3NQTA

Crystal structure of staphylococcal nuclease variant delta+phs v66a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nqtA00
5I9OA 4KV6A 4G57A 4NP5A 1A2TA 1SYFA 4K2KA 4K5WA 2HQEA 3D6CA 2KQ3A 2F0WA 5EKLA 1EZ8A 2OEOA 2RKSA 3ERQA 5C3XA 4IZ8A 1STBA 5CV6A 2F0HA 4KY7A 1EY7A 5E3FA 5KRUA 1EYDA 2SOBA 4J6HA 3TMEA 3SK8A 3SK5A 3T16A 4LAAA 2F0OA 5KYIA 1EYCA 3MHBA 3HEJA 5CGKA 4IUNA 3D4DA 5J1ZA 1STAA 1II3A 1JORA 1SYEA 5IIFA 2QDBA 2RDFA 4ODGA 1EZ6A 3PMFA 3E5SA 1JOKA 1KABA 3BDCA 4QMGA 1TT2A 2F3WA 2OF1A 3SK4A 4E6IA 1EY5A 5I9PA 5C6AA 1KAAA 5HURA 3D8GA 5CV4A 5CV9A 4IALA 4NDXA 4WRDA 2WACA 4DU9A 2EXZA 2M00A 4DGZA 5I6YA 4RKLA 5IGBA 3NP8A 3OMGA 2EY6A 4N9PA 1F2YA 2F0PA 3MVVA 4K8JA 1STNA 4KD3A 5DAUA 3SR1A 3TP8A 3DHQA 1EY0A 4HMIA 3EVQA 4PMCA 1A2UA 3RUZA 1SYBA 3TP5A 5IGEA 3HZXA 5IGDA 5KIXA 3LX0A 4ZUIA 3TP6A 4N9TA 3QOLA 5F2DA 5C3WA 3OMCA 4I65A 5IGCA 4QF4A 1EY6A 2F0UA 2ENBA 2PZUA 1EQVA 4ZQ3A 5KGUA 3MZ5A 3SK6A 1F2ZA 5EGTA 2F0KA 2PZWA 3S9WA 5CC4A 4QB4A 1SYGA 2EYLA 4DF7A 3NUCA 2KHSA 5M9OA 1NUCA 1STGA 1SNDA 5C4ZA 2EYOA 1TR5A 2EY5A 2EYPA 1IHZA 4ID6A 4KHVA 2EY2A 4KY5A 4DFAA 5KYLA 2F0NA 2F0EA 2F0TA 4K5VA 4ME5A 5EKKA 3V2TA 1RKNA 2F0FA 1SYDA 4KD4A 1STYA 2F0LA 5IGFA 1SNMA 1U9RA 2SNMA 2F0QA 2F0VA 1F2MA 3C1FA 4J1MA 4HTHA 3EROA 1NSNS 2EYMA 3QB3A 4NKLA 1KDBA 2F0SA 2LKVA 3BDLA 2F0DA 4RKBA 5IGGA 3EJIA 4KJNA 2EYFA 2EY1A 5CV8A 5J22A 4KTAA 5JAVA 4KY6A 1TQOA 4F8MA 1KDCA 4K8IA 1EY4A 3C1EA 3VA5A 4EQPA 2PW7A 5HGTA 3R3OA 1SNPA 5K5PA 2RBMA 4OL7A 1ENAA 1SNOA 5CR3A 4MIUA 1SNQA 3QOJA 2O4XA 2SNSA 4PNYA 3P75A 3ITPA 3DMUA 4TRDA 2PZTA 2F0MA 1EY8A 4PMBA 3SXHA 3OWFA 3H6MA 5CV7A 2EYHA 4ZUJA 5DEHA 4KJOA 5C4HA 2PW5A 3MXPA 5JOBA 1KDAA 4HMJA 4K14A 4S3SA 1JOOA 3P1HA 5IOCA 1A3TA 3OSOA 4YIJA 3SHLA 5NUCA 1A3VA 1SYCA 1AEXA 2F0GA 4H7BA 5ISRA 2F0JA 5J39A 2PQEA 4K5XA 3D4WA 5E1FA 3TP7A 4WORA 1EYAA 4NMZA 1EY9A 1STHA 2EYJA 4K2LA 4B9XA 4EQOA 5I6WA 4K6DA 4F7XA 2PYKA 3NK9A 1JOQA 3NQTA 1SNCA 3NXWA 2OXPA 4B9WA 2F0IA 1A3UA 3U9OA 3NHHA 4R8NA 4EQNA 2F3VA 5CV5A 3T13A 5C5MA 5C5LA 1ENCA 3MEHA 5KEEA 4EVOA 5IODA 2NUCA
chains in the Genus database with same CATH superfamily
5JJKA 3I73A 3M7GA 2MO0A 3H0GH 3G71A 3MXUA 1HQRD 3GTPH 4DR2L 1YHQA 2ZTCA 1NMFA 4TKOB 1UE5A 1LTID 5K36G 2MQHA 4FNFA 3J80c 2EJFC 3LWUA 4UY8C 1UEBA 1XJVA 3E6ZX 1FJGQ 4A3CH 4C3JH 3NQIA 1L2FA 4IUUA 1B53A 3DM3A 3E0EA 1X9NA 3ICEA 4JI1Q 4A3GB 1UUPA 1SYBA 4DK0A 1STEA 1BUVT 5IGCA 1EQTA 2N49A 3TRZA 2E5LQ 3BYYB 1EQVA 1CUKA 1PDQA 1F2ZA 2AQ2B 2EVBA 1E1TA 4BBRB 4LUZA 3K59A 1SYGA 1V9PA 5A2QL 2NWGA 3Q8DA 4DV0Q 2RQXA 3CQZB 3J81c 1HUNA 1E2ZA 4K5VA 2F4VQ 3K5LA 2B63G 1RKNA 4AQYQ 4FO2A 3K5NA 3M3YB 2BH8A 1F2MA 3EROA 5D65A 1VQEA 3FP9A 1SE4A 1SFOH 3HOYH 1F9PA 4HSPA 2EY1A 5I2XA 2B2UA 4Y7NB 2CH4A 5C4XB 4OL7A 1PTOC 1BQQT 4MIUA 1CZGA 2BE5D 1NMGA 2O2LD 3VA7A 3I4NB 4BBSH 4TRDA 2WIIB 2BA1A 2YYZA 1KDAA 5GADC 5GAHC 1R4PB 4R4OA 3HKSA 3N52A 5GROA 1JICA 2A8VA 5M5YH 3BYTB 3OTOL 2NVTH 4A3DB 3TEHB 2VQFL 1QCBD 3EBEA 1HXYD 4BY1B 3U58A 3I8ZA 1CTMA 5A35A 2XSCA 1I94L 2F1MA 3U50C 1MSGA 1DM0B 4MN3A 4DV2L 4JI5L 4G57A 3F2CA 3NTIA 2JA6H 4JBMA 2BA0A 1C7YA 4RMFA 1Y1WB 2JA5H 2RCNA 3SK8A 5KYIA 4KHPL 1UAPA 4GS3A 1F77A 1CQVA 1MSHA 2ZT9C 5IT9E 2AUKA 2G9HD 4JI6Q 1BVSA 1PTOD 1JJGA 4LF7Q 5HURA 2JA8H 4LFAL 2VUMG 4CKBA 2R7FA 4OEMB 4A3LG 5IWAQ 1EWHA 4HMIA 5IE8A 1A2UA 4IUVA 3NELA 5EKIA 3LX0A 4A93H 3F2DA 4A3BB 1DXMA 3S1QB 2A1AA 4HIDA 2FJ2A 2K7VA 2PZUA 4R9WA 4DV4Q 2N8NA 2NN6I 4FF4A 3Q24A 1NUCA 2VB2X 1EWIA 3PCOB 1I4GA 4JI2L 3DWAA 2F0LA 4DV1Q 5HY6A 1KDBA 4OO1I 2UUAQ 2F0DA 4B3RQ 1KHIA 4KJNA 4YWMA 1N32Q 1TQOA 5C3EG 4U68A 5K5PA 4KLKA 2XNAC 3NSWA 1BO0A 1JCKB 1NR4A 4J8QA 1WCMB 4FXDA 1VCIA 2NN6G 1PZID 5FO7B 3U4ZA 1Y8OB 1B1ZA 2XGTA 4L6TB 3SE0A 2NZ1D 2N55A 4LF9L 2LFNA 4RH6A 1YJ9A 2L15A 2ZJPA 4P74A 1LV9A 4YIJA 3WWVA 4RGNA 1RDPD 2M9VA 4IUTA 1VQCA 5FJ8G 1C4QA 1B3QA 4OO1G 2Z0SA 4FF2A 1G6PA 2R3ZA 4PZ7A 3T1YQ 1JE5A 3I2ZA 5I6WA 4EQOA 1SJHD 2K5VA 4F7XA 3RD4A 4JOIA 3CCRA 5A2QE 1UEAB 1TWAH 3DXJC 2NZOA 4NXML 1C0AA 1G2TA 3H3VC 3SGIA 1IL2A 2BDNA 4K5WA 5M5XH 3K5MA 1HCZA 1SJED 2KQ3A 3OWEB 3GTLH 3TS2A 1PMRA 4YY3L 3I4MG 4HJ8A 2YV5A 3IRBA 3HRZC 2K75A 2QKIC 4A3JB 5COYA 2Y0SE 1K9MC 3DM1A 3MHBA 3H09A 1CI3M 3S2DB 5J1ZA 2IX3A 1F9QA 1EOVA 4AYBG 5LMNL 3BDCA 3S2HH 1CFMA 2F3IA 4CGYB 2DJGC 2Q8IB 3J80L 1HR0L 1WFQA 2B2VA 3BZKA 5CV9A 4NDXA 1RJTA 4R4IA 1HJPA 4DGZA 3ND8A 4FP5D 1PH2A 5IGBA 1H95A 2EY6A 1PYWD 1OXVA 1DD2A 3DHQA 3KBXA 4PMCA 1UWVA 3TP5A 1Y1VH 3PGZA 1QNUA 4GNXB 3RZOB 1YNNC 2LY7A 1N9WA 3TN2A 1VQHA 2ENBA 2ZTEA 4JBKA 1FVIA 4IN3A 2DJFC 4HR7B 1X32A 1XMQQ 2Q2HA 1XNRL 1EIHA 2UU9Q 4KHVA 4OIJA 3PO2G 2LXKA 3HKZB 3PO3G 4LUOA 3JC66 4ZCKA 3J7A5 3J81L 2IWHA 3ER0A 4HTHA 1N34Q 1X6OA 3QJYA 4CJ1B 1YHBA 3J7ZC 4V0BA 1SE2A 1VQFA 2MHVA 4DUZL 4V190 1Z6HA 3PUZA 1CKNB 1ENAA 2KHIA 4GLAC 1H9JA 1T9HA 4IJHA 4IPGA 2B2UC 2HUGA 4BXXH 1TIID 1X54A 4QJFA 3SXHA 4GNXA 4RA8A 2KECA 4RCNA 1U4MA 3MFGA 4OWTB 2XVSA 4LUVA 5ELFA 1AE2A 1X3FA 3CCUA 2ZXRA 3L7ZC 3I4MH 4A3IG 1T5EA 1K73C 2F0JA 4KKUA 1XWEA 3BVZA 3FKIG 1YNND 1PH4A 2J4XA 4HIMA 5ELNA 1IBLQ 2F0IA 2MJ8A 1F2LA 2LMCB 3F8TA 1CKNA 1N33Q 1M90C 2K6AA 1SFOB 5EKLA 1DCZA 1EZ8A 2WAQG 2CW0D 4EQ5A 1A15A 2A69C 2F0HA 2MO1A 3STBC 3VYTA 2DN8A 4Z9CB 2FMMA 1PRTB 4J6HA 4C3IG 1VQOA 1NNXA 1M1KC 2I0QA 2DGYA 1E0BA 1B70B 1GO3E 5FLMH 4ZAIA 5KNCA 3PO2H 3SK4A 2OQKA 4I7AA 4CHTB 1KAAA 3CMEA 1HNWQ 5TSSA 2JA7H 4DNRB 3K7AH 4LF5L 2PI2A 5EPJA 4GLXA 4N9PA 1EY0A 3R2TA 1IKLA 3RNUA 2BOSA 3HZXA 4TVAB 2IL8A 2KA7A 3U9SA 4C2MH 3K7UC 5T1IA 1HNZL 2NVQB 1P8LA 1B9MA 3G7LA 5EGTA 1K8OA 4X62Q 4DF7A 3J81j 1SNDA 2EYOA 3GTGH 1JQYD 3FHWA 5FO8B 4A3FG 4YHHL 3HOZG 1X3GA 1VQ8A 1FD7D 3RN5A 5C44H 1JMCA 2SNMA 2QEXA 2IX0A 3CC4A 1I3QH 4RHSA 1L0XB 1JJ2A 2R92H 3KOJA 5IGGA 4LW1A 1B7YB 5CV8A 5JAVA 2OTLA 3K8AA 4K8IA 2UUCL 5HGTA 2JQOA 5M3MG 2C9OA 4PNYA 4C56C 2A69D 1IL8A 3L0OA 4DKAC 3HOVH 1CKOA 2B63B 4PMBA 3E3XA 3OWFA 5CV7A 3IFDA 4ZUJA 1PTOF 3I55A 5H1SE 1VQNA 5C4JB 3J80E 4L5TA 3MAQA 1RHPA 2ZM6L 4DR4Q 4FXKC 4DR1Q 5BN4A 5JPNC 1V1QA 3UDFA 4B3TL 4C3IH 3I4OA 2K04A 4TSSA 2Q8TA 4RG1A 2HD3A 3D4WA 1XNQQ 1I4QA 5E1FA 1EYAA 4X65L 1IBKQ 2EYJA 1N36Q 1J5EL 4O0AA 1EWCA 3A5ZB 3NXWA 1BDOA 3HOUG 2NVXH 4EQNA 1E2VA 1TVXA 3T13A 1WTOA 1QNKA 2IHFA 4GKJQ 3GDEA 1TU2B 1VQ7A 4JOIC 2MUYA 3RZDB 3D6CA 1HFGA 3J81E 1W3SA 2ZXOA 2Z4HA 2J7ZA 2RA4A 4LFCL 4DR6L 1EYDA 3CCEA 2B8FA 5GAEC 2G9DA 3HEJA 4A3MG 1QJOA 5CGKA 1YIJA 1CZWA 2A5HA 4IOCA 2I5HA 2FXQA 4QMGA 1I6VC 1YJNA 3I7FA 3A56A 1V8QA 2TSSA 5M3FH 1Q82C 5CYUA 3VYRA 4KD3A 5LHY1 2B2VC 1FL0A 3EVQA 1TKWB 2IPKD 1LT3D 3QOLA 5M3MH 1CKMA 1EY6A 4JC0A 5IP9H 3MXNB 1HRJA 3D6WA 1KQSA 2K03A 1X55A 3AB9A 4P75A 2HIXA 1IHZA 4JV5L 1CT1D 2VUMB 3Q22A 3F2UA 1IBML 1SNMA 2R7ZH 4DR7Q 2F0QA 1ASYA 3C1FA 4C3HG 1BR9A 1PH5A 3C46A 4FF3A 1J6QA 1GJXA 4B3SL 4BWGB 1GUTA 3R2IA 4IOAA 4CDCC 2D0PA 3RLFA 2HQLA 4QGUA 3V05A 3UDGA 3CCVA 5BR8L 4XYOA 1O7IA 1LTTD 4HJ9A 4GLVB 2WP8J 1KC8C 4GN5A 4A3CG 4KN4C 1SE8A 1HNXQ 2CFMA 4GNXC 3MXNA 3P1HA 3A55A 2K14A 1I6HH 4XQQA 5C3EB 2UXDQ 1RTOA 1MI2A 3VR6A 3T56B 4AH6A 2Z1CA 1NTGA 1VMCA 4JI1L 1YI2A 5DLQE 3GQBA 2R6GA 4X64L 4JCVE 1VQLA 1NAPA 4K2LA 1VQMA 5JPMC 2PYKA 2JE6I 2E5LL 2K52A 4DR3Q 1SNCA 4DXFA 3VR4A 2QA4A 2YU9H 3CC7A 2B39A 4UHVA 5CV5A 4NXNL 2HT1A 2K32A 1EFID 4OX9Q 1O7YA 2CWPA 2MNAA 2RKSA 3ERQA 3OOCA 5C3XA 5BN3A 2C35B 2CQOA 3PIOA 3HOYG 1CSQA 2KJXA 2SOBA 3SK5A 4LAAA 5FLXL 2PMZE 3W1BA 1EFWA 3PSIA 1EZ6A 3E5SA 4DK3C 1JOKA 2N3SA 2OF1A 2Z6BA 2JSOA 4X3SA 2VXWA 3I4MB 3NP8A 3DWPA 1STNA 4JI3Q 3GTOB 1KNAA 1BOSA 3VR2A 2A6HC 5KIXA 4WJ4A 3KBGA 1O7LA 3ND9A 4QF4A 1O7ZA 3MZ5A 1VQ6A 3P7JA 2VNUD 2H4OA 5CC4A 4A3EB 3GTMB 3SVMA 3M4OB 3NWTA 4A75A 3RMHA 4OONA 5EKKA 1QVGA 2YTVA 3PUVA 1SSOA 1XXGA 4Y52H 1GUGA 1PRTC 3D3RA 1WTQA 3KJPA 2PPBC 1TWGB 1GD7A 2JA6G 3GTJB 3R3OA 2I07B 2JA5G 5E4XA 3PO3B 1SEBD 1EY8A 1CHQD 3H6MA 4CJ2C 2Y0SG 1SBBB 4ILWA 2E2IH 1LTBD 4S3SA 2IJ0A 2JA8G 1HZCA 3S1RB 4LF7L 2WINB 2GVAA 3S1NH 3GD7A 2F0GA 2R93G 4GOPB 1TWFB 4K0KL 3HOWH 5J39A 2HHHL 4A93G 1RD9D 4G7HC 2BH2A 1X56A 2A6HD 3AMUA 5EAYA 2E2JH 3BZDB 3GTKH 1EQQA 3G48A 4F87A 4JI7Q 2NVYB 4JYAL 4R8NA 1VQGA 2SDFA 1ESFA 1FNVA 2DNCA 4A3IB 3I90A 1HUMA 3QWNA 4IZ8A 4MTNA 4LF6Q 3UDXA 4R4QA 2B29A 1PRTD 4DV3Q 3FKIB 4QIWE 5JJIA 4XIGS 1N32L 4UPAA 1BBWA 1TY0A 2UXBL 1MJCA 5M5WB 1LTSD 4GOPA 2UXCQ 1WI5A 2QCPX 5C6AA 2EQSA 4H02A 4ULLA 1HZ9A 4WRDA 2WACA 2KHJA 2WAQB 4LFBL 3CU7A 4G7ZC 1TY2A 1DONA 3S1MH 2QILA 3NEMA 2FINB 1JC7A 4C3IB 1FGBD 4LMQD 1UE1A 2E75C 3Q23A 5CBEE 1D6EC 1Q12A 2K33A 3S15H 1WD0A 1X3EA 1H9SB 3T1YL 1R9TH 1PTOH 