1PYBA

Crystal structure of aquifex aeolicus trbp111: a structure-specific trna binding protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
107
structure length
107
Chain Sequence
ALIGIEDFLKVDLRVAKVLSAERVEGSEKLLKLTLSLGDEERTVVAGIAKYYTPEELVGKKIVIVANLKPRKIFGIESQGMILAASDGENLSVIVPDRDVKEGAKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Trbp111: a Strcuture-Specific tRNA-Binding Protein
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Rna binding protein
molecule keywords tRNA-binding protein Trbp111
total genus 14
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1pybA00
2ATWA 3CXCA 4A3EH 4C2MH 1YBYA 1YNXA 4DV7Q 1XPUA 2E5LL 2MO1A 2NZOA 1SMXA 3M9BA 4A3LG 2XTIA 2RHSB 3NELA 3PF5A 1SROA 4RG1A 4HJ5A 1OXVA 4LF4Q 3PO2G 3K80C 1WYDA 1YITA 2JE6I 3S1NH 4DK6C 4DR7Q 3K81C 3S1MH 1HZAA 3J81c 1IZ6A 5GQOA 3T1YQ 2N3SA 3PGZA 4GS3A 2K5NA 2YTXA 5BR8L 3K7UC 1JE5A 1VQEA 3AQQA 3PCOB 4B3SQ 1YEZA 1CKOA 1X56A 2D0PA 4DR1Q 2YU9H 5IYDG 1CUKA 5AJ3L 1HR0W 3CPFA 3W1BA 2RF4A 2KCMA 5C3EG 1PH7A 1PH9A 2VL6A 3GO5A 4R4IA 3IRBA 3OW2A 3M3YH 1YJWA 2UXBL 5GAEC 1G291 2UXCQ 3HOYH 4UPAA 2CCZA 1WCMH 3KDFA 3BZKA 5IWAQ 4DV6Q 2K75A 3D31A 3PUYA 3L2PA 3PUVA 4IPDA 5H1SE 2R93H 4IJLA 3PO3G 4IOCA 4YWKA 4A3EG 1FJGL 5FLXc 4JG2A 1PH6A 2OTLA 1KD1C 4LW1A 3PO2H 2K52A 5JJIA 4HJ8A 2UXDL 4MTNA 4AH6A 5IT9c 1N36L 2K5VA 1Y1VG 3PO3H 2JQOA 1ASZA 1Y1VH 3S24A 1MJCA 3CCMA 1BKBA 4H02A 4B3ML 2JA6G 4R4QA 2VUMG 4DV2L 4JI7Q 4IOAA 4P75A 1VQLA 3HOYG 2HHHL 4BA2I 1K73C 4LF6Q 1K0RA 4L5TA 4DUYQ 1L2FA 1KAWA 1NJIC 3I56A 4LF7Q 3GTMH 1Y14B 3AYHB 3ULPA 1X65A 4GKKL 4P72A 2F4VL 3CCRA 3FHWA 4K0KQ 3RNUA 4DR3L 4HIKA 3S15H 1T9HA 2UUBL 3S14H 4B3RQ 2JA9A 4LF9Q 1KC8C 4P73A 2AHOB 2ZM6Q 1NMFA 5K36G 4P74A 2WP8J 2B63G 2C35B 5IP7G 2XGTA 4ME3A 4OWTB 3ULJA 2ZJQA 3S2HH 1A8VA 3CC2A 4NPSA 3TRZA 4AYBG 4BBRG 1OXXK 2I5MX 4UP7A 3ZJYC 1VQKA 1EQRA 4YCVA 1FJGQ 2CKZB 1K8AC 4JI0L 4X6AH 2QGQA 2ZTDA 3A5UA 3G48A 5FJ8G 3S16H 4IFDI 1N9WA 4C3HH 1NBWA 2L15A 1A62A 4JBWA 1VQMA 1BBWA 3CMEA 2JA8G 4JC0A 5FLMH 2JEAI 1NMGA 1X6OA 3GDEA 4HIOA 3J80i 2H5XA 1YHBA 4LFAQ 2AKWB 4C3IH 1I94Q 2LSSA 1JMCA 5JEAJ 4A3MG 2JA6H 4KHPQ 4A93G 4GN3B 1Y1WH 2Z6KA 2ALYB 4X66L 3GTJH 1Y1WG 4QY7A 1J5EL 3UE1A 1VQOA 4A3GH 2KCTA 2WAQG 3CD6A 1XMQQ 1EFWA 3G71A 2VUMH 2BA0A 2D0OA 2LXKA 1LUZA 2NN6I 1YIJA 4KLKA 3RLOA 3MXNB 1HZCA 1LTLA 3GD7A 1MJEA 4JI2Q 4MNOA 1VQJA 3PIPA 1TXYA 4IPCA 4LFBL 4YY3Q 1Q1BA 1L1OB 5GROA 3CCEA 4A3DG 1XNRL 4POFA 2JA7G 1RL2A 4JYAQ 2CQOA 2I5LX 3KOJA 5LMNW 5M5YH 4GNXA 1QZHA 1K9MC 4YCWA 4IFDJ 4A76A 3HKZG 3UDFA 1IYJB 3KLWA 4DR7L 2IY5B 5ELOA 1CSQA 2KENA 2ZJRA 1WCMG 1FL0A 2Q2HA 1CKNB 1KHIA 1N33Q 4GKJL 1BBUA 3RLFA 1D7QA 4RMFA 1XNQQ 5GAGC 4JI1Q 2OQ0A 2NZHA 1P8LA 2FXQA 3CCJA 4DR1L 4DUZQ 4OO1G 1EIYB 4GOPA 4GOPB 1GM5A 5C0XG 1JT8A 5IY0A 1FVIA 4X64L 3KDFB 1OXUA 3A5ZB 4J15A 3RZDH 3U4ZA 2R7FA 3MEFA 1PH3A 2WB1G 3T1YL 4BXXG 3HOVH 4K0KL 2YYZA 2VQEQ 3H15A 4JI8L 3F8TA 2JA5G 2UUAL 4R4OA 4ALPA 4EQ5A 2JK8A 3A0JA 3BU2A 3K7AH 4R4CA 5M3FG 2EXDA 4DUYL 2DGYA 2DUDA 1E3PA 4DKAC 2BH8A 4LUOA 4GLXA 1HNZL 4B3TQ 3HOZG 1IBLL 2D62A 4GNXB 2RCNA 3NEMA 4A3JG 3J7ZC 4GOPC 4B3MQ 2E2IH 3F2BA 2IX0A 1U5KA 4KHZA 3UDXA 1VQIA 1VQHA 2AWOA 1PYBA 4JBJA 3EBEA 2I0QA 2A19A 1A63A 2R93G 4HIDA 5C4XG 2HIVA 1IXRA 1YHAA 4JI6L 3GTOH 5JEAG 3HKSA 3U58A 1OTCA 1VQ9A 1J6QA 1C0AA 1V43A 1KRSA 2Q2UA 5HGQA 2VQFQ 1VQDA 3L0OA 3HOZH 2B3GA 3CCLA 3I2ZA 3KFUA 4A3BG 1N32L 1X3GA 2AWNA 3TS0A 4JI3Q 1H95A 1AH9A 3TS2A 1I94L 4KHPL 1N34L 1E1OA 3JAMi 4X65L 1E24A 2JA8H 3J81i 1XNQL 4JV5L 1X54A 5ELNA 1I5FA 2NVYH 3CP0A 3STBC 2WAQE 1W2BA 1N8RC 4NXNQ 4HIMA 2MO0A 2E2JH 2PI2A 3D0FA 1I3QH 4TVAB 1XPRA 1S40A 3I4NG 4YCUA 3KF6B 1HH2P 3KF6A 1NE3A 3A74A 5AJ3Q 4PG3A 4DR5Q 4JYAL 2N8NA 4NB3A 2HHHQ 1UE1A 2JA7H 2OCEA 5EAYA 4A3IG 1Q12A 1Q86C 1PH2A 4JI7L 2WB1E 5BR8Q 3U50C 4DUZL 4LWCA 2UXCL 2LXJA 1UWVA 4AYBE 3PUZA 4YHHQ 4QJFA 1N33L 3I4MG 5C44G 4GLAC 3UDIA 3JAMc 4DV4L 2PI2E 3I4OA 4LF4L 4L5RC 3PIOA 4OXPA 4POGA 4A4IA 2IT1A 4A3KH 2Q2IA 4R1JA 4LFCL 1VQBA 1XMOQ 2GVBA 4FDBA 4X66Q 1HR0Q 2UUCL 4LF7L 3GTPH 1XJVA 4JBKA 4A3BH 3LGJA 1CKNA 1KRTA 1GO3E 1HNWL 4OX9Q 3KJPA 1VQCA 5IWAL 2NVTH 4DPGA 3HFZB 3SGIA 3T1HQ 1PA6A 3RN2A 1VQPA 2Z6KC 4APVA 4BY1H 3ER0A 4GKJQ 4JOIA 1YVCA 1L0WA 4A3KG 5M3FH 4QGUA 1S72A 4PZ7A 4DR4L 3E9IA 4LUZA 5IYCH 1AE2A 2WFWA 1Q82C 4NXMQ 5DLQE 2PNHA 1TWCH 5IP7H 5GAHC 2VQEL 2IX1A 4IPHA 3CPWA 1IBML 4X62L 4JBMA 4BY7H 5LMNQ 1K8GA 4BBSG 4HJ7A 3DLLA 1LYLA 2AMCB 2Y0SE 3CF5A 4DR5L 1IBMQ 3E9HA 1BVSA 4KI0A 4DR3Q 1QVFA 2B63H 2BH2A 1EYGA 2R7DA 1PYSB 2ZTCA 3CCUA 1JB7A 2UUCQ 3WWVA 4LFCQ 4AQYL 1I6HH 2Z0SA 4JCVE 4A3CG 1XMQL 4DR2Q 1A0IA 1K3RA 4A3CH 3HOXG 2ZJPA 2IHEA 4AQYQ 1CKMA 2HIXA 1EIFA 3VDYA 5IYDH 3HOWG 1L1OA 4JV5Q 1UE5A 4YWMA 4AIMA 2YV5A 2QEXA 3CMAA 5IYBG 3CC7A 4LUVA 1E1TA 1E22A 2QA4A 4DV5Q 2NN6G 4A75A 1CSPA 4UP9A 4TQUS 4BBSH 4X62Q 4LFBQ 4OWXB 4OO1I 4A3LH 3PUXA 5GADC 4DV3Q 4PMWA 2YTVA 5C0XI 4DR6L 2F4VQ 3S2DH 1KL9A 1SN8A 1PH5A 3H0GH 3CAMA 3S1RH 3UDGA 2HQLA 5LMUL 1PHJA 3OYYA 5C4XH 2R6GA 1I50H 1J5EQ 2E5LQ 1L1OC 2PMZE 1NTGA 1QUQA 1VQGA 2K14A 3M85A 1G51A 4A3MH 4LNQA 3H0GG 1N34Q 2E2HH 3CCQA 2Y0SG 3W1GA 1PH4A 2JA5H 1YI2A 4A3GG 2CWPA 1Q46A 3TEHB 4R4TA 5C44H 4JI3L 4LF8Q 1DGSA 1O7IA 2B29A 4DV0Q 4Y52H 1YJNA 4A93H 5J3BA 3PSIA 3RZOH 1VQAA 3ICEA 4YWLA 4L5QA 4DR6Q 5C3EH 1ASYA 4UY8C 5FJ8H 4A3FG 5C0XJ 2RHQB 3ULLA 3M4QA 4WJ4A 4PZ8A 4MZ9A 1VS0A 3H3VH 1VQFA 1IBLQ 2F3IA 4GLVB 4UP8A 5M3MH 1QUQB 4A3FH 1W3SA 3BZCA 5M3MG 3F2DA 1UE7A 5IE8A 2VQFL 4L5SA 4XIGS 3F2CA 4DR4Q 1X9NA 5JJKA 1VQ5A 1UE6A 1JJGA 1QVCA 2MFIA 2R92H 4GN4B 2VW9A 5C4JH 4GNXC 4DV7L 1GVPA 1U0LA 4O2DA 3G6EA 2YTYA 2PQAA 4QIWE 3Q8DA 4OONA 1PVOA 2N78A 3PF4A 4DV5L 4DAMA 1SR3A 1TWFH 1WJJA 1Z9FA 4DV6L 2ES2A 1VQ6A 4YY3L 1IBKL 2K5HA 4JI5Q 1YJ9A 2KBNA 3HOUG 4C3JH 1EOVA 1Q7YC 1IL2A 3KF8B 3JC66 4EX5A 3TREA 5FLMG 3S1QH 1WOCA 4HJ9A 2GN5A 1VQ4A 2N49A 3M4OH 3F1ZA 3RN5A 3OTOQ 3FP9A 3NENA 2ID0A 2R92G 2VNUD 1WI5A 3EN2A 1X3FA 1XNRQ 2NVQH 2E8GA 1XPOA 1M1KC 3S17H 4IPGA 1AE3A 3HOVG 4JI0Q 1V1QA 4BXXH 3AEVA 3BJUA 4JOIC 1EQQA 4JI4Q 3FKIG 3HKZE 3ERSX 3L7ZC 4Y7NH 2UU9Q 3CCVA 1PH1A 1G6PA 3I4NH 1SLJA 4DR2L 3H3VI 1SRUA 4IJHA 4DV4Q 1GKHA 3RR5A 4GN5A 1R9TH 3TQYA 4JI5L 3T1HL 2EQSA 4LFAL 4LF9L 3CQZH 4OX9L 4DAYB 5HY6A 1RIPA 2MQHA 2KHIA 3J81j 1E7ZA 1PFSA 2PQAB 1MIUA 1B7YB 1HZBA 1XMOL 1HR0L 4NXML 1VCIA 2A1AA 2OQKA 4HJAA 2V1CC 2ASBA 4A3DH 4GKKQ 4NXNL 4BY7G 2ZTEA 2HT1A 2UU9L 4DV0L 2BA1A 4LF6L 4YHHL 3PUWA 3CW2C 4LF8L 2IHFA 1Q8KA 4LF5L 2ZM6L 5IYCG 3AFPA 3K8AA 3EIVA 5JJLA 2UUBQ 4QQBX 1HNZQ 1VQ8A 4B3TL 1HNXL 3HOUH 5IP9G 3GTKH 1QZGA 1N36Q 2K4KA 4JI2L 3GTGH 5LMUQ 3K0XA 1LM0A 4DK3C 1XTDA 1B8AA 1EUJA 3J7A5 4WJ3M 1YZ6A 2UUAQ 3U4VA 1VQNA 3M7NA 2CWAA 2A8VA 1GD7A 4DNIA 1OXSC 3I4MH 2K50A 4BA1I 3KYHC 1YHQA 2NVXH 4X65Q 2F52A 4DV2Q 4DV1Q 1TWGH 5IYBH 4A3IH 1HZ9A 1OXTA 2I5HA 2EIFA 2KHJA 1K83H 3DM3A 4JI1L 5M5XH 2OWOA 4LF5Q 3GTLH 3HOWH 4B3RL 1TWAH 4QL5A 4PZ6A 1Q1EA 3E0EA 1SFOH 1KIXA 1FGUA 5LMNL 1Q81C 1D8LA 3HOXH 1C7YA 4IO9A 4BBRH 1QVGA 4IFDG 1HJPA 2VY3A 1MKHA 3FKIH 1V9PA 3G4SA 3J80c 2R7ZG 3CC4A 3B6YA 2R7ZH 1HNXQ 1KXLA 1P16A 2JEBI 4O0AA 1UEBA 1X55A 2VS1A 4P71A 5M5WH 3STBD 2JJQA 1JJCB 1Z47A 3M4PA 3KJOA 4DV1L 1PV4A 2CFMA 1JJ2A 3RLNA 2MNAA 3OTOL 3AFQA 3NBHB 4XTCS 1N32Q 2OTJA 2UXBQ 1NY4A 2VZAA 3CCSA 2UXDQ 1VQ7A 1C9OA 3I55A 4JI8Q 3W5OA 4JI6Q 5E7NA 4JI4L 4BY1G 4OWWB 1SE8A 4DV3L 5IP9H 1EWIA 3PV0A 1WFQA 1KQSA 1S3OA 1B70B 1IBKQ 4X64Q 4B3SL 3UE0A 1TWHH 3GTQH 1PH8A 1X3EA 2GVAA 4A3JH 1HNWQ 3I7FA 1M90C 2Q2TA
chains in the Genus database with same CATH superfamily
1SSOA 3CXCA 4C2MH 1XPUA 5KNCA 5JVG3 4K14A 4RG1A 4LF4Q 2QF7A 3K80C 3GTMB 5JPMC 3OSOA 1IZ6A 3T1YQ 2P5ZX 3PGZA 4TKOB 2K5NA 5FLXE 1JE5A 3PCOB 1PDQA 4DR1Q 4CKCA 4A3MB 4A3EB 2K7VA 3CPFA 4KKTA 1MSHA 3VYUA 3W1BA 2MP1A 2VL6A 3GO5A 4R4IA 3P7JA 4M1UB 2UXBL 3EQLC 4KK7A 4UPAA 3R3OA 2CCZA 1WCMH 4DNTB 3PUYA 3L2PA 4OELB 5KNDA 3PUVA 5H1SE 3J7AF 2CH4W 4G7OC 1KABA 2F0PA 1CQVA 1LLRD 2OTLA 4LW1A 1QCBD 3MAQA 5KIXA 4MTNA 1Y1VG 1BR9A 1PZID 1BKBA 4DF7A 2JA6G 1NR2A 4ZYSA 1XXGA 1VQLA 3UI2A 3TN2A 4F87A 1CI3M 1BOSA 4LF6Q 4K6LA 3GTMH 4P72A 3FHWA 4K0KQ 4HCSA 3I4MB 1T9HA 3S14H 1WTVA 2L5TA 1KC8C 1R4QB 1LT4D 1BCPB 2ZXPA 2B63G 1QE6A 3ULJA 4ME3A 2R93B 1A8VA 3S14B 1F2MA 4BBRG 1OXXK 2I5MX 1VQKA 1EQRA 3HOYB 2CKZB 4X6AH 1A62A 1BBWA 1EZ8A 1GUSA 5FLMH 4HIOA 1YHBA 2E76C 1SNMA 4X3UA 4GN3B 2R7ZB 1Y1WG 4MN3A 4A3GH 2KCTA 4FVMA 1EFWA 3G71A 2D0OA 1YIJA 1EFID 3RLOA 2IWHA 4N9TA 1VQJA 3PIPA 4HMIA 1SNPA 4K8IA 3NHHA 5LMNW 1SXTA 4IFDJ 4YCWA 1WCMB 4R9WA 3KLWA 4DR7L 1CSQA 5C5LA 1EU3A 1B3AA 1WCMG 4RAUC 2L9HA 4NMZA 5IODA 4M8AA 3G6JB 3RLFA 3X3NA 4RMFA 1XNQQ 3CCJA 1WD1A 5C0XG 3J7AV 4X64L 2RBMA 1PTOH 3E6ZX 1E2WA 1JR0D 1C8CA 4ALPA 4ZLTF 4R4CA 3QJYA 1PTOB 2E2DC 1ENAA 1SE3A 4C1NK 2RCNA 4A3JG 2H1EA 4J1MA 2E2IH 4B3MQ 1YNJC 4EQOA 5C4XB 1VQHA 4JBJA 3OWFA 2A19A 3QR8A 5C4XG 3U58A 1C0AA 2VQFQ 3FVQA 1N32L 4I7ZC 4CDEC 1EY0A 4KHPL 1YNNC 4X65L 3J81L 1EIGA 1F9PA 5ELNA 2NVYH 3ERQA 1W2BA 1N8RC 1IW7D 2MO0A 4TVAB 1S40A 1NE3A 2F0UA 1LT6D 1AN8A 2NVYB 2N8NA 1IYUA 3GTOH 3S1MB 4ZKBB 4GLAC 4CJ1B 1PRTB 4DV4L 3CU7A 2PI2E 1Z7TA 4L5RC 4OXPA 2IT1A 4R1JA 1HR0Q 3RZOH 4LF7L 2GVBA 4FDBA 4KMUC 3GTPH 1KRTA 4A3FB 1HNWL 4C3IG 3KJPA 2NVTH 2B2YC 1TY2A 1PA6A 2Z6KC 2O5JC 1L0WA 3SXHA 5CMDA 2C5CA 3VA5A 5C4ZA 5IYCH 4LUZA 1AE2A 2WFWA 1UNSA 2J7ZA 4NXMQ 2PNHA 3PMFA 4RKLA 1K8GA 5IGDA 2EXZA 4DR5L 1BVSA 2EYOA 