1PYBA

Crystal structure of aquifex aeolicus trbp111: a structure-specific trna binding protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
107
structure length
107
Chain Sequence
ALIGIEDFLKVDLRVAKVLSAERVEGSEKLLKLTLSLGDEERTVVAGIAKYYTPEELVGKKIVIVANLKPRKIFGIESQGMILAASDGENLSVIVPDRDVKEGAKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA-binding protein Trbp111
publication title Crystal Structure of Trbp111: a Strcuture-Specific tRNA-Binding Protein
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Rna binding protein
total genus 14
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1pybA00
2V1CC 4A3FG 4BBSG 4IFDI 1XPOA 4NXNL 4YCWA 2OTLA 2VNUD 3IRBA 4A3BH 1VQOA 1XTDA 4UP9A 1HZAA 3TS0A 1OTCA 4ME3A 3AYHB 4DUYL 4R4TA 4LUZA 4HJ8A 3G48A 4OX9Q 2L15A 3J81j 1X3FA 1N32Q 2CFMA 4Y7NH 1NE3A 2OTJA 2NN6G 1X55A 1K9MC 4OWWB 1SN8A 4IFDJ 4K0KL 5HY6A 2UXBL 2R92H 3HOZH 5M5WH 3T1YQ 4DKAC 2OWOA 4JI6L 1SLJA 3RLFA 2MFIA 3H0GH 2JA8G 2FXQA 2EXDA 3OW2A 1B7YB 3JAMc 1GVPA 2ZJRA 4DUYQ 1NJIC 2VUMG 1CUKA 2JA5G 3CAMA 1PH9A 2IHFA 2K5VA 3PGZA 3GTGH 3S1QH 1SFOH 5C4XG 5BR8L 5C4JH 5ELOA 4DV2L 2NZHA 3OTOL 4K0KQ 4IOCA 1HR0W 3S16H 2BA0A 4UP7A 2UXBQ 4BXXG 2QA4A 4A3DG 3E9HA 2JK8A 2MQHA 3PCOB 1JJCB 2N49A 2AWNA 1PH7A 2IX1A 4JOIA 1XMOQ 1AH9A 4X66L 1VQMA 4PZ6A 4O0AA 5IE8A 3I4MH 3RLOA 4QJFA 2AWOA 1VS0A 4YCVA 4IPDA 2GVBA 2I5LX 5GADC 4DV5L 2XTIA 4JI5L 1HZ9A 3KYHC 5BR8Q 3U4ZA 4L5TA 1MJCA 1PYBA 1PH3A 3A0JA 1Z9FA 3KOJA 4R4CA 3OTOQ 4DV2Q 1AE2A 4AQYL 4JI4L 4GNXB 5IP9H 3PUVA 1WI5A 2K4KA 2K5HA 2NN6I 4IPGA 1JMCA 5GAGC 2YTXA 3HKZG 3S1RH 5JEAG 2RHQB 1GKHA 3PO3H 3CC4A 1TXYA 3PUZA 4DR5L 3EBEA 3W1GA 3J7A5 2KCMA 4PMWA 2YTYA 4HJ5A 2NVYH 4DV5Q 5LMNQ 2N78A 4JI5Q 3I4NH 1SE8A 4XTCS 2NVTH 3CCEA 1EOVA 3F2BA 2A8VA 4LF9L 4AQYQ 3BZKA 4JI4Q 1VQLA 4JYAL 4X62Q 2ES2A 2BH8A 1EYGA 1X56A 1VQKA 2ZJPA 1VQBA 5DLQE 1X65A 1R9TH 1YHBA 2E2JH 4JBKA 3HOZG 3F1ZA 1YIJA 4R1JA 3VDYA 4QIWE 1GM5A 4DR5Q 1Y1VH 3H0GG 4X64Q 1ASYA 3KFUA 4A3IH 4HJ9A 4GOPA 3GTPH 3UDGA 5M5YH 4DK6C 4LF9Q 2VS1A 3PSIA 4JYAQ 3KF8B 4DR1L 1I3QH 1FL0A 2WB1E 1Q1EA 4JCVE 2R93H 3HOWH 4AIMA 1UWVA 4IFDG 1Q1BA 3L2PA 1WYDA 1N36L 1PH1A 1IZ6A 1JT8A 5C0XI 2WB1G 1H95A 4A3EH 2ASBA 1QVFA 1QZHA 3KJOA 1N33L 3AFPA 4DR1Q 2JA6H 4GLVB 3CCQA 1VQCA 4GS3A 1TWAH 5E7NA 1KRTA 4FDBA 3ZJYC 3ERSX 4YHHL 1J5EL 1KHIA 3WWVA 5IP9G 5LMUL 1BBWA 4A75A 1YJNA 3S2DH 5AJ3L 4JI2L 5FLMH 5C0XJ 4L5RC 1LTLA 1HNXL 2UUCL 1N36Q 1PH5A 1D7QA 2IY5B 4JI8L 4DV0L 1M90C 3ULPA 3S2HH 1KL9A 2PI2E 1YJ9A 2K75A 4QY7A 4JI7L 1TWFH 2JE6I 3HOYH 3I4NG 1VQFA 1N33Q 2KBNA 2HIVA 4OWTB 1BBUA 1CSQA 5GAHC 4QGUA 3GTQH 1FVIA 4YHHQ 1L1OA 1E1OA 3G6EA 3HOVH 1J5EQ 2D0PA 2IT1A 2LSSA 2R7DA 2K5NA 4POGA 2XGTA 1CKOA 1EIYB 4MZ9A 1HNXQ 2CWPA 2UUCQ 3ER0A 2ALYB 1V9PA 2RF4A 4JI3L 4JI8Q 4DV0Q 4EQ5A 4OWXB 1Y1VG 3EIVA 3E9IA 3HOXG 4JI7Q 2VQFL 1NTGA 5IWAL 4A3IG 1E24A 1E1TA 1I50H 3I4OA 3M4PA 3JC66 2MNAA 4A3MH 1MKHA 3J81c 3KDFA 1Q82C 4JG2A 5J3BA 1PFSA 5M5XH 2RHSB 1QVGA 2KENA 1K8AC 4DR7L 1K0RA 1X6OA 2B3GA 4P73A 3CCUA 2R93G 1L2FA 3HOWG 2ID0A 4JI3Q 1B8AA 2YU9H 4A76A 3M4OH 2GVAA 2VQFQ 4NXNQ 2JA7H 4XIGS 5IWAQ 2ATWA 1LM0A 3S1NH 1U5KA 3E0EA 1C9OA 1N9WA 1I6HH 4A3JH 1JJ2A 4A3EG 4BBRH 4JBWA 1KC8C 4HIKA 3I56A 3SGIA 1CKNA 5JJIA 3MEFA 3S17H 1A8VA 2DUDA 2JA6G 2ZTCA 4DR7Q 2WAQE 3GDEA 3PIOA 1QZGA 2UUBL 3CMEA 2F52A 3RN2A 1NY4A 3PUWA 4B3ML 4JI6Q 2VUMH 5FLMG 1VQ4A 2VW9A 2UXDL 2NZOA 2A19A 1SR3A 1YEZA 5M3FH 2WAQG 4BY1H 2HT1A 2JQOA 3S24A 4A4IA 1X54A 1OXSC 1P8LA 1PYSB 1VCIA 3H15A 1Y1WH 1PH8A 2UU9L 3HOYG 4AYBE 4H02A 2WP8J 1HNWL 1FJGL 1BKBA 1X9NA 1IL2A 4BY7H 4LF6L 1TWCH 3HOVG 3J80i 1W2BA 4NPSA 4B3SL 1UE1A 5M3MH 4POFA 3GTLH 2Z6KC 4EX5A 3I7FA 2Y0SE 4GLAC 3CCRA 1A0IA 2UXDQ 3M9BA 1V43A 5C0XG 2EQSA 1CKMA 4X66Q 1VQ6A 1UE7A 4NXML 1LUZA 2UU9Q 3GTOH 5LMNW 4KLKA 3DLLA 1HNWQ 3KF6A 2ZM6L 1FJGQ 1YVCA 3UDIA 4C2MH 4A3MG 4LF6Q 4LUVA 3Q8DA 4LFBL 1G51A 4B3SQ 1RL2A 4PZ7A 3F2CA 4OXPA 4JI0L 3PUXA 2QEXA 3BJUA 2E8GA 2R92G 3GTJH 3I55A 1KXLA 2Q2IA 1NBWA 4GNXC 1PHJA 4JOIC 1VQJA 2JA7G 4KHPL 1VQIA 2RCNA 1HH2P 1EUJA 3ULJA 1Z47A 4R4IA 3UDFA 4IPCA 2ZM6Q 1N34L 4A3JG 5IP7H 3GO5A 5C3EH 5IYDH 4BBRG 1Q7YC 2UUAL 1AE3A 4IOAA 4LFBQ 1RIPA 1VQDA 2CKZB 4GN5A 2Z0SA 3GD7A 4JI0Q 1KAWA 1VQHA 2F3IA 2GN5A 3K81C 5FJ8H 4GOPB 3NENA 4LF8L 4KHPQ 4ALPA 3HOUH 4IPHA 3M7NA 2VL6A 1QVCA 3GTMH 2PQAA 5M3FG 1N34Q 4QQBX 2KCTA 2WFWA 3UDXA 2CQOA 4APVA 1HNZL 1PVOA 3K7AH 3CP0A 3I4MG 2UUAQ 4P74A 3CCJA 5ELNA 1NMFA 1KD1C 1QUQA 4UPAA 1VQAA 4BY7G 2YTVA 5IYCH 4DV4L 4R4OA 2ZJQA 2MO1A 2KHIA 4DV6L 5JJKA 3FKIH 1XPRA 1GD7A 4LW1A 2HHHL 4LF8Q 2MO0A 1S3OA 2R7FA 2ZTEA 4JC0A 4A3CH 1VQGA 1C7YA 1UEBA 3PO3G 3D31A 3RN5A 1VQEA 3GTKH 1E7ZA 4O2DA 5HGQA 4B3RL 1YZ6A 1HNZQ 1IBML 4GOPC 4IJLA 3K8AA 4P75A 3LGJA 3KJPA 3CMAA 1KQSA 4DV4Q 3DM3A 1YBYA 1KIXA 2OQKA 2E5LL 3NBHB 5H1SE 1VQPA 2D62A 3CPFA 4LNQA 4UY8C 4DV6Q 1BVSA 5LMUQ 3PF4A 5C44H 1XNRL 1WCMH 5AJ3Q 4JI2Q 2HHHQ 3ICEA 1PH4A 3UE0A 2YYZA 3M3YH 4B3RQ 4A3GH 1IBMQ 3EN2A 1X3EA 1EQQA 1L1OB 4OONA 4DR2L 3JAMi 1Q8KA 5IYDG 5C3EG 1VQNA 3CXCA 4JV5L 2E5LQ 3AFQA 2ZTDA 4NB3A 4B3TL 1L0WA 1XNRQ 1EIFA 3K0XA 4GLXA 1PA6A 1K3RA 1OXVA 5EAYA 1N32L 4DAYB 3K80C 1K73C 2EIFA 2N8NA 4L5SA 4HIOA 5FJ8G 3S14H 2B63H 4X6AH 2C35B 4TQUS 2E2IH 1M1KC 3BU2A 4HJ7A 2HIXA 1G6PA 4LFAL 2R6GA 4DR2Q 4YCUA 3T1YL 3KDFB 4GN4B 1JB7A 4JBMA 4JV5Q 3KLWA 1JE5A 2QGQA 4GKJL 4DV3L 2IHEA 3M4QA 4B3TQ 1CSPA 4OO1I 4X65L 1L1OC 2Q2HA 1Q12A 3RLNA 3RZDH 2JEAI 1G291 5IYCG 4LUOA 3STBC 1YNXA 4A3KH 1J6QA 4MNOA 3FKIG 1HJPA 1DGSA 1IBKL 2Q2UA 4A93H 1OXTA 3CD6A 4DV7L 4A3CG 1P16A 1Q86C 1IYJB 4KHZA 4HIMA 2Z6KA 4LFAQ 5FLXc 1HR0L 2K14A 1CKNB 4DUZL 4HJAA 3RNUA 3NEMA 3CC7A 4GKJQ 4DV3Q 1YI2A 4TVAB 4P71A 1I5FA 4R4QA 2LXJA 1XMOL 1EFWA 1VQ5A 4X65Q 3TRZA 1IXRA 2AHOB 1EWIA 3AQQA 1JJGA 1TWHH 3K7UC 5JJLA 4P72A 1Q81C 2UUBQ 3D0FA 1YITA 4DR3L 5C44G 4JI1L 1IBKQ 1WCMG 4B3MQ 1C0AA 2HQLA 2I5MX 3CCVA 3J7ZC 2OQ0A 3NELA 4AH6A 2B29A 4YWLA 4DV7Q 1PH2A 2DGYA 4AYBG 1HR0Q 4A3LH 4DUZQ 4A3GG 3L7ZC 2I0QA 1W3SA 2OCEA 1S72A 4GNXA 1GO3E 2VZAA 1XNQL 1Y14B 1LYLA 1EQRA 1NMGA 2Y0SG 3HKZE 4GKKL 4DR3Q 4JI1Q 1A62A 1UE5A 3TREA 5LMNL 4DV1L 1ASZA 4LFCL 4QL5A 3W5OA 1VQ9A 4YWMA 1FGUA 2K50A 3W1BA 4C3IH 2NVQH 1HZCA 4DAMA 1YHAA 4RG1A 3FHWA 4A3BG 4X62L 3U58A 2B63G 2CCZA 4YWKA 3MXNB 4DK3C 3KF6B 4NXMQ 3A5UA 4DNIA 2JA9A 4DPGA 3CC2A 2D0OA 1XNQQ 1SMXA 1Q46A 3S15H 4X64L 1MJEA 4GKKQ 4DR6L 5IT9c 4DV1Q 2YV5A 1T9HA 2A1AA 2NVXH 4L5QA 1WFQA 4LFCQ 3J80c 4A3KG 3I2ZA 3PUYA 1B70B 2BH2A 4RMFA 3PO2H 4A93G 3T1HL 4PG3A 2PNHA 3TS2A 5IYBH 3HKSA 2KHJA 4DR4L 4WJ4A 2JJQA 3STBD 2JEBI 4YY3L 1K8GA 1SRUA 1X3GA 2VQEL 5GROA 2LXKA 4BY1G 2VY3A 3A5ZB 4UP8A 3HOXH 3CCMA 4A3FH 4BBSH 2UXCL 3F2DA 2I5HA 5K36G 1Y1WG 3CW2C 4DR6Q 1I94L 3A74A 4C3HH 1OXUA 3CPWA 3L0OA 1N8RC 2IX0A 3G4SA 3HFZB 3TEHB 1WOCA 3T1HQ 5M3MG 3F8TA 2PQAB 4IO9A 3G71A 4DR4Q 2AMCB 1XMQL 1VQ7A 4YY3Q 3AEVA 4A3LG 4BA2I 2R7ZG 4GN3B 2CWAA 4C3JH 2VQEQ 5GQOA 3TQYA 1QUQB 1VQ8A 1XPUA 3U50C 2UXCQ 3H3VI 4LF5L 1K83H 2JA8H 2F4VL 4LF4L 4OO1G 3BZCA 1V1QA 3CQZH 1I94Q 3FP9A 1D8LA 3B6YA 4LWCA 4KI0A 4LF7L 1MIUA 4WJ3M 2JA5H 3J81i 3RZOH 2K52A 1PV4A 4JBJA 5C4XH 4HIDA 1E22A 2H5XA 2N3SA 2PMZE 4IJHA 4PZ8A 3PIPA 1IBLL 3CCLA 1XMQQ 2BA1A 5GAEC 3CF5A 1OXXK 5IY0A 4BXXH 4A3DH 5JEAJ 3S1MH 3PV0A 3OYYA 4LF5Q 2F4VQ 4LF4Q 2PI2A 1YJWA 1A63A 4J15A 4Y52H 3CCSA 1UE6A 2E2HH 5IP7G 4LF7Q 2Q2TA 1E3PA 1TWGH 3PF5A 1XJVA 2AKWB 3U4VA 2R7ZH 1SROA 1IBLQ 4OX9L 1U0LA 4MTNA 1PH6A 1S40A 3PO2G 1YHQA 1HZBA 1O7IA 5IYBG 3H3VH 4BA1I 3HOUG 3M85A 1KRSA 3RR5A 3ULLA 1WJJA 3UE1A
chains in the Genus database with same CATH superfamily
3HOXB 1KTKA 2V1CC 4IFDI 4A3IB 2A69C 3HEJA 4YCWA 3IRBA 4ME3A 1FNVA 4HJ8A 5FLXE 3G48A 4OX9Q 3J81j 1X3FA 1NE3A 2NN6G 5CV5A 1ENCA 5HY6A 4RHSA 2FMMA 3T1YQ 4DKAC 2OWOA 3C1FA 3ND9A 3QOJA 2FXQA 2JP1A 1B7YB 3EVQA 4DUYQ 1NJIC 3GP7A 2JA5G 2K5VA 1SFOH 3NQTA 5EKLA 4UP7A 2PO4A 3S2DB 2KA7A 4WFN3 4BXXG 2UXBQ 3E9HA 2JK8A 1FD7D 1JJCB 1QG7A 2B2VA 4XXEA 1JWSD 1XMOQ 1AN8A 3Q6SA 5JAVA 5EKIA 4G7HC 1JICA 1VS0A 2GVBA 1SNOA 2XTIA 3GTQB 1MJCA 3D4WA 4R4CA 3OTOQ 2A5HA 4JI4L 3MAQA 1WI5A 4IPGA 1JMCA 3KBGA 5IT9E 3PO3H 2RHQB 3J80E 2JYOA 2SDFA 2K05A 1HUMA 3EBEA 3W1GA 2KCMA 4PMWA 3I4NH 4DV5Q 1EOVA 1PRTD 2A8VA 2RDHA 3BZKA 2Z6BA 1C48A 2R92B 3WOEA 2H1EA 1YIJA 1TT2A 1S5CD 4HJ9A 2GA4B 3UDGA 4LF9Q 1IYUA 4JYAQ 3KF8B 1TVXA 1FL0A 3BDLA 2FINB 3S16B 4QB4A 2R93H 3ERQA 1RF2D 1EY6A 1IKLA 3J7AF 4H0LC 3C46A 1WYDA 1ESFA 1KDAA 1JT8A 3P75A 3KJOA 2JA6H 1B1ZA 4GS3A 4C3IG 1KRTA 4FDBA 2X6LA 4I7ZC 4DAVA 3WWVA 5FK9C 3P1HA 1T5XD 5FLMH 1IHZA 3S1RB 1HNXL 2UUCL 1N36Q 1D7QA 4DV0L 4I65A 3ULPA 2F1MA 1TWFH 4DN4M 3HOYH 3I4NG 1N33Q 1HQRD 5GAHC 3HOVH 1E1OA 3VYRA 2IT1A 2G5DA 4POGA 2XGTA 1R9TB 1SE3A 3ER0A 2NTTA 2RF4A 5C0XH 4DAYA 2VQFL 2B2YA 3NK9A 3GTPB 1PYWD 3NPPA 4L63B 1K28A 1LTBD 1PTOD 2LMCB 1TY2A 2PNRC 1Q82C 1I3QB 5J3BA 5IT9L 1K8AC 2KENA 5CR3A 3J80L 2F3WA 3CCUA 2R93G 1X3PA 2ID0A 1MSGA 4R8IA 4NXNQ 4O1NA 3VYTA 4A3EB 4BBRH 3PIP3 3C2PA 3SGIA 3DM1A 3MEFA 3S17H 1I4HA 2JA6G 4CJ1B 3GDEA 3PQIA 1QZGA 2NBFA 5FOBB 2C5CA 5FLMG 3DHQA 2VW9A 4B9WA 4C56C 1WTXA 2WAQG 2HT1A 2JQOA 5EPLA 5G3LF 3HOYG 1Y1WH 1PXUA 3E0JA 1PLFA 4H02A 2WP8J 4BY7H 4FP5D 1FR3A 3HOVG 1TWCH 2DJGC 1WD0A 1M8AA 4IZ8A 1PTOB 5M3MH 4POFA 5KNCA 2Z6KC 1VF7A 2F03A 2IW3A 5C0XG 4X3TA 2EQSA 4X66Q 1BUVT 1D6EC 1UE7A 2XVSA 2UU9Q 2F0NA 5LMNW 3MXNA 3A56A 1H9SB 2L0CA 3SK6A 4XQNA 3R2TA 2F0KA 4C2MH 1WTPA 4LF6Q 4LUVA 5CORA 