1PYBA

Crystal structure of aquifex aeolicus trbp111: a structure-specific trna binding protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
107
structure length
107
Chain Sequence
b'ALIGIEDFLKVDLRVAKVLSAERVEGSEKLLKLTLSLGDEERTVVAGIAKYYTPEELVGKKIVIVANLKPRKIFGIESQGMILAASDGENLSVIVPDRDVKEGAKLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA-binding protein Trbp111
publication title Crystal Structure of Trbp111: a Strcuture-Specific tRNA-Binding Protein
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Rna binding protein
total genus 14
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1pybA00
3JC66 2K75A 5JEAG 2ZTCA 2JEAI 2K50A 4BBSG 4GOPA 4BXXH 2PI2E 1VQ8A 4FDBA 4YY3Q 4RMFA 3E9HA 1S72A 3FKIH 1P16A 2DGYA 4LF9Q 2BH2A 1AH9A 1NE3A 2XTIA 3U50C 3GTOH 2N8NA 1QVFA 4X65Q 3U58A 1IBML 1XMQL 1WI5A 4JI6L 2NVTH 4KHPL 2UU9Q 1XMOQ 4LUOA 4YWMA 3CP0A 1SE8A 2RHQB 2UXCQ 3J7A5 4GN5A 1N36L 4DR6L 4JI7Q 2AWOA 2VW9A 4DV0L 4NXNQ 1SRUA 3MEFA 2E5LQ 4L5QA 2PQAA 4JBKA 4LFBQ 3CCEA 2L15A 4A75A 3M9BA 1K83H 3E0EA 4BY7H 4O0AA 3J81c 4JI5L 2VQFQ 1GO3E 3PF5A 1KAWA 2R7DA 3K80C 4A3EH 3F8TA 1B7YB 1PH4A 3CCVA 1JT8A 2D0PA 4LFAQ 2JA7G 1YI2A 4GKJQ 2KHIA 3CQZH 3S2HH 3J81j 1DGSA 2I0QA 5IYCG 4YCWA 4LF5Q 4BY1H 1A8VA 4JYAQ 4IOCA 5LMUQ 2IT1A 3I7FA 4L5SA 4J15A 4DV5Q 5GADC 1PH8A 2HHHL 3TS0A 3PUVA 3W1GA 4DV6L 4A3GH 3KYHC 5IP7G 2ZJQA 4IOAA 1YBYA 3CAMA 4IPHA 2F52A 1HNWQ 3HOWH 4JI8L 4IFDG 4O2DA 4UPAA 3CCSA 2MO1A 4HJ8A 2UU9L 4QGUA 2EQSA 5HY6A 3HOYH 3D0FA 2PQAB 4IJLA 1L1OC 1OXTA 1JJ2A 4NXNL 1QUQB 2KENA 1WFQA 5LMNQ 2E5LL 4LFBL 3OW2A 4B3RL 1VQMA 5IE8A 4OWWB 5IYBH 2RF4A 1B70B 1OXSC 3AFQA 3K7UC 2HQLA 5C4XH 1SN8A 5JJIA 3GTGH 2UXBQ 3OYYA 3T1YQ 4ME3A 2CCZA 2Q2HA 1JJGA 1PHJA 2JA8H 1HH2P 2F4VL 3KJOA 2ZM6Q 4YHHL 2C35B 2CFMA 2EIFA 2WAQG 3L7ZC 1PH5A 3DM3A 1XNRQ 4OO1I 4A3KH 4LF5L 4A93G 3TRZA 3J80i 5LMUL 1K73C 2HIVA 2B63H 2YYZA 5M3FH 2E8GA 2WB1E 3AEVA 1CUKA 3HOXH 4PG3A 4LNQA 3ERSX 3VDYA 4LF7Q 1XJVA 1H95A 4A3IG 4A3BG 4LF8Q 3HOUH 1Y1WG 1UE7A 3H0GH 4DR5Q 1R9TH 2JK8A 3A5UA 3TQYA 1VQAA 3NENA 1UE1A 4NXML 3H15A 2IHEA 2I5LX 5LMNL 2ES2A 2MNAA 2OTLA 1FJGL 3S15H 2WB1G 1EQRA 5ELOA 4DK3C 5FJ8G 5IYDG 4JI0L 5C44H 2BH8A 1PH2A 2CQOA 2JEBI 3W1BA 2UXBL 3FHWA 3T1YL 5FLMG 1YJ9A 3G48A 4IPGA 1E22A 4L5TA 1X9NA 1HNZQ 1QVGA 4P73A 4DV7L 1K3RA 4DK6C 1YZ6A 3RLFA 1X3FA 3AFPA 3JAMc 4X62L 4HIDA 1IBMQ 3EBEA 3L0OA 2YTYA 2GN5A 2RCNA 2AKWB 5M5XH 1TXYA 3CMAA 1XMQQ 4JI6Q 3CD6A 4A3CG 4KHPQ 2VS1A 2QA4A 4HJ5A 2KCMA 2ZTDA 4R4IA 1Q12A 1KIXA 1EOVA 5H1SE 1M1KC 3CCJA 1N36Q 4DR6Q 2K52A 4DV0Q 3U4VA 4H02A 1XPOA 2R92H 4B3TL 5IT9c 3I4MG 4JOIA 2AHOB 2E2IH 3D31A 3UDGA 4JI5Q 2GVAA 4UP8A 4DR5L 5EAYA 4DR4L 1X6OA 1NY4A 2E2JH 3CC2A 4GLAC 3HOVG 4YCVA 2JJQA 4XIGS 2R6GA 4NB3A 4NPSA 1N33L 1Y1VG 1KXLA 1I5FA 1NMGA 3PV0A 3RLNA 5JEAJ 5K36G 4A3FG 4LF6Q 4JI2L 4MZ9A 2I5HA 2A19A 1WYDA 3EN2A 2JE6I 5C3EG 2HHHQ 4KLKA 4R4QA 4DV6Q 1HNZL 1VQNA 1Q82C 2JA7H 2CWPA 4AYBG 4JI8Q 2QEXA 3S16H 3CCLA 3K81C 3HOZG 3PUZA 5IP9G 5IYCH 4BA2I 2Z0SA 1W3SA 1WCMG 4B3ML 1YITA 4OXPA 4R1JA 2VL6A 5M3MG 3M4OH 4BBRG 1IYJB 2FXQA 1KHIA 4UP7A 5GAGC 4MNOA 4A3MG 4LWCA 4WJ3M 5HGQA 4B3RQ 3E9IA 1S40A 4QIWE 2A8VA 1VQEA 2EXDA 3KF6A 1MJEA 4LF4Q 3NELA 2K14A 2JQOA 1E3PA 1HR0W 2ATWA 3TS2A 2F3IA 3CW2C 2A1AA 1KD1C 2NVXH 3S24A 4GOPB 2OTJA 2K5HA 2YTXA 3GO5A 2F4VQ 4GN3B 2MFIA 5GQOA 4JI1L 4YHHQ 1PH1A 4OWTB 4UY8C 3OTOL 4P75A 4PZ8A 2B29A 5DLQE 1EUJA 3ULJA 1VQ9A 5GAEC 4LF6L 4HJAA 1SR3A 1I50H 3ULLA 5GAHC 3STBD 2B3GA 1Q46A 1SROA 2JA5G 3BZKA 4DV2L 4BXXG 2LXJA 4WJ4A 1NTGA 1SFOH 4IPCA 3ZJYC 1HJPA 1I3QH 3STBC 3RNUA 4R4TA 4DV1Q 1M90C 4JG2A 4JI3Q 1EIFA 2CWAA 3HFZB 4DAYB 2GVBA 1UWVA 2DUDA 1HZBA 1KRSA 1ASZA 2WAQE 2Z6KA 2I5MX 1VQIA 1I6HH 4DKAC 5JJKA 2OWOA 4NXMQ 3PO2H 1LUZA 1Z9FA 1FJGQ 3KF6B 3SGIA 1FVIA 3BU2A 3GTJH 2R7FA 1GVPA 2JA9A 4A3IH 4A3BH 4JV5L 1XPUA 4JI0Q 4LF4L 1V9PA 2XGTA 5C0XJ 1J5EL 4DR7L 1N32L 3PO3G 5M5YH 4GKKL 3UDIA 1B8AA 1IXRA 4YWLA 4BY7G 4DV7Q 4A3DH 4GLVB 3CC4A 4OO1G 2UXDL 4X62Q 3KF8B 3S1NH 1OXVA 1AE2A 2IX0A 4A3EG 3RZOH 4A3LH 3Q8DA 2OCEA 1OXXK 1Q1EA 4QY7A 1K9MC 1CKMA 1PV4A 2Q2UA 5FLMH 4DR3L 3TEHB 3UDXA 1HNXL 2WFWA 4UP9A 2R7ZH 3S1QH 4JBWA 1V1QA 3A0JA 2D62A 5ELNA 4IJHA 1VQFA 4BY1G 4DV1L 4B3TQ 1EFWA 1UE5A 1Q86C 2AMCB 2H5XA 4JI3L 4A3GG 1X3EA 4APVA 1OTCA 4A3CH 4C3JH 2ALYB 2K5VA 4B3SQ 4DR4Q 4IPDA 4GNXA 4JI4L 4R4CA 3L2PA 1Z47A 1HZCA 2VUMH 1N33Q 1X65A 1A62A 3KJPA 3F2CA 4DUYQ 4LUVA 2R93H 3I2ZA 2NN6G 4A4IA 3I4MH 3HOYG 3NBHB 2NN6I 5GROA 2IX1A 4QQBX 1KQSA 3K8AA 1EQQA 4JI2Q 1YHAA 3M4QA 3CCMA 1IBLL 1C0AA 5IYBG 3ICEA 3RLOA 4JC0A 3H3VI 2PNHA 1JE5A 1YJNA 2KHJA 1BBWA 2BA0A 4DUZL 4DV3L 4HIMA 4LW1A 4BBSH 4Y52H 4A3FH 4OX9Q 3KFUA 3PF4A 3EIVA 3KDFA 1PFSA 1Q1BA 3KLWA 5C3EH 4LFCL 2LXKA 4B3MQ 3HKZE 2JA8G 4HJ9A 3I4NG 3M7NA 1NJIC 1I94L 3DLLA 4BA1I 3UDFA 4ALPA 3G71A 3M4PA 4A3KG 1BVSA 4LUZA 1PH3A 2NVQH 4X66Q 4HIOA 2B63G 4YCUA 4AQYL 3HOZH 1FL0A 5IP9H 3J80c 3F2DA 4GNXB 4B3SL 2D0OA 1CKNA 1X56A 4POGA 3ER0A 3GTPH 1Q7YC 1OXUA 2YTVA 4AYBE 1GD7A 1L0WA 1HZ9A 4BBRH 3HOUG 1P8LA 1XTDA 4JI1Q 3J81i 4DUYL 1IBKL 3GTQH 3HKZG 3OTOQ 3G4SA 1A0IA 3I56A 4X64Q 2UUCL 1YJWA 1VQLA 3RZDH 4DNIA 3S2DH 1KC8C 1VQHA 2K4KA 1LM0A 3K7AH 4GN4B 4DV2Q 2UUBQ 3FP9A 5C44G 1CKOA 1PH7A 3KDFB 4OX9L 3RN5A 1RL2A 1N9WA 3CMEA 2KCTA 1CSQA 3PUXA 3CPWA 1G51A 1GM5A 1L1OA 3RR5A 3PIOA 3AYHB 1S3OA 5E7NA 3U4ZA 2JA5H 5IP7H 2YV5A 1JB7A 1EIYB 3S17H 1YIJA 1K0RA 4X66L 1CKNB 4OWXB 4JV5Q 2VY3A 1WOCA 1E24A 1YNXA 1WJJA 3NEMA 4A3JG 1VQBA 3PUWA 5BR8L 1W2BA 1J5EQ 2JA6G 3GTKH 4DR7Q 1N32Q 4GKKQ 2K5NA 3MXNB 2R92G 1N34L 4AH6A 3S14H 1RIPA 1PVOA 4QJFA 4RG1A 4POFA 4P74A 1CSPA 2VZAA 2UXDQ 1HR0L 4DR1L 4X64L 1Q81C 1XNQQ 4C3IH 3I55A 4DV4Q 2OQ0A 4TQUS 3AQQA 3CPFA 3S1RH 2NVYH 4OONA 1Q8KA 4DR3Q 1LTLA 4KI0A 2UUBL 4PZ7A 1HNXQ 5IWAQ 3B6YA 2ID0A 4JOIC 4C3HH 1N8RC 4K0KL 1QUQA 4PMWA 1PH9A 1GKHA 1UE6A 2VNUD 3FKIG 4P72A 4YWKA 4IFDJ 2ZJPA 4A93H 1L1OB 1NMFA 5AJ3Q 4IO9A 4DPGA 1TWHH 4R4OA 1JJCB 2ZJRA 1KRTA 4GOPC 1VCIA 4JI4Q 1YEZA 1UEBA 3BZCA 4YY3L 2WP8J 1VQKA 1L2FA 1VQ4A 1Y1WH 1X3GA 1PYBA 2N3SA 3PSIA 4L5RC 4LF9L 1HZAA 2Q2IA 1ASYA 4TVAB 2IY5B 2MQHA 3CCUA 1X55A 1TWFH 1D7QA 2AWNA 1TWGH 4XTCS 1IBLQ 4X65L 1K8GA 4DR2Q 4X6AH 1TWAH 4JBJA 1VS0A 4IFDI 4JCVE 4DUZQ 4DV3Q 1MJCA 4EX5A 5FJ8H 1XNQL 1VQCA 1XMOL 2UXCL 3PIPA 3CF5A 5IYDH 4DV4L 3UE0A 4HJ7A 1A63A 5M5WH 1U0LA 3CCQA 1VQ5A 5C4JH 4JI7L 1IL2A 3GTLH 3F1ZA 4LFCQ 1YHQA 2ASBA 3CC7A 2HIXA 5IWAL 3BJUA 2PI2A 3JAMi 2PMZE 3PGZA 2N78A 3CCRA 3T1HQ 1I94Q 3H3VH 1G6PA 5C0XG 2VQFL 1MKHA 2V1CC 5C0XI 1E7ZA 2VQEQ 3TREA 5AJ3L 1QVCA 3PCOB 4AQYQ 3ULPA 1K8AC 4Y7NH 4LFAL 4GKJL 1IZ6A 2KBNA 1J6QA 1D8LA 1C7YA 3HOWG 3I4NH 1VQDA 2BA1A 2Y0SE 1E1TA 1X54A 1IBKQ 4JYAL 1BBUA 3F2BA 4PZ6A 4GLXA 1VQPA 4DV5L 1G291 3K0XA 2UUCQ 1SMXA 1EWIA 5J3BA 3PO2G 2UUAQ 3PUYA 4QL5A 3HOVH 3S1MH 1E1OA 2NZOA 4A76A 1VQOA 1HNWL 4KHZA 4DR2L 2OQKA 5LMNW 1MIUA 1XPRA 1Y1VH 1VQGA 5JJLA 4C2MH 1VQ7A 5C4XG 3HKSA 4JBMA 2HT1A 2Z6KC 3I4OA 2Y0SG 1U5KA 3KOJA 2CKZB 3M3YH 1QZHA 4A3DG 3IRBA 3T1HL 1V43A 4P71A 1LYLA 4A3LG 2MO0A 1VQ6A 1PYSB 1YHBA 3A5ZB 3GD7A 2VQEL 4GS3A 1BKBA 5M3FG 4AIMA 1PA6A 2QGQA 5BR8Q 3HOXG 2YU9H 1WCMH 2R7ZG 3RN2A 2ZM6L 3CXCA 3A74A 1FGUA 3W5OA 4DAMA 5M3MH 3G6EA 1N34Q 1NBWA 3GDEA 4A3MH 1XNRL 5IY0A 3J7ZC 3WWVA 3H0GG 1HR0Q 4DR1Q 2N49A 1C9OA 1TWCH 1KL9A 1QZGA 4A3JH 1PH6A 2Q2TA 1JMCA 3GTMH 2JA6H 2UUAL 2IHFA 2ZTEA 1O7IA 1YVCA 1VQJA 4LF7L 2VUMG 3PO3H 3LGJA 2LSSA 4LF8L 2R93G 4K0KQ 1T9HA 4EQ5A 2RHSB 5FLXc 4HIKA 1Y14B 1AE3A 3UE1A 1EYGA 1SLJA 2E2HH 4MTNA 4GNXC 2NZHA 3M85A
chains in the Genus database with same CATH superfamily
3JC66 4F8MA 2ZTCA 2JEAI 3S14B 3CHBD 1GUWA 2PI2E 3BYTB 1VQ8A 5FO8B 4K2LA 2Z4IA 2KCNA 2DGYA 2FFKB 4CJ0B 3MC0B 4IALA 2N8NA 5KGUA 1I3QB 1S5BD 4JI6L 4KHPL 4CGYB 5CORA 3TDQA 4A93B 1XMOQ 1SE3A 2MP1A 1RTNA 4DV0L 1SRUA 2JP1A 2RDGA 4L5QA 3CCEA 5CV8A 4JI5L 1GO3E 2G9DA 1KAWA 3K80C 5FLXE 1JCKB 3R8BA 4LFAQ 3J81j 4PMCA 5JPNC 1JOKA 4DNTB 5IYCG 4JYAQ 3K6OA 3I7FA 1PH8A 2A73B 3PUVA 3TS0A 3K5NA 2H4OA 2K5QA 2F0HA 3KYHC 5IP7G 2ZJQA 4IPHA 1J9OA 3HOWH 1G2SA 3QG1A 1RTOA 4ZQ3A 2NN6H 4QGUA 1ILPA 3HOYH 3D0FA 2CHBD 4EQPA 4B3RL 2RF4A 3AFQA 5C4XH 2WV6D 5JJIA 2LY7A 4EGVA 3T1YQ 1JJGA 1IL8A 4V0BA 3HOVB 2F4VL 4KJOA 3KJOA 2CFMA 3L7ZC 1XNRQ 3DM3A 4A93G 2HUGA 3J80i 3TRZA 1K73C 4ULLA 1LACA 1CA5A 1HHVA 3AEVA 1B44D 1DM0B 3HOXH 5D65A 3ERSX 2KVMA 1H95A 3SVMA 1SNOA 3KBGA 2LKVA 4EQNA 1VQAA 2YU9B 4NXML 3H15A 1S5ED 1PTOB 3OSOA 2CW0C 5LMNL 1EQRA 3PIO3 5C44H 1TWCB 4LK1C 2JEBI 3FHWA 1JWMD 3G48A 3NWSA 4P73A 4DV7L 5JOBA 3RLFA 1X3FA 4U68A 4HIDA 2GN5A 2AKWB 4G7OC 1WVLA 1STAA 1EY6A 3CCJA 2PW7A 2K52A 5CC4A 4FXGC 3T53B 1CK1A 1A2TA 4F87A 5IT9c 2E2IH 2MUYA 5EAYA 1QG7A 2EJGC 4JK1C 3HOVG 2JJQA 4XIGS 2XRSD 1KXLA 1I5FA 1NMGA 1ET9A 1RF2D 3NTKA 1MI2A 3P75A 1H9KA 4LF6Q 2I5HA 2A19A 2HHHQ 4KLKA 2HCCA 4DV6Q 1HNZL 3PO3B 2M2LA 4ABNA 4IUUA 1STHA 4BY7B 4AYBG 4JI8Q 2QEXA 3PUZA 5IYCH 2CH4A 3QJYA 3O13A 4OXPA 4R1JA 2FXQA 4UP7A 5KNCA 3VR5A 3NK9A 5M9OA 2JN4A 3FRPB 5I9OA 4QIWE 2KCCA 2A8VA 4DA2A 4B9WA 2K14A 3VA7A 2G9HD 1HR0W 4O42A 3CW2C 4RAUC 2A1AA 5LL6X 1KD1C 3GV6A 1EOTA 4GOPB 1BCPF 4PZ8A 3ULJA 1VQ9A 1BQQT 4HJAA 4ID6A 2IW3A 2B3GA 2D2CC 1RDPD 3EJIA 3BZKA 3R2TA 4KKTA 2LXJA 4WJ4A 1NTGA 2A5HA 4XT1B 1I3QH 3OPOA 3CU7A 2ZXPA 1M90C 1EIFA 3HFZB 1I4HA 4DAYB 2DUDA 1ASZA 2Z6KA 5FKAC 3ND9A 2JA8B 1EZ8A 2OWOA 4RH6A 3PO2H 1LUZA 3I4NB 1FVIA 1MSHA 3Q24A 2N88A 4R8NA 1J5EL 2B63B 