5LL6X

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
155
structure length
155
Chain Sequence
STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAGKANKQFAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
total genus 17
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00366 Ribosomal_S17 Ribosomal protein S17
X PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ll6X00
3J80L 5A2QL 5FLXL 5IT9L 3J81L 3JAML 5LL6X 3J7AV
chains in the Genus database with same CATH superfamily
1FNWA 3TQYA 4GKKL 3JC66 4RFBA 1PYBA 3DLLA 1F2ZA 1VQLA 4A3BH 2NVTB 2F0QA 1KC8C 1GUOA 1X3QA 1YJNA 1UWVA 2IWHA 3N6RA 1BNZA 2K33A 2MFIA 4NMZA 1O7IA 2F0TA 3PUXA 1N36L 3I4MB 2NVYB 2JJQA 1M1KC 5C44G 1T5XD 1IHZA 2PNRC 4A3MG 2EYHA 1WTWA 1WTRA 2F0OA 1PH4A 2B39A 4CHTB 1SDFA 5C0XJ 3A74A 4A3IG 4TQUS 1G91A 2JA9A 3I8ZA 4NP5A 3WDNA 4BS9A 5JJZA 2F4VL 3SK6A 3EA6A 1K3RA 1EQRA 3LWUA 4XYQA 4A3DH 4GZYC 2EDGA 3GTMH 2BDOA 2IHFA 3CU7A 3FPUB 3RZOH 2XIWA 3NWSA 2JXMB 1TQOA 1HZBA 4V190 5J1ZA 5JAVA 1XNRL 2K5VA 5A2QL 2LXJA 3AEVA 5IGDA 3PO3G 1SJED 5FLMH 1TWFB 3CRKC 2WACA 1MIUA 2OTLA 5C4JH 3PO2B 1PFNA 3BZDB 3S2DH 1HNZQ 5LMNL 1Z7TA 4DNIA 1YI2A 4F8MA 4KKUA 1TWAH 2NN6G 1CKNA 4X3TA 4AH6A 4B3TQ 1CSPA 2VS1A 5EBCA 4ALPA 4FNFA 1WYDA 3BG3A 4DK6C 1RODA 4B08A 4L6TB 1LV9A 1VQ8A 2AUKA 4A3LG 5JJLA 4YWMA 2CKZB 1YVCA 4KHPL 2Z6KA 2HDMA 4DKAC 1X56A 1ET9A 3RNUA 1Z9FA 4K8JA 2QKIC 3BU2A 2DNCA 3KLWA 2YU9B 4JI6L 4WRDA 3I55A 2K5QA 4I7AA 3PIO3 2DN8A 4JI0L 4A3FG 1VQDA 3S17H 4DGZA 1S5FD 1JC7A 3BVMA 3L3OC 1HZCA 3S9WA 3SK5A 4X65Q 4DUZQ 1Q1BA 1BF4A 1GM5A 1NTGA 1M4VA 2AWOA 1PH8A 3ICEA 4KD3A 4R8NA 1IBMQ 4R4TA 5CV6A 5FLXE 1LYLA 1I5FA 2BE5C 4LF6Q 5KIXA 2AWNA 4KKTA 3HOVH 4BY7H 2JA6B 4LAAA 1TS5A 1JB7A 2JEAI 3MTSA 1PH2A 1MI2A 2K6AA 2KA7A 1EQQA 1JCKB 1F9QA 2GA4B 1DOKA 4DR3L 1I4RA 3DWPA 3I4MG 3K7AH 3C2PA 1RF2D 1SEBD 1J6QA 5I9OA 4MN3A 4QGUA 1VQ5A 3BVGA 5DM63 1WI5A 3DM1A 3I3CA 5EBDA 2MNAA 2A6ED 2AHOB 2LMCB 1N9WA 4FDBA 1OXSC 1YNJC 5M5WB 1C48A 5CBAE 2MO1A 4HIMA 2ZJPA 1BOSA 1C4QA 3I73A 3J7A5 3DEPA 2MGSA 5CV7A 2PW7A 2D2CC 1JJGA 1GXDC 3HEJA 3PF5A 2TSSA 1ESFA 3C3LA 1LT4D 1K0RA 2F03A 2RDGA 2OXPA 1HNWQ 5K36H 1PYWD 1H9SA 1W6JA 4DR2L 2F0FA 4MHEA 3FMCA 1KIXA 1QOHA 2CWPA 5IYBH 1OXXK 4CJ2C 3CC2A 5CGKA 4NXML 2B2TC 1QG7A 1BBXC 3MXGA 5C44H 3KBGA 1SE8A 2WAQE 4A3MH 1AE2A 1TXYA 1ILPA 1ONLA 3S2HB 2GN5A 1N32Q 2YYZA 3PO2G 2PMZB 2RSOA 4B3SQ 4N8FA 2B2WC 2CH4A 2RDFA 4KD4A 3TS0A 5L37A 4A76A 3Q6SA 4KV6A 1P8LA 2F4IA 4QMGA 1VQ7A 3BVZA 4KY6A 1NJIC 1CQVA 1I50B 1CTMA 3RMHA 1DXMA 3NSWA 3RLNA 2K01A 3VR6A 1B50A 4X3UA 2KBNA 4KN4C 3D4RA 4LJZC 2ZTEA 1E24A 4UHVA 4BY7B 1FGUA 3PO3H 2RF4A 3T51B 5KNBA 2VZAA 3AYHB 3BYYB 3FKIG 1GHJA 4FXDA 4JI8Q 2B2VA 2A1AA 2DNEA 4LF5L 1MKHA 2XWBB 3UDFA 5DEHA 4A3JH 1E3PA 1I4HA 2L55A 1K8OA 1OXVA 1DCZA 4DR5L 1U4LA 4ZKBB 5AFWA 4GLAC 3U9SA 1STAA 5IYDG 5EGTA 4K6DA 4A3LH 1SAPA 1A63A 4JI4Q 2EYFA 4HIDA 1M90C 3STBC 4IFDG 1NAPA 1AFPA 1V1PB 2M00A 1VQIA 3ER0A 4C3IH 1JE4A 3OIPA 3DUZA 2HT1A 3R93A 3GTQB 4O2DA 3U9OA 2Q8IB 5JVH3 1HR0W 2HHHQ 4A3FH 1LABA 1ICFB 2QW7A 1W6KA 1L0WA 2IT1A 1HZAA 3M4OB 3CPWA 2A8VA 2IPKD 3MXPA 2EE1A 2EXZA 4GKKQ 3SE0A 1PH6A 3AU7A 1I3QB 1PFSA 3SGIA 3TN2A 2WINB 3QIAA 2NVTH 5FKAC 4X64L 2KECA 2VY3A 5IT9c 1NMFA 3LGJA 1QVCA 4OL7A 4UP8A 1EEFD 1SROA 2HQLA 4J1MA 1EL0A 1N36Q 3I4MH 4FO2A 3HOYG 3CHBD 4RGNA 2NVYH 3RN2A 3Q0AA 3D3RA 2LKVA 3H15A 1NY4A 1IYUA 2KENA 5I2YA 2XRQD 3A55A 3E6ZX 3U4VA 2A6HC 3M4YA 2OF1A 1KNAA 1SMXA 4N9PA 2F4VQ 3NELA 4P2CB 3CMEA 1LTBD 2D62A 2F0VA 4FP5D 1Z6HA 1VMPA 1BDOA 3K5NA 5EKLA 4LFBL 1PRTB 2EJMA 3PUYA 2K75A 1XNRQ 2PZUA 1STNA 4OEMB 1SNOA 1HTPA 2PCFB 4L5QA 4RH6A 2X6GA 2HCCA 2K28A 2MJ8A 4QJFA 4X62L 3E9HA 3DHQA 1LT6D 5KEEA 3KJPA 5H1SE 1TWFH 4M1UB 1YZ6A 5IODA 5D3IB 1TT2A 2RCNA 1CSQA 5LMNQ 3K6OA 1CKNB 5LHY1 1V43A 4DNTB 3KK7A 1C8CA 4YY3L 4JBKA 4ZUIA 2K5WA 4KHVA 1G2TA 1YBYA 2XSCA 5JOBA 2N8NA 1QWYA 5M3FG 4AYBE 3GTMB 4KHPQ 3ITPA 1OTCA 1U0LA 3KUPA 1CZWA 2Y0SB 1G2SA 2L9HA 1B8AA 5JEAG 4IUNA 1RKNA 5CV5A 4JI6Q 2AUJD 3TDQA 3WWVA 1EOTA 4P75A 2HIVA 4JI0Q 4DK0A 4F88A 3PF4A 5E4XA 5C4JB 3QOLA 5G3LD 2YTVA 5IP9G 5IYCG 3S2DB 3JAML 1G6ZA 4U673 1LO5D 1TU2B 1JICA 2JA7B 4RMFA 3J80i 4HJ5A 1X3GA 4OGQC 3OIQA 5IYDH 1LUZA 2Z8LA 1YHAA 5T1IA 5ELFA 3X3NA 1E22A 1IXRA 2O4XA 3UI2A 2JA6H 4PQXA 1D8LA 1CA6A 1PH9A 1DZ1A 3RN5A 4OO1G 4QIWE 2JYOA 2N55A 4IFDJ 1VDZA 1Y1VB 2C35B 2WB1B 4CKBA 4DR3Q 1EY8A 5BN3A 1EIFA 1L0YB 2SNSA 3BJUA 2KVMA 2JA8H 4KLKA 4QCLA 2SOBA 1PTOD 1KXLA 2I46A 3S14B 1HH2P 1K9MC 1WCMB 2NTTA 5M5WH 3K0YA 2K7VA 4HCSA 1HFNA 3S16B 3M9BA 1SMYD 2I5MX 3FVQA 4RHSA 4KKSA 4HCEA 5D65A 1H9SB 4PG3A 5FLXc 4A3CH 4DR2Q 3CD6A 1UE5A 1F9RA 1VQHA 4WJWA 4XIGS 2J4XA 4LWCA 2X6LA 2EY5A 2K50A 1SSOA 3NBHA 4NXMQ 1D5MC 3MHBA 3VR2A 4FXGC 2H4OA 2WIIB 3MZ5A 3CCSA 5IWAL 4R4OA 1NNXA 4DAYA 1LTGD 4ZRZA 1H9KA 3S24A 3K7UC 2ZJQA 2BA1A 2K5HA 3S2HH 4KY5A 4MTNA 4O1NA 3J7ZC 4G7OC 4DV6L 3TP5A 4FXKC 1VQBA 4ID6A 1IKMA 2H1EA 1GUGA 1D1IA 1A2TA 2WFWA 4PV1C 1KRTA 2E2DC 3RUZA 4NDXA 3KF8A 4ABNA 2A68D 1MSGA 2GVBA 3CMAA 1BCPB 4XQJA 1O7ZA 3FEWX 2Y0SG 1I4GA 2KHSA 4QUFA 1LTRD 1FVIA 1TWGB 1H9RA 3HKZE 2F0EA 2CFMA 1QB5D 1VQEA 1VQMA 4GKJL 5KRUA 5FLMG 4JVZA 1HRJA 4LF5Q 1F9SA 1R4PB 2B8FA 2RKSA 1SNDA 4UDUC 2A19A 4DR5Q 1CA5A 4DAPA 5CV8A 4YCVA 1C7YA 2ALYB 2EJGC 5LL6X 2JA7G 1TWHB 2PO4A 1MJCA 4IURA 3CCLA 4IALA 4UY8C 2TMPA 1PTOF 3OOCA 1VF5C 3TMEA 2OT2A 4K2LA 2F1MA 4IUVA 1SNMA 1Y1VG 2WB1G 4IOAA 5CORA 1CT1D 5JEAJ 3A7AB 4LF4L 3M4PA 1WTOA 3D4DA 3GTQH 2AMCB 1I4PA 4R8IA 3HOWB 4OIKA 2VB3X 4K6LA 4HAEA 1PHJA 1B9MA 1WCMG 1TIID 3MA2B 2VQEL 5IYCH 3M4OH 2D5DA 4A3JB 1V8QA 4OHJA 4DV7L 3LX0A 4O0AA 1I3QH 4ZLTF 4NKLA 1VQFA 3IRBA 1VS0A 4X64Q 1V1QA 2RHSB 5DAUA 5C4ZA 2ZXOA 4QF4A 4NW2A 2E8GA 5IT9E 1BUVT 3A7LA 4GLXA 1RD9D 1CZGA 1GUSA 4RGMA 5NUCA 4HIKA 3CPFA 4R1JA 2E76C 3GQBA 1SYGA 5E1FA 1QNUA 3HGBA 4DR6L 1HCZA 1S3OA 5CC4A 3IAYA 3KDFB 2KJXA 2WKCA 3IFDA 4GOPA 1J9OA 4JI2L 3I2ZA 2EVBA 2QGQA 3G6EA 1EWHA 2A69D 1STHA 3HS0C 4X3SA 1WTQA 4LFBQ 1EEID 4GN5A 3K59A 1XPOA 3F2BA 3HRZC 5K36G 3HFZB 1LM0A 3C1FA 2PPBC 1N34L 5IYBG 4JW0A 4X62Q 3VYTA 4V0BA 1HA6A 2EYJA 3MEHA 4KJOA 5CMDA 1VQ6A 3E5SA 4ULLA 3TZUA 3CCVA 4C1NK 2F0KA 5ELDA 1AE3A 3I70A 1EY6A 2XVSA 1KTKA 3GTGH 4B9XA 2Z4IA 1EOVA 4YY3Q 4ILWA 3P7JA 1QJOA 1G8ZD 4C56C 1S4ZA 2PQAA 4IJHA 2CVRA 2EY1A 2OWOA 4K8IA 3VYRA 1Q46A 2B3GA 1UEAB 3BDCA 2F0WA 4Q0FA 3CCRA 1STBA 5M9OA 4ME5A 3A5ZB 1BR9A 3KLSA 1X3FA 1ZYRD 2MUYA 4L63B 2OQKA 2EYOA 4JCVE 1E2VA 2F3VA 2Z4HA 4UAIA 3HOWG 1XMQL 1XWEA 2X69A 2KQ3A 3V2TA 1O80A 1NCVA 3KYHC 2F52A 1HR0L 2P5ZX 3CCJA 4CJ1B 1JOKA 4KY7A 4A3JG 1HXYD 3H94A 3A0JA 2JA7H 1I6HB 3J7AF 2F0SA 1SYFA 3HOXB 4R9WA 1T5EA 5I6YA 1W2BA 4OONA 1SE4A 1VCIA 3FP9A 1QVGA 1A15A 3TS2A 1Y1VH 1KLGD 3RR5A 4KN7C 1A2UA 4MNOA 2VW9A 2L11A 3EIVA 1EYAA 3MWYW 1ENFA 5IY0A 1G291 3SDZA 4K14A 4C3IG 3MXNA 4LF8L 2XGTA 4RGOS 4JOIA 3S14H 1DGSA 1WCMH 1AEXA 2B2UC 5J3BA 1PRTC 3S16H 3K8AA 3K57A 1PVOA 4LFCL 5DLQE 3T16A 2CHBD 1N33L 1U4MA 2UXDL 1IW7C 1E7ZA 4F7XA 3TSSA 3G4SA 3CP0A 2Z1CA 2IJ0A 1LTAD 4C3JH 1CHPD 2HQEA 2R7ZH 4ZCKA 1LTTD 3NBHB 1WFQA 4QL5A 3ULJA 2NWGA 4TSSA 2E74C 1K3BC 1ILQA 1TS3A 2OQ0A 5IWAQ 2V4DA 4LF7L 5I4DA 1A8VA 2ID0A 3A56A 4PZ7A 4CDFC 1BVSA 3NQTA 3PSIA 1STYA 2B2TA 2DGYA 2JA8B 1FD7D 3A8JE 2IW3A 2Z6KC 1H9MA 4DV6Q 2Z6BA 1K8MA 3F2UA 1PZJD 1FNUA 1ZKOA 2B2WA 4X66L 4PMCA 4A93B 3KF8B 5DNFA 4JC0A 4OIJA 1G6PA 3T1YL 2CWAA 1KDAA 2L5TA 5EPLA 1EIHA 2ZTCA 4DUYL 2FMCA 4HJAA 1X6OA 2O2LD 5COYA 4CKEA 2CH4W 1YHQA 3NUCA 2R93B 1TWGH 3ERSX 4H44C 1IBLL 4QQBX 4GKJQ 4L8JA 2F3WA 1BBWA 3C1EA 1KAAA 5FJ8H 3AB9A 3CCMA 4A75A 4YHHL 4FVMA 4WORA 1MGSA 2EY6A 5HY6A 5IGEA 1TWHH 2F0GA 4JI1L 3HOXG 2NVXB 3FHWA 3MEFA 3CRLC 1IKLA 3PIPA 1R9TB 2VQFL 2ZT9C 1QZHA 1ZEQX 1SNCA 3GP7A 2UUBL 4LF4Q 3S15B 3F2DA 2C5CA 4JV5L 3HOWH 5ISRA 1PFMA 2LY7A 2VQEQ 1DONA 4RHRA 2ICIA 3UDGA 3J7AV 3M4QA 4DV7Q 4BA1I 1PH7A 5FK9C 2BE5D 2IY5B 4H13C 1WTHA 1YJ9A 1VQNA 5ELBA 2BDNA 1MHWC 1YNNC 2ZJRA 1RTOA 4BBSB 3SXHA 3NPPA 4O42A 