1O7YA 1G51A 2O5IC 3PUXA 3O13A 4YIJA 2QEXA 1STBA 2B2VC 3S14B 2RVLA 1KXLA 4KY6A 1PHJA 5DAUA 1IKMA 1LTTD 1Z47A 1Y8OB 4ZLTF 1EWHA 1D5XC 1R4QB 4ME5A 5C3EH 1UNSA 4BBRG 4CDFC 4CDCC 1CHPD 2CKZB 4J1MA 4CJ0B 2K5QA 1HPCA 1VQHA 1K8MA 2F3IA 5FKAC 4A93B 4OL7A 1K3BC 5DNFA 4GOPB 4LF8L 4KHPQ 2QDBA 4IPHA 2VL6A 5M3FB 1F9QA 4HTHA 1PVOA 3OWEB 3MWYW 5ELNA 1VQAA 4BY7G 1YNNC 2MO1A 2WACA 5DM63 1BDOA 1GHKA 2ZTEA 4JC0A 1UEBA 1VF5C 5HGQA 1STEA 4ZKCB 1EY5A 1ILQA 3Q24A 4P75A 3R3OA 3CMAA 1BCPD 5CV9A 5H1SE 1VQPA 4LNQA 3CKIB 2KECA 3K5LA 1BVSA 4HEDA 5LMUQ 4DV6Q 3QR8A 2NVQB 2L5TA 1QWYA 3ICEA 2YYZA 3M3YH 5KGUA 4B3RQ 3HRZC 3BYYB 1IBMQ 2A6ED 1L0XB 5BN4A 3U9SA 1STHA 5C3EG 4JV5L 1SSOA 3HG9A 1L0WA 1XNRQ 1EIFA 3K0XA 5KNBA 5COYA 5EAYA 1N32L 1XWEA 3K80C 4UDUC 4HSPA 4X6AH 2B63H 1U4LA 2E2IH 3HOUB 3MHBA 4HJ7A 2XWBB 1ILPA 2KCNA 3H6MA 1AZQA 4N8X1 3T56B 2AQ3B 2A68C 4B3TQ 1B9NA 1CSPA 2AQ2B 4OO1I 3MC0B 1EQVA 3BYTB 1YNXA 3NBIA 4RA8A 1WTWA 5ELCA 1B50A 1MBYA 1Q86C 2HQEA 5I9PA 4KHZA 4H13C 4LFAQ 1HR0L 2K14A 1CKNB 4HJAA 2XWJB 3RNUA 3NEMA 3CC7A 4GKJQ 1LTID 4R4QA 2LXJA 1CM9A 1D5MC 3TRZA 1EWIA 3AQQA 3K7UC 3RZOB 3A8KE 1Q81C 3D0FA 2UUBQ 5EPJA 4KHVA 4DV7Q 1TS4A 1PH2A 3GQBA 2Q8TA 4HAEA 2DY8A 2I0QA 5C6AA 1SJED 1S72A 4PNYA 5FO7B 1A3UA 1XNQL 3HZXA 4ZUIA 4C1NK 1LYLA 2SNMA 1NMGA 4GKKL 4DR3Q 5LMNL 1E2VA 4DV1L 4LFCL 1VQ9A 4YWMA 2K50A 4ABNA 1HCZA 3LWEA 4PMBA 4K2KA 4K14A 3U58A 2OXPA 2K28A 2B63G 3T4AC 2CCZA 3KF6B 4NXMQ 3Q0AA 3I8ZA 2D0OA 1SMXA 1YNJC 1KABA 2LKVA 2SOBA 4QUFA 1RCVD 1MJEA 4DR6L 1F9SA 2NVXH 2XRSD 1WFQA 4A3KB 4E6IA 4Y7NB 4JVZA 1STAA 1ICFB 1EWCA 2JJQA 4V190 2CH4A 4C1NI 5GROA 2LXKA 4BY1G 2IL8A 3H0GB 2LS01 3HOXH 3CCMA 4A3FH 2UXCL 2I5HA 2EYJA 2EYLA 4KD4A 2QCPX 3G4SA 1DJRD 1GUWA 5C4JB 3T1HQ 5HURA 1SNDA 3G71A 2HDLA 3NE5B 4YY3Q 1DYQA 3VA5A 3FVQA 4GN3B 2CWAA 2VQEQ 4BA2I 4BS9A 3D8GA 3UI2A 4LF4L 3BZCA 3CQZH 1I94Q 1KDCA 3B6YA 4JW0A 2F0MA 2K52A 4JBJA 1SNMA 5C4XH 1G2SA 1U9RA 3PIPA 2N3SA 3MFGA 3CF5A 5IY0A 4KK7A 3S1MH 1EY4A 3OYYA 2ICIA 4LF5Q 1V1PA 5ELBA 2E2HH 3S15B 1ET6A 2PMZB 4LF7Q 1E3PA 1TWGH 1IW7C 3PF5A 3IFTA 3FDTA 1IBLQ 1HXYD 1SNCA 4BA1I 3AU7A 3RR5A 2B2TA 5JEAH 3UE1A 4A3FG 1VQOA 4C3HB 4EQOA 1MSHA 3MZ5A 1OTCA 4R4TA 1CQVA 3QG1A 4OWWB 1BNZA 2R92H 4K6LA 1SLJA 2CW0C 4KD3A 3RLFA 1E2ZA 2JA8B 1A15A 3FPUB 1DOMA 3OW2A 1NSNS 2N55A 2VUMG 1CUKA 3CAMA 5T1IA 3PGZA 5C4XG 1TWAB 5ELOA 1XXGA 4DV2L 1B3QA 4IOCA 3S16H 2DJFC 2Z1CA 2MQHA 2N49A 2AWNA 1E0BA 2IX1A 2EYOA 2PZWA 1SYGA 4PZ6A 5IE8A 4QJFA 2WINB 4KTAA 3DMUA 4IPDA 2I5LX 4G4KA 5JVH3 3FRPB 3KOJA 5IP9H 2K4KA 2K5HA 3SVMA 1MHWC 3S1RH 5JEAG 1GKHA 3CC4A 2DY7A 3PUZA 4DR5L 3J7A5 4HJ5A 2N78A 1SE8A 2NVTH 3CCEA 1CA6A 4WORA 4LAAA 1Y69U 3VR5A 4JI4Q 4MN3A 4FXKC 2ES2A 1EYGA 1F9RA 1VQKA 1CFMA 4TSSA 5DLQE 1R9TH 1SYDA 4R1JA 3VDYA 4QIWE 1B9MA 1GM5A 3TP7A 2JA7B 1Y1VH 4RWSC 3GTPH 3R8BA 1I6HB 2B2WA 5E4XA 2KHSA 2VXWA 2I46A 3MA2B 4DK6C 4HMJA 3GTGB 4DR1L 1I3QH 3K59A 1Q1EA 5JPMC 1UWVA 2EYFA 3L2PA 1TS2A 4EQNA 2WB1B 4DXFA 4A3EH 3I4MB 1EZ6A 2CQAA 2ASBA 2BDNA 1QVFA 3JAML 2PZTA 5IIFA 4GLVB 5KNDA 1ONLA 5JJZA 5IP9G 1BBWA 2F0UA 3NBHA 3SDZA 5C0XJ 4L5RC 2I07B 1LTLA 2JSOA 4B9XA 3VA7A 5J39A 3OMGA 4S3SA 1STGA 1M90C 4F88A 4KJNA 4JI7L 4FF2A 1A6XA 3HS0C 2K1BA 4OWTB 2EOTA 3IAYA 4OGQC 1L1OA 3G6EA 1X3QA 2LSSA 5CV7A 2R7DA 1PTOH 1HNXQ 2UUCQ 2G9HD 2ALYB 1V9PA 4JI3L 3GTJB 4DV0Q 1TS5A 4EQ5A 1Y1VG 3EIVA 1HUNA 5IGCA 1E24A 3M7GA 1NNXA 3I4OA 3M4PA 3JC66 1VMCA 4R8NA 2BDOA 3KDFA 5LL6S 2RHSB 1PDQA 1WTQA 4DR7L 1X6OA 4P73A 3HOWB 1L2FA 4DNTB 1Q8IA 4C3JG 3M4OH 4IUQA 2ZXRA 1BO0A 1CA5A 2TSSA 2VQFQ 2X6GA 2ATWA 1LM0A 2HDMA 3S1NH 3VR4A 3E0EA 5KYLA 1C9OA 1N9WA 4A3EG 5D3DA 3ONAB 2WAQE 4HMIA 3NWSA 2MPMA 3W2DA 2F52A 3CMEA 1NY4A 3PUWA 4JI6Q 2B2TC 1YNND 4KKSA 4MHEA 1VQ4A 4J8QA 2UXDL 2OEOA 2A19A 5BN5A 5M3FH 3S24A 1X54A 1PH8A 1CHQD 4AYBE 1RDPD 1FJGL 1IL2A 2E74C 3OHXC 1W2BA 1HA5A 4B3SL 1UE1A 3H91A 3GTLH 5I2YA 2EJGC 3I7FA 4GLAC 3NXWA 1A0IA 1CZWA 3M9BA 1ZYRC 1LUZA 3GTOH 4OO1H 1I50B 1O7LA 2ZM6L 2K6AA 4A3MB 2Y0SB 3PMFA 3IL8A 1F77A 2Z8LA 2F0DA 2EY2A 3F2CA 5M5XB 2J7ZA 4OXPA 1JOOA 3BJUA 2E8GA 2YU9B 2H4OA 3VYUA 4RHRA 2Q2IA 1VQJA 2RBMA 3MXUA 3ULJA 4R4IA 2NZ1D 5IP7H 1F2MA 3GO5A 4RGMA 3VYSA 1Q7YC 1AE3A 4CKBA 3RZDB 4GN5A 3GD7A 1D5ZC 2XN9C 3VR6A 1KAWA 4IN3A 2A68D 2NWGA 1HHVA 3X3NA 5A2QE 3HOUH 4FF3A 4NKLA 1QVCA 2PQAA 5M3FG 4QQBX 1HNZL 3SEBA 3CCJA 4UPAA 3J7YW 3KK7A 1TWHB 5IYCH 1NR4A 4RFBA 1XPRA 2RA4A 2F0QA 2QKIC 2HHHL 4LF8Q 2Z4IA 2WKDA 3PO3G 3RN5A 4IUNA 4O2DA 1KLGD 2B2WC 4IJLA 1TU2B 3LGJA 1EEID 3DM3A 2OQKA 2D62A 3CPFA 2F0SA 4NDXA 3PF4A 4HR7B 5AJ3Q 4JI2Q 3OIQA 1H9RA 2G9DA 3UE0A 5D3IB 4MTKA 4A3GH 4O42A 2EYMA 4OONA 3JAMi 1Q8KA 3M4YA 1PZID 5EJWA 2ZTDA 5CV4A 2ICEC 1GUGA 1PA6A 1X32A 4DAYB 3PO2B 4L5SA 4HIOA 4M1UB 3OPOA 2Z4HA 4F8MA 3BU2A 3E6ZX 3QO2A 1PRTF 3GTMB 2FJ2A 2R6GA 3T1YL 4GN4B 4JBMA 4QF4A 3K7AB 1JE5A 4JV5Q 3G7LA 1C8CA 1L1OC 2F0WA 2JEAI 2B8GA 5IYCG 3STBC 4A3KH 1PFBA 3VR2A 1J6QA 4MNOA 5A35A 1HJPA 1S5BD 1P16A 1JR0D 1QE6A 3SR1A 4LMQD 3GTKB 5J22A 4FNFA 2Q8RE 1YI2A 4TVAB 4P71A 1VDZA 1XMOL 5C4ZA 2AHOB 3OW7A 1PFMA 1EIHA 2JA5B 5A2QL 5C44B 1YITA 1W6KA 1WCMB 3NUCA 4DNRB 4B3MQ 2HQLA 2I5MX 3CCVA 4FXDA 4AH6A 5LHY1 4AYBG 4DK1A 3RMHA 1HR0Q 4A3LH 1NUCA 2EE1A 3A54A 4A3GG 2RSNA 4GZYC 4GNXA 1GO3E 3TMEA 1BR9A 2MGSA 1PZKD 1Y14B 1SNQA 1ENFA 4ZRZA 1HTPA 4RGNA 3W5OA 4DAMA 4RG1A 3FHWA 1JQYD 1DONA 3MXNB 2MHVA 2K04A 2JA9A 1LTAD 1XNQQ 2WIIB 3S15H 2O5JC 4GKKQ 3PIO3 3WOFA 1WTHA 4DV1Q 1T9HA 4LFCQ 3K5NA 4L5QA 3L3OC 4A3KG 5JVG3 3PUYA 4RMFA 2FMCA 3D6WA 4BWGB 3OWFA 2JEBI 1K8GA 1PTOF 3A5ZB 1Y1WG 4DR6Q 4C3HH 1MGSA 2CW0D 3BDCA 3CPWA 2IX0A 3TEHB 3TZDA 5M3MG 4IO9A 4A3LG 1LACA 5GQOA 1TQOA 3V96A 2JA8H 3H3VI 2UXCQ 4DXGA 1JE4A 3K0YA 1D8LA 3EFXD 4KI0A 4TRDA 3J81i 1GXDC 1TS3A 4C3IB 2QF7A 4QMGA 2BA1A 2PQEA 1RJTA 4KKTA 1OXXK 4A3DH 5JEAJ 4OIJA 3PV0A 4XT1B 1ZEQX 3I91A 3DWQA 4LF4Q 1QOHA 4J15A 1C4QA 4OEMB 1UE6A 4Y52H 4XQJA 1XJVA 4EGVA 1TKWB 4OHJA 2B2UA 5I9OA 3CRLC 1JB3A 4DF7A 1Q90A 1Y8PB 3I70A 1WJJA 4BBSB 4NXNL 3NQIA 2OTLA 3T53B 4A3BH 4UP9A 1HZAA 4C3HG 1U4MA 2F0VA 4LUZA 2CFMA 2OTJA 1X55A 4ZUJA 1SN8A 2PW5A 4K0KL 2R93B 3DUZA 3HOZH 2B2YC 1EU4A 2MFIA 2K7VA 1K83B 2JA8G 1RTOA 3EA6A 3JAMc 1GVPA 4CHTB 2IHFA 3GTGH 4F87A 2JA6B 5BR8L 2F0IA 1F2LA 4KV6A 5CC4A 2QEJC 5C5LA 2QA4A 4A3DG 4IFDH 2K32A 3K5MA 2XSCA 3NWTA 1KDBA 4JOIA 1B3AA 1AH9A 5FO9B 4X66L 1TWFB 5CMDA 3HOYB 3D6CA 3I4MH 3RLOA 5IGFA 5IGGA 4JI5L 1HZ9A 2R7ZB 3U4ZA 1PMRA 4L5TA 1PH3A 1Z9FA 4DV2Q 1AE2A 3BZDB 1D1IA 4AQYL 2EZVA 3H94A 3PUVA 5F2DA 4DGZA 5GAGC 3HKZB 1BCPF 3WDNA 4Q0FA 1Z7TA 1WTOA 1LO5D 4FVMA 4A3BG 4XTCS 3F2BA 4FF4A 2VB2X 4ULLA 3D4DA 3X3MA 2A69D 1GOZA 4X62Q 2BH8A 1X56A 1VQBA 1X65A 1YHBA 2Q8IB 5M5WB 2E2JH 4JBKA 3F1ZA 3HOZG 2BOSA 3DXJC 2X69A 4DR5Q 1EZ8A 3E5SA 2RQXA 4X64Q 3H3VC 1ASYA 3NP8A 2KUMA 4A3IH 3K5OA 3SE0A 4BBRB 3F2UA 3S17B 2PZUA 3S1QB 5C4HA 3HOWH 4RKBA 1HTLD 4IFDG 1R4PB 2PYKA 3NTKA 3TZUA 3I90A 2ENBA 3GV6A 2P5ZX 1S5DD 2L55A 1PH1A 1I4XA 2F4IA 5C0XI 2WB1G 1H95A 1O7ZA 1MI2A 3HGBA 4LK1C 4DR1Q 3S2HB 1KNAA 2EJMA 1TWCB 2K03A 1VQCA 3CCQA 5E7NA 4YHHL 2DNEA 3ZJYC 3ERSX 1HQMC 1KHIA 1J5EL 5LMUL 5KRUA 5DM73 3S2DH 2VB3X 1SEBD 1U4RA 2IY5B 4JI8L 1EU3A 4XYOA 1HFNA 1KL9A 1QJOA 2K75A 4QY7A 5CBAE 1AW7A 2NVYB 2RCFA 2KBNA 2HIVA 4K2LA 3ZYYX 1CSQA 4QGUA 1ZYRD 1AZPA 3GTQH 1FVIA 2O2LD 1V1PB 2K5NA 1T5EA 1CKOA 1CI3M 2LY7A 2ZXOA 1OO9B 1JWMD 2CWPA 3QIAA 5CBEE 5CYUA 1PFNA 1L0YB 4RKLA 3HOXG 4JI7Q 1NTGA 5NUCA 5IWAL 4A3IG 4FYDA 1E1TA 1I50H 5C3EB 5M5YB 2F0GA 2F0OA 4A3MH 2XIWA 1MKHA 3J81c 2A6HC 5M5XH 1QVGA 5I6WA 1J9OA 2B3GA 3JAME 3HOWG 1XTCD 2F0JA 4JI3Q 3BVMA 2YU9H 4A76A 1LTSD 2GVAA 1XX8A 3K58A 1I4RA 5L37A 4KMUC 1JJ2A 4ZYSA 4JBWA 4HIKA 3I56A 1BQQT 4DR7Q 1A3VA 2B2UC 3SK5A 3PIOA 2UUBL 3DWPA 4DU9A 4XDXA 2KEDA 2TMPA 1SR3A 1YEZA 1SBBB 1TIID 4A4IA 1OXSC 1VCIA 1HNWL 1UUPA 4ID6A 1GUSA 1X9NA 4TKOB 3A7LA 4DAPA 3R93A 2EYPA 3I4LA 4KY7A 1EQTA 3T16A 2UXDQ 3BVZA 1RHPA 5EKKA 3M3YB 1BCPC 4PMCA 1CKMA 4CGYB 1VQ6A 1G2TA 4NXML 3MTSA 2SEBD 4KLKA 3DLLA 1WTRA 1FJGQ 1AEXA 1YVCA 4RCOA 2DNCA 4A3MG 2NYZD 2CVRA 1EY8A 4B3SQ 1RL2A 4LFBL 4ILWA 1FNUA 4PZ7A 1EYAA 4JI0L 3OOCA 2R92G 2E2IB 5IODA 4JOIC 1SDFA 1EYCA 1HH2P 5J1ZA 1DD2A 3UDFA 1JCKB 2ZM6Q 4A3JB 1N34L 2ZT9C 4KN7C 5IYDH 2UUAL 1F9PA 4IOAA 1RIPA 2IPKD 4HCEA 5E3FA 1O78A 3G6JB 3K81C 5FJ8H 5ELEA 5AFWA 4ALPA 1FGBD 2OT2A 3M7NA 2K33A 4IUVA 5KYIA 3GTMH 1AP0A 4BY1B 2KCTA 2WFWA 3LX0A 4APVA 3J7AV 3K7AH 3CP0A 2EY1A 4L6TB 4P74A 1NMFA 2XNAC 1QUQA 4KY5A 4DV4L 3OIPA 2KHIA 5JJKA 3QJYA 4LW1A 1G8ZD 2R7FA 1S3OA 1V8QA 5EBCA 1VQGA 1TY0A 4FO2A 1VQEA 4KKUA 3GTKH 1E7ZA 1YZ6A 3AMUA 1HNZQ 4G57A 5JPNC 4WJWA 1H9KA 2B39A 1KQSA 1YBYA 2E5LL 2J0TD 3NBHB 2F3VA 4HSVA 3Q23A 2WV6D 5C44H 1WCMH 2HHHQ 1PH4A 2F0FA 4XT3B 2IWHA 2M2LA 3J81E 1I6VC 3EN2A 1EQQA 1L1OB 1JOKA 3MXGA 4N9TA 5C5MA 4DR2L 5IYDG 3A7AB 4NB3A 2K5DA 2NVXB 2QILA 4GLXA 1K3RA 2PCFB 1OXVA 5FJ8G 3S14H 2C35B 1SMYC 4L8JA 4HCSA 3KDFB 4A3FB 3KLWA 1SYBA 2QGQA 2E2DC 4DV3L 3M4QA 2BCOA 4X65L 4CDDC 1Q12A 1LTGD 1G291 3V2TA 2AUJD 3FKIB 5D65A 1IBKL 2Q2UA 2WKCA 4A93H 3MXPA 2A73B 1V1OA 4HIMA 2Z6KA 3URYA 4DUZL 3T51B 4IUTA 1EFWA 3CQZB 1I5FA 5ELDA 4CKCA 4H7BA 1IXRA 3A8IE 2CH4W 2VUMB 5TSSA 5JJLA 5IGBA 4P72A 5C44G 4JI1L 5C4XB 1WCMG 1C0AA 3NELA 2DGYA 3S1MB 3L7ZC 1ZXTA 2E2HB 4JK1C 3FPPA 4IUPA 1TWGB 3HKZE 1ZKOA 1D2BA 1A62A 4OELB 2NVQH 3U9OA 2F0EA 2EDGA 1FGUA 4C3IH 3W1BA 1HZCA 1YHAA 3TSSA 1KNEA 3KLSX 4YWKA 4DK3C 1I4QA 3A5UA 