5ELCA

Cholera toxin el tor b-pentamer in complex with lewis-y
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Cholera enterotoxin subunit B
publication title High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
pubmed doi rcsb
source organism Vibrio cholerae o1
total genus 27
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5elcA00
1BCPC 2XN9C 1LLRD 4RGMA 2SEBD 1CHPD 1JWSD 1S5BD 3R8BA 1SXTA 1EU3A 3GP7A 2CHBD 3OWEB 1TY0A 1SE4A 1EWCA 1KLGD 2IPKD 1MD2D 1HXYD 1SE3A 1JQYD 2QILA 1I4GA 1LTBD 2QEJC 2XRQD 4RFBA 1KLUD 3MFGA 1I4XA 1B44D 1FGBD 4K6LA 3BZDB 1DJRD 5FK9C 1EU4A 1KTKA 1V1OA 3W2DA 2RDGA 3URYA 3EFXD 1AN8A 4O1NA 4RGOS 3BVZA 4RH6A 1EEID 1ENFA 1XXGA 2R61A 4RGNA 1LTRD 1STEA 1LT5D 1AW7A 1SJHD 5D3IB 3BYTB 1ET6A 1CQVA 1D6EC 1PRTB 1T5XD 1FNWA 1RCVD 1CT1D 3O13A 1LTTD 1LT6D 4DXGA 1DYQA 3BVGA 1D5XC 1SBBB 1LT4D 3DWQA 2NTSA 4OHJA 1PTOB 1B1ZA 1CHQD 2J4XA 1TY2A 1ESFA 1PRTF 2AQ2B 1TS3A 1TS2A 5ELDA 1HA5A 3R2TA 1I4HA 4L6TB 3CHBD 1I4RA 1PRTD 3BYYB 4DXFA 1CK1A 1PTOF 4UDUC 1I4PA 1S5ED 1L0XB 1LTID 1RDPD 4RHRA 1SE2A 1BXTA 1PZJD 3R2IA 4TSSA 1PRTC 1PTOD 1EFID 4L63B 1D5ZC 1PZKD 1F77A 1HTLD 1LTSD 4ZYSA 1RD9D 1PZID 1XTCD 2AQ3B 2RDHA 1SJED 1PTOC 1JWMD 2AQ1B 4RCOA 1JWUD 2WV6D 4RHSA 1LT3D 1SEBD 1LTAD 1FNVA 1D5MC 1PYWD 3DWAA 1TS5A 2Z8LA 1PTOH 3V05A 1HQRD 1ET9A 1RF2D 1JCKB 1LTGD 4BWGB 3TSSA 5ELBA 1BCPB 1QILA 4RGTA 1I4QA 2IJ0A 5TSSA 1EEFD 2NTTA 4Z9CB 1L0YB 1V1PB 2ICIA 2XNAC 4C56C 1S5FD 1M4VA 2O2LD 2G9HD 5ELEA 1S5DD 2TSSA 1G8ZD 5ELFA 5ELCA 1FNUA 3SEBA 1BCPF 1S5CD 1TS4A 1LO5D 5FKAC 3DWPA 5D3DA 1BCPD 2XRSD 1UUPA 3MC0B 3EA6A 3KLSX 1UNSA 1V1PA 3BVMA 1GOZA 1JR0D 1FD7D 5I4DA
chains in the Genus database with same CATH superfamily
5C0XG 1HUNA 5I9OA 1EQVA 4DAVA 4AYBB 4JYAL 1KDCA 2PZWA 2QGQA 1WTOA 1GO3E 2R7FA 4N9TA 4BY1B 3S1MH 5IT9L 3NK9A 2XRQD 1Y1VB 4JBJA 1TKWB 3H0GH 1I3QH 5FJ8G 1VQFA 1HZBA 3HOYB 4JC0A 5DNFA 3HOZH 3RN5A 2ES2A 1K73C 5GROA 1EIGA 2B2TC 4EX5A 4DK3C 4A3KG 2N49A 2CCZA 2Y0SB 4KHZA 5D3IB 2NN6I 4ABNA 3W3AA 4JBMA 4OWTB 4CHTB 1L2FA 3E9HA 2NVTH 1ILPA 5JEAG 4DAMA 1IYUA 3E0JA 2VY3A 4C3JH 4P2CB 2HQEA 1JE5A 2V1CC 2RQXA 2CKZB 3QB3A 3PIOA 4IFDI 4DV7L 1S72A 1OXVA 1O7LA 4YHHQ 4RAUC 1X3PA 1B3QA 2DGYA 1IBLQ 3K57A 4QMGA 1TWAH 2F3IA 4PZ7A 2UXBL 1LTAD 2E74C 1UEBA 3C46A 4DAYB 2V4DA 4CJ2C 1KIXA 3BZCA 1ET9A 2L0CA 5IY0A 3HOXG 3K7AB 2F0IA 2XWJB 1GUWA 1GUGA 4QJFA 5EQ0A 1VQKA 1EEFD 4B3SQ 1MHWC 3KLWA 4Q0FA 4GLVB 4LF8L 4PNYA 2KHIA 3EN2A 4JI6Q 3SK6A 3WOEA 3E6ZX 5M5XB 4PQXA 4JI7Q 2WINB 3F2UA 2UUBQ 3KF8B 5I2XA 1HZ9A 1VDZA 4OELB 1GXDC 4GLAC 1BCPC 5C5MA 2F0UA 1VCIA 1PDQA 4EQ5A 1I94Q 2JEBI 4EVOA 2E2JB 3J81L 1KLGD 3T1YL 2B63G 2MPMA 3OWFA 2EPBA 5J3BA 4XT1B 3EBEA 1Y8OB 3M4OH 4LFCL 2H1EA 4ZKBB 3N6RA 4K14A 2N8NA 2EXZA 2L11A 3D6WA 5IYCH 3A5UA 1E2ZA 4RGNA 4RKLA 4YY3L 1D8LA 4BXXH 3CCRA 3NSWA 5M3FG 4G4KA 1T5XD 3QO2A 3NTHA 2JA5G 4JI1Q 4OL7A 4OO1H 1D2BA 3BVGA 3X3MA 3W5OA 4H13C 1LT4D 2LMCB 1B50A 3A8KE 4GOPA 1A63A 1PTOB 3DEPA 3SK4A 2VW9A 1BBXC 3CD6A 4KHPL 1E2VA 2D9UA 2K05A 4R4OA 2B2YA 2A68C 5EKLA 3NWTA 1WCMH 4DV4Q 3CHBD 5AFWA 4DUYL 1LTID 1NR4A 1QB5D 5CMDA 3SHLA 4A3LG 4OX9Q 2XWBB 2VNUD 2B8FA 2F0DA 4JI4Q 1YNNC 2XIWA 4GKKQ 2WV6D 3HG9A 4H0LC 5JJKA 1R4PB 1FYCA 3PO2B 3K80C 3S2HB 3TBIB 1EIYB 5KEEA 4K0KL 1A62A 2CQOA 2OTJA 1MJEA 3ND8A 2XNAC 1V1QA 2KBNA 3L3OC 2NZHA 4R9WA 1B70B 4PG3A 4DR6L 3NXWA 2VQEQ 4BBRH 2JA9A 5FLMG 4A3MB 1VQBA 4K2LA 1SRUA 4BA1I 1U4LA 2PMZE 4DGZA 1JOKA 4LFAQ 4DU9A 4ZLTF 1YI2A 1D1IA 1GOZA 1HCZA 2DNEA 4IPDA 2A6HD 5C4JH 2E2IH 3KLRA 4IZ8A 3MFYA 4YCVA 3M4PA 1SXTA 1CQFA 5JJZA 1KRSA 2GVBA 2KOLA 3GP7A 3SXHA 2JA7G 4JOIC 3H91A 1SYCA 2XVSA 4DNTB 1YBYA 3TP6A 1R9TB 2JP1A 4DR5L 4KJNA 1NE3A 3FKIG 3KF6B 1G2SA 3ONAB 2QEXA 3UDIA 2K7VA 4IUTA 1TWHH 1DD2A 4AYBG 3I4MH 2K52A 1HRJA 3MEFA 2IHEA 2YV5A 2EDGA 2RKSA 2PNRC 2B2UA 4BY1G 3G71A 1CKNB 4LF7L 1ML0D 1Y1VG 3F2BA 2I46A 1OXXK 2UUAQ 2VUMH 1AW7A 3HOYG 4K5XA 3MVVA 4UP8A 1Q12A 4X62L 2F3WA 1NAPA 1X3QA 2NVQH 1D5XC 1J5EQ 2B29A 4R8NA 3CCEA 2ID0A 1K0SA 2Y0SG 3VA7A 5C3EB 2K1BA 3MXGA 1L0WA 1HZCA 2RSNA 5CBEE 3HOUB 2DUDA 1Q86C 1D7QA 4XQJA 3AB9A 4N9PA 4C3IH 4DV5Q 1RDPD 1A15A 1BXTA 3HOVH 5IGDA 3D4RA 1L1OC 5GAEC 1ONLA 4DAYA 2K28A 5C4XH 1SYFA 3OW7A 4DV3L 2JA6B 1WYDA 4YCWA 3FRPB 3T1HQ 1PYWD 1A2UA 5DM63 2OXPA 4BY7H 1E7ZA 4B3TL 2ZTCA 3S2DB 1JCKB 1ZEQX 2B2WA 4R4IA 4HEDA 3GTQB 4LUZA 4HR7B 1CI3M 5AJ3L 1BDOA 1Y8PB 1L0YB 5KNDA 5JAVA 4S3SA 1BUVT 3PO3B 1IBKL 4OIJA 1SR3A 2F0TA 1G8ZD 5ELCA 2BDOA 2B2VC 3I4NB 4IFDG 1VQMA 2MHVA 3I2ZA 2PO4A 4KKSA 4HIKA 2K03A 3AFPA 4X3SA 1YITA 1Y1WB 2NVXH 3G4SA 4HIMA 4A3JH 2F03A 3Q22A 4A93B 1C7YA 2KUMA 3UE0A 1LV9A 2E2HB 1X54A 1KNAA 4CJ1B 1VQLA 1GHJA 4NXNL 1SFOB 3R8BA 2F0FA 1VF7A 2VL6A 5IP7G 1SE4A 4JG2A 5JJIA 1QZHA 2I07B 3H6MA 4KTAA 1NNXA 4O2DA 1NTGA 3BZDB 4FF4A 1DOLA 1EZ6A 3H3VI 4O1NA 1W2BA 1A3VA 3VYRA 1Q1EA 1XXGA 3P75A 4HIOA 4HCEA 3GTMH 1CQVA 3LWEA 1PRTB 1MSGA 1RCVD 2JN4A 1FGUA 1STNA 3WOFA 4L8JA 1WD0A 1SBBB 3I3CA 1FVIA 2NTSA 4OHJA 4A3DH 1BVSA 2Z1CA 3OYYA 2H4OA 2I5LX 3J81c 1WTVA 4QUCA 3PIO3 3BZKA 3WWVA 2ZJQA 1D1KA 4I7ZC 5CR3A 5IE8A 3ND9A 1KDBA 3S1NB 1I4RA 4X64Q 2C9OA 4DR4Q 4L5TA 1VQ8A 1W3SA 4A3FH 2NB0A 2EYHA 2PI2A 4E6IA 3IKJA 1B4OA 1PZKD 2QDBA 4LF4Q 3E5SA 3R3OA 1XNQQ 2BDNA 3UDXA 1JWMD 2CWAA 4UPAA 1EWIA 2A69D 3NPPA 4B08A 2AWOA 3T53B 4DR1L 1TS5A 1HNZQ 1FJGL 3I90A 5DM73 2YTYA 3EROA 4LF9L 4XDXA 1BR9A 3JAME 3S1MB 1I3QB 4IALA 3PO2G 2JQOA 2ZXRA 3AYHB 5C44H 1TR5A 3EJIA 3HOZB 4A3GH 1QNKA 1SNQA 3TN2A 2LKVA 4ILWA 4LNQA 3GTJH 2UUCQ 2K33A 1B9NA 1IYJB 2KENA 2LSSA 3GTPB 3JAML 1Y8NB 3GDEA 4PV1C 1F9SA 3J7AV 1CKMA 3KLSX 2EYLA 2FJ2A 2VZAA 5EKKA 5ELNA 4FVMA 4OGQC 3L9AX 2KEEA 1DOKA 4A3MG 3D3RA 4K5WA 3K5NA 3TQYA 5IYBH 1CUKA 2A6HC 4DV2L 5IODA 3J7YW 4JV5Q 4C3JB 1JICA 2JEAI 3A8JE 3S17H 3MFGA 1AFPA 1FGBD 1CKNA 3I70A 5M9OA 3HOWH 4A3BB 3VYSA 3KFUA 1GUTA 3ERSX 2UU9Q 3BVZA 2RBMA 3VDYA 4EQPA 1STEA 4LUVA 3I72A 4JBKA 4TVAB 2ZJPA 1WFQA 1XMOL 4ME5A 1VQAA 2VQFQ 2E5LL 3D0FA 5E4WC 1YHBA 5BN5A 1T5EA 1SLJA 4GN4B 2F4VQ 2N55A 3F1ZA 2H5XA 5IOCA 4KHVA 5DLQE 1X65A 2I0QA 4HAEA 4P71A 4IPCA 5JPMC 2MP1A 4DXFA 1I4PA 1IKMA 3U58A 4TSSA 4HJ8A 5C3EG 1QE6A 4O42A 3VA5A 2TMPA 2ZJRA 1PV4A 3HOUG 4X66L 1GUSA 3QIAA 2A68D 4NXMQ 3IRBA 3MAQA 5CYUA 1YEZA 5KNBA 4LMQD 1N33L 3A55A 3A0JA 3QWNA 4FXDA 1V9PA 3KLSA 3HKZE 1N8RC 1BCPB 3KJPA 4A3EB 1WTXA 2JA6G 3CMAA 4DR2Q 4OO1I 1VQ7A 5FOBB 2G9HD 3F8TA 5ELEA 2UXCL 1I5FA 4KJOA 1SYGA 4ZAIA 2R93H 1PH2A 5EPKA 1JT8A 2P5ZX 2LXJA 5M3MH 2EY6A 4C3HH 5K36H 3PO3G 2F0EA 3S9WA 3FVQA 3IFTA 1QVGA 2ASBA 3GTLB 2D62A 2F1MA 3QR8A 2JSOA 4RHSA 3I91A 3KYHC 3I4NG 2ZTEA 4GKJQ 1IBMQ 3AEVA 3GTGH 1LM0A 1Y1WG 4FXKC 5I2YA 5LMNL 1R4QB 4A76A 4A93G 2EYFA 1AZQA 1WCMB 1X9NA 4ODGA 3HFZB 3EFXD 4KI0A 1VQHA 1PH1A 1ZYRD 1CSPA 4IOAA 4MHEA 3A54A 1K0RA 1VF5C 4KY6A 4DNRB 1UAPA 4K8JA 2PQAB 1HFNA 2M9VA 1LT6D 2BOSA 3M4YA 3BG3A 4B3ML 1TWGH 2F52A 2NZ1D 5FLXE 3CMEA 4B3RQ 1MKHA 3DM3A 1TY2A 3NELA 4K5VA 1HA5A 1K8MA 1V43A 1XJVA 4LF8Q 4EQNA 4CBVA 4FF2A 2X6LA 3J80E 1SN8A 4JI8L 2K5VA 2Q8RE 2D5DA 2I5HA 2NZOA 1F77A 1T9HA 1HA6A 1TQOA 2QW7A 3G6EA 1ESRA 1QJOA 2OTLA 4G7OC 5IIFA 1EY0A 1XPOA 5IYDG 1DONA 1N34Q 1X56A 2Z6KA 1Q8KA 3J80L 4JBWA 4ZUJA 4LF5L 2Z8LA 1N36L 4R4CA 2A69C 3CPFA 2K5WA 3I4LA 4GS3A 4LWCA 1QILA 4IOCA 4JW0A 2GN5A 5E3FA 1OO9B 1JJCB 2A5HA 4DA2A 4B9XA 1M4VA 4FP5D 3RLFA 3NE5B 4J8QA 4UAIA 3VR6A 5ELFA 1TWHB 2Q2HA 2EYOA 4LUOA 3FMCA 4JI2Q 3QG1A 3CC7A 1DZ1A 1WTHA 3W1BA 3ER0A 1HNXL 3H0GG 4KK7A 4ME3A 2EYPA 2VUMB 1PMRA 1EQTA 1VQCA 2B8GA 1YJWA 4UHVA 4WRDA 2F4IA 3HOZG 1XNRQ 5CV7A 3V96A 3Q8DA 2B63H 2VS1A 3RNUA 2R7ZH 1H9MA 3OTOQ 2NVQB 2G5DA 1JQYD 2QILA 3PUXA 4RFBA 2D0PA 2WP8J 4CDDC 5GQOA 3GD7A 5L37A 4BS9A 2E76C 1EU4A 2LXKA 1VQOA 1PLFA 4CJ0B 4C3IB 4JVZA 4HMJA 4DV0Q 4C3JG 3MXUA 3TDQA 3S1RB 1ENFA 3M3YH 5CV4A 4KMUC 3UE1A 1LT5D 4A3BG 1Z7TA 4YWLA 3BYTB 1PVOA 2XSCA 5C4XB 2K14A 3CCQA 3S16B 2B3GA 5IP9G 1B8AA 2E2DC 1TS2A 4GOPC 1BKBA 1Z47A 3EQLC 4HSPA 1TWFH 3HZXA 3BYYB 2M2LA 2B2YC 1H9SA 3RZDH 1SE2A 2HT1A 4GNXC 3R2IA 4FDBA 4L63B 1MSHA 3NENA 4XXEA 3MTSA 3ZYYX 2BH2A 1STYA 4R1JA 2ZM6Q 3C1EA 4ZRZA 1UE5A 4YHHL 1E24A 3S15H 1IBLL 4DK6C 2Q2IA 1HQRD 1OXSC 1PH3A 2IY5B 2WKCA 4LAAA 4APVA 3M85A 3K8AA 2CH4A 1N32Q 4O0AA 5TSSA 1X55A 1C4QA 4IUUA 1A6XA 3RUZA 2O2LD 3J7A5 1GVPA 5EAYA 4X65Q 3J81j 2QDLA 2PYKA 5A35A 4B3SL 1LO5D 4A3EG 3I73A 5EBCA 4DV6Q 5M5WH 3TZDA 5CV8A 1PFBA 