1KDBA

Stabilization of a strained protein loop conformation through protein engineering
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYEPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stabilization of a strained protein loop conformation through protein engineering.
pubmed rcsb
source organism Staphylococcus aureus
total genus 41
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kdbA00
4RKBA 4ME5A 4NMZA 1U9RA 3P1HA 4HMJA 4KY7A 1A2TA 3V2TA 2PW5A 4MIUA 4J1MA 3T16A 3C1FA 3NP8A 1STAA 5CV4A 3T13A 2F0KA 2SOBA 2EY1A 3OMGA 1SNQA 3VA5A 1NSNS 3H6MA 3EROA 1TQOA 5IGBA 3LX0A 2EYHA 1F2MA 3DHQA 1STHA 3ERQA 4N9PA 3U9OA 5HGTA 3S9WA 1SYFA 1EY4A 2F0DA 4DF7A 3D4WA 2SNMA 4EQPA 1SNMA 5CV9A 1EY9A 2EXZA 4ODGA 4WORA 4DU9A 1SNPA 4HTHA 2M00A 1SNCA 2O4XA 5CGKA 1SYGA 5IGEA 2KHSA 5IOCA 1II3A 2OEOA 4ZUIA 3SHLA 1IHZA 4K14A 3TP7A 2PZTA 4DFAA 2EY6A 2PZUA 1EY0A 2SNSA 1SNDA 1EY5A 5C5MA 3SK4A 4KJNA 3SK5A 3C1EA 3NK9A 3SXHA 2WACA 3BDCA 5EGTA 1EY8A 4HMIA 1SYBA 3EJIA 1STYA 2PW7A 3HEJA 4ID6A 3SR1A 1RKNA 4H7BA 4IUNA 5NUCA 1A3TA 1EY6A 4KJOA 1KDCA 2F0VA 3D6CA 4K5VA 3SK6A 2PQEA 4F7XA 5CV5A 4PMBA 2F0UA 4EQOA 1EQVA 2PYKA 2F0LA 1ENAA 5IGFA 5C4HA 2F0OA 4K5WA 5C3XA 1JOOA 1EYDA 4J6HA 5K5PA 5M9OA 1EYCA 3OMCA 3OWFA 2F0QA 3OSOA 3QOJA 4K6DA 4F8MA 5F2DA 1AEXA 3TMEA 5I9PA 5JAVA 5ISRA 2EYJA 2F0PA 2LKVA 3TP6A 4KD3A 4RKLA 2F3WA 1A2UA 1KDBA 3ITPA 3SK8A 5KYLA 1A3UA 2F0JA 4KHVA 1EY7A 3TP8A 5IODA 5KRUA 1SYEA 4G57A 4TRDA 5C5LA 4QMGA 4QF4A 4B9XA 4PNYA 4WRDA 5KEEA 3QOLA 5CR3A 1EZ6A 1SNOA 2EYPA 4K5XA 2F0SA 5CV8A 1EYAA 5J22A 2F0FA 5KYIA 1STBA 2ENBA 4KY6A 2F0NA 1STNA 4KV6A 2F0EA 3P75A 4LAAA 2EY2A 2F0TA 2F0IA 4NP5A 4B9WA 5J39A 1JORA 5CC4A 5C6AA 4ZUJA 2F3VA 5CV6A 4DGZA 1JOKA 4NKLA 5IGDA 5J1ZA 5E3FA 4QB4A 5CV7A 5I6WA 2EY5A 3NQTA 4E6IA 3MHBA 5EKLA 3MXPA 3D8GA 5DEHA 5C4ZA 4KTAA 1A3VA 5KGUA 2HQEA 1SYCA 2EYLA 4K2KA 5DAUA 5JOBA 5IIFA 2RDFA 3MEHA 4IZ8A 4KD4A 1KABA 5EKKA 5I9OA 1F2ZA 2EYFA 2KQ3A 3BDLA 4YIJA 3PMFA 1F2YA 2EYMA 2QDBA 2RKSA 3NUCA 5HURA 2F0WA 2OXPA 3TP5A 5IGGA 2RBMA 3DMUA 1STGA 3NHHA 3R3OA 2OF1A 4EVOA 2EYOA 2NUCA 1TR5A 3NXWA 4K8IA 2F0HA 3MVVA 5E1FA 3EVQA 1TT2A 2F0MA 3MZ5A 3QB3A 1SYDA 4OL7A 1EZ8A 2PZWA 4I65A 1JOQA 4S3SA 5KIXA 4N9TA 3RUZA 4K8JA 5I6YA 4K2LA 4R8NA 5C3WA 4ZQ3A 2F0GA 1ENCA 1NUCA 3E5SA 4IALA 1KDAA 3D4DA 4PMCA 4NDXA 4EQNA 1KAAA 3HZXA 4KY5A 5IGCA
chains in the Genus database with same CATH superfamily
5JJIA 4TSSA 1UAPA 1HXYD 2BA0A 3CCUA 1PH4A 4IQZA 5IE8A 4JI6Q 1Y1WH 4CDCC 1G6PA 4WJ4A 1DOLA 4B3SL 3HG9A 1X3FA 3DHQA 3M4YA 1I6VC 1PV4A 2NVTH 4DF7A 3ZYYX 5M3MH 4WORA 2TMPA 2IJ0A 1EQRA 4O2DA 1BCPC 1H9MA 3T1YQ 2KHSA 1II3A 3SHLA 3IFDA 4L6TB 1QG7A 4JBJA 4JG2A 2QEXA 5C5MA 4HCSA 3EBEA 1J6QA 1D1KA 2Q8IB 1DGSA 2DY7A 5M5XB 3KFUA 4CKEA 3CRKC 3RZOB 4LF7L 3PO3G 3PIPA 4EQOA 3GTJB 1JMCA 2O5JC 2JA8H 3KBGA 1V1PA 4I7AA 2XWJB 3OSOA 1B4OA 3NTIA 3K58A 4IPGA 1VMPA 3CC4A 3JAMc 4GOPC 1V1PB 1D1IA 2KEEA 2VXWA 4ZAIA 1CM9A 1HTPA 3O13A 3UE0A 2AWOA 5IP9G 2K5NA 4PNYA 2LFNA 1O7IA 3NTHA 1LTID 4UHVA 5FO8B 3TZUA 4LAAA 4B9WA 3DXJC 2YV5A 1Q12A 2B2TA 1IBKQ 1HPCA 5E3FA 4R4OA 2ZTCA 3J81E 1JB7A 2SDFA 4IUVA 2ID0A 4GKJQ 4R4IA 4B3TQ 5I9OA 1IYVA 4X6AH 4ZKBB 1LV9A 1M8AA 2N55A 2F0WA 2XNAC 1LT5D 3HKZB 4JI3Q 3HOVB 1PFSA 2OF1A 3H0GH 3TDQA 2MUYA 4EVOA 1HNXQ 4HR7B 1IKMA 1NJIC 2F0HA 2MQHA 3NWTA 1PTOH 2D2CC 2PMZE 5DM63 1X3GA 2J4XA 2QILA 4XTCS 3G4SA 4JW0A 2JA9A 5IGCA 1Y69U 3S1NB 1GUNA 2EZVA 2JA6G 1QJOA 2PNHA 2L15A 3TREA 4IN3A 2AWNA 3CAMA 2PW5A 4DV2Q 4J8QA 2M9VA 2R7ZG 3OMGA 1J8IA 1TQOA 3J7YW 3I73A 1TWHB 4HIDA 1G291 3ER0A 1TKWB 3R93A 2SNMA 4EQPA 1I5FA 5ELNA 4A3GB 4C3HG 5M3FG 4A3CG 4G7ZC 1YHAA 2GVBA 2X6GA 1QB5D 1SNDA 5C44G 4LFBL 5EBDA 2X6LA 4V190 4YY3L 2K5VA 3IKJA 2IHFA 4IJHA 4IUNA 4DV6Q 4NPSA 1XMQL 1CZGA 4OHJA 1GUGA 1ZYRC 4A3KH 2V4DA 4OELB 2E2DC 2R3ZA 4A3FB 3HOWH 4F87A 2ICIA 4K5WA 1J5EL 1LACA 4DR4Q 4L5QA 4CDFC 2Z4IA 3UDXA 2EYJA 4L63B 4R1JA 1WTVA 3J7A5 3PO2B 1G6ZA 4KHVA 5KRUA 2R7DA 2RSNA 4B9XA 4WRDA 4YHHL 1MJEA 3I72A 2F4VQ 2BE5D 3MAQA 4NP5A 4IFDI 3I4OA 2K14A 3P7JA 5ELEA 3J81c 1PFMA 3K5MA 2A6HC 2D5DA 4O0AA 2ZM6Q 4A3MB 3HOXB 4JOIC 4QB4A 1D2BA 1CTMA 4AYBE 2MP1A 3Q0AA 3HOZG 2WAQE 2K4KA 2Z6BA 5C3EB 5IIFA 4IFDH 4DXGA 3SVMA 5CYUA 1HNWQ 2ES2A 1KHIA 2L12A 1YITA 4XDXA 4GLVB 1VQEA 1WCMB 2XVSA 4ABNA 1Z47A 1AH9A 2UUBQ 4DUZQ 5M3MB 4A3EG 4RFBA 2IY5B 2YTVA 3BU2A 3MXNA 5DLQE 1JB3A 2XN9C 2WINB 4NMZA 3NWSA 1PYSB 3W1GA 1S40A 4PZ7A 4ILWA 1BR9A 2YU9H 1PH3A 3MXNB 4J1MA 1M4VA 4P74A 4BWGB 5FLXE 2CWAA 2SOBA 3QO2A 4BA1I 1L0YB 1NSNS 4JI4Q 3EROA 2EYHA 4K6LA 3H3VH 3S14H 2NN6I 4ODGA 2EXZA 2P5ZX 2JA8B 2A6EC 5JEAG 1SYGA 4A3DG 1E3PA 2VUMH 4JI6L 4BY7G 3SXHA 5JJLA 5EGTA 4IUUA 2MPMA 3HEJA 3PSIA 4TVAB 2CQOA 3KLWA 2NN6H 4R8IA 4K5VA 1L1OC 1TWGH 1GOZA 1JWMD 3IFTA 2JA5H 1TS4A 2JSOA 3T1YL 1FGUA 2Q2TA 1K3RA 1I50B 4NXMQ 2B8GA 3UI2A 2Q2UA 4RKLA 4UP8A 3JAMi 1EY7A 3TP8A 4BBSG 2QKIC 3GV3A 2XRSD 1KLUD 5IYBH 1AFPA 2Q2IA 1A15A 5ELFA 2A68D 2F0SA 5CV8A 1PVOA 5CORA 2WB1B 3T53B 1JJGA 4PZ8A 4LFAQ 3S2DH 5JPNC 2IX0A 5DNFA 4X64Q 4IFDJ 2BCOA 2ZT9C 3H0GB 3GTPH 1VF5C 4WJWA 4R9WA 1PTOB 4JBMA 3CQZH 2K04A 3H09A 4OO1I 2LSSA 1STEA 3FEWX 2HQEA 3MWYW 3HOUH 4RG1A 1F9QA 4BXXG 1F2ZA 2PI2A 1IBKL 2RKSA 4DR3Q 3GTOH 1SR3A 4JYAQ 2EJMA 4CBVA 1Q1EA 1F9SA 1QZGA 3DUZA 1BUVT 4EX5A 3M3YB 4OO1H 1TR5A 3MVVA 5E1FA 1PRTC 2VQEL 4LWCA 3I4MH 1LTLA 4GKJL 1E2ZA 4B3TL 3STBD 3A56A 5JVG3 3RZDH 3CPFA 4LF4Q 5FLXc 1SBBB 3I4NG 4OXPA 1LO5D 4GN4B 5M5YH 3B6YA 4ME5A 4JI3L 1QOHA 1HNXL 1NAPA 2K1BA 1Q81C 4OONA 2F03A 5I2XA 3HFZB 4A75A 2DJFC 3Q22A 2CQAA 1QUQA 3EFXD 5IT9E 5H1SE 3I56A 3D4WA 4RMFA 2KA7A 2AKWB 3HOWB 1W6JA 4CHTB 1EWCA 1QUQB 2FXQA 3BZKA 1Z7TA 4JI1Q 4DV2L 3K80C 4B3SQ 2PZUA 4U68A 3TZDA 1PDQA 3CCJA 1WD0A 1SYBA 2RCNA 2K52A 1SFOH 5NUCA 3CP0A 1A3TA 2E76C 3J81j 4WFN3 3SDZA 1LT3D 3LNNA 4IPCA 1IYJB 1XWEA 3KF8A 5IGEA 5KGUA 1VQ5A 1GUTA 5IYCH 4F8MA 4JI5Q 4DV6L 1VMCA 3KF8B 1K0RA 1SYEA 5C5LA 3FKIH 1YJNA 4CDDC 1HFGA 2K50A 3BVZA 4DR4L 2K75A 3F1ZA 1STBA 2F1MA 4APVA 1LLRD 2Y0SG 3ND8A 4N8FA 2UUCQ 2F0TA 4XQNA 2FMCA 4ZUJA 2E8GA 1N34Q 1PFNA 1QCBD 3UDIA 1MI2A 3K59A 2HDLA 3DM3A 1G2SA 4MTNA 2F4VL 2AUKA 2DNCA 1BCPF 3BS1A 3ULLA 3D6WA 1KABA 1MIUA 4FVMA 4DK1A 3KJPA 3CCSA 2EYMA 1Q3LA 2XWBB 5M5WH 5IGGA 1VQ7A 2YU9B 2ZM6L 1UEAB 1TIID 3NHHA 1E1OA 1JT8A 3GDEA 1KRTA 4DNRB 1D7QA 3UDFA 5JJKA 4FP5D 1YJWA 2F0GA 1N8RC 1XJVA 1NUCA 1SRUA 2BA1A 4OWTB 4EQ5A 1HNWL 4JOIA 3P20A 2WV6D 3GTKB 1YNND 3PIO3 1Y8OB 3V2TA 4MIUA 3T51B 2UUBL 3R8BA 2B3GA 1SNQA 4DUZL 1MGSA 4FDBA 4X62Q 1Q90A 3V05A 2PPBC 4BS9A 1Y8PB 4YWKA 4WJ3M 1EY4A 3EQLC 4HJ5A 1BDOA 5LHY1 1SNMA 1P16A 2O4XA 3SGIA 2B63G 2XRQD 2CWPA 4DV1Q 3K5NA 4DFAA 3N52A 5G3LD 3ND9A 2JA7B 4JI4L 1I94Q 4MNOA 1ASYA 3S16B 1RKNA 1HTLD 1CUKA 2QGQA 3NBIA 4HCEA 1JE4A 3PO3H 2NTSA 3F2DA 1EQVA 2PO4A 2RF4A 2Z0SA 2O2LD 2BOSA 1U0LA 2ALYB 1EYCA 2QW7A 2MO1A 1BBWA 2OTLA 3CPWA 1OTCA 1K28A 1O78A 2NTTA 3S24A 5EPKA 4DR6Q 1C7YA 4QMGA 5FOBB 3FPPA 2PMZB 1KXLA 3HOUB 5EQ0A 5CR3A 3K7UC 5IP9H 3C46A 3RMHA 2E5LQ 2Q2HA 1HZBA 2AQ3B 4NXML 2F0EA 3GTOB 5J39A 1KQSA 4JPBW 1LTSD 3OYYA 4Y52H 2KCCA 3LWEA 5LMNQ 3IRBA 1VQKA 2A74C 3A55A 5CV7A 4JV5Q 3T56B 3DM1A 3CRLC 2B29A 1UE6A 3ONAB 3RZDB 1ILQA 2EYLA 2RQXA 1JCKB 2K5WA 5M5YB 1FVIA 2AHOB 1H9SA 4HAEA 4X64L 1AE3A 1YNJD 3A8IE 1E1TA 2L0CA 2VQFQ 1DOMA 1LYLA 1TWCH 1H9SB 2EXDA 1TY0A 1NMGA 3M7GA 1PH8A 1DZ1A 4I65A 3KYHC 1IBMQ 2WFWA 2B2YC 3KLRA 3S1QH 3RUZA 1K8OA 1JJCB 3J7AV 4CJ1B 3Q6SA 1VQ8A 4DR3L 1VQPA 2PQAA 4JYAL 1SXTA 2JP1A 1BKBA 2JA6H 3UDGA 2R6GA 1CHQD 2PQAB 3NP8A 1VQGA 1V1OA 2IHEA 1SFOB 1C0AA 3GV6A 4KHPQ 2R7ZH 4LF4L 3M4OB 3N6RA 4GLXA 2E2HH 2G5DA 2F0DA 2AMCB 4YCUA 4DU9A 1SNPA 4I7ZC 2RVLA 3VDYA 4C3HH 5M3FH 4A3CH 2K5QA 1Q86C 2KHIA 5C44H 4A93B 3E9IA 4X3SA 1S5FD 3SR1A 1Q82C 3FKIB 3NENA 2A73B 4QIWE 3MFGA 4AYBB 1A8VA 2BDOA 4N8X1 2WAQB 4NXNQ 4JI1L 1YZ6A 2L4NA 1N32Q 4A3IG 4QUCA 4ZRZA 2EJGC 1OO9B 2F4IA 2EIFA 4DAVA 3NELA 4UP9A 3GTGH 3LWUA 4KK7A 3PGZA 3TRZA 5IODA 1HFNA 1EEFD 1CKMA 5BN5A 3DLLA 3I90A 1KIXA 2UXBQ 2X69A 1SLJA 1PTOC 4JI5L 2ZJPA 3W2DA 1JORA 5M5WB 1Y8NB 4RGOS 2Q8RE 2N49A 5I4DA 3KLSA 1CA6A 2CH4W 1B7YB 2RHQB 5ELOA 3VYSA 4IUQA 2GN5A 1IL2A 4KKTA 1D5MC 3I4LA 1EYGA 1NY4A 3HOZH 2A19A 2UUCL 1DD2A 2VB2X 3TSSA 3MFYA 4YIJA 1K9MC 3CC7A 1F2YA 1TWAB 1WFQA 1N34L 2PCFB 3AYHB 4C2MH 3KJOA 2NUCA 1A0IA 4X3TA 5A2QL 1BVSA 2N78A 2C9OA 3M7NA 1NTGA 2J0TD 3E5SA 4IALA 1B9MA 3D4DA 4A3EH 4PQXA 3TN2A 1G2TA 4DKAC 2VQEQ 3J80L 1HQMC 3S17H 1O7YA 1SMYC 1CSPA 1VDZA 3RLNA 4C3IG 1WTOA 2LS01 1LTGD 1XTDA 1A6XA 2K32A 2KCNA 1Q7YC 1B8AA 1CZWA 1B44D 3H6MA 4A3GG 4GLAC 