5ELCA

Cholera toxin el tor b-pentamer in complex with lewis-y
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera enterotoxin subunit B
publication title High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Toxin
total genus 27
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5elcA00
1JQYD 1PTOC 1BCPC 4L6TB 1EEFD 1TS5A 5TSSA 1JWMD 2XRSD 1KLGD 1HA5A 1I4PA 1M4VA 1KTKA 1SE4A 1L0XB 1PRTB 3BYYB 1HXYD 1TS2A 4RHSA 3V05A 1EU3A 1LTRD 1S5BD 3BVGA 5D3IB 1B44D 1LLRD 2R61A 1ESFA 1JR0D 1ENFA 1JWUD 1CT1D 1XTCD 2TSSA 5ELFA 5D3DA 1SBBB 4K6LA 5FKAC 1AW7A 1LT6D 1LT3D 1RF2D 1LO5D 4ZYSA 4DXGA 1CQVA 1LTGD 2RDHA 1RD9D 3OWEB 1HTLD 1LTID 1V1PB 1EEID 1S5FD 3BZDB 1I4GA 1GOZA 1BCPB 3MC0B 3EFXD 1PTOF 1STEA 1SJED 1FD7D 3R2IA 2O2LD 2AQ2B 1D5XC 3O13A 3CHBD 1UUPA 1F77A 2QEJC 1BXTA 1D5ZC 1S5ED 2XNAC 4RGNA 1PRTF 2CHBD 4RGTA 1CHQD 4RFBA 1TS3A 5I4DA 2J4XA 1L0YB 1I4HA 2G9HD 2IPKD 1LT5D 4Z9CB 3TSSA 5FK9C 2Z8LA 3BYTB 1FNWA 1EWCA 3R2TA 1DYQA 4C56C 1T5XD 1HQRD 3BVMA 1ET6A 1BCPF 1LT4D 1CK1A 1AN8A 1SE3A 1D5MC 1LTAD 2RDGA 4RGMA 5ELCA 1XXGA 3GP7A 4UDUC 4RH6A 4DXFA 1S5CD 4L63B 1DJRD 1JWSD 1RCVD 3KLSX 1PTOD 5ELBA 1CHPD 1PZKD 1QILA 3EA6A 2AQ3B 4BWGB 4TSSA 3MFGA 1SEBD 1I4RA 1PZJD 1JCKB 3DWQA 1B1ZA 5ELDA 1UNSA 1PRTD 3W2DA 5ELEA 1PZID 1FNUA 1PYWD 1TY2A 3BVZA 1D6EC 1PTOH 1I4QA 3URYA 1FGBD 1ET9A 1KLUD 1PRTC 1FNVA 1V1OA 1MD2D 2ICIA 1TY0A 1EFID 2NTSA 4OHJA 1SXTA 3DWAA 2XRQD 4RHRA 1G8ZD 2XN9C 2IJ0A 3SEBA 1V1PA 1S5DD 2QILA 1LTSD 1SE2A 1EU4A 3R8BA 2NTTA 1I4XA 4RCOA 1LTTD 1BCPD 1LTBD 1SJHD 4O1NA 3DWPA 2SEBD 1TS4A 2AQ1B 2WV6D 1RDPD 1PTOB 4RGOS
chains in the Genus database with same CATH superfamily
1PTOC 1ICWA 2HDLA 2A69D 4LF8L 1DGSA 4DR4L 2F0MA 5M3FH 4FNFA 1GUWA 1VCIA 4JI3Q 2D2CC 4OONA 3VYRA 3S16H 1NSNS 3L9AX 5I6YA 2OT2A 4BXXG 3BVGA 2ICEC 1IZ6A 4DV1Q 1R9TB 3S1MB 1VQHA 3FHWA 2RQXA 1XMQQ 3QB3A 5C3EB 3J7AF 1EL0A 1Q86C 2NZ1D 3G7LA 3K5OA 3HP3A 1ONLA 1GOZA 3H0GB 3LWEA 1QWYA 4CDFC 3OW2A 3HOVH 5JOBA 2G9DA 3HS0C 5CV6A 3IFTA 1B9MA 2K4KA 1ZEQX 3PIOA 3GTKB 4K5XA 5I4DA 2J4XA 1EFWA 1L0YB 5KNDA 1QB5D 1PXUA 3QOJA 3CC2A 4L5SA 1SYCA 2G9HD 2ZXOA 5LHY1 3I4MB 3MXUA 5COYA 1CTMA 1E0BA 2Q2UA 1QOHA 4LF9L 3PIP3 4J15A 2EZVA 1IKMA 1JJCB 1HQMC 4OWTB 4JI2Q 4WORA 2IHEA 2L0CA 2F4VL 4JI6L 3RUZA 2WB1B 4K0KL 4DR7Q 3IRBA 5C0XG 2L12A 3G71A 2H5XA 2L4NA 3CC4A 3M4PA 2AWOA 1HFGA 1Y14B 5NUCA 5IP7H 2QDLA 4YWKA 4A3EH 1JCKB 1TT2A 3I4OA 1OXVA 4FXGC 3U9SA 3Q24A 1PH8A 4DK3C 5DLQE 4JI5L 2F0IA 2F0SA 1VQJA 1Q12A 4JBWA 3ICEA 3KUPA 2CQOA 2ASBA 2HIXA 2IJ0A 4OGQC 1K83H 4BY7G 4ZQ3A 4X66Q 4AIMA 2F0QA 3HOYH 3R8BA 2C35B 5I9OA 2UXBQ 2F1MA 3S14H 3H91A 3PCOB 1PVOA 2IHFA 1MBYA 3H09A 2XRSD 3I2ZA 1Z7TA 2CVRA 1VMPA 2F0JA 4B9XA 3SR1A 2B8GA 5M3MH 3V05A 4DA2A 2NVTH 4HMIA 1EOVA 2EY6A 5M9OA 1JR0D 1XTCD 1AP0A 1CT1D 3V96A 4FYDA 1CZWA 1BVSA 2KENA 4A3IG 1HNWL 1N32Q 3D0FA 5JVH3 5C4HA 1Y69U 1HR0W 1SJED 2QKIC 3R2IA 2MP1A 4YCVA 5HGTA 2R93B 4A3FG 4DV2L 2NVYB 1WTRA 1EYGA 1DM0B 4PG3A 3JAML 2FHTA 4I7AA 1CZGA 4XIGS 3M9BA 1PHJA 1EIGA 2K5VA 1KHIA 4BY1B 3EROA 5IGBA 4CDEC 1O7YA 1WCMG 3J81L 4JOIC 2K28A 1AEXA 2K04A 1H9KA 3GTQB 1VQ9A 3I90A 2VQEQ 4CJ2C 1KAWA 1F9SA 1NJIC 5EKLA 2D9UA 2LFNA 3GTGH 1EQRA 4ZAIA 2CQAA 1Q1BA 2MPMA 5LMNW 3GP7A 4BY7B 4AYBG 2AUJD 1C8CA 2Q8RE 2NUCA 3AFPA 4MIUA 1EIHA 1CHPD 1LABA 5M5YH 3E0EA 3GTLB 5C4JH 5ELDA 5EQ0A 3E9IA 5M3FG 2AHOB 5E4XA 1EY9A 2J0TD 1E2VA 1I5FA 1Y1WG 4GS3A 1PYBA 2KBNA 1SNQA 4BBSH 3NBIA 3PO3B 2Y0SG 2UXDL 4A3IB 2NZHA 2GA4B 3HOVG 1CKNB 1JQYD 4JI1Q 2B2VA 3B6YA 3ER0A 1C0AA 4A3FB 3QWNA 1E1OA 4L5RC 2CW0D 3WWVA 4RHSA 1OXXK 4TVAB 1HR0Q 1UAPA 3OMCA 2CWAA 4A3LH 3PIO3 1LYLA 4LFAQ 1XWEA 1IXRA 4DN4M 4LFCL 4B3SL 1WCMB 3F2CA 2TMPA 4IPCA 1AW7A 1RF2D 4P73A 3CCLA 1RIPA 4ME5A 2YTYA 4DPGA 2F0TA 1GUSA 3A55A 3QG1A 1HNZQ 2A68C 4EX5A 3GO5A 1KXLA 3E5SA 4IPHA 4EQ5A 1SDFA 3H94A 3GV3A 1FYCA 1SMYD 3CU7A 2LMCB 1A63A 3F2BA 4POGA 5ELOA 2JA9A 3OYYA 4R4CA 3RN2A 2KCTA 4AYBB 3NBHB 3J81c 3HOXB 5IP7G 4DR3Q 1HUMA 3K58A 4A3EG 1LT5D 1X3PA 2PCFB 1K3BC 4CBVA 3KJPA 5LMNQ 1HUNA 3KFUA 2I07B 1XNRL 1QCBD 3OW7A 1KDAA 4RCNA 4HIKA 1A0IA 1LM0A 1DCZA 1JB3A 1QNUA 5IWAQ 2JA5B 3MEHA 4X64L 4OX9Q 2PW7A 1GXDC 4UHVA 4AQYL 4YCWA 2F0EA 4C2MH 1Y1WB 2KA7A 4LF7L 4YIJA 4LF4L 1GHKA 2D0PA 1EWHA 2GN5A 4NDXA 3T51B 3HOYG 3CRLC 1YJ9A 2EIFA 4DV0Q 3ULPA 4PMCA 2R92B 3CMAA 4OELB 1NUCA 4JI4L 2R7FA 3A5UA 2WFWA 2HT1A 2LY7A 2RCFA 3BJUA 2F0PA 1IL8A 2Z6KC 4GN4B 2B2TA 1OXTA 1V1QA 2M9VA 2MFIA 1SFOB 2MGSA 2UUAQ 1V43A 1E1TA 2QILA 2BH8A 4HIDA 3OIQA 2B39A 2B2UA 3J7AV 4RWSC 1R9TH 2NB0A 3HRZC 3BU2A 5IT9L 2SEBD 2YTXA 3M4OB 5C3EH 1WOCA 1RDPD 3A7LA 3F2DA 1WTPA 5TSSA 1JWMD 1CKOA 2EYPA 1SE8A 3ONAB 1KLGD 3NWTA 3VR4A 2QF7A 3T1YQ 2EYJA 1IYJB 2NVXB 4P2CB 4FP5D 3UDGA 5IYDH 1WD1A 1LLRD 5FO9B 4GLXA 1YEZA 4FF3A 4TRDA 3GTKH 5IIFA 4UY8C 1E2ZA 2YYZA 2RDHA 4HSVA 5CGKA 2V4DA 1OTCA 3I4MH 3ZJYC 4MNOA 1F2YA 2RSNA 2IT1A 4JBKA 3Q23A 4ZLTF 2JA6B 2B2WA 2F0GA 4DAMA 4GKJL 3IAYA 4DR1Q 5M5WB 3VR5A 3OSOA 1K83B 1N33L 3GD7A 4J1MA 4KN4C 4DV5Q 3HOUB 1F2LA 2JN4A 4HEDA 3I91A 2KHSA 3N6RA 4XDXA 4HJ5A 2LS01 1AFPA 4B3MQ 3S14B 4BA2I 3K59A 2XVSA 3MHBA 4C3HB 1ML0D 1TWAB 5J22A 1PH4A 3DHQA 3K7UC 1U5KA 2YV5A 1BCPF 5AJ3L 4RKLA 4JG2A 1Z6HA 2PQAA 5HY6A 4LNQA 2VQFQ 4AH6A 1IBMQ 4L5TA 4BBSG 4GZYC 2EQSA 2X6GA 3I4NB 1PTOD 1PZKD 1CFMA 2AQ3B 4JI7L 4IUQA 4XQJA 2R7DA 4A4IA 1YJWA 1SEBD 1AH9A 2VL6A 1FR3A 3J81E 1ILQA 4ID6A 1EQVA 1FNUA 4LUOA 1X55A 4NP5A 2ZM6Q 1I4QA 2ICIA 2NTSA 1SYGA 1FGUA 4A3LG 1JJGA 1YJNA 4PZ8A 1SNMA 5IT9c 2UU9Q 1B3AA 5DEHA 1D7QA 1LTTD 1KL9A 4ZKCB 3TRZA 4JI3L 4GLAC 3DWPA 4OWXB 4A3CH 1EUJA 1GO3E 4O2DA 4JI0Q 3RLNA 4DV1L 1EZ8A 1LUZA 3AB9A 1B2TA 1XMQL 3GTGB 1KRSA 4P72A 2OTJA 2B2YA 2DY8A 1M4VA 1WTQA 1Q1EA 4KHVA 4DUYQ 2R93H 1VQBA 2NVYH 1B70B 4EVOA 5ELFA 4KJOA 1NR2A 1SBBB 2JSOA 2E74C 3D31A 3ERSX 3Q6SA 1TVXA 5C4XG 1TXYA 4BY1H 1VQ6A 4DV3Q 2PQEA 1E7ZA 2Z1CA 4RA8A 1EY4A 4CKBA 1BXTA 2D5DA 1HZBA 4HR7B 1GM5A 1N36Q 3QO2A 3OTOQ 2UUCQ 1IBLQ 2B3GA 1GVPA 4JI2L 1G2SA 2ALYB 1Y8PB 2F0DA 2E8GA 2DNCA 1VDZA 4WJ4A 4OO1G 4HN7A 1VQKA 2WAQB 2MNAA 3GTLH 1DXMA 1CM9A 2KQ3A 2M00A 2EY5A 1II3A 5DNFA 3R3OA 5EJWA 5HGQA 2E2HB 2PI2E 5ELCA 3D8GA 2PYKA 3DMUA 2NZOA 2VY3A 4P75A 1ENAA 5IODA 1JOKA 1Q90A 1JWSD 1STYA 2A1AA 4KY5A 3NK9A 1YVCA 3CCRA 2A6EC 4H7BA 5EKKA 1LTLA 5C3EG 1F2MA 1V8QA 3PO2B 2CWPA 4RG1A 3PO3H 2O4XA 3W2DA 2MHVA 1VQEA 4X66L 4DK6C 4C3JH 1NTGA 1P16A 3BVZA 4A3GH 2QCPX 2XSCA 1KLUD 2UXBL 3TS2A 4RHRA 2DUDA 2E75C 1JICA 3V2TA 2QGQA 4HSPA 4PMBA 1RTNA 4NMZA 4V190 3I4MG 4IPGA 5C4XB 2EYLA 5FLXL 1HFNA 4L6TB 4QUFA 1CQFA 4K8JA 3ITPA 4ZKBB 3GTMH 1N32L 4IJHA 4I65A 2OQKA 4H13C 3TEHB 1KC8C 5A2QE 2EJFC 1OXSC 2WB1G 1A62A 2X6LA 3TP6A 3X3MA 1NMGA 3FEWX 3IKJA 2K7VA 4IURA 3HOXH 4DXGA 1PH2A 1CQVA 2PZUA 4KKSA 2RBMA 4A93B 5IT9E 1BCPB 3Q22A 4A3DB 5CBAE 1MHWC 3EBEA 1B3QA 2K5DA 1YHQA 2F03A 3CHBD 3RLOA 2JA5H 1H9JA 1D5ZC 2XNAC 1SNDA 3E6ZX 1I50B 2VQEL 1HCZA 5GADC 4RFBA 2B2VC 1Y1WH 2OWOA 1HRJA 2V1CC 4KTAA 3FMCA 1BBXC 4LUZA 2OEOA 1WTOA 1B4OA 4KY6A 4QB4A 2MO1A 3J80i 4POFA 2R92H 4IOAA 1GKHA 2NWGA 1ASYA 3K8AA 1LT4D 1CK1A 4IO9A 4NXNQ 4J6HA 1Q8KA 4UP8A 1SYFA 2CKZB 2Q2TA 1CKNA 3K5LA 1X9NA 1SFOH 4JI8Q 1NAPA 4A3CG 5CV4A 4QIWB 1PH6A 1YI2A 1F9PA 1WFQA 1XPRA 3RNUA 3NSWA 3J80E 4DR2Q 3M4OH 4XQQA 2L9HA 1SNOA 4EQOA 1D6EC 4YHHQ 2R93G 4OHJA 4OWWB 3SEBA 4JI1L 4A3MB 2NVXH 3M7NA 4DR6Q 1TWFB 2LXKA 5FLXc 4NB3A 1LTSD 1IL2A 2A68D 3G4SA 4RCOA 2PPBC 1E2WA 2EDGA 5JEAJ 1FL0A 4O1NA 4HCSA 4BY1G 1HR0L 1A2TA 4KKUA 1AE3A 1PMRA 2K75A 3NWSA 4Y52H 3NBHA 4LFAL 2ZTDA 1GUOA 5GAGC 3D4WA 1L0XB 3NTHA 2JA6H 1TS2A 3MXGA 1HNZL 4R9WA 3KLRA 3ERQA 5M5WH 1F9RA 4A3BB 1B8AA 3STBC 3BZKA 1YITA 1Q7YC 3HOUH 3Q8DA 4IALA 2B2TC 4K6LA 4DU9A 4OO1I 1LT3D 2K33A 3CCJA 1N9WA 2K1BA 4N8FA 4IJLA 1NMFA 3CRKC 3J7YW 2PZTA 4DR3L 3EFXD 2JEBI 4C3HH 1TWAH 3AYHB 3VYTA 2AQ2B 4JW0A 2B2UC 5LMNL 2YTVA 3RZOB 3HOZB 2CHBD 4CKEA 5IWAL 3N52A 2DGYA 5BN5A 3MEFA 4OX9L 2HQEA 1I4HA 1YNJC 4DUZQ 3PO3G 3BYTB 1ENCA 4QMGA 4JYAQ 3S2DB 3I4NH 1FNWA 3R2TA 2Q2HA 3TN2A 2PW5A 4C3JG 4DV0L 3NXWA 5EBCA 2BE5D 1ET6A 4A3GG 1KAAA 2A73B 3DEOA 3EVQA 1VQGA 5IYBH 1O7LA 2BCOA 1SE3A 1W6KA 3KF6B 3CAMA 3LWUA 3K5NA 1HH2P 3SK8A 3K5MA 4X6AH 4KK7A 4QY7A 1K73C 4UDUC 4RH6A 3TDQA 2I5HA 3G48A 3GTOB 3M4YA 4RMFA 1PH3A 2B2WC 1WYDA 1MJEA 3CP0A 1JORA 2Z4HA 2UUAL 2JEAI 1U4LA 3DWQA 3W1BA 4F87A 4GOPB 5CORA 1PYSB 3E0JA 4FDBA 2B63B 4QQBX 