5LL6X

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
155
structure length
155
Chain Sequence
STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAGKANKQFAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00366 Ribosomal_S17 Ribosomal protein S17
X PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ll6X00
5FLXL 3J80L 5IT9L 3JAML 3J81L 5A2QL 3J7AV 5LL6X
chains in the Genus database with same CATH superfamily
1BXTA 3EJIA 3BZKA 4C56C 1AE3A 5EPKA 1WTPA 1F2YA 1JWSD 4H7BA 1PH8A 1I6HB 2NB0A 3PUYA 3ITPA 4JBKA 1LTSD 3J81E 4CDDC 1VQOA 1XMQL 4LFCQ 4IJHA 3VR5A 3RLFA 4O0AA 4QUFA 1GUOA 3RZDB 4E6IA 3S14B 2LS01 4HCSA 2VXWA 1STHA 3Q0AA 1MJCA 4HSPA 3O13A 5FLXc 3LGJA 3I8ZA 3KLSA 4IZ8A 5ELNA 1QZGA 2B3GA 5IP7H 5IWAL 5M3FG 1PTOB 3PUVA 4RKLA 1LUZA 2ICIA 2K1BA 3VR2A 1M90C 2FHTA 4R4IA 2E2HB 1Q1BA 3R3OA 3I56A 3TRZA 4K0KQ 5NUCA 4QIWB 1RD9D 3I4LA 4CHTB 2NVTB 5L37A 1RIPA 2PZWA 1Q1EA 1VQMA 1QZHA 2KEDA 4DNIA 2CVRA 1AP0A 4QF4A 1O7YA 1OTCA 1X56A 4PZ6A 2FMMA 4CJ2C 2NZOA 5IGEA 1DD2A 1VMCA 1EEFD 3F2UA 5M5YH 1K73C 3CQZH 2Z1CA 4UDUC 4Y7NB 1MHWC 5ISRA 3ND9A 1HNXQ 4G7OC 4LF9Q 1HR0W 2RDHA 4QL5A 1O7IA 2AKWB 1WTOA 4ME5A 2RHSB 1BCPC 1S5DD 4C3IB 1IBML 2VQFL 3CHBD 2WAQG 5I2XA 1RHPA 2NVXH 2Q2TA 4QMGA 2RCNA 2TSSA 1GHKA 1WD0A 2K5WA 2DNCA 1N32L 2N88A 4TRDA 1QB5D 1VQBA 2A69D 4LF4L 4A3BH 3M7GA 4OIJA 1N36Q 4J8QA 4LW1A 3UDIA 2IX3A 4JI5L 4KN7C 2NVYB 1KD1C 3VA5A 2HUGA 1U9RA 2MGSA 4IOAA 1LTTD 1NTGA 3HOUH 5C4ZA 2NVTH 3J81j 4I7AA 3GTOH 5HGQA 4CJ0B 1BVSA 2PMZB 4JV5Q 4POGA 3HOUG 2DUDA 5LHY1 3ICEA 1AH9A 4HMJA 1F9SA 1A2UA 2MO0A 4LWCA 4HCEA 2CWPA 4PNYA 2RCFA 4JBWA 2ZJRA 2WAQE 1SAPA 2LXKA 3HEJA 4ULLA 3WOEA 2WINB 3M85A 1CKMA 1PTOC 3I2ZA 5ELFA 3I4OA 4HTHA 4JOIC 1A62A 3VR6A 1TIID 3A7LA 3H3VC 1JOQA 3K80C 2ZM6Q 1L0XB 4C3IG 3A74A 4HIMA 1HZCA 1L0YB 1FJGL 3OMCA 4RHRA 4IJLA 5IP9H 5IP9G 1JICA 2EXDA 4QCLA 1U4MA 3JAME 5GROA 3TP7A 2GVBA 1D5MC 1GUTA 1I4HA 4AH6A 4XYOA 1JR0D 1SYBA 1LTLA 5ELBA 3CKIB 5JJZA 4YWLA 1G2SA 2RHQB 4A3EB 5D3IB 3VR3A 2OCEA 3T13A 1D7QA 2CH4A 2Q8IB 3TP8A 1XNRQ 4JI1L 3RZOH 4L5SA 3BJUA 1EIHA 4NMZA 3CCQA 4DV1L 3F8TA 4X66L 2YU9B 5J22A 1G2TA 4PMBA 3KBXA 1TS2A 1VCIA 4RMFA 4APVA 4G57A 2F3IA 2FJ2A 4DR7Q 1R4QB 2NTTA 4DR1L 2F0SA 4HMIA 4DAPA 3S1RB 3ND8A 1PYBA 1EY9A 3TREA 4CDEC 1VQ6A 2JE6I 4FVMA 1AE2A 2VUMB 1SN8A 1SMXA 3V96A 2ZTDA 4DAMA 1V8QA 3HOZB 2PI2E 4H13C 5EGTA 4CDFC 5D14A 1NBWA 4KMUC 2R7ZB 4GKJQ 3S17H 1B50A 4FF3A 1G291 2CW0C 1S5CD 5FLXE 1CHPD 1CFMA 1GUSA 4NW2A 1KQSA 3PF4A 4RAUC 1J5EL 2PMZE 2XIWA 2WACA 1Y1VH 1E2WA 3MFYA 3PQIA 1Y1VG 2KUMA 2DGYA 5I9OA 3I4MB 1RTNA 1UE5A 2MFIA 1Q86C 4DAVA 4GN3B 3ER0A 2A68D 1I50H 2NWGA 1OXVA 4LAAA 1VQPA 2QEXA 2Y0SG 1N33L 1JWMD 2VL6A 4FNFA 3NQTA 1YITA 5A2QE 3S1NH 4JYAL 2B2WC 2KHIA 3QJYA 2UU9L 1I4PA 3MC0B 1XNRL 4K6DA 4UP8A 4MIUA 3S16B 2ID0A 2YV5A 1SE3A 3A54A 3H6MA 5GADC 1KDBA 5IGBA 2IY5B 3S2DB 2VUMG 2PYKA 4DR7L 5C3XA 1I94L 1KLGD 4KJNA 1CI3M 3UDGA 5CV6A 4RGTA 2ATWA 4OWXB 1IYVA 3PUWA 3MXNB 1E2VA 1SE4A 1PH9A 3TS0A 4KKSA 5LMNW 1PDQA 1HNWQ 3FP9A 1MGSA 4Y52H 1PFMA 1I3QB 1JJ2A 3HOXB 3Q24A 4C2MB 2QCPX 2PI2A 4CBVA 5IY0A 2B2VA 3I72A 5JVG3 2JSOA 1Z47A 4EX5A 2QKIC 3LWEA 4DGZA 1CT1D 2F0KA 4JI2Q 3GTKH 2AQ2B 1NMFA 1XTDA 2IPKD 4S3SA 4GN4B 1GUWA 4LFAQ 5I9PA 4ZK9B 1KDCA 4KKTA 4RFBA 4QB4A 1Q46A 1WI5A 4K5XA 3IFDA 3GD7A 4PZ7A 2KVMA 1H9KA 1HXYD 2K03A 2UUAQ 3D4RA 3BZDB 2JEBI 3EBEA 2JA6B 1HTLD 2E2DC 3DWQA 3PUXA 3PO3B 3PO2H 2EVBA 5BR8Q 1MI2A 1IYJB 2MPMA 3PO2G 1QJOA 1TWFH 1E7ZA 2EY2A 2FMCA 2JA5H 1XPOA 1XMOQ 2JA5G 4LF7Q 2A69C 1RODA 4K14A 4A93B 3KFUA 2K05A 1HHVA 1V9PA 1LT5D 1H9SB 4OXPA 3L0OA 5CBAE 5HY6A 2L55A 5LL6S 1UUPA 1PRTB 3VR4A 4HJAA 4LF8Q 1S3OA 4N9PA 4DV4L 2WP8J 1CM9A 5CV7A 1EQQA 3CP0A 2IL8A 1IZ6A 3BVGA 3VA7A 1Y8OB 1GD7A 3D0FA 3PGZA 4RKBA 1GUNA 1EWCA 4F87A 3I73A 3IRBA 1C9OA 4NB3A 4DR3Q 3GO5A 3SR1A 4DXGA 1JORA 4CKBA 1X54A 5DEHA 1CKNB 2MJ8A 3C1FA 2FINB 2F0EA 4R8IA 1VQDA 1G6PA 1PMRA 2AWOA 1CUKA 4PZ8A 1TY2A 2OXPA 4ZYSA 2IWHA 1VQAA 2CQAA 2JYOA 3HFZB 1SBBB 4BY1H 1B44D 4DK1A 1EFWA 2B29A 4JI6L 2OQKA 3NE5B 1YEZA 4BY1G 1VQ5A 1PZKD 1HTPA 2DY8A 5FOBB 1K8OA 1A0IA 1JT8A 4DUZQ 2SDFA 3SK4A 3NTHA 4XIGS 4NXML 2EYLA 1YNJD 5AJ3L 1KAAA 5IT9L 4QGUA 2EYOA 2LSSA 4K2LA 5CV8A 4ODGA 3F2BA 1STEA 2M9VA 3J7YW 4KKUA 3OOCA 4KHPL 5EAYA 3QB3A 3ZYYX 3MAQA 1RDPD 1TWAH 4DF7A 4A3IB 4DR2Q 4ZKCB 3I4NB 4FF2A 1EL0A 4DV5Q 2J7ZA 4B08A 3CCMA 4QY7A 4LF5L 1QILA 5IGCA 3LX0A 3U4ZA 2E75C 3SVMA 1XTCD 4PMWA 4DAYB 5K5PA 1N34Q 1UEBA 2DJGC 4QQBX 3ONAB 1ILQA 1U4PA 2G5DA 2E76C 3S2HB 4AYBG 3OTOL 3KJOA 4I7ZC 3I90A 2XGTA 3ZJYC 5C4JH 1PH1A 4B3TL 4DK0A 3E3XA 1HUMA 1OO9B 2OF1A 2ICEC 1II3A 2EIFA 1WVLA 1WCMH 1VQ4A 4JI3Q 2Z6KA 2JA7H 1CTMA 1WJJA 2EPBA 1KDAA 3MXNA 1QG7A 2JA7G 3DEOA 3X3MA 3BYYB 2F0IA 5ELDA 1QWYA 2NBFA 4P73A 1HNZQ 4R4QA 2A68C 3L9AX 3HP3A 2R92H 1B53A 2FFKB 1PVOA 2DNEA 2KENA 5IYBH 3L2PA 2R92G 3MEFA 2I5LX 2UXCL 4DUZL 5IYBG 3OWEB 4K8IA 2E5LQ 4YWKA 3I4NG 4L63B 4CKCA 3BS1A 2KA7A 2WKDA 3J80i 1WFQA 3SXHA 1N8RC 1AN8A 3TMEA 3OSOA 3Q22A 2L1BA 2XN9C 5M5WH 4HJ5A 4KLKA 2HDLA 1BQQT 1W6KA 1VQLA 3W2DA 2Q2UA 2ZXPA 4IN3A 4K2KA 4GN5A 4NKLA 1X55A 4DA2A 2BA0A 1DYQA 3F1ZA 5GAEC 2O5IC 4ILWA 1EY6A 3NQIA 4PG3A 2KCMA 1F9RA 3N6RA 1Y8PB 1IBKL 3ULLA 3K8AA 3BVMA 1H9JA 1EQTA 1WOCA 2H5XA 3NXWA 2PW5A 4DK3C 3HOWH 4B3MQ 3RLOA 1B1ZA 1MSGA 4JI3L 3HOWG 1PYSB 2NYZD 1SNCA 3AYHB 4JI8Q 2EJMA 2D9UA 4ZAIA 4GKKQ 3C3LA 3TBIB 2JA8H 3HG9A 1UE6A 2JA8G 1UAPA 3A7AB 2K32A 2LY7A 4LK1C 2C5CA 1GJXA 4X3TA 1L2FA 2WV6D 2K04A 4LUZA 2E2JH 4BY7H 1BOSA 2IJ0A 5JJIA 4X6AH 2PPBC 4BY7G 5M5YB 4A3FH 2R7DA 2KCCA 3CQZB 3F2CA 4WJ4A 3QOLA 5DM63 1VQFA 3DLLA 4A3FG 3STBD 1KRTA 3NELA 4KTAA 1ENAA 3I91A 1E22A 1CKNA 4B3SL 2WAQB 2GA4B 1F77A 3C1EA 5M3MH 1Y69U 3J81L 3NWTA 1K8GA 3URYA 2NN6H 1C48A 1PFBA 4IPDA 5M3MG 2NVXB 4KHZA 4EQOA 2NN6G 3AQQA 3MTSA 2B2TA 2G9DA 4JI0Q 4Q5VA 1CSPA 2F0VA 3T51B 3N52A 1GKHA 4A3BB 3HOVH 4LFBL 4JI4L 4DV7L 4A3DH 4DUYQ 1X9NA 1K0SA 1PXUA 4G7HC 4A3DG 4V190 1VMPA 1TKWB 1WTHA 3ERSX 4OEMB 4RA8A 1EUJA 5IP7G 4ZUIA 1BBUA 4A4IA 3K7UC 3QWNA 4QJFA 2F0TA 2RDFA 3HOUB 5ELCA 3U58A 3GTOB 3R2IA 1FNUA 3WWVA 1XJVA 2MHVA 1Q82C 1VQIA 3CCLA 3EROA 4IOCA 4IALA 2Q8TA 2NVQH 4O2DA 4A3CH 4KN4C 5LMUQ 2L4NA 3E6ZX 4A3CG 4EGVA 1AW7A 2DY7A 1TS3A 4JVZA 2XWJB 1EYDA 3OMGA 1X32A 3ULPA 2AUKA 5FLMH 1M1KC 1XNQL 4WRDA 4JI7L 2R6GA 1VQKA 3M3YH 1A8VA 4IUPA 3OPOA 4TVAB 2EYJA 3CC2A 1Y1WH 4DAYA 1D1KA 4YCVA 1DXMA 2JK8A 5CGKA 1RL2A 1Y1WG 1EYGA 2F0QA 3H0GH 5IGGA 3UI2A 2K5HA 1O78A 2EE1A 2E2IH 1F2MA 3H0GG 1ASZA 2SOBA 5JPNC 4BWGB 2KEEA 3E0EA 1BCPF 4K5WA 1VQJA 4K5VA 3SGIA 3A5ZB 4FXDA 4FXKC 5FO9B 4LFCL 2UUCQ 4A3BG 1IW7D 4YIJA 1NR2A 1YNJC 3S1QH 3PF5A 3OW7A 5AFWA 4HAEA 3PIOA 1B2TA 1UNSA 1WTRA 3W5OA 4ZLTF 3TZDA 1O80A 4B3RQ 3I70A 4A3JH 4ZKBB 3RZOB 2OTJA 1PZID 3LNNA 2VW9A 4A3JG 1D8LA 3K57A 3M4PA 5CBEE 5C3WA 5EPLA 3AEVA 1E0BA 3FKIH 4K0KL 4OO1H 3X3NA 3HOYH 5M5XH 3P20A 2F3VA 4HJ8A 3FKIG 4OO1G 2ES2A 4EQNA 3HOYG 3R2TA 5J39A 1FL0A 2MNAA 5HURA 1FYCA 3H3VH 5LMUL 4C3JH 1VF7A 3OWFA 4RH6A 3AMUA 1ICFB 3RD4A 5D65A 4C3JG 1VQ9A 2QGQA 4L5TA 4G4KA 1U5KA 3LWUA 3S17B 3FVQA 4G7ZC 5JEAH 1HNXL 1CQVA 4K6LA 4LF9L 4DN4M 1I4QA 5JEAG 1SNDA 3BDCA 2AQ3B 3JAML 2IX0A 1XYIA 3KOJA 2KJXA 4FF1A 2EY5A 4KHVA 1Y1VB 2OT2A 1PH7A 2K01A 3P7JA 3NWSA 1KL9A 1R9TH 1FR3A 3C46A 5KEEA 3R93A 1N36L 4XT1B 4WORA 1I50B 1E1OA 2Y0SB 3I55A 3VYTA 3J81i 4IUUA 3CC7A 1HA5A 2VB2X 3S1NB 1LTRD 5EKIA 4R4OA 1K9MC 1ET6A 3NTKA 2O4XA 3OW2A 4JV5L 2B2VC 3GV3A 2UXDQ 2ASBA 1L1OB 4DR6Q 5T1IA 1SNMA 4TKOB 1FNWA 1IL8A 3MVVA 5JEAJ 1SYDA 1PRTD 3EQLC 3I7FA 1W3SA 1KNAA 3MZ5A 3SDZA 3SEBA 1EU3A 5FLXL 5H1SE 1E1TA 4M8AA 1HR0Q 4YY3Q 3T1HQ 3K58A 1K0RA 4YHHQ 4GNXB 1MIUA 1CA6A 5HGTA 4DR4Q 2ZM6L 2IX1A 3U4VA 1SMYD 1LV9A 2O5JC 2F0LA 3MWYW 2K6AA 5C3EH 1U4LA 1S5ED 1B4OA 1SNQA 4WJ3M 2D62A 3FPPA 5C3EG 3K6OA 1SEBD 2LMCB 1PYWD 3T53B 1PH5A 4P74A 2PCFB 3RN5A 1YZ6A 2K28A 3GTKB 1PHJA 1EU4A 3T4AC 1JB7A 2Q2IA 1SLJA 2NTSA 5A2QL 1NSNS 5KNDA 4AQYQ 1UEAB 2A74C 1WYDA 4DKAC 