1PYBA

Crystal structure of aquifex aeolicus trbp111: a structure-specific trna binding protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
107
structure length
107
Chain Sequence
ALIGIEDFLKVDLRVAKVLSAERVEGSEKLLKLTLSLGDEERTVVAGIAKYYTPEELVGKKIVIVANLKPRKIFGIESQGMILAASDGENLSVIVPDRDVKEGAKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords tRNA-binding protein Trbp111
publication title Crystal Structure of Trbp111: a Strcuture-Specific tRNA-Binding Protein
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 14
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1pybA00
1UWVA 3CF5A 2JA6G 4IOAA 1Q86C 3T1YQ 3OTOL 4AYBE 4OWXB 2E5LL 2UUAL 4LF9Q 3GTJH 3HFZB 4AQYL 4NXNL 1Y1WG 4OX9L 3ULLA 3M4QA 1FVIA 3NBHB 3PCOB 3NEMA 5LMNL 4GKJL 3KF6B 1HNXQ 4IFDG 2I5LX 1HR0Q 2VQFQ 4GS3A 4NXMQ 2RHQB 2HIXA 3RZDH 4JOIA 1KRSA 4WJ4A 4C3HH 4HJ5A 1KD1C 3T1YL 4RMFA 2JK8A 3E0EA 4OO1I 4BY1G 1MIUA 2N3SA 2OTLA 5JJIA 5GAHC 4BBSG 3I4NH 1YJNA 1D7QA 4DV2Q 4LFCQ 4GN4B 1HNXL 3AFQA 1HR0L 2VQFL 1VQOA 4X62Q 3CC7A 3L0OA 1SRUA 2GN5A 5HY6A 1XJVA 2IHFA 1YHQA 3PO3H 4BY7G 3H15A 4JI7Q 4DV1Q 4IPCA 1IL2A 1C9OA 5IT9c 2R93G 3VDYA 3PO2H 4AH6A 5H1SE 1XMQQ 1WI5A 1XPRA 3J81c 1HH2P 4B3SQ 4A3EG 2WAQG 3TEHB 4A93H 2RCNA 3B6YA 3EN2A 2L15A 4C3JH 4DR1Q 1VQ7A 4LFCL 1YJWA 3PUXA 4JI0L 2OQKA 4L5QA 1PYSB 1PH3A 2PQAB 1S40A 5C0XI 1M90C 4JI7L 4DV1L 3CCMA 2NVYH 3CPFA 4LW1A 4JBMA 2RF4A 1VQ9A 1TWHH 3KLWA 4B3SL 3M9BA 5K36G 1I50H 4JYAL 4DV7Q 1OXSC 3IRBA 3RLFA 4A75A 1YHBA 3U4ZA 1GO3E 4DR1L 1PH2A 3GTMH 2N78A 3GTLH 1VCIA 2XTIA 2B3GA 1TWFH 1TXYA 3KYHC 3U50C 2F3IA 5C4XH 2OWOA 3PV0A 1CKNB 2UXCQ 4YCVA 3K81C 4Y7NH 3S1QH 1XNQQ 4AIMA 3PO3G 1IYJB 3KF8B 5IP7G 2F4VQ 3H3VI 3M4OH 4JYAQ 2YTVA 1X3EA 2K50A 3RR5A 4PMWA 4C2MH 4C3IH 2Y0SG 4JI8Q 3L2PA 1V9PA 2K5NA 4DV6Q 1MJEA 4IPHA 4J15A 3S1MH 2UXCL 2HQLA 1RL2A 2R7DA 4GLXA 2CWPA 1Q82C 2Q2UA 4APVA 1QZGA 1XNQL 3G71A 2ZTDA 3BZKA 1XMOL 1OTCA 2KHJA 4DK3C 3GDEA 4JC0A 1A62A 4DK6C 4DV3L 4HIDA 3T1HQ 4MZ9A 5FLXc 1KQSA 1I5FA 2PI2A 5C3EH 2VW9A 2E2HH 3HOYH 4A3FG 1DGSA 4A3BH 3FKIH 4DV6L 2XGTA 4DR5Q 5BR8Q 4A3KH 4YWLA 3S2DH 5C44G 3CCRA 4A3IH 1Q1BA 2CKZB 2RHSB 3ERSX 1E1TA 3DM3A 3PGZA 3HOXG 1HZCA 1FL0A 3RLOA 1AE3A 3RNUA 4XIGS 2LXJA 3T1HL 2VUMG 2A19A 2NZHA 2B63G 4A3JH 1KRTA 4PZ8A 3KJOA 1VQPA 2EQSA 4O2DA 1NJIC 1NTGA 4DR5L 1HNZQ 5BR8L 2JA5H 1E24A 3F2CA 2QA4A 4B3TQ 3CCJA 3E9IA 1VQLA 2A8VA 3L7ZC 4X66L 2JA6H 1BKBA 1LTLA 1Q81C 5LMUQ 3AYHB 4UP8A 1Y1WH 1O7IA 1EYGA 1M1KC 2DGYA 3CC2A 1OXTA 5EAYA 1WYDA 4R4TA 1VQHA 4IO9A 2MQHA 2Q2TA 1WJJA 2KCMA 3G4SA 3GTGH 1HNZL 3UDXA 4B3TL 1B70B 2CQOA 1S3OA 3H0GG 5ELNA 2NN6G 1ASZA 3RN2A 4IOCA 1P16A 1L1OC 2WFWA 3HOUG 3GTKH 1IBLQ 3MXNB 2NVQH 3F8TA 4A3KG 1YBYA 3UDFA 4BBSH 3CCVA 1N34Q 2BH2A 2VQEQ 1EUJA 3K7AH 1PA6A 2HHHQ 1BBWA 3OW2A 3MEFA 1A63A 3RN5A 1HNWQ 4DAMA 1H95A 2K52A 1LM0A 2KENA 1HZAA 1X54A 2VY3A 3PSIA 4DV5Q 3UDGA 2CFMA 3S1RH 2R93H 4RG1A 1LYLA 2YTXA 3KDFB 4JI2Q 1J5EQ 3A74A 1IBLL 1IZ6A 2AHOB 2H5XA 5M5XH 4A3EH 3CMAA 5FLMG 4YHHQ 2R7ZG 5JEAG 2HHHL 2ATWA 3BU2A 4LF6Q 4QJFA 3F2BA 4GLAC 1HNWL 1FGUA 1PH9A 4LNQA 4BXXG 4R1JA 1EFWA 1PYBA 3W1GA 4L5TA 4BA1I 5IWAQ 4LUZA 4KHZA 1K73C 3KFUA 1J5EL 4IFDJ 2MO0A 1U0LA 2PNHA 1C7YA 4A4IA 1NE3A 1FJGQ 4JV5Q 1YEZA 4LF6L 4LF9L 1NY4A 2YV5A 3CPWA 5IYDH 4PG3A 4DUYQ 3AQQA 2HT1A 1CKMA 2IY5B 1W3SA 1CKOA 1QVFA 5IWAL 1V43A 5J3BA 2BA0A 2IX0A 3HOZG 1JE5A 1EWIA 4PZ6A 5IP7H 1JMCA 1VQ8A 4NXML 2AKWB 4JV5L 1E1OA 4P75A 1BBUA 2Q2HA 4DR3Q 4GNXB 1GKHA 4P74A 3K80C 2JQOA 1JJGA 1PH6A 4DV2L 4JI4Q 2IHEA 2ZTEA 4TVAB 3W5OA 4X62L 5IYCH 4OWWB 1PFSA 1SMXA 2JA7G 1VQ6A 4IPGA 3HOVH 3HKZG 2C35B 4WJ3M 1JB7A 1IBMQ 1GD7A 1VQMA 4JI0Q 1N9WA 4A3FH 1G291 4DR3L 1XMQL 1PH5A 4A3GG 2WB1G 2AWOA 4POFA 1YITA 4A3LG 2OCEA 5C44H 1S72A 3J7A5 3PF5A 2UXDQ 1X6OA 4GOPC 4MTNA 2YU9H 3HOXH 4DR6Q 3D31A 1NBWA 2R7FA 5IYDG 1GVPA 1MKHA 2VUMH 3J81i 2CWAA 1KL9A 4NPSA 1IBML 2B63H 3I56A 4IPDA 3D0FA 3PF4A 2OQ0A 1D8LA 2EXDA 4DKAC 4DV7L 2JA8G 1XPOA 3PUYA 4KHPQ 1T9HA 4YWMA 2UXDL 4R4CA 1AH9A 2YYZA 4X6AH 2UXBQ 4DR6L 4DR4Q 1I6HH 1C0AA 1PV4A 5IE8A 2HIVA 2D0PA 3J81j 1R9TH 2I5MX 4X65Q 2VS1A 5HGQA 5IYCG 3Q8DA 4DAYB 2F4VL 3H0GH 4MNOA 2MFIA 4LWCA 4LF7Q 1E3PA 3HOUH 1I94Q 2UXBL 2JE6I 4JI8L 1X65A 2QGQA 3I4MG 1PHJA 4LF8Q 4JI6Q 1SLJA 1X3FA 1SROA 4DUZQ 2UUCQ 3I7FA 4P72A 4X65L 4LUVA 4FDBA 3J80i 3NELA 4GN5A 4JBKA 1OXUA 2AWNA 1UE1A 1UE6A 4LF7L 1EIYB 3A5ZB 4YY3Q 1I94L 2OTJA 1Z47A 3I4OA 2ES2A 3STBD 2R92G 4AYBG 2WAQE 2NN6I 4LF8L 3AFPA 1L1OA 5FLMH 3U58A 2R7ZH 4JI1Q 4DUZL 1JJ2A 2UUCL 1EQRA 3TS2A 1N36Q 1N32Q 4TQUS 2PI2E 2Q2IA 1B7YB 5JJLA 1YJ9A 3GTQH 4BXXH 4LUOA 1IBKQ 1CUKA 4KI0A 1HJPA 4HIMA 3STBC 1VQNA 3HOVG 3I2ZA 5ELOA 4P71A 4XTCS 5C4JH 3UE0A 5FJ8G 4OWTB 1SE8A 2I5HA 2KCTA 4JI1L 1QVGA 4DR7Q 4HJ7A 1N36L 1J6QA 5LMUL 3AEVA 1IXRA 3CCLA 4A3DH 3G48A 4IJLA 3PUVA 3KJPA 1NMGA 1K9MC 1IBKL 1KHIA 3CCSA 4LF5Q 2NVTH 4BA2I 3GTOH 3HOZH 2D62A 2VL6A 1AE2A 2LXKA 2R6GA 4L5SA 1VQFA 2BA1A 4JI5L 3M7NA 3S14H 4LF4Q 1YI2A 2ZJQA 4DR7L 4B3RQ 4IFDI 1XNRQ 1LUZA 2Y0SE 4ME3A 4QIWE 3S2HH 3G6EA 4LF5L 1VQKA 1QVCA 5M3FG 1N34L 3KOJA 2VQEL 5JEAJ 3S17H 2MO1A 1WOCA 4A3CG 1Q46A 2CCZA 1CSQA 4BBRG 3CMEA 1K8GA 2JA7H 2GVAA 4A3MG 4LF4L 1X9NA 3LGJA 3BJUA 4R4IA 4R4QA 2K14A 4IJHA 3SGIA 4DV5L 3TS0A 1XNRL 4B3RL 5M3MG 2E2IH 4A3GH 1EIFA 1JT8A 4JBWA 2YTYA 3CP0A 4JI2L 1XPUA 4A3LH 5JJKA 2K5VA 4NXNQ 4EQ5A 4YHHL 4OONA 3M85A 4JI3Q 1WCMH 2ALYB 2DUDA 1U5KA 4A3DG 2KHIA 1EOVA 2E8GA 4DNIA 2F52A 3CQZH 3ER0A 4HIOA 1KAWA 3JAMi 2UU9Q 4R4OA 1Q1EA 1UE7A 5LMNW 2K75A 2V1CC 3CAMA 1L2FA 2D0OA 5IYBG 3TQYA 2JA8H 4JI3L 1FJGL 3UDIA 2B29A 1QUQA 1K0RA 3CW2C 3JC66 4LFBQ 3GD7A 1RIPA 5GAEC 3S1NH 3S24A 1N8RC 1KXLA 5IP9G 4DUYL 4YCWA 1L1OB 1Y1VG 1HZ9A 4GOPA 4DR2Q 1SR3A 3TREA 2UU9L 2Z6KA 1Y14B 1OXVA 3HKSA 4YWKA 5GAGC 1V1QA 2ZM6Q 1HR0W 1K83H 1PH1A 4LFBL 3K8AA 5M5WH 2Z0SA 1ASYA 2NVXH 3I4MH 1P8LA 4POGA 2N49A 1WCMG 4DR2L 4JI4L 4JOIC 4JI5Q 5AJ3Q 3GTPH 3J7ZC 2ZM6L 1X56A 4DV4Q 2Z6KC 4QL5A 1W2BA 1PH4A 5GROA 4OO1G 1TWAH 2JA9A 2UUBQ 2PMZE 4GKKQ 1VQDA 4LFAQ 4JG2A 2R92H 1SFOH 3CCUA 3TRZA 1VQGA 3H3VH 1E7ZA 5AJ3L 3HOWH 3EIVA 5IY0A 4P73A 4EX5A 4DV4L 4HJAA 1EQQA 4ALPA 1VQIA 4A76A 2UUBL 1E22A 4L5RC 3K7UC 4HIKA 4UY8C 3M4PA 4GKKL 1SN8A 3E9HA 4LFAL 4X64Q 4KHPL 5FJ8H 4QGUA 2FXQA 4QY7A 5C0XG 5C0XJ 1X3GA 3CD6A 3I4NG 4DR4L 3F2DA 2JJQA 2ID0A 3KDFA 2ZJPA 1XMOQ 2I0QA 2IX1A 4DV3Q 3PUZA 5GADC 3J80c 4HJ9A 1PH7A 3PO2G 4X64L 3I55A 2ZJRA 4B3MQ 5DLQE 1K3RA 2N8NA 4K0KQ 4QQBX 4A93G 3RLNA 4GN3B 1BVSA 3ZJYC 3ULJA 3KF6A 1VQBA 1A8VA 1XTDA 1UEBA 4OXPA 4JI6L 5M3FH 1VQ4A 1OXXK 4DPGA 1QUQB 1X55A 3W1BA 1PH8A 1A0IA 4A3CH 3HOWG 3PIOA 4GLVB 4BBRH 1KIXA 3ULPA 3PIPA 3HKZE 4A3MH 4GOPB 1QZHA 4B3ML 1Z9FA 4K0KL 3U4VA 1KC8C 1VS0A 4UP9A 4YY3L 1UE5A 2GVBA 5M3MH 4X66Q 1CSPA 2WB1E 4JCVE 4UPAA 2LSSA 1Q8KA 2ZTCA 1WFQA 3UE1A 3CCQA 3ICEA 5C4XG 2MNAA 1N32L 3FHWA 4DV0Q 2EIFA 2IT1A 2NZOA 3S16H 4GNXA 4NB3A 1Q12A 1VQ5A 5GQOA 2AMCB 3GO5A 2ASBA 2JEBI 4H02A 1TWCH 3PUWA 1JJCB 2E2JH 3CC4A 2JEAI 2BH8A 4YCUA 5IYBH 2PQAA 3CXCA 1MJCA 1NMFA 1VQCA 4DV0L 1YIJA 3K0XA 1VQEA 2KBNA 5IP9H 4GNXC 1Y1VH 3CCEA 1N33Q 4JBJA 1G51A 4O0AA 1GM5A 2K4KA 5C3EG 1I3QH 3HOYG 3OYYA 4BY1H 2K5HA 1VQJA 1YNXA 4A3BG 3FKIG 4HJ8A 4A3IG 1L0WA 1CKNA 3FP9A 4UP7A 1K8AC 3F1ZA 1YZ6A 1G6PA 1PVOA 3BZCA 3M3YH 1Q7YC 3OTOQ 2E5LQ 5E7NA 2UUAQ 1YHAA 4AQYQ 3S15H 4BY7H 4PZ7A 4OX9Q 1N33L 3DLLA 4KLKA 1YVCA 5M5YH 3WWVA 5LMNQ 1B8AA 3A5UA 4A3JG 4GKJQ 2VNUD 1TWGH 3EBEA 3A0JA 2QEXA 3RZOH 2VZAA 1VQAA 2JA5G 3NENA 2WP8J 1HZBA 2A1AA 4Y52H 3JAMc
chains in the Genus database with same CATH superfamily
3CF5A 1D5XC 3T1YQ 3OTOL 1RTNA 1WCMB 4OWXB 4U68A 3GTJH 3HFZB 1B44D 1II3A 2JYOA 3NBHB 5LL6S 4F88A 4XXEA 2I5LX 5J1ZA 1HR0Q 2A6ED 1NNXA 4WJ4A 2E2DC 2K28A 3NXWA 3T1YL 3E0EA 1E2VA 4BY1G 5GAHC 4BBSG 4RFBA 1EOTA 1Y8OB 3NE5B 1HR0L 4JI0Q 1TIID 4X62Q 1SRUA 1XJVA 4BY7G 5FLXL 4DV1Q 2LKVA 3VDYA 1TS3A 4KK7A 1PXUA 4AH6A 5H1SE 4B3SQ 3J81c 4R8NA 4A3EG 4EQNA 2RCNA 2WKDA 4HN7A 1YJWA 4JI0L 2KECA 1ML0D 3OPOA 3T56B 3VYSA 5ISRA 5C0XI 4DV1L 1JOKA 3H09A 3K5OA 3CCMA 1PLFA 4LW1A 4DAPA 4V0BA 1WVLA 3TZDA 3R3OA 3ONAB 4B3SL 2J4XA 3IRBA 1YHBA 4B9WA 1JWUD 3UI2A 5D14A 1TWFH 3KYHC 3OMCA 3U50C 3PV0A 1CKNB 2UXCQ 4H0LC 2RDGA 2CW0C 5FK9C 5ELEA 1XNQQ 2TSSA 3SXHA 1X3EA 2QF7A 1KDCA 5FKAC 4PMWA 1V9PA 2K5NA 1MJEA 1B3AA 1S5CD 2UXCL 3NPPA 1RL2A 2CWPA 1Q82C 2Q2UA 4ZKCB 5IIFA 1XNQL 2ZTDA 1XMOL 4KD3A 3VYTA 4DK3C 3GDEA 2NN6H 4JC0A 4DK6C 4C3IB 3T1HQ 5FLXc 5HURA 3HOYH 4DR5Q 2KOLA 4DFAA 1FL0A 3RLOA 2ENBA 3S9WA 5I4DA 2E2HB 1AFPA 3EFXD 4PQXA 3T1HL 4A3BB 1KRTA 2OEOA 3S2DB 1WTOA 4O2DA 3J7AF 4DR5L 5FO8B 4ULLA 1V8QA 1S5BD 1I6VC 3L7ZC 1SYEA 3H91A 1IW7C 1BKBA 2KEDA 4RGOS 3DEOA 4QUCA 4LK1C 4A3JB 4IZ8A 2KHSA 4R4TA 2Q2TA 4NDXA 1JOOA 2E2JB 3H0GG 5ELNA 2NN6G 1H9SA 4IOCA 3RN2A 1Y1WB 1L1OC 1KNAA 1SNDA 3NQTA 3GTKH 1IBLQ 3MXNB 3F8TA 1TY0A 1YBYA 3CHBD 2BH2A 3GTGB 1G2TA 3J7YW 3EA6A 1EU4A 2NB0A 1UNSA 1K3BC 4DAMA 2K5QA 2K52A 1GHKA 4DXGA 3VR2A 2VY3A 2CFMA 3MA2B 4RG1A 1LYLA 1IBLL 5COYA 4JI2Q 1X3QA 1J5EQ 2JP1A 2H5XA 3K7AB 5M5XH 2E76C 4HMIA 5FLMG 3CMAA 2R7ZG 3DXJC 5JEAG 3BU2A 4LF6Q 1STAA 4J1MA 1PH9A 2F0NA 3W1GA 1PTOC 2F0PA 4L5TA 1PFBA 4KHZA 4FNFA 1J5EL 3T13A 1C4QA 1C7YA 1YEZA 2G9HD 1E2ZA 4LF6L 1VF5C 1BCPB 2YV5A 2EYOA 4K5XA 3CPWA 1HUNA 2EJMA 2HT1A 1W3SA 1CKOA 3FDTA 5J3BA 2A6EC 1PRTF 3HOZG 3KLSX 1JE5A 1EWIA 5F2DA 2FINB 2AKWB 1WTXA 1GUSA 2Q2HA 3WOFA 2D5DA 5L37A 3K80C 3E0JA 2JQOA 3NUCA 