2EYFA 4R4IA 1PDQA 5EKIA 4IFDJ 3PUWA 2ENBA 4M8AA 4EQPA 3BS1A 4DV4Q 3PF4A 1G6PA 3HOXG 2K52A 4UPAA 3S9WA 3T1YL 1YNXA 3ZYYX 2PNHA 1HNXQ 3LX0A 1UEAB 2O5IC 1TS4A 4LF5L 2WV6D 3OIPA 1CKMA 1JE5A 1BCPC 3D6CA 2IY5B 2JA5G 1HTPA 3J7ZC 1TIID 4K5VA 1MIUA 2XWBB 1QZHA 2BOSA 3X3NA 5KNCA 1JWUD 1STNA 1ENFA 2KECA 2TSSA 4DR1L 2A6HC 3LNNA 1VMCA 3E9HA 2RA4A 1LO5D 2R92G 2I5MX 2FJ2A 4DV5L 1LTGD 1X3QA 4C3JB 1F2ZA 3A8KE 3SGIA 4A3GB 1PTOF 4B3ML 5FLXE 4A3KG 2JA8B 1N34Q 3CKIB 2GVBA 1VF7A 4JBMA 4QJFA 4XYQA 2QA4A 2SNMA 3PSIA 5EPJA 2X69A 2F52A 4FO2A 4RGNA 2ATWA 3A54A 1ZXTA 2EYOA 1X32A 2E2HH 1PFNA 2DJGC 3DEPA 3PMFA 2B2YC 1KIXA 1OO9B 1STBA 3HKSA 4KI0A 2VQFL 1IBML 2ZXPA 4YWLA 1PV4A 1HQRD 4B3RQ 3BVMA 3NEMA 1MGSA 2EPBA 4FF4A 3JAMc 5F2DA 3GTMB 1K28A 2A8VA 3PO2H 2NVQB 2Q2IA 3AFQA 2AKWB 4HJ8A 3OPOA 5FOBB 1J8IA 3GTJH 2KUMA 3TS0A 3T16A 2FXQA 2ZM6L 3KLSX 3L0OA 5ELBA 1O78A 5JEAG 4OEMB 4XT1B 2Y0SE 3HGBA 3DM1A 2IX0A 4B9WA 4GN3B 2UU9L 5E3FA 5JPMC 5C4XH 3CCQA 1VQ5A 3LGJA 1WTVA 2C5CA 2JA6G 1MJCA 2Q8IB 3T56B 3TZDA 1MD2D 1TY0A 3CQZB 4HJ9A 1X54A 3C1EA 4JI0L 4CJ1B 3VR3A 5CR3A 4HJAA 3HOUG 3W3AA 4NKLA 2F0VA 2SDFA 4KHPQ 4LUVA 1B50A 2CFMA 3TP5A 3MWYW 4DUYL 2JK8A 4B3TQ 1CA5A 2AQ1B 4KKTA 4C3HG 1QUQB 3M7GA 3A56A 1I6VC 2K32A 4XYOA 4A3KB 4OO1H 2HHHQ 4A93H 3ND8A 1SE4A 4H02A 4A3DH 3BYYB 1W6JA 2I46A 5GROA 3BG3A 1EWIA 5IY0A 4DV3L 1I50H 4Y7NH 1C48A 5FKAC 3I4NG 2LXJA 1LT6D 1XX8A 3PUZA 4DAPA 1EYAA 4ME3A 4JPBW 3OWEB 1N36L 3NENA 3FPUB 1UWVA 1I4GA 1BQQT 3BZDB 5CMDA 5IYBG 3OTOL 1IBLL 2UUCL 1QVGA 1NNXA 4FF1A 2A6ED 2ZTEA 4RGTA 4LF5Q 3DUZA 1BO0A 1SLJA 1X56A 4Q0FA 4S3SA 1A6XA 2Z8LA 2D0OA 4WRDA 5G3LF 5CBEE 3CCUA 4C3IH 4IOCA 2MUYA 3PUYA 5FO8B 1DZ1A 1AN8A 3U4ZA 4R1JA 3S15B 2EY2A 4M1UB 1HPCA 2SNSA 2NYZD 4KMUC 1CSPA 3CCVA 4IFDG 4NPSA 1X3GA 1WD0A 3QR8A 1CSQA 2KHIA 3CC7A 4QF4A 5K36G 3JAMi 1U4MA 1H95A 3ULJA 4G7OC 1DJRD 3A5ZB 1F9QA 1TWGB 2VZAA 3QJYA 4A3MH 1TWFH 2PZWA 3S17H 2N78A 3J81i 4KD4A 1PRTD 1XNQQ 4DKAC 2FMCA 2AMCB 3CD6A 3U4VA 1J9OA 5GAHC 3AEVA 5BR8Q 5IGFA 1ET9A 1T5EA 3KF8B 3GDEA 2K5NA 1G2TA 2UXCQ 4L8JA 1AZPA 2XN9C 5H1SE 1D8LA 1D1KA 3JAME 3NTKA 2UUBQ 1G91A 4A3BH 1YNNC 5FJ8H 2MJ8A 5T1IA 2DN8A 1PTOB 1SRUA 4KV6A 2WAQG 4F88A 1JB7A 2VUMB 1S40A 2VW9A 1K8OA 2JA7G 2IL8A 1KTKA 4CKCA 3M3YB 3PUVA 4H0LC 5DM63 1WTWA 2BH2A 3EIVA 5EAYA 1B44D 3W1GA 3RZOH 3HOZH 5ELNA 1WTXA 1IW7C 1AE2A 5I9PA 3AU7A 3KDFB 1EQQA 1B9NA 2HQLA 4DK0A 5C5MA 2PMZE 3PO2G 4H44C 4X3TA 1KDCA 3FPPA 3S2DH 1STEA 4PZ7A 2EXZA 1FD7D 5E4WC 3C3LA 1D2BA 1KQSA 2QEXA 1GJXA 4KLKA 4V0BA 1FVIA 3CCMA 2KEDA 1VQIA 3VR6A 1H9SB 3HKZE 2E2JB 4QCLA 4YCUA 1JJ2A 3P1HA 5KIXA 5I2YA 1QNKA 4PNYA 3R93A 4NXNL 1CA6A 4XXEA 3GTOH 3NPPA 1KABA 4JCVE 4NW2A 5K5PA 1EWCA 1XMOQ 4TQUS 4I7ZC 4C56C 1VQ4A 1VQ8A 2RCNA 1VS0A 3S1RB 2OXPA 1DOMA 4JI8L 4ABNA 2CH4W 2K50A 2RVLA 5IP9G 4Q5VA 1UE6A 4ULLA 5FO7B 1XYIA 4R4QA 5C0XJ 1EZ6A 1NBWA 1VQPA 1X65A 4DR2L 2B63H 4F7XA 3H3VI 1C9OA 2WIIB 4CGYB 3TQYA 4RAUC 4J8QA 4YHHL 4BWGB 2L11A 1EIFA 1Y1VB 4K5WA 1XTDA 3MFGA 1BBWA 1QE6A 3GV6A 1L2FA 1XPUA 2HUGA 4DR6L 4QL5A 4A93G 3HOWB 4A3DG 4JV5Q 3WDNA 2JA7B 1YZ6A 2F0LA 3HG9A 2E2IB 3RR5A 2BDNA 5KYIA 4APVA 1RJTA 2HCCA 2F0FA 1A3UA 3BZCA 3NQIA 1IYUA 2CH4A 1HZCA 3M4QA 4U673 1S72A 4RGOS 3P75A 4DGZA 1V9PA 2XIWA 4LW1A 3KBXA 4YWMA 2NBFA 4HCEA 5EBDA 1MI2A 3PUXA 3GTJB 2JA8H 1YNJD 2KCCA 5CYUA 2EVBA 1MSHA 1SYDA 5CC4A 3K57A 3C1FA 1GUTA 5ISRA 4R8IA 4DV6Q 3T1HQ 3I8ZA 3C46A 1SROA 2HCIA 5JJKA 4C3IG 3KF6A 5LMUQ 2WKCA 1V1PB 1EEID 4CDDC 5JJIA 4KN7C 3W5OA 2NN6I 4DUZL 2B8FA 1SNPA 1VQMA 4HJ7A 1QZGA 4IFDI 4JYAL 2JXMB 2L1BA 2ZXRA 2NVQH 3U58A 4MZ9A 3TP8A 1YIJA 5JJLA 2XWJB 4A3MG 5JPNC 4GOPA 2ZJRA 3VA7A 3TSSA 2JQOA 1BOSA 3KK7A 1A3TA 4CDCC 4NXMQ 5E1FA 4IUNA 3P7JA 3SK4A 1EY0A 1WJJA 4HTHA 4OIJA 5BN4A 4DR5Q 4WJ3M 2I5LX 2EY1A 1TWCH 2BDOA 4A3JG 1D5MC 4N8X1 1U0LA 4O0AA 1XXGA 4B08A 2FINB 4LK1C 4DXFA 4Y7NB 3PGZA 2A19A 2K6AA 3CQZH 1RCVD 4A3BG 3RN5A 4DAYB 5FJ8G 1TQOA 5DAUA 4HIMA 2CCZA 3D4DA 1ICFB 4TSSA 4DV4L 1B1ZA 4N9PA 1B53A 1E24A 2F3VA 4OL7A 4R4OA 1ASZA 1TR5A 1KD1C 5EPKA 4K6DA 3I70A 2YU9B 5J1ZA 3TP7A 1HNXL 3URYA 3CF5A 4A3KH 3VYSA 1K8GA 3S1NB 2A6HD 2ZTCA 4G4KA 3DWAA 5CV8A 3HOZG 2WB1E 2EJMA 5KGUA 5C3XA 1J6QA 2IX3A 3AMUA 2FMMA 1TWHB 3D3RA 1NY4A 1QJOA 1M90C 4C3IB 2KCNA 1A3VA 3A8JE 1BF4A 5LL6X 1Q3LA 5A35A 5C4ZA 2PNRC 4K2KA 3T13A 1XPOA 4X3SA 1X3FA 4DV7Q 3GTPB 1IHZA 4FF2A 3OMGA 2Z9HA 1JOOA 5D14A 2EXDA 3MXNA 1S5BD 3MTSA 2R61A 1ESFA 3H15A 1N34L 3SK6A 4BBRB 3S17B 1JT8A 2F3WA 2KOLA 2KJXA 1O7ZA 1A15A 1A8VA 1MSGA 1C7YA 5JEAH 1LTID 3S24A 3OWFA 1IBKQ 1OXUA 4A3JB 1GHJA 2O2LD 1U9RA 4K14A 2OQ0A 3O13A 1N8RC 5J39A 1ZKOA 2PO4A 3H6MA 2B63G 4B3RL 3K0YA 1ESRA 4MHEA 5HURA 2VB3X 3S15H 5M5XB 1HA6A 1GUNA 3MVVA 1L1OB 4X62Q 2HDMA 2LSSA 2EOTA 3EJIA 5AFWA 3S1QH 1YHAA 5FK9C 4PMWA 1Q81C 1TWGH 3H3VH 1JE4A 3NP8A 3I73A 2K03A 1MKHA 1VQFA 4RKBA 1J5EQ 3FDTA 1EYDA 2RKSA 4ZRZA 3WOFA 2Z0SA 2E76C 1LTAD 3MZ5A 4LAAA 1DD2A 4GLVB 2JP1A 3I56A 3I72A 3FKIH 1QUQA 3K80C 5J3BA 2WINB 3SXHA 2DNEA 1CI3M 4LFBQ 1SN8A 3D6WA 1LV9A 2GVAA 4XT3B 3PF5A 2R7ZH 2B29A 1PZID 3G6JB 4GKKQ 4KHPL 1JMCA 3UDXA 1PTOH 3BDLA 2JA8G 4O42A 1I94L 1V1OA 5JVG3 4B3TL 3RD4A 2VUMH 2OTLA 1UE5A 4X65Q 4DNRB 3RZDB 4DF7A 4XQNA 3M3YH 3D4RA 2HHHL 5C44G 1ZYRC 1I4XA 1VQCA 2M2LA 4P71A 3UE1A 5FLMH 2AWNA 2SOBA 5CV7A 1PH7A 4GN5A 1AZQA 4CJ0B 3VDYA 1EEFD 1KRTA 4IUPA 5KYLA 3ULLA 1I4PA 4K8IA 1XJVA 3QOLA 2E5LQ 4JC0A 4R4TA 1HXYD 4LF6Q 1D1IA 2NN6H 3A8IE 4PV1C 1H9RA 4YY3L 1S4ZA 3F1ZA 4IFDH 1STHA 1SYEA 5K36H 4LF8Q 1STAA 4QUCA 2E2JH 4DR4Q 5JAVA 2K5HA 4OXPA 1DOLA 1HTLD 2N3SA 4JBJA 1KDBA 1VQLA 1PFSA 1VQOA 4C1NI 3KLWA 1X3EA 3S1RH 2A5HA 1Y8OB 1F77A 2WACA 5I2XA 4G7ZC 1PRTF 5IGEA 2H4OA 2A69C 2HIVA 4GNXA 1TS3A 1Z47A 3TMEA 2EYMA 3FVQA 1EYCA 3CCSA 3NQTA 1I6HH 3KF8A 4HAEA 1T5XD 1WTHA 1EOTA 3K0XA 1Y1VH 1PH5A 5GAEC 3RLFA 1Q82C 5C6AA 3KOJA 1K0SA 1X6OA 1LACA 1SYBA 4KD3A 2XGTA 4WJWA 1E3PA 2P5ZX 3HOWH 1R4QB 2JA7H 4IZ8A 4LF9Q 1YNND 1XNQL 3OHXC 2E2IH 1HJPA 3K7AB 4AYBE 4L63B 1E22A 1EY5A 4WFN3 5C44B 5BR8L 1P8LA 2UXCL 1NE3A 1ILPA 1PZJD 2F4VQ 4JI6Q 2N8NA 1Q46A 4K0KQ 3MXNB 2F0HA 1I3QB 3PV0A 3M85A 3E3XA 1RODA 2VB2X 3S2HB 3EQLC 1PYWD 1PA6A 3SK5A 2UUBL 1YHBA 2N49A 4BA1I 1FGBD 1VQAA 1IW7D 3OOCA 1EFID 2KEEA 1VQNA 3KDFA 3NELA 2N88A 3KBGA 1CUKA 2F0NA 1Q8IA 4MTNA 4F8MA 2NTTA 2F4IA 4JI5Q 1LTBD 3I3CA 2RDFA 1G291 4PQXA 1K0RA 3IFDA 1SAPA 3HZXA 1H9SA 1TWCB 1VQDA 3A0JA 3WOEA 1TS5A 3FP9A 1TKWB 2K14A 3DM3A 2ZJPA 3J81j 2KCMA 3I7FA 4G57A 5C0XI 1IYVA 1RL2A 5DM73 5IYCH 5IP9H 4PZ6A 1L1OC 3UDFA 4ZUJA 3TZUA 3SE0A 2G5DA 3NHHA 5GQOA 1I94Q 1H9MA 1EY7A 5M3FB 4LWCA 1S5FD 4G7HC 4DFAA 2E2DC 3S16B 2KVMA 2Z6BA 4DK1A 2O5JC 2BA1A 4BS9A 1XMOL 2QEJC 3FKIG 1S5ED 2AUKA 1HNWQ 1DOKA 4OIKA 1CHQD 1STGA 2VNUD 3C2PA 2Y0SB 3HOVB 3ND9A 4DV2Q 1EIYB 2R7ZG 2Z4IA 2FFKB 4FVMA 4LJZC 1Y8NB 4YY3Q 3U9OA 3L2PA 5M3MG 5A2QL 4ZCKA 2VUMG 4RGMA 3Q0AA 2BE5C 3KYHC 2YU9H 3DXJC 1KNAA 1S5CD 3S1NH 4C1NK 4JV5L 3MA2B 1QILA 5FLMG 3S1MH 2QW7A 3CXCA 1I4RA 1TWHH 2RF4A 3UDIA 5JJZA 1TU2B 1U4RA 5IGGA 3CCEA 4GOPC 3MXPA 2LKVA 1BNZA 1TY2A 2IWHA 3H0GH 4ILWA 3CMEA 4HIOA 2NN6G 3BDOA 3GTPH 1G8ZD 1JC7A 2IX1A 4LMQD 1SMXA 1V1PA 2F0OA 3S1QB 3DLLA 4A3EB 1K8MA 1SE2A 2Q8TA 2ID0A 3VYUA 1U4PA 4N9TA 2OF1A 3SVMA 2PI2A 3I55A 3FRPB 4BBRH 1GUGA 1UEBA 4GNXB 2HD3A 4DV6L 4A76A 3T1HL 3A7AB 2ZJQA 1HA5A 1JOQA 4UP7A 3QIAA 1K8AC 4IUVA 1PRTB 3FKIB 4JOIA 4JVZA 5LMUL 4FXDA 3KJOA 2UXDQ 4A3JH 3HOYB 1FJGL 1GD7A 1PFMA 5IE8A 1LTRD 5IOCA 4X3UA 1K3RA 3KLSA 5E7NA 5M5XH 3K81C 2F0WA 4ZYSA 3J80L 2F3IA 2R7ZB 3RMHA 1Y1VG 3HFZB 1RD9D 1T9HA 4P74A 1UE7A 5M3MB 2L55A 1WI5A 1RTOA 1SR3A 1R4PB 3HOWG 2NVTB 4DAYA 4EGVA 1S3OA 4LFCQ 4B3SQ 4NXML 4CHTB 1BKBA 3IL8A 3CW2C 3HKZG 1QVFA 1WVLA 1BUVT 2K05A 5BN3A 1BBUA 4DR5L 2DJFC 2CW0C 5IGDA 4BXXH 2IPKD 2F0KA 1M1KC 4Z9CB 2EYHA 1BDOA 4A75A 1HZAA 2F0UA 1RKNA 2MO0A 3VR2A 4HMJA 2K01A 2RSOA 5KEEA 5LL6S 3UE0A 2RDGA 1C4QA 3SHLA 1W3SA 1O7IA 4MN3A 3T53B 1XNRQ 2EJGC 2MQHA 3TREA 2D62A 1SMYC 2H1EA 4X64Q 4K2LA 3RZDH 3EA6A 4AQYQ 1K9MC 3J7A5 4KHZA 2KHJA 3PIPA 4LF7Q 1UNSA 4LF4Q 5ELEA 5C5LA 1NR4A 2WAQE 5D65A 3UI2A 2L15A 5IYCG 1FNVA 4JI4Q 2XRQD 1EY6A 4DV7L 5M5YB 4ZUIA 1S5DD 3L7ZC 3K6OA 5C0XH 5EGTA 1EU4A 5C4JB 1I6HB 2RHQB 4DNTB 1SJHD 2VXWA 2PMZB 1VF5C 4ZK9B 5CV9A 3GTQH 2QDBA 1G51A 1L1OA 4ODGA 1PFBA 1RHPA 1QVCA 3I4LA 5I6WA 3STBD 3HKZB 4BBSB 1EU3A 1KNEA 2JJQA 1G6ZA 1IBKL 5EPLA 3J80c 5D3IB 2ZT9C 4KY7A 5L37A 4BY7H 4TKOB 5D3DA 1L0WA 3MAQA 3AQQA 4DR7L 3U50C 1VQ7A 2L5TA 5T1GA 1PH1A 1BR9A 2WP8J 4R8NA 1NCVA 1O80A 2J7ZA 3CPWA 4X62L 3MC0B 1UE1A 2I0QA 4JK1C 3A74A 1D5XC 4L5QA 1UUPA 1Z9FA 2N55A 3CPFA 1IKLA 5KNBA 1J5EL 2WKDA 3L3OC 3NUCA 2Z6KA 1HHVA 4GKJQ 3K7AH 4X3KA 3GQBA 5C44H 1QG7A 1DYQA 4IUTA 5CV5A 3T4AC 2IW3A 1N33Q 1PH9A 4A3IH 2JE6I 2C9OA 1FJGQ 3P20A 4UP9A 3H0GG 4UAIA 2RHSB 4IN3A 3HEJA 2K5QA 2EE1A 1I3QH 5IYDG 3NE5B 4LFBL 1SSOA 3S2HH 1ZYRD 3NTIA 4A3FH 5G3LD 2OCEA 4IPDA 3F8TA 4GKKL 1EQTA 4DNIA 4E6IA 4U68A 5C3WA 4FXKC 5AJ3Q 3H3VC 2R6GA 1HZ9A 4BBRG 4MTKA 4X65L 1A2UA 3VA5A 1WCMH 2R3ZA 4IUUA 4EQNA 1B7YB 3G6EA 4GNXC 5KRUA 4C2MB 3PQIA 4KJNA 1YBYA 4ALPA 2JYOA 1PLFA 1EY8A 2BA0A 3BDCA 1DONA 1PRTC 2ES2A 4JI7Q 4IQZA 4XTCS 3F2UA 1SXTA 3EN2A 3MFYA 3SDZA 2XTIA 5IGCA 2K5WA 1M8AA 4QGUA 2E5LL 2VS1A 2PQAB 3TBIB 2DY7A 1BCPD 2A74C 4LF6L 4DAVA 1SNCA 4QIWE 3JC66 1W2BA
