5LL6X

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
155
structure length
155
Chain Sequence
STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAGKANKQFAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00366 Ribosomal_S17 Ribosomal protein S17
X PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5ll6X00
3J7AV 3JAML 3J81L 5LL6X 5A2QL 3J80L 5FLXL 5IT9L
chains in the Genus database with same CATH superfamily
1X65A 1EY6A 1MSGA 4KN7C 1I94L 1MI2A 1PTOD 1Y8PB 2MPMA 2Q2UA 4PZ8A 5I4DA 1ASYA 2WB1E 3R8BA 3PUYA 1VQLA 1CA6A 4IUPA 4QIWB 4DAPA 4X66L 1WJJA 1YNNC 3T53B 1XNQL 1JORA 2KOLA 3E0JA 1VQIA 2DNCA 1X3GA 4JI8Q 4CDFC 4A3KH 5IYCH 3S1QB 4RCOA 3KF8A 1SROA 1P8LA 3F2DA 3MXPA 2EQSA 3D31A 4DUZQ 2SNSA 4Y7NB 3Q0AA 1RODA 2I07B 2Z9HA 3T16A 1Y1VG 2E2JB 1JWSD 2BCOA 2L1BA 1NBWA 3AEVA 4ZKBB 3J81L 4RCNA 4O0AA 4GOPB 2UUAL 4A3IH 4GNXC 1K0SA 1X3EA 5FOBB 4UDUC 1MJEA 3U9SA 1QZHA 1XMQQ 3CCVA 2DN8A 1G91A 5GAEC 3T1HL 3DWPA 1BVSA 4DFAA 2HIVA 2R92H 1F9RA 2H5XA 1VQEA 4ZKCB 5JAVA 3S2DH 1EIHA 4RKBA 5IE8A 3E5SA 4DV3Q 5C4XB 5FO8B 4OXPA 4HN7A 1Y69U 4GNXA 1V9PA 1H95A 4DUZL 3T1YQ 1EIYB 3VYTA 2Y0SE 2B63H 2X69A 2RHSB 3FMCA 1X3PA 2CH4A 4R4QA 3CCJA 1L1OB 4IFDG 2JA7B 2ZTEA 3NEMA 3W1GA 1AEXA 1XTCD 5ELNA 2K5DA 4QY7A 3K80C 2HQEA 4DGZA 4HEDA 4CKEA 1CQVA 1XMQL 2B8GA 3TDQA 1BXTA 1LT6D 1NAPA 3W5OA 5AJ3Q 3NUCA 1JR0D 4NB3A 4X64L 1PHJA 5JEAJ 1YNND 4KMUC 2NYZD 3H3VC 3PIPA 4A3MB 3GTQB 1SFOH 3BJUA 2ALYB 4KHZA 3G71A 5FJ8H 3K7AH 4ZRZA 3T1YL 1SE8A 5GADC 1AE3A 1Y14B 3A7LA 2NZ1D 2NTSA 2A8VA 3M7NA 4MTNA 5C5LA 4RA8A 4CGYB 3V2TA 4A3KB 2I46A 2LSSA 2UXCQ 3PIO3 1IYVA 3S2HH 3J7ZC 2WB1B 4JOIA 4U68A 1VMCA 4TSSA 1II3A 1Z47A 1M90C 1B4OA 3ERSX 3NTHA 2NN6I 1ENAA 3NSWA 1EY4A 3PO2H 1Q90A 5AJ3L 1BDOA 4FXDA 2B39A 5C44G 1AZQA 4GN5A 3W3AA 4JV5Q 1D5XC 1MKHA 1JICA 2DY8A 4R8NA 1SNPA 4ZCKA 5J22A 4JI1L 2ICEC 4LF6L 1ENFA 2PYKA 4JI2L 3NPPA 4OO1G 4GKJL 4A93H 4K5XA 2IHFA 4ZYSA 3I4NG 4K6DA 4UY8C 3RN2A 1VQ8A 2R92B 3BZDB 1PRTB 2JQOA 3S2DB 4Y52H 1S5FD 4J6HA 4HJ5A 2UXCL 3FP9A 4DNRB 4A3CG 1G6PA 5IGGA 3IRBA 3FEWX 4IPHA 1K3RA 2KHJA 1S4ZA 1HZ9A 2BH2A 3HOVH 1UNSA 1DJRD 2F0FA 4DR5Q 2ASBA 3TREA 2HUGA 5FO7B 4YCVA 2NBFA 3PIP3 3E0EA 5JVG3 4JI4Q 1QE6A 1HNXL 2F4VQ 5JOBA 2PMZE 3W1BA 3TBIB 1HR0L 4JV5L 4GOPA 2PCFB 2Y0SB 3WWVA 3ICEA 3K0XA 1HUMA 1RDPD 1RF2D 2ZJQA 1TS3A 1NSNS 3I4MH 3HOYH 2EY5A 2CH4W 4RGNA 1S5CD 2KCTA 1L1OC 1GVPA 1Z6HA 4QMGA 1PH5A 1TIID 2RBMA 1EY5A 4QF4A 4RKLA 4A3LH 1YI2A 4DF7A 3A5ZB 3I72A 1F2MA 5FK9C 3K7AB 4B3RL 4AQYQ 1SYEA 1HHVA 3HOZG 1IXRA 5KYLA 5BR8Q 3J7A5 5C4JH 5E7NA 1K73C 1F2LA 3S14B 4A3GH 2OQKA 1Y1WG 3GV6A 1DONA 3J81i 1L1OA 1PVOA 4JI4L 1D1IA 3C46A 2F4VL 1EYCA 4LFCL 3S2HB 1WYDA 1HNWL 1TWGB 4UP7A 4F8MA 3TEHB 2R7DA 1PXUA 3TQYA 3PO2B 5M5YB 3G6JB 5I9OA 1B3QA 1PTOH 1S5DD 3UE1A 4Q5VA 1JQYD 1GHJA 1VQCA 2BA0A 3AQQA 4DV5Q 3QR8A 1KLGD 4O2DA 2YTXA 4EQNA 3S15B 1KLUD 5K5PA 4AQYL 3H0GH 4KJNA 1WTRA 3HOUG 4BY7B 2VQFL 2BE5C 3VR3A 1JB3A 1O7YA 3JC66 4POGA 2RVLA 1TY0A 2F3WA 5M3MH 1SSOA 1TS4A 1ASZA 2WP8J 5KRUA 3RR5A 2K5VA 4RGTA 2Z6BA 5LMUL 1E22A 4WJ3M 2K03A 1H9MA 5IYDG 3HOVB 2AQ2B 1VQ6A 1I50H 1EYGA 3FKIH 2RKSA 1XTDA 5T1IA 3M3YH 3KJOA 4C3HG 1VQAA 1HFGA 1XWEA 3WOEA 1DOKA 1XJVA 2HT1A 3CMEA 1ICWA 3ERQA 2QW7A 4K2LA 1YBYA 4FXKC 1PV4A 3I4MB 3HOYB 1YNXA 1HRJA 1V8QA 1C48A 2D9UA 2F0NA 1KIXA 4B3SQ 2JEAI 2QF7A 5EBCA 1W6KA 3DM3A 4NKLA 2CFMA 1SLJA 3DM1A 1EU4A 2HHHQ 2XN9C 1NR4A 1R9TH 3RLOA 5JEAH 5HY6A 5JVH3 1C4QA 3BZCA 5GAGC 5C4JB 3FDTA 3TZDA 4FP5D 4CJ0B 1UAPA 1BCPB 2WAQB 5CV8A 4OL7A 2RF4A 5IOCA 3NBHB 4B3MQ 3QO2A 1Q46A 2RHQB 1SNMA 4IJLA 2Z8LA 1J9OA 1PTOB 4CKCA 5C3EH 4KLKA 4KI0A 4LW1A 2JA5H 1EIFA 5ISRA 3I2ZA 1VQ5A 1NJIC 3KF6B 4BY1G 1PFSA 1WCMB 5BN3A 3PF5A 5FLMH 1DM0B 2HHHL 5G3LF 3M4QA 2XTIA 3CRLC 4RWSC 4HIDA 2RQXA 1FJGQ 4Z9CB 1CHQD 1L2FA 1M1KC 1X55A 1XX8A 1HQRD 4L5QA 4N8X1 2R7ZB 1KAWA 1GJXA 4N9PA 3PO3H 3NTIA 3IFTA 1EWCA 3KK7A 4FYDA 4B3ML 1DGSA 1ET9A 1TWCH 2HQLA 1WTQA 2ATWA 5M3FG 5IGDA 2K33A 4EQPA 1I50B 1MJCA 5J3BA 2DUDA 2K32A 3U4ZA 4A4IA 3FKIB 4KY5A 5CR3A 1VQBA 5EKKA 3M3YB 1TS5A 5D65A 3PQIA 1U9RA 2QDBA 4HJAA 3FPUB 4LUZA 4P73A 1CSQA 1FJGL 3NXWA 2NWGA 1SR3A 3OYYA 3GD7A 1JOQA 3MAQA 4DKAC 1K8MA 3DMUA 4EQ5A 3IAYA 2JYOA 2R93H 3CQZB 1TY2A 3OHXC 2UXDQ 3T4AC 2F3IA 5EPKA 1GUOA 2IW3A 4MIUA 3CU7A 4GLAC 2CWAA 4BBRB 2F3VA 2PO4A 3UE0A 5C3XA 2A5HA 2F0QA 4H02A 3PUVA 2I0QA 1R9TB 4BXXH 3RLFA 1LTLA 3H3VH 5IP7H 4DV1Q 2F0VA 3SXHA 1AFPA 1IHZA 4JG2A 4HCSA 1SJED 2L4NA 3I4OA 4QJFA 1V1OA 2EJFC 1E7ZA 3BVZA 5HGQA 4V0BA 1EEID 3HOXB 3K81C 5CBEE 5LMNQ 4QIWE 1N8RC 1Z9FA 3HKZG 5I6WA 1MBYA 1SDFA 3OW2A 3BU2A 4DR4L 1E1OA 3RNUA 1NE3A 3CPFA 3L3OC 2Q2HA 2G9DA 4OWTB 3V96A 2I5MX 3X3MA 3EIVA 4WJ4A 1EOTA 1BCPC 1EQTA 2IHEA 2JA6G 1EQVA 2K4KA 5CV7A 5M9OA 1B7YB 2F0PA 4HJ8A 3OTOQ 2NVTB 4ZUJA 1M8AA 3VR6A 1BKBA 4DNIA 1WI5A 1F9QA 4YCWA 3MZ5A 3S1QH 2IPKD 4HR7B 2OTLA 1UUPA 4K0KQ 4C1NI 4Y7NH 4ZK9B 3Q22A 3PF4A 2YU9B 3PO3B 1HA6A 2YYZA 4K5VA 2XSCA 1LLRD 1E2WA 4JI7L 4NPSA 2E2JH 4P72A 5E4WC 1CSPA 1RTNA 1SEBD 1TWCB 2B2TC 5CYUA 3I8ZA 3NBHA 4IZ8A 3VYRA 2VXWA 1DOMA 1LTRD 3TN2A 5IGEA 4HMIA 4KK7A 5I2YA 2L12A 1GUWA 2EXDA 5GAHC 2CVRA 2VUMB 1H9JA 1STYA 2F03A 1DXMA 2F0DA 4KY6A 2OWOA 2TMPA 4MHEA 5ELBA 3HFZB 1PFBA 2HCIA 3KF6A 4DAMA 1SBBB 2FMCA 3SK8A 3EBEA 1X9NA 4G4KA 2IJ0A 1G51A 1HR0W 5J39A 2B2TA 4KV6A 1IKLA 1CM9A 2KUMA 5HURA 2ZXPA 1AH9A 5C0XH 3CC4A 1I4XA 3MFYA 4LNQA 3C2PA 1HPCA 1VQNA 3F2CA 2R61A 3J80E 3VYUA 2EY2A 1G291 3EVQA 5DEHA 4LFAQ 1PLFA 2EJGC 2NUCA 3BS1A 1K8GA 1JC7A 2IL8A 3Q24A 3K5OA 4JI0Q 4IFDH 2KEEA 5C6AA 1T5XD 4HJ7A 4GZYC 1VQJA 1BCPD 3NQIA 1B53A 4IUQA 2K01A 4NW2A 3W2DA 2JXMB 5EJWA 1IBLL 4UHVA 3RUZA 4EGVA 3JAMi 3F2BA 3GTQH 1KRTA 4C3JG 4R4OA 4Q0FA 3K0YA 1VQ4A 3HOWG 1UE1A 3A74A 3IFDA 1JWMD 5EBDA 1GOZA 1RHPA 3O13A 3K57A 2D0PA 2LXJA 2B3GA 5K36G 1QNUA 5KNDA 3CXCA 3QWNA 4QL5A 4LFAL 2RDHA 2ID0A 5HGTA 2UU9L 4ME5A 3CAMA 3OOCA 5D3IB 1UEBA 3PUZA 4HCEA 4A3EG 4JI3Q 2CKZB 2KEDA 1YZ6A 1YEZA 5IWAQ 4P74A 4GS3A 4K8JA 1EYAA 4XDXA 1E2ZA 3CRKC 2OT2A 2MGSA 1DOLA 5IP9H 2E2HB 1HJPA 1TU2B 1WD0A 3N6RA 1EUJA 4IOCA 5DLQE 2CQOA 1A3VA 2KHIA 3KBGA 4H44C 1FR3A 3J80L 1SNCA 3UI2A 4FF4A 1WD1A 4PQXA 1UEAB 1TWFH 2LMCB 4G7HC 4JI8L 4C1NK 4OO1H 3TMEA 2AUKA 4AYBE 5C4XG 2M00A 2EIFA 5D3DA 1N33Q 3I4NH 1KDAA 4K14A 2RCFA 2AQ1B 1YIJA 1SNDA 4A3JG 1L0WA 2AWNA 3KUPA 4JI3L 2ENBA 3S9WA 2E8GA 1D2BA 4A3DG 2HIXA 1XPOA 3GTMH 5LL6X 2JA7G 3CP0A 1TWHH 2F0HA 2WIIB 3KLSA 2Q2IA 3S16B 4FF2A 4CDEC 5KEEA 4JK1C 3GDEA 1H9SB 5C3WA 1SE4A 1KHIA 3D4RA 1B9MA 4RHSA 4ZLTF 3KFUA 1Q82C 2EYOA 1O7LA 1TVXA 2X6GA 2F4IA 2VB2X 1PH1A 4BBSG 3KLRA 4DV3L 4K6LA 2SEBD 4EQOA 5AFWA 1C0AA 4LF9Q 2K1BA 2GN5A 1ICFB 3EQLC 5H1SE 2L11A 1I6HH 1N33L 4AH6A 1X6OA 2WV6D 5E4XA 1HZCA 2M2LA 2VY3A 1JJGA 2K5QA 3S14H 2PW7A 2PNRC 3A55A 2QCPX 1FNUA 2JSOA 3OSOA 3HOZH 1VQ7A 1TWGH 1EQRA 4A3KG 1KTKA 2EE1A 2FMMA 2LXKA 1DD2A 4L5RC 2B2VC 1GUSA 5M5YH 2SNMA 4XQQA 2VQEQ 4AIMA 1EIGA 2TSSA 4HSPA 4OIJA 4KHPQ 1X54A 3BYTB 1CT1D 3S15H 3K6OA 4A3IG 1G2SA 4L63B 1AP0A 1WTOA 1VQHA 4BY7H 1FGBD 5C44B 4HIMA 3SDZA 1TWFB 1TWAH 3CHBD 3E6ZX 4WRDA 4QGUA 2B2VA 1UE5A 2A73B 1G2TA 3D0FA 5I2XA 1MSHA 2R92G 3OIQA 4NXMQ 1OXXK 5DNFA 3QB3A 1IW7C 1QUQB 3I4NB 1BO0A 4UAIA 2YV5A 3KDFB 5EKIA 5EAYA 4HSVA 3VR5A 1S40A 3WOFA 1LTSD 1QVCA 1T5EA 1JWUD 2OQ0A 2E2IH 4RH6A 5M5XB 2B63G 1STBA 2MO0A 2VQEL 3P75A 4FVMA 4EX5A 3GTMB 3NWSA 3QIAA 5KNCA 1TWHB 1PFMA 4AYBB 3M4PA 1ENCA 1I3QH 1OXTA 3OIPA 2EY6A 3VA5A 1AE2A 2KVMA 4C2MH 4DK1A 5CBAE 4QUFA 1IL8A 2F0UA 4RFBA 1ZEQX 5CV9A 4IPCA 5CV4A 4NP5A 2FHTA 1Q7YC 1WTXA 4R8IA 2KJXA 2WKDA 4YIJA 4NXML 2WAQE 4R1JA 3TP5A 2L15A 3E9HA 1I6HB 3MXUA 1I4GA 1RD9D 5FJ8G 2MO1A 3DLLA 4DR5L 1BR9A 4JBMA 4KJOA 4YWKA 5JJZA 2GVAA 4DR1Q 2AQ3B 2F0TA 3H6MA 1R4PB 3VR2A 3S1RB 3HOZB 4XXEA 4A3BH 2N3SA 2C35B 1GD7A 1HA5A 4DR3Q 3SVMA 1U0LA 4KD3A 2F0SA 1WFQA 3J80i 1Y1WB 2KQ3A 3SR1A 1O80A 4WORA 4DV2Q 1H9SA 4PNYA 3PO2G 3BDCA 3T13A 2PNHA 1WCMH 5T1GA 1I4PA 1YNJD 4JBWA 4PMWA 2ZTCA 1IW7D 4KD4A 