2KUMA 2JA6G 3HKSA 1PYSB 4DA2A 3OTOL 1QCBD 4J8QA 2K5DA 4ZKCB 3CF5A 2K52A 3OSOA 4M8AA 2Q2TA 2F0PA 1CI3M 1YNJD 2M2LA 3I90A 3J81L 4A3EH 4PZ8A 4DR6Q 1B7YB 2JA8G 4Y52H 2UUAL 3K5OA 2NB0A 3ONAB 3J80L 4GOPB 2VB2X 4B9WA 2QEJC 1X55A 1SNPA 1QE6A 5IGGA 4JI2Q 1BCPC 2E2IB 1K8GA 1JJCB 1PV4A 5KNDA 3L9AX 3OPOA 1F2YA 1KRSA 1GOZA 3IFTA 4HJ9A 1XNQL 1TS2A 2QCPX 3IKJA 2B2VC 3VR4A 1I94L 2F0MA 1FGBD 4A3CG 1NR4A 2JE6I 4JBJA 5HURA 3KLSX 4YCUA 1N34Q 1F2LA 5M5YB 2R93G 2HDLA 4H7BA 4IJLA 4XQQA 1CHQD 5J39A 1QILA 2PQEA 2E2JB 1B1ZA 4K5WA 4EQOA 2F0UA 2ICEC 4FF3A 1B53A 4JI3L 3FRPB 2PQAB 5BN4A 1SYCA 1PH3A 2NZHA 4DV4L 1HQMC 1ZXTA 3K81C 3UE1A 4A3KB 2O5IC 1L2FA 3PCOB 1SRUA 2SDFA 2K03A 1OXUA 4G57A 3H91A 1GO3E 5A2QE 1B3AA 2XRSD 3ND9A 4CGYB 1B4OA 2A5HA 1LACA 3RZDB 3SHLA 3S1RB 3PV0A 1X3EA 2HD3A 1Q12A 1XMQQ 4BA2I 4FYDA 3KOJA 5C3EB 1HR0Q 3V96A 1Q7YC 1SR3A 2OTJA 1NUCA 2DJFC 2QDLA 3GTGB 4HN7A 1I6HH 5I9PA 3DWAA 3HOXH 5CV4A 1EY9A 3STBD 1F77A 5EKKA 1EIYB 1K0SA 5IIFA 2N78A 2QILA 4BBSG 3J7YW 4PMBA 3EVQA 1Q81C 4JI5L 1CK1A 3MXNB 3TEHB 4B3RL 3L2PA 1HNXL 2RDHA 3CKIB 4LF8Q 2VUMB 2R7FA 3T1HL 3URYA 3D6CA 2F0IA 2R7DA 2E2HB 1EQTA 5J22A 1H95A 3L7ZC 4LW1A 2NZ1D 4K2KA 3UE0A 4BY1H 3GTPB 4ZUJA 3JAMc 3R2TA 4LFCQ 1IZ6A 3H3VI 3W3AA 3H0GB 3F1ZA 1N33Q 2UXDQ 3R3OA 3L0OA 3AQQA 1SXTA 1L1OA 2R92B 1DOMA 1JWSD 1HUNA 1Q90A 3GV3A 1RTNA 3K58A 2J0TD 2LXKA 4GNXA 5EAYA 2MPMA 5EKIA 4LF7Q 2C9OA 4XDXA 5C5LA 2JA5B 2KCCA 4L5RC 2A6HD 4CDDC 2BA0A 2HCIA 2KCMA 3MC0B 1HQRD 2WAQB 3PQIA 2UUCL 2FMMA 4RG1A 2BCOA 1Y1WB 4WJ4A 2UXCL 3RD4A 4EQNA 4OWWB 1E1OA 4X66Q 4NPSA 4A93H 2I5LX 4ZQ3A 2ZTDA 3EQLC 3T1YQ 1YIJA 4X6AH 3C46A 1EUJA 3MVVA 4DUYQ 3SEBA 4A3KG 1WJJA 1SYBA 4XQNA 2RSNA 4C3JB 2R7ZB 3V05A 1WD1A 3ND8A 4F87A 4HJ7A 1EU4A 4OX9L 2R93H 1IBLQ 3G7LA 1VQAA 3WOFA 1BQQT 2OCEA 1D5ZC 1GD7A 1VQJA 3OHXC 4JK1C 4DV3L 3TP7A 1IYJB 1A62A 2M9VA 4YHHQ 4Y7NH 5KGUA 3KFUA 1XXGA 1ENCA 4RWSC 4JI1Q 4JBWA 4POGA 1D1KA 2BH2A 1E1TA 3VA5A 2NVXH 3M7NA 2HIXA 4DV0L 1AP0A 2CW0C 2PW5A 2D9UA 2VQFQ 1R9TH 3GV6A 1Y8OB 2VXWA 2R3ZA 5G3LF 3W1GA 1S40A 5BR8L 4BBRB 2RA4A 2UUBQ 3D6WA 2DY7A 3S15H 3NE5B 3PIOA 4JV5Q 2CQOA 3T53B 4BXXH 1WTPA 2ZM6L 1RHPA 1TS4A 3A8IE 2KOLA 1EYGA 1PMRA 1JWUD 4B3ML 4DU9A 3OW2A 4R4IA 3E0JA 3NBIA 4CKCA 5LMUL 2L4NA 3QO2A 1UNSA 3BDOA 2OEOA 4OWXB 2NYZD 2QDBA 2F0HA 4BBSH 1QZGA 1V9PA 2XTIA 1KAWA 5IP7H 2EYPA 1SLJA 4ME3A 2Q8RE 2DUDA 3OTOQ 4HR7B 4RKBA 4YCWA 1K73C 1PDQA 3GO5A 1W3SA 4KTAA 4CDEC 1ASZA 2CCZA 1XTDA 2JA5G 1HUMA 3J81E 4BWGB 1SYEA 4P74A 3J80E 4XXEA 2WAQG 1JQYD 2UUAQ 2JK8A 5HGQA 4N8X1 2FINB 2N3SA 1P16A 1GUNA 2D0PA 3K0XA 4ZK9B 2E2IH 2Z9HA 4NXNL 5C0XI 1PTOB 2PNHA 2IX0A 2KEEA 3TZDA 3TP8A 3SK8A 5JJKA 1HTLD 4EQPA 1IL8A 1I94Q 5CYUA 2E5LL 2JSOA 4CDCC 5M3MH 4C3JG 2R7ZG 3KJOA 2CQAA 1O7YA 1JJ2A 5M5YH 3HOUB 1E2WA 4RGTA 2PMZE 3OMCA 2K04A 4LK1C 1BKBA 2E2JH 2K05A 2HUGA 5ELOA 4DK3C 5E3FA 3CAMA 4A3EB 3VA7A 4JI3Q 1U4RA 1UE7A 3WOEA 1MBYA 1GUTA 4K0KL 1VQPA 1CUKA 3Q23A 2F0JA 4S3SA 3X3MA 5FO7B 3BZCA 4DV4Q 5KNCA 2BH8A 3LWEA 1I6VC 3QWNA 1I4XA 5E7NA 3CQZB 3UDIA 4C1NI 4A3KH 3H6MA 4R4CA 4AYBB 2PYKA 3CW2C 5C3XA 1ENAA 3BYTB 3ZYYX 1FJGL 2K32A 1EWCA 3S1MB 1UAPA 5FO8B 3RZDH 3S1RH 2R61A 1VMCA 1FNVA 4KJNA 1S5CD 2I5HA 3OMGA 2SEBD 4HSVA 3T56B 4YWLA 5C3EH 3SK4A 1SBBB 5K5PA 1S72A 5FJ8G 1EQVA 1K83H 1EU3A 2EIFA 2EOTA 4KHZA 1SNQA 4UP7A 1NR2A 4IPGA 4DR7L 1VQGA 2WV6D 5BN5A 1B70B 3IL8A 4XYOA 5CR3A 3W5OA 1Q86C 1KHIA 3FDTA 4RCOA 4P71A 1A3TA 4A4IA 1M8AA 1WOCA 3NTKA 4DPGA 1VQ9A 3QB3A 1EYCA 4IUPA 2EJFC 2L1BA 2Q2HA 5EJWA 5I2XA 3CXCA 1ASYA 4JI5Q 2EPBA 3ZJYC 2FFKB 4QIWB 1EZ8A 2B2YC 5C0XH 4B3RQ 1HNXQ 2G9HD 4GOPC 3NK9A 2SNMA 1NE3A 4LUZA 2VUMH 3T1HQ 2ENBA 2MHVA 1PFBA 4OXPA 2E2HH 5FOBB 1UE6A 4EVOA 2A6EC 1XMOL 3GTPH 5D14A 1B9NA 1EWIA 3JAME 1Q82C 2QF7A 3H0GH 1L1OB 4LF9L 2MQHA 4CBVA 1AW7A 2B2UA 2LSSA 1JR0D 1LTLA 3D31A 2R92H 4TKOB 3MFYA 3PMFA 3W2DA 3CCEA 4GNXB 4IN3A 1MSHA 2EY2A 2JQOA 2K1BA 3F2CA 2GVAA 1EY0A 1S5BD 1Q1EA 2IX1A 3I56A 3HOUG 3GDEA 2FHTA 2JA5H 3GTOB 1RCVD 1Y8NB 3E0EA 3SVMA 4YIJA 5C4XH 2UUCQ 4IUQA 4A3EG 1Y1WH 5GADC 2Z0SA 4RAUC 2UXCQ 4BY1B 4AIMA 3NP8A 1JOOA 1KDBA 3CC7A 3UDXA 1EYDA 3K5MA 1IBKL 4K5XA 3G48A 1B2TA 3EROA 4AYBG 1AH9A 1U4PA 3FKIB 4DF7A 4OX9Q 3A5UA 1VQCA 1KDCA 1SFOB 3HOZH 3D0FA 2F0DA 4DAYB 3I7FA 3OWEB 1Y14B 5E4WC 1J8IA 2PZTA 3HKZB 2NVQB 4G7HC 4C3HH 5C3WA 4DV3Q 1S5ED 1C0AA 3AFPA 4LFAL 5GAGC 1V1OA 3GTLH 1K8AC 1DJRD 4DV0Q 3GTJB 2Y0SE 4N9TA 4DV5L 4JOIC 4IOCA 2IX3A 4G7ZC 2AQ3B 2NN6I 2B63B 2ATWA 1BBUA 5IGBA 5BR8Q 4BBRH 1CQFA 3A54A 3I4NH 1Q3LA 1ESRA 4RCNA 2ZM6Q 1HFGA 3VR3A 5EQ0A 1PA6A 3S1QB 3R2IA 1EY5A 4NB3A 1Q8IA 4B3MQ 3BS1A 1AN8A 5F2DA 3O13A 4IUUA 5LMUQ 2EYMA 4L5TA 4Y7NB 5GAHC 1PXUA 2FXQA 4ZAIA 4DR4L 4U68A 1UE1A 4DR1L 1KLUD 1KNEA 2WB1E 1L0XB 4J6HA 2B8GA 1VQOA 4AQYL 5GROA 3QOJA 3PUZA 1TVXA 3HOYB 4A3GB 1LTSD 4ODGA 2XN9C 1YITA 4PZ6A 2DJGC 1HZ9A 1QUQA 1A3VA 4A3IH 2NTSA 3T4AC 4UPAA 3TREA 1TKWB 2QA4A 1KD1C 1MD2D 1PRTD 1EZ6A 2KEDA 3DEOA 2ZXRA 2QEXA 1TY0A 2JP1A 4K5VA 4JI7L 4BY1G 1IW7D 1TY2A 4LNQA 1VQKA 4NXNQ 4JYAL 4QUCA 1PTOH 4IPHA 4I7ZC 3A8KE 1NSNS 2E5LQ 3P75A 1I4QA 2RQXA 3I91A 1QNKA 5GQOA 5C5MA 1JORA 1X65A 1U5KA 2UU9L 1F2MA 2XNAC 5M5XH 3HOUH 3Q22A 1TWCH 3D8GA 5JPNC 5IE8A 4QB4A 1KQSA 1C9OA 3M3YB 5IGFA 3J81c 3HKZG 3GTKH 4DV1L 1EIGA 1TR5A 2NN6H 1K28A 1AZPA 1AZQA 2A73B 3J80c 4TRDA 5GAEC 2UXBL 4K0KQ 5M3FB 2V1CC 1NBWA 2N88A 3NQIA 5FO9B 1H9JA 1SE3A 1GHKA 5IOCA 4JPBW 3EJIA 1BO0A 2L0CA 4A93G 3HG9A 1X9NA 3TBIB 3CQZH 3S1NH 2B63G 4EX5A 5KYIA 1GKHA 5KYLA 5M3MB 1FJGQ 1G51A 1O7LA 3NWTA 5IGCA 1WVLA 3S1MH 1R4QB 5LMNW 3PUWA 3K80C 2B29A 4PNYA 3Q8DA 4P72A 3ERQA 4FF1A 1XJVA 4DV2L 4WJ3M 3EN2A 2F3IA 5AJ3L 3VYUA 5JVG3 2K4KA 5D3DA 4C2MB 4DR7Q 1X54A 3AMUA 1D6EC 2EZVA 1EY7A 5IT9L 3GD7A 2VNUD 1HHVA 1UEBA 4J15A 1GJXA 1HPCA 2ZXPA 1PRTF 3DWQA 3NEMA 4DFAA 1XYIA 4DXGA 4A3GG 1YJWA 3N52A 1J5EL 3ULPA 3ULLA 3P20A 2ES2A 5TSSA 1XX8A 1FL0A 1GUWA 4DN4M 1U9RA 3KF6A 2IL8A 4IFDI 3KDFA 1PTOC 4BXXG 1XMOQ 3M85A 3TRZA 2JEBI 2AKWB 2YTXA 2NZOA 4LF9Q 2Q8TA 3U50C 5I6WA 1SMYC 2G9DA 1K83B 1PLFA 1YNND 3CC4A 3OW7A 4A3BB 4HIOA 1XPRA 1ET6A 1JWMD 4GN4B 2RCFA 3H09A 2RBMA 4G4KA 2I0QA 2K5NA 1FR3A 4YWKA 4R4QA 2JN4A 3HP3A 5IP7G 4P73A 4MIUA 3PO2H 1X32A 4FF4A 4HTHA 1EFID 4GLVB 3GTOH 2O5JC 1FYCA 3E9IA 4QY7A 5ELNA 4Q5VA 1GVPA 1OO9B 4XT1B 3QG1A 3QR8A 4GS3A 1ML0D 1WD0A 1JMCA 1BCPD 3HZXA 3KLRA 1WTXA 2IHEA 5HGTA 4A3DB 3J81j 3RZOB 3DXJC 2R6GA 1IBKQ 2F0LA 1II3A 1E0BA 4PMWA 4X3KA 2A68C 4LUVA 5EPKA 1B3QA 1RL2A 2YU9H 2KHJA 1SYDA 2LFNA 3FKIH 5M3MG 1BXTA 4OELB 1LT3D 2EQSA 1SFOH 3M7GA 1A0IA 2XWJB 5JJIA 4OWTB 3NHHA 2BOSA 1CFMA 4KMUC 4DNRB 1CKMA 3I4OA 2NVQH 3J81i 1HNZL 1IL2A 2G5DA 1PZKD 5C4XB 1TWAB 3TP6A 1D7QA 1SN8A 4LFAQ 4B3TL 4HEDA 1LT5D 5JPMC 2AQ1B 1VQ4A 4IFDH 3GTJH 2L12A 3B6YA 3VYSA 4DV5Q 3PIP3 2D0OA 1LLRD 3K5LA 2B63H 4I65A 4DAVA 1A6XA 1D2BA 1PH5A 5C4HA 4HMJA 2A74C 1EFWA 2RVLA 3DM3A 3HOZB 1L1OC 2K14A 5DM73 3CCUA 2F0NA 3S17B 3S1QH 4UP9A 1XPUA 1Q8KA 4X65L 2MP1A 4DUZL 3DMUA 1JE5A 4C3HB 4XTCS 1SJHD 1DOLA 5C3EG 4GNXC 1E2ZA 1NMGA 3Q24A 1IBML 4DXFA 3W1BA 4DR4Q 1YNXA 1HA5A 3I4LA 4LF6L 4DR1Q 3HOVB 1KABA 4IQZA 4DAMA 5FLXL 3GTLB 2J7ZA 4A3BG 2VL6A 4IZ8A 1CKOA 3D4WA 4HSPA 3CCQA 4AQYQ 1T9HA 1S5DD 1DYQA 4LUOA 3HOYH 4A3GH 4CJ0B 1BCPF 2KCTA 3U58A 1WTVA 1QUQB 1HJPA 3K7AB 5CBEE 3H3VH 2DY8A 3P1HA 1YHBA 5C0XG 1N8RC 3BZKA 1PH1A 2WP8J 4IO9A 3I4NB 1RJTA 2VUMG 4OO1I 1VF7A 2NUCA 3RLFA 1I50H 1O78A 3BDLA 5ELCA 2RHQB 5EPJA 1LTID 1XTCD 3R8BA 4JI7Q 2KHIA 3U4ZA 2PI2A 5ELEA 4EQ5A 2FJ2A 4TVAB 4RKLA 4A3DG 3I72A 4JYAQ 4HMIA 1KL9A 3H0GG 3LNNA 1QVFA 3PUVA 4IPDA 4ZYSA 2A69C 1HNWL 4IPCA 2PZWA 2R92G 1Y69U 3MXUA 4WFN3 1CM9A 4E6IA 4HJ8A 2UU9Q 4EGVA 3KBXA 2NBFA 4L5SA 1UUPA 1YEZA 4RA8A 5C44B 3AFQA 4A3MB 4APVA 2AQ2B 3NTHA 5T1GA 2N49A 4A3IB 3F8TA 1N32L 3M3YH 3SR1A 4DV1Q 2H5XA 3G71A 4B3SL 1STEA 2I07B 5C6AA 4KK7A 2PI2E 1B44D 5C4XG 1Z47A 2UXBQ 2Q2IA 1Y1WG 5M3FH 1X3PA 2EXDA 3JAMi 2L15A 3MFGA 3QJYA 4DK1A 4IUTA 1XNQQ 3OWFA 5JEAH 3T13A 1DM0B 4POFA 3PO3B 1F9PA 4XT3B 2Q2UA 4FF2A 3OYYA 1Y8PB 1ZYRC 3EBEA 5M5XB 4JBMA 1STGA 2LS01 4JI8L 1TWCB 5IP9H 3HOZG 3NENA 3E3XA 4DV2Q 5A35A 1OXTA 3GTKB 5AJ3Q 4C3HG 4JG2A 1A3UA 3VR5A 4LMQD 2E75C 4C2MH 3G6JB 4KI0A 1EY4A 3VDYA 2CW0D 2ASBA 1ICWA 2WKDA 3HOVG 3H3VC 4BY7G 4OO1H 5CV9A 3RLOA 2YV5A 4JI4L 4MTKA 1D5XC 5LL6S 3MAQA 1SE2A 2MO0A 1MJEA 2EYLA 4Z9CB 3EFXD 3NXWA 3FPPA 4C3IB 1PZID 1J5EQ 1V1PA 2KCNA 3S1NB 4GN3B 3KF6B 4BBRG 1RIPA 2HHHL 1JOQA 3I4NG 4A3FB 1DD2A 4H02A 1JT8A 1RDPD 2B2YA 2YTYA 4H0LC 4MZ9A 3PGZA 3NTIA 1JB3A 1IYVA
