5IY0A 3CC4A 1UE1A 2HD3A 1X3QA 2Y0SB 4JBMA 2J7ZA 5M5YB 2OEOA 4DPGA 1HNZL 3KOJA 4HJ9A 1BBWA 3DEOA 3I72A 5D3IB 2A8VA 1CSQA 4YHHQ 2R3ZA 2ZTEA 1WTOA 4CJ2C 2E2IB 3AFPA 2G9DA 1H9SA 1SYDA 3GTMH 3KBGA 2E5LQ 3H3VI 1TVXA 3GTQH 2UXDL 3J7AV 1YNXA 5JJLA 1VQOA 1FGUA 2HHHL 1SLJA 5C4JH 4B3RL 4DKAC 4TQUS 3WWVA 4YY3Q 2XRQD 4G7ZC 4ZUIA 5IT9E 3OMGA 3MXNA 4OELB 4DV4L 1IYUA 2GN5A 1G6ZA 1BXTA 1VQ8A 2Z1CA 4HMIA 1TWHH 2IW3A 5EKIA 1HPCA 3TP7A 5ELFA 4X66Q 4PMBA 4BBSG 1T5EA 4R4CA 2VUMG 3TN2A 1BKBA 2WKCA 1PRTF 5IE8A 1CZGA 2PQEA 4K14A 3T53B 3SVMA 4YWLA 4KKTA 3GTOH 1HJPA 1MGSA 2PQAB 1K83B 1JORA 3PF5A 4OXPA 1O80A 4RKBA 2JE6I 3Q0AA 1KDAA 1SYGA 3F2DA 2AWOA 5TSSA 5C3XA 3URYA 1YHAA 4K5XA 1IKLA 2Q8TA 4E6IA 3I7FA 5F2DA 2NUCA 1LT4D 2A68C 3P20A 2JYOA 2R7DA 2PNRC 1SN8A 1SYCA 1VQ6A 4F88A 1X55A 4KHZA 1ICWA 3U58A 5CR3A 1XTDA 4NMZA 1I3QH 5J22A 4DV3Q 2B63B 2E2HB 2CWAA 3S1MH 1H9SB 1JOKA 2B3GA 4JI0Q 5G3LD 1SR3A 3EVQA 4DR2Q 2DY7A 4JBKA 2F4IA 4RHRA 1O7ZA 5FLMG 1GUSA 3TQYA 4KD4A 1U0LA 4NXML 3J7ZC 3PUWA 3SGIA 1D5XC 1EU3A 3NXWA 3TEHB 1OTCA 5KYLA 2YYZA 2AWNA 4RCOA 3A8JE 3T1YL 4BBSH 3G6JB 3S1QB 2VUMH 1O78A 1EY0A 3D4DA 4YCUA 3RUZA 4A3JB 3ZYYX 1XX8A 3VYSA 4A3EB 1SJED 4POFA 3QO2A 4CHTB 1D7QA 1SE8A 1LACA 1QCBD 1PFSA 1B53A 1KDBA 1DYQA 4C56C 5IGBA 1K0SA 3PMFA 3R2TA 2NBFA 4LF7L 1EY5A 1RJTA 3QB3A 4KJNA 2GVAA 2VB2X 3BS1A 3E9HA 1K9MC 2R92G 1DONA 1CKMA 1VQIA 1V1OA 3HZXA 4B08A 4R4OA 2EOTA 1UUPA 3BVZA 1N36L 4A76A 3G48A 1CSPA 4Y7NH 2LMCB 4LF4L 1YNJC 2L55A 3M9BA 1X56A 5ELOA 2LXKA 1MJEA 2JA5H 3T13A 3QG1A 2I0QA 1CA6A 2CVRA 1EYAA 1YNND 2I5HA 3CF5A 2PW7A 4X3KA 5C0XI 1E24A 2VNUD 3I4OA 4Z9CB 5M5YH 1ICFB 2NN6I 3EBEA 4N8FA 2QKIC 4ZK9B 3VYTA 1IXRA 1W6KA 1GUTA 5EGTA 3HOXB 1II3A 2JA8B 5LL6S 1TT2A 2F4VQ 4POGA 3OPOA 2E2IH 4A3KB 1W2BA 3LWEA 5FLMH 1VQAA 3MVVA 1ASYA 5IGCA 4H7BA 3KF8A 1HUMA 3KLSA 3GTGB 2DUDA 1U9RA 5EBDA 4X62L 1LTRD 1D8LA 5E1FA 1EIYB 2FMMA 4GLAC 2ZTCA 1H9MA 5C0XG 2MPMA 2M2LA 4IJLA 4IN3A 3JAMi 3CCRA 2B2VA 4O1NA 1Z9FA 1J6QA 2R93B 3CRLC 5IIFA 1VQ7A 3MA2B 5C5LA 4KI0A 1J8IA 3GTJH 2I5LX 1UEAB 2R92H 3HOYH 2KCMA 4XTCS 2F0KA 1EY9A 3H15A 1E7ZA 1BO0A 2B2WC 1Q7YC 1PA6A 5C4XG 5C3EG 4G57A 1X54A 4HSVA 1FNVA 4UP7A 2OTJA 4LFCQ 2HQLA 2HT1A 5IYDH 5CV9A 1S3OA 1HR0W 1LLRD 5G3LF 4JBJA 5LMUL 3UE0A 5FLXE 2K05A 2A5HA 3GO5A 1SAPA 2K03A 5AJ3Q 3HOWG 1ENCA 1HZAA 4JYAL 1DD2A 5D3DA 2VQEL 3CCSA 1IHZA 1XYIA 1ET6A 2H4OA 2F3VA 2H1EA 1HA5A 4JK1C 2YU9H 1AE3A 1STYA 1ESFA 1TWCH 5C5MA 1Q1BA 2F0NA 4WORA 5EQ0A 5HY6A 3GV6A 2MQHA 4HIMA 3R93A 1X9NA 1IZ6A 1XJVA 1KNAA 1EZ6A 4A3MG 2F52A 3RN5A 3A5UA 4J15A 5A35A 5LMNW 5DLQE 3LGJA 1NAPA 1HR0L 2MO1A 4LF5L 3AYHB 3KF8B 5C0XH 3TSSA 3M3YB 3CRKC 2NN6H 2ZXRA 2CCZA 1JR0D 3MZ5A 3BZDB 3X3NA 1SE3A 4FF1A 1VS0A 5I2XA 2F0QA 2MGSA 3KLRA 4JI3L 1GXDC 1GM5A 4ZYSA 1IW7D 5CYUA 4UHVA 3BG3A 2IPKD 4ILWA 4XT3B 4IO9A 1U4RA 2KBNA 5C4XH 5C3EH 1W3SA 4A3JH 1UNSA 1C4QA 4EQ5A 1DOMA 4LF9Q 1Q46A 1TS2A 3D4WA 4R8NA 1WOCA 2SOBA 1Z47A 4DR7Q 1S4ZA 2K1BA 4JI4L 4UPAA 4PZ8A 1B3AA 2QDBA 2F0EA 4J8QA 1Y69U 3HOWH 3QOLA 1ZXTA 2NVYB 2A68D 2RQXA 4KY5A 4BY7B 1GHJA 1MSGA 1QNUA 5EPKA 2DJGC 4YHHL 2PI2E 1YJNA 2MHVA 3H91A 5CV7A 2K04A 5KNCA 1STEA 5KIXA 5T1IA 1U5KA 4JC0A 2UXBQ 4R1JA 2J0TD 4OO1I 2E5LL 1RTNA 2R7ZG 1D1KA 3U9OA 1FYCA 2CQAA 3HOVB 1JQYD 3K7UC 3C2PA 5CV6A 2JA8H 4L5QA 3EA6A 1HTPA 1SNOA 5ELEA 1QVFA 1MD2D 3W5OA 3NBHA 4YY3L 2SEBD 2EYOA 3DWQA 3HFZB 3TP8A 5HURA 5T1GA 2F0WA 2EQSA 3BVGA 3J81i 3N6RA 1VQHA 4DN4M 3P1HA 3PO2G 5IGDA 4KN4C 4X66L 1BCPD 4DNTB 1ASZA 1H9KA 2AQ3B 1PTOB 3G4SA 1YI2A 2HCIA 5BN3A 2UUBQ 2R93H 3UDIA 3CW2C 5C44G 1BOSA 2EDGA 3E0EA 1N8RC 4UDUC 4GOPC 4LNQA 3NENA 4I7ZC 4DK6C 2D0OA 2F3WA 2K52A 4IOAA 3QOJA 5FOBB 5IP9H 1XPOA 2SNMA 5CV5A 1SMYD 2K75A 3NQIA 2RA4A 3UE1A 4R9WA 5JJKA
chains in the Genus database with same CATH topology
3GTPB 1RD9D 3VR6A 3K5NA 3HEJA 2JSOA 2BDNA 2EE1A 1IL8A 2AUJD 1TY0A 2RDGA 2RBMA 1WTWA 1CA5A 1CFMA 1G2TA 4L63B 2PW5A 3SK5A 4K8IA 4OL7A 1R9TB 4ZRZA 2A69D 2WACA 1TS4A 2KJXA 3TP5A 1SNPA 2RKSA 2F0IA 4A3GB 5M3MB 4FXKC 1MI2A 1SSOA 1BR9A 3HP3A 2JEBI 3HG9A 3T56B 4OO1H 5JEAG 2QILA 5DM73 2EY1A 4DGZA 4ZKBB 1VMCA 1ESRA 1TY2A 2BOSA 3VR2A 1A2TA 3S17B 3NSWA 3A55A 1F9QA 1I4XA 1SYFA 4M1UB 4DF7A 4QIWB 1YNNC 4TKOB 5DNFA 3H09A 1JC7A 3MAQA 3WOFA 4DNRB 1OXVA 1IKMA 3PIP3 3GV3A 2K5QA 2DY8A 3CU7A 5CORA 2ICEC 3AMUA 2RDHA 1PZJD 3I4MB 4BS9A 2Z4IA 4DXGA 3BDCA 1NSNS 1SE4A 4K2LA 1VCIA 5LL6X 1K8MA 1SNMA 1BCPF 3I70A 3A8KE 1HQRD 1SJHD 5CBAE 4R8IA 1Y8PB 4IFDG 2EY5A 2ID0A 4DU9A 3JAML 2FHTA 1LTID 4TRDA 5JEAH 4C1NK 1V1PA 2K6AA 2F1MA 2F0OA 4RA8A 4XYQA 5EJWA 2L1BA 3L3OC 3MXUA 1EY7A 4QUCA 2NWGA 3NWTA 5E3FA 4BBRB 1BNZA 2LKVA 3DUZA 1PTOH 5EKKA 1PYWD 1I4PA 1VF5C 2JA7B 2F0MA 2I07B 1Y1VB 1I50B 4WJWA 1JOQA 1EY8A 5JVH3 3BVMA 3K57A 4KKSA 2KVMA 2EY2A 5NUCA 1NCVA 2KQ3A 3E6ZX 4UAIA 5DEHA 4KHVA 4BA2I 2WIIB 3SXHA 3K59A 4A3IB 5EPJA 4ZLTF 1X32A 3S2HB 2MP1A 4IQZA 4IFDH 5I2YA 5ELBA 1F2YA 2E74C 5IODA 2NYZD 1IW7C 3HOZB 3GTKB 1CM9A 3SK8A 2F0TA 3LNNA 4CKEA 1PFMA 3M4OB 3J7YW 2ZXPA 1E2VA 3DXJC 2F0LA 1QNKA 1V1PB 3NWSA 3NTIA 5ISRA 4FNFA 3ONAB 3H94A 1L0YB 4C3JB 1RF2D 2XRSD 3RLFA 1Q1EA 1FNWA 4NP5A 3I91A 3PIO3 3D6WA 5CV8A 4HSPA 2C5CA 2F0PA 3BYYB 1D5ZC 4KN7C 2NTTA 1F2MA 1GUWA 2C9OA 5AFWA 5LHY1 1EFID 4AYBB 4L8JA 2JA6B 3KBXA 4C3HB 4RKLA 5D65A 1H9RA 2NB0A 1O7YA 5IOCA 1JOOA 2PPBC 1BCPC 1MSHA 2PZUA 1O7LA 3Q23A 3J81L 4OIJA 2PYKA 2Z8LA 3R3OA 2QEJC 4EGVA 3J80L 3H6MA 4FP5D 1KLGD 1TWGB 3EQLC 1S5CD 3HS0C 5C3WA 3D6CA 1BF4A 2O4XA 1U4LA 1SMYC 1B9MA 3TMEA 3OSOA 4IUQA 4U673 2L0CA 3GTLB 4A3FB 5EPLA 1OXUA 1PFBA 4N9TA 5I6WA 1EU4A 1LTSD 2J4XA 2L9HA 1DCZA 3TBIB 1PZKD 1LTTD 1AZPA 2K28A 3RZDB 1TWFB 3D8GA 3MFYA 5FKAC 4KTAA 2A69C 3HKZB 2XVSA 3VYRA 3K6OA 3N52A 5KYIA 1W6JA 2NN6G 1F77A 3LX0A 1WTPA 4Q0FA 3C3LA 2FINB 3D31A 2B2VC 1QB5D 4HCEA 2IWHA 2GA4B 2KCNA 3FVQA 3Q22A 4FYDA 4L6TB 3NUCA 5BN5A 1ET9A 5K36G 1H9JA 4C3IB 2PO4A 2O5JC 3S9WA 3KUPA 3SK6A 4PNYA 4MHEA 2B2WA 3OIQA 4KMUC 4EQOA 4O42A 2L5TA 2BE5D 5EKLA 2AQ1B 5DM63 1ENAA 1TU2B 5E4XA 5I9PA 1F9SA 2WP8J 4YIJA 3S2DB 4K8JA 5KNBA 5C4HA 3F2UA 1D2BA 1Y1WB 1GUNA 2EJGC 3I90A 4A3DB 2K33A 4U68A 3TZUA 1LT6D 1TS5A 1NUCA 1HCZA 2EYJA 2B2UA 3R8BA 3VR4A 5IT9L 1AZQA 4OHJA 3OW7A 3EROA 3D3RA 4OIKA 4LK1C 1WD1A 4FO2A 3G7LA 1LT3D 1PTOC 2IJ0A 2ENBA 3SK4A 1C8CA 5K36H 3S14B 3KLSX 1WCMB 1EYCA 1JWSD 2A6EC 4QUFA 4FXDA 2F0JA 4XQNA 1SYEA 1D6EC 2EYHA 3S16B 1V8QA 1GOZA 2FJ2A 4LAAA 4ME5A 2OF1A 1PRTB 5KGUA 1KTKA 