2ZTCA 3CCUA 1JWSD 1QOHA 5A2QE 1TR5A 4NKLA 4A3CG 4KY6A 4DK1A 1K3RA 3HOXG 2IHEA 4IZ8A 1I4HA 3VDYA 1A6XA 5IYBG 4LUVA 3VR3A 2F0SA 1G2SA 4A3LH 1D5MC 5TSSA 4XDXA 2F4VQ 5C4HA 1KL9A 1PH5A 2DN8A 2RQXA 3UDGA 2HQLA 3OYYA 1TY0A 1F2YA 1I50H 2B2VC 2PMZE 1QUQA 4LNQA 4A3MH 3H0GG 2E2HH 1YI2A 3TEHB 5LHY1 3SK4A 4LF8Q 4JI3L 5ELEA 1O7IA 3K6OA 4DV0Q 2Z4HA 4Y52H 4A93H 2EY5A 1LTAD 5CV6A 1STGA 1GJXA 2PO4A 2X6GA 1LTTD 2RHQB 3ULLA 3M4QA 3TP5A 4WJ4A 5C0XH 1CK1A 1VS0A 4MZ9A 3SK8A 3H3VH 5E1FA 4GLVB 4RWSC 4XT3B 1UE7A 2Z9HA 4NDXA 4L5SA 4XIGS 3K58A 4DR4Q 5JJKA 3T16A 2DJGC 4GN4B 2VW9A 4GNXC 2PCFB 2YTYA 2PQAA 1SNQA 1PFBA 5D14A 2ES2A 2K5WA 1VQ6A 4YY3L 1IBKL 4JI5Q 3K0YA 2RDFA 2XNAC 1U4LA 4FXGC 1A2TA 3JC66 5DEHA 2D5DA 2DY7A 3TREA 4G7HC 3C3LA 1Y8OB 2B2WA 1EQVA 2JP1A 2EJMA 3W2DA 1XNRQ 1LTGD 2R3ZA 5CV5A 2ZXOA 1J8IA 1EY7A 4IPGA 2F0NA 3QO2A 3HP3A 4CDDC 4JI0Q 1V1QA 3DWPA 5DAUA 4JOIC 5A35A 1EQQA 2CHBD 3GP7A 1B44D 3Q22A 2RKSA 3L9AX 1GKHA 1JE4A 4FP5D 2EQSA 3RZOB 4LF9L 3BZDB 3BVZA 3TDQA 1S4ZA 3HS0C 2PQAB 1GXDC 5LL6S 1CA6A 1B7YB 1HZBA 2J4XA 1VCIA 3MXUA 4DXGA 5ELBA 2FINB 4HJAA 4GKKQ 5IGGA 2PZUA 1V8QA 4RCOA 4DV0L 2UU9L 2HT1A 4ODGA 4R8NA 5I2YA 1FNWA 4PNYA 4LF5L 1SYBA 3AFPA 5JJLA 4J6HA 2BDNA 4L6TB 1HNZQ 1VQ8A 4B3TL 4JI2L 2A6HD 4WJ3M 2UUAQ 5BN3A 1VQNA 2HDMA 4Y7NB 3V05A 1OXSC 1LTRD 2L11A 3Q0AA 1STBA 4A3IH 5EBDA 2BOSA 4LF5Q 1X32A 1SYGA 1C7YA 4IO9A 4BBRH 2DY8A 3FKIH 5FKAC 3BYYB 2SOBA 2XIWA 4C3JB 1PFMA 1KXLA 2MPMA 1P16A 1UEBA 2Q8TA 1X55A 2VS1A 4WORA 2I07B 3SDZA 1UAPA 1CA5A 1JJ2A 1T5EA 3AFQA 3NBHB 2B2TA 1B50A 3CCSA 1D5XC 5I6WA 1F9RA 3HG9A 3VYSA 2GA4B 4BY1G 1SE8A 1R9TB 3DMUA 1B70B 3UE0A 3HOUB 2O2LD 2G5DA 4ZAIA 3NELA 1HNWQ 1F2ZA 1M90C 2ATWA 2E5LL 2A5HA 2MO1A 2NZOA 1SMXA 1K0SA 2QDBA 4HTHA 3QG1A 3PF5A 2XVSA 1SROA 3VA7A 1OXVA 2H4OA 1YITA 1WYDA 1B53A 4C3HG 3S1MH 1DXMA 3J81c 1ZXTA 3ITPA 2X69A 5GQOA 2YTXA 1K28A 3LWUA 5T1GA 3MXGA 1FNVA 1BXTA 4RGNA 3R2TA 2B2VA 3C46A 1QNKA 2MHVA 2RF4A 5C3EG 2RCFA 3OW2A 1B3QA 5CYUA 3M3YH 4H0LC 1ML0D 2UXCQ 2NUCA 4O1NA 3T13A 5IWAQ 1Q90A 4FO2A 5KYLA 1WTOA 5L37A 2Z6BA 3D31A 2IX3A 3PO3G 4IOCA 1NAPA 3OOCA 4YWKA 1FJGL 5FLXc 3T51B 3NQIA 5JJIA 2UXDL 1ICFB 2K5VA 1ASZA 1WVLA 1PZKD 3S24A 1MJCA 4KD3A 4XQQA 4DNRB 4H02A 3CCMA 4B3ML 1PFNA 4IOAA 4KHVA 5CBAE 5FK9C 1S5FD 2A69D 1L2FA 1TWFB 3I56A 3A7LA 1EWCA 1L0XB 3ULPA 4GKKL 4EQNA 2RDGA 5IOCA 2F4VL 4LJZC 4DR3L 1XWEA 3NTIA 4ABNA 4IURA 4WFN3 1HA6A 4LF9Q 1KTKA 5DM63 1I4GA 2ZM6Q 1NMFA 5DNFA 5K36G 1X3QA 2WP8J 5IP7G 3MHBA 2XGTA 2ZJQA 1BCPF 3CC2A 3TRZA 3J80E 4DFAA 5KYIA 5BN5A 4YCVA 1FJGQ 3NPPA 4JI0L 3FPUB 1DOKA 1SAPA 1TT2A 4KV6A 4C3HH 2JA8G 2A69C 4IUUA 3CRLC 4JC0A 1NMGA 4A93B 3J80i 4C3IH 3NBHA 2AKWB 1JMCA 5JEAJ 2HUGA 3I90A 4A93G 1Y1WH 2Z6KA 1J5EL 4QY7A 3Q23A 3UE1A 2FMCA 1EY4A 3H09A 1XMQQ 2VUMH 2LXKA 1ICWA 3I4LA 4AYBB 4KLKA 1STHA 3MXNB 1HZCA 2F0EA 1MJEA 4JI2Q 5FLXL 3DHQA 3S16B 1ET9A 1Q1BA 4A3DG 3CCEA 3SHLA 4POFA 1XNRL 1RF2D 1FGBD 1I4QA 1RL2A 1WTXA 1K9MC 2I5LX 4GNXA 1QZHA 5M5YH 1EYDA 2JSOA 1F9SA 2EY6A 4LK1C 2M00A 4WJWA 2IY5B 1H9SA 2WAQB 1ENCA 3EFXD 2Z1CA 3GTKB 1KHIA 1HFGA 3DWQA 5GAGC 4JI1Q 2OQ0A 4OO1G 3I73A 2N88A 4DGZA 1BDOA 2F0WA 2ENBA 4GOPB 5IY0A 4ID6A 4Q5VA 3KDFB 4J15A 2F0QA 1PXUA 3RZDH 1PH3A 4KD4A 4K0KL 2EY1A 2YYZA 2VQEQ 3H15A 2JA5G 2B2UA 1TWCB 3A0JA 3ND8A 5M3FG 2JA5B 5IT9E 1EEFD 2DUDA 1E3PA 1SDFA 2BH8A 4GLXA 3RZDB 3VYRA 2PPBC 3F2BA 3DUZA 4KHZA 1PRTD 2AWOA 4JI6L 5JEAG 2PW7A 2NWGA 1V43A 5JVH3 2Q2UA 1LTID 3HOZH 2B3GA 3CCLA 1X3GA 2AWNA 1RDPD 1AH9A 1H9SB 3TS2A 3U9OA 3JAML 1ILQA 3JAMi 1ZYRD 1DJRD 3M3YB 4YIJA 1JOOA 3H3VC 3K5OA 4RGOS 1PYWD 2WAQE 2B63B 3D0FA 2VUMB 2KEDA 2F03A 5HGTA 3A7AB 1BQQT 1HTPA 1KLUD 5AJ3Q 4H44C 4PG3A 1RJTA 3C1EA 2KCNA 2OXPA 1JC7A 4NB3A 4C3IB 2HHHQ 4B9WA 2JA7H 5EAYA 1Q86C 1Q12A 3HZXA 4JI7L 4LWCA 3W3AA 2B2YA 4ZKCB 1DCZA 4QJFA 1LV9A 3TP7A 1H9MA 1B2TA 4LF4L 4POGA 1LTBD 2XSCA 5EGTA 4A3KH 2Q2IA 3WOFA 3VR4A 4DU9A 2BE5D 3LGJA 5KEEA 3Q6SA 4BS9A 1RTOA 4JK1C 2A6ED 1VQCA 2LKVA 2A68D 1U4MA 3RN2A 3C1FA 5EPLA 4A3KB 4APVA 3ZYYX 2QW7A 2QCPX 1YVCA 4QMGA 2PQEA 4A3KG 3VR6A 3A54A 5M3FH 3MEHA 1CFMA 2MJ8A 3E9IA 4PZ7A 4X3SA 1Q82C 5DLQE 1TWCH 5GAHC 3CHBD 4IPHA 1O7LA 1IBML 5LMNQ 3D4WA 4F88A 2EYHA 3HKZB 1QVFA 4DR3Q 2M2LA 1TS5A 2B63H 2B2TC 5CV4A 1NCVA 4WRDA 2HDLA 1TWHB 1A0IA 3HOWB 1V1PA 3N52A 2ZJPA 4B9XA 1CKMA 2HIXA 2L12A 1ZEQX 2K03A 3KLSX 4CGYB 5IYDH 3HOWG 1L1OA 2F1MA 5C4JB 2R92B 1W6KA 4NP5A 5JEAH 2SEBD 2NN6G 1HQMC 1CSPA 2LY7A 4UP9A 4LFBQ 4X62Q 4OWXB 3MFYA 4DV3Q 3HEJA 2F0TA 1SNDA 4H13C 3H0GH 3OMCA 2EYPA 5I9PA 1PHJA 2YU9B 3M85A 2M9VA 4U68A 3M7GA 5IGEA 2K5DA 1PH4A 2JA5H 1Q46A 3AB9A 2EJGC 5EBCA 1RD9D 3PSIA 3ICEA 1E2VA 5IIFA 1ASYA 2L4NA 3BVGA 5C0XJ 1Z6HA 1JQYD 1LT5D 3IL8A 3S1RB 1BO0A 3GV3A 3I4NB 4A3FH 2QKIC 1OO9B 4UAIA 5M3MG 3OIQA 5CBEE 2VQFL 1SEBD 2F0KA 2KHSA 1JJGA 5C4JH 4DAPA 3G6EA 4QF4A 2E75C 4BWGB 1PVOA 2N78A 4DAMA 3DXJC 3RMHA 1EYCA 1O7ZA 1HUMA 4RGTA 1R4PB 4K8JA 3HOUG 4MTKA 3JAME 1EOVA 1ZKOA 1VQ4A 3M4OH 1CHPD 3OTOQ 1S5ED 3NENA 4U673 2ID0A 1NR4A 4FF1A 1BBXC 2E8GA 5JJZA 2F0VA 1PTOC 1AE3A 1V1OA 3AEVA 1JB3A 3BJUA 3HKZE 2KEEA 4Y7NH 1PH1A 3KUPA 1SLJA 5EQ0A 1SRUA 4FXDA 4GN5A 4QCLA 4CHTB 4DAYB 4A3GB 2QILA 2MQHA 1PFSA 1VMCA 1MIUA 1FYCA 4KTAA 1HR0L 4NXML 4BY7B 2OQKA 2ASBA 3K7AB 4A3DH 2AUKA 2SNSA 1DYQA 4BY7G 2RDHA 2ZTEA 1AW7A 4LF6L 2IHFA 1MI2A 2ZM6L 1VDZA 5KNBA 5IYCG 3K8AA 2QEJC 3WDNA 1RTNA 4QQBX 3H94A 5IP9G 1A15A 2K4KA 3GTGH 5NUCA 3K0XA 5LMUQ 1LM0A 1QJOA 1XTDA 4LMQD 1IL8A 3M7NA 2FJ2A 5I9OA 2A8VA 4C3JG 4QB4A 3I4MH 2K50A 1QWYA 3QOJA 3E3XA 4X65Q 3BS1A 4DV1Q 5JPNC 4JI1L 2I5HA 4B3RL 1TWAH 4QL5A 1KIXA 1A3VA 3FMCA 1Q81C 3NTKA 3HRZC 3HOXH 4QIWB 2V4DA 1K3BC 2NB0A 1HFNA 4EGVA 2R7ZG 1Y1WB 4KN4C 3CC4A 1HNXQ 4O0AA 5I6YA 1WTRA 4PQXA 5JAVA 3I91A 3KJOA 2JA6B 4XQJA 4KY7A 3IAYA 3D6WA 3RLNA 4XYOA 1VF5C 5M5XB 1MBYA 4DXFA 1N32Q 2UXBQ 3K59A 1VQ7A 1D5ZC 3W5OA 1D1IA 4JI6Q 4DV3L 3PV0A 1WFQA 1SYFA 1KQSA 2KJXA 1IBKQ 1C4QA 4A3JH 5LMNL 4A3EH 1YBYA 2E2IB 5COYA 5C3EB 1Q8IA 2XTIA 2RHSB 3PO2G 4HJ5A 4EQPA 2JE6I 4DK6C 3SEBA 5BR8L 3RUZA 1F77A 3AQQA 2PZWA 4B3SQ 1DD2A 1YEZA 3IKJA 5IYDG 1HR0W 2WKCA 1S5CD 3D8GA 3P75A 5J1ZA 3GTJB 1PH7A 3IRBA 1YJWA 5GAEC 1S5BD 2RA4A 1HXYD 3KDFA 3BZKA 4DV6Q 2K75A 3R93A 4K6DA 1PTOD 2B39A 4IPDA 2KOLA 5J22A 1B1ZA 4KKSA 2EYMA 2A6HC 1KD1C 2K52A 4OGQC 5IT9c 5CGKA 1GHKA 1Y1VH 5FO8B 3S15B 1B9NA 3J7YW 4R4QA 1SYDA 2ZT9C 3QIAA 2HHHL 1CQFA 1U4PA 4DUYQ 4L5TA 2FFKB 3FDTA 3GV6A 3NXWA 4TRDA 3RNUA 4HIKA 3MWYW 2O5IC 3PO3B 1MSGA 4S3SA 5D3IB 1BUVT 1XX8A 4P73A 2AHOB 2EYFA 4X3TA 2VB3X 3DEPA 4P74A 2C35B 4OWTB 1AFPA 3BDOA 2L55A 1LACA 4NPSA 3I8ZA 4AYBG 4UP7A 1QNUA 2JYOA 1K8AC 2QGQA 2ZTDA 3S16H 4IFDI 1N9WA 5CR3A 1NBWA 1W6JA 3CMEA 2JEAI 4J8QA 2LFNA 2NZ1D 4LFAQ 2JA6H 4KHPQ 2LSSA 4A3MG 5G3LF 1SMYD 3PIO3 1SMYC 1VQOA 2WAQG 3CD6A 2BA0A 3A8IE 2G9HD 4OIKA 5JOBA 1LTLA 3GD7A 3QOLA 1A3TA 1CT1D 1ZYRC 3GTLB 4C3HB 4IPCA 4LFBL 4YY3Q 1K83B 1L1OB 4HSVA 2JA7G 2D9UA 4JYAQ 2CQOA 3KOJA 3R2IA 1D2BA 1S5DD 4A76A 3HKZG 1G6ZA 4I7AA 4FYDA 2NN6H 4LAAA 5ELOA 2A6EC 1FL0A 2Q2HA 4QUCA 1CKNB 1N33Q 4GKJL 1E0BA 2CW0D 2NZHA 1P8LA 1GHJA 2IJ0A 2K28A 2BDOA 2CVRA 4OHJA 1EIYB 2AQ1B 3MVVA 3NUCA 1ET6A 3A5ZB 1TS3A 4BXXG 2R7FA 3T1YL 3HOVH 5E4XA 3EVQA 5K5PA 3F8TA 4JW0A 2UUAL 2ICIA 4R4OA 2JK8A 3BU2A 3K7AH 3MC0B 4A3DB 2F0IA 2K04A 4DUYL 1L0YB 2HQEA 1A3UA 3HOZG 2D62A 4GOPC 3T56B 2K33A 2O4XA 3NWTA 5EPKA 3TP8A 3U9SA 1U5KA 4NW2A 1EYAA 4Q0FA 1PYBA 3EBEA 3NP8A 2R93G 4HIDA 1IXRA 4N8FA 5ELDA 1VQ9A 1OTCA 3KBXA 2BCOA 1J6QA 3SE0A 4A3BB 1KRSA 5HGQA 1VQDA 3DEOA 3L0OA 3VYTA 4FF4A 3KFUA 4A3BG 2RVLA 4JI3Q 3FEWX 1TQOA 2F3WA 1E24A 2JA8H 3E0JA 3J81i 1XNQL 1X54A 2Q8RE 4ZRZA 1I5FA 4RH6A 1KAAA 3M4OB 1TIID 2E2JH 2PI2A 3I4NG 1XPRA 2F0DA 4YCUA 3KF6B 1HH2P 1A2UA 3A74A 4DR5Q 1I4XA 3BYTB 1UE1A 2ICEC 2HCIA 2OCEA 1PH2A 2WB1E 5BR8Q 4DUZL 1DONA 2JA8B 3H91A 3P1HA 2UXCL 2LXJA 1UWVA 1TU2B 2NTSA 3I4MG 5C44G 4BBSB 3JAMc 3I4OA 2EVBA 4IN3A 4A4IA 2DNCA 1XJVA 2B2WC 4JBKA 4V190 1HA5A 5IGFA 3GTQB 3NBIA 1TKWB 1ONLA 1U4RA 2EDGA 1JWUD 3HFZB 3SGIA 1UEAB 1B9MA 5ISRA 3A8KE 4ZUIA 4ME5A 4IUNA 3ER0A 1LO5D 4X3KA 3A8JE 3TSSA 4QGUA 4DR4L 3T4AC 1EU4A 5IP7H 1F9QA 1SJHD 3CPWA 4JBMA 4BY7H 5E4WC 2CQAA 1QG7A 1Y8NB 1B4OA 3T53B 1JICA 2Y0SE 3CF5A 2BH2A 4KI0A 1AZPA 2E2JB 1PYSB 4AQYL 2Z0SA 3EROA 4JCVE 4HAEA 4A3CH 2IPKD 3GQBA 4OO1H 2IL8A 4AQYQ 4JV5Q 2QEXA 2YV5A 5M9OA 4DAVA 2EJFC 3CC7A 2QA4A 4A75A 4OO1I 4CDFC 3PUXA 4HSPA 2F0FA 4PMWA 1JCKB 3S2DH 3OHXC 4DA2A 1EL0A 5LMUL 1K8OA 5C4XH 2R6GA 4RA8A 2E5LQ 1VQGA 1AEXA 4G4KA 1PLFA 3CCQA 2Y0SG 3W1GA 4K5WA 5C44H 5EKKA 1DGSA 4IQZA 2B29A 4TSSA 2L1BA 1LT3D 4HCEA 5J3BA 1PTOF 4ZQ3A 2TSSA 2JN4A 1SYCA 5C3EH 4E6IA 4UY8C 5FJ8H 5D3DA 1DZ1A 5C5MA 4A3FG 1IYVA 1I50B 3I70A 3PIP3 1STAA 3GTGB 1IBLQ 3M4YA 4UP8A 5M3MH 3NTHA 1W3SA 3F2DA 3LNNA 1FR3A 1GUWA 3RD4A 2SDFA 1XTCD 1NSNS 1VQ5A 4JPBW 2Q8IB 4XXEA 3I3CA 1F2LA 2OF1A 4DV7L 1GVPA 3Q8DA 4OONA 2LS01 3PF4A 2FMMA 2PYKA 3GTOB 1SR3A 1TWFH 4JVZA 2K5HA 4OEMB 2HCCA 3J81E 3KLRA 1ILPA 1EEID 1HQRD 3DWAA 1Q7YC 2FHTA 1IL2A 3KF8B 3QWNA 4EX5A 3Q24A 5FLMG 3HOXB 4HJ9A 1IW7C 1Y69U 1DM0B 3F1ZA 3FP9A 3PO2B 1WI5A 3EN2A 1X3FA 4CBVA 1ENFA 2VB2X 1XPOA 3S17H 1Y8PB 3EA6A 3HOVG 4BXXH 4JI4Q 3FKIG 3L7ZC 3ERSX 3G7LA 2UU9Q 1BNZA 3H3VI 2IW3A 1FD7D 4K2KA 5IGBA 4JI5L 3T1HL 1YNJD 2NTTA 3QB3A 4H7BA 4DAYA 3AU7A 2KHIA 4ZUJA 3IFTA 4CJ2C 3J81j 1EY8A 5HURA 1VMPA 1XMOL 2A1AA 3LX0A 1LTSD 2V1CC 2EZVA 2BA1A 3PUWA 3K5NA 1I4RA 4IUTA 4KY5A 