4X65Q 3GTGH 2YTYA 1KHIA 1B3AA 1QNKA 1LT3D 2IHEA 3L3OC 1VQHA 3H94A 1BO0A 1HQMC 1X65A 3MEHA 2PQAB 4HN7A 3F2DA 4RGNA 3TZUA 5IYCH 3STBC 1BR9A 1YHQA 1W2BA 4OELB 1X6OA 4BS9A 5IYCG 1H95A 3PV0A 1Q8KA 3KDFA 1SJED 3PO2B 5TSSA 4WJWA 4DR6L 1T9HA 1EZ8A 4HEDA 3GV6A 1TWFB 1KNEA 1STBA 2FXQA 3MHBA 4KY7A 2Q8RE 2JA5B 2RBMA 4IUVA 4DV6Q 3TP6A 3VYSA 1WD1A 2L5TA 5ELOA 2RSOA 5C4XH 4DPGA 1XPRA 1SE2A 2SNSA 1PV4A 4GKJL 5C4XG 3P1HA 2Y0SE 2GN5A 3VYRA 2ZTCA 4XTCS 3V2TA 3CCJA 3E5SA 3T1YQ 1HR0L 4YY3L 3KF8B 4ZUJA 2SNMA 3DM3A 1TWCH 1Q3LA 1EEID 1MJEA 1I4RA 1DOLA 3OHXC 2D2CC 1JOOA 4DFAA 4GZYC 4XXEA 2F0GA 1FNVA 1G51A 1C7YA 2N3SA 3NSWA 4L8JA 4PQXA 1I4XA 1YHAA 5F2DA 1ZYRD 4IUNA 2NN6I 5BN5A 3JAMi 2UXBQ 4CDCC 2F0DA 1FD7D 2I5MX 4H44C 3BVZA 3GTLH 3CAMA 1PLFA 1WTWA 2EJFC 1EY8A 1EWIA 3D31A 5C5LA 3OYYA 1EY7A 5BN4A 5CC4A 2OTLA 4BBRH 1RKNA 2E8GA 4A3KH 1ZKOA 1SYGA 1TWGH 4BBRG 4A3KG 1D5XC 4BY1B 2I0QA 1K83H 3NK9A 4A3GH 1PH2A 1FGUA 1YJ9A 2I46A 4X64Q 1IW7C 4IFDH 2BA1A 1LTID 4LUVA 3G4SA 5COYA 4IFDG 1ZEQX 3L7ZC 2A19A 5E4WC 1A3VA 1HNWL 3CCEA 4UP7A 5KYIA 1T5EA 1X3QA 1D6EC 1P16A 1PA6A 5FKAC 4P72A 2KECA 5DAUA 3FMCA 2UUBQ 3I3CA 4IO9A 4RWSC 3EN2A 2Z6KC 5JPMC 2VQEQ 1QUQB 2L0CA 5CV5A 3SHLA 1TWAB 1BNZA 4H0LC 3J80E 4JI2L 3NBHB 4Z9CB 1Z7TA 2GVAA 4LFAL 3CCSA 3CPWA 3M4OH 5JVH3 3GTQH 4OIKA 3T16A 1KXLA 1L1OA 1IXRA 2UXBL 4AYBB 1C0AA 2PQEA 2HCCA 1KC8C 1D5ZC 3DUZA 4P2CB 5JOBA 4OGQC 5KGUA 3E9HA 2UUAL 2K33A 2Q2HA 5C4JB 4IFDJ 4U673 1STYA 3Q8DA 1YIJA 2QW7A 1LABA 2A6HD 1JQYD 1SYCA 1NR4A 1WCMB 5BR8L 2ZJPA 2JA7B 1PFSA 1ZXTA 3K5LA 3QR8A 1AZQA 1XMOL 3HKZG 4GNXA 2X6LA 4OWWB 5EBDA 4OO1I 4LF7L 3NUCA 5LMNQ 4R8NA 2K5QA 4LNQA 4KD4A 2B39A 1FVIA 3CCVA 1SR3A 4P71A 3H3VI 1G91A 2L11A 4FO2A 1SYFA 4DV2Q 2R92B 1EIYB 3IL8A 1A2TA 2R93H 1V1OA 3FEWX 4LF8L 4AIMA 2R93G 1YNXA 4UHVA 3K7AH 4POFA 3CD6A 1TS4A 4NDXA 2UUBL 4GLAC 4C1NI 4FP5D 4UP9A 1SE8A 2L12A 4DV3Q 2B63H 3DM1A 3CMAA 4O42A 4FXGC 2B63G 1ML0D 1PRTC 4PV1C 1VF5C 3GTPH 2PQAA 3EA6A 3CCUA 5M5WB 1TXYA 3CRKC 1ASYA 2P5ZX 4DR3L 4DXFA 1MBYA 1SNPA 3RR5A 2CH4W 1S5BD 1PH6A 2VY3A 4GOPB 1IKLA 2HIXA 3K81C 1B9NA 1SMYC 1EY0A 3HKSA 1WCMG 1LTBD 1K28A 3J7AV 2SEBD 3U9OA 2ZXOA 1O7LA 3G71A 3HOWB 3A8IE 2MUYA 4YCWA 4OX9Q 3G7LA 2ALYB 3MXGA 3GTMH 2B2UA 1E3PA 3KF8A 1MD2D 1NE3A 4KK7A 5C44H 2Z0SA 1ILPA 2JA8B 2B2TC 4XDXA 4JBMA 5C44G 2E74C 4JC0A 3BDLA 4AYBE 1EIFA 2B8FA 4LF6Q 3FRPB 2OQ0A 4NP5A 1B9MA 2E2JB 4BY7B 4MTNA 2K14A 3PIP3 3CF5A 1KIXA 1TT2A 4ID6A 3HRZC 3DWPA 1HPCA 1DOMA 2JP1A 4DV0Q 4A3FB 1S72A 2QDLA 1ICWA 5E4XA 2MP1A 5LL6X 4DR2L 4DV5L 1U0LA 4KY6A 1LT4D 3S24A 1F9PA 2CHBD 1TQOA 1H9MA 5E1FA 2QILA 4ZCKA 4WFN3 2RF4A 4K8JA 4XQNA 4NPSA 3CCRA 1D2BA 5M3MB 4RG1A 1N34L 4QUCA 1VDZA 3MXUA 2A8VA 3M9BA 2A6ED 4XT3B 1SNOA 4R1JA 5IODA 5C5MA 4IPGA 3PMFA 1XMQQ 2A5HA 3HOVB 1CKOA 3RNUA 4A3DB 1SSOA 2BH8A 2LFNA 2VNUD 4UY8C 1SDFA 3NTIA 5A35A 2A73B 4YWMA 1DCZA 2KCTA 2HDMA 4A76A 2CW0D 3KK7A 5IWAQ 4RCNA 1HNZL 2JQOA 2G9HD 1ZYRC 4OX9L 1EOTA 1VQ7A 1J9OA 2NVQB 4IUTA 1N9WA 2QEJC 1YVCA 1FGBD 1QUQA 4DU9A 4CJ1B 1EY5A 3S1MH 1F9QA 3E9IA 3NBHA 4R4CA 2E5LL 1BCPB 3W1BA 3PCOB 3VYUA 2VB3X 4EQPA 3M3YB 1Y1WB 1JJCB 1SXTA 1ONLA 3VDYA 3D8GA 1LACA 2TMPA 5C0XH 2AWNA 4JCVE 4LJZC 5C0XG 1HFGA 4JPBW 2RKSA 3H0GB 1TWHH 5J1ZA 4KI0A 2F1MA 2E2IB 2B2YA 3DXJC 2AUJD 3SK6A 1IBMQ 2VQFQ 2CQOA 3C2PA 1WTQA 4RGMA 2EOTA 5KNCA 5E3FA 3HZXA 5J3BA 3GTJH 1K8MA 4X62Q 1A3UA 3H15A 2HQLA 5IGFA 3J7AF 3HOVG 1N32Q 3FPUB 1R4PB 3S1QB 4LF4Q 1W6JA 1J8IA 5G3LF 1S4ZA 1JCKB 5FO7B 1F2ZA 1A15A 3NENA 1EYAA 4C3HH 4B3ML 5I6YA 3M4YA 4A3JB 1Z6HA 4J6HA 4N8FA 4CKEA 2HD3A 3IFTA 3TSSA 4JI5Q 4C3HG 1SFOH 3A0JA 4ALPA 4BBSH 2O2LD 2CWAA 1M4VA 2B8GA 4JI8L 1BBXC 4BBSG 3A55A 4RHSA 5CR3A 4GKKL 2F0HA 3D4DA 5I2YA 5M3FH 3FKIB 1BKBA 2RQXA 5M5XB 3HOYB 3IKJA 1V1PB 4IQZA 4A3MH 2F4VQ 1S40A 3KDFB 2XTIA 4IFDI 5C0XJ 4A3MG 4EQ5A 4C3JB 1PZJD 4UPAA 4HIOA 1LT6D 2IHFA 5FLMG 1EYCA 4NXNQ 2M00A 2XNAC 3S15H 4F7XA 4A3LH 2A6HC 4TSSA 2YTVA 5CYUA 3D3RA 4J15A 4A3LG 1YJWA 1IHZA 1BBWA 1JJGA 2F0PA 2F0MA 3CW2C 1CA5A 1STGA 3K5NA 4GOPA 1UE1A 3B6YA 5C4HA 3K0XA 1STAA 2EXZA 1FJGQ 5IE8A 1HJPA 1F2LA 2NZ1D 1CSQA 4I65A 4JI0L 1I6HH 2R3ZA 1EY4A 1RJTA 4ZQ3A 3DMUA 1R9TB 1JC7A 4X62L 3RZDH 4DUYL 1HRJA 3S14H 1NMGA 3ERQA 4C1NK 1HH2P 4JI1Q 4FDBA 1V43A 1PTOH 4DV1Q 4X66Q 2Z8LA 1OXTA 4FF4A 2E2HH 2L9HA 2L15A 3KF6B 2OEOA 4DR1Q 3A56A 3BU2A 1NJIC 2XRQD 3SK8A 4X3KA 5KIXA 2F4VL 4P75A 4MHEA 3V05A 2RDGA 1XPUA 1PTOF 3QG1A 2MQHA 4OONA 2PNRC 2AQ1B 4NXNL 3W1GA 1EIGA 2EYFA 2BDOA 1IL2A 4Y7NH 2K7VA 1PH3A 3A5UA 3UE0A 2F0FA 1X3GA 3M7NA 1E2ZA 5T1GA 4C3IH 5C3EB 2BE5D 1J5EQ 1Q7YC 4KV6A 5GQOA 1M8AA 1SRUA 2K4KA 2HQEA 3HGBA 1JE4A 2UUCL 1XX8A 1JWUD 5CORA 3UE1A 2EQSA 1JB3A 3QOJA 4IURA 2HCIA 4QIWE 2F4IA 2EDGA 3GQBA 2ZT9C 4B3RL 3GTGB 1ET9A 3GDEA 1N33Q 1EOVA 2XVSA 2NVYH 2HT1A 1LYLA 4HSVA 1YHBA 4JYAQ 3MFGA 3J80c 3J7A5 2UU9Q 2KBNA 2WB1B 4KD3A 3SK5A 3OIQA 3EIVA 3J7ZC 4GS3A 1IYUA 1VQGA 2WIIB 1QVGA 1DONA 1YBYA 2K52A 2EY1A 1TY0A 1KRSA 3KLRA 2A6EC 1B3QA 2NUCA 1I94Q 3FHWA 2Z9HA 3WOFA 2YTXA 3H91A 5C4XB 4HIKA 3CC4A 5EPJA 4RGOS 4PMCA 2I07B 1GHJA 3TP5A 2KOLA 2LKVA 4N9TA 1QVFA 1KAWA 3W3AA 1HZAA 2PZUA 2N55A 5DNFA 1TWCB 4LMQD 3KBGA 4L6TB 2V1CC 1CZWA 1BF4A 5IIFA 4TQUS 5FJ8H 4X3UA 1L0WA 1STNA 1EWHA 2PZTA 5FJ8G 2KHSA 3QO2A 4XQQA 5EKLA 2ENBA 2HIVA 3EVQA 1G8ZD 2F0UA 5GAHC 4R9WA 2F03A 4MZ9A 1NCVA 3A8KE 4DNRB 3GTLB 3PIPA 4A3EH 4ME3A 4MN3A 1NAPA 3UDFA 1O7ZA 4A3EG 3U50C 1V1PA 1YNND 3TN2A 2QF7A 4JOIA 2KQ3A 3RLNA 2WB1G 3WDNA 2KCNA 4MTKA 1GM5A 2YU9H 2UXDL 3CPFA 1X3FA 3Q6SA 5IT9c 2JEAI 1I5FA 3DHQA 1VQCA 4BBRB 3TQYA 4A3KB 4B9WA 2IT1A 1TWGB 3S1RH 1KTKA 5DM73 1C4QA 1K83B 1CHQD 4A3GB 1OXSC 2VUMH 4N8X1 4DK6C 3CMEA 1AEXA 3HOZH 1L1OC 2BCOA 1JMCA 4IPHA 2R7ZH 2RA4A 3HOZG 5JJLA 2CKZB 3T1HL 4H02A 2AMCB 2R7ZG 4YHHL 2EZVA 1CZGA 3PUZA 2F0JA 4DR4L 2V4DA 1KLUD 5DLQE 1I6VC 1RCVD 1T5XD 1YJNA 3AFPA 1GUGA 3K0YA 4DV4Q 2RSNA 2WB1E 4LUOA 5CMDA 4XQJA 1KABA 2YYZA 5C0XI 4JW0A 1YI2A 1PFNA 3NP8A 5BN3A 2D0PA 4GNXC 2DN8A 4F88A 3I4MH 5I4DA 2N49A 4U68A 3I4MG 4F8MA 3M4OB 4AQYL 3SE0A 4X65L 1Z9FA 2EYMA 1SYEA 3E0JA 3GTQB 3GP7A 1HUNA 3KF6A 3MA2B 3NEMA 2D0OA 5E7NA 3KUPA 1MKHA 2PO4A 4MNOA 5KYLA 4X3SA 4L5RC 3G6EA 1B8AA 5CV9A 2N8NA 3S16H 1RTOA 2JJQA 5JAVA 1RF2D 3EFXD 1B70B 1XXGA 3AB9A 2DJFC 1TR5A 2KHJA 3DWAA 4A3GG 3S2DH 2Z4HA 3HKZB 2HHHQ 1DJRD 4DV6L 1S5FD 3RMHA 4JI6Q 2PW7A 1X3EA 3TEHB 1DM0B 1J6QA 3FDTA 5CV4A 4JBJA 1A6XA 4J1MA 4L5QA 3KLSX 2NZHA 2CCZA 3AFQA 3NPPA 3T1YL 3R8BA 4NXMQ 2JXMB 5KNBA 2R93B 1I3QH 1VQNA 2MO1A 2XWBB 5AJ3Q 3HOXH 3H09A 2B2WA 2N78A 4C2MH 3J80L 3HOXG 4KHPQ 3K7AB 3DEPA 1QE6A 2VS1A 4BA1I 5G3LD 1I4GA 4OL7A 2F0WA 3U9SA 3BZCA 3PIO3 2A1AA 2J0TD 4HJ7A 2B63B 2B2UC 5I6WA 1IKMA 5KRUA 3GTPB 4LF5Q 1NUCA 4FYDA 1NY4A 2X69A 4KY5A 2F0OA 4B9XA 5EQ0A 3IAYA 1NNXA 4BA2I 1GVPA 2K5DA 4IUQA 3KLWA 1JE5A 1HZ9A 4O1NA 4CGYB 1ESFA 3ULJA 3OTOQ 1WTXA 4HIDA 3CU7A 1PH4A 4B3TQ 2JA6H 3CXCA 1EFID 2JA6G 1IBLQ 3PO3H 2BE5C 1QNUA 2C35B 3PO3G 2EY6A 4BXXH 3BG3A 1EQRA 1P8LA 1QOHA 4BXXG 3GTMB 1BCPD 5IOCA 4X64L 1ENFA 2I5HA 5IGDA 3JC66 1A3TA 2HHHL 1AZPA 4A93H 5C44B 1GOZA 1E24A 4A93G 1D1IA 1QVCA 3J81c 3G6JB 1LTGD 4OHJA 2QDBA 4OWTB 5FO8B 4HJ9A 2UXCQ 3RUZA 3D4WA 3NHHA 4V0BA 1MSHA 2VQEL 1K8AC 1GXDC 4HR7B 5IT9E 4ABNA 3PSIA 4EVOA 2JA9A 1Q90A 3UDXA 1UE7A 2PNHA 1K3RA 4ZRZA 5GAGC 3HKZE 1SROA 3AU7A 4M1UB 2XRSD 3TS2A 1PRTF 4R4TA 1HQRD 2ZXRA 1G6ZA 5EBCA 1XWEA 2H1EA 1LLRD 3K59A 3Q23A 5C6AA 1IBKQ 2F52A 1PTOD 2QA4A 2D5DA 1AFPA 4A75A 2K75A 2M2LA 5M9OA 2VZAA 4KJOA 1TS5A 3KYHC 1U4RA 4DR5Q 1IBLL 4UAIA 5FK9C 1VQEA 5LMNL 2B2YC 1CQFA 2ZTEA 5D3DA 1UWVA 1CK1A 2EYHA 3NBIA 2K5VA 4DNTB 3K5MA 4DV2L 4RCOA 4GLVB 5EJWA 2Z6BA 3S1MB 1EQVA 1DOKA 5K36H 1YNNC 3RN2A 2EJGC 1K3BC 5K36G 1H9RA 3BYTB 4GLXA 1OXXK 4IPCA 1A63A 1TU2B 1VS0A 3M4QA 2F3WA 2AHOB 2K5NA 2X6GA 1Q12A 3CRLC 1HCZA 5EKKA 4DV3L 3G48A 4A3IH 3I4NH 1Y14B 2BOSA 4YCUA 2WFWA 1WTVA 4A3IG 1Q8IA 2R7FA 3KJPA 1TWHB 4B3SQ 1VQ8A 3TDQA 2F0NA 1EZ6A 3A8JE 4Q0FA 1TVXA 3S2HH 4XYQA 3GTJB 1Y8NB 3D6WA 2ZJQA 3T56B 4JK1C 1ENCA 2JN4A 3P75A 3S9WA 1HFNA 4LFBQ 4JI4Q 1LM0A 4DV7Q 5JJKA 2OWOA 3QIAA 1BUVT 1C8CA 3HS0C 3K5OA 1HA6A 1DGSA 4C3HB 2BDNA 1BDOA 2IW3A 4GOPC 1SFOB 1B7YB 3MXPA 1ESRA 4BBSB 1LTAD 1DZ1A 1OXUA 4DR5L 2K50A 3BDOA 1H9SA 5M3FB 2CFMA 3JAMc 2C9OA 2WKCA 4A3MB 1HZBA 2R61A 2LXJA 1X3PA 4LF6L 1Q81C 3D6CA 2H4OA 2RVLA 5IYDH 5ELEA 1LO5D 1QCBD 4JG2A 1JOKA 5IYDG 1V1QA 4DV0L 3S15B 3OIPA 1XNQQ 1GO3E 2EYPA 4JI7Q 1SJHD 2BH2A 2J4XA 2Z4IA 2XSCA