2A69C 1F2MA 3ERQA 1I4QA 5HGTA 4A3JB 1VQAA 4O1NA 1XMOQ 1DOKA 2CCZA 4DA2A 1WTWA 4FF2A 2VL6A 5IOCA 1QVFA 5JEAH 1S5ED 1NE3A 2EY6A 3KOJA 4GKKQ 4A3DH 4X62L 4BY7H 4KI0A 2B2UA 1CKNA 3ERSX 4A3FG 3L7ZC 1C8CA 1KDCA 1EFWA 4F7XA 2BH2A 4HSVA 1CKNB 1B9NA 4DV1L 1QVGA 1FYCA 5C4HA 3RR5A 3PO2G 4UAIA 3MXGA 1I94L 1PRTF 2ICEC 5JAVA 1B1ZA 3VYUA 1E0BA 1FD7D 2C5CA 3ITPA 1FNWA 3BZCA 4CKBA 5KYLA 4MZ9A 2I0QA 2ZJQA 1YNXA 3UE1A 3E6ZX 3OIPA 1KNEA 1XXGA 1M90C 4BBSH 1A63A 4Y7NH 1SNOA 2XGTA 3R2IA 3F2UA 1STNA 4KV6A 1HA5A 1FR3A 5C4XB 1NR4A 1I4RA 1FGBD 4DUYQ 3QJYA 1IW7C 5JJZA 4DR6L 1KRSA 2NVYB 2ZTDA 1B3QA 1TY2A 3AEVA 5C3EG 2EY5A 4E6IA 2A5HA 3VYTA 2B39A 2M2LA 4UP7A 2E5LL 2UXCQ 2R7FA 3RLFA 4IUPA 1DONA 1WCMG 4NB3A 4RGMA 4DK3C 2Z4HA 4CKCA 4BXXH 5LMNL 2JA6B 4BBRG 3BJUA 3H3VC 1ESFA 1STGA 2E2IH 4JV5L 1WYDA 2R93G 1U5KA 2R7ZB 2DNEA 5FO7B 3PF5A 1W2BA 4DV4Q 1D5ZC 2ZTEA 4DR2Q 1KDAA 3A8KE 3I4NH 2VQFL 1HQRD 4Q5VA 1X54A 4H13C 4C3HB 1VQCA 3A7LA 1ICWA 2UU9Q 1RDPD 1U4MA 4RGTA 2PNRC 5C44B 1SJHD 5CV4A 3K57A 3CCQA 1IBML 1GUWA 4XQQA 4A3LG 5JEAJ 2CHBD 5LL6X 3FMCA 1Y1WB 1E2WA 1A62A 1C48A 1VQMA 1QILA 1S5CD 3MXUA 1EY9A 1JR0D 2NVTB 3L3OC 2L9HA 1RF2D 2B2YA 3G6JB 3CCLA 2K5DA 3FPUB 4K14A 4YWLA 4H44C 3GTGB 3SK5A 4KHPL 5BR8Q 1PFBA 2BH8A 5ELBA 2JEAI 2PW7A 5AFWA 1RD9D 1PLFA 1Q46A 2LY7A 4DNTB 1EY6A 3L2PA 4JI0Q 1C4QA 5D65A 3A5UA 1NBWA 4PMBA 5EBCA 4JK1C 2VNUD 4HIKA 1PYBA 1EYDA 5ISRA 3EA6A 2OCEA 2KENA 4BY1G 4POGA 3TP6A 2L11A 4KD3A 4X65Q 1LM0A 2R92G 1TS5A 2RDGA 1RIPA 4NXNL 3PF4A 1K8MA 3HOZB 4QJFA 1N32L 1DJRD 3MEFA 1O7LA 1EZ6A 3I3CA 2NBFA 4LUZA 1EU4A 1O80A 3H94A 1Y1VG 3KDFB 3OW2A 1RODA 3K8AA 2GVAA 2F3IA 4C2MB 3GD7A 3DEOA 2KHJA 2MGSA 1XPRA 4A3BG 3CF5A 4FF1A 1KL9A 1JOKA 2J7ZA 3AFQA 4XT1B 1EU3A 4JI7Q 3BVGA 2UXBL 1OXTA 2MNAA 1QE6A 5C4ZA 4DK0A 1TWFH 3NPPA 4YWMA 4AH6A 4C56C 1ZKOA 3D31A 4K2KA 5JOBA 4DAYA 4A3EB 1VQFA 4IZ8A 1BO0A 1S3OA 5EKKA 2KQ3A 3T1HQ 2JYOA 3NUCA 4L5SA 4P75A 3PIP3 3DMUA 4DAYB 3G48A 4HIOA 2ZXOA 2EYOA 1FL0A 1MHWC 1VS0A 4R4TA 1BQQT 1U4PA 3K0XA 5GAGC 2HIXA 1KC8C 5IYDG 1U4RA 1YIJA 3W3AA 3S1MH 3KF6A 3D0FA 2E2JH 4Q0FA 1A2TA 4BY7B 3C1FA 1F9PA 4PMWA 3KF6B 4FXDA 1SROA 1L0XB 1VQOA 3HOYG 2OQKA 2AQ1B 2NZOA 1XYIA 2N8NA 1SMXA 4DR1Q 2M00A 2B63H 4QCLA 4UDUC 1U4LA 4LK1C 2PZTA 1FNVA 2G9DA 1CSQA 1UE1A 4ID6A 1XMOL 3RN2A 2EDGA 3D6CA 3QWNA 3BYYB 3LGJA 3K81C 3W1BA 4C3JG 2KCMA 4B3RQ 4UPAA 4GKKL 4A3KB 1C9OA 1E2VA 4LF8Q 5FJ8G 4HJ9A 2OTJA 4XYQA 1B70B 2F0PA 2LKVA 1SE4A 1V8QA 1PHJA 1LUZA 3CMAA 4LFCQ 4QF4A 3S1RH 1K3BC 1G8ZD 2I5LX 4OEMB 4HJAA 1S4ZA 3CCMA 3CKIB 2F0NA 2NVQH 2E2IB 2IL8A 4KMUC 5DM73 2DGYA 1E7ZA 3S2HH 4M1UB 2B2WA 2LXKA 4IPDA 1HZCA 4G7OC 1A3VA 2Z6KC 1JWSD 3E0EA 2EPBA 1JC7A 2FHTA 2I5HA 3I4NB 1SEBD 2DUDA 1LTAD 4KD4A 2L1BA 4DUYL 1MSHA 1ICFB 2QDBA 2UXDQ 2SEBD 2KBNA 1AZQA 1EIFA 4KN4C 1L2FA 1Y14B 2Z9HA 1MSGA 4DV0Q 1BCPD 4OL7A 2UXCL 2PZWA 1CHPD 4LUVA 2DN8A 1LT4D 2MHVA 5TSSA 5JPMC 5KNCA 4U673 4QIWB 1ONLA 4NDXA 1KNAA 4RKBA 4H0LC 1RJTA 5LMNW 3A7AB 4P71A 1LTRD 1MBYA 4GN3B 1JQYD 2IW3A 3WOEA 1HUNA 3H15A 4X66Q 4DV4L 1PYWD 4GN5A 3PQIA 3NQIA 4DR2L 3LX0A 2EOTA 1PTOF 2N88A 1SYFA 4AIMA 1VQ4A 4RGNA 1N33Q 3M9BA 2QCPX 2JA7G 3KLSX 2E75C 1WVLA 5CGKA 3AMUA 4R4CA 2UU9L 3S14B 1BXTA 4DV3Q 3SK4A 4V0BA 5C0XI 2B2UC 2A1AA 3C1EA 3NK9A 3RZOH 1CA5A 2NWGA 2CVRA 1NCVA 3G6EA 3J7AF 3V96A 2VUMB 1YEZA 2R61A 3I2ZA 3PUXA 3GTJH 1WTQA 5E4WC 1M1KC 2PQEA 4HEDA 3E3XA 1NR2A 3MC0B 1TWGB 4DR5Q 2JA5B 3A8JE 4A3IH 2DJGC 1RTOA 3L9AX 5BR8L 4BA2I 1YVCA 1FJGQ 4QL5A 1V9PA 4JI0L 4DNIA 2EVBA 5IY0A 1TWFB 2IX1A 3VR2A 3QOLA 1L0WA 1R9TH 1GKHA 1SSOA 5KYIA 2WIIB 1HNZL 1WI5A 1X3EA 2F0IA 5FO9B 3F2CA 3NBHA 4X65L 3E0JA 1K8AC 3U4VA 3Q8DA 3G71A 1PA6A 4LF5Q 3S2DB 1V1QA 4FYDA 2BDNA 3NBHB 3GTPB 2KVMA 2G9HD 3RD4A 1VQHA 3CQZB 4TKOB 1EQQA 1SE2A 2JJQA 3PMFA 2K33A 3A0JA 2KUMA 1GJXA 1D6EC 1YHBA 1RCVD 4JI7L 2A68C 1AN8A 4J15A 2K05A 3U58A 2QF7A 2TSSA 3W5OA 1DM0B 3MA2B 5C4JH 4DK6C 3K5OA 4K2LA 1E22A 4DV5Q 3T1HL 5KNBA 3I4MB 3WWVA 1EY5A 3M4PA 4KY5A 3BZDB 5K36G 4XIGS 4OGQC 1ZYRD 3T16A 4C3IH 1I3QH 1FNUA 1X32A 2F0KA 1F9RA 1TWHH 3BVMA 3IAYA 1UNSA 3KK7A 4LF6Q 5EPJA 2YTYA 3U9OA 4KN7C 4N9PA 1GO3E 4JVZA 5AJ3Q 4JBWA 3S9WA 4A3GH 2XSCA 3JAML 5FK9C 1BBUA 2OQ0A 4AQYQ 1XTCD 4A93G 2HCCA 2SNSA 5D3IB 3STBC 4KJNA 2FINB 2HUGA 1B50A 2ZJRA 5C0XJ 1VCIA 5IWAQ 4H7BA 4A3FH 1VF7A 1AP0A 4DR1L 1SDFA 5HGQA 3PUZA 2A6HD 1H9JA 2NVQB 5IGFA 1R4QB 2WKDA 3EN2A 4J6HA 4K6DA 2NYZD 4LNQA 3PO2H 2YTXA 1AEXA 2NVXH 2I46A 2F3WA 3S2HB 1KDBA 2EQSA 1I6HH 5FLMG 4G57A 5IP7G 4JI8Q 4B3RL 1H95A 3MTSA 4HN7A 4LF8L 1HUMA 2F52A 4X3UA 3U9SA 3OIQA 3KUPA 5C0XG 3WOFA 5BN3A 3GQBA 2F3VA 1T5EA 1SN8A 4C1NK 1QNUA 1PH7A 4LFCL 4NKLA 5J1ZA 1VQ6A 5C3EH 2I07B 2HQLA 2KECA 3HP3A 4P73A 2K5HA 2RDFA 5GAHC 4JBKA 1OXUA 2D9UA 4L8JA 1WCMH 2IPKD 1HHVA 3DEPA 4BBRH 1T9HA 3AFPA 4K8IA 1YI2A 2A6ED 2R93H 1JOQA 4S3SA 5KIXA 4K8JA 2D0PA 1N36Q 2GA4B 4K0KL 1R4PB 2UXDL 2HHHQ 1QNKA 3P1HA 4B3MQ 2D0OA 4PG3A 2Z6KA 3HKZG 3CC2A 3GTQH 3HOVG 4CJ0B 2Y0SE 4DV0L 4KY7A 4A3JG 1BNZA 1STAA 1ILPA 3FVQA 4GZYC 3RN5A 4A3LH 1ET6A 1VQIA 1S72A 1EEID 2O5IC 2ASBA 5CV9A 1ESRA 5LMUQ 4GNXA 1K83H 4A3IB 4FF4A 4X66L 1Z6HA 5HY6A 2MO0A 4GNXB 4LF9Q 2E74C 1HCZA 1JE5A 1STYA 3J81L 1YNNC 1X3QA 3GP7A 1N33L 3SK6A 1R9TB 5A2QE 1TS2A 4EGVA 1VQLA 4DV3L 1I50H 5C3XA 4NW2A 5K5PA 3PO3B 2F0QA 5I9PA 3J80E 4M8AA 2UUAQ 4BY1H 4OWWB 1X3PA 2R92H 4RAUC 1VQ9A 1PZJD 5C4XG 4DV7Q 3I70A 4DR5L 3X3NA 5KEEA 1O7ZA 2EYPA 4K5XA 2F0FA 1PRTD 3CCEA 1FJGL 4IJLA 1Y1VH 2KOLA 5CC4A 4F88A 5C6AA 1EWIA 2VB3X 3CCVA 3NEMA 2CW0C 3TS2A 4MTKA 4DGZA 2B2WC 4A3BH 4ALPA 4OIKA 3MXPA 5C4JB 1YJ9A 5CBAE 1IBLQ 1HR0W 2JQOA 4IO9A 4OWXB 4RA8A 4OIJA 4ULLA 5EPLA 3M3YH 5COYA 2K03A 3RNUA 5HURA 1HH2P 3K7AH 3TP5A 4LF5L 1G51A 3CD6A 2L55A 4C3IB 1I3QB 4FO2A 3R3OA 3HOXG 2K7VA 4A3MG 3AU7A 2H5XA 3OWEB 4JI2Q 1SYDA 1K8GA 1EZ8A 2FMMA 3I55A 1TWCB 2RDHA 3D3RA 1IL8A 4HJ7A 4N9TA 3K6OA 2VY3A 4R8NA 4DR7Q 3S1QB 4XXEA 4XT3B 3FP9A 5IYDH 1X55A 4POFA 1CK1A 1W6KA 4HMJA 4G7HC 1B3AA 4X3KA 1Y1WG 3T13A 4CGYB 5J3BA 3VA7A 1YBYA 2RCFA 1TS3A 4B08A 4JCVE 1YNJC 4DV5L 3HOYH 3VR3A 3ZJYC 5M3MG 1UUPA 1GUSA 2LXJA 4QQBX 4DPGA 1PMRA 2E2HB 3C2PA 1SNCA 1JICA 2ATWA 1EOTA 2OEOA 1XNQQ 2NVXB 2MFIA 4RH6A 4LF6L 5E4XA 5M3FB 2WACA 1I6HB 2NB0A 4HMIA 1XNRQ 5AJ3L 4DAPA 2XTIA 4IUTA 3A54A 1F77A 4AQYL 3J80c 1CFMA 5KNDA 4RCOA 1I4PA 2JA8G 4A76A 1WTPA 2F0LA 1IXRA 1ENAA 3CW2C 4C3JH 5M9OA 3OMCA 1QWYA 3TQYA 2H4OA 5FJ8H 1ZXTA 5IWAL 2CH4A 4A4IA 1PH5A 1A3UA 1V43A 4TRDA 3T4AC 4CJ2C 3I8ZA 4P72A 3PIOA 3CMEA 1HRJA 5J22A 4ME3A 4KY6A 2Q8TA 1HR0Q 3OPOA 4BBRB 5FLXL 3C3LA 5L37A 4GS3A 4QUFA 5CV6A 4FNFA 1WTXA 3HGBA 2R93B 4JI8L 4C1NI 3HKSA 3QIAA 1TVXA 1HNZQ 5DEHA 3H3VI 1SYCA 2WB1G 1PXUA 3KDFA 4IOAA 4RHRA 3G7LA 3GTQB 3H0GG 1VQJA 2CFMA 1KD1C 4R4QA 2Z1CA 1KLGD 3OHXC 1LT6D 3E9HA 2F0MA 3MZ5A 3AB9A 3QB3A 4PV1C 1HA6A 1VQBA 4HSPA 3PUVA 2NZHA 3M85A 3GTKH 1SAPA 3BG3A 1DYQA 4ZQ3A 3VR4A 1KAWA 1K83B 4XQJA 4LW1A 1U9RA 1K73C 2NZ1D 4TQUS 3SEBA 5GROA 1RL2A 1PZKD 3S17B 2EY1A 5I2YA 5D3DA 4XYOA 1N36L 4ZYSA 2HHHL 1EIGA 3NE5B 1D8LA 1XPOA 1VQNA 4B3ML 3BDOA 2JA7H 3HKZE 2WKCA 3U4ZA 1EY0A 3A74A 4L5TA 3S16H 1UWVA 4BY1B 3BDCA 1EY8A 3GTLH 1BCPB 2R92B 4A3DB 1EWHA 5LMUL 2F0VA 4A3KG 1F2LA 3CCRA 4PZ6A 1P8LA 3U50C 5CV5A 2JEBI 1X6OA 2F0UA 3HOWG 2VS1A 2I5MX 2PYKA 5ELDA 3S15H 2K6AA 2F0OA 4ZKCB 1PZID 3OTOQ 1PH1A 5D14A 1Y1VB 3OWFA 4LF9L 2K28A 5F2DA 3I91A 1HJPA 1CT1D 4A3BB 5T1IA 2RHSB 1X56A 3SK8A 3R2TA 4OX9Q 2F0JA 2N3SA 4GOPA 2IX3A 3BYTB 1PH9A 4YCWA 1X65A 5EJWA 1EFID 1I4HA 2A8VA 2IWHA 1ENFA 1SE8A 4LMQD 3H91A 4GOPB 1PH2A 1S5DD 4BBSB 1HZ9A 2EY2A 3K7AB 4Y7NB 2UUAL 1GHKA 2VZAA 2B2VC 4H02A 4FF3A 1ET9A 5I6WA 1QZHA 3CXCA 3NQTA 4DV7L 5IT9L 2AQ2B 3ULJA 2K01A 4IFDG 1GD7A 1OXSC 3CHBD 1NMFA 3TS0A 2JN4A 1WOCA 2KEDA 1UEBA 2OXPA 4CDEC 2RBMA 3ICEA 1IBLL 1EIHA 2HCIA 3IL8A 1RTNA 3GTMH 4IOCA 3HOYB 3URYA 1CQVA 3RLOA 1EOVA 1SE3A 5C3WA 2Z8LA 3DWPA 3NSWA 4PMCA 1XPUA 2XIWA 2CKZB 5T1GA 3FHWA 5BN4A 1GUOA 1LABA 5K36H 1EQTA 4JI2L 3M4OH 4K0KQ 3CU7A 4DR7L 2OWOA 5CBEE 2BE5C 4GNXC 3A5ZB 2L5TA 2JXMB 5EKIA 4LF7Q 1J9OA 3JC66 3K0YA 4HTHA 4C3JB 1PH6A 2VUMG 4IURA 4ZUIA 4A93H 1IHZA 1IZ6A 3TP7A 2H1EA 5JVH3 1TU2B 1PTOD 5E7NA 3EJIA 2NN6G 1ZEQX 4ZLTF 1JWUD 1Q1BA 4MHEA 2JA5G 2B2TC 3J80i 4HJ8A 3EIVA 1XNQL 1H9RA 3J81i 1CQFA 1ASZA 3PUWA 3DWAA 1AW7A 4Z9CB 1I4XA 2QA4A 2OT2A 4HIMA 1OXXK 1XNRL 1VQDA 1Z9FA 1A2UA 1BBXC 3VR5A 2JK8A 5IYBG 5FLMH 5M5XH 4KHZA 5IP7H 4FXGC 1LTTD 2DY8A 1N9WA 2ENBA 2HT1A 1Q8KA 3P75A 4QGUA 2FFKB 2LMCB 4FXKC 4G4KA 5C0XH 3TBIB 2Y0SB 1IKLA 1Q8IA 1UE7A 3J7ZC 2KJXA 1IYUA 4KLKA 1SMYD 3HOUG 4KTAA 2C35B 4ZCKA 1TWAH 5DAUA 3K5LA 1K0SA 3PUYA 5IT9c 3MEHA 1X9NA 1HR0L 1UE5A 2V1CC 1EIYB 2A69D 4QY7A 4OO1G 1LTBD 3NXWA 3EVQA 1TT2A 2IT1A 4RHSA 5LL6S 5EAYA 2WP8J 3I4MG 1GHJA 2RSOA 5FKAC 2WB1E 1NNXA 1PRTB 1GM5A 2KCTA 4EQNA 1KAAA 1WTHA 2ZXRA 1JJ2A 4DN4M 1E24A 3Q24A 1B53A 3Q23A 1YHQA 2EE1A 3QR8A 1H9KA 3S1MB 1XX8A 3FDTA 3HOVH 1MKHA 3GTLB 4A3JH 3AQQA 4LFBQ 5G3LF 1ML0D 2E2JB 2CW0D 3VA5A 5ELCA 3PCOB 4IPHA 5IGBA 4DXFA 3F2BA 4YY3Q 1STHA 2B8FA 1I4GA 4YCVA 1HZAA 1WJJA 2D62A 2AUJD 1XMQQ 1G91A 3S15B 1BOSA 1EL0A 1SJED 3S1NH 4P2CB 2ZXPA 2PI2E 1J5EQ 4L5RC 3KBXA 3VYRA 3TEHB 2B63B 2HIVA 1GVPA 1T5XD 4O42A 4KJOA 3VR6A 1IW7D 5GADC 1L1OA 4KKUA 4LUOA 1DCZA 4YHHQ 1JOOA 3GO5A 5IYCG 1CKOA 2HD3A 3QOJA 1L1OB 1AE2A 1WD1A 3L0OA 4JC0A 2YYZA 1D5XC 3DWQA 4UY8C 2MJ8A 4KKSA 3QG1A 1TXYA 3D4RA 3HS0C 3FKIG 1W3SA 3PV0A 3F8TA 4AYBG 4LFAL 2HDMA 1AZPA 2WAQG 3HRZC 2JE6I 1RHPA 3OTOL 5C4XH 1EYAA 3JAME 4RCNA 3S1RB 2QEJC 2RA4A 4MN3A 2QDLA 2NVYH 2EJFC 4OX9L 3FRPB 5IGDA 2FJ2A 3NTKA 3GTMB 1QVCA 3I7FA 3MHBA 4LJZC 5EKLA 4ZK9B 3D8GA 1B2TA 5GQOA 5GAEC 1BF4A 1DXMA 1CI3M 1WTRA 4RWSC 2EYFA 3BDLA 5CMDA 1MJCA 1EUJA 3SE0A 2VW9A 3ULPA 1GXDC 3M4QA 3OOCA 1MD2D 3HOXH 4A3MH 4DAMA 1KTKA 2B2VA 5I6YA 3OW7A 3WDNA 1OXVA 5A35A 1ENCA 3X3MA 1S5BD 3TMEA 3HZXA
