5LL6X

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
155
structure length
155
Chain Sequence
b'STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAGKANKQFAKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00366 Ribosomal_S17 Ribosomal protein S17
X PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ll6X00
5A2QL 3J7AV 3J80L 5FLXL 5IT9L 3J81L 3JAML 5LL6X
chains in the Genus database with same CATH superfamily
3U9SA 1BOSA 1F2LA 4ZQ3A 4X64L 5I2YA 1JICA 4DV0L 2F4VQ 4A3CH 1HNWQ 1B9NA 5FLXL 1SMXA 4LUZA 3MTSA 3A55A 2RF4A 2Y0SG 3PIP3 4CJ1B 4MTKA 3SDZA 3K57A 1VQLA 2L1BA 5COYA 2JYOA 2LSSA 3J7AF 2XGTA 5IGDA 3PUWA 4LMQD 4C56C 3BDCA 4POGA 2KOLA 3DM1A 4O42A 1B2TA 3H3VI 3BYTB 2B8GA 2DNEA 1IYJB 2I5LX 1RIPA 1JWUD 1EYAA 1CKNB 1HQRD 1XPRA 4LF6L 5CORA 2CCZA 4L5SA 3MHBA 3H3VH 1JT8A 2RSOA 4G4KA 3V2TA 2AKWB 1I6VC 3UI2A 4XYOA 3H0GH 1CK1A 1Q7YC 3RLOA 1SNOA 2CWAA 5M3FH 2EYOA 1LTRD 2OTJA 2VUMB 4GNXB 4JV5Q 3TREA 2HDLA 3HKSA 1IL8A 3PUZA 5ELNA 1TR5A 2KA7A 2RVLA 4LF4L 4YCVA 2F0KA 4HCEA 2ATWA 1BBXC 1VQCA 1C0AA 3H3VC 1V43A 1XXGA 5JVG3 2Q8TA 1LT5D 1U4LA 1HA6A 3HOZB 3GTMB 5IGEA 5C4XB 5KNCA 4DF7A 1EQRA 1II3A 4I7AA 4Y7NH 4RFBA 3R2TA 1EWIA 1SNQA 1TQOA 5IT9c 3G6JB 1A15A 4IALA 1GO3E 2IX3A 4LFBL 4X62Q 3OIPA 1CZGA 3T16A 4BY1B 4DV1L 4FXDA 2A1AA 3PQIA 3K6OA 4BBRB 4HTHA 4DR5L 1I6HH 4A3IG 4XT1B 2YU9B 5JJIA 1BDOA 2LXJA 3TEHB 1E3PA 1HZBA 1SE2A 4NXNL 3R2IA 3ZJYC 1S3OA 1S5ED 5M5WB 2E75C 4BXXG 1T5EA 4DK1A 2F0LA 2E2JH 3H94A 1K8AC 3FMCA 1IW7C 3FKIB 1HNXQ 5IYBG 1UAPA 1AE3A 1K3RA 2QDLA 4IUPA 3I4LA 1D7QA 2HQEA 2MGSA 3TP8A 3EBEA 1TWGB 4PZ6A 3MXUA 4IN3A 1VQMA 4FF3A 4JVZA 5C5MA 4JI8L 4CKEA 2IWHA 5ELFA 3DWAA 1B9MA 2R7DA 4QMGA 5C3EH 4AYBE 4OWTB 2I46A 2HT1A 1EIHA 3DHQA 2EZVA 1ICFB 4A3DG 4UP9A 1Z6HA 2CH4W 1RTNA 2Q2HA 3NEMA 1DOMA 2IHFA 1IKLA 4X3TA 3QOLA 3J81c 4IFDH 1K3BC 2F0NA 1YJ9A 3OOCA 2B2TC 4A76A 2YV5A 2F4IA 3NBHB 3GTGB 3EVQA 3KLWA 2IW3A 4RAUC 4RA8A 2OWOA 3AEVA 1O80A 3QG1A 3RR5A 2JA7B 1LTLA 4YWKA 3MWYW 3QO2A 3J81L 3M3YH 3GTQB 3Q8DA 1NUCA 4A3MH 1YEZA 2CQAA 3ERQA 4TKOB 1N34L 4KY5A 1YNNC 4C1NK 4AQYL 2YTVA 1KRSA 3DUZA 3KF6A 1KC8C 1TY0A 4HJ8A 3L7ZC 5EGTA 4PG3A 1AEXA 3A8KE 4DV4L 2VL6A 3DEOA 2JA8H 1YHAA 3I8ZA 3IRBA 1EFID 2Z0SA 4IUQA 1VF7A 2KJXA 2F0VA 4LWCA 4HIDA 2J0TD 1RJTA 1EY4A 2NZ1D 2AUJD 2DUDA 4FF2A 4JI4L 2JEAI 3CHBD 4EX5A 1HA5A 4DV2L 4V190 3MXGA 1K8GA 1ET6A 3UDGA 1FNVA 3SVMA 3J80E 3KOJA 4FXKC 2NVYH 2BH2A 1A3VA 1D5ZC 3RN2A 4FF1A 2IY5B 1VQPA 2ZT9C 4IQZA 3C2PA 4JOIC 4DNIA 3PV0A 4ZKBB 2CW0C 3I4MH 2GA4B 2JA6B 2A68D 3VDYA 1SLJA 4A3LH 1A6XA 4GN3B 3JAME 2FHTA 4M8AA 4JI0Q 2Z8LA 3MA2B 1HNZL 2KHJA 2XRQD 2K04A 3HOWB 2WB1E 3GTPH 5LHY1 1ML0D 2K7VA 4G7HC 3S1NH 1SMYD 2JSOA 2R7FA 3I3CA 1M4VA 2HHHQ 3M4OH 2BCOA 5BN3A 3NQIA 1NNXA 2PZTA 1YI2A 2VNUD 4KHVA 4BS9A 2OEOA 3D31A 4IUTA 3VYSA 4QB4A 3PO3G 3TQYA 4B3ML 2DY8A 1A63A 4K2LA 4JI6L 3S16H 2X6LA 3TDQA 3D3RA 4S3SA 4DR6Q 2AQ2B 1Q81C 1XNRL 3WDNA 2A74C 3NSWA 3D6CA 3PO2B 2JQOA 4A3GH 5C3WA 2C35B 2R92H 1GHJA 3AU7A 5T1IA 1CA6A 2KECA 2NBFA 1SR3A 2Q2IA 4NXMQ 1JQYD 2YTYA 3K80C 4EQOA 1HPCA 2Z4IA 4OIKA 1CKOA 5M5XH 1VMCA 3C46A 4C3IG 2DY7A 1RODA 4KN7C 2VQEQ 2ZM6L 1V1QA 2KCTA 4DFAA 3U50C 4QJFA 1CQVA 3GTJH 1SFOB 3PF4A 1D1KA 4DV3L 1GVPA 2R7ZB 1E1OA 5I9OA 2XVSA 1YNXA 1DOKA 3D4WA 2E2DC 1U9RA 3CCMA 1KIXA 2PQEA 2FXQA 4P73A 5KRUA 1RCVD 4C3JB 4NB3A 1J9OA 4A93H 4O2DA 4R4CA 2UUCL 2XNAC 3WOEA 1Y8PB 1ENFA 1XTCD 2E8GA 4A3CG 2NTTA 2WKCA 2OCEA 1IBMQ 2N88A 1JR0D 2M00A 5IGGA 2ALYB 4IUVA 3VYUA 1CUKA 1PMRA 4R8NA 4YHHQ 3HOVB 2WINB 2D2CC 3D0FA 1SAPA 1XWEA 4C2MH 5M5YH 3CPFA 5IWAL 1MHWC 1EQVA 1Y1WB 1PH1A 4QQBX 5EPJA 3LGJA 3PGZA 1SE3A 1G8ZD 2UXCQ 4DUZL 3SK5A 4LF9Q 1B50A 4OL7A 4K2KA 4NKLA 4DR7Q 5C44B 1I3QH 1GUOA 2K52A 1GUTA 4HJ9A 2PPBC 1TWCB 3NELA 3FPUB 4XXEA 2A69D 5C0XH 4B3TL 5GADC 2DN8A 1B3AA 1NR4A 3CKIB 1TS4A 2P5ZX 4K8IA 3SK4A 3BDLA 3H0GG 2KEEA 4IUUA 1YHQA 4B3RQ 3GDEA 3C1EA 3J80L 2EXZA 3GQBA 5M3FG 2K75A 2Z6BA 1E2ZA 4CHTB 4KKSA 2VY3A 1N32L 4UP8A 2EJGC 2O5JC 1VQDA 4DPGA 2ENBA 2OTLA 4J15A 5AJ3L 4DV6Q 4KKTA 1KLUD 3JAML 3CCUA 4FXGC 5L37A 1GUGA 5DNFA 3G71A 3BG3A 5GQOA 1Q46A 1ILQA 1X3GA 4B3SL 4JI2L 4HSVA 1A62A 1EQTA 5GAGC 1WTHA 1IBLQ 1R4PB 1AP0A 4JYAQ 3L9AX 4R1JA 4DR1L 5DM63 2NVQB 2EDGA 5FKAC 1EOTA 3HP3A 2QCPX 2K5WA 1HZAA 4DV5L 1UE5A 5LMNW 1LACA 1QG7A 4RGTA 1BBWA 3ONAB 1AZQA 4RKLA 1R9TH 5LMNL 3R8BA 2MO0A 1SJED 1N36Q 4ALPA 3A7LA 1X6OA 3EN2A 1GUWA 1Z47A 1TXYA 4A3EB 1E24A 4DN4M 4DV7L 1A8VA 4DNTB 5JJZA 4PMBA 3T4AC 4A3JB 5DM73 1V8QA 4JBWA 3HOUB 2MNAA 3I4MB 2SEBD 5C44G 5G3LD 1UWVA 4RMFA 1PH3A 3OWFA 4CDCC 5FK9C 1CI3M 2X6GA 4G7ZC 2NVXB 4DR2Q 5C3EG 3KBGA 1U5KA 1SYEA 2VS1A 2R93B 2AMCB 2E76C 1ZXTA 1VQ4A 4FNFA 2K33A 1FGUA 1GXDC 2A6HC 1Y14B 4H02A 4LF7L 4IFDG 3TSSA 4WJ3M 2PNHA 1VS0A 5EKLA 3BS1A 5G3LF 5KIXA 1G51A 1STAA 2B2TA 1JOOA 4B9XA 4AH6A 1K8MA 3SEBA 1LYLA 3CAMA 1L0YB 1QWYA 4DU9A 5IGFA 4GKJL 5GROA 4A3MG 2E5LQ 3I4OA 4LF8Q 2EYFA 4R4TA 3GTKH 2K4KA 3PIOA 1D2BA 1QB5D 2EY5A 2QEXA 3FVQA 1LTGD 2F0OA 3CQZB 1XNQL 2IX1A 4DAVA 2F0PA 1EYGA 1CKMA 2WAQG 2D0OA 1IW7D 2F0TA 3B6YA 5FLMH 1CQFA 2Y0SB 3RZDH 4DK0A 4P75A 3MXPA 1W2BA 1PYBA 2JA8G 1K0RA 3F2BA 2LFNA 4ZK9B 4UAIA 4XQQA 4OXPA 1GJXA 3KUPA 4BWGB 4JI3Q 1IL2A 5JJKA 5C5LA 3S17H 1YNJC 2Z1CA 1Q1BA 4HIOA 4YWLA 3A5UA 1Q1EA 3QWNA 2UXBQ 3K58A 1K28A 4A3JG 1H9KA 4OX9L 3ND8A 2OXPA 2HIVA 1WFQA 2HCIA 2HQLA 2UU9Q 1X3EA 2LKVA 1VQNA 1VQEA 3I4MG 1LM0A 5I4DA 4DR3L 4HN7A 5IGCA 2E2HB 4X3KA 1O78A 4A3LG 5LMUL 1EY9A 3I90A 3A74A 3URYA 4F87A 4JI1L 4X3SA 2XRSD 3CCLA 1OTCA 5C6AA 5IYDH 5JPMC 2K03A 1PH2A 3KLSX 3R3OA 5FO8B 4X65L 1EEFD 1WI5A 2FMMA 1N33L 2ICIA 4BY7H 4DAYB 1UE1A 4PQXA 1YNND 1SJHD 3I7FA 1JJCB 4IZ8A 5I2XA 1ZKOA 4RGNA 1XMOL 4QUFA 4WFN3 2E2IB 4X66L 4CKCA 3S1RB 3NP8A 3H91A 3HZXA 4A3GG 1H9SA 1WTWA 2R92G 2F4VL 5CV6A 1JCKB 4A3BH 1HNWL 4B08A 3S2DH 5TSSA 3Q24A 2UUBQ 5BN4A 1DONA 1UEAB 4A3IB 5EBDA 2RDHA 3S14B 1JC7A 4LK1C 3Q23A 1ASZA 1WTQA 1HR0Q 4RHRA 3K5OA 1O7IA 1K0SA 3CCRA 5BR8Q 3J81E 2KQ3A 2L0CA 1ENCA 1F2ZA 2CW0D 4UHVA 3M7GA 2LY7A 4JI5L 2A19A 2HIXA 1K8OA 3S1MH 4DV0Q 2DJGC 4CKBA 1RHPA 1QILA 4A93G 4A3FH 1EZ6A 1Z7TA 3K0XA 1SNCA 3RZOH 4GLXA 1Y1VH 3V96A 3BDOA 4LF5L 3UE1A 3MFYA 5IGBA 3E3XA 3M4YA 1OXVA 3RLFA 3KLSA 3HOYH 5ELEA 1TWFB 1WOCA 1MI2A 1PTOH 4XDXA 4J1MA 1KDAA 2D0PA 3KF6B 3BZDB 3L0OA 4I65A 4A3DB 5IYCH 4APVA 1BCPC 4IOCA 1H9MA 1L2FA 1STHA 2CKZB 4ZAIA 4OO1H 1JORA 5JPNC 1RD9D 3OPOA 4KY6A 2FINB 3GTOB 1NAPA 2AUKA 1FVIA 2JA9A 2ZXOA 4K5VA 1DZ1A 1M1KC 3HFZB 4L6TB 4X62L 3DWPA 3BU2A 3HRZC 3Q22A 1I5FA 4KN4C 3AYHB 2B63H 2IX0A 1W6JA 1ZYRC 4LF4Q 4K8JA 4FDBA 1VDZA 3T56B 5IODA 1SNPA 1H9JA 4O0AA 4BBSH 3A0JA 4A75A 4PV1C 5IT9L 3BVZA 5JJLA 3ITPA 1PH4A 1WCMH 1PVOA 4DAYA 5J39A 3G4SA 2N55A 3VYTA 1HFNA 1D5XC 1EIFA 3M7NA 1HNXL 1E7ZA 1I50H 1SBBB 1Z9FA 2KEDA 3VYRA 2F52A 2A6ED 2PO4A 3S1QH 1SSOA 1SYCA 4DV1Q 4J6HA 3I2ZA 3NE5B 2I07B 3TP5A 5K5PA 4HJAA 4DKAC 1HJPA 2IPKD 3N6RA 3MVVA 2F0JA 1STYA 4TQUS 1X3FA 1C48A 3U4ZA 4KJOA 4RH6A 1KLGD 1RF2D 4IFDI 3X3NA 1AH9A 3HEJA 4WORA 4N8X1 4DK3C 2RQXA 2VW9A 2I0QA 1Q3LA 3N52A 2BA0A 2D62A 3HG9A 5D3IB 1XPOA 3GTLB 4EVOA 1VQ8A 3PO3B 4JI8Q 1GHKA 3EROA 3F2UA 5IP9H 1QZGA 3CC4A 2A73B 1RKNA 1WJJA 4GS3A 4GKKL 4R4OA 4DXGA 4IPDA 3EIVA 3T1HL 4CJ0B 1J5EL 1TS3A 4R4IA 3MEHA 2K5HA 2BOSA 1F2MA 4MHEA 3CCSA 4NMZA 3V05A 5IIFA 1Q90A 4C3HH 4A3KH 1UUPA 3W1GA 2QILA 4C3IB 3GO5A 3EA6A 3ULJA 1QUQA 5JVH3 1V1PA 1V9PA 2JA5H 1TWHB 3FP9A 4DUYL 5EKKA 5JEAH 2VXWA 1N8RC 2VB2X 4NP5A 1PH6A 1XTDA 3NK9A 4YCWA 3CCJA 1IHZA 1GUNA 4X3UA 1F9PA 3IAYA 1E0BA 4DV4Q 4LFCL 2N8NA 2L55A 1NSNS 2EOTA 3TS2A 5FLMG 1EY8A 1G6PA 2PZUA 4MIUA 3CCQA 2QDBA 3MFGA 1BKBA 4L8JA 5EKIA 2DGYA 1NMFA 3HKZG 4I7ZC 1WVLA 3K81C 4ZRZA 1OXUA 5LL6X 1HZCA 3ULPA 1B7YB 1K83H 1YHBA 2H5XA 4AIMA 2HHHL 2EE1A 4P72A 3WOFA 1KNEA 4K0KQ 1DYQA 1EYDA 3TP6A 3K7AH 4JPBW 5LL6S 5H1SE 3GV6A 1MSGA 3RZOB 1VQHA 1Y1VB 1PXUA 1VQOA 1G2TA 4YY3L 3PIPA 2XN9C 2Y0SE 1G91A 2K50A 1VQ5A 2A6HD 1LTBD 3CXCA 2NVTH 1SRUA 4WRDA 5C4JH 