1TIID

Escherichia coli heat labile enterotoxin type iib
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLSGMRVNMCASPASSPNVIWAIELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords HEAT LABILE ENTEROTOXIN TYPE IIB
publication title Crystal structure of a new heat-labile enterotoxin, LT-IIb.
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 98
sequence length 98
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1996-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.50 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1tiiD00
4FO2A 4FP5D 1QCBD 5G3LF 1QB5D 4FNFA 5G3LD 1TIID
chains in the Genus database with same CATH superfamily
4RA8A 1JE5A 4IUUA 2UXCQ 4OWWB 4A3GG 1WJJA 1I3QH 2L4NA 2JK8A 2Q2IA 4YY3Q 1YVCA 5CBEE 3UE1A 5I6WA 4YY3L 3BDOA 2NZ1D 1IW7D 1HXYD 3S2DH 1DM0B 2D0PA 4P74A 5IGBA 4POGA 5EAYA 1E22A 2Q2TA 1EU4A 2EYLA 4LFBL 1I94Q 1V8QA 2CVRA 1X3EA 3AYHB 1WTOA 3S17H 1ZXTA 5AJ3L 3Q0AA 4JI2Q 3DWAA 4LUVA 1LTID 5JVH3 1ICWA 1C9OA 4IZ8A 1K8OA 1G8ZD 3NPPA 4LK1C 1X65A 1X3GA 3J80E 1N36Q 1TKWB 4K6LA 1X3QA 1BF4A 1K28A 1V43A 5KNBA 2BH8A 2ZTDA 5C3EB 3GP7A 1DONA 2L1BA 1A15A 2DN8A 3HOWB 4YCUA 4JYAQ 5I6YA 3I73A 5E7NA 4L5QA 2Z9HA 3PIOA 3STBC 4L5RC 4FP5D 1HZCA 3RZOB 5EPLA 2K5QA 2ASBA 5KIXA 1Y14B 1HRJA 3NP8A 1Y1VG 2KCCA 2K28A 3FPPA 1TWCH 4A3CH 1ML0D 1VQPA 1IBMQ 1SSOA 3KJPA 4OL7A 3MXNB 1TS2A 4A75A 3GTOH 5HY6A 2UXBQ 1DJRD 4DV6Q 2GN5A 4LFAQ 3OSOA 2Q8TA 1C8CA 4JBWA 4ID6A 3KF8B 4IJHA 3UDIA 2B2UA 1SRUA 2Z6KA 2G9HD 3OIQA 1WTQA 3B6YA 4A3DG 2PQAA 5KYLA 3E9HA 3U58A 5GAEC 1GUOA 1LT4D 5EGTA 5M9OA 3VYUA 3ND8A 3PSIA 2N3SA 4G7OC 1HH2P 1K83B 2E2HB 4BY1G 1IBLL 1VQFA 5C4XB 1CHQD 2JSOA 5CYUA 1UEAB 2J0TD 3PCOB 3VR4A 2VUMH 3SVMA 5I4DA 4X3SA 2WB1G 2ZTCA 2KBNA 4ZK9B 1R9TB 1VQGA 1Q90A 1Y8OB 4GN5A 5IODA 1C48A 4IFDJ 1PRTF 2V4DA 3N6RA 4YHHL 1XMQQ 1GHKA 1HA6A 2RCNA 2HD3A 4RCOA 2B8FA 1FVIA 4FF4A 4NMZA 5C3WA 4JOIC 1EZ6A 1WTVA 2R7FA 4QL5A 5FK9C 2UU9L 4DR4L 3CCRA 1GXDC 3PUXA 4MIUA 3P20A 4A3MB 4XT1B 3VR5A 2FFKB 3KLSX 5C44H 3MVVA 3MFGA 1CSPA 5ELEA 3S1QH 3QB3A 3I3CA 4I65A 1L2FA 2NZOA 2RKSA 4DR7Q 4PQXA 4DR7L 1WCMH 3H3VI 1Q8IA 3MEHA 5T1GA 1HHVA 2NZHA 2UUAL 3VYRA 2F03A 3CCLA 2BA1A 4OIKA 3EA6A 3EFXD 4KN4C 5IT9c 2DJFC 4KJNA 2F0GA 3NQIA 2YU9B 4APVA 4NPSA 2BH2A 5FLXL 3BDLA 2XSCA 5FJ8G 1N33Q 1HNXL 2XNAC 5ELNA 3W5OA 1E7ZA 4OO1G 3OHXC 1VQJA 5CR3A 1DD2A 4KKSA 3D0FA 4A3FB 4RKBA 2HUGA 1CKNA 4X3TA 1I4XA 1AE3A 1WD0A 2A68C 4K5WA 3MC0B 3LGJA 4HJAA 3M4OH 1RDPD 1K73C 4IUTA 2ZT9C 2EPBA 1LTSD 5M5WH 3M85A 3HOYH 4RMFA 2CH4W 1EUJA 4LF9Q 1TWCB 1JORA 1QZHA 1PYSB 3OMGA 3SR1A 3ZJYC 4WRDA 4A3JB 4JK1C 5LMNQ 2H5XA 5LMNL 3EJIA 3GTOB 1MJCA 1XNRQ 5NUCA 2X6LA 1UE7A 1F9QA 1A63A 1B50A 3KF6B 2JP1A 2LY7A 1PH4A 4EQ5A 2HQLA 1YI2A 4XQQA 3CPWA 4OO1I 2BE5D 1PTOD 4JPBW 4GLXA 1LTBD 1UE1A 4A3BG 4NDXA 4R8IA 1X3PA 2IWHA 4DV5Q 4DV5L 5FOBB 1BXTA 1TWGH 2RF4A 3CCQA 1OXUA 2AQ2B 2CQOA 3NE5B 3VA7A 4H02A 1N32L 4TRDA 2K01A 1FYCA 4G7ZC 2VUMB 2IX3A 1KLUD 4DAYB 4IALA 2B2VA 4B3SL 4HJ7A 5JJKA 4IOCA 1K9MC 5A2QE 1PTOB 1V1PB 1VMPA 2ALYB 4JI8L 1LTRD 3T56B 3H91A 3TP5A 3S2HH 1V1OA 3NTIA 3HRZC 3T1YQ 3HFZB 1JOOA 4NXNL 3BJUA 2V1CC 3JAMi 2LKVA 1EFWA 4LUZA 2K5NA 1AH9A 3G4SA 4WJ4A 1PZID 1NMGA 2F0TA 1XXGA 2XRQD 3L7ZC 1NBWA 4J15A 2F3VA 4LW1A 5EKLA 4YCVA 5C44B 2QEXA 4FXDA 4HCEA 1HJPA 5DNFA 5K5PA 4EQPA 4HEDA 4JBKA 1WCMB 5E4XA 4QUFA 2C35B 2O4XA 1PH1A 3SDZA 3OTOL 1BVSA 3GD7A 3BVGA 1HTLD 3UE0A 3KLSA 4OWXB 2AQ1B 4TSSA 4X6AH 3J7A5 3FKIG 2A74C 3AQQA 3H09A 1SR3A 2K5WA 2B39A 3DWQA 3PO2G 2L15A 4BBSH 2ZJPA 3NEMA 4YWKA 4K5XA 1RODA 3CD6A 2KHJA 2IW3A 1MI2A 4KD4A 3PMFA 1IW7C 4LNQA 1STNA 3PGZA 1Z47A 1PA6A 1Y1WG 2NVXH 2IHFA 2NB0A 1QVGA 4HIMA 1HQMC 1JQYD 1KXLA 1XX8A 1J5EQ 5C0XH 2F0FA 4FF2A 2Y0SB 2VQFL 1T9HA 4A76A 3QG1A 4AH6A 2HIVA 2RA4A 1EYDA 2WINB 5JEAH 1VQEA 1EYGA 1Z6HA 1A3TA 4MN3A 3HOXB 2GVBA 4JI3Q 2Z8LA 3OWFA 4R9WA 1MGSA 1E1OA 2Y0SE 4QMGA 3K81C 4C3IH 2NVTH 3I4OA 3I91A 4XQNA 2MJ8A 1O7IA 2B8GA 1U4RA 5DAUA 3I4MG 1TWGB 2K4KA 5KNCA 1LTTD 4FNFA 3GTGH 4K2KA 2ZJRA 2DUDA 4A3GH 1NY4A 4Y7NH 1Q7YC 3Q8DA 3W2DA 1NR4A 4Y52H 5CORA 3UI2A 2AWNA 1Q1EA 1PRTD 1L0XB 2D0OA 2NTTA 4FDBA 3TZUA 4GKJQ 3SK5A 4H13C 4GKJL 1JB3A 4S3SA 3S2HB 1BBUA 3C46A 4DR3Q 1BO0A 2E75C 5D3IB 1DOMA 1S5ED 1VQKA 3C2PA 1VQ8A 1GUGA 1NCVA 1HR0L 4HSVA 3GDEA 2QEJC 2JQOA 1KQSA 1WYDA 1XMOQ 2JA7G 1PRTB 3PUYA 1XMOL 3WWVA 1UE6A 5FO7B 1LT6D 1HNWL 1JE4A 1CKMA 1EIGA 1G2SA 2EYOA 4K6DA 4RWSC 5IGEA 4B3TQ 4B3TL 4BS9A 1B44D 3IRBA 1STGA 1CZGA 3E5SA 1R4QB 3S1RB 1UUPA 4I7ZC 3TP7A 2CFMA 4M8AA 2UUCQ 4BBRG 1PH8A 2UUCL 2E5LL 5T1IA 1EIFA 1W6KA 4O42A 1KNAA 4GKKL 3LX0A 1Y8NB 1Y1VH 3I2ZA 3GTPH 3DMUA 3NTHA 2HHHL 3HOUG 4LF6L 4LF8L 1Q12A 5IOCA 1VQMA 1TWHH 1VQDA 4DUYL 2OT2A 4PZ8A 1VQIA 3D4RA 3J80c 4RAUC 2R93G 4BBSB 4HIDA 3ER0A 1U4PA 2MFIA 1IYUA 3G71A 1Q82C 1D7QA 5CV6A 3JAML 3KFUA 1D5XC 4A3DH 3FMCA 4JW0A 4JI4L 5M5YB 1CKNB 2IL8A 1IYVA 5CV8A 4HJ8A 4HAEA 4GOPB 1QOHA 5A35A 3HKZB 2K6AA 1A3UA 1BKBA 3SEBA 3K5LA 4BY1H 2VXWA 1OXTA 1WTPA 4DNRB 4K14A 4ZLTF 4MTNA 5C4ZA 1CA6A 4CDFC 2B2YA 3H3VH 2F0NA 5ELBA 2D2CC 3QJYA 4DV2L 3TRZA 3FRPB 4QJFA 1SLJA 2MUYA 1I5FA 4BA2I 5CMDA 2VS1A 5FLXE 2RCFA 4EGVA 3KBGA 1EOVA 4RGNA 4GZYC 3KLRA 4OIJA 1FGBD 3RD4A 3MAQA 4C3IB 2NVTB 4R4QA 2NVQH 1QNUA 1Q81C 4DUZQ 4R4OA 4PNYA 4DUZL 2QKIC 3U4ZA 3KLWA 3HOZG 4DV3L 1SNDA 2X69A 2NVYB 4RHSA 4Y7NB 4OELB 2ATWA 3K5MA 4QQBX 4KD3A 3PO3G 4OGQC 3M3YB 1G6PA 1IBKL 1HTPA 1STBA 2NN6G 3G6EA 4HJ5A 2B2WA 1HPCA 3BU2A 1N8RC 5FLMG 2Z1CA 3PIPA 5IIFA 1SYBA 1K3BC 5M5XB 2VB3X 2QGQA 2QW7A 1HCZA 2BE5C 4KV6A 3CCJA 2JEAI 2D62A 1PTOC 1YHQA 3MTSA 1VF7A 5EPKA 2AHOB 2L55A 5FJ8H 4GNXB 4P73A 1H9SA 3M4YA 1MIUA 1E2ZA 3HG9A 4LAAA 1VQCA 4Q5VA 4OO1H 1ET6A 1QCBD 1C0AA 4IPCA 4X66Q 2WV6D 1YHBA 4X66L 3A8JE 1D8LA 5IWAL 1MSHA 1Y69U 4N9PA 3NSWA 4K2LA 1ET9A 2VQEL 5EJWA 5C6AA 1B9MA 1ENCA 2NN6I 2E2DC 3D4WA 4ZYSA 3S15B 3GTPB 3O13A 5GQOA 3TREA 3PIP3 2NBFA 2EZVA 2UXCL 1BUVT 1RKNA 1WD1A 3ULLA 4A3IG 1AW7A 1X9NA 1TWHB 4A3EG 1BR9A 3MXGA 2QA4A 3UDGA 4A93B 1KAAA 3GTKH 2HDLA 2K5VA 3HOVB 1NJIC 3F2DA 1I94L 1LTLA 5J39A 2RBMA 1SYEA 1G6ZA 1KD1C 5M3MG 4QUCA 1CT1D 4DK3C 3NTKA 5HURA 5GAGC 4JI2L 2EY2A 5FO8B 2F0VA 1RF2D 2AWOA 1RHPA 4BWGB 3H0GG 2XWJB 2O5JC 1N36L 2E2JB 4A3BH 2K33A 5EKKA 5GAHC 1XPOA 4HR7B 1Q1BA 4IJLA 4ZKBB 3S16B 4PZ6A 2R7DA 4NP5A 1PHJA 4BY1B 2I0QA 4JYAL 3AMUA 2B2TC 4PMCA 3HEJA 1QZGA 3J81i 2R61A 1FJGQ 2K32A 4RG1A 4XYQA 3NBIA 2F0KA 5KYIA 3AEVA 2I5LX 2K7VA 4RH6A 5I9OA 3S1MB 3I70A 4MHEA 2R6GA 5BN4A 5IP7G 1EWCA 2N55A 4DAVA 4H44C 1QG7A 1L1OB 3PUZA 2F4VQ 1IBML 4I7AA 2F4VL 3X3NA 3U50C 5AFWA 2B63G 2K5DA 2UXBL 2A69C 2JA8G 1F2YA 5J1ZA 4DV6L 4LFAL 1SNCA 1H9KA 5M3FG 2IX0A 4R4CA 1TWFB 4ZQ3A 5CBAE 2B2UC 2K03A 3VDYA 1VQ7A 4N8FA 4ME5A 3VR6A 4DV0Q 3T13A 4K5VA 3CW2C 4IFDI 4DV0L 2XGTA 4OXPA 4OONA 1PH7A 3J7ZC 2Z6BA 3ZYYX 3PIO3 1SE3A 4X64Q 4X64L 4B3RQ 3UDFA 4OHJA 1TWAH 3KYHC 2MO0A 2WACA 1EIYB 2IT1A 4DR1Q 1SN8A 2XIWA 4IPDA 1S5BD 1PXUA 1I4GA 4K8JA 1HA5A 3FKIH 3CCUA 2ID0A 2VZAA 2JJQA 3VR2A 5EPJA 1GKHA 4MNOA 3PO2H 3F2BA 4JI1Q 2EY1A 1KLGD 5C3EG 2UXDQ 4JI1L 3A54A 3I55A 2E74C 3HOWG 1GJXA 2GA4B 3GTJB 1EWIA 2L12A 3C1FA 1B3AA 1F9SA 1XMQL 1PRTC 1BCPF 4DFAA 3NBHA 4O2DA 4C2MB 2XVSA 1T5EA 1YNJD 1Y1WH 2VL6A 1EU3A 5K36G 1TS3A 4FVMA 1LTAD 3OPOA 3RMHA 1PYBA 5KEEA 2SNMA 3GV6A 1I3QB 3X3MA 3RLOA 2ZXRA 1PFBA 3S2DB 3QIAA 3T1HQ 3RUZA 4LF7Q 3T4AC 1IKMA 3A55A 3DUZA 3J81j 1LABA 1X6OA 2LXKA 4CDCC 2AUKA 4L63B 3E6ZX 4IN3A 1YIJA 2DGYA 2RDGA 3S17B 1CHPD 4LMQD 2WIIB 2ICEC 4P71A 1RIPA 1N34Q 3ERSX 3N52A 2DNEA 4JI5Q 1GOZA 1CQFA 1N33L 4DK6C 4C3HG 3I4MH 1NAPA 1VQAA 2EE1A 2RDFA 4A4IA 1HZAA 2RQXA 1VQ6A 3NK9A 2KHIA 1CI3M 2KA7A 2Q2HA 4GOPC 1I50H 5IP9G 4EVOA 1NE3A 2KCMA 2F0JA 4R4IA 2EYMA 4OX9Q 1J8IA 4DXGA 1TT2A 2BDOA 2IPKD 4DV1Q 3HKSA 2EJFC 4LF9L 2MHVA 1YHAA 2JYOA 2E8GA 1SYGA 2KJXA 5IE8A 3D6CA 2MQHA 1XNRL 1EL0A 4L8JA 4J8QA 3JAME 2JA7H 1U5KA 2WAQB 1J6QA 4A3MG 4UY8C 1X55A 1TXYA 5CV7A 4A3KG 2R7ZG 4JC0A 2KECA 1E1TA 1D5ZC 1IKLA 1WVLA 4FXGC 4GLAC 2WAQE 