4DPGA 1DZ1A 3CC2A 3MEHA 1QNKA 3N52A 3K6OA 4DA2A 3J81L 1NR2A 2F0HA 4A93G 3FMCA 4PG3A 1SYEA 2RDFA 3HKSA 5IYBH 4DR4L 1SAPA 4WJ4A 3MVVA 1S4ZA 3KF8A 1SRUA 2BE5C 1CQFA 3SK8A 2VY3A 4BBSH 1E2WA 3F2DA 3A74A 3L0OA 1H9JA 5G3LD 4F7XA 1WOCA 4CJ2C 3F8TA 2PQAB 4M8AA 5EGTA 1VQ7A 1XMQL 3AEVA 1UAPA 1XPUA 3U50C 5IGEA 1U4PA 1K83H 5DEHA 2F4VL 4OO1G 5FLXL 1EYDA 3FP9A 4LWCA 5E4WC 3RZOH 3EQLC 1PV4A 2EY5A 2AQ1B 4HIDA 1Y8NB 2PPBC 3TBIB 1AFPA 4PZ8A 2PMZE 4IJHA 4J6HA 1PRTB 1I4GA 2C9OA 4N9PA 4X3UA 1YJWA 1H9MA 3GV3A 5IP7G 3CU7A 2Q2TA 1SYCA 1RKNA 2HCIA 2L11A 4X3KA 2NVTB 3U4VA 4JPBW 1YNJD 2R7ZH 1SROA 4OX9L 1BBXC 4MTNA 1B2TA 5IYBG 5CGKA 3KLRA 2E76C 3HOUG 3M85A 1XYIA 3DEOA 3ULLA 1Y1VB 1NAPA 4BBSG 1XPOA 2VNUD 1XTDA 3TS0A 3SHLA 1D1KA 3AYHB 4DUYL 2L15A 1N32Q 4Y7NH 3BDOA 4ZAIA 1S5FD 1K9MC 4IFDJ 3TN2A 2UXBL 1I4PA 2D9UA 4C3JB 2B8FA 4K5XA 5M5WH 1W6JA 4JI6L 1WTVA 3H0GH 3CHBD 2M00A 1WVLA 2EXDA 2ZJRA 4K8IA 4V0BA 1K0SA 2L12A 1PH9A 5IGDA 3S1QH 3A55A 1EFID 5C4JH 4DK0A 2NZHA 3OTOL 4K0KQ 1HR0W 2BA0A 1HFGA 1STYA 3PCOB 2NTSA 3D3RA 2XRQD 3NHHA 1PH7A 3L9AX 1VQMA 4O0AA 1A3TA 2AWOA 4YCVA 5GADC 1LLRD 4DV5L 1IL8A 3KYHC 3S2HH 5BR8Q 2R7ZG 1PYBA 3A0JA 4EVOA 3N6RA 4IURA 1H9SA 2ZXPA 1IW7D 4GNXB 5JOBA 2NN6I 4G7ZC 2E75C 2R61A 2YTXA 3HKZG 3HP3A 4DFAA 3SK4A 1TXYA 4PQXA 4ZCKA 2YTYA 2NVYH 5LMNQ 1GUNA 3DWAA 4JI5Q 4LJZC 1J8IA 4LF9L 4AQYQ 1VQLA 4JYAL 1EL0A 1ESRA 2ZJPA 1LABA 4ZKBB 2A6HD 3OSOA 3M4OB 5KEEA 4RH6A 1QB5D 3I73A 3H0GG 1G6ZA 2D5DA 2RDGA 3KFUA 3S1NB 4GOPA 1LV9A 5M5YH 3H09A 2VS1A 3PSIA 4QIWB 1SFOB 3S9WA 2WB1E 1ICWA 4JCVE 4AIMA 5I2XA 4XQQA 1Q1BA 2N88A 2KVMA 1N36L 1MD2D 1IZ6A 2DN8A 3KLSA 1QZHA 1N33L 3AFPA 1TWAH 2L9HA 2SNSA 4A75A 1YJNA 3P20A 3TP5A 5EBDA 3GTLB 5AJ3L 4JI2L 3C1EA 2F0PA 3PO3B 4EQPA 1PH5A 2CHBD 4RGOS 2PI2E 1YJ9A 3IFDA 4FXGC 3GTOB 2JE6I 1II3A 3I4NB 4MIUA 1VQFA 3Q22A 1BBUA 4IALA 1LT4D 4YHHQ 5LL6X 1J5EQ 2D0PA 4B08A 1HA6A 5KIXA 4R9WA 3A8JE 3DEPA 1EIYB 4MZ9A 5ISRA 4K5VA 1STNA 4JI8Q 2J4XA 1PRTC 4OWXB 1LT6D 3E9IA 4G7OC 2AUKA 1JOQA 2MNAA 4I7AA 5CV8A 1A2UA 4JG2A 2PW7A 1PFSA 1ML0D 1BF4A 2HCCA 1K0RA 2QDLA 5I4DA 4XYQA 1B8AA 3W3AA 3TP6A 5I6YA 1Z6HA 2JA7H 4XIGS 5IWAQ 1CT1D 2K01A 1U5KA 4CDEC 2EVBA 4WRDA 1Q3LA 1I6HH 5IOCA 4A3JH 1KC8C 1CKNA 1QILA 3ND8A 3OMCA 5JJIA 1A8VA 2DUDA 1CZGA 1SNPA 2ZTCA 3LWUA 1BCPB 3RN2A 4B3ML 1ET9A 3RUZA 3FEWX 2NZOA 4FF1A 2OF1A 1ENAA 2WAQB 2FHTA 4BY1H 3H15A 1P8LA 1PYSB 1EIGA 2UU9L 5T1GA 3SXHA 2R3ZA 1BKBA 3HOVB 4LF6L 3J80i 4NPSA 4EX5A 4RAUC 2Y0SE 3CCRA 4AYBB 3I3CA 1V43A 2IJ0A 4A3GB 4PV1C 1HNWQ 1S5ED 3KF6A 3UDIA 3T13A 4IQZA 3Q8DA 4CBVA 4KJOA 3GTJH 2Z9HA 1B4OA 1CTMA 3I55A 1NBWA 1PTOC 2MP1A 3BG3A 4GNXC 2JA7G 4KHPL 1VQIA 2RCNA 1EUJA 3LNNA 3D4RA 4UHVA 4IPCA 1IYVA 4A3JG 1GHJA 1SMYD 3KBXA 2FFKB 2F0LA 1KAAA 4LFBQ 1JORA 1VQDA 1DOLA 2Z0SA 3ITPA 4JI0Q 2GN5A 3CRKC 3NENA 2LFNA 2A74C 5C3XA 1N34Q 3UDXA 5ELFA 2CQOA 1RTNA 3NSWA 1Y1WB 3I4MG 2UUAQ 1WD1A 1A2TA 1KD1C 2MUYA 4BY7B 2YTVA 3AB9A 4R4OA 2ZJQA 2KEEA 4DV6L 3FKIH 5M3MB 1GD7A 1JWUD 2MO0A 4A3CH 4K5WA 1C7YA 2KQ3A 2K5WA 3D31A 1F2YA 1KLUD 1RODA 4B3RL 1IBML 4GOPC 3C3LA 1UEAB 3K8AA 3KJPA 2V4DA 4C2MB 4DV4Q 2EJFC 1KIXA 2VUMH 4UY8C 1B53A 1XNRL 4QUCA 3EROA 5EPKA 2EYHA 4U673 1X3EA 3BS1A 1B44D 2F0TA 4H44C 1SXTA 1VQNA 3CXCA 2E5LQ 3AFQA 5BN3A 4B3TL 4RCNA 1G91A 2HUGA 1K73C 2EIFA 2N8NA 3TP8A 4CKEA 1LT3D 4TQUS 4Z9CB 2O4XA 1M1KC 2HIXA 1G6PA 4LFAL 3NTHA 1CK1A 4YCUA 4DR2Q 4ODGA 1JB7A 4GKJL 2IHEA 1EOTA 4ZK9B 4HN7A 2Q2HA 2EXZA 1NCVA 2RSOA 2BE5D 3RLNA 3RZDH 4LUOA 1M4VA 3FKIG 1DGSA 4X3SA 1OXTA 3CD6A 4DV7L 4A3CG 1DM0B 1IYJB 5FLXc 4RGTA 1F2ZA 2KJXA 4DV3Q 1RD9D 5K36H 1VQ5A 4X65Q 4NMZA 2EY6A 3BVGA 1JJGA 1DCZA 1TWHH 4DR3L 1IBKQ 3J7ZC 2OQ0A 2B29A 4YWLA 3NTIA 4UAIA 4A3DB 4NW2A 5HGTA 4DUZQ 1GUTA 5CV6A 1QNUA 4ZQ3A 1W3SA 2OCEA 2VZAA 1BOSA 5EQ0A 1TR5A 1EQRA 2Y0SG 5K5PA 4IUUA 4KN4C 3TDQA 2MJ8A 4JI1Q 1ASZA 1UE5A 3TREA 2NUCA 4QL5A 2A6EC 1DOKA 4U68A 4X62L 2B63B 2L1BA 1O80A 4DNIA 4K8JA 3VR3A 4P2CB 1Q46A 5M9OA 4X64L 2NB0A 1HRJA 4A3BB 5IT9c 2YV5A 2A1AA 3J80c 3I2ZA 1JC7A 1B70B 2BH2A 3K57A 3PO2H 3T1HL 3TS2A 2PNHA 1FNWA 2KHJA 5D14A 3EJIA 3STBD 3HOZB 4YY3L 3P7JA 2JN4A 3E3XA 1X3GA 2VQEL 4N8FA 1GJXA 4UP8A 1PZJD 3I72A 2D2CC 5K36G 1GUOA 3CW2C 1I94L 1LT5D 1OXUA 2IX3A 1SE2A 1N8RC 1EY9A 3HFZB 3RD4A 2NN6H 1DXMA 4DR4Q 1EEFD 2AMCB 2KCCA 1SE4A 4C3JH 2HD3A 3TQYA 1QUQB 1VQ8A 4LF5L 2M9VA 1V1QA 2L4NA 1MIUA 4LF7L 4QCLA 4WJ3M 3MFYA 2JA5H 3R2IA 1SJHD 3V05A 1BXTA 1K8OA 1E22A 2EPBA 1VMPA 2H5XA 1EY7A 1IBLL 3CCLA 1XMQQ 5GAEC 3KUPA 4BXXH 4OIKA 3QB3A 1FYCA 1LTRD 1QCBD 2F4VQ 2PI2A 4Q5VA 1A63A 3IKJA 3CCSA 2KOLA 5E1FA 2QW7A 4NP5A 1SYFA 2AKWB 3QWNA 1U0LA 1PH6A 1EY0A 2JXMB 3QOLA 1YHQA 1HZBA 1S40A 3PO2G 1O7IA 3H3VH 2E2JB 2RKSA 1KRSA 5C3WA 4K6DA 5FO8B
chains in the Genus database with same CATH topology
2V1CC 4A3FG 4BBSG 4IFDI 1XPOA 4NXNL 4YCWA 2OTLA 2VNUD 3IRBA 4A3BH 1VQOA 1XTDA 4UP9A 1HZAA 3TS0A 1OTCA 4ME3A 3AYHB 4DUYL 4R4TA 4LUZA 4HJ8A 3G48A 4OX9Q 2L15A 3J81j 1X3FA 1N32Q 2CFMA 4Y7NH 1NE3A 2OTJA 2NN6G 1X55A 1K9MC 4OWWB 1SN8A 4IFDJ 4K0KL 5HY6A 2UXBL 2R92H 3HOZH 5M5WH 3T1YQ 4DKAC 2OWOA 4JI6L 1SLJA 3RLFA 2MFIA 3H0GH 2JA8G 2FXQA 2EXDA 3OW2A 1B7YB 3JAMc 1GVPA 2ZJRA 4DUYQ 1NJIC 2VUMG 1CUKA 2JA5G 3CAMA 1PH9A 2IHFA 2K5VA 3PGZA 3GTGH 3S1QH 1SFOH 5C4XG 5BR8L 5C4JH 5ELOA 4DV2L 2NZHA 3OTOL 4K0KQ 4IOCA 1HR0W 3S16H 2BA0A 4UP7A 2UXBQ 4BXXG 2QA4A 4A3DG 3E9HA 2JK8A 2MQHA 3PCOB 1JJCB 2N49A 2AWNA 1PH7A 2IX1A 4JOIA 1XMOQ 1AH9A 4X66L 1VQMA 4PZ6A 4O0AA 5IE8A 3I4MH 3RLOA 4QJFA 2AWOA 1VS0A 4YCVA 4IPDA 2GVBA 2I5LX 5GADC 4DV5L 2XTIA 4JI5L 1HZ9A 3KYHC 5BR8Q 3U4ZA 4L5TA 1MJCA 1PYBA 1PH3A 3A0JA 1Z9FA 3KOJA 4R4CA 3OTOQ 4DV2Q 1AE2A 4AQYL 4JI4L 4GNXB 5IP9H 3PUVA 1WI5A 2K4KA 2K5HA 2NN6I 4IPGA 1JMCA 5GAGC 2YTXA 3HKZG 3S1RH 5JEAG 2RHQB 1GKHA 3PO3H 3CC4A 1TXYA 3PUZA 4DR5L 3EBEA 3W1GA 3J7A5 2KCMA 4PMWA 2YTYA 4HJ5A 2NVYH 4DV5Q 5LMNQ 2N78A 4JI5Q 3I4NH 1SE8A 4XTCS 2NVTH 3CCEA 1EOVA 3F2BA 2A8VA 4LF9L 4AQYQ 3BZKA 4JI4Q 1VQLA 4JYAL 4X62Q 2ES2A 2BH8A 1EYGA 1X56A 1VQKA 2ZJPA 1VQBA 5DLQE 1X65A 1R9TH 1YHBA 2E2JH 4JBKA 3HOZG 3F1ZA 1YIJA 4R1JA 3VDYA 4QIWE 1GM5A 4DR5Q 1Y1VH 3H0GG 4X64Q 1ASYA 3KFUA 4A3IH 4HJ9A 4GOPA 3GTPH 3UDGA 5M5YH 4DK6C 4LF9Q 2VS1A 3PSIA 4JYAQ 3KF8B 4DR1L 1I3QH 1FL0A 2WB1E 1Q1EA 4JCVE 2R93H 3HOWH 4AIMA 1UWVA 4IFDG 1Q1BA 3L2PA 1WYDA 1N36L 1PH1A 1IZ6A 1JT8A 5C0XI 2WB1G 1H95A 4A3EH 2ASBA 1QVFA 1QZHA 3KJOA 1N33L 3AFPA 4DR1Q 2JA6H 4GLVB 3CCQA 1VQCA 4GS3A 1TWAH 5E7NA 1KRTA 4FDBA 3ZJYC 3ERSX 4YHHL 1J5EL 1KHIA 3WWVA 5IP9G 5LMUL 1BBWA 4A75A 1YJNA 3S2DH 5AJ3L 4JI2L 5FLMH 5C0XJ 4L5RC 1LTLA 1HNXL 2UUCL 1N36Q 1PH5A 1D7QA 2IY5B 4JI8L 4DV0L 1M90C 3ULPA 3S2HH 1KL9A 2PI2E 1YJ9A 2K75A 4QY7A 4JI7L 1TWFH 2JE6I 3HOYH 3I4NG 1VQFA 1N33Q 2KBNA 2HIVA 4OWTB 1BBUA 1CSQA 5GAHC 4QGUA 3GTQH 1FVIA 4YHHQ 1L1OA 1E1OA 3G6EA 3HOVH 1J5EQ 2D0PA 2IT1A 2LSSA 2R7DA 2K5NA 4POGA 2XGTA 1CKOA 1EIYB 4MZ9A 1HNXQ 2CWPA 2UUCQ 3ER0A 2ALYB 1V9PA 2RF4A 4JI3L 4JI8Q 4DV0Q 4EQ5A 4OWXB 1Y1VG 3EIVA 3E9IA 3HOXG 4JI7Q 2VQFL 1NTGA 5IWAL 4A3IG 1E24A 1E1TA 1I50H 3I4OA 3M4PA 3JC66 2MNAA 4A3MH 1MKHA 3J81c 3KDFA 1Q82C 4JG2A 5J3BA 1PFSA 5M5XH 2RHSB 1QVGA 2KENA 1K8AC 4DR7L 1K0RA 1X6OA 2B3GA 4P73A 3CCUA 2R93G 1L2FA 3HOWG 2ID0A 4JI3Q 1B8AA 2YU9H 4A76A 3M4OH 2GVAA 2VQFQ 4NXNQ 2JA7H 4XIGS 5IWAQ 2ATWA 1LM0A 3S1NH 1U5KA 3E0EA 1C9OA 1N9WA 1I6HH 4A3JH 1JJ2A 4A3EG 4BBRH 4JBWA 1KC8C 4HIKA 3I56A 3SGIA 1CKNA 5JJIA 3MEFA 3S17H 1A8VA 2DUDA 2JA6G 2ZTCA 4DR7Q 2WAQE 3GDEA 3PIOA 1QZGA 2UUBL 3CMEA 2F52A 3RN2A 1NY4A 3PUWA 4B3ML 4JI6Q 2VUMH 5FLMG 1VQ4A 2VW9A 2UXDL 2NZOA 2A19A 1SR3A 1YEZA 5M3FH 2WAQG 4BY1H 2HT1A 2JQOA 3S24A 4A4IA 1X54A 1OXSC 1P8LA 1PYSB 1VCIA 3H15A 1Y1WH 1PH8A 2UU9L 3HOYG 4AYBE 4H02A 2WP8J 1HNWL 1FJGL 1BKBA 1X9NA 1IL2A 4BY7H 4LF6L 1TWCH 3HOVG 3J80i 1W2BA 4NPSA 4B3SL 1UE1A 5M3MH 4POFA 3GTLH 2Z6KC 4EX5A 3I7FA 2Y0SE 4GLAC 3CCRA 1A0IA 2UXDQ 3M9BA 1V43A 5C0XG 2EQSA 1CKMA 4X66Q 1VQ6A 1UE7A 4NXML 1LUZA 2UU9Q 3GTOH 5LMNW 4KLKA 3DLLA 1HNWQ 3KF6A 2ZM6L 1FJGQ 1YVCA 3UDIA 4C2MH 4A3MG 4LF6Q 4LUVA 3Q8DA 4LFBL 1G51A 4B3SQ 1RL2A 4PZ7A 3F2CA 4OXPA 4JI0L 3PUXA 2QEXA 3BJUA 2E8GA 2R92G 3GTJH 3I55A 1KXLA 2Q2IA 1NBWA 4GNXC 1PHJA 4JOIC 1VQJA 2JA7G 4KHPL 1VQIA 2RCNA 1HH2P 1EUJA 3ULJA 1Z47A 4R4IA 3UDFA 4IPCA 2ZM6Q 1N34L 4A3JG 5IP7H 3GO5A 5C3EH 5IYDH 4BBRG 1Q7YC 2UUAL 1AE3A 4IOAA 4LFBQ 1RIPA 1VQDA 2CKZB 4GN5A 2Z0SA 3GD7A 4JI0Q 1KAWA 1VQHA 2F3IA 2GN5A 3K81C 5FJ8H 4GOPB 3NENA 4LF8L 4KHPQ 4ALPA 3HOUH 4IPHA 3M7NA 2VL6A 1QVCA 3GTMH 2PQAA 5M3FG 1N34Q 4QQBX 2KCTA 2WFWA 3UDXA 2CQOA 4APVA 1HNZL 1PVOA 3K7AH 3CP0A 3I4MG 2UUAQ 4P74A 3CCJA 5ELNA 1NMFA 1KD1C 1QUQA 4UPAA 1VQAA 4BY7G 2YTVA 5IYCH 4DV4L 4R4OA 2ZJQA 2MO1A 2KHIA 4DV6L 5JJKA 3FKIH 1XPRA 1GD7A 4LW1A 2HHHL 4LF8Q 2MO0A 1S3OA 2R7FA 2ZTEA 4JC0A 4A3CH 1VQGA 1C7YA 1UEBA 3PO3G 3D31A 3RN5A 1VQEA 3GTKH 1E7ZA 4O2DA 5HGQA 4B3RL 1YZ6A 1HNZQ 1IBML 4GOPC 4IJLA 3K8AA 4P75A 3LGJA 3KJPA 3CMAA 1KQSA 4DV4Q 3DM3A 1YBYA 1KIXA 2OQKA 2E5LL 3NBHB 5H1SE 1VQPA 2D62A 3CPFA 4LNQA 4UY8C 4DV6Q 1BVSA 5LMUQ 3PF4A 5C44H 1XNRL 1WCMH 5AJ3Q 4JI2Q 2HHHQ 3ICEA 1PH4A 3UE0A 2YYZA 3M3YH 4B3RQ 4A3GH 1IBMQ 3EN2A 1X3EA 1EQQA 1L1OB 4OONA 4DR2L 3JAMi 1Q8KA 5IYDG 5C3EG 1VQNA 3CXCA 4JV5L 2E5LQ 3AFQA 2ZTDA 4NB3A 4B3TL 1L0WA 1XNRQ 1EIFA 3K0XA 4GLXA 1PA6A 1K3RA 1OXVA 5EAYA 1N32L 4DAYB 3K80C 1K73C 2EIFA 2N8NA 4L5SA 4HIOA 5FJ8G 3S14H 2B63H 4X6AH 2C35B 4TQUS 2E2IH 1M1KC 3BU2A 4HJ7A 2HIXA 1G6PA 4LFAL 