1JB7A 3H0GB 3NTIA 2Z6KA 1MGSA 4NXML 2B2WC 5M3FB 1AZPA 5IYDG 1C8CA 1J6QA 4CDEC 5EPLA 1IYVA 4HIKA 1LT4D 2I5HA 3E9HA 3VR5A 1BUVT 3PMFA 4BY7G 1JE4A 3OHXC 2GVBA 3T53B 2Q8RE 1XNRQ 1IBKL 1STNA 4LFAL 2RA4A 3QOJA 1FJGL 4DAPA 2C5CA 4POFA 1FD7D 3PF5A 4Y7NB 3KJPA 1EY6A 2JN4A 2J7ZA 4B9WA 5C4HA 1MIUA 1S40A 1CHPD 1I4RA 3DXJC 3MXNA 5CV7A 3KK7A 3KJOA 4QL5A 4A3BG 1DOLA 1EWHA 3AMUA 1BXTA 3MZ5A 1I6HB 3VA7A 1YNJD 3IFDA 4DV3Q 2PW5A 4JC0A 3OMGA 4YHHL 1K73C 2L5TA 4RGOS 3UE0A 4RCNA 1E1TA 2Q8IB 1WCMB 2CHBD 1L0XB 2N3SA 2E2JB 3Q0AA 4JBMA 1QVFA 1QE6A 3OTOL 4KHPQ 4H13C 2GVAA 2B39A 2UUCQ 3J7YW 2UXCL 4LF9L 1YJNA 4HSPA 2RHSB 1A0IA 2F0MA 5C0XI 4GZYC 5M3MH 3S2HH 3SE0A 1JJGA 4A3FG 3G7LA 1W6KA 4G57A 1Y1VG 3CC2A 1D5MC 4NDXA 4OHJA 1K9MC 4JBKA 1B44D 1UE6A 3STBC 1LTTD 1F9QA 3HGBA 2PQAA 3HOYG 5IWAQ 5C3EB 1E2WA 1HUMA 2JXMB 3JC66 4DR4L 2ID0A 2KCNA 4DAMA 3I73A 1PV4A 1E22A 2PZWA 3P20A 1XMQQ 4DUZQ 5IYCG 2MUYA 1JWSD 4KMUC 4XIGS 3T1YQ 4F8MA 1PYSB 4DV6L 1F77A 3I70A 3E6ZX 3CRKC 4JI7L 1ESFA 3R93A 1WTOA 4OO1G 1FL0A 1C7YA 1M8AA 2RBMA 4B3TQ 3M4PA 1LT3D 3I55A 2ZTEA 1WD0A 4JYAL 3TZUA 4IFDJ 3M3YB 4UDUC 3UDXA 4A3MB 3TN2A 4HJ5A 3M85A 1DGSA 1BF4A 1N32Q 3IFTA 4TVAB 1B53A 2IHEA 5E7NA 2CH4A 2EYMA 5ELCA 5J1ZA 3D4DA 1T5XD 2WAQB 1BNZA 1O7ZA 2B63G 4AYBB 2NB0A 5DLQE 4OEMB 2PYKA 5AJ3Q 2TMPA 1NJIC 1WTXA 4PMCA 1FYCA 1NTGA 1B1ZA 1S5FD 3KDFA 4BBSG 1OXSC 3K5NA 3NTHA 2JA8B 3RD4A 1HRJA 1S5BD 1ESRA 1UE7A 1F9SA 4A4IA 1WCMG 1QCBD 4K14A 2EY1A 2QEJC 1SYFA 2MO1A 4ODGA 4DR1Q 2XWJB 4KJNA 1B4OA 5C4ZA 1KAAA 2M9VA 4QY7A 3DM3A 1NY4A 2NZOA 2QA4A 2NVYB 3FEWX 2RCNA 1CT1D 2B29A 3ERSX 2FJ2A 5CC4A 1CZWA 2E74C 1QJOA 4H7BA 4DK6C 2HCCA 3AFPA 2A68C 1JMCA 2VUMH 4HIMA 1H9SB 3FRPB 2IJ0A 4YWMA 3LWEA 5EBCA 4DV7Q 1DM0B 2KUMA 3H6MA 2VQFQ 1K83B 2QGQA 3GTPB 5HY6A 1I4HA 4IPHA 3S1NB 3I91A 4P71A 1P8LA 1VQFA 1ASYA 3M4OB 3K7AB 2EY6A 4K5WA 1H95A 5D14A 3HOZH 1VF5C 3UDIA 3W5OA 5C4XH 3GTMH 5CBEE 3X3MA 2NN6I 4HMIA 1ILPA 1HCZA 4IPGA 3C3LA 2Z4HA 5IP9G 1TY2A 3E0EA 3S16B 4OGQC 1ZYRD 4X6AH 2OF1A 5F2DA 2ZTCA 5CV4A 4BY1H 2E5LL 4LF8L 5EJWA 1OXTA 4BBRH 1I94Q 2UUAQ 4A3GB 2EYPA 5ELOA 2YU9H 2R92B 1FNWA 2NN6H 4RGMA 3BJUA 4C3HG 4JCVE 4A3KG 3NUCA 1IKMA 2EIFA 5M5XB 2DNCA 4AYBG 5M5WH 2XTIA 1I4XA 3J80i 1HTLD 4OONA 5CGKA 3FKIH 3GTJB 4N9TA 1CTMA 3SK6A 2BDNA 2JA5G 4JI3L 4ILWA 2UXDQ 1SEBD 2B3GA 4HCSA 2RDFA 4L5RC 2EY2A 5JEAG 3J81j 1TWGH 1KRTA 1NMGA 3JAMi 2RDGA 2WKDA 5KGUA 1XNQQ 1RL2A 3I56A 4Q5VA 2K1BA 4A93B 4RWSC 2IT1A 3L3OC 1V1OA 2PMZB 5DAUA 1VQIA 4GLVB 4CDFC 1IZ6A 1W3SA 1OO9B 2K6AA 2QF7A 5IT9E 1GD7A 4FYDA 2VB3X 1RTOA 3ICEA 4MNOA 1L1OC 3RN5A 5IY0A 3PUVA 2Z6KC 2A8VA 2K14A 1WYDA 4C2MB 5M5YB 4F7XA 1TU2B 2RHQB 1KTKA 2B2YA 1PLFA 2EPBA 4ME5A 2BH8A 4LUOA 1STBA 4OX9Q 3GTGH 2ICEC 3NWTA 3G6EA 3GV3A 2MQHA 4ULLA 2JEBI 4LNQA 3LWUA 4V0BA 1X55A 4XYQA 3KLRA 1TWAH 1PFMA 3PSIA 2JA7H 2HUGA 1BR9A 4HJ7A 5A35A 1I3QB 1WTRA 4K5XA 3GTQH 4ABNA 1Q8IA 4FO2A 4KKUA 1D1IA 4ME3A 2K5VA 3NPPA 1KAWA 1PH5A 1R4QB 3FDTA 5D65A 3EJIA 1N9WA 3VA5A 1VQ7A 2A69C 4GLAC 3PUXA 1TS5A 2B2VC 2R61A 2WP8J 3SK8A 1HR0W 2WACA 4GOPC 2F3VA 2B2WA 3MEFA 5C0XJ 4EQNA 3CMAA 1CSPA 1HR0L 1UEBA 3S15H 3ULLA 2WB1G 5I6WA 3W3AA 2EQSA 5FLXc 5BR8L 2BA1A 3QB3A 5E4WC 1XMOQ 3A8IE 4UPAA 2CQOA 1PHJA 2JE6I 4LUVA 1E2VA 3IL8A 1VQKA 5FO7B 1LLRD 4X64Q 1SDFA 2R6GA 2JA6H 5JAVA 1D6EC 2LMCB 1JJ2A 5CBAE 4U68A 2A5HA 2K01A 2LXKA 4R9WA 1PDQA 1B8AA 1BQQT 3E5SA 2WIIB 4IURA 3HOWH 1HTPA 2O5IC 1R9TB 2AQ3B 1SYBA 3CCVA 1C9OA 2EXDA 5T1GA 4JI5Q 4OO1I 2MP1A 4Z9CB 2Q2TA 1MSHA 4JV5L 4EGVA 3U9OA 1SXTA 3VR3A 1HHVA 2Q2UA 1SYDA 2LS01 1I4QA 1QUQB 4LF6Q 5CV5A 4LAAA 3K7UC 1V1PB 5M3MG 4LF5Q 2F0DA 1G2SA 1PZKD 1PRTC 1WTPA 2K28A 1TVXA 5I6YA 2H1EA 3DLLA 1SYGA 2KHSA 1CFMA 3PO2H 2NYZD 1F2YA 4CBVA 1ET9A 1PFBA 5ELBA 1PH9A 1LTSD 3KF8B 3A56A 1STGA 5C0XG 1KDBA 2JK8A 4H44C 2DJFC 4ID6A 3P1HA 1PTOC 1UNSA 2AHOB 1FR3A 1U4MA 2FFKB 2EYLA 2F0QA 1J8IA 2ES2A 5M9OA 2ZJRA 4FP5D 5CR3A 1CHQD 4KLKA 1SFOH 4MTNA 5GAEC 5EAYA 3CP0A 1A2UA 1S5DD 2R7ZH 1VQJA 2RCFA 2L15A 1DXMA 1NE3A 4KTAA 1X56A 3BVMA 1EFWA 3T13A 2RSNA 2K5DA 3E9IA 4C3JH 3SGIA 2JP1A 5E4XA 1SE4A 2RKSA 4NPSA 5E3FA 1DCZA 2EJFC 4LFBQ 1XJVA 1KABA 3MC0B 4BA1I 3GTKB 1H9RA 3RMHA 2PCFB 4DR5Q 2H4OA 4OIJA 4N8FA 4P74A 3U58A 1GOZA 1NCVA 3K5LA 4NXNQ 1SROA 3RUZA 3HOVH 1MBYA 1BVSA 5IE8A 3RZDB 3OYYA 1L1OB 2AWOA 2BDOA 4HMJA 2L11A 3HKZB 3LNNA 1Y1WH 5JOBA 3OIQA 3CRLC 3D6WA 4K6LA 2N78A 4LJZC 1EU4A 3S17B 1QZHA 1EEID 3STBD 1EIYB 5C44H 1KXLA 1X3QA 1O7LA 3M4QA 2G9DA 2M2LA 1TWCH 4CGYB 2WAQE 5DEHA 2BE5C 2EVBA 5NUCA 2IL8A 3QIAA 4U673 3O13A 5K36H 4KV6A 5EPKA 3J7AV 2VUMG 3MXNB 1LTAD 3WWVA 1AE2A 4ZUIA 4IO9A 4GOPB 1STEA 2VZAA 4IJLA 1EWCA 1YITA 1CKNA 2X69A 1XPUA 3DMUA 3VR6A 4UP7A 3M9BA 1TWAB 3E0JA 3OSOA 3UDFA 4BY7B 3HOZG 2G9HD 1GM5A 5C4XG 2QW7A 4GKKQ 1DD2A 3J7ZC 4XT3B 3T1HQ 1J5EQ 4QIWB 2PI2A 2NVQH 1N34Q 4AQYQ 3ND9A 4BY1G 2F0IA 3KF8A 4XQNA 1Q12A 4BBRG 1LO5D 3KFUA 5KEEA 4GNXA 1YBYA 2KENA 1X54A 2NN6G 4A3BB 3NTKA 3S2DB 2AWNA 1TKWB 2OT2A 3GP7A 2L12A 5IP7H 3KYHC 2FMCA 2V1CC 1I4PA 4KY7A 1VQ9A 2PQAB 4RCOA 3S15B 1LUZA 1I4GA 2R3ZA 3OMCA 2D5DA 2CWPA 2WV6D 1S4ZA 1B70B 4DUYQ 4A3EH 3FKIG 4JI0L 1SN8A 3AQQA 4O1NA 1Y69U 4JI4Q 2B2YC 1AW7A 4DV2Q 3G48A 2CFMA 1VQAA 4A3JH 1Y8NB 3I72A 4L5TA 4K0KL 2F0SA 5KYIA 3HOUH 3S1MB 1BCPB 1XYIA 4LFCQ 1JE5A 4QF4A 4QUCA 4A3FB 1JOQA 1PRTB 3AFQA 3KBXA 4JW0A 1PH7A 2B2UA 3CC7A 2NVXH 4DR6L 2F0EA 2G5DA 2ZTDA 3K59A 1MJCA 1VQBA 3PIO3 2R93H 3HOYB 2F0UA 1HNZQ 4IUNA 2EYHA 3EQLC 2K05A 1EOVA 2D9UA 3ZYYX 1L1OA 1YZ6A 2EYJA 3T51B 4ZKCB 1PTOB 2B8FA 2O2LD 1EIGA 1MJEA 2ASBA 4BA2I 3HOXH 2JJQA 2AQ1B 4PNYA 3CF5A 1HQMC 4GN4B 1S72A 3KDFB 2VQEL 5IOCA 4B3MQ 2OQKA 4YY3Q 4RG1A 5FJ8H 1PZID 4JI6Q 2PMZE 2JA7G 1KDCA 2SDFA 3I4NH 4HEDA 3H15A 5ISRA 2KVMA 4J8QA 3MAQA 3C1FA 3HS0C 2NZHA 3CQZH 5AFWA 4L5QA 3W1BA 2MJ8A 3A7AB 1VMPA 3LX0A 2L9HA 4YCUA 3J81i 3CU7A 1C4QA 5E1FA 2B2VA 4KHZA 2MPMA 2B63B 1IBML 4CJ2C 3VR4A 1Q82C 4GOPA 1JB3A 4Q0FA 1X32A 3GD7A 2ZM6Q 1Q86C 2OQ0A 4BBSB 3NBHA 3BZKA 2XIWA 1IBKQ 4YIJA 4LFAQ 3F8TA 4ZYSA 1FJGQ 1YVCA 3NENA 3SHLA 1HXYD 4KHPL 1SNDA 1I50B 5CV9A 5KNDA 3TP7A 3H09A 3S1QB 4DGZA 1U0LA 1TT2A 1U4PA 4JK1C 2V4DA 1OXXK 2A6EC 1ENAA 5J3BA 2JA6G 1MKHA 2E2HH 1JWMD 4DR7L 5CMDA 5I9PA 1A3TA 2C9OA 5ELDA 4C1NI 4IJHA 2HDMA 1CSQA 3CPWA 1HUNA 3SXHA 3HOWG 1BO0A 4EQPA 1EL0A 1ZEQX 2F0FA 2XWBB 4K6DA 3OTOQ 1Q8KA 4B3RL 1D8LA 4IOAA 1NBWA 1XMQL 1LV9A 1QOHA 4XTCS 5D3DA 3CMEA 3T1YL 4PZ7A 2KCCA 1BBUA 2F0GA 3J80c 3RLNA 1AFPA 4DA2A 4KI0A 1M90C 5A2QE 2E2IH 1EY5A 1RDPD 3S1RH 4Y52H 1VQGA 3PO2G 4L63B 4MZ9A 4ZLTF 1IBLL 1MD2D 4DR4Q 1PZJD 3JAMc 1EZ8A 3A5ZB 4GN5A 4A3IH 1TIID 4IPCA 3S14H 2I5MX 4C3HB 4A3KB 1PA6A 3S9WA 1JOKA 1GUSA 1EUJA 1QVCA 3QJYA 5CYUA 1KQSA 4JI7Q 4R4QA 1EQQA 4BXXH 2R7ZG 2MHVA 4WJWA 4E6IA 2PNRC 2F03A 3S24A 5IYBH 1N36L 3CD6A 2JA5B 2HD3A 4B3SQ 3NBIA 4JI2Q 2PI2E 3BVGA 3VR2A 2K5QA 1WD1A 1HZ9A 2YYZA 4C3JG 1QNUA 3W2DA 2KHIA 2ZJPA 1LABA 1LT6D 3OW7A 5EQ0A 5FOBB 3P75A 1A2TA 4G7OC 2EJMA 1EU3A 4CDDC 4DV5Q 3A8JE 4NW2A 4P2CB 5JEAJ 4H0LC 2F3IA 1TWFH 1QVGA 2GN5A 4TSSA 4RKBA 3F2CA 3HOVG 2SNSA 1S5CD 1EYCA 2Z9HA 3CCEA 5LMNQ 4PZ8A 1BCPD 4DR2L 4A3DH 1A3UA 2F1MA 4DNRB 4OWXB 1AN8A 1Y1WG 1VCIA 1PRTD 2VQFL 1T9HA 1QNKA 3IKJA 4RHSA 3QR8A 1VQ6A 2NWGA 5FLXE 2KCMA 3SR1A 4LW1A 3TBIB 1CM9A 2F0HA 2TSSA 4JG2A 3GTOH 2WFWA 1O7YA 1SMYC 1PTOD 2F3WA 4QCLA 5HGTA 3TRZA 3PUYA 3U4VA 1BCPF 2QKIC 4MN3A 5HURA 3NWSA 4KD3A 4TRDA 2NVTB 1ICWA 1KHIA 5J22A 1ONLA 1I94L 1PRTF 2UUAL 4GNXC 5K36G 5C4JB 1YIJA 5GAHC 3HKZE 1PFNA 4PMWA 3HOXB 2PW7A 3AB9A 1TS2A 3DEPA 4LF7Q 1NR2A 1Y8OB 3L2PA 3D8GA 1PTOF 1FNUA 1SE8A 2K32A 3A54A 4ZUJA 2XSCA 2WB1B 1GKHA 1G291 5CV8A 1U4RA 3OWEB 3K0YA 2UXDL 4KD4A 2N49A 2ZXPA 3I4NB 4HAEA 4QGUA 1FGBD 4GKJQ 1B3QA 2KBNA 2UXBL 2SNMA 1F9RA 1SNMA 1PH8A 3ER0A 1IXRA 2YTXA 3DWQA 3CW2C 3K8AA 1P16A 5KNBA 2B2UC 2L4NA 1KNAA 2UU9L 1EY0A 5IP7G 4HR7B 4XQJA 3NHHA 2MFIA 3J7A5 5HGQA 2J4XA 1PYWD 5A2QL 2NUCA 1KL9A 2ZXRA 1HH2P 4A3EG 3OW2A 1CA5A 4OWWB 3TMEA 3GTLH 4EQ5A 1X9NA 4QIWE 3EFXD 5BN5A 1G6ZA 2BE5D 3PO3H 3F1ZA 2ZJQA 5C3XA 3HOUG 4UY8C 3NXWA 5M3MB 4JOIA 3S2HB 4FVMA 5FO9B 4DR3Q 3TZDA 4DXFA 3BZCA 4FF4A 5LMUQ 3D4RA 3NQTA 3P7JA 3Q6SA 3F2DA 1HFGA 1X3PA 4OELB 4JI1Q 4JBJA 2R93G 3PCOB 4N9PA 1IYUA 2SOBA 2CVRA 4C3IH 4R8IA 2UUBL 2NTSA 4ZCKA 4X65Q 3HOXG 4WJ4A 1WTVA 4M1UB 1L0WA 1PFSA 1N33Q 1DJRD 3K5MA 1YJWA 1XX8A 3BYYB 4KK7A 1KD1C 1LTID 1X65A 1EY7A 1TWHH 2O4XA 3TS0A 3RNUA 3FPPA 4F88A 5FJ8G 2F0WA 5KYLA 3FHWA 3I4NG 2K5NA 4X66Q