4DFAA 3GTQH 4HJAA 4KD4A 4FDBA 1Q86C 3M9BA 1NSNS 1EIFA 3S17H 2R93H 3UDIA 4IFDH 2F0SA 2IY5B 3EJIA 1SAPA 2VB3X 1TWHB 3RLOA 3VA5A 4EQPA 1ICFB 4UAIA 4GN3B 1Q1BA 3I91A 4A3KH 4HEDA 1PH8A 2SNSA 4XTCS 4A3FB 3HOZB 5E7NA 3DMUA 1MIUA 4CJ0B 2Q8RE 1Q46A 3C2PA 2EYHA 3FPUB 4UP7A 4JI0Q 4YWKA 4DV7L 1PFBA 5JJLA 1H9SA 1IZ6A 3ONAB 3SEBA 5LMUQ 1S5DD 2OTJA 3OSOA 5NUCA 2EJGC 1XTCD 3U4VA 3HGBA 4C1NK 1Y1VG 2YTYA 1DZ1A 4GKKQ 1ZKOA 2A19A 1F9SA 3W3AA 4IJLA 1TWCH 3RN2A 2XRQD 2KCNA 4B9WA 3TSSA 4HJ7A 1NY4A 4RAUC 1XMQL 2UU9L 3D4RA 5I9OA 1K0SA 1WJJA 1TS2A 3IL8A 1LTGD 2L4NA 1LABA 3CW2C 3X3NA 4G7OC 1ENFA 1TS4A 4M1UB 3K6OA 4DAVA 4BY7H 4L63B 1EY7A 3KLSA 2DY7A 2JJQA 2K05A 4B3ML 1U4RA 5DM63 3HOUB 3HOXG 3CP0A 3PMFA 4ODGA 4BXXG 1BCPF 2UUBL 3BG3A 1EY5A 2NBFA 5I4DA 2E2HH 1IYUA 2RF4A 3WOFA 3KLSX 2EXZA 5EPKA 4KI0A 1G51A 4FF1A 4KHPQ 3MVVA 2GVBA 1QB5D 1VQIA 1C8CA 5IGDA 4A3MB 5D3DA 3S16H 4N8X1 1TS5A 4HCSA 3SK6A 2F0KA 3S9WA 3K0YA 2XWJB 3A5UA 4GN4B 1VQ5A 4JBWA 2H1EA 2I5MX 3K58A 3IFTA 4MNOA 2JA9A 4JBJA 2PNRC 4ME5A 2KVMA 1MD2D 4DAYB 2D62A 1LM0A 5ELEA 4DV6L 1JWMD 1DYQA 1Z7TA 2IW3A 3NWSA 3TREA 4LF4Q 3S14B 3CRLC 4DNTB 2FHTA 2X6LA 1SNPA 1CHPD 1LACA 3E0JA 1PV4A 3VR3A 3ULLA 3QOJA 2NTTA 3CHBD 1K83B 2KBNA 1LTAD 1UNSA 2PNHA 2PW5A 5FLMG 5JOBA 4C3HB 1HH2P 1HTLD 3FRPB 1ICWA 2G5DA 3TZUA 3H0GB 2JA7G 5IOCA 1HNWL 3GTPB 1V1PB 2IX1A 5EJWA 2L11A 1Q8KA 3CD6A 3H3VH 2K1BA 2MFIA 4DAYA 3NBIA 5IP7H 4Q5VA 1EY9A 3HOXH 3WOEA 3G4SA 5LMNW 3LGJA 4WJWA 5CBAE 3LNNA 1HR0W 4C3JB 1B50A 3Q0AA 4DAPA 4QL5A 3T53B 2A73B 3NTHA 2NUCA 1XMOL 4IO9A 1W6JA 1I50H 3A8JE 3E9HA 5IYBH 5C44G 1NJIC 1K3BC 3FEWX 4IUQA 1X3QA 2R92G 1SR3A 2E2DC 4X3TA 1L0YB 1SMXA 3TMEA 3RR5A 1RF2D 4NXMQ 1LTRD 1JORA 1V1PA 4HN7A 1H9MA 4YCUA 3HOVG 2L9HA 4IALA 1HPCA 1HZAA 1BNZA 2M00A 5I6YA 4GOPC 5IYCG 3HOYB 1F2YA 3GO5A 2CH4W 5FLXc 1YHAA 3KF6B 1HQMC 2CVRA 3I56A 4A3DG 2B2WA 4DR1L 2L55A 1Q7YC 4BBSB 5ELCA 4BY1G 1VF7A 1D1IA 2WB1E 1XNQL 1YVCA 1IBKL 2F0VA 4J1MA 4PV1C 2EYMA 1FNWA 4A3GH 5M5YB 4JI4Q 3K80C 2JN4A 2L12A 2NVTB 4X66Q 1SE3A 2EYFA 2D0OA 4WFN3 1XNRQ 1E24A 1L1OB 3CMAA 1WTXA 1PRTF 2PQAB 4BBRH 4XQNA 1EOTA 4IQZA 1Z47A 1EQRA 3BVMA 3CQZH 1EYGA 3KF6A 4DUYL 3MXPA 1KIXA 1JWSD 1GHJA 1HTPA 1IYJB 4O2DA 1PH9A 4RGOS 3M3YH 1C48A 5M3FG 3GP7A 2WKCA 2JA6B 3DEPA 1TS3A 1X65A 1QE6A 1RL2A 2JA5B 4MHEA 1B8AA 4Y7NH 5C4XH 1AW7A 4KK7A 4ZRZA 1GOZA 1X3PA 1O80A 5CORA 1OXUA 3BVGA 5IP9G 3STBD 2IHEA 2EOTA 4OELB 2Y0SB 3I4NH 2Z9HA 1JB3A 1S4ZA 4KKTA 3MTSA 2JA8B 1L1OA 3T4AC 2PQAA 1ENCA 5IYCH 1FR3A 4P2CB 1GM5A 2R7ZG 4LK1C 1YZ6A 4A93B 4LJZC 4MTKA 3MWYW 4L5QA 4A3DH 1BBUA 3A8IE 2NYZD 1LUZA 4NB3A 2OCEA 3VYSA 1JT8A 4BY1H 4ZKCB 2RDFA 1O78A 1VQBA 1BXTA 1HA5A 3KYHC 1FGUA 1AE3A 3BZCA 4FXGC 4OWWB 1CK1A 1R4QB 1H9KA 1E1OA 2KCMA 1I5FA 3OMGA 4YWLA 2F0PA 3TP8A 3I72A 1HNXL 1Y8PB 2K5HA 1NBWA 3JAMi 2UXDL 3VR5A 1RTNA 1Y1WH 4CDDC 4J15A 2PZWA 3ZYYX 3A74A 4LWCA 3FMCA 1MKHA 5C4ZA 2EXDA 5E4WC 2EY2A 5KYLA 2F0TA 2WV6D 2AKWB 3PQIA 4TQUS 3OYYA 4DR3L 1WTWA 3QB3A 1KTKA 3L3OC 3BDLA 4RKBA 5JEAG 5J22A 5LL6S 4JI8L 2V4DA 1EY4A 3GV6A 1QVFA 4A3BH 1OXXK 2RBMA 3CRKC 2K5DA 5CR3A 3KJOA 3P75A 5C0XG 4MZ9A 1TWAB 2XRSD 2E8GA 3NPPA 4JG2A 1ML0D 4IPCA 3TQYA 2CKZB 2AHOB 5M5XB 4NPSA 3GTLB 1G8ZD 3CKIB 2Q2UA 1EUJA 1A3VA 1ONLA 3QIAA 1ILPA 1TXYA 1K8GA 1RIPA 4I7ZC 1JR0D 2AQ1B 1SLJA 2LS01 2RHQB 3QO2A 1WCMH 3M4YA 4FYDA 3QR8A 4ME3A 3S2HB 2K01A 1SROA 1F9RA 3NQTA 3I4LA 4LF8Q 2ZM6Q 5C5LA 2B2TA 1D1KA 4B3TQ 1A2TA 5KNBA 1WD1A 1FJGL 1A62A 1Y1VB 1STBA 4X65Q 4KY7A 1J5EQ 4IUPA 3UE1A 1XPOA 4O42A 2AWNA 2KUMA 2F0OA 3A0JA 4K6LA 4POFA 1STAA 1II3A 3KUPA 2GN5A 3ULPA 1XX8A 4XYQA 3T1HQ 5AJ3Q 2F3WA 4E6IA 4RHRA 2R61A 4DV0L 4LFCQ 1LT6D 1Q3LA 2Z6KA 3FVQA 4X3UA 4DR6Q 5JEAH 3LWEA 2WFWA 2F4VL 2QGQA 4RGTA 3KLRA 3CPWA 1YITA 2JK8A 3K0XA 4AQYL 2MGSA 3AEVA 4PZ6A 2ES2A 5ELOA 4A3JH 3HOXB 2F0UA 3HS0C 2ID0A 3HOWG 1D5XC 3K81C 5C0XH 3S2DH 3TBIB 4QQBX 1A8VA 2AQ3B 1PFSA 1STGA 2B2WC 4PG3A 4ID6A 4RFBA 2F0NA 1YJWA 3V2TA 2BDOA 2VQEQ 2RDGA 1WTRA 4APVA 3TZDA 1OXSC 2FFKB 2Z4IA 1DGSA 3AFQA 3SDZA 4OGQC 3PIPA 1LTLA 3A7AB 1PH7A 1M4VA 2NTSA 3RZOH 1QG7A 4M8AA 3H91A 4LF6L 3RLNA 1WOCA 5EBDA 1S5CD 1VDZA 4AYBB 3D0FA 2PZTA 1AN8A 2VY3A 1QWYA 4DV3L 3PUXA 5C4HA 2XN9C 1I4XA 1DJRD 4B3SQ 3DLLA 3PUYA 1D5MC 1QILA 4CDFC 2KCCA 3Q6SA 5L37A 1PZKD 1PA6A 2UXCL 1IKMA 2BE5C 1G91A 4IFDI 1Y14B 1U0LA 3V96A 4DV5Q 2AWOA 5BR8Q 1I4RA 3I70A 1PH6A 1CA6A 3BJUA 2RDHA 3TDQA 2HDLA 3PO2B 3KF8B 4ALPA 4P73A 3HFZB 1ASZA 2Q2IA 4KHZA 1E22A 3AU7A 3NHHA 2JA7B 2DNEA 3K7AB 3MEHA 3R93A 2ICIA 1D7QA 4JI6L 3OIQA 1M8AA 5IYDH 4K2KA 4X64Q 1T5XD 1L1OC 2F0WA 2AMCB 1C9OA 2H5XA 4C2MB 3X3MA 1PLFA 1AH9A 4IFDG 4CDEC 1BF4A 2CHBD 4L5RC 5IWAL 2N78A 4NXNQ 1PXUA 4A3KG 3GTGB 2X69A 4DR5Q 1TT2A 1JWUD 3OW2A 1MGSA 4DV4L 1CM9A 5C44B 4IPDA 1I3QB 3G6JB 4DU9A 1WYDA 4IURA 2R92B 3KF8A 4JI0L 1SDFA 1G6ZA 2JEAI 4CBVA 5LMUL 4DV1L 4IFDJ 1PFMA 4I65A 3KDFB 1HZBA 2DUDA 4JW0A 3S24A 3PF5A 3OHXC 1ILQA 2UUAL 1LLRD 3HOVB 4B3RL 2KCTA 4QB4A 3NUCA 3D31A 1Y8NB 1V43A 1OXTA 4PZ8A 2EZVA 4XDXA 4GKKL 1RODA 2CWAA 2VZAA 1XTDA 4DR2Q 4QUFA 4ZK9B 2D5DA 4NKLA 1CA5A 2MPMA 1OTCA 1W2BA 1L0WA 2B3GA 4X6AH 4KY6A 2JEBI 5K36H 5LL6X 2D2CC 1FNUA 4BY7G 1CQFA 1S5BD 3JAMc 3HKZE 2E76C 4HAEA 2NVQH 3M85A 2F0MA 2K5QA 2VW9A 4XT3B 2JP1A 3WDNA 2NVXB 4P72A 5CMDA 2J0TD 1GUWA 3KDFA 1K8AC 1YNJC 3PF4A 4POGA 1DOKA 4Q0FA 4H0LC 2Z8LA 3C3LA 1A3TA 2FMCA 3W1GA 3FPPA 2HDMA 1BKBA 1YEZA 3BU2A 1LO5D 1AZPA 4K5XA 1P16A 1Y69U 1UE7A 1EL0A 1VS0A 1W6KA 5ELBA 3CCLA 3PIO3 3NK9A 2GA4B 1S40A 5FLXE 1G2SA 2B63H 2PO4A 2PMZB 1ZYRC 2RCFA 5M3FB 3M4QA 5C5MA 1DOMA 4K0KQ 3A7LA 4KV6A 5C4JH 5EQ0A 1KL9A 2L0CA 2HHHQ 2B2YA 1G291 2OEOA 1GVPA 2B2TC 2WB1G 5M3MB 1KRSA 2PI2E 1U4LA 4H13C 3H3VI 3QG1A 3T16A 1JE4A 4LF4L 2TMPA 3GV3A 2HIVA 2OT2A 4JYAQ 3PIP3 3AYHB 3NE5B 5ELDA 4GZYC 2ICEC 4ZLTF 2ASBA 4JVZA 1HFNA 1ZXTA 4UP9A 1KABA 2A6EC 5I9PA 2M2LA 2R7ZB 4HSVA 3DUZA 3OTOQ 1A6XA 3E9IA 2VQFQ 3RZDH 5IGEA 1B4OA 1V1OA 1YNJD 2KENA 2Z6KC 5F2DA 1LT4D 3OMCA 2UXBQ 1N34L 1KLUD 1I94Q 1WTPA 4LFBQ 1BCPB 5IP7G 3MC0B 4DV2Q 1DOLA 4JI5Q 1KLGD 2N88A 4H44C 5IGFA 5GQOA 3H15A 3VDYA 1I6HB 1K0RA 2KOLA 2C5CA 5IY0A 1ZYRD 5IYBG 2O5IC 2LKVA 2CQAA 4AIMA 5EPLA 4XXEA 4F8MA 3IKJA 4BA2I 1QZHA 3EN2A 1GHKA 4HCEA 4BS9A 3MEFA 1PH3A 1SXTA 4UP8A 5FKAC 2YU9B 4LFAQ 5DEHA 5BN5A 2VUMH 2VL6A 1GUSA 4A3LH 1VQKA 4YCWA 4KN7C 2L1BA 2A6ED 1IBLL 1A63A 4PMWA 4P71A 4KKSA 1N33L 3HP3A 1QUQB 2K5WA 1MBYA 1BBXC 3NTKA 3UE0A 5G3LD 4DV7Q 4UDUC 4JI2Q 1JB7A 4C1NI 1J8IA 4QIWB 5KNDA 1LYLA 4A3EG 1KAWA 3CCQA 1D2BA 3MFYA 1SYFA 2EE1A 5C3EH 4A3GG 4DN4M 1VQ4A 3EFXD 2O5JC 5E3FA 1K3RA 2QEJC 4JI4L 1FYCA 1EYCA 5DM73 3CCMA 2I5LX 4X66L 2NN6H 3OPOA 1SYEA 4LF9Q 2EPBA 1AP0A 1MJEA 4BBRG 4DNIA 2QDLA 2CW0C 1QUQA 3J7AV 5J3BA 3MA2B 1QVCA 3D8GA 1GUOA 4X62L 2KEDA 2ATWA 4K8JA 1KRTA 4QY7A 1B3AA 5DAUA 2AUJD 5FJ8H 5ISRA 4B3MQ 5D14A 1NR2A 3I3CA 4OO1H 1SRUA 1K28A 2UUBQ 4JK1C 5KGUA 3H94A 2MP1A 3UI2A 3IAYA 5C4XG 2RSOA 1ESRA 2EYLA 4N8FA 5M9OA 1Z9FA 5EBCA 1B9NA 4KY5A 3I4NG 3PUWA 3A54A 2PCFB 2E2IB 2JYOA 4YY3Q 3URYA 5JVH3 3EA6A 1IW7C 2XIWA 2A68C 3S1NB 1VMPA 5IT9c 3PV0A 4FVMA 1Q8IA 3GTOH 1EU3A 5HGQA 4KTAA 3HOWB 3A8KE 1KDCA 3K57A 2B8GA 2PW7A 1PYBA 3OW7A 2KEEA 2D9UA 4ZKBB 1SNOA 3ULJA 5LMNQ 4DR4L 1U5KA 4IPHA 4OIKA 1CSPA 1HR0Q 3ITPA 5FK9C 4LNQA 3GTKB 2E2JB 4A3EH 3GTMH 4HIOA 1VQDA 3JAML 4DV6Q 3M4OH 4KJOA 4JPBW 3FDTA 1PFNA 1N36L 3MXGA 4K14A 3KLWA 4DK1A 1MHWC 4KMUC 4HIKA 2JXMB 2QF7A 5T1GA 4A4IA 3CCJA 3SHLA 4GKJL 2LSSA 2ALYB 1WVLA 1D5ZC 1E3PA 1TWGH 3BS1A 3J80i 2K5NA 2L5TA 2ZXPA 3GTJH 1KXLA 2CCZA 4NMZA 4O1NA 1STHA 1Y1WG 1B44D 4K6DA 1WTVA 2QW7A 2LXJA 4EX5A 1XPRA 3PO3H 1YBYA 4L8JA 5KEEA 3J7YW 3K5OA 5IODA 3CPFA 3S1MB 3KFUA 1HHVA 4NP5A 5FO9B 4DUZQ 1WTHA 2HQEA 2NB0A 3W5OA 5AFWA 3S1RH 5CV6A 1PYSB 4RCOA 5KRUA 4YCVA 1IW7D 1TWFH 3S15B 2A68D 2B2YC 1VQPA 4WJ3M 1EEFD 4IUNA 4A3BG 3J81i 1XMOQ 1PHJA 1R9TB 3AQQA 1PTOB 4A76A 1UE6A 3GTQB 1B2TA 1RCVD 3F2BA 5CV4A 2NVYH 1GKHA 2HCIA 1U4PA 2RVLA 4RKLA 3DEOA 3S17B 2R93B 3SR1A 4A3IH 3RUZA 3B6YA 4ZUIA 4R4CA 5C3WA 4N9TA 4DR7L 4R4TA 4A3KB 3W2DA 2K50A 4ZQ3A 3ZJYC 3FKIH 3L9AX 3M7NA 3BDOA 3R8BA 1PZJD 2K4KA 3CAMA 3EIVA 3EQLC 1WCMG 1TR5A 2EY5A 2EYPA 5M5WH 2F0EA 1STYA 1GXDC 4LF8L 4G4KA 3CC2A 1S5FD 1VF5C 4AYBE 1XPUA 1A0IA 3C1EA 1Q81C 4DPGA 4OXPA 2ZJRA 2X6GA 1TWCB 1J9OA 5C0XI 3CF5A 4RWSC 4DA2A 1K8MA 3VYUA 3CXCA 2XWBB 4OHJA 1EIGA 4LF5Q 2E74C 1AFPA 4CKEA 2K28A 1IYVA 2HCCA 1VQJA 1NCVA 4HMJA 5JJZA 2P5ZX 3T1HL 2RHSB 5AJ3L 4QCLA 4U673 2EIFA 1JOOA 4X3KA 2OQ0A 2A74C 2XTIA 4DAMA 2Q2TA 3TS0A 1HNZQ 4BY7B 1S5ED 4OX9L 1BCPC 1TWHH 3L2PA 2PQEA 2SEBD 4DUYQ 4YHHQ 4A3JG 3TP7A 3S1QH 1D8LA 1YNXA 1KNEA 3HOZH 3O13A 4A3FH 1IXRA 2WKDA 1JOQA 1N8RC 2E2HB 1A3UA 2F52A 2F3VA 5JVG3 1SMYC 5GAGC 4NW2A 1ZEQX 1AZQA 1Q1EA 2UUCQ 2VQEL 3S16B 1I4HA 5JEAJ 2OWOA 1EIYB 1KD1C 2ZTDA 3T51B 3DWQA 4RGMA 4JI3L 1ET9A 3D4DA 2DY8A 3CCSA 5IIFA 2QDBA 1EU4A 5C0XJ 3OIPA 4DK6C 2EJMA 3JAME 4ABNA 2WB1B 3HKZG 1QZGA 2YTXA 3H0GG 2NZHA 3NBHB 4L5SA 4B08A 1SN8A 2EDGA 3TP6A 2ZJQA 4F88A 5D3IB 3J7AF 4DV5L 4HJ5A 5G3LF 1QOHA 4BA1I 5FOBB 2KHSA 2WAQE 2F03A 1BCPD 3HOUH 4QUCA 3NENA 1XYIA 2V1CC 3KK7A 3P20A 4C3JG 3AFPA 2F0FA 1SYDA 1PH1A 1U9RA 2BCOA 2I46A 5IYDG 4R8IA 1SMYD 1LT5D 1VQAA 1EEID 4A3MH 1NE3A 4XT1B 5IT9L 5I2YA 4DXGA 1PVOA 1SNQA 2O4XA 1Q90A 3M4PA 1S3OA 1E2WA 3NBHA 1S72A 2VS1A 1VQ9A 1H9RA 4PQXA 4EGVA 2R7DA 4DR5L 1I50B 4JI8Q 3HG9A 4CKCA 4JI7L 3N6RA 4XQJA 3F1ZA 1SYCA 1AEXA 3G6EA 3S14H 4H7BA 4OWXB 2IT1A 3ERSX 4WORA 4JV5Q 4B9XA 1GUNA 1OO9B 1K83H 1IBMQ 1I4PA 5DNFA 4BBSG 1E7ZA 2OXPA 1HA6A 4R1JA 1JJCB 3U9OA 4ZYSA 2F4IA 4EVOA 1ET6A 4C3HH 2RSNA