3A8IE 3P75A 1M8AA 1BUVT 2Q8IB 3E0JA 1T5XD 3M7GA 4PQXA 5I6YA 4QB4A 4CBVA 3E5SA 1G8ZD 4PV1C 3SHLA 4A3BB 5EBCA 2RSOA 1EY4A 2K5WA 2IX1A 1CK1A 5JPNC 2KUMA 3EJIA 4GZYC 2XWBB 3FRPB 3T4AC 4V190 4B9XA 1VDZA 3HOUB 1TWAB 4ID6A 1EEID 1STHA 5ELDA 2G9HD 1A15A 4OO1G 3SE0A 3ITPA 3PO3B 4P2CB 4C2MB 3SR1A 4RFBA 2NTSA 3PUZA 1A2UA 3VR5A 5JAVA 3MEHA 1C48A 4CJ1B 5IGEA 4BA1I 3PV0A 4X3UA 1TIID 1SEBD 1SNCA 2OXPA 2R61A 2NVTB 3MXPA 3OMCA 4HAEA 4IUUA 1EL0A 1ZEQX 5CC4A 3GTMB 1U4PA 1FGBD 1B1ZA 2F0DA 3GTQB 2IL8A 1MBYA 4XQJA 3PUXA 2Z4HA 4DK0A 2B2YC 3H3VC 4K6LA 4KD3A 1E2ZA 2B2TA 2HQEA 2OT2A 4F7XA 1G2SA 2E75C 3BYTB 3M4YA 5C4ZA 3ND9A 1EQTA 1ILPA 1SE2A 1Q8IA 5ELCA 1TKWB 3MTSA 1AW7A 1HFGA 4HMJA 4WRDA 3S1NB 5HGTA 2A74C 3K5OA 4M8AA 3VR3A 4ZUJA 1LV9A 2XWJB 2XIWA 5JJZA 4V0BA 2KEEA 2PCFB 4RGOS 1VF7A 4I65A 4ZQ3A 5BN4A 1KNEA 4QF4A 1OXSC 5JOBA 4KK7A 1IYVA 3LWUA 1I3QB 3IL8A 4J6HA 2B8GA 1PXUA 1LT5D 3S1MB 1ML0D 4FXGC 3IFDA 3U9SA 1EIGA 5FO9B 2LY7A 5FO7B 2F0GA 3GP7A 3M7NA 4G7HC 3QJYA 5CBEE 2EJMA 1RCVD 5C0XJ 2IX0A 4IALA 2PZTA 1FNUA 4RGNA 4K5WA 4BBSB 2VUMB 1I4QA 3K0YA 2CW0D 4X3TA 2AUKA 3V05A 4NDXA 1DXMA 1PTOD 2E2DC 3AU7A 3MC0B 1E2WA 1PFNA 4KV6A 4A93B 2F0FA 3DM1A 1GHKA 5A2QL 2BE5C 1CQFA 3FEWX 4CGYB 2PZWA 3IFTA 1CHQD 2A6ED 3A7AB 4HR7B 2JXMB 3K5LA 5KEEA 1HA6A 2KA7A 3VYUA 2KEDA 2K7VA 4RGMA 1OO9B 1QOHA 1PZID 3BDOA 4IUNA 5I9OA 3CQZB 5FO8B 4HTHA 3GD7A 3FDTA 2DNCA 3MFGA 1TS3A 1HHVA 4TSSA 1DJRD 1Y8NB 2LFNA 2HDMA 2KHSA 2L4NA 4F8MA 4IUTA 4ZAIA 2IX3A 3CKIB 4HEDA 4CJ0B 1OXXK 1VMPA 3GTJB 2CHBD 1LTGD 3HOYB 2R92B 1QJOA 1XXGA 2DNEA 3A56A 1DOKA 3W3AA 2L12A 2M00A 4EQPA 1WTVA 2EPBA 3PUYA 4FF3A 3OWEB 1B4OA 3H0GB 4XXEA 3Q6SA 1STBA 3NTHA 4F87A 1AFPA 2A6HD 5D14A 4LJZC 1PDQA 1I4HA 4MIUA 2YU9B 1G91A 1TWCB 1I6VC 2N88A 1A3TA 2L11A 4NKLA 1WD0A 1F9RA 1KDCA 4ABNA 4FF2A 1KABA 1S5FD 1AEXA 3NTKA 1FR3A 1PTOF 1JWUD 1SDFA 1LTAD 2QCPX 1KLUD 5J1ZA 4CKCA 4Q5VA 2RDFA 1DM0B 4S3SA 3QWNA 5M9OA 2QF7A 1Z7TA 1ILQA 1CI3M 2TSSA 4RCNA 2N55A 4CKBA 2ZXOA 3QIAA 5JVG3 3ERQA 2K01A 5I4DA 5C4XB 5C3EB 4DA2A 3R2IA 5CGKA 3Q24A 2M9VA 1F9PA 3TP6A 4XQQA 1RKNA 3FKIB 1HFNA 1Y8OB 2XNAC 4KKUA 2EJFC 1SNQA 3HOWB 3OOCA 2TMPA 5KRUA 1LABA 2PMZB 4QCLA 1A3UA 1ZKOA 1GJXA 2DN8A 4RWSC 3MHBA 2I46A 4C3JG 1EQVA 2R6GA 2VXWA 2JEAI 1I4GA 1Z6HA 4A3MB 3HRZC 4DFAA 2O2LD 4BY1B 1STAA 1AN8A 1SYBA 3T16A 1OXTA 2F0SA 2D9UA 4ULLA 1HXYD 1LO5D 1TQOA 2F0HA 5JEAJ 4C3HG 3S15B 2X6GA 4XIGS 2EZVA 2HDLA 1AP0A 2V4DA 3NK9A 1ZYRC 1BCPB 1EOTA 2IT1A 1KAAA 3CHBD 5DAUA 3MWYW 5M5XB 2VB3X 2EXZA 1J9OA 3C1FA 1ONLA 1BDOA 4HN7A 2XSCA 1PRTC 4DK1A 1HRJA 2F03A 3ND8A 3NBIA 1TR5A 2HUGA 3VA7A 3M85A 3VA5A 1M4VA 1EY6A 3I3CA 4G4KA 3SEBA 1HTLD 3OHXC 4DAVA 2R7ZB 4KY6A 5E4WC 1WTRA 3IAYA 3C46A 1QWYA 1A3VA 2MUYA 3O13A 2RVLA 2AQ2B 4RAUC 1CZWA 2KECA 4IFDJ 1RDPD 3P7JA 5M5WB 4NW2A 2B2UC 2BDOA 2EYFA 4FVMA 3DWPA 2CW0C 2E2JB 4DAYA 1ENFA 5IGFA 3JAME 3TZDA 3RZOB 1BQQT 3K58A 3PO2B 2EY6A 4ODGA 3EFXD 1B50A 4PMCA 1E0BA 2X6LA 3KK7A 4EQNA 4WFN3 3NQTA 5C44B 2FMCA 4N9PA 1LTBD 2MJ8A 3S1RB 3V96A 1Q90A 5K5PA 2BCOA 2D62A 3NHHA 4XDXA 5A2QE 1R4PB 4MN3A 5CMDA 3A7LA 3MXGA 1L0XB 3I73A 4C3IG 2WINB 3I4LA 1JE4A 4C1NI 1EWHA 5J39A 1I6HB 1EYDA 3K7AB 3RMHA 4RH6A 2F0VA 1RHPA 3I4NB 4LMQD 3FPPA 2KOLA 1DOLA 3BDLA 3RD4A 2X69A 1UAPA 4DAPA 2EYPA 4IZ8A 1EEFD 1NR2A 2B8FA 4IURA 1PMRA 2RSNA 1XTCD 1QILA 5CV4A 1K8OA 3D4RA 3W2DA 3X3MA 3K5MA 4ZKCB 5FK9C 2O5IC 3FPUB 1CQVA 3HGBA 2ICIA 1X3PA 4H44C 1Q12A 2D5DA 2F0UA 3AB9A 1XWEA 2K32A 2WKDA 1STGA 3J7AF 3L7ZC 1WTXA 2A6HC 1QE6A 2EYLA 2K5DA 2EYMA 2WAQB 1EIHA 1STNA 1U4MA 4JBWA 1F2LA 2FFKB 3NP8A 5KNDA 1B44D 3IKJA 1YNJD 2A73B 5C4JB 4IUPA 1Q3LA 1A6XA 4KJOA 1PLFA 4DXFA 4K6DA 3DWAA 3SDZA 1D5MC 4B9WA 2NZ1D 2B2YA 1JICA 2B2TC 1GUGA 3NE5B 1SFOB 1TWHB 1FD7D 1HQMC 4KY7A 4RGTA 2WB1B 1S5BD 4EVOA 4PMWA 1R4QB 3DEPA 3C1EA 3GQBA 1G291 5IGGA 3WOEA 3J81E 3GTOB 1D1IA 2HCCA 4IUVA 1WVLA 3J80E 2NVQB 4RHSA 3A54A 3DHQA 3WDNA 2XN9C 4XT1B 1ZYRD 2E76C 2BA1A 3DMUA 3T51B 3I8ZA 1QG7A 1CHPD 4G7OC 5FLXL 4X3SA 1GUOA 4J1MA 1RTOA 4HCSA 3NPPA 2LS01 1PRTD 2EVBA 4H0LC 4K5VA 3V2TA 1CT1D 1S5DD 2BA0A 1NR4A 1JWMD 4IFDI 4XYOA 1I4RA 5JPMC 1DZ1A 1SBBB 1B2TA 1WTQA 1B9NA 3OIPA 1SNDA 2JP1A 1BBXC 1EZ8A 3FMCA 5COYA 2KCCA 1F2ZA 5M3FB 2NVXB 1JB3A 3UI2A 4BWGB 1CTMA 1RODA 4QMGA 1SXTA 2ZT9C 2SNSA 1S5ED 1JCKB 1V43A 5C6AA 2B39A 2Q8RE 3L9AX 1EWCA 4K2KA 3TDQA 4Y7NB 2D2CC 4FF4A 1HUNA 4OGQC 4H13C 2SDFA 2JA5B 3OWFA 2WV6D 3PUVA 1X3QA 2Y0SB 2J7ZA 5M5YB 2OEOA 3DEOA 3I72A 5D3IB 2R3ZA 1WTOA 4CJ2C 2E2IB 2G9DA 1H9SA 1SYDA 3KBGA 1TVXA 3J7AV 4TQUS 2XRQD 4G7ZC 4ZUIA 5IT9E 3OMGA 3MXNA 1IYUA 1G6ZA 1BXTA 2Z1CA 4HMIA 2IW3A 5EKIA 1HPCA 3TP7A 5ELFA 4PMBA 1T5EA 3TN2A 2WKCA 1PRTF 1CZGA 2PQEA 4K14A 3T53B 3SVMA 4KKTA 1MGSA 1JORA 1K83B 1O80A 4RKBA 2JE6I 3Q0AA 1KDAA 1SYGA 2AWOA 5TSSA 5C3XA 3URYA 4K5XA 1IKLA 2Q8TA 4E6IA 5F2DA 2NUCA 1LT4D 2A68C 3P20A 2JYOA 2PNRC 1SYCA 4F88A 4KHZA 1ICWA 5CR3A 4NMZA 5J22A 2B63B 2E2HB 1H9SB 1JOKA 5G3LD 3EVQA 2DY7A 2F4IA 4RHRA 1O7ZA 1GUSA 4KD4A 3PUWA 1D5XC 1EU3A 3NXWA 5KYLA 2YYZA 2AWNA 4RCOA 3A8JE 3G6JB 3S1QB 1O78A 1EY0A 3D4DA 3RUZA 4A3JB 3ZYYX 1XX8A 3VYSA 4A3EB 1SJED 3QO2A 4CHTB 1LACA 1QCBD 1B53A 1KDBA 1DYQA 4C56C 5IGBA 3PMFA 3R2TA 2NBFA 1EY5A 1RJTA 3QB3A 4KJNA 3BS1A 2VB2X 1DONA 1V1OA 3HZXA 4B08A 2EOTA 1UUPA 3BVZA 2LMCB 1YNJC 2L55A 3T13A 3QG1A 1CA6A 2CVRA 1EYAA 1YNND 2PW7A 4X3KA 5C0XI 2VNUD 4Z9CB 2NN6I 2QKIC 4ZK9B 3VYTA 1W6KA 1GUTA 5EGTA 3HOXB 1II3A 2JA8B 5LL6S 1TT2A 3OPOA 4A3KB 3LWEA 3MVVA 5IGCA 4H7BA 3KF8A 1HUMA 3KLSA 3GTGB 1U9RA 5EBDA 1LTRD 5E1FA 2FMMA 1H9MA 5C0XG 2MPMA 2M2LA 4IN3A 2B2VA 4O1NA 2R93B 3CRLC 5IIFA 3MA2B 5C5LA 4KI0A 1J8IA 1UEAB 4XTCS 2F0KA 1EY9A 1BO0A 2B2WC 4G57A 4HSVA 1FNVA 5CV9A 1LLRD 5G3LF 5FLXE 2K05A 2A5HA 3GO5A 1SAPA 2K03A 1ENCA 1DD2A 5D3DA 1IHZA 1XYIA 1ET6A 2H4OA 2F3VA 2H1EA 1HA5A 4JK1C 1STYA 1ESFA 5C5MA 1Q1BA 2F0NA 4WORA 5EQ0A 3GV6A 3R93A 1KNAA 1EZ6A 5A35A 1NAPA 5C0XH 3TSSA 3M3YB 3CRKC 2NN6H 2ZXRA 1JR0D 3MZ5A 3BZDB 3X3NA 1SE3A 4FF1A 5I2XA 2F0QA 2MGSA 3KLRA 1GXDC 4ZYSA 1IW7D 5CYUA 3BG3A 2IPKD 4ILWA 4XT3B 1U4RA 1UNSA 1C4QA 1DOMA 1TS2A 3D4WA 4R8NA 2SOBA 1Z47A 1S4ZA 2K1BA 1B3AA 2QDBA 2F0EA 4J8QA 1Y69U 3QOLA 1ZXTA 2NVYB 2A68D 2RQXA 4KY5A 4BY7B 1GHJA 1MSGA 1QNUA 5EPKA 2MHVA 3H91A 5CV7A 2K04A 5KNCA 1STEA 5KIXA 5T1IA 2J0TD 4OO1I 1RTNA 1D1KA 3U9OA 1FYCA 2CQAA 3HOVB 1JQYD 3C2PA 5CV6A 3EA6A 1HTPA 1SNOA 5ELEA 1MD2D 3NBHA 2SEBD 2EYOA 3DWQA 3TP8A 5HURA 5T1GA 2F0WA 3BVGA 3N6RA 4DN4M 3P1HA 5IGDA 4KN4C 4DNTB 1BCPD 1H9KA 2AQ3B 1PTOB 2HCIA 5BN3A 1BOSA 2EDGA 4UDUC 4I7ZC 2F3WA 3QOJA 5FOBB 2SNMA 5CV5A 1SMYD 3NQIA 2RA4A 4R9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OHX C;  3HRZ C;  5FO9 B;  2I07 B;  2A73 B;  1BQQ T;  3I70 A;  1JB3 A;  5FO7 B;  2TMP A;  2QKI C;  3L3O C;  5JPM C;  3CU7 A;  2ICE C;  2WIN B;  3HS0 C;  3G6J B;  2E2D C;  2A74 C;  1D2B A;  5JPN C;  2J0T D;  1BUV T;  1UAP A;  1GXD C;  3V96 A;  5FOB B;  1OO9 B;  4FXK C;  2XWB B;  2XWJ B;  3MA2 B;  1PXU A;  3FRP B;  3T4A C;  1XWE A;  2B39 A;  1BR9 A;  1JC7 A;  4FXG C;  2WII B;  1UEA B;  3CKI B;  3KLS A;  4ILW A;  5FO8 B; 