2R6GA 4DR2Q 4YCUA 3T1YL 3KDFB 4GN4B 1JB7A 4JBMA 4JV5Q 3KLWA 1JE5A 2QGQA 4GKJL 4DV3L 2IHEA 3M4QA 4B3TQ 1CSPA 4OO1I 4X65L 1L1OC 2Q2HA 1Q12A 3RLNA 3RZDH 2JEAI 1G291 5IYCG 4LUOA 3STBC 1YNXA 4A3KH 1J6QA 4MNOA 3FKIG 1HJPA 1DGSA 1IBKL 2Q2UA 4A93H 1OXTA 3CD6A 4DV7L 4A3CG 1P16A 1Q86C 1IYJB 4KHZA 4HIMA 2Z6KA 4LFAQ 5FLXc 1HR0L 2K14A 1CKNB 4DUZL 4HJAA 3RNUA 3NEMA 3CC7A 4GKJQ 4DV3Q 1YI2A 4TVAB 4P71A 1I5FA 4R4QA 2LXJA 1XMOL 1EFWA 1VQ5A 4X65Q 3TRZA 1IXRA 2AHOB 1EWIA 3AQQA 1JJGA 1TWHH 3K7UC 5JJLA 4P72A 1Q81C 2UUBQ 3D0FA 1YITA 4DR3L 5C44G 4JI1L 1IBKQ 1WCMG 4B3MQ 1C0AA 2HQLA 2I5MX 3CCVA 3J7ZC 2OQ0A 3NELA 4AH6A 2B29A 4YWLA 4DV7Q 1PH2A 2DGYA 4AYBG 1HR0Q 4A3LH 4DUZQ 4A3GG 3L7ZC 2I0QA 1W3SA 2OCEA 1S72A 4GNXA 1GO3E 2VZAA 1XNQL 1Y14B 1LYLA 1EQRA 1NMGA 2Y0SG 3HKZE 4GKKL 4DR3Q 4JI1Q 1A62A 1UE5A 3TREA 5LMNL 4DV1L 1ASZA 4LFCL 4QL5A 3W5OA 1VQ9A 4YWMA 1FGUA 2K50A 3W1BA 4C3IH 2NVQH 1HZCA 4DAMA 1YHAA 4RG1A 3FHWA 4A3BG 4X62L 3U58A 2B63G 2CCZA 4YWKA 3MXNB 4DK3C 3KF6B 4NXMQ 3A5UA 4DNIA 2JA9A 4DPGA 3CC2A 2D0OA 1XNQQ 1SMXA 1Q46A 3S15H 4X64L 1MJEA 4GKKQ 4DR6L 5IT9c 4DV1Q 2YV5A 1T9HA 2A1AA 2NVXH 4L5QA 1WFQA 4LFCQ 3J80c 4A3KG 3I2ZA 3PUYA 1B70B 2BH2A 4RMFA 3PO2H 4A93G 3T1HL 4PG3A 2PNHA 3TS2A 5IYBH 3HKSA 2KHJA 4DR4L 4WJ4A 2JJQA 3STBD 2JEBI 4YY3L 1K8GA 1SRUA 1X3GA 2VQEL 5GROA 2LXKA 4BY1G 2VY3A 3A5ZB 4UP8A 3HOXH 3CCMA 4A3FH 4BBSH 2UXCL 3F2DA 2I5HA 5K36G 1Y1WG 3CW2C 4DR6Q 1I94L 3A74A 4C3HH 1OXUA 3CPWA 3L0OA 1N8RC 2IX0A 3G4SA 3HFZB 3TEHB 1WOCA 3T1HQ 5M3MG 3F8TA 2PQAB 4IO9A 3G71A 4DR4Q 2AMCB 1XMQL 1VQ7A 4YY3Q 3AEVA 4A3LG 4BA2I 2R7ZG 4GN3B 2CWAA 4C3JH 2VQEQ 5GQOA 3TQYA 1QUQB 1VQ8A 1XPUA 3U50C 2UXCQ 3H3VI 4LF5L 1K83H 2JA8H 2F4VL 4LF4L 4OO1G 3BZCA 1V1QA 3CQZH 1I94Q 3FP9A 1D8LA 3B6YA 4LWCA 4KI0A 4LF7L 1MIUA 4WJ3M 2JA5H 3J81i 3RZOH 2K52A 1PV4A 4JBJA 5C4XH 4HIDA 1E22A 2H5XA 2N3SA 2PMZE 4IJHA 4PZ8A 3PIPA 1IBLL 3CCLA 1XMQQ 2BA1A 5GAEC 3CF5A 1OXXK 5IY0A 4BXXH 4A3DH 5JEAJ 3S1MH 3PV0A 3OYYA 4LF5Q 2F4VQ 4LF4Q 2PI2A 1YJWA 1A63A 4J15A 4Y52H 3CCSA 1UE6A 2E2HH 5IP7G 4LF7Q 2Q2TA 1E3PA 1TWGH 3PF5A 1XJVA 2AKWB 3U4VA 2R7ZH 1SROA 1IBLQ 4OX9L 1U0LA 4MTNA 1PH6A 1S40A 3PO2G 1YHQA 1HZBA 1O7IA 5IYBG 3H3VH 4BA1I 3HOUG 3M85A 1KRSA 3RR5A 3ULLA 1WJJA 3UE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1C C;  4A3F G;  4BBS G;  4IFD I;  1XPO A;  4NXN L;  4YCW A;  2OTL A;  2VNU D;  3IRB A;  4A3B H;  1VQO A;  1XTD A;  4UP9 A;  1HZA A;  3TS0 A;  1OTC A;  4ME3 A;  3AYH B;  4DUY L;  4R4T A;  4LUZ A;  4HJ8 A;  3G48 A;  4OX9 Q;  2L15 A;  3J81 j;  1X3F A;  1N32 Q;  2CFM A;  4Y7N H;  1NE3 A;  2OTJ A;  2NN6 G;  1X55 A;  1K9M C;  4OWW B;  1SN8 A;  4IFD J;  4K0K L;  5HY6 A;  2UXB L;  2R92 H;  3HOZ H;  5M5W H;  3T1Y Q;  4DKA C;  2OWO A;  4JI6 L;  1SLJ A;  3RLF A;  2MFI A;  3H0G H;  2JA8 G;  2FXQ A;  2EXD A;  3OW2 A;  1B7Y B;  3JAM c;  1GVP A;  2ZJR A;  4DUY Q;  1NJI C;  2VUM G;  1CUK A;  2JA5 G;  3CAM A;  1PH9 A;  2IHF A;  2K5V A;  3PGZ A;  3GTG H;  3S1Q H;  1SFO H;  5C4X G;  5BR8 L;  5C4J H;  5ELO A;  4DV2 L;  2NZH A;  3OTO L;  4K0K Q;  4IOC A;  1HR0 W;  3S16 H;  2BA0 A;  4UP7 A;  2UXB Q;  4BXX G;  2QA4 A;  4A3D G;  3E9H A;  2JK8 A;  2MQH A;  3PCO B;  1JJC B;  2N49 A;  2AWN A;  1PH7 A;  2IX1 A;  4JOI A;  1XMO Q;  1AH9 A;  4X66 L;  1VQM A;  4PZ6 A;  4O0A A;  5IE8 A;  3I4M H;  3RLO A;  4QJF A;  2AWO A;  1VS0 A;  4YCV A;  4IPD A;  2GVB A;  2I5L X;  5GAD C;  4DV5 L;  2XTI A;  4JI5 L;  1HZ9 A;  3KYH C;  5BR8 Q;  3U4Z A;  4L5T A;  1MJC A;  1PYB A;  1PH3 A;  3A0J A;  1Z9F A;  3KOJ A;  4R4C A;  3OTO Q;  4DV2 Q;  1AE2 A;  4AQY L;  4JI4 L;  4GNX B;  5IP9 H;  3PUV A;  1WI5 A;  2K4K A;  2K5H A;  2NN6 I;  4IPG A;  1JMC A;  5GAG C;  2YTX A;  3HKZ G;  3S1R H;  5JEA G;  2RHQ B;  1GKH A;  3PO3 H;  3CC4 A;  1TXY A;  3PUZ A;  4DR5 L;  3EBE A;  3W1G A;  3J7A 5;  2KCM A;  4PMW A;  2YTY A;  4HJ5 A;  2NVY H;  4DV5 Q;  5LMN Q;  2N78 A;  4JI5 Q;  3I4N H;  1SE8 A;  4XTC S;  2NVT H;  3CCE A;  1EOV A;  3F2B A;  2A8V A;  4LF9 L;  4AQY Q;  3BZK A;  4JI4 Q;  1VQL A;  4JYA L;  4X62 Q;  2ES2 A;  2BH8 A;  1EYG A;  1X56 A;  1VQK A;  2ZJP A;  1VQB A;  5DLQ E;  1X65 A;  1R9T H;  1YHB A;  2E2J H;  4JBK A;  3HOZ G;  3F1Z A;  1YIJ A;  4R1J A;  3VDY A;  4QIW E;  1GM5 A;  4DR5 Q;  1Y1V H;  3H0G G;  4X64 Q;  1ASY A;  3KFU A;  4A3I H;  4HJ9 A;  4GOP A;  3GTP H;  3UDG A;  5M5Y H;  4DK6 C;  4LF9 Q;  2VS1 A;  3PSI A;  4JYA Q;  3KF8 B;  4DR1 L;  1I3Q H;  1FL0 A;  2WB1 E;  1Q1E A;  4JCV E;  2R93 H;  3HOW H;  4AIM A;  1UWV A;  4IFD G;  1Q1B A;  3L2P A;  1WYD A;  1N36 L;  1PH1 A;  1IZ6 A;  1JT8 A;  5C0X I;  2WB1 G;  1H95 A;  4A3E H;  2ASB A;  1QVF A;  1QZH A;  3KJO A;  1N33 L;  3AFP A;  4DR1 Q;  2JA6 H;  4GLV B;  3CCQ A;  1VQC A;  4GS3 A;  1TWA H;  5E7N A;  1KRT A;  4FDB A;  3ZJY C;  3ERS X;  4YHH L;  1J5E L;  1KHI A;  3WWV A;  5IP9 G;  5LMU L;  1BBW A;  4A75 A;  1YJN A;  3S2D H;  5AJ3 L;  4JI2 L;  5FLM H;  5C0X J;  4L5R C;  1LTL A;  1HNX L;  2UUC L;  1N36 Q;  1PH5 A;  1D7Q A;  2IY5 B;  4JI8 L;  4DV0 L;  1M90 C;  3ULP A;  3S2H H;  1KL9 A;  2PI2 E;  1YJ9 A;  2K75 A;  4QY7 A;  4JI7 L;  1TWF H;  2JE6 I;  3HOY H;  3I4N G;  1VQF A;  1N33 Q;  2KBN A;  2HIV A;  4OWT B;  1BBU A;  1CSQ A;  5GAH C;  4QGU A;  3GTQ H;  1FVI A;  4YHH Q;  1L1O A;  1E1O A;  3G6E A;  3HOV H;  1J5E Q;  2D0P A;  2IT1 A;  2LSS A;  2R7D A;  2K5N A;  4POG A;  2XGT A;  1CKO A;  1EIY B;  4MZ9 A;  1HNX Q;  2CWP A;  2UUC Q;  3ER0 A;  2ALY B;  1V9P A;  2RF4 A;  4JI3 L;  4JI8 Q;  4DV0 Q;  4EQ5 A;  4OWX B;  1Y1V G;  3EIV A;  3E9I A;  3HOX G;  4JI7 Q;  2VQF L;  1NTG A;  5IWA L;  4A3I G;  1E24 A;  1E1T A;  1I50 H;  3I4O A;  3M4P A;  3JC6 6;  2MNA A;  4A3M H;  1MKH A;  3J81 c;  3KDF A;  1Q82 C;  4JG2 A;  5J3B A;  1PFS A;  5M5X H;  2RHS B;  1QVG A;  2KEN A;  1K8A C;  4DR7 L;  1K0R A;  1X6O A;  2B3G A;  4P73 A;  3CCU A;  2R93 G;  1L2F A;  3HOW G;  2ID0 A;  4JI3 Q;  1B8A A;  2YU9 H;  4A76 A;  3M4O H;  2GVA A;  2VQF Q;  4NXN Q;  2JA7 H;  4XIG S;  5IWA Q;  2ATW A;  1LM0 A;  3S1N H;  1U5K A;  3E0E A;  1C9O A;  1N9W A;  1I6H H;  4A3J H;  1JJ2 A;  4A3E G;  4BBR H;  4JBW A;  1KC8 C;  4HIK A;  3I56 A;  3SGI A;  1CKN A;  5JJI A;  3MEF A;  3S17 H;  1A8V A;  2DUD A;  2JA6 G;  2ZTC A;  4DR7 Q;  2WAQ E;  3GDE A;  3PIO A;  1QZG A;  2UUB L;  3CME A;  2F52 A;  3RN2 A;  1NY4 A;  3PUW A;  4B3M L;  4JI6 Q;  2VUM H;  5FLM G;  1VQ4 A;  2VW9 A;  2UXD L;  2NZO A;  2A19 A;  1SR3 A;  1YEZ A;  5M3F H;  2WAQ G;  4BY1 H;  2HT1 A;  2JQO A;  3S24 A;  4A4I A;  1X54 A;  1OXS C;  1P8L A;  1PYS B;  1VCI A;  3H15 A;  1Y1W H;  1PH8 A;  2UU9 L;  3HOY G;  4AYB E;  4H02 A;  2WP8 J;  1HNW L;  1FJG L;  1BKB A;  1X9N A;  1IL2 A;  4BY7 H;  4LF6 L;  1TWC H;  3HOV G;  3J80 i;  1W2B A;  4NPS A;  4B3S L;  1UE1 A;  5M3M H;  4POF A;  3GTL H;  2Z6K C;  4EX5 A;  3I7F A;  2Y0S E;  4GLA C;  3CCR A;  1A0I A;  2UXD Q;  3M9B A;  1V43 A;  5C0X G;  2EQS A;  1CKM A;  4X66 Q;  1VQ6 A;  1UE7 A;  4NXM L;  1LUZ A;  2UU9 Q;  3GTO H;  5LMN W;  4KLK A;  3DLL A;  1HNW Q;  3KF6 A;  2ZM6 L;  1FJG Q;  1YVC A;  3UDI A;  4C2M H;  4A3M G;  4LF6 Q;  4LUV A;  3Q8D A;  4LFB L;  1G51 A;  4B3S Q;  1RL2 A;  4PZ7 A;  3F2C A;  4OXP A;  4JI0 L;  3PUX A;  2QEX A;  3BJU A;  2E8G A;  2R92 G;  3GTJ H;  3I55 A;  1KXL A;  2Q2I A;  1NBW A;  4GNX C;  1PHJ A;  4JOI C;  1VQJ A;  2JA7 G;  4KHP L;  1VQI A;  2RCN A;  1HH2 P;  1EUJ A;  3ULJ A;  1Z47 A;  4R4I A;  3UDF A;  4IPC A;  2ZM6 Q;  1N34 L;  4A3J G;  5IP7 H;  3GO5 A;  5C3E H;  5IYD H;  4BBR G;  1Q7Y C;  2UUA L;  1AE3 A;  4IOA A;  4LFB Q;  1RIP A;  1VQD A;  2CKZ B;  4GN5 A;  2Z0S A;  3GD7 A;  4JI0 Q;  1KAW A;  1VQH A;  2F3I A;  2GN5 A;  3K81 C;  5FJ8 H;  4GOP B;  3NEN A;  4LF8 L;  4KHP Q;  4ALP A;  3HOU H;  4IPH A;  3M7N A;  2VL6 A;  1QVC A;  3GTM H;  2PQA A;  5M3F G;  1N34 Q;  4QQB X;  2KCT A;  2WFW A;  3UDX A;  2CQO A;  4APV A;  1HNZ L;  1PVO A;  3K7A H;  3CP0 A;  3I4M G;  2UUA Q;  4P74 A;  3CCJ A;  5ELN A;  1NMF A;  1KD1 C;  1QUQ A;  4UPA A;  1VQA A;  4BY7 G;  2YTV A;  5IYC H;  4DV4 L;  4R4O A;  2ZJQ A;  2MO1 A;  2KHI A;  4DV6 L;  5JJK A;  3FKI H;  1XPR A;  1GD7 A;  4LW1 A;  2HHH L;  4LF8 Q;  2MO0 A;  1S3O A;  2R7F A;  2ZTE A;  4JC0 A;  4A3C H;  1VQG A;  1C7Y A;  1UEB A;  3PO3 G;  3D31 A;  3RN5 A;  1VQE A;  3GTK H;  1E7Z A;  4O2D A;  5HGQ A;  4B3R L;  1YZ6 A;  1HNZ Q;  1IBM L;  4GOP C;  4IJL A;  3K8A A;  4P75 A;  3LGJ A;  3KJP A;  3CMA A;  1KQS A;  4DV4 Q;  3DM3 A;  1YBY A;  1KIX A;  2OQK A;  2E5L L;  3NBH B;  5H1S E;  1VQP A;  2D62 A;  3CPF A;  4LNQ A;  4UY8 C;  4DV6 Q;  1BVS A;  5LMU Q;  3PF4 A;  5C44 H;  1XNR L;  1WCM H;  5AJ3 Q;  4JI2 Q;  2HHH Q;  3ICE A;  1PH4 A;  3UE0 A;  2YYZ A;  3M3Y H;  4B3R Q;  4A3G H;  1IBM Q;  3EN2 A;  1X3E A;  1EQQ A;  1L1O B;  4OON A;  4DR2 L;  3JAM i;  1Q8K A;  5IYD G;  5C3E G;  1VQN A;  3CXC A;  4JV5 L;  2E5L Q;  3AFQ A;  2ZTD A;  4NB3 A;  4B3T L;  1L0W A;  1XNR Q;  1EIF A;  3K0X A;  4GLX A;  1PA6 A;  1K3R A;  1OXV A;  5EAY A;  1N32 L;  4DAY B;  3K80 C;  1K73 C;  2EIF A;  2N8N A;  4L5S A;  4HIO A;  5FJ8 G;  3S14 H;  2B63 H;  4X6A H;  2C35 B;  4TQU S;  2E2I H;  1M1K C;  3BU2 A;  4HJ7 A;  2HIX A;  1G6P A;  4LFA L;  2R6G A;  4DR2 Q;  4YCU A;  3T1Y L;  3KDF B;  4GN4 B;  1JB7 A;  4JBM A;  4JV5 Q;  3KLW A;  1JE5 A;  2QGQ A;  4GKJ L;  4DV3 L;  2IHE A;  3M4Q A;  4B3T Q;  1CSP