chains in the Genus database with same CATH topology
4TSSA 1UAPA 1HXYD 2BA0A 4IQZA 1DOLA 3HG9A 3DHQA 3M4YA 1I6VC 4DF7A 3ZYYX 4WORA 2TMPA 2IJ0A 1BCPC 1H9MA 2KHSA 1II3A 3SHLA 3IFDA 4L6TB 1QG7A 5C5MA 4HCSA 1D1KA 2Q8IB 2DY7A 5M5XB 4CKEA 3CRKC 3RZOB 4EQOA 3GTJB 2O5JC 3KBGA 1V1PA 2XWJB 3OSOA 1B4OA 3NTIA 3K58A 1VMPA 1V1PB 1D1IA 2KEEA 2VXWA 4ZAIA 1CM9A 1HTPA 3O13A 2AWOA 4PNYA 2LFNA 3NTHA 1LTID 5FO8B 3TZUA 4LAAA 4B9WA 3DXJC 1Q12A 2B2TA 1HPCA 5E3FA 3J81E 2SDFA 4IUVA 2ID0A 5I9OA 1IYVA 4ZKBB 1LV9A 1M8AA 2N55A 2F0WA 2XNAC 1LT5D 3HKZB 3HOVB 2OF1A 3TDQA 4EVOA 2MUYA 1IKMA 4HR7B 2F0HA 3NWTA 1PTOH 2D2CC 5DM63 2J4XA 2QILA 4XTCS 5IGCA 1Y69U 3S1NB 1GUNA 2EZVA 1QJOA 4IN3A 2AWNA 2PW5A 4J8QA 2M9VA 3OMGA 1J8IA 1TQOA 3J7YW 3I73A 1TWHB 1G291 1TKWB 3R93A 2SNMA 4EQPA 4A3GB 4C3HG 4G7ZC 2X6GA 1QB5D 1SNDA 5EBDA 2X6LA 4V190 3IKJA 4IUNA 1CZGA 4OHJA 1GUGA 1ZYRC 2V4DA 2E2DC 2R3ZA 4A3FB 4F87A 2ICIA 4K5WA 1LACA 2Z4IA 2EYJA 4L63B 1WTVA 3PO2B 1G6ZA 4KHVA 5KRUA 2RSNA 4B9XA 4WRDA 3I72A 2BE5D 3MAQA 4NP5A 4IFDI 3P7JA 5ELEA 1PFMA 3K5MA 2A6HC 2D5DA 3HOXB 4A3MB 1D2BA 4QB4A 1CTMA 2MP1A 3Q0AA 5C3EB 5IIFA 4IFDH 4DXGA 3SVMA 5CYUA 2L12A 4XDXA 1WCMB 2XVSA 4ABNA 1Z47A 5M3MB 4RFBA 3MXNA 1JB3A 2XN9C 2WINB 4NMZA 3NWSA 4ILWA 1BR9A 4J1MA 1M4VA 4BWGB 5FLXE 2SOBA 3QO2A 4BA1I 1L0YB 1NSNS 3EROA 2EYHA 4K6LA 2NN6I 4ODGA 2EXZA 2JA8B 2A6EC 5JEAG 1SYGA 3SXHA 5EGTA 4IUUA 2MPMA 3HEJA 2NN6H 4R8IA 4K5VA 1GOZA 1JWMD 3IFTA 1TS4A 2JSOA 1I50B 2B8GA 3UI2A 4RKLA 1EY7A 3TP8A 2QKIC 3GV3A 2XRSD 1KLUD 1AFPA 1A15A 5ELFA 2A68D 2F0SA 5CV8A 5CORA 2WB1B 3T53B 5JPNC 2IX0A 5DNFA 4IFDJ 2BCOA 2ZT9C 3H0GB 1VF5C 4WJWA 4R9WA 1PTOB 2K04A 3H09A 4OO1I 1STEA 3FEWX 2HQEA 3MWYW 1F9QA 1F2ZA 2RKSA 2EJMA 4CBVA 1Q1EA 1F9SA 3DUZA 1BUVT 3M3YB 4OO1H 1TR5A 3MVVA 5E1FA 1PRTC 1E2ZA 3A56A 5JVG3 1SBBB 1LO5D 4ME5A 1QOHA 1NAPA 2K1BA 2F03A 5I2XA 3Q22A 2CQAA 3EFXD 5IT9E 3D4WA 2KA7A 3HOWB 1W6JA 4CHTB 1EWCA 1Z7TA 2PZUA 4U68A 3TZDA 1PDQA 1WD0A 1SYBA 5NUCA 1A3TA 2E76C 4WFN3 3SDZA 1LT3D 3LNNA 1XWEA 3KF8A 5IGEA 5KGUA 1GUTA 4F8MA 1VMCA 1SYEA 5C5LA 1HFGA 3BVZA 1STBA 2F1MA 1LLRD 3ND8A 2F0TA 4XQNA 2FMCA 4ZUJA 1PFNA 1QCBD 1MI2A 3K59A 2HDLA 1G2SA 2AUKA 2DNCA 1BCPF 3BS1A 3D6WA 1KABA 4FVMA 4DK1A 2EYMA 1Q3LA 2XWBB 5IGGA 2YU9B 1UEAB 1TIID 3NHHA 4DNRB 4FP5D 2F0GA 1NUCA 2BA1A 3P20A 2WV6D 3GTKB 1YNND 3PIO3 1Y8OB 3V2TA 4MIUA 3T51B 3R8BA 1SNQA 1MGSA 1Q90A 3V05A 2PPBC 4BS9A 1Y8PB 1EY4A 3EQLC 1BDOA 5LHY1 1SNMA 2O4XA 2XRQD 3K5NA 4DFAA 3N52A 5G3LD 3ND9A 2JA7B 3S16B 1RKNA 1HTLD 3NBIA 4HCEA 1JE4A 2NTSA 1EQVA 2PO4A 2O2LD 2BOSA 1EYCA 1O78A 2NTTA 5EPKA 4QMGA 5FOBB 3FPPA 2PMZB 3HOUB 5EQ0A 5CR3A 3C46A 3RMHA 2AQ3B 2F0EA 3GTOB 5J39A 1LTSD 2KCCA 3LWEA 2A74C 3A55A 5CV7A 3T56B 3DM1A 3CRLC 3ONAB 3RZDB 1ILQA 2EYLA 2RQXA 1JCKB 2K5WA 5M5YB 1H9SA 4HAEA 1YNJD 3A8IE 2L0CA 1DOMA 1H9SB 1TY0A 3M7GA 1DZ1A 4I65A 2B2YC 3KLRA 1K8OA 3RUZA 3J7AV 4CJ1B 3Q6SA 1SXTA 2JP1A 2R6GA 1CHQD 3NP8A 1V1OA 1SFOB 3GV6A 3M4OB 3N6RA 2F0DA 4DU9A 1SNPA 4I7ZC 2RVLA 2K5QA 4A93B 4X3SA 1S5FD 3SR1A 3FKIB 2A73B 3MFGA 4AYBB 2BDOA 2WAQB 2L4NA 4QUCA 4ZRZA 2EJGC 1OO9B 2F4IA 4DAVA 3LWUA 4KK7A 5IODA 1HFNA 1EEFD 5BN5A 3I90A 2X69A 1PTOC 3W2DA 1JORA 5M5WB 1Y8NB 4RGOS 2Q8RE 5I4DA 3KLSA 1CA6A 3VYSA 4IUQA 4KKTA 1D5MC 3I4LA 1DD2A 2VB2X 3TSSA 3MFYA 4YIJA 1F2YA 1TWAB 2PCFB 2NUCA 4X3TA 5A2QL 2C9OA 3M7NA 3E5SA 2J0TD 4IALA 1B9MA 3D4DA 4PQXA 3TN2A 1G2TA 3J80L 1HQMC 1O7YA 1SMYC 1WTOA 1VDZA 4C3IG 2LS01 1LTGD 1A6XA 2K32A 2KCNA 1CZWA 1B44D 3H6MA 2A69C 1F2MA 3ERQA 5HGTA 1I4QA 4A3JB 4O1NA 1DOKA 4DA2A 1WTWA 4FF2A 5IOCA 5JEAH 1S5ED 2EY6A 4KI0A 2B2UA 3L7ZC 1C8CA 1KDCA 4F7XA 4HSVA 1B9NA 1FYCA 5C4HA 4UAIA 3MXGA 1PRTF 2ICEC 5JAVA 1B1ZA 3VYUA 1E0BA 1FD7D 2C5CA 3ITPA 1FNWA 5KYLA 4CKBA 3E6ZX 3OIPA 1KNEA 1XXGA 1SNOA 3R2IA 3F2UA 1STNA 4KV6A 1HA5A 1FR3A 5C4XB 1NR4A 1I4RA 1FGBD 3QJYA 1IW7C 5JJZA 2NVYB 1TY2A 2EY5A 4E6IA 2A5HA 3VYTA 2B39A 2M2LA 3RLFA 4IUPA 1DONA 4RGMA 2Z4HA 4CKCA 2JA6B 3H3VC 1ESFA 1STGA 2R7ZB 2DNEA 5FO7B 1D5ZC 1KDAA 3A8KE 1HQRD 4Q5VA 4H13C 4C3HB 3A7LA 1ICWA 1RDPD 1U4MA 4RGTA 2PNRC 5C44B 1SJHD 5CV4A 3K57A 1GUWA 4XQQA 5JEAJ 2CHBD 5LL6X 3FMCA 1Y1WB 1E2WA 1C48A 1QILA 1S5CD 3MXUA 1EY9A 1JR0D 2NVTB 3L3OC 2L9HA 1RF2D 2B2YA 3G6JB 2K5DA 3FPUB 4K14A 4H44C 3GTGB 3SK5A 1PFBA 5ELBA 2JEAI 2PW7A 5AFWA 1RD9D 1PLFA 2LY7A 4DNTB 1EY6A 1C4QA 5D65A 4PMBA 5EBCA 4JK1C 2VNUD 1EYDA 5ISRA 3EA6A 3TP6A 2L11A 4KD3A 1TS5A 2RDGA 1K8MA 3HOZB 1DJRD 1O7LA 1EZ6A 3I3CA 2NBFA 1EU4A 1O80A 3H94A 1RODA 4C2MB 3GD7A 3DEOA 2MGSA 4FF1A 1JOKA 2J7ZA 4XT1B 1EU3A 3BVGA 1OXTA 1QE6A 5C4ZA 4DK0A 3NPPA 4C56C 1ZKOA 3D31A 4K2KA 5JOBA 4DAYA 4A3EB 4IZ8A 1BO0A 5EKKA 2KQ3A 2JYOA 3NUCA 3PIP3 3DMUA 2ZXOA 2EYOA 1BQQT 1U4PA 1U4RA 3W3AA 4Q0FA 1A2TA 4BY7B 3C1FA 1F9PA 4PMWA 4FXDA 1L0XB 2AQ1B 1XYIA 2M00A 4QCLA 4UDUC 1U4LA 4LK1C 2PZTA 1FNVA 2G9DA 4ID6A 2EDGA 3D6CA 3QWNA 3BYYB 4C3JG 4A3KB 1E2VA 4XYQA 2F0PA 2LKVA 1SE4A 1V8QA 4QF4A 1G8ZD 1S4ZA 3CKIB 2F0NA 2E2IB 2IL8A 4KMUC 5DM73 4M1UB 2B2WA 4G7OC 1A3VA 1JWSD 2EPBA 1JC7A 2FHTA 3I4NB 1SEBD 1LTAD 4KD4A 2L1BA 1MSHA 2QDBA 2SEBD 1AZQA 4KN4C 1MSGA 1BCPD 4OL7A 2PZWA 1CHPD 2DN8A 1LT4D 2MHVA 5TSSA 5JPMC 5KNCA 4U673 4QIWB 1ONLA 4NDXA 1KNAA 4RKBA 4H0LC 1RJTA 3A7AB 1LTRD 1MBYA 1JQYD 2IW3A 3WOEA 1HUNA 1PYWD 3NQIA 3LX0A 2EOTA 1PTOF 2N88A 1SYFA 4RGNA 2QCPX 3KLSX 2E75C 1WVLA 5CGKA 3AMUA 3S14B 1BXTA 3SK4A 4V0BA 5C0XI 2B2UC 3C1EA 3NK9A 1CA5A 2NWGA 2CVRA 1NCVA 3J7AF 2VUMB 3V96A 2R61A 3PUXA 1WTQA 5E4WC 2PQEA 4HEDA 1NR2A 3MC0B 1TWGB 2JA5B 3A8JE 1RTOA 3L9AX 4BA2I 2EVBA 1TWFB 2IX1A 3VR2A 3QOLA 1SSOA 5KYIA 2WIIB 2F0IA 5FO9B 3NBHA 3E0JA 3S2DB 4FYDA 2BDNA 3GTPB 2KVMA 2G9HD 3RD4A 3CQZB 4TKOB 1SE2A 3PMFA 2K33A 2KUMA 1GJXA 1D6EC 1RCVD 2A68C 1AN8A 2K05A 2QF7A 2TSSA 1DM0B 3MA2B 3K5OA 4K2LA 5KNBA 3I4MB 1EY5A 4KY5A 3BZDB 5K36G 4XIGS 4OGQC 1ZYRD 3T16A 1FNUA 1X32A 2F0KA 1F9RA 3BVMA 3IAYA 1UNSA 3KK7A 5EPJA 3U9OA 4KN7C 4N9PA 4JBWA 3S9WA 2XSCA 3JAML 5FK9C 1XTCD 2HCCA 2SNSA 5D3IB 4KJNA 2FINB 2HUGA 1B50A 5C0XJ 1VCIA 4H7BA 1VF7A 1AP0A 1SDFA 3PUZA 2A6HD 1H9JA 2NVQB 5IGFA 1R4QB 2WKDA 4J6HA 4K6DA 2NYZD 1AEXA 2I46A 2F3WA 3S2HB 1KDBA 4G57A 3MTSA 4HN7A 1HUMA 4X3UA 3U9SA 3OIQA 3KUPA 5C0XG 5BN3A 3WOFA 3GQBA 4C1NK 2F3VA 1T5EA 1QNUA 4NKLA 5J1ZA 2I07B 2KECA 3HP3A 2RDFA 1OXUA 2D9UA 4L8JA 2IPKD 1HHVA 3DEPA 4K8IA 2A6ED 1JOQA 4S3SA 5KIXA 4K8JA 2GA4B 1R4PB 1QNKA 3P1HA 4CJ0B 4KY7A 1BNZA 1STAA 1ILPA 3FVQA 4GZYC 1ET6A 1EEID 2O5IC 5CV9A 1ESRA 4A3IB 4FF4A 1Z6HA 2E74C 1HCZA 1STYA 3J81L 1YNNC 1X3QA 3GP7A 3SK6A 1R9TB 5A2QE 1TS2A 4EGVA 5C3XA 4NW2A 5K5PA 3PO3B 2F0QA 5I9PA 3J80E 4M8AA 1X3PA 4RAUC 1PZJD 3I70A 5KEEA 3X3NA 1O7ZA 2EYPA 4K5XA 2F0FA 1PRTD 2KOLA 5CC4A 4F88A 5C6AA 2VB3X 2CW0C 4DGZA 2B2WC 4OIKA 3MXPA 5C4JB 5CBAE 4RA8A 4OIJA 4ULLA 5EPLA 5COYA 2K03A 5HURA 3TP5A 2L55A 4C3IB 1I3QB 4FO2A 3R3OA 2K7VA 3AU7A 3OWEB 1SYDA 1EZ8A 2FMMA 1TWCB 2RDHA 3D3RA 1IL8A 4N9TA 3K6OA 4R8NA 3S1QB 4XXEA 4XT3B 1CK1A 1W6KA 4HMJA 4G7HC 1B3AA 4X3KA 3T13A 4CGYB 3VA7A 1TS3A 4B08A 1YNJC 3VR3A 1UUPA 1GUSA 1PMRA 2E2HB 3C2PA 1SNCA 1JICA 1EOTA 2OEOA 2NVXB 4RH6A 5E4XA 5M3FB 2WACA 1I6HB 2NB0A 4HMIA 4DAPA 4IUTA 3A54A 1F77A 1CFMA 5KNDA 4RCOA 1I4PA 1WTPA 2F0LA 1ENAA 5M9OA 3OMCA 1QWYA 2H4OA 1ZXTA 1A3UA 1V43A 4TRDA 3T4AC 4CJ2C 3I8ZA 1HRJA 5J22A 4KY6A 2Q8TA 3OPOA 4BBRB 5FLXL 3C3LA 4QUFA 5CV6A 4FNFA 