2PZUA 2HDLA 4DV2L 4DNRB 4RWSC 3MFYA 3HKZG 4XT3B 2ICIA 1VQMA 4A93B 2G5DA 2AWOA 4J6HA 2OCEA 5C44H 1S72A 2F0WA 1STBA 4JK1C 4I65A 4DR6Q 3E6ZX 1NBWA 2NWGA 3J81i 1NSNS 2L5TA 1F9QA 3PF4A 1U4RA 2YU9B 4KHPQ 3DMUA 2UXBQ 4EGVA 4DR6L 1D5MC 2B63B 3TDQA 4N9TA 1WTPA 1R9TH 4M1UB 4OELB 2B8FA 5HGQA 3HP3A 4MNOA 4OHJA 1I6HB 2DN8A 1E3PA 1I94Q 4RGMA 2UXBL 3MZ5A 1SE4A 4JI6Q 4B08A 2DY8A 4DUZQ 2V4DA 4P72A 3I3CA 1TU2B 4GN5A 3HOUB 2AWNA 1RTOA 2K7VA 1EIYB 3SDZA 4YY3Q 1I94L 4X3KA 2A69C 3TP6A 5I6WA 3AFPA 4DUZL 1JJ2A 3R93A 1N36Q 2Q2IA 4KV6A 4ZUIA 1BUVT 2PMZB 1A6XA 3JAME 5FO7B 1IBKQ 3BDLA 1CUKA 4MIUA 3I90A 2QDLA 3UE0A 1ET9A 4OWTB 1BCPF 4LMQD 3PIP3 4HJ7A 2PZTA 2KQ3A 1N36L 1IXRA 1GUWA 3MVVA 3G48A 4IJLA 3KJPA 4LF5Q 1NMGA 1PFNA 1IBKL 2NVTH 1WTRA 1SMYD 1S5DD 3MXPA 2R6GA 4L5SA 2BA1A 3M7NA 1YI2A 2ZJQA 2F0DA 3VR5A 2F0VA 4QIWE 4RHRA 3GTOB 1B9MA 4C56C 4LF5L 5M3FG 4JVZA 3A56A 4E6IA 2KCCA 3A7AB 2VQEL 5EQ0A 3S17H 2MO1A 2CCZA 1CSQA 3G7LA 1XWEA 4A3MG 3BJUA 4R4QA 2K14A 4IJHA 4DV5L 5M3MG 4A3GH 1GHJA 1SNQA 3P20A 1CA6A 1CFMA 4A3LH 4NXNQ 4EQ5A 4OONA 4HMJA 1QE6A 1U5KA 3OWEB 1SYGA 4RAUC 3T53B 1EOVA 2HCCA 4DNIA 3ER0A 1BQQT 3CAMA 2ZXOA 2D0OA 2JA8H 3TQYA 1NR4A 1TT2A 2B29A 1QUQA 2R3ZA 4P2CB 2P5ZX 1KXLA 5IP9G 1L1OB 1Y1VG 1HZ9A 4DR2Q 4RA8A 2Z6KA 1Y14B 4KN7C 2OF1A 4YWKA 5GAGC 1V1QA 1HR0W 1GUGA 1K83H 2LS01 2K32A 3K8AA 3BYYB 5M5WH 3SE0A 1K8MA 1P8LA 4FXDA 2N49A 4DR2L 1MSGA 5AJ3Q 4RH6A 3J7ZC 1W2BA 2XVSA 2Z6KC 3HGBA 1TWAH 2VB2X 2UUBQ 2F0OA 3I4MB 1QWYA 1VQDA 4LFAQ 4HSVA 1VQGA 1ENCA 5A35A 5AJ3L 2VUMB 4HJAA 4P73A 1EQQA 1ENFA 5IGFA 2UUBL 4A76A 4L5RC 1SFOB 3TZUA 1SN8A 3E9HA 1CZWA 1A3VA 4LFAL 2F3VA 3C3LA 5EPKA 5KEEA 4QY7A 5C0XG 1STHA 3I91A 4DR4L 4DV3Q 3HEJA 4HJ9A 3CKIB 5J22A 4A93G 3QWNA 1BVSA 3ZJYC 4C3JG 2RA4A 1O7LA 4WORA 1EYAA 2F0LA 4DU9A 2HUGA 1OXXK 1PH8A 1A0IA 2SOBA 5E3FA 3NTHA 3IAYA 4KKUA 3ULPA 3PMFA 3HKZE 3WDNA 3JAML 3PIPA 1YNJC 1O7YA 2JN4A 1BCPD 4ZUJA 1EIHA 4X3TA 2LSSA 1WFQA 2QEJC 3CCQA 1LT6D 5C4XG 2EOTA 2MNAA 1K28A 2EIFA 4GNXA 5IGBA 4RGNA 1X3PA 1V1OA 5GQOA 5KNCA 1VQ5A 2JEAI 1KLGD 2BH8A 3SHLA 1ET6A 4YCUA 5IYBH 3QOJA 1MJCA 1VQCA 2RVLA 2G9DA 1ONLA 4Q0FA 2F03A 1UEAB 3K0XA 1YIJA 4FF1A 2KBNA 1SMYC 4GNXC 3H94A 1EWCA 2KVMA 2NTSA 5C3EG 3S14B 1I3QH 3V2TA 3FKIG 4A3IG 1L0WA 1CKNA 2WKCA 1YZ6A 1PVOA 3M3YH 1B4OA 4AQYQ 5ELBA 2B2WC 1YVCA 2B8GA 5M5YH 3A5UA 1TWGH 3EBEA 3A0JA 3RZOH 4OO1H 2WP8J 3JAMc 1R4QB 2JA6G 4F87A 3S15B 1K0SA 1I4PA 2K6AA 4KHVA 4LF9Q 4AQYL 3ULLA 1FVIA 3PCOB 3ERQA 4OEMB 1PRTC 3NEMA 5BN3A 3OSOA 3P75A 3K59A 4NXMQ 1STGA 2RHQB 4JOIA 3VYUA 1KDAA 1KD1C 3GTJB 2CQAA 2N3SA 2DJGC 3I4NH 1YJNA 1D7QA 1TS4A 4LFCQ 4GN4B 1LTRD 3D4DA 1MI2A 1YHQA 3PO3H 2A74C 4IPCA 1C9OA 2R93G 3PO2H 1HH2P 2MGSA 2WAQG 2J0TD 3TEHB 5C3XA 2Q8TA 3EN2A 2L15A 4LFCL 2F0HA 1M90C 4JW0A 1VQ9A 1TWHH 3KLWA 4MTKA 3M9BA 5JOBA 2F0EA 3MXNA 1I50H 2CW0D 4DA2A 4IALA 3RLFA 1B50A 3U4ZA 1PH2A 2N78A 3GTLH 1TQOA 3GP7A 4QUFA 3HOWB 2F3IA 3FEWX 4R8IA 4YCVA 4Y7NH 4CBVA 4FP5D 4JPBW 3PO3G 1F2ZA 3BDOA 2K50A 1TWFB 2B2TC 4ME5A 3L2PA 4JI8Q 4ZQ3A 4DV6Q 3P1HA 1QCBD 3S1MH 4J15A 1XYIA 4GLXA 1SNMA 1QZGA 3G71A 3BZKA 4HIDA 3HOVG 3EQLC 1I5FA 4A3FG 4DV6L 2XGTA 5BR8Q 1C48A 3CCRA 3ERSX 2CKZB 1STYA 5JVG3 1Y8PB 4DNTB 3PGZA 3HOXG 1IW7D 1D1IA 3OIQA 3HOYB 1O80A 2LXJA 2VUMG 2NZHA 1S5ED 1HXYD 2JXMB 3KJOA 1HNZQ 1NTGA 2JA5H 5BR8L 1E24A 3F2CA 2QA4A 4B3TQ 1BCPC 3E9IA 4RKBA 3CCJA 4X66L 1RJTA 2F0SA 1Q81C 2ZXRA 5EGTA 3AYHB 4CDFC 2EYJA 4BS9A 2MQHA 3MFGA 3G4SA 1HNZL 3UDXA 1H9MA 1B70B 4B3TL 5EKIA 1B9NA 4BBSH 1N34Q 1HFGA 1PA6A 1BBWA 3OW2A 2DNEA 3D6WA 4RGTA 1I4XA 2SEBD 3GTKB 1X54A 3S1RH 3OW7A 2YTXA 2AHOB 4A3EH 4YHHQ 2K1BA 1HCZA 4QJFA 3F2BA 1FGUA 4LNQA 4BXXG 4R1JA 3IFTA 4LUZA 4IFDJ 1FNUA 1H9RA 2PNHA 4TKOB 1WD0A 3FPUB 2K04A 4ZRZA 1VF7A 4A4IA 1FJGQ 1M4VA 1NUCA 4PV1C 2C9OA 2RDFA 4PG3A 1K8OA 4ILWA 1JQYD 3LWUA 5EJWA 1QVFA 1V43A 5KIXA 4R9WA 4C3HB 5DM63 4GZYC 1V1PB 1E1OA 1PFMA 4GNXB 4WRDA 1EEID 1PH6A 3J80E 1LTID 3NBIA 4X62L 5IYCH 2D9UA 2DNCA 2MHVA 2JA7G 1VQ6A 2Y0SB 1JB7A 4LJZC 1SXTA 1ILQA 2L12A 4CDCC 1STNA 4L8JA 1PH5A 2WB1G 3KBXA 1YITA 4UHVA 2UXDQ 3PF5A 1X6OA 4GOPC 1MSHA 2NVYB 1T5EA 1MKHA 3EVQA 1KL9A 4F7XA 5JJZA 5C44B 2BOSA 2TMPA 3GTMB 4DKAC 1PRTB 1XPOA 3PUYA 5BN5A 2K05A 2FFKB 4KKTA 5E1FA 2UXDL 4QCLA 2FMMA 2EYHA 5IE8A 2HIVA 3J81j 1PZID 2I5MX 4X65Q 3M4OB 5IYCG 3Q8DA 3H0GH 4Q5VA 2NTTA 2F0JA 1R9TB 1PZJD 3Q24A 1PHJA 4LF8Q 1LO5D 2A69D 1SROA 4FYDA 3I7FA 3KBGA 4X65L 4FDBA 4CKCA 1BO0A 4ODGA 1SYDA 1OXUA 1UE6A 1ESRA 5IODA 3A5ZB 4A3KB 2OTJA 3A7LA 3VA5A 2ES2A 2R92G 3W2DA 2N88A 3QJYA 2M9VA 2WAQE 4AYBG 4LF8L 1L1OA 5FLMH 2R7ZH 5JEAH 1EQRA 4TSSA 1KTKA 1N32Q 2EZVA 4ABNA 2XIWA 1G2SA 3GTQH 3I8ZA 4KI0A 2X6GA 3STBC 1VQNA 2IWHA 4V190 2XWJB 5ELOA 4P71A 1CM9A 1ESFA 1JE4A 2I5HA 4NW2A 3DM1A 2QCPX 2XSCA 4PMBA 5C5LA 1J6QA 3A8KE 3CCLA 4A3DH 4K8IA 3EROA 1K9MC 3CCSA 4BA2I 4G7ZC 2MPMA 3HOZH 1DONA 2D62A 2VL6A 2LXKA 3IFDA 1F2YA 4J8QA 2EYFA 5CV4A 1CQVA 3C2PA 4B3RQ 1XNRQ 2CH4A 4ME3A 2NVTB 1VQKA 1QVCA 2EJGC 3KOJA 4RCOA 3Q6SA 3Q0AA 4BBRG 2HDMA 1K8GA 2GVAA 2MJ8A 2L1BA 4R4IA 3TS0A 4B3RL 1XNRL 3K58A 2E2IH 4JI2L 1JOQA 3D8GA 4ZLTF 3S17B 2K5WA 2K5VA 2I07B 3M85A 1WCMH 4FF3A 2HQEA 4YIJA 4A3DG 4H44C 3H3VC 2XRSD 2O2LD 1A3UA 1F9SA 1Q1EA 1UE7A 2V1CC 2KA7A 3UDIA 2QDBA 3CW2C 5I9OA 4LFBQ 3JC66 1N8RC 4YCWA 4X3UA 1SR3A 3J80L 5NUCA 2JA8B 2ZM6Q 3VYRA 5IGDA 4LFBL 3PQIA 2PPBC 5EKKA 2NVXH 1XX8A 1IKLA 1EYCA 4RKLA 1WCMG 4HTHA 4K5WA 1K83B 1X56A 1WTHA 2ZM6L 3AU7A 5GROA 1Q3LA 5M5WB 1PYWD 1QG7A 5JAVA 3TRZA 5IGEA 1JORA 4HEDA 5D3IB 1VDZA 4WJWA 1JR0D 3Q23A 3QO2A 4UY8C 4HIKA 3M4PA 4X64Q 4KHPL 3TSSA 3K5NA 1AP0A 2EY2A 1X3GA 2JJQA 3T51B 1QNKA 2I0QA 3PUZA 5GADC 3J80c 3VR6A 1PH7A 3MAQA 4X64L 1J9OA 3I55A 2ZJRA 1DM0B 2QKIC 3RLNA 1CTMA 1YNJD 2K03A 3ULJA 2IPKD 4OXPA 4JI6L 5M3FH 3IKJA 1VQ4A 1FD7D 1SNCA 4XQQA 3HG9A 4A3MH 4GOPB 1QZHA 1KC8C 1VS0A 3QR8A 2C5CA 2Z9HA 1ZYRD 5M3MH 4YY3L 2WB1E 1RKNA 1Q8KA 2ZTCA 1WTWA 1EFID 3NK9A 2IT1A 5M9OA 3S16H 4NB3A 5AFWA 3X3NA 5KGUA 3TP5A 2ASBA 2JEBI 3PUWA 1JJCB 2F0TA 2E2JH 4C3IG 5HGTA 3SK4A 2OT2A 3CXCA 1NMFA 2AQ1B 4DAVA 5BN4A 1U9RA 5IP9H 1Y1VH 4I7ZC 4O0AA 1GM5A 3DWPA 2K4KA 3K57A 3OHXC 1UAPA 1RDPD 3OYYA 1LTBD 2K5HA 1VQJA 4F8MA 4A3BG 2A68C 3J7AV 4G57A 3C1EA 3OIPA 4KJOA 1E0BA 4UP7A 3F1ZA 1G6PA 2O4XA 2XRQD 4CKBA 1G8ZD 1Q7YC 2E5LQ 2UUAQ 3KK7A 3DLLA 4KLKA 3SK6A 3WWVA 1B8AA 4IUQA 4A3JG 4G4KA 1PRTD 4FF4A 1SEBD 1HZBA 4EX5A 1QNUA 3M3YB 1EIGA 1QB5D 4IOAA 1Q86C 2KJXA 2E5LL 4AYBE 2UUAL 3A54A 4UAIA 3SEBA 1Y1WG 4NXNL 5M5YB 2OXPA 1SNOA 3M4QA 3RZOB 1B1ZA 1HNXQ 4IFDG 4GS3A 2HIXA 3RZDH 1KRSA 4HJ5A 2ZXPA 2JK8A 3L9AX 5JJIA 2OTLA 2FHTA 3K5MA 5C0XH 3S1NB 1CZGA 3MXUA 2HD3A 1HNXL 3AFQA 1VQOA 1HTPA 1D5ZC 2A6HC 2N55A 1EY5A 1BBXC 1IL2A 1XMQQ 1XPRA 1WI5A 3I4NB 2F0FA 4A93H 4C3JH 1DJRD 1VQ7A 2B39A 3PUXA 2OQKA 1PYSB 1PH3A 2L4NA 3M7GA 3PO2B 4LAAA 3CPFA 4JBMA 1QJOA 1Z7TA 5K36G 5KRUA 2L0CA 4DV7Q 1EQVA 1GO3E 1VCIA 3MWYW 2B3GA 1TXYA 5C4XH 2OWOA 1I50B 3TP7A 3S1QH 1IYJB 5IP7G 2F4VQ 3GTLB 4JYAQ 4QB4A 3SR1A 4C2MH 4FXGC 4IPHA 1CHQD 1HUMA 2HQLA 3QB3A 2FJ2A 4APVA 1ZEQX 2I46A 4UDUC 4DV3L 1KQSA 1A62A 1M8AA 4JYAL 2PI2A 5C3EH 2VW9A 2X6LA 3S1MB 1DGSA 4EQPA 2DY7A 3FKIH 2MUYA 4YWLA 2NYZD 2PW5A 4A3IH 5CV5A 1E1TA 3AMUA 4DXFA 1HZCA 4N8FA 2NUCA 4CJ1B 1V1PA 1D1KA 1AE3A 2Z1CA 2Z4HA 2B63G 1NJIC 2KUMA 3FPPA 5E4XA 1ZYRC 1VQLA 2JA6H 2B2VC 3NQIA 1LTLA 3CU7A 5LMUQ 1FNVA 1O7IA 1EYGA 1F2LA 1M1KC 2DGYA 1VQHA 2JA5B 1WJJA 3ZYYX 1E2WA 2KCMA 2B2WA 2WV6D 2CQOA 4JI5Q 1S3OA 2H1EA 1KDBA 1D6EC 2WFWA 3HOUG 3TBIB 2NVQH 5IGGA 3CCVA 2HHHQ 3T4AC 2EY6A 1A63A 1BDOA 1EY6A 2KENA 2ICEC 1HZAA 1SE2A 2EY5A 3PSIA 4BY1B 2R93H 1B53A 3A74A 4DGZA 1IZ6A 1LLRD 3R2TA 2HHHL 4BY7B 1AN8A 1TS5A 4GLAC 4FXKC 3S1RB 1ILPA 1BR9A 1NR2A 2BDOA 1EFWA 1PYBA 4N9PA 4ZYSA 4BA1I 5IWAQ 4A3EB 1K73C 3KFUA 1LT3D 3H6MA 3NWTA 2MO0A 1DZ1A 3VA7A 1WD1A 4JV5Q 1NE3A 1AZQA 4LF9L 1NY4A 3DUZA 5IYDH 4DUYQ 1CKMA 1SYFA 5IWAL 3E3XA 1SE3A 2BA0A 2IX0A 4NXML 4JV5L 4P75A 1PZKD 2FMCA 1BBUA 3KLSA 2AUJD 1GXDC 1JB3A 3G6JB 4JI4Q 1SNPA 5J39A 4K2KA 4TVAB 3W5OA 5KNDA 1PFSA 3I4LA 2F0GA 4IPGA 3HOVH 4WJ3M 1IBMQ 1N9WA 4A3FH 1G291 5CV8A 4XQJA 3RUZA 4POFA 2B2TA 1F9RA 1PTOH 3HOXH 2K01A 2R7FA 5IYDG 1GVPA 2F0MA 1U4PA 2VUMH 4NPSA 1LT5D 3MTSA 1STEA 3I56A 1IBML 4M8AA 1J8IA 2AQ2B 5KYIA 3D0FA 2OQ0A 2EXDA 2PZWA 4PNYA 1NAPA 1T9HA 5G3LF 4YWMA 5CV9A 1AH9A 4X6AH 1ICWA 1PV4A 2D0PA 1UUPA 4B9XA 3FMCA 5T1GA 4DK0A 1BOSA 4DAYB 4LWCA 5DEHA 4LF7Q 2PQEA 4KD4A 4K8JA 4JI8L 1AW7A 2QGQA 3I4MG 1X3FA 4IUUA 3TMEA 5IGCA 2CVRA 2QW7A 3H0GB 4LUVA 3NELA 1F2MA 4JBKA 1H9JA 1RCVD 1UE1A 4LF7L 4IUTA 3C1FA 1Z47A 3I4OA 3STBD 2ZT9C 1DXMA 1DOLA 4JI1Q 3GV3A 1NCVA 1G91A 5JJLA 1B7YB 4BXXH 3NWSA 4MN3A 1HJPA 4HIMA 3I2ZA 4HR7B 5C4JH 5FJ8G 3PIO3 1SE8A 2KCTA 4JI1L 4DR7Q 3GTQB 1U4LA 2EPBA 4K6DA 1FYCA 3AB9A 3D3RA 1Y8NB 2KCNA 2JSOA 1BXTA 2Z6BA 5C4ZA 1XTCD 1VQFA 5FO9B 2BE5C 3R8BA 3S14H 4DR7L 4IFDI 1LUZA 3U9OA 3S2HH 1N34L 3OMGA 3HOZB 5I6YA 5IT9E 1WOCA 1MHWC 4A3CG 4CHTB 1TS2A 3V96A 2JA7H 5CMDA 1X9NA 3LGJA 1IYUA 1ENAA 1JT8A 5M5XB 3RD4A 3CP0A 1XPUA 5JJKA 4I7AA 1SSOA 3SVMA 3KF8A 4DN4M 4YHHL 4JI3Q 3OWFA 2ALYB 1H9KA 3HKZB 3W3AA 4DF7A 1TR5A 3IL8A 2E2IB 1A3TA 1RODA 4IUPA 1EZ8A 2F52A 3CQZH 4NMZA 4HIOA 1KAWA 3JAMi 5A2QE 2UU9Q 4R4OA 5CBEE 2K75A 1L2FA 4JI3L 1FJGL 4L6TB 2EYLA 3N52A 4RHSA 1IHZA 4GOPA 5JPMC 1TY2A 2UU9L 1OXVA 3HKSA 2EYPA 2F0UA 3TP8A 5DM73 1QILA 2EE1A 2EJFC 1PH1A 2B2UA 2Z0SA 1ASYA 3NTKA 1LV9A 4C1NK 