4L8JA 2G9DA 1HNXL 1QZGA 1N36Q 2F0JA 1B8AA 1FNUA 4XT1B 3U4VA 1GOZA 1GD7A 3MZ5A 2NVXH 3KYHC 4I65A 3H6MA 4K2LA 1J9OA 4DV2Q 2WIIB 1TWGH 1GUNA 2XRSD 2I46A 1OXTA 3J7A5 3GTLH 2K6AA 3HOWH 4RGMA 3V2TA 4PZ6A 1RKNA 1FGUA 1SNCA 2F0LA 3OPOA 1QVGA 3CKIB 4FNFA 4IFDG 1JOKA 2VY3A 3J80c 4ULLA 3B6YA 3BG3A 1HPCA 1SFOB 4RFBA 1PV4A 1Z47A 3M4PA 4DV1L 4FXKC 2CFMA 3KBGA 4XTCS 1EY5A 2OTJA 1SYEA 1SJED 3SR1A 5AFWA 1C9OA 1O80A 2A68C 4KJOA 4C2MB 3S9WA 5E7NA 4JI4L 5DM73 4OWWB 2WKDA 5IP9H 1EWIA 1M8AA 4HR7B 4G7ZC 4X64Q 1TWHH 1X3EA 2GVAA 3I7FA 2J0TD 2Q2TA 2MGSA 1H9JA 3EJIA 1YNXA 4DV7Q 1KNAA 4UDUC 2VXWA 4A3LG 3M9BA 2K1BA 3S1NH 4DR7Q 1KLGD 3K81C 1HZAA 2Z8LA 2N3SA 4GS3A 2PW5A 3K7UC 1NNXA 3F2UA 4ZK9B 3K5LA 3S1QB 1VQEA 4K5XA 2B8FA 1CKOA 1MHWC 1X56A 2D0PA 2YU9H 5AJ3L 1CUKA 5K36H 2KCMA 1EIHA 1PH9A 3R8BA 2A73B 1G291 3LWEA 4CDCC 3HOYH 4RCNA 2KA7A 5FO7B 2KUMA 1GUTA 5CV9A 1CTMA 2R93H 2NVQB 4IJLA 2TMPA 2WACA 4A3EG 2WV6D 4JG2A 1PH6A 3PO2H 4HJ8A 5CC4A 3DM1A 4AH6A 3ONAB 1N36L 3PO3H 2JQOA 5EKIA 1LABA 1JWMD 3P20A 3X3MA 3MXNA 2VUMG 4DV2L 4JI7Q 4CJ0B 2F0HA 4P75A 3HOYG 4B08A 5BN4A 4BA2I 1NUCA 3IFDA 1K73C 1K0RA 1V1PB 1KNEA 5J39A 2N55A 1KAWA 1NJIC 1EOTA 4LF7Q 4MHEA 3S1NB 1Y14B 3AYHB 1X65A 3CCRA 4XYQA 2EPBA 5M3FB 4BY1B 3CQZB 4KN7C 1Y1VB 1TS4A 2JXMB 3CRKC 3S15H 1EY9A 2UUBL 4B3RQ 2JA9A 1T5XD 1AZQA 2K32A 5ELCA 2BE5C 1HCZA 1SBBB 3S2HH 4FF3A 3ZJYC 3MTSA 3A5UA 3G48A 5FJ8G 2KQ3A 2L15A 1VQMA 4JBWA 1X6OA 3GDEA 3ND9A 2H5XA 1I94Q 2ALYB 4X66L 3GTJH 1ESFA 1I3QB 1LUZA 1G91A 2NN6I 4BBRB 3E5SA 4FF2A 4MNOA 1GUGA 1TXYA 1KDAA 4CKBA 5GROA 1BF4A 1STEA 4PMBA 1CM9A 2AUJD 1GUOA 3UDFA 1IYJB 4IFDH 2OEOA 3NQTA 2KENA 1JORA 2ZJRA 4N9PA 2AQ2B 4F7XA 1BBUA 1D7QA 1HTLD 4K5VA 1M4VA 3NSWA 4N8X1 2FXQA 4DR1L 4DUZQ 4GOPA 4HMJA 1GM5A 1JT8A 1FVIA 5KRUA 1H9KA 1OXUA 1I6VC 3U4ZA 3MEFA 2WB1G 3N6RA 1BCPD 4JI8L 1O7YA 2WB1B 1K8MA 4EQ5A 4Z9CB 2JA7B 2EXDA 2DGYA 4DKAC 4LUOA 1HNZL 2E74C 4B3TQ 2X6LA 2K5QA 4RHRA 2B8GA 1CZWA 1SE2A 4GNXB 1IBLL 3NEMA 4C1NI 3J7ZC 1H9RA 2XWBB 2IX0A 3UDXA 3SK6A 5C3XA 1VQIA 1CZGA 2I0QA 1A63A 1IKMA 3SK5A 2HIVA 3VR5A 1EWHA 1YHAA 3HKSA 2XRQD 5T1IA 1X3PA 5IGCA 1EQTA 3I2ZA 2PZTA 1H95A 3TS0A 3TZUA 3TMEA 1I94L 1RODA 1N34L 1E1OA 2XWJB 2RSOA 4JV5L 3CP0A 3STBC 2WINB 5KGUA 1PRTC 4NXNQ 4HIMA 1I3QH 1I4PA 3KF6A 1HRJA 4JYAL 1U9RA 3BDLA 1HHVA 4A3IG 5CV7A 3U50C 5D65A 3HGBA 4A3IB 1G8ZD 3PUZA 4AYBE 1TWGB 4YHHQ 1N33L 3UDIA 2NVXB 2RSNA 3PIOA 5ELFA 2C9OA 4LFCL 1XMOQ 1VQBA 2UUCL 4X66Q 3TZDA 2F0MA 4A3BH 1CKNA 1GO3E 5G3LD 4F8MA 1O78A 1WTWA 4OX9Q 1D1KA 5IWAL 1PRTF 4DPGA 3T1HQ 2LMCB 1VQPA 3KF8A 4BY1H 4GKJQ 4JOIA 1EY6A 1Q3LA 1C48A 3TBIB 1S72A 3K5MA 2XN9C 4XQNA 2VQEL 5M5WB 2IX1A 2SNMA 1VF7A 5FOBB 5C44B 1SNOA 4X62L 4BBSG 4R8IA 4HJ7A 3NE5B 1II3A 3DLLA 3MXPA 1LYLA 2AMCB 1IBMQ 1WTHA 1MD2D 3E9HA 1KDBA 1EYGA 2R7DA 1JB7A 2UUCQ 3WWVA 3K57A 4LFCQ 3H0GB 1TWAB 2K05A 4DK0A 1XMQL 4DR2Q 2ZXRA 4MIUA 4CKEA 1G2TA 1EIFA 3D6CA 2QDLA 1YNND 1MGSA 1UE5A 4YWMA 3NK9A 4AIMA 2KCCA 2PMZB 3CMAA 4IALA 2Y0SB 1E1TA 1E22A 3KLSA 3HOZB 4DV5Q 3C2PA 3I72A 1I6HH 4BBSH 4TQUS 3S17B 4KJNA 3A55A 5GADC 3S2HB 3D4RA 2YTVA 1QILA 5C0XI 4DR6L 1SN8A 3CAMA 3S1RH 5F2DA 3TP6A 3AMUA 4RHSA 4KKUA 1J5EQ 1L1OC 1NTGA 2K14A 4RKBA 1G51A 1N34Q 1AP0A 3O13A 5LL6X 3SVMA 2CWPA 4A3GG 4R4TA 2NYZD 2R61A 4PV1C 1TS2A 1YJNA 3PQIA 3OMGA 3OW7A 1VQAA 4YWLA 1HUNA 5CV8A 4L5QA 5C3WA 4DR6Q 5E3FA 3VR2A 5I2XA 1JOQA 5C6AA 4PZ8A 1RHPA 3FPPA 2NVTB 3BVMA 1VQFA 2PNRC 2F3IA 5CORA 1QUQB 2KECA 3BZCA 4C56C 5I4DA 5IE8A 1IKLA 3F2CA 1STYA 1X9NA 1UE6A 5M5YB 1QVCA 4EVOA 2OT2A 2MFIA 4L63B 2R92H 2EOTA 1U0LA 4O2DA 4IUVA 4ZCKA 4QIWE 2Z4IA 5EPJA 4DV5L 3D4DA 1WJJA 1Z9FA 4DV6L 5EJWA 1BCPC 2MUYA 1YJ9A 2F4IA 2KBNA 3FKIB 2E2HB 5A2QL 1DOMA 4C3JH 3WOEA 2DNEA 3NWSA 3S1QH 1WOCA 2EE1A 2GN5A 3D3RA 2N49A 1EZ6A 3RN5A 3MFGA 1PZJD 1KDCA 2R92G 2VNUD 3FRPB 2NVQH 1M1KC 1TVXA 5EKLA 2EY2A 4V0BA 4QUFA 4ILWA 1UUPA 2K01A 3CCVA 4P2CB 1G6PA 1WTQA 3I4NH 1RCVD 4DR2L 4DN4M 4IJHA 4DV4Q 3RR5A 3BDCA 1R9TH 4PMCA 3TQYA 3V96A 4LFAL 3CQZH 4OX9L 5HY6A 1RIPA 1E7ZA 2KVMA 1WTPA 4OIJA 1IHZA 2HD3A 4G57A 2DJFC 4NXNL 1QB5D 2F0GA 4YHHL 3HOVB 3CW2C 1ESRA 4LF8L 1CHQD 1Q8KA 3A56A 4IUPA 5IT9L 3EIVA 2UUBQ 3HOUH 5M3MB 3GTKH 4A3JB 1D6EC 2EYJA 3S2DB 4DK3C 1XYIA 4GZYC 1EUJA 5FO9B 1YZ6A 1I6HB 4HEDA 3GTPB 2CWAA 2F3VA 3KK7A 1DOLA 4DNIA 4BA1I 1YHQA 1E2ZA 2F52A 1STNA 5IYBH 1HZ9A 2OWOA 2EIFA 2KHJA 1K83H 2L0CA 3DM3A 5M5XH 1SFOH 1Q1EA 3E0EA 1D8LA 3L3OC 4O42A 1HJPA 2D2CC 1MKHA 1V9PA 3MA2B 3G4SA 4IUQA 4HN7A 2R7ZH 1SE4A 4UHVA 1PMRA 2JEBI 4P71A 5M5WH 3STBD 2JJQA 1JJCB 2EYLA 2AQ3B 1WD0A 2MNAA 3OTOL 1NY4A 2VZAA 2UXDQ 3I55A 4JI8Q 2F0OA 2CW0C 3URYA 3OIPA 1S3OA 4B3SL 2CH4A 2A74C 3GTQH 2B2UC 1PH8A 4OL7A 2NBFA 3J80L 3OWEB
chains in the Genus database with same CATH topology
2ATWA 3CXCA 4A3EH 4C2MH 1YBYA 1YNXA 4DV7Q 1XPUA 2E5LL 2MO1A 2NZOA 1SMXA 3M9BA 4A3LG 2XTIA 2RHSB 3NELA 3PF5A 1SROA 4RG1A 4HJ5A 1OXVA 4LF4Q 3PO2G 3K80C 1WYDA 1YITA 2JE6I 3S1NH 4DK6C 4DR7Q 3K81C 3S1MH 1HZAA 3J81c 1IZ6A 5GQOA 3T1YQ 2N3SA 3PGZA 4GS3A 2K5NA 2YTXA 5BR8L 3K7UC 1JE5A 1VQEA 3AQQA 3PCOB 4B3SQ 1YEZA 1CKOA 1X56A 2D0PA 4DR1Q 2YU9H 5IYDG 1CUKA 5AJ3L 1HR0W 3CPFA 3W1BA 2RF4A 2KCMA 5C3EG 1PH7A 1PH9A 2VL6A 3GO5A 4R4IA 3IRBA 3OW2A 3M3YH 1YJWA 2UXBL 5GAEC 1G291 2UXCQ 3HOYH 4UPAA 2CCZA 1WCMH 3KDFA 3BZKA 5IWAQ 4DV6Q 2K75A 3D31A 3PUYA 3L2PA 3PUVA 4IPDA 5H1SE 2R93H 4IJLA 3PO3G 4IOCA 4YWKA 4A3EG 1FJGL 5FLXc 4JG2A 1PH6A 2OTLA 1KD1C 4LW1A 3PO2H 2K52A 5JJIA 4HJ8A 2UXDL 4MTNA 4AH6A 5IT9c 1N36L 2K5VA 1Y1VG 3PO3H 2JQOA 1ASZA 1Y1VH 3S24A 1MJCA 3CCMA 1BKBA 4H02A 4B3ML 2JA6G 4R4QA 2VUMG 4DV2L 4JI7Q 4IOAA 4P75A 1VQLA 3HOYG 2HHHL 4BA2I 1K73C 4LF6Q 1K0RA 4L5TA 4DUYQ 1L2FA 1KAWA 1NJIC 3I56A 4LF7Q 3GTMH 1Y14B 3AYHB 3ULPA 1X65A 4GKKL 4P72A 2F4VL 3CCRA 3FHWA 4K0KQ 3RNUA 4DR3L 4HIKA 3S15H 1T9HA 2UUBL 3S14H 4B3RQ 2JA9A 4LF9Q 1KC8C 4P73A 2AHOB 2ZM6Q 1NMFA 5K36G 4P74A 2WP8J 2B63G 2C35B 5IP7G 2XGTA 4ME3A 4OWTB 3ULJA 2ZJQA 3S2HH 1A8VA 3CC2A 4NPSA 3TRZA 4AYBG 4BBRG 1OXXK 2I5MX 4UP7A 3ZJYC 1VQKA 1EQRA 4YCVA 1FJGQ 2CKZB 1K8AC 4JI0L 4X6AH 2QGQA 2ZTDA 3A5UA 3G48A 5FJ8G 3S16H 4IFDI 1N9WA 4C3HH 1NBWA 2L15A 1A62A 4JBWA 1VQMA 1BBWA 3CMEA 2JA8G 4JC0A 5FLMH 2JEAI 1NMGA 1X6OA 3GDEA 4HIOA 3J80i 2H5XA 1YHBA 4LFAQ 2AKWB 4C3IH 1I94Q 2LSSA 1JMCA 5JEAJ 4A3MG 2JA6H 4KHPQ 4A93G 4GN3B 1Y1WH 2Z6KA 2ALYB 4X66L 3GTJH 1Y1WG 4QY7A 1J5EL 3UE1A 1VQOA 4A3GH 2KCTA 2WAQG 3CD6A 1XMQQ 1EFWA 3G71A 2VUMH 2BA0A 2D0OA 2LXKA 1LUZA 2NN6I 1YIJA 4KLKA 3RLOA 3MXNB 1HZCA 1LTLA 3GD7A 1MJEA 4JI2Q 4MNOA 1VQJA 3PIPA 1TXYA 4IPCA 4LFBL 4YY3Q 1Q1BA 1L1OB 5GROA 3CCEA 4A3DG 1XNRL 4POFA 2JA7G 1RL2A 4JYAQ 2CQOA 2I5LX 3KOJA 5LMNW 5M5YH 4GNXA 1QZHA 1K9MC 4YCWA 4IFDJ 4A76A 3HKZG 3UDFA 1IYJB 3KLWA 4DR7L 2IY5B 5ELOA 1CSQA 2KENA 2ZJRA 1WCMG 1FL0A 2Q2HA 1CKNB 1KHIA 1N33Q 4GKJL 1BBUA 3RLFA 1D7QA 4RMFA 1XNQQ 5GAGC 4JI1Q 2OQ0A 2NZHA 1P8LA 2FXQA 3CCJA 4DR1L 4DUZQ 4OO1G 1EIYB 4GOPA 4GOPB 1GM5A 5C0XG 1JT8A 5IY0A 1FVIA 4X64L 3KDFB 1OXUA 3A5ZB 4J15A 3RZDH 3U4ZA 2R7FA 3MEFA 1PH3A 2WB1G 3T1YL 4BXXG 3HOVH 4K0KL 2YYZA 2VQEQ 3H15A 4JI8L 3F8TA 2JA5G 2UUAL 4R4OA 4ALPA 4EQ5A 2JK8A 3A0JA 3BU2A 3K7AH 4R4CA 5M3FG 2EXDA 4DUYL 2DGYA 2DUDA 1E3PA 4DKAC 2BH8A 4LUOA 4GLXA 1HNZL 4B3TQ 3HOZG 1IBLL 2D62A 4GNXB 2RCNA 3NEMA 4A3JG 3J7ZC 4GOPC 4B3MQ 2E2IH 3F2BA 2IX0A 1U5KA 4KHZA 3UDXA 1VQIA 1VQHA 2AWOA 1PYBA 4JBJA 3EBEA 2I0QA 2A19A 1A63A 2R93G 4HIDA 5C4XG 2HIVA 1IXRA 1YHAA 4JI6L 3GTOH 5JEAG 3HKSA 3U58A 1OTCA 1VQ9A 1J6QA 1C0AA 1V43A 1KRSA 2Q2UA 5HGQA 2VQFQ 1VQDA 3L0OA 3HOZH 2B3GA 3CCLA 3I2ZA 3KFUA 4A3BG 1N32L 1X3GA 2AWNA 3TS0A 4JI3Q 1H95A 1AH9A 3TS2A 1I94L 4KHPL 1N34L 1E1OA 3JAMi 4X65L 1E24A 2JA8H 3J81i 1XNQL 4JV5L 1X54A 5ELNA 1I5FA 2NVYH 3CP0A 3STBC 2WAQE 1W2BA 1N8RC 4NXNQ 4HIMA 2MO0A 2E2JH 2PI2A 3D0FA 1I3QH 4TVAB 1XPRA 1S40A 3I4NG 4YCUA 3KF6B 1HH2P 3KF6A 1NE3A 3A74A 5AJ3Q 4PG3A 4DR5Q 4JYAL 2N8NA 4NB3A 2HHHQ 1UE1A 2JA7H 2OCEA 5EAYA 4A3IG 1Q12A 1Q86C 1PH2A 4JI7L 2WB1E 5BR8Q 3U50C 4DUZL 4LWCA 2UXCL 2LXJA 1UWVA 4AYBE 3PUZA 4YHHQ 4QJFA 1N33L 3I4MG 5C44G 4GLAC 3UDIA 3JAMc 4DV4L 2PI2E 3I4OA 4LF4L 4L5RC 3PIOA 4OXPA 4POGA 4A4IA 2IT1A 4A3KH 2Q2IA 4R1JA 4LFCL 1VQBA 1XMOQ 2GVBA 4FDBA 4X66Q 1HR0Q 2UUCL 4LF7L 3GTPH 1XJVA 4JBKA 4A3BH 3LGJA 1CKNA 1KRTA 1GO3E 1HNWL 4OX9Q 3KJPA 1VQCA 5IWAL 2NVTH 4DPGA 3HFZB 3SGIA 3T1HQ 1PA6A 3RN2A 1VQPA 2Z6KC 4APVA 4BY1H 3ER0A 4GKJQ 4JOIA 1YVCA 1L0WA 4A3KG 5M3FH 4QGUA 1S72A 4PZ7A 4DR4L 3E9IA 4LUZA 5IYCH 1AE2A 2WFWA 1Q82C 4NXMQ 5DLQE 2PNHA 1TWCH 5IP7H 5GAHC 2VQEL 2IX1A 4IPHA 3CPWA 1IBML 4X62L 4JBMA 4BY7H 5LMNQ 1K8GA 4BBSG 4HJ7A 3DLLA 1LYLA 2AMCB 2Y0SE 3CF5A 4DR5L 1IBMQ 3E9HA 1BVSA 4KI0A 4DR3Q 1QVFA 2B63H 2BH2A 1EYGA 2R7DA 1PYSB 2ZTCA 3CCUA 1JB7A 2UUCQ 3WWVA 4LFCQ 4AQYL 1I6HH 2Z0SA 4JCVE 4A3CG 1XMQL 4DR2Q 1A0IA 1K3RA 4A3CH 3HOXG 2ZJPA 2IHEA 4AQYQ 1CKMA 2HIXA 1EIFA 3VDYA 5IYDH 3HOWG 1L1OA 4JV5Q 1UE5A 4YWMA 4AIMA 2YV5A 2QEXA 3CMAA 5IYBG 3CC7A 4LUVA 1E1TA 1E22A 2QA4A 4DV5Q 2NN6G 4A75A 1CSPA 4UP9A 4TQUS 4BBSH 4X62Q 4LFBQ 4OWXB 4OO1I 4A3LH 3PUXA 5GADC 4DV3Q 4PMWA 2YTVA 5C0XI 4DR6L 2F4VQ 3S2DH 1KL9A 1SN8A 1PH5A 3H0GH 3CAMA 3S1RH 3UDGA 2HQLA 5LMUL 1PHJA 3OYYA 5C4XH 2R6GA 1I50H 1J5EQ 2E5LQ 1L1OC 2PMZE 1NTGA 1QUQA 1VQGA 2K14A 3M85A 1G51A 4A3MH 4LNQA 3H0GG 1N34Q 2E2HH 3CCQA 2Y0SG 3W1GA 1PH4A 2JA5H 1YI2A 4A3GG 2CWPA 1Q46A 3TEHB 4R4TA 5C44H 4JI3L 4LF8Q 1DGSA 1O7IA 2B29A 4DV0Q 4Y52H 1YJNA 4A93H 5J3BA 