1HR0W

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hr0W00
4DV6Q 1N36L 3HOZH 4UP9A 1KXLA 1W2BA 4JI2L 2KENA 4OO1I 2KHIA 1FGUA 1WOCA 1NBWA 3RNUA 4DV7L 4HIDA 4B3RL 4GKJL 1VQIA 4C3JH 3CCUA 4GOPC 1CKMA 3M7NA 1K0RA 1OXXK 2OCEA 2VL6A 2UXDQ 2GN5A 3M85A 3HOWH 1TWCH 4A3FH 3M4PA 3T1YL 4POFA 4PZ7A 3WWVA 2I0QA 4DR4L 4DAYB 2I5HA 3K0XA 1XNRQ 2R7DA 2JEAI 4B3MQ 2D0PA 5LMUQ 3J81c 4AYBG 2C35B 3U58A 4GLXA 2JQOA 2K52A 3AQQA 3KF6B 1K73C 2NVTH 4C3IH 3UDXA 1BBWA 2RHSB 4A3CH 4X66Q 2QGQA 2RF4A 2XTIA 1SR3A 2ZM6Q 3OTOL 4JI4L 1X56A 4KHZA 5JJLA 4DK6C 3UDIA 5IY0A 4IPDA 1K3RA 1SROA 3U4ZA 3A74A 1YEZA 3CCVA 4DR3L 4JBKA 3S2DH 4X6AH 1U0LA 1E24A 1SN8A 2RHQB 5JJIA 2HT1A 4IFDI 5E7NA 2JA5H 1L2FA 1KIXA 3OW2A 1I94L 3CC2A 4IPCA 4YY3Q 2VQEQ 4UP8A 5M5WH 3CQZH 1VQ5A 4Y52H 3J81j 4JG2A 4DR4Q 1KRSA 1UE7A 4LFAQ 1N32L 3PUYA 1YITA 4NXMQ 3W1BA 3KJPA 3ICEA 1B70B 1JE5A 4DAMA 1IBKL 4A4IA 4JI5Q 1PH8A 2MNAA 1C9OA 4IOAA 1H95A 5FJ8G 1Y14B 2B29A 1PA6A 3PO3G 2MFIA 3MEFA 1N34L 4LFBL 5LMUL 3T1YQ 1VQDA 4QGUA 1J5EQ 3KLWA 3CC4A 1XNRL 2UXDL 1MIUA 4YCVA 5IP9G 4HJ5A 2LXJA 4YWLA 3F2DA 4DV3Q 4HIMA 3RN5A 2F4VQ 4JI2Q 2ES2A 4UPAA 2A19A 3ER0A 1VQNA 2NVYH 4HIKA 4GLVB 2PNHA 2YYZA 1YZ6A 1EUJA 4DV0Q 4DV2Q 1FJGQ 1A63A 3CD6A 4EQ5A 1HNWQ 4LF8L 2B3GA 4PZ8A 4JI8L 4LF6L 5C4XG 5K36G 4POGA 2R6GA 2ATWA 1MJEA 3S24A 4GOPA 2R92H 1Y1WH 2UXBL 4GOPB 1P8LA 1WJJA 4XIGS 4GN4B 1IYJB 1PHJA 4IJLA 3EBEA 4UY8C 2AWNA 3F2CA 4JI0Q 3RLNA 3J7ZC 1N32Q 3MXNB 1BVSA 4DV4Q 1QVFA 4JI0L 2ALYB 1HZBA 5BR8Q 4WJ4A 1LYLA 3KF6A 1EFWA 3FP9A 4TVAB 3AYHB 2EQSA 2PQAB 3I4MH 1G6PA 1VQFA 1W3SA 1K8GA 2Z0SA 4HIOA 4BY1H 4K0KL 1XPOA 3M3YH 2K5VA 1VS0A 5DLQE 2F3IA 2IX0A 3FHWA 4AQYL 3ULLA 3PO3H 5IP7H 4DV5L 5JEAG 4OWXB 1EQRA 4A93H 4JI3Q 4PG3A 4L5QA 4RMFA 1BBUA 3S1QH 1LTLA 2IT1A 3CCEA 1VQMA 4IPHA 4DV1Q 3FKIH 4L5SA 1E3PA 1HZCA 2MQHA 1QUQB 4BA1I 3RZDH 2F4VL 1NMFA 1QUQA 4A3MG 4A3LH 1UWVA 4J15A 3ERSX 4A3BG 1HJPA 4JOIA 4KLKA 5ELNA 3ULJA 4QIWE 5GAEC 5M5XH 2JA5G 1PH7A 1A62A 3AEVA 1D8LA 4JI5L 3A5ZB 2E5LL 2JA8G 4LFAL 5C44G 4A3GH 5EAYA 3G6EA 1PH4A 2HHHQ 4R1JA 4GNXA 4A75A 1N33Q 1SRUA 5AJ3L 1GM5A 1EYGA 4A3CG 1GVPA 2YTXA 1Q82C 4YY3L 2IHEA 3A5UA 1T9HA 4JI1L 2HIVA 5IYCH 4B3SQ 1X3GA 3I2ZA 4X62L 4A3BH 4DV1L 4RG1A 2UUBL 2OWOA 3I7FA 1HNXQ 3LGJA 1TWHH 3K81C 4BBRH 1EIFA 4IO9A 3TS0A 1LM0A 2MO1A 3IRBA 1PH2A 1L1OB 4DUZQ 2K14A 1L1OA 3PCOB 5M3FG 4DR3Q 4H02A 3EN2A 4DV5Q 1YHQA 4IOCA 2JA8H 2WFWA 3PUXA 2CKZB 4NPSA 3J7A5 2BH8A 3H0GH 5C4JH 3CCRA 3SGIA 2K5NA 1CUKA 1Q1BA 3RZOH 4LUVA 4LF7L 4QY7A 4R4TA 4JI7L 2Z6KC 4X65Q 2NVQH 1UE5A 2CCZA 1TWGH 4GNXC 3CC7A 3UE1A 1MJCA 5J3BA 2E8GA 4FDBA 1VQ9A 1DGSA 3NELA 1PV4A 3HOZG 3G4SA 1VQBA 4BBSG 2PQAA 1K9MC 1HZAA 1U5KA 1VQGA 1XPUA 4MZ9A 1YBYA 4DNIA 1VQEA 2E2HH 1TWFH 3DLLA 3FKIG 4IJHA 4EX5A 5ELOA 3BZCA 4HJ7A 2E2JH 4KHPQ 1TWAH 2EIFA 2UUCL 3W5OA 5C0XJ 3S16H 2WAQE 1Q12A 1KD1C 2JA7G 3HKZG 1HH2P 4YWKA 5IYCG 1N36Q 1CKNB 4DV3L 4ME3A 1PH1A 4Y7NH 2D0OA 4QL5A 4DR2L 1X6OA 4DV6L 2OTJA 1YHBA 2KHJA 1IBKQ 3UE0A 2UXCL 1CKOA 2A1AA 4JYAQ 1RIPA 4JOIC 2WB1E 1PH5A 4NXML 3PF5A 1PH9A 1UE6A 2OQ0A 4LFCL 3KF8B 1YJNA 3CP0A 3H0GG 1CSQA 1WCMG 1Z47A 5IYBG 1SFOH 1XNQQ 1ASYA 4JV5Q 4JI6Q 1VQJA 2ID0A 3JAMi 3TQYA 4GNXB 1HNZL 3K7UC 1NTGA 4LF7Q 2Q2UA 4NXNQ 2VQEL 1VQ7A 3BU2A 1PH6A 4NB3A 4R4QA 2N3SA 5C3EG 4DR1L 1XMQQ 1S40A 3RLFA 3UDFA 1RL2A 3HOYG 4LF9L 1OXTA 2Q2IA 4LWCA 2UUBQ 1PFSA 4LF4Q 2UUAQ 1KAWA 2VZAA 5IP9H 3GTLH 2ZM6L 2CFMA 4O2DA 1HNXL 4APVA 4PZ6A 3STBC 1Z9FA 3CXCA 1JJGA 1HR0Q 1FVIA 4X66L 4A3EH 4A3JH 4A3DG 1R9TH 3T1HQ 1WFQA 1L1OC 4JI6L 2CQOA 3GTKH 4OWWB 2OTLA 4LNQA 3TS2A 4JBWA 4ALPA 1HNZQ 4A3JG 4OO1G 4JC0A 1N33L 4BBSH 2LSSA 1YNXA 4P75A 1YHAA 2B63G 3W1GA 1P16A 2Q2HA 1X9NA 4BY7H 1I50H 5GADC 1QVCA 2MO0A 1QVGA 2VUMG 3JAMc 4DR6L 4JYAL 1KHIA 1TXYA 2BA0A 3Q8DA 5IYBH 4B3RQ 4GKJQ 5H1SE 1GD7A 4X64Q 2UUCQ 5LMNW 3CCQA 3TRZA 2NN6G 2ZJQA 3T1HL 3S2HH 4GLAC 2IHFA 3M4QA 5IWAL 1VQOA 4A3KG 1HR0L 2KBNA 4LF5L 1XTDA 3GTOH 5GAGC 1KQSA 1Q81C 3PO2H 2HIXA 2NZOA 2VQFQ 2DGYA 3CF5A 4DPGA 4HJAA 1YJWA 3F8TA 4GS3A 2Y0SG 4O0AA 2AHOB 1XJVA 1N8RC 4OX9Q 1B8AA 3D0FA 3H15A 5M3MH 4K0KQ 1B7YB 5FLMG 3H3VH 2YU9H 4DK3C 3PSIA 1VQCA 2JA6G 4DUYQ 3KYHC 2F52A 2UU9Q 3L0OA 2GVBA 1O7IA 3PGZA 4B3TL 4MNOA 3I56A 4QQBX 4JI7Q 1IZ6A 1V1QA 4C2MH 2JEBI 3AFQA 1LUZA 3PUWA 2AMCB 1D7QA 1JT8A 1OXUA 4LF5Q 2B63H 4BY7G 1N9WA 4LF8Q 4IFDG 1VQLA 3BJUA 3RR5A 3UDGA 2HQLA 2VQFL 2UXCQ 4LF6Q 4DV0L 2VUMH 1VCIA 1Y1VH 3F1ZA 4L5RC 4YWMA 4AIMA 1HNWL 3S1MH 3J80c 1BKBA 1M90C 1CKNA 3CCSA 4OX9L 4OXPA 5IP7G 4A93G 1WI5A 4DR6Q 3CCLA 4HJ8A 2PI2A 2R92G 3GTQH 3HOUG 1CSPA 2N49A 1SMXA 5JEAJ 2QEXA 2IY5B 3NEMA 2VW9A 5AJ3Q 3BZKA 3TREA 1J5EL 4LW1A 4DR5Q 1SE8A 3PIPA 1K8AC 3TEHB 3HKZE 1Q86C 1I3QH 2IX1A 3E9IA 3K8AA 4UP7A 2NN6I 3B6YA 1E1OA 1HZ9A 2I5MX 1V43A 4R4IA 5HGQA 2JE6I 5IE8A 2QA4A 1E1TA 4GN5A 4TQUS 3H3VI 3HOYH 3GTPH 2WB1G 4A3KH 4MTNA 1VQ6A 1SLJA 2KCTA 1IL2A 3I4NH 4KI0A 4BXXG 2AWOA 1KRTA 5C44H 1PYBA 1Q8KA 3JC66 3J81i 1VQ8A 4LF4L 2ZTDA 1G51A 3GDEA 3CMAA 3S15H 1Y1VG 1XMQL 1EQQA 3G71A 2YTVA 5GROA 2JA7H 4GKKL 4B3SL 4C3HH 1GO3E 4A3LG 2UUAL 2K5HA 4R4CA 3CMEA 1NMGA 2V1CC 1A0IA 4JV5L 4JCVE 1QZHA 1C7YA 4JI4Q 1XMOQ 2K50A 1YVCA 3G48A 4LFCQ 1Q46A 3HOXG 1FL0A 3HOVH 2UXBQ 4B3ML 5M3FH 2D62A 3HKSA 1NJIC 2ZTEA 2WAQG 3E0EA 2JA6H 3CW2C 2YTYA 2PI2E 4LUOA 1JJCB 1AE2A 5FLXc 2JA9A 4P71A 1PYSB 1S3OA 2R7ZH 3VDYA 3L2PA 4DR5L 1VQAA 2N78A 3L7ZC 4L5TA 2R7ZG 3PV0A 3PO2G 1WYDA 5HY6A 4DV2L 1EOVA 1FJGL 2VNUD 4JBMA 1YIJA 1A8VA 4X64L 4DV7Q 2R93H 1NY4A 1VQPA 4BXXH 3S1NH 2KCMA 1PH3A 1NE3A 1N34Q 4LFBQ 3HFZB 1KL9A 3I4OA 1WCMH 1EIYB 4AYBE 5M3MG 3F2BA 1M1KC 4BA2I 3CCJA 4YHHQ 1C0AA 5C0XG 4P72A 1X54A 3KJOA 2E2IH 1XPRA 3I4NG 1E7ZA 5IT9c 4X65L 5FLMH 5GQOA 5C3EH 3CPWA 2LXKA 5IYDG 1ASZA 2Y0SE 3K80C 3CCMA 1OTCA 4R4OA 4B3TQ 1X3FA 4GN3B 4PMWA 1UE1A 4A3FG 3STBD 1VQKA 1OXSC 2BH2A 3ZJYC 4DKAC 1XMOL 1IBMQ 4GKKQ 2R93G 4P73A 5C0XI 4XTCS 3E9HA 1I94Q 1X65A 4A3DH 2BA1A 2YV5A 2CWPA 1QZGA 2CWAA 3PF4A 4JI1Q 1HR0W 4DR7Q 1GKHA 4A76A 3J80i 3CPFA 3CAMA 5GAHC 1MKHA 1UEBA 4JBJA 3GTJH 5LMNL 4A3MH 5M5YH 1JMCA 2DUDA 3I4MG 2Q2TA 1J6QA 3KFUA 3S17H 4X62Q 2H5XA 4LUZA 3OTOQ 1YI2A 1JB7A 1X3EA 3EIVA 2ZJPA 2K4KA 1PVOA 4P74A 3HOXH 1AE3A 4DR2Q 3HOVG 2NZHA 1XNQL 3HOUH 1Q1EA 4A3EG 2JK8A 4IPGA 3GTMH 4OWTB 2ZJRA 1Q7YC 2E5LQ 4A3IG 1I6HH 3NENA 5FJ8H 3AFPA 2HHHL 2FXQA 3RN2A 2EXDA 3S14H 5C4XH 2NVXH 5JJKA 4BBRG 3M4OH 5IYDH 3NBHB 1VQ4A 3S1RH 2OQKA 1G291 3GO5A 3PUVA 2XGTA 1OXVA 1X55A 3RLOA 4A3GG 4KHPL 1E22A 4JI3L 3OYYA 1VQHA 1EWIA 3D31A 4AQYQ 3GTGH 2K75A 2VS1A 2JJQA 3DM3A 2AKWB 3U4VA 3HOWG 5LMNQ 4HJ9A 1Y1WG 1IBML 5BR8L 4IFDJ 2N8NA 4DR1Q 3I55A 1IBLQ 4DV4L 1KC8C 4YCWA 4DR7L 4LF9Q 4NXNL 3A0JA 4AH6A 3PIOA 3U50C 1K83H 1YJ9A 2Z6KA 2R7FA 1S72A 2A8VA 1IXRA 2L15A 4WJ3M 2UU9L 3M9BA 3K7AH 4JI8Q 1JJ2A 2GVAA 4A3IH 2PMZE 1I5FA 3KOJA 2RCNA 4OONA 4QJFA 4DUZL 3PUZA 4DUYL 4YCUA 1IBLL 2ZTCA 3KDFA 3ULPA 1AH9A 2VY3A 3GD7A 3KDFB 4BY1G 2WP8J 1L0WA 5IWAQ 4YHHL 2ASBA 2I5LX 1V9PA
chains in the Genus database with same CATH superfamily
3HOZH 1NNXA 1CFMA 1WTQA 1KXLA 4RGTA 4L63B 1FNUA 4N8FA 3OSOA 3PQIA 3RNUA 5EJWA 4DV7L 3I4NB 4K5VA 5KYIA 2GN5A 1PZID 4A3FH 3M4PA 3NTIA 2I0QA 4B3MQ 4I65A 2F0NA 5LMUQ 1PDQA 3QR8A 3OPOA 2PO4A 5IT9L 4C3IH 1XTCD 2RHSB 4X66Q 2QGQA 2RF4A 2A68C 2XTIA 2ZM6Q 1X56A 1G8ZD 2BE5D 1HA5A 5EQ0A 3V96A 2OT2A 1K3RA 2K28A 4JBKA 4X6AH 1L0YB 1E24A 1NCVA 4B9WA 1L2FA 3OW2A 1S5BD 4YY3Q 2VQEQ 1VQ5A 1XYIA 4JG2A 4DR4Q 5DNFA 1N32L 1AW7A 3ICEA 1B70B 1JE5A 1PH8A 1Y14B 3CHBD 1K8OA 1CZGA 2K5WA 2MFIA 3J7AF 4OO1H 5LMUL 3LNNA 1VQDA 1J5EQ 1XNRL 4YCVA 1JOKA 1I4PA 3RN5A 4HIMA 4JI2Q 3EA6A 1SYBA 3ER0A 1EIGA 2X6GA 2KECA 4S3SA 5BN3A 4DV2Q 1A63A 2Z6BA 2IW3A 1HNWQ 2A69D 2ATWA 1MJEA 4RGMA 3S24A 2R92H 2UXBL 4GOPB 4IZ8A 3S16B 4GN4B 2AQ1B 3F2CA 1ENCA 5G3LF 2E2IB 1S5FD 1LYLA 3WDNA 1G6PA 2QF7A 5IGCA 1Z6HA 2D5DA 2VUMB 2IX0A 1KNAA 3PO3H 2A68D 4J8QA 3S1QH 1LTLA 2IT1A 3CCEA 1EY0A 4IPHA 5EPLA 4DV1Q 1YNND 1AP0A 2MQHA 3U9OA 4CHTB 1NMFA 1UWVA 2MP1A 3ERSX 4JOIA 3NXWA 1JORA 3VYUA 2JA5G 2MUYA 4ZK9B 3BYTB 5LL6X 1HFGA 3A5ZB 2JA8G 1BXTA 3SVMA 4XQJA 2R61A 1N33Q 1GM5A 1EYGA 4A3CG 3SDZA 1EY6A 2IHEA 1T9HA 3RD4A 3I2ZA 4BBRB 4X62L 4A3BH 2EYHA 4C3IB 3TS0A 3L3OC 2MO1A 2NN6H 4DUZQ 2K14A 1YHQA 4H02A 3PUXA 2BH8A 1PTOB 2K01A 4C1NI 1Q1BA 4R8IA 4N9TA 2Z6KC 4X65Q 2NVQH 4FF4A 5KYLA 2CCZA 3CC7A 3UE1A 2HCCA 4CKCA 4ILWA 1G6ZA 5EKKA 1YBYA 2E2HH 1IYUA 5T1GA 4TKOB 2F0SA 2EYJA 3BZCA 4KHPQ 2EIFA 3W5OA 4OHJA 3S16H 2SNSA 1CKNB 2NVQB 2DJGC 4ME3A 4ID6A 3CKIB 1B44D 4Y7NH 2D0OA 1X6OA 4DV6L 2SEBD 2OTJA 1YHBA 3UE0A 2UXCL 5KGUA 3IKJA 3QO2A 3KF8A 4LFCL 2Q8TA 1M4VA 1IKLA 2WAQB 4EQPA 1ASYA 4JV5Q 4IN3A 1HNZL 3H09A 3K7UC 2A6EC 3GTGB 3MC0B 4L8JA 4NXNQ 1VQ7A 1X3QA 4N9PA 5CORA 4DR1L 1QJOA 2H1EA 1WVLA 4LWCA 2Q2IA 4LF4Q 1H9SB 4C1NK 4EVOA 5IP9H 1II3A 2ZM6L 1HNXL 1E0BA 1D5MC 1HR0Q 4A3JH 2FMCA 1U4LA 5C4XB 3T1HQ 1B1ZA 1L1OC 3TS2A 4LNQA 4ALPA 1B4OA 1RTOA 1QNUA 3BZDB 4CDDC 4BBSB 2M00A 1CQFA 4BY7H 3H94A 3KK7A 1RHPA 2MO0A 1QVGA 4JYAL 3JAMc 1TXYA 2BA0A 3GTJB 4B3RQ 4GKJQ 1LT3D 2MJ8A 2UUCQ 2WB1B 2ZJQA 1EYAA 1E2ZA 3BDOA 1ESRA 4A3KG 3R2TA 1KQSA 3PO2H 3CF5A 4HJAA 4YIJA 3I72A 4GS3A 2AHOB 1N8RC 1B8AA 3DHQA 3NWTA 4LJZC 3PSIA 1VQCA 1LTAD 3EROA 2UU9Q 2E2HB 3PGZA 2L5TA 5A35A 5C3WA 2ICIA 2CH4A 1PZJD 1STBA 4MTKA 2KJXA 1OXUA 1TVXA 4BY7G 4IFDG 3BJUA 3RR5A 3UDGA 2HQLA 2VQFL 4DV0L 2L9HA 