1BQQT

Crystal structure of the mt1-mmp--timp-2 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
184
structure length
184
Chain Sequence
CSCSPVHPQQAFCNADIVIRAKAVNKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEYLIAGKAEGNGNMHITLCDFIVPWDTLSATQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords MEMBRANE-TYPE MATRIX METALLOPROTEINASE
publication title Crystal structure of the complex formed by the membrane type 1-matrix metalloproteinase with the tissue inhibitor of metalloproteinases-2, the soluble progelatinase A receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 1998-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bqqT02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 1bqqT01
5FO7B 1PXUA 3L3OC 5FO8B 5JPNC 1JB3A 2A73B 3CKIB 3G6JB 3MA2B 4FXGC 1GXDC 3CU7A 2I07B 2TMPA 2E2DC 2QKIC 4FXKC 1BR9A 3FRPB 3V96A 5FO9B 2XWJB 2ICEC 2A74C 5FOBB 1JC7A 2B39A 2J0TD 2WIIB 3OHXC 1D2BA 3I70A 1UEAB 1BUVT 1BQQT 1OO9B 2XWBB 3HS0C 5JPMC 1XWEA 2WINB 4ILWA 3T4AC 3HRZC 1UAPA 3KLSA
chains in the Genus database with same CATH superfamily
4X3SA 1W2BA 1LM0A 1ENAA 3PO2G 4DF7A 1D1IA 2YU9B 1JWMD 1RIPA 1Z7TA 1WTQA 1Q12A 4LF4L 1XNQQ 3ONAB 3NSWA 1WTWA 2QF7A 1SNQA 1UUPA 2HQEA 4JYAL 1WVLA 4IZ8A 3DHQA 4NXNQ 1DOKA 3F2UA 4JOIC 5FLXE 4N8X1 3OMGA 3D4DA 2E75C 5GADC 1PH2A 3DM1A 1ESFA 3K81C 2BDNA 3JAML 4ID6A 3RZOB 2KCCA 1TWFB 4C3JH 4IPHA 3S15B 1IL8A 3IKJA 3CP0A 4UHVA 2IW3A 3ICEA 2NTSA 1ZKOA 4DN4M 4DV2Q 3AEVA 3K0XA 4UP7A 5EPKA 1K8MA 4J8QA 5CV4A 4KN7C 1I3QH 3WOEA 1JOKA 2PZWA 1SRUA 3DXJC 3RR5A 3H0GG 5CC4A 1VDZA 3QB3A 3FVQA 1VQBA 1K9MC 2Q2TA 1N32L 5K36G 2MFIA 2B2VC 4ULLA 1VQ7A 1K8AC 3GTQB 4V190 4DV0Q 2M9VA 2MNAA 2K5WA 3K80C 4PNYA 3OWFA 2I0QA 1IZ6A 4NP5A 1HNXL 3RZDH 1ZYRC 2EE1A 1CSQA 4FP5D 5AFWA 2IPKD 3F2CA 4JOIA 1G2SA 3V96A 1B3QA 2CQAA 4X3KA 1BCPC 2K5HA 5IYDG 4JI6Q 2EXZA 1P8LA 1Q3LA 2NN6G 3D3RA 1K73C 3PF4A 1EIFA 2A68D 3VDYA 2B63B 2FFKB 3DUZA 2QGQA 4X66L 1HA5A 3A74A 1F9RA 3NUCA 4Y7NH 2RHQB 3VYTA 1XPOA 2K14A 5IP7H 1RD9D 1A15A 3PO2H 4A4IA 1SAPA 4GKJQ 1VQHA 2B2VA 1YBYA 3KYHC 3Q22A 2OCEA 4A3GB 4L5TA 2WAQG 3I70A 1SNPA 1SJHD 3ULPA 2HUGA 1JWUD 3VR3A 2KUMA 1V8QA 1TS2A 1FL0A 4B3ML 2DY8A 3DWQA 2JSOA 3E9HA 3HOZB 1E2VA 1SYEA 2NN6I 3OOCA 4ZK9B 4Q5VA 1I5FA 3K0YA 2F0NA 5KEEA 3OW7A 1ET9A 1E2WA 3P75A 3KJOA 2OTLA 5JJIA 3MFGA 4BXXG 4FYDA 2RF4A 3TS0A 1XNQL 3J81E 3CAMA 5ELFA 4EX5A 1Q86C 4DAYB 3QO2A 4A3BB 5C4HA 1V1PA 2CW0C 1MGSA 3BVMA 2F0WA 1CKNB 2L9HA 4R8NA 1M4VA 1OXUA 4NXNL 3P1HA 3R2TA 3KF6B 3H0GH 5FLXc 4OO1I 2VL6A 2JE6I 4R4OA 1B9NA 1ET6A 3OTOQ 4K8IA 2PMZB 5K36H 2WAQE 3M7GA 3W5OA 3DMUA 1WTOA 3I55A 2R7ZB 4DV2L 1G6ZA 3VR2A 1EIGA 3PO3G 1AN8A 2F0MA 5NUCA 4OWXB 4DV1Q 1CM9A 2F0JA 1IW7D 4JW0A 3MXNB 3D6WA 3PUXA 2EDGA 1SMXA 2BDOA 1XWEA 1G291 5DM63 4OELB 1BOSA 5IYDH 2G9DA 2NN6H 3GTOH 1B7YB 2F0TA 4CGYB 5KNDA 1XNRL 4U673 2DJFC 2F1MA 4K2LA 4S3SA 4G4KA 1AFPA 3EVQA 3KF8A 1GHKA 1QNUA 3HGBA 4BA1I 1KDCA 2XRQD 1LT4D 1CA6A 2ATWA 3A7AB 4IFDI 1YNNC 1A3TA 3MWYW 1DJRD 1G2TA 2F4IA 5C4JH 1I50H 3GV3A 5ELEA 4EGVA 5IT9E 5FOBB 1HR0Q 3BVZA 4IO9A 4X64Q 4AYBB 5CR3A 2AQ3B 1NCVA 4OIJA 4XYOA 5KIXA 4GKJL 1VQOA 5JPMC 1KABA 2PNHA 5M5YH 4DXGA 5KNBA 4BXXH 3J80i 4DUZQ 3PIPA 4QQBX 1HTLD 3IL8A 4A3IB 3WWVA 2JA7B 3Q0AA 2DNCA 3UE0A 2RCNA 4F88A 4KI0A 1NTGA 4DV7Q 1S5FD 4JI5L 1A0IA 2KBNA 1DD2A 2R93B 3PIP3 1Z9FA 4A3MB 1FNVA 4EQPA 5JEAG 3SR1A 4B3RQ 5IGGA 3GP7A 3SGIA 3PO3H 2E2JH 2B63G 3M7NA 3TRZA 2EXDA 5IE8A 3J81c 5E4WC 1RF2D 3EJIA 1STAA 4A76A 1BCPD 1QOHA 4J1MA 1Q90A 1JE4A 5FK9C 3RUZA 1W3SA 3E0JA 3OTOL 1AH9A 2ICIA 1DOMA 2YU9H 2K75A 4LF7Q 4AQYQ 4A3GG 1JCKB 3GTJB 4IURA 3N52A 4DV1L 2PZTA 4N8FA 1QJOA 4DK6C 2A69C 1D5MC 3I72A 2BH8A 2SDFA 1K8OA 2WP8J 2OF1A 1JR0D 2MUYA 2SNSA 3HEJA 5EGTA 2JA8B 2AQ1B 1VQCA 3RZOH 1DM0B 1NMGA 1TWFH 3S15H 4RAUC 1HCZA 3G4SA 3HOYB 3R3OA 1G91A 2UUCQ 1PFBA 1HQMC 3LNNA 3A7LA 4X3TA 3STBC 5EKIA 3W1GA 1SMYC 4A3BG 4IPCA 5EJWA 3CCUA 1LTID 1X3FA 3R93A 3MAQA 3BYTB 2DN8A 4E6IA 4OWWB 4GZYC 4POFA 4WJWA 1U4PA 4FF3A 2R7ZG 5E4XA 1HZCA 2CW0D 3D0FA 3BVGA 3QOLA 3CXCA 2ZJPA 2M00A 4CJ1B 3WDNA 1EYAA 3L7ZC 1EQVA 4B3TL 4A3FB 5KYIA 2FINB 5IT9c 4JPBW 1HR0L 4NMZA 2B8GA 4X64L 5JEAH 2Z8LA 4I7ZC 5JVG3 2F03A 1QVGA 4JCVE 3URYA 2B63H 1VCIA 1F9SA 4LF5L 4IJHA 2HIVA 3JAME 1SLJA 3EN2A 2LXKA 4QF4A 3D4RA 3CD6A 4DV7L 4WRDA 2PQAB 2F0UA 1SE3A 1Y1WG 3ER0A 1Y69U 1PYBA 1CZWA 1KDAA 1IBLQ 2H4OA 2PMZE 3K5MA 2D9UA 4ILWA 1I4QA 4B3RL 3I90A 4F8MA 4A3GH 2BH2A 3MXPA 3LWEA 5G3LD 4DR1Q 1QNKA 1X3GA 4FXKC 4HMIA 2RVLA 2CH4A 2NVTB 3J7ZC 4KHVA 1ILQA 4GN5A 4HIKA 2K4KA 2MHVA 2A74C 3HKZE 3EA6A 1PRTB 4AYBG 1MHWC 2CHBD 3OSOA 4P75A 3HKSA 3GTPB 1KRTA 3I2ZA 4DNRB 2NVXH 2Q2IA 5C4XB 4LF7L 1B8AA 2XN9C 1YNND 4AQYL 1X54A 5EPJA 5M5WB 1YJ9A 4A3IG 3IFTA 3ULJA 4P74A 3GTGB 4XQNA 4A3BH 2QEJC 4FF2A 3NWTA 1H9RA 1UE1A 2IL8A 3TP7A 3CRKC 4XQQA 2F0SA 5IODA 2EIFA 1PFNA 4HR7B 2R93G 5DEHA 4A3MG 1L0YB 2C5CA 1ILPA 1O78A 2Z6KA 5CV5A 2UUCL 2R7ZH 2KHSA 3DLLA 4HJ9A 1FJGQ 1R4QB 2N88A 1CQFA 2F4VQ 1BBUA 3FHWA 5FJ8G 2OQ0A 1PRTF 3CQZB 3MXUA 2DNEA 3K8AA 1SNOA 5LMNQ 4FF1A 3KDFB 3O13A 3A8JE 3U4ZA 4AYBE 1XPRA 2E5LQ 1FR3A 1EU4A 3H09A 4DV5Q 4OONA 1IBMQ 5KNCA 4R4IA 2Q2UA 1JC7A 1KQSA 2VNUD 1PRTC 1J5EQ 1OXVA 2R6GA 3AQQA 4K8JA 2SOBA 1HPCA 1CQVA 3A5ZB 1Y1WH 1PH3A 1H9KA 2NUCA 1OXSC 1GVPA 4TRDA 1PTOB 5IY0A 2JA8G 3SXHA 2ZT9C 3T1YQ 1K3BC 2DGYA 2ZXOA 1L0XB 4IN3A 2I5LX 3HOYG 3J81j 3PIO3 4TSSA 1I4HA 4PG3A 2A69D 4G7OC 5M3MB 1VMCA 2ES2A 1A2UA 1VQFA 3C1FA 4R4TA 1YJNA 1D7QA 5EKLA 3JAMc 4AIMA 4GNXB 2F0QA 2MP1A 4C2MB 4BS9A 5JAVA 4G57A 3KLRA 1IBLL 1LTTD 1QILA 1C9OA 4POGA 3RD4A 4WJ3M 3L2PA 1FVIA 3STBD 1I6HB 1SMYD 1LUZA 1LTLA 4JYAQ 4DR1L 1LT6D 1J9OA 3E5SA 4LF9Q 1WYDA 4A3IH 4HJ7A 5EQ0A 1PTOF 1VQPA 4A3FG 2VS1A 3U58A 3DM3A 4LF6Q 4JI2L 1CT1D 1H9SB 2G5DA 2R93H 4A3MH 1GOZA 4R4CA 1PYSB 4RWSC 1S5CD 3A8IE 1I4XA 2F0EA 3PF5A 1ICWA 1KXLA 5EBDA 3HOUB 2EJFC 1EQTA 2LXJA 1YJWA 1S72A 1NR2A 1LACA 3BZKA 2EYPA 2OQKA 4P2CB 5FJ8H 2WFWA 1EEID 5LMUQ 1E22A 1EY9A 2EY2A 2OT2A 3SEBA 4PZ8A 2B39A 1T9HA 3KJPA 1KTKA 4DR7Q 2NBFA 3U4VA 5C3WA 4YCVA 4J15A 3BDCA 3H15A 5J22A 4G7HC 1UE6A 5CV6A 1FJGL 2RDFA 2XVSA 4O0AA 5CORA 1LTAD 2R7FA 4DNTB 1KNEA 1E1TA 3D8GA 1YHQA 5LMNL 4WORA 2HIXA 1TKWB 1F2YA 1PLFA 2JA8H 1EZ8A 2EOTA 1WI5A 4DV5L 1CKMA 1BQQT 1W6JA 2WB1E 1IBML 3HOYH 1HNWQ 5C4XG 1Y8NB 4PMWA 1B44D 1J5EL 3KLSA 1NJIC 1IW7C 1Q7YC 1V43A 3MA2B 3TZDA 1PFSA 1F77A 1IKMA 3FDTA 1NMFA 2RDHA 1PH7A 2Z1CA 3D31A 4ZAIA 1BNZA 3T1YL 4EQNA 4X3UA 3I4LA 1TS5A 3PCOB 1NBWA 1QUQB 1VQMA 4RFBA 2NZ1D 2UUBQ 2KOLA 1UE7A 5IIFA 2KEDA 2NZHA 3FP9A 4L8JA 3F1ZA 1LT5D 4WJ4A 1MJCA 2B2TA 1PXUA 1SYGA 4DU9A 2AUJD 2AUKA 4A3FH 4JI1Q 1NAPA 3EIVA 1TR5A 2E8GA 5C0XG 1TWCH 3E6ZX 5FO9B 3M3YH 3UI2A 3G6EA 4P72A 3HP3A 4HJ8A 4GOPC 4KY7A 4LF9L 1RTOA 2CKZB 1Q8KA 4V0BA 3K57A 3A0JA 2L15A 1BF4A 4LF6L 1OXTA 1N36L 4DUYQ 4DAVA 1MSHA 2C9OA 2NTTA 2Z0SA 2GN5A 4QL5A 1PRTD 3K5NA 3T1HQ 2IHFA 1JJGA 4P73A 2XNAC 1JJ2A 2D0OA 5M3MG 5H1SE 1M90C 4X62Q 2J0TD 4Q0FA 5IGDA 5C0XI 5M3FB 2NVTH 5IYBG 5LMUL 4DFAA 3TEHB 2JYOA 3P7JA 5K5PA 1G6PA 1ENCA 1A3VA 2N49A 1XNRQ 4DR7L 1K3RA 1K8GA 3BYYB 3GTPH 3CU7A 5C4XH 4GOPA 2KCNA 2KEEA 3KFUA 4Z9CB 4HTHA 1F9QA 2CH4W 4K5WA 3GTGH 5AJ3L 1QVCA 1H95A 2UXCL 4XIGS 1KNAA 2MO1A 2HD3A 4MIUA 3CCMA 2X6GA 1HFNA 3DWAA 4L5QA 4CJ0B 1PZID 1SFOB 4CDEC 2FXQA 1ESRA 4LFCQ 1WFQA 1EWHA 1GUOA 4KD4A 1JB7A 4A3LG 1HNWL 5JJLA 3HOUG 2F0PA 2K6AA 1NE3A 1CHPD 5M5XB 1LTGD 4LW1A 1MBYA 2K5DA 3QIAA 2EYHA 4A3KB 1XJVA 2PPBC 2OXPA 2IX1A 1SR3A 3CQZH 1XMOQ 4DR3Q 4CBVA 3RLOA 3VR6A 4NXMQ 1V9PA 3OHXC 5D3IB 2B8FA 5C0XH 1DZ1A 4HSVA 5I6WA 2WKCA 1KIXA 1S5BD 1YZ6A 4P71A 1VS0A 5KGUA 2UUBL 1PH9A 1K0SA 3P20A 3L3OC 4RGTA 3VA5A 3R2IA 4JI5Q 4HN7A 1U4MA 2IY5B 3D6CA 2H1EA 1GHJA 4JI1L 4EVOA 2Z4HA 2R92B 2F0IA 3HOWB 1PTOH 1EIHA 2QILA 2RSOA 2FHTA 1SDFA 2CFMA 1SYBA 2KECA 4J6HA 5F2DA 3SK4A 3HRZC 5M3MH 4QIWB 4HJAA 4K0KQ 2PQEA 3TSSA 4PMCA 3CKIB 1BXTA 1U4RA 1GXDC 4CKEA 4JI7Q 3I73A 2MO0A 5T1IA 4QUCA 2PCFB 5IYBH 3ULLA 4ODGA 2RKSA 4C2MH 4IUPA 4LFBQ 4DUYL 5EKKA 3S16B 2PW7A 3LX0A 2BE5C 1AZPA 1T5EA 4KV6A 1BBWA 3T1HL 1WTXA 5DNFA 