1KDBA

Stabilization of a strained protein loop conformation through protein engineering
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYEPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stabilization of a strained protein loop conformation through protein engineering.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 41
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kdbA00
5E3FA 1SNOA 1STGA 2F3WA 4J6HA 4G57A 4KY6A 3DMUA 3TP7A 5JOBA 2OEOA 1EZ6A 2RKSA 5I6YA 4EQOA 3RUZA 1SYBA 4IZ8A 1EZ8A 3TP5A 4NKLA 5J1ZA 2EY1A 3SK4A 4OL7A 5C5LA 3SK6A 4LAAA 3LX0A 3NQTA 2F0GA 3D4DA 1EY9A 1SYGA 2EY2A 4RKBA 5HGTA 5I9OA 2O4XA 1TR5A 5KRUA 1A3VA 2F0IA 4K5WA 4DF7A 4QF4A 1F2YA 4IALA 5IIFA 4WRDA 3D4WA 4ZUIA 5KYLA 5IGGA 5IGCA 4I65A 5EKLA 1SNDA 4PNYA 2F3VA 2KHSA 3OWFA 5M9OA 4NP5A 2EYFA 3NP8A 2PW7A 3NXWA 1EYCA 4TRDA 3V2TA 2SNMA 4ODGA 4B9WA 4E6IA 4IUNA 1ENCA 4ID6A 4N9TA 1EYAA 1TQOA 4K14A 5C5MA 4F8MA 3E5SA 5IGFA 3S9WA 3SXHA 2EXZA 4R8NA 1ENAA 3P1HA 4F7XA 4ZUJA 3C1FA 5KEEA 4KD4A 5I6WA 1JORA 5JAVA 1EY8A 3MHBA 2OF1A 4KJOA 1KDBA 2M00A 5NUCA 5C6AA 2ENBA 4N9PA 1IHZA 1A2TA 1EY5A 5CV8A 4RKLA 3BDCA 3SK8A 1KAAA 3MEHA 4EQPA 4DGZA 5IGDA 2F0EA 1U9RA 4DU9A 2EYLA 2OXPA 3MVVA 4KTAA 2EYMA 3DHQA 4KY5A 4KY7A 1EY6A 1EYDA 5J39A 1SYFA 5CC4A 3QB3A 1JOQA 1SNCA 1EQVA 1STYA 2F0LA 5IODA 1JOOA 3MXPA 1EY4A 1SNQA 3EROA 4HMJA 3H6MA 4MIUA 1SYDA 2F0HA 4HTHA 4K5XA 2QDBA 2SNSA 1SNMA 2F0JA 2RBMA 2LKVA 3T16A 3MZ5A 3QOJA 5HURA 5IGBA 3QOLA 5CV9A 1F2MA 3ITPA 1STNA 4K8JA 3NUCA 2EYOA 4K2KA 2PQEA 2EY5A 3D8GA 3R3OA 2HQEA 3EVQA 2EYPA 3BDLA 2RDFA 3C1EA 1KDAA 1AEXA 3ERQA 3P75A 4EVOA 2EY6A 2KQ3A 3HEJA 4QB4A 4J1MA 5C3XA 2F0FA 1KABA 2F0WA 3EJIA 1A3UA 4HMIA 2PW5A 3U9OA 5I9PA 1KDCA 1STHA 2F0UA 1STAA 2PZWA 5ISRA 2NUCA 2WACA 4WORA 1EY7A 5C4ZA 5DAUA 5KGUA 2F0VA 4ME5A 5CV7A 1EY0A 2PZTA 5EGTA 2EYJA 2SOBA 5J22A 1II3A 4KHVA 4K8IA 1SNPA 1RKNA 4KJNA 4QMGA 2PZUA 5CV5A 5F2DA 5IGEA 4K5VA 5E1FA 2PYKA 4DFAA 1STBA 1NUCA 2F0TA 3OMCA 4B9XA 4K2LA 5CV4A 2EYHA 3TMEA 5CGKA 2F0QA 2F0OA 3SK5A 2F0KA 5C4HA 3HZXA 5KYIA 2F0MA 2F0NA 1TT2A 3OMGA 4NDXA 3SR1A 3T13A 3TP8A 4KD3A 1A2UA 5IOCA 3D6CA 5K5PA 2F0PA 4K6DA 3PMFA 3NK9A 5CR3A 1A3TA 1F2ZA 5DEHA 5EKKA 1SYEA 1SYCA 2F0DA 3OSOA 4NMZA 4S3SA 4ZQ3A 4PMCA 3VA5A 4EQNA 4KV6A 5KIXA 2F0SA 3TP6A 3SHLA 3NHHA 4H7BA 1NSNS 5CV6A 4PMBA 4YIJA 1JOKA 5C3WA
chains in the Genus database with same CATH superfamily
4IPCA 1M1KC 3E9HA 4JI1Q 1FNWA 3BZDB 1N33Q 1PH7A 1TU2B 4IZ8A 3EQLC 3TP5A 1BCPD 1CFMA 4R4IA 5LL6X 1VQIA 4BY1H 4DR5L 3HG9A 1H9SA 5IYDH 2NVYH 3MTSA 3RZOB 2F0GA 1K83B 3D4DA 2EY2A 5KNDA 3WWVA 4PZ7A 3ZYYX 3I91A 1HNXQ 2AQ1B 3S2HH 5DNFA 3D4WA 5IGGA 1U0LA 5C4JB 5C0XH 5IP7G 4JI4L 3NXWA 2SNMA 5FKAC 2HDLA 1NTGA 2AUJD 4N9TA 4M8AA 4UP9A 1UWVA 2KCNA 3K58A 3H91A 1QVGA 5EQ0A 1D8LA 1Y1WB 1RDPD 1B9MA 2BH8A 5ELFA 2JEBI 5IWAL 3J7A5 2JA6H 4EGVA 4AYBB 5M3MB 1ZKOA 3DHQA 3F2DA 4A3GG 1Y69U 1PH1A 2EXDA 4X62Q 1PH8A 3TDQA 1PXUA 4Q5VA 1AP0A 3J81E 3HRZC 4HMJA 1MD2D 4IUPA 4BA2I 2WAQG 4A3JB 1B3QA 4PMWA 4OX9Q 2EY5A 1ESRA 3RNUA 4A3IB 1KNAA 3P75A 2VB2X 5JPNC 5TSSA 4QJFA 1UAPA 4RMFA 1EFID 3LWUA 1S72A 2V4DA 2VXWA 3BVZA 1O7YA 4CJ1B 3I72A 4AYBG 2SEBD 5M3MG 2GA4B 2JE6I 5FO7B 4DV6L 1J8IA 2ZTCA 2VQFL 4BA1I 4FF1A 2NVTB 1PTOH 3NTKA 3K6OA 5FLMG 1GOZA 4A3EB 3HOVB 5T1GA 1IKLA 5F2DA 1L1OB 4B9XA 5CV4A 3S16B 4DV2Q 1CKNB 3B6YA 3OIPA 1LTAD 1S4ZA 4OXPA 4LFBQ 1LV9A 2FJ2A 5HGTA 3U9SA 1Q1EA 2Z6KC 2BA0A 2E76C 1C9OA 1NR2A 3PO2B 2Y0SE 4GKKL 2ALYB 2M9VA 5JVH3 1CHQD 2FXQA 4A3MH 1B4OA 1H95A 3HOWB 3OW2A 3CC7A 3HOVG 3DWPA 1UE5A 1YNJC 1TWCH 3PIOA 4HJ9A 3HOXG 3HOUG 5FO9B 5J1ZA 1KD1C 5C44H 4OWWB 3ICEA 3SVMA 1HR0W 1QNKA 1A3VA 1P8LA 3M4OB 3MXNA 5GQOA 1LABA 1K8OA 4IALA 5CMDA 5LMNL 1QNUA 4TQUS 4OO1G 1S5FD 4YWLA 2K75A 3PO2G 1VQJA 1HNZQ 5G3LD 1ENCA 3O13A 1LTTD 3D6WA 4HIMA 1XNRL 3HOWG 2NZHA 1ENAA 4DK1A 2HD3A 3NTIA 4HJ5A 1G2TA 2FHTA 2AWOA 4FVMA 3GTLB 3J81i 1D5ZC 3P20A 1CQFA 2OWOA 4LNQA 4JCVE 3ULJA 1SYFA 4BY7G 1JOOA 1B53A 1K28A 4AYBE 4JI5Q 1HXYD 2KEDA 4P71A 1MKHA 4JK1C 1NMFA 2F0JA 4B3MQ 1U4MA 5M5YH 5HURA 4LF4L 3GTKB 1YNJD 4A3KB 1STEA 1STNA 3CCMA 2UXBL 4K2KA 1WCMH 4JYAL 2B2YC 4APVA 4C3HB 3OIQA 4QQBX 1GUNA 3X3NA 2F4VQ 1CT1D 4BBSH 2K7VA 5JEAH 4DR1Q 1KDCA 4ZAIA 4G7HC 1I50B 2QEXA 2CW0C 4A93B 1PFMA 5E4XA 2IX3A 1QVFA 3JAML 2UUCL 3TBIB 3T4AC 2H1EA 3H94A 1SE2A 1F9QA 1LM0A 3SK5A 4A3KG 1H9KA 5C4HA 2EZVA 1XNQQ 1JE5A 1RD9D 2Z6BA 1C0AA 3VA7A 2HCIA 4C3HG 2R7DA 3PMFA 4GKJL 1IL2A 1N34Q 3VA5A 3GD7A 2B8FA 4HEDA 1LUZA 1MJCA 1SE4A 3PUWA 3PUXA 3NPPA 1FVIA 4A3GH 4IOAA 3VYUA 2A5HA 4DUZL 1PDQA 2RKSA 1Q8KA 4DV7Q 1I3QB 2EY1A 2F1MA 4G7ZC 1TWHH 2D0OA 4DV1Q 2B2VC 5FJ8G 3NE5B 2UUBL 1OXSC 2QF7A 1X3PA 4PZ8A 3CCUA 1HPCA 3LNNA 4NP5A 2PNHA 5GADC 2I46A 4FNFA 3G7LA 2IPKD 4LK1C 4C3IH 5KEEA 1DOKA 1RHPA 3W2DA 5JAVA 4LFAL 2YYZA 3GTPB 3KDFB 5ELNA 4A75A 3VYTA 1L0XB 4HIOA 2HT1A 2F0EA 3GP7A 4JI7L 2HCCA 1SLJA 3BU2A 2RHQB 5ELBA 5CC4A 3QB3A 2RSNA 2MQHA 1STYA 3K7UC 4UP7A 1JMCA 2RBMA 1EQTA 4JI6Q 1BCPB 2K52A 3ITPA 2A73B 4DR6L 1AEXA 3NTHA 4B3TQ 1CI3M 3AFQA 4QB4A 4BBRB 3S14H 4GLVB 1A3UA 4PV1C 2K5QA 2MJ8A 1KLUD 2R7ZB 3HKZB 2MO1A 4Y7NH 2VZAA 2EVBA 1II3A 2JA8H 1U4RA 1EWHA 1SNPA 1XYIA 1UEAB 4DAMA 1HFNA 1FNUA 4YHHL 2AQ3B 2F0TA 3U58A 1YNXA 3H0GH 5CGKA 5IP9H 3QJYA 2K4KA 4PG3A 3UDGA 2N49A 1SROA 2B2YA 4LF6Q 5EKKA 3S1QH 4S3SA 3ER0A 4DR3L 4KV6A 3A5UA 3U4VA 3HOZH 2D5DA 1S40A 1K8GA 4JI0Q 1UUPA 2R7ZG 3PUVA 4YIJA 5EPKA 2K04A 1HCZA 1OXXK 4HIKA 4A3DH 3S1NH 1PTOF 2CQAA 3H15A 1HHVA 1CSQA 3S17B 3SK4A 4O42A 4LAAA 3H3VH 3NENA 3T1YL 5I9OA 4FYDA 3P7JA 2XGTA 3KF6A 3Q23A 4BXXG 4QF4A 4Z9CB 4LF7Q 1D5XC 3V05A 1Q81C 3BZKA 3CCRA 1ASYA 4PNYA 1N8RC 2EYFA 2KCTA 1WTRA 4DKAC 2JYOA 2QCPX 4TRDA 4B9WA 1XMQL 2IY5B 1VQ6A 4DV0Q 1PHJA 2ZJPA 4XTCS 2N8NA 1EYAA 1TY0A 2QKIC 5M5XH 5C5MA 4F8MA 1PH3A 1F9SA 2FFKB 4B3SL 1D6EC 3MEFA 3W1GA 4A3FG 3R8BA 1QCBD 1WTWA 3GTQH 1GO3E 2JEAI 4DV4Q 1A6XA 3J7AF 3E9IA 3S15B 2DY7A 3CU7A 1HNWL 4RKLA 4XYOA 2K1BA 1RTNA 3TZDA 2BOSA 1BQQT 1XMOL 4JI2L 3GTOB 1GUGA 2EYMA 2ICIA 4F87A 2XVSA 1I4XA 1EY4A 2D2CC 2R92B 1SNQA 1LTBD 2A1AA 3TN2A 3DM1A 4K5XA 2X69A 1SMXA 1EIGA 4LUOA 2HIVA 3NBHB 3M3YH 2JN4A 3J80c 1R4QB 3KLSX 1KDAA 1EU3A 4J1MA 4TKOB 4FXDA 3S1RB 4DK3C 5BN5A 5DAUA 1Q86C 2SOBA 2B2WC 4XQJA 3AYHB 4DUYL 1K0SA 4QMGA 5E1FA 3I4NG 3HKZE 1U4LA 1Y1VH 3HGBA 1TS5A 4Q0FA 2ZM6Q 2VUMH 3KJOA 3PO3H 1X3FA 2ZJRA 2KUMA 2XRQD 1W3SA 1VMPA 2WV6D 4KD3A 1PH6A 3I70A 5T1IA 4KHPL 1SYEA 1GUTA 1I4GA 2ID0A 4KI0A 5GAHC 3CCVA 5KIXA 1G291 3TP6A 2ICEC 1QJOA 2VB3X 4YY3L 4CKEA 4GLAC 3L0OA 4QL5A 1XPOA 4R4QA 1KAWA 1MI2A 1WTPA 4HJ8A 2JA6B 4OHJA 3MC0B 1Z9FA 4RCOA 3NQTA 4FP5D 2R61A 4UPAA 2E5LQ 1G8ZD 3VR3A 2K5VA 4L63B 2A74C 1YHBA 3I4LA 2JP1A 5IGCA 1ENFA 3I56A 1F9PA 4RH6A 3K0XA 3T51B 4A3BB 2E2HB 4LF5Q 2ZXOA 4ID6A 4DAVA 1E3PA 3GDEA 4ZK9B 1RTOA 3FKIH 3CCSA 4U68A 2K14A 2Q2TA 2NB0A 1I6HH 5CV8A 3CCLA 2R6GA 1EQRA 4OIJA 1CKMA 2L4NA 3G6JB 1NJIC 1O7IA 4AH6A 1IBLL 4GNXC 1U5KA 3CPFA 1VQ7A 1ML0D 2VS1A 1HA5A 4A3BG 4DR5Q 2IW3A 1IW7C 1Y8PB 1TY2A 5IGBA 1Y8NB 1HTPA 1NAPA 2X6GA 2Q8RE 1NNXA 3EN2A 3TQYA 2PQEA 3K7AH 1B9NA 3BDLA 2RDFA 3UE0A 4JV5L 1Q3LA 1DD2A 1GUSA 2B29A 2PW5A 3CRLC 1STHA 1STAA 4P73A 2CKZB 1AFPA 1B7YB 5IE8A 5C44B 3CQZH 3HFZB 4IUVA 2KJXA 4NPSA 5IT9E 5IGEA 3UI2A 3BG3A 1EWIA 1XXGA 3HS0C 3VR2A 2PYKA 2KHIA 3ZJYC 1RCVD 1BDOA 2RCNA 4KKUA 5JJZA 1XWEA 4JI8Q 4GZYC 4RAUC 2HIXA 4DR7L 1A3TA 1YVCA 1SYCA 1CM9A 3VR5A 5C3EG 4DR2L 4A3CH 4PMBA 3FEWX 2B2WA 1SMYC 2F3WA 2XTIA 3E6ZX 4MTNA 2CH4W 3CMEA 3RN5A 1IW7D 3BYTB 1SBBB 3C46A 3A5ZB 2JA7G 1R9TH 4P74A 1QZGA 1SYGA 3SGIA 2B39A 1TWAB 3I4MB 4TVAB 1X3QA 4K5WA 1H9MA 4DV6Q 3F8TA 2VQFQ 1HH2P 2A19A 1PFBA 2KOLA 2G5DA 3K5MA 1E1OA 4I65A 1SNDA 3NELA 4HN7A 5M5YB 2KHSA 2RSOA 1BF4A 3KJPA 2PW7A 2GVBA 2LFNA 3V2TA 1EIHA 1NY4A 3R2IA 1FL0A 2R3ZA 1BVSA 1E24A 1M90C 3SXHA 1VQMA 3LWEA 2M2LA 1IBML 4BBSB 2Z4IA 5I6WA 3I4NH 4GOPC 1EY8A 1VF5C 3D31A 1KDBA 5C6AA 3M7NA 2NBFA 4YCUA 3V96A 4N9PA 2PO4A 2QDLA 2HHHL 4GKKQ 3I4MG 1B70B 2Y0SG 2I07B 3C3LA 1O7LA 2K05A 5D3IB 1BBUA 3W3AA 5EJWA 3CHBD 1CHPD 3EROA 2B2TC 4MIUA 1DJRD 2ZXRA 3JAME 1YNNC 4IOCA 3CCQA 5D14A 3QOLA 5JJKA 4X65L 1SE3A 4IURA 4MN3A 1DONA 5LMNQ 5IYCH 1YBYA 4JG2A 3HOYB 4X6AH 4OEMB 3BJUA 5ISRA 4B3RQ 1XNRQ 4NW2A 1YZ6A 3GV6A 5J22A 3AQQA 4KHVA 5HY6A 1TWHB 5I2YA 1A15A 2F3IA 1KLGD 1G51A 3OMCA 5EBDA 3PIPA 3KDFA 4KN7C 5EAYA 2E2JB 3SR1A 4XYQA 1Y1WG 1X54A 1LTRD 3NSWA 3AFPA 1OXUA 5K5PA 4XT1B 3Q6SA 5CR3A 1WFQA 1EEID 4ZQ3A 1GM5A 3HOYG 1KRTA 1PH9A 1RF2D 2J7ZA 5DM73 4JPBW 4RGNA 4DV3L 1VQHA 5CV6A 4LF4Q 3FVQA 4IN3A 5C3WA 2JQOA 4X66L 