chains in the Genus database with same CATH topology
3U9SA 1BOSA 1F2LA 4ZQ3A 5I2YA 1JICA 1B9NA 5FLXL 3MTSA 3A55A 3PIP3 4CJ1B 3K57A 3SDZA 2L1BA 5COYA 2JYOA 3J7AF 5IGDA 3PUWA 4LMQD 4C56C 3BDCA 2KOLA 3DM1A 4O42A 1B2TA 3BYTB 2B8GA 2DNEA 1JWUD 1EYAA 1HQRD 5CORA 3MHBA 2RSOA 4G4KA 3V2TA 1I6VC 3UI2A 4XYOA 1CK1A 1SNOA 2EYOA 1LTRD 2VUMB 2HDLA 1IL8A 3PUZA 1TR5A 2KA7A 2RVLA 2F0KA 4HCEA 1BBXC 3H3VC 1V43A 1XXGA 5JVG3 2Q8TA 1LT5D 1U4LA 1HA6A 3HOZB 3GTMB 5IGEA 5C4XB 5KNCA 4DF7A 1II3A 4RFBA 3R2TA 1SNQA 1TQOA 3G6JB 1A15A 4IALA 2IX3A 3OIPA 1CZGA 3T16A 4BY1B 4FXDA 3K6OA 4BBRB 4HTHA 4XT1B 2YU9B 1BDOA 1SE2A 3R2IA 1S5ED 5M5WB 2E75C 1T5EA 4DK1A 2F0LA 3H94A 3FMCA 1IW7C 3FKIB 1UAPA 4IUPA 3I4LA 2HQEA 2MGSA 3TP8A 1TWGB 3MXUA 4IN3A 4FF3A 5C5MA 4CKEA 2IWHA 5ELFA 3DWAA 1B9MA 4QMGA 2I46A 1EIHA 3DHQA 2EZVA 1Z6HA 1RTNA 1DOMA 1IKLA 4X3TA 3QOLA 4IFDH 2F0NA 3OOCA 2B2TC 2F4IA 3GTGB 3EVQA 4RAUC 2IW3A 4RA8A 1O80A 3QG1A 2JA7B 3J81L 3MWYW 3QO2A 3GTQB 1NUCA 4TKOB 2CQAA 3ERQA 4KY5A 1YNNC 4C1NK 3DUZA 1TY0A 3L7ZC 5EGTA 1AEXA 3A8KE 3DEOA 3I8ZA 1EFID 4IUQA 1VF7A 2KJXA 2F0VA 2J0TD 1RJTA 1EY4A 2NZ1D 2AUJD 4FF2A 2JEAI 3CHBD 4V190 1HA5A 3MXGA 1ET6A 1FNVA 3SVMA 3J80E 4FXKC 1A3VA 1D5ZC 4FF1A 2ZT9C 4IQZA 3C2PA 3PV0A 4ZKBB 2CW0C 2GA4B 2JA6B 2A68D 1A6XA 3JAME 2FHTA 4M8AA 2Z8LA 3MA2B 2XRQD 2K04A 3HOWB 5LHY1 1ML0D 2K7VA 4G7HC 1SMYD 2JSOA 3I3CA 1M4VA 2BCOA 5BN3A 3NQIA 2PZTA 2VNUD 4KHVA 4BS9A 2OEOA 3D31A 4IUTA 3VYSA 4QB4A 2DY8A 4K2LA 2X6LA 3TDQA 3D3RA 4S3SA 2AQ2B 3WDNA 2A74C 3NSWA 3D6CA 3PO2B 1GHJA 3AU7A 5T1IA 1CA6A 2KECA 2NBFA 1JQYD 4EQOA 1HPCA 2Z4IA 4OIKA 1VMCA 3C46A 4C3IG 2DY7A 1RODA 4KN7C 4DFAA 1SFOB 1CQVA 1D1KA 2R7ZB 5I9OA 2XVSA 1DOKA 3D4WA 2E2DC 1U9RA 2PQEA 5KRUA 1RCVD 4C3JB 1J9OA 2XNAC 3WOEA 1Y8PB 1ENFA 1XTCD 2NTTA 2WKCA 2N88A 1JR0D 2M00A 5IGGA 4IUVA 3VYUA 1PMRA 4R8NA 3HOVB 2WINB 2D2CC 1SAPA 1XWEA 1EQVA 1Y1WB 5EPJA 1SE3A 1G8ZD 3SK5A 1B50A 4OL7A 4K2KA 4NKLA 5C44B 1GUOA 1GUTA 2PPBC 1TWCB 3FPUB 4XXEA 2A69D 5C0XH 2DN8A 1B3AA 1NR4A 3CKIB 1TS4A 4K8IA 3SK4A 3BDLA 2KEEA 4IUUA 3C1EA 3J80L 2EXZA 3GQBA 1E2ZA 4CHTB 4KKSA 2EJGC 2O5JC 2ENBA 4KKTA 1KLUD 3JAML 4FXGC 1GUGA 5DNFA 3BG3A 1ILQA 4HSVA 1EQTA 1R4PB 1AP0A 3L9AX 5DM63 2NVQB 2EDGA 5FKAC 1EOTA 3HP3A 2QCPX 2K5WA 1LACA 1QG7A 4RGTA 3ONAB 1AZQA 4RKLA 3R8BA 1SJED 3A7LA 1GUWA 1Z47A 4A3EB 4DN4M 4DNTB 5JJZA 4PMBA 3T4AC 4A3JB 5DM73 1V8QA 4JBWA 3HOUB 3I4MB 2SEBD 5G3LD 3OWFA 5FK9C 1CI3M 2X6GA 4G7ZC 2NVXB 3KBGA 1SYEA 2R93B 2E76C 1ZXTA 4FNFA 2K33A 1GXDC 2A6HC 4IFDG 3TSSA 5EKLA 3BS1A 5G3LF 5KIXA 1STAA 2B2TA 1JOOA 4B9XA 1K8MA 3SEBA 1L0YB 1QWYA 4DU9A 5IGFA 2EYFA 1D2BA 1QB5D 2EY5A 3FVQA 1LTGD 2F0OA 3CQZB 2IX1A 4DAVA 2F0PA 1IW7D 2F0TA 1CQFA 2Y0SB 4DK0A 3MXPA 2LFNA 4ZK9B 4UAIA 4XQQA 1GJXA 3KUPA 4BWGB 5C5LA 1YNJC 2Z1CA 1Q1BA 1Q1EA 3QWNA 3K58A 1H9KA 3ND8A 2OXPA 2HCIA 2LKVA 5I4DA 4HN7A 5IGCA 2E2HB 4X3KA 1O78A 1EY9A 3I90A 3URYA 4F87A 4X3SA 2XRSD 5C6AA 5JPMC 2K03A 3KLSX 3R3OA 5FO8B 1EEFD 2FMMA 2ICIA 4PQXA 1YNND 1SJHD 4IZ8A 5I2XA 1ZKOA 4RGNA 4QUFA 4WFN3 2E2IB 4CKCA 3S1RB 3NP8A 3H91A 3HZXA 1H9SA 1WTWA 5CV6A 1JCKB 4B08A 5TSSA 3Q24A 5BN4A 1DONA 1UEAB 4A3IB 5EBDA 2RDHA 3S14B 1JC7A 4LK1C 3Q23A 1WTQA 4RHRA 3K5OA 3J81E 2KQ3A 2L0CA 1ENCA 1F2ZA 2CW0D 3M7GA 2LY7A 1K8OA 4CKBA 1RHPA 1QILA 1EZ6A 1Z7TA 1SNCA 3V96A 3BDOA 3MFYA 5IGBA 3M4YA 1OXVA 3RLFA 3KLSA 5ELEA 1TWFB 1MI2A 1PTOH 4XDXA 4J1MA 1KDAA 3BZDB 4I65A 4A3DB 1BCPC 1H9MA 1STHA 4ZAIA 4OO1H 1JORA 5JPNC 1RD9D 3OPOA 4KY6A 2FINB 3GTOB 1NAPA 2AUKA 2ZXOA 4K5VA 1DZ1A 4L6TB 3DWPA 3HRZC 3Q22A 4KN4C 2IX0A 1W6JA 1ZYRC 4K8JA 3T56B 1VDZA 5IODA 1SNPA 1H9JA 4PV1C 5IT9L 3BVZA 3ITPA 4DAYA 5J39A 2N55A 3VYTA 1HFNA 1D5XC 3M7NA 1SBBB 3VYRA 2KEDA 2A6ED 2PO4A 1SSOA 1SYCA 4J6HA 3NE5B 2I07B 3TP5A 5K5PA 2IPKD 3N6RA 3MVVA 2F0JA 1STYA 4TQUS 1C48A 4KJOA 4RH6A 1KLGD 1RF2D 4IFDI 3X3NA 3HEJA 4WORA 2RQXA 1Q3LA 3N52A 2BA0A 2D62A 3HG9A 5D3IB 3GTLB 4EVOA 3PO3B 1GHKA 3EROA 3F2UA 2A73B 1RKNA 4DXGA 4CJ0B 1TS3A 3MEHA 2BOSA 1F2MA 4MHEA 4NMZA 3V05A 5IIFA 1Q90A 1UUPA 2QILA 4C3IB 3GO5A 3EA6A 5JVH3 1V1PA 1TWHB 5EKKA 5JEAH 2VXWA 2VB2X 4NP5A 3NK9A 1IHZA 1GUNA 4X3UA 1F9PA 3IAYA 1E0BA 2L55A 1NSNS 2EOTA 1EY8A 2PZUA 4MIUA 2QDBA 3MFGA 4L8JA 5EKIA 4I7ZC 1WVLA 4ZRZA 1OXUA 5LL6X 2EE1A 3WOFA 1KNEA 1DYQA 1EYDA 3TP6A 5LL6S 3GV6A 1MSGA 3RZOB 1Y1VB 1PXUA 1G2TA 2XN9C 1G91A 2A6HD 1LTBD 4WRDA 3H0GB 3NTIA 1MGSA 2B2WC 5M3FB 1AZPA 1C8CA 5EPLA 1IYVA 1LT4D 3VR5A 1BUVT 3PMFA 1JE4A 3OHXC 3T53B 2Q8RE 1STNA 2RA4A 3QOJA 4DAPA 2C5CA 1FD7D 4Y7NB 1EY6A 2J7ZA 4B9WA 5C4HA 1CHPD 1I4RA 3DXJC 3MXNA 5CV7A 3KK7A 1DOLA 1EWHA 3AMUA 1BXTA 3MZ5A 1I6HB 3VA7A 1YNJD 3IFDA 2PW5A 3OMGA 2L5TA 4RGOS 4RCNA 2Q8IB 1WCMB 2CHBD 1L0XB 2E2JB 3Q0AA 1QE6A 4H13C 2B39A 3J7YW 4HSPA 5C0XI 2F0MA 4GZYC 3SE0A 3G7LA 1W6KA 4G57A 1D5MC 4NDXA 4OHJA 1B44D 1LTTD 1F9QA 3HGBA 5C3EB 1E2WA 1HUMA 2JXMB 2ID0A 2KCNA 3I73A 2PZWA 3P20A 2MUYA 1JWSD 4KMUC 4XIGS 4F8MA 1F77A 3I70A 3E6ZX 3CRKC 1ESFA 3R93A 1WTOA 4OO1G 1M8AA 2RBMA 1LT3D 1WD0A 4IFDJ 3TZUA 3M3YB 4UDUC 4A3MB 3TN2A 3M85A 1BF4A 3IFTA 1B53A 2EYMA 5ELCA 5J1ZA 3D4DA 1T5XD 2WAQB 1BNZA 1O7ZA 4AYBB 2NB0A 2PYKA 2TMPA 1WTXA 4PMCA 1FYCA 1S5FD 1B1ZA 1OXSC 3K5NA 3NTHA 2JA8B 3RD4A 1HRJA 1S5BD 1ESRA 1F9SA 1QCBD 4K14A 2EY1A 2QEJC 1SYFA 4ODGA 2XWJB 4KJNA 1B4OA 5C4ZA 1KAAA 2M9VA 2NVYB 3FEWX 1CT1D 2FJ2A 5CC4A 1CZWA 2E74C 1QJOA 4H7BA 2HCCA 2A68C 1H9SB 3FRPB 2IJ0A 3LWEA 5EBCA 1DM0B 2KUMA 3H6MA 3GTPB 1K83B 1I4HA 3S1NB 3I91A 3M4OB 3K7AB 2EY6A 4K5WA 5D14A 1VF5C 5CBEE 3X3MA 2NN6I 4HMIA 1ILPA 1HCZA 3C3LA 2Z4HA 1TY2A 3S16B 4OGQC 1ZYRD 2OF1A 5F2DA 5CV4A 5EJWA 1OXTA 4A3GB 2EYPA 2R92B 1FNWA 2NN6H 4RGMA 4C3HG 3NUCA 1IKMA 5M5XB 2DNCA 1I4XA 1HTLD 5CGKA 3GTJB 4N9TA 1CTMA 3SK6A 2BDNA 4ILWA 1SEBD 4HCSA 2RDFA 2EY2A 5JEAG 2RDGA 2WKDA 5KGUA 4Q5VA 2K1BA 4A93B 4RWSC 2IT1A 3L3OC 1V1OA 2PMZB 5DAUA 1OO9B 2K6AA 2QF7A 5IT9E 4FYDA 2VB3X 1RTOA 3PUVA 4C2MB 5M5YB 4F7XA 1TU2B 1KTKA 2B2YA 1PLFA 2EPBA 4ME5A 1STBA 2ICEC 3NWTA 3GV3A 4ULLA 2JEBI 3LWUA 4V0BA 4XYQA 3KLRA 1PFMA 2HUGA 1BR9A 5A35A 1I3QB 1WTRA 4K5XA 4ABNA 1Q8IA 4FO2A 4KKUA 1D1IA 3NPPA 5D65A 1R4QB 3FDTA 3EJIA 3VA5A 2A69C 3PUXA 1TS5A 2B2VC 2R61A 2WP8J 3SK8A 2WACA 2F3VA 2B2WA 5C0XJ 4EQNA 5I6WA 3W3AA 2BA1A 3QB3A 5E4WC 3A8IE 2JE6I 1E2VA 3IL8A 5FO7B 1LLRD 1SDFA 2R6GA 5JAVA 1D6EC 2LMCB 5CBAE 4U68A 2A5HA 2K01A 4R9WA 1PDQA 1BQQT 3E5SA 2WIIB 4IURA 1HTPA 2O5IC 1R9TB 2AQ3B 1SYBA 5T1GA 4OO1I 2MP1A 4Z9CB 1MSHA 4EGVA 3U9OA 1SXTA 3VR3A 1HHVA 1SYDA 2LS01 1I4QA 5CV5A 4LAAA 1V1PB 2F0DA 1G2SA 1PZKD 1PRTC 1WTPA 2K28A 1TVXA 5I6YA 2H1EA 1SYGA 2KHSA 1CFMA 2NYZD 1F2YA 4CBVA 1ET9A 1PFBA 5ELBA 1LTSD 3A56A 1STGA 5C0XG 1KDBA 4H44C 4ID6A 3P1HA 1PTOC 1UNSA 1FR3A 1U4MA 2FFKB 2EYLA 2F0QA 1J8IA 5M9OA 4FP5D 5CR3A 1CHQD 1A2UA 1S5DD 1DXMA 4KTAA 3BVMA 3T13A 2RSNA 2K5DA 2JP1A 5E4XA 1SE4A 2RKSA 5E3FA 1DCZA 2EJFC 1KABA 3MC0B 4BA1I 3GTKB 1H9RA 3RMHA 2PCFB 2H4OA 4OIJA 1GOZA 1NCVA 3K5LA 3RUZA 1MBYA 3RZDB 2AWOA 2BDOA 4HMJA 2L11A 3HKZB 3LNNA 5JOBA 3OIQA 3CRLC 3D6WA 4K6LA 4LJZC 1EU4A 3S17B 1EEID 1X3QA 1O7LA 2G9DA 2M2LA 4CGYB 5DEHA 2BE5C 2EVBA 5NUCA 2IL8A 3QIAA 4U673 3O13A 5K36H 4KV6A 5EPKA 3J7AV 1LTAD 4ZUIA 1STEA 1EWCA 2X69A 3DMUA 3VR6A 1TWAB 3E0JA 3OSOA 4BY7B 2G9HD 1DD2A 4XT3B 4QIWB 3ND9A 2F0IA 3KF8A 4XQNA 1Q12A 1LO5D 5KEEA 4A3BB 2NN6G 3NTKA 3S2DB 2AWNA 1TKWB 2OT2A 3GP7A 2L12A 2FMCA 1I4PA 4KY7A 4RCOA 3S15B 1I4GA 2R3ZA 3OMCA 2D5DA 2WV6D 1S4ZA 4O1NA 1Y69U 2B2YC 1AW7A 1Y8NB 3I72A 2F0SA 5KYIA 3S1MB 1BCPB 1XYIA 4QF4A 4QUCA 