3NQTA

Crystal structure of staphylococcal nuclease variant delta+phs v66a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nqtA00
2EY2A 3C1EA 1KAAA 3EROA 4KTAA 1EY4A 3TMEA 2PZTA 3E5SA 5NUCA 2EYFA 5I9PA 3D4DA 3D8GA 1EY9A 2EXZA 4NP5A 5I6WA 4E6IA 4DGZA 2EYLA 3TP6A 2OEOA 2RDFA 4R8NA 5I6YA 5KEEA 3V2TA 4KD4A 2F0TA 3MXPA 3TP5A 5C4ZA 5IGGA 3H6MA 3NP8A 4K5WA 5EKLA 5F2DA 1EY5A 1SNMA 1STNA 1EZ6A 4EQOA 1RKNA 2HQEA 3RUZA 2NUCA 1STHA 1A2TA 1F2MA 5IIFA 5K5PA 5HGTA 2ENBA 5CGKA 5DAUA 5EGTA 1II3A 1EYCA 3ERQA 5DEHA 3D6CA 3SHLA 2F0QA 3T16A 5KRUA 3T13A 4DFAA 1JORA 1EYDA 1A2UA 3OWFA 2PYKA 4NDXA 5KGUA 2F0WA 3QOJA 4I65A 4K8IA 1SYBA 3SXHA 5C6AA 2PZUA 4ZQ3A 3P75A 2F0FA 2F0SA 5CV8A 3SK5A 3SK8A 2KQ3A 4QMGA 2M00A 2PQEA 3OMGA 1EY6A 2F0PA 2EYHA 2LKVA 5C3XA 2PW5A 4PNYA 4PMBA 2F0LA 3D4WA 4DU9A 4K5XA 4PMCA 3R3OA 5IGDA 1ENCA 3DHQA 3SK4A 4ODGA 4DF7A 3S9WA 4KJNA 4ID6A 4MIUA 1SYDA 4K6DA 4F7XA 3NUCA 4ZUIA 1STBA 5C3WA 4IALA 5C5MA 2F0NA 2F3WA 5IGEA 4J1MA 1SYEA 3EJIA 4RKLA 4S3SA 5CC4A 1ENAA 2F0KA 4B9WA 3BDCA 3P1HA 4ZUJA 2PZWA 1KDAA 1STAA 2EYOA 1EY8A 1SNQA 3OMCA 3U9OA 4QB4A 2F0IA 5CV4A 4K2LA 2F0UA 1SYGA 4TRDA 3SK6A 5I9OA 2WACA 1SYFA 3MVVA 2PW7A 1A3UA 2F0OA 4HTHA 5IGCA 3MHBA 3HZXA 1EY0A 1EZ8A 4ME5A 4H7BA 5IODA 5M9OA 5J39A 2SNMA 1SNOA 2EY5A 2RKSA 3QB3A 5JAVA 1IHZA 1SNCA 4IZ8A 4KY7A 5CV7A 2F0EA 3VA5A 2F0GA 2F0HA 1EQVA 3HEJA 1TQOA 3NHHA 2QDBA 3OSOA 4HMIA 1TT2A 1A3TA 2EY6A 1F2ZA 5CV9A 5JOBA 3QOLA 1KDCA 4HMJA 4K5VA 1JOKA 5KYLA 5CV5A 5J22A 4WRDA 3TP7A 4N9TA 4OL7A 1AEXA 2F0DA 3NK9A 1KDBA 1SNDA 1F2YA 4K8JA 3TP8A 4KJOA 2O4XA 5CV6A 4WORA 5EKKA 5J1ZA 5IGFA 4QF4A 1STYA 2EYPA 2EY1A 5E1FA 5C5LA 4EQNA 3ITPA 1EYAA 1SYCA 2OXPA 1KABA 3C1FA 3LX0A 5IOCA 5ISRA 1A3VA 1STGA 2EYMA 3MEHA 1NSNS 5E3FA 1JOOA 4KY5A 2EYJA 3EVQA 2SNSA 2F3VA 1NUCA 4EVOA 4KY6A 4KHVA 4NMZA 2RBMA 4KD3A 4KV6A 4LAAA 4EQPA 5KIXA 3BDLA 4YIJA 4IUNA 2F0MA 5IGBA 4NKLA 4K2KA 2OF1A 5CR3A 3NXWA 5KYIA 2KHSA 2F0VA 4G57A 2SOBA 3DMUA 3SR1A 1SNPA 5C4HA 2F0JA 3NQTA 4N9PA 4K14A 4J6HA 1JOQA 3PMFA 1EY7A 4RKBA 4B9XA 4F8MA 3MZ5A 5HURA 1TR5A 1U9RA
chains in the Genus database with same CATH superfamily
1NCVA 5IWAQ 2EXZA 2NVXB 3TP6A 3J7A5 1PV4A 1B44D 3I91A 2CW0C 3X3MA 2WAQG 2VNUD 1EOVA 5C4JH 3FPPA 3J80i 4QCLA 5C4ZA 3FP9A 4C3HH 4DR3Q 2JSOA 2EJGC 2HQEA 1TWGH 1STHA 5IIFA 5M3FG 5IYDH 1DJRD 2HIVA 4B3RQ 2AUKA 4LUZA 4R1JA 3KDFA 2KCTA 5LMNQ 4J15A 3JAMc 1J9OA 4A3EB 4A3FB 2KQ3A 1A6XA 2CKZB 4DXGA 2VB2X 2EYHA 3R3OA 1DXMA 3S1NB 2N3SA 3MEFA 1J8IA 3PQIA 3CCVA 1NNXA 3NUCA 5C44H 1VQBA 5FO7B 5C5MA 3S15B 1I4PA 4PQXA 2WAQB 1TS5A 1PH5A 2UUBL 1RF2D 5KNCA 4FYDA 2CH4W 1FNUA 1LTGD 1E3PA 1ZXTA 5AJ3Q 2VQFL 5M3FB 3I56A 1BF4A 2EVBA 1OXVA 3BVMA 3MHBA 1XNRQ 1YNND 2DUDA 1SNOA 3QO2A 4KY7A 1UAPA 1X3QA 3G6JB 1PHJA 1RTOA 2BDOA 4L63B 1KTKA 2Q2UA 1WYDA 2ID0A 5IY0A 2XIWA 2NN6I 4DAVA 1KQSA 4UP8A 4DV2L 2JA8H 3CAMA 4EGVA 4A3BH 3RLOA 2IX1A 2EY1A 2IW3A 1UNSA 1EYAA 3K8AA 3CU7A 2P5ZX 1IYJB 3KF6A 3UDFA 2NN6H 1L2FA 3ND9A 1TS2A 1BXTA 4CDDC 3BVZA 1JQYD 3KJOA 4O1NA 2ZTDA 4DV5Q 1CQFA 3I4NH 1NE3A 1K8MA 3SEBA 2RF4A 3PIO3 4POGA 3NENA 1SNPA 1YZ6A 2F0JA 1U4PA 1BKBA 1JJCB 2K5VA 2IY5B 5M5YB 1GHJA 4HIMA 4JI2Q 2CW0D 1CKNA 1ICWA 1EY5A 5JEAJ 1Z7TA 4UAIA 1L0WA 5C4XH 4IFDI 1A2TA 1SJED 2MPMA 3GTJH 4C3HG 3ERQA 5KRUA 1EIFA 4R4OA 3SDZA 1WI5A 1UE5A 4ZQ3A 2YTXA 4DA2A 2AQ3B 3K59A 2R92B 2KVMA 2OQ0A 4IFDH 4OO1I 3NSWA 1D8LA 3ND8A 5BR8L 2VY3A 4A3IG 4DR5L 3EJIA 3GTMB 1OXSC 4OO1H 4ZUJA 1UE7A 3TBIB 5M5WH 1F2LA 1VQKA 4HCEA 5T1IA 5C4JB 2KA7A 4TRDA 4CDEC 1I4HA 2RCNA 4C3HB 3PIPA 3GTPB 1TWGB 2QDLA 3D4RA 3E9IA 2PMZB 2F0HA 1TQOA 1Q86C 1D1IA 4GKKL 1WVLA 4RWSC 4A76A 1UE1A 1B9NA 4DAMA 4EQ5A 4JOIA 1VS0A 1PH1A 2ZXOA 4WRDA 2K5QA 4LF9L 4O42A 4L5SA 4OXPA 4A3IB 1LACA 2A6HD 2PCFB 4KJOA 2R7ZH 4P75A 1N33L 2EYPA 1I94L 3ITPA 5M5XH 3PIP3 4A4IA 1N36L 3S2DB 4LFAL 3RN2A 3R8BA 1RODA 2B2UC 1I50H 1IL8A 3NBHB 1WCMH 1B4OA 3VYTA 5CR3A 1KXLA 1WTRA 3MA2B 4IPHA 4B9XA 4LFCQ 1LTID 1U9RA 3FMCA 2JA5H 2WV6D 1E1OA 3HKSA 1MIUA 1J5EL 1PVOA 3A0JA 4U68A 4ZKBB 2D62A 2VQFQ 1Q1EA 4ALPA 3OOCA 4N8FA 1HFGA 1FYCA 1ET6A 4BXXH 2UUAQ 3HOVG 1B3QA 1VQGA 1GUTA 5C4XG 4NXNL 1Y69U 1ENFA 3ZYYX 3CCRA 1BOSA 1QUQA 3OMGA 3KDFB 2KCMA 4FDBA 2BE5D 1GJXA 3ZJYC 4DV2Q 4QY7A 4PZ7A 4BWGB 1C0AA 4FF1A 4MIUA 1PH7A 1CA6A 4IFDG 4WJ4A 2I5LX 2E2JH 3GV6A 2RHSB 2NVTB 1CKMA 1QNKA 3S1QH 4IJHA 2MQHA 2PI2A 4HAEA 1Q7YC 1W6JA 2MHVA 1I4GA 4OWXB 2F0UA 3SK6A 5BN3A 3EN2A 1E0BA 4L8JA 5C4XB 4L5RC 3BYTB 4ZAIA 4A3JG 2MP1A 5HY6A 4BY1H 1S5DD 3CRKC 2VQEQ 2F3IA 1C48A 1HTPA 3JC66 4HMJA 4MHEA 3Q24A 3K5MA 4IOAA 3SVMA 4P2CB 2PQAA 5FKAC 2G9DA 1HR0L 1F2YA 2MO0A 3HGBA 1DONA 1SN8A 4QUCA 1V1PA 2L4NA 4TSSA 1STGA 4ZYSA 1UEBA 4RGOS 3CCLA 5FLXL 1ONLA 5IT9E 4LAAA 3RR5A 3KF6B 5IGBA 5BR8Q 4A3JB 3A7LA 2KHIA 4DK1A 4LMQD 5C3EG 3MXNA 4DR5Q 4NXMQ 4KTAA 3EROA 2CVRA 1QVFA 3PUVA 2EDGA 4ZRZA 1TKWB 3BJUA 4GN3B 2NTTA 5GAEC 5F2DA 3RZOB 1EZ6A 4CGYB 4YCVA 1L0XB 4A3KH 3S17H 3C2PA 2G9HD 1XPUA 1F2MA 2AWNA 5M3MG 5M5XB 1HTLD 1CKNB 4GKKQ 4NDXA 4A3GH 1Q90A 5EAYA 3KLRA 1V1OA 3STBC 2M2LA 1HA6A 1HFNA 1RL2A 4KK7A 1BR9A 3AU7A 1CUKA 1I50B 4CJ1B 4LF9Q 1TIID 1SDFA 2NB0A 1CKOA 3PO3H 2E2HH 1ZYRC 3NWSA 1I94Q 4K6DA 4YWLA 1N36Q 4Q5VA 4LFAQ 2A68C 1ASYA 1SYEA 2E74C 5EKIA 3GTQH 1GOZA 4K6LA 4B9WA 4JI6L 2XWJB 3A8JE 3F2UA 4RGMA 2F0IA 4KKSA 4DR6L 1SYGA 3LNNA 1NBWA 5M3MB 1SROA 1I4XA 1D7QA 1PLFA 4HTHA 1A3UA 5JJLA 5GQOA 1YHBA 1XJVA 4ME5A 4HJ7A 1PFSA 3K81C 4H7BA 1RCVD 1EFID 5ELNA 4RHSA 4R4CA 3K7UC 1J5EQ 4NW2A 5FJ8H 1Z47A 3K5LA 1LT4D 4HJ5A 5KYLA 4XQQA 1SXTA 4GLXA 1BDOA 2DGYA 1O80A 2K04A 2O4XA 5IGFA 2E2JB 3C1FA 3OHXC 4NXNQ 2CFMA 3ULJA 4B3RL 3J80L 4V190 2DY7A 1Y1VH 4C2MH 1IL2A 2ICEC 1A63A 1VQ7A 2EOTA 2MO1A 1KAAA 3R93A 2KENA 3E5SA 2DY8A 3D4DA 2JXMB 2EYLA 3M7NA 5JPNC 1E22A 4K0KL 5JJIA 1U4LA 1MBYA 4HSPA 4B3TL 4A3MH 2F0TA 5EPLA 4A93G 1GUNA 4RGNA 2KCNA 1DD2A 4OWTB 4YWKA 1HNXL 1VMCA 1Y1WG 4X65Q 4A3KG 1C7YA 2VS1A 4FXDA 1EWCA 4FXGC 4IPCA 5GAHC 1Q82C 1XNRL 1GUWA 2VW9A 3STBD 4RG1A 2F0FA 1C8CA 3RD4A 1HR0Q 3BZCA 1EU4A 1H9RA 1S5FD 1HNWQ 2F0LA 2QKIC 3GDEA 1ZYRD 4HR7B 4DF7A 2WP8J 2DNCA 3WWVA 4ID6A 1E2VA 1EEID 3HOWH 4HJAA 3CXCA 1JR0D 4QIWE 3PO3G 1E24A 2A68D 3H09A 2Z6KA 4S3SA 1WTOA 3J7YW 4A93B 3W1GA 4Z9CB 4L5QA 3MFGA 3UI2A 5EPJA 1UEAB 3HOUH 3BU2A 1Y8NB 4OONA 4WJWA 2WACA 4JI7L 4DV3L 4A3KB 2AWOA 3HZXA 1EY0A 1H95A 4V0BA 3S17B 3IAYA 2K28A 3DWPA 5JJZA 2AHOB 2JJQA 3E0JA 1F2ZA 5CV9A 1YI2A 4LF7L 4A3GB 1BBXC 3W3AA 2QW7A 2VL6A 2K5DA 1G6ZA 1Z9FA 2JA9A 2K50A 5FO8B 3Q8DA 2JP1A 3PO3B 2E2HB 5EKKA 4JI3Q 1W6KA 4ILWA 4H13C 5GROA 1HUMA 2PQAB 3V05A 2FMCA 1IXRA 3W2DA 3EQLC 1YNNC 1PFNA 2EYJA 1KD1C 2B2WA 3VYUA 1FD7D 1V1PB 1B7YB 3J81c 1QE6A 1AE3A 4IO9A 1VQAA 3CCQA 1JJ2A 1Y1VG 2JE6I 2BA0A 2A1AA 2E5LQ 2EY2A 3C1EA 4X64L 4G7ZC 3TMEA 3FKIH 1K8AC 1SAPA 2B29A 3MXNB 2BCOA 5I6YA 2XSCA 1CZWA 4DR6Q 1PFMA 4C3IH 4ABNA 2C5CA 2R61A 1GO3E 1JJGA 3I70A 4DKAC 3GTGH 4A3MG 5JPMC 1HPCA 2GA4B 1GM5A 4BBSH 2EZVA 3CMEA 4A3EG 2F0QA 1JORA 3K7AH 4DNTB 3OIQA 5DNFA 4HSVA 4QMGA 4C2MB 1Y1VB 3CQZB 2PQEA 5C3XA 5JJKA 1CSPA 2C35B 4DN4M 2LMCB 1DGSA 2KBNA 3HOWG 1IBML 4PZ6A 2B2YC 3WDNA 1EEFD 4A3MB 3M4OH 3Q22A 1B3AA 3FRPB 2XNAC 3T1HQ 1EOTA 3HOUG 2DJGC 1EFWA 1VQLA 3I73A 3VA5A 2ATWA 1EQVA 3OSOA 1JB3A 4Y7NH 3BZKA 4RMFA 4K0KQ 1DOKA 4LFCL 2L15A 2JQOA 5D3IB 1HXYD 4K5VA 2EIFA 4B3TQ 2J0TD 1EQTA 1BBUA 3MFYA 4WORA 3RMHA 4IOCA 4EQNA 5C5LA 1MJEA 1HNXQ 1SYCA 2XWBB 1YEZA 1K0RA 5EQ0A 3HOWB 1F9RA 1WTHA 3S16H 1E2WA 4KY5A 5FLXE 5IYBG 4F87A 4R9WA 1LTAD 1NUCA 4L6TB 1X32A 4X3KA 2UUAL 1I6VC 1CA5A 4EQPA 3HOUB 4IFDJ 4G7HC 4K2KA 2OF1A 1X3GA 3GD7A 3WOEA 3DMUA 4CDCC 3PIOA 4R8IA 4BBRH 2A6HC 3L3OC 2R93G 5CBAE 4FP5D 1D5MC 3TS2A 2EYFA 3PUZA 1GD7A 1HQRD 2JA7H 2I46A 2MUYA 4R8NA 2ES2A 5ELDA 2VB3X 4OGQC 3J81L 1IYVA 4JI7Q 4DV3Q 5IP7H 2MGSA 3I4OA 2NUCA 3UDIA 2ENBA 4AQYL 3DWAA 1VMPA 3SHLA 2R92G 5A2QL 4GZYC 3D3RA 1EYDA 4H44C 2F0WA 4LF7Q 4P74A 4BBSG 3NE5B 1J6QA 2HDLA 4XQNA 1JCKB 1ET9A 3OPOA 2M00A 2D2CC 2F0PA 2VQEL 4IURA 4KHZA 4A3LH 1Q46A 4PMCA 1XXGA 3GTLH 2R93B 3EA6A 5H1SE 4KJNA 3S1RH 2A69C 4F7XA 2VXWA 3PUWA 4JV5L 1DM0B 2DN8A 1GUSA 2XVSA 4JW0A 1GKHA 1VDZA 3BDCA 1PRTC 3VYSA 3I3CA 2E2DC 3QIAA 2K52A 2HQLA 3HG9A 1SNQA 1FNWA 1A8VA 3U9OA 3CKIB 5CBEE 5IYDG 5CV4A 1EIYB 2F4VL 3GTGB 3C3LA 1P8LA 3OYYA 3NPPA 3KBGA 2EY5A 3IFDA 3AMUA 2BE5C 1Q8IA 5CORA 2AKWB 4X64Q 4BBSB 4TVAB 4QJFA 1OXUA 1PYSB 2AQ2B 2KECA 1KDCA 3K7AB 4NXML 1DOMA 3V96A 1F9SA 3GV3A 1TXYA 5C44G 5TSSA 4H0LC 3A56A 3VYRA 2IX3A 1STYA 3K80C 1PFBA 3Q0AA 1S3OA 1ICFB 2Y0SE 2E2IH 5IOCA 2BH2A 1BVSA 3PO2H 1JOOA 