chains in the Genus database with same CATH topology
1BXTA 3EJIA 4C56C 5EPKA 1WTPA 1F2YA 1JWSD 4H7BA 1I6HB 2NB0A 3PUYA 3ITPA 1LTSD 3J81E 3VR5A 3RLFA 4QUFA 1GUOA 3RZDB 4E6IA 3S14B 2LS01 4HCSA 2VXWA 1STHA 3Q0AA 4HSPA 3O13A 3I8ZA 3KLSA 4IZ8A 1PTOB 3PUVA 4RKLA 2ICIA 2K1BA 3VR2A 2FHTA 2E2HB 1Q1BA 3R3OA 5NUCA 4QIWB 1RD9D 3I4LA 4CHTB 2NVTB 2PZWA 1Q1EA 2KEDA 2CVRA 1AP0A 4QF4A 1O7YA 2FMMA 4CJ2C 5IGEA 1DD2A 1VMCA 1EEFD 3F2UA 2Z1CA 4UDUC 4Y7NB 5ISRA 3ND9A 4G7OC 2RDHA 1WTOA 4ME5A 1BCPC 1S5DD 4C3IB 3CHBD 5I2XA 1RHPA 4QMGA 2TSSA 1GHKA 1WD0A 2K5WA 2DNCA 2N88A 4TRDA 1QB5D 2A69D 3M7GA 4OIJA 4J8QA 2IX3A 4KN7C 2NVYB 3VA5A 2HUGA 1U9RA 2MGSA 1LTTD 5C4ZA 4CJ0B 2PMZB 5LHY1 4HMJA 1F9SA 1A2UA 4HCEA 4PNYA 4JBWA 1SAPA 4ULLA 3HEJA 3WOEA 2WINB 3M85A 5ELFA 1PTOC 4HTHA 3VR6A 1TIID 3A7LA 3H3VC 1JOQA 1L0XB 4C3IG 1L0YB 3OMCA 4RHRA 1JICA 4QCLA 1U4MA 3JAME 3TP7A 1D5MC 1GUTA 1I4HA 4XYOA 1JR0D 1SYBA 5ELBA 3CKIB 5JJZA 1G2SA 4A3EB 5D3IB 3VR3A 3T13A 2Q8IB 3TP8A 1EIHA 4NMZA 1G2TA 2YU9B 5J22A 4PMBA 3KBXA 1TS2A 1VCIA 4G57A 2FJ2A 1R4QB 2NTTA 2F0SA 4HMIA 4DAPA 3S1RB 3ND8A 1EY9A 2JE6I 4FVMA 2VUMB 3V96A 1V8QA 3HOZB 4H13C 5EGTA 5D14A 4KMUC 2R7ZB 1B50A 4FF3A 1G291 2CW0C 1S5CD 5FLXE 1CHPD 1CFMA 1GUSA 4NW2A 4RAUC 2WACA 2XIWA 1E2WA 3MFYA 2KUMA 5I9OA 3I4MB 1RTNA 4DAVA 2A68D 2NWGA 1OXVA 4LAAA 1JWMD 4FNFA 3NQTA 5A2QE 2B2WC 3QJYA 1I4PA 3MC0B 4K6DA 4MIUA 3S16B 2ID0A 1SE3A 3A54A 3H6MA 1KDBA 5IGBA 3S2DB 2PYKA 5C3XA 1KLGD 4KJNA 1CI3M 5CV6A 4RGTA 1IYVA 3PUWA 1E2VA 1SE4A 4KKSA 1PDQA 1MGSA 1PFMA 1I3QB 3HOXB 3Q24A 4C2MB 2QCPX 4CBVA 2B2VA 3I72A 5JVG3 2JSOA 1Z47A 4DGZA 2QKIC 3LWEA 1CT1D 2F0KA 2AQ2B 2IPKD 4S3SA 1GUWA 5I9PA 4ZK9B 1KDCA 4KKTA 4RFBA 4QB4A 4K5XA 3IFDA 3GD7A 2KVMA 1H9KA 1HXYD 2K03A 3D4RA 3BZDB 2JEBI 2JA6B 1HTLD 2E2DC 3DWQA 3PUXA 3PO3B 2EVBA 1MI2A 2MPMA 1QJOA 2EY2A 2FMCA 2A69C 1RODA 4K14A 4A93B 2K05A 1HHVA 1LT5D 1H9SB 5CBAE 2L55A 5LL6S 1UUPA 1PRTB 3VR4A 4N9PA 2WP8J 1CM9A 5CV7A 2IL8A 3BVGA 3VA7A 1Y8OB 4RKBA 1GUNA 1EWCA 4F87A 3I73A 3GO5A 3SR1A 4DXGA 1JORA 4CKBA 5DEHA 2MJ8A 3C1FA 2FINB 2F0EA 4R8IA 1PMRA 2AWOA 1TY2A 2OXPA 4ZYSA 2IWHA 2CQAA 2JYOA 1SBBB 1B44D 4DK1A 3NE5B 1PZKD 1HTPA 2DY8A 5FOBB 1K8OA 2SDFA 3SK4A 3NTHA 4XIGS 2EYLA 1YNJD 1KAAA 5IT9L 2EYOA 4K2LA 5CV8A 4ODGA 1STEA 2M9VA 3J7YW 4KKUA 3OOCA 3QB3A 3ZYYX 3MAQA 1RDPD 4DF7A 4A3IB 3I4NB 4ZKCB 4FF2A 1EL0A 2J7ZA 4B08A 1QILA 5IGCA 3LX0A 2E75C 3SVMA 1XTCD 4PMWA 5K5PA 3ONAB 1ILQA 1U4PA 2E76C 3S2HB 4I7ZC 3I90A 4DK0A 1HUMA 1OO9B 2OF1A 2ICEC 1II3A 1WVLA 1CTMA 2EPBA 1KDAA 3MXNA 1QG7A 3DEOA 3X3MA 3BYYB 2F0IA 5ELDA 1QWYA 2NBFA 2A68C 3L9AX 3HP3A 1B53A 2FFKB 2DNEA 3OWEB 4K8IA 4L63B 4CKCA 3BS1A 2KA7A 2WKDA 3SXHA 1AN8A 3TMEA 3OSOA 3Q22A 2L1BA 2XN9C 2HDLA 1BQQT 1W6KA 3W2DA 2ZXPA 4IN3A 4K2KA 4NKLA 4DA2A 2BA0A 1DYQA 2O5IC 4ILWA 1EY6A 3NQIA 1F9RA 3N6RA 1Y8PB 3BVMA 1H9JA 1EQTA 3NXWA 2PW5A 1B1ZA 1MSGA 2NYZD 1SNCA 2EJMA 2D9UA 4ZAIA 3C3LA 3TBIB 3HG9A 1UAPA 3A7AB 2K32A 2LY7A 4LK1C 2C5CA 1GJXA 4X3TA 2WV6D 2K04A 1BOSA 2IJ0A 2PPBC 5M5YB 2KCCA 3CQZB 3QOLA 5DM63 4KTAA 1ENAA 3I91A 2WAQB 2GA4B 1F77A 3C1EA 1Y69U 3J81L 3NWTA 3URYA 2NN6H 1C48A 1PFBA 2NVXB 4KHZA 4EQOA 2NN6G 3MTSA 2B2TA 2G9DA 4Q5VA 2F0VA 3T51B 3N52A 4A3BB 1PXUA 4G7HC 4V190 1VMPA 1TKWB 4RA8A 4ZUIA 3QWNA 2F0TA 2RDFA 3HOUB 5ELCA 3GTOB 3R2IA 1FNUA 2MHVA 3EROA 4IALA 2Q8TA 4KN4C 2L4NA 3E6ZX 4EGVA 1AW7A 2DY7A 1TS3A 2XWJB 1EYDA 3OMGA 1X32A 2AUKA 4WRDA 2R6GA 4IUPA 3OPOA 2EYJA 4DAYA 1D1KA 1DXMA 5CGKA 2F0QA 5IGGA 3UI2A 1O78A 2EE1A 1F2MA 2SOBA 5JPNC 4BWGB 2KEEA 4K5WA 1BCPF 4K5VA 4FXDA 4FXKC 5FO9B 1IW7D 4YIJA 1NR2A 1YNJC 3OW7A 5AFWA 4HAEA 1B2TA 1UNSA 1WTRA 4ZLTF 3TZDA 1O80A 3I70A 4ZKBB 3RZOB 1PZID 3LNNA 3K57A 5CBEE 5C3WA 5EPLA 1E0BA 4OO1H 3X3NA 3P20A 2F3VA 4OO1G 4EQNA 3R2TA 5J39A 5HURA 1FYCA 1VF7A 3OWFA 4RH6A 3AMUA 3RD4A 5D65A 4C3JG 4G4KA 3LWUA 3S17B 3FVQA 4G7ZC 5JEAH 1CQVA 4K6LA 4DN4M 1I4QA 5JEAG 1SNDA 3BDCA 2AQ3B 3JAML 2IX0A 1XYIA 2KJXA 4FF1A 2EY5A 4KHVA 1Y1VB 2OT2A 2K01A 3P7JA 3NWSA 1FR3A 3C46A 5KEEA 3R93A 4XT1B 4WORA 1I50B 2Y0SB 3VYTA 4IUUA 1HA5A 2VB2X 3S1NB 1LTRD 5EKIA 1ET6A 3NTKA 2O4XA 2B2VC 3GV3A 5T1IA 1SNMA 4TKOB 1FNWA 1IL8A 3MVVA 5JEAJ 1SYDA 1PRTD 3EQLC 1KNAA 3MZ5A 3SDZA 3SEBA 1EU3A 5FLXL 4M8AA 3K58A 1CA6A 5HGTA 2IX1A 1SMYD 1LV9A 2O5JC 2F0LA 3MWYW 2K6AA 1U4LA 1S5ED 1B4OA 1SNQA 2D62A 3FPPA 3K6OA 1SEBD 2LMCB 1PYWD 3T53B 2PCFB 2K28A 3GTKB 1EU4A 3T4AC 2NTSA 5A2QL 1NSNS 5KNDA 1UEAB 2A74C 1B3AA 1QNKA 1LT3D 3L3OC 3H94A 1BO0A 1HQMC 3MEHA 4HN7A 4RGNA 3TZUA 1BR9A 4BS9A 3PV0A 1SJED 3PO2B 5TSSA 4WJWA 1EZ8A 4HEDA 3GV6A 1TWFB 1KNEA 1STBA 3MHBA 4KY7A 2Q8RE 2JA5B 2RBMA 4IUVA 3TP6A 3VYSA 1WD1A 2L5TA 2RSOA 1SE2A 2SNSA 3P1HA 3VYRA 4XTCS 3V2TA 3E5SA 4ZUJA 2SNMA 1Q3LA 1EEID 1I4RA 1DOLA 3OHXC 2D2CC 1JOOA 4DFAA 4GZYC 4XXEA 2F0GA 1FNVA 3NSWA 4L8JA 4PQXA 1I4XA 5F2DA 1ZYRD 4IUNA 2NN6I 5BN5A 2F0DA 1FD7D 4H44C 3BVZA 1PLFA 1WTWA 2EJFC 1EY8A 3D31A 5C5LA 1EY7A 5BN4A 5CC4A 1RKNA 1ZKOA 1SYGA 1D5XC 4BY1B 3NK9A 2I46A 1IW7C 4IFDH 2BA1A 1LTID 5COYA 4IFDG 1ZEQX 3L7ZC 5E4WC 1A3VA 5KYIA 1T5EA 1X3QA 1D6EC 5FKAC 2KECA 5DAUA 3FMCA 3I3CA 4RWSC 5JPMC 2L0CA 5CV5A 3SHLA 1TWAB 1BNZA 4H0LC 3J80E 4Z9CB 1Z7TA 5JVH3 4OIKA 3T16A 4AYBB 2PQEA 2HCCA 1D5ZC 3DUZA 4P2CB 5JOBA 4OGQC 5KGUA 2K33A 5C4JB 4IFDJ 4U673 1STYA 1LABA 2A6HD 1JQYD 1SYCA 1NR4A 1WCMB 2JA7B 1ZXTA 3K5LA 1AZQA 2X6LA 4OO1I 5EBDA 3NUCA 4R8NA 2K5QA 4KD4A 2B39A 1G91A 2L11A 4FO2A 1SYFA 2R92B 3IL8A 1A2TA 1V1OA 3FEWX 1TS4A 4NDXA 4C1NI 4FP5D 2L12A 3DM1A 4O42A 4FXGC 1ML0D 1PRTC 4PV1C 1VF5C 3EA6A 5M5WB 3CRKC 4DXFA 1MBYA 1SNPA 1S5BD 1IKLA 1B9NA 1SMYC 1EY0A 1LTBD 3J7AV 2SEBD 3U9OA 2ZXOA 1O7LA 3HOWB 3A8IE 2MUYA 3G7LA 3MXGA 2B2UA 3KF8A 1MD2D 4KK7A 1ILPA 2JA8B 2B2TC 4XDXA 2E74C 3BDLA 2B8FA 3FRPB 4NP5A 1B9MA 2E2JB 4BY7B 3PIP3 1TT2A 4ID6A 3HRZC 3DWPA 1HPCA 1DOMA 2JP1A 4A3FB 1ICWA 5E4XA 2MP1A 5LL6X 4KY6A 1LT4D 1F9PA 2CHBD 1TQOA 1H9MA 5E1FA 2QILA 4WFN3 4K8JA 4XQNA 1D2BA 5M3MB 4QUCA 1VDZA 3MXUA 2A6ED 4XT3B 1SNOA 5IODA 5C5MA 3PMFA 2A5HA 3HOVB 4A3DB 1SSOA 2LFNA 2VNUD 1SDFA 3NTIA 5A35A 2A73B 1DCZA 2HDMA 2CW0D 3KK7A 4RCNA 2G9HD 1ZYRC 1EOTA 1J9OA 2NVQB 4IUTA 2QEJC 1FGBD 4DU9A 4CJ1B 1EY5A 1F9QA 3NBHA 1BCPB 3VYUA 2VB3X 4EQPA 3M3YB 1Y1WB 1SXTA 1ONLA 3D8GA 1LACA 2TMPA 5C0XH 2AWNA 4LJZC 5C0XG 1HFGA 2RKSA 3H0GB 5J1ZA 4KI0A 2F1MA 2E2IB 2B2YA 3DXJC 2AUJD 3SK6A 3C2PA 1WTQA 4RGMA 2EOTA 5KNCA 5E3FA 3HZXA 1K8MA 1A3UA 5IGFA 3J7AF 3FPUB 1R4PB 3S1QB 1W6JA 1J8IA 5G3LF 1S4ZA 1JCKB 5FO7B 1F2ZA 1A15A 1EYAA 5I6YA 3M4YA 4A3JB 1Z6HA 4J6HA 4CKEA 3IFTA 3TSSA 4C3HG 2O2LD 1M4VA 2B8GA 1BBXC 3A55A 4RHSA 5CR3A 2F0HA 3D4DA 5I2YA 3FKIB 2RQXA 3HOYB 5M5XB 3IKJA 1V1PB 4IQZA 4IFDI 5C0XJ 4C3JB 1PZJD 1LT6D 1EYCA 2M00A 2XNAC 4F7XA 2A6HC 4TSSA 5CYUA 3D3RA 1IHZA 2F0PA 2F0MA 1CA5A 1STGA 3K5NA 5C4HA 1STAA 2EXZA 1F2LA 2NZ1D 4I65A 2R3ZA 1EY4A 1RJTA 4ZQ3A 3DMUA 1R9TB 1JC7A 1HRJA 3ERQA 4C1NK 1V43A 1PTOH 2Z8LA 1OXTA 4FF4A 2L9HA 2OEOA 3A56A 2XRQD 3SK8A 4X3KA 5KIXA 4MHEA 3V05A 2RDGA 1PTOF 3QG1A 2PNRC 2AQ1B 1EIGA 2EYFA 2BDOA 2K7VA 2F0FA 3M7NA 1E2ZA 5T1GA 5C3EB 2BE5D 4KV6A 1M8AA 2HQEA 3HGBA 1JE4A 1XX8A 1JWUD 5CORA 1JB3A 3QOJA 4IURA 2HCIA 2F4IA 2EDGA 3GQBA 2ZT9C 3GTGB 1ET9A 2XVSA 4HSVA 3MFGA 2WB1B 4KD3A 3SK5A 3OIQA 1IYUA 2WIIB 1DONA 2EY1A 1TY0A 3KLRA 2A6EC 2NUCA 3WOFA 3H91A 5C4XB 5EPJA 4RGOS 4PMCA 2I07B 1GHJA 3TP5A 2KOLA 2LKVA 4N9TA 3W3AA 2PZUA 2N55A 5DNFA 1TWCB 4LMQD 3KBGA 4L6TB 1CZWA 1BF4A 5IIFA 4TQUS 4X3UA 1STNA 1EWHA 2PZTA 2KHSA 3QO2A 4XQQA 5EKLA 2ENBA 3EVQA 1G8ZD 