4OGQC 3GTPH 2M00A 4DV4Q 5C4HA 5EPLA 2PMZE 5G3LD 2NVXB 4EQOA 2B2UC 2R92H 2DJFC 4C1NI 1O78A 2F0QA 3HOWH 5C6AA 4DV4L 3A8JE 4ALPA 1E22A 2XWBB 3K5LA 1HFNA 4QGUA 1DOKA 2FXQA 4FO2A 5C0XJ 3CD6A 1TVXA 3KDFA 2ID0A 4IN3A 1XMOQ 2IX1A 4QF4A 3CRLC 3MHBA 5DLQE 1K3RA 2N8NA 5CYUA 4K0KQ 4QQBX 2Z4IA 4PMCA 1L0YB 1VQBA 1XTDA 3ITPA 3HZXA 4DPGA 1X55A 3W1BA 3HOWG 3PIOA 1ZKOA 4GLVB 4BBRH 2CHBD 1KIXA 4K0KL 3ND9A 1Z9FA 4KY5A 1UE5A 2GVBA 3SK8A 5M3FB 4JCVE 2A5HA 3R2IA 4UPAA 3HS0C 3N6RA 3ICEA 3UE1A 4XQNA 4A3MB 1N32L 3FHWA 4DV0Q 3QIAA 2XN9C 1Q12A 5M3MB 2AMCB 1LT4D 1Q8IA 4H02A 1TWCH 1ZXTA 4O1NA 4U673 3S16B 1GUNA 2A68D 4DV0L 1FGBD 1F77A 1VQEA 1LTTD 4JBJA 1G51A 3FRPB 5IT9L 5CR3A 3BVMA 3HOYG 5D3DA 2E74C 1L0XB 4HJ8A 1RF2D 3NHHA 3FP9A 1FR3A 1Y1VB 3BZCA 2WINB 3BZDB 5E7NA 3O13A 4PZ7A 4OX9Q 4TRDA 4S3SA 2L55A 5LMNQ 4GKJQ 2QEXA 3NENA 4A3GB 4Y52H 1UWVA 5A2QL 1S5FD 1I4QA 1EZ6A 1JC7A 4OX9L 5LMNL 4GKJL 3KF6B 2IJ0A 2VQFQ 1HPCA 4C3HH 2A6HD 4OO1I 4RMFA 3D4RA 1F9PA 3NP8A 1A15A 1LACA 1MIUA 4DV2Q 4CJ2C 2VQFL 3RZDB 4ZK9B 4MHEA 3L0OA 2GN5A 5HY6A 3CC7A 1G6ZA 2IHFA 4QMGA 3H15A 4JI7Q 4NP5A 2WIIB 3KLRA 1HA6A 5IT9c 3OOCA 3Q22A 5JPNC 2PW7A 1HA5A 3B6YA 4DR1Q 4IQZA 3LWEA 4L5QA 2PQAB 1S40A 4JI7L 2NVYH 4X3SA 5I2YA 1SYCA 1TWAB 2D2CC 2RF4A 4L63B 4C3JB 1RHPA 1OXSC 4A75A 4C3HG 4DR1L 3GTMH 2PCFB 2XTIA 2AQ3B 1T5XD 1MGSA 5C3WA 2IL8A 3K81C 1EU3A 4AIMA 3KF8B 3M4YA 3H3VI 3M4OH 3L3OC 2YTVA 3RR5A 3C46A 5C4XB 4C3IH 2Y0SG 2F0IA 2M2LA 4RCNA 4G7OC 3S1QB 3VR4A 2R7DA 1GOZA 1EYDA 1OTCA 5E4WC 2K33A 2KHJA 3I73A 1MD2D 1FNWA 4C2MB 2BDNA 2J7ZA 4MZ9A 2L11A 1JCKB 4FVMA 2E2HH 1HHVA 4A3BH 4A3KH 3U9SA 3S2DH 5C44G 5K5PA 1Q1BA 2RHSB 3DM3A 1EL0A 1HRJA 4CDDC 5C3EB 1CI3M 3RNUA 4XIGS 2RDHA 2A19A 4FF2A 3FKIB 4A3JH 4PZ8A 4A3IB 1VQPA 4BWGB 2EQSA 1QOHA 1LTGD 1X32A 2A8VA 3NTIA 4KJNA 4NKLA 1EY8A 4UP8A 1Y1WH 3CC2A 1OXTA 5EAYA 1WYDA 4IO9A 2PO4A 4IFDH 2SNSA 3I72A 1KLUD 3GTGH 2JA6B 4KKSA 1ASZA 1P16A 1AZPA 3FVQA 2HCIA 4A3KG 3UDFA 3RMHA 2VQEQ 1EUJA 3K7AH 4KY7A 4OIJA 3MEFA 3RN5A 5ELDA 1HNWQ 1H95A 4ZAIA 1I3QB 4XDXA 1LM0A 3UDGA 4DV5Q 2NVQB 5D65A 4K2LA 5IOCA 3KDFB 3VR3A 2F0KA 3E5SA 1GJXA 4EVOA 2ATWA 5JVH3 2B2YA 3P7JA 4O42A 1HNWL 4DAYA 2R93B 1SJED 1TWGB 4KN4C 1I4RA 1JWSD 2Q8RE 2WAQB 3BS1A 5K36H 3BVGA 1U0LA 1R4PB 2Q8IB 1YNND 4HCEA 4KY6A 4CGYB 1CQFA 2B2YC 5LHY1 5CV7A 1SAPA 5LL6X 1S4ZA 3AQQA 2IY5B 4XYOA 1HQMC 1WTQA 4PZ6A 5IP7H 1JMCA 1VQ8A 4H13C 2RBMA 2KEEA 4DR3Q 2MP1A 1GKHA 4P74A 2IX3A 1W6JA 5CGKA 1DYQA 1JJGA 1VMCA 2QILA 1O7ZA 3PO3B 2IHEA 2LMCB 2ZTEA 3D4WA 4IURA 4OWWB 1SMXA 5FOBB 3KUPA 2C35B 1EY0A 1GD7A 2F4IA 4DR3L 4A3GG 1XMQL 4A3LG 3QG1A 1H9SB 3J7A5 1HTLD 1C8CA 4H7BA 4MTNA 2YU9H 1BNZA 1HQRD 3HOVB 3D31A 1TWHB 4A3FB 2CWAA 1GUTA 2B63H 1CK1A 5ELFA 4Z9CB 4IPDA 1D8LA 4DV7L 3BDCA 2JA8G 1PTOB 1SJHD 3HOXB 3BVZA 4WFN3 2RSNA 1EY9A 4R4CA 1PDQA 2YYZA 1I4GA 4DR4Q 1C0AA 1I6HH 1EY4A 3EJIA 4CDEC 4Y7NB 1EWHA 1MBYA 3TN2A 5CBAE 2VS1A 4OL7A 1LTAD 2F4VL 2F3WA 2MFIA 1B3QA 3HOUH 1W6KA 2JE6I 1X65A 1XXGA 2LY7A 2B2VA 1SLJA 1BF4A 4KTAA 2UUCQ 2SNMA 1IKMA 3MXGA 3J80i 2EY1A 3NBHA 1DD2A 1IYVA 1CT1D 2NN6I 2VB3X 4K5VA 3U58A 2R61A 4CKEA 2UUCL 3TS2A 1U4MA 3D6CA 3DHQA 3I70A 4TQUS 2PI2E 3MEHA 1YJ9A 4LUOA 1B2TA 5T1IA 5EBDA 4IUVA 4XTCS 5EKLA 3HRZC 5CC4A 1OO9B 1QVGA 2BE5D 5LMUL 1JICA 3AEVA 2EVBA 3PUVA 1KHIA 3GTOH 5C4JB 1Y69U 2F1MA 2LFNA 1AE2A 2RQXA 4JI5L 4LF4Q 3GQBA 2Y0SE 4BBSB 3G6EA 2EYMA 4K14A 5CORA 5JEAJ 4CJ0B 1Q46A 3J81E 3CMEA 2BCOA 5EBCA 4LF4L 1SBBB 3SGIA 5TSSA 2RKSA 3S2HB 1LTSD 3LNNA 1EIFA 4DK1A 3K6OA 2YTYA 4JBWA 1KAAA 3URYA 2A73B 5ELCA 1SDFA 2JA7B 2DUDA 3SK5A 2KHIA 2E8GA 4HCSA 2WB1B 1PTOF 5LMNW 2WACA 1YNNC 2H4OA 5IYBG 1K0RA 3GD7A 1I4HA 1RIPA 4HAEA 3LX0A 3CQZB 4N8X1 3S24A 5KYLA 5GAEC 3S1NH 4DUYL 2PYKA 3TREA 2O5IC 4KMUC 1WTVA 2RCFA 1DOMA 1A2UA 4QIWB 1LABA 3DWAA 3I4MH 4K6LA 5FLXE 4POGA 5DNFA 4JI4L 1AEXA 1Z6HA 4JOIC 3A8IE 4OO1G 4QL5A 5DAUA 1PH4A 3X3MA 2JA9A 1RD9D 4GKKQ 3DWQA 3DEPA 2IW3A 4JG2A 1SFOH 3BG3A 3CCUA 2L9HA 3BYTB 1TKWB 3GTPB 3H3VH 1E7ZA 3EIVA 5IY0A 5KNBA 3NSWA 1VQIA 2R92B 3K7UC 4AYBB 4GKKL 1KNEA 1CHPD 5FJ8H 1EEFD 2GA4B 3I4NG 2RSOA 2K5DA 3F2DA 2PNRC 3GV6A 2ZJPA 1KABA 5CV6A 2EDGA 2NBFA 3T16A 3PO2G 3A55A 3QOLA 4B3MQ 5C5MA 5I2XA 4GN3B 3F2UA 3KF6A 1DCZA 1A8VA 2SDFA 1IL8A 4XT1B 1UEBA 4G7HC 4ID6A 1QUQB 2O5JC 4A3CH 4B3ML 3U4VA 3K0YA 4UP9A 4X66Q 4ZCKA 1CSPA 2R7ZB 4HSPA 1ICFB 2X69A 4BBRB 2XNAC 2NZOA 3MC0B 1GUOA 5I9PA 1EY7A 3GO5A 3V05A 3CC4A 4IUNA 2PQAA 1CA5A 1VMPA 4A3DB 2E75C 1JWMD 1SYBA 1TWCB 3ND8A 3CCEA 1N33Q 2EXZA 3WOEA 3J81L 2AUKA 4BY1H 1YNXA 1A2TA 2VXWA 4XYQA 1EQTA 1K8AC 3CRKC 3OTOQ 1YHAA 4BY7H 1PMRA 3S15H 1Q90A 1N33L 2CH4W 2Z8LA 4OIKA 4ZKBB 2VNUD 1PTOD 2NZ1D 1VQAA 2VZAA 2JA5G 2A1AA 5EPJA 1D2BA
chains in the Genus database with same CATH topology
1UWVA 3CF5A 2JA6G 4IOAA 1Q86C 3T1YQ 3OTOL 4AYBE 4OWXB 2E5LL 2UUAL 4LF9Q 3GTJH 3HFZB 4AQYL 4NXNL 1Y1WG 4OX9L 3ULLA 3M4QA 1FVIA 3NBHB 3PCOB 3NEMA 5LMNL 4GKJL 3KF6B 1HNXQ 4IFDG 2I5LX 1HR0Q 2VQFQ 4GS3A 4NXMQ 2RHQB 2HIXA 3RZDH 4JOIA 1KRSA 4WJ4A 4C3HH 4HJ5A 1KD1C 3T1YL 4RMFA 2JK8A 3E0EA 4OO1I 4BY1G 1MIUA 2N3SA 2OTLA 5JJIA 5GAHC 4BBSG 3I4NH 1YJNA 1D7QA 4DV2Q 4LFCQ 4GN4B 1HNXL 3AFQA 1HR0L 2VQFL 1VQOA 4X62Q 3CC7A 3L0OA 1SRUA 2GN5A 5HY6A 1XJVA 2IHFA 1YHQA 3PO3H 4BY7G 3H15A 4JI7Q 4DV1Q 4IPCA 1IL2A 1C9OA 5IT9c 2R93G 3VDYA 3PO2H 4AH6A 5H1SE 1XMQQ 1WI5A 1XPRA 3J81c 1HH2P 4B3SQ 4A3EG 2WAQG 3TEHB 4A93H 2RCNA 3B6YA 3EN2A 2L15A 4C3JH 4DR1Q 1VQ7A 4LFCL 1YJWA 3PUXA 4JI0L 2OQKA 4L5QA 1PYSB 1PH3A 2PQAB 1S40A 5C0XI 1M90C 4JI7L 4DV1L 3CCMA 2NVYH 3CPFA 4LW1A 4JBMA 2RF4A 1VQ9A 1TWHH 3KLWA 4B3SL 3M9BA 5K36G 1I50H 4JYAL 4DV7Q 1OXSC 3IRBA 3RLFA 4A75A 1YHBA 3U4ZA 1GO3E 4DR1L 1PH2A 3GTMH 2N78A 3GTLH 1VCIA 2XTIA 2B3GA 1TWFH 1TXYA 3KYHC 3U50C 2F3IA 5C4XH 2OWOA 3PV0A 1CKNB 2UXCQ 4YCVA 3K81C 4Y7NH 3S1QH 1XNQQ 4AIMA 3PO3G 1IYJB 3KF8B 5IP7G 2F4VQ 3H3VI 3M4OH 4JYAQ 2YTVA 1X3EA 2K50A 3RR5A 4PMWA 4C2MH 4C3IH 2Y0SG 4JI8Q 3L2PA 1V9PA 2K5NA 4DV6Q 1MJEA 4IPHA 4J15A 3S1MH 2UXCL 2HQLA 1RL2A 2R7DA 4GLXA 2CWPA 1Q82C 2Q2UA 4APVA 1QZGA 1XNQL 3G71A 2ZTDA 3BZKA 1XMOL 1OTCA 2KHJA 4DK3C 3GDEA 4JC0A 1A62A 4DK6C 4DV3L 4HIDA 3T1HQ 4MZ9A 5FLXc 1KQSA 1I5FA 2PI2A 5C3EH 2VW9A 2E2HH 3HOYH 4A3FG 1DGSA 4A3BH 3FKIH 4DV6L 2XGTA 4DR5Q 5BR8Q 4A3KH 4YWLA 3S2DH 5C44G 3CCRA 4A3IH 1Q1BA 2CKZB 2RHSB 3ERSX 1E1TA 3DM3A 3PGZA 3HOXG 1HZCA 1FL0A 3RLOA 1AE3A 3RNUA 4XIGS 2LXJA 3T1HL 2VUMG 2A19A 2NZHA 2B63G 4A3JH 1KRTA 4PZ8A 3KJOA 1VQPA 2EQSA 4O2DA 1NJIC 1NTGA 4DR5L 1HNZQ 5BR8L 2JA5H 1E24A 3F2CA 2QA4A 4B3TQ 3CCJA 3E9IA 1VQLA 2A8VA 3L7ZC 4X66L 2JA6H 1BKBA 1LTLA 1Q81C 5LMUQ 3AYHB 4UP8A 1Y1WH 1O7IA 1EYGA 1M1KC 2DGYA 3CC2A 1OXTA 5EAYA 1WYDA 4R4TA 1VQHA 4IO9A 2MQHA 2Q2TA 1WJJA 2KCMA 3G4SA 3GTGH 1HNZL 3UDXA 4B3TL 1B70B 2CQOA 1S3OA 3H0GG 5ELNA 2NN6G 1ASZA 3RN2A 4IOCA 1P16A 1L1OC 2WFWA 3HOUG 3GTKH 1IBLQ 3MXNB 2NVQH 3F8TA 4A3KG 1YBYA 3UDFA 4BBSH 3CCVA 1N34Q 2BH2A 2VQEQ 1EUJA 3K7AH 1PA6A 2HHHQ 1BBWA 3OW2A 3MEFA 1A63A 3RN5A 1HNWQ 4DAMA 1H95A 2K52A 1LM0A 2KENA 1HZAA 1X54A 2VY3A 3PSIA 4DV5Q 3UDGA 2CFMA 3S1RH 2R93H 4RG1A 1LYLA 2YTXA 3KDFB 4JI2Q 1J5EQ 3A74A 1IBLL 1IZ6A 2AHOB 2H5XA 5M5XH 4A3EH 3CMAA 5FLMG 4YHHQ 2R7ZG 5JEAG 2HHHL 2ATWA 3BU2A 4LF6Q 4QJFA 3F2BA 4GLAC 1HNWL 1FGUA 1PH9A 4LNQA 4BXXG 4R1JA 1EFWA 1PYBA 3W1GA 4L5TA 4BA1I 5IWAQ 4LUZA 4KHZA 1K73C 3KFUA 1J5EL 4IFDJ 2MO0A 1U0LA 2PNHA 1C7YA 4A4IA 1NE3A 1FJGQ 4JV5Q 1YEZA 4LF6L 4LF9L 1NY4A 2YV5A 3CPWA 5IYDH 4PG3A 4DUYQ 3AQQA 2HT1A 1CKMA 2IY5B 1W3SA 1CKOA 1QVFA 5IWAL 1V43A 5J3BA 2BA0A 2IX0A 3HOZG 1JE5A 1EWIA 4PZ6A 5IP7H 1JMCA 1VQ8A 4NXML 2AKWB 4JV5L 1E1OA 4P75A 1BBUA 2Q2HA 4DR3Q 4GNXB 1GKHA 4P74A 3K80C 2JQOA 1JJGA 1PH6A 4DV2L 4JI4Q 2IHEA 2ZTEA 4TVAB 3W5OA 4X62L 5IYCH 4OWWB 1PFSA 1SMXA 2JA7G 1VQ6A 4IPGA 3HOVH 3HKZG 2C35B 4WJ3M 1JB7A 1IBMQ 1GD7A 1VQMA 4JI0Q 1N9WA 4A3FH 1G291 4DR3L 1XMQL 1PH5A 4A3GG 2WB1G 2AWOA 4POFA 1YITA 4A3LG 2OCEA 5C44H 1S72A 3J7A5 3PF5A 2UXDQ 1X6OA 4GOPC 4MTNA 2YU9H 3HOXH 4DR6Q 3D31A 1NBWA 2R7FA 5IYDG 1GVPA 1MKHA 2VUMH 3J81i 2CWAA 1KL9A 4NPSA 1IBML 2B63H 3I56A 4IPDA 3D0FA 3PF4A 2OQ0A 1D8LA 2EXDA 4DKAC 4DV7L 2JA8G 1XPOA 3PUYA 4KHPQ 1T9HA 4YWMA 2UXDL 4R4CA 1AH9A 2YYZA 4X6AH 2UXBQ 4DR6L 4DR4Q 1I6HH 1C0AA 1PV4A 5IE8A 2HIVA 2D0PA 3J81j 1R9TH 2I5MX 4X65Q 2VS1A 5HGQA 5IYCG 3Q8DA 4DAYB 2F4VL 3H0GH 4MNOA 2MFIA 4LWCA 4LF7Q 1E3PA 3HOUH 1I94Q 2UXBL 2JE6I 4JI8L 1X65A 2QGQA 3I4MG 1PHJA 4LF8Q 4JI6Q 1SLJA 1X3FA 1SROA 4DUZQ 2UUCQ 3I7FA 4P72A 4X65L 4LUVA 4FDBA 3J80i 3NELA 4GN5A 4JBKA 1OXUA 2AWNA 1UE1A 1UE6A 4LF7L 1EIYB 3A5ZB 4YY3Q 1I94L 2OTJA 1Z47A 3I4OA 2ES2A 3STBD 2R92G 4AYBG 2WAQE 2NN6I 4LF8L 3AFPA 1L1OA 5FLMH 3U58A 2R7ZH 4JI1Q 4DUZL 1JJ2A 2UUCL 1EQRA 3TS2A 1N36Q 1N32Q 4TQUS 2PI2E 2Q2IA 1B7YB 5JJLA 1YJ9A 3GTQH 4BXXH 4LUOA 1IBKQ 1CUKA 4KI0A 1HJPA 4HIMA 3STBC 1VQNA 3HOVG 3I2ZA 5ELOA 4P71A 4XTCS 5C4JH 3UE0A 5FJ8G 4OWTB 1SE8A 2I5HA 2KCTA 4JI1L 1QVGA 4DR7Q 4HJ7A 1N36L 1J6QA 5LMUL 3AEVA 1IXRA 3CCLA 4A3DH 3G48A 4IJLA 3PUVA 3KJPA 1NMGA 1K9MC 1IBKL 1KHIA 3CCSA 4LF5Q 2NVTH 4BA2I 3GTOH 3HOZH 2D62A 2VL6A 1AE2A 2LXKA 2R6GA 4L5SA 1VQFA 2BA1A 4JI5L 3M7NA 3S14H 4LF4Q 1YI2A 2ZJQA 4DR7L 4B3RQ 4IFDI 1XNRQ 1LUZA 2Y0SE 4ME3A 4QIWE 3S2HH 3G6EA 4LF5L 1VQKA 1QVCA 5M3FG 1N34L 3KOJA 2VQEL 5JEAJ 3S17H 2MO1A 1WOCA 4A3CG 1Q46A 2CCZA 1CSQA 4BBRG 3CMEA 1K8GA 2JA7H 2GVAA 4A3MG 4LF4L 1X9NA 3LGJA 3BJUA 4R4IA 4R4QA 2K14A 4IJHA 3SGIA 4DV5L 3TS0A 1XNRL 4B3RL 5M3MG 