chains in the Genus database with same CATH topology
1FNWA 4RFBA 1F2ZA 2NVTB 2F0QA 1GUOA 1X3QA 2IWHA 3N6RA 1BNZA 2K33A 4NMZA 2F0TA 3PUXA 3I4MB 2NVYB 1T5XD 1IHZA 2PNRC 2EYHA 1WTWA 1WTRA 2F0OA 2B39A 4CHTB 1SDFA 5C0XJ 4TQUS 1G91A 3WDNA 3I8ZA 4NP5A 4BS9A 5JJZA 3SK6A 3EA6A 3LWUA 4XYQA 4GZYC 2EDGA 2BDOA 3CU7A 3FPUB 2XIWA 3NWSA 2JXMB 1TQOA 4V190 5J1ZA 5JAVA 5A2QL 5IGDA 1SJED 1TWFB 3CRKC 2WACA 3PO2B 1PFNA 3BZDB 1Z7TA 4F8MA 4KKUA 2NN6G 4X3TA 5EBCA 4FNFA 3BG3A 1RODA 4B08A 4L6TB 1LV9A 2AUKA 2HDMA 1ET9A 4K8JA 2QKIC 2DNCA 2YU9B 4WRDA 2K5QA 3PIO3 2DN8A 4DGZA 1S5FD 1JC7A 3BVMA 3L3OC 3S9WA 3SK5A 1Q1BA 1BF4A 1M4VA 2AWOA 4KD3A 4R8NA 5CV6A 5FLXE 2BE5C 5KIXA 2AWNA 4KKTA 2JA6B 4LAAA 1TS5A 2JEAI 3MTSA 1MI2A 2K6AA 2KA7A 1JCKB 1F9QA 2GA4B 1DOKA 1I4RA 3DWPA 3C2PA 1RF2D 1SEBD 5I9OA 4MN3A 3BVGA 5DM63 3DM1A 3I3CA 5EBDA 2A6ED 2LMCB 1OXSC 1YNJC 5M5WB 1C48A 5CBAE 1BOSA 1C4QA 3I73A 3DEPA 2MGSA 5CV7A 2PW7A 2D2CC 1GXDC 3HEJA 2TSSA 1ESFA 3C3LA 1LT4D 2F03A 2RDGA 2OXPA 5K36H 1PYWD 1H9SA 1W6JA 2F0FA 4MHEA 3FMCA 1QOHA 1OXXK 4CJ2C 5CGKA 2B2TC 1QG7A 1BBXC 3MXGA 3KBGA 1ILPA 1ONLA 3S2HB 2YYZA 2PMZB 2RSOA 2B2WC 2RDFA 4KD4A 3Q6SA 4KV6A 2F4IA 4QMGA 3BVZA 4KY6A 1CQVA 1I50B 1CTMA 3RMHA 1DXMA 3NSWA 2K01A 3VR6A 1B50A 4X3UA 4KN4C 3D4RA 4LJZC 3T51B 5KNBA 3BYYB 1GHJA 4FXDA 2B2VA 2DNEA 2XWBB 5DEHA 1I4HA 2L55A 1K8OA 1OXVA 1DCZA 1U4LA 4ZKBB 5AFWA 3U9SA 1STAA 5EGTA 4K6DA 1SAPA 2EYFA 4IFDG 1NAPA 1AFPA 1V1PB 2M00A 1JE4A 3OIPA 3DUZA 3R93A 3GTQB 3U9OA 2Q8IB 5JVH3 1LABA 1W6KA 2IT1A 3M4OB 2IPKD 3MXPA 2EE1A 2EXZA 3SE0A 3AU7A 1I3QB 3TN2A 2WINB 3QIAA 5FKAC 2KECA 4OL7A 1EEFD 4J1MA 1EL0A 4FO2A 3CHBD 4RGNA 3Q0AA 3D3RA 2LKVA 1IYUA 5I2YA 2XRQD 3A55A 3E6ZX 2A6HC 3M4YA 2OF1A 1KNAA 4N9PA 4P2CB 1LTBD 2D62A 2F0VA 4FP5D 1Z6HA 1VMPA 1BDOA 3K5NA 5EKLA 1PRTB 2EJMA 3PUYA 2PZUA 1STNA 1SNOA 1HTPA 2PCFB 4RH6A 2X6GA 2HCCA 2K28A 2MJ8A 3DHQA 1LT6D 5KEEA 4M1UB 5IODA 5D3IB 1TT2A 3K6OA 5LHY1 1V43A 4DNTB 3KK7A 1C8CA 4ZUIA 2K5WA 4KHVA 1G2TA 2XSCA 5JOBA 1QWYA 3GTMB 3ITPA 3KUPA 1CZWA 2Y0SB 1G2SA 2L9HA 5JEAG 4IUNA 1RKNA 5CV5A 2AUJD 3TDQA 1EOTA 4DK0A 4F88A 5E4XA 5C4JB 3QOLA 5G3LD 3S2DB 3JAML 1G6ZA 4U673 1LO5D 1TU2B 1JICA 2JA7B 4OGQC 3OIQA 2Z8LA 5T1IA 5ELFA 3X3NA 2O4XA 3UI2A 1DZ1A 4PQXA 1CA6A 4OO1G 2JYOA 2N55A 4IFDJ 1VDZA 1Y1VB 2WB1B 4CKBA 1EY8A 5BN3A 1L0YB 2SNSA 2KVMA 4QCLA 2SOBA 1PTOD 2I46A 3S14B 1WCMB 2NTTA 3K0YA 2K7VA 4HCSA 1HFNA 3S16B 1SMYD 3FVQA 4RHSA 4KKSA 4HCEA 5D65A 1H9SB 1F9RA 4XIGS 4WJWA 2J4XA 2X6LA 2EY5A 1SSOA 3NBHA 1D5MC 3MHBA 3VR2A 4FXGC 2H4OA 2WIIB 3MZ5A 4DAYA 1LTGD 4ZRZA 1H9KA 2BA1A 4KY5A 4O1NA 4G7OC 3TP5A 4FXKC 4ID6A 1IKMA 2H1EA 1GUGA 1D1IA 1A2TA 4PV1C 2E2DC 3RUZA 4NDXA 3KF8A 4ABNA 2A68D 1MSGA 1BCPB 4XQJA 1O7ZA 3FEWX 1I4GA 2KHSA 4QUFA 1LTRD 1TWGB 1H9RA 2F0EA 1QB5D 5KRUA 1HRJA 1F9SA 1R4PB 2B8FA 2RKSA 1SNDA 4UDUC 1CA5A 4DAPA 5CV8A 2EJGC 5LL6X 1TWHB 2PO4A 4IURA 4IALA 2TMPA 1PTOF 3OOCA 1VF5C 3TMEA 2OT2A 4K2LA 2F1MA 4IUVA 1SNMA 5CORA 1CT1D 5JEAJ 3A7AB 1WTOA 3D4DA 1I4PA 4R8IA 3HOWB 4OIKA 2VB3X 4K6LA 4HAEA 1B9MA 3MA2B 1TIID 2D5DA 4A3JB 1V8QA 4OHJA 3LX0A 4ZLTF 4NKLA 5DAUA 5C4ZA 2ZXOA 4QF4A 4NW2A 5IT9E 1BUVT 3A7LA 1RD9D 1CZGA 1GUSA 4RGMA 5NUCA 2E76C 3GQBA 1SYGA 5E1FA 1QNUA 3HGBA 1HCZA 5CC4A 3IAYA 2KJXA 2WKCA 3IFDA 1J9OA 2EVBA 1EWHA 2A69D 1STHA 3HS0C 4X3SA 1WTQA 1EEID 3K59A 3HRZC 5K36G 3C1FA 2PPBC 3VYTA 4V0BA 1HA6A 2EYJA 3MEHA 4KJOA 5CMDA 3E5SA 4ULLA 3TZUA 4C1NK 2F0KA 5ELDA 3I70A 1EY6A 2XVSA 1KTKA 4B9XA 2Z4IA 4ILWA 3P7JA 1QJOA 1G8ZD 4C56C 1S4ZA 2CVRA 2EY1A 4K8IA 3VYRA 1UEAB 3BDCA 2F0WA 4Q0FA 1STBA 5M9OA 4ME5A 1BR9A 3KLSA 1ZYRD 2MUYA 4L63B 2EYOA 1E2VA 2F3VA 2Z4HA 4UAIA 1XWEA 2X69A 2KQ3A 3V2TA 1O80A 1NCVA 4CJ1B 1JOKA 4KY7A 1HXYD 3H94A 1I6HB 3J7AF 2F0SA 1SYFA 3HOXB 4R9WA 1T5EA 5I6YA 1SE4A 1VCIA 1A15A 1KLGD 4KN7C 1A2UA 2L11A 1EYAA 3MWYW 1ENFA 1G291 3SDZA 4K14A 4C3IG 3MXNA 4RGOS 1AEXA 2B2UC 1PRTC 3K57A 3T16A 2CHBD 1U4MA 1IW7C 4F7XA 3TSSA 2Z1CA 2IJ0A 1LTAD 1CHPD 2HQEA 1LTTD 2NWGA 4TSSA 2E74C 1ILQA 1TS3A 2V4DA 5I4DA 2ID0A 3A56A 3NQTA 1STYA 2B2TA 2JA8B 1FD7D 3A8JE 2IW3A 1H9MA 1K8MA 3F2UA 1PZJD 1FNUA 1ZKOA 2B2WA 4PMCA 4A93B 5DNFA 4OIJA 1KDAA 2L5TA 5EPLA 1EIHA 2FMCA 2O2LD 5COYA 4CKEA 3NUCA 2R93B 4H44C 4L8JA 2F3WA 3C1EA 1KAAA 3AB9A 4FVMA 4WORA 1MGSA 2EY6A 5IGEA 2F0GA 2NVXB 3CRLC 1IKLA 1R9TB 2ZT9C 1ZEQX 1SNCA 3GP7A 3S15B 2C5CA 5ISRA 1PFMA 2LY7A 1DONA 4RHRA 2ICIA 3J7AV 4BA1I 5FK9C 2BE5D 4H13C 5ELBA 2BDNA 1YNNC 1RTOA 4BBSB 3SXHA 3NPPA 4O42A 2KUMA 4DA2A 1QCBD 4J8QA 2K5DA 4ZKCB 3OSOA 4M8AA 2F0PA 1CI3M 1YNJD 2M2LA 3I90A 3J81L 3K5OA 2NB0A 3ONAB 3J80L 2VB2X 4B9WA 2QEJC 1SNPA 1QE6A 5IGGA 1BCPC 2E2IB 5KNDA 3L9AX 3OPOA 1F2YA 1GOZA 3IFTA 1TS2A 2QCPX 3IKJA 2B2VC 3VR4A 2F0MA 1FGBD 1NR4A 2JE6I 5HURA 3KLSX 1F2LA 5M5YB 2HDLA 4H7BA 4XQQA 1CHQD 5J39A 1QILA 2PQEA 2E2JB 1B1ZA 4K5WA 4EQOA 2F0UA 2ICEC 4FF3A 1B53A 3FRPB 5BN4A 1SYCA 1HQMC 1ZXTA 4A3KB 2O5IC 2SDFA 2K03A 1OXUA 4G57A 3H91A 5A2QE 1B3AA 2XRSD 3ND9A 4CGYB 1B4OA 2A5HA 1LACA 3RZDB 3SHLA 3S1RB 3PV0A 1Q12A 4BA2I 4FYDA 5C3EB 3V96A 1NUCA 3GTGB 4HN7A 5I9PA 3DWAA 5CV4A 1EY9A 1F77A 5EKKA 5IIFA 2QILA 3J7YW 4PMBA 3EVQA 1CK1A 2RDHA 3CKIB 2VUMB 3URYA 3D6CA 2F0IA 2E2HB 1EQTA 5J22A 3L7ZC 2NZ1D 4K2KA 3GTPB 4ZUJA 3R2TA 3W3AA 3H0GB 3R3OA 1SXTA 2R92B 1DOMA 1JWSD 1HUNA 1Q90A 3GV3A 1RTNA 3K58A 2J0TD 2MPMA 5EKIA 2C9OA 4XDXA 5C5LA 2JA5B 2KCCA 2A6HD 2BA0A 2HCIA 3MC0B 1HQRD 2WAQB 2FMMA 2BCOA 1Y1WB 3RD4A 4EQNA 4ZQ3A 3EQLC 3C46A 3MVVA 3SEBA 1SYBA 4XQNA 2RSNA 4C3JB 2R7ZB 3V05A 1WD1A 3ND8A 4F87A 1EU4A 3G7LA 3WOFA 1BQQT 1D5ZC 3OHXC 4JK1C 3TP7A 2M9VA 5KGUA 1XXGA 1ENCA 4RWSC 4JBWA 1D1KA 3VA5A 3M7NA 1AP0A 2CW0C 2PW5A 2D9UA 3GV6A 1Y8OB 2VXWA 2R3ZA 5G3LF 4BBRB 2RA4A 3D6WA 2DY7A 3NE5B 3T53B 1WTPA 1RHPA 1TS4A 3A8IE 2KOLA 1PMRA 1JWUD 4DU9A 3E0JA 3NBIA 4CKCA 2L4NA 3QO2A 1UNSA 3BDOA 2OEOA 2NYZD 2QDBA 2F0HA 2EYPA 2Q8RE 4HR7B 4RKBA 1PDQA 3GO5A 4KTAA 1HUMA 3J81E 4BWGB 1SYEA 3J80E 4XXEA 1JQYD 2FINB 1GUNA 4ZK9B 5C0XI 1PTOB 2IX0A 2KEEA 3TZDA 3TP8A 3SK8A 1HTLD 4EQPA 1IL8A 5CYUA 2JSOA 4C3JG 2CQAA 1O7YA 3HOUB 1E2WA 4RGTA 3OMCA 2K04A 4LK1C 2K05A 2HUGA 5E3FA 4A3EB 3VA7A 1U4RA 3WOEA 1MBYA 1GUTA 3Q23A 2F0JA 4S3SA 3X3MA 5FO7B 5KNCA 3LWEA 1I6VC 3QWNA 1I4XA 4C1NI 3CQZB 3H6MA 4AYBB 2PYKA 5C3XA 1ENAA 3BYTB 3ZYYX 2K32A 1EWCA 3S1MB 1UAPA 5FO8B 2R61A 1VMCA 1FNVA 4KJNA 1S5CD 3OMGA 2SEBD 4HSVA 3T56B 3SK4A 1SBBB 5K5PA 1EQVA 1EU3A 2EOTA 4KHZA 1SNQA 1NR2A 2WV6D 5BN5A 3IL8A 4XYOA 5CR3A 3FDTA 4RCOA 1A3TA 1M8AA 3NTKA 3QB3A 1EYCA 5I2XA 4IUPA 2EJFC 2L1BA 5EJWA 2EPBA 2FFKB 4QIWB 1EZ8A 2B2YC 5C0XH 2G9HD 3NK9A 2SNMA 2ENBA 2MHVA 1PFBA 5FOBB 4EVOA 2A6EC 5D14A 1B9NA 3JAME 2QF7A 4CBVA 1AW7A 2B2UA 1JR0D 3D31A 4TKOB 3MFYA 3PMFA 3W2DA 4IN3A 1MSHA 2EY2A 2K1BA 1EY0A 1S5BD 1Q1EA 2IX1A 2FHTA 3GTOB 1RCVD 1Y8NB 3SVMA 4YIJA 4IUQA 4RAUC 4BY1B 3NP8A 1JOOA 1KDBA 1EYDA 3K5MA 4K5XA 1B2TA 3EROA 1U4PA 3FKIB 4DF7A 1KDCA 1SFOB 2F0DA 3OWEB 5E4WC 1J8IA 2PZTA 3HKZB 2NVQB 4G7HC 5C3WA 1S5ED 1V1OA 1DJRD 3GTJB 4N9TA 2IX3A 4G7ZC 2AQ3B 2NN6I 2B63B 5IGBA 1CQFA 3A54A 1Q3LA 1ESRA 4RCNA 1HFGA 3VR3A 5EQ0A 3S1QB 3R2IA 1EY5A 1Q8IA 3BS1A 1AN8A 5F2DA 3O13A 4IUUA 2EYMA 4Y7NB 1PXUA 4ZAIA 4U68A 1KLUD 1KNEA 1L0XB 4J6HA 2B8GA 3QOJA 3PUZA 1TVXA 3HOYB 4A3GB 1LTSD 4ODGA 2XN9C 1A3VA 2NTSA 3T4AC 1TKWB 1MD2D 1PRTD 1EZ6A 2KEDA 3DEOA 2ZXRA 1TY0A 2JP1A 4K5VA 1IW7D 1TY2A 4QUCA 1PTOH 4I7ZC 3A8KE 1NSNS 3P75A 1I4QA 2RQXA 3I91A 1QNKA 5C5MA 1JORA 1F2MA 2XNAC 3Q22A 3D8GA 