chains in the Genus database with same CATH topology
3I73A 3M7GA 3MXUA 1HQRD 4TKOB 1LTID 5K36G 4FNFA 2EJFC 3LWUA 3E6ZX 3NQIA 4IUUA 1B53A 4A3GB 1UUPA 1SYBA 4DK0A 1STEA 1BUVT 5IGCA 1EQTA 3BYYB 1EQVA 1PDQA 1F2ZA 2AQ2B 2EVBA 4BBRB 3K59A 1SYGA 5A2QL 2NWGA 2RQXA 3CQZB 1HUNA 1E2ZA 4K5VA 3K5LA 1RKNA 4FO2A 3K5NA 3M3YB 1F2MA 3EROA 5D65A 1SE4A 1F9PA 4HSPA 2EY1A 5I2XA 2B2UA 4Y7NB 5C4XB 4OL7A 1PTOC 1BQQT 4MIUA 1CZGA 2BE5D 2O2LD 3VA7A 3I4NB 4TRDA 2WIIB 2BA1A 2YYZA 1KDAA 1R4PB 3N52A 1JICA 3BYTB 4A3DB 1QCBD 1HXYD 4BY1B 3I8ZA 1CTMA 5A35A 2XSCA 2F1MA 1MSGA 1DM0B 4MN3A 4G57A 3NTIA 2BA0A 1Y1WB 5KYIA 3SK8A 1UAPA 1F77A 1CQVA 1MSHA 2ZT9C 5IT9E 2AUKA 2G9HD 1PTOD 5HURA 4CKBA 1EWHA 4HMIA 1A2UA 4IUVA 5EKIA 3LX0A 4A3BB 1DXMA 3S1QB 2FJ2A 2K7VA 2PZUA 4R9WA 2NN6I 4FF4A 3Q24A 1NUCA 2VB2X 1I4GA 3DWAA 2F0LA 1KDBA 4OO1I 2F0DA 4KJNA 1TQOA 4U68A 5K5PA 2XNAC 3NSWA 1BO0A 1JCKB 1NR4A 4J8QA 1WCMB 4FXDA 1VCIA 2NN6G 1PZID 5FO7B 1Y8OB 1B1ZA 4L6TB 3SE0A 2NZ1D 2N55A 2LFNA 4RH6A 1LV9A 4YIJA 4RGNA 1RDPD 2M9VA 4IUTA 1C4QA 4OO1G 4FF2A 2R3ZA 5I6WA 4EQOA 1SJHD 4F7XA 3RD4A 5A2QE 1UEAB 3DXJC 1G2TA 3H3VC 2BDNA 4K5WA 3K5MA 1HCZA 1SJED 2KQ3A 3OWEB 1PMRA 4A3JB 3HRZC 2QKIC 5COYA 3DM1A 3MHBA 3H09A 1CI3M 3S2DB 5J1ZA 2IX3A 1F9QA 3BDCA 1CFMA 4CGYB 2Q8IB 3J80L 2B2VA 5CV9A 4NDXA 1RJTA 4DGZA 3ND8A 4FP5D 5IGBA 2EY6A 1PYWD 1OXVA 1DD2A 3DHQA 3KBXA 4PMCA 3TP5A 1QNUA 3RZOB 1YNNC 2LY7A 3TN2A 2ENBA 4IN3A 4HR7B 1X32A 1EIHA 4KHVA 4OIJA 3HKZB 3J81L 2IWHA 4HTHA 3QJYA 4CJ1B 4V0BA 1SE2A 2MHVA 4V190 1Z6HA 3PUZA 1ENAA 1H9JA 2B2UC 2HUGA 1TIID 3SXHA 4RA8A 2KECA 4RCNA 1U4MA 3MFGA 2XVSA 5ELFA 2ZXRA 3L7ZC 1T5EA 2F0JA 4KKUA 1XWEA 3BVZA 1YNND 2J4XA 2F0IA 2MJ8A 1F2LA 2LMCB 2K6AA 1SFOB 5EKLA 1DCZA 1EZ8A 2CW0D 1A15A 2A69C 2F0HA 3VYTA 2DN8A 4Z9CB 2FMMA 1PRTB 4J6HA 4C3IG 1E0BA 4ZAIA 5KNCA 3SK4A 4CHTB 1KAAA 5TSSA 4DNRB 5EPJA 4N9PA 1EY0A 3R2TA 1IKLA 2BOSA 3HZXA 2IL8A 2KA7A 3U9SA 5T1IA 2NVQB 5EGTA 1B9MA 3G7LA 1K8OA 4DF7A 1SNDA 2EYOA 1JQYD 5FO8B 1FD7D 2SNMA 2IX0A 4RHSA 1L0XB 5IGGA 5CV8A 5JAVA 4K8IA 5HGTA 2C9OA 4PNYA 4C56C 2A69D 1IL8A 2B63B 4PMBA 3OWFA 5CV7A 3IFDA 4ZUJA 1PTOF 5C4JB 3J80E 3MAQA 1RHPA 4FXKC 5BN4A 5JPNC 2K04A 4TSSA 2Q8TA 3D4WA 1I4QA 5E1FA 1EYAA 2EYJA 1EWCA 3NXWA 1BDOA 4EQNA 1E2VA 1TVXA 3T13A 1WTOA 1QNKA 1TU2B 2MUYA 3RZDB 3D6CA 1HFGA 3J81E 2ZXOA 2Z4HA 2J7ZA 2RA4A 1EYDA 2B8FA 2G9DA 3HEJA 1QJOA 5CGKA 1CZWA 2A5HA 4QMGA 1I6VC 3A56A 1V8QA 2TSSA 5CYUA 3VYRA 4KD3A 5LHY1 2B2VC 3EVQA 1TKWB 2IPKD 1LT3D 3QOLA 1EY6A 1HRJA 3D6WA 2K03A 3AB9A 1IHZA 1CT1D 2VUMB 3Q22A 3F2UA 1SNMA 2F0QA 3C1FA 4C3HG 1BR9A 3C46A 4FF3A 1GJXA 4BWGB 1GUTA 3R2IA 3RLFA 3V05A 4XYOA 1LTTD 2WP8J 4KN4C 3MXNA 3P1HA 3A55A 4XQQA 5C3EB 1RTOA 1MI2A 3VR6A 3T56B 2Z1CA 1VMCA 3GQBA 2R6GA 1NAPA 4K2LA 5JPMC 2PYKA 2JE6I 1SNCA 4DXFA 3VR4A 2B39A 5CV5A 2K32A 1EFID 1O7YA 2RKSA 3ERQA 3OOCA 5C3XA 5BN3A 2KJXA 2SOBA 3SK5A 4LAAA 5FLXL 1EZ6A 3E5SA 1JOKA 2OF1A 2JSOA 4X3SA 2VXWA 3I4MB 3NP8A 3DWPA 1STNA 3GTOB 1KNAA 1BOSA 3VR2A 2A6HC 5KIXA 3KBGA 1O7LA 3ND9A 4QF4A 1O7ZA 3MZ5A 3P7JA 2VNUD 2H4OA 5CC4A 4A3EB 3GTMB 3SVMA 3M4OB 3NWTA 3RMHA 5EKKA 3PUVA 1SSOA 1XXGA 1GUGA 1PRTC 3D3RA 1WTQA 2PPBC 1TWGB 3GTJB 3R3OA 2I07B 5E4XA 3PO3B 1SEBD 1EY8A 1CHQD 3H6MA 4CJ2C 1SBBB 4ILWA 1LTBD 4S3SA 2IJ0A 3S1RB 2WINB 3GD7A 2F0GA 1TWFB 5J39A 1RD9D 4G7HC 2A6HD 3AMUA 3BZDB 4F87A 2NVYB 4R8NA 2SDFA 1ESFA 1FNVA 2DNCA 4A3IB 3I90A 1HUMA 3QWNA 4IZ8A 1PRTD 3FKIB 4XIGS 1TY0A 5M5WB 1LTSD 2QCPX 5C6AA 4ULLA 4WRDA 2WACA 2WAQB 3CU7A 4G7ZC 1TY2A 1DONA 2QILA 2FINB 1JC7A 4C3IB 1FGBD 4LMQD 2E75C 3Q23A 5CBEE 1D6EC 1Q12A 2K33A 1WD0A 1H9SB 1PTOH 4DFAA 4KD4A 1NSNS 4IFDH 2F0SA 3EJIA 1SAPA 2VB3X 1TWHB 3VA5A 4EQPA 4UAIA 1Q1BA 3I91A 4HEDA 2SNSA 4XTCS 4A3FB 3HOZB 3DMUA 4CJ0B 2Q8RE 3C2PA 2EYHA 3FPUB 1PFBA 1H9SA 3ONAB 3SEBA 1S5DD 3OSOA 5NUCA 2EJGC 1XTCD 3HGBA 4C1NK 1DZ1A 1ZKOA 1F9SA 3W3AA 2XRQD 2KCNA 4B9WA 3TSSA 4RAUC 3D4RA 5I9OA 1TS2A 3IL8A 1LTGD 2L4NA 1LABA 3X3NA 4G7OC 1ENFA 1TS4A 4M1UB 3K6OA 4DAVA 4L63B 1EY7A 3KLSA 2DY7A 2K05A 1U4RA 5DM63 3HOUB 4ODGA 3PMFA 1BCPF 3BG3A 1EY5A 2NBFA 5I4DA 1IYUA 3WOFA 3KLSX 2EXZA 5EPKA 4KI0A 4FF1A 3MVVA 1QB5D 1C8CA 5IGDA 4A3MB 5D3DA 1TS5A 4HCSA 3SK6A 2F0KA 3S9WA 3K0YA 2XWJB 4JBWA 2H1EA 3K58A 3IFTA 4ME5A 2PNRC 2KVMA 1MD2D 2D62A 5ELEA 1JWMD 1DYQA 1Z7TA 2IW3A 3NWSA 3S14B 3CRLC 4DNTB 2FHTA 2X6LA 1SNPA 1CHPD 1LACA 3E0JA 3VR3A 3QOJA 2NTTA 3CHBD 1K83B 1LTAD 1UNSA 2PW5A 5JOBA 4C3HB 1HTLD 3FRPB 1ICWA 3TZUA 3H0GB 5IOCA 3GTPB 1V1PB 2IX1A 5EJWA 2L11A 2K1BA 4DAYA 3NBIA 4Q5VA 1EY9A 3WOEA 4WJWA 5CBAE 3LNNA 4C3JB 1B50A 3Q0AA 4DAPA 3T53B 2A73B 3NTHA 2NUCA 1W6JA 3A8JE 3FEWX 4IUQA 1X3QA 2E2DC 4X3TA 1L0YB 3TMEA 1RF2D 1LTRD 1JORA 1V1PA 4HN7A 1H9MA 2L9HA 4IALA 1HPCA 1BNZA 2M00A 5I6YA 3HOYB 1F2YA 3GO5A 1HQMC 2CVRA 2B2WA 2L55A 4BBSB 5ELCA 1VF7A 1D1IA 2F0VA 4J1MA 4PV1C 2EYMA 1FNWA 5M5YB 2L12A 2NVTB 1SE3A 2EYFA 4WFN3 1WTXA 1PRTF 4XQNA 1EOTA 4IQZA 1Z47A 3BVMA 3MXPA 1JWSD 1GHJA 1HTPA 4RGOS 1C48A 3GP7A 2WKCA 2JA6B 3DEPA 1TS3A 1QE6A 2JA5B 4MHEA 1AW7A 4KK7A 4ZRZA 1GOZA 1X3PA 1O80A 5CORA 1OXUA 3BVGA 2EOTA 2Y0SB 1JB3A 1S4ZA 4KKTA 3MTSA 2JA8B 3T4AC 1ENCA 1FR3A 4P2CB 4LK1C 4A93B 4LJZC 3MWYW 3A8IE 2NYZD 3VYSA 4ZKCB 2RDFA 1O78A 1BXTA 1HA5A 4FXGC 1CK1A 1R4QB 1H9KA 3OMGA 2F0PA 3TP8A 3I72A 1Y8PB 3VR5A 1RTNA 2PZWA 3ZYYX 3FMCA 5C4ZA 5E4WC 2EY2A 5KYLA 2F0TA 2WV6D 4TQUS 1WTWA 3QB3A 1KTKA 3L3OC 3BDLA 4RKBA 5JEAG 5J22A 5LL6S 2V4DA 1EY4A 3GV6A 1OXXK 2RBMA 2K5DA 3CRKC 5CR3A 3P75A 5C0XG 1TWAB 2XRSD 3NPPA 1ML0D 5M5XB 3GTLB 1G8ZD 3CKIB 1A3VA 1ONLA 3QIAA 1ILPA 4I7ZC 1JR0D 2AQ1B 2LS01 3QO2A 3M4YA 4FYDA 3S2HB 2K01A 1F9RA 3NQTA 3I4LA 5C5LA 2B2TA 1D1KA 1A2TA 5KNBA 1WD1A 1Y1VB 1STBA 4KY7A 4IUPA 4O42A 2AWNA 2KUMA 2F0OA 4K6LA 1STAA 1II3A 3KUPA 1XX8A 4XYQA 2F3WA 4E6IA 4RHRA 2R61A 1LT6D 1Q3LA 3FVQA 4X3UA 5JEAH 3LWEA 4RGTA 3KLRA 2MGSA 3HOXB 2F0UA 3HS0C 2ID0A 1D5XC 5C0XH 3TBIB 2AQ3B 1STGA 2B2WC 4ID6A 4RFBA 2F0NA 3V2TA 2BDOA 2RDGA 1WTRA 3TZDA 1OXSC 2FFKB 2Z4IA 3SDZA 4OGQC 3A7AB 1M4VA 2NTSA 1QG7A 4M8AA 3H91A 5EBDA 1S5CD 1VDZA 4AYBB 2PZTA 1AN8A 1QWYA 3PUXA 5C4HA 2XN9C 1I4XA 1DJRD 1D5MC 1QILA 3PUYA 2KCCA 3Q6SA 1PZKD 1IKMA 2BE5C 1G91A 4IFDI 3V96A 2AWOA 1I4RA 3I70A 1CA6A 2RDHA 3TDQA 2HDLA 3PO2B 4KHZA 3AU7A 3NHHA 2JA7B 2DNEA 3K7AB 3MEHA 3R93A 2ICIA 3OIQA 1M8AA 4K2KA 1T5XD 2F0WA 4C2MB 3X3MA 1PLFA 4IFDG 1BF4A 2CHBD 1PXUA 3GTGB 2X69A 1TT2A 1JWUD 1MGSA 1CM9A 5C44B 1I3QB 3G6JB 4DU9A 4IURA 2R92B 3KF8A 1SDFA 1G6ZA 2JEAI 4CBVA 4IFDJ 1PFMA 4I65A 3OHXC 1ILQA 3HOVB 1LLRD 4QB4A 3NUCA 3D31A 1Y8NB 1V43A 1OXTA 2EZVA 4XDXA 1RODA 4QUFA 4ZK9B 2D5DA 4NKLA 1CA5A 2MPMA 4KY6A 2JEBI 5K36H 5LL6X 2D2CC 1FNUA 1CQFA 1S5BD 2E76C 4HAEA 3M85A 2F0MA 2K5QA 4XT3B 2JP1A 3WDNA 2NVXB 5CMDA 2J0TD 1GUWA 1YNJC 1DOKA 4Q0FA 4H0LC 2Z8LA 3C3LA 1A3TA 2FMCA 3FPPA 2HDMA 1LO5D 1AZPA 4K5XA 1Y69U 1EL0A 1W6KA 5ELBA 3PIO3 3NK9A 2GA4B 5FLXE 1G2SA 2PO4A 2PMZB 1ZYRC 5M3FB 5C5MA 1DOMA 3A7LA 4KV6A 5EQ0A 2L0CA 2B2YA 1G291 2OEOA 2B2TC 5M3MB 4H13C 1U4LA 3QG1A 3T16A 1JE4A 2TMPA 3GV3A 2OT2A 3PIP3 3NE5B 5ELDA 4GZYC 2ICEC 4ZLTF 1HFNA 1ZXTA 1KABA 2A6EC 5I9PA 2M2LA 2R7ZB 4HSVA 3DUZA 1A6XA 5IGEA 1B4OA 1V1OA 1YNJD 5F2DA 1LT4D 3OMCA 1KLUD 1WTPA 1BCPB 3MC0B 1DOLA 1KLGD 2N88A 4H44C 5IGFA 1I6HB 2KOLA 2C5CA 1ZYRD 2O5IC 2LKVA 2CQAA 5EPLA 4XXEA 4F8MA 3IKJA 4BA2I 1GHKA 4HCEA 4BS9A 1SXTA 5FKAC 2YU9B 5DEHA 5BN5A 1GUSA 4KN7C 2L1BA 2A6ED 4PMWA 4KKSA 3HP3A 2K5WA 1MBYA 1BBXC 3NTKA 5G3LD 4UDUC 4C1NI 1J8IA 4QIWB 5KNDA 1D2BA 3MFYA 1SYFA 2EE1A 4DN4M 3EFXD 