4ZK9B 3PO3G 5M5YH 4GKKL 3MFYA 1EU4A 3NBHA 4ZKBB 1AP0A 4F7XA 3QR8A 1IXRA 2RQXA 3R3OA 4BY7G 4GLVB 1W6KA 3HOUB 3KF8B 1O7ZA 4A3EG 2BCOA 3R2IA 3L9AX 1OXXK 4HAEA 1V1OA 1SNPA 1PV4A 2EY5A 1T5EA 4LMQD 3S15B 1HFNA 4UP9A 2WIIB 5CV9A 4DV1L 2H5XA 1EU3A 5CBEE 2E75C 5F2DA 1WCMB 1JOOA 1NCVA 2ZXRA 4JI4L 4Q0FA 4R4CA 1KAAA 1N33Q 1A62A 2TMPA 3KJPA 3BS1A 4LUVA 3I2ZA 4QQBX 2IX1A 1KQSA 4JI2Q 2B2VC 2B2TA 2XNAC 1H9MA 1C0AA 5IYBG 3RLOA 2KHJA 5HGTA 1GHKA 4OX9Q 1LTBD 2HCIA 3KDFA 1PTOD 1PFSA 4M1UB 3KLWA 2JA8G 2LXKA 3M7NA 3I4NG 3TN2A 4ALPA 3UDFA 1PTOC 4A3KG 3QOLA 3NXWA 4FNFA 4HIOA 2B63G 4YCUA 4AQYL 1FL0A 2PZWA 4B3SL 4HTHA 2HD3A 3ER0A 1OXUA 2YTVA 1TIID 3I73A 4AYBE 1Z6HA 1L0WA 1PTOH 1HZ9A 5C4HA 4BS9A 4N9PA 3LWUA 5C6AA 1FNVA 1XTDA 3HOUG 4DUYL 2RCFA 4CDEC 4X64Q 2Z4HA 4HEDA 2F3VA 4QMGA 1TY2A 3K5OA 3M4OB 4DV2Q 2LFNA 4RHSA 5KNDA 3RN5A 2C9OA 1G2TA 5EKKA 2NVXB 3CPWA 4DU9A 1TVXA 3PIOA 3U4ZA 5E7NA 2D9UA 2YV5A 4FO2A 1LTTD 4X66L 4JV5Q 5G3LD 1VQBA 3PUWA 1W2BA 5CYUA 1K0SA 4IUQA 5CV4A 1VF7A 2R92G 3WDNA 1PVOA 1VDZA 4QJFA 4RG1A 1EYAA 1CSPA 2N55A 2KQ3A 1Q81C 5CGKA 2KJXA 1LABA 2NTSA 2OQ0A 5IGCA 1Q8KA 5FO9B 4KI0A 1HNXQ 3B6YA 2ID0A 4C3HH 1CTMA 2PCFB 1UE6A 3I90A 3DHQA 4RWSC 3FEWX 4IFDJ 1JICA 4RKBA 2J4XA 3GTGB 3IL8A 2Y0SB 3DUZA 1CHQD 4J8QA 1JJCB 4GOPC 1YEZA 2EY2A 1SBBB 4RGTA 2O5JC 5A2QE 5E4XA 1VQ4A 1PYBA 2TSSA 4L5RC 1HZAA 2Q2IA 2WKCA 1ASYA 3OMCA 2IY5B 4RKLA 1C4QA 2ZXOA 4X3KA 1BXTA 1PRTB 2AWNA 2RSOA 3BVGA 4DR2Q 4JBJA 3MVVA 4DUZQ 4DV3Q 1U9RA 1EY4A 3G7LA 5FJ8H 1XNQL 1XMOL 5IYDH 1SYBA 4C3JB 1U0LA 1CHPD 1CFMA 1OO9B 5IWAL 1I94Q 3T1HQ 2ZT9C 1G6PA 5KIXA 5C0XI 2F0MA 3BDOA 1V1PB 1QVCA 2EJMA 4LFAL 3OWEB 3I4NH 5IIFA 4JYAL 1BBUA 1IKLA 5M5XB 1ZEQX 3F2BA 4PZ6A 4GLXA 1VQPA 4ZYSA 1AFPA 1EWIA 1HA5A 3PUYA 1E1OA 1VQOA 1CM9A 2NVQB 1VQGA 2VB3X 1VQ7A 1HUNA 3HKSA 3LWEA 2HT1A 2CVRA 2Y0SG 1BNZA 1DD2A 1ZKOA 4DN4M 2R61A 1B9MA 3WOFA 3IRBA 1V43A 3GTQB 2PZTA 2VQEL 5EKLA 1BKBA 2F0TA 1KABA 5BR8Q 3OMGA 1SYEA 3IFTA 1WCMH 3OWFA 3RN2A 2K28A 4DAMA 2JSOA 1N34Q 2B2YA 4DF7A 4A3MH 1XNRL 1ZXTA 2NWGA 3J7ZC 2QDLA 4C3JG 1NNXA 2SNMA 1PH6A 3BVMA 2UUAL 1PLFA 5D14A 1B3AA 2LSSA 3LGJA 4IUPA 1IYUA 2R93G 2SNSA 2DJGC 1BO0A 4CDCC 2KOLA 1I4RA 1QNKA 2EYMA 3F2UA 3ERQA 2K04A 4MTNA 4H13C 1EEID 2J0TD 2K75A 3MEHA 2K50A 3E0JA 4BBSG 1HQRD 4FDBA 1SE2A 2VXWA 1K3BC 4HCSA 1S72A 1I50B 1SXTA 2RDHA 3U9OA 3ZYYX 1AH9A 3I4LA 3I72A 3GTOH 3K5LA 1SFOB 1X32A 4X65Q 3U58A 3A8JE 1WI5A 2F0FA 4J6HA 1ICWA 2LS01 4F88A 2UU9Q 2UXCQ 4LUOA 2RHQB 3J7A5 4GN5A 4IQZA 4JI7Q 2VW9A 2L12A 2PQAA 4A75A 1BCPB 4A3BB 4I7ZC 3PF5A 2OXPA 3DEPA 4G7ZC 2Z9HA 2EY6A 1PH4A 4GKJQ 1STYA 1K8MA 1U4PA 1HPCA 4LF5Q 3I8ZA 1A8VA 1S5FD 2K5WA 4IOCA 5LMUQ 2IT1A 3NQTA 3NHHA 4L5SA 4J15A 4DV5Q 5GADC 5M5WB 2HHHL 1TS4A 2E76C 3W1GA 4DV6L 3GTLB 1Z7TA 5J1ZA 3D4WA 4JI8L 3Q22A 1A3VA 2MO1A 5JVG3 2XWJB 4IJLA 4NXNL 1QUQB 2KENA 2E5LL 4LFBL 2SOBA 3D8GA 1VQMA 5IE8A 3PQIA 4J1MA 5C5LA 1B70B 2L1BA 2HQLA 4U673 4XDXA 1PRTD 3GTGH 3OYYA 2UXBQ 2Q8RE 1GXDC 2CCZA 2Q2HA 3NWTA 4BWGB 3QIAA 2ZM6Q 2WAQG 4HSPA 1Y1VB 3ONAB 4CDDC 4DK0A 2HIVA 5IT9L 2P5ZX 5C3EB 3M3YB 1CUKA 2K5DA 1W6JA 4PG3A 2E74C 4A3BG 3AB9A 2FHTA 4DR5Q 1R9TH 3A5UA 1JE4A 1DONA 3NENA 1UE1A 2L11A 5M3MB 2MNAA 4BBRB 1PYWD 2OTLA 5ELOA 3MFGA 3P20A 2BH8A 1Y8NB 1E2ZA 1B50A 3S2DB 4IUTA 4CKEA 2ICEC 3SE0A 3AFPA 1RODA 3WOEA 3CMAA 1LT5D 1XMQQ 5M5XH 3CD6A 2KCMA 2ZTDA 4PMBA 1KIXA 5H1SE 3NE5B 3D4DA 4QIWB 1N36Q 1HQMC 1U4LA 3EROA 3U4VA 5DAUA 4H02A 3S17B 1FD7D 5I2XA 4JOIA 2AHOB 4UDUC 3D31A 3UDGA 5EKIA 5COYA 1I4PA 1X6OA 1NY4A 4YCVA 1FGBD 2F0SA 4NPSA 4N8FA 1N33L 1Y1VG 1BDOA 2NVTB 3TP8A 4HSVA 4JI2L 2K03A 3EN2A 5C3EG 2JE6I 5C4ZA 2F0NA 2A74C 1VQNA 1Q82C 5IOCA 1X3QA 2Q8IB 3K81C 1ONLA 4BA2I 2F0UA 3JAME 1CA6A 1EIHA 1TWHB 5M3MG 4BBRG 3MXPA 4MNOA 5KNBA 3E9IA 1S40A 1WTPA 4BY1B 1VQEA 2EXDA 3KBXA 3KF6A 4LF4Q 3NELA 4A3GB 4JVZA 2QDBA 3S24A 3T13A 2YTXA 1PH1A 4YHHQ 4OWTB 2EOTA 5E3FA 5C0XH 1TS5A 1X3PA 1I50H 2FINB 5GAHC 4KN7C 4ZUJA 1SROA 4DV2L 4BXXG 1SFOH 4IPCA 3ZJYC 1EY7A 3RNUA 1BCPC 4HR7B 5JJZA 4JI3Q 2QF7A 2GVBA 1UWVA 1UNSA 2WAQE 1STEA 2I5MX 1VQIA 3CRKC 3W3AA 1D2BA 3SGIA 2R7FA 5BN3A 4A3BH 4JV5L 5DM73 4JI0Q 1V9PA 2C5CA 1GUNA 1TT2A 3J81E 1T5XD 5K5PA 3S1MB 1B8AA 2QW7A 4JW0A 3KLRA 2IJ0A 4X62Q 2IX0A 1CKMA 2BE5D 2EPBA 4CDFC 1HNXL 2MJ8A 4JBWA 3R93A 3A0JA 2BE5C 2D62A 5ELNA 4BY1G 1VQFA 4B3TQ 4AYBB 4A3GG 4APVA 1OTCA 2F0WA 2CW0D 1NSNS 2ALYB 2K5VA 3GP7A 5E4WC 1I4GA 2RKSA 3L2PA 2VUMH 4ODGA 1S5DD 3F2CA 3NBHB 2EZVA 2K33A 5FO7B 3VYSA 3GTMB 5FLXL 2I07B 1HXYD 2EE1A 3ICEA 1AW7A 2K6AA 4JC0A 1YJNA 1CQVA 3VYRA 2BA0A 4DUZL 4DV3L 4Y52H 2E2JB 3HS0C 5C3EH 2IPKD 4HJ9A 1I94L 4BA1I 4GZYC 3G71A 3M4PA 1PH3A 2EYPA 1CQFA 1JC7A 2X6LA 4POGA 2D0OA 1CKNA 3GTPH 4BBRH 2F0IA 4H0LC 3MXNA 4G57A 4TKOB 1P8LA 2A6HD 3S16B 2EYJA 3OTOQ 1A0IA 3I56A 3SK8A 3VR6A 2A6HC 3S2DH 1EY5A 1D1IA 1VQHA 2K4KA 1XXGA 4MHEA 2UUBQ 2L9HA 1FNUA 1CKOA 2B2UA 1K83B 2RVLA 3SHLA 3KDFB 3LX0A 4XQQA 1XYIA 4A3EB 4R9WA 2EDGA 1CSQA 3PUXA 1G51A 5EBCA 1L1OA 2WACA 3C46A 5IP7H 1JB7A 3S17H 3MHBA 1WTVA 2J7ZA 2F0OA 1EWHA 1YNXA 4CBVA 5BR8L 4DR7Q 1O7LA 2K5NA 2PYKA 3J80E 1N34L 3S14H 3X3NA 2UXDQ 1B3QA 3J7AV 4DV4Q 4TQUS 1I6HB 1TQOA 3CPFA 4OONA 4PZ7A 5ELEA 4MN3A 1N8RC 3DWQA 1JB3A 3FDTA 4A93H 3C1EA 3Q6SA 5AJ3Q 3DMUA 1TWHH 3HRZC 3TZDA 1HCZA 2AUKA 1NR2A 4KV6A 4A3DB 1A15A 1VQKA 4HMIA 4A3KB 2N3SA 3PSIA 3MXGA 3NP8A 4TVAB 1U4MA 1X55A 5JVH3 4XTCS 1IBLQ 4X65L 1HTPA 5I2YA 4IFDI 2HQEA 4EX5A 1VQCA 2UXCL 1LTSD 1A63A 1IL2A 1IW7D 4JI7L 5KRUA 4DAPA 4KY7A 4FF1A 3CC7A 3BJUA 3PGZA 3P7JA 1IW7C 1R4PB 1PFMA 4TRDA 3TSSA 1XX8A 1GUGA 4GKJL 4FF2A 1IZ6A 1IKMA 1C7YA 2BA1A 5CV6A 4DV5L 3D6CA 2UUCQ 1QB5D 2F0GA 1GOZA 4QL5A 3HOVH 3S1MH 4A76A 1TY0A 2R92B 5LMNW 1XPRA 2BDOA 2MGSA 5JJLA 2F1MA 1QCBD 4ZAIA 2Z6KC 3I4OA 5J39A 1Q90A 1SE4A 4C1NK 1U5KA 2QEJC 2CQAA 4A3DG 4DXFA 4A3LG 4DFAA 1VQ6A 1YHBA 3VYUA 4GS3A 4RFBA 4LJZC 4QF4A 1KDAA 2F03A 2O4XA 3A8IE 4IZ8A 2YU9H 2R7ZG 3K7AB 4FYDA 2ZM6L 3CXCA 1SYDA 1FGUA 3I3CA 1NBWA 1HUMA 3CRLC 4OHJA 1HR0Q 1TWCH 2F0PA 1QZGA 3GTMH 2ZTEA 1YVCA 5NUCA 3GQBA 4XT3B 4K0KQ 2RHSB 5FLXc 3MWYW 5KYLA 4WORA 3NBIA 1KDBA 5JEAG 1O78A 4GOPA 3BDCA 4RMFA 4S3SA 1Y8PB 2B2TC 1RHPA 2BH2A 5CV7A 1NE3A 2XTIA 1L0XB 4Z9CB 3KLSX 3K58A 1XMQL 4FXKC 4YWMA 2KEEA 3CP0A 4C1NI 1ESRA 1STBA 4DAYA 1N36L 3OOCA 3PO3H 4JBKA 3UI2A 3M9BA 3GTJB 1K83H 3E0EA 4BY7H 4O0AA 3J81c 2KUMA 3A54A 1Y1WB 5DNFA 4A3EH 3F8TA 1JT8A 3TBIB 2B8GA 4HCEA 3T4AC 2D0PA 1BUVT 4FF3A 4K8IA 1YI2A 1DGSA 4YCWA 3S1NB 3ND8A 1UEAB 3KF8A 3URYA 4KN4C 2F0QA 3IAYA 1Q3LA 3CAMA 4IOAA 3KLSA 2NYZD 1HNWQ 4IFDG 1LTRD 3CCSA 2HDLA 4HJ8A 4WFN3 2EQSA 5HY6A 2PQAB 1HTLD 3TP6A 3Q23A 5LMNQ 4KMUC 1H9SA 3I70A 5IYBH 1XWEA 2R93B 3I4MB 1CI3M 3K7UC 1SN8A 4ME3A 4ZUIA 1NUCA 1TU2B 3IKJA 1PHJA 2JA8H 1HH2P 4YHHL 1O7YA 4BBSB 4OO1I 4A3KH 5I9PA 5A35A 3M4YA 2B63H 2YYZA 2K1BA 2E8GA 2WB1E 4I65A 1XJVA 4ILWA 1M4VA 3HOUH 1Y1WG 3HEJA 3A56A 2JK8A 4KJNA 1JQYD 3NQIA 1H9JA 5IGBA 2IHEA 1SNDA 2I5LX 2ES2A 3S15H 1K8OA 4JI0L 1CZGA 1LTGD 2AQ3B 2CQOA 2Z1CA 3T1YL 1ENAA 3RZDB 4RGMA 2G5DA 2B2WA 4L5TA 1PTOF 1X9NA 1HNZQ 1EYCA 1K3RA 1E0BA 1ENCA 1KNAA 1YZ6A 5JEAH 1JR0D 4X62L 1IBMQ 2B8FA 2RBMA 5A2QL 2VS1A 4HJ5A 4R4IA 1Q12A 5IGFA 1EOVA 4DR6Q 3FPPA 2R92H 1PMRA 4B3TL 3I4MG 2OF1A 2AQ1B 2GVAA 2ICIA 2A69D 3GTKB 3CC2A 4FVMA 2R6GA 3M7GA 3SXHA 1SNMA 2A69C 1WTWA 3C2PA 5K36G 3J7YW 4R4QA 3S1RB 1LTID 2JYOA 3H91A 2CWPA 2WAQB 1G91A 3CCLA 1W3SA 3GV3A 5G3LF 3AMUA 1YITA 1MBYA 4L63B 1SMYC 2VL6A 3M4OH 5GAGC 5IGDA 4G7HC 4LWCA 4CHTB 4ZKCB 4IFDH 4IUNA 1S4ZA 5I6WA 2JQOA 1E3PA 2F3IA 2NVXH 2EYLA 1WTXA 1TWFB 2B2YC 4H44C 1TWGB 3GO5A 4GN3B 4UY8C 1TR5A 3BDLA 1TWAB 3OTOL 4WJWA 1E2WA 2B29A 2F4IA 4OIJA 5DLQE 1Y8OB 5GAEC 4LF6L 1B53A 3HOYB 1F2MA 2A6ED 3D6WA 3ULLA 5L37A 1F9QA 2L5TA 1Q46A 4CKBA 4NMZA 3DM1A 2A6EC 1YNNC 1GUOA 4K5WA 4R4TA 4DV1Q 2WKDA 2KECA 1DOMA 1PZJD 1HZBA 2KHSA 4KY6A 1VMPA 4WRDA 4Y7NB 2DY7A 5LHY1 1FJGQ 3KF6B 3BU2A 3GTJH 3NPPA 2JA9A 1RJTA 1XPUA 3E3XA 5C0XJ 2XGTA 4DR7L 1Q8IA 2OEOA 2F0KA 2O2LD 2RA4A 2F0VA 4YWLA 3D3RA 4OO1G 2UXDL 3S1NH 4C2MB 3MZ5A 2BDNA 2OCEA 1Q1EA 1QOHA 2Q2UA 1FNWA 4NDXA 3HZXA 4CKCA 1A6XA 3NTIA 1V1QA 5TSSA 4DK1A 4IJHA 5C44B 3TMEA 1EFWA 1UE5A 2DJFC 1Q86C 1BR9A 1O80A 3K5MA 4ZCKA 1LTAD 4C3JH 4B3SQ 4DR4Q 1ML0D 4IPDA 1NAPA 4GNXA 1HZCA 4OIKA 1BOSA 4DUYQ 2R93H 2NN6G 4A4IA 3I4MH 3HOYG 5GROA 2XVSA 5IGEA 1QE6A 5AFWA 1ESFA 1EQQA 1YHAA 2JA6B 3M4QA 3CCMA 1IBLL 1EL0A 3SDZA 2PNHA 1JE5A 2PNRC 5BN4A 2E2IB 4BBSH 4LW1A 2IL8A 5K36H 3KFUA 2BOSA 4N8X1 1PZKD 1DJRD 2DY8A 2K01A 3MAQA 1HRJA 4B3MQ 3HKZE 1BVSA 4LUZA 2NVQH 4MTKA 4X66Q 3HG9A 3FKIB 1RCVD 1ICFB 2XSCA 1X56A 1Q7YC 3K59A 1GD7A 1EWCA 1I4QA 4JI1Q 3J81i 3GTQH 1DZ1A 2MHVA 4OEMB 2UUCL 4RCNA 1YJWA 1BBXC 3RZDH 4DNIA 1KC8C 3FP9A 5C44G 4OX9L 1RL2A 1S5CD 1I4XA 3CMEA 2KCTA 3RR5A 3CQZB 1S3OA 3S2HB 3V05A 1EIYB 2Z6BA 2MPMA 3QO2A 1CKNB 4OWXB 2VY3A 3NEMA 2JA6G 3OIQA 1N32Q 1R4QB 3GTKH 3MXNB 4AH6A 4POFA 1LV9A 4P74A 1RKNA 2VZAA 4V190 1HR0L 4CJ1B 4C56C 4X64L 1XNQQ 2WINB 3AQQA 2Q8TA 1A3UA 2XWBB 3S1RH 2AQ2B 1BCPD 4O1NA 4DR3Q 3PO2B 1LTLA 1WTOA 5IWAQ 2M00A 4JOIC 4K0KL 1QUQA 4L8JA 1GKHA 4RCOA 3FKIG 5JPMC 4OO1H 1QNUA 4KD3A 1U4RA 2ZJPA 1L1OB 1NMFA 1V8QA 5M5YB 3FPUB 1HA6A 4R4OA 1DOLA 1FR3A 1VCIA 3BZCA 2WP8J 1D5ZC 1B1ZA 1X3GA 5M3FB 2MQHA 4NW2A 3CCUA 1TWFH 4HMJA 4RHRA 1TWGH 1K8GA 1TWAH 3J7AF 3H3VC 1VS0A 1MJCA 2X69A 1F9RA 3H0GB 3PIPA 3CF5A 4HJ7A 5M5WH 3CCQA 3GTLH 1PRTF 3H94A 5DM63 4LFCQ 1G8ZD 1YHQA 