#chains in the Genus database with same CATH topology
 3GTP B;  1UWV A;  1JB7 A;  1RD9 D;  3VR6 A;  3K5N A;  3HEJ A;  1A8V A;  2JSO A;  2BDN A;  2EE1 A;  4TVA B;  1IL8 A;  1PH4 A;  2AUJ D;  1TY0 A;  2RDG A;  2RBM A;  4IPH A;  1WTW A;  2OTL A;  1CA5 A;  1CFM A;  1G2T A;  4DV3 L;  3I4N G;  4JI5 Q;  4AH6 A;  4DK3 C;  4L63 B;  2PW5 A;  1VQ5 A;  3SK5 A;  4JI0 L;  4K8I A;  4OL7 A;  2HIX A;  4ZRZ A;  4DR2 L;  1R9T B;  2A69 D;  2WAC A;  1TS4 A;  3A5Z B;  2KJX A;  3TP5 A;  1SNP A;  4DUZ Q;  2RKS A;  2F0I A;  4DAM A;  2E2J H;  1IYJ B;  4A3G B;  5M3M B;  3HOV G;  3RZO H;  1PH1 A;  4FXK C;  1MI2 A;  2FXQ A;  1SSO A;  3PO2 H;  3NBH B;  2ATW A;  1BR9 A;  3HP3 A;  2JEB I;  3HG9 A;  3T56 B;  4OO1 H;  3KJO A;  5JEA G;  2UUA Q;  2QIL A;  3ULJ A;  5DM7 3;  2EY1 A;  2OCE A;  4DGZ A;  4ZKB B;  1VMC A;  3KYH C;  1ESR A;  1TY2 A;  2BOS A;  3VR2 A;  3EIV A;  1A2T A;  3S17 B;  3NSW A;  3A55 A;  1F9Q A;  1I4X A;  1SYF A;  4M1U B;  4DF7 A;  4QIW B;  1YNN C;  4TKO B;  5DNF A;  1C7Y A;  3H09 A;  1JC7 A;  3MAQ A;  3WOF A;  4DNR B;  1OXV A;  2WAQ G;  1IKM A;  3PIP 3;  2N8N A;  3GV3 A;  3CCQ A;  3AFQ A;  4DUY Q;  2K5Q A;  1KQS A;  2DY8 A;  3CU7 A;  5COR A;  3UDF A;  2ICE C;  2JJQ A;  2PNH A;  2YTY A;  4GKJ Q;  3AMU A;  2RDH A;  1PZJ D;  3I4M B;  3PSI A;  2NVY H;  4BS9 A;  2Z4I A;  4DXG A;  3BDC A;  3I4N H;  1NSN S;  1SE4 A;  2IHF A;  4K2L A;  1VQJ A;  1VCI A;  5LL6 X;  1K8M A;  1SNM A;  2F4V L;  4A3C G;  1BCP F;  1L2F A;  3I70 A;  3A8K E;  1HQR D;  1UEB A;  1BBU A;  1SJH D;  5CBA E;  3JC6 6;  1A63 A;  2K5V A;  4R8I A;  3HOV H;  1NBW A;  1Y8P B;  5L37 A;  5GAH C;  4IFD G;  2EY5 A;  2ID0 A;  4DU9 A;  2PMZ E;  1IBL Q;  3JAM L;  2FHT A;  1LTI D;  2WB1 G;  4P71 A;  4TRD A;  3RLN A;  3OW2 A;  3ULP A;  5JEA H;  4C1N K;  1V1P A;  2K6A A;  3F1Z A;  4GNX A;  1E1T A;  3F8T A;  2F1M A;  2F0O A;  4RA8 A;  4XYQ A;  5EJW A;  2L1B A;  1L0W A;  5LMN Q;  3L3O C;  3MXU A;  1XMQ Q;  1EY7 A;  4QUC A;  5M3M G;  2NWG A;  3NWT A;  5E3F A;  4BBR B;  1CUK A;  1MHW C;  1BNZ A;  2LKV A;  3DUZ A;  1PTO H;  5EKK A;  1PYW D;  1I4P A;  4IPG A;  4RG1 A;  1VF5 C;  1XNQ Q;  2D0P A;  4LFC L;  4DNI A;  2JA7 B;  2F0M A;  2I07 B;  1HZC A;  1Y1V B;  1I50 B;  4WJW A;  1JOQ A;  4GN5 A;  1EY8 A;  3CME A;  4AIM A;  5JVH 3;  2K14 A;  4X65 Q;  5AJ3 L;  3K81 C;  1PH6 A;  3BVM A;  3K57 A;  1X65 A;  4KKS A;  2KVM A;  1Q8K A;  4DV5 Q;  2EY2 A;  5NUC A;  3I56 A;  3GTP H;  1NCV A;  2KQ3 A;  3E6Z X;  4UAI A;  5DEH A;  4KHV A;  3FHW A;  4BA2 I;  4A3C H;  2WII B;  3SXH A;  4R4I A;  5BR8 Q;  4OX9 Q;  3K59 A;  4A3I B;  5EPJ A;  4ZLT F;  1X32 A;  3S2H B;  2MP1 A;  3I4M G;  4IQZ A;  1SFO H;  4P73 A;  4IFD H;  2K4K A;  4DV1 Q;  5I2Y A;  5ELB A;  1EWI A;  4N8X 1;  4R4T A;  1F2Y A;  2E74 C;  5IOD A;  3KLW A;  2NYZ D;  1IW7 C;  3HOZ B;  3GTK B;  1CM9 A;  3NEL A;  1R9T H;  3SK8 A;  2F0T A;  5M3F G;  3LNN A;  4CKE A;  1PFM A;  3M4O B;  3J7Y W;  2ZXP A;  3TS0 A;  2NVQ H;  1E2V A;  3DXJ C;  2F0L A;  4RMF A;  1QNK A;  5M3M H;  1V1P B;  1K3B C;  4GN3 B;  3NWS A;  4GNX B;  3B6Y A;  3NTI A;  2UUC Q;  3BJU A;  5ISR A;  3J81 c;  4GLX A;  4FNF A;  3J80 c;  3ONA B;  3H94 A;  1L0Y B;  4C3J B;  2YTV A;  4LF9 L;  4JI6 Q;  3S24 A;  1RF2 D;  1NTG A;  3TRZ A;  2XRS D;  2JA5 G;  3RLF A;  4DR7 L;  2N78 A;  1Q1E A;  1FNW A;  2K50 A;  4NP5 A;  3I91 A;  2Y0S G;  3KDF A;  3PIO 3;  1B3Q A;  2RHS B;  3D6W A;  5CV8 A;  4HSP A;  2C5C A;  2F0P A;  3BYY B;  1EQQ A;  1D5Z C;  4KN7 C;  5GAG C;  2NTT A;  1F2M A;  1GUW A;  2C9O A;  1CKO A;  5AFW A;  5LHY 1;  5JJI A;  1VQL A;  2MO0 A;  2UXB L;  1EFI D;  4AYB B;  1O7I A;  4L8J A;  4DV0 L;  2JA6 B;  3I4M H;  3KBX A;  4C3H B;  3I55 A;  4RKL A;  5D65 A;  1H9R A;  2KHI A;  2NB0 A;  3I2Z A;  3H3V H;  1O7Y A;  4LUZ A;  3RN2 A;  5IOC A;  1JOO A;  2PPB C;  1BCP C;  5M3F H;  2NVX H;  1MSH A;  2PZU A;  1O7L A;  3Q23 A;  3J81 L;  4OIJ A;  2PYK A;  1J5E Q;  2Z8L A;  3R3O A;  2QEJ C;  4EGV A;  3J80 L;  2A1A A;  3H6M A;  5IYB G;  4FP5 D;  1KLG D;  1TWG B;  3EQL C;  1S5C D;  3HS0 C;  5C3W A;  3D6C A;  1K8A C;  1HZ9 A;  1G6P A;  1BF4 A;  2O4X A;  1U4L A;  1YZ6 A;  1SMY C;  1B9M A;  3TME A;  3OSO A;  4IUQ A;  4KHP Q;  1UE5 A;  4U67 3;  2L0C A;  2V1C C;  3GTL B;  2OQ0 A;  4A3F B;  2UUB L;  5EPL A;  5IWA Q;  1OXU A;  5IYD G;  1PFB A;  4N9T A;  2QEX A;  5I6W A;  1EU4 A;  1LTS D;  1VQB A;  4YWK A;  1N34 Q;  2J4X A;  2L9H A;  1DCZ A;  3TBI B;  2L15 A;  1PZK D;  1JMC A;  1LTT D;  1AZP A;  2K28 A;  3RZD B;  1TWF B;  1TXY A;  1I5F A;  3D8G A;  3ULL A;  2JA7 H;  3KDF B;  2RCF A;  3MFY A;  2RF4 A;  1I50 H;  5FKA C;  4KTA A;  2A69 C;  3HKZ B;  1JJG A;  4FDB A;  2XVS A;  2B63 G;  3VYR A;  3K6O A;  1EIF A;  5FJ8 G;  4LF6 Q;  3N52 A;  2Z6K C;  2WAQ E;  4JI5 L;  5KYI A;  1W6J A;  2NN6 G;  1F77 A;  3LX0 A;  1WTP A;  1IBK Q;  5EAY A;  4Q0F A;  3C3L A;  2FIN B;  3D31 A;  5IYC G;  2B2V C;  1QB5 D;  4HCE A;  2IWH A;  4DUZ L;  5IYB H;  2GA4 B;  2KCN A;  3FVQ A;  3Q22 A;  4FYD A;  2UU9 Q;  3UDG A;  5ELN A;  5IT9 c;  3F2B A;  3GTK H;  4L6T B;  3NUC A;  5BN5 A;  1ET9 A;  2JK8 A;  1WI5 A;  1XMO Q;  5K36 G;  4A3J G;  1H9J A;  3DLL A;  4C3I B;  2PO4 A;  2O5J C;  4DR3 Q;  3S9W A;  3KUP A;  3SK6 A;  4A3E G;  4PNY A;  2UUA L;  4MHE A;  1K83 H;  3M4O H;  1I94 Q;  2UXC Q;  1PH3 A;  2VQF L;  2B2W A;  3OIQ A;  4KMU C;  4EQO A;  4O42 A;  2B29 A;  2WB1 E;  2L5T A;  2BE5 D;  1NY4 A;  4ME3 A;  2AQ1 B;  5EKL A;  1PH7 A;  5DM6 3;  2RHQ B;  1ENA A;  1TU2 B;  5E4X A;  5I9P A;  1F9S A;  2WP8 J;  4YIJ A;  3S2D B;  4K8J A;  5KNB A;  5C4H A;  3K8A A;  3F2U A;  1D2B A;  1Y1W B;  1GUN A;  4DUY L;  2EJG C;  4CDF C;  3I90 A;  4A3D B;  2K33 A;  4U68 A;  2JA9 A;  4OON