1JJ2A 1RTOA 3P7JA 4JI6L 2EVBA 5I4DA 5J22A 1EY9A 1ENAA 4JI7L 2A19A 1HNWQ 3FKIH 4DUZQ 2UUBL 1YHQA 1NMFA 3GTOB 3I56A 3SE0A 2MO1A 2R7DA 4BXXG 3OMGA 2L1BA 2EYJA 1B7YB 2EQSA 2DY7A 3ULPA 2HHHQ 2R92B 3OIQA 1Y1VH 3JC66 2KJXA 1I94L 4OO1G 1XMQQ 1IKLA 3MHBA 5KYIA 2OCEA 4HJ7A 4KKUA 4EQOA 4MZ9A 3W2DA 3HOYH 3URYA 3NHHA 4LFBQ 4V0BA 2JA8H 2PMZB 4A3FB 4I65A 2MO0A 2B2UC 1WCMG 4QL5A 2HIXA 1ZYRC 1D6EC 2FFKB 4QIWE 2F0HA 5IWAQ 1VMPA 4FXGC 1OXTA 4A4IA 2RVLA 4JI0L 2RCFA 4P74A 1SAPA 4HJ9A 4DR7Q 1DCZA 1K83B 2WB1E 4JI1L 4BBSH 1FL0A 3S24A 3NTIA 1C0AA 4N8X1 4PMWA 2MQHA 4XIGS 4U673 2WAQE 4RHRA 5NUCA 3T16A 2HDMA 2SNSA 1A3TA 3UI2A 4DV4L 2DJFC 1WTPA 1VQ9A 2KCCA 1ICWA 2HCIA 3Q6SA 2HIVA 4DR3Q 1SMYD 4FO2A 4JCVE 4XT3B 1F9QA 1BO0A 4WORA 3OOCA 1O7ZA 5IT9c 4WJ4A 4IQZA 2CH4W 4OX9L 3K5LA 4CKEA 3PGZA 4JI4L 4X3KA 1LABA 4F8MA 5JOBA 4GKKL 3PSIA 3RZOB 4RG1A 1F9RA 3RLOA 3T56B 4RGTA 1Y14B 4K8IA 2B2WC 3QOJA 4ZK9B 3CCUA 1TXYA 3MZ5A 3HOWB 3U50C 1FNUA 3SEBA 3DXJC 5EJWA 1P16A 2NN6G 1W6JA 3F2DA 3AU7A 4WJ3M 1OXUA 2VQEL 1E1OA 1BBUA 1JR0D 2F3VA 5C6AA 3JAMi 3DLLA 3GTKH 3GV6A 2EY2A 3LNNA 1DXMA 2F0PA 3PQIA 3KDFB 4P73A 3K7UC 3BDLA 4LFAL 2L5TA 1SE3A 1MJCA 1WI5A 4UY8C 2VUMG 5EBDA 3WDNA 3U4ZA 1PA6A 2E2JH 1GKHA 3KF8A 1B44D 1EIFA 1P8LA 4K6LA 1Y69U 1F2LA 2XGTA 3Q24A 4JI3Q 4A3IH 1U4MA 3PUVA 1EEID 3TEHB 4XQQA 1J6QA 1XYIA 5EPJA 1F2YA 2R61A 1QUQB 4NB3A 5LMUQ 3DM1A 1KQSA 3K58A 1CT1D 1A3UA 4C3IG 5EKIA 4C1NK 1WTWA 2AMCB 1X3GA 2SDFA 3MWYW 3SGIA 4JI5Q 2UUAL 4KD3A 5J39A 5E7NA 2FINB 4QQBX 4DV1Q 5A2QE 3STBD 3TS0A 1AH9A 1MGSA 1TS3A 1STAA 1CSQA 5C4XG 1J5EL 3CCMA 1HR0Q 4RA8A 4IO9A 4DAPA 4XTCS 2YU9B 1PFNA 4C2MB 3G6JB 3NEMA 1EUJA 1HFGA 5A2QL 1D5ZC 4ULLA 1DGSA 3OIPA 3CQZH 1RD9D 3T4AC 4Y7NH 2AQ3B 4C3HB 1SJED 4DV5L 1E0BA 2LY7A 2ZXOA 3W1GA 1SEBD 3H94A 4OIKA 1PYSB 3K5MA 3K59A 4HMIA 2GA4B 2IX1A 3IL8A 2F0VA 4OWWB 4H7BA 3IFDA 3NP8A 2HUGA 1WTQA 1ZKOA 1WJJA 3T1HL 4AQYQ 2NTTA 3M9BA 1V1PB 2BCOA 4J15A 4C56C 5D14A 4YIJA 1TVXA 1S5DD 2TSSA 1U0LA 3T13A 3CC2A 4K2KA 1MI2A 2LFNA 1I50H 1BF4A 1EFWA 1S5CD 2F0LA 3PF4A 1JORA 4M1UB 3SR1A 2RA4A 1CA6A 2OQKA 2UXDL 2PQEA 1X6OA 3ULLA 4R4TA 1NJIC 3L0OA 4A3MH 1EY7A 4QCLA 2A8VA 2Q2TA 4M8AA 4X6AH 2I5MX 5EPLA 1M90C 4QY7A 3OHXC 1A0IA 1TWGB 2PW5A 3OW2A 3H0GB 3V2TA 2O5IC 1CKOA 1HXYD 1STBA 2F0JA 4A75A 1TWCH 3HEJA 2EJMA 1R9TH 4YWKA 1GM5A 2EXDA 4NW2A 1U9RA 2KA7A 1V1OA 2AWNA 3KK7A 2R92G 1KABA 2NVTB 4P72A 3FHWA 3KF6A 3CXCA 1F2MA 1LTTD 5IGCA 3PIPA 3K0XA 4KLKA 4OXPA 4KY5A 4A3FG 1G6PA 1NCVA 1CTMA 1YVCA 1IL8A 4AH6A 2Z0SA 1GD7A 1KAAA 2BE5C 5C3WA 1G291 3R2TA 1I4HA 3BJUA 4K6DA 1AZPA 3U9SA 3CC4A 4UDUC 1XTDA 1NY4A 1O78A 4HJ5A 3HOUH 4GN5A 2QF7A 1F2ZA 4OONA 2ATWA 1TWAB 4X64L 1SYEA 2RDHA 1XTCD 1EQRA 2L15A 3CU7A 2VB3X 1VQ4A 3KJOA 4DR4L 4DF7A 2RF4A 4F7XA 4YCUA 4I7AA 4TRDA 1X3FA 2JA6H 3PUYA 4LF4L 1SMYC 3UDFA 1HH2P 1XNQL 2R7ZB 3BDCA 1LTGD 2BA0A 4RKBA 3J80i 3TSSA 3VR5A 4XYOA 4H44C 2NVYH 4IUQA 4HSVA 4FF3A 4A3CH 1HNZL 4TKOB 1YHAA 5F2DA 2O4XA 3C1FA 1GHKA 1EZ8A 3C3LA 3PO3H 2MUYA 4LF6Q 2CFMA 2HCCA 5IYBG 4R8IA 2EZVA 2N3SA 3HKSA 5C3XA 4JYAQ 2XRSD 3M3YB 1UUPA 2WACA 3KDFA 3HOWG 3M4QA 2DJGC 3BVMA 5M5YH 5H1SE 2RCNA 3NTKA 1O7IA 2XN9C 4A93H 2SEBD 1JWSD 2UUCL 4L5QA 3HKZB 2X69A 5JVG3 3E3XA 5I6YA 1QOHA 2IPKD 1X32A 4ZCKA 3ZJYC 3M4OB 1F9PA 1B9MA 5FO8B 1WTRA 3D31A 5HY6A 2IX3A 1AE3A 4POFA 1TWFB 5C0XH 4JV5L 4RH6A 5KIXA 3UDGA 1LTRD 2K04A 2RHSB 5C4ZA 2WIIB 3EVQA 4GNXB 1VQJA 3J7AF 3CRLC 5FJ8H 1S4ZA 2UU9L 4AIMA 3FPUB 1CA5A 4H02A 2A1AA 3DWQA 1S3OA 2C5CA 5JPNC 1NR2A 1IW7D 2Z4HA 1Q1BA 1K3BC 1JMCA 3G48A 2LS01 4DV7Q 4A3KH 2VQFL 1HQMC 1LACA 3STBC 2A6ED 1PTOF 2F4VL 3D4WA 1L0XB 1EY5A 3A7LA 2F0MA 5CC4A 5JEAH 5IYDH 1PH7A 2UXBQ 5BN3A 2NWGA 1U5KA 1KC8C 1WOCA 3NBHB 4IJLA 3FDTA 3S1QH 2AKWB 2F0OA 2ICEC 3R93A 2EJGC 3A5ZB 4UP7A 3ERQA 2EE1A 2IHFA 2DY8A 1TT2A 1D5MC 3DWAA 2PCFB 3AFQA 5J1ZA 4X3UA 1HTPA 3CF5A 2CWPA 2BH8A 1EYGA 2Z6KC 3H09A 4C3HG 4AYBE 4NXML 5HURA 2CVRA 4HIDA 5K36G 5FO7B 1VQIA 4R4QA 5FLXL 4HN7A 4IN3A 2RHQB 1JOQA 3D8GA 1JB7A 4BBRB 3I55A 1ASZA 2R6GA 3E0EA 2JA8B 4POGA 3HOXH 4DR2L 2KHJA 3OPOA 1JJGA 3FP9A 4KN7C 5C4JB 1I6HH 2NUCA 2E2IB 1C9OA 2EY5A 2K6AA 3GTPH 2Y0SE 3T1YQ 1PYBA 2PPBC 3SK5A 1H95A 4RGMA 4UP9A 3CCSA 3MXPA 4LFCQ 2CHBD 3A8IE 5ELOA 2JE6I 3C2PA 1IZ6A 2RSOA 3I4MB 4GKJL 4KD4A 4BBSB 1IBML 5FK9C 2GVAA 4YY3Q 3MXNB 2B2TA 4DK1A 1MIUA 1SNDA 4XYQA 2SNMA 4A3BH 5IGBA 4RGOS 4IUVA 3RMHA 3RD4A 3E9IA 1KNEA 3CPWA 4OWXB 4Y52H 1VQ5A 3ITPA 2JJQA 4KHPQ 2F0SA 4HCSA 4DXGA 5CV9A 5IP9H 1X3EA 2KVMA 5C0XJ 2OEOA 3HRZC 5BR8L 1VS0A 1A8VA 1B1ZA 1CZGA 4DUYQ 3HP3A 3TP5A 3P20A 2PNHA 3TP8A 2F0KA 5KYLA 3BS1A 1AE2A 5M3FH 3S14H 3B6YA 3HOVB 5JJLA 4B3RL 2JA5H 1YNJD 3QJYA 3JAMc 3KOJA 5LL6X 1PHJA 2FXQA 1EY4A 5I6WA 1TIID 5DEHA 1PTOD 2M00A 3T51B 3TP7A 1L1OB 1B2TA 4RCOA 4BA2I 4PMBA 4Q5VA 4BY7B 4K0KQ 4ZKCB 3GO5A 3J81E 3N52A 4FYDA 1FNVA 1BOSA 3V05A 3NBIA 5JEAJ 3GTKB 5E1FA 4A3LH 1JE4A 4RCNA 1N34L 4X3TA 4DR6Q 1VQEA 2K5NA 4Z9CB 4XQNA 1HPCA 1VQDA 2Q2UA 3K6OA 4A3EH 1HR0W 1QG7A 1VQNA 3TS2A 2R7ZG 5KGUA 5I9PA 2NVXB 3DEOA 1M1KC 1SMXA 3D4DA 4A3JB 4A3IB 1CM9A 3K5OA 3MA2B 1A2TA 2JYOA 1S40A 1C48A 3PMFA 1EIHA 1QVCA 3EA6A 3F2CA 2L12A 1OTCA 2RDFA 1FD7D 3GTLH 4JI2L 2Q8IB 4DR5Q 4RWSC 4JI0Q 2ZXPA 3PCOB 5FLMH 1M8AA 4DK0A 1YJ9A 4DFAA 3RN2A 1XNRL 4LF7Q 3DMUA 2AUJD 3X3NA 4EGVA 3OTOL 1RTNA 1SYDA 2K32A 1KAWA 3HKZG 4MNOA 5FO9B 3PIP3 3RLNA 4GNXA 5CORA 1ILQA 4X62Q 4MTKA 2JA7H 4PMCA 3GTMB 3TRZA 3CQZB 4Y7NB 1BBWA 1E22A 1SJHD 1PH6A 2CW0D 3LGJA 1FNWA 5IYCG 4DV0L 4A3DB 2IWHA 1DYQA 2PI2E 3CCLA 2EY1A 4CKBA 3BU2A 4BY1H 1CHQD 5CGKA 2MGSA 1UEAB 1PRTF 3ULJA 2VXWA 3FEWX 1EQQA 1Q90A 3TZUA 1IW7C 3NUCA 1SNCA 4P75A 5EGTA 2PQAA 4CGYB 3NBHA 1K8GA 5IGEA 2OQ0A 5G3LF 1EY8A 1HHVA 4DV3Q 4WFN3 3PUWA 1I50B 2A6EC 4CDCC 2AUKA 1PFMA 4NKLA 1PZID 4B3TQ 2A73B 2Z6BA 1UE1A 4QIWB 2BA1A 2BE5D 1Q8IA 4QUFA 2IL8A 4KV6A 5AJ3Q 1EWHA 1VQGA 1G91A 4MN3A 1AEXA 2CQAA 2KEDA 4ZQ3A 1PH5A 5CV6A 2ZM6L 4J6HA 1IBKQ 5JVH3 1CFMA 1YJNA 4QF4A 2WB1B 1RODA 3L2PA 1YIJA 1I4QA 2F0NA 1QCBD 2WKDA 5BN4A 5CBAE 1TWCB 2EYMA 2WAQB 1S5FD 5C44B 4A3GB 2NN6H 2ZTDA 4JK1C 2YTVA 2PZUA 3GTJB 2L55A 1N32L 1E1TA 5KNCA 4NXNQ 3VR4A 2DN8A 3SDZA 4X65L 5DAUA 2MJ8A 1UNSA 2ALYB 4BBRG 1XWEA 4GLXA 3LWUA 4JOIA 3CP0A 3FPPA 1S5BD 2JA8G 4DV6L 1BNZA 3K7AH 1EU3A 3LX0A 5LMNW 3OWEB 3S17B 1TY0A 4CDEC 4IFDH 2R3ZA 3MXNA 1RHPA 3J7ZC 2VB2X 3TREA 2FMCA 5FLXc 1I4XA 2L4NA 1HNWL 4DUZL 4YWMA 1DJRD 3Q0AA 1SSOA 2OT2A 1V8QA 2RDGA 1PH9A 5LHY1 5M5XH 1STHA 1H9RA 2K75A 2KCNA 4CDFC 3J80c 2HHHL 1K8AC 2NBFA 5IP7H 4NMZA 3ICEA 3I4MG 2YYZA 4BBSG 1XMQL 4NDXA 3S1RH 2K5HA 3I8ZA 4LFBL 4IJHA 4F87A 4L5SA 2ENBA 2EJFC 1JB3A 5COYA 2J4XA 1ESFA 1DOMA 2D0OA 3S16H 1J9OA 5ELDA 3OSOA 2NVYB 5IWAL 1RIPA 2B39A 1PRTD 2E8GA 2MNAA 1L1OA 1EY6A 1S5ED 1K8OA 4DR7L 3SK8A 1SDFA 1K3RA 5GAGC 1PZJD 3I4OA 2UXDQ 3PUZA 1EYDA 4DR1Q 1RJTA 1YNJC 2A74C 1FJGQ 5G3LD 2PZTA 4FNFA 4LW1A 1SNOA 5D65A 1PTOC 2AQ1B 1N9WA 3HOVG 4LF9Q 5C5LA 1LYLA 1UWVA 3NWSA 5C0XI 5HGQA 1CZWA 5M5YB 1VQPA 1PTOH 1U4PA 1RF2D 1JOOA 3A56A 4MTNA 4BWGB 4DR3L 1KXLA 1ENCA 1LTLA 3AMUA 2EOTA 3RR5A 1NUCA 3K81C 4BY7G 3SVMA 1FR3A 5KRUA 2R93B 2B2VA 2OF1A 3PV0A 2KQ3A 5LL6S 2D2CC 1G51A 1II3A 1JC7A 5M3MB 1IL2A 1BCPF 4IPHA 2K4KA 4KY7A 1QWYA 2KCMA 4G57A 5D3DA 2IX0A 2NYZD 2DNCA 3VR3A 3GV3A 4IURA 4DV2Q 2HQLA 2ZT9C 4QGUA 2IW3A 1C8CA 4PZ8A 3PO2H 3GTGB 1LLRD 3S2HH 4B9WA 2QA4A 1CHPD 4A3JG 4A3IG 2N88A 1G6ZA 1NSNS 1Q46A 1K9MC 1O80A 1PH4A 3BDOA 3CRKC 1VMCA 3GTOH 4C1NI 1I6VC 1TU2B 3G7LA 5HGTA 4A3KB 1PH8A 2JK8A 1ICFB 4WJWA 2R92H 2FHTA 3P1HA 1XMOQ 3DUZA 2SOBA 4G7HC 4IFDJ 2E5LQ 1XPUA 2K01A 4ZUIA 3VR2A 4G7ZC 3H15A 3OMCA 3HGBA 1WVLA 4JI3L 3S1QB 1ET6A 1HUMA 2F0QA 3L7ZC 3NQTA 3O13A 5T1IA 1SROA 1HZAA 4KN4C 3A7AB 1RL2A 1Z6HA 4MIUA 4L5RC 2CW0C 1H9KA 1K28A 3CKIB 5LMUL 1U4RA 2HD3A 2XTIA 3KBXA 3Q23A 5GAHC 4A3DG 4OEMB 1SNPA 1K83H 2C35B 4L6TB 4JI5L 4GZYC 1CK1A 4CKCA 2KCTA 4DV1L 4X66Q 4HTHA 2OWOA 4FF1A 4NPSA 1IYVA 3QOLA 4PZ6A 3KBGA 3K0YA 3D6CA 1N33Q 1AP0A 1HR0L 3HOXB 3NQIA 5IGGA 2YTXA 1DM0B 3KUPA 4F88A 1W6KA 1NMGA 1I6HB 2HDLA 4U68A 2JXMB 5E4XA 3CW2C 3VYUA 1SNMA 2UXCQ 4GN3B 5C3EH 5ELBA 1EOTA 1KDAA 2IJ0A 3RZOH 1YZ6A 5K5PA 1O7YA 1B53A 1KL9A 3A74A 4ID6A 3HS0C 1YNXA 5IGFA 1MBYA 4N8FA 2Q8TA 2WB1G 2G9DA 1TS4A 2L9HA 4AQYL 2Z9HA 4IUNA 2Z4IA 1XX8A 1ASYA 1IHZA 1BCPD 4JPBW 2WAQG 5C44G 4A3GG 2B63B 2FMMA 2QKIC 2MFIA 5LMNQ 3DHQA 1QZGA 5GADC 1Q3LA 4DNIA 3S2DH 2J0TD 1B3AA 3GQBA 1ZXTA 3GTQH 1E3PA 1STGA 1J8IA 1EWCA 1LUZA 1MD2D 4V190 1I4GA 2QEJC 1LTBD 2KHSA 1GJXA 1KLUD 2EIFA 2J7ZA 3MEHA 3S14B 2X6GA 5M3FB 1G2TA 1KTKA 1Z9FA 1Q82C 3I4NH 2JA5B 4QB4A 2WFWA 1AN8A 4TQUS 1SE8A 1Y1WH 1IXRA 1SYBA 1RKNA 1BQQT 1PXUA 4B3MQ 1QNUA 3VYTA 1GUOA 2E2HH 2O5JC 3U4VA 1H9SB 1SFOH 4KKTA 4DPGA 1KRTA 1Q7YC 1UE7A 1EYAA 4JI8Q 4ALPA 1H9JA 2AQ2B 4DKAC 2F0WA 1QUQA 1GUNA 5ISRA 1EYCA 4GOPB 3CAMA 3RZDB 1KD1C 4LJZC 3M7NA 1EL0A 1Q81C 4LK1C 3EIVA 1YNND 1PRTC 2N78A 2YU9H 1EFID 1NBWA 2AHOB 4NP5A 1EOVA 4C2MH 1HTLD 1LTSD 4IUPA 4LF5Q 4DN4M 4ZYSA 2QCPX 1N36Q 4A3CG 4IPGA 3TMEA 3H3VC 1JWUD 3S15B 1LT3D 4J1MA 4HJAA 3I7FA 1E2WA 3IAYA 5C4HA 3H3VH 2IT1A 1XPRA 3M7GA 1VQ6A 2K5DA 1PFSA 2KECA 1QVFA 3S1NH 4RMFA 1HJPA 2K5QA 2ICIA 3PF5A 1HNXQ 3CCJA 1UE6A 3U9OA 3AQQA 3J81i 5T1GA 3CCVA 5FKAC 5M5WB 3DWPA 1WD1A 2JA7B 5IT9E 2R93G 1KHIA 2E75C 3MC0B 2PW7A 4LF6L 1V1PA 2K50A 2F0GA 5BR8Q 3FKIB 5M3MG 5CV5A
