1KDBA

Stabilization of a strained protein loop conformation through protein engineering
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYEPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stabilization of a strained protein loop conformation through protein engineering.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 41
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kdbA00
2EY2A 3OMGA 1EY8A 2PYKA 1NUCA 1SNDA 2SNSA 3SK4A 3SK8A 5J22A 5DAUA 4NMZA 1EYAA 1SNMA 1EY4A 2F0TA 4KY7A 1SNQA 2F0EA 3TP7A 1U9RA 1II3A 5IGGA 5IGFA 1STBA 4NKLA 5K5PA 3SK6A 1STYA 1AEXA 4IZ8A 5E1FA 3V2TA 2KHSA 3DMUA 1EY9A 4KY5A 1ENAA 4KY6A 2F0OA 3SK5A 5HURA 5IOCA 2F0JA 1ENCA 2F0GA 4NDXA 4HTHA 5CC4A 3QOJA 4ME5A 3DHQA 5E3FA 1EZ8A 5J39A 1EY6A 2F0MA 2PW5A 4K14A 4B9XA 4RKLA 5F2DA 4K5WA 1EQVA 1SNPA 4KJNA 5C4ZA 2KQ3A 1SNOA 4F8MA 4MIUA 5ISRA 3S9WA 1A3TA 3C1EA 5IIFA 4PMCA 2O4XA 4KTAA 2F0UA 5KIXA 4F7XA 3SHLA 2EYOA 2F3VA 2QDBA 4KD4A 2RDFA 2F0PA 3C1FA 5KRUA 5EGTA 5IGDA 4HMJA 4EQPA 3MHBA 5C3WA 2F0QA 5C3XA 3NQTA 4K8JA 1SNCA 5I6WA 5IODA 1STGA 3TP5A 2RBMA 1A2TA 2EYHA 1EY7A 1KAAA 2F0WA 4N9PA 3EVQA 3MEHA 3NP8A 4WORA 3ITPA 5JOBA 2EYLA 5KYLA 1F2ZA 1STNA 2SOBA 3HEJA 4K2KA 5CV9A 2WACA 2EYJA 4ODGA 2PZWA 5CGKA 1JORA 2EY5A 4QMGA 5J1ZA 3D4WA 1RKNA 3NUCA 5M9OA 4G57A 2HQEA 4ZQ3A 2EYPA 1EYCA 4QF4A 5IGBA 2EYFA 2F0FA 5CV5A 2LKVA 4KJOA 4OL7A 3LX0A 5IGEA 4IALA 4TRDA 1F2YA 1IHZA 4ID6A 3D8GA 1KDBA 2ENBA 1EZ6A 5CV6A 3TMEA 4EQOA 2PZTA 1SYBA 2F0KA 4I65A 4RKBA 2F0LA 5I9PA 2PQEA 3PMFA 3NHHA 1A3VA 2F0NA 1STAA 2F0VA 3D4DA 5CR3A 5EKLA 2EY1A 4K8IA 3EJIA 2M00A 3P75A 4R8NA 4LAAA 4K6DA 4S3SA 4PNYA 5JAVA 1EY5A 1JOKA 2EYMA 4IUNA 4PMBA 4E6IA 5C4HA 2EXZA 3SR1A 3OMCA 2F0DA 5HGTA 5KYIA 2EY6A 3MZ5A 2NUCA 4HMIA 4J1MA 5CV7A 2F0HA 5C5MA 5NUCA 1JOOA 1TT2A 4J6HA 5I6YA 4K2LA 1NSNS 1A2UA 4H7BA 5DEHA 4KD3A 2PZUA 3OSOA 4K5VA 4NP5A 4EQNA 5IGCA 5C6AA 5EKKA 1SYCA 3R3OA 5KEEA 4EVOA 1SYDA 2SNMA 1KABA 3RUZA 3T16A 5I9OA 3HZXA 3NXWA 1F2MA 5C5LA 3OWFA 1TR5A 1TQOA 3NK9A 3T13A 2F0SA 2F0IA 3TP6A 3TP8A 1STHA 3BDLA 3BDCA 4K5XA 4WRDA 3SXHA 1JOQA 5CV4A 3VA5A 3ERQA 2OEOA 3EROA 1SYFA 4DU9A 1SYEA 1KDAA 3MVVA 1A3UA 3H6MA 3U9OA 4ZUJA 4YIJA 3E5SA 2PW7A 5KGUA 3MXPA 4QB4A 4KHVA 3P1HA 2OXPA 2F3WA 4KV6A 4DF7A 4B9WA 1EY0A 1EYDA 4N9TA 2OF1A 3D6CA 1KDCA 3QB3A 5CV8A 4ZUIA 4DFAA 4DGZA 1SYGA 2RKSA 3QOLA
chains in the Genus database with same CATH superfamily
1WCMH 4HCSA 3SK4A 5HURA 3CXCA 2VB2X 1SEBD 3KJPA 3HKZE 4WJWA 1YJNA 2PMZB 1S3OA 4HCEA 1Y14B 1XNQQ 4A3KH 1IXRA 1F9QA 4QCLA 3HOWH 3I55A 4IUPA 1VS0A 5IP9H 4B08A 2ZT9C 5JVG3 2RDGA 1BXTA 3S1QB 3S16B 1UEBA 5ISRA 5C3EB 4L63B 1I6HH 4JW0A 3I91A 4LUZA 1TXYA 1N33Q 5KIXA 2KJXA 2I46A 1J8IA 3MC0B 2RDFA 1W2BA 1V8QA 2D0PA 2KA7A 5FK9C 3OW2A 3IL8A 3TP5A 4MZ9A 4RGMA 3UI2A 2CVRA 3TS2A 3NQIA 2K01A 3A5ZB 3EFXD 2L9HA 2Q2IA 4NXNL 3S1MH 1Y1VG 1F9RA 3K7UC 2AWOA 1Y69U 5J1ZA 3L2PA 2RHSB 2HQEA 2UXDQ 3R2TA 4DV1Q 2UXCL 4QF4A 3DM1A 2BCOA 4A3IB 4TSSA 1DXMA 4IALA 3BVMA 3U50C 2CQOA 2FJ2A 1EZ6A 1AE3A 2XNAC 3LWUA 3K5MA 3RZDB 5C4XH 4YCUA 5IP7H 1X56A 1G6ZA 3FDTA 2EY1A 1CSQA 4I7ZC 5JJIA 3PIPA 5C44G 5IY0A 2JA7H 2Q8TA 1HR0Q 2K5NA 1TWGB 1FJGL 3GTPB 3W5OA 4IUNA 4ZKBB 1PZKD 3RZOB 1DZ1A 2OT2A 4JBMA 1WFQA 3A5UA 5GADC 3U9SA 4KLKA 3IAYA 1ET9A 2A68D 4GOPA 4DN4M 1SMXA 4R9WA 4C3HG 4BBRB 4A3FG 1X3PA 2Z1CA 1E2VA 2UUBQ 3F2DA 3A54A 1TWAB 2B8GA 2MJ8A 3BDLA 3JAMc 4K5XA 1AP0A 1JOQA 3SGIA 2YU9B 1KAWA 1CUKA 4IPHA 1XPOA 3GTGB 1UUPA 1E1OA 4G4KA 3I2ZA 5M3MG 2K14A 2R92B 3EBEA 4JI0L 4XQQA 1QZGA 1Y1VB 1K0RA 1OO9B 3BZCA 2MPMA 3MA2B 1XPRA 3HOWG 1S5DD 1HR0W 3KF6B 1D6EC 1PXUA 2F0EA 3TBIB 3VR4A 5IP9G 2PI2A 3J7A5 3I4NB 1PRTD 3GV3A 1E2WA 4HJ9A 1GJXA 1VQMA 2DY8A 5IOCA 2A8VA 2CFMA 3I90A 1GUTA 2Q8IB 1I4HA 2K5DA 2K5VA 3PO3G 3G6JB 1DD2A 4MIUA 3CCRA 1SFOH 2Y0SG 1GXDC 1X65A 3ICEA 1RDPD 1CSPA 3BJUA 1C7YA 1KTKA 2C35B 2I0QA 3VYUA 4XTCS 1N8RC 5JPNC 1EEID 4JYAL 1JWUD 1STNA 2CKZB 3FEWX 1ICFB 2IW3A 3HRZC 1KD1C 2RVLA 3CMAA 4Q5VA 1QG7A 2E5LQ 4CJ2C 1S40A 2VY3A 4DUZL 1EUJA 3FRPB 1C0AA 5CV5A 4FXGC 1H9KA 1J9OA 1HUMA 3STBD 5IP7G 2HIVA 5JVH3 1WCMB 3Q8DA 4ID6A 5CV6A 3K6OA 2ZM6L 2JA7G 1S72A 2WINB 3H91A 1KIXA 1JJGA 2QDLA 5FLXE 1MI2A 2NZ1D 3RLFA 4A3KB 1K73C 2EJMA 4RCOA 5C0XG 1J5EQ 3DEPA 2YYZA 1PH1A 4UY8C 3I3CA 5JAVA 1X54A 4DUYQ 2JSOA 4QUCA 1C8CA 4A76A 3T4AC 4HIDA 1VQ9A 2F0HA 4DAYA 1I6HB 1B4OA 1XWEA 4B3SQ 2WKDA 4TKOB 1O80A 2AWNA 2B2WA 1D7QA 2SNMA 1SBBB 1DOMA 2YV5A 1QUQA 4X3UA 3WOEA 2XN9C 2V1CC 4FXDA 4JPBW 3SXHA 3ERQA 2MGSA 3S1MB 1HUNA 4AQYL 1U5KA 3UE0A 3KDFA 1V43A 1BBUA 4APVA 4KKSA 3NBHB 3NBIA 3QWNA 5CV8A 1SYGA 4P74A 1HNXL 4FYDA 1AZQA 1VQAA 2SNSA 2LY7A 1HTPA 1HNZQ 1GUSA 3HKSA 1STBA 4DV6L 1STYA 4QUFA 4IPGA 1T9HA 1IW7D 5EBCA 2H1EA 5C4XB 1OXXK 4JBJA 5GROA 1XXGA 3MWYW 4LMQD 4NDXA 5CC4A 3QOJA 3W1BA 5LMUQ 2HQLA 2J7ZA 3HOVG 4RG1A 2B2YA 4JVZA 3FHWA 3W2DA 5C4ZA 2GA4B 1EIFA 1XTDA 2R7ZG 2KECA 4PMCA 5KRUA 4LFAL 4JI3L 4K8JA 1VQGA 1DOKA 4XDXA 1NR4A 4X65L 3K0XA 3S9WA 3CKIB 1WTHA 3G48A 5K36G 1PFNA 3T51B 1YHBA 4H13C 4KN4C 3CC7A 3CCVA 1RTOA 4M8AA 4UP7A 1WTVA 3NTIA 3HOZH 2EYPA 3O13A 1WTPA 5IT9L 3A7LA 1LYLA 2HT1A 3R2IA 2B2VC 1F2YA 2Z6KC 1WTQA 3EIVA 2SDFA 3W3AA 3TMEA 4Y52H 4ULLA 4YWLA 4RKBA 3NHHA 2F3IA 4O0AA 3C2PA 4J8QA 3PIO3 2ZJPA 1HXYD 1SMYC 2P5ZX 4P2CB 3ZJYC 2HCCA 4AYBG 2NTTA 2A6EC 3I4MH 4X64L 2LS01 5HY6A 2JYOA 5C5MA 1J6QA 2CH4W 3AEVA 1KL9A 1X3GA 3DM3A 4J6HA 5M5XH 1SFOB 4NXNQ 3PO2G 4H7BA 3Q22A 4KD3A 1B7YB 3OSOA 1CK1A 1WTOA 2Z4IA 4FP5D 4DV2L 3ULJA 3DWAA 4K6LA 1X55A 4M1UB 2UXCQ 1TR5A 5JJLA 3TP8A 1BR9A 5DLQE 3BDCA 1CQFA 1B44D 3VA5A 2VZAA 1L0XB 2E75C 4DU9A 3CRLC 1KDAA 4IQZA 2JEAI 4R4OA 4ZUJA 2BDNA 1KRTA 1YIJA 3AFPA 1TS2A 3WDNA 3VYSA 3QB3A 4YCVA 4DFAA 1GHJA 4G7ZC 4A3EH 1KLGD 1O7ZA 4B3RQ 1II3A 4Q0FA 3B6YA 3CQZH 3TEHB 4X66L 1E0BA 2Z0SA 1EZ8A 3S1RH 3VR2A 1D1IA 4RGTA 1N33L 1I4RA 5AFWA 5F2DA 4K5WA 2DNEA 4KJNA 2DGYA 1SNOA 1LUZA 3TN2A 2WAQB 3NTKA 1EEFD 3K58A 5LMNL 1A63A 3HS0C 2UUCL 2JA8H 4CJ1B 3F2BA 5C3XA 2OCEA 5GQOA 2JQOA 3W1GA 1A2TA 4JI0Q 1IKLA 3DWPA 5ELFA 4WJ4A 1IBKL 2JE6I 3HOZG 2RF4A 2L15A 3M85A 1VQNA 3J81L 1ZEQX 4YWKA 5JEAH 2O2LD 3HOYH 5G3LF 4HJAA 5IGBA 3K5LA 4GNXC 4LF6L 1PRTB 1YVCA 1K83H 3NPPA 1UAPA 1VQIA 1NJIC 4H0LC 2Q2TA 4A3DG 4BY1H 2F0KA 3T53B 1KRSA 4BBSH 4A3CH 4FF3A 3P75A 1HQMC 3MTSA 2CCZA 2KHIA 1HFNA 4JYAQ 3H0GG 3CCSA 1JOOA 1TWFB 1R9TH 1JB7A 4C3IG 4JG2A 3R93A 3CW2C 1S5FD 1I4GA 4DUZQ 2NN6G 4LF4L 5M3FH 4DKAC 1T5XD 3F8TA 1PTOD 3CF5A 5FJ8H 1I4XA 1D5XC 2WP8J 2Z8LA 2ZM6Q 4AIMA 4JI6L 1QZHA 4XT1B 1LM0A 2K03A 4QB4A 2XRQD 1SE3A 2A68C 2L55A 1KLUD 1PH7A 2C9OA 4TVAB 2B63G 1NUCA 4CGYB 3E3XA 4KY7A 2WB1B 3GTQH 4MNOA 2R7DA 1AEXA 4IZ8A 2LMCB 2GN5A 1L0YB 2MFIA 2F0GA 1I94L 3A0JA 1V9PA 5J39A 2OTLA 1S5BD 2JA8G 1L0WA 2OTJA 3I4MB 4DNTB 3Q23A 4DA2A 1PYBA 5BR8L 4DNIA 4KKUA 3NEMA 4IFDH 2NVYH 3GTOB 4DAYB 4DR6L 4C3JG 4AQYQ 1PRTC 2DJGC 1JJ2A 1C9OA 5IGDA 4HMJA 5C3WA 4P75A 2KBNA 1HTLD 4RAUC 5IODA 1EWCA 5KEEA 5JOBA 4WORA 3G6EA 1HNXQ 1QUQB 3HOYG 2EYLA 3CPFA 3CMEA 4GLAC 4ODGA 4DV6Q 4TQUS 1XJVA 1JORA 3MXNB 4DXFA 1RIPA 1FYCA 5M9OA 5BN3A 1Q82C 1U4MA 3KDFB 3E0JA 5JJKA 2F1MA 2B2VA 1YBYA 1BBXC 3MAQA 3DWQA 3AFQA 5D3IB 4A3EB 1KDBA 3ONAB 3TRZA 3KUPA 3F2UA 3CQZB 3AYHB 2F0NA 2XVSA 2IY5B 2K4KA 3J80c 2IPKD 3RLOA 1CHQD 5E7NA 4IUUA 4P72A 5H1SE 4LFAQ 3BZDB 4JI3Q 3S1RB 1EY5A 2Z4HA 4X65Q 2FXQA 2XGTA 5C4HA 3SVMA 1VQJA 4UP8A 3STBC 3PV0A 1EU3A 2N49A 5COYA 1PFBA 2IJ0A 3CCEA 2BOSA 2RCFA 4JI4L 3I56A 3HOUG 1SAPA 3X3MA 1CHPD 2K28A 2KHJA 1VQHA 1PLFA 1LTAD 3PCOB 3OW7A 1SDFA 1VQ4A 1STHA 2UXBL 2B2UC 2OEOA 4JI5L 5GAGC 4LFBL 2D62A 3JAMi 2QEXA 2PO4A 5KGUA 1BCPF 1HNZL 2WAQE 5C44H 2JA9A 2PQAA 3QOLA 1K83B 2PYKA 3BYYB 1W3SA 1B9MA 1SNQA 3QJYA 5EQ0A 3D6WA 4X64Q 5LMUL 4FF2A 4BWGB 1X3QA 1OXUA 4RWSC 4BY1B 3SEBA 2B2WC 4BBSB 1RL2A 5DM73 1GOZA 1RTNA 5C4JH 4DV2Q 1HPCA 2UU9L 1PH6A 4C3HH 4HEDA 2PW5A 2N78A 4A3FH 1X9NA 2AUKA 3BZKA 1HFGA 3CP0A 1H95A 4JOIC 5IIFA 4YWMA 4POGA 3M4PA 5CBEE 1TS5A 1IW7C 1LABA 4B3ML 2VNUD 3QG1A 4R4QA 5M3MH 2JK8A 3J80E 2CHBD 1Z7TA 3F2CA 5M3FB 2PI2E 1GKHA 1I5FA 1DGSA 2RQXA 2G9HD 3Q0AA 4U673 3MFYA 2WACA 1E1TA 2HCIA 3LGJA 4GNXA 1I50B 3PUZA 2L4NA 4KHZA 4X66Q 1OTCA 1VQ6A 1EIGA 2B2YC 1VQLA 2HDLA 3HOXG 2K52A 1K8AC 1EWHA 3PO3H 1TWHH 2JEBI 3GTQB 2KOLA 2F0VA 5IYCH 5LMNQ 2HHHL 4DAPA 2CH4A 2UUCQ 3T1YL 1H9RA 2F0DA 5FO7B 1IBKQ 2K5WA 4K2LA 5DEHA 1QVFA 4NP5A 1N36L 1EFID 2NVYB 1ZYRD 1G2TA 3KBGA 5EKKA 3IFDA 3R3OA 2WB1E 1HRJA 4A93G 4LF6Q 3EN2A 3UDXA 4KKTA 4IO9A 2ZXOA 2PPBC 1P8LA 2IHEA 4RCNA 1PRTF 3GP7A 4GKKL 3IFTA 3OIQA 3BVZA 4B3RL 2OXPA 4OIKA 5C0XH 2K50A 1F9PA 