1HR0W

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hr0W00
1N36Q 1Z9FA 1B7YB 2I5LX 4IPDA 4AQYQ 2B29A 2E2IH 3W5OA 2NZOA 4JI4L 2JA7H 3T1YQ 1YZ6A 4BBRG 1VQ5A 5JJIA 3RR5A 4A3LH 4KHPQ 1PFSA 1N36L 1BKBA 4AQYL 5C0XJ 1A0IA 4IJLA 3TRZA 3I4OA 3PV0A 2VUMG 4GOPC 3AFQA 3T1YL 1R9TH 2JA8G 3KF6B 4JI8Q 1PH3A 4POFA 5GAHC 3OTOQ 1X55A 2CFMA 3CQZH 4FDBA 4GOPA 5J3BA 1Q7YC 2ATWA 1AE3A 4KHPL 1K83H 1GVPA 3PO3G 4OO1I 1RIPA 3TS2A 1PH5A 2RHQB 3CPWA 1JJ2A 3KLWA 3K8AA 4JI1Q 3T1HL 1OTCA 4GKKL 2HIVA 1KHIA 1HZAA 2WP8J 3F1ZA 4JI8L 2AMCB 3UE0A 5FLXc 4IO9A 4JOIC 3OTOL 1E7ZA 4A4IA 5M5XH 3AYHB 4DR2Q 4UY8C 1PV4A 3PIPA 3UE1A 4JOIA 4A3CH 2WFWA 4DV0Q 4OWXB 3ULJA 2HT1A 4JI1L 3PCOB 1PH6A 4QJFA 3NBHB 1C9OA 3STBC 3I4MG 1JB7A 4DR4Q 2C35B 3PO2G 4DR2L 1L2FA 1Y14B 1B8AA 2IY5B 1D8LA 1NMGA 4JI0Q 2A8VA 3CC7A 2PNHA 3U4VA 4LNQA 3J7ZC 2MO0A 4DV2Q 2F4VL 4A3BH 5C3EH 5C0XI 1QZGA 3KF6A 4A3MG 1X65A 2PI2A 4C3IH 3OW2A 2ZTDA 1UE7A 3GTQH 1CSPA 2KCMA 3FKIG 4JI2Q 3TEHB 3M85A 3A0JA 2R6GA 4Y7NH 1KXLA 3PUWA 4LFBQ 1IZ6A 5C4JH 5GAEC 4DV3Q 2ID0A 1NE3A 2YTVA 4P71A 4HJAA 3W1GA 3CXCA 3G71A 2UUCQ 3DLLA 3NENA 4A3DH 4JI2L 1YIJA 3BJUA 4YY3Q 1X54A 1QVCA 2WB1G 2KCTA 4BBSH 1KQSA 3UDFA 3IRBA 3PF4A 4DV3L 1OXXK 3K7UC 4JI6Q 3K7AH 2A1AA 2AWOA 4XTCS 2JA6G 3W1BA 5IYBH 3U58A 2KBNA 1K73C 4Y52H 4YY3L 3CMEA 3HOUH 2N8NA 2VY3A 3EBEA 2AKWB 5LMNW 1P8LA 1QUQB 1EFWA 1PHJA 3H15A 1VQNA 4DR5Q 1XJVA 2K50A 2LXJA 3CCVA 3OYYA 1EYGA 2PMZE 4BY1H 2N3SA 3GTJH 1YVCA 4HJ7A 2XTIA 4BBRH 1JJCB 1SR3A 4DV7Q 3PSIA 1XMOQ 4UP8A 5IT9c 4JI3L 2NVYH 1VQOA 2UUAQ 3HKZG 3CMAA 2WAQG 4DR5L 2L15A 1YI2A 4DAYB 3L0OA 1YJNA 1YNXA 1TXYA 5FLMG 4LF8Q 3CD6A 1VS0A 5JEAG 1P16A 3KYHC 3TREA 4X66Q 2JQOA 4R4OA 4DV7L 1VQPA 1XMOL 2KHIA 4LWCA 3HFZB 4PZ7A 4QY7A 5C3EG 1LUZA 4A75A 4LW1A 1Y1WG 1CKNB 1VQKA 2UUAL 3GTLH 2RCNA 4QL5A 3PO3H 2IT1A 3S1MH 2PI2E 3AEVA 1X56A 4DR6L 1E1OA 4X65Q 1Q8KA 3RZDH 1QVFA 3I2ZA 2MQHA 4X66L 4A3IH 2AHOB 3PUZA 3ERSX 4L5QA 1GM5A 1HZ9A 1K0RA 1CKOA 1TWGH 1FL0A 3S1NH 2ZJPA 4AIMA 3CCUA 3WWVA 3ULPA 3U4ZA 1KC8C 3I4MH 3CF5A 1W2BA 4HJ8A 3BZKA 3RN2A 4OX9Q 3PO2H 3J80c 3K0XA 4GKJQ 3S2HH 3M7NA 1IXRA 1B70B 1IL2A 4UP9A 1WCMG 5M3FH 3F2DA 2OQKA 2F3IA 5E7NA 1X3GA 1KRTA 5IYBG 1NJIC 3CCLA 4OX9L 2IHEA 3HOUG 4OONA 1V1QA 4GKJL 3TS0A 4DR7Q 1ASZA 3CC2A 1MIUA 1SLJA 1CKNA 1ASYA 3FKIH 1PH4A 1HNWQ 4AYBG 1S40A 4L5RC 2JJQA 4DPGA 2UXCQ 4BY1G 1N9WA 1QZHA 4JYAQ 2UXDQ 4IFDJ 4LFAQ 4UP7A 3CAMA 3H3VI 1IBMQ 1WI5A 3JC66 1VQAA 4JI5Q 4DR7L 2OTLA 2PQAB 2E2JH 3EN2A 1LTLA 4DV6Q 1TWAH 1GO3E 1OXVA 1UE5A 2NN6I 1WYDA 1SFOH 2OQ0A 4A3FG 1YJWA 1HNWL 1VQ9A 4LUOA 4JYAL 1E24A 1KL9A 3BZCA 4HIDA 2UXDL 2VQEQ 4LFAL 1TWFH 1IBML 4JI5L 5JJLA 3VDYA 5AJ3Q 4R1JA 4DV6L 3J81j 4MZ9A 2JA6H 4R4CA 4P72A 3HOYG 2YTXA 5IY0A 2B3GA 2HQLA 3CCJA 4HJ9A 1IBKQ 2VQEL 2D62A 1YBYA 3CW2C 4JBWA 4LF9Q 4A3GH 5LMNQ 1L1OC 5AJ3L 4A3IG 1I5FA 2UXBQ 4DV4Q 2Q2HA 1L1OA 2Q2UA 4NXMQ 3J7A5 4R4IA 4LF5Q 1VQFA 2NZHA 3J80i 1Q1BA 1IBKL 1JMCA 4LF9L 3J81c 5LMNL 1QVGA 3CCRA 4DUYQ 3RLOA 2FXQA 3HOVH 2PQAA 1SN8A 3I56A 2ZJQA 2UXBL 4DV4L 5IYDG 3F2BA 1S72A 1MJCA 2IHFA 2K75A 2YV5A 4OXPA 1M90C 5M3FG 5FLMH 4NXML 4LF5L 1X3FA 1SROA 4DV0L 2DUDA 1Y1WH 4DR4L 1FVIA 1J6QA 2VL6A 4OWTB 4DUYL 1MJEA 4JBMA 4C3JH 5IP9G 3A74A 3FHWA 1A8VA 5LMUQ 4JI0L 3KDFB 3I4NG 3KOJA 2I0QA 1Q86C 3RLNA 1UWVA 2V1CC 2IX0A 3M4QA 4DK6C 1HH2P 3S1QH 3PUXA 4A93H 3GD7A 3ULLA 1NY4A 4DV2L 3I55A 2R93G 4B3RQ 1LM0A 2JEBI 4B3SQ 1Q12A 3D0FA 5LMUL 3GTKH 5IP7G 2AWNA 1WFQA 3CC4A 5C4XG 2A19A 3KJPA 2JA5G 4LFBL 1A63A 1KIXA 3EIVA 4BA2I 1HNXQ 3BU2A 1VQHA 1Y1VG 2JE6I 3MEFA 1VQGA 4B3TQ 1WCMH 2VQFQ 4B3SL 4K0KQ 2Q2TA 2UUCL 4MTNA 2WB1E 3L2PA 1OXUA 2BA0A 1T9HA 1BBUA 2Y0SG 2DGYA 5IWAQ 1I3QH 1G6PA 1Q81C 1K9MC 3A5ZB 1GKHA 4P73A 5ELNA 3F2CA 2VQFL 4GNXB 4B3TL 1HR0Q 4LFCQ 4A3GG 4K0KL 4JI6L 1O7IA 4PZ8A 2QGQA 1J5EQ 1N32Q 3RLFA 3DM3A 4DUZQ 4L5TA 3CCQA 3J81i 4GLXA 3UDGA 1KAWA 2Z0SA 4WJ3M 1VQJA 5EAYA 5IWAL 1VQIA 1VQ4A 5GAGC 2B63H 4C2MH 1YHQA 4LFCL 3H0GH 3M4PA 3Q8DA 2UUBQ 4A3BG 4A3FH 5HGQA 3HOVG 4B3MQ 3NEMA 4YCUA 2QA4A 1J5EL 4BXXG 1N32L 4YCWA 4DUZL 2EXDA 4YWKA 4QGUA 4ME3A 1N33Q 1VQEA 3HKZE 1I6HH 2LSSA 2WAQE 2F52A 1XTDA 2UUBL 1YHBA 3HOYH 3KFUA 2E8GA 4B3ML 1IBLQ 2OTJA 2H5XA 4YCVA 4LF8L 1CUKA 3CCEA 4J15A 4GLVB 4A93G 3M3YH 3G4SA 1YITA 1HZBA 1QUQA 1UEBA 4TVAB 4EQ5A 4DR3Q 1IBLL 1LYLA 1PH1A 3E9IA 1EUJA 3HKSA 3NELA 1GD7A 4QIWE 4APVA 1XPOA 4X65L 1N34Q 1MKHA 4YWMA 4LF6Q 1SMXA 5JEAJ 3S16H 3GTPH 4IPGA 1EIFA 5IYCG 1FGUA 1TWCH 4JG2A 4LF7Q 5IYDH 5FJ8H 2RHSB 1X6OA 2I5HA 1AE2A 4GLAC 2ZJRA 1RL2A 1U5KA 3FP9A 4DV1Q 4DR1Q 1K8AC 5M3MG 1C7YA 4LF4Q 4OO1G 4B3RL 1N34L 2MFIA 4KHZA 5IE8A 4A3KH 4NXNQ 2RF4A 5IP9H 1V9PA 4X62Q 4LF7L 2R7ZG 1OXSC 3LGJA 1HR0W 4DV1L 3G48A 3I4NH 4LF4L 1CKMA 2N49A 1N8RC 1A62A 2JA9A 2R93H 1WJJA 3CCMA 4L5SA 2VNUD 3S14H 4X62L 1Q46A 1PA6A 5H1SE 4AYBE 2B63G 1NMFA 1PYSB 2OWOA 3H0GG 5IP7H 4DV5Q 1YHAA 4GOPB 1W3SA 1WOCA 3CP0A 4P75A 5C4XH 1JE5A 4LUZA 2JA5H 2UXCL 3HOXH 1EQQA 1Y1VH 2JK8A 5C0XG 4HIKA 4KI0A 1Q82C 2BH2A 3ICEA 4RMFA 1BBWA 5GADC 3RN5A 4JI4Q 4OWWB 1XNQQ 2KENA 5ELOA 5BR8Q 4JV5Q 1C0AA 4DV5L 1DGSA 3TQYA 1V43A 1KD1C 1VQ6A 1PVOA 2GVBA 5C44G 4IPCA 1K3RA 4O0AA 1XMQQ 2NVQH 1XNQL 4IJHA 5BR8L 4JV5L 4R4TA 3A5UA 4P74A 2VW9A 2MO1A 4XIGS 2NVXH 3L7ZC 2CQOA 5JJKA 1EOVA 2JEAI 1XMQL 2HHHQ 1PYBA 4HJ5A 2YYZA 1CSQA 2KHJA 4A76A 3T1HQ 1XPUA 3HOWH 1SRUA 1XPRA 2ES2A 4GKKQ 5GQOA 4BXXH 4IFDI 3S2DH 2XGTA 2I5MX 5FJ8G 2E2HH 1D7QA 4A3JG 3RZOH 5HY6A 3SGIA 1VQBA 2CWPA 4EX5A 4A3KG 2HHHL 1IYJB 2VZAA 4C3HH 1HJPA 4NB3A 3KF8B 1SE8A 1AH9A 2VS1A 3HOZH 2N78A 3H3VH 2IX1A 2YTYA 4X64Q 2K14A 1E3PA 3JAMc 4AH6A 2EIFA 1VCIA 3S15H 1Q1EA 3GTGH 2QEXA 2F4VQ 1EWIA 2GN5A 1FJGQ 3GTOH 2R7DA 2NVTH 5M5WH 4BY7G 4X64L 4GN4B 5IYCH 2LXKA 2Z6KC 3M9BA 3HOXG 4JI7Q 3G6EA 4NPSA 3S1RH 4A3EG 3S24A 2Z6KA 1TWHH 2ZM6Q 1G51A 3MXNB 4PG3A 5M3MH 1FJGL 4DNIA 2E5LQ 3K81C 3PUYA 1NBWA 2ASBA 3PGZA 3ER0A 4TQUS 1HNXL 4JI7L 2R7ZH 4QQBX 3D31A 1PH9A 2OCEA 3F8TA 2EQSA 3ZJYC 2ZM6L 2JA7G 5K36G 1EIYB 4YHHQ 2Y0SE 3KDFA 2E5LL 1VQCA 2R92H 2K52A 2ALYB 3I7FA 4A3LG 2BH8A 4O2DA 1XNRQ 1S3OA 3PIOA 4YWLA 2CWAA 1G291 4IPHA 1HR0L 3HOWG 4DAMA 3PUVA 1VQLA 4WJ4A 2GVAA 4YHHL 2K5NA 2CCZA 1M1KC 4R4QA 1VQMA 1I94Q 4GN5A 4GN3B 1XNRL 3S17H 4ALPA 1YJ9A 3AQQA 2K4KA 2K5VA 4BA1I 3PF5A 4H02A 1KRSA 3U50C 4KLKA 4DK3C 4JI3Q 1PH8A 2HIXA 3JAMi 5C44H 3HOZG 1I94L 4GNXC 1N33L 4A3CG 1L0WA 1VQ8A 4RG1A 3AFPA 2NN6G 4GNXA 3CPFA 1E1TA 1BVSA 5DLQE 3CCSA 3E0EA 1VQ7A 4LUVA 4JCVE 2K5HA 4X6AH 3GDEA 5GROA 2R7FA 1PH7A 3UDXA 4DR6Q 2VUMH 2CKZB 3GTMH 3KJOA 2JA8H 1VQDA 2D0OA 1JT8A 1YEZA 4DR3L 1E22A 4A3JH 3GO5A 4LF6L 1I50H 3B6YA 3UDIA 5M5YH 1PH2A 2MNAA 3M4OH 1H95A 2BA1A 1K8GA 1JJGA 4HIOA 4IOAA 4DR1L 1NTGA 4MNOA 4PZ6A 1UE1A 2YU9H 4JBJA 2R92G 4NXNL 4A3DG 1X3EA 3E9HA 4GS3A 4DKAC 1UE6A 4IFDG 1X9NA 4BBSG 2ZTCA 2UU9Q 4BY7H 2Q2IA 3STBD 1HNZQ 1EQRA 3RNUA 1OXTA 4IOCA 1HZCA 4HIMA 4A3EH 2ZTEA 1Z47A 3K80C 4PMWA 2D0PA 4A3MH 1U0LA 2UU9L 4UPAA 4JC0A 1L1OB 1HNZL 4JBKA 4POGA
chains in the Genus database with same CATH superfamily
5KYIA 3E0JA 1GXDC 2NZOA 1EZ8A 4BBRG 2Q8RE 4OHJA 2IWHA 1N36L 5LL6S 1RJTA 1Q90A 1W6JA 3TRZA 1IYVA 3PV0A 2OF1A 5KNCA 4GOPA 3OTOQ 3CQZH 3MXPA 1TIID 4LMQD 1Y1WB 5C3EB 3PO3G 4C3IB 2CQAA 4GKKL 2HIVA 4IUTA 1KHIA 2WP8J 4GZYC 1BNZA 2B39A 4JI8L 5FLXc 4DR2Q 3C46A 4JOIC 4QIWB 3D4DA 5M5XH 3AYHB 1PV4A 3UE1A 2F0NA 2KCNA 1PH6A 3STBC 4DR4Q 2JN4A 3FPPA 4JI0Q 1KNEA 5IT9L 2Z6BA 2K33A 4L8JA 5LHY1 1PTOB 2F4VL 2AQ2B 3VR6A 3KF6A 1GUTA 3C3LA 1X65A 2PI2A 3OW2A 3AB9A 2H1EA 4H7BA 2KCMA 3TEHB 4JI2Q 1KXLA 4BY1B 4FXDA 3H09A 2OT2A 2L5TA 2EYMA 1QVCA 2NVYB 3LNNA 1CA5A 2LFNA 4DV3L 1OXXK 4RAUC 3BVMA 2F03A 3K7UC 2EJMA 3K7AH 1EY0A 4XTCS 5IYBH 2ZXPA 3BS1A 2G9HD 4DU9A 2AKWB 4EQNA 5KYLA 3S1MB 1QUQB 1EFWA 1HHVA 2EPBA 2JSOA 2LXJA 3OYYA 1EYGA 1YVCA 3MEHA 4DV7Q 2X69A 1XMOQ 5E3FA 2WAQG 1S5FD 4KMUC 3L0OA 4U68A 1YNXA 1SE4A 1VS0A 1EY8A 2J0TD 3KYHC 3TREA 2JQOA 2KHIA 4WFN3 1JWUD 3C1EA 4PZ7A 4KHVA 2PCFB 3OMGA 1MD2D 5KNDA 1A2TA 3KK7A 4X65Q 1Q8KA 3RZDH 3I4NB 2CVRA 4X66L 2AHOB 3D3RA 3PUZA 3ERSX 1GM5A 1K0RA 1L0XB 1TWGH 4OIKA 2A6HD 2R93B 1EYAA 3I4MH 1STNA 3FEWX 4HJ8A 3PO2H 5DM63 3S2HH 2JA5B 1Y8PB 1B70B 1F2LA 4UP9A 1WCMG 3BDOA 5M3FH 1S5BD 1HA5A 1TWFB 1H9RA 5E7NA 3WDNA 5FKAC 3VYTA 5IYBG 1NJIC 3CCLA 1GUWA 4OONA 5FOBB 2BOSA 4WJWA 4DR7Q 3I91A 4AYBG 1S40A 2NVQB 4DPGA 3TP6A 3CAMA 1IBMQ 1WI5A 2K01A 3JC66 2A6ED 1ENFA 4DV6Q 1TWAH 3MXGA 1SFOH 1UE5A 1HNWL 2OQ0A 1HFNA 1WTXA 3O13A 2DN8A 3A7LA 1EIGA 1IKLA 1QILA 4KD3A 2J7ZA 4ZUJA 5AJ3Q 4K5VA 3CCJA 2VB3X 3E5SA 4A3GH 5LMNQ 3SK5A 1PTOD 1NAPA 5FK9C 5CV8A 2UXBQ 4A93B 2DNCA 4LF5Q 4MIUA 2NZHA 5CV6A 3J80i 1IBKL 5DEHA 4R8NA 4DUYQ 4FXGC 4C1NK 4IN3A 5J22A 2IHFA 2YV5A 3FPUB 1QE6A 5M3FG 3S1RB 1MHWC 1Y1WH 2EY1A 1J6QA 1TS4A 1MJEA 4DR4L 5IP9G 3SDZA 2A68D 3FHWA 1LTID 2XWBB 3X3NA 1II3A 3K5NA 4JI0L 4DK6C 4CJ1B 5I2XA 3I55A 2JEBI 1Q12A 3D0FA 5LMUL 1VDZA 3CC4A 2F0VA 2NZ1D 1A63A 3EIVA 4PV1C 3BDLA 3DEOA 2Q2TA 1PTOH 4MTNA 1LT5D 2BA0A 1CZWA 1BBUA 2Y0SG 5BN3A 3K5MA 1G6PA 1LT3D 5CV7A 4A3GG 1HR0Q 2N88A 2X6LA 2QGQA 4P2CB 1J5EQ 1N32Q 3RLFA 2L0CA 4GLXA 2Z0SA 5EAYA 5IWAL 1BQQT 3NQTA 3T4AC 4K14A 3H0GH 3Q8DA 4K8IA 5HGQA 4B3MQ 2KEEA 4DUZL 3URYA 1E2WA 1A15A 5C0XH 2HD3A 2V4DA 1VQEA 3HKZE 1TVXA 2QCPX 2UUBL 1E0BA 2E8GA 3M4OB 2RDHA 4IUVA 3K5LA 1JR0D 1H9MA 3CCEA 5HURA 3M3YH 3K59A 1QB5D 1XX8A 2HQEA 4DAPA 4EQ5A 3DM1A 