1HR0W

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hr0W00
3RZOH 1NMFA 2A1AA 4GKJL 3W5OA 1MJCA 4LFCL 4B3ML 3S1RH 1CKOA 1L1OA 1BKBA 2QGQA 3M4QA 2PI2E 3STBC 5C0XG 3J7ZC 2RF4A 2VY3A 3KF8B 4A3JG 1A0IA 4HJ8A 3RZDH 1KD1C 2NN6G 1MJEA 1HR0Q 2PQAB 1AE3A 4A3FG 2FXQA 2JA5G 1IBKQ 1TWAH 4BBRH 4IPDA 5IYBH 3H15A 1OXTA 2KHIA 4GLXA 2ZJRA 1XPUA 3PO3G 2E2HH 3CXCA 1XNQL 4JI5Q 2PNHA 4JYAL 1HZBA 4JI1Q 3HOWG 1PH5A 2UUAL 1Q7YC 4JI3L 2VW9A 1QVCA 3ULJA 5GADC 3ULLA 4LUZA 4UP8A 5C44H 4Y52H 4DV6L 4DV5L 2N8NA 1X3FA 1X3GA 1N32L 3A0JA 2Z0SA 2WP8J 3FKIG 5AJ3L 3JAMc 3HOYG 1V43A 3EIVA 5IYCG 4WJ3M 1KRTA 3BZCA 4LWCA 4DV2L 2VQEL 3S1NH 1WYDA 3PCOB 1SR3A 4C3JH 4DV1Q 3HOVG 2GVAA 1FVIA 3A74A 3PV0A 4JOIC 5LMNW 3BZKA 1EIYB 1K0RA 4LF4L 1E3PA 4DK6C 2ZJPA 1CSQA 2ID0A 2WB1E 4MTNA 5JEAG 1CKMA 2MNAA 1ASZA 4LF6L 2R7ZG 1HNXQ 3U58A 2YTYA 5HGQA 2AMCB 3L0OA 1JJGA 4A3EH 2K4KA 4ALPA 4LFBQ 4O2DA 1BVSA 2JEAI 1J5EL 1NE3A 4JI5L 2PMZE 2R92H 1GO3E 1WOCA 3A5UA 2NN6I 1I94Q 1IBLQ 1KIXA 3GD7A 4L5SA 4NXML 4YWLA 1CKNB 1EIFA 4LUVA 4A3DH 2CKZB 4LFAQ 5C4JH 4LFBL 5E7NA 3GTPH 4XTCS 4PZ6A 1PV4A 1N33Q 1U5KA 2HIVA 2LSSA 3M85A 1EQQA 1VQKA 1Z9FA 4KHZA 3F2CA 1W2BA 1SRUA 5EAYA 1I3QH 4LF9Q 4AH6A 1L0WA 1E7ZA 4HIMA 1O7IA 4IJHA 1HNZQ 1SLJA 4HIKA 4LF4Q 2K5VA 4GN5A 4A3KH 4X64L 3S14H 3DLLA 2EQSA 2WAQG 3CCLA 2MO0A 2K5NA 2YU9H 2KHJA 4BY1G 1PH7A 1A63A 2I5LX 3G71A 3S16H 4A3GH 4DAMA 5HY6A 3F1ZA 4P72A 2Y0SG 1QUQB 1XPRA 3A5ZB 4QIWE 1HNWL 3FP9A 2AWOA 2RHSB 1K8AC 3RLFA 3J81j 4A75A 4A3DG 2UXBL 1NBWA 1VQIA 2ES2A 3T1YL 1Q82C 4DK3C 3PF4A 3CCJA 4PZ8A 4LF6Q 2NVYH 1QVGA 2IY5B 4POGA 5IYCH 1HZ9A 1TWCH 4EX5A 4X66Q 4LFAL 2E5LL 2E5LQ 2R6GA 5IP7G 3CPWA 1JJ2A 4GOPC 4ME3A 5FJ8H 4XIGS 4YWKA 2PI2A 4A3FH 4LF9L 3WWVA 1EQRA 1NMGA 1EYGA 1SFOH 3J81i 3GTMH 2QA4A 5LMUQ 3EBEA 4A3KG 2R7ZH 4DUZL 1K8GA 1S3OA 3HOZG 4HIOA 2GVBA 4GN3B 4LF7Q 1L1OB 3K7UC 4MZ9A 3E9IA 3CCRA 3CCQA 3HOZH 4OWXB 4KLKA 5C44G 1KAWA 1VQ7A 4A3EG 2BH8A 3I56A 2UXDQ 2IHFA 1I94L 3ER0A 3CC7A 2R92G 4OXPA 1YI2A 2UU9L 4B3TQ 3TREA 1N34Q 3S15H 2MO1A 4IO9A 4JI2Q 1KHIA 2E2JH 5LMNQ 1SE8A 3ULPA 4GLAC 1YJWA 3H3VH 5FLMH 1QZGA 1N8RC 1JB7A 2UUCL 5GQOA 3W1GA 4B3SL 2NVQH 1QVFA 4OWTB 1PHJA 1VQ9A 5ELNA 3AFQA 2MQHA 4POFA 1E1TA 3M9BA 2CWAA 4J15A 1FJGL 1DGSA 1EOVA 2VQFQ 4JV5L 4IPGA 4A3JH 2OCEA 2DUDA 1XNQQ 1D7QA 4K0KQ 4DR5Q 4TQUS 4JI0L 4LF7L 1IZ6A 1WCMG 4DV3Q 2OQ0A 3CC4A 1PYSB 4DR4L 2CWPA 1MIUA 3K0XA 3HOWH 1I6HH 1XPOA 4JBMA 4LF8Q 2D0OA 1JT8A 1VQAA 4JBJA 4YCUA 1N9WA 5M3FH 4LFCQ 1Q1EA 1YHAA 3B6YA 1IBMQ 3GTGH 4K0KL 1PH3A 4JI0Q 3KOJA 2OTLA 4GNXC 1VQPA 4A3CH 4UPAA 4B3RQ 3S1MH 4RMFA 4KHPL 4QL5A 2N3SA 2OTJA 3PO2H 4UY8C 4YY3Q 2ZTDA 2HQLA 3CPFA 4B3MQ 4C3HH 2HIXA 4X65Q 4L5RC 1XMOQ 3T1YQ 2K14A 2IX0A 3U4VA 4JI4Q 4IPHA 5BR8Q 3G4SA 1Y1WG 4BY7G 4AQYQ 1B70B 1KRSA 3NEMA 4R4IA 1YNXA 4LF5Q 3CF5A 2UU9Q 4JC0A 3HOXG 4A3MH 4BY7H 1I50H 1LUZA 3CC2A 1VQJA 2Z6KC 3KF6B 3GTJH 2UUAQ 1PFSA 2EXDA 1FGUA 3JC66 5K36G 3E9HA 2F52A 3E0EA 4DUYQ 3UDGA 2UXDL 2ZTCA 4LUOA 2UXCL 3RNUA 2WFWA 1VQFA 4AIMA 1IBKL 1VQ8A 1UWVA 1Q1BA 2L15A 3VDYA 2JEBI 4AQYL 2ASBA 4A93G 1TWFH 3GDEA 1NJIC 4P75A 5JJKA 2N49A 3PO2G 2K52A 1H95A 1A8VA 1YJ9A 1GM5A 1TWHH 4GOPB 4AYBE 2PQAA 4P73A 2Z6KA 2ZM6Q 3W1BA 3TEHB 4NXMQ 2XGTA 4L5TA 5IY0A 4YWMA 1CSPA 3BJUA 3U50C 2BH2A 2YYZA 3AQQA 3CAMA 3CCEA 4DR3L 4X6AH 1Y1VH 4A3MG 4RG1A 4R4QA 5FLXc 2NVXH 5JJIA 3PUXA 2JA5H 3EN2A 4NB3A 4C2MH 4A76A 2A8VA 1WI5A 2NVTH 1PH4A 3HOXH 4GKKQ 5IWAQ 2JA8G 3UDIA 1JE5A 4DR6L 1K3RA 4X62Q 1EUJA 3AFPA 3I7FA 3KDFA 4GS3A 3PIPA 4DV7L 3I4MH 1HNXL 1HNWQ 5JEAJ 4JG2A 2CQOA 2R7DA 3I4NH 4A93H 4NXNQ 1UE1A 3Q8DA 1PH1A 2Q2HA 3CCUA 4X64Q 2F4VQ 4DNIA 3T1HQ 1XMQL 5GAHC 3HOYH 3S2HH 3ERSX 4QY7A 2UUBL 4DV1L 2VS1A 1Q86C 3RR5A 4B3SQ 4YHHQ 2C35B 1E22A 1VCIA 1XMOL 1I5FA 1C7YA 2YV5A 4BBRG 5IYBG 5C3EG 4DV6Q 1EFWA 2RCNA 1N32Q 1PH2A 1XTDA 3CMAA 3GTOH 3AYHB 2K50A 1E1OA 4JI3Q 1Y1WH 3H0GG 4KHPQ 4GN4B 4JI1L 3TQYA 1YHQA 2XTIA 2IX1A 1SROA 4B3RL 1YZ6A 4IOCA 1V1QA 2E8GA 4A3IG 1J5EQ 1TWGH 3NENA 5GROA 3PIOA 1IYJB 2EIFA 2VQFL 4JV5Q 3PF5A 1XNRL 2YTVA 1Q81C 3RN2A 4FDBA 4BA2I 4DV0Q 3M4PA 4JI4L 4DR7L 3J81c 4DV3L 4DR2Q 1KXLA 1LTLA 1LYLA 3KLWA 5IP7H 1HR0W 2DGYA 5FJ8G 1X65A 4GKJQ 3J80i 1C0AA 5M3MH 1YEZA 1PH6A 3AEVA 4YHHL 1OTCA 2UUBQ 2ALYB 3BU2A 1A62A 3G48A 1IXRA 2JA6H 1WFQA 5C3EH 1RIPA 1VQ5A 1FJGQ 1IL2A 5C0XI 1X54A 3CD6A 4DR1L 1VQGA 4GNXB 3S2DH 2IHEA 2HHHQ 2OQKA 1Z47A 1OXVA 2ATWA 1HH2P 1AE2A 2B29A 3HKSA 3PUZA 4DV2Q 2WB1G 4NXNL 1U0LA 1VQ6A 3I4OA 1QZHA 4R1JA 1HZCA 4JCVE 2VNUD 4R4OA 4GOPA 1Q8KA 4BY1H 4X62L 4JI7L 1BBUA 4BXXG 4WJ4A 4X65L 1ASYA 1B7YB 2OWOA 4B3TL 2JA8H 3TRZA 4DAYB 4DR6Q 2Q2UA 1RL2A 2H5XA 2K75A 4BXXH 2CCZA 2JE6I 2N78A 4DR3Q 2Q2TA 4KI0A 2MFIA 4P71A 3HKZE 1OXXK 3L7ZC 1V9PA 3D0FA 3FKIH 5FLMG 2BA0A 3HOUH 3M3YH 2LXKA 4X66L 5M3MG 4OONA 4HJ5A 4JI7Q 2JA7H 4A3LG 2R93H 3S24A 1YBYA 5JJLA 2Y0SE 1VQ4A 1FL0A 2ZM6L 2UUCQ 1OXUA 1HJPA 2JA7G 1X3EA 3MXNB 4JBWA 3OW2A 3HOVH 1BBWA 2BA1A 2JA6G 2YTXA 4LF8L 1G6PA 3UE0A 4DKAC 4JI8L 4OX9L 1KQSA 4JI2L 2R7FA 4DV0L 4P74A 1K9MC 1Y14B 1N34L 4L5QA 3GTQH 4A4IA 1X56A 4Y7NH 3KJOA 4A3GG 4DR5L 3OTOQ 4APVA 1D8LA 3DM3A 4QJFA 3T1HL 1XMQQ 1PH8A 2GN5A 3PUVA 4JOIA 2V1CC 4DUYL 3H0GH 2KCTA 3G6EA 1IBLL 1P8LA 1UE5A 2I5MX 2RHQB 3I2ZA 2UXBQ 4JI6Q 3M7NA 1VQCA 1TXYA 1KC8C 2LXJA 4BBSH 1S40A 2IT1A 3CP0A 1HNZL 4LF5L 1EWIA 3K7AH 1VQEA 1N36Q 4JBKA 5BR8L 1VQDA 4DR2L 5LMNL 1Q12A 2Q2IA 4DR7Q 3MEFA 1UE6A 3KDFB 3SGIA 5C4XH 1X55A 4HJ9A 4DV4L 1GD7A 2D0PA 2KENA 3KYHC 1P16A 1C9OA 3STBD 4YY3L 3F2DA 5IYDG 3PGZA 4HIDA 2K5HA 3KFUA 1YVCA 4LW1A 3I55A 4R4TA 4IFDJ 5ELOA 4OO1I 2JK8A 1HZAA 1IBML 1L2FA 4TVAB 2HT1A 5AJ3Q 2D62A 2KCMA 1M1KC 3U4ZA 3F8TA 3OYYA 3H3VI 1N33L 1L1OC 3RLOA 2QEXA 3K81C 1K83H 1W3SA 4A3IH 4DR4Q 1PVOA 3GTLH 1PYBA 5IWAL 1VQLA 3S17H 4PG3A 1PA6A 1VQBA 2B63G 2UXCQ 1LM0A 1XNRQ 4IFDG 2HHHL 1GKHA 3GO5A 5IT9c 1VQMA 4R4CA 4UP9A 5DLQE 4GLVB 3RN5A 3LGJA 5C4XG 5M5XH 1WJJA 1JJCB 1NTGA 3NBHB 4DV4Q 2F3IA 4H02A 5IP9G 2ZTEA 3M4OH 1G291 3L2PA 3CCVA 3TS0A 1M90C 4LNQA 3UDXA 4DV7Q 1UE7A 2WAQE 1Y1VG 3ICEA 4YCVA 3IRBA 4QQBX 1XJVA 4YCWA 1J6QA 1SN8A 3KF6A 2AKWB 4IJLA 5IE8A 1WCMH 1CUKA 3UE1A 4OWWB 5J3BA 1CKNA 4EQ5A 2F4VL 4A3BG 1GVPA 2AWNA 4JYAQ 1NY4A 2JA9A 2VQEQ 1VQHA 1VQOA 2KBNA 1X9NA 3FHWA 3GTKH 3S1QH 3CMEA 1Q46A 4OO1G 4GNXA 4HJ7A 3I4NG 5H1SE 4DV5Q 4JI8Q 1YITA 4OX9Q 3F2BA 1K73C 5LMUL 2A19A 4A3CG 3PUWA 2B3GA 3HKZG 4DUZQ 3HOUG 2VUMG 2VL6A 4MNOA 4A3LH 2R93G 4PZ7A 3PSIA 1G51A 1KL9A 3D31A 4BA1I 4NPSA 2VUMH 4PMWA 1YJNA 2ZJQA 1MKHA 2NZOA 4DPGA 1PH9A 1E24A 1AH9A 5IP9H 3KJPA 1HR0L 1VS0A 2JJQA 4IPCA 3PUYA 1VQNA 3K80C 5GAEC 3UDFA 1QUQA 1S72A 5IYDH 4UP7A 1N36L 1R9TH 3PO3H 2I0QA 1SMXA 3TS2A 2JQOA 4A3BH 1X6OA 3ZJYC 1YHBA 3CW2C 3JAMi 3RLNA 3NELA 4GKKL 5M5WH 1T9HA 4IFDI 3K8AA 4AYBG 5C0XJ 3HFZB 3J80c 4JI6L 4BBSG 3CQZH 2AHOB 3CCMA 1JMCA 1B8AA 3I4MG 5M5YH 2I5HA 2VZAA 5M3FG 2B63H 4DR1Q 4HJAA 4IOAA 3OTOL 5GAGC 4QGUA 3CCSA 4O0AA 1OXSC 2CFMA 4C3IH 2NZHA 1YIJA 3J7A5 1UEBA 2E2IH
chains in the Genus database with same CATH superfamily