1F2ZA 1EZ6A 1WVLA 2CQAA 1STHA 2WFWA 5BR8L 3F2UA 1TWAB 3NHHA 1L0XB 1N36Q 2F0LA 2R7ZH 1JOOA 4ID6A 4DNTB 4A93G 1EWIA 2F0EA 1Q8KA 2V1CC 4YCUA 2MNAA 1D1KA 4YY3Q 1SRUA 3LWEA 5E1FA 3HOUB 1VDZA 4LWCA 1A63A 1QCBD 3STBD 2C5CA 2NZHA 4DR3L 3NK9A 1NCVA 5KYIA 2K04A 4XQJA 3I7FA 1QG7A 2E2IB 3QOLA 4CDDC 4DV0Q 5EQ0A 1JCKB 4DV2L 3BVMA 5LHY1 4OWXB 2RDGA 1YJ9A 3MWYW 2G9HD 4DV5L 1NMFA 3HS0C 4RGOS 1I3QB 1PDQA 3UDGA 4DV7Q 4GN4B 1RIPA 1GUNA 5C0XJ 3GTJB 4C2MB 3GTLB 1NY4A 3CQZH 4C3HB 1EEFD 1VF7A 1TKWB 4B3TQ 2K05A 2EY1A 2K14A 1N9WA 2Q8RE 1BBWA 4BBRH 4X6AH 4YY3L 3J7AV 1PZKD 2ZJPA 3I90A 4HMJA 1IZ6A 4A3LG 2N88A 5CC4A 3U58A 4IFDJ 2H1EA 4C56C 4PV1C 3S1NH 5KGUA 1QUQA 4DV4Q 3FRPB 3KDFA 1F2YA 4DV0L 5M5WB 2VS1A 1YVCA 1JE4A 1SNQA 3LX0A 4GKKQ 1GHKA 3CCQA 4IO9A 4BA1I 3HOXH 1B1ZA 2QEXA 2A1AA 4A3GG 4IALA 2B8FA 4PG3A 5IGFA 1XPRA 4A3BB 4UPAA 3LWUA 3ITPA 3HKZE 4DV7L 2ZTDA 5NUCA 1E3PA 1PYBA 1EY7A 3OWFA 3VR4A 3D6WA 4X3SA 1MIUA 4OIKA 3HP3A 5CV6A 3ULLA 4ABNA 4B3SL 3FPPA 4B3TL 5CMDA 2JA8H 1B2TA 1PYWD 1LTID 1I4QA 2N49A 2E74C 1CTMA 1FD7D 3B6YA 1ESFA 4I65A 2O2LD 2MHVA 2NVTH 1ESRA 5BN5A 4IOAA 3IL8A 3NE5B 4R4TA 2NN6H 3L2PA 4DV4L 4BY1B 2BA1A 2QDLA 2H4OA 2LKVA 3H0GG 2Z4IA 1I6VC 4GKKL 3U50C 2YU9H 1HNZQ 1VQDA 2NZOA 1IKMA 1GO3E 1LT5D 3S1MB 1I5FA 2B2YC 4A3FH 5M3MG 3L9AX 1UE7A 1ZXTA 4DK0A 4YHHQ 5KNBA 4DA2A 4K5WA 1VQKA 2I5HA 5FLXc 4A76A 2D0OA 2UUBQ 1N34Q 1R4QB 1XNRQ 5CV5A 3NQTA 3FKIG 4C3IG 2VUMH 1NTGA 5C4ZA 4I7ZC 2VZAA 4LFBQ 1CFMA 2F0JA 4KKSA 2AKWB 3H94A 1WTHA 2B2YA 2FINB 4OGQC 2MFIA 4CJ1B 3A5UA 3GTOB 2EDGA 4DR7Q 2HDLA 1VMPA 1A2TA 2WACA 3RD4A 2SOBA 1G8ZD 3L7ZC 2XWJB 2ZT9C 1QVGA 4LK1C 1Q8IA 1HNZL 5TSSA 1B9NA 1IYJB 1YHAA 4G7ZC 5FO9B 1DYQA 3S1NB 2OF1A 4DR6Q 1KNAA 4L6TB 5FLXE 3AFPA 4CKBA 1YJWA 4QQBX 2UUCQ 5JEAG 4OEMB 1O78A 3CCMA 1N34L 1XNRL 2RDFA 4DUYQ 1IYUA 4LFBL 3S17B 2LY7A 1ILPA 1FYCA 4IQZA 3GTGH 3PSIA 3AYHB 3A0JA 3S24A 2XIWA 1D5MC 1EY0A 3UDIA 4PZ7A 3UDXA 3DXJC 2UXDL 1CKNA 2UXBQ 1K8OA 2JJQA 4H13C 2JA8B 3ND9A 3NP8A 2NVQB 3DUZA 5C3EG 3I55A 4IUTA 2OCEA 5ELFA 2JA5G 3HKZB 5EGTA 2O5IC 2CWPA 3Q6SA 5DM63 3ONAB 4ME3A 1TR5A 2KHSA 4DV1L 4BA2I 4IN3A 1U4LA 3MA2B 2F1MA 1WTWA 2F0MA 5ELDA 4UP8A 1QB5D 5J1ZA 2JA6B 2MP1A 4L5SA 1N32Q 1LT3D 1KC8C 3I3CA 1JJ2A 1ML0D 3NWTA 4LUOA 4K2KA 1YJNA 1VQMA 3I56A 2L55A 1KDBA 2PZUA 2JE6I 3C3LA 4A3FB 3K8AA 1LTTD 5LMNL 1BUVT 3K59A 1QVFA 3D3RA 2Z6KC 4OX9Q 2E2HH 1IBKQ 1GXDC 2CW0C 2O5JC 1PFNA 1O7ZA 4LF4Q 1LO5D 3SK5A 1Y1VH 4A3EH 2UXBL 1SE2A 4LJZC 1Q1EA 4A75A 4PMBA 4L5TA 4ODGA 4GN3B 5FLXL 1CQFA 1K83B 1HTLD 3TP7A 2Q8TA 3OTOL 2DNEA 3MTSA 4F7XA 2GVBA 1WOCA 1Y8OB 2BH8A 3D4DA 2SDFA 4U673 1HZBA 3PGZA 1EZ8A 3M7GA 1RCVD 3KJPA 4X3UA 1HFNA 4K0KL 1N32L 2R93G 1CZWA 1SYGA 1AZPA 1PH6A 4GLXA 4LMQD 1CA5A 1TS2A 2JP1A 3PMFA 3A7AB 3GO5A 3RLNA 2RA4A 1W6JA 4OX9L 1IBKL 3K7UC 3R2TA 3CKIB 4RGMA 3CMAA 1QJOA 5EPLA 5IP7G 4LF4L 3S16H 3PCOB 3C1FA 3VYSA 2K5NA 4H7BA 3MFGA 3P7JA 4N9TA 1WTPA 4XYOA 2EYFA 4IURA 1H9RA 2NTTA 3BDOA 2B2WC 3MVVA 3A8IE 3TRZA 3CCLA 3GTGB 4K8IA 1BOSA 4J15A 2L5TA 2EYPA 4POFA 3LGJA 2CHBD 1EWHA 3RN5A 1A2UA 2IX3A 5G3LD 4X3TA 5JJIA 1JT8A 3R3OA 1KL9A 3TSSA 5JPNC 2KCMA 3CPWA 2KECA 3D6CA 2YTYA 3AMUA 2BDOA 4GLVB 2JA9A 3D4WA 2UUAQ 1CK1A 3MEHA 1JE5A 1SAPA 1VS0A 2B2WA 3HOWB 1T9HA 3SGIA 1ZKOA 4WFN3 4MNOA 2CW0D 3I91A 2JEBI 3NTKA 4RMFA 1LTAD 4CHTB 1ZYRC 4JI0L 4DAVA 2NVXH 3T1HQ 4E6IA 3I4LA 4RHRA 4B9WA 4R9WA 1LV9A 3A8KE 2I5LX 3QG1A 2PPBC 1KNEA 1YHBA 2XGTA 3CC7A 3EFXD 4NDXA 2A6ED 5D14A 2Q8IB 3BDLA 2GA4B 1B44D 2P5ZX 3DWAA 3GTPH 4ILWA 1Y1VB 4A3EB 1J6QA 2AUJD 4DAYB 5C44H 2F0OA 4P75A 1QWYA 3TS0A 1IL2A 1E0BA 3CC2A 1OO9B 2V4DA 1BNZA 1VF5C 1U4PA 1VCIA 3PIOA 1NUCA 3OW7A 2KBNA 1OXVA 1TT2A 1A8VA 1K3BC 2D2CC 1PYSB 1S72A 3OWEB 4OHJA 3G48A 1C9OA 1EU3A 3TP6A 2EVBA 4X64Q 3ZJYC 2LS01 1UWVA 5M5XH 5IWAL 5C0XG 1SYCA 2XRSD 4ULLA 5DM73 1K8AC 4A3CH 3MC0B 1MD2D 1O7IA 2E5LQ 1U5KA 4ALPA 1G6ZA 5IYBG 1XYIA 3RZOH 4O1NA 3H09A 4A3JB 4FF1A 1EY9A 4L8JA 4A3DB 2Z4HA 5IODA 1Z7TA 1LACA 2K75A 3LNNA 2VL6A 4JBKA 1KABA 1KDCA 2A19A 2HD3A 1Q3LA 4IUVA 4LUVA 1CUKA 1QOHA 5GQOA 4A3MG 2E76C 1X32A 1ZYRD 5ELOA 1STGA 2E75C 1X56A 2FXQA 1ET6A 4BBSB 2XRQD 3N52A 1Q12A 1QNKA 2DGYA 1JB7A 1FNWA 3KLSX 1B8AA 4JOIC 2J0TD 2E5LL 3GTKH 4APVA 1V43A 3T51B 3S1RH 3TP8A 1BBXC 4LF6Q 4JI1Q 4DR2Q 4JI2Q 3BYYB 5IYCG 3EN2A 1KAAA 3HRZC 4GKJQ 2NVXB 2WB1G 3SK6A 2IX0A 3J7YW 3AU7A 1STNA 3AFQA 1Y1WH 5BN4A 1SMXA 2PZWA 3G4SA 5ELCA 4N8FA 5IIFA 2B29A 2EZVA 4G7OC 2ES2A 4LF9L 3GTPB 2OXPA 3L0OA 4XT1B 5IP9G 3NELA 1A3UA 3PUWA 4YWLA 2LFNA 3K5LA 3CF5A 4DV6Q 3CW2C 3GV3A 4JBJA 2L9HA 2QGQA 4XQNA 3QOJA 1GKHA 1BQQT 1HXYD 3K5MA 4A3IB 2A69C 1HNXQ 1V1PB 5I6YA 3HOUH 1HR0Q 1E2VA 1YNJC 5IY0A 5DAUA 4KY7A 2QKIC 4DR2L 1XXGA 4S3SA 4F87A 1SYFA 1TXYA 1SE3A 1JOKA 1HH2P 1D7QA 5EKLA 3VDYA 2KCCA 1SYDA 3BG3A 2DJFC 1LYLA 4M8AA 4GOPC 4JI5Q 4KHPL 4MZ9A 1PRTF 1IBMQ 1HZAA 4NMZA 2WKCA 3RZOB 5IYDH 2Z0SA 3H15A 2ZJRA 5F2DA 3STBC 1SMYC 3BVGA 1B3AA 1PH4A 4XIGS 2VW9A 4B3RQ 2VB3X 3ULJA 4AYBG 3GTJH 2CCZA 2B63B 3GTLH 4KTAA 5IT9c 4DV6L 4XYQA 1MGSA 2Y0SG 2Z1CA 1LT4D 4C3HH 1BF4A 3PV0A 3FVQA 2MUYA 2OTJA 4DAYA 3AB9A 4CJ2C 2F0IA 2EJMA 3GQBA 5KIXA 4ZUIA 4LFCQ 1HCZA 1HNWQ 3EA6A 2EYMA 3OMGA 3H3VI 1EFWA 3K5NA 2AHOB 4EVOA 1B70B 3WDNA 2NVYH 4IUUA 1PMRA 3P20A 5M5WH 2RSNA 2BDNA 1GM5A 1LM0A 1XMOQ 4JI5L 3GTKB 4TQUS 1E1TA 1SFOB 1IBML 4R4IA 2NB0A 1A3TA 3TS2A 1KD1C 5CORA 1F9SA 3UDFA 2AWOA 5IT9E 2QA4A 1VQPA 1FNVA 2VQFQ 3K58A 2IX1A 1MHWC 2YTVA 1Y8NB 2A69D 4J8QA 2EYJA 4HIOA 5LMNW 4BS9A 5A2QE 1I4HA 5LMUQ 1V1QA 1DZ1A 4YWMA 1RTOA 2F0KA 4P2CB 4BY1H 3DWQA 4JVZA 2M9VA 4BY7G 1B50A 2PQEA 1GUGA 1HTPA 3JAMc 3J81j 1VQGA 4DR1L 1XMOL 2VNUD 2N78A 3HKSA 3DHQA 2ZM6Q 3S1MH 3CCSA 1SMYD 1W3SA 5JPMC 2PI2A 1CHPD 4QB4A 2ZXRA 3NBIA 4A93B 4B9XA 3OPOA 3Q23A 3BZKA 3HOVG 1EY8A 3GP7A 4JC0A 5M3FH 3ULPA 1A6XA 3CCRA 4OWWB 1FGUA 2G5DA 1CKOA 4X62Q 1FVIA 2X6LA 1NNXA 4OONA 2K28A 5E3FA 1HQMC 1CKNB 4DXFA 3GTOH 2MQHA 1S3OA 2WINB 3SK4A 1PH9A 3JAME 1AN8A 4HJ9A 4H0LC 4C3IH 1N36L 3M4OH 3A56A 3FHWA 3RMHA 3ZYYX 3I4MG 3HOYG 1PRTC 3KBXA 3MXNB 5C0XI 3EROA 5IT9L 5A35A 2A68C 5C4HA 4MTKA 2IY5B 4DXGA 2AMCB 2EYHA 1SNOA 2ZM6L 3CCEA 1V1PA 5GROA 4IPDA 4X65Q 2F52A 1X3FA 2NVYB 3M4YA 3TZUA 1STAA 4JYAQ 1A0IA 2ZXOA 1S5ED 4DU9A 3E3XA 4IFDI 5A2QL 2PMZB 1Q86C 4R4CA 2PQAB 2F0GA 3RZDH 2MJ8A 3H91A 2D5DA 4X62L 3D8GA 4F88A 3S17H 1F77A 4FF3A 4J1MA 2WAQG 3M85A 1ONLA 4MN3A 3KLWA 1PH7A 2IWHA 4A3BG 1K0RA 4KKUA 3F1ZA 4XTCS 1LUZA 4A3GB 4CBVA 3G7LA 4DPGA 1JJCB 2NVQH 1C7YA 4DN4M 2KCNA 5I9PA 3URYA 3F8TA 1VQ9A 2KENA 1BCPF 1WCMG 4X65L 1I4RA 3C1EA 4TRDA 2E2DC 3A54A 2BE5D 4JYAL 4DK6C 4KKTA 2JA6H 1F9PA 4FNFA 1PZID 3X3NA 3U9OA 1YITA 1PTOF 3CCUA 2R7ZG 2XNAC 2A74C 1NR2A 2R7FA 4B08A 3R93A 3JAML 1ILQA 4G57A 4LAAA 3H0GB 2DJGC 3EJIA 4FO2A 4X3KA 1CKMA 4RAUC 2L0CA 1HUNA 3HGBA 1KXLA 1PRTD 1JMCA 2RSOA 1J5EQ 5M3MB 4I7AA 1Q1BA 1RJTA 1SXTA 5M3FB 2A68D 2IT1A 1D6EC 3P1HA 2JN4A 3U4VA 1K83H 3R2IA 3MEFA 1OXSC 1W2BA 1A15A 3I73A 2HDMA 4OO1I 4LF7Q 1LABA 2K5WA 5EPJA 3ND8A 1VQFA 4UP9A 1S5BD 1L0YB 4C3IB 3M4OB 4FDBA 5LL6S 2FFKB 1AW7A 3KOJA 3SE0A 3NENA 4DK3C 4JPBW 2FJ2A 1BBUA 4BBRG 2K52A 3MXGA 1SN8A 3I70A 4YHHL 4DR4Q 1STEA 2EYLA 2O4XA 1VQOA 2KA7A 2UUBL 2C9OA 2B2UC 2XVSA 4HAEA 1J5EL 3RZDB 4CDCC 2BOSA 3KF8B 3E9IA 3HOXG 4JW0A 1H9KA 1D8LA 4PZ6A 2D62A 3A8JE 4LF7L 4DR7L 3DEOA 1QZGA 1OTCA 4IUNA 2RCNA 1RL2A 2J7ZA 4KHVA 2Q2TA 2EPBA 4QUCA 1LTBD 4TVAB 1EOVA 1CZGA 4JI7Q 1D5ZC 3HZXA 1QILA 3MXNA 4V190 2B2UA 1PH2A 2JA8G 1XPUA 4BWGB 5JJKA 4C3JH 5FLMG 3V05A 4WJWA 2J4XA 2R6GA 4DR6L 3HOWH 2HCCA 2JK8A 3Q8DA 1Q81C 2UUCL 2QILA 5IGCA 5C3EB 2JA5B 2NN6G 5K36H 1DCZA 1FL0A 5IGBA 4DUYL 4NXNQ 3DEPA 2A6HC 1PA6A 1KQSA 3SHLA 2PQAA 4LF5Q 3PO3G 1PH8A 3ER0A 4RG1A 4ZQ3A 1TQOA 4HTHA 1K9MC 4GNXB 4HIKA 5CGKA 1M4VA 1PZJD 4A3FG 2K7VA 1PTOC 1SYBA 3SEBA 1P16A 2F0WA 4TKOB 3J81c 3MHBA 2XWBB 3HG9A 3OMCA 2EOTA 2PW5A 2K50A 3QJYA 2VUMG 5L37A 4OELB 2OEOA 2A6EC 4IPGA 3J80c 2ICIA 1EFID 2Z6KA 3J7AF 4M1UB 2QEJC 3T56B 4QCLA 1J8IA 4JCVE 5ELEA 3VA7A 3G6EA 4JI6Q 4P71A 2N55A 2N8NA 4NXNL 1SJHD 2K5HA 3PUXA 4O42A 1EQQA 1IBLQ 4LF5L 4LF8Q 1EL0A 1E24A 1NMGA 3M9BA 1U4MA 5C4XH 2K6AA 1I94Q 2R93B 4BXXG 3J81E 1YHQA 1OXUA 1CI3M 2DY7A 4PMCA 4A3JH 1PH3A 3IKJA 1X3QA 4A3DH 5FKAC 1K28A 5C5MA 1LTGD 4X66Q 1RKNA 5COYA 2JA7H 1XNQQ 1KRSA 5IYBH 2PZTA 1U4RA 5JJLA 3KYHC 2PI2E 2UU9Q 1UE6A 4FXGC 4XT3B 2EXZA 4JI6L 1EYDA 1GUTA 4KN4C 2A6HD 4ZAIA 1WTVA 4BBSH 3CD6A 1C8CA 4C3JB 4LF8L 2R3ZA 4IJHA 3HEJA 4A3MH 1A62A
chains in the Genus database with same CATH topology
1EY6A 1MSGA 4KN7C 1MI2A 1PTOD 1Y8PB 2MPMA 5I4DA 3R8BA 3PUYA 1CA6A 4IUPA 4QIWB 4DAPA 1YNNC 3T53B 1JORA 2KOLA 3E0JA 2DNCA 3S1QB 4RCOA 3KF8A 3MXPA 3D31A 2SNSA 4Y7NB 3Q0AA 1RODA 2I07B 3T16A 2E2JB 1JWSD 2BCOA 2L1BA 4ZKBB 3J81L 4RCNA 5FOBB 4UDUC 3U9SA 2DN8A 1G91A 3DWPA 4DFAA 1F9RA 4ZKCB 5JAVA 1EIHA 4RKBA 3E5SA 5C4XB 5FO8B 4HN7A 1Y69U 3VYTA 2X69A 3FMCA 1X3PA 4IFDG 2JA7B 1AEXA 1XTCD 2K5DA 2HQEA 4DGZA 4HEDA 4CKEA 1CQVA 2B8GA 3TDQA 1BXTA 1LT6D 1NAPA 3NUCA 1JR0D 5JEAJ 1YNND 4KMUC 2NYZD 3H3VC 4A3MB 3GTQB 4KHZA 4ZRZA 3A7LA 2NZ1D 2NTSA 3M7NA 5C5LA 4RA8A 4CGYB 3V2TA 4A3KB 2I46A 1IYVA 3PIO3 2WB1B 4U68A 1VMCA 4TSSA 1II3A 1Z47A 1B4OA 3NTHA 2NN6I 1ENAA 3NSWA 1EY4A 1Q90A 1BDOA 4FXDA 2B39A 1AZQA 3W3AA 1D5XC 1JICA 2DY8A 4R8NA 1SNPA 5J22A 2ICEC 1ENFA 2PYKA 3NPPA 4OO1G 4K5XA 4ZYSA 4K6DA 2R92B 3BZDB 1PRTB 3S2DB 1S5FD 4J6HA 4DNRB 5IGGA 3FEWX 1S4ZA 1UNSA 1DJRD 2F0FA 2HUGA 5FO7B 2NBFA 3PIP3 5JVG3 1QE6A 5JOBA 3TBIB 2PCFB 2Y0SB 1HUMA 1RDPD 1RF2D 1TS3A 1NSNS 2EY5A 4RGNA 1S5CD 1Z6HA 4QMGA 1TIID 2RBMA 1EY5A 4QF4A 4RKLA 4DF7A 3I72A 1F2MA 5FK9C 3K7AB 1SYEA 1HHVA 5KYLA 1F2LA 3S14B 3GV6A 1DONA 1D1IA 3C46A 1EYCA 3S2HB 1TWGB 4F8MA 1PXUA 3PO2B 5M5YB 3G6JB 5I9OA 1PTOH 1S5DD 4Q5VA 1JQYD 1GHJA 2BA0A 1KLGD 4EQNA 3S15B 1KLUD 5K5PA 1WTRA 4KJNA 4BY7B 2BE5C 3VR3A 1JB3A 1O7YA 2RVLA 1TY0A 2F3WA 1SSOA 1TS4A 2WP8J 5KRUA 4RGTA 2K03A 1H9MA 3HOVB 2AQ2B 2RKSA 5T1IA 4C3HG 1HFGA 1XWEA 3WOEA 1DOKA 1ICWA 3ERQA 4K2LA 4FXKC 3I4MB 3HOYB 1HRJA 1V8QA 1C48A 2D9UA 2F0NA 2JEAI 2QF7A 5EBCA 1W6KA 4NKLA 3DM1A 1EU4A 2XN9C 1NR4A 5JEAH 5JVH3 1C4QA 5C4JB 3FDTA 3TZDA 4FP5D 4CJ0B 1UAPA 1BCPB 2WAQB 5CV8A 4OL7A 5IOCA 3QO2A 1SNMA 2Z8LA 1J9OA 1PTOB 4CKCA 4KI0A 5ISRA 1WCMB 5BN3A 1DM0B 5G3LF 3CRLC 4RWSC 2RQXA 4Z9CB 1CHQD 1XX8A 1HQRD 2R7ZB 1GJXA 4N9PA 3NTIA 3IFTA 1EWCA 3KK7A 4FYDA 1ET9A 1WTQA 5IGDA 2K33A 4EQPA 1I50B 2K32A 3FKIB 4KY5A 5CR3A 5EKKA 3M3YB 1TS5A 5D65A 1U9RA 2QDBA 3FPUB 3NXWA 2NWGA 3GD7A 1JOQA 3MAQA 1K8MA 3DMUA 3IAYA 2JYOA 3CQZB 1TY2A 3OHXC 3T4AC 5EPKA 1GUOA 2IW3A 4MIUA 3CU7A 4BBRB 2F3VA 2PO4A 5C3XA 2A5HA 2F0QA 3PUVA 1R9TB 3RLFA 2F0VA 3SXHA 1AFPA 1IHZA 4HCSA 1SJED 2L4NA 1V1OA 2EJFC 3BVZA 4V0BA 1EEID 3HOXB 5CBEE 5I6WA 1MBYA 1SDFA 3L3OC 2G9DA 3V96A 3X3MA 1EOTA 1BCPC 1EQTA 1EQVA 5CV7A 5M9OA 2F0PA 2NVTB 4ZUJA 1M8AA 3VR6A 1F9QA 3MZ5A 2IPKD 4HR7B 1UUPA 4C1NI 4ZK9B 3Q22A 2YU9B 3PO3B 1HA6A 2YYZA 4K5VA 2XSCA 1LLRD 1E2WA 5E4WC 1RTNA 1SEBD 1TWCB 2B2TC 5CYUA 3I8ZA 3NBHA 4IZ8A 3VYRA 2VXWA 1DOMA 1LTRD 3TN2A 5IGEA 4HMIA 4KK7A 5I2YA 2L12A 1GUWA 2CVRA 2VUMB 1H9JA 1STYA 2F03A 1DXMA 2F0DA 4KY6A 2TMPA 4MHEA 5ELBA 1PFBA 2HCIA 1SBBB 2FMCA 3SK8A 4G4KA 2IJ0A 5J39A 2B2TA 4KV6A 1IKLA 1CM9A 2KUMA 5HURA 2ZXPA 5C0XH 1I4XA 3MFYA 3C2PA 1HPCA 2R61A 3J80E 3VYUA 2EY2A 1G291 3EVQA 5DEHA 1PLFA 2EJGC 2NUCA 3BS1A 1JC7A 2IL8A 3Q24A 3K5OA 4IFDH 2KEEA 5C6AA 1T5XD 4GZYC 1BCPD 3NQIA 1B53A 4IUQA 2K01A 4NW2A 3W2DA 2JXMB 5EJWA 3RUZA 4EGVA 4C3JG 4Q0FA 3K0YA 3IFDA 1JWMD 5EBDA 1GOZA 1RHPA 3O13A 3K57A 5K36G 1QNUA 5KNDA 3QWNA 2RDHA 2ID0A 5HGTA 4ME5A 3OOCA 5D3IB 3PUZA 4HCEA 2KEDA 4K8JA 1EYAA 4XDXA 1E2ZA 3CRKC 2OT2A 2MGSA 1DOLA 2E2HB 1TU2B 1WD0A 3N6RA 1A3VA 3KBGA 4H44C 1FR3A 3J80L 1SNCA 3UI2A 4FF4A 1WD1A 4PQXA 1UEAB 2LMCB 4G7HC 4C1NK 4OO1H 3TMEA 2AUKA 2M00A 5D3DA 1KDAA 4K14A 2AQ1B 1SNDA 2AWNA 3KUPA 2ENBA 3S9WA 1D2BA 5LL6X 2F0HA 2WIIB 3KLSA 3S16B 4FF2A 5KEEA 4JK1C 1H9SB 5C3WA 1SE4A 3D4RA 1B9MA 4RHSA 4ZLTF 2EYOA 1O7LA 1TVXA 2X6GA 2F4IA 2VB2X 3KLRA 4K6LA 2SEBD 4EQOA 5AFWA 2K1BA 3EQLC 2L11A 2WV6D 5E4XA 2M2LA 2K5QA 2PW7A 2PNRC 3A55A 2QCPX 1FNUA 2JSOA 3OSOA 1KTKA 2EE1A 2FMMA 1DD2A 2B2VC 1GUSA 2SNMA 4XQQA 1EIGA 2TSSA 4HSPA 4OIJA 3BYTB 1CT1D 3K6OA 1G2SA 4L63B 1AP0A 1WTOA 1FGBD 5C44B 3SDZA 1TWFB 3CHBD 3E6ZX 4WRDA 2B2VA 2A73B 1G2TA 5I2XA 1MSHA 3OIQA 1OXXK 5DNFA 1IW7C 3QB3A 3I4NB 1BO0A 4UAIA 5EKIA 4HSVA 3VR5A 3WOFA 1LTSD 1T5EA 1JWUD 4RH6A 5M5XB 1STBA 3P75A 4FVMA 3GTMB 3NWSA 3QIAA 5KNCA 1TWHB 1PFMA 4AYBB 1ENCA 1OXTA 3OIPA 2EY6A 3VA5A 2KVMA 4DK1A 5CBAE 4QUFA 1IL8A 2F0UA 4RFBA 1ZEQX 5CV9A 5CV4A 4NP5A 2FHTA 1WTXA 4R8IA 2KJXA 2WKDA 4YIJA 3TP5A 1I6HB 3MXUA 1I4GA 1RD9D 1BR9A 4KJOA 5JJZA 2AQ3B 2F0TA 3H6MA 1R4PB 3VR2A 3S1RB 3HOZB 4XXEA 1HA5A 3SVMA 4KD3A 2F0SA 1Y1WB 2KQ3A 3SR1A 1O80A 4WORA 1H9SA 4PNYA 3BDCA 3T13A 5T1GA 1I4PA 1YNJD 4JBWA 4PMWA 1IW7D 4KD4A 1F2ZA 1EZ6A 1WVLA 2CQAA 1STHA 3F2UA 1TWAB 3NHHA 1L0XB 2F0LA 1JOOA 4ID6A 4DNTB 2F0EA 1D1KA 5E1FA 3LWEA 3HOUB 1VDZA 1QCBD 2C5CA 3NK9A 1NCVA 5KYIA 2K04A 4XQJA 1QG7A 2E2IB 3QOLA 5EQ0A 1JCKB 3BVMA 5LHY1 2RDGA 3MWYW 2G9HD 3HS0C 4RGOS 1I3QB 1PDQA 1GUNA 5C0XJ 3GTJB 4C2MB 3GTLB 4C3HB 1EEFD 1VF7A 1TKWB 2K05A 2EY1A 2Q8RE 3J7AV 1PZKD 3I90A 4HMJA 2N88A 5CC4A 4IFDJ 2H1EA 4C56C 4PV1C 5KGUA 3FRPB 1F2YA 5M5WB 1JE4A 1SNQA 3LX0A 1GHKA 4BA1I 1B1ZA 4IALA 2B8FA 5IGFA 4A3BB 3LWUA 3ITPA 5NUCA 1EY7A 3OWFA 3VR4A 3D6WA 4X3SA 4OIKA 3HP3A 5CV6A 4ABNA 3FPPA 5CMDA 1B2TA 1PYWD 1LTID 1I4QA 2E74C 1CTMA 1FD7D 1ESFA 4I65A 2O2LD 2MHVA 1ESRA 5BN5A 3IL8A 3NE5B 2NN6H 4BY1B 2BA1A 2H4OA 2LKVA 2Z4IA 1I6VC 1IKMA 1LT5D 3S1MB 2B2YC 3L9AX 1ZXTA 4DK0A 5KNBA 4DA2A 4K5WA 1R4QB 5CV5A 3NQTA 4C3IG 5C4ZA 4I7ZC 1CFMA 2F0JA 4KKSA 3H94A 2B2YA 2FINB 4OGQC 3GTOB 4CJ1B 1DZ1A 2EDGA 2HDLA 1VMPA 1A2TA 2WACA 3RD4A 2SOBA 1G8ZD 3L7ZC 2XWJB 2ZT9C 4LK1C 1Q8IA 5TSSA 1B9NA 4G7ZC 5FO9B 1DYQA 3S1NB 2OF1A 1KNAA 4L6TB 5FLXE 4CKBA 5JEAG 1O78A 2RDFA 1IYUA 3S17B 2LY7A 1ILPA 1FYCA 4IQZA 2XIWA 1D5MC 1EY0A 3DXJC 1K8OA 4H13C 2JA8B 3ND9A 3NP8A 2NVQB 3DUZA 4IUTA 5ELFA 2O5IC 3HKZB 5EGTA 3Q6SA 5DM63 3ONAB 1TR5A 2KHSA 4BA2I 4IN3A 1U4LA 3MA2B 2F1MA 1WTWA 2F0MA 5ELDA 1QB5D 5J1ZA 2JA6B 2MP1A 1LT3D 3I3CA 1ML0D 3NWTA 4K2KA 2L55A 1KDBA 2PZUA 2JE6I 3C3LA 4A3FB 1LTTD 1BUVT 3K59A 3D3RA 1GXDC 2CW0C 2O5JC 1PFNA 1O7ZA 1LO5D 3SK5A 1SE2A 4LJZC 1Q1EA 4PMBA 4ODGA 5FLXL 1CQFA 1K83B 1HTLD 3TP7A 2Q8TA 2DNEA 3MTSA 4F7XA 3D4DA 1Y8OB 4U673 2SDFA 1EZ8A 3M7GA 1RCVD 4X3UA 1HFNA 1CZWA 1SYGA 1AZPA 4LMQD 1CA5A 1TS2A 2JP1A 3PMFA 3A7AB 3GO5A 2RA4A 1W6JA 3R2TA 4RGMA 3CKIB 1QJOA 5EPLA 3C1FA 3VYSA 4H7BA 3MFGA 3P7JA 4N9TA 1WTPA 4XYOA 2EYFA 4IURA 1H9RA 2NTTA 3BDOA 2B2WC 3MVVA 3A8IE 3GTGB 4K8IA 1BOSA 2L5TA 2EYPA 2CHBD 1EWHA 1A2UA 2IX3A 5G3LD 4X3TA 3R3OA 3TSSA 5JPNC 2KECA 3D6CA 3AMUA 2BDOA 3D4WA 1CK1A 1SAPA 3MEHA 2B2WA 3HOWB 1ZKOA 4WFN3 2CW0D 3I91A 2JEBI 3NTKA 1LTAD 4CHTB 1ZYRC 4DAVA 4E6IA 3I4LA 4RHRA 4B9WA 4R9WA 1LV9A 3A8KE 3QG1A 2PPBC 1KNEA 3EFXD 4NDXA 2A6ED 5D14A 2Q8IB 3BDLA 2GA4B 1B44D 3DWAA 4ILWA 1Y1VB 4A3EB 2AUJD 2F0OA 1QWYA 1E0BA 1OO9B 2V4DA 1BNZA 1VF5C 1U4PA 1VCIA 1NUCA 3OW7A 1OXVA 1TT2A 2D2CC 3OWEB 4OHJA 1EU3A 3TP6A 2EVBA 2LS01 5C0XG 1SYCA 2XRSD 5DM73 4ULLA 3MC0B 1MD2D 1G6ZA 1XYIA 4O1NA 3H09A 4A3JB 4FF1A 1EY9A 4L8JA 4A3DB 2Z4HA 5IODA 1Z7TA 1LACA 3LNNA 1KABA 1KDCA 1Q3LA 4IUVA 1QOHA 2E76C 1X32A 1ZYRD 1STGA 2E75C 1ET6A 4BBSB 2XRQD 3N52A 1Q12A 1QNKA 1FNWA 3KLSX 2J0TD 1V43A 3T51B 3TP8A 1BBXC 3BYYB 3HRZC 1KAAA 2NVXB 3SK6A 2IX0A 3J7YW 3AU7A 1STNA 5BN4A 2PZWA 5ELCA 5IIFA 2EZVA 4G7OC 3GTPB 2OXPA 4XT1B 1A3UA 3PUWA 2LFNA 3K5LA 3GV3A 2L9HA 4XQNA 3QOJA 1BQQT 1HXYD 3K5MA 4A3IB 2A69C 1V1PB 5I6YA 1E2VA 1YNJC 5DAUA 4KY7A 2QKIC 1XXGA 4S3SA 4F87A 1SYFA 1SE3A 1JOKA 5EKLA 2KCCA 1SYDA 3BG3A 4M8AA 1PRTF 4NMZA 2WKCA 3RZOB 5F2DA 1SMYC 3BVGA 1B3AA 4XIGS 2VB3X 2B63B 4KTAA 4XYQA 1MGSA 2Z1CA 1LT4D 1BF4A 3PV0A 3FVQA 2MUYA 4DAYA 3AB9A 4CJ2C 2F0IA 2EJMA 3GQBA 5KIXA 4ZUIA 1HCZA 3EA6A 2EYMA 3OMGA 3K5NA 4EVOA 3WDNA 4IUUA 1PMRA 3P20A 2RSNA 2BDNA 3GTKB 4TQUS 1SFOB 2NB0A 1A3TA 5CORA 1F9SA 2AWOA 5IT9E 1FNVA 3K58A 2IX1A 1Y8NB 2A69D 4J8QA 2EYJA 4BS9A 5A2QE 1I4HA 1RTOA 2F0KA 4P2CB 3DWQA 2M9VA 1B50A 2PQEA 1GUGA 1HTPA 2VNUD 3DHQA 1SMYD 5JPMC 1CHPD 4QB4A 2ZXRA 3NBIA 4A93B 4B9XA 3OPOA 3Q23A 1EY8A 3GP7A 1A6XA 2X6LA 2K28A 5E3FA 1HQMC 4DXFA 2WINB 3SK4A 3JAME 1AN8A 4H0LC 3A56A 3RMHA 3ZYYX 1PRTC 3KBXA 5C0XI 3EROA 5IT9L 5A35A 2A68C 5C4HA 4DXGA 2EYHA 1SNOA 1V1PA 2NVYB 3M4YA 3TZUA 1STAA 2ZXOA 1S5ED 4DU9A 4IFDI 5A2QL 2PMZB 2F0GA 2MJ8A 3H91A 2D5DA 3D8GA 4F88A 1F77A 4FF3A 4J1MA 3M85A 1ONLA 4MN3A 2IWHA 4KKUA 4XTCS 4A3GB 4CBVA 3G7LA 4DN4M 2KCNA 5I9PA 3URYA 1BCPF 1I4RA 3C1EA 4TRDA 2E2DC 3A54A 2BE5D 4KKTA 1F9PA 4FNFA 1PZID 3X3NA 3U9OA 1PTOF 2XNAC 2A74C 1NR2A 4B08A 3R93A 3JAML 1ILQA 4G57A 4LAAA 3H0GB 3EJIA 4FO2A 4X3KA 4RAUC 2L0CA 1HUNA 3HGBA 1PRTD 2RSOA 5M3MB 1Q1BA 1RJTA 1SXTA 5M3FB 2A68D 2IT1A 1D6EC 3P1HA 3R2IA 1OXSC 1A15A 3I73A 2HDMA 4OO1I 1LABA 2K5WA 5EPJA 3ND8A 4C3IB 1S5BD 1L0YB 3M4OB 5LL6S 2FFKB 1AW7A 3SE0A 2FJ2A 3MXGA 3I70A 1STEA 2EYLA 2O4XA 2KA7A 2C9OA 2B2UC 2XVSA 4HAEA 3RZDB 2BOSA 1H9KA 2D62A 3A8JE 3DEOA 4IUNA 4KHVA 2J7ZA 2EPBA 4QUCA 1LTBD 1CZGA 1D5ZC 3HZXA 1QILA 3MXNA 4V190 2B2UA 4BWGB 3V05A 4WJWA 2J4XA 2R6GA 2HCCA 2QILA 5IGCA 5C3EB 2JA5B 2NN6G 5K36H 1DCZA 5IGBA 3DEPA 2A6HC 3SHLA 4ZQ3A 1TQOA 4HTHA 5CGKA 1M4VA 1PZJD 2K7VA 1PTOC 1SYBA 3SEBA 2F0WA 4TKOB 3MHBA 2XWBB 3HG9A 3OMCA 2EOTA 2PW5A 3QJYA 2OEOA 2A6EC 2ICIA 1EFID 3J7AF 4M1UB 2QEJC 3T56B 4QCLA 1J8IA 5ELEA 3VA7A 2N55A 1SJHD 3PUXA 4O42A 1EL0A 1U4MA 2K6AA 2R93B 3J81E 1OXUA 1CI3M 2DY7A 4PMCA 3IKJA 1X3QA 5FKAC 5C5MA 1LTGD 1RKNA 5COYA 2PZTA 1U4RA 4FXGC 4XT3B 2EXZA 1EYDA 1GUTA 4KN4C 2A6HD 4ZAIA 1WTVA 1C8CA 4C3JB 2R3ZA 3HEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A V;  3JAM L;  3J81 L;  5LL6 X;  5A2Q L;  3J80 L;  5FLX L;  5IT9 L; 
#chains in the Genus database with same CATH topology
 1X65 A;  1EY6 A;  1MSG A;  4KN7 C;  1I94 L;  1MI2 A;  1PTO D;  1Y8P B;  2MPM A;  2Q2U A;  4PZ8 A;  5I4D A;  1ASY A;  2WB1 E;  3R8B A;  3PUY A;  1VQL A;  1CA6 A;  4IUP A;  4QIW B;  4DAP A;  4X66 L;  1WJJ A;  1YNN C;  3T53 B;  1XNQ L;  1JOR A;  2KOL A;  3E0J A;  1VQI A;  2DNC A;  1X3G A;  4JI8 Q;  4CDF C;  4A3K H;  5IYC H;  3S1Q B;  4RCO A;  3KF8 A;  1SRO A;  1P8L A;  3F2D A;  3MXP A;  2EQS A;  3D31 A;  4DUZ Q;  2SNS A;  4Y7N B;  3Q0A A;  1ROD A;  2I07 B;  2Z9H A;  3T16 A;  1Y1V G;  2E2J B;  1JWS D;  2BCO A;  2L1B A;  1NBW A;  3AEV A;  4ZKB B;  3J81 L;  4RCN A;  4O0A A;  4GOP B;  2UUA L;  4A3I H;  4GNX C;  1K0S A;  1X3E A;  5FOB B;  4UDU C;  1MJE A;  3U9S A;  1QZH A;  1XMQ Q;  3CCV A;  2DN8 A;  1G91 A;  5GAE C;  3T1H L;  3DWP A;  1BVS A;  4DFA A;  2HIV A;  2R92 H;  1F9R A;  2H5X A;  1VQE A;  4ZKC B;  5JAV A;  3S2D H;  1EIH A;  4RKB A;  5IE8 A;  3E5S A;  4DV3 Q;  5C4X B;  5FO8 B;  4OXP A;  4HN7 A;  1Y69 U;  4GNX A;  1V9P A;  1H95 A;  4DUZ L;  3T1Y Q;  1EIY B;  3VYT A;  2Y0S E;  2B63 H;  2X69 A;  2RHS B;  3FMC A;  1X3P A;  2CH4 A;  4R4Q A;  3CCJ A;  1L1O B;  4IFD G;  2JA7 B;  2ZTE A;  3NEM A;  3W1G A;  1AEX A;  1XTC D;  5ELN A;  2K5D A;  4QY7 A;  3K80 C;  2HQE A;  4DGZ A;  4HED A;  4CKE A;  1CQV A;  1XMQ L;  2B8G A;  3TDQ A;  1BXT A;  1LT6 D;  1NAP A;  3W5O A;  5AJ3 Q;  3NUC A;  1JR0 D;  4NB3 A;  4X64 L;  1PHJ A;  5JEA J;  1YNN D;  4KMU C;  2NYZ D;  3H3V C;  3PIP A;  4A3M B;  3GTQ B;  1SFO H;  3BJU A;  2ALY B;  4KHZ A;  3G71 A;  5FJ8 H;  3K7A H;  4ZRZ A;  3T1Y L;  1SE8 A;  5GAD C;  1AE3 A;  1Y14 B;  3A7L A;  2NZ1 D;  2NTS A;  2A8V A;  3M7N A;  4MTN A;  5C5L A;  4RA8 A;  4CGY B;  3V2T A;  4A3K B;  2I46 A;  2LSS A;  2UXC Q;  3PIO 3;  1IYV A;  3S2H H;  3J7Z C;  2WB1 B;  4JOI A;  4U68 A;  1VMC A;  4TSS A;  1II3 A;  1Z47 A;  1M90 C;  1B4O A;  3ERS X;  3NTH A;  2NN6 I;  1ENA A;  3NSW A;  1EY4 A;  3PO2 H;  1Q90 A;  5AJ3 L;  1BDO A;  4FXD A;  2B39 A;  5C44 G;  1AZQ A;  4GN5 A;  3W3A A;  4JV5 Q;  1D5X C;  1MKH A;  1JIC A;  2DY8 A;  4R8N A;  1SNP A;  4ZCK A;  5J22 A;  4JI1 L;  2ICE C;  4LF6 L;  1ENF A;  2PYK A;  4JI2 L;  3NPP A;  4OO1 G;  4GKJ L;  4A93 H;  4K5X A;  2IHF A;  4ZYS A;  3I4N G;  4K6D A;  4UY8 C;  3RN2 A;  1VQ8 A;  2R92 B;  3BZD B;  1PRT B;  2JQO A;  3S2D B;  4Y52 H;  1S5F D;  4J6H A;  4HJ5 A;  2UXC L;  3FP9 A;  4DNR B;  4A3C G;  1G6P A;  5IGG A;  3IRB A;  3FEW X;  4IPH A;  1K3R A;  2KHJ A;  1S4Z A;  1HZ9 A;  2BH2 A;  3HOV H;  1UNS A;  1DJR D;  2F0F A;  4DR5 Q;  2ASB A;  3TRE A;  2HUG A;  5FO7 B;  4YCV A;  2NBF A;  3PIP 3;  3E0E A;  5JVG 3;  4JI4 Q;  1QE6 A;  1HNX L;  2F4V Q;  5JOB A;  2PMZ E;  3W1B A;  3TBI B;  1HR0 L;  4JV5 L;  4GOP A;  2PCF B;  2Y0S B;  3WWV A;  3ICE A;  3K0X A;  1HUM A;  1RDP D;  1RF2 D;  2ZJQ A;  1TS3 A;  1NSN S;  3I4M H;  3HOY H;  2EY5 A;  2CH4 W;  4RGN A;  1S5C D;  2KCT A;  1L1O C;  1GVP A;  1Z6H A;  4QMG A;  1PH5 A;  1TII D;  2RBM A;  1EY5 A;  4QF4 A;  4RKL A;  4A3L H;  1YI2 A;  4DF7 A;  3A5Z B;  3I72 A;  1F2M A;  5FK9 C;  3K7A B;  4B3R L;  4AQY Q;  1SYE A;  1HHV A;  3HOZ G;  1IXR A;  5KYL A;  5BR8 Q;  3J7A 5;  5C4J H;  5E7N A;  1K73 C;  1F2L A;  3S14 B;  4A3G H;  2OQK A;  1Y1W G;  3GV6 A;  1DON A;  3J81 i;  1L1O A;  1PVO A;  4JI4 L;  1D1I A;  3C46 A;  2F4V L;  1EYC A;  4LFC L;  3S2H B;  1WYD A;  1HNW L;  1TWG B;  4UP7 A;  4F8M A;  3TEH B;  2R7D A;  1PXU A;  3TQY A;  3PO2 B;  5M5Y B;  3G6J B;  5I9O A;  1B3Q A;  1PTO H;  1S5D D;  3UE1 A;  4Q5V A;  1JQY D;  1GHJ A;  1VQC A;  2BA0 A;  3AQQ A;  4DV5 Q;  3QR8 A;  1KLG D;  4O2D A;  2YTX A;  4EQN A;  3S15 B;  1KLU D;  5K5P A;  4AQY L;  3H0G H;  4KJN A;  1WTR A;  3HOU G;  4BY7 B;  2VQF L;  2BE5 C;  3VR3 A;  1JB3 A;  1O7Y A;  3JC6 6;  4POG A;  2RVL A;  1TY0 A;  2F3W A;  5M3M H;  1SSO A;  1TS4 A;  1ASZ A;  2WP8 J;  5KRU A;  3RR5 A;  2K5V A;  4RGT A;  2Z6B A;  5LMU L;  1E22 A;  4WJ3 M;  2K03 A;  1H9M A;  5IYD G;  3HOV B;  2AQ2 B;  1VQ6 A;  1I50 H;  1EYG A;  3FKI H;  2RKS A;  1XTD A;  5T1I A;  3M3Y H;  3KJO A;  4C3H G;  1VQA A;  1HFG A;  1XWE A;  3WOE A;  1DOK A;  1XJV A;  2HT1 A;  3CME A;  1ICW A;  3ERQ A;  2QW7 A;  4K2L A;  1YBY A;  4FXK C;  1PV4 A;  3I4M B;  3HOY B;  1YNX A;  1HRJ A;  1V8Q A;  1C48 A;  2D9U A;  2F0N A;  1KIX A;  4B3S Q;  2JEA I;  2QF7 A;  5EBC A;  1W6K A;  3DM3 A;  4NKL A;  2CFM A;  1SLJ A;  3DM1 A;  1EU4 A;  2HHH Q;  2XN9 C;  1NR4 A;  1R9T H;  3RLO A;  5JEA H;  5HY6 A;  5JVH 3;  1C4Q A;  3BZC A;  5GAG C;  5C4J B;  3FDT A;  3TZD A;  4FP5 D;  4CJ0 B;  1UAP A;  1BCP B;  2WAQ B;  5CV8 A;  4OL7 A;  2RF4 A;  5IOC A;  3NBH B;  4B3M Q;  3QO2 A;  1Q46 A;  2RHQ B;  1SNM A;  4IJL A;  2Z8L A;  1J9O A;  1PTO B;  4CKC A;  5C3E H;  4KLK A;  4KI0 A;  4LW1 A;  2JA5 H;  1EIF A;  5ISR A;  3I2Z A;  1VQ5 A;  1NJI C;  3KF6 B;  4BY1 G;  1PFS A;  1WCM B;  5BN3 A;  3PF5 A;  5FLM H;  1DM0 B;  2HHH L;  5G3L F;  3M4Q A;  2XTI A;  3CRL C;  4RWS C;  4HID A;  2RQX A;  1FJG Q;  4Z9C B;  1CHQ D;  1L2F A;  1M1K C;  1X55 A;  1XX8 A;  1HQR D;  4L5Q A;  4N8X 1;  2R7Z B;  1KAW A;  1GJX A;  4N9P A;  3PO3 H;  3NTI A;  3IFT A;  1EWC A;  3KK7 A;  4FYD A;  4B3M L;  1DGS A;  1ET9 A;  1TWC H;  2HQL A;  1WTQ A;  2ATW A;  5M3F G;  5IGD A;  2K33 A;  4EQP A;  1I50 B;  1MJC A;  5J3B A;  2DUD A;  2K32 A;  3U4Z A;  4A4I A;  3FKI B;  4KY5 A;  5CR3 A;  1VQB A;  5EKK A;  3M3Y B;  1TS5 A;  5D65 A;  3PQI A;  1U9R A;  2QDB A;  4HJA A;  3FPU B;  4LUZ A;  4P73 A;  1CSQ A;  1FJG L;  3NXW A;  2NWG A;  1SR3 A;  3OYY A;  3GD7 A;  1JOQ A;  3MAQ A;  4DKA C;  1K8M A;  3DMU A;  4EQ5 A;  3IAY A;  2JYO A;  2R93 H;  3CQZ B;  1TY2 A;  3OHX C;  2UXD Q;  3T4A C;  2F3I A;  5EPK A;  1GUO A;  2IW3 A;  4MIU A;  3CU7 A;  4GLA C;  2CWA A;  4BBR B;  2F3V A;  2PO4 A;  3UE0 A;  5C3X A;  2A5H A;  2F0Q A;  4H02 A;  3PUV A;  2I0Q A;  1R9T B;  4BXX H;  3RLF A;  1LTL A;  3H3V H;  5IP7 H;  4DV1 Q;  2F0V A;  3SXH A;  1AFP A;  1IHZ A;  4JG2 A;  