4A3FB 1JOQA 1PRTB 3KBXA 2B2UA 2F0EA 3K59A 3PIO3 3HOYB 2F0UA 4IUNA 2EYHA 3EQLC 2K05A 2D9UA 3ZYYX 4ZKCB 2EYJA 3T51B 1PTOB 2B8FA 2O2LD 1EIGA 4BA2I 2AQ1B 4PNYA 1HQMC 5IOCA 1PZID 1KDCA 2SDFA 4HEDA 5ISRA 2KVMA 4J8QA 3MAQA 3C1FA 3HS0C 5AFWA 2MJ8A 3A7AB 1VMPA 3LX0A 2L9HA 3CU7A 1C4QA 5E1FA 2B2VA 4KHZA 2MPMA 2B63B 4CJ2C 3VR4A 1JB3A 4Q0FA 1X32A 3GD7A 4BBSB 3NBHA 2XIWA 4YIJA 4ZYSA 3SHLA 1HXYD 1SNDA 1I50B 5CV9A 5KNDA 3TP7A 3H09A 3S1QB 4DGZA 1TT2A 1U4PA 4JK1C 2V4DA 1OXXK 2A6EC 1ENAA 1JWMD 5CMDA 5I9PA 1A3TA 2C9OA 5ELDA 4C1NI 2HDMA 1HUNA 3SXHA 1BO0A 4EQPA 1EL0A 1ZEQX 2F0FA 2XWBB 4K6DA 1LV9A 1QOHA 4XTCS 5D3DA 2KCCA 2F0GA 1AFPA 4DA2A 4KI0A 5A2QE 1EY5A 1RDPD 4L63B 4ZLTF 1MD2D 1PZJD 1EZ8A 1TIID 4C3HB 4A3KB 3S9WA 1JOKA 1GUSA 5CYUA 3QJYA 2MHVA 4WJWA 4E6IA 2PNRC 2F03A 2JA5B 3NBIA 3BVGA 3VR2A 2K5QA 1WD1A 2YYZA 4C3JG 1QNUA 3W2DA 1LABA 1LT6D 3OW7A 5EQ0A 5FOBB 3P75A 1A2TA 4G7OC 2EJMA 1EU3A 3A8JE 4NW2A 4P2CB 5JEAJ 4H0LC 4TSSA 4RKBA 2SNSA 1S5CD 1EYCA 1BCPD 1A3UA 2F1MA 4DNRB 1AN8A 1VCIA 1PRTD 1QNKA 3IKJA 4RHSA 2NWGA 5FLXE 3SR1A 3TBIB 1CM9A 2F0HA 2TSSA 1O7YA 1SMYC 1PTOD 2F3WA 4QCLA 5HGTA 3PUYA 1BCPF 5HURA 4MN3A 2QKIC 3NWSA 4KD3A 4TRDA 2NVTB 1ICWA 5K36G 5J22A 1ONLA 1PRTF 5C4JB 1PFNA 4PMWA 3HOXB 2PW7A 3AB9A 1TS2A 3DEPA 1NR2A 1Y8OB 3D8GA 1PTOF 1FNUA 2K32A 3A54A 4ZUJA 2XSCA 2WB1B 1G291 5CV8A 1U4RA 3OWEB 3K0YA 4KD4A 2ZXPA 3I4NB 4HAEA 1FGBD 2SNMA 1F9RA 1SNMA 3DWQA 5KNBA 2B2UC 2L4NA 1KNAA 1EY0A 4HR7B 4XQJA 3NHHA 2J4XA 1PYWD 5A2QL 2NUCA 2ZXRA 1CA5A 3TMEA 3EFXD 5BN5A 1G6ZA 2BE5D 5C3XA 3NXWA 5M3MB 3S2HB 4FVMA 5FO9B 3TZDA 4DXFA 4FF4A 3D4RA 3NQTA 3P7JA 3Q6SA 1HFGA 1X3PA 4N9PA 1IYUA 2SOBA 2CVRA 4R8IA 2NTSA 1WTVA 4M1UB 1DJRD 3K5MA 1XX8A 3BYYB 4KK7A 1LTID 1EY7A 2O4XA 3FPPA 4F88A 2F0WA 5KYLA 5C3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q L;  3J7A V;  3J80 L;  5FLX L;  5IT9 L;  3J81 L;  3JAM L;  5LL6 X; 
#chains in the Genus database with same CATH topology
 3U9S A;  1BOS A;  1F2L A;  4ZQ3 A;  4X64 L;  5I2Y A;  1JIC A;  4DV0 L;  2F4V Q;  4A3C H;  1HNW Q;  1B9N A;  5FLX L;  1SMX A;  4LUZ A;  3MTS A;  3A55 A;  2RF4 A;  2Y0S G;  3PIP 3;  4CJ1 B;  4MTK A;  3SDZ A;  3K57 A;  1VQL A;  2L1B A;  5COY A;  2JYO A;  2LSS A;  3J7A F;  2XGT A;  5IGD A;  3PUW A;  4LMQ D;  4C56 C;  3BDC A;  4POG A;  2KOL A;  3DM1 A;  4O42 A;  1B2T A;  3H3V I;  3BYT B;  2B8G A;  2DNE A;  1IYJ B;  2I5L X;  1RIP A;  1JWU D;  1EYA A;  1CKN B;  1HQR D;  1XPR A;  4LF6 L;  5COR A;  2CCZ A;  4L5S A;  3MHB A;  3H3V H;  1JT8 A;  2RSO A;  4G4K A;  3V2T A;  2AKW B;  1I6V C;  3UI2 A;  4XYO A;  3H0G H;  1CK1 A;  1Q7Y C;  3RLO A;  1SNO A;  2CWA A;  5M3F H;  2EYO A;  1LTR D;  2OTJ A;  2VUM B;  4GNX B;  4JV5 Q;  3TRE A;  2HDL A;  3HKS A;  1IL8 A;  3PUZ A;  5ELN A;  1TR5 A;  2KA7 A;  2RVL A;  4LF4 L;  4YCV A;  2F0K A;  4HCE A;  2ATW A;  1BBX C;  1VQC A;  1C0A A;  3H3V C;  1V43 A;  1XXG A;  5JVG 3;  2Q8T A;  1LT5 D;  1U4L A;  1HA6 A;  3HOZ B;  3GTM B;  5IGE A;  5C4X B;  5KNC A;  4DF7 A;  1EQR A;  1II3 A;  4I7A A;  4Y7N H;  4RFB A;  3R2T A;  1EWI A;  1SNQ A;  1TQO A;  5IT9 c;  3G6J B;  1A15 A;  4IAL A;  1GO3 E;  2IX3 A;  4LFB L;  4X62 Q;  3OIP A;  1CZG A;  3T16 A;  4BY1 B;  4DV1 L;  4FXD A;  2A1A A;  3PQI A;  3K6O A;  4BBR B;  4HTH A;  4DR5 L;  1I6H H;  4A3I G;  4XT1 B;  2YU9 B;  5JJI A;  1BDO A;  2LXJ A;  3TEH B;  1E3P A;  1HZB A;  1SE2 A;  4NXN L;  3R2I A;  3ZJY C;  1S3O A;  1S5E D;  5M5W B;  2E75 C;  4BXX G;  1T5E A;  4DK1 A;  2F0L A;  2E2J H;  3H94 A;  1K8A C;  3FMC A;  1IW7 C;  3FKI B;  1HNX Q;  5IYB G;  1UAP A;  1AE3 A;  1K3R A;  2QDL A;  4IUP A;  3I4L A;  1D7Q A;  2HQE A;  2MGS A;  3TP8 A;  3EBE A;  1TWG B;  4PZ6 A;  3MXU A;  4IN3 A;  1VQM A;  4FF3 A;  4JVZ A;  5C5M A;  4JI8 L;  4CKE A;  2IWH A;  5ELF A;  3DWA A;  1B9M A;  2R7D A;  4QMG A;  5C3E H;  4AYB E;  4OWT B;  2I46 A;  2HT1 A;  1EIH A;  3DHQ A;  2EZV A;  1ICF B;  4A3D G;  4UP9 A;  1Z6H A;  2CH4 W;  1RTN A;  2Q2H A;  3NEM A;  1DOM A;  2IHF A;  1IKL A;  4X3T A;  3QOL A;  3J81 c;  4IFD H;  1K3B C;  2F0N A;  1YJ9 A;  3OOC A;  2B2T C;  4A76 A;  2YV5 A;  2F4I A;  3NBH B;  3GTG B;  3EVQ A;  3KLW A;  2IW3 A;  4RAU C;  4RA8 A;  2OWO A;  3AEV A;  1O80 A;  3QG1 A;  3RR5 A;  2JA7 B;  1LTL A;  4YWK A;  3MWY W;  3QO2 A;  3J81 L;  3M3Y H;  3GTQ B;  3Q8D A;  1NUC A;  4A3M H;  1YEZ A;  2CQA A;  3ERQ A;  4TKO B;  1N34 L;  4KY5 A;  1YNN C;  4C1N K;  4AQY L;  2YTV A;  1KRS A;  3DUZ A;  3KF6 A;  1KC8 C;  1TY0 A;  4HJ8 A;  3L7Z C;  5EGT A;  4PG3 A;  1AEX A;  3A8K E;  4DV4 L;  2VL6 A;  3DEO A;  2JA8 H;  1YHA A;  3I8Z A;  3IRB A;  1EFI D;  2Z0S A;  4IUQ A;  1VF7 A;  2KJX A;  2F0V A;  4LWC A;  4HID A;  2J0T D;  1RJT A;  1EY4 A;  2NZ1 D;  2AUJ D;  2DUD A;  4FF2 A;  4JI4 L;  2JEA I;  3CHB D;  4EX5 A;  1HA5 A;  4DV2 L;  4V19 0;  3MXG A;  1K8G A;  1ET6 A;  3UDG A;  1FNV A;  3SVM A;  3J80 E;  3KOJ A;  4FXK C;  2NVY H;  2BH2 A;  1A3V A;  1D5Z C;  3RN2 A;  4FF1 A;  2IY5 B;  1VQP A;  2ZT9 C;  4IQZ A;  3C2P A;  4JOI C;  4DNI A;  3PV0 A;  4ZKB B;  2CW0 C;  3I4M H;  2GA4 B;  2JA6 B;  2A68 D;  3VDY A;  1SLJ A;  4A3L H;  1A6X A;  4GN3 B;  3JAM E;  2FHT A;  4M8A A;  4JI0 Q;  2Z8L A;  3MA2 B;  1HNZ L;  2KHJ A;  2XRQ D;  2K04 A;  3HOW B;  2WB1 E;  3GTP H;  5LHY 1;  1ML0 D;  2K7V A;  4G7H C;  3S1N H;  1SMY D;  2JSO A;  2R7F A;  3I3C A;  1M4V A;  2HHH Q;  3M4O H;  2BCO A;  5BN3 A;  3NQI A;  1NNX A;  2PZT A;  1YI2 A;  2VNU D;  4KHV A;  4BS9 A;  2OEO A;  3D31 A;  4IUT A;  3VYS A;  4QB4 A;  3PO3 G;  3TQY A;  4B3M L;  2DY8 A;  1A63 A;  4K2L A;  4JI6 L;  3S16 H;  2X6L A;  3TDQ A;  3D3R A;  4S3S A;  4DR6 Q;  2AQ2 B;  1Q81 C;  1XNR L;  3WDN A;  2A74 C;  3NSW A;  3D6C A;  3PO2 B;  2JQO A;  4A3G H;  5C3W A;  2C35 B;  2R92 H;  1GHJ A;  3AU7 A;  5T1I A;  1CA6 A;  2KEC A;  2NBF A;  1SR3 A;  2Q2I A;  4NXM Q;  1JQY D;  2YTY A;  3K80 C;  4EQO A;  1HPC A;  2Z4I A;  4OIK A;  1CKO A;  5M5X H;  1VMC A;  3C46 A;  4C3I G;  2DY7 A;  1ROD A;  4KN7 C;  2VQE Q;  2ZM6 L;  1V1Q A;  2KCT A;  4DFA A;  3U50 C;  4QJF A;  1CQV A;  3GTJ H;  1SFO B;  3PF4 A;  1D1K A;  4DV3 L;  1GVP A;  2R7Z B;  1E1O A;  5I9O A;  2XVS A;  1YNX A;  1DOK A;  3D4W A;  2E2D C;  1U9R A;  3CCM A;  1KIX A;  2PQE A;  2FXQ A;  4P73 A;  5KRU A;  1RCV D;  4C3J B;  4NB3 A;  1J9O A;  4A93 H;  4O2D A;  4R4C A;  2UUC L;  2XNA C;  3WOE A;  1Y8P B;  1ENF A;  1XTC D;  2E8G A;  4A3C G;  2NTT A;  2WKC A;  2OCE A;  1IBM Q;  2N88 A;  1JR0 D;  2M00 A;  5IGG A;  2ALY B;  4IUV A;  3VYU A;  1CUK A;  1PMR A;  4R8N A;  4YHH Q;  3HOV B;  2WIN B;  2D2C C;  3D0F A;  1SAP A;  1XWE A;  4C2M H;  5M5Y H;  3CPF A;  5IWA L;  1MHW C;  1EQV A;  1Y1W B;  1PH1 A;  4QQB X;  5EPJ A;  3LGJ A;  3PGZ A;  1SE3 A;  1G8Z D;  2UXC Q;  4DUZ L;  3SK5 A;  4LF9 Q;  1B50 A;  4OL7 A;  4K2K A;  4NKL A;  4DR7 Q;  5C44 B;  1I3Q H;  1GUO A;  2K52 A;  1GUT A;  4HJ9 A;  2PPB C;  1TWC B;  3NEL A;  3FPU B;  4XXE A;  2A69 D;  5C0X H;  4B3T L;  5GAD C;  2DN8 A;  1B3A A;  1NR4 A;  3CKI B;  1TS4 A;  2P5Z X;  4K8I A;  3SK4 A;  3BDL A;  3H0G G;  2KEE A;  4IUU A;  1YHQ A;  4B3R Q;  3GDE A;  3C1E A;  3J80 L;  2EXZ A;  3GQB A;  5M3F G;  2K75 A;  2Z6B A;  1E2Z A;  4CHT B;  4KKS A;  2VY3 A;  1N32 L;  4UP8 A;  2EJG C;  2O5J C;  1VQD A;  4DPG A;  2ENB A;  2OTL A;  4J15 A;  5AJ3 L;  4DV6 Q;  4KKT A;  1KLU D;  3JAM L;  3CCU A;  4FXG C;  5L37 A;  1GUG A;  5DNF A;  3G71 A;  3BG3 A;  5GQO A;  1Q46 A;  1ILQ A;  1X3G A;  4B3S L;  4JI2 L;  4HSV A;  1A62 A;  1EQT A;  5GAG C;  1WTH A;  1IBL Q;  1R4P B;  1AP0 A;  4JYA Q;  3L9A X;  4R1J A;  4DR1 L;  5DM6 3;  2NVQ B;  2EDG A;  5FKA C;  1EOT A;  3HP3 A;  2QCP X;  2K5W A;  1HZA A;  4DV5 L;  1UE5 A;  5LMN W;  1LAC A;  1QG7 A;  4RGT A;  1BBW A;  3ONA B;  1AZQ A;  4RKL A;  1R9T H;  5LMN L;  3R8B A;  2MO0 A;  1SJE D;  1N36 Q;  4ALP A;  3A7L A;  1X6O A;  3EN2 A;  1GUW A;  1Z47 A;  1TXY A;  4A3E B;  1E24 A;  4DN4 M;  