4TVAB 3HKSA 1FD7D 5G3LD 4B3RQ 4X65L 1MKHA 1LTRD 2HDMA 5JEAJ 4IPGA 3M7GA 5IYDH 5FJ8H 1WTWA 1V1PB 2I5HA 1AE2A 3PF4A 1IKMA 1D5ZC 1ICFB 5CV4A 3SVMA 1QWYA 5M3MG 4A3KH 4KKSA 2PW7A 4X62Q 2AUKA 5BN5A 3I4NH 3G48A 2B2TC 4LF4L 5ELFA 4OIJA 3G6JB 2R93H 1WJJA 5CV9A 3QR8A 2EZVA 2A74C 2WV6D 1NMFA 1PYSB 3VYSA 2OWOA 3H0GG 3CP0A 1F2ZA 2JA5H 2SNSA 5C0XG 5KGUA 4KI0A 2NBFA 1GUNA 1BBWA 1XNQQ 3VR3A 4JV5Q 4DV5L 3TQYA 3D4WA 4C3HB 1Z6HA 1PTOF 1XMQQ 2F0HA 1HCZA 1LTAD 3QOLA 2NVQH 3EJIA 5BR8L 4R4TA 3L7ZC 2CQOA 1J9OA 3MFYA 4A3BH 3T1HQ 1CSQA 4WRDA 1XPRA 1GHJA 5FJ8G 2B8GA 2CWPA 4A3KG 5EQ0A 2VZAA 1HFGA 1H9KA 1EQVA 4K6DA 3KF8B 2R7ZB 5C4JB 4CJ2C 4HCEA 2YTYA 4X64Q 1SDFA 2K14A 1E3PA 3JAMc 3H3VC 1J8IA 3H91A 2M2LA 1EY7A 3D4RA 1VF5C 1BBXC 3VA7A 4BBSB 1U4RA 5IYCH 1TKWB 3V05A 1RTOA 4JI7Q 3G6EA 4NPSA 3S1RH 1EEID 4DF7A 4DK0A 4CDFC 2WACA 2E5LQ 3K81C 3PUYA 4KK7A 1S5DD 3LWUA 1I6VC 3DMUA 5K36G 1CZGA 4XQJA 3GTJB 2JA7G 2JP1A 2RDGA 4BBRB 4KJOA 2R92H 2ALYB 3I7FA 1RODA 3PIOA 4YWLA 2CWAA 1B50A 1HR0L 4DAMA 3PUVA 1VQLA 1SE2A 1R4PB 2XRQD 4RHRA 1ZKOA 3J80L 1EQTA 5IGGA 1VQMA 1LTBD 4CDCC 3GTPB 2M9VA 4CHTB 4O1NA 2K4KA 2K5VA 4BA1I 3PO3B 4H02A 1JE4A 2WKDA 1PH8A 2IX3A 3VR5A 1STBA 3K57A 4GNXC 1UEAB 4FF4A 1HQRD 4NDXA 4JCVE 3DWQA 1PH7A 4DR6Q 2VUMH 3D8GA 3BG3A 3KJOA 4Q0FA 1H9SA 2E75C 1TS3A 3P20A 1H95A 3EVQA 3VYRA 3M4OH 2BA1A 2VXWA 1HRJA 4PZ6A 2B2YC 1Z7TA 2R92G 2E2JB 1X3EA 4GS3A 1DONA 1UE6A 4IFDG 2ZTCA 2UU9Q 3STBD 2ZTEA 2ZXRA 3CQZB 5CBAE 4ZUIA 3UI2A 4UPAA 4EVOA 2A5HA 1BDOA 4EGVA 1N36Q 1CT1D 2I5LX 4H44C 4IPDA 4RGTA 5CR3A 5M5XB 4KY5A 4J8QA 3JAME 1IL8A 3J7AV 5IGDA 3RR5A 1ML0D 2Z4IA 5IIFA 1ONLA 2WAQB 5JJZA 2VUMG 3I70A 4GOPC 4JI8Q 4CKCA 1PH3A 5GAHC 3KUPA 3GQBA 4FDBA 5D14A 5J3BA 4KHPL 1AE3A 3MA2B 3PIP3 1GVPA 3M4YA 5EBDA 1RIPA 3TS2A 3PMFA 1JJ2A 1OTCA 3K8AA 3T1HL 4DK1A 3J7YW 3HEJA 4EQOA 4DNRB 4A4IA 2L4NA 4FP5D 4OWXB 2HT1A 4JI1L 3GTKB 3NBHB 3LX0A 1SYFA 5ELCA 1Y14B 3P1HA 2IY5B 2FHTA 3NE5B 4RGMA 4WORA 4TRDA 3CC7A 5FO8B 2Z1CA 1WCMB 5IGEA 4LNQA 1SYEA 4DV2Q 3VA5A 3F2UA 1UE7A 1B9MA 1CSPA 4O42A 1ILPA 1JOQA 4XQNA 2R6GA 4Y7NH 3PUWA 4IQZA 1IZ6A 2EYFA 5C4JH 4DV3Q 1MSHA 4TSSA 1ILQA 4HJAA 1A3TA 3CXCA 3G71A 4A3DH 3ERQA 3BJUA 1YNJC 2KCTA 1LTSD 1KQSA 4BBSH 3IRBA 4RA8A 5ISRA 4JI6Q 2AWOA 3U58A 1I6HB 5ELDA 3NXWA 3HOUH 2N8NA 2VY3A 2DJGC 3QWNA 2RDFA 5LMNW 1P8LA 1SE3A 1HXYD 3MXNA 3H15A 1ICWA 3NBIA 2K50A 4ULLA 2PMZE 4K2LA 3GTJH 1TWGB 2XTIA 4BBRH 1JJCB 5J39A 4UP8A 5IT9c 2HDLA 2O2LD 3I4MB 3CMAA 3PO2B 4B08A 3S2HB 1YJNA 3QIAA 1LTGD 5EBCA 3KBGA 5D65A 1P16A 5M3FB 1XYIA 4X66Q 1VQPA 1VMPA 3GTPH 5EKIA 4C3JG 4QL5A 1BF4A 3PO3H 4DR6L 4ZK9B 1IW7C 3DHQA 4F8MA 4L6TB 1HZ9A 1BOSA 4AIMA 4KN4C 1W6KA 1TWAB 1SFOB 1W2BA 3SHLA 3BZKA 1STGA 3I90A 4FF3A 1AZQA 3K0XA 2EVBA 3LWEA 3Q22A 1RDPD 2OQKA 2F3IA 4ODGA 4C56C 3HOUG 4PNYA 1F2YA 1I4RA 2Y0SB 3WOEA 1ASZA 3CRKC 4ILWA 5E1FA 1ASYA 4A3GB 1HNWQ 2HCIA 2UXCQ 2ICEC 3NPPA 2EDGA 1NCVA 1VQAA 5CV5A 2OTLA 2E2JH 3EN2A 1GO3E 1OXVA 2NN6I 1WYDA 1YJWA 3GV3A 4A3FG 1E24A 1KL9A 4HIDA 2UXDL 4LFAL 2XSCA 3J81j 4I7AA 5IY0A 2HQLA 4HJ9A 4ZLTF 1IBKQ 2HCCA 3CW2C 4MHEA 4CJ0B 3L9AX 3D6CA 1B1ZA 4CKEA 3CRLC 1L1OA 3BVGA 3Q0AA 1CHPD 4FXKC 3GTGB 2AUJD 1JMCA 3QJYA 2O4XA 1QVGA 3RLOA 2FXQA 3HOVH 4IZ8A 2F0UA 1RF2D 4NXML 1SROA 3FRPB 5M3MB 3AU7A 1MGSA 3EROA 4EQPA 4JBMA 1DXMA 1BCPF 5LMUQ 3KDFB 4DXFA 2I0QA 2AQ1B 1Q86C 1Y8NB 2PPBC 3TBIB 3GD7A 4DV2L 1LM0A 4X3TA 1D1IA 5EPJA 3TZDA 2XRSD 3GTKH 4OGQC 4QUCA 4KD4A 3OPOA 2F3VA 3MHBA 3H0GB 2SNMA 1SEBD 1KIXA 4I65A 1FNVA 1Y1VG 1VQGA 1WCMH 4B3SL 4OO1H 1EOTA 2WB1E 3S17B 1TS5A 3MXUA 3HG9A 2DGYA 5IWAQ 1RD9D 1K9MC 1DOKA 3A5ZB 1B3AA 4GNXB 3C1FA 4B3TL 3A7AB 4K0KL 4JI6L 1O7IA 4KV6A 3M3YB 4DUZQ 4V0BA 2EYOA 2PYKA 1VQ4A 2B63H 1WTQA 1YHQA 4G57A 3C2PA 2UUBQ 1STYA 3RUZA 3HOVG 3RMHA 4BXXG 2QA4A 2EJFC 2QDLA 1PDQA 1BCPC 1I6HH 3BYYB 2F52A 4A3KB 2C9OA 5L37A 4HEDA 1BXTA 1CUKA 1D1KA 1NSNS 2MP1A 1HZBA 2K28A 2ZXOA 3BYTB 5D3IB 3BVZA 2F0MA 1GD7A 4QIWE 4APVA 1XPOA 1U9RA 1U4PA 1EIFA 1FGUA 1EWHA 1TWCH 1I4XA 1TQOA 2KEDA 2F4IA 3FMCA 1RL2A 3FP9A 5FO7B 1K8AC 4LF4Q 4OO1G 4DAYA 1N34L 2MFIA 5C5LA 4DAVA 3OSOA 1KDCA 2PQEA 5IP9H 4LF7L 4K5XA 3LGJA 2OEOA 4XDXA 5I6YA 4G4KA 2E2IB 1N8RC 5FLXE 1I4HA 1PFNA 1Q8IA 1PA6A 2FMCA 2TMPA 2B63G 1DZ1A 1SYGA 4DV5Q 4GOPB 1WOCA 4A3BB 1JE5A 4LUZA 1BR9A 4YIJA 4FF1A 2UXCL 4OEMB 1R9TB 2KCCA 2DJFC 2JK8A 1Q82C 4DFAA 4RMFA 4JI4Q 3QO2A 1C0AA 5BR8Q 1TR5A 1LABA 4ZYSA 1V1PA 4KY7A 1DGSA 1KD1C 5C44G 1HPCA 4O0AA 4RGOS 4JPBW 1SYCA 3HS0C 2NVXH 2NWGA 1EOVA 2K7VA 3T53B 3HOWH 1PYBA 1XPUA 2YYZA 2KHJA 3S2DH 2XGTA 5EPKA 2B2UA 4A3JG 1GHKA 1PFBA 1IYJB 3GTQB 1SSOA 3MFGA 3MZ5A 4PQXA 1AH9A 2VS1A 3HOZH 2N78A 3H3VH 2IX1A 2SOBA 1LACA 1JC7A 4ZRZA 2D5DA 2EIFA 3GTGH 2R92B 3SEBA 2NVTH 1QOHA 5M5WH 4BY7G 4RH6A 1KTKA 3Q24A 4A3EG 2Z6KA 5T1GA 4PG3A 5M3MH 3ZYYX 4DNIA 4RFBA 2RSOA 2ASBA 1NBWA 1PMRA 4N9TA 1KLUD 3D31A 4JVZA 2OCEA 2EQSA 3ZJYC 1ZEQX 5I6WA 3KF8A 4XT1B 1VQCA 3TMEA 2K52A 4ZAIA 4A3LG 4O2DA 1X3QA 4HSVA 3HOWG 1ZXTA 2MHVA 4RCOA 2VUMB 4YHHL 2K5NA 2CCZA 5C4ZA 1M1KC 1FGBD 1XNRL 4CGYB 3S17H 5E4XA 1KRSA 2K05A 4KLKA 1EZ6A 1F9RA 3JAMi 5CMDA 4UAIA 3HOZG 2QKIC 3IKJA 4A3CG 2G5DA 1L0WA 3OIPA 1VQ8A 1Y69U 3CCSA 1E1TA 1BVSA 4NMZA 1VQ7A 4LUVA 2K5HA 2R7FA 1SAPA 3UDXA 2RA4A 2JA8H 1VQDA 4ID6A 3SK4A 5EPLA 4C3IG 1AW7A 1AZPA 3UDIA 1PH2A 1SJED 1K8GA 1JJGA 4IOAA 4MNOA 3I3CA 4JBJA 1O7ZA 2DNEA 3E9HA 2NTSA 3A54A 1JOOA 1JWMD 2Q2IA 1TT2A 2RQXA 3RNUA 1DM0B 3K80C 4PMWA 2D0PA 4K5WA 3G7LA 4A3MH 1U0LA 2JYOA 3U9SA 2H4OA 1HNZL 4XQQA 1Z9FA 1B7YB 3K5OA 1UUPA 4N9PA 2BE5C 2E2IH 4OELB 2GA4B 1D2BA 1G6ZA 3W5OA 4JI4L 4LK1C 2JA7H 1VQ5A 5K36H 5JJIA 3ND8A 4KHPQ 1K8MA 1PFSA 4AQYL 1A0IA 2MPMA 5IGFA 1LT4D 3I4OA 3AFQA 3OWFA 3T1YL 1R9TH 2JA8G 1YNJD 3MWYW 4POFA 2CFMA 3DEPA 2SDFA 2ATWA 4R9WA 3N52A 4ZCKA 4C3JB 1PH5A 2RHQB 3CPWA 1AFPA 2KQ3A 4JI1Q 5C3XA 3UE0A 4Y7NB 1E7ZA 2F0OA 3HRZC 3EQLC 3OWEB 2WFWA 2D2CC 3ULJA 3PCOB 1C9OA 2C35B 4A3DB 1RTNA 4HSPA 2PNHA 2NB0A 5C0XI 1QZGA 2EYPA 1VF7A 4A3MG 3HOUB 4ZKCB 3GTQH 3FKIG 5COYA 3QOJA 3M85A 3OHXC 5GAEC 2ID0A 1NE3A 1IW7D 4BS9A 1B53A 3NENA 1YIJA 1O78A 5CYUA 4IFDH 1GJXA 5EJWA 4A3FB 2K04A 4KTAA 3UDFA 3NBHA 5I2YA 2CH4W 2TSSA 1BCPB 2A1AA 2JA6G 3W1BA 1K73C 2KBNA 5NUCA 4YY3L 1AN8A 4IUPA 1MI2A 3I8ZA 4X3KA 4QCLA 3MAQA 1XJVA 3CCVA 3SK8A 1LTTD 4HJ7A 1KDBA 1SYBA 1WTHA 1PFMA 3HKZG 1SXTA 4DR5L 1YI2A 2L15A 5FLMG 4LF8Q 5JEAG 4R4OA 2F0JA 4LWCA 4QY7A 2EY6A 2F0SA 1LUZA 3BZDB 4LW1A 4A75A 1CKNB 1VQKA 3T13A 2UUAL 2RCNA 3GTLH 2IT1A 3AEVA 1F9SA 3I2ZA 1I4QA 2KHSA 4A3IH 4DNTB 1FL0A 3CCUA 2EYJA 3S9WA 3ULPA 3U4ZA 1QJOA 3CF5A 3RN2A 2QF7A 1JQYD 1PXUA 2L11A 4I7ZC 2FJ2A 1IL2A 2R3ZA 3TZUA 1Y1VB 4XT3B 3F2DA 1KRTA 4OX9L 1V1QA 5E4WC 4GKJL 4M1UB 1SLJA 3KLSX 2DY7A 2JJQA 1ESFA 1N9WA 4DGZA 2F0QA 2UXDQ 4LFAQ 2AQ3B 5A35A 2PQAB 1LTLA 3JAML 2RVLA 4LUOA 4JYAL 1K3BC 3HOVB 3BZCA 2O5IC 1EYDA 4JI5L 3VDYA 1JICA 4R1JA 4MZ9A 4E6IA 4P72A 3HOYG 2QDBA 1QNKA 3NUCA 2VQEL 1L1OC 4A3IG 1I5FA 1C48A 3DWPA 2E74C 4KN7C 1SBBB 4NXMQ 3SK6A 3J7A5 1A6XA 1VQFA 4LF9L 3J81c 1F9QA 3I56A 1SN8A 2ZJQA 2L12A 3FVQA 4DV4L 3F2BA 1MJCA 2K75A 3NP8A 1X3FA 4DA2A 1JCKB 2FINB 4TKOB 1FVIA 1SNOA 1M8AA 5JOBA 4C3JH 4MN3A 1A8VA 2XIWA 1BCPD 3KOJA 3R93A 3RLNA 1HUNA 2V1CC 2IX0A 5C4HA 3S1QH 1ENAA 1RHPA 4AYBB 3ULLA 1NY4A 4B9XA 2PZUA 2ZT9C 4B3SQ 5IP7G 2AWNA 2B63B 1RCVD 5C4XG 2WKCA 3BU2A 1VQHA 2JE6I 3MEFA 4B3TQ 4KKUA 4K0KQ 5KNBA 3RD4A 2Q8IB 1CI3M 1I3QH 3CKIB 4HAEA 1GKHA 3F2CA 4DN4M 2VQFL 2KUMA 1WTOA 3V96A 1V8QA 1D5MC 2B8FA 4L5TA 3UDGA 1KAWA 4WJ3M 1QCBD 1VQIA 5GAGC 4C2MH 4LFCL 4A3FH 3NEMA 4HTHA 3GTMB 1ET9A 4RCNA 1RKNA 1TWCB 2EXDA 4YWKA 4A3JB 2EY2A 2WAQE 2IW3A 3IFDA 1YHBA 2A69C 3KFUA 3QG1A 2OTJA 5M5YB 5A2QE 4F7XA 2B2VA 4YCVA 4LF8L 1T5XD 1U4LA 4J15A 1FNUA 1HTLD 4GLVB 1NNXA 3G4SA 1QUQA 2Z8LA 1UEBA 1E2ZA 1IBLL 3E9IA 1FNWA 1LLRD 1TY2A 1N34Q 4LF6Q 1DYQA 4YWMA 3S16H 1SMXA 4CDEC 2Z9HA 3NTHA 5JVG3 1G91A 4BY7B 5I9OA 4LF7Q 4UHVA 1X6OA 4GLAC 4XXEA 2ZJRA 4DR1Q 3TN2A 1JWSD 2NTTA 4A3EB 1SNDA 4QMGA 5ELBA 1XWEA 2CH4A 4KHZA 5IE8A 2RF4A 2RKSA 3R3OA 4MTKA 1V9PA 2R7ZG 1OXSC 4Z9CB 1HR0W 4DV1L 1CKMA 1EYCA 4FNFA 1T5EA 1AEXA 1SJHD 4KJNA 1Q46A 2XN9C 3V2TA 4AYBE 2NVXB 3J81E 2A8VA 5DM73 3CD6A 1W3SA 3HOWB 3OOCA 3HOXH 4FVMA 4U673 3S2DB 1Y1VH 4HIKA 3ICEA 2BDNA 3HGBA 3ND9A 1NR2A 5ELOA 1Y8OB 3NTKA 5CGKA 1VQ6A 1DD2A 1PVOA 2D9UA 3K6OA 3PQIA 2GVBA 4IPCA 1EY5A 2NUCA 3W3AA 4IJHA 3HOZB 2CW0C 1KDAA 3A8KE 2MO1A 4XIGS 1A3UA 2PW5A 3NWTA 5JJKA 2JEAI 2KOLA 4HMJA 4K2KA 2NVTB 4A76A 1SRUA 5M5WB 2ES2A 2B2UC 4BXXH 2I5MX 2XWJB 1D7QA 1KABA 5CC4A 2HHHL 2K6AA 1GUOA 4NB3A 4LAAA 4NW2A 1NR4A 1SE8A 2EJGC 4KKTA 4X3UA 2K5WA 1L0YB 3S15H 1F77A 1Q1EA 2QEXA 1PYWD 1EWIA 1LO5D 2GN5A 1TS2A 1YNNC 5DAUA 2R7DA 3N6RA 5IT9E 3DUZA 2LXKA 2Z6KC 3M9BA 3HOXG 3K58A 5EKLA 4RHSA 2KJXA 5I9PA 5IOCA 1TWHH 3ITPA 1G51A 3MXNB 1FJGL 1B4OA 3TSSA 1B44D 1EIHA 2QILA 3DWAA 3PGZA 4TQUS 4QQBX 4BWGB 1CQVA 1PH9A 3PIO3 2ZM6L 2I07B 1EIYB 1G8ZD 2Y0SE 4YHHQ 3KLRA 3K0YA 1SNCA 1GUSA 2BH8A 3SXHA 1XNRQ 1CQFA 1G291 4IPHA 4QUFA 2RBMA 1I4PA 1SMYC 2GVAA 4WJ4A 3A56A 5LL6X 3NSWA 4R4QA 2JA8B 2F0WA 4GN5A 1ZYRC 4IUNA 1KLGD 4NKLA 4ALPA 3AQQA 2EE1A 1JOKA 4DK3C 4JI3Q 2N55A 4ABNA 2HIXA 5C44H 1I94L 3CU7A 1PRTF 3E3XA 3S1NB 3T56B 3AFPA 2BE5D 5TSSA 4RKLA 3E0EA 2PO4A 2KA7A 2CKZB 3GTMH 1TY0A 2MGSA 1E22A 4A3JH 3DXJC 3L3OC 2EYHA 4LF6L 1O7YA 1I50H 4A3MB 3B6YA 5M5YH 4L63B 