chains in the Genus database with same CATH topology
5C0XG 1HUNA 5I9OA 1EQVA 4DAVA 4AYBB 1KDCA 2PZWA 1WTOA 4BY1B 4N9TA 5IT9L 3NK9A 2XRQD 1Y1VB 1TKWB 3HOYB 5DNFA 1EIGA 2B2TC 2Y0SB 4KHZA 5D3IB 2NN6I 4ABNA 3W3AA 4CHTB 1ILPA 5JEAG 1IYUA 3E0JA 4P2CB 2HQEA 2RQXA 3QB3A 4IFDI 1OXVA 1O7LA 4RAUC 1X3PA 3K57A 4QMGA 1LTAD 2E74C 3C46A 2V4DA 4CJ2C 1ET9A 2L0CA 3K7AB 2F0IA 2XWJB 1GUWA 1GUGA 5EQ0A 1EEFD 4Q0FA 4PNYA 3SK6A 3WOEA 3E6ZX 5M5XB 4PQXA 2WINB 3F2UA 5I2XA 1VDZA 1GXDC 1BCPC 5C5MA 2F0UA 1VCIA 1PDQA 2JEBI 4EVOA 2E2JB 3J81L 1KLGD 2MPMA 3OWFA 2EPBA 4XT1B 1Y8OB 2H1EA 4ZKBB 3N6RA 4K14A 2EXZA 2L11A 3D6WA 1E2ZA 4RGNA 4RKLA 3NSWA 4G4KA 1T5XD 3QO2A 3NTHA 4OO1H 4OL7A 1D2BA 3BVGA 3X3MA 4H13C 1LT4D 2LMCB 1B50A 3A8KE 1PTOB 3DEPA 3SK4A 1BBXC 1E2VA 2D9UA 2K05A 2B2YA 2A68C 5EKLA 3NWTA 3CHBD 5AFWA 1LTID 1NR4A 1QB5D 5CMDA 3SHLA 2XWBB 2VNUD 2B8FA 2F0DA 1YNNC 2XIWA 2WV6D 3HG9A 4H0LC 1R4PB 1FYCA 3PO2B 3S2HB 3TBIB 5KEEA 3ND8A 2XNAC 3L3OC 4R9WA 3NXWA 4A3MB 4K2LA 4BA1I 1U4LA 4DGZA 1JOKA 4ZLTF 4DU9A 1D1IA 1GOZA 1HCZA 2DNEA 2A6HD 3KLRA 4IZ8A 3MFYA 1SXTA 1CQFA 5JJZA 3GP7A 2KOLA 3SXHA 3H91A 1SYCA 2XVSA 4DNTB 3TP6A 1R9TB 2JP1A 4KJNA 1G2SA 3ONAB 2K7VA 4IUTA 1DD2A 1HRJA 2EDGA 2RKSA 2PNRC 2B2UA 1ML0D 2I46A 1OXXK 1AW7A 4K5XA 3MVVA 1Q12A 2F3WA 1NAPA 1X3QA 1D5XC 4R8NA 2ID0A 3VA7A 5C3EB 2K1BA 3MXGA 2RSNA 5CBEE 3HOUB 4XQJA 3AB9A 4N9PA 1RDPD 1A15A 1BXTA 5IGDA 3D4RA 1ONLA 4DAYA 2K28A 1SYFA 3OW7A 2JA6B 3FRPB 1PYWD 1A2UA 5DM63 2OXPA 3S2DB 1JCKB 1ZEQX 2B2WA 4HEDA 3GTQB 4HR7B 1CI3M 1BDOA 1Y8PB 1L0YB 5KNDA 5JAVA 4S3SA 1BUVT 3PO3B 4OIJA 2F0TA 1G8ZD 5ELCA 2BDOA 2B2VC 3I4NB 4IFDG 2MHVA 4KKSA 2PO4A 2K03A 4X3SA 1Y1WB 2F03A 3Q22A 4A93B 2KUMA 1LV9A 2E2HB 1KNAA 4CJ1B 1GHJA 1SFOB 3R8BA 2F0FA 1VF7A 1SE4A 2I07B 3H6MA 4KTAA 3BZDB 4FF4A 1DOLA 1EZ6A 4O1NA 1A3VA 3VYRA 1Q1EA 1XXGA 3P75A 4HCEA 1CQVA 3LWEA 1PRTB 1MSGA 1RCVD 1STNA 3WOFA 4L8JA 1WD0A 1SBBB 3I3CA 2NTSA 4OHJA 2Z1CA 2H4OA 1WTVA 4QUCA 3PIO3 1D1KA 4I7ZC 5CR3A 3ND9A 1KDBA 3S1NB 1I4RA 2C9OA 2EYHA 2NB0A 4E6IA 3IKJA 1B4OA 1PZKD 2QDBA 3E5SA 3R3OA 2BDNA 1JWMD 2A69D 3NPPA 4B08A 2AWOA 3T53B 1TS5A 3I90A 5DM73 3EROA 4XDXA 1BR9A 3JAME 3S1MB 1I3QB 4IALA 2ZXRA 1TR5A 3EJIA 3HOZB 1QNKA 1SNQA 3TN2A 2LKVA 4ILWA 2K33A 1B9NA 3GTPB 3JAML 1Y8NB 4PV1C 1F9SA 3J7AV 2EYLA 2FJ2A 3KLSX 5EKKA 4FVMA 4OGQC 3L9AX 2KEEA 1DOKA 3D3RA 4K5WA 3K5NA 2A6HC 5IODA 3J7YW 4C3JB 1JICA 2JEAI 3A8JE 3MFGA 1AFPA 1FGBD 3I70A 5M9OA 4A3BB 3VYSA 1GUTA 3BVZA 2RBMA 4EQPA 1STEA 3I72A 4ME5A 5E4WC 5BN5A 1T5EA 2N55A 5IOCA 4KHVA 4HAEA 5JPMC 2MP1A 4DXFA 1I4PA 1IKMA 4TSSA 1QE6A 4O42A 3VA5A 2TMPA 1GUSA 3QIAA 2A68D 3MAQA 5CYUA 5KNBA 4LMQD 3A55A 3QWNA 4FXDA 3KLSA 1BCPB 4A3EB 1WTXA 4OO1I 5FOBB 2G9HD 5ELEA 4KJOA 1SYGA 4ZAIA 5EPKA 2EY6A 5K36H 2F0EA 3S9WA 3FVQA 3IFTA 3GTLB 2D62A 2F1MA 2JSOA 4RHSA 3I91A 4FXKC 5I2YA 1R4QB 2EYFA 1AZQA 1WCMB 4ODGA 3EFXD 4KI0A 1ZYRD 4MHEA 3A54A 1VF5C 4KY6A 4DNRB 1UAPA 4K8JA 1HFNA 2M9VA 1LT6D 2BOSA 3M4YA 3BG3A 2NZ1D 5FLXE 1TY2A 4K5VA 1HA5A 1K8MA 1V43A 4EQNA 4CBVA 4FF2A 2X6LA 3J80E 2Q8RE 2D5DA 1F77A 1HA6A 1TQOA 1ESRA 1QJOA 4G7OC 5IIFA 1EY0A 1DONA 3J80L 4JBWA 4ZUJA 2Z8LA 2A69C 2K5WA 3I4LA 1QILA 5E3FA 1OO9B 2A5HA 4DA2A 4B9XA 1M4VA 4FP5D 3RLFA 3NE5B 4J8QA 4UAIA 3VR6A 5ELFA 1TWHB 2EYOA 3FMCA 3QG1A 1DZ1A 4KK7A 2EYPA 2VUMB 1PMRA 1EQTA 2B8GA 4WRDA 2F4IA 5CV7A 3V96A 1H9MA 2NVQB 1JQYD 2QILA 3PUXA 4RFBA 2WP8J 3GD7A 4BS9A 2E76C 1EU4A 1PLFA 4CJ0B 4C3IB 4HMJA 4C3JG 3MXUA 3TDQA 3S1RB 1ENFA 5CV4A 4KMUC 1LT5D 1Z7TA 3BYTB 2XSCA 5C4XB 3S16B 2E2DC 1TS2A 1Z47A 3EQLC 4HSPA 3HZXA 3BYYB 2M2LA 2B2YC 1H9SA 1SE2A 3R2IA 4L63B 1MSHA 4XXEA 3MTSA 3ZYYX 1STYA 3C1EA 4ZRZA 1HQRD 1OXSC 2WKCA 4LAAA 3M85A 5TSSA 4IUUA 1C4QA 1A6XA 3RUZA 2O2LD 2PYKA 5A35A 1LO5D 3I73A 5EBCA 3TZDA 5CV8A 1PFBA 1RTOA 3P7JA 2EVBA 5I4DA 5J22A 1EY9A 1ENAA 3GTOB 3SE0A 3OMGA 2L1BA 2EYJA 2DY7A 2R92B 3OIQA 2KJXA 4OO1G 1IKLA 3MHBA 5KYIA 4KKUA 4EQOA 3W2DA 3URYA 3NHHA 4V0BA 2PMZB 4A3FB 4I65A 2B2UC 1ZYRC 1D6EC 2FFKB 2F0HA 1VMPA 4FXGC 1OXTA 2RVLA 1SAPA 1DCZA 1K83B 3NTIA 4PMWA 4XIGS 4U673 4RHRA 5NUCA 3T16A 2HDMA 2SNSA 1A3TA 3UI2A 1WTPA 2KCCA 1ICWA 2HCIA 3Q6SA 1SMYD 4FO2A 4XT3B 1F9QA 1BO0A 4WORA 3OOCA 1O7ZA 4IQZA 3K5LA 4CKEA 4X3KA 1LABA 4F8MA 5JOBA 3RZOB 1F9RA 3T56B 4RGTA 4K8IA 2B2WC 3QOJA 4ZK9B 3MZ5A 3HOWB 1FNUA 3SEBA 3DXJC 5EJWA 2NN6G 1W6JA 3AU7A 1OXUA 5C6AA 1JR0D 2F3VA 3GV6A 2EY2A 3LNNA 1DXMA 2F0PA 3BDLA 2L5TA 1SE3A 5EBDA 3WDNA 3KF8A 1B44D 4K6LA 1Y69U 1F2LA 3Q24A 1U4MA 3PUVA 1EEID 4XQQA 1XYIA 5EPJA 1F2YA 2R61A 3DM1A 3K58A 1CT1D 1A3UA 4C3IG 5EKIA 4C1NK 1WTWA 2SDFA 3MWYW 4KD3A 5J39A 2FINB 5A2QE 1MGSA 1TS3A 1STAA 4RA8A 4DAPA 4XTCS 2YU9B 1PFNA 4C2MB 3G6JB 1HFGA 5A2QL 1D5ZC 4ULLA 3OIPA 1RD9D 3T4AC 2AQ3B 4C3HB 1SJED 1E0BA 2LY7A 2ZXOA 1SEBD 3H94A 4OIKA 3K5MA 3K59A 4HMIA 2GA4B 2IX1A 3IL8A 2F0VA 4H7BA 3IFDA 3NP8A 2HUGA 1WTQA 1ZKOA 2NTTA 1V1PB 2BCOA 4C56C 5D14A 4YIJA 1TVXA 1S5DD 2TSSA 3T13A 4K2KA 1MI2A 2LFNA 1BF4A 1S5CD 2F0LA 1JORA 4M1UB 3SR1A 2RA4A 1CA6A 2PQEA 1EY7A 4QCLA 4M8AA 5EPLA 3OHXC 1TWGB 2PW5A 3H0GB 3V2TA 2O5IC 1HXYD 1STBA 2F0JA 3HEJA 2EJMA 4NW2A 1U9RA 2KA7A 1V1OA 2AWNA 3KK7A 1KABA 2NVTB 1F2MA 1LTTD 5IGCA 4KY5A 1NCVA 1CTMA 1IL8A 1KAAA 2BE5C 5C3WA 1G291 3R2TA 1I4HA 4K6DA 1AZPA 3U9SA 4UDUC 1O78A 2QF7A 1F2ZA 1TWAB 1SYEA 2RDHA 1XTCD 3CU7A 2VB3X 4DF7A 4F7XA 4TRDA 3PUYA 1SMYC 2R7ZB 3BDCA 1LTGD 2BA0A 4RKBA 3TSSA 3VR5A 4XYOA 4H44C 4IUQA 4HSVA 4FF3A 4TKOB 5F2DA 2O4XA 3C1FA 1GHKA 1EZ8A 3C3LA 2MUYA 2HCCA 4R8IA 2EZVA 5C3XA 2XRSD 3M3YB 1UUPA 2WACA 3BVMA 3NTKA 2XN9C 2SEBD 1JWSD 3HKZB 2X69A 5JVG3 5I6YA 1QOHA 2IPKD 1X32A 3M4OB 1F9PA 1B9MA 5FO8B 1WTRA 3D31A 2IX3A 1TWFB 5C0XH 4RH6A 5KIXA 1LTRD 2K04A 5C4ZA 2WIIB 3EVQA 3J7AF 3CRLC 1S4ZA 3FPUB 1CA5A 3DWQA 2C5CA 5JPNC 1NR2A 1IW7D 2Z4HA 1Q1BA 2LS01 1HQMC 1LACA 2A6ED 1PTOF 3D4WA 1L0XB 1EY5A 3A7LA 2F0MA 5CC4A 5JEAH 5BN3A 2NWGA 3FDTA 2F0OA 2ICEC 3R93A 2EJGC 3ERQA 2EE1A 2DY8A 1TT2A 1D5MC 3DWAA 2PCFB 5J1ZA 4X3UA 1HTPA 3H09A 4C3HG 5HURA 2CVRA 5K36G 5FO7B 5FLXL 4HN7A 4IN3A 1JOQA 3D8GA 4BBRB 2R6GA 2JA8B 3OPOA 4KN7C 5C4JB 2NUCA 2E2IB 2EY5A 2K6AA 2PPBC 3SK5A 4RGMA 3MXPA 2CHBD 3A8IE 2JE6I 3C2PA 2RSOA 3I4MB 4KD4A 4BBSB 5FK9C 2B2TA 4DK1A 1SNDA 4XYQA 2SNMA 5IGBA 4RGOS 4IUVA 3RMHA 3RD4A 1KNEA 3ITPA 2F0SA 4HCSA 4DXGA 5CV9A 5C0XJ 2KVMA 2OEOA 3HRZC 1B1ZA 1CZGA 3HP3A 3TP5A 3P20A 3TP8A 2F0KA 5KYLA 3BS1A 3HOVB 1YNJD 3QJYA 5LL6X 1EY4A 5I6WA 1TIID 5DEHA 1PTOD 2M00A 3T51B 3TP7A 1B2TA 4RCOA 4BA2I 4PMBA 4Q5VA 4BY7B 4ZKCB 3GO5A 3J81E 3N52A 4FYDA 1FNVA 1BOSA 3V05A 3NBIA 5JEAJ 3GTKB 5E1FA 1JE4A 4RCNA 4X3TA 4Z9CB 4XQNA 1HPCA 3K6OA 1QG7A 5KGUA 5I9PA 2NVXB 3DEOA 3D4DA 4A3JB 4A3IB 1CM9A 3K5OA 1A2TA 2JYOA 3MA2B 1C48A 3PMFA 1EIHA 3EA6A 2L12A 2RDFA 1FD7D 2Q8IB 4RWSC 2ZXPA 1M8AA 4DK0A 4DFAA 3DMUA 2AUJD 3X3NA 4EGVA 1RTNA 1SYDA 2K32A 5FO9B 3PIP3 5CORA 1ILQA 4PMCA 3GTMB 3CQZB 4Y7NB 1SJHD 2CW0D 1FNWA 4A3DB 2IWHA 1DYQA 2EY1A 4CKBA 1CHQD 5CGKA 2MGSA 1UEAB 1PRTF 2VXWA 3FEWX 1Q90A 3TZUA 1IW7C 3NUCA 1SNCA 5EGTA 4CGYB 3NBHA 5IGEA 5G3LF 1EY8A 1HHVA 4WFN3 3PUWA 1I50B 2A6EC 2AUKA 1PFMA 4NKLA 1PZID 2A73B 4QIWB 2BA1A 2BE5D 1Q8IA 4QUFA 2IL8A 4KV6A 1EWHA 1G91A 4MN3A 1AEXA 2CQAA 2KEDA 4ZQ3A 5CV6A 4J6HA 5JVH3 1CFMA 4QF4A 2WB1B 1RODA 1I4QA 2F0NA 1QCBD 2WKDA 5BN4A 5CBAE 1TWCB 2EYMA 2WAQB 1S5FD 5C44B 4A3GB 2NN6H 4JK1C 2PZUA 3GTJB 2L55A 5KNCA 3VR4A 2DN8A 3SDZA 5DAUA 2MJ8A 1UNSA 1XWEA 3LWUA 