5JPNC 4QB4A 3M3YB 5IGFA 1EIGA 1TR5A 2NN6H 1AZPA 1AZQA 2A73B 4TRDA 5M3FB 2N88A 3NQIA 5FO9B 1H9JA 1SE3A 1GHKA 5IOCA 3EJIA 1BO0A 2L0CA 3HG9A 3TBIB 5KYIA 5KYLA 5M3MB 1O7LA 3NWTA 5IGCA 1WVLA 1R4QB 3PUWA 4PNYA 3ERQA 4FF1A 3VYUA 5JVG3 5D3DA 4C2MB 3AMUA 1D6EC 2EZVA 1EY7A 5IT9L 3GD7A 2VNUD 1HHVA 1GJXA 1HPCA 2ZXPA 1PRTF 3DWQA 4DFAA 1XYIA 4DXGA 3N52A 3P20A 5TSSA 1XX8A 1GUWA 4DN4M 1U9RA 2IL8A 4IFDI 1PTOC 3M85A 2JEBI 2Q8TA 5I6WA 1SMYC 2G9DA 1K83B 1PLFA 1YNND 3OW7A 4A3BB 1ET6A 1JWMD 3H09A 2RBMA 4G4KA 1FR3A 3HP3A 4MIUA 1X32A 4FF4A 4HTHA 1EFID 2O5JC 1FYCA 4Q5VA 1OO9B 4XT1B 3QG1A 1ML0D 1WD0A 1BCPD 3HZXA 3KLRA 1WTXA 5HGTA 4A3DB 3RZOB 3DXJC 2R6GA 2F0LA 1II3A 1E0BA 4PMWA 4X3KA 2A68C 5EPKA 1SYDA 2LFNA 1BXTA 1LT3D 3M7GA 2XWJB 3NHHA 2BOSA 1CFMA 4KMUC 4DNRB 1PZKD 5C4XB 1TWAB 3TP6A 4HEDA 1LT5D 5JPMC 2AQ1B 4IFDH 2L12A 3VYSA 3PIP3 1LLRD 3K5LA 4I65A 4DAVA 1A6XA 1D2BA 5C4HA 4HMJA 2A74C 2RVLA 3HOZB 5DM73 2F0NA 3S17B 2MP1A 3DMUA 4C3HB 4XTCS 1SJHD 1DOLA 1E2ZA 3Q24A 4DXFA 1HA5A 3I4LA 3HOVB 4BY7B 1KABA 4IQZA 3GTLB 5FLXL 2J7ZA 4IZ8A 3D4WA 4HSPA 1S5DD 1DYQA 4CJ0B 1BCPF 1WTVA 5CBEE 3K7AB 2DY8A 3P1HA 5C0XG 2WP8J 3I4NB 1RJTA 4OO1I 2NUCA 3RLFA 1O78A 3BDLA 5ELCA 3R8BA 5EPJA 1LTID 1XTCD 5ELEA 2FJ2A 4RKLA 3I72A 4HMIA 3LNNA 3PUVA 4ZYSA 2A69C 2PZWA 1Y69U 3MXUA 4WFN3 1CM9A 4E6IA 4EGVA 3KBXA 2NBFA 1UUPA 4RA8A 5C44B 4A3MB 2AQ2B 3NTHA 5T1GA 4A3IB 3SR1A 1STEA 2I07B 5C6AA 4KK7A 1B44D 1Z47A 1X3PA 3MFGA 3QJYA 4DK1A 4IUTA 3OWFA 5JEAH 3T13A 1DM0B 3PO3B 1F9PA 4XT3B 4FF2A 1Y8PB 1ZYRC 5M5XB 1STGA 2LS01 1TWCB 5A35A 1OXTA 3GTKB 4C3HG 1A3UA 3VR5A 4LMQD 2E75C 3G6JB 4KI0A 1EY4A 2CW0D 1ICWA 2WKDA 4OO1H 3H3VC 5CV9A 1D5XC 5LL6S 3MAQA 1SE2A 2EYLA 4Z9CB 3EFXD 3NXWA 3FPPA 4C3IB 1PZID 1V1PA 2KCNA 3S1NB 1JOQA 4A3FB 1DD2A 1RDPD 2B2YA 4H0LC 1VF7A 3NTIA 1JB3A 1IYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 L;  5A2Q L;  5FLX L;  5IT9 L;  3J81 L;  3JAM L;  5LL6 X;  3J7A V; 
#chains in the Genus database with same CATH topology
 1FNW A;  3TQY A;  4GKK L;  3JC6 6;  4RFB A;  1PYB A;  3DLL A;  1F2Z A;  1VQL A;  4A3B H;  2NVT B;  2F0Q A;  1KC8 C;  1GUO A;  1X3Q A;  1YJN A;  1UWV A;  2IWH A;  3N6R A;  1BNZ A;  2K33 A;  2MFI A;  4NMZ A;  1O7I A;  2F0T A;  3PUX A;  1N36 L;  3I4M B;  2NVY B;  2JJQ A;  1M1K C;  5C44 G;  1T5X D;  1IHZ A;  2PNR C;  4A3M G;  2EYH A;  1WTW A;  1WTR A;  2F0O A;  1PH4 A;  2B39 A;  4CHT B;  1SDF A;  5C0X J;  3A74 A;  4A3I G;  4TQU S;  1G91 A;  2JA9 A;  3I8Z A;  4NP5 A;  3WDN A;  4BS9 A;  5JJZ A;  2F4V L;  3SK6 A;  3EA6 A;  1K3R A;  1EQR A;  3LWU A;  4XYQ A;  4A3D H;  4GZY C;  2EDG A;  3GTM H;  2BDO A;  2IHF A;  3CU7 A;  3FPU B;  3RZO H;  2XIW A;  3NWS A;  2JXM B;  1TQO A;  1HZB A;  4V19 0;  5J1Z A;  5JAV A;  1XNR L;  2K5V A;  5A2Q L;  2LXJ A;  3AEV A;  5IGD A;  3PO3 G;  1SJE D;  5FLM H;  1TWF B;  3CRK C;  2WAC A;  1MIU A;  2OTL A;  5C4J H;  3PO2 B;  1PFN A;  3BZD B;  3S2D H;  1HNZ Q;  5LMN L;  1Z7T A;  4DNI A;  1YI2 A;  4F8M A;  4KKU A;  1TWA H;  2NN6 G;  1CKN A;  4X3T A;  4AH6 A;  4B3T Q;  1CSP A;  2VS1 A;  5EBC A;  4ALP A;  4FNF A;  1WYD A;  3BG3 A;  4DK6 C;  1ROD A;  4B08 A;  4L6T B;  1LV9 A;  1VQ8 A;  2AUK A;  4A3L G;  5JJL A;  4YWM A;  2CKZ B;  1YVC A;  4KHP L;  2Z6K A;  2HDM A;  4DKA C;  1X56 A;  1ET9 A;  3RNU A;  1Z9F A;  4K8J A;  2QKI C;  3BU2 A;  2DNC A;  3KLW A;  2YU9 B;  4JI6 L;  4WRD A;  3I55 A;  2K5Q A;  4I7A A;  3PIO 3;  2DN8 A;  4JI0 L;  4A3F G;  1VQD A;  3S17 H;  4DGZ A;  1S5F D;  1JC7 A;  3BVM A;  3L3O C;  1HZC A;  3S9W A;  3SK5 A;  4X65 Q;  4DUZ Q;  1Q1B A;  1BF4 A;  1GM5 A;  1NTG A;  1M4V A;  2AWO A;  1PH8 A;  3ICE A;  4KD3 A;  4R8N A;  1IBM Q;  4R4T A;  5CV6 A;  5FLX E;  1LYL A;  1I5F A;  2BE5 C;  4LF6 Q;  5KIX A;  2AWN A;  4KKT A;  3HOV H;  4BY7 H;  2JA6 B;  4LAA A;  1TS5 A;  1JB7 A;  2JEA I;  3MTS A;  1PH2 A;  1MI2 A;  2K6A A;  2KA7 A;  1EQQ A;  1JCK B;  1F9Q A;  2GA4 B;  1DOK A;  4DR3 L;  1I4R A;  3DWP A;  3I4M G;  3K7A H;  3C2P A;  1RF2 D;  1SEB D;  1J6Q A;  5I9O A;  4MN3 A;  4QGU A;  1VQ5 A;  3BVG A;  5DM6 3;  1WI5 A;  3DM1 A;  3I3C A;  5EBD A;  2MNA A;  2A6E D;  2AHO B;  2LMC B;  1N9W A;  4FDB A;  1OXS C;  1YNJ C;  5M5W B;  1C48 A;  5CBA E;  2MO1 A;  4HIM A;  2ZJP A;  1BOS A;  1C4Q A;  3I73 A;  3J7A 5;  3DEP A;  2MGS A;  5CV7 A;  2PW7 A;  2D2C C;  1JJG A;  1GXD C;  3HEJ A;  3PF5 A;  2TSS A;  1ESF A;  3C3L A;  1LT4 D;  1K0R A;  2F03 A;  2RDG A;  2OXP A;  1HNW Q;  5K36 H;  1PYW D;  1H9S A;  1W6J A;  4DR2 L;  2F0F A;  4MHE A;  3FMC A;  1KIX A;  1QOH A;  2CWP A;  5IYB H;  1OXX K;  4CJ2 C;  3CC2 A;  5CGK A;  4NXM L;  2B2T C;  1QG7 A;  1BBX C;  3MXG A;  5C44 H;  3KBG A;  1SE8 A;  2WAQ E;  4A3M H;  1AE2 A;  1TXY A;  1ILP A;  1ONL A;  3S2H B;  2GN5 A;  1N32 Q;  2YYZ A;  3PO2 G;  2PMZ B;  2RSO A;  4B3S Q;  4N8F A;  2B2W C;  2CH4 A;  2RDF A;  4KD4 A;  3TS0 A;  5L37 A;  4A76 A;  3Q6S A;  4KV6 A;  1P8L A;  2F4I A;  4QMG A;  1VQ7 A;  3BVZ A;  4KY6 A;  1NJI C;  1CQV A;  1I50 B;  1CTM A;  3RMH A;  1DXM A;  3NSW A;  3RLN A;  2K01 A;  3VR6 A;  1B50 A;  4X3U A;  2KBN A;  4KN4 C;  3D4R A;  4LJZ C;  2ZTE A;  1E24 A;  4UHV A;  4BY7 B;  1FGU A;  3PO3 H;  2RF4 A;  3T51 B;  5KNB A;  2VZA A;  3AYH B;  3BYY B;  3FKI G;  1GHJ A;  4FXD A;  4JI8 Q;  2B2V A;  2A1A A;  2DNE A;  4LF5 L;  1MKH A;  2XWB B;  3UDF A;  5DEH A;  4A3J H;  1E3P A;  1I4H A;  2L55 A;  1K8O A;  1OXV A;  1DCZ A;  4DR5 L;  1U4L A;  4ZKB B;  5AFW A;  4GLA C;  3U9S A;  1STA A;  5IYD G;  5EGT A;  4K6D A;  4A3L H;  1SAP A;  1A63 A;  4JI4 Q;  2EYF A;  4HID A;  1M90 C;  3STB C;  4IFD G;  1NAP A;  1AFP A;  1V1P B;  2M00 A;  1VQI A;  3ER0 A;  4C3I H;  1JE4 A;  3OIP A;  3DUZ A;  2HT1 A;  3R93 A;  3GTQ B;  4O2D A;  3U9O A;  2Q8I B;  5JVH 3;  1HR0 W;  2HHH Q;  4A3F H;  1LAB A;  1ICF B;  2QW7 A;  1W6K A;  1L0W A;  2IT1 A;  1HZA A;  3M4O B;  3CPW A;  2A8V A;  2IPK D;  3MXP A;  2EE1 A;  2EXZ A;  4GKK Q;  3SE0 A;  1PH6 A;  3AU7 A;  1I3Q B;  1PFS A;  3SGI A;  3TN2 A;  2WIN B;  3QIA A;  2NVT H;  5FKA C;  4X64 L;  2KEC A;  2VY3 A;  5IT9 c;  1NMF A;  3LGJ A;  1QVC A;  4OL7 A;  4UP8 A;  1EEF D;  1SRO A;  2HQL A;  4J1M A;  1EL0 A;  1N36 Q;  3I4M H;  4FO2 A;  3HOY G;  3CHB D;  4RGN A;  2NVY H;  3RN2 A;  3Q0A A;  3D3R A;  2LKV A;  3H15 A;  1NY4 A;  1IYU A;  2KEN A;  5I2Y A;  2XRQ D;  3A55 A;  3E6Z X;  3U4V A;  2A6H C;  3M4Y A;  2OF1 A;  1KNA A;  1SMX A;  4N9P A;  2F4V Q;  3NEL A;  4P2C B;  3CME A;  1LTB D;  2D62 A;  2F0V A;  4FP5 D;  1Z6H A;  1VMP A;  1BDO A;  3K5N A;  5EKL A;  4LFB L;  1PRT B;  2EJM A;  3PUY A;  2K75 A;  1XNR Q;  2PZU A;  1STN A;  4OEM B;  1SNO A;  1HTP A;  2PCF B;  4L5Q A;  4RH6 A;  2X6G A;  2HCC A;  2K28 A;  2MJ8 A;  4QJF A;  4X62 L;  3E9H A;  3DHQ A;  1LT6 D;  5KEE A;  3KJP A;  5H1S E;  1TWF H;  4M1U B;  1YZ6 A;  5IOD A;  5D3I B;  1TT2 A;  2RCN A;  1CSQ A;  5LMN Q;  3K6O A;  1CKN B;  5LHY 1;  1V43 A;  4DNT B;  3KK7 A;  1C8C A;  4YY3 L;  4JBK A;  4ZUI A;  2K5W A;  4KHV A;  1G2T A;  1YBY A;  2XSC A;  5JOB A;  2N8N A;  1QWY A;  5M3F G;  4AYB E;  3GTM B;  4KHP Q;  3ITP A;  1OTC A;  1U0L A;  3KUP A;  1CZW A;  2Y0S B;  1G2S A;  2L9H A;  1B8A A;  5JEA G;  4IUN A;  1RKN A;  5CV5 A;  4JI6 Q;  2AUJ D;  3TDQ A;  3WWV A;  1EOT A;  4P75 A;  2HIV A;  4JI0 Q;  4DK0 A;  4F88 A;  3PF4 A;  5E4X A;  5C4J B;  3QOL A;  5G3L D;  2YTV A;  5IP9 G;  5IYC G;  3S2D B;  3JAM L;  1G6Z A;  4U67 3;  1LO5 D;  1TU2 B;  1JIC A;  2JA7 B;  4RMF A;  3J80 i;  4HJ5 A;  1X3G A;  4OGQ C;  3OIQ A;  5IYD H;  1LUZ A;  2Z8L A;  1YHA A;  5T1I A;  5ELF A;  3X3N A;  1E22 A;  1IXR A;  2O4X A;  3UI2 A;  2JA6 H;  4PQX A;  1D8L A;  1CA6 A;  1PH9 A;  1DZ1 A;  3RN5 A;  4OO1 G;  4QIW E;  2JYO A;  2N55 A;  4IFD J;  1VDZ A;  1Y1V B;  2C35 B;  2WB1 B;  4CKB A;  4DR3 Q;  1EY8 A;  5BN3 A;  1EIF A;  1L0Y B;  2SNS A;  3BJU A;  2KVM A;  2JA8 H;  4KLK A;  4QCL A;  2SOB A;  1PTO D;  1KXL A;  2I46 A;  3S14 B;  1HH2 