3NTHA 2HIXA 3N52A 3H3VH 2PMZE 1TKWB 2N78A 2D5DA 1MKHA 2V1CC 1E7ZA 2VQEQ 4XYQA 5HURA 3TREA 1I6VC 3JAML 2V4DA 4Y7NH 1J6QA 1D8LA 1TS3A 3SR1A 2NB0A 1ENFA 1LT6D 2GA4B 1X54A 1IBKQ 1L0YB 3HGBA 3IFDA 1F9PA 3PO2G 2UUAQ 2NZOA 4KHVA 1AEXA 1HNWL 4DR2L 2OQKA 1MIUA 1Y1VH 4C2MH 4QCLA 4OGQC 3QB3A 3KOJA 2CKZB 3M3YH 1QZHA 1MD2D 1BF4A 3T1HL 4P71A 1LYLA 2FMMA 5ELFA 3V2TA 1PYSB 2F0EA 4X3UA 3N6RA 4E6IA 3V96A 3VR3A 4KKUA 5M3FG 4EVOA 3TP5A 2FJ2A 2VB2X 1SEBD 2JA7B 3W5OA 5M3MH 1GHJA 3GDEA 4RA8A 3HP3A 3SK5A 1EEFD 3WWVA 3H0GG 5EPJA 4DR1Q 2Q2TA 1C9OA 3J81L 2JA6H 5C3WA 3SK6A 4B08A 2IHFA 1WTHA 3T51B 1VQJA 5ELDA 1T9HA 3ITPA 4EQ5A 2KEDA 4HIKA 1F2ZA 1AE3A 1EZ6A 1SLJA 2K7VA 5IGGA 4OL7A 4I7AA 4FP5D 4KTAA 4CJ2C 3LNNA 4BXXH 2PZUA 1JWSD 4YY3Q 2F0JA 3E9HA 5KYIA 3FKIH 1P16A 4DGZA 4LF9Q 3X3MA 3T56B 3U50C 1EY9A 4KY5A 4C3HB 1QVFA 4OELB 1IBML 3SK4A 2NVTH 4K5XA 3MA2B 1SE8A 3NUCA 5T1GA 4DR6L 4IUVA 2AWOA 4NXNQ 4X3TA 3MEFA 2E5LQ 1E2VA 4LFBQ 2L15A 4PV1C 4QUCA 4A3IB 2VQFQ 1WTRA 1MHWC 2EVBA 2R7DA 3P1HA 1VMCA 1B7YB 5I4DA 3CCVA 1MSGA 2JA7G 2KHIA 3CQZH 3S2HH 2F3WA 4XQNA 1JOQA 2WB1B 5J22A 2I0QA 3RZOB 4BY1H 3EFXD 4K6DA 4A3GH 3BZDB 3DWAA 1QILA 1YBYA 2B2VA 2B2UC 3S1QB 2F52A 2R7ZB 1G6ZA 3TP7A 3CKIB 4O2DA 4UPAA 1WD1A 4IURA 2UU9L 2DNEA 4ZRZA 1L1OC 2NBFA 4QB4A 1OXTA 1JJ2A 1WFQA 2O5IC 3OW2A 4OWWB 3FMCA 1OXSC 2PPBC 3RMHA 5I6YA 1MGSA 4C3HG 2C35B 2EIFA 1AN8A 5IODA 3C1FA 3U9SA 2SDFA 1PH5A 4A3FB 4LF5L 1C8CA 5LMUL 5M3FH 4HN7A 5EPKA 1SAPA 1DYQA 5FOBB 3J80L 4LNQA 3VDYA 4LF7Q 4A3IG 4EQOA 3E6ZX 4LF8Q 5D3DA 1UE7A 3HOZB 3H0GH 1SNQA 3TQYA 1H9SB 5EGTA 1FJGL 3DWPA 4G4KA 4A3MB 2WB1G 4DK3C 3H09A 5FJ8G 5IYDG 2RSNA 2I46A 1PH2A 2UXBL 3W1BA 3W2DA 5EPLA 5FLMG 1YJ9A 3S9WA 4IPGA 1E22A 1QVGA 4DK6C 3JAMc 2NUCA 3A8KE 3EBEA 3L0OA 2YTYA 2RCNA 4JI6Q 1TXYA 4KHPQ 4A3CG 4N9TA 2QA4A 2EXZA 3G6JB 2E2DC 1SYGA 1EIGA 1SJED 1M1KC 3A7LA 4DV0Q 2JA5B 1XPOA 3A55A 1AZQA 2K32A 4JI5Q 4UP8A 4DR5L 3OIPA 4K8JA 4DR4L 4P2CB 2E2JH 1PFBA 1SJHD 4GLAC 1HFGA 4NB3A 2EY1A 3GTOB 1SYFA 4NKLA 1LLRD 5EQ0A 3PV0A 3EQLC 3RLNA 5JEAJ 4A3FG 1PXUA 4MZ9A 1WYDA 4C3IB 2NVYB 2JA7H 1EQTA 5BN5A 1DOKA 3EVQA 3S16H 3HOZG 5IP9G 2Z0SA 3MTSA 1WCMG 5CR3A 4B3ML 1F77A 1JORA 1IYJB 4A3MG 1KHIA 3VR4A 4WJ3M 5HGQA 4B3RQ 4MIUA 1GUTA 1MJEA 1PDQA 3TS2A 5ISRA 1DXMA 2ATWA 1F2YA 2OTJA 2K5HA 4LAAA 2F4VQ 2MFIA 5GQOA 4JI1L 1SNCA 4P75A 1EUJA 2L0CA 2PW5A 3OHXC 1SR3A 1KDCA 3STBD 4UAIA 5C4JB 3VA5A 2JA5G 5D3IB 1UAPA 2Z8LA 1XTCD 1HJPA 2XIWA 3STBC 1GJXA 4KD4A 1GUSA 4JG2A 2CWAA 1KRSA 2EYHA 1I6HH 1WD0A 3KUPA 4DKAC 5JJKA 4NXMQ 1Z9FA 3A7AB 4FF4A 1GVPA 1Y69U 4A3IH 4LF4L 4C3IG 1N32L 3DEOA 1ZYRD 3UDIA 2ENBA 4DV7Q 4A3DH 1ZYRC 3CC4A 4A3LH 1OXVA 1AE2A 3RZOH 3HKZB 3Q8DA 4QY7A 1R9TB 1K9MC 5FLMH 4DR3L 3TEHB 1A2UA 3UDXA 2WFWA 2R7ZH 3S1QH 1EFID 2OT2A 1B4OA 1DCZA 2AMCB 4JI3L 1TS2A 1X3EA 3T16A 4A3CH 4JPBW 2EYFA 1Z47A 1F9SA 3K57A 1X65A 1KTKA 2NN6I 3K8AA 4RGOS 1NR4A 1B9NA 1EYDA 4A3JB 2X6GA 3AU7A 3QOJA 3H3VI 1BBWA 4HIMA 4A3FH 1PZID 1D5MC 2L4NA 3PF4A 3EIVA 2DNCA 5EBDA 2E2HB 1LO5D 1Q1BA 4LFCL 2F0DA 3D4RA 2B39A 1NJIC 3DLLA 3DXJC 5CBAE 5CMDA 1C48A 2PQEA 1D1KA 2F0LA 3HOZH 5IP9H 3J80c 3F2DA 4GNXB 3KK7A 4Q5VA 3RUZA 1H9RA 4M8AA 5ELBA 1IBKL 3NSWA 3HKZG 3G4SA 3OW7A 3L3OC 1VQLA 1LM0A 3K7AH 3H6MA 4GN4B 1PH7A 1M8AA 1SMYD 2IWHA 2L55A 4L6TB 3RD4A 1N9WA 1QWYA 2CH4W 1GM5A 3PIP3 2FMCA 3BVZA 3AYHB 2JA5H 1A3TA 1AZPA 2QILA 1YIJA 1KLUD 1K0RA 2A68D 5C3XA 5KEEA 1WOCA 1E24A 4A3JG 1WJJA 2XRQD 2SEBD 1EY0A 1J5EQ 2B2WC 5IT9E 1STGA 3BYYB 4XXEA 4GKKQ 3EA6A 4K14A 2A68C 1CT1D 3QWNA 4UHVA 1RIPA 3HOWB 1PFNA 3BG3A 4ME5A 1CZWA 4DR1L 2DN8A 4C3IH 3I55A 2PMZB 1YNND 3MXUA 5CV5A 2NVYH 3VYTA 1KLGD 2UUBL 4DNRB 4PMWA 1PH9A 4DAVA 2VNUD 4P72A 4YWKA 5C4XB 4QUFA 4IO9A 5EJWA 3Q0AA 4DPGA 3C3LA 1V1PA 1KNEA 5LL6S 2ZJRA 1KRTA 4ZLTF 4JI4Q 1UEBA 4KKSA 4YY3L 5T1IA 4PNYA 5JAVA 1L2FA 3E5SA 3FVQA 1Y1WH 4LF9L 1SYCA 3SEBA 1B2TA 2M9VA 4K6LA 3HOXB 1D7QA 4X6AH 5ELCA 2QKIC 4JCVE 1EY8A 2HDMA 4DV4L 3UE0A 1VQ5A 2NTTA 5C4JH 3F1ZA 2ASBA 1SSOA 1QJOA 3CCRA 2VUMB 2PI2A 3JAMi 5C0XG 2VQFL 3PMFA 3K0YA 4XYOA 5AJ3L 2NZ1D 3PCOB 4AQYQ 1F2LA 3ULPA 1K8AC 5FK9C 1EQVA 2KBNA 1VF5C 1IYVA 1PRTC 3HOWG 1LT4D 1VQDA 2Y0SE 1II3A 2H1EA 4KK7A 1E1TA 2XN9C 5DEHA 1G291 3K0XA 3TZUA 1SMXA 1FYCA 5J3BA 1SDFA 1LT3D 4KHZA 1RD9D 4YIJA 5C5MA 2RDFA 5C4XG 1D6EC 2AUJD 4JBMA 4IN3A 1YNJD 3GTPB 4K2KA 4DXGA 4FXDA 5E1FA 2K05A 1YNJC 4K5VA 4R8IA 2MO0A 1WTQA 3A5ZB 3GD7A 1IHZA 4RGNA 2EYOA 4AIMA 2QGQA 1PA6A 3HOXG 4X3SA 1JWUD 3A74A 3G6EA 2R3ZA 2PO4A 4PQXA 3VR2A 1D5XC 5IY0A 2LMCB 1ET6A 1STNA 3I91A 2N49A 1KL9A 4H7BA 4A3JH 1JMCA 2IX3A 1K28A 2QCPX 1O7IA 2VUMG 1J8IA 4LF7L 2JXMB 2KA7A 1UUPA 4LF8L 4XQJA 1Y14B 4NP5A 4TSSA 1ILQA 3UE1A 1EYGA 2E2HH 4GNXC 2NZHA 4B9XA 2EJFC 3M85A
chains in the Genus database with same CATH topology
3JC66 2K75A 5JEAG 2ZTCA 2JEAI 2K50A 4BBSG 4GOPA 4BXXH 2PI2E 1VQ8A 4FDBA 4YY3Q 4RMFA 3E9HA 1S72A 3FKIH 1P16A 2DGYA 4LF9Q 2BH2A 1AH9A 1NE3A 2XTIA 3U50C 3GTOH 2N8NA 1QVFA 4X65Q 3U58A 1IBML 1XMQL 1WI5A 4JI6L 2NVTH 4KHPL 2UU9Q 1XMOQ 4LUOA 4YWMA 3CP0A 1SE8A 2RHQB 2UXCQ 3J7A5 4GN5A 1N36L 4DR6L 4JI7Q 2AWOA 2VW9A 4DV0L 4NXNQ 1SRUA 3MEFA 2E5LQ 4L5QA 2PQAA 4JBKA 4LFBQ 3CCEA 2L15A 4A75A 3M9BA 1K83H 3E0EA 4BY7H 4O0AA 3J81c 4JI5L 2VQFQ 1GO3E 3PF5A 1KAWA 2R7DA 3K80C 4A3EH 3F8TA 1B7YB 1PH4A 3CCVA 1JT8A 2D0PA 4LFAQ 2JA7G 1YI2A 4GKJQ 2KHIA 3CQZH 3S2HH 3J81j 1DGSA 2I0QA 5IYCG 4YCWA 4LF5Q 4BY1H 1A8VA 4JYAQ 4IOCA 5LMUQ 2IT1A 3I7FA 4L5SA 4J15A 4DV5Q 5GADC 1PH8A 2HHHL 3TS0A 3PUVA 3W1GA 4DV6L 4A3GH 3KYHC 5IP7G 2ZJQA 4IOAA 1YBYA 3CAMA 4IPHA 2F52A 1HNWQ 3HOWH 4JI8L 4IFDG 4O2DA 4UPAA 3CCSA 2MO1A 4HJ8A 2UU9L 4QGUA 2EQSA 5HY6A 3HOYH 3D0FA 2PQAB 4IJLA 1L1OC 1OXTA 1JJ2A 4NXNL 1QUQB 2KENA 1WFQA 5LMNQ 2E5LL 4LFBL 3OW2A 4B3RL 1VQMA 5IE8A 4OWWB 5IYBH 2RF4A 1B70B 1OXSC 3AFQA 3K7UC 2HQLA 5C4XH 1SN8A 5JJIA 3GTGH 2UXBQ 3OYYA 3T1YQ 4ME3A 2CCZA 2Q2HA 1JJGA 1PHJA 2JA8H 1HH2P 2F4VL 3KJOA 2ZM6Q 4YHHL 2C35B 2CFMA 2EIFA 2WAQG 3L7ZC 1PH5A 3DM3A 1XNRQ 4OO1I 4A3KH 4LF5L 4A93G 3TRZA 3J80i 5LMUL 1K73C 2HIVA 2B63H 2YYZA 5M3FH 2E8GA 2WB1E 3AEVA 1CUKA 3HOXH 4PG3A 4LNQA 3ERSX 3VDYA 4LF7Q 1XJVA 1H95A 4A3IG 4A3BG 4LF8Q 3HOUH 1Y1WG 1UE7A 3H0GH 4DR5Q 1R9TH 2JK8A 3A5UA 3TQYA 1VQAA 3NENA 1UE1A 4NXML 3H15A 2IHEA 2I5LX 5LMNL 2ES2A 2MNAA 2OTLA 1FJGL 3S15H 2WB1G 1EQRA 5ELOA 4DK3C 5FJ8G 5IYDG 4JI0L 5C44H 2BH8A 1PH2A 2CQOA 2JEBI 3W1BA 2UXBL 3FHWA 3T1YL 5FLMG 1YJ9A 3G48A 4IPGA 1E22A 4L5TA 1X9NA 1HNZQ 1QVGA 4P73A 4DV7L 1K3RA 4DK6C 1YZ6A 3RLFA 1X3FA 3AFPA 3JAMc 4X62L 4HIDA 1IBMQ 3EBEA 3L0OA 2YTYA 2GN5A 2RCNA 2AKWB 5M5XH 1TXYA 3CMAA 1XMQQ 4JI6Q 3CD6A 4A3CG 4KHPQ 2VS1A 2QA4A 4HJ5A 2KCMA 2ZTDA 4R4IA 1Q12A 1KIXA 1EOVA 5H1SE 1M1KC 3CCJA 1N36Q 4DR6Q 2K52A 4DV0Q 3U4VA 4H02A 1XPOA 2R92H 4B3TL 5IT9c 3I4MG 4JOIA 2AHOB 2E2IH 3D31A 3UDGA 4JI5Q 2GVAA 4UP8A 4DR5L 5EAYA 4DR4L 1X6OA 1NY4A 2E2JH 3CC2A 4GLAC 3HOVG 4YCVA 2JJQA 4XIGS 2R6GA 4NB3A 4NPSA 1N33L 1Y1VG 1KXLA 1I5FA 1NMGA 3PV0A 3RLNA 5JEAJ 5K36G 4A3FG 4LF6Q 4JI2L 4MZ9A 2I5HA 2A19A 1WYDA 3EN2A 2JE6I 5C3EG 2HHHQ 4KLKA 4R4QA 4DV6Q 1HNZL 1VQNA 1Q82C 2JA7H 2CWPA 4AYBG 4JI8Q 2QEXA 3S16H 3CCLA 3K81C 3HOZG 3PUZA 5IP9G 5IYCH 4BA2I 2Z0SA 1W3SA 1WCMG 4B3ML 1YITA 4OXPA 4R1JA 2VL6A 5M3MG 3M4OH 4BBRG 1IYJB 2FXQA 1KHIA 4UP7A 5GAGC 4MNOA 4A3MG 4LWCA 4WJ3M 5HGQA 4B3RQ 3E9IA 1S40A 4QIWE 2A8VA 1VQEA 2EXDA 3KF6A 1MJEA 4LF4Q 3NELA 2K14A 2JQOA 1E3PA 1HR0W 2ATWA 3TS2A 2F3IA 3CW2C 2A1AA 1KD1C 2NVXH 3S24A 4GOPB 2OTJA 2K5HA 2YTXA 3GO5A 2F4VQ 4GN3B 2MFIA 5GQOA 4JI1L 4YHHQ 1PH1A 4OWTB 4UY8C 3OTOL 4P75A 4PZ8A 2B29A 5DLQE 1EUJA 3ULJA 1VQ9A 5GAEC 4LF6L 4HJAA 1SR3A 1I50H 3ULLA 5GAHC 3STBD 2B3GA 1Q46A 1SROA 2JA5G 3BZKA 4DV2L 4BXXG 2LXJA 4WJ4A 1NTGA 1SFOH 4IPCA 3ZJYC 1HJPA 1I3QH 3STBC 3RNUA 4R4TA 4DV1Q 1M90C 4JG2A 4JI3Q 1EIFA 2CWAA 3HFZB 4DAYB 2GVBA 1UWVA 2DUDA 1HZBA 1KRSA 1ASZA 2WAQE 2Z6KA 2I5MX 1VQIA 1I6HH 4DKAC 5JJKA 2OWOA 4NXMQ 3PO2H 1LUZA 1Z9FA 1FJGQ 3KF6B 3SGIA 1FVIA 3BU2A 3GTJH 2R7FA 1GVPA 2JA9A 4A3IH 4A3BH 4JV5L 1XPUA 4JI0Q 4LF4L 1V9PA 2XGTA 5C0XJ 1J5EL 4DR7L 1N32L 3PO3G 5M5YH 4GKKL 3UDIA 1B8AA 1IXRA 4YWLA 4BY7G 4DV7Q 4A3DH 4GLVB 3CC4A 4OO1G 2UXDL 4X62Q 3KF8B 3S1NH 1OXVA 1AE2A 2IX0A 4A3EG 3RZOH 4A3LH 3Q8DA 2OCEA 1OXXK 1Q1EA 4QY7A 1K9MC 1CKMA 1PV4A 2Q2UA 5FLMH 4DR3L 3TEHB 3UDXA 1HNXL 2WFWA 4UP9A 2R7ZH 3S1QH 4JBWA 1V1QA 3A0JA 2D62A 5ELNA 4IJHA 1VQFA 4BY1G 4DV1L 4B3TQ 1EFWA 1UE5A 1Q86C 2AMCB 2H5XA 4JI3L 4A3GG 1X3EA 4APVA 1OTCA 4A3CH 4C3JH 2ALYB 2K5VA 4B3SQ 4DR4Q 4IPDA 4GNXA 4JI4L 4R4CA 3L2PA 1Z47A 1HZCA 2VUMH 1N33Q 1X65A 1A62A 3KJPA 3F2CA 4DUYQ 4LUVA 2R93H 3I2ZA 2NN6G 4A4IA 3I4MH 3HOYG 3NBHB 2NN6I 5GROA 2IX1A 4QQBX 1KQSA 3K8AA 1EQQA 4JI2Q 1YHAA 3M4QA 3CCMA 1IBLL 1C0AA 5IYBG 3ICEA 3RLOA 4JC0A 3H3VI 2PNHA 1JE5A 1YJNA 2KHJA 1BBWA 2BA0A 4DUZL 4DV3L 4HIMA 4LW1A 4BBSH 4Y52H 4A3FH 4OX9Q 3KFUA 3PF4A 3EIVA 3KDFA 1PFSA 1Q1BA 3KLWA 5C3EH 4LFCL 2LXKA 4B3MQ 3HKZE 2JA8G 4HJ9A 3I4NG 3M7NA 1NJIC 1I94L 3DLLA 4BA1I 3UDFA 4ALPA 3G71A 3M4PA 4A3KG 1BVSA 4LUZA 1PH3A 2NVQH 4X66Q 4HIOA 2B63G 4YCUA 4AQYL 3HOZH 1FL0A 5IP9H 3J80c 3F2DA 4GNXB 4B3SL 2D0OA 1CKNA 1X56A 4POGA 3ER0A 3GTPH 1Q7YC 1OXUA 2YTVA 4AYBE 1GD7A 1L0WA 1HZ9A 4BBRH 3HOUG 1P8LA 1XTDA 4JI1Q 3J81i 4DUYL 1IBKL 3GTQH 3HKZG 3OTOQ 3G4SA 1A0IA 3I56A 4X64Q 2UUCL 1YJWA 1VQLA 3RZDH 4DNIA 3S2DH 1KC8C 1VQHA 2K4KA 1LM0A 3K7AH 4GN4B 4DV2Q 2UUBQ 3FP9A 5C44G 1CKOA 1PH7A 3KDFB 4OX9L 3RN5A 1RL2A 1N9WA 3CMEA 