4BBRH 5C4JH 1WTXA 2SOBA 3PV0A 1DOLA 1JB7A 5BR8Q 2C9OA 1BNZA 1F9RA 1EQTA 2F0PA 3J81L 4UP9A 5C4HA 4PG3A 4BA1I 3HOUH 3NELA 4PV1C 1DGSA 1KABA 2EY5A 2A6HD 4DK1A 4B9XA 3PO2B 2R93H 5CV9A 4HIOA 2WP8J 4RKLA 1N9WA 4DV7Q 2EJMA 1O7ZA 2LSSA 3A0JA 1A6XA 2B29A 4GNXC 3T1YL 2KQ3A 4A3FG 3QWNA 2EIFA 1B3QA 4JI7Q 3E9IA 4JI6Q 4JI6L 5I9PA 3E0EA 4B3MQ 3F1ZA 2A1AA 2ZTEA 4B3ML 4B08A 3MXUA 5JJIA 1BBWA 3TSSA 3MFYA 1PZKD 1BDOA 1F2LA 1ASYA 1XWEA 3DWPA 3S1QB 3W1BA 3CHBD 5JJZA 3A5UA 4A3JG 1ICFB 3F2CA 5EKIA 5LMNW 5IGDA 2E2IH 1UNSA 1TVXA 4KMUC 1XNQQ 4WJ3M 3URYA 1XNQL 1VQNA 2PNHA 1QJOA 1JJ2A 1SYFA 4ABNA 4BXXG 3A7AB 4XDXA 3S1NH 4GN4B 2WKCA 1JCKB 2CQAA 1PMRA 3M4PA 1TIID 2K04A 3A7LA 1SEBD 2I07B 2I5HA 3HOZH 1SE2A 2X6GA 4WFN3 2NUCA 1X32A 4AYBG 5DM73 2ZM6Q 4HJ9A 2ZM6L 1HZBA 3AU7A 3SE0A 4C3JG 1SMYD 3PO3H 3K58A 2NN6H 3JC66 4DGZA 3M4OB 2E76C 2M9VA 1O7YA 1EWHA 3TS2A 1U9RA 5FLMH 5M5WB 3HOYB 1E2WA 2F52A 3J7AV 3F2UA 2CCZA 4LUOA 2ENBA 3MWYW 4ME3A 2D9UA 5IGGA 5FLXc 2Q2UA 1J5EL 3E3XA 2MNAA 2G9DA 1O80A 5IGFA 1YNXA 2PZUA 1GHJA 2EYJA 3CMAA 2CWPA 5BN5A 2IX1A 1L1OC 1NTGA 2Z0SA 1EY5A 3LWEA 1Q46A 2JA7B 4DV4Q 1AP0A 2NTSA 4Q0FA 4JI3L 4QB4A 3R8BA 2I46A 3BZCA 3Q23A 2KCNA 1PH6A 2PQAB 3TP8A 1A3VA 4UHVA 2I5MX 1FNVA 3RZDH 1SMXA 4HMJA 4CKCA 5C4JB 3I90A 5JJLA 3DM3A 4ZAIA 1E0BA 1G2TA 3L0OA 2KOLA 3J7YW 1VQ4A 2IY5B 1JMCA 3HOUB 2M00A 4A3IH 1Q86C 1NNXA 1D6EC 3GTQH 4A3EH 2R93B 4LFCQ 2HCCA 1BCPD 3CRLC 4RGTA 1DCZA 1EY6A 4DR3L 1YJWA 5M3MH 2XWBB 1V9PA 4FXKC 4ZUIA 3TZDA 4AQYQ 5KGUA 2F0LA 4CGYB 1TS5A 3H0GH 4JV5Q 3NBHB 1B70B 2K14A 1JR0D 2KCTA 1ENFA 1JJGA 5DEHA 2QDBA 1AEXA 4LWCA 5ELDA 1KRSA 3EQLC 1BCPB 1O78A 1KNEA 2Y0SG 2PZWA 1AZPA 2FMMA 3KJOA 2QILA 3PUVA 2C5CA 1SAPA 4IO9A 1H95A 1OTCA 1AZQA 4LF4Q 3NUCA 3HOXG 2EYHA 5IP7H 5I2YA 3S1NB 1I4PA 4RGMA 3GQBA 1YBYA 1YNJC 1QVFA 2FINB 1PZJD 2B63H 3BYTB 5D3DA 1RTOA 2PW5A 3W3AA 4KHPQ 2JA8H 3NXWA 4C56C 3A8IE 2H4OA 5M3FH 4KLKA 4QIWB 3CCMA 2F3WA 3S24A 1QE6A 1P16A 3CCEA 5COYA 3H6MA 4BY7G 5E1FA 5KNDA 1MBYA 3PO3B 1EFID 1JJCB 4CJ1B 3K5OA 4F88A 2NVXB 1HUMA 3RNUA 1PLFA 2CKZB 5TSSA 4QIWE 3V96A 1X56A 1I6HH 4KJOA 2JA5G 5DM63 3SXHA 1D5MC 4KN7C 5CV4A 2F0WA 1CK1A 1HR0W 3R3OA 2FXQA 2QF7A 1SROA 4DA2A 3HKZE 2JA6G 3NWTA 3ONAB 1HUNA 5IYDG 5C3EH 1P8LA 3GTLH 3TQYA 2ICIA 1QB5D 5ELFA 3HOWH 4DKAC 1I4HA 1X54A 3HS0C 3OMCA 4JVZA 4NW2A 3PF5A 1ILQA 1QWYA 3RZDB 2RHSB 2KVMA 1STHA 5K36H 3RZOH 1NR2A 1LACA 2KEDA 3U9OA 2F0QA 1PDQA 2KEEA 3A8KE 3GTGB 1CKOA 4A3GB 3BZDB 2EJGC 1B8AA 4IUVA 3I72A 1EQQA 1PFMA 3RLNA 1LYLA 1PFNA 4X62Q 4NB3A 3GTQB 1JT8A 4X62L 2RSOA 3TS0A 1RJTA 4DR5Q 3CKIB 1JWMD 3D31A 3W1GA 5M3MB 1S5DD 1RD9D 2SEBD 4E6IA 2F0HA 1A2TA 3G7LA 4P2CB 2IJ0A 1M4VA 2XRSD 4DR6Q 4C3HH 2OXPA 1Q8KA 1LT5D 3NHHA 1FNWA 3FVQA 2E2HH 1QVCA 2HT1A 5L37A 1DYQA 3D4DA 1S40A 3L3OC 5F2DA 4JI0Q 5IP9H 1XYIA 2A6HC 3TEHB 1E24A 1V1PA 4CHTB 1R9TH 2ES2A 2R3ZA 3J81E 1BBXC 1C4QA 3K80C 1Y1VB 4H7BA 1KDBA 4NXMQ 1SYDA 1S4ZA 2CWAA 4XIGS 3MA2B 1CA5A 1OXXK 1SBBB 2B63B 5IT9L 2UUBQ 1JWUD 2R92G 4GN3B 4YWLA 1JOKA 5IY0A 3R2IA 3CRKC 2LS01 4DN4M 2JEBI 4A3MH 1SJHD 3CP0A 3AB9A 4A3KH 2R7ZH 1U0LA 4A3DB 1LUZA 2WKDA 1EZ8A 3OOCA 3KDFA 1ZYRD 3I4LA 4DXFA 1DOKA 5C0XI 4HSPA 2OQKA 1JOQA 2AUJD 1G291 5LHY1 3CF5A 4LFBQ 2SDFA 4IFDG 1I6HB 2PZTA 1NMFA 3OIPA 4YIJA 5JPMC 4CDDC 5AJ3Q 1K8AC 2OTLA 4IOAA 5JOBA 3HGBA 1M1KC 3ULJA 2VB2X 4KY5A 1SFOH 2YU9H 1CTMA 2J7ZA 2WB1B 1FJGL 3HP3A 3WOFA 3I4NG 2K75A 4JCVE 3DEPA 1EQVA 3H94A 3P7JA 1S3OA 4QGUA 3GTLB 5CC4A 2MGSA 3JAMc 1XTCD 5C0XJ 3FPUB 1K8GA 4FYDA 1YZ6A 3CCSA 2ZXPA 2A6ED 2PMZB 1SMYC 4TVAB 2WB1E 4A3FH 4CDEC 2B2TA 3VYSA 1B7YB 2NVQB 1Z9FA 5JEAJ 1B9NA 1FGUA 4G4KA 1WTWA 3Q6SA 1KL9A 1KRTA 2Z6KC 1GUNA 3IL8A 1J9OA 2N88A 1B1ZA 2PMZE 1EQRA 2O5IC 4A3JH 3C3LA 2K50A 5LL6S 1WOCA 1UE5A 4A93G 2J4XA 4XT3B 2Z4HA 1QILA 4A3LG 2RDHA 3EIVA 3D6WA 1KC8C 2WFWA 1HNZQ 3HOVG 1HNZL 1UAPA 4B3RL 4K0KQ 2LFNA 1SNPA 2EVBA 1EEFD 1I4QA 3TMEA 4G7HC 4BXXH 3J80i 2EY6A 4K0KL 4DR1L 4RFBA 1W3SA 1K0SA 2EXDA 1QNKA 4RHRA 5IYCG 1VQLA 1WI5A 3MEFA 2DY7A 4J6HA 4C3HB 4U68A 1D1KA 2G5DA 2AQ3B 2HDMA 2HCIA 2N49A 2UXDL 1F77A 4B9WA 1IBLQ 3VYTA 5FO9B 1QUQA 5HGQA 4DR2Q 3NQTA 1O7LA 4KK7A 1YNND 4XTCS 4C3JH 2GVAA 4DR2L 2PNRC 4J1MA 4DAMA 3BYYB 3BG3A 3LWUA 2O2LD 1BCPC 5C5LA 1CSQA 1PTOH 2A19A 1VQ5A 4GLVB 4V190 1CFMA 3FP9A 4YHHQ 1XPUA 4PZ7A 3TP6A 1FR3A 2N8NA 3D3RA 5G3LF 1TS4A 1IL8A 3CC2A 3T1HL 3CPFA 4LF7L 3GTKB 2UU9Q 4DR4Q 4HCSA 4K8IA 4JOIA 1SE4A 4DU9A 3I7FA 5CGKA 5CV5A 4YWMA 3PUWA 1CM9A 2PI2A 4EX5A 3KUPA 4A3KB 2R7ZB 1IL2A 4P75A 3IFDA 1F2MA 4ODGA 2CH4A 1N34L 2LXJA 3GTMH 3NENA 1B4OA 2Q8RE 5IYBG 4A3BB 3MXPA 4JI5L 3FHWA 3K8AA 4ZRZA 3ND9A 4H0LC 4QY7A 2VW9A 2UUAQ 1KHIA 5ISRA 5C4XG 1EYCA 1A62A 4JBJA 3BS1A 1I6VC 1SFOB 3K0YA 4IPGA 1VQHA 3TDQA 2PPBC 2FMCA 4PMWA 1JWSD 1T5XD 1HFGA 1HNXQ 3K7AH 4CKEA 1V1QA 2NYZD 4OX9L 1WTHA 1PH2A 3FDTA 3GV3A 1A0IA 4DV1L 4XXEA 4IQZA 4XYOA 4CBVA 3I8ZA 4CJ2C 1GUWA 4KKUA 1SNQA 2CHBD 2LMCB 3P1HA 4IUNA 2CW0D 2VY3A 2L0CA 3K0XA 3S9WA 4GOPA 2EDGA 4UP7A 1IXRA 1KTKA 4QCLA 1UEBA 4L5SA 1YITA 5KRUA 2JA9A 1PH9A 2YV5A 2SNSA 3OWEB 3VA5A 2EOTA 4DF7A 1TQOA 1VMCA 2EQSA 2EXZA 2NWGA 2OQ0A 4MZ9A 3EVQA 2JN4A 3CXCA 1TWAB 3CQZH 1Q3LA 3HOXH 5C5MA 3KK7A 5JAVA 1U4LA 5BR8L 1B2TA 1GD7A 2B2VC 1STYA 1K0RA 5ELCA 3CC7A 3PF4A 1ENAA 2Z4IA 3VR3A 3FKIB 1EY7A 3T51B 4P72A 3H15A 1YEZA 2OWOA 1SJED 4MTKA 3QOLA 2DY8A 1GUSA 1MHWC 2F0IA 3L2PA 3D8GA 2QDLA 2F4IA 3CCVA 4NKLA 1K3RA 4X3UA 1JICA 2PW7A 4UP8A 2ZJQA 1H9SB 3K7UC 4DV7L 1RL2A 3M7GA 1W2BA 3IAYA 1N32Q 2FJ2A 4AYBB 1G91A 3T16A 1EOTA 1XPRA 4BY7H 3A74A 4EQOA 4C3JB 4B3SQ 3OW2A 1Y1WB 3CAMA 1AFPA 3U4VA 4JI7L 1NSNS 4KKTA 4JI8Q 2BDNA 2RHQB 1A8VA 4AYBE 1OO9B 1X3FA 1KAWA 2JA5H 4A3CG 4NXNQ 1FNUA 3U9SA 2RVLA 4IURA 4GNXA 4TKOB 4IUPA 3J7AF 1S5FD 2YTXA 5C3XA 2JA6H 4DNTB 1EY8A 5IYDH 1PV4A 1VF5C 1H9RA 2WAQG 3J80L 4FF1A 1W6JA 2ZXOA 2OF1A 1M90C 4L5TA 3F8TA 1BOSA 2F0SA 3G6JB 4RCNA 3EBEA 3GTMB 2BA0A 1L0WA 3S1RH 3KDFB 1EY4A 3I4MB 2MPMA 3OTOQ 4ULLA 1DZ1A 4ILWA 3DHQA 2VUMG 1I50B 1YJNA 2OCEA 3MZ5A 4XQJA 1VQBA 2YTYA 3V05A 1PFSA 5E4WC 1D1IA 3STBD 1MKHA 3M9BA 3K7AB 4KY7A 4N9TA 5LL6X 2JE6I 1A2UA 4R4TA 3H3VC 5EBCA 4HN7A 2EYFA 1AN8A 1OXVA 1SNMA 4UDUC 2K5HA 5IT9E 2EYPA 5BN3A 1ZYRC 5M5YH 1E2VA 4G57A 3SHLA 3DEOA 1SXTA 5HGTA 3ITPA 1TY2A 3RN2A 3DXJC 2A69D 3OW7A 1MJEA 3K59A 3OYYA 1ASZA 3WDNA 1II3A 2FHTA 4DV4L 3KBXA 3BVMA 3K6OA 1DXMA 5C44G 4UPAA 1ZKOA 2YTVA 2VQFQ 1IYJB 1VS0A 1GVPA 4X65Q 1TR5A 2F1MA 1WCMG 4X65L 1ILPA 2HIXA 2M2LA 3ICEA 4BBRB 1Z7TA 3S14H 3CQZB 1SDFA 1FD7D 4F7XA 3Q24A 2XTIA 1L1OA 2TMPA 1LO5D 1RTNA 4R1JA 2A6EC 4N8X1 1VDZA 3MXNA 4HIKA 1KIXA 1OXSC 3IFTA 1SYCA 2PQEA 1C7YA 2R92H 2TSSA 2H1EA 4LJZC 2D5DA 5H1SE 3QOJA 4LFCL 2K52A 3KF8A 2L11A 4ZKCB 1PH5A 4KI0A 1R4PB 3TBIB 2F0DA 4FF3A 3AFPA 2NVYH 4BY7B 1MSGA 1WTRA 4AQYL 2BCOA 1MD2D 1QUQB 4ALPA 3M3YH 2N78A 3PQIA 1BQQT 4PMBA 4OWTB 4QF4A 2IHEA 4JV5L 1I4RA 5G3LD 5EQ0A 3NWSA 4JG2A 3K5NA 3HOYG 1H9JA 2KUMA 3J81c 4IFDH 5GROA 3FEWX 3RLFA 5M5XH 2JA5B 1G51A 2L9HA 4HMIA 1HR0Q 1UWVA 1ONLA 2E2IB 3CC4A 3IKJA 4HTHA 3SK8A 2MP1A 3SK6A 4O0AA 3I4NH 4JBMA 2JA6B 4M1UB 1SE8A 5EBDA 2OTJA 1FL0A 1NUCA 1KDAA 2Q8IB 4AIMA 5IGCA 4LF4L 1CZWA 1HNWQ 3ULPA 4UAIA 1U4MA 1CQVA 1GUTA 5E3FA 5JVG3 1KDCA 1YNNC 2VNUD 2XN9C 4WORA 5GADC 3BDCA 1HFNA 4KHPL 3QR8A 5D65A 2F0OA 2B3GA 3GO5A 3LNNA 2E5LQ 3HOZB 1STEA 1VQ9A 4EQNA 3I56A 4GKKQ 3S15H 4KHZA 1LM0A 4POFA 4DPGA 2HHHQ 1YJ9A 2PI2E 2KHSA 4C1NK 4WJWA 4X3KA 4LF6Q 1GO3E 1PYWD 4LF8Q 3M7NA 4R8NA 2MO1A 4DUYQ 1D2BA 4A93H 2A68D 1RCVD 5ELOA 2JXMB 3C1EA 1LV9A 5DLQE 4A3LH 2PYKA 3HOVH 1EIHA 4RGOS 1F9PA 1ZEQX 3P75A 2B2YC 4ZCKA 3M4QA 1EEID 4DK0A 1TY0A 5IYCH 4JI4Q 4FO2A 1Y8PB 4DAPA 1STAA 3TN2A 2AKWB 5JPNC 3K57A 2E2JH 3Q22A 2P5ZX 1SNOA 1EYAA 4F8MA 4IPHA 3S16H 4OEMB 2A73B 3G48A 1HZ9A 3MHBA 4LF5Q 4LF5L 1IHZA 5D14A 3UDXA 3BVZA 2HQEA 4C1NI 1S5CD 1EY9A 4DV2Q 2RSNA 2DNCA 4Z9CB 4KTAA 1EY0A 3S14B 3WOEA 5I2XA 3S1MH 1VCIA 3DM1A 1GM5A 5A2QL 4GS3A 2F0EA 3A56A 1XTDA 2CW0C 2QCPX 3E0JA 4IUQA 4A3IB 2B2WC 4A3EB 3EROA 3R2TA 2A8VA 2R92B 2F3IA 3KF6A 1LT3D 2AMCB 4BBSG 1TWFH 4DV3Q 4DR5L 1PVOA 1L0YB 1XJVA 1H9MA 1TU2B 4V0BA 5J22A 1PH3A 1IBKQ 3RN5A 3H0GB 3A5ZB 4KHVA 5IYBH 1E3PA 1LLRD 5LMUQ 4ZUJA 2PCFB 3EN2A 3CU7A 4DR6L 5LMUL 3RR5A 3AFQA 3HKZG 4U673 1PTOF 1ESRA 1K83H 3QO2A 3DLLA 3CMEA 2K05A 2OEOA 3BZKA 5C4XH 4DNIA 5C0XG 4DAYA 4L6TB 1K8MA 1M8AA 1IZ6A 4KY6A 2L5TA 4CJ0B 4JI0L 3T53B 1F2ZA 4TQUS 1JC7A 4YCWA 3R93A 3V2TA 1VQOA 3I4NB 2DJGC 5JEAG 3SGIA 4F87A 2YYZA 3L9AX 2A5HA 2F0UA 2KENA 4NXML 3ERQA 5J3BA 3GTJH 1HQRD 3KOJA 3HZXA 1AE2A 1B53A 2K1BA 1WFQA 4C3IG 5IWAQ 2BOSA 4O1NA 1S72A 1CUKA 4C2MH 4CKBA 2UUBL 2JA8B 1ESFA 3SK4A 2VQEQ 5FKAC 2PO4A 5M3FB 1LTGD 2F0MA