4DV7 L;  1A8V A;  4DNT B;  5JJZ A;  4PMB A;  3T4A C;  4A3J B;  5DM7 3;  1V8Q A;  4JBW A;  3HOU B;  2MNA A;  3I4M B;  2SEB D;  5C44 G;  5G3L D;  1UWV A;  4RMF A;  1PH3 A;  3OWF A;  4CDC C;  5FK9 C;  1CI3 M;  2X6G A;  4G7Z C;  2NVX B;  4DR2 Q;  5C3E G;  3KBG A;  1U5K A;  1SYE A;  2VS1 A;  2R93 B;  2AMC B;  2E76 C;  1ZXT A;  1VQ4 A;  4FNF A;  2K33 A;  1FGU A;  1GXD C;  2A6H C;  1Y14 B;  4H02 A;  4LF7 L;  4IFD G;  3TSS A;  4WJ3 M;  2PNH A;  1VS0 A;  5EKL A;  3BS1 A;  5G3L F;  5KIX A;  1G51 A;  1STA A;  2B2T A;  1JOO A;  4B9X A;  4AH6 A;  1K8M A;  3SEB A;  1LYL A;  3CAM A;  1L0Y B;  1QWY A;  4DU9 A;  5IGF A;  4GKJ L;  5GRO A;  4A3M G;  2E5L Q;  3I4O A;  4LF8 Q;  2EYF A;  4R4T A;  3GTK H;  2K4K A;  3PIO A;  1D2B A;  1QB5 D;  2EY5 A;  2QEX A;  3FVQ A;  1LTG D;  2F0O A;  3CQZ B;  1XNQ L;  2IX1 A;  4DAV A;  2F0P A;  1EYG A;  1CKM A;  2WAQ G;  2D0O A;  1IW7 D;  2F0T A;  3B6Y A;  5FLM H;  1CQF A;  2Y0S B;  3RZD H;  4DK0 A;  4P75 A;  3MXP A;  1W2B A;  1PYB A;  2JA8 G;  1K0R A;  3F2B A;  2LFN A;  4ZK9 B;  4UAI A;  4XQQ A;  4OXP A;  1GJX A;  3KUP A;  4BWG B;  4JI3 Q;  1IL2 A;  5JJK A;  5C5L A;  3S17 H;  1YNJ C;  2Z1C A;  1Q1B A;  4HIO A;  4YWL A;  3A5U A;  1Q1E A;  3QWN A;  2UXB Q;  3K58 A;  1K28 A;  4A3J G;  1H9K A;  4OX9 L;  3ND8 A;  2OXP A;  2HIV A;  1WFQ A;  2HCI A;  2HQL A;  2UU9 Q;  1X3E A;  2LKV A;  1VQN A;  1VQE A;  3I4M G;  1LM0 A;  5I4D A;  4DR3 L;  4HN7 A;  5IGC A;  2E2H B;  4X3K A;  1O78 A;  4A3L G;  5LMU L;  1EY9 A;  3I90 A;  3A74 A;  3URY A;  4F87 A;  4JI1 L;  4X3S A;  2XRS D;  3CCL A;  1OTC A;  5C6A A;  5IYD H;  5JPM C;  2K03 A;  1PH2 A;  3KLS X;  3R3O A;  5FO8 B;  4X65 L;  1EEF D;  1WI5 A;  2FMM A;  1N33 L;  2ICI A;  4BY7 H;  4DAY B;  1UE1 A;  4PQX A;  1YNN D;  1SJH D;  3I7F A;  1JJC B;  4IZ8 A;  5I2X A;  1ZKO A;  4RGN A;  1XMO L;  4QUF A;  4WFN 3;  2E2I B;  4X66 L;  4CKC A;  3S1R B;  3NP8 A;  3H91 A;  3HZX A;  4A3G G;  1H9S A;  1WTW A;  2R92 G;  2F4V L;  5CV6 A;  1JCK B;  4A3B H;  1HNW L;  4B08 A;  3S2D H;  5TSS A;  3Q24 A;  2UUB Q;  5BN4 A;  1DON A;  1UEA B;  4A3I B;  5EBD A;  2RDH A;  3S14 B;  1JC7 A;  4LK1 C;  3Q23 A;  1ASZ A;  1WTQ A;  1HR0 Q;  4RHR A;  3K5O A;  1O7I A;  1K0S A;  3CCR A;  5BR8 Q;  3J81 E;  2KQ3 A;  2L0C A;  1ENC A;  1F2Z A;  2CW0 D;  4UHV A;  3M7G A;  2LY7 A;  4JI5 L;  2A19 A;  2HIX A;  1K8O A;  3S1M H;  4DV0 Q;  2DJG C;  4CKB A;  1RHP A;  1QIL A;  4A93 G;  4A3F H;  1EZ6 A;  1Z7T A;  3K0X A;  1SNC A;  3RZO H;  4GLX A;  1Y1V H;  3V96 A;  3BDO A;  4LF5 L;  3UE1 A;  3MFY A;  5IGB A;  3E3X A;  3M4Y A;  1OXV A;  3RLF A;  3KLS A;  3HOY H;  5ELE A;  1TWF B;  1WOC A;  1MI2 A;  1PTO H;  4XDX A;  4J1M A;  1KDA A;  2D0P A;  3KF6 B;  3BZD B;  3L0O A;  4I65 A;  4A3D B;  5IYC H;  4APV A;  1BCP C;  4IOC A;  1H9M A;  1L2F A;  1STH A;  2CKZ B;  4ZAI A;  4OO1 H;  1JOR A;  5JPN C;  1RD9 D;  3OPO A;  4KY6 A;  2FIN B;  3GTO B;  1NAP A;  2AUK A;  1FVI A;  2JA9 A;  2ZXO A;  4K5V A;  1DZ1 A;  1M1K C;  3HFZ B;  4L6T B;  4X62 L;  3DWP A;  3BU2 A;  3HRZ C;  3Q22 A;  1I5F A;  4KN4 C;  3AYH B;  2B63 H;  2IX0 A;  1W6J A;  1ZYR C;  4LF4 Q;  4K8J A;  4FDB A;  1VDZ A;  3T56 B;  5IOD A;  1SNP A;  1H9J A;  4O0A A;  4BBS H;  3A0J A;  4A75 A;  4PV1 C;  5IT9 L;  3BVZ A;  5JJL A;  3ITP A;  1PH4 A;  1WCM H;  1PVO A;  4DAY A;  5J39 A;  3G4S A;  2N55 A;  3VYT A;  1HFN A;  1D5X C;  1EIF A;  3M7N A;  1HNX L;  1E7Z A;  1I50 H;  1SBB B;  1Z9F A;  2KED A;  3VYR A;  2F52 A;  2A6E D;  2PO4 A;  3S1Q H;  1SSO A;  1SYC A;  4DV1 Q;  4J6H A;  3I2Z A;  3NE5 B;  2I07 B;  3TP5 A;  5K5P A;  4HJA A;  4DKA C;  1HJP A;  2IPK D;  3N6R A;  3MVV A;  2F0J A;  1STY A;  4TQU S;  1X3F A;  1C48 A;  3U4Z A;  4KJO A;  4RH6 A;  1KLG D;  1RF2 D;  4IFD I;  3X3N A;  1AH9 A;  3HEJ A;  4WOR A;  4N8X 1;  4DK3 C;  2RQX A;  2VW9 A;  2I0Q A;  1Q3L A;  3N52 A;  2BA0 A;  2D62 A;  3HG9 A;  5D3I B;  1XPO A;  3GTL B;  4EVO A;  1VQ8 A;  3PO3 B;  4JI8 Q;  1GHK A;  3ERO A;  3F2U A;  5IP9 H;  1QZG A;  3CC4 A;  2A73 B;  1RKN A;  1WJJ A;  4GS3 A;  4GKK L;  4R4O A;  4DXG A;  4IPD A;  3EIV A;  3T1H L;  4CJ0 B;  1J5E L;  1TS3 A;  4R4I A;  3MEH A;  2K5H A;  2BOS A;  1F2M A;  4MHE A;  3CCS A;  4NMZ A;  3V05 A;  5IIF A;  1Q90 A;  4C3H H;  4A3K H;  1UUP A;  3W1G A;  2QIL A;  4C3I B;  3GO5 A;  3EA6 A;  3ULJ A;  1QUQ A;  5JVH 3;  1V1P A;  1V9P A;  2JA5 H;  1TWH B;  3FP9 A;  4DUY L;  5EKK A;  5JEA H;  2VXW A;  1N8R C;  2VB2 X;  4NP5 A;  1PH6 A;  1XTD A;  3NK9 A;  4YCW A;  3CCJ A;  1IHZ A;  1GUN A;  4X3U A;  1F9P A;  3IAY A;  1E0B A;  4DV4 Q;  4LFC L;  2N8N A;  2L55 A;  1NSN S;  2EOT A;  3TS2 A;  5FLM G;  1EY8 A;  1G6P A;  2PZU A;  4MIU A;  3CCQ A;  2QDB A;  3MFG A;  1BKB A;  4L8J A;  5EKI A;  2DGY A;  1NMF A;  3HKZ G;  4I7Z C;  1WVL A;  3K81 C;  4ZRZ A;  1OXU A;  5LL6 X;  1HZC A;  3ULP A;  1B7Y B;  1K83 H;  1YHB A;  2H5X A;  4AIM A;  2HHH L;  2EE1 A;  4P72 A;  3WOF A;  1KNE A;  4K0K Q;  1DYQ A;  1EYD A;  3TP6 A;  3K7A H;  4JPB W;  5LL6 S;  5H1S E;  3GV6 A;  1MSG A;  3RZO B;  1VQH A;  1Y1V B;  1PXU A;  1VQO A;  1G2T A;  4YY3 L;  3PIP A;  2XN9 C;  2Y0S E;  1G91 A;  2K50 A;  1VQ5 A;  2A6H D;  1LTB D;  3CXC A;  2NVT H;  1SRU A;  4WRD A;  5C4J H;  1JB7 A;  3H0G B;  3NTI A;  2Z6K A;  1MGS A;  4NXM L;  2B2W C;  5M3F B;  1AZP A;  5IYD G;  1C8C A;  1J6Q A;  4CDE C;  5EPL A;  1IYV A;  4HIK A;  1LT4 D;  2I5H A;  3E9H A;  3VR5 A;  1BUV T;  3PMF A;  4BY7 G;  1JE4 A;  3OHX C;  2GVB A;  3T53 B;  2Q8R E;  1XNR Q;  1IBK L;  1STN A;  4LFA L;  2RA4 A;  3QOJ A;  1FJG L;  4DAP A;  2C5C A;  4POF A;  1FD7 D;  3PF5 A;  4Y7N B;  3KJP A;  1EY6 A;  2JN4 A;  2J7Z A;  4B9W A;  5C4H A;  1MIU A;  1S40 A;  1CHP D;  1I4R A;  3DXJ C;  3MXN A;  5CV7 A;  3KK7 A;  3KJO A;  4QL5 A;  4A3B G;  1DOL A;  1EWH A;  3AMU A;  1BXT A;  3MZ5 A;  1I6H B;  3VA7 A;  1YNJ D;  3IFD A;  4DV3 Q;  2PW5 A;  4JC0 A;  3OMG A;  4YHH L;  1K73 C;  2L5T A;  4RGO S;  3UE0 A;  4RCN A;  1E1T A;  2Q8I B;  1WCM B;  2CHB D;  1L0X B;  2N3S A;  2E2J B;  3Q0A A;  4JBM A;  1QVF A;  1QE6 A;  3OTO L;  4KHP Q;  4H13 C;  2GVA A;  2B39 A;  2UUC Q;  3J7Y W;  2UXC L;  4LF9 L;  1YJN A;  4HSP A;  2RHS B;  1A0I A;  2F0M A;  5C0X I;  4GZY C;  5M3M H;  3S2H H;  3SE0 A;  1JJG A;  4A3F G;  3G7L A;  1W6K A;  4G57 A;  1Y1V G;  3CC2 A;  1D5M C;  4NDX A;  4OHJ A;  1K9M C;  4JBK A;  1B44 D;  1UE6 A;  3STB C;  1LTT D;  1F9Q A;  3HGB A;  2PQA A;  3HOY G;  5IWA Q;  5C3E B;  1E2W A;  1HUM A;  2JXM B;  3JC6 6;  4DR4 L;  2ID0 A;  2KCN A;  4DAM A;  3I73 A;  1PV4 A;  1E22 A;  2PZW A;  3P20 A;  1XMQ Q;  4DUZ Q;  5IYC G;  2MUY A;  1JWS D;  4KMU C;  4XIG S;  3T1Y Q;  4F8M A;  1PYS B;  4DV6 L;  1F77 A;  3I70 A;  3E6Z X;  3CRK C;  4JI7 L;  1ESF A;  3R93 A;  1WTO A;  4OO1 G;  1FL0 A;  1C7Y A;  1M8A A;  2RBM A;  4B3T Q;  3M4P A;  1LT3 D;  3I55 A;  2ZTE A;  1WD0 A;  4JYA L;  3TZU A;  4IFD J;  3M3Y B;  4UDU C;  3UDX A;  4A3M B;  3TN2 A;  4HJ5 A;  3M85 A;  1DGS A;  1BF4 A;  1N32 Q;  3IFT A;  4TVA B;  1B53 A;  2IHE A;  5E7N A;  2CH4 A;  2EYM A;  5ELC A;  5J1Z A;  3D4D A;  1T5X D;  2WAQ B;  1BNZ A;  1O7Z A;  2B63 G;  4AYB B;  2NB0 A;  5DLQ E;  4OEM B;  2PYK A;  5AJ3 Q;  2TMP A;  1NJI C;  1WTX A;  4PMC A;  1FYC A;  1NTG A;  1B1Z A;  1S5F D;  3KDF A;  4BBS G;  1OXS C;  3K5N A;  3NTH A;  2JA8 B;  3RD4 A;  1HRJ A;  1S5B D;  1ESR A;  1UE7 A;  1F9S A;  4A4I A;  1WCM G;  1QCB D;  4K14 A;  2EY1 A;  2QEJ C;  1SYF A;  2MO1 A;  4ODG A;  4DR1 Q;  2XWJ B;  4KJN A;  1B4O A;  5C4Z A;  1KAA A;  2M9V A;  4QY7 A;  3DM3 A;  1NY4 A;  2NZO A;  2QA4 A;  2NVY B;  3FEW X;  2RCN A;  1CT1 D;  2B29 A;  3ERS X;  2FJ2 A;  5CC4 A;  1CZW A;  2E74 C;  1QJO A;  4H7B A;  4DK6 C;  2HCC A;  3AFP A;  2A68 C;  1JMC A;  2VUM H;  4HIM A;  1H9S B;  3FRP B;  2IJ0 A;  4YWM A;  3LWE A;  5EBC A;  4DV7 Q;  1DM0 B;  2KUM A;  3H6M A;  2VQF Q;  1K83 B;  2QGQ A;  3GTP B;  5HY6 A;  1I4H A;  