4HCS A;  1SJE D;  2L4N A;  3I4O A;  4QJF A;  1V1O A;  2EJF C;  1E7Z A;  3BVZ A;  5HGQ A;  4V0B A;  1EEI D;  3HOX B;  3K81 C;  5CBE E;  5LMN Q;  4QIW E;  1N8R C;  1Z9F A;  3HKZ G;  5I6W A;  1MBY A;  1SDF A;  3OW2 A;  3BU2 A;  4DR4 L;  1E1O A;  3RNU A;  1NE3 A;  3CPF A;  3L3O C;  2Q2H A;  2G9D A;  4OWT B;  3V96 A;  2I5M X;  3X3M A;  3EIV A;  4WJ4 A;  1EOT A;  1BCP C;  1EQT A;  2IHE A;  2JA6 G;  1EQV A;  2K4K A;  5CV7 A;  5M9O A;  1B7Y B;  2F0P A;  4HJ8 A;  3OTO Q;  2NVT B;  4ZUJ A;  1M8A A;  3VR6 A;  1BKB A;  4DNI A;  1WI5 A;  1F9Q A;  4YCW A;  3MZ5 A;  3S1Q H;  2IPK D;  4HR7 B;  2OTL A;  1UUP A;  4K0K Q;  4C1N I;  4Y7N H;  4ZK9 B;  3Q22 A;  3PF4 A;  2YU9 B;  3PO3 B;  1HA6 A;  2YYZ A;  4K5V A;  2XSC A;  1LLR D;  1E2W A;  4JI7 L;  4NPS A;  2E2J H;  4P72 A;  5E4W C;  1CSP A;  1RTN A;  1SEB D;  1TWC B;  2B2T C;  5CYU A;  3I8Z A;  3NBH A;  4IZ8 A;  3VYR A;  2VXW A;  1DOM A;  1LTR D;  3TN2 A;  5IGE A;  4HMI A;  4KK7 A;  5I2Y A;  2L12 A;  1GUW A;  2EXD A;  5GAH C;  2CVR A;  2VUM B;  1H9J A;  1STY A;  2F03 A;  1DXM A;  2F0D A;  4KY6 A;  2OWO A;  2TMP A;  4MHE A;  5ELB A;  3HFZ B;  1PFB A;  2HCI A;  3KF6 A;  4DAM A;  1SBB B;  2FMC A;  3SK8 A;  3EBE A;  1X9N A;  4G4K A;  2IJ0 A;  1G51 A;  1HR0 W;  5J39 A;  2B2T A;  4KV6 A;  1IKL A;  1CM9 A;  2KUM A;  5HUR A;  2ZXP A;  1AH9 A;  5C0X H;  3CC4 A;  1I4X A;  3MFY A;  4LNQ A;  3C2P A;  1HPC A;  1VQN A;  3F2C A;  2R61 A;  3J80 E;  3VYU A;  2EY2 A;  1G29 1;  3EVQ A;  5DEH A;  4LFA Q;  1PLF A;  2EJG C;  2NUC A;  3BS1 A;  1K8G A;  1JC7 A;  2IL8 A;  3Q24 A;  3K5O A;  4JI0 Q;  4IFD H;  2KEE A;  5C6A A;  1T5X D;  4HJ7 A;  4GZY C;  1VQJ A;  1BCP D;  3NQI A;  1B53 A;  4IUQ A;  2K01 A;  4NW2 A;  3W2D A;  2JXM B;  5EJW A;  1IBL L;  4UHV A;  3RUZ A;  4EGV A;  3JAM i;  3F2B A;  3GTQ H;  1KRT A;  4C3J G;  4R4O A;  4Q0F A;  3K0Y A;  1VQ4 A;  3HOW G;  1UE1 A;  3A74 A;  3IFD A;  1JWM D;  5EBD A;  1GOZ A;  1RHP A;  3O13 A;  3K57 A;  2D0P A;  2LXJ A;  2B3G A;  5K36 G;  1QNU A;  5KND A;  3CXC A;  3QWN A;  4QL5 A;  4LFA L;  2RDH A;  2ID0 A;  5HGT A;  2UU9 L;  4ME5 A;  3CAM A;  3OOC A;  5D3I B;  1UEB A;  3PUZ A;  4HCE A;  4A3E G;  4JI3 Q;  2CKZ B;  2KED A;  1YZ6 A;  1YEZ A;  5IWA Q;  4P74 A;  4GS3 A;  4K8J A;  1EYA A;  4XDX A;  1E2Z A;  3CRK C;  2OT2 A;  2MGS A;  1DOL A;  5IP9 H;  2E2H B;  1HJP A;  1TU2 B;  1WD0 A;  3N6R A;  1EUJ A;  4IOC A;  5DLQ E;  2CQO A;  1A3V A;  2KHI A;  3KBG A;  4H44 C;  1FR3 A;  3J80 L;  1SNC A;  3UI2 A;  4FF4 A;  1WD1 A;  4PQX A;  1UEA B;  1TWF H;  2LMC B;  4G7H C;  4JI8 L;  4C1N K;  4OO1 H;  3TME A;  2AUK A;  4AYB E;  5C4X G;  2M00 A;  2EIF A;  5D3D A;  1N33 Q;  3I4N H;  1KDA A;  4K14 A;  2RCF A;  2AQ1 B;  1YIJ A;  1SND A;  4A3J G;  1L0W A;  2AWN A;  3KUP A;  4JI3 L;  2ENB A;  3S9W A;  2E8G A;  1D2B A;  4A3D G;  2HIX A;  1XPO A;  3GTM H;  5LL6 X;  2JA7 G;  3CP0 A;  1TWH H;  2F0H A;  2WII B;  3KLS A;  2Q2I A;  3S16 B;  4FF2 A;  4CDE C;  5KEE A;  4JK1 C;  3GDE A;  1H9S B;  5C3W A;  1SE4 A;  1KHI A;  3D4R A;  1B9M A;  4RHS A;  4ZLT F;  3KFU A;  1Q82 C;  2EYO A;  1O7L A;  1TVX A;  2X6G A;  2F4I A;  2VB2 X;  1PH1 A;  4BBS G;  3KLR A;  4DV3 L;  4K6L A;  2SEB D;  4EQO A;  5AFW A;  1C0A A;  4LF9 Q;  2K1B A;  2GN5 A;  1ICF B;  3EQL C;  5H1S E;  2L11 A;  1I6H H;  1N33 L;  4AH6 A;  1X6O A;  2WV6 D;  5E4X A;  1HZC A;  2M2L A;  2VY3 A;  1JJG A;  2K5Q A;  3S14 H;  2PW7 A;  2PNR C;  3A55 A;  2QCP X;  1FNU A;  2JSO A;  3OSO A;  3HOZ H;  1VQ7 A;  1TWG H;  1EQR A;  4A3K G;  1KTK A;  2EE1 A;  2FMM A;  2LXK A;  1DD2 A;  4L5R C;  2B2V C;  1GUS A;  5M5Y H;  2SNM A;  4XQQ A;  2VQE Q;  4AIM A;  1EIG A;  2TSS A;  4HSP A;  4OIJ A;  4KHP Q;  1X54 A;  3BYT B;  1CT1 D;  3S15 H;  3K6O A;  4A3I G;  1G2S A;  4L63 B;  1AP0 A;  1WTO A;  1VQH A;  4BY7 H;  1FGB D;  5C44 B;  4HIM A;  3SDZ A;  1TWF B;  1TWA H;  3CHB D;  3E6Z X;  4WRD A;  4QGU A;  2B2V A;  1UE5 A;  2A73 B;  1G2T A;  3D0F A;  5I2X A;  1MSH A;  2R92 G;  3OIQ A;  4NXM Q;  1OXX K;  5DNF A;  3QB3 A;  1IW7 C;  1QUQ B;  3I4N B;  1BO0 A;  4UAI A;  2YV5 A;  3KDF B;  5EKI A;  5EAY A;  4HSV A;  3VR5 A;  1S40 A;  3WOF A;  1LTS D;  1QVC A;  1T5E A;  1JWU D;  2OQ0 A;  2E2I H;  4RH6 A;  5M5X B;  2B63 G;  1STB A;  2MO0 A;  2VQE L;  3P75 A;  4FVM A;  4EX5 A;  3GTM B;  3NWS A;  3QIA A;  5KNC A;  1TWH B;  1PFM A;  4AYB B;  3M4P A;  1ENC A;  1I3Q H;  1OXT A;  3OIP A;  2EY6 A;  3VA5 A;  1AE2 A;  2KVM A;  4C2M H;  4DK1 A;  5CBA E;  4QUF A;  1IL8 A;  2F0U A;  4RFB A;  1ZEQ X;  5CV9 A;  4IPC A;  5CV4 A;  4NP5 A;  2FHT A;  1Q7Y C;  1WTX A;  4R8I A;  2KJX A;  2WKD A;  4YIJ A;  4NXM L;  2WAQ E;  4R1J A;  3TP5 A;  2L15 A;  3E9H A;  1I6H B;  3MXU A;  1I4G A;  1RD9 D;  5FJ8 G;  2MO1 A;  3DLL A;  4DR5 L;  1BR9 A;  4JBM A;  4KJO A;  4YWK A;  5JJZ A;  2GVA A;  4DR1 Q;  2AQ3 B;  2F0T A;  3H6M A;  1R4P B;  3VR2 A;  3S1R B;  3HOZ B;  4XXE A;  4A3B H;  2N3S A;  2C35 B;  1GD7 A;  1HA5 A;  4DR3 Q;  3SVM A;  1U0L A;  4KD3 A;  2F0S A;  1WFQ A;  3J80 i;  1Y1W B;  2KQ3 A;  3SR1 A;  1O80 A;  4WOR A;  4DV2 Q;  1H9S A;  4PNY A;  3PO2 G;  3BDC A;  3T13 A;  2PNH A;  1WCM H;  5T1G A;  1I4P A;  1YNJ D;  4JBW A;  4PMW A;  2ZTC A;  1IW7 D;  4KD4 A;  1F2Z A;  1EZ6 A;  1WVL A;  2CQA A;  1STH A;  2WFW A;  5BR8 L;  3F2U A;  1TWA B;  3NHH A;  1L0X B;  1N36 Q;  2F0L A;  2R7Z H;  1JOO A;  4ID6 A;  4DNT B;  4A93 G;  1EWI A;  2F0E A;  1Q8K A;  2V1C C;  4YCU A;  2MNA A;  1D1K A;  4YY3 Q;  1SRU A;  3LWE A;  5E1F A;  3HOU B;  1VDZ A;  4LWC A;  1A63 A;  1QCB D;  3STB D;  2C5C A;  2NZH A;  4DR3 L;  3NK9 A;  1NCV A;  5KYI A;  2K04 A;  4XQJ A;  3I7F A;  1QG7 A;  2E2I B;  3QOL A;  4CDD C;  4DV0 Q;  5EQ0 A;  1JCK B;  4DV2 L;  3BVM A;  5LHY 1;  4OWX B;  2RDG A;  1YJ9 A;  3MWY W;  2G9H D;  4DV5 L;  1NMF A;  3HS0 C;  4RGO S;  1I3Q B;  1PDQ A;  3UDG A;  4DV7 Q;  4GN4 B;  1RIP A;  1GUN A;  5C0X J;  3GTJ B;  4C2M B;  3GTL B;  1NY4 A;  3CQZ H;  4C3H B;  1EEF D;  1VF7 A;  1TKW B;  4B3T Q;  2K05 A;  2EY1 A;  2K14 A;  1N9W A;  2Q8R E;  1BBW A;  4BBR H;  4X6A H;  4YY3 L;  3J7A V;  1PZK D;  2ZJP A;  3I90 A;  4HMJ A;  1IZ6 A;  4A3L G;  2N88 A;  5CC4 A;  3U58 A;  4IFD J;  2H1E A;  4C56 C;  4PV1 C;  3S1N H;  5KGU A;  1QUQ A;  4DV4 Q;  3FRP B;  3KDF A;  1F2Y A;  4DV0 L;  5M5W B;  2VS1 A;  1YVC A;  1JE4 A;  1SNQ A;  3LX0 A;  4GKK Q;  1GHK A;  3CCQ A;  4IO9 A;  4BA1 I;  3HOX H;  1B1Z A;  2QEX A;  2A1A A;  4A3G G;  4IAL A;  2B8F A;  4PG3 A;  5IGF A;  1XPR A;  4A3B B;  4UPA A;  3LWU A;  3ITP A;  3HKZ E;  4DV7 L;  2ZTD A;  5NUC A;  1E3P A;  1PYB A;  1EY7 A;  3OWF A;  3VR4 A;  3D6W A;  4X3S A;  1MIU A;  4OIK A;  3HP3 A;  5CV6 A;  3ULL A;  4ABN A;  4B3S L;  3FPP A;  4B3T L;  5CMD A;  2JA8 H;  1B2T A;  1PYW D;  1LTI D;  1I4Q A;  2N49 A;  2E74 C;  1CTM A;  1FD7 D;  3B6Y A;  1ESF A;  4I65 A;  2O2L D;  2MHV A;  2NVT H;  1ESR A;  5BN5 A;  4IOA A;  3IL8 A;  3NE5 B;  4R4T A;  2NN6 H;  3L2P A;  4DV4 L;  4BY1 B;  2BA1 A;  2QDL A;  2H4O A;  2LKV A;  3H0G G;  2Z4I A;  1I6V C;  4GKK L;  3U50 C;  2YU9 H;  1HNZ Q;  1VQD A;  2NZO A;  1IKM A;  1GO3 E;  1LT5 D;  3S1M B;  1I5F A;  2B2Y C;  4A3F H;  5M3M G;  3L9A X;  1UE7 A;  1ZXT A;  4DK0 A;  4YHH Q;  5KNB A;  4DA2 A;  4K5W A;  1VQK A;  2I5H A;  5FLX c;  4A76 A;  2D0O A;  2UUB Q;  1N34 Q;  1R4Q B;  1XNR Q;  5CV5 A;  3NQT A;  3FKI G;  4C3I G;  2VUM H;  1NTG A;  5C4Z A;  4I7Z C;  2VZA A;  4LFB Q;  1CFM A;  2F0J A;  4KKS A;  2AKW B;  3H94 A;  1WTH A;  2B2Y A;  2FIN B;  4OGQ C;  2MFI A;  4CJ1 B;  3A5U A;  3GTO B;  2EDG A;  4DR7 Q;  2HDL A;  1VMP A;  1A2T A;  2WAC A;  3RD4 A;  2SOB A;  1G8Z D;  3L7Z C;  2XWJ B;  2ZT9 C;  1QVG A;  4LK1 C;  1Q8I A;  1HNZ L;  5TSS A;  1B9N A;  1IYJ B;  1YHA A;  4G7Z C;  5FO9 B;  1DYQ A;  3S1N B;  2OF1 A;  4DR6 Q;  1KNA A;  4L6T B;  5FLX E;  3AFP A;  4CKB A;  1YJW A;  4QQB X;  2UUC Q;  5JEA G;  4OEM B;  1O78 A;  3CCM A;  