1JWSD 1I6HH 1O7LA 3K5OA 4X62L 2ZTCA 2F52A 4GKKQ 2KHIA 2CQOA 1AE2A 1E3PA 2D0PA 2H5XA 1QB5D 4KLKA 4A3LH 3M4OB 4IOAA 2EPBA 3HOUH 2NWGA 4KHZA 5E1FA 2R3ZA 1LYLA 3J80L 4MZ9A 5CYUA 1D6EC 4IUUA 2QEXA 1HUMA 3HZXA 1NUCA 3SHLA 4YWLA 1B2TA 1ZXTA 1CUKA 4CKBA 1E0BA 3HOXB 3SK5A 1EZ6A 1RDPD 1GUSA 2F0OA 4LFCL 2JJQA 2Z4IA 1DONA 2YTYA 4BY1B 2VQEQ 3CCSA 4CKCA 4B3TQ 1A6XA 4DV6Q 1C0AA 1YHBA 4RA8A 3NTIA 2VW9A 1JICA 1I4PA 1PV4A 4IUVA 1UEBA 1XMOL 4DR3L 4IFDJ 4NXML 2E2IH 3A5UA 3TN2A 4GLVB 1I6VC 2Y0SB 4LF5Q 3DEOA 4HIDA 4I65A 1EY0A 3SVMA 4DAYA 3QR8A 4EQ5A 5L37A 4PV1C 2J7ZA 1CKNA 2IWHA 1HR0W 3KF6A 4CJ2C 2VXWA 2EYJA 4C1NK 2ZJQA 5JJZA 3EQLC 5GQOA 2KCTA 1X6OA 1VQ8A 2VY3A 3G48A 4X6AH 3QWNA 4DXFA 3CCQA 5A2QL 5E7NA 4A3KG 2HCIA 3I4MB 4K0KL 4OIKA 3MXNA 2A6EC 1X3PA 3NBHA 1C8CA 5T1GA 4H02A 4JI7L 2YV5A 4K5XA 4LFBL 2PYKA 2UXBQ 2BOSA 1K28A 2R7DA 2MJ8A 3CMEA 1MKHA 1P16A 3TP8A 4KK7A 3ND9A 3S1QB 4KHPQ 1A3UA 3HOZG 2K05A 2XSCA 4FVMA 4JI0Q 3QOJA 4GKKL 3HOVB 1V1QA 1NNXA 1QE6A 3BS1A 1EY5A 3E9IA 2R92G 3HOWG 1LTBD 4APVA 2EQSA 1FGUA 5JEAJ 1AEXA 4A3EB 2O2LD 1SYDA 5ELCA 1JE5A 3X3MA 1C4QA 1EIYB 2WV6D 4KTAA 2A73B 2FJ2A 3NHHA 2JP1A 2K04A 5IP9G 3E3XA 4GN4B 3PGZA 3GTKB 1VF5C 2PZUA 4UAIA 3WOFA 3GTQH 1SE2A 1PFMA 3OMCA 3C3LA 4RGMA 1VQIA 3S2DB 4LF8Q 4BA2I 2VQEL 3F2BA 1E2ZA 5CBEE 3X3NA 4DV6L 4XXEA 3SDZA 1S4ZA 3W1BA 4RKLA 4ME5A 4HSPA 2DY7A 1L1OB 1UE5A 3S2HB 2L5TA 1S5ED 2BE5D 1Q81C 2I07B 4OWTB 2AWNA 3GV6A 1SFOH 1O7YA 1FD7D 2AMCB 1QVFA 4KKSA 1JT8A 1G8ZD 4QIWE 5M5XH 1SYFA 4A3KH 1Y14B 2HDMA 3FPPA 3KLWA 4R8IA 2OTJA 3HOXG 3Q24A 5C6AA 1RTNA 3ZYYX 4EQOA 1SE4A 2HT1A 1WTRA 3GTMB 4RCNA 4BY1G 5GAGC 5C44B 1R9TB 2ZM6Q 3HOZH 1VQKA 2O4XA 3F8TA 2VB3X 3D4WA 4JI2Q 4ZLTF 5IGBA 2C35B 2PW5A 4DNIA 1PA6A 1K83B 2O5IC 1YIJA 1JMCA 1A62A 2R92H 2EY5A 3HOWH 3SK6A 2BCOA 2SEBD 4LMQD 1L1OC 5I9OA 2UXBL 4BY7B 3I4NB 1HTPA 1VMPA 4H13C 2G9HD 2JA7G 2Y0SG 3OYYA 1XTDA 4OGQC 4YIJA 1K0RA 1GUTA 4KHPL 5ELNA 3PUYA 3MC0B 3FRPB 5JVH3 4A3CG 1PH5A 4JI0L 2EY1A 1PHJA 1EQQA 1EYDA 5IP9H 3VR5A 1JJCB 2F3VA 2RCFA 3RZDB 4BBSB 2KCMA 4DK3C 3S16H 2K03A 1FYCA 4DKAC 1TWHB 1MIUA 4OEMB 2K28A 2TMPA 4FDBA 4QGUA 3I4MG 4NDXA 3H3VH 3K7AB 4LUVA 4DPGA 1KD1C 1PH1A 2RQXA 3KUPA 4TVAB 4C3IB 1Y8OB 4HCEA 5J3BA 4Y7NB 1DYQA 3NP8A 1D2BA 1XYIA 2Y0SE 4IALA 1TS3A 4QJFA 3M4OH 4LF8L 3J7AF 3S14B 2A6ED 2DJGC 3AYHB 3GQBA 2ZJRA 4DV3Q 3Q23A 2E2HB 3CCLA 1STNA 1Q46A 3HOVG 2QKIC 2E74C 2PQAA 4R4QA 5C3EB 1SROA 2LKVA 3J81i 4H0LC 1VQGA 1EFWA 3CHBD 1KC8C 3HOXH 2GVBA 1S3OA 3V2TA 5I6YA 2N8NA 2Z9HA 4A93B 2YTVA 2X69A 1UEAB 2Z6BA 4RGOS 5KRUA 4A3EG 4BY1H 1EOVA 4KY6A 3HS0C 4JBMA 2NVQB 3CC7A 1Q82C 1SXTA 3CPWA 2Q8RE 5J1ZA 3I91A 4AH6A 2MQHA 3UDGA 1VQ6A 3FEWX 1PDQA 3HG9A 5FKAC 3GTLB 4NW2A 2JA7H 1IBKQ 1TWAB 2X6LA 1B4OA 2ZM6L 4CHTB 1U0LA 2NB0A 1XMQQ 3EBEA 4A3CH 3W3AA 1WD1A 1N36Q 4MN3A 4MTKA 1SBBB 3Q8DA 4FXDA 2JA5B 4UP9A 4IOCA 3BG3A 4L6TB 1PVOA 3J80E 1PTOC 3C1EA 1X32A 4PQXA 3U9SA 5LHY1 3T51B 1M1KC 3OPOA 5J39A 3GTOB 2UUAQ 4GS3A 2JQOA 3I4MH 3FKIB 2PI2E 3PV0A 3KOJA 1EY8A 4K6DA 4N9PA 3GD7A 4GNXC 1J8IA 1ASYA 1PYWD 1JOQA 2KQ3A 2NYZD 2HHHQ 3GTJH 1Q8IA 4HMJA 1L0WA 3PUWA 4RGNA 4QUFA 1GUGA 3A8KE 1LT3D 1EY7A 5C44G 5AJ3Q 3S1QH 2UXCQ 4RG1A 1TQOA 1VQDA 2OWOA 4B3SQ 5GAHC 1N33Q 4DK1A 3HOVH 4HJ5A 1RODA 4ZUJA 5IYCG 4ABNA 5HY6A 3F2DA 4UDUC 4BY7G 4YWKA 3I4NG 2F0KA 4CDDC 4ALPA 1LTRD 1Q1BA 2NVYB 3UE1A 4YY3Q 1RL2A 4A3EH 4A3DB 4MHEA 1SN8A 1Y8PB 1CA5A 1MSGA 5CV7A 1BR9A 3T56B 4DV3L 2XGTA 5M5YB 2F0HA 1NY4A 3M9BA 3TQYA 5HGQA 3J7YW 4BBRB 3M4YA 3NTKA 3GTKH 4BBSG 1CHQD 3NEMA 1QCBD 2PNRC 1PH4A 3K59A 2XTIA 3PSIA 3BDLA 1AW7A 2KHJA 3S2DH 3MHBA 4C3HB 5LL6X 3S17B 1ML0D 3IRBA 3A55A 2NZOA 1I94Q 3NTHA 2BA0A 4JK1C 4KY5A 1H9MA 2JK8A 1YNXA 3S2HH 1YEZA 4ZUIA 4C3IG 1N9WA 4YHHQ 5ISRA 3EROA 3CC2A 1BUVT 2VUMB 3SE0A 1IBKL 4DAPA 1RJTA 4A3JB 1GJXA 4GN3B 2IJ0A 5D3DA 1LV9A 4JBKA 4OX9Q 1XMQL 1JORA 3BDOA 3U9OA 2N55A 1F2MA 2AWOA 5C3EG 2P5ZX 4KKUA 3FMCA 1BCPB 3CCRA 4K6LA 1E24A 3J80c 2QDBA 4FO2A 4JI3Q 3GTMH 4A93G 3MEHA 2QDLA 5C44H 1R9TH 1O7ZA 2UUAL 1DOLA 4ZRZA 3R8BA 2UU9Q 2F0DA 2BA1A 2Q8TA 2DUDA 4XT3B 1V1PB 1GO3E 1KLUD 1X56A 1K83H 3AU7A 3NQTA 1SNMA 3RLFA 5FLMG 5IYCH 1QZHA 2HHHL 5C0XJ 4BY7H 3I4NH 3H94A 5IOCA 5M5WH 4PZ7A 1II3A 1QG7A 4CDCC 4O42A 4JBJA 2B2UC 3MVVA 4JBWA 3U50C 1HUNA 2KJXA 1HRJA 1TIID 4B3SL 1BCPF 3AFPA 2IX3A 3E0EA 1N33L 1HA6A 4UPAA 2ZTDA 2VQFQ 2ZXRA 4X65Q 3IAYA 4R1JA 2JA5G 3HFZB 2JEBI 3TS2A 1SJED 3JAMi 4BBSH 1A63A 2Q2HA 2V1CC 4YY3L 1QUQA 1TWHH 3S1NB 4GLXA 5HGTA 3QJYA 4L63B 2GA4B 3S24A 2Q8IB 5C5LA 1B50A 1X3QA 1Y1VB 3FKIG 3NQIA 3I7FA 2B2WC 3K7AH 4DV4Q 2RHSB 3NPPA 2JN4A 1STEA 1PTOD 1YNJC 3KF8B 3CF5A 3VR4A 2L11A 4C3IH 4LUZA 3PUZA 2XIWA 3TMEA 1IHZA 3ERQA 1TVXA 3OW2A 2B2UA 4IPGA 5JJKA 2WKDA 3G71A 4IJLA 1MJEA 1KLGD 4DA2A 3S14H 1I94L 4OO1G 4RCOA 2I5HA 2VB2X 2K32A 2E2HH 2LMCB 1TS4A 3I8ZA 2EJGC 4LWCA 5C3EH 3ERSX 3RNUA 4HIMA 1VQEA 3BZDB 4WFN3 4YHHL 3CPFA 4JI4Q 1JQYD 1SYCA 3OWEB 4MNOA 4JV5Q 4A93H 4A3DG 4BWGB 4KKTA 4QMGA 1TY0A 1CZGA 3J7A5 3TP5A 2NVQH 1U9RA 5DLQE 2IT1A 4OX9L 2NVXB 3OIQA 2B2WA 4QCLA 4DGZA 2JA6B 4BBRG 3ND8A 3LWUA 4XQJA 3TREA 5FLMH 1EYGA 4HIOA 2K5VA 1AP0A 4DR5Q 2F0GA 2WINB 4ZCKA 4JI3L 3GTLH 4DR4Q 4ZQ3A 2K5NA 5IGFA 4DR6Q 5BN3A 1TWAH 2KVMA 4C3HG 1FGBD 1LTSD 2UU9L 5I4DA 1BBXC 4QY7A 5C5MA 1HXYD 1WJJA 2A8VA 2JA5H 3I3CA 3NBHB 1C7YA 4TKOB 2E76C 4IFDG 1S40A 4ZKCB 1FNWA 1CI3M 2VUMG 2ENBA 2TSSA 5G3LF 5TSSA 1EEFD 1SSOA 4A3JG 4FF4A 1YITA 4KJNA 3HKZB 5IWAQ 2KENA 1QWYA 4F87A 1UNSA 3FKIH 2LY7A 4DV0L 2VQFL 4X65L 2AKWB 2A6HC 1Y1WB 1STBA 4LUOA 2JA9A 2VZAA 1EUJA 3FPUB 3MFYA 4JI6L 5M3FG 2EYLA 2F0LA 4OO1H 2ASBA 2EYMA 2B2YC 1EFID 3H3VC 4DV4L 1UWVA 5CV9A 2GVAA 1R4PB 2D2CC 2QA4A 3PMFA 2QW7A 1X3EA 3A54A 1IL2A 2MPMA 2NVYH 3BU2A 3T53B 4A3DH 2V4DA 4RMFA 1I4RA 5I2XA 1M8AA 1IKLA 1SNDA 1VQLA 1NR4A 3RLNA 1PMRA 2R61A 1TWGB 1KRSA 4F7XA 1D5ZC 4IQZA 4BBRH 5JOBA 2CWAA 4RHSA 4UY8C 3G6JB 1I4GA 3NK9A 1BO0A 1F2ZA 4JI4L 4C56C 1EOTA 4JV5L 4YWMA 1HH2P 5GAEC 1B70B 3S1RB 4C3HH 3S17H 1WTHA 4HCSA 2B2YA 2FMCA 2EYOA 3NWSA 1Y1VG 2K01A 2ALYB 1IXRA 4PZ6A 4JI8Q 5E3FA 1ZYRD 1DCZA 3UDIA 1GM5A 1IYJB 1ZEQX 4DR5L 4IFDH 1WCMB 4DR4L 2K33A 4DR6L 1WTPA 4B9XA 2VUMH 2YYZA 4U68A 1Q1EA 5IGEA 3NXWA 4XTCS 4A3JH 1WD0A 1MI2A 2XRSD 1A8VA 3UDFA 3AB9A 3CMAA 3RN2A 1YNJD 4M1UB 1ICFB 1CFMA 4IUNA 2RDGA 4HEDA 3W2DA 1SNCA 4LNQA 1EYCA 1STYA 2D62A 5IGCA 3NELA 5FO8B 1LABA 5FLXL 2N78A 1Z6HA 2A19A 1O7IA 2F0VA 3I4OA 2E2DC 5IWAL 5M3FH 2FMMA 3S1MB 3NBIA 1A2TA 1PZKD 4LFAQ 1ASZA 3C46A 3B6YA 4R9WA 4DR2Q 1T5XD 2JA6G 1HFGA 3CW2C 3N6RA 1VQAA 1VQNA 5ELOA 1C48A 1WTVA 1EY6A 1XX8A 3KBXA 2CCZA 1UAPA 1FNUA 3BZCA 5BR8Q 1E7ZA 4K2KA 2RSNA 3K7UC 3K58A 3QG1A 2SNMA 3LGJA 1MD2D 3NENA 3A56A 1RHPA 3RN5A 4XT1B 4LJZC 4IUTA 3J7AV 4L5RC 1PH6A 1TY2A 1XTCD 1XPUA 1IYVA 3S1NH 2I5MX 1RCVD 3HKZG 1VQ4A 1TWCB 3M3YB 1HJPA 1Y1VH 2EYFA 1N34Q 2WB1B 4QB4A 1OTCA 3I56A 5LL6S 4DUZL 4LAAA 2QCPX 4O1NA 3CCEA 1EL0A 1GD7A 3H3VI 1IYUA 5CMDA 2EJMA 2ICEC 5A35A 1U5KA 4C3JB 1AZQA 4Y52H 1JOOA 1D1KA 1B1ZA 4TQUS 3VYRA 5EAYA 1AE3A 3AFQA 1I3QB 2Z6KC 4JI8L 2F3IA 4L5SA 4IPDA 1EQRA 2EY6A 2LSSA 2LFNA 2L4NA 2A6HD 4XDXA 3ZJYC 4NB3A 3G7LA 1ENFA 4ZKBB 3K5LA 2A1AA 5COYA 1CSPA 1SE8A 4PMBA 1J6QA 3VA7A 1HZ9A 2K7VA 4I7AA 3IFDA 3DEPA 2XWBB 5DM73 4GLAC 1KHIA 1SEBD 2PI2A 2RBMA 4N9TA 1H9JA 2JA6H 3J81L 2O5JC 3M85A 1B53A 3Q6SA 5M9OA 1LO5D 1YI2A 4KN4C 3NE5B 3OIPA 5GROA 2K5QA 3SK8A 3CCVA 3BJUA 4DAMA 1OXXK 4LFAL 4M8AA 2I46A 2D5DA 1L1OA 1HNZQ 4DR2L 3VYUA 1EWIA 2F3WA 3KK7A 1G51A 3K6OA 1HHVA 2KA7A 3PO2B 1X65A 1WCMG 3VYSA 2J4XA 3AMUA 3L9AX 5BR8L 3H91A 5LMNW 1CKOA 3MZ5A 5BN5A 4IUQA 3C2PA 3S9WA 5DAUA 2N3SA 5I9PA 4FNFA 2JEAI 2HDLA 4K5VA 2IHEA 1VQ9A 1U4LA 1HZBA 4CDFC 1B3AA 4H44C 2IX0A 2L12A 2WIIB 4O2DA 2UXDQ 1Z47A 1OO9B 4NKLA 4RKBA 3PQIA 1ONLA 3DWPA 4H7BA 3V05A 3PIOA 1VF7A 3UDXA 4YCUA 1HZAA 3KLSX 1BVSA 4JVZA 3EFXD 4ZYSA 4A75A 1NSNS 1WOCA 3CCJA 2L1BA 1E1OA 1N34L 3T16A 1B9MA 1TU2B 2ZTEA 2K50A 2L0CA 3H0GB 2M2LA 1D5XC 1GKHA 4ME3A 4JC0A 3TBIB 1TT2A 5IT9L 1EY4A 4NPSA 1S5DD 2B29A 5FO7B 5ELDA 5I2YA 4LF4Q 1N8RC 1JB3A 4OXPA 2A68C 4RHRA 2WACA 4OL7A 4YCWA 1KDBA 3MXGA 2ID0A 3CC4A 1O80A 1YVCA 1TWGH 3GDEA 2PO4A 3MEFA 2K52A 1GUWA 3M4PA 2XWJB 5CGKA 1DXMA 2A5HA 2CVRA 3JC66 3ITPA 1VQJA 1EU3A 5BN4A 4B08A 3S1RH 4MTNA 3KDFA 2EVBA 5ELBA 5JPNC 1RKNA 4FXGC 1HQRD 1X9NA 2WB1G 2CWPA 1PZJD 1QZGA 3MTSA 5HURA 1XXGA 1TXYA 1D8LA 4UP8A 4C1NI 3GO5A 1L2FA 2F0FA 3KBGA 4XYQA 4C3JG 1WCMH 1STHA 1N32Q 1KAWA 1F2LA 1STGA 2WAQB 5D65A 4K14A 4KMUC 1BKBA 5KYLA 1EWCA 2L55A 1HNXQ 3L0OA 1HNZL 5C4JB 1I50B 2RA4A 2F4VL 4HAEA 2AQ2B 2B2TC 3TDQA 1V1OA 5C4ZA 1DGSA 2E2IB 2JXMB 4GOPB 2AHOB 3M4QA 2ZXPA 2OEOA 1CTMA 4RH6A 4GNXA 2E5LL 4KD3A 4KJOA 1PH8A 3S1MH 5D14A 1GUNA 2LS01 4X66Q 2B3GA 2MGSA 5A2QE 2HQLA 5EBCA 5C3XA 4LK1C 4DK0A 2UXDL 1F9PA 1LLRD 3TZUA 1X55A 2HCCA 3T13A 4OHJA 1VQ5A 3RMHA 1BDOA 3H6MA 4B9WA 3PO3B 1KL9A 2E2JB 3TP6A 4JG2A 1W6KA 3CRLC 1H9SA 1YHAA 1CK1A 4G7ZC 4B3MQ 2K1BA 2YTXA 5CV8A 3T4AC 5EPLA 2EZVA 5IP7G 1KAAA 5CBAE 3PUVA