chains in the Genus database with same CATH topology
4RA8A 4IUUA 2L4NA 5CBEE 5I6WA 3BDOA 2NZ1D 1IW7D 1HXYD 1DM0B 5IGBA 1EU4A 2EYLA 1V8QA 2CVRA 1WTOA 1ZXTA 3Q0AA 3DWAA 1LTID 5JVH3 1ICWA 4IZ8A 1K8OA 1G8ZD 3NPPA 4LK1C 3J80E 1TKWB 4K6LA 1X3QA 1BF4A 1V43A 5KNBA 5C3EB 1DONA 3GP7A 2L1BA 1A15A 2DN8A 3HOWB 5I6YA 3I73A 4FP5D 3RZOB 5EPLA 2K5QA 5KIXA 1HRJA 3NP8A 2KCCA 2K28A 3FPPA 1ML0D 1SSOA 4OL7A 1TS2A 1DJRD 3OSOA 2Q8TA 1C8CA 4JBWA 4ID6A 2B2UA 2G9HD 3OIQA 1WTQA 5KYLA 1GUOA 1LT4D 5EGTA 5M9OA 3VYUA 3ND8A 4G7OC 1K83B 2E2HB 5C4XB 1CHQD 2JSOA 5CYUA 1UEAB 2J0TD 3VR4A 3SVMA 5I4DA 4X3SA 4ZK9B 1R9TB 1Q90A 1Y8OB 5IODA 1C48A 4IFDJ 1PRTF 2V4DA 3N6RA 1GHKA 1HA6A 4RCOA 2B8FA 4FF4A 4NMZA 5C3WA 1EZ6A 1WTVA 5FK9C 1GXDC 3PUXA 4MIUA 3P20A 4A3MB 4XT1B 3VR5A 2FFKB 3KLSX 3MVVA 3MFGA 5ELEA 3QB3A 3I3CA 4I65A 2RKSA 4PQXA 1Q8IA 3MEHA 5T1GA 1HHVA 3VYRA 2F03A 2BA1A 4OIKA 3EA6A 3EFXD 4KN4C 4KJNA 2F0GA 3NQIA 2YU9B 5FLXL 3BDLA 2XSCA 2XNAC 4OO1G 3OHXC 5CR3A 1DD2A 4KKSA 4A3FB 4RKBA 2HUGA 4X3TA 1I4XA 1WD0A 2A68C 4K5WA 3MC0B 1RDPD 4IUTA 2ZT9C 2EPBA 1LTSD 3M85A 1JORA 1TWCB 3OMGA 3SR1A 4WRDA 4A3JB 4JK1C 3EJIA 3GTOB 5NUCA 2X6LA 1F9QA 1B50A 2JP1A 2LY7A 4XQQA 4OO1I 2BE5D 1PTOD 1LTBD 4NDXA 4R8IA 1X3PA 2IWHA 5FOBB 1BXTA 1OXUA 2AQ2B 3NE5B 3VA7A 4TRDA 2K01A 1FYCA 4G7ZC 2VUMB 2IX3A 1KLUD 4IALA 2B2VA 5A2QE 1PTOB 1V1PB 1VMPA 1LTRD 3T56B 3H91A 3TP5A 1V1OA 3NTIA 3HRZC 1JOOA 2LKVA 1PZID 2F0TA 1XXGA 2XRQD 3L7ZC 2F3VA 5EKLA 5C44B 4FXDA 4HCEA 5DNFA 5K5PA 4EQPA 4HEDA 1WCMB 5E4XA 4QUFA 2O4XA 3SDZA 3GD7A 3BVGA 1HTLD 3KLSA 2AQ1B 4TSSA 2A74C 3H09A 2K5WA 2B39A 3DWQA 4K5XA 1RODA 2IW3A 1MI2A 4KD4A 3PMFA 1IW7C 1STNA 1Z47A 2NB0A 1HQMC 1JQYD 1XX8A 5C0XH 2F0FA 4FF2A 2Y0SB 3QG1A 2RA4A 1EYDA 2WINB 5JEAH 1Z6HA 1A3TA 4MN3A 3HOXB 2Z8LA 3OWFA 4R9WA 1MGSA 4QMGA 3I91A 4XQNA 2MJ8A 2B8GA 1U4RA 5DAUA 1TWGB 5KNCA 1LTTD 4FNFA 4K2KA 3W2DA 1NR4A 5CORA 3UI2A 2AWNA 1Q1EA 1PRTD 1L0XB 2NTTA 3TZUA 3SK5A 4H13C 1JB3A 4S3SA 3S2HB 3C46A 1BO0A 2E75C 5D3IB 1DOMA 1S5ED 3C2PA 1GUGA 1NCVA 4HSVA 2QEJC 1PRTB 3PUYA 5FO7B 1LT6D 1JE4A 5IGEA 1EIGA 1G2SA 2EYOA 4K6DA 4RWSC 4BS9A 1B44D 1STGA 1CZGA 3E5SA 1R4QB 3S1RB 1UUPA 4I7ZC 3TP7A 4M8AA 5T1IA 1W6KA 4O42A 1KNAA 3LX0A 1Y8NB 3DMUA 3NTHA 1Q12A 5IOCA 2OT2A 3D4RA 4RAUC 4BBSB 1U4PA 1IYUA 5CV6A 3JAML 1D5XC 3FMCA 5M5YB 2IL8A 1IYVA 5CV8A 4HAEA 1QOHA 5A35A 3HKZB 2K6AA 1A3UA 3SEBA 3K5LA 2VXWA 1OXTA 1WTPA 4DNRB 4K14A 4ZLTF 5C4ZA 1CA6A 2B2YA 2F0NA 5ELBA 2D2CC 3QJYA 3FRPB 2MUYA 4BA2I 5CMDA 5FLXE 4EGVA 3KBGA 4RGNA 4GZYC 3KLRA 4OIJA 1FGBD 3RD4A 3MAQA 4C3IB 2NVTB 1QNUA 4PNYA 2QKIC 1SNDA 2X69A 2NVYB 4RHSA 4Y7NB 3K5MA 4KD3A 3M3YB 4OGQC 1HTPA 1STBA 2NN6G 2B2WA 1HPCA 2Z1CA 5IIFA 1SYBA 5M5XB 2VB3X 1HCZA 2BE5C 4KV6A 2JEAI 2D62A 1PTOC 3MTSA 1VF7A 5EPKA 2L55A 1H9SA 3M4YA 1E2ZA 3HG9A 4LAAA 4Q5VA 4OO1H 1ET6A 1QCBD 2WV6D 3A8JE 1MSHA 1Y69U 4N9PA 3NSWA 4K2LA 1ET9A 5EJWA 5C6AA 1B9MA 1ENCA 2NN6I 2E2DC 3D4WA 4ZYSA 3S15B 3GTPB 3O13A 3PIP3 2EZVA 2NBFA 1BUVT 1RKNA 1WD1A 1AW7A 1TWHB 4A93B 1BR9A 3MXGA 1KAAA 2HDLA 3HOVB 5J39A 2RBMA 1SYEA 1G6ZA 4QUCA 1CT1D 5HURA 3NTKA 2EY2A 5FO8B 2F0VA 1RF2D 2AWOA 1RHPA 4BWGB 2XWJB 2O5JC 2E2JB 2K33A 5EKKA 4HR7B 1Q1BA 4ZKBB 3S16B 4NP5A 4BY1B 3AMUA 2B2TC 4PMCA 3HEJA 2R61A 2K32A 4XYQA 3NBIA 2F0KA 5KYIA 2K7VA 4RH6A 5I9OA 3S1MB 3I70A 4MHEA 2R6GA 5BN4A 1EWCA 2N55A 4DAVA 4H44C 1QG7A 3PUZA 3X3NA 5AFWA 2K5DA 2A69C 1F2YA 5J1ZA 1SNCA 1H9KA 2IX0A 1TWFB 4ZQ3A 5CBAE 2B2UC 2K03A 4ME5A 3VR6A 3T13A 4K5VA 4IFDI 3ZYYX 3PIO3 1SE3A 4OHJA 2WACA 2IT1A 2XIWA 1S5BD 1PXUA 1I4GA 4K8JA 1HA5A 2ID0A 3VR2A 5EPJA 2EY1A 1KLGD 3A54A 2E74C 1GJXA 2GA4B 3GTJB 2L12A 3C1FA 1B3AA 1F9SA 1PRTC 1BCPF 4DFAA 3NBHA 4C2MB 2XVSA 1T5EA 1YNJD 1EU3A 5K36G 1TS3A 4FVMA 1LTAD 3OPOA 3RMHA 5KEEA 2SNMA 3GV6A 1I3QB 3X3MA 2ZXRA 1PFBA 3S2DB 3QIAA 3RUZA 3T4AC 1IKMA 3A55A 3DUZA 1LABA 2AUKA 4L63B 3E6ZX 4IN3A 2RDGA 3S17B 1CHPD 4LMQD 2WIIB 2ICEC 3N52A 2DNEA 1GOZA 1CQFA 4C3HG 1NAPA 2RDFA 2EE1A 2RQXA 3NK9A 1CI3M 2KA7A 4EVOA 2F0JA 2EYMA 1J8IA 4DXGA 1TT2A 2BDOA 2IPKD 2EJFC 2MHVA 2JYOA 1SYGA 2KJXA 3D6CA 1EL0A 4L8JA 4J8QA 3JAME 2WAQB 5CV7A 2KECA 1D5ZC 1IKLA 1WVLA 4FXGC 1WTXA 2SOBA 3PV0A 1DOLA 2C9OA 1BNZA 1F9RA 1EQTA 2F0PA 3J81L 5C4HA 4BA1I 4PV1C 1KABA 2EY5A 2A6HD 4DK1A 4B9XA 3PO2B 5CV9A 2WP8J 4RKLA 2EJMA 1O7ZA 1A6XA 2KQ3A 3QWNA 5I9PA 4B08A 3MXUA 3TSSA 3MFYA 1PZKD 1BDOA 1F2LA 1XWEA 3DWPA 3S1QB 3CHBD 5JJZA 5EKIA 5IGDA 1UNSA 1TVXA 4KMUC 3URYA 1QJOA 1SYFA 4ABNA 3A7AB 4XDXA 2WKCA 1JCKB 2CQAA 1PMRA 1TIID 2K04A 3A7LA 1SEBD 2I07B 1SE2A 2X6GA 4WFN3 2NUCA 1X32A 5DM73 3AU7A 3SE0A 4C3JG 1SMYD 3K58A 2NN6H 4DGZA 3M4OB 2E76C 2M9VA 1O7YA 1EWHA 1U9RA 5M5WB 3HOYB 1E2WA 3J7AV 3F2UA 2ENBA 3MWYW 2D9UA 5IGGA 2G9DA 1O80A 5IGFA 2PZUA 1GHJA 2EYJA 5BN5A 2IX1A 3LWEA 2JA7B 1EY5A 1AP0A 2NTSA 4Q0FA 4QB4A 3R8BA 2I46A 3Q23A 2KCNA 3TP8A 1A3VA 1FNVA 4HMJA 4CKCA 5C4JB 3I90A 4ZAIA 1E0BA 1G2TA 2KOLA 3J7YW 3HOUB 2M00A 1D6EC 2R93B 2HCCA 1BCPD 3CRLC 4RGTA 1DCZA 1EY6A 2XWBB 4FXKC 4ZUIA 3TZDA 5KGUA 2F0LA 4CGYB 1TS5A 1JR0D 1ENFA 5DEHA 2QDBA 1AEXA 5ELDA 3EQLC 1BCPB 1O78A 1KNEA 2PZWA 1AZPA 2FMMA 2QILA 3PUVA 2C5CA 1SAPA 1AZQA 3NUCA 2EYHA 5I2YA 3S1NB 1I4PA 4RGMA 3GQBA 1YNJC 2FINB 1PZJD 3BYTB 5D3DA 1RTOA 2PW5A 3W3AA 3NXWA 4C56C 3A8IE 2H4OA 4QIWB 2F3WA 1QE6A 5COYA 3H6MA 5E1FA 5KNDA 1MBYA 3PO3B 1EFID 4CJ1B 3K5OA 4F88A 2NVXB 1HUMA 1PLFA 5TSSA 3V96A 4KJOA 5DM63 3SXHA 1D5MC 4KN7C 5CV4A 2F0WA 1CK1A 3R3OA 2QF7A 4DA2A 3NWTA 3ONAB 1HUNA 2ICIA 1QB5D 5ELFA 1I4HA 3HS0C 3OMCA 4NW2A 1ILQA 1QWYA 3RZDB 2KVMA 1STHA 5K36H 1NR2A 1LACA 2KEDA 3U9OA 2F0QA 1PDQA 2KEEA 3A8KE 3GTGB 4A3GB 3BZDB 2EJGC 4IUVA 3I72A 1PFMA 1PFNA 3GTQB 2RSOA 1RJTA 3CKIB 1JWMD 3D31A 5M3MB 1S5DD 1RD9D 2SEBD 4E6IA 2F0HA 1A2TA 3G7LA 4P2CB 2IJ0A 1M4VA 2XRSD 2OXPA 1LT5D 3NHHA 1FNWA 3FVQA 1DYQA 3D4DA 3L3OC 5F2DA 1XYIA 2A6HC 1V1PA 4CHTB 2R3ZA 3J81E 1BBXC 1C4QA 1Y1VB 4H7BA 1KDBA 1SYDA 1S4ZA 4XIGS 3MA2B 1CA5A 1OXXK 1SBBB 2B63B 5IT9L 1JWUD 1JOKA 3R2IA 3CRKC 2LS01 4DN4M 2JEBI 1SJHD 3AB9A 4A3DB 2WKDA 1EZ8A 3OOCA 1ZYRD 3I4LA 4DXFA 1DOKA 5C0XI 4HSPA 1JOQA 2AUJD 1G291 5LHY1 2SDFA 4IFDG 1I6HB 2PZTA 3OIPA 4YIJA 5JPMC 5JOBA 3HGBA 2VB2X 4KY5A 1CTMA 2J7ZA 2WB1B 3HP3A 3WOFA 3DEPA 1EQVA 3H94A 3P7JA 3GTLB 5CC4A 2MGSA 1XTCD 5C0XJ 3FPUB 4FYDA 2ZXPA 2A6ED 2PMZB 1SMYC 2B2TA 3VYSA 2NVQB 5JEAJ 1B9NA 4G4KA 1WTWA 3Q6SA 1GUNA 3IL8A 1J9OA 2N88A 1B1ZA 2O5IC 3C3LA 5LL6S 2J4XA 4XT3B 2Z4HA 1QILA 2RDHA 3D6WA 1UAPA 2LFNA 1SNPA 2EVBA 1EEFD 1I4QA 3TMEA 4G7HC 2EY6A 4RFBA 1QNKA 4RHRA 2DY7A 4J6HA 4C3HB 4U68A 1D1KA 2AQ3B 2HDMA 2HCIA 1F77A 4B9WA 3VYTA 5FO9B 3NQTA 1O7LA 4KK7A 1YNND 4XTCS 2PNRC 4J1MA 3BYYB 3BG3A 3LWUA 2O2LD 1BCPC 5C5LA 1PTOH 4V190 1CFMA 3TP6A 1FR3A 3D3RA 5G3LF 1TS4A 1IL8A 3GTKB 4HCSA 4K8IA 5CGKA 1SE4A 4DU9A 5CV5A 3PUWA 1CM9A 4A3KB 3KUPA 2R7ZB 3IFDA 1F2MA 4ODGA 1B4OA 2Q8RE 4A3BB 3MXPA 4ZRZA 3ND9A 4H0LC 5ISRA 1EYCA 3BS1A 1I6VC 1SFOB 3K0YA 2PPBC 3TDQA 2FMCA 4PMWA 1JWSD 1T5XD 1HFGA 4CKEA 2NYZD 3FDTA 3GV3A 4XXEA 4IQZA 4XYOA 4CBVA 3I8ZA 4CJ2C 1GUWA 4KKUA 1SNQA 2CHBD 2LMCB 3P1HA 4IUNA 2CW0D 2L0CA 3S9WA 2EDGA 1KTKA 4QCLA 5KRUA 2SNSA 3OWEB 3VA5A 2EOTA 4DF7A 1TQOA 1VMCA 2EXZA 2NWGA 3EVQA 1TWAB 1Q3LA 5C5MA 3KK7A 5JAVA 1U4LA 1B2TA 2B2VC 1STYA 5ELCA 1ENAA 2Z4IA 3VR3A 3FKIB 1EY7A 3T51B 1SJED 3QOLA 2DY8A 1GUSA 2F0IA 3D8GA 2F4IA 4NKLA 4X3UA 1JICA 2PW7A 1H9SB 