chains in the Genus database with same CATH topology
1PTOC 1ICWA 2HDLA 2A69D 2F0MA 4FNFA 1GUWA 1VCIA 2D2CC 3VYRA 1NSNS 3L9AX 5I6YA 2OT2A 3BVGA 2ICEC 1R9TB 3S1MB 2RQXA 3QB3A 5C3EB 3J7AF 1EL0A 2NZ1D 3G7LA 3K5OA 3HP3A 1ONLA 1GOZA 3H0GB 3LWEA 1QWYA 5JOBA 2G9DA 3HS0C 5CV6A 3IFTA 1B9MA 1ZEQX 3GTKB 4K5XA 5I4DA 2J4XA 1L0YB 5KNDA 1QB5D 1PXUA 3QOJA 1SYCA 2G9HD 2ZXOA 5LHY1 3I4MB 3MXUA 5COYA 1CTMA 1E0BA 1QOHA 3PIP3 2EZVA 1IKMA 1HQMC 4WORA 2L0CA 3RUZA 2WB1B 5C0XG 2L12A 2L4NA 2AWOA 1HFGA 5NUCA 1JCKB 1TT2A 1OXVA 4FXGC 3U9SA 3Q24A 2F0IA 2F0SA 1Q12A 4JBWA 3KUPA 2IJ0A 4OGQC 4ZQ3A 2F0QA 3R8BA 5I9OA 2F1MA 3H91A 1MBYA 3H09A 2XRSD 1Z7TA 2CVRA 1VMPA 2F0JA 4B9XA 3SR1A 2B8GA 3V05A 4DA2A 4HMIA 2EY6A 5M9OA 1JR0D 1XTCD 1AP0A 1CT1D 3V96A 4FYDA 1CZWA 5JVH3 5C4HA 1Y69U 1SJED 2QKIC 3R2IA 2MP1A 5HGTA 2R93B 2NVYB 1WTRA 1DM0B 3JAML 2FHTA 1CZGA 4XIGS 1EIGA 4BY1B 3EROA 5IGBA 1O7YA 3J81L 2K28A 1AEXA 2K04A 1H9KA 3GTQB 3I90A 4CJ2C 1F9SA 5EKLA 2D9UA 2LFNA 4ZAIA 2CQAA 1Q1BA 2MPMA 3GP7A 4BY7B 2AUJD 1C8CA 2Q8RE 2NUCA 4MIUA 1EIHA 1CHPD 1LABA 3GTLB 5ELDA 5EQ0A 5E4XA 1EY9A 2J0TD 1E2VA 1SNQA 3NBIA 3PO3B 4A3IB 2GA4B 1JQYD 2B2VA 4A3FB 3QWNA 2CW0D 4RHSA 1OXXK 1UAPA 3OMCA 3PIO3 4DN4M 1XWEA 1WCMB 2TMPA 1AW7A 1RF2D 4ME5A 2F0TA 1GUSA 3A55A 3QG1A 2A68C 3GO5A 3E5SA 1SDFA 3H94A 3GV3A 1FYCA 1SMYD 3CU7A 2LMCB 4AYBB 3HOXB 1HUMA 3K58A 1LT5D 1X3PA 2PCFB 4CBVA 1HUNA 2I07B 1QCBD 3OW7A 1KDAA 4RCNA 1DCZA 1JB3A 1QNUA 2JA5B 3MEHA 2PW7A 1GXDC 2F0EA 1Y1WB 2KA7A 4YIJA 1GHKA 1EWHA 4NDXA 3T51B 3CRLC 4PMCA 2R92B 1NUCA 2LY7A 2F0PA 1IL8A 2B2TA 1OXTA 2M9VA 1SFOB 2MGSA 1V43A 2QILA 3OIQA 2B39A 2B2UA 3J7AV 4RWSC 2NB0A 3HRZC 5IT9L 2SEBD 3M4OB 3A7LA 1RDPD 1WTPA 5TSSA 1JWMD 2EYPA 3ONAB 1KLGD 3NWTA 3VR4A 2QF7A 2EYJA 2NVXB 4P2CB 4FP5D 1WD1A 1LLRD 5FO9B 4FF3A 4TRDA 5IIFA 1E2ZA 2YYZA 2RDHA 5CGKA 4HSVA 2V4DA 1F2YA 2RSNA 2IT1A 3Q23A 4ZLTF 2JA6B 2B2WA 2F0GA 3IAYA 5M5WB 3VR5A 3OSOA 1K83B 3GD7A 4J1MA 4KN4C 3HOUB 1F2LA 4HEDA 3I91A 2KHSA 3N6RA 4XDXA 2LS01 1AFPA 3S14B 4BA2I 3K59A 2XVSA 3MHBA 4C3HB 1ML0D 1TWAB 5J22A 3DHQA 1BCPF 4RKLA 1Z6HA 4GZYC 2X6GA 3I4NB 1PTOD 1PZKD 1CFMA 2AQ3B 4IUQA 4XQJA 1SEBD 1FR3A 3J81E 1ILQA 4ID6A 1EQVA 1FNUA 4NP5A 1I4QA 2ICIA 2NTSA 1SYGA 1SNMA 1B3AA 5DEHA 1LTTD 4ZKCB 3DWPA 1EZ8A 3AB9A 1B2TA 3GTGB 2B2YA 2DY8A 1M4VA 1WTQA 1Q1EA 4KHVA 4EVOA 5ELFA 4KJOA 1NR2A 1SBBB 2JSOA 2E74C 3D31A 3Q6SA 1TVXA 2PQEA 2Z1CA 4RA8A 1EY4A 4CKBA 1BXTA 2D5DA 4HR7B 3QO2A 1G2SA 1Y8PB 2F0DA 2DNCA 1VDZA 4OO1G 4HN7A 2WAQB 1DXMA 1CM9A 2KQ3A 2M00A 2EY5A 1II3A 5DNFA 3R3OA 5EJWA 2E2HB 5ELCA 3D8GA 2PYKA 3DMUA 1ENAA 5IODA 1JOKA 1Q90A 1JWSD 1STYA 4KY5A 3NK9A 2A6EC 4H7BA 5EKKA 1F2MA 1V8QA 3PO2B 2O4XA 3W2DA 2MHVA 3BVZA 2QCPX 2XSCA 1KLUD 4RHRA 2E75C 1JICA 3V2TA 4HSPA 4PMBA 1RTNA 4NMZA 4V190 5C4XB 2EYLA 5FLXL 1HFNA 4L6TB 4QUFA 1CQFA 4K8JA 3ITPA 4ZKBB 4I65A 4H13C 5A2QE 2EJFC 1OXSC 2X6LA 3TP6A 3X3MA 3FEWX 3IKJA 2K7VA 4IURA 4DXGA 1CQVA 2PZUA 4KKSA 2RBMA 4A93B 5IT9E 1BCPB 3Q22A 4A3DB 5CBAE 2K5DA 2F03A 3CHBD 1H9JA 1D5ZC 2XNAC 1SNDA 3E6ZX 1I50B 1HCZA 4RFBA 2B2VC 1HRJA 4KTAA 3FMCA 1BBXC 2OEOA 1WTOA 1B4OA 4KY6A 4QB4A 2NWGA 1LT4D 1CK1A 4J6HA 1SYFA 3K5LA 1NAPA 5CV4A 4QIWB 1F9PA 3NSWA 3J80E 4XQQA 2L9HA 1SNOA 4EQOA 1D6EC 4OHJA 3SEBA 4A3MB 3M7NA 1TWFB 1LTSD 2A68D 4RCOA 2PPBC 1E2WA 2EDGA 5JEAJ 4O1NA 4HCSA 1A2TA 4KKUA 1PMRA 3NWSA 3NBHA 1GUOA 3D4WA 1L0XB 3NTHA 1TS2A 3MXGA 4R9WA 3KLRA 3ERQA 1F9RA 4A3BB 4IALA 4K6LA 2B2TC 4DU9A 4OO1I 1LT3D 2K33A 2K1BA 3CRKC 3J7YW 2PZTA 3EFXD 2JEBI 3VYTA 2AQ2B 2B2UC 3RZOB 3HOZB 2CHBD 4CKEA 3N52A 5BN5A 2HQEA 1I4HA 1YNJC 3BYTB 1ENCA 4QMGA 3S2DB 1FNWA 3R2TA 3TN2A 2PW5A 4C3JG 3NXWA 5EBCA 2BE5D 1ET6A 1KAAA 2A73B 3DEOA 3EVQA 1O7LA 2BCOA 1SE3A 1W6KA 3LWUA 3K5NA 3K5MA 3SK8A 4KK7A 4UDUC 4RH6A 3TDQA 3GTOB 3M4YA 2B2WC 1JORA 2Z4HA 2JEAI 1U4LA 3DWQA 4F87A 5CORA 3E0JA 2B63B 2EYFA 1PDQA 5EKIA 4IFDJ 3PUWA 2ENBA 4M8AA 4EQPA 3BS1A 3S9WA 3ZYYX 3LX0A 1UEAB 2O5IC 1TS4A 2WV6D 3OIPA 1BCPC 3D6CA 1HTPA 1TIID 4K5VA 2XWBB 2BOSA 3X3NA 5KNCA 1JWUD 1STNA 1ENFA 2KECA 2TSSA 2A6HC 3LNNA 1VMCA 2RA4A 1LO5D 2FJ2A 1LTGD 1X3QA 4C3JB 1F2ZA 3A8KE 4A3GB 1PTOF 5FLXE 2JA8B 3CKIB 1VF7A 4XYQA 2SNMA 5EPJA 2X69A 4FO2A 4RGNA 3A54A 1ZXTA 2EYOA 1X32A 1PFNA 3DEPA 3PMFA 2B2YC 1OO9B 1STBA 4KI0A 2ZXPA 1HQRD 3BVMA 1MGSA 2EPBA 4FF4A 2NVQB 5F2DA 3GTMB 3OPOA 5FOBB 1J8IA 2KUMA 3T16A 3KLSX 5ELBA 1O78A 5JEAG 4XT1B 3HGBA 3DM1A 2IX0A 4B9WA 5E3FA 5JPMC 1WTVA 2C5CA 2Q8IB 3T56B 3TZDA 1MD2D 1TY0A 3CQZB 3C1EA 4CJ1B 3VR3A 5CR3A 3W3AA 4NKLA 2F0VA 2SDFA 1B50A 3TP5A 3MWYW 1CA5A 2AQ1B 4KKTA 4C3HG 3M7GA 3A56A 1I6VC 2K32A 4XYOA 4A3KB 4OO1H 3ND8A 1SE4A 3BYYB 1W6JA 2I46A 3BG3A 1C48A 5FKAC 1LT6D 1XX8A 3PUZA 4DAPA 1EYAA 3OWEB 3FPUB 3BZDB 1I4GA 1BQQT 5CMDA 4FF1A 2A6ED 4RGTA 3DUZA 1BO0A 4Q0FA 1A6XA 4S3SA 2Z8LA 4WRDA 5G3LF 5CBEE 2MUYA 3PUYA 5FO8B 1DZ1A 1AN8A 3S15B 2EY2A 4M1UB 1HPCA 2SNSA 2NYZD 4KMUC 4IFDG 1WD0A 5K36G 4QF4A 1U4MA 4G7OC 1DJRD 1F9QA 1TWGB 3QJYA 2PZWA 4KD4A 1PRTD 2FMCA 1J9OA 5IGFA 1ET9A 1T5EA 1G2TA 4L8JA 1AZPA 2XN9C 1D1KA 3JAME 3NTKA 1G91A 1YNNC 2MJ8A 5T1IA 2DN8A 1PTOB 4KV6A 4F88A 2VUMB 1K8OA 2IL8A 1KTKA 4CKCA 3M3YB 3PUVA 4H0LC 5DM63 1WTWA 1B44D 1WTXA 1IW7C 5I9PA 3AU7A 1B9NA 4DK0A 5C5MA 4H44C 4X3TA 1KDCA 3FPPA 1STEA 2EXZA 1FD7D 5E4WC 3C3LA 1D2BA 1GJXA 4V0BA 2KEDA 3VR6A 1H9SB 2E2JB 4QCLA 3P1HA 5KIXA 5I2YA 1QNKA 4PNYA 3R93A 1CA6A 4XXEA 3NPPA 1KABA 4NW2A 5K5PA 1EWCA 4TQUS 4I7ZC 4C56C 3S1RB 2OXPA 1DOMA 4ABNA 2RVLA 4Q5VA 4ULLA 5FO7B 1XYIA 5C0XJ 1EZ6A 4F7XA 2WIIB 4CGYB 4RAUC 4J8QA 4BWGB 2L11A 1Y1VB 4K5WA 3MFGA 1QE6A 3GV6A 2HUGA 3HOWB 3WDNA 2JA7B 2F0LA 3HG9A 2E2IB 2BDNA 5KYIA 1RJTA 2HCCA 2F0FA 1A3UA 3NQIA 1IYUA 4U673 4RGOS 3P75A 4DGZA 2XIWA 3KBXA 2NBFA 4HCEA 5EBDA 1MI2A 3PUXA 3GTJB 1YNJD 2KCCA 5CYUA 2EVBA 1MSHA 1SYDA 5CC4A 3K57A 3C1FA 1GUTA 5ISRA 4R8IA 3I8ZA 3C46A 2HCIA 4C3IG 2WKCA 1V1PB 1EEID 4KN7C 2NN6I 2B8FA 1SNPA 4IFDI 2JXMB 2L1BA 2ZXRA 3TP8A 2XWJB 5JPNC 3VA7A 3TSSA 1BOSA 3KK7A 1A3TA 5E1FA 4IUNA 3P7JA 3SK4A 1EY0A 4HTHA 4OIJA 5BN4A 2EY1A 2BDOA 1D5MC 1XXGA 4B08A 2FINB 4LK1C 4DXFA 4Y7NB 2K6AA 1RCVD 1TQOA 5DAUA 3D4DA 4TSSA 1B1ZA 4N9PA 1B53A 2F3VA 4OL7A 1TR5A 5EPKA 4K6DA 3I70A 2YU9B 5J1ZA 3TP7A 3URYA 3VYSA 3S1NB 2A6HD 4G4KA 3DWAA 5CV8A 2EJMA 5KGUA 5C3XA 2IX3A 3AMUA 2FMMA 1TWHB 3D3RA 1QJOA 4C3IB 2KCNA 1A3VA 3A8JE 1BF4A 5LL6X 1Q3LA 5A35A 5C4ZA 2PNRC 4K2KA 3T13A 4X3SA 3GTPB 1IHZA 4FF2A 3OMGA 1JOOA 5D14A 3MXNA 1S5BD 3MTSA 2R61A 1ESFA 3SK6A 4BBRB 3S17B 2F3WA 2KOLA 2KJXA 1O7ZA 1A15A 1MSGA 5JEAH 1LTID 3OWFA 1OXUA 4A3JB 1GHJA 2O2LD 1U9RA 4K14A 3O13A 5J39A 1ZKOA 2PO4A 3H6MA 3K0YA 1ESRA 5HURA 4MHEA 2VB3X 5M5XB 1HA6A 1GUNA 3MVVA 2HDMA 3EJIA 2EOTA 5AFWA 5FK9C 4PMWA 1JE4A 3NP8A 3I73A 2K03A 4RKBA 3FDTA 1EYDA 2RKSA 4ZRZA 3WOFA 2E76C 1LTAD 3MZ5A 4LAAA 1DD2A 2JP1A 3I72A 2WINB 3SXHA 2DNEA 1CI3M 3D6WA 1LV9A 4XT3B 1PZID 3G6JB 1PTOH 3BDLA 4O42A 1V1OA 5JVG3 3RD4A 4DNRB 3RZDB 4DF7A 4XQNA 3D4RA 1ZYRC 1I4XA 2M2LA 2AWNA 2SOBA 5CV7A 1AZQA 4CJ0B 1EEFD 4IUPA 5KYLA 1I4PA 4K8IA 3QOLA 1HXYD 1D1IA 2NN6H 3A8IE 4PV1C 1H9RA 1S4ZA 4IFDH 1STHA 1SYEA 5K36H 1STAA 4QUCA 5JAVA 1DOLA 1HTLD 1KDBA 4C1NI 2A5HA 1Y8OB 1F77A 2WACA 5I2XA 4G7ZC 1PRTF 5IGEA 2H4OA 2A69C 1TS3A 1Z47A 3TMEA 2EYMA 3FVQA 1EYCA 3NQTA 3KF8A 4HAEA 1T5XD 1EOTA 3RLFA 5C6AA 4KD3A 1LACA 1SYBA 4WJWA 1R4QB 4IZ8A 1YNND 3OHXC 3K7AB 4L63B 1EY5A 4WFN3 5C44B 1ILPA 1PZJD 2F0HA 1I3QB 3PV0A 3M85A 1RODA 2VB2X 3S2HB 3EQLC 1PYWD 