3PSIA 3RZOH 1VQAA 3ICEA 4YWLA 4L5QA 4DR6Q 5C3EH 1ASYA 4UY8C 5FJ8H 4A3FG 5C0XJ 2RHQB 3ULLA 3M4QA 4WJ4A 4PZ8A 4MZ9A 1VS0A 3H3VH 1VQFA 1IBLQ 2F3IA 4GLVB 4UP8A 5M3MH 1QUQB 4A3FH 1W3SA 3BZCA 5M3MG 3F2DA 1UE7A 5IE8A 2VQFL 4L5SA 4XIGS 3F2CA 4DR4Q 1X9NA 5JJKA 1VQ5A 1UE6A 1JJGA 1QVCA 2MFIA 2R92H 4GN4B 2VW9A 5C4JH 4GNXC 4DV7L 1GVPA 1U0LA 4O2DA 3G6EA 2YTYA 2PQAA 4QIWE 3Q8DA 4OONA 1PVOA 2N78A 3PF4A 4DV5L 4DAMA 1SR3A 1TWFH 1WJJA 1Z9FA 4DV6L 2ES2A 1VQ6A 4YY3L 1IBKL 2K5HA 4JI5Q 1YJ9A 2KBNA 3HOUG 4C3JH 1EOVA 1Q7YC 1IL2A 3KF8B 3JC66 4EX5A 3TREA 5FLMG 3S1QH 1WOCA 4HJ9A 2GN5A 1VQ4A 2N49A 3M4OH 3F1ZA 3RN5A 3OTOQ 3FP9A 3NENA 2ID0A 2R92G 2VNUD 1WI5A 3EN2A 1X3FA 1XNRQ 2NVQH 2E8GA 1XPOA 1M1KC 3S17H 4IPGA 1AE3A 3HOVG 4JI0Q 1V1QA 4BXXH 3AEVA 3BJUA 4JOIC 1EQQA 4JI4Q 3FKIG 3HKZE 3ERSX 3L7ZC 4Y7NH 2UU9Q 3CCVA 1PH1A 1G6PA 3I4NH 1SLJA 4DR2L 3H3VI 1SRUA 4IJHA 4DV4Q 1GKHA 3RR5A 4GN5A 1R9TH 3TQYA 4JI5L 3T1HL 2EQSA 4LFAL 4LF9L 3CQZH 4OX9L 4DAYB 5HY6A 1RIPA 2MQHA 2KHIA 3J81j 1E7ZA 1PFSA 2PQAB 1MIUA 1B7YB 1HZBA 1XMOL 1HR0L 4NXML 1VCIA 2A1AA 2OQKA 4HJAA 2V1CC 2ASBA 4A3DH 4GKKQ 4NXNL 4BY7G 2ZTEA 2HT1A 2UU9L 4DV0L 2BA1A 4LF6L 4YHHL 3PUWA 3CW2C 4LF8L 2IHFA 1Q8KA 4LF5L 2ZM6L 5IYCG 3AFPA 3K8AA 3EIVA 5JJLA 2UUBQ 4QQBX 1HNZQ 1VQ8A 4B3TL 1HNXL 3HOUH 5IP9G 3GTKH 1QZGA 1N36Q 2K4KA 4JI2L 3GTGH 5LMUQ 3K0XA 1LM0A 4DK3C 1XTDA 1B8AA 1EUJA 3J7A5 4WJ3M 1YZ6A 2UUAQ 3U4VA 1VQNA 3M7NA 2CWAA 2A8VA 1GD7A 4DNIA 1OXSC 3I4MH 2K50A 4BA1I 3KYHC 1YHQA 2NVXH 4X65Q 2F52A 4DV2Q 4DV1Q 1TWGH 5IYBH 4A3IH 1HZ9A 1OXTA 2I5HA 2EIFA 2KHJA 1K83H 3DM3A 4JI1L 5M5XH 2OWOA 4LF5Q 3GTLH 3HOWH 4B3RL 1TWAH 4QL5A 4PZ6A 1Q1EA 3E0EA 1SFOH 1KIXA 1FGUA 5LMNL 1Q81C 1D8LA 3HOXH 1C7YA 4IO9A 4BBRH 1QVGA 4IFDG 1HJPA 2VY3A 1MKHA 3FKIH 1V9PA 3G4SA 3J80c 2R7ZG 3CC4A 3B6YA 2R7ZH 1HNXQ 1KXLA 1P16A 2JEBI 4O0AA 1UEBA 1X55A 2VS1A 4P71A 5M5WH 3STBD 2JJQA 1JJCB 1Z47A 3M4PA 3KJOA 4DV1L 1PV4A 2CFMA 1JJ2A 3RLNA 2MNAA 3OTOL 3AFQA 3NBHB 4XTCS 1N32Q 2OTJA 2UXBQ 1NY4A 2VZAA 3CCSA 2UXDQ 1VQ7A 1C9OA 3I55A 4JI8Q 3W5OA 4JI6Q 5E7NA 4JI4L 4BY1G 4OWWB 1SE8A 4DV3L 5IP9H 1EWIA 3PV0A 1WFQA 1KQSA 1S3OA 1B70B 1IBKQ 4X64Q 4B3SL 3UE0A 1TWHH 3GTQH 1PH8A 1X3EA 2GVAA 4A3JH 1HNWQ 3I7FA 1M90C 2Q2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATW A;  3CXC A;  4A3E H;  4C2M H;  1YBY A;  1YNX A;  4DV7 Q;  1XPU A;  2E5L L;  2MO1 A;  2NZO A;  1SMX A;  3M9B A;  4A3L G;  2XTI A;  2RHS B;  3NEL A;  3PF5 A;  1SRO A;  4RG1 A;  4HJ5 A;  1OXV A;  4LF4 Q;  3PO2 G;  3K80 C;  1WYD A;  1YIT A;  2JE6 I;  3S1N H;  4DK6 C;  4DR7 Q;  3K81 C;  3S1M H;  1HZA A;  3J81 c;  1IZ6 A;  5GQO A;  3T1Y Q;  2N3S A;  3PGZ A;  4GS3 A;  2K5N A;  2YTX A;  5BR8 L;  3K7U C;  1JE5 A;  1VQE A;  3AQQ A;  3PCO B;  4B3S Q;  1YEZ A;  1CKO A;  1X56 A;  2D0P A;  4DR1 Q;  2YU9 H;  5IYD G;  1CUK A;  5AJ3 L;  1HR0 W;  3CPF A;  3W1B A;  2RF4 A;  2KCM A;  5C3E G;  1PH7 A;  1PH9 A;  2VL6 A;  3GO5 A;  4R4I A;  3IRB A;  3OW2 A;  3M3Y H;  1YJW A;  2UXB L;  5GAE C;  1G29 1;  2UXC Q;  3HOY H;  4UPA A;  2CCZ A;  1WCM H;  3KDF A;  3BZK A;  5IWA Q;  4DV6 Q;  2K75 A;  3D31 A;  3PUY A;  3L2P A;  3PUV A;  4IPD A;  5H1S E;  2R93 H;  4IJL A;  3PO3 G;  4IOC A;  4YWK A;  4A3E G;  1FJG L;  5FLX c;  4JG2 A;  1PH6 A;  2OTL A;  1KD1 C;  4LW1 A;  3PO2 H;  2K52 A;  5JJI A;  4HJ8 A;  2UXD L;  4MTN A;  4AH6 A;  5IT9 c;  1N36 L;  2K5V A;  1Y1V G;  3PO3 H;  2JQO A;  1ASZ A;  1Y1V H;  3S24 A;  1MJC A;  3CCM A;  1BKB A;  4H02 A;  4B3M L;  2JA6 G;  4R4Q A;  2VUM G;  4DV2 L;  4JI7 Q;  4IOA A;  4P75 A;  1VQL A;  3HOY G;  2HHH L;  4BA2 I;  1K73 C;  4LF6 Q;  1K0R A;  4L5T A;  4DUY Q;  1L2F A;  1KAW A;  1NJI C;  3I56 A;  4LF7 Q;  3GTM H;  1Y14 B;  3AYH B;  3ULP A;  1X65 A;  4GKK L;  4P72 A;  2F4V L;  3CCR A;  3FHW A;  4K0K Q;  3RNU A;  4DR3 L;  4HIK A;  3S15 H;  1T9H A;  2UUB L;  3S14 H;  4B3R Q;  2JA9 A;  4LF9 Q;  1KC8 C;  4P73 A;  2AHO B;  2ZM6 Q;  1NMF A;  5K36 G;  4P74 A;  2WP8 J;  2B63 G;  2C35 B;  5IP7 G;  2XGT A;  4ME3 A;  4OWT B;  3ULJ A;  2ZJQ A;  3S2H H;  1A8V A;  3CC2 A;  4NPS A;  3TRZ A;  4AYB G;  4BBR G;  1OXX K;  2I5M X;  4UP7 A;  3ZJY C;  1VQK A;  1EQR A;  4YCV A;  1FJG Q;  2CKZ B;  1K8A C;  4JI0 L;  4X6A H;  2QGQ A;  2ZTD A;  3A5U A;  3G48 A;  5FJ8 G;  3S16 H;  4IFD I;  1N9W A;  4C3H H;  1NBW A;  2L15 A;  1A62 A;  4JBW A;  1VQM A;  1BBW A;  3CME A;  2JA8 G;  4JC0 A;  5FLM H;  2JEA I;  1NMG A;  1X6O A;  3GDE A;  4HIO A;  3J80 i;  2H5X A;  1YHB A;  4LFA Q;  2AKW B;  4C3I H;  1I94 Q;  2LSS A;  1JMC A;  5JEA J;  4A3M G;  2JA6 H;  4KHP Q;  4A93 G;  4GN3 B;  1Y1W H;  2Z6K A;  2ALY B;  4X66 L;  3GTJ H;  1Y1W G;  4QY7 A;  1J5E L;  3UE1 A;  1VQO A;  4A3G H;  2KCT A;  2WAQ G;  3CD6 A;  1XMQ Q;  1EFW A;  3G71 A;  2VUM H;  2BA0 A;  2D0O A;  2LXK A;  1LUZ A;  2NN6 I;  1YIJ A;  4KLK A;  3RLO A;  3MXN B;  1HZC A;  1LTL A;  3GD7 A;  1MJE A;  4JI2 Q;  4MNO A;  1VQJ A;  3PIP A;  1TXY A;  4IPC A;  4LFB L;  4YY3 Q;  1Q1B A;  1L1O B;  5GRO A;  3CCE A;  4A3D G;  1XNR L;  4POF A;  2JA7 G;  1RL2 A;  4JYA Q;  2CQO A;  2I5L X;  3KOJ A;  5LMN W;  5M5Y H;  4GNX A;  1QZH A;  1K9M C;  4YCW A;  4IFD J;  4A76 A;  3HKZ G;  3UDF A;  1IYJ B;  3KLW A;  4DR7 L;  2IY5 B;  5ELO A;  1CSQ A;  2KEN A;  2ZJR A;  1WCM G;  1FL0 A;  2Q2H A;  1CKN B;  1KHI A;  1N33 Q;  4GKJ L;  1BBU A;  3RLF A;  1D7Q A;  4RMF A;  1XNQ Q;  5GAG C;  4JI1 Q;  2OQ0 A;  2NZH A;  1P8L A;  2FXQ A;  3CCJ A;  4DR1 L;  4DUZ Q;  4OO1 G;  1EIY B;  4GOP A;  4GOP B;  1GM5 A;  5C0X G;  1JT8 A;  5IY0 A;  1FVI A;  4X64 L;  3KDF B;  1OXU A;  3A5Z B;  4J15 A;  3RZD H;  3U4Z A;  2R7F A;  3MEF A;  1PH3 A;  2WB1 G;  3T1Y L;  4BXX G;  3HOV H;  4K0K L;  2YYZ A;  2VQE Q;  3H15 A;  4JI8 L;  3F8T A;  2JA5 G;  2UUA L;  4R4O A;  4ALP A;  4EQ5 A;  2JK8 A;  3A0J A;  3BU2 A;  3K7A H;  4R4C A;  5M3F G;  2EXD A;  4DUY L;  2DGY A;  2DUD A;  1E3P A;  4DKA C;  2BH8 A;  4LUO A;  4GLX A;  1HNZ L;  4B3T Q;  3HOZ G;  1IBL L;  2D62 A;  4GNX B;  2RCN A;  3NEM A;  4A3J G;  3J7Z C;  4GOP C;  4B3M Q;  2E2I H;  3F2B A;  2IX0 A;  1U5K A;  4KHZ A;  3UDX A;  1VQI A;  1VQH A;  2AWO A;  1PYB A;  4JBJ A;  3EBE A;  2I0Q A;  2A19 A;  1A63 A;  2R93 G;  4HID A;  5C4X G;  2HIV A;  1IXR A;  1YHA A;  4JI6 L;  3GTO H;  5JEA G;  3HKS A;  3U58 A;  1OTC A;  1VQ9 A;  1J6Q A;  1C0A A;  1V43 A;  1KRS A;  2Q2U A;  5HGQ A;  2VQF Q;  1VQD A;  3L0O A;  3HOZ H;  2B3G A;  3CCL A;  3I2Z A;  3KFU A;  4A3B G;  1N32 L;  1X3G A;  2AWN A;  3TS0 A;  4JI3 Q;  1H95 A;  1AH9 A;  3TS2 A;  1I94 L;  4KHP L;  1N34 L;  1E1O A;  3JAM i;  4X65 L;  1E24 A;  2JA8 H;  3J81 i;  1XNQ L;  4JV5 L;  1X54 A;  5ELN A;  1I5F A;  2NVY H;  3CP0 A;  3STB C;  2WAQ E;  1W2B A;  1N8R C;  4NXN Q;  4HIM A;  2MO0 A;  2E2J H;  2PI2 A;  3D0F A;  1I3Q H;  4TVA B;  1XPR A;  1S40 A;  3I4N G;  4YCU A;  3KF6 B;  1HH2 P;  3KF6 A;  1NE3 A;  3A74 A;  5AJ3 Q;  4PG3 A;  4DR5 Q;  4JYA L;  2N8N A;  4NB3 A;  2HHH Q;  1UE1 A;  2JA7 H;  2OCE A;  5EAY A;  4A3I G;  1Q12 A;  1Q86 C;  1PH2 A;  4JI7 L;  2WB1 E;  5BR8 Q;  3U50 C;  4DUZ L;  4LWC A;  2UXC L;  2LXJ A;  1UWV A;  4AYB E;  3PUZ A;  4YHH Q;  4QJF A;  1N33 L;  3I4M G;  5C44 G;  4GLA C;  3UDI A;  3JAM c;  4DV4 L;  2PI2 E;  3I4O A;  4LF4 L;  4L5R C;  3PIO A;  4OXP A;  4POG A;  4A4I A;  2IT1 A;  4A3K H;  2Q2I A;  4R1J A;  4LFC L;  1VQB A;  1XMO Q;  2GVB A;  4FDB A;  4X66 Q;  1HR0 Q;  2UUC L;  4LF7 L;  3GTP H;  1XJV A;  4JBK A;  4A3B H;  3LGJ A;  1CKN A;  1KRT A;  1GO3 E;  1HNW L;  4OX9 Q;  3KJP A;  1VQC A;  5IWA L;  2NVT H;  4DPG A;  3HFZ B;  3SGI A;  3T1H Q;  1PA6 A;  3RN2 A;  1VQP A;  2Z6K C;  4APV A;  4BY1 H;  3ER0 A;  4GKJ Q;  4JOI A;  1YVC A;  1L0W A;  4A3K G;  5M3F H;  4QGU A;  1S72 A;  4PZ7 A;  4DR4 L;  3E9I A;  4LUZ A;  5IYC H;  1AE2 A;  2WFW A;  1Q82 C;  4NXM Q;  5DLQ E;  2PNH A;  1TWC H;  5IP7 H;  5GAH C;  2VQE L;  2IX1 A;  4IPH A;  3CPW A;  1IBM L;  4X62 L;  4JBM A;  4BY7 H;  5LMN Q;  1K8G A;  4BBS G;  4HJ7 A;  3DLL A;  1LYL A;  2AMC B;  2Y0S E;  3CF5 A;  4DR5 L;  1IBM Q;  3E9H A;  1BVS A;  4KI0 A;  4DR3 Q;  1QVF A;  2B63 H;  2BH2 A;  1EYG A;  2R7D A;  1PYS B;  2ZTC A;  3CCU A;  1JB7 A;  2UUC Q;  3WWV A;  4LFC Q;  4AQY L;  1I6H H;  2Z0S A;  4JCV E;  4A3C G;  1XMQ L;  4DR2 Q;  1A0I A;  1K3R A;  4A3C H;  3HOX G;  2ZJP A;  2IHE A;  4AQY Q;  1CKM A;  2HIX A;  1EIF A;  3VDY A;  5IYD H;  3HOW G;  1L1O A;  4JV5 Q;  1UE5 A;  4YWM A;  4AIM A;  2YV5 A;  2QEX A;  3CMA A;  5IYB G;  3CC7 A;  4LUV A;  1E1T A;  1E22 A;  2QA4 A;  4DV5 Q;  2NN6 G;  4A75 A;  1CSP A;  4UP9 A;  4TQU S;  4BBS H;  4X62 Q;  4LFB Q;  4OWX B;  4OO1 I;  4A3L H;  3PUX A;  5GAD C;  4DV3 Q;  4PMW A;  2YTV A;  5C0X I;  4DR6 L;  2F4V Q;  3S2D H;  1KL9 A;  1SN8 A;  1PH5 A;  3H0G H;  3CAM A;  3S1R H;  3UDG A;  2HQL A;  5LMU L;  1PHJ A;  3OYY A;  5C4X H;  2R6G A;  1I50 H;  1J5E Q;  2E5L Q;  1L1O C;  2PMZ E;  1NTG A;  1QUQ A;  1VQG A;  2K14 A;  3M85 A;  1G51 A;  4A3M H;  4LNQ A;  3H0G G;  1N34 Q;  2E2H H;  3CCQ A;  2Y0S G;  3W1G A;  1PH4 A;  2JA5 H;  1YI2 A;  4A3G G;  2CWP A;  1Q46 A;  3TEH B;  4R4T A;  5C44 H;  4JI3 L;  4LF8 Q;  1DGS A;  1O7I A;  2B29 A;  4DV0 Q;  4Y52 H;  1YJN A;  4A93 H;  5J3B A;  3PSI A;  3RZO H;  1VQA A;  3ICE A;  4YWL A;  4L5Q A;  4DR6 Q;  5C3E H;  1ASY A;  4UY8 C;  5FJ8 H;  4A3F G;  5C0X J;  2RHQ B;  3ULL A;  3M4Q A;  4WJ4 