2KCTA 1CSQA 3PUXA 3CPWA 1G51A 1GM5A 1L1OA 3RR5A 3PIOA 3AYHB 1S3OA 5E7NA 3U4ZA 2JA5H 5IP7H 2YV5A 1JB7A 1EIYB 3S17H 1YIJA 1K0RA 4X66L 1CKNB 4OWXB 4JV5Q 2VY3A 1WOCA 1E24A 1YNXA 1WJJA 3NEMA 4A3JG 1VQBA 3PUWA 5BR8L 1W2BA 1J5EQ 2JA6G 3GTKH 4DR7Q 1N32Q 4GKKQ 2K5NA 3MXNB 2R92G 1N34L 4AH6A 3S14H 1RIPA 1PVOA 4QJFA 4RG1A 4POFA 4P74A 1CSPA 2VZAA 2UXDQ 1HR0L 4DR1L 4X64L 1Q81C 1XNQQ 4C3IH 3I55A 4DV4Q 2OQ0A 4TQUS 3AQQA 3CPFA 3S1RH 2NVYH 4OONA 1Q8KA 4DR3Q 1LTLA 4KI0A 2UUBL 4PZ7A 1HNXQ 5IWAQ 3B6YA 2ID0A 4JOIC 4C3HH 1N8RC 4K0KL 1QUQA 4PMWA 1PH9A 1GKHA 1UE6A 2VNUD 3FKIG 4P72A 4YWKA 4IFDJ 2ZJPA 4A93H 1L1OB 1NMFA 5AJ3Q 4IO9A 4DPGA 1TWHH 4R4OA 1JJCB 2ZJRA 1KRTA 4GOPC 1VCIA 4JI4Q 1YEZA 1UEBA 3BZCA 4YY3L 2WP8J 1VQKA 1L2FA 1VQ4A 1Y1WH 1X3GA 1PYBA 2N3SA 3PSIA 4L5RC 4LF9L 1HZAA 2Q2IA 1ASYA 4TVAB 2IY5B 2MQHA 3CCUA 1X55A 1TWFH 1D7QA 2AWNA 1TWGH 4XTCS 1IBLQ 4X65L 1K8GA 4DR2Q 4X6AH 1TWAH 4JBJA 1VS0A 4IFDI 4JCVE 4DUZQ 4DV3Q 1MJCA 4EX5A 5FJ8H 1XNQL 1VQCA 1XMOL 2UXCL 3PIPA 3CF5A 5IYDH 4DV4L 3UE0A 4HJ7A 1A63A 5M5WH 1U0LA 3CCQA 1VQ5A 5C4JH 4JI7L 1IL2A 3GTLH 3F1ZA 4LFCQ 1YHQA 2ASBA 3CC7A 2HIXA 5IWAL 3BJUA 2PI2A 3JAMi 2PMZE 3PGZA 2N78A 3CCRA 3T1HQ 1I94Q 3H3VH 1G6PA 5C0XG 2VQFL 1MKHA 2V1CC 5C0XI 1E7ZA 2VQEQ 3TREA 5AJ3L 1QVCA 3PCOB 4AQYQ 3ULPA 1K8AC 4Y7NH 4LFAL 4GKJL 1IZ6A 2KBNA 1J6QA 1D8LA 1C7YA 3HOWG 3I4NH 1VQDA 2BA1A 2Y0SE 1E1TA 1X54A 1IBKQ 4JYAL 1BBUA 3F2BA 4PZ6A 4GLXA 1VQPA 4DV5L 1G291 3K0XA 2UUCQ 1SMXA 1EWIA 5J3BA 3PO2G 2UUAQ 3PUYA 4QL5A 3HOVH 3S1MH 1E1OA 2NZOA 4A76A 1VQOA 1HNWL 4KHZA 4DR2L 2OQKA 5LMNW 1MIUA 1XPRA 1Y1VH 1VQGA 5JJLA 4C2MH 1VQ7A 5C4XG 3HKSA 4JBMA 2HT1A 2Z6KC 3I4OA 2Y0SG 1U5KA 3KOJA 2CKZB 3M3YH 1QZHA 4A3DG 3IRBA 3T1HL 1V43A 4P71A 1LYLA 4A3LG 2MO0A 1VQ6A 1PYSB 1YHBA 3A5ZB 3GD7A 2VQEL 4GS3A 1BKBA 5M3FG 4AIMA 1PA6A 2QGQA 5BR8Q 3HOXG 2YU9H 1WCMH 2R7ZG 3RN2A 2ZM6L 3CXCA 3A74A 1FGUA 3W5OA 4DAMA 5M3MH 3G6EA 1N34Q 1NBWA 3GDEA 4A3MH 1XNRL 5IY0A 3J7ZC 3WWVA 3H0GG 1HR0Q 4DR1Q 2N49A 1C9OA 1TWCH 1KL9A 1QZGA 4A3JH 1PH6A 2Q2TA 1JMCA 3GTMH 2JA6H 2UUAL 2IHFA 2ZTEA 1O7IA 1YVCA 1VQJA 4LF7L 2VUMG 3PO3H 3LGJA 2LSSA 4LF8L 2R93G 4K0KQ 1T9HA 4EQ5A 2RHSB 5FLXc 4HIKA 1Y14B 1AE3A 3UE1A 1EYGA 1SLJA 2E2HH 4MTNA 4GNXC 2NZHA 3M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JC6 6;  2K75 A;  5JEA G;  2ZTC A;  2JEA I;  2K50 A;  4BBS G;  4GOP A;  4BXX H;  2PI2 E;  1VQ8 A;  4FDB A;  4YY3 Q;  4RMF A;  3E9H A;  1S72 A;  3FKI H;  1P16 A;  2DGY A;  4LF9 Q;  2BH2 A;  1AH9 A;  1NE3 A;  2XTI A;  3U50 C;  3GTO H;  2N8N A;  1QVF A;  4X65 Q;  3U58 A;  1IBM L;  1XMQ L;  1WI5 A;  4JI6 L;  2NVT H;  4KHP L;  2UU9 Q;  1XMO Q;  4LUO A;  4YWM A;  3CP0 A;  1SE8 A;  2RHQ B;  2UXC Q;  3J7A 5;  4GN5 A;  1N36 L;  4DR6 L;  4JI7 Q;  2AWO A;  2VW9 A;  4DV0 L;  4NXN Q;  1SRU A;  3MEF A;  2E5L Q;  4L5Q A;  2PQA A;  4JBK A;  4LFB Q;  3CCE A;  2L15 A;  4A75 A;  3M9B A;  1K83 H;  3E0E A;  4BY7 H;  4O0A A;  3J81 c;  4JI5 L;  2VQF Q;  1GO3 E;  3PF5 A;  1KAW A;  2R7D A;  3K80 C;  4A3E H;  3F8T A;  1B7Y B;  1PH4 A;  3CCV A;  1JT8 A;  2D0P A;  4LFA Q;  2JA7 G;  1YI2 A;  4GKJ Q;  2KHI A;  3CQZ H;  3S2H H;  3J81 j;  1DGS A;  2I0Q A;  5IYC G;  4YCW A;  4LF5 Q;  4BY1 H;  1A8V A;  4JYA Q;  4IOC A;  5LMU Q;  2IT1 A;  3I7F A;  4L5S A;  4J15 A;  4DV5 Q;  5GAD C;  1PH8 A;  2HHH L;  3TS0 A;  3PUV A;  3W1G A;  4DV6 L;  4A3G H;  3KYH C;  5IP7 G;  2ZJQ A;  4IOA A;  1YBY A;  3CAM A;  4IPH A;  2F52 A;  1HNW Q;  3HOW H;  4JI8 L;  4IFD G;  4O2D A;  4UPA A;  3CCS A;  2MO1 A;  4HJ8 A;  2UU9 L;  4QGU A;  2EQS A;  5HY6 A;  3HOY H;  3D0F A;  2PQA B;  4IJL A;  1L1O C;  1OXT A;  1JJ2 A;  4NXN L;  1QUQ B;  2KEN A;  1WFQ A;  5LMN Q;  2E5L L;  4LFB L;  3OW2 A;  4B3R L;  1VQM A;  5IE8 A;  4OWW B;  5IYB H;  2RF4 A;  1B70 B;  1OXS C;  3AFQ A;  3K7U C;  2HQL A;  5C4X H;  1SN8 A;  5JJI A;  3GTG H;  2UXB Q;  3OYY A;  3T1Y Q;  4ME3 A;  2CCZ A;  2Q2H A;  1JJG A;  1PHJ A;  2JA8 H;  1HH2 P;  2F4V L;  3KJO A;  2ZM6 Q;  4YHH L;  2C35 B;  2CFM A;  2EIF A;  2WAQ G;  3L7Z C;  1PH5 A;  3DM3 A;  1XNR Q;  4OO1 I;  4A3K H;  4LF5 L;  4A93 G;  3TRZ A;  3J80 i;  5LMU L;  1K73 C;  2HIV A;  2B63 H;  2YYZ A;  5M3F H;  2E8G A;  2WB1 E;  3AEV A;  1CUK A;  3HOX H;  4PG3 A;  4LNQ A;  3ERS X;  3VDY A;  4LF7 Q;  1XJV A;  1H95 A;  4A3I G;  4A3B G;  4LF8 Q;  3HOU H;  1Y1W G;  1UE7 A;  3H0G H;  4DR5 Q;  1R9T H;  2JK8 A;  3A5U A;  3TQY A;  1VQA A;  3NEN A;  1UE1 A;  4NXM L;  3H15 A;  2IHE A;  2I5L X;  5LMN L;  2ES2 A;  2MNA A;  2OTL A;  1FJG L;  3S15 H;  2WB1 G;  1EQR A;  5ELO A;  4DK3 C;  5FJ8 G;  5IYD G;  4JI0 L;  5C44 H;  2BH8 A;  1PH2 A;  2CQO A;  2JEB I;  3W1B A;  2UXB L;  3FHW A;  3T1Y L;  5FLM G;  1YJ9 A;  3G48 A;  4IPG A;  1E22 A;  4L5T A;  1X9N A;  1HNZ Q;  1QVG A;  4P73 A;  4DV7 L;  1K3R A;  4DK6 C;  1YZ6 A;  3RLF A;  1X3F A;  3AFP A;  3JAM c;  4X62 L;  4HID A;  1IBM Q;  3EBE A;  3L0O A;  2YTY A;  2GN5 A;  2RCN A;  2AKW B;  5M5X H;  1TXY A;  3CMA A;  1XMQ Q;  4JI6 Q;  3CD6 A;  4A3C G;  4KHP Q;  2VS1 A;  2QA4 A;  4HJ5 A;  2KCM A;  2ZTD A;  4R4I A;  1Q12 A;  1KIX A;  1EOV A;  5H1S E;  1M1K C;  3CCJ A;  1N36 Q;  4DR6 Q;  2K52 A;  4DV0 Q;  3U4V A;  4H02 A;  1XPO A;  2R92 H;  4B3T L;  5IT9 c;  3I4M G;  4JOI A;  2AHO B;  2E2I H;  3D31 A;  3UDG A;  4JI5 Q;  2GVA A;  4UP8 A;  4DR5 L;  5EAY A;  4DR4 L;  1X6O A;  1NY4 A;  2E2J H;  3CC2 A;  4GLA C;  3HOV G;  4YCV A;  2JJQ A;  4XIG S;  2R6G A;  4NB3 A;  4NPS A;  1N33 L;  1Y1V G;  1KXL A;  1I5F A;  1NMG A;  3PV0 A;  3RLN A;  5JEA J;  5K36 G;  4A3F G;  4LF6 Q;  4JI2 L;  4MZ9 A;  2I5H A;  2A19 A;  1WYD A;  3EN2 A;  2JE6 I;  5C3E G;  2HHH Q;  4KLK A;  4R4Q A;  4DV6 Q;  1HNZ L;  1VQN A;  1Q82 C;  2JA7 H;  2CWP A;  4AYB G;  4JI8 Q;  2QEX A;  3S16 H;  3CCL A;  3K81 C;  3HOZ G;  3PUZ A;  5IP9 G;  5IYC H;  4BA2 I;  2Z0S A;  1W3S A;  1WCM G;  4B3M L;  1YIT A;  4OXP A;  4R1J A;  2VL6 A;  5M3M G;  3M4O H;  4BBR G;  1IYJ B;  2FXQ A;  1KHI A;  4UP7 A;  5GAG C;  4MNO A;  4A3M G;  4LWC A;  4WJ3 M;  5HGQ A;  4B3R Q;  3E9I A;  1S40 A;  4QIW E;  2A8V A;  1VQE A;  2EXD A;  3KF6 A;  1MJE A;  4LF4 Q;  3NEL A;  2K14 A;  2JQO A;  1E3P A;  1HR0 W;  2ATW A;  3TS2 A;  2F3I A;  3CW2 C;  2A1A A;  1KD1 C;  2NVX H;  3S24 A;  4GOP B;  2OTJ A;  2K5H A;  2YTX A;  3GO5 A;  2F4V Q;  4GN3 B;  2MFI A;  5GQO A;  4JI1 L;  4YHH Q;  1PH1 A;  4OWT B;  4UY8 C;  3OTO L;  4P75 A;  4PZ8 A;  2B29 A;  5DLQ E;  1EUJ A;  3ULJ A;  1VQ9 A;  5GAE C;  4LF6 L;  4HJA A;  1SR3 A;  1I50 H;  3ULL A;  5GAH C;  3STB D;  2B3G A;  1Q46 A;  1SRO A;  2JA5 G;  3BZK A;  4DV2 L;  4BXX G;  2LXJ A;  4WJ4 A;  1NTG A;  1SFO H;  4IPC A;  3ZJY C;  1HJP A;  1I3Q H;  3STB C;  3RNU A;  4R4T A;  4DV1 Q;  1M90 C;  4JG2 A;  4JI3 Q;  1EIF A;  2CWA A;  3HFZ B;  4DAY B;  2GVB A;  1UWV A;  2DUD A;  1HZB A;  1KRS A;  1ASZ A;  2WAQ E;  2Z6K A;  2I5M X;  1VQI A;  1I6H H;  4DKA C;  5JJK A;  2OWO A;  4NXM Q;  3PO2 H;  1LUZ A;  1Z9F A;  1FJG Q;  3KF6 B;  3SGI A;  1FVI A;  3BU2 A;  3GTJ H;  2R7F A;  1GVP A;  2JA9 A;  4A3I H;  4A3B H;  4JV5 L;  1XPU A;  4JI0 Q;  4LF4 L;  1V9P A;  2XGT A;  5C0X J;  1J5E L;  4DR7 L;  1N32 L;  3PO3 G;  5M5Y H;  4GKK L;  3UDI A;  1B8A A;  1IXR A;  4YWL A;  4BY7 G;  4DV7 Q;  4A3D H;  4GLV B;  3CC4 A;  4OO1 G;  2UXD L;  4X62 Q;  3KF8 B;  3S1N H;  1OXV A;  1AE2 A;  2IX0 A;  4A3E G;  3RZO H;  4A3L H;  3Q8D A;  2OCE A;  1OXX K;  1Q1E A;  4QY7 A;  1K9M C;  1CKM A;  1PV4 A;  2Q2U A;  5FLM H;  4DR3 L;  3TEH B;  3UDX A;  1HNX L;  2WFW A;  4UP9 A;  2R7Z H;  3S1Q H;  4JBW A;  1V1Q A;  3A0J A;  2D62 A;  5ELN A;  4IJH A;  1VQF A;  4BY1 G;  4DV1 L;  4B3T Q;  1EFW A;  1UE5 A;  1Q86 C;  2AMC B;  2H5X A;  4JI3 L;  4A3G G;  1X3E A;  4APV A;  1OTC A;  4A3C H;  4C3J H;  2ALY B;  2K5V A;  4B3S Q;  4DR4 Q;  4IPD A;  4GNX A;  4JI4 L;  4R4C A;  3L2P A;  1Z47 A;  1HZC A;  2VUM H;  1N33 Q;  1X65 A;  1A62 A;  3KJP A;  3F2C A;  4DUY Q;  4LUV A;  2R93 H;  3I2Z A;  2NN6 G;  4A4I A;  3I4M H;  3HOY G;  3NBH B;  2NN6 I;  5GRO A;  2IX1 A;  4QQB X;  1KQS A;  3K8A A;  1EQQ A;  4JI2 Q;  1YHA A;  3M4Q A;  3CCM A;  1IBL L;  1C0A A;  5IYB G;  3ICE A;  3RLO A;  4JC0 A;  3H3V I;  2PNH A;  1JE5 A;  1YJN A;  2KHJ A;  1BBW A;  2BA0 A;  4DUZ L;  4DV3 L;  4HIM A;  4LW1 A;  4BBS H;  4Y52 H;  4A3F H;  4OX9 Q;  3KFU A;  3PF4 A;  3EIV A;  3KDF A;  1PFS A;  1Q1B A;  3KLW A;  5C3E H;  4LFC L;  2LXK A;  4B3M Q;  3HKZ E;  2JA8 G;  4HJ9 A;  3I4N G;  3M7N A;  1NJI C;  1I94 L;  3DLL A;  4BA1 I;  3UDF A;  4ALP A;  3G71 A;  3M4P A;  4A3K G;  1BVS A;  4LUZ A;  1PH3 A;  2NVQ H;  4X66 Q;  4HIO A;  2B63 G;  4YCU A;  4AQY L;  3HOZ H;  1FL0 A;  5IP9 H;  3J80 c;  3F2D A;  4GNX B;  4B3S L;  2D0O A;  1CKN A;  1X56 A;  4POG A;  3ER0 A;  3GTP H;  1Q7Y C;  1OXU A;  2YTV A;  4AYB E;  1GD7 A;  1L0W A;  1HZ9 A;  4BBR H;  3HOU G;  1P8L A;  1XTD A;  4JI1 Q;  3J81 i;  4DUY L;  1IBK L;  3GTQ H;  3HKZ G;  3OTO Q;  3G4S A;  1A0I A;  3I56 A;  4X64 Q;  2UUC L;  1YJW A;  1VQL A;  3RZD H;  4DNI A;  3S2D H;  1KC8 C;  1VQH A;  2K4K A;  1LM0 A;  3K7A H;  4GN4 B;  4DV2 Q;  2UUB Q;  3FP9 A;  5C44 G;  1CKO A;  1PH7 A;  3KDF B;  4OX9 L;  3RN5 A;  1RL2 A;  1N9W A;  3CME A;  2KCT A;  1CSQ A;  3PUX A;  3CPW A;  1G51 A;  1GM5 A;  1L1O A;  3RR5 A;  3PIO A;  3AYH B;  1S3O A;  5E7N A;  3U4Z A;  2JA5 H;  5IP7 H;  2YV5 A;  1JB7 A;  