3SK5A 4BA1I 1FGBD 1IW7D 3OOCA 1EFID 2KEEA 2N88A 3KBGA 2F0NA 1Q8IA 4F8MA 2NTTA 2F4IA 1LTBD 3I3CA 2RDFA 1G291 4PQXA 3IFDA 1SAPA 3HZXA 1H9SA 1TWCB 3WOEA 1TS5A 1TKWB 4G57A 5C0XI 1IYVA 5DM73 4ZUJA 3TZUA 3SE0A 3NHHA 1H9MA 1EY7A 5M3FB 1S5FD 4G7HC 4DFAA 2E2DC 3S16B 2KVMA 4DK1A 2O5JC 2BA1A 4BS9A 2QEJC 1S5ED 2AUKA 1DOKA 4OIKA 1CHQD 1STGA 2VNUD 3C2PA 2Y0SB 3HOVB 3ND9A 2Z4IA 2FFKB 4FVMA 4LJZC 1Y8NB 3U9OA 5A2QL 4RGMA 3Q0AA 2BE5C 3DXJC 1KNAA 1S5CD 4C1NK 3MA2B 1QILA 1I4RA 5JJZA 1TU2B 1U4RA 5IGGA 3MXPA 2LKVA 1BNZA 1TY2A 2IWHA 4ILWA 2NN6G 3BDOA 1G8ZD 1JC7A 2IX1A 4LMQD 1V1PA 2F0OA 3S1QB 4A3EB 1K8MA 1SE2A 2Q8TA 2ID0A 3VYUA 1U4PA 4N9TA 2OF1A 3SVMA 3FRPB 1GUGA 3A7AB 1HA5A 1JOQA 3QIAA 4IUVA 1PRTB 3FKIB 4FXDA 3HOYB 1PFMA 1LTRD 5IOCA 4X3UA 3KLSA 2F0WA 4ZYSA 3J80L 2R7ZB 3RMHA 1RD9D 5M3MB 2L55A 1RTOA 1R4PB 2NVTB 4DAYA 4EGVA 4CHTB 3IL8A 1WVLA 1BUVT 2K05A 5BN3A 2CW0C 5IGDA 2IPKD 2F0KA 4Z9CB 2EYHA 1BDOA 2F0UA 1RKNA 3VR2A 4HMJA 2K01A 2RSOA 5KEEA 5LL6S 2RDGA 1C4QA 3SHLA 4MN3A 3T53B 2EJGC 2D62A 1SMYC 2H1EA 4K2LA 3EA6A 4KHZA 1UNSA 5ELEA 5C5LA 1NR4A 5D65A 3UI2A 1FNVA 2XRQD 1EY6A 5M5YB 4ZUIA 1S5DD 3L7ZC 3K6OA 5C0XH 5EGTA 1EU4A 5C4JB 1I6HB 4DNTB 1SJHD 2VXWA 2PMZB 1VF5C 4ZK9B 5CV9A 2QDBA 4ODGA 1PFBA 1RHPA 3I4LA 5I6WA 3HKZB 4BBSB 1EU3A 1KNEA 1G6ZA 5EPLA 5D3IB 2ZT9C 4KY7A 4TKOB 5D3DA 3MAQA 2L5TA 5T1GA 1BR9A 2WP8J 4R8NA 1NCVA 1O80A 2J7ZA 3MC0B 4JK1C 1D5XC 1UUPA 2N55A 1IKLA 5KNBA 2WKDA 3L3OC 3NUCA 1HHVA 4X3KA 3GQBA 1QG7A 1DYQA 4IUTA 5CV5A 3T4AC 2IW3A 2JE6I 2C9OA 3P20A 4UAIA 4IN3A 3HEJA 2K5QA 2EE1A 3NE5B 1SSOA 1ZYRD 3NTIA 5G3LD 1EQTA 5C3WA 4E6IA 4U68A 4FXKC 3H3VC 2R6GA 1A2UA 3VA5A 2R3ZA 4IUUA 4EQNA 5KRUA 4C2MB 4KJNA 2JYOA 1PLFA 1EY8A 2BA0A 3BDCA 1DONA 1PRTC 4IQZA 4XTCS 3F2UA 1SXTA 3MFYA 3SDZA 5IGCA 2K5WA 1M8AA 3TBIB 2DY7A 1BCPD 2A74C 4DAVA 1SNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQY D;  1PTO C;  1BCP C;  4L6T B;  1EEF D;  1TS5 A;  5TSS A;  1JWM D;  2XRS D;  1KLG D;  1HA5 A;  1I4P A;  1M4V A;  1KTK A;  1SE4 A;  1L0X B;  1PRT B;  3BYY B;  1HXY D;  1TS2 A;  4RHS A;  3V05 A;  1EU3 A;  1LTR D;  1S5B D;  3BVG A;  5D3I B;  1B44 D;  1LLR D;  2R61 A;  1ESF A;  1JR0 D;  1ENF A;  1JWU D;  1CT1 D;  1XTC D;  2TSS A;  5ELF A;  5D3D A;  1SBB B;  4K6L A;  5FKA C;  1AW7 A;  1LT6 D;  1LT3 D;  1RF2 D;  1LO5 D;  4ZYS A;  4DXG A;  1CQV A;  1LTG D;  2RDH A;  1RD9 D;  3OWE B;  1HTL D;  1LTI D;  1V1P B;  1EEI D;  1S5F D;  3BZD B;  1I4G A;  1GOZ A;  1BCP B;  3MC0 B;  3EFX D;  1PTO F;  1STE A;  1SJE D;  1FD7 D;  3R2I A;  2O2L D;  2AQ2 B;  1D5X C;  3O13 A;  3CHB D;  1UUP A;  1F77 A;  2QEJ C;  1BXT A;  1D5Z C;  1S5E D;  2XNA C;  4RGN A;  1PRT F;  2CHB D;  4RGT A;  1CHQ D;  4RFB A;  1TS3 A;  5I4D A;  2J4X A;  1L0Y B;  1I4H A;  2G9H D;  2IPK D;  1LT5 D;  4Z9C B;  3TSS A;  5FK9 C;  2Z8L A;  3BYT B;  1FNW A;  1EWC A;  3R2T A;  1DYQ A;  4C56 C;  1T5X D;  1HQR D;  3BVM A;  1ET6 A;  1BCP F;  1LT4 D;  1CK1 A;  1AN8 A;  1SE3 A;  1D5M C;  1LTA D;  2RDG A;  4RGM A;  5ELC A;  1XXG A;  3GP7 A;  4UDU C;  4RH6 A;  4DXF A;  1S5C D;  4L63 B;  1DJR D;  1JWS D;  1RCV D;  3KLS X;  1PTO D;  5ELB A;  1CHP D;  1PZK D;  1QIL A;  3EA6 A;  2AQ3 B;  4BWG B;  4TSS A;  3MFG A;  1SEB D;  1I4R A;  1PZJ D;  1JCK B;  3DWQ A;  1B1Z A;  5ELD A;  1UNS A;  1PRT D;  3W2D A;  5ELE A;  1PZI D;  1FNU A;  1PYW D;  1TY2 A;  3BVZ A;  1D6E C;  1PTO H;  1I4Q A;  3URY A;  1FGB D;  1ET9 A;  1KLU D;  1PRT C;  1FNV A;  1V1O A;  1MD2 D;  2ICI A;  1TY0 A;  1EFI D;  2NTS A;  4OHJ A;  1SXT A;  3DWA A;  2XRQ D;  4RHR A;  1G8Z D;  2XN9 C;  2IJ0 A;  3SEB A;  1V1P A;  1S5D D;  2QIL A;  1LTS D;  1SE2 A;  1EU4 A;  3R8B A;  2NTT A;  1I4X A;  4RCO A;  1LTT D;  1BCP D;  1LTB D;  1SJH D;  4O1N A;  3DWP A;  2SEB D;  1TS4 A;  2AQ1 B;  2WV6 D;  1RDP D;  1PTO B;  4RGO S; 
#chains in the Genus database with same CATH topology
 1PTO C;  1ICW A;  2HDL A;  2A69 D;  4LF8 L;  1DGS A;  4DR4 L;  2F0M A;  5M3F H;  4FNF A;  1GUW A;  1VCI A;  4JI3 Q;  2D2C C;  4OON A;  3VYR A;  3S16 H;  1NSN S;  3L9A X;  5I6Y A;  2OT2 A;  4BXX G;  3BVG A;  2ICE C;  1IZ6 A;  4DV1 Q;  1R9T B;  3S1M B;  1VQH A;  3FHW A;  2RQX A;  1XMQ Q;  3QB3 A;  5C3E B;  3J7A F;  1EL0 A;  1Q86 C;  2NZ1 D;  3G7L A;  3K5O A;  3HP3 A;  1ONL A;  1GOZ A;  3H0G B;  3LWE A;  1QWY A;  4CDF C;  3OW2 A;  3HOV H;  5JOB A;  2G9D A;  3HS0 C;  5CV6 A;  3IFT A;  1B9M A;  2K4K A;  1ZEQ X;  3PIO A;  3GTK B;  4K5X A;  5I4D A;  2J4X A;  1EFW A;  1L0Y B;  5KND A;  1QB5 D;  1PXU A;  3QOJ A;  3CC2 A;  4L5S A;  1SYC A;  2G9H D;  2ZXO A;  5LHY 1;  3I4M B;  3MXU A;  5COY A;  1CTM A;  1E0B A;  2Q2U A;  1QOH A;  4LF9 L;  3PIP 3;  4J15 A;  2EZV A;  1IKM A;  1JJC B;  1HQM C;  4OWT B;  4JI2 Q;  4WOR A;  2IHE A;  2L0C A;  2F4V L;  4JI6 L;  3RUZ A;  2WB1 B;  4K0K L;  4DR7 Q;  3IRB A;  5C0X G;  2L12 A;  3G71 A;  2H5X A;  2L4N A;  3CC4 A;  3M4P A;  2AWO A;  1HFG A;  1Y14 B;  5NUC A;  5IP7 H;  2QDL A;  4YWK A;  4A3E H;  1JCK B;  1TT2 A;  3I4O A;  1OXV A;  4FXG C;  3U9S A;  3Q24 A;  1PH8 A;  4DK3 C;  5DLQ E;  4JI5 L;  2F0I A;  2F0S A;  1VQJ A;  1Q12 A;  4JBW A;  3ICE A;  3KUP A;  2CQO A;  2ASB A;  2HIX A;  2IJ0 A;  4OGQ C;  1K83 H;  4BY7 G;  4ZQ3 A;  4X66 Q;  4AIM A;  2F0Q A;  3HOY H;  3R8B A;  2C35 B;  5I9O A;  2UXB Q;  2F1M A;  3S14 H;  3H91 A;  3PCO B;  1PVO A;  2IHF A;  1MBY A;  3H09 A;  2XRS D;  3I2Z A;  1Z7T A;  2CVR A;  1VMP A;  2F0J A;  4B9X A;  3SR1 A;  2B8G A;  5M3M H;  3V05 A;  4DA2 A;  2NVT H;  4HMI A;  1EOV A;  2EY6 A;  5M9O A;  1JR0 D;  1XTC D;  1AP0 A;  1CT1 D;  3V96 A;  4FYD A;  1CZW A;  1BVS A;  2KEN A;  4A3I G;  1HNW L;  1N32 Q;  3D0F A;  5JVH 3;  5C4H A;  1Y69 U;  1HR0 W;  1SJE D;  2QKI C;  3R2I A;  2MP1 A;  4YCV A;  5HGT A;  2R93 B;  4A3F G;  4DV2 L;  2NVY B;  1WTR A;  1EYG A;  1DM0 B;  4PG3 A;  3JAM L;  2FHT A;  4I7A A;  1CZG A;  4XIG S;  3M9B A;  1PHJ A;  1EIG A;  2K5V A;  1KHI A;  4BY1 B;  3ERO A;  5IGB A;  4CDE C;  1O7Y A;  1WCM G;  3J81 L;  4JOI C;  2K28 A;  1AEX A;  2K04 A;  1H9K A;  3GTQ B;  1VQ9 A;  3I90 A;  2VQE Q;  4CJ2 C;  1KAW A;  1F9S A;  1NJI C;  5EKL A;  2D9U A;  2LFN A;  3GTG H;  1EQR A;  4ZAI A;  2CQA A;  1Q1B A;  2MPM A;  5LMN W;  3GP7 A;  4BY7 B;  4AYB G;  2AUJ D;  1C8C A;  2Q8R E;  2NUC A;  3AFP A;  4MIU A;  1EIH A;  1CHP D;  1LAB A;  5M5Y H;  3E0E A;  3GTL B;  5C4J H;  5ELD A;  5EQ0 A;  3E9I A;  5M3F G;  2AHO B;  5E4X A;  1EY9 A;  2J0T D;  1E2V A;  1I5F A;  1Y1W G;  4GS3 A;  1PYB A;  2KBN A;  1SNQ A;  4BBS H;  3NBI A;  3PO3 B;  2Y0S G;  2UXD L;  4A3I B;  2NZH A;  2GA4 B;  3HOV G;  1CKN B;  1JQY D;  4JI1 Q;  2B2V A;  3B6Y A;  3ER0 A;  1C0A A;  4A3F B;  3QWN A;  1E1O A;  4L5R C;  2CW0 D;  3WWV A;  4RHS A;  1OXX K;  4TVA B;  1HR0 Q;  1UAP A;  3OMC A;  2CWA A;  4A3L H;  3PIO 3;  1LYL A;  4LFA Q;  1XWE A;  1IXR A;  4DN4 M;  4LFC L;  4B3S L;  1WCM B;  3F2C A;  2TMP A;  4IPC A;  1AW7 A;  1RF2 D;  4P73 A;  3CCL A;  1RIP A;  4ME5 A;  2YTY A;  4DPG A;  2F0T A;  1GUS A;  3A55 A;  3QG1 A;  1HNZ Q;  2A68 C;  4EX5 A;  3GO5 A;  1KXL A;  3E5S A;  4IPH A;  4EQ5 A;  1SDF A;  3H94 A;  3GV3 A;  1FYC A;  1SMY D;  3CU7 A;  2LMC B;  1A63 A;  3F2B A;  4POG A;  5ELO A;  2JA9 A;  3OYY A;  4R4C A;  3RN2 A;  2KCT A;  4AYB B;  3NBH B;  3J81 c;  3HOX B;  5IP7 G;  4DR3 Q;  1HUM A;  3K58 A;  4A3E G;  1LT5 D;  1X3P A;  2PCF B;  1K3B C;  4CBV A;  3KJP A;  5LMN Q;  1HUN A;  3KFU A;  2I07 B;  1XNR L;  1QCB D;  3OW7 A;  1KDA A;  4RCN A;  4HIK A;  1A0I A;  1LM0 A;  1DCZ A;  1JB3 A;  1QNU A;  5IWA Q;  2JA5 B;  3MEH A;  4X64 L;  4OX9 Q;  2PW7 A;  1GXD C;  4UHV A;  4AQY L;  4YCW A;  2F0E A;  4C2M H;  1Y1W B;  2KA7 A;  4LF7 L;  4YIJ A;  4LF4 L;  1GHK A;  2D0P A;  1EWH A;  2GN5 A;  4NDX A;  3T51 B;  3HOY G;  3CRL C;  1YJ9 A;  2EIF A;  4DV0 Q;  3ULP A;  4PMC A;  2R92 B;  3CMA A;  4OEL B;  1NUC A;  4JI4 L;  2R7F A;  3A5U A;  2WFW A;  2HT1 A;  2LY7 A;  2RCF A;  3BJU A;  2F0P A;  1IL8 A;  2Z6K C;  4GN4 B;  2B2T A;  1OXT A;  1V1Q A;  2M9V A;  2MFI A;  1SFO B;  2MGS A;  2UUA Q;  1V43 A;  1E1T A;  2QIL A;  2BH8 A;  4HID A;  3OIQ A;  2B39 A;  2B2U A;  3J7A V;  4RWS C;  1R9T H;  2NB0 A;  3HRZ C;  3BU2 A;  5IT9 L;  2SEB D;  2YTX A;  3M4O B;  5C3E H;  1WOC A;  1RDP D;  3A7L A;  3F2D A;  1WTP A;  5TSS A;  1JWM D;  1CKO A;  