3LWEA 3MXUA 2WFWA 5C0XI 3G4SA 3J80E 4KY6A 4IQZA 4KHVA 5E4WC 2OTLA 3NEMA 4PZ8A 4UDUC 2B2TA 4NKLA 5FLXc 4LF4L 4JI4L 2AUJD 5HGQA 1K8GA 1K3RA 1NR2A 3CP0A 3CRLC 5C0XH 1XMQL 3E9HA 1FNVA 3W5OA 1HNZL 3MAQA 4Y7NB 2PZTA 4YWMA 1EU3A 4IUUA 1IBMQ 4NP5A 5EBCA 1F77A 4BBRG 5C44B 3RNUA 1YVCA 2QGQA 4OEMB 2JA8G 5KEEA 4A3BG 5LHY1 1LTLA 3NTHA 1B1ZA 3MXPA 1FGUA 1CHPD 2JA7G 4EQOA 2QEXA 2NN6G 1XNQL 1DOLA 2B2TC 4JBJA 5K5PA 2OWOA 3A7AB 3M85A 4KMUC 1QOHA 1O7IA 3HKZE 4JOIC 2Z4HA 4X62Q 4B3ML 1QNUA 4CKBA 4DV1L 1SJHD 3I4NG 1NMFA 4XIGS 1B50A 3K5NA 2I07B 4UP9A 3PSIA 2EQSA 4PMBA 2L9HA 1QCBD 1GXDC 3OIPA 2R7FA 2VUMH 3HOZH 2AMCB 3ER0A 1GVPA 1Q8KA 2A69D 1Q81C 4ZUIA 4BBRB 4OX9L 2JA8B 2F3WA 4A3BB 4RKLA 4NB3A 5ELFA 4H02A 1PRTD 1VQ9A 1X55A 1MSHA 4GNXA 2JA7B 1XWEA 1FR3A 2FINB 2NVYH 3I90A 3J7AV 3KYHC 4CKCA 4DR4Q 1N32L 2ZTEA 3I4NB 4O2DA 4G4KA 5CV7A 1VQEA 1SE8A 1FGBD 1PMRA 1GUGA 4P72A 2B2VA 2RDHA 3MTSA 3URYA 1LO5D 2FXQA 3BS1A 1IYUA 3NK9A 4GNXC 3GTLB 1NAPA 5J1ZA 1NR4A 4C56C 4OO1G 4JI8Q 4AQYQ 2B8FA 3S1RB 4CDFC 2OXPA 3LX0A 1XPOA 4DUYL 1A3VA 2YTVA 1U4RA 4KI0A 1NY4A 1QZHA 1EQQA 1KNEA 1IW7D 3GTJB 2K05A 1LLRD 2HDMA 4X65L 4KD3A 3PO2G 3L9AX 2IPKD 5KYIA 1XTDA 3J80c 2RDGA 3H3VI 4JV5Q 1HNWL 2IT1A 3BDOA 3J81j 1PXUA 4JYAL 5JVH3 3H3VH 3DWQA 2ZJPA 2R7ZG 1ASZA 4KD4A 1VQNA 2F4VQ 1PRTF 1LV9A 5M5WB 2RSNA 4F88A 1SE2A 2R6GA 2ZJRA 4OWWB 4X3SA 3M3YH 1YBYA 2JYOA 3PO2B 2ZM6L 1WCMG 2D0PA 5LL6X 1D2BA 4UP7A 1BUVT 2QEJC 1PRTB 2HCCA 4LFBL 2B8GA 4IJLA 1EY6A 2K4KA 2PW5A 4U673 2JA5G 1QVGA 3O13A 4LNQA 1CFMA 1M90C 4IN3A 4PMWA 4X6AH 1EWIA 2R7ZB 2K6AA 4JI3L 1HA5A 1G6PA 2F0KA 1S4ZA 3JAMi 1KDAA 3U58A 1HZCA 1HRJA 1QJOA 1V9PA 5FOBB 4LF4Q 4JI4Q 4BXXG 1ESFA 2WB1E 1UWVA 4X3UA 5IODA 1WCMB 1STEA 1SMYC 1XMQQ 3KBXA 1SNCA 1JWSD 3NQIA 1VQHA 1HNZQ 2JA6H 4P71A 1A3TA 3PF4A 3QOLA 1EL0A 2E5LL 4J8QA 3AFQA 2JA5B 4KHPL 2YV5A 4JBWA 3L2PA 2F0DA 2HIXA 2Q8TA 2K75A 1XNQQ 4KN4C 4FF3A 4KKUA 5ELOA 1P16A 1SBBB 1KC8C 3S1MH 4B3MQ 2PMZE 1KLUD 2A73B 4DV1Q 2RVLA 1NSNS 5E3FA 3SE0A 5ELCA 1QZGA 1CZGA 1JICA 3EVQA 2QILA 2F3VA 4AIMA 2WIIB 1E1TA 4KV6A 2NVYB 3S14H 3Q6SA 1K83H 3VDYA 3NTKA 2F0VA 1K0SA 2SOBA 4BY1G 4K14A 4J6HA 2Z4IA 4KLKA 4JI1Q 3PF5A 4OX9Q 3NWTA 2FFKB 2LS01 1EIHA 1HQMC 4QQBX 3HOXH 3L0OA 3NELA 2OEOA 1LT6D 5D3DA 3J81E 1HJPA 5IE8A 3N52A 4X66Q 1EQRA 3S1QB 5EKLA 1AH9A 1STNA 1N32Q 5DM73 4A3CH 1D1KA 1MSGA 1UE6A 2BOSA 5HGTA 1IZ6A 1JE4A 3T1HL 1GHKA 1YITA 2B63H 5A2QE 1YIJA 3HOYH 1TVXA 3F2CA 2O2LD 1YNJD 4LJZC 2UXDL 2CWAA 5IP9H 3S24A 4BY1B 4I7ZC 1LTSD 2C9OA 1B9MA 3GTKH 5IGDA 2CHBD 2E8GA 1BO0A 1H9JA 1PYBA 1SYDA 1YJNA 1TY2A 2NVXH 4DUYQ 1QWYA 2X6GA 3LWUA 5COYA 1I3QH 1AE2A 1C4QA 3KF8A 1VF7A 3I7FA 5K36H 2LY7A 3TEHB 1KLGD 3U9SA 2E76C 4EX5A 3D0FA 3HFZB 4Y52H 4GNXB 1G2TA 4RCOA 2XTIA 4A3GG 3QJYA 1SMYD 4OIKA 2F0EA 5EJWA 2F0GA 2NYZD 3TSSA 1H9KA 1TT2A 4HIDA 2L55A 1A62A 2F03A 5GADC 4JYAQ 3H0GH 4XT1B 2I0QA 2JA6G 4DNRB 2K1BA 2AQ1B 2GVAA 1VF5C 3DEPA 4N9TA 2YU9H 1VQCA 3TZDA 1PZJD 4K8JA 3T4AC 1R4QB 4R4QA 3M4PA 2D9UA 4IUTA 3OW7A 1V43A 4C1NI 2WINB 3VR5A 2FJ2A 1HR0W 2ZM6Q 4JI0L 1PH9A 1E2ZA 5M3FH 1VQMA 1G8ZD 3PUXA 1PH4A 2V4DA 4NMZA 2F1MA 1N34L 4LFBQ 4YIJA 4CJ2C 4KN7C 4JC0A 1PA6A 3CC4A 3VR4A 5CMDA 2K5NA 2UXCQ 2HUGA 3E3XA 1OO9B 4GN5A 2Z6KC 1VQ8A 1TS3A 1PH2A 3HS0C 1WD0A 5FJ8G 2JA6B 1CHQD 4APVA 2N8NA 1IKLA 3ICEA 1JMCA 4POFA 1KL9A 1PZID 3HRZC 3U4VA 2RDFA 4XYOA 2NZ1D 4WFN3 3GTQB 1WJJA 4WJ3M 2WKDA 2I5MX 1NMGA 1BQQT 4ME3A 3T53B 3UDXA 4GOPA 4GLAC 5DAUA 1EYCA 3T16A 1Q1BA 3VR2A 4A3CG 1VQ5A 1MD2D 2JN4A 2PZUA 2B63G 1K28A 4DNIA 2OQKA 4XT3B 1WTXA 3HOYG 4KHPQ 4C1NK 1LTRD 3S14B 1SEBD 2LKVA 1K83B 4PNYA 4RGTA 4QGUA 3BVGA 3M4YA 1KRTA 2IHFA 5EPKA 1PTOH 3HKZG 2NZHA 3PCOB 2B2WC 5JVG3 4YCWA 1SFOH 4J1MA 4ZKCB 2CQOA 2YTYA 3HOXB 1V1QA 3L7ZC 1BCPC 3VR6A 4A3DH 3NBIA 1AP0A 3A54A 4K2LA 3DEOA 5AFWA 5K36G 3CPWA 3F8TA 1FL0A 4UPAA 2X6LA 2SNMA 2GVBA 2RKSA 5JAVA 4YHHL 2BA1A 1IHZA 5I4DA 3NHHA 4HMIA 2B63B 2QDBA 4RCNA 3HOYB 1MJCA 3GTOH 1L1OA 3TZUA 4OELB 4OIJA 3R2TA 2MNAA 3QR8A 3MWYW 1JOKA 2L11A 4GN4B 1WTWA 4DV4L 3HKZB 1AEXA 3H0GG 3GTKB 2MFIA 1B8AA 2IJ0A 3HP3A 5CV6A 3GTMH 3I55A 3VA7A 4DAYB 2H1EA 3K0XA 1XMOL 1I3QB 3CCMA 2UXDQ 1PH8A 4X62L 2Q2TA 3GTPH 3TDQA 1L1OC 3P7JA 5G3LD 1AFPA 3TS0A 2UXBL 2TMPA 1PTOD 1HZBA 1TR5A 2EXDA 5I2XA 3IL8A 1I4QA 2XRSD 5LMNW 1WFQA 1TWFH 1EY9A 3E6ZX 4M1UB 4DGZA 3H0GB 1R4PB 4A3IH 1I5FA 4L5TA 3DUZA 3TN2A 3H6MA 4JCVE 2UUCQ 2YU9B 3S2DH 2N55A 4NPSA 2KJXA 1CSQA 1II3A 4LF5Q 3LGJA 1JB7A 1RJTA 4DR4L 1A2UA 3BYYB 4DR2L 5KGUA 1VQIA 3VR3A 1GUOA 2LXKA 1PDQA 3KK7A 2Q8IB 2Z0SA 3SK8A 2IHEA 4JK1C 4CJ0B 4FO2A 1LABA 3A8IE 3D4WA 4K5XA 3D6WA 3DHQA 3UDGA 4XTCS 4RA8A 3FKIG 4HJ9A 4P73A 1A15A 2R3ZA 1BBWA 4LF8Q 2F0NA 4JI0Q 2RQXA 5IGEA 4OHJA 4C3IG 4JI8L 3P1HA 5EBDA 1SRUA 3WOFA 3F2BA 3W1BA 1KIXA 4HIOA 1BCPD 2EYOA 2KHJA 1EY8A 3ONAB 1N34Q 2O5IC 1RDPD 3PV0A 3KLWA 2FMMA 1NJIC 4ZK9B 5I9OA 1NTGA 2F0OA 4A3DG 3KF8B 5J39A 5C0XJ 3QB3A 4DV7L 4JI5Q 5DLQE 5G3LF 1CI3M 2EY6A 1PTOF 3CHBD 1CQVA 4MZ9A 2WB1G 3FKIB 4OL7A 4AYBE 1SNDA 2LXJA 5FLMH 1O7YA 1PZKD 2NVTH 2XN9C 2KUMA 4QF4A 4JVZA 1PTOB 4C3IB 2UU9L 2PI2E 2XGTA 1JWUD 3N6RA 3KUPA 1SFOB 4YY3L 4MTKA 1CTMA 4MNOA 1W2BA 3FVQA 2LSSA 2N78A 4UHVA 3HOVH 1T5EA 3S2HH 4A3DB 1G51A 4GKJL 1TWHH 2NTSA 4QUFA 1F9QA 1TWAH 1SR3A 2E75C 3SR1A 4FF2A 3NQTA 4RKBA 3CCEA 1X3PA 3DM3A 2O5JC 3I4MH 1QG7A 5ISRA 4JBKA 2ZT9C 1IBKQ 3NTIA 2WB1B 3GTOB 5I6WA 4E6IA 2K7VA 3KFUA 1U5KA 3V2TA 2A8VA 1U0LA 1H9SA 1HUNA 3I4LA 5I2YA 3G48A 3TP5A 1R9TH 1IW7C 2Q2IA 1TU2B 2SDFA 1C9OA 1YJ9A 1BCPF 4JPBW 2IWHA 4YHHQ 1O78A 3M4OB 5EGTA 2JEAI 5DEHA 2NBFA 3G6EA 4DV0L 3JAML 3OTOL 4MTNA 1B53A 3OWFA 4Q0FA 1LT5D 4K8IA 3QOJA 4GS3A 4HCSA 4I65A 2FHTA 4DPGA 4A3JH 1DZ1A 4GOPB 4DUZL 4RAUC 4CHTB 1ILQA 1BCPB 4DV4Q 3A5UA 1XX8A 2D0OA 4IUQA 1I4RA 1LTBD 3K57A 1RTNA 2B2UA 3FEWX 3SK4A 4ODGA 5D65A 3KLSX 3KLSA 2Z9HA 3K58A 1X3FA 3J7AF 5CC4A 4IPGA 1XMOQ 1CK1A 2Z8LA 1TWFB 2J7ZA 3ULLA 3GO5A 3EBEA 5IP7G 1KHIA 3RZOH 3EIVA 2PO4A 2F52A 3S16B 2Q8RE 3K5OA 1K8OA 2ZTCA 4QB4A 1EIGA 2EE1A 1SYFA 2PW7A 5JEAH 5IGCA 2UXBQ 1RD9D 2PNRC 1EZ8A 5M9OA 2B39A 2LFNA 1HH2P 2NWGA 1S40A 4ZCKA 4JI1L 4R4IA 2BH8A 5C3EH 4A3LG 3GP7A 4DR1L 2CWPA 5J22A 5IYCH 1G291 2RSOA 1L1OB 1KDBA 4DK3C 4TQUS 1B70B 2UUBQ 1VQPA 4G7OC 4X66L 1EWHA 5FK9C 1UUPA 1A0IA 4DXFA 5FLMG 1ZEQX 2EYMA 1VQ6A 4DR2Q 1JE5A 1VQDA 3AYHB 4DR7L 5M3MH 3D31A 2BDNA 3EFXD 4IUNA 2F0MA 4BA1I 2NZOA 3H3VC 5ELBA 2WAQE 3CCJA 3T56B 3CC7A 4N9PA 4DAPA 1N8RC 4F8MA 3R2IA 5J3BA 4A75A 2HD3A 2OTJA 1Y8OB 1YHAA 2RHQB 2N88A 2ICIA 3I4MG 3U4ZA 2EPBA 1VQOA 2CCZA 3J81i 2KOLA 3T1YL 3I72A 4JBMA 2ASBA 3NP8A 4K5WA 1M8AA 2Q2HA 4N8X1 1JT8A 3FHWA 1RKNA 2VZAA 2EJFC 1VQFA 4QIWB 4DV7Q 2B2VC 1FJGL 1CT1D 3TQYA 5LL6S 1YNXA 2PYKA 1M1KC 2XRQD 2I5HA 1S5CD 3SXHA 3I8ZA 1QVCA 5KNBA 4LUOA 3DLLA 3P75A 2F0SA 5CV8A 3HOVB 3S2HB 1IBLL 1SLJA 5C0XG 1TWHB 1OTCA 2EJMA 2R7DA 1TWAB 2YYZA 1YHQA 3M7GA 2QF7A 2UU9Q 2QA4A 2ALYB 1LYLA 3I4MB 3SGIA 4RHRA 1STBA 2N49A 1WD1A 4LK1C 4YY3Q 1QB5D 3TREA 1SE4A 4R4TA 3CC2A 4BY7H 2K03A 2L12A 2E2IB 3DM1A 1E7ZA 2NVQH 4GKJQ 1HHVA 1O7ZA 1H9MA 1QILA 1JC7A 1R9TB 3IKJA 5D14A 3FPUB 1AZPA 3CCSA 1YNJC 1FVIA 2OT2A 2RCFA 3OW2A 4LF6L 4DV6L 5JEAG 2UXCL 5L37A 4FXKC 1K3BC 1PH6A 2L1BA 4IPDA 3BG3A 4B3SL 1RIPA 1VQJA 4RH6A 3UE1A 1LUZA 1SE3A 2VUMG 5CV5A 3HOZG 3AB9A 3M4QA 4BA2I 3G71A 1PYWD 2L5TA 3X3NA 2L0CA 3J7ZC 5IYCG 2HHHL 5E1FA 1MKHA 4A93H 1KRSA 4O0AA 1B2TA 2CH4A 3AFPA 1OXXK 1VCIA 1KABA 5LMUL 4DV0Q 4LWCA 3OTOQ 2GN5A 4TKOB 1IKMA 3E0EA 4AH6A 4DUZQ 1Y1WH 1L0YB 2RA4A 3FDTA 2D5DA 5KIXA 3BDLA 5GAGC 3QWNA 2JEBI 3B6YA 1SMXA 3RZDH 2J4XA 5HURA 1WTPA 4GLVB 4DAYA 1Y14B 2Z6BA 1VQ4A 3HOZB 2VUMB 1PH3A 2SEBD 3G7LA 5C3EB 1SSOA 2DNEA 2DJFC 1N33Q 2HT1A 4CBVA 5IGGA 4CKEA 1SNMA 5E4XA 3F1ZA 1H9SB 1X9NA 1WTQA 2H5XA 3OWEB 3PUYA 4FNFA 2K01A 3AEVA 4DFAA 4QL5A 3IFTA 3GQBA 1SYBA 3T51B 4DR1Q 1N9WA 1KAWA 4HN7A 4BS9A 3RN5A 3ULPA 4DU9A 1LT3D 3H91A 1ENCA 2PNHA 1EYGA 1HCZA 1LTTD 4C3JH 1MI2A 4HJ8A 2A6EC 4I7AA 1ZKOA 1TY0A 4DK0A 3AQQA 2K33A 2KCCA 5CYUA 2H4OA 5E7NA 2B3GA 2X69A 3RLFA 5IWAL 3TRZA 4DR7Q 3RLNA 1I6HH 5T1GA 5A35A 1AW7A 3OMCA 1M4VA 3A5ZB 4BY7G 1V8QA 1X56A 2G5DA 3MVVA 5KNDA 4DR3L 1BNZA 1K73C 2A19A 1TWCH 1X6OA 3HEJA 4ZLTF 4HIKA 4MN3A 3CQZH 5JOBA 1AZQA 1ML0D 3P20A 4M8AA 4XQJA 1MGSA 2ZXPA 5IT9c 5LMNL 3T1YQ 3TP7A 1KNAA 1T5XD 2WKCA 1S5ED 3TP8A 2V1CC 1WTVA 3U50C 3KJPA 1FJGQ 3CMAA 2UUCL 2HCIA 1S5BD 3M9BA 3K6OA 3MC0B 2M9VA 2SNSA 4EVOA 3M3YB 4BY7B 2ZJQA 4LF5L 4A3EH 4FF4A 4A3FH 4AYBG 2K14A 1IBLQ 2NVQB 5AJ3L 4IUPA 3NXWA 1D5ZC 2KHSA 2K5HA 4UY8C 1O7LA 3I2ZA 3S1NH 1JOQA 4X3TA 3H94A 2IL8A 3MXGA 3S15H 2OCEA 3BZDB 1EY4A 2QCPX 5I9PA 4YCUA 5NUCA 1DYQA 5DM63 3D8GA 4LF8L 3ERSX 2JK8A 4ULLA 1D5XC 1TS4A 2IX0A 1QUQB 1D6EC 4IUVA 3RUZA 4B08A 4LF6Q 4HEDA 4DV6Q 1HZAA 3C46A 2K5WA 5CGKA 2KEDA 3JAME 3D6CA 1PTOC 3T13A 2Y0SG 4LW1A 4AYBB 4B3SQ 1JWMD 5C6AA 3CF5A 1G2SA 4JI5L 1Y1WB 5BN5A 3SK5A 1OXTA 1Q3LA 4DV5L 1HZ9A 1RHPA 1YJWA 3RZDB 3S9WA 2HHHQ 3HOXG 3QG1A 2A6ED 1F9PA 2TSSA 1EUJA 4PG3A 5LMUQ 1W3SA 5C3WA 4IALA 3CPFA 4FVMA 4XYQA 1ESRA 1XTCD 4C3JG 1ENAA 1X65A 4JI2L 2PZWA 2ZXRA 1STAA 3PGZA 3S1MB 1CM9A 1XYIA 4XDXA 5IYBH 1G91A 4XXEA 1T9HA 3A55A 3CCUA 4JG2A 2CQAA 3IRBA 2F4IA 2Y0SB 4IZ8A 3A8KE 3Q23A 5IP9G 2K32A 5M5YH 1Y8PB 4PV1C 2PPBC 2R93H 1Z6HA 3KOJA 3UE0A 1IBKL 4GOPC 1LM0A 3H15A 3DXJC 4RFBA 5FO9B 1S72A 2Z1CA 5ELEA 2KEEA 4C3JB 1X3EA 4LUVA 4JI6Q 3K0YA 1ILPA 3NBHA 3A74A 3MEHA 1X54A 3CD6A 3F2DA 1I6HB 1U4MA 2RBMA 2A74C 5IT9L 4DK6C 2R92H 1WOCA 1Q12A 3CW2C 1DCZA 2MJ8A 4G57A 2B2YA 5BN4A 1MHWC 1XPRA 4A3FG 5C4HA 1AN8A 2A5HA 3PMFA 1EY7A 4KKTA 3MZ5A 1K9MC 1TWCB