2F0UA 4R9WA 2F03A 1NCVA 3A8KE 4DNRB 3GTLB 4MN3A 1NAPA 1O7ZA 1V1PA 1YNND 3TN2A 2QF7A 2KQ3A 3WDNA 2KCNA 3Q6SA 2JEAI 3DHQA 4BBRB 4A3KB 4B9WA 2IT1A 1TWGB 1KTKA 5DM73 1C4QA 1K83B 1CHQD 4A3GB 1OXSC 1AEXA 2BCOA 2RA4A 2EZVA 1CZGA 3PUZA 2F0JA 2V4DA 1KLUD 1I6VC 1RCVD 1T5XD 1GUGA 3K0YA 2RSNA 5CMDA 4XQJA 1KABA 2YYZA 5C0XI 1PFNA 3NP8A 5BN3A 2DN8A 4F88A 5I4DA 4U68A 4F8MA 3M4OB 3SE0A 2EYMA 1SYEA 3E0JA 3GTQB 3GP7A 1HUNA 3MA2B 3KUPA 2PO4A 5KYLA 4X3SA 5CV9A 1RTOA 5JAVA 1RF2D 3EFXD 1XXGA 3AB9A 1TR5A 3DWAA 2Z4HA 3HKZB 1DJRD 1S5FD 3RMHA 2PW7A 1DM0B 3FDTA 5CV4A 1A6XA 4J1MA 3KLSX 3NPPA 3R8BA 2JXMB 5KNBA 2R93B 2XWBB 3H09A 2B2WA 3J80L 3K7AB 3DEPA 1QE6A 4BA1I 5G3LD 1I4GA 4OL7A 2F0WA 3U9SA 3PIO3 2J0TD 2B63B 2B2UC 5I6WA 1IKMA 5KRUA 3GTPB 1NUCA 4FYDA 2X69A 4KY5A 2F0OA 4B9XA 5EQ0A 3IAYA 4BA2I 2K5DA 4IUQA 4O1NA 4CGYB 1ESFA 1WTXA 3CU7A 1EFID 2BE5C 1QNUA 2EY6A 3BG3A 1QOHA 3GTMB 1BCPD 5IOCA 1ENFA 5IGDA 1A3TA 1AZPA 5C44B 1GOZA 1D1IA 3G6JB 1LTGD 4OHJA 2QDBA 5FO8B 3RUZA 3D4WA 3NHHA 4V0BA 1MSHA 1GXDC 4HR7B 5IT9E 4ABNA 4EVOA 1Q90A 4ZRZA 3AU7A 4M1UB 2XRSD 1PRTF 1HQRD 2ZXRA 1G6ZA 5EBCA 1XWEA 2H1EA 1LLRD 3K59A 3Q23A 5C6AA 1PTOD 2D5DA 1AFPA 2M2LA 5M9OA 4KJOA 1TS5A 1U4RA 4UAIA 5FK9C 2B2YC 1CQFA 5D3DA 1CK1A 2EYHA 3NBIA 4DNTB 3K5MA 4RCOA 5EJWA 3S1MB 1EQVA 1DOKA 5K36H 1YNNC 2EJGC 5K36G 1H9RA 3BYTB 1OXXK 1TU2B 2F3WA 2X6GA 1Q12A 3CRLC 1HCZA 5EKKA 2BOSA 1WTVA 1Q8IA 1TWHB 3TDQA 2F0NA 1EZ6A 3A8JE 4Q0FA 1TVXA 4XYQA 3GTJB 1Y8NB 3D6WA 3T56B 4JK1C 1ENCA 3S9WA 3P75A 1HFNA 3QIAA 1BUVT 1C8CA 3HS0C 3K5OA 1HA6A 4C3HB 2BDNA 1BDOA 2IW3A 1SFOB 3MXPA 1ESRA 4BBSB 1LTAD 1DZ1A 1OXUA 3BDOA 1H9SA 5M3FB 2C9OA 2WKCA 4A3MB 2R61A 1X3PA 3D6CA 2H4OA 2RVLA 5ELEA 1LO5D 1QCBD 1JOKA 3S15B 3OIPA 2EYPA 1SJHD 2J4XA 2Z4IA 2XSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX L;  3J80 L;  5IT9 L;  3JAM L;  3J81 L;  5A2Q L;  3J7A V;  5LL6 X; 
#chains in the Genus database with same CATH topology
 1BXT A;  3EJI A;  3BZK A;  4C56 C;  1AE3 A;  5EPK A;  1WTP A;  1F2Y A;  1JWS D;  4H7B A;  1PH8 A;  1I6H B;  2NB0 A;  3PUY A;  3ITP A;  4JBK A;  1LTS D;  3J81 E;  4CDD C;  1VQO A;  1XMQ L;  4LFC Q;  4IJH A;  3VR5 A;  3RLF A;  4O0A A;  4QUF A;  1GUO A;  3RZD B;  4E6I A;  3S14 B;  2LS0 1;  4HCS A;  2VXW A;  1STH A;  3Q0A A;  1MJC A;  4HSP A;  3O13 A;  5FLX c;  3LGJ A;  3I8Z A;  3KLS A;  4IZ8 A;  5ELN A;  1QZG A;  2B3G A;  5IP7 H;  5IWA L;  5M3F G;  1PTO B;  3PUV A;  4RKL A;  1LUZ A;  2ICI A;  2K1B A;  3VR2 A;  1M90 C;  2FHT A;  4R4I A;  2E2H B;  1Q1B A;  3R3O A;  3I56 A;  3TRZ A;  4K0K Q;  5NUC A;  4QIW B;  1RD9 D;  3I4L A;  4CHT B;  2NVT B;  5L37 A;  1RIP A;  2PZW A;  1Q1E A;  1VQM A;  1QZH A;  2KED A;  4DNI A;  2CVR A;  1AP0 A;  4QF4 A;  1O7Y A;  1OTC A;  1X56 A;  4PZ6 A;  2FMM A;  4CJ2 C;  2NZO A;  5IGE A;  1DD2 A;  1VMC A;  1EEF D;  3F2U A;  5M5Y H;  1K73 C;  3CQZ H;  2Z1C A;  4UDU C;  4Y7N B;  1MHW C;  5ISR A;  3ND9 A;  1HNX Q;  4G7O C;  4LF9 Q;  1HR0 W;  2RDH A;  4QL5 A;  1O7I A;  2AKW B;  1WTO A;  4ME5 A;  2RHS B;  1BCP C;  1S5D D;  4C3I B;  1IBM L;  2VQF L;  3CHB D;  2WAQ G;  5I2X A;  1RHP A;  2NVX H;  2Q2T A;  4QMG A;  2RCN A;  2TSS A;  1GHK A;  1WD0 A;  2K5W A;  2DNC A;  1N32 L;  2N88 A;  4TRD A;  1QB5 D;  1VQB A;  2A69 D;  4LF4 L;  4A3B H;  3M7G A;  4OIJ A;  1N36 Q;  4J8Q A;  4LW1 A;  3UDI A;  2IX3 A;  4JI5 L;  4KN7 C;  2NVY B;  1KD1 C;  3VA5 A;  2HUG A;  1U9R A;  2MGS A;  4IOA A;  1LTT D;  1NTG A;  3HOU H;  5C4Z A;  2NVT H;  3J81 j;  4I7A A;  3GTO H;  5HGQ A;  4CJ0 B;  1BVS A;  2PMZ B;  4JV5 Q;  4POG A;  3HOU G;  2DUD A;  5LHY 1;  3ICE A;  1AH9 A;  4HMJ A;  1F9S A;  1A2U A;  2MO0 A;  4LWC A;  4HCE A;  2CWP A;  4PNY A;  2RCF A;  4JBW A;  2ZJR A;  2WAQ E;  1SAP A;  2LXK A;  3HEJ A;  4ULL A;  3WOE A;  2WIN B;  3M85 A;  1CKM A;  1PTO C;  3I2Z A;  5ELF A;  3I4O A;  4HTH A;  4JOI C;  1A62 A;  3VR6 A;  1TII D;  3A7L A;  3H3V C;  1JOQ A;  3K80 C;  2ZM6 Q;  1L0X B;  4C3I G;  3A74 A;  4HIM A;  1HZC A;  1L0Y B;  1FJG L;  3OMC A;  4RHR A;  4IJL A;  5IP9 H;  5IP9 G;  1JIC A;  2EXD A;  4QCL A;  1U4M A;  3JAM E;  5GRO A;  3TP7 A;  2GVB A;  1D5M C;  1GUT A;  1I4H A;  4AH6 A;  4XYO A;  1JR0 D;  1SYB A;  1LTL A;  5ELB A;  3CKI B;  5JJZ A;  4YWL A;  1G2S A;  2RHQ B;  4A3E B;  5D3I B;  3VR3 A;  2OCE A;  3T13 A;  1D7Q A;  2CH4 A;  2Q8I B;  3TP8 A;  1XNR Q;  4JI1 L;  3RZO H;  4L5S A;  3BJU A;  1EIH A;  4NMZ A;  3CCQ A;  4DV1 L;  3F8T A;  4X66 L;  2YU9 B;  5J22 A;  1G2T A;  4PMB A;  3KBX A;  1TS2 A;  1VCI A;  4RMF A;  4APV A;  4G57 A;  2F3I A;  2FJ2 A;  4DR7 Q;  1R4Q B;  2NTT A;  4DR1 L;  2F0S A;  4HMI A;  4DAP A;  3S1R B;  3ND8 A;  1PYB A;  1EY9 A;  3TRE A;  4CDE C;  1VQ6 A;  2JE6 I;  4FVM A;  1AE2 A;  2VUM B;  1SN8 A;  1SMX A;  3V96 A;  2ZTD A;  4DAM A;  1V8Q A;  3HOZ B;  2PI2 E;  4H13 C;  5EGT A;  4CDF C;  5D14 A;  1NBW A;  4KMU C;  2R7Z B;  4GKJ Q;  3S17 H;  1B50 A;  4FF3 A;  1G29 1;  2CW0 C;  1S5C D;  5FLX E;  1CHP D;  1CFM A;  1GUS A;  4NW2 A;  1KQS A;  3PF4 A;  4RAU C;  1J5E L;  2PMZ E;  2XIW A;  2WAC A;  1Y1V H;  1E2W A;  3MFY A;  3PQI A;  1Y1V G;  2KUM A;  2DGY A;  5I9O A;  3I4M B;  1RTN A;  1UE5 A;  2MFI A;  1Q86 C;  4DAV A;  4GN3 B;  3ER0 A;  2A68 D;  1I50 H;  2NWG A;  1OXV A;  4LAA A;  1VQP A;  2QEX A;  2Y0S G;  1N33 L;  1JWM D;  2VL6 A;  4FNF A;  3NQT A;  1YIT A;  5A2Q E;  3S1N H;  4JYA L;  2B2W C;  2KHI A;  3QJY A;  2UU9 L;  1I4P A;  3MC0 B;  1XNR L;  4K6D A;  4UP8 A;  4MIU A;  3S16 B;  2ID0 A;  2YV5 A;  1SE3 A;  3A54 A;  3H6M A;  5GAD C;  1KDB A;  5IGB A;  2IY5 B;  3S2D B;  2VUM G;  2PYK A;  4DR7 L;  5C3X A;  1I94 L;  1KLG D;  4KJN A;  1CI3 M;  3UDG A;  5CV6 A;  4RGT A;  2ATW A;  4OWX B;  1IYV A;  3PUW A;  3MXN B;  1E2V A;  1SE4 A;  1PH9 A;  3TS0 A;  4KKS A;  5LMN W;  1PDQ A;  1HNW Q;  3FP9 A;  1MGS A;  4Y52 H;  1PFM A;  1I3Q B;  1JJ2 A;  3HOX B;  3Q24 A;  4C2M B;  2QCP X;  2PI2 A;  4CBV A;  5IY0 A;  2B2V A;  3I72 A;  5JVG 3;  2JSO A;  1Z47 A;  4EX5 A;  2QKI C;  3LWE A;  4DGZ A;  1CT1 D;  2F0K A;  4JI2 Q;  3GTK H;  2AQ2 B;  1NMF A;  1XTD A;  2IPK D;  4S3S A;  4GN4 B;  1GUW A;  4LFA Q;  5I9P A;  4ZK9 B;  1KDC A;  4KKT A;  4RFB A;  4QB4 A;  1Q46 A;  1WI5 A;  4K5X A;  3IFD A;  3GD7 A;  4PZ7 A;  2KVM A;  1H9K A;  1HXY D;  2K03 A;  2UUA Q;  3D4R A;  3BZD B;  2JEB I;  3EBE A;  2JA6 B;  1HTL D;  2E2D C;  3DWQ A;  3PUX A;  3PO3 B;  3PO2 H;  2EVB A;  5BR8 Q;  1MI2 A;  1IYJ B;  2MPM A;  3PO2 G;  1QJO A;  1TWF H;  1E7Z A;  2EY2 A;  2FMC A;  2JA5 H;  1XPO A;  1XMO Q;  2JA5 G;  4LF7 Q;  2A69 C;  1ROD A;  4K14 A;  4A93 B;  3KFU A;  2K05 A;  1HHV A;  1V9P A;  1LT5 D;  1H9S B;  4OXP A;  3L0O A;  5CBA E;  5HY6 A;  2L55 A;  5LL6 S;  1UUP A;  1PRT B;  3VR4 A;  4HJA A;  4LF8 Q;  1S3O A;  4N9P A;  4DV4 L;  2WP8 J;  1CM9 A;  5CV7 A;  1EQQ A;  3CP0 A;  2IL8 A;  1IZ6 A;  3BVG A;  3VA7 A;  1Y8O B;  1GD7 A;  3D0F A;  3PGZ A;  4RKB A;  1GUN A;  1EWC A;  4F87 A;  3I73 A;  3IRB A;  1C9O A;  4NB3 A;  4DR3 Q;  3GO5 A;  3SR1 A;  4DXG A;  1JOR A;  4CKB A;  1X54 A;  5DEH A;  1CKN B;  2MJ8 A;  3C1F A;  2FIN B;  2F0E A;  4R8I A;  1VQD A;  1G6P A;  1PMR A;  2AWO A;  1CUK A;  4PZ8 A;  1TY2 A;  2OXP A;  4ZYS A;  2IWH A;  1VQA A;  2CQA A;  2JYO A;  3HFZ B;  1SBB B;  4BY1 H;  1B44 D;  4DK1 A;  1EFW A;  2B29 A;  4JI6 L;  2OQK A;  3NE5 B;  1YEZ A;  4BY1 G;  1VQ5 A;  1PZK D;  1HTP A;  2DY8 A;  5FOB B;  1K8O A;  1A0I A;  1JT8 A;  4DUZ Q;  2SDF A;  3SK4 A;  3NTH A;  4XIG S;  4NXM L;  2EYL A;  1YNJ D;  5AJ3 L;  1KAA A;  5IT9 L;  4QGU A;  2EYO A;  2LSS A;  4K2L A;  5CV8 A;  4ODG A;  3F2B A;  1STE A;  2M9V A;  3J7Y W;  4KKU A;  3OOC A;  4KHP L;  5EAY A;  3QB3 A;  3ZYY X;  3MAQ A;  1RDP D;  1TWA H;  4DF7 A;  4A3I B;  4DR2 Q;  4ZKC B;  3I4N B;  4FF2 A;  1EL0 A;  4DV5 Q;  2J7Z A;  4B08 A;  3CCM A;  4QY7 A;  4LF5 L;  1QIL A;  5IGC A;  3LX0 A;  3U4Z A;  2E75 C;  3SVM A;  1XTC D;  4PMW A;  4DAY