3FPPA 1S5BD 1BNZA 1EU3A 3LX0A 3OWEB 3S17B 1TY0A 4IFDH 2R3ZA 3MXNA 1RHPA 2VB2X 2FMCA 1I4XA 2L4NA 1DJRD 3Q0AA 1SSOA 2OT2A 1V8QA 2RDGA 5LHY1 1STHA 1H9RA 2KCNA 2NBFA 4NMZA 2YYZA 4NDXA 3I8ZA 4F87A 2ENBA 2EJFC 1JB3A 5COYA 2J4XA 1ESFA 1DOMA 1J9OA 5ELDA 3OSOA 2NVYB 2B39A 1PRTD 1EY6A 1S5ED 1K8OA 3SK8A 1SDFA 1PZJD 3PUZA 1EYDA 1RJTA 1YNJC 2A74C 5G3LD 2PZTA 4FNFA 1SNOA 5D65A 1PTOC 2AQ1B 5C5LA 3NWSA 5C0XI 1CZWA 5M5YB 1PTOH 1U4PA 1RF2D 1JOOA 3A56A 4BWGB 1ENCA 3AMUA 2EOTA 1NUCA 3SVMA 1FR3A 5KRUA 2R93B 2B2VA 2OF1A 3PV0A 2KQ3A 5LL6S 2D2CC 1II3A 1JC7A 5M3MB 1BCPF 4KY7A 1QWYA 4G57A 5D3DA 2IX0A 2NYZD 2DNCA 3VR3A 3GV3A 4IURA 2ZT9C 2IW3A 1C8CA 3GTGB 1LLRD 4B9WA 1CHPD 2N88A 1G6ZA 1NSNS 1O80A 3BDOA 3CRKC 1VMCA 4C1NI 1I6VC 1TU2B 3G7LA 5HGTA 4A3KB 4WJWA 2FHTA 3P1HA 3DUZA 2SOBA 4G7HC 4IFDJ 2K01A 4ZUIA 3VR2A 4G7ZC 3OMCA 3HGBA 1WVLA 3S1QB 1ET6A 1HUMA 2F0QA 3L7ZC 3NQTA 3O13A 5T1IA 4KN4C 3A7AB 1Z6HA 4MIUA 2CW0C 1H9KA 3CKIB 1U4RA 3KBXA 3Q23A 1SNPA 4L6TB 4GZYC 1CK1A 4CKCA 4HTHA 4FF1A 1IYVA 3QOLA 3KBGA 3K0YA 3D6CA 1AP0A 3HOXB 3NQIA 5IGGA 1DM0B 3KUPA 4F88A 1W6KA 1I6HB 2HDLA 4U68A 2JXMB 5E4XA 3VYUA 1SNMA 5ELBA 1EOTA 1KDAA 2IJ0A 5K5PA 1O7YA 1B53A 4ID6A 3HS0C 5IGFA 1MBYA 2Q8TA 2G9DA 1TS4A 2L9HA 4IUNA 2Z4IA 1XX8A 1IHZA 1BCPD 2B63B 2FMMA 2QKIC 3DHQA 1Q3LA 2J0TD 1B3AA 3GQBA 1ZXTA 1STGA 1J8IA 1EWCA 1MD2D 4V190 1I4GA 1LTBD 2KHSA 2QEJC 1GJXA 1KLUD 2J7ZA 3MEHA 3S14B 2X6GA 5M3FB 1G2TA 1KTKA 2JA5B 4QB4A 1AN8A 4TQUS 1SYBA 1RKNA 1BQQT 1PXUA 1QNUA 3VYTA 1GUOA 2O5JC 1H9SB 4KKTA 1EYAA 1H9JA 2AQ2B 2F0WA 1GUNA 5ISRA 1EYCA 3RZDB 4LJZC 3M7NA 1EL0A 4LK1C 1YNND 1PRTC 1EFID 4NP5A 1HTLD 1LTSD 4IUPA 4DN4M 4ZYSA 2QCPX 3TMEA 3H3VC 1JWUD 3S15B 1LT3D 4J1MA 1E2WA 3IAYA 5C4HA 2IT1A 3M7GA 2K5DA 2KECA 2K5QA 2ICIA 3U9OA 5T1GA 5FKAC 5M5WB 3DWPA 1WD1A 2JA7B 5IT9E 2E75C 3MC0B 2PW7A 1V1PA 2F0GA 3FKIB 5CV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCP C;  2XN9 C;  1LLR D;  4RGM A;  2SEB D;  1CHP D;  1JWS D;  1S5B D;  3R8B A;  1SXT A;  1EU3 A;  3GP7 A;  2CHB D;  3OWE B;  1TY0 A;  1SE4 A;  1EWC A;  1KLG D;  2IPK D;  1MD2 D;  1HXY D;  1SE3 A;  1JQY D;  2QIL A;  1I4G A;  1LTB D;  2QEJ C;  2XRQ D;  4RFB A;  1KLU D;  3MFG A;  1I4X A;  1B44 D;  1FGB D;  4K6L A;  3BZD B;  1DJR D;  5FK9 C;  1EU4 A;  1KTK A;  1V1O A;  3W2D A;  2RDG A;  3URY A;  3EFX D;  1AN8 A;  4O1N A;  4RGO S;  3BVZ A;  4RH6 A;  1EEI D;  1ENF A;  1XXG A;  2R61 A;  4RGN A;  1LTR D;  1STE A;  1LT5 D;  1AW7 A;  1SJH D;  5D3I B;  3BYT B;  1ET6 A;  1CQV A;  1D6E C;  1PRT B;  1T5X D;  1FNW A;  1RCV D;  1CT1 D;  3O13 A;  1LTT D;  1LT6 D;  4DXG A;  1DYQ A;  3BVG A;  1D5X C;  1SBB B;  1LT4 D;  3DWQ A;  2NTS A;  4OHJ A;  1PTO B;  1B1Z A;  1CHQ D;  2J4X A;  1TY2 A;  1ESF A;  1PRT F;  2AQ2 B;  1TS3 A;  1TS2 A;  5ELD A;  1HA5 A;  3R2T A;  1I4H A;  4L6T B;  3CHB D;  1I4R A;  1PRT D;  3BYY B;  4DXF A;  1CK1 A;  1PTO F;  4UDU C;  1I4P A;  1S5E D;  1L0X B;  1LTI D;  1RDP D;  4RHR A;  1SE2 A;  1BXT A;  1PZJ D;  3R2I A;  4TSS A;  1PRT C;  1PTO D;  1EFI D;  4L63 B;  1D5Z C;  1PZK D;  1F77 A;  1HTL D;  1LTS D;  4ZYS A;  1RD9 D;  1PZI D;  1XTC D;  2AQ3 B;  2RDH A;  1SJE D;  1PTO C;  1JWM D;  2AQ1 B;  4RCO A;  1JWU D;  2WV6 D;  4RHS A;  1LT3 D;  1SEB D;  1LTA D;  1FNV A;  1D5M C;  1PYW D;  3DWA A;  1TS5 A;  2Z8L A;  1PTO H;  3V05 A;  1HQR D;  1ET9 A;  1RF2 D;  1JCK B;  1LTG D;  4BWG B;  3TSS A;  5ELB A;  1BCP B;  1QIL A;  4RGT A;  1I4Q A;  2IJ0 A;  5TSS A;  1EEF D;  2NTT A;  4Z9C B;  1L0Y B;  1V1P B;  2ICI A;  2XNA C;  4C56 C;  1S5F D;  1M4V A;  2O2L D;  2G9H D;  5ELE A;  1S5D D;  2TSS A;  1G8Z D;  5ELF A;  5ELC A;  1FNU A;  3SEB A;  1BCP F;  1S5C D;  1TS4 A;  1LO5 D;  5FKA C;  3DWP A;  5D3D A;  1BCP D;  2XRS D;  1UUP A;  3MC0 B;  3EA6 A;  3KLS X;  1UNS A;  1V1P A;  3BVM A;  1GOZ A;  1JR0 D;  1FD7 D;  5I4D A; 
#chains in the Genus database with same CATH topology
 5C0X G;  1HUN A;  5I9O A;  1EQV A;  4DAV A;  4AYB B;  4JYA L;  1KDC A;  2PZW A;  2QGQ A;  1WTO A;  1GO3 E;  2R7F A;  4N9T A;  4BY1 B;  3S1M H;  5IT9 L;  3NK9 A;  2XRQ D;  1Y1V B;  4JBJ A;  1TKW B;  3H0G H;  1I3Q H;  5FJ8 G;  1VQF A;  1HZB A;  3HOY B;  4JC0 A;  5DNF A;  3HOZ H;  3RN5 A;  2ES2 A;  1K73 C;  5GRO A;  1EIG A;  2B2T C;  4EX5 A;  4DK3 C;  4A3K G;  2N49 A;  2CCZ A;  2Y0S B;  4KHZ A;  5D3I B;  2NN6 I;  4ABN A;  3W3A A;  4JBM A;  4OWT B;  4CHT B;  1L2F A;  3E9H A;  2NVT H;  1ILP A;  5JEA G;  4DAM A;  1IYU A;  3E0J A;  2VY3 A;  4C3J H;  4P2C B;  2HQE A;  1JE5 A;  2V1C C;  2RQX A;  2CKZ B;  3QB3 A;  3PIO A;  4IFD I;  4DV7 L;  1S72 A;  1OXV A;  1O7L A;  4YHH Q;  4RAU C;  1X3P A;  1B3Q A;  2DGY A;  1IBL Q;  3K57 A;  4QMG A;  1TWA H;  2F3I A;  4PZ7 A;  2UXB L;  1LTA D;  2E74 C;  1UEB A;  3C46 A;  4DAY B;  2V4D A;  4CJ2 C;  1KIX A;  3BZC A;  1ET9 A;  2L0C A;  5IY0 A;  3HOX G;  3K7A B;  2F0I A;  2XWJ B;  1GUW A;  1GUG A;  4QJF A;  5EQ0 A;  1VQK A;  1EEF D;  4B3S Q;  1MHW C;  3KLW A;  4Q0F A;  4GLV B;  4LF8 L;  4PNY A;  2KHI A;  3EN2 A;  4JI6 Q;  3SK6 A;  3WOE A;  3E6Z X;  5M5X B;  4PQX A;  4JI7 Q;  2WIN B;  3F2U A;  2UUB Q;  3KF8 B;  5I2X A;  1HZ9 A;  1VDZ A;  4OEL B;  1GXD C;  4GLA C;  1BCP C;  5C5M A;  2F0U A;  1VCI A;  1PDQ A;  4EQ5 A;  1I94 Q;  2JEB I;  4EVO A;  2E2J B;  3J81 L;  1KLG D;  3T1Y L;  2B63 G;  2MPM A;  3OWF A;  2EPB A;  5J3B A;  4XT1 B;  3EBE A;  1Y8O B;  3M4O H;  4LFC L;  2H1E A;  4ZKB B;  3N6R A;  4K14 A;  2N8N A;  2EXZ A;  2L11 A;  3D6W A;  5IYC H;  3A5U A;  1E2Z A;  4RGN A;  4RKL A;  4YY3 L;  1D8L A;  4BXX H;  3CCR A;  3NSW A;  5M3F G;  4G4K A;  1T5X D;  3QO2 A;  3NTH A;  2JA5 G;  4JI1 Q;  4OL7 A;  4OO1 H;  1D2B A;  3BVG A;  3X3M A;  3W5O A;  4H13 C;  1LT4 D;  2LMC B;  1B50 A;  3A8K E;  4GOP A;  1A63 A;  1PTO B;  3DEP A;  3SK4 A;  2VW9 A;  1BBX C;  3CD6 A;  4KHP L;  1E2V A;  2D9U A;  2K05 A;  4R4O A;  2B2Y A;  2A68 C;  5EKL A;  3NWT A;  1WCM H;  4DV4 Q;  3CHB D;  5AFW A;  4DUY L;  1LTI D;  1NR4 A;  1QB5 D;  5CMD A;  3SHL A;  4A3L G;  4OX9 Q;  2XWB B;  2VNU D;  2B8F A;  2F0D A;  4JI4 Q;  1YNN C;  2XIW A;  4GKK Q;  2WV6 D;  3HG9 A;  4H0L C;  5JJK A;  1R4P B;  1FYC A;  3PO2 B;  3K80 C;  3S2H B;  3TBI B;  1EIY B;  5KEE A;  4K0K L;  1A62 A;  2CQO A;  2OTJ A;  1MJE A;  3ND8 A;  2XNA C;  1V1Q A;  2KBN A;  3L3O C;  2NZH A;  4R9W A;  1B70 B;  4PG3 A;  4DR6 L;  3NXW A;  2VQE Q;  4BBR H;  2JA9 A;  5FLM G;  4A3M B;  1VQB A;  4K2L A;  1SRU A;  4BA1 I;  1U4L A;  2PMZ E;  4DGZ A;  1JOK A;  4LFA Q;  4DU9 A;  4ZLT F;  1YI2 A;  1D1I A;  1GOZ A;  1HCZ A;  2DNE A;  4IPD A;  2A6H D;  5C4J H;  2E2I H;  3KLR A;  4IZ8 A;  3MFY A;  4YCV A;  3M4P A;  1SXT A;  1CQF A;  5JJZ A;  1KRS A;  2GVB A;  2KOL A;  3GP7 A;  3SXH A;  2JA7 G;  4JOI C;  3H91 A;  1SYC A;  2XVS A;  4DNT B;  1YBY A;  3TP6 A;  1R9T B;  2JP1 A;  4DR5 L;  4KJN A;  1NE3 A;  3FKI G;  3KF6 B;  1G2S A;  3ONA B;  2QEX A;  3UDI A;  2K7V A;  4IUT A;  1TWH H;  1DD2 A;  4AYB G;  3I4M H;  2K52 A;  1HRJ A;  3MEF A;  2IHE A;  2YV5 A;  2EDG A;  2RKS A;  2PNR C;  2B2U A;  4BY1 G;  3G71 A;  1CKN B;  4LF7 L;  1ML0 D;  1Y1V G;  3F2B A;  2I46 A;  1OXX K;  2UUA Q;  2VUM H;  1AW7 A;  3HOY G;  4K5X A;  3MVV A;  4UP8 A;  1Q12 A;  4X62 L;  2F3W A;  1NAP A;  1X3Q A;  2NVQ H;  1D5X C;  1J5E Q;  2B29 A;  4R8N A;  3CCE A;  2ID0 A;  1K0S A;  2Y0S G;  3VA7 A;  5C3E B;  2K1B A;  3MXG A;  1L0W A;  1HZC A;  2RSN A;  5CBE E;  3HOU B;  2DUD A;  1Q86 C;  1D7Q A;  4XQJ A;  3AB9 A;  4N9P A;  4C3I H;  4DV5 Q;  1RDP D;  1A15 A;  1BXT A;  3HOV H;  5IGD A;  3D4R A;  1L1O C;  5GAE C;  1ONL A;  4DAY A;  2K28 A;  5C4X H;  1SYF A;  3OW7 A;  4DV3 L;  2JA6 B;  1WYD A;  4YCW A;  3FRP B;  3T1H Q;  1PYW D;  1A2U A;  5DM6 3;  2OXP A;  4BY7 H;  1E7Z A;  4B3T L;  2ZTC A;  3S2D B;  1JCK B;  1ZEQ X;  2B2W A;  4R4I A;  4HED A;  3GTQ B;  4LUZ A;  4HR7 B;  1CI3 M;  5AJ3 L;  1BDO A;  1Y8P B;  1L0Y B;  5KND A;  5JAV A;  4S3S A;  1BUV T;  3PO3 B;  1IBK L;  4OIJ A;  1SR3 A;  2F0T A;  1G8Z D;  5ELC A;  2BDO A;  2B2V C;  3I4N B;  4IFD G;  1VQM A;  2MHV A;  3I2Z A;  2PO4 A;  4KKS A;  4HIK A;  2K03 A;  3AFP A;  4X3S A;  1YIT A;  1Y1W B;  2NVX H;  3G4S A;  4HIM A;  4A3J H;  2F03 A;  3Q22 A;  4A93 B;  1C7Y A;  2KUM A;  3UE0 A;  1LV9 A;  2E2H B;  1X54 A;  1KNA A;  4CJ1 B;  1VQL A;  1GHJ A;  4NXN