chains in the Genus database with same CATH topology
1NCVA 2EXZA 2NVXB 3TP6A 1B44D 3I91A 2CW0C 3X3MA 2VNUD 3FPPA 4QCLA 5C4ZA 2JSOA 2EJGC 2HQEA 1STHA 5IIFA 1DJRD 2AUKA 1J9OA 4A3EB 4A3FB 2KQ3A 1A6XA 4DXGA 2VB2X 2EYHA 3R3OA 1DXMA 3S1NB 1J8IA 3NUCA 5FO7B 5C5MA 3S15B 1I4PA 4PQXA 2WAQB 1TS5A 1RF2D 5KNCA 4FYDA 1FNUA 1LTGD 1ZXTA 5M3FB 1BF4A 2EVBA 1OXVA 3BVMA 3MHBA 1YNND 1SNOA 3QO2A 4KY7A 1UAPA 1X3QA 3G6JB 1RTOA 2BDOA 4L63B 1KTKA 2ID0A 2XIWA 2NN6I 4DAVA 4EGVA 2IX1A 2EY1A 2IW3A 1UNSA 1EYAA 3CU7A 2NN6H 3ND9A 1TS2A 1BXTA 3BVZA 1JQYD 4O1NA 1CQFA 3SEBA 1K8MA 3PIO3 1SNPA 2F0JA 1U4PA 5M5YB 1GHJA 2CW0D 1ICWA 1EY5A 5JEAJ 1Z7TA 4UAIA 4IFDI 1A2TA 1SJED 2MPMA 4C3HG 3ERQA 5KRUA 3SDZA 4ZQ3A 4DA2A 2AQ3B 3K59A 2R92B 2KVMA 4IFDH 4OO1I 3NSWA 3ND8A 3EJIA 3GTMB 1OXSC 4OO1H 4ZUJA 3TBIB 1F2LA 4HCEA 5T1IA 5C4JB 2KA7A 4TRDA 4C3HB 1I4HA 3GTPB 1TWGB 3D4RA 2PMZB 2F0HA 1TQOA 1D1IA 1WVLA 4RWSC 1B9NA 2ZXOA 4WRDA 2K5QA 4O42A 4A3IB 1LACA 2A6HD 2PCFB 4KJOA 2EYPA 3ITPA 3PIP3 3S2DB 3R8BA 1RODA 2B2UC 1IL8A 1B4OA 3VYTA 5CR3A 1WTRA 3MA2B 4B9XA 1LTID 1U9RA 3FMCA 2WV6D 4U68A 4ZKBB 2D62A 1Q1EA 3OOCA 1HFGA 1FYCA 1ET6A 1GUTA 1Y69U 1ENFA 3ZYYX 1BOSA 3OMGA 1GJXA 2BE5D 4BWGB 4FF1A 4MIUA 1CA6A 4IFDG 3GV6A 2NVTB 1QNKA 4HAEA 1W6JA 2MHVA 1I4GA 2F0UA 3SK6A 5BN3A 1E0BA 4L8JA 5C4XB 3BYTB 4ZAIA 2MP1A 1S5DD 3CRKC 1C48A 1HTPA 4HMJA 4MHEA 3Q24A 3K5MA 3SVMA 4P2CB 5FKAC 2G9DA 1F2YA 3HGBA 1DONA 4QUCA 1V1PA 2L4NA 4TSSA 1STGA 4ZYSA 4RGOS 5FLXL 1ONLA 5IT9E 4LAAA 5IGBA 4A3JB 3A7LA 4DK1A 4LMQD 3MXNA 4KTAA 3EROA 2CVRA 3PUVA 2EDGA 4ZRZA 1TKWB 2NTTA 5F2DA 3RZOB 1EZ6A 4CGYB 1L0XB 3C2PA 2G9HD 1F2MA 2AWNA 5M5XB 1HTLD 4NDXA 1Q90A 3KLRA 1V1OA 2M2LA 1HA6A 1HFNA 4KK7A 1BR9A 3AU7A 1I50B 4CJ1B 1TIID 1SDFA 2NB0A 1ZYRC 3NWSA 4K6DA 4Q5VA 2A68C 1SYEA 2E74C 5EKIA 1GOZA 4K6LA 4B9WA 2XWJB 3A8JE 3F2UA 4RGMA 2F0IA 4KKSA 1SYGA 3LNNA 5M3MB 1I4XA 1PLFA 4HTHA 1A3UA 4ME5A 4H7BA 1RCVD 1EFID 4RHSA 4NW2A 1Z47A 3K5LA 1LT4D 5KYLA 4XQQA 1SXTA 1BDOA 1O80A 2K04A 2O4XA 5IGFA 2E2JB 3C1FA 3OHXC 3J80L 4V190 2DY7A 2ICEC 2EOTA 1KAAA 3R93A 3E5SA 2DY8A 3D4DA 2JXMB 2EYLA 3M7NA 5JPNC 1U4LA 1MBYA 4HSPA 2F0TA 5EPLA 1GUNA 4RGNA 2KCNA 1DD2A 1VMCA 4FXDA 1EWCA 4FXGC 1GUWA 2F0FA 1C8CA 3RD4A 1EU4A 1H9RA 1S5FD 2F0LA 2QKIC 1ZYRD 4HR7B 4DF7A 2WP8J 2DNCA 4ID6A 1E2VA 1EEID 1JR0D 2A68D 3H09A 4S3SA 1WTOA 3J7YW 4A93B 4Z9CB 3MFGA 3UI2A 5EPJA 1UEAB 1Y8NB 4WJWA 2WACA 4A3KB 2AWOA 3HZXA 1EY0A 4V0BA 3S17B 3IAYA 2K28A 3DWPA 5JJZA 3E0JA 1F2ZA 5CV9A 4A3GB 1BBXC 3W3AA 2K5DA 1G6ZA 5FO8B 2JP1A 3PO3B 2E2HB 5EKKA 1W6KA 4ILWA 4H13C 1HUMA 3V05A 2FMCA 3W2DA 3EQLC 1YNNC 1PFNA 2EYJA 2B2WA 3VYUA 1FD7D 1V1PB 1QE6A 2JE6I 2BA0A 2EY2A 3C1EA 4G7ZC 3TMEA 1SAPA 2BCOA 5I6YA 2XSCA 1CZWA 1PFMA 4ABNA 2C5CA 2R61A 3I70A 5JPMC 1HPCA 2GA4B 2EZVA 2F0QA 1JORA 4DNTB 3OIQA 5DNFA 4HSVA 4QMGA 4C2MB 1Y1VB 3CQZB 2PQEA 5C3XA 4DN4M 2LMCB 2B2YC 3WDNA 1EEFD 4A3MB 3Q22A 1B3AA 3FRPB 2XNAC 1EOTA 3I73A 3VA5A 1EQVA 3OSOA 1JB3A 1DOKA 5D3IB 1HXYD 4K5VA 2J0TD 1EQTA 3MFYA 4WORA 3RMHA 4EQNA 5C5LA 1SYCA 2XWBB 5EQ0A 3HOWB 1F9RA 1E2WA 4KY5A 5FLXE 4F87A 4R9WA 1LTAD 1NUCA 4L6TB 4X3KA 1X32A 1I6VC 1CA5A 4EQPA 3HOUB 4IFDJ 4G7HC 4K2KA 2OF1A 3GD7A 3WOEA 3DMUA 4R8IA 2A6HC 3L3OC 5CBAE 4FP5D 1D5MC 2EYFA 3PUZA 1HQRD 2I46A 2MUYA 4R8NA 5ELDA 2VB3X 4OGQC 3J81L 1IYVA 2MGSA 2NUCA 2ENBA 3DWAA 1VMPA 3SHLA 5A2QL 4GZYC 3D3RA 1EYDA 4H44C 2F0WA 3NE5B 2HDLA 4XQNA 1JCKB 1ET9A 3OPOA 2M00A 2D2CC 2F0PA 4IURA 4KHZA 4PMCA 1XXGA 2R93B 3EA6A 4KJNA 2A69C 4F7XA 2VXWA 3PUWA 1DM0B 2DN8A 1GUSA 2XVSA 1VDZA 3BDCA 1PRTC 3VYSA 3I3CA 2E2DC 3QIAA 3HG9A 1SNQA 1FNWA 5CBEE 3U9OA 3CKIB 5CV4A 3GTGB 3C3LA 3NPPA 3KBGA 2EY5A 3IFDA 3AMUA 2BE5C 1Q8IA 5CORA 4BBSB 1OXUA 2AQ2B 2KECA 1KDCA 3K7AB 1DOMA 3V96A 1F9SA 3GV3A 5TSSA 4H0LC 3A56A 3VYRA 2IX3A 1STYA 1PFBA 3Q0AA 5IOCA 1JOOA 3LWEA 3MXUA 5C0XI 3J80E 4KY6A 4IQZA 4KHVA 5E4WC 4UDUC 2B2TA 4NKLA 2AUJD 1NR2A 3CRLC 5C0XH 1FNVA 3MAQA 4Y7NB 2PZTA 1EU3A 4IUUA 4NP5A 5EBCA 1F77A 5C44B 5KEEA 5LHY1 3NTHA 1B1ZA 3MXPA 1CHPD 4EQOA 2NN6G 1DOLA 2B2TC 5K5PA 3A7AB 3M85A 4KMUC 1QOHA 2Z4HA 1QNUA 4CKBA 1SJHD 4XIGS 1B50A 3K5NA 2I07B 4PMBA 2L9HA 1QCBD 1GXDC 3OIPA 2A69D 4ZUIA 4BBRB 2JA8B 2F3WA 4A3BB 4RKLA 5ELFA 1PRTD 1MSHA 2JA7B 1XWEA 1FR3A 2FINB 3I90A 3J7AV 4CKCA 3I4NB 4G4KA 5CV7A 1FGBD 1PMRA 1GUGA 2B2VA 2RDHA 3MTSA 3URYA 1LO5D 3BS1A 1IYUA 3NK9A 3GTLB 1NAPA 5J1ZA 1NR4A 4C56C 4OO1G 2B8FA 3S1RB 2OXPA 3LX0A 1A3VA 1U4RA 4KI0A 1KNEA 1IW7D 3GTJB 2K05A 1LLRD 2HDMA 4KD3A 3L9AX 2IPKD 5KYIA 2RDGA 2IT1A 3BDOA 1PXUA 5JVH3 3DWQA 4KD4A 1PRTF 1LV9A 5M5WB 2RSNA 4F88A 1SE2A 2R6GA 4X3SA 2JYOA 3PO2B 5LL6X 1D2BA 1BUVT 2QEJC 1PRTB 2HCCA 2B8GA 1EY6A 2PW5A 4U673 3O13A 1CFMA 4IN3A 4PMWA 2R7ZB 2K6AA 1HA5A 2F0KA 1S4ZA 1KDAA 1HRJA 1QJOA 5FOBB 1ESFA 4X3UA 5IODA 1WCMB 1STEA 1SMYC 3KBXA 1SNCA 1JWSD 3NQIA 1A3TA 3QOLA 1EL0A 4J8QA 2JA5B 4JBWA 2F0DA 2Q8TA 4KN4C 4FF3A 4KKUA 1SBBB 1KLUD 2A73B 2RVLA 1NSNS 5E3FA 3SE0A 5ELCA 1CZGA 1JICA 3EVQA 2QILA 2F3VA 2WIIB 4KV6A 2NVYB 3Q6SA 3NTKA 2F0VA 2SOBA 4K14A 4J6HA 2Z4IA 3NWTA 2FFKB 2LS01 1EIHA 1HQMC 2OEOA 1LT6D 5D3DA 3J81E 3N52A 3S1QB 5EKLA 1STNA 5DM73 1D1KA 1MSGA 2BOSA 5HGTA 1JE4A 1GHKA 5A2QE 1TVXA 2O2LD 1YNJD 4LJZC 4BY1B 4I7ZC 1LTSD 2C9OA 1B9MA 5IGDA 2CHBD 1BO0A 1H9JA 1SYDA 1TY2A 1QWYA 2X6GA 3LWUA 5COYA 1C4QA 1VF7A 3KF8A 5K36H 2LY7A 1KLGD 3U9SA 2E76C 1G2TA 4RCOA 3QJYA 1SMYD 4OIKA 2F0EA 5EJWA 2F0GA 2NYZD 3TSSA 1H9KA 1TT2A 2L55A 2F03A 4XT1B 4DNRB 2K1BA 2AQ1B 1VF5C 3DEPA 4N9TA 3TZDA 1PZJD 4K8JA 3T4AC 1R4QB 2D9UA 4IUTA 3OW7A 1V43A 4C1NI 2WINB 3VR5A 2FJ2A 1E2ZA 1G8ZD 3PUXA 2V4DA 4NMZA 2F1MA 4YIJA 4CJ2C 4KN7C 3VR4A 5CMDA 2HUGA 1OO9B 1TS3A 3HS0C 1WD0A 2JA6B 1CHQD 1IKLA 1PZID 3HRZC 2RDFA 4XYOA 2NZ1D 4WFN3 3GTQB 2WKDA 1BQQT 3T53B 5DAUA 1EYCA 3T16A 1Q1BA 3VR2A 1MD2D 2PZUA 4XT3B 1WTXA 4C1NK 1LTRD 3S14B 1SEBD 2LKVA 1K83B 4PNYA 4RGTA 3BVGA 3M4YA 5EPKA 1PTOH 2B2WC 5JVG3 4J1MA 4ZKCB 3HOXB 3VR6A 3L7ZC 1BCPC 3NBIA 1AP0A 3A54A 4K2LA 3DEOA 5AFWA 5K36G 2X6LA 2SNMA 2RKSA 5JAVA 2BA1A 1IHZA 5I4DA 3NHHA 4HMIA 2B63B 2QDBA 4RCNA 3HOYB 3TZUA 4OIJA 3R2TA 3MWYW 1JOKA 2L11A 1WTWA 3HKZB 1AEXA 3GTKB 2IJ0A 3HP3A 5CV6A 3VA7A 2H1EA 1I3QB 3TDQA 3P7JA 5G3LD 1AFPA 2TMPA 1PTOD 1TR5A 5I2XA 3IL8A 1I4QA 2XRSD 1EY9A 3E6ZX 4M1UB 4DGZA 3H0GB 1R4PB 3DUZA 3TN2A 3H6MA 2YU9B 2N55A 2KJXA 1II3A 1RJTA 1A2UA 3BYYB 5KGUA 3VR3A 1GUOA 1PDQA 3KK7A 2Q8IB 3SK8A 4JK1C 4CJ0B 4FO2A 1LABA 3A8IE 3D4WA 4K5XA 3D6WA 3DHQA 4XTCS 4RA8A 1A15A 2R3ZA 2F0NA 2RQXA 5IGEA 4OHJA 4C3IG 3P1HA 5EBDA 3WOFA 1BCPD 2EYOA 3ONAB 1EY8A 2O5IC 1RDPD 3PV0A 2FMMA 4ZK9B 5I9OA 2F0OA 5J39A 5C0XJ 3QB3A 5G3LF 1CI3M 2EY6A 1PTOF 3CHBD 1CQVA 3FKIB 4OL7A 1SNDA 1O7YA 1PZKD 2XN9C 2KUMA 4QF4A 1PTOB 4C3IB 1JWUD 3N6RA 3KUPA 1SFOB 1CTMA 3FVQA 1T5EA 4A3DB 2NTSA 4QUFA 1F9QA 2E75C 3SR1A 4FF2A 3NQTA 4RKBA 1X3PA 2O5JC 1QG7A 5ISRA 2ZT9C 3NTIA 2WB1B 3GTOB 5I6WA 4E6IA 2K7VA 3V2TA 1H9SA 1HUNA 3I4LA 5I2YA 3TP5A 1IW7C 1TU2B 2SDFA 1BCPF 2IWHA 1O78A 3M4OB 5EGTA 2JEAI 5DEHA 2NBFA 3JAML 1B53A 3OWFA 4Q0FA 1LT5D 4K8IA 3QOJA 4HCSA 4I65A 2FHTA 1DZ1A 4RAUC 4CHTB 1ILQA 1BCPB 1XX8A 4IUQA 1I4RA 1LTBD 3K57A 1RTNA 2B2UA 3FEWX 3SK4A 4ODGA 5D65A 3KLSX 3KLSA 3K58A 3J7AF 5CC4A 1CK1A 2Z8LA 1TWFB 2J7ZA 3GO5A 2PO4A 3S16B 2Q8RE 3K5OA 1K8OA 4QB4A 1EIGA 2EE1A 1SYFA 2PW7A 5JEAH 5IGCA 1RD9D 2PNRC 1EZ8A 5M9OA 2B39A 2LFNA 2NWGA 3GP7A 5J22A 1G291 2RSOA 1KDBA 4TQUS 4G7OC 1EWHA 5FK9C 1UUPA 4DXFA 1ZEQX 2EYMA 3D31A 2BDNA 3EFXD 4IUNA 2F0MA 4BA1I 3H3VC 5ELBA 3T56B 4N9PA 4DAPA 4F8MA 3R2IA 