4IPH A;  3S1N B;  3I91 A;  4P71 A;  1P8L A;  1VQF A;  1ASY A;  3M4O B;  3K7A B;  2EY6 A;  4K5W A;  1H95 A;  5D14 A;  3HOZ H;  1VF5 C;  3UDI A;  3W5O A;  5C4X H;  3GTM H;  5CBE E;  3X3M A;  2NN6 I;  4HMI A;  1ILP A;  1HCZ A;  4IPG A;  3C3L A;  2Z4H A;  5IP9 G;  1TY2 A;  3E0E A;  3S16 B;  4OGQ C;  1ZYR D;  4X6A H;  2OF1 A;  5F2D A;  2ZTC A;  5CV4 A;  4BY1 H;  2E5L L;  4LF8 L;  5EJW A;  1OXT A;  4BBR H;  1I94 Q;  2UUA Q;  4A3G B;  2EYP A;  5ELO A;  2YU9 H;  2R92 B;  1FNW A;  2NN6 H;  4RGM A;  3BJU A;  4C3H G;  4JCV E;  4A3K G;  3NUC A;  1IKM A;  2EIF A;  5M5X B;  2DNC A;  4AYB G;  5M5W H;  2XTI A;  1I4X A;  3J80 i;  1HTL D;  4OON A;  5CGK A;  3FKI H;  3GTJ B;  4N9T A;  1CTM A;  3SK6 A;  2BDN A;  2JA5 G;  4JI3 L;  4ILW A;  2UXD Q;  1SEB D;  2B3G A;  4HCS A;  2RDF A;  4L5R C;  2EY2 A;  5JEA G;  3J81 j;  1TWG H;  1KRT A;  1NMG A;  3JAM i;  2RDG A;  2WKD A;  5KGU A;  1XNQ Q;  1RL2 A;  3I56 A;  4Q5V A;  2K1B A;  4A93 B;  4RWS C;  2IT1 A;  3L3O C;  1V1O A;  2PMZ B;  5DAU A;  1VQI A;  4GLV B;  4CDF C;  1IZ6 A;  1W3S A;  1OO9 B;  2K6A A;  2QF7 A;  5IT9 E;  1GD7 A;  4FYD A;  2VB3 X;  1RTO A;  3ICE A;  4MNO A;  1L1O C;  3RN5 A;  5IY0 A;  3PUV A;  2Z6K C;  2A8V A;  2K14 A;  1WYD A;  4C2M B;  5M5Y B;  4F7X A;  1TU2 B;  2RHQ B;  1KTK A;  2B2Y A;  1PLF A;  2EPB A;  4ME5 A;  2BH8 A;  4LUO A;  1STB A;  4OX9 Q;  3GTG H;  2ICE C;  3NWT A;  3G6E A;  3GV3 A;  2MQH A;  4ULL A;  2JEB I;  4LNQ A;  3LWU A;  4V0B A;  1X55 A;  4XYQ A;  3KLR A;  1TWA H;  1PFM A;  3PSI A;  2JA7 H;  2HUG A;  1BR9 A;  4HJ7 A;  5A35 A;  1I3Q B;  1WTR A;  4K5X A;  3GTQ H;  4ABN A;  1Q8I A;  4FO2 A;  4KKU A;  1D1I A;  4ME3 A;  2K5V A;  3NPP A;  1KAW A;  1PH5 A;  1R4Q B;  3FDT A;  5D65 A;  3EJI A;  1N9W A;  3VA5 A;  1VQ7 A;  2A69 C;  4GLA C;  3PUX A;  1TS5 A;  2B2V C;  2R61 A;  2WP8 J;  3SK8 A;  1HR0 W;  2WAC A;  4GOP C;  2F3V A;  2B2W A;  3MEF A;  5C0X J;  4EQN A;  3CMA A;  1CSP A;  1HR0 L;  1UEB A;  3S15 H;  3ULL A;  2WB1 G;  5I6W A;  3W3A A;  2EQS A;  5FLX c;  5BR8 L;  2BA1 A;  3QB3 A;  5E4W C;  1XMO Q;  3A8I E;  4UPA A;  2CQO A;  1PHJ A;  2JE6 I;  4LUV A;  1E2V A;  3IL8 A;  1VQK A;  5FO7 B;  1LLR D;  4X64 Q;  1SDF A;  2R6G A;  2JA6 H;  5JAV A;  1D6E C;  2LMC B;  1JJ2 A;  5CBA E;  4U68 A;  2A5H A;  2K01 A;  2LXK A;  4R9W A;  1PDQ A;  1B8A A;  1BQQ T;  3E5S A;  2WII B;  4IUR A;  3HOW H;  1HTP A;  2O5I C;  1R9T B;  2AQ3 B;  1SYB A;  3CCV A;  1C9O A;  2EXD A;  5T1G A;  4JI5 Q;  4OO1 I;  2MP1 A;  4Z9C B;  2Q2T A;  1MSH A;  4JV5 L;  4EGV A;  3U9O A;  1SXT A;  3VR3 A;  1HHV A;  2Q2U A;  1SYD A;  2LS0 1;  1I4Q A;  1QUQ B;  4LF6 Q;  5CV5 A;  4LAA A;  3K7U C;  1V1P B;  5M3M G;  4LF5 Q;  2F0D A;  1G2S A;  1PZK D;  1PRT C;  1WTP A;  2K28 A;  1TVX A;  5I6Y A;  2H1E A;  3DLL A;  1SYG A;  2KHS A;  1CFM A;  3PO2 H;  2NYZ D;  1F2Y A;  4CBV A;  1ET9 A;  1PFB A;  5ELB A;  1PH9 A;  1LTS D;  3KF8 B;  3A56 A;  1STG A;  5C0X G;  1KDB A;  2JK8 A;  4H44 C;  2DJF C;  4ID6 A;  3P1H A;  1PTO C;  1UNS A;  2AHO B;  1FR3 A;  1U4M A;  2FFK B;  2EYL A;  2F0Q A;  1J8I A;  2ES2 A;  5M9O A;  2ZJR A;  4FP5 D;  5CR3 A;  1CHQ D;  4KLK A;  1SFO H;  4MTN A;  5GAE C;  5EAY A;  3CP0 A;  1A2U A;  1S5D D;  2R7Z H;  1VQJ A;  2RCF A;  2L15 A;  1DXM A;  1NE3 A;  4KTA A;  1X56 A;  3BVM A;  1EFW A;  3T13 A;  2RSN A;  2K5D A;  3E9I A;  4C3J H;  3SGI A;  2JP1 A;  5E4X A;  1SE4 A;  2RKS A;  4NPS A;  5E3F A;  1DCZ A;  2EJF C;  4LFB Q;  1XJV A;  1KAB A;  3MC0 B;  4BA1 I;  3GTK B;  1H9R A;  3RMH A;  2PCF B;  4DR5 Q;  2H4O A;  4OIJ A;  4N8F A;  4P74 A;  3U58 A;  1GOZ A;  1NCV A;  3K5L A;  4NXN Q;  1SRO A;  3RUZ A;  3HOV H;  1MBY A;  1BVS A;  5IE8 A;  3RZD B;  3OYY A;  1L1O B;  2AWO A;  2BDO A;  4HMJ A;  2L11 A;  3HKZ B;  3LNN A;  1Y1W H;  5JOB A;  3OIQ A;  3CRL C;  3D6W A;  4K6L A;  2N78 A;  4LJZ C;  1EU4 A;  3S17 B;  1QZH A;  1EEI D;  3STB D;  1EIY B;  5C44 H;  1KXL A;  1X3Q A;  1O7L A;  3M4Q A;  2G9D A;  2M2L A;  1TWC H;  4CGY B;  2WAQ E;  5DEH A;  2BE5 C;  2EVB A;  5NUC A;  2IL8 A;  3QIA A;  4U67 3;  3O13 A;  5K36 H;  4KV6 A;  5EPK A;  3J7A V;  2VUM G;  3MXN B;  1LTA D;  3WWV A;  1AE2 A;  4ZUI A;  4IO9 A;  4GOP B;  1STE A;  2VZA A;  4IJL A;  1EWC A;  1YIT A;  1CKN A;  2X69 A;  1XPU A;  3DMU A;  3VR6 A;  4UP7 A;  3M9B A;  1TWA B;  3E0J A;  3OSO A;  3UDF A;  4BY7 B;  3HOZ G;  2G9H D;  1GM5 A;  5C4X G;  2QW7 A;  4GKK Q;  1DD2 A;  3J7Z C;  4XT3 B;  3T1H Q;  1J5E Q;  4QIW B;  2PI2 A;  2NVQ H;  1N34 Q;  4AQY Q;  3ND9 A;  4BY1 G;  2F0I A;  3KF8 A;  4XQN A;  1Q12 A;  4BBR G;  1LO5 D;  3KFU A;  5KEE A;  4GNX A;  1YBY A;  2KEN A;  1X54 A;  2NN6 G;  4A3B B;  3NTK A;  3S2D B;  2AWN A;  1TKW B;  2OT2 A;  3GP7 A;  2L12 A;  5IP7 H;  3KYH C;  2FMC A;  2V1C C;  1I4P A;  4KY7 A;  1VQ9 A;  2PQA B;  4RCO A;  3S15 B;  1LUZ A;  1I4G A;  2R3Z A;  3OMC A;  2D5D A;  2CWP A;  2WV6 D;  1S4Z A;  1B70 B;  4DUY Q;  4A3E H;  3FKI G;  4JI0 L;  1SN8 A;  3AQQ A;  4O1N A;  1Y69 U;  4JI4 Q;  2B2Y C;  1AW7 A;  4DV2 Q;  3G48 A;  2CFM A;  1VQA A;  4A3J H;  1Y8N B;  3I72 A;  4L5T A;  4K0K L;  2F0S A;  5KYI A;  3HOU H;  3S1M B;  1BCP B;  1XYI A;  4LFC Q;  1JE5 A;  4QF4 A;  4QUC A;  4A3F B;  1JOQ A;  1PRT B;  3AFQ A;  3KBX A;  4JW0 A;  1PH7 A;  2B2U A;  3CC7 A;  2NVX H;  4DR6 L;  2F0E A;  2G5D A;  2ZTD A;  3K59 A;  1MJC A;  1VQB A;  3PIO 3;  2R93 H;  3HOY B;  2F0U A;  1HNZ Q;  4IUN A;  2EYH A;  3EQL C;  2K05 A;  1EOV A;  2D9U A;  3ZYY X;  1L1O A;  1YZ6 A;  2EYJ A;  3T51 B;  4ZKC B;  1PTO B;  2B8F A;  2O2L D;  1EIG A;  1MJE A;  2ASB A;  4BA2 I;  3HOX H;  2JJQ A;  2AQ1 B;  4PNY A;  3CF5 A;  1HQM C;  4GN4 B;  1S72 A;  3KDF B;  2VQE L;  5IOC A;  4B3M Q;  2OQK A;  4YY3 Q;  4RG1 A;  5FJ8 H;  1PZI D;  4JI6 Q;  2PMZ E;  2JA7 G;  1KDC A;  2SDF A;  3I4N H;  4HED A;  3H15 A;  5ISR A;  2KVM A;  4J8Q A;  3MAQ A;  3C1F A;  3HS0 C;  2NZH A;  3CQZ H;  5AFW A;  4L5Q A;  3W1B A;  2MJ8 A;  3A7A B;  1VMP A;  3LX0 A;  2L9H A;  4YCU A;  3J81 i;  3CU7 A;  1C4Q A;  5E1F A;  2B2V A;  4KHZ A;  2MPM A;  2B63 B;  1IBM L;  4CJ2 C;  3VR4 A;  1Q82 C;  4GOP A;  1JB3 A;  4Q0F A;  1X32 A;  3GD7 A;  2ZM6 Q;  1Q86 C;  2OQ0 A;  4BBS B;  3NBH A;  3BZK A;  2XIW A;  1IBK Q;  4YIJ A;  4LFA Q;  3F8T A;  4ZYS A;  1FJG Q;  1YVC A;  3NEN A;  3SHL A;  1HXY D;  4KHP L;  1SND A;  1I50 B;  5CV9 A;  5KND A;  3TP7 A;  3H09 A;  3S1Q B;  4DGZ A;  1U0L A;  1TT2 A;  1U4P A;  4JK1 C;  2V4D A;  1OXX K;  2A6E C;  1ENA A;  5J3B A;  2JA6 G;  1MKH A;  2E2H H;  1JWM D;  4DR7 L;  5CMD A;  5I9P A;  1A3T A;  2C9O A;  5ELD A;  4C1N I;  4IJH A;  2HDM A;  1CSQ A;  3CPW A;  1HUN A;  3SXH A;  3HOW G;  1BO0 A;  4EQP A;  1EL0 A;  1ZEQ X;  2F0F A;  2XWB B;  4K6D A;  3OTO Q;  1Q8K A;  4B3R L;  1D8L A;  4IOA A;  1NBW A;  1XMQ L;  1LV9 A;  1QOH A;  4XTC S;  5D3D A;  3CME A;  3T1Y L;  4PZ7 A;  2KCC A;  1BBU A;  2F0G A;  3J80 c;  3RLN A;  1AFP A;  4DA2 A;  4KI0 A;  1M90 C;  5A2Q E;  2E2I H;  1EY5 A;  1RDP D;  3S1R H;  4Y52 H;  1VQG A;  3PO2 G;  4L63 B;  4MZ9 A;  4ZLT F;  1IBL L;  1MD2 D;  4DR4 Q;  1PZJ D;  3JAM c;  1EZ8 A;  3A5Z B;  4GN5 A;  4A3I H;  1TII D;  4IPC A;  3S14 H;  2I5M X;  4C3H B;  4A3K B;  1PA6 A;  3S9W A;  1JOK A;  1GUS A;  1EUJ A;  1QVC A;  3QJY A;  5CYU A;  1KQS A;  4JI7 Q;  4R4Q A;  1EQQ A;  4BXX H;  2R7Z G;  2MHV A;  4WJW A;  4E6I A;  2PNR C;  2F03 A;  3S24 A;  5IYB H;  1N36 L;  3CD6 A;  2JA5 B;  2HD3 A;  4B3S Q;  3NBI A;  4JI2 Q;  2PI2 E;  3BVG A;  3VR2 A;  2K5Q A;  1WD1 A;  1HZ9 A;  2YYZ A;  4C3J G;  1QNU A;  3W2D A;  2KHI A;  2ZJP A;  1LAB A;  1LT6 D;  3OW7 A;  5EQ0 A;  5FOB B;  3P75 A;  1A2T A;  4G7O C;  2EJM A;  1EU3 A;  4CDD C;  4DV5 Q;  3A8J E;  4NW2 A;  4P2C B;  5JEA J;  4H0L C;  2F3I A;  1TWF H;  1QVG A;  2GN5 A;  4TSS A;  4RKB A;  3F2C A;  3HOV G;  2SNS A;  1S5C D;  1EYC A;  2Z9H A;  3CCE A;  5LMN Q;  4PZ8 A;  1BCP D;  4DR2 L;  4A3D H;  1A3U A;  