2K05A 4GN5A 5LMNW 2ZJQA 1LT6D 3H09A 4Z9CB 3SK8A 1Y8NB 1BVSA 1MGSA 3M9BA 3M4OH 2BH2A 1WTXA 4YHHL 4AH6A 3DMUA 1NTGA 4C1NK 4DR5L 5FLXc 3DHQA 2X6LA 4B9XA 1YNJD 1JC7A 5M5YH 4LF4Q 2KQ3A 1SRUA 4GS3A 1I3QH 1YJ9A 1EL0A 1EIYB 1D2BA 3M4QA 5I2XA 4CDFC 3FPPA 2F3VA 4KD4A 4IPDA 4JI6Q 2R7FA 1CKNB 1KC8C 3E9HA 3A55A 1EY7A 5M5WH 4J15A 4JI1L 5CV9A 3MXUA 4U68A 5D14A 2TSSA 1R4QB 1BBWA 1EYCA 1NBWA 3TZDA 1I94Q 5C44B 2LKVA 4IJHA 5A2QL 3HOVH 4MHEA 4RHRA 5IYCG 2I07B 1G91A 4LWCA 1QILA 4C2MH 2CW0D 2R7ZH 2ATWA 3PMFA 5BR8Q 5DM63 3K8AA 3J7ZC 2NVXH 3FKIH 1CZWA 4DR6Q 4UPAA 3CD6A 4R8NA 4K6DA 2JXMB 5C4JB 4S3SA 1CA5A 1VQ8A 4C3HB 4BA2I 1C4QA 2EYMA 4PMBA 1CKMA 4A3FB 2EXZA 3D31A 5K36H 3OMCA 3U58A 2E2HH 3MZ5A 5CV7A 1GUOA 1Z47A 1Y8OB 1VQPA 5C6AA 2QKIC 1EQTA 3KF8A 5HGQA 1KABA 1RJTA 2EXDA 2JP1A 5M3MB 2B2UA 1F2MA 4N8X1 4L6TB 3TP6A 1JJCB 1LTTD 3H15A 1ONLA 1HA5A 3HOWB 1GUGA 2XTIA 4JK1C 3V05A 2NYZD 3MVVA 2K1BA 2L0CA 3E5SA 3SE0A 4CBVA 5I4DA 4RHSA 4B9WA 3H3VI 5BN5A 4ME3A 3S2HH 4NMZA 1SNMA 4PZ6A 5IGGA 1PTOC 5IGFA 3PO3B 4L5QA 3K59A 1YHQA 1N9WA 1LT5D 2A1AA 1TWHB 4FNFA 5D65A 2Y0SB 3TREA 3PO2H 1E2ZA 1O7LA 1KXLA 1TU2B 2NN6I 3S2DH 1FNWA 2KCMA 3FP9A 3PUVA 2QW7A 5AJ3L 1RD9D 4JI4Q 2F0JA 3KLSX 4CKEA 1Q46A 5IT9E 2SEBD 2F0MA 4JOIA 3MXNA 4MTNA 1WJJA 1LT4D 1NY4A 1YI2A 2UXBQ 2JN4A 2ID0A 4JI5Q 4LFBQ 1ZKOA 3PGZA 3OIPA 4HIKA 3C1FA 3RD4A 1EQQA 5EJWA 2EE1A 4DNRB 1WTRA 1Q90A 4LF5L 5KNBA 1NAPA 5JPMC 5KYLA 2SOBA 3QIAA 2GVBA 3KOJA 4ALPA 3V96A 2E2IH 2JA7B 1AZPA 2JA6G 1ESFA 3D4WA 1GUWA 1NCVA 3Q6SA 2BE5D 1ICWA 5EBDA 2EYFA 4RGOS 3CCQA 1EIHA 2UU9Q 5EPJA 1B3AA 3F1ZA 4DR3L 2PQAB 3FKIG 1K8MA 2MQHA 1G6PA 2PZTA 3MEFA 3OOCA 3VDYA 2F0LA 1B1ZA 1IBMQ 1ASZA 1B2TA 2D2CC 2H4OA 3E6ZX 4B3MQ 1JB3A 1G291 5IYDG 3JAML 2O5JC 2M2LA 1EWIA 5M5YB 1I3QB 3AB9A 3KLWA 1Q12A 1A2UA 4K5VA 2F4VL 3M7NA 2KENA 4DR7L 1B8AA 2E74C 1PH9A 5EPLA 1LTGD 1PH5A 2X6GA 1SJHD 5CV4A 5M5WB 4A3DH 4NXML 2E76C 2KCTA 1AH9A 3U9OA 2HHHQ 1L2FA 4GNXB 4DF7A 5I9PA 4ZUIA 1KDCA 1EFWA 3QR8A 2IL8A 3GTJH 3HOVB 2NB0A 3T1YQ 1VQ7A 3TP7A 4C2MB 3J81E 3H0GH 3SK6A 5E1FA 2R7ZB 3V2TA 1B3QA 1VF5C 2WV6D 3GO5A 1N36Q 3S14H 2ICEC 4C3IH 5EPKA 3FKIB 4HTHA 1PA6A 3PUYA 4ZAIA 1EY6A 4K14A 2A6HD 2KEEA 2NN6H 1MJEA 4XT3B 4A3GG 4DXGA 1K8OA 1PH8A 4F8MA 4DR4L 2E2HB 1XYIA 1MD2D 4PZ7A 2EYOA 3SHLA 1KHIA 2VQEL 4L8JA 1G51A 2Q8RE 3PF4A 2QA4A 4GKKQ 2FHTA 2F0QA 3NQTA 4H44C 5FLMG 3DEOA 3NP8A 3MEHA 2B63H 2JA5G 3CCMA 5DNFA 1CTMA 3NSWA 3PF5A 1KNAA 4DK1A 1V1QA 2KCNA 2XIWA 4YHHQ 1FGUA 4LUVA 1Q1BA 1U4RA 3HKZG 5EKIA 4BXXH 2VUMG 2AQ1B 3U4VA 1OXSC 2EDGA 1LACA 4DR5Q 4KJOA 5CBAE 4NW2A 1DONA 3S17H 4AYBB 3S2HB 3GTLH 4X3TA 3ND9A 1LTSD 3PO2B 3S2DB 4C3JH 4RFBA 1GVPA 2KVMA 2NTSA 3J80i 1QCBD 2K32A 3PSIA 2EY6A 3UDFA 2FMMA 3L7ZC 4JI1Q 4RH6A 4A3JH 1JE5A 2R61A 3UE1A 2PZUA 1BF4A 2B39A 3ND8A 4MTKA 1O7IA 1YNND 5C0XJ 4CKBA 1MJCA 3ULLA 2Y0SE 2NVTH 2RA4A 1B9NA 4OO1G 1HNWL 2KEDA 1YZ6A 1VQDA 1MKHA 4BY7G 5FKAC 5ELNA 4DR2L 3H6MA 2E2IB 3K57A 5ELCA 5TSSA 1MIUA 1ZYRC 2ZTEA 4P71A 1JWSD 1IKMA 4DGZA 2C5CA 2RKSA 3ZYYX 3PUXA 1CKNA 2DN8A 3EQLC 2XRSD 4NKLA 3U4ZA 4P73A 2VS1A 3GTMH 3PIP3 1ENAA 2K5HA 2WKCA 3HOUH 3TDQA 3P20A 2L1BA 1CT1D 1O7YA 1DYQA 3L0OA 1BOSA 4A3BG 1BUVT 3RMHA 3L9AX 3HOZB 4KTAA 4OXPA 1CKOA 1S4ZA 4FF1A 1WI5A 1I4QA 3T1HL 3HGBA 4B3TL 1Z6HA 1B53A 1D5ZC 1WYDA 1STGA 3I4LA 4CDEC 3KF8B 2YTYA 1PZID 1YNJC 1S5ED 4KK7A 4BXXG 2V4DA 3IKJA 2J0TD 2ZTDA 2K33A 1FL0A 4OONA 2AMCB 5T1GA 4A3DB 3K7AH 5C3EH 2A74C 5JJZA 2XWBB 1WD1A 4G57A 2R93G 1H9MA 2J4XA 5AJ3Q 5IYBG 4CHTB 1I4PA 3WOFA 1JWMD 5M5XB 1W6KA 5IGEA 3GTJB 1AW7A 4O1NA 3D8GA 4IJLA 4EQOA 3KJOA 3C3LA 2PQEA 3GD7A 3H0GB 1HA6A 1SLJA 1KNEA 1EOTA 1UE1A 1EOVA 2L12A 1MHWC 2M00A 1K8GA 3S14B 4C3IB 4A3MG 4A3JG 1D5MC 5ELEA 3KYHC 4LF5Q 1O78A 1WVLA 1N32L 4JBWA 5LL6S 2CW0C 2MP1A 5IGCA 5KNDA 3M3YH 1DJRD 1PFSA 1Y1WG 4EVOA 1SYDA 2YTVA 3A8JE 3RUZA 3E9IA 3WWVA 2NVQH 3NK9A 3HOXH 1LTLA 5E4XA 2B63B 2K04A 4DR3Q 1SYFA 4DV5Q 1SYEA 2N3SA 3LWEA 3RZOH 1A3UA 1NE3A 4DV7L 3VR5A 2A19A 2FMCA 2Z6BA 1BDOA 3P1HA 4A3LH 4GKJL 1M1KC 2OF1A 4IN3A 1MBYA 1PTOH 2EY2A 4C56C 1SNDA 1QWYA 4BBRH 1MSGA 3S17B 5I2YA 2AUJD 2JA8B 4UDUC 3DLLA 1XMOL 1EY9A 3FVQA 3TSSA 1YNXA 2BDOA 5LHY1 4LW1A 4C3JB 5FO8B 2F4VQ 4ME5A 4ZRZA 4DR7Q 3PIOA 4A93H 3FPUB 4RKLA 1ET6A 2I5LX 2L5TA 3HOYB 4A3JB 1N34L 1STEA 2ZXRA 4NXMQ 3C46A 2QDBA 1Q81C 4HAEA 1PZJD 4AYBE 3MHBA 1LTID 3GV6A 2EYHA 5C3EG 3I70A 4N9PA 3H3VC 3M4YA 3RN2A 1IYJB 2NVTB 2A69D 5IE8A 3BVGA 4LF7L 4LF9L 1BO0A 2AQ3B 1G8ZD 3NENA 1HHVA 1PV4A 2K7VA 3CCUA 2B3GA 4X62L 1V1PB 2F0FA 1IBML 1AN8A 1W6JA 1A8VA 1TY0A 4JBKA 1LTRD 4PZ8A 1ZXTA 4TRDA 4HIOA 1R9TB 1BKBA 4DR4Q 1Z9FA 1A3VA 1WTWA 2R6GA 3GTMB 2VQEQ 4K8IA 1A15A 4A3IG 3HOUB 4K0KL 1RODA 1SXTA 1FGBD 2MUYA 5CORA 4Y7NH 2A5HA 2BE5C 2EQSA 2EJFC 1JR0D 2BH8A 3SR1A 1IYUA 1UEAB 5NUCA 4JI8L 2O5IC 4EQNA 1SYCA 3TS0A 4LFCL 4XQJA 1BCPD 1PVOA 4WRDA 5ELBA 4IOCA 4A3LG 1XTCD 1XX8A 1TWCH 3CPWA 3K7AB 3S24A 5EAYA 1M4VA 4BBRG 4KHVA 2QGQA 3EA6A 1HCZA 1NR2A 1E24A 2CWPA 1YJWA 1U9RA 5K5PA 2F52A 1TIID 1NMFA 4KI0A 1JCKB 2R92G 3SK5A 4OIJA 2K5QA 4OWWB 3N6RA 2VB3X 4BS9A 1LTBD 4QL5A 5E3FA 5A2QE 2UUAL 4LK1C 1S5CD 3J7AF 2DY7A 4QIWB 3I4NG 1PYSB 1HNWQ 5BN4A 1I6VC 3ULPA 5FO9B 3VYRA 3J81j 3M3YB 4DR2Q 2RHQB 2F0PA 4CDCC 4DR1L 1PHJA 2IT1A 1VCIA 1CI3M 4HSPA 2D5DA 2R3ZA 1KAAA 2NVQB 2DUDA 3I8ZA 2A6HC 4OELB 3HOXB 4GLXA 4K2KA 4F88A 5CYUA 3AU7A 1FNVA 1V1OA 2EYJA 3J81i 2ALYB 2LSSA 4QMGA 3J80L 2BA0A 2MO0A 2XSCA 2E8GA 4IPCA 4JV5L 1G2SA 1ILQA 2FINB 2I5HA 4OL7A 2N88A 4QJFA 1PTOB 4OEMB 5JEAJ 2K75A 1JT8A 1PFMA 1JMCA 4OGQC 1SYBA 5CR3A 3D4DA 3CC2A 5EKLA 2B2TC 4F87A 3T56B 1IBLL 1QOHA 3TZUA 3T1HQ 4PNYA 4B3TQ 2IHFA 3UDGA 1WCMG 2WIIB 4A93B 1JOKA 4LJZC 4E6IA 5IT9c 2I5MX 3OHXC 1UNSA 3D4RA 1ML0D 1F2LA 1X3FA 4DV0L 3N52A 4A3KG 2IX1A 1F77A 2JA6H 2ES2A 1EYGA 3CC4A 5E4WC 3MXGA 5C5LA 4UP9A 1VQBA 3BYTB 3I72A 4HIMA 1CA6A 3A8IE 1GUNA 5KNCA 3CU7A 4DV3L 3K81C 2F3WA 3D6CA 4IUVA 2D0OA 2MHVA 4R4IA 1U0LA 1YNNC 4JI2L 4LF8L 1XNRL 3OMGA 1SN8A 1EU4A 5IYDH 1EYAA 1PH4A 5KYIA 4L5SA 4LNQA 1UE5A 1Q8IA 5D3DA 2E2JH 1N32Q 2X69A 1Q3LA 2WFWA 4KY5A 2PNHA 1K3RA 1SR3A 4KY6A 1ILPA 1F9SA 4JI7L 1IYVA 1ENCA 3HP3A 4LUOA 1H9JA 1YEZA 2JJQA 1HZ9A 4OO1I 4L5RC 4Y7NB 4A4IA 4FXKC 1SSOA 3K0YA 3PUWA 2A73B 4WJ3M 1VMCA 4A75A 2VXWA 1OXVA 5C4XG 1QJOA 2CQAA 2QEJC 4DV7Q 5EGTA 1IL8A 5I6WA 4KHPQ 3JAME 2RBMA 2BA1A 5A35A 1LO5D 2TMPA 3KBXA 4GKJQ 3EVQA 4YY3L 1HZAA 4IFDJ 2NWGA 4ILWA 2EVBA 2HUGA 3HEJA 3DXJC 1M8AA 2EIFA 2NZOA 2EY5A 1TWCB 1FNUA 4FVMA 4DAMA 1K9MC 1XMOQ 1SE4A 1HH2P 1VQKA 4X3SA 2Q2HA 3RR5A 4FF4A 3CRKC 3LX0A 1SJED 4UHVA 1VDZA 2MO1A 4A3GH 3VYTA 1IHZA 2N8NA 2ENBA 4EX5A 2ZTCA 2PMZE 4I65A 1Y8PB 4IOAA 3VR3A 3J81c 1N34Q 1ASYA 4RGNA 4LAAA 1VQEA 1U4LA 2HDMA 2G9DA 5FLMH 1H9SA 4G7OC 2JA5H 4I7AA 4J1MA 4HR7B 5ELOA 5T1IA 4LF7Q 4LF9Q 4IUQA 3S1NH 2OQ0A 4R1JA 1CM9A 1QNKA 4RA8A 4OX9Q 2F4IA 2VUMH 4OWXB 3T16A 3A8KE 3HZXA 4DV5L 4X62Q 3M4OB 3OWFA 1TQOA 2K6AA 2ZXPA 4H02A 1U4PA 3OPOA 4RMFA 4YCWA 1AFPA 1GM5A 1MSHA 1D8LA 1IZ6A 2PCFB 1XPUA 1D1KA 3MXPA 4QIWE 5FLXL 4KV6A 1TWFH 1RHPA 3K80C 1E22A 4K0KQ 4HJ7A 1EY8A 3LNNA 2Q2UA 4FO2A 1P16A 3BS1A 4JCVE 3L3OC 3SDZA 1IL2A 4JI8Q 3NWTA 4C1NI 4EQ5A 1VMPA 4KN7C 4LFCQ 1EQVA 1SNPA 4HJ5A 4XXEA 1V1PA 1A3TA 3BU2A 4OO1H 5L37A 3K5OA 1GHKA 4F7XA 1L1OB 4BY7H 1BCPB 1VQFA 1OXTA 2JA6B 2GVAA 2IX0A 1SNCA 1A0IA 4QGUA 3H3VH 4ABNA 2VQFL 2F0WA 2WAQG 3ITPA 1ENFA 1M90C 2NVXB 2VW9A 3M7GA 1TY2A 5FOBB 3NUCA 1HJPA 3URYA 3D3RA 4WFN3 3QO2A 4PV1C 1XMQL 3A74A 2ICIA 3GTOH 4GZYC 1QB5D 4DK3C 3S15H 4OHJA 2UUAQ 1YHAA 2B2TA 1SE8A 2E2JB 4DV4L 1TKWB 2A69C 3UDIA 1Q7YC 4A3BH 3R8BA 5IWAL 3OTOL 4L5TA 1C48A 2N55A 3IRBA 1T5EA 1K0SA 4DR1Q 1BNZA 4HSVA 2PNRC 4HMIA 2RDHA 5I6YA 1XNQL 2LFNA 1NSNS 1FJGQ 1LLRD 2EOTA 4DAVA 4X3KA 3RN5A 4DPGA 1QNUA 1B50A 2R93H 1VQOA 4ZK9B 1FD7D 4JV5Q 5IYBH 2F0IA 3GQBA 4R4TA 3K5NA 1QE6A 4EGVA 1FR3A 2AQ2B 3CCLA 2G5DA 3J7AV 1NMGA 1TVXA 1PMRA 4IFDI 2QF7A 3NTHA 1PTOF 4CKCA 4ZCKA 1IBLQ 4PG3A 1EY0A 4QY7A 4N9TA 4A3MH 4G7HC 2F0TA 4GOPB 4A3GB 1L1OC 1X32A 1BCPC 4MN3A 3A56A 4DV0Q 2UXDL 4DV1L 3KLRA 1Y1WH 1FVIA 5LL6X 2RCNA 5ELDA 2RSNA 2WB1G 1EQRA 3C1EA 2JA5B 2KCCA 2F03A 1CZGA 2O4XA 2F0UA 3CCJA 5GAHC 4JC0A 3S1NB 4EQPA 1Q8KA 1HR0L 3HKZB 3GTKH 4DV3Q 2VUMB 3VR6A 4V190 4JI2Q 4LF8Q 3I4MG 3G7LA 1XNRQ 1F2ZA 5CMDA 4R8IA 2PZWA 2OWOA 4X6AH 1RF2D 4ZQ3A 4V0BA 3D0FA 4JI7Q 1VF7A 2UUBL 2RSOA 3KF6A 3HG9A 1GD7A 2FFKB 4XQNA 1BQQT 4O42A 2VL6A 1STAA 2QILA 2ASBA 1K28A 2CWAA 5G3LD 3A7AB 2EPBA 1X3EA 1I50H 3S1QH 3S16H 1ESRA 4A3EG 1UWVA 2LXJA 1SE2A 2AHOB 5HGTA 4YY3Q 2MNAA 3CHBD 4POFA 2NUCA 4KMUC 3I73A 2IX3A 2Z9HA 2IWHA 1PH2A 4BY7B 4HN7A 2NBFA 5I9OA 1NNXA 3NXWA 4XIGS 4GOPC 3RNUA 1WD0A 1UE7A 3T13A 4PQXA 1LT3D 3HFZB 4HJ8A 2H5XA 3DUZA 2EJGC 1VQ5A 4DK6C 1EYDA 4A3IH 2E2DC 4DK0A 1JQYD 3Q24A 1DOLA 3S15B 1DCZA 5J22A 3H94A 5DAUA 1EY4A 3ERSX 3RZDH 2EZVA 1TS4A 5JEAG 2KHSA 4A3BB 1GO3E 2E5LL 2F0OA 4IURA 3X3NA 1A6XA 4GN3B 1TWGH 3GTPH 3PQIA 3NE5B 3G4SA 3AMUA 1YITA 4XYQA 4OWTB 3GDEA 1JE4A 4NPSA 4BY1G 1H9SB 2Z6KA 1KQSA 4ZLTF 4KHPL 4QQBX 2DJFC 4BBSG 4GLVB 4A3CG 2HD3A 2LXKA 2DNCA 4GN4B 1J5EL 4FDBA 3BDOA 1Q1EA 2R93B 4ZYSA 1JICA 1LV9A 3ER0A 4DUYL 4UAIA 1TWAH 3GTLB 2B29A 2YU9H 4BA1I 1CFMA 4B3SL 2AKWB 1PYWD 3J7YW 3GTGH 4CDDC 5CGKA 1A62A 1RKNA 3NBHA 5GAEC 1SMYD 2R92H 3KLSA 1VQCA 1Y1VH 3KK7A 4ZKCB 2A6ED 5M3FG 4PMWA 4A3MB 1PDQA 5FJ8G 2NZHA 2YTXA 1WOCA 1K3BC 3I4NH 3BG3A 1QVCA 1Q86C 3P7JA 1HQRD 4O2DA 2XWJB 3EJIA 3TQYA 5C0XI 1Y1WB 2KUMA 3NELA 1DM0B 1B70B 3I7FA 3JC66 4IUTA 3RLNA 3VA7A 3KFUA 2VQFQ 2QCPX 4OX9L 3OWEB 3NWSA 3I4OA 2B8FA 4N8FA 2D9UA 2ZJRA 1TT2A 1UE6A 3AQQA 2HIXA 4CJ0B 2M9VA 1E3PA 2OQKA 3OYYA 1SROA 3GTKB 1R4PB 1XMQQ 1TS3A 2L11A 1RCVD 4XYOA 3CAMA 4NB3A 2F0SA 1CQVA 1X6OA 3MFGA 3FMCA 1E7ZA 1AE2A 3G71A 1PH3A 3EROA 4IFDG 5J3BA 4DV4Q 4YIJA 5IWAQ 3E0EA 4R4CA 3OTOQ 2PW7A 1HZCA 1HZBA 1L1OA 1QVGA