1Y8OB 2N88A 2ICIA 2EPBA 2KOLA 3I72A 3NP8A 4K5WA 1M8AA 1RKNA 2EJFC 4QIWB 2B2VC 1CT1D 5LL6S 2PYKA 2XRQD 1S5CD 3SXHA 3I8ZA 5KNBA 3P75A 2F0SA 5CV8A 3HOVB 3S2HB 5C0XG 1TWHB 2EJMA 1TWAB 2YYZA 3M7GA 2QF7A 3I4MB 4RHRA 1STBA 1WD1A 4LK1C 1QB5D 1SE4A 2K03A 2L12A 2E2IB 3DM1A 1HHVA 1O7ZA 1H9MA 1QILA 1JC7A 1R9TB 3IKJA 5D14A 3FPUB 1AZPA 1YNJC 2OT2A 5JEAG 4FXKC 2L1BA 3BG3A 4RH6A 1SE3A 5CV5A 3AB9A 4BA2I 1PYWD 2L5TA 3X3NA 2L0CA 5E1FA 1B2TA 1OXXK 1VCIA 1KABA 4TKOB 1IKMA 1L0YB 2RA4A 3FDTA 2D5DA 5KIXA 3BDLA 3QWNA 2JEBI 2J4XA 5HURA 1WTPA 4DAYA 3HOZB 2VUMB 2SEBD 3G7LA 5C3EB 1SSOA 2DNEA 4CBVA 5IGGA 4CKEA 1SNMA 5E4XA 1H9SB 1WTQA 3OWEB 3PUYA 4FNFA 2K01A 4DFAA 3IFTA 3GQBA 1SYBA 3T51B 4HN7A 4BS9A 4DU9A 1LT3D 3H91A 1ENCA 1HCZA 1LTTD 1MI2A 2A6EC 1ZKOA 1TY0A 4DK0A 2K33A 2KCCA 5CYUA 2H4OA 2X69A 3RLFA 5T1GA 5A35A 1AW7A 3OMCA 1M4VA 1V8QA 3MVVA 5KNDA 1BNZA 3HEJA 4ZLTF 4MN3A 5JOBA 1AZQA 1ML0D 3P20A 4M8AA 4XQJA 1MGSA 2ZXPA 3TP7A 1KNAA 1T5XD 2WKCA 1S5ED 3TP8A 1WTVA 2HCIA 1S5BD 3K6OA 3MC0B 2M9VA 2SNSA 4EVOA 3M3YB 4BY7B 4FF4A 2NVQB 4IUPA 3NXWA 1D5ZC 2KHSA 1O7LA 1JOQA 4X3TA 3H94A 2IL8A 3MXGA 3BZDB 1EY4A 2QCPX 5I9PA 5NUCA 1DYQA 5DM63 3D8GA 4ULLA 1D5XC 1TS4A 2IX0A 1D6EC 4IUVA 3RUZA 4B08A 4HEDA 3C46A 2K5WA 5CGKA 2KEDA 3JAME 3D6CA 1PTOC 3T13A 4AYBB 1JWMD 5C6AA 1G2SA 1Y1WB 5BN5A 3SK5A 1OXTA 1Q3LA 1RHPA 3RZDB 3S9WA 3QG1A 2A6ED 1F9PA 2TSSA 5C3WA 4IALA 4FVMA 4XYQA 1ESRA 1XTCD 4C3JG 1ENAA 2PZWA 2ZXRA 1STAA 3S1MB 1CM9A 1XYIA 4XDXA 1G91A 4XXEA 3A55A 2CQAA 2F4IA 2Y0SB 4IZ8A 3A8KE 3Q23A 2K32A 1Y8PB 4PV1C 2PPBC 1Z6HA 3DXJC 4RFBA 5FO9B 2Z1CA 5ELEA 2KEEA 4C3JB 3K0YA 1ILPA 3NBHA 3MEHA 1I6HB 1U4MA 2RBMA 2A74C 5IT9L 1Q12A 1DCZA 2MJ8A 4G57A 2B2YA 5BN4A 5C4HA 1AN8A 2A5HA 3PMFA 1EY7A 4KKTA 3MZ5A 1TWCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY2 A;  3C1E A;  1KAA A;  3ERO A;  4KTA A;  1EY4 A;  3TME A;  2PZT A;  3E5S A;  5NUC A;  2EYF A;  5I9P A;  3D4D A;  3D8G A;  1EY9 A;  2EXZ A;  4NP5 A;  5I6W A;  4E6I A;  4DGZ A;  2EYL A;  3TP6 A;  2OEO A;  2RDF A;  4R8N A;  5I6Y A;  5KEE A;  3V2T A;  4KD4 A;  2F0T A;  3MXP A;  3TP5 A;  5C4Z A;  5IGG A;  3H6M A;  3NP8 A;  4K5W A;  5EKL A;  5F2D A;  1EY5 A;  1SNM A;  1STN A;  1EZ6 A;  4EQO A;  1RKN A;  2HQE A;  3RUZ A;  2NUC A;  1STH A;  1A2T A;  1F2M A;  5IIF A;  5K5P A;  5HGT A;  2ENB A;  5CGK A;  5DAU A;  5EGT A;  1II3 A;  1EYC A;  3ERQ A;  5DEH A;  3D6C A;  3SHL A;  2F0Q A;  3T16 A;  5KRU A;  3T13 A;  4DFA A;  1JOR A;  1EYD A;  1A2U A;  3OWF A;  2PYK A;  4NDX A;  5KGU A;  2F0W A;  3QOJ A;  4I65 A;  4K8I A;  1SYB A;  3SXH A;  5C6A A;  2PZU A;  4ZQ3 A;  3P75 A;  2F0F A;  2F0S A;  5CV8 A;  3SK5 A;  3SK8 A;  2KQ3 A;  4QMG A;  2M00 A;  2PQE A;  3OMG A;  1EY6 A;  2F0P A;  2EYH A;  2LKV A;  5C3X A;  2PW5 A;  4PNY A;  4PMB A;  2F0L A;  3D4W A;  4DU9 A;  4K5X A;  4PMC A;  3R3O A;  5IGD A;  1ENC A;  3DHQ A;  3SK4 A;  4ODG A;  4DF7 A;  3S9W A;  4KJN A;  4ID6 A;  4MIU A;  1SYD A;  4K6D A;  4F7X A;  3NUC A;  4ZUI A;  1STB A;  5C3W A;  4IAL A;  5C5M A;  2F0N A;  2F3W A;  5IGE A;  4J1M A;  1SYE A;  3EJI A;  4RKL A;  4S3S A;  5CC4 A;  1ENA A;  2F0K A;  4B9W A;  3BDC A;  3P1H A;  4ZUJ A;  2PZW A;  1KDA A;  1STA A;  2EYO A;  1EY8 A;  1SNQ A;  3OMC A;  3U9O A;  4QB4 A;  2F0I A;  5CV4 A;  4K2L A;  2F0U A;  1SYG A;  4TRD A;  3SK6 A;  5I9O A;  2WAC A;  1SYF A;  3MVV A;  2PW7 A;  1A3U A;  2F0O A;  4HTH A;  5IGC A;  3MHB A;  3HZX A;  1EY0 A;  1EZ8 A;  4ME5 A;  4H7B A;  5IOD A;  5M9O A;  5J39 A;  2SNM A;  1SNO A;  2EY5 A;  2RKS A;  3QB3 A;  5JAV A;  1IHZ A;  1SNC A;  4IZ8 A;  4KY7 A;  5CV7 A;  2F0E A;  3VA5 A;  2F0G A;  2F0H A;  1EQV A;  3HEJ A;  1TQO A;  3NHH A;  2QDB A;  3OSO A;  4HMI A;  1TT2 A;  1A3T A;  2EY6 A;  1F2Z A;  5CV9 A;  5JOB A;  3QOL A;  1KDC A;  4HMJ A;  4K5V A;  1JOK A;  5KYL A;  5CV5 A;  5J22 A;  4WRD A;  3TP7 A;  4N9T A;  4OL7 A;  1AEX A;  2F0D A;  3NK9 A;  1KDB A;  1SND A;  1F2Y A;  4K8J A;  3TP8 A;  4KJO A;  2O4X A;  5CV6 A;  4WOR A;  5EKK A;  5J1Z A;  5IGF A;  4QF4 A;  1STY A;  2EYP A;  2EY1 A;  5E1F A;  5C5L A;  4EQN A;  3ITP A;  1EYA A;  1SYC A;  2OXP A;  1KAB A;  3C1F A;  3LX0 A;  5IOC A;  5ISR A;  1A3V A;  1STG A;  2EYM A;  3MEH A;  1NSN S;  5E3F A;  1JOO A;  4KY5 A;  2EYJ A;  3EVQ A;  2SNS A;  2F3V A;  1NUC A;  4EVO A;  4KY6 A;  4KHV A;  4NMZ A;  2RBM A;  4KD3 A;  4KV6 A;  4LAA A;  4EQP A;  5KIX A;  3BDL A;  4YIJ A;  4IUN A;  2F0M A;  5IGB A;  4NKL A;  4K2K A;  2OF1 A;  5CR3 A;  3NXW A;  5KYI A;  2KHS A;  2F0V A;  4G57 A;  2SOB A;  3DMU A;  3SR1 A;  1SNP A;  5C4H A;  2F0J A;  3NQT A;  4N9P A;  4K14 A;  4J6H A;  1JOQ A;  3PMF A;  1EY7 A;  4RKB A;  4B9X A;  4F8M A;  3MZ5 A;  5HUR A;  1TR5 A;  1U9R A; 
#chains in the Genus database with same CATH topology
 1NCV A;  5IWA Q;  2EXZ A;  2NVX B;  3TP6 A;  3J7A 5;  1PV4 A;  1B44 D;  3I91 A;  2CW0 C;  3X3M A;  2WAQ G;  2VNU D;  1EOV A;  5C4J H;  3FPP A;  3J80 i;  4QCL A;  5C4Z A;  3FP9 A;  4C3H H;  4DR3 Q;  2JSO A;  2EJG C;  2HQE A;  1TWG H;  1STH A;  5IIF A;  5M3F G;  5IYD H;  1DJR D;  2HIV A;  4B3R Q;  2AUK A;  4LUZ A;  4R1J A;  3KDF A;  2KCT A;  5LMN Q;  4J15 A;  3JAM c;  1J9O A;  4A3E B;  4A3F B;  2KQ3 A;  1A6X A;  2CKZ B;  4DXG A;  2VB2 X;  2EYH A;  3R3O A;  1DXM A;  3S1N B;  2N3S A;  3MEF A;  1J8I A;  3PQI A;  3CCV A;  1NNX A;  3NUC A;  5C44 H;  1VQB A;  5FO7 B;  5C5M A;  3S15 B;  1I4P A;  4PQX A;  2WAQ B;  1TS5 A;  1PH5 A;  2UUB L;  1RF2 D;  5KNC A;  4FYD A;  2CH4 W;  1FNU A;  1LTG D;  1E3P A;  1ZXT A;  5AJ3 Q;  2VQF L;  5M3F B;  3I56 A;  1BF4 A;  2EVB A;  1OXV A;  3BVM A;  3MHB A;  1XNR Q;  1YNN D;  2DUD A;  1SNO A;  3QO2 A;  4KY7 A;  1UAP A;  1X3Q A;  3G6J B;  1PHJ A;  1RTO A;  2BDO A;  4L63 B;  1KTK A;  2Q2U A;  1WYD A;  2ID0 A;  5IY0 A;  2XIW A;  2NN6 I;  4DAV A;  1KQS A;  4UP8 A;  4DV2 L;  2JA8 H;  3CAM A;  4EGV A;  4A3B H;  3RLO A;  2IX1 A;  2EY1 A;  2IW3 A;  1UNS A;  1EYA A;  3K8A A;  3CU7 A;  2P5Z X;  1IYJ B;  3KF6 A;  3UDF A;  2NN6 H;  1L2F A;  3ND9 A;  1TS2 A;  1BXT A;  4CDD C;  3BVZ A;  1JQY D;  3KJO A;  4O1N A;  2ZTD A;  4DV5 Q;  1CQF A;  3I4N H;  1NE3 A;  1K8M A;  3SEB A;  2RF4 A;  3PIO 3;  4POG A;  3NEN A;  1SNP A;  1YZ6 A;  2F0J A;  1U4P A;  1BKB A;  1JJC B;  2K5V A;  2IY5 B;  5M5Y B;  1GHJ A;  4HIM A;  4JI2 Q;  2CW0 D;  1CKN A;  1ICW A;  1EY5 A;  5JEA J;  1Z7T A;  4UAI A;  1L0W A;  5C4X H;  4IFD I;  1A2T A;  1SJE D;  2MPM A;  3GTJ H;  4C3H G;  3ERQ A;  5KRU A;  1EIF A;  4R4O A;  3SDZ A;  1WI5 A;  1UE5 A;  4ZQ3 A;  2YTX A;  4DA2 A;  2AQ3 B;  3K59 A;  2R92 B;  2KVM A;  2OQ0 A;  4IFD H;  4OO1 I;  3NSW A;  1D8L A;  3ND8 A;  5BR8 L;  2VY3 A;  4A3I G;  4DR5 L;  3EJI A;  3GTM B;  1OXS C;  4OO1 H;  4ZUJ A;  1UE7 A;  3TBI B;  5M5W H;  1F2L A;  1VQK A;  4HCE A;  5T1I A;  5C4J B;  2KA7 A;  4TRD A;  4CDE C;  1I4H A;  2RCN A;  4C3H B;  3PIP A;  3GTP B;  1TWG B;  2QDL A;  3D4R A;  3E9I A;  2PMZ B;  2F0H A;  1TQO A;  1Q86 C;  1D1I A;  4GKK L;  1WVL A;  4RWS C;  4A76 A;  1UE1 A;  1B9N A;  4DAM A;  4EQ5 A;  4JOI A;  1VS0 A;  1PH1 A;  2ZXO A;  4WRD A;  2K5Q A;  4LF9 L;  4O42 A;  4L5S A;  4OXP A;  4A3I B;  1LAC A;  2A6H D;  2PCF B;  4KJO A;  2R7Z H;  4P75 A;  1N33 L;  2EYP A;  1I94 L;  3ITP A;  5M5X H;  3PIP 3;  4A4I A;  1N36 L;  3S2D B;  4LFA L;  3RN2 A;  3R8B A;  1ROD A;  2B2U C;  1I50 H;  1IL8 A;  3NBH B;  1WCM H;  1B4O A;  3VYT A;  5CR3 A;  1KXL A;  1WTR A;  3MA2 B;  4IPH A;  4B9X A;  4LFC Q;  1LTI D;  1U9R A;  3FMC A;  2JA5 H;  2WV6 D;  1E1O A;  3HKS A;  1MIU A;  1J5E L;  1PVO A;  3A0J A;  4U68 A;  4ZKB B;  2D62 A;  2VQF Q;  1Q1E A;  4ALP A;  3OOC A;  4N8F A;  1HFG A;  1FYC A;  1ET6 A;  4BXX H;  2UUA Q;  3HOV G;  1B3Q A;  1VQG A;  1GUT A;  5C4X G;  4NXN L;  1Y69 U;  1ENF A;  3ZYY X;  3CCR A;  1BOS A;  1QUQ A;  3OMG A;  3KDF B;  2KCM A;  4FDB A;  2BE5 D;  1GJX A;  3ZJY C;  4DV2 Q;  4QY7 A;  4PZ7 A;  4BWG B;  1C0A A;  4FF1 A;  4MIU A;  1PH7 A;  1CA6 A;  4IFD G;  4WJ4 A;  2I5L X;  2E2J H;  3GV6 A;  2RHS B;  2NVT B;  1CKM A;  1QNK A;  3S1Q H;  4IJH A;  2MQH A;  2PI2 A;  4HAE A;  1Q7Y C;  1W6J A;  2MHV A;  1I4G A;  4OWX B;  2F0U A;  3SK6 A;  5BN3 A;  3EN2 A;  1E0B A;  4L8J A;  5C4X B;  4L5R C;  3BYT B;  4ZAI A;  4A3J G;  2MP1 A;  5HY6 A;  4BY1 H;  1S5D D;  3CRK C;  2VQE Q;  2F3I A;  1C48 A;  1HTP A;  3JC6 6;  4HMJ A;  4MHE A;  3Q24 A;  3K5M A;  4IOA A;  3SVM A;  4P2C B;  2PQA A;  5FKA C;  2G9D A;  1HR0 L;  1F2Y A;  2MO0 A;  3HGB A;  1DON A;  1SN8 