3RLFA 4J6HA 3CRKC 2UXBQ 2JSOA 4HIDA 4JYAQ 1YNND 4A3JG 2PCFB 2B8GA 2I5HA 2NN6I 4A3IG 1K0RA 1B2TA 1OTCA 5IY0A 2UUCQ 4OGQC 5KYLA 3FHWA 1I94L 2WIIB 3UDXA 1WD1A 1EYCA 5IT9L 1HZ9A 4FF3A 1TQOA 3PIO3 4HJ7A 3K57A 4A3EG 1E2VA 1JE4A 4ABNA 3NEMA 2K50A 1ASZA 1N32L 4GKJQ 4L6TB 5M5WB 3D0FA 5I2XA 2E74C 5C4XB 4XIGS 2A69C 4Y7NB 2CVRA 2KVMA 2A6HC 2JA8B 1VDZA 2N3SA 2H5XA 3QG1A 3JAMi 1ZEQX 2OXPA 5IYBH 4DUZQ 2XSCA 1KHIA 2RF4A 4PZ6A 3K5OA 3RZDH 1SYDA 2F0HA 2IL8A 2QDBA 2AUKA 2UUBQ 4GLXA 1WTXA 3S1QB 1VQDA 2FMMA 2JJQA 3D8GA 4UHVA 3HOZB 2JA5B 5A35A 2ZTDA 4C3JB 3BVGA 1PTOC 5C4XG 1JJ2A 4L5QA 3A56A 5I9PA 1WTHA 4X3TA 4V190 1E2ZA 4WJ4A 5M3FB 3U4ZA 4A3LG 5E7NA 4LFAQ 1JQYD 2B2TA 4X62L 1ONLA 2YTVA 4LF8L 3G71A 2EYHA 5AJ3Q 2VQEL 4V0BA 1KIXA 2Q8IB 4JI7Q 1J5EL 4LJZC 3BS1A 5EKIA 2JA5G 4C3JG 2A69D 2DUDA 3E3XA 2A6HD 3OSOA 4C56C 1BUVT 1PRTF 3CD6A 2WKCA 4X3SA 1TS2A 4RGMA 2TSSA 1XJVA 4CDCC 2A6EC 1VQOA 5M3FG 3TP7A 2CQOA 1WYDA 3I3CA 4EQOA 5IP7H 4DR6Q 4HSPA 1GD7A 1I4RA 1IZ6A 3NBHA 4JOIC 5E4WC 1AE3A 4F88A 2K03A 3LX0A 5ELEA 2OQKA 2YU9H 1JWMD 4H44C 1IXRA 4RWSC 1EWCA 4LFBL 3KF8B 3PSIA 1K83H 1SN8A 4YHHQ 5EKLA 4JBWA 1MGSA 2XIWA 3GV3A 1HUMA 3OWFA 1C8CA 2K28A 3M3YB 5I4DA 4A93G 4IUNA 2MFIA 1JB3A 5IGFA 3OHXC 2DY8A 5C4JH 1ILPA 3KFUA 1XX8A 4EX5A 4DR3Q 1AN8A 3KBXA 2K5DA 1QILA 3BDCA 1KAAA 2LMCB 1VQLA 4R4OA 4DU9A 2UXDL 2Z6KA 5K36G 3CP0A 3VYRA 2NVQH 5J39A 3MFYA 5KNCA 3S1MB 2VUMB 4GNXB 1SNCA 3H09A 4P75A 2CW0D 3PO3B 5ELCA 2F03A 2A6ED 2CHBD 2LY7A 5M3MH 3T1YQ 4HTHA 2EQSA 2SNSA 1TWFB 5FLMH 3J80L 4CKBA 1GXDC 3N6RA 2OTLA 4LF9L 2HQEA 3QO2A 1X6OA 2EY6A 2YV5A 3HEJA 1T9HA 1B3AA 4ZCKA 2KENA 1XMQQ 4JBJA 4OIKA 4JW0A 2MO0A 2I5MX 2Z4HA 1G6PA 1Q46A 4L8JA 1IKMA 4XQNA 2C9OA 1V1OA 2H4OA 4B3SQ 1HQRD 4I7AA 1FR3A 1FJGL 1HNWQ 1U4PA 2F0QA 1VQNA 4JI5L 3HOVH 3CC4A 4JI2Q 3HOXH 1LT6D 1TT2A 4P2CB 3HOUH 1MSGA 2EE1A 1D7QA 1ET6A 4POFA 4X64L 3PF4A 3PQIA 5FO8B 1PV4A 1YHAA 3KYHC 2L9HA 2L1BA 4KN4C 2FINB 3I90A 1B44D 1JWSD 1W6KA 1SNOA 3NQIA 2OQ0A 4KY6A 1LT3D 1A0IA 4N8FA 4OO1H 3S2DB 1UE6A 3PO2H 3S24A 1GUOA 1VQ8A 1LYLA 1Q8IA 2DJFC 3BZCA 3SK6A 3CAMA 3HOWH 1YI2A 1MBYA 4C1NK 3U50C 1EQQA 1N9WA 2R93B 1SE8A 1HTLD 2KEEA 3UDFA 4BBRG 4DUYQ 4O2DA 3AEVA 1E1TA 3M4OH 3HKZG 2L5TA 1YJNA 4NXML 1V1PB 4LW1A 2D62A 5CBEE 4BY7H 1VQKA 2BDOA 1DZ1A 1JT8A 1PRTB 1FNVA 3PUYA 2ZJQA 4KHPQ 2OF1A 4R1JA 4KJOA 4GOPB 5ELDA 1QE6A 1A2TA 3J7ZC 2R93G 2EYLA 1O78A 4YY3Q 4YCWA 3GTLH 3H3VI 1KTKA 2K32A 4GS3A 5IODA 4X3KA 3H6MA 1CKOA 2PMZB 1YHQA 1EOTA 1HFGA 1C4QA 5JVG3 1BXTA 2EPBA 5CV9A 3CMAA 1XPRA 2O2LD 1N36L 1EFWA 1QOHA 2B2VA 3CCJA 2ASBA 4XDXA 3GTKH 4A3KH 3A55A 3I8ZA 1W2BA 2PZWA 3GTGB 1EY7A 4DNIA 5LMUL 4C3HH 3A0JA 1D2BA 3M9BA 1O80A 4R4CA 4OELB 3J81c 1I50H 5CBAE 3MFGA 1KL9A 4A93H 3MXGA 1PFNA 2B63B 1A62A 1LTSD 1VCIA 3TMEA 3HZXA 1AW7A 2F0NA 1AE2A 5LMNW 3TP8A 1LT4D 3TREA 1G6ZA 5HGQA 4RCNA 4IFDI 2DNCA 5DEHA 5FJ8H 3URYA 3EBEA 2Q2IA 1BOSA 2F0SA 2LXJA 1NBWA 1NSNS 4DV5L 1ICFB 5E3FA 2NVXH 1S3OA 3NWTA 4RG1A 3UE1A 4BY1B 3H3VC 3M4YA 1EU4A 2NVYB 1Z47A 3KUPA 3DLLA 2R92G 4JV5Q 2UU9L 3TS2A 2B63G 4DK6C 4K0KL 3RD4A 2LS01 3S2HB 4IJHA 3DEPA 4RHRA 1I3QH 2F0IA 1RL2A 1VQEA 2NZOA 4WRDA 4LWCA 1S5DD 4R4TA 1S5ED 1AZPA 2K01A 1BBWA 5JPMC 4B08A 4ODGA 3MXUA 1QZHA 4BY1G 2E2DC 5IYDG 1Q82C 1B8AA 4FF4A 4DR7Q 3C1FA 2UUAL 3T1HL 1PYWD 1PYSB 5BR8L 1I4QA 3AMUA 4DR2Q 2E8GA 1J6QA 2HQLA 4IPGA 4CDFC 1HR0L 1JWUD 4KY7A 3QR8A 4IUQA 3K59A 1JOQA 3KBGA 4KKTA 3N52A 1WI5A 4CKCA 1DCZA 1DM0B 1XTDA 4CHTB 1BR9A 1F2MA 2JXMB 4AQYQ 1ILQA 2MPMA 2JA6G 1B1ZA 4JI3L 1PLFA 2PMZE 1IL8A 4I7ZC 1PTOB 4RHSA 4UP8A 4FXKC 3UDIA 3CW2C 5C4ZA 5KGUA 1Q90A 2VY3A 2UXCL 1PVOA 1VQAA 3R2TA 4K8IA 1L0WA 1TS3A 2R7ZH 3X3MA 4K2LA 1E7ZA 4MHEA 2HHHQ 3CKIB 1V9PA 2IT1A 2F0MA 5KYIA 2Z9HA 1EL0A 5IOCA 2C5CA 4K6DA 4A3MB 5CYUA 4GN4B 4JI4Q 1GJXA 4RFBA 1SR3A 4DN4M 2RDGA 4BXXH 3NBIA 2WKDA 2NN6G 5EGTA 2F4IA 1TWCB 1VQGA 2CWPA 2MP1A 3Q24A 1CTMA 2AQ2B 4G57A 4X65Q 3DMUA 1PFSA 4JBMA 4LFCL 3PUZA 5I6YA 1EEFD 4O1NA 3OYYA 2PNRC 4NKLA 2XNAC 2Z1CA 1V43A 1Z7TA 5IWAQ 4OL7A 4HSVA 2BA1A 1QUQB 4OONA 1CK1A 1G2SA 2IHFA 3SDZA 1ESFA 4A3FH 4ME3A 1SEBD 3RZDB 4KK7A 4A3MG 1T5XD 4ZUIA 4HR7B 4QUFA 1BBXC 2PQAB 1LTGD 3I7FA 5AFWA 2BH2A 4E6IA 1CSPA 3TEHB 5C44G 4K14A 3E5SA 4FDBA 2VNUD 2QA4A 4IO9A 1JORA 1I4HA 1PMRA 2XWJB 1WVLA 1A8VA 2M00A 4NXNL 2KBNA 1X9NA 1TWGH 2GVAA 4X66Q 1EIFA 3DWAA 4CBVA 4KTAA 1FD7D 1HZAA 4DXFA 3W5OA 2QEJC 3K81C 1EQVA 1WCMB 3D4RA 1PRTC 1GKHA 3CCEA 4LF5L 3F2UA 4C2MH 3BDOA 3MAQA 4H0LC 2XWBB 1SJED 1I94Q 1LLRD 4XT3B 2MNAA 4ULLA 2F0FA 2F0WA 5GAEC 1E0BA 2L15A 3KF8A 3U9OA 2F0UA 4DPGA 5A2QL 2JA9A 1L2FA 3OTOL 1EOVA 1K3RA 1WJJA 1OXTA 1N32Q 3S1RH 3MWYW 2YU9B 1SMYD 1WCMG 4HCSA 3I4OA 1LT5D 3PF5A 1IBKL 3R93A 4BBSG 5JEAG 5C0XI 1KXLA 1QVCA 1K8AC 1F2ZA 2F0DA 4NMZA 1WTVA 4A3GB 4QCLA 4QGUA 1FYCA 3NHHA 4H7BA 4GNXA 2MUYA 4WJWA 1JB7A 3K5LA 2N55A 1STGA 2WAQB 1SFOH 1EZ6A 3PCOB 2MGSA 3PIP3 4DR4L 2WINB 1PRTD 1EY9A 1CZWA 2NVQB 1F2LA 3K8AA 4EQ5A 1TR5A 2X6LA 2OT2A 2NTTA 1CA5A 3T53B 1UE1A 4K6LA 2Q2HA 4JI8L 1VMCA 2XRSD 5M9OA 4LF8Q 3NP8A 4C3IB 1EYGA 1G91A 1UE7A 2VQEQ 4ZLTF 1YITA 1EUJA 1J5EQ 2KHJA 3P1HA 3CC2A 1MJEA 2E2HH 4A3BH 2L12A 2B3GA 4KD4A 1LTLA 3FPPA 3J80E 1L0YB 2DN8A 2E2IH 4R8IA 1H9JA 5FLXc 1IHZA 1EY5A 3KLRA 1HRJA 3M4QA 5LHY1 2ES2A 1IYVA 1U9RA 2L55A 1R4PB 3M4PA 3MVVA 2E75C 4CJ0B 1DXMA 1EYDA 1HZCA 2NYZD 5LL6S 4DA2A 5KNBA 1KRSA 4L5SA 4WFN3 3L7ZC 3L3OC 2NN6H 3EA6A 2XN9C 4C3IG 5GAGC 2I5LX 3HOXB 3HOUB 3W1BA 4DXGA 1TIID 2LKVA 4CDDC 1FGBD 4JI1L 3S14B 1C48A 1MSHA 1N33L 5D3DA 4BWGB 3EVQA 3DWQA 4YWKA 2KQ3A 2TMPA 1M4VA 2L0CA 2I0QA 1ZXTA 2HDMA 3H0GB 1WTOA 1HNXL 1V1PA 5C3EH 1RODA 1PYBA 4KJNA 1B50A 2PZUA 3BVMA 1STBA 2YTXA 1CUKA 1Y14B 3ULPA 3FDTA 1YIJA 4IFDJ 2EDGA 2UXDQ 4AIMA 4IUTA 4GOPA 3GTMH 2JA7H 1VS0A 2B2UC 4DK0A 2JA8G 4PMCA 4BY7B 4A3DB 1BCPF 3S1NB 3TRZA 3J7YW 5FK9C 3NWSA 3IKJA 2AWNA 3AB9A 4B3RL 3CXCA 3H0GG 5IP9G 1QG7A 2P5ZX 2OEOA 4LF9Q 1GHKA 2N78A 2QGQA 2D0PA 3JC66 3QIAA 4QUCA 2RCFA 2WAQE 4KMUC 1KC8C 5JJLA 1A63A 1W6JA 1H9RA 2O4XA 5CORA 1YJWA 3C2PA 3HOZG 4IUUA 3GTJH 4OX9L 5M5XB 2KECA 1TWAH 3I4MH 4KKSA 4A3DG 4IPHA 1YEZA 4L5TA 1FJGQ 1ICWA 3J80i 3GTQB 2NWGA 4KHZA 4CGYB 3ONAB 1HUNA 3RMHA 3EFXD 2IWHA 4CJ2C 2EXZA 4FO2A 5J3BA 2G9DA 4ZUJA 2SDFA 1TXYA 4X64Q 4R9WA 1LTID 1ZYRC 3MHBA 3M85A 1GVPA 3GO5A 4LUVA 1K3BC 4DV2L 3G48A 3MEHA 5IGDA 1PTOD 2A8VA 3RZOH 4KY5A 1EY6A 1VQFA 1LACA 1PA6A 1QWYA 2EJFC 3OW7A 1LO5D 4MTKA 3DUZA 2PI2A 1H9SB 3KK7A 3MA2B 3RUZA 4H13C 2EYPA 3C1EA 1DOMA 4XQQA 3F2CA 2NVXB 5C3XA 3E0EA 4NXMQ 5L37A 1Y1WH 1KQSA 3ULLA 2IHEA 2ATWA 4WORA 3D3RA 3IFDA 4H02A 4DAYA 4IFDG 2F0VA 1Y1VB 3J81L 1EY0A 2A68C 3FP9A 4G4KA 3HOYH 2EJMA 2BDNA 1SRUA 4K5VA 3WDNA 1VQPA 3J7AV 1OXVA 1F9RA 4ZKBB 1HNZL 1VQ9A 4DNTB 2F0KA 2YTYA 1ZYRD 2AMCB 3EIVA 3T13A 4A3JH 4IQZA 2C35B 3NK9A 3WOEA 3PGZA 1WD0A 1SJHD 4J8QA 2NTSA 2L11A 3Q8DA 4JVZA 4MZ9A 2E2JH 4Y52H 1HA6A 4RGTA 3SHLA 4A3IH 2MHVA 1Q12A 2JK8A 1Y1VG 3ND8A 4GN5A 3A7LA 1N36Q 2BE5C 3M7GA 1VQ5A 5IT9c 2VL6A 2VUMG 3PO3G 3FRPB 2CFMA 3TZUA 1EZ8A 2NVTH 3A74A 1Q7YC 2RHSB 4A3EH 2K5HA 4OWXB 1PH4A 1XMOQ 1TKWB 4HAEA 4B3ML 5LMUQ 5G3LF 5AJ3L 1M8AA 4CDEC 2B2UA 4UAIA 4ZKCB 1PH2A 3S16H 1F2YA 1C7YA 4YWMA 1DOLA 1QB5D 1VF7A 2RVLA 2WP8J 2F4VL 4RGOS 1DGSA 4MNOA 3FKIB 2A68D 4ILWA 4DR1L 1V8QA 3IFTA 5EBCA 3CF5A 1I6HB 5DLQE 1PZKD 3OPOA 5ELOA 3KLSA 2ZXPA 2Q8TA 4DV5Q 4OO1I 2EJGC 4EQPA 1XNQL 2K33A 3ERSX 3I73A 1TVXA 5M5WH 1I6VC 5C4XH 2V1CC 1BO0A 1CZGA 1F77A 3A8JE 1X56A 2Z0SA 2UU9Q 1JC7A 2K5WA 3RN2A 2IX0A 1N34L 3STBC 2ZTEA 3FKIG 2LSSA 3A8IE 3DXJC 4ZYSA 4K0KQ 2BE5D 3K7AB 1SNMA 4UDUC 4A3LH 1V1QA 3G4SA 4GN3B 1UNSA 4HJAA 4K8JA 4JOIA 1P16A 1HZBA 1QUQA 2EYOA 3F1ZA 4JBKA 3R3OA 4PQXA 4DV7L 2K5NA 1O7ZA 3CQZB 3MXNB 1X55A 4IPDA 4DV1L 1RJTA 2NUCA 2PQAA 3VR6A 2JA5H 4C3JH 2WFWA 3I2ZA 1CQVA 2UUAQ 3HKSA 4XXEA 2RDHA 3T1HQ 5CV5A 1L1OC 1E22A 5BR8Q 3A54A 4A3FB 3JAMc 1NUCA 1SXTA 3RLNA 5C0XJ 5M3FH 2ZT9C 3TSSA 1HR0Q 5BN4A 5FLXE 2CCZA 3DM3A 1HQMC 3OMGA 4NDXA 5GROA 1VQ4A 1IYUA 5JOBA 4M1UB 4TSSA 2WB1B 1JOKA 1GHJA 3SE0A 3OWEB 1JR0D 2AKWB 1R9TB 3STBD 3FMCA 4JI3Q 4JC0A 1SYBA 3J81j 1TWGB 5C5LA 2BCOA 1Z6HA 2OTJA 4RKBA 3DEOA 2O5JC 1JICA 1J9OA 4JI6L 1IBLQ 4A3CG 2UXCQ 1D5MC 1K8MA 1VQCA 2R7FA 4X3UA 3SEBA 1MHWC 4B3TL 3CPWA 1X3EA 4C2MB 2WB1G 2AHOB 5K36H 1K9MC 3I4NB 4IFDH 4U673 4BS9A 2CH4A 3RLOA 2K6AA 4DNRB 1PZID 1YJ9A 2O5IC 2QW7A 3BYYB 5NUCA 4KLKA 1KNEA 4L5RC 3SK8A 4DGZA 4LUZA 1IYJB 2IX1A 4G7OC 1NR4A 1PH5A 2RA4A 4HCEA 5D65A 1JJGA 4LFCQ 3AU7A 2KCMA 3A8KE 5A2QE 4DAYB 4LF6L 3VYSA 3MXPA 5EPJA 3L2PA 1CA6A 4JI0L 3T16A 4POGA 3FPUB 3MZ5A 3QOJA 2FMCA 3S1MH 1D1IA 1AH9A 3TS0A 2J0TD 3ERQA 2IJ0A 4EVOA 5IIFA 4QIWB 1TWFH 1Y8OB 2DNEA 5C0XG 5JJIA 1SFOB 3GTPH 2WACA 4N8X1 3IL8A 1TS4A 4ME5A 5CV7A 2PZTA 3A7AB 4LF7L 1RKNA 1I4PA 1Q1BA 3K5NA 4NXNQ 1I5FA 1NMGA 4C1NI 4DAPA 2F0OA 4DV0L 5IYCG 2J4XA 1S5BD 1AZQA 4UY8C 5BN3A 2OCEA 1A2UA 2NZ1D 2F0PA 3OOCA 4DV4L 1SAPA 3LGJA 2RQXA 4IJLA 3WOFA 4FF2A 4BBRH 1IBMQ 2E2IB 1L1OA 2KA7A 3F2BA 1CKNA 2WB1E 4O0AA 3S2DH 1JJCB 2HUGA 1WOCA 4OWTB 3QWNA 5KRUA 2F52A 4DF7A 3OTOQ 4YCVA 3KOJA 4P72A 3Q0AA 5EPLA 2DGYA 4ALPA 3K0YA 2KCCA 5FOBB 2CWAA 2VW9A 1XPUA 2F3VA 4J15A 2R93H 5JEAJ 1SSOA 1IBKQ 3IRBA 4A4IA 3S9WA 3K80C 2PPBC 4R8NA 1T5EA 4F7XA 3ND9A 3I55A 5FLXL 2EOTA 2Z8LA 2QILA 2ENBA 2ZM6L 3Q22A 5C3EB 1PZJD 1K73C 3S17H 3IAYA 1WTQA 2PI2E 3G6EA 1E2WA 1NCVA 1X65A 5H1SE 4DR4Q 1HJPA 2F0LA 3T56B 1UEBA 4WJ3M 3HP3A 1BCPC 3GTMB 3KLWA 2JA7B 1MIUA 5DM63 2LXKA 3NUCA 4RA8A 1BKBA 5COYA 1FGUA 3KF6B 5IYBG 1KABA 4DV3Q 3EJIA 3L9AX 4HMIA 1XTCD 1OO9B 1X32A 1ET9A 2E5LL 1JCKB 3GQBA 4QIWE 3S15H 2EYJA 3RR5A 2DJGC 3VDYA 4QY7A 3GTOH 3GTGH 3VR4A 1X3GA 4DFAA 1NE3A 1DYQA 3GTJB 3E0JA 1VQBA 2N88A 3PV0A 4FXGC 2R92H 2D9UA 1SDFA 2B63H 2Y0SB 2Q2UA 1EIYB 3D6CA 1D1KA 1RIPA 2GN5A 4AQYL 1GUWA 1BNZA 4EQNA 2EIFA 4A76A 1S5CD 2G9HD 4NB3A 4ZRZA 4LMQD