L;  1SFO B;  3R8B A;  2F0F A;  1VF7 A;  2VL6 A;  5IP7 G;  1SE4 A;  4JG2 A;  5JJI A;  1QZH A;  2I07 B;  3H6M A;  4KTA A;  1NNX A;  4O2D A;  1NTG A;  3BZD B;  4FF4 A;  1DOL A;  1EZ6 A;  3H3V I;  4O1N A;  1W2B A;  1A3V A;  3VYR A;  1Q1E A;  1XXG A;  3P75 A;  4HIO A;  4HCE A;  3GTM H;  1CQV A;  3LWE A;  1PRT B;  1MSG A;  1RCV D;  2JN4 A;  1FGU A;  1STN A;  3WOF A;  4L8J A;  1WD0 A;  1SBB B;  3I3C A;  1FVI A;  2NTS A;  4OHJ A;  4A3D H;  1BVS A;  2Z1C A;  3OYY A;  2H4O A;  2I5L X;  3J81 c;  1WTV A;  4QUC A;  3PIO 3;  3BZK A;  3WWV A;  2ZJQ A;  1D1K A;  4I7Z C;  5CR3 A;  5IE8 A;  3ND9 A;  1KDB A;  3S1N B;  1I4R A;  4X64 Q;  2C9O A;  4DR4 Q;  4L5T A;  1VQ8 A;  1W3S A;  4A3F H;  2NB0 A;  2EYH A;  2PI2 A;  4E6I A;  3IKJ A;  1B4O A;  1PZK D;  2QDB A;  4LF4 Q;  3E5S A;  3R3O A;  1XNQ Q;  2BDN A;  3UDX A;  1JWM D;  2CWA A;  4UPA A;  1EWI A;  2A69 D;  3NPP A;  4B08 A;  2AWO A;  3T53 B;  4DR1 L;  1TS5 A;  1HNZ Q;  1FJG L;  3I90 A;  5DM7 3;  2YTY A;  3ERO A;  4LF9 L;  4XDX A;  1BR9 A;  3JAM E;  3S1M B;  1I3Q B;  4IAL A;  3PO2 G;  2JQO A;  2ZXR A;  3AYH B;  5C44 H;  1TR5 A;  3EJI A;  3HOZ B;  4A3G H;  1QNK A;  1SNQ A;  3TN2 A;  2LKV A;  4ILW A;  4LNQ A;  3GTJ H;  2UUC Q;  2K33 A;  1B9N A;  1IYJ B;  2KEN A;  2LSS A;  3GTP B;  3JAM L;  1Y8N B;  3GDE A;  4PV1 C;  1F9S A;  3J7A V;  1CKM A;  3KLS X;  2EYL A;  2FJ2 A;  2VZA A;  5EKK A;  5ELN A;  4FVM A;  4OGQ C;  3L9A X;  2KEE A;  1DOK A;  4A3M G;  3D3R A;  4K5W A;  3K5N A;  3TQY A;  5IYB H;  1CUK A;  2A6H C;  4DV2 L;  5IOD A;  3J7Y W;  4JV5 Q;  4C3J B;  1JIC A;  2JEA I;  3A8J E;  3S17 H;  3MFG A;  1AFP A;  1FGB D;  1CKN A;  3I70 A;  5M9O A;  3HOW H;  4A3B B;  3VYS A;  3KFU A;  1GUT A;  3ERS X;  2UU9 Q;  3BVZ A;  2RBM A;  3VDY A;  4EQP A;  1STE A;  4LUV A;  3I72 A;  4JBK A;  4TVA B;  2ZJP A;  1WFQ A;  1XMO L;  4ME5 A;  1VQA A;  2VQF Q;  2E5L L;  3D0F A;  5E4W C;  1YHB A;  5BN5 A;  1T5E A;  1SLJ A;  4GN4 B;  2F4V Q;  2N55 A;  3F1Z A;  2H5X A;  5IOC A;  4KHV A;  5DLQ E;  1X65 A;  2I0Q A;  4HAE A;  4P71 A;  4IPC A;  5JPM C;  2MP1 A;  4DXF A;  1I4P A;  1IKM A;  3U58 A;  4TSS A;  4HJ8 A;  5C3E G;  1QE6 A;  4O42 A;  3VA5 A;  2TMP A;  2ZJR A;  1PV4 A;  3HOU G;  4X66 L;  1GUS A;  3QIA A;  2A68 D;  4NXM Q;  3IRB A;  3MAQ A;  5CYU A;  1YEZ A;  5KNB A;  4LMQ D;  1N33 L;  3A55 A;  3A0J A;  3QWN A;  4FXD A;  1V9P A;  3KLS A;  3HKZ E;  1N8R C;  1BCP B;  3KJP A;  4A3E B;  1WTX A;  2JA6 G;  3CMA A;  4DR2 Q;  4OO1 I;  1VQ7 A;  5FOB B;  2G9H D;  3F8T A;  5ELE A;  2UXC L;  1I5F A;  4KJO A;  1SYG A;  4ZAI A;  2R93 H;  1PH2 A;  5EPK A;  1JT8 A;  2P5Z X;  2LXJ A;  5M3M H;  2EY6 A;  4C3H H;  5K36 H;  3PO3 G;  2F0E A;  3S9W A;  3FVQ A;  3IFT A;  1QVG A;  2ASB A;  3GTL B;  2D62 A;  2F1M A;  3QR8 A;  2JSO A;  4RHS A;  3I91 A;  3KYH C;  3I4N G;  2ZTE A;  4GKJ Q;  1IBM Q;  3AEV A;  3GTG H;  1LM0 A;  1Y1W G;  4FXK C;  5I2Y A;  5LMN L;  1R4Q B;  4A76 A;  4A93 G;  2EYF A;  1AZQ A;  1WCM B;  1X9N A;  4ODG A;  3HFZ B;  3EFX D;  4KI0 A;  1VQH A;  1PH1 A;  1ZYR D;  1CSP A;  4IOA A;  4MHE A;  3A54 A;  1K0R A;  1VF5 C;  4KY6 A;  4DNR B;  1UAP A;  4K8J A;  2PQA B;  1HFN A;  2M9V A;  1LT6 D;  2BOS A;  3M4Y A;  3BG3 A;  4B3M L;  1TWG H;  2F52 A;  2NZ1 D;  5FLX E;  3CME A;  4B3R Q;  1MKH A;  3DM3 A;  1TY2 A;  3NEL A;  4K5V A;  1HA5 A;  1K8M A;  1V43 A;  1XJV A;  4LF8 Q;  4EQN A;  4CBV A;  4FF2 A;  2X6L A;  3J80 E;  1SN8 A;  4JI8 L;  2K5V A;  2Q8R E;  2D5D A;  2I5H A;  2NZO A;  1F77 A;  1T9H A;  1HA6 A;  1TQO A;  2QW7 A;  3G6E A;  1ESR A;  1QJO A;  2OTL A;  4G7O C;  5IIF A;  1EY0 A;  1XPO A;  5IYD G;  1DON A;  1N34 Q;  1X56 A;  2Z6K A;  1Q8K A;  3J80 L;  4JBW A;  4ZUJ A;  4LF5 L;  2Z8L A;  1N36 L;  4R4C A;  2A69 C;  3CPF A;  2K5W A;  3I4L A;  4GS3 A;  4LWC A;  1QIL A;  4IOC A;  4JW0 A;  2GN5 A;  5E3F A;  1OO9 B;  1JJC B;  2A5H A;  4DA2 A;  4B9X A;  1M4V A;  4FP5 D;  3RLF A;  3NE5 B;  4J8Q A;  4UAI A;  3VR6 A;  5ELF A;  1TWH B;  2Q2H A;  2EYO A;  4LUO A;  3FMC A;  4JI2 Q;  3QG1 A;  3CC7 A;  1DZ1 A;  1WTH A;  3W1B A;  3ER0 A;  1HNX L;  3H0G G;  4KK7 A;  4ME3 A;  2EYP A;  2VUM B;  1PMR A;  1EQT A;  1VQC A;  2B8G A;  1YJW A;  4UHV A;  4WRD A;  2F4I A;  3HOZ G;  1XNR Q;  5CV7 A;  3V96 A;  3Q8D A;  2B63 H;  2VS1 A;  3RNU A;  2R7Z H;  1H9M A;  3OTO Q;  2NVQ B;  2G5D A;  1JQY D;  2QIL A;  3PUX A;  4RFB A;  2D0P A;  2WP8 J;  4CDD C;  5GQO A;  3GD7 A;  5L37 A;  4BS9 A;  2E76 C;  1EU4 A;  2LXK A;  1VQO A;  1PLF A;  4CJ0 B;  4C3I B;  4JVZ A;  4HMJ A;  4DV0 Q;  4C3J G;  3MXU A;  3TDQ A;  3S1R B;  1ENF A;  3M3Y H;  5CV4 A;  4KMU C;  3UE1 A;  1LT5 D;  4A3B G;  1Z7T A;  4YWL A;  3BYT B;  1PVO A;  2XSC A;  5C4X B;  2K14 A;  3CCQ A;  3S16 B;  2B3G A;  5IP9 G;  1B8A A;  2E2D C;  1TS2 A;  4GOP C;  1BKB A;  1Z47 A;  3EQL C;  4HSP A;  1TWF H;  3HZX A;  3BYY B;  2M2L A;  2B2Y C;  1H9S A;  3RZD H;  1SE2 A;  2HT1 A;  4GNX C;  3R2I A;  4FDB A;  4L63 B;  1MSH A;  3NEN A;  4XXE A;  3MTS A;  3ZYY X;  2BH2 A;  1STY A;  4R1J A;  2ZM6 Q;  3C1E A;  4ZRZ A;  1UE5 A;  4YHH L;  1E24 A;  3S15 H;  1IBL L;  4DK6 C;  2Q2I A;  1HQR D;  1OXS C;  1PH3 A;  2IY5 B;  2WKC A;  4LAA A;  4APV A;  3M85 A;  3K8A A;  2CH4 A;  1N32 Q;  4O0A A;  5TSS A;  1X55 A;  1C4Q A;  4IUU A;  1A6X A;  3RUZ A;  2O2L D;  3J7A 5;  1GVP A;  5EAY A;  4X65 Q;  3J81 j;  2QDL A;  2PYK A;  5A35 A;  4B3S L;  1LO5 D;  4A3E G;  3I73 A;  5EBC A;  4DV6 Q;  5M5W H;  3TZD A;  5CV8 A;  1PFB A;  1JJ2 A;  1RTO A;  3P7J A;  4JI6 L;  2EVB A;  5I4D A;  5J22 A;  1EY9 A;  1ENA A;  4JI7 L;  2A19 A;  1HNW Q;  3FKI H;  4DUZ Q;  2UUB L;  1YHQ A;  1NMF A;  3GTO B;  3I56 A;  3SE0 A;  2MO1 A;  2R7D A;  4BXX G;  3OMG A;  2L1B A;  2EYJ A;  1B7Y B;  2EQS A;  2DY7 A;  3ULP A;  2HHH Q;  2R92 B;  3OIQ A;  1Y1V H;  3JC6 6;  2KJX A;  1I94 L;  4OO1 G;  1XMQ Q;  1IKL A;  3MHB A;  5KYI A;  2OCE A;  4HJ7 A;  4KKU A;  4EQO A;  4MZ9 A;  3W2D A;  3HOY H;  3URY A;  3NHH A;  4LFB Q;  4V0B A;  2JA8 H;  2PMZ B;  4A3F B;  4I65 A;  2MO0 A;  2B2U C;  1WCM G;  4QL5 A;  2HIX A;  1ZYR C;  1D6E C;  2FFK B;  4QIW E;  2F0H A;  5IWA Q;  1VMP A;  4FXG C;  1OXT A;  4A4I A;  2RVL A;  4JI0 L;  2RCF A;  4P74 A;  1SAP A;  4HJ9 A;  4DR7 Q;  1DCZ A;  1K83 B;  2WB1 E;  4JI1 L;  4BBS H;  1FL0 A;  3S24 A;  3NTI A;  1C0A A;  4N8X 1;  4PMW A;  2MQH A;  4XIG S;  4U67 3;  2WAQ E;  4RHR A;  5NUC A;  3T16 A;  2HDM A;  2SNS A;  1A3T A;  3UI2 A;  4DV4 L;  2DJF C;  1WTP A;  1VQ9 A;  2KCC A;  1ICW A;  2HCI A;  3Q6S A;  2HIV A;  4DR3 Q;  1SMY D;  4FO2 A;  4JCV E;  4XT3 B;  1F9Q A;  1BO0 A;  4WOR A;  3OOC A;  1O7Z A;  5IT9 c;  4WJ4 A;  4IQZ A;  2CH4 W;  4OX9 L;  3K5L A;  4CKE A;  3PGZ A;  4JI4 L;  4X3K A;  1LAB A;  4F8M A;  5JOB A;  4GKK L;  3PSI A;  3RZO B;  4RG1 A;  1F9R A;  3RLO A;  3T56 B;  4RGT A;  1Y14 B;  4K8I A;  2B2W C;  3QOJ A;  4ZK9 B;  3CCU A;  1TXY A;  3MZ5 A;  3HOW B;  3U50 C;  1FNU A;  3SEB A;  3DXJ C;  5EJW A;  1P16 A;  2NN6 G;  1W6J A;  3F2D A;  3AU7 A;  4WJ3 M;  1OXU A;  2VQE L;  1E1O A;  1BBU A;  1JR0 D;  2F3V A;  5C6A A;  3JAM i;  3DLL A;  3GTK H;  3GV6 A;  2EY2 A;  3LNN A;  1DXM A;  2F0P A;  3PQI A;  3KDF B;  4P73 A;  3K7U C;  3BDL A;  4LFA L;  2L5T A;  1SE3 A;  1MJC A;  1WI5 A;  4UY8 C;  2VUM G;  5EBD A;  3WDN A;  3U4Z A;  1PA6 A;  2E2J H;  1GKH A;  3KF8 A;  1B44 D;  1EIF A;  1P8L A;  4K6L A;  1Y69 U;  1F2L A;  2XGT A;  3Q24 A;  4JI3 Q;  4A3I H;  1U4M A;  3PUV A;  1EEI D;  3TEH B;  4XQQ A;  1J6Q A;  1XYI A;  5EPJ A;  1F2Y A;  2R61 A;  1QUQ B;  4NB3 A;  5LMU Q;  3DM1 A;  1KQS A;  3K58 A;  1CT1 D;  1A3U A;  4C3I G;  5EKI A;  4C1N K;  1WTW A;  2AMC B;  1X3G A;  2SDF A;  3MWY W;  3SGI A;  4JI5 Q;  2UUA L;  4KD3 A;  5J39 A;  5E7N A;  2FIN B;  4QQB X;  4DV1 Q;  5A2Q E;  3STB D;  3TS0 A;  1AH9 A;  1MGS A;  1TS3 A;  1STA A;  1CSQ A;  5C4X G;  1J5E L;  3CCM A;  1HR0 Q;  4RA8 A;  4IO9 A;  4DAP A;  4XTC S;  2YU9 B;  1PFN A;  4C2M B;  3G6J B;  3NEM A;  1EUJ A;  1HFG A;  5A2Q L;  1D5Z C;  4ULL A;  1DGS A;  3OIP A;  3CQZ H;  1RD9 D;  3T4A C;  4Y7N H;  2AQ3 B;  4C3H B;  1SJE D;  4DV5 L;  1E0B A;  2LY7 A;  2ZXO A;  3W1G A;  1SEB D;  3H94 A;  4OIK A;  1PYS B;  3K5M A;  3K59 A;  4HMI A;  2GA4 B;  2IX1 A;  3IL8 A;  2F0V A;  4OWW B;  4H7B A;  3IFD A;  3NP8 A;  2HUG A;  1WTQ A;  1ZKO A;  1WJJ A;  3T1H L;  4AQY Q;  2NTT A;  3M9B A;  1V1P B;  2BCO A;  4J15 A;  4C56 C;  5D14 A;  4YIJ A;  1TVX A;  1S5D D;  2TSS A;  1U0L A;  3T13 A;  3CC2 A;  4K2K A;  1MI2 A;  2LFN A;  1I50 H;  1BF4 A;  1EFW A;  1S5C D;  2F0L A;  3PF4 A;  1JOR A;  4M1U B;  3SR1 A;  2RA4 A;  1CA6 A;  2OQK A;  2UXD L;  2PQE A;  1X6O A;  3ULL A;  4R4T A;  1NJI C;  3L0O A;  4A3M H;  1EY7 A;  4QCL A;  2A8V A;  2Q2T A;  4M8A A;  4X6A H;  2I5M X;  5EPL A;  1M90 C;  4QY7 A;  3OHX C;  1A0I A;  1TWG B;  2PW5 A;  3OW2 A;  3H0G B;  3V2T A;  2O5I C;  1CKO A;  1HXY D;  1STB A;  2F0J A;  4A75 A;  1TWC H;  3HEJ A;  2EJM A;  1R9T H;  4YWK A;  1GM5 A;  2EXD A;  4NW2 A;  1U9R A;  2KA7 A;  1V1O A;  2AWN A;  3KK7 A;  2R92 G;  1KAB A;  2NVT B;  4P72 A;  3FHW A;  3KF6 A;  3CXC A;  1F2M A;  1LTT D;  5IGC A;  3PIP A;  3K0X A;  4KLK A;  4OXP A;  4KY5 A;  4A3F G;  1G6P A;  1NCV A;  1CTM A;  1YVC A;  1IL8 A;  4AH6 A;  2Z0S A;  1GD7 A;  1KAA A;  2BE5 C;  5C3W A;  1G29 1;  3R2T A;  1I4H A;  3BJU A;  4K6D A;  1AZP A;  3U9S A;  3CC4 A;  4UDU C;  1XTD A;  1NY4 A;  1O78 A;  4HJ5 A;  3HOU H;  4GN5 A;  2QF7 A;  1F2Z A;  4OON A;  2ATW A;  1TWA B;  4X64 L;  1SYE A;  2RDH A;  1XTC D;  1EQR A;  2L15 A;  3CU7 A;  2VB3 X;  1VQ4 A;  3KJO A;  4DR4 L;  4DF7 A;  2RF4 A;  4F7X A;  4YCU A;  4I7A A;  4TRD A;  1X3F A;  2JA6 H;  3PUY A;  4LF4 L;  1SMY C;  3UDF A;  1HH2 P;  1XNQ L;  2R7Z B;  3BDC A;  1LTG D;  2BA0 A;  4RKB A;  3J80 i;  3TSS A;  3VR5 A;  4XYO A;  4H44 C;  2NVY H;  4IUQ A;  4HSV A;  4FF3 A;  4A3C H;  1HNZ L;  4TKO B;  1YHA A;  5F2D A;  2O4X A;  3C1F A;  1GHK A;  1EZ8 A;  3C3L A;  3PO3 H;  2MUY A;  4LF6 Q;  2CFM A;  2HCC A;  5IYB G;  4R8I A;  2EZV A;  2N3S A;  3HKS A;  5C3X A;  4JYA Q;  2XRS D;  3M3Y B;  1UUP A;  2WAC A;  3KDF A;  3HOW G;  3M4Q A;  2DJG C;  3BVM A;  5M5Y H;  5H1S E;  2RCN A;  3NTK A;  1O7I A;  2XN9 C;  4A93 H;  2SEB D;  1JWS D;  2UUC L;  4L5Q A;  3HKZ B;  2X69 A;  5JVG 3;  3E3X A;  5I6Y A;  1QOH A;  2IPK D;  1X32 A;  4ZCK A;  3ZJY C;  3M4O B;  1F9P A;  1B9M A;  5FO8 B;  1WTR A;  3D31 A;  5HY6 A;  2IX3 A;  1AE3 A;  4POF A;  1TWF B;  5C0X H;  4JV5 L;  4RH6 A;  5KIX A;  3UDG A;  1LTR D;  2K04 A;  2RHS B;  5C4Z A;  2WII B;  3EVQ A;  4GNX B;  1VQJ A;  3J7A F;  3CRL C;  5FJ8 H;  1S4Z A;  2UU9 L;  4AIM A;  3FPU B;  1CA5 A;  4H02 A;  2A1A A;  3DWQ A;  1S3O A;  2C5C A;  5JPN C;  1NR2 A;  1IW7 D;  2Z4H A;  1Q1B A;  1K3B C;  1JMC A;  3G48 A;  2LS0 1;  4DV7 Q;  4A3K H;  2VQF L;  1HQM C;  1LAC A;  3STB C;  2A6E D;  1PTO F;  2F4V L;  3D4W A;  1L0X B;  1EY5 A;  3A7L A;  2F0M A;  5CC4 A;  5JEA H;  5IYD H;  1PH7 A;  2UXB Q;  5BN3 A;  2NWG A;  1U5K A;  1KC8 C;  1WOC A;  3NBH B;  4IJL A;  3FDT A;  3S1Q H;  2AKW B;  2F0O A;  2ICE C;  3R93 A;  2EJG C;  3A5Z B;  4UP7 A;  3ERQ A;  2EE1 A;  2IHF A;  2DY8 A;  1TT2 A;  1D5M C;  3DWA A;  2PCF B;  3AFQ A;  5J1Z A;  4X3U A;  1HTP A;  3CF5 A;  2CWP A;  2BH8 A;  1EYG A;  2Z6K C;  3H09 A;  4C3H G;  4AYB E;  4NXM L;  5HUR A;  2CVR A;  4HID A;  5K36 G;  5FO7 B;  1VQI A;  4R4Q A;  5FLX L;  4HN7 A;  4IN3 A;  2RHQ B;  1JOQ A;  3D8G A;  1JB7 A;  4BBR B;  3I55 A;  1ASZ A;  2R6G A;  3E0E A;  2JA8 B;  4POG A;  3HOX H;  4DR2 L;  2KHJ A;  3OPO A;  1JJG A;  3FP9 A;  4KN7 C;  5C4J B;  1I6H H;  2NUC A;  2E2I B;  1C9O A;  2EY5 A;  2K6A A;  3GTP H;  2Y0S E;  3T1Y Q;  1PYB A;  2PPB C;  3SK5 A;  1H95 A;  4RGM A;  4UP9 A;  3CCS A;  3MXP A;  4LFC Q;  2CHB D;  3A8I E;  5ELO A;  2JE6 I;  3C2P A;  1IZ6 A;  2RSO A;  3I4M B;  4GKJ L;  4KD4 A;  4BBS B;  1IBM L;  5FK9 C;  2GVA A;  4YY3 Q;  3MXN B;  2B2T A;  4DK1 A;  1MIU A;  1SND A;  4XYQ A;  2SNM A;  4A3B H;  5IGB A;  4RGO S;  4IUV A;  3RMH A;  3RD4 A;  3E9I A;  1KNE A;  3CPW A;  4OWX B;  4Y52 H;  1VQ5 A;  3ITP A;  2JJQ A;  4KHP Q;  2F0S A;  4HCS A;  4DXG A;  5CV9 A;  5IP9 H;  1X3E A;  2KVM A;  5C0X J;  2OEO A;  3HRZ C;  5BR8 L;  1VS0 A;  1A8V A;  1B1Z A;  1CZG A;  4DUY Q;  3HP3 A;  3TP5 A;  3P20 A;  2PNH A;  3TP8 A;  2F0K A;  5KYL A;  3BS1 A;  1AE2 A;  5M3F H;  3S14 H;  3B6Y A;  3HOV B;  5JJL A;  4B3R L;  2JA5 H;  1YNJ D;  3QJY A;  3JAM c;  3KOJ A;  5LL6 X;  1PHJ A;  2FXQ A;  1EY4 A;  5I6W A;  1TII D;  5DEH A;  1PTO D;  2M00 A;  3T51 B;  3TP7 A;  1L1O B;  1B2T A;  4RCO A;  4BA2 I;  4PMB A;  4Q5V A;  4BY7 B;  4K0K Q;  4ZKC B;  3GO5 A;  3J81 E;  3N52 A;  4FYD A;  1FNV A;  1BOS A;  3V05 A;  3NBI A;  5JEA J;  3GTK B;  5E1F A;  4A3L H;  1JE4 A;  4RCN A;  1N34 L;  4X3T A;  4DR6 Q;  1VQE A;  2K5N A;  4Z9C B;  4XQN A;  1HPC A;  1VQD A;  2Q2U A;  3K6O A;  4A3E H;  1HR0 W;  1QG7 A;  1VQN A;  3TS2 A;  2R7Z G;  5KGU A;  5I9P A;  2NVX B;  3DEO A;  1M1K C;  1SMX A;  3D4D A;  4A3J B;  4A3I B;  1CM9 A;  3K5O A;  3MA2 B;  1A2T A;  2JYO A;  1S40 A;  1C48 A;  3PMF A;  1EIH A;  1QVC A;  3EA6 A;  3F2C A;  2L12 A;  1OTC A;  2RDF A;  1FD7 D;  3GTL H;  4JI2 L;  2Q8I B;  4DR5 Q;  4RWS C;  4JI0 Q;  2ZXP A;  3PCO B;  5FLM H;  1M8A A;  4DK0 A;  1YJ9 A;  4DFA A;  3RN2 A;  1XNR L;  4LF7 Q;  3DMU A;  2AUJ D;  3X3N A;  4EGV A;  3OTO L;  1RTN A;  1SYD A;  2K32 A;  1KAW A;  3HKZ G;  4MNO A;  5FO9 B;  3PIP 3;  3RLN A;  4GNX A;  5COR A;  1ILQ A;  4X62 Q;  4MTK A;  2JA7 H;  4PMC A;  3GTM B;  3TRZ A;  3CQZ B;  4Y7N B;  1BBW A;  1E22 A;  1SJH D;  1PH6 A;  2CW0 D;  3LGJ A;  1FNW A;  5IYC G;  4DV0 L;  4A3D B;  2IWH A;  1DYQ A;  2PI2 E;  3CCL A;  2EY1 A;  4CKB A;  3BU2 A;  4BY1 H;  1CHQ D;  5CGK A;  2MGS A;  1UEA B;  1PRT F;  3ULJ A;  2VXW A;  3FEW X;  1EQQ A;  1Q90 A;  3TZU A;  1IW7 C;  3NUC A;  1SNC A;  4P75 A;  5EGT A;  2PQA A;  4CGY B;  3NBH A;  1K8G A;  5IGE A;  2OQ0 A;  5G3L F;  1EY8 A;  1HHV A;  4DV3 Q;  4WFN 3;  3PUW A;  1I50 B;  2A6E C;  4CDC C;  2AUK A;  1PFM A;  4NKL A;  1PZI D;  4B3T Q;  2A73 B;  2Z6B A;  1UE1 A;  4QIW B;  2BA1 A;  2BE5 D;  1Q8I A;  4QUF A;  2IL8 A;  4KV6 A;  5AJ3 Q;  1EWH A;  1VQG A;  1G91 A;  4MN3 A;  1AEX A;  2CQA A;  2KED A;  4ZQ3 A;  1PH5 A;  5CV6 A;  2ZM6 L;  4J6H A;  1IBK Q;  5JVH 3;  1CFM A;  1YJN A;  4QF4 A;  2WB1 B;  1ROD A;  3L2P A;  1YIJ A;  1I4Q A;  2F0N A;  1QCB D;  2WKD A;  5BN4 A;  5CBA E;  1TWC B;  2EYM A;  2WAQ B;  1S5F D;  5C44 B;  4A3G B;  2NN6 H;  2ZTD A;  4JK1 C;  2YTV A;  2PZU A;  3GTJ B;  2L55 A;  1N32 L;  1E1T A;  5KNC A;  4NXN Q;  3VR4 A;  2DN8 A;  3SDZ A;  4X65 L;  5DAU A;  2MJ8 A;  1UNS A;  2ALY B;  4BBR G;  1XWE A;  4GLX A;  3LWU A;  4JOI A;  3CP0 A;  3FPP A;  1S5B D;  2JA8 G;  4DV6 L;  1BNZ A;  3K7A H;  1EU3 A;  3LX0 A;  5LMN W;  3OWE B;  3S17 B;  1TY0 A;  4CDE C;  4IFD H;  2R3Z A;  3MXN A;  1RHP A;  3J7Z C;  2VB2 X;  3TRE A;  2FMC A;  5FLX c;  1I4X A;  2L4N A;  1HNW L;  4DUZ L;  4YWM A;  1DJR D;  3Q0A A;  1SSO A;  2OT2 A;  1V8Q A;  2RDG A;  1PH9 A;  5LHY 1;  5M5X H;  1STH A;  1H9R A;  2K75 A;  2KCN A;  4CDF C;  3J80 c;  2HHH L;  1K8A C;  2NBF A;  5IP7 H;  4NMZ A;  3ICE A;  3I4M G;  2YYZ A;  4BBS G;  1XMQ L;  4NDX A;  3S1R H;  2K5H A;  3I8Z A;  4LFB L;  4IJH A;  4F87 A;  4L5S A;  2ENB A;  2EJF C;  1JB3 A;  5COY A;  2J4X A;  1ESF A;  1DOM A;  2D0O A;  3S16 H;  1J9O A;  5ELD A;  3OSO A;  2NVY B;  5IWA L;  1RIP A;  2B39 A;  1PRT D;  2E8G A;  2MNA A;  1L1O A;  1EY6 A;  1S5E D;  1K8O A;  4DR7 L;  3SK8 A;  1SDF A;  1K3R A;  5GAG C;  1PZJ D;  3I4O A;  2UXD Q;  3PUZ A;  1EYD A;  4DR1 Q;  1RJT A;  1YNJ C;  2A74 C;  1FJG Q;  5G3L D;  2PZT A;  4FNF A;  4LW1 A;  1SNO A;  5D65 A;  1PTO C;  2AQ1 B;  1N9W A;  3HOV G;  4LF9 Q;  5C5L A;  1LYL A;  1UWV A;  3NWS A;  5C0X I;  5HGQ A;  1CZW A;  5M5Y B;  1VQP A;  1PTO H;  1U4P A;  1RF2 D;  1JOO A;  3A56 A;  4MTN A;  4BWG B;  4DR3 L;  1KXL A;  1ENC A;  1LTL A;  3AMU A;  2EOT A;  3RR5 A;  1NUC A;  3K81 C;  4BY7 G;  3SVM A;  1FR3 A;  5KRU A;  2R93 B;  2B2V A;  2OF1 A;  3PV0 A;  2KQ3 A;  5LL6 S;  2D2C C;  1G51 A;  1II3 A;  1JC7 A;  5M3M B;  1IL2 A;  1BCP F;  4IPH A;  2K4K A;  4KY7 A;  1QWY A;  2KCM A;  4G57 A;  5D3D A;  2IX0 A;  2NYZ D;  2DNC A;  3VR3 A;  3GV3 A;  4IUR A;  4DV2 Q;  2HQL A;  2ZT9 C;  4QGU A;  2IW3 A;  1C8C A;  4PZ8 A;  3PO2 H;  3GTG B;  1LLR D;  3S2H H;  4B9W A;  2QA4 A;  1CHP D;  4A3J G;  4A3I G;  2N88 A;  1G6Z A;  1NSN S;  1Q46 A;  1K9M C;  1O80 A;  1PH4 A;  3BDO A;  3CRK C;  1VMC A;  3GTO H;  4C1N I;  1I6V C;  1TU2 B;  3G7L A;  5HGT A;  4A3K