2O5JC 5E3FA 2QEJC 1FYCA 1EYCA 5DM73 2NN6H 3OPOA 1SYEA 2EPBA 1AP0A 2CW0C 3J7AV 3MA2B 3D8GA 1GUOA 2KEDA 4K8JA 5ISRA 5DAUA 1B3AA 2AUJD 4OO1H 5D14A 1NR2A 3I3CA 5KGUA 4JK1C 3H94A 2MP1A 3UI2A 3IAYA 2RSOA 1ESRA 2EYLA 5M9OA 5EBCA 1B9NA 4KY5A 3PUWA 3A54A 2PCFB 2E2IB 2JYOA 3URYA 5JVH3 3EA6A 1IW7C 2XIWA 2A68C 3S1NB 1VMPA 3PV0A 4FVMA 1Q8IA 1EU3A 4KTAA 3HOWB 3A8KE 1KDCA 3K57A 2B8GA 2PW7A 3OW7A 4ZKBB 2D9UA 2KEEA 1SNOA 4OIKA 3ITPA 5FK9C 3GTKB 2E2JB 3JAML 4KJOA 3FDTA 1PFNA 3MXGA 4K14A 4DK1A 4KMUC 2JXMB 2QF7A 5T1GA 3SHLA 1WVLA 1D5ZC 3BS1A 2L5TA 2ZXPA 4NMZA 4O1NA 1STHA 1B44D 4K6DA 1WTVA 4L8JA 5KEEA 3J7YW 3K5OA 5IODA 3S1MB 1HHVA 4NP5A 5FO9B 2HQEA 2NB0A 5AFWA 5CV6A 4RCOA 5KRUA 1IW7D 3S15B 2A68D 2B2YC 1EEFD 4IUNA 1R9TB 1PTOB 3GTQB 1B2TA 1RCVD 5CV4A 2HCIA 1U4PA 2RVLA 4RKLA 3DEOA 3S17B 2R93B 3SR1A 3RUZA 4ZUIA 5C3WA 4N9TA 4A3KB 3W2DA 4ZQ3A 3L9AX 3M7NA 3BDOA 3R8BA 1PZJD 3EQLC 1TR5A 2EY5A 2EYPA 2F0EA 1STYA 1GXDC 4G4KA 1S5FD 1VF5C 3C1EA 2X6GA 1TWCB 1J9OA 5C0XI 4RWSC 4DA2A 1K8MA 3VYUA 2XWBB 4OHJA 1EIGA 2E74C 1AFPA 4CKEA 2K28A 1IYVA 2HCCA 1NCVA 4HMJA 5JJZA 4QCLA 4U673 1JOOA 4X3KA 2A74C 4BY7B 1S5ED 1BCPC 2PQEA 2SEBD 3TP7A 1KNEA 3O13A 2WKDA 1JOQA 2E2HB 1A3UA 2F3VA 5JVG3 1SMYC 4NW2A 1ZEQX 1AZQA 1Q1EA 3S16B 1I4HA 5JEAJ 3T51B 3DWQA 4RGMA 1ET9A 3D4DA 2DY8A 5IIFA 2QDBA 1EU4A 5C0XJ 3OIPA 2EJMA 3JAME 4ABNA 2WB1B 4B08A 2EDGA 3TP6A 4F88A 5D3IB 3J7AF 5G3LF 1QOHA 4BA1I 5FOBB 2KHSA 2F03A 1BCPD 4QUCA 1XYIA 3KK7A 3P20A 4C3JG 2F0FA 1SYDA 1U9RA 2BCOA 2I46A 4R8IA 1SMYD 1LT5D 1EEID 4XT1B 5IT9L 5I2YA 4DXGA 1SNQA 2O4XA 1Q90A 1E2WA 3NBHA 1H9RA 4PQXA 4EGVA 1I50B 3HG9A 4CKCA 3N6RA 4XQJA 1SYCA 1AEXA 4H7BA 2IT1A 4WORA 4B9XA 1GUNA 1OO9B 1I4PA 5DNFA 2OXPA 1HA6A 3U9OA 4ZYSA 2F4IA 4EVOA 1ET6A 2RSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I9O A;  4KV6 A;  4G57 A;  4NP5 A;  1A2T A;  1SYF A;  4K2K A;  4K5W A;  2HQE A;  3D6C A;  2KQ3 A;  2F0W A;  5EKL A;  1EZ8 A;  2OEO A;  2RKS A;  3ERQ A;  5C3X A;  4IZ8 A;  1STB A;  5CV6 A;  2F0H A;  4KY7 A;  1EY7 A;  5E3F A;  5KRU A;  1EYD A;  2SOB A;  4J6H A;  3TME A;  3SK8 A;  3SK5 A;  3T16 A;  4LAA A;  2F0O A;  5KYI A;  1EYC A;  3MHB A;  3HEJ A;  5CGK A;  4IUN A;  3D4D A;  5J1Z A;  1STA A;  1II3 A;  1JOR A;  1SYE A;  5IIF A;  2QDB A;  2RDF A;  4ODG A;  1EZ6 A;  3PMF A;  3E5S A;  1JOK A;  1KAB A;  3BDC A;  4QMG A;  1TT2 A;  2F3W A;  2OF1 A;  3SK4 A;  4E6I A;  1EY5 A;  5I9P A;  5C6A A;  1KAA A;  5HUR A;  3D8G A;  5CV4 A;  5CV9 A;  4IAL A;  4NDX A;  4WRD A;  2WAC A;  4DU9 A;  2EXZ A;  2M00 A;  4DGZ A;  5I6Y A;  4RKL A;  5IGB A;  3NP8 A;  3OMG A;  2EY6 A;  4N9P A;  1F2Y A;  2F0P A;  3MVV A;  4K8J A;  1STN A;  4KD3 A;  5DAU A;  3SR1 A;  3TP8 A;  3DHQ A;  1EY0 A;  4HMI A;  3EVQ A;  4PMC A;  1A2U A;  3RUZ A;  1SYB A;  3TP5 A;  5IGE A;  3HZX A;  5IGD A;  5KIX A;  3LX0 A;  4ZUI A;  3TP6 A;  4N9T A;  3QOL A;  5F2D A;  5C3W A;  3OMC A;  4I65 A;  5IGC A;  4QF4 A;  1EY6 A;  2F0U A;  2ENB A;  2PZU A;  1EQV A;  4ZQ3 A;  5KGU A;  3MZ5 A;  3SK6 A;  1F2Z A;  5EGT A;  2F0K A;  2PZW A;  3S9W A;  5CC4 A;  4QB4 A;  1SYG A;  2EYL A;  4DF7 A;  3NUC A;  2KHS A;  5M9O A;  1NUC A;  1STG A;  1SND A;  5C4Z A;  2EYO A;  1TR5 A;  2EY5 A;  2EYP A;  1IHZ A;  4ID6 A;  4KHV A;  2EY2 A;  4KY5 A;  4DFA A;  5KYL A;  2F0N A;  2F0E A;  2F0T A;  4K5V A;  4ME5 A;  5EKK A;  3V2T A;  1RKN A;  2F0F A;  1SYD A;  4KD4 A;  1STY A;  2F0L A;  5IGF A;  1SNM A;  1U9R A;  2SNM A;  2F0Q A;  2F0V A;  1F2M A;  3C1F A;  4J1M A;  4HTH A;  3ERO A;  1NSN S;  2EYM A;  3QB3 A;  4NKL A;  1KDB A;  2F0S A;  2LKV A;  3BDL A;  2F0D A;  4RKB A;  5IGG A;  3EJI A;  4KJN A;  2EYF A;  2EY1 A;  5CV8 A;  5J22 A;  4KTA A;  5JAV A;  4KY6 A;  1TQO A;  4F8M A;  1KDC A;  4K8I A;  1EY4 A;  3C1E A;  3VA5 A;  4EQP A;  2PW7 A;  5HGT A;  3R3O A;  1SNP A;  5K5P A;  2RBM A;  4OL7 A;  1ENA A;  1SNO A;  5CR3 A;  4MIU A;  1SNQ A;  3QOJ A;  2O4X A;  2SNS A;  4PNY A;  3P75 A;  3ITP A;  3DMU A;  4TRD A;  2PZT A;  2F0M A;  1EY8 A;  4PMB A;  3SXH A;  3OWF A;  3H6M A;  5CV7 A;  2EYH A;  4ZUJ A;  5DEH A;  4KJO A;  5C4H A;  2PW5 A;  3MXP A;  5JOB A;  1KDA A;  4HMJ A;  4K14 A;  4S3S A;  1JOO A;  3P1H A;  5IOC A;  1A3T A;  3OSO A;  4YIJ A;  3SHL A;  5NUC A;  1A3V A;  1SYC A;  1AEX A;  2F0G A;  4H7B A;  5ISR A;  2F0J A;  5J39 A;  2PQE A;  4K5X A;  3D4W A;  5E1F A;  3TP7 A;  4WOR A;  1EYA A;  4NMZ A;  1EY9 A;  1STH A;  2EYJ A;  4K2L A;  4B9X A;  4EQO A;  5I6W A;  4K6D A;  4F7X A;  2PYK A;  3NK9 A;  1JOQ A;  3NQT A;  1SNC A;  3NXW A;  2OXP A;  4B9W A;  2F0I A;  1A3U A;  3U9O A;  3NHH A;  4R8N A;  4EQN A;  2F3V A;  5CV5 A;  3T13 A;  5C5M A;  5C5L A;  1ENC A;  3MEH A;  5KEE A;  4EVO A;  5IOD A;  2NUC A; 
#chains in the Genus database with same CATH topology
 5JJK A;  3I73 A;  3M7G A;  2MO0 A;  3H0G H;  3G71 A;  3MXU A;  1HQR D;  3GTP H;  4DR2 L;  1YHQ A;  2ZTC A;  1NMF A;  4TKO B;  1UE5 A;  1LTI D;  5K36 G;  2MQH A;  4FNF A;  3J80 c;  2EJF C;  3LWU A;  4UY8 C;  1UEB A;  1XJV A;  3E6Z X;  1FJG Q;  4A3C H;  4C3J H;  3NQI A;  1L2F A;  4IUU A;  1B53 A;  3DM3 A;  3E0E A;  1X9N A;  3ICE A;  4JI1 Q;  4A3G B;  1UUP A;  1SYB A;  4DK0 A;  1STE A;  1BUV T;  5IGC A;  1EQT A;  2N49 A;  3TRZ A;  2E5L Q;  3BYY B;  1EQV A;  1CUK A;  1PDQ A;  1F2Z A;  2AQ2 B;  2EVB A;  1E1T A;  4BBR B;  4LUZ A;  3K59 A;  1SYG A;  1V9P A;  5A2Q L;  2NWG A;  3Q8D A;  4DV0 Q;  2RQX A;  3CQZ B;  3J81 c;  1HUN A;  1E2Z A;  4K5V A;  2F4V Q;  3K5L A;  2B63 G;  1RKN A;  4AQY Q;  4FO2 A;  3K5N A;  3M3Y B;  2BH8 A;  1F2M A;  3ERO A;  5D65 A;  1VQE A;  3FP9 A;  1SE4 A;  1SFO H;  3HOY H;  1F9P A;  4HSP A;  2EY1 A;  5I2X A;  2B2U A;  4Y7N B;  2CH4 A;  5C4X B;  4OL7 A;  1PTO C;  1BQQ T;  4MIU A;  1CZG A;  2BE5 D;  1NMG A;  2O2L D;  3VA7 A;  3I4N B;  4BBS H;  4TRD A;  2WII B;  2BA1 A;  2YYZ A;  1KDA A;  5GAD C;  5GAH C;  1R4P B;  4R4O A;  3HKS A;  3N52 A;  5GRO A;  1JIC A;  2A8V A;  5M5Y H;  3BYT B;  3OTO L;  2NVT H;  4A3D B;  3TEH B;  2VQF L;  1QCB D;  3EBE A;  1HXY D;  4BY1 B;  3U58 A;  3I8Z A;  1CTM A;  5A35 A;  2XSC A;  1I94 L;  2F1M A;  3U50 C;  1MSG A;  1DM0 B;  4MN3 A;  4DV2 L;  4JI5 L;  4G57 A;  3F2C A;  3NTI A;  2JA6 H;  4JBM A;  2BA0 A;  1C7Y A;  4RMF A;  1Y1W B;  2JA5 H;  2RCN A;  3SK8 A;  5KYI A;  4KHP L;  1UAP A;  4GS3 A;  1F77 A;  1CQV A;  1MSH A;  2ZT9 C;  5IT9 E;  2AUK A;  2G9H D;  4JI6 Q;  1BVS A;  1PTO D;  1JJG A;  4LF7 Q;  5HUR A;  2JA8 H;  4LFA L;  2VUM G;  4CKB A;  2R7F A;  4OEM B;  4A3L G;  5IWA Q;  1EWH A;  4HMI A;  5IE8 A;  1A2U A;  4IUV A;  3NEL A;  5EKI A;  3LX0 A;  4A93 H;  3F2D A;  4A3B B;  1DXM A;  3S1Q B;  2A1A A;  4HID A;  2FJ2 A;  2K7V A;  2PZU A;  4R9W A;  4DV4 Q;  2N8N A;  2NN6 I;  4FF4 A;  3Q24 A;  1NUC A;  2VB2 X;  1EWI A;  3PCO B;  1I4G A;  4JI2 L;  3DWA A;  2F0L A;  4DV1 Q;  5HY6 A;  1KDB A;  4OO1 I;  2UUA Q;  2F0D A;  4B3R Q;  1KHI A;  4KJN A;  4YWM A;  1N32 Q;  1TQO A;  5C3E G;  4U68 A;  5K5P A;  4KLK A;  2XNA C;  3NSW A;  1BO0 A;  1JCK B;  1NR4 A;  4J8Q A;  1WCM B;  4FXD A;  1VCI A;  2NN6 G;  1PZI D;  5FO7 B;  3U4Z A;  1Y8O B;  1B1Z A;  2XGT A;  4L6T B;  3SE0 A;  2NZ1 D;  2N55 A;  4LF9 L;  2LFN A;  4RH6 A;  1YJ9 A;  2L15 A;  2ZJP A;  4P74 A;  1LV9 A;  4YIJ A;  3WWV A;  4RGN A;  1RDP D;  2M9V A;  4IUT A;  1VQC A;  5FJ8 G;  1C4Q A;  1B3Q A;  4OO1 G;  2Z0S A;  4FF2 A;  1G6P A;  2R3Z A;  4PZ7 A;  3T1Y Q;  1JE5 A;  3I2Z A;  5I6W A;  4EQO A;  1SJH D;  2K5V A;  4F7X A;  3RD4 A;  4JOI A;  3CCR A;  5A2Q E;  1UEA B;  1TWA H;  3DXJ C;  2NZO A;  4NXM L;  1C0A A;  1G2T A;  3H3V C;  3SGI A;  1IL2 A;  2BDN A;  4K5W A;  5M5X H;  3K5M A;  1HCZ A;  1SJE D;  2KQ3 A;  3OWE B;  3GTL H;  3TS2 A;  1PMR A;  4YY3 L;  3I4M G;  4HJ8 A;  2YV5 A;  3IRB A;  3HRZ C;  2K75 A;  2QKI C;  4A3J B;  5COY A;  2Y0S E;  1K9M C;  3DM1 A;  3MHB A;  3H09 A;  1CI3 M;  3S2D B;  5J1Z A;  2IX3 A;  1F9Q A;  1EOV A;  4AYB G;  5LMN L;  3BDC A;  3S2H H;  1CFM A;  2F3I A;  4CGY B;  2DJG C;  2Q8I B;  3J80 L;  1HR0 L;  1WFQ A;  2B2V A;  3BZK A;  5CV9 A;  4NDX A;  1RJT A;  4R4I A;  1HJP A;  4DGZ A;  3ND8 A;  4FP5 D;  1PH2 A;  5IGB A;  1H95 A;  2EY6 A;  1PYW D;  1OXV A;  1DD2 A;  3DHQ A;  3KBX A;  4PMC A;  1UWV A;  3TP5 A;  1Y1V H;  3PGZ A;  1QNU A;  4GNX B;  3RZO B;  1YNN C;  2LY7 A;  1N9W A;  3TN2 A;  1VQH A;  2ENB A;  2ZTE A;  4JBK A;  1FVI A;  4IN3 A;  2DJF C;  4HR7 B;  1X32 A;  1XMQ Q;  2Q2H A;  1XNR L;  1EIH A;  2UU9 Q;  4KHV A;  4OIJ A;  3PO2 G;  2LXK