A;  4OO1 I;  4X65 L;  1L1O C;  2Q2H A;  1Q12 A;  3RLN A;  3RZD H;  2JEA I;  1G29 1;  5IYC G;  4LUO A;  3STB C;  1YNX A;  4A3K H;  1J6Q A;  4MNO A;  3FKI G;  1HJP A;  1DGS A;  1IBK L;  2Q2U A;  4A93 H;  1OXT A;  3CD6 A;  4DV7 L;  4A3C G;  1P16 A;  1Q86 C;  1IYJ B;  4KHZ A;  4HIM A;  2Z6K A;  4LFA Q;  5FLX c;  1HR0 L;  2K14 A;  1CKN B;  4DUZ L;  4HJA A;  3RNU A;  3NEM A;  3CC7 A;  4GKJ Q;  4DV3 Q;  1YI2 A;  4TVA B;  4P71 A;  1I5F A;  4R4Q A;  2LXJ A;  1XMO L;  1EFW A;  1VQ5 A;  4X65 Q;  3TRZ A;  1IXR A;  2AHO B;  1EWI A;  3AQQ A;  1JJG A;  1TWH H;  3K7U C;  5JJL A;  4P72 A;  1Q81 C;  2UUB Q;  3D0F A;  1YIT A;  4DR3 L;  5C44 G;  4JI1 L;  1IBK Q;  1WCM G;  4B3M Q;  1C0A A;  2HQL A;  2I5M X;  3CCV A;  3J7Z C;  2OQ0 A;  3NEL A;  4AH6 A;  2B29 A;  4YWL A;  4DV7 Q;  1PH2 A;  2DGY A;  4AYB G;  1HR0 Q;  4A3L H;  4DUZ Q;  4A3G G;  3L7Z C;  2I0Q A;  1W3S A;  2OCE A;  1S72 A;  4GNX A;  1GO3 E;  2VZA A;  1XNQ L;  1Y14 B;  1LYL A;  1EQR A;  1NMG A;  2Y0S G;  3HKZ E;  4GKK L;  4DR3 Q;  4JI1 Q;  1A62 A;  1UE5 A;  3TRE A;  5LMN L;  4DV1 L;  1ASZ A;  4LFC L;  4QL5 A;  3W5O A;  1VQ9 A;  4YWM A;  1FGU A;  2K50 A;  3W1B A;  4C3I H;  2NVQ H;  1HZC A;  4DAM A;  1YHA A;  4RG1 A;  3FHW A;  4A3B G;  4X62 L;  3U58 A;  2B63 G;  2CCZ A;  4YWK A;  3MXN B;  4DK3 C;  3KF6 B;  4NXM Q;  3A5U A;  4DNI A;  2JA9 A;  4DPG A;  3CC2 A;  2D0O A;  1XNQ Q;  1SMX A;  1Q46 A;  3S15 H;  4X64 L;  1MJE A;  4GKK Q;  4DR6 L;  5IT9 c;  4DV1 Q;  2YV5 A;  1T9H A;  2A1A A;  2NVX H;  4L5Q A;  1WFQ A;  4LFC Q;  3J80 c;  4A3K G;  3I2Z A;  3PUY A;  1B70 B;  2BH2 A;  4RMF A;  3PO2 H;  4A93 G;  3T1H L;  4PG3 A;  2PNH A;  3TS2 A;  5IYB H;  3HKS A;  2KHJ A;  4DR4 L;  4WJ4 A;  2JJQ A;  3STB D;  2JEB I;  4YY3 L;  1K8G A;  1SRU A;  1X3G A;  2VQE L;  5GRO A;  2LXK A;  4BY1 G;  2VY3 A;  3A5Z B;  4UP8 A;  3HOX H;  3CCM A;  4A3F H;  4BBS H;  2UXC L;  3F2D A;  2I5H A;  5K36 G;  1Y1W G;  3CW2 C;  4DR6 Q;  1I94 L;  3A74 A;  4C3H H;  1OXU A;  3CPW A;  3L0O A;  1N8R C;  2IX0 A;  3G4S A;  3HFZ B;  3TEH B;  1WOC A;  3T1H Q;  5M3M G;  3F8T A;  2PQA B;  4IO9 A;  3G71 A;  4DR4 Q;  2AMC B;  1XMQ L;  1VQ7 A;  4YY3 Q;  3AEV A;  4A3L G;  4BA2 I;  2R7Z G;  4GN3 B;  2CWA A;  4C3J H;  2VQE Q;  5GQO A;  3TQY A;  1QUQ B;  1VQ8 A;  1XPU A;  3U50 C;  2UXC Q;  3H3V I;  4LF5 L;  1K83 H;  2JA8 H;  2F4V L;  4LF4 L;  4OO1 G;  3BZC A;  1V1Q A;  3CQZ H;  1I94 Q;  3FP9 A;  1D8L A;  3B6Y A;  4LWC A;  4KI0 A;  4LF7 L;  1MIU A;  4WJ3 M;  2JA5 H;  3J81 i;  3RZO H;  2K52 A;  1PV4 A;  4JBJ A;  5C4X H;  4HID A;  1E22 A;  2H5X A;  2N3S A;  2PMZ E;  4IJH A;  4PZ8 A;  3PIP A;  1IBL L;  3CCL A;  1XMQ Q;  2BA1 A;  5GAE C;  3CF5 A;  1OXX K;  5IY0 A;  4BXX H;  4A3D H;  5JEA J;  3S1M H;  3PV0 A;  3OYY A;  4LF5 Q;  2F4V Q;  4LF4 Q;  2PI2 A;  1YJW A;  1A63 A;  4J15 A;  4Y52 H;  3CCS A;  1UE6 A;  2E2H H;  5IP7 G;  4LF7 Q;  2Q2T A;  1E3P A;  1TWG H;  3PF5 A;  1XJV A;  2AKW B;  3U4V A;  2R7Z H;  1SRO A;  1IBL Q;  4OX9 L;  1U0L A;  4MTN A;  1PH6 A;  1S40 A;  3PO2 G;  1YHQ A;  1HZB A;  1O7I A;  5IYB G;  3H3V H;  4BA1 I;  3HOU G;  3M85 A;  1KRS A;  3RR5 A;  3ULL A;  1WJJ A;  3UE1 A; 
#chains in the Genus database with same CATH topology
 3HOX B;  1KTK A;  2V1C C;  4IFD I;  4A3I B;  2A69 C;  3HEJ A;  4YCW A;  3IRB A;  4ME3 A;  1FNV A;  4HJ8 A;  5FLX E;  3G48 A;  4OX9 Q;  3J81 j;  1X3F A;  1NE3 A;  2NN6 G;  5CV5 A;  1ENC A;  5HY6 A;  4RHS A;  2FMM A;  3T1Y Q;  4DKA C;  2OWO A;  3C1F A;  3ND9 A;  3QOJ A;  2FXQ A;  2JP1 A;  1B7Y B;  3EVQ A;  4DUY Q;  1NJI C;  3GP7 A;  2JA5 G;  2K5V A;  1SFO H;  3NQT A;  5EKL A;  4UP7 A;  2PO4 A;  3S2D B;  2KA7 A;  4WFN 3;  4BXX G;  2UXB Q;  3E9H A;  2JK8 A;  1FD7 D;  1JJC B;  1QG7 A;  2B2V A;  4XXE A;  1JWS D;  1XMO Q;  1AN8 A;  3Q6S A;  5JAV A;  5EKI A;  4G7H C;  1JIC A;  1VS0 A;  2GVB A;  1SNO A;  2XTI A;  3GTQ B;  1MJC A;  3D4W A;  4R4C A;  3OTO Q;  2A5H A;  4JI4 L;  3MAQ A;  1WI5 A;  4IPG A;  1JMC A;  3KBG A;  5IT9 E;  3PO3 H;  2RHQ B;  3J80 E;  2JYO A;  2SDF A;  2K05 A;  1HUM A;  3EBE A;  3W1G A;  2KCM A;  4PMW A;  3I4N H;  4DV5 Q;  1EOV A;  1PRT D;  2A8V A;  2RDH A;  3BZK A;  2Z6B A;  1C48 A;  2R92 B;  3WOE A;  2H1E A;  1YIJ A;  1TT2 A;  1S5C D;  4HJ9 A;  2GA4 B;  3UDG A;  4LF9 Q;  1IYU A;  4JYA Q;  3KF8 B;  1TVX A;  1FL0 A;  3BDL A;  2FIN B;  3S16 B;  4QB4 A;  2R93 H;  3ERQ A;  1RF2 D;  1EY6 A;  1IKL A;  3J7A F;  4H0L C;  3C46 A;  1WYD A;  1ESF A;  1KDA A;  1JT8 A;  3P75 A;  3KJO A;  2JA6 H;  1B1Z A;  4GS3 A;  4C3I G;  1KRT A;  4FDB A;  2X6L A;  4I7Z C;  4DAV A;  3WWV A;  5FK9 C;  3P1H A;  1T5X D;  5FLM H;  1IHZ A;  3S1R B;  1HNX L;  2UUC L;  1N36 Q;  1D7Q A;  4DV0 L;  4I65 A;  3ULP A;  2F1M A;  1TWF H;  4DN4 M;  3HOY H;  3I4N G;  1N33 Q;  1HQR D;  5GAH C;  3HOV H;  1E1O A;  3VYR A;  2IT1 A;  2G5D A;  4POG A;  2XGT A;  1R9T B;  1SE3 A;  3ER0 A;  2NTT A;  2RF4 A;  5C0X H;  4DAY A;  2VQF L;  2B2Y A;  3NK9 A;  3GTP B;  1PYW D;  3NPP A;  4L63 B;  1K28 A;  1LTB D;  1PTO D;  2LMC B;  1TY2 A;  2PNR C;  1Q82 C;  1I3Q B;  5J3B A;  5IT9 L;  1K8A C;  2KEN A;  5CR3 A;  3J80 L;  2F3W A;  3CCU A;  2R93 G;  1X3P A;  2ID0 A;  1MSG A;  4R8I A;  4NXN Q;  4O1N A;  3VYT A;  4A3E B;  4BBR H;  3PIP 3;  3C2P A;  3SGI A;  3DM1 A;  3MEF A;  3S17 H;  1I4H A;  2JA6 G;  4CJ1 B;  3GDE A;  3PQI A;  1QZG A;  2NBF A;  5FOB B;  2C5C A;  5FLM G;  3DHQ A;  2VW9 A;  4B9W A;  4C56 C;  1WTX A;  2WAQ G;  2HT1 A;  2JQO A;  5EPL A;  5G3L F;  3HOY G;  1Y1W H;  1PXU A;  3E0J A;  1PLF A;  4H02 A;  2WP8 J;  4BY7 H;  4FP5 D;  1FR3 A;  3HOV G;  1TWC H;  2DJG C;  1WD0 A;  1M8A A;  4IZ8 A;  1PTO B;  5M3M H;  4POF A;  5KNC A;  2Z6K C;  1VF7 A;  2F03 A;  2IW3 A;  5C0X G;  4X3T A;  2EQS A;  4X66 Q;  1BUV T;  1D6E C;  1UE7 A;  2XVS A;  2UU9 Q;  2F0N A;  5LMN W;  3MXN A;  3A56 A;  1H9S B;  2L0C A;  3SK6 A;  4XQN A;  3R2T A;  2F0K A;  4C2M H;  1WTP A;  4LF6 Q;  4LUV A;  5COR A;  1O7Y A;  1G51 A;  2O5I C;  3PUX A;  3O13 A;  4YIJ A;  2QEX A;  1STB A;  2B2V C;  3S14 B;  2RVL A;  1KXL A;  4KY6 A;  1PHJ A;  5DAU A;  1IKM A;  1LTT D;  1Z47 A;  1Y8O B;  4ZLT F;  1EWH A;  1D5X C;  1R4Q B;  4ME5 A;  5C3E H;  1UNS A;  4BBR G;  4CDF C;  4CDC C;  1CHP D;  2CKZ B;  4J1M A;  4CJ0 B;  2K5Q A;  1HPC A;  1VQH A;  1K8M A;  2F3I A;  5FKA C;  4A93 B;  4OL7 A;  1K3B C;  5DNF A;  4GOP B;  4LF8 L;  4KHP Q;  2QDB A;  4IPH A;  2VL6 A;  5M3F B;  1F9Q A;  4HTH A;  1PVO A;  3OWE B;  3MWY W;  5ELN A;  1VQA A;  4BY7 G;  1YNN C;  2MO1 A;  2WAC A;  5DM6 3;  1BDO A;  1GHK A;  2ZTE A;  4JC0 A;  1UEB A;  1VF5 C;  5HGQ A;  1STE A;  4ZKC B;  1EY5 A;  1ILQ A;  3Q24 A;  4P75 A;  3R3O A;  3CMA A;  1BCP D;  5CV9 A;  5H1S E;  1VQP A;  4LNQ A;  3CKI B;  2KEC A;  3K5L A;  1BVS A;  4HED A;  5LMU Q;  4DV6 Q;  3QR8 A;  2NVQ B;  2L5T A;  1QWY A;  3ICE A;  2YYZ A;  3M3Y H;  5KGU A;  4B3R Q;  3HRZ C;  3BYY B;  1IBM Q;  2A6E D;  1L0X B;  5BN4 A;  3U9S A;  1STH A;  5C3E G;  4JV5 L;  1SSO A;  3HG9 A;  1L0W A;  1XNR Q;  1EIF A;  3K0X A;  5KNB A;  5COY A;  5EAY A;  1N32 L;  1XWE A;  3K80 C;  4UDU C;  4HSP A;  4X6A H;  2B63 H;  1U4L A;  2E2I H;  3HOU B;  3MHB A;  4HJ7 A;  2XWB B;  1ILP A;  2KCN A;  3H6M A;  1AZQ A;  4N8X 1;  3T56 B;  2AQ3 B;  2A68 C;  4B3T Q;  1B9N A;  1CSP A;  2AQ2 B;  4OO1 I;  3MC0 B;  1EQV A;  3BYT B;  1YNX A;  3NBI A;  4RA8 A;  1WTW A;  5ELC A;  1B50 A;  1MBY A;  1Q86 C;  2HQE A;  5I9P A;  4KHZ A;  4H13 C;  4LFA Q;  1HR0 L;  2K14 A;  1CKN B;  4HJA A;  2XWJ B;  3RNU A;  3NEM A;  3CC7 A;  4GKJ Q;  1LTI D;  4R4Q A;  2LXJ A;  1CM9 A;  1D5M C;  3TRZ A;  1EWI A;  3AQQ A;  3K7U C;  3RZO B;  3A8K E;  1Q81 C;  3D0F A;  2UUB Q;  5EPJ A;  4KHV A;  4DV7 Q;  1TS4 A;  1PH2 A;  3GQB A;  2Q8T A;  4HAE A;  2DY8 A;  2I0Q A;  5C6A A;  1SJE D;  1S72 A;  4PNY A;  5FO7 B;  1A3U A;  1XNQ L;  3HZX A;  4ZUI A;  4C1N K;  1LYL A;  2SNM A;  1NMG A;  4GKK L;  4DR3 Q;  5LMN L;  1E2V A;  4DV1 L;  4LFC L;  1VQ9 A;  4YWM A;  2K50 A;  4ABN A;  1HCZ A;  3LWE A;  4PMB A;  4K2K A;  4K14 A;  3U58 A;  2OXP A;  2K28 A;  2B63 G;  3T4A C;  2CCZ A;  3KF6 B;  4NXM Q;  3Q0A A;  3I8Z A;  2D0O A;  1SMX A;  1YNJ C;  1KAB A;  2LKV A;  2SOB A;  4QUF A;  1RCV D;  1MJE A;  4DR6 L;  1F9S A;  2NVX H;  2XRS D;  1WFQ A;  4A3K B;  4E6I A;  4Y7N B;  4JVZ A;  1STA A;  1ICF B;  1EWC A;  2JJQ A;  4V19 0;  2CH4 A;  4C1N I;  5GRO A;  2LXK A;  4BY1 G;  2IL8 A;  3H0G B;  2LS0 1;  3HOX H;  3CCM A;  4A3F H;  2UXC L;  2I5H A;  2EYJ A;  2EYL A;  4KD4 A;  2QCP X;  3G4S A;  1DJR D;  1GUW A;  5C4J B;  3T1H Q;  5HUR A;  1SND A;  3G71 A;  2HDL A;  3NE5 B;  4YY3 Q;  1DYQ A;  3VA5 A;  3FVQ A;  4GN3 B;  2CWA A;  2VQE Q;  4BA2 I;  4BS9 A;  3D8G A;  3UI2 A;  4LF4 L;  3BZC A;  3CQZ H;  1I94 Q;  1KDC A;  3B6Y A;  4JW0 A;  2F0M A;  2K52 A;  4JBJ A;  1SNM A;  5C4X H;  1G2S A;  1U9R A;  3PIP A;  2N3S A;  3MFG A;  3CF5 A;  5IY0 A;  4KK7 A;  3S1M H;  1EY4 A;  3OYY A;  2ICI A;  4LF5 Q;  1V1P A;  5ELB A;  2E2H H;  3S15 B;  1ET6 A;  2PMZ B;  4LF7 Q;  1E3P A;  1TWG H;  1IW7 C;  3PF5 A;  3IFT A;  3FDT A;  1IBL Q;  1HXY D;  1SNC A;  4BA1 I;  3AU7 A;  3RR5 A;  2B2T A;  5JEA H;  3UE1 A;  4A3F G;  1VQO A;  4C3H B;  4EQO A;  1MSH A;  3MZ5 A;  1OTC A;  4R4T A;  1CQV A;  3QG1 A;  4OWW B;  1BNZ A;  2R92 H;  4K6L A;  1SLJ A;  2CW0 C;  4KD3 A;  3RLF