2E2IH 4A3GH 1EIFA 1JT8A 4JBWA 2YTYA 3CP0A 4JI2L 1XPUA 4A3LH 5JJKA 2K5VA 4NXNQ 4EQ5A 4YHHL 4OONA 3M85A 4JI3Q 1WCMH 2ALYB 2DUDA 1U5KA 4A3DG 2KHIA 1EOVA 2E8GA 4DNIA 2F52A 3CQZH 3ER0A 4HIOA 1KAWA 3JAMi 2UU9Q 4R4OA 1Q1EA 1UE7A 5LMNW 2K75A 2V1CC 3CAMA 1L2FA 2D0OA 5IYBG 3TQYA 2JA8H 4JI3L 1FJGL 3UDIA 2B29A 1QUQA 1K0RA 3CW2C 3JC66 4LFBQ 3GD7A 1RIPA 5GAEC 3S1NH 3S24A 1N8RC 1KXLA 5IP9G 4DUYL 4YCWA 1L1OB 1Y1VG 1HZ9A 4GOPA 4DR2Q 1SR3A 3TREA 2UU9L 2Z6KA 1Y14B 1OXVA 3HKSA 4YWKA 5GAGC 1V1QA 2ZM6Q 1HR0W 1K83H 1PH1A 4LFBL 3K8AA 5M5WH 2Z0SA 1ASYA 2NVXH 3I4MH 1P8LA 4POGA 2N49A 1WCMG 4DR2L 4JI4L 4JOIC 4JI5Q 5AJ3Q 3GTPH 3J7ZC 2ZM6L 1X56A 4DV4Q 2Z6KC 4QL5A 1W2BA 1PH4A 5GROA 4OO1G 1TWAH 2JA9A 2UUBQ 2PMZE 4GKKQ 1VQDA 4LFAQ 4JG2A 2R92H 1SFOH 3CCUA 3TRZA 1VQGA 3H3VH 1E7ZA 5AJ3L 3HOWH 3EIVA 5IY0A 4P73A 4EX5A 4DV4L 4HJAA 1EQQA 4ALPA 1VQIA 4A76A 2UUBL 1E22A 4L5RC 3K7UC 4HIKA 4UY8C 3M4PA 4GKKL 1SN8A 3E9HA 4LFAL 4X64Q 4KHPL 5FJ8H 4QGUA 2FXQA 4QY7A 5C0XG 5C0XJ 1X3GA 3CD6A 3I4NG 4DR4L 3F2DA 2JJQA 2ID0A 3KDFA 2ZJPA 1XMOQ 2I0QA 2IX1A 4DV3Q 3PUZA 5GADC 3J80c 4HJ9A 1PH7A 3PO2G 4X64L 3I55A 2ZJRA 4B3MQ 5DLQE 1K3RA 2N8NA 4K0KQ 4QQBX 4A93G 3RLNA 4GN3B 1BVSA 3ZJYC 3ULJA 3KF6A 1VQBA 1A8VA 1XTDA 1UEBA 4OXPA 4JI6L 5M3FH 1VQ4A 1OXXK 4DPGA 1QUQB 1X55A 3W1BA 1PH8A 1A0IA 4A3CH 3HOWG 3PIOA 4GLVB 4BBRH 1KIXA 3ULPA 3PIPA 3HKZE 4A3MH 4GOPB 1QZHA 4B3ML 1Z9FA 4K0KL 3U4VA 1KC8C 1VS0A 4UP9A 4YY3L 1UE5A 2GVBA 5M3MH 4X66Q 1CSPA 2WB1E 4JCVE 4UPAA 2LSSA 1Q8KA 2ZTCA 1WFQA 3UE1A 3CCQA 3ICEA 5C4XG 2MNAA 1N32L 3FHWA 4DV0Q 2EIFA 2IT1A 2NZOA 3S16H 4GNXA 4NB3A 1Q12A 1VQ5A 5GQOA 2AMCB 3GO5A 2ASBA 2JEBI 4H02A 1TWCH 3PUWA 1JJCB 2E2JH 3CC4A 2JEAI 2BH8A 4YCUA 5IYBH 2PQAA 3CXCA 1MJCA 1NMFA 1VQCA 4DV0L 1YIJA 3K0XA 1VQEA 2KBNA 5IP9H 4GNXC 1Y1VH 3CCEA 1N33Q 4JBJA 1G51A 4O0AA 1GM5A 2K4KA 5C3EG 1I3QH 3HOYG 3OYYA 4BY1H 2K5HA 1VQJA 1YNXA 4A3BG 3FKIG 4HJ8A 4A3IG 1L0WA 1CKNA 3FP9A 4UP7A 1K8AC 3F1ZA 1YZ6A 1G6PA 1PVOA 3BZCA 3M3YH 1Q7YC 3OTOQ 2E5LQ 5E7NA 2UUAQ 1YHAA 4AQYQ 3S15H 4BY7H 4PZ7A 4OX9Q 1N33L 3DLLA 4KLKA 1YVCA 5M5YH 3WWVA 5LMNQ 1B8AA 3A5UA 4A3JG 4GKJQ 2VNUD 1TWGH 3EBEA 3A0JA 2QEXA 3RZOH 2VZAA 1VQAA 2JA5G 3NENA 2WP8J 1HZBA 2A1AA 4Y52H 3JAMc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWV A;  3CF5 A;  2JA6 G;  4IOA A;  1Q86 C;  3T1Y Q;  3OTO L;  4AYB E;  4OWX B;  2E5L L;  2UUA L;  4LF9 Q;  3GTJ H;  3HFZ B;  4AQY L;  4NXN L;  1Y1W G;  4OX9 L;  3ULL A;  3M4Q A;  1FVI A;  3NBH B;  3PCO B;  3NEM A;  5LMN L;  4GKJ L;  3KF6 B;  1HNX Q;  4IFD G;  2I5L X;  1HR0 Q;  2VQF Q;  4GS3 A;  4NXM Q;  2RHQ B;  2HIX A;  3RZD H;  4JOI A;  1KRS A;  4WJ4 A;  4C3H H;  4HJ5 A;  1KD1 C;  3T1Y L;  4RMF A;  2JK8 A;  3E0E A;  4OO1 I;  4BY1 G;  1MIU A;  2N3S A;  2OTL A;  5JJI A;  5GAH C;  4BBS G;  3I4N H;  1YJN A;  1D7Q A;  4DV2 Q;  4LFC Q;  4GN4 B;  1HNX L;  3AFQ A;  1HR0 L;  2VQF L;  1VQO A;  4X62 Q;  3CC7 A;  3L0O A;  1SRU A;  2GN5 A;  5HY6 A;  1XJV A;  2IHF A;  1YHQ A;  3PO3 H;  4BY7 G;  3H15 A;  4JI7 Q;  4DV1 Q;  4IPC A;  1IL2 A;  1C9O A;  5IT9 c;  2R93 G;  3VDY A;  3PO2 H;  4AH6 A;  5H1S E;  1XMQ Q;  1WI5 A;  1XPR A;  3J81 c;  1HH2 P;  4B3S Q;  4A3E G;  2WAQ G;  3TEH B;  4A93 H;  2RCN A;  3B6Y A;  3EN2 A;  2L15 A;  4C3J H;  4DR1 Q;  1VQ7 A;  4LFC L;  1YJW A;  3PUX A;  4JI0 L;  2OQK A;  4L5Q A;  1PYS B;  1PH3 A;  2PQA B;  1S40 A;  5C0X I;  1M90 C;  4JI7 L;  4DV1 L;  3CCM A;  2NVY H;  3CPF A;  4LW1 A;  4JBM A;  2RF4 A;  1VQ9 A;  1TWH H;  3KLW A;  4B3S L;  3M9B A;  5K36 G;  1I50 H;  4JYA L;  4DV7 Q;  1OXS C;  3IRB A;  3RLF A;  4A75 A;  1YHB A;  3U4Z A;  1GO3 E;  4DR1 L;  1PH2 A;  3GTM H;  2N78 A;  3GTL H;  1VCI A;  2XTI A;  2B3G A;  1TWF H;  1TXY A;  3KYH C;  3U50 C;  2F3I A;  5C4X H;  2OWO A;  3PV0 A;  1CKN B;  2UXC Q;  4YCV A;  3K81 C;  4Y7N H;  3S1Q H;  1XNQ Q;  4AIM A;  3PO3 G;  1IYJ B;  3KF8 B;  5IP7 G;  2F4V Q;  3H3V I;  3M4O H;  4JYA Q;  2YTV A;  1X3E A;  2K50 A;  3RR5 A;  4PMW A;  4C2M H;  4C3I H;  2Y0S G;  4JI8 Q;  3L2P A;  1V9P A;  2K5N A;  4DV6 Q;  1MJE A;  4IPH A;  4J15 A;  3S1M H;  2UXC L;  2HQL A;  1RL2 A;  2R7D A;  4GLX A;  2CWP A;  1Q82 C;  2Q2U A;  4APV A;  1QZG A;  1XNQ L;  3G71 A;  2ZTD A;  3BZK A;  1XMO L;  1OTC A;  2KHJ A;  4DK3 C;  3GDE A;  4JC0 A;  1A62 A;  4DK6 C;  4DV3 L;  4HID A;  3T1H Q;  4MZ9 A;  5FLX c;  1KQS A;  1I5F A;  2PI2 A;  5C3E H;  2VW9 A;  2E2H H;  3HOY H;  4A3F G;  1DGS A;  4A3B H;  3FKI H;  4DV6 L;  2XGT A;  4DR5 Q;  5BR8 Q;  4A3K H;  4YWL A;  3S2D H;  5C44 G;  3CCR A;  4A3I H;  1Q1B A;  2CKZ B;  2RHS B;  3ERS X;  1E1T A;  3DM3 A;  3PGZ A;  3HOX G;  1HZC A;  1FL0 A;  3RLO A;  1AE3 A;  3RNU A;  4XIG S;  2LXJ A;  3T1H L;  2VUM G;  2A19 A;  2NZH A;  2B63 G;  4A3J H;  1KRT A;  4PZ8 A;  3KJO A;  1VQP A;  2EQS A;  4O2D A;  1NJI C;  1NTG A;  4DR5 L;  1HNZ Q;  5BR8 L;  2JA5 H;  1E24 A;  3F2C A;  2QA4 A;  4B3T Q;  3CCJ A;  3E9I A;  1VQL A;  2A8V A;  3L7Z C;  4X66 L;  2JA6 H;  1BKB A;  1LTL A;  1Q81 C;  5LMU Q;  3AYH B;  4UP8 A;  1Y1W H;  1O7I A;  1EYG A;  1M1K C;  2DGY A;  3CC2 A;  1OXT A;  5EAY A;  1WYD A;  4R4T A;  1VQH A;  4IO9 A;  2MQH A;  2Q2T A;  1WJJ A;  2KCM A;  3G4S A;  3GTG H;  1HNZ L;  3UDX A;  4B3T L;  1B70 B;  2CQO A;  1S3O A;  3H0G G;  5ELN A;  2NN6 G;  1ASZ A;  3RN2 A;  4IOC A;  1P16 A;  1L1O C;  2WFW A;  3HOU G;  3GTK H;  1IBL Q;  3MXN B;  2NVQ H;  3F8T A;  4A3K G;  1YBY A;  3UDF A;  4BBS H;  3CCV A;  1N34 Q;  2BH2 A;  2VQE Q;  1EUJ A;  3K7A H;  1PA6 A;  2HHH Q;  1BBW A;  3OW2 A;  3MEF A;  1A63 A;  3RN5 A;  1HNW Q;  4DAM A;  1H95 A;  2K52 A;  1LM0 A;  2KEN A;  1HZA A;  1X54 A;  2VY3 A;  3PSI A;  4DV5 Q;  3UDG A;  2CFM A;  3S1R H;  2R93 H;  4RG1 A;  1LYL A;  2YTX A;  3KDF B;  4JI2 Q;  1J5E Q;  3A74 A;  1IBL L;  1IZ6 A;  2AHO B;  2H5X A;  5M5X H;  4A3E H;  3CMA A;  5FLM G;  4YHH Q;  2R7Z G;  5JEA G;  2HHH L;  2ATW A;  3BU2 A;  4LF6 Q;  4QJF A;  3F2B A;  4GLA C;  1HNW L;  1FGU A;  1PH9 A;  4LNQ A;  4BXX G;  4R1J A;  1EFW A;  1PYB A;  3W1G A;  4L5T A;  4BA1 I;  5IWA Q;  4LUZ A;  4KHZ A;  1K73 C;  3KFU A;  1J5E L;  4IFD J;  2MO0 A;  1U0L A;  2PNH A;  1C7Y A;  4A4I A;  1NE3 A;  1FJG Q;  4JV5 Q;  1YEZ A;  4LF6 L;  4LF9 L;  1NY4 A;  2YV5 A;  3CPW A;  5IYD H;  4PG3 A;  4DUY Q;  3AQQ A;  2HT1 A;  1CKM A;  2IY5 B;  1W3S A;  1CKO A;  1QVF A;  5IWA L;  1V43 A;  5J3B A;  2BA0 A;  2IX0 A;  3HOZ G;  1JE5 A;  1EWI A;  4PZ6 A;  5IP7 H;  1JMC A;  1VQ8 A;  4NXM L;  2AKW B;  4JV5 L;  1E1O A;  4P75 A;  1BBU A;  2Q2H A;  4DR3 Q;  4GNX B;  1GKH A;  4P74 A;  3K80 C;  2JQO A;  1JJG A;  1PH6 A;  4DV2 L;  4JI4 Q;  2IHE A;  2ZTE A;  4TVA B;  3W5O A;  4X62 L;  5IYC H;  4OWW B;  1PFS A;  1SMX A;  2JA7 G;  1VQ6 A;  4IPG A;  3HOV H;  3HKZ G;  2C35 B;  4WJ3 M;  1JB7 A;  1IBM Q;  1GD7 A;  1VQM A;  4JI0 Q;  1N9W A;  4A3F H;  1G29 1;  4DR3 L;  1XMQ L;  1PH5 A;  4A3G G;  2WB1 G;  2AWO A;  4POF A;  1YIT A;  4A3L G;  2OCE A;  5C44 H;  1S72 A;  3J7A 5;  3PF5 A;  2UXD Q;  1X6O A;  4GOP C;  4MTN A;  2YU9 H;  3HOX H;  4DR6 Q;  3D31 A;  1NBW A;  2R7F A;  5IYD G;  1GVP A;  1MKH A;  2VUM H;  3J81 i;  2CWA A;  1KL9 A;  4NPS A;  1IBM L;  2B63 H;  3I56 A;  4IPD A;  3D0F A;  3PF4 A;  2OQ0 A;  1D8L A;  2EXD A;  4DKA C;  4DV7 L;  2JA8 G;  1XPO A;  3PUY A;  4KHP Q;  1T9H A;  4YWM A;  2UXD L;  4R4C A;  1AH9 A;  2YYZ A;  4X6A H;  2UXB Q;  4DR6 L;  4DR4 Q;  1I6H H;  1C0A A;  1PV4 A;  5IE8 A;  2HIV A;  2D0P A;  3J81 j;  1R9T H;  2I5M X;  4X65 Q;  2VS1 A;  5HGQ A;  5IYC G;  3Q8D A;  4DAY B;  2F4V L;  3H0G H;  4MNO A;  2MFI A;  4LWC A;  4LF7 Q;  1E3P A;  3HOU H;  1I94 Q;  2UXB L;  2JE6 I;  4JI8 L;  1X65 A;  2QGQ A;  3I4M G;  1PHJ A;  4LF8 Q;  4JI6 Q;  1SLJ A;  1X3F A;  1SRO A;  4DUZ Q;  2UUC Q;  3I7F A;  4P72 A;  4X65 L;  4LUV A;  4FDB A;  3J80 i;  3NEL A;  4GN5 A;  4JBK A;  1OXU A;  2AWN A;  1UE1 A;  1UE6 A;  4LF7 L;  1EIY B;  3A5Z B;  4YY3 Q;  1I94 L;  2OTJ A;  1Z47 A;  3I4O A;  2ES2 A;  3STB D;  2R92 G;  4AYB G;  2WAQ E;  2NN6 I;  4LF8 L;  3AFP A;  1L1O A;  5FLM H;  3U58 A;  2R7Z H;  4JI1 Q;  4DUZ L;  1JJ2 A;  2UUC L;  1EQR A;  3TS2 A;  1N36 Q;  1N32 Q;  4TQU S;  2PI2 E;  2Q2I A;  1B7Y B;  5JJL A;  1YJ9 A;  3GTQ H;  4BXX H;  4LUO A;  1IBK Q;  1CUK A;  4KI0 A;  1HJP A;  4HIM A;  3STB C;  1VQN A;  3HOV G;  3I2Z A;  5ELO A;  4P71 A;  4XTC S;  5C4J H;  3UE0 A;  5FJ8 G;  4OWT B;  1SE8 A;  2I5H A;  2KCT A;  4JI1 L;  1QVG A;  4DR7 Q;  4HJ7 A;  1N36 L;  1J6Q A;  5LMU L;  3AEV A;  1IXR A;  3CCL A;  4A3D H;  3G48 A;  4IJL A;  3PUV A;  3KJP A;  1NMG A;  1K9M C;  1IBK L;  1KHI A;  3CCS A;  4LF5 Q;  2NVT H;  4BA2 I;  3GTO H;  3HOZ H;  2D62 A;  2VL6 A;  1AE2 A;  2LXK A;  2R6G A;  4L5S A;  1VQF A;  2BA1 A;  4JI5 L;  3M7N A;  3S14 H;  4LF4 Q;  1YI2 A;  2ZJQ A;  4DR7 L;  4B3R Q;  4IFD I;  1XNR Q;  1LUZ A;  2Y0S E;  4ME3 A;  4QIW E;  3S2H H;  3G6E A;  4LF5 L;  1VQK A;  1QVC A;  5M3F G;  1N34 L;  3KOJ A;  2VQE L;  5JEA J;  3S17 H;  2MO1 A;  1WOC A;  4A3C G;  1Q46 A;  2CCZ A;  1CSQ A;  4BBR G;  3CME A;  1K8G A;  2JA7 H;  2GVA A;  4A3M G;  4LF4 L;  1X9N A;  3LGJ A;  3BJU A;  4R4I A;  4R4Q A;  2K14 A;  4IJH A;  3SGI A;  4DV5 L;  3TS0 A;  1XNR L;  4B3R L;  5M3M G;  2E2I H;  4A3G H;  1EIF A;  1JT8 A;  4JBW A;  2YTY A;  3CP0 A;  4JI2 L;  1XPU A;  4A3L H;  5JJK A;  2K5V A;  4NXN Q;  4EQ5 A;  4YHH L;  4OON A;  