3RZOH 1B9MA 1EYDA 3SDZA 5EQ0A 1STHA 4RGOS 4P2CB 3RZDH 4ZK9B 2PQAB 2HUGA 4A3FG 5IYBH 1OXTA 1D5MC 1RHPA 4ZLTF 2MUYA 4JYAL 1D1IA 3RMHA 1PH5A 4ZKBB 2H1EA 2VW9A 3GTJB 2Z9HA 4Y52H 4DV5L 5FLXL 1HTLD 3A0JA 2WP8J 4ZQ3A 5EBDA 5T1GA 3HOYG 1Y8PB 4C3HB 1PFMA 4DV1Q 1FVIA 2F0WA 3LWEA 4JOIC 1EIYB 1EZ8A 1K0RA 4LF4L 2C9OA 4DK6C 2QDLA 4A3GB 1CSQA 2ID0A 2WB1E 4MTNA 1ASZA 2JA7B 1EY0A 3OW7A 3K6OA 1WTVA 3I91A 5C44B 1JJGA 1CHQD 2KQ3A 2RSOA 3TN2A 4O2DA 1BVSA 1I94Q 2NN6I 5I6YA 4BY1B 4RH6A 1HQRD 3GD7A 1F2MA 1KNEA 2FMMA 1PDQA 2Z4HA 4A3DH 2CKZB 2RDFA 5IODA 3VA7A 3WOEA 4FXDA 1PV4A 4QCLA 1U5KA 3M85A 1EQQA 1I3QH 3CRKC 4IJHA 2JA5B 4HIKA 4L6TB 2F0SA 2K5VA 1DOLA 3PIP3 1VF5C 1SNQA 1A63A 1W6JA 2B2TA 3T53B 1QUQB 3SVMA 1XPRA 5C4XB 1SJHD 2RHSB 3FP9A 3KBXA 3J81j 2L55A 2UXBL 4ULLA 4IUPA 2ES2A 2LFNA 4LMQD 4LF6Q 2IY5B 1TWCH 4X66Q 2OXPA 4RWSC 4DXFA 5I4DA 1IKMA 1QCBD 1V1PA 1EY7A 1NMGA 4HCSA 1AEXA 5CV9A 5LMUQ 3A8KE 1F9QA 1K8GA 3D6CA 4CHTB 2GVBA 1CTMA 4MZ9A 4CKCA 4KLKA 4CJ2C 1KAWA 2BH8A 5EKLA 1WVLA 1I94L 1II3A 2R61A 3TMEA 4IO9A 3A7AB 1TIID 5JOBA 3TP7A 4KY6A 1W6KA 2XRQD 5FLMH 1JB7A 3M4OB 1B44D 3NUCA 3GTQB 2EZVA 1PHJA 1CA6A 1DGSA 1EOVA 1STBA 3V2TA 2VQFQ 4IPGA 3MXUA 2OCEA 2EYHA 4K0KQ 4DR5Q 3S1RB 4LF7L 1WCMG 4DV3Q 5C3WA 1PYSB 3A56A 3K0XA 2YU9B 2F0KA 3QO2A 2D0OA 1SNMA 3BVGA 1VDZA 4WFN3 1Q1EA 1YHAA 3B6YA 1IBMQ 2KHSA 3OWEB 4JI0Q 4GNXC 4A3CH 4B3RQ 3S1MH 2G5DA 4QL5A 1GUNA 3PO2H 4YY3Q 4JVZA 1G2TA 2HQLA 1I4HA 3MFGA 2IX0A 3U4VA 2R7ZB 4FP5D 4RKBA 1KRSA 2F0IA 4R4IA 3K58A 1F9RA 1Q90A 4A3FB 4LF5Q 2UU9Q 3HOXG 5BN5A 4HMJA 1I50H 3OMCA 1VQJA 2Z6KC 2L0CA 4DU9A 2UUAQ 4A3MB 3JC66 3E9HA 3WOFA 2UXCL 4OIKA 1SBBB 1IBKL 3BDOA 4G7OC 2AUJD 1UWVA 1Q1BA 5E3FA 3GDEA 5K5PA 4P75A 5ISRA 2KEDA 3HS0C 1H95A 2XIWA 2B39A 1MBYA 1TWHH 4GOPB 3DEPA 1U4PA 2PQAA 3D8GA 4P73A 2DJGC 1BBXC 3TEHB 4YWMA 1U4RA 1CSPA 2YYZA 3AQQA 3CAMA 3S14B 3CCEA 4K5WA 1EYCA 2EJMA 4X6AH 1S5FD 1CQFA 4NB3A 2NVTH 4L8JA 3HOXH 4N9TA 2JA8G 2L11A 1JE5A 1K3RA 3PIPA 4KJOA 2FFKB 5DM73 1TWHB 5EPJA 3SEBA 1VF7A 4I7AA 1A2TA 4CJ1B 2IX3A 2MPMA 2B2UC 1STGA 5GAHC 4QY7A 3HP3A 2CQAA 1Q86C 4B3SQ 3KLSA 2YV5A 4IUNA 3GTOH 2VB2X 4DN4M 1Y1WH 3KF8A 2K33A 2IX1A 1PTOC 2XTIA 4IOCA 5F2DA 1J5EQ 3NENA 2VQFL 1K28A 1RD9D 2FJ2A 2M00A 1U4LA 4V190 3J81c 4DV3L 3EVQA 2A68D 1NNXA 1GOZA 1IW7C 1SYDA 3OMGA 1C0AA 1HUMA 1PH6A 3AEVA 1QWYA 1A62A 1IXRA 4C56C 2I46A 5C3EH 2EY1A 2LMCB 1E2WA 1H9JA 3S2DH 1WTWA 2OQKA 5KIXA 2ATWA 1HH2P 1AE2A 2B29A 1R4PB 1MSHA 3PUZA 2BDOA 1VQ6A 1IL8A 4EGVA 4R4OA 4GOPA 4X62L 1ASYA 1B7YB 4B3TL 2Q2UA 1RL2A 4A3EB 2JE6I 3FVQA 4P71A 5M5YB 1BCPF 3HKZE 1OXXK 2B63B 3HEJA 3L7ZC 2LKVA 5FLMG 2JP1A 4MN3A 1D1KA 1RTOA 2K5WA 4PNYA 3S24A 2Y0SE 3MXNA 5JJLA 1VQ4A 3EJIA 1BO0A 3NWSA 4K5VA 3OW2A 1SEBD 5C4JB 2JA6G 3JAME 4DKAC 1K8MA 2AQ3B 1D2BA 2MGSA 3H3VC 2NVQB 2BDNA 3OTOQ 5M9OA 1XMQQ 5CV4A 2V1CC 4DUYL 3H0GH 5DAUA 5ELCA 3QOLA 1WTRA 4NDXA 4JI6Q 1EZ6A 1SXTA 3HGBA 4NKLA 1KC8C 1EEFD 2E2HB 1HNZL 3HOYB 2QDBA 3MVVA 4IQZA 3BDLA 1TWGB 4G4KA 5LMNL 1LTID 3KBGA 4DV4L 3KYHC 4JI7L 2KENA 5IYDG 3PGZA 4FXGC 1YVCA 4LW1A 5TSSA 3GTMB 1GXDC 2X6GA 1IBML 1RKNA 4QF4A 1V1PB 1L1OC 1EOTA 2QEXA 4A3IH 1PVOA 1Y69U 3DHQA 1PYBA 1VQLA 4DA2A 1LT5D 4AYBB 5KYLA 5DLQE 3RN5A 3LGJA 5M5XH 1A15A 1JJCB 1NTGA 5IP9G 2ZTEA 4FF3A 1G291 1IW7D 3CCVA 1M90C 1WTHA 2PZTA 2RQXA 4LNQA 1J8IA 1E2VA 1TKWB 1G2SA 1TU2B 1XJVA 1J6QA 3SK8A 5IE8A 3QB3A 3UE1A 4KN4C 3TSSA 4RHRA 1CKNA 1IYUA 1QNKA 4JYAQ 4IALA 2JA9A 4K6LA 4HN7A 3CMEA 4N9PA 3HOZB 3SXHA 3BDCA 1ENFA 1SE2A 1AFPA 2A19A 4A3CG 1DM0B 1SSOA 3HOUG 3KUPA 2VUMG 2HCIA 3PSIA 1AW7A 1KL9A 1LT6D 4NPSA 2DNEA 1YJNA 1MKHA 2NZOA 1B50A 1E24A 1AH9A 3KJPA 2A6ED 2JJQA 5GAEC 3DEOA 5IYDH 4UP7A 2V4DA 3DWAA 3VR6A 3TZUA 1TWAB 2RSNA 1SMXA 3TS2A 4H0LC 2L12A 4DF7A 4X3KA 1H9SA 1X6OA 3ZJYC 3RZDB 3RLNA 1T9HA 3K8AA 3S1NB 1YNND 4A3IB 3I4MG 2B63H 3OTOL 3CCSA 1KNAA 4OEMB 1OXSC 2Q8RE 3S15B 3J7A5 4PQXA 1UEBA 4KN7C 4S3SA 3G7LA 4GKJL 5KNCA 1X3QA 3I90A 4ZKCB 4LFCL 2PNRC 3S1RH 1L1OA 2QGQA 2VY3A 3KF8B 1A0IA 1HR0Q 5CMDA 3GTPH 4J1MA 2FXQA 2JA5G 4BBRH 3H15A 1IHZA 2KHIA 2L1BA 3Q23A 4GLXA 1EWHA 2E2HH 1XNQL 1HZBA 4JI1Q 4G7HC 3HOWG 1PLFA 1QVCA 3RUZA 4LUZA 2X6LA 5EGTA 1JE4A 4DV6L 3KLRA 1X3FA 2Z0SA 2EY5A 4HR7B 4IUVA 3EIVA 5IYCG 4J6HA 4LWCA 3S1NH 1JQYD 1WYDA 1SR3A 3TP8A 3HOVG 3D4WA 3A74A 3PV0A 4QUFA 4XDXA 3BZKA 1S4ZA 4OIJA 2Z8LA 2ZJPA 3MTSA 2AQ2B 3L3OC 4LF6L 5A2QL 2R7ZG 1HNXQ 4C1NI 2L5TA 3C1EA 1AP0A 3I73A 4RKLA 5L37A 5HGQA 3L0OA 4A3EH 3OIPA 2K4KA 4ALPA 2JEAI 1J5EL 2PMZE 1IBLQ 4X3SA 3A5UA 4F88A 1ZXTA 4NXML 2EYOA 1EIFA 4LUVA 2RVLA 5C4JH 3CHBD 4UAIA 4LFBL 2HIVA 1VQKA 1Z9FA 1JCKB 2E74C 4RA8A 4AH6A 4LF9Q 1E7ZA 2A69D 1SYEA 4LF4Q 3O13A 4X64L 2HDMA 3DLLA 2EQSA 2WAQG 1CFMA 4PMBA 1EIHA 4CGYB 1SE3A 1PH7A 2L4NA 1HA6A 2JN4A 2F0TA 1FGBD 2Y0SG 3A5ZB 4QIWE 1HNWL 5CBAE 1KDCA 1SAPA 1NBWA 3T16A 2KVMA 3T1YL 2A6HD 4DK3C 3PF4A 3CCJA 5C4ZA 2EVBA 2MJ8A 2R92B 1JWSD 2EY6A 2B2WA 2E5LQ 2H4OA 3CPWA 1JJ2A 2ZT9C 2KCNA 2OT2A 1STAA 3K5LA 2PI2A 2WACA 2B2TC 3OOCA 1S5BD 3IAYA 1DCZA 1A2UA 4MHEA 2B2VA 2IWHA 4E6IA 4JK1C 3J81i 4Y7NB 3GTMH 2R7ZH 1S3OA 2XVSA 1LTRD 3ND8A 3JAML 1ILQA 3E9IA 2NWGA 5C44G 2F3WA 1XXGA 3OWFA 3ER0A 3CC7A 1MI2A 4K5XA 4OXPA 2UU9L 5IGBA 3VR2A 2HDLA 4C3IB 2D5DA 4JI2Q 4IUUA 4KHVA 3I70A 3GQBA 1I6HB 1K0SA 3FPPA 3H3VH 1SNCA 4TRDA 5CORA 4MTKA 3W1GA 4B3SL 1ENCA 2NVQH 1QVFA 1VQ9A 5ELNA 4POFA 1E1TA 2CWAA 3VR4A 1D7QA 2F0HA 4TQUS 4JI0L 1RF2D 1F2LA 5KNDA 2CWPA 4IZ8A 3S17B 1JT8A 1LO5D 4JBJA 4YCUA 1N9WA 2C5CA 3E5SA 3SK5A 2J4XA 4LFCQ 2OF1A 1O80A 4CDFC 4DXGA 5CV8A 2BCOA 5CBEE 1PYWD 4RMFA 5JPMC 2NB0A 2CW0D 5EKIA 3PO2B 4FF4A 2WKDA 4C3HH 3C3LA 3S2DB 1XMOQ 3T1YQ 4HCEA 1EL0A 5BR8Q 3G4SA 4ID6A 5C3EB 4PMCA 4A3MH 1ML0D 3CC2A 3GTJH 5KNBA 1B3AA 2EXDA 1X32A 2F0QA 3RNUA 1FYCA 1VQFA 1VQ8A 3MC0B 3P1HA 1I4RA 4A93G 1TWFH 2N49A 3PO2G 5A35A 1YJ9A 3HOVB 3J7AF 2KJXA 1UNSA 2DY8A 1Y1WB 4QIWB 4KTAA 4TSSA 2XGTA 5IY0A 2PZUA 3A8JE 3H91A 1PFBA 4DR3L 1IKLA 4RG1A 4R4QA 3EN2A 1SE4A 1QOHA 4X62Q 1EUJA 3AFPA 3I7FA 4DV7L 3I4MH 4XYOA 3MXGA 4R8NA 3I4NH 4ODGA 1M8AA 3Q8DA 1PH1A 3J80E 2F4VQ 1A3VA 4X64Q 1MSGA 1XMQL 3ERSX 1SMYC 5DM63 5LL6X 2ICEC 1BCPD 1WD1A 2JA6B 2VS1A 1SYCA 4RGNA 3URYA 2C35B 3IFDA 1VCIA 1PTOF 1I5FA 1OO9B 5IYBG 4DV6Q 1TWCB 3X3MA 1N32Q 2XWJB 2CVRA 2EXZA 4XYQA 4EVOA 2K50A 1E1OA 4JI3Q 3K0YA 5DEHA 4JI1L 2M9VA 1SNPA 1V1QA 4V0BA 2EJFC 2EIFA 3GTKB 2OEOA 4CKBA 2F0NA 2Z4IA 2FMCA 1EIGA 2DY7A 1H9RA 3KLWA 1B4OA 3J80i 5M3MH 1PRTB 1YEZA 4YHHL 1SDFA 4XXEA 3U9OA 2JA6H 1I3QB 1FJGQ 1IL2A 5AFWA 5C0XI 1X54A 3CD6A 3W3AA 4GNXB 2A6HC 1CT1D 2HHHQ 1Z47A 3A7LA 1OXVA 3HKSA 4KY5A 1SNDA 5G3LF 1QZHA 4BY1H 2F03A 5IGFA 2NVTB 2JA8H 3GTLB 4L63B 3C46A 4BXXH 2CCZA 2N78A 4DR3Q 1KLGD 4KI0A 2MFIA 1U4MA 3ZYYX 4CBVA 2E2JB 1WTPA 3D0FA 1FR3A 4Q5VA 3HOUH 2LXKA 4X66L 3CQZB 2JA7H 4B9WA 1FL0A 3MWYW 3J7AV 5ELFA 2JA7G 4JBWA 3HOVH 1DXMA 2PYKA 3DUZA 4OX9L 2M2LA 3R8BA 2R7FA 1K9MC 4P74A 3S9WA 3GV6A 3GTQH 4A4IA 1STNA 1LTSD 4CDCC 4DR5L 1LT3D 4DK0A 2WV6D 3DM3A 3T1HL 1PH8A 4JOIA 2KCTA 5FO8B 1UE5A 2NUCA 4NW2A 2EY2A 1KDBA 5IGEA 2VUMB 1TXYA 4XQNA 1EQVA 3J7YW 4BBSH 5IGDA 4LF5L 5BR8L 1VQDA 1UE6A 3SGIA 2N55A 4HJ9A 1SMYD 4WJ3M 4HIDA 4C3JB 4YY3L 3KFUA 2VXWA 2XN9C 3S1MB 4IFDJ 3RZOB 2JK8A 1HZAA 3MA2B 2HT1A 5AJ3Q 3F8TA 3RLOA 1D6EC 5EPLA 1LV9A 5E4XA 3GTLH 5IWAL 2JA8B 3S17H 2WINB 4PG3A 4U68A 1M4VA 1PA6A 1VQBA 1WTQA 2UXCQ 3C2PA 2HHHL 4ZUIA 1VQMA 1O7ZA 1XTCD 4A93B 2KECA 3I4LA 2I07B 5C4XG 1WJJA 1F2YA 2DNCA 1FNUA 1AZPA 4DV7Q 3DM1A 1BDOA 1Y1VG 3ICEA 4YCVA 1T5EA 1F9SA 2AKWB 4IJLA 2F0EA 1WCMH 1CUKA 2RBMA 2F4VL 4A3BG 2AWNA 2BOSA 3FHWA 3GTKH 1Q46A 3VYRA 1DOKA 4K8IA 4HJ7A 3I4NG 3ITPA 4OX9Q 3F2BA 1K73C 4UDUC 2B3GA 1XYIA 2VL6A 3MZ5A 1HRJA 4MNOA 3NPPA 4A3LH 4PZ7A 2R93G 1CQVA 4BA1I 4PMWA 3VR5A 4DAYA 4B9XA 2ZJQA 4DPGA 1PH9A 3K59A 