A;  3HKZ B;  3PO3 G;  4LUO A;  3JC6 6;  4ZCK A;  3J7A 5;  3J81 L;  2IWH A;  3ER0 A;  4HTH A;  1N34 Q;  1X6O A;  3QJY A;  4CJ1 B;  1YHB A;  3J7Z C;  4V0B A;  1SE2 A;  1VQF A;  2MHV A;  4DUZ L;  4V19 0;  1Z6H A;  3PUZ A;  1CKN B;  1ENA A;  2KHI A;  4GLA C;  1H9J A;  1T9H A;  4IJH A;  4IPG A;  2B2U C;  2HUG A;  4BXX H;  1TII D;  1X54 A;  4QJF A;  3SXH A;  4GNX A;  4RA8 A;  2KEC A;  4RCN A;  1U4M A;  3MFG A;  4OWT B;  2XVS A;  4LUV A;  5ELF A;  1AE2 A;  1X3F A;  3CCU A;  2ZXR A;  3L7Z C;  3I4M H;  4A3I G;  1T5E A;  1K73 C;  2F0J A;  4KKU A;  1XWE A;  3BVZ A;  3FKI G;  1YNN D;  1PH4 A;  2J4X A;  4HIM A;  5ELN A;  1IBL Q;  2F0I A;  2MJ8 A;  1F2L A;  2LMC B;  3F8T A;  1CKN A;  1N33 Q;  1M90 C;  2K6A A;  1SFO B;  5EKL A;  1DCZ A;  1EZ8 A;  2WAQ G;  2CW0 D;  4EQ5 A;  1A15 A;  2A69 C;  2F0H A;  2MO1 A;  3STB C;  3VYT A;  2DN8 A;  4Z9C B;  2FMM A;  1PRT B;  4J6H A;  4C3I G;  1VQO A;  1NNX A;  1M1K C;  2I0Q A;  2DGY A;  1E0B A;  1B70 B;  1GO3 E;  5FLM H;  4ZAI A;  5KNC A;  3PO2 H;  3SK4 A;  2OQK A;  4I7A A;  4CHT B;  1KAA A;  3CME A;  1HNW Q;  5TSS A;  2JA7 H;  4DNR B;  3K7A H;  4LF5 L;  2PI2 A;  5EPJ A;  4GLX A;  4N9P A;  1EY0 A;  3R2T A;  1IKL A;  3RNU A;  2BOS A;  3HZX A;  4TVA B;  2IL8 A;  2KA7 A;  3U9S A;  4C2M H;  3K7U C;  5T1I A;  1HNZ L;  2NVQ B;  1P8L A;  1B9M A;  3G7L A;  5EGT A;  1K8O A;  4X62 Q;  4DF7 A;  3J81 j;  1SND A;  2EYO A;  3GTG H;  1JQY D;  3FHW A;  5FO8 B;  4A3F G;  4YHH L;  3HOZ G;  1X3G A;  1VQ8 A;  1FD7 D;  3RN5 A;  5C44 H;  1JMC A;  2SNM A;  2QEX A;  2IX0 A;  3CC4 A;  1I3Q H;  4RHS A;  1L0X B;  1JJ2 A;  2R92 H;  3KOJ A;  5IGG A;  4LW1 A;  1B7Y B;  5CV8 A;  5JAV A;  2OTL A;  3K8A A;  4K8I A;  2UUC L;  5HGT A;  2JQO A;  5M3M G;  2C9O A;  4PNY A;  4C56 C;  2A69 D;  1IL8 A;  3L0O A;  4DKA C;  3HOV H;  1CKO A;  2B63 B;  4PMB A;  3E3X A;  3OWF A;  5CV7 A;  3IFD A;  4ZUJ A;  1PTO F;  3I55 A;  5H1S E;  1VQN A;  5C4J B;  3J80 E;  4L5T A;  3MAQ A;  1RHP A;  2ZM6 L;  4DR4 Q;  4FXK C;  4DR1 Q;  5BN4 A;  5JPN C;  1V1Q A;  3UDF A;  4B3T L;  4C3I H;  3I4O A;  2K04 A;  4TSS A;  2Q8T A;  4RG1 A;  2HD3 A;  3D4W A;  1XNQ Q;  1I4Q A;  5E1F A;  1EYA A;  4X65 L;  1IBK Q;  2EYJ A;  1N36 Q;  1J5E L;  4O0A A;  1EWC A;  3A5Z B;  3NXW A;  1BDO A;  3HOU G;  2NVX H;  4EQN A;  1E2V A;  1TVX A;  3T13 A;  1WTO A;  1QNK A;  2IHF A;  4GKJ Q;  3GDE A;  1TU2 B;  1VQ7 A;  4JOI C;  2MUY A;  3RZD B;  3D6C A;  1HFG A;  3J81 E;  1W3S A;  2ZXO A;  2Z4H A;  2J7Z A;  2RA4 A;  4LFC L;  4DR6 L;  1EYD A;  3CCE A;  2B8F A;  5GAE C;  2G9D A;  3HEJ A;  4A3M G;  1QJO A;  5CGK A;  1YIJ A;  1CZW A;  2A5H A;  4IOC A;  2I5H A;  2FXQ A;  4QMG A;  1I6V C;  1YJN A;  3I7F A;  3A56 A;  1V8Q A;  2TSS A;  5M3F H;  1Q82 C;  5CYU A;  3VYR A;  4KD3 A;  5LHY 1;  2B2V C;  1FL0 A;  3EVQ A;  1TKW B;  2IPK D;  1LT3 D;  3QOL A;  5M3M H;  1CKM A;  1EY6 A;  4JC0 A;  5IP9 H;  3MXN B;  1HRJ A;  3D6W A;  1KQS A;  2K03 A;  1X55 A;  3AB9 A;  4P75 A;  2HIX A;  1IHZ A;  4JV5 L;  1CT1 D;  2VUM B;  3Q22 A;  3F2U A;  1IBM L;  1SNM A;  2R7Z H;  4DR7 Q;  2F0Q A;  1ASY A;  3C1F A;  4C3H G;  1BR9 A;  1PH5 A;  3C46 A;  4FF3 A;  1J6Q A;  1GJX A;  4B3S L;  4BWG B;  1GUT A;  3R2I A;  4IOA A;  4CDC C;  2D0P A;  3RLF A;  2HQL A;  4QGU A;  3V05 A;  3UDG A;  3CCV A;  5BR8 L;  4XYO A;  1O7I A;  1LTT D;  4HJ9 A;  4GLV B;  2WP8 J;  1KC8 C;  4GN5 A;  4A3C G;  4KN4 C;  1SE8 A;  1HNX Q;  2CFM A;  4GNX C;  3MXN A;  3P1H A;  3A55 A;  2K14 A;  1I6H H;  4XQQ A;  5C3E B;  2UXD Q;  1RTO A;  1MI2 A;  3VR6 A;  3T56 B;  4AH6 A;  2Z1C A;  1NTG A;  1VMC A;  4JI1 L;  1YI2 A;  5DLQ E;  3GQB A;  2R6G A;  4X64 L;  4JCV E;  1VQL A;  1NAP A;  4K2L A;  1VQM A;  5JPM C;  2PYK A;  2JE6 I;  2E5L L;  2K52 A;  4DR3 Q;  1SNC A;  4DXF A;  3VR4 A;  2QA4 A;  2YU9 H;  3CC7 A;  2B39 A;  4UHV A;  5CV5 A;  4NXN L;  2HT1 A;  2K32 A;  1EFI D;  4OX9 Q;  1O7Y A;  2CWP A;  2MNA A;  2RKS A;  3ERQ A;  3OOC A;  5C3X A;  5BN3 A;  2C35 B;  2CQO A;  3PIO A;  3HOY G;  1CSQ A;  2KJX A;  2SOB A;  3SK5 A;  4LAA A;  5FLX L;  2PMZ E;  3W1B A;  1EFW A;  3PSI A;  1EZ6 A;  3E5S A;  4DK3 C;  1JOK A;  2N3S A;  2OF1 A;  2Z6B A;  2JSO A;  4X3S A;  2VXW A;  3I4M B;  3NP8 A;  3DWP A;  1STN A;  4JI3 Q;  3GTO B;  1KNA A;  1BOS A;  3VR2 A;  2A6H C;  5KIX A;  4WJ4 A;  3KBG A;  1O7L A;  3ND9 A;  4QF4 A;  1O7Z A;  3MZ5 A;  1VQ6 A;  3P7J A;  2VNU D;  2H4O A;  5CC4 A;  4A3E B;  3GTM B;  3SVM A;  3M4O B;  3NWT A;  4A75 A;  3RMH A;  4OON A;  5EKK A;  1QVG A;  2YTV A;  3PUV A;  1SSO A;  1XXG A;  4Y52 H;  1GUG A;  1PRT C;  3D3R A;  1WTQ A;  3KJP A;  2PPB C;  1TWG B;  1GD7 A;  2JA6 G;  3GTJ B;  3R3O A;  2I07 B;  2JA5 G;  5E4X A;  3PO3 B;  1SEB D;  1EY8 A;  1CHQ D;  3H6M A;  4CJ2 C;  2Y0S G;  1SBB B;  4ILW A;  2E2I H;  1LTB D;  4S3S A;  2IJ0 A;  2JA8 G;  1HZC A;  3S1R B;  4LF7 L;  2WIN B;  2GVA A;  3S1N H;  3GD7 A;  2F0G A;  2R93 G;  4GOP B;  1TWF B;  4K0K L;  3HOW H;  5J39 A;  2HHH L;  4A93 G;  1RD9 D;  4G7H C;  2BH2 A;  1X56 A;  2A6H D;  3AMU A;  5EAY A;  2E2J H;  3BZD B;  3GTK H;  1EQQ A;  3G48 A;  4F87 A;  4JI7 Q;  2NVY B;  4JYA L;  4R8N A;  1VQG A;  2SDF A;  1ESF A;  1FNV A;  2DNC A;  4A3I B;  3I90 A;  1HUM A;  3QWN A;  4IZ8 A;  4MTN A;  4LF6 Q;  3UDX A;  4R4Q A;  2B29 A;  1PRT D;  4DV3 Q;  3FKI B;  4QIW E;  5JJI A;  4XIG S;  1N32 L;  4UPA A;  1BBW A;  1TY0 A;  2UXB L;  1MJC A;  5M5W B;  1LTS D;  4GOP A;  2UXC Q;  1WI5 A;  2QCP X;  5C6A A;  2EQS A;  4H02 A;  4ULL A;  1HZ9 A;  4WRD A;  2WAC A;  2KHJ A;  2WAQ B;  4LFB L;  3CU7 A;  4G7Z C;  1TY2 A;  1DON A;  3S1M H;  2QIL A;  3NEM A;  2FIN B;  1JC7 A;  4C3I B;  1FGB D;  4LMQ D;  1UE1 A;  2E75 C;  3Q23 A;  5CBE E;  1D6E C;  1Q12 A;  2K33 A;  3S15 H;  1WD0 A;  1X3E A;  1H9S B;  3T1Y L;  1R9T H;  1PTO H;  4DFA A;  3GTQ H;  4HJA A;  4KD4 A;  4FDB A;  1Q86 C;  3M9B A;  1NSN S;  1EIF A;  3S17 H;  2R93 H;  3UDI A;  4IFD H;  2F0S A;  2IY5 B;  3EJI A;  1SAP A;  2VB3 X;  1TWH B;  3RLO A;  3VA5 A;  4EQP A;  1ICF B;  4UAI A;  4GN3 B;  1Q1B A;  3I91 A;  4A3K H;  4HED A;  1PH8 A;  2SNS A;  4XTC S;  4A3F B;  3HOZ B;  5E7N A;  3DMU A;  1MIU A;  4CJ0 B;  2Q8R E;  1Q46 A;  3C2P A;  2EYH A;  3FPU B;  4UP7 A;  4JI0 Q;  4YWK A;  4DV7 L;  1PFB A;  5JJL A;  1H9S A;  1IZ6 A;  3ONA B;  3SEB A;  5LMU Q;  1S5D D;  2OTJ A;  3OSO A;  5NUC A;  2EJG C;  1XTC D;  3U4V A;  3HGB A;  4C1N K;  1Y1V G;  2YTY A;  1DZ1 A;  4GKK Q;  1ZKO A;  2A19 A;  1F9S A;  3W3A A;  4IJL A;  1TWC H;  3RN2 A;  2XRQ D;  2KCN A;  4B9W A;  3TSS A;  4HJ7 A;  1NY4 A;  4RAU C;  1XMQ L;  2UU9 L;  3D4R A;  5I9O A;  1K0S A;  1WJJ A;  1TS2 A;  3IL8 A;  1LTG D;  2L4N A;  1LAB A;  3CW2 C;  3X3N A;  4G7O C;  1ENF A;  1TS4 A;  4M1U B;  3K6O A;  4DAV A;  4BY7 H;  4L63 B;  1EY7 A;  3KLS A;  2DY7 A;  2JJQ A;  2K05 A;  4B3M L;  1U4R A;  5DM6 3;  3HOU B;  3HOX G;  3CP0 A;  3PMF A;  4ODG A;  4BXX G;  1BCP F;  2UUB L;  3BG3 A;  1EY5 A;  2NBF A;  5I4D A;  2E2H H;  1IYU A;  2RF4 A;  3WOF A;  3KLS X;  2EXZ A;  5EPK A;  4KI0 A;  1G51 A;  4FF1 A;  4KHP Q;  3MVV A;  2GVB A;  1QB5 D;  1VQI A;  1C8C A;  5IGD A;  4A3M B;  5D3D A;  3S16 H;  4N8X 1;  1TS5 A;  4HCS A;  3SK6 A;  2F0K A;  3S9W A;  3K0Y A;  2XWJ B;  3A5U A;  4GN4 B;  1VQ5 A;  4JBW A;  2H1E A;  2I5M X;  3K58 A;  3IFT A;  4MNO A;  2JA9 A;  4JBJ A;  2PNR C;  4ME5 A;  2KVM A;  1MD2 D;  4DAY B;  2D62 A;  1LM0 A;  5ELE A;  4DV6 L;  1JWM D;  1DYQ A;  1Z7T A;  2IW3 A;  3NWS A;  3TRE A;  4LF4 Q;  3S14 B;  3CRL C;  4DNT B;  2FHT A;  2X6L A;  1SNP A;  1CHP D;  1LAC A;  3E0J A;  1PV4 A;  3VR3 A;  3ULL A;  3QOJ A;  2NTT A;  3CHB D;  1K83 B;  2KBN A;  1LTA D;  1UNS A;  2PNH A;  2PW5 A;  5FLM G;  5JOB A;  4C3H B;  1HH2 P;  1HTL D;  3FRP B;  1ICW A;  2G5D A;  3TZU A;  3H0G B;  2JA7 G;  5IOC A;  1HNW L;  3GTP B;  1V1P B;  2IX1 A;  5EJW A;  2L11 A;  1Q8K A;  3CD6 A;  3H3V H;  2K1B A;  2MFI A;  4DAY A;  3NBI A;  5IP7 H;  4Q5V A;  1EY9 A;  3HOX H;  3WOE A;  3G4S A;  5LMN W;  3LGJ A;  4WJW A;  5CBA E;  3LNN A;  1HR0 W;  4C3J B;  1B50 A;  3Q0A A;  4DAP A;  4QL5 A;  3T53 B;  2A73 B;  3NTH A;  2NUC A;  1XMO L;  4IO9 A;  1W6J A;  1I50 H;  3A8J E;  3E9H A;  5IYB H;  5C44 G;  1NJI C;  1K3B C;  3FEW X;  4IUQ A;  1X3Q A;  2R92 G;  1SR3 A;  2E2D C;  4X3T A;  1L0Y B;  1SMX A;  3TME A;  3RR5 A;  1RF2 D;  4NXM Q;  1LTR D;  1JOR A;  1V1P A;  4HN7 A;  1H9M A;  4YCU A;  3HOV G;  2L9H A;  4IAL A;  1HPC A;  1HZA A;  1BNZ A;  2M00 A;  5I6Y