3M7GA 3IAYA 2FJ2A 4AYBB 1G91A 3T16A 1EOTA 4EQOA 4C3JB 1Y1WB 1AFPA 1NSNS 4KKTA 2BDNA 1OO9B 1FNUA 3U9SA 2RVLA 4IURA 4TKOB 4IUPA 3J7AF 1S5FD 5C3XA 4DNTB 1EY8A 1VF5C 1H9RA 3J80L 4FF1A 1W6JA 2ZXOA 2OF1A 1BOSA 2F0SA 3G6JB 4RCNA 3GTMB 2BA0A 1EY4A 3I4MB 2MPMA 4ULLA 1DZ1A 4ILWA 3DHQA 1I50B 3MZ5A 4XQJA 3V05A 5E4WC 1D1IA 3K7AB 4KY7A 4N9TA 5LL6X 2JE6I 1A2UA 3H3VC 5EBCA 4HN7A 2EYFA 1AN8A 1OXVA 1SNMA 4UDUC 5IT9E 2EYPA 5BN3A 1ZYRC 1E2VA 4G57A 3SHLA 3DEOA 1SXTA 5HGTA 3ITPA 1TY2A 3DXJC 2A69D 3OW7A 3K59A 3WDNA 1II3A 2FHTA 3KBXA 3BVMA 3K6OA 1DXMA 1ZKOA 1TR5A 2F1MA 1ILPA 2M2LA 4BBRB 1Z7TA 3CQZB 1SDFA 1FD7D 4F7XA 3Q24A 2TMPA 1LO5D 1RTNA 2A6EC 1VDZA 3MXNA 1OXSC 3IFTA 1SYCA 2PQEA 2TSSA 2H1EA 4LJZC 2D5DA 3QOJA 3KF8A 4ZKCB 2L11A 4KI0A 1R4PB 3TBIB 2F0DA 4FF3A 4BY7B 1MSGA 1WTRA 2BCOA 1MD2D 1BQQT 4PMBA 4QF4A 1I4RA 5G3LD 5EQ0A 3NWSA 3K5NA 1H9JA 2KUMA 4IFDH 3FEWX 3RLFA 2JA5B 2L9HA 4HMIA 2E2IB 1ONLA 3IKJA 4HTHA 3SK8A 2MP1A 3SK6A 2JA6B 4M1UB 5EBDA 1NUCA 1KDAA 2Q8IB 5IGCA 1CZWA 4UAIA 1U4MA 1CQVA 1GUTA 5E3FA 5JVG3 1KDCA 1YNNC 2VNUD 2XN9C 4WORA 3BDCA 1HFNA 5D65A 2F0OA 3GO5A 3LNNA 3HOZB 1STEA 4EQNA 4KHZA 2KHSA 4C1NK 4WJWA 4X3KA 1PYWD 3M7NA 4R8NA 1D2BA 2A68D 1RCVD 2JXMB 3C1EA 1LV9A 2PYKA 1EIHA 4RGOS 1F9PA 1ZEQX 3P75A 2B2YC 1EEID 4DK0A 1TY0A 4FO2A 1Y8PB 4DAPA 1STAA 3TN2A 5JPNC 3K57A 3Q22A 1SNOA 1EYAA 4F8MA 2A73B 3MHBA 1IHZA 5D14A 3BVZA 2HQEA 4C1NI 1S5CD 1EY9A 2RSNA 2DNCA 4Z9CB 4KTAA 1EY0A 3S14B 3WOEA 5I2XA 1VCIA 3DM1A 5A2QL 2F0EA 3A56A 4IUQA 2CW0C 2QCPX 3E0JA 4A3IB 2B2WC 4A3EB 3EROA 3R2TA 2R92B 1LT3D 1L0YB 1H9MA 1TU2B 4V0BA 5J22A 3H0GB 4KHVA 1LLRD 4ZUJA 2PCFB 3CU7A 4U673 1PTOF 1ESRA 3QO2A 2K05A 2OEOA 5C0XG 4DAYA 4L6TB 1K8MA 1M8AA 4KY6A 2L5TA 4CJ0B 3T53B 1F2ZA 4TQUS 1JC7A 3R93A 3V2TA 3I4NB 5JEAG 4F87A 2YYZA 3L9AX 2A5HA 2F0UA 3ERQA 1HQRD 3HZXA 1B53A 2K1BA 4C3IG 2BOSA 4O1NA 4CKBA 2JA8B 1ESFA 3SK4A 5FKAC 2PO4A 5M3FB 1LTGD 2F0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FO2 A;  4FP5 D;  1QCB D;  5G3L F;  1QB5 D;  4FNF A;  5G3L D;  1TII D; 
#chains in the Genus database with same CATH topology
 4RA8 A;  1JE5 A;  4IUU A;  2UXC Q;  4OWW B;  4A3G G;  1WJJ A;  1I3Q H;  2L4N A;  2JK8 A;  2Q2I A;  4YY3 Q;  1YVC A;  5CBE E;  3UE1 A;  5I6W A;  4YY3 L;  3BDO A;  2NZ1 D;  1IW7 D;  1HXY D;  3S2D H;  1DM0 B;  2D0P A;  4P74 A;  5IGB A;  4POG A;  5EAY A;  1E22 A;  2Q2T A;  1EU4 A;  2EYL A;  4LFB L;  1I94 Q;  1V8Q A;  2CVR A;  1X3E A;  3AYH B;  1WTO A;  3S17 H;  1ZXT A;  5AJ3 L;  3Q0A A;  4JI2 Q;  3DWA A;  4LUV A;  1LTI D;  5JVH 3;  1ICW A;  1C9O A;  4IZ8 A;  1K8O A;  1G8Z D;  3NPP A;  4LK1 C;  1X65 A;  1X3G A;  3J80 E;  1N36 Q;  1TKW B;  4K6L A;  1X3Q A;  1BF4 A;  1K28 A;  1V43 A;  5KNB A;  2BH8 A;  2ZTD A;  5C3E B;  3GP7 A;  1DON A;  2L1B A;  1A15 A;  2DN8 A;  3HOW B;  4YCU A;  4JYA Q;  5I6Y A;  3I73 A;  5E7N A;  4L5Q A;  2Z9H A;  3PIO A;  3STB C;  4L5R C;  4FP5 D;  1HZC A;  3RZO B;  5EPL A;  2K5Q A;  2ASB A;  5KIX A;  1Y14 B;  1HRJ A;  3NP8 A;  1Y1V G;  2KCC A;  2K28 A;  3FPP A;  1TWC H;  4A3C H;  1ML0 D;  1VQP A;  1IBM Q;  1SSO A;  3KJP A;  4OL7 A;  3MXN B;  1TS2 A;  4A75 A;  3GTO H;  5HY6 A;  2UXB Q;  1DJR D;  4DV6 Q;  2GN5 A;  4LFA Q;  3OSO A;  2Q8T A;  1C8C A;  4JBW A;  4ID6 A;  3KF8 B;  4IJH A;  3UDI A;  2B2U A;  1SRU A;  2Z6K A;  2G9H D;  3OIQ A;  1WTQ A;  3B6Y A;  4A3D G;  2PQA A;  5KYL A;  3E9H A;  3U58 A;  5GAE C;  1GUO A;  1LT4 D;  5EGT A;  5M9O A;  3VYU A;  3ND8 A;  3PSI A;  2N3S A;  4G7O C;  1HH2 P;  1K83 B;  2E2H B;  4BY1 G;  1IBL L;  1VQF A;  5C4X B;  1CHQ D;  2JSO A;  5CYU A;  1UEA B;  2J0T D;  3PCO B;  3VR4 A;  2VUM H;  3SVM A;  5I4D A;  4X3S A;  2WB1 G;  2ZTC A;  2KBN A;  4ZK9 B;  1R9T B;  1VQG A;  1Q90 A;  1Y8O B;  4GN5 A;  5IOD A;  1C48 A;  4IFD J;  1PRT F;  2V4D A;  3N6R A;  4YHH L;  1XMQ Q;  1GHK A;  1HA6 A;  2RCN A;  2HD3 A;  4RCO A;  2B8F A;  1FVI A;  4FF4 A;  4NMZ A;  5C3W A;  4JOI C;  1EZ6 A;  1WTV A;  2R7F A;  4QL5 A;  5FK9 C;  2UU9 L;  4DR4 L;  3CCR A;  1GXD C;  3PUX A;  4MIU A;  3P20 A;  4A3M B;  4XT1 B;  3VR5 A;  2FFK B;  3KLS X;  5C44 H;  3MVV A;  3MFG A;  1CSP A;  5ELE A;  3S1Q H;  3QB3 A;  3I3C A;  4I65 A;  1L2F A;  2NZO A;  2RKS A;  4DR7 Q;  4PQX A;  4DR7 L;  1WCM H;  3H3V I;  1Q8I A;  3MEH A;  5T1G A;  1HHV A;  2NZH A;  2UUA L;  3VYR A;  2F03 A;  3CCL A;  2BA1 A;  4OIK A;  3EA6 A;  3EFX D;  4KN4 C;  5IT9 c;  2DJF C;  4KJN A;  2F0G A;  3NQI A;  2YU9 B;  4APV A;  4NPS A;  2BH2 A;  5FLX L;  3BDL A;  2XSC A;  5FJ8 G;  1N33 Q;  1HNX L;  2XNA C;  5ELN A;  3W5O A;  1E7Z A;  4OO1 G;  3OHX C;  1VQJ A;  5CR3 A;  1DD2 A;  4KKS A;  3D0F A;  4A3F B;  4RKB A;  2HUG A;  1CKN A;  4X3T A;  1I4X A;  1AE3 A;  1WD0 A;  2A68 C;  4K5W A;  3MC0 B;  3LGJ A;  4HJA A;  3M4O H;  1RDP D;  1K73 C;  4IUT A;  2ZT9 C;  2EPB A;  1LTS D;  5M5W H;  3M85 A;  3HOY H;  4RMF A;  2CH4 W;  1EUJ A;  4LF9 Q;  1TWC B;  1JOR A;  1QZH A;  1PYS B;  3OMG A;  3SR1 A;  3ZJY C;  4WRD A;  4A3J B;  4JK1 C;  5LMN Q;  2H5X A;  5LMN L;  3EJI A;  3GTO B;  1MJC A;  1XNR Q;  5NUC A;  2X6L A;  1UE7 A;  1F9Q A;  1A63 A;  1B50 A;  3KF6 B;  2JP1 A;  2LY7 A;  1PH4 A;  4EQ5 A;  2HQL A;  1YI2 A;  4XQQ A;  3CPW A;  4OO1 I;  2BE5 D;  1PTO D;  4JPB W;  4GLX A;  1LTB D;  1UE1 A;  4A3B G;  4NDX A;  4R8I A;  1X3P A;  2IWH A;  4DV5 Q;  4DV5 L;  5FOB B;  1BXT A;  1TWG H;  2RF4 A;  3CCQ A;  1OXU A;  2AQ2 B;  2CQO A;  3NE5 B;  3VA7 A;  4H02 A;  1N32 L;  4TRD A;  2K01 A;  1FYC A;  4G7Z C;  2VUM B;  2IX3 A;  1KLU D;  4DAY B;  4IAL A;  2B2V A;  4B3S L;  4HJ7 A;  5JJK A;  4IOC A;  1K9M C;  5A2Q E;  1PTO B;  1V1P B;  1VMP A;  2ALY B;  4JI8 L;  1LTR D;  3T56 B;  3H91 A;  3TP5 A;  3S2H H;  1V1O A;  3NTI A;  3HRZ C;  3T1Y Q;  3HFZ B;  1JOO A;  4NXN L;  3BJU A;  2V1C C;  3JAM i;  2LKV A;  1EFW A;  4LUZ A;  2K5N A;  1AH9 A;  3G4S A;  4WJ4 A;  1PZI D;  1NMG A;  2F0T A;  1XXG A;  2XRQ D;  3L7Z C;  1NBW A;  4J15 A;  2F3V A;  4LW1 A;  5EKL A;  4YCV A;  5C44 B;  2QEX A;  4FXD A;  4HCE A;  1HJP A;  5DNF A;  5K5P A;  4EQP A;  4HED A;  4JBK A;  1WCM B;  5E4X A;  4QUF A;  2C35 B;  2O4X A;  1PH1 A;  3SDZ A;  3OTO L;  1BVS A;  3GD7 A;  3BVG A;  1HTL D;  3UE0 A;  3KLS A;  4OWX B;  2AQ1 B;  4TSS A;  4X6A H;  3J7A 5;  3FKI G;  2A74 C;  3AQQ A;  3H09 A;  1SR3 A;  2K5W A;  2B39 A;  3DWQ A;  3PO2 G;  2L15 A;  4BBS H;  2ZJP A;  3NEM A;  4YWK A;  4K5X A;  1ROD A;  3CD6 A;  2KHJ A;  2IW3 A;  1MI2 A;  4KD4 A;  3PMF A;  1IW7 C;  4LNQ A;  1STN A;  3PGZ A;  1Z47 A;  1PA6 A;  1Y1W G;  2NVX H;  2IHF A;  2NB0 A;  1QVG A;  4HIM A;  1HQM C;  1JQY D;  1KXL A;  1XX8 A;  1J5E Q;  5C0X H;  2F0F A;  4FF2 A;  2Y0S B;  2VQF L;  1T9H A;  4A76 A;  3QG1 A;  4AH6 A;  2HIV A;  2RA4 A;  1EYD A;  2WIN B;  5JEA H;  1VQE A;  1EYG A;  1Z6H A;  1A3T A;  4MN3 A;  3HOX B;  2GVB A;  4JI3 Q;  2Z8L A;  3OWF A;  4R9W A;  1MGS A;  1E1O A;  2Y0S E;  4QMG A;  3K81 C;  4C3I H;  2NVT H;  3I4O A;  3I91 A;  4XQN A;  2MJ8 A;  1O7I A;  2B8G A;  1U4R A;  5DAU A;  3I4M G;  1TWG B;  2K4K A;  5KNC A;  1LTT D;  4FNF A;  3GTG H;  4K2K A;  2ZJR A;  2DUD A;  4A3G H;  1NY4 A;  4Y7N H;  1Q7Y C;  3Q8D A;  3W2D A;  1NR4 A;  4Y52 H;  5COR A;  3UI2 A;  2AWN A;  1Q1E A;  1PRT D;  1L0X B;  2D0O A;  2NTT A;  4FDB A;  3TZU A;  4GKJ Q;  3SK5 A;  4H13 C;  4GKJ L;  1JB3 A;  4S3S A;  3S2H B;  1BBU A;  3C46 A;  4DR3 Q;  1BO0 A;  2E75 C;  5D3I B;  1DOM A;  1S5E D;  1VQK A;  3C2P A;  1VQ8 A;  1GUG A;  1NCV A;  1HR0 L;  4HSV A;  3GDE A;  2QEJ C;  2JQO A;  1KQS A;  1WYD A;  1XMO Q;  2JA7 G;  1PRT B;  3PUY A;  1XMO L;  3WWV A;  1UE6 A;  5FO7 B;  1LT6 D;  1HNW L;  1JE4 A;  1CKM A;  1EIG A;  1G2S A;  2EYO A;  4K6D A;  4RWS C;  5IGE A;  4B3T Q;  4B3T L;  4BS9 A;  1B44 D;  3IRB A;  1STG A;  1CZG A;  3E5S A;  1R4Q B;  3S1R B;  1UUP A;  4I7Z C;  3TP7 A;  2CFM A;  4M8A A;  2UUC Q;  4BBR G;  1PH8 A;  2UUC L;  2E5L L;  5T1I A;  1EIF A;  1W6K A;  4O42 A;  1KNA A;  4GKK L;  3LX0 