A;  1E2Z A;  2JA8 B;  1A15 A;  3FPU B;  1DOM A;  3OW2 A;  1NSN S;  2N55 A;  2VUM G;  1CUK A;  3CAM A;  5T1I A;  3PGZ A;  5C4X G;  1TWA B;  5ELO A;  1XXG A;  4DV2 L;  1B3Q A;  4IOC A;  3S16 H;  2DJF C;  2Z1C A;  2MQH A;  2N49 A;  2AWN A;  1E0B A;  2IX1 A;  2EYO A;  2PZW A;  1SYG A;  4PZ6 A;  5IE8 A;  4QJF A;  2WIN B;  4KTA A;  3DMU A;  4IPD A;  2I5L X;  4G4K A;  5JVH 3;  3FRP B;  3KOJ A;  5IP9 H;  2K4K A;  2K5H A;  3SVM A;  1MHW C;  3S1R H;  5JEA G;  1GKH A;  3CC4 A;  2DY7 A;  3PUZ A;  4DR5 L;  3J7A 5;  4HJ5 A;  2N78 A;  1SE8 A;  2NVT H;  3CCE A;  1CA6 A;  4WOR A;  4LAA A;  1Y69 U;  3VR5 A;  4JI4 Q;  4MN3 A;  4FXK C;  2ES2 A;  1EYG A;  1F9R A;  1VQK A;  1CFM A;  4TSS A;  5DLQ E;  1R9T H;  1SYD A;  4R1J A;  3VDY A;  4QIW E;  1B9M A;  1GM5 A;  3TP7 A;  2JA7 B;  1Y1V H;  4RWS C;  3GTP H;  3R8B A;  1I6H B;  2B2W A;  5E4X A;  2KHS A;  2VXW A;  2I46 A;  3MA2 B;  4DK6 C;  4HMJ A;  3GTG B;  4DR1 L;  1I3Q H;  3K59 A;  1Q1E A;  5JPM C;  1UWV A;  2EYF A;  3L2P A;  1TS2 A;  4EQN A;  2WB1 B;  4DXF A;  4A3E H;  3I4M B;  1EZ6 A;  2CQA A;  2ASB A;  2BDN A;  1QVF A;  3JAM L;  2PZT A;  5IIF A;  4GLV B;  5KND A;  1ONL A;  5JJZ A;  5IP9 G;  1BBW A;  2F0U A;  3NBH A;  3SDZ A;  5C0X J;  4L5R C;  2I07 B;  1LTL A;  2JSO A;  4B9X A;  3VA7 A;  5J39 A;  3OMG A;  4S3S A;  1STG A;  1M90 C;  4F88 A;  4KJN A;  4JI7 L;  4FF2 A;  1A6X A;  3HS0 C;  2K1B A;  4OWT B;  2EOT A;  3IAY A;  4OGQ C;  1L1O A;  3G6E A;  1X3Q A;  2LSS A;  5CV7 A;  2R7D A;  1PTO H;  1HNX Q;  2UUC Q;  2G9H D;  2ALY B;  1V9P A;  4JI3 L;  3GTJ B;  4DV0 Q;  1TS5 A;  4EQ5 A;  1Y1V G;  3EIV A;  1HUN A;  5IGC A;  1E24 A;  3M7G A;  1NNX A;  3I4O A;  3M4P A;  3JC6 6;  1VMC A;  4R8N A;  2BDO A;  3KDF A;  5LL6 S;  2RHS B;  1PDQ A;  1WTQ A;  4DR7 L;  1X6O A;  4P73 A;  3HOW B;  1L2F A;  4DNT B;  1Q8I A;  4C3J G;  3M4O H;  4IUQ A;  2ZXR A;  1BO0 A;  1CA5 A;  2TSS A;  2VQF Q;  2X6G A;  2ATW A;  1LM0 A;  2HDM A;  3S1N H;  3VR4 A;  3E0E A;  5KYL A;  1C9O A;  1N9W A;  4A3E G;  5D3D A;  3ONA B;  2WAQ E;  4HMI A;  3NWS A;  2MPM A;  3W2D A;  2F52 A;  3CME A;  1NY4 A;  3PUW A;  4JI6 Q;  2B2T C;  1YNN D;  4KKS A;  4MHE A;  1VQ4 A;  4J8Q A;  2UXD L;  2OEO A;  2A19 A;  5BN5 A;  5M3F H;  3S24 A;  1X54 A;  1PH8 A;  1CHQ D;  4AYB E;  1RDP D;  1FJG L;  1IL2 A;  2E74 C;  3OHX C;  1W2B A;  1HA5 A;  4B3S L;  1UE1 A;  3H91 A;  3GTL H;  5I2Y A;  2EJG C;  3I7F A;  4GLA C;  3NXW A;  1A0I A;  1CZW A;  3M9B A;  1ZYR C;  1LUZ A;  3GTO H;  4OO1 H;  1I50 B;  1O7L A;  2ZM6 L;  2K6A A;  4A3M B;  2Y0S B;  3PMF A;  3IL8 A;  1F77 A;  2Z8L A;  2F0D A;  2EY2 A;  3F2C A;  5M5X B;  2J7Z A;  4OXP A;  1JOO A;  3BJU A;  2E8G A;  2YU9 B;  2H4O A;  3VYU A;  4RHR A;  2Q2I A;  1VQJ A;  2RBM A;  3MXU A;  3ULJ A;  4R4I A;  2NZ1 D;  5IP7 H;  1F2M A;  3GO5 A;  4RGM A;  3VYS A;  1Q7Y C;  1AE3 A;  4CKB A;  3RZD B;  4GN5 A;  3GD7 A;  1D5Z C;  2XN9 C;  3VR6 A;  1KAW A;  4IN3 A;  2A68 D;  2NWG A;  1HHV A;  3X3N A;  5A2Q E;  3HOU H;  4FF3 A;  4NKL A;  1QVC A;  2PQA A;  5M3F G;  4QQB X;  1HNZ L;  3SEB A;  3CCJ A;  4UPA A;  3J7Y W;  3KK7 A;  1TWH B;  5IYC H;  1NR4 A;  4RFB A;  1XPR A;  2RA4 A;  2F0Q A;  2QKI C;  2HHH L;  4LF8 Q;  2Z4I A;  2WKD A;  3PO3 G;  3RN5 A;  4IUN A;  4O2D A;  1KLG D;  2B2W C;  4IJL A;  1TU2 B;  3LGJ A;  1EEI D;  3DM3 A;  2OQK A;  2D62 A;  3CPF A;  2F0S A;  4NDX A;  3PF4 A;  4HR7 B;  5AJ3 Q;  4JI2 Q;  3OIQ A;  1H9R A;  2G9D A;  3UE0 A;  5D3I B;  4MTK A;  4A3G H;  4O42 A;  2EYM A;  4OON A;  3JAM i;  1Q8K A;  3M4Y A;  1PZI D;  5EJW A;  2ZTD A;  5CV4 A;  2ICE C;  1GUG A;  1PA6 A;  1X32 A;  4DAY B;  3PO2 B;  4L5S A;  4HIO A;  4M1U B;  3OPO A;  2Z4H A;  4F8M A;  3BU2 A;  3E6Z X;  3QO2 A;  1PRT F;  3GTM B;  2FJ2 A;  2R6G A;  3T1Y L;  4GN4 B;  4JBM A;  4QF4 A;  3K7A B;  1JE5 A;  4JV5 Q;  3G7L A;  1C8C A;  1L1O C;  2F0W A;  2JEA I;  2B8G A;  5IYC G;  3STB C;  4A3K H;  1PFB A;  3VR2 A;  1J6Q A;  4MNO A;  5A35 A;  1HJP A;  1S5B D;  1P16 A;  1JR0 D;  1QE6 A;  3SR1 A;  4LMQ D;  3GTK B;  5J22 A;  4FNF A;  2Q8R E;  1YI2 A;  4TVA B;  4P71 A;  1VDZ A;  1XMO L;  5C4Z A;  2AHO B;  3OW7 A;  1PFM A;  1EIH A;  2JA5 B;  5A2Q L;  5C44 B;  1YIT A;  1W6K A;  1WCM B;  3NUC A;  4DNR B;  4B3M Q;  2HQL A;  2I5M X;  3CCV A;  4FXD A;  4AH6 A;  5LHY 1;  4AYB G;  4DK1 A;  3RMH A;  1HR0 Q;  4A3L H;  1NUC A;  2EE1 A;  3A54 A;  4A3G G;  2RSN A;  4GZY C;  4GNX A;  1GO3 E;  3TME A;  1BR9 A;  2MGS A;  1PZK D;  1Y14 B;  1SNQ A;  1ENF A;  4ZRZ A;  1HTP A;  4RGN A;  3W5O A;  4DAM A;  4RG1 A;  3FHW A;  1JQY D;  1DON A;  3MXN B;  2MHV A;  2K04 A;  2JA9 A;  1LTA D;  1XNQ Q;  2WII B;  3S15 H;  2O5J C;  4GKK Q;  3PIO 3;  3WOF A;  1WTH A;  4DV1 Q;  1T9H A;  4LFC Q;  3K5N A;  4L5Q A;  3L3O C;  4A3K G;  5JVG 3;  3PUY A;  4RMF A;  2FMC A;  3D6W A;  4BWG B;  3OWF A;  2JEB I;  1K8G A;  1PTO F;  3A5Z B;  1Y1W G;  4DR6 Q;  4C3H H;  1MGS A;  2CW0 D;  3BDC A;  3CPW A;  2IX0 A;  3TEH B;  3TZD A;  5M3M G;  4IO9 A;  4A3L G;  1LAC A;  5GQO A;  1TQO A;  3V96 A;  2JA8 H;  3H3V I;  2UXC Q;  4DXG A;  1JE4 A;  3K0Y A;  1D8L A;  3EFX D;  4KI0 A;  4TRD A;  3J81 i;  1GXD C;  1TS3 A;  4C3I B;  2QF7 A;  4QMG A;  2BA1 A;  2PQE A;  1RJT A;  4KKT A;  1OXX K;  4A3D H;  5JEA J;  4OIJ A;  3PV0 A;  4XT1 B;  1ZEQ X;  3I91 A;  3DWQ A;  4LF4 Q;  1QOH A;  4J15 A;  1C4Q A;  4OEM B;  1UE6 A;  4Y52 H;  4XQJ A;  1XJV A;  4EGV A;  1TKW B;  4OHJ A;  2B2U A;  5I9O A;  3CRL C;  1JB3 A;  4DF7 A;  1Q90 A;  1Y8P B;  3I70 A;  1WJJ A;  4BBS B;  4NXN L;  3NQI A;  2OTL A;  3T53 B;  4A3B H;  4UP9 A;  1HZA A;  4C3H G;  1U4M A;  2F0V A;  4LUZ A;  2CFM A;  2OTJ A;  1X55 A;  4ZUJ A;  1SN8 A;  2PW5 A;  4K0K L;  2R93 B;  3DUZ A;  3HOZ H;  2B2Y C;  1EU4 A;  2MFI A;  2K7V A;  1K83 B;  2JA8 G;  1RTO A;  3EA6 A;  3JAM c;  1GVP A;  4CHT B;  2IHF A;  3GTG H;  4F87 A;  2JA6 B;  5BR8 L;  2F0I A;  1F2L A;  4KV6 A;  5CC4 A;  2QEJ C;  5C5L A;  2QA4 A;  4A3D G;  4IFD H;  2K32 A;  3K5M A;  2XSC A;  3NWT A;  1KDB A;  4JOI A;  1B3A A;  1AH9 A;  5FO9 B;  4X66 L;  1TWF B;  5CMD A;  3HOY B;  3D6C A;  3I4M H;  3RLO A;  5IGF A;  5IGG A;  4JI5 L;  1HZ9 A;  2R7Z B;  3U4Z A;  1PMR A;  4L5T A;  1PH3 A;  1Z9F A;  4DV2 Q;  1AE2 A;  3BZD B;  1D1I A;  4AQY L;  2EZV A;  3H94 A;  3PUV A;  5F2D A;  4DGZ A;  5GAG C;  3HKZ B;  1BCP F;  3WDN A;  4Q0F A;  1Z7T A;  1WTO A;  1LO5 D;  4FVM A;  4A3B G;  4XTC S;  3F2B A;  4FF4 A;  2VB2 X;  4ULL A;  3D4D A;  3X3M A;  2A69 D;  1GOZ A;  4X62 Q;  2BH8 A;  1X56 A;  1VQB A;  1X65 A;  1YHB A;  2Q8I B;  5M5W B;  2E2J H;  4JBK A;  3F1Z A;  3HOZ G;  2BOS A;  3DXJ C;  2X69 A;  4DR5 Q;  1EZ8 A;  3E5S A;  2RQX A;  4X64 Q;  3H3V C;  1ASY A;  3NP8 A;  2KUM A;  4A3I H;  3K5O A;  3SE0 A;  4BBR B;  3F2U A;  3S17 B;  2PZU A;  3S1Q B;  5C4H A;  3HOW H;  4RKB A;  1HTL D;  4IFD G;  1R4P B;  2PYK A;  3NTK A;  3TZU A;  3I90 A;  2ENB A;  3GV6 A;  2P5Z X;  1S5D D;  2L55 A;  1PH1 A;  1I4X A;  2F4I A;  5C0X I;  2WB1 G;  1H95 A;  1O7Z A;  1MI2 A;  3HGB A;  4LK1 C;  4DR1 Q;  3S2H B;  1KNA A;  2EJM A;  1TWC B;  2K03 A;  1VQC A;  3CCQ A;  5E7N A;  4YHH L;  2DNE A;  3ZJY C;  3ERS X;  1HQM C;  1KHI A;  1J5E L;  5LMU L;  5KRU A;  5DM7 3;  3S2D H;  2VB3 X;  1SEB D;  1U4R A;  2IY5 B;  4JI8 L;  1EU3 A;  4XYO A;  1HFN A;  1KL9 A;  1QJO A;  2K75 A;  4QY7 A;  5CBA E;  1AW7 A;  2NVY B;  2RCF A;  2KBN A;  2HIV A;  4K2L A;  3ZYY X;  1CSQ A;  4QGU A;  1ZYR D;  1AZP A;  3GTQ H;  1FVI A;  2O2L D;  1V1P B;  2K5N A;  1T5E A;  1CKO A;  1CI3 M;  2LY7 A;  2ZXO A;  1OO9 B;  1JWM D;  2CWP A;  3QIA A;  5CBE E;  5CYU A;  1PFN A;  1L0Y B;  4RKL A;  3HOX G;  4JI7 Q;  1NTG A;  5NUC A;  5IWA L;  4A3I G;  4FYD A;  1E1T A;  1I50 H;  5C3E B;  5M5Y B;  2F0G A;  2F0O A;  4A3M H;  2XIW A;  1MKH A;  3J81 c;  2A6H C;  5M5X H;  1QVG A;  5I6W A;  1J9O A;  2B3G A;  3JAM E;  3HOW G;  1XTC D;  2F0J A;  4JI3 Q;  3BVM A;  2YU9 H;  4A76 A;  1LTS D;  2GVA A;  1XX8 A;  3K58 A;  1I4R A;  5L37 A;  4KMU C;  1JJ2 A;  4ZYS A;  4JBW A;  4HIK A;  3I56 A;  1BQQ T;  4DR7 Q;  1A3V A;  2B2U C;  3SK5 A;  3PIO A;  2UUB L;  3DWP A;  4DU9 A;  4XDX A;  2KED A;  2TMP A;  1SR3 A;  1YEZ A;  1SBB B;  1TII D;  4A4I A;  1OXS C;  1VCI A;  1HNW L;  1UUP A;  4ID6 A;  1GUS A;  1X9N A;  4TKO B;  3A7L A;  4DAP A;  3R93 A;  2EYP A;  3I4L A;  4KY7 A;  1EQT A;  3T16 A;  2UXD Q;  3BVZ A;  1RHP A;  5EKK A;  3M3Y B;  1BCP C;  4PMC A;  1CKM A;  4CGY B;  1VQ6 A;  1G2T A;  4NXM L;  3MTS A;  2SEB D;  4KLK A;  3DLL A;  1WTR A;  1FJG Q;  1AEX A;  1YVC A;  4RCO A;  2DNC A;  4A3M G;  2NYZ D;  2CVR A;  1EY8 A;  4B3S Q;  1RL2 A;  4LFB L;  4ILW A;  1FNU A;  4PZ7 A;  1EYA A;  4JI0 L;  3OOC A;  2R92 G;  2E2I B;  5IOD A;  4JOI C;  1SDF A;  1EYC A;  1HH2 P;  5J1Z A;  1DD2 A;  3UDF A;  1JCK B;  2ZM6 Q;  4A3J B;  1N34 L;  2ZT9 C;  4KN7 C;  5IYD H;  2UUA L;  1F9P A;  4IOA A;  1RIP A;  2IPK D;  4HCE A;  5E3F A;  1O78 A;  3G6J B;  3K81 C;  5FJ8 H;  5ELE A;  5AFW A;  4ALP A;  1FGB D;  2OT2 A;  3M7N A;  2K33 A;  4IUV A;  5KYI A;  3GTM H;  1AP0 A;  4BY1 B;  2KCT A;  2WFW A;  3LX0 A;  4APV A;  3J7A V;  3K7A H;  3CP0 A;  2EY1 A;  4L6T B;  4P74 A;  1NMF A;  2XNA C;  1QUQ A;  4KY5 A;  4DV4 L;  3OIP A;  2KHI A;  5JJK A;  3QJY A;  4LW1 A;  1G8Z D;  2R7F A;  1S3O A;  1V8Q A;  5EBC A;  1VQG A;  1TY0 A;  4FO2 A;  1VQE A;  4KKU A;  3GTK H;  1E7Z A;  1YZ6 A;  3AMU A;  1HNZ Q;  4G57 A;  5JPN C;  4WJW A;  1H9K A;  2B39 A;  1KQS A;  1YBY A;  2E5L L;  2J0T D;  3NBH B;  2F3V A;  4HSV A;  3Q23 A;  2WV6 D;  5C44 H;  1WCM H;  2HHH Q;  1PH4 A;  2F0F A;  4XT3 B;  2IWH A;  2M2L A;  3J81 E;  1I6V C;  3EN2 A;  1EQQ A;  1L1O B;  1JOK A;  3MXG A;  4N9T A;  5C5M A;  4DR2 L;  5IYD G;  3A7A B;  4NB3 A;  2K5D A;  2NVX B;  2QIL A;  4GLX A;  1K3R A;  2PCF B;  1OXV A;  5FJ8 G;  3S14 H;  2C35 B;  1SMY C;  4L8J A;  4HCS A;  3KDF B;  4A3F B;  3KLW A;  1SYB A;  2QGQ A;  2E2D C;  4DV3 L;  3M4Q A;  2BCO A;  4X65 L;  4CDD C;  1Q12 A;  1LTG D;  1G29 1;  3V2T A;  2AUJ D;  3FKI B;  5D65 A;  1IBK L;  2Q2U A;  2WKC A;  4A93 H;  3MXP A;  2A73 B;  1V1O A;  4HIM A;  2Z6K A;  3URY A;  4DUZ L;  3T51 B;  4IUT A;  1EFW A;  3CQZ B;  1I5F A;  5ELD A;  4CKC A;  4H7B A;  1IXR A;  3A8I E;  2CH4 W;  2VUM B;  5TSS A;  5JJL A;  5IGB A;  4P72 A;  5C44 G;  4JI1 L;  5C4X B;  1WCM G;  1C0A A;  3NEL A;  2DGY A;  3S1M B;  3L7Z C;  1ZXT A;  2E2H B;  4JK1 C;  3FPP A;  4IUP A;  1TWG B;  3HKZ E;  1ZKO A;  1D2B A;  1A62 A;  4OEL B;  2NVQ H;  3U9O A;  2F0E A;  2EDG A;  1FGU A;  4C3I H;  3W1B A;  1HZC A;  1YHA A;  3TSS A;  1KNE A;  3KLS X;  4YWK A;  4DK3 C;  1I4Q A;  3A5U A;  4DPG A;  1DZ1 A;  3CC2 A;  3MEH A;  1QNK A;  3N52 A;  3K6O A;  4DA2 A;  3J81 L;  1NR2 A;  2F0H A;  4A93 G;  3FMC A;  4PG3 A;  1SYE A;  2RDF A;  3HKS A;  5IYB H;  4DR4 L;  1SAP A;  4WJ4 A;  3MVV A;  1S4Z A;  3KF8 A;  1SRU A;  2BE5 C;  1CQF A;  3SK8 A;  2VY3 A;  4BBS H;  1E2W A;  3F2D A;  3A74 A;  3L0O A;  1H9J A;  5G3L D;  4F7X A;  1WOC A;  4CJ2 C;  3F8T A;  2PQA B;  4M8A A;  5EGT A;  1VQ7 A;  1XMQ L;  3AEV A;  1UAP A;  1XPU A;  3U50 C;  5IGE A;  1U4P A;  1K83 H;  5DEH A;  2F4V L;  4OO1 G;  5FLX L;  1EYD A;  3FP9 A;  4LWC A;  5E4W C;  3RZO H;  3EQL C;  1PV4 A;  2EY5 A;  2AQ1 B;  4HID A;  1Y8N B;  2PPB C;  3TBI B;  1AFP A;  4PZ8 A;  2PMZ E;  4IJH A;  4J6H A;  1PRT B;  1I4G A;  2C9O A;  4N9P A;  4X3U A;  1YJW A;  1H9M A;  3GV3 A;  5IP7 G;  3CU7 A;  2Q2T A;  1SYC A;  1RKN A;  2HCI A;  2L11 A;  4X3K A;  2NVT B;  3U4V A;  4JPB W;  1YNJ D;  2R7Z H;  1SRO A;  4OX9 L;  1BBX C;  4MTN A;  1B2T A;  5IYB G;  5CGK A;  3KLR A;  2E76 C;  3HOU G;  3M85 A;  1XYI A;  3DEO A;  3ULL A;  1Y1V B;  1NAP A;  4BBS G;  1XPO A;  2VNU D;  1XTD A;  3TS0 A;  3SHL A;  1D1K A;  3AYH B;  4DUY L;  2L15 A;  1N32 Q;  4Y7N H;  3BDO A;  4ZAI A;  1S5F D;  1K9M C;  4IFD J;  3TN2 A;  2UXB L;  1I4P A;  2D9U A;  4C3J B;  2B8F A;  4K5X A;  5M5W H;  1W6J A;  4JI6 L;  1WTV A;  3H0G H;  3CHB D;  2M00 A;  1WVL A;  2EXD A;  2ZJR A;  4K8I A;  4V0B A;  1K0S A;  2L12 A;  1PH9 A;  5IGD A;  3S1Q H;  3A55 A;  1EFI D;  5C4J H;  4DK0 A;  2NZH A;  3OTO L;  4K0K Q;  1HR0 W;  2BA0 A;  1HFG A;  1STY A;  3PCO B;  2NTS A;  3D3R A;  2XRQ D;  3NHH A;  1PH7 A;  3L9A X;  1VQM A;  4O0A A;  1A3T A;  2AWO A;  4YCV A;  5GAD C;  1LLR D;  4DV5 L;  1IL8 A;  3KYH C;  3S2H H;  5BR8 Q;  2R7Z G;  1PYB A;  3A0J A;  4EVO A;  3N6R A;  4IUR A;  1H9S A;  2ZXP A;  1IW7 D;  4GNX B;  5JOB A;  2NN6 I;  4G7Z C;  2E75 C;  2R61 A;  2YTX A;  3HKZ G;  3HP3 A;  4DFA A;  3SK4 A;  1TXY A;  4PQX A;  4ZCK A;  2YTY A;  2NVY H;  5LMN Q;  1GUN A;  3DWA A;  4JI5 Q;  4LJZ C;  1J8I A;  4LF9 L;  4AQY Q;  1VQL A;  4JYA L;  1EL0 A;  1ESR A;  2ZJP A;  1LAB A;  4ZKB B;  2A6H D;  3OSO A;  3M4O B;  5KEE A;  4RH6 A;  1QB5 D;  3I73 A;  3H0G G;  1G6Z A;  2D5D A;  2RDG A;  3KFU A;  3S1N B;  4GOP A;  1LV9 A;  5M5Y H;  3H09 A;  2VS1 A;  3PSI A;  4QIW B;  1SFO B;  3S9W A;  2WB1 E;  1ICW A;  4JCV E;  4AIM A;  5I2X A;  4XQQ A;  1Q1B A;  2N88 A;  2KVM A;  1N36 L;  1MD2 D;  1IZ6 A;  2DN8 A;  3KLS A;  1QZH A;  1N33 L;  3AFP A;  1TWA H;  2L9H A;  2SNS A;  4A75 A;  1YJN A;  3P20 A;  3TP5 A;  5EBD A;  3GTL B;  5AJ3 L;  4JI2 L;  3C1E A;  2F0P A;  3PO3 B;  4EQP A;  1PH5 A;  2CHB D;  4RGO S;  2PI2 E;  1YJ9 A;  3IFD A;  4FXG C;  3GTO B;  2JE6 I;  1II3 A;  3I4N B;  4MIU A;  1VQF A;  3Q22 A;  1BBU A;  4IAL A;  1LT4 D;  4YHH Q;  5LL6 X;  1J5E Q;  2D0P A;  4B08 A;  1HA6 A;  5KIX A;  4R9W A;  3A8J E;  3DEP A;  1EIY B;  4MZ9 A;  5ISR A;  4K5V A;  1STN A;  4JI8 Q;  2J4X A;  1PRT C;  4OWX B;  1LT6 D;  3E9I A;  4G7O C;  2AUK A;  1JOQ A;  2MNA A;  4I7A A;  5CV8 A;  1A2U A;  4JG2 A;  2PW7 A;  1PFS A;  1ML0 D;  1BF4 A;  2HCC A;  1K0R A;  2QDL A;  5I4D A;  4XYQ A;  1B8A A;  3W3A A;  3TP6 A;  5I6Y A;  1Z6H A;  2JA7 H;  4XIG S;  5IWA Q;  1CT1 D;  2K01 A;  1U5K A;  4CDE C;  2EVB A;  4WRD A;  1Q3L A;  1I6H H;  5IOC A;  4A3J H;  1KC8 C;  1CKN A;  1QIL A;  3ND8 A;  3OMC A;  5JJI A;  1A8V A;  2DUD A;  1CZG A;  1SNP A;  2ZTC A;  3LWU A;  1BCP B;  3RN2 A;  4B3M L;  1ET9 A;  3RUZ A;  3FEW X;  2NZO A;  4FF1 A;  2OF1 A;  1ENA A;  2WAQ B;  2FHT A;  4BY1 H;  3H15 A;  1P8L A;  1PYS B;  1EIG A;  2UU9 L;  5T1G A;  3SXH A;  2R3Z A;  1BKB A;  3HOV B;  4LF6 L;  3J80 i;  4NPS A;  4EX5 A;  4RAU C;  2Y0S E;  3CCR A;  4AYB B;  3I3C A;  1V43 A;  2IJ0 A;  4A3G B;  4PV1 C;  1HNW Q;  1S5E D;  3KF6 A;  3UDI A;  3T13 A;  4IQZ A;  3Q8D A;  4CBV A;  4KJO A;  3GTJ H;  2Z9H A;  1B4O A;  1CTM A;  3I55 A;  1NBW A;  1PTO C;  2MP1 A;  3BG3 A;  4GNX C;  2JA7 G;  4KHP L;  1VQI A;  2RCN A;  1EUJ A;  3LNN A;  3D4R A;  4UHV A;  4IPC A;  1IYV A;  4A3J G;  1GHJ A;  1SMY D;  3KBX A;  2FFK B;  2F0L A;  1KAA A;  4LFB Q;  1JOR A;  1VQD A;  1DOL A;  2Z0S A;  3ITP A;  4JI0 Q;  2GN5 A;  3CRK C;  3NEN A;  2LFN A;  2A74 C;  5C3X A;  1N34 Q;  3UDX A;  5ELF A;  2CQO A;  1RTN A;  3NSW A;  1Y1W B;  3I4M G;  2UUA Q;  1WD1 A;  1A2T A;  1KD1 C;  2MUY A;  4BY7 B;  2YTV A;  3AB9 A;  4R4O A;  2ZJQ A;  2KEE A;  4DV6 L;  3FKI H;  5M3M B;  1GD7 A;  1JWU D;  2MO0 A;  4A3C H;  4K5W A;  1C7Y A;  2KQ3 A;  2K5W A;  3D31 A;  1F2Y A;  1KLU D;  1ROD A;  4B3R L;  1IBM L;  4GOP C;  3C3L A;  1UEA B;  3K8A A;  3KJP A;  2V4D A;  4C2M B;  4DV4 Q;  2EJF C;  1KIX A;  2VUM H;  4UY8 C;  1B53 A;  1XNR L;  4QUC A;  3ERO A;  5EPK A;  2EYH A;  4U67 3;  1X3E A;  3BS1 A;  1B44 D;  2F0T A;  4H44 C;  1SXT A;  1VQN A;  3CXC A;  2E5L Q;  3AFQ A;  5BN3 A;  4B3T L;  4RCN A;  1G91 A;  2HUG A;  1K73 C;  2EIF A;  2N8N A;  3TP8 A;  4CKE A;  1LT3 D;  4TQU S;  4Z9C B;  2O4X A;  1M1K C;  2HIX A;  1G6P A;  4LFA L;  3NTH A;  1CK1 A;  4YCU A;  4DR2 Q;  4ODG A;  1JB7 A;  4GKJ L;  2IHE A;  1EOT A;  4ZK9 B;  4HN7 A;  2Q2H A;  2EXZ A;  1NCV A;  2RSO A;  2BE5 D;  3RLN A;  3RZD H;  4LUO A;  1M4V A;  3FKI G;  1DGS A;  4X3S A;  1OXT A;  3CD6 A;  4DV7 L;  4A3C G;  1DM0 B;  1IYJ B;  5FLX c;  4RGT A;  1F2Z A;  2KJX A;  4DV3 Q;  1RD9 D;  5K36 H;  1VQ5 A;  4X65 Q;  4NMZ A;  2EY6 A;  3BVG A;  1JJG A;  1DCZ A;  1TWH H;  4DR3 L;  1IBK Q;  3J7Z C;  2OQ0 A;  2B29 A;  4YWL A;  3NTI A;  4UAI A;  4A3D B;  4NW2 A;  5HGT A;  4DUZ Q;  1GUT A;  5CV6 A;  1QNU A;  4ZQ3 A;  1W3S A;  2OCE A;  2VZA A;  1BOS A;  5EQ0 A;  1TR5 A;  1EQR A;  2Y0S G;  5K5P A;  4IUU A;  4KN4 C;  3TDQ A;  2MJ8 A;  4JI1 Q;  1ASZ A;  1UE5 A;  3TRE A;  2NUC A;  4QL5 A;  2A6E C;  1DOK A;  4U68 A;  4X62 L;  2B63 B;  2L1B A;  1O80 A;  4DNI A;  4K8J A;  3VR3 A;  4P2C B;  1Q46 A;  5M9O A;  4X64 L;  2NB0 A;  1HRJ A;  4A3B B;  5IT9 c;  2YV5 A;  2A1A A;  3J80 c;  3I2Z A;  1JC7 A;  1B70 B;  2BH2 A;  3K57 A;  3PO2 H;  3T1H L;  3TS2 A;  2PNH A;  1FNW A;  2KHJ A;  5D14 A;  3EJI A;  3STB D;  3HOZ B;  4YY3 L;  3P7J A;  2JN4 A;  3E3X A;  1X3G A;  2VQE L;  4N8F A;  1GJX A;  4UP8 A;  1PZJ D;  3I72 A;  2D2C C;  5K36 G;  1GUO A;  3CW2 C;  1I94 L;  1LT5 D;  1OXU A;  2IX3 A;  1SE2 A;  1N8R C;  1EY9 A;  3HFZ B;  3RD4 A;  2NN6 H;  1DXM A;  4DR4 Q;  1EEF D;  2AMC B;  2KCC A;  1SE4 A;  4C3J H;  2HD3 A;  3TQY A;  1QUQ B;  1VQ8 A;  4LF5 L;  2M9V A;  1V1Q A;  2L4N A;  1MIU A;  4LF7 L;  4QCL A;  4WJ3 M;  3MFY A;  2JA5 H;  3R2I A;  1SJH D;  3V05 A;  1BXT A;  1K8O A;  1E22 A;  2EPB A;  1VMP A;  2H5X A;  1EY7 A;  1IBL L;  3CCL A;  1XMQ Q;  5GAE C;  3KUP A;  4BXX H;  4OIK A;  3QB3 A;  1FYC A;  1LTR D;  1QCB D;  2F4V Q;  2PI2 A;  4Q5V A;  1A63 A;  3IKJ A;  3CCS A;  2KOL A;  5E1F A;  2QW7 A;  4NP5 A;  1SYF A;  2AKW B;  3QWN A;  1U0L A;  1PH6 A;  1EY0 A;  2JXM B;  3QOL A;  1YHQ A;  1HZB A;  1S40 A;  3PO2 G;  1O7I A;  3H3V H;  2E2J B;  2RKS A;  1KRS A;  5C3W A;  4K6D A;  5FO8 B; 
#chains in the Genus database with same CATH homology