3I73A 1F2YA 1HRJA 3F1ZA 4YWMA 1I50B 2HUGA 3DWPA 1RDPD 3V05A 5HGTA 1EWHA 1VF5C 3GTQH 1WTPA 2R92G 1SNDA 1CTMA 4DK1A 3K57A 3BZKA 3MFYA 5M5YB 1DONA 2B63B 4H7BA 4KK7A 2Q8RE 3TEHB 3HKZE 4DFAA 2EXZA 1Y8NB 2JE6I 1IW7C 4TQUS 1TWCB 5CC4A 1S5CD 5D3DA 3HGBA 4CJ1B 1SLJA 4WRDA 2KCTA 2B2YC 4KI0A 4BXXG 2AWOA 1X3PA 4HMIA 4X3TA 5C44H 1PYBA 5D3IB 3J81i 2QCPX 4C3JG 5K5PA 2QDLA 1XMQL 2Z1CA 3KUPA 4GKKL 1GO3E 4RGNA 4A3LG 1A0IA 1EU4A 1QZHA 1C7YA 1YVCA 2PW7A 5C4JB 2JA6H 2PI2E 4LUOA 4QIWB 4GZYC 1PYSB 3NBHA 2ICEC 3S1MB 1SXTA 3L7ZC 5HY6A 1GUNA 2R92B 4A93B 4JBMA 1LTGD 4X64L 2JA7B 3OWEB 3I4OA 1WCMH 2K03A 3J81L 3HOWB 1C0AA 3BVMA 3MFGA 2A6HD 1TY2A 1X54A 2KCCA 2YU9B 1H9KA 1E7ZA 1HCZA 5GQOA 2M2LA 1SE4A 4B3TQ 2NVTB 1X3FA 3P7JA 4HSPA 1UE1A 3E5SA 1GUGA 4GKKQ 2EY2A 1IW7D 1IBMQ 4PNYA 4XTCS 3VYTA 1X65A 4DGZA 2BA1A 1VMPA 1F9RA 2CWPA 1QZGA 3PF4A 1JE4A 3OWFA 1HR0W 1GKHA 2B2WC 2R93B 2K5DA 4F88A 4JBJA 3I4MG 4A3MH 3DMUA 5LMNL 2ZXOA 1KLUD 1J6QA 5EPJA 4X62Q 3EIVA 2ZJPA 2PW5A 4P74A 1AE3A 1CK1A 1AEXA 2C9OA 3MZ5A 4OWTB 5FJ8H 3VR4A 1WTOA 3S14H 2DY7A 1GUWA 5JJKA 5M5WB 3J7YW 2J7ZA 2F0MA 4HSVA 4BY1B 2KA7A 3A54A 3GO5A 1UEAB 1OXVA 4EGVA 3RLOA 4Y7NB 1TS4A 1E22A 3OYYA 1VQHA 1O7YA 3D31A 3DM3A 2PMZB 4ZUJA 3H3VC 2QW7A 5BR8L 4UAIA 3I8ZA 1ML0D 2X69A 4YCWA 4DR7L 4LF9Q 3A0JA 3TZUA 2F1MA 1U4MA 2WV6D 2A8VA 1PFNA 3M9BA 3K7AH 1JJ2A 2GVAA 4NDXA 3NWSA 3MWYW 3KOJA 4C2MB 1F2MA 1D6EC 2RDGA 2I07B 3KDFA 1AH9A 3I4MB 1L0WA 1Y69U 1DCZA 1WTVA 4RKLA 4UP9A 3N52A 1W2BA 3DM1A 4OO1I 3A8KE 1FGUA 1LTTD 2HCIA 1TWGB 4IUPA 4C3JH 5IIFA 3CCUA 4GOPC 2CW0C 4A3EB 1D5XC 5CYUA 2UXDQ 3M85A 1TWCH 3X3NA 3EVQA 4PQXA 4QUFA 4CDEC 4U673 3J81c 4AYBG 2JQOA 3AQQA 3KF6B 4OEMB 2NVXB 2LKVA 1O7LA 3J81E 4A3CH 2F0IA 2NUCA 4JI4L 1OO9B 3OTOL 3GTQB 1EY4A 5FLXE 1BCPC 1GXDC 2XSCA 3O13A 5IY0A 4IPDA 1AZQA 2BDNA 5JAVA 1SROA 3OMGA 1YEZA 4CDCC 2EYOA 2RHQB 2HT1A 3M4YA 5E7NA 2JA5H 3TP5A 2AQ2B 1KDAA 3CC2A 2KEDA 2FINB 4PMBA 1STAA 3DWAA 3J81j 4K6DA 4B9XA 1YITA 2CH4W 2K5QA 5CV9A 1KDBA 1PA6A 3PO3G 2X6LA 1N34L 3A55A 3T1YQ 1EQVA 4QGUA 3D8GA 1CT1D 5C3EB 1MIUA 2LXJA 3F2DA 4KKTA 4UPAA 1VQNA 4GLVB 2YYZA 1YZ6A 1EUJA 1FJGQ 4DNRB 4ZRZA 4EQ5A 3NQTA 4LF8L 2DNCA 2B3GA 4JI8L 4LF6L 2BCOA 3I4LA 3TP7A 1Y1WH 1P8LA 1WJJA 1RKNA 4IJLA 1QB5D 4OELB 2OF1A 1BVSA 4TRDA 4DV4Q 4DU9A 1QVFA 1FD7D 3RZDB 1HZBA 3MEHA 4OIKA 2SNMA 1EFWA 4TVAB 1H9RA 3AYHB 4BY1H 1K3BC 4F7XA 3S1NB 3M3YH 2V4DA 1VS0A 2F3IA 2F0KA 2SOBA 4AQYL 5IP7H 4DV5L 4RHSA 4OWXB 5JEAG 1PRTC 4L5QA 4RMFA 1F77A 2RVLA 3SHLA 1E3PA 2F0VA 4ZQ3A 2L0CA 3RZDH 2Z9HA 4A3MG 4J15A 4A3BG 4JPBW 2WACA 3ULJA 2F0JA 3E0JA 2FHTA 4QIWE 4DAPA 1MHWC 4KJNA 4RHRA 1GOZA 1LABA 2EJMA 1TR5A 2RQXA 4A3GH 3RUZA 1PH4A 1R4PB 4A75A 2QKIC 1EZ6A 1K83B 1H9MA 2AQ3B 1GVPA 2XNAC 2YTXA 3OIQA 4CGYB 1U4RA 5M9OA 1I4HA 2L55A 1HUMA 1BUVT 2UUBL 2O5IC 1HNXQ 3HKZB 1TWHH 3K81C 1PH2A 3A7AB 4IO9A 1LM0A 4A3KB 3JAML 1L1OB 3GV3A 1SBBB 1L1OA 3PCOB 5M3FG 1MD2D 1SNOA 3I4NG 3HOUB 2WFWA 1Z7TA 3J7A5 5C4JH 2JA6B 4QMGA 1F9PA 1CUKA 4LUVA 4JI7L 1B3QA 2RA4A 4GNXC 1MJCA 5J3BA 2KCNA 3HOZG 1PV4A 1VQBA 2PQAA 3LWUA 3T16A 1K9MC 1WTXA 2KOLA 3NK9A 4DNIA 1TWFH 3FKIG 4IJHA 4CKEA 4HJ7A 5KEEA 3K5NA 1KD1C 2HDLA 4A3BB 1HH2P 1PH1A 1RODA 2JA5B 2KHJA 2RSOA 1IBKQ 1RIPA 4JOIC 2WB1E 3S1RB 1PH5A 3QOJA 1PH9A 1A3UA 1A2UA 2CW0D 1YJNA 3CP0A 3H0GG 1I4GA 1XNQQ 3K5OA 1I4QA 1TU2B 5DEHA 3TQYA 4LF7Q 4FVMA 2XWBB 1RJTA 1PH6A 4R4QA 3BDCA 1XMQQ 3HOYG 3HP3A 1PFSA 1PTOF 3TMEA 2UUAQ 4IUVA 3TBIB 2VZAA 5JJZA 2CFMA 5C6AA 3STBC 1JJGA 4C3JB 4X66L 4A3EH 1RF2D 1EU3A 1VMCA 1R9TH 1WFQA 3VA7A 2CQOA 3GTKH 4OWWB 1YNJD 4JC0A 2L1BA 1MBYA 3W1GA 1I50H 5IGBA 1QVCA 4DA2A 2WKDA 2QILA 2C5CA 5H1SE 5IGDA 5LMNW 1A3TA 2NN6G 4FF2A 1W6KA 2F0LA 4GLAC 2IHFA 4ZUIA 1VQOA 2MPMA 4K2LA 1HR0L 2KBNA 2L11A 4LF5L 3GTOH 2K33A 2HIXA 2VQFQ 2DGYA 3D4DA 4DPGA 1XJVA 5FO7B 3C2PA 4OX9Q 3KBXA 5DM63 3OMCA 4B08A 4DK0A 4K5WA 2JA6G 3SXHA 3KYHC 2F52A 3VR2A 3L0OA 2GVBA 1O7IA 3NE5B 1HUNA 4MHEA 2VB2X 3IFDA 1L0XB 4MNOA 1V1QA 2NVYB 3AFQA 4KKSA 1JWUD 4LF8Q 1DOMA 2LFNA 2UXCQ 3S14B 3M3YB 2E74C 4AIMA 4I7AA 3J80c 1BKBA 1ZKOA 1BR9A 2EY6A 5IP7G 2PI2A 5CR3A 5HURA 4IQZA 1ENFA 1J5EL 1K8AC 1LO5D 1Q86C 1I3QH 3V2TA 1F9QA 5HGQA 1H95A 1KTKA 1E1TA 3KLSX 4GN5A 1HPCA 2WB1G 1SYGA 1IL2A 3I4NH 2B2WA 4KD4A 5CV4A 1KRTA 4LF4L 2ZTDA 5CMDA 3GDEA 3CMAA 2FMMA 2A74C 1TY0A 3FMCA 1EQQA 4OL7A 1BOSA 1Q3LA 3G71A 2OXPA 5GROA 2JA7H 3UI2A 4X3UA 1IL8A 1M8AA 2XIWA 3K6OA 4EQNA 3CMEA 4JV5L 1R4QB 2K50A 1PFBA 4LFCQ 3HOXG 2UXBQ 5IOCA 5M3FH 1NJIC 4HEDA 4KMUC 3E0EA 1JJCB 1AE2A 5FLXc 4HCSA 1S3OA 2F3VA 3PO2G 1WYDA 3D6CA 1YIJA 2EE1A 2F3WA 1QG7A 4JW0A 1SYEA 3IFTA 2KCMA 1K8MA 1PTOH 4IALA 5C0XG 2NBFA 1I6VC 3SK4A 2DNEA 4X65L 5FLMH 3OOCA 1BCPF 2P5ZX 2LXKA 5IYDG 1MSHA 2A73B 3K80C 5KRUA 2PYKA 1JQYD 4R4OA 4GN3B 1JOQA 4FXDA 2BH2A 1XMOL 3J7AV 1WTHA 1TS2A 5C0XI 1I94Q 4MIUA 1LT5D 4JI1Q 5JPMC 4DR7Q 2DN8A 2K1BA 3Q22A 5GAHC 1MKHA 1JMCA 5M5YH 2DUDA 5KNBA 2Q2TA 1DYQA 1NR2A 3QOLA 4C3HB 3OTOQ 1JB7A 1X3EA 2K4KA 1PVOA 3HOXH 4DR2Q 3J80L 1DOLA 2N55A 2F0EA 3HOUH 1Q1EA 2JK8A 1Q7YC 3RN2A 2EXDA 4LAAA 5IGEA 1KLGD 1J8IA 4KY6A 3M4OH 3CU7A 4XQNA 1HHVA 2OQKA 1G291 2BE5C 3K5LA 3ITPA 1X55A 1EY7A 1ZYRD 1A6XA 2JJQA 4OIJA 2AKWB 3HOWG 1IBML 1PRTB 4K8IA 3I55A 4DV4L 4HCEA 4NXNL 3PIOA 1TIID 1K83H 1LTSD 1S72A 1IXRA 4K8JA 4JI8Q 4A3IH 4QF4A 4ZCKA 4OONA 3NTHA 4DN4M 3GD7A 4YHHL 2WP8J 4BY7B 4KN4C 5C3XA 4G57A 4FNFA 4JI2L 2KENA 4QUCA 5I4DA 2KHIA 1WOCA 3QWNA 4HIDA 1Y1WB 1VQIA 1CKMA 3M7NA 4V190 2OCEA 3HOWH 3T1YL 3DUZA 3WWVA 3Q24A 2AUKA 4DAYB 5JVH3 1XNRQ 4DAVA 4A3FB 2JEAI 4RAUC 1GUTA 5ELEA 2QDBA 2NYZD 3U58A 4GLXA 1WTRA 2NVTH 1K73C 1EFID 1STEA 1BBWA 1X32A 1SYCA 1IHZA 1SR3A 1SSOA 5EPKA 4DK6C 2EVBA 3U4ZA 1ENAA 5EKIA 3S2DH 1U0LA 1LTRD 1SN8A 5JJIA 3PIP3 1ZYRC 1PYWD 3FEWX 2EYFA 5F2DA 3FDTA 4Y52H 1EYDA 4LFAQ 1F2ZA 3PUYA 5FLXL 3W1BA 3KJPA 3BVGA 5FOBB 4DAMA 2MNAA 5FJ8G 3HOZB 4LFBL 3HS0C 3KLWA 2BDOA 2UXDL 5IP9G 2B8FA 4YWLA 2ES2A 2Y0SB 2A19A 3F2UA 4MN3A 4HIKA 4P2CB 3P75A 1ZXTA 4DV0Q 3M7GA 1SNPA 4PZ8A 4EQOA 4POGA 2R6GA 4GOPA 2K05A 1IYJB 3TZDA 2AWNA 1J9OA 2E2DC 1PLFA 5CV6A 4WORA 2ALYB 2RBMA 5BR8Q 4WJ4A 3KF6A 1S4ZA 3FP9A 2EQSA 2PQAB 4BS9A 3I4MH 1VQFA 1W3SA 1K8GA 4HIOA 3S17B 2F0GA 2K5VA 4ZYSA 2I46A 1HQRD 1V1PB 3EQLC 3W3AA 1NSNS 3ULLA 2VB3X 1GUSA 1EQRA 1HFNA 2EJGC 2O2LD 1BBUA 1I4RA 1VQMA 2D9UA 4ZKCB 3FKIH 3HG9A 1UUPA 1FGBD 3LX0A 4L5SA 5CV5A 1HTPA 1HJPA 4KLKA 1G2SA 4KTAA 1RTNA 4ZAIA 5LL6S 1A62A 4PV1C 3AEVA 3S9WA 3PO3B 2E5LL 3K7AB 5KIXA 2HHHQ 3HZXA 1JOOA 1E2WA 4K6LA 3WOFA 3ONAB 4HAEA 5AJ3L 1PFMA 3T4AC 2F0HA 1Q82C 4YY3L 1WD0A 4XT3B 3A5UA 3SEBA 1VDZA 5A2QE 4B3SQ 1TWHB 4DV1L 4RG1A 2OWOA 3I7FA 3LGJA 3IRBA 3E6ZX 4I7ZC 4X3KA 5JPNC 1U9RA 4DR3Q 3EN2A 5IGFA 4NPSA 3H0GH 3KLSA 2K5NA 1A2TA 1JR0D 2KHSA 3RZOH 4LF7L 4QY7A 1I4XA 1SEBD 4R4TA 1A3VA 2RSNA 3Q6SA 4A3JB 1CA5A 1UE5A 1DOKA 2F0OA 3G7LA 3MHBA 2QEJC 2E8GA 1V1OA 3G4SA 5T1IA 3R93A 1HZAA 1XPUA 1RD9D 4MZ9A 1XX8A 1S5DD 4EX5A 1C48A 2A69C 4UHVA 3U9SA 5M3MB 5K36H 5C0XJ 1BQQT 1Q12A 1CHQD 2WIIB 1GJXA 4A3MB 5IYCG 4DV3L 3BG3A 3C1EA 2PZWA 3VR5A 1G2TA 1BBXC 4QL5A 1QILA 1WCMB 3HEJA 5FK9C 5I2XA 4HN7A 4JYAQ 3PF5A 3N6RA 4XT1B 3VYRA 3KF8B 1F2LA 5IYBG 1ESFA 5TSSA 1VQJA 3T13A 4GNXB 1WTWA 1I6HB 3BU2A 3K0YA 3ND9A 4NB3A 5D65A 2PQEA 5C3EG 2N3SA 1S40A 4LF9L 3T56B 2PZTA 3D4WA 4PZ6A 1Z9FA 4FP5D 4A3DG 1FVIA 4NW2A 4JI6L 1HNZQ 4O1NA 5C4ZA 3R8BA 5I9PA 4HTHA 4P75A 4LK1C 1P16A 2Q2HA 2IL8A 5GADC 1S5ED 5IT9E 2VUMG 4DR6L 3Q8DA 5IYBH 1LACA 4X64Q 1YNJC 3SE0A 3TRZA 5G3LD 4RWSC 1MGSA 3M4QA 2M9VA 5DAUA 1ET6A 1XTDA 5ELBA 4FXKC 1Q81C 2NZOA 2J4XA 5JOBA 2Y0SG 4O0AA 2B2VA 1TS5A 5M3MH 4K0KQ 5FLMG 4ZLTF 2L4NA 5IGGA 4DUYQ 2Z8LA 2NZ1D 5C5LA 2PCFB 1AN8A 3GQBA 3I56A 2B2UA 4U68A 1ILPA 4M8AA 1K0SA 5D14A 2JEBI 3PUWA 1LUZA 2AMCB 1TKWB 2B63H 1VQLA 1BDOA 3KLRA 4LF6Q 2VUMH 1LT6D 1VCIA 1Y1VH 4L5RC 4A3DB 3I3CA 5EBCA 3NHHA 2B2YA 1M90C 3CCSA 4OX9L 1FNVA 4OXPA 1TT2A 1WI5A 4DR6Q 5M3FB 3HOUG 2N49A 2A6HC 1SMXA 5JEAJ 1D5ZC 2IY5B 5AJ3Q 3TREA 5L37A 3URYA 1SE8A 2KVMA 3TN2A 1SFOB 2KEEA 2B2UC 2IX1A 1CHPD 2PZUA 1E1OA 2NN6I 3B6YA 4R4IA 4DR2L 3OHXC 4LFAL 5IE8A 3H3VI 5EGTA 3GTPH 5ELDA 4A3KH 4ZKBB 2WKCA 4MTNA 1VQ6A 5IODA 3JC66 1E2VA 2K32A 2PNRC 1TS3A 4XQQA 3SR1A 3S15H 3FPPA 1UNSA 5BN4A 4G7OC 2Z4HA 4KN7C 1CZWA 4C3HH 2UUAL 2K5HA 1PTOC 4R4CA 1NMGA 2V1CC 4FXGC 3TDQA 4JCVE 1XMOQ 3G48A 3H6MA 3IL8A 2R3ZA 1FL0A 4DNTB 3DXJC 3HKSA 2WAQG 3A56A 4C56C 2JA9A 5COYA 4P71A 2R7ZH 3VDYA 2F0FA 3L2PA 5J22A 1VQAA 2XN9C 4DV2L 3KBGA 2VNUD 1XXGA 3D3RA 2KQ3A 4DV7Q 4ME5A 2R93H 4BXXH 3BS1A 3S1NH 5EBDA 1PH3A 1N34Q 1KL9A 5M3MG 3F2BA 1M1KC 3CCJA 3P1HA 1EOTA 2F0WA 1JC7A 4V0BA 1XPRA 1HTLD 2CQAA 1T5EA 3G6JB 2Q8IB 3DWQA 3MXNA 4G7HC 4A3FG 4DKAC 4P73A 3E9HA 1JWSD 1H9SA 4DXGA 2A6ED 3J80i 4WFN3 3CPFA 2G5DA 2B2TA 4LUZA 1YI2A 2RDHA 2JP1A 4XYOA 1CM9A 4F87A 2A5HA 2DJFC 5CBEE 4CDFC 3R2IA 4IPGA 3HOXB 1I6HH 3NENA 2HHHL 4KY7A 1DM0B 1QCBD 2G9DA 4L6TB 4QCLA 5C5MA 3EFXD 1VQ4A 1DJRD 2IWHA 3J80E 2EYPA 1CI3M 3PUVA 1KAAA 2EY5A 4A3GG 2B2TC 4KHPL 3OW7A 4JI3L 2IJ0A 4XYQA 1SMYD 4AQYQ 2K75A 2VS1A 4R9WA 2XRSD 4O42A 4HJ9A 3P20A 2N8NA 2FJ2A 1IBLQ 4IFDJ 4J6HA 4RCOA 3BYYB 1YJ9A 2L15A 1IKMA 2UU9L 2KUMA 2PMZE 2LMCB 4OGQC 1I5FA 5I6WA 3SK6A 4DUZL 3PUZA 4YCUA 3ULPA 1NUCA 2VY3A 3KDFB 4BY1G 5IWAQ 1XWEA 3U50C 1V9PA 1ICFB 4DV6Q 1N36L 2HDMA 2EYLA 4IFDH 1EL0A 1CA6A 1LTID 1EY9A 1NBWA 4JVZA 4B3RL 