A;  1Y8N B;  1Y1V H;  3I2Z A;  3GTP H;  3DMU A;  3NTH A;  2HHH L;  3HOU G;  4LF6 L;  4LF8 L;  1Q12 A;  5IOC A;  1VQM A;  1TWH H;  1VQD A;  4DUY L;  2OT2 A;  4PZ8 A;  1VQI A;  3D4R A;  3J80 c;  4RAU C;  2R93 G;  4BBS B;  4HID A;  3ER0 A;  1U4P A;  2MFI A;  1IYU A;  3G71 A;  1Q82 C;  1D7Q A;  5CV6 A;  3JAM L;  3KFU A;  1D5X C;  4A3D H;  3FMC A;  4JW0 A;  4JI4 L;  5M5Y B;  1CKN B;  2IL8 A;  1IYV A;  5CV8 A;  4HJ8 A;  4HAE A;  4GOP B;  1QOH A;  5A35 A;  3HKZ B;  2K6A A;  1A3U A;  1BKB A;  3SEB A;  3K5L A;  4BY1 H;  2VXW A;  1OXT A;  1WTP A;  4DNR B;  4K14 A;  4ZLT F;  4MTN A;  5C4Z A;  1CA6 A;  4CDF C;  2B2Y A;  3H3V H;  2F0N A;  5ELB A;  2D2C C;  3QJY A;  4DV2 L;  3TRZ A;  3FRP B;  4QJF A;  1SLJ A;  2MUY A;  1I5F A;  4BA2 I;  5CMD A;  2VS1 A;  5FLX E;  2RCF A;  4EGV A;  3KBG A;  1EOV A;  4RGN A;  4GZY C;  3KLR A;  4OIJ A;  1FGB D;  3RD4 A;  3MAQ A;  4C3I B;  2NVT B;  4R4Q A;  2NVQ H;  1QNU A;  1Q81 C;  4DUZ Q;  4R4O A;  4PNY A;  4DUZ L;  2QKI C;  3U4Z A;  3KLW A;  3HOZ G;  4DV3 L;  1SND A;  2X69 A;  2NVY B;  4RHS A;  4Y7N B;  4OEL B;  2ATW A;  3K5M A;  4QQB X;  4KD3 A;  3PO3 G;  4OGQ C;  3M3Y B;  1G6P A;  1IBK L;  1HTP A;  1STB A;  2NN6 G;  3G6E A;  4HJ5 A;  2B2W A;  1HPC A;  3BU2 A;  1N8R C;  5FLM G;  2Z1C A;  3PIP A;  5IIF A;  1SYB A;  1K3B C;  5M5X B;  2VB3 X;  2QGQ A;  2QW7 A;  1HCZ A;  2BE5 C;  4KV6 A;  3CCJ A;  2JEA I;  2D62 A;  1PTO C;  1YHQ A;  3MTS A;  1VF7 A;  5EPK A;  2AHO B;  2L55 A;  5FJ8 H;  4GNX B;  4P73 A;  1H9S A;  3M4Y A;  1MIU A;  1E2Z A;  3HG9 A;  4LAA A;  1VQC A;  4Q5V A;  4OO1 H;  1ET6 A;  1QCB D;  1C0A A;  4IPC A;  4X66 Q;  2WV6 D;  1YHB A;  4X66 L;  3A8J E;  1D8L A;  5IWA L;  1MSH A;  1Y69 U;  4N9P A;  3NSW A;  4K2L A;  1ET9 A;  2VQE L;  5EJW A;  5C6A A;  1B9M A;  1ENC A;  2NN6 I;  2E2D C;  3D4W A;  4ZYS A;  3S15 B;  3GTP B;  3O13 A;  5GQO A;  3TRE A;  3PIP 3;  2NBF A;  2EZV A;  2UXC L;  1BUV T;  1RKN A;  1WD1 A;  3ULL A;  4A3I G;  1AW7 A;  1X9N A;  1TWH B;  4A3E G;  1BR9 A;  3MXG A;  2QA4 A;  3UDG A;  4A93 B;  1KAA A;  3GTK H;  2HDL A;  2K5V A;  3HOV B;  1NJI C;  3F2D A;  1I94 L;  1LTL A;  5J39 A;  2RBM A;  1SYE A;  1G6Z A;  1KD1 C;  5M3M G;  4QUC A;  1CT1 D;  4DK3 C;  3NTK A;  5HUR A;  5GAG C;  4JI2 L;  2EY2 A;  5FO8 B;  2F0V A;  1RF2 D;  2AWO A;  1RHP A;  4BWG B;  3H0G G;  2XWJ B;  2O5J C;  1N36 L;  2E2J B;  4A3B H;  2K33 A;  5EKK A;  5GAH C;  1XPO A;  4HR7 B;  1Q1B A;  4IJL A;  4ZKB B;  3S16 B;  4PZ6 A;  2R7D A;  4NP5 A;  1PHJ A;  4BY1 B;  2I0Q A;  4JYA L;  3AMU A;  2B2T C;  4PMC A;  3HEJ A;  1QZG A;  3J81 i;  2R61 A;  1FJG Q;  2K32 A;  4RG1 A;  4XYQ A;  3NBI A;  2F0K A;  5KYI A;  3AEV A;  2I5L X;  2K7V A;  4RH6 A;  5I9O A;  3S1M B;  3I70 A;  4MHE A;  2R6G A;  5BN4 A;  5IP7 G;  1EWC A;  2N55 A;  4DAV A;  4H44 C;  1QG7 A;  1L1O B;  3PUZ A;  2F4V Q;  1IBM L;  4I7A A;  2F4V L;  3X3N A;  3U50 C;  5AFW A;  2B63 G;  2K5D A;  2UXB L;  2A69 C;  2JA8 G;  1F2Y A;  5J1Z A;  4DV6 L;  4LFA L;  1SNC A;  1H9K A;  5M3F G;  2IX0 A;  4R4C A;  1TWF B;  4ZQ3 A;  5CBA E;  2B2U C;  2K03 A;  3VDY A;  1VQ7 A;  4N8F A;  4ME5 A;  3VR6 A;  4DV0 Q;  3T13 A;  4K5V A;  3CW2 C;  4IFD I;  4DV0 L;  2XGT A;  4OXP A;  4OON A;  1PH7 A;  3J7Z C;  2Z6B A;  3ZYY X;  3PIO 3;  1SE3 A;  4X64 Q;  4X64 L;  4B3R Q;  3UDF A;  4OHJ A;  1TWA H;  3KYH C;  2MO0 A;  2WAC A;  1EIY B;  2IT1 A;  4DR1 Q;  1SN8 A;  2XIW A;  4IPD A;  1S5B D;  1PXU A;  1I4G A;  4K8J A;  1HA5 A;  3FKI H;  3CCU A;  2ID0 A;  2VZA A;  2JJQ A;  3VR2 A;  5EPJ A;  1GKH A;  4MNO A;  3PO2 H;  3F2B A;  4JI1 Q;  2EY1 A;  1KLG D;  5C3E G;  2UXD Q;  4JI1 L;  3A54 A;  3I55 A;  2E74 C;  3HOW G;  1GJX A;  2GA4 B;  3GTJ B;  1EWI A;  2L12 A;  3C1F A;  1B3A A;  1F9S A;  1XMQ L;  1PRT C;  1BCP F;  4DFA A;  3NBH A;  4O2D A;  4C2M B;  2XVS A;  1T5E A;  1YNJ D;  1Y1W H;  2VL6 A;  1EU3 A;  5K36 G;  1TS3 A;  4FVM A;  1LTA D;  3OPO A;  3RMH A;  1PYB A;  5KEE A;  2SNM A;  3GV6 A;  1I3Q B;  3X3M A;  3RLO A;  2ZXR A;  1PFB A;  3S2D B;  3QIA A;  3T1H Q;  3RUZ A;  4LF7 Q;  3T4A C;  1IKM A;  3A55 A;  3DUZ A;  3J81 j;  1LAB A;  1X6O A;  2LXK A;  4CDC C;  2AUK A;  4L63 B;  3E6Z X;  4IN3 A;  1YIJ A;  2DGY A;  2RDG A;  3S17 B;  1CHP D;  4LMQ D;  2WII B;  2ICE C;  4P71 A;  1RIP A;  1N34 Q;  3ERS X;  3N52 A;  2DNE A;  4JI5 Q;  1GOZ A;  1CQF A;  1N33 L;  4DK6 C;  4C3H G;  3I4M H;  1NAP A;  1VQA A;  2EE1 A;  2RDF A;  4A4I A;  1HZA A;  2RQX A;  1VQ6 A;  3NK9 A;  2KHI A;  1CI3 M;  2KA7 A;  2Q2H A;  4GOP C;  1I50 H;  5IP9 G;  4EVO A;  1NE3 A;  2KCM A;  2F0J A;  4R4I A;  2EYM A;  4OX9 Q;  1J8I A;  4DXG A;  1TT2 A;  2BDO A;  2IPK D;  4DV1 Q;  3HKS A;  2EJF C;  4LF9 L;  2MHV A;  1YHA A;  2JYO A;  2E8G A;  1SYG A;  2KJX A;  5IE8 A;  3D6C A;  2MQH A;  1XNR L;  1EL0 A;  4L8J A;  4J8Q A;  3JAM E;  2JA7 H;  1U5K A;  2WAQ B;  1J6Q A;  4A3M G;  4UY8 C;  1X55 A;  1TXY A;  5CV7 A;  4A3K G;  2R7Z G;  4JC0 A;  2KEC A;  1E1T A;  1D5Z C;  1IKL A;  1WVL A;  4FXG C;  4GLA C;  2WAQ E;  4BBR H;  5C4J H;  1WTX A;  2SOB A;  3PV0 A;  1DOL A;  1JB7 A;  5BR8 Q;  2C9O A;  1BNZ A;  1F9R A;  1EQT A;  2F0P A;  3J81 L;  4UP9 A;  5C4H A;  4PG3 A;  4BA1 I;  3HOU H;  3NEL A;  4PV1 C;  1DGS A;  1KAB A;  2EY5 A;  2A6H D;  4DK1 A;  4B9X A;  3PO2 B;  2R93 H;  5CV9 A;  4HIO A;  2WP8 J;  4RKL A;  1N9W A;  4DV7 Q;  2EJM A;  1O7Z A;  2LSS A;  3A0J A;  1A6X A;  2B29 A;  4GNX C;  3T1Y L;  2KQ3 A;  4A3F G;  3QWN A;  2EIF A;  1B3Q A;  4JI7 Q;  3E9I A;  4JI6 Q;  4JI6 L;  5I9P A;  3E0E A;  4B3M Q;  3F1Z A;  2A1A A;  2ZTE A;  4B3M L;  4B08 A;  3MXU A;  5JJI A;  1BBW A;  3TSS A;  3MFY A;  1PZK D;  1BDO A;  1F2L A;  1ASY A;  1XWE A;  3DWP A;  3S1Q B;  3W1B A;  3CHB D;  5JJZ A;  3A5U A;  4A3J G;  1ICF B;  3F2C A;  5EKI A;  5LMN W;  5IGD A;  2E2I H;  1UNS A;  1TVX A;  4KMU C;  1XNQ Q;  4WJ3 M;  3URY A;  1XNQ L;  1VQN A;  2PNH A;  1QJO A;  1JJ2 A;  1SYF A;  4ABN A;  4BXX G;  3A7A B;  4XDX A;  3S1N H;  4GN4 B;  2WKC A;  1JCK B;  2CQA A;  1PMR A;  3M4P A;  1TII D;  2K04 A;  3A7L A;  1SEB D;  2I07 B;  2I5H A;  3HOZ H;  1SE2 A;  2X6G A;  4WFN 3;  2NUC A;  1X32 A;  4AYB G;  5DM7 3;  2ZM6 Q;  4HJ9 A;  2ZM6 L;  1HZB A;  3AU7 A;  3SE0 A;  4C3J G;  1SMY D;  3PO3 H;  3K58 A;  2NN6 H;  3JC6 6;  4DGZ A;  3M4O B;  2E76 C;  2M9V A;  1O7Y A;  1EWH A;  3TS2 A;  1U9R A;  5FLM H;  5M5W B;  3HOY B;  1E2W A;  2F52 A;  3J7A V;  3F2U A;  2CCZ A;  4LUO A;  2ENB A;  3MWY W;  4ME3 A;  2D9U A;  5IGG A;  5FLX c;  2Q2U A;  1J5E L;  3E3X A;  2MNA A;  2G9D A;  1O80 A;  5IGF A;  1YNX A;  2PZU A;  1GHJ A;  2EYJ A;  3CMA A;  2CWP A;  5BN5 A;  2IX1 A;  1L1O C;  1NTG A;  2Z0S A;  1EY5 A;  3LWE A;  1Q46 A;  2JA7 B;  4DV4 Q;  1AP0 A;  2NTS A;  4Q0F A;  4JI3 L;  4QB4 A;  3R8B A;  2I46 A;  3BZC A;  3Q23 A;  2KCN A;  1PH6 A;  2PQA B;  3TP8 A;  1A3V A;  4UHV A;  2I5M X;  1FNV A;  3RZD H;  1SMX A;  4HMJ A;  4CKC A;  5C4J B;  3I90 A;  5JJL A;  3DM3 A;  4ZAI A;  1E0B A;  1G2T A;  3L0O A;  2KOL A;  3J7Y W;  1VQ4 A;  2IY5 B;  1JMC A;  3HOU B;  2M00 A;  4A3I H;  1Q86 C;  1NNX A;  1D6E C;  3GTQ H;  4A3E H;  2R93 B;  4LFC Q;  2HCC A;  1BCP D;  3CRL C;  4RGT A;  1DCZ A;  1EY6 A;  4DR3 L;  1YJW A;  5M3M H;  2XWB B;  1V9P A;  4FXK C;  4ZUI A;  3TZD A;  4AQY Q;  5KGU A;  2F0L A;  4CGY B;  1TS5 A;  3H0G H;  4JV5 Q;  3NBH B;  1B70 B;  2K14 A;  1JR0 D;  2KCT A;  1ENF A;  1JJG A;  5DEH A;  2QDB A;  1AEX A;  4LWC A;  5ELD A;  1KRS A;  3EQL C;  1BCP B;  1O78 A;  1KNE A;  2Y0S G;  2PZW A;  1AZP A;  2FMM A;  3KJO A;  2QIL A;  3PUV A;  2C5C A;  1SAP A;  4IO9 A;  1H95 A;  1OTC A;  1AZQ A;  4LF4 Q;  3NUC A;  3HOX G;  2EYH A;  5IP7 H;  5I2Y A;  3S1N B;  1I4P A;  4RGM A;  3GQB A;  1YBY A;  1YNJ C;  1QVF A;  2FIN B;  1PZJ D;  2B63 H;  3BYT B;  5D3D A;  1RTO A;  2PW5 A;  3W3A A;  4KHP Q;  2JA8 H;  3NXW A;  4C56 C;  3A8I E;  2H4O A;  5M3F H;  4KLK A;  4QIW B;  3CCM A;  2F3W A;  3S24 A;  1QE6 