3M85 A;  4JI3 Q;  1WCM H;  2ALY B;  2DUD A;  1U5K A;  4A3D G;  2KHI A;  1EOV A;  2E8G A;  4DNI A;  2F52 A;  3CQZ H;  3ER0 A;  4HIO A;  1KAW A;  3JAM i;  2UU9 Q;  4R4O A;  1Q1E A;  1UE7 A;  5LMN W;  2K75 A;  2V1C C;  3CAM A;  1L2F A;  2D0O A;  5IYB G;  3TQY A;  2JA8 H;  4JI3 L;  1FJG L;  3UDI A;  2B29 A;  1QUQ A;  1K0R A;  3CW2 C;  3JC6 6;  4LFB Q;  3GD7 A;  1RIP A;  5GAE C;  3S1N H;  3S24 A;  1N8R C;  1KXL A;  5IP9 G;  4DUY L;  4YCW A;  1L1O B;  1Y1V G;  1HZ9 A;  4GOP A;  4DR2 Q;  1SR3 A;  3TRE A;  2UU9 L;  2Z6K A;  1Y14 B;  1OXV A;  3HKS A;  4YWK A;  5GAG C;  1V1Q A;  2ZM6 Q;  1HR0 W;  1K83 H;  1PH1 A;  4LFB L;  3K8A A;  5M5W H;  2Z0S A;  1ASY A;  2NVX H;  3I4M H;  1P8L A;  4POG A;  2N49 A;  1WCM G;  4DR2 L;  4JI4 L;  4JOI C;  4JI5 Q;  5AJ3 Q;  3GTP H;  3J7Z C;  2ZM6 L;  1X56 A;  4DV4 Q;  2Z6K C;  4QL5 A;  1W2B A;  1PH4 A;  5GRO A;  4OO1 G;  1TWA H;  2JA9 A;  2UUB Q;  2PMZ E;  4GKK Q;  1VQD A;  4LFA Q;  4JG2 A;  2R92 H;  1SFO H;  3CCU A;  3TRZ A;  1VQG A;  3H3V H;  1E7Z A;  5AJ3 L;  3HOW H;  3EIV A;  5IY0 A;  4P73 A;  4EX5 A;  4DV4 L;  4HJA A;  1EQQ A;  4ALP A;  1VQI A;  4A76 A;  2UUB L;  1E22 A;  4L5R C;  3K7U C;  4HIK A;  4UY8 C;  3M4P A;  4GKK L;  1SN8 A;  3E9H A;  4LFA L;  4X64 Q;  4KHP L;  5FJ8 H;  4QGU A;  2FXQ A;  4QY7 A;  5C0X G;  5C0X J;  1X3G A;  3CD6 A;  3I4N G;  4DR4 L;  3F2D A;  2JJQ A;  2ID0 A;  3KDF A;  2ZJP A;  1XMO Q;  2I0Q A;  2IX1 A;  4DV3 Q;  3PUZ A;  5GAD C;  3J80 c;  4HJ9 A;  1PH7 A;  3PO2 G;  4X64 L;  3I55 A;  2ZJR A;  4B3M Q;  5DLQ E;  1K3R A;  2N8N A;  4K0K Q;  4QQB X;  4A93 G;  3RLN A;  4GN3 B;  1BVS A;  3ZJY C;  3ULJ A;  3KF6 A;  1VQB A;  1A8V A;  1XTD A;  1UEB A;  4OXP A;  4JI6 L;  5M3F H;  1VQ4 A;  1OXX K;  4DPG A;  1QUQ B;  1X55 A;  3W1B A;  1PH8 A;  1A0I A;  4A3C H;  3HOW G;  3PIO A;  4GLV B;  4BBR H;  1KIX A;  3ULP A;  3PIP A;  3HKZ E;  4A3M H;  4GOP B;  1QZH A;  4B3M L;  1Z9F A;  4K0K L;  3U4V A;  1KC8 C;  1VS0 A;  4UP9 A;  4YY3 L;  1UE5 A;  2GVB A;  5M3M H;  4X66 Q;  1CSP A;  2WB1 E;  4JCV E;  4UPA A;  2LSS A;  1Q8K A;  2ZTC A;  1WFQ A;  3UE1 A;  3CCQ A;  3ICE A;  5C4X G;  2MNA A;  1N32 L;  3FHW A;  4DV0 Q;  2EIF A;  2IT1 A;  2NZO A;  3S16 H;  4GNX A;  4NB3 A;  1Q12 A;  1VQ5 A;  5GQO A;  2AMC B;  3GO5 A;  2ASB A;  2JEB I;  4H02 A;  1TWC H;  3PUW A;  1JJC B;  2E2J H;  3CC4 A;  2JEA I;  2BH8 A;  4YCU A;  5IYB H;  2PQA A;  3CXC A;  1MJC A;  1NMF A;  1VQC A;  4DV0 L;  1YIJ A;  3K0X A;  1VQE A;  2KBN A;  5IP9 H;  4GNX C;  1Y1V H;  3CCE A;  1N33 Q;  4JBJ A;  1G51 A;  4O0A A;  1GM5 A;  2K4K A;  5C3E G;  1I3Q H;  3HOY G;  3OYY A;  4BY1 H;  2K5H A;  1VQJ A;  1YNX A;  4A3B G;  3FKI G;  4HJ8 A;  4A3I G;  1L0W A;  1CKN A;  3FP9 A;  4UP7 A;  1K8A C;  3F1Z A;  1YZ6 A;  1G6P A;  1PVO A;  3BZC A;  3M3Y H;  1Q7Y C;  3OTO Q;  2E5L Q;  5E7N A;  2UUA Q;  1YHA A;  4AQY Q;  3S15 H;  4BY7 H;  4PZ7 A;  4OX9 Q;  1N33 L;  3DLL A;  4KLK A;  1YVC A;  5M5Y H;  3WWV A;  5LMN Q;  1B8A A;  3A5U A;  4A3J G;  4GKJ Q;  2VNU D;  1TWG H;  3EBE A;  3A0J A;  2QEX A;  3RZO H;  2VZA A;  1VQA A;  2JA5 G;  3NEN A;  2WP8 J;  1HZB A;  2A1A A;  4Y52 H;  3JAM c; 
#chains in the Genus database with same CATH topology
 3CF5 A;  1D5X C;  3T1Y Q;  3OTO L;  1RTN A;  1WCM B;  4OWX B;  4U68 A;  3GTJ H;  3HFZ B;  1B44 D;  1II3 A;  2JYO A;  3NBH B;  5LL6 S;  4F88 A;  4XXE A;  2I5L X;  5J1Z A;  1HR0 Q;  2A6E D;  1NNX A;  4WJ4 A;  2E2D C;  2K28 A;  3NXW A;  3T1Y L;  3E0E A;  1E2V A;  4BY1 G;  5GAH C;  4BBS G;  4RFB A;  1EOT A;  1Y8O B;  3NE5 B;  1HR0 L;  4JI0 Q;  1TII D;  4X62 Q;  1SRU A;  1XJV A;  4BY7 G;  5FLX L;  4DV1 Q;  2LKV A;  3VDY A;  1TS3 A;  4KK7 A;  1PXU A;  4AH6 A;  5H1S E;  4B3S Q;  3J81 c;  4R8N A;  4A3E G;  4EQN A;  2RCN A;  2WKD A;  4HN7 A;  1YJW A;  4JI0 L;  2KEC A;  1ML0 D;  3OPO A;  3T56 B;  3VYS A;  5ISR A;  5C0X I;  4DV1 L;  1JOK A;  3H09 A;  3K5O A;  3CCM A;  1PLF A;  4LW1 A;  4DAP A;  4V0B A;  1WVL A;  3TZD A;  3R3O A;  3ONA B;  4B3S L;  2J4X A;  3IRB A;  1YHB A;  4B9W A;  1JWU D;  3UI2 A;  5D14 A;  1TWF H;  3KYH C;  3OMC A;  3U50 C;  3PV0 A;  1CKN B;  2UXC Q;  4H0L C;  2RDG A;  2CW0 C;  5FK9 C;  5ELE A;  1XNQ Q;  2TSS A;  3SXH A;  1X3E A;  2QF7 A;  1KDC A;  5FKA C;  4PMW A;  1V9P A;  2K5N A;  1MJE A;  1B3A A;  1S5C D;  2UXC L;  3NPP A;  1RL2 A;  2CWP A;  1Q82 C;  2Q2U A;  4ZKC B;  5IIF A;  1XNQ L;  2ZTD A;  1XMO L;  4KD3 A;  3VYT A;  4DK3 C;  3GDE A;  2NN6 H;  4JC0 A;  4DK6 C;  4C3I B;  3T1H Q;  5FLX c;  5HUR A;  3HOY H;  4DR5 Q;  2KOL A;  4DFA A;  1FL0 A;  3RLO A;  2ENB A;  3S9W A;  5I4D A;  2E2H B;  1AFP A;  3EFX D;  4PQX A;  3T1H L;  4A3B B;  1KRT A;  2OEO A;  3S2D B;  1WTO A;  4O2D A;  3J7A F;  4DR5 L;  5FO8 B;  4ULL A;  1V8Q A;  1S5B D;  1I6V C;  3L7Z C;  1SYE A;  3H91 A;  1IW7 C;  1BKB A;  2KED A;  4RGO S;  3DEO A;  4QUC A;  4LK1 C;  4A3J B;  4IZ8 A;  2KHS A;  4R4T A;  2Q2T A;  4NDX A;  1JOO A;  2E2J B;  3H0G G;  5ELN A;  2NN6 G;  1H9S A;  4IOC A;  3RN2 A;  1Y1W B;  1L1O C;  1KNA A;  1SND A;  3NQT A;  3GTK H;  1IBL Q;  3MXN B;  3F8T A;  1TY0 A;  1YBY A;  3CHB D;  2BH2 A;  3GTG B;  1G2T A;  3J7Y W;  3EA6 A;  1EU4 A;  2NB0 A;  1UNS A;  1K3B C;  4DAM A;  2K5Q A;  2K52 A;  1GHK A;  4DXG A;  3VR2 A;  2VY3 A;  2CFM A;  3MA2 B;  4RG1 A;  1LYL A;  1IBL L;  5COY A;  4JI2 Q;  1X3Q A;  1J5E Q;  2JP1 A;  2H5X A;  3K7A B;  5M5X H;  2E76 C;  4HMI A;  5FLM G;  3CMA A;  2R7Z G;  3DXJ C;  5JEA G;  3BU2 A;  4LF6 Q;  1STA A;  4J1M A;  1PH9 A;  2F0N A;  3W1G A;  1PTO C;  2F0P A;  4L5T A;  1PFB A;  4KHZ A;  4FNF A;  1J5E L;  3T13 A;  1C4Q A;  1C7Y A;  1YEZ A;  2G9H D;  1E2Z A;  4LF6 L;  1VF5 C;  1BCP B;  2YV5 A;  2EYO A;  4K5X A;  3CPW A;  1HUN A;  2EJM A;  2HT1 A;  1W3S A;  1CKO A;  3FDT A;  5J3B A;  2A6E C;  1PRT F;  3HOZ G;  3KLS X;  1JE5 A;  1EWI A;  5F2D A;  2FIN B;  2AKW B;  1WTX A;  1GUS A;  2Q2H A;  3WOF A;  2D5D A;  5L37 A;  3K80 C;  3E0J A;  2JQO A;  3NUC A;  2PZU A;  2HDL A;  4DV2 L;  4DNR B;  4RWS C;  3MFY A;  3HKZ G;  4XT3 B;  2ICI A;  1VQM A;  4A93 B;  2G5D A;  2AWO A;  4J6H A;  2OCE A;  5C44 H;  1S72 A;  2F0W A;  1STB A;  4JK1 C;  4I65 A;  4DR6 Q;  3E6Z X;  1NBW A;  2NWG A;  3J81 i;  1NSN S;  2L5T A;  1F9Q A;  3PF4 A;  1U4R A;  2YU9 B;  4KHP Q;  3DMU A;  2UXB Q;  4EGV A;  4DR6 L;  1D5M C;  2B63 B;  3TDQ A;  4N9T A;  1WTP A;  1R9T H;  4M1U B;  4OEL B;  2B8F A;  5HGQ A;  3HP3 A;  4MNO A;  4OHJ A;  1I6H B;  2DN8 A;  1E3P A;  1I94 Q;  4RGM A;  2UXB L;  3MZ5 A;  1SE4 A;  4JI6 Q;  4B08 A;  2DY8 A;  4DUZ Q;  2V4D A;  4P72 A;  3I3C A;  1TU2 B;  4GN5 A;  3HOU B;  2AWN A;  1RTO A;  2K7V A;  1EIY B;  3SDZ A;  4YY3 Q;  1I94 L;  4X3K A;  2A69 C;  3TP6 A;  5I6W A;  3AFP A;  4DUZ L;  1JJ2 A;  3R93 A;  1N36 Q;  2Q2I A;  4KV6 A;  4ZUI A;  1BUV T;  2PMZ B;  1A6X A;  3JAM E;  5FO7 B;  1IBK Q;  3BDL A;  1CUK A;  4MIU A;  3I90 A;  2QDL A;  3UE0 A;  1ET9 A;  4OWT B;  1BCP F;  4LMQ D;  3PIP 3;  4HJ7 A;  2PZT A;  2KQ3 A;  1N36 L;  1IXR A;  1GUW A;  3MVV A;  3G48 A;  4IJL A;  3KJP A;  4LF5 Q;  1NMG A;  1PFN A;  1IBK L;  2NVT H;  1WTR A;  1SMY D;  1S5D D;  3MXP A;  2R6G A;  4L5S A;  2BA1 A;  3M7N A;  1YI2 A;  2ZJQ A;  2F0D A;  3VR5 A;  2F0V A;  4QIW E;  4RHR A;  3GTO B;  1B9M A;  4C56 C;  4LF5 L;  5M3F G;  4JVZ A;  3A56 A;  4E6I A;  2KCC A;  3A7A B;  2VQE L;  5EQ0 A;  3S17 H;  2MO1 A;  2CCZ A;  1CSQ A;  3G7L A;  1XWE A;  4A3M G;  3BJU A;  4R4Q A;  2K14 A;  4IJH A;  4DV5 L;  5M3M G;  4A3G H;  1GHJ A;  1SNQ A;  3P20 A;  1CA6 A;  1CFM A;  4A3L H;  4NXN Q;  4EQ5 A;  4OON A;  4HMJ A;  1QE6 A;  1U5K A;  3OWE B;  1SYG A;  4RAU C;  3T53 B;  1EOV A;  2HCC A;  4DNI A;  3ER0 A;  1BQQ T;  3CAM A;  2ZXO A;  2D0O A;  2JA8 H;  3TQY A;  1NR4 A;  1TT2 A;  2B29 A;  1QUQ A;  2R3Z A;  4P2C B;  2P5Z X;  1KXL A;  5IP9 G;  1L1O B;  1Y1V G;  1HZ9 A;  4DR2 Q;  4RA8 A;  2Z6K A;  1Y14 B;  4KN7 C;  2OF1 A;  4YWK A;  5GAG C;  1V1Q A;  1HR0 W;  1GUG A;  1K83 H;  2LS0 1;  2K32 A;  3K8A A;  3BYY B;  5M5W H;  3SE0 A;  1K8M A;  1P8L A;  4FXD A;  2N49 A;  4DR2 L;  1MSG A;  5AJ3 Q;  4RH6 A;  3J7Z C;  1W2B A;  2XVS A;  2Z6K C;  3HGB A;  1TWA H;  2VB2 X;  2UUB Q;  2F0O A;  3I4M B;  1QWY A;  1VQD A;  4LFA Q;  4HSV A;  1VQG A;  1ENC A;  5A35 A;  5AJ3 L;  2VUM B;  4HJA A;  4P73 A;  1EQQ A;  1ENF A;  5IGF A;  2UUB L;  4A76 A;  4L5R C;  1SFO B;  3TZU A;  1SN8 A;  3E9H A;  1CZW A;  1A3V A;  4LFA L;  2F3V A;  3C3L A;  5EPK A;  5KEE A;  4QY7 A;  5C0X G;  1STH A;  3I91 A;  4DR4 L;  4DV3 Q;  3HEJ A;  4HJ9 A;  3CKI B;  5J22 A;  4A93 G;  3QWN A;  1BVS A;  3ZJY C;  4C3J G;  2RA4 A;  1O7L A;  4WOR A;  1EYA A;  2F0L A;  4DU9 A;  2HUG A;  1OXX K;  1PH8 A;  1A0I A;  2SOB A;  5E3F A;  3NTH A;  3IAY A;  4KKU A;  3ULP A;  3PMF A;  3HKZ E;  3WDN A;  3JAM L;  3PIP A;  1YNJ C;  1O7Y A;  2JN4 A;  1BCP D;  4ZUJ A;  1EIH A;  4X3T A;  2LSS A;  1WFQ A;  2QEJ C;  3CCQ A;  1LT6 D;  5C4X G;  2EOT A;  2MNA A;  1K28 A;  2EIF A;  4GNX A;  5IGB A;  4RGN A;  1X3P A;  1V1O A;  5GQO A;  5KNC A;  1VQ5 A;  2JEA I;  1KLG D;  2BH8 A;  3SHL A;  1ET6 A;  4YCU A;  5IYB H;  3QOJ A;  1MJC A;  1VQC A;  2RVL A;  2G9D A;  1ONL A;  4Q0F A;  2F03 A;  1UEA B;  3K0X A;  1YIJ A;  4FF1 A;  2KBN A;  1SMY C;  4GNX C;  3H94 A;  1EWC A;  2KVM A;  2NTS A;  5C3E G;  3S14 B;  1I3Q H;  3V2T A;  3FKI