A;  4QUC A;  1V1P A;  2L4N A;  4TSS A;  1STG A;  4ZYS A;  1UEB A;  4RGO S;  3CCL A;  5FLX L;  1ONL A;  5IT9 E;  4LAA A;  3RR5 A;  3KF6 B;  5IGB A;  5BR8 Q;  4A3J B;  3A7L A;  2KHI A;  4DK1 A;  4LMQ D;  5C3E G;  3MXN A;  4DR5 Q;  4NXM Q;  4KTA A;  3ERO A;  2CVR A;  1QVF A;  3PUV A;  2EDG A;  4ZRZ A;  1TKW B;  3BJU A;  4GN3 B;  2NTT A;  5GAE C;  5F2D A;  3RZO B;  1EZ6 A;  4CGY B;  4YCV A;  1L0X B;  4A3K H;  3S17 H;  3C2P A;  2G9H D;  1XPU A;  1F2M A;  2AWN A;  5M3M G;  5M5X B;  1HTL D;  1CKN B;  4GKK Q;  4NDX A;  4A3G H;  1Q90 A;  5EAY A;  3KLR A;  1V1O A;  3STB C;  2M2L A;  1HA6 A;  1HFN A;  1RL2 A;  4KK7 A;  1BR9 A;  3AU7 A;  1CUK A;  1I50 B;  4CJ1 B;  4LF9 Q;  1TII D;  1SDF A;  2NB0 A;  1CKO A;  3PO3 H;  2E2H H;  1ZYR C;  3NWS A;  1I94 Q;  4K6D A;  4YWL A;  1N36 Q;  4Q5V A;  4LFA Q;  2A68 C;  1ASY A;  1SYE A;  2E74 C;  5EKI A;  3GTQ H;  1GOZ A;  4K6L A;  4B9W A;  4JI6 L;  2XWJ B;  3A8J E;  3F2U A;  4RGM A;  2F0I A;  4KKS A;  4DR6 L;  1SYG A;  3LNN A;  1NBW A;  5M3M B;  1SRO A;  1I4X A;  1D7Q A;  1PLF A;  4HTH A;  1A3U A;  5JJL A;  5GQO A;  1YHB A;  1XJV A;  4ME5 A;  4HJ7 A;  1PFS A;  3K81 C;  4H7B A;  1RCV D;  1EFI D;  5ELN A;  4RHS A;  4R4C A;  3K7U C;  1J5E Q;  4NW2 A;  5FJ8 H;  1Z47 A;  3K5L A;  1LT4 D;  4HJ5 A;  5KYL A;  4XQQ A;  1SXT A;  4GLX A;  1BDO A;  2DGY A;  1O80 A;  2K04 A;  2O4X A;  5IGF A;  2E2J B;  3C1F A;  3OHX C;  4NXN Q;  2CFM A;  3ULJ A;  4B3R L;  3J80 L;  4V19 0;  2DY7 A;  1Y1V H;  4C2M H;  1IL2 A;  2ICE C;  1A63 A;  1VQ7 A;  2EOT A;  2MO1 A;  1KAA A;  3R93 A;  2KEN A;  3E5S A;  2DY8 A;  3D4D A;  2JXM B;  2EYL A;  3M7N A;  5JPN C;  1E22 A;  4K0K L;  5JJI A;  1U4L A;  1MBY A;  4HSP A;  4B3T L;  4A3M H;  2F0T A;  5EPL A;  4A93 G;  1GUN A;  4RGN A;  2KCN A;  1DD2 A;  4OWT B;  4YWK A;  1HNX L;  1VMC A;  1Y1W G;  4X65 Q;  4A3K G;  1C7Y A;  2VS1 A;  4FXD A;  1EWC A;  4FXG C;  4IPC A;  5GAH C;  1Q82 C;  1XNR L;  1GUW A;  2VW9 A;  3STB D;  4RG1 A;  2F0F A;  1C8C A;  3RD4 A;  1HR0 Q;  3BZC A;  1EU4 A;  1H9R A;  1S5F D;  1HNW Q;  2F0L A;  2QKI C;  3GDE A;  1ZYR D;  4HR7 B;  4DF7 A;  2WP8 J;  2DNC A;  3WWV A;  4ID6 A;  1E2V A;  1EEI D;  3HOW H;  4HJA A;  3CXC A;  1JR0 D;  4QIW E;  3PO3 G;  1E24 A;  2A68 D;  3H09 A;  2Z6K A;  4S3S A;  1WTO A;  3J7Y W;  4A93 B;  3W1G A;  4Z9C B;  4L5Q A;  3MFG A;  3UI2 A;  5EPJ A;  1UEA B;  3HOU H;  3BU2 A;  1Y8N B;  4OON A;  4WJW A;  2WAC A;  4JI7 L;  4DV3 L;  4A3K B;  2AWO A;  3HZX A;  1EY0 A;  1H95 A;  4V0B A;  3S17 B;  3IAY A;  2K28 A;  3DWP A;  5JJZ A;  2AHO B;  2JJQ A;  3E0J A;  1F2Z A;  5CV9 A;  1YI2 A;  4LF7 L;  4A3G B;  1BBX C;  3W3A A;  2QW7 A;  2VL6 A;  2K5D A;  1G6Z A;  1Z9F A;  2JA9 A;  2K50 A;  5FO8 B;  3Q8D A;  2JP1 A;  3PO3 B;  2E2H B;  5EKK A;  4JI3 Q;  1W6K A;  4ILW A;  4H13 C;  5GRO A;  1HUM A;  2PQA B;  3V05 A;  2FMC A;  1IXR A;  3W2D A;  3EQL C;  1YNN C;  1PFN A;  2EYJ A;  1KD1 C;  2B2W A;  3VYU A;  1FD7 D;  1V1P B;  1B7Y B;  3J81 c;  1QE6 A;  1AE3 A;  4IO9 A;  1VQA A;  3CCQ A;  1JJ2 A;  1Y1V G;  2JE6 I;  2BA0 A;  2A1A A;  2E5L Q;  2EY2 A;  3C1E A;  4X64 L;  4G7Z C;  3TME A;  3FKI H;  1K8A C;  1SAP A;  2B29 A;  3MXN B;  2BCO A;  5I6Y A;  2XSC A;  1CZW A;  4DR6 Q;  1PFM A;  4C3I H;  4ABN A;  2C5C A;  2R61 A;  1GO3 E;  1JJG A;  3I70 A;  4DKA C;  3GTG H;  4A3M G;  5JPM C;  1HPC A;  2GA4 B;  1GM5 A;  4BBS H;  2EZV A;  3CME A;  4A3E G;  2F0Q A;  1JOR A;  3K7A H;  4DNT B;  3OIQ A;  5DNF A;  4HSV A;  4QMG A;  4C2M B;  1Y1V B;  3CQZ B;  2PQE A;  5C3X A;  5JJK A;  1CSP A;  2C35 B;  4DN4 M;  2LMC B;  1DGS A;  2KBN A;  3HOW G;  1IBM L;  4PZ6 A;  2B2Y C;  3WDN A;  1EEF D;  4A3M B;  3M4O H;  3Q22 A;  1B3A A;  3FRP B;  2XNA C;  3T1H Q;  1EOT A;  3HOU G;  2DJG C;  1EFW A;  1VQL A;  3I73 A;  3VA5 A;  2ATW A;  1EQV A;  3OSO A;  1JB3 A;  4Y7N H;  3BZK A;  4RMF A;  4K0K Q;  1DOK A;  4LFC L;  2L15 A;  2JQO A;  5D3I B;  1HXY D;  4K5V A;  2EIF A;  4B3T Q;  2J0T D;  1EQT A;  1BBU A;  3MFY A;  4WOR A;  3RMH A;  4IOC A;  4EQN A;  5C5L A;  1MJE A;  1HNX Q;  1SYC A;  2XWB B;  1YEZ A;  1K0R A;  5EQ0 A;  3HOW B;  1F9R A;  1WTH A;  3S16 H;  1E2W A;  4KY5 A;  5FLX E;  5IYB G;  4F87 A;  4R9W A;  1LTA D;  1NUC A;  4L6T B;  1X32 A;  4X3K A;  2UUA L;  1I6V C;  1CA5 A;  4EQP A;  3HOU B;  4IFD J;  4G7H C;  4K2K A;  2OF1 A;  1X3G A;  3GD7 A;  3WOE A;  3DMU A;  4CDC C;  3PIO A;  4R8I A;  4BBR H;  2A6H C;  3L3O C;  2R93 G;  5CBA E;  4FP5 D;  1D5M C;  3TS2 A;  2EYF A;  3PUZ A;  1GD7 A;  1HQR D;  2JA7 H;  2I46 A;  2MUY A;  4R8N A;  2ES2 A;  5ELD A;  2VB3 X;  4OGQ C;  3J81 L;  1IYV A;  4JI7 Q;  4DV3 Q;  5IP7 H;  2MGS A;  3I4O A;  2NUC A;  3UDI A;  2ENB A;  4AQY L;  3DWA A;  1VMP A;  3SHL A;  2R92 G;  5A2Q L;  4GZY C;  3D3R A;  1EYD A;  4H44 C;  2F0W A;  4LF7 Q;  4P74 A;  4BBS G;  3NE5 B;  1J6Q A;  2HDL A;  4XQN A;  1JCK B;  1ET9 A;  3OPO A;  2M00 A;  2D2C C;  2F0P A;  2VQE L;  4IUR A;  4KHZ A;  4A3L H;  1Q46 A;  4PMC A;  1XXG A;  3GTL H;  2R93 B;  3EA6 A;  5H1S E;  4KJN A;  3S1R H;  2A69 C;  4F7X A;  2VXW A;  3PUW A;  4JV5 L;  1DM0 B;  2DN8 A;  1GUS A;  2XVS A;  4JW0 A;  1GKH A;  1VDZ A;  3BDC A;  1PRT C;  3VYS A;  3I3C A;  2E2D C;  3QIA A;  2K52 A;  2HQL A;  3HG9 A;  1SNQ A;  1FNW A;  1A8V A;  3U9O A;  3CKI B;  5CBE E;  5IYD G;  5CV4 A;  1EIY B;  2F4V L;  3GTG B;  3C3L A;  1P8L A;  3OYY A;  3NPP A;  3KBG A;  2EY5 A;  3IFD A;  3AMU A;  2BE5 C;  1Q8I A;  5COR A;  2AKW B;  4X64 Q;  4BBS B;  4TVA B;  4QJF A;  1OXU A;  1PYS B;  2AQ2 B;  2KEC A;  1KDC A;  3K7A B;  4NXM L;  1DOM A;  3V96 A;  1F9S A;  3GV3 A;  1TXY A;  5C44 G;  5TSS A;  4H0L C;  3A56 A;  3VYR A;  2IX3 A;  1STY A;  3K80 C;  1PFB A;  3Q0A A;  1S3O A;  1ICF B;  2Y0S E;  2E2I H;  5IOC A;  2BH2 A;  1BVS A;  3PO2 H;  1JOO A;  3LWE A;  3MXU A;  2WFW A;  5C0X I;  3G4S A;  3J80 E;  4KY6 A;  4IQZ A;  4KHV A;  5E4W C;  2OTL A;  3NEM A;  4PZ8 A;  4UDU C;  2B2T A;  4NKL A;  5FLX c;  4LF4 L;  4JI4 L;  2AUJ D;  5HGQ A;  1K8G A;  1K3R A;  1NR2 A;  3CP0 A;  3CRL C;  5C0X H;  1XMQ L;  3E9H A;  1FNV A;  3W5O A;  1HNZ L;  3MAQ A;  4Y7N B;  2PZT A;  4YWM A;  1EU3 A;  4IUU A;  1IBM Q;  4NP5 A;  5EBC A;  1F77 A;  4BBR G;  5C44 B;  3RNU A;  1YVC A;  2QGQ A;  4OEM B;  2JA8 G;  5KEE A;  4A3B G;  5LHY 1;  1LTL A;  3NTH A;  1B1Z A;  3MXP A;  1FGU A;  1CHP D;  2JA7 G;  4EQO A;  2QEX A;  2NN6 G;  1XNQ L;  1DOL A;  2B2T C;  4JBJ A;  5K5P A;  2OWO A;  3A7A B;  3M85 A;  4KMU C;  1QOH A;  1O7I A;  3HKZ E;  4JOI C;  2Z4H A;  4X62 Q;  4B3M L;  1QNU A;  4CKB A;  4DV1 L;  1SJH D;  3I4N G;  1NMF A;  4XIG S;  1B50 A;  3K5N A;  2I07 B;  4UP9 A;  3PSI A;  2EQS A;  4PMB A;  2L9H A;  1QCB D;  1GXD C;  3OIP A;  2R7F A;  2VUM H;  3HOZ H;  2AMC B;  3ER0 A;  1GVP A;  1Q8K A;  2A69 D;  1Q81 C;  4ZUI A;  4BBR B;  4OX9 L;  2JA8 B;  2F3W A;  4A3B B;  4RKL A;  4NB3 A;  5ELF A;  4H02 A;  1PRT D;  1VQ9 A;  1X55 A;  1MSH A;  4GNX A;  2JA7 B;  1XWE A;  1FR3 A;  2FIN B;  2NVY H;  3I90 A;  3J7A V;  3KYH C;  4CKC A;  4DR4 Q;  1N32 L;  2ZTE A;  3I4N B;  4O2D A;  4G4K A;  5CV7 A;  1VQE A;  1SE8 A;  1FGB D;  1PMR A;  1GUG A;  4P72 A;  2B2V A;  2RDH A;  3MTS A;  3URY A;  1LO5 D;  2FXQ A;  3BS1 A;  1IYU A;  3NK9 A;  4GNX C;  3GTL B;  1NAP A;  5J1Z A;  1NR4 A;  4C56 C;  4OO1 G;  4JI8 Q;  4AQY Q;  2B8F A;  3S1R B;  4CDF C;  2OXP A;  3LX0 A;  1XPO A;  4DUY L;  1A3V A;  2YTV A;  1U4R A;  4KI0 A;  1NY4 A;  1QZH A;  1EQQ A;  1KNE A;  1IW7 D;  3GTJ B;  2K05 A;  1LLR D;  2HDM A;  4X65 L;  4KD3 A;  3PO2 G;  3L9A X;  2IPK D;  5KYI A;  1XTD A;  3J80 c;  2RDG A;  3H3V I;  4JV5 Q;  1HNW L;  2IT1 A;  3BDO A;  3J81 j;  1PXU A;  4JYA L;  5JVH 3;  3H3V H;  3DWQ A;  2ZJP A;  2R7Z G;  1ASZ A;  4KD4 A;  1VQN A;  2F4V Q;  1PRT F;  1LV9 A;  5M5W B;  2RSN A;  4F88 A;  1SE2 A;  2R6G A;  2ZJR A;  4OWW B;  4X3S A;  3M3Y H;  1YBY A;  2JYO A;  3PO2 B;  2ZM6 L;  1WCM G;  2D0P A;  5LL6 X;  1D2B A;  4UP7 A;  1BUV T;  2QEJ C;  1PRT B;  2HCC A;  4LFB L;  2B8G A;  4IJL A;  1EY6 A;  2K4K A;  2PW5 A;  4U67 3;  2JA5 G;  1QVG A;  3O13 A;  4LNQ A;  1CFM A;  1M90 C;  4IN3 A;  4PMW A;  4X6A H;  1EWI A;  2R7Z B;  2K6A A;  4JI3 L;  1HA5 A;  1G6P A;  2F0K A;  1S4Z A;  3JAM i;  1KDA A;  3U58 A;  1HZC A;  1HRJ A;  1QJO A;  1V9P A;  5FOB B;  4LF4 Q;  4JI4 Q;  4BXX G;  1ESF A;  2WB1 E;  1UWV A;  4X3U A;  5IOD A;  1WCM B;  1STE A;  1SMY C;  1XMQ Q;  3KBX A;  1SNC A;  1JWS D;  3NQI A;  1VQH A;  1HNZ Q;  2JA6 