B;  5K5P A;  1N34 Q;  1UEB A;  2DJG C;  4QQB X;  3ONA B;  1ILQ A;  1U4P A;  2G5D A;  2E76 C;  3S2H B;  4AYB G;  3OTO L;  3KJO A;  4I7Z C;  3I90 A;  2XGT A;  3ZJY C;  5C4J H;  1PH1 A;  4B3T L;  4DK0 A;  3E3X A;  1HUM A;  1OO9 B;  2OF1 A;  2ICE C;  1II3 A;  2EIF A;  1WVL A;  1WCM H;  1VQ4 A;  4JI3 Q;  2Z6K A;  2JA7 H;  1CTM A;  1WJJ A;  2EPB A;  1KDA A;  3MXN A;  1QG7 A;  2JA7 G;  3DEO A;  3X3M A;  3BYY B;  2F0I A;  5ELD A;  1QWY A;  2NBF A;  4P73 A;  1HNZ Q;  4R4Q A;  2A68 C;  3L9A X;  3HP3 A;  2R92 H;  1B53 A;  2FFK B;  1PVO A;  2DNE A;  2KEN A;  5IYB H;  3L2P A;  2R92 G;  3MEF A;  2I5L X;  2UXC L;  4DUZ L;  5IYB G;  3OWE B;  4K8I A;  2E5L Q;  4YWK A;  3I4N G;  4L63 B;  4CKC A;  3BS1 A;  2KA7 A;  2WKD A;  3J80 i;  1WFQ A;  3SXH A;  1N8R C;  1AN8 A;  3TME A;  3OSO A;  3Q22 A;  2L1B A;  2XN9 C;  5M5W H;  4HJ5 A;  4KLK A;  2HDL A;  1BQQ T;  1W6K A;  1VQL A;  3W2D A;  2Q2U A;  2ZXP A;  4IN3 A;  4K2K A;  4GN5 A;  4NKL A;  1X55 A;  4DA2 A;  2BA0 A;  1DYQ A;  3F1Z A;  5GAE C;  2O5I C;  4ILW A;  1EY6 A;  3NQI A;  4PG3 A;  2KCM A;  1F9R A;  3N6R A;  1Y8P B;  1IBK L;  3ULL A;  3K8A A;  3BVM A;  1H9J A;  1EQT A;  1WOC A;  2H5X A;  3NXW A;  2PW5 A;  4DK3 C;  3HOW H;  4B3M Q;  3RLO A;  1B1Z A;  1MSG A;  4JI3 L;  3HOW G;  1PYS B;  2NYZ D;  1SNC A;  3AYH B;  4JI8 Q;  2EJM A;  2D9U A;  4ZAI A;  4GKK Q;  3C3L A;  3TBI B;  2JA8 H;  3HG9 A;  1UE6 A;  2JA8 G;  1UAP A;  3A7A B;  2K32 A;  2LY7 A;  4LK1 C;  2C5C A;  1GJX A;  4X3T A;  1L2F A;  2WV6 D;  2K04 A;  4LUZ A;  2E2J H;  4BY7 H;  1BOS A;  2IJ0 A;  5JJI A;  4X6A H;  2PPB C;  4BY7 G;  5M5Y B;  4A3F H;  2R7D A;  2KCC A;  3CQZ B;  3F2C A;  4WJ4 A;  3QOL A;  5DM6 3;  1VQF A;  3DLL A;  4A3F G;  3STB D;  1KRT A;  3NEL A;  4KTA A;  1ENA A;  3I91 A;  1E22 A;  1CKN A;  4B3S L;  2WAQ B;  2GA4 B;  1F77 A;  3C1E A;  5M3M H;  1Y69 U;  3J81 L;  3NWT A;  1K8G A;  3URY A;  2NN6 H;  1C48 A;  1PFB A;  4IPD A;  5M3M G;  2NVX B;  4KHZ A;  4EQO A;  2NN6 G;  3AQQ A;  3MTS A;  2B2T A;  2G9D A;  4JI0 Q;  4Q5V A;  1CSP A;  2F0V A;  3T51 B;  3N52 A;  1GKH A;  4A3B B;  3HOV H;  4LFB L;  4JI4 L;  4DV7 L;  4A3D H;  4DUY Q;  1X9N A;  1K0S A;  1PXU A;  4G7H C;  4A3D G;  4V19 0;  1VMP A;  1TKW B;  1WTH A;  3ERS X;  4OEM B;  4RA8 A;  1EUJ A;  5IP7 G;  4ZUI A;  1BBU A;  4A4I A;  3K7U C;  3QWN A;  4QJF A;  2F0T A;  2RDF A;  3HOU B;  5ELC A;  3U58 A;  3GTO B;  3R2I A;  1FNU A;  3WWV A;  1XJV A;  2MHV A;  1Q82 C;  1VQI A;  3CCL A;  3ERO A;  4IOC A;  4IAL A;  2Q8T A;  2NVQ H;  4O2D A;  4A3C H;  4KN4 C;  5LMU Q;  2L4N A;  3E6Z X;  4A3C G;  4EGV A;  1AW7 A;  2DY7 A;  1TS3 A;  4JVZ A;  2XWJ B;  1EYD A;  3OMG A;  1X32 A;  3ULP A;  2AUK A;  5FLM H;  1M1K C;  1XNQ L;  4WRD A;  4JI7 L;  2R6G A;  1VQK A;  3M3Y H;  1A8V A;  4IUP A;  3OPO A;  4TVA B;  2EYJ A;  3CC2 A;  1Y1W H;  4DAY A;  1D1K A;  4YCV A;  1DXM A;  2JK8 A;  5CGK A;  1RL2 A;  1Y1W G;  1EYG A;  2F0Q A;  3H0G H;  5IGG A;  3UI2 A;  2K5H A;  1O78 A;  2EE1 A;  2E2I H;  1F2M A;  3H0G G;  1ASZ A;  2SOB A;  5JPN C;  4BWG B;  2KEE A;  3E0E A;  1BCP F;  4K5W A;  1VQJ A;  4K5V A;  3SGI A;  3A5Z B;  4FXD A;  4FXK C;  5FO9 B;  4LFC L;  2UUC Q;  4A3B G;  1IW7 D;  4YIJ A;  1NR2 A;  1YNJ C;  3S1Q H;  3PF5 A;  3OW7 A;  5AFW A;  4HAE A;  3PIO A;  1B2T A;  1UNS A;  1WTR A;  3W5O A;  4ZLT F;  3TZD A;  1O80 A;  4B3R Q;  3I70 A;  4A3J H;  4ZKB B;  3RZO B;  2OTJ A;  1PZI D;  3LNN A;  2VW9 A;  4A3J G;  1D8L A;  3K57 A;  3M4P A;  5CBE E;  5C3W A;  5EPL A;  3AEV A;  1E0B A;  3FKI H;  4K0K L;  4OO1 H;  3X3N A;  3HOY H;  5M5X H;  3P20 A;  2F3V A;  4HJ8 A;  3FKI G;  4OO1 G;  2ES2 A;  4EQN A;  3HOY G;  3R2T A;  5J39 A;  1FL0 A;  2MNA A;  5HUR A;  1FYC A;  3H3V H;  5LMU L;  4C3J H;  1VF7 A;  3OWF A;  4RH6 A;  3AMU A;  1ICF B;  3RD4 A;  5D65 A;  4C3J G;  1VQ9 A;  2QGQ A;  4L5T A;  4G4K A;  1U5K A;  3LWU A;  3S17 B;  3FVQ A;  4G7Z C;  5JEA H;  1HNX L;  1CQV A;  4K6L A;  4LF9 L;  4DN4 M;  1I4Q A;  5JEA G;  1SND A;  3BDC A;  2AQ3 B;  3JAM L;  2IX0 A;  1XYI A;  3KOJ A;  2KJX A;  4FF1 A;  2EY5 A;  4KHV A;  1Y1V B;  2OT2 A;  1PH7 A;  2K01 A;  3P7J A;  3NWS A;  1KL9 A;  1R9T H;  1FR3 A;  3C46 A;  5KEE A;  3R93 A;  1N36 L;  4XT1 B;  4WOR A;  1I50 B;  1E1O A;  2Y0S B;  3I55 A;  3VYT A;  3J81 i;  4IUU A;  3CC7 A;  1HA5 A;  2VB2 X;  3S1N B;  1LTR D;  5EKI A;  4R4O A;  1K9M C;  1ET6 A;  3NTK A;  2O4X A;  3OW2 A;  4JV5 L;  2B2V C;  3GV3 A;  2UXD Q;  2ASB A;  1L1O B;  4DR6 Q;  5T1I A;  1SNM A;  4TKO B;  1FNW A;  1IL8 A;  3MVV A;  5JEA J;  1SYD A;  1PRT D;  3EQL C;  3I7F A;  1W3S A;  1KNA A;  3MZ5 A;  3SDZ A;  3SEB A;  1EU3 A;  5FLX L;  5H1S E;  1E1T A;  4M8A A;  1HR0 Q;  4YY3 Q;  3T1H Q;  3K58 A;  1K0R A;  4YHH Q;  4GNX B;  1MIU A;  1CA6 A;  5HGT A;  4DR4 Q;  2ZM6 L;  2IX1 A;  3U4V A;  1SMY D;  1LV9 A;  2O5J C;  2F0L A;  3MWY W;  2K6A A;  5C3E H;  1U4L A;  1S5E D;  1B4O A;  1SNQ A;  4WJ3 M;  2D62 A;  3FPP A;  5C3E G;  3K6O A;  1SEB D;  2LMC B;  1PYW D;  3T53 B;  1PH5 A;  4P74 A;  2PCF B;  3RN5 A;  1YZ6 A;  2K28 A;  3GTK B;  1PHJ A;  1EU4 A;  3T4A C;  1JB7 A;  2Q2I A;  1SLJ A;  2NTS A;  5A2Q L;  1NSN S;  5KND A;  4AQY Q;  1UEA B;  2A74 C;  1WYD A;  4DKA C;  4X65 Q;  3GTG H;  2YTY A;  1KHI A;  1B3A A;  1QNK A;  1LT3 D;  2IHE A;  3L3O C;  1VQH A;  3H94 A;  1BO0 A;  1HQM C;  1X65 A;  3MEH A;  2PQA B;  4HN7 A;  3F2D A;  4RGN A;  3TZU A;  5IYC H;  3STB C;  1BR9 A;  1YHQ A;  1W2B A;  4OEL B;  1X6O A;  4BS9 A;  5IYC G;  1H95 A;  3PV0 A;  1Q8K A;  3KDF A;  1SJE D;  3PO2 B;  5TSS A;  4WJW A;  4DR6 L;  1T9H A;  1EZ8 A;  4HED A;  3GV6 A;  1TWF B;  1KNE A;  1STB A;  2FXQ A;  3MHB A;  4KY7 A;  2Q8R E;  2JA5 B;  2RBM A;  4IUV A;  4DV6 Q;  3TP6 A;  3VYS A;  1WD1 A;  2L5T A;  5ELO A;  2RSO A;  5C4X H;  4DPG A;  1XPR A;  1SE2 A;  2SNS A;  1PV4 A;  4GKJ L;  5C4X G;  3P1H A;  2Y0S E;  2GN5 A;  3VYR A;  2ZTC A;  4XTC S;  3V2T A;  3CCJ A;  3E5S A;  3T1Y Q;  1HR0 L;  4YY3 L;  3KF8 B;  4ZUJ A;  2SNM A;  3DM3 A;  1TWC H;  1Q3L A;  1EEI D;  1MJE A;  1I4R A;  1DOL A;  3OHX C;  2D2C C;  1JOO A;  4DFA A;  4GZY C;  4XXE A;  2F0G A;  1FNV A;  1G51 A;  1C7Y A;  2N3S A;  3NSW A;  4L8J A;  4PQX A;  1I4X A;  1YHA A;  5F2D A;  1ZYR D;  4IUN A;  2NN6 I;  5BN5 A;  3JAM i;  2UXB Q;  4CDC C;  2F0D A;  1FD7 D;  2I5M X;  4H44 C;  3BVZ A;  3GTL H;  3CAM A;  1PLF A;  1WTW A;  2EJF C;  1EY8 A;  1EWI A;  3D31 A;  5C5L A;  3OYY A;  1EY7 A;  5BN4 A;  5CC4 A;  2OTL A;  4BBR H;  1RKN A;  2E8G A;  4A3K H;  1ZKO A;  1SYG A;  1TWG H;  4BBR G;  4A3K G;  1D5X C;  4BY1 B;  2I0Q A;  1K83 H;  3NK9 A;  4A3G H;  1PH2 A;  1FGU A;  1YJ9 A;  2I46 A;  4X64 Q;  1IW7 C;  4IFD H;  2BA1 A;  1LTI D;  4LUV A;  3G4S A;  5COY A;  4IFD G;  1ZEQ X;  3L7Z C;  2A19 A;  5E4W C;  1A3V A;  1HNW L;  3CCE A;  4UP7 A;  5KYI A;  1T5E A;  1X3Q A;  1D6E C;  1P16 A;  1PA6 A;  5FKA C;  4P72 A;  2KEC A;  5DAU A;  3FMC A;  2UUB Q;  3I3C A;  4IO9 A;  4RWS C;  3EN2 A;  2Z6K C;  5JPM C;  2VQE Q;  1QUQ B;  2L0C A;  5CV5 A;  3SHL A;  1TWA B;  1BNZ A;  4H0L C;  3J80 E;  4JI2 L;  3NBH B;  4Z9C B;  1Z7T A;  2GVA A;  4LFA L;  3CCS A;  3CPW A;  3M4O H;  5JVH 3;  3GTQ H;  4OIK A;  3T16 A;  1KXL A;  1L1O A;  1IXR A;  2UXB L;  4AYB B;  1C0A A;  2PQE A;  2HCC A;  1KC8 C;  1D5Z C;  3DUZ A;  4P2C B;  5JOB A;  4OGQ C;  5KGU A;  3E9H A;  2UUA L;  2K33 A;  2Q2H A;  5C4J B;  4IFD J;  4U67 3;  1STY A;  3Q8D A;  1YIJ A;  2QW7 A;  1LAB A;  2A6H D;  1JQY D;  1SYC A;  1NR4 A;  1WCM B;  5BR8 L;  2ZJP A;  2JA7 B;  1PFS A;  1ZXT A;  3K5L A;  3QR8 A;  1AZQ A;  1XMO L;  3HKZ G;  4GNX A;  2X6L A;  4OWW B;  5EBD A;  4OO1 I;  4LF7 L;  3NUC A;  5LMN Q;  4R8N A;  2K5Q A;  4LNQ A;  4KD4 A;  2B39 A;  1FVI A;  3CCV A;  1SR3 A;  4P71 A;  3H3V I;  1G91 A;  2L11 A;  4FO2 A;  1SYF A;  4DV2 Q;  2R92 B;  1EIY B;  3IL8 A;  1A2T A;  2R93 H;  1V1O A;  3FEW X;  4LF8 L;  4AIM A;  