3FKIB 4HIOA 2F3WA 4DR1L 1NTGA 2EYLA 2YU9H 2JA7B 1SNQA 5FLXL 2OXPA 3IL8A 4PMCA 4BY7H 2RSNA 1HNZQ 1EQRA 4IUUA 3A8JE 1OXTA 4IOCA 2M00A 1HZCA 4HIMA 3R8BA 4A3EH 1Z47A 4FF2A 2JA6B 1A2UA 5IODA 4JC0A 1L1OB 4POGA 2B2WA 1PRTC 4AQYQ 4FO2A 2B29A 3Q6SA 4RWSC 3T1YQ 1YZ6A 1UNSA 2Z4HA 1PLFA 4N8X1 4A3LH 1Q3LA 1BKBA 1O7LA 3HP3A 3HKZB 5C0XJ 4IJLA 2BDOA 4HCSA 5BN4A 2MUYA 3KF6B 5EGTA 3OIQA 1X55A 1Q7YC 3D6WA 1K83H 3SR1A 4OO1I 1DOMA 3GP7A 3KLWA 1HZAA 3F1ZA 4IO9A 2AMCB 3OTOL 2XNAC 4G7HC 4UY8C 3PIPA 4JOIA 4A3CH 2L9HA 4DV0Q 4QJFA 3I4MG 1JB7A 3PO2G 4DR2L 1L2FA 1B8AA 2PZWA 3H94A 3T16A 1D8LA 1NMGA 3U4VA 2F1MA 1IYUA 3J7ZC 2F0IA 2MO0A 1MBYA 5JPNC 5C3EH 3TP8A 4C3IH 2ZTDA 4B9WA 1EU4A 3WOFA 5JPMC 3A0JA 1SYDA 4LFBQ 1AP0A 1SNMA 1CK1A 1WTVA 1G2TA 3TP7A 2YTVA 4P71A 3W1GA 2UUCQ 3DLLA 4JI2L 4YY3Q 1X54A 2QW7A 2WB1G 3I4LA 1EWCA 3KLSA 5KEEA 1KAAA 1K8OA 4HR7B 1K0SA 5M9OA 4Y52H 3CMEA 3HOYB 3GTLB 2E2DC 3I73A 3EBEA 4S3SA 2EOTA 1PHJA 1VQNA 3GV6A 4DR5Q 4BY1H 4A3IB 2N3SA 2F0FA 1QNUA 1IHZA 1X32A 1SR3A 1HTPA 3PSIA 3Q23A 4JI3L 2NVYH 1VQOA 2UUAQ 1NUCA 5JVH3 4DXGA 4DAYB 2K1BA 1DOLA 1TXYA 1CFMA 1FYCA 1B9NA 4DV7L 1XMOL 3VR4A 4PMBA 1Y1WG 3HFZB 1O80A 3EFXD 5C3EG 3MTSA 1WTRA 3S1MH 2PI2E 1FR3A 1X56A 1E1OA 4OL7A 4QF4A 1QVFA 1R4QB 2MQHA 3IFTA 2F0GA 1U4MA 4L5QA 1CKOA 4H0LC 1QG7A 3S1NH 2ZJPA 3S14B 3WWVA 1EFID 1OO9B 1KC8C 4OX9Q 1LV9A 5C4XB 3J80c 2IJ0A 4JK1C 5DNFA 3M7NA 4GKJQ 1IXRA 2HUGA 1X3GA 1X3PA 1D5XC 2IHEA 4K6LA 1MSGA 4F88A 4K8JA 3TS0A 3CC2A 1MIUA 3P7JA 1CKNA 1JORA 1UAPA 2J4XA 3FKIH 1PH4A 4L5RC 4BY1G 4JYAQ 1QZHA 1S5CD 4IFDJ 4UP7A 4CKBA 3H3VI 2XVSA 4JI5Q 4DR7L 2CHBD 1VQ9A 1ENCA 1BUVT 2VQEQ 4QB4A 1TWFH 1IBML 2E2HB 5JJLA 1EEFD 4DV6L 3RZOB 1HUMA 2JA6H 2PNRC 4R4CA 2YTXA 2B3GA 2G9DA 2A6HC 2D62A 1YBYA 4JBWA 4LF9Q 2O5JC 5AJ3L 2EY5A 4DV4Q 3S1QB 2Q2HA 2BCOA 2Q2UA 4R4IA 2K5QA 1Q1BA 4F87A 3GTOB 5LMNL 3CCRA 2PQAA 2UXBL 5IYDG 1S72A 1M90C 4OXPA 2R61A 1GUGA 5FLMH 4LF5L 5JEAH 4DV0L 2DUDA 5IGBA 4J1MA 2VL6A 4OWTB 4DUYL 3A74A 3E6ZX 1I4GA 3J7AF 1I3QB 3I4NG 1A3VA 2NYZD 5HGTA 1UWVA 3M4QA 2A69D 2A6EC 1HH2P 3PUXA 4A93H 2R93G 3EA6A 1F2MA 3A8IE 3KBXA 1WFQA 4C2MB 2A19A 4G7OC 3KJPA 2JA5G 4LFBL 4BA2I 2L1BA 1HNXQ 2K03A 4IURA 2VQFQ 2L55A 2LS01 1DJRD 1JB3A 1STEA 2UUCL 3L2PA 1OXUA 1T9HA 1BO0A 1PTOC 2LMCB 1EY4A 1Q81C 4P73A 5ELNA 4LFCQ 4HMIA 2WINB 4XYOA 4PZ8A 5I4DA 3DM3A 1CTMA 3CCQA 3J81i 3P75A 1VQJA 4FYDA 1STAA 2LY7A 4A3BG 3M4PA 2K32A 3S16B 3J80E 1J5EL 4YCUA 1N32L 5T1IA 4YCWA 3OW7A 4QGUA 2A68C 4ME3A 1N33Q 4UDUC 1F9PA 3NWSA 2F0EA 1E2VA 2LSSA 4ZQ3A 3T51B 2Q8TA 1XTDA 2B2VC 4IUQA 3HOYH 4B3ML 1IBLQ 2H5XA 2K5DA 1CA6A 5KRUA 1WD1A 4A93G 2KVMA 1YITA 4RGNA 5F2DA 4DR3Q 1LYLA 5G3LF 1C8CA 1PH1A 1EUJA 3NELA 1WVLA 2CW0D 2X6GA 5IYCG 4JG2A 1V1OA 3HOXB 4M8AA 2RHSB 1CHQD 2F0KA 3R2TA 1H9JA 4XYQA 4DV1Q 1HQMC 1U5KA 1C7YA 4B3RL 4NXNQ 2P5ZX 1PRTB 2VB2X 2N49A 1A62A 3ONAB 4CBVA 2B2TA 2JA9A 1S4ZA 2F0TA 3CCMA 4L5SA 2VNUD 3S14H 1B2TA 4X62L 5H1SE 5IP7H 5IGCA 1YHAA 4P75A 5C4XH 1EQQA 1YNND 2BH2A 5GADC 3RN5A 4OWWB 1PZID 2DY8A 2KENA 1ESRA 2PMZB 5FO9B 2QEJC 1V43A 3BDCA 4H13C 1EY9A 1K3RA 1XNQL 2LKVA 5JAVA 4JV5L 3A5UA 4P74A 2VW9A 1C4QA 3S15B 1SNPA 4KY6A 4R8IA 3W2DA 1XMQL 2HHHQ 4HJ5A 4GKKQ 4IFDI 5GQOA 1HA6A 2ENBA 2E2HH 4CDDC 2EXZA 2F0DA 4HN7A 1SMYD 4C1NI 3RZOH 2SEBD 1TWHB 5HY6A 3SGIA 1VQBA 4EX5A 4C3HH 3MC0B 1HJPA 3FDTA 1ZYRD 5AFWA 3TDQA 2A73B 5KIXA 1K28A 2I46A 2NN6H 4AH6A 1VCIA 2F4VQ 1FJGQ 3GTOH 4X64L 4GN4B 2KECA 3K7AB 4G7ZC 3HZXA 3S24A 1VMCA 2ZM6Q 3CHBD 3NQIA 2E76C 5C6AA 3ER0A 2ICIA 3I72A 2PZTA 1HNXL 4JI7L 3R2IA 2R7ZH 3VR2A 5C44B 1STHA 3F8TA 4Q5VA 3KDFA 2E5LL 3U9OA 4J6HA 4IALA 1S3OA 4LJZC 2C5CA 1M4VA 5EKKA 1B3QA 1H9SB 5D3DA 1KNAA 4N8FA 3VYUA 2RCFA 1G2SA 2JXMB 3IAYA 4ZKBB 1I94Q 4GN3B 3SE0A 4RKBA 4X3SA 1YJ9A 3PF5A 3H6MA 3U50C 3NTIA 1I50B 4JW0A 4C3HG 1XXGA 3AMUA 3RZDB 2FFKB 3A55A 5J1ZA 5A2QL 1XTCD 1TU2B 5K5PA 2F0LA 1N33L 1EY6A 3X3MA 4RG1A 2YU9B 2NN6G 1PRTD 4GNXA 5CORA 1EL0A 3CPFA 5DLQE 1D6EC 3QB3A 4NP5A 1ET6A 4X6AH 3GDEA 5C5MA 5GROA 4V190 3NHHA 1GOZA 1EU3A 1DCZA 2D0OA 1LT6D 1JT8A 1YEZA 4DR3L 3NK9A 3OMCA 3GO5A 2F0PA 3TP5A 1PZJD 2IPKD 5CBEE 2MNAA 1WD0A 5ELEA 5C3WA 2FMMA 2IL8A 1UE1A 2B2YA 4NXNL 4A3DG 4DKAC 1S5ED 1X9NA 4BBSG 1CM9A 2WB1B 2MJ8A 3J81L 2WIIB 4ME5A 1PZKD 1K83B 2UU9L 2B2WC 3MVVA 1WTPA 4JBKA
chains in the Genus database with same CATH topology
1N36Q 1Z9FA 1B7YB 2I5LX 4IPDA 4AQYQ 2B29A 2E2IH 3W5OA 2NZOA 4JI4L 2JA7H 3T1YQ 1YZ6A 4BBRG 1VQ5A 5JJIA 3RR5A 4A3LH 4KHPQ 1PFSA 1N36L 1BKBA 4AQYL 5C0XJ 1A0IA 4IJLA 3TRZA 3I4OA 3PV0A 2VUMG 4GOPC 3AFQA 3T1YL 1R9TH 2JA8G 3KF6B 4JI8Q 1PH3A 4POFA 5GAHC 3OTOQ 1X55A 2CFMA 3CQZH 4FDBA 4GOPA 5J3BA 1Q7YC 2ATWA 1AE3A 4KHPL 1K83H 1GVPA 3PO3G 4OO1I 1RIPA 3TS2A 1PH5A 2RHQB 3CPWA 1JJ2A 3KLWA 3K8AA 4JI1Q 3T1HL 1OTCA 4GKKL 2HIVA 1KHIA 1HZAA 2WP8J 3F1ZA 4JI8L 2AMCB 3UE0A 5FLXc 4IO9A 4JOIC 3OTOL 1E7ZA 4A4IA 5M5XH 3AYHB 4DR2Q 4UY8C 1PV4A 3PIPA 3UE1A 4JOIA 4A3CH 2WFWA 4DV0Q 4OWXB 3ULJA 2HT1A 4JI1L 3PCOB 1PH6A 4QJFA 3NBHB 1C9OA 3STBC 3I4MG 1JB7A 4DR4Q 2C35B 3PO2G 4DR2L 1L2FA 1Y14B 1B8AA 2IY5B 1D8LA 1NMGA 4JI0Q 2A8VA 3CC7A 2PNHA 3U4VA 4LNQA 3J7ZC 2MO0A 4DV2Q 2F4VL 4A3BH 5C3EH 5C0XI 1QZGA 3KF6A 4A3MG 1X65A 2PI2A 4C3IH 3OW2A 2ZTDA 1UE7A 3GTQH 1CSPA 2KCMA 3FKIG 4JI2Q 3TEHB 3M85A 3A0JA 2R6GA 4Y7NH 1KXLA 3PUWA 4LFBQ 1IZ6A 5C4JH 5GAEC 4DV3Q 2ID0A 1NE3A 2YTVA 4P71A 4HJAA 3W1GA 3CXCA 3G71A 2UUCQ 3DLLA 3NENA 4A3DH 4JI2L 1YIJA 3BJUA 4YY3Q 1X54A 1QVCA 2WB1G 2KCTA 4BBSH 1KQSA 3UDFA 3IRBA 3PF4A 4DV3L 1OXXK 3K7UC 4JI6Q 3K7AH 2A1AA 2AWOA 4XTCS 2JA6G 3W1BA 5IYBH 3U58A 2KBNA 1K73C 4Y52H 4YY3L 3CMEA 3HOUH 2N8NA 2VY3A 3EBEA 2AKWB 5LMNW 1P8LA 1QUQB 1EFWA 1PHJA 3H15A 1VQNA 4DR5Q 1XJVA 2K50A 2LXJA 3CCVA 3OYYA 1EYGA 2PMZE 4BY1H 2N3SA 3GTJH 1YVCA 4HJ7A 2XTIA 4BBRH 1JJCB 1SR3A 4DV7Q 3PSIA 1XMOQ 4UP8A 5IT9c 4JI3L 2NVYH 1VQOA 2UUAQ 3HKZG 3CMAA 2WAQG 4DR5L 2L15A 1YI2A 4DAYB 3L0OA 1YJNA 1YNXA 1TXYA 5FLMG 4LF8Q 3CD6A 1VS0A 5JEAG 1P16A 3KYHC 3TREA 4X66Q 2JQOA 4R4OA 4DV7L 1VQPA 1XMOL 2KHIA 4LWCA 3HFZB 4PZ7A 4QY7A 5C3EG 1LUZA 4A75A 4LW1A 1Y1WG 1CKNB 1VQKA 2UUAL 3GTLH 2RCNA 4QL5A 3PO3H 2IT1A 3S1MH 2PI2E 3AEVA 1X56A 4DR6L 1E1OA 4X65Q 1Q8KA 3RZDH 1QVFA 3I2ZA 2MQHA 4X66L 4A3IH 2AHOB 3PUZA 3ERSX 4L5QA 1GM5A 1HZ9A 1K0RA 1CKOA 1TWGH 1FL0A 3S1NH 2ZJPA 4AIMA 3CCUA 3WWVA 3ULPA 3U4ZA 1KC8C 3I4MH 3CF5A 1W2BA 4HJ8A 3BZKA 3RN2A 4OX9Q 3PO2H 3J80c 3K0XA 4GKJQ 3S2HH 3M7NA 1IXRA 1B70B 1IL2A 4UP9A 1WCMG 5M3FH 3F2DA 2OQKA 2F3IA 5E7NA 1X3GA 1KRTA 5IYBG 1NJIC 3CCLA 4OX9L 2IHEA 3HOUG 4OONA 1V1QA 4GKJL 3TS0A 4DR7Q 1ASZA 3CC2A 1MIUA 1SLJA 1CKNA 1ASYA 3FKIH 1PH4A 1HNWQ 4AYBG 1S40A 4L5RC 2JJQA 4DPGA 2UXCQ 4BY1G 1N9WA 1QZHA 4JYAQ 2UXDQ 4IFDJ 4LFAQ 4UP7A 3CAMA 3H3VI 1IBMQ 1WI5A 3JC66 1VQAA 4JI5Q 4DR7L 2OTLA 2PQAB 2E2JH 3EN2A 1LTLA 4DV6Q 1TWAH 1GO3E 1OXVA 1UE5A 2NN6I 1WYDA 1SFOH 2OQ0A 4A3FG 1YJWA 1HNWL 1VQ9A 4LUOA 4JYAL 1E24A 1KL9A 3BZCA 4HIDA 2UXDL 2VQEQ 4LFAL 1TWFH 1IBML 4JI5L 5JJLA 3VDYA 5AJ3Q 4R1JA 4DV6L 3J81j 4MZ9A 2JA6H 4R4CA 4P72A 3HOYG 2YTXA 5IY0A 2B3GA 2HQLA 3CCJA 4HJ9A 1IBKQ 2VQEL 2D62A 1YBYA 3CW2C 4JBWA 4LF9Q 4A3GH 5LMNQ 1L1OC 5AJ3L 4A3IG 1I5FA 2UXBQ 4DV4Q 2Q2HA 1L1OA 2Q2UA 4NXMQ 3J7A5 4R4IA 4LF5Q 1VQFA 2NZHA 3J80i 1Q1BA 1IBKL 1JMCA 4LF9L 3J81c 5LMNL 1QVGA 3CCRA 4DUYQ 3RLOA 2FXQA 3HOVH 2PQAA 1SN8A 3I56A 2ZJQA 2UXBL 4DV4L 5IYDG 3F2BA 1S72A 1MJCA 2IHFA 2K75A 2YV5A 4OXPA 1M90C 5M3FG 5FLMH 4NXML 4LF5L 1X3FA 1SROA 4DV0L 2DUDA 1Y1WH 4DR4L 1FVIA 1J6QA 2VL6A 4OWTB 4DUYL 1MJEA 4JBMA 4C3JH 5IP9G 3A74A 3FHWA 1A8VA 5LMUQ 4JI0L 3KDFB 3I4NG 3KOJA 2I0QA 1Q86C 3RLNA 1UWVA 2V1CC 2IX0A 3M4QA 4DK6C 1HH2P 3S1QH 3PUXA 4A93H 3GD7A 3ULLA 1NY4A 4DV2L 3I55A 2R93G 4B3RQ 1LM0A 2JEBI 4B3SQ 1Q12A 3D0FA 5LMUL 3GTKH 5IP7G 2AWNA 1WFQA 3CC4A 5C4XG 2A19A 3KJPA 2JA5G 4LFBL 1A63A 1KIXA 3EIVA 4BA2I 1HNXQ 3BU2A 1VQHA 1Y1VG 2JE6I 3MEFA 1VQGA 4B3TQ 1WCMH 2VQFQ 4B3SL 4K0KQ 2Q2TA 2UUCL 4MTNA 2WB1E 3L2PA 1OXUA 2BA0A 1T9HA 1BBUA 2Y0SG 2DGYA 5IWAQ 1I3QH 1G6PA 1Q81C 1K9MC 3A5ZB 1GKHA 4P73A 5ELNA 3F2CA 2VQFL 4GNXB 4B3TL 1HR0Q 4LFCQ 4A3GG 4K0KL 4JI6L 1O7IA 4PZ8A 2QGQA 1J5EQ 1N32Q 3RLFA 3DM3A 4DUZQ 4L5TA 3CCQA 3J81i 4GLXA 3UDGA 1KAWA 2Z0SA 4WJ3M 1VQJA 5EAYA 5IWAL 1VQIA 1VQ4A 5GAGC 2B63H 4C2MH 1YHQA 4LFCL 3H0GH 3M4PA 3Q8DA 2UUBQ 4A3BG 4A3FH 5HGQA 3HOVG 4B3MQ 3NEMA 4YCUA 2QA4A 1J5EL 4BXXG 1N32L 4YCWA 4DUZL 2EXDA 4YWKA 4QGUA 4ME3A 1N33Q 1VQEA 3HKZE 1I6HH 2LSSA 2WAQE 2F52A 1XTDA 2UUBL 1YHBA 3HOYH 3KFUA 2E8GA 4B3ML 1IBLQ 2OTJA 2H5XA 4YCVA 4LF8L 1CUKA 3CCEA 4J15A 4GLVB 4A93G 3M3YH 3G4SA 1YITA 1HZBA 1QUQA 1UEBA 4TVAB 4EQ5A 4DR3Q 1IBLL 1LYLA 1PH1A 3E9IA 1EUJA 3HKSA 3NELA 1GD7A 4QIWE 4APVA 1XPOA 4X65L 1N34Q 1MKHA 4YWMA 4LF6Q 1SMXA 5JEAJ 3S16H 3GTPH 4IPGA 1EIFA 5IYCG 1FGUA 1TWCH 4JG2A 4LF7Q 5IYDH 5FJ8H 2RHSB 1X6OA 2I5HA 1AE2A 4GLAC 2ZJRA 1RL2A 1U5KA 3FP9A 4DV1Q 4DR1Q 1K8AC 5M3MG 1C7YA 4LF4Q 4OO1G 4B3RL 1N34L 2MFIA 4KHZA 5IE8A 4A3KH 4NXNQ 2RF4A 5IP9H 1V9PA 4X62Q 4LF7L 2R7ZG 1OXSC 3LGJA 1HR0W 4DV1L 3G48A 3I4NH 4LF4L 1CKMA 2N49A 1N8RC 1A62A 2JA9A 2R93H 1WJJA 3CCMA 4L5SA 2VNUD 3S14H 4X62L 1Q46A 1PA6A 5H1SE 4AYBE 2B63G 1NMFA 1PYSB 2OWOA 3H0GG 5IP7H 4DV5Q 1YHAA 4GOPB 1W3SA 1WOCA 3CP0A 4P75A 5C4XH 1JE5A 4LUZA 2JA5H 2UXCL 3HOXH 1EQQA 1Y1VH 2JK8A 5C0XG 4HIKA 4KI0A 1Q82C 2BH2A 3ICEA 4RMFA 1BBWA 5GADC 3RN5A 4JI4Q 4OWWB 1XNQQ 2KENA 5ELOA 5BR8Q 4JV5Q 