chains in the Genus database with same CATH topology
4X3SA 1ENAA 4DF7A 1D1IA 2YU9B 1JWMD 1Z7TA 1WTQA 1Q12A 3ONAB 3NSWA 1WTWA 2QF7A 1SNQA 1UUPA 2HQEA 1WVLA 4IZ8A 3DHQA 1DOKA 3F2UA 5FLXE 3OMGA 3D4DA 2E75C 3DM1A 1ESFA 2BDNA 3JAML 4ID6A 3RZOB 2KCCA 1TWFB 3S15B 1IL8A 3IKJA 2IW3A 2NTSA 1ZKOA 4DN4M 5EPKA 1K8MA 4J8QA 5CV4A 4KN7C 3WOEA 1JOKA 2PZWA 3DXJC 5CC4A 1VDZA 3QB3A 3FVQA 5K36G 2B2VC 4ULLA 3GTQB 4V190 2M9VA 2K5WA 4PNYA 3OWFA 4NP5A 1ZYRC 2EE1A 4FP5D 5AFWA 2IPKD 1G2SA 3V96A 2CQAA 4X3KA 1BCPC 2EXZA 1Q3LA 2NN6G 3D3RA 2A68D 2B63B 2FFKB 3DUZA 1HA5A 1F9RA 3NUCA 3VYTA 1RD9D 1A15A 1SAPA 2B2VA 3Q22A 4A3GB 3I70A 1SNPA 1SJHD 2HUGA 1JWUD 3VR3A 2KUMA 1V8QA 1TS2A 2DY8A 3DWQA 2JSOA 3HOZB 1E2VA 1SYEA 2NN6I 3OOCA 4ZK9B 4Q5VA 3K0YA 2F0NA 5KEEA 3OW7A 1ET9A 1E2WA 3P75A 3MFGA 4FYDA 3J81E 5ELFA 3QO2A 4A3BB 5C4HA 1V1PA 2CW0C 1MGSA 3BVMA 2F0WA 2L9HA 4R8NA 1M4VA 1OXUA 3P1HA 3R2TA 4OO1I 2JE6I 1B9NA 1ET6A 4K8IA 2PMZB 5K36H 3M7GA 3DMUA 1WTOA 2R7ZB 1G6ZA 3VR2A 1EIGA 1AN8A 2F0MA 5NUCA 1CM9A 2F0JA 1IW7D 3D6WA 3PUXA 2EDGA 2BDOA 1XWEA 1G291 5DM63 1BOSA 2G9DA 2NN6H 2F0TA 4CGYB 5KNDA 4U673 2F1MA 4K2LA 4S3SA 4G4KA 1AFPA 3EVQA 3KF8A 1GHKA 1QNUA 3HGBA 4BA1I 1KDCA 2XRQD 1LT4D 1CA6A 3A7AB 4IFDI 1YNNC 1A3TA 3MWYW 1DJRD 1G2TA 2F4IA 3GV3A 5ELEA 4EGVA 5IT9E 5FOBB 3BVZA 4AYBB 5CR3A 2AQ3B 1NCVA 4OIJA 4XYOA 5KIXA 5JPMC 1KABA 4DXGA 5KNBA 2JA7B 1HTLD 3IL8A 4A3IB 3Q0AA 2DNCA 4F88A 4KI0A 1S5FD 1DD2A 2R93B 3PIP3 4A3MB 1FNVA 4EQPA 5JEAG 3SR1A 5IGGA 3GP7A 3M7NA 5E4WC 1RF2D 3EJIA 1STAA 1BCPD 1QOHA 4J1MA 1Q90A 1JE4A 5FK9C 3RUZA 3E0JA 2ICIA 1DOMA 1JCKB 3GTJB 4IURA 3N52A 2PZTA 1QJOA 2A69C 1D5MC 3I72A 2SDFA 1K8OA 2WP8J 2OF1A 5EGTA 1JR0D 2MUYA 2SNSA 3HEJA 2JA8B 2AQ1B 1DM0B 3HOYB 4RAUC 1HCZA 1G91A 3R3OA 1PFBA 1HQMC 3LNNA 3A7LA 4X3TA 5EKIA 1SMYC 5EJWA 1LTID 3R93A 3MAQA 3BYTB 2DN8A 4E6IA 4GZYC 4WJWA 1U4PA 4FF3A 5E4XA 2CW0D 3BVGA 3QOLA 2M00A 4CJ1B 3WDNA 1EYAA 3L7ZC 1EQVA 4A3FB 5KYIA 2FINB 4NMZA 2B8GA 5JEAH 2Z8LA 4I7ZC 5JVG3 2F03A 3URYA 1VCIA 1F9SA 3JAME 4QF4A 3D4RA 4WRDA 2F0UA 1SE3A 1Y69U 1CZWA 1KDAA 2H4OA 3K5MA 2D9UA 4ILWA 1I4QA 3I90A 4F8MA 3MXPA 3LWEA 5G3LD 1QNKA 4FXKC 4HMIA 2RVLA 2NVTB 4KHVA 1ILQA 2MHVA 2A74C 3EA6A 1PRTB 2CHBD 3OSOA 3GTPB 4DNRB 5C4XB 2XN9C 1YNND 5EPJA 5M5WB 3IFTA 3GTGB 4XQNA 2QEJC 4FF2A 3NWTA 1H9RA 2IL8A 3TP7A 3CRKC 5IODA 2F0SA 4XQQA 1PFNA 4HR7B 5DEHA 1L0YB 2C5CA 1ILPA 1O78A 5CV5A 2KHSA 1R4QB 2N88A 1CQFA 1PRTF 3CQZB 3MXUA 2DNEA 1SNOA 4FF1A 3O13A 3A8JE 1FR3A 1EU4A 3H09A 5KNCA 1JC7A 2VNUD 1PRTC 1OXVA 2R6GA 4K8JA 2SOBA 1HPCA 1CQVA 1H9KA 2NUCA 1OXSC 4TRDA 1PTOB 3SXHA 2ZT9C 2ZXOA 1L0XB 4IN3A 3PIO3 4TSSA 1I4HA 2A69D 4G7OC 5M3MB 1VMCA 1A2UA 3C1FA 5EKLA 2F0QA 2MP1A 4C2MB 4BS9A 5JAVA 4G57A 3KLRA 1LTTD 1QILA 3RD4A 1I6HB 1SMYD 1LT6D 1J9OA 3E5SA 5EQ0A 1PTOF 1CT1D 1H9SB 1GOZA 4RWSC 1S5CD 3A8IE 1I4XA 2F0EA 1ICWA 5EBDA 3HOUB 2EJFC 1EQTA 1NR2A 1LACA 2EYPA 4P2CB 1EEID 1EY9A 2EY2A 2OT2A 3SEBA 2B39A 1KTKA 2NBFA 5C3WA 3BDCA 5J22A 4G7HC 5CV6A 2RDFA 2XVSA 5CORA 1LTAD 4DNTB 1KNEA 3D8GA 4WORA 1TKWB 1F2YA 1PLFA 1EZ8A 2EOTA 1BQQT 1W6JA 1Y8NB 4PMWA 1B44D 3KLSA 1IW7C 1V43A 3MA2B 3TZDA 1F77A 1IKMA 3FDTA 2RDHA 2Z1CA 3D31A 4ZAIA 1BNZA 4EQNA 4X3UA 3I4LA 1TS5A 4RFBA 2NZ1D 2KOLA 5IIFA 2KEDA 4L8JA 1LT5D 2B2TA 1PXUA 1SYGA 4DU9A 2AUJD 2AUKA 1NAPA 1TR5A 5C0XG 3E6ZX 5FO9B 3UI2A 3HP3A 4KY7A 1RTOA 4V0BA 3K57A 1BF4A 1OXTA 4DAVA 1MSHA 2C9OA 2NTTA 1PRTD 3K5NA 2XNAC 2J0TD 4Q0FA 5IGDA 5C0XI 5M3FB 4DFAA 2JYOA 3P7JA 5K5PA 1ENCA 1A3VA 3BYYB 3CU7A 2KCNA 2KEEA 4Z9CB 4HTHA 1F9QA 4K5WA 4XIGS 1KNAA 4MIUA 1HFNA 2X6GA 3DWAA 4CJ0B 1PZID 1SFOB 1ESRA 1EWHA 1GUOA 4KD4A 2F0PA 2K6AA 1CHPD 5M5XB 1LTGD 1MBYA 2K5DA 3QIAA 2EYHA 4A3KB 2PPBC 2OXPA 2IX1A 4CBVA 3VR6A 3OHXC 5D3IB 2B8FA 5C0XH 1DZ1A 4HSVA 5I6WA 2WKCA 1S5BD 5KGUA 3P20A 3L3OC 4RGTA 3VA5A 3R2IA 4HN7A 1U4MA 3D6CA 2H1EA 1GHJA 4EVOA 2Z4HA 2R92B 2F0IA 3HOWB 1PTOH 1EIHA 2QILA 2RSOA 2FHTA 1SDFA 1SYBA 2KECA 4J6HA 5F2DA 3SK4A 3HRZC 4QIWB 2PQEA 3TSSA 4PMCA 3CKIB 4CKEA 1BXTA 1U4RA 1GXDC 3I73A 5T1IA 4QUCA 2PCFB 4ODGA 2RKSA 4IUPA 5EKKA 3S16B 2PW7A 3LX0A 2BE5C 1AZPA 1T5EA 4KV6A 1WTXA 5DNFA 1JWSD 1O7LA 3K5OA 1QB5D 3M4OB 2EPBA 2NWGA 4KHZA 5E1FA 2R3ZA 3J80L 5CYUA 1D6EC 4IUUA 1HUMA 3HZXA 1NUCA 3SHLA 1B2TA 1ZXTA 4CKBA 1E0BA 3HOXB 3SK5A 1EZ6A 1RDPD 1GUSA 2F0OA 2Z4IA 1DONA 4BY1B 4CKCA 1A6XA 4RA8A 3NTIA 1JICA 1I4PA 4IUVA 4IFDJ 3TN2A 1I6VC 2Y0SB 3DEOA 4I65A 1EY0A 3SVMA 4DAYA 4PV1C 2J7ZA 2IWHA 4CJ2C 2VXWA 2EYJA 4C1NK 5JJZA 3EQLC 3QWNA 4DXFA 5A2QL 2HCIA 3I4MB 4OIKA 3MXNA 2A6EC 1X3PA 3NBHA 1C8CA 5T1GA 4K5XA 2PYKA 2BOSA 2MJ8A 3TP8A 4KK7A 3ND9A 3S1QB 1A3UA 2K05A 2XSCA 4FVMA 3QOJA 3HOVB 1QE6A 3BS1A 1EY5A 1LTBD 5JEAJ 1AEXA 4A3EB 2O2LD 1SYDA 5ELCA 3X3MA 1C4QA 2WV6D 4KTAA 2A73B 2FJ2A 3NHHA 2JP1A 2K04A 3GTKB 1VF5C 2PZUA 4UAIA 3WOFA 1SE2A 1PFMA 3OMCA 3C3LA 4RGMA 3S2DB 4BA2I 1E2ZA 5CBEE 3X3NA 4XXEA 3SDZA 1S4ZA 4RKLA 4ME5A 4HSPA 2DY7A 3S2HB 2L5TA 1S5ED 2BE5D 2I07B 2AWNA 3GV6A 1O7YA 1FD7D 4KKSA 1G8ZD 1SYFA 2HDMA 3FPPA 4R8IA 3Q24A 5C6AA 1RTNA 3ZYYX 4EQOA 1SE4A 1WTRA 3GTMB 4RCNA 5C44B 1R9TB 2O4XA 2VB3X 3D4WA 4ZLTF 5IGBA 2PW5A 1K83B 2O5IC 2EY5A 3SK6A 2BCOA 2SEBD 4LMQD 5I9OA 4BY7B 3I4NB 1HTPA 1VMPA 4H13C 2G9HD 4OGQC 4YIJA 1GUTA 3PUYA 3MC0B 3FRPB 5JVH3 2EY1A 1EYDA 3VR5A 2F3VA 3RZDB 4BBSB 2K03A 1FYCA 1TWHB 2K28A 2TMPA 4NDXA 3K7AB 2RQXA 3KUPA 4C3IB 1Y8OB 4HCEA 4Y7NB 1DYQA 3NP8A 1D2BA 1XYIA 4IALA 1TS3A 3J7AF 3S14B 2A6ED 3GQBA 3Q23A 2E2HB 1STNA 2QKIC 2E74C 5C3EB 2LKVA 4H0LC 3CHBD 3V2TA 5I6YA 4A93B 2X69A 1UEAB 4RGOS 5KRUA 4KY6A 3HS0C 2NVQB 1SXTA 2Q8RE 5J1ZA 3I91A 3FEWX 1PDQA 3HG9A 5FKAC 3GTLB 4NW2A 1TWAB 2X6LA 1B4OA 4CHTB 2NB0A 3W3AA 1WD1A 4MN3A 1SBBB 4FXDA 2JA5B 3BG3A 4L6TB 3J80E 1PTOC 3C1EA 1X32A 4PQXA 3U9SA 5LHY1 3T51B 3OPOA 5J39A 3GTOB 3FKIB 3PV0A 1EY8A 4K6DA 4N9PA 3GD7A 1J8IA 1PYWD 1JOQA 2KQ3A 2NYZD 1Q8IA 4HMJA 3PUWA 4RGNA 4QUFA 1GUGA 3A8KE 1LT3D 1EY7A 1TQOA 4DK1A 1RODA 4ZUJA 4ABNA 4UDUC 2F0KA 1LTRD 1Q1BA 2NVYB 4A3DB 4MHEA 1Y8PB 1CA5A 1MSGA 5CV7A 1BR9A 3T56B 5M5YB 2F0HA 3J7YW 4BBRB 3M4YA 3NTKA 1CHQD 1QCBD 2PNRC 3K59A 3BDLA 1AW7A 3MHBA 4C3HB 5LL6X 3S17B 1ML0D 3A55A 3NTHA 2BA0A 4JK1C 4KY5A 1H9MA 4ZUIA 4C3IG 5ISRA 3EROA 1BUVT 2VUMB 3SE0A 4DAPA 1RJTA 4A3JB 1GJXA 2IJ0A 5D3DA 1LV9A 1JORA 3BDOA 3U9OA 2N55A 1F2MA 2AWOA 4KKUA 3FMCA 1BCPB 4K6LA 2QDBA 4FO2A 3MEHA 1O7ZA 1DOLA 4ZRZA 3R8BA 2F0DA 2BA1A 2Q8TA 4XT3B 1V1PB 1KLUD 3NQTA 3AU7A 3RLFA 1SNMA 5C0XJ 3H94A 5IOCA 1II3A 1QG7A 4O42A 2B2UC 3MVVA 4JBWA 1HUNA 2KJXA 1HRJA 1TIID 1BCPF 2IX3A 1HA6A 2ZXRA 3IAYA 2JEBI 1SJED 3S1NB 5HGTA 3QJYA 4L63B 2GA4B 2Q8IB 5C5LA 1B50A 1X3QA 1Y1VB 3NQIA 2B2WC 3NPPA 1STEA 1PTOD 1YNJC 3VR4A 2L11A 3PUZA 2XIWA 3TMEA 1IHZA 3ERQA 1TVXA 2B2UA 2WKDA 1KLGD 4DA2A 4OO1G 4RCOA 2VB2X 2K32A 2LMCB 1TS4A 3I8ZA 2EJGC 3BZDB 4WFN3 1JQYD 1SYCA 3OWEB 4BWGB 4KKTA 4QMGA 1TY0A 1CZGA 3TP5A 1U9RA 2IT1A 2NVXB 3OIQA 2B2WA 4QCLA 4DGZA 2JA6B 3ND8A 3LWUA 4XQJA 1AP0A 2F0GA 2WINB 4ZQ3A 5IGFA 5BN3A 2KVMA 4C3HG 1FGBD 1LTSD 5I4DA 1BBXC 5C5MA 1HXYD 3I3CA 4TKOB 2E76C 4IFDG 4ZKCB 1FNWA 1CI3M 2ENBA 2TSSA 5G3LF 5TSSA 1EEFD 1SSOA 4FF4A 4KJNA 3HKZB 1QWYA 4F87A 1UNSA 2LY7A 2A6HC 1Y1WB 1STBA 3FPUB 3MFYA 2EYLA 2F0LA 4OO1H 2EYMA 2B2YC 1EFID 