chains in the Genus database with same CATH topology
4HCSA 3SK4A 5HURA 2VB2X 1SEBD 4WJWA 2PMZB 4HCEA 1F9QA 4QCLA 4IUPA 4B08A 2ZT9C 5JVG3 2RDGA 1BXTA 3S1QB 3S16B 5ISRA 5C3EB 4L63B 3I91A 5KIXA 2KJXA 2I46A 1J8IA 3MC0B 2RDFA 1V8QA 2KA7A 5FK9C 3IL8A 3TP5A 4RGMA 3UI2A 2CVRA 3NQIA 2K01A 3EFXD 2L9HA 1F9RA 2AWOA 1Y69U 5J1ZA 2HQEA 3R2TA 4QF4A 3DM1A 2BCOA 4A3IB 4TSSA 1DXMA 4IALA 3BVMA 2FJ2A 1EZ6A 2XNAC 3LWUA 3K5MA 3RZDB 1G6ZA 3FDTA 2EY1A 4I7ZC 2Q8TA 1TWGB 3GTPB 4IUNA 4ZKBB 1PZKD 3RZOB 1DZ1A 2OT2A 3U9SA 3IAYA 1ET9A 2A68D 4DN4M 4R9WA 4C3HG 4BBRB 1X3PA 2Z1CA 1E2VA 3A54A 1TWAB 2B8GA 2MJ8A 3BDLA 1AP0A 4K5XA 1JOQA 2YU9B 3GTGB 1UUPA 4G4KA 2R92B 4XQQA 1Y1VB 1OO9B 2MPMA 3MA2B 1S5DD 1D6EC 1PXUA 2F0EA 3TBIB 3VR4A 3I4NB 1PRTD 3GV3A 1E2WA 1GJXA 2DY8A 5IOCA 3I90A 1GUTA 2Q8IB 1I4HA 2K5DA 3G6JB 1DD2A 4MIUA 1GXDC 1RDPD 1KTKA 3VYUA 4XTCS 5JPNC 1EEID 1JWUD 1STNA 3FEWX 2IW3A 3HRZC 2RVLA 4Q5VA 1QG7A 4CJ2C 3FRPB 5CV5A 4FXGC 1H9KA 1J9OA 1HUMA 5JVH3 1WCMB 4ID6A 5CV6A 3K6OA 2WINB 3H91A 5FLXE 1MI2A 2NZ1D 3RLFA 4A3KB 2EJMA 4RCOA 5C0XG 3DEPA 2YYZA 3I3CA 5JAVA 2JSOA 4QUCA 1C8CA 3T4AC 2F0HA 4DAYA 1I6HB 1B4OA 1XWEA 2WKDA 4TKOB 1O80A 2AWNA 2B2WA 2SNMA 1SBBB 1DOMA 4X3UA 3WOEA 2XN9C 4FXDA 3SXHA 3ERQA 2MGSA 3S1MB 1HUNA 1V43A 4KKSA 3NBIA 3QWNA 5CV8A 1SYGA 4FYDA 1AZQA 2SNSA 2LY7A 1HTPA 1GUSA 1STBA 1STYA 4QUFA 1IW7D 5EBCA 2H1EA 5C4XB 1OXXK 1XXGA 3MWYW 4LMQD 4NDXA 5CC4A 3QOJA 2J7ZA 2B2YA 3W2DA 5C4ZA 2GA4B 2KECA 4PMCA 5KRUA 4K8JA 1DOKA 4XDXA 1NR4A 3S9WA 3CKIB 5K36G 1PFNA 3T51B 4H13C 4KN4C 1RTOA 4M8AA 1WTVA 3NTIA 2EYPA 3O13A 1WTPA 5IT9L 3A7LA 3R2IA 2B2VC 1F2YA 1WTQA 2SDFA 3W3AA 3TMEA 4ULLA 4RKBA 3NHHA 3C2PA 4J8QA 3PIO3 1HXYD 1SMYC 4P2CB 2HCCA 2NTTA 2A6EC 2LS01 2JYOA 5C5MA 4J6HA 1SFOB 4H7BA 3Q22A 4KD3A 3OSOA 1CK1A 1WTOA 2Z4IA 4FP5D 3DWAA 4K6LA 4M1UB 1TR5A 3TP8A 1BR9A 3BDCA 1CQFA 1B44D 3VA5A 1L0XB 2E75C 4DU9A 3CRLC 1KDAA 4IQZA 2JEAI 4ZUJA 2BDNA 1TS2A 3WDNA 3VYSA 3QB3A 4DFAA 1GHJA 4G7ZC 1KLGD 1O7ZA 1II3A 4Q0FA 1E0BA 1EZ8A 3VR2A 1D1IA 4RGTA 1I4RA 5AFWA 5F2DA 4K5WA 2DNEA 4KJNA 1SNOA 3TN2A 2WAQB 3NTKA 1EEFD 3K58A 3HS0C 4CJ1B 5C3XA 1A2TA 1IKLA 3DWPA 5ELFA 2JE6I 3M85A 3J81L 1ZEQX 5JEAH 2O2LD 5G3LF 5IGBA 3K5LA 1PRTB 3NPPA 1UAPA 4H0LC 2F0KA 3T53B 4FF3A 3P75A 1HQMC 3MTSA 1HFNA 1JOOA 1TWFB 4C3IG 3R93A 1S5FD 1I4GA 2NN6G 1T5XD 1PTOD 1I4XA 1D5XC 2WP8J 2Z8LA 4XT1B 2K03A 4QB4A 2XRQD 1SE3A 2A68C 2L55A 1KLUD 2C9OA 1NUCA 4CGYB 4KY7A 2WB1B 1AEXA 4IZ8A 2LMCB 1L0YB 2F0GA 5J39A 1S5BD 3I4MB 4DNTB 3Q23A 4DA2A 4KKUA 4IFDH 3GTOB 4C3JG 1PRTC 5IGDA 4HMJA 5C3WA 1HTLD 4RAUC 5IODA 1EWCA 5KEEA 5JOBA 4WORA 2EYLA 4ODGA 4TQUS 1JORA 4DXFA 1FYCA 5M9OA 5BN3A 1U4MA 3E0JA 2F1MA 2B2VA 1BBXC 3MAQA 3DWQA 5D3IB 4A3EB 1KDBA 3ONAB 3KUPA 3F2UA 3CQZB 2F0NA 2XVSA 2IPKD 1CHQD 4IUUA 3BZDB 3S1RB 1EY5A 2Z4HA 5C4HA 3SVMA 3PV0A 1EU3A 5COYA 1PFBA 2IJ0A 2BOSA 1SAPA 3X3MA 1CHPD 2K28A 1PLFA 1LTAD 3OW7A 1SDFA 1STHA 2B2UC 2OEOA 2D62A 2PO4A 5KGUA 1BCPF 3QOLA 1K83B 2PYKA 3BYYB 1B9MA 1SNQA 3QJYA 5EQ0A 3D6WA 4FF2A 4BWGB 1X3QA 1OXUA 4RWSC 4BY1B 3SEBA 2B2WC 4BBSB 5DM73 1GOZA 1RTNA 1HPCA 4HEDA 2PW5A 2AUKA 1HFGA 5IIFA 5CBEE 1TS5A 1IW7C 1LABA 2VNUD 3QG1A 3J80E 2CHBD 1Z7TA 5M3FB 2RQXA 2G9HD 3Q0AA 4U673 2WACA 3MFYA 2HCIA 1I50B 3PUZA 2L4NA 4KHZA 1EIGA 2B2YC 2HDLA 1EWHA 2JEBI 3GTQB 2KOLA 2F0VA 4DAPA 1H9RA 2F0DA 5FO7B 2K5WA 4K2LA 5DEHA 4NP5A 1EFID 2NVYB 1ZYRD 1G2TA 3KBGA 5EKKA 3IFDA 3R3OA 1HRJA 4KKTA 2ZXOA 2PPBC 4RCNA 1PRTF 3GP7A 3IFTA 3OIQA 3BVZA 2OXPA 4OIKA 5C0XH 1F9PA 2K05A 1LT6D 3H09A 4Z9CB 3SK8A 1Y8NB 1MGSA 1WTXA 3DMUA 4C1NK 3DHQA 2X6LA 4B9XA 1YNJD 1JC7A 2KQ3A 1EL0A 1D2BA 5I2XA 3FPPA 2F3VA 4KD4A 3A55A 1EY7A 5CV9A 3MXUA 4U68A 5D14A 2TSSA 1R4QB 1EYCA 3TZDA 5C44B 2LKVA 5A2QL 4MHEA 4RHRA 1G91A 2I07B 1QILA 2CW0D 3PMFA 5DM63 1CZWA 4R8NA 4K6DA 2JXMB 5C4JB 4S3SA 1CA5A 4C3HB 4BA2I 1C4QA 2EYMA 4PMBA 4A3FB 2EXZA 3D31A 5K36H 3OMCA 3MZ5A 5CV7A 1GUOA 1Z47A 1Y8OB 5C6AA 2QKIC 1EQTA 3KF8A 1KABA 1RJTA 2JP1A 5M3MB 2B2UA 1F2MA 4L6TB 3TP6A 1LTTD 1ONLA 1HA5A 3HOWB 1GUGA 4JK1C 3V05A 2NYZD 3MVVA 2K1BA 2L0CA 3E5SA 3SE0A 4CBVA 5I4DA 4RHSA 4B9WA 5BN5A 4NMZA 1SNMA 5IGGA 1PTOC 5IGFA 3PO3B 3K59A 1LT5D 4FNFA 1TWHB 5D65A 2Y0SB 1E2ZA 1O7LA 1TU2B 2NN6I 1FNWA 3PUVA 1RD9D 2F0JA 3KLSX 4CKEA 5IT9E 2SEBD 2F0MA 3MXNA 1LT4D 2ID0A 1ZKOA 3OIPA 3C1FA 3RD4A 5EJWA 2EE1A 4DNRB 1WTRA 1Q90A 5KNBA 1NAPA 5JPMC 5KYLA 2SOBA 3QIAA 3V96A 2JA7B 1AZPA 1ESFA 3D4WA 1GUWA 1NCVA 3Q6SA 2BE5D 1ICWA 5EBDA 2EYFA 4RGOS 1EIHA 5EPJA 1B3AA 1K8MA 2PZTA 3OOCA 2F0LA 1B1ZA 1B2TA 2D2CC 2H4OA 3E6ZX 1JB3A 1G291 3JAML 2O5JC 2M2LA 5M5YB 1I3QB 3AB9A 1Q12A 1A2UA 4K5VA 3M7NA 2E74C 5EPLA 1LTGD 2X6GA 1SJHD 5CV4A 5M5WB 2E76C 3U9OA 4DF7A 5I9PA 4ZUIA 1KDCA 2IL8A 3HOVB 2NB0A 3TP7A 4C2MB 3J81E 3SK6A 5E1FA 2R7ZB 3V2TA 2WV6D 1VF5C 3GO5A 2ICEC 5EPKA 3FKIB 4HTHA 3PUYA 4ZAIA 1EY6A 4K14A 2A6HD 2KEEA 2NN6H 4XT3B 1K8OA 4DXGA 4F8MA 2E2HB 1XYIA 1MD2D 3SHLA 2EYOA 4L8JA 2Q8RE 2FHTA 2F0QA 3NQTA 4H44C 3DEOA 3NP8A 3MEHA 5DNFA 1CTMA 3NSWA 1KNAA 4DK1A 2KCNA 2XIWA 1Q1BA 1U4RA 5EKIA 2AQ1B 1OXSC 2EDGA 1LACA 4KJOA 5CBAE 4NW2A 1DONA 4AYBB 3S2HB 4X3TA 3ND9A 1LTSD 3PO2B 3S2DB 4RFBA 2KVMA 2NTSA 1QCBD 2K32A 2EY6A 2FMMA 3L7ZC 4RH6A 2R61A 2PZUA 1BF4A 2B39A 3ND8A 1YNND 5C0XJ 4CKBA 2RA4A 1B9NA 4OO1G 2KEDA 5FKAC 3H6MA 2E2IB 3K57A 5ELCA 5TSSA 1ZYRC 1IKMA 1JWSD 4DGZA 2C5CA 2RKSA 3ZYYX 3PUXA 2DN8A 3EQLC 2XRSD 4NKLA 3PIP3 1ENAA 2WKCA 3TDQA 3P20A 2L1BA 1CT1D 1O7YA 1DYQA 1BOSA 1BUVT 3RMHA 3L9AX 3HOZB 4KTAA 1S4ZA 4FF1A 1I4QA 3HGBA 1Z6HA 1B53A 1D5ZC 3I4LA 1STGA 1PZID 1YNJC 1S5ED 4KK7A 2V4DA 3IKJA 2J0TD 2K33A 4A3DB 5T1GA 2A74C 5JJZA 2XWBB 1WD1A 4G57A 1H9MA 2J4XA 4CHTB 1I4PA 3WOFA 1JWMD 5M5XB 1W6KA 5IGEA 3GTJB 1AW7A 4O1NA 3D8GA 4EQOA 3C3LA 2PQEA 3GD7A 3H0GB 1HA6A 1KNEA 1EOTA 2L12A 2M00A 3S14B 4C3IB 1D5MC 5ELEA 1O78A 1WVLA 4JBWA 5LL6S 2CW0C 2MP1A 5IGCA 5KNDA 1DJRD 4EVOA 1SYDA 3A8JE 3RUZA 3NK9A 5E4XA 2B63B 2K04A 1SYFA 1SYEA 3LWEA 1A3UA 3VR5A 2FMCA 1BDOA 3P1HA 2OF1A 4IN3A 1MBYA 1PTOH 2EY2A 4C56C 1SNDA 1QWYA 1MSGA 3S17B 5I2YA 2AUJD 2JA8B 4UDUC 1EY9A 3FVQA 3TSSA 2BDOA 5LHY1 4C3JB 5FO8B 4ME5A 4ZRZA 3FPUB 4RKLA 1ET6A 2L5TA 3HOYB 4A3JB 1STEA 2ZXRA 3C46A 2QDBA 4HAEA 1PZJD 3MHBA 1LTID 3GV6A 2EYHA 3I70A 4N9PA 3H3VC 3M4YA 2NVTB 2A69D 3BVGA 1BO0A 2AQ3B 1G8ZD 1HHVA 2K7VA 1V1PB 2F0FA 1AN8A 1W6JA 1TY0A 1LTRD 4TRDA 1ZXTA 1R9TB 1A3VA 1WTWA 2R6GA 3GTMB 4K8IA 1A15A 3HOUB 1RODA 1SXTA 5CORA 1FGBD 2MUYA 2A5HA 2BE5C 2EJFC 1JR0D 3SR1A 1IYUA 1UEAB 5NUCA 2O5IC 4EQNA 1SYCA 4XQJA 1BCPD 4WRDA 5ELBA 1XTCD 1XX8A 3K7AB 1M4VA 4KHVA 3EA6A 1HCZA 1NR2A 1U9RA 5K5PA 1TIID 4KI0A 1JCKB 3SK5A 4OIJA 2K5QA 3N6RA 2VB3X 4BS9A 1LTBD 5E3FA 5A2QE 4LK1C 1S5CD 3J7AF 2DY7A 4QIWB 5BN4A 1I6VC 5FO9B 3VYRA 3M3YB 2F0PA 2IT1A 1VCIA 1CI3M 4HSPA 2D5DA 2R3ZA 1KAAA 2NVQB 3I8ZA 2A6HC 3HOXB 4K2KA 4F88A 5CYUA 3AU7A 1FNVA 1V1OA 2EYJA 4QMGA 3J80L 2BA0A 2XSCA 1G2SA 1ILQA 2FINB 4OL7A 2N88A 1PTOB 5JEAJ 1PFMA 4OGQC 1SYBA 5CR3A 3D4DA 5EKLA 2B2TC 4F87A 3T56B 1QOHA 3TZUA 4PNYA 2WIIB 4A93B 1JOKA 4LJZC 4E6IA 3OHXC 1UNSA 3D4RA 1ML0D 1F2LA 3N52A 2IX1A 1F77A 5E4WC 3MXGA 5C5LA 3BYTB 3I72A 1CA6A 3A8IE 1GUNA 5KNCA 3CU7A 2F3WA 3D6CA 4IUVA 2MHVA 1YNNC 3OMGA 1EU4A 1EYAA 5KYIA 1Q8IA 5D3DA 2X69A 1Q3LA 4KY5A 4KY6A 1ILPA 1F9SA 1IYVA 1ENCA 3HP3A 1H9JA 4OO1I 4Y7NB 4FXKC 1SSOA 3K0YA 3PUWA 2A73B 1VMCA 