1C0AA 4DV5L 1DGSA 3TQYA 1V43A 1KD1C 1VQ6A 1PVOA 2GVBA 5C44G 4IPCA 1K3RA 4O0AA 1XMQQ 2NVQH 1XNQL 4IJHA 5BR8L 4JV5L 4R4TA 3A5UA 4P74A 2VW9A 2MO1A 4XIGS 2NVXH 3L7ZC 2CQOA 5JJKA 1EOVA 2JEAI 1XMQL 2HHHQ 1PYBA 4HJ5A 2YYZA 1CSQA 2KHJA 4A76A 3T1HQ 1XPUA 3HOWH 1SRUA 1XPRA 2ES2A 4GKKQ 5GQOA 4BXXH 4IFDI 3S2DH 2XGTA 2I5MX 5FJ8G 2E2HH 1D7QA 4A3JG 3RZOH 5HY6A 3SGIA 1VQBA 2CWPA 4EX5A 4A3KG 2HHHL 1IYJB 2VZAA 4C3HH 1HJPA 4NB3A 3KF8B 1SE8A 1AH9A 2VS1A 3HOZH 2N78A 3H3VH 2IX1A 2YTYA 4X64Q 2K14A 1E3PA 3JAMc 4AH6A 2EIFA 1VCIA 3S15H 1Q1EA 3GTGH 2QEXA 2F4VQ 1EWIA 2GN5A 1FJGQ 3GTOH 2R7DA 2NVTH 5M5WH 4BY7G 4X64L 4GN4B 5IYCH 2LXKA 2Z6KC 3M9BA 3HOXG 4JI7Q 3G6EA 4NPSA 3S1RH 4A3EG 3S24A 2Z6KA 1TWHH 2ZM6Q 1G51A 3MXNB 4PG3A 5M3MH 1FJGL 4DNIA 2E5LQ 3K81C 3PUYA 1NBWA 2ASBA 3PGZA 3ER0A 4TQUS 1HNXL 4JI7L 2R7ZH 4QQBX 3D31A 1PH9A 2OCEA 3F8TA 2EQSA 3ZJYC 2ZM6L 2JA7G 5K36G 1EIYB 4YHHQ 2Y0SE 3KDFA 2E5LL 1VQCA 2R92H 2K52A 2ALYB 3I7FA 4A3LG 2BH8A 4O2DA 1XNRQ 1S3OA 3PIOA 4YWLA 2CWAA 1G291 4IPHA 1HR0L 3HOWG 4DAMA 3PUVA 1VQLA 4WJ4A 2GVAA 4YHHL 2K5NA 2CCZA 1M1KC 4R4QA 1VQMA 1I94Q 4GN5A 4GN3B 1XNRL 3S17H 4ALPA 1YJ9A 3AQQA 2K4KA 2K5VA 4BA1I 3PF5A 4H02A 1KRSA 3U50C 4KLKA 4DK3C 4JI3Q 1PH8A 2HIXA 3JAMi 5C44H 3HOZG 1I94L 4GNXC 1N33L 4A3CG 1L0WA 1VQ8A 4RG1A 3AFPA 2NN6G 4GNXA 3CPFA 1E1TA 1BVSA 5DLQE 3CCSA 3E0EA 1VQ7A 4LUVA 4JCVE 2K5HA 4X6AH 3GDEA 5GROA 2R7FA 1PH7A 3UDXA 4DR6Q 2VUMH 2CKZB 3GTMH 3KJOA 2JA8H 1VQDA 2D0OA 1JT8A 1YEZA 4DR3L 1E22A 4A3JH 3GO5A 4LF6L 1I50H 3B6YA 3UDIA 5M5YH 1PH2A 2MNAA 3M4OH 1H95A 2BA1A 1K8GA 1JJGA 4HIOA 4IOAA 4DR1L 1NTGA 4MNOA 4PZ6A 1UE1A 2YU9H 4JBJA 2R92G 4NXNL 4A3DG 1X3EA 3E9HA 4GS3A 4DKAC 1UE6A 4IFDG 1X9NA 4BBSG 2ZTCA 2UU9Q 4BY7H 2Q2IA 3STBD 1HNZQ 1EQRA 3RNUA 1OXTA 4IOCA 1HZCA 4HIMA 4A3EH 2ZTEA 1Z47A 3K80C 4PMWA 2D0PA 4A3MH 1U0LA 2UU9L 4UPAA 4JC0A 1L1OB 1HNZL 4JBKA 4POGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 Q;  1Z9F A;  1B7Y B;  2I5L X;  4IPD A;  4AQY Q;  2B29 A;  2E2I H;  3W5O A;  2NZO A;  4JI4 L;  2JA7 H;  3T1Y Q;  1YZ6 A;  4BBR G;  1VQ5 A;  5JJI A;  3RR5 A;  4A3L H;  4KHP Q;  1PFS A;  1N36 L;  1BKB A;  4AQY L;  5C0X J;  1A0I A;  4IJL A;  3TRZ A;  3I4O A;  3PV0 A;  2VUM G;  4GOP C;  3AFQ A;  3T1Y L;  1R9T H;  2JA8 G;  3KF6 B;  4JI8 Q;  1PH3 A;  4POF A;  5GAH C;  3OTO Q;  1X55 A;  2CFM A;  3CQZ H;  4FDB A;  4GOP A;  5J3B A;  1Q7Y C;  2ATW A;  1AE3 A;  4KHP L;  1K83 H;  1GVP A;  3PO3 G;  4OO1 I;  1RIP A;  3TS2 A;  1PH5 A;  2RHQ B;  3CPW A;  1JJ2 A;  3KLW A;  3K8A A;  4JI1 Q;  3T1H L;  1OTC A;  4GKK L;  2HIV A;  1KHI A;  1HZA A;  2WP8 J;  3F1Z A;  4JI8 L;  2AMC B;  3UE0 A;  5FLX c;  4IO9 A;  4JOI C;  3OTO L;  1E7Z A;  4A4I A;  5M5X H;  3AYH B;  4DR2 Q;  4UY8 C;  1PV4 A;  3PIP A;  3UE1 A;  4JOI A;  4A3C H;  2WFW A;  4DV0 Q;  4OWX B;  3ULJ A;  2HT1 A;  4JI1 L;  3PCO B;  1PH6 A;  4QJF A;  3NBH B;  1C9O A;  3STB C;  3I4M G;  1JB7 A;  4DR4 Q;  2C35 B;  3PO2 G;  4DR2 L;  1L2F A;  1Y14 B;  1B8A A;  2IY5 B;  1D8L A;  1NMG A;  4JI0 Q;  2A8V A;  3CC7 A;  2PNH A;  3U4V A;  4LNQ A;  3J7Z C;  2MO0 A;  4DV2 Q;  2F4V L;  4A3B H;  5C3E H;  5C0X I;  1QZG A;  3KF6 A;  4A3M G;  1X65 A;  2PI2 A;  4C3I H;  3OW2 A;  2ZTD A;  1UE7 A;  3GTQ H;  1CSP A;  2KCM A;  3FKI G;  4JI2 Q;  3TEH B;  3M85 A;  3A0J A;  2R6G A;  4Y7N H;  1KXL A;  3PUW A;  4LFB Q;  1IZ6 A;  5C4J H;  5GAE C;  4DV3 Q;  2ID0 A;  1NE3 A;  2YTV A;  4P71 A;  4HJA A;  3W1G A;  3CXC A;  3G71 A;  2UUC Q;  3DLL A;  3NEN A;  4A3D H;  4JI2 L;  1YIJ A;  3BJU A;  4YY3 Q;  1X54 A;  1QVC A;  2WB1 G;  2KCT A;  4BBS H;  1KQS A;  3UDF A;  3IRB A;  3PF4 A;  4DV3 L;  1OXX K;  3K7U C;  4JI6 Q;  3K7A H;  2A1A A;  2AWO A;  4XTC S;  2JA6 G;  3W1B A;  5IYB H;  3U58 A;  2KBN A;  1K73 C;  4Y52 H;  4YY3 L;  3CME A;  3HOU H;  2N8N A;  2VY3 A;  3EBE A;  2AKW B;  5LMN W;  1P8L A;  1QUQ B;  1EFW A;  1PHJ A;  3H15 A;  1VQN A;  4DR5 Q;  1XJV A;  2K50 A;  2LXJ A;  3CCV A;  3OYY A;  1EYG A;  2PMZ E;  4BY1 H;  2N3S A;  3GTJ H;  1YVC A;  4HJ7 A;  2XTI A;  4BBR H;  1JJC B;  1SR3 A;  4DV7 Q;  3PSI A;  1XMO Q;  4UP8 A;  5IT9 c;  4JI3 L;  2NVY H;  1VQO A;  2UUA Q;  3HKZ G;  3CMA A;  2WAQ G;  4DR5 L;  2L15 A;  1YI2 A;  4DAY B;  3L0O A;  1YJN A;  1YNX A;  1TXY A;  5FLM G;  4LF8 Q;  3CD6 A;  1VS0 A;  5JEA G;  1P16 A;  3KYH C;  3TRE A;  4X66 Q;  2JQO A;  4R4O A;  4DV7 L;  1VQP A;  1XMO L;  2KHI A;  4LWC A;  3HFZ B;  4PZ7 A;  4QY7 A;  5C3E G;  1LUZ A;  4A75 A;  4LW1 A;  1Y1W G;  1CKN B;  1VQK A;  2UUA L;  3GTL H;  2RCN A;  4QL5 A;  3PO3 H;  2IT1 A;  3S1M H;  2PI2 E;  3AEV A;  1X56 A;  4DR6 L;  1E1O A;  4X65 Q;  1Q8K A;  3RZD H;  1QVF A;  3I2Z A;  2MQH A;  4X66 L;  4A3I H;  2AHO B;  3PUZ A;  3ERS X;  4L5Q A;  1GM5 A;  1HZ9 A;  1K0R A;  1CKO A;  1TWG H;  1FL0 A;  3S1N H;  2ZJP A;  4AIM A;  3CCU A;  3WWV A;  3ULP A;  3U4Z A;  1KC8 C;  3I4M H;  3CF5 A;  1W2B A;  4HJ8 A;  3BZK A;  3RN2 A;  4OX9 Q;  3PO2 H;  3J80 c;  3K0X A;  4GKJ Q;  3S2H H;  3M7N A;  1IXR A;  1B70 B;  1IL2 A;  4UP9 A;  1WCM G;  5M3F H;  3F2D A;  2OQK A;  2F3I A;  5E7N A;  1X3G A;  1KRT A;  5IYB G;  1NJI C;  3CCL A;  4OX9 L;  2IHE A;  3HOU G;  4OON A;  1V1Q A;  4GKJ L;  3TS0 A;  4DR7 Q;  1ASZ A;  3CC2 A;  1MIU A;  1SLJ A;  1CKN A;  1ASY A;  3FKI H;  1PH4 A;  1HNW Q;  4AYB G;  1S40 A;  4L5R C;  2JJQ A;  4DPG A;  2UXC Q;  4BY1 G;  1N9W A;  1QZH A;  4JYA Q;  2UXD Q;  4IFD J;  4LFA Q;  4UP7 A;  3CAM A;  3H3V I;  1IBM Q;  1WI5 A;  3JC6 6;  1VQA A;  4JI5 Q;  4DR7 L;  2OTL A;  2PQA B;  2E2J H;  3EN2 A;  1LTL A;  4DV6 Q;  1TWA H;  1GO3 E;  1OXV A;  1UE5 A;  2NN6 I;  1WYD A;  1SFO H;  2OQ0 A;  4A3F G;  1YJW A;  1HNW L;  1VQ9 A;  4LUO A;  4JYA L;  1E24 A;  1KL9 A;  3BZC A;  4HID A;  2UXD L;  2VQE Q;  4LFA L;  1TWF H;  1IBM L;  4JI5 L;  5JJL A;  3VDY A;  5AJ3 Q;  4R1J A;  4DV6 L;  3J81 j;  4MZ9 A;  2JA6 H;  4R4C A;  4P72 A;  3HOY G;  2YTX A;  5IY0 A;  2B3G A;  2HQL A;  3CCJ A;  4HJ9 A;  1IBK Q;  2VQE L;  2D62 A;  1YBY A;  3CW2 C;  4JBW A;  4LF9 Q;  4A3G H;  5LMN Q;  1L1O C;  5AJ3 L;  4A3I G;  1I5F A;  2UXB Q;  4DV4 Q;  2Q2H A;  1L1O A;  2Q2U A;  4NXM Q;  3J7A 5;  4R4I A;  4LF5 Q;  1VQF A;  2NZH A;  3J80 i;  1Q1B A;  1IBK L;  1JMC A;  4LF9 L;  3J81 c;  5LMN L;  1QVG A;  3CCR A;  4DUY Q;  3RLO A;  2FXQ A;  3HOV H;  2PQA A;  1SN8 A;  3I56 A;  2ZJQ A;  2UXB L;  4DV4 L;  5IYD G;  3F2B A;  1S72 A;  1MJC A;  2IHF A;  2K75 A;  2YV5 A;  4OXP A;  1M90 C;  5M3F G;  5FLM H;  4NXM L;  4LF5 L;  1X3F A;  1SRO A;  4DV0 L;  2DUD A;  1Y1W H;  4DR4 L;  1FVI A;  1J6Q A;  2VL6 A;  4OWT B;  4DUY L;  1MJE A;  4JBM A;  4C3J H;  5IP9 G;  3A74 A;  3FHW A;  1A8V A;  5LMU Q;  4JI0 L;  3KDF B;  3I4N G;  3KOJ A;  2I0Q A;  1Q86 C;  3RLN A;  1UWV A;  2V1C C;  2IX0 A;  3M4Q A;  4DK6 C;  1HH2 P;  3S1Q H;  3PUX A;  4A93 H;  3GD7 A;  3ULL A;  1NY4 A;  4DV2 L;  3I55 A;  2R93 G;  4B3R Q;  1LM0 A;  2JEB I;  4B3S Q;  1Q12 A;  3D0F A;  5LMU L;  3GTK H;  5IP7 G;  2AWN A;  1WFQ A;  3CC4 A;  5C4X G;  2A19 A;  3KJP A;  2JA5 G;  4LFB L;  1A63 A;  1KIX A;  3EIV A;  4BA2 I;  1HNX Q;  3BU2 A;  1VQH A;  1Y1V G;  2JE6 I;  3MEF A;  1VQG A;  4B3T Q;  1WCM H;  2VQF Q;  4B3S L;  4K0K Q;  2Q2T A;  2UUC L;  4MTN A;  2WB1 E;  3L2P A;  1OXU A;  2BA0 A;  1T9H A;  1BBU A;  2Y0S G;  2DGY A;  5IWA Q;  1I3Q H;  1G6P A;  1Q81 C;  1K9M C;  3A5Z B;  1GKH A;  4P73 A;  5ELN A;  3F2C A;  2VQF L;  4GNX B;  4B3T L;  1HR0 Q;  4LFC Q;  4A3G G;  4K0K L;  4JI6 L;  1O7I A;  4PZ8 A;  2QGQ A;  1J5E Q;  1N32 Q;  3RLF A;  3DM3 A;  4DUZ Q;  4L5T A;  3CCQ A;  3J81 i;  4GLX A;  3UDG A;  1KAW A;  2Z0S A;  4WJ3 M;  1VQJ A;  5EAY A;  5IWA L;  1VQI A;  1VQ4 A;  5GAG C;  2B63 H;  4C2M H;  1YHQ A;  4LFC L;  3H0G H;  3M4P A;  3Q8D A;  2UUB Q;  4A3B G;  4A3F H;  5HGQ A;  3HOV G;  4B3M Q;  3NEM A;  4YCU A;  2QA4 A;  1J5E L;  4BXX G;  1N32 L;  4YCW A;  4DUZ L;  2EXD A;  4YWK A;  4QGU A;  4ME3 A;  1N33 Q;  1VQE A;  3HKZ E;  1I6H H;  2LSS A;  2WAQ E;  2F52 A;  1XTD A;  2UUB L;  1YHB A;  3HOY H;  3KFU A;  2E8G A;  4B3M L;  1IBL Q;  2OTJ A;  2H5X A;  4YCV A;  4LF8 L;  1CUK A;  3CCE A;  4J15 A;  4GLV B;  4A93 G;  3M3Y H;  3G4S A;  1YIT A;  1HZB A;  1QUQ A;  1UEB A;  4TVA B;  4EQ5 A;  4DR3 Q;  1IBL L;  1LYL A;  1PH1 A;  3E9I A;  1EUJ A;  3HKS A;  3NEL A;  1GD7 A;  4QIW E;  4APV A;  1XPO A;  4X65 L;  1N34 Q;  1MKH A;  4YWM A;  4LF6 Q;  1SMX A;  5JEA J;  3S16 H;  3GTP H;  4IPG A;  1EIF A;  5IYC G;  1FGU A;  1TWC H;  4JG2 A;  4LF7 Q;  5IYD H;  5FJ8 H;  2RHS B;  1X6O A;  2I5H A;  1AE2 A;  4GLA C;  2ZJR A;  1RL2 A;  1U5K A;  3FP9 A;  4DV1 Q;  4DR1 Q;  1K8A C;  5M3M G;  1C7Y A;  4LF4 Q;  4OO1 G;  4B3R L;  1N34 L;  2MFI A;  4KHZ A;  5IE8 A;  4A3K H;  4NXN Q;  2RF4 A;  5IP9 H;  1V9P A;  4X62 Q;  4LF7 L;  2R7Z G;  1OXS C;  3LGJ A;  1HR0 W;  4DV1 L;  3G48 A;  3I4N H;  4LF4 L;  1CKM A;  2N49 A;  1N8R C;  1A62 A;  2JA9 A;  2R93 H;  1WJJ A;  3CCM A;  4L5S A;  2VNU D;  3S14 H;  4X62 L;  1Q46 A;  1PA6 A;  5H1S E;  4AYB E;  2B63 G;  1NMF A;  1PYS B;  2OWO A;  3H0G G;  5IP7 H;  4DV5 Q;  1YHA A;  4GOP B;  1W3S A;  1WOC A;  3CP0 A;  4P75 A;  5C4X H;  1JE5 A;  4LUZ A;  2JA5 H;  2UXC L;  3HOX H;  1EQQ A;  1Y1V H;  2JK8 A;  5C0X G;  4HIK A;  4KI0 A;  1Q82 C;  2BH2 A;  3ICE A;  4RMF A;  1BBW