1N34 L;  1XNR L;  2RDF A;  4DUY Q;  1IYU A;  4LFB L;  3S17 B;  2LY7 A;  1ILP A;  1FYC A;  4IQZ A;  3GTG H;  3PSI A;  3AYH B;  3A0J A;  3S24 A;  2XIW A;  1D5M C;  1EY0 A;  3UDI A;  4PZ7 A;  3UDX A;  3DXJ C;  2UXD L;  1CKN A;  2UXB Q;  1K8O A;  2JJQ A;  4H13 C;  2JA8 B;  3ND9 A;  3NP8 A;  2NVQ B;  3DUZ A;  5C3E G;  3I55 A;  4IUT A;  2OCE A;  5ELF A;  2JA5 G;  3HKZ B;  5EGT A;  2O5I C;  2CWP A;  3Q6S A;  5DM6 3;  3ONA B;  4ME3 A;  1TR5 A;  2KHS A;  4DV1 L;  4BA2 I;  4IN3 A;  1U4L A;  3MA2 B;  2F1M A;  1WTW A;  2F0M A;  5ELD A;  4UP8 A;  1QB5 D;  5J1Z A;  2JA6 B;  2MP1 A;  4L5S A;  1N32 Q;  1LT3 D;  1KC8 C;  3I3C A;  1JJ2 A;  1ML0 D;  3NWT A;  4LUO A;  4K2K A;  1YJN A;  1VQM A;  3I56 A;  2L55 A;  1KDB A;  2PZU A;  2JE6 I;  3C3L A;  4A3F B;  3K8A A;  1LTT D;  5LMN L;  1BUV T;  3K59 A;  1QVF A;  3D3R A;  2Z6K C;  4OX9 Q;  2E2H H;  1IBK Q;  1GXD C;  2CW0 C;  2O5J C;  1PFN A;  1O7Z A;  4LF4 Q;  1LO5 D;  3SK5 A;  1Y1V H;  4A3E H;  2UXB L;  1SE2 A;  4LJZ C;  1Q1E A;  4A75 A;  4PMB A;  4L5T A;  4ODG A;  4GN3 B;  5FLX L;  1CQF A;  1K83 B;  1HTL D;  3TP7 A;  2Q8T A;  3OTO L;  2DNE A;  3MTS A;  4F7X A;  2GVB A;  1WOC A;  1Y8O B;  2BH8 A;  3D4D A;  2SDF A;  4U67 3;  1HZB A;  3PGZ A;  1EZ8 A;  3M7G A;  1RCV D;  3KJP A;  4X3U A;  1HFN A;  4K0K L;  1N32 L;  2R93 G;  1CZW A;  1SYG A;  1AZP A;  1PH6 A;  4GLX A;  4LMQ D;  1CA5 A;  1TS2 A;  2JP1 A;  3PMF A;  3A7A B;  3GO5 A;  3RLN A;  2RA4 A;  1W6J A;  4OX9 L;  1IBK L;  3K7U C;  3R2T A;  3CKI B;  4RGM A;  3CMA A;  1QJO A;  5EPL A;  5IP7 G;  4LF4 L;  3S16 H;  3PCO B;  3C1F A;  3VYS A;  2K5N A;  4H7B A;  3MFG A;  3P7J A;  4N9T A;  1WTP A;  4XYO A;  2EYF A;  4IUR A;  1H9R A;  2NTT A;  3BDO A;  2B2W C;  3MVV A;  3A8I E;  3TRZ A;  3CCL A;  3GTG B;  4K8I A;  1BOS A;  4J15 A;  2L5T A;  2EYP A;  4POF A;  3LGJ A;  2CHB D;  1EWH A;  3RN5 A;  1A2U A;  2IX3 A;  5G3L D;  4X3T A;  5JJI A;  1JT8 A;  3R3O A;  1KL9 A;  3TSS A;  5JPN C;  2KCM A;  3CPW A;  2KEC A;  3D6C A;  2YTY A;  3AMU A;  2BDO A;  4GLV B;  2JA9 A;  3D4W A;  2UUA Q;  1CK1 A;  3MEH A;  1JE5 A;  1SAP A;  1VS0 A;  2B2W A;  3HOW B;  1T9H A;  3SGI A;  1ZKO A;  4WFN 3;  4MNO A;  2CW0 D;  3I91 A;  2JEB I;  3NTK A;  4RMF A;  1LTA D;  4CHT B;  1ZYR C;  4JI0 L;  4DAV A;  2NVX H;  3T1H Q;  4E6I A;  3I4L A;  4RHR A;  4B9W A;  4R9W A;  1LV9 A;  3A8K E;  2I5L X;  3QG1 A;  2PPB C;  1KNE A;  1YHB A;  2XGT A;  3CC7 A;  3EFX D;  4NDX A;  2A6E D;  5D14 A;  2Q8I B;  3BDL A;  2GA4 B;  1B44 D;  2P5Z X;  3DWA A;  3GTP H;  4ILW A;  1Y1V B;  4A3E B;  1J6Q A;  2AUJ D;  4DAY B;  5C44 H;  2F0O A;  4P75 A;  1QWY A;  3TS0 A;  1IL2 A;  1E0B A;  3CC2 A;  1OO9 B;  2V4D A;  1BNZ A;  1VF5 C;  1U4P A;  1VCI A;  3PIO A;  1NUC A;  3OW7 A;  2KBN A;  1OXV A;  1TT2 A;  1A8V A;  1K3B C;  2D2C C;  1PYS B;  1S72 A;  3OWE B;  4OHJ A;  3G48 A;  1C9O A;  1EU3 A;  3TP6 A;  2EVB A;  4X64 Q;  3ZJY C;  2LS0 1;  1UWV A;  5M5X H;  5IWA L;  5C0X G;  1SYC A;  2XRS D;  4ULL A;  5DM7 3;  1K8A C;  4A3C H;  3MC0 B;  1MD2 D;  1O7I A;  2E5L Q;  1U5K A;  4ALP A;  1G6Z A;  5IYB G;  1XYI A;  3RZO H;  4O1N A;  3H09 A;  4A3J B;  4FF1 A;  1EY9 A;  4L8J A;  4A3D B;  2Z4H A;  5IOD A;  1Z7T A;  1LAC A;  2K75 A;  3LNN A;  2VL6 A;  4JBK A;  1KAB A;  1KDC A;  2A19 A;  2HD3 A;  1Q3L A;  4IUV A;  4LUV A;  1CUK A;  1QOH A;  5GQO A;  4A3M G;  2E76 C;  1X32 A;  1ZYR D;  5ELO A;  1STG A;  2E75 C;  1X56 A;  2FXQ A;  1ET6 A;  4BBS B;  2XRQ D;  3N52 A;  1Q12 A;  1QNK A;  2DGY A;  1JB7 A;  1FNW A;  3KLS X;  1B8A A;  4JOI C;  2J0T D;  2E5L L;  3GTK H;  4APV A;  1V43 A;  3T51 B;  3S1R H;  3TP8 A;  1BBX C;  4LF6 Q;  4JI1 Q;  4DR2 Q;  4JI2 Q;  3BYY B;  5IYC G;  3EN2 A;  1KAA A;  3HRZ C;  4GKJ Q;  2NVX B;  2WB1 G;  3SK6 A;  2IX0 A;  3J7Y W;  3AU7 A;  1STN A;  3AFQ A;  1Y1W H;  5BN4 A;  1SMX A;  2PZW A;  3G4S A;  5ELC A;  4N8F A;  5IIF A;  2B29 A;  2EZV A;  4G7O C;  2ES2 A;  4LF9 L;  3GTP B;  2OXP A;  3L0O A;  4XT1 B;  5IP9 G;  3NEL A;  1A3U A;  3PUW A;  4YWL A;  2LFN A;  3K5L A;  3CF5 A;  4DV6 Q;  3CW2 C;  3GV3 A;  4JBJ A;  2L9H A;  2QGQ A;  4XQN A;  3QOJ A;  1GKH A;  1BQQ T;  1HXY D;  3K5M A;  4A3I B;  2A69 C;  1HNX Q;  1V1P B;  5I6Y A;  3HOU H;  1HR0 Q;  1E2V A;  1YNJ C;  5IY0 A;  5DAU A;  4KY7 A;  2QKI C;  4DR2 L;  1XXG A;  4S3S A;  4F87 A;  1SYF A;  1TXY A;  1SE3 A;  1JOK A;  1HH2 P;  1D7Q A;  5EKL A;  3VDY A;  2KCC A;  1SYD A;  3BG3 A;  2DJF C;  1LYL A;  4M8A A;  4GOP C;  4JI5 Q;  4KHP L;  4MZ9 A;  1PRT F;  1IBM Q;  1HZA A;  4NMZ A;  2WKC A;  3RZO B;  5IYD H;  2Z0S A;  3H15 A;  2ZJR A;  5F2D A;  3STB C;  1SMY C;  3BVG A;  1B3A A;  1PH4 A;  4XIG S;  2VW9 A;  4B3R Q;  2VB3 X;  3ULJ A;  4AYB G;  3GTJ H;  2CCZ A;  2B63 B;  3GTL H;  4KTA A;  5IT9 c;  4DV6 L;  4XYQ A;  1MGS A;  2Y0S G;  2Z1C A;  1LT4 D;  4C3H H;  1BF4 A;  3PV0 A;  3FVQ A;  2MUY A;  2OTJ A;  4DAY A;  3AB9 A;  4CJ2 C;  2F0I A;  2EJM A;  3GQB A;  5KIX A;  4ZUI A;  4LFC Q;  1HCZ A;  1HNW Q;  3EA6 A;  2EYM A;  3OMG A;  3H3V I;  1EFW A;  3K5N A;  2AHO B;  4EVO A;  1B70 B;  3WDN A;  2NVY H;  4IUU A;  1PMR A;  3P20 A;  5M5W H;  2RSN A;  2BDN A;  1GM5 A;  1LM0 A;  1XMO Q;  4JI5 L;  3GTK B;  4TQU S;  1E1T A;  1SFO B;  1IBM L;  4R4I A;  2NB0 A;  1A3T A;  3TS2 A;  1KD1 C;  5COR A;  1F9S A;  3UDF A;  2AWO A;  5IT9 E;  2QA4 A;  1VQP A;  1FNV A;  2VQF Q;  3K58 A;  2IX1 A;  1MHW C;  2YTV A;  1Y8N B;  2A69 D;  4J8Q A;  2EYJ A;  4HIO A;  5LMN W;  4BS9 A;  5A2Q E;  1I4H A;  5LMU Q;  1V1Q A;  1DZ1 A;  4YWM A;  1RTO A;  2F0K A;  4P2C B;  4BY1 H;  3DWQ A;  4JVZ A;  2M9V A;  4BY7 G;  1B50 A;  2PQE A;  1GUG A;  1HTP A;  3JAM c;  3J81 j;  1VQG A;  4DR1 L;  1XMO L;  2VNU D;  2N78 A;  3HKS A;  3DHQ A;  2ZM6 Q;  3S1M H;  3CCS A;  1SMY D;  1W3S A;  5JPM C;  2PI2 A;  1CHP D;  4QB4 A;  2ZXR A;  3NBI A;  4A93 B;  4B9X A;  3OPO A;  3Q23 A;  3BZK A;  3HOV G;  1EY8 A;  3GP7 A;  4JC0 A;  5M3F H;  3ULP A;  1A6X A;  3CCR A;  4OWW B;  1FGU A;  2G5D A;  1CKO A;  4X62 Q;  1FVI A;  2X6L A;  1NNX A;  4OON A;  2K28 A;  5E3F A;  1HQM C;  1CKN B;  4DXF A;  3GTO H;  2MQH A;  1S3O A;  2WIN B;  3SK4 A;  1PH9 A;  3JAM E;  1AN8 A;  4HJ9 A;  4H0L C;  4C3I H;  1N36 L;  3M4O H;  3A56 A;  3FHW A;  3RMH A;  3ZYY X;  3I4M G;  3HOY G;  1PRT C;  3KBX A;  3MXN B;  5C0X I;  3ERO A;  5IT9 L;  5A35 A;  2A68 C;  5C4H A;  4MTK A;  2IY5 B;  4DXG A;  2AMC B;  2EYH A;  1SNO A;  2ZM6 L;  3CCE A;  1V1P A;  5GRO A;  4IPD A;  4X65 Q;  2F52 A;  1X3F A;  2NVY B;  3M4Y A;  3TZU A;  1STA A;  4JYA Q;  1A0I A;  2ZXO A;  1S5E D;  4DU9 A;  3E3X A;  4IFD I;  5A2Q L;  2PMZ B;  1Q86 C;  4R4C A;  2PQA B;  2F0G A;  3RZD H;  2MJ8 A;  3H91 A;  2D5D A;  4X62 L;  3D8G A;  4F88 A;  3S17 H;  1F77 A;  4FF3 A;  4J1M A;  2WAQ G;  3M85 A;  1ONL A;  4MN3 A;  3KLW A;  1PH7 A;  2IWH A;  4A3B G;  1K0R A;  4KKU A;  3F1Z A;  4XTC S;  1LUZ A;  4A3G B;  4CBV A;  3G7L A;  4DPG A;  1JJC B;  2NVQ H;  1C7Y A;  4DN4 M;  2KCN A;  5I9P A;  3URY A;  3F8T A;  1VQ9 A;  2KEN A;  1BCP F;  1WCM G;  4X65 L;  1I4R A;  3C1E A;  4TRD A;  2E2D C;  3A54 A;  2BE5 D;  4JYA L;  4DK6 C;  4KKT A;  2JA6 H;  1F9P A;  4FNF A;  1PZI D;  3X3N A;  3U9O A;  1YIT A;  1PTO F;  3CCU A;  2R7Z G;  2XNA C;  2A74 C;  1NR2 A;  2R7F A;  4B08 A;  3R93 A;  3JAM L;  1ILQ A;  4G57 A;  4LAA A;  3H0G B;  2DJG C;  3EJI A;  4FO2 A;  4X3K A;  1CKM A;  4RAU C;  2L0C A;  1HUN A;  3HGB A;  1KXL A;  1PRT D;  1JMC A;  2RSO A;  1J5E Q;  5M3M B;  4I7A A;  1Q1B A;  1RJT A;  1SXT A;  5M3F B;  2A68 D;  2IT1 A;  1D6E C;  3P1H A;  2JN4 A;  3U4V A;  1K83 H;  3R2I A;  3MEF A;  1OXS C;  1W2B A;  1A15 A;  3I73 A;  2HDM A;  4OO1 I;  4LF7 Q;  1LAB A;  2K5W A;  5EPJ A;  3ND8 A;  1VQF A;  4UP9 A;  1S5B D;  1L0Y B;  4C3I B;  3M4O B;  4FDB A;  5LL6 S;  2FFK B;  1AW7 A;  3KOJ A;  3SE0 A;  3NEN A;  4DK3 C;  4JPB W;  2FJ2 A;  1BBU A;  4BBR G;  2K52 A;  3MXG A;  1SN8 A;  