1WTXA 3HGBA 2R93B 4C1NI 3QIAA 1TVXA 5DEHA 1SYCA 1PXUA 4RHRA 3G7LA 3GTQB 2Z1CA 1KLGD 4PV1C 1LT6D 3OHXC 2F0MA 3MZ5A 3AB9A 3QB3A 1HA6A 4HSPA 3PUVA 3M85A 1SAPA 3BG3A 1DYQA 4ZQ3A 3VR4A 1K83B 4XQJA 1U9RA 2NZ1D 4TQUS 3SEBA 1PZKD 3S17B 2EY1A 5I2YA 5D3DA 4XYOA 4ZYSA 1EIGA 3NE5B 3BDOA 2WKCA 1EY0A 4BY1B 3BDCA 1EY8A 1BCPB 2R92B 4A3DB 1EWHA 2F0VA 1F2LA 5CV5A 2JEBI 2F0UA 2PYKA 5ELDA 2K6AA 2F0OA 4ZKCB 1PZID 5D14A 1Y1VB 3OWFA 2K28A 5F2DA 3I91A 1CT1D 4A3BB 5T1IA 3SK8A 3R2TA 2F0JA 2IX3A 3BYTB 5EJWA 1EFID 1I4HA 2IWHA 1ENFA 4LMQD 3H91A 1S5DD 4BBSB 2EY2A 3K7AB 4Y7NB 1GHKA 2B2VC 4FF3A 1ET9A 5I6WA 3NQTA 5IT9L 2AQ2B 2K01A 4IFDG 1OXSC 3CHBD 2KEDA 2OXPA 2RBMA 1EIHA 2HCIA 3IL8A 1RTNA 3HOYB 3URYA 1CQVA 1SE3A 5C3WA 2Z8LA 3DWPA 3NSWA 4PMCA 2XIWA 5T1GA 5BN4A 1GUOA 1LABA 5K36H 1EQTA 3CU7A 5CBEE 2BE5C 2L5TA 2JXMB 5EKIA 1J9OA 3K0YA 4HTHA 4C3JB 4IURA 4ZUIA 1IHZA 3TP7A 2H1EA 5JVH3 1TU2B 1PTOD 3EJIA 2NN6G 1ZEQX 4ZLTF 1JWUD 1Q1BA 4MHEA 2B2TC 1H9RA 1CQFA 3PUWA 3DWAA 1AW7A 4Z9CB 1I4XA 2OT2A 1OXXK 1A2UA 1BBXC 3VR5A 4KHZA 4FXGC 1LTTD 2DY8A 2ENBA 3P75A 2FFKB 2LMCB 4FXKC 4G4KA 5C0XH 3TBIB 2Y0SB 1IKLA 1Q8IA 2KJXA 1IYUA 1SMYD 4KTAA 5DAUA 3K5LA 3PUYA 3MEHA 2A69D 4OO1G 1LTBD 3NXWA 3EVQA 1TT2A 2IT1A 4RHSA 5LL6S 2WP8J 1GHJA 2RSOA 5FKAC 1PRTB 4EQNA 1KAAA 2ZXRA 4DN4M 3Q24A 1B53A 3Q23A 2EE1A 1H9KA 3S1MB 1XX8A 3FDTA 3GTLB 2E2JB 5G3LF 1ML0D 2CW0D 3VA5A 5ELCA 5IGBA 4DXFA 1STHA 2B8FA 1I4GA 2D62A 2AUJD 1G91A 3S15B 1BOSA 1EL0A 1SJED 4P2CB 2ZXPA 3KBXA 3VYRA 2B63B 1T5XD 4O42A 4KJOA 3VR6A 1IW7D 4KKUA 1DCZA 1JOOA 3GO5A 3QOJA 1WD1A 2YYZA 1D5XC 3DWQA 2MJ8A 4KKSA 3D4RA 3QG1A 3HS0C 3PV0A 2HDMA 1AZPA 3HRZC 2JE6I 1RHPA 1EYAA 3JAME 4RCNA 3S1RB 2QEJC 2RA4A 4MN3A 2EJFC 3FRPB 5IGDA 2FJ2A 3NTKA 3GTMB 3MHBA 5EKLA 4LJZC 4ZK9B 3D8GA 1B2TA 1BF4A 1DXMA 1CI3M 1WTRA 4RWSC 2EYFA 3BDLA 5CMDA 3SE0A 1GXDC 3OOCA 1MD2D 1KTKA 2B2VA 5I6YA 3OW7A 3WDNA 1OXVA 5A35A 1ENCA 3X3MA 1S5BD 3TMEA 3HZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKB A;  4ME5 A;  4NMZ A;  1U9R A;  3P1H A;  4HMJ A;  4KY7 A;  1A2T A;  3V2T A;  2PW5 A;  4MIU A;  4J1M A;  3T16 A;  3C1F A;  3NP8 A;  1STA A;  5CV4 A;  3T13 A;  2F0K A;  2SOB A;  2EY1 A;  3OMG A;  1SNQ A;  3VA5 A;  1NSN S;  3H6M A;  3ERO A;  1TQO A;  5IGB A;  3LX0 A;  2EYH A;  1F2M A;  3DHQ A;  1STH A;  3ERQ A;  4N9P A;  3U9O A;  5HGT A;  3S9W A;  1SYF A;  1EY4 A;  2F0D A;  4DF7 A;  3D4W A;  2SNM A;  4EQP A;  1SNM A;  5CV9 A;  1EY9 A;  2EXZ A;  4ODG A;  4WOR A;  4DU9 A;  1SNP A;  4HTH A;  2M00 A;  1SNC A;  2O4X A;  5CGK A;  1SYG A;  5IGE A;  2KHS A;  5IOC A;  1II3 A;  2OEO A;  4ZUI A;  3SHL A;  1IHZ A;  4K14 A;  3TP7 A;  2PZT A;  4DFA A;  2EY6 A;  2PZU A;  1EY0 A;  2SNS A;  1SND A;  1EY5 A;  5C5M A;  3SK4 A;  4KJN A;  3SK5 A;  3C1E A;  3NK9 A;  3SXH A;  2WAC A;  3BDC A;  5EGT A;  1EY8 A;  4HMI A;  1SYB A;  3EJI A;  1STY A;  2PW7 A;  3HEJ A;  4ID6 A;  3SR1 A;  1RKN A;  4H7B A;  4IUN A;  5NUC A;  1A3T A;  1EY6 A;  4KJO A;  1KDC A;  2F0V A;  3D6C A;  4K5V A;  3SK6 A;  2PQE A;  4F7X A;  5CV5 A;  4PMB A;  2F0U A;  4EQO A;  1EQV A;  2PYK A;  2F0L A;  1ENA A;  5IGF A;  5C4H A;  2F0O A;  4K5W A;  5C3X A;  1JOO A;  1EYD A;  4J6H A;  5K5P A;  5M9O A;  1EYC A;  3OMC A;  3OWF A;  2F0Q A;  3OSO A;  3QOJ A;  4K6D A;  4F8M A;  5F2D A;  1AEX A;  3TME A;  5I9P A;  5JAV A;  5ISR A;  2EYJ A;  2F0P A;  2LKV A;  3TP6 A;  4KD3 A;  4RKL A;  2F3W A;  1A2U A;  1KDB A;  3ITP A;  3SK8 A;  5KYL A;  1A3U A;  2F0J A;  4KHV A;  1EY7 A;  3TP8 A;  5IOD A;  5KRU A;  1SYE A;  4G57 A;  4TRD A;  5C5L A;  4QMG A;  4QF4 A;  4B9X A;  4PNY A;  4WRD A;  5KEE A;  3QOL A;  5CR3 A;  1EZ6 A;  1SNO A;  2EYP A;  4K5X A;  2F0S A;  5CV8 A;  1EYA A;  5J22 A;  2F0F A;  5KYI A;  1STB A;  2ENB A;  4KY6 A;  2F0N A;  1STN A;  4KV6 A;  2F0E A;  3P75 A;  4LAA A;  2EY2 A;  2F0T A;  2F0I A;  4NP5 A;  4B9W A;  5J39 A;  1JOR A;  5CC4 A;  5C6A A;  4ZUJ A;  2F3V A;  5CV6 A;  4DGZ A;  1JOK A;  4NKL A;  5IGD A;  5J1Z A;  5E3F A;  4QB4 A;  5CV7 A;  5I6W A;  2EY5 A;  3NQT A;  4E6I A;  3MHB A;  5EKL A;  3MXP A;  3D8G A;  5DEH A;  5C4Z A;  4KTA A;  1A3V A;  5KGU A;  2HQE A;  1SYC A;  2EYL A;  4K2K A;  5DAU A;  5JOB A;  5IIF A;  2RDF A;  3MEH A;  4IZ8 A;  4KD4 A;  1KAB A;  5EKK A;  5I9O A;  1F2Z A;  2EYF A;  2KQ3 A;  3BDL A;  4YIJ A;  3PMF A;  1F2Y A;  2EYM A;  2QDB A;  2RKS A;  3NUC A;  5HUR A;  2F0W A;  2OXP A;  3TP5 A;  5IGG A;  2RBM A;  3DMU A;  1STG A;  3NHH A;  3R3O A;  2OF1 A;  4EVO A;  2EYO A;  2NUC A;  1TR5 A;  3NXW A;  4K8I A;  2F0H A;  3MVV A;  5E1F A;  3EVQ A;  1TT2 A;  2F0M A;  3MZ5 A;  3QB3 A;  1SYD A;  4OL7 A;  1EZ8 A;  2PZW A;  4I65 A;  1JOQ A;  4S3S A;  5KIX A;  4N9T A;  3RUZ A;  4K8J A;  5I6Y A;  4K2L A;  4R8N A;  5C3W A;  4ZQ3 A;  2F0G A;  1ENC A;  1NUC A;  3E5S A;  4IAL A;  1KDA A;  3D4D A;  4PMC A;  4NDX A;  4EQN A;  1KAA A;  3HZX A;  4KY5 A;  5IGC A; 
#chains in the Genus database with same CATH topology
 5JJI A;  4TSS A;  1UAP A;  1HXY D;  2BA0 A;  3CCU A;  1PH4 A;  4IQZ A;  5IE8 A;  4JI6 Q;  1Y1W H;  4CDC C;  1G6P A;  4WJ4 A;  1DOL A;  4B3S L;  3HG9 A;  1X3F A;  3DHQ A;  3M4Y A;  1I6V C;  1PV4 A;  2NVT H;  4DF7 A;  3ZYY X;  5M3M H;  4WOR A;  2TMP A;  2IJ0 A;  1EQR A;  4O2D A;  1BCP C;  1H9M A;  3T1Y Q;  2KHS A;  1II3 A;  3SHL A;  3IFD A;  4L6T B;  1QG7 A;  4JBJ A;  4JG2 A;  2QEX A;  5C5M A;  4HCS A;  3EBE A;  1J6Q A;  1D1K A;  2Q8I B;  1DGS A;  2DY7 A;  5M5X B;  3KFU A;  4CKE A;  3CRK C;  3RZO B;  4LF7 L;  3PO3 G;  3PIP A;  4EQO A;  3GTJ B;  1JMC A;  2O5J C;  2JA8 H;  3KBG A;  1V1P A;  4I7A A;  2XWJ B;  3OSO A;  1B4O A;  3NTI A;  3K58 A;  4IPG A;  1VMP A;  3CC4 A;  3JAM c;  4GOP C;  1V1P B;  1D1I A;  2KEE A;  2VXW A;  4ZAI A;  1CM9 A;  1HTP A;  3O13 A;  3UE0 A;  2AWO A;  5IP9 G;  2K5N A;  4PNY A;  2LFN A;  1O7I A;  3NTH A;  1LTI D;  4UHV A;  5FO8 B;  3TZU A;  4LAA A;  4B9W A;  3DXJ C;  2YV5 A;  1Q12 A;  2B2T A;  1IBK Q;  1HPC A;  5E3F A;  4R4O A;  2ZTC A;  3J81 E;  1JB7 A;  2SDF A;  4IUV A;  2ID0 A;  4GKJ Q;  4R4I A;  4B3T Q;  5I9O A;  1IYV A;  4X6A H;  4ZKB B;  1LV9 A;  1M8A A;  2N55 A;  2F0W A;  2XNA C;  1LT5 D;  3HKZ B;  4JI3 Q;  3HOV B;  1PFS A;  2OF1 A;  3H0G H;  3TDQ A;  2MUY A;  4EVO A;  1HNX Q;  4HR7 B;  1IKM A;  1NJI C;  2F0H A;  2MQH A;  3NWT A;  1PTO H;  2D2C C;  2PMZ E;  5DM6 3;  1X3G A;  2J4X A;  2QIL A;  4XTC S;  3G4S A;  4JW0 A;  2JA9 A;  5IGC A;  1Y69 U;  3S1N B;  1GUN A;  2EZV A;  2JA6 G;  1QJO A;  2PNH A;  2L15 A;  3TRE A;  4IN3 A;  2AWN A;  3CAM A;  2PW5 A;  4DV2 Q;  4J8Q A;  2M9V A;  2R7Z G;  3OMG A;  1J8I A;  1TQO A;  3J7Y W;  3I73 A;  1TWH B;  4HID A;  1G29 1;  3ER0 A;  1TKW B;  3R93 A;  2SNM A;  4EQP A;  1I5F A;  5ELN A;  4A3G B;  4C3H G;  5M3F G;  4A3C G;  4G7Z C;  1YHA A;  2GVB A;  2X6G A;  1QB5 D;  1SND A;  5C44 G;  4LFB L;  5EBD A;  2X6L A;  4V19 0;  4YY3 L;  2K5V A;  3IKJ A;  2IHF A;  4IJH A;  4IUN A;  4DV6 Q;  4NPS A;  1XMQ L;  1CZG A;  4OHJ A;  1GUG A;  1ZYR C;  4A3K H;  2V4D A;  4OEL B;  2E2D C;  2R3Z A;  4A3F B;  3HOW H;  4F87 A;  2ICI A;  4K5W A;  1J5E L;  1LAC A;  4DR4 Q;  4L5Q A;  4CDF C;  2Z4I A;  3UDX A;  2EYJ A;  4L63 B;  4R1J A;  1WTV A;  3J7A 5;  3PO2 B;  1G6Z A;  4KHV A;  5KRU A;  2R7D A;  2RSN A;  4B9X A;  4WRD A;  4YHH L;  1MJE A;  3I72 A;  2F4V Q;  2BE5 D;  3MAQ A;  4NP5 A;  4IFD I;  3I4O A;  2K14 A;  3P7J A;  5ELE A;  3J81 c;  1PFM A;  3K5M A;  2A6H C;  2D5D A;  4O0A A;  2ZM6 Q;  4A3M B;  3HOX B;  4JOI C;  4QB4 A;  1D2B A;  1CTM A;  4AYB E;  2MP1 A;  3Q0A A;  3HOZ G;  2WAQ E;  2K4K A;  2Z6B A;  5C3E B;  5IIF A;  4IFD H;  4DXG A;  3SVM A;  5CYU A;  1HNW Q;  2ES2 A;  1KHI A;  2L12 A;  1YIT A;  4XDX A;  4GLV B;  1VQE A;  1WCM B;  2XVS A;  4ABN A;  1Z47 A;  1AH9 A;  2UUB Q;  4DUZ Q;  5M3M B;  4A3E G;  4RFB A;  2IY5 B;  2YTV A;  3BU2 A;  3MXN A;  5DLQ E;  1JB3 A;  2XN9 C;  2WIN B;  4NMZ A;  3NWS A;  1PYS B;  3W1G A;  1S40 A;  4PZ7 A;  4ILW A;  1BR9 A;  2YU9 H;  1PH3 A;  3MXN B;  4J1M A;  1M4V A;  4P74 A;  4BWG B;  5FLX E;  2CWA A;  2SOB A;  3QO2 A;  4BA1 I;  1L0Y B;  1NSN S;  4JI4 Q;  3ERO A;  2EYH A;  4K6L A;  3H3V H;  3S14 H;  2NN6 I;  4ODG A;  2EXZ A;  2P5Z X;  2JA8 B;  2A6E C;  5JEA G;  1SYG A;  4A3D G;  1E3P A;  2VUM H;  4JI6 L;  4BY7 G;  3SXH A;  5JJL A;  5EGT A;  4IUU A;  2MPM A;  3HEJ A;  3PSI A;  4TVA B;  2CQO A;  3KLW A;  2NN6 H;  4R8I A;  4K5V A;  1L1O C;  1TWG H;  1GOZ A;  1JWM D;  3IFT A;  2JA5 H;  1TS4 A;  2JSO A;  3T1Y L;  1FGU A;  2Q2T A;  1K3R A;  1I50 