P;  1K9M C;  1WCM B;  2NTT A;  5M5W H;  3K0Y A;  2K7V A;  4HCS A;  1HFN A;  3S16 B;  3M9B A;  1SMY D;  2I5M X;  3FVQ A;  4RHS A;  4KKS A;  4HCE A;  5D65 A;  1H9S B;  4PG3 A;  5FLX c;  4A3C H;  4DR2 Q;  3CD6 A;  1UE5 A;  1F9R A;  1VQH A;  4WJW A;  4XIG S;  2J4X A;  4LWC A;  2X6L A;  2EY5 A;  2K50 A;  1SSO A;  3NBH A;  4NXM Q;  1D5M C;  3MHB A;  3VR2 A;  4FXG C;  2H4O A;  2WII B;  3MZ5 A;  3CCS A;  5IWA L;  4R4O A;  1NNX A;  4DAY A;  1LTG D;  4ZRZ A;  1H9K A;  3S24 A;  3K7U C;  2ZJQ A;  2BA1 A;  2K5H A;  3S2H H;  4KY5 A;  4MTN A;  4O1N A;  3J7Z C;  4G7O C;  4DV6 L;  3TP5 A;  4FXK C;  1VQB A;  4ID6 A;  1IKM A;  2H1E A;  1GUG A;  1D1I A;  1A2T A;  2WFW A;  4PV1 C;  1KRT A;  2E2D C;  3RUZ A;  4NDX A;  3KF8 A;  4ABN A;  2A68 D;  1MSG A;  2GVB A;  3CMA A;  1BCP B;  4XQJ A;  1O7Z A;  3FEW X;  2Y0S G;  1I4G A;  2KHS A;  4QUF A;  1LTR D;  1FVI A;  1TWG B;  1H9R A;  3HKZ E;  2F0E A;  2CFM A;  1QB5 D;  1VQE A;  1VQM A;  4GKJ L;  5KRU A;  5FLM G;  4JVZ A;  1HRJ A;  4LF5 Q;  1F9S A;  1R4P B;  2B8F A;  2RKS A;  1SND A;  4UDU C;  2A19 A;  4DR5 Q;  1CA5 A;  4DAP A;  5CV8 A;  4YCV A;  1C7Y A;  2ALY B;  2EJG C;  5LL6 X;  2JA7 G;  1TWH B;  2PO4 A;  1MJC A;  4IUR A;  3CCL A;  4IAL A;  4UY8 C;  2TMP A;  1PTO F;  3OOC A;  1VF5 C;  3TME A;  2OT2 A;  4K2L A;  2F1M A;  4IUV A;  1SNM A;  1Y1V G;  2WB1 G;  4IOA A;  5COR A;  1CT1 D;  5JEA J;  3A7A B;  4LF4 L;  3M4P A;  1WTO A;  3D4D A;  3GTQ H;  2AMC B;  1I4P A;  4R8I A;  3HOW B;  4OIK A;  2VB3 X;  4K6L A;  4HAE A;  1PHJ A;  1B9M A;  1WCM G;  1TII D;  3MA2 B;  2VQE L;  5IYC H;  3M4O H;  2D5D A;  4A3J B;  1V8Q A;  4OHJ A;  4DV7 L;  3LX0 A;  4O0A A;  1I3Q H;  4ZLT F;  4NKL A;  1VQF A;  3IRB A;  1VS0 A;  4X64 Q;  1V1Q A;  2RHS B;  5DAU A;  5C4Z A;  2ZXO A;  4QF4 A;  4NW2 A;  2E8G A;  5IT9 E;  1BUV T;  3A7L A;  4GLX A;  1RD9 D;  1CZG A;  1GUS A;  4RGM A;  5NUC A;  4HIK A;  3CPF A;  4R1J A;  2E76 C;  3GQB A;  1SYG A;  5E1F A;  1QNU A;  3HGB A;  4DR6 L;  1HCZ A;  1S3O A;  5CC4 A;  3IAY A;  3KDF B;  2KJX A;  2WKC A;  3IFD A;  4GOP A;  1J9O A;  4JI2 L;  3I2Z A;  2EVB A;  2QGQ A;  3G6E A;  1EWH A;  2A69 D;  1STH A;  3HS0 C;  4X3S A;  1WTQ A;  4LFB Q;  1EEI D;  4GN5 A;  3K59 A;  1XPO A;  3F2B A;  3HRZ C;  5K36 G;  3HFZ B;  1LM0 A;  3C1F A;  2PPB C;  1N34 L;  5IYB G;  4JW0 A;  4X62 Q;  3VYT A;  4V0B A;  1HA6 A;  2EYJ A;  3MEH A;  4KJO A;  5CMD A;  1VQ6 A;  3E5S A;  4ULL A;  3TZU A;  3CCV A;  4C1N K;  2F0K A;  5ELD A;  1AE3 A;  3I70 A;  1EY6 A;  2XVS A;  1KTK A;  3GTG H;  4B9X A;  2Z4I A;  1EOV A;  4YY3 Q;  4ILW A;  3P7J A;  1QJO A;  1G8Z D;  4C56 C;  1S4Z A;  2PQA A;  4IJH A;  2CVR A;  2EY1 A;  2OWO A;  4K8I A;  3VYR A;  1Q46 A;  2B3G A;  1UEA B;  3BDC A;  2F0W A;  4Q0F A;  3CCR A;  1STB A;  5M9O A;  4ME5 A;  3A5Z B;  1BR9 A;  3KLS A;  1X3F A;  1ZYR D;  2MUY A;  4L63 B;  2OQK A;  2EYO A;  4JCV E;  1E2V A;  2F3V A;  2Z4H A;  4UAI A;  3HOW G;  1XMQ L;  1XWE A;  2X69 A;  2KQ3 A;  3V2T A;  1O80 A;  1NCV A;  3KYH C;  2F52 A;  1HR0 L;  2P5Z X;  3CCJ A;  4CJ1 B;  1JOK A;  4KY7 A;  4A3J G;  1HXY D;  3H94 A;  3A0J A;  2JA7 H;  1I6H B;  3J7A F;  2F0S A;  1SYF A;  3HOX B;  4R9W A;  1T5E A;  5I6Y A;  1W2B A;  4OON A;  1SE4 A;  1VCI A;  3FP9 A;  1QVG A;  1A15 A;  3TS2 A;  1Y1V H;  1KLG D;  3RR5 A;  4KN7 C;  1A2U A;  4MNO A;  2VW9 A;  2L11 A;  3EIV A;  1EYA A;  3MWY W;  1ENF A;  5IY0 A;  1G29 1;  3SDZ A;  4K14 A;  4C3I G;  3MXN A;  4LF8 L;  2XGT A;  4RGO S;  4JOI A;  3S14 H;  1DGS A;  1WCM H;  1AEX A;  2B2U C;  5J3B A;  1PRT C;  3S16 H;  3K8A A;  3K57 A;  1PVO A;  4LFC L;  5DLQ E;  3T16 A;  2CHB D;  1N33 L;  1U4M A;  2UXD L;  1IW7 C;  1E7Z A;  4F7X A;  3TSS A;  3G4S A;  3CP0 A;  2Z1C A;  2IJ0 A;  1LTA D;  4C3J H;  1CHP D;  2HQE A;  2R7Z H;  4ZCK A;  1LTT D;  3NBH B;  1WFQ A;  4QL5 A;  3ULJ A;  2NWG A;  4TSS A;  2E74 C;  1K3B C;  1ILQ A;  1TS3 A;  2OQ0 A;  5IWA Q;  2V4D A;  4LF7 L;  5I4D A;  1A8V A;  2ID0 A;  3A56 A;  4PZ7 A;  4CDF C;  1BVS A;  3NQT A;  3PSI A;  1STY A;  2B2T A;  2DGY A;  2JA8 B;  1FD7 D;  3A8J E;  2IW3 A;  2Z6K C;  1H9M A;  4DV6 Q;  2Z6B A;  1K8M A;  3F2U A;  1PZJ D;  1FNU A;  1ZKO A;  2B2W A;  4X66 L;  4PMC A;  4A93 B;  3KF8 B;  5DNF A;  4JC0 A;  4OIJ A;  1G6P A;  3T1Y L;  2CWA A;  1KDA A;  2L5T A;  5EPL A;  1EIH A;  2ZTC A;  4DUY L;  2FMC A;  4HJA A;  1X6O A;  2O2L D;  5COY A;  4CKE A;  2CH4 W;  1YHQ A;  3NUC A;  2R93 B;  1TWG H;  3ERS X;  4H44 C;  1IBL L;  4QQB X;  4GKJ Q;  4L8J A;  2F3W A;  1BBW A;  3C1E A;  1KAA A;  5FJ8 H;  3AB9 A;  3CCM A;  4A75 A;  4YHH L;  4FVM A;  4WOR A;  1MGS A;  2EY6 A;  5HY6 A;  5IGE A;  1TWH H;  2F0G A;  4JI1 L;  3HOX G;  2NVX B;  3FHW A;  3MEF A;  3CRL C;  1IKL A;  3PIP A;  1R9T B;  2VQF L;  2ZT9 C;  1QZH A;  1ZEQ X;  1SNC A;  3GP7 A;  2UUB L;  4LF4 Q;  3S15 B;  3F2D A;  2C5C A;  4JV5 L;  3HOW H;  5ISR A;  1PFM A;  2LY7 A;  2VQE Q;  1DON A;  4RHR A;  2ICI A;  3UDG A;  3J7A V;  3M4Q A;  4DV7 Q;  4BA1 I;  1PH7 A;  5FK9 C;  2BE5 D;  2IY5 B;  4H13 C;  1WTH A;  1YJ9 A;  1VQN A;  5ELB A;  2BDN A;  1MHW C;  1YNN C;  2ZJR A;  1RTO A;  4BBS B;  3SXH A;  3NPP A;  4O42 A;  2KUM A;  2JA6 G;  3HKS A;  1PYS B;  4DA2 A;  3OTO L;  1QCB D;  4J8Q A;  2K5D A;  4ZKC B;  3CF5 A;  2K52 A;  3OSO A;  4M8A A;  2Q2T A;  2F0P A;  1CI3 M;  1YNJ D;  2M2L A;  3I90 A;  3J81 L;  4A3E H;  4PZ8 A;  4DR6 Q;  1B7Y B;  2JA8 G;  4Y52 H;  2UUA L;  3K5O A;  2NB0 A;  3ONA B;  3J80 L;  4GOP B;  2VB2 X;  4B9W A;  2QEJ C;  1X55 A;  1SNP A;  1QE6 A;  5IGG A;  4JI2 Q;  1BCP C;  2E2I B;  1K8G A;  1JJC B;  1PV4 A;  5KND A;  3L9A X;  3OPO A;  1F2Y A;  1KRS A;  1GOZ A;  3IFT A;  4HJ9 A;  1XNQ L;  1TS2 A;  2QCP X;  3IKJ A;  2B2V C;  3VR4 A;  1I94 L;  2F0M A;  1FGB D;  4A3C G;  1NR4 A;  2JE6 I;  4JBJ A;  5HUR A;  3KLS X;  4YCU A;  1N34 Q;  1F2L A;  5M5Y B;  2R93 G;  2HDL A;  4H7B A;  4IJL A;  4XQQ A;  1CHQ D;  5J39 A;  1QIL A;  2PQE A;  2E2J B;  1B1Z A;  4K5W A;  4EQO A;  2F0U A;  2ICE C;  4FF3 A;  1B53 A;  4JI3 L;  3FRP B;  2PQA B;  5BN4 A;  1SYC A;  1PH3 A;  2NZH A;  4DV4 L;  1HQM C;  1ZXT A;  3K81 C;  3UE1 A;  4A3K B;  2O5I C;  1L2F A;  3PCO B;  1SRU A;  2SDF A;  2K03 A;  1OXU A;  4G57 A;  3H91 A;  1GO3 E;  5A2Q E;  1B3A A;  2XRS D;  3ND9 A;  4CGY B;  1B4O A;  2A5H A;  1LAC A;  3RZD B;  3SHL A;  3S1R B;  3PV0 A;  1X3E A;  2HD3 A;  1Q12 A;  1XMQ Q;  4BA2 I;  4FYD A;  3KOJ A;  5C3E B;  1HR0 Q;  3V96 A;  1Q7Y C;  1SR3 A;  2OTJ A;  1NUC A;  2DJF C;  2QDL A;  3GTG B;  4HN7 A;  1I6H H;  5I9P A;  3DWA A;  3HOX H;  5CV4 A;  1EY9 A;  3STB D;  1F77 A;  5EKK A;  1EIY B;  1K0S A;  5IIF A;  2N78 A;  2QIL A;  4BBS G;  3J7Y W;  4PMB A;  3EVQ A;  1Q81 C;  4JI5 L;  1CK1 A;  3MXN B;  3TEH B;  4B3R L;  3L2P A;  1HNX L;  2RDH A;  3CKI B;  4LF8 Q;  2VUM B;  2R7F A;  3T1H L;  3URY A;  3D6C A;  2F0I A;  2R7D A;  2E2H B;  1EQT A;  5J22 A;  1H95 A;  3L7Z C;  4LW1 A;  2NZ1 D;  4K2K A;  3UE0 A;  4BY1 H;  3GTP B;  4ZUJ A;  3JAM c;  3R2T A;  4LFC Q;  1IZ6 A;  3H3V I;  3W3A A;  3H0G B;  3F1Z A;  1N33 Q;  2UXD Q;  3R3O A;  3L0O A;  3AQQ A;  1SXT A;  1L1O A;  2R92 B;  1DOM A;  1JWS D;  1HUN A;  1Q90 A;  3GV3 A;  1RTN A;  3K58 A;  2J0T D;  2LXK A;  4GNX A;  5EAY A;  2MPM A;  5EKI A;  4LF7 Q;  2C9O A;  4XDX A;  5C5L A;  2JA5 B;  2KCC A;  4L5R C;  2A6H D;  4CDD C;  2BA0 A;  2HCI A;  2KCM A;  3MC0 B;  1HQR D;  2WAQ B;  3PQI A;  2UUC L;  2FMM A;  4RG1 A;  2BCO A;  1Y1W B;  4WJ4 A;  2UXC L;  3RD4 A;  4EQN A;  4OWW B;  1E1O A;  4X66 Q;  4NPS A;  4A93 H;  2I5L X;  4ZQ3 A;  2ZTD A;  3EQL C;  3T1Y Q;  1YIJ A;  4X6A H;  3C46 A;  1EUJ A;  3MVV A;  4DUY Q;  3SEB A;  4A3K G;  1WJJ A;  1SYB A;  4XQN A;  2RSN A;  4C3J B;  2R7Z B;  3V05 A;  1WD1 A;  3ND8 A;  4F87 A;  4HJ7 A;  1EU4 A;  4OX9 L;  2R93 H;  1IBL Q;  3G7L A;  1VQA A;  3WOF A;  1BQQ T;  2OCE A;  1D5Z C;  1GD7 A;  1VQJ A;  3OHX C;  4JK1 C;  4DV3 L;  3TP7 