A;  3TZU A;  1KRT A;  1LT6 D;  2B63 H;  1TS5 A;  1UE6 A;  2E2H H;  5FJ8 H;  1E1O A;  1NUC A;  1HCZ A;  2EYJ A;  4UP9 A;  3HOX G;  3L0O A;  2JA8 G;  3K0X A;  2B2U A;  4A3K G;  3R8B A;  3VR4 A;  4DV4 Q;  5IT9 L;  1AZQ A;  5IYC H;  4OHJ A;  3OW7 A;  3ERO A;  3D3R A;  4OIK A;  2JA6 H;  4LK1 C;  1WD1 A;  4FO2 A;  3G7L A;  1LT3 D;  3S1Q H;  1PTO C;  5GRO A;  2IJ0 A;  4WJ3 M;  1IBL L;  2ENB A;  3SK4 A;  3CPW A;  1C8C A;  5K36 H;  1X3G A;  5J3B A;  3S14 B;  2LSS A;  3KLS X;  5GAD C;  4A3E H;  2R93 G;  1WCM B;  1YJ9 A;  1EYC A;  1JWS D;  4OWX B;  2CH4 A;  2KCT A;  3K80 C;  2Z6B A;  5LMN L;  2A6E C;  4QUF A;  1XMQ L;  4DR4 Q;  4FXD A;  5IP9 G;  1TWG H;  3STB D;  2F0J A;  4XQN A;  1SYE A;  1D6E C;  2EYH A;  3S16 B;  1V8Q A;  1GOZ A;  2FJ2 A;  3DM3 A;  2K5N A;  4LAA A;  4DR6 Q;  1GVP A;  4ME5 A;  4A3F H;  1M1K C;  2OF1 A;  1PRT B;  1XNQ L;  5KGU A;  1E22 A;  1KTK A;  3A8I E;  3P75 A;  1M8A A;  1BUV T;  2Q8I B;  3E0J A;  4IJH A;  1T5X D;  1IL2 A;  4X65 L;  1UE7 A;  3M7G A;  4GKK Q;  4PQX A;  3HOX H;  4DV5 L;  4LF8 Q;  1QUQ A;  5I6Y A;  2N49 A;  4QB4 A;  3RZD H;  1EYG A;  2AHO B;  1E3P A;  3E5S A;  1G8Z D;  4PV1 C;  4CBV A;  4A3K H;  4JCV E;  1NNX A;  3SHL A;  4A3B B;  3T1H Q;  5EBC A;  2RSO A;  1EY4 A;  5BR8 L;  2K5W A;  3CCE A;  4OX9 L;  2IX1 A;  1CK1 A;  5JPN C;  2KUM A;  2Y0S E;  3GTG H;  3EJI A;  4GZY C;  2XWB B;  3FRP B;  3T4A C;  4V19 0;  2IY5 B;  4B9X A;  1SRO A;  1VDZ A;  4DV1 L;  3HOU B;  4LUO A;  1TWA B;  4ID6 A;  3J80 i;  1K73 C;  1XNR Q;  3PGZ A;  1EEI D;  1STH A;  5ELD A;  2G9H D;  4DR5 Q;  1A15 A;  4OO1 G;  1EOV A;  1VQG A;  3SE0 A;  3ITP A;  3PO3 B;  3CCM A;  4P2C B;  4C2M B;  3SR1 A;  4RFB A;  2NTS A;  3PUZ A;  1A2U A;  3VR5 A;  5JAV A;  1LUZ A;  3MEH A;  1C48 A;  4CJ1 B;  5IGE A;  3PIP A;  4JOI A;  4BA1 I;  4BXX H;  3PV0 A;  4X3U A;  4HID A;  1HNX Q;  1TII D;  2UUC L;  4GOP A;  2OQK A;  4C3I H;  1SEB D;  1SNC A;  2CH4 W;  2K5H A;  2OXP A;  1QVC A;  4B3M Q;  2I5M X;  1PYB A;  4JI6 L;  4L5T A;  2R61 A;  2NVT B;  3MXP A;  3OMC A;  4HAE A;  4IUU A;  1K28 A;  1EL0 A;  1ZEQ X;  5CC4 A;  2E8G A;  3GTM B;  1U4P A;  1K3R A;  1FGB D;  1B1Z A;  2F0D A;  3GTQ B;  2IL8 A;  4PZ7 A;  2N3S A;  1MBY A;  4BY7 G;  4XQJ A;  3PUX A;  2Z4H A;  5FLX c;  4DK0 A;  2B2Y C;  1QZG A;  3H3V C;  3S2D H;  3EN2 A;  4K6L A;  1Y1W H;  4KD3 A;  4A75 A;  1E2Z A;  2B2T A;  4A3D H;  2HQE A;  2OT2 A;  4F7X A;  1QUQ B;  1G2S A;  2E75 C;  3BYT B;  3M4Y A;  5C4Z A;  4LFB Q;  4GLV B;  3ND9 A;  2ZJR A;  2MNA A;  1GKH A;  1EQT A;  1ILP A;  2PI2 A;  1BVS A;  3M3Y H;  1X3E A;  1C0A A;  2DJF C;  1SE2 A;  1Q8I A;  5ELC A;  1TKW B;  3MTS A;  1L1O C;  1HNW Q;  1AW7 A;  1HFG A;  1CKN B;  4HMJ A;  4JI7 Q;  4WRD A;  3S1N B;  5HGT A;  2A74 C;  3AQQ A;  3K5O A;  4M8A A;  1J5E L;  1MJC A;  3VR3 A;  4ZUJ A;  1LV9 A;  1P16 A;  1WTH A;  2XWJ B;  2XIW A;  5GAE C;  5JJZ A;  4V0B A;  2KEE A;  2PCF B;  3CP0 A;  4KHP L;  4DV6 Q;  4RGO S;  1VF7 A;  4I65 A;  5IWA L;  2JQO A;  2VZA A;  4ZQ3 A;  5BN4 A;  4GOP B;  1KNE A;  1VQP A;  1N34 L;  2CFM A;  1JJ2 A;  4JYA Q;  4QF4 A;  1OXS C;  1PHJ A;  5JOB A;  2NZH A;  4KK7 A;  1IYV A;  3S16 H;  3LWU A;  1I3Q B;  3IL8 A;  4J6H A;  2B8G A;  1PXU A;  1LT5 D;  4BY7 H;  3S1M B;  1ML0 D;  4FXG C;  3IFD A;  3U9S A;  1EIG A;  5FO9 B;  4A3L G;  2LY7 A;  5IP7 G;  5FO7 B;  2F0G A;  3GP7 A;  4NXN Q;  3M7N A;  2AMC B;  4G7H C;  3QJY A;  2AKW B;  5CBE E;  2EJM A;  1RCV D;  5C0X J;  3RR5 A;  4MZ9 A;  3A74 A;  2IX0 A;  4A4I A;  3OTO Q;  4IAL A;  2PZT A;  1FNU A;  4RGN A;  4K5W A;  4BBS B;  4LF6 L;  2VUM B;  1QZH A;  1I4Q A;  3K0Y A;  1WJJ A;  2CW0 D;  4I7A A;  4X3T A;  2AUK A;  3V05 A;  1IBK L;  3F2C A;  4NDX A;  4CDC C;  4DV7 Q;  1HZB A;  1T9H A;  1DXM A;  1PTO D;  2E2D C;  2P5Z X;  3AU7 A;  4A3G G;  3MC0 B;  1E2W A;  1PFN A;  4KV6 A;  1TWA H;  4A93 B;  2F0F A;  2UU9 L;  3DM1 A;  1GHK A;  5A2Q L;  2BE5 C;  1CQF A;  3FEW X;  4CGY B;  2ASB A;  1AH9 A;  2QGQ A;  2PZW A;  3RNU A;  3L2P A;  1SRU A;  3IFT A;  4DR3 L;  1CHQ D;  2A6E D;  3A7A B;  4HR7 B;  2UXC L;  1EFW A;  2JXM B;  3K5L A;  5KEE A;  1C9O A;  1VQD A;  3UDX A;  1HA6 A;  4JI1 Q;  2KA7 A;  3VYU A;  2KED A;  4JV5 Q;  3TS2 A;  2K7V A;  4RGM A;  2VW9 A;  1OO9 B;  1QOH A;  1PH5 A;  1PZI D;  3BDO A;  1VQC A;  4IUN A;  5I9O A;  3CQZ B;  4A3L H;  2GVB A;  5IP7 H;  5FO8 B;  4HTH A;  2NVT H;  3GD7 A;  3FDT A;  2DNC A;  3MFG A;  1X3F A;  3CPF A;  1TS3 A;  1HHV A;  4TSS A;  1DJR D;  4LFA Q;  1Y8N B;  2LFN A;  2HDM A;  2KHS A;  2L4N A;  4L5R C;  1JJC B;  4F8M A;  4AQY Q;  3MEF A;  4IUT A;  4ZAI A;  2IX3 A;  3CKI B;  4HED A;  1KHI A;  4MNO A;  4NB3 A;  4Y52 H;  1IBM Q;  1OXX K;  4CJ0 B;  1VMP A;  3G71 A;  3GTJ B;  2CHB D;  1LTG D;  4A3G H;  3HOY B;  2R92 B;  1NMF A;  2C35 B;  1QJO A;  1XXG A;  1B70 B;  2DNE A;  3A56 A;  4HJ8 A;  1DOK A;  3W3A A;  4WJ4 A;  2L12 A;  2M00 A;  4EQP A;  3STB C;  1WTV A;  2EPB A;  3PUY A;  4FF3 A;  3S1N H;  2CQO A;  4K0K Q;  3OWE B;  1B4O A;  3H0G B;  1PV4 A;  2Q2T A;  4XXE A;  4O2D A;  3S17 H;  3Q6S A;  1STB A;  3NTH A;  4F87 A;  2EIF A;  4QJF A;  1AFP A;  2A6H D;  4A93 G;  1V9P A;  4DR4 L;  4BBR G;  1PH8 A;  5D14 A;  4DR1 Q;  4LJZ C;  1PDQ A;  5H1S E;  1I4H A;  4MIU A;  2YU9 B;  4JI8 Q;  4DR6 L;  1G91 A;  4HJ5 A;  1TWC B;  2JA7 G;  1I6V C;  1Y1V G;  1A0I A;  1KIX A;  2N88 A;  1A3T A;  2L11 A;  4NKL A;  1WD0 A;  1F9R A;  1KDC A;  4ABN A;  4FF2 A;  1KAB A;  1S5F D;  1AEX A;  1VQN A;  1NJI C;  3NTK A;  2ZM6 Q;  4B3T Q;  4GKK L;  1YBY A;  1PH2 A;  1FR3 A;  1PTO F;  1RL2 A;  4JG2 A;  1JWU D;  1SDF A;  1LTA D;  2QCP X;  1KLU D;  4LF8 L;  5J1Z A;  3M4Q A;  4CKC A;  4Q5V A;  2RDF A;  1DM0 B;  4S3S A;  3QWN A;  1LM0 A;  3T1H L;  4ALP A;  1DGS A;  5M9O A;  2QF7 A;  2BH8 A;  4A3I G;  1VQK A;  1Z7T A;  1ILQ A;  1CI3 M;  2TSS A;  4APV A;  4RCN A;  2Q2I A;  2N55 A;  1N9W A;  4CKB A;  2DGY A;  2ZXO A;  3MXN B;  3QIA A;  4LUV A;  5JVG 3;  3ERQ A;  2K01 A;  5I4D A;  3HOZ G;  5C4X B;  5C3E B;  1KRS A;  4DA2 A;  1XNR L;  2VS1 A;  3R2I A;  4YCW A;  4DR5 L;  4P74 A;  5CGK A;  4LW1 A;  3Q24 A;  4R4Q A;  2M9V A;  3VDY A;  1F9P A;  3TP6 A;  4XQQ A;  1RKN A;  1N33 Q;  3FKI B;  1HFN A;  1Y8O B;  3PF4 A;  2XNA C;  4H02 A;  3ZJY C;  4KKU A;  2EJF C;  1SNQ A;  3HOW B;  3OOC A;  4A93 H;  2TMP A;  3D0F A;  4BBR H;  5KRU A;  1FJG Q;  