B;  1PH8 A;  2JK8 A;  1ICF B;  4WJW A;  2R92 H;  2FHT A;  3P1H A;  1XMO Q;  3DUZ A;  2SOB A;  4G7H C;  4IFD J;  2E5L Q;  1XPU A;  2K01 A;  4ZUI A;  3VR2 A;  4G7Z C;  3H15 A;  3OMC A;  3HGB A;  1WVL A;  4JI3 L;  3S1Q B;  1ET6 A;  1HUM A;  2F0Q A;  3L7Z C;  3NQT A;  3O13 A;  5T1I A;  1SRO A;  1HZA A;  4KN4 C;  3A7A B;  1RL2 A;  1Z6H A;  4MIU A;  4L5R C;  2CW0 C;  1H9K A;  1K28 A;  3CKI B;  5LMU L;  1U4R A;  2HD3 A;  2XTI A;  3KBX A;  3Q23 A;  5GAH C;  4A3D G;  4OEM B;  1SNP A;  1K83 H;  2C35 B;  4L6T B;  4JI5 L;  4GZY C;  1CK1 A;  4CKC A;  2KCT A;  4DV1 L;  4X66 Q;  4HTH A;  2OWO A;  4FF1 A;  4NPS A;  1IYV A;  3QOL A;  4PZ6 A;  3KBG A;  3K0Y A;  3D6C A;  1N33 Q;  1AP0 A;  1HR0 L;  3HOX B;  3NQI A;  5IGG A;  2YTX A;  1DM0 B;  3KUP A;  4F88 A;  1W6K A;  1NMG A;  1I6H B;  2HDL A;  4U68 A;  2JXM B;  5E4X A;  3CW2 C;  3VYU A;  1SNM A;  2UXC Q;  4GN3 B;  5C3E H;  5ELB A;  1EOT A;  1KDA A;  2IJ0 A;  3RZO H;  1YZ6 A;  5K5P A;  1O7Y A;  1B53 A;  1KL9 A;  3A74 A;  4ID6 A;  3HS0 C;  1YNX A;  5IGF A;  1MBY A;  4N8F A;  2Q8T A;  2WB1 G;  2G9D A;  1TS4 A;  2L9H A;  4AQY L;  2Z9H A;  4IUN A;  2Z4I A;  1XX8 A;  1ASY A;  1IHZ A;  1BCP D;  4JPB W;  2WAQ G;  5C44 G;  4A3G G;  2B63 B;  2FMM A;  2QKI C;  2MFI A;  5LMN Q;  3DHQ A;  1QZG A;  5GAD C;  1Q3L A;  4DNI A;  3S2D H;  2J0T D;  1B3A A;  3GQB A;  1ZXT A;  3GTQ H;  1E3P A;  1STG A;  1J8I A;  1EWC A;  1LUZ A;  1MD2 D;  4V19 0;  1I4G A;  2QEJ C;  1LTB D;  2KHS A;  1GJX A;  1KLU D;  2EIF A;  2J7Z A;  3MEH A;  3S14 B;  2X6G A;  5M3F B;  1G2T A;  1KTK A;  1Z9F A;  1Q82 C;  3I4N H;  2JA5 B;  4QB4 A;  2WFW A;  1AN8 A;  4TQU S;  1SE8 A;  1Y1W H;  1IXR A;  1SYB A;  1RKN A;  1BQQ T;  1PXU A;  4B3M Q;  1QNU A;  3VYT A;  1GUO A;  2E2H H;  2O5J C;  3U4V A;  1H9S B;  1SFO H;  4KKT A;  4DPG A;  1KRT A;  1Q7Y C;  1UE7 A;  1EYA A;  4JI8 Q;  4ALP A;  1H9J A;  2AQ2 B;  4DKA C;  2F0W A;  1QUQ A;  1GUN A;  5ISR A;  1EYC A;  4GOP B;  3CAM A;  3RZD B;  1KD1 C;  4LJZ C;  3M7N A;  1EL0 A;  1Q81 C;  4LK1 C;  3EIV A;  1YNN D;  1PRT C;  2N78 A;  2YU9 H;  1EFI D;  1NBW A;  2AHO B;  4NP5 A;  1EOV A;  4C2M H;  1HTL D;  1LTS D;  4IUP A;  4LF5 Q;  4DN4 M;  4ZYS A;  2QCP X;  1N36 Q;  4A3C G;  4IPG A;  3TME A;  3H3V C;  1JWU D;  3S15 B;  1LT3 D;  4J1M A;  4HJA A;  3I7F A;  1E2W A;  3IAY A;  5C4H A;  3H3V H;  2IT1 A;  1XPR A;  3M7G A;  1VQ6 A;  2K5D A;  1PFS A;  2KEC A;  1QVF A;  3S1N H;  4RMF A;  1HJP A;  2K5Q A;  2ICI A;  3PF5 A;  1HNX Q;  3CCJ A;  1UE6 A;  3U9O A;  3AQQ A;  3J81 i;  5T1G A;  3CCV A;  5FKA C;  5M5W B;  3DWP A;  1WD1 A;  2JA7 B;  5IT9 E;  2R93 G;  1KHI A;  2E75 C;  3MC0 B;  2PW7 A;  4LF6 L;  1V1P A;  2K50 A;  2F0G A;  5BR8 Q;  3FKI B;  5M3M G;  5CV5 A; 
#chains in the Genus database with same CATH homology
 5C0X G;  1HUN A;  5I9O A;  1EQV A;  4DAV A;  4AYB B;  1KDC A;  2PZW A;  1WTO A;  4BY1 B;  4N9T A;  5IT9 L;  3NK9 A;  2XRQ D;  1Y1V B;  1TKW B;  3HOY B;  5DNF A;  1EIG A;  2B2T C;  2Y0S B;  4KHZ A;  5D3I B;  2NN6 I;  4ABN A;  3W3A A;  4CHT B;  1ILP A;  5JEA G;  1IYU A;  3E0J A;  4P2C B;  2HQE A;  2RQX A;  3QB3 A;  4IFD I;  1OXV A;  1O7L A;  4RAU C;  1X3P A;  3K57 A;  4QMG A;  1LTA D;  2E74 C;  3C46 A;  2V4D A;  4CJ2 C;  1ET9 A;  2L0C A;  3K7A B;  2F0I A;  2XWJ B;  1GUW A;  1GUG A;  5EQ0 A;  1EEF D;  4Q0F A;  4PNY A;  3SK6 A;  3WOE A;  3E6Z X;  5M5X B;  4PQX A;  2WIN B;  3F2U A;  5I2X A;  1VDZ A;  1GXD C;  1BCP C;  5C5M A;  2F0U A;  1VCI A;  1PDQ A;  2JEB I;  4EVO A;  2E2J B;  3J81 L;  1KLG D;  2MPM A;  3OWF A;  2EPB A;  4XT1 B;  1Y8O B;  2H1E A;  4ZKB B;  3N6R A;  4K14 A;  2EXZ A;  2L11 A;  3D6W A;  1E2Z A;  4RGN A;  4RKL A;  3NSW A;  4G4K A;  1T5X D;  3QO2 A;  3NTH A;  4OO1 H;  4OL7 A;  1D2B A;  3BVG A;  3X3M A;  4H13 C;  1LT4 D;  2LMC B;  1B50 A;  3A8K E;  1PTO B;  3DEP A;  3SK4 A;  1BBX C;  1E2V A;  2D9U A;  2K05 A;  2B2Y A;  2A68 C;  5EKL A;  3NWT A;  3CHB D;  5AFW A;  1LTI D;  1NR4 A;  1QB5 D;  5CMD A;  3SHL A;  2XWB B;  2VNU D;  2B8F A;  2F0D A;  1YNN C;  2XIW A;  2WV6 D;  3HG9 A;  4H0L C;  1R4P B;  1FYC A;  3PO2 B;  3S2H B;  3TBI B;  5KEE A;  3ND8 A;  2XNA C;  3L3O C;  4R9W A;  3NXW A;  4A3M B;  4K2L A;  4BA1 I;  1U4L A;  4DGZ A;  1JOK A;  4ZLT F;  4DU9 A;  1D1I A;  1GOZ A;  1HCZ A;  2DNE A;  2A6H D;  3KLR A;  4IZ8 A;  3MFY A;  1SXT A;  1CQF A;  5JJZ A;  3GP7 A;  2KOL A;  3SXH A;  3H91 A;  1SYC A;  2XVS A;  4DNT B;  3TP6 A;  1R9T B;  2JP1 A;  4KJN A;  1G2S A;  3ONA B;  2K7V A;  4IUT A;  1DD2 A;  1HRJ A;  2EDG A;  2RKS A;  2PNR C;  2B2U A;  1ML0 D;  2I46 A;  1OXX K;  1AW7 A;  4K5X A;  3MVV A;  1Q12 A;  2F3W A;  1NAP A;  1X3Q A;  1D5X C;  4R8N A;  2ID0 A;  3VA7 A;  5C3E B;  2K1B A;  3MXG A;  2RSN A;  5CBE E;  3HOU B;  4XQJ A;  3AB9 A;  4N9P A;  1RDP D;  1A15 A;  1BXT A;  5IGD A;  3D4R A;  1ONL A;  4DAY A;  2K28 A;  1SYF A;  3OW7 A;  2JA6 B;  3FRP B;  1PYW D;  1A2U A;  5DM6 3;  2OXP A;  3S2D B;  1JCK B;  1ZEQ X;  2B2W A;  4HED A;  3GTQ B;  4HR7 B;  1CI3 M;  1BDO A;  1Y8P B;  1L0Y B;  5KND A;  5JAV A;  4S3S A;  1BUV T;  3PO3 B;  4OIJ A;  2F0T A;  1G8Z D;  5ELC A;  2BDO A;  2B2V C;  3I4N B;  4IFD G;  2MHV A;  4KKS A;  2PO4 A;  2K03 A;  4X3S A;  1Y1W B;  2F03 A;  3Q22 A;  4A93 B;  2KUM A;  1LV9 A;  2E2H B;  1KNA A;  4CJ1 B;  1GHJ A;  1SFO B;  3R8B A;  2F0F A;  1VF7 A;  1SE4 A;  2I07 B;  3H6M A;  4KTA A;  3BZD B;  4FF4 A;  1DOL A;  1EZ6 A;  4O1N A;  1A3V A;  3VYR A;  1Q1E A;  1XXG A;  3P75 A;  4HCE A;  1CQV A;  3LWE A;  1PRT B;  1MSG A;  1RCV D;  1STN A;  3WOF A;  4L8J A;  1WD0 A;  1SBB B;  3I3C A;  2NTS A;  4OHJ A;  2Z1C A;  2H4O A;  1WTV A;  4QUC A;  3PIO 3;  1D1K A;  4I7Z C;  5CR3 A;  3ND9 A;  1KDB A;  3S1N B;  1I4R A;  2C9O A;  2EYH A;  2NB0 A;  4E6I A;  3IKJ A;  1B4O A;  1PZK D;  2QDB A;  3E5S A;  3R3O A;  2BDN A;  1JWM D;  2A69 D;  3NPP A;  4B08 A;  2AWO A;  3T53 B;  1TS5 A;  3I90 A;  5DM7 3;  3ERO A;  4XDX A;  1BR9 A;  3JAM E;  3S1M B;  1I3Q B;  4IAL A;  2ZXR A;  1TR5 A;  3EJI A;  3HOZ B;  1QNK A;  1SNQ A;  3TN2 A;  2LKV A;  4ILW A;  2K33 A;  1B9N A;  3GTP B;  3JAM L;  1Y8N B;  4PV1 C;  1F9S A;  3J7A V;  2EYL A;  2FJ2 A;  3KLS X;  5EKK A;  4FVM A;  4OGQ C;  3L9A X;  2KEE A;  1DOK A;  3D3R A;  4K5W A;  3K5N A;  2A6H C;  5IOD A;  3J7Y W;  4C3J B;  1JIC A;  2JEA I;  3A8J E;  3MFG A;  1AFP A;  1FGB D;  3I70 A;  5M9O A;  4A3B B;  3VYS A;  1GUT A;  3BVZ A;  2RBM A;  4EQP A;  1STE A;  3I72 A;  4ME5 A;  5E4W C;  5BN5 A;  1T5E A;  2N55 A;  5IOC A;  4KHV A;  4HAE A;  5JPM C;  2MP1 A;  4DXF A;  1I4P A;  1IKM A;  4TSS A;  1QE6 A;  4O42 A;  3VA5 A;  2TMP A;  1GUS A;  3QIA A;  2A68 D;  3MAQ A;  5CYU A;  5KNB A;  4LMQ D;  3A55 A;  3QWN A;  4FXD A;  3KLS A;  1BCP B;  4A3E B;  1WTX A;  4OO1 I;  5FOB B;  2G9H D;  5ELE A;  4KJO A;  1SYG A;  4ZAI A;  5EPK A;  2EY6 A;  5K36 H;  2F0E A;  3S9W A;  3FVQ A;  3IFT A;  3GTL B;  2D62 A;  2F1M A;  2JSO A;  4RHS A;  3I91 A;  4FXK C;  5I2Y A;  1R4Q B;  2EYF A;  1AZQ A;  1WCM B;  4ODG A;  3EFX D;  4KI0 A;  1ZYR D;  4MHE A;  3A54 A;  1VF5 C;  4KY6 A;  4DNR B;  1UAP A;  4K8J A;  1HFN A;  2M9V A;  1LT6 D;  2BOS A;  3M4Y A;  3BG3 A;  2NZ1 D;  5FLX E;  1TY2 A;  4K5V A;  1HA5 A;  1K8M A;  1V43 A;  4EQN A;  4CBV A;  4FF2 A;  2X6L A;  3J80 E;  2Q8R E;  2D5D A;  1F77 A;  1HA6 A;  1TQO A;  1ESR A;  1QJO A;  4G7O C;  5IIF A;  1EY0 A;  1DON A;  3J80 L;  4JBW A;  4ZUJ A;  2Z8L A;  2A69 C;  2K5W A;  3I4L A;  1QIL A;  5E3F A;  1OO9 B;  2A5H A;  4DA2 A;  4B9X A;  1M4V A;  4FP5 D;  3RLF A;  3NE5 B;  4J8Q A;  4UAI A;  3VR6 A;  5ELF A;  1TWH B;  2EYO A;  3FMC A;  3QG1 A;  1DZ1 A;  4KK7 A;  2EYP A;  2VUM B;  1PMR A;  1EQT A;  2B8G A;  4WRD A;  2F4I A;  5CV7 A;  3V96 A;  1H9M A;  2NVQ B;  1JQY D;  2QIL A;  3PUX A;  4RFB A;  2WP8 J;  3GD7 A;  4BS9 A;  2E76 C;  1EU4 A;  1PLF A;  4CJ0 B;  4C3I B;  4HMJ A;  4C3J G;  3MXU A;  3TDQ A;  3S1R B;  1ENF A;  5CV4 A;  4KMU C;  1LT5 D;  1Z7T A;  3BYT B;  2XSC A;  5C4X B;  3S16 B;  2E2D C;  1TS2 A;  1Z47 A;  3EQL C;  4HSP A;  3HZX A;  3BYY B;  2M2L A;  2B2Y C;  1H9S A;  1SE2 A;  3R2I A;  4L63 B;  1MSH A;  4XXE A;  3MTS A;  3ZYY X;  1STY A;  3C1E A;  4ZRZ A;  1HQR D;  1OXS C;  2WKC A;  4LAA A;  3M85 A;  5TSS A;  4IUU A;  1C4Q A;  1A6X A;  3RUZ A;  2O2L D;  2PYK