2R93 G;  1YNX A;  4UHV A;  3K7A H;  4POF A;  3CD6 A;  1TS4 A;  4NDX A;  2UUB L;  4GLA C;  4C1N I;  4FP5 D;  4UP9 A;  1SE8 A;  2L12 A;  4DV3 Q;  2B63 H;  3DM1 A;  3CMA A;  4O42 A;  4FXG C;  2B63 G;  1ML0 D;  1PRT C;  4PV1 C;  1VF5 C;  3GTP H;  2PQA A;  3EA6 A;  3CCU A;  5M5W B;  1TXY A;  3CRK C;  1ASY A;  2P5Z X;  4DR3 L;  4DXF A;  1MBY A;  1SNP A;  3RR5 A;  2CH4 W;  1S5B D;  1PH6 A;  2VY3 A;  4GOP B;  1IKL A;  2HIX A;  3K81 C;  1B9N A;  1SMY C;  1EY0 A;  3HKS A;  1WCM G;  1LTB D;  1K28 A;  3J7A V;  2SEB D;  3U9O A;  2ZXO A;  1O7L A;  3G71 A;  3HOW B;  3A8I E;  2MUY A;  4YCW A;  4OX9 Q;  3G7L A;  2ALY B;  3MXG A;  3GTM H;  2B2U A;  1E3P A;  3KF8 A;  1MD2 D;  1NE3 A;  4KK7 A;  5C44 H;  2Z0S A;  1ILP A;  2JA8 B;  2B2T C;  4XDX A;  4JBM A;  5C44 G;  2E74 C;  4JC0 A;  3BDL A;  4AYB E;  1EIF A;  2B8F A;  4LF6 Q;  3FRP B;  2OQ0 A;  4NP5 A;  1B9M A;  2E2J B;  4BY7 B;  4MTN A;  2K14 A;  3PIP 3;  3CF5 A;  1KIX A;  1TT2 A;  4ID6 A;  3HRZ C;  3DWP A;  1HPC A;  1DOM A;  2JP1 A;  4DV0 Q;  4A3F B;  1S72 A;  2QDL A;  1ICW A;  5E4X A;  2MP1 A;  5LL6 X;  4DR2 L;  4DV5 L;  1U0L A;  4KY6 A;  1LT4 D;  3S24 A;  1F9P A;  2CHB D;  1TQO A;  1H9M A;  5E1F A;  2QIL A;  4ZCK A;  4WFN 3;  2RF4 A;  4K8J A;  4XQN A;  4NPS A;  3CCR A;  1D2B A;  5M3M B;  4RG1 A;  1N34 L;  4QUC A;  1VDZ A;  3MXU A;  2A8V A;  3M9B A;  2A6E D;  4XT3 B;  1SNO A;  4R1J A;  5IOD A;  5C5M A;  4IPG A;  3PMF A;  1XMQ Q;  2A5H A;  3HOV B;  1CKO A;  3RNU A;  4A3D B;  1SSO A;  2BH8 A;  2LFN A;  2VNU D;  4UY8 C;  1SDF A;  3NTI A;  5A35 A;  2A73 B;  4YWM A;  1DCZ A;  2KCT A;  2HDM A;  4A76 A;  2CW0 D;  3KK7 A;  5IWA Q;  4RCN A;  1HNZ L;  2JQO A;  2G9H D;  1ZYR C;  4OX9 L;  1EOT A;  1VQ7 A;  1J9O A;  2NVQ B;  4IUT A;  1N9W A;  2QEJ C;  1YVC A;  1FGB D;  1QUQ A;  4DU9 A;  4CJ1 B;  1EY5 A;  3S1M H;  1F9Q A;  3E9I A;  3NBH A;  4R4C A;  2E5L L;  1BCP B;  3W1B A;  3PCO B;  3VYU A;  2VB3 X;  4EQP A;  3M3Y B;  1Y1W B;  1JJC B;  1SXT A;  1ONL A;  3VDY A;  3D8G A;  1LAC A;  2TMP A;  5C0X H;  2AWN A;  4JCV E;  4LJZ C;  5C0X G;  1HFG A;  4JPB W;  2RKS A;  3H0G B;  1TWH H;  5J1Z A;  4KI0 A;  2F1M A;  2E2I B;  2B2Y A;  3DXJ C;  2AUJ D;  3SK6 A;  1IBM Q;  2VQF Q;  2CQO A;  3C2P A;  1WTQ A;  4RGM A;  2EOT A;  5KNC A;  5E3F A;  3HZX A;  5J3B A;  3GTJ H;  1K8M A;  4X62 Q;  1A3U A;  3H15 A;  2HQL A;  5IGF A;  3J7A F;  3HOV G;  1N32 Q;  3FPU B;  1R4P B;  3S1Q B;  4LF4 Q;  1W6J A;  1J8I A;  5G3L F;  1S4Z A;  1JCK B;  5FO7 B;  1F2Z A;  1A15 A;  3NEN A;  1EYA A;  4C3H H;  4B3M L;  5I6Y A;  3M4Y A;  4A3J B;  1Z6H A;  4J6H A;  4N8F A;  4CKE A;  2HD3 A;  3IFT A;  3TSS A;  4JI5 Q;  4C3H G;  1SFO H;  3A0J A;  4ALP A;  4BBS H;  2O2L D;  2CWA A;  1M4V A;  2B8G A;  4JI8 L;  1BBX C;  4BBS G;  3A55 A;  4RHS A;  5CR3 A;  4GKK L;  2F0H A;  3D4D A;  5I2Y A;  5M3F H;  3FKI B;  1BKB A;  2RQX A;  5M5X B;  3HOY B;  3IKJ A;  1V1P B;  4IQZ A;  4A3M H;  2F4V Q;  1S40 A;  3KDF B;  2XTI A;  4IFD I;  5C0X J;  4A3M G;  4EQ5 A;  4C3J B;  1PZJ D;  4UPA A;  4HIO A;  1LT6 D;  2IHF A;  5FLM G;  1EYC A;  4NXN Q;  2M00 A;  2XNA C;  3S15 H;  4F7X A;  4A3L H;  2A6H C;  4TSS A;  2YTV A;  5CYU A;  3D3R A;  4J15 A;  4A3L G;  1YJW A;  1IHZ A;  1BBW A;  1JJG A;  2F0P A;  2F0M A;  3CW2 C;  1CA5 A;  1STG A;  3K5N A;  4GOP A;  1UE1 A;  3B6Y A;  5C4H A;  3K0X A;  1STA A;  2EXZ A;  1FJG Q;  5IE8 A;  1HJP A;  1F2L A;  2NZ1 D;  1CSQ A;  4I65 A;  4JI0 L;  1I6H H;  2R3Z A;  1EY4 A;  1RJT A;  4ZQ3 A;  3DMU A;  1R9T B;  1JC7 A;  4X62 L;  3RZD H;  4DUY L;  1HRJ A;  3S14 H;  1NMG A;  3ERQ A;  4C1N K;  1HH2 P;  4JI1 Q;  4FDB A;  1V43 A;  1PTO H;  4DV1 Q;  4X66 Q;  2Z8L A;  1OXT A;  4FF4 A;  2E2H H;  2L9H A;  2L15 A;  3KF6 B;  2OEO A;  4DR1 Q;  3A56 A;  3BU2 A;  1NJI C;  2XRQ D;  3SK8 A;  4X3K A;  5KIX A;  2F4V L;  4P75 A;  4MHE A;  3V05 A;  2RDG A;  1XPU A;  1PTO F;  3QG1 A;  2MQH A;  4OON A;  2PNR C;  2AQ1 B;  4NXN L;  3W1G A;  1EIG A;  2EYF A;  2BDO A;  1IL2 A;  4Y7N H;  2K7V A;  1PH3 A;  3A5U A;  3UE0 A;  2F0F A;  1X3G A;  3M7N A;  1E2Z A;  5T1G A;  4C3I H;  5C3E B;  2BE5 D;  1J5E Q;  1Q7Y C;  4KV6 A;  5GQO A;  1M8A A;  1SRU A;  2K4K A;  2HQE A;  3HGB A;  1JE4 A;  2UUC L;  1XX8 A;  1JWU D;  5COR A;  3UE1 A;  2EQS A;  1JB3 A;  3QOJ A;  4IUR A;  2HCI A;  4QIW E;  2F4I A;  2EDG A;  3GQB A;  2ZT9 C;  4B3R L;  3GTG B;  1ET9 A;  3GDE A;  1N33 Q;  1EOV A;  2XVS A;  2NVY H;  2HT1 A;  1LYL A;  4HSV A;  1YHB A;  4JYA Q;  3MFG A;  3J80 c;  3J7A 5;  2UU9 Q;  2KBN A;  2WB1 B;  4KD3 A;  3SK5 A;  3OIQ A;  3EIV A;  3J7Z C;  4GS3 A;  1IYU A;  1VQG A;  2WII B;  1QVG A;  1DON A;  1YBY A;  2K52 A;  2EY1 A;  1TY0 A;  1KRS A;  3KLR A;  2A6E C;  1B3Q A;  2NUC A;  1I94 Q;  3FHW A;  2Z9H A;  3WOF A;  2YTX A;  3H91 A;  5C4X B;  4HIK A;  3CC4 A;  5EPJ A;  4RGO S;  4PMC A;  2I07 B;  1GHJ A;  3TP5 A;  2KOL A;  2LKV A;  4N9T A;  1QVF A;  1KAW A;  3W3A A;  1HZA A;  2PZU A;  2N55 A;  5DNF A;  1TWC B;  4LMQ D;  3KBG A;  4L6T B;  2V1C C;  1CZW A;  1BF4 A;  5IIF A;  4TQU S;  5FJ8 H;  4X3U A;  1L0W A;  1STN A;  1EWH A;  2PZT A;  5FJ8 G;  2KHS A;  3QO2 A;  4XQQ A;  5EKL A;  2ENB A;  2HIV A;  3EVQ A;  1G8Z D;  2F0U A;  5GAH C;  4R9W A;  2F03 A;  4MZ9 A;  1NCV A;  3A8K E;  4DNR B;  3GTL B;  3PIP A;  4A3E H;  4ME3 A;  4MN3 A;  1NAP A;  3UDF A;  1O7Z A;  4A3E G;  3U50 C;  1V1P A;  1YNN D;  3TN2 A;  2QF7 A;  4JOI A;  2KQ3 A;  3RLN A;  2WB1 G;  3WDN A;  2KCN A;  4MTK A;  1GM5 A;  2YU9 H;  2UXD L;  3CPF A;  1X3F A;  3Q6S A;  5IT9 c;  2JEA I;  1I5F A;  3DHQ A;  1VQC A;  4BBR B;  3TQY A;  4A3K B;  4B9W A;  2IT1 A;  1TWG B;  3S1R H;  1KTK A;  5DM7 3;  1C4Q A;  1K83 B;  1CHQ D;  4A3G B;  1OXS C;  2VUM H;  4N8X 1;  4DK6 C;  3CME A;  1AEX A;  3HOZ H;  1L1O C;  2BCO A;  1JMC A;  4IPH A;  2R7Z H;  2RA4 A;  3HOZ G;  5JJL A;  2CKZ B;  3T1H L;  4H02 A;  2AMC B;  2R7Z G;  4YHH L;  2EZV A;  1CZG A;  3PUZ A;  2F0J A;  4DR4 L;  2V4D A;  1KLU D;  5DLQ E;  1I6V C;  1RCV D;  1T5X D;  1YJN A;  3AFP A;  1GUG A;  3K0Y A;  4DV4 Q;  2RSN A;  2WB1 E;  4LUO A;  5CMD A;  4XQJ A;  1KAB A;  2YYZ A;  5C0X I;  4JW0 A;  1YI2 A;  1PFN A;  3NP8 A;  5BN3 A;  2D0P A;  4GNX C;  2DN8 A;  4F88 A;  3I4M H;  5I4D A;  2N49 A;  4U68 A;  3I4M G;  4F8M A;  3M4O B;  4AQY L;  3SE0 A;  4X65 L;  1Z9F A;  2EYM A;  1SYE A;  3E0J A;  3GTQ B;  3GP7 A;  1HUN A;  3KF6 A;  3MA2 B;  3NEM A;  2D0O A;  5E7N A;  3KUP A;  1MKH A;  2PO4 A;  4MNO A;  5KYL A;  4X3S A;  4L5R C;  3G6E A;  1B8A A;  5CV9 A;  2N8N A;  3S16 H;  1RTO A;  2JJQ A;  5JAV A;  1RF2 D;  3EFX D;  1B70 B;  1XXG A;  3AB9 A;  2DJF C;  1TR5 A;  2KHJ A;  3DWA A;  4A3G G;  3S2D H;  2Z4H A;  3HKZ B;  2HHH Q;  1DJR D;  4DV6 L;  1S5F D;  3RMH A;  4JI6 Q;  2PW7 A;  1X3E A;  3TEH B;  1DM0 B;  1J6Q A;  3FDT A;  5CV4 A;  4JBJ A;  1A6X A;  4J1M A;  4L5Q A;  3KLS X;  2NZH A;  2CCZ A;  3AFQ A;  3NPP A;  3T1Y L;  3R8B A;  4NXM Q;  2JXM B;  5KNB A;  2R93 B;  1I3Q H;  1VQN A;  2MO1 A;  2XWB B;  5AJ3 Q;  3HOX H;  3H09 A;  2B2W A;  2N78 A;  4C2M H;  3J80 L;  3HOX G;  4KHP Q;  3K7A B;  3DEP A;  1QE6 A;  2VS1 A;  4BA1 I;  5G3L D;  1I4G A;  4OL7 A;  2F0W A;  3U9S A;  3BZC A;  3PIO 3;  2A1A A;  2J0T D;  4HJ7 A;  2B63 B;  2B2U C;  5I6W A;  1IKM A;  5KRU A;  3GTP B;  4LF5 Q;  1NUC A;  4FYD A;  1NY4 A;  2X69 A;  4KY5 A;  2F0O A;  4B9X A;  5EQ0 A;  3IAY A;  1NNX A;  4BA2 I;  1GVP A;  2K5D A;  4IUQ A;  3KLW A;  1JE5 A;  1HZ9 A;  4O1N A;  4CGY B;  1ESF A;  3ULJ A;  3OTO Q;  1WTX A;  4HID A;  3CU7 A;  1PH4 A;  4B3T Q;  2JA6 H;  3CXC A;  1EFI D;  2JA6 G;  1IBL Q;  3PO3 H;  2BE5 C;  1QNU A;  2C35 B;  3PO3 G;  2EY6 A;  4BXX H;  3BG3 A;  1EQR A;  1P8L A;  1QOH A;  4BXX G;  3GTM B;  1BCP D;  5IOC A;  4X64 L;  1ENF A;  2I5H A;  5IGD A;  3JC6 6;  1A3T A;  2HHH L;  1AZP A;  4A93 H;  5C44 B;  1GOZ A;  1E24 A;  4A93 G;  1D1I A;  1QVC A;  3J81 c;  3G6J B;  1LTG D;  