3H3VC 5CV9A 1R4PB 2D2CC 3PMFA 3A54A 2MPMA 3T53B 2V4DA 1I4RA 5I2XA 1M8AA 1IKLA 1SNDA 1NR4A 1PMRA 2R61A 1TWGB 4F7XA 1D5ZC 4IQZA 5JOBA 4RHSA 3G6JB 1I4GA 3NK9A 1BO0A 1F2ZA 4C56C 1EOTA 3S1RB 4HCSA 2B2YA 2FMCA 2EYOA 3NWSA 2K01A 5E3FA 1ZYRD 1DCZA 1ZEQX 4IFDH 1WCMB 2K33A 1WTPA 4B9XA 2YYZA 4U68A 1Q1EA 5IGEA 3NXWA 4XTCS 1WD0A 1MI2A 2XRSD 3AB9A 1YNJD 4M1UB 1CFMA 4IUNA 2RDGA 4HEDA 3W2DA 1SNCA 1EYCA 1STYA 2D62A 5IGCA 5FO8B 1LABA 5FLXL 1Z6HA 2F0VA 2E2DC 2FMMA 3S1MB 3NBIA 1A2TA 1PZKD 3C46A 4R9WA 1T5XD 1HFGA 3N6RA 1C48A 1WTVA 1EY6A 1XX8A 3KBXA 1UAPA 1FNUA 4K2KA 2RSNA 3K58A 3QG1A 2SNMA 1MD2D 3A56A 1RHPA 4XT1B 4LJZC 4IUTA 3J7AV 1TY2A 1XTCD 1IYVA 1RCVD 1TWCB 3M3YB 2EYFA 2WB1B 4QB4A 5LL6S 4LAAA 2QCPX 4O1NA 1EL0A 1IYUA 5CMDA 2EJMA 2ICEC 5A35A 1AZQA 4C3JB 1JOOA 1D1KA 1B1ZA 4TQUS 3VYRA 1I3QB 2EY6A 2LFNA 2L4NA 2A6HD 4XDXA 3G7LA 1ENFA 4ZKBB 3K5LA 5COYA 4PMBA 3VA7A 2K7VA 3IFDA 3DEPA 2XWBB 5DM73 1SEBD 2RBMA 4N9TA 1H9JA 3J81L 2O5JC 3M85A 1B53A 3Q6SA 5M9OA 1LO5D 4KN4C 3NE5B 3OIPA 2K5QA 3SK8A 1OXXK 4M8AA 2I46A 2D5DA 3VYUA 2F3WA 3KK7A 3K6OA 1HHVA 2KA7A 3PO2B 3VYSA 2J4XA 3AMUA 3L9AX 3H91A 5BN5A 3MZ5A 4IUQA 3C2PA 3S9WA 5DAUA 5I9PA 4FNFA 2JEAI 2HDLA 4K5VA 1U4LA 1B3AA 4H44C 2IX0A 2L12A 2WIIB 1Z47A 1OO9B 4NKLA 4RKBA 1ONLA 3DWPA 4H7BA 3V05A 1VF7A 3KLSX 3EFXD 4ZYSA 1NSNS 2L1BA 3T16A 1B9MA 1TU2B 2L0CA 3H0GB 2M2LA 1D5XC 3TBIB 5IT9L 1TT2A 1EY4A 1S5DD 5FO7B 5ELDA 5I2YA 1JB3A 4RHRA 2A68C 2WACA 4OL7A 1KDBA 3MXGA 2ID0A 1O80A 2PO4A 1GUWA 2XWJB 5CGKA 1DXMA 2A5HA 2CVRA 3ITPA 1EU3A 5BN4A 4B08A 2EVBA 5ELBA 5JPNC 1RKNA 1HQRD 4FXGC 1PZJD 3MTSA 5HURA 1XXGA 4C1NI 3GO5A 2F0FA 3KBGA 4XYQA 4C3JG 1STHA 1STGA 1F2LA 2WAQB 5D65A 4K14A 4KMUC 5KYLA 1EWCA 2L55A 5C4JB 1I50B 2RA4A 4HAEA 2AQ2B 2B2TC 3TDQA 1V1OA 5C4ZA 2E2IB 2JXMB 4RH6A 2ZXPA 2OEOA 1CTMA 4KD3A 4KJOA 5D14A 1GUNA 2LS01 2MGSA 5A2QE 5EBCA 5C3XA 4LK1C 4DK0A 1F9PA 1LLRD 3TZUA 2HCCA 3T13A 4OHJA 3RMHA 1BDOA 3H6MA 4B9WA 3PO3B 2E2JB 3TP6A 1W6KA 3CRLC 1H9SA 1CK1A 4G7ZC 2K1BA 5CV8A 3T4AC 5EPLA 2EZVA 1KAAA 5CBAE 3PUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FO7 B;  1PXU A;  3L3O C;  5FO8 B;  5JPN C;  1JB3 A;  2A73 B;  3CKI B;  3G6J B;  3MA2 B;  4FXG C;  1GXD C;  3CU7 A;  2I07 B;  2TMP A;  2E2D C;  2QKI C;  4FXK C;  1BR9 A;  3FRP B;  3V96 A;  5FO9 B;  2XWJ B;  2ICE C;  2A74 C;  5FOB B;  1JC7 A;  2B39 A;  2J0T D;  2WII B;  3OHX C;  1D2B A;  3I70 A;  1UEA B;  1BUV T;  1BQQ T;  1OO9 B;  2XWB B;  3HS0 C;  5JPM C;  1XWE A;  2WIN B;  4ILW A;  3T4A C;  3HRZ C;  1UAP A;  3KLS A; 
#chains in the Genus database with same CATH topology
 4X3S A;  1W2B A;  1LM0 A;  1ENA A;  3PO2 G;  4DF7 A;  1D1I A;  2YU9 B;  1JWM D;  1RIP A;  1Z7T A;  1WTQ A;  1Q12 A;  4LF4 L;  1XNQ Q;  3ONA B;  3NSW A;  1WTW A;  2QF7 A;  1SNQ A;  1UUP A;  2HQE A;  4JYA L;  1WVL A;  4IZ8 A;  3DHQ A;  4NXN Q;  1DOK A;  3F2U A;  4JOI C;  5FLX E;  4N8X 1;  3OMG A;  3D4D A;  2E75 C;  5GAD C;  1PH2 A;  3DM1 A;  1ESF A;  3K81 C;  2BDN A;  3JAM L;  4ID6 A;  3RZO B;  2KCC A;  1TWF B;  4C3J H;  4IPH A;  3S15 B;  1IL8 A;  3IKJ A;  3CP0 A;  4UHV A;  2IW3 A;  3ICE A;  2NTS A;  1ZKO A;  4DN4 M;  4DV2 Q;  3AEV A;  3K0X A;  4UP7 A;  5EPK A;  1K8M A;  4J8Q A;  5CV4 A;  4KN7 C;  1I3Q H;  3WOE A;  1JOK A;  2PZW A;  1SRU A;  3DXJ C;  3RR5 A;  3H0G G;  5CC4 A;  1VDZ A;  3QB3 A;  3FVQ A;  1VQB A;  1K9M C;  2Q2T A;  1N32 L;  5K36 G;  2MFI A;  2B2V C;  4ULL A;  1VQ7 A;  1K8A C;  3GTQ B;  4V19 0;  4DV0 Q;  2M9V A;  2MNA A;  2K5W A;  3K80 C;  4PNY A;  3OWF A;  2I0Q A;  1IZ6 A;  4NP5 A;  1HNX L;  3RZD H;  1ZYR C;  2EE1 A;  1CSQ A;  4FP5 D;  5AFW A;  2IPK D;  3F2C A;  4JOI A;  1G2S A;  3V96 A;  1B3Q A;  2CQA A;  4X3K A;  1BCP C;  2K5H A;  5IYD G;  4JI6 Q;  2EXZ A;  1P8L A;  1Q3L A;  2NN6 G;  3D3R A;  1K73 C;  3PF4 A;  1EIF A;  2A68 D;  3VDY A;  2B63 B;  2FFK B;  3DUZ A;  2QGQ A;  4X66 L;  1HA5 A;  3A74 A;  1F9R A;  3NUC A;  4Y7N H;  2RHQ B;  3VYT A;  1XPO A;  2K14 A;  5IP7 H;  1RD9 D;  1A15 A;  3PO2 H;  4A4I A;  1SAP A;  4GKJ Q;  1VQH A;  2B2V A;  1YBY A;  3KYH C;  3Q22 A;  2OCE A;  4A3G B;  4L5T A;  2WAQ G;  3I70 A;  1SNP A;  1SJH D;  3ULP A;  2HUG A;  1JWU D;  3VR3 A;  2KUM A;  1V8Q A;  1TS2 A;  1FL0 A;  4B3M L;  2DY8 A;  3DWQ A;  2JSO A;  3E9H A;  3HOZ B;  1E2V A;  1SYE A;  2NN6 I;  3OOC A;  4ZK9 B;  4Q5V A;  1I5F A;  3K0Y A;  2F0N A;  5KEE A;  3OW7 A;  1ET9 A;  1E2W A;  3P75 A;  3KJO A;  2OTL A;  5JJI A;  3MFG A;  4BXX G;  4FYD A;  2RF4 A;  3TS0 A;  1XNQ L;  3J81 E;  3CAM A;  5ELF A;  4EX5 A;  1Q86 C;  4DAY B;  3QO2 A;  4A3B B;  5C4H A;  1V1P A;  2CW0 C;  1MGS A;  3BVM A;  2F0W A;  1CKN B;  2L9H A;  4R8N A;  1M4V A;  1OXU A;  4NXN L;  3P1H A;  3R2T A;  3KF6 B;  3H0G H;  5FLX c;  4OO1 I;  2VL6 A;  2JE6 I;  4R4O A;  1B9N A;  1ET6 A;  3OTO Q;  4K8I A;  2PMZ B;  5K36 H;  2WAQ E;  3M7G A;  3W5O A;  3DMU A;  1WTO A;  3I55 A;  2R7Z B;  4DV2 L;  1G6Z A;  3VR2 A;  1EIG A;  3PO3 G;  1AN8 A;  2F0M A;  5NUC A;  4OWX B;  4DV1 Q;  1CM9 A;  2F0J A;  1IW7 D;  4JW0 A;  3MXN B;  3D6W A;  3PUX A;  2EDG A;  1SMX A;  2BDO A;  1XWE A;  1G29 1;  5DM6 3;  4OEL B;  1BOS A;  5IYD H;  2G9D A;  2NN6 H;  3GTO H;  1B7Y B;  2F0T A;  4CGY B;  5KND A;  1XNR L;  4U67 3;  2DJF C;  2F1M A;  4K2L A;  4S3S A;  4G4K A;  1AFP A;  3EVQ A;  3KF8 A;  1GHK A;  1QNU A;  3HGB A;  4BA1 I;  1KDC A;  2XRQ D;  1LT4 D;  1CA6 A;  2ATW A;  3A7A B;  4IFD I;  1YNN C;  1A3T A;  3MWY W;  1DJR D;  1G2T A;  2F4I A;  5C4J H;  1I50 H;  3GV3 A;  5ELE A;  4EGV A;  5IT9 E;  5FOB B;  1HR0 Q;  3BVZ A;  4IO9 A;  4X64 Q;  4AYB B;  5CR3 A;  2AQ3 B;  1NCV A;  4OIJ A;  4XYO A;  5KIX A;  4GKJ L;  1VQO A;  5JPM C;  1KAB A;  2PNH A;  5M5Y H;  4DXG A;  5KNB A;  4BXX H;  3J80 i;  4DUZ Q;  3PIP A;  4QQB X;  1HTL D;  3IL8 A;  4A3I B;  3WWV A;  2JA7 B;  3Q0A A;  2DNC A;  3UE0 A;  2RCN A;  4F88 A;  4KI0 A;  1NTG A;  4DV7 Q;  1S5F D;  4JI5 L;  1A0I A;  2KBN A;  1DD2 A;  2R93 B;  3PIP 3;  1Z9F A;  4A3M B;  1FNV A;  4EQP A;  5JEA G;  3SR1 A;  4B3R Q;  5IGG A;  3GP7 A;  3SGI A;  3PO3 H;  2E2J H;  2B63 G;  3M7N A;  3TRZ A;  2EXD A;  5IE8 A;  3J81 c;  5E4W C;  1RF2 D;  3EJI A;  1STA A;  4A76 A;  1BCP D;  1QOH A;  4J1M A;  1Q90 A;  1JE4 A;  5FK9 C;  3RUZ A;  1W3S A;  3E0J A;  3OTO L;  1AH9 A;  2ICI A;  1DOM A;  2YU9 H;  2K75 A;  4LF7 Q;  4AQY Q;  4A3G G;  1JCK B;  3GTJ B;  4IUR A;  3N52 A;  4DV1 L;  2PZT A;  4N8F A;  1QJO A;  4DK6 C;  2A69 C;  1D5M C;  3I72 A;  2BH8 A;  2SDF A;  1K8O A;  2WP8 J;  2OF1 A;  1JR0 D;  2MUY A;  2SNS A;  3HEJ A;  5EGT A;  2JA8 B;  2AQ1 B;  1VQC A;  3RZO H;  1DM0 B;  1NMG A;  1TWF H;  3S15 H;  4RAU C;  1HCZ A;  3G4S A;  3HOY B;  3R3O A;  1G91 A;  2UUC Q;  1PFB A;  1HQM C;  3LNN A;  3A7L A;  4X3T A;  3STB C;  5EKI A;  3W1G A;  1SMY C;  4A3B G;  4IPC A;  5EJW A;  3CCU A;  1LTI D;  1X3F A;  3R93 A;  3MAQ A;  3BYT B;  2DN8 A;  4E6I A;  4OWW B;  4GZY C;  4POF A;  4WJW A;  1U4P A;  4FF3 A;  2R7Z G;  5E4X A;  1HZC A;  2CW0 D;  3D0F A;  3BVG A;  3QOL A;  3CXC A;  2ZJP A;  2M00 A;  4CJ1 B;  3WDN A;  1EYA A;  3L7Z C;  1EQV A;  4B3T L;  4A3F B;  5KYI A;  2FIN B;  5IT9 c;  4JPB W;  1HR0 L;  4NMZ A;  2B8G A;  4X64 L;  5JEA H;  2Z8L A;  4I7Z C;  5JVG 3;  2F03 A;  1QVG A;  4JCV E;  3URY A;  2B63 H;  1VCI A;  1F9S A;  4LF5 L;  4IJH A;  2HIV A;  3JAM E;  1SLJ A;  3EN2 A;  2LXK A;  4QF4 A;  3D4R A;  3CD6 A;  4DV7 L;  4WRD A;  2PQA B;  2F0U A;  1SE3 A;  1Y1W G;  3ER0 A;  1Y69 U;  1PYB A;  1CZW A;  1KDA A;  1IBL Q;  2H4O A;  2PMZ E;  3K5M A;  2D9U A;  4ILW A;  1I4Q A;  4B3R L;  3I90 A;  4F8M A;  4A3G H;  2BH2 A;  3MXP A;  3LWE A;  5G3L D;  4DR1 Q;  1QNK A;  1X3G A;  4FXK C;  4HMI A;  2RVL A;  2CH4 A;  2NVT B;  3J7Z C;  4KHV A;  1ILQ A;  4GN5 A;  4HIK A;  2K4K A;  2MHV A;  2A74 C;  3HKZ E;  3EA6 A;  1PRT B;  4AYB G;  1MHW C;  2CHB D;  3OSO A;  4P75 A;  3HKS A;  3GTP B;  1KRT A;  3I2Z A;  4DNR B;  2NVX H;  2Q2I A;  5C4X B;  4LF7 L;  1B8A A;  2XN9 C;  1YNN D;  4AQY L;  1X54 A;  5EPJ A;  5M5W B;  1YJ9 A;  4A3I G;  3IFT A;  3ULJ A;  4P74 A;  3GTG B;  4XQN A;  4A3B H;  2QEJ C;  4FF2 A;  3NWT A;  1H9R A;  1UE1 A;  2IL8 A;  3TP7 A;  3CRK C;  4XQQ A;  2F0S A;  5IOD A;  2EIF A;  1PFN A;  4HR7 B;  2R93 G;  5DEH A;  4A3M G;  1L0Y B;  2C5C A;  1ILP A;  1O78 A;  2Z6K A;  5CV5 A;  2UUC L;  2R7Z H;  2KHS A;  3DLL A;  4HJ9 A;  1FJG Q;  1R4Q B;  2N88 A;  1CQF A;  2F4V Q;  1BBU A;  3FHW A;  5FJ8 G;  2OQ0 A;  1PRT F;  3CQZ B;  3MXU A;  2DNE A;  3K8A A;  1SNO A;  5LMN Q;  4FF1 A;  3KDF B;  3O13 A;  3A8J E;  3U4Z A;  4AYB E;  1XPR A;  2E5L Q;  1FR3 A;  1EU4 A;  3H09 A;  4DV5 Q;  4OON A;  1IBM Q;  5KNC A;  4R4I A;  2Q2U A;  1JC7 A;  1KQS A;  2VNU D;  1PRT C;  1J5E Q;  1OXV A;  2R6G A;  3AQQ A;  4K8J A;  2SOB A;  1HPC A;  1CQV A;  3A5Z B;  1Y1W H;  1PH3 A;  1H9K A;  2NUC A;  1OXS C;  1GVP A;  4TRD A;  1PTO B;  5IY0 A;  2JA8 G;  3SXH A;  2ZT9 C;  3T1Y Q;  1K3B C;  2DGY A;  2ZXO A;  1L0X B;  4IN3 A;  2I5L X;  3HOY G;  3J81 j;  3PIO 3;  4TSS A;  1I4H A;  4PG3 A;  2A69 D;  4G7O C;  5M3M B;  1VMC A;  2ES2 A;  1A2U A;  1VQF A;  3C1F A;  4R4T A;  1YJN A;  1D7Q A;  5EKL A;  3JAM c;  4AIM A;  4GNX B;  2F0Q A;  2MP1 A;  4C2M B;  4BS9 A;  5JAV A;  4G57 A;  3KLR A;  1IBL L;  1LTT D;  1QIL A;  1C9O A;  4POG A;  3RD4 A;  4WJ3 M;  3L2P A;  1FVI A;  3STB D;  1I6H B;  1SMY D;  1LUZ A;  1LTL A;  4JYA Q;  4DR1 L;  1LT6 D;  1J9O A;  3E5S A;  4LF9 Q;  1WYD A;  4A3I H;  4HJ7 A;  5EQ0 A;  1PTO F;  1VQP A;  4A3F G;  2VS1 A;  3U58 A;  3DM3 A;  4LF6 Q;  4JI2 L;  1CT1 D;  1H9S B;  2G5D A;  2R93 H;  4A3M H;  1GOZ A;  4R4C A;  1PYS B;  4RWS C;  1S5C D;  3A8I E;  1I4X A;  2F0E A;  3PF5 A;  1ICW A;  1KXL A;  5EBD A;  3HOU B;  2EJF C;  1EQT A;  2LXJ A;  1YJW A;  1S72 A;  1NR2 A;  1LAC A;  3BZK A;  2EYP A;  2OQK A;  4P2C B;  5FJ8 H;  2WFW A;  1EEI D;  5LMU Q;  1E22 A;  1EY9 A;  2EY2 A;  2OT2 A;  3SEB A;  4PZ8 A;  2B39 A;  1T9H A;  3KJP A;  1KTK A;  4DR7 Q;  2NBF A;  3U4V A;  5C3W A;  4YCV A;  4J15 A;  3BDC A;  3H15 A;  5J22 A;  4G7H C;  1UE6 A;  5CV6 A;  1FJG L;  2RDF A;  2XVS A;  4O0A A;  5COR A;  1LTA D;  2R7F A;  4DNT B;  1KNE A;  1E1T A;  3D8G A;  1YHQ A;  5LMN L;  4WOR A;  2HIX A;  1TKW B;  1F2Y A;  1PLF A;  2JA8 H;  1EZ8 A;  2EOT A;  1WI5 A;  4DV5 L;  1CKM A;  1BQQ T;  1W6J A;  2WB1 E;  1IBM L;  3HOY H;  1HNW Q;  5C4X G;  1Y8N B;  4PMW A;  1B44 D;  1J5E L;  3KLS A;  1NJI C;  1IW7 C;  1Q7Y C;  1V43 A;  3MA2 B;  3TZD A;  1PFS A;  1F77 A;  1IKM A;  3FDT A;  1NMF A;  2RDH A;  1PH7 A;  2Z1C A;  3D31 A;  4ZAI A;  1BNZ A;  3T1Y L;  4EQN A;  4X3U A;  3I4L A;  1TS5 A;  3PCO B;  1NBW A;  1QUQ B;  1VQM A;  4RFB A;  2NZ1 D;  2UUB Q;  2KOL A;  1UE7 A;  5IIF A;  2KED A;  2NZH A;  3FP9 A;  4L8J A;  3F1Z A;  1LT5 D;  4WJ4 A;  1MJC A;  2B2T A;  1PXU A;  1SYG A;  4DU9 A;  2AUJ D;  2AUK A;  4A3F H;  4JI1 Q;  1NAP A;  3EIV A;  1TR5 A;  2E8G A;  5C0X G;  1TWC H;  3E6Z X;  5FO9 B;  3M3Y H;  3UI2 A;  3G6E A;  4P72 A;  3HP3 A;  4HJ8 A;  4GOP C;  4KY7 A;  4LF9 L;  1RTO A;  2CKZ B;  1Q8K A;  4V0B A;  3K57 A;  3A0J A;  2L15 A;  1BF4 A;  4LF6 L;  1OXT A;  1N36 L;  4DUY Q;  4DAV A;  1MSH A;  2C9O A;  2NTT A;  2Z0S A;  2GN5 A;  4QL5 A;  1PRT D;  3K5N A;  3T1H Q;  2IHF A;  1JJG A;  4P73 A;  2XNA C;  1JJ2 A;  2D0O A;  5M3M G;  5H1S E;  1M90 C;  4X62 Q;  2J0T D;  4Q0F A;  5IGD A;  5C0X I;  5M3F B;  2NVT H;  5IYB G;  5LMU L;  4DFA A;  3TEH B;  2JYO A;  3P7J A;  5K5P A;  1G6P A;  1ENC A;  1A3V A;  2N49 A;  1XNR Q;  4DR7 L;  1K3R A;  1K8G A;  3BYY B;  3GTP H;  3CU7 A;  5C4X H;  4GOP A;  2KCN A;  2KEE A;  3KFU A;  4Z9C B;  4HTH A;  1F9Q A;  2CH4 W;  4K5W A;  3GTG H;  5AJ3 L;  1QVC A;  1H95 A;  2UXC L;  4XIG S;  1KNA A;  2MO1 A;  2HD3 A;  4MIU A;  3CCM A;  2X6G A;  1HFN A;  3DWA A;  4L5Q A;  4CJ0 B;  1PZI D;  1SFO B;  4CDE C;  2FXQ A;  1ESR A;  4LFC Q;  1WFQ A;  1EWH A;  1GUO A;  4KD4 A;  1JB7 A;  4A3L G;  1HNW L;  5JJL A;  3HOU G;  2F0P A;  2K6A A;  1NE3 A;  1CHP D;  5M5X B;  1LTG D;  4LW1 A;  1MBY A;  2K5D A;  3QIA A;  2EYH A;  4A3K B;  1XJV A;  2PPB C;  2OXP A;  2IX1 A;  1SR3 A;  3CQZ H;  1XMO Q;  4DR3 Q;  4CBV A;  3RLO A;  3VR6 A;  4NXM Q;  1V9P A;  3OHX C;  5D3I B;  2B8F A;  5C0X H;  1DZ1 A;  4HSV A;  5I6W A;  2WKC A;  1KIX A;  1S5B D;  1YZ6 A;  4P71 A;  1VS0 A;  5KGU A;  2UUB L;  1PH9 A;  1K0S A;  3P20 A;  3L3O C;  4RGT A;  3VA5 A;  3R2I A;  4JI5 Q;  4HN7 A;  1U4M A;  2IY5 B;  3D6C A;  2H1E A;  1GHJ A;  4JI1 L;  4EVO A;  2Z4H A;  2R92 B;  2F0I A;  3HOW B;  1PTO H;  1EIH A;  2QIL A;  2RSO A;  2FHT A;  1SDF A;  2CFM A;  1SYB A;  2KEC A;  4J6H A;  5F2D A;  3SK4 A;  3HRZ C;  5M3M H;  4QIW B;  4HJA A;  4K0K Q;  2PQE A;  3TSS A;  4PMC A;  3CKI B;  1BXT A;  1U4R A;  1GXD C;  4CKE A;  4JI7 Q;  3I73 A;  2MO0 A;  5T1I A;  4QUC A;  2PCF B;  5IYB H;  3ULL A;  4ODG A;  2RKS A;  4C2M H;  4IUP A;  4LFB Q;  4DUY L;  5EKK A;  3S16 B;  2PW7 A;  3LX0 A;  2BE5 C;  1AZP A;  1T5E A;  4KV6 A;  1BBW A;  3T1H L;  1WTX A;  5DNF A;  1JWS D;  1I6H H;  1O7L A;  3K5O A;  4X62 L;  2ZTC A;  2F52 A;  4GKK Q;  2KHI A;  2CQO A;  1AE2 A;  1E3P A;  2D0P A;  2H5X A;  1QB5 D;  4KLK A;  4A3L H;  3M4O B;  4IOA A;  2EPB A;  3HOU H;  2NWG A;  4KHZ A;  5E1F A;  2R3Z A;  1LYL A;  3J80 L;  4MZ9 A;  5CYU A;  1D6E C;  4IUU A;  2QEX A;  1HUM A;  3HZX A;  1NUC A;  3SHL A;  4YWL A;  1B2T A;  1ZXT A;  1CUK A;  4CKB A;  1E0B A;  3HOX B;  3SK5 A;  1EZ6 A;  1RDP D;  1GUS A;  2F0O A;  4LFC L;  2JJQ A;  2Z4I A;  1DON A;  2YTY A;  4BY1 B;  2VQE Q;  3CCS A;  4CKC A;  4B3T Q;  1A6X A;  4DV6 Q;  1C0A A;  1YHB A;  4RA8 A;  3NTI A;  2VW9 A;  1JIC A;  1I4P A;  1PV4 A;  4IUV A;  1UEB A;  1XMO L;  4DR3 L;  4IFD J;  4NXM L;  2E2I H;  3A5U A;  3TN2 A;  4GLV B;  1I6V C;  2Y0S B;  4LF5 Q;  3DEO A;  4HID A;  4I65 A;  1EY0 A;  3SVM A;  4DAY A;  3QR8 A;  4EQ5 A;  5L37 A;  4PV1 C;  2J7Z A;  1CKN A;  2IWH A;  1HR0 W;  3KF6 A;  4CJ2 C;  2VXW A;  2EYJ A;  4C1N K;  2ZJQ A;  5JJZ A;  3EQL C;  5GQO A;  2KCT A;  1X6O A;  1VQ8 A;  2VY3 A;  3G48 A;  4X6A H;  3QWN A;  4DXF A;  3CCQ A;  5A2Q L;  5E7N A;  4A3K G;  2HCI A;  3I4M B;  4K0K L;  4OIK A;  3MXN A;  2A6E C;  1X3P A;  3NBH A;  1C8C A;  5T1G A;  4H02 A;  4JI7 L;  2YV5 A;  4K5X A;  4LFB L;  2PYK A;  2UXB Q;  2BOS A;  1K28 A;  2R7D A;  2MJ8 A;  3CME A;  1MKH A;  1P16 A;  3TP8 A;  4KK7 A;  3ND9 A;  3S1Q B;  4KHP Q;  1A3U A;  3HOZ G;  2K05 A;  2XSC A;  4FVM A;  4JI0 Q;  3QOJ A;  4GKK L;  3HOV B;  1V1Q A;  1NNX A;  1QE6 A;  3BS1 A;  1EY5 A;  3E9I A;  2R92 G;  3HOW G;  1LTB D;  4APV A;  2EQS A;  1FGU A;  5JEA J;  1AEX A;  4A3E B;  2O2L D;  1SYD A;  5ELC A;  1JE5 A;  3X3M A;  1C4Q A;  1EIY B;  2WV6 D;  4KTA A;  2A73 B;  2FJ2 A;  3NHH A;  2JP1 A;  2K04 A;  5IP9 G;  3E3X A;  4GN4 B;  3PGZ A;  3GTK B;  1VF5 C;  2PZU A;  4UAI A;  3WOF A;  3GTQ H;  1SE2 A;  1PFM A;  3OMC A;  3C3L A;  4RGM A;  1VQI A;  3S2D B;  4LF8 Q;  4BA2 I;  2VQE L;  3F2B A;  1E2Z A;  5CBE E;  3X3N A;  4DV6 L;  4XXE A;  3SDZ A;  1S4Z A;  3W1B A;  4RKL A;  4ME5 A;  4HSP A;  2DY7 A;  1L1O B;  1UE5 A;  3S2H B;  2L5T A;  1S5E D;  2BE5 D;  1Q81 C;  2I07 B;  4OWT B;  2AWN A;  3GV6 A;  1SFO H;  1O7Y A;  1FD7 D;  2AMC B;  1QVF A;  4KKS A;  1JT8 A;  1G8Z D;  4QIW E;  5M5X H;  1SYF A;  4A3K H;  1Y14 B;  2HDM A;  3FPP A;  3KLW A;  4R8I A;  2OTJ A;  3HOX G;  3Q24 A;  5C6A A;  1RTN A;  3ZYY X;  4EQO A;  1SE4 A;  2HT1 A;  1WTR A;  3GTM B;  4RCN A;  4BY1 G;  5GAG C;  5C44 B;  1R9T B;  2ZM6 Q;  3HOZ H;  1VQK A;  2O4X A;  3F8T A;  2VB3 X;  3D4W A;  4JI2 Q;  4ZLT F;  5IGB A;  2C35 B;  2PW5 A;  4DNI A;  1PA6 A;  1K83 B;  2O5I C;  1YIJ A;  1JMC A;  1A62 A;  2R92 H;  2EY5 A;  3HOW H;  3SK6 A;  2BCO A;  2SEB D;  4LMQ D;  1L1O C;  5I9O A;  2UXB L;  4BY7 B;  3I4N B;  1HTP A;  1VMP A;  4H13 C;  2G9H D;  2JA7 G;  2Y0S G;  3OYY A;  1XTD A;  4OGQ C;  4YIJ A;  1K0R A;  1GUT A;  4KHP L;  5ELN A;  3PUY A;  3MC0 B;  3FRP B;  5JVH 3;  4A3C G;  1PH5 A;  4JI0 L;  2EY1 A;  1PHJ A;  1EQQ A;  1EYD A;  5IP9 H;  3VR5 A;  1JJC B;  2F3V A;  2RCF A;  3RZD B;  4BBS B;  2KCM A;  4DK3 C;  