A;  1P16 A;  3CCE A;  5COY A;  3H6M A;  4BY7 G;  5E1F A;  5KND A;  1MBY A;  3PO3 B;  1EFI D;  1JJC B;  4CJ1 B;  3K5O A;  4F88 A;  2NVX B;  1HUM A;  3RNU A;  1PLF A;  2CKZ B;  5TSS A;  4QIW E;  3V96 A;  1X56 A;  1I6H H;  4KJO A;  2JA5 G;  5DM6 3;  3SXH A;  1D5M C;  4KN7 C;  5CV4 A;  2F0W A;  1CK1 A;  1HR0 W;  3R3O A;  2FXQ A;  2QF7 A;  1SRO A;  4DA2 A;  3HKZ E;  2JA6 G;  3NWT A;  3ONA B;  1HUN A;  5IYD G;  5C3E H;  1P8L A;  3GTL H;  3TQY A;  2ICI A;  1QB5 D;  5ELF A;  3HOW H;  4DKA C;  1I4H A;  1X54 A;  3HS0 C;  3OMC A;  4JVZ A;  4NW2 A;  3PF5 A;  1ILQ A;  1QWY A;  3RZD B;  2RHS B;  2KVM A;  1STH A;  5K36 H;  3RZO H;  1NR2 A;  1LAC A;  2KED A;  3U9O A;  2F0Q A;  1PDQ A;  2KEE A;  3A8K E;  3GTG B;  1CKO A;  4A3G B;  3BZD B;  2EJG C;  1B8A A;  4IUV A;  3I72 A;  1EQQ A;  1PFM A;  3RLN A;  1LYL A;  1PFN A;  4X62 Q;  4NB3 A;  3GTQ B;  1JT8 A;  4X62 L;  2RSO A;  3TS0 A;  1RJT A;  4DR5 Q;  3CKI B;  1JWM D;  3D31 A;  3W1G A;  5M3M B;  1S5D D;  1RD9 D;  2SEB D;  4E6I A;  2F0H A;  1A2T A;  3G7L A;  4P2C B;  2IJ0 A;  1M4V A;  2XRS D;  4DR6 Q;  4C3H H;  2OXP A;  1Q8K A;  1LT5 D;  3NHH A;  1FNW A;  3FVQ A;  2E2H H;  1QVC A;  2HT1 A;  5L37 A;  1DYQ A;  3D4D A;  1S40 A;  3L3O C;  5F2D A;  4JI0 Q;  5IP9 H;  1XYI A;  2A6H C;  3TEH B;  1E24 A;  1V1P A;  4CHT B;  1R9T H;  2ES2 A;  2R3Z A;  3J81 E;  1BBX C;  1C4Q A;  3K80 C;  1Y1V B;  4H7B A;  1KDB A;  4NXM Q;  1SYD A;  1S4Z A;  2CWA A;  4XIG S;  3MA2 B;  1CA5 A;  1OXX K;  1SBB B;  2B63 B;  5IT9 L;  2UUB Q;  1JWU D;  2R92 G;  4GN3 B;  4YWL A;  1JOK A;  5IY0 A;  3R2I A;  3CRK C;  2LS0 1;  4DN4 M;  2JEB I;  4A3M H;  1SJH D;  3CP0 A;  3AB9 A;  4A3K H;  2R7Z H;  1U0L A;  4A3D B;  1LUZ A;  2WKD A;  1EZ8 A;  3OOC A;  3KDF A;  1ZYR D;  3I4L A;  4DXF A;  1DOK A;  5C0X I;  4HSP A;  2OQK A;  1JOQ A;  2AUJ D;  1G29 1;  5LHY 1;  3CF5 A;  4LFB Q;  2SDF A;  4IFD G;  1I6H B;  2PZT A;  1NMF A;  3OIP A;  4YIJ A;  5JPM C;  4CDD C;  5AJ3 Q;  1K8A C;  2OTL A;  4IOA A;  5JOB A;  3HGB A;  1M1K C;  3ULJ A;  2VB2 X;  4KY5 A;  1SFO H;  2YU9 H;  1CTM A;  2J7Z A;  2WB1 B;  1FJG L;  3HP3 A;  3WOF A;  3I4N G;  2K75 A;  4JCV E;  3DEP A;  1EQV A;  3H94 A;  3P7J A;  1S3O A;  4QGU A;  3GTL B;  5CC4 A;  2MGS A;  3JAM c;  1XTC D;  5C0X J;  3FPU B;  1K8G A;  4FYD A;  1YZ6 A;  3CCS A;  2ZXP A;  2A6E D;  2PMZ B;  1SMY C;  4TVA B;  2WB1 E;  4A3F H;  4CDE C;  2B2T A;  3VYS A;  1B7Y B;  2NVQ B;  1Z9F A;  5JEA J;  1B9N A;  1FGU A;  4G4K A;  1WTW A;  3Q6S A;  1KL9 A;  1KRT A;  2Z6K C;  1GUN A;  3IL8 A;  1J9O A;  2N88 A;  1B1Z A;  2PMZ E;  1EQR A;  2O5I C;  4A3J H;  3C3L A;  2K50 A;  5LL6 S;  1WOC A;  1UE5 A;  4A93 G;  2J4X A;  4XT3 B;  2Z4H A;  1QIL A;  4A3L G;  2RDH A;  3EIV A;  3D6W A;  1KC8 C;  2WFW A;  1HNZ Q;  3HOV G;  1HNZ L;  1UAP A;  4B3R L;  4K0K Q;  2LFN A;  1SNP A;  2EVB A;  1EEF D;  1I4Q A;  3TME A;  4G7H C;  4BXX H;  3J80 i;  2EY6 A;  4K0K L;  4DR1 L;  4RFB A;  1W3S A;  1K0S A;  2EXD A;  1QNK A;  4RHR A;  5IYC G;  1VQL A;  1WI5 A;  3MEF A;  2DY7 A;  4J6H A;  4C3H B;  4U68 A;  1D1K A;  2G5D A;  2AQ3 B;  2HDM A;  2HCI A;  2N49 A;  2UXD L;  1F77 A;  4B9W A;  1IBL Q;  3VYT A;  5FO9 B;  1QUQ A;  5HGQ A;  4DR2 Q;  3NQT A;  1O7L A;  4KK7 A;  1YNN D;  4XTC S;  4C3J H;  2GVA A;  4DR2 L;  2PNR C;  4J1M A;  4DAM A;  3BYY B;  3BG3 A;  3LWU A;  2O2L D;  1BCP C;  5C5L A;  1CSQ A;  1PTO H;  2A19 A;  1VQ5 A;  4GLV B;  4V19 0;  1CFM A;  3FP9 A;  4YHH Q;  1XPU A;  4PZ7 A;  3TP6 A;  1FR3 A;  2N8N A;  3D3R A;  5G3L F;  1TS4 A;  1IL8 A;  3CC2 A;  3T1H L;  3CPF A;  4LF7 L;  3GTK B;  2UU9 Q;  4DR4 Q;  4HCS A;  4K8I A;  4JOI A;  1SE4 A;  4DU9 A;  3I7F A;  5CGK A;  5CV5 A;  4YWM A;  3PUW A;  1CM9 A;  2PI2 A;  4EX5 A;  3KUP A;  4A3K B;  2R7Z B;  1IL2 A;  4P75 A;  3IFD A;  1F2M A;  4ODG A;  2CH4 A;  1N34 L;  2LXJ A;  3GTM H;  3NEN A;  1B4O A;  2Q8R E;  5IYB G;  4A3B B;  3MXP A;  4JI5 L;  3FHW A;  3K8A A;  4ZRZ A;  3ND9 A;  4H0L C;  4QY7 A;  2VW9 A;  2UUA Q;  1KHI A;  5ISR A;  5C4X G;  1EYC A;  1A62 A;  4JBJ A;  3BS1 A;  1I6V C;  1SFO B;  3K0Y A;  4IPG A;  1VQH A;  3TDQ A;  2PPB C;  2FMC A;  4PMW A;  1JWS D;  1T5X D;  1HFG A;  1HNX Q;  3K7A H;  4CKE A;  1V1Q A;  2NYZ D;  4OX9 L;  1WTH A;  1PH2 A;  3FDT A;  3GV3 A;  1A0I A;  4DV1 L;  4XXE A;  4IQZ A;  4XYO A;  4CBV A;  3I8Z A;  4CJ2 C;  1GUW A;  4KKU A;  1SNQ A;  2CHB D;  2LMC B;  3P1H A;  4IUN A;  2CW0 D;  2VY3 A;  2L0C A;  3K0X A;  3S9W A;  4GOP A;  2EDG A;  4UP7 A;  1IXR A;  1KTK A;  4QCL A;  1UEB A;  4L5S A;  1YIT A;  5KRU A;  2JA9 A;  1PH9 A;  2YV5 A;  2SNS A;  3OWE B;  3VA5 A;  2EOT A;  4DF7 A;  1TQO A;  1VMC A;  2EQS A;  2EXZ A;  2NWG A;  2OQ0 A;  4MZ9 A;  3EVQ A;  2JN4 A;  3CXC A;  1TWA B;  3CQZ H;  1Q3L A;  3HOX H;  5C5M A;  3KK7 A;  5JAV A;  1U4L A;  5BR8 L;  1B2T A;  1GD7 A;  2B2V C;  1STY A;  1K0R A;  5ELC A;  3CC7 A;  3PF4 A;  1ENA A;  2Z4I A;  3VR3 A;  3FKI B;  1EY7 A;  3T51 B;  4P72 A;  3H15 A;  1YEZ A;  2OWO A;  1SJE D;  4MTK A;  3QOL A;  2DY8 A;  1GUS A;  1MHW C;  2F0I A;  3L2P A;  3D8G A;  2QDL A;  2F4I A;  3CCV A;  4NKL A;  1K3R A;  4X3U A;  1JIC A;  2PW7 A;  4UP8 A;  2ZJQ A;  1H9S B;  3K7U C;  4DV7 L;  1RL2 A;  3M7G A;  1W2B A;  3IAY A;  1N32 Q;  2FJ2 A;  4AYB B;  1G91 A;  3T16 A;  1EOT A;  1XPR A;  4BY7 H;  3A74 A;  4EQO A;  4C3J B;  4B3S Q;  3OW2 A;  1Y1W B;  3CAM A;  1AFP A;  3U4V A;  4JI7 L;  1NSN S;  4KKT A;  4JI8 Q;  2BDN A;  2RHQ B;  1A8V A;  4AYB E;  1OO9 B;  1X3F A;  1KAW A;  2JA5 H;  4A3C G;  4NXN Q;  1FNU A;  3U9S A;  2RVL A;  4IUR A;  4GNX A;  4TKO B;  4IUP A;  3J7A F;  1S5F D;  2YTX A;  5C3X A;  2JA6 H;  4DNT B;  1EY8 A;  5IYD H;  1PV4 A;  1VF5 C;  1H9R A;  2WAQ G;  3J80 L;  4FF1 A;  1W6J A;  2ZXO A;  2OF1 A;  1M90 C;  4L5T A;  3F8T A;  1BOS A;  2F0S A;  3G6J B;  4RCN A;  3EBE A;  3GTM B;  2BA0 A;  1L0W A;  3S1R H;  3KDF B;  1EY4 A;  3I4M B;  2MPM A;  3OTO Q;  4ULL A;  1DZ1 A;  4ILW A;  3DHQ A;  2VUM G;  1I50 B;  1YJN A;  2OCE A;  3MZ5 A;  4XQJ A;  1VQB A;  2YTY A;  3V05 A;  1PFS A;  5E4W C;  1D1I A;  3STB D;  1MKH A;  3M9B A;  3K7A B;  4KY7 A;  4N9T A;  5LL6 X;  2JE6 I;  1A2U A;  4R4T A;  3H3V C;  5EBC A;  4HN7 A;  2EYF A;  1AN8 A;  1OXV A;  1SNM A;  4UDU C;  2K5H A;  5IT9 E;  2EYP A;  5BN3 A;  1ZYR C;  5M5Y H;  1E2V A;  4G57 A;  3SHL A;  3DEO A;  1SXT A;  5HGT A;  3ITP A;  1TY2 A;  3RN2 A;  3DXJ C;  2A69 D;  3OW7 A;  1MJE A;  3K59 A;  3OYY A;  1ASZ A;  3WDN A;  1II3 A;  2FHT A;  4DV4 L;  3KBX A;  3BVM A;  3K6O A;  1DXM A;  5C44 G;  4UPA A;  1ZKO A;  2YTV A;  2VQF Q;  1IYJ B;  1VS0 A;  1GVP A;  4X65 Q;  1TR5 A;  2F1M A;  1WCM G;  4X65 L;  1ILP A;  2HIX A;  2M2L A;  3ICE A;  4BBR B;  1Z7T A;  3S14 H;  3CQZ B;  1SDF A;  1FD7 D;  4F7X A;  3Q24 A;  2XTI A;  1L1O A;  2TMP A;  1LO5 D;  1RTN A;  4R1J A;  2A6E C;  4N8X 1;  1VDZ A;  3MXN A;  4HIK A;  1KIX A;  1OXS C;  3IFT A;  1SYC A;  2PQE A;  1C7Y A;  2R92 H;  2TSS A;  2H1E A;  4LJZ C;  2D5D A;  5H1S E;  3QOJ A;  4LFC L;  2K52 A;  3KF8 A;  2L11 A;  4ZKC B;  1PH5 A;  4KI0 A;  1R4P B;  3TBI B;  2F0D A;  4FF3 A;  3AFP A;  2NVY H;  4BY7 B;  1MSG A;  1WTR A;  4AQY L;  2BCO A;  1MD2 D;  1QUQ B;  4ALP A;  3M3Y H;  2N78 A;  3PQI A;  1BQQ T;  4PMB A;  4OWT B;  4QF4 A;  2IHE A;  4JV5 L;  1I4R A;  5G3L D;  5EQ0 A;  3NWS A;  4JG2 A;  3K5N A;  3HOY G;  1H9J A;  2KUM A;  3J81 c;  4IFD H;  5GRO A;  3FEW X;  3RLF A;  5M5X H;  2JA5 B;  1G51 A;  2L9H A;  4HMI A;  1HR0 Q;  1UWV A;  1ONL A;  2E2I B;  3CC4 A;  3IKJ A;  4HTH A;  3SK8 A;  2MP1 A;  3SK6 A;  4O0A A;  3I4N H;  4JBM A;  2JA6 B;  4M1U B;  1SE8 A;  5EBD A;  2OTJ A;  1FL0 A;  1NUC A;  1KDA A;  2Q8I B;  4AIM A;  5IGC A;  4LF4 L;  1CZW A;  1HNW Q;  3ULP A;  4UAI A;  1U4M A;  1CQV A;  1GUT A;  5E3F A;  5JVG 3;  1KDC A;  1YNN C;  2VNU D;  2XN9 C;  4WOR A;  5GAD C;  3BDC A;  1HFN A;  4KHP L;  3QR8 A;  5D65 A;  2F0O A;  2B3G A;  3GO5 A;  3LNN A;  2E5L