H;  4P71 A;  1A3T A;  3PF4 A;  3QOL A;  1EL0 A;  2E5L L;  4J8Q A;  3AFQ A;  2JA5 B;  4KHP L;  2YV5 A;  4JBW A;  3L2P A;  2F0D A;  2HIX A;  2Q8T A;  2K75 A;  1XNQ Q;  4KN4 C;  4FF3 A;  4KKU A;  5ELO A;  1P16 A;  1SBB B;  1KC8 C;  3S1M H;  4B3M Q;  2PMZ E;  1KLU D;  2A73 B;  4DV1 Q;  2RVL A;  1NSN S;  5E3F A;  3SE0 A;  5ELC A;  1QZG A;  1CZG A;  1JIC A;  3EVQ A;  2QIL A;  2F3V A;  4AIM A;  2WII B;  1E1T A;  4KV6 A;  2NVY B;  3S14 H;  3Q6S A;  1K83 H;  3VDY A;  3NTK A;  2F0V A;  1K0S A;  2SOB A;  4BY1 G;  4K14 A;  4J6H A;  2Z4I A;  4KLK A;  4JI1 Q;  3PF5 A;  4OX9 Q;  3NWT A;  2FFK B;  2LS0 1;  1EIH A;  1HQM C;  4QQB X;  3HOX H;  3L0O A;  3NEL A;  2OEO A;  1LT6 D;  5D3D A;  3J81 E;  1HJP A;  5IE8 A;  3N52 A;  4X66 Q;  1EQR A;  3S1Q B;  5EKL A;  1AH9 A;  1STN A;  1N32 Q;  5DM7 3;  4A3C H;  1D1K A;  1MSG A;  1UE6 A;  2BOS A;  5HGT A;  1IZ6 A;  1JE4 A;  3T1H L;  1GHK A;  1YIT A;  2B63 H;  5A2Q E;  1YIJ A;  3HOY H;  1TVX A;  3F2C A;  2O2L D;  1YNJ D;  4LJZ C;  2UXD L;  2CWA A;  5IP9 H;  3S24 A;  4BY1 B;  4I7Z C;  1LTS D;  2C9O A;  1B9M A;  3GTK H;  5IGD A;  2CHB D;  2E8G A;  1BO0 A;  1H9J A;  1PYB A;  1SYD A;  1YJN A;  1TY2 A;  2NVX H;  4DUY Q;  1QWY A;  2X6G A;  3LWU A;  5COY A;  1I3Q H;  1AE2 A;  1C4Q A;  3KF8 A;  1VF7 A;  3I7F A;  5K36 H;  2LY7 A;  3TEH B;  1KLG D;  3U9S A;  2E76 C;  4EX5 A;  3D0F A;  3HFZ B;  4Y52 H;  4GNX B;  1G2T A;  4RCO A;  2XTI A;  4A3G G;  3QJY A;  1SMY D;  4OIK A;  2F0E A;  5EJW A;  2F0G A;  2NYZ D;  3TSS A;  1H9K A;  1TT2 A;  4HID A;  2L55 A;  1A62 A;  2F03 A;  5GAD C;  4JYA Q;  3H0G H;  4XT1 B;  2I0Q A;  2JA6 G;  4DNR B;  2K1B A;  2AQ1 B;  2GVA A;  1VF5 C;  3DEP A;  4N9T A;  2YU9 H;  1VQC A;  3TZD A;  1PZJ D;  4K8J A;  3T4A C;  1R4Q B;  4R4Q A;  3M4P A;  2D9U A;  4IUT A;  3OW7 A;  1V43 A;  4C1N I;  2WIN B;  3VR5 A;  2FJ2 A;  1HR0 W;  2ZM6 Q;  4JI0 L;  1PH9 A;  1E2Z A;  5M3F H;  1VQM A;  1G8Z D;  3PUX A;  1PH4 A;  2V4D A;  4NMZ A;  2F1M A;  1N34 L;  4LFB Q;  4YIJ A;  4CJ2 C;  4KN7 C;  4JC0 A;  1PA6 A;  3CC4 A;  3VR4 A;  5CMD A;  2K5N A;  2UXC Q;  2HUG A;  3E3X A;  1OO9 B;  4GN5 A;  2Z6K C;  1VQ8 A;  1TS3 A;  1PH2 A;  3HS0 C;  1WD0 A;  5FJ8 G;  2JA6 B;  1CHQ D;  4APV A;  2N8N A;  1IKL A;  3ICE A;  1JMC A;  4POF A;  1KL9 A;  1PZI D;  3HRZ C;  3U4V A;  2RDF A;  4XYO A;  2NZ1 D;  4WFN 3;  3GTQ B;  1WJJ A;  4WJ3 M;  2WKD A;  2I5M X;  1NMG A;  1BQQ T;  4ME3 A;  3T53 B;  3UDX A;  4GOP A;  4GLA C;  5DAU A;  1EYC A;  3T16 A;  1Q1B A;  3VR2 A;  4A3C G;  1VQ5 A;  1MD2 D;  2JN4 A;  2PZU A;  2B63 G;  1K28 A;  4DNI A;  2OQK A;  4XT3 B;  1WTX A;  3HOY G;  4KHP Q;  4C1N K;  1LTR D;  3S14 B;  1SEB D;  2LKV A;  1K83 B;  4PNY A;  4RGT A;  4QGU A;  3BVG A;  3M4Y A;  1KRT A;  2IHF A;  5EPK A;  1PTO H;  3HKZ G;  2NZH A;  3PCO B;  2B2W C;  5JVG 3;  4YCW A;  1SFO H;  4J1M A;  4ZKC B;  2CQO A;  2YTY A;  3HOX B;  1V1Q A;  3L7Z C;  1BCP C;  3VR6 A;  4A3D H;  3NBI A;  1AP0 A;  3A54 A;  4K2L A;  3DEO A;  5AFW A;  5K36 G;  3CPW A;  3F8T A;  1FL0 A;  4UPA A;  2X6L A;  2SNM A;  2GVB A;  2RKS A;  5JAV A;  4YHH L;  2BA1 A;  1IHZ A;  5I4D A;  3NHH A;  4HMI A;  2B63 B;  2QDB A;  4RCN A;  3HOY B;  1MJC A;  3GTO H;  1L1O A;  3TZU A;  4OEL B;  4OIJ A;  3R2T A;  2MNA A;  3QR8 A;  3MWY W;  1JOK A;  2L11 A;  4GN4 B;  1WTW A;  4DV4 L;  3HKZ B;  1AEX A;  3H0G G;  3GTK B;  2MFI A;  1B8A A;  2IJ0 A;  3HP3 A;  5CV6 A;  3GTM H;  3I55 A;  3VA7 A;  4DAY B;  2H1E A;  3K0X A;  1XMO L;  1I3Q B;  3CCM A;  2UXD Q;  1PH8 A;  4X62 L;  2Q2T A;  3GTP H;  3TDQ A;  1L1O C;  3P7J A;  5G3L D;  1AFP A;  3TS0 A;  2UXB L;  2TMP A;  1PTO D;  1HZB A;  1TR5 A;  2EXD A;  5I2X A;  3IL8 A;  1I4Q A;  2XRS D;  5LMN W;  1WFQ A;  1TWF H;  1EY9 A;  3E6Z X;  4M1U B;  4DGZ A;  3H0G B;  1R4P B;  4A3I H;  1I5F A;  4L5T A;  3DUZ A;  3TN2 A;  3H6M A;  4JCV E;  2UUC Q;  2YU9 B;  3S2D H;  2N55 A;  4NPS A;  2KJX A;  1CSQ A;  1II3 A;  4LF5 Q;  3LGJ A;  1JB7 A;  1RJT A;  4DR4 L;  1A2U A;  3BYY B;  4DR2 L;  5KGU A;  1VQI A;  3VR3 A;  1GUO A;  2LXK A;  1PDQ A;  3KK7 A;  2Q8I B;  2Z0S A;  3SK8 A;  2IHE A;  4JK1 C;  4CJ0 B;  4FO2 A;  1LAB A;  3A8I E;  3D4W A;  4K5X A;  3D6W A;  3DHQ A;  3UDG A;  4XTC S;  4RA8 A;  3FKI G;  4HJ9 A;  4P73 A;  1A15 A;  2R3Z A;  1BBW A;  4LF8 Q;  2F0N A;  4JI0 Q;  2RQX A;  5IGE A;  4OHJ A;  4C3I G;  4JI8 L;  3P1H A;  5EBD A;  1SRU A;  3WOF A;  3F2B A;  3W1B A;  1KIX A;  4HIO A;  1BCP D;  2EYO A;  2KHJ A;  1EY8 A;  3ONA B;  1N34 Q;  2O5I C;  1RDP D;  3PV0 A;  3KLW A;  2FMM A;  1NJI C;  4ZK9 B;  5I9O A;  1NTG A;  2F0O A;  4A3D G;  3KF8 B;  5J39 A;  5C0X J;  3QB3 A;  4DV7 L;  4JI5 Q;  5DLQ E;  5G3L F;  1CI3 M;  2EY6 A;  1PTO F;  3CHB D;  1CQV A;  4MZ9 A;  2WB1 G;  3FKI B;  4OL7 A;  4AYB E;  1SND A;  2LXJ A;  5FLM H;  1O7Y A;  1PZK D;  2NVT H;  2XN9 C;  2KUM A;  4QF4 A;  4JVZ A;  1PTO B;  4C3I B;  2UU9 L;  2PI2 E;  2XGT A;  1JWU D;  3N6R A;  3KUP A;  1SFO B;  4YY3 L;  4MTK A;  1CTM A;  4MNO A;  1W2B A;  3FVQ A;  2LSS A;  2N78 A;  4UHV A;  3HOV H;  1T5E A;  3S2H H;  4A3D B;  1G51 A;  4GKJ L;  1TWH H;  2NTS A;  4QUF A;  1F9Q A;  1TWA H;  1SR3 A;  2E75 C;  3SR1 A;  4FF2 A;  3NQT A;  4RKB A;  3CCE A;  1X3P A;  3DM3 A;  2O5J C;  3I4M H;  1QG7 A;  5ISR A;  4JBK A;  2ZT9 C;  1IBK Q;  3NTI A;  2WB1 B;  3GTO B;  5I6W A;  4E6I A;  2K7V A;  3KFU A;  1U5K A;  3V2T A;  2A8V A;  1U0L A;  1H9S A;  1HUN A;  3I4L A;  5I2Y A;  3G48 A;  3TP5 A;  1R9T H;  1IW7 C;  2Q2I A;  1TU2 B;  2SDF A;  1C9O A;  1YJ9 A;  1BCP F;  4JPB W;  2IWH A;  4YHH Q;  1O78 A;  3M4O B;  5EGT A;  2JEA I;  5DEH A;  2NBF A;  3G6E A;  4DV0 L;  3JAM L;  3OTO L;  4MTN A;  1B53 A;  3OWF A;  4Q0F A;  1LT5 D;  4K8I A;  3QOJ A;  4GS3 A;  4HCS A;  4I65 A;  2FHT A;  4DPG A;  4A3J H;  1DZ1 A;  4GOP B;  4DUZ L;  4RAU C;  4CHT B;  1ILQ A;  1BCP B;  4DV4 Q;  3A5U A;  1XX8 A;  2D0O A;  4IUQ A;  1I4R A;  1LTB D;  3K57 A;  1RTN A;  2B2U A;  3FEW X;  3SK4 A;  4ODG A;  5D65 A;  3KLS X;  3KLS A;  2Z9H A;  3K58 A;  1X3F A;  3J7A F;  5CC4 A;  4IPG A;  1XMO Q;  1CK1 A;  2Z8L A;  1TWF B;  2J7Z A;  3ULL A;  3GO5 A;  3EBE A;  5IP7 G;  1KHI A;  3RZO H;  3EIV A;  2PO4 A;  2F52 A;  3S16 B;  2Q8R E;  3K5O A;  1K8O A;  2ZTC A;  4QB4 A;  1EIG A;  2EE1 A;  1SYF A;  2PW7 A;  5JEA H;  5IGC A;  2UXB Q;  1RD9 D;  2PNR C;  1EZ8 A;  5M9O A;  2B39 A;  2LFN A;  1HH2 P;  2NWG A;  1S40 A;  4ZCK A;  4JI1 L;  4R4I A;  2BH8 A;  5C3E H;  4A3L G;  3GP7 A;  4DR1 L;  2CWP A;  5J22 A;  5IYC H;  1G29 1;  2RSO A;  1L1O B;  1KDB A;  4DK3 C;  4TQU S;  1B70 B;  2UUB Q;  1VQP A;  4G7O C;  4X66 L;  1EWH A;  5FK9 C;  1UUP A;  1A0I A;  4DXF A;  5FLM G;  1ZEQ X;  2EYM A;  1VQ6 A;  4DR2 Q;  1JE5 A;  1VQD A;  3AYH B;  4DR7 L;  5M3M H;  3D31 A;  2BDN A;  3EFX D;  4IUN A;  2F0M A;  4BA1 I;  2NZO A;  3H3V C;  5ELB A;  2WAQ E;  3CCJ A;  3T56 B;  3CC7 A;  4N9P A;  4DAP A;  1N8R C;  4F8M A;  3R2I A;  5J3B A;  4A75 A;  2HD3 A;  2OTJ A;  1Y8O B;  1YHA A;  2RHQ B;  2N88 A;  2ICI A;  3I4M G;  3U4Z A;  2EPB A;  1VQO A;  2CCZ A;  3J81 i;  2KOL A;  3T1Y L;  3I72 A;  4JBM A;  2ASB A;  3NP8 A;  4K5W A;  1M8A A;  2Q2H A;  4N8X 1;  1JT8 A;  3FHW A;  1RKN A;  2VZA A;  2EJF C;  1VQF A;  4QIW B;  4DV7 Q;  2B2V C;  1FJG L;  1CT1 D;  3TQY A;  5LL6 S;  1YNX A;  2PYK A;  1M1K C;  2XRQ D;  2I5H A;  1S5C D;  3SXH A;  3I8Z A;  1QVC A;  5KNB A;  4LUO A;  3DLL A;  3P75 A;  2F0S A;  5CV8 A;  3HOV B;  3S2H B;  1IBL L;  1SLJ A;  5C0X G;  1TWH B;  1OTC A;  2EJM A;  2R7D A;  1TWA B;  2YYZ A;  1YHQ A;  3M7G A;  2QF7 A;  2UU9 Q;  2QA4 A;  2ALY B;  1LYL A;  3I4M B;  3SGI A;  4RHR A;  1STB A;  2N49 A;  1WD1 A;  4LK1 C;  4YY3 Q;  1QB5 D;  3TRE A;  1SE4 A;  4R4T A;  3CC2 A;  4BY7 H;  2K03 A;  2L12 A;  2E2I B;  3DM1 A;  1E7Z A;  2NVQ H;  4GKJ Q;  1HHV A;  1O7Z A;  1H9M A;  1QIL A;  1JC7 A;  1R9T B;  3IKJ A;  5D14 A;  3FPU B;  1AZP A;  3CCS A;  1YNJ C;  1FVI A;  2OT2 A;  2RCF A;  3OW2 A;  4LF6 L;  4DV6 L;  5JEA G;  2UXC L;  5L37 A;  4FXK C;  1K3B C;  1PH6 A;  2L1B A;  4IPD A;  3BG3 A;  4B3S L;  1RIP A;  1VQJ A;  4RH6 A;  3UE1 A;  1LUZ A;  1SE3 A;  2VUM G;  5CV5 A;  3HOZ G;  3AB9 A;  3M4Q A;  4BA2 I;  3G71 A;  1PYW D;  2L5T A;  3X3N A;  2L0C A;  3J7Z C;  5IYC G;  2HHH L;  5E1F A;  1MKH A;  4A93 H;  1KRS A;  4O0A A;  1B2T A;  2CH4 A;  3AFP A;  1OXX K;  1VCI A;  1KAB A;  5LMU L;  4DV0 Q;  4LWC A;  3OTO Q;  2GN5 A;  4TKO B;  1IKM A;  3E0E A;  4AH6 A;  4DUZ Q;  1Y1W H;  1L0Y B;  