2QW7A 4IPCA 3PUYA 5EPKA 2JQOA 3NE5B 3I4NB 3D3RA 4M1UB 5DNFA 1Q8IA 1AN8A 2R93B 1WCMB 3ONAB 4WORA 1DJRD 4HJAA 3GTGB 4IOAA 4O0AA 4C3IH 3PMFA 2NZHA 1HQMC 2E2IH 5BN3A 1NMFA 1MJCA 4HTHA 3J81E 4B3ML 4UY8C 2N88A 4UHVA 4A3JG 2K05A 5C0XG 2RF4A 3E6ZX 1MJEA 2NN6G 3FMCA 5C0XH 4IPDA 2ZXPA 4DAPA 4JW0A 3AB9A 2ZJRA 2L9HA 5CV7A 4JI5Q 2PNHA 1FNWA 4XQJA 2TSSA 5CV6A 4JI3L 1ONLA 4RFBA 3ULJA 3ULLA 2F0LA 1D5XC 2K5QA 2N8NA 1X3GA 2CHBD 1N32L 5AJ3L 1RCVD 1KRTA 1HTPA 2AQ1B 1C4QA 2PMZB 5LHY1 5D3DA 5JJZA 3EROA 4HAEA 4C3JH 3P7JA 5C4HA 1B2TA 1K3BC 2NBFA 1E3PA 5JEAG 1O7LA 4R9WA 3M4YA 3U58A 3DWPA 4BS9A 4KV6A 1B9NA 2AMCB 1Z7TA 2K28A 1GO3E 1WOCA 3NK9A 5HGTA 2F0GA 1JOKA 1VMPA 3R2TA 5CR3A 1HPCA 1CKNB 1KDAA 1D5ZC 4LFAQ 2SDFA 5E7NA 5I9OA 1N33Q 2LSSA 4C3IG 5A2QE 3F2CA 1W2BA 1SRUA 5EAYA 1O7IA 1HNZQ 3BYTB 1SLJA 2PZWA 1STEA 4GN5A 2MHVA 5COYA 1EY8A 3CCLA 2MO0A 2KHJA 4BY1G 2I5LX 5HY6A 3VYUA 3F1ZA 4GZYC 2NTSA 4KKUA 4F87A 1PRTC 2AWOA 4KMUC 3M7GA 1H9MA 4A3DG 4XT1B 1VQIA 2KOLA 1CA5A 1Q82C 3K7AB 3RD4A 3SK4A 4POGA 5IYCH 1HZ9A 2IW3A 4KJNA 2R6GA 3R93A 1HUNA 4GOPC 4YWKA 3QIAA 1MGSA 4BY7B 4LF9L 1WD0A 1UUPA 1EQRA 1QNUA 1SFOH 1EYGA 2QA4A 5JEAH 5KYIA 4LF7Q 1F77A 1L1OB 3K7UC 3HOZH 1NR2A 5J39A 3CCQA 2XSCA 4A3EG 3I56A 5ELBA 2IHFA 3MFYA 5C3XA 3KLSX 4B3TQ 3HG9A 1N34Q 3S15H 4IFDH 3TDQA 2ENBA 2IJ0A 1SE8A 1ICFB 4GLAC 1U9RA 4CKEA 2UUCL 2XNAC 1LLRD 1C48A 4OWTB 1BQQT 2F0OA 3AFQA 1TS2A 2Z1CA 3M9BA 4J15A 4JV5L 4DFAA 2K5DA 4ZAIA 4K6DA 3QOJA 4RHSA 3C1FA 1T5XD 2OQ0A 1A3UA 1L0YB 2EOTA 3CC4A 4DR4L 2PQEA 1MIUA 3HOWH 1I6HH 4JBMA 4LF8Q 5K36H 2R3ZA 3LNNA 2Y0SB 1JC7A 4K0KL 1ESRA 1I4PA 1WTXA 3I8ZA 1VQPA 4UPAA 1PFNA 2K7VA 2N3SA 2OTJA 2ZTDA 3CPFA 1TWFB 2HIXA 4X65Q 4L5RC 4AQYQ 3NEMA 1YNXA 1LUZA 4KKSA 1QILA 4WRDA 4N8FA 1PFSA 1NAPA 3H0GB 1EY6A 1YNNC 5IIFA 2F52A 5JAVA 5KRUA 4DUYQ 4XT3B 3UDGA 2UXDL 4LUOA 3SHLA 3GP7A 1KAAA 4LJZC 4FNFA 3EQLC 4IN3A 2JEBI 4MIUA 2K52A 3P20A 1GM5A 2O2LD 2LY7A 1NR4A 2CW0C 2XWBB 2Z6KA 1UEAB 2EPBA 3EFXD 3W1BA 4NXMQ 1X3PA 4L5TA 3BVMA 2BH2A 3U50C 2Z6BA 1Y1VH 4A3MG 1GJXA 5EJWA 5FLXc 2NVXH 1XX8A 3PUXA 2A8VA 1WI5A 4OELB 5IOCA 2G9HD 3UDIA 3AU7A 4DR6L 1F9PA 3KDFA 4DAVA 4GS3A 2B8GA 1HNXL 1HCZA 4OL7A 1HNWQ 4JG2A 1I4XA 2R7DA 5I6WA 3CCUA 2A69C 3IKJA 3T1HQ 4KY7A 5JVG3 3HOYH 5J22A 3S2HH 2UUBL 3BYYB 3RR5A 3KK7A 2EDGA 2B2YA 1E22A 2NTTA 1XMOL 1C7YA 3U9SA 1EFWA 4BBRG 5C3EG 1V8QA 2RCNA 1O7YA 1PH2A 1XTDA 3CMAA 4KKTA 4GN4B 2CH4A 3TQYA 1YZ6A 2SEBD 4A3IG 1RODA 3PIOA 2EYJA 3NBHA 4DNTB 4JV5Q 1XNRL 2YTVA 1Q81C 3RN2A 4BA2I 4O1NA 3M4PA 1G91A 4JI4L 1LTLA 5IP7H 3HZXA 5FJ8G 2WKCA 4ILWA 2IPKD 3E3XA 2ALYB 3BU2A 3G48A 5KGUA 4YIJA 2K1BA 2RDHA 5CC4A 1ESFA 5IGGA 4LK1C 3T51B 2B2VC 4DV2Q 5D14A 1QJOA 4NXNL 2CH4W 1U0LA 1EY4A 1EQTA 4R1JA 3S16B 1HHVA 2VNUD 1EU4A 3E0JA 4X3TA 1Q8KA 4OGQC 4BXXG 4WJ4A 4X65L 4DR6Q 3TP5A 2ZXOA 3P75A 2H5XA 3FKIB 2Q2TA 1EU3A 3EA6A 3VR3A 3FKIH 3M3YH 5M3MG 4OONA 4QB4A 3NTHA 1FNVA 3HRZC 2ZM6L 4CJ0B 1OXUA 1HJPA 2PW5A 1QG7A 3MXNB 2A5HA 4LF8L 1SJED 3UE0A 4DK1A 4JI8L 4JI2L 4A3BB 1Y14B 1N34L 4L5QA 5LL6S 3QR8A 3KJOA 4APVA 1D8LA 1YNJD 4KK7A 1EEID 2GN5A 1TY0A 2I5MX 3T56B 3I2ZA 3M7NA 5IGCA 3QG1A 2LXJA 5CGKA 2IT1A 3CP0A 2SOBA 1EWIA 3K7AH 1VQEA 1N36Q 4JBKA 1ZEQX 4DR2L 1RDPD 2Q2IA 3MEFA 1I6VC 2QEJC 1GD7A 3STBD 2K5HA 3I55A 3HOXB 4OO1I 2WAQB 4CDDC 1L2FA 2Q8TA 1F2ZA 2KCMA 3G6JB 4ZCKA 3U4ZA 1L0XB 2KCCA 3K81C 1PRTF 3UI2A 2RKSA 3S2HB 2NVYB 3PIO3 1TY2A 5M5XB 1CM9A 5IT9c 2QKIC 3DXJC 4UP9A 5ELEA 1XWEA 2JXMB 1ZYRC 5BN4A 5C6AA 4DV4Q 4PV1C 3M4OH 3L2PA 3D4DA 1B1ZA 1UE7A 2WAQE 4QQBX 4RCOA 4A3KB 3IRBA 2PW7A 5C5LA 1SN8A 1BOSA 1LTAD 5G3LD 3FPUB 2E2DC 5J3BA 1GVPA 3QJYA 2DN8A 2VQEQ 1VQOA 1VQHA 1HFNA 4OO1G 2D2CC 4JI8Q 2EE1A 3PUWA 4DUZQ 2G9DA 1G51A 3A8IE 1KTKA 5I2YA 2BE5D 4H7BA 4C3HG 1JB3A 1VS0A 3IFTA 1VQNA 2JYOA 1QUQA 5IT9L 1S72A 4I7ZC 1N36L 4BBRB 4R8IA 3J81L 1R9TH 3PO3H 4A3BH 5EKKA 2F0MA 3VA5A 1A3TA 1EFID 3MHBA 3CW2C 4RGTA 3JAMi 3GV3A 4GKKL 3BG3A 3J80c 2PPBC 2F1MA 4OO1H 1K8OA 1JMCA 2E2IB 1B8AA 2FHTA 5M5YH 2VZAA 5GAGC 1BCPB 2CFMA 3F2UA 1BBWA 1JOOA 2A1AA 3W5OA 1DONA 1CKOA 3M4QA 1BKBA 2RCFA 4H44C 2PI2E 3STBC 3J7ZC 1QZGA 1ZKOA 4RGMA 1PXUA 1QB5D 4HJ8A 1KD1C 1XNRQ 1AE3A 1BCPC 1IBKQ 1TWAH 1XPUA 3PO3G 4QUCA 3CXCA 3DMUA 5I2XA 3D6WA 2UUAL 1Q7YC 5GADC 1I4QA 4UP8A 5C44H 3A54A 2F4IA 3T4AC 1JWMD 1RJTA 3DWQA 3FKIG 1EWCA 1J9OA 3JAMc 1V43A 2Q8IB 1BF4A 3BZCA 4DV2L 2VQEL 2EYPA 2F3VA 1CZGA 3PCOB 2P5ZX 4ZUJA 4FF1A 1Z6HA 2GVAA 1BXTA 3K5OA 5LMNW 3V05A 2LS01 1R9TB 2MNAA 3PO3B 1CKMA 4I65A 2O4XA 3GTOB 2YTYA 2KEEA 3X3NA 5FO7B 3N52A 2K32A 4LFBQ 1NE3A 4KD4A 4JI5L 2R92H 1DOMA 2GA4B 3V96A 1KIXA 2HQEA 4FVMA 2F0JA 4L5SA 4YWLA 4QMGA 1CK1A 3R2IA 4XTCS 3NQTA 4PZ6A 3TBIB 4K14A 4KHZA 1H9KA 1L0WA 4HIMA 2F0UA 3CRLC 3NTIA 1ZYRD 4N8X1 4A3KH 4Q0FA 1Y1VB 3S14H 4NP5A 2NN6H 2K5NA 2YU9H 4Z9CB 4RAUC 3G71A 3S16H 4A3GH 1CI3M 4DAMA 1GUGA 4P72A 5M5WB 1K8AC 1LTBD 3NSWA 3RLFA 4A75A 2B2WC 4HEDA 2PCFB 1DD2A 4PZ8A 2NVYH 1QVGA 1UAPA 4EX5A 4LFAL 2DJFC 2E5LL 1TT2A 5IP7G 1V1OA 4ME3A 5FJ8H 4XIGS 4XQQA 4A3FH 2A68C 3WWVA 1G8ZD 2PO4A 3EBEA 3Q24A 4A3KG 4DUZL 3HOZG 2WB1B 5I9PA 4HIOA 1TS5A 4GN3B 3CCRA 4OWXB 3T13A 1VQ7A 2J0TD 1SYGA 2UXDQ 2R92G 3BS1A 1YI2A 3HOUB 3TREA 4FXKC 2O5JC 5CYUA 2MO1A 1ENAA 1KHIA 1EY9A 1SYFA 2K04A 5HURA 3NTKA 5LMNQ 2E2JH 1JORA 3ULPA 1TS3A 1YJWA 1PZKD 4EQNA 3J80L 1N8RC 5GQOA 2EYMA 2E75C 2SNMA 2F0PA 2MQHA 3GTPB 1FJGL 4A3JH 2DUDA 1XNQQ 1QE6A 3A55A 2VB3X 4RCNA 5FK9C 5NUCA 1EYAA 1STYA 2K01A 1PMRA 3WDNA 4DGZA 1IZ6A 3N6RA 1GUSA 1XPOA 1VQAA 1SYBA 1LABA 5M3FH 3GTGH 4K2LA 5CV5A 3I72A 1GUOA 1PH3A 3KOJA 2OTLA 4C1NK 4ZRZA 2ZXRA 4KHPL 4KD3A 4C3JG 5D3IB 1ICWA 4B3MQ 3OSOA 2K14A 3ERQA 4JI4Q 4IPHA 1Y1WG 4BY7G 1DZ1A 1B70B 3CF5A 4JC0A 1GHKA 4BY7H 3KF6B 4G7ZC 1FGUA 3HOWB 1I50B 5K36G 3E0EA 2ZTCA 2B8FA 4H13C 3SE0A 2WFWA 4AIMA 4F8MA 1Q3LA 2QCPX 2L15A 3VDYA 3FEWX 3K5MA 4AQYL 1ET6A 1TS4A 2ASBA 1NJIC 1EY5A 4TKOB 5JJKA 1LTTD 2D9UA 1A8VA 1KABA 4AYBE 2AUKA 2ZM6Q 4B08A 3M3YB 4ZYSA 1K83B 1O78A 3BJUA 1RTNA 1SNOA 1PTOB 1LACA 5JJIA 2JA5H 4C2MH 4A76A 1E2ZA 1ET9A 1WTOA 5IWAQ 1PH4A 4GKKQ 3OPOA 2B2YC 4IUTA 3OIQA 5JEAJ 2CQOA 4A93H 4NXNQ 1UE1A 2KA7A 2Q2HA 5J1ZA 4DNIA 1SFOB 5KEEA 3QWNA 1NUCA 3HKZB 4O42A 4K2KA 4DV1L 1ILPA 4YHHQ 1BR9A 2SNSA 2WIIB 3AYHB 3Q6SA 4NMZA 4KHPQ 3H0GG 3Q0AA 1YHQA 1TQOA 1SROA 4B3RL 4DNRB 3D4RA 2E8GA 4G57A 1TWGH 5GROA 1IYJB 4X3UA 3PF5A 1IYVA 3VYSA 3K57A 4FDBA 2K6AA 4DV0Q 4M8AA 4BBSB 4DR7L 2BE5C 2F0DA 2ICIA 3AMUA 1PZID 4DR2Q 3H94A 1KXLA 1LYLA 5FOBB 1HR0W 1CZWA 2DGYA 1X65A 4GKJQ 1OTCA 2UUBQ 1PZJD 1WFQA 1VQ5A 1RIPA 3BZDB 2IL8A 4DR1L 1VQGA 2IHEA 4ME5A 1KLUD 4IURA 1JR0D 2WB1G 3FDTA 4BWGB 1B3QA 1AZQA 2MP1A 3S1QB 3H6MA 3I4OA 1HZCA 1HA5A 4JCVE 4HMIA 1BBUA 4WJWA 3Q22A 3TRZA 2OWOA 1NCVA 4DAYB 2NVXB 2K75A 4C2MB 1GUWA 2XRSD 3ND9A 1BUVT 2FINB 1S5ED 1V9PA 3L9AX 2BA0A 2TMPA 1VMCA 4JI7Q 4HJ5A 4OHJA 4A3LG 2NYZD 2A74C 2E76C 1YBYA 2R93H 1BNZA 4CDEC 3K5NA 2UUCQ 1X3EA 5JVH3 1DYQA 2BA1A 1S5DD 2YTXA 3NBIA 1G6PA 4LAAA 1KQSA 4DV0L 1PRTD 2K03A 1X56A 4Y7NH 4A3GG 4FYDA 4QJFA 5FO9B 3PUVA 2QF7A 3G6EA 1IBLL 1P8LA 2HD3A 2RHQB 1HXYD 2UXBQ 1VQCA 1S40A 3NHHA 3IL8A 1Y8NB 1Q12A 1H9SB 4DR7Q 2F0VA 3KDFB 5C4XH 3NP8A 1C8CA 1S5CD 1X55A 2D0PA 3VYTA 1P16A 1C9OA 3F2DA 4JPBW 3MXPA 4F7XA 4R4TA 5ELOA 3CU7A 3NQIA 3W2DA 1PTOH 1TVXA 4TVAB 2JSOA 2D62A 1M1KC 2EYFA 3OYYA 3H3VI 1N33L 4IUQA 1K83H 1W3SA 3LWUA 4DR4Q 1I4GA 5ELDA 3TZDA 3PQIA 2NZ1D 4K8JA 3FRPB 2B63G 1LM0A 4IFDG 5JPNC 1GKHA 3GO5A 3LX0A 4A3DB 4R4CA 1YNJC 4GLVB 2QILA 3I4MB 3BVZA 2X69A 5FLXE 3CKIB 5T1IA 3NBHB 2F3IA 4H02A 2A73B 5E4WC 5M3MB 2A6EC 3R3OA 3NXWA 5D65A 3TS0A 1NSNS 3UDXA 4EQPA 3MEHA 4HSVA 4YCWA 2RDGA 1GHJA 3KF6A 3NWTA 1Y8OB 1E0BA 2KUMA 4OWWB 4EQ5A 5IT9E 1NY4A 2KBNA 3I3CA 1X9NA 1A6XA 3S1QH 1R4QB 4GNXA 5H1SE 4DV5Q 1YITA 1B53A 5LMUL 1FD7D 3HKZG 5FKAC 1G6ZA 4U673 3D31A 5EBCA 2VUMH 1HFGA 5M3FB 3SK6A 3SR1A 2EYLA 1JICA 1TR5A 1CHPD 5IP9H 1HR0L 3K80C 1JWUD 3UDFA 1MHWC 2I0QA 4FF2A 4J8QA 2HCCA 4EQOA 3TP6A 4A3JB 1MD2D 1JOQA 1PTOD 2F0FA 2RA4A 1YHBA 3MAQA 3NELA 5M5WH 2J7ZA 3OHXC 4IFDI 4AYBG 5C0XJ 3HFZB 4JI6L 1GUTA 5E1FA 4BBSG 1LT4D 3CQZH 2AHOB 1LTGD 2B2UA 3CCMA 2O5IC 4FO2A 3H09A 5C5MA 4ABNA 2I5HA 5M3FG 2EJGC 4DR1Q 4HSPA 4QGUA 1YIJA
chains in the Genus database with same CATH topology
3RZOH 1NMFA 2A1AA 4GKJL 3W5OA 1MJCA 4LFCL 4B3ML 3S1RH 1CKOA 1L1OA 1BKBA 2QGQA 3M4QA 2PI2E 3STBC 5C0XG 3J7ZC 2RF4A 2VY3A 3KF8B 4A3JG 1A0IA 4HJ8A 3RZDH 1KD1C 2NN6G 1MJEA 1HR0Q 2PQAB 1AE3A 4A3FG 2FXQA 2JA5G 1IBKQ 1TWAH 4BBRH 4IPDA 5IYBH 3H15A 1OXTA 2KHIA 4GLXA 2ZJRA 1XPUA 3PO3G 2E2HH 3CXCA 1XNQL 4JI5Q 2PNHA 4JYAL 1HZBA 4JI1Q 3HOWG 1PH5A 2UUAL 1Q7YC 4JI3L 2VW9A 1QVCA 3ULJA 5GADC 3ULLA 4LUZA 4UP8A 5C44H 4Y52H 4DV6L 4DV5L 2N8NA 1X3FA 1X3GA 1N32L 3A0JA 2Z0SA 2WP8J 3FKIG 5AJ3L 3JAMc 3HOYG 1V43A 3EIVA 5IYCG 4WJ3M 1KRTA 3BZCA 4LWCA 4DV2L 2VQEL 3S1NH 1WYDA 3PCOB 1SR3A 4C3JH 4DV1Q 3HOVG 2GVAA 1FVIA 3A74A 3PV0A 4JOIC 5LMNW 3BZKA 1EIYB 1K0RA 4LF4L 1E3PA 4DK6C 2ZJPA 1CSQA 2ID0A 2WB1E 4MTNA 5JEAG 1CKMA 2MNAA 1ASZA 4LF6L 2R7ZG 1HNXQ 3U58A 2YTYA 5HGQA 2AMCB 3L0OA 1JJGA 4A3EH 2K4KA 4ALPA 4LFBQ 4O2DA 1BVSA 2JEAI 1J5EL 1NE3A 4JI5L 2PMZE 2R92H 1GO3E 1WOCA 3A5UA 2NN6I 1I94Q 1IBLQ 1KIXA 3GD7A 4L5SA 4NXML 4YWLA 1CKNB 1EIFA 4LUVA 4A3DH 2CKZB 4LFAQ 5C4JH 4LFBL 5E7NA 3GTPH 4XTCS 4PZ6A 1PV4A 1N33Q 1U5KA 2HIVA 2LSSA 3M85A 1EQQA 1VQKA 1Z9FA 4KHZA 3F2CA 1W2BA 1SRUA 5EAYA 1I3QH 4LF9Q 4AH6A 1L0WA 1E7ZA 4HIMA 1O7IA 4IJHA 1HNZQ 1SLJA 4HIKA 4LF4Q 2K5VA 4GN5A 4A3KH 4X64L 3S14H 3DLLA 2EQSA 2WAQG 3CCLA 2MO0A 2K5NA 2YU9H 2KHJA 4BY1G 1PH7A 1A63A 2I5LX 3G71A 3S16H 4A3GH 4DAMA 5HY6A 3F1ZA 4P72A 2Y0SG 1QUQB 1XPRA 3A5ZB 4QIWE 1HNWL 3FP9A 2AWOA 2RHSB 1K8AC 3RLFA 3J81j 4A75A 4A3DG 2UXBL 1NBWA 1VQIA 2ES2A 3T1YL 1Q82C 4DK3C 3PF4A 3CCJA 4PZ8A 4LF6Q 2NVYH 1QVGA 2IY5B 4POGA 5IYCH 1HZ9A 1TWCH 4EX5A 4X66Q 4LFAL 2E5LL 2E5LQ 2R6GA 5IP7G 3CPWA 1JJ2A 4GOPC 4ME3A 5FJ8H 4XIGS 4YWKA 2PI2A 4A3FH 4LF9L 3WWVA 1EQRA 1NMGA 1EYGA 1SFOH 3J81i 3GTMH 2QA4A 5LMUQ 3EBEA 4A3KG 2R7ZH 4DUZL 1K8GA 1S3OA 3HOZG 4HIOA 2GVBA 4GN3B 4LF7Q 1L1OB 3K7UC 4MZ9A 3E9IA 3CCRA 3CCQA 3HOZH 4OWXB 4KLKA 5C44G 1KAWA 1VQ7A 4A3EG 2BH8A 3I56A 2UXDQ 2IHFA 1I94L 3ER0A 3CC7A 2R92G 4OXPA 1YI2A 2UU9L 4B3TQ 3TREA 1N34Q 3S15H 2MO1A 4IO9A 4JI2Q 1KHIA 2E2JH 5LMNQ 1SE8A 3ULPA 4GLAC 1YJWA 3H3VH 5FLMH 1QZGA 1N8RC 1JB7A 2UUCL 5GQOA 3W1GA 4B3SL 2NVQH 1QVFA 4OWTB 1PHJA 1VQ9A 5ELNA 3AFQA 2MQHA 4POFA 1E1TA 3M9BA 2CWAA 4J15A 1FJGL 1DGSA 1EOVA 2VQFQ 4JV5L 4IPGA 4A3JH 2OCEA 2DUDA 1XNQQ 1D7QA 4K0KQ 4DR5Q 4TQUS 4JI0L 4LF7L 1IZ6A 1WCMG 4DV3Q 2OQ0A 3CC4A 1PYSB 4DR4L 2CWPA 1MIUA 3K0XA 3HOWH 1I6HH 1XPOA 4JBMA 4LF8Q 2D0OA 1JT8A 1VQAA 4JBJA 4YCUA 1N9WA 5M3FH 4LFCQ 1Q1EA 1YHAA 3B6YA 1IBMQ 3GTGH 4K0KL 1PH3A 4JI0Q 3KOJA 2OTLA 4GNXC 1VQPA 4A3CH 4UPAA 4B3RQ 3S1MH 4RMFA 4KHPL 4QL5A 2N3SA 2OTJA 3PO2H 4UY8C 4YY3Q 2ZTDA 2HQLA 3CPFA 4B3MQ 4C3HH 2HIXA 4X65Q 4L5RC 1XMOQ 3T1YQ 2K14A 2IX0A 3U4VA 4JI4Q 4IPHA 5BR8Q 3G4SA 1Y1WG 4BY7G 4AQYQ 1B70B 1KRSA 3NEMA 4R4IA 1YNXA 4LF5Q 3CF5A 2UU9Q 4JC0A 3HOXG 4A3MH 4BY7H 1I50H 1LUZA 3CC2A 1VQJA 2Z6KC 3KF6B 3GTJH 2UUAQ 1PFSA 2EXDA 1FGUA 3JC66 5K36G 3E9HA 2F52A 3E0EA 4DUYQ 3UDGA 2UXDL 2ZTCA 4LUOA 2UXCL 3RNUA 2WFWA 1VQFA 4AIMA 1IBKL 1VQ8A 1UWVA 1Q1BA 2L15A 3VDYA 2JEBI 4AQYL 2ASBA 4A93G 1TWFH 3GDEA 1NJIC 4P75A 5JJKA 2N49A 3PO2G 2K52A 1H95A 1A8VA 1YJ9A 1GM5A 1TWHH 4GOPB 4AYBE 2PQAA 4P73A 2Z6KA 2ZM6Q 3W1BA 3TEHB 4NXMQ 2XGTA 4L5TA 5IY0A 4YWMA 1CSPA 3BJUA 3U50C 2BH2A 2YYZA 3AQQA 3CAMA 3CCEA 4DR3L 4X6AH 1Y1VH 4A3MG 4RG1A 4R4QA 5FLXc 2NVXH 5JJIA 3PUXA 2JA5H 3EN2A 4NB3A 4C2MH 4A76A 2A8VA 1WI5A 2NVTH 1PH4A 3HOXH 4GKKQ 5IWAQ 2JA8G 3UDIA 1JE5A 4DR6L 1K3RA 4X62Q 1EUJA 3AFPA 3I7FA 3KDFA 4GS3A 3PIPA 4DV7L 3I4MH 1HNXL 1HNWQ 5JEAJ 4JG2A 2CQOA 2R7DA 3I4NH 4A93H 4NXNQ 1UE1A 3Q8DA 1PH1A 2Q2HA 3CCUA 4X64Q 2F4VQ 4DNIA 3T1HQ 1XMQL 5GAHC 3HOYH 3S2HH 3ERSX 4QY7A 2UUBL 4DV1L 2VS1A 1Q86C 3RR5A 4B3SQ 4YHHQ 2C35B 1E22A 1VCIA 1XMOL 1I5FA 1C7YA 2YV5A 4BBRG 5IYBG 5C3EG 4DV6Q 1EFWA 2RCNA 1N32Q 1PH2A 1XTDA 3CMAA 3GTOH 3AYHB 2K50A 1E1OA 4JI3Q 1Y1WH 3H0GG 4KHPQ 4GN4B 4JI1L 3TQYA 1YHQA 2XTIA 2IX1A 1SROA 4B3RL 1YZ6A 4IOCA 1V1QA 2E8GA 4A3IG 1J5EQ 1TWGH 3NENA 5GROA 3PIOA 1IYJB 2EIFA 2VQFL 4JV5Q 3PF5A 1XNRL 2YTVA 1Q81C 3RN2A 4FDBA 4BA2I 4DV0Q 3M4PA 4JI4L 4DR7L 3J81c 4DV3L 4DR2Q 1KXLA 1LTLA 1LYLA 3KLWA 5IP7H 1HR0W 2DGYA 5FJ8G 1X65A 4GKJQ 3J80i 1C0AA 5M3MH 1YEZA 1PH6A 3AEVA 4YHHL 1OTCA 2UUBQ 2ALYB 3BU2A 1A62A 3G48A 1IXRA 2JA6H 1WFQA 5C3EH 1RIPA 1VQ5A 1FJGQ 1IL2A 5C0XI 1X54A 3CD6A 4DR1L 1VQGA 4GNXB 3S2DH 2IHEA 2HHHQ 2OQKA 1Z47A 1OXVA 2ATWA 1HH2P 1AE2A 2B29A 3HKSA 3PUZA 4DV2Q 2WB1G 4NXNL 1U0LA 1VQ6A 3I4OA 1QZHA 4R1JA 1HZCA 4JCVE 2VNUD 4R4OA 4GOPA 1Q8KA 4BY1H 4X62L 4JI7L 1BBUA 4BXXG 4WJ4A 4X65L 1ASYA 1B7YB 2OWOA 4B3TL 2JA8H 3TRZA 4DAYB 4DR6Q 2Q2UA 1RL2A 2H5XA 2K75A 4BXXH 2CCZA 2JE6I 2N78A 4DR3Q 2Q2TA 4KI0A 2MFIA 4P71A 3HKZE 1OXXK 3L7ZC 1V9PA 3D0FA 3FKIH 5FLMG 2BA0A 3HOUH 3M3YH 2LXKA 4X66L 5M3MG 4OONA 4HJ5A 4JI7Q 2JA7H 4A3LG 2R93H 3S24A 1YBYA 5JJLA 2Y0SE 1VQ4A 1FL0A 2ZM6L 2UUCQ 1OXUA 1HJPA 2JA7G 1X3EA 3MXNB 4JBWA 3OW2A 3HOVH 1BBWA 2BA1A 2JA6G 2YTXA 4LF8L 1G6PA 3UE0A 4DKAC 4JI8L 4OX9L 1KQSA 4JI2L 2R7FA 4DV0L 4P74A 1K9MC 1Y14B 1N34L 4L5QA 3GTQH 4A4IA 1X56A 4Y7NH 3KJOA 4A3GG 4DR5L 3OTOQ 4APVA 1D8LA 3DM3A 4QJFA 3T1HL 1XMQQ 1PH8A 2GN5A 3PUVA 4JOIA 2V1CC 4DUYL 3H0GH 2KCTA 3G6EA 1IBLL 1P8LA 1UE5A 2I5MX 2RHQB 3I2ZA 2UXBQ 4JI6Q 3M7NA 1VQCA 1TXYA 1KC8C 2LXJA 4BBSH 1S40A 2IT1A 3CP0A 1HNZL 4LF5L 1EWIA 3K7AH 1VQEA 1N36Q 4JBKA 5BR8L 1VQDA 4DR2L 5LMNL 1Q12A 2Q2IA 4DR7Q 3MEFA 1UE6A 3KDFB 3SGIA 5C4XH 1X55A 4HJ9A 4DV4L 1GD7A 2D0PA 2KENA 3KYHC 1P16A 1C9OA 3STBD 4YY3L 3F2DA 5IYDG 3PGZA 4HIDA 2K5HA 3KFUA 1YVCA 4LW1A 3I55A 4R4TA 4IFDJ 5ELOA 4OO1I 2JK8A 1HZAA 1IBML 1L2FA 4TVAB 2HT1A 5AJ3Q 2D62A 2KCMA 1M1KC 3U4ZA 3F8TA 3OYYA 3H3VI 1N33L 1L1OC 3RLOA 2QEXA 3K81C 1K83H 1W3SA 4A3IH 4DR4Q 1PVOA 3GTLH 1PYBA 5IWAL 1VQLA 3S17H 4PG3A 1PA6A 1VQBA 2B63G 2UXCQ 1LM0A 1XNRQ 4IFDG 2HHHL 1GKHA 3GO5A 5IT9c 1VQMA 4R4CA 4UP9A 5DLQE 4GLVB 3RN5A 3LGJA 5C4XG 5M5XH 1WJJA 1JJCB 1NTGA 3NBHB 4DV4Q 2F3IA 4H02A 5IP9G 2ZTEA 3M4OH 1G291 3L2PA 3CCVA 3TS0A 1M90C 4LNQA 3UDXA 4DV7Q 1UE7A 2WAQE 1Y1VG 3ICEA 4YCVA 3IRBA 4QQBX 1XJVA 4YCWA 1J6QA 1SN8A 3KF6A 2AKWB 4IJLA 5IE8A 1WCMH 1CUKA 3UE1A 4OWWB 5J3BA 1CKNA 4EQ5A 2F4VL 4A3BG 1GVPA 2AWNA 4JYAQ 1NY4A 2JA9A 2VQEQ 1VQHA 1VQOA 2KBNA 1X9NA 3FHWA 3GTKH 3S1QH 3CMEA 1Q46A 4OO1G 4GNXA 4HJ7A 3I4NG 5H1SE 4DV5Q 4JI8Q 1YITA 4OX9Q 3F2BA 1K73C 5LMUL 2A19A 4A3CG 3PUWA 2B3GA 3HKZG 4DUZQ 3HOUG 2VUMG 2VL6A 4MNOA 4A3LH 2R93G 4PZ7A 3PSIA 1G51A 1KL9A 3D31A 4BA1I 4NPSA 2VUMH 4PMWA 1YJNA 2ZJQA 1MKHA 2NZOA 4DPGA 1PH9A 1E24A 1AH9A 5IP9H 3KJPA 1HR0L 1VS0A 2JJQA 4IPCA 3PUYA 1VQNA 3K80C 5GAEC 3UDFA 1QUQA 1S72A 5IYDH 4UP7A 1N36L 1R9TH 3PO3H 2I0QA 1SMXA 3TS2A 2JQOA 4A3BH 1X6OA 3ZJYC 1YHBA 3CW2C 3JAMi 3RLNA 3NELA 4GKKL 5M5WH 1T9HA 4IFDI 3K8AA 4AYBG 5C0XJ 3HFZB 3J80c 4JI6L 4BBSG 3CQZH 2AHOB 3CCMA 1JMCA 1B8AA 3I4MG 5M5YH 2I5HA 2VZAA 5M3FG 2B63H 4DR1Q 4HJAA 4IOAA 3OTOL 5GAGC 4QGUA 3CCSA 4O0AA 1OXSC 2CFMA 4C3IH 2NZHA 1YIJA 3J7A5 1UEBA 2E2IH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZO H;  1NMF A;  2A1A A;  4GKJ L;  3W5O A;  1MJC A;  4LFC L;  4B3M L;  3S1R H;  1CKO A;  1L1O A;  1BKB A;  2QGQ A;  3M4Q A;  2PI2 E;  3STB C;  5C0X G;  3J7Z C;  2RF4 A;  2VY3 A;  3KF8 B;  4A3J G;  1A0I A;  4HJ8 A;  3RZD H;  1KD1 C;  2NN6 G;  1MJE A;  1HR0 Q;  2PQA B;  1AE3 A;  4A3F G;  2FXQ A;  2JA5 G;  1IBK Q;  1TWA H;  4BBR H;  4IPD A;  5IYB H;  3H15 A;  1OXT A;  2KHI A;  4GLX A;  2ZJR A;  1XPU A;  3PO3 G;  2E2H H;  3CXC A;  1XNQ L;  4JI5 Q;  2PNH A;  4JYA L;  1HZB A;  4JI1 Q;  3HOW G;  1PH5 A;  2UUA L;  1Q7Y C;  4JI3 L;  2VW9 A;  1QVC A;  3ULJ A;  5GAD C;  3ULL A;  4LUZ A;  4UP8 A;  5C44 H;  4Y52 H;  4DV6 L;  4DV5 L;  2N8N A;  1X3F A;  1X3G A;  1N32 L;  3A0J A;  2Z0S A;  2WP8 J;  3FKI G;  5AJ3 L;  3JAM c;  3HOY G;  1V43 A;  3EIV A;  5IYC G;  4WJ3 M;  1KRT A;  3BZC A;  4LWC A;  4DV2 L;  2VQE L;  3S1N H;  1WYD A;  3PCO B;  1SR3 A;  4C3J H;  4DV1 Q;  3HOV G;  2GVA A;  1FVI A;  3A74 A;  3PV0 A;  4JOI C;  5LMN W;  3BZK A;  1EIY B;  1K0R A;  4LF4 L;  1E3P A;  4DK6 C;  2ZJP A;  1CSQ A;  2ID0 A;  2WB1 E;  4MTN A;  5JEA G;  1CKM A;  2MNA A;  1ASZ A;  4LF6 L;  2R7Z G;  1HNX Q;  3U58 A;  2YTY A;  5HGQ A;  2AMC B;  3L0O A;  1JJG A;  4A3E H;  2K4K A;  4ALP A;  4LFB Q;  4O2D A;  1BVS A;  2JEA I;  1J5E L;  1NE3 A;  4JI5 L;  2PMZ E;  2R92 H;  1GO3 E;  1WOC A;  3A5U A;  2NN6 I;  1I94 Q;  1IBL Q;  1KIX A;  3GD7 A;  4L5S A;  4NXM L;  4YWL A;  1CKN B;  1EIF A;  4LUV A;  4A3D H;  2CKZ B;  4LFA Q;  5C4J H;  4LFB L;  5E7N A;  3GTP H;  4XTC S;  4PZ6 A;  1PV4 A;  1N33 Q;  1U5K A;  2HIV A;  2LSS A;  3M85 A;  1EQQ A;  1VQK A;  1Z9F A;  4KHZ A;  3F2C A;  1W2B A;  1SRU A;  5EAY A;  1I3Q H;  4LF9 Q;  4AH6 A;  1L0W A;  1E7Z A;  4HIM A;  1O7I A;  4IJH A;  1HNZ Q;  1SLJ A;  4HIK A;  4LF4 Q;  2K5V A;  4GN5 A;  4A3K H;  4X64 L;  3S14 H;  3DLL A;  2EQS A;  2WAQ G;  3CCL A;  2MO0 A;  2K5N A;  2YU9 H;  2KHJ A;  4BY1 G;  1PH7 A;  1A63 A;  2I5L X;  3G71 A;  3S16 H;  4A3G H;  4DAM A;  5HY6 A;  3F1Z A;  4P72 A;  2Y0S G;  1QUQ B;  1XPR A;  3A5Z B;  4QIW E;  1HNW L;  3FP9 A;  2AWO A;  2RHS B;  1K8A C;  3RLF A;  3J81 j;  4A75 A;  4A3D G;  2UXB L;  1NBW A;  1VQI A;  2ES2 A;  3T1Y L;  1Q82 C;  4DK3 C;  3PF4 A;  3CCJ A;  4PZ8 A;  4LF6 Q;  2NVY H;  1QVG A;  2IY5 B;  4POG A;  5IYC H;  1HZ9 A;  1TWC H;  4EX5 A;  4X66 Q;  4LFA L;  2E5L L;  2E5L Q;  2R6G A;  5IP7 G;  3CPW A;  1JJ2 A;  4GOP C;  4ME3 A;  5FJ8 H;  4XIG S;  4YWK A;  2PI2 A;  4A3F H;  4LF9 L;  3WWV A;  1EQR A;  1NMG A;  1EYG A;  1SFO H;  3J81 i;  3GTM H;  2QA4 A;  5LMU Q;  3EBE A;  4A3K G;  2R7Z H;  4DUZ L;  1K8G A;  1S3O A;  3HOZ G;  4HIO A;  2GVB A;  4GN3 B;  4LF7 Q;  1L1O B;  3K7U C;  4MZ9 A;  3E9I A;  3CCR A;  3CCQ A;  3HOZ H;  4OWX B;  4KLK A;  5C44 G;  1KAW A;  1VQ7 A;  4A3E G;  2BH8 A;  3I56 A;  2UXD Q;  2IHF A;  1I94 L;  3ER0 A;  3CC7 A;  2R92 G;  4OXP A;  1YI2 A;  2UU9 L;  4B3T Q;  3TRE A;  1N34 Q;  3S15 H;  2MO1 A;  4IO9 A;  4JI2 Q;  1KHI A;  2E2J H;  5LMN Q;  1SE8 A;  3ULP A;  4GLA C;  1YJW A;  3H3V H;  5FLM H;  1QZG A;  1N8R C;  1JB7 A;  2UUC L;  5GQO A;  3W1G A;  4B3S L;  2NVQ H;  1QVF A;  4OWT B;  1PHJ A;  1VQ9 A;  5ELN A;  3AFQ A;  2MQH A;  4POF A;  1E1T A;  3M9B A;  2CWA A;  4J15 A;  1FJG L;  1DGS A;  1EOV A;  2VQF Q;  4JV5 L;  4IPG A;  4A3J H;  2OCE A;  2DUD A;  1XNQ Q;  1D7Q A;  4K0K Q;  4DR5 Q;  4TQU S;  4JI0 L;  4LF7 L;  1IZ6 A;  1WCM G;  4DV3 Q;  2OQ0 A;  3CC4 A;  1PYS B;  4DR4 L;  2CWP A;  1MIU A;  3K0X A;  3HOW H;  1I6H H;  1XPO A;  4JBM A;  4LF8 Q;  2D0O A;  1JT8 A;  1VQA A;  4JBJ A;  4YCU A;  1N9W A;  5M3F H;  4LFC Q;  1Q1E A;  1YHA A;  3B6Y A;  1IBM Q;  3GTG H;  4K0K L;  1PH3 A;  4JI0 Q;  3KOJ A;  2OTL A;  4GNX C;  1VQP A;  4A3C H;  4UPA A;  4B3R Q;  3S1M H;  4RMF A;  4KHP L;  4QL5 A;  2N3S A;  2OTJ A;  3PO2 H;  4UY8 C;  4YY3 Q;  2ZTD A;  2HQL A;  3CPF A;  4B3M Q;  4C3H H;  2HIX A;  4X65 Q;  4L5R C;  1XMO Q;  3T1Y Q;  2K14 A;  2IX0 A;  3U4V A;  4JI4 Q;  4IPH A;  5BR8 Q;  3G4S A;  1Y1W G;  4BY7 G;  4AQY Q;  1B70 B;  1KRS A;  3NEM A;  4R4I A;  1YNX A;  4LF5 Q;  3CF5 A;  2UU9 Q;  4JC0 A;  3HOX G;  4A3M H;  4BY7 H;  1I50 H;  1LUZ A;  3CC2 A;  1VQJ A;  2Z6K C;  3KF6 B;  3GTJ H;  2UUA Q;  1PFS A;  2EXD A;  1FGU A;  3JC6 6;  5K36 G;  3E9H A;  2F52 A;  3E0E A;  4DUY Q;  3UDG A;  2UXD L;  2ZTC A;  4LUO A;  2UXC L;  3RNU A;  2WFW A;  1VQF A;  4AIM A;  1IBK L;  1VQ8 A;  1UWV A;  1Q1B A;  2L15 A;  3VDY A;  2JEB I;  4AQY L;  2ASB A;  4A93 G;  1TWF H;  3GDE A;  1NJI C;  4P75 A;  5JJK A;  2N49 A;  3PO2 G;  2K52 A;  1H95 A;  1A8V A;  1YJ9 A;  1GM5 A;  1TWH H;  4GOP B;  4AYB E;  2PQA A;  4P73 A;  2Z6K A;  2ZM6 Q;  3W1B A;  3TEH B;  4NXM Q;  2XGT A;  4L5T A;  5IY0 A;  4YWM A;  1CSP A;  3BJU A;  3U50 C;  2BH2 A;  2YYZ A;  3AQQ A;  3CAM A;  3CCE A;  4DR3 L;  4X6A H;  1Y1V H;  4A3M G;  4RG1 A;  4R4Q A;  5FLX c;  2NVX H;  5JJI A;  3PUX A;  2JA5 H;  3EN2 A;  4NB3 A;  4C2M H;  4A76 A;  2A8V A;  1WI5 A;  2NVT H;  1PH4 A;  3HOX H;  4GKK Q;  5IWA Q;  2JA8 G;  3UDI A;  1JE5 A;  4DR6 L;  1K3R A;  4X62 Q;  1EUJ A;  3AFP A;  3I7F A;  3KDF A;  4GS3 A;  3PIP A;  4DV7 L;  3I4M H;  1HNX L;  1HNW Q;  5JEA J;  4JG2 A;  2CQO A;  2R7D A;  3I4N H;  4A93 H;  4NXN Q;  1UE1 A;  3Q8D A;  1PH1 A;  2Q2H A;  3CCU A;  4X64 Q;  2F4V Q;  4DNI A;  3T1H Q;  1XMQ L;  5GAH C;  3HOY H;  3S2H H;  3ERS X;  4QY7 A;  2UUB L;  4DV1 L;  2VS1 A;  1Q86 C;  3RR5 A;  4B3S Q;  4YHH Q;  2C35 B;  1E22 A;  1VCI A;  1XMO L;  1I5F A;  1C7Y A;  2YV5 A;  4BBR G;  5IYB G;  5C3E G;  4DV6 Q;  1EFW A;  2RCN A;  1N32 Q;  1PH2 A;  1XTD A;  3CMA A;  3GTO H;  3AYH B;  2K50 A;  1E1O A;  4JI3 Q;  1Y1W H;  3H0G G;  4KHP Q;  4GN4 B;  4JI1 L;  3TQY A;  1YHQ A;  2XTI A;  2IX1 A;  1SRO A;  4B3R L;  1YZ6 A;  4IOC A;  1V1Q A;  2E8G A;  4A3I G;  1J5E Q;  1TWG H;  3NEN A;  5GRO A;  3PIO A;  1IYJ B;  2EIF A;  2VQF L;  4JV5 Q;  3PF5 A;  1XNR L;  2YTV A;  1Q81 C;  3RN2 A;  4FDB A;  4BA2 I;  4DV0 Q;  3M4P A;  4JI4 L;  4DR7 L;  3J81 c;  4DV3 L;  4DR2 Q;  1KXL A;  1LTL A;  1LYL A;  3KLW A;  5IP7 H;  1HR0 W;  2DGY A;  5FJ8 G;  1X65 A;  4GKJ Q;  3J80 i;  1C0A A;  5M3M H;  1YEZ A;  1PH6 A;  3AEV A;  4YHH L;  1OTC A;  2UUB Q;  2ALY B;  3BU2 A;  1A62 A;  3G48 A;  1IXR A;  2JA6 H;  1WFQ A;  5C3E H;  1RIP A;  1VQ5 A;  1FJG Q;  1IL2 A;  5C0X I;  1X54 A;  3CD6 A;  4DR1 L;  1VQG A;  4GNX B;  3S2D H;  2IHE A;  2HHH Q;  2OQK A;  1Z47 A;  1OXV A;  2ATW A;  1HH2 P;  1AE2 A;  2B29 A;  3HKS A;  3PUZ A;  4DV2 Q;  2WB1 G;  4NXN L;  1U0L A;  1VQ6 A;  3I4O A;  1QZH A;  4R1J A;  1HZC A;  4JCV E;  2VNU D;  4R4O A;  4GOP A;  1Q8K A;  4BY1 H;  4X62 L;  4JI7 L;  1BBU A;  4BXX G;  4WJ4 A;  4X65 L;  1ASY A;  1B7Y B;  2OWO A;  4B3T L;  2JA8 H;  3TRZ A;  4DAY B;  4DR6 Q;  2Q2U A;  1RL2 A;  2H5X A;  2K75 A;  4BXX H;  2CCZ A;  2JE6 I;  2N78 A;  4DR3 Q;  2Q2T A;  4KI0 A;  2MFI A;  4P71 A;  3HKZ E;  1OXX K;  3L7Z C;  1V9P A;  3D0F A;  3FKI