A;  5A35 A;  1LO5 D;  3I73 A;  5EBC A;  3TZD A;  5CV8 A;  1PFB A;  1RTO A;  3P7J A;  2EVB A;  5I4D A;  5J22 A;  1EY9 A;  1ENA A;  3GTO B;  3SE0 A;  3OMG A;  2L1B A;  2EYJ A;  2DY7 A;  2R92 B;  3OIQ A;  2KJX A;  4OO1 G;  1IKL A;  3MHB A;  5KYI A;  4KKU A;  4EQO A;  3W2D A;  3URY A;  3NHH A;  4V0B A;  2PMZ B;  4A3F B;  4I65 A;  2B2U C;  1ZYR C;  1D6E C;  2FFK B;  2F0H A;  1VMP A;  4FXG C;  1OXT A;  2RVL A;  1SAP A;  1DCZ A;  1K83 B;  3NTI A;  4PMW A;  4XIG S;  4U67 3;  4RHR A;  5NUC A;  3T16 A;  2HDM A;  2SNS A;  1A3T A;  3UI2 A;  1WTP A;  2KCC A;  1ICW A;  2HCI A;  3Q6S A;  1SMY D;  4FO2 A;  4XT3 B;  1F9Q A;  1BO0 A;  4WOR A;  3OOC A;  1O7Z A;  4IQZ A;  3K5L A;  4CKE A;  4X3K A;  1LAB A;  4F8M A;  5JOB A;  3RZO B;  1F9R A;  3T56 B;  4RGT A;  4K8I A;  2B2W C;  3QOJ A;  4ZK9 B;  3MZ5 A;  3HOW B;  1FNU A;  3SEB A;  3DXJ C;  5EJW A;  2NN6 G;  1W6J A;  3AU7 A;  1OXU A;  5C6A A;  1JR0 D;  2F3V A;  3GV6 A;  2EY2 A;  3LNN A;  1DXM A;  2F0P A;  3BDL A;  2L5T A;  1SE3 A;  5EBD A;  3WDN A;  3KF8 A;  1B44 D;  4K6L A;  1Y69 U;  1F2L A;  3Q24 A;  1U4M A;  3PUV A;  1EEI D;  4XQQ A;  1XYI A;  5EPJ A;  1F2Y A;  2R61 A;  3DM1 A;  3K58 A;  1CT1 D;  1A3U A;  4C3I G;  5EKI A;  4C1N K;  1WTW A;  2SDF A;  3MWY W;  4KD3 A;  5J39 A;  2FIN B;  5A2Q E;  1MGS A;  1TS3 A;  1STA A;  4RA8 A;  4DAP A;  4XTC S;  2YU9 B;  1PFN A;  4C2M B;  3G6J B;  1HFG A;  5A2Q L;  1D5Z C;  4ULL A;  3OIP A;  1RD9 D;  3T4A C;  2AQ3 B;  4C3H B;  1SJE D;  1E0B A;  2LY7 A;  2ZXO A;  1SEB D;  3H94 A;  4OIK A;  3K5M A;  3K59 A;  4HMI A;  2GA4 B;  2IX1 A;  3IL8 A;  2F0V A;  4H7B A;  3IFD A;  3NP8 A;  2HUG A;  1WTQ A;  1ZKO A;  2NTT A;  1V1P B;  2BCO A;  4C56 C;  5D14 A;  4YIJ A;  1TVX A;  1S5D D;  2TSS A;  3T13 A;  4K2K A;  1MI2 A;  2LFN A;  1BF4 A;  1S5C D;  2F0L A;  1JOR A;  4M1U B;  3SR1 A;  2RA4 A;  1CA6 A;  2PQE A;  1EY7 A;  4QCL A;  4M8A A;  5EPL A;  3OHX C;  1TWG B;  2PW5 A;  3H0G B;  3V2T A;  2O5I C;  1HXY D;  1STB A;  2F0J A;  3HEJ A;  2EJM A;  4NW2 A;  1U9R A;  2KA7 A;  1V1O A;  2AWN A;  3KK7 A;  1KAB A;  2NVT B;  1F2M A;  1LTT D;  5IGC A;  4KY5 A;  1NCV A;  1CTM A;  1IL8 A;  1KAA A;  2BE5 C;  5C3W A;  1G29 1;  3R2T A;  1I4H A;  4K6D A;  1AZP A;  3U9S A;  4UDU C;  1O78 A;  2QF7 A;  1F2Z A;  1TWA B;  1SYE A;  2RDH A;  1XTC D;  3CU7 A;  2VB3 X;  4DF7 A;  4F7X A;  4TRD A;  3PUY A;  1SMY C;  2R7Z B;  3BDC A;  1LTG D;  2BA0 A;  4RKB A;  3TSS A;  3VR5 A;  4XYO A;  4H44 C;  4IUQ A;  4HSV A;  4FF3 A;  4TKO B;  5F2D A;  2O4X A;  3C1F A;  1GHK A;  1EZ8 A;  3C3L A;  2MUY A;  2HCC A;  4R8I A;  2EZV A;  5C3X A;  2XRS D;  3M3Y B;  1UUP A;  2WAC A;  3BVM A;  3NTK A;  2XN9 C;  2SEB D;  1JWS D;  3HKZ B;  2X69 A;  5JVG 3;  5I6Y A;  1QOH A;  2IPK D;  1X32 A;  3M4O B;  1F9P A;  1B9M A;  5FO8 B;  1WTR A;  3D31 A;  2IX3 A;  1TWF B;  5C0X H;  4RH6 A;  5KIX A;  1LTR D;  2K04 A;  5C4Z A;  2WII B;  3EVQ A;  3J7A F;  3CRL C;  1S4Z A;  3FPU B;  1CA5 A;  3DWQ A;  2C5C A;  5JPN C;  1NR2 A;  1IW7 D;  2Z4H A;  1Q1B A;  2LS0 1;  1HQM C;  1LAC A;  2A6E D;  1PTO F;  3D4W A;  1L0X B;  1EY5 A;  3A7L A;  2F0M A;  5CC4 A;  5JEA H;  5BN3 A;  2NWG A;  3FDT A;  2F0O A;  2ICE C;  3R93 A;  2EJG C;  3ERQ A;  2EE1 A;  2DY8 A;  1TT2 A;  1D5M C;  3DWA A;  2PCF B;  5J1Z A;  4X3U A;  1HTP A;  3H09 A;  4C3H G;  5HUR A;  2CVR A;  5K36 G;  5FO7 B;  5FLX L;  4HN7 A;  4IN3 A;  1JOQ A;  3D8G A;  4BBR B;  2R6G A;  2JA8 B;  3OPO A;  4KN7 C;  5C4J B;  2NUC A;  2E2I B;  2EY5 A;  2K6A A;  2PPB C;  3SK5 A;  4RGM A;  3MXP A;  2CHB D;  3A8I E;  2JE6 I;  3C2P A;  2RSO A;  3I4M B;  4KD4 A;  4BBS B;  5FK9 C;  2B2T A;  4DK1 A;  1SND A;  4XYQ A;  2SNM A;  5IGB A;  4RGO S;  4IUV A;  3RMH A;  3RD4 A;  1KNE A;  3ITP A;  2F0S A;  4HCS A;  4DXG A;  5CV9 A;  5C0X J;  2KVM A;  2OEO A;  3HRZ C;  1B1Z A;  1CZG A;  3HP3 A;  3TP5 A;  3P20 A;  3TP8 A;  2F0K A;  5KYL A;  3BS1 A;  3HOV B;  1YNJ D;  3QJY A;  5LL6 X;  1EY4 A;  5I6W A;  1TII D;  5DEH A;  1PTO D;  2M00 A;  3T51 B;  3TP7 A;  1B2T A;  4RCO A;  4BA2 I;  4PMB A;  4Q5V A;  4BY7 B;  4ZKC B;  3GO5 A;  3J81 E;  3N52 A;  4FYD A;  1FNV A;  1BOS A;  3V05 A;  3NBI A;  5JEA J;  3GTK B;  5E1F A;  1JE4 A;  4RCN A;  4X3T A;  4Z9C B;  4XQN A;  1HPC A;  3K6O A;  1QG7 A;  5KGU A;  5I9P A;  2NVX B;  3DEO A;  3D4D A;  4A3J B;  4A3I B;  1CM9 A;  3K5O A;  1A2T A;  2JYO A;  3MA2 B;  1C48 A;  3PMF A;  1EIH A;  3EA6 A;  2L12 A;  2RDF A;  1FD7 D;  2Q8I B;  4RWS C;  2ZXP A;  1M8A A;  4DK0 A;  4DFA A;  3DMU A;  2AUJ D;  3X3N A;  4EGV A;  1RTN A;  1SYD A;  2K32 A;  5FO9 B;  3PIP 3;  5COR A;  1ILQ A;  4PMC A;  3GTM B;  3CQZ B;  4Y7N B;  1SJH D;  2CW0 D;  1FNW A;  4A3D B;  2IWH A;  1DYQ A;  2EY1 A;  4CKB A;  1CHQ D;  5CGK A;  2MGS A;  1UEA B;  1PRT F;  2VXW A;  3FEW X;  1Q90 A;  3TZU A;  1IW7 C;  3NUC A;  1SNC A;  5EGT A;  4CGY B;  3NBH A;  5IGE A;  5G3L F;  1EY8 A;  1HHV A;  4WFN 3;  3PUW A;  1I50 B;  2A6E C;  2AUK A;  1PFM A;  4NKL A;  1PZI D;  2A73 B;  4QIW B;  2BA1 A;  2BE5 D;  1Q8I A;  4QUF A;  2IL8 A;  4KV6 A;  1EWH A;  1G91 A;  4MN3 A;  1AEX A;  2CQA A;  2KED A;  4ZQ3 A;  5CV6 A;  4J6H A;  5JVH 3;  1CFM A;  4QF4 A;  2WB1 B;  1ROD A;  1I4Q A;  2F0N A;  1QCB D;  2WKD A;  5BN4 A;  5CBA E;  1TWC B;  2EYM A;  2WAQ B;  1S5F D;  5C44 B;  4A3G B;  2NN6 H;  4JK1 C;  2PZU A;  3GTJ B;  2L55 A;  5KNC A;  3VR4 A;  2DN8 A;  3SDZ A;  5DAU A;  2MJ8 A;  1UNS A;  1XWE A;  3LWU A;  3FPP A;  1S5B D;  1BNZ A;  1EU3 A;  3LX0 A;  3OWE B;  3S17 B;  1TY0 A;  4IFD H;  2R3Z A;  3MXN A;  1RHP A;  2VB2 X;  2FMC A;  1I4X A;  2L4N A;  1DJR D;  3Q0A A;  1SSO A;  2OT2 A;  1V8Q A;  2RDG A;  5LHY 1;  1STH A;  1H9R A;  2KCN A;  2NBF A;  4NMZ A;  2YYZ A;  4NDX A;  3I8Z A;  4F87 A;  2ENB A;  2EJF C;  1JB3 A;  5COY A;  2J4X A;  1ESF A;  1DOM A;  1J9O A;  5ELD A;  3OSO A;  2NVY B;  2B39 A;  1PRT D;  1EY6 A;  1S5E D;  1K8O A;  3SK8 A;  1SDF A;  1PZJ D;  3PUZ A;  1EYD A;  1RJT A;  1YNJ C;  2A74 C;  5G3L D;  2PZT A;  4FNF A;  1SNO A;  5D65 A;  1PTO C;  2AQ1 B;  5C5L A;  3NWS A;  5C0X I;  1CZW A;  5M5Y B;  1PTO H;  1U4P A;  1RF2 D;  1JOO A;  3A56 A;  4BWG B;  1ENC A;  3AMU A;  2EOT A;  1NUC A;  3SVM A;  1FR3 A;  5KRU A;  2R93 B;  2B2V A;  2OF1 A;  3PV0 A;  2KQ3 A;  5LL6 S;  2D2C C;  1II3 A;  1JC7 A;  5M3M B;  1BCP F;  4KY7 A;  1QWY A;  4G57 A;  5D3D A;  2IX0 A;  2NYZ D;  2DNC A;  3VR3 A;  3GV3 A;  4IUR A;  2ZT9 C;  2IW3 A;  1C8C A;  3GTG B;  1LLR D;  4B9W A;  1CHP D;  2N88 A;  1G6Z A;  1NSN S;  1O80 A;  3BDO A;  3CRK C;  1VMC A;  4C1N I;  1I6V C;  1TU2 B;  3G7L A;  5HGT A;  4A3K B;  4WJW A;  2FHT A;  3P1H A;  3DUZ A;  2SOB A;  4G7H C;  4IFD J;  2K01 A;  4ZUI A;  3VR2 A;  4G7Z C;  3OMC A;  3HGB A;  1WVL A;  3S1Q B;  1ET6 A;  1HUM A;  2F0Q A;  3L7Z C;  3NQT A;  3O13 A;  5T1I A;  4KN4 C;  3A7A B;  1Z6H A;  4MIU A;  2CW0 C;  1H9K A;  3CKI B;  1U4R A;  3KBX A;  3Q23 A;  1SNP A;  4L6T B;  4GZY C;  1CK1 A;  4CKC A;  4HTH A;  4FF1 A;  1IYV A;  3QOL A;  3KBG A;  3K0Y A;  3D6C A;  1AP0 A;  3HOX B;  3NQI A;  5IGG A;  1DM0 B;  3KUP A;  4F88 A;  1W6K A;  1I6H B;  2HDL A;  4U68 A;  2JXM B;  5E4X A;  3VYU A;  1SNM A;  5ELB A;  1EOT A;  1KDA A;  2IJ0 A;  5K5P A;  1O7Y A;  1B53 A;  4ID6 A;  3HS0 C;  5IGF A;  1MBY A;  2Q8T A;  2G9D A;  1TS4 A;  2L9H A;  4IUN A;  2Z4I A;  1XX8 A;  1IHZ A;  1BCP D;  2B63 B;  2FMM A;  2QKI C;  3DHQ A;  1Q3L A;  2J0T D;  1B3A A;  3GQB A;  1ZXT A;  1STG A;  1J8I A;  1EWC A;  1MD2 D;  4V19 0;  1I4G A;  1LTB D;  2KHS A;  2QEJ C;  1GJX A;  1KLU D;  2J7Z A;  3MEH A;  3S14 B;  2X6G A;  5M3F B;  1G2T A;  1KTK A;  2JA5 B;  4QB4 A;  1AN8 A;  4TQU S;  1SYB A;  1RKN A;  1BQQ T;  1PXU A;  1QNU A;  3VYT A;  1GUO A;  2O5J C;  1H9S B;  4KKT A;  1EYA A;  1H9J A;  2AQ2 B;  2F0W A;  1GUN A;  5ISR A;  1EYC A;  3RZD B;  4LJZ C;  3M7N A;  1EL0 A;  4LK1 C;  1YNN D;  1PRT C;  1EFI D;  4NP5 A;  1HTL D;  1LTS D;  4IUP A;  4DN4 M;  4ZYS A;  2QCP X;  3TME A;  3H3V C;  1JWU D;  3S15 B;  1LT3 D;  4J1M A;  1E2W A;  3IAY A;  5C4H A;  2IT1 A;  3M7G A;  2K5D A;  2KEC A;  2K5Q A;  2ICI A;  3U9O A;  5T1G A;  5FKA C;  5M5W B;  3DWP A;  1WD1 A;  2JA7 B;  5IT9 E;  2E75 C;  3MC0 B;  2PW7 A;  1V1P A;  2F0G A;  3FKI B;  5CV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...