G;  4A3I G;  1L0W A;  1CKN A;  2WKC A;  1YZ6 A;  1PVO A;  3M3Y H;  1B4O A;  4AQY Q;  5ELB A;  2B2W C;  1YVC A;  2B8G A;  5M5Y H;  3A5U A;  1TWG H;  3EBE A;  3A0J A;  3RZO H;  4OO1 H;  2WP8 J;  3JAM c;  1R4Q B;  2JA6 G;  4F87 A;  3S15 B;  1K0S A;  1I4P A;  2K6A A;  4KHV A;  4LF9 Q;  4AQY L;  3ULL A;  1FVI A;  3PCO B;  3ERQ A;  4OEM B;  1PRT C;  3NEM A;  5BN3 A;  3OSO A;  3P75 A;  3K59 A;  4NXM Q;  1STG A;  2RHQ B;  4JOI A;  3VYU A;  1KDA A;  1KD1 C;  3GTJ B;  2CQA A;  2N3S A;  2DJG C;  3I4N H;  1YJN A;  1D7Q A;  1TS4 A;  4LFC Q;  4GN4 B;  1LTR D;  3D4D A;  1MI2 A;  1YHQ A;  3PO3 H;  2A74 C;  4IPC A;  1C9O A;  2R93 G;  3PO2 H;  1HH2 P;  2MGS A;  2WAQ G;  2J0T D;  3TEH B;  5C3X A;  2Q8T A;  3EN2 A;  2L15 A;  4LFC L;  2F0H A;  1M90 C;  4JW0 A;  1VQ9 A;  1TWH H;  3KLW A;  4MTK A;  3M9B A;  5JOB A;  2F0E A;  3MXN A;  1I50 H;  2CW0 D;  4DA2 A;  4IAL A;  3RLF A;  1B50 A;  3U4Z A;  1PH2 A;  2N78 A;  3GTL H;  1TQO A;  3GP7 A;  4QUF A;  3HOW B;  2F3I A;  3FEW X;  4R8I A;  4YCV A;  4Y7N H;  4CBV A;  4FP5 D;  4JPB W;  3PO3 G;  1F2Z A;  3BDO A;  2K50 A;  1TWF B;  2B2T C;  4ME5 A;  3L2P A;  4JI8 Q;  4ZQ3 A;  4DV6 Q;  3P1H A;  1QCB D;  3S1M H;  4J15 A;  1XYI A;  4GLX A;  1SNM A;  1QZG A;  3G71 A;  3BZK A;  4HID A;  3HOV G;  3EQL C;  1I5F A;  4A3F G;  4DV6 L;  2XGT A;  5BR8 Q;  1C48 A;  3CCR A;  3ERS X;  2CKZ B;  1STY A;  5JVG 3;  1Y8P B;  4DNT B;  3PGZ A;  3HOX G;  1IW7 D;  1D1I A;  3OIQ A;  3HOY B;  1O80 A;  2LXJ A;  2VUM G;  2NZH A;  1S5E D;  1HXY D;  2JXM B;  3KJO A;  1HNZ Q;  1NTG A;  2JA5 H;  5BR8 L;  1E24 A;  3F2C A;  2QA4 A;  4B3T Q;  1BCP C;  3E9I A;  4RKB A;  3CCJ A;  4X66 L;  1RJT A;  2F0S A;  1Q81 C;  2ZXR A;  5EGT A;  3AYH B;  4CDF C;  2EYJ A;  4BS9 A;  2MQH A;  3MFG A;  3G4S A;  1HNZ L;  3UDX A;  1H9M A;  1B70 B;  4B3T L;  5EKI A;  1B9N A;  4BBS H;  1N34 Q;  1HFG A;  1PA6 A;  1BBW A;  3OW2 A;  2DNE A;  3D6W A;  4RGT A;  1I4X A;  2SEB D;  3GTK B;  1X54 A;  3S1R H;  3OW7 A;  2YTX A;  2AHO B;  4A3E H;  4YHH Q;  2K1B A;  1HCZ A;  4QJF A;  3F2B A;  1FGU A;  4LNQ A;  4BXX G;  4R1J A;  3IFT A;  4LUZ A;  4IFD J;  1FNU A;  1H9R A;  2PNH A;  4TKO B;  1WD0 A;  3FPU B;  2K04 A;  4ZRZ A;  1VF7 A;  4A4I A;  1FJG Q;  1M4V A;  1NUC A;  4PV1 C;  2C9O A;  2RDF A;  4PG3 A;  1K8O A;  4ILW A;  1JQY D;  3LWU A;  5EJW A;  1QVF A;  1V43 A;  5KIX A;  4R9W A;  4C3H B;  5DM6 3;  4GZY C;  1V1P B;  1E1O A;  1PFM A;  4GNX B;  4WRD A;  1EEI D;  1PH6 A;  3J80 E;  1LTI D;  3NBI A;  4X62 L;  5IYC H;  2D9U A;  2DNC A;  2MHV A;  2JA7 G;  1VQ6 A;  2Y0S B;  1JB7 A;  4LJZ C;  1SXT A;  1ILQ A;  2L12 A;  4CDC C;  1STN A;  4L8J A;  1PH5 A;  2WB1 G;  3KBX A;  1YIT A;  4UHV A;  2UXD Q;  3PF5 A;  1X6O A;  4GOP C;  1MSH A;  2NVY B;  1T5E A;  1MKH A;  3EVQ A;  1KL9 A;  4F7X A;  5JJZ A;  5C44 B;  2BOS A;  2TMP A;  3GTM B;  4DKA C;  1PRT B;  1XPO A;  3PUY A;  5BN5 A;  2K05 A;  2FFK B;  4KKT A;  5E1F A;  2UXD L;  4QCL A;  2FMM A;  2EYH A;  5IE8 A;  2HIV A;  3J81 j;  1PZI D;  2I5M X;  4X65 Q;  3M4O B;  5IYC G;  3Q8D A;  3H0G H;  4Q5V A;  2NTT A;  2F0J A;  1R9T B;  1PZJ D;  3Q24 A;  1PHJ A;  4LF8 Q;  1LO5 D;  2A69 D;  1SRO A;  4FYD A;  3I7F A;  3KBG A;  4X65 L;  4FDB A;  4CKC A;  1BO0 A;  4ODG A;  1SYD A;  1OXU A;  1UE6 A;  1ESR A;  5IOD A;  3A5Z B;  4A3K B;  2OTJ A;  3A7L A;  3VA5 A;  2ES2 A;  2R92 G;  3W2D A;  2N88 A;  3QJY A;  2M9V A;  2WAQ E;  4AYB G;  4LF8 L;  1L1O A;  5FLM H;  2R7Z H;  5JEA H;  1EQR A;  4TSS A;  1KTK A;  1N32 Q;  2EZV A;  4ABN A;  2XIW A;  1G2S A;  3GTQ H;  3I8Z A;  4KI0 A;  2X6G A;  3STB C;  1VQN A;  2IWH A;  4V19 0;  2XWJ B;  5ELO A;  4P71 A;  1CM9 A;  1ESF A;  1JE4 A;  2I5H A;  4NW2 A;  3DM1 A;  2QCP X;  2XSC A;  4PMB A;  5C5L A;  1J6Q A;  3A8K E;  3CCL A;  4A3D H;  4K8I A;  3ERO A;  1K9M C;  3CCS A;  4BA2 I;  4G7Z C;  2MPM A;  3HOZ H;  1DON A;  2D62 A;  2VL6 A;  2LXK A;  3IFD A;  1F2Y A;  4J8Q A;  2EYF A;  5CV4 A;  1CQV A;  3C2P A;  4B3R Q;  1XNR Q;  2CH4 A;  4ME3 A;  2NVT B;  1VQK A;  1QVC A;  2EJG C;  3KOJ A;  4RCO A;  3Q6S A;  3Q0A A;  4BBR G;  2HDM A;  1K8G A;  2GVA A;  2MJ8 A;  2L1B A;  4R4I A;  3TS0 A;  4B3R L;  1XNR L;  3K58 A;  2E2I H;  4JI2 L;  1JOQ A;  3D8G A;  4ZLT F;  3S17 B;  2K5W A;  2K5V A;  2I07 B;  3M85 A;  1WCM H;  4FF3 A;  2HQE A;  4YIJ A;  4A3D G;  4H44 C;  3H3V C;  2XRS D;  2O2L D;  1A3U A;  1F9S A;  1Q1E A;  1UE7 A;  2V1C C;  2KA7 A;  3UDI A;  2QDB A;  3CW2 C;  5I9O A;  4LFB Q;  3JC6 6;  1N8R C;  4YCW A;  4X3U A;  1SR3 A;  3J80 L;  5NUC A;  2JA8 B;  2ZM6 Q;  3VYR A;  5IGD A;  4LFB L;  3PQI A;  2PPB C;  5EKK A;  2NVX H;  1XX8 A;  1IKL A;  1EYC A;  4RKL A;  1WCM G;  4HTH A;  4K5W A;  1K83 B;  1X56 A;  1WTH A;  2ZM6 L;  3AU7 A;  5GRO A;  1Q3L A;  5M5W B;  1PYW D;  1QG7 A;  5JAV A;  3TRZ A;  5IGE A;  1JOR A;  4HED A;  5D3I B;  1VDZ A;  4WJW A;  1JR0 D;  3Q23 A;  3QO2 A;  4UY8 C;  4HIK A;  3M4P A;  4X64 Q;  4KHP L;  3TSS A;  3K5N A;  1AP0 A;  2EY2 A;  1X3G A;  2JJQ A;  3T51 B;  1QNK A;  2I0Q A;  3PUZ A;  5GAD C;  3J80 c;  3VR6 A;  1PH7 A;  3MAQ A;  4X64 L;  1J9O A;  3I55 A;  2ZJR A;  1DM0 B;  2QKI C;  3RLN A;  1CTM A;  1YNJ D;  2K03 A;  3ULJ A;  2IPK D;  4OXP A;  4JI6 L;  5M3F H;  3IKJ A;  1VQ4 A;  1FD7 D;  1SNC A;  4XQQ A;  3HG9 A;  4A3M H;  4GOP B;  1QZH A;  1KC8 C;  1VS0 A;  3QR8 A;  2C5C A;  2Z9H A;  1ZYR D;  5M3M H;  4YY3 L;  2WB1 E;  1RKN A;  1Q8K A;  2ZTC A;  1WTW A;  1EFI D;  3NK9 A;  2IT1 A;  5M9O A;  3S16 H;  4NB3 A;  5AFW A;  3X3N A;  5KGU A;  3TP5 A;  2ASB A;  2JEB I;  3PUW A;  1JJC B;  2F0T A;  2E2J H;  4C3I G;  5HGT A;  3SK4 A;  2OT2 A;  3CXC A;  1NMF A;  2AQ1 B;  4DAV A;  5BN4 A;  1U9R A;  5IP9 H;  1Y1V H;  4I7Z C;  4O0A A;  1GM5 A;  3DWP A;  2K4K A;  3K57 A;  3OHX C;  1UAP A;  1RDP D;  3OYY A;  1LTB D;  2K5H A;  1VQJ A;  4F8M A;  4A3B G;  2A68 C;  3J7A V;  4G57 A;  3C1E A;  3OIP A;  4KJO A;  1E0B A;  4UP7 A;  3F1Z A;  1G6P A;  2O4X A;  2XRQ D;  4CKB A;  1G8Z D;  1Q7Y C;  2E5L Q;  2UUA Q;  3KK7 A;  3DLL A;  4KLK A;  3SK6 A;  3WWV A;  1B8A A;  4IUQ A;  4A3J G;  4G4K A;  1PRT D;  4FF4 A;  1SEB D;  1HZB A;  4EX5 A;  1QNU A;  3M3Y B;  1EIG A;  1QB5 D;  4IOA A;  1Q86 C;  2KJX A;  2E5L L;  4AYB E;  2UUA L;  3A54 A;  4UAI A;  3SEB A;  1Y1W G;  4NXN L;  5M5Y B;  2OXP A;  1SNO A;  3M4Q A;  3RZO B;  1B1Z A;  1HNX Q;  4IFD G;  4GS3 A;  2HIX A;  3RZD H;  1KRS A;  4HJ5 A;  2ZXP A;  2JK8 A;  3L9A X;  5JJI A;  2OTL A;  2FHT A;  3K5M A;  5C0X H;  3S1N B;  1CZG A;  3MXU A;  2HD3 A;  1HNX L;  3AFQ A;  1VQO A;  1HTP A;  1D5Z C;  2A6H C;  2N55 A;  1EY5 A;  1BBX C;  1IL2 A;  1XMQ Q;  1XPR A;  1WI5 A;  3I4N B;  2F0F A;  4A93 H;  4C3J H;  1DJR D;  1VQ7 A;  2B39 A;  3PUX A;  2OQK A;  1PYS B;  1PH3 A;  2L4N A;  3M7G A;  3PO2 B;  4LAA A;  3CPF A;  4JBM A;  1QJO A;  1Z7T A;  5K36 G;  5KRU A;  2L0C A;  4DV7 Q;  1EQV A;  1GO3 E;  1VCI A;  3MWY W;  2B3G A;  1TXY A;  5C4X H;  2OWO A;  1I50 B;  3TP7 A;  3S1Q H;  1IYJ B;  5IP7 G;  2F4V Q;  3GTL B;  4JYA Q;  4QB4 A;  3SR1 A;  4C2M H;  4FXG C;  4IPH A;  1CHQ D;  1HUM A;  2HQL A;  3QB3 A;  2FJ2 A;  4APV A;  1ZEQ X;  2I46 A;  4UDU C;  4DV3 L;  1KQS A;  1A62 A;  1M8A A;  4JYA L;  2PI2 A;  5C3E H;  2VW9 A;  2X6L A;  3S1M B;  1DGS A;  4EQP A;  2DY7 A;  3FKI H;  2MUY A;  4YWL A;  2NYZ D;  2PW5 A;  4A3I H;  5CV5 A;  1E1T A;  3AMU A;  4DXF A;  1HZC A;  4N8F A;  2NUC A;  4CJ1 B;  1V1P A;  1D1K A;  1AE3 A;  2Z1C A;  2Z4H A;  2B63 G;  1NJI C;  2KUM A;  3FPP A;  5E4X A;  1ZYR C;  1VQL A;  2JA6 H;  2B2V C;  3NQI A;  1LTL A;  3CU7 A;  5LMU Q;  1FNV A;  1O7I A;  1EYG A;  1F2L A;  1M1K C;  2DGY A;  1VQH A;  2JA5 B;  1WJJ A;  3ZYY X;  1E2W A;  2KCM A;  2B2W A;  2WV6 D;  2CQO A;  4JI5 Q;  1S3O A;  2H1E A;  1KDB A;  1D6E C;  2WFW A;  3HOU G;  3TBI B;  2NVQ H;  5IGG A;  3CCV A;  2HHH Q;  3T4A C;  2EY6 A;  1A63 A;  1BDO A;  1EY6 A;  2KEN A;  2ICE C;  1HZA A;  1SE2 A;  2EY5 A;  3PSI A;  4BY1 B;  2R93 H;  1B53 A;  3A74 A;  4DGZ A;  1IZ6 A;  1LLR D;  3R2T A;  2HHH L;  4BY7 B;  1AN8 A;  1TS5 A;  4GLA C;  4FXK C;  3S1R B;  1ILP A;  1BR9 A;  1NR2 A;  2BDO A;  1EFW A;  1PYB A;  4N9P A;  4ZYS A;  4BA1 I;  5IWA Q;  4A3E B;  1K73 C;  3KFU A;  1LT3 D;  3H6M A;  3NWT A;  2MO0 A;  1DZ1 A;  3VA7 A;  1WD1 A;  4JV5 Q;  1NE3 A;  1AZQ A;  4LF9 L;  1NY4 A;  3DUZ A;  5IYD H;  4DUY Q;  1CKM A;  1SYF A;  5IWA L;  3E3X A;  1SE3 A;  2BA0 A;  2IX0 A;  4NXM L;  4JV5 L;  4P75 A;  1PZK D;  2FMC A;  1BBU A;  3KLS A;  2AUJ D;  1GXD C;  1JB3 A;  3G6J B;  4JI4 Q;  1SNP A;  5J39 A;  4K2K A;  4TVA B;  3W5O A;  5KND A;  1PFS A;  3I4L A;  2F0G A;  4IPG A;  3HOV H;  4WJ3 M;  1IBM Q;  1N9W A;  4A3F H;  1G29 1;  5CV8 A;  4XQJ A;  3RUZ A;  4POF A;  2B2T A;  1F9R A;  1PTO H;  3HOX H;  2K01 A;  2R7F A;  5IYD G;  1GVP A;  2F0M A;  1U4P A;  2VUM H;  4NPS A;  1LT5 D;  3MTS A;  1STE A;  3I56 A;  1IBM L;  4M8A A;  1J8I A;  2AQ2 B;  5KYI A;  3D0F A;  2OQ0 A;  2EXD A;  2PZW A;  4PNY A;  1NAP A;  1T9H A;  5G3L F;  4YWM A;  5CV9 A;  1AH9 A;  4X6A H;  1ICW A;  1PV4 A;  2D0P A;  1UUP A;  4B9X A;  3FMC A;  5T1G A;  4DK0 A;  1BOS A;  4DAY B;  4LWC A;  5DEH A;  4LF7 Q;  2PQE A;  4KD4 A;  4K8J A;  4JI8 L;  1AW7 A;  2QGQ A;  3I4M G;  1X3F A;  4IUU A;  3TME A;  5IGC A;  2CVR A;  2QW7 A;  3H0G B;  4LUV A;  3NEL A;  1F2M A;  4JBK A;  1H9J