4OHJ A;  2QDB A;  4OWT B;  5FO8 B;  4HJ9 A;  2UXC Q;  3RUZ A;  3D4W A;  3NHH A;  4V0B A;  1MSH A;  2VQE L;  1K8A C;  1GXD C;  4HR7 B;  5IT9 E;  4ABN A;  3PSI A;  4EVO A;  2JA9 A;  1Q90 A;  3UDX A;  1UE7 A;  2PNH A;  1K3R A;  4ZRZ A;  5GAG C;  3HKZ E;  1SRO A;  3AU7 A;  4M1U B;  2XRS D;  3TS2 A;  1PRT F;  4R4T A;  1HQR D;  2ZXR A;  1G6Z A;  5EBC A;  1XWE A;  2H1E A;  1LLR D;  3K59 A;  3Q23 A;  5C6A A;  1IBK Q;  2F52 A;  1PTO D;  2QA4 A;  2D5D A;  1AFP A;  4A75 A;  2K75 A;  2M2L A;  5M9O A;  2VZA A;  4KJO A;  1TS5 A;  3KYH C;  1U4R A;  4DR5 Q;  1IBL L;  4UAI A;  5FK9 C;  1VQE A;  5LMN L;  2B2Y C;  1CQF A;  2ZTE A;  5D3D A;  1UWV A;  1CK1 A;  2EYH A;  3NBI A;  2K5V A;  4DNT B;  3K5M A;  4DV2 L;  4RCO A;  4GLV B;  5EJW A;  2Z6B A;  3S1M B;  1EQV A;  1DOK A;  5K36 H;  1YNN C;  3RN2 A;  2EJG C;  1K3B C;  5K36 G;  1H9R A;  3BYT B;  4GLX A;  1OXX K;  4IPC A;  1A63 A;  1TU2 B;  1VS0 A;  3M4Q A;  2F3W A;  2AHO B;  2K5N A;  2X6G A;  1Q12 A;  3CRL C;  1HCZ A;  5EKK A;  4DV3 L;  3G48 A;  4A3I H;  3I4N H;  1Y14 B;  2BOS A;  4YCU A;  2WFW A;  1WTV A;  4A3I G;  1Q8I A;  2R7F A;  3KJP A;  1TWH B;  4B3S Q;  1VQ8 A;  3TDQ A;  2F0N A;  1EZ6 A;  3A8J E;  4Q0F A;  1TVX A;  3S2H H;  4XYQ A;  3GTJ B;  1Y8N B;  3D6W A;  2ZJQ A;  3T56 B;  4JK1 C;  1ENC A;  2JN4 A;  3P75 A;  3S9W A;  1HFN A;  4LFB Q;  4JI4 Q;  1LM0 A;  4DV7 Q;  5JJK A;  2OWO A;  3QIA A;  1BUV T;  1C8C A;  3HS0 C;  3K5O A;  1HA6 A;  1DGS A;  4C3H B;  2BDN A;  1BDO A;  2IW3 A;  4GOP C;  1SFO B;  1B7Y B;  3MXP A;  1ESR A;  4BBS B;  1LTA D;  1DZ1 A;  1OXU A;  4DR5 L;  2K50 A;  3BDO A;  1H9S A;  5M3F B;  2CFM A;  3JAM c;  2C9O A;  2WKC A;  4A3M B;  1HZB A;  2R61 A;  2LXJ A;  1X3P A;  4LF6 L;  1Q81 C;  3D6C A;  2H4O A;  2RVL A;  5IYD H;  5ELE A;  1LO5 D;  1QCB D;  4JG2 A;  1JOK A;  5IYD G;  1V1Q A;  4DV0 L;  3S15 B;  3OIP A;  1XNQ Q;  1GO3 E;  2EYP A;  4JI7 Q;  1SJH D;  2BH2 A;  2J4X A;  2Z4I A;  2XSC A; 
#chains in the Genus database with same CATH homology
 1BXT A;  3EJI A;  4C56 C;  5EPK A;  1WTP A;  1F2Y A;  1JWS D;  4H7B A;  1I6H B;  2NB0 A;  3PUY A;  3ITP A;  1LTS D;  3J81 E;  3VR5 A;  3RLF A;  4QUF A;  1GUO A;  3RZD B;  4E6I A;  3S14 B;  2LS0 1;  4HCS A;  2VXW A;  1STH A;  3Q0A A;  4HSP A;  3O13 A;  3I8Z A;  3KLS A;  4IZ8 A;  1PTO B;  3PUV A;  4RKL A;  2ICI A;  2K1B A;  3VR2 A;  2FHT A;  2E2H B;  1Q1B A;  3R3O A;  5NUC A;  4QIW B;  1RD9 D;  3I4L A;  4CHT B;  2NVT B;  2PZW A;  1Q1E A;  2KED A;  2CVR A;  1AP0 A;  4QF4 A;  1O7Y A;  2FMM A;  4CJ2 C;  5IGE A;  1DD2 A;  1VMC A;  1EEF D;  3F2U A;  2Z1C A;  4UDU C;  4Y7N B;  5ISR A;  3ND9 A;  4G7O C;  2RDH A;  1WTO A;  4ME5 A;  1BCP C;  1S5D D;  4C3I B;  3CHB D;  5I2X A;  1RHP A;  4QMG A;  2TSS A;  1GHK A;  1WD0 A;  2K5W A;  2DNC A;  2N88 A;  4TRD A;  1QB5 D;  2A69 D;  3M7G A;  4OIJ A;  4J8Q A;  2IX3 A;  4KN7 C;  2NVY B;  3VA5 A;  2HUG A;  1U9R A;  2MGS A;  1LTT D;  5C4Z A;  4CJ0 B;  2PMZ B;  5LHY 1;  4HMJ A;  1F9S A;  1A2U A;  4HCE A;  4PNY A;  4JBW A;  1SAP A;  4ULL A;  3HEJ A;  3WOE A;  2WIN B;  3M85 A;  5ELF A;  1PTO C;  4HTH A;  3VR6 A;  1TII D;  3A7L A;  3H3V C;  1JOQ A;  1L0X B;  4C3I G;  1L0Y B;  3OMC A;  4RHR A;  1JIC A;  4QCL A;  1U4M A;  3JAM E;  3TP7 A;  1D5M C;  1GUT A;  1I4H A;  4XYO A;  1JR0 D;  1SYB A;  5ELB A;  3CKI B;  5JJZ A;  1G2S A;  4A3E B;  5D3I B;  3VR3 A;  3T13 A;  2Q8I B;  3TP8 A;  1EIH A;  4NMZ A;  1G2T A;  2YU9 B;  5J22 A;  4PMB A;  3KBX A;  1TS2 A;  1VCI A;  4G57 A;  2FJ2 A;  1R4Q B;  2NTT A;  2F0S A;  4HMI A;  4DAP A;  3S1R B;  3ND8 A;  1EY9 A;  2JE6 I;  4FVM A;  2VUM B;  3V96 A;  1V8Q A;  3HOZ B;  4H13 C;  5EGT A;  5D14 A;  4KMU C;  2R7Z B;  1B50 A;  4FF3 A;  1G29 1;  2CW0 C;  1S5C D;  5FLX E;  1CHP D;  1CFM A;  1GUS A;  4NW2 A;  4RAU C;  2WAC A;  2XIW A;  1E2W A;  3MFY A;  2KUM A;  5I9O A;  3I4M B;  1RTN A;  4DAV A;  2A68 D;  2NWG A;  1OXV A;  4LAA A;  1JWM D;  4FNF A;  3NQT A;  5A2Q E;  2B2W C;  3QJY A;  1I4P A;  3MC0 B;  4K6D A;  4MIU A;  3S16 B;  2ID0 A;  1SE3 A;  3A54 A;  3H6M A;  1KDB A;  5IGB A;  3S2D B;  2PYK A;  5C3X A;  1KLG D;  4KJN A;  1CI3 M;  5CV6 A;  4RGT A;  1IYV A;  3PUW A;  1E2V A;  1SE4 A;  4KKS A;  1PDQ A;  1MGS A;  1PFM A;  1I3Q B;  3HOX B;  3Q24 A;  4C2M B;  2QCP X;  4CBV A;  2B2V A;  3I72 A;  5JVG 3;  2JSO A;  1Z47 A;  4DGZ A;  2QKI C;  3LWE A;  1CT1 D;  2F0K A;  2AQ2 B;  2IPK D;  4S3S A;  1GUW A;  5I9P A;  4ZK9 B;  1KDC A;  4KKT A;  4RFB A;  4QB4 A;  4K5X A;  3IFD A;  3GD7 A;  2KVM A;  1H9K A;  1HXY D;  2K03 A;  3D4R A;  3BZD B;  2JEB I;  2JA6 B;  1HTL D;  2E2D C;  3DWQ A;  3PUX A;  3PO3 B;  2EVB A;  1MI2 A;  2MPM A;  1QJO A;  2EY2 A;  2FMC A;  2A69 C;  1ROD A;  4K14 A;  4A93 B;  2K05 A;  1HHV A;  1LT5 D;  1H9S B;  5CBA E;  2L55 A;  5LL6 S;  1UUP A;  1PRT B;  3VR4 A;  4N9P A;  2WP8 J;  1CM9 A;  5CV7 A;  2IL8 A;  3BVG A;  3VA7 A;  1Y8O B;  4RKB A;  1GUN A;  1EWC A;  4F87 A;  3I73 A;  3GO5 A;  3SR1 A;  4DXG A;  1JOR A;  4CKB A;  5DEH A;  2MJ8 A;  3C1F A;  2FIN B;  2F0E A;  4R8I A;  1PMR A;  2AWO A;  1TY2 A;  2OXP A;  4ZYS A;  2IWH A;  2CQA A;  2JYO A;  1SBB B;  1B44 D;  4DK1 A;  3NE5 B;  1PZK D;  1HTP A;  2DY8 A;  5FOB B;  1K8O A;  2SDF A;  3SK4 A;  3NTH A;  4XIG S;  2EYL A;  1YNJ D;  1KAA A;  5IT9 L;  2EYO A;  4K2L A;  5CV8 A;  4ODG A;  1STE A;  2M9V A;  3J7Y W;  4KKU A;  3OOC A;  3QB3 A;  3ZYY X;  3MAQ A;  1RDP D;  4DF7 A;  4A3I B;  3I4N B;  4ZKC B;  4FF2 A;  1EL0 A;  2J7Z A;  4B08 A;  1QIL A;  5IGC A;  3LX0 A;  2E75 C;  3SVM A;  1XTC D;  4PMW A;  5K5P A;  3ONA B;  1ILQ A;  1U4P A;  2E76 C;  3S2H B;  4I7Z C;  3I90 A;  4DK0 A;  1HUM A;  1OO9 B;  2OF1 A;  2ICE C;  1II3 A;  1WVL A;  1CTM A;  2EPB A;  1KDA A;  3MXN A;  1QG7 A;  3DEO A;  3X3M A;  3BYY B;  2F0I A;  5ELD A;  1QWY A;  2NBF A;  2A68 C;  3L9A X;  3HP3 A;  1B53 A;  2FFK B;  2DNE A;  3OWE B;  4K8I A;  4L63 B;  4CKC A;  3BS1 A;  2KA7 A;  2WKD A;  3SXH A;  1AN8 A;  3TME A;  3OSO A;  3Q22 A;  2L1B A;  2XN9 C;  2HDL A;  1BQQ T;  1W6K A;  3W2D A;  2ZXP A;  4IN3 A;  4K2K A;  4NKL A;  4DA2 A;  2BA0 A;  1DYQ A;  2O5I C;  4ILW A;  1EY6 A;  3NQI A;  1F9R A;  3N6R A;  1Y8P B;  3BVM A;  1H9J A;  1EQT A;  3NXW A;  2PW5 A;  1B1Z A;  1MSG A;  2NYZ D;  1SNC A;  2EJM A;  2D9U A;  4ZAI A;  3C3L A;  3TBI B;  3HG9 A;  1UAP A;  3A7A B;  2K32 A;  2LY7 A;  4LK1 C;  2C5C A;  1GJX A;  4X3T A;  2WV6 D;  2K04 A;  1BOS A;  2IJ0 A;  2PPB C;  5M5Y B;  2KCC A;  3CQZ B;  3QOL A;  5DM6 3;  4KTA A;  1ENA A;  3I91 A;  2WAQ B;  2GA4 B;  1F77 A;  3C1E A;  1Y69 U;  3J81 L;  3NWT A;  3URY A;  2NN6 H;  1C48 A;  1PFB A;  2NVX B;  4KHZ A;  4EQO A;  2NN6 G;  3MTS A;  2B2T A;  2G9D A;  4Q5V A;  2F0V A;  3T51 B;  3N52 A;  4A3B B;  1PXU A;  4G7H C;  4V19 0;  1VMP A;  1TKW B;  4RA8 A;  4ZUI A;  3QWN A;  2F0T A;  2RDF A;  3HOU B;  5ELC A;  3GTO B;  3R2I A;  1FNU A;  2MHV A;  3ERO A;  4IAL A;  2Q8T A;  4KN4 C;  2L4N A;  3E6Z X;  4EGV A;  1AW7 A;  2DY7 A;  1TS3 A;  2XWJ B;  1EYD A;  3OMG A;  1X32 A;  2AUK A;  4WRD A;  2R6G A;  4IUP A;  3OPO A;  2EYJ A;  4DAY A;  1D1K A;  1DXM A;  5CGK A;  2F0Q A;  5IGG A;  3UI2 A;  1O78 A;  2EE1 A;  1F2M A;  2SOB A;  5JPN C;  4BWG B;  2KEE A;  4K5W A;  1BCP F;  4K5V A;  4FXD A;  4FXK C;  5FO9 B;  1IW7 D;  4YIJ A;  1NR2 A;  1YNJ C;  3OW7 A;  5AFW A;  4HAE A;  1B2T A;  1UNS A;  1WTR A;  4ZLT F;  3TZD A;  1O80 A;  3I70 A;  4ZKB B;  3RZO B;  1PZI D;  3LNN A;  3K57 A;  5CBE E;  5C3W A;  5EPL A;  1E0B A;  4OO1 H;  3X3N A;  3P20 A;  2F3V A;  4OO1 G;  4EQN A;  3R2T A;  5J39 A;  5HUR A;  1FYC A;  1VF7 A;  3OWF A;  4RH6 A;  3AMU A;  3RD4 A;  5D65 A;  4C3J G;  4G4K A;  3LWU A;  3S17 B;  3FVQ A;  4G7Z C;  5JEA H;  1CQV A;  4K6L A;  4DN4 M;  1I4Q A;  5JEA G;  1SND A;  3BDC A;  2AQ3 B;  3JAM L;  2IX0 A;  1XYI A;  2KJX A;  4FF1 A;  2EY5 A;  4KHV A;  1Y1V B;  2OT2 A;  2K01 A;  3P7J A;  3NWS