2RA4 A;  3FDT A;  2D5D A;  5KIX A;  3BDL A;  5GAG C;  3QWN A;  2JEB I;  3B6Y A;  1SMX A;  3RZD H;  2J4X A;  5HUR A;  1WTP A;  4GLV B;  4DAY A;  1Y14 B;  2Z6B A;  1VQ4 A;  3HOZ B;  2VUM B;  1PH3 A;  2SEB D;  3G7L A;  5C3E B;  1SSO A;  2DNE A;  2DJF C;  1N33 Q;  2HT1 A;  4CBV A;  5IGG A;  4CKE A;  1SNM A;  5E4X A;  3F1Z A;  1H9S B;  1X9N A;  1WTQ A;  2H5X A;  3OWE B;  3PUY A;  4FNF A;  2K01 A;  3AEV A;  4DFA A;  4QL5 A;  3IFT A;  3GQB A;  1SYB A;  3T51 B;  4DR1 Q;  1N9W A;  1KAW A;  4HN7 A;  4BS9 A;  3RN5 A;  3ULP A;  4DU9 A;  1LT3 D;  3H91 A;  1ENC A;  2PNH A;  1EYG A;  1HCZ A;  1LTT D;  4C3J H;  1MI2 A;  4HJ8 A;  2A6E C;  4I7A A;  1ZKO A;  1TY0 A;  4DK0 A;  3AQQ A;  2K33 A;  2KCC A;  5CYU A;  2H4O A;  5E7N A;  2B3G A;  2X69 A;  3RLF A;  5IWA L;  3TRZ A;  4DR7 Q;  3RLN A;  1I6H H;  5T1G A;  5A35 A;  1AW7 A;  3OMC A;  1M4V A;  3A5Z B;  4BY7 G;  1V8Q A;  1X56 A;  2G5D A;  3MVV A;  5KND A;  4DR3 L;  1BNZ A;  1K73 C;  2A19 A;  1TWC H;  1X6O A;  3HEJ A;  4ZLT F;  4HIK A;  4MN3 A;  3CQZ H;  5JOB A;  1AZQ A;  1ML0 D;  3P20 A;  4M8A A;  4XQJ A;  1MGS A;  2ZXP A;  5IT9 c;  5LMN L;  3T1Y Q;  3TP7 A;  1KNA A;  1T5X D;  2WKC A;  1S5E D;  3TP8 A;  2V1C C;  1WTV A;  3U50 C;  3KJP A;  1FJG Q;  3CMA A;  2UUC L;  2HCI A;  1S5B D;  3M9B A;  3K6O A;  3MC0 B;  2M9V A;  2SNS A;  4EVO A;  3M3Y B;  4BY7 B;  2ZJQ A;  4LF5 L;  4A3E H;  4FF4 A;  4A3F H;  4AYB G;  2K14 A;  1IBL Q;  2NVQ B;  5AJ3 L;  4IUP A;  3NXW A;  1D5Z C;  2KHS A;  2K5H A;  4UY8 C;  1O7L A;  3I2Z A;  3S1N H;  1JOQ A;  4X3T A;  3H94 A;  2IL8 A;  3MXG A;  3S15 H;  2OCE A;  3BZD B;  1EY4 A;  2QCP X;  5I9P A;  4YCU A;  5NUC A;  1DYQ A;  5DM6 3;  3D8G A;  4LF8 L;  3ERS X;  2JK8 A;  4ULL A;  1D5X C;  1TS4 A;  2IX0 A;  1QUQ B;  1D6E C;  4IUV A;  3RUZ A;  4B08 A;  4LF6 Q;  4HED A;  4DV6 Q;  1HZA A;  3C46 A;  2K5W A;  5CGK A;  2KED A;  3JAM E;  3D6C A;  1PTO C;  3T13 A;  2Y0S G;  4LW1 A;  4AYB B;  4B3S Q;  1JWM D;  5C6A A;  3CF5 A;  1G2S A;  4JI5 L;  1Y1W B;  5BN5 A;  3SK5 A;  1OXT A;  1Q3L A;  4DV5 L;  1HZ9 A;  1RHP A;  1YJW A;  3RZD B;  3S9W A;  2HHH Q;  3HOX G;  3QG1 A;  2A6E D;  1F9P A;  2TSS A;  1EUJ A;  4PG3 A;  5LMU Q;  1W3S A;  5C3W A;  4IAL A;  3CPF A;  4FVM A;  4XYQ A;  1ESR A;  1XTC D;  4C3J G;  1ENA A;  1X65 A;  4JI2 L;  2PZW A;  2ZXR A;  1STA A;  3PGZ A;  3S1M B;  1CM9 A;  1XYI A;  4XDX A;  5IYB H;  1G91 A;  4XXE A;  1T9H A;  3A55 A;  3CCU A;  4JG2 A;  2CQA A;  3IRB A;  2F4I A;  2Y0S B;  4IZ8 A;  3A8K E;  3Q23 A;  5IP9 G;  2K32 A;  5M5Y H;  1Y8P B;  4PV1 C;  2PPB C;  2R93 H;  1Z6H A;  3KOJ A;  3UE0 A;  1IBK L;  4GOP C;  1LM0 A;  3H15 A;  3DXJ C;  4RFB A;  5FO9 B;  1S72 A;  2Z1C A;  5ELE A;  2KEE A;  4C3J B;  1X3E A;  4LUV A;  4JI6 Q;  3K0Y A;  1ILP A;  3NBH A;  3A74 A;  3MEH A;  1X54 A;  3CD6 A;  3F2D A;  1I6H B;  1U4M A;  2RBM A;  2A74 C;  5IT9 L;  4DK6 C;  2R92 H;  1WOC A;  1Q12 A;  3CW2 C;  1DCZ A;  2MJ8 A;  4G57 A;  2B2Y A;  5BN4 A;  1MHW C;  1XPR A;  4A3F G;  5C4H A;  1AN8 A;  2A5H A;  3PMF A;  1EY7 A;  4KKT A;  3MZ5 A;  1K9M C;  1TWC B; 
#chains in the Genus database with same CATH homology
 1NCV A;  2EXZ A;  2NVX B;  3TP6 A;  1B44 D;  3I91 A;  2CW0 C;  3X3M A;  2VNU D;  3FPP A;  4QCL A;  5C4Z A;  2JSO A;  2EJG C;  2HQE A;  1STH A;  5IIF A;  1DJR D;  2AUK A;  1J9O A;  4A3E B;  4A3F B;  2KQ3 A;  1A6X A;  4DXG A;  2VB2 X;  2EYH A;  3R3O A;  1DXM A;  3S1N B;  1J8I A;  3NUC A;  5FO7 B;  5C5M A;  3S15 B;  1I4P A;  4PQX A;  2WAQ B;  1TS5 A;  1RF2 D;  5KNC A;  4FYD A;  1FNU A;  1LTG D;  1ZXT A;  5M3F B;  1BF4 A;  2EVB A;  1OXV A;  3BVM A;  3MHB A;  1YNN D;  1SNO A;  3QO2 A;  4KY7 A;  1UAP A;  1X3Q A;  3G6J B;  1RTO A;  2BDO A;  4L63 B;  1KTK A;  2ID0 A;  2XIW A;  2NN6 I;  4DAV A;  4EGV A;  2IX1 A;  2EY1 A;  2IW3 A;  1UNS A;  1EYA A;  3CU7 A;  2NN6 H;  3ND9 A;  1TS2 A;  1BXT A;  3BVZ A;  1JQY D;  4O1N A;  1CQF A;  3SEB A;  1K8M A;  3PIO 3;  1SNP A;  2F0J A;  1U4P A;  5M5Y B;  1GHJ A;  2CW0 D;  1ICW A;  1EY5 A;  5JEA J;  1Z7T A;  4UAI A;  4IFD I;  1A2T A;  1SJE D;  2MPM A;  4C3H G;  3ERQ A;  5KRU A;  3SDZ A;  4ZQ3 A;  4DA2 A;  2AQ3 B;  3K59 A;  2R92 B;  2KVM A;  4IFD H;  4OO1 I;  3NSW A;  3ND8 A;  3EJI A;  3GTM B;  1OXS C;  4OO1 H;  4ZUJ A;  3TBI B;  1F2L A;  4HCE A;  5T1I A;  5C4J B;  2KA7 A;  4TRD A;  4C3H B;  1I4H A;  3GTP B;  1TWG B;  3D4R A;  2PMZ B;  2F0H A;  1TQO A;  1D1I A;  1WVL A;  4RWS C;  1B9N A;  2ZXO A;  4WRD A;  2K5Q A;  4O42 A;  4A3I B;  1LAC A;  2A6H D;  2PCF B;  4KJO A;  2EYP A;  3ITP A;  3PIP 3;  3S2D B;  3R8B A;  1ROD A;  2B2U C;  1IL8 A;  1B4O A;  3VYT A;  5CR3 A;  1WTR A;  3MA2 B;  4B9X A;  1LTI D;  1U9R A;  3FMC A;  2WV6 D;  4U68 A;  4ZKB B;  2D62 A;  1Q1E A;  3OOC A;  1HFG A;  1FYC A;  1ET6 A;  1GUT A;  1Y69 U;  1ENF A;  3ZYY X;  1BOS A;  3OMG A;  1GJX A;  2BE5 D;  4BWG B;  4FF1 A;  4MIU A;  1CA6 A;  4IFD G;  3GV6 A;  2NVT B;  1QNK A;  4HAE A;  1W6J A;  2MHV A;  1I4G A;  2F0U A;  3SK6 A;  5BN3 A;  1E0B A;  4L8J A;  5C4X B;  3BYT B;  4ZAI A;  2MP1 A;  1S5D D;  3CRK C;  1C48 A;  1HTP A;  4HMJ A;  4MHE A;  3Q24 A;  3K5M A;  3SVM A;  4P2C B;  5FKA C;  2G9D A;  1F2Y A;  3HGB A;  1DON A;  4QUC A;  1V1P A;  2L4N A;  4TSS A;  1STG A;  4ZYS A;  4RGO S;  5FLX L;  1ONL A;  5IT9 E;  4LAA A;  5IGB A;  4A3J B;  3A7L A;  4DK1 A;  4LMQ D;  3MXN A;  4KTA A;  3ERO A;  2CVR A;  3PUV A;  2EDG A;  4ZRZ A;  1TKW B;  2NTT A;  5F2D A;  3RZO B;  1EZ6 A;  4CGY B;  1L0X B;  3C2P A;  2G9H D;  1F2M A;  2AWN A;  5M5X B;  1HTL D;  4NDX A;  1Q90 A;  3KLR A;  1V1O A;  2M2L A;  1HA6 A;  1HFN A;  4KK7 A;  1BR9 A;  3AU7 A;  1I50 B;  4CJ1 B;  1TII D;  1SDF A;  2NB0 A;  1ZYR C;  3NWS A;  4K6D A;  4Q5V A;  2A68 C;  1SYE A;  2E74 C;  5EKI A;  1GOZ A;  4K6L A;  4B9W A;  2XWJ B;  3A8J E;  3F2U A;  4RGM A;  2F0I A;  4KKS A;  1SYG A;  3LNN A;  5M3M B;  1I4X A;  1PLF A;  4HTH A;  1A3U A;  4ME5 A;  4H7B A;  1RCV D;  1EFI D;  4RHS A;  4NW2 A;  1Z47 A;  3K5L A;  1LT4 D;  5KYL A;  4XQQ A;  1SXT A;  1BDO A;  1O80 A;  2K04 A;  2O4X A;  5IGF A;  2E2J B;  3C1F A;  3OHX C;  3J80 L;  4V19 0;  2DY7 A;  2ICE C;  2EOT A;  1KAA A;  3R93 A;  3E5S A;  2DY8 A;  3D4D A;  2JXM B;  2EYL A;  3M7N A;  5JPN C;  1U4L A;  1MBY A;  4HSP A;  2F0T A;  5EPL A;  1GUN A;  4RGN A;  2KCN A;  1DD2 A;  1VMC A;  4FXD A;  1EWC A;  4FXG C;  1GUW A;  2F0F A;  1C8C A;  3RD4 A;  1EU4 A;  1H9R A;  1S5F D;  2F0L A;  2QKI C;  1ZYR D;  4HR7 B;  4DF7 A;  2WP8 J;  2DNC A;  4ID6 A;  1E2V A;  1EEI D;  1JR0 D;  2A68 D;  3H09 A;  4S3S A;  1WTO A;  3J7Y W;  4A93 B;  4Z9C B;  3MFG A;  3UI2 A;  5EPJ A;  1UEA B;  1Y8N B;  4WJW A;  2WAC A;  4A3K B;  2AWO A;  3HZX A;  1EY0 A;  4V0B A;  3S17 B;  3IAY A;  2K28 A;  3DWP A;  5JJZ A;  3E0J A;  1F2Z A;  5CV9 A;  4A3G B;  1BBX C;  3W3A A;  2K5D A;  1G6Z A;  5FO8 B;  2JP1 A;  3PO3 B;  2E2H B;  5EKK A;  1W6K A;  4ILW A;  4H13 C;  1HUM A;  3V05 A;  2FMC A;  3W2D A;  3EQL C;  1YNN C;  1PFN A;  2EYJ A;  2B2W A;  3VYU A;  1FD7 D;  1V1P B;  1QE6 A;  2JE6 I;  2BA0 A;  2EY2 A;  3C1E A;  4G7Z C;  3TME A;  1SAP A;  2BCO A;  5I6Y A;  2XSC A;  1CZW A;  1PFM A;  4ABN A;  2C5C A;  2R61 A;  3I70 A;  5JPM C;  1HPC A;  2GA4 B;  2EZV A;  2F0Q A;  1JOR A;  4DNT B;  3OIQ A;  5DNF A;  4HSV A;  4QMG A;  4C2M B;  1Y1V B;  3CQZ B;  2PQE A;  5C3X A;  4DN4 M;  2LMC B;  2B2Y C;  3WDN A;  1EEF D;  4A3M B;  3Q22 A;  1B3A A;  3FRP B;  2XNA C;  1EOT A;  3I73 A;  3VA5 A;  1EQV A;  3OSO A;  1JB3 A;  1DOK A;  5D3I B;  1HXY D;  4K5V A;  2J0T D;  1EQT A;  3MFY A;  4WOR A;  3RMH A;  4EQN A;  5C5L A;  1SYC A;  2XWB B;  5EQ0 A;  3HOW B;  1F9R A;  1E2W A;  4KY5 A;  5FLX E;  4F87 A;  4R9W A;  1LTA D;  1NUC A;  4L6T B;  4X3K A;  1X32 A;  1I6V C;  1CA5 A;  4EQP A;  3HOU B;  4IFD J;  4G7H C;  4K2K A;  2OF1 A;  3GD7 A;  3WOE A;  3DMU A;  4R8I A;  2A6H C;  3L3O C;  5CBA E;  4FP5 D;  1D5M C;  2EYF A;  3PUZ A;  1HQR D;  2I46 A;  2MUY A;  4R8N A;  5ELD A;  2VB3 X;  4OGQ C;  3J81 L;  1IYV A;  2MGS A;  2NUC A;  2ENB A;  3DWA A;  1VMP A;  3SHL A;  5A2Q L;  4GZY C;  3D3R A;  1EYD A;  4H44 C;  2F0W A;  3NE5 B;  2HDL A;  4XQN A;  1JCK B;  1ET9 A;  3OPO A;  2M00 A;  2D2C C;  2F0P A;  4IUR A;  4KHZ A;  4PMC A;  1XXG A;  2R93 B;  3EA6 A;  4KJN A;  2A69 C;  4F7X A;  2VXW A;  3PUW A;  1DM0 B;  2DN8 A;  1GUS A;  2XVS A;  1VDZ A;  3BDC A;  1PRT C;  3VYS A;  3I3C A;  2E2D C;  3QIA A;  3HG9 A;  1SNQ A;  1FNW A;  5CBE E;  3U9O A;  3CKI