Q;  3HOZ B;  1STE A;  1VQ9 A;  4EQN A;  3I56 A;  4GKK Q;  3S15 H;  4KHZ A;  1LM0 A;  4POF A;  4DPG A;  2HHH Q;  1YJ9 A;  2PI2 E;  2KHS A;  4C1N K;  4WJW A;  4X3K A;  4LF6 Q;  1GO3 E;  1PYW D;  4LF8 Q;  3M7N A;  4R8N A;  2MO1 A;  4DUY Q;  1D2B A;  4A93 H;  2A68 D;  1RCV D;  5ELO A;  2JXM B;  3C1E A;  1LV9 A;  5DLQ E;  4A3L H;  2PYK A;  3HOV H;  1EIH A;  4RGO S;  1F9P A;  1ZEQ X;  3P75 A;  2B2Y C;  4ZCK A;  3M4Q A;  1EEI D;  4DK0 A;  1TY0 A;  5IYC H;  4JI4 Q;  4FO2 A;  1Y8P B;  4DAP A;  1STA A;  3TN2 A;  2AKW B;  5JPN C;  3K57 A;  2E2J H;  3Q22 A;  2P5Z X;  1SNO A;  1EYA A;  4F8M A;  4IPH A;  3S16 H;  4OEM B;  2A73 B;  3G48 A;  1HZ9 A;  3MHB A;  4LF5 Q;  4LF5 L;  1IHZ A;  5D14 A;  3UDX A;  3BVZ A;  2HQE A;  4C1N I;  1S5C D;  1EY9 A;  4DV2 Q;  2RSN A;  2DNC A;  4Z9C B;  4KTA A;  1EY0 A;  3S14 B;  3WOE A;  5I2X A;  3S1M H;  1VCI A;  3DM1 A;  1GM5 A;  5A2Q L;  4GS3 A;  2F0E A;  3A56 A;  1XTD A;  2CW0 C;  2QCP X;  3E0J A;  4IUQ A;  4A3I B;  2B2W C;  4A3E B;  3ERO A;  3R2T A;  2A8V A;  2R92 B;  2F3I A;  3KF6 A;  1LT3 D;  2AMC B;  4BBS G;  1TWF H;  4DV3 Q;  4DR5 L;  1PVO A;  1L0Y B;  1XJV A;  1H9M A;  1TU2 B;  4V0B A;  5J22 A;  1PH3 A;  1IBK Q;  3RN5 A;  3H0G B;  3A5Z B;  4KHV A;  5IYB H;  1E3P A;  1LLR D;  5LMU Q;  4ZUJ A;  2PCF B;  3EN2 A;  3CU7 A;  4DR6 L;  5LMU L;  3RR5 A;  3AFQ A;  3HKZ G;  4U67 3;  1PTO F;  1ESR A;  1K83 H;  3QO2 A;  3DLL A;  3CME A;  2K05 A;  2OEO A;  3BZK A;  5C4X H;  4DNI A;  5C0X G;  4DAY A;  4L6T B;  1K8M A;  1M8A A;  1IZ6 A;  4KY6 A;  2L5T A;  4CJ0 B;  4JI0 L;  3T53 B;  1F2Z A;  4TQU S;  1JC7 A;  4YCW A;  3R93 A;  3V2T A;  1VQO A;  3I4N B;  2DJG C;  5JEA G;  3SGI A;  4F87 A;  2YYZ A;  3L9A X;  2A5H A;  2F0U A;  2KEN A;  4NXM L;  3ERQ A;  5J3B A;  3GTJ H;  1HQR D;  3KOJ A;  3HZX A;  1AE2 A;  1B53 A;  2K1B A;  1WFQ A;  4C3I G;  5IWA Q;  2BOS A;  4O1N A;  1S72 A;  1CUK A;  4C2M H;  4CKB A;  2UUB L;  2JA8 B;  1ESF A;  3SK4 A;  2VQE Q;  5FKA C;  2PO4 A;  5M3F B;  1LTG D;  2F0M A; 
#chains in the Genus database with same CATH homology
 4RA8 A;  4IUU A;  2L4N A;  5CBE E;  5I6W A;  3BDO A;  2NZ1 D;  1IW7 D;  1HXY D;  1DM0 B;  5IGB A;  1EU4 A;  2EYL A;  1V8Q A;  2CVR A;  1WTO A;  1ZXT A;  3Q0A A;  3DWA A;  1LTI D;  5JVH 3;  1ICW A;  4IZ8 A;  1K8O A;  1G8Z D;  3NPP A;  4LK1 C;  3J80 E;  1TKW B;  4K6L A;  1X3Q A;  1BF4 A;  1V43 A;  5KNB A;  5C3E B;  1DON A;  3GP7 A;  2L1B A;  1A15 A;  2DN8 A;  3HOW B;  5I6Y A;  3I73 A;  4FP5 D;  3RZO B;  5EPL A;  2K5Q A;  5KIX A;  1HRJ A;  3NP8 A;  2KCC A;  2K28 A;  3FPP A;  1ML0 D;  1SSO A;  4OL7 A;  1TS2 A;  1DJR D;  3OSO A;  2Q8T A;  1C8C A;  4JBW A;  4ID6 A;  2B2U A;  2G9H D;  3OIQ A;  1WTQ A;  5KYL A;  1GUO A;  1LT4 D;  5EGT A;  5M9O A;  3VYU A;  3ND8 A;  4G7O C;  1K83 B;  2E2H B;  5C4X B;  1CHQ D;  2JSO A;  5CYU A;  1UEA B;  2J0T D;  3VR4 A;  3SVM A;  5I4D A;  4X3S A;  4ZK9 B;  1R9T B;  1Q90 A;  1Y8O B;  5IOD A;  1C48 A;  4IFD J;  1PRT F;  2V4D A;  3N6R A;  1GHK A;  1HA6 A;  4RCO A;  2B8F A;  4FF4 A;  4NMZ A;  5C3W A;  1EZ6 A;  1WTV A;  5FK9 C;  1GXD C;  3PUX A;  4MIU A;  3P20 A;  4A3M B;  4XT1 B;  3VR5 A;  2FFK B;  3KLS X;  3MVV A;  3MFG A;  5ELE A;  3QB3 A;  3I3C A;  4I65 A;  2RKS A;  4PQX A;  1Q8I A;  3MEH A;  5T1G A;  1HHV A;  3VYR A;  2F03 A;  2BA1 A;  4OIK A;  3EA6 A;  3EFX D;  4KN4 C;  4KJN A;  2F0G A;  3NQI A;  2YU9 B;  5FLX L;  3BDL A;  2XSC A;  2XNA C;  4OO1 G;  3OHX C;  5CR3 A;  1DD2 A;  4KKS A;  4A3F B;  4RKB A;  2HUG A;  4X3T A;  1I4X A;  1WD0 A;  2A68 C;  4K5W A;  3MC0 B;  1RDP D;  4IUT A;  2ZT9 C;  2EPB A;  1LTS D;  3M85 A;  1JOR A;  1TWC B;  3OMG A;  3SR1 A;  4WRD A;  4A3J B;  4JK1 C;  3EJI A;  3GTO B;  5NUC A;  2X6L A;  1F9Q A;  1B50 A;  2JP1 A;  2LY7 A;  4XQQ A;  4OO1 I;  2BE5 D;  1PTO D;  1LTB D;  4NDX A;  4R8I A;  1X3P A;  2IWH A;  5FOB B;  1BXT A;  1OXU A;  2AQ2 B;  3NE5 B;  3VA7 A;  4TRD A;  2K01 A;  1FYC A;  4G7Z C;  2VUM B;  2IX3 A;  1KLU D;  4IAL A;  2B2V A;  5A2Q E;  1PTO B;  1V1P B;  1VMP A;  1LTR D;  3T56 B;  3H91 A;  3TP5 A;  1V1O A;  3NTI A;  3HRZ C;  1JOO A;  2LKV A;  1PZI D;  2F0T A;  1XXG A;  2XRQ D;  3L7Z C;  2F3V A;  5EKL A;  5C44 B;  4FXD A;  4HCE A;  5DNF A;  5K5P A;  4EQP A;  4HED A;  1WCM B;  5E4X A;  4QUF A;  2O4X A;  3SDZ A;  3GD7 A;  3BVG A;  1HTL D;  3KLS A;  2AQ1 B;  4TSS A;  2A74 C;  3H09 A;  2K5W A;  2B39 A;  3DWQ A;  4K5X A;  1ROD A;  2IW3 A;  1MI2 A;  4KD4 A;  3PMF A;  1IW7 C;  1STN A;  1Z47 A;  2NB0 A;  1HQM C;  1JQY D;  1XX8 A;  5C0X H;  2F0F A;  4FF2 A;  2Y0S B;  3QG1 A;  2RA4 A;  1EYD A;  2WIN B;  5JEA H;  1Z6H A;  1A3T A;  4MN3 A;  3HOX B;  2Z8L A;  3OWF A;  4R9W A;  1MGS A;  4QMG A;  3I91 A;  4XQN A;  2MJ8 A;  2B8G A;  1U4R A;  5DAU A;  1TWG B;  5KNC A;  1LTT D;  4FNF A;  4K2K A;  3W2D A;  1NR4 A;  5COR A;  3UI2 A;  2AWN A;  1Q1E A;  1PRT D;  1L0X B;  2NTT A;  3TZU A;  3SK5 A;  4H13 C;  1JB3 A;  4S3S A;  3S2H B;  3C46 A;  1BO0 A;  2E75 C;  5D3I B;  1DOM A;  1S5E D;  3C2P A;  1GUG A;  1NCV A;  4HSV A;  2QEJ C;  1PRT B;  3PUY A;  5FO7 B;  1LT6 D;  1JE4 A;  5IGE A;  1EIG A;  1G2S A;  2EYO A;  4K6D A;  4RWS C;  4BS9 A;  1B44 D;  1STG A;  1CZG A;  3E5S A;  1R4Q B;  3S1R B;  1UUP A;  4I7Z C;  3TP7 A;  4M8A A;  5T1I A;  1W6K A;  4O42 A;  1KNA A;  3LX0 A;  1Y8N B;  3DMU A;  3NTH A;  1Q12 A;  5IOC A;  2OT2 A;  3D4R A;  4RAU C;  4BBS B;  1U4P A;  1IYU A;  5CV6 A;  3JAM L;  1D5X C;  3FMC A;  5M5Y B;  2IL8 A;  1IYV A;  5CV8 A;  4HAE A;  1QOH A;  5A35 A;  3HKZ B;  2K6A A;  1A3U A;  3SEB A;  3K5L A;  2VXW A;  1OXT A;  1WTP A;  4DNR B;  4K14 A;  4ZLT F;  5C4Z A;  1CA6 A;  2B2Y A;  2F0N A;  5ELB A;  2D2C C;  3QJY A;  3FRP B;  2MUY A;  4BA2 I;  5CMD A;  5FLX E;  4EGV A;  3KBG A;  4RGN A;  4GZY C;  3KLR A;  4OIJ A;  1FGB D;  3RD4 A;  3MAQ A;  4C3I B;  2NVT B;  1QNU A;  4PNY A;  2QKI C;  1SND A;  2X69 A;  2NVY B;  4RHS A;  4Y7N B;  3K5M A;  4KD3 A;  3M3Y B;  4OGQ C;  1HTP A;  1STB A;  2NN6 G;  2B2W A;  1HPC A;  2Z1C A;  5IIF A;  1SYB A;  5M5X B;  2VB3 X;  1HCZ A;  2BE5 C;  4KV6 A;  2JEA I;  2D62 A;  1PTO C;  3MTS A;  1VF7 A;  5EPK A;  2L55 A;  1H9S A;  3M4Y A;  1E2Z A;  3HG9 A;  4LAA A;  4Q5V A;  4OO1 H;  1ET6 A;  1QCB D;  2WV6 D;  3A8J E;  1MSH A;  1Y69 U;  4N9P A;  3NSW A;  4K2L A;  1ET9 A;  5EJW A;  5C6A A;  1B9M A;  1ENC A;  2NN6 I;  2E2D C;  3D4W A;  4ZYS A;  3S15 B;  3GTP B;  3O13 A;  3PIP 3;  2EZV A;  2NBF A;  1BUV T;  1RKN A;  1WD1 A;  1AW7 A;  1TWH B;  4A93 B;  1BR9 A;  3MXG A;  1KAA A;  2HDL A;  3HOV B;  5J39 A;  2RBM A;  1SYE A;  1G6Z A;  4QUC A;  1CT1 D;  5HUR A;  3NTK A;  2EY2 A;  5FO8 B;  2F0V A;  1RF2 D;  2AWO A;  1RHP A;  4BWG B;  2XWJ B;  2O5J C;  2E2J B;  2K33 A;  5EKK A;  4HR7 B;  1Q1B A;  4ZKB B;  3S16 B;  4NP5 A;  4BY1 B;  3AMU A;  2B2T C;  4PMC A;  3HEJ A;  2R61 A;  2K32 A;  4XYQ A;  3NBI A;  2F0K A;  5KYI A;  2K7V A;  4RH6 A;  5I9O A;  3S1M B;  3I70 A;  4MHE A;  2R6G A;  5BN4 A;  1EWC A;  2N55 A;  4DAV A;  4H44 C;  1QG7 A;  3PUZ A;  3X3N A;  5AFW A;  2K5D A;  2A69 C;  1F2Y A;  5J1Z A;  1SNC A;  1H9K A;  2IX0 A;  1TWF B;  4ZQ3 A;  5CBA E;  2B2U C;  2K03 A;  4ME5 A;  3VR6 A;  3T13 A;  4K5V A;  4IFD I;  3ZYY X;  3PIO 3;  1SE3 A;  4OHJ A;  2WAC A;  2IT1 A;  2XIW A;  1S5B D;  1PXU A;  1I4G A;  4K8J A;  1HA5 A;  2ID0 A;  3VR2 A;  5EPJ A;  2EY1 A;  1KLG D;  3A54 A;  2E74 C;  1GJX A;  2GA4 B;  3GTJ B;  2L12 A;  3C1F A;  1B3A A;  1F9S A;  1PRT C;  1BCP F;  4DFA A;  3NBH A;  4C2M B;  2XVS A;  1T5E A;  1YNJ D;  1EU3 A;  5K36 G;  1TS3 A;  4FVM A;  1LTA D;  3OPO A;  3RMH A;  5KEE A;  2SNM A;  3GV6 A;  1I3Q B;  3X3M A;  2ZXR A;  1PFB A;  3S2D B;  3QIA A;  3RUZ A;  3T4A C;  1IKM A;  3A55 A;  3DUZ A;  1LAB A;  2AUK A;  4L63 B;  3E6Z X;  4IN3 A;  2RDG A;  3S17 B;  1CHP D;  4LMQ D;  2WII B;  2ICE C;  3N52 A;  2DNE A;  1GOZ A;  1CQF A;  4C3H G;  1NAP A;  2RDF A;  2EE1 A;  2RQX A;  3NK9 A;  1CI3 