3I70 A;  4YHH L;  4DR4 Q;  1STE A;  2EYL A;  2O4X A;  1VQO A;  2KA7 A;  2UUB L;  2C9O A;  2B2U C;  2XVS A;  4HAE A;  1J5E L;  3RZD B;  4CDC C;  2BOS A;  3KF8 B;  3E9I A;  3HOX G;  4JW0 A;  1H9K A;  1D8L A;  4PZ6 A;  2D62 A;  3A8J E;  4LF7 L;  4DR7 L;  3DEO A;  1QZG A;  1OTC A;  4IUN A;  2RCN A;  1RL2 A;  2J7Z A;  4KHV A;  2Q2T A;  2EPB A;  4QUC A;  1LTB D;  4TVA B;  1EOV A;  1CZG A;  4JI7 Q;  1D5Z C;  3HZX A;  1QIL A;  3MXN A;  4V19 0;  2B2U A;  1PH2 A;  2JA8 G;  1XPU A;  4BWG B;  5JJK A;  4C3J H;  5FLM G;  3V05 A;  4WJW A;  2J4X A;  2R6G A;  4DR6 L;  3HOW H;  2HCC A;  2JK8 A;  3Q8D A;  1Q81 C;  2UUC L;  2QIL A;  5IGC A;  5C3E B;  2JA5 B;  2NN6 G;  5K36 H;  1DCZ A;  1FL0 A;  5IGB A;  4DUY L;  4NXN Q;  3DEP A;  2A6H C;  1PA6 A;  1KQS A;  3SHL A;  2PQA A;  4LF5 Q;  3PO3 G;  1PH8 A;  3ER0 A;  4RG1 A;  4ZQ3 A;  1TQO A;  4HTH A;  1K9M C;  4GNX B;  4HIK A;  5CGK A;  1M4V A;  1PZJ D;  4A3F G;  2K7V A;  1PTO C;  1SYB A;  3SEB A;  1P16 A;  2F0W A;  4TKO B;  3J81 c;  3MHB A;  2XWB B;  3HG9 A;  3OMC A;  2EOT A;  2PW5 A;  2K50 A;  3QJY A;  2VUM G;  5L37 A;  4OEL B;  2OEO A;  2A6E C;  4IPG A;  3J80 c;  2ICI A;  1EFI D;  2Z6K A;  3J7A F;  4M1U B;  2QEJ C;  3T56 B;  4QCL A;  1J8I A;  4JCV E;  5ELE A;  3VA7 A;  3G6E A;  4JI6 Q;  4P71 A;  2N55 A;  2N8N A;  4NXN L;  1SJH D;  2K5H A;  3PUX A;  4O42 A;  1EQQ A;  1IBL Q;  4LF5 L;  4LF8 Q;  1EL0 A;  1E24 A;  1NMG A;  3M9B A;  1U4M A;  5C4X H;  2K6A A;  1I94 Q;  2R93 B;  4BXX G;  3J81 E;  1YHQ A;  1OXU A;  1CI3 M;  2DY7 A;  4PMC A;  4A3J H;  1PH3 A;  3IKJ A;  1X3Q A;  4A3D H;  5FKA C;  1K28 A;  5C5M A;  1LTG D;  4X66 Q;  1RKN A;  5COY A;  2JA7 H;  1XNQ Q;  1KRS A;  5IYB H;  2PZT A;  1U4R A;  5JJL A;  3KYH C;  2PI2 E;  2UU9 Q;  1UE6 A;  4FXG C;  4XT3 B;  2EXZ A;  4JI6 L;  1EYD A;  1GUT A;  4KN4 C;  2A6H D;  4ZAI A;  1WTV A;  4BBS H;  3CD6 A;  1C8C A;  4C3J B;  4LF8 L;  2R3Z A;  4IJH A;  3HEJ A;  4A3M H;  1A62 A; 
#chains in the Genus database with same CATH homology
 1EY6 A;  1MSG A;  4KN7 C;  1MI2 A;  1PTO D;  1Y8P B;  2MPM A;  5I4D A;  3R8B A;  3PUY A;  1CA6 A;  4IUP A;  4QIW B;  4DAP A;  1YNN C;  3T53 B;  1JOR A;  2KOL A;  3E0J A;  2DNC A;  3S1Q B;  4RCO A;  3KF8 A;  3MXP A;  3D31 A;  2SNS A;  4Y7N B;  3Q0A A;  1ROD A;  2I07 B;  3T16 A;  2E2J B;  1JWS D;  2BCO A;  2L1B A;  4ZKB B;  3J81 L;  4RCN A;  5FOB B;  4UDU C;  3U9S A;  2DN8 A;  1G91 A;  3DWP A;  4DFA A;  1F9R A;  4ZKC B;  5JAV A;  1EIH A;  4RKB A;  3E5S A;  5C4X B;  5FO8 B;  4HN7 A;  1Y69 U;  3VYT A;  2X69 A;  3FMC A;  1X3P A;  4IFD G;  2JA7 B;  1AEX A;  1XTC D;  2K5D A;  2HQE A;  4DGZ A;  4HED A;  4CKE A;  1CQV A;  2B8G A;  3TDQ A;  1BXT A;  1LT6 D;  1NAP A;  3NUC A;  1JR0 D;  5JEA J;  1YNN D;  4KMU C;  2NYZ D;  3H3V C;  4A3M B;  3GTQ B;  4KHZ A;  4ZRZ A;  3A7L A;  2NZ1 D;  2NTS A;  3M7N A;  5C5L A;  4RA8 A;  4CGY B;  3V2T A;  4A3K B;  2I46 A;  1IYV A;  3PIO 3;  2WB1 B;  4U68 A;  1VMC A;  4TSS A;  1II3 A;  1Z47 A;  1B4O A;  3NTH A;  2NN6 I;  1ENA A;  3NSW A;  1EY4 A;  1Q90 A;  1BDO A;  4FXD A;  2B39 A;  1AZQ A;  3W3A A;  1D5X C;  1JIC A;  2DY8 A;  4R8N A;  1SNP A;  5J22 A;  2ICE C;  1ENF A;  2PYK A;  3NPP A;  4OO1 G;  4K5X A;  4ZYS A;  4K6D A;  2R92 B;  3BZD B;  1PRT B;  3S2D B;  1S5F D;  4J6H A;  4DNR B;  5IGG A;  3FEW X;  1S4Z A;  1UNS A;  1DJR D;  2F0F A;  2HUG A;  5FO7 B;  2NBF A;  3PIP 3;  5JVG 3;  1QE6 A;  5JOB A;  3TBI B;  2PCF B;  2Y0S B;  1HUM A;  1RDP D;  1RF2 D;  1TS3 A;  1NSN S;  2EY5 A;  4RGN A;  1S5C D;  1Z6H A;  4QMG A;  1TII D;  2RBM A;  1EY5 A;  4QF4 A;  4RKL A;  4DF7 A;  3I72 A;  1F2M A;  5FK9 C;  3K7A B;  1SYE A;  1HHV A;  5KYL A;  1F2L A;  3S14 B;  3GV6 A;  1DON A;  1D1I A;  3C46 A;  1EYC A;  3S2H B;  1TWG B;  4F8M A;  1PXU A;  3PO2 B;  5M5Y B;  3G6J B;  5I9O A;  1PTO H;  1S5D D;  4Q5V A;  1JQY D;  1GHJ A;  2BA0 A;  1KLG D;  4EQN A;  3S15 B;  1KLU D;  5K5P A;  1WTR A;  4KJN A;  4BY7 B;  2BE5 C;  3VR3 A;  1JB3 A;  1O7Y A;  2RVL A;  1TY0 A;  2F3W A;  1SSO A;  1TS4 A;  2WP8 J;  5KRU A;  4RGT A;  2K03 A;  1H9M A;  3HOV B;  2AQ2 B;  2RKS A;  5T1I A;  4C3H G;  1HFG A;  1XWE A;  3WOE A;  1DOK A;  1ICW A;  3ERQ A;  4K2L A;  4FXK C;  3I4M B;  3HOY B;  1HRJ A;  1V8Q A;  1C48 A;  2D9U A;  2F0N A;  2JEA I;  2QF7 A;  5EBC A;  1W6K A;  4NKL A;  3DM1 A;  1EU4 A;  2XN9 C;  1NR4 A;  5JEA H;  5JVH 3;  1C4Q A;  5C4J B;  3FDT A;  3TZD A;  4FP5 D;  4CJ0 B;  1UAP A;  1BCP B;  2WAQ B;  5CV8 A;  4OL7 A;  5IOC A;  3QO2 A;  1SNM A;  2Z8L A;  1J9O A;  1PTO B;  4CKC A;  4KI0 A;  5ISR A;  1WCM B;  5BN3 A;  1DM0 B;  5G3L F;  3CRL C;  4RWS C;  2RQX A;  4Z9C B;  1CHQ D;  1XX8 A;  1HQR D;  2R7Z B;  1GJX A;  4N9P A;  3NTI A;  3IFT A;  1EWC A;  3KK7 A;  4FYD A;  1ET9 A;  1WTQ A;  5IGD A;  2K33 A;  4EQP A;  1I50 B;  2K32 A;  3FKI B;  4KY5 A;  5CR3 A;  5EKK A;  3M3Y B;  1TS5 A;  5D65 A;  1U9R A;  2QDB A;  3FPU B;  3NXW A;  2NWG A;  3GD7 A;  1JOQ A;  3MAQ A;  1K8M A;  3DMU A;  3IAY A;  2JYO A;  3CQZ B;  1TY2 A;  3OHX C;  3T4A C;  5EPK A;  1GUO A;  2IW3 A;  4MIU A;  3CU7 A;  4BBR B;  2F3V A;  2PO4 A;  5C3X A;  2A5H A;  2F0Q A;  3PUV A;  1R9T B;  3RLF A;  2F0V A;  3SXH A;  1AFP A;  1IHZ A;  4HCS A;  1SJE D;  2L4N A;  1V1O A;  2EJF C;  3BVZ A;  4V0B A;  1EEI D;  3HOX B;  5CBE E;  5I6W A;  1MBY A;  1SDF A;  3L3O C;  2G9D A;  3V96 A;  3X3M A;  1EOT A;  1BCP C;  1EQT A;  1EQV A;  5CV7 A;  5M9O A;  2F0P A;  2NVT B;  4ZUJ A;  1M8A A;  3VR6 A;  1F9Q A;  3MZ5 A;  2IPK D;  4HR7 B;  1UUP A;  4C1N I;  4ZK9 B;  3Q22 A;  2YU9 B;  3PO3 B;  1HA6 A;  2YYZ A;  4K5V A;  2XSC A;  1LLR D;  1E2W A;  5E4W C;  1RTN A;  1SEB D;  1TWC B;  2B2T C;  5CYU A;  3I8Z A;  3NBH A;  4IZ8 A;  3VYR A;  2VXW A;  1DOM A;  1LTR D;  3TN2 A;  5IGE A;  4HMI A;  4KK7 A;  5I2Y A;  2L12 A;  1GUW A;  2CVR A;  2VUM B;  1H9J A;  1STY A;  2F03 A;  1DXM A;  2F0D A;  4KY6 A;  2TMP A;  4MHE A;  5ELB A;  1PFB A;  2HCI A;  1SBB B;  2FMC A;  3SK8 A;  4G4K A;  2IJ0 A;  5J39 A;  2B2T A;  4KV6 A;  1IKL A;  1CM9 A;  2KUM A;  5HUR A;  2ZXP A;  5C0X H;  1I4X A;  3MFY A;  3C2P A;  1HPC A;  2R61 A;  3J80 E;  3VYU A;  2EY2 A;  1G29 1;  3EVQ A;  5DEH A;  1PLF A;  2EJG C;  2NUC A;  3BS1 A;  1JC7 A;  2IL8 A;  3Q24 A;  3K5O A;  4IFD H;  2KEE A;  5C6A A;  1T5X D;  4GZY C;  1BCP D;  3NQI A;  1B53 A;  4IUQ A;  2K01 A;  4NW2 A;  3W2D A;  2JXM B;  5EJW A;  3RUZ A;  4EGV A;  4C3J G;  4Q0F A;  3K0Y A;  3IFD A;  1JWM D;  5EBD A;  1GOZ A;  1RHP A;  3O13 A;  3K57 A;  5K36 G;  1QNU A;  5KND A;  3QWN A;  2RDH A;  2ID0 A;  5HGT A;  4ME5 A;  3OOC A;  5D3I B;  3PUZ A;  4HCE A;  2KED A;  4K8J A;  1EYA A;  4XDX A;  1E2Z A;  3CRK C;  2OT2 A;  2MGS A;  1DOL A;  2E2H B;  1TU2 B;  1WD0 A;  3N6R A;  1A3V A;  3KBG A;  4H44 C;  1FR3 A;  3J80 L;  1SNC A;  3UI2 A;  4FF4 A;  1WD1 A;  4PQX A;  1UEA B;  2LMC B;  4G7H C;  4C1N K;  4OO1 H;  3TME A;  2AUK A;  2M00 A;  5D3D A;  1KDA A;  4K14 A;  2AQ1 B;  1SND A;  2AWN A;  3KUP A;  2ENB A;  3S9W A;  1D2B A;  5LL6 X;  2F0H A;  2WII B;  3KLS A;  3S16 B;  4FF2 A;  5KEE A;  4JK1 C;  1H9S B;  5C3W A;  1SE4 A;  3D4R A;  1B9M A;  4RHS A;  4ZLT F;  2EYO A;  1O7L A;  1TVX A;  2X6G A;  2F4I A;  2VB2 X;  3KLR A;  4K6L A;  2SEB D;  4EQO A;  5AFW A;  2K1B A;  3EQL C;  2L11 A;  2WV6 D;  5E4X A;  2M2L A;  2K5Q A;  2PW7 A;  2PNR C;  3A55 A;  2QCP X;  1FNU A;  2JSO A;  3OSO A;  1KTK A;  2EE1 A;  2FMM A;  1DD2 A;  2B2V C;  1GUS A;  2SNM A;  4XQQ A;  1EIG A;  2TSS A;  4HSP A;  4OIJ A;  3BYT B;  1CT1 D;  3K6O A;  1G2S A;  4L63 B;  1AP0 A;  1WTO A;  1FGB D;  5C44 B;  3SDZ A;  1TWF B;  3CHB D;  3E6Z X;  4WRD A;  2B2V A;  2A73 B;  1G2T A;  5I2X A;  1MSH A;  3OIQ A;  1OXX K;  5DNF A;  1IW7 C;  3QB3 A;  3I4N B;  1BO0 A;  4UAI A;  5EKI A;  4HSV A;  3VR5 A;  3WOF A;  1LTS D;  1T5E A;  1JWU D;  4RH6 A;  5M5X B;  1STB A;  3P75 A;  4FVM A;  3GTM B;  3NWS A;  3QIA