B;  5CV4 A;  3GTG B;  3C3L A;  3NPP A;  3KBG A;  2EY5 A;  3IFD A;  3AMU A;  2BE5 C;  1Q8I A;  5COR A;  4BBS B;  1OXU A;  2AQ2 B;  2KEC A;  1KDC A;  3K7A B;  1DOM A;  3V96 A;  1F9S A;  3GV3 A;  5TSS A;  4H0L C;  3A56 A;  3VYR A;  2IX3 A;  1STY A;  1PFB A;  3Q0A A;  5IOC A;  1JOO A;  3LWE A;  3MXU A;  5C0X I;  3J80 E;  4KY6 A;  4IQZ A;  4KHV A;  5E4W C;  4UDU C;  2B2T A;  4NKL A;  2AUJ D;  1NR2 A;  3CRL C;  5C0X H;  1FNV A;  3MAQ A;  4Y7N B;  2PZT A;  1EU3 A;  4IUU A;  4NP5 A;  5EBC A;  1F77 A;  5C44 B;  5KEE A;  5LHY 1;  3NTH A;  1B1Z A;  3MXP A;  1CHP D;  4EQO A;  2NN6 G;  1DOL A;  2B2T C;  5K5P A;  3A7A B;  3M85 A;  4KMU C;  1QOH A;  2Z4H A;  1QNU A;  4CKB A;  1SJH D;  4XIG S;  1B50 A;  3K5N A;  2I07 B;  4PMB A;  2L9H A;  1QCB D;  1GXD C;  3OIP A;  2A69 D;  4ZUI A;  4BBR B;  2JA8 B;  2F3W A;  4A3B B;  4RKL A;  5ELF A;  1PRT D;  1MSH A;  2JA7 B;  1XWE A;  1FR3 A;  2FIN B;  3I90 A;  3J7A V;  4CKC A;  3I4N B;  4G4K A;  5CV7 A;  1FGB D;  1PMR A;  1GUG A;  2B2V A;  2RDH A;  3MTS A;  3URY A;  1LO5 D;  3BS1 A;  1IYU A;  3NK9 A;  3GTL B;  1NAP A;  5J1Z A;  1NR4 A;  4C56 C;  4OO1 G;  2B8F A;  3S1R B;  2OXP A;  3LX0 A;  1A3V A;  1U4R A;  4KI0 A;  1KNE A;  1IW7 D;  3GTJ B;  2K05 A;  1LLR D;  2HDM A;  4KD3 A;  3L9A X;  2IPK D;  5KYI A;  2RDG A;  2IT1 A;  3BDO A;  1PXU A;  5JVH 3;  3DWQ A;  4KD4 A;  1PRT F;  1LV9 A;  5M5W B;  2RSN A;  4F88 A;  1SE2 A;  2R6G A;  4X3S A;  2JYO A;  3PO2 B;  5LL6 X;  1D2B A;  1BUV T;  2QEJ C;  1PRT B;  2HCC A;  2B8G A;  1EY6 A;  2PW5 A;  4U67 3;  3O13 A;  1CFM A;  4IN3 A;  4PMW A;  2R7Z B;  2K6A A;  1HA5 A;  2F0K A;  1S4Z A;  1KDA A;  1HRJ A;  1QJO A;  5FOB B;  1ESF A;  4X3U A;  5IOD A;  1WCM B;  1STE A;  1SMY C;  3KBX A;  1SNC A;  1JWS D;  3NQI A;  1A3T A;  3QOL A;  1EL0 A;  4J8Q A;  2JA5 B;  4JBW A;  2F0D A;  2Q8T A;  4KN4 C;  4FF3 A;  4KKU A;  1SBB B;  1KLU D;  2A73 B;  2RVL A;  1NSN S;  5E3F A;  3SE0 A;  5ELC A;  1CZG A;  1JIC A;  3EVQ A;  2QIL A;  2F3V A;  2WII B;  4KV6 A;  2NVY B;  3Q6S A;  3NTK A;  2F0V A;  2SOB A;  4K14 A;  4J6H A;  2Z4I A;  3NWT A;  2FFK B;  2LS0 1;  1EIH A;  1HQM C;  2OEO A;  1LT6 D;  5D3D A;  3J81 E;  3N52 A;  3S1Q B;  5EKL A;  1STN A;  5DM7 3;  1D1K A;  1MSG A;  2BOS A;  5HGT A;  1JE4 A;  1GHK A;  5A2Q E;  1TVX A;  2O2L D;  1YNJ D;  4LJZ C;  4BY1 B;  4I7Z C;  1LTS D;  2C9O A;  1B9M A;  5IGD A;  2CHB D;  1BO0 A;  1H9J A;  1SYD A;  1TY2 A;  1QWY A;  2X6G A;  3LWU A;  5COY A;  1C4Q A;  1VF7 A;  3KF8 A;  5K36 H;  2LY7 A;  1KLG D;  3U9S A;  2E76 C;  1G2T A;  4RCO A;  3QJY A;  1SMY D;  4OIK A;  2F0E A;  5EJW A;  2F0G A;  2NYZ D;  3TSS A;  1H9K A;  1TT2 A;  2L55 A;  2F03 A;  4XT1 B;  4DNR B;  2K1B A;  2AQ1 B;  1VF5 C;  3DEP A;  4N9T A;  3TZD A;  1PZJ D;  4K8J A;  3T4A C;  1R4Q B;  2D9U A;  4IUT A;  3OW7 A;  1V43 A;  4C1N I;  2WIN B;  3VR5 A;  2FJ2 A;  1E2Z A;  1G8Z D;  3PUX A;  2V4D A;  4NMZ A;  2F1M A;  4YIJ A;  4CJ2 C;  4KN7 C;  3VR4 A;  5CMD A;  2HUG A;  1OO9 B;  1TS3 A;  3HS0 C;  1WD0 A;  2JA6 B;  1CHQ D;  1IKL A;  1PZI D;  3HRZ C;  2RDF A;  4XYO A;  2NZ1 D;  4WFN 3;  3GTQ B;  2WKD A;  1BQQ T;  3T53 B;  5DAU A;  1EYC A;  3T16 A;  1Q1B A;  3VR2 A;  1MD2 D;  2PZU A;  4XT3 B;  1WTX A;  4C1N K;  1LTR D;  3S14 B;  1SEB D;  2LKV A;  1K83 B;  4PNY A;  4RGT A;  3BVG A;  3M4Y A;  5EPK A;  1PTO H;  2B2W C;  5JVG 3;  4J1M A;  4ZKC B;  3HOX B;  3VR6 A;  3L7Z C;  1BCP C;  3NBI A;  1AP0 A;  3A54 A;  4K2L A;  3DEO A;  5AFW A;  5K36 G;  2X6L A;  2SNM A;  2RKS A;  5JAV A;  2BA1 A;  1IHZ A;  5I4D A;  3NHH A;  4HMI A;  2B63 B;  2QDB A;  4RCN A;  3HOY B;  3TZU A;  4OIJ A;  3R2T A;  3MWY W;  1JOK A;  2L11 A;  1WTW A;  3HKZ B;  1AEX A;  3GTK B;  2IJ0 A;  3HP3 A;  5CV6 A;  3VA7 A;  2H1E A;  1I3Q B;  3TDQ A;  3P7J A;  5G3L D;  1AFP A;  2TMP A;  1PTO D;  1TR5 A;  5I2X A;  3IL8 A;  1I4Q A;  2XRS D;  1EY9 A;  3E6Z X;  4M1U B;  4DGZ A;  3H0G B;  1R4P B;  3DUZ A;  3TN2 A;  3H6M A;  2YU9 B;  2N55 A;  2KJX A;  1II3 A;  1RJT A;  1A2U A;  3BYY B;  5KGU A;  3VR3 A;  1GUO A;  1PDQ A;  3KK7 A;  2Q8I B;  3SK8 A;  4JK1 C;  4CJ0 B;  4FO2 A;  1LAB A;  3A8I E;  3D4W A;  4K5X A;  3D6W A;  3DHQ A;  4XTC S;  4RA8 A;  1A15 A;  2R3Z A;  2F0N A;  2RQX A;  5IGE A;  4OHJ A;  4C3I G;  3P1H A;  5EBD A;  3WOF A;  1BCP D;  2EYO A;  3ONA B;  1EY8 A;  2O5I C;  1RDP D;  3PV0 A;  2FMM A;  4ZK9 B;  5I9O A;  2F0O A;  5J39 A;  5C0X J;  3QB3 A;  5G3L F;  1CI3 M;  2EY6 A;  1PTO F;  3CHB D;  1CQV A;  3FKI B;  4OL7 A;  1SND A;  1O7Y A;  1PZK D;  2XN9 C;  2KUM A;  4QF4 A;  1PTO B;  4C3I B;  1JWU D;  3N6R A;  3KUP A;  1SFO B;  1CTM A;  3FVQ A;  1T5E A;  4A3D B;  2NTS A;  4QUF A;  1F9Q A;  2E75 C;  3SR1 A;  4FF2 A;  3NQT A;  4RKB A;  1X3P A;  2O5J C;  1QG7 A;  5ISR A;  2ZT9 C;  3NTI A;  2WB1 B;  3GTO B;  5I6W A;  4E6I A;  2K7V A;  3V2T A;  1H9S A;  1HUN A;  3I4L A;  5I2Y A;  3TP5 A;  1IW7 C;  1TU2 B;  2SDF A;  1BCP F;  2IWH A;  1O78 A;  3M4O B;  5EGT A;  2JEA I;  5DEH A;  2NBF A;  3JAM L;  1B53 A;  3OWF A;  4Q0F A;  1LT5 D;  4K8I A;  3QOJ A;  4HCS A;  4I65 A;  2FHT A;  1DZ1 A;  4RAU C;  4CHT B;  1ILQ A;  1BCP B;  1XX8 A;  4IUQ A;  1I4R A;  1LTB D;  3K57 A;  1RTN A;  2B2U A;  3FEW X;  3SK4 A;  4ODG A;  5D65 A;  3KLS X;  3KLS A;  3K58 A;  3J7A F;  5CC4 A;  1CK1 A;  2Z8L A;  1TWF B;  2J7Z A;  3GO5 A;  2PO4 A;  3S16 B;  2Q8R E;  3K5O A;  1K8O A;  4QB4 A;  1EIG A;  2EE1 A;  1SYF A;  2PW7 A;  5JEA H;  5IGC A;  1RD9 D;  2PNR C;  1EZ8 A;  5M9O A;  2B39 A;  2LFN A;  2NWG A;  3GP7 A;  5J22 A;  1G29 1;  2RSO A;  1KDB A;  4TQU S;  4G7O C;  1EWH A;  5FK9 C;  1UUP A;  4DXF A;  1ZEQ X;  2EYM A;  3D31 A;  2BDN A;  3EFX D;  4IUN A;  2F0M A;  4BA1 I;  3H3V C;  5ELB A;  3T56 B;  4N9P A;  4DAP A;  4F8M A;  3R2I A;  1Y8O B;  2N88 A;  2ICI A;  2EPB A;  2KOL A;  3I72 A;  3NP8 A;  4K5W A;  1M8A A;  1RKN A;  2EJF C;  4QIW B;  2B2V C;  1CT1 D;  5LL6 S;  2PYK A;  2XRQ D;  1S5C D;  3SXH A;  3I8Z A;  5KNB A;  3P75 A;  2F0S A;  5CV8 A;  3HOV B;  3S2H B;  5C0X G;  1TWH B;  2EJM A;  1TWA B;  2YYZ A;  3M7G A;  2QF7 A;  3I4M B;  4RHR A;  1STB A;  1WD1 A;  4LK1 C;  1QB5 D;  1SE4 A;  2K03 A;  2L12 A;  2E2I B;  3DM1 A;  1HHV A;  1O7Z A;  1H9M A;  1QIL A;  1JC7 A;  1R9T B;  3IKJ A;  5D14 A;  3FPU B;  1AZP A;  1YNJ C;  2OT2 A;  5JEA G;  4FXK C;  2L1B A;  3BG3 A;  4RH6 A;  1SE3 A;  5CV5 A;  3AB9 A;  4BA2 I;  1PYW D;  2L5T A;  3X3N A;  2L0C A;  5E1F A;  1B2T A;  1OXX K;  1VCI A;  1KAB A;  4TKO B;  1IKM A;  1L0Y B;  2RA4 A;  3FDT A;  2D5D A;  5KIX A;  3BDL A;  3QWN A;  2JEB I;  2J4X A;  5HUR A;  1WTP A;  4DAY A;  3HOZ B;  2VUM B;  2SEB D;  3G7L A;  5C3E B;  1SSO A;  2DNE A;  4CBV A;  5IGG A;  4CKE A;  1SNM A;  5E4X A;  1H9S B;  1WTQ A;  3OWE B;  3PUY A;  4FNF A;  2K01 A;  4DFA A;  3IFT A;  3GQB A;  1SYB A;  3T51 B;  4HN7 A;  4BS9 A;  4DU9 A;  1LT3 D;  3H91 A;  1ENC A;  1HCZ A;  1LTT D;  1MI2 A;  2A6E C;  1ZKO A;  1TY0 A;  4DK0 A;  2K33 A;  2KCC A;  5CYU A;  2H4O A;  2X69 A;  3RLF A;  5T1G A;  5A35 A;  1AW7 A;  3OMC A;  1M4V A;  1V8Q A;  3MVV A;  5KND A;  1BNZ A;  3HEJ A;  4ZLT F;  4MN3 A;  5JOB A;  1AZQ A;  1ML0 D;  3P20 A;  4M8A A;  4XQJ A;  1MGS A;  2ZXP A;  3TP7 A;  1KNA A;  1T5X D;  2WKC A;  1S5E D;  3TP8 A;  1WTV A;  2HCI A;  1S5B D;  3K6O A;  3MC0 B;  2M9V A;  2SNS A;  4EVO A;  3M3Y B;  4BY7 B;  4FF4 A;  2NVQ B;  4IUP A;  3NXW A;  1D5Z C;  2KHS A;  1O7L A;  1JOQ A;  4X3T A;  3H94 A;  2IL8 A;  3MXG A;  3BZD B;  1EY4 A;  2QCP X;  5I9P A;  5NUC A;  1DYQ A;  5DM6 3;  3D8G A;  4ULL A;  1D5X C;  1TS4 A;  2IX0 A;  1D6E C;  4IUV A;  3RUZ A;  4B08 A;  4HED A;  3C46 A;  2K5W A;  5CGK A;  2KED A;  3JAM E;  3D6C A;  1PTO C;  3T13 A;  4AYB B;  1JWM D;  5C6A A;  1G2S A;  1Y1W B;  5BN5 A;  3SK5 A;  1OXT A;  1Q3L A;  1RHP A;  3RZD B;  3S9W A;  3QG1 A;  2A6E D;  1F9P A;  2TSS A;  5C3W A;  4IAL A;  4FVM A;  4XYQ A;  1ESR A;  1XTC D;  4C3J G;  1ENA A;  2PZW A;  2ZXR A;  1STA A;  3S1M B;  1CM9 A;  1XYI A;  4XDX A;  1G91 A;  4XXE A;  3A55 A;  2CQA A;  2F4I A;  2Y0S B;  4IZ8 A;  3A8K E;  3Q23 A;  2K32 A;  1Y8P B;  4PV1 C;  2PPB C;  1Z6H A;  3DXJ C;  4RFB A;  5FO9 B;  2Z1C A;  5ELE A;  2KEE A;  4C3J B;  3K0Y A;  1ILP A;  3NBH A;  3MEH A;  1I6H B;  1U4M A;  2RBM A;  2A74 C;  5IT9 L;  1Q12 A;  1DCZ A;  2MJ8 A;  4G57 A;  2B2Y A;  5BN4 A;  5C4H A;  1AN8 A;  2A5H A;  3PMF A;  1EY7 A;  4KKT A;  3MZ5 A;  1TWC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...