1LAB A;  2JN4 A;  3IRB A;  2PMZ B;  4QCL A;  1A3U A;  1ZKO A;  1HNX L;  1GJX A;  2DN8 A;  4RWS C;  3MHB A;  4OWT B;  4HIK A;  2I46 A;  4C3J G;  1EQV A;  1KC8 C;  3U4V A;  2ZJP A;  3J7A 5;  4B3M L;  2R6G A;  1Y1V H;  2VXW A;  3H0G G;  2JEA I;  4P72 A;  1I4G A;  1Z6H A;  4A3M B;  3HRZ C;  4QQB X;  1WYD A;  4X64 Q;  4DFA A;  1KXL A;  2O2L D;  4BY1 B;  3HOY G;  1STA A;  1AN8 A;  1SYB A;  4UP8 A;  3T16 A;  1OXT A;  2F0S A;  1N32 Q;  2D9U A;  3CQZ H;  4ULL A;  1HXY D;  4PG3 A;  1LO5 D;  1Y14 B;  2CKZ B;  4B3S Q;  2XTI A;  1TQO A;  2VL6 A;  4A3I H;  1RIP A;  5E7N A;  3S2H H;  2F0H A;  4AYB G;  2JA6 G;  2Z6K A;  5JEA J;  4JI2 Q;  4C3H G;  3S15 B;  2Z9H A;  2X6G A;  4X6A H;  3CCU A;  4XIG S;  2EZV A;  2HDL A;  4LFB L;  1AP0 A;  3HOZ H;  2Q2U A;  3BZK A;  2V4D A;  3NK9 A;  4DV2 Q;  2ES2 A;  1KL9 A;  1ZYR C;  1HNW L;  1BCP B;  3GDE A;  1EOT A;  2IT1 A;  4JI7 L;  1S72 A;  2H5X A;  1KAA A;  3CHB D;  5DAU A;  3MWY W;  5M5X B;  2YTX A;  2VB3 X;  2EXZ A;  4PZ6 A;  1HNZ Q;  1J9O A;  3C1F A;  1ONL A;  1BDO A;  4GS3 A;  4HN7 A;  4KLK A;  2XSC A;  2Q2H A;  1PRT C;  4DK1 A;  1HRJ A;  4C3J H;  2F03 A;  3ND8 A;  4A3F G;  3NBI A;  4L5S A;  1TR5 A;  2HUG A;  3FKI G;  4CDD C;  3VA7 A;  4DV6 L;  3H0G H;  3M85 A;  1YIT A;  4CDE C;  3VA5 A;  1Q81 C;  1M4V A;  2UXD Q;  3W1B A;  1EY6 A;  3I3C A;  4G4K A;  3SEB A;  1HTL D;  4GKJ L;  3OHX C;  3TRE A;  4DAV A;  2R7Z B;  4KY6 A;  1NE3 A;  1GD7 A;  1YVC A;  5E4W C;  1WTR A;  3IAY A;  3C46 A;  2HHH Q;  1QWY A;  3RLO A;  4B3R Q;  1A3V A;  2MUY A;  3O13 A;  2RVL A;  2ALY B;  2AQ2 B;  4RAU C;  4OEM B;  1CZW A;  1MKH A;  2KEC A;  4IFD J;  1RDP D;  3P7J A;  1LTL A;  5M5W B;  4NW2 A;  2B2U C;  2BDO A;  4NXN L;  2EYF A;  4FVM A;  4QL5 A;  1K8G A;  4QY7 A;  3DWP A;  2CW0 C;  4QIW E;  3HKZ G;  4C3H H;  2E2J B;  4BY1 G;  4DAY A;  1Q82 C;  1ENF A;  5IGF A;  3JAM E;  3CD6 A;  3TZD A;  3OTO L;  3RZO B;  1BQQ T;  3K58 A;  3PO2 B;  2EY6 A;  2WFW A;  2KEN A;  4ODG A;  3EFX D;  1B50 A;  4PMC A;  1E0B A;  3M4P A;  2X6L A;  3KK7 A;  4EQN A;  4WFN 3;  3NQT A;  5C44 B;  2FMC A;  4N9P A;  1LTB D;  2MFI A;  2ZJQ A;  2MJ8 A;  3S1R B;  4JVZ A;  1VQ9 A;  3V96 A;  1Q90 A;  3CMA A;  4DV7 L;  2LXJ A;  5K5P A;  3ICE A;  5GQO A;  2EXD A;  4HIO A;  1Q86 C;  2BCO A;  2D62 A;  4O0A A;  4BXX G;  3NHH A;  4XDX A;  5A2Q E;  3U50 C;  1R4P B;  4MN3 A;  5CMD A;  3A7L A;  4MTN A;  3MXG A;  1NMG A;  1L0X B;  3I73 A;  3W1G A;  4C3I G;  2WIN B;  2OWO A;  1XPR A;  3GTL H;  1VQF A;  3I4L A;  1JE4 A;  3FKI H;  5HGQ A;  4MTK A;  3CXC A;  1B7Y B;  4C1N I;  1EWH A;  3BZC A;  5J39 A;  1I6H B;  1EYD A;  4JI1 L;  4LWC A;  4JV5 L;  3K7A B;  1G51 A;  3A0J A;  4RH6 A;  2F0V A;  1RHP A;  3RMH A;  3I4N B;  4LMQ D;  1PYS B;  1TWF H;  3FPP A;  4EX5 A;  2KOL A;  1DOL A;  2ZTD A;  1Y1W G;  4NXM Q;  3BDL A;  1VQM A;  4A3D G;  3RD4 A;  2X69 A;  3CCV A;  4DV0 Q;  1HH2 P;  4A3M H;  4QGU A;  1UAP A;  4DAP A;  2EYP A;  2QDL A;  4IZ8 A;  1EEF D;  1NR2 A;  2B8F A;  4IUR A;  4BY1 H;  1PMR A;  3T1Y Q;  1YEZ A;  2RSN A;  1X6O A;  1XTC D;  1CKN A;  3AEV A;  4LFA L;  1PVO A;  1QIL A;  5CV4 A;  1K8O A;  2F3I A;  3D4R A;  3W2D A;  3X3M A;  3CC7 A;  2RCN A;  4DAY B;  4AQY L;  2NZO A;  3K5M A;  4ZKC B;  5FK9 C;  2O5I C;  1A62 A;  3FPU B;  1CQV A;  3HGB A;  2ICI A;  1VQE A;  1X3P A;  2XGT A;  4LF7 Q;  4H44 C;  3S15 H;  3CCL A;  1IBM L;  1Q12 A;  2D5D A;  2F0U A;  3AB9 A;  1XWE A;  2K32 A;  2WKD A;  1STG A;  1XPU A;  3ERS X;  1K0R A;  2HIV A;  3J7A F;  3L7Z C;  2A19 A;  1WTX A;  1N36 Q;  2A6H C;  1AE2 A;  1QE6 A;  2EYL A;  1EQR A;  3CAM A;  2K5D A;  3CCJ A;  1H95 A;  2EYM A;  4JOI C;  2WAQ B;  4LF4 Q;  1STN A;  1EIH A;  3OYY A;  1U4M A;  1SMX A;  1WCM G;  1FVI A;  4JBW A;  1F2L A;  2R7F A;  2FFK B;  4K0K L;  5M5X H;  1VQ4 A;  3NP8 A;  4HJ7 A;  2VY3 A;  5KND A;  1B44 D;  3KFU A;  1EUJ A;  3NEM A;  1PH9 A;  3IKJ A;  1YNJ D;  4DR1 L;  4UY8 C;  2A73 B;  4IOC A;  5C4J B;  4IUP A;  1Q3L A;  4JI8 L;  1A6X A;  4KJO A;  4IPC A;  1PLF A;  4DXF A;  4K6D A;  1YIJ A;  3KF6 A;  3DWA A;  3PQI A;  3SDZ A;  1D5M C;  3E9I A;  4B9W A;  1KAW A;  2NZ1 D;  2Z0S A;  2B2Y A;  2R7Z H;  1JIC A;  2B2T C;  1GUG A;  4X62 Q;  3NE5 B;  1SFO B;  1TWH B;  1FD7 D;  1HQM C;  4KY7 A;  4RGT A;  4B3T L;  2ZM6 L;  2KHJ A;  2WB1 B;  3QR8 A;  1S5B D;  2BH2 A;  4EVO A;  4PMW A;  1YJW A;  1R4Q B;  1P8L A;  3DEP A;  3C1E A;  3GQB A;  5M5W H;  4JW0 A;  1G29 1;  5IGG A;  4A3B G;  3WOE A;  1YHB A;  2QA4 A;  3J81 E;  3GTO B;  1D1I A;  2HCC A;  4IUV A;  1WVL A;  3J80 E;  2NVQ B;  4RHS A;  3G6E A;  1M90 C;  3A54 A;  3HOU G;  1L1O A;  3DHQ A;  3WDN A;  2XN9 C;  1B8A A;  4XT1 B;  4YWM A;  1ZYR D;  3S14 H;  1JT8 A;  2E76 C;  2BA1 A;  5C44 H;  1WCM H;  3DMU A;  3FP9 A;  3T51 B;  5LMU Q;  3I8Z A;  3KJP A;  2VQF Q;  3S1R H;  3JAM c;  3PO3 G;  1QG7 A;  3HKS A;  4AYB E;  4HJA A;  1N33 L;  1CHP D;  4G7O C;  5FLX L;  1S40 A;  4X3S A;  3J81 j;  1GUO A;  4J1M A;  1RTO A;  2VQE Q;  4HCS A;  2IHE A;  3NPP A;  1YHQ A;  2LS0 1;  1PRT D;  1GO3 E;  2EVB A;  3E3X A;  1JE5 A;  4H0L C;  4K5V A;  1FJG L;  3V2T A;  3ER0 A;  2G5D A;  1QVG A;  1KD1 C;  1CT1 D;  1S5D D;  2BA0 A;  1NR4 A;  1JWM D;  4IFD I;  4XYO A;  1I4R A;  5JPM C;  1DZ1 A;  1SBB B;  3Q8D A;  1B2T A;  1WTQ A;  1B9N A;  1I6H H;  4GN4 B;  3OIP A;  1FL0 A;  3K7A H;  1HR0 Q;  4X64 L;  4LF5 Q;  1SND A;  2JP1 A;  3KF6 B;  1BBX C;  3U4Z A;  1EZ8 A;  3CC2 A;  3FMC A;  1LYL A;  5COY A;  2KCC A;  1MIU A;  1N32 L;  4A3B H;  1F2Z A;  5M3F B;  4IPD A;  2NVX B;  4JI3 Q;  1JB3 A;  4JPB W;  3UI2 A;  4BWG B;  4B3S L;  1CTM A;  1ROD A;  4GNX C;  4ZCK A;  4JI2 L;  4QMG A;  3HOU H;  1SXT A;  2QW7 A;  2ZT9 C;  4P75 A;  2PQA A;  2SNS A;  1S5E D;  1JCK B;  4OWW B;  1V43 A;  2YV5 A;  3PCO B;  5C6A A;  2B39 A;  2Q8R E;  1WFQ A;  3L9A X;  3BU2 A;  4NPS A;  1EWC A;  1XMO L;  4K2K A;  4DV2 L;  3TDQ A;  4Y7N B;  3PO3 H;  2D2C C;  4FF4 A;  1L1O B;  4YCV A;  4OGQ C;  4H13 C;  4C2M H;  1HUN A;  2SDF A;  4JI4 Q;  3HKZ E;  3PIO A;  1I94 L;  2JA5 B;  3OWF A;  2WV6 D;  3PUV A;  1V1Q A;  2CWP A;  5IY0 A;  3CC4 A;  1UE1 A;  2HD3 A;  1X3Q A;  2Y0S B;  4JBM A;  2J7Z A;  5M5Y B;  2OEO A;  4DPG A;  1HNZ L;  3KOJ A;  4HJ9 A;  1BBW A;  3DEO A;  3I72 A;  5D3I B;  2A8V A;  1CSQ A;  4YHH Q;  2R3Z A;  2ZTE A;  1WTO A;  4CJ2 C;  2E2I B;  3AFP A;  2G9D A;  1H9S