chains in the Genus database with same CATH topology
1FNWA 3BZDB 1TU2B 4IZ8A 3EQLC 3TP5A 1BCPD 1CFMA 5LL6X 3HG9A 1H9SA 3MTSA 3RZOB 2F0GA 1K83B 3D4DA 2EY2A 5KNDA 3ZYYX 3I91A 2AQ1B 5DNFA 3D4WA 5IGGA 5C4JB 5C0XH 3NXWA 2SNMA 5FKAC 2HDLA 2AUJD 4N9TA 4M8AA 2KCNA 3K58A 3H91A 5EQ0A 1Y1WB 1RDPD 1B9MA 5ELFA 2JEBI 4EGVA 4AYBB 5M3MB 1ZKOA 3DHQA 1Y69U 3TDQA 1PXUA 4Q5VA 1AP0A 3J81E 3HRZC 4HMJA 1MD2D 4IUPA 4BA2I 4A3JB 4PMWA 2EY5A 1ESRA 4A3IB 1KNAA 3P75A 2VB2X 5JPNC 5TSSA 1UAPA 1EFID 3LWUA 2V4DA 2VXWA 3BVZA 1O7YA 4CJ1B 3I72A 2SEBD 2GA4B 2JE6I 5FO7B 1J8IA 2NVTB 4BA1I 4FF1A 1PTOH 3NTKA 3K6OA 1GOZA 4A3EB 3HOVB 5T1GA 1IKLA 5F2DA 4B9XA 5CV4A 3S16B 3OIPA 1LTAD 1S4ZA 1LV9A 2FJ2A 5HGTA 3U9SA 1Q1EA 2BA0A 2E76C 3PO2B 1NR2A 2M9VA 5JVH3 1CHQD 1B4OA 3HOWB 3DWPA 1YNJC 5FO9B 5J1ZA 3SVMA 1QNKA 1A3VA 3M4OB 3MXNA 1LABA 1K8OA 4IALA 5CMDA 1QNUA 4TQUS 4OO1G 1S5FD 5G3LD 1ENCA 3O13A 1LTTD 3D6WA 1ENAA 4DK1A 3NTIA 1G2TA 2FHTA 2AWOA 4FVMA 3GTLB 1D5ZC 3P20A 1CQFA 1SYFA 1JOOA 1B53A 1HXYD 2KEDA 4JK1C 2F0JA 1U4MA 5HURA 3GTKB 1YNJD 4A3KB 1STEA 1STNA 4K2KA 2B2YC 4C3HB 3OIQA 1GUNA 3X3NA 1CT1D 2K7VA 5JEAH 1KDCA 4ZAIA 4G7HC 1I50B 2CW0C 4A93B 1PFMA 5E4XA 2IX3A 3JAML 3TBIB 3T4AC 2H1EA 3H94A 1SE2A 1F9QA 3SK5A 1H9KA 5C4HA 2EZVA 1RD9D 3VA7A 2HCIA 4C3HG 3PMFA 3VA5A 3GD7A 2B8FA 4HEDA 1SE4A 3PUWA 3PUXA 3NPPA 3VYUA 2A5HA 1PDQA 2RKSA 1I3QB 2EY1A 2F1MA 4G7ZC 2B2VC 3NE5B 1OXSC 2QF7A 1X3PA 1HPCA 3LNNA 4NP5A 2I46A 4FNFA 3G7LA 2IPKD 4LK1C 5KEEA 1DOKA 1RHPA 3W2DA 5JAVA 2YYZA 3GTPB 3VYTA 1L0XB 2F0EA 3GP7A 2HCCA 5ELBA 5CC4A 3QB3A 2RSNA 1STYA 2RBMA 1EQTA 1BCPB 3ITPA 2A73B 1AEXA 3NTHA 1CI3M 4QB4A 4BBRB 1A3UA 4PV1C 2K5QA 2MJ8A 1KLUD 2R7ZB 3HKZB 2EVBA 1II3A 1U4RA 1EWHA 1SNPA 1XYIA 1UEAB 1HFNA 1FNUA 2AQ3B 2F0TA 5CGKA 3QJYA 2B2YA 5EKKA 4S3SA 4KV6A 2D5DA 1UUPA 3PUVA 4YIJA 5EPKA 2K04A 1HCZA 1OXXK 1PTOF 2CQAA 1HHVA 3S17B 3SK4A 4O42A 4LAAA 5I9OA 4FYDA 3P7JA 3Q23A 4QF4A 4Z9CB 1D5XC 3V05A 4PNYA 2EYFA 1WTRA 2JYOA 2QCPX 4TRDA 4B9WA 4XTCS 1EYAA 1TY0A 2QKIC 5C5MA 4F8MA 1F9SA 2FFKB 1D6EC 1WTWA 3R8BA 1QCBD 2JEAI 1A6XA 3J7AF 3S15B 2DY7A 3CU7A 4RKLA 4XYOA 2K1BA 1RTNA 3TZDA 2BOSA 1BQQT 3GTOB 1GUGA 2EYMA 2ICIA 4F87A 2XVSA 1I4XA 1EY4A 2D2CC 2R92B 1SNQA 1LTBD 3TN2A 3DM1A 4K5XA 2X69A 1EIGA 1R4QB 3KLSX 1KDAA 1EU3A 4J1MA 4TKOB 4FXDA 3S1RB 5BN5A 5DAUA 2SOBA 2B2WC 4XQJA 4QMGA 5E1FA 1U4LA 3HGBA 1TS5A 4Q0FA 2KUMA 2XRQD 1VMPA 2WV6D 4KD3A 3I70A 5T1IA 1SYEA 1GUTA 1I4GA 2ID0A 4KI0A 5KIXA 1G291 3TP6A 2ICEC 1QJOA 2VB3X 4CKEA 1WTPA 1MI2A 2JA6B 4OHJA 3MC0B 4RCOA 3NQTA 4FP5D 2R61A 1G8ZD 3VR3A 4L63B 2A74C 3I4LA 2JP1A 5IGCA 1ENFA 1F9PA 4RH6A 3T51B 4A3BB 2E2HB 2ZXOA 4ID6A 4DAVA 4ZK9B 1RTOA 4U68A 2NB0A 5CV8A 2R6GA 4OIJA 2L4NA 3G6JB 1ML0D 1HA5A 2IW3A 1IW7C 1Y8PB 1TY2A 5IGBA 1Y8NB 1HTPA 1NAPA 2X6GA 2Q8RE 2PQEA 1B9NA 3BDLA 2RDFA 1Q3LA 1DD2A 1GUSA 2PW5A 3CRLC 1STHA 1STAA 1AFPA 5C44B 4IUVA 2KJXA 5IT9E 5IGEA 3UI2A 3BG3A 1XXGA 3VR2A 3HS0C 2PYKA 1RCVD 1BDOA 4KKUA 5JJZA 1XWEA 4GZYC 4RAUC 1A3TA 1SYCA 1CM9A 3VR5A 4PMBA 3FEWX 2B2WA 1SMYC 2F3WA 3E6ZX 1IW7D 3BYTB 1SBBB 3C46A 1SYGA 2B39A 1TWAB 3I4MB 1X3QA 4K5WA 1H9MA 1PFBA 2KOLA 3K5MA 4I65A 1SNDA 4HN7A 5M5YB 2KHSA 2RSOA 1BF4A 2PW7A 2LFNA 3V2TA 1EIHA 3R2IA 2R3ZA 3SXHA 3LWEA 2M2LA 4BBSB 2Z4IA 5I6WA 1EY8A 1VF5C 3D31A 1KDBA 5C6AA 3M7NA 2NBFA 3V96A 4N9PA 2PO4A 2I07B 3C3LA 1O7LA 2K05A 5D3IB 3W3AA 5EJWA 3CHBD 1CHPD 3EROA 2B2TC 4MIUA 1DJRD 2ZXRA 3JAME 1YNNC 5D14A 3QOLA 1SE3A 4IURA 4MN3A 1DONA 3HOYB 5ISRA 4NW2A 3GV6A 5J22A 4KHVA 1TWHB 5I2YA 1A15A 1KLGD 3OMCA 5EBDA 4KN7C 2E2JB 3SR1A 4XYQA 1LTRD 3NSWA 1OXUA 5K5PA 4XT1B 3Q6SA 5CR3A 1EEID 4ZQ3A 1RF2D 2J7ZA 5DM73 4RGNA 5CV6A 3FVQA 4IN3A 5C3WA 3RLFA 4J6HA 3CRKC 2JSOA 1YNND 2PCFB 2B8GA 2NN6I 1B2TA 4OGQC 5KYLA 2WIIB 1WD1A 1EYCA 5IT9L 4FF3A 1TQOA 3PIO3 3K57A 1E2VA 1JE4A 4ABNA 4L6TB 5M5WB 5I2XA 2E74C 5C4XB 4XIGS 2A69C 4Y7NB 2CVRA 2KVMA 2A6HC 2JA8B 1VDZA 3QG1A 1ZEQX 2OXPA 2XSCA 3K5OA 1SYDA 2F0HA 2IL8A 2QDBA 2AUKA 1WTXA 3S1QB 2FMMA 3D8GA 3HOZB 2JA5B 5A35A 4C3JB 3BVGA 1PTOC 3A56A 5I9PA 4X3TA 4V190 1E2ZA 5M3FB 1JQYD 2B2TA 1ONLA 2EYHA 4V0BA 2Q8IB 4LJZC 3BS1A 5EKIA 4C3JG 2A69D 2A6HD 3OSOA 4C56C 1BUVT 1PRTF 2WKCA 4X3SA 1TS2A 4RGMA 2TSSA 2A6EC 3TP7A 3I3CA 4EQOA 4HSPA 1I4RA 3NBHA 5E4WC 4F88A 2K03A 3LX0A 5ELEA 1JWMD 4H44C 4RWSC 1EWCA 5EKLA 4JBWA 1MGSA 2XIWA 3GV3A 1HUMA 3OWFA 1C8CA 2K28A 3M3YB 5I4DA 4IUNA 1JB3A 5IGFA 3OHXC 2DY8A 1ILPA 1XX8A 1AN8A 3KBXA 2K5DA 1QILA 3BDCA 1KAAA 2LMCB 4DU9A 5K36G 3VYRA 5J39A 3MFYA 5KNCA 3S1MB 2VUMB 1SNCA 3H09A 3PO3B 2CW0D 5ELCA 2F03A 2A6ED 2CHBD 2LY7A 4HTHA 2SNSA 1TWFB 3J80L 4CKBA 1GXDC 3N6RA 2HQEA 3QO2A 2EY6A 3HEJA 1B3AA 4OIKA 2Z4HA 4L8JA 1IKMA 4XQNA 2C9OA 1V1OA 2H4OA 1HQRD 1FR3A 1U4PA 2F0QA 1LT6D 1TT2A 4P2CB 1MSGA 2EE1A 1ET6A 5FO8B 2L9HA 2L1BA 4KN4C 2FINB 3I90A 1B44D 1JWSD 1W6KA 1SNOA 3NQIA 4KY6A 1LT3D 4OO1H 3S2DB 1GUOA 1Q8IA 3SK6A 1MBYA 4C1NK 2R93B 1HTLD 2KEEA 2L5TA 1V1PB 2D62A 5CBEE 2BDOA 1DZ1A 1PRTB 1FNVA 3PUYA 2OF1A 4KJOA 5ELDA 1QE6A 1A2TA 2EYLA 1O78A 1KTKA 2K32A 5IODA 4X3KA 3H6MA 2PMZB 1EOTA 1HFGA 1C4QA 5JVG3 1BXTA 2EPBA 5CV9A 2O2LD 1QOHA 2B2VA 4XDXA 3A55A 3I8ZA 2PZWA 3GTGB 1EY7A 1D2BA 1O80A 5CBAE 3MFGA 3MXGA 1PFNA 2B63B 1LTSD 1VCIA 3TMEA 3HZXA 1AW7A 2F0NA 3TP8A 1LT4D 1G6ZA 4RCNA 4IFDI 2DNCA 5DEHA 3URYA 1BOSA 2F0SA 1NSNS 5E3FA 3NWTA 4BY1B 3H3VC 3M4YA 1EU4A 2NVYB 1Z47A 3KUPA 3S2HB 3RD4A 2LS01 3DEPA 4RHRA 2F0IA 4WRDA 1S5DD 1S5ED 1AZPA 2K01A 5JPMC 4B08A 4ODGA 3MXUA 2E2DC 4FF4A 3C1FA 1PYWD 1I4QA 3AMUA 1JWUD 4KY7A 4IUQA 3K59A 1JOQA 3KBGA 4KKTA 3N52A 4CKCA 1DCZA 1DM0B 4CHTB 1BR9A 1F2MA 2JXMB 1ILQA 2MPMA 1B1ZA 1PLFA 1IL8A 4I7ZC 1PTOB 4RHSA 4FXKC 5C4ZA 5KGUA 1Q90A 3R2TA 4K8IA 1TS3A 3X3MA 4K2LA 4MHEA 3CKIB 2IT1A 2F0MA 5KYIA 1EL0A 5IOCA 2C5CA 4K6DA 4A3MB 5CYUA 1GJXA 4RFBA 4DN4M 2RDGA 3NBIA 2WKDA 2NN6G 5EGTA 2F4IA 1TWCB 2MP1A 3Q24A 1CTMA 2AQ2B 4G57A 3DMUA 3PUZA 5I6YA 1EEFD 4O1NA 2PNRC 4NKLA 2XNAC 2Z1CA 1V43A 1Z7TA 4OL7A 4HSVA 2BA1A 1CK1A 1G2SA 3SDZA 1ESFA 1SEBD 3RZDB 4KK7A 1T5XD 4ZUIA 4HR7B 4QUFA 1BBXC 1LTGD 5AFWA 4E6IA 4K14A 3E5SA 2VNUD 1JORA 1I4HA 1PMRA 2XWJB 1WVLA 2M00A 3DWAA 4CBVA 4KTAA 1FD7D 4DXFA 2QEJC 1EQVA 1WCMB 3D4RA 1PRTC 3F2UA 3BDOA 3MAQA 4H0LC 2XWBB 1SJED 1LLRD 4XT3B 4ULLA 2F0FA 2F0WA 1E0BA 3U9OA 3KF8A 2F0UA 5A2QL 1OXTA 3MWYW 2YU9B 1SMYD 4HCSA 1LT5D 3R93A 5JEAG 5C0XI 1F2ZA 2F0DA 4NMZA 1WTVA 4A3GB 4QCLA 1FYCA 3NHHA 4H7BA 2MUYA 4WJWA 3K5LA 2N55A 1STGA 2WAQB 1EZ6A 2MGSA 3PIP3 2WINB 1PRTD 1EY9A 1CZWA 2NVQB 1F2LA 1TR5A 2X6LA 2OT2A 2NTTA 1CA5A 3T53B 4K6LA 1VMCA 2XRSD 5M9OA 3NP8A 4C3IB 1G91A 4ZLTF 3P1HA 2L12A 4KD4A 3FPPA 3J80E 1L0YB 2DN8A 4R8IA 1H9JA 1IHZA 1EY5A 3KLRA 1HRJA 5LHY1 1IYVA 1U9RA 2L55A 1R4PB 3MVVA 4CJ0B 2E75C 1DXMA 1EYDA 2NYZD 4DA2A 5LL6S 5KNBA 4WFN3 3L7ZC 3L3OC 2NN6H 3EA6A 2XN9C 4C3IG 3HOXB 3HOUB 4DXGA 1TIID 2LKVA 1FGBD 3S14B 1C48A 1MSHA 5D3DA 4BWGB 3EVQA 3DWQA 2KQ3A 2TMPA 1M4VA 2L0CA 1ZXTA 2HDMA 3H0GB 1WTOA 1V1PA 1RODA 4KJNA 1B50A 2PZUA 3BVMA 1STBA 3FDTA 4IFDJ 2EDGA 4IUTA 2B2UC 4DK0A 4PMCA 4BY7B 4A3DB 1BCPF 3S1NB 3J7YW 5FK9C 3NWSA 3IKJA 2AWNA 3AB9A 1QG7A 2OEOA 1GHKA 3QIAA 4QUCA 4KMUC 1W6JA 1H9RA 2O4XA 5CORA 3C2PA 4IUUA 5M5XB 2KECA 4KKSA 1ICWA 3GTQB 2NWGA 4KHZA 4CGYB 3ONAB 1HUNA 3RMHA 3EFXD 2IWHA 4CJ2C 2EXZA 4FO2A 2G9DA 4ZUJA 2SDFA 4R9WA 1LTID 1ZYRC 3MHBA 3M85A 3GO5A 3MEHA 5IGDA 