A;  5GAD C;  3RN5 A;  4JI4 Q;  4OWW B;  1XNQ Q;  2KEN A;  5ELO A;  5BR8 Q;  4JV5 Q;  1C0A A;  4DV5 L;  1DGS A;  3TQY A;  1V43 A;  1KD1 C;  1VQ6 A;  1PVO A;  2GVB A;  5C44 G;  4IPC A;  1K3R A;  4O0A A;  1XMQ Q;  2NVQ H;  1XNQ L;  4IJH A;  5BR8 L;  4JV5 L;  4R4T A;  3A5U A;  4P74 A;  2VW9 A;  2MO1 A;  4XIG S;  2NVX H;  3L7Z C;  2CQO A;  5JJK A;  1EOV A;  2JEA I;  1XMQ L;  2HHH Q;  1PYB A;  4HJ5 A;  2YYZ A;  1CSQ A;  2KHJ A;  4A76 A;  3T1H Q;  1XPU A;  3HOW H;  1SRU A;  1XPR A;  2ES2 A;  4GKK Q;  5GQO A;  4BXX H;  4IFD I;  3S2D H;  2XGT A;  2I5M X;  5FJ8 G;  2E2H H;  1D7Q A;  4A3J G;  3RZO H;  5HY6 A;  3SGI A;  1VQB A;  2CWP A;  4EX5 A;  4A3K G;  2HHH L;  1IYJ B;  2VZA A;  4C3H H;  1HJP A;  4NB3 A;  3KF8 B;  1SE8 A;  1AH9 A;  2VS1 A;  3HOZ H;  2N78 A;  3H3V H;  2IX1 A;  2YTY A;  4X64 Q;  2K14 A;  1E3P A;  3JAM c;  4AH6 A;  2EIF A;  1VCI A;  3S15 H;  1Q1E A;  3GTG H;  2QEX A;  2F4V Q;  1EWI A;  2GN5 A;  1FJG Q;  3GTO H;  2R7D A;  2NVT H;  5M5W H;  4BY7 G;  4X64 L;  4GN4 B;  5IYC H;  2LXK A;  2Z6K C;  3M9B A;  3HOX G;  4JI7 Q;  3G6E A;  4NPS A;  3S1R H;  4A3E G;  3S24 A;  2Z6K A;  1TWH H;  2ZM6 Q;  1G51 A;  3MXN B;  4PG3 A;  5M3M H;  1FJG L;  4DNI A;  2E5L Q;  3K81 C;  3PUY A;  1NBW A;  2ASB A;  3PGZ A;  3ER0 A;  4TQU S;  1HNX L;  4JI7 L;  2R7Z H;  4QQB X;  3D31 A;  1PH9 A;  2OCE A;  3F8T A;  2EQS A;  3ZJY C;  2ZM6 L;  2JA7 G;  5K36 G;  1EIY B;  4YHH Q;  2Y0S E;  3KDF A;  2E5L L;  1VQC A;  2R92 H;  2K52 A;  2ALY B;  3I7F A;  4A3L G;  2BH8 A;  4O2D A;  1XNR Q;  1S3O A;  3PIO A;  4YWL A;  2CWA A;  1G29 1;  4IPH A;  1HR0 L;  3HOW G;  4DAM A;  3PUV A;  1VQL A;  4WJ4 A;  2GVA A;  4YHH L;  2K5N A;  2CCZ A;  1M1K C;  4R4Q A;  1VQM A;  1I94 Q;  4GN5 A;  4GN3 B;  1XNR L;  3S17 H;  4ALP A;  1YJ9 A;  3AQQ A;  2K4K A;  2K5V A;  4BA1 I;  3PF5 A;  4H02 A;  1KRS A;  3U50 C;  4KLK A;  4DK3 C;  4JI3 Q;  1PH8 A;  2HIX A;  3JAM i;  5C44 H;  3HOZ G;  1I94 L;  4GNX C;  1N33 L;  4A3C G;  1L0W A;  1VQ8 A;  4RG1 A;  3AFP A;  2NN6 G;  4GNX A;  3CPF A;  1E1T A;  1BVS A;  5DLQ E;  3CCS A;  3E0E A;  1VQ7 A;  4LUV A;  4JCV E;  2K5H A;  4X6A H;  3GDE A;  5GRO A;  2R7F A;  1PH7 A;  3UDX A;  4DR6 Q;  2VUM H;  2CKZ B;  3GTM H;  3KJO A;  2JA8 H;  1VQD A;  2D0O A;  1JT8 A;  1YEZ A;  4DR3 L;  1E22 A;  4A3J H;  3GO5 A;  4LF6 L;  1I50 H;  3B6Y A;  3UDI A;  5M5Y H;  1PH2 A;  2MNA A;  3M4O H;  1H95 A;  2BA1 A;  1K8G A;  1JJG A;  4HIO A;  4IOA A;  4DR1 L;  1NTG A;  4MNO A;  4PZ6 A;  1UE1 A;  2YU9 H;  4JBJ A;  2R92 G;  4NXN L;  4A3D G;  1X3E A;  3E9H A;  4GS3 A;  4DKA C;  1UE6 A;  4IFD G;  1X9N A;  4BBS G;  2ZTC A;  2UU9 Q;  4BY7 H;  2Q2I A;  3STB D;  1HNZ Q;  1EQR A;  3RNU A;  1OXT A;  4IOC A;  1HZC A;  4HIM A;  4A3E H;  2ZTE A;  1Z47 A;  3K80 C;  4PMW A;  2D0P A;  4A3M H;  1U0L A;  2UU9 L;  4UPA A;  4JC0 A;  1L1O B;  1HNZ L;  4JBK A;  4POG A; 
#chains in the Genus database with same CATH topology
 5KYI A;  3E0J A;  1GXD C;  2NZO A;  1EZ8 A;  4BBR G;  2Q8R E;  4OHJ A;  2IWH A;  1N36 L;  5LL6 S;  1RJT A;  1Q90 A;  1W6J A;  3TRZ A;  1IYV A;  3PV0 A;  2OF1 A;  5KNC A;  4GOP A;  3OTO Q;  3CQZ H;  3MXP A;  1TII D;  4LMQ D;  1Y1W B;  5C3E B;  3PO3 G;  4C3I B;  2CQA A;  4GKK L;  2HIV A;  4IUT A;  1KHI A;  2WP8 J;  4GZY C;  1BNZ A;  2B39 A;  4JI8 L;  5FLX c;  4DR2 Q;  3C46 A;  4JOI C;  4QIW B;  3D4D A;  5M5X H;  3AYH B;  1PV4 A;  3UE1 A;  2F0N A;  2KCN A;  1PH6 A;  3STB C;  4DR4 Q;  2JN4 A;  3FPP A;  4JI0 Q;  1KNE A;  5IT9 L;  2Z6B A;  2K33 A;  4L8J A;  5LHY 1;  1PTO B;  2F4V L;  2AQ2 B;  3VR6 A;  3KF6 A;  1GUT A;  3C3L A;  1X65 A;  2PI2 A;  3OW2 A;  3AB9 A;  2H1E A;  4H7B A;  2KCM A;  3TEH B;  4JI2 Q;  1KXL A;  4BY1 B;  4FXD A;  3H09 A;  2OT2 A;  2L5T A;  2EYM A;  1QVC A;  2NVY B;  3LNN A;  1CA5 A;  2LFN A;  4DV3 L;  1OXX K;  4RAU C;  3BVM A;  2F03 A;  3K7U C;  2EJM A;  3K7A H;  1EY0 A;  4XTC S;  5IYB H;  2ZXP A;  3BS1 A;  2G9H D;  4DU9 A;  2AKW B;  4EQN A;  5KYL A;  3S1M B;  1QUQ B;  1EFW A;  1HHV A;  2EPB A;  2JSO A;  2LXJ A;  3OYY A;  1EYG A;  1YVC A;  3MEH A;  4DV7 Q;  2X69 A;  1XMO Q;  5E3F A;  2WAQ G;  1S5F D;  4KMU C;  3L0O A;  4U68 A;  1YNX A;  1SE4 A;  1VS0 A;  1EY8 A;  2J0T D;  3KYH C;  3TRE A;  2JQO A;  2KHI A;  4WFN 3;  1JWU D;  3C1E A;  4PZ7 A;  4KHV A;  2PCF B;  3OMG A;  1MD2 D;  5KND A;  1A2T A;  3KK7 A;  4X65 Q;  1Q8K A;  3RZD H;  3I4N B;  2CVR A;  4X66 L;  2AHO B;  3D3R A;  3PUZ A;  3ERS X;  1GM5 A;  1K0R A;  1L0X B;  1TWG H;  4OIK A;  2A6H D;  2R93 B;  1EYA A;  3I4M H;  1STN A;  3FEW X;  4HJ8 A;  3PO2 H;  5DM6 3;  3S2H H;  2JA5 B;  1Y8P B;  1B70 B;  1F2L A;  4UP9 A;  1WCM G;  3BDO A;  5M3F H;  1S5B D;  1HA5 A;  1TWF B;  1H9R A;  5E7N A;  3WDN A;  5FKA C;  3VYT A;  5IYB G;  1NJI C;  3CCL A;  1GUW A;  4OON A;  5FOB B;  2BOS A;  4WJW A;  4DR7 Q;  3I91 A;  4AYB G;  1S40 A;  2NVQ B;  4DPG A;  3TP6 A;  3CAM A;  1IBM Q;  1WI5 A;  2K01 A;  3JC6 6;  2A6E D;  1ENF A;  4DV6 Q;  1TWA H;  3MXG A;  1SFO H;  1UE5 A;  1HNW L;  2OQ0 A;  1HFN A;  1WTX A;  3O13 A;  2DN8 A;  3A7L A;  1EIG A;  1IKL A;  1QIL A;  4KD3 A;  2J7Z A;  4ZUJ A;  5AJ3 Q;  4K5V A;  3CCJ A;  2VB3 X;  3E5S A;  4A3G H;  5LMN Q;  3SK5 A;  1PTO D;  1NAP A;  5FK9 C;  5CV8 A;  2UXB Q;  4A93 B;  2DNC A;  4LF5 Q;  4MIU A;  2NZH A;  5CV6 A;  3J80 i;  1IBK L;  5DEH A;  4R8N A;  4DUY Q;  4FXG C;  4C1N K;  4IN3 A;  5J22 A;  2IHF A;  2YV5 A;  3FPU B;  1QE6 A;  5M3F G;  3S1R B;  1MHW C;  1Y1W H;  2EY1 A;  1J6Q A;  1TS4 A;  1MJE A;  4DR4 L;  5IP9 G;  3SDZ A;  2A68 D;  3FHW A;  1LTI D;  2XWB B;  3X3N A;  1II3 A;  3K5N A;  4JI0 L;  4DK6 C;  4CJ1 B;  5I2X A;  3I55 A;  2JEB I;  1Q12 A;  3D0F A;  5LMU L;  1VDZ A;  3CC4 A;  2F0V A;  2NZ1 D;  1A63 A;  3EIV A;  4PV1 C;  3BDL A;  3DEO A;  2Q2T A;  1PTO H;  4MTN A;  1LT5 D;  2BA0 A;  1CZW A;  1BBU A;  2Y0S G;  5BN3 A;  3K5M A;  1G6P A;  1LT3 D;  5CV7 A;  4A3G G;  1HR0 Q;  2N88 A;  2X6L A;  2QGQ A;  4P2C B;  1J5E Q;  1N32 Q;  3RLF A;  2L0C A;  4GLX A;  2Z0S A;  5EAY A;  5IWA L;  1BQQ T;  3NQT A;  3T4A C;  4K14 A;  3H0G H;  3Q8D A;  4K8I A;  5HGQ A;  4B3M Q;  2KEE A;  4DUZ L;  3URY A;  1E2W A;  1A15 A;  5C0X H;  2HD3 A;  2V4D A;  1VQE A;  3HKZ E;  1TVX A;  2QCP X;  2UUB L;  1E0B A;  2E8G A;  3M4O B;  2RDH A;  4IUV A;  3K5L A;  1JR0 D;  1H9M A;  3CCE A;  5HUR A;  3M3Y H;  3K59 A;  1QB5 D;  1XX8 A;  2HQE A;  4DAP A;  4EQ5 A;  3DM1 A;  4TVA B;  3HKS A;  1FD7 D;  5G3L D;  4B3R Q;  4X65 L;  1MKH A;  1LTR D;  2HDM A;  5JEA J;  4IPG A;  3M7G A;  5IYD H;  5FJ8 H;  1WTW A;  1V1P B;  2I5H A;  1AE2 A;  3PF4 A;  1IKM A;  1D5Z C;  1ICF B;  5CV4 A;  3SVM A;  1QWY A;  5M3M G;  4A3K H;  4KKS A;  2PW7 A;  4X62 Q;  2AUK A;  5BN5 A;  3I4N H;  3G48 A;  2B2T C;  4LF4 L;  5ELF A;  4OIJ A;  3G6J B;  2R93 H;  1WJJ A;  5CV9 A;  3QR8 A;  2EZV A;  2A74 C;  2WV6 D;  1NMF A;  1PYS B;  3VYS A;  2OWO A;  3H0G G;  3CP0 A;  1F2Z A;  2JA5 H;  2SNS A;  5C0X G;  5KGU A;  4KI0 A;  2NBF A;  1GUN A;  1BBW A;  1XNQ Q;  3VR3 A;  4JV5 Q;  4DV5 L;  3TQY A;  3D4W A;  4C3H B;  1Z6H A;  1PTO F;  1XMQ Q;  2F0H A;  1HCZ A;  1LTA D;  3QOL A;  2NVQ H;  3EJI A;  5BR8 L;  4R4T A;  3L7Z C;  2CQO A;  1J9O A;  3MFY A;  4A3B H;  3T1H Q;  1CSQ A;  4WRD A;  1XPR A;  1GHJ A;  5FJ8 G;  2B8G A;  2CWP A;  4A3K G;  5EQ0 A;  2VZA A;  1HFG A;  1H9K A;  1EQV A;  4K6D A;  3KF8 B;  2R7Z B;  5C4J B;  4CJ2 C;  4HCE A;  2YTY A;  4X64 Q;  1SDF A;  2K14 A;  1E3P A;  3JAM c;  3H3V C;  1J8I A;  3H91 A;  2M2L A;  1EY7 A;  3D4R A;  1VF5 C;  1BBX C;  3VA7 A;  4BBS B;  1U4R A;  5IYC H;  1TKW B;  3V05 A;  1RTO A;  4JI7 Q;  3G6E A;  4NPS A;  3S1R H;  1EEI D;  4DF7 A;  4DK0 A;  4CDF C;  2WAC A;  2E5L Q;  3K81 C;  3PUY A;  4KK7 A;  1S5D D;  3LWU A;  1I6V C;  3DMU A;  5K36 G;  1CZG A;  4XQJ A;  3GTJ B;  2JA7 G;  2JP1 A;  2RDG A;  4BBR B;  4KJO A;  2R92 H;  2ALY B;  3I7F A;  1ROD A;  3PIO A;  4YWL A;  2CWA A;  1B50 A;  1HR0 L;  4DAM A;  3PUV A;  1VQL A;  1SE2 A;  1R4P B;  2XRQ D;  4RHR A;  1ZKO A;  3J80 L;  1EQT A;  5IGG A;  1VQM A;  1LTB D;  4CDC C;  3GTP B;  2M9V A;  4CHT B;  4O1N A;  2K4K A;  2K5V A;  4BA1 I;  3PO3 B;  4H02 A;  1JE4 A;  2WKD A;  1PH8 A;  2IX3 A;  3VR5 A;  1STB A;  3K57 A;  4GNX C;  1UEA B;  4FF4 A;  1HQR D;  4NDX A;  4JCV E;  3DWQ A;  1PH7 A;  4DR6 Q;  2VUM H;  3D8G A;  3BG3 A;  3KJO A;  4Q0F A;  1H9S A;  2E75 C;  1TS3 A;  3P20 A;  1H95 A;  3EVQ A;  3VYR A;  3M4O H;  2BA1 A;  2VXW A;  1HRJ A;  4PZ6 A;  2B2Y C;  1Z7T A;  2R92 G;  2E2J B;  1X3E A;  4GS3 A;  1DON A;  1UE6 A;  4IFD G;  2ZTC A;  2UU9 Q;  3STB D;  2ZTE A;  2ZXR A;  3CQZ B;  5CBA E;  4ZUI A;  3UI2 A;  4UPA A;  4EVO A;  2A5H A;  1BDO A;  4EGV A;  1N36 Q;  1CT1 D;  2I5L X;  4H44 C;  4IPD A;  4RGT A;  5CR3 A;  5M5X B;  4KY5 A;  4J8Q A;  3JAM E;  1IL8 A;  3J7A V;  5IGD A;  3RR5 A;  1ML0 D;  2Z4I A;  5IIF A;  1ONL A;  2WAQ B;  5JJZ A;  2VUM G;  3I70 A;  4GOP C;  4JI8 Q;  4CKC A;  1PH3 A;  5GAH C;  3KUP A;  3GQB A;  4FDB A;  5D14 A;  5J3B A;  4KHP L;  1AE3 A;  3MA2 B;  3PIP 3;  1GVP A;  3M4Y A;  5EBD A;  1RIP A;  3TS2 A;  3PMF A;  1JJ2 A;  1OTC A;  3K8A A;  3T1H L;  4DK1 A;  3J7Y W;  3HEJ A;  4EQO A;  4DNR B;  4A4I A;  2L4N A;  4FP5 D;  4OWX B;  2HT1 A;  4JI1 L;  3GTK B;  3NBH B;  