1SJHD 4GKJL 2DY8A 4KJOA 1K0RA 1OXXK 3TSSA 1LTBD 2VL6A 2ZT9C 3GTPB 1JB3A 3GTOB 3DEPA 4POFA 4PZ7A 1O80A 1SJED 4DR4L 2I5HA 3K0XA 1EYCA 2R7DA 2TMPA 1B3AA 2D0PA 4Z9CB 3MTSA 1CQVA 3M4OB 4H44C 3MAQA 2C35B 2JXMB 5I6YA 3VR3A 2K52A 4K5XA 4HMJA 3UDXA 1ICWA 2IX3A 3NSWA 1STYA 1EZ8A 5JJLA 4KHZA 5CV7A 3UDIA 1EQTA 4IUTA 4Q5VA 2RDFA 3CCVA 3A74A 4DR3L 2K6AA 2HD3A 3FKIB 3K58A 2EY1A 3L9AX 4IFDI 1SDFA 3HOVB 1I3QB 1KIXA 1SYDA 2EZVA 1I94L 4IPCA 4UP8A 5M5WH 3CQZH 3FVQA 3VYSA 2K04A 4H13C 1JCKB 1G91A 3CRKC 1KRSA 1UE7A 3GV6A 4NXMQ 1PZKD 3RMHA 1IBKL 4A4IA 4JI5Q 1PTOD 1C9OA 4IOAA 2B29A 4AYBB 2F0TA 1Q90A 4DXFA 1QWYA 5LHY1 3MEFA 3JAME 4FF3A 3X3MA 3W2DA 1C8CA 1AZPA 2ZXRA 3CC4A 3A8IE 4HJ5A 2F4VQ 4DV3Q 4F8MA 2NVYH 2PNHA 3TP8A 3HOYB 1GHKA 3K59A 5JVG3 3CD6A 5C4XG 5K36G 1Y8PB 3E3XA 4XIGS 3Q23A 1PXUA 1PHJA 3EBEA 1VF7A 2EDGA 2XVSA 4UY8C 4JI0Q 1NAPA 3RLNA 3J7ZC 1N32Q 3MXNB 1SE2A 1TWFB 4JI0L 3CRLC 4ULLA 5I9OA 4NKLA 2F4IA 1UAPA 2Z0SA 5E4WC 3NBIA 4K0KL 1XPOA 5DLQE 3FHWA 4A93H 4JI3Q 4PG3A 2PPBC 1SNQA 4WJWA 2B8GA 1GUOA 1HZCA 4BA1I 1QUQB 2F4VL 4A3LH 1QUQA 2J0TD 2CVRA 3QB3A 1LLRD 1LT4D 2JYOA 5ELNA 5GAEC 5M5XH 4DAYA 2NTSA 1D8LA 4NMZA 4JI5L 5C44G 2N88A 2HQEA 5JEAH 5EAYA 3G6EA 4R1JA 3SK5A 3T51B 4GNXA 1SRUA 1HA6A 3T53B 4C3IG 4JI1L 1B50A 2HIVA 5IYCH 1X3GA 1EWCA 1LV9A 5E1FA 4BBRH 1EIFA 2R7ZB 2K7VA 4DV5Q 1NR4A 3A7LA 4IOCA 2JA8H 2CKZB 1D2BA 3CCRA 3K5MA 3SGIA 3S2HB 5DM73 5ELFA 4FYDA 1F9SA 1TWGH 4A3IB 1EY5A 4BWGB 2O4XA 4FDBA 1VQ9A 1DGSA 3NELA 4FO2A 4BBSG 3GTLB 3RZOB 1KNEA 3VR6A 2F03A 1VQGA 1U5KA 3GTMB 4XXEA 3S15B 2CHBD 1VQEA 3DLLA 1HQMC 1STGA 1ONLA 5ELOA 2EJFC 4JK1C 2H4OA 2E2JH 1TWAH 2UUCL 2XWJB 2WAQE 3TP6A 3MA2B 2JA7G 2EPBA 2NTTA 2OEOA 3HKZG 3HRZC 4YWKA 3WOEA 3CQZB 1N36Q 1AFPA 2B2VC 2ENBA 1B9NA 1W6JA 5E3FA 4Q0FA 1CKOA 4RCNA 2A1AA 3D4RA 1SYFA 4NXML 2Z4IA 1UE6A 2OQ0A 2JN4A 5J1ZA 1SFOH 1CSQA 1WCMG 1Z47A 4JI6Q 2ID0A 3JAMi 4H0LC 1NTGA 3MXPA 2Q2UA 2VQEL 1V1PA 1EEFD 3PO2B 5NUCA 3FPUB 4HR7B 3RLFA 3UDFA 1BNZA 1RL2A 1OXTA 5EKLA 2UUBQ 2BOSA 4X3SA 1KAWA 3GTKB 3GTLH 4O2DA 1Y1VB 4APVA 1R9TB 1BCPD 1STHA 1U4PA 3C3LA 3AMUA 2NWGA 3CXCA 2EYMA 1TWAB 2OTLA 1EIHA 3NP8A 4JBWA 4OO1G 4A3JG 1N33L 4BBSH 1WD1A 1KDCA 2TSSA 2LSSA 1YNXA 4QB4A 1DD2A 1YHAA 4XDXA 2B63G 5FO9B 4ODGA 1X9NA 2XRQD 1ILQA 3QG1A 3NUCA 2E76C 1KHIA 1SMYC 5KNDA 4CBVA 4ABNA 1GD7A 3BDLA 3BVZA 3CCQA 5BN5A 3T1HL 3S2HH 2WINB 1B53A 5IWAL 4C3HG 3C46A 5GAGC 5J39A 1YJWA 1PH7A 1HXYD 3F8TA 5C0XH 3DEOA 5FKAC 3MXGA 2NB0A 3D0FA 3H15A 5M5XB 1B7YB 1TQOA 2MGSA 3H3VH 2EOTA 4DK3C 2YU9H 1SAPA 4G4KA 3IAYA 4B3TL 3MXUA 4RKBA 1D1IA 3R3OA 4QQBX 4JI7Q 1IZ6A 1H9JA 1MI2A 1K28A 3QJYA 4C2MH 1JT8A 1D7QA 2ZXPA 2F0QA 4RH6A 4LF5Q 1N9WA 1MSGA 4KD3A 1A15A 1JICA 2B39A 1GHJA 1HNWL 3S1MH 1SNCA 1QE6A 1FYCA 1CKNA 1EEID 3ERQA 5CGKA 1BF4A 4A93G 3CCLA 3C1FA 4HJ8A 1CSPA 3PMFA 3AB9A 2QEXA 3NEMA 2VW9A 3I91A 2G9HD 4LW1A 4DR5Q 3PIPA 2SDFA 1YNNC 3E9IA 3K8AA 4UP7A 4NP5A 2I5MX 1HZ9A 3QIAA 1V43A 4IUUA 4IUNA 2QA4A 3HOYH 4R8NA 1FR3A 4A3GB 1EY8A 2F0PA 5C44B 3D6WA 4J1MA 5FO8B 5ISRA 4M1UB 1Q8KA 1VQ8A 3AU7A 1G51A 2AUJD 1Y1VG 4CJ2C 2YTVA 2O5JC 1QOHA 4B3SL 4JI4Q 3ZYYX 1BO0A 4FF1A 1Q46A 3HOVH 4B3ML 1STNA 2D62A 4PMCA 2ZTEA 3H0GB 3ND8A 3CW2C 4K2KA 2YTYA 3LWEA 1ET9A 1FNWA 1O78A 2RKSA 3NTKA 4DR5L 4IUQA 2N78A 4L5TA 5KNCA 3PV0A 3S1QB 3VA5A 1FJGL 1EOVA 2VXWA 4KKUA 3GP7A 1A8VA 1SNMA 1RCVD 1NY4A 1T5XD 1VQPA 1NE3A 1Q8IA 4RGOS 4LFBQ 1IYVA 3HFZB 1B2TA 1EIYB 4AYBE 3PIO3 4BA2I 5AFWA 4YHHQ 5ELCA 2GA4B 4P72A 3KJOA 2E2IH 5IT9c 5C3EH 3CPWA 1ASZA 2Y0SE 1ZEQX 3CCMA 4E6IA 1OTCA 4PMWA 1PRTD 1VQKA 4UDUC 3STBD 1OXSC 3ZJYC 3Q0AA 3NPPA 3I90A 2R93G 1V8QA 2LS01 4A3DH 4LMQD 2YV5A 2CWAA 5A2QL 3I70A 4A76A 3CAMA 1UEBA 4KV6A 3GTJH 2R7ZG 5CBAE 3A8JE 3H91A 3KFUA 4KY5A 3S17H 2H5XA 4RA8A 2E2JB 1B9MA 2F0UA 3HOVG 2JA8B 2IPKD 2NZHA 3EJIA 3SK8A 1XNQL 4A3EG 2L12A 3GTMH 2ZJRA 2E5LQ 4A3IG 4DF7A 2D2CC 3AFPA 2FXQA 1QNKA 4G7ZC 5C4XH 4CJ0B 5I2YA 2NVXH 2RCFA 3OIPA 1DXMA 1Y8OB 4BBRG 1O7ZA 5IYDH 3NBHB 3S1RH 4IURA 5C4HA 2XGTA 1KABA 4CKBA 4RFBA 1EWIA 1DZ1A 3GTGH 1PMRA 1C4QA 3U4VA 5LMNQ 1Y1WG 3FRPB 4DR1Q 1KC8C 4N8X1 4AH6A 2FFKB 1D1KA 1SE3A 4K14A 2LY7A 2Z6KA 2R7FA 2F0DA 3MVVA 4WJ3M 4KHVA 5CV8A 1JWMD 1PRTF 5E4XA 2E75C 4TSSA 2RCNA 4QJFA 3NQIA 4DUYL 1IBLL 2ZTCA 1BCPB 2ASBA 2MHVA 2JSOA 2I5LX 3S2DB
chains in the Genus database with same CATH topology
4DV6Q 1N36L 3HOZH 4UP9A 1KXLA 1W2BA 4JI2L 2KENA 4OO1I 2KHIA 1FGUA 1WOCA 1NBWA 3RNUA 4DV7L 4HIDA 4B3RL 4GKJL 1VQIA 4C3JH 3CCUA 4GOPC 1CKMA 3M7NA 1K0RA 1OXXK 2OCEA 2VL6A 2UXDQ 2GN5A 3M85A 3HOWH 1TWCH 4A3FH 3M4PA 3T1YL 4POFA 4PZ7A 3WWVA 2I0QA 4DR4L 4DAYB 2I5HA 3K0XA 1XNRQ 2R7DA 2JEAI 4B3MQ 2D0PA 5LMUQ 3J81c 4AYBG 2C35B 3U58A 4GLXA 2JQOA 2K52A 3AQQA 3KF6B 1K73C 2NVTH 4C3IH 3UDXA 1BBWA 2RHSB 4A3CH 4X66Q 2QGQA 2RF4A 2XTIA 1SR3A 2ZM6Q 3OTOL 4JI4L 1X56A 4KHZA 5JJLA 4DK6C 3UDIA 5IY0A 4IPDA 1K3RA 1SROA 3U4ZA 3A74A 1YEZA 3CCVA 4DR3L 4JBKA 3S2DH 4X6AH 1U0LA 1E24A 1SN8A 2RHQB 5JJIA 2HT1A 4IFDI 5E7NA 2JA5H 1L2FA 1KIXA 3OW2A 1I94L 3CC2A 4IPCA 4YY3Q 2VQEQ 4UP8A 5M5WH 3CQZH 1VQ5A 4Y52H 3J81j 4JG2A 4DR4Q 1KRSA 1UE7A 4LFAQ 1N32L 3PUYA 1YITA 4NXMQ 3W1BA 3KJPA 3ICEA 1B70B 1JE5A 4DAMA 1IBKL 4A4IA 4JI5Q 1PH8A 2MNAA 1C9OA 4IOAA 1H95A 5FJ8G 1Y14B 2B29A 1PA6A 3PO3G 2MFIA 3MEFA 1N34L 4LFBL 5LMUL 3T1YQ 1VQDA 4QGUA 1J5EQ 3KLWA 3CC4A 1XNRL 2UXDL 1MIUA 4YCVA 5IP9G 4HJ5A 2LXJA 4YWLA 3F2DA 4DV3Q 4HIMA 3RN5A 2F4VQ 4JI2Q 2ES2A 4UPAA 2A19A 3ER0A 1VQNA 2NVYH 4HIKA 4GLVB 2PNHA 2YYZA 1YZ6A 1EUJA 4DV0Q 4DV2Q 1FJGQ 1A63A 3CD6A 4EQ5A 1HNWQ 4LF8L 2B3GA 4PZ8A 4JI8L 4LF6L 5C4XG 5K36G 4POGA 2R6GA 2ATWA 1MJEA 3S24A 4GOPA 2R92H 1Y1WH 2UXBL 4GOPB 1P8LA 1WJJA 4XIGS 4GN4B 1IYJB 1PHJA 4IJLA 3EBEA 4UY8C 2AWNA 3F2CA 4JI0Q 3RLNA 3J7ZC 1N32Q 3MXNB 1BVSA 4DV4Q 1QVFA 4JI0L 2ALYB 1HZBA 5BR8Q 4WJ4A 1LYLA 3KF6A 1EFWA 3FP9A 4TVAB 3AYHB 2EQSA 2PQAB 3I4MH 1G6PA 1VQFA 1W3SA 1K8GA 2Z0SA 4HIOA 4BY1H 4K0KL 1XPOA 3M3YH 2K5VA 1VS0A 5DLQE 2F3IA 2IX0A 3FHWA 4AQYL 3ULLA 3PO3H 5IP7H 4DV5L 5JEAG 4OWXB 1EQRA 4A93H 4JI3Q 4PG3A 4L5QA 4RMFA 1BBUA 3S1QH 1LTLA 2IT1A 3CCEA 1VQMA 4IPHA 4DV1Q 3FKIH 4L5SA 1E3PA 1HZCA 2MQHA 1QUQB 4BA1I 3RZDH 2F4VL 1NMFA 1QUQA 4A3MG 4A3LH 1UWVA 4J15A 3ERSX 4A3BG 1HJPA 4JOIA 4KLKA 5ELNA 3ULJA 4QIWE 5GAEC 5M5XH 2JA5G 1PH7A 1A62A 3AEVA 1D8LA 4JI5L 3A5ZB 2E5LL 2JA8G 4LFAL 5C44G 4A3GH 5EAYA 3G6EA 1PH4A 2HHHQ 4R1JA 4GNXA 4A75A 1N33Q 1SRUA 5AJ3L 1GM5A 1EYGA 4A3CG 1GVPA 2YTXA 1Q82C 4YY3L 2IHEA 3A5UA 1T9HA 4JI1L 2HIVA 5IYCH 4B3SQ 1X3GA 3I2ZA 4X62L 4A3BH 4DV1L 4RG1A 2UUBL 2OWOA 3I7FA 1HNXQ 3LGJA 1TWHH 3K81C 4BBRH 1EIFA 4IO9A 3TS0A 1LM0A 2MO1A 3IRBA 1PH2A 1L1OB 4DUZQ 2K14A 1L1OA 3PCOB 5M3FG 4DR3Q 4H02A 3EN2A 4DV5Q 1YHQA 4IOCA 2JA8H 2WFWA 3PUXA 2CKZB 4NPSA 3J7A5 2BH8A 3H0GH 5C4JH 3CCRA 3SGIA 2K5NA 1CUKA 1Q1BA 3RZOH 4LUVA 4LF7L 4QY7A 4R4TA 4JI7L 2Z6KC 4X65Q 2NVQH 1UE5A 2CCZA 1TWGH 4GNXC 3CC7A 3UE1A 1MJCA 5J3BA 2E8GA 4FDBA 1VQ9A 1DGSA 3NELA 1PV4A 3HOZG 3G4SA 1VQBA 4BBSG 2PQAA 1K9MC 1HZAA 1U5KA 1VQGA 1XPUA 4MZ9A 1YBYA 4DNIA 1VQEA 2E2HH 1TWFH 3DLLA 3FKIG 4IJHA 4EX5A 5ELOA 3BZCA 4HJ7A 2E2JH 4KHPQ 1TWAH 2EIFA 2UUCL 3W5OA 5C0XJ 3S16H 2WAQE 1Q12A 1KD1C 2JA7G 3HKZG 1HH2P 4YWKA 5IYCG 1N36Q 1CKNB 4DV3L 4ME3A 1PH1A 4Y7NH 2D0OA 4QL5A 4DR2L 1X6OA 4DV6L 2OTJA 1YHBA 2KHJA 1IBKQ 3UE0A 2UXCL 1CKOA 2A1AA 4JYAQ 1RIPA 4JOIC 2WB1E 1PH5A 4NXML 3PF5A 1PH9A 1UE6A 2OQ0A 4LFCL 3KF8B 1YJNA 3CP0A 3H0GG 1CSQA 1WCMG 1Z47A 5IYBG 1SFOH 1XNQQ 1ASYA 4JV5Q 4JI6Q 1VQJA 2ID0A 3JAMi 3TQYA 4GNXB 1HNZL 3K7UC 1NTGA 4LF7Q 2Q2UA 4NXNQ 2VQEL 1VQ7A 3BU2A 1PH6A 4NB3A 4R4QA 2N3SA 5C3EG 4DR1L 1XMQQ 1S40A 3RLFA 3UDFA 1RL2A 3HOYG 4LF9L 1OXTA 2Q2IA 4LWCA 2UUBQ 1PFSA 4LF4Q 2UUAQ 1KAWA 2VZAA 5IP9H 3GTLH 2ZM6L 2CFMA 4O2DA 1HNXL 4APVA 4PZ6A 3STBC 1Z9FA 3CXCA 1JJGA 1HR0Q 1FVIA 4X66L 4A3EH 4A3JH 4A3DG 1R9TH 3T1HQ 1WFQA 1L1OC 4JI6L 2CQOA 3GTKH 4OWWB 2OTLA 4LNQA 3TS2A 4JBWA 4ALPA 1HNZQ 4A3JG 4OO1G 4JC0A 1N33L 4BBSH 2LSSA 1YNXA 4P75A 1YHAA 2B63G 3W1GA 1P16A 2Q2HA 1X9NA 4BY7H 1I50H 5GADC 1QVCA 2MO0A 1QVGA 2VUMG 3JAMc 4DR6L 4JYAL 1KHIA 1TXYA 2BA0A 3Q8DA 5IYBH 4B3RQ 4GKJQ 5H1SE 1GD7A 4X64Q 2UUCQ 5LMNW 3CCQA 3TRZA 2NN6G 2ZJQA 3T1HL 3S2HH 4GLAC 2IHFA 3M4QA 5IWAL 1VQOA 4A3KG 1HR0L 2KBNA 4LF5L 1XTDA 3GTOH 5GAGC 1KQSA 1Q81C 3PO2H 2HIXA 2NZOA 2VQFQ 2DGYA 3CF5A 4DPGA 4HJAA 1YJWA 3F8TA 4GS3A 2Y0SG 4O0AA 2AHOB 1XJVA 1N8RC 4OX9Q 1B8AA 3D0FA 3H15A 5M3MH 4K0KQ 1B7YB 5FLMG 3H3VH 2YU9H 4DK3C 3PSIA 1VQCA 2JA6G 4DUYQ 3KYHC 2F52A 2UU9Q 3L0OA 2GVBA 1O7IA 3PGZA 4B3TL 4MNOA 3I56A 4QQBX 4JI7Q 1IZ6A 1V1QA 4C2MH 2JEBI 3AFQA 1LUZA 3PUWA 2AMCB 1D7QA 1JT8A 1OXUA 4LF5Q 2B63H 4BY7G 1N9WA 4LF8Q 4IFDG 1VQLA 3BJUA 3RR5A 3UDGA 2HQLA 2VQFL 2UXCQ 4LF6Q 4DV0L 2VUMH 1VCIA 1Y1VH 3F1ZA 4L5RC 4YWMA 4AIMA 1HNWL 3S1MH 3J80c 1BKBA 1M90C 1CKNA 3CCSA 4OX9L 4OXPA 5IP7G 4A93G 1WI5A 4DR6Q 3CCLA 4HJ8A 2PI2A 2R92G 3GTQH 3HOUG 1CSPA 2N49A 1SMXA 5JEAJ 2QEXA 2IY5B 3NEMA 2VW9A 5AJ3Q 3BZKA 3TREA 1J5EL 4LW1A 4DR5Q 1SE8A 3PIPA 1K8AC 3TEHB 3HKZE 1Q86C 1I3QH 2IX1A 3E9IA 3K8AA 4UP7A 2NN6I 3B6YA 1E1OA 1HZ9A 2I5MX 1V43A 4R4IA 5HGQA 2JE6I 5IE8A 2QA4A 1E1TA 4GN5A 4TQUS 3H3VI 3HOYH 3GTPH 2WB1G 4A3KH 4MTNA 1VQ6A 1SLJA 2KCTA 1IL2A 3I4NH 4KI0A 4BXXG 2AWOA 1KRTA 5C44H 1PYBA 1Q8KA 3JC66 3J81i 1VQ8A 4LF4L 2ZTDA 1G51A 3GDEA 3CMAA 3S15H 1Y1VG 1XMQL 1EQQA 3G71A 2YTVA 5GROA 2JA7H 4GKKL 4B3SL 4C3HH 