2VXWA 1OXVA 1QJOA 2CQAA 2QEJC 5EGTA 1IL8A 5I6WA 3JAME 2RBMA 2BA1A 5A35A 1LO5D 2TMPA 3KBXA 3EVQA 4IFDJ 2NWGA 4ILWA 2EVBA 2HUGA 3HEJA 3DXJC 1M8AA 2EY5A 1TWCB 1FNUA 4FVMA 1SE4A 4X3SA 4FF4A 3CRKC 3LX0A 1SJED 1VDZA 3VYTA 1IHZA 2ENBA 4I65A 1Y8PB 3VR3A 4RGNA 4LAAA 1U4LA 2HDMA 2G9DA 1H9SA 4G7OC 4J1MA 4HR7B 5T1IA 4IUQA 1CM9A 1QNKA 4RA8A 2F4IA 3T16A 3A8KE 3HZXA 3M4OB 3OWFA 1TQOA 2K6AA 2ZXPA 1U4PA 3OPOA 1AFPA 1MSHA 2PCFB 1D1KA 3MXPA 5FLXL 4KV6A 1RHPA 1EY8A 3LNNA 4FO2A 3BS1A 3L3OC 3SDZA 3NWTA 4C1NI 1VMPA 4KN7C 1EQVA 1SNPA 4XXEA 1V1PA 1A3TA 4OO1H 3K5OA 1GHKA 4F7XA 1BCPB 1OXTA 2JA6B 2IX0A 1SNCA 4ABNA 2F0WA 3ITPA 1ENFA 2NVXB 3M7GA 1TY2A 5FOBB 3NUCA 3URYA 3D3RA 4WFN3 3QO2A 4PV1C 4GZYC 2ICIA 1QB5D 4OHJA 2B2TA 2E2JB 1TKWB 2A69C 3R8BA 1C48A 2N55A 1T5EA 1BNZA 4HSVA 2PNRC 4HMIA 2RDHA 5I6YA 2LFNA 1NSNS 1LLRD 2EOTA 4DAVA 4X3KA 1QNUA 1B50A 4ZK9B 1FD7D 2F0IA 3GQBA 3K5NA 1QE6A 4EGVA 1FR3A 2AQ2B 3J7AV 1TVXA 1PMRA 4IFDI 2QF7A 3NTHA 1PTOF 4CKCA 1EY0A 4N9TA 4G7HC 2F0TA 4A3GB 1X32A 1BCPC 4MN3A 3A56A 3KLRA 5LL6X 5ELDA 2RSNA 3C1EA 2JA5B 2KCCA 2F03A 1CZGA 2O4XA 2F0UA 3S1NB 4EQPA 3HKZB 2VUMB 3VR6A 4V190 3G7LA 1F2ZA 5CMDA 4R8IA 2PZWA 1RF2D 4ZQ3A 4V0BA 1VF7A 2RSOA 3HG9A 2FFKB 4XQNA 1BQQT 4O42A 1STAA 2QILA 5G3LD 3A7AB 2EPBA 1ESRA 1SE2A 5HGTA 3CHBD 2NUCA 4KMUC 3I73A 2IX3A 2IWHA 4BY7B 4HN7A 2NBFA 5I9OA 3NXWA 4XIGS 1WD0A 3T13A 4PQXA 1LT3D 3DUZA 2EJGC 1EYDA 4DK0A 2E2DC 1JQYD 3Q24A 1DOLA 3S15B 1DCZA 5J22A 3H94A 5DAUA 1EY4A 2EZVA 1TS4A 5JEAG 2KHSA 4A3BB 2F0OA 4IURA 3X3NA 1A6XA 3NE5B 3AMUA 4XYQA 1JE4A 1H9SB 4ZLTF 2DNCA 3BDOA 1Q1EA 2R93B 4ZYSA 1JICA 1LV9A 4UAIA 3GTLB 4BA1I 1CFMA 1PYWD 3J7YW 5CGKA 1RKNA 3NBHA 1SMYD 3KLSA 3KK7A 4ZKCB 2A6ED 4PMWA 4A3MB 1PDQA 3BG3A 3P7JA 1HQRD 2XWJB 3EJIA 5C0XI 1Y1WB 2KUMA 1DM0B 4IUTA 3VA7A 2QCPX 3OWEB 3NWSA 2B8FA 2D9UA 1TT2A 4CJ0B 2M9VA 3GTKB 1R4PB 1TS3A 2L11A 1RCVD 4XYOA 2F0SA 1CQVA 3MFGA 3FMCA 3EROA 4IFDG 4YIJA 2PW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY2 A;  3OMG A;  1EY8 A;  2PYK A;  1NUC A;  1SND A;  2SNS A;  3SK4 A;  3SK8 A;  5J22 A;  5DAU A;  4NMZ A;  1EYA A;  1SNM A;  1EY4 A;  2F0T A;  4KY7 A;  1SNQ A;  2F0E A;  3TP7 A;  1U9R A;  1II3 A;  5IGG A;  5IGF A;  1STB A;  4NKL A;  5K5P A;  3SK6 A;  1STY A;  1AEX A;  4IZ8 A;  5E1F A;  3V2T A;  2KHS A;  3DMU A;  1EY9 A;  4KY5 A;  1ENA A;  4KY6 A;  2F0O A;  3SK5 A;  5HUR A;  5IOC A;  2F0J A;  1ENC A;  2F0G A;  4NDX A;  4HTH A;  5CC4 A;  3QOJ A;  4ME5 A;  3DHQ A;  5E3F A;  1EZ8 A;  5J39 A;  1EY6 A;  2F0M A;  2PW5 A;  4K14 A;  4B9X A;  4RKL A;  5F2D A;  4K5W A;  1EQV A;  1SNP A;  4KJN A;  5C4Z A;  2KQ3 A;  1SNO A;  4F8M A;  4MIU A;  5ISR A;  3S9W A;  1A3T A;  3C1E A;  5IIF A;  4PMC A;  2O4X A;  4KTA A;  2F0U A;  5KIX A;  4F7X A;  3SHL A;  2EYO A;  2F3V A;  2QDB A;  4KD4 A;  2RDF A;  2F0P A;  3C1F A;  5KRU A;  5EGT A;  5IGD A;  4HMJ A;  4EQP A;  3MHB A;  5C3W A;  2F0Q A;  5C3X A;  3NQT A;  4K8J A;  1SNC A;  5I6W A;  5IOD A;  1STG A;  3TP5 A;  2RBM A;  1A2T A;  2EYH A;  1EY7 A;  1KAA A;  2F0W A;  4N9P A;  3EVQ A;  3MEH A;  3NP8 A;  4WOR A;  3ITP A;  5JOB A;  2EYL A;  5KYL A;  1F2Z A;  1STN A;  2SOB A;  3HEJ A;  4K2K A;  5CV9 A;  2WAC A;  2EYJ A;  4ODG A;  2PZW A;  5CGK A;  1JOR A;  2EY5 A;  4QMG A;  5J1Z A;  3D4W A;  1RKN A;  3NUC A;  5M9O A;  4G57 A;  2HQE A;  4ZQ3 A;  2EYP A;  1EYC A;  4QF4 A;  5IGB A;  2EYF A;  2F0F A;  5CV5 A;  2LKV A;  4KJO A;  4OL7 A;  3LX0 A;  5IGE A;  4IAL A;  4TRD A;  1F2Y A;  1IHZ A;  4ID6 A;  3D8G A;  1KDB A;  2ENB A;  1EZ6 A;  5CV6 A;  3TME A;  4EQO A;  2PZT A;  1SYB A;  2F0K A;  4I65 A;  4RKB A;  2F0L A;  5I9P A;  2PQE A;  3PMF A;  3NHH A;  1A3V A;  2F0N A;  1STA A;  2F0V A;  3D4D A;  5CR3 A;  5EKL A;  2EY1 A;  4K8I A;  3EJI A;  2M00 A;  3P75 A;  4R8N A;  4LAA A;  4K6D A;  4S3S A;  4PNY A;  5JAV A;  1EY5 A;  1JOK A;  2EYM A;  4IUN A;  4PMB A;  4E6I A;  5C4H A;  2EXZ A;  3SR1 A;  3OMC A;  2F0D A;  5HGT A;  5KYI A;  2EY6 A;  3MZ5 A;  2NUC A;  4HMI A;  4J1M A;  5CV7 A;  2F0H A;  5C5M A;  5NUC A;  1JOO A;  1TT2 A;  4J6H A;  5I6Y A;  4K2L A;  1NSN S;  1A2U A;  4H7B A;  5DEH A;  4KD3 A;  2PZU A;  3OSO A;  4K5V A;  4NP5 A;  4EQN A;  5IGC A;  5C6A A;  5EKK A;  1SYC A;  3R3O A;  5KEE A;  4EVO A;  1SYD A;  2SNM A;  1KAB A;  3RUZ A;  3T16 A;  5I9O A;  3HZX A;  3NXW A;  1F2M A;  5C5L A;  3OWF A;  1TR5 A;  1TQO A;  3NK9 A;  3T13 A;  2F0S A;  2F0I A;  3TP6 A;  3TP8 A;  1STH A;  3BDL A;  3BDC A;  4K5X A;  4WRD A;  3SXH A;  1JOQ A;  5CV4 A;  3VA5 A;  3ERQ A;  2OEO A;  3ERO A;  1SYF A;  4DU9 A;  1SYE A;  1KDA A;  3MVV A;  1A3U A;  3H6M A;  3U9O A;  4ZUJ A;  4YIJ A;  3E5S A;  2PW7 A;  5KGU A;  3MXP A;  4QB4 A;  4KHV A;  3P1H A;  2OXP A;  2F3W A;  4KV6 A;  4DF7 A;  4B9W A;  1EY0 A;  1EYD A;  4N9T A;  2OF1 A;  3D6C A;  1KDC A;  3QB3 A;  5CV8 A;  4ZUI A;  4DFA A;  4DGZ A;  1SYG A;  2RKS A;  3QOL A; 
#chains in the Genus database with same CATH topology
 1WCM H;  4HCS A;  3SK4 A;  5HUR A;  3CXC A;  2VB2 X;  1SEB D;  3KJP A;  3HKZ E;  4WJW A;  1YJN A;  2PMZ B;  1S3O A;  4HCE A;  1Y14 B;  1XNQ Q;  4A3K H;  1IXR A;  1F9Q A;  4QCL A;  3HOW H;  3I55 A;  4IUP A;  1VS0 A;  5IP9 H;  4B08 A;  2ZT9 C;  5JVG 3;  2RDG A;  1BXT A;  3S1Q B;  3S16 B;  1UEB A;  5ISR A;  5C3E B;  4L63 B;  1I6H H;  4JW0 A;  3I91 A;  4LUZ A;  1TXY A;  1N33 Q;  5KIX A;  2KJX A;  2I46 A;  1J8I A;  3MC0 B;  2RDF A;  1W2B A;  1V8Q A;  2D0P A;  2KA7 A;  5FK9 C;  3OW2 A;  3IL8 A;  3TP5 A;  4MZ9 A;  4RGM A;  3UI2 A;  2CVR A;  3TS2 A;  3NQI A;  2K01 A;  3A5Z B;  3EFX D;  2L9H A;  2Q2I A;  4NXN L;  3S1M H;  1Y1V G;  1F9R A;  3K7U C;  2AWO A;  1Y69 U;  5J1Z A;  3L2P A;  2RHS B;  2HQE A;  2UXD Q;  3R2T A;  4DV1 Q;  2UXC L;  4QF4 A;  3DM1 A;  2BCO A;  4A3I B;  4TSS A;  1DXM A;  4IAL A;  3BVM A;  3U50 C;  2CQO A;  2FJ2 A;  1EZ6 A;  1AE3 A;  2XNA C;  3LWU A;  3K5M A;  3RZD B;  5C4X H;  4YCU A;  5IP7 H;  1X56 A;  1G6Z A;  3FDT A;  2EY1 A;  1CSQ A;  4I7Z C;  5JJI A;  3PIP A;  5C44 G;  5IY0 A;  2JA7 H;  2Q8T A;  1HR0 Q;  2K5N A;  1TWG B;  1FJG L;  3GTP B;  3W5O A;  4IUN A;  4ZKB B;  1PZK D;  3RZO B;  1DZ1 A;  2OT2 A;  4JBM A;  1WFQ A;  3A5U A;  5GAD C;  3U9S A;  4KLK A;  3IAY A;  1ET9 A;  2A68 D;  4GOP A;  4DN4 M;  1SMX A;  4R9W A;  4C3H G;  4BBR B;  4A3F G;  1X3P A;  2Z1C A;  1E2V A;  2UUB Q;  3F2D A;  3A54 A;  1TWA B;  2B8G A;  2MJ8 A;  3BDL A;  3JAM c;  4K5X A;  1AP0 A;  1JOQ A;  3SGI A;  2YU9 B;  1KAW A;  1CUK A;  4IPH A;  1XPO A;  3GTG B;  1UUP A;  1E1O A;  4G4K A;  3I2Z A;  5M3M G;  2K14 A;  2R92 B;  3EBE A;  4JI0 L;  4XQQ A;  1QZG A;  1Y1V B;  1K0R A;  1OO9 B;  3BZC A;  2MPM A;  3MA2 B;  1XPR A;  3HOW G;  1S5D D;  1HR0 W;  3KF6 B;  1D6E C;  1PXU A;  2F0E A;  3TBI B;  3VR4 A;  5IP9 G;  2PI2 A;  3J7A 5;  3I4N B;  1PRT D;  3GV3 A;  1E2W A;  4HJ9 A;  1GJX A;  1VQM A;  2DY8 A;  5IOC A;  2A8V A;  2CFM A;  3I90 A;  1GUT A;  2Q8I B;  1I4H A;  2K5D A;  2K5V A;  3PO3 G;  3G6J B;  1DD2 A;  4MIU A;  3CCR A;  1SFO H;  2Y0S G;  1GXD C;  1X65 A;  3ICE A;  1RDP D;  1CSP A;  3BJU A;  1C7Y A;  1KTK A;  2C35 B;  2I0Q A;  3VYU A;  4XTC S;  1N8R C;  5JPN C;  1EEI D;  4JYA L;  1JWU D;  1STN A;  2CKZ B;  3FEW X;  1ICF B;  2IW3 A;  3HRZ C;  1KD1 C;  2RVL A;  3CMA A;  4Q5V A;  1QG7 A;  2E5L Q;  4CJ2 C;  1S40 A;  2VY3 A;  4DUZ L;  1EUJ A;  3FRP B;  1C0A A;  5CV5 A;  4FXG C;  1H9K A;  1J9O A;  1HUM A;  3STB D;  5IP7 G;  2HIV A;  5JVH 3;  1WCM B;  3Q8D A;  4ID6 A;  5CV6 A;  3K6O A;  2ZM6 L;  2JA7 G;  1S72 A;  2WIN B;  3H91 A;  1KIX A;  1JJG A;  2QDL A;  5FLX E;  1MI2 A;  2NZ1 D;  3RLF A;  4A3K B;  1K73 C;  2EJM A;  4RCO A;  5C0X G;  1J5E Q;  3DEP A;  2YYZ A;  1PH1 A;  4UY8 C;  3I3C A;  5JAV A;  1X54 A;  4DUY Q;  2JSO A;  4QUC A;  1C8C A;  4A76 A;  3T4A C;  4HID A;  1VQ9 A;  2F0H A;  4DAY A;  1I6H B;  1B4O A;  1XWE A;  4B3S Q;  2WKD A;  4TKO B;  1O80 A;  2AWN A;  2B2W A;  1D7Q A;  2SNM A;  1SBB B;  1DOM A;  2YV5 A;  1QUQ A;  4X3U A;  3WOE A;  2XN9 C;  2V1C C;  4FXD A;  4JPB W;  3SXH A;  3ERQ A;  2MGS A;  3S1M B;  1HUN A;  4AQY L;  1U5K A;  3UE0 A;  3KDF A;  1V43 A;  1BBU A;  4APV A;  4KKS A;  3NBH B;  3NBI A;  3QWN A;  5CV8 A;  1SYG A;  4P74 A;  1HNX L;  4FYD A;  1AZQ A;  1VQA A;  2SNS A;  2LY7 A;  1HTP A;  1HNZ Q;  1GUS A;  3HKS A;  1STB A;  4DV6 L;  1STY A;  4QUF A;  4IPG A;  1T9H A;  1IW7 D;  5EBC A;  2H1E A;  5C4X B;  1OXX K;  4JBJ A;  5GRO A;  1XXG A;  3MWY W;  4LMQ D;  4NDX A;  5CC4 A;  3QOJ A;  3W1B A;  5LMU Q;  2HQL A;  2J7Z A;  