3LX0 A;  1SYF A;  5ELC A;  1Y14 B;  3P1H A;  2IY5 B;  2FHT A;  3NE5 B;  4RGM A;  4WOR A;  4TRD A;  3CC7 A;  5FO8 B;  2Z1C A;  1WCM B;  5IGE A;  4LNQ A;  1SYE A;  4DV2 Q;  3VA5 A;  3F2U A;  1UE7 A;  1B9M A;  1CSP A;  4O42 A;  1ILP A;  1JOQ A;  4XQN A;  2R6G A;  4Y7N H;  3PUW A;  4IQZ A;  1IZ6 A;  2EYF A;  5C4J H;  4DV3 Q;  1MSH A;  4TSS A;  1ILQ A;  4HJA A;  1A3T A;  3CXC A;  3G71 A;  4A3D H;  3ERQ A;  3BJU A;  1YNJ C;  2KCT A;  1LTS D;  1KQS A;  4BBS H;  3IRB A;  4RA8 A;  5ISR A;  4JI6 Q;  2AWO A;  3U58 A;  1I6H B;  5ELD A;  3NXW A;  3HOU H;  2N8N A;  2VY3 A;  2DJG C;  3QWN A;  2RDF A;  5LMN W;  1P8L A;  1SE3 A;  1HXY D;  3MXN A;  3H15 A;  1ICW A;  3NBI A;  2K50 A;  4ULL A;  2PMZ E;  4K2L A;  3GTJ H;  1TWG B;  2XTI A;  4BBR H;  1JJC B;  5J39 A;  4UP8 A;  5IT9 c;  2HDL A;  2O2L D;  3I4M B;  3CMA A;  3PO2 B;  4B08 A;  3S2H B;  1YJN A;  3QIA A;  1LTG D;  5EBC A;  3KBG A;  5D65 A;  1P16 A;  5M3F B;  1XYI A;  4X66 Q;  1VQP A;  1VMP A;  3GTP H;  5EKI A;  4C3J G;  4QL5 A;  1BF4 A;  3PO3 H;  4DR6 L;  4ZK9 B;  1IW7 C;  3DHQ A;  4F8M A;  4L6T B;  1HZ9 A;  1BOS A;  4AIM A;  4KN4 C;  1W6K A;  1TWA B;  1SFO B;  1W2B A;  3SHL A;  3BZK A;  1STG A;  3I90 A;  4FF3 A;  1AZQ A;  3K0X A;  2EVB A;  3LWE A;  3Q22 A;  1RDP D;  2OQK A;  2F3I A;  4ODG A;  4C56 C;  3HOU G;  4PNY A;  1F2Y A;  1I4R A;  2Y0S B;  3WOE A;  1ASZ A;  3CRK C;  4ILW A;  5E1F A;  1ASY A;  4A3G B;  1HNW Q;  2HCI A;  2UXC Q;  2ICE C;  3NPP A;  2EDG A;  1NCV A;  1VQA A;  5CV5 A;  2OTL A;  2E2J H;  3EN2 A;  1GO3 E;  1OXV A;  2NN6 I;  1WYD A;  1YJW A;  3GV3 A;  4A3F G;  1E24 A;  1KL9 A;  4HID A;  2UXD L;  4LFA L;  2XSC A;  3J81 j;  4I7A A;  5IY0 A;  2HQL A;  4HJ9 A;  4ZLT F;  1IBK Q;  2HCC A;  3CW2 C;  4MHE A;  4CJ0 B;  3L9A X;  3D6C A;  1B1Z A;  4CKE A;  3CRL C;  1L1O A;  3BVG A;  3Q0A A;  1CHP D;  4FXK C;  3GTG B;  2AUJ D;  1JMC A;  3QJY A;  2O4X A;  1QVG A;  3RLO A;  2FXQ A;  3HOV H;  4IZ8 A;  2F0U A;  1RF2 D;  4NXM L;  1SRO A;  3FRP B;  5M3M B;  3AU7 A;  1MGS A;  3ERO A;  4EQP A;  4JBM A;  1DXM A;  1BCP F;  5LMU Q;  3KDF B;  4DXF A;  2I0Q A;  2AQ1 B;  1Q86 C;  1Y8N B;  2PPB C;  3TBI B;  3GD7 A;  4DV2 L;  1LM0 A;  4X3T A;  1D1I A;  5EPJ A;  3TZD A;  2XRS D;  3GTK H;  4OGQ C;  4QUC A;  4KD4 A;  3OPO A;  2F3V A;  3MHB A;  3H0G B;  2SNM A;  1SEB D;  1KIX A;  4I65 A;  1FNV A;  1Y1V G;  1VQG A;  1WCM H;  4B3S L;  4OO1 H;  1EOT A;  2WB1 E;  3S17 B;  1TS5 A;  3MXU A;  3HG9 A;  2DGY A;  5IWA Q;  1RD9 D;  1K9M C;  1DOK A;  3A5Z B;  1B3A A;  4GNX B;  3C1F A;  4B3T L;  3A7A B;  4K0K L;  4JI6 L;  1O7I A;  4KV6 A;  3M3Y B;  4DUZ Q;  4V0B A;  2EYO A;  2PYK A;  1VQ4 A;  2B63 H;  1WTQ A;  1YHQ A;  4G57 A;  3C2P A;  2UUB Q;  1STY A;  3RUZ A;  3HOV G;  3RMH A;  4BXX G;  2QA4 A;  2EJF C;  2QDL A;  1PDQ A;  1BCP C;  1I6H H;  3BYY B;  2F52 A;  4A3K B;  2C9O A;  5L37 A;  4HED A;  1BXT A;  1CUK A;  1D1K A;  1NSN S;  2MP1 A;  1HZB A;  2K28 A;  2ZXO A;  3BYT B;  5D3I B;  3BVZ A;  2F0M A;  1GD7 A;  4QIW E;  4APV A;  1XPO A;  1U9R A;  1U4P A;  1EIF A;  1FGU A;  1EWH A;  1TWC H;  1I4X A;  1TQO A;  2KED A;  2F4I A;  3FMC A;  1RL2 A;  3FP9 A;  5FO7 B;  1K8A C;  4LF4 Q;  4OO1 G;  4DAY A;  1N34 L;  2MFI A;  5C5L A;  4DAV A;  3OSO A;  1KDC A;  2PQE A;  5IP9 H;  4LF7 L;  4K5X A;  3LGJ A;  2OEO A;  4XDX A;  5I6Y A;  4G4K A;  2E2I B;  1N8R C;  5FLX E;  1I4H A;  1PFN A;  1Q8I A;  1PA6 A;  2FMC A;  2TMP A;  2B63 G;  1DZ1 A;  1SYG A;  4DV5 Q;  4GOP B;  1WOC A;  4A3B B;  1JE5 A;  4LUZ A;  1BR9 A;  4YIJ A;  4FF1 A;  2UXC L;  4OEM B;  1R9T B;  2KCC A;  2DJF C;  2JK8 A;  1Q82 C;  4DFA A;  4RMF A;  4JI4 Q;  3QO2 A;  1C0A A;  5BR8 Q;  1TR5 A;  1LAB A;  4ZYS A;  1V1P A;  4KY7 A;  1DGS A;  1KD1 C;  5C44 G;  1HPC A;  4O0A A;  4RGO S;  4JPB W;  1SYC A;  3HS0 C;  2NVX H;  2NWG A;  1EOV A;  2K7V A;  3T53 B;  3HOW H;  1PYB A;  1XPU A;  2YYZ A;  2KHJ A;  3S2D H;  2XGT A;  5EPK A;  2B2U A;  4A3J G;  1GHK A;  1PFB A;  1IYJ B;  3GTQ B;  1SSO A;  3MFG A;  3MZ5 A;  4PQX A;  1AH9 A;  2VS1 A;  3HOZ H;  2N78 A;  3H3V H;  2IX1 A;  2SOB A;  1LAC A;  1JC7 A;  4ZRZ A;  2D5D A;  2EIF A;  3GTG H;  2R92 B;  3SEB A;  2NVT H;  1QOH A;  5M5W H;  4BY7 G;  4RH6 A;  1KTK A;  3Q24 A;  4A3E G;  2Z6K A;  5T1G A;  4PG3 A;  5M3M H;  3ZYY X;  4DNI A;  4RFB A;  2RSO A;  2ASB A;  1NBW A;  1PMR A;  4N9T A;  1KLU D;  3D31 A;  4JVZ A;  2OCE A;  2EQS A;  3ZJY C;  1ZEQ X;  5I6W A;  3KF8 A;  4XT1 B;  1VQC A;  3TME A;  2K52 A;  4ZAI A;  4A3L G;  4O2D A;  1X3Q A;  4HSV A;  3HOW G;  1ZXT A;  2MHV A;  4RCO A;  2VUM B;  4YHH L;  2K5N A;  2CCZ A;  5C4Z A;  1M1K C;  1FGB D;  1XNR L;  4CGY B;  3S17 H;  5E4X A;  1KRS A;  2K05 A;  4KLK A;  1EZ6 A;  1F9R A;  3JAM i;  5CMD A;  4UAI A;  3HOZ G;  2QKI C;  3IKJ A;  4A3C G;  2G5D A;  1L0W A;  3OIP A;  1VQ8 A;  1Y69 U;  3CCS A;  1E1T A;  1BVS A;  4NMZ A;  1VQ7 A;  4LUV A;  2K5H A;  2R7F A;  1SAP A;  3UDX A;  2RA4 A;  2JA8 H;  1VQD A;  4ID6 A;  3SK4 A;  5EPL A;  4C3I G;  1AW7 A;  1AZP A;  3UDI A;  1PH2 A;  1SJE D;  1K8G A;  1JJG A;  4IOA A;  4MNO A;  3I3C A;  4JBJ A;  1O7Z A;  2DNE A;  3E9H A;  2NTS A;  3A54 A;  1JOO A;  1JWM D;  2Q2I A;  1TT2 A;  2RQX A;  3RNU A;  1DM0 B;  3K80 C;  4PMW A;  2D0P A;  4K5W A;  3G7L A;  4A3M H;  1U0L A;  2JYO A;  3U9S A;  2H4O A;  1HNZ L;  4XQQ A;  1Z9F A;  1B7Y B;  3K5O A;  1UUP A;  4N9P A;  2BE5 C;  2E2I H;  4OEL B;  2GA4 B;  1D2B A;  1G6Z A;  3W5O A;  4JI4 L;  4LK1 C;  2JA7 H;  1VQ5 A;  5K36 H;  5JJI A;  3ND8 A;  4KHP Q;  1K8M A;  1PFS A;  4AQY L;  1A0I A;  2MPM A;  5IGF A;  1LT4 D;  3I4O A;  3AFQ A;  3OWF A;  3T1Y L;  1R9T H;  2JA8 G;  1YNJ D;  3MWY W;  4POF A;  2CFM A;  3DEP A;  2SDF A;  2ATW A;  4R9W A;  3N52 A;  4ZCK A;  4C3J B;  1PH5 A;  2RHQ B;  3CPW A;  1AFP A;  2KQ3 A;  4JI1 Q;  5C3X A;  3UE0 A;  4Y7N B;  1E7Z A;  2F0O A;  3HRZ C;  3EQL C;  3OWE B;  2WFW A;  2D2C C;  3ULJ A;  3PCO B;  1C9O A;  2C35 B;  4A3D B;  1RTN A;  4HSP A;  2PNH A;  2NB0 A;  5C0X I;  1QZG A;  2EYP A;  1VF7 A;  4A3M G;  3HOU B;  4ZKC B;  3GTQ H;  3FKI G;  5COY A;  3QOJ A;  3M85 A;  3OHX C;  5GAE C;  2ID0 A;  1NE3 A;  1IW7 D;  4BS9 A;  1B53 A;  3NEN A;  1YIJ A;  1O78 A;  5CYU A;  4IFD H;  1GJX A;  5EJW A;  4A3F B;  2K04 A;  4KTA A;  3UDF A;  3NBH A;  5I2Y A;  2CH4 W;  2TSS A;  1BCP B;  2A1A A;  2JA6 G;  3W1B A;  1K73 C;  2KBN A;  5NUC A;  4YY3 L;  1AN8 A;  4IUP A;  1MI2 A;  3I8Z A;  4X3K A;  4QCL A;  3MAQ A;  1XJV A;  3CCV A;  3SK8 A;  1LTT D;  4HJ7 A;  1KDB A;  1SYB A;  1WTH A;  1PFM A;  3HKZ G;  1SXT A;  4DR5 L;  1YI2 A;  2L15 A;  5FLM G;  4LF8 Q;  5JEA G;  4R4O A;  2F0J A;  4LWC A;  4QY7 A;  2EY6 A;  2F0S A;  1LUZ A;  3BZD B;  4LW1 A;  4A75 A;  1CKN B;  1VQK A;  3T13 A;  2UUA L;  2RCN A;  3GTL H;  2IT1 A;  3AEV A;  1F9S A;  3I2Z A;  1I4Q A;  2KHS A;  4A3I H;  4DNT B;  1FL0 A;  3CCU A;  2EYJ A;  3S9W A;  3ULP A;  3U4Z A;  1QJO A;  3CF5 A;  3RN2 A;  2QF7 A;  1JQY D;  1PXU A;  2L11 A;  4I7Z C;  2FJ2 A;  1IL2 A;  2R3Z A;  3TZU A;  1Y1V B;  4XT3 B;  3F2D A;  1KRT A;  4OX9 L;  1V1Q A;  5E4W C;  4GKJ L;  4M1U B;  1SLJ A;  3KLS X;  2DY7 A;  2JJQ A;  1ESF A;  1N9W A;  4DGZ A;  2F0Q A;  2UXD Q;  4LFA Q;  2AQ3 B;  5A35 A;  2PQA B;  1LTL A;  3JAM L;  2RVL A;  4LUO A;  4JYA L;  1K3B C;  3HOV B;  3BZC A;  2O5I C;  1EYD A;  4JI5 L;  3VDY A;  1JIC A;  4R1J A;  4MZ9 A;  4E6I A;  4P72 A;  3HOY G;  2QDB A;  1QNK A;  3NUC A;  2VQE L;  1L1O C;  4A3I G;  1I5F A;  1C48 A;  3DWP A;  2E74 C;  4KN7 C;  1SBB B;  4NXM Q;  3SK6 A;  3J7A 5;  1A6X A;  1VQF A;  4LF9 L;  3J81 c;  1F9Q A;  3I56 A;  1SN8 A;  2ZJQ A;  2L12 A;  3FVQ A;  4DV4 L;  3F2B A;  1MJC A;  2K75 A;  3NP8 A;  1X3F A;  4DA2 A;  1JCK B;  2FIN B;  4TKO B;  1FVI A;  1SNO A;  1M8A A;  5JOB A;  4C3J H;  4MN3 A;  1A8V A;  2XIW A;  1BCP D;  3KOJ A;  3R93 A;  3RLN A;  1HUN A;  2V1C C;  2IX0 A;  5C4H A;  3S1Q H;  1ENA A;  1RHP A;  4AYB B;  3ULL A;  1NY4 A;  4B9X A;  2PZU A;  2ZT9 C;  4B3S Q;  5IP7 G;  2AWN A;  2B63 B;  1RCV D;  5C4X G;  2WKC A;  3BU2 A;  1VQH A;  2JE6 I;  3MEF A;  4B3T Q;  4KKU A;  4K0K Q;  5KNB A;  3RD4 A;  2Q8I B;  1CI3 M;  1I3Q H;  3CKI B;  4HAE A;  1GKH A;  3F2C A;  4DN4 M;  2VQF L;  2KUM A;  1WTO A;  3V96 A;  1V8Q A;  1D5M C;  2B8F A;  4L5T A;  3UDG A;  1KAW A;  4WJ3 M;  1QCB D;  1VQI A;  5GAG C;  4C2M H;  4LFC L;  4A3F H;  3NEM A;  4HTH A;  3GTM B;  1ET9 A;  4RCN A;  1RKN A;  1TWC B;  2EXD A;  4YWK A;  4A3J B;  2EY2 A;  2WAQ E;  2IW3 A;  3IFD A;  1YHB A;  2A69 C;  3KFU A;  3QG1 A;  2OTJ A;  5M5Y B;  5A2Q E;  4F7X A;  2B2V A;  4YCV A;  4LF8 L;  1T5X D;  1U4L A;  4J15 A;  1FNU A;  1HTL D;  4GLV B;  1NNX A;  3G4S A;  1QUQ A;  2Z8L A;  1UEB A;  1E2Z A;  1IBL L;  3E9I A;  1FNW A;  1LLR D;  1TY2 A;  1N34 Q;  4LF6 Q;  1DYQ A;  4YWM A;  3S16 H;  1SMX A;  4CDE C;  2Z9H A;  3NTH A;  5JVG 3;  1G91 A;  4BY7 B;  5I9O A;  4LF7 Q;  4UHV A;  1X6O A;  4GLA C;  4XXE A;  2ZJR A;  4DR1 Q;  3TN2 A;  1JWS D;  2NTT A;  4A3E B;  1SND A;  4QMG A;  5ELB A;  1XWE A;  2CH4 A;  4KHZ A;  5IE8 A;  2RF4 A;  2RKS A;  3R3O A;  4MTK A;  1V9P A;  2R7Z G;  1OXS C;  4Z9C B;  1HR0 W;  4DV1 L;  1CKM A;  1EYC A;  4FNF A;  1T5E A;  1AEX A;  1SJH D;  4KJN A;  1Q46 A;  2XN9 C;  3V2T A;  4AYB E;  2NVX