1GO3E 4A3LG 2UUAL 2K5HA 4R4CA 3CMEA 1NMGA 2V1CC 1A0IA 4JV5L 4JCVE 1QZHA 1C7YA 4JI4Q 1XMOQ 2K50A 1YVCA 3G48A 4LFCQ 1Q46A 3HOXG 1FL0A 3HOVH 2UXBQ 4B3ML 5M3FH 2D62A 3HKSA 1NJIC 2ZTEA 2WAQG 3E0EA 2JA6H 3CW2C 2YTYA 2PI2E 4LUOA 1JJCB 1AE2A 5FLXc 2JA9A 4P71A 1PYSB 1S3OA 2R7ZH 3VDYA 3L2PA 4DR5L 1VQAA 2N78A 3L7ZC 4L5TA 2R7ZG 3PV0A 3PO2G 1WYDA 5HY6A 4DV2L 1EOVA 1FJGL 2VNUD 4JBMA 1YIJA 1A8VA 4X64L 4DV7Q 2R93H 1NY4A 1VQPA 4BXXH 3S1NH 2KCMA 1PH3A 1NE3A 1N34Q 4LFBQ 3HFZB 1KL9A 3I4OA 1WCMH 1EIYB 4AYBE 5M3MG 3F2BA 1M1KC 4BA2I 3CCJA 4YHHQ 1C0AA 5C0XG 4P72A 1X54A 3KJOA 2E2IH 1XPRA 3I4NG 1E7ZA 5IT9c 4X65L 5FLMH 5GQOA 5C3EH 3CPWA 2LXKA 5IYDG 1ASZA 2Y0SE 3K80C 3CCMA 1OTCA 4R4OA 4B3TQ 1X3FA 4GN3B 4PMWA 1UE1A 4A3FG 3STBD 1VQKA 1OXSC 2BH2A 3ZJYC 4DKAC 1XMOL 1IBMQ 4GKKQ 2R93G 4P73A 5C0XI 4XTCS 3E9HA 1I94Q 1X65A 4A3DH 2BA1A 2YV5A 2CWPA 1QZGA 2CWAA 3PF4A 4JI1Q 1HR0W 4DR7Q 1GKHA 4A76A 3J80i 3CPFA 3CAMA 5GAHC 1MKHA 1UEBA 4JBJA 3GTJH 5LMNL 4A3MH 5M5YH 1JMCA 2DUDA 3I4MG 2Q2TA 1J6QA 3KFUA 3S17H 4X62Q 2H5XA 4LUZA 3OTOQ 1YI2A 1JB7A 1X3EA 3EIVA 2ZJPA 2K4KA 1PVOA 4P74A 3HOXH 1AE3A 4DR2Q 3HOVG 2NZHA 1XNQL 3HOUH 1Q1EA 4A3EG 2JK8A 4IPGA 3GTMH 4OWTB 2ZJRA 1Q7YC 2E5LQ 4A3IG 1I6HH 3NENA 5FJ8H 3AFPA 2HHHL 2FXQA 3RN2A 2EXDA 3S14H 5C4XH 2NVXH 5JJKA 4BBRG 3M4OH 5IYDH 3NBHB 1VQ4A 3S1RH 2OQKA 1G291 3GO5A 3PUVA 2XGTA 1OXVA 1X55A 3RLOA 4A3GG 4KHPL 1E22A 4JI3L 3OYYA 1VQHA 1EWIA 3D31A 4AQYQ 3GTGH 2K75A 2VS1A 2JJQA 3DM3A 2AKWB 3U4VA 3HOWG 5LMNQ 4HJ9A 1Y1WG 1IBML 5BR8L 4IFDJ 2N8NA 4DR1Q 3I55A 1IBLQ 4DV4L 1KC8C 4YCWA 4DR7L 4LF9Q 4NXNL 3A0JA 4AH6A 3PIOA 3U50C 1K83H 1YJ9A 2Z6KA 2R7FA 1S72A 2A8VA 1IXRA 2L15A 4WJ3M 2UU9L 3M9BA 3K7AH 4JI8Q 1JJ2A 2GVAA 4A3IH 2PMZE 1I5FA 3KOJA 2RCNA 4OONA 4QJFA 4DUZL 3PUZA 4DUYL 4YCUA 1IBLL 2ZTCA 3KDFA 3ULPA 1AH9A 2VY3A 3GD7A 3KDFB 4BY1G 2WP8J 1L0WA 5IWAQ 4YHHL 2ASBA 2I5LX 1V9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 Q;  1N36 L;  3HOZ H;  4UP9 A;  1KXL A;  1W2B A;  4JI2 L;  2KEN A;  4OO1 I;  2KHI A;  1FGU A;  1WOC A;  1NBW A;  3RNU A;  4DV7 L;  4HID A;  4B3R L;  4GKJ L;  1VQI A;  4C3J H;  3CCU A;  4GOP C;  1CKM A;  3M7N A;  1K0R A;  1OXX K;  2OCE A;  2VL6 A;  2UXD Q;  2GN5 A;  3M85 A;  3HOW H;  1TWC H;  4A3F H;  3M4P A;  3T1Y L;  4POF A;  4PZ7 A;  3WWV A;  2I0Q A;  4DR4 L;  4DAY B;  2I5H A;  3K0X A;  1XNR Q;  2R7D A;  2JEA I;  4B3M Q;  2D0P A;  5LMU Q;  3J81 c;  4AYB G;  2C35 B;  3U58 A;  4GLX A;  2JQO A;  2K52 A;  3AQQ A;  3KF6 B;  1K73 C;  2NVT H;  4C3I H;  3UDX A;  1BBW A;  2RHS B;  4A3C H;  4X66 Q;  2QGQ A;  2RF4 A;  2XTI A;  1SR3 A;  2ZM6 Q;  3OTO L;  4JI4 L;  1X56 A;  4KHZ A;  5JJL A;  4DK6 C;  3UDI A;  5IY0 A;  4IPD A;  1K3R A;  1SRO A;  3U4Z A;  3A74 A;  1YEZ A;  3CCV A;  4DR3 L;  4JBK A;  3S2D H;  4X6A H;  1U0L A;  1E24 A;  1SN8 A;  2RHQ B;  5JJI A;  2HT1 A;  4IFD I;  5E7N A;  2JA5 H;  1L2F A;  1KIX A;  3OW2 A;  1I94 L;  3CC2 A;  4IPC A;  4YY3 Q;  2VQE Q;  4UP8 A;  5M5W H;  3CQZ H;  1VQ5 A;  4Y52 H;  3J81 j;  4JG2 A;  4DR4 Q;  1KRS A;  1UE7 A;  4LFA Q;  1N32 L;  3PUY A;  1YIT A;  4NXM Q;  3W1B A;  3KJP A;  3ICE A;  1B70 B;  1JE5 A;  4DAM A;  1IBK L;  4A4I A;  4JI5 Q;  1PH8 A;  2MNA A;  1C9O A;  4IOA A;  1H95 A;  5FJ8 G;  1Y14 B;  2B29 A;  1PA6 A;  3PO3 G;  2MFI A;  3MEF A;  1N34 L;  4LFB L;  5LMU L;  3T1Y Q;  1VQD A;  4QGU A;  1J5E Q;  3KLW A;  3CC4 A;  1XNR L;  2UXD L;  1MIU A;  4YCV A;  5IP9 G;  4HJ5 A;  2LXJ A;  4YWL A;  3F2D A;  4DV3 Q;  4HIM A;  3RN5 A;  2F4V Q;  4JI2 Q;  2ES2 A;  4UPA A;  2A19 A;  3ER0 A;  1VQN A;  2NVY H;  4HIK A;  4GLV B;  2PNH A;  2YYZ A;  1YZ6 A;  1EUJ A;  4DV0 Q;  4DV2 Q;  1FJG Q;  1A63 A;  3CD6 A;  4EQ5 A;  1HNW Q;  4LF8 L;  2B3G A;  4PZ8 A;  4JI8 L;  4LF6 L;  5C4X G;  5K36 G;  4POG A;  2R6G A;  2ATW A;  1MJE A;  3S24 A;  4GOP A;  2R92 H;  1Y1W H;  2UXB L;  4GOP B;  1P8L A;  1WJJ A;  4XIG S;  4GN4 B;  1IYJ B;  1PHJ A;  4IJL A;  3EBE A;  4UY8 C;  2AWN A;  3F2C A;  4JI0 Q;  3RLN A;  3J7Z C;  1N32 Q;  3MXN B;  1BVS A;  4DV4 Q;  1QVF A;  4JI0 L;  2ALY B;  1HZB A;  5BR8 Q;  4WJ4 A;  1LYL A;  3KF6 A;  1EFW A;  3FP9 A;  4TVA B;  3AYH B;  2EQS A;  2PQA B;  3I4M H;  1G6P A;  1VQF A;  1W3S A;  1K8G A;  2Z0S A;  4HIO A;  4BY1 H;  4K0K L;  1XPO A;  3M3Y H;  2K5V A;  1VS0 A;  5DLQ E;  2F3I A;  2IX0 A;  3FHW A;  4AQY L;  3ULL A;  3PO3 H;  5IP7 H;  4DV5 L;  5JEA G;  4OWX B;  1EQR A;  4A93 H;  4JI3 Q;  4PG3 A;  4L5Q A;  4RMF A;  1BBU A;  3S1Q H;  1LTL A;  2IT1 A;  3CCE A;  1VQM A;  4IPH A;  4DV1 Q;  3FKI H;  4L5S A;  1E3P A;  1HZC A;  2MQH A;  1QUQ B;  4BA1 I;  3RZD H;  2F4V L;  1NMF A;  1QUQ A;  4A3M G;  4A3L H;  1UWV A;  4J15 A;  3ERS X;  4A3B G;  1HJP A;  4JOI A;  4KLK A;  5ELN A;  3ULJ A;  4QIW E;  5GAE C;  5M5X H;  2JA5 G;  1PH7 A;  1A62 A;  3AEV A;  1D8L A;  4JI5 L;  3A5Z B;  2E5L L;  2JA8 G;  4LFA L;  5C44 G;  4A3G H;  5EAY A;  3G6E A;  1PH4 A;  2HHH Q;  4R1J A;  4GNX A;  4A75 A;  1N33 Q;  1SRU A;  5AJ3 L;  1GM5 A;  1EYG A;  4A3C G;  1GVP A;  2YTX A;  1Q82 C;  4YY3 L;  2IHE A;  3A5U A;  1T9H A;  4JI1 L;  2HIV A;  5IYC H;  4B3S Q;  1X3G A;  3I2Z A;  4X62 L;  4A3B H;  4DV1 L;  4RG1 A;  2UUB L;  2OWO A;  3I7F A;  1HNX Q;  3LGJ A;  1TWH H;  3K81 C;  4BBR H;  1EIF A;  4IO9 A;  3TS0 A;  1LM0 A;  2MO1 A;  3IRB A;  1PH2 A;  1L1O B;  4DUZ Q;  2K14 A;  1L1O A;  3PCO B;  5M3F G;  4DR3 Q;  4H02 A;  3EN2 A;  4DV5 Q;  1YHQ A;  4IOC A;  2JA8 H;  2WFW A;  3PUX A;  2CKZ B;  4NPS A;  3J7A 5;  2BH8 A;  3H0G H;  5C4J H;  3CCR A;  3SGI A;  2K5N A;  1CUK A;  1Q1B A;  3RZO H;  4LUV A;  4LF7 L;  4QY7 A;  4R4T A;  4JI7 L;  2Z6K C;  4X65 Q;  2NVQ H;  1UE5 A;  2CCZ A;  1TWG H;  4GNX C;  3CC7 A;  3UE1 A;  1MJC A;  5J3B A;  2E8G A;  4FDB A;  1VQ9 A;  1DGS A;  3NEL A;  1PV4 A;  3HOZ G;  3G4S A;  1VQB A;  4BBS G;  2PQA A;  1K9M C;  1HZA A;  1U5K A;  1VQG A;  1XPU A;  4MZ9 A;  1YBY A;  4DNI A;  1VQE A;  2E2H H;  1TWF H;  3DLL A;  3FKI G;  4IJH A;  4EX5 A;  5ELO A;  3BZC A;  4HJ7 A;  2E2J H;  4KHP Q;  1TWA H;  2EIF A;  2UUC L;  3W5O A;  5C0X J;  3S16 H;  2WAQ E;  1Q12 A;  1KD1 C;  2JA7 G;  3HKZ G;  1HH2 P;  4YWK A;  5IYC G;  1N36 Q;  1CKN B;  4DV3 L;  4ME3 A;  1PH1 A;  4Y7N H;  2D0O A;  4QL5 A;  4DR2 L;  1X6O A;  4DV6 L;  2OTJ A;  1YHB A;  2KHJ A;  1IBK Q;  3UE0 A;  2UXC L;  1CKO A;  2A1A A;  4JYA Q;  1RIP A;  4JOI C;  2WB1 E;  1PH5 A;  4NXM L;  3PF5 A;  1PH9 A;  1UE6 A;  2OQ0 A;  4LFC L;  3KF8 B;  1YJN A;  3CP0 A;  3H0G G;  1CSQ A;  1WCM G;  1Z47 A;  5IYB G;  1SFO H;  1XNQ Q;  1ASY A;  4JV5 Q;  4JI6 Q;  1VQJ A;  2ID0 A;  3JAM i;  3TQY A;  4GNX B;  1HNZ L;  3K7U C;  1NTG A;  4LF7 Q;  2Q2U A;  4NXN Q;  2VQE L;  1VQ7 A;  3BU2 A;  1PH6 A;  4NB3 A;  4R4Q A;  2N3S A;  5C3E G;  4DR1 L;  1XMQ Q;  1S40 A;  3RLF A;  3UDF A;  1RL2 A;  3HOY G;  4LF9 L;  1OXT A;  2Q2I A;  4LWC A;  2UUB Q;  1PFS A;  4LF4 Q;  2UUA Q;  1KAW A;  2VZA A;  5IP9 H;  3GTL H;  2ZM6 L;  2CFM A;  4O2D A;  1HNX L;  4APV A;  4PZ6 A;  3STB C;  1Z9F A;  3CXC A;  1JJG A;  1HR0 Q;  1FVI A;  4X66 L;  4A3E H;  4A3J H;  4A3D G;  1R9T H;  3T1H Q;  1WFQ A;  1L1O C;  4JI6 L;  2CQO A;  3GTK H;  4OWW B;  2OTL A;  4LNQ A;  3TS2 A;  4JBW A;  4ALP A;  1HNZ Q;  4A3J G;  4OO1 G;  4JC0 A;  1N33 L;  4BBS H;  2LSS A;  1YNX A;  4P75 A;  1YHA A;  2B63 G;  3W1G A;  1P16 A;  2Q2H A;  1X9N A;  4BY7 H;  1I50 H;  5GAD C;  1QVC A;  2MO0 A;  1QVG A;  2VUM G;  3JAM c;  4DR6 L;  4JYA L;  1KHI A;  1TXY A;  2BA0 A;  3Q8D A;  5IYB H;  4B3R Q;  4GKJ Q;  5H1S E;  1GD7 A;  4X64 Q;  2UUC Q;  5LMN W;  3CCQ A;  3TRZ A;  2NN6 G;  2ZJQ A;  3T1H L;  3S2H H;  4GLA C;  2IHF A;  3M4Q A;  5IWA L;  1VQO A;  4A3K G;  1HR0 L;  2KBN A;  4LF5 L;  1XTD A;  3GTO H;  5GAG C;  1KQS A;  1Q81 C;  3PO2 H;  2HIX A;  2NZO A;  2VQF Q;  2DGY A;  3CF5 A;  4DPG A;  4HJA A;  1YJW A;  3F8T A;  4GS3 A;  2Y0S G;  4O0A A;  2AHO B;  1XJV A;  1N8R C;  4OX9 Q;  1B8A A;  3D0F A;  3H15 A;  5M3M H;  4K0K Q;  1B7Y B;  5FLM G;  3H3V H;  2YU9 H;  4DK3 C;  3PSI A;  1VQC A;  2JA6 G;  4DUY Q;  3KYH C;  2F52 A;  2UU9 Q;  3L0O A;  2GVB A;  1O7I A;  3PGZ A;  4B3T L;  4MNO A;  3I56 A;  4QQB X;  4JI7 Q;  1IZ6 A;  1V1Q A;  4C2M H;  2JEB I;  3AFQ A;  1LUZ A;  3PUW A;  2AMC B;  1D7Q A;  1JT8 A;  1OXU A;  4LF5 Q;  2B63 H;  4BY7 G;  1N9W A;  4LF8 Q;  4IFD G;  1VQL A;  3BJU A;  3RR5 A;  3UDG A;  2HQL A;  2VQF L;  2UXC Q;  4LF6 Q;  4DV0 L;  2VUM H;  1VCI A;  1Y1V H;  3F1Z A;  4L5R C;  4YWM A;  4AIM A;  1HNW L;  3S1M H;  3J80 c;  1BKB A;  1M90 C;  1CKN A;  3CCS A;  4OX9 L;  4OXP A;  5IP7 G;  4A93 G;  1WI5 A;  4DR6 Q;  3CCL A;  4HJ8 A;  2PI2 A;  2R92 G;  3GTQ H;  3HOU G;  1CSP A;  2N49 A;  1SMX A;  5JEA J;  2QEX A;  2IY5 B;  3NEM A;  2VW9 A;  5AJ3 Q;  3BZK A;  3TRE A;  1J5E L;  4LW1 A;  4DR5 Q;  1SE8 A;  3PIP A;  1K8A C;  3TEH B;  3HKZ E;  1Q86 C;  1I3Q H;  2IX1 A;  3E9I A;  3K8A A;  4UP7 A;  2NN6 I;  3B6Y A;  1E1O A;  1HZ9 A;  2I5M X;  1V43 A;  4R4I A;  5HGQ A;  2JE6 I;  5IE8 A;  2QA4 A;  1E1T A;  4GN5 A;  4TQU S;  3H3V I;  3HOY H;  3GTP H;  2WB1 G;  4A3K H;  4MTN A;  1VQ6 A;  1SLJ A;  2KCT A;  1IL2 A;  3I4N H;  4KI0 A;  4BXX G;  2AWO A;  1KRT A;  5C44 H;  1PYB A;  1Q8K A;  3JC6 6;  3J81 i;  1VQ8 A;  4LF4 L;  2ZTD A;  1G51 A;  3GDE A;  3CMA A;  3S15 H;  1Y1V G;  1XMQ L;  1EQQ A;  3G71 A;  2YTV A;  5GRO A;  2JA7 H;  4GKK L;  4B3S L;  4C3H H;  1GO3 E;  4A3L G;  2UUA L;  2K5H A;  4R4C A;  3CME A;  1NMG A;  2V1C C;  1A0I A;  4JV5 L;  4JCV E;  1QZH A;  1C7Y A;  4JI4 Q;  1XMO Q;  2K50 A;  1YVC A;  3G48 A;  4LFC Q;  1Q46 A;  3HOX G;  1FL0 A;  3HOV H;  2UXB Q;  4B3M L;  5M3F H;  2D62 A;  3HKS A;  1NJI C;  2ZTE A;  2WAQ G;  3E0E A;  2JA6 H;  3CW2 C;  2YTY A;  2PI2 E;  4LUO A;  1JJC B;  1AE2 A;  5FLX c;  2JA9 A;  4P71 A;  1PYS B;  1S3O A;  2R7Z H;  3VDY A;  3L2P A;  4DR5 L;  1VQA A;  2N78 A;  3L7Z C;  4L5T A;  2R7Z G;  3PV0 A;  3PO2 G;  1WYD A;  5HY6 A;  4DV2 L;  1EOV A;  1FJG L;  2VNU D;  4JBM A;  1YIJ A;  1A8V A;  4X64 L;  4DV7 Q;  2R93 H;  1NY4 A;  1VQP A;  4BXX H;  3S1N H;  2KCM A;  1PH3 A;  1NE3 A;  1N34 Q;  4LFB Q;  3HFZ B;  1KL9 A;  3I4O A;  1WCM H;  1EIY B;  4AYB E;  5M3M G;  3F2B A;  1M1K C;  4BA2 I;  3CCJ A;  4YHH Q;  1C0A A;  5C0X G;  4P72 A;  1X54 A;  3KJO A;  2E2I H;  1XPR A;  3I4N G;  1E7Z A;  5IT9 c;  4X65 L;  5FLM H;  5GQO A;  5C3E H;  3CPW A;  2LXK A;  5IYD G;  1ASZ A;  2Y0S E;  3K80 C;  3CCM A;  1OTC A;  4R4O A;  4B3T Q;  1X3F A;  4GN3 B;  4PMW A;  1UE1 A;  4A3F G;  3STB D;  1VQK A;  1OXS C;  2BH2 A;  3ZJY C;  4DKA C;  1XMO L;  1IBM Q;  4GKK Q;  2R93 G;  4P73 A;  5C0X I;  4XTC S;  3E9H A;  1I94 Q;  1X65 A;  4A3D H;  2BA1 A;  2YV5 A;  2CWP A;  1QZG A;  2CWA A;  3PF4 A;  4JI1 Q;  1HR0 W;  4DR7 Q;  1GKH A;  4A76 A;  3J80 i;  3CPF A;  3CAM A;  5GAH C;  1MKH A;  1UEB A;  4JBJ A;  3GTJ H;  5LMN L;  4A3M H;  5M5Y H;  1JMC A;  2DUD A;  3I4M G;  2Q2T A;  1J6Q A;  3KFU A;  3S17 H;  4X62 Q;  2H5X A;  4LUZ A;  3OTO Q;  1YI2 A;  1JB7 A;  1X3E A;  3EIV A;  2ZJP A;  2K4K A;  1PVO A;  4P74 A;  3HOX H;  1AE3 A;  4DR2 Q;  3HOV G;  2NZH A;  1XNQ L;  3HOU H;  1Q1E A;  4A3E G;  2JK8 A;  4IPG A;  3GTM H;  4OWT B;  2ZJR A;  1Q7Y C;  2E5L Q;  4A3I G;  1I6H H;  3NEN A;  5FJ8 H;  3AFP A;  2HHH L;  2FXQ A;  3RN2 A;  2EXD A;  3S14 H;  5C4X H;  2NVX H;  5JJK A;  4BBR G;  3M4O H;  5IYD H;  3NBH B;  1VQ4 A;  3S1R H;  2OQK A;  1G29 1;  3GO5 A;  3PUV A;  2XGT A;  1OXV A;  1X55 A;  3RLO A;  4A3G G;  4KHP L;  1E22 A;  4JI3 L;  3OYY A;  1VQH A;  1EWI A;  3D31 A;  4AQY Q;  3GTG H;  2K75 A;  2VS1 A;  2JJQ A;  3DM3 A;  2AKW B;  3U4V A;  3HOW G;  5LMN Q;  4HJ9 A;  1Y1W G;  1IBM L;  5BR8 L;  4IFD J;  2N8N A;  4DR1 Q;  3I55 A;  1IBL Q;  4DV4 L;  1KC8 C;  4YCW A;  4DR7 L;  4LF9 Q;  4NXN L;  3A0J A;  4AH6 A;  3PIO A;  3U50 C;  1K83 H;  1YJ9 A;  2Z6K A;  2R7F A;  1S72 A;  2A8V A;  1IXR A;  2L15 A;  4WJ3 M;  2UU9 L;  3M9B A;  3K7A H;  4JI8 Q;  1JJ2 A;  2GVA A;  4A3I H;  2PMZ E;  1I5F A;  3KOJ A;  2RCN A;  4OON A;  4QJF A;  4DUZ L;  3PUZ A;  4DUY L;  4YCU A;  1IBL L;  2ZTC A;  3KDF A;  3ULP A;  1AH9 A;  2VY3 A;  3GD7 A;  3KDF B;  4BY1 G;  2WP8 J;  1L0W A;  5IWA Q;  4YHH L;  2ASB A;  2I5L X;  1V9P A; 
#chains in the Genus database with same CATH topology
 3HOZ H;  1NNX A;  1CFM A;  1WTQ A;  1KXL A;  4RGT A;  4L63 B;  1FNU A;  4N8F A;  3OSO A;  3PQI A;  3RNU A;  5EJW A;  4DV7 L;  3I4N B;  4K5V A;  5KYI A;  2GN5 A;  1PZI D;  4A3F H;  3M4P A;  3NTI A;  2I0Q A;  4B3M Q;  4I65 A;  2F0N A;  5LMU Q;  1PDQ A;  3QR8 A;  3OPO A;  2PO4 A;  5IT9 L;  4C3I H;  1XTC D;  2RHS B;  4X66 Q;  2QGQ A;  2RF4 A;  2A68 C;  2XTI A;  2ZM6 Q;  1X56 A;  1G8Z D;  2BE5 D;  1HA5 A;  5EQ0 A;  3V96 A;  2OT2 A;  1K3R A;  2K28 A;  4JBK A;  4X6A H;  1L0Y B;  1E24 A;  1NCV A;  4B9W A;  1L2F A;  3OW2 A;  1S5B D;  4YY3 Q;  2VQE Q;  1VQ5 A;  1XYI A;  4JG2 A;  4DR4 Q;  5DNF A;  1N32 L;  1AW7 A;  3ICE A;  1B70 B;  1JE5 A;  1PH8 A;  1Y14 B;  3CHB D;  1K8O A;  1CZG A;  2K5W A;  2MFI A;  3J7A F;  4OO1 H;  5LMU L;  3LNN A;  1VQD A;  1J5E Q;  1XNR L;  4YCV A;  1JOK A;  1I4P A;  3RN5 A;  4HIM A;  4JI2 Q;  3EA6 A;  1SYB A;  3ER0 A;  1EIG A;  2X6G A;  2KEC A;  4S3S A;  5BN3 A;  4DV2 Q;  1A63 A;  2Z6B A;  2IW3 A;  1HNW Q;  2A69 D;  2ATW A;  1MJE A;  4RGM A;  3S24 A;  2R92 H;  2UXB L;  4GOP B;  4IZ8 A;  3S16 B;  4GN4 B;  2AQ1 B;  3F2C A;  1ENC A;  5G3L F;  2E2I B;  1S5F D;  1LYL A;  3WDN A;  1G6P A;  2QF7 A;  5IGC A;  1Z6H A;  2D5D A;  2VUM B;  2IX0 A;  1KNA A;  3PO3 H;  2A68 D;  4J8Q A;  3S1Q H;  1LTL A;  2IT1 A;  3CCE A;  1EY0 A;  4IPH A;  5EPL A;  4DV1 Q;  1YNN D;  1AP0 A;  2MQH A;  3U9O A;  4CHT B;  1NMF A;  1UWV A;  2MP1 A;  3ERS X;  4JOI A;  3NXW A;  1JOR A;  3VYU A;  2JA5 G;  2MUY A;  4ZK9 B;  3BYT B;  5LL6 X;  1HFG A;  3A5Z B;  2JA8 G;  1BXT A;  3SVM A;  4XQJ A;  2R61 A;  1N33 Q;  1GM5 A;  1EYG A;  4A3C G;  3SDZ A;  1EY6 A;  2IHE A;  1T9H A;  3RD4 A;  3I2Z A;  4BBR B;  4X62 L;  4A3B H;  2EYH A;  4C3I B;  3TS0 A;  3L3O C;  2MO1 A;  2NN6 H;  4DUZ Q;  2K14 A;  1YHQ A;  4H02 A;  3PUX A;  2BH8 A;  1PTO B;  2K01 A;  4C1N I;  1Q1B A;  4R8I A;  4N9T A;  2Z6K C;  4X65 Q;  2NVQ H;  4FF4 A;  5KYL A;  2CCZ A;  3CC7 A;  3UE1 A;  2HCC A;  4CKC A;  4ILW A;  1G6Z A;  5EKK A;  1YBY A;  2E2H H;  1IYU A;  5T1G A;  4TKO B;  2F0S A;  2EYJ A;  3BZC A;  4KHP Q;  2EIF A;  3W5O A;  4OHJ A;  3S16 H;  2SNS A;  1CKN B;  2NVQ B;  2DJG C;  4ME3 A;  4ID6 A;  3CKI B;  1B44 D;  4Y7N H;  2D0O A;  1X6O A;  4DV6 L;  2SEB D;  2OTJ A;  1YHB A;  3UE0 A;  2UXC L;  5KGU A;  3IKJ A;  3QO2 A;  3KF8 A;  4LFC L;  2Q8T A;  1M4V A;  1IKL A;  2WAQ B;  4EQP A;  1ASY A;  4JV5 Q;  4IN3 A;  1HNZ L;  3H09 A;  3K7U C;  2A6E C;  3GTG B;  3MC0 B;  4L8J A;  4NXN Q;  1VQ7 A;  1X3Q A;  4N9P A;  5COR A;  4DR1 L;  1QJO A;  2H1E A;  1WVL A;  4LWC A;  2Q2I A;  4LF4 Q;  1H9S B;  4C1N K;  4EVO A;  5IP9 H;  1II3 A;  2ZM6 L;  1HNX L;  1E0B A;  1D5M C;  1HR0 Q;  4A3J H;  2FMC A;  1U4L A;  5C4X B;  3T1H Q;  1B1Z A;  1L1O C;  3TS2 A;  4LNQ A;  4ALP A;  1B4O A;  1RTO A;  1QNU A;  3BZD B;  4CDD C;  4BBS B;  2M00 A;  1CQF A;  4BY7 H;  3H94 A;  3KK7 A;  1RHP A;  2MO0 A;  1QVG A;  4JYA L;  3JAM c;  1TXY A;  2BA0 A;  3GTJ B;  4B3R Q;  4GKJ Q;  1LT3 D;  2MJ8 A;  2UUC Q;  2WB1 B;  2ZJQ A;  1EYA A;  1E2Z A;  3BDO A;  1ESR A;  4A3K G;  3R2T A;  1KQS A;  3PO2 H;  3CF5 A;  4HJA A;  4YIJ A;  3I72 A;  4GS3 A;  2AHO B;  1N8R C;  1B8A A;  3DHQ A;  3NWT A;  4LJZ C;  3PSI A;  1VQC A;  1LTA D;  3ERO A;  2UU9 Q;  2E2H B;  3PGZ A;  2L5T A;  5A35 A;  5C3W A;  2ICI A;  2CH4 A;  1PZJ D;  1STB A;  4MTK A;  2KJX A;  1OXU A;  1TVX A;  4BY7 G;  4IFD G;  3BJU A;  3RR5 A;  3UDG A;  2HQL A;  2VQF L;  4DV0 L;  2L9H A;  3I73 A;  1F2Y A;  1HRJ A;  3F1Z A;  4YWM A;  1I50 B;  2HUG A;  3DWP A;  1RDP D;  3V05 A;  5HGT A;  1EWH A;  1VF5 C;  3GTQ H;  1WTP A;  2R92 G;  1SND A;  1CTM A;  4DK1 A;  3K57 A;  3BZK A;  3MFY A;  5M5Y B;  1DON A;  2B63 B;  4H7B A;  4KK7 A;  2Q8R E;  3TEH B;  3HKZ E;  4DFA A;  2EXZ A;  1Y8N B;  2JE6 I;  1IW7 C;  4TQU S;  1TWC B;  5CC4 A;  1S5C D;  5D3D A;  3HGB A;  4CJ1 B;  1SLJ A;  4WRD A;  2KCT A;  2B2Y C;  4KI0 A;  4BXX G;  2AWO A;  1X3P A;  4HMI A;  4X3T A;  5C44 H;  1PYB A;  5D3I B;  3J81 i;  2QCP X;  4C3J G;  5K5P A;  2QDL A;  1XMQ L;  2Z1C A;  3KUP A;  4GKK L;  1GO3 E;  4RGN A;  4A3L G;  1A0I A;  1EU4 A;  1QZH A;  1C7Y A;  1YVC A;  2PW7 A;  5C4J B;  2JA6 H;  2PI2 E;  4LUO A;  4QIW B;  4GZY C;  1PYS B;  3NBH A;  2ICE C;  3S1M B;  1SXT A;  3L7Z C;  5HY6 A;  1GUN A;  2R92 B;  4A93 B;  4JBM A;  1LTG D;  4X64 L;  2JA7 B;  3OWE B;  3I4O A;  1WCM H;  2K03 A;  3J81 L;  3HOW B;  1C0A A;  3BVM A;  3MFG A;  2A6H D;  1TY2 A;  1X54 A;  2KCC A;  2YU9 B;  1H9K A;  1E7Z A;  1HCZ A;  5GQO A;  2M2L A;  1SE4 A;  4B3T Q;  2NVT B;  1X3F A;  3P7J A;  4HSP A;  1UE1 A;  3E5S A;  1GUG A;  4GKK Q;  2EY2 A;  1IW7 D;  1IBM Q;  4PNY A;  4XTC S;  3VYT A;  1X65 A;  4DGZ A;  2BA1 A;  1VMP A;  1F9R A;  2CWP A;  1QZG A;  3PF4 A;  1JE4 A;  3OWF A;  1HR0 W;  1GKH A;  2B2W C;  2R93 B;  2K5D A;  4F88 A;  4JBJ A;  3I4M G;  4A3M H;  3DMU A;  5LMN L;  2ZXO A;  1KLU D;  1J6Q A;  5EPJ A;  4X62 Q;  3EIV A;  2ZJP A;  2PW5 A;  4P74 A;  1AE3 A;  1CK1 A;  1AEX A;  2C9O A;  3MZ5 A;  4OWT B;  5FJ8 H;  3VR4 A;  1WTO A;  3S14 H;  2DY7 A;  1GUW A;  5JJK A;  5M5W B;  3J7Y W;  2J7Z A;  2F0M A;  4HSV A;  4BY1 B;  2KA7 A;  3A54 A;  3GO5 A;  1UEA B;  1OXV A;  4EGV A;  3RLO A;  4Y7N B;  1TS4 A;  1E22 A;  3OYY A;  1VQH A;  1O7Y A;  3D31 A;  3DM3 A;  2PMZ B;  4ZUJ A;  3H3V C;  2QW7 A;  5BR8 L;  4UAI A;  3I8Z A;  1ML0 D;  2X69 A;  4YCW A;  4DR7 L;  4LF9 Q;  3A0J A;  3TZU A;  2F1M A;  1U4M A;  2WV6 D;  2A8V A;  1PFN A;  3M9B A;  3K7A H;  1JJ2 A;  2GVA A;  4NDX A;  3NWS A;  3MWY W;  3KOJ A;  4C2M B;  1F2M A;  1D6E C;  2RDG A;  2I07 B;  3KDF A;  1AH9 A;  3I4M B;  1L0W A;  1Y69 U;  1DCZ A;  1WTV A;  4RKL A;  4UP9 A;  3N52 A;  1W2B A;  3DM1 A;  4OO1 I;  3A8K E;  1FGU A;  1LTT D;  2HCI A;  1TWG B;  4IUP A;  4C3J H;  5IIF A;  3CCU A;  4GOP C;  2CW0 C;  4A3E B;  1D5X C;  5CYU A;  2UXD Q;  3M85 A;  1TWC H;  3X3N A;  3EVQ A;  4PQX A;  4QUF A;  4CDE C;  4U67 3;  3J81 c;  4AYB G;  2JQO A;  3AQQ A;  3KF6 B;  4OEM B;  2NVX B;  2LKV A;  1O7L A;  3J81 E;  4A3C H;  2F0I A;  2NUC A;  4JI4 L;  1OO9 B;  3OTO L;  3GTQ B;  1EY4 A;  5FLX E;  1BCP C;  1GXD C;  2XSC A;  3O13 A;  5IY0 A;  4IPD A;  1AZQ A;  2BDN A;  5JAV A;  1SRO A;  3OMG A;  1YEZ A;  4CDC C;  2EYO A;  2RHQ B;  2HT1 A;  3M4Y A;  5E7N A;  2JA5 H;  3TP5 A;  