A;  1IYJ B;  1A62 A;  2M9V A;  4YHH Q;  4Y7N H;  5KGU A;  3KFU A;  1XXG A;  1ENC A;  4RWS C;  4JI1 Q;  4JBW A;  4POG A;  1D1K A;  2BH2 A;  1E1T A;  3VA5 A;  2NVX H;  3M7N A;  2HIX A;  4DV0 L;  1AP0 A;  2CW0 C;  2PW5 A;  2D9U A;  2VQF Q;  1R9T H;  3GV6 A;  1Y8O B;  2VXW A;  2R3Z A;  5G3L F;  3W1G A;  1S40 A;  5BR8 L;  4BBR B;  2RA4 A;  2UUB Q;  3D6W A;  2DY7 A;  3S15 H;  3NE5 B;  3PIO A;  4JV5 Q;  2CQO A;  3T53 B;  4BXX H;  1WTP A;  2ZM6 L;  1RHP A;  1TS4 A;  3A8I E;  2KOL A;  1EYG A;  1PMR A;  1JWU D;  4B3M L;  4DU9 A;  3OW2 A;  4R4I A;  3E0J A;  3NBI A;  4CKC A;  5LMU L;  2L4N A;  3QO2 A;  1UNS A;  3BDO A;  2OEO A;  4OWX B;  2NYZ D;  2QDB A;  2F0H A;  4BBS H;  1QZG A;  1V9P A;  2XTI A;  1KAW A;  5IP7 H;  2EYP A;  1SLJ A;  4ME3 A;  2Q8R E;  2DUD A;  3OTO Q;  4HR7 B;  4RKB A;  4YCW A;  1K73 C;  1PDQ A;  3GO5 A;  1W3S A;  4KTA A;  4CDE C;  1ASZ A;  2CCZ A;  1XTD A;  2JA5 G;  1HUM A;  3J81 E;  4BWG B;  1SYE A;  4P74 A;  3J80 E;  4XXE A;  2WAQ G;  1JQY D;  2UUA Q;  2JK8 A;  5HGQ A;  4N8X 1;  2FIN B;  2N3S A;  1P16 A;  1GUN A;  2D0P A;  3K0X A;  4ZK9 B;  2E2I H;  2Z9H A;  4NXN L;  5C0X I;  1PTO B;  2PNH A;  2IX0 A;  2KEE A;  3TZD A;  3TP8 A;  3SK8 A;  5JJK A;  1HTL D;  4EQP A;  1IL8 A;  1I94 Q;  5CYU A;  2E5L L;  2JSO A;  4CDC C;  5M3M H;  4C3J G;  2R7Z G;  3KJO A;  2CQA A;  1O7Y A;  1JJ2 A;  5M5Y H;  3HOU B;  1E2W A;  4RGT A;  2PMZ E;  3OMC A;  2K04 A;  4LK1 C;  1BKB A;  2E2J H;  2K05 A;  2HUG A;  5ELO A;  4DK3 C;  5E3F A;  3CAM A;  4A3E B;  3VA7 A;  4JI3 Q;  1U4R A;  1UE7 A;  3WOE A;  1MBY A;  1GUT A;  4K0K L;  1VQP A;  1CUK A;  3Q23 A;  2F0J A;  4S3S A;  3X3M A;  5FO7 B;  3BZC A;  4DV4 Q;  5KNC A;  2BH8 A;  3LWE A;  1I6V C;  3QWN A;  1I4X A;  5E7N A;  3CQZ B;  3UDI A;  4C1N I;  4A3K H;  3H6M A;  4R4C A;  4AYB B;  2PYK A;  3CW2 C;  5C3X A;  1ENA A;  3BYT B;  3ZYY X;  1FJG L;  2K32 A;  1EWC A;  3S1M B;  1UAP A;  5FO8 B;  3RZD H;  3S1R H;  2R61 A;  1VMC A;  1FNV A;  4KJN A;  1S5C D;  2I5H A;  3OMG A;  2SEB D;  4HSV A;  3T56 B;  4YWL A;  5C3E H;  3SK4 A;  1SBB B;  5K5P A;  1S72 A;  5FJ8 G;  1EQV A;  1K83 H;  1EU3 A;  2EIF A;  2EOT A;  4KHZ A;  1SNQ A;  4UP7 A;  1NR2 A;  4IPG A;  4DR7 L;  1VQG A;  2WV6 D;  5BN5 A;  1B70 B;  3IL8 A;  4XYO A;  5CR3 A;  3W5O A;  1Q86 C;  1KHI A;  3FDT A;  4RCO A;  4P71 A;  1A3T A;  4A4I A;  1M8A A;  1WOC A;  3NTK A;  4DPG A;  1VQ9 A;  3QB3 A;  1EYC A;  4IUP A;  2EJF C;  2L1B A;  2Q2H A;  5EJW A;  5I2X A;  3CXC A;  1ASY A;  4JI5 Q;  2EPB A;  3ZJY C;  2FFK B;  4QIW B;  1EZ8 A;  2B2Y C;  5C0X H;  4B3R Q;  1HNX Q;  2G9H D;  4GOP C;  3NK9 A;  2SNM A;  1NE3 A;  4LUZ A;  2VUM H;  3T1H Q;  2ENB A;  2MHV A;  1PFB A;  4OXP A;  2E2H H;  5FOB B;  1UE6 A;  4EVO A;  2A6E C;  1XMO L;  3GTP H;  5D14 A;  1B9N A;  1EWI A;  3JAM E;  1Q82 C;  2QF7 A;  3H0G H;  1L1O B;  4LF9 L;  2MQH A;  4CBV A;  1AW7 A;  2B2U A;  2LSS A;  1JR0 D;  1LTL A;  3D31 A;  2R92 H;  4TKO B;  3MFY A;  3PMF A;  3W2D A;  3CCE A;  4GNX B;  4IN3 A;  1MSH A;  2EY2 A;  2JQO A;  2K1B A;  3F2C A;  2GVA A;  1EY0 A;  1S5B D;  1Q1E A;  2IX1 A;  3I56 A;  3HOU G;  3GDE A;  2FHT A;  2JA5 H;  3GTO B;  1RCV D;  1Y8N B;  3E0E A;  3SVM A;  4YIJ A;  5C4X H;  2UUC Q;  4IUQ A;  4A3E G;  1Y1W H;  5GAD C;  2Z0S A;  4RAU C;  2UXC Q;  4BY1 B;  4AIM A;  3NP8 A;  1JOO A;  1KDB A;  3CC7 A;  3UDX A;  1EYD A;  3K5M A;  1IBK L;  4K5X A;  3G48 A;  1B2T A;  3ERO A;  4AYB G;  1AH9 A;  1U4P A;  3FKI B;  4DF7 A;  4OX9 Q;  3A5U A;  1VQC A;  1KDC A;  1SFO B;  3HOZ H;  3D0F A;  2F0D A;  4DAY B;  3I7F A;  3OWE B;  1Y14 B;  5E4W C;  1J8I A;  2PZT A;  3HKZ B;  2NVQ B;  4G7H C;  4C3H H;  5C3W A;  4DV3 Q;  1S5E D;  1C0A A;  3AFP A;  4LFA L;  5GAG C;  1V1O A;  3GTL H;  1K8A C;  1DJR D;  4DV0 Q;  3GTJ B;  2Y0S E;  4N9T A;  4DV5 L;  4JOI C;  4IOC A;  2IX3 A;  4G7Z C;  2AQ3 B;  2NN6 I;  2B63 B;  2ATW A;  1BBU A;  5IGB A;  5BR8 Q;  4BBR H;  1CQF A;  3A54 A;  3I4N H;  1Q3L A;  1ESR A;  4RCN A;  2ZM6 Q;  1HFG A;  3VR3 A;  5EQ0 A;  1PA6 A;  3S1Q B;  3R2I A;  1EY5 A;  4NB3 A;  1Q8I A;  4B3M Q;  3BS1 A;  1AN8 A;  5F2D A;  3O13 A;  4IUU A;  5LMU Q;  2EYM A;  4L5T A;  4Y7N B;  5GAH C;  1PXU A;  2FXQ A;  4ZAI A;  4DR4 L;  4U68 A;  1UE1 A;  4DR1 L;  1KLU D;  1KNE A;  2WB1 E;  1L0X B;  4J6H A;  2B8G A;  1VQO A;  4AQY L;  5GRO A;  3QOJ A;  3PUZ A;  1TVX A;  3HOY B;  4A3G B;  1LTS D;  4ODG A;  2XN9 C;  1YIT A;  4PZ6 A;  2DJG C;  1HZ9 A;  1QUQ A;  1A3V A;  4A3I H;  2NTS A;  3T4A C;  4UPA A;  3TRE A;  1TKW B;  2QA4 A;  1KD1 C;  1MD2 D;  1PRT D;  1EZ6 A;  2KED A;  3DEO A;  2ZXR A;  2QEX A;  1TY0 A;  2JP1 A;  4K5V A;  4JI7 L;  4BY1 G;  1IW7 D;  1TY2 A;  4LNQ A;  1VQK A;  4NXN Q;  4JYA L;  4QUC A;  1PTO H;  4IPH A;  4I7Z C;  3A8K E;  1NSN S;  2E5L Q;  3P75 A;  1I4Q A;  2RQX A;  3I91 A;  1QNK A;  5GQO A;  5C5M A;  1JOR A;  1X65 A;  1U5K A;  2UU9 L;  1F2M A;  2XNA C;  5M5X H;  3HOU H;  3Q22 A;  1TWC H;  3D8G A;  5JPN C;  5IE8 A;  4QB4 A;  1KQS A;  1C9O A;  3M3Y B;  5IGF A;  3J81 c;  3HKZ G;  3GTK H;  4DV1 L;  1EIG A;  1TR5 A;  2NN6 H;  1K28 A;  1AZP A;  1AZQ A;  2A73 B;  3J80 c;  4TRD A;  5GAE C;  2UXB L;  4K0K Q;  5M3F B;  2V1C C;  1NBW A;  2N88 A;  3NQI A;  5FO9 B;  1H9J A;  1SE3 A;  1GHK A;  5IOC A;  4JPB W;  3EJI A;  1BO0 A;  2L0C A;  4A93 G;  3HG9 A;  1X9N A;  3TBI B;  3CQZ H;  3S1N H;  2B63 G;  4EX5 A;  5KYI A;  1GKH A;  5KYL A;  5M3M B;  1FJG Q;  1G51 A;  1O7L A;  3NWT A;  5IGC A;  1WVL A;  3S1M H;  1R4Q B;  5LMN W;  3PUW A;  3K80 C;  2B29 A;  4PNY A;  3Q8D A;  4P72 A;  3ERQ A;  4FF1 A;  1XJV A;  4DV2 L;  4WJ3 M;  3EN2 A;  2F3I A;  5AJ3 L;  3VYU A;  5JVG 3;  2K4K A;  5D3D A;  4C2M B;  4DR7 Q;  1X54 A;  3AMU A;  1D6E C;  2EZV A;  1EY7 A;  5IT9 L;  3GD7 A;  2VNU D;  1HHV A;  1UEB A;  4J15 A;  1GJX A;  1HPC A;  2ZXP A;  1PRT F;  3DWQ A;  3NEM A;  4DFA A;  1XYI A;  4DXG A;  4A3G G;  1YJW A;  3N52 A;  1J5E L;  3ULP A;  3ULL A;  3P20 A;  2ES2 A;  5TSS A;  1XX8 A;  1FL0 A;  1GUW A;  4DN4 M;  1U9R A;  3KF6 A;  2IL8 A;  4IFD I;  3KDF A;  1PTO C;  4BXX G;  1XMO Q;  3M85 A;  3TRZ A;  2JEB I;  2AKW B;  2YTX A;  2NZO A;  4LF9 Q;  2Q8T A;  3U50 C;  5I6W A;  1SMY C;  2G9D A;  1K83 B;  1PLF A;  1YNN D;  3CC4 A;  3OW7 A;  4A3B B;  4HIO A;  1XPR A;  1ET6 A;  1JWM D;  4GN4 B;  2RCF A;  3H09 A;  2RBM A;  4G4K A;  2I0Q A;  2K5N A;  1FR3 A;  4YWK A;  4R4Q A;  2JN4 A;  3HP3 A;  5IP7 G;  4P73 A;  4MIU A;  3PO2 H;  1X32 A;  4FF4 A;  4HTH A;  1EFI D;  4GLV B;  3GTO H;  2O5J C;  1FYC A;  3E9I A;  4QY7 A;  5ELN A;  4Q5V A;  1GVP A;  1OO9 B;  4XT1 B;  3QG1 A;  3QR8 A;  4GS3 A;  1ML0 D;  1WD0 A;  1JMC A;  1BCP D;  3HZX A;  3KLR A;  1WTX A;  2IHE A;  5HGT A;  4A3D B;  3J81 j;  3RZO B;  3DXJ C;  2R6G A;  1IBK Q;  2F0L A;  1II3 A;  1E0B A;  4PMW A;  4X3K A;  2A68 C;  4LUV A;  5EPK A;  1B3Q A;  1RL2 A;  2YU9 H;  2KHJ A;  1SYD A;  2LFN A;  3FKI H;  5M3M G;  1BXT A;  4OEL B;  1LT3 D;  2EQS A;  1SFO H;  3M7G A;  1A0I A;  2XWJ B;  5JJI A;  4OWT B;  3NHH A;  2BOS A;  1CFM A;  4KMU C;  4DNR B;  1CKM A;  3I4O A;  2NVQ H;  3J81 i;  1HNZ L;  1IL2 A;  2G5D A;  1PZK D;  5C4X B;  1TWA B;  3TP6 A;  1D7Q A;  1SN8 A;  4LFA Q;  4B3T L;  4HED A;  1LT5 D;  5JPM C;  2AQ1 B;  1VQ4 A;  4IFD H;  3GTJ H;  2L12 A;  3B6Y A;  3VYS A;  4DV5 Q;  3PIP 3;  2D0O A;  1LLR D;  3K5L A;  2B63 H;  4I65 A;  4DAV A;  1A6X A;  1D2B A;  1PH5 A;  5C4H A;  4HMJ A;  2A74 C;  1EFW A;  2RVL A;  3DM3 A;  3HOZ B;  1L1O C;  2K14 A;  5DM7 3;  3CCU A;  2F0N A;  3S17 B;  3S1Q H;  4UP9 A;  1XPU A;  1Q8K A;  4X65 L;  2MP1 A;  4DUZ L;  3DMU A;  1JE5 A;  4C3H B;  4XTC S;  1SJH D;  1DOL A;  5C3E G;  4GNX C;  1E2Z A;  1NMG A;  3Q24 A;  1IBM L;  4DXF A;  3W1B A;  4DR4 Q;  1YNX A;  1HA5 A;  3I4L A;  4LF6 L;  4DR1 Q;  3HOV B;  1KAB A;  4IQZ A;  4DAM A;  5FLX L;  3GTL B;  2J7Z A;  4A3B G;  2VL6 A;  4IZ8 A;  1CKO A;  3D4W A;  4HSP A;  