A;  4GOP C;  5IYC G;  3HOY B;  1F2Y A;  3GO5 A;  2CH4 W;  5FLX c;  1YHA A;  3KF6 B;  1HQM C;  2CVR A;  3I56 A;  4A3D G;  2B2W A;  4DR1 L;  2L55 A;  1Q7Y C;  4BBS B;  5ELC A;  4BY1 G;  1VF7 A;  1D1I A;  2WB1 E;  1XNQ L;  1YVC A;  1IBK L;  2F0V A;  4J1M A;  4PV1 C;  2EYM A;  1FNW A;  4A3G H;  5M5Y B;  4JI4 Q;  3K80 C;  2JN4 A;  2L12 A;  2NVT B;  4X66 Q;  1SE3 A;  2EYF A;  2D0O A;  4WFN 3;  1XNR Q;  1E24 A;  1L1O B;  3CMA A;  1WTX A;  1PRT F;  2PQA B;  4BBR H;  4XQN A;  1EOT A;  4IQZ A;  1Z47 A;  1EQR A;  3BVM A;  3CQZ H;  1EYG A;  3KF6 A;  4DUY L;  3MXP A;  1KIX A;  1JWS D;  1GHJ A;  1HTP A;  1IYJ B;  4O2D A;  1PH9 A;  4RGO S;  3M3Y H;  1C48 A;  5M3F G;  3GP7 A;  2WKC A;  2JA6 B;  3DEP A;  1TS3 A;  1X65 A;  1QE6 A;  1RL2 A;  2JA5 B;  4MHE A;  1B8A A;  4Y7N H;  5C4X H;  1AW7 A;  4KK7 A;  4ZRZ A;  1GOZ A;  1X3P A;  1O80 A;  5COR A;  1OXU A;  3BVG A;  5IP9 G;  3STB D;  2IHE A;  2EOT A;  4OEL B;  2Y0S B;  3I4N H;  2Z9H A;  1JB3 A;  1S4Z A;  4KKT A;  3MTS A;  2JA8 B;  1L1O A;  3T4A C;  2PQA A;  1ENC A;  5IYC H;  1FR3 A;  4P2C B;  1GM5 A;  2R7Z G;  4LK1 C;  1YZ6 A;  4A93 B;  4LJZ C;  4MTK A;  3MWY W;  4L5Q A;  4A3D H;  1BBU A;  3A8I E;  2NYZ D;  1LUZ A;  4NB3 A;  2OCE A;  3VYS A;  1JT8 A;  4BY1 H;  4ZKC B;  2RDF A;  1O78 A;  1VQB A;  1BXT A;  1HA5 A;  3KYH C;  1FGU A;  1AE3 A;  3BZC A;  4FXG C;  4OWW B;  1CK1 A;  1R4Q B;  1H9K A;  1E1O A;  2KCM A;  1I5F A;  3OMG A;  4YWL A;  2F0P A;  3TP8 A;  3I72 A;  1HNX L;  1Y8P B;  2K5H A;  1NBW A;  3JAM i;  2UXD L;  3VR5 A;  1RTN A;  1Y1W H;  4CDD C;  4J15 A;  2PZW A;  3ZYY X;  3A74 A;  4LWC A;  3FMC A;  1MKH A;  5C4Z A;  2EXD A;  5E4W C;  2EY2 A;  5KYL A;  2F0T A;  2WV6 D;  2AKW B;  3PQI A;  4TQU S;  3OYY A;  4DR3 L;  1WTW A;  3QB3 A;  1KTK A;  3L3O C;  3BDL A;  4RKB A;  5JEA G;  5J22 A;  5LL6 S;  4JI8 L;  2V4D A;  1EY4 A;  3GV6 A;  1QVF A;  4A3B H;  1OXX K;  2RBM A;  3CRK C;  2K5D A;  5CR3 A;  3KJO A;  3P75 A;  5C0X G;  4MZ9 A;  1TWA B;  2XRS D;  2E8G A;  3NPP A;  4JG2 A;  1ML0 D;  4IPC A;  3TQY A;  2CKZ B;  2AHO B;  5M5X B;  4NPS A;  3GTL B;  1G8Z D;  3CKI B;  2Q2U A;  1EUJ A;  1A3V A;  1ONL A;  3QIA A;  1ILP A;  1TXY A;  1K8G A;  1RIP A;  4I7Z C;  1JR0 D;  2AQ1 B;  1SLJ A;  2LS0 1;  2RHQ B;  3QO2 A;  1WCM H;  3M4Y A;  4FYD A;  3QR8 A;  4ME3 A;  3S2H B;  2K01 A;  1SRO A;  1F9R A;  3NQT A;  3I4L A;  4LF8 Q;  2ZM6 Q;  5C5L A;  2B2T A;  1D1K A;  4B3T Q;  1A2T A;  5KNB A;  1WD1 A;  1FJG L;  1A62 A;  1Y1V B;  1STB A;  4X65 Q;  4KY7 A;  1J5E Q;  4IUP A;  3UE1 A;  1XPO A;  4O42 A;  2AWN A;  2KUM A;  2F0O A;  3A0J A;  4K6L A;  4POF A;  1STA A;  1II3 A;  3KUP A;  2GN5 A;  3ULP A;  1XX8 A;  4XYQ A;  3T1H Q;  5AJ3 Q;  2F3W A;  4E6I A;  4RHR A;  2R61 A;  4DV0 L;  4LFC Q;  1LT6 D;  1Q3L A;  2Z6K A;  3FVQ A;  4X3U A;  4DR6 Q;  5JEA H;  3LWE A;  2WFW A;  2F4V L;  2QGQ A;  4RGT A;  3KLR A;  3CPW A;  1YIT A;  2JK8 A;  3K0X A;  4AQY L;  2MGS A;  3AEV A;  4PZ6 A;  2ES2 A;  5ELO A;  4A3J H;  3HOX B;  2F0U A;  3HS0 C;  2ID0 A;  3HOW G;  1D5X C;  3K81 C;  5C0X H;  3S2D H;  3TBI B;  4QQB X;  1A8V A;  2AQ3 B;  1PFS A;  1STG A;  2B2W C;  4PG3 A;  4ID6 A;  4RFB A;  2F0N A;  1YJW A;  3V2T A;  2BDO A;  2VQE Q;  2RDG A;  1WTR A;  4APV A;  3TZD A;  1OXS C;  2FFK B;  2Z4I A;  1DGS A;  3AFQ A;  3SDZ A;  4OGQ C;  3PIP A;  1LTL A;  3A7A B;  1PH7 A;  1M4V A;  2NTS A;  3RZO H;  1QG7 A;  4M8A A;  3H91 A;  4LF6 L;  3RLN A;  1WOC A;  5EBD A;  1S5C D;  1VDZ A;  4AYB B;  3D0F A;  2PZT A;  1AN8 A;  2VY3 A;  1QWY A;  4DV3 L;  3PUX A;  5C4H A;  2XN9 C;  1I4X A;  1DJR D;  4B3S Q;  3DLL A;  3PUY A;  1D5M C;  1QIL A;  4CDF C;  2KCC A;  3Q6S A;  5L37 A;  1PZK D;  1PA6 A;  2UXC L;  1IKM A;  2BE5 C;  1G91 A;  4IFD I;  1Y14 B;  1U0L A;  3V96 A;  4DV5 Q;  2AWO A;  5BR8 Q;  1I4R A;  3I70 A;  1PH6 A;  1CA6 A;  3BJU A;  2RDH A;  3TDQ A;  2HDL A;  3PO2 B;  3KF8 B;  4ALP A;  4P73 A;  3HFZ B;  1ASZ A;  2Q2I A;  4KHZ A;  1E22 A;  3AU7 A;  3NHH A;  2JA7 B;  2DNE A;  3K7A B;  3MEH A;  3R93 A;  2ICI A;  1D7Q A;  4JI6 L;  3OIQ A;  1M8A A;  5IYD H;  4K2K A;  4X64 Q;  1T5X D;  1L1O C;  2F0W A;  2AMC B;  1C9O A;  2H5X A;  4C2M B;  3X3M A;  1PLF A;  1AH9 A;  4IFD G;  4CDE C;  1BF4 A;  2CHB D;  4L5R C;  5IWA L;  2N78 A;  4NXN Q;  1PXU A;  4A3K G;  3GTG B;  2X69 A;  4DR5 Q;  1TT2 A;  1JWU D;  3OW2 A;  1MGS A;  4DV4 L;  1CM9 A;  5C44 B;  4IPD A;  1I3Q B;  3G6J B;  4DU9 A;  1WYD A;  4IUR A;  2R92 B;  3KF8 A;  4JI0 L;  1SDF A;  1G6Z A;  2JEA I;  4CBV A;  5LMU L;  4DV1 L;  4IFD J;  1PFM A;  4I65 A;  3KDF B;  1HZB A;  2DUD A;  4JW0 A;  3S24 A;  3PF5 A;  3OHX C;  1ILQ A;  2UUA L;  1LLR D;  3HOV B;  4B3R L;  2KCT A;  4QB4 A;  3NUC A;  3D31 A;  1Y8N B;  1V43 A;  1OXT A;  4PZ8 A;  2EZV A;  4XDX A;  4GKK L;  1ROD A;  2CWA A;  2VZA A;  1XTD A;  4DR2 Q;  4QUF A;  4ZK9 B;  2D5D A;  4NKL A;  1CA5 A;  2MPM A;  1OTC A;  1W2B A;  1L0W A;  2B3G A;  4X6A H;  4KY6 A;  2JEB I;  5K36 H;  5LL6 X;  2D2C C;  1FNU A;  4BY7 G;  1CQF A;  1S5B D;  3JAM c;  3HKZ E;  2E76 C;  4HAE A;  2NVQ H;  3M85 A;  2F0M A;  2K5Q A;  2VW9 A;  4XT3 B;  2JP1 A;  3WDN A;  2NVX B;  4P72 A;  5CMD A;  2J0T D;  1GUW A;  3KDF A;  1K8A C;  1YNJ C;  3PF4 A;  4POG A;  1DOK A;  4Q0F A;  4H0L C;  2Z8L A;  3C3L A;  1A3T A;  2FMC A;  3W1G A;  3FPP A;  2HDM A;  1BKB A;  1YEZ A;  3BU2 A;  1LO5 D;  1AZP A;  4K5X A;  1P16 A;  1Y69 U;  1UE7 A;  1EL0 A;  1VS0 A;  1W6K A;  5ELB A;  3CCL A;  3PIO 3;  3NK9 A;  2GA4 B;  1S40 A;  5FLX E;  1G2S A;  2B63 H;  2PO4 A;  2PMZ B;  1ZYR C;  2RCF A;  5M3F B;  3M4Q A;  5C5M A;  1DOM A;  4K0K Q;  3A7L A;  4KV6 A;  5C4J H;  5EQ0 A;  1KL9 A;  2L0C A;  2HHH Q;  2B2Y A;  1G29 1;  2OEO A;  1GVP A;  2B2T C;  2WB1 G;  5M3M B;  1KRS A;  2PI2 E;  1U4L A;  4H13 C;  3H3V I;  3QG1 A;  3T16 A;  1JE4 A;  4LF4 L;  2TMP A;  3GV3 A;  2HIV A;  2OT2 A;  4JYA Q;  3PIP 3;  3AYH B;  3NE5 B;  5ELD A;  4GZY C;  2ICE C;  4ZLT F;  2ASB A;  4JVZ A;  1HFN A;  1ZXT A;  4UP9 A;  1KAB A;  2A6E C;  5I9P A;  2M2L A;  2R7Z B;  4HSV A;  3DUZ A;  3OTO Q;  1A6X A;  3E9I A;  2VQF Q;  3RZD H;  5IGE A;  1B4O A;  1V1O A;  1YNJ D;  2KEN A;  2Z6K C;  5F2D A;  1LT4 D;  3OMC A;  2UXB Q;  1N34 L;  1KLU D;  1I94 Q;  1WTP A;  4LFB Q;  1BCP B;  5IP7 G;  3MC0 B;  4DV2 Q;  1DOL A;  4JI5 Q;  1KLG D;  2N88 A;  4H44 C;  5IGF A;  5GQO A;  3H15 A;  3VDY A;  1I6H B;  1K0R A;  2KOL A;  2C5C A;  5IY0 A;  1ZYR D;  5IYB G;  2O5I C;  2LKV A;  2CQA A;  4AIM A;  5EPL A;  4XXE A;  4F8M A;  3IKJ A;  4BA2 I;  1QZH A;  3EN2 A;  1GHK A;  4HCE A;  4BS9 A;  3MEF A;  1PH3 A;  1SXT A;  4UP8 A;  5FKA C;  2YU9 B;  4LFA Q;  5DEH A;  5BN5 A;  2VUM H;  2VL6 A;  1GUS A;  4A3L H;  1VQK A;  4YCW A;  4KN7 C;  2L1B A;  2A6E D;  1IBL L;  1A63 A;  4PMW A;  4P71 A;  4KKS A;  1N33 L;  3HP3 A;  1QUQ B;  2K5W A;  1MBY A;  1BBX C;  3NTK A;  3UE0 A;  5G3L D;  4DV7 Q;  4UDU C;  4JI2 Q;  1JB7 A;  4C1N I;  1J8I A;  4QIW B;  5KND A;  1LYL A;  4A3E G;  1KAW A;  3CCQ A;  1D2B A;  3MFY A;  1SYF A;  2EE1 A;  5C3E H;  4A3G G;  4DN4 M;  1VQ4 A;  3EFX D;  2O5J C;  5E3F A;  1K3R A;  2QEJ C;  4JI4 L;  1FYC A;  1EYC A;  5DM7 3;  3CCM A;  2I5L X;  4X66 L;  2NN6 H;  3OPO A;  1SYE A;  4LF9 Q;  2EPB A;  1AP0 A;  1MJE A;  4BBR G;  4DNI A;  2QDL A;  2CW0 C;  1QUQ A;  3J7A V;  5J3B A;  3MA2 B;  1QVC A;  3D8G A;  1GUO A;  4X62 L;  2KED A;  2ATW A;  4K8J A;  1KRT A;  4QY7 A;  1B3A A;  5DAU A;  2AUJ D;  5FJ8 H;  5ISR A;  4B3M Q;  5D14 A;  1NR2 A;  3I3C A;  4OO1 H;  1SRU A;  1K28 A;  2UUB Q;  4JK1 C;  5KGU A;  3H94 A;  2MP1 A;  3UI2 A;  3IAY A;  5C4X G;  2RSO A;  1ESR A;  2EYL A;  4N8F A;  5M9O A;  1Z9F A;  5EBC A;  1B9N A;  4KY5 A;  3I4N G;  3PUW A;  3A54 A;  2PCF B;  2E2I B;  2JYO A;  4YY3 Q;  3URY A;  5JVH 3;  3EA6 A;  1IW7 C;  2XIW A;  2A68 C;  3S1N B;  1VMP A;  5IT9 c;  3PV0 A;  4FVM A;  1Q8I A;  3GTO H;  1EU3 A;  5HGQ A;  4KTA A;  3HOW B;  3A8K E;  1KDC A;  3K57 A;  2B8G A;  2PW7 A;  1PYB A;  3OW7 A;  2KEE A;  2D9U A;  4ZKB B;  1SNO A;  3ULJ A;  5LMN Q;  4DR4 L;  1U5K A;  4IPH A;  4OIK A;  1CSP A;  1HR0 Q;  3ITP A;  5FK9 C;  4LNQ A;  3GTK B;  2E2J B;  4A3E H;  3GTM H;  4HIO A;  1VQD A;  3JAM L;  4DV6 Q;  3M4O H;  4KJO A;  4JPB W;  3FDT A;  1PFN A;  1N36 L;  3MXG A;  4K14 A;  3KLW A;  4DK1 A;  1MHW C;  4KMU C;  4HIK A;  2JXM B;  2QF7 A;  5T1G A;  4A4I A;  3CCJ A;  3SHL A;  4GKJ L;  2LSS A;  2ALY B;  1WVL A;  1D5Z C;  1E3P A;  1TWG H;  3BS1 A;  3J80 i;  