B;  4NXM Q;  2B8G A;  3UI2 A;  2Q2U A;  4RKL A;  4UP8 A;  3JAM i;  1EY7 A;  3TP8 A;  4BBS G;  2QKI C;  3GV3 A;  2XRS D;  1KLU D;  5IYB H;  1AFP A;  2Q2I A;  1A15 A;  5ELF A;  2A68 D;  2F0S A;  5CV8 A;  1PVO A;  5COR A;  2WB1 B;  3T53 B;  1JJG A;  4PZ8 A;  4LFA Q;  3S2D H;  5JPN C;  2IX0 A;  5DNF A;  4X64 Q;  4IFD J;  2BCO A;  2ZT9 C;  3H0G B;  3GTP H;  1VF5 C;  4WJW A;  4R9W A;  1PTO B;  4JBM A;  3CQZ H;  2K04 A;  3H09 A;  4OO1 I;  2LSS A;  1STE A;  3FEW X;  2HQE A;  3MWY W;  3HOU H;  4RG1 A;  1F9Q A;  4BXX G;  1F2Z A;  2PI2 A;  1IBK L;  2RKS A;  4DR3 Q;  3GTO H;  1SR3 A;  4JYA Q;  2EJM A;  4CBV A;  1Q1E A;  1F9S A;  1QZG A;  3DUZ A;  1BUV T;  4EX5 A;  3M3Y B;  4OO1 H;  1TR5 A;  3MVV A;  5E1F A;  1PRT C;  2VQE L;  4LWC A;  3I4M H;  1LTL A;  4GKJ L;  1E2Z A;  4B3T L;  3STB D;  3A56 A;  5JVG 3;  3RZD H;  3CPF A;  4LF4 Q;  5FLX c;  1SBB B;  3I4N G;  4OXP A;  1LO5 D;  4GN4 B;  5M5Y H;  3B6Y A;  4ME5 A;  4JI3 L;  1QOH A;  1HNX L;  1NAP A;  2K1B A;  1Q81 C;  4OON A;  2F03 A;  5I2X A;  3HFZ B;  4A75 A;  2DJF C;  3Q22 A;  2CQA A;  1QUQ A;  3EFX D;  5IT9 E;  5H1S E;  3I56 A;  3D4W A;  4RMF A;  2KA7 A;  2AKW B;  3HOW B;  1W6J A;  4CHT B;  1EWC A;  1QUQ B;  2FXQ A;  3BZK A;  1Z7T A;  4JI1 Q;  4DV2 L;  3K80 C;  4B3S Q;  2PZU A;  4U68 A;  3TZD A;  1PDQ A;  3CCJ A;  1WD0 A;  1SYB A;  2RCN A;  2K52 A;  1SFO H;  5NUC A;  3CP0 A;  1A3T A;  2E76 C;  3J81 j;  4WFN 3;  3SDZ A;  1LT3 D;  3LNN A;  4IPC A;  1IYJ B;  1XWE A;  3KF8 A;  5IGE A;  5KGU A;  1VQ5 A;  1GUT A;  5IYC H;  4F8M A;  4JI5 Q;  4DV6 L;  1VMC A;  3KF8 B;  1K0R A;  1SYE A;  5C5L A;  3FKI H;  1YJN A;  4CDD C;  1HFG A;  2K50 A;  3BVZ A;  4DR4 L;  2K75 A;  3F1Z A;  1STB A;  2F1M A;  4APV A;  1LLR D;  2Y0S G;  3ND8 A;  4N8F A;  2UUC Q;  2F0T A;  4XQN A;  2FMC A;  4ZUJ A;  2E8G A;  1N34 Q;  1PFN A;  1QCB D;  3UDI A;  1MI2 A;  3K59 A;  2HDL A;  3DM3 A;  1G2S A;  4MTN A;  2F4V L;  2AUK A;  2DNC A;  1BCP F;  3BS1 A;  3ULL A;  3D6W A;  1KAB A;  1MIU A;  4FVM A;  4DK1 A;  3KJP A;  3CCS A;  2EYM A;  1Q3L A;  2XWB B;  5M5W H;  5IGG A;  1VQ7 A;  2YU9 B;  2ZM6 L;  1UEA B;  1TII D;  3NHH A;  1E1O A;  1JT8 A;  3GDE A;  1KRT A;  4DNR B;  1D7Q A;  3UDF A;  5JJK A;  4FP5 D;  1YJW A;  2F0G A;  1N8R C;  1XJV A;  1NUC A;  1SRU A;  2BA1 A;  4OWT B;  4EQ5 A;  1HNW L;  4JOI A;  3P20 A;  2WV6 D;  3GTK B;  1YNN D;  3PIO 3;  1Y8O B;  3V2T A;  4MIU A;  3T51 B;  2UUB L;  3R8B A;  2B3G A;  1SNQ A;  4DUZ L;  1MGS A;  4FDB A;  4X62 Q;  1Q90 A;  3V05 A;  2PPB C;  4BS9 A;  1Y8P B;  4YWK A;  4WJ3 M;  1EY4 A;  3EQL C;  4HJ5 A;  1BDO A;  5LHY 1;  1SNM A;  1P16 A;  2O4X A;  3SGI A;  2B63 G;  2XRQ D;  2CWP A;  4DV1 Q;  3K5N A;  4DFA A;  3N52 A;  5G3L D;  3ND9 A;  2JA7 B;  4JI4 L;  1I94 Q;  4MNO A;  1ASY A;  3S16 B;  1RKN A;  1HTL D;  1CUK A;  2QGQ A;  3NBI A;  4HCE A;  1JE4 A;  3PO3 H;  2NTS A;  3F2D A;  1EQV A;  2PO4 A;  2RF4 A;  2Z0S A;  2O2L D;  2BOS A;  1U0L A;  2ALY B;  1EYC A;  2QW7 A;  2MO1 A;  1BBW A;  2OTL A;  3CPW A;  1OTC A;  1K28 A;  1O78 A;  2NTT A;  3S24 A;  5EPK A;  4DR6 Q;  1C7Y A;  4QMG A;  5FOB B;  3FPP A;  2PMZ B;  1KXL A;  3HOU B;  5EQ0 A;  5CR3 A;  3K7U C;  5IP9 H;  3C46 A;  3RMH A;  2E5L Q;  2Q2H A;  1HZB A;  2AQ3 B;  4NXM L;  2F0E A;  3GTO B;  5J39 A;  1KQS A;  4JPB W;  1LTS D;  3OYY A;  4Y52 H;  2KCC A;  3LWE A;  5LMN Q;  3IRB A;  1VQK A;  2A74 C;  3A55 A;  5CV7 A;  4JV5 Q;  3T56 B;  3DM1 A;  3CRL C;  2B29 A;  1UE6 A;  3ONA B;  3RZD B;  1ILQ A;  2EYL A;  2RQX A;  1JCK B;  2K5W A;  5M5Y B;  1FVI A;  2AHO B;  1H9S A;  4HAE A;  4X64 L;  1AE3 A;  1YNJ D;  3A8I E;  1E1T A;  2L0C A;  2VQF Q;  1DOM A;  1LYL A;  1TWC H;  1H9S B;  2EXD A;  1TY0 A;  1NMG A;  3M7G A;  1PH8 A;  1DZ1 A;  4I65 A;  3KYH C;  1IBM Q;  2WFW A;  2B2Y C;  3KLR A;  3S1Q H;  3RUZ A;  1K8O A;  1JJC B;  3J7A V;  4CJ1 B;  3Q6S A;  1VQ8 A;  4DR3 L;  1VQP A;  2PQA A;  4JYA L;  1SXT A;  2JP1 A;  1BKB A;  2JA6 H;  3UDG A;  2R6G A;  1CHQ D;  2PQA B;  3NP8 A;  1VQG A;  1V1O A;  2IHE A;  1SFO B;  1C0A A;  3GV6 A;  4KHP Q;  2R7Z H;  4LF4 L;  3M4O B;  3N6R A;  4GLX A;  2E2H H;  2G5D A;  2F0D A;  2AMC B;  4YCU A;  4DU9 A;  1SNP A;  4I7Z C;  2RVL A;  3VDY A;  4C3H H;  5M3F H;  4A3C H;  2K5Q A;  1Q86 C;  2KHI A;  5C44 H;  4A93 B;  3E9I A;  4X3S A;  1S5F D;  3SR1 A;  1Q82 C;  3FKI B;  3NEN A;  2A73 B;  4QIW E;  3MFG A;  4AYB B;  1A8V A;  2BDO A;  4N8X 1;  2WAQ B;  4NXN Q;  4JI1 L;  1YZ6 A;  2L4N A;  1N32 Q;  4A3I G;  4QUC A;  4ZRZ A;  2EJG C;  1OO9 B;  2F4I A;  2EIF A;  4DAV A;  3NEL A;  4UP9 A;  3GTG H;  3LWU A;  4KK7 A;  3PGZ A;  3TRZ A;  5IOD A;  1HFN A;  1EEF D;  1CKM A;  5BN5 A;  3DLL A;  3I90 A;  1KIX A;  2UXB Q;  2X69 A;  1SLJ A;  1PTO C;  4JI5 L;  2ZJP A;  3W2D A;  1JOR A;  5M5W B;  1Y8N B;  4RGO S;  2Q8R E;  2N49 A;  5I4D A;  3KLS A;  1CA6 A;  2CH4 W;  1B7Y B;  2RHQ B;  5ELO A;  3VYS A;  4IUQ A;  2GN5 A;  1IL2 A;  4KKT A;  1D5M C;  3I4L A;  1EYG A;  1NY4 A;  3HOZ H;  2A19 A;  2UUC L;  1DD2 A;  2VB2 X;  3TSS A;  3MFY A;  4YIJ A;  1K9M C;  3CC7 A;  1F2Y A;  1TWA B;  1WFQ A;  1N34 L;  2PCF B;  3AYH B;  4C2M H;  3KJO A;  2NUC A;  1A0I A;  4X3T A;  5A2Q L;  1BVS A;  2N78 A;  2C9O A;  3M7N A;  1NTG A;  2J0T D;  3E5S A;  4IAL A;  1B9M A;  3D4D A;  4A3E H;  4PQX A;  3TN2 A;  1G2T A;  4DKA C;  2VQE Q;  3J80 L;  1HQM C;  3S17 H;  1O7Y A;  1SMY C;  1CSP A;  1VDZ A;  3RLN A;  4C3I G;  1WTO A;  2LS0 1;  1LTG D;  1XTD A;  1A6X A;  2K32 A;  2KCN A;  1Q7Y C;  1B8A A;  1CZW A;  1B44 D;  3H6M A;  4A3G G;  4GLA C;  2A69 C;  1F2M A;  3ERQ A;  1I4Q A;  5HGT A;  4A3J B;  1VQA A;  4O1N A;  1XMO Q;  1DOK A;  2CCZ A;  4DA2 A;  1WTW A;  4FF2 A;  2VL6 A;  5IOC A;  1QVF A;  5JEA H;  1S5E D;  1NE3 A;  2EY6 A;  3KOJ A;  4GKK Q;  4A3D H;  4X62 L;  4BY7 H;  4KI0 A;  2B2U A;  1CKN A;  3ERS X;  4A3F G;  3L7Z C;  1C8C A;  1KDC A;  1EFW A;  4F7X A;  2BH2 A;  4HSV A;  1CKN B;  1B9N A;  4DV1 L;  1QVG A;  1FYC A;  5C4H A;  3RR5 A;  3PO2 G;  4UAI A;  3MXG A;  1I94 L;  1PRT F;  2ICE C;  5JAV A;  1B1Z A;  3VYU A;  1E0B A;  1FD7 D;  2C5C A;  3ITP A;  1FNW A;  3BZC A;  4CKB A;  5KYL A;  4MZ9 A;  2I0Q A;  2ZJQ A;  1YNX A;  3UE1 A;  3E6Z X;  3OIP A;  1KNE A;  1XXG A;  1M90 C;  4BBS H;  1A63 A;  4Y7N H;  1SNO A;  2XGT A;  3R2I A;  3F2U A;  1STN A;  4KV6 A;  1HA5 A;  1FR3 A;  5C4X B;  1NR4 A;  1I4R A;  1FGB D;  4DUY Q;  3QJY A;  1IW7 C;  5JJZ A;  4DR6 L;  1KRS A;  2NVY B;  2ZTD A;  1B3Q A;  1TY2 A;  3AEV A;  5C3E G;  2EY5 A;  4E6I A;  2A5H A;  3VYT A;  2B39 A;  2M2L A;  4UP7 A;  2E5L L;  2UXC Q;  2R7F A;  3RLF A;  4IUP A;  1DON A;  1WCM G;  4NB3 A;  4RGM A;  4DK3 C;  2Z4H A;  4CKC A;  4BXX H;  5LMN L;  2JA6 B;  4BBR G;  3BJU A;  3H3V C;  1ESF A;  1STG A;  2E2I H;  4JV5 L;  1WYD A;  2R93 G;  1U5K A;  2R7Z B;  2DNE A;  5FO7 B;  3PF5 A;  1W2B A;  4DV4 Q;  1D5Z C;  2ZTE A;  4DR2 Q;  1KDA A;  3A8K E;  3I4N H;  2VQF L;  1HQR D;  4Q5V A;  1X54 A;  4H13 C;  4C3H B;  1VQC A;  3A7L A;  1ICW A;  2UU9 Q;  1RDP D;  1U4M A;  4RGT A;  2PNR C;  5C44 B;  1SJH D;  5CV4 A;  3K57 A;  3CCQ A;  1IBM L;  1GUW A;  4XQQ A;  4A3L G;  5JEA J;  2CHB D;  5LL6 X;  3FMC A;  1Y1W B;  1E2W A;  1A62 A;  1C48 A;  1VQM A;  1QIL A;  1S5C D;  3MXU A;  1EY9 A;  1JR0 D;  2NVT B;  3L3O C;  2L9H A;  1RF2 D;  2B2Y A;  3G6J B;  3CCL A;  2K5D A;  3FPU B;  4K14 A;  4YWL A;  4H44 C;  3GTG B;  3SK5 A;  4KHP L;  5BR8 Q;  1PFB A;  2BH8 A;  5ELB A;  2JEA I;  2PW7 A;  5AFW A;  1RD9 D;  1PLF A;  1Q46 A;  2LY7 A;  4DNT B;  1EY6 A;  3L2P A;  4JI0 Q;  1C4Q A;  5D65 A;  3A5U A;  1NBW A;  4PMB A;  5EBC A;  4JK1 C;  2VNU D;  4HIK A;  1PYB A;  1EYD A;  5ISR A;  3EA6 A;  2OCE A;  2KEN A;  4BY1 G;  4POG A;  3TP6 A;  2L11 A;  4KD3 A;  4X65 Q;  1LM0 A;  2R92 G;  1TS5 A;  2RDG A;  1RIP A;  4NXN L;  3PF4 A;  1K8M A;  3HOZ B;  4QJF A;  1N32 L;  1DJR D;  3MEF A;  1O7L A;  1EZ6 A;  3I3C A;  2NBF A;  4LUZ A;  1EU4 A;  1O80 A;  3H94 A;  1Y1V G;  3KDF B;  3OW2 A;  1ROD A;  3K8A A;  2GVA A;  2F3I A;  4C2M B;  3GD7 A;  3DEO A;  2KHJ A;  2MGS A;  1XPR A;  4A3B G;  3CF5 A;  4FF1 A;  1KL9 A;  1JOK A;  2J7Z A;  3AFQ A;  4XT1 B;  1EU3 A;  4JI7 Q;  3BVG A;  2UXB L;  1OXT A;  2MNA A;  1QE6 A;  5C4Z A;  4DK0 A;  1TWF H;  3NPP A;  4YWM A;  4AH6 A;  4C56 C;  1ZKO A;  3D31 A;  4K2K A;  5JOB A;  4DAY A;  4A3E B;  1VQF A;  4IZ8 A;  1BO0 A;  1S3O A;  5EKK A;  2KQ3 A;  3T1H Q;  2JYO A;  3NUC A;  4L5S A;  4P75 A;  3PIP 3;  3DMU A;  4DAY B;  3G48 A;  4HIO A;  2ZXO