1PTOD 4KY5A 1EY6A 1LACA 1QWYA 2EJFC 3OW7A 1LO5D 3DUZA 1H9SB 3KK7A 3MA2B 3RUZA 4H13C 2EYPA 3C1EA 1DOMA 4XQQA 2NVXB 5C3XA 4WORA 3D3RA 3IFDA 4DAYA 4IFDG 2F0VA 1Y1VB 3J81L 1EY0A 2A68C 4G4KA 2EJMA 2BDNA 4K5VA 3WDNA 3J7AV 1OXVA 1F9RA 4ZKBB 4DNTB 2F0KA 1ZYRD 3T13A 4IQZA 3NK9A 3WOEA 1WD0A 1SJHD 4J8QA 2NTSA 2L11A 1HA6A 4RGTA 3SHLA 2MHVA 1Q12A 3ND8A 3A7LA 2BE5C 3M7GA 3FRPB 3TZUA 1EZ8A 1TKWB 4HAEA 5G3LF 1M8AA 2B2UA 4UAIA 4ZKCB 1F2YA 1DOLA 1QB5D 1VF7A 2RVLA 2WP8J 4RGOS 3FKIB 2A68D 4ILWA 1V8QA 3IFTA 5EBCA 1I6HB 1PZKD 3OPOA 3KLSA 2ZXPA 2Q8TA 4OO1I 2EJGC 4EQPA 2K33A 3I73A 1TVXA 1I6VC 1BO0A 1CZGA 1F77A 3A8JE 1JC7A 2K5WA 2IX0A 3A8IE 3DXJC 4ZYSA 2BE5D 3K7AB 1SNMA 4UDUC 1UNSA 4K8JA 2EYOA 3R3OA 4PQXA 1O7ZA 3CQZB 1RJTA 2NUCA 3VR6A 1CQVA 4XXEA 2RDHA 5CV5A 3A54A 4A3FB 1NUCA 1SXTA 5C0XJ 2ZT9C 3TSSA 5BN4A 5FLXE 1HQMC 3OMGA 4NDXA 1IYUA 5JOBA 4M1UB 4TSSA 2WB1B 1JOKA 1GHJA 3SE0A 3OWEB 1JR0D 1R9TB 3FMCA 1SYBA 1TWGB 5C5LA 2BCOA 1Z6HA 4RKBA 3DEOA 2O5JC 1JICA 1J9OA 1D5MC 1K8MA 4X3UA 3SEBA 4C2MB 5K36H 3I4NB 4IFDH 4U673 4BS9A 2K6AA 4DNRB 1PZID 2O5IC 3BYYB 5NUCA 1KNEA 3SK8A 4DGZA 2IX1A 4G7OC 1NR4A 2RA4A 4HCEA 5D65A 3AU7A 3A8KE 5A2QE 3VYSA 3MXPA 5EPJA 1CA6A 3T16A 3FPUB 3MZ5A 3QOJA 2FMCA 1D1IA 2J0TD 3ERQA 2IJ0A 4EVOA 5IIFA 4QIWB 1Y8OB 2DNEA 5C0XG 1SFOB 2WACA 3IL8A 1TS4A 4ME5A 5CV7A 2PZTA 3A7AB 1RKNA 1I4PA 1Q1BA 3K5NA 4C1NI 4DAPA 2F0OA 2J4XA 1S5BD 1AZQA 5BN3A 1A2UA 2NZ1D 2F0PA 3OOCA 1SAPA 2RQXA 3WOFA 4FF2A 2E2IB 2KA7A 2HUGA 3QWNA 5KRUA 4DF7A 3Q0AA 5EPLA 3K0YA 2KCCA 5FOBB 2F3VA 5JEAJ 1SSOA 3S9WA 2PPBC 4R8NA 1T5EA 4F7XA 3ND9A 5FLXL 2EOTA 2Z8LA 2QILA 2ENBA 3Q22A 5C3EB 1PZJD 3IAYA 1WTQA 1E2WA 1NCVA 2F0LA 3T56B 3HP3A 1BCPC 3GTMB 2JA7B 5DM63 3NUCA 4RA8A 5COYA 1KABA 3EJIA 3L9AX 4HMIA 1XTCD 1OO9B 1X32A 1ET9A 1JCKB 3GQBA 2EYJA 3VR4A 4DFAA 1DYQA 3GTJB 3E0JA 2N88A 3PV0A 4FXGC 2D9UA 1SDFA 2Y0SB 3D6CA 1D1KA 1GUWA 1BNZA 4EQNA 1S5CD 2G9HD 4ZRZA 4LMQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3F A;  1SNO A;  1STG A;  2F3W A;  4J6H A;  4G57 A;  4KY6 A;  3DMU A;  3TP7 A;  5JOB A;  2OEO A;  1EZ6 A;  2RKS A;  5I6Y A;  4EQO A;  3RUZ A;  1SYB A;  4IZ8 A;  1EZ8 A;  3TP5 A;  4NKL A;  5J1Z A;  2EY1 A;  3SK4 A;  4OL7 A;  5C5L A;  3SK6 A;  4LAA A;  3LX0 A;  3NQT A;  2F0G A;  3D4D A;  1EY9 A;  1SYG A;  2EY2 A;  4RKB A;  5HGT A;  5I9O A;  2O4X A;  1TR5 A;  5KRU A;  1A3V A;  2F0I A;  4K5W A;  4DF7 A;  4QF4 A;  1F2Y A;  4IAL A;  5IIF A;  4WRD A;  3D4W A;  4ZUI A;  5KYL A;  5IGG A;  5IGC A;  4I65 A;  5EKL A;  1SND A;  4PNY A;  2F3V A;  2KHS A;  3OWF A;  5M9O A;  4NP5 A;  2EYF A;  3NP8 A;  2PW7 A;  3NXW A;  1EYC A;  4TRD A;  3V2T A;  2SNM A;  4ODG A;  4B9W A;  4E6I A;  4IUN A;  1ENC A;  4ID6 A;  4N9T A;  1EYA A;  1TQO A;  4K14 A;  5C5M A;  4F8M A;  3E5S A;  5IGF A;  3S9W A;  3SXH A;  2EXZ A;  4R8N A;  1ENA A;  3P1H A;  4F7X A;  4ZUJ A;  3C1F A;  5KEE A;  4KD4 A;  5I6W A;  1JOR A;  5JAV A;  1EY8 A;  3MHB A;  2OF1 A;  4KJO A;  1KDB A;  2M00 A;  5NUC A;  5C6A A;  2ENB A;  4N9P A;  1IHZ A;  1A2T A;  1EY5 A;  5CV8 A;  4RKL A;  3BDC A;  3SK8 A;  1KAA A;  3MEH A;  4EQP A;  4DGZ A;  5IGD A;  2F0E A;  1U9R A;  4DU9 A;  2EYL A;  2OXP A;  3MVV A;  4KTA A;  2EYM A;  3DHQ A;  4KY5 A;  4KY7 A;  1EY6 A;  1EYD A;  5J39 A;  1SYF A;  5CC4 A;  3QB3 A;  1JOQ A;  1SNC A;  1EQV A;  1STY A;  2F0L A;  5IOD A;  1JOO A;  3MXP A;  1EY4 A;  1SNQ A;  3ERO A;  4HMJ A;  3H6M A;  4MIU A;  1SYD A;  2F0H A;  4HTH A;  4K5X A;  2QDB A;  2SNS A;  1SNM A;  2F0J A;  2RBM A;  2LKV A;  3T16 A;  3MZ5 A;  3QOJ A;  5HUR A;  5IGB A;  3QOL A;  5CV9 A;  1F2M A;  3ITP A;  1STN A;  4K8J A;  3NUC A;  2EYO A;  4K2K A;  2PQE A;  2EY5 A;  3D8G A;  3R3O A;  2HQE A;  3EVQ A;  2EYP A;  3BDL A;  2RDF A;  3C1E A;  1KDA A;  1AEX A;  3ERQ A;  3P75 A;  4EVO A;  2EY6 A;  2KQ3 A;  3HEJ A;  4QB4 A;  4J1M A;  5C3X A;  2F0F A;  1KAB A;  2F0W A;  3EJI A;  1A3U A;  4HMI A;  2PW5 A;  3U9O A;  5I9P A;  1KDC A;  1STH A;  2F0U A;  1STA A;  2PZW A;  5ISR A;  2NUC A;  2WAC A;  4WOR A;  1EY7 A;  5C4Z A;  5DAU A;  5KGU A;  2F0V A;  4ME5 A;  5CV7 A;  1EY0 A;  2PZT A;  5EGT A;  2EYJ A;  2SOB A;  5J22 A;  1II3 A;  4KHV A;  4K8I A;  1SNP A;  1RKN A;  4KJN A;  4QMG A;  2PZU A;  5CV5 A;  5F2D A;  5IGE A;  4K5V A;  5E1F A;  2PYK A;  4DFA A;  1STB A;  1NUC A;  2F0T A;  3OMC A;  4B9X A;  4K2L A;  5CV4 A;  2EYH A;  3TME A;  5CGK A;  2F0Q A;  2F0O A;  3SK5 A;  2F0K A;  5C4H A;  3HZX A;  5KYI A;  2F0M A;  2F0N A;  1TT2 A;  3OMG A;  4NDX A;  3SR1 A;  3T13 A;  3TP8 A;  4KD3 A;  1A2U A;  5IOC A;  3D6C A;  5K5P A;  2F0P A;  4K6D A;  3PMF A;  3NK9 A;  5CR3 A;  1A3T A;  1F2Z A;  5DEH A;  5EKK A;  1SYE A;  1SYC A;  2F0D A;  3OSO A;  4NMZ A;  4S3S A;  4ZQ3 A;  4PMC A;  3VA5 A;  4EQN A;  4KV6 A;  5KIX A;  2F0S A;  3TP6 A;  3SHL A;  3NHH A;  4H7B A;  1NSN S;  5CV6 A;  4PMB A;  4YIJ A;  1JOK A;  5C3W A; 
#chains in the Genus database with same CATH topology
 4IPC A;  1M1K C;  3E9H A;  4JI1 Q;  1FNW A;  3BZD B;  1N33 Q;  1PH7 A;  1TU2 B;  4IZ8 A;  3EQL C;  3TP5 A;  1BCP D;  1CFM A;  4R4I A;  5LL6 X;  1VQI A;  4BY1 H;  4DR5 L;  3HG9 A;  1H9S A;  5IYD H;  2NVY H;  3MTS A;  3RZO B;  2F0G A;  1K83 B;  3D4D A;  2EY2 A;  5KND A;  3WWV A;  4PZ7 A;  3ZYY X;  3I91 A;  1HNX Q;  2AQ1 B;  3S2H H;  5DNF A;  3D4W A;  5IGG A;  1U0L A;  5C4J B;  5C0X H;  5IP7 G;  4JI4 L;  3NXW A;  2SNM A;  5FKA C;  2HDL A;  1NTG A;  2AUJ D;  4N9T A;  4M8A A;  4UP9 A;  1UWV A;  2KCN A;  3K58 A;  3H91 A;  1QVG A;  5EQ0 A;  1D8L A;  1Y1W B;  1RDP D;  1B9M A;  2BH8 A;  5ELF A;  2JEB I;  5IWA L;  3J7A 5;  2JA6 H;  4EGV A;  4AYB B;  5M3M B;  1ZKO A;  3DHQ A;  3F2D A;  4A3G G;  1Y69 U;  1PH1 A;  2EXD A;  4X62 Q;  1PH8 A;  3TDQ A;  1PXU A;  4Q5V A;  1AP0 A;  3J81 E;  3HRZ C;  4HMJ A;  1MD2 D;  4IUP A;  4BA2 I;  2WAQ G;  4A3J B;  1B3Q A;  4PMW A;  4OX9 Q;  2EY5 A;  1ESR A;  3RNU A;  4A3I B;  1KNA A;  3P75 A;  2VB2 X;  5JPN C;  5TSS A;  4QJF A;  1UAP A;  4RMF A;  1EFI D;  3LWU A;  1S72 A;  2V4D A;  2VXW A;  3BVZ A;  1O7Y A;  4CJ1 B;  3I72 A;  4AYB G;  2SEB D;  5M3M G;  2GA4 B;  2JE6 I;  5FO7 B;  4DV6 L;  1J8I A;  2ZTC A;  2VQF L;  4BA1 I;  4FF1 A;  2NVT B;  1PTO H;  3NTK A;  3K6O A;  5FLM G;  1GOZ A;  4A3E B;  3HOV B;  5T1G A;  1IKL A;  5F2D A;  1L1O B;  4B9X A;  5CV4 A;  3S16 B;  4DV2 Q;  1CKN B;  3B6Y A;  3OIP A;  1LTA D;  1S4Z A;  4OXP A;  4LFB Q;  1LV9 A;  2FJ2 A;  5HGT A;  3U9S A;  1Q1E A;  2Z6K C;  2BA0 A;  2E76 C;  1C9O A;  1NR2 A;  3PO2 B;  2Y0S E;  4GKK L;  2ALY B;  2M9V A;  5JVH 3;  1CHQ D;  2FXQ A;  4A3M H;  1B4O A;  1H95 A;  3HOW B;  3OW2 A;  3CC7 A;  3HOV G;  3DWP A;  1UE5 A;  1YNJ C;  1TWC H;  3PIO A;  4HJ9 A;  3HOX G;  3HOU G;  5FO9 B;  5J1Z A;  1KD1 C;  5C44 H;  4OWW B;  3ICE A;  3SVM A;  1HR0 W;  1QNK A;  1A3V A;  1P8L A;  3M4O B;  3MXN A;  5GQO A;  1LAB A;  1K8O A;  4IAL A;  5CMD A;  5LMN L;  1QNU A;  4TQU S;  4OO1 G;  1S5F D;  4YWL A;  2K75 A;  3PO2 G;  1VQJ A;  1HNZ Q;  5G3L D;  1ENC A;  3O13 A;  1LTT D;  3D6W A;  4HIM A;  1XNR L;  3HOW G;  2NZH A;  1ENA A;  4DK1 A;  2HD3 A;  3NTI A;  4HJ5 A;  1G2T A;  2FHT A;  2AWO A;  4FVM A;  3GTL B;  3J81 i;  1D5Z C;  3P20 A;  1CQF A;  2OWO A;  4LNQ A;  4JCV E;  3ULJ A;  1SYF A;  4BY7 G;  1JOO A;  1B53 A;  1K28 A;  4AYB E;  4JI5 Q;  1HXY D;  2KED A;  4P71 A;  1MKH A;  4JK1 C;  1NMF A;  2F0J A;  4B3M Q;  1U4M A;  5M5Y H;  5HUR A;  4LF4 L;  3GTK B;  1YNJ D;  4A3K B;  1STE A;  1STN A;  3CCM A;  2UXB L;  4K2K A;  1WCM H;  4JYA L;  2B2Y C;  4APV A;  4C3H B;  3OIQ A;  4QQB X;  1GUN A;  3X3N A;  2F4V Q;  1CT1 D;  4BBS H;  2K7V A;  5JEA H;  4DR1 Q;  1KDC A;  4ZAI A;  4G7H C;  1I50 B;  2QEX A;  2CW0 C;  4A93 B;  1PFM A;  5E4X A;  2IX3 A;  1QVF A;  3JAM L;  2UUC L;  3TBI B;  3T4A C;  2H1E A;  3H94 A;  1SE2 A;  1F9Q A;  1LM0 A;  3SK5 A;  4A3K G;  1H9K A;  5C4H A;  2EZV A;  1XNQ Q;  1JE5 A;  1RD9 D;  2Z6B A;  1C0A A;  3VA7 A;  2HCI A;  4C3H G;  2R7D A;  3PMF A;  4GKJ L;  1IL2 A;  1N34 Q;  3VA5 A;  3GD7 A;  2B8F A;  4HED A;  1LUZ A;  1MJC A;  1SE4 A;  3PUW A;  3PUX A;  3NPP A;  1FVI A;  4A3G H;  4IOA A;  3VYU A;  2A5H A;  4DUZ L;  1PDQ A;  2RKS A;  1Q8K A;  4DV7 Q;  1I3Q B;  2EY1 A;  2F1M A;  4G7Z C;  1TWH H;  2D0O A;  4DV1 Q;  2B2V C;  5FJ8 G;  3NE5 B;  2UUB L;  1OXS C;  2QF7 A;  1X3P A;  4PZ8 A;  3CCU A;  1HPC A;  3LNN A;  4NP5 A;  2PNH A;  5GAD C;  2I46 A;  4FNF A;  3G7L A;  2IPK D;  4LK1 C;  4C3I H;  5KEE A;  1DOK A;  1RHP A;  3W2D A;  5JAV A;  4LFA L;  2YYZ A;  