3CCQ A;  4AQY Q;  1T9H A;  1S5D D;  1DYQ A;  4LUO A;  3HOY H;  4A3G H;  4CJ0 B;  1BCP F;  2KCT A;  3U58 A;  1WTV A;  1QUQ B;  1HJP A;  3K7A B;  5CBE E;  3H3V H;  2DY8 A;  3P1H A;  1YHB A;  5C0X G;  1N8R C;  3BZK A;  1PH1 A;  2WP8 J;  4IO9 A;  3I4N B;  1RJT A;  2VUM G;  4OO1 I;  1VF7 A;  2NUC A;  3RLF A;  1I50 H;  1O78 A;  3BDL A;  5ELC A;  2RHQ B;  5EPJ A;  1LTI D;  1XTC D;  3R8B A;  4JI7 Q;  2KHI A;  3U4Z A;  2PI2 A;  5ELE A;  4EQ5 A;  2FJ2 A;  4TVA B;  4RKL A;  4A3D G;  3I72 A;  4JYA Q;  4HMI A;  1KL9 A;  3H0G G;  3LNN A;  1QVF A;  3PUV A;  4IPD A;  4ZYS A;  2A69 C;  1HNW L;  4IPC A;  2PZW A;  2R92 G;  1Y69 U;  3MXU A;  4WFN 3;  1CM9 A;  4E6I A;  4HJ8 A;  2UU9 Q;  4EGV A;  3KBX A;  2NBF A;  4L5S A;  1UUP A;  1YEZ A;  4RA8 A;  5C44 B;  3AFQ A;  4A3M B;  4APV A;  2AQ2 B;  3NTH A;  5T1G A;  2N49 A;  4A3I B;  3F8T A;  1N32 L;  3M3Y H;  3SR1 A;  4DV1 Q;  2H5X A;  3G71 A;  4B3S L;  1STE A;  2I07 B;  5C6A A;  4KK7 A;  2PI2 E;  1B44 D;  5C4X G;  1Z47 A;  2UXB Q;  2Q2I A;  1Y1W G;  5M3F H;  1X3P A;  2EXD A;  3JAM i;  2L15 A;  3MFG A;  3QJY A;  4DK1 A;  4IUT A;  1XNQ Q;  3OWF A;  5JEA H;  3T13 A;  1DM0 B;  4POF A;  3PO3 B;  1F9P A;  4XT3 B;  2Q2U A;  4FF2 A;  3OYY A;  1Y8P B;  1ZYR C;  3EBE A;  5M5X B;  4JBM A;  1STG A;  2LS0 1;  4JI8 L;  1TWC B;  5IP9 H;  3HOZ G;  3NEN A;  3E3X A;  4DV2 Q;  5A35 A;  1OXT A;  3GTK B;  5AJ3 Q;  4C3H G;  4JG2 A;  1A3U A;  3VR5 A;  4LMQ D;  2E75 C;  4C2M H;  3G6J B;  4KI0 A;  1EY4 A;  3VDY A;  2CW0 D;  2ASB A;  1ICW A;  2WKD A;  3HOV G;  3H3V C;  4BY7 G;  4OO1 H;  5CV9 A;  3RLO A;  2YV5 A;  4JI4 L;  4MTK A;  1D5X C;  5LL6 S;  3MAQ A;  1SE2 A;  2MO0 A;  1MJE A;  2EYL A;  4Z9C B;  3EFX D;  3NXW A;  3FPP A;  4C3I B;  1PZI D;  1J5E Q;  1V1P A;  2KCN A;  3S1N B;  4GN3 B;  3KF6 B;  4BBR G;  1RIP A;  2HHH L;  1JOQ A;  3I4N G;  4A3F B;  1DD2 A;  4H02 A;  1JT8 A;  1RDP D;  2B2Y A;  2YTY A;  4H0L C;  4MZ9 A;  3PGZ A;  3NTI A;  1JB3 A;  1IYV A; 
#chains in the Genus database with same CATH homology
 1FNW A;  4RFB A;  1F2Z A;  2NVT B;  2F0Q A;  1GUO A;  1X3Q A;  2IWH A;  3N6R A;  1BNZ A;  2K33 A;  4NMZ A;  2F0T A;  3PUX A;  3I4M B;  2NVY B;  1T5X D;  1IHZ A;  2PNR C;  2EYH A;  1WTW A;  1WTR A;  2F0O A;  2B39 A;  4CHT B;  1SDF A;  5C0X J;  4TQU S;  1G91 A;  3WDN A;  3I8Z A;  4NP5 A;  4BS9 A;  5JJZ A;  3SK6 A;  3EA6 A;  3LWU A;  4XYQ A;  4GZY C;  2EDG A;  2BDO A;  3CU7 A;  3FPU B;  2XIW A;  3NWS A;  2JXM B;  1TQO A;  4V19 0;  5J1Z A;  5JAV A;  5A2Q L;  5IGD A;  1SJE D;  1TWF B;  3CRK C;  2WAC A;  3PO2 B;  1PFN A;  3BZD B;  1Z7T A;  4F8M A;  4KKU A;  2NN6 G;  4X3T A;  5EBC A;  4FNF A;  3BG3 A;  1ROD A;  4B08 A;  4L6T B;  1LV9 A;  2AUK A;  2HDM A;  1ET9 A;  4K8J A;  2QKI C;  2DNC A;  2YU9 B;  4WRD A;  2K5Q A;  3PIO 3;  2DN8 A;  4DGZ A;  1S5F D;  1JC7 A;  3BVM A;  3L3O C;  3S9W A;  3SK5 A;  1Q1B A;  1BF4 A;  1M4V A;  2AWO A;  4KD3 A;  4R8N A;  5CV6 A;  5FLX E;  2BE5 C;  5KIX A;  2AWN A;  4KKT A;  2JA6 B;  4LAA A;  1TS5 A;  2JEA I;  3MTS A;  1MI2 A;  2K6A A;  2KA7 A;  1JCK B;  1F9Q A;  2GA4 B;  1DOK A;  1I4R A;  3DWP A;  3C2P A;  1RF2 D;  1SEB D;  5I9O A;  4MN3 A;  3BVG A;  5DM6 3;  3DM1 A;  3I3C A;  5EBD A;  2A6E D;  2LMC B;  1OXS C;  1YNJ C;  5M5W B;  1C48 A;  5CBA E;  1BOS A;  1C4Q A;  3I73 A;  3DEP A;  2MGS A;  5CV7 A;  2PW7 A;  2D2C C;  1GXD C;  3HEJ A;  2TSS A;  1ESF A;  3C3L A;  1LT4 D;  2F03 A;  2RDG A;  2OXP A;  5K36 H;  1PYW D;  1H9S A;  1W6J A;  2F0F A;  4MHE A;  3FMC A;  1QOH A;  1OXX K;  4CJ2 C;  5CGK A;  2B2T C;  1QG7 A;  1BBX C;  3MXG A;  3KBG A;  1ILP A;  1ONL A;  3S2H B;  2YYZ A;  2PMZ B;  2RSO A;  2B2W C;  2RDF A;  4KD4 A;  3Q6S A;  4KV6 A;  2F4I A;  4QMG A;  3BVZ A;  4KY6 A;  1CQV A;  1I50 B;  1CTM A;  3RMH A;  1DXM A;  3NSW A;  2K01 A;  3VR6 A;  1B50 A;  4X3U A;  4KN4 C;  3D4R A;  4LJZ C;  3T51 B;  5KNB A;  3BYY B;  1GHJ A;  4FXD A;  2B2V A;  2DNE A;  2XWB B;  5DEH A;  1I4H A;  2L55 A;  1K8O A;  1OXV A;  1DCZ A;  1U4L A;  4ZKB B;  5AFW A;  3U9S A;  1STA A;  5EGT A;  4K6D A;  1SAP A;  2EYF A;  4IFD G;  1NAP A;  1AFP A;  1V1P B;  2M00 A;  1JE4 A;  3OIP A;  3DUZ A;  3R93 A;  3GTQ B;  3U9O A;  2Q8I B;  5JVH 3;  1LAB A;  1W6K A;  2IT1 A;  3M4O B;  2IPK D;  3MXP A;  2EE1 A;  2EXZ A;  3SE0 A;  3AU7 A;  1I3Q B;  3TN2 A;  2WIN B;  3QIA A;  5FKA C;  2KEC A;  4OL7 A;  1EEF D;  4J1M A;  1EL0 A;  4FO2 A;  3CHB D;  4RGN A;  3Q0A A;  3D3R A;  2LKV A;  1IYU A;  5I2Y A;  2XRQ D;  3A55 A;  3E6Z X;  2A6H C;  3M4Y A;  2OF1 A;  1KNA A;  4N9P A;  4P2C B;  1LTB D;  2D62 A;  2F0V A;  4FP5 D;  1Z6H A;  1VMP A;  1BDO A;  3K5N A;  5EKL A;  1PRT B;  2EJM A;  3PUY A;  2PZU A;  1STN A;  1SNO A;  1HTP A;  2PCF B;  4RH6 A;  2X6G A;  2HCC A;  2K28 A;  2MJ8 A;  3DHQ A;  1LT6 D;  5KEE A;  4M1U B;  5IOD A;  5D3I B;  1TT2 A;  3K6O A;  5LHY 1;  1V43 A;  4DNT B;  3KK7 A;  1C8C A;  4ZUI A;  2K5W A;  4KHV A;  1G2T A;  2XSC A;  5JOB A;  1QWY A;  3GTM B;  3ITP A;  3KUP A;  1CZW A;  2Y0S B;  1G2S A;  2L9H A;  5JEA G;  4IUN A;  1RKN A;  5CV5 A;  2AUJ D;  3TDQ A;  1EOT A;  4DK0 A;  4F88 A;  5E4X A;  5C4J B;  3QOL A;  5G3L D;  3S2D B;  3JAM L;  1G6Z A;  4U67 3;  1LO5 D;  1TU2 B;  1JIC A;  2JA7 B;  4OGQ C;  3OIQ A;  2Z8L A;  5T1I A;  5ELF A;  3X3N A;  2O4X A;  3UI2 A;  1DZ1 A;  4PQX A;  1CA6 A;  4OO1 G;  2JYO A;  2N55 A;  4IFD J;  1VDZ A;  1Y1V B;  2WB1 B;  4CKB A;  1EY8 A;  5BN3 A;  1L0Y B;  2SNS A;  2KVM A;  4QCL A;  2SOB A;  1PTO D;  2I46 A;  3S14 B;  1WCM B;  2NTT A;  3K0Y A;  2K7V A;  4HCS A;  1HFN A;  3S16 B;  1SMY D;  3FVQ A;  4RHS A;  4KKS A;  4HCE A;  5D65 A;  1H9S B;  1F9R A;  4XIG S;  4WJW A;  2J4X A;  2X6L A;  2EY5 A;  1SSO A;  3NBH A;  1D5M C;  3MHB A;  3VR2 A;  4FXG C;  2H4O A;  2WII B;  3MZ5 A;  4DAY A;  1LTG D;  4ZRZ A;  1H9K A;  2BA1 A;  4KY5 A;  4O1N A;  4G7O C;  3TP5 A;  4FXK C;  4ID6 A;  1IKM A;  2H1E A;  1GUG A;  1D1I A;  1A2T A;  4PV1 C;  2E2D C;  3RUZ A;  4NDX A;  3KF8 A;  4ABN A;  2A68 D;  1MSG A;  1BCP B;  4XQJ A;  1O7Z A;  3FEW X;  1I4G A;  2KHS A;  4QUF A;  1LTR D;  1TWG B;  1H9R A;  2F0E A;  1QB5 D;  5KRU A;  1HRJ A;  1F9S A;  1R4P B;  2B8F A;  2RKS A;  1SND A;  4UDU C;  1CA5 A;  4DAP A;  5CV8 A;  2EJG C;  5LL6 X;  1TWH B;  2PO4 A;  4IUR A;  4IAL A;  2TMP A;  1PTO F;  3OOC A;  1VF5 C;  3TME A;  2OT2 A;  4K2L A;  2F1M A;  4IUV A;  1SNM A;  5COR A;  1CT1 D;  5JEA J;  3A7A B;  1WTO A;  3D4D A;  1I4P A;  4R8I A;  3HOW B;  4OIK A;  2VB3 X;  4K6L A;  4HAE A;  1B9M A;  3MA2 B;  1TII D;  2D5D A;  4A3J B;  1V8Q A;  4OHJ A;  3LX0 A;  4ZLT F;  4NKL A;  5DAU A;  5C4Z A;  2ZXO A;  4QF4 A;  4NW2 A;  5IT9 E;  1BUV T;  3A7L A;  1RD9 D;  1CZG A;  1GUS A;  4RGM A;  5NUC A;  2E76 C;  3GQB A;  1SYG A;  5E1F A;  1QNU A;  3HGB A;  1HCZ A;  5CC4 A;  3IAY A;  2KJX A;  2WKC A;  3IFD A;  1J9O A;  2EVB A;  1EWH A;  2A69 D;  1STH A;  3HS0 C;  4X3S A;  1WTQ A;  1EEI D;  3K59 A;  3HRZ C;  5K36 G;  3C1F A;  2PPB C;  3VYT A;  4V0B A;  1HA6 A;  2EYJ A;  3MEH A;  4KJO A;  5CMD A;  3E5S A;  4ULL A;  3TZU A;  4C1N K;  2F0K A;  5ELD A;  3I70 A;  1EY6 A;  2XVS A;  1KTK A;  4B9X A;  2Z4I A;  4ILW A;  3P7J A;  1QJO A;  1G8Z D;  4C56 C;  1S4Z A;  2CVR A;  2EY1 A;  4K8I A;  3VYR A;  1UEA B;  3BDC A;  2F0W A;  4Q0F A;  1STB A;  5M9O A;  4ME5 A;  1BR9 A;  3KLS A;  1ZYR D;  2MUY A;  4L63 B;  2EYO A;  1E2V A;  2F3V A;  2Z4H A;  4UAI A;  1XWE A;  2X69 A;  2KQ3 A;  3V2T A;  1O80 A;  1NCV A;  4CJ1 B;  1JOK A;  4KY7 A;  1HXY D;  3H94 A;  1I6H B;  3J7A F;  2F0S A;  1SYF A;  3HOX B;  4R9W A;  1T5E A;  5I6Y A;  1SE4 A;  1VCI A;  1A15 A;  1KLG D;  4KN7 C;  1A2U A;  2L11 A;  1EYA A;  3MWY W;  1ENF A;  1G29 1;  3SDZ A;  4K14 A;  4C3I G;  3MXN A;  4RGO S;  1AEX A;  2B2U C;  1PRT C;  3K57 A;  3T16 A;  2CHB D;  1U4M A;  1IW7 C;  4F7X A;  3TSS A;  2Z1C A;  2IJ0 A;  1LTA D;  1CHP D;  2HQE A;  1LTT D;  2NWG A;  4TSS