2K5N A;  2L5T A;  2ZXP A;  3GTJ H;  1KXL A;  2CCZ A;  4NMZ A;  4O1N A;  1STH A;  1Y1W G;  1B44 D;  4K6D A;  1WTV A;  2QW7 A;  2LXJ A;  4EX5 A;  1XPR A;  3PO3 H;  1YBY A;  4L8J A;  5KEE A;  3J7Y W;  3K5O A;  5IOD A;  3CPF A;  3S1M B;  3KFU A;  1HHV A;  4NP5 A;  5FO9 B;  4DUZ Q;  1WTH A;  2HQE A;  2NB0 A;  3W5O A;  5AFW A;  3S1R H;  5CV6 A;  1PYS B;  4RCO A;  5KRU A;  4YCV A;  1IW7 D;  1TWF H;  3S15 B;  2A68 D;  2B2Y C;  1VQP A;  4WJ3 M;  1EEF D;  4IUN A;  4A3B G;  3J81 i;  1XMO Q;  1PHJ A;  1R9T B;  3AQQ A;  1PTO B;  4A76 A;  1UE6 A;  3GTQ B;  1B2T A;  1RCV D;  3F2B A;  5CV4 A;  2NVY H;  1GKH A;  2HCI A;  1U4P A;  2RVL A;  4RKL A;  3DEO A;  3S17 B;  2R93 B;  3SR1 A;  4A3I H;  3RUZ A;  3B6Y A;  4ZUI A;  4R4C A;  5C3W A;  4N9T A;  4DR7 L;  4R4T A;  4A3K B;  3W2D A;  2K50 A;  4ZQ3 A;  3ZJY C;  3FKI H;  3L9A X;  3M7N A;  3BDO A;  3R8B A;  1PZJ D;  2K4K A;  3CAM A;  3EIV A;  3EQL C;  1WCM G;  1TR5 A;  2EY5 A;  2EYP A;  5M5W H;  2F0E A;  1STY A;  1GXD C;  4LF8 L;  4G4K A;  3CC2 A;  1S5F D;  1VF5 C;  4AYB E;  1XPU A;  1A0I A;  3C1E A;  1Q81 C;  4DPG A;  4OXP A;  2ZJR A;  2X6G A;  1TWC B;  1J9O A;  5C0X I;  3CF5 A;  4RWS C;  4DA2 A;  1K8M A;  3VYU A;  3CXC A;  2XWB B;  4OHJ A;  1EIG A;  4LF5 Q;  2E74 C;  1AFP A;  4CKE A;  2K28 A;  1IYV A;  2HCC A;  1VQJ A;  1NCV A;  4HMJ A;  5JJZ A;  2P5Z X;  3T1H L;  2RHS B;  5AJ3 L;  4QCL A;  4U67 3;  2EIF A;  1JOO A;  4X3K A;  2OQ0 A;  2A74 C;  2XTI A;  4DAM A;  2Q2T A;  3TS0 A;  1HNZ Q;  4BY7 B;  1S5E D;  4OX9 L;  1BCP C;  1TWH H;  3L2P A;  2PQE A;  2SEB D;  4DUY Q;  4YHH Q;  4A3J G;  3TP7 A;  3S1Q H;  1D8L A;  1YNX A;  1KNE A;  3HOZ H;  3O13 A;  4A3F H;  1IXR A;  2WKD A;  1JOQ A;  1N8R C;  2E2H B;  1A3U A;  2F52 A;  2F3V A;  5JVG 3;  1SMY C;  5GAG C;  4NW2 A;  1ZEQ X;  1AZQ A;  1Q1E A;  2UUC Q;  2VQE L;  3S16 B;  1I4H A;  5JEA J;  2OWO A;  1EIY B;  1KD1 C;  2ZTD A;  3T51 B;  3DWQ A;  4RGM A;  4JI3 L;  1ET9 A;  3D4D A;  2DY8 A;  3CCS A;  5IIF A;  2QDB A;  1EU4 A;  5C0X J;  3OIP A;  4DK6 C;  2EJM A;  3JAM E;  4ABN A;  2WB1 B;  3HKZ G;  1QZG A;  2YTX A;  3H0G G;  2NZH A;  3NBH B;  4L5S A;  4B08 A;  1SN8 A;  2EDG A;  3TP6 A;  2ZJQ A;  4F88 A;  5D3I B;  3J7A F;  4DV5 L;  4HJ5 A;  5G3L F;  1QOH A;  4BA1 I;  5FOB B;  2KHS A;  2WAQ E;  2F03 A;  1BCP D;  3HOU H;  4QUC A;  3NEN A;  1XYI A;  2V1C C;  3KK7 A;  3P20 A;  4C3J G;  3AFP A;  2F0F A;  1SYD A;  1PH1 A;  1U9R A;  2BCO A;  2I46 A;  5IYD G;  4R8I A;  1SMY D;  1LT5 D;  1VQA A;  1EEI D;  4A3M H;  1NE3 A;  4XT1 B;  5IT9 L;  5I2Y A;  4DXG A;  1PVO A;  1SNQ A;  2O4X A;  1Q90 A;  3M4P A;  1S3O A;  1E2W A;  3NBH A;  1S72 A;  2VS1 A;  1VQ9 A;  1H9R A;  4PQX A;  4EGV A;  2R7D A;  4DR5 L;  1I50 B;  4JI8 Q;  3HG9 A;  4CKC A;  4JI7 L;  3N6R A;  4XQJ A;  3F1Z A;  1SYC A;  1AEX A;  3G6E A;  3S14 H;  4H7B A;  4OWX B;  2IT1 A;  3ERS X;  4WOR A;  4JV5 Q;  4B9X A;  1GUN A;  1OO9 B;  1K83 H;  1IBM Q;  1I4P A;  5DNF A;  4BBS G;  1E7Z A;  2OXP A;  1HA6 A;  4R1J A;  1JJC B;  3U9O A;  4ZYS A;  2F4I A;  4EVO A;  1ET6 A;  4C3H H;  2RSN A; 
#chains in the Genus database with same CATH homology
 3I73 A;  3M7G A;  3MXU A;  1HQR D;  4TKO B;  1LTI D;  5K36 G;  4FNF A;  2EJF C;  3LWU A;  3E6Z X;  3NQI A;  4IUU A;  1B53 A;  4A3G B;  1UUP A;  1SYB A;  4DK0 A;  1STE A;  1BUV T;  5IGC A;  1EQT A;  3BYY B;  1EQV A;  1PDQ A;  1F2Z A;  2AQ2 B;  2EVB A;  4BBR B;  3K59 A;  1SYG A;  5A2Q L;  2NWG A;  2RQX A;  3CQZ B;  1HUN A;  1E2Z A;  4K5V A;  3K5L A;  1RKN A;  4FO2 A;  3K5N A;  3M3Y B;  1F2M A;  3ERO A;  5D65 A;  1SE4 A;  1F9P A;  4HSP A;  2EY1 A;  5I2X A;  2B2U A;  4Y7N B;  5C4X B;  4OL7 A;  1PTO C;  1BQQ T;  4MIU A;  1CZG A;  2BE5 D;  2O2L D;  3VA7 A;  3I4N B;  4TRD A;  2WII B;  2BA1 A;  2YYZ A;  1KDA A;  1R4P B;  3N52 A;  1JIC A;  3BYT B;  4A3D B;  1QCB D;  1HXY D;  4BY1 B;  3I8Z A;  1CTM A;  5A35 A;  2XSC A;  2F1M A;  1MSG A;  1DM0 B;  4MN3 A;  4G57 A;  3NTI A;  2BA0 A;  1Y1W B;  5KYI A;  3SK8 A;  1UAP A;  1F77 A;  1CQV A;  1MSH A;  2ZT9 C;  5IT9 E;  2AUK A;  2G9H D;  1PTO D;  5HUR A;  4CKB A;  1EWH A;  4HMI A;  1A2U A;  4IUV A;  5EKI A;  3LX0 A;  4A3B B;  1DXM A;  3S1Q B;  2FJ2 A;  2K7V A;  2PZU A;  4R9W A;  2NN6 I;  4FF4 A;  3Q24 A;  1NUC A;  2VB2 X;  1I4G A;  3DWA A;  2F0L A;  1KDB A;  4OO1 I;  2F0D A;  4KJN A;  1TQO A;  4U68 A;  5K5P A;  2XNA C;  3NSW A;  1BO0 A;  1JCK B;  1NR4 A;  4J8Q A;  1WCM B;  4FXD A;  1VCI A;  2NN6 G;  1PZI D;  5FO7 B;  1Y8O B;  1B1Z A;  4L6T B;  3SE0 A;  2NZ1 D;  2N55 A;  2LFN A;  4RH6 A;  1LV9 A;  4YIJ A;  4RGN A;  1RDP D;  2M9V A;  4IUT A;  1C4Q A;  4OO1 G;  4FF2 A;  2R3Z A;  5I6W A;  4EQO A;  1SJH D;  4F7X A;  3RD4 A;  5A2Q E;  1UEA B;  3DXJ C;  1G2T A;  3H3V C;  2BDN A;  4K5W A;  3K5M A;  1HCZ A;  1SJE D;  2KQ3 A;  3OWE B;  1PMR A;  4A3J B;  3HRZ C;  2QKI C;  5COY A;  3DM1 A;  3MHB A;  3H09 A;  1CI3 M;  3S2D B;  5J1Z A;  2IX3 A;  1F9Q A;  3BDC A;  1CFM A;  4CGY B;  2Q8I B;  3J80 L;  2B2V A;  5CV9 A;  4NDX A;  1RJT A;  4DGZ A;  3ND8 A;  4FP5 D;  5IGB A;  2EY6 A;  1PYW D;  1OXV A;  1DD2 A;  3DHQ A;  3KBX A;  4PMC A;  3TP5 A;  1QNU A;  3RZO B;  1YNN C;  2LY7 A;  3TN2 A;  2ENB A;  4IN3 A;  4HR7 B;  1X32 A;  1EIH A;  4KHV A;  4OIJ A;  3HKZ B;  3J81 L;  2IWH A;  4HTH A;  3QJY A;  4CJ1 B;  4V0B A;  1SE2 A;  2MHV A;  4V19 0;  1Z6H A;  3PUZ A;  1ENA A;  1H9J A;  2B2U C;  2HUG A;  1TII D;  3SXH A;  4RA8 A;  2KEC A;  4RCN A;  1U4M A;  3MFG A;  2XVS A;  5ELF A;  2ZXR A;  3L7Z C;  1T5E A;  2F0J A;  4KKU A;  1XWE A;  3BVZ A;  1YNN D;  2J4X A;  2F0I A;  2MJ8 A;  1F2L A;  2LMC B;  2K6A A;  1SFO B;  5EKL A;  1DCZ A;  1EZ8 A;  2CW0 D;  1A15 A;  2A69 C;  2F0H A;  3VYT A;  2DN8 A;  4Z9C B;  2FMM A;  1PRT B;  4J6H A;  4C3I G;  1E0B A;  4ZAI A;  5KNC A;  3SK4 A;  4CHT B;  1KAA A;  5TSS A;  4DNR B;  5EPJ A;  4N9P A;  1EY0 A;  3R2T A;  1IKL A;  2BOS A;  3HZX A;  2IL8 A;  2KA7 A;  3U9S A;  5T1I A;  2NVQ B;  5EGT A;  1B9M A;  3G7L A;  1K8O A;  4DF7 A;  1SND A;  2EYO A;  1JQY D;  5FO8 B;  1FD7 D;  2SNM A;  2IX0 A;  4RHS A;  1L0X B;  5IGG A;  5CV8 A;  5JAV A;  4K8I A;  5HGT A;  2C9O A;  4PNY A;  4C56 C;  2A69 D;  1IL8 A;  2B63 B;  4PMB A;  3OWF A;  5CV7 A;  3IFD A;  4ZUJ A;  1PTO F;  5C4J B;  3J80 E;  3MAQ A;  1RHP A;  4FXK C;  5BN4 A;  5JPN C;  2K04 A;  4TSS A;  2Q8T A;  3D4W A;  1I4Q A;  5E1F A;  1EYA A;  2EYJ A;  1EWC A;  3NXW A;  1BDO A;  4EQN A;  1E2V A;  1TVX A;  3T13 A;  1WTO A;  1QNK A;  1TU2 B;  2MUY A;  3RZD B;  3D6C A;  1HFG A;  3J81 E;  2ZXO A;  2Z4H A;  2J7Z A;  2RA4 A;  1EYD A;  2B8F A;  2G9D A;  3HEJ A;  1QJO A;  5CGK A;  1CZW A;  2A5H A;  4QMG A;  1I6V C;  3A56 A;  1V8Q A;  2TSS A;  5CYU A;  3VYR A;  4KD3 A;  5LHY 1;  2B2V C;  3EVQ A;  1TKW B;  2IPK D;  1LT3 D;  3QOL A;  1EY6 A;  1HRJ A;  3D6W A;  2K03 A;  3AB9 A;  1IHZ A;  1CT1 D;  2VUM B;  3Q22 A;  3F2U A;  1SNM A;  2F0Q A;  3C1F A;  4C3H G;  1BR9 A;  3C46 A;  4FF3 A;  1GJX A;  4BWG B;  1GUT A;  3R2I A;  3RLF A;  3V05 A;  4XYO A;  1LTT D;  2WP8 J;  4KN4 C;  3MXN A;  3P1H A;  3A55 A;  4XQQ A;  5C3E B;  1RTO A;  1MI2 A;  3VR6 A;  3T56 B;  2Z1C A;  1VMC A;  3GQB A;  2R6G A;  1NAP A;  4K2L A;  5JPM C;  2PYK A;  2JE6 I;  1SNC A;  4DXF A;  3VR4 A;  2B39 A;  5CV5 A;  2K32 A;  1EFI D;  1O7Y A;  2RKS A;  3ERQ A;  3OOC A;  5C3X A;  5BN3 A;  2KJX A;  2SOB A;  3SK5 A;  4LAA A;  5FLX L;  1EZ6 A;  3E5S A;  1JOK A;  2OF1 A;  2JSO A;  4X3S A;  2VXW A;  3I4M B;  3NP8 A;  3DWP A;  1STN A;  3GTO B;  1KNA A;  1BOS A;  3VR2 A;  2A6H C;  5KIX A;  3KBG A;  1O7L A;  3ND9 A;  4QF4 A;  1O7Z A;  3MZ5 A;  3P7J A;  2VNU D;  2H4O A;  5CC4 A;  4A3E B;  3GTM B;  3SVM A;  3M4O B;  3NWT A;  3RMH A;  5EKK A;  3PUV A;  1SSO A;  1XXG A;  1GUG A;  1PRT C;  3D3R A;  1WTQ A;  2PPB C;  1TWG B;  3GTJ B;  3R3O A;  2I07 B;  5E4X A;  3PO3 B;  1SEB D;  1EY8 A;  1CHQ D;  3H6M A;  4CJ2 C;  1SBB B;  4ILW A;  1LTB D;  4S3S A;  2IJ0 A;  3S1R B;  2WIN B;  3GD7 A;  2F0G A;  1TWF B;  5J39 A;  1RD9 D;  4G7H C;  2A6H D;  3AMU A;  3BZD B;  4F87 A;  2NVY B;  4R8N A;  2SDF A;  1ESF A;  1FNV A;  2DNC A;  4A3I B;  3I90 A;  1HUM A;  3QWN A;  4IZ8 A;  1PRT D;  3FKI B;  4XIG S;  1TY0 A;  5M5W B;  1LTS D;  2QCP X;  5C6A A;  4ULL A;  4WRD A;  2WAC A;  2WAQ B;  3CU7 A;  4G7Z C;  1TY2 A;  1DON A;  2QIL A;  2FIN B;  1JC7 A;  4C3I B;  1FGB D;  4LMQ D;  2E75 C;  3Q23 A;  5CBE E;  1D6E C;  1Q12 A;  2K33 A;  1WD0 A;  1H9S B;  1PTO H;  