 2V1C C;  4A3F G;  4BBS G;  4IFD I;  1XPO A;  4NXN L;  4YCW A;  2OTL A;  2VNU D;  3IRB A;  4A3B H;  1VQO A;  1XTD A;  4UP9 A;  1HZA A;  3TS0 A;  1OTC A;  4ME3 A;  3AYH B;  4DUY L;  4R4T A;  4LUZ A;  4HJ8 A;  3G48 A;  4OX9 Q;  2L15 A;  3J81 j;  1X3F A;  1N32 Q;  2CFM A;  4Y7N H;  1NE3 A;  2OTJ A;  2NN6 G;  1X55 A;  1K9M C;  4OWW B;  1SN8 A;  4IFD J;  4K0K L;  5HY6 A;  2UXB L;  2R92 H;  3HOZ H;  5M5W H;  3T1Y Q;  4DKA C;  2OWO A;  4JI6 L;  1SLJ A;  3RLF A;  2MFI A;  3H0G H;  2JA8 G;  2FXQ A;  2EXD A;  3OW2 A;  1B7Y B;  3JAM c;  1GVP A;  2ZJR A;  4DUY Q;  1NJI C;  2VUM G;  1CUK A;  2JA5 G;  3CAM A;  1PH9 A;  2IHF A;  2K5V A;  3PGZ A;  3GTG H;  3S1Q H;  1SFO H;  5C4X G;  5BR8 L;  5C4J H;  5ELO A;  4DV2 L;  2NZH A;  3OTO L;  4K0K Q;  4IOC A;  1HR0 W;  3S16 H;  2BA0 A;  4UP7 A;  2UXB Q;  4BXX G;  2QA4 A;  4A3D G;  3E9H A;  2JK8 A;  2MQH A;  3PCO B;  1JJC B;  2N49 A;  2AWN A;  1PH7 A;  2IX1 A;  4JOI A;  1XMO Q;  1AH9 A;  4X66 L;  1VQM A;  4PZ6 A;  4O0A A;  5IE8 A;  3I4M H;  3RLO A;  4QJF A;  2AWO A;  1VS0 A;  4YCV A;  4IPD A;  2GVB A;  2I5L X;  5GAD C;  4DV5 L;  2XTI A;  4JI5 L;  1HZ9 A;  3KYH C;  5BR8 Q;  3U4Z A;  4L5T A;  1MJC A;  1PYB A;  1PH3 A;  3A0J A;  1Z9F A;  3KOJ A;  4R4C A;  3OTO Q;  4DV2 Q;  1AE2 A;  4AQY L;  4JI4 L;  4GNX B;  5IP9 H;  3PUV A;  1WI5 A;  2K4K A;  2K5H A;  2NN6 I;  4IPG A;  1JMC A;  5GAG C;  2YTX A;  3HKZ G;  3S1R H;  5JEA G;  2RHQ B;  1GKH A;  3PO3 H;  3CC4 A;  1TXY A;  3PUZ A;  4DR5 L;  3EBE A;  3W1G A;  3J7A 5;  2KCM A;  4PMW A;  2YTY A;  4HJ5 A;  2NVY H;  4DV5 Q;  5LMN Q;  2N78 A;  4JI5 Q;  3I4N H;  1SE8 A;  4XTC S;  2NVT H;  3CCE A;  1EOV A;  3F2B A;  2A8V A;  4LF9 L;  4AQY Q;  3BZK A;  4JI4 Q;  1VQL A;  4JYA L;  4X62 Q;  2ES2 A;  2BH8 A;  1EYG A;  1X56 A;  1VQK A;  2ZJP A;  1VQB A;  5DLQ E;  1X65 A;  1R9T H;  1YHB A;  2E2J H;  4JBK A;  3HOZ G;  3F1Z A;  1YIJ A;  4R1J A;  3VDY A;  4QIW E;  1GM5 A;  4DR5 Q;  1Y1V H;  3H0G G;  4X64 Q;  1ASY A;  3KFU A;  4A3I H;  4HJ9 A;  4GOP A;  3GTP H;  3UDG A;  5M5Y H;  4DK6 C;  4LF9 Q;  2VS1 A;  3PSI A;  4JYA Q;  3KF8 B;  4DR1 L;  1I3Q H;  1FL0 A;  2WB1 E;  1Q1E A;  4JCV E;  2R93 H;  3HOW H;  4AIM A;  1UWV A;  4IFD G;  1Q1B A;  3L2P A;  1WYD A;  1N36 L;  1PH1 A;  1IZ6 A;  1JT8 A;  5C0X I;  2WB1 G;  1H95 A;  4A3E H;  2ASB A;  1QVF A;  1QZH A;  3KJO A;  1N33 L;  3AFP A;  4DR1 Q;  2JA6 H;  4GLV B;  3CCQ A;  1VQC A;  4GS3 A;  1TWA H;  5E7N A;  1KRT A;  4FDB A;  3ZJY C;  3ERS X;  4YHH L;  1J5E L;  1KHI A;  3WWV A;  5IP9 G;  5LMU L;  1BBW A;  4A75 A;  1YJN A;  3S2D H;  5AJ3 L;  4JI2 L;  5FLM H;  5C0X J;  4L5R C;  1LTL A;  1HNX L;  2UUC L;  1N36 Q;  1PH5 A;  1D7Q A;  2IY5 B;  4JI8 L;  4DV0 L;  1M90 C;  3ULP A;  3S2H H;  1KL9 A;  2PI2 E;  1YJ9 A;  2K75 A;  4QY7 A;  4JI7 L;  1TWF H;  2JE6 I;  3HOY H;  3I4N G;  1VQF A;  1N33 Q;  2KBN A;  2HIV A;  4OWT B;  1BBU A;  1CSQ A;  5GAH C;  4QGU A;  3GTQ H;  1FVI A;  4YHH Q;  1L1O A;  1E1O A;  3G6E A;  3HOV H;  1J5E Q;  2D0P A;  2IT1 A;  2LSS A;  2R7D A;  2K5N A;  4POG A;  2XGT A;  1CKO A;  1EIY B;  4MZ9 A;  1HNX Q;  2CWP A;  2UUC Q;  3ER0 A;  2ALY B;  1V9P A;  2RF4 A;  4JI3 L;  4JI8 Q;  4DV0 Q;  4EQ5 A;  4OWX B;  1Y1V G;  3EIV A;  3E9I A;  3HOX G;  4JI7 Q;  2VQF L;  1NTG A;  5IWA L;  4A3I G;  1E24 A;  1E1T A;  1I50 H;  3I4O A;  3M4P A;  3JC6 6;  2MNA A;  4A3M H;  1MKH A;  3J81 c;  3KDF A;  1Q82 C;  4JG2 A;  5J3B A;  1PFS A;  5M5X H;  2RHS B;  1QVG A;  2KEN A;  1K8A C;  4DR7 L;  1K0R A;  1X6O A;  2B3G A;  4P73 A;  3CCU A;  2R93 G;  1L2F A;  3HOW G;  2ID0 A;  4JI3 Q;  1B8A A;  2YU9 H;  4A76 A;  3M4O H;  2GVA A;  2VQF Q;  4NXN Q;  2JA7 H;  4XIG S;  5IWA Q;  2ATW A;  1LM0 A;  3S1N H;  1U5K A;  3E0E A;  1C9O A;  1N9W A;  1I6H H;  4A3J H;  1JJ2 A;  4A3E G;  4BBR H;  4JBW A;  1KC8 C;  4HIK A;  3I56 A;  3SGI A;  1CKN A;  5JJI A;  3MEF A;  3S17 H;  1A8V A;  2DUD A;  2JA6 G;  2ZTC A;  4DR7 Q;  2WAQ E;  3GDE A;  3PIO A;  1QZG A;  2UUB L;  3CME A;  2F52 A;  3RN2 A;  1NY4 A;  3PUW A;  4B3M L;  4JI6 Q;  2VUM H;  5FLM G;  1VQ4 A;  2VW9 A;  2UXD L;  2NZO A;  2A19 A;  1SR3 A;  1YEZ A;  5M3F H;  2WAQ G;  4BY1 H;  2HT1 A;  2JQO A;  3S24 A;  4A4I A;  1X54 A;  1OXS C;  1P8L A;  1PYS B;  1VCI A;  3H15 A;  1Y1W H;  1PH8 A;  2UU9 L;  3HOY G;  4AYB E;  4H02 A;  2WP8 J;  1HNW L;  1FJG L;  1BKB A;  1X9N A;  1IL2 A;  4BY7 H;  4LF6 L;  1TWC H;  3HOV G;  3J80 i;  1W2B A;  4NPS A;  4B3S L;  1UE1 A;  5M3M H;  4POF A;  3GTL H;  2Z6K C;  4EX5 A;  3I7F A;  2Y0S E;  4GLA C;  3CCR A;  1A0I A;  2UXD Q;  3M9B A;  1V43 A;  5C0X G;  2EQS A;  1CKM A;  4X66 Q;  1VQ6 A;  1UE7 A;  4NXM L;  1LUZ A;  2UU9 Q;  3GTO H;  5LMN W;  4KLK A;  3DLL A;  1HNW Q;  3KF6 A;  2ZM6 L;  1FJG Q;  1YVC A;  3UDI A;  4C2M H;  4A3M G;  4LF6 Q;  4LUV A;  3Q8D A;  4LFB L;  1G51 A;  4B3S Q;  1RL2 A;  4PZ7 A;  3F2C A;  4OXP A;  4JI0 L;  3PUX A;  2QEX A;  3BJU A;  2E8G A;  2R92 G;  3GTJ H;  3I55 A;  1KXL A;  2Q2I A;  1NBW A;  4GNX C;  1PHJ A;  4JOI C;  1VQJ A;  2JA7 G;  4KHP L;  1VQI A;  2RCN A;  1HH2 P;  1EUJ A;  3ULJ A;  1Z47 A;  4R4I A;  3UDF A;  4IPC A;  2ZM6 Q;  1N34 L;  4A3J G;  5IP7 H;  3GO5 A;  5C3E H;  5IYD H;  4BBR G;  1Q7Y C;  2UUA L;  1AE3 A;  4IOA A;  4LFB Q;  1RIP A;  1VQD A;  2CKZ B;  4GN5 A;  2Z0S A;  3GD7 A;  4JI0 Q;  1KAW A;  1VQH A;  2F3I A;  2GN5 A;  3K81 C;  5FJ8 H;  4GOP B;  3NEN A;  4LF8 L;  4KHP Q;  4ALP A;  3HOU H;  4IPH A;  3M7N A;  2VL6 A;  1QVC A;  3GTM H;  2PQA A;  5M3F G;  1N34 Q;  4QQB X;  2KCT A;  2WFW A;  3UDX A;  2CQO A;  4APV A;  1HNZ L;  1PVO A;  3K7A H;  3CP0 A;  3I4M G;  2UUA Q;  4P74 A;  3CCJ A;  5ELN A;  1NMF A;  1KD1 C;  1QUQ A;  4UPA A;  1VQA A;  4BY7 G;  2YTV A;  5IYC H;  4DV4 L;  4R4O A;  2ZJQ A;  2MO1 A;  2KHI A;  4DV6 L;  5JJK A;  3FKI H;  1XPR A;  1GD7 A;  4LW1 A;  2HHH L;  4LF8 Q;  2MO0 A;  1S3O A;  2R7F A;  2ZTE A;  4JC0 A;  4A3C H;  1VQG A;  1C7Y A;  1UEB A;  3PO3 G;  3D31 A;  3RN5 A;  1VQE A;  3GTK H;  1E7Z A;  4O2D A;  5HGQ A;  4B3R L;  1YZ6 A;  1HNZ Q;  1IBM L;  4GOP C;  4IJL A;  3K8A A;  4P75 A;  3LGJ A;  3KJP A;  3CMA A;  1KQS A;  4DV4 Q;  3DM3 A;  1YBY A;  1KIX A;  2OQK A;  2E5L L;  3NBH B;  5H1S E;  1VQP A;  2D62 A;  3CPF A;  4LNQ A;  4UY8 C;  4DV6 Q;  1BVS A;  5LMU Q;  3PF4 A;  5C44 H;  1XNR L;  1WCM H;  5AJ3 Q;  4JI2 Q;  2HHH Q;  3ICE A;  1PH4 A;  3UE0 A;  2YYZ A;  3M3Y H;  4B3R Q;  4A3G H;  1IBM Q;  3EN2 A;  1X3E A;  1EQQ A;  1L1O B;  4OON A;  4DR2 L;  3JAM i;  1Q8K A;  5IYD G;  5C3E G;  1VQN A;  3CXC A;  4JV5 L;  2E5L Q;  3AFQ A;  2ZTD A;  4NB3 A;  4B3T L;  1L0W A;  1XNR Q;  1EIF A;  3K0X A;  4GLX A;  1PA6 A;  1K3R A;  1OXV A;  5EAY A;  1N32 L;  4DAY B;  3K80 C;  1K73 C;  2EIF A;  2N8N A;  4L5S A;  4HIO A;  5FJ8 G;  3S14 H;  2B63 H;  4X6A H;  2C35 B;  4TQU S;  2E2I H;  1M1K C;  3BU2 A;  4HJ7 A;  2HIX A;  1G6P A;  4LFA L;  2R6G A;  4DR2 Q;  4YCU A;  3T1Y L;  3KDF B;  4GN4 B;  1JB7 A;  4JBM A;  4JV5 Q;  3KLW A;  1JE5 A;  2QGQ A;  4GKJ L;  4DV3 L;  2IHE A;  3M4Q A;  4B3T Q;  1CSP A;  4OO1 I;  4X65 L;  1L1O C;  2Q2H A;  1Q12 A;  3RLN A;  3RZD H;  2JEA I;  1G29 1;  5IYC G;  4LUO A;  3STB C;  1YNX A;  4A3K H;  1J6Q A;  4MNO A;  3FKI G;  1HJP A;  1DGS A;  1IBK L;  2Q2U A;  4A93 H;  1OXT A;  3CD6 A;  4DV7 L;  4A3C G;  1P16 A;  1Q86 C;  1IYJ B;  4KHZ A;  4HIM A;  2Z6K A;  4LFA Q;  5FLX c;  1HR0 L;  2K14 A;  1CKN B;  4DUZ L;  4HJA A;  3RNU A;  3NEM A;  3CC7 A;  4GKJ Q;  4DV3 Q;  1YI2 A;  4TVA B;  4P71 A;  1I5F A;  4R4Q A;  2LXJ A;  1XMO L;  1EFW A;  1VQ5 A;  4X65 Q;  3TRZ A;  1IXR A;  2AHO B;  1EWI A;  3AQQ A;  1JJG A;  1TWH H;  3K7U C;  5JJL A;  4P72 A;  1Q81 C;  2UUB Q;  3D0F A;  1YIT A;  4DR3 L;  5C44 G;  4JI1 L;  1IBK Q;  1WCM G;  4B3M Q;  1C0A A;  2HQL A;  2I5M X;  3CCV A;  3J7Z C;  2OQ0 A;  3NEL A;  4AH6 A;  2B29 A;  4YWL A;  4DV7 Q;  1PH2 A;  2DGY A;  4AYB G;  1HR0 Q;  4A3L H;  4DUZ Q;  4A3G G;  3L7Z C;  2I0Q A;  1W3S A;  2OCE A;  1S72 A;  4GNX A;  1GO3 E;  2VZA A;  1XNQ L;  1Y14 B;  1LYL A;  1EQR A;  1NMG A;  2Y0S G;  3HKZ E;  4GKK L;  4DR3 Q;  4JI1 Q;  1A62 A;  1UE5 A;  3TRE A;  5LMN L;  4DV1 L;  1ASZ A;  4LFC L;  4QL5 A;  3W5O A;  1VQ9 A;  4YWM A;  1FGU A;  2K50 A;  3W1B A;  4C3I H;  2NVQ H;  1HZC A;  4DAM A;  1YHA A;  4RG1 A;  3FHW A;  4A3B G;  4X62 L;  3U58 A;  2B63 G;  2CCZ A;  4YWK A;  3MXN B;  4DK3 C;  3KF6 B;  4NXM Q;  3A5U A;  4DNI A;  2JA9 A;  4DPG A;  3CC2 A;  2D0O A;  1XNQ Q;  1SMX A;  1Q46 A;  3S15 H;  4X64 L;  1MJE A;  4GKK Q;  4DR6 L;  5IT9 c;  4DV1 Q;  2YV5 A;  1T9H A;  2A1A A;  2NVX H;  4L5Q A;  1WFQ A;  4LFC Q;  3J80 c;  4A3K G;  3I2Z A;  3PUY A;  1B70 B;  2BH2 A;  4RMF A;  3PO2 H;  4A93 G;  3T1H L;  4PG3 A;  2PNH A;  3TS2 A;  5IYB H;  3HKS A;  2KHJ A;  4DR4 L;  4WJ4 A;  2JJQ A;  3STB D;  2JEB I;  4YY3 L;  1K8G A;  1SRU A;  1X3G A;  2VQE L;  5GRO A;  2LXK A;  4BY1 G;  2VY3 A;  3A5Z B;  4UP8 A;  3HOX H;  3CCM A;  4A3F H;  4BBS H;  2UXC L;  3F2D A;  2I5H A;  5K36 G;  1Y1W G;  3CW2 C;  4DR6 Q;  1I94 L;  3A74 A;  4C3H H;  1OXU A;  3CPW A;  3L0O A;  1N8R C;  2IX0 A;  3G4S A;  3HFZ B;  3TEH B;  1WOC A;  3T1H Q;  5M3M G;  3F8T A;  2PQA B;  4IO9 A;  3G71 A;  4DR4 Q;  2AMC B;  1XMQ L;  1VQ7 A;  4YY3 Q;  3AEV A;  4A3L G;  4BA2 I;  2R7Z G;  4GN3 B;  2CWA A;  4C3J H;  2VQE Q;  5GQO A;  3TQY A;  1QUQ B;  1VQ8 A;  1XPU A;  3U50 C;  2UXC Q;  3H3V I;  4LF5 L;  1K83 H;  2JA8 H;  2F4V L;  4LF4 L;  4OO1 G;  3BZC A;  1V1Q A;  3CQZ H;  1I94 Q;  3FP9 A;  1D8L A;  3B6Y A;  4LWC A;  4KI0 A;  4LF7 L;  1MIU A;  4WJ3 M;  2JA5 H;  3J81 i;  3RZO H;  2K52 A;  1PV4 A;  4JBJ A;  5C4X H;  4HID A;  1E22 A;  2H5X A;  2N3S A;  2PMZ E;  4IJH A;  4PZ8 A;  3PIP A;  1IBL L;  3CCL A;  1XMQ Q;  2BA1 A;  5GAE C;  3CF5 A;  1OXX K;  5IY0 A;  4BXX H;  4A3D H;  5JEA J;  3S1M H;  3PV0 A;  3OYY A;  4LF5 Q;  2F4V Q;  4LF4 Q;  2PI2 A;  1YJW A;  1A63 A;  4J15 A;  4Y52 H;  3CCS A;  1UE6 A;  2E2H H;  5IP7 G;  4LF7 Q;  2Q2T A;  1E3P A;  1TWG H;  3PF5 A;  1XJV A;  2AKW B;  3U4V A;  2R7Z H;  1SRO A;  1IBL Q;  4OX9 L;  1U0L A;  4MTN A;  1PH6 A;  1S40 A;  3PO2 G;  1YHQ A;  1HZB A;  1O7I A;  5IYB G;  3H3V H;  4BA1 I;  3HOU G;  3M85 A;  1KRS A;  3RR5 A;  3ULL A;  1WJJ A;  3UE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...