A;  2EYO A;  1FL0 A;  1MHW C;  1VS0 A;  4R4T A;  1BQQ T;  1U4P A;  3K0X A;  5GAG C;  2HIX A;  1KC8 C;  5IYD G;  1U4R A;  1YIJ A;  3W3A A;  3S1M H;  3KF6 A;  3D0F A;  2E2J H;  4Q0F A;  1A2T A;  4BY7 B;  3C1F A;  1F9P A;  4PMW A;  3KF6 B;  4FXD A;  1SRO A;  1L0X B;  1VQO A;  3HOY G;  2OQK A;  2AQ1 B;  2NZO A;  1XYI A;  2N8N A;  1SMX A;  4DR1 Q;  2M00 A;  2B63 H;  4QCL A;  4UDU C;  1U4L A;  4LK1 C;  2PZT A;  1FNV A;  2G9D A;  1CSQ A;  1UE1 A;  4ID6 A;  1XMO L;  3RN2 A;  2EDG A;  3D6C A;  3QWN A;  3BYY B;  3LGJ A;  3K81 C;  3W1B A;  4C3J G;  2KCM A;  4B3R Q;  4UPA A;  4GKK L;  4A3K B;  1C9O A;  1E2V A;  4LF8 Q;  5FJ8 G;  4HJ9 A;  2OTJ A;  4XYQ A;  1B70 B;  2F0P A;  2LKV A;  1SE4 A;  1V8Q A;  1PHJ A;  1LUZ A;  3CMA A;  4LFC Q;  4QF4 A;  3S1R H;  1K3B C;  1G8Z D;  2I5L X;  4OEM B;  4HJA A;  1S4Z A;  3CCM A;  3CKI B;  2F0N A;  2NVQ H;  2E2I B;  2IL8 A;  4KMU C;  5DM7 3;  2DGY A;  1E7Z A;  3S2H H;  4M1U B;  2B2W A;  2LXK A;  4IPD A;  1HZC A;  4G7O C;  1A3V A;  2Z6K C;  1JWS D;  3E0E A;  2EPB A;  1JC7 A;  2FHT A;  2I5H A;  3I4N B;  1SEB D;  2DUD A;  1LTA D;  4KD4 A;  2L1B A;  4DUY L;  1MSH A;  1ICF B;  2QDB A;  2UXD Q;  2SEB D;  2KBN A;  1AZQ A;  1EIF A;  4KN4 C;  1L2F A;  1Y14 B;  2Z9H A;  1MSG A;  4DV0 Q;  1BCP D;  4OL7 A;  2UXC L;  2PZW A;  1CHP D;  4LUV A;  2DN8 A;  1LT4 D;  2MHV A;  5TSS A;  5JPM C;  5KNC A;  4U67 3;  4QIW B;  1ONL A;  4NDX A;  1KNA A;  4RKB A;  4H0L C;  1RJT A;  5LMN W;  3A7A B;  4P71 A;  1LTR D;  1MBY A;  4GN3 B;  1JQY D;  2IW3 A;  3WOE A;  1HUN A;  3H15 A;  4X66 Q;  4DV4 L;  1PYW D;  4GN5 A;  3PQI A;  3NQI A;  4DR2 L;  3LX0 A;  2EOT A;  1PTO F;  2N88 A;  1SYF A;  4AIM A;  1VQ4 A;  4RGN A;  1N33 Q;  3M9B A;  2QCP X;  2JA7 G;  3KLS X;  2E75 C;  1WVL A;  5CGK A;  3AMU A;  4R4C A;  2UU9 L;  3S14 B;  1BXT A;  4DV3 Q;  3SK4 A;  4V0B A;  5C0X I;  2B2U C;  2A1A A;  3C1E A;  3NK9 A;  3RZO H;  1CA5 A;  2NWG A;  2CVR A;  1NCV A;  3G6E A;  3J7A F;  3V96 A;  2VUM B;  1YEZ A;  2R61 A;  3I2Z A;  3PUX A;  3GTJ H;  1WTQ A;  5E4W C;  1M1K C;  2PQE A;  4HED A;  3E3X A;  1NR2 A;  3MC0 B;  1TWG B;  4DR5 Q;  2JA5 B;  3A8J E;  4A3I H;  2DJG C;  1RTO A;  3L9A X;  5BR8 L;  4BA2 I;  1YVC A;  1FJG Q;  4QL5 A;  1V9P A;  4JI0 L;  4DNI A;  2EVB A;  5IY0 A;  1TWF B;  2IX1 A;  3VR2 A;  3QOL A;  1L0W A;  1R9T H;  1GKH A;  1SSO A;  5KYI A;  2WII B;  1HNZ L;  1WI5 A;  1X3E A;  2F0I A;  5FO9 B;  3F2C A;  3NBH A;  4X65 L;  3E0J A;  1K8A C;  3U4V A;  3Q8D A;  3G71 A;  1PA6 A;  4LF5 Q;  3S2D B;  1V1Q A;  4FYD A;  2BDN A;  3NBH B;  3GTP B;  2KVM A;  2G9H D;  3RD4 A;  1VQH A;  3CQZ B;  4TKO B;  1EQQ A;  1SE2 A;  2JJQ A;  3PMF A;  2K33 A;  3A0J A;  2KUM A;  1GJX A;  1D6E C;  1YHB A;  1RCV D;  4JI7 L;  2A68 C;  1AN8 A;  4J15 A;  2K05 A;  3U58 A;  2QF7 A;  2TSS A;  3W5O A;  1DM0 B;  3MA2 B;  5C4J H;  4DK6 C;  3K5O A;  4K2L A;  1E22 A;  4DV5 Q;  3T1H L;  5KNB A;  3I4M B;  3WWV A;  1EY5 A;  3M4P A;  4KY5 A;  3BZD B;  5K36 G;  4XIG S;  4OGQ C;  1ZYR D;  3T16 A;  4C3I H;  1I3Q H;  1FNU A;  1X32 A;  2F0K A;  1F9R A;  1TWH H;  3BVM A;  3IAY A;  1UNS A;  3KK7 A;  4LF6 Q;  5EPJ A;  2YTY A;  3U9O A;  4KN7 C;  4N9P A;  1GO3 E;  4JVZ A;  5AJ3 Q;  4JBW A;  3S9W A;  4A3G H;  2XSC A;  3JAM L;  5FK9 C;  1BBU A;  2OQ0 A;  4AQY Q;  1XTC D;  4A93 G;  2HCC A;  2SNS A;  5D3I B;  3STB C;  4KJN A;  2FIN B;  2HUG A;  1B50 A;  2ZJR A;  5C0X J;  1VCI A;  5IWA Q;  4H7B A;  4A3F H;  1VF7 A;  1AP0 A;  4DR1 L;  1SDF A;  5HGQ A;  3PUZ A;  2A6H D;  1H9J A;  2NVQ B;  5IGF A;  1R4Q B;  2WKD A;  3EN2 A;  4J6H A;  4K6D A;  2NYZ D;  4LNQ A;  3PO2 H;  2YTX A;  1AEX A;  2NVX H;  2I46 A;  2F3W A;  3S2H B;  1KDB A;  2EQS A;  1I6H H;  5FLM G;  4G57 A;  5IP7 G;  4JI8 Q;  4B3R L;  1H95 A;  3MTS A;  4HN7 A;  4LF8 L;  1HUM A;  2F52 A;  4X3U A;  3U9S A;  3OIQ A;  3KUP A;  5C0X G;  3WOF A;  5BN3 A;  3GQB A;  2F3V A;  1T5E A;  1SN8 A;  4C1N K;  1QNU A;  1PH7 A;  4LFC L;  4NKL A;  5J1Z A;  1VQ6 A;  5C3E H;  2I07 B;  2HQL A;  2KEC A;  3HP3 A;  4P73 A;  2K5H A;  2RDF A;  5GAH C;  4JBK A;  1OXU A;  2D9U A;  4L8J A;  1WCM H;  2IPK D;  1HHV A;  3DEP A;  4BBR H;  1T9H A;  3AFP A;  4K8I A;  1YI2 A;  2A6E D;  2R93 H;  1JOQ A;  4S3S A;  5KIX A;  4K8J A;  2D0P A;  1N36 Q;  2GA4 B;  4K0K L;  1R4P B;  2UXD L;  2HHH Q;  1QNK A;  3P1H A;  4B3M Q;  2D0O A;  4PG3 A;  2Z6K A;  3HKZ G;  3CC2 A;  3GTQ H;  3HOV G;  4CJ0 B;  2Y0S E;  4DV0 L;  4KY7 A;  4A3J G;  1BNZ A;  1STA A;  1ILP A;  3FVQ A;  4GZY C;  3RN5 A;  4A3L H;  1ET6 A;  1VQI A;  1S72 A;  1EEI D;  2O5I C;  2ASB A;  5CV9 A;  1ESR A;  5LMU Q;  4GNX A;  1K83 H;  4A3I B;  4FF4 A;  4X66 L;  1Z6H A;  5HY6 A;  2MO0 A;  4GNX B;  4LF9 Q;  2E74 C;  1HCZ A;  1JE5 A;  1STY A;  3J81 L;  1YNN C;  1X3Q A;  3GP7 A;  1N33 L;  3SK6 A;  1R9T B;  5A2Q E;  1TS2 A;  4EGV A;  1VQL A;  4DV3 L;  1I50 H;  5C3X A;  4NW2 A;  5K5P A;  3PO3 B;  2F0Q A;  5I9P A;  3J80 E;  4M8A A;  2UUA Q;  4BY1 H;  4OWW B;  1X3P A;  2R92 H;  4RAU C;  1VQ9 A;  1PZJ D;  5C4X G;  4DV7 Q;  3I70 A;  4DR5 L;  3X3N A;  5KEE A;  1O7Z A;  2EYP A;  4K5X A;  2F0F A;  1PRT D;  3CCE A;  1FJG L;  4IJL A;  1Y1V H;  2KOL A;  5CC4 A;  4F88 A;  5C6A A;  1EWI A;  2VB3 X;  3CCV A;  3NEM A;  2CW0 C;  3TS2 A;  4MTK A;  4DGZ A;  2B2W C;  4A3B H;  4ALP A;  4OIK A;  3MXP A;  5C4J B;  1YJ9 A;  5CBA E;  1IBL Q;  1HR0 W;  2JQO A;  4IO9 A;  4OWX B;  4RA8 A;  4OIJ A;  4ULL A;  5EPL A;  3M3Y H;  5COY A;  2K03 A;  3RNU A;  5HUR A;  1HH2 P;  3K7A H;  3TP5 A;  4LF5 L;  1G51 A;  3CD6 A;  2L55 A;  4C3I B;  1I3Q B;  4FO2 A;  3R3O A;  3HOX G;  2K7V A;  4A3M G;  3AU7 A;  2H5X A;  3OWE B;  4JI2 Q;  1SYD A;  1K8G A;  1EZ8 A;  2FMM A;  3I55 A;  1TWC B;  2RDH A;  3D3R A;  1IL8 A;  4HJ7 A;  4N9T A;  3K6O A;  2VY3 A;  4R8N A;  4DR7 Q;  3S1Q B;  4XXE A;  4XT3 B;  3FP9 A;  5IYD H;  1X55 A;  4POF A;  1CK1 A;  1W6K A;  4HMJ A;  4G7H C;  1B3A A;  4X3K A;  1Y1W G;  3T13 A;  4CGY B;  5J3B A;  3VA7 A;  1YBY A;  2RCF A;  1TS3 A;  4B08 A;  4JCV E;  1YNJ C;  4DV5 L;  3HOY H;  3VR3 A;  3ZJY C;  5M3M G;  1UUP A;  1GUS A;  2LXJ A;  4QQB X;  4DPG A;  1PMR A;  2E2H B;  3C2P A;  1SNC A;  1JIC A;  2ATW A;  1EOT A;  2OEO A;  1XNQ Q;  2NVX B;  2MFI A;  4RH6 A;  4LF6 L;  5E4X A;  5M3F B;  2WAC A;  1I6H B;  2NB0 A;  4HMI A;  1XNR Q;  5AJ3 L;  4DAP A;  2XTI A;  4IUT A;  3A54 A;  1F77 A;  4AQY L;  3J80 c;  1CFM A;  5KND A;  4RCO A;  1I4P A;  2JA8 G;  4A76 A;  1WTP A;  2F0L A;  1IXR A;  1ENA A;  3CW2 C;  4C3J H;  5M9O A;  3OMC A;  1QWY A;  3TQY A;  2H4O A;  5FJ8 H;  1ZXT A;  5IWA L;  2CH4 A;  4A4I A;  1PH5 A;  1A3U A;  1V43 A;  4TRD A;  3T4A C;  4CJ2 C;  3I8Z A;  4P72 A;  3PIO A;  3CME A;  1HRJ A;  5J22 A;  4ME3 A;  4KY6 A;  2Q8T A;  1HR0 Q;  3OPO A;  4BBR B;  5FLX L;  3C3L A;  5L37 A;  4GS3 A;  4QUF A;  5CV6 A;  4FNF A;  1WTX A;  3HGB A;  2R93 B;  4JI8 L;  4C1N I;  3HKS A;  3QIA A;  1TVX A;  1HNZ Q;  5DEH A;  3H3V I;  1SYC A;  2WB1 G;  1PXU A;  3KDF A;  4IOA A;  4RHR A;  3G7L A;  3GTQ B;  3H0G G;  1VQJ A;  2CFM A;  1KD1 C;  4R4Q A;  2Z1C A;  1KLG D;  3OHX C;  1LT6 D;  3E9H A;  2F0M A;  3MZ5 A;  3AB9 A;  3QB3 A;  4PV1 C;  1HA6 A;  1VQB A;  4HSP A;  3PUV A;  2NZH A;  3M85 A;  3GTK H;  1SAP A;  3BG3 A;  1DYQ A;  4ZQ3 A;  3VR4 A;  1KAW A;  1K83 B;  4XQJ A;  4LW1 A;  1U9R A;  1K73 C;  2NZ1 D;  4TQU S;  3SEB A;  5GRO A;  1RL2 A;  1PZK D;  3S17 B;  2EY1 A;  5I2Y A;  5D3D A;  4XYO A;  1N36 L;  4ZYS A;  2HHH L;  1EIG A;  3NE5 B;  1D8L A;  1XPO A;  1VQN A;  4B3M L;  3BDO A;  2JA7 H;  3HKZ E;  2WKC A;  3U4Z A;  1EY0 A;  3A74 A;  4L5T A;  3S16 H;  1UWV A;  4BY1 B;  3BDC A;  1EY8 A;  3GTL H;  1BCP B;  2R92 B;  4A3D B;  1EWH A;  5LMU L;  2F0V A;  4A3K G;  1F2L A;  3CCR A;  4PZ6 A;  1P8L A;  3U50 C;  5CV5 A;  2JEB I;  1X6O A;  2F0U A;  3HOW G;  2VS1 A;  2I5M X;  2PYK A;  5ELD A;  3S15 H;  2K6A A;  2F0O A;  4ZKC B;  1PZI D;  3OTO Q;  1PH1 A;  5D14 A;  1Y1V B;  3OWF A;  4LF9 L;  2K28 A;  5F2D A;  3I91 A;  1HJP A;  1CT1 D;  4A3B B;  5T1I A;  2RHS B;  1X56 A;  3SK8 A;  3R2T A;  4OX9 Q;  2F0J A;  2N3S A;  4GOP A;  2IX3 A;  3BYT B;  1PH9 A;  4YCW A;  1X65 A;  5EJW A;  1EFI D;  1I4H A;  2A8V A;  2IWH A;  1ENF A;  1SE8 A;  4LMQ D;  3H91 A;  4GOP B;  1PH2 A;  1S5D D;  4BBS B;  1HZ9 A;  2EY2 A;  3K7A B;  4Y7N B;  2UUA L;  1GHK A;  2VZA A;  2B2V C;  4H02 A;  4FF3 A;  1ET9 A;  5I6W A;  1QZH A;  3CXC A;  3NQT A;  4DV7 L;  5IT9 L;  2AQ2 B;  3ULJ A;  2K01 A;  4IFD G;  1GD7 A;  1OXS C;  3CHB