A;  2E74 C;  1ILQ A;  1TS3 A;  2V4D A;  5I4D A;  2ID0 A;  3A56 A;  3NQT A;  1STY A;  2B2T A;  2JA8 B;  1FD7 D;  3A8J E;  2IW3 A;  1H9M A;  1K8M A;  3F2U A;  1PZJ D;  1FNU A;  1ZKO A;  2B2W A;  4PMC A;  4A93 B;  5DNF A;  4OIJ A;  1KDA A;  2L5T A;  5EPL A;  1EIH A;  2FMC A;  2O2L D;  5COY A;  4CKE A;  3NUC A;  2R93 B;  4H44 C;  4L8J A;  2F3W A;  3C1E A;  1KAA A;  3AB9 A;  4FVM A;  4WOR A;  1MGS A;  2EY6 A;  5IGE A;  2F0G A;  2NVX B;  3CRL C;  1IKL A;  1R9T B;  2ZT9 C;  1ZEQ X;  1SNC A;  3GP7 A;  3S15 B;  2C5C A;  5ISR A;  1PFM A;  2LY7 A;  1DON A;  4RHR A;  2ICI A;  3J7A V;  4BA1 I;  5FK9 C;  2BE5 D;  4H13 C;  5ELB A;  2BDN A;  1YNN C;  1RTO A;  4BBS B;  3SXH A;  3NPP A;  4O42 A;  2KUM A;  4DA2 A;  1QCB D;  4J8Q A;  2K5D A;  4ZKC B;  3OSO A;  4M8A A;  2F0P A;  1CI3 M;  1YNJ D;  2M2L A;  3I90 A;  3J81 L;  3K5O A;  2NB0 A;  3ONA B;  3J80 L;  2VB2 X;  4B9W A;  2QEJ C;  1SNP A;  1QE6 A;  5IGG A;  1BCP C;  2E2I B;  5KND A;  3L9A X;  3OPO A;  1F2Y A;  1GOZ A;  3IFT A;  1TS2 A;  2QCP X;  3IKJ A;  2B2V C;  3VR4 A;  2F0M A;  1FGB D;  1NR4 A;  2JE6 I;  5HUR A;  3KLS X;  1F2L A;  5M5Y B;  2HDL A;  4H7B A;  4XQQ A;  1CHQ D;  5J39 A;  1QIL A;  2PQE A;  2E2J B;  1B1Z A;  4K5W A;  4EQO A;  2F0U A;  2ICE C;  4FF3 A;  1B53 A;  3FRP B;  5BN4 A;  1SYC A;  1HQM C;  1ZXT A;  4A3K B;  2O5I C;  2SDF A;  2K03 A;  1OXU A;  4G57 A;  3H91 A;  5A2Q E;  1B3A A;  2XRS D;  3ND9 A;  4CGY B;  1B4O A;  2A5H A;  1LAC A;  3RZD B;  3SHL A;  3S1R B;  3PV0 A;  1Q12 A;  4BA2 I;  4FYD A;  5C3E B;  3V96 A;  1NUC A;  3GTG B;  4HN7 A;  5I9P A;  3DWA A;  5CV4 A;  1EY9 A;  1F77 A;  5EKK A;  5IIF A;  2QIL A;  3J7Y W;  4PMB A;  3EVQ A;  1CK1 A;  2RDH A;  3CKI B;  2VUM B;  3URY A;  3D6C A;  2F0I A;  2E2H B;  1EQT A;  5J22 A;  3L7Z C;  2NZ1 D;  4K2K A;  3GTP B;  4ZUJ A;  3R2T A;  3W3A A;  3H0G B;  3R3O A;  1SXT A;  2R92 B;  1DOM A;  1JWS D;  1HUN A;  1Q90 A;  3GV3 A;  1RTN A;  3K58 A;  2J0T D;  2MPM A;  5EKI A;  2C9O A;  4XDX A;  5C5L A;  2JA5 B;  2KCC A;  2A6H D;  2BA0 A;  2HCI A;  3MC0 B;  1HQR D;  2WAQ B;  2FMM A;  2BCO A;  1Y1W B;  3RD4 A;  4EQN A;  4ZQ3 A;  3EQL C;  3C46 A;  3MVV A;  3SEB A;  1SYB A;  4XQN A;  2RSN A;  4C3J B;  2R7Z B;  3V05 A;  1WD1 A;  3ND8 A;  4F87 A;  1EU4 A;  3G7L A;  3WOF A;  1BQQ T;  1D5Z C;  3OHX C;  4JK1 C;  3TP7 A;  2M9V A;  5KGU A;  1XXG A;  1ENC A;  4RWS C;  4JBW A;  1D1K A;  3VA5 A;  3M7N A;  1AP0 A;  2CW0 C;  2PW5 A;  2D9U A;  3GV6 A;  1Y8O B;  2VXW A;  2R3Z A;  5G3L F;  4BBR B;  2RA4 A;  3D6W A;  2DY7 A;  3NE5 B;  3T53 B;  1WTP A;  1RHP A;  1TS4 A;  3A8I E;  2KOL A;  1PMR A;  1JWU D;  4DU9 A;  3E0J A;  3NBI A;  4CKC A;  2L4N A;  3QO2 A;  1UNS A;  3BDO A;  2OEO A;  2NYZ D;  2QDB A;  2F0H A;  2EYP A;  2Q8R E;  4HR7 B;  4RKB A;  1PDQ A;  3GO5 A;  4KTA A;  1HUM A;  3J81 E;  4BWG B;  1SYE A;  3J80 E;  4XXE A;  1JQY D;  2FIN B;  1GUN A;  4ZK9 B;  5C0X I;  1PTO B;  2IX0 A;  2KEE A;  3TZD A;  3TP8 A;  3SK8 A;  1HTL D;  4EQP A;  1IL8 A;  5CYU A;  2JSO A;  4C3J G;  2CQA A;  1O7Y A;  3HOU B;  1E2W A;  4RGT A;  3OMC A;  2K04 A;  4LK1 C;  2K05 A;  2HUG A;  5E3F A;  4A3E B;  3VA7 A;  1U4R A;  3WOE A;  1MBY A;  1GUT A;  3Q23 A;  2F0J A;  4S3S A;  3X3M A;  5FO7 B;  5KNC A;  3LWE A;  1I6V C;  3QWN A;  1I4X A;  4C1N I;  3CQZ B;  3H6M A;  4AYB B;  2PYK A;  5C3X A;  1ENA A;  3BYT B;  3ZYY X;  2K32 A;  1EWC A;  3S1M B;  1UAP A;  5FO8 B;  2R61 A;  1VMC A;  1FNV A;  4KJN A;  1S5C D;  3OMG A;  2SEB D;  4HSV A;  3T56 B;  3SK4 A;  1SBB B;  5K5P A;  1EQV A;  1EU3 A;  2EOT A;  4KHZ A;  1SNQ A;  1NR2 A;  2WV6 D;  5BN5 A;  3IL8 A;  4XYO A;  5CR3 A;  3FDT A;  4RCO A;  1A3T A;  1M8A A;  3NTK A;  3QB3 A;  1EYC A;  5I2X A;  4IUP A;  2EJF C;  2L1B A;  5EJW A;  2EPB A;  2FFK B;  4QIW B;  1EZ8 A;  2B2Y C;  5C0X H;  2G9H D;  3NK9 A;  2SNM A;  2ENB A;  2MHV A;  1PFB A;  5FOB B;  4EVO A;  2A6E C;  5D14 A;  1B9N A;  3JAM E;  2QF7 A;  4CBV A;  1AW7 A;  2B2U A;  1JR0 D;  3D31 A;  4TKO B;  3MFY A;  3PMF A;  3W2D A;  4IN3 A;  1MSH A;  2EY2 A;  2K1B A;  1EY0 A;  1S5B D;  1Q1E A;  2IX1 A;  2FHT A;  3GTO B;  1RCV D;  1Y8N B;  3SVM A;  4YIJ A;  4IUQ A;  4RAU C;  4BY1 B;  3NP8 A;  1JOO A;  1KDB A;  1EYD A;  3K5M A;  4K5X A;  1B2T A;  3ERO A;  1U4P A;  3FKI B;  4DF7 A;  1KDC A;  1SFO B;  2F0D A;  3OWE B;  5E4W C;  1J8I A;  2PZT A;  3HKZ B;  2NVQ B;  4G7H C;  5C3W A;  1S5E D;  1V1O A;  1DJR D;  3GTJ B;  4N9T A;  2IX3 A;  4G7Z C;  2AQ3 B;  2NN6 I;  2B63 B;  5IGB A;  1CQF A;  3A54 A;  1Q3L A;  1ESR A;  4RCN A;  1HFG A;  3VR3 A;  5EQ0 A;  3S1Q B;  3R2I A;  1EY5 A;  1Q8I A;  3BS1 A;  1AN8 A;  5F2D A;  3O13 A;  4IUU A;  2EYM A;  4Y7N B;  1PXU A;  4ZAI A;  4U68 A;  1KLU D;  1KNE A;  1L0X B;  4J6H A;  2B8G A;  3QOJ A;  3PUZ A;  1TVX A;  3HOY B;  4A3G B;  1LTS D;  4ODG A;  2XN9 C;  1A3V A;  2NTS A;  3T4A C;  1TKW B;  1MD2 D;  1PRT D;  1EZ6 A;  2KED A;  3DEO A;  2ZXR A;  1TY0 A;  2JP1 A;  4K5V A;  1IW7 D;  1TY2 A;  4QUC A;  1PTO H;  4I7Z C;  3A8K E;  1NSN S;  3P75 A;  1I4Q A;  2RQX A;  3I91 A;  1QNK A;  5C5M A;  1JOR A;  1F2M A;  2XNA C;  3Q22 A;  3D8G A;  5JPN C;  4QB4 A;  3M3Y B;  5IGF A;  1EIG A;  1TR5 A;  2NN6 H;  1AZP A;  1AZQ A;  2A73 B;  4TRD A;  5M3F B;  2N88 A;  3NQI A;  5FO9 B;  1H9J A;  1SE3 A;  1GHK A;  5IOC A;  3EJI A;  1BO0 A;  2L0C A;  3HG9 A;  3TBI B;  5KYI A;  5KYL A;  5M3M B;  1O7L A;  3NWT A;  5IGC A;  1WVL A;  1R4Q B;  3PUW A;  4PNY A;  3ERQ A;  4FF1 A;  3VYU A;  5JVG 3;  5D3D A;  4C2M B;  3AMU A;  1D6E C;  2EZV A;  1EY7 A;  5IT9 L;  3GD7 A;  2VNU D;  1HHV A;  1GJX A;  1HPC A;  2ZXP A;  1PRT F;  3DWQ A;  4DFA A;  1XYI A;  4DXG A;  3N52 A;  3P20 A;  5TSS A;  1XX8 A;  1GUW A;  4DN4 M;  1U9R A;  2IL8 A;  4IFD I;  1PTO C;  3M85 A;  2JEB I;  2Q8T A;  5I6W A;  1SMY C;  2G9D A;  1K83 B;  1PLF A;  1YNN D;  3OW7 A;  4A3B B;  1ET6 A;  1JWM D;  3H09 A;  2RBM A;  4G4K A;  1FR3 A;  3HP3 A;  4MIU A;  1X32 A;  4FF4 A;  4HTH A;  1EFI D;  2O5J C;  1FYC A;  4Q5V A;  1OO9 B;  4XT1 B;  3QG1 A;  1ML0 D;  1WD0 A;  1BCP D;  3HZX A;  3KLR A;  1WTX A;  5HGT A;  4A3D B;  3RZO B;  3DXJ C;  2R6G A;  2F0L A;  1II3 A;  1E0B A;  4PMW A;  4X3K A;  2A68 C;  5EPK A;  1SYD A;  2LFN A;  1BXT A;  1LT3 D;  3M7G A;  2XWJ B;  3NHH A;  2BOS A;  1CFM A;  4KMU C;  4DNR B;  1PZK D;  5C4X B;  1TWA B;  3TP6 A;  4HED A;  1LT5 D;  5JPM C;  2AQ1 B;  4IFD H;  2L12 A;  3VYS A;  3PIP 3;  1LLR D;  3K5L A;  4I65 A;  4DAV A;  1A6X A;  1D2B A;  5C4H A;  4HMJ A;  2A74 C;  2RVL A;  3HOZ B;  5DM7 3;  2F0N A;  3S17 B;  2MP1 A;  3DMU A;  4C3H B;  4XTC S;  1SJH D;  1DOL A;  1E2Z A;  3Q24 A;  4DXF A;  1HA5 A;  3I4L A;  3HOV B;  4BY7 B;  1KAB A;  4IQZ A;  3GTL B;  5FLX L;  2J7Z A;  4IZ8 A;  3D4W A;  4HSP A;  1S5D D;  1DYQ A;  4CJ0 B;  1BCP F;  1WTV A;  5CBE E;  3K7A B;  2DY8 A;  3P1H A;  5C0X G;  2WP8 J;  3I4N B;  1RJT A;  4OO1 I;  2NUC A;  3RLF A;  1O78 A;  3BDL A;  5ELC A;  3R8B A;  5EPJ A;  1LTI D;  1XTC D;  5ELE A;  2FJ2 A;  4RKL A;  3I72 A;  4HMI A;  3LNN A;  3PUV A;  4ZYS A;  2A69 C;  2PZW A;  1Y69 U;  3MXU A;  4WFN 3;  1CM9 A;  4E6I A;  4EGV A;  3KBX A;  2NBF A;  1UUP A;  4RA8 A;  5C44 B;  4A3M B;  2AQ2 B;  3NTH A;  5T1G A;  4A3I B;  3SR1 A;  1STE A;  2I07 B;  5C6A A;  4KK7 A;  1B44 D;  1Z47 A;  1X3P A;  3MFG A;  3QJY A;  4DK1 A;  4IUT A;  3OWF A;  5JEA H;  3T13 A;  1DM0 B;  3PO3 B;  1F9P A;  4XT3 B;  4FF2 A;  1Y8P B;  1ZYR C;  5M5X B;  1STG A;  2LS0 1;  1TWC B;  5A35 A;  1OXT A;  3GTK B;  4C3H G;  1A3U A;  3VR5 A;  4LMQ D;  2E75 C;  3G6J B;  4KI0 A;  1EY4 A;  2CW0 D;  1ICW A;  2WKD A;  4OO1 H;  3H3V C;  5CV9 A;  1D5X C;  5LL6 S;  3MAQ A;  1SE2 A;  2EYL A;  4Z9C B;  3EFX D;  3NXW A;  3FPP A;  4C3I B;  1PZI D;  1V1P A;  2KCN A;  3S1N B;  1JOQ A;  4A3F B;  1DD2 A;  1RDP D;  2B2Y A;  4H0L C;  1VF7 A;  3NTI A;  1JB3 A;  1IYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...