3GTP B;  3KDF B;  5ELN A;  4A75 A;  3VYT A;  1L0X B;  4HIO A;  2HT1 A;  2F0E A;  3GP7 A;  4JI7 L;  2HCC A;  1SLJ A;  3BU2 A;  2RHQ B;  5ELB A;  5CC4 A;  3QB3 A;  2RSN A;  2MQH A;  1STY A;  3K7U C;  4UP7 A;  1JMC A;  2RBM A;  1EQT A;  4JI6 Q;  1BCP B;  2K52 A;  3ITP A;  2A73 B;  4DR6 L;  1AEX A;  3NTH A;  4B3T Q;  1CI3 M;  3AFQ A;  4QB4 A;  4BBR B;  3S14 H;  4GLV B;  1A3U A;  4PV1 C;  2K5Q A;  2MJ8 A;  1KLU D;  2R7Z B;  3HKZ B;  2MO1 A;  4Y7N H;  2VZA A;  2EVB A;  1II3 A;  2JA8 H;  1U4R A;  1EWH A;  1SNP A;  1XYI A;  1UEA B;  4DAM A;  1HFN A;  1FNU A;  4YHH L;  2AQ3 B;  2F0T A;  3U58 A;  1YNX A;  3H0G H;  5CGK A;  5IP9 H;  3QJY A;  2K4K A;  4PG3 A;  3UDG A;  2N49 A;  1SRO A;  2B2Y A;  4LF6 Q;  5EKK A;  3S1Q H;  4S3S A;  3ER0 A;  4DR3 L;  4KV6 A;  3A5U A;  3U4V A;  3HOZ H;  2D5D A;  1S40 A;  1K8G A;  4JI0 Q;  1UUP A;  2R7Z G;  3PUV A;  4YIJ A;  5EPK A;  2K04 A;  1HCZ A;  1OXX K;  4HIK A;  4A3D H;  3S1N H;  1PTO F;  2CQA A;  3H15 A;  1HHV A;  1CSQ A;  3S17 B;  3SK4 A;  4O42 A;  4LAA A;  3H3V H;  3NEN A;  3T1Y L;  5I9O A;  4FYD A;  3P7J A;  2XGT A;  3KF6 A;  3Q23 A;  4BXX G;  4QF4 A;  4Z9C B;  4LF7 Q;  1D5X C;  3V05 A;  1Q81 C;  3BZK A;  3CCR A;  1ASY A;  4PNY A;  1N8R C;  2EYF A;  2KCT A;  1WTR A;  4DKA C;  2JYO A;  2QCP X;  4TRD A;  4B9W A;  1XMQ L;  2IY5 B;  1VQ6 A;  4DV0 Q;  1PHJ A;  2ZJP A;  4XTC S;  2N8N A;  1EYA A;  1TY0 A;  2QKI C;  5M5X H;  5C5M A;  4F8M A;  1PH3 A;  1F9S A;  2FFK B;  4B3S L;  1D6E C;  3MEF A;  3W1G A;  4A3F G;  3R8B A;  1QCB D;  1WTW A;  3GTQ H;  1GO3 E;  2JEA I;  4DV4 Q;  1A6X A;  3J7A F;  3E9I A;  3S15 B;  2DY7 A;  3CU7 A;  1HNW L;  4RKL A;  4XYO A;  2K1B A;  1RTN A;  3TZD A;  2BOS A;  1BQQ T;  1XMO L;  4JI2 L;  3GTO B;  1GUG A;  2EYM A;  2ICI A;  4F87 A;  2XVS A;  1I4X A;  1EY4 A;  2D2C C;  2R92 B;  1SNQ A;  1LTB D;  2A1A A;  3TN2 A;  3DM1 A;  4K5X A;  2X69 A;  1SMX A;  1EIG A;  4LUO A;  2HIV A;  3NBH B;  3M3Y H;  2JN4 A;  3J80 c;  1R4Q B;  3KLS X;  1KDA A;  1EU3 A;  4J1M A;  4TKO B;  4FXD A;  3S1R B;  4DK3 C;  5BN5 A;  5DAU A;  1Q86 C;  2SOB A;  2B2W C;  4XQJ A;  3AYH B;  4DUY L;  1K0S A;  4QMG A;  5E1F A;  3I4N G;  3HKZ E;  1U4L A;  1Y1V H;  3HGB A;  1TS5 A;  4Q0F A;  2ZM6 Q;  2VUM H;  3KJO A;  3PO3 H;  1X3F A;  2ZJR A;  2KUM A;  2XRQ D;  1W3S A;  1VMP A;  2WV6 D;  4KD3 A;  1PH6 A;  3I70 A;  5T1I A;  4KHP L;  1SYE A;  1GUT A;  1I4G A;  2ID0 A;  4KI0 A;  5GAH C;  3CCV A;  5KIX A;  1G29 1;  3TP6 A;  2ICE C;  1QJO A;  2VB3 X;  4YY3 L;  4CKE A;  4GLA C;  3L0O A;  4QL5 A;  1XPO A;  4R4Q A;  1KAW A;  1MI2 A;  1WTP A;  4HJ8 A;  2JA6 B;  4OHJ A;  3MC0 B;  1Z9F A;  4RCO A;  3NQT A;  4FP5 D;  2R61 A;  4UPA A;  2E5L Q;  1G8Z D;  3VR3 A;  2K5V A;  4L63 B;  2A74 C;  1YHB A;  3I4L A;  2JP1 A;  5IGC A;  1ENF A;  3I56 A;  1F9P A;  4RH6 A;  3K0X A;  3T51 B;  4A3B B;  2E2H B;  4LF5 Q;  2ZXO A;  4ID6 A;  4DAV A;  1E3P A;  3GDE A;  4ZK9 B;  1RTO A;  3FKI H;  3CCS A;  4U68 A;  2K14 A;  2Q2T A;  2NB0 A;  1I6H H;  5CV8 A;  3CCL A;  2R6G A;  1EQR A;  4OIJ A;  1CKM A;  2L4N A;  3G6J B;  1NJI C;  1O7I A;  4AH6 A;  1IBL L;  4GNX C;  1U5K A;  3CPF A;  1VQ7 A;  1ML0 D;  2VS1 A;  1HA5 A;  4A3B G;  4DR5 Q;  2IW3 A;  1IW7 C;  1Y8P B;  1TY2 A;  5IGB A;  1Y8N B;  1HTP A;  1NAP A;  2X6G A;  2Q8R E;  1NNX A;  3EN2 A;  3TQY A;  2PQE A;  3K7A H;  1B9N A;  3BDL A;  2RDF A;  3UE0 A;  4JV5 L;  1Q3L A;  1DD2 A;  1GUS A;  2B29 A;  2PW5 A;  3CRL C;  1STH A;  1STA A;  4P73 A;  2CKZ B;  1AFP A;  1B7Y B;  5IE8 A;  5C44 B;  3CQZ H;  3HFZ B;  4IUV A;  2KJX A;  4NPS A;  5IT9 E;  5IGE A;  3UI2 A;  3BG3 A;  1EWI A;  1XXG A;  3HS0 C;  3VR2 A;  2PYK A;  2KHI A;  3ZJY C;  1RCV D;  1BDO A;  2RCN A;  4KKU A;  5JJZ A;  1XWE A;  4JI8 Q;  4GZY C;  4RAU C;  2HIX A;  4DR7 L;  1A3T A;  1YVC A;  1SYC A;  1CM9 A;  3VR5 A;  5C3E G;  4DR2 L;  4A3C H;  4PMB A;  3FEW X;  2B2W A;  1SMY C;  2F3W A;  2XTI A;  3E6Z X;  4MTN A;  2CH4 W;  3CME A;  3RN5 A;  1IW7 D;  3BYT B;  1SBB B;  3C46 A;  3A5Z B;  2JA7 G;  1R9T H;  4P74 A;  1QZG A;  1SYG A;  3SGI A;  2B39 A;  1TWA B;  3I4M B;  4TVA B;  1X3Q A;  4K5W A;  1H9M A;  4DV6 Q;  3F8T A;  2VQF Q;  1HH2 P;  2A19 A;  1PFB A;  2KOL A;  2G5D A;  3K5M A;  1E1O A;  4I65 A;  1SND A;  3NEL A;  4HN7 A;  5M5Y B;  2KHS A;  2RSO A;  1BF4 A;  3KJP A;  2PW7 A;  2GVB A;  2LFN A;  3V2T A;  1EIH A;  1NY4 A;  3R2I A;  1FL0 A;  2R3Z A;  1BVS A;  1E24 A;  1M90 C;  3SXH A;  1VQM A;  3LWE A;  2M2L A;  1IBM L;  4BBS B;  2Z4I A;  5I6W A;  3I4N H;  4GOP C;  1EY8 A;  1VF5 C;  3D31 A;  1KDB A;  5C6A A;  3M7N A;  2NBF A;  4YCU A;  3V96 A;  4N9P A;  2PO4 A;  2QDL A;  2HHH L;  4GKK Q;  3I4M G;  1B70 B;  2Y0S G;  2I07 B;  3C3L A;  1O7L A;  2K05 A;  5D3I B;  1BBU A;  3W3A A;  5EJW A;  3CHB D;  1CHP D;  3ERO A;  2B2T C;  4MIU A;  1DJR D;  2ZXR A;  3JAM E;  1YNN C;  4IOC A;  3CCQ A;  5D14 A;  3QOL A;  5JJK A;  4X65 L;  1SE3 A;  4IUR A;  4MN3 A;  1DON A;  5LMN Q;  5IYC H;  1YBY A;  4JG2 A;  3HOY B;  4X6A H;  4OEM B;  3BJU A;  5ISR A;  4B3R Q;  1XNR Q;  4NW2 A;  1YZ6 A;  3GV6 A;  5J22 A;  3AQQ A;  4KHV A;  5HY6 A;  1TWH B;  5I2Y A;  1A15 A;  2F3I A;  1KLG D;  1G51 A;  3OMC A;  5EBD A;  3PIP A;  3KDF A;  4KN7 C;  5EAY A;  2E2J B;  3SR1 A;  4XYQ A;  1Y1W G;  1X54 A;  1LTR D;  3NSW A;  3AFP A;  1OXU A;  5K5P A;  4XT1 B;  3Q6S A;  5CR3 A;  1WFQ A;  1EEI D;  4ZQ3 A;  1GM5 A;  3HOY G;  1KRT A;  1PH9 A;  1RF2 D;  2J7Z A;  5DM7 3;  4JPB W;  4RGN A;  4DV3 L;  1VQH A;  5CV6 A;  4LF4 Q;  3FVQ A;  4IN3 A;  5C3W A;  2JQO A;  4X66 L;  3RLF A;  4J6H A;  3CRK C;  2UXB Q;  2JSO A;  4HID A;  4JYA Q;  1YNN D;  4A3J G;  2PCF B;  2B8G A;  2I5H A;  2NN6 I;  4A3I G;  1K0R A;  1B2T A;  1OTC A;  5IY0 A;  2UUC Q;  4OGQ C;  5KYL A;  3FHW A;  1I94 L;  2WII B;  3UDX A;  1WD1 A;  1EYC A;  5IT9 L;  1HZ9 A;  4FF3 A;  1TQO A;  3PIO 3;  4HJ7 A;  3K57 A;  4A3E G;  1E2V A;  1JE4 A;  4ABN A;  3NEM A;  2K50 A;  1ASZ A;  1N32 L;  4GKJ Q;  4L6T B;  5M5W B;  3D0F A;  5I2X A;  2E74 C;  5C4X B;  4XIG S;  2A69 C;  4Y7N B;  2CVR A;  2KVM A;  2A6H C;  2JA8 B;  1VDZ A;  2N3S A;  2H5X A;  3QG1 A;  3JAM i;  1ZEQ X;  2OXP A;  5IYB H;  4DUZ Q;  2XSC A;  1KHI A;  2RF4 A;  4PZ6 A;  3K5O A;  3RZD H;  1SYD A;  2F0H A;  2IL8 A;  2QDB A;  2AUK A;  2UUB Q;  4GLX A;  1WTX A;  3S1Q B;  1VQD A;  2FMM A;  2JJQ A;  3D8G A;  4UHV A;  3HOZ B;  2JA5 B;  5A35 A;  2ZTD A;  4C3J B;  3BVG A;  1PTO C;  5C4X G;  1JJ2 A;  4L5Q A;  3A56 A;  5I9P A;  1WTH A;  4X3T A;  4V19 0;  1E2Z A;  4WJ4 A;  5M3F B;  3U4Z A;  4A3L G;  5E7N A;  4LFA Q;  1JQY D;  2B2T A;  4X62 L;  1ONL A;  2YTV A;  4LF8 L;  3G71 A;  2EYH A;  5AJ3 Q;  2VQE L;  4V0B A;  1KIX A;  2Q8I B;  4JI7 Q;  1J5E L;  4LJZ C;  3BS1 A;  5EKI A;  2JA5 G;  4C3J G;  2A69 D;  2DUD A;  3E3X A;  2A6H D;  3OSO A;  4C56 C;  1BUV T;  1PRT F;  3CD6 A;  2WKC A;  4X3S A;  1TS2 A;  4RGM A;  2TSS A;  1XJV A;  4CDC C;  2A6E C;  1VQO A;  5M3F G;  3TP7 A;  2CQO A;  1WYD A;  3I3C A;  4EQO A;  5IP7 H;  4DR6 Q;  4HSP A;  1GD7 A;  1I4R A;  1IZ6 A;  3NBH A;  4JOI C;  5E4W C;  1AE3 A;  4F88 A;  2K03 A;  3LX0 A;  5ELE A;  2OQK A;  2YU9 H;  1JWM D;  4H44 C;  1IXR A;  4RWS C;  1EWC A;  4LFB L;  3KF8 B;  3PSI A;  1K83 H;  1SN8 A;  4YHH Q;  5EKL A;  4JBW A;  1MGS A;  2XIW A;  3GV3 A;  1HUM A;  3OWF A;  1C8C A;  2K28 A;  3M3Y B;  5I4D A;  4A93 G;  4IUN A;  2MFI A;  1JB3 A;  5IGF A;  3OHX C;  2DY8 A;  5C4J H;  1ILP A;  3KFU A;  1XX8 A;  4EX5 A;  4DR3 Q;  1AN8 A;  3KBX A;  2K5D A;  1QIL A;  3BDC A;  1KAA A;  2LMC B;  1VQL A;  4R4O A;  4DU9 A;  2UXD L;  2Z6K A;  5K36 G;  3CP0 A;  3VYR A;  2NVQ H;  5J39 A;  3MFY A;  5KNC A;  3S1M B;  2VUM B;  4GNX B;  1SNC A;  3H09 A;  4P75 A;  2CW0 D;  3PO3 B;  5ELC A;  2F03 A;  2A6E D;  2CHB D;  2LY7 A;  5M3M H;  3T1Y Q;  4HTH A;  2EQS A;  2SNS A;  1TWF B;  5FLM H;  3J80 L;  4CKB A;  1GXD C;  3N6R A;  2OTL A;  4LF9 L;  2HQE A;  3QO2 A;  1X6O A;  2EY6 A;  2YV5 A;  3HEJ A;  1T9H A;  1B3A A;  4ZCK A;  2KEN A;  1XMQ Q;  4JBJ A;  4OIK A;  4JW0 A;  2MO0 A;  2I5M X;  2Z4H A;  1G6P A;  1Q46 A;  4L8J A;  1IKM A;  4XQN A;  2C9O A;  1V1O A;  2H4O A;  4B3S Q;  1HQR D;  4I7A A;  1FR3 A;  1FJG L;  1HNW Q;  1U4P A;  2F0Q A;  1VQN A;  4JI5 L;  3HOV H;  3CC4 A;  4JI2 Q;  3HOX H;  1LT6 D;  1TT2 A;  4P2C B;  3HOU H;  1MSG A;  2EE1 A;  1D7Q A;  1ET6 A;  4POF A;  4X64 L;  3PF4 A;  3PQI A;  5FO8 B;  1PV4 A;  1YHA A;  3KYH C;  2L9H A;  2L1B A;  4KN4 C;  2FIN B;  3I90 A;  1B44 D;  1JWS D;  