1EIY B;  3S17 H;  1YIJ A;  1K0R A;  4X66 L;  1CKN B;  4OWX B;  4JV5 Q;  2VY3 A;  1WOC A;  1E24 A;  1YNX A;  1WJJ A;  3NEM A;  4A3J G;  1VQB A;  3PUW A;  5BR8 L;  1W2B A;  1J5E Q;  2JA6 G;  3GTK H;  4DR7 Q;  1N32 Q;  4GKK Q;  2K5N A;  3MXN B;  2R92 G;  1N34 L;  4AH6 A;  3S14 H;  1RIP A;  1PVO A;  4QJF A;  4RG1 A;  4POF A;  4P74 A;  1CSP A;  2VZA A;  2UXD Q;  1HR0 L;  4DR1 L;  4X64 L;  1Q81 C;  1XNQ Q;  4C3I H;  3I55 A;  4DV4 Q;  2OQ0 A;  4TQU S;  3AQQ A;  3CPF A;  3S1R H;  2NVY H;  4OON A;  1Q8K A;  4DR3 Q;  1LTL A;  4KI0 A;  2UUB L;  4PZ7 A;  1HNX Q;  5IWA Q;  3B6Y A;  2ID0 A;  4JOI C;  4C3H H;  1N8R C;  4K0K L;  1QUQ A;  4PMW A;  1PH9 A;  1GKH A;  1UE6 A;  2VNU D;  3FKI G;  4P72 A;  4YWK A;  4IFD J;  2ZJP A;  4A93 H;  1L1O B;  1NMF A;  5AJ3 Q;  4IO9 A;  4DPG A;  1TWH H;  4R4O A;  1JJC B;  2ZJR A;  1KRT A;  4GOP C;  1VCI A;  4JI4 Q;  1YEZ A;  1UEB A;  3BZC A;  4YY3 L;  2WP8 J;  1VQK A;  1L2F A;  1VQ4 A;  1Y1W H;  1X3G A;  1PYB A;  2N3S A;  3PSI A;  4L5R C;  4LF9 L;  1HZA A;  2Q2I A;  1ASY A;  4TVA B;  2IY5 B;  2MQH A;  3CCU A;  1X55 A;  1TWF H;  1D7Q A;  2AWN A;  1TWG H;  4XTC S;  1IBL Q;  4X65 L;  1K8G A;  4DR2 Q;  4X6A H;  1TWA H;  4JBJ A;  1VS0 A;  4IFD I;  4JCV E;  4DUZ Q;  4DV3 Q;  1MJC A;  4EX5 A;  5FJ8 H;  1XNQ L;  1VQC A;  1XMO L;  2UXC L;  3PIP A;  3CF5 A;  5IYD H;  4DV4 L;  3UE0 A;  4HJ7 A;  1A63 A;  5M5W H;  1U0L A;  3CCQ A;  1VQ5 A;  5C4J H;  4JI7 L;  1IL2 A;  3GTL H;  3F1Z A;  4LFC Q;  1YHQ A;  2ASB A;  3CC7 A;  2HIX A;  5IWA L;  3BJU A;  2PI2 A;  3JAM i;  2PMZ E;  3PGZ A;  2N78 A;  3CCR A;  3T1H Q;  1I94 Q;  3H3V H;  1G6P A;  5C0X G;  2VQF L;  1MKH A;  2V1C C;  5C0X I;  1E7Z A;  2VQE Q;  3TRE A;  5AJ3 L;  1QVC A;  3PCO B;  4AQY Q;  3ULP A;  1K8A C;  4Y7N H;  4LFA L;  4GKJ L;  1IZ6 A;  2KBN A;  1J6Q A;  1D8L A;  1C7Y A;  3HOW G;  3I4N H;  1VQD A;  2BA1 A;  2Y0S E;  1E1T A;  1X54 A;  1IBK Q;  4JYA L;  1BBU A;  3F2B A;  4PZ6 A;  4GLX A;  1VQP A;  4DV5 L;  1G29 1;  3K0X A;  2UUC Q;  1SMX A;  1EWI A;  5J3B A;  3PO2 G;  2UUA Q;  3PUY A;  4QL5 A;  3HOV H;  3S1M H;  1E1O A;  2NZO A;  4A76 A;  1VQO A;  1HNW L;  4KHZ A;  4DR2 L;  2OQK A;  5LMN W;  1MIU A;  1XPR A;  1Y1V H;  1VQG A;  5JJL A;  4C2M H;  1VQ7 A;  5C4X G;  3HKS A;  4JBM A;  2HT1 A;  2Z6K C;  3I4O A;  2Y0S G;  1U5K A;  3KOJ A;  2CKZ B;  3M3Y H;  1QZH A;  4A3D G;  3IRB A;  3T1H L;  1V43 A;  4P71 A;  1LYL A;  4A3L G;  2MO0 A;  1VQ6 A;  1PYS B;  1YHB A;  3A5Z B;  3GD7 A;  2VQE L;  4GS3 A;  1BKB A;  5M3F G;  4AIM A;  1PA6 A;  2QGQ A;  5BR8 Q;  3HOX G;  2YU9 H;  1WCM H;  2R7Z G;  3RN2 A;  2ZM6 L;  3CXC A;  3A74 A;  1FGU A;  3W5O A;  4DAM A;  5M3M H;  3G6E A;  1N34 Q;  1NBW A;  3GDE A;  4A3M H;  1XNR L;  5IY0 A;  3J7Z C;  3WWV A;  3H0G G;  1HR0 Q;  4DR1 Q;  2N49 A;  1C9O A;  1TWC H;  1KL9 A;  1QZG A;  4A3J H;  1PH6 A;  2Q2T A;  1JMC A;  3GTM H;  2JA6 H;  2UUA L;  2IHF A;  2ZTE A;  1O7I A;  1YVC A;  1VQJ A;  4LF7 L;  2VUM G;  3PO3 H;  3LGJ A;  2LSS A;  4LF8 L;  2R93 G;  4K0K Q;  1T9H A;  4EQ5 A;  2RHS B;  5FLX c;  4HIK A;  1Y14 B;  1AE3 A;  3UE1 A;  1EYG A;  1SLJ A;  2E2H H;  4MTN A;  4GNX C;  2NZH A;  3M85 A; 
#chains in the Genus database with same CATH topology
 3JC6 6;  4F8M A;  2ZTC A;  2JEA I;  3S14 B;  3CHB D;  1GUW A;  2PI2 E;  3BYT B;  1VQ8 A;  5FO8 B;  4K2L A;  2Z4I A;  2KCN A;  2DGY A;  2FFK B;  4CJ0 B;  3MC0 B;  4IAL A;  2N8N A;  5KGU A;  1I3Q B;  1S5B D;  4JI6 L;  4KHP L;  4CGY B;  5COR A;  3TDQ A;  4A93 B;  1XMO Q;  1SE3 A;  2MP1 A;  1RTN A;  4DV0 L;  1SRU A;  2JP1 A;  2RDG A;  4L5Q A;  3CCE A;  5CV8 A;  4JI5 L;  1GO3 E;  2G9D A;  1KAW A;  3K80 C;  5FLX E;  1JCK B;  3R8B A;  4LFA Q;  3J81 j;  4PMC A;  5JPN C;  1JOK A;  4DNT B;  5IYC G;  4JYA Q;  3K6O A;  3I7F A;  1PH8 A;  2A73 B;  3PUV A;  3TS0 A;  3K5N A;  2H4O A;  2K5Q A;  2F0H A;  3KYH C;  5IP7 G;  2ZJQ A;  4IPH A;  1J9O A;  3HOW H;  1G2S A;  3QG1 A;  1RTO A;  4ZQ3 A;  2NN6 H;  4QGU A;  1ILP A;  3HOY H;  3D0F A;  2CHB D;  4EQP A;  4B3R L;  2RF4 A;  3AFQ A;  5C4X H;  2WV6 D;  5JJI A;  2LY7 A;  4EGV A;  3T1Y Q;  1JJG A;  1IL8 A;  4V0B A;  3HOV B;  2F4V L;  4KJO A;  3KJO A;  2CFM A;  3L7Z C;  1XNR Q;  3DM3 A;  4A93 G;  2HUG A;  3J80 i;  3TRZ A;  1K73 C;  4ULL A;  1LAC A;  1CA5 A;  1HHV A;  3AEV A;  1B44 D;  1DM0 B;  3HOX H;  5D65 A;  3ERS X;  2KVM A;  1H95 A;  3SVM A;  1SNO A;  3KBG A;  2LKV A;  4EQN A;  1VQA A;  2YU9 B;  4NXM L;  3H15 A;  1S5E D;  1PTO B;  3OSO A;  2CW0 C;  5LMN L;  1EQR A;  3PIO 3;  5C44 H;  1TWC B;  4LK1 C;  2JEB I;  3FHW A;  1JWM D;  3G48 A;  3NWS A;  4P73 A;  4DV7 L;  5JOB A;  3RLF A;  1X3F A;  4U68 A;  4HID A;  2GN5 A;  2AKW B;  4G7O C;  1WVL A;  1STA A;  1EY6 A;  3CCJ A;  2PW7 A;  2K52 A;  5CC4 A;  4FXG C;  3T53 B;  1CK1 A;  1A2T A;  4F87 A;  5IT9 c;  2E2I H;  2MUY A;  5EAY A;  1QG7 A;  2EJG C;  4JK1 C;  3HOV G;  2JJQ A;  4XIG S;  2XRS D;  1KXL A;  1I5F A;  1NMG A;  1ET9 A;  1RF2 D;  3NTK A;  1MI2 A;  3P75 A;  1H9K A;  4LF6 Q;  2I5H A;  2A19 A;  2HHH Q;  4KLK A;  2HCC A;  4DV6 Q;  1HNZ L;  3PO3 B;  2M2L A;  4ABN A;  4IUU A;  1STH A;  4BY7 B;  4AYB G;  4JI8 Q;  2QEX A;  3PUZ A;  5IYC H;  2CH4 A;  3QJY A;  3O13 A;  4OXP A;  4R1J A;  2FXQ A;  4UP7 A;  5KNC A;  3VR5 A;  3NK9 A;  5M9O A;  2JN4 A;  3FRP B;  5I9O A;  4QIW E;  2KCC A;  2A8V A;  4DA2 A;  4B9W A;  2K14 A;  3VA7 A;  2G9H D;  1HR0 W;  4O42 A;  3CW2 C;  4RAU C;  2A1A A;  5LL6 X;  1KD1 C;  3GV6 A;  1EOT A;  4GOP B;  1BCP F;  4PZ8 A;  3ULJ A;  1VQ9 A;  1BQQ T;  4HJA A;  4ID6 A;  2IW3 A;  2B3G A;  2D2C C;  1RDP D;  3EJI A;  3BZK A;  3R2T A;  4KKT A;  2LXJ A;  4WJ4 A;  1NTG A;  2A5H A;  4XT1 B;  1I3Q H;  3OPO A;  3CU7 A;  2ZXP A;  1M90 C;  1EIF A;  3HFZ B;  1I4H A;  4DAY B;  2DUD A;  1ASZ A;  2Z6K A;  5FKA C;  3ND9 A;  2JA8 B;  1EZ8 A;  2OWO A;  4RH6 A;  3PO2 H;  1LUZ A;  3I4N B;  1FVI A;  1MSH A;  3Q24 A;  2N88 A;  4R8N A;  1J5E L;  2B63 B;  4ZK9 B;  3PO3 G;  5M5Y H;  4GKK L;  3MFY A;  1EU4 A;  3NBH A;  4ZKB B;  1AP0 A;  4F7X A;  3QR8 A;  1IXR A;  2RQX A;  3R3O A;  4BY7 G;  4GLV B;  1W6K A;  3HOU B;  3KF8 B;  1O7Z A;  4A3E G;  2BCO A;  3R2I A;  3L9A X;  1OXX K;  4HAE A;  1V1O A;  1SNP A;  1PV4 A;  2EY5 A;  1T5E A;  4LMQ D;  3S15 B;  1HFN A;  4UP9 A;  2WII B;  5CV9 A;  4DV1 L;  2H5X A;  1EU3 A;  5CBE E;  2E75 C;  5F2D A;  1WCM B;  1JOO A;  1NCV A;  2ZXR A;  4JI4 L;  4Q0F A;  4R4C A;  1KAA A;  1N33 Q;  1A62 A;  2TMP A;  3KJP A;  3BS1 A;  4LUV A;  3I2Z A;  4QQB X;  2IX1 A;  1KQS A;  4JI2 Q;  2B2V C;  2B2T A;  2XNA C;  1H9M A;  1C0A A;  5IYB G;  3RLO A;  2KHJ A;  5HGT A;  1GHK A;  4OX9 Q;  1LTB D;  2HCI A;  3KDF A;  1PTO D;  1PFS A;  4M1U B;  3KLW A;  2JA8 G;  2LXK A;  3M7N A;  3I4N G;  3TN2 A;  4ALP A;  3UDF A;  1PTO C;  4A3K G;  3QOL A;  3NXW A;  4FNF A;  4HIO A;  2B63 G;  4YCU A;  4AQY L;  1FL0 A;  2PZW A;  4B3S L;  4HTH A;  2HD3 A;  3ER0 A;  1OXU A;  2YTV A;  1TII D;  3I73 A;  4AYB E;  1Z6H A;  1L0W A;  1PTO H;  1HZ9 A;  5C4H A;  4BS9 A;  4N9P A;  3LWU A;  5C6A A;  1FNV A;  1XTD A;  3HOU G;  4DUY L;  2RCF A;  4CDE C;  4X64 Q;  2Z4H A;  4HED A;  2F3V A;  4QMG A;  1TY2 A;  3K5O A;  3M4O B;  4DV2 Q;  2LFN A;  4RHS A;  5KND A;  3RN5 A;  2C9O A;  1G2T A;  5EKK A;  2NVX B;  3CPW A;  4DU9 A;  1TVX A;  3PIO A;  3U4Z A;  5E7N A;  2D9U A;  2YV5 A;  4FO2 A;  1LTT D;  4X66 L;  4JV5 Q;  5G3L D;  1VQB A;  3PUW A;  1W2B A;  5CYU A;  1K0S A;  4IUQ A;  5CV4 A;  1VF7 A;  2R92 G;  3WDN A;  1PVO A;  1VDZ A;  4QJF A;  4RG1 A;  1EYA A;  1CSP A;  2N55 A;  2KQ3 A;  1Q81 C;  5CGK A;  2KJX A;  1LAB A;  2NTS A;  2OQ0 A;  5IGC A;  1Q8K A;  5FO9 B;  4KI0 A;  1HNX Q;  3B6Y A;  2ID0 A;  4C3H H;  1CTM A;  2PCF B;  1UE6 A;  3I90 A;  3DHQ A;  4RWS C;  3FEW X;  4IFD J;  1JIC A;  4RKB A;  2J4X A;  3GTG B;  3IL8 A;  2Y0S B;  3DUZ A;  1CHQ D;  4J8Q A;  1JJC B;  4GOP C;  1YEZ A;  2EY2 A;  1SBB B;  4RGT A;  2O5J C;  5A2Q E;  5E4X A;  1VQ4 A;  1PYB A;  2TSS A;  4L5R C;  1HZA A;  2Q2I A;  2WKC A;  1ASY A;  3OMC A;  2IY5 B;  4RKL A;  1C4Q A;  2ZXO A;  4X3K A;  1BXT A;  1PRT B;  2AWN A;  2RSO A;  3BVG A;  4DR2 Q;  4JBJ A;  3MVV A;  4DUZ Q;  4DV3 Q;  1U9R A;  1EY4 A;  3G7L A;  5FJ8 H;  1XNQ L;  1XMO L;  5IYD H;  1SYB A;  4C3J B;  1U0L A;  1CHP D;  1CFM A;  1OO9 B;  5IWA L;  1I94 Q;  3T1H Q;  2ZT9 C;  1G6P A;  5KIX A;  5C0X I;  2F0M A;  3BDO A;  1V1P B;  1QVC A;  2EJM A;  4LFA L;  3OWE B;  3I4N H;  5IIF A;  4JYA L;  1BBU A;  1IKL A;  5M5X B;  1ZEQ X;  3F2B A;  4PZ6 A;  4GLX A;  1VQP A;  4ZYS A;  1AFP A;  1EWI A;  1HA5 A;  3PUY A;  1E1O A;  1VQO A;  1CM9 A;  2NVQ B;  1VQG A;  2VB3 X;  1VQ7 A;  1HUN A;  3HKS A;  3LWE A;  2HT1 A;  2CVR A;  2Y0S G;  1BNZ A;  1DD2 A;  1ZKO A;  4DN4 M;  2R61 A;  1B9M A;  3WOF A;  3IRB A;  1V43 A;  3GTQ B;  2PZT A;  2VQE L;  5EKL A;  1BKB A;  2F0T A;  1KAB A;  5BR8 Q;  3OMG A;  1SYE A;  3IFT A;  1WCM H;  3OWF A;  3RN2 A;  2K28 A;  4DAM A;  2JSO A;  1N34 Q;  2B2Y A;  4DF7 A;  4A3M H;  1XNR L;  1ZXT A;  2NWG A;  3J7Z C;  2QDL A;  4C3J G;  1NNX A;  2SNM A;  1PH6 A;  3BVM A;  2UUA L;  1PLF A;  5D14 A;  1B3A A;  2LSS A;  3LGJ A;  4IUP A;  1IYU A;  2R93 G;  2SNS A;  2DJG C;  1BO0 A;  4CDC C;  2KOL A;  1I4R A;  1QNK A;  2EYM A;  3F2U A;  3ERQ A;  2K04 A;  4MTN A;  4H13 C;  1EEI D;  2J0T D;  2K75 A;  3MEH A;  