3HOV G;  4RG1 A;  2B2Y A;  4JVZ A;  3FHW A;  3W2D A;  5C4Z A;  2GA4 B;  1EIF A;  1XTD A;  2R7Z G;  2KEC A;  4PMC A;  5KRU A;  4LFA L;  4JI3 L;  4K8J A;  1VQG A;  1DOK A;  4XDX A;  1NR4 A;  4X65 L;  3K0X A;  3S9W A;  3CKI B;  1WTH A;  3G48 A;  5K36 G;  1PFN A;  3T51 B;  1YHB A;  4H13 C;  4KN4 C;  3CC7 A;  3CCV A;  1RTO A;  4M8A A;  4UP7 A;  1WTV A;  3NTI A;  3HOZ H;  2EYP A;  3O13 A;  1WTP A;  5IT9 L;  3A7L A;  1LYL A;  2HT1 A;  3R2I A;  2B2V C;  1F2Y A;  2Z6K C;  1WTQ A;  3EIV A;  2SDF A;  3W3A A;  3TME A;  4Y52 H;  4ULL A;  4YWL A;  4RKB A;  3NHH A;  2F3I A;  4O0A A;  3C2P A;  4J8Q A;  3PIO 3;  2ZJP A;  1HXY D;  1SMY C;  2P5Z X;  4P2C B;  3ZJY C;  2HCC A;  4AYB G;  2NTT A;  2A6E C;  3I4M H;  4X64 L;  2LS0 1;  5HY6 A;  2JYO A;  5C5M A;  1J6Q A;  2CH4 W;  3AEV A;  1KL9 A;  1X3G A;  3DM3 A;  4J6H A;  5M5X H;  1SFO B;  4NXN Q;  3PO2 G;  4H7B A;  3Q22 A;  4KD3 A;  1B7Y B;  3OSO A;  1CK1 A;  1WTO A;  2Z4I A;  4FP5 D;  4DV2 L;  3ULJ A;  3DWA A;  4K6L A;  1X55 A;  4M1U B;  2UXC Q;  1TR5 A;  5JJL A;  3TP8 A;  1BR9 A;  5DLQ E;  3BDC A;  1CQF A;  1B44 D;  3VA5 A;  2VZA A;  1L0X B;  2E75 C;  4DU9 A;  3CRL C;  1KDA A;  4IQZ A;  2JEA I;  4R4O A;  4ZUJ A;  2BDN A;  1KRT A;  1YIJ A;  3AFP A;  1TS2 A;  3WDN A;  3VYS A;  3QB3 A;  4YCV A;  4DFA A;  1GHJ A;  4G7Z C;  4A3E H;  1KLG D;  1O7Z A;  4B3R Q;  1II3 A;  4Q0F A;  3B6Y A;  3CQZ H;  3TEH B;  4X66 L;  1E0B A;  2Z0S A;  1EZ8 A;  3S1R H;  3VR2 A;  1D1I A;  4RGT A;  1N33 L;  1I4R A;  5AFW A;  5F2D A;  4K5W A;  2DNE A;  4KJN A;  2DGY A;  1SNO A;  1LUZ A;  3TN2 A;  2WAQ B;  3NTK A;  1EEF D;  3K58 A;  5LMN L;  1A63 A;  3HS0 C;  2UUC L;  2JA8 H;  4CJ1 B;  3F2B A;  5C3X A;  2OCE A;  5GQO A;  2JQO A;  3W1G A;  1A2T A;  4JI0 Q;  1IKL A;  3DWP A;  5ELF A;  4WJ4 A;  1IBK L;  2JE6 I;  3HOZ G;  2RF4 A;  2L15 A;  3M85 A;  1VQN A;  3J81 L;  1ZEQ X;  4YWK A;  5JEA H;  2O2L D;  3HOY H;  5G3L F;  4HJA A;  5IGB A;  3K5L A;  4GNX C;  4LF6 L;  1PRT B;  1YVC A;  1K83 H;  3NPP A;  1UAP A;  1VQI A;  1NJI C;  4H0L C;  2Q2T A;  4A3D G;  4BY1 H;  2F0K A;  3T53 B;  1KRS A;  4BBS H;  4A3C H;  4FF3 A;  3P75 A;  1HQM C;  3MTS A;  2CCZ A;  2KHI A;  1HFN A;  4JYA Q;  3H0G G;  3CCS A;  1JOO A;  1TWF B;  1R9T H;  1JB7 A;  4C3I G;  4JG2 A;  3R93 A;  3CW2 C;  1S5F D;  1I4G A;  4DUZ Q;  2NN6 G;  4LF4 L;  5M3F H;  4DKA C;  1T5X D;  3F8T A;  1PTO D;  3CF5 A;  5FJ8 H;  1I4X A;  1D5X C;  2WP8 J;  2Z8L A;  2ZM6 Q;  4AIM A;  4JI6 L;  1QZH A;  4XT1 B;  1LM0 A;  2K03 A;  4QB4 A;  2XRQ D;  1SE3 A;  2A68 C;  2L55 A;  1KLU D;  1PH7 A;  2C9O A;  4TVA B;  2B63 G;  1NUC A;  4CGY B;  3E3X A;  4KY7 A;  2WB1 B;  3GTQ H;  4MNO A;  2R7D A;  1AEX A;  4IZ8 A;  2LMC B;  2GN5 A;  1L0Y B;  2MFI A;  2F0G A;  1I94 L;  3A0J A;  1V9P A;  5J39 A;  2OTL A;  1S5B D;  2JA8 G;  1L0W A;  2OTJ A;  3I4M B;  4DNT B;  3Q23 A;  4DA2 A;  1PYB A;  5BR8 L;  4DNI A;  4KKU A;  3NEM A;  4IFD H;  2NVY H;  3GTO B;  4DAY B;  4DR6 L;  4C3J G;  4AQY Q;  1PRT C;  2DJG C;  1JJ2 A;  1C9O A;  5IGD A;  4HMJ A;  5C3W A;  4P75 A;  2KBN A;  1HTL D;  4RAU C;  5IOD A;  1EWC A;  5KEE A;  5JOB A;  4WOR A;  3G6E A;  1HNX Q;  1QUQ B;  3HOY G;  2EYL A;  3CPF A;  3CME A;  4GLA C;  4ODG A;  4DV6 Q;  4TQU S;  1XJV A;  1JOR A;  3MXN B;  4DXF A;  1RIP A;  1FYC A;  5M9O A;  5BN3 A;  1Q82 C;  1U4M A;  3KDF B;  3E0J A;  5JJK A;  2F1M A;  2B2V A;  1YBY A;  1BBX C;  3MAQ A;  3DWQ A;  3AFQ A;  5D3I B;  4A3E B;  1KDB A;  3ONA B;  3TRZ A;  3KUP A;  3F2U A;  3CQZ B;  3AYH B;  2F0N A;  2XVS A;  2IY5 B;  2K4K A;  3J80 c;  2IPK D;  3RLO A;  1CHQ D;  5E7N A;  4IUU A;  4P72 A;  5H1S E;  4LFA Q;  3BZD B;  4JI3 Q;  3S1R B;  1EY5 A;  2Z4H A;  4X65 Q;  2FXQ A;  2XGT A;  5C4H A;  3SVM A;  1VQJ A;  4UP8 A;  3STB C;  3PV0 A;  1EU3 A;  2N49 A;  5COY A;  1PFB A;  2IJ0 A;  3CCE A;  2BOS A;  2RCF A;  4JI4 L;  3I56 A;  3HOU G;  1SAP A;  3X3M A;  1CHP D;  2K28 A;  2KHJ A;  1VQH A;  1PLF A;  1LTA D;  3PCO B;  3OW7 A;  1SDF A;  1VQ4 A;  1STH A;  2UXB L;  2B2U C;  2OEO A;  4JI5 L;  5GAG C;  4LFB L;  2D62 A;  3JAM i;  2QEX A;  2PO4 A;  5KGU A;  1BCP F;  1HNZ L;  2WAQ E;  5C44 H;  2JA9 A;  2PQA A;  3QOL A;  1K83 B;  2PYK A;  3BYY B;  1W3S A;  1B9M A;  1SNQ A;  3QJY A;  5EQ0 A;  3D6W A;  4X64 Q;  5LMU L;  4FF2 A;  4BWG B;  1X3Q A;  1OXU A;  4RWS C;  4BY1 B;  3SEB A;  2B2W C;  4BBS B;  1RL2 A;  5DM7 3;  1GOZ A;  1RTN A;  5C4J H;  4DV2 Q;  1HPC A;  2UU9 L;  1PH6 A;  4C3H H;  4HED A;  2PW5 A;  2N78 A;  4A3F H;  1X9N A;  2AUK A;  3BZK A;  1HFG A;  3CP0 A;  1H95 A;  4JOI C;  5IIF A;  4YWM A;  4POG A;  3M4P A;  5CBE E;  1TS5 A;  1IW7 C;  1LAB A;  4B3M L;  2VNU D;  3QG1 A;  4R4Q A;  5M3M H;  2JK8 A;  3J80 E;  2CHB D;  1Z7T A;  3F2C A;  5M3F B;  2PI2 E;  1GKH A;  1I5F A;  1DGS A;  2RQX A;  2G9H D;  3Q0A A;  4U67 3;  3MFY A;  2WAC A;  1E1T A;  2HCI A;  3LGJ A;  4GNX A;  1I50 B;  3PUZ A;  2L4N A;  4KHZ A;  4X66 Q;  1OTC A;  1VQ6 A;  1EIG A;  2B2Y C;  1VQL A;  2HDL A;  3HOX G;  2K52 A;  1K8A C;  1EWH A;  3PO3 H;  1TWH H;  2JEB I;  3GTQ B;  2KOL A;  2F0V A;  5IYC H;  5LMN Q;  2HHH L;  4DAP A;  2CH4 A;  2UUC Q;  3T1Y L;  1H9R A;  2F0D A;  5FO7 B;  1IBK Q;  2K5W A;  4K2L A;  5DEH A;  1QVF A;  4NP5 A;  1N36 L;  1EFI D;  2NVY B;  1ZYR D;  1G2T A;  3KBG A;  5EKK A;  3IFD A;  3R3O A;  2WB1 E;  1HRJ A;  4A93 G;  4LF6 Q;  3EN2 A;  3UDX A;  4KKT A;  4IO9 A;  2ZXO A;  2PPB C;  1P8L A;  2IHE A;  4RCN A;  1PRT F;  3GP7 A;  4GKK L;  3IFT A;  3OIQ A;  3BVZ A;  4B3R L;  2OXP A;  4OIK A;  5C0X H;  2K50 A;  1F9P A;  2K05 A;  4GN5 A;  5LMN W;  2ZJQ A;  1LT6 D;  3H09 A;  4Z9C B;  3SK8 A;  1Y8N B;  1BVS A;  1MGS A;  3M9B A;  3M4O H;  2BH2 A;  1WTX A;  4YHH L;  4AH6 A;  3DMU A;  1NTG A;  4C1N K;  4DR5 L;  5FLX c;  3DHQ A;  2X6L A;  4B9X A;  1YNJ D;  1JC7 A;  5M5Y H;  4LF4 Q;  2KQ3 A;  1SRU A;  4GS3 A;  1I3Q H;  1YJ9 A;  1EL0 A;  1EIY B;  1D2B A;  3M4Q A;  5I2X A;  4CDF C;  3FPP A;  2F3V A;  4KD4 A;  4IPD A;  4JI6 Q;  2R7F A;  1CKN B;  1KC8 C;  3E9H A;  3A55 A;  1EY7 A;  5M5W H;  4J15 A;  4JI1 L;  5CV9 A;  3MXU A;  4U68 A;  5D14 A;  2TSS A;  1R4Q B;  1BBW A;  1EYC A;  1NBW A;  3TZD A;  1I94 Q;  5C44 B;  2LKV A;  4IJH A;  5A2Q L;  3HOV H;  4MHE A;  4RHR A;  5IYC G;  2I07 B;  1G91 A;  4LWC A;  1QIL A;  4C2M H;  2CW0 D;  2R7Z H;  2ATW A;  3PMF A;  5BR8 Q;  5DM6 3;  3K8A A;  3J7Z C;  2NVX H;  3FKI H;  1CZW A;  4DR6 Q;  4UPA A;  3CD6 A;  4R8N A;  4K6D A;  2JXM B;  5C4J B;  4S3S A;  1CA5 A;  1VQ8 A;  4C3H B;  4BA2 I;  1C4Q A;  2EYM A;  4PMB A;  1CKM A;  4A3F B;  2EXZ A;  3D31 A;  5K36 H;  3OMC A;  3U58 A;  2E2H H;  3MZ5 A;  5CV7 A;  1GUO A;  1Z47 A;  1Y8O B;  1VQP A;  5C6A A;  2QKI C;  1EQT A;  3KF8 A;  5HGQ A;  1KAB A;  1RJT A;  2EXD A;  2JP1 A;  5M3M B;  2B2U A;  1F2M A;  4N8X 1;  4L6T B;  3TP6 A;  1JJC B;  1LTT D;  3H15 A;  1ONL A;  1HA5 A;  3HOW B;  1GUG A;  2XTI A;  4JK1 C;  3V05 A;  2NYZ D;  3MVV A;  2K1B A;  2L0C A;  3E5S A;  3SE0 A;  4CBV A;  5I4D A;  4RHS A;  4B9W A;  3H3V I;  5BN5 A;  4ME3 A;  3S2H H;  4NMZ A;  1SNM A;  4PZ6 A;  5IGG A;  1PTO C;  5IGF A;  3PO3 B;  4L5Q A;  3K59 A;  1YHQ A;  1N9W A;  1LT5 D;  2A1A A;  1TWH B;  4FNF A;  5D65 A;  2Y0S B;  3TRE A;  3PO2 H;  1E2Z A;  1O7L A;  1KXL A;  1TU2 B;  2NN6 I;  3S2D H;  1FNW A;  2KCM A;  3FP9 A;  3PUV A;  2QW7 A;  5AJ3 L;  1RD9 D;  4JI4 Q;  2F0J A;  3KLS X;  4CKE A;  1Q46 A;  5IT9 E;  2SEB D;  2F0M A;  4JOI A;  3MXN A;  4MTN A;  1WJJ A;  1LT4 D;  1NY4 A;  1YI2 A;  2UXB Q;  2JN4 A;  2ID0 A;  4JI5 Q;  4LFB Q;  1ZKO A;  3PGZ A;  3OIP A;  4HIK A;  3C1F A;  3RD4 A;  1EQQ A;  5EJW A;  2EE1 A;  4DNR B;  1WTR A;  1Q90 A;  4LF5 L;  5KNB A;  1NAP A;  5JPM C;  5KYL A;  2SOB A;  3QIA A;  2GVB A;  3KOJ A;  4ALP A;  3V96 A;  2E2I H;  2JA7 B;  1AZP A;  2JA6 G;  1ESF A;  3D4W A;  1GUW A;  1NCV A;  3Q6S A;  2BE5 D;  1ICW A;  5EBD A;  2EYF A;  4RGO S;  3CCQ A;  1EIH A;  2UU9 Q;  5EPJ A;  1B3A A;  3F1Z A;  4DR3 L;  2PQA B;  3FKI G;  1K8M A;  2MQH A;  1G6P A;  2PZT A;  3MEF A;  3OOC A;  3VDY A;  2F0L A;  1B1Z A;  1IBM Q;  1ASZ A;  1B2T A;  2D2C C;  2H4O A;  3E6Z X;  4B3M Q;  1JB3 A;  1G29 1;  5IYD G;  3JAM L;  2O5J C;  2M2L A;  1EWI A;  5M5Y B;  1I3Q B;  3AB9 A;  3KLW A;  1Q12 A;  1A2U A;  4K5V A;  2F4V L;  3M7N A;  2KEN A;  4DR7 L;  1B8A A;  2E74 C;  1PH9 A;  5EPL A;  1LTG D;  1PH5 A;  2X6G A;  1SJH D;  5CV4 A;  5M5W B;  4A3D H;  4NXM L;  2E76 C;  2KCT A;  1AH9 A;  3U9O A;  2HHH Q;  1L2F A;  4GNX B;  4DF7 A;  