2AQ2 B;  1KDA A;  3CC2 A;  2KED A;  2FIN B;  4PMB A;  1STA A;  3DWA A;  3J81 j;  4K6D A;  4B9X A;  1YIT A;  2CH4 W;  2K5Q A;  5CV9 A;  1KDB A;  1PA6 A;  3PO3 G;  2X6L A;  1N34 L;  3A55 A;  3T1Y Q;  1EQV A;  4QGU A;  3D8G A;  1CT1 D;  5C3E B;  1MIU A;  2LXJ A;  3F2D A;  4KKT A;  4UPA A;  1VQN A;  4GLV B;  2YYZ A;  1YZ6 A;  1EUJ A;  1FJG Q;  4DNR B;  4ZRZ A;  4EQ5 A;  3NQT A;  4LF8 L;  2DNC A;  2B3G A;  4JI8 L;  4LF6 L;  2BCO A;  3I4L A;  3TP7 A;  1Y1W H;  1P8L A;  1WJJ A;  1RKN A;  4IJL A;  1QB5 D;  4OEL B;  2OF1 A;  1BVS A;  4TRD A;  4DV4 Q;  4DU9 A;  1QVF A;  1FD7 D;  3RZD B;  1HZB A;  3MEH A;  4OIK A;  2SNM A;  1EFW A;  4TVA B;  1H9R A;  3AYH B;  4BY1 H;  1K3B C;  4F7X A;  3S1N B;  3M3Y H;  2V4D A;  1VS0 A;  2F3I A;  2F0K A;  2SOB A;  4AQY L;  5IP7 H;  4DV5 L;  4RHS A;  4OWX B;  5JEA G;  1PRT C;  4L5Q A;  4RMF A;  1F77 A;  2RVL A;  3SHL A;  1E3P A;  2F0V A;  4ZQ3 A;  2L0C A;  3RZD H;  2Z9H A;  4A3M G;  4J15 A;  4A3B G;  4JPB W;  2WAC A;  3ULJ A;  2F0J A;  3E0J A;  2FHT A;  4QIW E;  4DAP A;  1MHW C;  4KJN A;  4RHR A;  1GOZ A;  1LAB A;  2EJM A;  1TR5 A;  2RQX A;  4A3G H;  3RUZ A;  1PH4 A;  1R4P B;  4A75 A;  2QKI C;  1EZ6 A;  1K83 B;  1H9M A;  2AQ3 B;  1GVP A;  2XNA C;  2YTX A;  3OIQ A;  4CGY B;  1U4R A;  5M9O A;  1I4H A;  2L55 A;  1HUM A;  1BUV T;  2UUB L;  2O5I C;  1HNX Q;  3HKZ B;  1TWH H;  3K81 C;  1PH2 A;  3A7A B;  4IO9 A;  1LM0 A;  4A3K B;  3JAM L;  1L1O B;  3GV3 A;  1SBB B;  1L1O A;  3PCO B;  5M3F G;  1MD2 D;  1SNO A;  3I4N G;  3HOU B;  2WFW A;  1Z7T A;  3J7A 5;  5C4J H;  2JA6 B;  4QMG A;  1F9P A;  1CUK A;  4LUV A;  4JI7 L;  1B3Q A;  2RA4 A;  4GNX C;  1MJC A;  5J3B A;  2KCN A;  3HOZ G;  1PV4 A;  1VQB A;  2PQA A;  3LWU A;  3T16 A;  1K9M C;  1WTX A;  2KOL A;  3NK9 A;  4DNI A;  1TWF H;  3FKI G;  4IJH A;  4CKE A;  4HJ7 A;  5KEE A;  3K5N A;  1KD1 C;  2HDL A;  4A3B B;  1HH2 P;  1PH1 A;  1ROD A;  2JA5 B;  2KHJ A;  2RSO A;  1IBK Q;  1RIP A;  4JOI C;  2WB1 E;  3S1R B;  1PH5 A;  3QOJ A;  1PH9 A;  1A3U A;  1A2U A;  2CW0 D;  1YJN A;  3CP0 A;  3H0G G;  1I4G A;  1XNQ Q;  3K5O A;  1I4Q A;  1TU2 B;  5DEH A;  3TQY A;  4LF7 Q;  4FVM A;  2XWB B;  1RJT A;  1PH6 A;  4R4Q A;  3BDC A;  1XMQ Q;  3HOY G;  3HP3 A;  1PFS A;  1PTO F;  3TME A;  2UUA Q;  4IUV A;  3TBI B;  2VZA A;  5JJZ A;  2CFM A;  5C6A A;  3STB C;  1JJG A;  4C3J B;  4X66 L;  4A3E H;  1RF2 D;  1EU3 A;  1VMC A;  1R9T H;  1WFQ A;  3VA7 A;  2CQO A;  3GTK H;  4OWW B;  1YNJ D;  4JC0 A;  2L1B A;  1MBY A;  3W1G A;  1I50 H;  5IGB A;  1QVC A;  4DA2 A;  2WKD A;  2QIL A;  2C5C A;  5H1S E;  5IGD A;  5LMN W;  1A3T A;  2NN6 G;  4FF2 A;  1W6K A;  2F0L A;  4GLA C;  2IHF A;  4ZUI A;  1VQO A;  2MPM A;  4K2L A;  1HR0 L;  2KBN A;  2L11 A;  4LF5 L;  3GTO H;  2K33 A;  2HIX A;  2VQF Q;  2DGY A;  3D4D A;  4DPG A;  1XJV A;  5FO7 B;  3C2P A;  4OX9 Q;  3KBX A;  5DM6 3;  3OMC A;  4B08 A;  4DK0 A;  4K5W A;  2JA6 G;  3SXH A;  3KYH C;  2F52 A;  3VR2 A;  3L0O A;  2GVB A;  1O7I A;  3NE5 B;  1HUN A;  4MHE A;  2VB2 X;  3IFD A;  1L0X B;  4MNO A;  1V1Q A;  2NVY B;  3AFQ A;  4KKS A;  1JWU D;  4LF8 Q;  1DOM A;  2LFN A;  2UXC Q;  3S14 B;  3M3Y B;  2E74 C;  4AIM A;  4I7A A;  3J80 c;  1BKB A;  1ZKO A;  1BR9 A;  2EY6 A;  5IP7 G;  2PI2 A;  5CR3 A;  5HUR A;  4IQZ A;  1ENF A;  1J5E L;  1K8A C;  1LO5 D;  1Q86 C;  1I3Q H;  3V2T A;  1F9Q A;  5HGQ A;  1H95 A;  1KTK A;  1E1T A;  3KLS X;  4GN5 A;  1HPC A;  2WB1 G;  1SYG A;  1IL2 A;  3I4N H;  2B2W A;  4KD4 A;  5CV4 A;  1KRT A;  4LF4 L;  2ZTD A;  5CMD A;  3GDE A;  3CMA A;  2FMM A;  2A74 C;  1TY0 A;  3FMC A;  1EQQ A;  4OL7 A;  1BOS A;  1Q3L A;  3G71 A;  2OXP A;  5GRO A;  2JA7 H;  3UI2 A;  4X3U A;  1IL8 A;  1M8A A;  2XIW A;  3K6O A;  4EQN A;  3CME A;  4JV5 L;  1R4Q B;  2K50 A;  1PFB A;  4LFC Q;  3HOX G;  2UXB Q;  5IOC A;  5M3F H;  1NJI C;  4HED A;  4KMU C;  3E0E A;  1JJC B;  1AE2 A;  5FLX c;  4HCS A;  1S3O A;  2F3V A;  3PO2 G;  1WYD A;  3D6C A;  1YIJ A;  2EE1 A;  2F3W A;  1QG7 A;  4JW0 A;  1SYE A;  3IFT A;  2KCM A;  1K8M A;  1PTO H;  4IAL A;  5C0X G;  2NBF A;  1I6V C;  3SK4 A;  2DNE A;  4X65 L;  5FLM H;  3OOC A;  1BCP F;  2P5Z X;  2LXK A;  5IYD G;  1MSH A;  2A73 B;  3K80 C;  5KRU A;  2PYK A;  1JQY D;  4R4O A;  4GN3 B;  1JOQ A;  4FXD A;  2BH2 A;  1XMO L;  3J7A V;  1WTH A;  1TS2 A;  5C0X I;  1I94 Q;  4MIU A;  1LT5 D;  4JI1 Q;  5JPM C;  4DR7 Q;  2DN8 A;  2K1B A;  3Q22 A;  5GAH C;  1MKH A;  1JMC A;  5M5Y H;  2DUD A;  5KNB A;  2Q2T A;  1DYQ A;  1NR2 A;  3QOL A;  4C3H B;  3OTO Q;  1JB7 A;  1X3E A;  2K4K A;  1PVO A;  3HOX H;  4DR2 Q;  3J80 L;  1DOL A;  2N55 A;  2F0E A;  3HOU H;  1Q1E A;  2JK8 A;  1Q7Y C;  3RN2 A;  2EXD A;  4LAA A;  5IGE A;  1KLG D;  1J8I A;  4KY6 A;  3M4O H;  3CU7 A;  4XQN A;  1HHV A;  2OQK A;  1G29 1;  2BE5 C;  3K5L A;  3ITP A;  1X55 A;  1EY7 A;  1ZYR D;  1A6X A;  2JJQ A;  4OIJ A;  2AKW B;  3HOW G;  1IBM L;  1PRT B;  4K8I A;  3I55 A;  4DV4 L;  4HCE A;  4NXN L;  3PIO A;  1TII D;  1K83 H;  1LTS D;  1S72 A;  1IXR A;  4K8J A;  4JI8 Q;  4A3I H;  4QF4 A;  4ZCK A;  4OON A;  3NTH A;  4DN4 M;  3GD7 A;  4YHH L;  2WP8 J;  4BY7 B;  4KN4 C;  5C3X A;  4G57 A;  4FNF A;  4JI2 L;  2KEN A;  4QUC A;  5I4D A;  2KHI A;  1WOC A;  3QWN A;  4HID A;  1Y1W B;  1VQI A;  1CKM A;  3M7N A;  4V19 0;  2OCE A;  3HOW H;  3T1Y L;  3DUZ A;  3WWV A;  3Q24 A;  2AUK A;  4DAY B;  5JVH 3;  1XNR Q;  4DAV A;  4A3F B;  2JEA I;  4RAU C;  1GUT A;  5ELE A;  2QDB A;  2NYZ D;  3U58 A;  4GLX A;  1WTR A;  2NVT H;  1K73 C;  1EFI D;  1STE A;  1BBW A;  1X32 A;  1SYC A;  1IHZ A;  1SR3 A;  1SSO A;  5EPK A;  4DK6 C;  2EVB A;  3U4Z A;  1ENA A;  5EKI A;  3S2D H;  1U0L A;  1LTR D;  1SN8 A;  5JJI A;  3PIP 3;  1ZYR C;  1PYW D;  3FEW X;  2EYF A;  5F2D A;  3FDT A;  4Y52 H;  1EYD A;  4LFA Q;  1F2Z A;  3PUY A;  5FLX L;  3W1B A;  3KJP A;  3BVG A;  5FOB B;  4DAM A;  2MNA A;  5FJ8 G;  3HOZ B;  4LFB L;  3HS0 C;  3KLW A;  2BDO A;  2UXD L;  5IP9 G;  2B8F A;  4YWL A;  2ES2 A;  2Y0S B;  2A19 A;  3F2U A;  4MN3 A;  4HIK A;  4P2C B;  3P75 A;  1ZXT A;  4DV0 Q;  3M7G A;  1SNP A;  4PZ8 A;  4EQO A;  4POG A;  2R6G A;  4GOP A;  2K05 A;  1IYJ B;  3TZD A;  2AWN A;  1J9O A;  2E2D C;  1PLF A;  5CV6 A;  4WOR A;  2ALY B;  2RBM A;  5BR8 Q;  4WJ4 A;  3KF6 A;  1S4Z A;  3FP9 A;  2EQS A;  2PQA B;  4BS9 A;  3I4M H;  1VQF A;  1W3S A;  1K8G A;  4HIO A;  3S17 B;  2F0G A;  2K5V A;  4ZYS A;  2I46 A;  1HQR D;  1V1P B;  3EQL C;  3W3A A;  1NSN S;  3ULL A;  2VB3 X;  1GUS A;  1EQR A;  1HFN A;  2EJG C;  2O2L D;  1BBU A;  1I4R A;  1VQM A;  2D9U A;  4ZKC B;  3FKI H;  3HG9 A;  1UUP A;  1FGB D;  3LX0 A;  4L5S A;  5CV5 A;  1HTP A;  1HJP A;  4KLK A;  1G2S A;  4KTA A;  1RTN A;  4ZAI A;  5LL6 S;  1A62 A;  4PV1 C;  3AEV A;  3S9W A;  3PO3 B;  2E5L L;  3K7A B;  5KIX A;  2HHH Q;  3HZX A;  1JOO A;  1E2W A;  4K6L A;  3WOF A;  3ONA B;  4HAE A;  5AJ3 L;  1PFM A;  3T4A C;  2F0H A;  1Q82 C;  4YY3 L;  1WD0 A;  4XT3 B;  3A5U A;  3SEB A;  1VDZ A;  5A2Q E;  4B3S Q;  1TWH B;  4DV1 L;  4RG1 A;  2OWO A;  3I7F A;  3LGJ A;  3IRB A;  3E6Z X;  4I7Z C;  4X3K A;  5JPN C;  1U9R A;  4DR3 Q;  3EN2 A;  5IGF A;  4NPS A;  3H0G H;  3KLS A;  2K5N A;  1A2T A;  1JR0 D;  2KHS A;  3RZO H;  4LF7 L;  4QY7 A;  1I4X A;  1SEB D;  4R4T A;  1A3V A;  2RSN A;  3Q6S A;  4A3J B;  1CA5 A;  1UE5 A;  1DOK A;  2F0O A;  3G7L A;  3MHB A;  2QEJ C;  2E8G A;  1V1O A;  3G4S A;  5T1I A;  3R93 A;  1HZA A;  1XPU A;  1RD9 D;  4MZ9 A;  1XX8 A;  1S5D D;  4EX5 A;  1C48 A;  2A69 C;  4UHV A;  3U9S A;  5M3M B;  5K36 H;  5C0X J;  1BQQ T;  1Q12 A;  1CHQ D;  2WII B;  1GJX A;  4A3M B;  5IYC G;  4DV3 L;  3BG3 A;  3C1E A;  2PZW A;  3VR5 A;  1G2T A;  1BBX C;  4QL5 A;  1QIL A;  1WCM B;  3HEJ A;  5FK9 C;  5I2X A;  4HN7 A;  4JYA Q;  3PF5 A;  3N6R A;  4XT1 B;  3VYR A;  3KF8 B;  1F2L A;  5IYB G;  1ESF A;  5TSS A;  1VQJ A;  3T13 A;  4GNX B;  1WTW A;  1I6H B;  3BU2 A;  3K0Y A;  3ND9 A;  4NB3 A;  5D65 A;  2PQE A;  5C3E G;  2N3S A;  1S40 A;  4LF9 L;  3T56 B;  2PZT A;  3D4W A;  4PZ6 A;  1Z9F A;  4FP5 D;  4A3D G;  1FVI A;  4NW2 A;  4JI6 L;  1HNZ Q;  4O1N A;  5C4Z A;  3R8B A;  5I9P A;  4HTH A;  4P75 A;  4LK1 C;  1P16 A;  2Q2H A;  2IL8 A;  5GAD C;  1S5E D;  5IT9 E;  2VUM G;  4DR6 L;  3Q8D A;  5IYB H;  1LAC A;  4X64 Q;  1YNJ C;  3SE0 A;  3TRZ A;  5G3L D;  4RWS C;  1MGS A;  3M4Q A;  2M9V A;  5DAU A;  1ET6 A;  1XTD A;  5ELB A;  4FXK C;  1Q81 C;  2NZO A;  2J4X A;  5JOB A;  2Y0S G;  4O0A A;  2B2V A;  1TS5 A;  5M3M H;  4K0K Q;  5FLM G;  4ZLT F;  2L4N A;  5IGG A;  4DUY Q;  2Z8L A;  2NZ1 D;  5C5L A;  2PCF B;  1AN8 A;  3GQB A;  3I56 A;  2B2U A;  4U68 A;  1ILP A;  4M8A A;  1K0S A;  5D14 A;  2JEB I;  3PUW A;  1LUZ A;  2AMC B;  1TKW B;  2B63 H;  1VQL A;  1BDO A;  3KLR A;  4LF6 Q;  2VUM H;  1LT6 D;  1VCI A;  1Y1V H;  4L5R C;  4A3D B;  3I3C A;  5EBC A;  3NHH A;  2B2Y A;  1M90 C;  3CCS A;  4OX9 L;  1FNV A;  4OXP A;  1TT2 A;  1WI5 A;  4DR6 Q;  5M3F B;  3HOU G;  2N49 A;  2A6H C;  1SMX A;  5JEA J;  1D5Z C;  2IY5 B;  5AJ3 Q;  3TRE A;  5L37 A;  3URY A;  1SE8 A;  2KVM A;  3TN2 A;  1SFO B;  2KEE A;  2B2U C;  2IX1 A;  1CHP D;  2PZU A;  1E1O A;  2NN6 I;  3B6Y A;  4R4I A;  4DR2 L;  3OHX C;  4LFA L;  5IE8 A;  3H3V I;  5EGT A;  3GTP H;  5ELD A;  4A3K H;  4ZKB B;  2WKC A;  4MTN A;  1VQ6 