2K50 A;  3E0J A;  4BBS G;  1HQR D;  4FDB A;  1SE2 A;  2VXW A;  1K3B C;  4HCS A;  1S72 A;  1I50 B;  1SXT A;  2RDH A;  3U9O A;  3ZYY X;  1AH9 A;  3I4L A;  3I72 A;  3GTO H;  3K5L A;  1SFO B;  1X32 A;  4X65 Q;  3U58 A;  3A8J E;  1WI5 A;  2F0F A;  4J6H A;  1ICW A;  2LS0 1;  4F88 A;  2UU9 Q;  2UXC Q;  4LUO A;  2RHQ B;  3J7A 5;  4GN5 A;  4IQZ A;  4JI7 Q;  2VW9 A;  2L12 A;  2PQA A;  4A75 A;  1BCP B;  4A3B B;  4I7Z C;  3PF5 A;  2OXP A;  3DEP A;  4G7Z C;  2Z9H A;  2EY6 A;  1PH4 A;  4GKJ Q;  1STY A;  1K8M A;  1U4P A;  1HPC A;  4LF5 Q;  3I8Z A;  1A8V A;  1S5F D;  2K5W A;  4IOC A;  5LMU Q;  2IT1 A;  3NQT A;  3NHH A;  4L5S A;  4J15 A;  4DV5 Q;  5GAD C;  5M5W B;  2HHH L;  1TS4 A;  2E76 C;  3W1G A;  4DV6 L;  3GTL B;  1Z7T A;  5J1Z A;  3D4W A;  4JI8 L;  3Q22 A;  1A3V A;  2MO1 A;  5JVG 3;  2XWJ B;  4IJL A;  4NXN L;  1QUQ B;  2KEN A;  2E5L L;  4LFB L;  2SOB A;  3D8G A;  1VQM A;  5IE8 A;  3PQI A;  4J1M A;  5C5L A;  1B70 B;  2L1B A;  2HQL A;  4U67 3;  4XDX A;  1PRT D;  3GTG H;  3OYY A;  2UXB Q;  2Q8R E;  1GXD C;  2CCZ A;  2Q2H A;  3NWT A;  4BWG B;  3QIA A;  2ZM6 Q;  2WAQ G;  4HSP A;  1Y1V B;  3ONA B;  4CDD C;  4DK0 A;  2HIV A;  5IT9 L;  2P5Z X;  5C3E B;  3M3Y B;  1CUK A;  2K5D A;  1W6J A;  4PG3 A;  2E74 C;  4A3B G;  3AB9 A;  2FHT A;  4DR5 Q;  1R9T H;  3A5U A;  1JE4 A;  1DON A;  3NEN A;  1UE1 A;  2L11 A;  5M3M B;  2MNA A;  4BBR B;  1PYW D;  2OTL A;  5ELO A;  3MFG A;  3P20 A;  2BH8 A;  1Y8N B;  1E2Z A;  1B50 A;  3S2D B;  4IUT A;  4CKE A;  2ICE C;  3SE0 A;  3AFP A;  1ROD A;  3WOE A;  3CMA A;  1LT5 D;  1XMQ Q;  5M5X H;  3CD6 A;  2KCM A;  2ZTD A;  4PMB A;  1KIX A;  5H1S E;  3NE5 B;  3D4D A;  4QIW B;  1N36 Q;  1HQM C;  1U4L A;  3ERO A;  3U4V A;  5DAU A;  4H02 A;  3S17 B;  1FD7 D;  5I2X A;  4JOI A;  2AHO B;  4UDU C;  3D31 A;  3UDG A;  5EKI A;  5COY A;  1I4P A;  1X6O A;  1NY4 A;  4YCV A;  1FGB D;  2F0S A;  4NPS A;  4N8F A;  1N33 L;  1Y1V G;  1BDO A;  2NVT B;  3TP8 A;  4HSV A;  4JI2 L;  2K03 A;  3EN2 A;  5C3E G;  2JE6 I;  5C4Z A;  2F0N A;  2A74 C;  1VQN A;  1Q82 C;  5IOC A;  1X3Q A;  2Q8I B;  3K81 C;  1ONL A;  4BA2 I;  2F0U A;  3JAM E;  1CA6 A;  1EIH A;  1TWH B;  5M3M G;  4BBR G;  3MXP A;  4MNO A;  5KNB A;  3E9I A;  1S40 A;  1WTP A;  4BY1 B;  1VQE A;  2EXD A;  3KBX A;  3KF6 A;  4LF4 Q;  3NEL A;  4A3G B;  4JVZ A;  2QDB A;  3S24 A;  3T13 A;  2YTX A;  1PH1 A;  4YHH Q;  4OWT B;  2EOT A;  5E3F A;  5C0X H;  1TS5 A;  1X3P A;  1I50 H;  2FIN B;  5GAH C;  4KN7 C;  4ZUJ A;  1SRO A;  4DV2 L;  4BXX G;  1SFO H;  4IPC A;  3ZJY C;  1EY7 A;  3RNU A;  1BCP C;  4HR7 B;  5JJZ A;  4JI3 Q;  2QF7 A;  2GVB A;  1UWV A;  1UNS A;  2WAQ E;  1STE A;  2I5M X;  1VQI A;  3CRK C;  3W3A A;  1D2B A;  3SGI A;  2R7F A;  5BN3 A;  4A3B H;  4JV5 L;  5DM7 3;  4JI0 Q;  1V9P A;  2C5C A;  1GUN A;  1TT2 A;  3J81 E;  1T5X D;  5K5P A;  3S1M B;  1B8A A;  2QW7 A;  4JW0 A;  3KLR A;  2IJ0 A;  4X62 Q;  2IX0 A;  1CKM A;  2BE5 D;  2EPB A;  4CDF C;  1HNX L;  2MJ8 A;  4JBW A;  3R93 A;  3A0J A;  2BE5 C;  2D62 A;  5ELN A;  4BY1 G;  1VQF A;  4B3T Q;  4AYB B;  4A3G G;  4APV A;  1OTC A;  2F0W A;  2CW0 D;  1NSN S;  2ALY B;  2K5V A;  3GP7 A;  5E4W C;  1I4G A;  2RKS A;  3L2P A;  2VUM H;  4ODG A;  1S5D D;  3F2C A;  3NBH B;  2EZV A;  2K33 A;  5FO7 B;  3VYS A;  3GTM B;  5FLX L;  2I07 B;  1HXY D;  2EE1 A;  3ICE A;  1AW7 A;  2K6A A;  4JC0 A;  1YJN A;  1CQV A;  3VYR A;  2BA0 A;  4DUZ L;  4DV3 L;  4Y52 H;  2E2J B;  3HS0 C;  5C3E H;  2IPK D;  4HJ9 A;  1I94 L;  4BA1 I;  4GZY C;  3G71 A;  3M4P A;  1PH3 A;  2EYP A;  1CQF A;  1JC7 A;  2X6L A;  4POG A;  2D0O A;  1CKN A;  3GTP H;  4BBR H;  2F0I A;  4H0L C;  3MXN A;  4G57 A;  4TKO B;  1P8L A;  2A6H D;  3S16 B;  2EYJ A;  3OTO Q;  1A0I A;  3I56 A;  3SK8 A;  3VR6 A;  2A6H C;  3S2D H;  1EY5 A;  1D1I A;  1VQH A;  2K4K A;  1XXG A;  4MHE A;  2UUB Q;  2L9H A;  1FNU A;  1CKO A;  2B2U A;  1K83 B;  2RVL A;  3SHL A;  3KDF B;  3LX0 A;  4XQQ A;  1XYI A;  4A3E B;  4R9W A;  2EDG A;  1CSQ A;  3PUX A;  1G51 A;  5EBC A;  1L1O A;  2WAC A;  3C46 A;  5IP7 H;  1JB7 A;  3S17 H;  3MHB A;  1WTV A;  2J7Z A;  2F0O A;  1EWH A;  1YNX A;  4CBV A;  5BR8 L;  4DR7 Q;  1O7L A;  2K5N A;  2PYK A;  3J80 E;  1N34 L;  3S14 H;  3X3N A;  2UXD Q;  1B3Q A;  3J7A V;  4DV4 Q;  4TQU S;  1I6H B;  1TQO A;  3CPF A;  4OON A;  4PZ7 A;  5ELE A;  4MN3 A;  1N8R C;  3DWQ A;  1JB3 A;  3FDT A;  4A93 H;  3C1E A;  3Q6S A;  5AJ3 Q;  3DMU A;  1TWH H;  3HRZ C;  3TZD A;  1HCZ A;  2AUK A;  1NR2 A;  4KV6 A;  4A3D B;  1A15 A;  1VQK A;  4HMI A;  4A3K B;  2N3S A;  3PSI A;  3MXG A;  3NP8 A;  4TVA B;  1U4M A;  1X55 A;  5JVH 3;  4XTC S;  1IBL Q;  4X65 L;  1HTP A;  5I2Y A;  4IFD I;  2HQE A;  4EX5 A;  1VQC A;  2UXC L;  1LTS D;  1A63 A;  1IL2 A;  1IW7 D;  4JI7 L;  5KRU A;  4DAP A;  4KY7 A;  4FF1 A;  3CC7 A;  3BJU A;  3PGZ A;  3P7J A;  1IW7 C;  1R4P B;  1PFM A;  4TRD A;  3TSS A;  1XX8 A;  1GUG A;  4GKJ L;  4FF2 A;  1IZ6 A;  1IKM A;  1C7Y A;  2BA1 A;  5CV6 A;  4DV5 L;  3D6C A;  2UUC Q;  1QB5 D;  2F0G A;  1GOZ A;  4QL5 A;  3HOV H;  3S1M H;  4A76 A;  1TY0 A;  2R92 B;  5LMN W;  1XPR A;  2BDO A;  2MGS A;  5JJL A;  2F1M A;  1QCB D;  4ZAI A;  2Z6K C;  3I4O A;  5J39 A;  1Q90 A;  1SE4 A;  4C1N K;  1U5K A;  2QEJ C;  2CQA A;  4A3D G;  4DXF A;  4A3L G;  4DFA A;  1VQ6 A;  1YHB A;  3VYU A;  4GS3 A;  4RFB A;  4LJZ C;  4QF4 A;  1KDA A;  2F03 A;  2O4X A;  3A8I E;  4IZ8 A;  2YU9 H;  2R7Z G;  3K7A B;  4FYD A;  2ZM6 L;  3CXC A;  1SYD A;  1FGU A;  3I3C A;  1NBW A;  1HUM A;  3CRL C;  4OHJ A;  1HR0 Q;  1TWC H;  2F0P A;  1QZG A;  3GTM H;  2ZTE A;  1YVC A;  5NUC A;  3GQB A;  4XT3 B;  4K0K Q;  2RHS B;  5FLX c;  3MWY W;  5KYL A;  4WOR A;  3NBI A;  1KDB A;  5JEA G;  1O78 A;  4GOP A;  3BDC A;  4RMF A;  4S3S A;  1Y8P B;  2B2T C;  1RHP A;  2BH2 A;  5CV7 A;  1NE3 A;  2XTI A;  1L0X B;  4Z9C B;  3KLS X;  3K58 A;  1XMQ L;  4FXK C;  4YWM A;  2KEE A;  3CP0 A;  4C1N I;  1ESR A;  1STB A;  4DAY A;  1N36 L;  3OOC A;  3PO3 H;  4JBK A;  3UI2 A;  3M9B A;  3GTJ B;  1K83 H;  3E0E A;  4BY7 H;  4O0A A;  3J81 c;  2KUM A;  3A54 A;  1Y1W B;  5DNF A;  4A3E H;  3F8T A;  1JT8 A;  3TBI B;  2B8G A;  4HCE A;  3T4A C;  2D0P A;  1BUV T;  4FF3 A;  4K8I A;  1YI2 A;  1DGS A;  4YCW A;  3S1N B;  3ND8 A;  1UEA B;  3KF8 A;  3URY A;  4KN4 C;  2F0Q A;  3IAY A;  1Q3L A;  3CAM A;  4IOA A;  3KLS A;  2NYZ D;  1HNW Q;  4IFD G;  1LTR D;  3CCS A;  2HDL A;  4HJ8 A;  4WFN 3;  2EQS A;  5HY6 A;  2PQA B;  1HTL D;  3TP6 A;  3Q23 A;  5LMN Q;  4KMU C;  1H9S A;  3I70 A;  5IYB H;  1XWE A;  2R93 B;  3I4M B;  1CI3 M;  3K7U C;  1SN8 A;  4ME3 A;  4ZUI A;  1NUC A;  1TU2 B;  3IKJ A;  1PHJ A;  2JA8 H;  1HH2 P;  4YHH L;  1O7Y A;  4BBS B;  4OO1 I;  4A3K H;  5I9P A;  5A35 A;  3M4Y A;  2B63 H;  2YYZ A;  2K1B A;  2E8G A;  2WB1 E;  4I65 A;  1XJV A;  4ILW A;  1M4V A;  3HOU H;  1Y1W G;  3HEJ A;  3A56 A;  2JK8 A;  4KJN A;  1JQY D;  3NQI A;  1H9J A;  5IGB A;  2IHE A;  1SND A;  2I5L X;  2ES2 A;  3S15 H;  1K8O A;  4JI0 L;  1CZG A;  1LTG D;  2AQ3 B;  2CQO A;  2Z1C A;  3T1Y L;  1ENA A;  3RZD B;  4RGM A;  2G5D A;  2B2W A;  4L5T A;  1PTO F;  1X9N A;  1HNZ Q;  1EYC A;  1K3R A;  1E0B A;  1ENC A;  1KNA A;  1YZ6 A;  5JEA H;  1JR0 D;  4X62 L;  1IBM Q;  2B8F A;  2RBM A;  5A2Q L;  2VS1 A;  4HJ5 A;  4R4I A;  1Q12 A;  5IGF A;  1EOV A;  4DR6 Q;  3FPP A;  2R92 H;  1PMR A;  4B3T L;  3I4M G;  2OF1 A;  2AQ1 B;  2GVA A;  2ICI A;  2A69 D;  3GTK B;  3CC2 A;  4FVM A;  2R6G A;  3M7G A;  3SXH A;  1SNM A;  2A69 C;  1WTW A;  3C2P A;  5K36 G;  3J7Y W;  4R4Q A;  3S1R B;  1LTI D;  2JYO A;  3H91 A;  2CWP A;  2WAQ B;  1G91 A;  3CCL A;  1W3S A;  3GV3 A;  5G3L F;  3AMU A;  1YIT A;  1MBY A;  4L63 B;  1SMY C;  2VL6 A;  3M4O H;  5GAG C;  5IGD A;  4G7H C;  4LWC A;  4CHT B;  4ZKC B;  4IFD H;  4IUN A;  1S4Z A;  5I6W A;  2JQO A;  1E3P A;  2F3I A;  2NVX H;  2EYL A;  1WTX A;  1TWF B;  2B2Y C;  4H44 C;  1TWG B;  3GO5 A;  4GN3 B;  4UY8 C;  1TR5 A;  3BDL A;  1TWA B;  3OTO L;  4WJW A;  1E2W A;  2B29 A;  2F4I A;  4OIJ A;  5DLQ E;  1Y8O B;  5GAE C;  4LF6 L;  1B53 A;  3HOY B;  1F2M A;  2A6E D;  3D6W A;  3ULL A;  5L37 A;  1F9Q A;  2L5T A;  1Q46 A;  4CKB A;  4NMZ A;  3DM1 A;  2A6E C;  1YNN C;  1GUO A;  4K5W A;  4R4T A;  4DV1 Q;  2WKD A;  2KEC A;  1DOM A;  1PZJ D;  1HZB A;  2KHS A;  4KY6 A;  1VMP A;  4WRD A;  4Y7N B;  2DY7 A;  5LHY 1;  1FJG Q;  3KF6 B;  3BU2 A;  3GTJ H;  3NPP A;  2JA9 A;  1RJT A;  1XPU A;  3E3X A;  5C0X J;  2XGT A;  4DR7 L;  1Q8I A;  2OEO A;  2F0K A;  2O2L D;  2RA4 A;  2F0V A;  4YWL A;  3D3R A;  4OO1 G;  2UXD L;  3S1N H;  4C2M B;  3MZ5 A;  2BDN A;  2OCE A;  1Q1E A;  1QOH A;  2Q2U A;  1FNW A;  4NDX A;  3HZX A;  4CKC A;  1A6X A;  3NTI A;  1V1Q A;  5TSS A;  4DK1 A;  4IJH A;  5C44 B;  3TME A;  1EFW A;  1UE5 A;  2DJF C;  1Q86 C;  1BR9 A;  1O80 A;  3K5M A;  4ZCK A;  1LTA D;  4C3J H;  4B3S Q;  4DR4 Q;  1ML0 D;  4IPD A;  1NAP A;  4GNX A;  1HZC A;  4OIK A;  1BOS A;  4DUY Q;  2R93 H;  2NN6 G;  4A4I A;  3I4M H;  3HOY G;  5GRO A;  2XVS A;  5IGE A;  1QE6 A;  5AFW A;  1ESF A;  1EQQ A;  1YHA A;  2JA6 B;  3M4Q A;  3CCM A;  1IBL L;  1EL0 A;  3SDZ A;  2PNH A;  1JE5 A;  2PNR C;  5BN4 A;  2E2I B;  4BBS H;  4LW1 A;  2IL8 A;  5K36 H;  3KFU A;  2BOS A;  4N8X 1;  1PZK D;  1DJR D;  2DY8 A;  2K01 A;  3MAQ A;  1HRJ A;  4B3M Q;  3HKZ E;  1BVS A;  4LUZ A;  2NVQ H;  4MTK A;  4X66 