A;  1RCV D;  1UE1 A;  4LF7 L;  4IUT A;  3C1F A;  1Z47 A;  3I4O A;  3STB D;  2ZT9 C;  1DXM A;  1DOL A;  4JI1 Q;  3GV3 A;  1NCV A;  1G91 A;  5JJL A;  1B7Y B;  4BXX H;  3NWS A;  4MN3 A;  1HJP A;  4HIM A;  3I2Z A;  4HR7 B;  5C4J H;  5FJ8 G;  3PIO 3;  1SE8 A;  2KCT A;  4JI1 L;  4DR7 Q;  3GTQ B;  1U4L A;  2EPB A;  4K6D A;  1FYC A;  3AB9 A;  3D3R A;  1Y8N B;  2KCN A;  2JSO A;  1BXT A;  2Z6B A;  5C4Z A;  1XTC D;  1VQF A;  5FO9 B;  2BE5 C;  3R8B A;  3S14 H;  4DR7 L;  4IFD I;  1LUZ A;  3U9O A;  3S2H H;  1N34 L;  3OMG A;  3HOZ B;  5I6Y A;  5IT9 E;  1WOC A;  1MHW C;  4A3C G;  4CHT B;  1TS2 A;  3V96 A;  2JA7 H;  5CMD A;  1X9N A;  3LGJ A;  1IYU A;  1ENA A;  1JT8 A;  5M5X B;  3RD4 A;  3CP0 A;  1XPU A;  5JJK A;  4I7A A;  1SSO A;  3SVM A;  3KF8 A;  4DN4 M;  4YHH L;  4JI3 Q;  3OWF A;  2ALY B;  1H9K A;  3HKZ B;  3W3A A;  4DF7 A;  1TR5 A;  3IL8 A;  2E2I B;  1A3T A;  1ROD A;  4IUP A;  1EZ8 A;  2F52 A;  3CQZ H;  4NMZ A;  4HIO A;  1KAW A;  3JAM i;  5A2Q E;  2UU9 Q;  4R4O A;  5CBE E;  2K75 A;  1L2F A;  4JI3 L;  1FJG L;  4L6T B;  2EYL A;  3N52 A;  4RHS A;  1IHZ A;  4GOP A;  5JPM C;  1TY2 A;  2UU9 L;  1OXV A;  3HKS A;  2EYP A;  2F0U A;  3TP8 A;  5DM7 3;  1QIL A;  2EE1 A;  2EJF C;  1PH1 A;  2B2U A;  2Z0S A;  1ASY A;  3NTK A;  1LV9 A;  4C1N K;  4OGQ C;  3GTP H;  2M00 A;  4DV4 Q;  5C4H A;  5EPL A;  2PMZ E;  5G3L D;  2NVX B;  4EQO A;  2B2U C;  2R92 H;  2DJF C;  4C1N I;  1O78 A;  2F0Q A;  3HOW H;  5C6A A;  4DV4 L;  3A8J E;  4ALP A;  1E22 A;  2XWB B;  3K5L A;  1HFN A;  4QGU A;  1DOK A;  2FXQ A;  4FO2 A;  5C0X J;  3CD6 A;  1TVX A;  3KDF A;  2ID0 A;  4IN3 A;  1XMO Q;  2IX1 A;  4QF4 A;  3CRL C;  3MHB A;  5DLQ E;  1K3R A;  2N8N A;  5CYU A;  4K0K Q;  4QQB X;  2Z4I A;  4PMC A;  1L0Y B;  1VQB A;  1XTD A;  3ITP A;  3HZX A;  4DPG A;  1X55 A;  3W1B A;  3HOW G;  3PIO A;  1ZKO A;  4GLV B;  4BBR H;  2CHB D;  1KIX A;  4K0K L;  3ND9 A;  1Z9F A;  4KY5 A;  1UE5 A;  2GVB A;  3SK8 A;  5M3F B;  4JCV E;  2A5H A;  3R2I A;  4UPA A;  3HS0 C;  3N6R A;  3ICE A;  3UE1 A;  4XQN A;  4A3M B;  1N32 L;  3FHW A;  4DV0 Q;  3QIA A;  2XN9 C;  1Q12 A;  5M3M B;  2AMC B;  1LT4 D;  1Q8I A;  4H02 A;  1TWC H;  1ZXT A;  4O1N A;  4U67 3;  3S16 B;  1GUN A;  2A68 D;  4DV0 L;  1FGB D;  1F77 A;  1VQE A;  1LTT D;  4JBJ A;  1G51 A;  3FRP B;  5IT9 L;  5CR3 A;  3BVM A;  3HOY G;  5D3D A;  2E74 C;  1L0X B;  4HJ8 A;  1RF2 D;  3NHH A;  3FP9 A;  1FR3 A;  1Y1V B;  3BZC A;  2WIN B;  3BZD B;  5E7N A;  3O13 A;  4PZ7 A;  4OX9 Q;  4TRD A;  4S3S A;  2L55 A;  5LMN Q;  4GKJ Q;  2QEX A;  3NEN A;  4A3G B;  4Y52 H;  1UWV A;  5A2Q L;  1S5F D;  1I4Q A;  1EZ6 A;  1JC7 A;  4OX9 L;  5LMN L;  4GKJ L;  3KF6 B;  2IJ0 A;  2VQF Q;  1HPC A;  4C3H H;  2A6H D;  4OO1 I;  4RMF A;  3D4R A;  1F9P A;  3NP8 A;  1A15 A;  1LAC A;  1MIU A;  4DV2 Q;  4CJ2 C;  2VQF L;  3RZD B;  4ZK9 B;  4MHE A;  3L0O A;  2GN5 A;  5HY6 A;  3CC7 A;  1G6Z A;  2IHF A;  4QMG A;  3H15 A;  4JI7 Q;  4NP5 A;  2WII B;  3KLR A;  1HA6 A;  5IT9 c;  3OOC A;  3Q22 A;  5JPN C;  2PW7 A;  1HA5 A;  3B6Y A;  4DR1 Q;  4IQZ A;  3LWE A;  4L5Q A;  2PQA B;  1S40 A;  4JI7 L;  2NVY H;  4X3S A;  5I2Y A;  1SYC A;  1TWA B;  2D2C C;  2RF4 A;  4L63 B;  4C3J B;  1RHP A;  1OXS C;  4A75 A;  4C3H G;  4DR1 L;  3GTM H;  2PCF B;  2XTI A;  2AQ3 B;  1T5X D;  1MGS A;  5C3W A;  2IL8 A;  3K81 C;  1EU3 A;  4AIM A;  3KF8 B;  3M4Y A;  3H3V I;  3M4O H;  3L3O C;  2YTV A;  3RR5 A;  3C46 A;  5C4X B;  4C3I H;  2Y0S G;  2F0I A;  2M2L A;  4RCN A;  4G7O C;  3S1Q B;  3VR4 A;  2R7D A;  1GOZ A;  1EYD A;  1OTC A;  5E4W C;  2K33 A;  2KHJ A;  3I73 A;  1MD2 D;  1FNW A;  4C2M B;  2BDN A;  2J7Z A;  4MZ9 A;  2L11 A;  1JCK B;  4FVM A;  2E2H H;  1HHV A;  4A3B H;  4A3K H;  3U9S A;  3S2D H;  5C44 G;  5K5P A;  1Q1B A;  2RHS B;  3DM3 A;  1EL0 A;  1HRJ A;  4CDD C;  5C3E B;  1CI3 M;  3RNU A;  4XIG S;  2RDH A;  2A19 A;  4FF2 A;  3FKI B;  4A3J H;  4PZ8 A;  4A3I B;  1VQP A;  4BWG B;  2EQS A;  1QOH A;  1LTG D;  1X32 A;  2A8V A;  3NTI A;  4KJN A;  4NKL A;  1EY8 A;  4UP8 A;  1Y1W H;  3CC2 A;  1OXT A;  5EAY A;  1WYD A;  4IO9 A;  2PO4 A;  4IFD H;  2SNS A;  3I72 A;  1KLU D;  3GTG H;  2JA6 B;  4KKS A;  1ASZ A;  1P16 A;  1AZP A;  3FVQ A;  2HCI A;  4A3K G;  3UDF A;  3RMH A;  2VQE Q;  1EUJ A;  3K7A H;  4KY7 A;  4OIJ A;  3MEF A;  3RN5 A;  5ELD A;  1HNW Q;  1H95 A;  4ZAI A;  1I3Q B;  4XDX A;  1LM0 A;  3UDG A;  4DV5 Q;  2NVQ B;  5D65 A;  4K2L A;  5IOC A;  3KDF B;  3VR3 A;  2F0K A;  3E5S A;  1GJX A;  4EVO A;  2ATW A;  5JVH 3;  2B2Y A;  3P7J A;  4O42 A;  1HNW L;  4DAY A;  2R93 B;  1SJE D;  1TWG B;  4KN4 C;  1I4R A;  1JWS D;  2Q8R E;  2WAQ B;  3BS1 A;  5K36 H;  3BVG A;  1U0L A;  1R4P B;  2Q8I B;  1YNN D;  4HCE A;  4KY6 A;  4CGY B;  1CQF A;  2B2Y C;  5LHY 1;  5CV7 A;  1SAP A;  5LL6 X;  1S4Z A;  3AQQ A;  2IY5 B;  4XYO A;  1HQM C;  1WTQ A;  4PZ6 A;  5IP7 H;  1JMC A;  1VQ8 A;  4H13 C;  2RBM A;  2KEE A;  4DR3 Q;  2MP1 A;  1GKH A;  4P74 A;  2IX3 A;  1W6J A;  5CGK A;  1DYQ A;  1JJG A;  1VMC A;  2QIL A;  1O7Z A;  3PO3 B;  2IHE A;  2LMC B;  2ZTE A;  3D4W A;  4IUR A;  4OWW B;  1SMX A;  5FOB B;  3KUP A;  2C35 B;  1EY0 A;  1GD7 A;  2F4I A;  4DR3 L;  4A3G G;  1XMQ L;  4A3L G;  3QG1 A;  1H9S B;  3J7A 5;  1HTL D;  1C8C A;  4H7B A;  4MTN A;  2YU9 H;  1BNZ A;  1HQR D;  3HOV B;  3D31 A;  1TWH B;  4A3F B;  2CWA A;  1GUT A;  2B63 H;  1CK1 A;  5ELF A;  4Z9C B;  4IPD A;  1D8L A;  4DV7 L;  3BDC A;  2JA8 G;  1PTO B;  1SJH D;  3HOX B;  3BVZ A;  4WFN 3;  2RSN A;  1EY9 A;  4R4C A;  1PDQ A;  2YYZ A;  1I4G A;  4DR4 Q;  1C0A A;  1I6H H;  1EY4 A;  3EJI A;  4CDE C;  4Y7N B;  1EWH A;  1MBY A;  3TN2 A;  5CBA E;  2VS1 A;  4OL7 A;  1LTA D;  2F4V L;  2F3W A;  2MFI A;  1B3Q A;  3HOU H;  1W6K A;  2JE6 I;  1X65 A;  1XXG A;  2LY7 A;  2B2V A;  1SLJ A;  1BF4 A;  4KTA A;  2UUC Q;  2SNM A;  1IKM A;  3MXG A;  3J80 i;  2EY1 A;  3NBH A;  1DD2 A;  1IYV A;  1CT1 D;  2NN6 I;  2VB3 X;  4K5V A;  3U58 A;  2R61 A;  4CKE A;  2UUC L;  3TS2 A;  1U4M A;  3D6C A;  3DHQ A;  3I70 A;  4TQU S;  2PI2 E;  3MEH A;  1YJ9 A;  4LUO A;  1B2T A;  5T1I A;  5EBD A;  4IUV A;  4XTC S;  5EKL A;  3HRZ C;  5CC4 A;  1OO9 B;  1QVG A;  2BE5 D;  5LMU L;  1JIC A;  3AEV A;  2EVB A;  3PUV A;  1KHI A;  3GTO H;  5C4J B;  1Y69 U;  2F1M A;  2LFN A;  1AE2 A;  2RQX A;  4JI5 L;  4LF4 Q;  3GQB A;  2Y0S E;  4BBS B;  3G6E A;  2EYM A;  4K14 A;  5COR A;  5JEA J;  4CJ0 B;  1Q46 A;  3J81 E;  3CME A;  2BCO A;  5EBC A;  4LF4 L;  1SBB B;  3SGI A;  5TSS A;  2RKS A;  3S2H B;  1LTS D;  3LNN A;  1EIF A;  4DK1 A;  3K6O A;  2YTY A;  4JBW A;  1KAA A;  3URY A;  2A73 B;  5ELC A;  1SDF A;  2JA7 B;  2DUD A;  3SK5 A;  2KHI A;  2E8G A;  4HCS A;  2WB1 B;  1PTO F;  5LMN W;  2WAC A;  1YNN C;  2H4O A;  5IYB G;  1K0R A;  3GD7 A;  1I4H A;  1RIP A;  4HAE A;  3LX0 A;  3CQZ B;  4N8X 1;  3S24 A;  5KYL A;  5GAE C;  3S1N H;  4DUY L;  2PYK A;  3TRE A;  2O5I C;  4KMU C;  1WTV A;  2RCF A;  1DOM A;  1A2U A;  4QIW B;  1LAB A;  3DWA A;  3I4M H;  4K6L A;  5FLX E;  4POG A;  5DNF A;  4JI4 L;  1AEX A;  1Z6H A;  4JOI C;  3A8I E;  4OO1 G;  4QL5 A;  5DAU A;  1PH4 A;  3X3M A;  2JA9 A;  1RD9 D;  4GKK Q;  3DWQ A;  3DEP A;  2IW3 A;  4JG2 A;  1SFO H;  3BG3 A;  3CCU A;  2L9H A;  3BYT B;  1TKW B;  3GTP B;  3H3V H;  1E7Z A;  3EIV A;  5IY0 A;  5KNB A;  3NSW A;  1VQI A;  2R92 B;  3K7U C;  4AYB B;  4GKK L;  1KNE A;  1CHP D;  5FJ8 H;  1EEF D;  2GA4 B;  3I4N G;  2RSO A;  2K5D A;  3F2D A;  2PNR C;  3GV6 A;  2ZJP A;  1KAB A;  5CV6 A;  2EDG A;  2NBF A;  3T16 A;  3PO2 G;  3A55 A;  3QOL A;  4B3M Q;  5C5M A;  5I2X A;  4GN3 B;  3F2U A;  3KF6 A;  1DCZ A;  1A8V A;  2SDF A;  1IL8 A;  4XT1 B;  1UEB A;  4G7H C;  4ID6 A;  1QUQ B;  2O5J C;  4A3C H;  4B3M L;  3U4V A;  3K0Y A;  4UP9 A;  4X66 Q;  4ZCK A;  1CSP A;  2R7Z B;  4HSP A;  1ICF B;  2X69 A;  4BBR B;  2XNA C;  2NZO A;  3MC0 B;  1GUO A;  5I9P A;  1EY7 A;  3GO5 A;  3V05 A;  3CC4 A;  4IUN A;  2PQA A;  1CA5 A;  1VMP A;  4A3D B;  2E75 C;  1JWM D;  1SYB A;  1TWC B;  3ND8 A;  3CCE A;  1N33 Q;  2EXZ A;  3WOE A;  3J81 L;  2AUK A;  4BY1 H;  1YNX A;  1A2T A;  2VXW A;  4XYQ A;  1EQT A;  1K8A C;  3CRK C;  3OTO Q;  1YHA A;  4BY7 H;  1PMR A;  3S15 H;  1Q90 A;  1N33 L;  2CH4 W;  2Z8L A;  4OIK A;  4ZKB B;  2VNU D;  1PTO D;  2NZ1 D;  1VQA A;  2VZA A;  2JA5 G;  2A1A A;  5EPJ A;  1D2B A; 
#chains in the Genus database with same CATH homology