D;  1NMF A;  3TS0 A;  2JN4 A;  1WOC A;  2KED A;  1UEB A;  2OXP A;  4CDE C;  2RBM A;  3ICE A;  1IBL L;  1EIH A;  2HCI A;  3IL8 A;  1RTN A;  3GTM H;  4IOC A;  3HOY B;  3URY A;  1CQV A;  3RLO A;  1EOV A;  1SE3 A;  5C3W A;  2Z8L A;  3DWP A;  3NSW A;  4PMC A;  1XPU A;  2XIW A;  2CKZ B;  5T1G A;  3FHW A;  5BN4 A;  1GUO A;  1LAB A;  5K36 H;  1EQT A;  4JI2 L;  3M4O H;  4K0K Q;  3CU7 A;  4DR7 L;  2OWO A;  5CBE E;  2BE5 C;  4GNX C;  3A5Z B;  2L5T A;  2JXM B;  5EKI A;  4LF7 Q;  1J9O A;  3JC6 6;  3K0Y A;  4HTH A;  4C3J B;  1PH6 A;  2VUM G;  4IUR A;  4ZUI A;  4A93 H;  1IHZ A;  1IZ6 A;  3TP7 A;  2H1E A;  5JVH 3;  1TU2 B;  1PTO D;  5E7N A;  3EJI A;  2NN6 G;  1ZEQ X;  4ZLT F;  1JWU D;  1Q1B A;  4MHE A;  2JA5 G;  2B2T C;  3J80 i;  4HJ8 A;  3EIV A;  1XNQ L;  1H9R A;  3J81 i;  1CQF A;  1ASZ A;  3PUW A;  3DWA A;  1AW7 A;  4Z9C B;  1I4X A;  2QA4 A;  2OT2 A;  4HIM A;  1OXX K;  1XNR L;  1VQD A;  1Z9F A;  1A2U A;  1BBX C;  3VR5 A;  2JK8 A;  5IYB G;  5FLM H;  5M5X H;  4KHZ A;  5IP7 H;  4FXG C;  1LTT D;  2DY8 A;  1N9W A;  2ENB A;  2HT1 A;  1Q8K A;  3P75 A;  4QGU A;  2FFK B;  2LMC B;  4FXK C;  4G4K A;  5C0X H;  3TBI B;  2Y0S B;  1IKL A;  1Q8I A;  1UE7 A;  3J7Z C;  2KJX A;  1IYU A;  4KLK A;  1SMY D;  3HOU G;  4KTA A;  2C35 B;  4ZCK A;  1TWA H;  5DAU A;  3K5L A;  1K0S A;  3PUY A;  5IT9 c;  3MEH A;  1X9N A;  1HR0 L;  1UE5 A;  2V1C C;  1EIY B;  2A69 D;  4QY7 A;  4OO1 G;  1LTB D;  3NXW A;  3EVQ A;  1TT2 A;  2IT1 A;  4RHS A;  5LL6 S;  5EAY A;  2WP8 J;  3I4M G;  1GHJ A;  2RSO A;  5FKA C;  2WB1 E;  1NNX A;  1PRT B;  1GM5 A;  2KCT A;  4EQN A;  1KAA A;  1WTH A;  2ZXR A;  1JJ2 A;  4DN4 M;  1E24 A;  3Q24 A;  1B53 A;  3Q23 A;  1YHQ A;  2EE1 A;  3QR8 A;  1H9K A;  3S1M B;  1XX8 A;  3FDT A;  3HOV H;  1MKH A;  3GTL B;  4A3J H;  3AQQ A;  4LFB Q;  5G3L F;  1ML0 D;  2E2J B;  2CW0 D;  3VA5 A;  5ELC A;  3PCO B;  4IPH A;  5IGB A;  4DXF A;  3F2B A;  4YY3 Q;  1STH A;  2B8F A;  1I4G A;  4YCV A;  1HZA A;  1WJJ A;  2D62 A;  2AUJ D;  1XMQ Q;  1G91 A;  3S15 B;  1BOS A;  1EL0 A;  1SJE D;  3S1N H;  4P2C B;  2ZXP A;  2PI2 E;  1J5E Q;  4L5R C;  3KBX A;  3VYR A;  3TEH B;  2B63 B;  2HIV A;  1GVP A;  1T5X D;  4O42 A;  4KJO A;  3VR6 A;  1IW7 D;  5GAD C;  1L1O A;  4KKU A;  4LUO A;  1DCZ A;  4YHH Q;  1JOO A;  3GO5 A;  5IYC G;  1CKO A;  2HD3 A;  3QOJ A;  1L1O B;  1AE2 A;  1WD1 A;  3L0O A;  4JC0 A;  2YYZ A;  1D5X C;  3DWQ A;  4UY8 C;  2MJ8 A;  4KKS A;  3QG1 A;  1TXY A;  3D4R A;  3HS0 C;  3FKI G;  1W3S A;  3PV0 A;  3F8T A;  4AYB G;  4LFA L;  2HDM A;  1AZP A;  2WAQ G;  3HRZ C;  2JE6 I;  1RHP A;  3OTO L;  5C4X H;  1EYA A;  3JAM E;  4RCN A;  3S1R B;  2QEJ C;  2RA4 A;  4MN3 A;  2QDL A;  2NVY H;  2EJF C;  4OX9 L;  3FRP B;  5IGD A;  2FJ2 A;  3NTK A;  3GTM B;  1QVC A;  3I7F A;  3MHB A;  4LJZ C;  5EKL A;  4ZK9 B;  3D8G A;  1B2T A;  5GQO A;  5GAE C;  1BF4 A;  1DXM A;  1CI3 M;  1WTR A;  4RWS C;  2EYF A;  3BDL A;  5CMD A;  1MJC A;  1EUJ A;  3SE0 A;  2VW9 A;  3ULP A;  1GXD C;  3M4Q A;  3OOC A;  1MD2 D;  3HOX H;  4A3M H;  4DAM A;  1KTK A;  2B2V A;  5I6Y A;  3OW7 A;  3WDN A;  1OXV A;  5A35 A;  1ENC A;  3X3M A;  1S5B D;  3TME A;  3HZX A; 
#chains in the Genus database with same CATH homology
 4TSS A;  1UAP A;  1HXY D;  2BA0 A;  4IQZ A;  1DOL A;  3HG9 A;  3DHQ A;  3M4Y A;  1I6V C;  4DF7 A;  3ZYY X;  4WOR A;  2TMP A;  2IJ0 A;  1BCP C;  1H9M A;  2KHS A;  1II3 A;  3SHL A;  3IFD A;  4L6T B;  1QG7 A;  5C5M A;  4HCS A;  1D1K A;  2Q8I B;  2DY7 A;  5M5X B;  4CKE A;  3CRK C;  3RZO B;  4EQO A;  3GTJ B;  2O5J C;  3KBG A;  1V1P A;  2XWJ B;  3OSO A;  1B4O A;  3NTI A;  3K58 A;  1VMP A;  1V1P B;  1D1I A;  2KEE A;  2VXW A;  4ZAI A;  1CM9 A;  1HTP A;  3O13 A;  2AWO A;  4PNY A;  2LFN A;  3NTH A;  1LTI D;  5FO8 B;  3TZU A;  4LAA A;  4B9W A;  3DXJ C;  1Q12 A;  2B2T A;  1HPC A;  5E3F A;  3J81 E;  2SDF A;  4IUV A;  2ID0 A;  5I9O A;  1IYV A;  4ZKB B;  1LV9 A;  1M8A A;  2N55 A;  2F0W A;  2XNA C;  1LT5 D;  3HKZ B;  3HOV B;  2OF1 A;  3TDQ A;  4EVO A;  2MUY A;  1IKM A;  4HR7 B;  2F0H A;  3NWT A;  1PTO H;  2D2C C;  5DM6 3;  2J4X A;  2QIL A;  4XTC S;  5IGC A;  1Y69 U;  3S1N B;  1GUN A;  2EZV A;  1QJO A;  4IN3 A;  2AWN A;  2PW5 A;  4J8Q A;  2M9V A;  3OMG A;  1J8I A;  1TQO A;  3J7Y W;  3I73 A;  1TWH B;  1G29 1;  1TKW B;  3R93 A;  2SNM A;  4EQP A;  4A3G B;  4C3H G;  4G7Z C;  2X6G A;  1QB5 D;  1SND A;  5EBD A;  2X6L A;  4V19 0;  3IKJ A;  4IUN A;  1CZG A;  4OHJ A;  1GUG A;  1ZYR C;  2V4D A;  2E2D C;  2R3Z A;  4A3F B;  4F87 A;  2ICI A;  4K5W A;  1LAC A;  2Z4I A;  2EYJ A;  4L63 B;  1WTV A;  3PO2 B;  1G6Z A;  4KHV A;  5KRU A;  2RSN A;  4B9X A;  4WRD A;  3I72 A;  2BE5 D;  3MAQ A;  4NP5 A;  4IFD I;  3P7J A;  5ELE A;  1PFM A;  3K5M A;  2A6H C;  2D5D A;  3HOX B;  4A3M B;  1D2B A;  4QB4 A;  1CTM A;  2MP1 A;  3Q0A A;  5C3E B;  5IIF A;  4IFD H;  4DXG A;  3SVM A;  5CYU A;  2L12 A;  4XDX A;  1WCM B;  2XVS A;  4ABN A;  1Z47 A;  5M3M B;  4RFB A;  3MXN A;  1JB3 A;  2XN9 C;  2WIN B;  4NMZ A;  3NWS A;  4ILW A;  1BR9 A;  4J1M A;  1M4V A;  4BWG B;  5FLX E;  2SOB A;  3QO2 A;  4BA1 I;  1L0Y B;  1NSN S;  3ERO A;  2EYH A;  4K6L A;  2NN6 I;  4ODG A;  2EXZ A;  2JA8 B;  2A6E C;  5JEA G;  1SYG A;  3SXH A;  5EGT A;  4IUU A;  2MPM A;  3HEJ A;  2NN6 H;  4R8I A;  4K5V A;  1GOZ A;  1JWM D;  3IFT A;  1TS4 A;  2JSO A;  1I50 B;  2B8G A;  3UI2 A;  4RKL A;  1EY7 A;  3TP8 A;  2QKI C;  3GV3 A;  2XRS D;  1KLU D;  1AFP A;  1A15 A;  5ELF A;  2A68 D;  2F0S A;  5CV8 A;  5COR A;  2WB1 B;  3T53 B;  5JPN C;  2IX0 A;  5DNF A;  4IFD J;  2BCO A;  2ZT9 C;  3H0G B;  1VF5 C;  4WJW A;  4R9W A;  1PTO B;  2K04 A;  3H09 A;  4OO1 I;  1STE A;  3FEW X;  2HQE A;  3MWY W;  1F9Q A;  1F2Z A;  2RKS A;  2EJM A;  4CBV A;  1Q1E A;  1F9S A;  3DUZ A;  1BUV T;  3M3Y B;  4OO1 H;  1TR5 A;  3MVV A;  5E1F A;  1PRT C;  1E2Z A;  3A56 A;  5JVG 3;  1SBB B;  1LO5 D;  4ME5 A;  1QOH A;  1NAP A;  2K1B A;  2F03 A;  5I2X A;  3Q22 A;  2CQA A;  3EFX D;  5IT9 E;  3D4W A;  2KA7 A;  3HOW B;  1W6J A;  4CHT B;  1EWC A;  1Z7T A;  2PZU A;  4U68 A;  3TZD A;  1PDQ A;  1WD0 A;  1SYB A;  5NUC A;  1A3T A;  2E76 C;  4WFN 3;  3SDZ A;  1LT3 D;  3LNN A;  1XWE A;  3KF8 A;  5IGE A;  5KGU A;  1GUT A;  4F8M A;  1VMC A;  1SYE A;  5C5L A;  1HFG A;  3BVZ A;  1STB A;  2F1M A;  1LLR D;  3ND8 A;  2F0T A;  4XQN A;  2FMC A;  4ZUJ A;  1PFN A;  1QCB D;  1MI2 A;  3K59 A;  2HDL A;  1G2S A;  2AUK A;  2DNC A;  1BCP F;  3BS1 A;  3D6W A;  1KAB A;  4FVM A;  4DK1 A;  2EYM A;  1Q3L A;  2XWB B;  5IGG A;  2YU9 B;  1UEA B;  1TII D;  3NHH A;  4DNR B;  4FP5 D;  2F0G A;  1NUC A;  2BA1 A;  3P20 A;  2WV6 D;  3GTK B;  1YNN D;  3PIO 3;  1Y8O B;  3V2T A;  4MIU A;  3T51 B;  3R8B A;  1SNQ A;  1MGS A;  1Q90 A;  3V05 A;  2PPB C;  4BS9 A;  1Y8P B;  1EY4 A;  3EQL C;  1BDO A;  5LHY 1;  1SNM A;  2O4X A;  2XRQ D;  3K5N A;  4DFA A;  3N52 A;  5G3L D;  3ND9 A;  2JA7 B;  3S16 B;  1RKN A;  1HTL D;  3NBI A;  4HCE A;  1JE4 A;  2NTS A;  1EQV A;  2PO4 A;  2O2L D;  2BOS A;  1EYC A;  1O78 A;  2NTT A;  5EPK A;  4QMG A;  5FOB B;  3FPP A;  2PMZ B;  3HOU B;  5EQ0 A;  5CR3 A;  3C46 A;  3RMH A;  2AQ3 B;  2F0E A;  3GTO B;  5J39 A;  1LTS D;  2KCC A;  3LWE A;  2A74 C;  3A55 A;  5CV7 A;  3T56 B;  3DM1 A;  3CRL C;  3ONA B;  3RZD B;  1ILQ A;  2EYL A;  2RQX A;  1JCK B;  2K5W A;  5M5Y B;  1H9S A;  4HAE A;  1YNJ D;  3A8I E;  2L0C A;  1DOM A;  1H9S B;  1TY0 A;  3M7G A;  1DZ1 A;  4I65 A;  2B2Y C;  3KLR A;  1K8O A;  3RUZ A;  3J7A V;  4CJ1 B;  3Q6S A;  1SXT A;  2JP1 A;  2R6G A;  1CHQ D;  3NP8 A;  1V1O A;  1SFO B;  3GV6 A;  3M4O B;  3N6R A;  2F0D A;  4DU9 A;  1SNP A;  4I7Z C;  2RVL A;  2K5Q A;  4A93 B;  4X3S A;  1S5F D;  3SR1 A;  3FKI B;  2A73 B;  3MFG A;  4AYB B;  2BDO A;  2WAQ B;  2L4N A;  4QUC A;  4ZRZ A;  2EJG C;  1OO9 B;  2F4I A;  4DAV A;  3LWU A;  4KK7 A;  5IOD A;  1HFN A;  1EEF D;  5BN5 A;  3I90 A;  2X69 A;  1PTO C;  3W2D A;  1JOR A;  5M5W B;  1Y8N B;  4RGO S;  2Q8R E;  5I4D A;  3KLS A;  1CA6 A;  3VYS A;  4IUQ A;  4KKT A;  1D5M C;  3I4L A;  1DD2 A;  2VB2 X;  3TSS A;  3MFY A;  4YIJ A;  1F2Y A;  1TWA B;  2PCF B;  2NUC A;  4X3T A;  5A2Q L;  2C9O A;  3M7N A;  3E5S A;  2J0T D;  4IAL A;  1B9M A;  3D4D A;  4PQX A;  3TN2 A;  1G2T A;  3J80 L;  1HQM C;  1O7Y A;  1SMY C;  1WTO A;  1VDZ A;  4C3I G;  2LS0 1;  1LTG D;  1A6X A;  2K32 A;  2KCN A;  1CZW A;  1B44 D;  3H6M A;  2A69 C;  1F2M A;  3ERQ A;  5HGT A;  1I4Q A;  4A3J B;  4O1N A;  1DOK A;  4DA2 A;  1WTW A;  4FF2 A;  5IOC A;  5JEA H;  1S5E D;  2EY6 A;  4KI0 