A;  4PZ8 A;  4MZ9 A;  1VS0 A;  3H3V H;  1VQF A;  1IBL Q;  2F3I A;  4GLV B;  4UP8 A;  5M3M H;  1QUQ B;  4A3F H;  1W3S A;  3BZC A;  5M3M G;  3F2D A;  1UE7 A;  5IE8 A;  2VQF L;  4L5S A;  4XIG S;  3F2C A;  4DR4 Q;  1X9N A;  5JJK A;  1VQ5 A;  1UE6 A;  1JJG A;  1QVC A;  2MFI A;  2R92 H;  4GN4 B;  2VW9 A;  5C4J H;  4GNX C;  4DV7 L;  1GVP A;  1U0L A;  4O2D A;  3G6E A;  2YTY A;  2PQA A;  4QIW E;  3Q8D A;  4OON A;  1PVO A;  2N78 A;  3PF4 A;  4DV5 L;  4DAM A;  1SR3 A;  1TWF H;  1WJJ A;  1Z9F A;  4DV6 L;  2ES2 A;  1VQ6 A;  4YY3 L;  1IBK L;  2K5H A;  4JI5 Q;  1YJ9 A;  2KBN A;  3HOU G;  4C3J H;  1EOV A;  1Q7Y C;  1IL2 A;  3KF8 B;  3JC6 6;  4EX5 A;  3TRE A;  5FLM G;  3S1Q H;  1WOC A;  4HJ9 A;  2GN5 A;  1VQ4 A;  2N49 A;  3M4O H;  3F1Z A;  3RN5 A;  3OTO Q;  3FP9 A;  3NEN A;  2ID0 A;  2R92 G;  2VNU D;  1WI5 A;  3EN2 A;  1X3F A;  1XNR Q;  2NVQ H;  2E8G A;  1XPO A;  1M1K C;  3S17 H;  4IPG A;  1AE3 A;  3HOV G;  4JI0 Q;  1V1Q A;  4BXX H;  3AEV A;  3BJU A;  4JOI C;  1EQQ A;  4JI4 Q;  3FKI G;  3HKZ E;  3ERS X;  3L7Z C;  4Y7N H;  2UU9 Q;  3CCV A;  1PH1 A;  1G6P A;  3I4N H;  1SLJ A;  4DR2 L;  3H3V I;  1SRU A;  4IJH A;  4DV4 Q;  1GKH A;  3RR5 A;  4GN5 A;  1R9T H;  3TQY A;  4JI5 L;  3T1H L;  2EQS A;  4LFA L;  4LF9 L;  3CQZ H;  4OX9 L;  4DAY B;  5HY6 A;  1RIP A;  2MQH A;  2KHI A;  3J81 j;  1E7Z A;  1PFS A;  2PQA B;  1MIU A;  1B7Y B;  1HZB A;  1XMO L;  1HR0 L;  4NXM L;  1VCI A;  2A1A A;  2OQK A;  4HJA A;  2V1C C;  2ASB A;  4A3D H;  4GKK Q;  4NXN L;  4BY7 G;  2ZTE A;  2HT1 A;  2UU9 L;  4DV0 L;  2BA1 A;  4LF6 L;  4YHH L;  3PUW A;  3CW2 C;  4LF8 L;  2IHF A;  1Q8K A;  4LF5 L;  2ZM6 L;  5IYC G;  3AFP A;  3K8A A;  3EIV A;  5JJL A;  2UUB Q;  4QQB X;  1HNZ Q;  1VQ8 A;  4B3T L;  1HNX L;  3HOU H;  5IP9 G;  3GTK H;  1QZG A;  1N36 Q;  2K4K A;  4JI2 L;  3GTG H;  5LMU Q;  3K0X A;  1LM0 A;  4DK3 C;  1XTD A;  1B8A A;  1EUJ A;  3J7A 5;  4WJ3 M;  1YZ6 A;  2UUA Q;  3U4V A;  1VQN A;  3M7N A;  2CWA A;  2A8V A;  1GD7 A;  4DNI A;  1OXS C;  3I4M H;  2K50 A;  4BA1 I;  3KYH C;  1YHQ A;  2NVX H;  4X65 Q;  2F52 A;  4DV2 Q;  4DV1 Q;  1TWG H;  5IYB H;  4A3I H;  1HZ9 A;  1OXT A;  2I5H A;  2EIF A;  2KHJ A;  1K83 H;  3DM3 A;  4JI1 L;  5M5X H;  2OWO A;  4LF5 Q;  3GTL H;  3HOW H;  4B3R L;  1TWA H;  4QL5 A;  4PZ6 A;  1Q1E A;  3E0E A;  1SFO H;  1KIX A;  1FGU A;  5LMN L;  1Q81 C;  1D8L A;  3HOX H;  1C7Y A;  4IO9 A;  4BBR H;  1QVG A;  4IFD G;  1HJP A;  2VY3 A;  1MKH A;  3FKI H;  1V9P A;  3G4S A;  3J80 c;  2R7Z G;  3CC4 A;  3B6Y A;  2R7Z H;  1HNX Q;  1KXL A;  1P16 A;  2JEB I;  4O0A A;  1UEB A;  1X55 A;  2VS1 A;  4P71 A;  5M5W H;  3STB D;  2JJQ A;  1JJC B;  1Z47 A;  3M4P A;  3KJO A;  4DV1 L;  1PV4 A;  2CFM A;  1JJ2 A;  3RLN A;  2MNA A;  3OTO L;  3AFQ A;  3NBH B;  4XTC S;  1N32 Q;  2OTJ A;  2UXB Q;  1NY4 A;  2VZA A;  3CCS A;  2UXD Q;  1VQ7 A;  1C9O A;  3I55 A;  4JI8 Q;  3W5O A;  4JI6 Q;  5E7N A;  4JI4 L;  4BY1 G;  4OWW B;  1SE8 A;  4DV3 L;  5IP9 H;  1EWI A;  3PV0 A;  1WFQ A;  1KQS A;  1S3O A;  1B70 B;  1IBK Q;  4X64 Q;  4B3S L;  3UE0 A;  1TWH H;  3GTQ H;  1PH8 A;  1X3E A;  2GVA A;  4A3J H;  1HNW Q;  3I7F A;  1M90 C;  2Q2T A; 
#chains in the Genus database with same CATH topology
 1SSO A;  3CXC A;  4C2M H;  1XPU A;  5KNC A;  5JVG 3;  4K14 A;  4RG1 A;  4LF4 Q;  2QF7 A;  3K80 C;  3GTM B;  5JPM C;  3OSO A;  1IZ6 A;  3T1Y Q;  2P5Z X;  3PGZ A;  4TKO B;  2K5N A;  5FLX E;  1JE5 A;  3PCO B;  1PDQ A;  4DR1 Q;  4CKC A;  4A3M B;  4A3E B;  2K7V A;  3CPF A;  4KKT A;  1MSH A;  3VYU A;  3W1B A;  2MP1 A;  2VL6 A;  3GO5 A;  4R4I A;  3P7J A;  4M1U B;  2UXB L;  3EQL C;  4KK7 A;  4UPA A;  3R3O A;  2CCZ A;  1WCM H;  4DNT B;  3PUY A;  3L2P A;  4OEL B;  5KND A;  3PUV A;  5H1S E;  3J7A F;  2CH4 W;  4G7O C;  1KAB A;  2F0P A;  1CQV A;  1LLR D;  2OTL A;  4LW1 A;  1QCB D;  3MAQ A;  5KIX A;  4MTN A;  1Y1V G;  1BR9 A;  1PZI D;  1BKB A;  4DF7 A;  2JA6 G;  1NR2 A;  4ZYS A;  1XXG A;  1VQL A;  3UI2 A;  3TN2 A;  4F87 A;  1CI3 M;  1BOS A;  4LF6 Q;  4K6L A;  3GTM H;  4P72 A;  3FHW A;  4K0K Q;  4HCS A;  3I4M B;  1T9H A;  3S14 H;  1WTV A;  2L5T A;  1KC8 C;  1R4Q B;  1LT4 D;  1BCP B;  2ZXP A;  2B63 G;  1QE6 A;  3ULJ A;  4ME3 A;  2R93 B;  1A8V A;  3S14 B;  1F2M A;  4BBR G;  1OXX K;  2I5M X;  1VQK A;  1EQR A;  3HOY B;  2CKZ B;  4X6A H;  1A62 A;  1BBW A;  1EZ8 A;  1GUS A;  5FLM H;  4HIO A;  1YHB A;  2E76 C;  1SNM A;  4X3U A;  4GN3 B;  2R7Z B;  1Y1W G;  4MN3 A;  4A3G H;  2KCT A;  4FVM A;  1EFW A;  3G71 A;  2D0O A;  1YIJ A;  1EFI D;  3RLO A;  2IWH A;  4N9T A;  1VQJ A;  3PIP A;  4HMI A;  1SNP A;  4K8I A;  3NHH A;  5LMN W;  1SXT A;  4IFD J;  4YCW A;  1WCM B;  4R9W A;  3KLW A;  4DR7 L;  1CSQ A;  5C5L A;  1EU3 A;  1B3A A;  1WCM G;  4RAU C;  2L9H A;  4NMZ A;  5IOD A;  4M8A A;  3G6J B;  3RLF A;  3X3N A;  4RMF A;  1XNQ Q;  3CCJ A;  1WD1 A;  5C0X G;  3J7A V;  4X64 L;  2RBM A;  1PTO H;  3E6Z X;  1E2W A;  1JR0 D;  1C8C A;  4ALP A;  4ZLT F;  4R4C A;  3QJY A;  1PTO B;  2E2D C;  1ENA A;  1SE3 A;  4C1N K;  2RCN A;  4A3J G;  2H1E A;  4J1M A;  2E2I H;  4B3M Q;  1YNJ C;  4EQO A;  5C4X B;  1VQH A;  4JBJ A;  3OWF A;  2A19 A;  3QR8 A;  5C4X G;  3U58 A;  1C0A A;  2VQF Q;  3FVQ A;  1N32 L;  4I7Z C;  4CDE C;  1EY0 A;  4KHP L;  1YNN C;  4X65 L;  3J81 L;  1EIG A;  1F9P A;  5ELN A;  2NVY H;  3ERQ A;  1W2B A;  1N8R C;  1IW7 D;  2MO0 A;  4TVA B;  1S40 A;  1NE3 A;  2F0U A;  1LT6 D;  1AN8 A;  2NVY B;  2N8N A;  1IYU A;  3GTO H;  3S1M B;  4ZKB B;  4GLA C;  4CJ1 B;  1PRT B;  4DV4 L;  3CU7 A;  2PI2 E;  1Z7T A;  4L5R C;  4OXP A;  2IT1 A;  4R1J A;  1HR0 Q;  3RZO H;  4LF7 L;  2GVB A;  4FDB A;  4KMU C;  3GTP H;  1KRT A;  4A3F B;  1HNW L;  4C3I G;  3KJP A;  2NVT H;  2B2Y C;  1TY2 A;  1PA6 A;  2Z6K C;  2O5J C;  1L0W A;  3SXH A;  5CMD A;  2C5C A;  3VA5 A;  5C4Z A;  5IYC H;  4LUZ A;  1AE2 A;  2WFW A;  1UNS A;  2J7Z A;  4NXM Q;  2PNH A;  3PMF A;  4RKL A;  1K8G A;  5IGD A;  2EXZ A;  4DR5 L;  1BVS A;  2EYO A;  2ZTC A;  3CCU A;  1JWS D;  1QOH A;  5A2Q E;  1TR5 A;  4NKL A;  4A3C G;  4KY6 A;  4DK1 A;  1K3R A;  3HOX G;  2IHE A;  4IZ8 A;  1I4H A;  3VDY A;  1A6X A;  5IYB G;  4LUV A;  3VR3 A;  2F0S A;  1G2S A;  4A3L H;  1D5M C;  5TSS A;  4XDX A;  2F4V Q;  5C4H A;  1KL9 A;  1PH5 A;  2DN8 A;  2RQX A;  3UDG A;  2HQL A;  3OYY A;  1TY0 A;  1F2Y A;  1I50 H;  2B2V C;  2PMZ E;  1QUQ A;  4LNQ A;  4A3M H;  3H0G G;  2E2H H;  1YI2 A;  3TEH B;  5LHY 1;  3SK4 A;  4LF8 Q;  4JI3 L;  5ELE A;  1O7I A;  3K6O A;  4DV0 Q;  2Z4H A;  4Y52 H;  4A93 H;  2EY5 A;  1LTA D;  5CV6 A;  1STG A;  1GJX A;  2PO4 A;  2X6G A;  1LTT D;  2RHQ B;  3ULL A;  3M4Q A;  3TP5 A;  4WJ4 A;  5C0X H;  1CK1 A;  1VS0 A;  4MZ9 A;  3SK8 A;  3H3V H;  5E1F A;  4GLV B;  4RWS C;  4XT3 B;  1UE7 A;  2Z9H A;  4NDX A;  4L5S A;  4XIG S;  3K58 A;  4DR4 Q;  5JJK A;  3T16 A;  2DJG C;  4GN4 B;  2VW9 A;  4GNX C;  2PCF B;  2YTY A;  2PQA A;  1SNQ A;  1PFB A;  5D14 A;  2ES2 A;  2K5W A;  1VQ6 A;  4YY3 L;  1IBK L;  4JI5 Q;  3K0Y A;  2RDF A;  2XNA C;  1U4L A;  4FXG C;  1A2T A;  3JC6 6;  5DEH A;  2D5D A;  2DY7 A;  3TRE A;  4G7H C;  3C3L A;  1Y8O B;  2B2W A;  1EQV A;  2JP1 A;  2EJM A;  3W2D A;  1XNR Q;  1LTG D;  2R3Z A;  5CV5 A;  2ZXO A;  1J8I A;  1EY7 A;  4IPG A;  2F0N A;  3QO2 A;  3HP3 A;  4CDD C;  4JI0 Q;  1V1Q A;  3DWP A;  5DAU A;  4JOI C;  5A35 A;  1EQQ A;  2CHB D;  3GP7 A;  1B44 D;  3Q22 A;  2RKS A;  3L9A X;  1GKH A;  1JE4 A;  4FP5 D;  2EQS A;  3RZO B;  4LF9 L;  3BZD B;  3BVZ A;  3TDQ A;  1S4Z A;  3HS0 C;  2PQA B;  1GXD C;  5LL6 S;  1CA6 A;  1B7Y B;  1HZB A;  2J4X A;  1VCI A;  3MXU A;  4DXG A;  5ELB A;  2FIN B;  4HJA A;  4GKK Q;  5IGG A;  2PZU A;  1V8Q A;  4RCO A;  4DV0 L;  2UU9 L;  2HT1 A;  4ODG A;  4R8N A;  5I2Y A;  1FNW A;  4PNY A;  4LF5 L;  1SYB A;  3AFP A;  5JJL A;  4J6H A;  2BDN A;  4L6T B;  1HNZ Q;  1VQ8 A;  4B3T L;  4JI2 L;  2A6H D;  4WJ3 M;  2UUA Q;  5BN3 A;  1VQN A;  2HDM A;  4Y7N B;  3V05 A;  1OXS C;  1LTR D;  2L11 A;  3Q0A A;  1STB A;  4A3I H;  5EBD A;  2BOS A;  4LF5 Q;  1X32 A;  1SYG A;  1C7Y A;  4IO9 A;  4BBR H;  2DY8 A;  3FKI H;  5FKA C;  3BYY B;  2SOB A;  2XIW A;  4C3J B;  1PFM A;  1KXL A;  2MPM A;  1P16 A;  1UEB A;  2Q8T A;  1X55 A;  2VS1 A;  4WOR A;  2I07 B;  3SDZ A;  1UAP A;  1CA5 A;  1JJ2 A;  1T5E A;  3AFQ A;  3NBH B;  2B2T A;  1B50 A;  3CCS A;  1D5X C;  5I6W A;  1F9R A;  3HG9 A;  3VYS A;  2GA4 B;  4BY1 G;  1SE8 A;  1R9T B;  3DMU A;  1B70 B;  3UE0 A;  3HOU B;  2O2L D;  2G5D A;  4ZAI A;  3NEL A;  1HNW Q;  1F2Z A;  1M90 C;  2ATW A;  2E5L L;  2A5H A;  2MO1 A;  2NZO A;  1SMX A;  1K0S A;  2QDB A;  4HTH A;  3QG1 A;  3PF5 A;  2XVS A;  1SRO A;  3VA7 A;  1OXV A;  2H4O A;  1YIT A;  1WYD A;  1B53 A;  4C3H G;  3S1M H;  1DXM A;  3J81 c;  1ZXT A;  3ITP A;  2X69 A;  5GQO A;  2YTX A;  1K28 A;  3LWU A;  5T1G A;  3MXG A;  1FNV A;  1BXT A;  4RGN A;  3R2T A;  2B2V A;  3C46 A;  1QNK A;  2MHV A;  2RF4 A;  5C3E G;  2RCF A;  3OW2 A;  1B3Q A;  5CYU A;  3M3Y H;  4H0L C;  1ML0 D;  2UXC Q;  2NUC A;  4O1N A;  3T13 A;  5IWA Q;  1Q90 A;  4FO2 A;  5KYL A;  1WTO A;  5L37 A;  2Z6B A;  3D31 A;  2IX3 A;  3PO3 G;  4IOC A;  1NAP A;  3OOC A;  4YWK A;  1FJG L;  5FLX c;  3T51 B;  3NQI A;  5JJI A;  2UXD L;  1ICF B;  2K5V A;  1ASZ A;  1WVL A;  1PZK D;  3S24 A;  1MJC A;  4KD3 A;  4XQQ A;  4DNR B;  4H02 A;  3CCM A;  4B3M L;  1PFN A;  