1W6K A;  1SNO A;  3NQI A;  2OQ0 A;  4KY6 A;  1LT3 D;  1A0I A;  4N8F A;  4OO1 H;  3S2D B;  1UE6 A;  3PO2 H;  3S24 A;  1GUO A;  1VQ8 A;  1LYL A;  1Q8I A;  2DJF C;  3BZC A;  3SK6 A;  3CAM A;  3HOW H;  1YI2 A;  1MBY A;  4C1N K;  3U50 C;  1EQQ A;  1N9W A;  2R93 B;  1SE8 A;  1HTL D;  2KEE A;  3UDF A;  4BBR G;  4DUY Q;  4O2D A;  3AEV A;  1E1T A;  3M4O H;  3HKZ G;  2L5T A;  1YJN A;  4NXM L;  1V1P B;  4LW1 A;  2D62 A;  5CBE E;  4BY7 H;  1VQK A;  2BDO A;  1DZ1 A;  1JT8 A;  1PRT B;  1FNV A;  3PUY A;  2ZJQ A;  4KHP Q;  2OF1 A;  4R1J A;  4KJO A;  4GOP B;  5ELD A;  1QE6 A;  1A2T A;  3J7Z C;  2R93 G;  2EYL A;  1O78 A;  4YY3 Q;  4YCW A;  3GTL H;  3H3V I;  1KTK A;  2K32 A;  4GS3 A;  5IOD A;  4X3K A;  3H6M A;  1CKO A;  2PMZ B;  1YHQ A;  1EOT A;  1HFG A;  1C4Q A;  5JVG 3;  1BXT A;  2EPB A;  5CV9 A;  3CMA A;  1XPR A;  2O2L D;  1N36 L;  1EFW A;  1QOH A;  2B2V A;  3CCJ A;  2ASB A;  4XDX A;  3GTK H;  4A3K H;  3A55 A;  3I8Z A;  1W2B A;  2PZW A;  3GTG B;  1EY7 A;  4DNI A;  5LMU L;  4C3H H;  3A0J A;  1D2B A;  3M9B A;  1O80 A;  4R4C A;  4OEL B;  3J81 c;  1I50 H;  5CBA E;  3MFG A;  1KL9 A;  4A93 H;  3MXG A;  1PFN A;  2B63 B;  1A62 A;  1LTS D;  1VCI A;  3TME A;  3HZX A;  1AW7 A;  2F0N A;  1AE2 A;  5LMN W;  3TP8 A;  1LT4 D;  3TRE A;  1G6Z A;  5HGQ A;  4RCN A;  4IFD I;  2DNC A;  5DEH A;  5FJ8 H;  3URY A;  3EBE A;  2Q2I A;  1BOS A;  2F0S A;  2LXJ A;  1NBW A;  1NSN S;  4DV5 L;  1ICF B;  5E3F A;  2NVX H;  1S3O A;  3NWT A;  4RG1 A;  3UE1 A;  4BY1 B;  3H3V C;  3M4Y A;  1EU4 A;  2NVY B;  1Z47 A;  3KUP A;  3DLL A;  2R92 G;  4JV5 Q;  2UU9 L;  3TS2 A;  2B63 G;  4DK6 C;  4K0K L;  3RD4 A;  2LS0 1;  3S2H B;  4IJH A;  3DEP A;  4RHR A;  1I3Q H;  2F0I A;  1RL2 A;  1VQE A;  2NZO A;  4WRD A;  4LWC A;  1S5D D;  4R4T A;  1S5E D;  1AZP A;  2K01 A;  1BBW A;  5JPM C;  4B08 A;  4ODG A;  3MXU A;  1QZH A;  4BY1 G;  2E2D C;  5IYD G;  1Q82 C;  1B8A A;  4FF4 A;  4DR7 Q;  3C1F A;  2UUA L;  3T1H L;  1PYW D;  1PYS B;  5BR8 L;  1I4Q A;  3AMU A;  4DR2 Q;  2E8G A;  1J6Q A;  2HQL A;  4IPG A;  4CDF C;  1HR0 L;  1JWU D;  4KY7 A;  3QR8 A;  4IUQ A;  3K59 A;  1JOQ A;  3KBG A;  4KKT A;  3N52 A;  1WI5 A;  4CKC A;  1DCZ A;  1DM0 B;  1XTD A;  4CHT B;  1BR9 A;  1F2M A;  2JXM B;  4AQY Q;  1ILQ A;  2MPM A;  2JA6 G;  1B1Z A;  4JI3 L;  1PLF A;  2PMZ E;  1IL8 A;  4I7Z C;  1PTO B;  4RHS A;  4UP8 A;  4FXK C;  3UDI A;  3CW2 C;  5C4Z A;  5KGU A;  1Q90 A;  2VY3 A;  2UXC L;  1PVO A;  1VQA A;  3R2T A;  4K8I A;  1L0W A;  1TS3 A;  2R7Z H;  3X3M A;  4K2L A;  1E7Z A;  4MHE A;  2HHH Q;  3CKI B;  1V9P A;  2IT1 A;  2F0M A;  5KYI A;  2Z9H A;  1EL0 A;  5IOC A;  2C5C A;  4K6D A;  4A3M B;  5CYU A;  4GN4 B;  4JI4 Q;  1GJX A;  4RFB A;  1SR3 A;  4DN4 M;  2RDG A;  4BXX H;  3NBI A;  2WKD A;  2NN6 G;  5EGT A;  2F4I A;  1TWC B;  1VQG A;  2CWP A;  2MP1 A;  3Q24 A;  1CTM A;  2AQ2 B;  4G57 A;  4X65 Q;  3DMU A;  1PFS A;  4JBM A;  4LFC L;  3PUZ A;  5I6Y A;  1EEF D;  4O1N A;  3OYY A;  2PNR C;  4NKL A;  2XNA C;  2Z1C A;  1V43 A;  1Z7T A;  5IWA Q;  4OL7 A;  4HSV A;  2BA1 A;  1QUQ B;  4OON A;  1CK1 A;  1G2S A;  2IHF A;  3SDZ A;  1ESF A;  4A3F H;  4ME3 A;  1SEB D;  3RZD B;  4KK7 A;  4A3M G;  1T5X D;  4ZUI A;  4HR7 B;  4QUF A;  1BBX C;  2PQA B;  1LTG D;  3I7F A;  5AFW A;  2BH2 A;  4E6I A;  1CSP A;  3TEH B;  5C44 G;  4K14 A;  3E5S A;  4FDB A;  2VNU D;  2QA4 A;  4IO9 A;  1JOR A;  1I4H A;  1PMR A;  2XWJ B;  1WVL A;  1A8V A;  2M00 A;  4NXN L;  2KBN A;  1X9N A;  1TWG H;  2GVA A;  4X66 Q;  1EIF A;  3DWA A;  4CBV A;  4KTA A;  1FD7 D;  1HZA A;  4DXF A;  3W5O A;  2QEJ C;  3K81 C;  1EQV A;  1WCM B;  3D4R A;  1PRT C;  1GKH A;  3CCE A;  4LF5 L;  3F2U A;  4C2M H;  3BDO A;  3MAQ A;  4H0L C;  2XWB B;  1SJE D;  1I94 Q;  1LLR D;  4XT3 B;  2MNA A;  4ULL A;  2F0F A;  2F0W A;  5GAE C;  1E0B A;  2L15 A;  3KF8 A;  3U9O A;  2F0U A;  4DPG A;  5A2Q L;  2JA9 A;  1L2F A;  3OTO L;  1EOV A;  1K3R A;  1WJJ A;  1OXT A;  1N32 Q;  3S1R H;  3MWY W;  2YU9 B;  1SMY D;  1WCM G;  4HCS A;  3I4O A;  1LT5 D;  3PF5 A;  1IBK L;  3R93 A;  4BBS G;  5JEA G;  5C0X I;  1KXL A;  1QVC A;  1K8A C;  1F2Z A;  2F0D A;  4NMZ A;  1WTV A;  4A3G B;  4QCL A;  4QGU A;  1FYC A;  3NHH A;  4H7B A;  4GNX A;  2MUY A;  4WJW A;  1JB7 A;  3K5L A;  2N55 A;  1STG A;  2WAQ B;  1SFO H;  1EZ6 A;  3PCO B;  2MGS A;  3PIP 3;  4DR4 L;  2WIN B;  1PRT D;  1EY9 A;  1CZW A;  2NVQ B;  1F2L A;  3K8A A;  4EQ5 A;  1TR5 A;  2X6L A;  2OT2 A;  2NTT A;  1CA5 A;  3T53 B;  1UE1 A;  4K6L A;  2Q2H A;  4JI8 L;  1VMC A;  2XRS D;  5M9O A;  4LF8 Q;  3NP8 A;  4C3I B;  1EYG A;  1G91 A;  1UE7 A;  2VQE Q;  4ZLT F;  1YIT A;  1EUJ A;  1J5E Q;  2KHJ A;  3P1H A;  3CC2 A;  1MJE A;  2E2H H;  4A3B H;  2L12 A;  2B3G A;  4KD4 A;  1LTL A;  3FPP A;  3J80 E;  1L0Y B;  2DN8 A;  2E2I H;  4R8I A;  1H9J A;  5FLX c;  1IHZ A;  1EY5 A;  3KLR A;  1HRJ A;  3M4Q A;  5LHY 1;  2ES2 A;  1IYV A;  1U9R A;  2L55 A;  1R4P B;  3M4P A;  3MVV A;  2E75 C;  4CJ0 B;  1DXM A;  1EYD A;  1HZC A;  2NYZ D;  5LL6 S;  4DA2 A;  5KNB A;  1KRS A;  4L5S A;  4WFN 3;  3L7Z C;  3L3O C;  2NN6 H;  3EA6 A;  2XN9 C;  4C3I G;  5GAG C;  2I5L X;  3HOX B;  3HOU B;  3W1B A;  4DXG A;  1TII D;  2LKV A;  4CDD C;  1FGB D;  4JI1 L;  3S14 B;  1C48 A;  1MSH A;  1N33 L;  5D3D A;  4BWG B;  3EVQ A;  3DWQ A;  4YWK A;  2KQ3 A;  2TMP A;  1M4V A;  2L0C A;  2I0Q A;  1ZXT A;  2HDM A;  3H0G B;  1WTO A;  1HNX L;  1V1P A;  5C3E H;  1ROD A;  1PYB A;  4KJN A;  1B50 A;  2PZU A;  3BVM A;  1STB A;  2YTX A;  1CUK A;  1Y14 B;  3ULP A;  3FDT A;  1YIJ A;  4IFD J;  2EDG A;  2UXD Q;  4AIM A;  4IUT A;  4GOP A;  3GTM H;  2JA7 H;  1VS0 A;  2B2U C;  4DK0 A;  2JA8 G;  4PMC A;  4BY7 B;  4A3D B;  1BCP F;  3S1N B;  3TRZ A;  3J7Y W;  5FK9 C;  3NWS A;  3IKJ A;  2AWN A;  3AB9 A;  4B3R L;  3CXC A;  3H0G G;  5IP9 G;  1QG7 A;  2P5Z X;  2OEO A;  4LF9 Q;  1GHK A;  2N78 A;  2QGQ A;  2D0P A;  3JC6 6;  3QIA A;  4QUC A;  2RCF A;  2WAQ E;  4KMU C;  1KC8 C;  5JJL A;  1A63 A;  1W6J A;  1H9R A;  2O4X A;  5COR A;  1YJW A;  3C2P A;  3HOZ G;  4IUU A;  3GTJ H;  4OX9 L;  5M5X B;  2KEC A;  1TWA H;  3I4M H;  4KKS A;  4A3D G;  4IPH A;  1YEZ A;  4L5T A;  1FJG Q;  1ICW A;  3J80 i;  3GTQ B;  2NWG A;  4KHZ A;  4CGY B;  3ONA B;  1HUN A;  3RMH A;  3EFX D;  2IWH A;  4CJ2 C;  2EXZ A;  4FO2 A;  5J3B A;  2G9D A;  4ZUJ A;  2SDF A;  1TXY A;  4X64 Q;  4R9W A;  1LTI D;  1ZYR C;  3MHB A;  3M85 A;  1GVP A;  3GO5 A;  4LUV A;  1K3B C;  4DV2 L;  3G48 A;  3MEH A;  5IGD A;  1PTO D;  2A8V A;  3RZO H;  4KY5 A;  1EY6 A;  1VQF A;  1LAC A;  1PA6 A;  1QWY A;  2EJF C;  3OW7 A;  1LO5 D;  4MTK A;  3DUZ A;  2PI2 A;  1H9S B;  3KK7 A;  3MA2 B;  3RUZ A;  4H13 C;  2EYP A;  3C1E A;  1DOM A;  4XQQ A;  3F2C A;  2NVX B;  5C3X A;  3E0E A;  4NXM Q;  5L37 A;  1Y1W H;  1KQS A;  3ULL A;  2IHE A;  2ATW A;  4WOR A;  3D3R A;  3IFD A;  4H02 A;  4DAY A;  4IFD G;  2F0V A;  1Y1V B;  3J81 L;  1EY0 A;  2A68 C;  3FP9 A;  4G4K A;  3HOY H;  2EJM A;  2BDN A;  1SRU A;  4K5V A;  3WDN A;  1VQP A;  3J7A V;  1OXV A;  1F9R A;  4ZKB B;  1HNZ L;  1VQ9 A;  4DNT B;  2F0K A;  2YTY A;  1ZYR D;  2AMC B;  3EIV A;  3T13 A;  4A3J H;  4IQZ A;  2C35 B;  3NK9 A;  3WOE A;  3PGZ A;  1WD0 A;  1SJH D;  4J8Q A;  2NTS A;  2L11 A;  3Q8D A;  4JVZ A;  4MZ9 A;  2E2J H;  4Y52 H;  1HA6 A;  4RGT A;  3SHL A;  4A3I H;  2MHV A;  1Q12 A;  2JK8 A;  1Y1V G;  3ND8 A;  4GN5 A;  3A7L A;  1N36 Q;  2BE5 C;  3M7G A;  1VQ5 A;  5IT9 c;  2VL6 A;  2VUM G;  3PO3 G;  3FRP B;  2CFM A;  3TZU A;  1EZ8 A;  2NVT H;  3A74 A;  1Q7Y C;  2RHS B;  4A3E H;  2K5H A;  4OWX B;  1PH4 A;  1XMO Q;  1TKW B;  4HAE A;  4B3M L;  5LMU Q;  5G3L F;  5AJ3 L;  1M8A A;  4CDE C;  2B2U A;  4UAI A;  4ZKC B;  1PH2 A;  3S16 H;  1F2Y A;  1C7Y A;  4YWM A;  1DOL A;  1QB5 D;  1VF7 A;  2RVL A;  2WP8 J;  2F4V L;  4RGO S;  1DGS A;  4MNO A;  3FKI B;  2A68 D;  4ILW A;  4DR1 L;  1V8Q A;  3IFT A;  5EBC A;  3CF5 A;  1I6H B;  5DLQ E;  1PZK D;  3OPO A;  5ELO A;  3KLS A;  2ZXP A;  2Q8T A;  4DV5 Q;  4OO1 I;  2EJG C;  4EQP A;  1XNQ L;  2K33 A;  3ERS X;  3I73 A;  1TVX A;  5M5W H;  1I6V C;  5C4X H;  2V1C C;  1BO0 A;  1CZG A;  1F77 A;  3A8J E;  1X56 A;  2Z0S A;  2UU9 Q;  1JC7 A;  2K5W A;  3RN2 A;  2IX0 A;  1N34 L;  3STB C;  2ZTE A;  3FKI G;  2LSS A;  3A8I E;  3DXJ C;  4ZYS A;  4K0K Q;  2BE5 D;  3K7A B;  1SNM A;  4UDU C;  4A3L H;  1V1Q A;  3G4S A;  4GN3 B;  1UNS A;  4HJA A;  4K8J A;  4JOI A;  1P16 A;  1HZB A;  1QUQ A;  2EYO A;  3F1Z A;  4JBK A;  3R3O A;  4PQX A;  4DV7 L;  2K5N A;  1O7Z A;  3CQZ B;  