H;  5FLM G;  2BA0 A;  3HOU H;  3M3Y H;  2LXK A;  4X66 L;  5M3M G;  4OON A;  4HJ5 A;  4JI7 Q;  2JA7 H;  4A3L G;  2R93 H;  3S24 A;  1YBY A;  5JJL A;  2Y0S E;  1VQ4 A;  1FL0 A;  2ZM6 L;  2UUC Q;  1OXU A;  1HJP A;  2JA7 G;  1X3E A;  3MXN B;  4JBW A;  3OW2 A;  3HOV H;  1BBW A;  2BA1 A;  2JA6 G;  2YTX A;  4LF8 L;  1G6P A;  3UE0 A;  4DKA C;  4JI8 L;  4OX9 L;  1KQS A;  4JI2 L;  2R7F A;  4DV0 L;  4P74 A;  1K9M C;  1Y14 B;  1N34 L;  4L5Q A;  3GTQ H;  4A4I A;  1X56 A;  4Y7N H;  3KJO A;  4A3G G;  4DR5 L;  3OTO Q;  4APV A;  1D8L A;  3DM3 A;  4QJF A;  3T1H L;  1XMQ Q;  1PH8 A;  2GN5 A;  3PUV A;  4JOI A;  2V1C C;  4DUY L;  3H0G H;  2KCT A;  3G6E A;  1IBL L;  1P8L A;  1UE5 A;  2I5M X;  2RHQ B;  3I2Z A;  2UXB Q;  4JI6 Q;  3M7N A;  1VQC A;  1TXY A;  1KC8 C;  2LXJ A;  4BBS H;  1S40 A;  2IT1 A;  3CP0 A;  1HNZ L;  4LF5 L;  1EWI A;  3K7A H;  1VQE A;  1N36 Q;  4JBK A;  5BR8 L;  1VQD A;  4DR2 L;  5LMN L;  1Q12 A;  2Q2I A;  4DR7 Q;  3MEF A;  1UE6 A;  3KDF B;  3SGI A;  5C4X H;  1X55 A;  4HJ9 A;  4DV4 L;  1GD7 A;  2D0P A;  2KEN A;  3KYH C;  1P16 A;  1C9O A;  3STB D;  4YY3 L;  3F2D A;  5IYD G;  3PGZ A;  4HID A;  2K5H A;  3KFU A;  1YVC A;  4LW1 A;  3I55 A;  4R4T A;  4IFD J;  5ELO A;  4OO1 I;  2JK8 A;  1HZA A;  1IBM L;  1L2F A;  4TVA B;  2HT1 A;  5AJ3 Q;  2D62 A;  2KCM A;  1M1K C;  3U4Z A;  3F8T A;  3OYY A;  3H3V I;  1N33 L;  1L1O C;  3RLO A;  2QEX A;  3K81 C;  1K83 H;  1W3S A;  4A3I H;  4DR4 Q;  1PVO A;  3GTL H;  1PYB A;  5IWA L;  1VQL A;  3S17 H;  4PG3 A;  1PA6 A;  1VQB A;  2B63 G;  2UXC Q;  1LM0 A;  1XNR Q;  4IFD G;  2HHH L;  1GKH A;  3GO5 A;  5IT9 c;  1VQM A;  4R4C A;  4UP9 A;  5DLQ E;  4GLV B;  3RN5 A;  3LGJ A;  5C4X G;  5M5X H;  1WJJ A;  1JJC B;  1NTG A;  3NBH B;  4DV4 Q;  2F3I A;  4H02 A;  5IP9 G;  2ZTE A;  3M4O H;  1G29 1;  3L2P A;  3CCV A;  3TS0 A;  1M90 C;  4LNQ A;  3UDX A;  4DV7 Q;  1UE7 A;  2WAQ E;  1Y1V G;  3ICE A;  4YCV A;  3IRB A;  4QQB X;  1XJV A;  4YCW A;  1J6Q A;  1SN8 A;  3KF6 A;  2AKW B;  4IJL A;  5IE8 A;  1WCM H;  1CUK A;  3UE1 A;  4OWW B;  5J3B A;  1CKN A;  4EQ5 A;  2F4V L;  4A3B G;  1GVP A;  2AWN A;  4JYA Q;  1NY4 A;  2JA9 A;  2VQE Q;  1VQH A;  1VQO A;  2KBN A;  1X9N A;  3FHW A;  3GTK H;  3S1Q H;  3CME A;  1Q46 A;  4OO1 G;  4GNX A;  4HJ7 A;  3I4N G;  5H1S E;  4DV5 Q;  4JI8 Q;  1YIT A;  4OX9 Q;  3F2B A;  1K73 C;  5LMU L;  2A19 A;  4A3C G;  3PUW A;  2B3G A;  3HKZ G;  4DUZ Q;  3HOU G;  2VUM G;  2VL6 A;  4MNO A;  4A3L H;  2R93 G;  4PZ7 A;  3PSI A;  1G51 A;  1KL9 A;  3D31 A;  4BA1 I;  4NPS A;  2VUM H;  4PMW A;  1YJN A;  2ZJQ A;  1MKH A;  2NZO A;  4DPG A;  1PH9 A;  1E24 A;  1AH9 A;  5IP9 H;  3KJP A;  1HR0 L;  1VS0 A;  2JJQ A;  4IPC A;  3PUY A;  1VQN A;  3K80 C;  5GAE C;  3UDF A;  1QUQ A;  1S72 A;  5IYD H;  4UP7 A;  1N36 L;  1R9T H;  3PO3 H;  2I0Q A;  1SMX A;  3TS2 A;  2JQO A;  4A3B H;  1X6O A;  3ZJY C;  1YHB A;  3CW2 C;  3JAM i;  3RLN A;  3NEL A;  4GKK L;  5M5W H;  1T9H A;  4IFD I;  3K8A A;  4AYB G;  5C0X J;  3HFZ B;  3J80 c;  4JI6 L;  4BBS G;  3CQZ H;  2AHO B;  3CCM A;  1JMC A;  1B8A A;  3I4M G;  5M5Y H;  2I5H A;  2VZA A;  5M3F G;  2B63 H;  4DR1 Q;  4HJA A;  4IOA A;  3OTO L;  5GAG C;  4QGU A;  3CCS A;  4O0A A;  1OXS C;  2CFM A;  4C3I H;  2NZH A;  1YIJ A;  3J7A 5;  1UEB A;  2E2I H; 
#chains in the Genus database with same CATH topology
 3RZO H;  1B9M A;  1EYD A;  3SDZ A;  5EQ0 A;  1STH A;  4RGO S;  4P2C B;  3RZD H;  4ZK9 B;  2PQA B;  2HUG A;  4A3F G;  5IYB H;  1OXT A;  1D5M C;  1RHP A;  4ZLT F;  2MUY A;  4JYA L;  1D1I A;  3RMH A;  1PH5 A;  4ZKB B;  2H1E A;  2VW9 A;  3GTJ B;  2Z9H A;  4Y52 H;  4DV5 L;  5FLX L;  1HTL D;  3A0J A;  2WP8 J;  4ZQ3 A;  5EBD A;  5T1G A;  3HOY G;  1Y8P B;  4C3H B;  1PFM A;  4DV1 Q;  1FVI A;  2F0W A;  3LWE A;  4JOI C;  1EIY B;  1EZ8 A;  1K0R A;  4LF4 L;  2C9O A;  4DK6 C;  2QDL A;  4A3G B;  1CSQ A;  2ID0 A;  2WB1 E;  4MTN A;  1ASZ A;  2JA7 B;  1EY0 A;  3OW7 A;  3K6O A;  1WTV A;  3I91 A;  5C44 B;  1JJG A;  1CHQ D;  2KQ3 A;  2RSO A;  3TN2 A;  4O2D A;  1BVS A;  1I94 Q;  2NN6 I;  5I6Y A;  4BY1 B;  4RH6 A;  1HQR D;  3GD7 A;  1F2M A;  1KNE A;  2FMM A;  1PDQ A;  2Z4H A;  4A3D H;  2CKZ B;  2RDF A;  5IOD A;  3VA7 A;  3WOE A;  4FXD A;  1PV4 A;  4QCL A;  1U5K A;  3M85 A;  1EQQ A;  1I3Q H;  3CRK C;  4IJH A;  2JA5 B;  4HIK A;  4L6T B;  2F0S A;  2K5V A;  1DOL A;  3PIP 3;  1VF5 C;  1SNQ A;  1A63 A;  1W6J A;  2B2T A;  3T53 B;  1QUQ B;  3SVM A;  1XPR A;  5C4X B;  1SJH D;  2RHS B;  3FP9 A;  3KBX A;  3J81 j;  2L55 A;  2UXB L;  4ULL A;  4IUP A;  2ES2 A;  2LFN A;  4LMQ D;  4LF6 Q;  2IY5 B;  1TWC H;  4X66 Q;  2OXP A;  4RWS C;  4DXF A;  5I4D A;  1IKM A;  1QCB D;  1V1P A;  1EY7 A;  1NMG A;  4HCS A;  1AEX A;  5CV9 A;  5LMU Q;  3A8K E;  1F9Q A;  1K8G A;  3D6C A;  4CHT B;  2GVB A;  1CTM A;  4MZ9 A;  4CKC A;  4KLK A;  4CJ2 C;  1KAW A;  2BH8 A;  5EKL A;  1WVL A;  1I94 L;  1II3 A;  2R61 A;  3TME A;  4IO9 A;  3A7A B;  1TII D;  5JOB A;  3TP7 A;  4KY6 A;  1W6K A;  2XRQ D;  5FLM H;  1JB7 A;  3M4O B;  1B44 D;  3NUC A;  3GTQ B;  2EZV A;  1PHJ A;  1CA6 A;  1DGS A;  1EOV A;  1STB A;  3V2T A;  2VQF Q;  4IPG A;  3MXU A;  2OCE A;  2EYH A;  4K0K Q;  4DR5 Q;  3S1R B;  4LF7 L;  1WCM G;  4DV3 Q;  5C3W A;  1PYS B;  3A56 A;  3K0X A;  2YU9 B;  2F0K A;  3QO2 A;  2D0O A;  1SNM A;  3BVG A;  1VDZ A;  4WFN 3;  1Q1E A;  1YHA A;  3B6Y A;  1IBM Q;  2KHS A;  3OWE B;  4JI0 Q;  4GNX C;  4A3C H;  4B3R Q;  3S1M H;  2G5D A;  4QL5 A;  1GUN A;  3PO2 H;  4YY3 Q;  4JVZ A;  1G2T A;  2HQL A;  1I4H A;  3MFG A;  2IX0 A;  3U4V A;  2R7Z B;  4FP5 D;  4RKB A;  1KRS A;  2F0I A;  4R4I A;  3K58 A;  1F9R A;  1Q90 A;  4A3F B;  4LF5 Q;  2UU9 Q;  3HOX G;  5BN5 A;  4HMJ A;  1I50 H;  3OMC A;  1VQJ A;  2Z6K C;  2L0C A;  4DU9 A;  2UUA Q;  4A3M B;  3JC6 6;  3E9H A;  3WOF A;  2UXC L;  4OIK A;  1SBB B;  1IBK L;  3BDO A;  4G7O C;  2AUJ D;  1UWV A;  1Q1B A;  5E3F A;  3GDE A;  5K5P A;  4P75 A;  5ISR A;  2KED A;  3HS0 C;  1H95 A;  2XIW A;  2B39 A;  1MBY A;  1TWH H;  4GOP B;  3DEP A;  1U4P A;  2PQA A;  3D8G A;  4P73 A;  2DJG C;  1BBX C;  3TEH B;  4YWM A;  1U4R A;  1CSP A;  2YYZ A;  3AQQ A;  3CAM A;  3S14 B;  3CCE A;  4K5W A;  1EYC A;  2EJM A;  4X6A H;  1S5F D;  1CQF A;  4NB3 A;  2NVT H;  4L8J A;  3HOX H;  4N9T A;  2JA8 G;  2L11 A;  1JE5 A;  1K3R A;  3PIP A;  4KJO A;  2FFK B;  5DM7 3;  1TWH B;  5EPJ A;  3SEB A;  1VF7 A;  4I7A A;  1A2T A;  4CJ1 B;  2IX3 A;  2MPM A;  2B2U C;  1STG A;  5GAH C;  4QY7 A;  3HP3 A;  2CQA A;  1Q86 C;  4B3S Q;  3KLS A;  2YV5 A;  4IUN A;  3GTO H;  2VB2 X;  4DN4 M;  1Y1W H;  3KF8 A;  2K33 A;  2IX1 A;  1PTO C;  2XTI A;  4IOC A;  5F2D A;  1J5E Q;  3NEN A;  2VQF L;  1K28 A;  1RD9 D;  2FJ2 A;  2M00 A;  1U4L A;  4V19 0;  3J81 c;  4DV3 L;  3EVQ A;  2A68 D;  1NNX A;  1GOZ A;  1IW7 C;  1SYD A;  3OMG A;  1C0A A;  1HUM A;  1PH6 A;  3AEV A;  1QWY A;  1A62 A;  1IXR A;  4C56 C;  2I46 A;  5C3E H;  2EY1 A;  2LMC B;  1E2W A;  1H9J A;  3S2D H;  1WTW A;  2OQK A;  5KIX A;  2ATW A;  1HH2 P;  1AE2 A;  2B29 A;  1R4P B;  1MSH A;  3PUZ A;  2BDO A;  1VQ6 A;  1IL8 A;  4EGV A;  4R4O A;  4GOP A;  4X62 L;  1ASY A;  1B7Y B;  4B3T L;  2Q2U A;  1RL2 A;  4A3E B;  2JE6 I;  3FVQ A;  4P71 A;  5M5Y B;  1BCP F;  3HKZ E;  1OXX K;  2B63 B;  3HEJ A;  3L7Z C;  2LKV A;  5FLM G;  2JP1 A;  4MN3 A;  1D1K A;  1RTO A;  2K5W