2EYP A;  1SE8 A;  3ONA B;  1KLG D;  3NWT A;  3VR4 A;  2QF7 A;  3T1Y Q;  2EYJ A;  1IYJ B;  2NVX B;  4P2C B;  4FP5 D;  3UDG A;  5IYD H;  1WD1 A;  1LLR D;  5FO9 B;  4GLX A;  1YEZ A;  4FF3 A;  4TRD A;  3GTK H;  5IIF A;  4UY8 C;  1E2Z A;  2YYZ A;  2RDH A;  4HSV A;  5CGK A;  2V4D A;  1OTC A;  3I4M H;  3ZJY C;  4MNO A;  1F2Y A;  2RSN A;  2IT1 A;  4JBK A;  3Q23 A;  4ZLT F;  2JA6 B;  2B2W A;  2F0G A;  4DAM A;  4GKJ L;  3IAY A;  4DR1 Q;  5M5W B;  3VR5 A;  3OSO A;  1K83 B;  1N33 L;  3GD7 A;  4J1M A;  4KN4 C;  4DV5 Q;  3HOU B;  1F2L A;  2JN4 A;  4HED A;  3I91 A;  2KHS A;  3N6R A;  4XDX A;  4HJ5 A;  2LS0 1;  1AFP A;  4B3M Q;  3S14 B;  4BA2 I;  3K59 A;  2XVS A;  3MHB A;  4C3H B;  1ML0 D;  1TWA B;  5J22 A;  1PH4 A;  3DHQ A;  3K7U C;  1U5K A;  2YV5 A;  1BCP F;  5AJ3 L;  4RKL A;  4JG2 A;  1Z6H A;  2PQA A;  5HY6 A;  4LNQ A;  2VQF Q;  4AH6 A;  1IBM Q;  4L5T A;  4BBS G;  4GZY C;  2EQS A;  2X6G A;  3I4N B;  1PTO D;  1PZK D;  1CFM A;  2AQ3 B;  4JI7 L;  4IUQ A;  4XQJ A;  2R7D A;  4A4I A;  1YJW A;  1SEB D;  1AH9 A;  2VL6 A;  1FR3 A;  3J81 E;  1ILQ A;  4ID6 A;  1EQV A;  1FNU A;  4LUO A;  1X55 A;  4NP5 A;  2ZM6 Q;  1I4Q A;  2ICI A;  2NTS A;  1SYG A;  1FGU A;  4A3L G;  1JJG A;  1YJN A;  4PZ8 A;  1SNM A;  5IT9 c;  2UU9 Q;  1B3A A;  5DEH A;  1D7Q A;  1LTT D;  1KL9 A;  4ZKC B;  3TRZ A;  4JI3 L;  4GLA C;  3DWP A;  4OWX B;  4A3C H;  1EUJ A;  1GO3 E;  4O2D A;  4JI0 Q;  3RLN A;  4DV1 L;  1EZ8 A;  1LUZ A;  3AB9 A;  1B2T A;  1XMQ L;  3GTG B;  1KRS A;  4P72 A;  2OTJ A;  2B2Y A;  2DY8 A;  1M4V A;  1WTQ A;  1Q1E A;  4KHV A;  4DUY Q;  2R93 H;  1VQB A;  2NVY H;  1B70 B;  4EVO A;  5ELF A;  4KJO A;  1NR2 A;  1SBB B;  2JSO A;  2E74 C;  3D31 A;  3ERS X;  3Q6S A;  1TVX A;  5C4X G;  1TXY A;  4BY1 H;  1VQ6 A;  4DV3 Q;  2PQE A;  1E7Z A;  2Z1C A;  4RA8 A;  1EY4 A;  4CKB A;  1BXT A;  2D5D A;  1HZB A;  4HR7 B;  1GM5 A;  1N36 Q;  3QO2 A;  3OTO Q;  2UUC Q;  1IBL Q;  2B3G A;  1GVP A;  4JI2 L;  1G2S A;  2ALY B;  1Y8P B;  2F0D A;  2E8G A;  2DNC A;  1VDZ A;  4WJ4 A;  4OO1 G;  4HN7 A;  1VQK A;  2WAQ B;  2MNA A;  3GTL H;  1DXM A;  1CM9 A;  2KQ3 A;  2M00 A;  2EY5 A;  1II3 A;  5DNF A;  3R3O A;  5EJW A;  5HGQ A;  2E2H B;  2PI2 E;  5ELC A;  3D8G A;  2PYK A;  3DMU A;  2NZO A;  2VY3 A;  4P75 A;  1ENA A;  5IOD A;  1JOK A;  1Q90 A;  1JWS D;  1STY A;  2A1A A;  4KY5 A;  3NK9 A;  1YVC A;  3CCR A;  2A6E C;  4H7B A;  5EKK A;  1LTL A;  5C3E G;  1F2M A;  1V8Q A;  3PO2 B;  2CWP A;  4RG1 A;  3PO3 H;  2O4X A;  3W2D A;  2MHV A;  1VQE A;  4X66 L;  4DK6 C;  4C3J H;  1NTG A;  1P16 A;  3BVZ A;  4A3G H;  2QCP X;  2XSC A;  1KLU D;  2UXB L;  3TS2 A;  4RHR A;  2DUD A;  2E75 C;  1JIC A;  3V2T A;  2QGQ A;  4HSP A;  4PMB A;  1RTN A;  4NMZ A;  4V19 0;  3I4M G;  4IPG A;  5C4X B;  2EYL A;  5FLX L;  1HFN A;  4L6T B;  4QUF A;  1CQF A;  4K8J A;  3ITP A;  4ZKB B;  3GTM H;  1N32 L;  4IJH A;  4I65 A;  2OQK A;  4H13 C;  3TEH B;  1KC8 C;  5A2Q E;  2EJF C;  1OXS C;  2WB1 G;  1A62 A;  2X6L A;  3TP6 A;  3X3M A;  1NMG A;  3FEW X;  3IKJ A;  2K7V A;  4IUR A;  3HOX H;  4DXG A;  1PH2 A;  1CQV A;  2PZU A;  4KKS A;  2RBM A;  4A93 B;  5IT9 E;  1BCP B;  3Q22 A;  4A3D B;  5CBA E;  1MHW C;  3EBE A;  1B3Q A;  2K5D A;  1YHQ A;  2F03 A;  3CHB D;  3RLO A;  2JA5 H;  1H9J A;  1D5Z C;  2XNA C;  1SND A;  3E6Z X;  1I50 B;  2VQE L;  1HCZ A;  5GAD C;  4RFB A;  2B2V C;  1Y1W H;  2OWO A;  1HRJ A;  2V1C C;  4KTA A;  3FMC A;  1BBX C;  4LUZ A;  2OEO A;  1WTO A;  1B4O A;  4KY6 A;  4QB4 A;  2MO1 A;  3J80 i;  4POF A;  2R92 H;  4IOA A;  1GKH A;  2NWG A;  1ASY A;  3K8A A;  1LT4 D;  1CK1 A;  4IO9 A;  4NXN Q;  4J6H A;  1Q8K A;  4UP8 A;  1SYF A;  2CKZ B;  2Q2T A;  1CKN A;  3K5L A;  1X9N A;  1SFO H;  4JI8 Q;  1NAP A;  4A3C G;  5CV4 A;  4QIW B;  1PH6 A;  1YI2 A;  1F9P A;  1WFQ A;  1XPR A;  3RNU A;  3NSW A;  3J80 E;  4DR2 Q;  3M4O H;  4XQQ A;  2L9H A;  1SNO A;  4EQO A;  1D6E C;  4YHH Q;  2R93 G;  4OHJ A;  4OWW B;  3SEB A;  4JI1 L;  4A3M B;  2NVX H;  3M7N A;  4DR6 Q;  1TWF B;  2LXK A;  5FLX c;  4NB3 A;  1LTS D;  1IL2 A;  2A68 D;  3G4S A;  4RCO A;  2PPB C;  1E2W A;  2EDG A;  5JEA J;  1FL0 A;  4O1N A;  4HCS A;  4BY1 G;  1HR0 L;  1A2T A;  4KKU A;  1AE3 A;  1PMR A;  2K75 A;  3NWS A;  4Y52 H;  3NBH A;  4LFA L;  2ZTD A;  1GUO A;  5GAG C;  3D4W A;  1L0X B;  3NTH A;  2JA6 H;  1TS2 A;  3MXG A;  1HNZ L;  4R9W A;  3KLR A;  3ERQ A;  5M5W H;  1F9R A;  4A3B B;  1B8A A;  3STB C;  3BZK A;  1YIT A;  1Q7Y C;  3HOU H;  3Q8D A;  4IAL A;  2B2T C;  4K6L A;  4DU9 A;  4OO1 I;  1LT3 D;  2K33 A;  3CCJ A;  1N9W A;  2K1B A;  4N8F A;  4IJL A;  1NMF A;  3CRK C;  3J7Y W;  2PZT A;  4DR3 L;  3EFX D;  2JEB I;  4C3H H;  1TWA H;  3AYH B;  3VYT A;  2AQ2 B;  4JW0 A;  2B2U C;  5LMN L;  2YTV A;  3RZO B;  3HOZ B;  2CHB D;  4CKE A;  5IWA L;  3N52 A;  2DGY A;  5BN5 A;  3MEF A;  4OX9 L;  2HQE A;  1I4H A;  1YNJ C;  4DUZ Q;  3PO3 G;  3BYT B;  1ENC A;  4QMG A;  4JYA Q;  3S2D B;  3I4N H;  1FNW A;  3R2T A;  2Q2H A;  3TN2 A;  2PW5 A;  4C3J G;  4DV0 L;  3NXW A;  5EBC A;  2BE5 D;  1ET6 A;  4A3G G;  1KAA A;  2A73 B;  3DEO A;  3EVQ A;  1VQG A;  5IYB H;  1O7L A;  2BCO A;  1SE3 A;  1W6K A;  3KF6 B;  3CAM A;  3LWU A;  3K5N A;  1HH2 P;  3SK8 A;  3K5M A;  4X6A H;  4KK7 A;  4QY7 A;  1K73 C;  4UDU C;  4RH6 A;  3TDQ A;  2I5H A;  3G48 A;  3GTO B;  3M4Y A;  4RMF A;  1PH3 A;  2B2W C;  1WYD A;  1MJE A;  3CP0 A;  1JOR A;  2Z4H A;  2UUA L;  2JEA I;  1U4L A;  3DWQ A;  3W1B A;  4F87 A;  4GOP B;  5COR A;  1PYS B;  3E0J A;  4FDB A;  2B63 B;  4QQB X;  2EYF A;  4R4I A;  1PDQ A;  5EKI A;  4IFD J;  3PUW A;  2ENB A;  4M8A A;  4EQP A;  3BS1 A;  4DV4 Q;  3PF4 A;  1G6P A;  3HOX G;  2K52 A;  4UPA A;  3S9W A;  3T1Y L;  1YNX A;  3ZYY X;  2PNH A;  1HNX Q;  3LX0 A;  1UEA B;  2O5I C;  1TS4 A;  4LF5 L;  2WV6 D;  3OIP A;  1CKM A;  1JE5 A;  1BCP C;  3D6C A;  2IY5 B;  2JA5 G;  1HTP A;  3J7Z C;  1TII D;  4K5V A;  1MIU A;  2XWB B;  1QZH A;  2BOS A;  3X3N A;  5KNC A;  1JWU D;  1STN A;  1ENF A;  2KEC A;  2TSS A;  4DR1 L;  2A6H C;  3LNN A;  1VMC A;  3E9H A;  2RA4 A;  1LO5 D;  2R92 G;  2I5M X;  2FJ2 A;  4DV5 L;  1LTG D;  1X3Q A;  4C3J B;  1F2Z A;  3A8K E;  3SGI A;  4A3G B;  1PTO F;  4B3M L;  5FLX E;  4A3K G;  2JA8 B;  1N34 Q;  3CKI B;  2GVB A;  1VF7 A;  4JBM A;  4QJF A;  4XYQ A;  2QA4 A;  2SNM A;  3PSI A;  5EPJ A;  2X69 A;  2F52 A;  4FO2 A;  4RGN A;  2ATW A;  3A54 A;  1ZXT A;  2EYO A;  1X32 A;  2E2H H;  1PFN A;  2DJG C;  3DEP A;  3PMF A;  2B2Y C;  1KIX A;  1OO9 B;  1STB A;  3HKS A;  4KI0 A;  2VQF L;  1IBM L;  2ZXP A;  4YWL A;  1PV4 A;  1HQR D;  4B3R Q;  3BVM A;  3NEM A;  1MGS A;  2EPB A;  4FF4 A;  3JAM c;  5F2D A;  3GTM B;  1K28 A;  2A8V A;  3PO2 H;  2NVQ B;  2Q2I A;  3AFQ A;  2AKW B;  4HJ8 A;  3OPO A;  5FOB B;  1J8I A;  3GTJ H;  2KUM A;  3TS0 A;  3T16 A;  2FXQ A;  2ZM6 L;  3KLS X;  3L0O A;  5ELB A;  1O78 A;  5JEA G;  4OEM B;  4XT1 B;  2Y0S E;  3HGB A;  3DM1 A;  2IX0 A;  4B9W A;  4GN3 B;  2UU9 L;  5E3F A;  5JPM C;  5C4X H;  3CCQ A;  1VQ5 A;  3LGJ A;  1WTV A;  2C5C A;  2JA6 G;  1MJC A;  2Q8I B;  3T56 B;  3TZD A;  1MD2 D;  1TY0 A;  3CQZ B;  4HJ9 A;  1X54 A;  3C1E A;  4JI0 L;  4CJ1 B;  3VR3 A;  5CR3 A;  4HJA A;  3HOU G;  3W3A A;  4NKL A;  2F0V A;  2SDF A;  4KHP Q;  4LUV A;  1B50 A;  2CFM A;  3TP5 A;  3MWY W;  4DUY L;  2JK8 A;  4B3T Q;  1CA5 A;  2AQ1 B;  4KKT A;  4C3H G;  1QUQ B;  3M7G A;  3A56 A;  1I6V C;  2K32 A;  4XYO A;  4A3K B;  4OO1 H;  2HHH Q;  4A93 H;  3ND8 A;  1SE4 A;  4H02 A;  4A3D H;  3BYY B;  1W6J A;  2I46 A;  5GRO A;  3BG3 A;  1EWI A;  5IY0 A;  4DV3 L;  1I50 H;  4Y7N H;  1C48 A;  5FKA C;  3I4N G;  2LXJ A;  1LT6 D;  1XX8 A;  3PUZ A;  4DAP A;  1EYA A;  4ME3 A;  4JPB W;  3OWE B;  1N36 L;  3NEN A;  3FPU B;  1UWV A;  1I4G A;  1BQQ T;  3BZD B;  5CMD A;  5IYB G;  3OTO L;  1IBL L;  2UUC L;  1QVG A;  1NNX A;  4FF1 A;  2A6E D;  2ZTE A;  4RGT A;  4LF5 Q;  3DUZ A;  1BO0 A;  1SLJ A;  1X56 A;  4Q0F A;  4S3S A;  1A6X A;  2Z8L A;  2D0O A;  4WRD A;  5G3L F;  5CBE E;  3CCU A;  4C3I H;  4IOC A;  2MUY A;  3PUY A;  5FO8 B;  1DZ1 A;  1AN8 A;  3U4Z A;  4R1J A;  3S15 B;  2EY2 A;  4M1U B;  1HPC A;  2SNS A;  2NYZ D;  4KMU C;  1CSP A;  3CCV A;  4IFD G;  4NPS A;  1X3G A;  1WD0 A;  3QR8 A;  1CSQ A;  2KHI A;  3CC7 A;  4QF4 A;  5K36 G;  3JAM i;  1U4M A;  1H95 A;  3ULJ A;  4G7O C;  1DJR D;  3A5Z B;  1F9Q A;  1TWG B;  2VZA A;  3QJY A;  4A3M H;  1TWF H;  2PZW A;  3S17 H;  2N78 A;  3J81 i;  4KD4 A;  1PRT D;  1XNQ Q;  4DKA C;  2FMC A;  2AMC B;  3CD6 A;  3U4V A;  1J9O A;  5GAH C;  3AEV A;  5BR8 Q;  5IGF A;  1ET9 A;  1T5E A;  3KF8 B;  3GDE A;  2K5N A;  1G2T A;  2UXC Q;  4L8J A;  1AZP A;  2XN9 C;  5H1S E;  1D8L A;  1D1K A;  3JAM E;  3NTK A;  2UUB Q;  1G91 A;  4A3B H;  1YNN C;  5FJ8 H;  2MJ8 A;  5T1I A;  2DN8 A;  1PTO B;  1SRU A;  4KV6 A;  2WAQ G;  4F88 A;  1JB7 A;  2VUM B;  1S40 A;  2VW9 A;  1K8O A;  2JA7 G;  2IL8 A;  1KTK A;  4CKC A;  3M3Y B;  3PUV A;  4H0L C;  5DM6 3;  1WTW A;  2BH2 A;  3EIV A;  5EAY A;  1B44 D;  3W1G A;  3RZO H;  3HOZ H;  5ELN A;  1WTX A;  1IW7 C;  1AE2 A;  5I9P A;  3AU7 A;  3KDF B;  1EQQ A;  1B9N A;  2HQL A;  4DK0 A;  5C5M A;  2PMZ E;  3PO2 G;  4H44 C;  4X3T A;  1KDC A;  3FPP A;  3S2D H;  1STE A;  4PZ7 A;  2EXZ A;  1FD7 D;  5E4W C;  3C3L A;  1D2B A;  1KQS A;  2QEX A;  1GJX A;  4KLK A;  4V0B A;  1FVI A;  3CCM A;  2KED A;  1VQI A;  3VR6 A;  1H9S B;  3HKZ E;  2E2J B;  4QCL A;  4YCU A;  1JJ2 A;  3P1H A;  5KIX A;  5I2Y A;  1QNK A;  4PNY A;  3R93 A;  4NXN L;  1CA6 A;  4XXE A;  3GTO H;  3NPP A;  1KAB A;  4JCV E;  4NW2 A;  5K5P A;  1EWC A;  1XMO Q;  4TQU S;  4I7Z C;  4C56 C;  1VQ4 A;  1VQ8 A;  2RCN A;  1VS0 A;  3S1R B;  2OXP A;  1DOM A;  4JI8 L;  4ABN A;  2CH4 W;  2K50 A;  2RVL A;  5IP9 G;  4Q5V A;  1UE6 A;  4ULL A;  5FO7 B;  1XYI A;  4R4Q A;  5C0X J;  1EZ6 A;  1NBW A;  1VQP A;  1X65 A;  4DR2 L;  2B63 H;  4F7X A;  3H3V I;  1C9O A;  2WII B;  4CGY B;  3TQY A;  4RAU C;  4J8Q A;  4YHH L;  4BWG B;  2L11 A;  1EIF A;  1Y1V B;  4K5W A;  1XTD A;  3MFG A;  1BBW A;  1QE6 A;  3GV6 A;  1L2F A;  1XPU A;  2HUG A;  4DR6 L;  4QL5 A;  4A93 G;  3HOW B;  4A3D G;  4JV5 Q;  3WDN A;  2JA7 B;  1YZ6 A;  2F0L A;  3HG9 A;  2E2I B;  3RR5 A;  2BDN A;  5KYI A;  4APV A;  1RJT A;  2HCC A;  2F0F A;  1A3U A;  3BZC A;  3NQI A;  1IYU A;  2CH4 A;  1HZC A;  3M4Q A;  4U67 3;  1S72 A;  4RGO S;  3P75 A;  4DGZ A;  1V9P A;  2XIW A;  4LW1 A;  3KBX A;  4YWM A;  2NBF A;  4HCE A;  5EBD A;  1MI2 A;  3PUX A;  3GTJ B;  2JA8 H;  1YNJ D;  2KCC A;  5CYU A;  2EVB A;  1MSH A;  1SYD A;  5CC4 A;  3K57 A;  3C1F A;  1GUT A;  5ISR A;  4R8I A;  4DV6 Q;  3T1H Q;  3I8Z A;  3C46 A;  1SRO A;  2HCI A;  5JJK A;  4C3I G;  3KF6 A;  5LMU Q;  2WKC A;  1V1P B;  1EEI D;  4CDD C;  5JJI A;  4KN7 C;  3W5O A;  2NN6 I;  4DUZ L;  2B8F A;  1SNP A;  1VQM A;  4HJ7 A;  1QZG A;  4IFD I;  4JYA L;  2JXM B;  2L1B A;  2ZXR A;  2NVQ H;  3U58 A;  4MZ9 A;  3TP8 A;  1YIJ A;  5JJL A;  2XWJ B;  4A3M G;  5JPN C;  4GOP A;  2ZJR A;  3VA7 A;  3TSS A;  2JQO A;  1BOS A;  3KK7 A;  1A3T A;  4CDC C;  4NXM Q;  5E1F A;  4IUN A;  3P7J A;  3SK4 A;  1EY0 A;  1WJJ A;  4HTH A;  4OIJ A;  5BN4 A;  4DR5 Q;  4WJ3 M;  2I5L X;  2EY1 A;  1TWC H;  2BDO A;  4A3J G;  1D5M C;  4N8X 1;  1U0L A;  4O0A A;  1XXG A;  4B08 A;  2FIN B;  4LK1 C;  4DXF A;  4Y7N B;  3PGZ A;  2A19 A;  2K6A A;  3CQZ H;  1RCV D;  4A3B G;  3RN5 A;  4DAY B;  5FJ8 G;  1TQO A;  5DAU A;  4HIM A;  2CCZ A;  3D4D A;  1ICF B;  4TSS A;  4DV4 L;  1B1Z A;  4N9P A;  1B53 A;  1E24 A;  2F3V A;  4OL7 A;  4R4O A;  1ASZ A;  1TR5 A;  1KD1 C;  5EPK A;  4K6D A;  3I70 A;  2YU9 B;  5J1Z A;  3TP7 A;  1HNX L;  3URY A;  3CF5 A;  4A3K H;  3VYS A;  1K8G A;  3S1N B;  2A6H D;  2ZTC A;  4G4K A;  3DWA A;  5CV8 A;  3HOZ G;  2WB1 E;  2EJM A;  5KGU A;  5C3X A;  1J6Q A;  2IX3 A;  3AMU A;  2FMM A;  1TWH B;  3D3R A;  1NY4 A;  1QJO A;  1M90 C;  4C3I B;  2KCN A;  1A3V A;  3A8J E;  1BF4 A;  5LL6 X;  1Q3L A;  5A35 A;  5C4Z A;  2PNR C;  4K2K A;  3T13 A;  1XPO A;  4X3S A;  1X3F A;  4DV7 Q;  3GTP B;  1IHZ A;  4FF2 A;  3OMG A;  2Z9H A;  1JOO A;  5D14 A;  2EXD A;  3MXN A;  1S5B D;  3MTS A;  2R61 A;  1ESF A;  3H15 A;  1N34 L;  3SK6 A;  4BBR B;  3S17 B;  1JT8 A;  2F3W A;  2KOL A;  2KJX A;  1O7Z A;  1A15 A;  1A8V A;  1MSG A;  1C7Y A;  5JEA H;  1LTI D;  3S24 A;  3OWF A;  1IBK Q;  1OXU A;  4A3J B;  1GHJ A;  2O2L D;  1U9R A;  4K14 A;  2OQ0 A;  3O13 A;  1N8R C;  5J39 A;  1ZKO A;  2PO4 A;  3H6M A;  2B63 G;  4B3R L;  3K0Y A;  1ESR A;  4MHE A;  5HUR A;  2VB3 X;  3S15 H;  5M5X B;  1HA6 A;  1GUN A;  3MVV A;  1L1O B;  4X62 Q;  2HDM A;  2LSS A;  2EOT A;  3EJI A;  5AFW A;  3S1Q H;  1YHA A;  5FK9 C;  4PMW A;  1Q81 C;  1TWG H;  3H3V H;  1JE4 A;  3NP8 A;  3I73 A;  2K03 A;  1MKH A;  1VQF A;  4RKB A;  1J5E Q;  3FDT A;  1EYD A;  2RKS A;  4ZRZ A;  3WOF A;  2Z0S A;  2E76 C;  1LTA D;  3MZ5 A;  4LAA A;  1DD2 A;  4GLV B;  2JP1 A;  3I56 A;  3I72 A;  3FKI H;  1QUQ A;  3K80 C;  5J3B A;  2WIN B;  3SXH A;  2DNE A;  1CI3 M;  4LFB Q;  1SN8 A;  3D6W A;  1LV9 A;  2GVA A;  4XT3 B;  3PF5 A;  2R7Z H;  2B29 A;  1PZI D;  3G6J B;  4GKK Q;  4KHP L;  1JMC A;  3UDX A;  1PTO H;  3BDL A;  2JA8 G;  4O42 A;  1I94 L;  1V1O A;  5JVG 3;  4B3T L;  3RD4 A;  2VUM H;  2OTL A;  1UE5 A;  4X65 Q;  4DNR B;  3RZD B;  4DF7 A;  4XQN A;  3M3Y H;  3D4R A;  2HHH L;  5C44 G;  1ZYR C;  1I4X A;  1VQC A;  2M2L A;  4P71 A;  3UE1 A;  5FLM H;  2AWN A;  2SOB A;  5CV7 A;  1PH7 A;  4GN5 A;  1AZQ A;  4CJ0 B;  3VDY A;  1EEF D;  1KRT A;  4IUP A;  5KYL A;  3ULL A;  1I4P A;  4K8I A;  1XJV A;  3QOL A;  2E5L Q;  4JC0 A;  4R4T A;  1HXY D;  4LF6 Q;  1D1I A;  2NN6 H;  3A8I E;  4PV1 C;  1H9R A;  4YY3 L;  1S4Z A;  3F1Z A;  4IFD H;  1STH A;  1SYE A;  5K36 H;  4LF8 Q;  1STA A;  4QUC A;  2E2J H;  4DR4 Q;  5JAV A;  2K5H A;  4OXP A;  1DOL A;  1HTL D;  2N3S A;  4JBJ A;  1KDB A;  1VQL A;  1PFS A;  1VQO A;  4C1N I;  3KLW A;  1X3E A;  3S1R H;  2A5H A;  1Y8O B;  1F77 A;  2WAC A;  5I2X A;  4G7Z C;  1PRT F;  5IGE A;  2H4O A;  2A69 C;  2HIV A;  4GNX A;  1TS3 A;  1Z47 A;  3TME A;  2EYM A;  3FVQ A;  1EYC A;  3CCS A;  3NQT A;  1I6H H;  3KF8 A;  4HAE A;  1T5X D;  1WTH A;  1EOT A;  3K0X A;  1Y1V H;  1PH5 A;  5GAE C;  3RLF A;  1Q82 C;  5C6A A;  3KOJ A;  1K0S A;  1X6O A;  1LAC A;  1SYB A;  4KD3 A;  2XGT A;  4WJW A;  1E3P A;  2P5Z X;  3HOW H;  1R4Q B;  2JA7 H;  4IZ8 A;  4LF9 Q;  1YNN D;  1XNQ L;  3OHX C;  2E2I H;  1HJP A;  3K7A B;  4AYB E;  4L63 B;  1E22 A;  1EY5 A;  4WFN 3;  5C44 B;  5BR8 L;  1P8L A;  2UXC L;  1NE3 A;  1ILP A;  1PZJ D;  2F4V Q;  4JI6 Q;  2N8N A;  1Q46 A;  4K0K Q;  3MXN B;  2F0H A;  1I3Q B;  3PV0 A;  3M85 A;  3E3X A;  1ROD A;  2VB2 X;  3S2H B;  3EQL C;  1PYW D;  1PA6 A;  3SK5 A;  2UUB L;  1YHB A;  2N49 A;  4BA1 I;  1FGB D;  1VQA A;  1IW7 D;  3OOC A;  1EFI D;  2KEE A;  1VQN A;  3KDF A;  3NEL A;  2N88 A;  3KBG A;  1CUK A;  2F0N A;  1Q8I A;  4MTN A;  4F8M A;  2NTT A;  2F4I A;  4JI5 Q;  1LTB D;  3I3C A;  2RDF A;  1G29 1;  4PQX A;  1K0R A;  3IFD A;  1SAP A;  3HZX A;  1H9S A;  1TWC B;  1VQD A;  3A0J A;  3WOE A;  1TS5 A;  3FP9 A;  1TKW B;  2K14 A;  3DM3 A;  2ZJP A;  3J81 j;  2KCM A;  3I7F A;  4G57 A;  5C0X I;  1IYV A;  1RL2 A;  5DM7 3;  5IYC H;  5IP9 H;  4PZ6 A;  1L1O C;  3UDF A;  4ZUJ A;  3TZU A;  3SE0 A;  2G5D A;  3NHH A;  5GQO A;  1I94 Q;  1H9M A;  1EY7 A;  5M3F B;  4LWC A;  1S5F D;  4G7H C;  4DFA A;  2E2D C;  3S16 B;  2KVM A;  2Z6B A;  4DK1 A;  2O5J C;  2BA1 A;  4BS9 A;  1XMO L;  2QEJ C;  3FKI G;  1S5E D;  2AUK A;  1HNW Q;  1DOK A;  4OIK A;  1CHQ D;  1STG A;  2VNU D;  3C2P A;  2Y0S B;  3HOV B;  3ND9 A;  4DV2 Q;  1EIY B;  2R7Z G;  2Z4I A;  2FFK B;  4FVM A;  4LJZ C;  1Y8N B;  4YY3 Q;  3U9O A;  3L2P A;  5M3M G;  5A2Q L;  4ZCK A;  2VUM G;  4RGM A;  3Q0A A;  2BE5 C;  3KYH C;  2YU9 H;  3DXJ C;  1KNA A;  1S5C D;  3S1N H;  4C1N K;  4JV5 L;  3MA2 B;  1QIL A;  5FLM G;  3S1M H;  2QW7 A;  3CXC A;  1I4R A;  1TWH H;  2RF4 A;  3UDI A;  5JJZ A;  1TU2 B;  1U4R A;  5IGG A;  3CCE A;  4GOP C;  3MXP A;  2LKV A;  1BNZ A;  1TY2 A;  2IWH A;  3H0G H;  4ILW A;  3CME A;  4HIO A;  2NN6 G;  3BDO A;  3GTP H;  1G8Z D;  1JC7 A;  2IX1 A;  4LMQ D;  1SMX A;  1V1P A;  2F0O A;  3S1Q B;  3DLL A;  4A3E B;  1K8M A;  1SE2 A;  2Q8T A;  2ID0 A;  3VYU A;  1U4P A;  4N9T A;  2OF1 A;  3SVM A;  2PI2 A;  3I55 A;  3FRP B;  4BBR H;  1GUG A;  1UEB A;  4GNX B;  2HD3 A;  4DV6 L;  4A76 A;  3T1H L;  3A7A B;  2ZJQ A;  1HA5 A;  1JOQ A;  4UP7 A;  3QIA A;  1K8A C;  4IUV A;  1PRT B;  3FKI B;  4JOI A;  4JVZ A;  5LMU L;  4FXD A;  3KJO A;  2UXD Q;  4A3J H;  3HOY B;  1FJG L;  1GD7 A;  1PFM A;  5IE8 A;  1LTR D;  5IOC A;  