4IOA A;  4KHV A;  5CBA E;  5FK9 C;  1S5F D;  2A69 D;  1L2F A;  1TWF B;  3I56 A;  3A7L A;  1EWC A;  1L0X B;  3ULP A;  4GKK L;  4EQN A;  2RDG A;  5IOC A;  2F4V L;  4LJZ C;  4DR3 L;  1XWE A;  3NTI A;  4ABN A;  4IUR A;  4WFN 3;  1HA6 A;  4LF9 Q;  1KTK A;  5DM6 3;  1I4G A;  2ZM6 Q;  1NMF A;  5DNF A;  5K36 G;  1X3Q A;  2WP8 J;  5IP7 G;  3MHB A;  2XGT A;  2ZJQ A;  1BCP F;  3CC2 A;  3TRZ A;  3J80 E;  4DFA A;  5KYI A;  5BN5 A;  4YCV A;  1FJG Q;  3NPP A;  4JI0 L;  3FPU B;  1DOK A;  1SAP A;  1TT2 A;  4KV6 A;  4C3H H;  2JA8 G;  2A69 C;  4IUU A;  3CRL C;  4JC0 A;  1NMG A;  4A93 B;  3J80 i;  4C3I H;  3NBH A;  2AKW B;  1JMC A;  5JEA J;  2HUG A;  3I90 A;  4A93 G;  1Y1W H;  2Z6K A;  1J5E L;  4QY7 A;  3Q23 A;  3UE1 A;  2FMC A;  1EY4 A;  3H09 A;  1XMQ Q;  2VUM H;  2LXK A;  1ICW A;  3I4L A;  4AYB B;  4KLK A;  1STH A;  3MXN B;  1HZC A;  2F0E A;  1MJE A;  4JI2 Q;  5FLX L;  3DHQ A;  3S16 B;  1ET9 A;  1Q1B A;  4A3D G;  3CCE A;  3SHL A;  4POF A;  1XNR L;  1RF2 D;  1FGB D;  1I4Q A;  1RL2 A;  1WTX A;  1K9M C;  2I5L X;  4GNX A;  1QZH A;  5M5Y H;  1EYD A;  2JSO A;  1F9S A;  2EY6 A;  4LK1 C;  2M00 A;  4WJW A;  2IY5 B;  1H9S A;  2WAQ B;  1ENC A;  3EFX D;  2Z1C A;  3GTK B;  1KHI A;  1HFG A;  3DWQ A;  5GAG C;  4JI1 Q;  2OQ0 A;  4OO1 G;  3I73 A;  2N88 A;  4DGZ A;  1BDO A;  2F0W A;  2ENB A;  4GOP B;  5IY0 A;  4ID6 A;  4Q5V A;  3KDF B;  4J15 A;  2F0Q A;  1PXU A;  3RZD H;  1PH3 A;  4KD4 A;  4K0K L;  2EY1 A;  2YYZ A;  2VQE Q;  3H15 A;  2JA5 G;  2B2U A;  1TWC B;  3A0J A;  3ND8 A;  5M3F G;  2JA5 B;  5IT9 E;  1EEF D;  2DUD A;  1E3P A;  1SDF A;  2BH8 A;  4GLX A;  3RZD B;  3VYR A;  2PPB C;  3F2B A;  3DUZ A;  4KHZ A;  1PRT D;  2AWO A;  4JI6 L;  5JEA G;  2PW7 A;  2NWG A;  1V43 A;  5JVH 3;  2Q2U A;  1LTI D;  3HOZ H;  2B3G A;  3CCL A;  1X3G A;  2AWN A;  1RDP D;  1AH9 A;  1H9S B;  3TS2 A;  3U9O A;  3JAM L;  1ILQ A;  3JAM i;  1ZYR D;  1DJR D;  3M3Y B;  4YIJ A;  1JOO A;  3H3V C;  3K5O A;  4RGO S;  1PYW D;  2WAQ E;  2B63 B;  3D0F A;  2VUM B;  2KED A;  2F03 A;  5HGT A;  3A7A B;  1BQQ T;  1HTP A;  1KLU D;  5AJ3 Q;  4H44 C;  4PG3 A;  1RJT A;  3C1E A;  2KCN A;  2OXP A;  1JC7 A;  4NB3 A;  4C3I B;  2HHH Q;  4B9W A;  2JA7 H;  5EAY A;  1Q86 C;  1Q12 A;  3HZX A;  4JI7 L;  4LWC A;  3W3A A;  2B2Y A;  4ZKC B;  1DCZ A;  4QJF A;  1LV9 A;  3TP7 A;  1H9M A;  1B2T A;  4LF4 L;  4POG A;  1LTB D;  2XSC A;  5EGT A;  4A3K H;  2Q2I A;  3WOF A;  3VR4 A;  4DU9 A;  2BE5 D;  3LGJ A;  5KEE A;  3Q6S A;  4BS9 A;  1RTO A;  4JK1 C;  2A6E D;  1VQC A;  2LKV A;  2A68 D;  1U4M A;  3RN2 A;  3C1F A;  5EPL A;  4A3K B;  4APV A;  3ZYY X;  2QW7 A;  2QCP X;  1YVC A;  4QMG A;  2PQE A;  4A3K G;  3VR6 A;  3A54 A;  5M3F H;  3MEH A;  1CFM A;  2MJ8 A;  3E9I A;  4PZ7 A;  4X3S A;  1Q82 C;  5DLQ E;  1TWC H;  5GAH C;  3CHB D;  4IPH A;  1O7L A;  1IBM L;  5LMN Q;  3D4W A;  4F88 A;  2EYH A;  3HKZ B;  1QVF A;  4DR3 Q;  2M2L A;  1TS5 A;  2B63 H;  2B2T C;  5CV4 A;  1NCV A;  4WRD A;  2HDL A;  1TWH B;  1A0I A;  3HOW B;  1V1P A;  3N52 A;  2ZJP A;  4B9X A;  1CKM A;  2HIX A;  2L12 A;  1ZEQ X;  2K03 A;  3KLS X;  4CGY B;  5IYD H;  3HOW G;  1L1O A;  2F1M A;  5C4J B;  2R92 B;  1W6K A;  4NP5 A;  5JEA H;  2SEB D;  2NN6 G;  1HQM C;  1CSP A;  2LY7 A;  4UP9 A;  4LFB Q;  4X62 Q;  4OWX B;  3MFY A;  4DV3 Q;  3HEJ A;  2F0T A;  1SND A;  4H13 C;  3H0G H;  3OMC A;  2EYP A;  5I9P A;  1PHJ A;  2YU9 B;  3M85 A;  2M9V A;  4U68 A;  3M7G A;  5IGE A;  2K5D A;  1PH4 A;  2JA5 H;  1Q46 A;  3AB9 A;  2EJG C;  5EBC A;  1RD9 D;  3PSI A;  3ICE A;  1E2V A;  5IIF A;  1ASY A;  2L4N A;  3BVG A;  5C0X J;  1Z6H A;  1JQY D;  1LT5 D;  3IL8 A;  3S1R B;  1BO0 A;  3GV3 A;  3I4N B;  4A3F H;  2QKI C;  1OO9 B;  4UAI A;  5M3M G;  3OIQ A;  5CBE E;  2VQF L;  1SEB D;  2F0K A;  2KHS A;  1JJG A;  5C4J H;  4DAP A;  3G6E A;  4QF4 A;  2E75 C;  4BWG B;  1PVO A;  2N78 A;  4DAM A;  3DXJ C;  3RMH A;  1EYC A;  1O7Z A;  1HUM A;  4RGT A;  1R4P B;  4K8J A;  3HOU G;  4MTK A;  3JAM E;  1EOV A;  1ZKO A;  1VQ4 A;  3M4O H;  1CHP D;  3OTO Q;  1S5E D;  3NEN A;  4U67 3;  2ID0 A;  1NR4 A;  4FF1 A;  1BBX C;  2E8G A;  5JJZ A;  2F0V A;  1PTO C;  1AE3 A;  1V1O A;  3AEV A;  1JB3 A;  3BJU A;  3HKZ E;  2KEE A;  4Y7N H;  1PH1 A;  3KUP A;  1SLJ A;  5EQ0 A;  1SRU A;  4FXD A;  4GN5 A;  4QCL A;  4CHT B;  4DAY B;  4A3G B;  2QIL A;  2MQH A;  1PFS A;  1VMC A;  1MIU A;  1FYC A;  4KTA A;  1HR0 L;  4NXM L;  4BY7 B;  2OQK A;  2ASB A;  3K7A B;  4A3D H;  2AUK A;  2SNS A;  1DYQ A;  4BY7 G;  2RDH A;  2ZTE A;  1AW7 A;  4LF6 L;  2IHF A;  1MI2 A;  2ZM6 L;  1VDZ A;  5KNB A;  5IYC G;  3K8A A;  2QEJ C;  3WDN A;  1RTN A;  4QQB X;  3H94 A;  5IP9 G;  1A15 A;  2K4K A;  3GTG H;  5NUC A;  3K0X A;  5LMU Q;  1LM0 A;  1QJO A;  1XTD A;  4LMQ D;  1IL8 A;  3M7N A;  2FJ2 A;  5I9O A;  2A8V A;  4C3J G;  4QB4 A;  3I4M H;  2K50 A;  1QWY A;  3QOJ A;  3E3X A;  4X65 Q;  3BS1 A;  4DV1 Q;  5JPN C;  4JI1 L;  2I5H A;  4B3R L;  1TWA H;  4QL5 A;  1KIX A;  1A3V A;  3FMC A;  1Q81 C;  3NTK A;  3HRZ C;  3HOX H;  4QIW B;  2V4D A;  1K3B C;  2NB0 A;  1HFN A;  4EGV A;  2R7Z G;  1Y1W B;  4KN4 C;  3CC4 A;  1HNX Q;  4O0A A;  5I6Y A;  1WTR A;  4PQX A;  5JAV A;  3I91 A;  3KJO A;  2JA6 B;  4XQJ A;  4KY7 A;  3IAY A;  3D6W A;  3RLN A;  4XYO A;  1VF5 C;  5M5X B;  1MBY A;  4DXF A;  1N32 Q;  2UXB Q;  3K59 A;  1VQ7 A;  1D5Z C;  3W5O A;  1D1I A;  4JI6 Q;  4DV3 L;  3PV0 A;  1WFQ A;  1SYF A;  1KQS A;  2KJX A;  1IBK Q;  1C4Q A;  4A3J H;  5LMN L;  4A3E H;  1YBY A;  2E2I B;  5COY A;  5C3E B;  1Q8I A;  2XTI A;  2RHS B;  3PO2 G;  4HJ5 A;  4EQP A;  2JE6 I;  4DK6 C;  3SEB A;  5BR8 L;  3RUZ A;  1F77 A;  3AQQ A;  2PZW A;  4B3S Q;  1DD2 A;  1YEZ A;  3IKJ A;  5IYD G;  1HR0 W;  2WKC A;  1S5C D;  3D8G A;  3P75 A;  5J1Z A;  3GTJ B;  1PH7 A;  3IRB A;  1YJW A;  5GAE C;  1S5B D;  2RA4 A;  1HXY D;  3KDF A;  3BZK A;  4DV6 Q;  2K75 A;  3R93 A;  4K6D A;  1PTO D;  2B39 A;  4IPD A;  2KOL A;  5J22 A;  1B1Z A;  4KKS A;  2EYM A;  2A6H C;  1KD1 C;  2K52 A;  4OGQ C;  5IT9 c;  5CGK A;  1GHK A;  1Y1V H;  5FO8 B;  3S15 B;  1B9N A;  3J7Y W;  4R4Q A;  1SYD A;  2ZT9 C;  3QIA A;  2HHH L;  1CQF A;  1U4P A;  4DUY Q;  4L5T A;  2FFK B;  3FDT A;  3GV6 A;  3NXW A;  4TRD A;  3RNU A;  4HIK A;  3MWY W;  2O5I C;  3PO3 B;  1MSG A;  4S3S A;  5D3I B;  1BUV T;  1XX8 A;  4P73 A;  2AHO B;  2EYF A;  4X3T A;  2VB3 X;  3DEP A;  4P74 A;  2C35 B;  4OWT B;  1AFP A;  3BDO A;  2L55 A;  1LAC A;  4NPS A;  3I8Z A;  4AYB G;  4UP7 A;  1QNU A;  2JYO A;  1K8A C;  2QGQ A;  2ZTD A;  3S16 H;  4IFD I;  1N9W A;  5CR3 A;  1NBW A;  1W6J A;  3CME A;  2JEA I;  4J8Q A;  2LFN A;  2NZ1 D;  4LFA Q;  2JA6 H;  4KHP Q;  2LSS A;  4A3M G;  5G3L F;  1SMY D;  3PIO 3;  1SMY C;  1VQO A;  2WAQ G;  3CD6 A;  2BA0 A;  3A8I E;  2G9H D;  4OIK A;  5JOB A;  1LTL A;  3GD7 A;  3QOL A;  1A3T A;  1CT1 D;  1ZYR C;  3GTL B;  4C3H B;  4IPC A;  4LFB L;  4YY3 Q;  1K83 B;  1L1O B;  4HSV A;  2JA7 G;  2D9U A;  4JYA Q;  2CQO A;  3KOJ A;  3R2I A;  1D2B A;  1S5D D;  4A76 A;  3HKZ G;  1G6Z A;  4I7A A;  4FYD A;  2NN6 H;  4LAA A;  5ELO A;  2A6E C;  1FL0 A;  2Q2H A;  4QUC A;  1CKN B;  1N33 Q;  4GKJ L;  1E0B A;  2CW0 D;  2NZH A;  1P8L A;  1GHJ A;  2IJ0 A;  2K28 A;  2BDO A;  2CVR A;  4OHJ A;  1EIY B;  2AQ1 B;  3MVV A;  3NUC A;  1ET6 A;  3A5Z B;  1TS3 A;  4BXX G;  2R7F A;  3T1Y L;  3HOV H;  5E4X A;  3EVQ A;  5K5P A;  3F8T A;  4JW0 A;  2UUA L;  2ICI A;  4R4O A;  2JK8 A;  3BU2 A;  3K7A H;  3MC0 B;  4A3D B;  2F0I A;  2K04 A;  4DUY L;  1L0Y B;  2HQE A;  1A3U A;  3HOZ G;  2D62 A;  4GOP C;  3T56 B;  2K33 A;  2O4X A;  3NWT A;  5EPK A;  3TP8 A;  3U9S A;  1U5K A;  4NW2 A;  1EYA A;  4Q0F A;  1PYB A;  3EBE A;  3NP8 A;  2R93 G;  4HID A;  1IXR A;  4N8F A;  5ELD A;  1VQ9 A;  1OTC A;  3KBX A;  2BCO A;  1J6Q A;  3SE0 A;  4A3B B;  1KRS A;  5HGQ A;  1VQD A;  3DEO A;  3L0O A;  3VYT A;  4FF4 A;  3KFU A;  4A3B G;  2RVL A;  4JI3 Q;  3FEW X;  1TQO A;  2F3W A;  1E24 A;  2JA8 H;  3E0J A;  3J81 i;  1XNQ L;  1X54 A;  2Q8R E;  4ZRZ A;  1I5F A;  4RH6 A;  1KAA A;  3M4O B;  1TII D;  2E2J H;  2PI2 A;  3I4N G;  1XPR A;  2F0D A;  4YCU A;  3KF6 B;  1HH2 P;  1A2U A;  3A74 A;  4DR5 Q;  1I4X A;  3BYT B;  1UE1 A;  2ICE C;  2HCI A;  2OCE A;  1PH2 A;  2WB1 E;  5BR8 Q;  4DUZ L;  1DON A;  2JA8 B;  3H91 A;  3P1H A;  2UXC L;  2LXJ A;  1UWV A;  1TU2 B;  2NTS A;  3I4M G;  5C44 G;  4BBS B;  3JAM c;  3I4O A;  2EVB A;  4IN3 A;  4A4I A;  2DNC A;  1XJV A;  2B2W C;  4JBK A;  4V19 0;  1HA5 A;  5IGF A;  3GTQ B;  3NBI A;  1TKW B;  1ONL A;  1U4R A;  2EDG A;  1JWU D;  3HFZ B;  3SGI A;  1UEA B;  1B9M A;  5ISR A;  3A8K E;  4ZUI A;  4ME5 A;  4IUN A;  3ER0 A;  1LO5 D;  4X3K A;  3A8J E;  3TSS A;  4QGU A;  4DR4 L;  3T4A C;  1EU4 A;  5IP7 H;  1F9Q A;  1SJH D;  3CPW A;  4JBM A;  4BY7 H;  5E4W C;  2CQA A;  1QG7 A;  1Y8N B;  1B4O A;  3T53 B;  1JIC A;  2Y0S E;  3CF5 A;  2BH2 A;  4KI0 A;  1AZP A;  2E2J B;  1PYS B;  4AQY L;  2Z0S A;  3ERO A;  4JCV E;  4HAE A;  4A3C H;  2IPK D;  3GQB A;  4OO1 H;  2IL8 A;  4AQY Q;  4JV5 Q;  2QEX A;  2YV5 A;  5M9O A;  4DAV A;  2EJF C;  3CC7 A;  2QA4 A;  4A75 A;  4OO1 I;  4CDF C;  3PUX A;  4HSP A;  2F0F A;  4PMW A;  1JCK B;  3S2D H;  3OHX C;  4DA2 A;  1EL0 A;  5LMU L;  1K8O A;  5C4X H;  2R6G A;  4RA8 A;  2E5L Q;  1VQG A;  1AEX A;  4G4K A;  1PLF A;  3CCQ A;  2Y0S G;  3W1G A;  4K5W A;  5C44 H;  