A;  1SYD A;  3GTM H;  3KBG A;  2E5L Q;  3H3V I;  1TVX A;  3GTQ H;  2UXD L;  3J7A V;  1YNX A;  5JJL A;  1VQO A;  1FGU A;  2HHH L;  1SLJ A;  5C4J H;  4B3R L;  4DKA C;  4TQU S;  3WWV A;  4YY3 Q;  2XRQ D;  4G7Z C;  4ZUI A;  5IT9 E;  3OMG A;  3MXN A;  4OEL B;  4DV4 L;  1IYU A;  2GN5 A;  1G6Z A;  1BXT A;  1VQ8 A;  2Z1C A;  4HMI A;  1TWH H;  2IW3 A;  5EKI A;  1HPC A;  3TP7 A;  5ELF A;  4X66 Q;  4PMB A;  4BBS G;  1T5E A;  4R4C A;  2VUM G;  3TN2 A;  1BKB A;  2WKC A;  1PRT F;  5IE8 A;  1CZG A;  2PQE A;  4K14 A;  3T53 B;  3SVM A;  4YWL A;  4KKT A;  3GTO H;  1HJP A;  1MGS A;  2PQA B;  1K83 B;  1JOR A;  3PF5 A;  4OXP A;  1O80 A;  4RKB A;  2JE6 I;  3Q0A A;  1KDA A;  1SYG A;  3F2D A;  2AWO A;  5TSS A;  5C3X A;  3URY A;  1YHA A;  4K5X A;  1IKL A;  2Q8T A;  4E6I A;  3I7F A;  5F2D A;  2NUC A;  1LT4 D;  2A68 C;  3P20 A;  2JYO A;  2R7D A;  2PNR C;  1SN8 A;  1SYC A;  1VQ6 A;  4F88 A;  1X55 A;  4KHZ A;  1ICW A;  3U58 A;  5CR3 A;  1XTD A;  4NMZ A;  1I3Q H;  5J22 A;  4DV3 Q;  2B63 B;  2E2H B;  2CWA A;  3S1M H;  1H9S B;  1JOK A;  2B3G A;  4JI0 Q;  5G3L D;  1SR3 A;  3EVQ A;  4DR2 Q;  2DY7 A;  4JBK A;  2F4I A;  4RHR A;  1O7Z A;  5FLM G;  1GUS A;  3TQY A;  4KD4 A;  1U0L A;  4NXM L;  3J7Z C;  3PUW A;  3SGI A;  1D5X C;  1EU3 A;  3NXW A;  3TEH B;  1OTC A;  5KYL A;  2YYZ A;  2AWN A;  4RCO A;  3A8J E;  3T1Y L;  4BBS H;  3G6J B;  3S1Q B;  2VUM H;  1O78 A;  1EY0 A;  3D4D A;  4YCU A;  3RUZ A;  4A3J B;  3ZYY X;  1XX8 A;  3VYS A;  4A3E B;  1SJE D;  4POF A;  3QO2 A;  4CHT B;  1D7Q A;  1SE8 A;  1LAC A;  1QCB D;  1PFS A;  1B53 A;  1KDB A;  1DYQ A;  4C56 C;  5IGB A;  1K0S A;  3PMF A;  3R2T A;  2NBF A;  4LF7 L;  1EY5 A;  1RJT A;  3QB3 A;  4KJN A;  2GVA A;  2VB2 X;  3BS1 A;  3E9H A;  1K9M C;  2R92 G;  1DON A;  1CKM A;  1VQI A;  1V1O A;  3HZX A;  4B08 A;  4R4O A;  2EOT A;  1UUP A;  3BVZ A;  1N36 L;  4A76 A;  3G48 A;  1CSP A;  4Y7N H;  2LMC B;  4LF4 L;  1YNJ C;  2L55 A;  3M9B A;  1X56 A;  5ELO A;  2LXK A;  1MJE A;  2JA5 H;  3T13 A;  3QG1 A;  2I0Q A;  1CA6 A;  2CVR A;  1EYA A;  1YNN D;  2I5H A;  3CF5 A;  2PW7 A;  4X3K A;  5C0X I;  1E24 A;  2VNU D;  3I4O A;  4Z9C B;  5M5Y H;  1ICF B;  2NN6 I;  3EBE A;  4N8F A;  2QKI C;  4ZK9 B;  3VYT A;  1IXR A;  1W6K A;  1GUT A;  5EGT A;  3HOX B;  1II3 A;  2JA8 B;  5LL6 S;  1TT2 A;  2F4V Q;  4POG A;  3OPO A;  2E2I H;  4A3K B;  1W2B A;  3LWE A;  5FLM H;  1VQA A;  3MVV A;  1ASY A;  5IGC A;  4H7B A;  3KF8 A;  1HUM A;  3KLS A;  3GTG B;  2DUD A;  1U9R A;  5EBD A;  4X62 L;  1LTR D;  1D8L A;  5E1F A;  1EIY B;  2FMM A;  4GLA C;  2ZTC A;  1H9M A;  5C0X G;  2MPM A;  2M2L A;  4IJL A;  4IN3 A;  3JAM i;  3CCR A;  2B2V A;  4O1N A;  1Z9F A;  1J6Q A;  2R93 B;  3CRL C;  5IIF A;  1VQ7 A;  3MA2 B;  5C5L A;  4KI0 A;  1J8I A;  3GTJ H;  2I5L X;  1UEA B;  2R92 H;  3HOY H;  2KCM A;  4XTC S;  2F0K A;  1EY9 A;  3H15 A;  1E7Z A;  1BO0 A;  2B2W C;  1Q7Y C;  1PA6 A;  5C4X G;  5C3E G;  4G57 A;  1X54 A;  4HSV A;  1FNV A;  4UP7 A;  2OTJ A;  4LFC Q;  2HQL A;  2HT1 A;  5IYD H;  5CV9 A;  1S3O A;  1HR0 W;  1LLR D;  5G3L F;  4JBJ A;  5LMU L;  3UE0 A;  5FLX E;  2K05 A;  2A5H A;  3GO5 A;  1SAP A;  2K03 A;  5AJ3 Q;  3HOW G;  1ENC A;  1HZA A;  4JYA L;  1DD2 A;  5D3D A;  2VQE L;  3CCS A;  1IHZ A;  1XYI A;  1ET6 A;  2H4O A;  2F3V A;  2H1E A;  1HA5 A;  4JK1 C;  2YU9 H;  1AE3 A;  1STY A;  1ESF A;  1TWC H;  5C5M A;  1Q1B A;  2F0N A;  4WOR A;  5EQ0 A;  5HY6 A;  3GV6 A;  2MQH A;  4HIM A;  3R93 A;  1X9N A;  1IZ6 A;  1XJV A;  1KNA A;  1EZ6 A;  4A3M G;  2F52 A;  3RN5 A;  3A5U A;  4J15 A;  5A35 A;  5LMN W;  5DLQ E;  3LGJ A;  1NAP A;  1HR0 L;  2MO1 A;  4LF5 L;  3AYH B;  3KF8 B;  5C0X H;  3TSS A;  3M3Y B;  3CRK C;  2NN6 H;  2ZXR A;  2CCZ A;  1JR0 D;  3MZ5 A;  3BZD B;  3X3N A;  1SE3 A;  4FF1 A;  1VS0 A;  5I2X A;  2F0Q A;  2MGS A;  3KLR A;  4JI3 L;  1GXD C;  1GM5 A;  4ZYS A;  1IW7 D;  5CYU A;  4UHV A;  3BG3 A;  2IPK D;  4ILW A;  4XT3 B;  4IO9 A;  1U4R A;  2KBN A;  5C4X H;  5C3E H;  1W3S A;  4A3J H;  1UNS A;  1C4Q A;  4EQ5 A;  1DOM A;  4LF9 Q;  1Q46 A;  1TS2 A;  3D4W A;  4R8N A;  1WOC A;  2SOB A;  1Z47 A;  4DR7 Q;  1S4Z A;  2K1B A;  4JI4 L;  4UPA A;  4PZ8 A;  1B3A A;  2QDB A;  2F0E A;  4J8Q A;  1Y69 U;  3HOW H;  3QOL A;  1ZXT A;  2NVY B;  2A68 D;  2RQX A;  4KY5 A;  4BY7 B;  1GHJ A;  1MSG A;  1QNU A;  5EPK A;  2DJG C;  4YHH L;  2PI2 E;  1YJN A;  2MHV A;  3H91 A;  5CV7 A;  2K04 A;  5KNC A;  1STE A;  5KIX A;  5T1I A;  1U5K A;  4JC0 A;  2UXB Q;  4R1J A;  2J0T D;  4OO1 I;  2E5L L;  1RTN A;  2R7Z G;  1D1K A;  3U9O A;  1FYC A;  2CQA A;  3HOV B;  1JQY D;  3K7U C;  3C2P A;  5CV6 A;  2JA8 H;  4L5Q A;  3EA6 A;  1HTP A;  1SNO A;  5ELE A;  1QVF A;  1MD2 D;  3W5O A;  3NBH A;  4YY3 L;  2SEB D;  2EYO A;  3DWQ A;  3HFZ B;  3TP8 A;  5HUR A;  5T1G A;  2F0W A;  2EQS A;  3BVG A;  3J81 i;  3N6R A;  1VQH A;  4DN4 M;  3P1H A;  3PO2 G;  5IGD A;  4KN4 C;  4X66 L;  1BCP D;  4DNT B;  1ASZ A;  1H9K A;  2AQ3 B;  1PTO B;  3G4S A;  1YI2 A;  2HCI A;  5BN3 A;  2UUB Q;  2R93 H;  3UDI A;  3CW2 C;  5C44 G;  1BOS A;  2EDG A;  3E0E A;  1N8R C;  4UDU C;  4GOP C;  4LNQ A;  3NEN A;  4I7Z C;  4DK6 C;  2D0O A;  2F3W A;  2K52 A;  4IOA A;  3QOJ A;  5FOB B;  5IP9 H;  1XPO A;  2SNM A;  5CV5 A;  1SMY D;  2K75 A;  3NQI A;  2RA4 A;  3UE1 A;  4R9W A;  5JJK A; 
#chains in the Genus database with same CATH homology
 3GTP B;  1RD9 D;  3VR6 A;  3K5N A;  3HEJ A;  2JSO A;  2BDN A;  2EE1 A;  1IL8 A;  2AUJ D;  1TY0 A;  2RDG A;  2RBM A;  1WTW A;  1CA5 A;  1CFM A;  1G2T A;  4L63 B;  2PW5 A;  3SK5 A;  4K8I A;  4OL7 A;  1R9T B;  4ZRZ A;  2A69 D;  2WAC A;  1TS4 A;  2KJX A;  3TP5 A;  1SNP A;  2RKS A;  2F0I A;  4A3G B;  5M3M B;  4FXK C;  1MI2 A;  1SSO A;  1BR9 A;  3HP3 A;  2JEB I;  3HG9 A;  3T56 B;  4OO1 H;  5JEA G;  2QIL A;  5DM7 3;  2EY1 A;  4DGZ A;  4ZKB B;  1VMC A;  1ESR A;  1TY2 A;  2BOS A;  3VR2 A;  1A2T A;  3S17 B;  3NSW A;  3A55 A;  1F9Q A;  1I4X A;  1SYF A;  4M1U B;  4DF7 A;  4QIW B;  1YNN C;  4TKO B;  5DNF A;  3H09 A;  1JC7 A;  3MAQ A;  3WOF A;  4DNR B;  1OXV A;  1IKM A;  3PIP 3;  3GV3 A;  2K5Q A;  2DY8 A;  3CU7 A;  5COR A;  2ICE C;  3AMU A;  2RDH A;  1PZJ D;  3I4M B;  4BS9 A;  2Z4I A;  4DXG A;  3BDC A;  1NSN S;  1SE4 A;  4K2L A;  1VCI A;  5LL6 X;  1K8M A;  1SNM A;  1BCP F;  3I70 A;  3A8K E;  1HQR D;  1SJH D;  5CBA E;  4R8I A;  1Y8P B;  4IFD G;  2EY5 A;  2ID0 