3S16 H;  2K03 A;  1FYC A;  4DKA C;  1TWH B;  1MIU A;  4OEM B;  2K28 A;  2TMP A;  4FDB A;  4QGU A;  3I4M G;  4NDX A;  3H3V H;  3K7A B;  4LUV A;  4DPG A;  1KD1 C;  1PH1 A;  2RQX A;  3KUP A;  4TVA B;  4C3I B;  1Y8O B;  4HCE A;  5J3B A;  4Y7N B;  1DYQ A;  3NP8 A;  1D2B A;  1XYI A;  2Y0S E;  4IAL A;  1TS3 A;  4QJF A;  3M4O H;  4LF8 L;  3J7A F;  3S14 B;  2A6E D;  2DJG C;  3AYH B;  3GQB A;  2ZJR A;  4DV3 Q;  3Q23 A;  2E2H B;  3CCL A;  1STN A;  1Q46 A;  3HOV G;  2QKI C;  2E74 C;  2PQA A;  4R4Q A;  5C3E B;  1SRO A;  2LKV A;  3J81 i;  4H0L C;  1VQG A;  1EFW A;  3CHB D;  1KC8 C;  3HOX H;  2GVB A;  1S3O A;  3V2T A;  5I6Y A;  2N8N A;  2Z9H A;  4A93 B;  2YTV A;  2X69 A;  1UEA B;  2Z6B A;  4RGO S;  5KRU A;  4A3E G;  4BY1 H;  1EOV A;  4KY6 A;  3HS0 C;  4JBM A;  2NVQ B;  3CC7 A;  1Q82 C;  1SXT A;  3CPW A;  2Q8R E;  5J1Z A;  3I91 A;  4AH6 A;  2MQH A;  3UDG A;  1VQ6 A;  3FEW X;  1PDQ A;  3HG9 A;  5FKA C;  3GTL B;  4NW2 A;  2JA7 H;  1IBK Q;  1TWA B;  2X6L A;  1B4O A;  2ZM6 L;  4CHT B;  1U0L A;  2NB0 A;  1XMQ Q;  3EBE A;  4A3C H;  3W3A A;  1WD1 A;  1N36 Q;  4MN3 A;  4MTK A;  1SBB B;  3Q8D A;  4FXD A;  2JA5 B;  4UP9 A;  4IOC A;  3BG3 A;  4L6T B;  1PVO A;  3J80 E;  1PTO C;  3C1E A;  1X32 A;  4PQX A;  3U9S A;  5LHY 1;  3T51 B;  1M1K C;  3OPO A;  5J39 A;  3GTO B;  2UUA Q;  4GS3 A;  2JQO A;  3I4M H;  3FKI B;  2PI2 E;  3PV0 A;  3KOJ A;  1EY8 A;  4K6D A;  4N9P A;  3GD7 A;  4GNX C;  1J8I A;  1ASY A;  1PYW D;  1JOQ A;  2KQ3 A;  2NYZ D;  2HHH Q;  3GTJ H;  1Q8I A;  4HMJ A;  1L0W A;  3PUW A;  4RGN A;  4QUF A;  1GUG A;  3A8K E;  1LT3 D;  1EY7 A;  5C44 G;  5AJ3 Q;  3S1Q H;  2UXC Q;  4RG1 A;  1TQO A;  1VQD A;  2OWO A;  4B3S Q;  5GAH C;  1N33 Q;  4DK1 A;  3HOV H;  4HJ5 A;  1ROD A;  4ZUJ A;  5IYC G;  4ABN A;  5HY6 A;  3F2D A;  4UDU C;  4BY7 G;  4YWK A;  3I4N G;  2F0K A;  4CDD C;  4ALP A;  1LTR D;  1Q1B A;  2NVY B;  3UE1 A;  4YY3 Q;  1RL2 A;  4A3E H;  4A3D B;  4MHE A;  1SN8 A;  1Y8P B;  1CA5 A;  1MSG A;  5CV7 A;  1BR9 A;  3T56 B;  4DV3 L;  2XGT A;  5M5Y B;  2F0H A;  1NY4 A;  3M9B A;  3TQY A;  5HGQ A;  3J7Y W;  4BBR B;  3M4Y A;  3NTK A;  3GTK H;  4BBS G;  1CHQ D;  3NEM A;  1QCB D;  2PNR C;  1PH4 A;  3K59 A;  2XTI A;  3PSI A;  3BDL A;  1AW7 A;  2KHJ A;  3S2D H;  3MHB A;  4C3H B;  5LL6 X;  3S17 B;  1ML0 D;  3IRB A;  3A55 A;  2NZO A;  1I94 Q;  3NTH A;  2BA0 A;  4JK1 C;  4KY5 A;  1H9M A;  2JK8 A;  1YNX A;  3S2H H;  1YEZ A;  4ZUI A;  4C3I G;  1N9W A;  4YHH Q;  5ISR A;  3ERO A;  3CC2 A;  1BUV T;  2VUM B;  3SE0 A;  1IBK L;  4DAP A;  1RJT A;  4A3J B;  1GJX A;  4GN3 B;  2IJ0 A;  5D3D A;  1LV9 A;  4JBK A;  4OX9 Q;  1XMQ L;  1JOR A;  3BDO A;  3U9O A;  2N55 A;  1F2M A;  2AWO A;  5C3E G;  2P5Z X;  4KKU A;  3FMC A;  1BCP B;  3CCR A;  4K6L A;  1E24 A;  3J80 c;  2QDB A;  4FO2 A;  4JI3 Q;  3GTM H;  4A93 G;  3MEH A;  2QDL A;  5C44 H;  1R9T H;  1O7Z A;  2UUA L;  1DOL A;  4ZRZ A;  3R8B A;  2UU9 Q;  2F0D A;  2BA1 A;  2Q8T A;  2DUD A;  4XT3 B;  1V1P B;  1GO3 E;  1KLU D;  1X56 A;  1K83 H;  3AU7 A;  3NQT A;  1SNM A;  3RLF A;  5FLM G;  5IYC H;  1QZH A;  2HHH L;  5C0X J;  4BY7 H;  3I4N H;  3H94 A;  5IOC A;  5M5W H;  4PZ7 A;  1II3 A;  1QG7 A;  4CDC C;  4O42 A;  4JBJ A;  2B2U C;  3MVV A;  4JBW A;  3U50 C;  1HUN A;  2KJX A;  1HRJ A;  1TII D;  4B3S L;  1BCP F;  3AFP A;  2IX3 A;  3E0E A;  1N33 L;  1HA6 A;  4UPA A;  2ZTD A;  2VQF Q;  2ZXR A;  4X65 Q;  3IAY A;  4R1J A;  2JA5 G;  3HFZ B;  2JEB I;  3TS2 A;  1SJE D;  3JAM i;  4BBS H;  1A63 A;  2Q2H A;  2V1C C;  4YY3 L;  1QUQ A;  1TWH H;  3S1N B;  4GLX A;  5HGT A;  3QJY A;  4L63 B;  2GA4 B;  3S24 A;  2Q8I B;  5C5L A;  1B50 A;  1X3Q A;  1Y1V B;  3FKI G;  3NQI A;  3I7F A;  2B2W C;  3K7A H;  4DV4 Q;  2RHS B;  3NPP A;  2JN4 A;  1STE A;  1PTO D;  1YNJ C;  3KF8 B;  3CF5 A;  3VR4 A;  2L11 A;  4C3I H;  4LUZ A;  3PUZ A;  2XIW A;  3TME A;  1IHZ A;  3ERQ A;  1TVX A;  3OW2 A;  2B2U A;  4IPG A;  5JJK A;  2WKD A;  3G71 A;  4IJL A;  1MJE A;  1KLG D;  4DA2 A;  3S14 H;  1I94 L;  4OO1 G;  4RCO A;  2I5H A;  2VB2 X;  2K32 A;  2E2H H;  2LMC B;  1TS4 A;  3I8Z A;  2EJG C;  4LWC A;  5C3E H;  3ERS X;  3RNU A;  4HIM A;  1VQE A;  3BZD B;  4WFN 3;  4YHH L;  3CPF A;  4JI4 Q;  1JQY D;  1SYC A;  3OWE B;  4MNO A;  4JV5 Q;  4A93 H;  4A3D G;  4BWG B;  4KKT A;  4QMG A;  1TY0 A;  1CZG A;  3J7A 5;  3TP5 A;  2NVQ H;  1U9R A;  5DLQ E;  2IT1 A;  4OX9 L;  2NVX B;  3OIQ A;  2B2W A;  4QCL A;  4DGZ A;  2JA6 B;  4BBR G;  3ND8 A;  3LWU A;  4XQJ A;  3TRE A;  5FLM H;  1EYG A;  4HIO A;  2K5V A;  1AP0 A;  4DR5 Q;  2F0G A;  2WIN B;  4ZCK A;  4JI3 L;  3GTL H;  4DR4 Q;  4ZQ3 A;  2K5N A;  5IGF A;  4DR6 Q;  5BN3 A;  1TWA H;  2KVM A;  4C3H G;  1FGB D;  1LTS D;  2UU9 L;  5I4D A;  1BBX C;  4QY7 A;  5C5M A;  1HXY D;  1WJJ A;  2A8V A;  2JA5 H;  3I3C A;  3NBH B;  1C7Y A;  4TKO B;  2E76 C;  4IFD G;  1S40 A;  4ZKC B;  1FNW A;  1CI3 M;  2VUM G;  2ENB A;  2TSS A;  5G3L F;  5TSS A;  1EEF D;  1SSO A;  4A3J G;  4FF4 A;  1YIT A;  4KJN A;  3HKZ B;  5IWA Q;  2KEN A;  1QWY A;  4F87 A;  1UNS A;  3FKI H;  2LY7 A;  4DV0 L;  2VQF L;  4X65 L;  2AKW B;  2A6H C;  1Y1W B;  1STB A;  4LUO A;  2JA9 A;  2VZA A;  1EUJ A;  3FPU B;  3MFY A;  4JI6 L;  5M3F G;  2EYL A;  2F0L A;  4OO1 H;  2ASB A;  2EYM A;  2B2Y C;  1EFI D;  3H3V C;  4DV4 L;  1UWV A;  5CV9 A;  2GVA A;  1R4P B;  2D2C C;  2QA4 A;  3PMF A;  2QW7 A;  1X3E A;  3A54 A;  1IL2 A;  2MPM A;  2NVY H;  3BU2 A;  3T53 B;  4A3D H;  2V4D A;  4RMF A;  1I4R A;  5I2X A;  1M8A A;  1IKL A;  1SND A;  1VQL A;  1NR4 A;  3RLN A;  1PMR A;  2R61 A;  1TWG B;  1KRS A;  4F7X A;  1D5Z C;  4IQZ A;  4BBR H;  5JOB A;  2CWA A;  4RHS A;  4UY8 C;  3G6J B;  1I4G A;  3NK9 A;  1BO0 A;  1F2Z A;  4JI4 L;  4C56 C;  1EOT A;  4JV5 L;  4YWM A;  1HH2 P;  5GAE C;  1B70 B;  3S1R B;  4C3H H;  3S17 H;  1WTH A;  4HCS A;  2B2Y A;  2FMC A;  2EYO A;  3NWS A;  1Y1V G;  2K01 A;  2ALY B;  1IXR A;  4PZ6 A;  4JI8 Q;  5E3F A;  1ZYR D;  1DCZ A;  3UDI A;  1GM5 A;  1IYJ B;  1ZEQ X;  4DR5 L;  4IFD H;  1WCM B;  4DR4 L;  2K33 A;  4DR6 L;  1WTP A;  4B9X A;  2VUM H;  2YYZ A;  4U68 A;  1Q1E A;  5IGE A;  3NXW A;  4XTC S;  4A3J H;  1WD0 A;  1MI2 A;  2XRS D;  1A8V A;  3UDF A;  3AB9 A;  3CMA A;  3RN2 A;  1YNJ D;  4M1U B;  1ICF B;  1CFM A;  4IUN A;  2RDG A;  4HED A;  3W2D A;  1SNC A;  4LNQ A;  1EYC A;  1STY A;  2D62 A;  5IGC A;  3NEL A;  5FO8 B;  1LAB A;  5FLX L;  2N78 A;  1Z6H A;  2A19 A;  1O7I A;  2F0V A;  3I4O A;  2E2D C;  5IWA L;  5M3F H;  2FMM A;  3S1M B;  3NBI A;  1A2T A;  1PZK D;  4LFA Q;  1ASZ A;  3C46 A;  3B6Y A;  4R9W A;  4DR2 Q;  1T5X D;  2JA6 G;  1HFG A;  3CW2 C;  3N6R A;  1VQA A;  1VQN A;  5ELO A;  1C48 A;  1WTV A;  1EY6 A;  1XX8 A;  3KBX A;  2CCZ A;  1UAP A;  1FNU A;  3BZC A;  5BR8 Q;  1E7Z A;  4K2K A;  2RSN A;  3K7U C;  3K58 A;  3QG1 A;  2SNM A;  3LGJ A;  1MD2 D;  3NEN A;  3A56 A;  1RHP A;  3RN5 A;  4XT1 B;  4LJZ C;  4IUT A;  3J7A V;  4L5R C;  1PH6 A;  1TY2 A;  1XTC D;  1XPU A;  1IYV A;  3S1N H;  2I5M X;  1RCV D;  3HKZ G;  1VQ4 A;  1TWC B;  3M3Y B;  1HJP A;  1Y1V H;  2EYF A;  1N34 Q;  2WB1 B;  4QB4 A;  1OTC A;  3I56 A;  5LL6 S;  4DUZ L;  4LAA A;  2QCP X;  4O1N A;  3CCE A;  1EL0 A;  1GD7 A;  3H3V I;  1IYU A;  5CMD A;  2EJM A;  2ICE C;  5A35 A;  1U5K A;  4C3J B;  1AZQ A;  4Y52 H;  1JOO A;  1D1K A;  1B1Z A;  4TQU S;  3VYR A;  5EAY A;  1AE3 A;  3AFQ A;  1I3Q B;  2Z6K C;  4JI8 L;  2F3I A;  4L5S A;  4IPD A;  1EQR A;  2EY6 A;  2LSS A;  2LFN A;  2L4N A;  2A6H D;  4XDX A;  3ZJY C;  4NB3 A;  3G7L A;  1ENF A;  4ZKB B;  3K5L A;  2A1A A;  5COY A;  1CSP A;  1SE8 A;  4PMB A;  1J6Q A;  3VA7 A;  1HZ9 A;  2K7V A;  4I7A A;  3IFD A;  3DEP A;  2XWB B;  5DM7 3;  4GLA C;  1KHI A;  1SEB D;  2PI2 A;  2RBM A;  4N9T A;  1H9J A;  2JA6 H;  3J81 L;  2O5J C;  3M85 A;  1B53 A;  3Q6S A;  5M9O A;  1LO5 D;  1YI2 A;  4KN4 C;  3NE5 B;  3OIP A;  5GRO A;  2K5Q A;  3SK8 A;  3CCV A;  3BJU A;  4DAM A;  1OXX K;  4LFA L;  4M8A A;  2I46 A;  2D5D A;  1L1O A;  1HNZ Q;  4DR2 L;  3VYU A;  1EWI A;  2F3W A;  3KK7 A;  1G51 A;  3K6O