2F1M A;  4DNR B;  4OWX B;  1AN8 A;  1Y1W G;  1VCI A;  1PRT D;  2VQF L;  1T9H A;  1QNK A;  3IKJ A;  4RHS A;  3QR8 A;  1VQ6 A;  2NWG A;  5FLX E;  2KCM A;  3SR1 A;  4LW1 A;  3TBI B;  1CM9 A;  2F0H A;  2TSS A;  4JG2 A;  3GTO H;  2WFW A;  1O7Y A;  1SMY C;  1PTO D;  2F3W A;  4QCL A;  5HGT A;  3TRZ A;  3PUY A;  3U4V A;  1BCP F;  2QKI C;  4MN3 A;  5HUR A;  3NWS A;  4KD3 A;  4TRD A;  2NVT B;  1ICW A;  1KHI A;  5J22 A;  1ONL A;  1I94 L;  1PRT F;  2UUA L;  4GNX C;  5K36 G;  5C4J B;  1YIJ A;  5GAH C;  3HKZ E;  1PFN A;  4PMW A;  3HOX B;  2PW7 A;  3AB9 A;  1TS2 A;  3DEP A;  4LF7 Q;  1NR2 A;  1Y8O B;  3L2P A;  3D8G A;  1PTO F;  1FNU A;  1SE8 A;  2K32 A;  3A54 A;  4ZUJ A;  2XSC A;  2WB1 B;  1GKH A;  1G29 1;  5CV8 A;  1U4R A;  3OWE B;  3K0Y A;  2UXD L;  4KD4 A;  2N49 A;  2ZXP A;  3I4N B;  4HAE A;  4QGU A;  1FGB D;  4GKJ Q;  1B3Q A;  2KBN A;  2UXB L;  2SNM A;  1F9R A;  1SNM A;  1PH8 A;  3ER0 A;  1IXR A;  2YTX A;  3DWQ A;  3CW2 C;  3K8A A;  1P16 A;  5KNB A;  2B2U C;  2L4N A;  1KNA A;  2UU9 L;  1EY0 A;  5IP7 G;  4HR7 B;  4XQJ A;  3NHH A;  2MFI A;  3J7A 5;  5HGQ A;  2J4X A;  1PYW D;  5A2Q L;  2NUC A;  1KL9 A;  2ZXR A;  1HH2 P;  4A3E G;  3OW2 A;  1CA5 A;  4OWW B;  3TME A;  3GTL H;  4EQ5 A;  1X9N A;  4QIW E;  3EFX D;  5BN5 A;  1G6Z A;  2BE5 D;  3PO3 H;  3F1Z A;  2ZJQ A;  5C3X A;  3HOU G;  4UY8 C;  3NXW A;  5M3M B;  4JOI A;  3S2H B;  4FVM A;  5FO9 B;  4DR3 Q;  3TZD A;  4DXF A;  3BZC A;  4FF4 A;  5LMU Q;  3D4R A;  3NQT A;  3P7J A;  3Q6S A;  3F2D A;  1HFG A;  1X3P A;  4OEL B;  4JI1 Q;  4JBJ A;  2R93 G;  3PCO B;  4N9P A;  1IYU A;  2SOB A;  2CVR A;  4C3I H;  4R8I A;  2UUB L;  2NTS A;  4ZCK A;  4X65 Q;  3HOX G;  4WJ4 A;  1WTV A;  4M1U B;  1L0W A;  1PFS A;  1N33 Q;  1DJR D;  3K5M A;  1YJW A;  1XX8 A;  3BYY B;  4KK7 A;  1KD1 C;  1LTI D;  1X65 A;  1EY7 A;  1TWH H;  2O4X A;  3TS0 A;  3RNU A;  3FPP A;  4F88 A;  5FJ8 G;  2F0W A;  5KYL A;  3FHW A;  3I4N G;  2K5N A;  4X66 Q; 
#chains in the Genus database with same CATH homology
 3U9S A;  1BOS A;  1F2L A;  4ZQ3 A;  5I2Y A;  1JIC A;  1B9N A;  5FLX L;  3MTS A;  3A55 A;  3PIP 3;  4CJ1 B;  3K57 A;  3SDZ A;  2L1B A;  5COY A;  2JYO A;  3J7A F;  5IGD A;  3PUW A;  4LMQ D;  4C56 C;  3BDC A;  2KOL A;  3DM1 A;  4O42 A;  1B2T A;  3BYT B;  2B8G A;  2DNE A;  1JWU D;  1EYA A;  1HQR D;  5COR A;  3MHB A;  2RSO A;  4G4K A;  3V2T A;  1I6V C;  3UI2 A;  4XYO A;  1CK1 A;  1SNO A;  2EYO A;  1LTR D;  2VUM B;  2HDL A;  1IL8 A;  3PUZ A;  1TR5 A;  2KA7 A;  2RVL A;  2F0K A;  4HCE A;  1BBX C;  3H3V C;  1V43 A;  1XXG A;  5JVG 3;  2Q8T A;  1LT5 D;  1U4L A;  1HA6 A;  3HOZ B;  3GTM B;  5IGE A;  5C4X B;  5KNC A;  4DF7 A;  1II3 A;  4RFB A;  3R2T A;  1SNQ A;  1TQO A;  3G6J B;  1A15 A;  4IAL A;  2IX3 A;  3OIP A;  1CZG A;  3T16 A;  4BY1 B;  4FXD A;  3K6O A;  4BBR B;  4HTH A;  4XT1 B;  2YU9 B;  1BDO A;  1SE2 A;  3R2I A;  1S5E D;  5M5W B;  2E75 C;  1T5E A;  4DK1 A;  2F0L A;  3H94 A;  3FMC A;  1IW7 C;  3FKI B;  1UAP A;  4IUP A;  3I4L A;  2HQE A;  2MGS A;  3TP8 A;  1TWG B;  3MXU A;  4IN3 A;  4FF3 A;  5C5M A;  4CKE A;  2IWH A;  5ELF A;  3DWA A;  1B9M A;  4QMG A;  2I46 A;  1EIH A;  3DHQ A;  2EZV A;  1Z6H A;  1RTN A;  1DOM A;  1IKL A;  4X3T A;  3QOL A;  4IFD H;  2F0N A;  3OOC A;  2B2T C;  2F4I A;  3GTG B;  3EVQ A;  4RAU C;  2IW3 A;  4RA8 A;  1O80 A;  3QG1 A;  2JA7 B;  3J81 L;  3MWY W;  3QO2 A;  3GTQ B;  1NUC A;  4TKO B;  2CQA A;  3ERQ A;  4KY5 A;  1YNN C;  4C1N K;  3DUZ A;  1TY0 A;  3L7Z C;  5EGT A;  1AEX A;  3A8K E;  3DEO A;  3I8Z A;  1EFI D;  4IUQ A;  1VF7 A;  2KJX A;  2F0V A;  2J0T D;  1RJT A;  1EY4 A;  2NZ1 D;  2AUJ D;  4FF2 A;  2JEA I;  3CHB D;  4V19 0;  1HA5 A;  3MXG A;  1ET6 A;  1FNV A;  3SVM A;  3J80 E;  4FXK C;  1A3V A;  1D5Z C;  4FF1 A;  2ZT9 C;  4IQZ A;  3C2P A;  3PV0 A;  4ZKB B;  2CW0 C;  2GA4 B;  2JA6 B;  2A68 D;  1A6X A;  3JAM E;  2FHT A;  4M8A A;  2Z8L A;  3MA2 B;  2XRQ D;  2K04 A;  3HOW B;  5LHY 1;  1ML0 D;  2K7V A;  4G7H C;  1SMY D;  2JSO A;  3I3C A;  1M4V A;  2BCO A;  5BN3 A;  3NQI A;  2PZT A;  2VNU D;  4KHV A;  4BS9 A;  2OEO A;  3D31 A;  4IUT A;  3VYS A;  4QB4 A;  2DY8 A;  4K2L A;  2X6L A;  3TDQ A;  3D3R A;  4S3S A;  2AQ2 B;  3WDN A;  2A74 C;  3NSW A;  3D6C A;  3PO2 B;  1GHJ A;  3AU7 A;  5T1I A;  1CA6 A;  2KEC A;  2NBF A;  1JQY D;  4EQO A;  1HPC A;  2Z4I A;  4OIK A;  1VMC A;  3C46 A;  4C3I G;  2DY7 A;  1ROD A;  4KN7 C;  4DFA A;  1SFO B;  1CQV A;  1D1K A;  2R7Z B;  5I9O A;  2XVS A;  1DOK A;  3D4W A;  2E2D C;  1U9R A;  2PQE A;  5KRU A;  1RCV D;  4C3J B;  1J9O A;  2XNA C;  3WOE A;  1Y8P B;  1ENF A;  1XTC D;  2NTT A;  2WKC A;  2N88 A;  1JR0 D;  2M00 A;  5IGG A;  4IUV A;  3VYU A;  1PMR A;  4R8N A;  3HOV B;  2WIN B;  2D2C C;  1SAP A;  1XWE A;  1EQV A;  1Y1W B;  5EPJ A;  1SE3 A;  1G8Z D;  3SK5 A;  1B50 A;  4OL7 A;  4K2K A;  4NKL A;  5C44 B;  1GUO A;  1GUT A;  2PPB C;  1TWC B;  3FPU B;  4XXE A;  2A69 D;  5C0X H;  2DN8 A;  1B3A A;  1NR4 A;  3CKI B;  1TS4 A;  4K8I A;  3SK4 A;  3BDL A;  2KEE A;  4IUU A;  3C1E A;  3J80 L;  2EXZ A;  3GQB A;  1E2Z A;  4CHT B;  4KKS A;  2EJG C;  2O5J C;  2ENB A;  4KKT A;  1KLU D;  3JAM L;  4FXG C;  1GUG A;  5DNF A;  3BG3 A;  1ILQ A;  4HSV A;  1EQT A;  1R4P B;  1AP0 A;  3L9A X;  5DM6 3;  2NVQ B;  2EDG A;  5FKA C;  1EOT A;  3HP3 A;  2QCP X;  2K5W A;  1LAC A;  1QG7 A;  4RGT A;  3ONA B;  1AZQ A;  4RKL A;  3R8B A;  1SJE D;  3A7L A;  1GUW A;  1Z47 A;  4A3E B;  4DN4 M;  4DNT B;  5JJZ A;  4PMB A;  3T4A C;  4A3J B;  5DM7 3;  1V8Q A;  4JBW A;  3HOU B;  3I4M B;  2SEB D;  5G3L D;  3OWF A;  5FK9 C;  1CI3 M;  2X6G A;  4G7Z C;  2NVX B;  3KBG A;  1SYE A;  2R93 B;  2E76 C;  1ZXT A;  4FNF A;  2K33 A;  1GXD C;  2A6H C;  4IFD G;  3TSS A;  5EKL A;  3BS1 A;  5G3L F;  5KIX A;  1STA A;  2B2T A;  1JOO A;  4B9X A;  1K8M A;  3SEB A;  1L0Y B;  1QWY A;  4DU9 A;  5IGF A;  2EYF A;  1D2B A;  1QB5 D;  2EY5 A;  3FVQ A;  1LTG D;  2F0O A;  3CQZ B;  2IX1 A;  4DAV A;  2F0P A;  1IW7 D;  2F0T A;  1CQF A;  2Y0S B;  4DK0 A;  3MXP A;  2LFN A;  4ZK9 B;  4UAI A;  4XQQ A;  1GJX A;  3KUP A;  4BWG B;  5C5L A;  1YNJ C;  2Z1C A;  1Q1B A;  1Q1E A;  3QWN A;  3K58 A;  1H9K A;  3ND8 A;  2OXP A;  2HCI A;  2LKV A;  5I4D A;  4HN7 A;  5IGC A;  2E2H B;  4X3K A;  1O78 A;  1EY9 A;  3I90 A;  3URY A;  4F87 A;  4X3S A;  2XRS D;  5C6A A;  5JPM C;  2K03 A;  3KLS X;  3R3O A;  5FO8 B;  1EEF D;  2FMM A;  2ICI A;  4PQX A;  1YNN D;  1SJH D;  4IZ8 A;  5I2X A;  1ZKO A;  4RGN A;  4QUF A;  4WFN 3;  2E2I B;  4CKC A;  3S1R B;  3NP8 A;  3H91 A;  3HZX A;  1H9S A;  1WTW A;  5CV6 A;  1JCK B;  4B08 A;  5TSS A;  3Q24 A;  5BN4 A;  1DON A;  1UEA B;  4A3I B;  5EBD A;  2RDH A;  3S14 B;  1JC7 A;  4LK1 C;  3Q23 A;  1WTQ A;  4RHR A;  3K5O A;  3J81 E;  2KQ3 A;  2L0C A;  1ENC A;  1F2Z A;  2CW0 D;  3M7G A;  2LY7 A;  1K8O A;  4CKB A;  1RHP A;  1QIL A;  1EZ6 A;  1Z7T A;  1SNC A;  3V96 A;  3BDO A;  3MFY A;  5IGB A;  3M4Y A;  1OXV A;  3RLF A;  3KLS A;  5ELE A;  1TWF B;  1MI2 A;  1PTO H;  4XDX A;  4J1M A;  1KDA A;  3BZD B;  4I65 A;  4A3D B;  1BCP C;  1H9M A;  1STH A;  4ZAI A;  4OO1 H;  1JOR A;  5JPN C;  1RD9 D;  3OPO A;  4KY6 A;  2FIN B;  3GTO B;  1NAP A;  2AUK A;  2ZXO A;  4K5V A;  1DZ1 A;  4L6T B;  3DWP A;  3HRZ C;  3Q22 A;  4KN4 C;  2IX0 A;  1W6J A;  1ZYR C;  4K8J A;  3T56 B;  1VDZ A;  5IOD A;  1SNP A;  1H9J A;  4PV1 C;  5IT9 L;  3BVZ A;  3ITP A;  4DAY A;  5J39 A;  2N55 A;  3VYT A;  1HFN A;  1D5X C;  3M7N A;  1SBB B;  3VYR A;  2KED A;  2A6E D;  2PO4 A;  1SSO A;  1SYC A;  4J6H A;  3NE5 B;  2I07 B;  3TP5 A;  5K5P A;  2IPK D;  3N6R A;  3MVV A;  2F0J A;  1STY A;  4TQU S;  1C48 A;  4KJO A;  4RH6 A;  1KLG D;  1RF2 D;  4IFD I;  3X3N A;  3HEJ A;  4WOR A;  2RQX A;  1Q3L A;  3N52 A;  2BA0 A;  2D62 A;  3HG9 A;  5D3I B;  3GTL B;  4EVO A;  3PO3 B;  1GHK A;  3ERO A;  3F2U A;  2A73 B;  1RKN A;  4DXG A;  4CJ0 B;  1TS3 A;  3MEH A;  2BOS A;  1F2M A;  4MHE