3MXN B;  1X55 A;  4IPD A;  4DV1 L;  1RJT A;  2NUC A;  2PQA A;  3VR6 A;  2JA5 H;  4C3J H;  2WFW A;  3I2Z A;  1CQV A;  2UUA Q;  3HKS A;  4XXE A;  2RDH A;  3T1H Q;  5CV5 A;  1L1O C;  1E22 A;  5BR8 Q;  3A54 A;  4A3F B;  3JAM c;  1NUC A;  1SXT A;  3RLN A;  5C0X J;  5M3F H;  2ZT9 C;  3TSS A;  1HR0 Q;  5BN4 A;  5FLX E;  2CCZ A;  3DM3 A;  1HQM C;  3OMG A;  4NDX A;  5GRO A;  1VQ4 A;  1IYU A;  5JOB A;  4M1U B;  4TSS A;  2WB1 B;  1JOK A;  1GHJ A;  3SE0 A;  3OWE B;  1JR0 D;  2AKW B;  1R9T B;  3STB D;  3FMC A;  4JI3 Q;  4JC0 A;  1SYB A;  3J81 j;  1TWG B;  5C5L A;  2BCO A;  1Z6H A;  2OTJ A;  4RKB A;  3DEO A;  2O5J C;  1JIC A;  1J9O A;  4JI6 L;  1IBL Q;  4A3C G;  2UXC Q;  1D5M C;  1K8M A;  1VQC A;  2R7F A;  4X3U A;  3SEB A;  1MHW C;  4B3T L;  3CPW A;  1X3E A;  4C2M B;  2WB1 G;  2AHO B;  5K36 H;  1K9M C;  3I4N B;  4IFD H;  4U67 3;  4BS9 A;  2CH4 A;  3RLO A;  2K6A A;  4DNR B;  1PZI D;  1YJ9 A;  2O5I C;  2QW7 A;  3BYY B;  5NUC A;  4KLK A;  1KNE A;  4L5R C;  3SK8 A;  4DGZ A;  4LUZ A;  1IYJ B;  2IX1 A;  4G7O C;  1NR4 A;  1PH5 A;  2RA4 A;  4HCE A;  5D65 A;  1JJG A;  4LFC Q;  3AU7 A;  2KCM A;  3A8K E;  5A2Q E;  4DAY B;  4LF6 L;  3VYS A;  3MXP A;  5EPJ A;  3L2P A;  1CA6 A;  4JI0 L;  3T16 A;  4POG A;  3FPU B;  3MZ5 A;  3QOJ A;  2FMC A;  3S1M H;  1D1I A;  1AH9 A;  3TS0 A;  2J0T D;  3ERQ A;  2IJ0 A;  4EVO A;  5IIF A;  4QIW B;  1TWF H;  1Y8O B;  2DNE A;  5C0X G;  5JJI A;  1SFO B;  3GTP H;  2WAC A;  4N8X 1;  3IL8 A;  1TS4 A;  4ME5 A;  5CV7 A;  2PZT A;  3A7A B;  4LF7 L;  1RKN A;  1I4P A;  1Q1B A;  3K5N A;  4NXN Q;  1I5F A;  1NMG A;  4C1N I;  4DAP A;  2F0O A;  4DV0 L;  5IYC G;  2J4X A;  1S5B D;  1AZQ A;  4UY8 C;  5BN3 A;  2OCE A;  1A2U A;  2NZ1 D;  2F0P A;  3OOC A;  4DV4 L;  1SAP A;  3LGJ A;  2RQX A;  4IJL A;  3WOF A;  4FF2 A;  4BBR H;  1IBM Q;  2E2I B;  1L1O A;  2KA7 A;  3F2B A;  1CKN A;  2WB1 E;  4O0A A;  3S2D H;  1JJC B;  2HUG A;  1WOC A;  4OWT B;  3QWN A;  5KRU A;  2F52 A;  4DF7 A;  3OTO Q;  4YCV A;  3KOJ A;  4P72 A;  3Q0A A;  5EPL A;  2DGY A;  4ALP A;  3K0Y A;  2KCC A;  5FOB B;  2CWA A;  2VW9 A;  1XPU A;  2F3V A;  4J15 A;  2R93 H;  5JEA J;  1SSO A;  1IBK Q;  3IRB A;  4A4I A;  3S9W A;  3K80 C;  2PPB C;  4R8N A;  1T5E A;  4F7X A;  3ND9 A;  3I55 A;  5FLX L;  2EOT A;  2Z8L A;  2QIL A;  2ENB A;  2ZM6 L;  3Q22 A;  5C3E B;  1PZJ D;  1K73 C;  3S17 H;  3IAY A;  1WTQ A;  2PI2 E;  3G6E A;  1E2W A;  1NCV A;  1X65 A;  5H1S E;  4DR4 Q;  1HJP A;  2F0L A;  3T56 B;  1UEB A;  4WJ3 M;  3HP3 A;  1BCP C;  3GTM B;  3KLW A;  2JA7 B;  1MIU A;  5DM6 3;  2LXK A;  3NUC A;  4RA8 A;  1BKB A;  5COY A;  1FGU A;  3KF6 B;  5IYB G;  1KAB A;  4DV3 Q;  3EJI A;  3L9A X;  4HMI A;  1XTC D;  1OO9 B;  1X32 A;  1ET9 A;  2E5L L;  1JCK B;  3GQB A;  4QIW E;  3S15 H;  2EYJ A;  3RR5 A;  2DJG C;  3VDY A;  4QY7 A;  3GTO H;  3GTG H;  3VR4 A;  1X3G A;  4DFA A;  1NE3 A;  1DYQ A;  3GTJ B;  3E0J A;  1VQB A;  2N88 A;  3PV0 A;  4FXG C;  2R92 H;  2D9U A;  1SDF A;  2B63 H;  2Y0S B;  2Q2U A;  1EIY B;  3D6C A;  1D1K A;  1RIP A;  2GN5 A;  4AQY L;  1GUW A;  1BNZ A;  4EQN A;  2EIF A;  4A76 A;  1S5C D;  2G9H D;  4NB3 A;  4ZRZ A;  4LMQ D; 
#chains in the Genus database with same CATH homology
 1FNW A;  3BZD B;  1TU2 B;  4IZ8 A;  3EQL C;  3TP5 A;  1BCP D;  1CFM A;  5LL6 X;  3HG9 A;  1H9S A;  3MTS A;  3RZO B;  2F0G A;  1K83 B;  3D4D A;  2EY2 A;  5KND A;  3ZYY X;  3I91 A;  2AQ1 B;  5DNF A;  3D4W A;  5IGG A;  5C4J B;  5C0X H;  3NXW A;  2SNM A;  5FKA C;  2HDL A;  2AUJ D;  4N9T A;  4M8A A;  2KCN A;  3K58 A;  3H91 A;  5EQ0 A;  1Y1W B;  1RDP D;  1B9M A;  5ELF A;  2JEB I;  4EGV A;  4AYB B;  5M3M B;  1ZKO A;  3DHQ A;  1Y69 U;  3TDQ A;  1PXU A;  4Q5V A;  1AP0 A;  3J81 E;  3HRZ C;  4HMJ A;  1MD2 D;  4IUP A;  4BA2 I;  4A3J B;  4PMW A;  2EY5 A;  1ESR A;  4A3I B;  1KNA A;  3P75 A;  2VB2 X;  5JPN C;  5TSS A;  1UAP A;  1EFI D;  3LWU A;  2V4D A;  2VXW A;  3BVZ A;  1O7Y A;  4CJ1 B;  3I72 A;  2SEB D;  2GA4 B;  2JE6 I;  5FO7 B;  1J8I A;  2NVT B;  4BA1 I;  4FF1 A;  1PTO H;  3NTK A;  3K6O A;  1GOZ A;  4A3E B;  3HOV B;  5T1G A;  1IKL A;  5F2D A;  4B9X A;  5CV4 A;  3S16 B;  3OIP A;  1LTA D;  1S4Z A;  1LV9 A;  2FJ2 A;  5HGT A;  3U9S A;  1Q1E A;  2BA0 A;  2E76 C;  3PO2 B;  1NR2 A;  2M9V A;  5JVH 3;  1CHQ D;  1B4O A;  3HOW B;  3DWP A;  1YNJ C;  5FO9 B;  5J1Z A;  3SVM A;  1QNK A;  1A3V A;  3M4O B;  3MXN A;  1LAB A;  1K8O A;  4IAL A;  5CMD A;  1QNU A;  4TQU S;  4OO1 G;  1S5F D;  5G3L D;  1ENC A;  3O13 A;  1LTT D;  3D6W A;  1ENA A;  4DK1 A;  3NTI A;  1G2T A;  2FHT A;  2AWO A;  4FVM A;  3GTL B;  1D5Z C;  3P20 A;  1CQF A;  1SYF A;  1JOO A;  1B53 A;  1HXY D;  2KED A;  4JK1 C;  2F0J A;  1U4M A;  5HUR A;  3GTK B;  1YNJ D;  4A3K B;  1STE A;  1STN A;  4K2K A;  2B2Y C;  4C3H B;  3OIQ A;  1GUN A;  3X3N A;  1CT1 D;  2K7V A;  5JEA H;  1KDC A;  4ZAI A;  4G7H C;  1I50 B;  2CW0 C;  4A93 B;  1PFM A;  5E4X A;  2IX3 A;  3JAM L;  3TBI B;  3T4A C;  2H1E A;  3H94 A;  1SE2 A;  1F9Q A;  3SK5 A;  1H9K A;  5C4H A;  2EZV A;  1RD9 D;  3VA7 A;  2HCI A;  4C3H G;  3PMF A;  3VA5 A;  3GD7 A;  2B8F A;  4HED A;  1SE4 A;  3PUW A;  3PUX A;  3NPP A;  3VYU A;  2A5H A;  1PDQ A;  2RKS A;  1I3Q B;  2EY1 A;  2F1M A;  4G7Z C;  2B2V C;  3NE5 B;  1OXS C;  2QF7 A;  1X3P A;  1HPC A;  3LNN A;  4NP5 A;  2I46 A;  4FNF A;  3G7L A;  2IPK D;  4LK1 C;  5KEE A;  1DOK A;  1RHP A;  3W2D A;  5JAV A;  2YYZ A;  3GTP B;  3VYT A;  1L0X B;  2F0E A;  3GP7 A;  2HCC A;  5ELB A;  5CC4 A;  3QB3 A;  2RSN A;  1STY A;  2RBM A;  1EQT A;  1BCP B;  3ITP A;  2A73 B;  1AEX A;  3NTH A;  1CI3 M;  4QB4 A;  4BBR B;  1A3U A;  4PV1 C;  2K5Q A;  2MJ8 A;  1KLU D;  2R7Z B;  3HKZ B;  2EVB A;  1II3 A;  1U4R A;  1EWH A;  1SNP A;  1XYI A;  1UEA B;  1HFN A;  1FNU A;  2AQ3 B;  2F0T A;  5CGK A;  3QJY A;  2B2Y A;  5EKK A;  4S3S A;  4KV6 A;  2D5D A;  1UUP A;  3PUV A;  4YIJ A;  5EPK A;  2K04 A;  1HCZ A;  1OXX K;  1PTO F;  2CQA A;  1HHV A;  3S17 B;  3SK4 A;  4O42 A;  4LAA A;  5I9O A;  4FYD A;  3P7J A;  3Q23 A;  4QF4 A;  4Z9C B;  1D5X C;  3V05 A;  4PNY A;  2EYF A;  1WTR A;  2JYO A;  2QCP X;  4TRD A;  4B9W A;  4XTC S;  1EYA A;  1TY0 A;  2QKI C;  5C5M A;  4F8M A;  1F9S A;  2FFK B;  1D6E C;  1WTW A;  3R8B A;  1QCB D;  2JEA I;  1A6X A;  3J7A F;  3S15 B;  2DY7 A;  3CU7 A;  4RKL A;  4XYO A;  2K1B A;  1RTN A;  3TZD A;  2BOS A;  1BQQ T;  3GTO B;  1GUG A;  2EYM A;  2ICI A;  4F87 A;  2XVS A;  1I4X A;  1EY4 A;  2D2C C;  2R92 B;  1SNQ A;  1LTB D;  3TN2 A;  3DM1 A;  4K5X A;  2X69 A;  1EIG A;  1R4Q B;  3KLS X;  1KDA A;  1EU3 A;  4J1M A;  4TKO B;  4FXD A;  3S1R B;  5BN5 A;  5DAU A;  2SOB A;  2B2W C;  4XQJ A;  4QMG A;  5E1F A;  1U4L A;  3HGB A;  1TS5 A;  4Q0F A;  2KUM A;  2XRQ D;  1VMP A;  2WV6 D;  4KD3 A;  3I70 A;  5T1I A;  1SYE A;  1GUT A;  1I4G A;  2ID0 A;  4KI0 A;  5KIX A;  1G29 1;  3TP6 A;  2ICE C;  1QJO A;  2VB3 X;  4CKE A;  1WTP A;  1MI2 A;  2JA6 B;  4OHJ A;  3MC0 B;  4RCO A;  3NQT A;  4FP5 D;  2R61 A;  1G8Z D;  3VR3 A;  4L63 B;  2A74 C;  3I4L A;  2JP1 A;  5IGC A;  1ENF A;  1F9P A;  4RH6 A;  3T51 B;  4A3B B;  2E2H B;  2ZXO A;  4ID6 A;  4DAV A;  4ZK9 B;  1RTO A;  4U68 A;  2NB0 A;  5CV8 A;  2R6G A;  4OIJ A;  2L4N A;  3G6J B;  1ML0 D;  1HA5 A;  2IW3 A;  1IW7 C;  1Y8P B;  1TY2 A;  5IGB A;  1Y8N B;  1HTP A;  1NAP A;  2X6G A;  2Q8R E;  2PQE A;  1B9N A;  3BDL A;  2RDF A;  1Q3L A;  1DD2 A;  1GUS A;  2PW5 A;  3CRL C;  1STH A;  1STA A;  1AFP A;  5C44 B;  4IUV A;  2KJX A;  5IT9 E;  5IGE A;  3UI2 A;  3BG3 A;  1XXG A;  3VR2 A;  3HS0 C;  2PYK A;  1RCV D;  1BDO A;  4KKU A;  5JJZ A;  1XWE A;  4GZY C;  4RAU C;  1A3T A;  1SYC A;  1CM9 A;  3VR5 A;  4PMB A;  3FEW X;  2B2W A;  1SMY C;  2F3W A;  3E6Z X;  1IW7 D;  3BYT B;  1SBB B;  3C46 A;  1SYG A;  2B39 A;  1TWA B;  3I4M B;  1X3Q A;  4K5W A;  1H9M A;  1PFB A;  2KOL A;  3K5M A;  4I65 A;  1SND A;  4HN7 A;  5M5Y B;  2KHS A;  2RSO A;  1BF4 A;  2PW7 A;  2LFN A;  3V2T A;  1EIH A;  3R2I A;  2R3Z A;  3SXH A;  3LWE A;  2M2L A;  4BBS B;  2Z4I A;  5I6W A;  1EY8 A;  1VF5 C;  3D31 A;  1KDB A;  5C6A A;  3M7N A;  2NBF A;  3V96 A;  4N9P A;  2PO4 A;  2I07 B;  3C3L A;  1O7L A;  2K05 A;  5D3I B;  3W3A A;  5EJW A;  3CHB D;  1CHP D;  3ERO A;  2B2T C;  4MIU A;  1DJR D;  2ZXR A;  3JAM E;  1YNN C;  5D14 A;  3QOL A;  1SE3 A;  4IUR A;  4MN3 A;  1DON A;  3HOY B;  5ISR A;  4NW2 A;  3GV6 A;  5J22 A;  4KHV A;  1TWH B;  5I2Y A;  1A15 A;  1KLG D;  3OMC A;  5EBD A;  4KN7 C;  2E2J B;  3SR1 A;  4XYQ A;  1LTR D;  3NSW A;  1OXU A;  5K5P