4X3U A;  1K3R A;  3KLS A;  5E7N A;  5M5X H;  3K81 C;  2F0W A;  4ZYS A;  3J80 L;  2F3I A;  2R7Z B;  3RMH A;  1Y1V G;  3HFZ B;  1RD9 D;  1T9H A;  4P74 A;  1UE7 A;  5M3M B;  2L55 A;  1WI5 A;  1RTO A;  1SR3 A;  1R4P B;  3HOW G;  2NVT B;  4DAY A;  4EGV A;  1S3O A;  4LFC Q;  4B3S Q;  4NXM L;  4CHT B;  1BKB A;  3IL8 A;  3CW2 C;  3HKZ G;  1QVF A;  1WVL A;  1BUV T;  2K05 A;  5BN3 A;  1BBU A;  4DR5 L;  2DJF C;  2CW0 C;  5IGD A;  4BXX H;  2IPK D;  2F0K A;  1M1K C;  4Z9C B;  2EYH A;  1BDO A;  4A75 A;  1HZA A;  2F0U A;  1RKN A;  2MO0 A;  3VR2 A;  4HMJ A;  2K01 A;  2RSO A;  5KEE A;  5LL6 S;  3UE0 A;  2RDG A;  1C4Q A;  3SHL A;  1W3S A;  1O7I A;  4MN3 A;  3T53 B;  1XNR Q;  2EJG C;  2MQH A;  3TRE A;  2D62 A;  1SMY C;  2H1E A;  4X64 Q;  4K2L A;  3RZD H;  3EA6 A;  4AQY Q;  1K9M C;  3J7A 5;  4KHZ A;  2KHJ A;  3PIP A;  4LF7 Q;  1UNS A;  4LF4 Q;  5ELE A;  5C5L A;  1NR4 A;  2WAQ E;  5D65 A;  3UI2 A;  2L15 A;  5IYC G;  1FNV A;  4JI4 Q;  2XRQ D;  1EY6 A;  4DV7 L;  5M5Y B;  4ZUI A;  1S5D D;  3L7Z C;  3K6O A;  5C0X H;  5EGT A;  1EU4 A;  5C4J B;  1I6H B;  2RHQ B;  4DNT B;  1SJH D;  2VXW A;  2PMZ B;  1VF5 C;  4ZK9 B;  5CV9 A;  3GTQ H;  2QDB A;  1G51 A;  1L1O A;  4ODG A;  1PFB A;  1RHP A;  1QVC A;  3I4L A;  5I6W A;  3STB D;  3HKZ B;  4BBS B;  1EU3 A;  1KNE A;  2JJQ A;  1G6Z A;  1IBK L;  5EPL A;  3J80 c;  5D3I B;  2ZT9 C;  4KY7 A;  5L37 A;  4BY7 H;  4TKO B;  5D3D A;  1L0W A;  3MAQ A;  3AQQ A;  4DR7 L;  3U50 C;  1VQ7 A;  2L5T A;  5T1G A;  1PH1 A;  1BR9 A;  2WP8 J;  4R8N A;  1NCV A;  1O80 A;  2J7Z A;  3CPW A;  4X62 L;  3MC0 B;  1UE1 A;  2I0Q A;  4JK1 C;  3A74 A;  1D5X C;  4L5Q A;  1UUP A;  1Z9F A;  2N55 A;  3CPF A;  1IKL A;  5KNB A;  1J5E L;  2WKD A;  3L3O C;  3NUC A;  2Z6K A;  1HHV A;  4GKJ Q;  3K7A H;  4X3K A;  3GQB A;  5C44 H;  1QG7 A;  1DYQ A;  4IUT A;  5CV5 A;  3T4A C;  2IW3 A;  1N33 Q;  1PH9 A;  4A3I H;  2JE6 I;  2C9O A;  1FJG Q;  3P20 A;  4UP9 A;  3H0G G;  4UAI A;  2RHS B;  4IN3 A;  3HEJ A;  2K5Q A;  2EE1 A;  1I3Q H;  5IYD G;  3NE5 B;  4LFB L;  1SSO A;  3S2H H;  1ZYR D;  3NTI A;  4A3F H;  5G3L D;  2OCE A;  4IPD A;  3F8T A;  4GKK L;  1EQT A;  4DNI A;  4E6I A;  4U68 A;  5C3W A;  4FXK C;  5AJ3 Q;  3H3V C;  2R6G A;  1HZ9 A;  4BBR G;  4MTK A;  4X65 L;  1A2U A;  3VA5 A;  1WCM H;  2R3Z A;  4IUU A;  4EQN A;  1B7Y B;  3G6E A;  4GNX C;  5KRU A;  4C2M B;  3PQI A;  4KJN A;  1YBY A;  4ALP A;  2JYO A;  1PLF A;  1EY8 A;  2BA0 A;  3BDC A;  1DON A;  1PRT C;  2ES2 A;  4JI7 Q;  4IQZ A;  4XTC S;  3F2U A;  1SXT A;  3EN2 A;  3MFY A;  3SDZ A;  2XTI A;  5IGC A;  2K5W A;  1M8A A;  4QGU A;  2E5L L;  2VS1 A;  2PQA B;  3TBI B;  2DY7 A;  1BCP D;  2A74 C;  4LF6 L;  4DAV A;  1SNC A;  4QIW E;  3JC6 6;  1W2B A; 
#chains in the Genus database with same CATH homology
 1PTO C;  1ICW A;  2HDL A;  2A69 D;  2F0M A;  4FNF A;  1GUW A;  1VCI A;  2D2C C;  3VYR A;  1NSN S;  3L9A X;  5I6Y A;  2OT2 A;  3BVG A;  2ICE C;  1R9T B;  3S1M B;  2RQX A;  3QB3 A;  5C3E B;  3J7A F;  1EL0 A;  2NZ1 D;  3G7L A;  3K5O A;  3HP3 A;  1ONL A;  1GOZ A;  3H0G B;  3LWE A;  1QWY A;  5JOB A;  2G9D A;  3HS0 C;  5CV6 A;  3IFT A;  1B9M A;  1ZEQ X;  3GTK B;  4K5X A;  5I4D A;  2J4X A;  1L0Y B;  5KND A;  1QB5 D;  1PXU A;  3QOJ A;  1SYC A;  2G9H D;  2ZXO A;  5LHY 1;  3I4M B;  3MXU A;  5COY A;  1CTM A;  1E0B A;  1QOH A;  3PIP 3;  2EZV A;  1IKM A;  1HQM C;  4WOR A;  2L0C A;  3RUZ A;  2WB1 B;  5C0X G;  2L12 A;  2L4N A;  2AWO A;  1HFG A;  5NUC A;  1JCK B;  1TT2 A;  1OXV A;  4FXG C;  3U9S A;  3Q24 A;  2F0I A;  2F0S A;  1Q12 A;  4JBW A;  3KUP A;  2IJ0 A;  4OGQ C;  4ZQ3 A;  2F0Q A;  3R8B A;  5I9O A;  2F1M A;  3H91 A;  1MBY A;  3H09 A;  2XRS D;  1Z7T A;  2CVR A;  1VMP A;  2F0J A;  4B9X A;  3SR1 A;  2B8G A;  3V05 A;  4DA2 A;  4HMI A;  2EY6 A;  5M9O A;  1JR0 D;  1XTC D;  1AP0 A;  1CT1 D;  3V96 A;  4FYD A;  1CZW A;  5JVH 3;  5C4H A;  1Y69 U;  1SJE D;  2QKI C;  3R2I A;  2MP1 A;  5HGT A;  2R93 B;  2NVY B;  1WTR A;  1DM0 B;  3JAM L;  2FHT A;  1CZG A;  4XIG S;  1EIG A;  4BY1 B;  3ERO A;  5IGB A;  1O7Y A;  3J81 L;  2K28 A;  1AEX A;  2K04 A;  1H9K A;  3GTQ B;  3I90 A;  4CJ2 C;  1F9S A;  5EKL A;  2D9U A;  2LFN A;  4ZAI A;  2CQA A;  1Q1B A;  2MPM A;  3GP7 A;  4BY7 B;  2AUJ D;  1C8C A;  2Q8R E;  2NUC A;  4MIU A;  1EIH A;  1CHP D;  1LAB A;  3GTL B;  5ELD A;  5EQ0 A;  5E4X A;  1EY9 A;  2J0T D;  1E2V A;  1SNQ A;  3NBI A;  3PO3 B;  4A3I B;  2GA4 B;  1JQY D;  2B2V A;  4A3F B;  3QWN A;  2CW0 D;  4RHS A;  1OXX K;  1UAP A;  3OMC A;  3PIO 3;  4DN4 M;  1XWE A;  1WCM B;  2TMP A;  1AW7 A;  1RF2 D;  4ME5 A;  2F0T A;  1GUS A;  3A55 A;  3QG1 A;  2A68 C;  3GO5 A;  3E5S A;  1SDF A;  3H94 A;  3GV3 A;  1FYC A;  1SMY D;  3CU7 A;  2LMC B;  4AYB B;  3HOX B;  1HUM A;  3K58 A;  1LT5 D;  1X3P A;  2PCF B;  4CBV A;  1HUN A;  2I07 B;  1QCB D;  3OW7 A;  1KDA A;  4RCN A;  1DCZ A;  1JB3 A;  1QNU A;  2JA5 B;  3MEH A;  2PW7 A;  1GXD C;  2F0E A;  1Y1W B;  2KA7 A;  4YIJ A;  1GHK A;  1EWH A;  4NDX A;  3T51 B;  3CRL C;  4PMC A;  2R92 B;  1NUC A;  2LY7 A;  2F0P A;  1IL8 A;  2B2T A;  1OXT A;  2M9V A;  1SFO B;  2MGS A;  1V43 A;  2QIL A;  3OIQ A;  2B39 A;  2B2U A;  3J7A V;  4RWS C;  2NB0 A;  3HRZ C;  5IT9 L;  2SEB D;  3M4O B;  3A7L A;  1RDP D;  1WTP A;  5TSS A;  1JWM D;  2EYP A;  3ONA B;  1KLG D;  3NWT A;  3VR4 A;  2QF7 A;  2EYJ A;  2NVX B;  4P2C B;  4FP5 D;  1WD1 A;  1LLR D;  5FO9 B;  4FF3 A;  4TRD A;  5IIF A;  1E2Z A;  2YYZ A;  2RDH A;  5CGK A;  4HSV A;  2V4D A;  1F2Y A;  2RSN A;  2IT1 A;  3Q23 A;  4ZLT F;  2JA6 B;  2B2W A;  2F0G A;  3IAY A;  5M5W B;  3VR5 A;  3OSO A;  1K83 B;  3GD7 A;  4J1M A;  4KN4 C;  3HOU B;  1F2L A;  4HED A;  3I91 A;  2KHS A;  3N6R A;  4XDX A;  2LS0 1;  1AFP A;  3S14 B;  4BA2 I;  3K59 A;  2XVS A;  3MHB A;  4C3H B;  1ML0 D;  1TWA B;  5J22 A;  3DHQ A;  1BCP F;  4RKL A;  1Z6H A;  4GZY C;  2X6G A;  3I4N B;  1PTO D;  1PZK D;  1CFM A;  2AQ3 B;  4IUQ A;  4XQJ A;  1SEB D;  1FR3 A;  3J81 E;  1ILQ A;  4ID6 A;  1EQV A;  1FNU A;  4NP5 A;  1I4Q A;  2ICI A;  2NTS A;  1SYG A;  1SNM A;  1B3A A;  5DEH A;  1LTT D;  4ZKC B;  3DWP A;  1EZ8 A;  3AB9 A;  1B2T A;  3GTG B;  2B2Y A;  2DY8 A;  1M4V A;  1WTQ A;  1Q1E A;  4KHV A;  4EVO A;  5ELF A;  4KJO A;  1NR2 A;  1SBB B;  2JSO A;  2E74 C;  3D31 A;  3Q6S A;  1TVX A;  2PQE A;  2Z1C A;  4RA8 A;  1EY4 A;  4CKB A;  1BXT A;  2D5D A;  4HR7 B;  3QO2 A;  1G2S A;  1Y8P B;  2F0D A;  2DNC A;  1VDZ A;  4OO1 G;  4HN7 A;  2WAQ B;  1DXM A;  1CM9 A;  2KQ3 A;  2M00 A;  2EY5 A;  1II3 A;  5DNF A;  3R3O A;  5EJW A;  2E2H B;  5ELC A;  3D8G A;  2PYK A;  3DMU A;  1ENA A;  5IOD A;  1JOK A;  1Q90 A;  1JWS D;  1STY A;  4KY5 A;  3NK9 A;  2A6E C;  4H7B A;  5EKK A;  1F2M A;  1V8Q A;  3PO2 B;  2O4X A;  3W2D A;  2MHV A;  3BVZ A;  2QCP X;  2XSC A;  1KLU D;  4RHR A;  2E75 C;  1JIC A;  3V2T A;  4HSP A;  4PMB A;  1RTN A;  4NMZ A;  4V19 0;  5C4X B;  2EYL A;  5FLX L;  1HFN A;  4L6T B;  4QUF A;  1CQF A;  4K8J A;  3ITP A;  4ZKB B;  4I65 A;  4H13 C;  5A2Q E;  2EJF C;  1OXS C;  2X6L A;  3TP6 A;  3X3M A;  3FEW X;  3IKJ A;  2K7V A;  4IUR A;  4DXG A;  1CQV A;  2PZU A;  4KKS A;  2RBM A;  4A93 B;  5IT9 E;  1BCP B;  3Q22 A;  4A3D B;  5CBA E;  2K5D A;  2F03 A;  3CHB D;  1H9J A;  1D5Z C;  2XNA C;  1SND A;  3E6Z X;  1I50 B;  1HCZ A;  4RFB A;  2B2V C;  1HRJ A;  4KTA A;  3FMC A;  1BBX C;  2OEO A;  1WTO A;  1B4O A;  4KY6 A;  4QB4 A;  2NWG A;  1LT4 D;  1CK1 A;  4J6H A;  1SYF A;  3K5L A;  1NAP A;  5CV4 A;  4QIW B;  1F9P A;  3NSW A;  3J80 E;  4XQQ A;  2L9H A;  1SNO A;  4EQO A;  1D6E C;  4OHJ A;  3SEB A;  4A3M B;  3M7N A;  1TWF B;  1LTS D;  2A68 D;  4RCO A;  2PPB C;  1E2W A;  2EDG A;  5JEA J;  4O1N A;  4HCS A;  1A2T A;  4KKU A;  1PMR A;  3NWS A;  3NBH A;  1GUO A;  3D4W A;  1L0X B;  3NTH A;  1TS2 A;  3MXG A;  4R9W A;  3KLR A;  3ERQ A;  1F9R A;  4A3B B;  4IAL A;  4K6L A;  2B2T C;  4DU9 A;  4OO1 I;  1LT3 D;  2K33 A;  2K1B A;  3CRK C;  3J7Y W;  2PZT A;  3EFX D;  2JEB I;  3VYT A;  2AQ2 B;  2B2U C;  3RZO B;  3HOZ B;  2CHB D;  4CKE A;  3N52 A;  5BN5 A;  2HQE A;  1I4H A;  1YNJ C;  3BYT B;  1ENC A;  4QMG A;  3S2D B;  1FNW A;  3R2T A;  3TN2 A;  2PW5 A;  4C3J G;  3NXW A;  5EBC A;  2BE5 D;  1ET6 A;  1KAA A;  2A73 B;  3DEO A;  3EVQ A;  1O7L A;  2BCO A;  1SE3 A;  1W6K A;  3LWU A;  3K5N A;  