A;  5KNC A;  1TWH B;  1PFM A;  4AYB B;  1ENC A;  1OXT A;  3OIP A;  2EY6 A;  3VA5 A;  2KVM A;  4DK1 A;  5CBA E;  4QUF A;  1IL8 A;  2F0U A;  4RFB A;  1ZEQ X;  5CV9 A;  5CV4 A;  4NP5 A;  2FHT A;  1WTX A;  4R8I A;  2KJX A;  2WKD A;  4YIJ A;  3TP5 A;  1I6H B;  3MXU A;  1I4G A;  1RD9 D;  1BR9 A;  4KJO A;  5JJZ A;  2AQ3 B;  2F0T A;  3H6M A;  1R4P B;  3VR2 A;  3S1R B;  3HOZ B;  4XXE A;  1HA5 A;  3SVM A;  4KD3 A;  2F0S A;  1Y1W B;  2KQ3 A;  3SR1 A;  1O80 A;  4WOR A;  1H9S A;  4PNY A;  3BDC A;  3T13 A;  5T1G A;  1I4P A;  1YNJ D;  4JBW A;  4PMW A;  1IW7 D;  4KD4 A;  1F2Z A;  1EZ6 A;  1WVL A;  2CQA A;  1STH A;  3F2U A;  1TWA B;  3NHH A;  1L0X B;  2F0L A;  1JOO A;  4ID6 A;  4DNT B;  2F0E A;  1D1K A;  5E1F A;  3LWE A;  3HOU B;  1VDZ A;  1QCB D;  2C5C A;  3NK9 A;  1NCV A;  5KYI A;  2K04 A;  4XQJ A;  1QG7 A;  2E2I B;  3QOL A;  5EQ0 A;  1JCK B;  3BVM A;  5LHY 1;  2RDG A;  3MWY W;  2G9H D;  3HS0 C;  4RGO S;  1I3Q B;  1PDQ A;  1GUN A;  5C0X J;  3GTJ B;  4C2M B;  3GTL B;  4C3H B;  1EEF D;  1VF7 A;  1TKW B;  2K05 A;  2EY1 A;  2Q8R E;  3J7A V;  1PZK D;  3I90 A;  4HMJ A;  2N88 A;  5CC4 A;  4IFD J;  2H1E A;  4C56 C;  4PV1 C;  5KGU A;  3FRP B;  1F2Y A;  5M5W B;  1JE4 A;  1SNQ A;  3LX0 A;  1GHK A;  4BA1 I;  1B1Z A;  4IAL A;  2B8F A;  5IGF A;  4A3B B;  3LWU A;  3ITP A;  5NUC A;  1EY7 A;  3OWF A;  3VR4 A;  3D6W A;  4X3S A;  4OIK A;  3HP3 A;  5CV6 A;  4ABN A;  3FPP A;  5CMD A;  1B2T A;  1PYW D;  1LTI D;  1I4Q A;  2E74 C;  1CTM A;  1FD7 D;  1ESF A;  4I65 A;  2O2L D;  2MHV A;  1ESR A;  5BN5 A;  3IL8 A;  3NE5 B;  2NN6 H;  4BY1 B;  2BA1 A;  2H4O A;  2LKV A;  2Z4I A;  1I6V C;  1IKM A;  1LT5 D;  3S1M B;  2B2Y C;  3L9A X;  1ZXT A;  4DK0 A;  5KNB A;  4DA2 A;  4K5W A;  1R4Q B;  5CV5 A;  3NQT A;  4C3I G;  5C4Z A;  4I7Z C;  1CFM A;  2F0J A;  4KKS A;  3H94 A;  2B2Y A;  2FIN B;  4OGQ C;  3GTO B;  4CJ1 B;  1DZ1 A;  2EDG A;  2HDL A;  1VMP A;  1A2T A;  2WAC A;  3RD4 A;  2SOB A;  1G8Z D;  3L7Z C;  2XWJ B;  2ZT9 C;  4LK1 C;  1Q8I A;  5TSS A;  1B9N A;  4G7Z C;  5FO9 B;  1DYQ A;  3S1N B;  2OF1 A;  1KNA A;  4L6T B;  5FLX E;  4CKB A;  5JEA G;  1O78 A;  2RDF A;  1IYU A;  3S17 B;  2LY7 A;  1ILP A;  1FYC A;  4IQZ A;  2XIW A;  1D5M C;  1EY0 A;  3DXJ C;  1K8O A;  4H13 C;  2JA8 B;  3ND9 A;  3NP8 A;  2NVQ B;  3DUZ A;  4IUT A;  5ELF A;  2O5I C;  3HKZ B;  5EGT A;  3Q6S A;  5DM6 3;  3ONA B;  1TR5 A;  2KHS A;  4BA2 I;  4IN3 A;  1U4L A;  3MA2 B;  2F1M A;  1WTW A;  2F0M A;  5ELD A;  1QB5 D;  5J1Z A;  2JA6 B;  2MP1 A;  1LT3 D;  3I3C A;  1ML0 D;  3NWT A;  4K2K A;  2L55 A;  1KDB A;  2PZU A;  2JE6 I;  3C3L A;  4A3F B;  1LTT D;  1BUV T;  3K59 A;  3D3R A;  1GXD C;  2CW0 C;  2O5J C;  1PFN A;  1O7Z A;  1LO5 D;  3SK5 A;  1SE2 A;  4LJZ C;  1Q1E A;  4PMB A;  4ODG A;  5FLX L;  1CQF A;  1K83 B;  1HTL D;  3TP7 A;  2Q8T A;  2DNE A;  3MTS A;  4F7X A;  3D4D A;  1Y8O B;  4U67 3;  2SDF A;  1EZ8 A;  3M7G A;  1RCV D;  4X3U A;  1HFN A;  1CZW A;  1SYG A;  1AZP A;  4LMQ D;  1CA5 A;  1TS2 A;  2JP1 A;  3PMF A;  3A7A B;  3GO5 A;  2RA4 A;  1W6J A;  3R2T A;  4RGM A;  3CKI B;  1QJO A;  5EPL A;  3C1F A;  3VYS A;  4H7B A;  3MFG A;  3P7J A;  4N9T A;  1WTP A;  4XYO A;  2EYF A;  4IUR A;  1H9R A;  2NTT A;  3BDO A;  2B2W C;  3MVV A;  3A8I E;  3GTG B;  4K8I A;  1BOS A;  2L5T A;  2EYP A;  2CHB D;  1EWH A;  1A2U A;  2IX3 A;  5G3L D;  4X3T A;  3R3O A;  3TSS A;  5JPN C;  2KEC A;  3D6C A;  3AMU A;  2BDO A;  3D4W A;  1CK1 A;  1SAP A;  3MEH A;  2B2W A;  3HOW B;  1ZKO A;  4WFN 3;  2CW0 D;  3I91 A;  2JEB I;  3NTK A;  1LTA D;  4CHT B;  1ZYR C;  4DAV A;  4E6I A;  3I4L A;  4RHR A;  4B9W A;  4R9W A;  1LV9 A;  3A8K E;  3QG1 A;  2PPB C;  1KNE A;  3EFX D;  4NDX A;  2A6E D;  5D14 A;  2Q8I B;  3BDL A;  2GA4 B;  1B44 D;  3DWA A;  4ILW A;  1Y1V B;  4A3E B;  2AUJ D;  2F0O A;  1QWY A;  1E0B A;  1OO9 B;  2V4D A;  1BNZ A;  1VF5 C;  1U4P A;  1VCI A;  1NUC A;  3OW7 A;  1OXV A;  1TT2 A;  2D2C C;  3OWE B;  4OHJ A;  1EU3 A;  3TP6 A;  2EVB A;  2LS0 1;  5C0X G;  1SYC A;  2XRS D;  5DM7 3;  4ULL A;  3MC0 B;  1MD2 D;  1G6Z A;  1XYI A;  4O1N A;  3H09 A;  4A3J B;  4FF1 A;  1EY9 A;  4L8J A;  4A3D B;  2Z4H A;  5IOD A;  1Z7T A;  1LAC A;  3LNN A;  1KAB A;  1KDC A;  1Q3L A;  4IUV A;  1QOH A;  2E76 C;  1X32 A;  1ZYR D;  1STG A;  2E75 C;  1ET6 A;  4BBS B;  2XRQ D;  3N52 A;  1Q12 A;  1QNK A;  1FNW A;  3KLS X;  2J0T D;  1V43 A;  3T51 B;  3TP8 A;  1BBX C;  3BYY B;  3HRZ C;  1KAA A;  2NVX B;  3SK6 A;  2IX0 A;  3J7Y W;  3AU7 A;  1STN A;  5BN4 A;  2PZW A;  5ELC A;  5IIF A;  2EZV A;  4G7O C;  3GTP B;  2OXP A;  4XT1 B;  1A3U A;  3PUW A;  2LFN A;  3K5L A;  3GV3 A;  2L9H A;  4XQN A;  3QOJ A;  1BQQ T;  1HXY D;  3K5M A;  4A3I B;  2A69 C;  1V1P B;  5I6Y A;  1E2V A;  1YNJ C;  5DAU A;  4KY7 A;  2QKI C;  1XXG A;  4S3S A;  4F87 A;  1SYF A;  1SE3 A;  1JOK A;  5EKL A;  2KCC A;  1SYD A;  3BG3 A;  4M8A A;  1PRT F;  4NMZ A;  2WKC A;  3RZO B;  5F2D A;  1SMY C;  3BVG A;  1B3A A;  4XIG S;  2VB3 X;  2B63 B;  4KTA A;  4XYQ A;  1MGS A;  2Z1C A;  1LT4 D;  1BF4 A;  3PV0 A;  3FVQ A;  2MUY A;  4DAY A;  3AB9 A;  4CJ2 C;  2F0I A;  2EJM A;  3GQB A;  5KIX A;  4ZUI A;  1HCZ A;  3EA6 A;  2EYM A;  3OMG A;  3K5N A;  4EVO A;  3WDN A;  4IUU A;  1PMR A;  3P20 A;  2RSN A;  2BDN A;  3GTK B;  4TQU S;  1SFO B;  2NB0 A;  1A3T A;  5COR A;  1F9S A;  2AWO A;  5IT9 E;  1FNV A;  3K58 A;  2IX1 A;  1Y8N B;  2A69 D;  4J8Q A;  2EYJ A;  4BS9 A;  5A2Q E;  1I4H A;  1RTO A;  2F0K A;  4P2C B;  3DWQ A;  2M9V A;  1B50 A;  2PQE A;  1GUG A;  1HTP A;  2VNU D;  3DHQ A;  1SMY D;  5JPM C;  1CHP D;  4QB4 A;  2ZXR A;  3NBI A;  4A93 B;  4B9X A;  3OPO A;  3Q23 A;  1EY8 A;  3GP7 A;  1A6X A;  2X6L A;  2K28 A;  5E3F A;  1HQM C;  4DXF A;  2WIN B;  3SK4 A;  3JAM E;  1AN8 A;  4H0L C;  3A56 A;  3RMH A;  3ZYY X;  1PRT C;  3KBX A;  5C0X I;  3ERO A;  5IT9 L;  5A35 A;  2A68 C;  5C4H A;  4DXG A;  2EYH A;  1SNO A;  1V1P A;  2NVY B;  3M4Y A;  3TZU A;  1STA A;  2ZXO A;  1S5E D;  4DU9 A;  4IFD I;  5A2Q L;  2PMZ B;  2F0G A;  2MJ8 A;  3H91 A;  2D5D A;  3D8G A;  4F88 A;  1F77 A;  4FF3 A;  4J1M A;  3M85 A;  1ONL A;  4MN3 A;  2IWH A;  4KKU A;  4XTC S;  4A3G B;  4CBV A;  3G7L A;  4DN4 M;  2KCN A;  5I9P A;  3URY A;  1BCP F;  1I4R A;  3C1E A;  4TRD A;  2E2D C;  3A54 A;  2BE5 D;  4KKT A;  1F9P A;  4FNF A;  1PZI D;  3X3N A;  3U9O A;  1PTO F;  2XNA C;  2A74 C;  1NR2 A;  4B08 A;  3R93 A;  3JAM L;  1ILQ A;  4G57 A;  4LAA A;  3H0G B;  3EJI A;  4FO2 A;  4X3K A;  4RAU C;  2L0C A;  1HUN A;  3HGB A;  1PRT D;  2RSO A;  5M3M B;  1Q1B A;  1RJT A;  1SXT A;  5M3F B;  2A68 D;  2IT1 A;  1D6E C;  3P1H A;  3R2I A;  1OXS C;  1A15 A;  3I73 A;  2HDM A;  4OO1 I;  1LAB A;  2K5W A;  5EPJ A;  3ND8 A;  4C3I B;  1S5B D;  1L0Y B;  3M4O B;  5LL6 S;  2FFK B;  1AW7 A;  3SE0 A;  2FJ2 A;  3MXG A;  3I70 A;  1STE A;  2EYL A;  2O4X A;  2KA7 A;  2C9O A;  2B2U C;  2XVS A;  4HAE A;  3RZD B;  2BOS A;  1H9K A;  2D62 A;  3A8J E;  3DEO A;  4IUN A;  4KHV A;  2J7Z A;  2EPB A;  4QUC A;  1LTB D;  1CZG A;  1D5Z C;  3HZX A;  1QIL A;  3MXN A;  4V19 0;  2B2U A;  4BWG B;  3V05 A;  4WJW A;  2J4X A;  2R6G A;  2HCC A;  2QIL A;  5IGC A;  5C3E B;  2JA5 B;  2NN6 G;  5K36 H;  1DCZ A;  5IGB A;  3DEP A;  2A6H C;  3SHL A;  4ZQ3 A;  1TQO A;  4HTH A;  5CGK A;  1M4V A;  1PZJ D;  2K7V A;  1PTO C;  1SYB A;  3SEB A;  2F0W A;  4TKO B;  3MHB A;  2XWB B;  3HG9 A;  3OMC A;  2EOT A;  2PW5 A;  3QJY A;  2OEO A;  2A6E C;  2ICI A;  1EFI D;  3J7A F;  4M1U B;  2QEJ C;  3T56 B;  4QCL A;  1J8I A;  5ELE A;  3VA7 A;  2N55 A;  1SJH D;  3PUX A;  4O42 A;  1EL0 A;  1U4M A;  2K6A A;  2R93 B;  3J81 E;  1OXU A;  1CI3 M;  2DY7 A;  4PMC A;  3IKJ A;  1X3Q A;  5FKA C;  5C5M A;  1LTG D;  1RKN A;  5COY A;  2PZT A;  1U4R A;  4FXG C;  4XT3 B;  2EXZ A;  1EYD A;  1GUT A;  4KN4 C;  2A6H D;  4ZAI A;  1WTV A;  1C8C A;  4C3J B;  2R3Z A;  3HEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...