4DFA A;  4KD4 A;  1NSN S;  4IFD H;  2F0S A;  3EJI A;  1SAP A;  2VB3 X;  1TWH B;  3VA5 A;  4EQP A;  4UAI A;  1Q1B A;  3I91 A;  4HED A;  2SNS A;  4XTC S;  4A3F B;  3HOZ B;  3DMU A;  4CJ0 B;  2Q8R E;  3C2P A;  2EYH A;  3FPU B;  1PFB A;  1H9S A;  3ONA B;  3SEB A;  1S5D D;  3OSO A;  5NUC A;  2EJG C;  1XTC D;  3HGB A;  4C1N K;  1DZ1 A;  1ZKO A;  1F9S A;  3W3A A;  2XRQ D;  2KCN A;  4B9W A;  3TSS A;  4RAU C;  3D4R A;  5I9O A;  1TS2 A;  3IL8 A;  1LTG D;  2L4N A;  1LAB A;  3X3N A;  4G7O C;  1ENF A;  1TS4 A;  4M1U B;  3K6O A;  4DAV A;  4L63 B;  1EY7 A;  3KLS A;  2DY7 A;  2K05 A;  1U4R A;  5DM6 3;  3HOU B;  4ODG A;  3PMF A;  1BCP F;  3BG3 A;  1EY5 A;  2NBF A;  5I4D A;  1IYU A;  3WOF A;  3KLS X;  2EXZ A;  5EPK A;  4KI0 A;  4FF1 A;  3MVV A;  1QB5 D;  1C8C A;  5IGD A;  4A3M B;  5D3D A;  1TS5 A;  4HCS A;  3SK6 A;  2F0K A;  3S9W A;  3K0Y A;  2XWJ B;  4JBW A;  2H1E A;  3K58 A;  3IFT A;  4ME5 A;  2PNR C;  2KVM A;  1MD2 D;  2D62 A;  5ELE A;  1JWM D;  1DYQ A;  1Z7T A;  2IW3 A;  3NWS A;  3S14 B;  3CRL C;  4DNT B;  2FHT A;  2X6L A;  1SNP A;  1CHP D;  1LAC A;  3E0J A;  3VR3 A;  3QOJ A;  2NTT A;  3CHB D;  1K83 B;  1LTA D;  1UNS A;  2PW5 A;  5JOB A;  4C3H B;  1HTL D;  3FRP B;  1ICW A;  3TZU A;  3H0G B;  5IOC A;  3GTP B;  1V1P B;  2IX1 A;  5EJW A;  2L11 A;  2K1B A;  4DAY A;  3NBI A;  4Q5V A;  1EY9 A;  3WOE A;  4WJW A;  5CBA E;  3LNN A;  4C3J B;  1B50 A;  3Q0A A;  4DAP A;  3T53 B;  2A73 B;  3NTH A;  2NUC A;  1W6J A;  3A8J E;  3FEW X;  4IUQ A;  1X3Q A;  2E2D C;  4X3T A;  1L0Y B;  3TME A;  1RF2 D;  1LTR D;  1JOR A;  1V1P A;  4HN7 A;  1H9M A;  2L9H A;  4IAL A;  1HPC A;  1BNZ A;  2M00 A;  5I6Y A;  3HOY B;  1F2Y A;  3GO5 A;  1HQM C;  2CVR A;  2B2W A;  2L55 A;  4BBS B;  5ELC A;  1VF7 A;  1D1I A;  2F0V A;  4J1M A;  4PV1 C;  2EYM A;  1FNW A;  5M5Y B;  2L12 A;  2NVT B;  1SE3 A;  2EYF A;  4WFN 3;  1WTX A;  1PRT F;  4XQN A;  1EOT A;  4IQZ A;  1Z47 A;  3BVM A;  3MXP A;  1JWS D;  1GHJ A;  1HTP A;  4RGO S;  1C48 A;  3GP7 A;  2WKC A;  2JA6 B;  3DEP A;  1TS3 A;  1QE6 A;  2JA5 B;  4MHE A;  1AW7 A;  4KK7 A;  4ZRZ A;  1GOZ A;  1X3P A;  1O80 A;  5COR A;  1OXU A;  3BVG A;  2EOT A;  2Y0S B;  1JB3 A;  1S4Z A;  4KKT A;  3MTS A;  2JA8 B;  3T4A C;  1ENC A;  1FR3 A;  4P2C B;  4LK1 C;  4A93 B;  4LJZ C;  3MWY W;  3A8I E;  2NYZ D;  3VYS A;  4ZKC B;  2RDF A;  1O78 A;  1BXT A;  1HA5 A;  4FXG C;  1CK1 A;  1R4Q B;  1H9K A;  3OMG A;  2F0P A;  3TP8 A;  3I72 A;  1Y8P B;  3VR5 A;  1RTN A;  2PZW A;  3ZYY X;  3FMC A;  5C4Z A;  5E4W C;  2EY2 A;  5KYL A;  2F0T A;  2WV6 D;  4TQU S;  1WTW A;  3QB3 A;  1KTK A;  3L3O C;  3BDL A;  4RKB A;  5JEA G;  5J22 A;  5LL6 S;  2V4D A;  1EY4 A;  3GV6 A;  1OXX K;  2RBM A;  2K5D A;  3CRK C;  5CR3 A;  3P75 A;  5C0X G;  1TWA B;  2XRS D;  3NPP A;  1ML0 D;  5M5X B;  3GTL B;  1G8Z D;  3CKI B;  1A3V A;  1ONL A;  3QIA A;  1ILP A;  4I7Z C;  1JR0 D;  2AQ1 B;  2LS0 1;  3QO2 A;  3M4Y A;  4FYD A;  3S2H B;  2K01 A;  1F9R A;  3NQT A;  3I4L A;  5C5L A;  2B2T A;  1D1K A;  1A2T A;  5KNB A;  1WD1 A;  1Y1V B;  1STB A;  4KY7 A;  4IUP A;  4O42 A;  2AWN A;  2KUM A;  2F0O A;  4K6L A;  1STA A;  1II3 A;  3KUP A;  1XX8 A;  4XYQ A;  2F3W A;  4E6I A;  4RHR A;  2R61 A;  1LT6 D;  1Q3L A;  3FVQ A;  4X3U A;  5JEA H;  3LWE A;  4RGT A;  3KLR A;  2MGS A;  3HOX B;  2F0U A;  3HS0 C;  2ID0 A;  1D5X C;  5C0X H;  3TBI B;  2AQ3 B;  1STG A;  2B2W C;  4ID6 A;  4RFB A;  2F0N A;  3V2T A;  2BDO A;  2RDG A;  1WTR A;  3TZD A;  1OXS C;  2FFK B;  2Z4I A;  3SDZ A;  4OGQ C;  3A7A B;  1M4V A;  2NTS A;  1QG7 A;  4M8A A;  3H91 A;  5EBD A;  1S5C D;  1VDZ A;  4AYB B;  2PZT A;  1AN8 A;  1QWY A;  3PUX A;  5C4H A;  2XN9 C;  1I4X A;  1DJR D;  1D5M C;  1QIL A;  3PUY A;  2KCC A;  3Q6S A;  1PZK D;  1IKM A;  2BE5 C;  1G91 A;  4IFD I;  3V96 A;  2AWO A;  1I4R A;  3I70 A;  1CA6 A;  2RDH A;  3TDQ A;  2HDL A;  3PO2 B;  4KHZ A;  3AU7 A;  3NHH A;  2JA7 B;  2DNE A;  3K7A B;  3MEH A;  3R93 A;  2ICI A;  3OIQ A;  1M8A A;  4K2K A;  1T5X D;  2F0W A;  4C2M B;  3X3M A;  1PLF A;  4IFD G;  1BF4 A;  2CHB D;  1PXU A;  3GTG B;  2X69 A;  1TT2 A;  1JWU D;  1MGS A;  1CM9 A;  5C44 B;  1I3Q B;  3G6J B;  4DU9 A;  4IUR A;  2R92 B;  3KF8 A;  1SDF A;  1G6Z A;  2JEA I;  4CBV A;  4IFD J;  1PFM A;  4I65 A;  3OHX C;  1ILQ A;  3HOV B;  1LLR D;  4QB4 A;  3NUC A;  3D31 A;  1Y8N B;  1V43 A;  1OXT A;  2EZV A;  4XDX A;  1ROD A;  4QUF A;  4ZK9 B;  2D5D A;  4NKL A;  1CA5 A;  2MPM A;  4KY6 A;  2JEB I;  5K36 H;  5LL6 X;  2D2C C;  1FNU A;  1CQF A;  1S5B D;  2E76 C;  4HAE A;  3M85 A;  2F0M A;  2K5Q A;  4XT3 B;  2JP1 A;  3WDN A;  2NVX B;  5CMD A;  2J0T D;  1GUW A;  1YNJ C;  1DOK A;  4Q0F A;  4H0L C;  2Z8L A;  3C3L A;  1A3T A;  2FMC A;  3FPP A;  2HDM A;  1LO5 D;  1AZP A;  4K5X A;  1Y69 U;  1EL0 A;  1W6K A;  5ELB A;  3PIO 3;  3NK9 A;  2GA4 B;  5FLX E;  1G2S A;  2PO4 A;  2PMZ B;  1ZYR C;  5M3F B;  5C5M A;  1DOM A;  3A7L A;  4KV6 A;  5EQ0 A;  2L0C A;  2B2Y A;  1G29 1;  2OEO A;  2B2T C;  5M3M B;  4H13 C;  1U4L A;  3QG1 A;  3T16 A;  1JE4 A;  2TMP A;  3GV3 A;  2OT2 A;  3PIP 3;  3NE5 B;  5ELD A;  4GZY C;  2ICE C;  4ZLT F;  1HFN A;  1ZXT A;  1KAB A;  2A6E C;  5I9P A;  2M2L A;  2R7Z B;  4HSV A;  3DUZ A;  1A6X A;  5IGE A;  1B4O A;  1V1O A;  1YNJ D;  5F2D A;  1LT4 D;  3OMC A;  1KLU D;  1WTP A;  1BCP B;  3MC0 B;  1DOL A;  1KLG D;  2N88 A;  4H44 C;  5IGF A;  1I6H B;  2KOL A;  2C5C A;  1ZYR D;  2O5I C;  2LKV A;  2CQA A;  5EPL A;  4XXE A;  4F8M A;  3IKJ A;  4BA2 I;  1GHK A;  4HCE A;  4BS9 A;  1SXT A;  5FKA C;  2YU9 B;  5DEH A;  5BN5 A;  1GUS A;  4KN7 C;  2L1B A;  2A6E D;  4PMW A;  4KKS A;  3HP3 A;  2K5W A;  1MBY A;  1BBX C;  3NTK A;  5G3L D;  4UDU C;  4C1N I;  1J8I A;  4QIW B;  5KND A;  1D2B A;  3MFY A;  1SYF A;  2EE1 A;  4DN4 M;  3EFX D;  2O5J C;  5E3F A;  2QEJ C;  1FYC A;  1EYC A;  5DM7 3;  2NN6 H;  3OPO A;  1SYE A;  2EPB A;  1AP0 A;  2CW0 C;  3J7A V;  3MA2 B;  3D8G A;  1GUO A;  2KED A;  4K8J A;  5ISR A;  5DAU A;  1B3A A;  2AUJ D;  4OO1 H;  5D14 A;  1NR2 A;  3I3C A;  5KGU A;  4JK1 C;  3H94 A;  2MP1 A;  3UI2 A;  3IAY A;  2RSO A;  1ESR A;  2EYL A;  5M9O A;  5EBC A;  1B9N A;  4KY5 A;  3PUW A;  3A54 A;  2PCF B;  2E2I B;  2JYO A;  3URY A;  5JVH 3;  3EA6 A;  1IW7 C;  2XIW A;  2A68 C;  3S1N B;  1VMP A;  3PV0 A;  4FVM A;  1Q8I A;  1EU3 A;  4KTA A;  3HOW B;  3A8K E;  1KDC A;  3K57 A;  2B8G A;  2PW7 A;  3OW7 A;  4ZKB B;  2D9U A;  2KEE A;  1SNO A;  4OIK A;  3ITP A;  5FK9 C;  3GTK B;  2E2J B;  3JAM L;  4KJO A;  3FDT A;  1PFN A;  3MXG A;  4K14 A;  4DK1 A;  4KMU C;  2JXM B;  2QF7 A;  5T1G A;  3SHL A;  1WVL A;  1D5Z C;  3BS1 A;  2L5T A;  2ZXP A;  4NMZ A;  4O1N A;  1STH A;  1B44 D;  4K6D A;  1WTV A;  4L8J A;  5KEE A;  3J7Y W;  3K5O A;  5IOD A;  3S1M B;  1HHV A;  4NP5 A;  5FO9 B;  2HQE A;  2NB0 A;  5AFW A;  5CV6 A;  4RCO A;  5KRU A;  1IW7 D;  3S15 B;  2A68 D;  2B2Y C;  1EEF D;  4IUN A;  1R9T B;  1PTO B;  3GTQ B;  1B2T A;  1RCV D;  5CV4 A;  2HCI A;  1U4P A;  2RVL A;  4RKL A;  3DEO A;  3S17 B;  2R93 B;  3SR1 A;  3RUZ A;  4ZUI A;  5C3W A;  4N9T A;  4A3K B;  3W2D A;  4ZQ3 A;  3L9A X;  3M7N A;  3BDO A;  3R8B A;  1PZJ D;  3EQL C;  1TR5 A;  2EY5 A;  2EYP A;  2F0E A;  1STY A;  1GXD C;  4G4K A;  1S5F D;  1VF5 C;  3C1E A;  2X6G A;  1TWC B;  1J9O A;  5C0X I;  4RWS C;  4DA2 A;  1K8M A;  3VYU A;  2XWB B;  4OHJ A;  1EIG A;  2E74 C;  1AFP A;  4CKE A;  2K28 A;  1IYV A;  2HCC A;  1NCV A;  4HMJ A;  5JJZ A;  4QCL A;  4U67 3;  1JOO A;  4X3K A;  2A74 C;  4BY7 B;  1S5E D;  1BCP C;  2PQE A;  2SEB D;  3TP7 A;  1KNE A;  3O13 A;  2WKD A;  1JOQ A;  2E2H B;  1A3U A;  2F3V A;  5JVG 3;  1SMY C;  4NW2 A;  1ZEQ X;  1AZQ A;  1Q1E A;  3S16 B;  1I4H A;  5JEA J;  3T51 B;  3DWQ A;  4RGM A;  1ET9 A;  3D4D A;  2DY8 A;  5IIF A;  2QDB A;  1EU4 A;  5C0X J;  3OIP A;  2EJM A;  3JAM E;  4ABN A;  2WB1 B;  4B08 A;  2EDG A;  3TP6 A;  4F88 A;  5D3I B;  3J7A F;  5G3L F;  1QOH A;  4BA1 I;  5FOB B;  2KHS A;  2F03 A;  1BCP D;  4QUC A;  1XYI A;  3KK7 A;  3P20 A;  4C3J G;  2F0F A;  1SYD A;  1U9R A;  2BCO A;  2I46 A;  4R8I A;  1SMY D;  1LT5 D;  1EEI D;  4XT1 B;  5IT9 L;  5I2Y A;  4DXG A;  1SNQ A;  2O4X A;  1Q90 A;  1E2W A;  3NBH A;  1H9R A;  4PQX A;  4EGV A;  1I50 B;  3HG9 A;  4CKC A;  3N6R A;  4XQJ A;  1SYC A;  1AEX A;  4H7B A;  2IT1 A;  4WOR A;  4B9X A;  1GUN A;  1OO9 B;  1I4P A;  5DNF A;  2OXP A;  1HA6 A;  3U9O A;  4ZYS A;  2F4I A;  4EVO A;  1ET6 A;  2RSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...