A;  5IOD A;  3JC6 6;  1E2V A;  2K32 A;  2PNR C;  1TS3 A;  4XQQ A;  3SR1 A;  3S15 H;  3FPP A;  1UNS A;  5BN4 A;  4G7O C;  2Z4H A;  4KN7 C;  1CZW A;  4C3H H;  2UUA L;  2K5H A;  1PTO C;  4R4C A;  1NMG A;  2V1C C;  4FXG C;  3TDQ A;  4JCV E;  1XMO Q;  3G48 A;  3H6M A;  3IL8 A;  2R3Z A;  1FL0 A;  4DNT B;  3DXJ C;  3HKS A;  2WAQ G;  3A56 A;  4C56 C;  2JA9 A;  5COY A;  4P71 A;  2R7Z H;  3VDY A;  2F0F A;  3L2P A;  5J22 A;  1VQA A;  2XN9 C;  4DV2 L;  3KBG A;  2VNU D;  1XXG A;  3D3R A;  2KQ3 A;  4DV7 Q;  4ME5 A;  2R93 H;  4BXX H;  3BS1 A;  3S1N H;  5EBD A;  1PH3 A;  1N34 Q;  1KL9 A;  5M3M G;  3F2B A;  1M1K C;  3CCJ A;  3P1H A;  1EOT A;  2F0W A;  1JC7 A;  4V0B A;  1XPR A;  1HTL D;  2CQA A;  1T5E A;  3G6J B;  2Q8I B;  3DWQ A;  3MXN A;  4G7H C;  4A3F G;  4DKA C;  4P73 A;  3E9H A;  1JWS D;  1H9S A;  4DXG A;  2A6E D;  3J80 i;  4WFN 3;  3CPF A;  2G5D A;  2B2T A;  4LUZ A;  1YI2 A;  2RDH A;  2JP1 A;  4XYO A;  1CM9 A;  4F87 A;  2A5H A;  2DJF C;  5CBE E;  4CDF C;  3R2I A;  4IPG A;  3HOX B;  1I6H H;  3NEN A;  2HHH L;  4KY7 A;  1DM0 B;  1QCB D;  2G9D A;  4L6T B;  4QCL A;  5C5M A;  3EFX D;  1VQ4 A;  1DJR D;  2IWH A;  3J80 E;  2EYP A;  1CI3 M;  3PUV A;  1KAA A;  2EY5 A;  4A3G G;  2B2T C;  4KHP L;  3OW7 A;  4JI3 L;  2IJ0 A;  4XYQ A;  1SMY D;  4AQY Q;  2K75 A;  2VS1 A;  4R9W A;  2XRS D;  4O42 A;  4HJ9 A;  3P20 A;  2N8N A;  2FJ2 A;  1IBL Q;  4IFD J;  4J6H A;  4RCO A;  3BYY B;  1YJ9 A;  2L15 A;  1IKM A;  2UU9 L;  2KUM A;  2PMZ E;  2LMC B;  4OGQ C;  1I5F A;  5I6W A;  3SK6 A;  4DUZ L;  3PUZ A;  4YCU A;  3ULP A;  1NUC A;  2VY3 A;  3KDF B;  4BY1 G;  5IWA Q;  1XWE A;  3U50 C;  1V9P A;  1ICF B;  4DV6 Q;  1N36 L;  2HDM A;  2EYL A;  4IFD H;  1EL0 A;  1CA6 A;  1LTI D;  1EY9 A;  1NBW A;  4JVZ A;  4B3R L;  1SJH D;  4GKJ L;  2DY8 A;  4KJO A;  1K0R A;  1OXX K;  3TSS A;  1LTB D;  2VL6 A;  2ZT9 C;  3GTP B;  1JB3 A;  3GTO B;  3DEP A;  4POF A;  4PZ7 A;  1O80 A;  1SJE D;  4DR4 L;  2I5H A;  3K0X A;  1EYC A;  2R7D A;  2TMP A;  1B3A A;  2D0P A;  4Z9C B;  3MTS A;  1CQV A;  3M4O B;  4H44 C;  3MAQ A;  2C35 B;  2JXM B;  5I6Y A;  3VR3 A;  2K52 A;  4K5X A;  4HMJ A;  3UDX A;  1ICW A;  2IX3 A;  3NSW A;  1STY A;  1EZ8 A;  5JJL A;  4KHZ A;  5CV7 A;  3UDI A;  1EQT A;  4IUT A;  4Q5V A;  2RDF A;  3CCV A;  3A74 A;  4DR3 L;  2K6A A;  2HD3 A;  3FKI B;  3K58 A;  2EY1 A;  3L9A X;  4IFD I;  1SDF A;  3HOV B;  1I3Q B;  1KIX A;  1SYD A;  2EZV A;  1I94 L;  4IPC A;  4UP8 A;  5M5W H;  3CQZ H;  3FVQ A;  3VYS A;  2K04 A;  4H13 C;  1JCK B;  1G91 A;  3CRK C;  1KRS A;  1UE7 A;  3GV6 A;  4NXM Q;  1PZK D;  3RMH A;  1IBK L;  4A4I A;  4JI5 Q;  1PTO D;  1C9O A;  4IOA A;  2B29 A;  4AYB B;  2F0T A;  1Q90 A;  4DXF A;  1QWY A;  5LHY 1;  3MEF A;  3JAM E;  4FF3 A;  3X3M A;  3W2D A;  1C8C A;  1AZP A;  2ZXR A;  3CC4 A;  3A8I E;  4HJ5 A;  2F4V Q;  4DV3 Q;  4F8M A;  2NVY H;  2PNH A;  3TP8 A;  3HOY B;  1GHK A;  3K59 A;  5JVG 3;  3CD6 A;  5C4X G;  5K36 G;  1Y8P B;  3E3X A;  4XIG S;  3Q23 A;  1PXU A;  1PHJ A;  3EBE A;  1VF7 A;  2EDG A;  2XVS A;  4UY8 C;  4JI0 Q;  1NAP A;  3RLN A;  3J7Z C;  1N32 Q;  3MXN B;  1SE2 A;  1TWF B;  4JI0 L;  3CRL C;  4ULL A;  5I9O A;  4NKL A;  2F4I A;  1UAP A;  2Z0S A;  5E4W C;  3NBI A;  4K0K L;  1XPO A;  5DLQ E;  3FHW A;  4A93 H;  4JI3 Q;  4PG3 A;  2PPB C;  1SNQ A;  4WJW A;  2B8G A;  1GUO A;  1HZC A;  4BA1 I;  1QUQ B;  2F4V L;  4A3L H;  1QUQ A;  2J0T D;  2CVR A;  3QB3 A;  1LLR D;  1LT4 D;  2JYO A;  5ELN A;  5GAE C;  5M5X H;  4DAY A;  2NTS A;  1D8L A;  4NMZ A;  4JI5 L;  5C44 G;  2N88 A;  2HQE A;  5JEA H;  5EAY A;  3G6E A;  4R1J A;  3SK5 A;  3T51 B;  4GNX A;  1SRU A;  1HA6 A;  3T53 B;  4C3I G;  4JI1 L;  1B50 A;  2HIV A;  5IYC H;  1X3G A;  1EWC A;  1LV9 A;  5E1F A;  4BBR H;  1EIF A;  2R7Z B;  2K7V A;  4DV5 Q;  1NR4 A;  3A7L A;  4IOC A;  2JA8 H;  2CKZ B;  1D2B A;  3CCR A;  3K5M A;  3SGI A;  3S2H B;  5DM7 3;  5ELF A;  4FYD A;  1F9S A;  1TWG H;  4A3I B;  1EY5 A;  4BWG B;  2O4X A;  4FDB A;  1VQ9 A;  1DGS A;  3NEL A;  4FO2 A;  4BBS G;  3GTL B;  3RZO B;  1KNE A;  3VR6 A;  2F03 A;  1VQG A;  1U5K A;  3GTM B;  4XXE A;  3S15 B;  2CHB D;  1VQE A;  3DLL A;  1HQM C;  1STG A;  1ONL A;  5ELO A;  2EJF C;  4JK1 C;  2H4O A;  2E2J H;  1TWA H;  2UUC L;  2XWJ B;  2WAQ E;  3TP6 A;  3MA2 B;  2JA7 G;  2EPB A;  2NTT A;  2OEO A;  3HKZ G;  3HRZ C;  4YWK A;  3WOE A;  3CQZ B;  1N36 Q;  1AFP A;  2B2V C;  2ENB A;  1B9N A;  1W6J A;  5E3F A;  4Q0F A;  1CKO A;  4RCN A;  2A1A A;  3D4R A;  1SYF A;  4NXM L;  2Z4I A;  1UE6 A;  2OQ0 A;  2JN4 A;  5J1Z A;  1SFO H;  1CSQ A;  1WCM G;  1Z47 A;  4JI6 Q;  2ID0 A;  3JAM i;  4H0L C;  1NTG A;  3MXP A;  2Q2U A;  2VQE L;  1V1P A;  1EEF D;  3PO2 B;  5NUC A;  3FPU B;  4HR7 B;  3RLF A;  3UDF A;  1BNZ A;  1RL2 A;  1OXT A;  5EKL A;  2UUB Q;  2BOS A;  4X3S A;  1KAW A;  3GTK B;  3GTL H;  4O2D A;  1Y1V B;  4APV A;  1R9T B;  1BCP D;  1STH A;  1U4P A;  3C3L A;  3AMU A;  2NWG A;  3CXC A;  2EYM A;  1TWA B;  2OTL A;  1EIH A;  3NP8 A;  4JBW A;  4OO1 G;  4A3J G;  1N33 L;  4BBS H;  1WD1 A;  1KDC A;  2TSS A;  2LSS A;  1YNX A;  4QB4 A;  1DD2 A;  1YHA A;  4XDX A;  2B63 G;  5FO9 B;  4ODG A;  1X9N A;  2XRQ D;  1ILQ A;  3QG1 A;  3NUC A;  2E76 C;  1KHI A;  1SMY C;  5KND A;  4CBV A;  4ABN A;  1GD7 A;  3BDL A;  3BVZ A;  3CCQ A;  5BN5 A;  3T1H L;  3S2H H;  2WIN B;  1B53 A;  5IWA L;  4C3H G;  3C46 A;  5GAG C;  5J39 A;  1YJW A;  1PH7 A;  1HXY D;  3F8T A;  5C0X H;  3DEO A;  5FKA C;  3MXG A;  2NB0 A;  3D0F A;  3H15 A;  5M5X B;  1B7Y B;  1TQO A;  2MGS A;  3H3V H;  2EOT A;  4DK3 C;  2YU9 H;  1SAP A;  4G4K A;  3IAY A;  4B3T L;  3MXU A;  4RKB A;  1D1I A;  3R3O A;  4QQB X;  4JI7 Q;  1IZ6 A;  1H9J A;  1MI2 A;  1K28 A;  3QJY A;  4C2M H;  1JT8 A;  1D7Q A;  2ZXP A;  2F0Q A;  4RH6 A;  4LF5 Q;  1N9W A;  1MSG A;  4KD3 A;  1A15 A;  1JIC A;  2B39 A;  1GHJ A;  1HNW L;  3S1M H;  1SNC A;  1QE6 A;  1FYC A;  1CKN A;  1EEI D;  3ERQ A;  5CGK A;  1BF4 A;  4A93 G;  3CCL A;  3C1F A;  4HJ8 A;  1CSP A;  3PMF A;  3AB9 A;  2QEX A;  3NEM A;  2VW9 A;  3I91 A;  2G9H D;  4LW1 A;  4DR5 Q;  3PIP A;  2SDF A;  1YNN C;  3E9I A;  3K8A A;  4UP7 A;  4NP5 A;  2I5M X;  1HZ9 A;  3QIA A;  1V43 A;  4IUU A;  4IUN A;  2QA4 A;  3HOY H;  4R8N A;  1FR3 A;  4A3G B;  1EY8 A;  2F0P A;  5C44 B;  3D6W A;  4J1M A;  5FO8 B;  5ISR A;  4M1U B;  1Q8K A;  1VQ8 A;  3AU7 A;  1G51 A;  2AUJ D;  1Y1V G;  4CJ2 C;  2YTV A;  2O5J C;  1QOH A;  4B3S L;  4JI4 Q;  3ZYY X;  1BO0 A;  4FF1 A;  1Q46 A;  3HOV H;  4B3M L;  1STN A;  2D62 A;  4PMC A;  2ZTE A;  3H0G B;  3ND8 A;  3CW2 C;  4K2K A;  2YTY A;  3LWE A;  1ET9 A;  1FNW A;  1O78 A;  2RKS A;  3NTK A;  4DR5 L;  4IUQ A;  2N78 A;  4L5T A;  5KNC A;  3PV0 A;  3S1Q B;  3VA5 A;  1FJG L;  1EOV A;  2VXW A;  4KKU A;  3GP7 A;  1A8V A;  1SNM A;  1RCV D;  1NY4 A;  1T5X D;  1VQP A;  1NE3 A;  1Q8I A;  4RGO S;  4LFB Q;  1IYV A;  3HFZ B;  1B2T A;  1EIY B;  4AYB E;  3PIO 3;  4BA2 I;  5AFW A;  4YHH Q;  5ELC A;  2GA4 B;  4P72 A;  3KJO A;  2E2I H;  5IT9 c;  5C3E H;  3CPW A;  1ASZ A;  2Y0S E;  1ZEQ X;  3CCM A;  4E6I A;  1OTC A;  4PMW A;  1PRT D;  1VQK A;  4UDU C;  3STB D;  1OXS C;  3ZJY C;  3Q0A A;  3NPP A;  3I90 A;  2R93 G;  1V8Q A;  2LS0 1;  4A3D H;  4LMQ D;  2YV5 A;  2CWA A;  5A2Q L;  3I70 A;  4A76 A;  3CAM A;  1UEB A;  4KV6 A;  3GTJ H;  2R7Z G;  5CBA E;  3A8J E;  3H91 A;  3KFU A;  4KY5 A;  3S17 H;  2H5X A;  4RA8 A;  2E2J B;  1B9M A;  2F0U A;  3HOV G;  2JA8 B;  2IPK D;  2NZH A;  3EJI A;  3SK8 A;  1XNQ L;  4A3E G;  2L12 A;  3GTM H;  2ZJR A;  2E5L Q;  4A3I G;  4DF7 A;  2D2C C;  3AFP A;  2FXQ A;  1QNK A;  4G7Z C;  5C4X H;  4CJ0 B;  5I2Y A;  2NVX H;  2RCF A;  3OIP A;  1DXM A;  1Y8O B;  4BBR G;  1O7Z A;  5IYD H;  3NBH B;  3S1R H;  4IUR A;  5C4H A;  2XGT A;  1KAB A;  4CKB A;  4RFB A;  1EWI A;  1DZ1 A;  3GTG H;  1PMR A;  1C4Q A;  3U4V A;  5LMN Q;  1Y1W G;  3FRP B;  4DR1 Q;  1KC8 C;  4N8X 1;  4AH6 A;  2FFK B;  1D1K A;  1SE3 A;  4K14 A;  2LY7 A;  2Z6K A;  2R7F A;  2F0D A;  3MVV A;  4WJ3 M;  4KHV A;  5CV8 A;  1JWM D;  1PRT F;  5E4X A;  2E75 C;  4TSS A;  2RCN A;  4QJF A;  3NQI A;  4DUY L;  1IBL L;  2ZTC A;  1BCP B;  2ASB A;  2MHV A;  2JSO A;  2I5L X;  3S2D B; 
#chains in the Genus database with same CATH homology