A;  4DU9 A;  3JAM L;  2FHT A;  1LTI D;  4TRD A;  5JEA H;  4C1N K;  1V1P A;  2K6A A;  2F1M A;  2F0O A;  4RA8 A;  4XYQ A;  5EJW A;  2L1B A;  3L3O C;  3MXU A;  1EY7 A;  4QUC A;  2NWG A;  3NWT A;  5E3F A;  4BBR B;  1BNZ A;  2LKV A;  3DUZ A;  1PTO H;  5EKK A;  1PYW D;  1I4P A;  1VF5 C;  2JA7 B;  2F0M A;  2I07 B;  1Y1V B;  1I50 B;  4WJW A;  1JOQ A;  1EY8 A;  5JVH 3;  3BVM A;  3K57 A;  4KKS A;  2KVM A;  2EY2 A;  5NUC A;  1NCV A;  2KQ3 A;  3E6Z X;  4UAI A;  5DEH A;  4KHV A;  4BA2 I;  2WII B;  3SXH A;  3K59 A;  4A3I B;  5EPJ A;  4ZLT F;  1X32 A;  3S2H B;  2MP1 A;  4IQZ A;  4IFD H;  5I2Y A;  5ELB A;  1F2Y A;  2E74 C;  5IOD A;  2NYZ D;  1IW7 C;  3HOZ B;  3GTK B;  1CM9 A;  3SK8 A;  2F0T A;  3LNN A;  4CKE A;  1PFM A;  3M4O B;  3J7Y W;  2ZXP A;  1E2V A;  3DXJ C;  2F0L A;  1QNK A;  1V1P B;  3NWS A;  3NTI A;  5ISR A;  4FNF A;  3ONA B;  3H94 A;  1L0Y B;  4C3J B;  1RF2 D;  2XRS D;  3RLF A;  1Q1E A;  1FNW A;  4NP5 A;  3I91 A;  3PIO 3;  3D6W A;  5CV8 A;  4HSP A;  2C5C A;  2F0P A;  3BYY B;  1D5Z C;  4KN7 C;  2NTT A;  1F2M A;  1GUW A;  2C9O A;  5AFW A;  5LHY 1;  1EFI D;  4AYB B;  4L8J A;  2JA6 B;  3KBX A;  4C3H B;  4RKL A;  5D65 A;  1H9R A;  2NB0 A;  1O7Y A;  5IOC A;  1JOO A;  2PPB C;  1BCP C;  1MSH A;  2PZU A;  1O7L A;  3Q23 A;  3J81 L;  4OIJ A;  2PYK A;  2Z8L A;  3R3O A;  2QEJ C;  4EGV A;  3J80 L;  3H6M A;  4FP5 D;  1KLG D;  1TWG B;  3EQL C;  1S5C D;  3HS0 C;  5C3W A;  3D6C A;  1BF4 A;  2O4X A;  1U4L A;  1SMY C;  1B9M A;  3TME A;  3OSO A;  4IUQ A;  4U67 3;  2L0C A;  3GTL B;  4A3F B;  5EPL A;  1OXU A;  1PFB A;  4N9T A;  5I6W A;  1EU4 A;  1LTS D;  2J4X A;  2L9H A;  1DCZ A;  3TBI B;  1PZK D;  1LTT D;  1AZP A;  2K28 A;  3RZD B;  1TWF B;  3D8G A;  3MFY A;  5FKA C;  4KTA A;  2A69 C;  3HKZ B;  2XVS A;  3VYR A;  3K6O A;  3N52 A;  5KYI A;  1W6J A;  2NN6 G;  1F77 A;  3LX0 A;  1WTP A;  4Q0F A;  3C3L A;  2FIN B;  3D31 A;  2B2V C;  1QB5 D;  4HCE A;  2IWH A;  2GA4 B;  2KCN A;  3FVQ A;  3Q22 A;  4FYD A;  4L6T B;  3NUC A;  5BN5 A;  1ET9 A;  5K36 G;  1H9J A;  4C3I B;  2PO4 A;  2O5J C;  3S9W A;  3KUP A;  3SK6 A;  4PNY A;  4MHE A;  2B2W A;  3OIQ A;  4KMU C;  4EQO A;  4O42 A;  2L5T A;  2BE5 D;  5EKL A;  2AQ1 B;  5DM6 3;  1ENA A;  1TU2 B;  5E4X A;  5I9P A;  1F9S A;  2WP8 J;  4YIJ A;  3S2D B;  4K8J A;  5KNB A;  5C4H A;  3F2U A;  1D2B A;  1Y1W B;  1GUN A;  2EJG C;  3I90 A;  4A3D B;  2K33 A;  4U68 A;  3TZU A;  1LT6 D;  1TS5 A;  1NUC A;  1HCZ A;  2EYJ A;  2B2U A;  3R8B A;  3VR4 A;  5IT9 L;  1AZQ A;  4OHJ A;  3OW7 A;  3ERO A;  3D3R A;  4OIK A;  4LK1 C;  1WD1 A;  4FO2 A;  3G7L A;  1LT3 D;  1PTO C;  2IJ0 A;  2ENB A;  3SK4 A;  1C8C A;  5K36 H;  3S14 B;  3KLS X;  1WCM B;  1EYC A;  1JWS D;  2A6E C;  4QUF A;  4FXD A;  2F0J A;  4XQN A;  1SYE A;  1D6E C;  2EYH A;  3S16 B;  1V8Q A;  1GOZ A;  2FJ2 A;  4LAA A;  4ME5 A;  2OF1 A;  1PRT B;  5KGU A;  1KTK A;  3A8I E;  3P75 A;  1M8A A;  1BUV T;  2Q8I B;  3E0J A;  1T5X D;  3M7G A;  4PQX A;  5I6Y A;  4QB4 A;  4CBV A;  3E5S A;  1G8Z D;  4PV1 C;  3SHL A;  4A3B B;  5EBC A;  2RSO A;  1EY4 A;  2K5W A;  2IX1 A;  1CK1 A;  5JPN C;  2KUM A;  3EJI A;  4GZY C;  2XWB B;  3FRP B;  3T4A C;  4V19 0;  4B9X A;  1VDZ A;  3HOU B;  1TWA B;  4ID6 A;  1EEI D;  1STH A;  5ELD A;  2G9H D;  1A15 A;  4OO1 G;  3SE0 A;  3ITP A;  3PO3 B;  4P2C B;  4C2M B;  3SR1 A;  4RFB A;  2NTS A;  3PUZ A;  1A2U A;  3VR5 A;  5JAV A;  3MEH A;  1C48 A;  4CJ1 B;  5IGE A;  4BA1 I;  3PV0 A;  4X3U A;  1TII D;  1SEB D;  1SNC A;  2OXP A;  2R61 A;  2NVT B;  3MXP A;  3OMC A;  4HAE A;  4IUU A;  1EL0 A;  1ZEQ X;  5CC4 A;  3GTM B;  1U4P A;  1FGB D;  1B1Z A;  2F0D A;  3GTQ B;  2IL8 A;  1MBY A;  4XQJ A;  3PUX A;  2Z4H A;  4DK0 A;  2B2Y C;  3H3V C;  4K6L A;  4KD3 A;  1E2Z A;  2B2T A;  2HQE A;  2OT2 A;  4F7X A;  1G2S A;  2E75 C;  3BYT B;  3M4Y A;  5C4Z A;  3ND9 A;  1EQT A;  1ILP A;  1SE2 A;  1Q8I A;  5ELC A;  1TKW B;  3MTS A;  1AW7 A;  1HFG A;  4HMJ A;  4WRD A;  3S1N B;  5HGT A;  2A74 C;  3K5O A;  4M8A A;  3VR3 A;  4ZUJ A;  1LV9 A;  2XWJ B;  2XIW A;  5JJZ A;  4V0B A;  2KEE A;  2PCF B;  4RGO S;  1VF7 A;  4I65 A;  4ZQ3 A;  5BN4 A;  1KNE A;  4QF4 A;  1OXS C;  5JOB A;  4KK7 A;  1IYV A;  3LWU A;  1I3Q B;  3IL8 A;  4J6H A;  2B8G A;  1PXU A;  1LT5 D;  3S1M B;  1ML0 D;  4FXG C;  3IFD A;  3U9S A;  1EIG A;  5FO9 B;  2LY7 A;  5FO7 B;  2F0G A;  3GP7 A;  3M7N A;  4G7H C;  3QJY A;  5CBE E;  2EJM A;  1RCV D;  5C0X J;  2IX0 A;  4IAL A;  2PZT A;  1FNU A;  4RGN A;  4K5W A;  4BBS B;  2VUM B;  1I4Q A;  3K0Y A;  2CW0 D;  4X3T A;  2AUK A;  3V05 A;  4NDX A;  1DXM A;  1PTO D;  2E2D C;  3AU7 A;  3MC0 B;  1E2W A;  1PFN A;  4KV6 A;  4A93 B;  2F0F A;  3DM1 A;  1GHK A;  5A2Q L;  2BE5 C;  1CQF A;  3FEW X;  4CGY B;  2PZW A;  3IFT A;  1CHQ D;  2A6E D;  3A7A B;  4HR7 B;  2JXM B;  3K5L A;  5KEE A;  1HA6 A;  2KA7 A;  3VYU A;  2KED A;  2K7V A;  4RGM A;  1OO9 B;  1QOH A;  1PZI D;  3BDO A;  4IUN A;  5I9O A;  3CQZ B;  5FO8 B;  4HTH A;  3GD7 A;  3FDT A;  2DNC A;  3MFG A;  1TS3 A;  1HHV A;  4TSS A;  1DJR D;  1Y8N B;  2LFN A;  2HDM A;  2KHS A;  2L4N A;  4F8M A;  4IUT A;  4ZAI A;  2IX3 A;  3CKI B;  4HED A;  4CJ0 B;  1OXX K;  1VMP A;  3GTJ B;  2CHB D;  1LTG D;  3HOY B;  2R92 B;  1QJO A;  1XXG A;  2DNE A;  3A56 A;  1DOK A;  3W3A A;  2L12 A;  2M00 A;  4EQP A;  1WTV A;  2EPB A;  3PUY A;  4FF3 A;  3OWE B;  1B4O A;  3H0G B;  4XXE A;  3Q6S A;  1STB A;  3NTH A;  4F87 A;  1AFP A;  2A6H D;  5D14 A;  4LJZ C;  1PDQ A;  1I4H A;  4MIU A;  2YU9 B;  1G91 A;  1TWC B;  1I6V C;  2N88 A;  1A3T A;  2L11 A;  4NKL A;  1WD0 A;  1F9R A;  1KDC A;  4ABN A;  4FF2 A;  1KAB A;  1S5F D;  1AEX A;  3NTK A;  1FR3 A;  1PTO F;  1JWU D;  1SDF A;  1LTA D;  2QCP X;  1KLU D;  5J1Z A;  4CKC A;  4Q5V A;  2RDF A;  1DM0 B;  4S3S A;  3QWN A;  5M9O A;  2QF7 A;  1Z7T A;  1ILQ A;  1CI3 M;  2TSS A;  4RCN A;  2N55 A;  4CKB A;  2ZXO A;  3QIA A;  5JVG 3;  3ERQ A;  2K01 A;  5I4D A;  5C4X B;  5C3E B;  4DA2 A;  3R2I A;  5CGK A;  3Q24 A;  2M9V A;  1F9P A;  3TP6 A;  4XQQ A;  1RKN A;  3FKI B;  1HFN A;  1Y8O B;  2XNA C;  4KKU A;  2EJF C;  1SNQ A;  3HOW B;  3OOC A;  2TMP A;  5KRU A;  1LAB A;  2PMZ B;  4QCL A;  1A3U A;  1ZKO A;  1GJX A;  2DN8 A;  4RWS C;  3MHB A;  2I46 A;  4C3J G;  1EQV A;  2R6G A;  2VXW A;  2JEA I;  1I4G A;  1Z6H A;  4A3M B;  3HRZ C;  4DFA A;  2O2L D;  4BY1 B;  1STA A;  1AN8 A;  1SYB A;  3T16 A;  