Q;  3HG9 A;  3FKI B;  1RCV D;  1ICF B;  2XSC A;  1X56 A;  1Q7Y C;  3K59 A;  1GD7 A;  1EWC A;  1I4Q A;  4JI1 Q;  3J81 i;  3GTQ H;  1DZ1 A;  2MHV A;  4OEM B;  2UUC L;  4RCN A;  1YJW A;  1BBX C;  3RZD H;  4DNI A;  1KC8 C;  3FP9 A;  5C44 G;  4OX9 L;  1RL2 A;  1S5C D;  1I4X A;  3CME A;  2KCT A;  3RR5 A;  3CQZ B;  1S3O A;  3S2H B;  3V05 A;  1EIY B;  2Z6B A;  2MPM A;  3QO2 A;  1CKN B;  4OWX B;  2VY3 A;  3NEM A;  2JA6 G;  3OIQ A;  1N32 Q;  1R4Q B;  3GTK H;  3MXN B;  4AH6 A;  4POF A;  1LV9 A;  4P74 A;  1RKN A;  2VZA A;  4V19 0;  1HR0 L;  4CJ1 B;  4C56 C;  4X64 L;  1XNQ Q;  2WIN B;  3AQQ A;  2Q8T A;  1A3U A;  2XWB B;  3S1R H;  2AQ2 B;  1BCP D;  4O1N A;  4DR3 Q;  3PO2 B;  1LTL A;  1WTO A;  5IWA Q;  2M00 A;  4JOI C;  4K0K L;  1QUQ A;  4L8J A;  1GKH A;  4RCO A;  3FKI G;  5JPM C;  4OO1 H;  1QNU A;  4KD3 A;  1U4R A;  2ZJP A;  1L1O B;  1NMF A;  1V8Q A;  5M5Y B;  3FPU B;  1HA6 A;  4R4O A;  1DOL A;  1FR3 A;  1VCI A;  3BZC A;  2WP8 J;  1D5Z C;  1B1Z A;  1X3G A;  5M3F B;  2MQH A;  4NW2 A;  3CCU A;  1TWF H;  4HMJ A;  4RHR A;  1TWG H;  1K8G A;  1TWA H;  3J7A F;  3H3V C;  1VS0 A;  1MJC A;  2X69 A;  1F9R A;  3H0G B;  3PIP A;  3CF5 A;  4HJ7 A;  5M5W H;  3CCQ A;  3GTL H;  1PRT F;  3H94 A;  5DM6 3;  4LFC Q;  1G8Z D;  1YHQ A;  3NTH A;  2HIX A;  3N52 A;  3H3V H;  2PMZ E;  1TKW B;  2N78 A;  2D5D A;  1MKH A;  2V1C C;  1E7Z A;  2VQE Q;  4XYQ A;  5HUR A;  3TRE A;  1I6V C;  3JAM L;  2V4D A;  4Y7N H;  1J6Q A;  1D8L A;  1TS3 A;  3SR1 A;  2NB0 A;  1ENF A;  1LT6 D;  2GA4 B;  1X54 A;  1IBK Q;  1L0Y B;  3HGB A;  3IFD A;  1F9P A;  3PO2 G;  2UUA Q;  2NZO A;  4KHV A;  1AEX A;  1HNW L;  4DR2 L;  2OQK A;  1MIU A;  1Y1V H;  4C2M H;  4QCL A;  4OGQ C;  3QB3 A;  3KOJ A;  2CKZ B;  3M3Y H;  1QZH A;  1MD2 D;  1BF4 A;  3T1H L;  4P71 A;  1LYL A;  2FMM A;  5ELF A;  3V2T A;  1PYS B;  2F0E A;  4X3U A;  3N6R A;  4E6I A;  3V96 A;  3VR3 A;  4KKU A;  5M3F G;  4EVO A;  3TP5 A;  2FJ2 A;  2VB2 X;  1SEB D;  2JA7 B;  3W5O A;  5M3M H;  1GHJ A;  3GDE A;  4RA8 A;  3HP3 A;  3SK5 A;  1EEF D;  3WWV A;  3H0G G;  5EPJ A;  4DR1 Q;  2Q2T A;  1C9O A;  3J81 L;  2JA6 H;  5C3W A;  3SK6 A;  4B08 A;  2IHF A;  1WTH A;  3T51 B;  1VQJ A;  5ELD A;  1T9H A;  3ITP A;  4EQ5 A;  2KED A;  4HIK A;  1F2Z A;  1AE3 A;  1EZ6 A;  1SLJ A;  2K7V A;  5IGG A;  4OL7 A;  4I7A A;  4FP5 D;  4KTA A;  4CJ2 C;  3LNN A;  4BXX H;  2PZU A;  1JWS D;  4YY3 Q;  2F0J A;  3E9H A;  5KYI A;  3FKI H;  1P16 A;  4DGZ A;  4LF9 Q;  3X3M A;  3T56 B;  3U50 C;  1EY9 A;  4KY5 A;  4C3H B;  1QVF A;  4OEL B;  1IBM L;  3SK4 A;  2NVT H;  4K5X A;  3MA2 B;  1SE8 A;  3NUC A;  5T1G A;  4DR6 L;  4IUV A;  2AWO A;  4NXN Q;  4X3T A;  3MEF A;  2E5L Q;  1E2V A;  4LFB Q;  2L15 A;  4PV1 C;  4QUC A;  4A3I B;  2VQF Q;  1WTR A;  1MHW C;  2EVB A;  2R7D A;  3P1H A;  1VMC A;  1B7Y B;  5I4D A;  3CCV A;  1MSG A;  2JA7 G;  2KHI A;  3CQZ H;  3S2H H;  2F3W A;  4XQN A;  1JOQ A;  2WB1 B;  5J22 A;  2I0Q A;  3RZO B;  4BY1 H;  3EFX D;  4K6D A;  4A3G H;  3BZD B;  3DWA A;  1QIL A;  1YBY A;  2B2V A;  2B2U C;  3S1Q B;  2F52 A;  2R7Z B;  1G6Z A;  3TP7 A;  3CKI B;  4O2D A;  4UPA A;  1WD1 A;  4IUR A;  2UU9 L;  2DNE A;  4ZRZ A;  1L1O C;  2NBF A;  4QB4 A;  1OXT A;  1JJ2 A;  1WFQ A;  2O5I C;  3OW2 A;  4OWW B;  3FMC A;  1OXS C;  2PPB C;  3RMH A;  5I6Y A;  1MGS A;  4C3H G;  2C35 B;  2EIF A;  1AN8 A;  5IOD A;  3C1F A;  3U9S A;  2SDF A;  1PH5 A;  4A3F B;  4LF5 L;  1C8C A;  5LMU L;  5M3F H;  4HN7 A;  5EPK A;  1SAP A;  1DYQ A;  5FOB B;  3J80 L;  4LNQ A;  3VDY A;  4LF7 Q;  4A3I G;  4EQO A;  3E6Z X;  4LF8 Q;  5D3D A;  1UE7 A;  3HOZ B;  3H0G H;  1SNQ A;  3TQY A;  1H9S B;  5EGT A;  1FJG L;  3DWP A;  4G4K A;  4A3M B;  2WB1 G;  4DK3 C;  3H09 A;  5FJ8 G;  5IYD G;  2RSN A;  2I46 A;  1PH2 A;  2UXB L;  3W1B A;  3W2D A;  5EPL A;  5FLM G;  1YJ9 A;  3S9W A;  4IPG A;  1E22 A;  1QVG A;  4DK6 C;  3JAM c;  2NUC A;  3A8K E;  3EBE A;  3L0O A;  2YTY A;  2RCN A;  4JI6 Q;  1TXY A;  4KHP Q;  4A3C G;  4N9T A;  2QA4 A;  2EXZ A;  3G6J B;  2E2D C;  1SYG A;  1EIG A;  1SJE D;  1M1K C;  3A7L A;  4DV0 Q;  2JA5 B;  1XPO A;  3A55 A;  1AZQ A;  2K32 A;  4JI5 Q;  4UP8 A;  4DR5 L;  3OIP A;  4K8J A;  4DR4 L;  4P2C B;  2E2J H;  1PFB A;  1SJH D;  4GLA C;  1HFG A;  4NB3 A;  2EY1 A;  3GTO B;  1SYF A;  4NKL A;  1LLR D;  5EQ0 A;  3PV0 A;  3EQL C;  3RLN A;  5JEA J;  4A3F G;  1PXU A;  4MZ9 A;  1WYD A;  4C3I B;  2NVY B;  2JA7 H;  1EQT A;  5BN5 A;  1DOK A;  3EVQ A;  3S16 H;  3HOZ G;  5IP9 G;  2Z0S A;  3MTS A;  1WCM G;  5CR3 A;  4B3M L;  1F77 A;  1JOR A;  1IYJ B;  4A3M G;  1KHI A;  3VR4 A;  4WJ3 M;  5HGQ A;  4B3R Q;  4MIU A;  1GUT A;  1MJE A;  1PDQ A;  3TS2 A;  5ISR A;  1DXM A;  2ATW A;  1F2Y A;  2OTJ A;  2K5H A;  4LAA A;  2F4V Q;  2MFI A;  5GQO A;  4JI1 L;  1SNC A;  4P75 A;  1EUJ A;  2L0C A;  2PW5 A;  3OHX C;  1SR3 A;  1KDC A;  3STB D;  4UAI A;  5C4J B;  3VA5 A;  2JA5 G;  5D3I B;  1UAP A;  2Z8L A;  1XTC D;  1HJP A;  2XIW A;  3STB C;  1GJX A;  4KD4 A;  1GUS A;  4JG2 A;  2CWA A;  1KRS A;  2EYH A;  1I6H H;  1WD0 A;  3KUP A;  4DKA C;  5JJK A;  4NXM Q;  1Z9F A;  3A7A B;  4FF4 A;  1GVP A;  1Y69 U;  4A3I H;  4LF4 L;  4C3I G;  1N32 L;  3DEO A;  1ZYR D;  3UDI A;  2ENB A;  4DV7 Q;  4A3D H;  1ZYR C;  3CC4 A;  4A3L H;  1OXV A;  1AE2 A;  3RZO H;  3HKZ B;  3Q8D A;  4QY7 A;  1R9T B;  1K9M C;  5FLM H;  4DR3 L;  3TEH B;  1A2U A;  3UDX A;  2WFW A;  2R7Z H;  3S1Q H;  1EFI D;  2OT2 A;  1B4O A;  1DCZ A;  2AMC B;  4JI3 L;  1TS2 A;  1X3E A;  3T16 A;  4A3C H;  4JPB W;  2EYF A;  1Z47 A;  1F9S A;  3K57 A;  1X65 A;  1KTK A;  2NN6 I;  3K8A A;  4RGO S;  1NR4 A;  1B9N A;  1EYD A;  4A3J B;  2X6G A;  3AU7 A;  3QOJ A;  3H3V I;  1BBW A;  4HIM A;  4A3F H;  1PZI D;  1D5M C;  2L4N A;  3PF4 A;  3EIV A;  2DNC A;  5EBD A;  2E2H B;  1LO5 D;  1Q1B A;  4LFC L;  2F0D A;  3D4R A;  2B39 A;  1NJI C;  3DLL A;  3DXJ C;  5CBA E;  5CMD A;  1C48 A;  2PQE A;  1D1K A;  2F0L A;  3HOZ H;  5IP9 H;  3J80 c;  3F2D A;  4GNX B;  3KK7 A;  4Q5V A;  3RUZ A;  1H9R A;  4M8A A;  5ELB A;  1IBK L;  3NSW A;  3HKZ G;  3G4S A;  3OW7 A;  3L3O C;  1VQL A;  1LM0 A;  3K7A H;  3H6M A;  4GN4 B;  1PH7 A;  1M8A A;  1SMY D;  2IWH A;  2L55 A;  4L6T B;  3RD4 A;  1N9W A;  1QWY A;  2CH4 W;  1GM5 A;  3PIP 3;  2FMC A;  3BVZ A;  3AYH B;  2JA5 H;  1A3T A;  1AZP A;  2QIL A;  1YIJ A;  1KLU D;  1K0R A;  2A68 D;  5C3X A;  5KEE A;  1WOC A;  1E24 A;  4A3J G;  1WJJ A;  2XRQ D;  2SEB D;  1EY0 A;  1J5E Q;  2B2W C;  5IT9 E;  1STG A;  3BYY B;  4XXE A;  4GKK Q;  3EA6 A;  4K14 A;  2A68 C;  1CT1 D;  3QWN A;  4UHV A;  1RIP A;  3HOW B;  1PFN A;  3BG3 A;  4ME5 A;  1CZW A;  4DR1 L;  2DN8 A;  4C3I H;  3I55 A;  2PMZ B;  1YNN D;  3MXU A;  5CV5 A;  2NVY H;  3VYT A;  1KLG D;  2UUB L;  4DNR B;  4PMW A;  1PH9 A;  4DAV A;  2VNU D;  4P72 A;  4YWK A;  5C4X B;  4QUF A;  4IO9 A;  5EJW A;  3Q0A A;  4DPG A;  3C3L A;  1V1P A;  1KNE A;  5LL6 S;  2ZJR A;  1KRT A;  4ZLT F;  4JI4 Q;  1UEB A;  4KKS A;  4YY3 L;  5T1I A;  4PNY A;  5JAV A;  1L2F A;  3E5S A;  3FVQ A;  1Y1W H;  4LF9 L;  1SYC A;  3SEB A;  1B2T A;  2M9V A;  4K6L A;  3HOX B;  1D7Q A;  4X6A H;  5ELC A;  2QKI C;  4JCV E;  1EY8 A;  2HDM A;  4DV4 L;  3UE0 A;  1VQ5 A;  2NTT A;  5C4J H;  3F1Z A;  2ASB A;  1SSO A;  1QJO A;  3CCR A;  2VUM B;  2PI2 A;  3JAM i;  5C0X G;  2VQF L;  3PMF A;  3K0Y A;  4XYO A;  5AJ3 L;  2NZ1 D;  3PCO B;  4AQY Q;  1F2L A;  3ULP A;  1K8A C;  5FK9 C;  1EQV A;  2KBN A;  1VF5 C;  1IYV A;  1PRT C;  3HOW G;  1LT4 D;  1VQD A;  2Y0S E;  1II3 A;  2H1E A;  4KK7 A;  1E1T A;  2XN9 C;  5DEH A;  1G29 1;  3K0X A;  3TZU A;  1SMX A;  1FYC A;  5J3B A;  1SDF A;  1LT3 D;  4KHZ A;  1RD9 D;  4YIJ A;  5C5M A;  2RDF A;  5C4X G;  1D6E C;  2AUJ D;  4JBM A;  4IN3 A;  1YNJ D;  3GTP B;  4K2K A;  4DXG A;  4FXD A;  5E1F A;  2K05 A;  1YNJ C;  4K5V A;  4R8I A;  2MO0 A;  1WTQ A;  3A5Z B;  3GD7 A;  1IHZ A;  4RGN A;  2EYO A;  4AIM A;  2QGQ A;  1PA6 A;  3HOX G;  4X3S A;  1JWU D;  3A74 A;  3G6E A;  2R3Z A;  2PO4 A;  4PQX A;  3VR2 A;  1D5X C;  5IY0 A;  2LMC B;  1ET6 A;  1STN A;  3I91 A;  2N49 A;  1KL9 A;  4H7B A;  4A3J H;  1JMC A;  2IX3 A;  1K28 A;  2QCP X;  1O7I A;  2VUM G;  1J8I A;  4LF7 L;  2JXM B;  2KA7 A;  1UUP A;  4LF8 L;  4XQJ A;  1Y14 B;  4NP5 A;  4TSS A;  1ILQ A;  3UE1 A;  1EYG A;  2E2H H;  4GNX C;  2NZH A;  4B9X A;  2EJF C;  3M85 A; 
#chains in the Genus database with same CATH homology