A;  4NMZ A;  3V05 A;  5IIF A;  1Q90 A;  1UUP A;  2QIL A;  4C3I B;  3GO5 A;  3EA6 A;  5JVH 3;  1V1P A;  1TWH B;  5EKK A;  5JEA H;  2VXW A;  2VB2 X;  4NP5 A;  3NK9 A;  1IHZ A;  1GUN A;  4X3U A;  1F9P A;  3IAY A;  1E0B A;  2L55 A;  1NSN S;  2EOT A;  1EY8 A;  2PZU A;  4MIU A;  2QDB A;  3MFG A;  4L8J A;  5EKI A;  4I7Z C;  1WVL A;  4ZRZ A;  1OXU A;  5LL6 X;  2EE1 A;  3WOF A;  1KNE A;  1DYQ A;  1EYD A;  3TP6 A;  5LL6 S;  3GV6 A;  1MSG A;  3RZO B;  1Y1V B;  1PXU A;  1G2T A;  2XN9 C;  1G91 A;  2A6H D;  1LTB D;  4WRD A;  3H0G B;  3NTI A;  1MGS A;  2B2W C;  5M3F B;  1AZP A;  1C8C A;  5EPL A;  1IYV A;  1LT4 D;  3VR5 A;  1BUV T;  3PMF A;  1JE4 A;  3OHX C;  3T53 B;  2Q8R E;  1STN A;  2RA4 A;  3QOJ A;  4DAP A;  2C5C A;  1FD7 D;  4Y7N B;  1EY6 A;  2J7Z A;  4B9W A;  5C4H A;  1CHP D;  1I4R A;  3DXJ C;  3MXN A;  5CV7 A;  3KK7 A;  1DOL A;  1EWH A;  3AMU A;  1BXT A;  3MZ5 A;  1I6H B;  3VA7 A;  1YNJ D;  3IFD A;  2PW5 A;  3OMG A;  2L5T A;  4RGO S;  4RCN A;  2Q8I B;  1WCM B;  2CHB D;  1L0X B;  2E2J B;  3Q0A A;  1QE6 A;  4H13 C;  2B39 A;  3J7Y W;  4HSP A;  5C0X I;  2F0M A;  4GZY C;  3SE0 A;  3G7L A;  1W6K A;  4G57 A;  1D5M C;  4NDX A;  4OHJ A;  1B44 D;  1LTT D;  1F9Q A;  3HGB A;  5C3E B;  1E2W A;  1HUM A;  2JXM B;  2ID0 A;  2KCN A;  3I73 A;  2PZW A;  3P20 A;  2MUY A;  1JWS D;  4KMU C;  4XIG S;  4F8M A;  1F77 A;  3I70 A;  3E6Z X;  3CRK C;  1ESF A;  3R93 A;  1WTO A;  4OO1 G;  1M8A A;  2RBM A;  1LT3 D;  1WD0 A;  4IFD J;  3TZU A;  3M3Y B;  4UDU C;  4A3M B;  3TN2 A;  3M85 A;  1BF4 A;  3IFT A;  1B53 A;  2EYM A;  5ELC A;  5J1Z A;  3D4D A;  1T5X D;  2WAQ B;  1BNZ A;  1O7Z A;  4AYB B;  2NB0 A;  2PYK A;  2TMP A;  1WTX A;  4PMC A;  1FYC A;  1S5F D;  1B1Z A;  1OXS C;  3K5N A;  3NTH A;  2JA8 B;  3RD4 A;  1HRJ A;  1S5B D;  1ESR A;  1F9S A;  1QCB D;  4K14 A;  2EY1 A;  2QEJ C;  1SYF A;  4ODG A;  2XWJ B;  4KJN A;  1B4O A;  5C4Z A;  1KAA A;  2M9V A;  2NVY B;  3FEW X;  1CT1 D;  2FJ2 A;  5CC4 A;  1CZW A;  2E74 C;  1QJO A;  4H7B A;  2HCC A;  2A68 C;  1H9S B;  3FRP B;  2IJ0 A;  3LWE A;  5EBC A;  1DM0 B;  2KUM A;  3H6M A;  3GTP B;  1K83 B;  1I4H A;  3S1N B;  3I91 A;  3M4O B;  3K7A B;  2EY6 A;  4K5W A;  5D14 A;  1VF5 C;  5CBE E;  3X3M A;  2NN6 I;  4HMI A;  1ILP A;  1HCZ A;  3C3L A;  2Z4H A;  1TY2 A;  3S16 B;  4OGQ C;  1ZYR D;  2OF1 A;  5F2D A;  5CV4 A;  5EJW A;  1OXT A;  4A3G B;  2EYP A;  2R92 B;  1FNW A;  2NN6 H;  4RGM A;  4C3H G;  3NUC A;  1IKM A;  5M5X B;  2DNC A;  1I4X A;  1HTL D;  5CGK A;  3GTJ B;  4N9T A;  1CTM A;  3SK6 A;  2BDN A;  4ILW A;  1SEB D;  4HCS A;  2RDF A;  2EY2 A;  5JEA G;  2RDG A;  2WKD A;  5KGU A;  4Q5V A;  2K1B A;  4A93 B;  4RWS C;  2IT1 A;  3L3O C;  1V1O A;  2PMZ B;  5DAU A;  1OO9 B;  2K6A A;  2QF7 A;  5IT9 E;  4FYD A;  2VB3 X;  1RTO A;  3PUV A;  4C2M B;  5M5Y B;  4F7X A;  1TU2 B;  1KTK A;  2B2Y A;  1PLF A;  2EPB A;  4ME5 A;  1STB A;  2ICE C;  3NWT A;  3GV3 A;  4ULL A;  2JEB I;  3LWU A;  4V0B A;  4XYQ A;  3KLR A;  1PFM A;  2HUG A;  1BR9 A;  5A35 A;  1I3Q B;  1WTR A;  4K5X A;  4ABN A;  1Q8I A;  4FO2 A;  4KKU A;  1D1I A;  3NPP A;  5D65 A;  1R4Q B;  3FDT A;  3EJI A;  3VA5 A;  2A69 C;  3PUX A;  1TS5 A;  2B2V C;  2R61 A;  2WP8 J;  3SK8 A;  2WAC A;  2F3V A;  2B2W A;  5C0X J;  4EQN A;  5I6W A;  3W3A A;  2BA1 A;  3QB3 A;  5E4W C;  3A8I E;  2JE6 I;  1E2V A;  3IL8 A;  5FO7 B;  1LLR D;  1SDF A;  2R6G A;  5JAV A;  1D6E C;  2LMC B;  5CBA E;  4U68 A;  2A5H A;  2K01 A;  4R9W A;  1PDQ A;  1BQQ T;  3E5S A;  2WII B;  4IUR A;  1HTP A;  2O5I C;  1R9T B;  2AQ3 B;  1SYB A;  5T1G A;  4OO1 I;  2MP1 A;  4Z9C B;  1MSH A;  4EGV A;  3U9O A;  1SXT A;  3VR3 A;  1HHV A;  1SYD A;  2LS0 1;  1I4Q A;  5CV5 A;  4LAA A;  1V1P B;  2F0D A;  1G2S A;  1PZK D;  1PRT C;  1WTP A;  2K28 A;  1TVX A;  5I6Y A;  2H1E A;  1SYG A;  2KHS A;  1CFM A;  2NYZ D;  1F2Y A;  4CBV A;  1ET9 A;  1PFB A;  5ELB A;  1LTS D;  3A56 A;  1STG A;  5C0X G;  1KDB A;  4H44 C;  4ID6 A;  3P1H A;  1PTO C;  1UNS A;  1FR3 A;  1U4M A;  2FFK B;  2EYL A;  2F0Q A;  1J8I A;  5M9O A;  4FP5 D;  5CR3 A;  1CHQ D;  1A2U A;  1S5D D;  1DXM A;  4KTA A;  3BVM A;  3T13 A;  2RSN A;  2K5D A;  2JP1 A;  5E4X A;  1SE4 A;  2RKS A;  5E3F A;  1DCZ A;  2EJF C;  1KAB A;  3MC0 B;  4BA1 I;  3GTK B;  1H9R A;  3RMH A;  2PCF B;  2H4O A;  4OIJ A;  1GOZ A;  1NCV A;  3K5L A;  3RUZ A;  1MBY A;  3RZD B;  2AWO A;  2BDO A;  4HMJ A;  2L11 A;  3HKZ B;  3LNN A;  5JOB A;  3OIQ A;  3CRL C;  3D6W A;  4K6L A;  4LJZ C;  1EU4 A;  3S17 B;  1EEI D;  1X3Q A;  1O7L A;  2G9D A;  2M2L A;  4CGY B;  5DEH A;  2BE5 C;  2EVB A;  5NUC A;  2IL8 A;  3QIA A;  4U67 3;  3O13 A;  5K36 H;  4KV6 A;  5EPK A;  3J7A V;  1LTA D;  4ZUI A;  1STE A;  1EWC A;  2X69 A;  3DMU A;  3VR6 A;  1TWA B;  3E0J A;  3OSO A;  4BY7 B;  2G9H D;  1DD2 A;  4XT3 B;  4QIW B;  3ND9 A;  2F0I A;  3KF8 A;  4XQN A;  1Q12 A;  1LO5 D;  5KEE A;  4A3B B;  2NN6 G;  3NTK A;  3S2D B;  2AWN A;  1TKW B;  2OT2 A;  3GP7 A;  2L12 A;  2FMC A;  1I4P A;  4KY7 A;  4RCO A;  3S15 B;  1I4G A;  2R3Z A;  3OMC A;  2D5D A;  2WV6 D;  1S4Z A;  4O1N A;  1Y69 U;  2B2Y C;  1AW7 A;  1Y8N B;  3I72 A;  2F0S A;  5KYI A;  3S1M B;  1BCP B;  1XYI A;  4QF4 A;  4QUC A;  4A3F B;  1JOQ A;  1PRT B;  3KBX A;  2B2U A;  2F0E A;  3K59 A;  3PIO 3;  3HOY B;  2F0U A;  4IUN A;  2EYH A;  3EQL C;  2K05 A;  2D9U A;  3ZYY X;  4ZKC B;  2EYJ A;  3T51 B;  1PTO B;  2B8F A;  2O2L D;  1EIG A;  4BA2 I;  2AQ1 B;  4PNY A;  1HQM C;  5IOC A;  1PZI D;  1KDC A;  2SDF A;  4HED A;  5ISR A;  2KVM A;  4J8Q A;  3MAQ A;  3C1F A;  3HS0 C;  5AFW A;  2MJ8 A;  3A7A B;  1VMP A;  3LX0 A;  2L9H A;  3CU7 A;  1C4Q A;  5E1F A;  2B2V A;  4KHZ A;  2MPM A;  2B63 B;  4CJ2 C;  3VR4 A;  1JB3 A;  4Q0F A;  1X32 A;  3GD7 A;  4BBS B;  3NBH A;  2XIW A;  4YIJ A;  4ZYS A;  3SHL A;  1HXY D;  1SND A;  1I50 B;  5CV9 A;  5KND A;  3TP7 A;  3H09 A;  3S1Q B;  4DGZ A;  1TT2 A;  1U4P A;  4JK1 C;  2V4D A;  1OXX K;  2A6E C;  1ENA A;  1JWM D;  5CMD A;  5I9P A;  1A3T A;  2C9O A;  5ELD A;  4C1N I;  2HDM A;  1HUN A;  3SXH A;  1BO0 A;  4EQP A;  1EL0 A;  1ZEQ X;  2F0F A;  2XWB B;  4K6D A;  1LV9 A;  1QOH A;  4XTC S;  5D3D A;  2KCC A;  2F0G A;  1AFP A;  4DA2 A;  4KI0 A;  5A2Q E;  1EY5 A;  1RDP D;  4L63 B;  4ZLT F;  1MD2 D;  1PZJ D;  1EZ8 A;  1TII D;  4C3H B;  4A3K B;  3S9W A;  1JOK A;  1GUS A;  5CYU A;  3QJY A;  2MHV A;  4WJW A;  4E6I A;  2PNR C;  2F03 A;  2JA5 B;  3NBI A;  3BVG A;  3VR2 A;  2K5Q A;  1WD1 A;  2YYZ A;  4C3J G;  1QNU A;  3W2D A;  1LAB A;  1LT6 D;  3OW7 A;  5EQ0 A;  5FOB B;  3P75 A;  1A2T A;  4G7O C;  2EJM A;  1EU3 A;  3A8J E;  4NW2 A;  4P2C B;  5JEA J;  4H0L C;  4TSS A;  4RKB A;  2SNS A;  1S5C D;  1EYC A;  1BCP D;  1A3U A;  2F1M A;  4DNR B;  1AN8 A;  1VCI A;  1PRT D;  1QNK A;  3IKJ A;  4RHS A;  2NWG A;  5FLX E;  3SR1 A;  3TBI B;  1CM9 A;  2F0H A;  2TSS A;  1O7Y A;  1SMY C;  1PTO D;  2F3W A;  4QCL A;  5HGT A;  3PUY A;  1BCP F;  5HUR A;  4MN3 A;  2QKI C;  3NWS A;  4KD3 A;  4TRD A;  2NVT B;  1ICW A;  5K36 G;  5J22 A;  1ONL A;  1PRT F;  5C4J B;  1PFN A;  4PMW A;  3HOX B;  2PW7 A;  3AB9 A;  1TS2 A;  3DEP A;  1NR2 A;  1Y8O B;  3D8G A;  1PTO F;  1FNU A;  2K32 A;  3A54 A;  4ZUJ A;  2XSC A;  2WB1 B;  1G29 1;  5CV8 A;  1U4R A;  3OWE B;  3K0Y A;  4KD4 A;  2ZXP A;  3I4N B;  4HAE A;  1FGB D;  2SNM A;  1F9R A;  1SNM A;  3DWQ A;  5KNB A;  2B2U C;  2L4N A;  1KNA A;  1EY0 A;  4HR7 B;  4XQJ A;  3NHH A;  2J4X A;  1PYW D;  5A2Q L;  2NUC A;  2ZXR A;  1CA5 A;  3TME A;  3EFX D;  5BN5 A;  1G6Z A;  2BE5 D;  5C3X A;  3NXW A;  5M3M B;  3S2H B;  4FVM A;  5FO9 B;  3TZD A;  4DXF A;  4FF4 A;  3D4R A;  3NQT A;  3P7J A;  3Q6S A;  1HFG A;  1X3P A;  4N9P A;  1IYU A;  2SOB A;  2CVR A;  4R8I A;  2NTS A;  1WTV A;  4M1U B;  1DJR D;  3K5M A;  1XX8 A;  3BYY B;  4KK7 A;  1LTI D;  1EY7 A;  2O4X A;  3FPP A;  4F88 A;  2F0W A;  5KYL A;  5C3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...