B;  3J81 E;  2A8V A;  5DM7 3;  3CD6 A;  1W3S A;  3HOW B;  3OOC A;  3HOX H;  4FVM A;  4U67 3;  3S2D B;  1Y1V H;  4HIK A;  3ICE A;  2BDN A;  3HGB A;  3ND9 A;  1NR2 A;  5ELO A;  1Y8O B;  3NTK A;  5CGK A;  1VQ6 A;  1DD2 A;  1PVO A;  2D9U A;  3K6O A;  3PQI A;  2GVB A;  4IPC A;  1EY5 A;  2NUC A;  3W3A A;  4IJH A;  3HOZ B;  2CW0 C;  1KDA A;  3A8K E;  2MO1 A;  4XIG S;  1A3U A;  2PW5 A;  3NWT A;  5JJK A;  2JEA I;  2KOL A;  4HMJ A;  4K2K A;  2NVT B;  4A76 A;  1SRU A;  5M5W B;  2ES2 A;  2B2U C;  4BXX H;  2I5M X;  2XWJ B;  1D7Q A;  1KAB A;  5CC4 A;  2HHH L;  2K6A A;  1GUO A;  4NB3 A;  4LAA A;  4NW2 A;  1NR4 A;  1SE8 A;  2EJG C;  4KKT A;  4X3U A;  2K5W A;  1L0Y B;  3S15 H;  1F77 A;  1Q1E A;  2QEX A;  1PYW D;  1EWI A;  1LO5 D;  2GN5 A;  1TS2 A;  1YNN C;  5DAU A;  2R7D A;  3N6R A;  5IT9 E;  3DUZ A;  2LXK A;  2Z6K C;  3M9B A;  3HOX G;  3K58 A;  5EKL A;  4RHS A;  2KJX A;  5I9P A;  5IOC A;  1TWH H;  3ITP A;  1G51 A;  3MXN B;  1FJG L;  1B4O A;  3TSS A;  1B44 D;  1EIH A;  2QIL A;  3DWA A;  3PGZ A;  4TQU S;  4QQB X;  4BWG B;  1CQV A;  1PH9 A;  3PIO 3;  2ZM6 L;  2I07 B;  1EIY B;  1G8Z D;  2Y0S E;  4YHH Q;  3KLR A;  3K0Y A;  1SNC A;  1GUS A;  2BH8 A;  3SXH A;  1XNR Q;  1CQF A;  1G29 1;  4IPH A;  4QUF A;  2RBM A;  1I4P A;  1SMY C;  2GVA A;  4WJ4 A;  3A56 A;  5LL6 X;  3NSW A;  4R4Q A;  2JA8 B;  2F0W A;  4GN5 A;  1ZYR C;  4IUN A;  1KLG D;  4NKL A;  4ALP A;  3AQQ A;  2EE1 A;  1JOK A;  4DK3 C;  4JI3 Q;  2N55 A;  4ABN A;  2HIX A;  5C44 H;  1I94 L;  3CU7 A;  1PRT F;  3E3X A;  3S1N B;  3T56 B;  3AFP A;  2BE5 D;  5TSS A;  4RKL A;  3E0E A;  2PO4 A;  2KA7 A;  2CKZ B;  3GTM H;  1TY0 A;  2MGS A;  1E22 A;  4A3J H;  3DXJ C;  3L3O C;  2EYH A;  4LF6 L;  1O7Y A;  1I50 H;  4A3M B;  3B6Y A;  5M5Y H;  4L63 B;  3FKI B;  4HIO A;  2F3W A;  4DR1 L;  1NTG A;  2EYL A;  2YU9 H;  2JA7 B;  1SNQ A;  5FLX L;  2OXP A;  3IL8 A;  4PMC A;  4BY7 H;  2RSN A;  1HNZ Q;  1EQR A;  4IUU A;  3A8J E;  1OXT A;  4IOC A;  2M00 A;  1HZC A;  4HIM A;  3R8B A;  4A3E H;  1Z47 A;  4FF2 A;  2JA6 B;  1A2U A;  5IOD A;  4JC0 A;  1L1O B;  4POG A;  2B2W A;  1PRT C;  4AQY Q;  4FO2 A;  2B29 A;  3Q6S A;  4RWS C;  3T1Y Q;  1YZ6 A;  1UNS A;  2Z4H A;  1PLF A;  4N8X 1;  4A3L H;  1Q3L A;  1BKB A;  1O7L A;  3HP3 A;  3HKZ B;  5C0X J;  4IJL A;  2BDO A;  4HCS A;  5BN4 A;  2MUY A;  3KF6 B;  5EGT A;  3OIQ A;  1X55 A;  1Q7Y C;  3D6W A;  1K83 H;  3SR1 A;  4OO1 I;  1DOM A;  3GP7 A;  3KLW A;  1HZA A;  3F1Z A;  4IO9 A;  2AMC B;  3OTO L;  2XNA C;  4G7H C;  4UY8 C;  3PIP A;  4JOI A;  4A3C H;  2L9H A;  4DV0 Q;  4QJF A;  3I4M G;  1JB7 A;  3PO2 G;  4DR2 L;  1L2F A;  1B8A A;  2PZW A;  3H94 A;  3T16 A;  1D8L A;  1NMG A;  3U4V A;  2F1M A;  1IYU A;  3J7Z C;  2F0I A;  2MO0 A;  1MBY A;  5JPN C;  5C3E H;  3TP8 A;  4C3I H;  2ZTD A;  4B9W A;  1EU4 A;  3WOF A;  5JPM C;  3A0J A;  1SYD A;  4LFB Q;  1AP0 A;  1SNM A;  1CK1 A;  1WTV A;  1G2T A;  3TP7 A;  2YTV A;  4P71 A;  3W1G A;  2UUC Q;  3DLL A;  4JI2 L;  4YY3 Q;  1X54 A;  2QW7 A;  2WB1 G;  3I4L A;  1EWC A;  3KLS A;  5KEE A;  1KAA A;  1K8O A;  4HR7 B;  1K0S A;  5M9O A;  4Y52 H;  3CME A;  3HOY B;  3GTL B;  2E2D C;  3I73 A;  3EBE A;  4S3S A;  2EOT A;  1PHJ A;  1VQN A;  3GV6 A;  4DR5 Q;  4BY1 H;  4A3I B;  2N3S A;  2F0F A;  1QNU A;  1IHZ A;  1X32 A;  1SR3 A;  1HTP A;  3PSI A;  3Q23 A;  4JI3 L;  2NVY H;  1VQO A;  2UUA Q;  1NUC A;  5JVH 3;  4DXG A;  4DAY B;  2K1B A;  1DOL A;  1TXY A;  1CFM A;  1FYC A;  1B9N A;  4DV7 L;  1XMO L;  3VR4 A;  4PMB A;  1Y1W G;  3HFZ B;  1O80 A;  3EFX D;  5C3E G;  3MTS A;  1WTR A;  3S1M H;  2PI2 E;  1FR3 A;  1X56 A;  1E1O A;  4OL7 A;  4QF4 A;  1QVF A;  1R4Q B;  2MQH A;  3IFT A;  2F0G A;  1U4M A;  4L5Q A;  1CKO A;  4H0L C;  1QG7 A;  3S1N H;  2ZJP A;  3S14 B;  3WWV A;  1EFI D;  1OO9 B;  1KC8 C;  4OX9 Q;  1LV9 A;  5C4X B;  3J80 c;  2IJ0 A;  4JK1 C;  5DNF A;  3M7N A;  4GKJ Q;  1IXR A;  2HUG A;  1X3G A;  1X3P A;  1D5X C;  2IHE A;  4K6L A;  1MSG A;  4F88 A;  4K8J A;  3TS0 A;  3CC2 A;  1MIU A;  3P7J A;  1CKN A;  1JOR A;  1UAP A;  2J4X A;  3FKI H;  1PH4 A;  4L5R C;  4BY1 G;  4JYA Q;  1QZH A;  1S5C D;  4IFD J;  4UP7 A;  4CKB A;  3H3V I;  2XVS A;  4JI5 Q;  4DR7 L;  2CHB D;  1VQ9 A;  1ENC A;  1BUV T;  2VQE Q;  4QB4 A;  1TWF H;  1IBM L;  2E2H B;  5JJL A;  1EEF D;  4DV6 L;  3RZO B;  1HUM A;  2JA6 H;  2PNR C;  4R4C A;  2YTX A;  2B3G A;  2G9D A;  2A6H C;  2D62 A;  1YBY A;  4JBW A;  4LF9 Q;  2O5J C;  5AJ3 L;  2EY5 A;  4DV4 Q;  3S1Q B;  2Q2H A;  2BCO A;  2Q2U A;  4R4I A;  2K5Q A;  1Q1B A;  4F87 A;  3GTO B;  5LMN L;  3CCR A;  2PQA A;  2UXB L;  5IYD G;  1S72 A;  1M90 C;  4OXP A;  2R61 A;  1GUG A;  5FLM H;  4LF5 L;  5JEA H;  4DV0 L;  2DUD A;  5IGB A;  4J1M A;  2VL6 A;  4OWT B;  4DUY L;  3A74 A;  3E6Z X;  1I4G A;  3J7A F;  1I3Q B;  3I4N G;  1A3V A;  2NYZ D;  5HGT A;  1UWV A;  3M4Q A;  2A69 D;  2A6E C;  1HH2 P;  3PUX A;  4A93 H;  2R93 G;  3EA6 A;  1F2M A;  3A8I E;  3KBX A;  1WFQ A;  4C2M B;  2A19 A;  4G7O C;  3KJP A;  2JA5 G;  4LFB L;  4BA2 I;  2L1B A;  1HNX Q;  2K03 A;  4IUR A;  2VQF Q;  2L55 A;  2LS0 1;  1DJR D;  1JB3 A;  1STE A;  2UUC L;  3L2P A;  1OXU A;  1T9H A;  1BO0 A;  1PTO C;  2LMC B;  1EY4 A;  1Q81 C;  4P73 A;  5ELN A;  4LFC Q;  4HMI A;  2WIN B;  4XYO A;  4PZ8 A;  5I4D A;  3DM3 A;  1CTM A;  3CCQ A;  3J81 i;  3P75 A;  1VQJ A;  4FYD A;  1STA A;  2LY7 A;  4A3B G;  3M4P A;  2K32 A;  3S16 B;  3J80 E;  1J5E L;  4YCU A;  1N32 L;  5T1I A;  4YCW A;  3OW7 A;  4QGU A;  2A68 C;  4ME3 A;  1N33 Q;  4UDU C;  1F9P A;  3NWS A;  2F0E A;  1E2V A;  2LSS A;  4ZQ3 A;  3T51 B;  2Q8T A;  1XTD A;  2B2V C;  4IUQ A;  3HOY H;  4B3M L;  1IBL Q;  2H5X A;  2K5D A;  1CA6 A;  5KRU A;  1WD1 A;  4A93 G;  2KVM A;  1YIT A;  4RGN A;  5F2D A;  4DR3 Q;  1LYL A;  5G3L F;  1C8C A;  1PH1 A;  1EUJ A;  3NEL A;  1WVL A;  2CW0 D;  2X6G A;  5IYC G;  4JG2 A;  1V1O A;  3HOX B;  4M8A A;  2RHS B;  1CHQ D;  2F0K A;  3R2T A;  1H9J A;  4XYQ A;  4DV1 Q;  1HQM C;  1U5K A;  1C7Y A;  4B3R L;  4NXN Q;  2P5Z X;  1PRT B;  2VB2 X;  2N49 A;  1A62 A;  3ONA B;  4CBV A;  2B2T A;  2JA9 A;  1S4Z A;  2F0T A;  3CCM A;  4L5S A;  2VNU D;  3S14 H;  1B2T A;  4X62 L;  5H1S E;  5IP7 H;  5IGC A;  1YHA A;  4P75 A;  5C4X H;  1EQQ A;  1YNN D;  2BH2 A;  5GAD C;  3RN5 A;  4OWW B;  1PZI D;  2DY8 A;  2KEN A;  1ESR A;  2PMZ B;  5FO9 B;  2QEJ C;  1V43 A;  3BDC A;  4H13 C;  1EY9 A;  1K3R A;  1XNQ L;  2LKV A;  5JAV A;  4JV5 L;  3A5U A;  4P74 A;  2VW9 A;  1C4Q A;  3S15 B;  1SNP A;  4KY6 A;  4R8I A;  3W2D A;  1XMQ L;  2HHH Q;  4HJ5 A;  4GKK Q;  4IFD I;  5GQO A;  1HA6 A;  2ENB A;  2E2H H;  4CDD C;  2EXZ A;  2F0D A;  4HN7 A;  1SMY D;  4C1N I;  3RZO H;  2SEB D;  1TWH B;  5HY6 A;  3SGI A;  1VQB A;  4EX5 A;  4C3H H;  3MC0 B;  1HJP A;  3FDT A;  1ZYR D;  5AFW A;  3TDQ A;  2A73 B;  5KIX A;  1K28 A;  2I46 A;  2NN6 H;  4AH6 A;  1VCI A;  2F4V Q;  1FJG Q;  3GTO H;  4X64 L;  4GN4 B;  2KEC A;  3K7A B;  4G7Z C;  3HZX A;  3S24 A;  1VMC A;  2ZM6 Q;  3CHB D;  3NQI A;  2E76 C;  5C6A A;  3ER0 A;  2ICI A;  3I72 A;  2PZT A;  1HNX L;  4JI7 L;  3R2I A;  2R7Z H;  3VR2 A;  5C44 B;  1STH A;  3F8T A;  4Q5V A;  3KDF A;  2E5L L;  3U9O A;  4J6H A;  4IAL A;  1S3O A;  4LJZ C;  2C5C A;  1M4V A;  5EKK A;  1B3Q A;  1H9S B;  5D3D A;  1KNA A;  4N8F A;  3VYU A;  2RCF A;  1G2S A;  2JXM B;  3IAY A;  4ZKB B;  1I94 Q;  4GN3 B;  3SE0 A;  4RKB A;  4X3S A;  1YJ9 A;  3PF5 A;  3H6M A;  3U50 C;  3NTI A;  1I50 B;  4JW0 A;  4C3H G;  1XXG A;  3AMU A;  3RZD B;  2FFK B;  3A55 A;  5J1Z A;  5A2Q L;  1XTC D;  1TU2 B;  5K5P A;  2F0L A;  1N33 L;  1EY6 A;  3X3M A;  4RG1 A;  2YU9 B;  2NN6 G;  1PRT D;  4GNX A;  5COR A;  1EL0 A;  3CPF A;  5DLQ E;  1D6E C;  3QB3 A;  4NP5 A;  1ET6 A;  4X6A H;  3GDE A;  5C5M A;  5GRO A;  4V19 0;  3NHH A;  1GOZ A;  1EU3 A;  1DCZ A;  2D0O A;  1LT6 D;  1JT8 A;  1YEZ A;  4DR3 L;  3NK9 A;  3OMC A;  3GO5 A;  2F0P A;  3TP5 A;  1PZJ D;  2IPK D;  5CBE E;  2MNA A;  1WD0 A;  5ELE A;  5C3W A;  2FMM A;  2IL8 A;  1UE1 A;  2B2Y A;  4NXN L;  4A3D G;  4DKA C;  1S5E D;  1X9N A;  4BBS G;  1CM9 A;  2WB1 B;  2MJ8 A;  3J81 L;  2WII B;  4ME5 A;  1PZK D;  1K83 B;  2UU9 L;  2B2W C;  3MVV A;  1WTP A;  4JBK A; 
#chains in the Genus database with same CATH homology