A;  1HHV A;  2KA7 A;  3PO2 B;  1X65 A;  1WCM G;  3VYS A;  2J4X A;  3AMU A;  3L9A X;  5BR8 L;  3H91 A;  5LMN W;  1CKO A;  3MZ5 A;  5BN5 A;  4IUQ A;  3C2P A;  3S9W A;  5DAU A;  2N3S A;  5I9P A;  4FNF A;  2JEA I;  2HDL A;  4K5V A;  2IHE A;  1VQ9 A;  1U4L A;  1HZB A;  4CDF C;  1B3A A;  4H44 C;  2IX0 A;  2L12 A;  2WII B;  4O2D A;  2UXD Q;  1Z47 A;  1OO9 B;  4NKL A;  4RKB A;  3PQI A;  1ONL A;  3DWP A;  4H7B A;  3V05 A;  3PIO A;  1VF7 A;  3UDX A;  4YCU A;  1HZA A;  3KLS X;  1BVS A;  4JVZ A;  3EFX D;  4ZYS A;  4A75 A;  1NSN S;  1WOC A;  3CCJ A;  2L1B A;  1E1O A;  1N34 L;  3T16 A;  1B9M A;  1TU2 B;  2ZTE A;  2K50 A;  2L0C A;  3H0G B;  2M2L A;  1D5X C;  1GKH A;  4ME3 A;  4JC0 A;  3TBI B;  1TT2 A;  5IT9 L;  1EY4 A;  4NPS A;  1S5D D;  2B29 A;  5FO7 B;  5ELD A;  5I2Y A;  4LF4 Q;  1N8R C;  1JB3 A;  4OXP A;  2A68 C;  4RHR A;  2WAC A;  4OL7 A;  4YCW A;  1KDB A;  3MXG A;  2ID0 A;  3CC4 A;  1O80 A;  1YVC A;  1TWG H;  3GDE A;  2PO4 A;  3MEF A;  2K52 A;  1GUW A;  3M4P A;  2XWJ B;  5CGK A;  1DXM A;  2A5H A;  2CVR A;  3JC6 6;  3ITP A;  1VQJ A;  1EU3 A;  5BN4 A;  4B08 A;  3S1R H;  4MTN A;  3KDF A;  2EVB A;  5ELB A;  5JPN C;  1RKN A;  4FXG C;  1HQR D;  1X9N A;  2WB1 G;  2CWP A;  1PZJ D;  1QZG A;  3MTS A;  5HUR A;  1XXG A;  1TXY A;  1D8L A;  4UP8 A;  4C1N I;  3GO5 A;  1L2F A;  2F0F A;  3KBG A;  4XYQ A;  4C3J G;  1WCM H;  1STH A;  1N32 Q;  1KAW A;  1F2L A;  1STG A;  2WAQ B;  5D65 A;  4K14 A;  4KMU C;  1BKB A;  5KYL A;  1EWC A;  2L55 A;  1HNX Q;  3L0O A;  1HNZ L;  5C4J B;  1I50 B;  2RA4 A;  2F4V L;  4HAE A;  2AQ2 B;  2B2T C;  3TDQ A;  1V1O A;  5C4Z A;  1DGS A;  2E2I B;  2JXM B;  4GOP B;  2AHO B;  3M4Q A;  2ZXP A;  2OEO A;  1CTM A;  4RH6 A;  4GNX A;  2E5L L;  4KD3 A;  4KJO A;  1PH8 A;  3S1M H;  5D14 A;  1GUN A;  2LS0 1;  4X66 Q;  2B3G A;  2MGS A;  5A2Q E;  2HQL A;  5EBC A;  5C3X A;  4LK1 C;  4DK0 A;  2UXD L;  1F9P A;  1LLR D;  3TZU A;  1X55 A;  2HCC A;  3T13 A;  4OHJ A;  1VQ5 A;  3RMH A;  1BDO A;  3H6M A;  4B9W A;  3PO3 B;  1KL9 A;  2E2J B;  3TP6 A;  4JG2 A;  1W6K A;  3CRL C;  1H9S A;  1YHA A;  1CK1 A;  4G7Z C;  4B3M Q;  2K1B A;  2YTX A;  5CV8 A;  3T4A C;  5EPL A;  2EZV A;  5IP7 G;  1KAA A;  5CBA E;  3PUV A; 
#chains in the Genus database with same CATH homology
 4X3S A;  1ENA A;  4DF7 A;  1D1I A;  2YU9 B;  1JWM D;  1Z7T A;  1WTQ A;  1Q12 A;  3ONA B;  3NSW A;  1WTW A;  2QF7 A;  1SNQ A;  1UUP A;  2HQE A;  1WVL A;  4IZ8 A;  3DHQ A;  1DOK A;  3F2U A;  5FLX E;  3OMG A;  3D4D A;  2E75 C;  3DM1 A;  1ESF A;  2BDN A;  3JAM L;  4ID6 A;  3RZO B;  2KCC A;  1TWF B;  3S15 B;  1IL8 A;  3IKJ A;  2IW3 A;  2NTS A;  1ZKO A;  4DN4 M;  5EPK A;  1K8M A;  4J8Q A;  5CV4 A;  4KN7 C;  3WOE A;  1JOK A;  2PZW A;  3DXJ C;  5CC4 A;  1VDZ A;  3QB3 A;  3FVQ A;  5K36 G;  2B2V C;  4ULL A;  3GTQ B;  4V19 0;  2M9V A;  2K5W A;  4PNY A;  3OWF A;  4NP5 A;  1ZYR C;  2EE1 A;  4FP5 D;  5AFW A;  2IPK D;  1G2S A;  3V96 A;  2CQA A;  4X3K A;  1BCP C;  2EXZ A;  1Q3L A;  2NN6 G;  3D3R A;  2A68 D;  2B63 B;  2FFK B;  3DUZ A;  1HA5 A;  1F9R A;  3NUC A;  3VYT A;  1RD9 D;  1A15 A;  1SAP A;  2B2V A;  3Q22 A;  4A3G B;  3I70 A;  1SNP A;  1SJH D;  2HUG A;  1JWU D;  3VR3 A;  2KUM A;  1V8Q A;  1TS2 A;  2DY8 A;  3DWQ A;  2JSO A;  3HOZ B;  1E2V A;  1SYE A;  2NN6 I;  3OOC A;  4ZK9 B;  4Q5V A;  3K0Y A;  2F0N A;  5KEE A;  3OW7 A;  1ET9 A;  1E2W A;  3P75 A;  3MFG A;  4FYD A;  3J81 E;  5ELF A;  3QO2 A;  4A3B B;  5C4H A;  1V1P A;  2CW0 C;  1MGS A;  3BVM A;  2F0W A;  2L9H A;  4R8N A;  1M4V A;  1OXU A;  3P1H A;  3R2T A;  4OO1 I;  2JE6 I;  1B9N A;  1ET6 A;  4K8I A;  2PMZ B;  5K36 H;  3M7G A;  3DMU A;  1WTO A;  2R7Z B;  1G6Z A;  3VR2 A;  1EIG A;  1AN8 A;  2F0M A;  5NUC A;  1CM9 A;  2F0J A;  1IW7 D;  3D6W A;  3PUX A;  2EDG A;  2BDO A;  1XWE A;  1G29 1;  5DM6 3;  1BOS A;  2G9D A;  2NN6 H;  2F0T A;  4CGY B;  5KND A;  4U67 3;  2F1M A;  4K2L A;  4S3S A;  4G4K A;  1AFP A;  3EVQ A;  3KF8 A;  1GHK A;  1QNU A;  3HGB A;  4BA1 I;  1KDC A;  2XRQ D;  1LT4 D;  1CA6 A;  3A7A B;  4IFD I;  1YNN C;  1A3T A;  3MWY W;  1DJR D;  1G2T A;  2F4I A;  3GV3 A;  5ELE A;  4EGV A;  5IT9 E;  5FOB B;  3BVZ A;  4AYB B;  5CR3 A;  2AQ3 B;  1NCV A;  4OIJ A;  4XYO A;  5KIX A;  5JPM C;  1KAB A;  4DXG A;  5KNB A;  2JA7 B;  1HTL D;  3IL8 A;  4A3I B;  3Q0A A;  2DNC A;  4F88 A;  4KI0 A;  1S5F D;  1DD2 A;  2R93 B;  3PIP 3;  4A3M B;  1FNV A;  4EQP A;  5JEA G;  3SR1 A;  5IGG A;  3GP7 A;  3M7N A;  5E4W C;  1RF2 D;  3EJI A;  1STA A;  1BCP D;  1QOH A;  4J1M A;  1Q90 A;  1JE4 A;  5FK9 C;  3RUZ A;  3E0J A;  2ICI A;  1DOM A;  1JCK B;  3GTJ B;  4IUR A;  3N52 A;  2PZT A;  1QJO A;  2A69 C;  1D5M C;  3I72 A;  2SDF A;  1K8O A;  2WP8 J;  2OF1 A;  5EGT A;  1JR0 D;  2MUY A;  2SNS A;  3HEJ A;  2JA8 B;  2AQ1 B;  1DM0 B;  3HOY B;  4RAU C;  1HCZ A;  1G91 A;  3R3O A;  1PFB A;  1HQM C;  3LNN A;  3A7L A;  4X3T A;  5EKI A;  1SMY C;  5EJW A;  1LTI D;  3R93 A;  3MAQ A;  3BYT B;  2DN8 A;  4E6I A;  4GZY C;  4WJW A;  1U4P A;  4FF3 A;  5E4X A;  2CW0 D;  3BVG A;  3QOL A;  2M00 A;  4CJ1 B;  3WDN A;  1EYA A;  3L7Z C;  1EQV A;  4A3F B;  5KYI A;  2FIN B;  4NMZ A;  2B8G A;  5JEA H;  2Z8L A;  4I7Z C;  5JVG 3;  2F03 A;  3URY A;  1VCI A;  1F9S A;  3JAM E;  4QF4 A;  3D4R A;  4WRD A;  2F0U A;  1SE3 A;  1Y69 U;  1CZW A;  1KDA A;  2H4O A;  3K5M A;  2D9U A;  4ILW A;  1I4Q A;  3I90 A;  4F8M A;  3MXP A;  3LWE A;  5G3L D;  1QNK A;  4FXK C;  4HMI A;  2RVL A;  2NVT B;  4KHV A;  1ILQ A;  2MHV A;  2A74 C;  3EA6 A;  1PRT B;  2CHB D;  3OSO A;  3GTP B;  4DNR B;  5C4X B;  2XN9 C;  1YNN D;  5EPJ A;  5M5W B;  3IFT A;  3GTG B;  4XQN A;  2QEJ C;  4FF2 A;  3NWT A;  1H9R A;  2IL8 A;  3TP7 A;  3CRK C;  5IOD A;  2F0S A;  4XQQ A;  1PFN A;  4HR7 B;  5DEH A;  1L0Y B;  2C5C A;  1ILP A;  1O78 A;  5CV5 A;  2KHS A;  1R4Q B;  2N88 A;  1CQF A;  1PRT F;  3CQZ B;  3MXU A;  2DNE A;  1SNO A;  4FF1 A;  3O13 A;  3A8J E;  1FR3 A;  1EU4 A;  3H09 A;  5KNC A;  1JC7 A;  2VNU D;  1PRT C;  1OXV A;  2R6G A;  4K8J A;  2SOB A;  1HPC A;  1CQV A;  1H9K A;  2NUC A;  1OXS C;  4TRD A;  1PTO B;  3SXH A;  2ZT9 C;  2ZXO A;  1L0X B;  4IN3 A;  3PIO 3;  4TSS A;  1I4H A;  2A69 D;  4G7O C;  5M3M B;  1VMC A;  1A2U A;  3C1F A;  5EKL A;  2F0Q A;  2MP1 A;  4C2M B;  4BS9 A;  5JAV A;  4G57 A;  3KLR A;  1LTT D;  1QIL A;  3RD4 A;  1I6H B;  1SMY D;  1LT6 D;  1J9O A;  3E5S A;  5EQ0 A;  1PTO F;  1CT1 D;  1H9S B;  1GOZ A;  4RWS C;  1S5C D;  3A8I E;  1I4X A;  2F0E A;  1ICW A;  5EBD A;  3HOU B;  2EJF C;  1EQT A;  1NR2 A;  1LAC A;  2EYP A;  4P2C B;  1EEI D;  1EY9 A;  2EY2 A;  2OT2 A;  3SEB A;  2B39 A;  1KTK A;  2NBF A;  5C3W A;  3BDC A;  5J22 A;  4G7H C;  5CV6 A;  2RDF A;  2XVS A;  5COR A;  1LTA D;  4DNT B;  1KNE A;  3D8G A;  4WOR A;  1TKW B;  1F2Y A;  1PLF A;  1EZ8 A;  2EOT A;  1BQQ T;  1W6J A;  1Y8N B;  4PMW A;  1B44 D;  3KLS A;  1IW7 C;  1V43 A;  3MA2 B;  3TZD A;  1F77 A;  1IKM A;  3FDT A;  2RDH A;  2Z1C A;  3D31 A;  4ZAI A;  1BNZ A;  4EQN A;  4X3U A;  3I4L A;  1TS5 A;  4RFB A;  2NZ1 D;  2KOL A;  5IIF A;  2KED A;  4L8J A;  1LT5 D;  2B2T A;  1PXU A;  1SYG A;  4DU9 A;  2AUJ D;  2AUK A;  1NAP A;  1TR5 A;  5C0X G;  3E6Z X;  5FO9 B;  3UI2 A;  3HP3 A;  4KY7 A;  1RTO A;  4V0B A;  3K57 A;  1BF4 A;  1OXT A;  4DAV A;  1MSH A;  2C9O A;  2NTT A;  1PRT D;  3K5N A;  2XNA C;  2J0T D;  4Q0F A;  5IGD A;  5C0X I;  5M3F B;  4DFA A;  2JYO A;  3P7J A;  5K5P A;  1ENC A;  1A3V A;  3BYY B;  3CU7 A;  2KCN A;  2KEE A;  4Z9C B;  4HTH A;  1F9Q A;  4K5W A;  4XIG S;  1KNA A;  4MIU A;  1HFN A;  2X6G A;  3DWA A;  4CJ0 B;  1PZI D;  1SFO B;  1ESR A;  1EWH A;  1GUO A;  4KD4 A;  2F0P A;  2K6A A;  1CHP D;  5M5X B;  1LTG D;  1MBY A;  2K5D A;  3QIA A;  2EYH A;  4A3K B;  2PPB C;  2OXP A;  2IX1 A;  4CBV A;  3VR6 A;  3OHX C;  5D3I B;  2B8F A;  5C0X H;  1DZ1 A;  4HSV A;  5I6W A;  2WKC A;  1S5B D;  5KGU A;  3P20 A;  3L3O C;  4RGT A;  3VA5 A;  3R2I A;  4HN7 A;  1U4M A;  3D6C A;  2H1E A;  1GHJ A;  4EVO A;  2Z4H A;  2R92 B;  2F0I A;  3HOW B;  1PTO H;  1EIH A;  2QIL A;  