3K5M A;  3SK8 A;  4KK7 A;  4UDU C;  4RH6 A;  3TDQ A;  3GTO B;  3M4Y A;  2B2W C;  1JOR A;  2Z4H A;  2JEA I;  1U4L A;  3DWQ A;  4F87 A;  5COR A;  3E0J A;  2B63 B;  2EYF A;  1PDQ A;  5EKI A;  4IFD J;  3PUW A;  2ENB A;  4M8A A;  4EQP A;  3BS1 A;  3S9W A;  3ZYY X;  3LX0 A;  1UEA B;  2O5I C;  1TS4 A;  2WV6 D;  3OIP A;  1BCP C;  3D6C A;  1HTP A;  1TII D;  4K5V A;  2XWB B;  2BOS A;  3X3N A;  5KNC A;  1JWU D;  1STN A;  1ENF A;  2KEC A;  2TSS A;  2A6H C;  3LNN A;  1VMC A;  2RA4 A;  1LO5 D;  2FJ2 A;  1LTG D;  1X3Q A;  4C3J B;  1F2Z A;  3A8K E;  4A3G B;  1PTO F;  5FLX E;  2JA8 B;  3CKI B;  1VF7 A;  4XYQ A;  2SNM A;  5EPJ A;  2X69 A;  4FO2 A;  4RGN A;  3A54 A;  1ZXT A;  2EYO A;  1X32 A;  1PFN A;  3DEP A;  3PMF A;  2B2Y C;  1OO9 B;  1STB A;  4KI0 A;  2ZXP A;  1HQR D;  3BVM A;  1MGS A;  2EPB A;  4FF4 A;  2NVQ B;  5F2D A;  3GTM B;  3OPO A;  5FOB B;  1J8I A;  2KUM A;  3T16 A;  3KLS X;  5ELB A;  1O78 A;  5JEA G;  4XT1 B;  3HGB A;  3DM1 A;  2IX0 A;  4B9W A;  5E3F A;  5JPM C;  1WTV A;  2C5C A;  2Q8I B;  3T56 B;  3TZD A;  1MD2 D;  1TY0 A;  3CQZ B;  3C1E A;  4CJ1 B;  3VR3 A;  5CR3 A;  3W3A A;  4NKL A;  2F0V A;  2SDF A;  1B50 A;  3TP5 A;  3MWY W;  1CA5 A;  2AQ1 B;  4KKT A;  4C3H G;  3M7G A;  3A56 A;  1I6V C;  2K32 A;  4XYO A;  4A3K B;  4OO1 H;  3ND8 A;  1SE4 A;  3BYY B;  1W6J A;  2I46 A;  3BG3 A;  1C48 A;  5FKA C;  1LT6 D;  1XX8 A;  3PUZ A;  4DAP A;  1EYA A;  3OWE B;  3FPU B;  3BZD B;  1I4G A;  1BQQ T;  5CMD A;  4FF1 A;  2A6E D;  4RGT A;  3DUZ A;  1BO0 A;  4Q0F A;  1A6X A;  4S3S A;  2Z8L A;  4WRD A;  5G3L F;  5CBE E;  2MUY A;  3PUY A;  5FO8 B;  1DZ1 A;  1AN8 A;  3S15 B;  2EY2 A;  4M1U B;  1HPC A;  2SNS A;  2NYZ D;  4KMU C;  4IFD G;  1WD0 A;  5K36 G;  4QF4 A;  1U4M A;  4G7O C;  1DJR D;  1F9Q A;  1TWG B;  3QJY A;  2PZW A;  4KD4 A;  1PRT D;  2FMC A;  1J9O A;  5IGF A;  1ET9 A;  1T5E A;  1G2T A;  4L8J A;  1AZP A;  2XN9 C;  1D1K A;  3JAM E;  3NTK A;  1G91 A;  1YNN C;  2MJ8 A;  5T1I A;  2DN8 A;  1PTO B;  4KV6 A;  4F88 A;  2VUM B;  1K8O A;  2IL8 A;  1KTK A;  4CKC A;  3M3Y B;  3PUV A;  4H0L C;  5DM6 3;  1WTW A;  1B44 D;  1WTX A;  1IW7 C;  5I9P A;  3AU7 A;  1B9N A;  4DK0 A;  5C5M A;  4H44 C;  4X3T A;  1KDC A;  3FPP A;  1STE A;  2EXZ A;  1FD7 D;  5E4W C;  3C3L A;  1D2B A;  1GJX A;  4V0B A;  2KED A;  3VR6 A;  1H9S B;  2E2J B;  4QCL A;  3P1H A;  5KIX A;  5I2Y A;  1QNK A;  4PNY A;  3R93 A;  1CA6 A;  4XXE A;  3NPP A;  1KAB A;  4NW2 A;  5K5P A;  1EWC A;  4TQU S;  4I7Z C;  4C56 C;  3S1R B;  2OXP A;  1DOM A;  4ABN A;  2RVL A;  4Q5V A;  4ULL A;  5FO7 B;  1XYI A;  5C0X J;  1EZ6 A;  4F7X A;  2WII B;  4CGY B;  4RAU C;  4J8Q A;  4BWG B;  2L11 A;  1Y1V B;  4K5W A;  3MFG A;  1QE6 A;  3GV6 A;  2HUG A;  3HOW B;  3WDN A;  2JA7 B;  2F0L A;  3HG9 A;  2E2I B;  2BDN A;  5KYI A;  1RJT A;  2HCC A;  2F0F A;  1A3U A;  3NQI A;  1IYU A;  4U67 3;  4RGO S;  3P75 A;  4DGZ A;  2XIW A;  3KBX A;  2NBF A;  4HCE A;  5EBD A;  1MI2 A;  3PUX A;  3GTJ B;  1YNJ D;  2KCC A;  5CYU A;  2EVB A;  1MSH A;  1SYD A;  5CC4 A;  3K57 A;  3C1F A;  1GUT A;  5ISR A;  4R8I A;  3I8Z A;  3C46 A;  2HCI A;  4C3I G;  2WKC A;  1V1P B;  1EEI D;  4KN7 C;  2NN6 I;  2B8F A;  1SNP A;  4IFD I;  2JXM B;  2L1B A;  2ZXR A;  3TP8 A;  2XWJ B;  5JPN C;  3VA7 A;  3TSS A;  1BOS A;  3KK7 A;  1A3T A;  5E1F A;  4IUN A;  3P7J A;  3SK4 A;  1EY0 A;  4HTH A;  4OIJ A;  5BN4 A;  2EY1 A;  2BDO A;  1D5M C;  1XXG A;  4B08 A;  2FIN B;  4LK1 C;  4DXF A;  4Y7N B;  2K6A A;  1RCV D;  1TQO A;  5DAU A;  3D4D A;  4TSS A;  1B1Z A;  4N9P A;  1B53 A;  2F3V A;  4OL7 A;  1TR5 A;  5EPK A;  4K6D A;  3I70 A;  2YU9 B;  5J1Z A;  3TP7 A;  3URY A;  3VYS A;  3S1N B;  2A6H D;  4G4K A;  3DWA A;  5CV8 A;  2EJM A;  5KGU A;  5C3X A;  2IX3 A;  3AMU A;  2FMM A;  1TWH B;  3D3R A;  1QJO A;  4C3I B;  2KCN A;  1A3V A;  3A8J E;  1BF4 A;  5LL6 X;  1Q3L A;  5A35 A;  5C4Z A;  2PNR C;  4K2K A;  3T13 A;  4X3S A;  3GTP B;  1IHZ A;  4FF2 A;  3OMG A;  1JOO A;  5D14 A;  3MXN A;  1S5B D;  3MTS A;  2R61 A;  1ESF A;  3SK6 A;  4BBR B;  3S17 B;  2F3W A;  2KOL A;  2KJX A;  1O7Z A;  1A15 A;  1MSG A;  5JEA H;  1LTI D;  3OWF A;  1OXU A;  4A3J B;  1GHJ A;  2O2L D;  1U9R A;  4K14 A;  3O13 A;  5J39 A;  1ZKO A;  2PO4 A;  3H6M A;  3K0Y A;  1ESR A;  5HUR A;  4MHE A;  2VB3 X;  5M5X B;  1HA6 A;  1GUN A;  3MVV A;  2HDM A;  3EJI A;  2EOT A;  5AFW A;  5FK9 C;  4PMW A;  1JE4 A;  3NP8 A;  3I73 A;  2K03 A;  4RKB A;  3FDT A;  1EYD A;  2RKS A;  4ZRZ A;  3WOF A;  2E76 C;  1LTA D;  3MZ5 A;  4LAA A;  1DD2 A;  2JP1 A;  3I72 A;  2WIN B;  3SXH A;  2DNE A;  1CI3 M;  3D6W A;  1LV9 A;  4XT3 B;  1PZI D;  3G6J B;  1PTO H;  3BDL A;  4O42 A;  1V1O A;  5JVG 3;  3RD4 A;  4DNR B;  3RZD B;  4DF7 A;  4XQN A;  3D4R A;  1ZYR C;  1I4X A;  2M2L A;  2AWN A;  2SOB A;  5CV7 A;  1AZQ A;  4CJ0 B;  1EEF D;  4IUP A;  5KYL A;  1I4P A;  4K8I A;  3QOL A;  1HXY D;  1D1I A;  2NN6 H;  3A8I E;  4PV1 C;  1H9R A;  1S4Z A;  4IFD H;  1STH A;  1SYE A;  5K36 H;  1STA A;  4QUC A;  5JAV A;  1DOL A;  1HTL D;  1KDB A;  4C1N I;  2A5H A;  1Y8O B;  1F77 A;  2WAC A;  5I2X A;  4G7Z C;  1PRT F;  5IGE A;  2H4O A;  2A69 C;  1TS3 A;  1Z47 A;  3TME A;  2EYM A;  3FVQ A;  1EYC A;  3NQT A;  3KF8 A;  4HAE A;  1T5X D;  1EOT A;  3RLF A;  5C6A A;  4KD3 A;  1LAC A;  1SYB A;  4WJW A;  1R4Q B;  4IZ8 A;  1YNN D;  3OHX C;  3K7A B;  4L63 B;  1EY5 A;  4WFN 3;  5C44 B;  1ILP A;  1PZJ D;  2F0H A;  1I3Q B;  3PV0 A;  3M85 A;  1ROD A;  2VB2 X;  3S2H B;  3EQL C;  1PYW D;  3SK5 A;  4BA1 I;  1FGB D;  1IW7 D;  3OOC A;  1EFI D;  2KEE A;  2N88 A;  3KBG A;  2F0N A;  1Q8I A;  4F8M A;  2NTT A;  2F4I A;  1LTB D;  3I3C A;  2RDF A;  1G29 1;  4PQX A;  3IFD A;  1SAP A;  3HZX A;  1H9S A;  1TWC B;  3WOE A;  1TS5 A;  1TKW B;  4G57 A;  5C0X I;  1IYV A;  5DM7 3;  4ZUJ A;  3TZU A;  3SE0 A;  3NHH A;  1H9M A;  1EY7 A;  5M3F B;  1S5F D;  4G7H C;  4DFA A;  2E2D C;  3S16 B;  2KVM A;  4DK1 A;  2O5J C;  2BA1 A;  4BS9 A;  2QEJ C;  1S5E D;  2AUK A;  1DOK A;  4OIK A;  1CHQ D;  1STG A;  2VNU D;  3C2P A;  2Y0S B;  3HOV B;  3ND9 A;  2Z4I A;  2FFK B;  4FVM A;  4LJZ C;  1Y8N B;  3U9O A;  5A2Q L;  4RGM A;  3Q0A A;  2BE5 C;  3DXJ C;  1KNA A;  1S5C D;  4C1N K;  3MA2 B;  1QIL A;  1I4R A;  5JJZ A;  1TU2 B;  1U4R A;  5IGG A;  3MXP A;  2LKV A;  1BNZ A;  1TY2 A;  2IWH A;  4ILW A;  2NN6 G;  3BDO A;  1G8Z D;  1JC7 A;  2IX1 A;  4LMQ D;  1V1P A;  2F0O A;  3S1Q B;  4A3E B;  1K8M A;  1SE2 A;  2Q8T A;  2ID0 A;  3VYU A;  1U4P A;  4N9T A;  2OF1 A;  3SVM A;  3FRP B;  1GUG A;  3A7A B;  1HA5 A;  1JOQ A;  3QIA A;  4IUV A;  1PRT B;  3FKI B;  4FXD A;  3HOY B;  1PFM A;  1LTR D;  5IOC A;  4X3U A;  3KLS A;  2F0W A;  4ZYS A;  3J80 L;  2R7Z B;  3RMH A;  1RD9 D;  5M3M B;  2L55 A;  1RTO A;  1R4P B;  2NVT B;  4DAY A;  4EGV A;  4CHT B;  3IL8 A;  1WVL A;  1BUV T;  2K05 A;  5BN3 A;  2CW0 C;  5IGD A;  2IPK D;  2F0K A;  4Z9C B;  2EYH A;  1BDO A;  2F0U A;  1RKN A;  3VR2 A;  4HMJ A;  2K01 A;  2RSO A;  5KEE A;  5LL6 S;  2RDG A;  1C4Q A;  3SHL A;  4MN3 A;  3T53 B;  2EJG C;  2D62 A;  1SMY C;  2H1E A;  4K2L A;  3EA6 A;  4KHZ A;  1UNS A;  5ELE A;  5C5L A;  1NR4 A;  5D65 A;  3UI2 A;  1FNV A;  2XRQ D;  1EY6 A;  5M5Y B;  4ZUI A;  1S5D D;  3L7Z C;  3K6O A;  5C0X H;  5EGT A;  1EU4 A;  5C4J B;  1I6H B;  4DNT B;  1SJH D;  2VXW A;  2PMZ B;  1VF5 C;  4ZK9 B;  5CV9 A;  2QDB A;  4ODG A;  1PFB A;  1RHP A;  3I4L A;  5I6W A;  3HKZ B;  4BBS B;  1EU3 A;  1KNE A;  1G6Z A;  5EPL A;  5D3I B;  2ZT9 C;  4KY7 A;  4TKO B;  5D3D A;  3MAQ A;  2L5T A;  5T1G A;  1BR9 A;  2WP8 J;  4R8N A;  1NCV A;  1O80 A;  2J7Z A;  3MC0 B;  4JK1 C;  1D5X C;  1UUP A;  2N55 A;  1IKL A;  5KNB A;  2WKD A;  3L3O C;  3NUC A;  1HHV A;  4X3K A;  3GQB A;  1QG7 A;  1DYQ A;  4IUT A;  5CV5 A;  3T4A C;  2IW3 A;  2JE6 I;  2C9O A;  3P20 A;  4UAI A;  4IN3 A;  3HEJ A;  2K5Q A;  2EE1 A;  3NE5 B;  1SSO A;  1ZYR D;  3NTI A;  5G3L D;  1EQT A;  5C3W A;  4E6I A;  4U68 A;  4FXK C;  3H3V C;  2R6G A;  1A2U A;  3VA5 A;  2R3Z A;  4IUU A;  4EQN A;  5KRU A;  4C2M B;  4KJN A;  2JYO A;  1PLF A;  1EY8 A;  2BA0 A;  3BDC A;  1DON A;  1PRT C;  4IQZ A;  4XTC S;  3F2U A;  1SXT A;  3MFY A;  3SDZ A;  5IGC A;  2K5W A;  1M8A A;  3TBI B;  2DY7 A;  1BCP D;  2A74 C;  4DAV A;  1SNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...