A;  4PNY A;  3S24 A;  2Y0S E;  3MXN A;  5JJL A;  1VQ4 A;  3EJI A;  1BO0 A;  3NWS A;  4K5V A;  3OW2 A;  1SEB D;  5C4J B;  2JA6 G;  3JAM E;  4DKA C;  1K8M A;  2AQ3 B;  1D2B A;  2MGS A;  3H3V C;  2NVQ B;  2BDN A;  3OTO Q;  5M9O A;  1XMQ Q;  5CV4 A;  2V1C C;  4DUY L;  3H0G H;  5DAU A;  5ELC A;  3QOL A;  1WTR A;  4NDX A;  4JI6 Q;  1EZ6 A;  1SXT A;  3HGB A;  4NKL A;  1KC8 C;  1EEF D;  2E2H B;  1HNZ L;  3HOY B;  2QDB A;  3MVV A;  4IQZ A;  3BDL A;  1TWG B;  4G4K A;  5LMN L;  1LTI D;  3KBG A;  4DV4 L;  3KYH C;  4JI7 L;  2KEN A;  5IYD G;  3PGZ A;  4FXG C;  1YVC A;  4LW1 A;  5TSS A;  3GTM B;  1GXD C;  2X6G A;  1IBM L;  1RKN A;  4QF4 A;  1V1P B;  1L1O C;  1EOT A;  2QEX A;  4A3I H;  1PVO A;  1Y69 U;  3DHQ A;  1PYB A;  1VQL A;  4DA2 A;  1LT5 D;  4AYB B;  5KYL A;  5DLQ E;  3RN5 A;  3LGJ A;  5M5X H;  1A15 A;  1JJC B;  1NTG A;  5IP9 G;  2ZTE A;  4FF3 A;  1G29 1;  1IW7 D;  3CCV A;  1M90 C;  1WTH A;  2PZT A;  2RQX A;  4LNQ A;  1J8I A;  1E2V A;  1TKW B;  1G2S A;  1TU2 B;  1XJV A;  1J6Q A;  3SK8 A;  5IE8 A;  3QB3 A;  3UE1 A;  4KN4 C;  3TSS A;  4RHR A;  1CKN A;  1IYU A;  1QNK A;  4JYA Q;  4IAL A;  2JA9 A;  4K6L A;  4HN7 A;  3CME A;  4N9P A;  3HOZ B;  3SXH A;  3BDC A;  1ENF A;  1SE2 A;  1AFP A;  2A19 A;  4A3C G;  1DM0 B;  1SSO A;  3HOU G;  3KUP A;  2VUM G;  2HCI A;  3PSI A;  1AW7 A;  1KL9 A;  1LT6 D;  4NPS A;  2DNE A;  1YJN A;  1MKH A;  2NZO A;  1B50 A;  1E24 A;  1AH9 A;  3KJP A;  2A6E D;  2JJQ A;  5GAE C;  3DEO A;  5IYD H;  4UP7 A;  2V4D A;  3DWA A;  3VR6 A;  3TZU A;  1TWA B;  2RSN A;  1SMX A;  3TS2 A;  4H0L C;  2L12 A;  4DF7 A;  4X3K A;  1H9S A;  1X6O A;  3ZJY C;  3RZD B;  3RLN A;  1T9H A;  3K8A A;  3S1N B;  1YNN D;  4A3I B;  3I4M G;  2B63 H;  3OTO L;  3CCS A;  1KNA A;  4OEM B;  1OXS C;  2Q8R E;  3S15 B;  3J7A 5;  4PQX A;  1UEB A;  4KN7 C;  4S3S A;  3G7L A;  4GKJ L;  5KNC A;  1X3Q A;  3I90 A;  4ZKC B;  4LFC L;  2PNR C;  3S1R H;  1L1O A;  2QGQ A;  2VY3 A;  3KF8 B;  1A0I A;  1HR0 Q;  5CMD A;  3GTP H;  4J1M A;  2FXQ A;  2JA5 G;  4BBR H;  3H15 A;  1IHZ A;  2KHI A;  2L1B A;  3Q23 A;  4GLX A;  1EWH A;  2E2H H;  1XNQ L;  1HZB A;  4JI1 Q;  4G7H C;  3HOW G;  1PLF A;  1QVC A;  3RUZ A;  4LUZ A;  2X6L A;  5EGT A;  1JE4 A;  4DV6 L;  3KLR A;  1X3F A;  2Z0S A;  2EY5 A;  4HR7 B;  4IUV A;  3EIV A;  5IYC G;  4J6H A;  4LWC A;  3S1N H;  1JQY D;  1WYD A;  1SR3 A;  3TP8 A;  3HOV G;  3D4W A;  3A74 A;  3PV0 A;  4QUF A;  4XDX A;  3BZK A;  1S4Z A;  4OIJ A;  2Z8L A;  2ZJP A;  3MTS A;  2AQ2 B;  3L3O C;  4LF6 L;  5A2Q L;  2R7Z G;  1HNX Q;  4C1N I;  2L5T A;  3C1E A;  1AP0 A;  3I73 A;  4RKL A;  5L37 A;  5HGQ A;  3L0O A;  4A3E H;  3OIP A;  2K4K A;  4ALP A;  2JEA I;  1J5E L;  2PMZ E;  1IBL Q;  4X3S A;  3A5U A;  4F88 A;  1ZXT A;  4NXM L;  2EYO A;  1EIF A;  4LUV A;  2RVL A;  5C4J H;  3CHB D;  4UAI A;  4LFB L;  2HIV A;  1VQK A;  1Z9F A;  1JCK B;  2E74 C;  4RA8 A;  4AH6 A;  4LF9 Q;  1E7Z A;  2A69 D;  1SYE A;  4LF4 Q;  3O13 A;  4X64 L;  2HDM A;  3DLL A;  2EQS A;  2WAQ G;  1CFM A;  4PMB A;  1EIH A;  4CGY B;  1SE3 A;  1PH7 A;  2L4N A;  1HA6 A;  2JN4 A;  2F0T A;  1FGB D;  2Y0S G;  3A5Z B;  4QIW E;  1HNW L;  5CBA E;  1KDC A;  1SAP A;  1NBW A;  3T16 A;  2KVM A;  3T1Y L;  2A6H D;  4DK3 C;  3PF4 A;  3CCJ A;  5C4Z A;  2EVB A;  2MJ8 A;  2R92 B;  1JWS D;  2EY6 A;  2B2W A;  2E5L Q;  2H4O A;  3CPW A;  1JJ2 A;  2ZT9 C;  2KCN A;  2OT2 A;  1STA A;  3K5L A;  2PI2 A;  2WAC A;  2B2T C;  3OOC A;  1S5B D;  3IAY A;  1DCZ A;  1A2U A;  4MHE A;  2B2V A;  2IWH A;  4E6I A;  4JK1 C;  3J81 i;  4Y7N B;  3GTM H;  2R7Z H;  1S3O A;  2XVS A;  1LTR D;  3ND8 A;  3JAM L;  1ILQ A;  3E9I A;  2NWG A;  5C44 G;  2F3W A;  1XXG A;  3OWF A;  3ER0 A;  3CC7 A;  1MI2 A;  4K5X A;  4OXP A;  2UU9 L;  5IGB A;  3VR2 A;  2HDL A;  4C3I B;  2D5D A;  4JI2 Q;  4IUU A;  4KHV A;  3I70 A;  3GQB A;  1I6H B;  1K0S A;  3FPP A;  3H3V H;  1SNC A;  4TRD A;  5COR A;  4MTK A;  3W1G A;  4B3S L;  1ENC A;  2NVQ H;  1QVF A;  1VQ9 A;  5ELN A;  4POF A;  1E1T A;  2CWA A;  3VR4 A;  1D7Q A;  2F0H A;  4TQU S;  4JI0 L;  1RF2 D;  1F2L A;  5KND A;  2CWP A;  4IZ8 A;  3S17 B;  1JT8 A;  1LO5 D;  4JBJ A;  4YCU A;  1N9W A;  2C5C A;  3E5S A;  3SK5 A;  2J4X A;  4LFC Q;  2OF1 A;  1O80 A;  4CDF C;  4DXG A;  5CV8 A;  2BCO A;  5CBE E;  1PYW D;  4RMF A;  5JPM C;  2NB0 A;  2CW0 D;  5EKI A;  3PO2 B;  4FF4 A;  2WKD A;  4C3H H;  3C3L A;  3S2D B;  1XMO Q;  3T1Y Q;  4HCE A;  1EL0 A;  5BR8 Q;  3G4S A;  4ID6 A;  5C3E B;  4PMC A;  4A3M H;  1ML0 D;  3CC2 A;  3GTJ H;  5KNB A;  1B3A A;  2EXD A;  1X32 A;  2F0Q A;  3RNU A;  1FYC A;  1VQF A;  1VQ8 A;  3MC0 B;  3P1H A;  1I4R A;  4A93 G;  1TWF H;  2N49 A;  3PO2 G;  5A35 A;  1YJ9 A;  3HOV B;  3J7A F;  2KJX A;  1UNS A;  2DY8 A;  1Y1W B;  4QIW B;  4KTA A;  4TSS A;  2XGT A;  5IY0 A;  2PZU A;  3A8J E;  3H91 A;  1PFB A;  4DR3 L;  1IKL A;  4RG1 A;  4R4Q A;  3EN2 A;  1SE4 A;  1QOH A;  4X62 Q;  1EUJ A;  3AFP A;  3I7F A;  4DV7 L;  3I4M H;  4XYO A;  3MXG A;  4R8N A;  3I4N H;  4ODG A;  1M8A A;  3Q8D A;  1PH1 A;  3J80 E;  2F4V Q;  1A3V A;  4X64 Q;  1MSG A;  1XMQ L;  3ERS X;  1SMY C;  5DM6 3;  5LL6 X;  2ICE C;  1BCP D;  1WD1 A;  2JA6 B;  2VS1 A;  1SYC A;  4RGN A;  3URY A;  2C35 B;  3IFD A;  1VCI A;  1PTO F;  1I5F A;  1OO9 B;  5IYB G;  4DV6 Q;  1TWC B;  3X3M A;  1N32 Q;  2XWJ B;  2CVR A;  2EXZ A;  4XYQ A;  4EVO A;  2K50 A;  1E1O A;  4JI3 Q;  3K0Y A;  5DEH A;  4JI1 L;  2M9V A;  1SNP A;  1V1Q A;  4V0B A;  2EJF C;  2EIF A;  3GTK B;  2OEO A;  4CKB A;  2F0N A;  2Z4I A;  2FMC A;  1EIG A;  2DY7 A;  1H9R A;  3KLW A;  1B4O A;  3J80 i;  5M3M H;  1PRT B;  1YEZ A;  4YHH L;  1SDF A;  4XXE A;  3U9O A;  2JA6 H;  1I3Q B;  1FJG Q;  1IL2 A;  5AFW A;  5C0X I;  1X54 A;  3CD6 A;  3W3A A;  4GNX B;  2A6H C;  1CT1 D;  2HHH Q;  1Z47 A;  3A7L A;  1OXV A;  3HKS A;  4KY5 A;  1SND A;  5G3L F;  1QZH A;  4BY1 H;  2F03 A;  5IGF A;  2NVT B;  2JA8 H;  3GTL B;  4L63 B;  3C46 A;  4BXX H;  2CCZ A;  2N78 A;  4DR3 Q;  1KLG D;  4KI0 A;  2MFI A;  1U4M A;  3ZYY X;  4CBV A;  2E2J B;  1WTP A;  3D0F A;  1FR3 A;  4Q5V A;  3HOU H;  2LXK A;  4X66 L;  3CQZ B;  2JA7 H;  4B9W A;  1FL0 A;  3MWY W;  3J7A V;  5ELF A;  2JA7 G;  4JBW A;  3HOV H;  1DXM A;  2PYK A;  3DUZ A;  4OX9 L;  2M2L A;  3R8B A;  2R7F A;  1K9M C;  4P74 A;  3S9W A;  3GV6 A;  3GTQ H;  4A4I A;  1STN A;  1LTS D;  4CDC C;  4DR5 L;  1LT3 D;  4DK0 A;  2WV6 D;  3DM3 A;  3T1H L;  1PH8 A;  4JOI A;  2KCT A;  5FO8 B;  1UE5 A;  2NUC A;  4NW2 A;  2EY2 A;  1KDB A;  5IGE A;  2VUM B;  1TXY A;  4XQN A;  1EQV A;  3J7Y W;  4BBS H;  5IGD A;  4LF5 L;  5BR8 L;  1VQD A;  1UE6 A;  3SGI A;  2N55 A;  4HJ9 A;  1SMY D;  4WJ3 M;  4HID A;  4C3J B;  4YY3 L;  3KFU A;  2VXW A;  2XN9 C;  3S1M B;  4IFD J;  3RZO B;  2JK8 A;  1HZA A;  3MA2 B;  2HT1 A;  5AJ3 Q;  3F8T A;  3RLO A;  1D6E C;  5EPL A;  1LV9 A;  5E4X A;  3GTL H;  5IWA L;  2JA8 B;  3S17 H;  2WIN B;  4PG3 A;  4U68 A;  1M4V A;  1PA6 A;  1VQB A;  1WTQ A;  2UXC Q;  3C2P A;  2HHH L;  4ZUI A;  1VQM A;  1O7Z A;  1XTC D;  4A93 B;  2KEC A;  3I4L A;  2I07 B;  5C4X G;  1WJJ A;  1F2Y A;  2DNC A;  1FNU A;  1AZP A;  4DV7 Q;  3DM1 A;  1BDO A;  1Y1V G;  3ICE A;  4YCV A;  1T5E A;  1F9S A;  2AKW B;  4IJL A;  2F0E A;  1WCM H;  1CUK A;  2RBM A;  2F4V L;  4A3B G;  2AWN A;  2BOS A;  3FHW A;  3GTK H;  1Q46 A;  3VYR A;  1DOK A;  4K8I A;  