 3JC6 6;  2K75 A;  5JEA G;  2ZTC A;  2JEA I;  2K50 A;  4BBS G;  4GOP A;  4BXX H;  2PI2 E;  1VQ8 A;  4FDB A;  4YY3 Q;  4RMF A;  3E9H A;  1S72 A;  3FKI H;  1P16 A;  2DGY A;  4LF9 Q;  2BH2 A;  1AH9 A;  1NE3 A;  2XTI A;  3U50 C;  3GTO H;  2N8N A;  1QVF A;  4X65 Q;  3U58 A;  1IBM L;  1XMQ L;  1WI5 A;  4JI6 L;  2NVT H;  4KHP L;  2UU9 Q;  1XMO Q;  4LUO A;  4YWM A;  3CP0 A;  1SE8 A;  2RHQ B;  2UXC Q;  3J7A 5;  4GN5 A;  1N36 L;  4DR6 L;  4JI7 Q;  2AWO A;  2VW9 A;  4DV0 L;  4NXN Q;  1SRU A;  3MEF A;  2E5L Q;  4L5Q A;  2PQA A;  4JBK A;  4LFB Q;  3CCE A;  2L15 A;  4A75 A;  3M9B A;  1K83 H;  3E0E A;  4BY7 H;  4O0A A;  3J81 c;  4JI5 L;  2VQF Q;  1GO3 E;  3PF5 A;  1KAW A;  2R7D A;  3K80 C;  4A3E H;  3F8T A;  1B7Y B;  1PH4 A;  3CCV A;  1JT8 A;  2D0P A;  4LFA Q;  2JA7 G;  1YI2 A;  4GKJ Q;  2KHI A;  3CQZ H;  3S2H H;  3J81 j;  1DGS A;  2I0Q A;  5IYC G;  4YCW A;  4LF5 Q;  4BY1 H;  1A8V A;  4JYA Q;  4IOC A;  5LMU Q;  2IT1 A;  3I7F A;  4L5S A;  4J15 A;  4DV5 Q;  5GAD C;  1PH8 A;  2HHH L;  3TS0 A;  3PUV A;  3W1G A;  4DV6 L;  4A3G H;  3KYH C;  5IP7 G;  2ZJQ A;  4IOA A;  1YBY A;  3CAM A;  4IPH A;  2F52 A;  1HNW Q;  3HOW H;  4JI8 L;  4IFD G;  4O2D A;  4UPA A;  3CCS A;  2MO1 A;  4HJ8 A;  2UU9 L;  4QGU A;  2EQS A;  5HY6 A;  3HOY H;  3D0F A;  2PQA B;  4IJL A;  1L1O C;  1OXT A;  1JJ2 A;  4NXN L;  1QUQ B;  2KEN A;  1WFQ A;  5LMN Q;  2E5L L;  4LFB L;  3OW2 A;  4B3R L;  1VQM A;  5IE8 A;  4OWW B;  5IYB H;  2RF4 A;  1B70 B;  1OXS C;  3AFQ A;  3K7U C;  2HQL A;  5C4X H;  1SN8 A;  5JJI A;  3GTG H;  2UXB Q;  3OYY A;  3T1Y Q;  4ME3 A;  2CCZ A;  2Q2H A;  1JJG A;  1PHJ A;  2JA8 H;  1HH2 P;  2F4V L;  3KJO A;  2ZM6 Q;  4YHH L;  2C35 B;  2CFM A;  2EIF A;  2WAQ G;  3L7Z C;  1PH5 A;  3DM3 A;  1XNR Q;  4OO1 I;  4A3K H;  4LF5 L;  4A93 G;  3TRZ A;  3J80 i;  5LMU L;  1K73 C;  2HIV A;  2B63 H;  2YYZ A;  5M3F H;  2E8G A;  2WB1 E;  3AEV A;  1CUK A;  3HOX H;  4PG3 A;  4LNQ A;  3ERS X;  3VDY A;  4LF7 Q;  1XJV A;  1H95 A;  4A3I G;  4A3B G;  4LF8 Q;  3HOU H;  1Y1W G;  1UE7 A;  3H0G H;  4DR5 Q;  1R9T H;  2JK8 A;  3A5U A;  3TQY A;  1VQA A;  3NEN A;  1UE1 A;  4NXM L;  3H15 A;  2IHE A;  2I5L X;  5LMN L;  2ES2 A;  2MNA A;  2OTL A;  1FJG L;  3S15 H;  2WB1 G;  1EQR A;  5ELO A;  4DK3 C;  5FJ8 G;  5IYD G;  4JI0 L;  5C44 H;  2BH8 A;  1PH2 A;  2CQO A;  2JEB I;  3W1B A;  2UXB L;  3FHW A;  3T1Y L;  5FLM G;  1YJ9 A;  3G48 A;  4IPG A;  1E22 A;  4L5T A;  1X9N A;  1HNZ Q;  1QVG A;  4P73 A;  4DV7 L;  1K3R A;  4DK6 C;  1YZ6 A;  3RLF A;  1X3F A;  3AFP A;  3JAM c;  4X62 L;  4HID A;  1IBM Q;  3EBE A;  3L0O A;  2YTY A;  2GN5 A;  2RCN A;  2AKW B;  5M5X H;  1TXY A;  3CMA A;  1XMQ Q;  4JI6 Q;  3CD6 A;  4A3C G;  4KHP Q;  2VS1 A;  2QA4 A;  4HJ5 A;  2KCM A;  2ZTD A;  4R4I A;  1Q12 A;  1KIX A;  1EOV A;  5H1S E;  1M1K C;  3CCJ A;  1N36 Q;  4DR6 Q;  2K52 A;  4DV0 Q;  3U4V A;  4H02 A;  1XPO A;  2R92 H;  4B3T L;  5IT9 c;  3I4M G;  4JOI A;  2AHO B;  2E2I H;  3D31 A;  3UDG A;  4JI5 Q;  2GVA A;  4UP8 A;  4DR5 L;  5EAY A;  4DR4 L;  1X6O A;  1NY4 A;  2E2J H;  3CC2 A;  4GLA C;  3HOV G;  4YCV A;  2JJQ A;  4XIG S;  2R6G A;  4NB3 A;  4NPS A;  1N33 L;  1Y1V G;  1KXL A;  1I5F A;  1NMG A;  3PV0 A;  3RLN A;  5JEA J;  5K36 G;  4A3F G;  4LF6 Q;  4JI2 L;  4MZ9 A;  2I5H A;  2A19 A;  1WYD A;  3EN2 A;  2JE6 I;  5C3E G;  2HHH Q;  4KLK A;  4R4Q A;  4DV6 Q;  1HNZ L;  1VQN A;  1Q82 C;  2JA7 H;  2CWP A;  4AYB G;  4JI8 Q;  2QEX A;  3S16 H;  3CCL A;  3K81 C;  3HOZ G;  3PUZ A;  5IP9 G;  5IYC H;  4BA2 I;  2Z0S A;  1W3S A;  1WCM G;  4B3M L;  1YIT A;  4OXP A;  4R1J A;  2VL6 A;  5M3M G;  3M4O H;  4BBR G;  1IYJ B;  2FXQ A;  1KHI A;  4UP7 A;  5GAG C;  4MNO A;  4A3M G;  4LWC A;  4WJ3 M;  5HGQ A;  4B3R Q;  3E9I A;  1S40 A;  4QIW E;  2A8V A;  1VQE A;  2EXD A;  3KF6 A;  1MJE A;  4LF4 Q;  3NEL A;  2K14 A;  2JQO A;  1E3P A;  1HR0 W;  2ATW A;  3TS2 A;  2F3I A;  3CW2 C;  2A1A A;  1KD1 C;  2NVX H;  3S24 A;  4GOP B;  2OTJ A;  2K5H A;  2YTX A;  3GO5 A;  2F4V Q;  4GN3 B;  2MFI A;  5GQO A;  4JI1 L;  4YHH Q;  1PH1 A;  4OWT B;  4UY8 C;  3OTO L;  4P75 A;  4PZ8 A;  2B29 A;  5DLQ E;  1EUJ A;  3ULJ A;  1VQ9 A;  5GAE C;  4LF6 L;  4HJA A;  1SR3 A;  1I50 H;  3ULL A;  5GAH C;  3STB D;  2B3G A;  1Q46 A;  1SRO A;  2JA5 G;  3BZK A;  4DV2 L;  4BXX G;  2LXJ A;  4WJ4 A;  1NTG A;  1SFO H;  4IPC A;  3ZJY C;  1HJP A;  1I3Q H;  3STB C;  3RNU A;  4R4T A;  4DV1 Q;  1M90 C;  4JG2 A;  4JI3 Q;  1EIF A;  2CWA A;  3HFZ B;  4DAY B;  2GVB A;  1UWV A;  2DUD A;  1HZB A;  1KRS A;  1ASZ A;  2WAQ E;  2Z6K A;  2I5M X;  1VQI A;  1I6H H;  4DKA C;  5JJK A;  2OWO A;  4NXM Q;  3PO2 H;  1LUZ A;  1Z9F A;  1FJG Q;  3KF6 B;  3SGI A;  1FVI A;  3BU2 A;  3GTJ H;  2R7F A;  1GVP A;  2JA9 A;  4A3I H;  4A3B H;  4JV5 L;  1XPU A;  4JI0 Q;  4LF4 L;  1V9P A;  2XGT A;  5C0X J;  1J5E L;  4DR7 L;  1N32 L;  3PO3 G;  5M5Y H;  4GKK L;  3UDI A;  1B8A A;  1IXR A;  4YWL A;  4BY7 G;  4DV7 Q;  4A3D H;  4GLV B;  3CC4 A;  4OO1 G;  2UXD L;  4X62 Q;  3KF8 B;  3S1N H;  1OXV A;  1AE2 A;  2IX0 A;  4A3E G;  3RZO H;  4A3L H;  3Q8D A;  2OCE A;  1OXX K;  1Q1E A;  4QY7 A;  1K9M C;  1CKM A;  1PV4 A;  2Q2U A;  5FLM H;  4DR3 L;  3TEH B;  3UDX A;  1HNX L;  2WFW A;  4UP9 A;  2R7Z H;  3S1Q H;  4JBW A;  1V1Q A;  3A0J A;  2D62 A;  5ELN A;  4IJH A;  1VQF A;  4BY1 G;  4DV1 L;  4B3T Q;  1EFW A;  1UE5 A;  1Q86 C;  2AMC B;  2H5X A;  4JI3 L;  4A3G G;  1X3E A;  4APV A;  1OTC A;  4A3C H;  4C3J H;  2ALY B;  2K5V A;  4B3S Q;  4DR4 Q;  4IPD A;  4GNX A;  4JI4 L;  4R4C A;  3L2P A;  1Z47 A;  1HZC A;  2VUM H;  1N33 Q;  1X65 A;  1A62 A;  3KJP A;  3F2C A;  4DUY Q;  4LUV A;  2R93 H;  3I2Z A;  2NN6 G;  4A4I A;  3I4M H;  3HOY G;  3NBH B;  2NN6 I;  5GRO A;  2IX1 A;  4QQB X;  1KQS A;  3K8A A;  1EQQ A;  4JI2 Q;  1YHA A;  3M4Q A;  3CCM A;  1IBL L;  1C0A A;  5IYB G;  3ICE A;  3RLO A;  4JC0 A;  3H3V I;  2PNH A;  1JE5 A;  1YJN A;  2KHJ A;  1BBW A;  2BA0 A;  4DUZ L;  4DV3 L;  4HIM A;  4LW1 A;  4BBS H;  4Y52 H;  4A3F H;  4OX9 Q;  3KFU A;  3PF4 A;  3EIV A;  3KDF A;  1PFS A;  1Q1B A;  3KLW A;  5C3E H;  4LFC L;  2LXK A;  4B3M Q;  3HKZ E;  2JA8 G;  4HJ9 A;  3I4N G;  3M7N A;  1NJI C;  1I94 L;  3DLL A;  4BA1 I;  3UDF A;  4ALP A;  3G71 A;  3M4P A;  4A3K G;  1BVS A;  4LUZ A;  1PH3 A;  2NVQ H;  4X66 Q;  4HIO A;  2B63 G;  4YCU A;  4AQY L;  3HOZ H;  1FL0 A;  5IP9 H;  3J80 c;  3F2D A;  4GNX B;  4B3S L;  2D0O A;  1CKN A;  1X56 A;  4POG A;  3ER0 A;  3GTP H;  1Q7Y C;  1OXU A;  2YTV A;  4AYB E;  1GD7 A;  1L0W A;  1HZ9 A;  4BBR H;  3HOU G;  1P8L A;  1XTD A;  4JI1 Q;  3J81 i;  4DUY L;  1IBK L;  3GTQ H;  3HKZ G;  3OTO Q;  3G4S A;  1A0I A;  3I56 A;  4X64 Q;  2UUC L;  1YJW A;  1VQL A;  3RZD H;  4DNI A;  3S2D H;  1KC8 C;  1VQH A;  2K4K A;  1LM0 A;  3K7A H;  4GN4 B;  4DV2 Q;  2UUB Q;  3FP9 A;  5C44 G;  1CKO A;  1PH7 A;  3KDF B;  4OX9 L;  3RN5 A;  1RL2 A;  1N9W A;  3CME A;  2KCT A;  1CSQ A;  3PUX A;  3CPW A;  1G51 A;  1GM5 A;  1L1O A;  3RR5 A;  3PIO A;  3AYH B;  1S3O A;  5E7N A;  3U4Z A;  2JA5 H;  5IP7 H;  2YV5 A;  1JB7 A;  1EIY B;  3S17 H;  1YIJ A;  1K0R A;  4X66 L;  1CKN B;  4OWX B;  4JV5 Q;  2VY3 A;  1WOC A;  1E24 A;  1YNX A;  1WJJ A;  3NEM A;  4A3J G;  1VQB A;  3PUW A;  5BR8 L;  1W2B A;  1J5E Q;  2JA6 G;  3GTK H;  4DR7 Q;  1N32 Q;  4GKK Q;  2K5N A;  3MXN B;  2R92 G;  1N34 L;  4AH6 A;  3S14 H;  1RIP A;  1PVO A;  4QJF A;  4RG1 A;  4POF A;  4P74 A;  1CSP A;  2VZA A;  2UXD Q;  1HR0 L;  4DR1 L;  4X64 L;  1Q81 C;  1XNQ Q;  4C3I H;  3I55 A;  4DV4 Q;  2OQ0 A;  4TQU S;  3AQQ A;  3CPF A;  3S1R H;  2NVY H;  4OON A;  1Q8K A;  4DR3 Q;  1LTL A;  4KI0 A;  2UUB L;  4PZ7 A;  1HNX Q;  5IWA Q;  3B6Y A;  2ID0 A;  4JOI C;  4C3H H;  1N8R C;  4K0K L;  1QUQ A;  4PMW A;  1PH9 A;  1GKH A;  1UE6 A;  2VNU D;  3FKI G;  4P72 A;  4YWK A;  4IFD J;  2ZJP A;  4A93 H;  1L1O B;  1NMF A;  5AJ3 Q;  4IO9 A;  4DPG A;  1TWH H;  4R4O A;  1JJC B;  2ZJR A;  1KRT A;  4GOP C;  1VCI A;  4JI4 Q;  1YEZ A;  1UEB A;  3BZC A;  4YY3 L;  2WP8 J;  1VQK A;  1L2F A;  1VQ4 A;  1Y1W H;  1X3G A;  1PYB A;  2N3S A;  3PSI A;  4L5R C;  4LF9 L;  1HZA A;  2Q2I A;  1ASY A;  4TVA B;  2IY5 B;  2MQH A;  3CCU A;  1X55 A;  1TWF H;  1D7Q A;  2AWN A;  1TWG H;  4XTC S;  1IBL Q;  4X65 L;  1K8G A;  4DR2 Q;  4X6A H;  1TWA H;  4JBJ A;  1VS0 A;  4IFD I;  4JCV E;  4DUZ Q;  4DV3 Q;  1MJC A;  4EX5 A;  5FJ8 H;  1XNQ L;  1VQC A;  1XMO L;  2UXC L;  3PIP A;  3CF5 A;  5IYD H;  4DV4 L;  3UE0 A;  4HJ7 A;  1A63 A;  5M5W H;  1U0L A;  3CCQ A;  1VQ5 A;  5C4J H;  4JI7 L;  1IL2 A;  3GTL H;  3F1Z A;  4LFC Q;  1YHQ A;  2ASB A;  3CC7 A;  2HIX A;  5IWA L;  3BJU A;  2PI2 A;  3JAM i;  2PMZ E;  3PGZ A;  2N78 A;  3CCR A;  3T1H Q;  1I94 Q;  3H3V H;  1G6P A;  5C0X G;  2VQF L;  1MKH A;  2V1C C;  5C0X I;  1E7Z A;  2VQE Q;  3TRE A;  5AJ3 L;  1QVC A;  3PCO B;  4AQY Q;  3ULP A;  1K8A C;  4Y7N H;  4LFA L;  4GKJ L;  1IZ6 A;  2KBN A;  1J6Q A;  1D8L A;  1C7Y A;  3HOW G;  3I4N H;  1VQD A;  2BA1 A;  2Y0S E;  1E1T A;  1X54 A;  1IBK Q;  4JYA L;  1BBU A;  3F2B A;  4PZ6 A;  4GLX A;  1VQP A;  4DV5 L;  1G29 1;  3K0X A;  2UUC Q;  1SMX A;  1EWI A;  5J3B A;  3PO2 G;  2UUA Q;  3PUY A;  4QL5 A;  3HOV H;  3S1M H;  1E1O A;  2NZO A;  4A76 A;  1VQO A;  1HNW L;  4KHZ A;  4DR2 L;  2OQK A;  5LMN W;  1MIU A;  1XPR A;  1Y1V H;  1VQG A;  5JJL A;  4C2M H;  1VQ7 A;  5C4X G;  3HKS A;  4JBM A;  2HT1 A;  2Z6K C;  3I4O A;  2Y0S G;  1U5K A;  3KOJ A;  2CKZ B;  3M3Y H;  1QZH A;  4A3D G;  3IRB A;  3T1H L;  1V43 A;  4P71 A;  1LYL A;  4A3L G;  2MO0 A;  1VQ6 A;  1PYS B;  1YHB A;  3A5Z B;  3GD7 A;  2VQE L;  4GS3 A;  1BKB A;  5M3F G;  4AIM A;  1PA6 A;  2QGQ A;  5BR8 Q;  3HOX G;  2YU9 H;  1WCM H;  2R7Z G;  3RN2 A;  2ZM6 L;  3CXC A;  3A74 A;  1FGU A;  3W5O A;  4DAM A;  5M3M H;  3G6E A;  1N34 Q;  1NBW A;  3GDE A;  4A3M H;  1XNR L;  5IY0 A;  3J7Z C;  3WWV A;  3H0G G;  1HR0 Q;  4DR1 Q;  2N49 A;  1C9O A;  1TWC H;  1KL9 A;  1QZG A;  4A3J H;  1PH6 A;  2Q2T A;  1JMC A;  3GTM H;  2JA6 H;  2UUA L;  2IHF A;  2ZTE A;  1O7I A;  1YVC A;  1VQJ A;  4LF7 L;  2VUM G;  3PO3 H;  3LGJ A;  2LSS A;  4LF8 L;  2R93 G;  4K0K Q;  1T9H A;  4EQ5 A;  2RHS B;  5FLX c;  4HIK A;  1Y14 B;  1AE3 A;  3UE1 A;  1EYG A;  1SLJ A;  2E2H H;  4MTN A;  4GNX C;  2NZH A;  3M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...