5I9P A;  4ZUI A;  1KDC A;  1EFW A;  3QR8 A;  2IL8 A;  3GTJ H;  3HOV B;  2NB0 A;  3T1Y Q;  1VQ7 A;  3TP7 A;  4C2M B;  3J81 E;  3H0G H;  3SK6 A;  5E1F A;  2R7Z B;  3V2T A;  1B3Q A;  1VF5 C;  2WV6 D;  3GO5 A;  1N36 Q;  3S14 H;  2ICE C;  4C3I H;  5EPK A;  3FKI B;  4HTH A;  1PA6 A;  3PUY A;  4ZAI A;  1EY6 A;  4K14 A;  2A6H D;  2KEE A;  2NN6 H;  1MJE A;  4XT3 B;  4A3G G;  4DXG A;  1K8O A;  1PH8 A;  4F8M A;  4DR4 L;  2E2H B;  1XYI A;  1MD2 D;  4PZ7 A;  2EYO A;  3SHL A;  1KHI A;  2VQE L;  4L8J A;  1G51 A;  2Q8R E;  3PF4 A;  2QA4 A;  4GKK Q;  2FHT A;  2F0Q A;  3NQT A;  4H44 C;  5FLM G;  3DEO A;  3NP8 A;  3MEH A;  2B63 H;  2JA5 G;  3CCM A;  5DNF A;  1CTM A;  3NSW A;  3PF5 A;  1KNA A;  4DK1 A;  1V1Q A;  2KCN A;  2XIW A;  4YHH Q;  1FGU A;  4LUV A;  1Q1B A;  1U4R A;  3HKZ G;  5EKI A;  4BXX H;  2VUM G;  2AQ1 B;  3U4V A;  1OXS C;  2EDG A;  1LAC A;  4DR5 Q;  4KJO A;  5CBA E;  4NW2 A;  1DON A;  3S17 H;  4AYB B;  3S2H B;  3GTL H;  4X3T A;  3ND9 A;  1LTS D;  3PO2 B;  3S2D B;  4C3J H;  4RFB A;  1GVP A;  2KVM A;  2NTS A;  3J80 i;  1QCB D;  2K32 A;  3PSI A;  2EY6 A;  3UDF A;  2FMM A;  3L7Z C;  4JI1 Q;  4RH6 A;  4A3J H;  1JE5 A;  2R61 A;  3UE1 A;  2PZU A;  1BF4 A;  2B39 A;  3ND8 A;  4MTK A;  1O7I A;  1YNN D;  5C0X J;  4CKB A;  1MJC A;  3ULL A;  2Y0S E;  2NVT H;  2RA4 A;  1B9N A;  4OO1 G;  1HNW L;  2KED A;  1YZ6 A;  1VQD A;  1MKH A;  4BY7 G;  5FKA C;  5ELN A;  4DR2 L;  3H6M A;  2E2I B;  3K57 A;  5ELC A;  5TSS A;  1MIU A;  1ZYR C;  2ZTE A;  4P71 A;  1JWS D;  1IKM A;  4DGZ A;  2C5C A;  2RKS A;  3ZYY X;  3PUX A;  1CKN A;  2DN8 A;  3EQL C;  2XRS D;  4NKL A;  3U4Z A;  4P73 A;  2VS1 A;  3GTM H;  3PIP 3;  1ENA A;  2K5H A;  2WKC A;  3HOU H;  3TDQ A;  3P20 A;  2L1B A;  1CT1 D;  1O7Y A;  1DYQ A;  3L0O A;  1BOS A;  4A3B G;  1BUV T;  3RMH A;  3L9A X;  3HOZ B;  4KTA A;  4OXP A;  1CKO A;  1S4Z A;  4FF1 A;  1WI5 A;  1I4Q A;  3T1H L;  3HGB A;  4B3T L;  1Z6H A;  1B53 A;  1D5Z C;  1WYD A;  1STG A;  3I4L A;  4CDE C;  3KF8 B;  2YTY A;  1PZI D;  1YNJ C;  1S5E D;  4KK7 A;  4BXX G;  2V4D A;  3IKJ A;  2J0T D;  2ZTD A;  2K33 A;  1FL0 A;  4OON A;  2AMC B;  5T1G A;  4A3D B;  3K7A H;  5C3E H;  2A74 C;  5JJZ A;  2XWB B;  1WD1 A;  4G57 A;  2R93 G;  1H9M A;  2J4X A;  5AJ3 Q;  5IYB G;  4CHT B;  1I4P A;  3WOF A;  1JWM D;  5M5X B;  1W6K A;  5IGE A;  3GTJ B;  1AW7 A;  4O1N A;  3D8G A;  4IJL A;  4EQO A;  3KJO A;  3C3L A;  2PQE A;  3GD7 A;  3H0G B;  1HA6 A;  1SLJ A;  1KNE A;  1EOT A;  1UE1 A;  1EOV A;  2L12 A;  1MHW C;  2M00 A;  1K8G A;  3S14 B;  4C3I B;  4A3M G;  4A3J G;  1D5M C;  5ELE A;  3KYH C;  4LF5 Q;  1O78 A;  1WVL A;  1N32 L;  4JBW A;  5LL6 S;  2CW0 C;  2MP1 A;  5IGC A;  5KND A;  3M3Y H;  1DJR D;  1PFS A;  1Y1W G;  4EVO A;  1SYD A;  2YTV A;  3A8J E;  3RUZ A;  3E9I A;  3WWV A;  2NVQ H;  3NK9 A;  3HOX H;  1LTL A;  5E4X A;  2B63 B;  2K04 A;  4DR3 Q;  1SYF A;  4DV5 Q;  1SYE A;  2N3S A;  3LWE A;  3RZO H;  1A3U A;  1NE3 A;  4DV7 L;  3VR5 A;  2A19 A;  2FMC A;  2Z6B A;  1BDO A;  3P1H A;  4A3L H;  4GKJ L;  1M1K C;  2OF1 A;  4IN3 A;  1MBY A;  1PTO H;  2EY2 A;  4C56 C;  1SND A;  1QWY A;  4BBR H;  1MSG A;  3S17 B;  5I2Y A;  2AUJ D;  2JA8 B;  4UDU C;  3DLL A;  1XMO L;  1EY9 A;  3FVQ A;  3TSS A;  1YNX A;  2BDO A;  5LHY 1;  4LW1 A;  4C3J B;  5FO8 B;  2F4V Q;  4ME5 A;  4ZRZ A;  4DR7 Q;  3PIO A;  4A93 H;  3FPU B;  4RKL A;  1ET6 A;  2I5L X;  2L5T A;  3HOY B;  4A3J B;  1N34 L;  1STE A;  2ZXR A;  4NXM Q;  3C46 A;  2QDB A;  1Q81 C;  4HAE A;  1PZJ D;  4AYB E;  3MHB A;  1LTI D;  3GV6 A;  2EYH A;  5C3E G;  3I70 A;  4N9P A;  3H3V C;  3M4Y A;  3RN2 A;  1IYJ B;  2NVT B;  2A69 D;  5IE8 A;  3BVG A;  4LF7 L;  4LF9 L;  1BO0 A;  2AQ3 B;  1G8Z D;  3NEN A;  1HHV A;  1PV4 A;  2K7V A;  3CCU A;  2B3G A;  4X62 L;  1V1P B;  2F0F A;  1IBM L;  1AN8 A;  1W6J A;  1A8V A;  1TY0 A;  4JBK A;  1LTR D;  4PZ8 A;  1ZXT A;  4TRD A;  4HIO A;  1R9T B;  1BKB A;  4DR4 Q;  1Z9F A;  1A3V A;  1WTW A;  2R6G A;  3GTM B;  2VQE Q;  4K8I A;  1A15 A;  4A3I G;  3HOU B;  4K0K L;  1ROD A;  1SXT A;  1FGB D;  2MUY A;  5COR A;  4Y7N H;  2A5H A;  2BE5 C;  2EQS A;  2EJF C;  1JR0 D;  2BH8 A;  3SR1 A;  1IYU A;  1UEA B;  5NUC A;  4JI8 L;  2O5I C;  4EQN A;  1SYC A;  3TS0 A;  4LFC L;  4XQJ A;  1BCP D;  1PVO A;  4WRD A;  5ELB A;  4IOC A;  4A3L G;  1XTC D;  1XX8 A;  1TWC H;  3CPW A;  3K7A B;  3S24 A;  5EAY A;  1M4V A;  4BBR G;  4KHV A;  2QGQ A;  3EA6 A;  1HCZ A;  1NR2 A;  1E24 A;  2CWP A;  1YJW A;  1U9R A;  5K5P A;  2F52 A;  1TII D;  1NMF A;  4KI0 A;  1JCK B;  2R92 G;  3SK5 A;  4OIJ A;  2K5Q A;  4OWW B;  3N6R A;  2VB3 X;  4BS9 A;  1LTB D;  4QL5 A;  5E3F A;  5A2Q E;  2UUA L;  4LK1 C;  1S5C D;  3J7A F;  2DY7 A;  4QIW B;  3I4N G;  1PYS B;  1HNW Q;  5BN4 A;  1I6V C;  3ULP A;  5FO9 B;  3VYR A;  3J81 j;  3M3Y B;  4DR2 Q;  2RHQ B;  2F0P A;  4CDC C;  4DR1 L;  1PHJ A;  2IT1 A;  1VCI A;  1CI3 M;  4HSP A;  2D5D A;  2R3Z A;  1KAA A;  2NVQ B;  2DUD A;  3I8Z A;  2A6H C;  4OEL B;  3HOX B;  4GLX A;  4K2K A;  4F88 A;  5CYU A;  3AU7 A;  1FNV A;  1V1O A;  2EYJ A;  3J81 i;  2ALY B;  2LSS A;  4QMG A;  3J80 L;  2BA0 A;  2MO0 A;  2XSC A;  2E8G A;  4IPC A;  4JV5 L;  1G2S A;  1ILQ A;  2FIN B;  2I5H A;  4OL7 A;  2N88 A;  4QJF A;  1PTO B;  4OEM B;  5JEA J;  2K75 A;  1JT8 A;  1PFM A;  1JMC A;  4OGQ C;  1SYB A;  5CR3 A;  3D4D A;  3CC2 A;  5EKL A;  2B2T C;  4F87 A;  3T56 B;  1IBL L;  1QOH A;  3TZU A;  3T1H Q;  4PNY A;  4B3T Q;  2IHF A;  3UDG A;  1WCM G;  2WII B;  4A93 B;  1JOK A;  4LJZ C;  4E6I A;  5IT9 c;  2I5M X;  3OHX C;  1UNS A;  3D4R A;  1ML0 D;  1F2L A;  1X3F A;  4DV0 L;  3N52 A;  4A3K G;  2IX1 A;  1F77 A;  2JA6 H;  2ES2 A;  1EYG A;  3CC4 A;  5E4W C;  3MXG A;  5C5L A;  4UP9 A;  1VQB A;  3BYT B;  3I72 A;  4HIM A;  1CA6 A;  3A8I E;  1GUN A;  5KNC A;  3CU7 A;  4DV3 L;  3K81 C;  2F3W A;  3D6C A;  4IUV A;  2D0O A;  2MHV A;  4R4I A;  1U0L A;  1YNN C;  4JI2 L;  4LF8 L;  1XNR L;  3OMG A;  1SN8 A;  1EU4 A;  5IYD H;  1EYA A;  1PH4 A;  5KYI A;  4L5S A;  4LNQ A;  1UE5 A;  1Q8I A;  5D3D A;  2E2J H;  1N32 Q;  2X69 A;  1Q3L A;  2WFW A;  4KY5 A;  2PNH A;  1K3R A;  1SR3 A;  4KY6 A;  1ILP A;  1F9S A;  4JI7 L;  1IYV A;  1ENC A;  3HP3 A;  4LUO A;  1H9J A;  1YEZ A;  2JJQ A;  1HZ9 A;  4OO1 I;  4L5R C;  4Y7N B;  4A4I A;  4FXK C;  1SSO A;  3K0Y A;  3PUW A;  2A73 B;  4WJ3 M;  1VMC A;  4A75 A;  2VXW A;  1OXV A;  5C4X G;  1QJO A;  2CQA A;  2QEJ C;  4DV7 Q;  5EGT A;  1IL8 A;  5I6W A;  4KHP Q;  3JAM E;  2RBM A;  2BA1 A;  5A35 A;  1LO5 D;  2TMP A;  3KBX A;  4GKJ Q;  3EVQ A;  4YY3 L;  1HZA A;  4IFD J;  2NWG A;  4ILW A;  2EVB A;  2HUG A;  3HEJ A;  3DXJ C;  1M8A A;  2EIF A;  2NZO A;  2EY5 A;  1TWC B;  1FNU A;  4FVM A;  4DAM A;  1K9M C;  1XMO Q;  1SE4 A;  1HH2 P;  1VQK A;  4X3S A;  2Q2H A;  3RR5 A;  4FF4 A;  3CRK C;  3LX0 A;  1SJE D;  4UHV A;  1VDZ A;  2MO1 A;  4A3G H;  3VYT A;  1IHZ A;  2N8N A;  2ENB A;  4EX5 A;  2ZTC A;  2PMZ E;  4I65 A;  1Y8P B;  4IOA A;  3VR3 A;  3J81 c;  1N34 Q;  1ASY A;  4RGN A;  4LAA A;  1VQE A;  1U4L A;  2HDM A;  2G9D A;  5FLM H;  1H9S A;  4G7O C;  2JA5 H;  4I7A A;  4J1M A;  4HR7 B;  5ELO A;  5T1I A;  4LF7 Q;  4LF9 Q;  4IUQ A;  3S1N H;  2OQ0 A;  4R1J A;  1CM9 A;  1QNK A;  4RA8 A;  4OX9 Q;  2F4I A;  2VUM H;  4OWX B;  3T16 A;  3A8K E;  3HZX A;  4DV5 L;  4X62 Q;  3M4O B;  3OWF A;  1TQO A;  2K6A A;  2ZXP A;  4H02 A;  1U4P A;  3OPO A;  4RMF A;  4YCW A;  1AFP A;  1GM5 A;  1MSH A;  1D8L A;  1IZ6 A;  2PCF B;  1XPU A;  1D1K A;  3MXP A;  4QIW E;  5FLX L;  4KV6 A;  1TWF H;  1RHP A;  3K80 C;  1E22 A;  4K0K Q;  4HJ7 A;  1EY8 A;  3LNN A;  2Q2U A;  4FO2 A;  1P16 A;  3BS1 A;  4JCV E;  3L3O C;  3SDZ A;  1IL2 A;  4JI8 Q;  3NWT A;  4C1N I;  4EQ5 A;  1VMP A;  4KN7 C;  4LFC Q;  1EQV A;  1SNP A;  4HJ5 A;  4XXE A;  1V1P A;  1A3T A;  3BU2 A;  4OO1 H;  5L37 A;  3K5O A;  1GHK A;  4F7X A;  1L1O B;  4BY7 H;  1BCP B;  1VQF A;  1OXT A;  2JA6 B;  2GVA A;  2IX0 A;  1SNC A;  1A0I A;  4QGU A;  3H3V H;  4ABN A;  2VQF L;  2F0W A;  2WAQ G;  3ITP A;  1ENF A;  1M90 C;  2NVX B;  2VW9 A;  3M7G A;  1TY2 A;  5FOB B;  3NUC A;  1HJP A;  3URY A;  3D3R A;  4WFN 3;  3QO2 A;  4PV1 C;  1XMQ L;  3A74 A;  2ICI A;  3GTO H;  4GZY C;  1QB5 D;  4DK3 C;  3S15 H;  4OHJ A;  2UUA Q;  1YHA A;  2B2T A;  1SE8 A;  2E2J B;  4DV4 L;  1TKW B;  2A69 C;  3UDI A;  1Q7Y C;  4A3B H;  3R8B A;  5IWA L;  3OTO L;  4L5T A;  1C48 A;  2N55 A;  3IRB A;  1T5E A;  1K0S A;  4DR1 Q;  1BNZ A;  4HSV A;  2PNR C;  4HMI A;  2RDH A;  5I6Y A;  1XNQ L;  2LFN