5EKK A;  1DGS A;  4IQZ A;  2B29 A;  4TSS A;  2L1B A;  1LT3 D;  4HCE A;  5J3B A;  1PTO F;  4ZQ3 A;  2TSS A;  2JN4 A;  1SYC A;  5C3E H;  4E6I A;  4UY8 C;  5FJ8 H;  5D3D A;  1DZ1 A;  5C5M A;  4A3F G;  1IYV A;  1I50 B;  3I70 A;  3PIP 3;  1STA A;  3GTG B;  1IBL Q;  3M4Y A;  4UP8 A;  5M3M H;  3NTH A;  1W3S A;  3F2D A;  3LNN A;  1FR3 A;  1GUW A;  3RD4 A;  2SDF A;  1XTC D;  1NSN S;  1VQ5 A;  4JPB W;  2Q8I B;  4XXE A;  3I3C A;  1F2L A;  2OF1 A;  4DV7 L;  1GVP A;  3Q8D A;  4OON A;  2LS0 1;  3PF4 A;  2FMM A;  2PYK A;  3GTO B;  1SR3 A;  1TWF H;  4JVZ A;  2K5H A;  4OEM B;  2HCC A;  3J81 E;  3KLR A;  1ILP A;  1EEI D;  1HQR D;  3DWA A;  1Q7Y C;  2FHT A;  1IL2 A;  3KF8 B;  3QWN A;  4EX5 A;  3Q24 A;  5FLM G;  3HOX B;  4HJ9 A;  1IW7 C;  1Y69 U;  1DM0 B;  3F1Z A;  3FP9 A;  3PO2 B;  1WI5 A;  3EN2 A;  1X3F A;  4CBV A;  1ENF A;  2VB2 X;  1XPO A;  3S17 H;  1Y8P B;  3EA6 A;  3HOV G;  4BXX H;  4JI4 Q;  3FKI G;  3L7Z C;  3ERS X;  3G7L A;  2UU9 Q;  1BNZ A;  3H3V I;  2IW3 A;  1FD7 D;  4K2K A;  5IGB A;  4JI5 L;  3T1H L;  1YNJ D;  2NTT A;  3QB3 A;  4H7B A;  4DAY A;  3AU7 A;  2KHI A;  4ZUJ A;  3IFT A;  4CJ2 C;  3J81 j;  1EY8 A;  5HUR A;  1VMP A;  1XMO L;  2A1A A;  3LX0 A;  1LTS D;  2V1C C;  2EZV A;  2BA1 A;  3PUW A;  3K5N A;  1I4R A;  4IUT A;  4KY5 A;  4L8J A;  2G9D A;  1HNX L;  1QZG A;  1N36 Q;  2F0J A;  1B8A A;  1FNU A;  4XT1 B;  3U4V A;  1GOZ A;  1GD7 A;  3MZ5 A;  2NVX H;  3KYH C;  4I65 A;  3H6M A;  4K2L A;  1J9O A;  4DV2 Q;  2WII B;  1TWG H;  1GUN A;  2XRS D;  2I46 A;  1OXT A;  3J7A 5;  3GTL H;  2K6A A;  3HOW H;  4RGM A;  3V2T A;  4PZ6 A;  1RKN A;  1FGU A;  1SNC A;  2F0L A;  3OPO A;  1QVG A;  3CKI B;  4FNF A;  4IFD G;  1JOK A;  2VY3 A;  3J80 c;  4ULL A;  3B6Y A;  3BG3 A;  1HPC A;  1SFO B;  4RFB A;  1PV4 A;  1Z47 A;  3M4P A;  4DV1 L;  4FXK C;  2CFM A;  3KBG A;  4XTC S;  1EY5 A;  2OTJ A;  1SYE A;  1SJE D;  3SR1 A;  5AFW A;  1C9O A;  1O80 A;  2A68 C;  4KJO A;  4C2M B;  3S9W A;  5E7N A;  4JI4 L;  5DM7 3;  4OWW B;  2WKD A;  5IP9 H;  1EWI A;  1M8A A;  4HR7 B;  4G7Z C;  4X64 Q;  1TWH H;  1X3E A;  2GVA A;  3I7F A;  2J0T D;  2Q2T A;  2MGS A;  1H9J A;  3EJI A;  1YNX A;  4DV7 Q;  1KNA A;  4UDU C;  2VXW A;  4A3L G;  3M9B A;  2K1B A;  3S1N H;  4DR7 Q;  1KLG D;  3K81 C;  1HZA A;  2Z8L A;  2N3S A;  4GS3 A;  2PW5 A;  3K7U C;  1NNX A;  3F2U A;  4ZK9 B;  3K5L A;  3S1Q B;  1VQE A;  4K5X A;  2B8F A;  1CKO A;  1MHW C;  1X56 A;  2D0P A;  2YU9 H;  5AJ3 L;  1CUK A;  5K36 H;  2KCM A;  1EIH A;  1PH9 A;  3R8B A;  2A73 B;  1G29 1;  3LWE A;  4CDC C;  3HOY H;  4RCN A;  2KA7 A;  5FO7 B;  2KUM A;  1GUT A;  5CV9 A;  1CTM A;  2R93 H;  2NVQ B;  4IJL A;  2TMP A;  2WAC A;  4A3E G;  2WV6 D;  4JG2 A;  1PH6 A;  3PO2 H;  4HJ8 A;  5CC4 A;  3DM1 A;  4AH6 A;  3ONA B;  1N36 L;  3PO3 H;  2JQO A;  5EKI A;  1LAB A;  1JWM D;  3P20 A;  3X3M A;  3MXN A;  2VUM G;  4DV2 L;  4JI7 Q;  4CJ0 B;  2F0H A;  4P75 A;  3HOY G;  4B08 A;  5BN4 A;  4BA2 I;  1NUC A;  3IFD A;  1K73 C;  1K0R A;  1V1P B;  1KNE A;  5J39 A;  2N55 A;  1KAW A;  1NJI C;  1EOT A;  4LF7 Q;  4MHE A;  3S1N B;  1Y14 B;  3AYH B;  1X65 A;  3CCR A;  4XYQ A;  2EPB A;  5M3F B;  4BY1 B;  3CQZ B;  4KN7 C;  1Y1V B;  1TS4 A;  2JXM B;  3CRK C;  3S15 H;  1EY9 A;  2UUB L;  4B3R Q;  2JA9 A;  1T5X D;  1AZQ A;  2K32 A;  5ELC A;  2BE5 C;  1HCZ A;  1SBB B;  3S2H H;  4FF3 A;  3ZJY C;  3MTS A;  3A5U A;  3G48 A;  5FJ8 G;  2KQ3 A;  2L15 A;  1VQM A;  4JBW A;  1X6O A;  3GDE A;  3ND9 A;  2H5X A;  1I94 Q;  2ALY B;  4X66 L;  3GTJ H;  1ESF A;  1I3Q B;  1LUZ A;  1G91 A;  2NN6 I;  4BBR B;  3E5S A;  4FF2 A;  4MNO A;  1GUG A;  1TXY A;  1KDA A;  4CKB A;  5GRO A;  1BF4 A;  1STE A;  4PMB A;  1CM9 A;  2AUJ D;  1GUO A;  3UDF A;  1IYJ B;  4IFD H;  2OEO A;  3NQT A;  2KEN A;  1JOR A;  2ZJR A;  4N9P A;  2AQ2 B;  4F7X A;  1BBU A;  1D7Q A;  1HTL D;  4K5V A;  1M4V A;  3NSW A;  4N8X 1;  2FXQ A;  4DR1 L;  4DUZ Q;  4GOP A;  4HMJ A;  1GM5 A;  1JT8 A;  1FVI A;  5KRU A;  1H9K A;  1OXU A;  1I6V C;  3U4Z A;  3MEF A;  2WB1 G;  3N6R A;  1BCP D;  4JI8 L;  1O7Y A;  2WB1 B;  1K8M A;  4EQ5 A;  4Z9C B;  2JA7 B;  2EXD A;  2DGY A;  4DKA C;  4LUO A;  1HNZ L;  2E74 C;  4B3T Q;  2X6L A;  2K5Q A;  4RHR A;  2B8G A;  1CZW A;  1SE2 A;  4GNX B;  1IBL L;  3NEM A;  4C1N I;  3J7Z C;  1H9R A;  2XWB B;  2IX0 A;  3UDX A;  3SK6 A;  5C3X A;  1VQI A;  1CZG A;  2I0Q A;  1A63 A;  1IKM A;  3SK5 A;  2HIV A;  3VR5 A;  1EWH A;  1YHA A;  3HKS A;  2XRQ D;  5T1I A;  1X3P A;  5IGC A;  1EQT A;  3I2Z A;  2PZT A;  1H95 A;  3TS0 A;  3TZU A;  3TME A;  1I94 L;  1ROD A;  1N34 L;  1E1O A;  2XWJ B;  2RSO A;  4JV5 L;  3CP0 A;  3STB C;  2WIN B;  5KGU A;  1PRT C;  4NXN Q;  4HIM A;  1I3Q H;  1I4P A;  3KF6 A;  1HRJ A;  4JYA L;  1U9R A;  3BDL A;  1HHV A;  4A3I G;  5CV7 A;  3U50 C;  5D65 A;  3HGB A;  4A3I B;  1G8Z D;  3PUZ A;  4AYB E;  1TWG B;  4YHH Q;  1N33 L;  3UDI A;  2NVX B;  2RSN A;  3PIO A;  5ELF A;  2C9O A;  4LFC L;  1XMO Q;  1VQB A;  2UUC L;  4X66 Q;  3TZD A;  2F0M A;  4A3B H;  1CKN A;  1GO3 E;  5G3L D;  4F8M A;  1O78 A;  1WTW A;  4OX9 Q;  1D1K A;  5IWA L;  1PRT F;  4DPG A;  3T1H Q;  2LMC B;  1VQP A;  3KF8 A;  4BY1 H;  4GKJ Q;  4JOI A;  1EY6 A;  1Q3L A;  1C48 A;  3TBI B;  1S72 A;  3K5M A;  2XN9 C;  4XQN A;  2VQE L;  5M5W B;  2IX1 A;  2SNM A;  1VF7 A;  5FOB B;  5C44 B;  1SNO A;  4X62 L;  4BBS G;  4R8I A;  4HJ7 A;  3NE5 B;  1II3 A;  3DLL A;  3MXP A;  1LYL A;  2AMC B;  1IBM Q;  1WTH A;  1MD2 D;  3E9H A;  1KDB A;  1EYG A;  2R7D A;  1JB7 A;  2UUC Q;  3WWV A;  3K57 A;  4LFC Q;  3H0G B;  1TWA B;  2K05 A;  4DK0 A;  1XMQ L;  4DR2 Q;  2ZXR A;  4MIU A;  4CKE A;  1G2T A;  1EIF A;  3D6C A;  2QDL A;  1YNN D;  1MGS A;  1UE5 A;  4YWM A;  3NK9 A;  4AIM A;  2KCC A;  2PMZ B;  3CMA A;  4IAL A;  2Y0S B;  1E1T A;  1E22 A;  3KLS A;  3HOZ B;  4DV5 Q;  3C2P A;  3I72 A;  1I6H H;  4BBS H;  4TQU S;  3S17 B;  4KJN A;  3A55 A;  5GAD C;  3S2H B;  3D4R A;  2YTV A;  1QIL A;  5C0X I;  4DR6 L;  1SN8 A;  3CAM A;  3S1R H;  5F2D A;  3TP6 A;  3AMU A;  4RHS A;  4KKU A;  1J5E Q;  1L1O C;  1NTG A;  2K14 A;  4RKB A;  1G51 A;  1N34 Q;  1AP0 A;  3O13 A;  5LL6 X;  3SVM A;  2CWP A;  4A3G G;  4R4T A;  2NYZ D;  2R61 A;  4PV1 C;  1TS2 A;  1YJN A;  3PQI A;  3OMG A;  3OW7 A;  1VQA A;  4YWL A;  1HUN A;  5CV8 A;  4L5Q A;  5C3W A;  4DR6 Q;  5E3F A;  3VR2 A;  5I2X A;  1JOQ A;  5C6A A;  4PZ8 A;  1RHP A;  3FPP A;  2NVT B;  3BVM A;  1VQF A;  2PNR C;  2F3I A;  5COR A;  1QUQ B;  2KEC A;  3BZC A;  4C56 C;  5I4D A;  5IE8 A;  1IKL A;  3F2C A;  1STY A;  1X9N A;  1UE6 A;  5M5Y B;  1QVC A;  4EVO A;  2OT2 A;  2MFI A;  4L63 B;  2R92 H;  2EOT A;  1U0L A;  4O2D A;  4IUV A;  4ZCK A;  4QIW E;  2Z4I A;  5EPJ A;  4DV5 L;  3D4D A;  1WJJ A;  1Z9F A;  4DV6 L;  5EJW A;  1BCP C;  2MUY A;  1YJ9 A;  2F4I A;  2KBN A;  3FKI B;  2E2H B;  5A2Q L;  1DOM A;  4C3J H;  3WOE A;  2DNE A;  3NWS A;  3S1Q H;  1WOC A;  2EE1 A;  2GN5 A;  3D3R A;  2N49 A;  1EZ6 A;  3RN5 A;  3MFG A;  1PZJ D;  1KDC A;  2R92 G;  2VNU D;  3FRP B;  2NVQ H;  1M1K C;  1TVX A;  5EKL A;  2EY2 A;  4V0B A;  4QUF A;  4ILW A;  1UUP A;  2K01 A;  3CCV A;  4P2C B;  1G6P A;  1WTQ A;  3I4N H;  1RCV D;  4DR2 L;  4DN4 M;  4IJH A;  4DV4 Q;  3RR5 A;  3BDC A;  1R9T H;  4PMC A;  3TQY A;  3V96 A;  4LFA L;  3CQZ H;  4OX9 L;  5HY6 A;  1RIP A;  1E7Z A;  2KVM A;  1WTP A;  4OIJ A;  1IHZ A;  2HD3 A;  4G57 A;  2DJF C;  4NXN L;  1QB5 D;  2F0G A;  4YHH L;  3HOV B;  3CW2 C;  1ESR A;  4LF8 L;  1CHQ D;  1Q8K A;  3A56 A;  4IUP A;  5IT9 L;  3EIV A;  2UUB Q;  3HOU H;  5M3M B;  3GTK H;  4A3J B;  1D6E C;  2EYJ A;  3S2D B;  4DK3 C;  1XYI A;  4GZY C;  1EUJ A;  5FO9 B;  1YZ6 A;  1I6H B;  4HED A;  3GTP B;  2CWA A;  2F3V A;  3KK7 A;  1DOL A;  4DNI A;  4BA1 I;  1YHQ A;  1E2Z A;  2F52 A;  1STN A;  5IYB H;  1HZ9 A;  2OWO A;  2EIF A;  2KHJ A;  1K83 H;  2L0C A;  3DM3 A;  5M5X H;  1SFO H;  1Q1E A;  3E0E A;  1D8L A;  3L3O C;  4O42 A;  1HJP A;  2D2C C;  1MKH A;  1V9P A;  3MA2 B;  3G4S A;  4IUQ A;  4HN7 A;  2R7Z H;  1SE4 A;  4UHV A;  1PMR A;  2JEB I;  4P71 A;  5M5W H;  3STB D;  2JJQ A;  1JJC B;  2EYL A;  2AQ3 B;  1WD0 A;  2MNA A;  3OTO L;  1NY4 A;  2VZA A;  2UXD Q;  3I55 A;  4JI8 Q;  2F0O A;  2CW0 C;  3URY A;  3OIP A;  1S3O A;  4B3S L;  2CH4 A;  2A74 C;  3GTQ H;  2B2U C;  1PH8 A;  4OL7 A;  2NBF A;  3J80 L;  3OWE B; 
#chains in the Genus database with same CATH homology