1OXT A;  2F0S A;  2D9U A;  4ULL A;  1HXY D;  1LO5 D;  1TQO A;  2F0H A;  5JEA J;  4C3H G;  3S15 B;  2X6G A;  4XIG S;  2EZV A;  2HDL A;  1AP0 A;  2V4D A;  3NK9 A;  1ZYR C;  1BCP B;  1EOT A;  2IT1 A;  1KAA A;  3CHB D;  5DAU A;  3MWY W;  5M5X B;  2VB3 X;  2EXZ A;  1J9O A;  3C1F A;  1ONL A;  1BDO A;  4HN7 A;  2XSC A;  1PRT C;  4DK1 A;  1HRJ A;  2F03 A;  3ND8 A;  3NBI A;  1TR5 A;  2HUG A;  3VA7 A;  3M85 A;  3VA5 A;  1M4V A;  1EY6 A;  3I3C A;  4G4K A;  3SEB A;  1HTL D;  3OHX C;  4DAV A;  2R7Z B;  4KY6 A;  5E4W C;  1WTR A;  3IAY A;  3C46 A;  1QWY A;  1A3V A;  2MUY A;  3O13 A;  2RVL A;  2AQ2 B;  4RAU C;  1CZW A;  2KEC A;  4IFD J;  1RDP D;  3P7J A;  5M5W B;  4NW2 A;  2B2U C;  2BDO A;  2EYF A;  4FVM A;  3DWP A;  2CW0 C;  2E2J B;  4DAY A;  1ENF A;  5IGF A;  3JAM E;  3TZD A;  3RZO B;  1BQQ T;  3K58 A;  3PO2 B;  2EY6 A;  4ODG A;  3EFX D;  1B50 A;  4PMC A;  1E0B A;  2X6L A;  3KK7 A;  4EQN A;  4WFN 3;  3NQT A;  5C44 B;  2FMC A;  4N9P A;  1LTB D;  2MJ8 A;  3S1R B;  3V96 A;  1Q90 A;  5K5P A;  2BCO A;  2D62 A;  3NHH A;  4XDX A;  5A2Q E;  1R4P B;  4MN3 A;  5CMD A;  3A7L A;  3MXG A;  1L0X B;  3I73 A;  4C3I G;  2WIN B;  3I4L A;  1JE4 A;  4C1N I;  1EWH A;  5J39 A;  1I6H B;  1EYD A;  3K7A B;  3RMH A;  4RH6 A;  2F0V A;  1RHP A;  3I4N B;  4LMQ D;  3FPP A;  2KOL A;  1DOL A;  3BDL A;  3RD4 A;  2X69 A;  1UAP A;  4DAP A;  2EYP A;  4IZ8 A;  1EEF D;  1NR2 A;  2B8F A;  4IUR A;  1PMR A;  2RSN A;  1XTC D;  1QIL A;  5CV4 A;  1K8O A;  3D4R A;  3W2D A;  3X3M A;  3K5M A;  4ZKC B;  5FK9 C;  2O5I C;  3FPU B;  1CQV A;  3HGB A;  2ICI A;  1X3P A;  4H44 C;  1Q12 A;  2D5D A;  2F0U A;  3AB9 A;  1XWE A;  2K32 A;  2WKD A;  1STG A;  3J7A F;  3L7Z C;  1WTX A;  2A6H C;  1QE6 A;  2EYL A;  2K5D A;  2EYM A;  2WAQ B;  1EIH A;  1STN A;  1U4M A;  4JBW A;  1F2L A;  2FFK B;  3NP8 A;  5KND A;  1B44 D;  3IKJ A;  1YNJ D;  2A73 B;  5C4J B;  4IUP A;  1Q3L A;  1A6X A;  4KJO A;  1PLF A;  4DXF A;  4K6D A;  3DWA A;  3SDZ A;  1D5M C;  4B9W A;  2NZ1 D;  2B2Y A;  1JIC A;  2B2T C;  1GUG A;  3NE5 B;  1SFO B;  1TWH B;  1FD7 D;  1HQM C;  4KY7 A;  4RGT A;  2WB1 B;  1S5B D;  4EVO A;  4PMW A;  1R4Q B;  3DEP A;  3C1E A;  3GQB A;  1G29 1;  5IGG A;  3WOE A;  3J81 E;  3GTO B;  1D1I A;  2HCC A;  4IUV A;  1WVL A;  3J80 E;  2NVQ B;  4RHS A;  3A54 A;  3DHQ A;  3WDN A;  2XN9 C;  4XT1 B;  1ZYR D;  2E76 C;  2BA1 A;  3DMU A;  3T51 B;  3I8Z A;  1QG7 A;  1CHP D;  4G7O C;  5FLX L;  4X3S A;  1GUO A;  4J1M A;  1RTO A;  4HCS A;  3NPP A;  2LS0 1;  1PRT D;  2EVB A;  4H0L C;  4K5V A;  3V2T A;  1CT1 D;  1S5D D;  2BA0 A;  1NR4 A;  1JWM D;  4IFD I;  4XYO A;  1I4R A;  5JPM C;  1DZ1 A;  1SBB B;  1B2T A;  1WTQ A;  1B9N A;  3OIP A;  1SND A;  2JP1 A;  1BBX C;  1EZ8 A;  3FMC A;  5COY A;  2KCC A;  1F2Z A;  5M3F B;  2NVX B;  1JB3 A;  3UI2 A;  4BWG B;  1CTM A;  1ROD A;  4QMG A;  1SXT A;  2ZT9 C;  2SNS A;  1S5E D;  1JCK B;  1V43 A;  5C6A A;  2B39 A;  2Q8R E;  3L9A X;  1EWC A;  4K2K A;  3TDQ A;  4Y7N B;  2D2C C;  4FF4 A;  1HUN A;  4OGQ C;  4H13 C;  2SDF A;  2JA5 B;  3OWF A;  2WV6 D;  3PUV A;  1X3Q A;  2Y0S B;  2J7Z A;  5M5Y B;  2OEO A;  3DEO A;  3I72 A;  5D3I B;  2R3Z A;  1WTO A;  4CJ2 C;  2E2I B;  2G9D A;  1H9S A;  1SYD A;  3KBG A;  1TVX A;  3J7A V;  4TQU S;  2XRQ D;  4G7Z C;  4ZUI A;  5IT9 E;  3OMG A;  3MXN A;  1IYU A;  1G6Z A;  1BXT A;  2Z1C A;  4HMI A;  2IW3 A;  5EKI A;  1HPC A;  3TP7 A;  5ELF A;  4PMB A;  1T5E A;  3TN2 A;  2WKC A;  1PRT F;  1CZG A;  2PQE A;  4K14 A;  3T53 B;  3SVM A;  4KKT A;  1MGS A;  1JOR A;  1K83 B;  1O80 A;  4RKB A;  2JE6 I;  3Q0A A;  1KDA A;  1SYG A;  2AWO A;  5TSS A;  5C3X A;  3URY A;  4K5X A;  1IKL A;  2Q8T A;  4E6I A;  5F2D A;  2NUC A;  1LT4 D;  2A68 C;  3P20 A;  2JYO A;  2PNR C;  1SYC A;  4F88 A;  4KHZ A;  1ICW A;  5CR3 A;  4NMZ A;  5J22 A;  2B63 B;  2E2H B;  1H9S B;  1JOK A;  5G3L D;  3EVQ A;  2DY7 A;  2F4I A;  4RHR A;  1O7Z A;  1GUS A;  4KD4 A;  3PUW A;  1D5X C;  1EU3 A;  3NXW A;  5KYL A;  2YYZ A;  2AWN A;  4RCO A;  3A8J E;  3G6J B;  3S1Q B;  1O78 A;  1EY0 A;  3D4D A;  3RUZ A;  4A3J B;  3ZYY X;  1XX8 A;  3VYS A;  4A3E B;  1SJE D;  3QO2 A;  4CHT B;  1LAC A;  1QCB D;  1B53 A;  1KDB A;  1DYQ A;  4C56 C;  5IGB A;  3PMF A;  3R2T A;  2NBF A;  1EY5 A;  1RJT A;  3QB3 A;  4KJN A;  3BS1 A;  2VB2 X;  1DON A;  1V1O A;  3HZX A;  4B08 A;  2EOT A;  1UUP A;  3BVZ A;  2LMC B;  1YNJ C;  2L55 A;  3T13 A;  3QG1 A;  1CA6 A;  2CVR A;  1EYA A;  1YNN D;  2PW7 A;  4X3K A;  5C0X I;  2VNU D;  4Z9C B;  2NN6 I;  2QKI C;  4ZK9 B;  3VYT A;  1W6K A;  1GUT A;  5EGT A;  3HOX B;  1II3 A;  2JA8 B;  5LL6 S;  1TT2 A;  3OPO A;  4A3K B;  3LWE A;  3MVV A;  5IGC A;  4H7B A;  3KF8 A;  1HUM A;  3KLS A;  3GTG B;  1U9R A;  5EBD A;  1LTR D;  5E1F A;  2FMM A;  1H9M A;  5C0X G;  2MPM A;  2M2L A;  4IN3 A;  2B2V A;  4O1N A;  2R93 B;  3CRL C;  5IIF A;  3MA2 B;  5C5L A;  4KI0 A;  1J8I A;  1UEA B;  4XTC S;  2F0K A;  1EY9 A;  1BO0 A;  2B2W C;  4G57 A;  4HSV A;  1FNV A;  5CV9 A;  1LLR D;  5G3L F;  5FLX E;  2K05 A;  2A5H A;  3GO5 A;  1SAP A;  2K03 A;  1ENC A;  1DD2 A;  5D3D A;  1IHZ A;  1XYI A;  1ET6 A;  2H4O A;  2F3V A;  2H1E A;  1HA5 A;  4JK1 C;  1STY A;  1ESF A;  5C5M A;  1Q1B A;  2F0N A;  4WOR A;  5EQ0 A;  3GV6 A;  3R93 A;  1KNA A;  1EZ6 A;  5A35 A;  1NAP A;  5C0X H;  3TSS A;  3M3Y B;  3CRK C;  2NN6 H;  2ZXR A;  1JR0 D;  3MZ5 A;  3BZD B;  3X3N A;  1SE3 A;  4FF1 A;  5I2X A;  2F0Q A;  2MGS A;  3KLR A;  1GXD C;  4ZYS A;  1IW7 D;  5CYU A;  3BG3 A;  2IPK D;  4ILW A;  4XT3 B;  1U4R A;  1UNS A;  1C4Q A;  1DOM A;  1TS2 A;  3D4W A;  4R8N A;  2SOB A;  1Z47 A;  1S4Z A;  2K1B A;  1B3A A;  2QDB A;  2F0E A;  4J8Q A;  1Y69 U;  3QOL A;  1ZXT A;  2NVY B;  2A68 D;  2RQX A;  4KY5 A;  4BY7 B;  1GHJ A;  1MSG A;  1QNU A;  5EPK A;  2MHV A;  3H91 A;  5CV7 A;  2K04 A;  5KNC A;  1STE A;  5KIX A;  5T1I A;  2J0T D;  4OO1 I;  1RTN A;  1D1K A;  3U9O A;  1FYC A;  2CQA A;  3HOV B;  1JQY D;  3C2P A;  5CV6 A;  3EA6 A;  1HTP A;  1SNO A;  5ELE A;  1MD2 D;  3NBH A;  2SEB D;  2EYO A;  3DWQ A;  3TP8 A;  5HUR A;  5T1G A;  2F0W A;  3BVG A;  3N6R A;  4DN4 M;  3P1H A;  5IGD A;  4KN4 C;  4DNT B;  1BCP D;  1H9K A;  2AQ3 B;  1PTO B;  2HCI A;  5BN3 A;  1BOS A;  2EDG A;  4UDU C;  4I7Z C;  2F3W A;  3QOJ A;  5FOB B;  2SNM A;  5CV5 A;  1SMY D;  3NQI A;  2RA4 A;  4R9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...