 1N36 Q;  1Z9F A;  1B7Y B;  2I5L X;  4IPD A;  4AQY Q;  2B29 A;  2E2I H;  3W5O A;  2NZO A;  4JI4 L;  2JA7 H;  3T1Y Q;  1YZ6 A;  4BBR G;  1VQ5 A;  5JJI A;  3RR5 A;  4A3L H;  4KHP Q;  1PFS A;  1N36 L;  1BKB A;  4AQY L;  5C0X J;  1A0I A;  4IJL A;  3TRZ A;  3I4O A;  3PV0 A;  2VUM G;  4GOP C;  3AFQ A;  3T1Y L;  1R9T H;  2JA8 G;  3KF6 B;  4JI8 Q;  1PH3 A;  4POF A;  5GAH C;  3OTO Q;  1X55 A;  2CFM A;  3CQZ H;  4FDB A;  4GOP A;  5J3B A;  1Q7Y C;  2ATW A;  1AE3 A;  4KHP L;  1K83 H;  1GVP A;  3PO3 G;  4OO1 I;  1RIP A;  3TS2 A;  1PH5 A;  2RHQ B;  3CPW A;  1JJ2 A;  3KLW A;  3K8A A;  4JI1 Q;  3T1H L;  1OTC A;  4GKK L;  2HIV A;  1KHI A;  1HZA A;  2WP8 J;  3F1Z A;  4JI8 L;  2AMC B;  3UE0 A;  5FLX c;  4IO9 A;  4JOI C;  3OTO L;  1E7Z A;  4A4I A;  5M5X H;  3AYH B;  4DR2 Q;  4UY8 C;  1PV4 A;  3PIP A;  3UE1 A;  4JOI A;  4A3C H;  2WFW A;  4DV0 Q;  4OWX B;  3ULJ A;  2HT1 A;  4JI1 L;  3PCO B;  1PH6 A;  4QJF A;  3NBH B;  1C9O A;  3STB C;  3I4M G;  1JB7 A;  4DR4 Q;  2C35 B;  3PO2 G;  4DR2 L;  1L2F A;  1Y14 B;  1B8A A;  2IY5 B;  1D8L A;  1NMG A;  4JI0 Q;  2A8V A;  3CC7 A;  2PNH A;  3U4V A;  4LNQ A;  3J7Z C;  2MO0 A;  4DV2 Q;  2F4V L;  4A3B H;  5C3E H;  5C0X I;  1QZG A;  3KF6 A;  4A3M G;  1X65 A;  2PI2 A;  4C3I H;  3OW2 A;  2ZTD A;  1UE7 A;  3GTQ H;  1CSP A;  2KCM A;  3FKI G;  4JI2 Q;  3TEH B;  3M85 A;  3A0J A;  2R6G A;  4Y7N H;  1KXL A;  3PUW A;  4LFB Q;  1IZ6 A;  5C4J H;  5GAE C;  4DV3 Q;  2ID0 A;  1NE3 A;  2YTV A;  4P71 A;  4HJA A;  3W1G A;  3CXC A;  3G71 A;  2UUC Q;  3DLL A;  3NEN A;  4A3D H;  4JI2 L;  1YIJ A;  3BJU A;  4YY3 Q;  1X54 A;  1QVC A;  2WB1 G;  2KCT A;  4BBS H;  1KQS A;  3UDF A;  3IRB A;  3PF4 A;  4DV3 L;  1OXX K;  3K7U C;  4JI6 Q;  3K7A H;  2A1A A;  2AWO A;  4XTC S;  2JA6 G;  3W1B A;  5IYB H;  3U58 A;  2KBN A;  1K73 C;  4Y52 H;  4YY3 L;  3CME A;  3HOU H;  2N8N A;  2VY3 A;  3EBE A;  2AKW B;  5LMN W;  1P8L A;  1QUQ B;  1EFW A;  1PHJ A;  3H15 A;  1VQN A;  4DR5 Q;  1XJV A;  2K50 A;  2LXJ A;  3CCV A;  3OYY A;  1EYG A;  2PMZ E;  4BY1 H;  2N3S A;  3GTJ H;  1YVC A;  4HJ7 A;  2XTI A;  4BBR H;  1JJC B;  1SR3 A;  4DV7 Q;  3PSI A;  1XMO Q;  4UP8 A;  5IT9 c;  4JI3 L;  2NVY H;  1VQO A;  2UUA Q;  3HKZ G;  3CMA A;  2WAQ G;  4DR5 L;  2L15 A;  1YI2 A;  4DAY B;  3L0O A;  1YJN A;  1YNX A;  1TXY A;  5FLM G;  4LF8 Q;  3CD6 A;  1VS0 A;  5JEA G;  1P16 A;  3KYH C;  3TRE A;  4X66 Q;  2JQO A;  4R4O A;  4DV7 L;  1VQP A;  1XMO L;  2KHI A;  4LWC A;  3HFZ B;  4PZ7 A;  4QY7 A;  5C3E G;  1LUZ A;  4A75 A;  4LW1 A;  1Y1W G;  1CKN B;  1VQK A;  2UUA L;  3GTL H;  2RCN A;  4QL5 A;  3PO3 H;  2IT1 A;  3S1M H;  2PI2 E;  3AEV A;  1X56 A;  4DR6 L;  1E1O A;  4X65 Q;  1Q8K A;  3RZD H;  1QVF A;  3I2Z A;  2MQH A;  4X66 L;  4A3I H;  2AHO B;  3PUZ A;  3ERS X;  4L5Q A;  1GM5 A;  1HZ9 A;  1K0R A;  1CKO A;  1TWG H;  1FL0 A;  3S1N H;  2ZJP A;  4AIM A;  3CCU A;  3WWV A;  3ULP A;  3U4Z A;  1KC8 C;  3I4M H;  3CF5 A;  1W2B A;  4HJ8 A;  3BZK A;  3RN2 A;  4OX9 Q;  3PO2 H;  3J80 c;  3K0X A;  4GKJ Q;  3S2H H;  3M7N A;  1IXR A;  1B70 B;  1IL2 A;  4UP9 A;  1WCM G;  5M3F H;  3F2D A;  2OQK A;  2F3I A;  5E7N A;  1X3G A;  1KRT A;  5IYB G;  1NJI C;  3CCL A;  4OX9 L;  2IHE A;  3HOU G;  4OON A;  1V1Q A;  4GKJ L;  3TS0 A;  4DR7 Q;  1ASZ A;  3CC2 A;  1MIU A;  1SLJ A;  1CKN A;  1ASY A;  3FKI H;  1PH4 A;  1HNW Q;  4AYB G;  1S40 A;  4L5R C;  2JJQ A;  4DPG A;  2UXC Q;  4BY1 G;  1N9W A;  1QZH A;  4JYA Q;  2UXD Q;  4IFD J;  4LFA Q;  4UP7 A;  3CAM A;  3H3V I;  1IBM Q;  1WI5 A;  3JC6 6;  1VQA A;  4JI5 Q;  4DR7 L;  2OTL A;  2PQA B;  2E2J H;  3EN2 A;  1LTL A;  4DV6 Q;  1TWA H;  1GO3 E;  1OXV A;  1UE5 A;  2NN6 I;  1WYD A;  1SFO H;  2OQ0 A;  4A3F G;  1YJW A;  1HNW L;  1VQ9 A;  4LUO A;  4JYA L;  1E24 A;  1KL9 A;  3BZC A;  4HID A;  2UXD L;  2VQE Q;  4LFA L;  1TWF H;  1IBM L;  4JI5 L;  5JJL A;  3VDY A;  5AJ3 Q;  4R1J A;  4DV6 L;  3J81 j;  4MZ9 A;  2JA6 H;  4R4C A;  4P72 A;  3HOY G;  2YTX A;  5IY0 A;  2B3G A;  2HQL A;  3CCJ A;  4HJ9 A;  1IBK Q;  2VQE L;  2D62 A;  1YBY A;  3CW2 C;  4JBW A;  4LF9 Q;  4A3G H;  5LMN Q;  1L1O C;  5AJ3 L;  4A3I G;  1I5F A;  2UXB Q;  4DV4 Q;  2Q2H A;  1L1O A;  2Q2U A;  4NXM Q;  3J7A 5;  4R4I A;  4LF5 Q;  1VQF A;  2NZH A;  3J80 i;  1Q1B A;  1IBK L;  1JMC A;  4LF9 L;  3J81 c;  5LMN L;  1QVG A;  3CCR A;  4DUY Q;  3RLO A;  2FXQ A;  3HOV H;  2PQA A;  1SN8 A;  3I56 A;  2ZJQ A;  2UXB L;  4DV4 L;  5IYD G;  3F2B A;  1S72 A;  1MJC A;  2IHF A;  2K75 A;  2YV5 A;  4OXP A;  1M90 C;  5M3F G;  5FLM H;  4NXM L;  4LF5 L;  1X3F A;  1SRO A;  4DV0 L;  2DUD A;  1Y1W H;  4DR4 L;  1FVI A;  1J6Q A;  2VL6 A;  4OWT B;  4DUY L;  1MJE A;  4JBM A;  4C3J H;  5IP9 G;  3A74 A;  3FHW A;  1A8V A;  5LMU Q;  4JI0 L;  3KDF B;  3I4N G;  3KOJ A;  2I0Q A;  1Q86 C;  3RLN A;  1UWV A;  2V1C C;  2IX0 A;  3M4Q A;  4DK6 C;  1HH2 P;  3S1Q H;  3PUX A;  4A93 H;  3GD7 A;  3ULL A;  1NY4 A;  4DV2 L;  3I55 A;  2R93 G;  4B3R Q;  1LM0 A;  2JEB I;  4B3S Q;  1Q12 A;  3D0F A;  5LMU L;  3GTK H;  5IP7 G;  2AWN A;  1WFQ A;  3CC4 A;  5C4X G;  2A19 A;  3KJP A;  2JA5 G;  4LFB L;  1A63 A;  1KIX A;  3EIV A;  4BA2 I;  1HNX Q;  3BU2 A;  1VQH A;  1Y1V G;  2JE6 I;  3MEF A;  1VQG A;  4B3T Q;  1WCM H;  2VQF Q;  4B3S L;  4K0K Q;  2Q2T A;  2UUC L;  4MTN A;  2WB1 E;  3L2P A;  1OXU A;  2BA0 A;  1T9H A;  1BBU A;  2Y0S G;  2DGY A;  5IWA Q;  1I3Q H;  1G6P A;  1Q81 C;  1K9M C;  3A5Z B;  1GKH A;  4P73 A;  5ELN A;  3F2C A;  2VQF L;  4GNX B;  4B3T L;  1HR0 Q;  4LFC Q;  4A3G G;  4K0K L;  4JI6 L;  1O7I A;  4PZ8 A;  2QGQ A;  1J5E Q;  1N32 Q;  3RLF A;  3DM3 A;  4DUZ Q;  4L5T A;  3CCQ A;  3J81 i;  4GLX A;  3UDG A;  1KAW A;  2Z0S A;  4WJ3 M;  1VQJ A;  5EAY A;  5IWA L;  1VQI A;  1VQ4 A;  5GAG C;  2B63 H;  4C2M H;  1YHQ A;  4LFC L;  3H0G H;  3M4P A;  3Q8D A;  2UUB Q;  4A3B G;  4A3F H;  5HGQ A;  3HOV G;  4B3M Q;  3NEM A;  4YCU A;  2QA4 A;  1J5E L;  4BXX G;  1N32 L;  4YCW A;  4DUZ L;  2EXD A;  4YWK A;  4QGU A;  4ME3 A;  1N33 Q;  1VQE A;  3HKZ E;  1I6H H;  2LSS A;  2WAQ E;  2F52 A;  1XTD A;  2UUB L;  1YHB A;  3HOY H;  3KFU A;  2E8G A;  4B3M L;  1IBL Q;  2OTJ A;  2H5X A;  4YCV A;  4LF8 L;  1CUK A;  3CCE A;  4J15 A;  4GLV B;  4A93 G;  3M3Y H;  3G4S A;  1YIT A;  1HZB A;  1QUQ A;  1UEB A;  4TVA B;  4EQ5 A;  4DR3 Q;  1IBL L;  1LYL A;  1PH1 A;  3E9I A;  1EUJ A;  3HKS A;  3NEL A;  1GD7 A;  4QIW E;  4APV A;  1XPO A;  4X65 L;  1N34 Q;  1MKH A;  4YWM A;  4LF6 Q;  1SMX A;  5JEA J;  3S16 H;  3GTP H;  4IPG A;  1EIF A;  5IYC G;  1FGU A;  1TWC H;  4JG2 A;  4LF7 Q;  5IYD H;  5FJ8 H;  2RHS B;  1X6O A;  2I5H A;  1AE2 A;  4GLA C;  2ZJR A;  1RL2 A;  1U5K A;  3FP9 A;  4DV1 Q;  4DR1 Q;  1K8A C;  5M3M G;  1C7Y A;  4LF4 Q;  4OO1 G;  4B3R L;  1N34 L;  2MFI A;  4KHZ A;  5IE8 A;  4A3K H;  4NXN Q;  2RF4 A;  5IP9 H;  1V9P A;  4X62 Q;  4LF7 L;  2R7Z G;  1OXS C;  3LGJ A;  1HR0 W;  4DV1 L;  3G48 A;  3I4N H;  4LF4 L;  1CKM A;  2N49 A;  1N8R C;  1A62 A;  2JA9 A;  2R93 H;  1WJJ A;  3CCM A;  4L5S A;  2VNU D;  3S14 H;  4X62 L;  1Q46 A;  1PA6 A;  5H1S E;  4AYB E;  2B63 G;  1NMF A;  1PYS B;  2OWO A;  3H0G G;  5IP7 H;  4DV5 Q;  1YHA A;  4GOP B;  1W3S A;  1WOC A;  3CP0 A;  4P75 A;  5C4X H;  1JE5 A;  4LUZ A;  2JA5 H;  2UXC L;  3HOX H;  1EQQ A;  1Y1V H;  2JK8 A;  5C0X G;  4HIK A;  4KI0 A;  1Q82 C;  2BH2 A;  3ICE A;  4RMF A;  1BBW A;  5GAD C;  3RN5 A;  4JI4 Q;  4OWW B;  1XNQ Q;  2KEN A;  5ELO A;  5BR8 Q;  4JV5 Q;  1C0A A;  4DV5 L;  1DGS A;  3TQY A;  1V43 A;  1KD1 C;  1VQ6 A;  1PVO A;  2GVB A;  5C44 G;  4IPC A;  1K3R A;  4O0A A;  1XMQ Q;  2NVQ H;  1XNQ L;  4IJH A;  5BR8 L;  4JV5 L;  4R4T A;  3A5U A;  4P74 A;  2VW9 A;  2MO1 A;  4XIG S;  2NVX H;  3L7Z C;  2CQO A;  5JJK A;  1EOV A;  2JEA I;  1XMQ L;  2HHH Q;  1PYB A;  4HJ5 A;  2YYZ A;  1CSQ A;  2KHJ A;  4A76 A;  3T1H Q;  1XPU A;  3HOW H;  1SRU A;  1XPR A;  2ES2 A;  4GKK Q;  5GQO A;  4BXX H;  4IFD I;  3S2D H;  2XGT A;  2I5M X;  5FJ8 G;  2E2H H;  1D7Q A;  4A3J G;  3RZO H;  5HY6 A;  3SGI A;  1VQB A;  2CWP A;  4EX5 A;  4A3K G;  2HHH L;  1IYJ B;  2VZA A;  4C3H H;  1HJP A;  4NB3 A;  3KF8 B;  1SE8 A;  1AH9 A;  2VS1 A;  3HOZ H;  2N78 A;  3H3V H;  2IX1 A;  2YTY A;  4X64 Q;  2K14 A;  1E3P A;  3JAM c;  4AH6 A;  2EIF A;  1VCI A;  3S15 H;  1Q1E A;  3GTG H;  2QEX A;  2F4V Q;  1EWI A;  2GN5 A;  1FJG Q;  3GTO H;  2R7D A;  2NVT H;  5M5W H;  4BY7 G;  4X64 L;  4GN4 B;  5IYC H;  2LXK A;  2Z6K C;  3M9B A;  3HOX G;  4JI7 Q;  3G6E A;  4NPS A;  3S1R H;  4A3E G;  3S24 A;  2Z6K A;  1TWH H;  2ZM6 Q;  1G51 A;  3MXN B;  4PG3 A;  5M3M H;  1FJG L;  4DNI A;  2E5L Q;  3K81 C;  3PUY A;  1NBW A;  2ASB A;  3PGZ A;  3ER0 A;  4TQU S;  1HNX L;  4JI7 L;  2R7Z H;  4QQB X;  3D31 A;  1PH9 A;  2OCE A;  3F8T A;  2EQS A;  3ZJY C;  2ZM6 L;  2JA7 G;  5K36 G;  1EIY B;  4YHH Q;  2Y0S E;  3KDF A;  2E5L L;  1VQC A;  2R92 H;  2K52 A;  2ALY B;  3I7F A;  4A3L G;  2BH8 A;  4O2D A;  1XNR Q;  1S3O A;  3PIO A;  4YWL A;  2CWA A;  1G29 1;  4IPH A;  1HR0 L;  3HOW G;  4DAM A;  3PUV A;  1VQL A;  4WJ4 A;  2GVA A;  4YHH L;  2K5N A;  2CCZ A;  1M1K C;  4R4Q A;  1VQM A;  1I94 Q;  4GN5 A;  4GN3 B;  1XNR L;  3S17 H;  4ALP A;  1YJ9 A;  3AQQ A;  2K4K A;  2K5V A;  4BA1 I;  3PF5 A;  4H02 A;  1KRS A;  3U50 C;  4KLK A;  4DK3 C;  4JI3 Q;  1PH8 A;  2HIX A;  3JAM i;  5C44 H;  3HOZ G;  1I94 L;  4GNX C;  1N33 L;  4A3C G;  1L0W A;  1VQ8 A;  4RG1 A;  3AFP A;  2NN6 G;  4GNX A;  3CPF A;  1E1T A;  1BVS A;  5DLQ E;  3CCS A;  3E0E A;  1VQ7 A;  4LUV A;  4JCV E;  2K5H A;  4X6A H;  3GDE A;  5GRO A;  2R7F A;  1PH7 A;  3UDX A;  4DR6 Q;  2VUM H;  2CKZ B;  3GTM H;  3KJO A;  2JA8 H;  1VQD A;  2D0O A;  1JT8 A;  1YEZ A;  4DR3 L;  1E22 A;  4A3J H;  3GO5 A;  4LF6 L;  1I50 H;  3B6Y A;  3UDI A;  5M5Y H;  1PH2 A;  2MNA A;  3M4O H;  1H95 A;  2BA1 A;  1K8G A;  1JJG A;  4HIO A;  4IOA A;  4DR1 L;  1NTG A;  4MNO A;  4PZ6 A;  1UE1 A;  2YU9 H;  4JBJ A;  2R92 G;  4NXN L;  4A3D G;  1X3E A;  3E9H A;  4GS3 A;  4DKA C;  1UE6 A;  4IFD G;  1X9N A;  4BBS G;  2ZTC A;  2UU9 Q;  4BY7 H;  2Q2I A;  3STB D;  1HNZ Q;  1EQR A;  3RNU A;  1OXT A;  4IOC A;  1HZC A;  4HIM A;  4A3E H;  2ZTE A;  1Z47 A;  3K80 C;  4PMW A;  2D0P A;  4A3M H;  1U0L A;  2UU9 L;  4UPA A;  4JC0 A;  1L1O B;  1HNZ L;  4JBK A;  4POG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...