A;  2B2U A;  3L7Z C;  1C8C A;  1KDC A;  4F7X A;  4HSV A;  1B9N A;  1FYC A;  5C4H A;  4UAI A;  3MXG A;  1PRT F;  2ICE C;  5JAV A;  1B1Z A;  3VYU A;  1E0B A;  1FD7 D;  2C5C A;  3ITP A;  1FNW A;  5KYL A;  4CKB A;  3E6Z X;  3OIP A;  1KNE A;  1XXG A;  1SNO A;  3R2I A;  3F2U A;  1STN A;  4KV6 A;  1HA5 A;  1FR3 A;  5C4X B;  1NR4 A;  1I4R A;  1FGB D;  3QJY A;  1IW7 C;  5JJZ A;  2NVY B;  1TY2 A;  2EY5 A;  4E6I A;  2A5H A;  3VYT A;  2B39 A;  2M2L A;  3RLF A;  4IUP A;  1DON A;  4RGM A;  2Z4H A;  4CKC A;  2JA6 B;  3H3V C;  1ESF A;  1STG A;  2R7Z B;  2DNE A;  5FO7 B;  1D5Z C;  1KDA A;  3A8K E;  1HQR D;  4Q5V A;  4H13 C;  4C3H B;  3A7L A;  1ICW A;  1RDP D;  1U4M A;  4RGT A;  2PNR C;  5C44 B;  1SJH D;  5CV4 A;  3K57 A;  1GUW A;  4XQQ A;  5JEA J;  2CHB D;  5LL6 X;  3FMC A;  1Y1W B;  1E2W A;  1C48 A;  1QIL A;  1S5C D;  3MXU A;  1EY9 A;  1JR0 D;  2NVT B;  3L3O C;  2L9H A;  1RF2 D;  2B2Y A;  3G6J B;  2K5D A;  3FPU B;  4K14 A;  4H44 C;  3GTG B;  3SK5 A;  1PFB A;  5ELB A;  2JEA I;  2PW7 A;  5AFW A;  1RD9 D;  1PLF A;  2LY7 A;  4DNT B;  1EY6 A;  1C4Q A;  5D65 A;  4PMB A;  5EBC A;  4JK1 C;  2VNU D;  1EYD A;  5ISR A;  3EA6 A;  3TP6 A;  2L11 A;  4KD3 A;  1TS5 A;  2RDG A;  1K8M A;  3HOZ B;  1DJR D;  1O7L A;  1EZ6 A;  3I3C A;  2NBF A;  1EU4 A;  1O80 A;  3H94 A;  1ROD A;  4C2M B;  3GD7 A;  3DEO A;  2MGS A;  4FF1 A;  1JOK A;  2J7Z A;  4XT1 B;  1EU3 A;  3BVG A;  1OXT A;  1QE6 A;  5C4Z A;  4DK0 A;  3NPP A;  4C56 C;  1ZKO A;  3D31 A;  4K2K A;  5JOB A;  4DAY A;  4A3E B;  4IZ8 A;  1BO0 A;  5EKK A;  2KQ3 A;  2JYO A;  3NUC A;  3PIP 3;  3DMU A;  2ZXO A;  2EYO A;  1BQQ T;  1U4P A;  1U4R A;  3W3A A;  4Q0F A;  1A2T A;  4BY7 B;  3C1F A;  1F9P A;  4PMW A;  4FXD A;  1L0X B;  2AQ1 B;  1XYI A;  2M00 A;  4QCL A;  4UDU C;  1U4L A;  4LK1 C;  2PZT A;  1FNV A;  2G9D A;  4ID6 A;  2EDG A;  3D6C A;  3QWN A;  3BYY B;  4C3J G;  4A3K B;  1E2V A;  4XYQ A;  2F0P A;  2LKV A;  1SE4 A;  1V8Q A;  4QF4 A;  1G8Z D;  1S4Z A;  3CKI B;  2F0N A;  2E2I B;  2IL8 A;  4KMU C;  5DM7 3;  4M1U B;  2B2W A;  4G7O C;  1A3V A;  1JWS D;  2EPB A;  1JC7 A;  2FHT A;  3I4N B;  1SEB D;  1LTA D;  4KD4 A;  2L1B A;  1MSH A;  2QDB A;  2SEB D;  1AZQ A;  4KN4 C;  1MSG A;  1BCP D;  4OL7 A;  2PZW A;  1CHP D;  2DN8 A;  1LT4 D;  2MHV A;  5TSS A;  5JPM C;  5KNC A;  4U67 3;  4QIW B;  1ONL A;  4NDX A;  1KNA A;  4RKB A;  4H0L C;  1RJT A;  3A7A B;  1LTR D;  1MBY A;  1JQY D;  2IW3 A;  3WOE A;  1HUN A;  1PYW D;  3NQI A;  3LX0 A;  2EOT A;  1PTO F;  2N88 A;  1SYF A;  4RGN A;  2QCP X;  3KLS X;  2E75 C;  1WVL A;  5CGK A;  3AMU A;  3S14 B;  1BXT A;  3SK4 A;  4V0B A;  5C0X I;  2B2U C;  3C1E A;  3NK9 A;  1CA5 A;  2NWG A;  2CVR A;  1NCV A;  3J7A F;  2VUM B;  3V96 A;  2R61 A;  3PUX A;  1WTQ A;  5E4W C;  2PQE A;  4HED A;  1NR2 A;  3MC0 B;  1TWG B;  2JA5 B;  3A8J E;  1RTO A;  3L9A X;  4BA2 I;  2EVB A;  1TWF B;  2IX1 A;  3VR2 A;  3QOL A;  1SSO A;  5KYI A;  2WII B;  2F0I A;  5FO9 B;  3NBH A;  3E0J A;  3S2D B;  4FYD A;  2BDN A;  3GTP B;  2KVM A;  2G9H D;  3RD4 A;  3CQZ B;  4TKO B;  1SE2 A;  3PMF A;  2K33 A;  2KUM A;  1GJX A;  1D6E C;  1RCV D;  2A68 C;  1AN8 A;  2K05 A;  2QF7 A;  2TSS A;  1DM0 B;  3MA2 B;  3K5O A;  4K2L A;  5KNB A;  3I4M B;  1EY5 A;  4KY5 A;  3BZD B;  5K36 G;  4XIG S;  4OGQ C;  1ZYR D;  3T16 A;  1FNU A;  1X32 A;  2F0K A;  1F9R A;  3BVM A;  3IAY A;  1UNS A;  3KK7 A;  5EPJ A;  3U9O A;  4KN7 C;  4N9P A;  4JBW A;  3S9W A;  2XSC A;  3JAM L;  5FK9 C;  1XTC D;  2HCC A;  2SNS A;  5D3I B;  4KJN A;  2FIN B;  2HUG A;  1B50 A;  5C0X J;  1VCI A;  4H7B A;  1VF7 A;  1AP0 A;  1SDF A;  3PUZ A;  2A6H D;  1H9J A;  2NVQ B;  5IGF A;  1R4Q B;  2WKD A;  4J6H A;  4K6D A;  2NYZ D;  1AEX A;  2I46 A;  2F3W A;  3S2H B;  1KDB A;  4G57 A;  3MTS A;  4HN7 A;  1HUM A;  4X3U A;  3U9S A;  3OIQ A;  3KUP A;  5C0X G;  5BN3 A;  3WOF A;  3GQB A;  4C1N K;  2F3V A;  1T5E A;  1QNU A;  4NKL A;  5J1Z A;  2I07 B;  2KEC A;  3HP3 A;  2RDF A;  1OXU A;  2D9U A;  4L8J A;  2IPK D;  1HHV A;  3DEP A;  4K8I A;  2A6E D;  1JOQ A;  4S3S A;  5KIX A;  4K8J A;  2GA4 B;  1R4P B;  1QNK A;  3P1H A;  4CJ0 B;  4KY7 A;  1BNZ A;  1STA A;  1ILP A;  3FVQ A;  4GZY C;  1ET6 A;  1EEI D;  2O5I C;  5CV9 A;  1ESR A;  4A3I B;  4FF4 A;  1Z6H A;  2E74 C;  1HCZ A;  1STY A;  3J81 L;  1YNN C;  1X3Q A;  3GP7 A;  3SK6 A;  1R9T B;  5A2Q E;  1TS2 A;  4EGV A;  5C3X A;  4NW2 A;  5K5P A;  3PO3 B;  2F0Q A;  5I9P A;  3J80 E;  4M8A A;  1X3P A;  4RAU C;  1PZJ D;  3I70 A;  5KEE A;  3X3N A;  1O7Z A;  2EYP A;  4K5X A;  2F0F A;  1PRT D;  2KOL A;  5CC4 A;  4F88 A;  5C6A A;  2VB3 X;  2CW0 C;  4DGZ A;  2B2W C;  4OIK A;  3MXP A;  5C4J B;  5CBA E;  4RA8 A;  4OIJ A;  4ULL A;  5EPL A;  5COY A;  2K03 A;  5HUR A;  3TP5 A;  2L55 A;  4C3I B;  1I3Q B;  4FO2 A;  3R3O A;  2K7V A;  3AU7 A;  3OWE B;  1SYD A;  1EZ8 A;  2FMM A;  1TWC B;  2RDH A;  3D3R A;  1IL8 A;  4N9T A;  3K6O A;  4R8N A;  3S1Q B;  4XXE A;  4XT3 B;  1CK1 A;  1W6K A;  4HMJ A;  4G7H C;  1B3A A;  4X3K A;  3T13 A;  4CGY B;  3VA7 A;  1TS3 A;  4B08 A;  1YNJ C;  3VR3 A;  1UUP A;  1GUS A;  1PMR A;  2E2H B;  3C2P A;  1SNC A;  1JIC A;  1EOT A;  2OEO A;  2NVX B;  4RH6 A;  5E4X A;  5M3F B;  2WAC A;  1I6H B;  2NB0 A;  4HMI A;  4DAP A;  4IUT A;  3A54 A;  1F77 A;  1CFM A;  5KND A;  4RCO A;  1I4P A;  1WTP A;  2F0L A;  1ENA A;  5M9O A;  3OMC A;  1QWY A;  2H4O A;  1ZXT A;  1A3U A;  1V43 A;  4TRD A;  3T4A C;  4CJ2 C;  3I8Z A;  1HRJ A;  5J22 A;  4KY6 A;  2Q8T A;  3OPO A;  4BBR B;  5FLX L;  3C3L A;  4QUF A;  5CV6 A;  4FNF A;  1WTX A;  3HGB A;  2R93 B;  4C1N I;  3QIA A;  1TVX A;  5DEH A;  1SYC A;  1PXU A;  4RHR A;  3G7L A;  3GTQ B;  2Z1C A;  1KLG D;  4PV1 C;  1LT6 D;  3OHX C;  2F0M A;  3MZ5 A;  3AB9 A;  3QB3 A;  1HA6 A;  4HSP A;  3PUV A;  3M85 A;  1SAP A;  3BG3 A;  1DYQ A;  4ZQ3 A;  3VR4 A;  1K83 B;  4XQJ A;  1U9R A;  2NZ1 D;  4TQU S;  3SEB A;  1PZK D;  3S17 B;  2EY1 A;  5I2Y A;  5D3D A;  4XYO A;  4ZYS A;  1EIG A;  3NE5 B;  3BDO A;  2WKC A;  1EY0 A;  4BY1 B;  3BDC A;  1EY8 A;  1BCP B;  2R92 B;  4A3D B;  1EWH A;  2F0V A;  1F2L A;  5CV5 A;  2JEB I;  2F0U A;  2PYK A;  5ELD A;  2K6A A;  2F0O A;  4ZKC B;  1PZI D;  5D14 A;  1Y1V B;  3OWF A;  2K28 A;  5F2D A;  3I91 A;  1CT1 D;  4A3B B;  5T1I A;  3SK8 A;  3R2T A;  2F0J A;  2IX3 A;  3BYT B;  5EJW A;  1EFI D;  1I4H A;  2IWH A;  1ENF A;  4LMQ D;  3H91 A;  1S5D D;  4BBS B;  2EY2 A;  3K7A B;  4Y7N B;  1GHK A;  2B2V C;  4FF3 A;  1ET9 A;  5I6W A;  3NQT A;  5IT9 L;  2AQ2 B;  2K01 A;  4IFD G;  1OXS C;  3CHB D;  2KED A;  2OXP A;  2RBM A;  1EIH A;  2HCI A;  3IL8 A;  1RTN A;  3HOY B;  3URY A;  1CQV A;  1SE3 A;  5C3W A;  2Z8L A;  3DWP A;  3NSW A;  4PMC A;  2XIW A;  5T1G A;  5BN4 A;  1GUO A;  1LAB A;  5K36 H;  1EQT A;  3CU7 A;  5CBE E;  2BE5 C;  2L5T A;  2JXM B;  5EKI A;  1J9O A;  3K0Y A;  4HTH A;  4C3J B;  4IUR A;  4ZUI A;  1IHZ A;  3TP7 A;  2H1E A;  5JVH 3;  1TU2 B;  1PTO D;  3EJI A;  2NN6 G;  1ZEQ X;  4ZLT F;  1JWU D;  1Q1B A;  4MHE A;  2B2T C;  1H9R A;  1CQF A;  3PUW A;  3DWA A;  1AW7 A;  4Z9C B;  1I4X A;  2OT2 A;  1OXX K;  1A2U A;  1BBX C;  3VR5 A;  4KHZ A;  4FXG C;  1LTT D;  2DY8 A;  2ENB A;  3P75 A;  2FFK B;  2LMC B;  4FXK C;  4G4K A;  5C0X H;  3TBI B;  2Y0S B;  1IKL A;  1Q8I A;  2KJX A;  1IYU A;  1SMY D;  4KTA A;  5DAU A;  3K5L A;  3PUY A;  3MEH A;  2A69 D;  4OO1 G;  1LTB D;  3NXW A;  3EVQ A;  1TT2 A;  2IT1 A;  4RHS A;  5LL6 S;  2WP8 J;  1GHJ A;  2RSO A;  5FKA C;  1PRT B;  4EQN A;  1KAA A;  2ZXR A;  4DN4 M;  3Q24 A;  1B53 A;  3Q23 A;  2EE1 A;  1H9K A;  3S1M B;  1XX8 A;  3FDT A;  3GTL B;  2E2J B;  5G3L F;  1ML0 D;  2CW0 D;  3VA5 A;  5ELC A;  5IGB A;  4DXF A;  1STH A;  2B8F A;  1I4G A;  2D62 A;  2AUJ D;  1G91 A;  3S15 B;  1BOS A;  1EL0 A;  1SJE D;  4P2C B;  2ZXP A;  3KBX A;  3VYR A;  2B63 B;  1T5X D;  4O42 A;  4KJO A;  3VR6 A;  1IW7 D;  4KKU A;  1DCZ A;  1JOO A;  3GO5 A;  3QOJ A;  1WD1 A;  2YYZ A;  1D5X C;  3DWQ A;  2MJ8 A;  4KKS A;  3D4R A;  3QG1 A;  3HS0 C;  3PV0 A;  2HDM A;  1AZP A;  3HRZ C;  2JE6 I;  1RHP A;  1EYA A;  3JAM E;  4RCN A;  3S1R B;  2QEJ C;  2RA4 A;  4MN3 A;  2EJF C;  3FRP B;  5IGD A;  2FJ2 A;  3NTK A;  3GTM B;  3MHB A;  5EKL A;  4LJZ C;  4ZK9 B;  3D8G A;  1B2T A;  1BF4 A;  1DXM A;  1CI3 M;  1WTR A;  4RWS C;  2EYF A;  3BDL A;  5CMD A;  3SE0 A;  1GXD C;  3OOC A;  1MD2 D;  1KTK A;  2B2V A;  5I6Y A;  3OW7 A;  3WDN A;  1OXV A;  5A35 A;  1ENC A;  3X3M A;  1S5B D;  3TME A;  3HZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...