 1UWV A;  3CF5 A;  2JA6 G;  4IOA A;  1Q86 C;  3T1Y Q;  3OTO L;  4AYB E;  4OWX B;  2E5L L;  2UUA L;  4LF9 Q;  3GTJ H;  3HFZ B;  4AQY L;  4NXN L;  1Y1W G;  4OX9 L;  3ULL A;  3M4Q A;  1FVI A;  3NBH B;  3PCO B;  3NEM A;  5LMN L;  4GKJ L;  3KF6 B;  1HNX Q;  4IFD G;  2I5L X;  1HR0 Q;  2VQF Q;  4GS3 A;  4NXM Q;  2RHQ B;  2HIX A;  3RZD H;  4JOI A;  1KRS A;  4WJ4 A;  4C3H H;  4HJ5 A;  1KD1 C;  3T1Y L;  4RMF A;  2JK8 A;  3E0E A;  4OO1 I;  4BY1 G;  1MIU A;  2N3S A;  2OTL A;  5JJI A;  5GAH C;  4BBS G;  3I4N H;  1YJN A;  1D7Q A;  4DV2 Q;  4LFC Q;  4GN4 B;  1HNX L;  3AFQ A;  1HR0 L;  2VQF L;  1VQO A;  4X62 Q;  3CC7 A;  3L0O A;  1SRU A;  2GN5 A;  5HY6 A;  1XJV A;  2IHF A;  1YHQ A;  3PO3 H;  4BY7 G;  3H15 A;  4JI7 Q;  4DV1 Q;  4IPC A;  1IL2 A;  1C9O A;  5IT9 c;  2R93 G;  3VDY A;  3PO2 H;  4AH6 A;  5H1S E;  1XMQ Q;  1WI5 A;  1XPR A;  3J81 c;  1HH2 P;  4B3S Q;  4A3E G;  2WAQ G;  3TEH B;  4A93 H;  2RCN A;  3B6Y A;  3EN2 A;  2L15 A;  4C3J H;  4DR1 Q;  1VQ7 A;  4LFC L;  1YJW A;  3PUX A;  4JI0 L;  2OQK A;  4L5Q A;  1PYS B;  1PH3 A;  2PQA B;  1S40 A;  5C0X I;  1M90 C;  4JI7 L;  4DV1 L;  3CCM A;  2NVY H;  3CPF A;  4LW1 A;  4JBM A;  2RF4 A;  1VQ9 A;  1TWH H;  3KLW A;  4B3S L;  3M9B A;  5K36 G;  1I50 H;  4JYA L;  4DV7 Q;  1OXS C;  3IRB A;  3RLF A;  4A75 A;  1YHB A;  3U4Z A;  1GO3 E;  4DR1 L;  1PH2 A;  3GTM H;  2N78 A;  3GTL H;  1VCI A;  2XTI A;  2B3G A;  1TWF H;  1TXY A;  3KYH C;  3U50 C;  2F3I A;  5C4X H;  2OWO A;  3PV0 A;  1CKN B;  2UXC Q;  4YCV A;  3K81 C;  4Y7N H;  3S1Q H;  1XNQ Q;  4AIM A;  3PO3 G;  1IYJ B;  3KF8 B;  5IP7 G;  2F4V Q;  3H3V I;  3M4O H;  4JYA Q;  2YTV A;  1X3E A;  2K50 A;  3RR5 A;  4PMW A;  4C2M H;  4C3I H;  2Y0S G;  4JI8 Q;  3L2P A;  1V9P A;  2K5N A;  4DV6 Q;  1MJE A;  4IPH A;  4J15 A;  3S1M H;  2UXC L;  2HQL A;  1RL2 A;  2R7D A;  4GLX A;  2CWP A;  1Q82 C;  2Q2U A;  4APV A;  1QZG A;  1XNQ L;  3G71 A;  2ZTD A;  3BZK A;  1XMO L;  1OTC A;  2KHJ A;  4DK3 C;  3GDE A;  4JC0 A;  1A62 A;  4DK6 C;  4DV3 L;  4HID A;  3T1H Q;  4MZ9 A;  5FLX c;  1KQS A;  1I5F A;  2PI2 A;  5C3E H;  2VW9 A;  2E2H H;  3HOY H;  4A3F G;  1DGS A;  4A3B H;  3FKI H;  4DV6 L;  2XGT A;  4DR5 Q;  5BR8 Q;  4A3K H;  4YWL A;  3S2D H;  5C44 G;  3CCR A;  4A3I H;  1Q1B A;  2CKZ B;  2RHS B;  3ERS X;  1E1T A;  3DM3 A;  3PGZ A;  3HOX G;  1HZC A;  1FL0 A;  3RLO A;  1AE3 A;  3RNU A;  4XIG S;  2LXJ A;  3T1H L;  2VUM G;  2A19 A;  2NZH A;  2B63 G;  4A3J H;  1KRT A;  4PZ8 A;  3KJO A;  1VQP A;  2EQS A;  4O2D A;  1NJI C;  1NTG A;  4DR5 L;  1HNZ Q;  5BR8 L;  2JA5 H;  1E24 A;  3F2C A;  2QA4 A;  4B3T Q;  3CCJ A;  3E9I A;  1VQL A;  2A8V A;  3L7Z C;  4X66 L;  2JA6 H;  1BKB A;  1LTL A;  1Q81 C;  5LMU Q;  3AYH B;  4UP8 A;  1Y1W H;  1O7I A;  1EYG A;  1M1K C;  2DGY A;  3CC2 A;  1OXT A;  5EAY A;  1WYD A;  4R4T A;  1VQH A;  4IO9 A;  2MQH A;  2Q2T A;  1WJJ A;  2KCM A;  3G4S A;  3GTG H;  1HNZ L;  3UDX A;  4B3T L;  1B70 B;  2CQO A;  1S3O A;  3H0G G;  5ELN A;  2NN6 G;  1ASZ A;  3RN2 A;  4IOC A;  1P16 A;  1L1O C;  2WFW A;  3HOU G;  3GTK H;  1IBL Q;  3MXN B;  2NVQ H;  3F8T A;  4A3K G;  1YBY A;  3UDF A;  4BBS H;  3CCV A;  1N34 Q;  2BH2 A;  2VQE Q;  1EUJ A;  3K7A H;  1PA6 A;  2HHH Q;  1BBW A;  3OW2 A;  3MEF A;  1A63 A;  3RN5 A;  1HNW Q;  4DAM A;  1H95 A;  2K52 A;  1LM0 A;  2KEN A;  1HZA A;  1X54 A;  2VY3 A;  3PSI A;  4DV5 Q;  3UDG A;  2CFM A;  3S1R H;  2R93 H;  4RG1 A;  1LYL A;  2YTX A;  3KDF B;  4JI2 Q;  1J5E Q;  3A74 A;  1IBL L;  1IZ6 A;  2AHO B;  2H5X A;  5M5X H;  4A3E H;  3CMA A;  5FLM G;  4YHH Q;  2R7Z G;  5JEA G;  2HHH L;  2ATW A;  3BU2 A;  4LF6 Q;  4QJF A;  3F2B A;  4GLA C;  1HNW L;  1FGU A;  1PH9 A;  4LNQ A;  4BXX G;  4R1J A;  1EFW A;  1PYB A;  3W1G A;  4L5T A;  4BA1 I;  5IWA Q;  4LUZ A;  4KHZ A;  1K73 C;  3KFU A;  1J5E L;  4IFD J;  2MO0 A;  1U0L A;  2PNH A;  1C7Y A;  4A4I A;  1NE3 A;  1FJG Q;  4JV5 Q;  1YEZ A;  4LF6 L;  4LF9 L;  1NY4 A;  2YV5 A;  3CPW A;  5IYD H;  4PG3 A;  4DUY Q;  3AQQ A;  2HT1 A;  1CKM A;  2IY5 B;  1W3S A;  1CKO A;  1QVF A;  5IWA L;  1V43 A;  5J3B A;  2BA0 A;  2IX0 A;  3HOZ G;  1JE5 A;  1EWI A;  4PZ6 A;  5IP7 H;  1JMC A;  1VQ8 A;  4NXM L;  2AKW B;  4JV5 L;  1E1O A;  4P75 A;  1BBU A;  2Q2H A;  4DR3 Q;  4GNX B;  1GKH A;  4P74 A;  3K80 C;  2JQO A;  1JJG A;  1PH6 A;  4DV2 L;  4JI4 Q;  2IHE A;  2ZTE A;  4TVA B;  3W5O A;  4X62 L;  5IYC H;  4OWW B;  1PFS A;  1SMX A;  2JA7 G;  1VQ6 A;  4IPG A;  3HOV H;  3HKZ G;  2C35 B;  4WJ3 M;  1JB7 A;  1IBM Q;  1GD7 A;  1VQM A;  4JI0 Q;  1N9W A;  4A3F H;  1G29 1;  4DR3 L;  1XMQ L;  1PH5 A;  4A3G G;  2WB1 G;  2AWO A;  4POF A;  1YIT A;  4A3L G;  2OCE A;  5C44 H;  1S72 A;  3J7A 5;  3PF5 A;  2UXD Q;  1X6O A;  4GOP C;  4MTN A;  2YU9 H;  3HOX H;  4DR6 Q;  3D31 A;  1NBW A;  2R7F A;  5IYD G;  1GVP A;  1MKH A;  2VUM H;  3J81 i;  2CWA A;  1KL9 A;  4NPS A;  1IBM L;  2B63 H;  3I56 A;  4IPD A;  3D0F A;  3PF4 A;  2OQ0 A;  1D8L A;  2EXD A;  4DKA C;  4DV7 L;  2JA8 G;  1XPO A;  3PUY A;  4KHP Q;  1T9H A;  4YWM A;  2UXD L;  4R4C A;  1AH9 A;  2YYZ A;  4X6A H;  2UXB Q;  4DR6 L;  4DR4 Q;  1I6H H;  1C0A A;  1PV4 A;  5IE8 A;  2HIV A;  2D0P A;  3J81 j;  1R9T H;  2I5M X;  4X65 Q;  2VS1 A;  5HGQ A;  5IYC G;  3Q8D A;  4DAY B;  2F4V L;  3H0G H;  4MNO A;  2MFI A;  4LWC A;  4LF7 Q;  1E3P A;  3HOU H;  1I94 Q;  2UXB L;  2JE6 I;  4JI8 L;  1X65 A;  2QGQ A;  3I4M G;  1PHJ A;  4LF8 Q;  4JI6 Q;  1SLJ A;  1X3F A;  1SRO A;  4DUZ Q;  2UUC Q;  3I7F A;  4P72 A;  4X65 L;  4LUV A;  4FDB A;  3J80 i;  3NEL A;  4GN5 A;  4JBK A;  1OXU A;  2AWN A;  1UE1 A;  1UE6 A;  4LF7 L;  1EIY B;  3A5Z B;  4YY3 Q;  1I94 L;  2OTJ A;  1Z47 A;  3I4O A;  2ES2 A;  3STB D;  2R92 G;  4AYB G;  2WAQ E;  2NN6 I;  4LF8 L;  3AFP A;  1L1O A;  5FLM H;  3U58 A;  2R7Z H;  4JI1 Q;  4DUZ L;  1JJ2 A;  2UUC L;  1EQR A;  3TS2 A;  1N36 Q;  1N32 Q;  4TQU S;  2PI2 E;  2Q2I A;  1B7Y B;  5JJL A;  1YJ9 A;  3GTQ H;  4BXX H;  4LUO A;  1IBK Q;  1CUK A;  4KI0 A;  1HJP A;  4HIM A;  3STB C;  1VQN A;  3HOV G;  3I2Z A;  5ELO A;  4P71 A;  4XTC S;  5C4J H;  3UE0 A;  5FJ8 G;  4OWT B;  1SE8 A;  2I5H A;  2KCT A;  4JI1 L;  1QVG A;  4DR7 Q;  4HJ7 A;  1N36 L;  1J6Q A;  5LMU L;  3AEV A;  1IXR A;  3CCL A;  4A3D H;  3G48 A;  4IJL A;  3PUV A;  3KJP A;  1NMG A;  1K9M C;  1IBK L;  1KHI A;  3CCS A;  4LF5 Q;  2NVT H;  4BA2 I;  3GTO H;  3HOZ H;  2D62 A;  2VL6 A;  1AE2 A;  2LXK A;  2R6G A;  4L5S A;  1VQF A;  2BA1 A;  4JI5 L;  3M7N A;  3S14 H;  4LF4 Q;  1YI2 A;  2ZJQ A;  4DR7 L;  4B3R Q;  4IFD I;  1XNR Q;  1LUZ A;  2Y0S E;  4ME3 A;  4QIW E;  3S2H H;  3G6E A;  4LF5 L;  1VQK A;  1QVC A;  5M3F G;  1N34 L;  3KOJ A;  2VQE L;  5JEA J;  3S17 H;  2MO1 A;  1WOC A;  4A3C G;  1Q46 A;  2CCZ A;  1CSQ A;  4BBR G;  3CME A;  1K8G A;  2JA7 H;  2GVA A;  4A3M G;  4LF4 L;  1X9N A;  3LGJ A;  3BJU A;  4R4I A;  4R4Q A;  2K14 A;  4IJH A;  3SGI A;  4DV5 L;  3TS0 A;  1XNR L;  4B3R L;  5M3M G;  2E2I H;  4A3G H;  1EIF A;  1JT8 A;  4JBW A;  2YTY A;  3CP0 A;  4JI2 L;  1XPU A;  4A3L H;  5JJK A;  2K5V A;  4NXN Q;  4EQ5 A;  4YHH L;  4OON A;  3M85 A;  4JI3 Q;  1WCM H;  2ALY B;  2DUD A;  1U5K A;  4A3D G;  2KHI A;  1EOV A;  2E8G A;  4DNI A;  2F52 A;  3CQZ H;  3ER0 A;  4HIO A;  1KAW A;  3JAM i;  2UU9 Q;  4R4O A;  1Q1E A;  1UE7 A;  5LMN W;  2K75 A;  2V1C C;  3CAM A;  1L2F A;  2D0O A;  5IYB G;  3TQY A;  2JA8 H;  4JI3 L;  1FJG L;  3UDI A;  2B29 A;  1QUQ A;  1K0R A;  3CW2 C;  3JC6 6;  4LFB Q;  3GD7 A;  1RIP A;  5GAE C;  3S1N H;  3S24 A;  1N8R C;  1KXL A;  5IP9 G;  4DUY L;  4YCW A;  1L1O B;  1Y1V G;  1HZ9 A;  4GOP A;  4DR2 Q;  1SR3 A;  3TRE A;  2UU9 L;  2Z6K A;  1Y14 B;  1OXV A;  3HKS A;  4YWK A;  5GAG C;  1V1Q A;  2ZM6 Q;  1HR0 W;  1K83 H;  1PH1 A;  4LFB L;  3K8A A;  5M5W H;  2Z0S A;  1ASY A;  2NVX H;  3I4M H;  1P8L A;  4POG A;  2N49 A;  1WCM G;  4DR2 L;  4JI4 L;  4JOI C;  4JI5 Q;  5AJ3 Q;  3GTP H;  3J7Z C;  2ZM6 L;  1X56 A;  4DV4 Q;  2Z6K C;  4QL5 A;  1W2B A;  1PH4 A;  5GRO A;  4OO1 G;  1TWA H;  2JA9 A;  2UUB Q;  2PMZ E;  4GKK Q;  1VQD A;  4LFA Q;  4JG2 A;  2R92 H;  1SFO H;  3CCU A;  3TRZ A;  1VQG A;  3H3V H;  1E7Z A;  5AJ3 L;  3HOW H;  3EIV A;  5IY0 A;  4P73 A;  4EX5 A;  4DV4 L;  4HJA A;  1EQQ A;  4ALP A;  1VQI A;  4A76 A;  2UUB L;  1E22 A;  4L5R C;  3K7U C;  4HIK A;  4UY8 C;  3M4P A;  4GKK L;  1SN8 A;  3E9H A;  4LFA L;  4X64 Q;  4KHP L;  5FJ8 H;  4QGU A;  2FXQ A;  4QY7 A;  5C0X G;  5C0X J;  1X3G A;  3CD6 A;  3I4N G;  4DR4 L;  3F2D A;  2JJQ A;  2ID0 A;  3KDF A;  2ZJP A;  1XMO Q;  2I0Q A;  2IX1 A;  4DV3 Q;  3PUZ A;  5GAD C;  3J80 c;  4HJ9 A;  1PH7 A;  3PO2 G;  4X64 L;  3I55 A;  2ZJR A;  4B3M Q;  5DLQ E;  1K3R A;  2N8N A;  4K0K Q;  4QQB X;  4A93 G;  3RLN A;  4GN3 B;  1BVS A;  3ZJY C;  3ULJ A;  3KF6 A;  1VQB A;  1A8V A;  1XTD A;  1UEB A;  4OXP A;  4JI6 L;  5M3F H;  1VQ4 A;  1OXX K;  4DPG A;  1QUQ B;  1X55 A;  3W1B A;  1PH8 A;  1A0I A;  4A3C H;  3HOW G;  3PIO A;  4GLV B;  4BBR H;  1KIX A;  3ULP A;  3PIP A;  3HKZ E;  4A3M H;  4GOP B;  1QZH A;  4B3M L;  1Z9F A;  4K0K L;  3U4V A;  1KC8 C;  1VS0 A;  4UP9 A;  4YY3 L;  1UE5 A;  2GVB A;  5M3M H;  4X66 Q;  1CSP A;  2WB1 E;  4JCV E;  4UPA A;  2LSS A;  1Q8K A;  2ZTC A;  1WFQ A;  3UE1 A;  3CCQ A;  3ICE A;  5C4X G;  2MNA A;  1N32 L;  3FHW A;  4DV0 Q;  2EIF A;  2IT1 A;  2NZO A;  3S16 H;  4GNX A;  4NB3 A;  1Q12 A;  1VQ5 A;  5GQO A;  2AMC B;  3GO5 A;  2ASB A;  2JEB I;  4H02 A;  1TWC H;  3PUW A;  1JJC B;  2E2J H;  3CC4 A;  2JEA I;  2BH8 A;  4YCU A;  5IYB H;  2PQA A;  3CXC A;  1MJC A;  1NMF A;  1VQC A;  4DV0 L;  1YIJ A;  3K0X A;  1VQE A;  2KBN A;  5IP9 H;  4GNX C;  1Y1V H;  3CCE A;  1N33 Q;  4JBJ A;  1G51 A;  4O0A A;  1GM5 A;  2K4K A;  5C3E G;  1I3Q H;  3HOY G;  3OYY A;  4BY1 H;  2K5H A;  1VQJ A;  1YNX A;  4A3B G;  3FKI G;  4HJ8 A;  4A3I G;  1L0W A;  1CKN A;  3FP9 A;  4UP7 A;  1K8A C;  3F1Z A;  1YZ6 A;  1G6P A;  1PVO A;  3BZC A;  3M3Y H;  1Q7Y C;  3OTO Q;  2E5L Q;  5E7N A;  2UUA Q;  1YHA A;  4AQY Q;  3S15 H;  4BY7 H;  4PZ7 A;  4OX9 Q;  1N33 L;  3DLL A;  4KLK A;  1YVC A;  5M5Y H;  3WWV A;  5LMN Q;  1B8A A;  3A5U A;  4A3J G;  4GKJ Q;  2VNU D;  1TWG H;  3EBE A;  3A0J A;  2QEX A;  3RZO H;  2VZA A;  1VQA A;  2JA5 G;  3NEN A;  2WP8 J;  1HZB A;  2A1A A;  4Y52 H;  3JAM c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...