 2ATW A;  3CXC A;  4A3E H;  4C2M H;  1YBY A;  1YNX A;  4DV7 Q;  1XPU A;  2E5L L;  2MO1 A;  2NZO A;  1SMX A;  3M9B A;  4A3L G;  2XTI A;  2RHS B;  3NEL A;  3PF5 A;  1SRO A;  4RG1 A;  4HJ5 A;  1OXV A;  4LF4 Q;  3PO2 G;  3K80 C;  1WYD A;  1YIT A;  2JE6 I;  3S1N H;  4DK6 C;  4DR7 Q;  3K81 C;  3S1M H;  1HZA A;  3J81 c;  1IZ6 A;  5GQO A;  3T1Y Q;  2N3S A;  3PGZ A;  4GS3 A;  2K5N A;  2YTX A;  5BR8 L;  3K7U C;  1JE5 A;  1VQE A;  3AQQ A;  3PCO B;  4B3S Q;  1YEZ A;  1CKO A;  1X56 A;  2D0P A;  4DR1 Q;  2YU9 H;  5IYD G;  1CUK A;  5AJ3 L;  1HR0 W;  3CPF A;  3W1B A;  2RF4 A;  2KCM A;  5C3E G;  1PH7 A;  1PH9 A;  2VL6 A;  3GO5 A;  4R4I A;  3IRB A;  3OW2 A;  3M3Y H;  1YJW A;  2UXB L;  5GAE C;  1G29 1;  2UXC Q;  3HOY H;  4UPA A;  2CCZ A;  1WCM H;  3KDF A;  3BZK A;  5IWA Q;  4DV6 Q;  2K75 A;  3D31 A;  3PUY A;  3L2P A;  3PUV A;  4IPD A;  5H1S E;  2R93 H;  4IJL A;  3PO3 G;  4IOC A;  4YWK A;  4A3E G;  1FJG L;  5FLX c;  4JG2 A;  1PH6 A;  2OTL A;  1KD1 C;  4LW1 A;  3PO2 H;  2K52 A;  5JJI A;  4HJ8 A;  2UXD L;  4MTN A;  4AH6 A;  5IT9 c;  1N36 L;  2K5V A;  1Y1V G;  3PO3 H;  2JQO A;  1ASZ A;  1Y1V H;  3S24 A;  1MJC A;  3CCM A;  1BKB A;  4H02 A;  4B3M L;  2JA6 G;  4R4Q A;  2VUM G;  4DV2 L;  4JI7 Q;  4IOA A;  4P75 A;  1VQL A;  3HOY G;  2HHH L;  4BA2 I;  1K73 C;  4LF6 Q;  1K0R A;  4L5T A;  4DUY Q;  1L2F A;  1KAW A;  1NJI C;  3I56 A;  4LF7 Q;  3GTM H;  1Y14 B;  3AYH B;  3ULP A;  1X65 A;  4GKK L;  4P72 A;  2F4V L;  3CCR A;  3FHW A;  4K0K Q;  3RNU A;  4DR3 L;  4HIK A;  3S15 H;  1T9H A;  2UUB L;  3S14 H;  4B3R Q;  2JA9 A;  4LF9 Q;  1KC8 C;  4P73 A;  2AHO B;  2ZM6 Q;  1NMF A;  5K36 G;  4P74 A;  2WP8 J;  2B63 G;  2C35 B;  5IP7 G;  2XGT A;  4ME3 A;  4OWT B;  3ULJ A;  2ZJQ A;  3S2H H;  1A8V A;  3CC2 A;  4NPS A;  3TRZ A;  4AYB G;  4BBR G;  1OXX K;  2I5M X;  4UP7 A;  3ZJY C;  1VQK A;  1EQR A;  4YCV A;  1FJG Q;  2CKZ B;  1K8A C;  4JI0 L;  4X6A H;  2QGQ A;  2ZTD A;  3A5U A;  3G48 A;  5FJ8 G;  3S16 H;  4IFD I;  1N9W A;  4C3H H;  1NBW A;  2L15 A;  1A62 A;  4JBW A;  1VQM A;  1BBW A;  3CME A;  2JA8 G;  4JC0 A;  5FLM H;  2JEA I;  1NMG A;  1X6O A;  3GDE A;  4HIO A;  3J80 i;  2H5X A;  1YHB A;  4LFA Q;  2AKW B;  4C3I H;  1I94 Q;  2LSS A;  1JMC A;  5JEA J;  4A3M G;  2JA6 H;  4KHP Q;  4A93 G;  4GN3 B;  1Y1W H;  2Z6K A;  2ALY B;  4X66 L;  3GTJ H;  1Y1W G;  4QY7 A;  1J5E L;  3UE1 A;  1VQO A;  4A3G H;  2KCT A;  2WAQ G;  3CD6 A;  1XMQ Q;  1EFW A;  3G71 A;  2VUM H;  2BA0 A;  2D0O A;  2LXK A;  1LUZ A;  2NN6 I;  1YIJ A;  4KLK A;  3RLO A;  3MXN B;  1HZC A;  1LTL A;  3GD7 A;  1MJE A;  4JI2 Q;  4MNO A;  1VQJ A;  3PIP A;  1TXY A;  4IPC A;  4LFB L;  4YY3 Q;  1Q1B A;  1L1O B;  5GRO A;  3CCE A;  4A3D G;  1XNR L;  4POF A;  2JA7 G;  1RL2 A;  4JYA Q;  2CQO A;  2I5L X;  3KOJ A;  5LMN W;  5M5Y H;  4GNX A;  1QZH A;  1K9M C;  4YCW A;  4IFD J;  4A76 A;  3HKZ G;  3UDF A;  1IYJ B;  3KLW A;  4DR7 L;  2IY5 B;  5ELO A;  1CSQ A;  2KEN A;  2ZJR A;  1WCM G;  1FL0 A;  2Q2H A;  1CKN B;  1KHI A;  1N33 Q;  4GKJ L;  1BBU A;  3RLF A;  1D7Q A;  4RMF A;  1XNQ Q;  5GAG C;  4JI1 Q;  2OQ0 A;  2NZH A;  1P8L A;  2FXQ A;  3CCJ A;  4DR1 L;  4DUZ Q;  4OO1 G;  1EIY B;  4GOP A;  4GOP B;  1GM5 A;  5C0X G;  1JT8 A;  5IY0 A;  1FVI A;  4X64 L;  3KDF B;  1OXU A;  3A5Z B;  4J15 A;  3RZD H;  3U4Z A;  2R7F A;  3MEF A;  1PH3 A;  2WB1 G;  3T1Y L;  4BXX G;  3HOV H;  4K0K L;  2YYZ A;  2VQE Q;  3H15 A;  4JI8 L;  3F8T A;  2JA5 G;  2UUA L;  4R4O A;  4ALP A;  4EQ5 A;  2JK8 A;  3A0J A;  3BU2 A;  3K7A H;  4R4C A;  5M3F G;  2EXD A;  4DUY L;  2DGY A;  2DUD A;  1E3P A;  4DKA C;  2BH8 A;  4LUO A;  4GLX A;  1HNZ L;  4B3T Q;  3HOZ G;  1IBL L;  2D62 A;  4GNX B;  2RCN A;  3NEM A;  4A3J G;  3J7Z C;  4GOP C;  4B3M Q;  2E2I H;  3F2B A;  2IX0 A;  1U5K A;  4KHZ A;  3UDX A;  1VQI A;  1VQH A;  2AWO A;  1PYB A;  4JBJ A;  3EBE A;  2I0Q A;  2A19 A;  1A63 A;  2R93 G;  4HID A;  5C4X G;  2HIV A;  1IXR A;  1YHA A;  4JI6 L;  3GTO H;  5JEA G;  3HKS A;  3U58 A;  1OTC A;  1VQ9 A;  1J6Q A;  1C0A A;  1V43 A;  1KRS A;  2Q2U A;  5HGQ A;  2VQF Q;  1VQD A;  3L0O A;  3HOZ H;  2B3G A;  3CCL A;  3I2Z A;  3KFU A;  4A3B G;  1N32 L;  1X3G A;  2AWN A;  3TS0 A;  4JI3 Q;  1H95 A;  1AH9 A;  3TS2 A;  1I94 L;  4KHP L;  1N34 L;  1E1O A;  3JAM i;  4X65 L;  1E24 A;  2JA8 H;  3J81 i;  1XNQ L;  4JV5 L;  1X54 A;  5ELN A;  1I5F A;  2NVY H;  3CP0 A;  3STB C;  2WAQ E;  1W2B A;  1N8R C;  4NXN Q;  4HIM A;  2MO0 A;  2E2J H;  2PI2 A;  3D0F A;  1I3Q H;  4TVA B;  1XPR A;  1S40 A;  3I4N G;  4YCU A;  3KF6 B;  1HH2 P;  3KF6 A;  1NE3 A;  3A74 A;  5AJ3 Q;  4PG3 A;  4DR5 Q;  4JYA L;  2N8N A;  4NB3 A;  2HHH Q;  1UE1 A;  2JA7 H;  2OCE A;  5EAY A;  4A3I G;  1Q12 A;  1Q86 C;  1PH2 A;  4JI7 L;  2WB1 E;  5BR8 Q;  3U50 C;  4DUZ L;  4LWC A;  2UXC L;  2LXJ A;  1UWV A;  4AYB E;  3PUZ A;  4YHH Q;  4QJF A;  1N33 L;  3I4M G;  5C44 G;  4GLA C;  3UDI A;  3JAM c;  4DV4 L;  2PI2 E;  3I4O A;  4LF4 L;  4L5R C;  3PIO A;  4OXP A;  4POG A;  4A4I A;  2IT1 A;  4A3K H;  2Q2I A;  4R1J A;  4LFC L;  1VQB A;  1XMO Q;  2GVB A;  4FDB A;  4X66 Q;  1HR0 Q;  2UUC L;  4LF7 L;  3GTP H;  1XJV A;  4JBK A;  4A3B H;  3LGJ A;  1CKN A;  1KRT A;  1GO3 E;  1HNW L;  4OX9 Q;  3KJP A;  1VQC A;  5IWA L;  2NVT H;  4DPG A;  3HFZ B;  3SGI A;  3T1H Q;  1PA6 A;  3RN2 A;  1VQP A;  2Z6K C;  4APV A;  4BY1 H;  3ER0 A;  4GKJ Q;  4JOI A;  1YVC A;  1L0W A;  4A3K G;  5M3F H;  4QGU A;  1S72 A;  4PZ7 A;  4DR4 L;  3E9I A;  4LUZ A;  5IYC H;  1AE2 A;  2WFW A;  1Q82 C;  4NXM Q;  5DLQ E;  2PNH A;  1TWC H;  5IP7 H;  5GAH C;  2VQE L;  2IX1 A;  4IPH A;  3CPW A;  1IBM L;  4X62 L;  4JBM A;  4BY7 H;  5LMN Q;  1K8G A;  4BBS G;  4HJ7 A;  3DLL A;  1LYL A;  2AMC B;  2Y0S E;  3CF5 A;  4DR5 L;  1IBM Q;  3E9H A;  1BVS A;  4KI0 A;  4DR3 Q;  1QVF A;  2B63 H;  2BH2 A;  1EYG A;  2R7D A;  1PYS B;  2ZTC A;  3CCU A;  1JB7 A;  2UUC Q;  3WWV A;  4LFC Q;  4AQY L;  1I6H H;  2Z0S A;  4JCV E;  4A3C G;  1XMQ L;  4DR2 Q;  1A0I A;  1K3R A;  4A3C H;  3HOX G;  2ZJP A;  2IHE A;  4AQY Q;  1CKM A;  2HIX A;  1EIF A;  3VDY A;  5IYD H;  3HOW G;  1L1O A;  4JV5 Q;  1UE5 A;  4YWM A;  4AIM A;  2YV5 A;  2QEX A;  3CMA A;  5IYB G;  3CC7 A;  4LUV A;  1E1T A;  1E22 A;  2QA4 A;  4DV5 Q;  2NN6 G;  4A75 A;  1CSP A;  4UP9 A;  4TQU S;  4BBS H;  4X62 Q;  4LFB Q;  4OWX B;  4OO1 I;  4A3L H;  3PUX A;  5GAD C;  4DV3 Q;  4PMW A;  2YTV A;  5C0X I;  4DR6 L;  2F4V Q;  3S2D H;  1KL9 A;  1SN8 A;  1PH5 A;  3H0G H;  3CAM A;  3S1R H;  3UDG A;  2HQL A;  5LMU L;  1PHJ A;  3OYY A;  5C4X H;  2R6G A;  1I50 H;  1J5E Q;  2E5L Q;  1L1O C;  2PMZ E;  1NTG A;  1QUQ A;  1VQG A;  2K14 A;  3M85 A;  1G51 A;  4A3M H;  4LNQ A;  3H0G G;  1N34 Q;  2E2H H;  3CCQ A;  2Y0S G;  3W1G A;  1PH4 A;  2JA5 H;  1YI2 A;  4A3G G;  2CWP A;  1Q46 A;  3TEH B;  4R4T A;  5C44 H;  4JI3 L;  4LF8 Q;  1DGS A;  1O7I A;  2B29 A;  4DV0 Q;  4Y52 H;  1YJN A;  4A93 H;  5J3B A;  3PSI A;  3RZO H;  1VQA A;  3ICE A;  4YWL A;  4L5Q A;  4DR6 Q;  5C3E H;  1ASY A;  4UY8 C;  5FJ8 H;  4A3F G;  5C0X J;  2RHQ B;  3ULL A;  3M4Q A;  4WJ4 A;  4PZ8 A;  4MZ9 A;  1VS0 A;  3H3V H;  1VQF A;  1IBL Q;  2F3I A;  4GLV B;  4UP8 A;  5M3M H;  1QUQ B;  4A3F H;  1W3S A;  3BZC A;  5M3M G;  3F2D A;  1UE7 A;  5IE8 A;  2VQF L;  4L5S A;  4XIG S;  3F2C A;  4DR4 Q;  1X9N A;  5JJK A;  1VQ5 A;  1UE6 A;  1JJG A;  1QVC A;  2MFI A;  2R92 H;  4GN4 B;  2VW9 A;  5C4J H;  4GNX C;  4DV7 L;  1GVP A;  1U0L A;  4O2D A;  3G6E A;  2YTY A;  2PQA A;  4QIW E;  3Q8D A;  4OON A;  1PVO A;  2N78 A;  3PF4 A;  4DV5 L;  4DAM A;  1SR3 A;  1TWF H;  1WJJ A;  1Z9F A;  4DV6 L;  2ES2 A;  1VQ6 A;  4YY3 L;  1IBK L;  2K5H A;  4JI5 Q;  1YJ9 A;  2KBN A;  3HOU G;  4C3J H;  1EOV A;  1Q7Y C;  1IL2 A;  3KF8 B;  3JC6 6;  4EX5 A;  3TRE A;  5FLM G;  3S1Q H;  1WOC A;  4HJ9 A;  2GN5 A;  1VQ4 A;  2N49 A;  3M4O H;  3F1Z A;  3RN5 A;  3OTO Q;  3FP9 A;  3NEN A;  2ID0 A;  2R92 G;  2VNU D;  1WI5 A;  3EN2 A;  1X3F A;  1XNR Q;  2NVQ H;  2E8G A;  1XPO A;  1M1K C;  3S17 H;  4IPG A;  1AE3 A;  3HOV G;  4JI0 Q;  1V1Q A;  4BXX H;  3AEV A;  3BJU A;  4JOI C;  1EQQ A;  4JI4 Q;  3FKI G;  3HKZ E;  3ERS X;  3L7Z C;  4Y7N H;  2UU9 Q;  3CCV A;  1PH1 A;  1G6P A;  3I4N H;  1SLJ A;  4DR2 L;  3H3V I;  1SRU A;  4IJH A;  4DV4 Q;  1GKH A;  3RR5 A;  4GN5 A;  1R9T H;  3TQY A;  4JI5 L;  3T1H L;  2EQS A;  4LFA L;  4LF9 L;  3CQZ H;  4OX9 L;  4DAY B;  5HY6 A;  1RIP A;  2MQH A;  2KHI A;  3J81 j;  1E7Z A;  1PFS A;  2PQA B;  1MIU A;  1B7Y B;  1HZB A;  1XMO L;  1HR0 L;  4NXM L;  1VCI A;  2A1A A;  2OQK A;  4HJA A;  2V1C C;  2ASB A;  4A3D H;  4GKK Q;  4NXN L;  4BY7 G;  2ZTE A;  2HT1 A;  2UU9 L;  4DV0 L;  2BA1 A;  4LF6 L;  4YHH L;  3PUW A;  3CW2 C;  4LF8 L;  2IHF A;  1Q8K A;  4LF5 L;  2ZM6 L;  5IYC G;  3AFP A;  3K8A A;  3EIV A;  5JJL A;  2UUB Q;  4QQB X;  1HNZ Q;  1VQ8 A;  4B3T L;  1HNX L;  3HOU H;  5IP9 G;  3GTK H;  1QZG A;  1N36 Q;  2K4K A;  4JI2 L;  3GTG H;  5LMU Q;  3K0X A;  1LM0 A;  4DK3 C;  1XTD A;  1B8A A;  1EUJ A;  3J7A 5;  4WJ3 M;  1YZ6 A;  2UUA Q;  3U4V A;  1VQN A;  3M7N A;  2CWA A;  2A8V A;  1GD7 A;  4DNI A;  1OXS C;  3I4M H;  2K50 A;  4BA1 I;  3KYH C;  1YHQ A;  2NVX H;  4X65 Q;  2F52 A;  4DV2 Q;  4DV1 Q;  1TWG H;  5IYB H;  4A3I H;  1HZ9 A;  1OXT A;  2I5H A;  2EIF A;  2KHJ A;  1K83 H;  3DM3 A;  4JI1 L;  5M5X H;  2OWO A;  4LF5 Q;  3GTL H;  3HOW H;  4B3R L;  1TWA H;  4QL5 A;  4PZ6 A;  1Q1E A;  3E0E A;  1SFO H;  1KIX A;  1FGU A;  5LMN L;  1Q81 C;  1D8L A;  3HOX H;  1C7Y A;  4IO9 A;  4BBR H;  1QVG A;  4IFD G;  1HJP A;  2VY3 A;  1MKH A;  3FKI H;  1V9P A;  3G4S A;  3J80 c;  2R7Z G;  3CC4 A;  3B6Y A;  2R7Z H;  1HNX Q;  1KXL A;  1P16 A;  2JEB I;  4O0A A;  1UEB A;  1X55 A;  2VS1 A;  4P71 A;  5M5W H;  3STB D;  2JJQ A;  1JJC B;  1Z47 A;  3M4P A;  3KJO A;  4DV1 L;  1PV4 A;  2CFM A;  1JJ2 A;  3RLN A;  2MNA A;  3OTO L;  3AFQ A;  3NBH B;  4XTC S;  1N32 Q;  2OTJ A;  2UXB Q;  1NY4 A;  2VZA A;  3CCS A;  2UXD Q;  1VQ7 A;  1C9O A;  3I55 A;  4JI8 Q;  3W5O A;  4JI6 Q;  5E7N A;  4JI4 L;  4BY1 G;  4OWW B;  1SE8 A;  4DV3 L;  5IP9 H;  1EWI A;  3PV0 A;  1WFQ A;  1KQS A;  1S3O A;  1B70 B;  1IBK Q;  4X64 Q;  4B3S L;  3UE0 A;  1TWH H;  3GTQ H;  1PH8 A;  1X3E A;  2GVA A;  4A3J H;  1HNW Q;  3I7F A;  1M90 C;  2Q2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...