A;  1NSN S;  1FJG Q;  1LLR D;  2EOT A;  4DAV A;  4X3K A;  3RN5 A;  4DPG A;  1QNU A;  1B50 A;  2R93 H;  1VQO A;  4ZK9 B;  1FD7 D;  4JV5 Q;  5IYB H;  2F0I A;  3GQB A;  4R4T A;  3K5N A;  1QE6 A;  4EGV A;  1FR3 A;  2AQ2 B;  3CCL A;  2G5D A;  3J7A V;  1NMG A;  1TVX A;  1PMR A;  4IFD I;  2QF7 A;  3NTH A;  1PTO F;  4CKC A;  4ZCK A;  1IBL Q;  4PG3 A;  1EY0 A;  4QY7 A;  4N9T A;  4A3M H;  4G7H C;  2F0T A;  4GOP B;  4A3G B;  1L1O C;  1X32 A;  1BCP C;  4MN3 A;  3A56 A;  4DV0 Q;  2UXD L;  4DV1 L;  3KLR A;  1Y1W H;  1FVI A;  5LL6 X;  2RCN A;  5ELD A;  2RSN A;  2WB1 G;  1EQR A;  3C1E A;  2JA5 B;  2KCC A;  2F03 A;  1CZG A;  2O4X A;  2F0U A;  3CCJ A;  5GAH C;  4JC0 A;  3S1N B;  4EQP A;  1Q8K A;  1HR0 L;  3HKZ B;  3GTK H;  4DV3 Q;  2VUM B;  3VR6 A;  4V19 0;  4JI2 Q;  4LF8 Q;  3I4M G;  3G7L A;  1XNR Q;  1F2Z A;  5CMD A;  4R8I A;  2PZW A;  2OWO A;  4X6A H;  1RF2 D;  4ZQ3 A;  4V0B A;  3D0F A;  4JI7 Q;  1VF7 A;  2UUB L;  2RSO A;  3KF6 A;  3HG9 A;  1GD7 A;  2FFK B;  4XQN A;  1BQQ T;  4O42 A;  2VL6 A;  1STA A;  2QIL A;  2ASB A;  1K28 A;  2CWA A;  5G3L D;  3A7A B;  2EPB A;  1X3E A;  1I50 H;  3S1Q H;  3S16 H;  1ESR A;  4A3E G;  1UWV A;  2LXJ A;  1SE2 A;  2AHO B;  5HGT A;  4YY3 Q;  2MNA A;  3CHB D;  4POF A;  2NUC A;  4KMU C;  3I73 A;  2IX3 A;  2Z9H A;  2IWH A;  1PH2 A;  4BY7 B;  4HN7 A;  2NBF A;  5I9O A;  1NNX A;  3NXW A;  4XIG S;  4GOP C;  3RNU A;  1WD0 A;  1UE7 A;  3T13 A;  4PQX A;  1LT3 D;  3HFZ B;  4HJ8 A;  2H5X A;  3DUZ A;  2EJG C;  1VQ5 A;  4DK6 C;  1EYD A;  4A3I H;  2E2D C;  4DK0 A;  1JQY D;  3Q24 A;  1DOL A;  3S15 B;  1DCZ A;  5J22 A;  3H94 A;  5DAU A;  1EY4 A;  3ERS X;  3RZD H;  2EZV A;  1TS4 A;  5JEA G;  2KHS A;  4A3B B;  1GO3 E;  2E5L L;  2F0O A;  4IUR A;  3X3N A;  1A6X A;  4GN3 B;  1TWG H;  3GTP H;  3PQI A;  3NE5 B;  3G4S A;  3AMU A;  1YIT A;  4XYQ A;  4OWT B;  3GDE A;  1JE4 A;  4NPS A;  4BY1 G;  1H9S B;  2Z6K A;  1KQS A;  4ZLT F;  4KHP L;  4QQB X;  2DJF C;  4BBS G;  4GLV B;  4A3C G;  2HD3 A;  2LXK A;  2DNC A;  4GN4 B;  1J5E L;  4FDB A;  3BDO A;  1Q1E A;  2R93 B;  4ZYS A;  1JIC A;  1LV9 A;  3ER0 A;  4DUY L;  4UAI A;  1TWA H;  3GTL B;  2B29 A;  2YU9 H;  4BA1 I;  1CFM A;  4B3S L;  2AKW B;  1PYW D;  3J7Y W;  3GTG H;  4CDD C;  5CGK A;  1A62 A;  1RKN A;  3NBH A;  5GAE C;  1SMY D;  2R92 H;  3KLS A;  1VQC A;  1Y1V H;  3KK7 A;  4ZKC B;  2A6E D;  5M3F G;  4PMW A;  4A3M B;  1PDQ A;  5FJ8 G;  2NZH A;  2YTX A;  1WOC A;  1K3B C;  3I4N H;  3BG3 A;  1QVC A;  1Q86 C;  3P7J A;  1HQR D;  4O2D A;  2XWJ B;  3EJI A;  3TQY A;  5C0X I;  1Y1W B;  2KUM A;  3NEL A;  1DM0 B;  1B70 B;  3I7F A;  3JC6 6;  4IUT A;  3RLN A;  3VA7 A;  3KFU A;  2VQF Q;  2QCP X;  4OX9 L;  3OWE B;  3NWS A;  3I4O A;  2B8F A;  4N8F A;  2D9U A;  2ZJR A;  1TT2 A;  1UE6 A;  3AQQ A;  2HIX A;  4CJ0 B;  2M9V A;  1E3P A;  2OQK A;  3OYY A;  1SRO A;  3GTK B;  1R4P B;  1XMQ Q;  1TS3 A;  2L11 A;  1RCV D;  4XYO A;  3CAM A;  4NB3 A;  2F0S A;  1CQV A;  1X6O A;  3MFG A;  3FMC A;  1E7Z A;  1AE2 A;  3G71 A;  1PH3 A;  3ERO A;  4IFD G;  5J3B A;  4DV4 Q;  4YIJ A;  5IWA Q;  3E0E A;  4R4C A;  3OTO Q;  2PW7 A;  1HZC A;  1HZB A;  1L1O A;  1QVG A; 
#chains in the Genus database with same CATH homology
 4HCS A;  3SK4 A;  5HUR A;  2VB2 X;  1SEB D;  4WJW A;  2PMZ B;  4HCE A;  1F9Q A;  4QCL A;  4IUP A;  4B08 A;  2ZT9 C;  5JVG 3;  2RDG A;  1BXT A;  3S1Q B;  3S16 B;  5ISR A;  5C3E B;  4L63 B;  3I91 A;  5KIX A;  2KJX A;  2I46 A;  1J8I A;  3MC0 B;  2RDF A;  1V8Q A;  2KA7 A;  5FK9 C;  3IL8 A;  3TP5 A;  4RGM A;  3UI2 A;  2CVR A;  3NQI A;  2K01 A;  3EFX D;  2L9H A;  1F9R A;  2AWO A;  1Y69 U;  5J1Z A;  2HQE A;  3R2T A;  4QF4 A;  3DM1 A;  2BCO A;  4A3I B;  4TSS A;  1DXM A;  4IAL A;  3BVM A;  2FJ2 A;  1EZ6 A;  2XNA C;  3LWU A;  3K5M A;  3RZD B;  1G6Z A;  3FDT A;  2EY1 A;  4I7Z C;  2Q8T A;  1TWG B;  3GTP B;  4IUN A;  4ZKB B;  1PZK D;  3RZO B;  1DZ1 A;  2OT2 A;  3U9S A;  3IAY A;  1ET9 A;  2A68 D;  4DN4 M;  4R9W A;  4C3H G;  4BBR B;  1X3P A;  2Z1C A;  1E2V A;  3A54 A;  1TWA B;  2B8G A;  2MJ8 A;  3BDL A;  1AP0 A;  4K5X A;  1JOQ A;  2YU9 B;  3GTG B;  1UUP A;  4G4K A;  2R92 B;  4XQQ A;  1Y1V B;  1OO9 B;  2MPM A;  3MA2 B;  1S5D D;  1D6E C;  1PXU A;  2F0E A;  3TBI B;  3VR4 A;  3I4N B;  1PRT D;  3GV3 A;  1E2W A;  1GJX A;  2DY8 A;  5IOC A;  3I90 A;  1GUT A;  2Q8I B;  1I4H A;  2K5D A;  3G6J B;  1DD2 A;  4MIU A;  1GXD C;  1RDP D;  1KTK A;  3VYU A;  4XTC S;  5JPN C;  1EEI D;  1JWU D;  1STN A;  3FEW X;  2IW3 A;  3HRZ C;  2RVL A;  4Q5V A;  1QG7 A;  4CJ2 C;  3FRP B;  5CV5 A;  4FXG C;  1H9K A;  1J9O A;  1HUM A;  5JVH 3;  1WCM B;  4ID6 A;  5CV6 A;  3K6O A;  2WIN B;  3H91 A;  5FLX E;  1MI2 A;  2NZ1 D;  3RLF A;  4A3K B;  2EJM A;  4RCO A;  5C0X G;  3DEP A;  2YYZ A;  3I3C A;  5JAV A;  2JSO A;  4QUC A;  1C8C A;  3T4A C;  2F0H A;  4DAY A;  1I6H B;  1B4O A;  1XWE A;  2WKD A;  4TKO B;  1O80 A;  2AWN A;  2B2W A;  2SNM A;  1SBB B;  1DOM A;  4X3U A;  3WOE A;  2XN9 C;  4FXD A;  3SXH A;  3ERQ A;  2MGS A;  3S1M B;  1HUN A;  1V43 A;  4KKS A;  3NBI A;  3QWN A;  5CV8 A;  1SYG A;  4FYD A;  1AZQ A;  2SNS A;  2LY7 A;  1HTP A;  1GUS A;  1STB A;  1STY A;  4QUF A;  1IW7 D;  5EBC A;  2H1E A;  5C4X B;  1OXX K;  1XXG A;  3MWY W;  4LMQ D;  4NDX A;  5CC4 A;  3QOJ A;  2J7Z A;  2B2Y A;  3W2D A;  5C4Z A;  2GA4 B;  2KEC A;  4PMC A;  5KRU A;  4K8J A;  1DOK A;  4XDX A;  1NR4 A;  3S9W A;  3CKI B;  5K36 G;  1PFN A;  3T51 B;  4H13 C;  4KN4 C;  1RTO A;  4M8A A;  1WTV A;  3NTI A;  2EYP A;  3O13 A;  1WTP A;  5IT9 L;  3A7L A;  3R2I A;  2B2V C;  1F2Y A;  1WTQ A;  2SDF A;  3W3A A;  3TME A;  4ULL A;  4RKB A;  3NHH A;  3C2P A;  4J8Q A;  3PIO 3;  1HXY D;  1SMY C;  4P2C B;  2HCC A;  2NTT A;  2A6E C;  2LS0 1;  2JYO A;  5C5M A;  4J6H A;  1SFO B;  4H7B A;  3Q22 A;  4KD3 A;  3OSO A;  1CK1 A;  1WTO A;  2Z4I A;  4FP5 D;  3DWA A;  4K6L A;  4M1U B;  1TR5 A;  3TP8 A;  1BR9 A;  3BDC A;  1CQF A;  1B44 D;  3VA5 A;  1L0X B;  2E75 C;  4DU9 A;  3CRL C;  1KDA A;  4IQZ A;  2JEA I;  4ZUJ A;  2BDN A;  1TS2 A;  3WDN A;  3VYS A;  3QB3 A;  4DFA A;  1GHJ A;  4G7Z C;  1KLG D;  1O7Z A;  1II3 A;  4Q0F A;  1E0B A;  1EZ8 A;  3VR2 A;  1D1I A;  4RGT A;  1I4R A;  5AFW A;  5F2D A;  4K5W A;  2DNE A;  4KJN A;  1SNO A;  3TN2 A;  2WAQ B;  3NTK A;  1EEF D;  3K58 A;  3HS0 C;  4CJ1 B;  5C3X A;  1A2T A;  1IKL A;  3DWP A;  5ELF A;  2JE6 I;  3M85 A;  3J81 L;  1ZEQ X;  5JEA H;  2O2L D;  5G3L F;  5IGB A;  3K5L A;  1PRT B;  3NPP A;  1UAP A;  4H0L C;  2F0K A;  3T53 B;  4FF3 A;  3P75 A;  1HQM C;  3MTS A;  1HFN A;  1JOO A;  1TWF B;  4C3I G;  3R93 A;  1S5F D;  1I4G A;  2NN6 G;  1T5X D;  1PTO D;  1I4X A;  1D5X C;  2WP8 J;  2Z8L A;  4XT1 B;  2K03 A;  4QB4 A;  2XRQ D;  1SE3 A;  2A68 C;  2L55 A;  1KLU D;  2C9O A;  1NUC A;  4CGY B;  4KY7 A;  2WB1 B;  1AEX A;  4IZ8 A;  2LMC B;  1L0Y B;  2F0G A;  5J39 A;  1S5B D;  3I4M B;  4DNT B;  3Q23 A;  4DA2 A;  4KKU A;  4IFD H;  3GTO B;  4C3J G;  1PRT C;  5IGD A;  4HMJ A;  5C3W A;  1HTL D;  4RAU C;  5IOD A;  1EWC A;  5KEE A;  5JOB A;  4WOR A;  2EYL A;  4ODG A;  4TQU S;  1JOR A;  4DXF A;  1FYC A;  5M9O A;  5BN3 A;  1U4M A;  3E0J A;  2F1M A;  2B2V A;  1BBX C;  3MAQ A;  3DWQ A;  5D3I B;  4A3E B;  1KDB A;  3ONA B;  3KUP A;  3F2U A;  3CQZ B;  2F0N A;  2XVS A;  2IPK D;  1CHQ D;  4IUU A;  3BZD B;  3S1R B;  1EY5 A;  2Z4H A;  5C4H A;  3SVM A;  3PV0 A;  1EU3 A;  5COY A;  1PFB A;  2IJ0 A;  2BOS A;  1SAP A;  3X3M A;  1CHP D;  2K28 A;  1PLF A;  1LTA D;  3OW7 A;  1SDF A;  1STH A;  2B2U C;  2OEO A;  2D62 A;  2PO4 A;  5KGU A;  1BCP F;  3QOL A;  1K83 B;  2PYK A;  3BYY B;  1B9M A;  1SNQ A;  3QJY A;  5EQ0 A;  3D6W A;  4FF2 A;  4BWG B;  1X3Q A;  1OXU A;  4RWS C;  4BY1 B;  3SEB A;  2B2W C;  4BBS B;  5DM7 3;  1GOZ A;  1RTN A;  1HPC A;  4HED A;  2PW5 A;  2AUK A;  1HFG A;  5IIF A;  5CBE E;  1TS5 A;  1IW7 C;  1LAB A;  2VNU D;  3QG1 A;  3J80 E;  2CHB D;  1Z7T A;  5M3F B;  2RQX A;  2G9H D;  3Q0A A;  4U67 3;  2WAC A;  3MFY A;  2HCI A;  1I50 B;  3PUZ A;  2L4N A;  4KHZ A;  1EIG A;  2B2Y C;  2HDL A;  1EWH A;  2JEB I;  3GTQ B;  2KOL A;  2F0V A;  4DAP A;  1H9R A;  2F0D A;  5FO7 B;  2K5W A;  4K2L A;  5DEH A;  4NP5 A;  1EFI D;  2NVY B;  1ZYR D;  1G2T A;  3KBG A;  5EKK A;  3IFD A;  3R3O A;  1HRJ A;  4KKT A;  2ZXO A;  2PPB C;  4RCN A;  1PRT F;  3GP7 A;  3IFT A;  3OIQ A;  3BVZ A;  2OXP A;  4OIK A;  5C0X H;  1F9P A;  2K05 A;  1LT6 D;  3H09 A;  4Z9C B;  3SK8 A;  1Y8N B;  1MGS A;  1WTX A;  3DMU A;  4C1N K;  3DHQ A;  2X6L A;  4B9X A;  1YNJ D;  1JC7 A;  2KQ3 A;  1EL0 A;  1D2B A;  5I2X A;  3FPP A;  2F3V A;  4KD4 A;  3A55 A;  1EY7 A;  5CV9 A;  3MXU A;  4U68 A;  5D14 A;  2TSS A;  1R4Q B;  1EYC A;  3TZD A;  5C44 B;  2LKV A;  5A2Q L;  4MHE A;  4RHR A;  1G91 A;  2I07 B;  1QIL A;  2CW0 D;  3PMF A;  5DM6 3;  1CZW A;  4R8N A;  4K6D A;  2JXM B;  5C4J B;  4S3S A;  1CA5 A;  4C3H B;  4BA2 I;  1C4Q A;  2EYM A;  4PMB A;  4A3F B;  2EXZ A;  3D31 A;  5K36 H;  3OMC A;  3MZ5 A;  5CV7 A;  1GUO A;  1Z47 A;  1Y8O B;  5C6A A;  2QKI C;  1EQT A;  3KF8 A;  1KAB A;  1RJT A;  2JP1 A;  5M3M B;  2B2U A;  1F2M A;  4L6T B;  3TP6 A;  1LTT D;  1ONL A;  1HA5 A;  3HOW B;  1GUG A;  4JK1 C;  3V05 A;  2NYZ D;  3MVV A;  2K1B A;  2L0C A;  3E5S A;  3SE0 A;  4CBV A;  5I4D A;  4RHS A;  4B9W A;  5BN5 A;  4NMZ A;  1SNM A;  5IGG A;  1PTO C;  5IGF A;  3PO3 B;  3K59 A;  1LT5 D;  4FNF A;  1TWH B;  5D65 A;  2Y0S B;  1E2Z A;  1O7L A;  1TU2 B;  2NN6 I;  1FNW A;  3PUV A;  1RD9 D;  2F0J A;  3KLS X;  4CKE A;  5IT9 E;  2SEB D;  2F0M A;  3MXN A;  1LT4 D;  2ID0 A;  1ZKO A;  3OIP A;  3C1F A;  3RD4 A;  5EJW A;  2EE1 A;  4DNR B;  1WTR A;  1Q90 A;  5KNB A;  1NAP A;  5JPM C;  5KYL A;  2SOB A;  3QIA A;  3V96 A;  2JA7 B;  1AZP A;  1ESF A;  3D4W A;  1GUW A;  1NCV A;  3Q6S A;  2BE5 D;  1ICW A;  5EBD A;  2EYF A;  4RGO S;  1EIH A;  5EPJ A;  1B3A A;  1K8M A;  2PZT A;  3OOC A;  2F0L A;  1B1Z A;  1B2T A;  2D2C C;  2H4O A;  3E6Z X;  1JB3 A;  1G29 1;  3JAM L;  2O5J C;  2M2L A;  5M5Y B;  1I3Q B;  3AB9 A;  1Q12 A;  1A2U A;  4K5V A;  3M7N A;  2E74 C;  5EPL A;  1LTG D;  2X6G A;  1SJH D;  5CV4 A;  5M5W B;  2E76 C;  3U9O A;  4DF7 A;  5I9P A;  4ZUI A;  1KDC A;  2IL8 A;  3HOV B;  2NB0 A;  3TP7 A;  4C2M B;  3J81 E;  3SK6 A;  5E1F A;  2R7Z B;  3V2T A;  2WV6 D;  1VF5 C;  3GO5 A;  2ICE C;  5EPK A;  3FKI B;  4HTH A;  3PUY A;  4ZAI A;  1EY6 A;  4K14 A;  2A6H D;  2KEE A;  2NN6 H;  4XT3 B;  1K8O A;  4DXG A;  4F8M A;  2E2H B;  1XYI A;  1MD2 D;  3SHL A;  2EYO A;  4L8J A;  2Q8R E;  2FHT A;  2F0Q A;  3NQT A;  4H44 C;  3DEO A;  3NP8 A;  3MEH A;  5DNF A;  1CTM A;  3NSW A;  1KNA A;  4DK1 A;  2KCN A;  2XIW A;  1Q1B A;  1U4R A;  5EKI A;  2AQ1 B;  1OXS C;  2EDG A;  1LAC A;  4KJO A;  5CBA E;  4NW2 A;  1DON A;  4AYB B;  3S2H B;  4X3T A;  3ND9 A;  1LTS D;  3PO2 B;  3S2D B;  4RFB A;  2KVM A;  2NTS A;  1QCB D;  2K32 A;  2EY6 A;  2FMM A;  3L7Z C;  4RH6 A;  2R61 A;  2PZU A;  1BF4 A;  2B39 A;  3ND8 A;  1YNN D;  5C0X J;  4CKB A;  2RA4 A;  1B9N A;  4OO1 G;  2KED A;  5FKA C;  3H6M A;  2E2I B;  3K57 A;  5ELC A;  5TSS A;  1ZYR C;  1IKM A;  1JWS D;  4DGZ A;  2C5C A;  2RKS A;  3ZYY X;  3PUX A;  2DN8 A;  3EQL C;  2XRS D;  4NKL A;  3PIP 3;  1ENA A;  2WKC A;  3TDQ A;  3P20 A;  2L1B A;  1CT1 D;  1O7Y A;  1DYQ A;  1BOS A;  1BUV T;  3RMH A;  3L9A X;  3HOZ B;  4KTA A;  1S4Z A;  4FF1 A;  1I4Q A;  3HGB A;  1Z6H A;  1B53 A;  1D5Z C;  3I4L A;  1STG A;  1PZI D;  1YNJ C;  1S5E D;  4KK7 A;  2V4D A;  3IKJ A;  2J0T D;  2K33 A;  4A3D B;  5T1G A;  2A74 C;  5JJZ A;  2XWB B;  1WD1 A;  4G57 A;  1H9M A;  2J4X A;  4CHT B;  1I4P A;  3WOF A;  1JWM D;  5M5X B;  1W6K A;  5IGE A;  3GTJ B;  1AW7 A;  4O1N A;  3D8G A;  4EQO A;  3C3L A;  2PQE A;  3GD7 A;  3H0G B;  1HA6 A;  1KNE A;  1EOT A;  2L12 A;  2M00 A;  3S14 B;  4C3I B;  1D5M C;  5ELE A;  1O78 A;  1WVL A;  4JBW A;  5LL6 S;  2CW0 C;  2MP1 A;  5IGC A;  5KND A;  1DJR D;  4EVO A;  1SYD A;  3A8J E;  3RUZ A;  3NK9 A;  5E4X A;  2B63 B;  2K04 A;  1SYF A;  1SYE A;  3LWE A;  1A3U A;  3VR5 A;  2FMC A;  1BDO A;  3P1H A;  2OF1 A;  4IN3 A;  1MBY A;  1PTO H;  2EY2 A;  4C56 C;  1SND A;  1QWY A;  1MSG A;  3S17 B;  5I2Y A;  2AUJ D;  2JA8 B;  4UDU C;  1EY9 A;  3FVQ A;  3TSS A;  2BDO A;  5LHY 1;  4C3J B;  5FO8 B;  4ME5 A;  4ZRZ A;  3FPU B;  4RKL A;  1ET6 A;  2L5T A;  3HOY B;  4A3J B;  1STE A;  2ZXR A;  3C46 A;  2QDB A;  4HAE A;  1PZJ D;  3MHB A;  1LTI D;  3GV6 A;  2EYH A;  3I70 A;  4N9P A;  3H3V C;  3M4Y A;  2NVT B;  2A69 D;  3BVG A;  1BO0 A;  2AQ3 B;  1G8Z D;  1HHV A;  2K7V A;  1V1P B;  2F0F A;  1AN8 A;  1W6J A;  1TY0 A;  1LTR D;  4TRD A;  1ZXT A;  1R9T B;  1A3V A;  1WTW A;  2R6G A;  3GTM B;  4K8I A;  1A15 A;  3HOU B;  1ROD A;  1SXT A;  5COR A;  1FGB D;  2MUY A;  2A5H A;  2BE5 C;  2EJF C;  1JR0 D;  3SR1 A;  1IYU A;  1UEA B;  5NUC A;  2O5I C;  4EQN A;  1SYC A;  4XQJ A;  1BCP D;  4WRD A;  5ELB A;  1XTC D;  1XX8 A;  3K7A B;  1M4V A;  4KHV A;  3EA6 A;  1HCZ A;  1NR2 A;  1U9R A;  5K5P A;  1TII D;  4KI0 A;  1JCK B;  3SK5 A;  4OIJ A;  2K5Q A;  3N6R A;  2VB3 X;  4BS9 A;  1LTB D;  5E3F A;  5A2Q E;  4LK1 C;  1S5C D;  3J7A F;  2DY7 A;  4QIW B;  5BN4 A;  1I6V C;  5FO9 B;  3VYR A;  3M3Y B;  2F0P A;  2IT1 A;  1VCI A;  1CI3 M;  4HSP A;  2D5D A;  2R3Z A;  1KAA A;  2NVQ B;  3I8Z A;  2A6H C;  3HOX B;  4K2K A;  4F88 A;  5CYU A;  3AU7 A;  1FNV A;  1V1O A;  2EYJ A;  4QMG A;  3J80 L;  2BA0 A;  2XSC A;  1G2S A;  1ILQ A;  2FIN B;  4OL7 A;  2N88 A;  1PTO B;  5JEA J;  1PFM A;  4OGQ C;  1SYB A;  5CR3 A;  3D4D A;  5EKL A;  2B2T C;  4F87 A;  3T56 B;  1QOH A;  3TZU A;  4PNY A;  2WII B;  4A93 B;  1JOK A;  4LJZ C;  4E6I A;  3OHX C;  1UNS A;  3D4R A;  1ML0 D;  1F2L A;  3N52 A;  2IX1 A;  1F77 A;  5E4W C;  3MXG A;  5C5L A;  3BYT B;  3I72 A;  1CA6 A;  3A8I E;  1GUN A;  5KNC A;  3CU7 A;  2F3W A;  3D6C A;  4IUV A;  2MHV A;  1YNN C;  3OMG A;  1EU4 A;  1EYA A;  5KYI A;  1Q8I A;  5D3D A;  2X69 A;  1Q3L A;  4KY5 A;  4KY6 A;  1ILP A;  1F9S A;  1IYV A;  1ENC A;  3HP3 A;  1H9J A;  4OO1 I;  4Y7N B;  4FXK C;  1SSO A;  3K0Y A;  3PUW A;  2A73 B;  1VMC A;  2VXW A;  1OXV A;  1QJO A;  2CQA A;  2QEJ C;  5EGT A;  1IL8 A;  5I6W A;  3JAM E;  2RBM A;  2BA1 A;  5A35 A;  1LO5 D;  2TMP A;  3KBX A;  3EVQ A;  4IFD J;  2NWG A;  4ILW A;  2EVB A;  2HUG A;  3HEJ A;  3DXJ C;  1M8A A;  2EY5 A;  1TWC B;  1FNU A;  4FVM A;  1SE4 A;  4X3S A;  4FF4 A;  3CRK C;  3LX0 A;  1SJE D;  1VDZ A;  3VYT A;  1IHZ A;  2ENB A;  4I65 A;  1Y8P B;  3VR3 A;  4RGN A;  4LAA A;  1U4L A;  2HDM A;  2G9D A;  1H9S A;  4G7O C;  4J1M A;  4HR7 B;  5T1I A;  4IUQ A;  1CM9 A;  1QNK A;  4RA8 A;  2F4I A;  3T16 A;  3A8K E;  3HZX A;  3M4O B;  3OWF A;  1TQO A;  2K6A A;  2ZXP A;  1U4P A;  3OPO A;  1AFP A;  1MSH A;  2PCF B;  1D1K A;  3MXP A;  5FLX L;  4KV6 A;  1RHP A;  1EY8 A;  3LNN A;  4FO2 A;  3BS1 A;  3L3O C;  3SDZ A;  3NWT A;  4C1N I;  1VMP A;  4KN7 C;  1EQV A;  1SNP A;  4XXE A;  1V1P A;  1A3T A;  4OO1 H;  3K5O A;  1GHK A;  4F7X A;  1BCP B;  1OXT A;  2JA6 B;  2IX0 A;  1SNC A;  4ABN A;  2F0W A;  3ITP A;  1ENF A;  2NVX B;  3M7G A;  1TY2 A;  5FOB B;  3NUC A;  3URY A;  3D3R A;  4WFN 3;  3QO2 A;  4PV1 C;  4GZY C;  2ICI A;  1QB5 D;  4OHJ A;  2B2T A;  2E2J B;  1TKW B;  2A69 C;  3R8B A;  1C48 A;  2N55 A;  1T5E A;  1BNZ A;  4HSV A;  2PNR C;  4HMI A;  2RDH A;  5I6Y A;  2LFN A;  1NSN S;  1LLR D;  2EOT A;  4DAV A;  4X3K A;  1QNU A;  1B50 A;  4ZK9 B;  1FD7 D;  2F0I A;  3GQB A;  3K5N A;  1QE6 A;  4EGV A;  1FR3 A;  2AQ2 B;  3J7A V;  1TVX A;  1PMR A;  4IFD I;  2QF7 A;  3NTH A;  1PTO F;  4CKC A;  1EY0 A;  4N9T A;  4G7H C;  2F0T A;  4A3G B;  1X32 A;  1BCP C;  4MN3 A;  3A56 A;  3KLR A;  5LL6 X;  5ELD A;  2RSN A;  3C1E A;  2JA5 B;  2KCC A;  2F03 A;  1CZG A;  2O4X A;  2F0U A;  3S1N B;  4EQP A;  3HKZ B;  2VUM B;  3VR6 A;  4V19 0;  3G7L A;  1F2Z A;  5CMD A;  4R8I A;  2PZW A;  1RF2 D;  4ZQ3 A;  4V0B A;  1VF7 A;  2RSO A;  3HG9 A;  2FFK B;  4XQN A;  1BQQ T;  4O42 A;  1STA A;  2QIL A;  5G3L D;  3A7A B;  2EPB A;  1ESR A;  1SE2 A;  5HGT A;  3CHB D;  2NUC A;  4KMU C;  3I73 A;  2IX3 A;  2IWH A;  4BY7 B;  4HN7 A;  2NBF A;  5I9O A;  3NXW A;  4XIG S;  1WD0 A;  3T13 A;  4PQX A;  1LT3 D;  3DUZ A;  2EJG C;  1EYD A;  4DK0 A;  2E2D C;  1JQY D;  3Q24 A;  1DOL A;  3S15 B;  1DCZ A;  5J22 A;  3H94 A;  5DAU A;  1EY4 A;  2EZV A;  1TS4 A;  5JEA G;  2KHS A;  4A3B B;  2F0O A;  4IUR A;  3X3N A;  1A6X A;  3NE5 B;  3AMU A;  4XYQ A;  1JE4 A;  1H9S B;  4ZLT F;  2DNC A;  3BDO A;  1Q1E A;  2R93 B;  4ZYS A;  1JIC A;  1LV9 A;  4UAI A;  3GTL B;  4BA1 I;  1CFM A;  1PYW D;  3J7Y W;  5CGK A;  1RKN A;  3NBH A;  1SMY D;  3KLS A;  3KK7 A;  4ZKC B;  2A6E D;  4PMW A;  4A3M B;  1PDQ A;  3BG3 A;  3P7J A;  1HQR D;  2XWJ B;  3EJI A;  5C0X I;  1Y1W B;  2KUM A;  1DM0 B;  4IUT A;  3VA7 A;  2QCP X;  3OWE B;  3NWS A;  2B8F A;  2D9U A;  1TT2 A;  4CJ0 B;  2M9V A;  3GTK B;  1R4P B;  1TS3 A;  2L11 A;  1RCV D;  4XYO A;  2F0S A;  1CQV A;  3MFG A;  3FMC A;  3ERO A;  4IFD G;  4YIJ A;  2PW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...