2RSO A;  2FHT A;  1SDF A;  1SYB A;  2KEC A;  4J6H A;  5F2D A;  3SK4 A;  3HRZ C;  4QIW B;  2PQE A;  3TSS A;  4PMC A;  3CKI B;  4CKE A;  1BXT A;  1U4R A;  1GXD C;  3I73 A;  5T1I A;  4QUC A;  2PCF B;  4ODG A;  2RKS A;  4IUP A;  5EKK A;  3S16 B;  2PW7 A;  3LX0 A;  2BE5 C;  1AZP A;  1T5E A;  4KV6 A;  1WTX A;  5DNF A;  1JWS D;  1O7L A;  3K5O A;  1QB5 D;  3M4O B;  2EPB A;  2NWG A;  4KHZ A;  5E1F A;  2R3Z A;  3J80 L;  5CYU A;  1D6E C;  4IUU A;  1HUM A;  3HZX A;  1NUC A;  3SHL A;  1B2T A;  1ZXT A;  4CKB A;  1E0B A;  3HOX B;  3SK5 A;  1EZ6 A;  1RDP D;  1GUS A;  2F0O A;  2Z4I A;  1DON A;  4BY1 B;  4CKC A;  1A6X A;  4RA8 A;  3NTI A;  1JIC A;  1I4P A;  4IUV A;  4IFD J;  3TN2 A;  1I6V C;  2Y0S B;  3DEO A;  4I65 A;  1EY0 A;  3SVM A;  4DAY A;  4PV1 C;  2J7Z A;  2IWH A;  4CJ2 C;  2VXW A;  2EYJ A;  4C1N K;  5JJZ A;  3EQL C;  3QWN A;  4DXF A;  5A2Q L;  2HCI A;  3I4M B;  4OIK A;  3MXN A;  2A6E C;  1X3P A;  3NBH A;  1C8C A;  5T1G A;  4K5X A;  2PYK A;  2BOS A;  2MJ8 A;  3TP8 A;  4KK7 A;  3ND9 A;  3S1Q B;  1A3U A;  2K05 A;  2XSC A;  4FVM A;  3QOJ A;  3HOV B;  1QE6 A;  3BS1 A;  1EY5 A;  1LTB D;  5JEA J;  1AEX A;  4A3E B;  2O2L D;  1SYD A;  5ELC A;  3X3M A;  1C4Q A;  2WV6 D;  4KTA A;  2A73 B;  2FJ2 A;  3NHH A;  2JP1 A;  2K04 A;  3GTK B;  1VF5 C;  2PZU A;  4UAI A;  3WOF A;  1SE2 A;  1PFM A;  3OMC A;  3C3L A;  4RGM A;  3S2D B;  4BA2 I;  1E2Z A;  5CBE E;  3X3N A;  4XXE A;  3SDZ A;  1S4Z A;  4RKL A;  4ME5 A;  4HSP A;  2DY7 A;  3S2H B;  2L5T A;  1S5E D;  2BE5 D;  2I07 B;  2AWN A;  3GV6 A;  1O7Y A;  1FD7 D;  4KKS A;  1G8Z D;  1SYF A;  2HDM A;  3FPP A;  4R8I A;  3Q24 A;  5C6A A;  1RTN A;  3ZYY X;  4EQO A;  1SE4 A;  1WTR A;  3GTM B;  4RCN A;  5C44 B;  1R9T B;  2O4X A;  2VB3 X;  3D4W A;  4ZLT F;  5IGB A;  2PW5 A;  1K83 B;  2O5I C;  2EY5 A;  3SK6 A;  2BCO A;  2SEB D;  4LMQ D;  5I9O A;  4BY7 B;  3I4N B;  1HTP A;  1VMP A;  4H13 C;  2G9H D;  4OGQ C;  4YIJ A;  1GUT A;  3PUY A;  3MC0 B;  3FRP B;  5JVH 3;  2EY1 A;  1EYD A;  3VR5 A;  2F3V A;  3RZD B;  4BBS B;  2K03 A;  1FYC A;  1TWH B;  2K28 A;  2TMP A;  4NDX A;  3K7A B;  2RQX A;  3KUP A;  4C3I B;  1Y8O B;  4HCE A;  4Y7N B;  1DYQ A;  3NP8 A;  1D2B A;  1XYI A;  4IAL A;  1TS3 A;  3J7A F;  3S14 B;  2A6E D;  3GQB A;  3Q23 A;  2E2H B;  1STN A;  2QKI C;  2E74 C;  5C3E B;  2LKV A;  4H0L C;  3CHB D;  3V2T A;  5I6Y A;  4A93 B;  2X69 A;  1UEA B;  4RGO S;  5KRU A;  4KY6 A;  3HS0 C;  2NVQ B;  1SXT A;  2Q8R E;  5J1Z A;  3I91 A;  3FEW X;  1PDQ A;  3HG9 A;  5FKA C;  3GTL B;  4NW2 A;  1TWA B;  2X6L A;  1B4O A;  4CHT B;  2NB0 A;  3W3A A;  1WD1 A;  4MN3 A;  1SBB B;  4FXD A;  2JA5 B;  3BG3 A;  4L6T B;  3J80 E;  1PTO C;  3C1E A;  1X32 A;  4PQX A;  3U9S A;  5LHY 1;  3T51 B;  3OPO A;  5J39 A;  3GTO B;  3FKI B;  3PV0 A;  1EY8 A;  4K6D A;  4N9P A;  3GD7 A;  1J8I A;  1PYW D;  1JOQ A;  2KQ3 A;  2NYZ D;  1Q8I A;  4HMJ A;  3PUW A;  4RGN A;  4QUF A;  1GUG A;  3A8K E;  1LT3 D;  1EY7 A;  1TQO A;  4DK1 A;  1ROD A;  4ZUJ A;  4ABN A;  4UDU C;  2F0K A;  1LTR D;  1Q1B A;  2NVY B;  4A3D B;  4MHE A;  1Y8P B;  1CA5 A;  1MSG A;  5CV7 A;  1BR9 A;  3T56 B;  5M5Y B;  2F0H A;  3J7Y W;  4BBR B;  3M4Y A;  3NTK A;  1CHQ D;  1QCB D;  2PNR C;  3K59 A;  3BDL A;  1AW7 A;  3MHB A;  4C3H B;  5LL6 X;  3S17 B;  1ML0 D;  3A55 A;  3NTH A;  2BA0 A;  4JK1 C;  4KY5 A;  1H9M A;  4ZUI A;  4C3I G;  5ISR A;  3ERO A;  1BUV T;  2VUM B;  3SE0 A;  4DAP A;  1RJT A;  4A3J B;  1GJX A;  2IJ0 A;  5D3D A;  1LV9 A;  1JOR A;  3BDO A;  3U9O A;  2N55 A;  1F2M A;  2AWO A;  4KKU A;  3FMC A;  1BCP B;  4K6L A;  2QDB A;  4FO2 A;  3MEH A;  1O7Z A;  1DOL A;  4ZRZ A;  3R8B A;  2F0D A;  2BA1 A;  2Q8T A;  4XT3 B;  1V1P B;  1KLU D;  3NQT A;  3AU7 A;  3RLF A;  1SNM A;  5C0X J;  3H94 A;  5IOC A;  1II3 A;  1QG7 A;  4O42 A;  2B2U C;  3MVV A;  4JBW A;  1HUN A;  2KJX A;  1HRJ A;  1TII D;  1BCP F;  2IX3 A;  1HA6 A;  2ZXR A;  3IAY A;  2JEB I;  1SJE D;  3S1N B;  5HGT A;  3QJY A;  4L63 B;  2GA4 B;  2Q8I B;  5C5L A;  1B50 A;  1X3Q A;  1Y1V B;  3NQI A;  2B2W C;  3NPP A;  1STE A;  1PTO D;  1YNJ C;  3VR4 A;  2L11 A;  3PUZ A;  2XIW A;  3TME A;  1IHZ A;  3ERQ A;  1TVX A;  2B2U A;  2WKD A;  1KLG D;  4DA2 A;  4OO1 G;  4RCO A;  2VB2 X;  2K32 A;  2LMC B;  1TS4 A;  3I8Z A;  2EJG C;  3BZD B;  4WFN 3;  1JQY D;  1SYC A;  3OWE B;  4BWG B;  4KKT A;  4QMG A;  1TY0 A;  1CZG A;  3TP5 A;  1U9R A;  2IT1 A;  2NVX B;  3OIQ A;  2B2W A;  4QCL A;  4DGZ A;  2JA6 B;  3ND8 A;  3LWU A;  4XQJ A;  1AP0 A;  2F0G A;  2WIN B;  4ZQ3 A;  5IGF A;  5BN3 A;  2KVM A;  4C3H G;  1FGB D;  1LTS D;  5I4D A;  1BBX C;  5C5M A;  1HXY D;  3I3C A;  4TKO B;  2E76 C;  4IFD G;  4ZKC B;  1FNW A;  1CI3 M;  2ENB A;  2TSS A;  5G3L F;  5TSS A;  1EEF D;  1SSO A;  4FF4 A;  4KJN A;  3HKZ B;  1QWY A;  4F87 A;  1UNS A;  2LY7 A;  2A6H C;  1Y1W B;  1STB A;  3FPU B;  3MFY A;  2EYL A;  2F0L A;  4OO1 H;  2EYM A;  2B2Y C;  1EFI D;  3H3V C;  5CV9 A;  1R4P B;  2D2C C;  3PMF A;  3A54 A;  2MPM A;  3T53 B;  2V4D A;  1I4R A;  5I2X A;  1M8A A;  1IKL A;  1SND A;  1NR4 A;  1PMR A;  2R61 A;  1TWG B;  4F7X A;  1D5Z C;  4IQZ A;  5JOB A;  4RHS A;  3G6J B;  1I4G A;  3NK9 A;  1BO0 A;  1F2Z A;  4C56 C;  1EOT A;  3S1R B;  4HCS A;  2B2Y A;  2FMC A;  2EYO A;  3NWS A;  2K01 A;  5E3F A;  1ZYR D;  1DCZ A;  1ZEQ X;  4IFD H;  1WCM B;  2K33 A;  1WTP A;  4B9X A;  2YYZ A;  4U68 A;  1Q1E A;  5IGE A;  3NXW A;  4XTC S;  1WD0 A;  1MI2 A;  2XRS D;  3AB9 A;  1YNJ D;  4M1U B;  1CFM A;  4IUN A;  2RDG A;  4HED A;  3W2D A;  1SNC A;  1EYC A;  1STY A;  2D62 A;  5IGC A;  5FO8 B;  1LAB A;  5FLX L;  1Z6H A;  2F0V A;  2E2D C;  2FMM A;  3S1M B;  3NBI A;  1A2T A;  1PZK D;  3C46 A;  4R9W A;  1T5X D;  1HFG A;  3N6R A;  1C48 A;  1WTV A;  1EY6 A;  1XX8 A;  3KBX A;  1UAP A;  1FNU A;  4K2K A;  2RSN A;  3K58 A;  3QG1 A;  2SNM A;  1MD2 D;  3A56 A;  1RHP A;  4XT1 B;  4LJZ C;  4IUT A;  3J7A V;  1TY2 A;  1XTC D;  1IYV A;  1RCV D;  1TWC B;  3M3Y B;  2EYF A;  2WB1 B;  4QB4 A;  5LL6 S;  4LAA A;  2QCP X;  4O1N A;  1EL0 A;  1IYU A;  5CMD A;  2EJM A;  2ICE C;  5A35 A;  1AZQ A;  4C3J B;  1JOO A;  1D1K A;  1B1Z A;  4TQU S;  3VYR A;  1I3Q B;  2EY6 A;  2LFN A;  2L4N A;  2A6H D;  4XDX A;  3G7L A;  1ENF A;  4ZKB B;  3K5L A;  5COY A;  4PMB A;  3VA7 A;  2K7V A;  3IFD A;  3DEP A;  2XWB B;  5DM7 3;  1SEB D;  2RBM A;  4N9T A;  1H9J A;  3J81 L;  2O5J C;  3M85 A;  1B53 A;  3Q6S A;  5M9O A;  1LO5 D;  4KN4 C;  3NE5 B;  3OIP A;  2K5Q A;  3SK8 A;  1OXX K;  4M8A A;  2I46 A;  2D5D A;  3VYU A;  2F3W A;  3KK7 A;  3K6O A;  1HHV A;  2KA7 A;  3PO2 B;  3VYS A;  2J4X A;  3AMU A;  3L9A X;  3H91 A;  5BN5 A;  3MZ5 A;  4IUQ A;  3C2P A;  3S9W A;  5DAU A;  5I9P A;  4FNF A;  2JEA I;  2HDL A;  4K5V A;  1U4L A;  1B3A A;  4H44 C;  2IX0 A;  2L12 A;  2WII B;  1Z47 A;  1OO9 B;  4NKL A;  4RKB A;  1ONL A;  3DWP A;  4H7B A;  3V05 A;  1VF7 A;  3KLS X;  3EFX D;  4ZYS A;  1NSN S;  2L1B A;  3T16 A;  1B9M A;  1TU2 B;  2L0C A;  3H0G B;  2M2L A;  1D5X C;  3TBI B;  5IT9 L;  1TT2 A;  1EY4 A;  1S5D D;  5FO7 B;  5ELD A;  5I2Y A;  1JB3 A;  4RHR A;  2A68 C;  2WAC A;  4OL7 A;  1KDB A;  3MXG A;  2ID0 A;  1O80 A;  2PO4 A;  1GUW A;  2XWJ B;  5CGK A;  1DXM A;  2A5H A;  2CVR A;  3ITP A;  1EU3 A;  5BN4 A;  4B08 A;  2EVB A;  5ELB A;  5JPN C;  1RKN A;  1HQR D;  4FXG C;  1PZJ D;  3MTS A;  5HUR A;  1XXG A;  4C1N I;  3GO5 A;  2F0F A;  3KBG A;  4XYQ A;  4C3J G;  1STH A;  1STG A;  1F2L A;  2WAQ B;  5D65 A;  4K14 A;  4KMU C;  5KYL A;  1EWC A;  2L55 A;  5C4J B;  1I50 B;  2RA4 A;  4HAE A;  2AQ2 B;  2B2T C;  3TDQ A;  1V1O A;  5C4Z A;  2E2I B;  2JXM B;  4RH6 A;  2ZXP A;  2OEO A;  1CTM A;  4KD3 A;  4KJO A;  5D14 A;  1GUN A;  2LS0 1;  2MGS A;  5A2Q E;  5EBC A;  5C3X A;  4LK1 C;  4DK0 A;  1F9P A;  1LLR D;  3TZU A;  2HCC A;  3T13 A;  4OHJ A;  3RMH A;  1BDO A;  3H6M A;  4B9W A;  3PO3 B;  2E2J B;  3TP6 A;  1W6K A;  3CRL C;  1H9S A;  1CK1 A;  4G7Z C;  2K1B A;  5CV8 A;  3T4A C;  5EPL A;  2EZV A;  1KAA A;  5CBA E;  3PUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...