M;  2KA7 A;  4EVO A;  2F0J A;  2EYM A;  1J8I A;  4DXG A;  1TT2 A;  2BDO A;  2IPK D;  2EJF C;  2MHV A;  2JYO A;  1SYG A;  2KJX A;  3D6C A;  1EL0 A;  4L8J A;  4J8Q A;  3JAM E;  2WAQ B;  5CV7 A;  2KEC A;  1D5Z C;  1IKL A;  1WVL A;  4FXG C;  1WTX A;  2SOB A;  3PV0 A;  1DOL A;  2C9O A;  1BNZ A;  1F9R A;  1EQT A;  2F0P A;  3J81 L;  5C4H A;  4BA1 I;  4PV1 C;  1KAB A;  2EY5 A;  2A6H D;  4DK1 A;  4B9X A;  3PO2 B;  5CV9 A;  2WP8 J;  4RKL A;  2EJM A;  1O7Z A;  1A6X A;  2KQ3 A;  3QWN A;  5I9P A;  4B08 A;  3MXU A;  3TSS A;  3MFY A;  1PZK D;  1BDO A;  1F2L A;  1XWE A;  3DWP A;  3S1Q B;  3CHB D;  5JJZ A;  5EKI A;  5IGD A;  1UNS A;  1TVX A;  4KMU C;  3URY A;  1QJO A;  1SYF A;  4ABN A;  3A7A B;  4XDX A;  2WKC A;  1JCK B;  2CQA A;  1PMR A;  1TII D;  2K04 A;  3A7L A;  1SEB D;  2I07 B;  1SE2 A;  2X6G A;  4WFN 3;  2NUC A;  1X32 A;  5DM7 3;  3AU7 A;  3SE0 A;  4C3J G;  1SMY D;  3K58 A;  2NN6 H;  4DGZ A;  3M4O B;  2E76 C;  2M9V A;  1O7Y A;  1EWH A;  1U9R A;  5M5W B;  3HOY B;  1E2W A;  3J7A V;  3F2U A;  2ENB A;  3MWY W;  2D9U A;  5IGG A;  2G9D A;  1O80 A;  5IGF A;  2PZU A;  1GHJ A;  2EYJ A;  5BN5 A;  2IX1 A;  3LWE A;  2JA7 B;  1EY5 A;  1AP0 A;  2NTS A;  4Q0F A;  4QB4 A;  3R8B A;  2I46 A;  3Q23 A;  2KCN A;  3TP8 A;  1A3V A;  1FNV A;  4HMJ A;  4CKC A;  5C4J B;  3I90 A;  4ZAI A;  1E0B A;  1G2T A;  2KOL A;  3J7Y W;  3HOU B;  2M00 A;  1D6E C;  2R93 B;  2HCC A;  1BCP D;  3CRL C;  4RGT A;  1DCZ A;  1EY6 A;  2XWB B;  4FXK C;  4ZUI A;  3TZD A;  5KGU A;  2F0L A;  4CGY B;  1TS5 A;  1JR0 D;  1ENF A;  5DEH A;  2QDB A;  1AEX A;  5ELD A;  3EQL C;  1BCP B;  1O78 A;  1KNE A;  2PZW A;  1AZP A;  2FMM A;  2QIL A;  3PUV A;  2C5C A;  1SAP A;  1AZQ A;  3NUC A;  2EYH A;  5I2Y A;  3S1N B;  1I4P A;  4RGM A;  3GQB A;  1YNJ C;  2FIN B;  1PZJ D;  3BYT B;  5D3D A;  1RTO A;  2PW5 A;  3W3A A;  3NXW A;  4C56 C;  3A8I E;  2H4O A;  4QIW B;  2F3W A;  1QE6 A;  5COY A;  3H6M A;  5E1F A;  5KND A;  1MBY A;  3PO3 B;  1EFI D;  4CJ1 B;  3K5O A;  4F88 A;  2NVX B;  1HUM A;  1PLF A;  5TSS A;  3V96 A;  4KJO A;  5DM6 3;  3SXH A;  1D5M C;  4KN7 C;  5CV4 A;  2F0W A;  1CK1 A;  3R3O A;  2QF7 A;  4DA2 A;  3NWT A;  3ONA B;  1HUN A;  2ICI A;  1QB5 D;  5ELF A;  1I4H A;  3HS0 C;  3OMC A;  4NW2 A;  1ILQ A;  1QWY A;  3RZD B;  2KVM A;  1STH A;  5K36 H;  1NR2 A;  1LAC A;  2KED A;  3U9O A;  2F0Q A;  1PDQ A;  2KEE A;  3A8K E;  3GTG B;  4A3G B;  3BZD B;  2EJG C;  4IUV A;  3I72 A;  1PFM A;  1PFN A;  3GTQ B;  2RSO A;  1RJT A;  3CKI B;  1JWM D;  3D31 A;  5M3M B;  1S5D D;  1RD9 D;  2SEB D;  4E6I A;  2F0H A;  1A2T A;  3G7L A;  4P2C B;  2IJ0 A;  1M4V A;  2XRS D;  2OXP A;  1LT5 D;  3NHH A;  1FNW A;  3FVQ A;  1DYQ A;  3D4D A;  3L3O C;  5F2D A;  1XYI A;  2A6H C;  1V1P A;  4CHT B;  2R3Z A;  3J81 E;  1BBX C;  1C4Q A;  1Y1V B;  4H7B A;  1KDB A;  1SYD A;  1S4Z A;  4XIG S;  3MA2 B;  1CA5 A;  1OXX K;  1SBB B;  2B63 B;  5IT9 L;  1JWU D;  1JOK A;  3R2I A;  3CRK C;  2LS0 1;  4DN4 M;  2JEB I;  1SJH D;  3AB9 A;  4A3D B;  2WKD A;  1EZ8 A;  3OOC A;  1ZYR D;  3I4L A;  4DXF A;  1DOK A;  5C0X I;  4HSP A;  1JOQ A;  2AUJ D;  1G29 1;  5LHY 1;  2SDF A;  4IFD G;  1I6H B;  2PZT A;  3OIP A;  4YIJ A;  5JPM C;  5JOB A;  3HGB A;  2VB2 X;  4KY5 A;  1CTM A;  2J7Z A;  2WB1 B;  3HP3 A;  3WOF A;  3DEP A;  1EQV A;  3H94 A;  3P7J A;  3GTL B;  5CC4 A;  2MGS A;  1XTC D;  5C0X J;  3FPU B;  4FYD A;  2ZXP A;  2A6E D;  2PMZ B;  1SMY C;  2B2T A;  3VYS A;  2NVQ B;  5JEA J;  1B9N A;  4G4K A;  1WTW A;  3Q6S A;  1GUN A;  3IL8 A;  1J9O A;  2N88 A;  1B1Z A;  2O5I C;  3C3L A;  5LL6 S;  2J4X A;  4XT3 B;  2Z4H A;  1QIL A;  2RDH A;  3D6W A;  1UAP A;  2LFN A;  1SNP A;  2EVB A;  1EEF D;  1I4Q A;  3TME A;  4G7H C;  2EY6 A;  4RFB A;  1QNK A;  4RHR A;  2DY7 A;  4J6H A;  4C3H B;  4U68 A;  1D1K A;  2AQ3 B;  2HDM A;  2HCI A;  1F77 A;  4B9W A;  3VYT A;  5FO9 B;  3NQT A;  1O7L A;  4KK7 A;  1YNN D;  4XTC S;  2PNR C;  4J1M A;  3BYY B;  3BG3 A;  3LWU A;  2O2L D;  1BCP C;  5C5L A;  1PTO H;  4V19 0;  1CFM A;  3TP6 A;  1FR3 A;  3D3R A;  5G3L F;  1TS4 A;  1IL8 A;  3GTK B;  4HCS A;  4K8I A;  5CGK A;  1SE4 A;  4DU9 A;  5CV5 A;  3PUW A;  1CM9 A;  4A3K B;  3KUP A;  2R7Z B;  3IFD A;  1F2M A;  4ODG A;  1B4O A;  2Q8R E;  4A3B B;  3MXP A;  4ZRZ A;  3ND9 A;  4H0L C;  5ISR A;  1EYC A;  3BS1 A;  1I6V C;  1SFO B;  3K0Y A;  2PPB C;  3TDQ A;  2FMC A;  4PMW A;  1JWS D;  1T5X D;  1HFG A;  4CKE A;  2NYZ D;  3FDT A;  3GV3 A;  4XXE A;  4IQZ A;  4XYO A;  4CBV A;  3I8Z A;  4CJ2 C;  1GUW A;  4KKU A;  1SNQ A;  2CHB D;  2LMC B;  3P1H A;  4IUN A;  2CW0 D;  2L0C A;  3S9W A;  2EDG A;  1KTK A;  4QCL A;  5KRU A;  2SNS A;  3OWE B;  3VA5 A;  2EOT A;  4DF7 A;  1TQO A;  1VMC A;  2EXZ A;  2NWG A;  3EVQ A;  1TWA B;  1Q3L A;  5C5M A;  3KK7 A;  5JAV A;  1U4L A;  1B2T A;  2B2V C;  1STY A;  5ELC A;  1ENA A;  2Z4I A;  3VR3 A;  3FKI B;  1EY7 A;  3T51 B;  1SJE D;  3QOL A;  2DY8 A;  1GUS A;  2F0I A;  3D8G A;  2F4I A;  4NKL A;  4X3U A;  1JIC A;  2PW7 A;  1H9S B;  3M7G A;  3IAY A;  2FJ2 A;  4AYB B;  1G91 A;  3T16 A;  1EOT A;  4EQO A;  4C3J B;  1Y1W B;  1AFP A;  1NSN S;  4KKT A;  2BDN A;  1OO9 B;  1FNU A;  3U9S A;  2RVL A;  4IUR A;  4TKO B;  4IUP A;  3J7A F;  1S5F D;  5C3X A;  4DNT B;  1EY8 A;  1VF5 C;  1H9R A;  3J80 L;  4FF1 A;  1W6J A;  2ZXO A;  2OF1 A;  1BOS A;  2F0S A;  3G6J B;  4RCN A;  3GTM B;  2BA0 A;  1EY4 A;  3I4M B;  2MPM A;  4ULL A;  1DZ1 A;  4ILW A;  3DHQ A;  1I50 B;  3MZ5 A;  4XQJ A;  3V05 A;  5E4W C;  1D1I A;  3K7A B;  4KY7 A;  4N9T A;  5LL6 X;  2JE6 I;  1A2U A;  3H3V C;  5EBC A;  4HN7 A;  2EYF A;  1AN8 A;  1OXV A;  1SNM A;  4UDU C;  5IT9 E;  2EYP A;  5BN3 A;  1ZYR C;  1E2V A;  4G57 A;  3SHL A;  3DEO A;  1SXT A;  5HGT A;  3ITP A;  1TY2 A;  3DXJ C;  2A69 D;  3OW7 A;  3K59 A;  3WDN A;  1II3 A;  2FHT A;  3KBX A;  3BVM A;  3K6O A;  1DXM A;  1ZKO A;  1TR5 A;  2F1M A;  1ILP A;  2M2L A;  4BBR B;  1Z7T A;  3CQZ B;  1SDF A;  1FD7 D;  4F7X A;  3Q24 A;  2TMP A;  1LO5 D;  1RTN A;  2A6E C;  1VDZ A;  3MXN A;  1OXS C;  3IFT A;  1SYC A;  2PQE A;  2TSS A;  2H1E A;  4LJZ C;  2D5D A;  3QOJ A;  3KF8 A;  4ZKC B;  2L11 A;  4KI0 A;  1R4P B;  3TBI B;  2F0D A;  4FF3 A;  4BY7 B;  1MSG A;  1WTR A;  2BCO A;  1MD2 D;  1BQQ T;  4PMB A;  4QF4 A;  1I4R A;  5G3L D;  5EQ0 A;  3NWS A;  3K5N A;  1H9J A;  2KUM A;  4IFD H;  3FEW X;  3RLF A;  2JA5 B;  2L9H A;  4HMI A;  2E2I B;  1ONL A;  3IKJ A;  4HTH A;  3SK8 A;  2MP1 A;  3SK6 A;  2JA6 B;  4M1U B;  5EBD A;  1NUC A;  1KDA A;  2Q8I B;  5IGC A;  1CZW A;  4UAI A;  1U4M A;  1CQV A;  1GUT A;  5E3F A;  5JVG 3;  1KDC A;  1YNN C;  2VNU D;  2XN9 C;  4WOR A;  3BDC A;  1HFN A;  5D65 A;  2F0O A;  3GO5 A;  3LNN A;  3HOZ B;  1STE A;  4EQN A;  4KHZ A;  2KHS A;  4C1N K;  4WJW A;  4X3K A;  1PYW D;  3M7N A;  4R8N A;  1D2B A;  2A68 D;  1RCV D;  2JXM B;  3C1E A;  1LV9 A;  2PYK A;  1EIH A;  4RGO S;  1F9P A;  1ZEQ X;  3P75 A;  2B2Y C;  1EEI D;  4DK0 A;  1TY0 A;  4FO2 A;  1Y8P B;  4DAP A;  1STA A;  3TN2 A;  5JPN C;  3K57 A;  3Q22 A;  1SNO A;  1EYA A;  4F8M A;  2A73 B;  3MHB A;  1IHZ A;  5D14 A;  3BVZ A;  2HQE A;  4C1N I;  1S5C D;  1EY9 A;  2RSN A;  2DNC A;  4Z9C B;  4KTA A;  1EY0 A;  3S14 B;  3WOE A;  5I2X A;  1VCI A;  3DM1 A;  5A2Q L;  2F0E A;  3A56 A;  4IUQ A;  2CW0 C;  2QCP X;  3E0J A;  4A3I B;  2B2W C;  4A3E B;  3ERO A;  3R2T A;  2R92 B;  1LT3 D;  1L0Y B;  1H9M A;  1TU2 B;  4V0B A;  5J22 A;  3H0G B;  4KHV A;  1LLR D;  4ZUJ A;  2PCF B;  3CU7 A;  4U67 3;  1PTO F;  1ESR A;  3QO2 A;  2K05 A;  2OEO A;  5C0X G;  4DAY A;  4L6T B;  1K8M A;  1M8A A;  4KY6 A;  2L5T A;  4CJ0 B;  3T53 B;  1F2Z A;  4TQU S;  1JC7 A;  3R93 A;  3V2T A;  3I4N B;  5JEA G;  4F87 A;  2YYZ A;  3L9A X;  2A5H A;  2F0U A;  3ERQ A;  1HQR D;  3HZX A;  1B53 A;  2K1B A;  4C3I G;  2BOS A;  4O1N A;  4CKB A;  2JA8 B;  1ESF A;  3SK4 A;  5FKA C;  2PO4 A;  5M3F B;  1LTG D;  2F0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...