A;  4XT1 B;  3Q6S A;  5CR3 A;  1EEI D;  4ZQ3 A;  1RF2 D;  2J7Z A;  5DM7 3;  4RGN A;  5CV6 A;  3FVQ A;  4IN3 A;  5C3W A;  3RLF A;  4J6H A;  3CRK C;  2JSO A;  1YNN D;  2PCF B;  2B8G A;  2NN6 I;  1B2T A;  4OGQ C;  5KYL A;  2WII B;  1WD1 A;  1EYC A;  5IT9 L;  4FF3 A;  1TQO A;  3PIO 3;  3K57 A;  1E2V A;  1JE4 A;  4ABN A;  4L6T B;  5M5W B;  5I2X A;  2E74 C;  5C4X B;  4XIG S;  2A69 C;  4Y7N B;  2CVR A;  2KVM A;  2A6H C;  2JA8 B;  1VDZ A;  3QG1 A;  1ZEQ X;  2OXP A;  2XSC A;  3K5O A;  1SYD A;  2F0H A;  2IL8 A;  2QDB A;  2AUK A;  1WTX A;  3S1Q B;  2FMM A;  3D8G A;  3HOZ B;  2JA5 B;  5A35 A;  4C3J B;  3BVG A;  1PTO C;  3A56 A;  5I9P A;  4X3T A;  4V19 0;  1E2Z A;  5M3F B;  1JQY D;  2B2T A;  1ONL A;  2EYH A;  4V0B A;  2Q8I B;  4LJZ C;  3BS1 A;  5EKI A;  4C3J G;  2A69 D;  2A6H D;  3OSO A;  4C56 C;  1BUV T;  1PRT F;  2WKC A;  4X3S A;  1TS2 A;  4RGM A;  2TSS A;  2A6E C;  3TP7 A;  3I3C A;  4EQO A;  4HSP A;  1I4R A;  3NBH A;  5E4W C;  4F88 A;  2K03 A;  3LX0 A;  5ELE A;  1JWM D;  4H44 C;  4RWS C;  1EWC A;  5EKL A;  4JBW A;  1MGS A;  2XIW A;  3GV3 A;  1HUM A;  3OWF A;  1C8C A;  2K28 A;  3M3Y B;  5I4D A;  4IUN A;  1JB3 A;  5IGF A;  3OHX C;  2DY8 A;  1ILP A;  1XX8 A;  1AN8 A;  3KBX A;  2K5D A;  1QIL A;  3BDC A;  1KAA A;  2LMC B;  4DU9 A;  5K36 G;  3VYR A;  5J39 A;  3MFY A;  5KNC A;  3S1M B;  2VUM B;  1SNC A;  3H09 A;  3PO3 B;  2CW0 D;  5ELC A;  2F03 A;  2A6E D;  2CHB D;  2LY7 A;  4HTH A;  2SNS A;  1TWF B;  3J80 L;  4CKB A;  1GXD C;  3N6R A;  2HQE A;  3QO2 A;  2EY6 A;  3HEJ A;  1B3A A;  4OIK A;  2Z4H A;  4L8J A;  1IKM A;  4XQN A;  2C9O A;  1V1O A;  2H4O A;  1HQR D;  1FR3 A;  1U4P A;  2F0Q A;  1LT6 D;  1TT2 A;  4P2C B;  1MSG A;  2EE1 A;  1ET6 A;  5FO8 B;  2L9H A;  2L1B A;  4KN4 C;  2FIN B;  3I90 A;  1B44 D;  1JWS D;  1W6K A;  1SNO A;  3NQI A;  4KY6 A;  1LT3 D;  4OO1 H;  3S2D B;  1GUO A;  1Q8I A;  3SK6 A;  1MBY A;  4C1N K;  2R93 B;  1HTL D;  2KEE A;  2L5T A;  1V1P B;  2D62 A;  5CBE E;  2BDO A;  1DZ1 A;  1PRT B;  1FNV A;  3PUY A;  2OF1 A;  4KJO A;  5ELD A;  1QE6 A;  1A2T A;  2EYL A;  1O78 A;  1KTK A;  2K32 A;  5IOD A;  4X3K A;  3H6M A;  2PMZ B;  1EOT A;  1HFG A;  1C4Q A;  5JVG 3;  1BXT A;  2EPB A;  5CV9 A;  2O2L D;  1QOH A;  2B2V A;  4XDX A;  3A55 A;  3I8Z A;  2PZW A;  3GTG B;  1EY7 A;  1D2B A;  1O80 A;  5CBA E;  3MFG A;  3MXG A;  1PFN A;  2B63 B;  1LTS D;  1VCI A;  3TME A;  3HZX A;  1AW7 A;  2F0N A;  3TP8 A;  1LT4 D;  1G6Z A;  4RCN A;  4IFD I;  2DNC A;  5DEH A;  3URY A;  1BOS A;  2F0S A;  1NSN S;  5E3F A;  3NWT A;  4BY1 B;  3H3V C;  3M4Y A;  1EU4 A;  2NVY B;  1Z47 A;  3KUP A;  3S2H B;  3RD4 A;  2LS0 1;  3DEP A;  4RHR A;  2F0I A;  4WRD A;  1S5D D;  1S5E D;  1AZP A;  2K01 A;  5JPM C;  4B08 A;  4ODG A;  3MXU A;  2E2D C;  4FF4 A;  3C1F A;  1PYW D;  1I4Q A;  3AMU A;  1JWU D;  4KY7 A;  4IUQ A;  3K59 A;  1JOQ A;  3KBG A;  4KKT A;  3N52 A;  4CKC A;  1DCZ A;  1DM0 B;  4CHT B;  1BR9 A;  1F2M A;  2JXM B;  1ILQ A;  2MPM A;  1B1Z A;  1PLF A;  1IL8 A;  4I7Z C;  1PTO B;  4RHS A;  4FXK C;  5C4Z A;  5KGU A;  1Q90 A;  3R2T A;  4K8I A;  1TS3 A;  3X3M A;  4K2L A;  4MHE A;  3CKI B;  2IT1 A;  2F0M A;  5KYI A;  1EL0 A;  5IOC A;  2C5C A;  4K6D A;  4A3M B;  5CYU A;  1GJX A;  4RFB A;  4DN4 M;  2RDG A;  3NBI A;  2WKD A;  2NN6 G;  5EGT A;  2F4I A;  1TWC B;  2MP1 A;  3Q24 A;  1CTM A;  2AQ2 B;  4G57 A;  3DMU A;  3PUZ A;  5I6Y A;  1EEF D;  4O1N A;  2PNR C;  4NKL A;  2XNA C;  2Z1C A;  1V43 A;  1Z7T A;  4OL7 A;  4HSV A;  2BA1 A;  1CK1 A;  1G2S A;  3SDZ A;  1ESF A;  1SEB D;  3RZD B;  4KK7 A;  1T5X D;  4ZUI A;  4HR7 B;  4QUF A;  1BBX C;  1LTG D;  5AFW A;  4E6I A;  4K14 A;  3E5S A;  2VNU D;  1JOR A;  1I4H A;  1PMR A;  2XWJ B;  1WVL A;  2M00 A;  3DWA A;  4CBV A;  4KTA A;  1FD7 D;  4DXF A;  2QEJ C;  1EQV A;  1WCM B;  3D4R A;  1PRT C;  3F2U A;  3BDO A;  3MAQ A;  4H0L C;  2XWB B;  1SJE D;  1LLR D;  4XT3 B;  4ULL A;  2F0F A;  2F0W A;  1E0B A;  3U9O A;  3KF8 A;  2F0U A;  5A2Q L;  1OXT A;  3MWY W;  2YU9 B;  1SMY D;  4HCS A;  1LT5 D;  3R93 A;  5JEA G;  5C0X I;  1F2Z A;  2F0D A;  4NMZ A;  1WTV A;  4A3G B;  4QCL A;  1FYC A;  3NHH A;  4H7B A;  2MUY A;  4WJW A;  3K5L A;  2N55 A;  1STG A;  2WAQ B;  1EZ6 A;  2MGS A;  3PIP 3;  2WIN B;  1PRT D;  1EY9 A;  1CZW A;  2NVQ B;  1F2L A;  1TR5 A;  2X6L A;  2OT2 A;  2NTT A;  1CA5 A;  3T53 B;  4K6L A;  1VMC A;  2XRS D;  5M9O A;  3NP8 A;  4C3I B;  1G91 A;  4ZLT F;  3P1H A;  2L12 A;  4KD4 A;  3FPP A;  3J80 E;  1L0Y B;  2DN8 A;  4R8I A;  1H9J A;  1IHZ A;  1EY5 A;  3KLR A;  1HRJ A;  5LHY 1;  1IYV A;  1U9R A;  2L55 A;  1R4P B;  3MVV A;  4CJ0 B;  2E75 C;  1DXM A;  1EYD A;  2NYZ D;  4DA2 A;  5LL6 S;  5KNB A;  4WFN 3;  3L7Z C;  3L3O C;  2NN6 H;  3EA6 A;  2XN9 C;  4C3I G;  3HOX B;  3HOU B;  4DXG A;  1TII D;  2LKV A;  1FGB D;  3S14 B;  1C48 A;  1MSH A;  5D3D A;  4BWG B;  3EVQ A;  3DWQ A;  2KQ3 A;  2TMP A;  1M4V A;  2L0C A;  1ZXT A;  2HDM A;  3H0G B;  1WTO A;  1V1P A;  1ROD A;  4KJN A;  1B50 A;  2PZU A;  3BVM A;  1STB A;  3FDT A;  4IFD J;  2EDG A;  4IUT A;  2B2U C;  4DK0 A;  4PMC A;  4BY7 B;  4A3D B;  1BCP F;  3S1N B;  3J7Y W;  5FK9 C;  3NWS A;  3IKJ A;  2AWN A;  3AB9 A;  1QG7 A;  2OEO A;  1GHK A;  3QIA A;  4QUC A;  4KMU C;  1W6J A;  1H9R A;  2O4X A;  5COR A;  3C2P A;  4IUU A;  5M5X B;  2KEC A;  4KKS A;  1ICW A;  3GTQ B;  2NWG A;  4KHZ A;  4CGY B;  3ONA B;  1HUN A;  3RMH A;  3EFX D;  2IWH A;  4CJ2 C;  2EXZ A;  4FO2 A;  2G9D A;  4ZUJ A;  2SDF A;  4R9W A;  1LTI D;  1ZYR C;  3MHB A;  3M85 A;  3GO5 A;  3MEH A;  5IGD A;  1PTO D;  4KY5 A;  1EY6 A;  1LAC A;  1QWY A;  2EJF C;  3OW7 A;  1LO5 D;  3DUZ A;  1H9S B;  3KK7 A;  3MA2 B;  3RUZ A;  4H13 C;  2EYP A;  3C1E A;  1DOM A;  4XQQ A;  2NVX B;  5C3X A;  4WOR A;  3D3R A;  3IFD A;  4DAY A;  4IFD G;  2F0V A;  1Y1V B;  3J81 L;  1EY0 A;  2A68 C;  4G4K A;  2EJM A;  2BDN A;  4K5V A;  3WDN A;  3J7A V;  1OXV A;  1F9R A;  4ZKB B;  4DNT B;  2F0K A;  1ZYR D;  3T13 A;  4IQZ A;  3NK9 A;  3WOE A;  1WD0 A;  1SJH D;  4J8Q A;  2NTS A;  2L11 A;  1HA6 A;  4RGT A;  3SHL A;  2MHV A;  1Q12 A;  3ND8 A;  3A7L A;  2BE5 C;  3M7G A;  3FRP B;  3TZU A;  1EZ8 A;  1TKW B;  4HAE A;  5G3L F;  1M8A A;  2B2U A;  4UAI A;  4ZKC B;  1F2Y A;  1DOL A;  1QB5 D;  1VF7 A;  2RVL A;  2WP8 J;  4RGO S;  3FKI B;  2A68 D;  4ILW A;  1V8Q A;  3IFT A;  5EBC A;  1I6H B;  1PZK D;  3OPO A;  3KLS A;  2ZXP A;  2Q8T A;  4OO1 I;  2EJG C;  4EQP A;  2K33 A;  3I73 A;  1TVX A;  1I6V C;  1BO0 A;  1CZG A;  1F77 A;  3A8J E;  1JC7 A;  2K5W A;  2IX0 A;  3A8I E;  3DXJ C;  4ZYS A;  2BE5 D;  3K7A B;  1SNM A;  4UDU C;  1UNS A;  4K8J A;  2EYO A;  3R3O A;  4PQX A;  1O7Z A;  3CQZ B;  1RJT A;  2NUC A;  3VR6 A;  1CQV A;  4XXE A;  2RDH A;  5CV5 A;  3A54 A;  4A3F B;  1NUC A;  1SXT A;  5C0X J;  2ZT9 C;  3TSS A;  5BN4 A;  5FLX E;  1HQM C;  3OMG A;  4NDX A;  1IYU A;  5JOB A;  4M1U B;  4TSS A;  2WB1 B;  1JOK A;  1GHJ A;  3SE0 A;  3OWE B;  1JR0 D;  1R9T B;  3FMC A;  1SYB A;  1TWG B;  5C5L A;  2BCO A;  1Z6H A;  4RKB A;  3DEO A;  2O5J C;  1JIC A;  1J9O A;  1D5M C;  1K8M A;  4X3U A;  3SEB A;  4C2M B;  5K36 H;  3I4N B;  4IFD H;  4U67 3;  4BS9 A;  2K6A A;  4DNR B;  1PZI D;  2O5I C;  3BYY B;  5NUC A;  1KNE A;  3SK8 A;  4DGZ A;  2IX1 A;  4G7O C;  1NR4 A;  2RA4 A;  4HCE A;  5D65 A;  3AU7 A;  3A8K E;  5A2Q E;  3VYS A;  3MXP A;  5EPJ A;  1CA6 A;  3T16 A;  3FPU B;  3MZ5 A;  3QOJ A;  2FMC A;  1D1I A;  2J0T D;  3ERQ A;  2IJ0 A;  4EVO A;  5IIF A;  4QIW B;  1Y8O B;  2DNE A;  5C0X G;  1SFO B;  2WAC A;  3IL8 A;  1TS4 A;  4ME5 A;  5CV7 A;  2PZT A;  3A7A B;  1RKN A;  1I4P A;  1Q1B A;  3K5N A;  4C1N I;  4DAP A;  2F0O A;  2J4X A;  1S5B D;  1AZQ A;  5BN3 A;  1A2U A;  2NZ1 D;  2F0P A;  3OOC A;  1SAP A;  2RQX A;  3WOF A;  4FF2 A;  2E2I B;  2KA7 A;  2HUG A;  3QWN A;  5KRU A;  4DF7 A;  3Q0A A;  5EPL A;  3K0Y A;  2KCC A;  5FOB B;  2F3V A;  5JEA J;  1SSO A;  3S9W A;  2PPB C;  4R8N A;  1T5E A;  4F7X A;  3ND9 A;  5FLX L;  2EOT A;  2Z8L A;  2QIL A;  2ENB A;  3Q22 A;  5C3E B;  1PZJ D;  3IAY A;  1WTQ A;  1E2W A;  1NCV A;  2F0L A;  3T56 B;  3HP3 A;  1BCP C;  3GTM B;  2JA7 B;  5DM6 3;  3NUC A;  4RA8 A;  5COY A;  1KAB A;  3EJI A;  3L9A X;  4HMI A;  1XTC D;  1OO9 B;  1X32 A;  1ET9 A;  1JCK B;  3GQB A;  2EYJ A;  3VR4 A;  4DFA A;  1DYQ A;  3GTJ B;  3E0J A;  2N88 A;  3PV0 A;  4FXG C;  2D9U A;  1SDF A;  2Y0S B;  3D6C A;  1D1K A;  1GUW A;  1BNZ A;  4EQN A;  1S5C D;  2G9H D;  4ZRZ A;  4LMQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...