 4DV6 Q;  1N36 L;  3HOZ H;  4UP9 A;  1KXL A;  1W2B A;  4JI2 L;  2KEN A;  4OO1 I;  2KHI A;  1FGU A;  1WOC A;  1NBW A;  3RNU A;  4DV7 L;  4HID A;  4B3R L;  4GKJ L;  1VQI A;  4C3J H;  3CCU A;  4GOP C;  1CKM A;  3M7N A;  1K0R A;  1OXX K;  2OCE A;  2VL6 A;  2UXD Q;  2GN5 A;  3M85 A;  3HOW H;  1TWC H;  4A3F H;  3M4P A;  3T1Y L;  4POF A;  4PZ7 A;  3WWV A;  2I0Q A;  4DR4 L;  4DAY B;  2I5H A;  3K0X A;  1XNR Q;  2R7D A;  2JEA I;  4B3M Q;  2D0P A;  5LMU Q;  3J81 c;  4AYB G;  2C35 B;  3U58 A;  4GLX A;  2JQO A;  2K52 A;  3AQQ A;  3KF6 B;  1K73 C;  2NVT H;  4C3I H;  3UDX A;  1BBW A;  2RHS B;  4A3C H;  4X66 Q;  2QGQ A;  2RF4 A;  2XTI A;  1SR3 A;  2ZM6 Q;  3OTO L;  4JI4 L;  1X56 A;  4KHZ A;  5JJL A;  4DK6 C;  3UDI A;  5IY0 A;  4IPD A;  1K3R A;  1SRO A;  3U4Z A;  3A74 A;  1YEZ A;  3CCV A;  4DR3 L;  4JBK A;  3S2D H;  4X6A H;  1U0L A;  1E24 A;  1SN8 A;  2RHQ B;  5JJI A;  2HT1 A;  4IFD I;  5E7N A;  2JA5 H;  1L2F A;  1KIX A;  3OW2 A;  1I94 L;  3CC2 A;  4IPC A;  4YY3 Q;  2VQE Q;  4UP8 A;  5M5W H;  3CQZ H;  1VQ5 A;  4Y52 H;  3J81 j;  4JG2 A;  4DR4 Q;  1KRS A;  1UE7 A;  4LFA Q;  1N32 L;  3PUY A;  1YIT A;  4NXM Q;  3W1B A;  3KJP A;  3ICE A;  1B70 B;  1JE5 A;  4DAM A;  1IBK L;  4A4I A;  4JI5 Q;  1PH8 A;  2MNA A;  1C9O A;  4IOA A;  1H95 A;  5FJ8 G;  1Y14 B;  2B29 A;  1PA6 A;  3PO3 G;  2MFI A;  3MEF A;  1N34 L;  4LFB L;  5LMU L;  3T1Y Q;  1VQD A;  4QGU A;  1J5E Q;  3KLW A;  3CC4 A;  1XNR L;  2UXD L;  1MIU A;  4YCV A;  5IP9 G;  4HJ5 A;  2LXJ A;  4YWL A;  3F2D A;  4DV3 Q;  4HIM A;  3RN5 A;  2F4V Q;  4JI2 Q;  2ES2 A;  4UPA A;  2A19 A;  3ER0 A;  1VQN A;  2NVY H;  4HIK A;  4GLV B;  2PNH A;  2YYZ A;  1YZ6 A;  1EUJ A;  4DV0 Q;  4DV2 Q;  1FJG Q;  1A63 A;  3CD6 A;  4EQ5 A;  1HNW Q;  4LF8 L;  2B3G A;  4PZ8 A;  4JI8 L;  4LF6 L;  5C4X G;  5K36 G;  4POG A;  2R6G A;  2ATW A;  1MJE A;  3S24 A;  4GOP A;  2R92 H;  1Y1W H;  2UXB L;  4GOP B;  1P8L A;  1WJJ A;  4XIG S;  4GN4 B;  1IYJ B;  1PHJ A;  4IJL A;  3EBE A;  4UY8 C;  2AWN A;  3F2C A;  4JI0 Q;  3RLN A;  3J7Z C;  1N32 Q;  3MXN B;  1BVS A;  4DV4 Q;  1QVF A;  4JI0 L;  2ALY B;  1HZB A;  5BR8 Q;  4WJ4 A;  1LYL A;  3KF6 A;  1EFW A;  3FP9 A;  4TVA B;  3AYH B;  2EQS A;  2PQA B;  3I4M H;  1G6P A;  1VQF A;  1W3S A;  1K8G A;  2Z0S A;  4HIO A;  4BY1 H;  4K0K L;  1XPO A;  3M3Y H;  2K5V A;  1VS0 A;  5DLQ E;  2F3I A;  2IX0 A;  3FHW A;  4AQY L;  3ULL A;  3PO3 H;  5IP7 H;  4DV5 L;  5JEA G;  4OWX B;  1EQR A;  4A93 H;  4JI3 Q;  4PG3 A;  4L5Q A;  4RMF A;  1BBU A;  3S1Q H;  1LTL A;  2IT1 A;  3CCE A;  1VQM A;  4IPH A;  4DV1 Q;  3FKI H;  4L5S A;  1E3P A;  1HZC A;  2MQH A;  1QUQ B;  4BA1 I;  3RZD H;  2F4V L;  1NMF A;  1QUQ A;  4A3M G;  4A3L H;  1UWV A;  4J15 A;  3ERS X;  4A3B G;  1HJP A;  4JOI A;  4KLK A;  5ELN A;  3ULJ A;  4QIW E;  5GAE C;  5M5X H;  2JA5 G;  1PH7 A;  1A62 A;  3AEV A;  1D8L A;  4JI5 L;  3A5Z B;  2E5L L;  2JA8 G;  4LFA L;  5C44 G;  4A3G H;  5EAY A;  3G6E A;  1PH4 A;  2HHH Q;  4R1J A;  4GNX A;  4A75 A;  1N33 Q;  1SRU A;  5AJ3 L;  1GM5 A;  1EYG A;  4A3C G;  1GVP A;  2YTX A;  1Q82 C;  4YY3 L;  2IHE A;  3A5U A;  1T9H A;  4JI1 L;  2HIV A;  5IYC H;  4B3S Q;  1X3G A;  3I2Z A;  4X62 L;  4A3B H;  4DV1 L;  4RG1 A;  2UUB L;  2OWO A;  3I7F A;  1HNX Q;  3LGJ A;  1TWH H;  3K81 C;  4BBR H;  1EIF A;  4IO9 A;  3TS0 A;  1LM0 A;  2MO1 A;  3IRB A;  1PH2 A;  1L1O B;  4DUZ Q;  2K14 A;  1L1O A;  3PCO B;  5M3F G;  4DR3 Q;  4H02 A;  3EN2 A;  4DV5 Q;  1YHQ A;  4IOC A;  2JA8 H;  2WFW A;  3PUX A;  2CKZ B;  4NPS A;  3J7A 5;  2BH8 A;  3H0G H;  5C4J H;  3CCR A;  3SGI A;  2K5N A;  1CUK A;  1Q1B A;  3RZO H;  4LUV A;  4LF7 L;  4QY7 A;  4R4T A;  4JI7 L;  2Z6K C;  4X65 Q;  2NVQ H;  1UE5 A;  2CCZ A;  1TWG H;  4GNX C;  3CC7 A;  3UE1 A;  1MJC A;  5J3B A;  2E8G A;  4FDB A;  1VQ9 A;  1DGS A;  3NEL A;  1PV4 A;  3HOZ G;  3G4S A;  1VQB A;  4BBS G;  2PQA A;  1K9M C;  1HZA A;  1U5K A;  1VQG A;  1XPU A;  4MZ9 A;  1YBY A;  4DNI A;  1VQE A;  2E2H H;  1TWF H;  3DLL A;  3FKI G;  4IJH A;  4EX5 A;  5ELO A;  3BZC A;  4HJ7 A;  2E2J H;  4KHP Q;  1TWA H;  2EIF A;  2UUC L;  3W5O A;  5C0X J;  3S16 H;  2WAQ E;  1Q12 A;  1KD1 C;  2JA7 G;  3HKZ G;  1HH2 P;  4YWK A;  5IYC G;  1N36 Q;  1CKN B;  4DV3 L;  4ME3 A;  1PH1 A;  4Y7N H;  2D0O A;  4QL5 A;  4DR2 L;  1X6O A;  4DV6 L;  2OTJ A;  1YHB A;  2KHJ A;  1IBK Q;  3UE0 A;  2UXC L;  1CKO A;  2A1A A;  4JYA Q;  1RIP A;  4JOI C;  2WB1 E;  1PH5 A;  4NXM L;  3PF5 A;  1PH9 A;  1UE6 A;  2OQ0 A;  4LFC L;  3KF8 B;  1YJN A;  3CP0 A;  3H0G G;  1CSQ A;  1WCM G;  1Z47 A;  5IYB G;  1SFO H;  1XNQ Q;  1ASY A;  4JV5 Q;  4JI6 Q;  1VQJ A;  2ID0 A;  3JAM i;  3TQY A;  4GNX B;  1HNZ L;  3K7U C;  1NTG A;  4LF7 Q;  2Q2U A;  4NXN Q;  2VQE L;  1VQ7 A;  3BU2 A;  1PH6 A;  4NB3 A;  4R4Q A;  2N3S A;  5C3E G;  4DR1 L;  1XMQ Q;  1S40 A;  3RLF A;  3UDF A;  1RL2 A;  3HOY G;  4LF9 L;  1OXT A;  2Q2I A;  4LWC A;  2UUB Q;  1PFS A;  4LF4 Q;  2UUA Q;  1KAW A;  2VZA A;  5IP9 H;  3GTL H;  2ZM6 L;  2CFM A;  4O2D A;  1HNX L;  4APV A;  4PZ6 A;  3STB C;  1Z9F A;  3CXC A;  1JJG A;  1HR0 Q;  1FVI A;  4X66 L;  4A3E H;  4A3J H;  4A3D G;  1R9T H;  3T1H Q;  1WFQ A;  1L1O C;  4JI6 L;  2CQO A;  3GTK H;  4OWW B;  2OTL A;  4LNQ A;  3TS2 A;  4JBW A;  4ALP A;  1HNZ Q;  4A3J G;  4OO1 G;  4JC0 A;  1N33 L;  4BBS H;  2LSS A;  1YNX A;  4P75 A;  1YHA A;  2B63 G;  3W1G A;  1P16 A;  2Q2H A;  1X9N A;  4BY7 H;  1I50 H;  5GAD C;  1QVC A;  2MO0 A;  1QVG A;  2VUM G;  3JAM c;  4DR6 L;  4JYA L;  1KHI A;  1TXY A;  2BA0 A;  3Q8D A;  5IYB H;  4B3R Q;  4GKJ Q;  5H1S E;  1GD7 A;  4X64 Q;  2UUC Q;  5LMN W;  3CCQ A;  3TRZ A;  2NN6 G;  2ZJQ A;  3T1H L;  3S2H H;  4GLA C;  2IHF A;  3M4Q A;  5IWA L;  1VQO A;  4A3K G;  1HR0 L;  2KBN A;  4LF5 L;  1XTD A;  3GTO H;  5GAG C;  1KQS A;  1Q81 C;  3PO2 H;  2HIX A;  2NZO A;  2VQF Q;  2DGY A;  3CF5 A;  4DPG A;  4HJA A;  1YJW A;  3F8T A;  4GS3 A;  2Y0S G;  4O0A A;  2AHO B;  1XJV A;  1N8R C;  4OX9 Q;  1B8A A;  3D0F A;  3H15 A;  5M3M H;  4K0K Q;  1B7Y B;  5FLM G;  3H3V H;  2YU9 H;  4DK3 C;  3PSI A;  1VQC A;  2JA6 G;  4DUY Q;  3KYH C;  2F52 A;  2UU9 Q;  3L0O A;  2GVB A;  1O7I A;  3PGZ A;  4B3T L;  4MNO A;  3I56 A;  4QQB X;  4JI7 Q;  1IZ6 A;  1V1Q A;  4C2M H;  2JEB I;  3AFQ A;  1LUZ A;  3PUW A;  2AMC B;  1D7Q A;  1JT8 A;  1OXU A;  4LF5 Q;  2B63 H;  4BY7 G;  1N9W A;  4LF8 Q;  4IFD G;  1VQL A;  3BJU A;  3RR5 A;  3UDG A;  2HQL A;  2VQF L;  2UXC Q;  4LF6 Q;  4DV0 L;  2VUM H;  1VCI A;  1Y1V H;  3F1Z A;  4L5R C;  4YWM A;  4AIM A;  1HNW L;  3S1M H;  3J80 c;  1BKB A;  1M90 C;  1CKN A;  3CCS A;  4OX9 L;  4OXP A;  5IP7 G;  4A93 G;  1WI5 A;  4DR6 Q;  3CCL A;  4HJ8 A;  2PI2 A;  2R92 G;  3GTQ H;  3HOU G;  1CSP A;  2N49 A;  1SMX A;  5JEA J;  2QEX A;  2IY5 B;  3NEM A;  2VW9 A;  5AJ3 Q;  3BZK A;  3TRE A;  1J5E L;  4LW1 A;  4DR5 Q;  1SE8 A;  3PIP A;  1K8A C;  3TEH B;  3HKZ E;  1Q86 C;  1I3Q H;  2IX1 A;  3E9I A;  3K8A A;  4UP7 A;  2NN6 I;  3B6Y A;  1E1O A;  1HZ9 A;  2I5M X;  1V43 A;  4R4I A;  5HGQ A;  2JE6 I;  5IE8 A;  2QA4 A;  1E1T A;  4GN5 A;  4TQU S;  3H3V I;  3HOY H;  3GTP H;  2WB1 G;  4A3K H;  4MTN A;  1VQ6 A;  1SLJ A;  2KCT A;  1IL2 A;  3I4N H;  4KI0 A;  4BXX G;  2AWO A;  1KRT A;  5C44 H;  1PYB A;  1Q8K A;  3JC6 6;  3J81 i;  1VQ8 A;  4LF4 L;  2ZTD A;  1G51 A;  3GDE A;  3CMA A;  3S15 H;  1Y1V G;  1XMQ L;  1EQQ A;  3G71 A;  2YTV A;  5GRO A;  2JA7 H;  4GKK L;  4B3S L;  4C3H H;  1GO3 E;  4A3L G;  2UUA L;  2K5H A;  4R4C A;  3CME A;  1NMG A;  2V1C C;  1A0I A;  4JV5 L;  4JCV E;  1QZH A;  1C7Y A;  4JI4 Q;  1XMO Q;  2K50 A;  1YVC A;  3G48 A;  4LFC Q;  1Q46 A;  3HOX G;  1FL0 A;  3HOV H;  2UXB Q;  4B3M L;  5M3F H;  2D62 A;  3HKS A;  1NJI C;  2ZTE A;  2WAQ G;  3E0E A;  2JA6 H;  3CW2 C;  2YTY A;  2PI2 E;  4LUO A;  1JJC B;  1AE2 A;  5FLX c;  2JA9 A;  4P71 A;  1PYS B;  1S3O A;  2R7Z H;  3VDY A;  3L2P A;  4DR5 L;  1VQA A;  2N78 A;  3L7Z C;  4L5T A;  2R7Z G;  3PV0 A;  3PO2 G;  1WYD A;  5HY6 A;  4DV2 L;  1EOV A;  1FJG L;  2VNU D;  4JBM A;  1YIJ A;  1A8V A;  4X64 L;  4DV7 Q;  2R93 H;  1NY4 A;  1VQP A;  4BXX H;  3S1N H;  2KCM A;  1PH3 A;  1NE3 A;  1N34 Q;  4LFB Q;  3HFZ B;  1KL9 A;  3I4O A;  1WCM H;  1EIY B;  4AYB E;  5M3M G;  3F2B A;  1M1K C;  4BA2 I;  3CCJ A;  4YHH Q;  1C0A A;  5C0X G;  4P72 A;  1X54 A;  3KJO A;  2E2I H;  1XPR A;  3I4N G;  1E7Z A;  5IT9 c;  4X65 L;  5FLM H;  5GQO A;  5C3E H;  3CPW A;  2LXK A;  5IYD G;  1ASZ A;  2Y0S E;  3K80 C;  3CCM A;  1OTC A;  4R4O A;  4B3T Q;  1X3F A;  4GN3 B;  4PMW A;  1UE1 A;  4A3F G;  3STB D;  1VQK A;  1OXS C;  2BH2 A;  3ZJY C;  4DKA C;  1XMO L;  1IBM Q;  4GKK Q;  2R93 G;  4P73 A;  5C0X I;  4XTC S;  3E9H A;  1I94 Q;  1X65 A;  4A3D H;  2BA1 A;  2YV5 A;  2CWP A;  1QZG A;  2CWA A;  3PF4 A;  4JI1 Q;  1HR0 W;  4DR7 Q;  1GKH A;  4A76 A;  3J80 i;  3CPF A;  3CAM A;  5GAH C;  1MKH A;  1UEB A;  4JBJ A;  3GTJ H;  5LMN L;  4A3M H;  5M5Y H;  1JMC A;  2DUD A;  3I4M G;  2Q2T A;  1J6Q A;  3KFU A;  3S17 H;  4X62 Q;  2H5X A;  4LUZ A;  3OTO Q;  1YI2 A;  1JB7 A;  1X3E A;  3EIV A;  2ZJP A;  2K4K A;  1PVO A;  4P74 A;  3HOX H;  1AE3 A;  4DR2 Q;  3HOV G;  2NZH A;  1XNQ L;  3HOU H;  1Q1E A;  4A3E G;  2JK8 A;  4IPG A;  3GTM H;  4OWT B;  2ZJR A;  1Q7Y C;  2E5L Q;  4A3I G;  1I6H H;  3NEN A;  5FJ8 H;  3AFP A;  2HHH L;  2FXQ A;  3RN2 A;  2EXD A;  3S14 H;  5C4X H;  2NVX H;  5JJK A;  4BBR G;  3M4O H;  5IYD H;  3NBH B;  1VQ4 A;  3S1R H;  2OQK A;  1G29 1;  3GO5 A;  3PUV A;  2XGT A;  1OXV A;  1X55 A;  3RLO A;  4A3G G;  4KHP L;  1E22 A;  4JI3 L;  3OYY A;  1VQH A;  1EWI A;  3D31 A;  4AQY Q;  3GTG H;  2K75 A;  2VS1 A;  2JJQ A;  3DM3 A;  2AKW B;  3U4V A;  3HOW G;  5LMN Q;  4HJ9 A;  1Y1W G;  1IBM L;  5BR8 L;  4IFD J;  2N8N A;  4DR1 Q;  3I55 A;  1IBL Q;  4DV4 L;  1KC8 C;  4YCW A;  4DR7 L;  4LF9 Q;  4NXN L;  3A0J A;  4AH6 A;  3PIO A;  3U50 C;  1K83 H;  1YJ9 A;  2Z6K A;  2R7F A;  1S72 A;  2A8V A;  1IXR A;  2L15 A;  4WJ3 M;  2UU9 L;  3M9B A;  3K7A H;  4JI8 Q;  1JJ2 A;  2GVA A;  4A3I H;  2PMZ E;  1I5F A;  3KOJ A;  2RCN A;  4OON A;  4QJF A;  4DUZ L;  3PUZ A;  4DUY L;  4YCU A;  1IBL L;  2ZTC A;  3KDF A;  3ULP A;  1AH9 A;  2VY3 A;  3GD7 A;  3KDF B;  4BY1 G;  2WP8 J;  1L0W A;  5IWA Q;  4YHH L;  2ASB A;  2I5L X;  1V9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...