A;  1FR3 A;  3C46 A;  5KEE A;  3R93 A;  4XT1 B;  4WOR A;  1I50 B;  2Y0S B;  3VYT A;  4IUU A;  1HA5 A;  2VB2 X;  3S1N B;  1LTR D;  5EKI A;  1ET6 A;  3NTK A;  2O4X A;  2B2V C;  3GV3 A;  5T1I A;  1SNM A;  4TKO B;  1FNW A;  1IL8 A;  3MVV A;  5JEA J;  1SYD A;  1PRT D;  3EQL C;  1KNA A;  3MZ5 A;  3SDZ A;  3SEB A;  1EU3 A;  5FLX L;  4M8A A;  3K58 A;  1CA6 A;  5HGT A;  2IX1 A;  1SMY D;  1LV9 A;  2O5J C;  2F0L A;  3MWY W;  2K6A A;  1U4L A;  1S5E D;  1B4O A;  1SNQ A;  2D62 A;  3FPP A;  3K6O A;  1SEB D;  2LMC B;  1PYW D;  3T53 B;  2PCF B;  2K28 A;  3GTK B;  1EU4 A;  3T4A C;  2NTS A;  5A2Q L;  1NSN S;  5KND A;  1UEA B;  2A74 C;  1B3A A;  1QNK A;  1LT3 D;  3L3O C;  3H94 A;  1BO0 A;  1HQM C;  3MEH A;  4HN7 A;  4RGN A;  3TZU A;  1BR9 A;  4BS9 A;  3PV0 A;  1SJE D;  3PO2 B;  5TSS A;  4WJW A;  1EZ8 A;  4HED A;  3GV6 A;  1TWF B;  1KNE A;  1STB A;  3MHB A;  4KY7 A;  2Q8R E;  2JA5 B;  2RBM A;  4IUV A;  3TP6 A;  3VYS A;  1WD1 A;  2L5T A;  2RSO A;  1SE2 A;  2SNS A;  3P1H A;  3VYR A;  4XTC S;  3V2T A;  3E5S A;  4ZUJ A;  2SNM A;  1Q3L A;  1EEI D;  1I4R A;  1DOL A;  3OHX C;  2D2C C;  1JOO A;  4DFA A;  4GZY C;  4XXE A;  2F0G A;  1FNV A;  3NSW A;  4L8J A;  4PQX A;  1I4X A;  5F2D A;  1ZYR D;  4IUN A;  2NN6 I;  5BN5 A;  2F0D A;  1FD7 D;  4H44 C;  3BVZ A;  1PLF A;  1WTW A;  2EJF C;  1EY8 A;  3D31 A;  5C5L A;  1EY7 A;  5BN4 A;  5CC4 A;  1RKN A;  1ZKO A;  1SYG A;  1D5X C;  4BY1 B;  3NK9 A;  2I46 A;  1IW7 C;  4IFD H;  2BA1 A;  1LTI D;  5COY A;  4IFD G;  1ZEQ X;  3L7Z C;  5E4W C;  1A3V A;  5KYI A;  1T5E A;  1X3Q A;  1D6E C;  5FKA C;  2KEC A;  5DAU A;  3FMC A;  3I3C A;  4RWS C;  5JPM C;  2L0C A;  5CV5 A;  3SHL A;  1TWA B;  1BNZ A;  4H0L C;  3J80 E;  4Z9C B;  1Z7T A;  5JVH 3;  4OIK A;  3T16 A;  4AYB B;  2PQE A;  2HCC A;  1D5Z C;  3DUZ A;  4P2C B;  5JOB A;  4OGQ C;  5KGU A;  2K33 A;  5C4J B;  4IFD J;  4U67 3;  1STY A;  1LAB A;  2A6H D;  1JQY D;  1SYC A;  1NR4 A;  1WCM B;  2JA7 B;  1ZXT A;  3K5L A;  1AZQ A;  2X6L A;  4OO1 I;  5EBD A;  3NUC A;  4R8N A;  2K5Q A;  4KD4 A;  2B39 A;  1G91 A;  2L11 A;  4FO2 A;  1SYF A;  2R92 B;  3IL8 A;  1A2T A;  1V1O A;  3FEW X;  1TS4 A;  4NDX A;  4C1N I;  4FP5 D;  2L12 A;  3DM1 A;  4O42 A;  4FXG C;  1ML0 D;  1PRT C;  4PV1 C;  1VF5 C;  3EA6 A;  5M5W B;  3CRK C;  4DXF A;  1MBY A;  1SNP A;  1S5B D;  1IKL A;  1B9N A;  1SMY C;  1EY0 A;  1LTB D;  3J7A V;  2SEB D;  3U9O A;  2ZXO A;  1O7L A;  3HOW B;  3A8I E;  2MUY A;  3G7L A;  3MXG A;  2B2U A;  3KF8 A;  1MD2 D;  4KK7 A;  1ILP A;  2JA8 B;  2B2T C;  4XDX A;  2E74 C;  3BDL A;  2B8F A;  3FRP B;  4NP5 A;  1B9M A;  2E2J B;  4BY7 B;  3PIP 3;  1TT2 A;  4ID6 A;  3HRZ C;  3DWP A;  1HPC A;  1DOM A;  2JP1 A;  4A3F B;  1ICW A;  5E4X A;  2MP1 A;  5LL6 X;  4KY6 A;  1LT4 D;  1F9P A;  2CHB D;  1TQO A;  1H9M A;  5E1F A;  2QIL A;  4WFN 3;  4K8J A;  4XQN A;  1D2B A;  5M3M B;  4QUC A;  1VDZ A;  3MXU A;  2A6E D;  4XT3 B;  1SNO A;  5IOD A;  5C5M A;  3PMF A;  2A5H A;  3HOV B;  4A3D B;  1SSO A;  2LFN A;  2VNU D;  1SDF A;  3NTI A;  5A35 A;  2A73 B;  1DCZ A;  2HDM A;  2CW0 D;  3KK7 A;  4RCN A;  2G9H D;  1ZYR C;  1EOT A;  1J9O A;  2NVQ B;  4IUT A;  2QEJ C;  1FGB D;  4DU9 A;  4CJ1 B;  1EY5 A;  1F9Q A;  3NBH A;  1BCP B;  3VYU A;  2VB3 X;  4EQP A;  3M3Y B;  1Y1W B;  1SXT A;  1ONL A;  3D8G A;  1LAC A;  2TMP A;  5C0X H;  2AWN A;  4LJZ C;  5C0X G;  1HFG A;  2RKS A;  3H0G B;  5J1Z A;  4KI0 A;  2F1M A;  2E2I B;  2B2Y A;  3DXJ C;  2AUJ D;  3SK6 A;  3C2P A;  1WTQ A;  4RGM A;  2EOT A;  5KNC A;  5E3F A;  3HZX A;  1K8M A;  1A3U A;  5IGF A;  3J7A F;  3FPU B;  1R4P B;  3S1Q B;  1W6J A;  1J8I A;  5G3L F;  1S4Z A;  1JCK B;  5FO7 B;  1F2Z A;  1A15 A;  1EYA A;  5I6Y A;  3M4Y A;  4A3J B;  1Z6H A;  4J6H A;  4CKE A;  3IFT A;  3TSS A;  4C3H G;  2O2L D;  1M4V A;  2B8G A;  1BBX C;  3A55 A;  4RHS A;  5CR3 A;  2F0H A;  3D4D A;  5I2Y A;  3FKI B;  2RQX A;  3HOY B;  5M5X B;  3IKJ A;  1V1P B;  4IQZ A;  4IFD I;  5C0X J;  4C3J B;  1PZJ D;  1LT6 D;  1EYC A;  2M00 A;  2XNA C;  4F7X A;  2A6H C;  4TSS A;  5CYU A;  3D3R A;  1IHZ A;  2F0P A;  2F0M A;  1CA5 A;  1STG A;  3K5N A;  5C4H A;  1STA A;  2EXZ A;  1F2L A;  2NZ1 D;  4I65 A;  2R3Z A;  1EY4 A;  1RJT A;  4ZQ3 A;  3DMU A;  1R9T B;  1JC7 A;  1HRJ A;  3ERQ A;  4C1N K;  1V43 A;  1PTO H;  2Z8L A;  1OXT A;  4FF4 A;  2L9H A;  2OEO A;  3A56 A;  2XRQ D;  3SK8 A;  4X3K A;  5KIX A;  4MHE A;  3V05 A;  2RDG A;  1PTO F;  3QG1 A;  2PNR C;  2AQ1 B;  1EIG A;  2EYF A;  2BDO A;  2K7V A;  2F0F A;  3M7N A;  1E2Z A;  5T1G A;  5C3E B;  2BE5 D;  4KV6 A;  1M8A A;  2HQE A;  3HGB A;  1JE4 A;  1XX8 A;  1JWU D;  5COR A;  1JB3 A;  3QOJ A;  4IUR A;  2HCI A;  2F4I A;  2EDG A;  3GQB A;  2ZT9 C;  3GTG B;  1ET9 A;  2XVS A;  4HSV A;  3MFG A;  2WB1 B;  4KD3 A;  3SK5 A;  3OIQ A;  1IYU A;  2WII B;  1DON A;  2EY1 A;  1TY0 A;  3KLR A;  2A6E C;  2NUC A;  3WOF A;  3H91 A;  5C4X B;  5EPJ A;  4RGO S;  4PMC A;  2I07 B;  1GHJ A;  3TP5 A;  2KOL A;  2LKV A;  4N9T A;  3W3A A;  2PZU A;  2N55 A;  5DNF A;  1TWC B;  4LMQ D;  3KBG A;  4L6T B;  1CZW A;  1BF4 A;  5IIF A;  4TQU S;  4X3U A;  1STN A;  1EWH A;  2PZT A;  2KHS A;  3QO2 A;  4XQQ A;  5EKL A;  2ENB A;  3EVQ A;  1G8Z D;  2F0U A;  4R9W A;  2F03 A;  1NCV A;  3A8K E;  4DNR B;  3GTL B;  4MN3 A;  1NAP A;  1O7Z A;  1V1P A;  1YNN D;  3TN2 A;  2QF7 A;  2KQ3 A;  3WDN A;  2KCN A;  3Q6S A;  2JEA I;  3DHQ A;  4BBR B;  4A3K B;  4B9W A;  2IT1 A;  1TWG B;  1KTK A;  5DM7 3;  1C4Q A;  1K83 B;  1CHQ D;  4A3G B;  1OXS C;  1AEX A;  2BCO A;  2RA4 A;  2EZV A;  1CZG A;  3PUZ A;  2F0J A;  2V4D A;  1KLU D;  1I6V C;  1RCV D;  1T5X D;  1GUG A;  3K0Y A;  2RSN A;  5CMD A;  4XQJ A;  1KAB A;  2YYZ A;  5C0X I;  1PFN A;  3NP8 A;  5BN3 A;  2DN8 A;  4F88 A;  5I4D A;  4U68 A;  4F8M A;  3M4O B;  3SE0 A;  2EYM A;  1SYE A;  3E0J A;  3GTQ B;  3GP7 A;  1HUN A;  3MA2 B;  3KUP A;  2PO4 A;  5KYL A;  4X3S A;  5CV9 A;  1RTO A;  5JAV A;  1RF2 D;  3EFX D;  1XXG A;  3AB9 A;  1TR5 A;  3DWA A;  2Z4H A;  3HKZ B;  1DJR D;  1S5F D;  3RMH A;  2PW7 A;  1DM0 B;  3FDT A;  5CV4 A;  1A6X A;  4J1M A;  3KLS X;  3NPP A;  3R8B A;  2JXM B;  5KNB A;  2R93 B;  2XWB B;  3H09 A;  2B2W A;  3J80 L;  3K7A B;  3DEP A;  1QE6 A;  4BA1 I;  5G3L D;  1I4G A;  4OL7 A;  2F0W A;  3U9S A;  3PIO 3;  2J0T D;  2B63 B;  2B2U C;  5I6W A;  1IKM A;  5KRU A;  3GTP B;  1NUC A;  4FYD A;  2X69 A;  4KY5 A;  2F0O A;  4B9X A;  5EQ0 A;  3IAY A;  4BA2 I;  2K5D A;  4IUQ A;  4O1N A;  4CGY B;  1ESF A;  1WTX A;  3CU7 A;  1EFI D;  2BE5 C;  1QNU A;  2EY6 A;  3BG3 A;  1QOH A;  3GTM B;  1BCP D;  5IOC A;  1ENF A;  5IGD A;  1A3T A;  1AZP A;  5C44 B;  1GOZ A;  1D1I A;  3G6J B;  1LTG D;  4OHJ A;  2QDB A;  5FO8 B;  3RUZ A;  3D4W A;  3NHH A;  4V0B A;  1MSH A;  1GXD C;  4HR7 B;  5IT9 E;  4ABN A;  4EVO A;  1Q90 A;  4ZRZ A;  3AU7 A;  4M1U B;  2XRS D;  1PRT F;  1HQR D;  2ZXR A;  1G6Z A;  5EBC A;  1XWE A;  2H1E A;  1LLR D;  3K59 A;  3Q23 A;  5C6A A;  1PTO D;  2D5D A;  1AFP A;  2M2L A;  5M9O A;  4KJO A;  1TS5 A;  1U4R A;  4UAI A;  5FK9 C;  2B2Y C;  1CQF A;  5D3D A;  1CK1 A;  2EYH A;  3NBI A;  4DNT B;  3K5M A;  4RCO A;  5EJW A;  3S1M B;  1EQV A;  1DOK A;  5K36 H;  1YNN C;  2EJG C;  5K36 G;  1H9R A;  3BYT B;  1OXX K;  1TU2 B;  2F3W A;  2X6G A;  1Q12 A;  3CRL C;  1HCZ A;  5EKK A;  2BOS A;  1WTV A;  1Q8I A;  1TWH B;  3TDQ A;  2F0N A;  1EZ6 A;  3A8J E;  4Q0F A;  1TVX A;  4XYQ A;  3GTJ B;  1Y8N B;  3D6W A;  3T56 B;  4JK1 C;  1ENC A;  3S9W A;  3P75 A;  1HFN A;  3QIA A;  1BUV T;  1C8C A;  3HS0 C;  3K5O A;  1HA6 A;  4C3H B;  2BDN A;  1BDO A;  2IW3 A;  1SFO B;  3MXP A;  1ESR A;  4BBS B;  1LTA D;  1DZ1 A;  1OXU A;  3BDO A;  1H9S A;  5M3F B;  2C9O A;  2WKC A;  4A3M B;  2R61 A;  1X3P A;  3D6C A;  2H4O A;  2RVL A;  5ELE A;  1LO5 D;  1QCB D;  1JOK A;  3S15 B;  3OIP A;  2EYP A;  1SJH D;  2J4X A;  2Z4I A;  2XSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...