4HJ7 A;  3I4N G;  3ITP A;  4OX9 Q;  3F2B A;  1K73 C;  4UDU C;  2B3G A;  1XYI A;  2VL6 A;  3MZ5 A;  1HRJ A;  4MNO A;  3NPP A;  4A3L H;  4PZ7 A;  2R93 G;  1CQV A;  4BA1 I;  4PMW A;  3VR5 A;  4DAY A;  4B9X A;  2ZJQ A;  4DPG A;  1PH9 A;  3K59 A;  2QW7 A;  4IPC A;  3PUY A;  5EPK A;  2JQO A;  3NE5 B;  3I4N B;  3D3R A;  4M1U B;  5DNF A;  1Q8I A;  1AN8 A;  2R93 B;  1WCM B;  3ONA B;  4WOR A;  1DJR D;  4HJA A;  3GTG B;  4IOA A;  4O0A A;  4C3I H;  3PMF A;  2NZH A;  1HQM C;  2E2I H;  5BN3 A;  1NMF A;  1MJC A;  4HTH A;  3J81 E;  4B3M L;  4UY8 C;  2N88 A;  4UHV A;  4A3J G;  2K05 A;  5C0X G;  2RF4 A;  3E6Z X;  1MJE A;  2NN6 G;  3FMC A;  5C0X H;  4IPD A;  2ZXP A;  4DAP A;  4JW0 A;  3AB9 A;  2ZJR A;  2L9H A;  5CV7 A;  4JI5 Q;  2PNH A;  1FNW A;  4XQJ A;  2TSS A;  5CV6 A;  4JI3 L;  1ONL A;  4RFB A;  3ULJ A;  3ULL A;  2F0L A;  1D5X C;  2K5Q A;  2N8N A;  1X3G A;  2CHB D;  1N32 L;  5AJ3 L;  1RCV D;  1KRT A;  1HTP A;  2AQ1 B;  1C4Q A;  2PMZ B;  5LHY 1;  5D3D A;  5JJZ A;  3ERO A;  4HAE A;  4C3J H;  3P7J A;  5C4H A;  1B2T A;  1K3B C;  2NBF A;  1E3P A;  5JEA G;  1O7L A;  4R9W A;  3M4Y A;  3U58 A;  3DWP A;  4BS9 A;  4KV6 A;  1B9N A;  2AMC B;  1Z7T A;  2K28 A;  1GO3 E;  1WOC A;  3NK9 A;  5HGT A;  2F0G A;  1JOK A;  1VMP A;  3R2T A;  5CR3 A;  1HPC A;  1CKN B;  1KDA A;  1D5Z C;  4LFA Q;  2SDF A;  5E7N A;  5I9O A;  1N33 Q;  2LSS A;  4C3I G;  5A2Q E;  3F2C A;  1W2B A;  1SRU A;  5EAY A;  1O7I A;  1HNZ Q;  3BYT B;  1SLJ A;  2PZW A;  1STE A;  4GN5 A;  2MHV A;  5COY A;  1EY8 A;  3CCL A;  2MO0 A;  2KHJ A;  4BY1 G;  2I5L X;  5HY6 A;  3VYU A;  3F1Z A;  4GZY C;  2NTS A;  4KKU A;  4F87 A;  1PRT C;  2AWO A;  4KMU C;  3M7G A;  1H9M A;  4A3D G;  4XT1 B;  1VQI A;  2KOL A;  1CA5 A;  1Q82 C;  3K7A B;  3RD4 A;  3SK4 A;  4POG A;  5IYC H;  1HZ9 A;  2IW3 A;  4KJN A;  2R6G A;  3R93 A;  1HUN A;  4GOP C;  4YWK A;  3QIA A;  1MGS A;  4BY7 B;  4LF9 L;  1WD0 A;  1UUP A;  1EQR A;  1QNU A;  1SFO H;  1EYG A;  2QA4 A;  5JEA H;  5KYI A;  4LF7 Q;  1F77 A;  1L1O B;  3K7U C;  3HOZ H;  1NR2 A;  5J39 A;  3CCQ A;  2XSC A;  4A3E G;  3I56 A;  5ELB A;  2IHF A;  3MFY A;  5C3X A;  3KLS X;  4B3T Q;  3HG9 A;  1N34 Q;  3S15 H;  4IFD H;  3TDQ A;  2ENB A;  2IJ0 A;  1SE8 A;  1ICF B;  4GLA C;  1U9R A;  4CKE A;  2UUC L;  2XNA C;  1LLR D;  1C48 A;  4OWT B;  1BQQ T;  2F0O A;  3AFQ A;  1TS2 A;  2Z1C A;  3M9B A;  4J15 A;  4JV5 L;  4DFA A;  2K5D A;  4ZAI A;  4K6D A;  3QOJ A;  4RHS A;  3C1F A;  1T5X D;  2OQ0 A;  1A3U A;  1L0Y B;  2EOT A;  3CC4 A;  4DR4 L;  2PQE A;  1MIU A;  3HOW H;  1I6H H;  4JBM A;  4LF8 Q;  5K36 H;  2R3Z A;  3LNN A;  2Y0S B;  1JC7 A;  4K0K L;  1ESR A;  1I4P A;  1WTX A;  3I8Z A;  1VQP A;  4UPA A;  1PFN A;  2K7V A;  2N3S A;  2OTJ A;  2ZTD A;  3CPF A;  1TWF B;  2HIX A;  4X65 Q;  4L5R C;  4AQY Q;  3NEM A;  1YNX A;  1LUZ A;  4KKS A;  1QIL A;  4WRD A;  4N8F A;  1PFS A;  1NAP A;  3H0G B;  1EY6 A;  1YNN C;  5IIF A;  2F52 A;  5JAV A;  5KRU A;  4DUY Q;  4XT3 B;  3UDG A;  2UXD L;  4LUO A;  3SHL A;  3GP7 A;  1KAA A;  4LJZ C;  4FNF A;  3EQL C;  4IN3 A;  2JEB I;  4MIU A;  2K52 A;  3P20 A;  1GM5 A;  2O2L D;  2LY7 A;  1NR4 A;  2CW0 C;  2XWB B;  2Z6K A;  1UEA B;  2EPB A;  3EFX D;  3W1B A;  4NXM Q;  1X3P A;  4L5T A;  3BVM A;  2BH2 A;  3U50 C;  2Z6B A;  1Y1V H;  4A3M G;  1GJX A;  5EJW A;  5FLX c;  2NVX H;  1XX8 A;  3PUX A;  2A8V A;  1WI5 A;  4OEL B;  5IOC A;  2G9H D;  3UDI A;  3AU7 A;  4DR6 L;  1F9P A;  3KDF A;  4DAV A;  4GS3 A;  2B8G A;  1HNX L;  1HCZ A;  4OL7 A;  1HNW Q;  4JG2 A;  1I4X A;  2R7D A;  5I6W A;  3CCU A;  2A69 C;  3IKJ A;  3T1H Q;  4KY7 A;  5JVG 3;  3HOY H;  5J22 A;  3S2H H;  2UUB L;  3BYY B;  3RR5 A;  3KK7 A;  2EDG A;  2B2Y A;  1E22 A;  2NTT A;  1XMO L;  1C7Y A;  3U9S A;  1EFW A;  4BBR G;  5C3E G;  1V8Q A;  2RCN A;  1O7Y A;  1PH2 A;  1XTD A;  3CMA A;  4KKT A;  4GN4 B;  2CH4 A;  3TQY A;  1YZ6 A;  2SEB D;  4A3I G;  1ROD A;  3PIO A;  2EYJ A;  3NBH A;  4DNT B;  4JV5 Q;  1XNR L;  2YTV A;  1Q81 C;  3RN2 A;  4BA2 I;  4O1N A;  3M4P A;  1G91 A;  4JI4 L;  1LTL A;  5IP7 H;  3HZX A;  5FJ8 G;  2WKC A;  4ILW A;  2IPK D;  3E3X A;  2ALY B;  3BU2 A;  3G48 A;  5KGU A;  4YIJ A;  2K1B A;  2RDH A;  5CC4 A;  1ESF A;  5IGG A;  4LK1 C;  3T51 B;  2B2V C;  4DV2 Q;  5D14 A;  1QJO A;  4NXN L;  2CH4 W;  1U0L A;  1EY4 A;  1EQT A;  4R1J A;  3S16 B;  1HHV A;  2VNU D;  1EU4 A;  3E0J A;  4X3T A;  1Q8K A;  4OGQ C;  4BXX G;  4WJ4 A;  4X65 L;  4DR6 Q;  3TP5 A;  2ZXO A;  3P75 A;  2H5X A;  3FKI B;  2Q2T A;  1EU3 A;  3EA6 A;  3VR3 A;  3FKI H;  3M3Y H;  5M3M G;  4OON A;  4QB4 A;  3NTH A;  1FNV A;  3HRZ C;  2ZM6 L;  4CJ0 B;  1OXU A;  1HJP A;  2PW5 A;  1QG7 A;  3MXN B;  2A5H A;  4LF8 L;  1SJE D;  3UE0 A;  4DK1 A;  4JI8 L;  4JI2 L;  4A3B B;  1Y14 B;  1N34 L;  4L5Q A;  5LL6 S;  3QR8 A;  3KJO A;  4APV A;  1D8L A;  1YNJ D;  4KK7 A;  1EEI D;  2GN5 A;  1TY0 A;  2I5M X;  3T56 B;  3I2Z A;  3M7N A;  5IGC A;  3QG1 A;  2LXJ A;  5CGK A;  2IT1 A;  3CP0 A;  2SOB A;  1EWI A;  3K7A H;  1VQE A;  1N36 Q;  4JBK A;  1ZEQ X;  4DR2 L;  1RDP D;  2Q2I A;  3MEF A;  1I6V C;  2QEJ C;  1GD7 A;  3STB D;  2K5H A;  3I55 A;  3HOX B;  4OO1 I;  2WAQ B;  4CDD C;  1L2F A;  2Q8T A;  1F2Z A;  2KCM A;  3G6J B;  4ZCK A;  3U4Z A;  1L0X B;  2KCC A;  3K81 C;  1PRT F;  3UI2 A;  2RKS A;  3S2H B;  2NVY B;  3PIO 3;  1TY2 A;  5M5X B;  1CM9 A;  5IT9 c;  2QKI C;  3DXJ C;  4UP9 A;  5ELE A;  1XWE A;  2JXM B;  1ZYR C;  5BN4 A;  5C6A A;  4DV4 Q;  4PV1 C;  3M4O H;  3L2P A;  3D4D A;  1B1Z A;  1UE7 A;  2WAQ E;  4QQB X;  4RCO A;  4A3K B;  3IRB A;  2PW7 A;  5C5L A;  1SN8 A;  1BOS A;  1LTA D;  5G3L D;  3FPU B;  2E2D C;  5J3B A;  1GVP A;  3QJY A;  2DN8 A;  2VQE Q;  1VQO A;  1VQH A;  1HFN A;  4OO1 G;  2D2C C;  4JI8 Q;  2EE1 A;  3PUW A;  4DUZ Q;  2G9D A;  1G51 A;  3A8I E;  1KTK A;  5I2Y A;  2BE5 D;  4H7B A;  4C3H G;  1JB3 A;  1VS0 A;  3IFT A;  1VQN A;  2JYO A;  1QUQ A;  5IT9 L;  1S72 A;  4I7Z C;  1N36 L;  4BBR B;  4R8I A;  3J81 L;  1R9T H;  3PO3 H;  4A3B H;  5EKK A;  2F0M A;  3VA5 A;  1A3T A;  1EFI D;  3MHB A;  3CW2 C;  4RGT A;  3JAM i;  3GV3 A;  4GKK L;  3BG3 A;  3J80 c;  2PPB C;  2F1M A;  4OO1 H;  1K8O A;  1JMC A;  2E2I B;  1B8A A;  2FHT A;  5M5Y H;  2VZA A;  5GAG C;  1BCP B;  2CFM A;  3F2U A;  1BBW A;  1JOO A;  2A1A A;  3W5O A;  1DON A;  1CKO A;  3M4Q A;  1BKB A;  2RCF A;  4H44 C;  2PI2 E;  3STB C;  3J7Z C;  1QZG A;  1ZKO A;  4RGM A;  1PXU A;  1QB5 D;  4HJ8 A;  1KD1 C;  1XNR Q;  1AE3 A;  1BCP C;  1IBK Q;  1TWA H;  1XPU A;  3PO3 G;  4QUC A;  3CXC A;  3DMU A;  5I2X A;  3D6W A;  2UUA L;  1Q7Y C;  5GAD C;  1I4Q A;  4UP8 A;  5C44 H;  3A54 A;  2F4I A;  3T4A C;  1JWM D;  1RJT A;  3DWQ A;  3FKI G;  1EWC A;  1J9O A;  3JAM c;  1V43 A;  2Q8I B;  1BF4 A;  3BZC A;  4DV2 L;  2VQE L;  2EYP A;  2F3V A;  1CZG A;  3PCO B;  2P5Z X;  4ZUJ A;  4FF1 A;  1Z6H A;  2GVA A;  1BXT A;  3K5O A;  5LMN W;  3V05 A;  2LS0 1;  1R9T B;  2MNA A;  3PO3 B;  1CKM A;  4I65 A;  2O4X A;  3GTO B;  2YTY A;  2KEE A;  3X3N A;  5FO7 B;  3N52 A;  2K32 A;  4LFB Q;  1NE3 A;  4KD4 A;  4JI5 L;  2R92 H;  1DOM A;  2GA4 B;  3V96 A;  1KIX A;  2HQE A;  4FVM A;  2F0J A;  4L5S A;  4YWL A;  4QMG A;  1CK1 A;  3R2I A;  4XTC S;  3NQT A;  4PZ6 A;  3TBI B;  4K14 A;  4KHZ A;  1H9K A;  1L0W A;  4HIM A;  2F0U A;  3CRL C;  3NTI A;  1ZYR D;  4N8X 1;  4A3K H;  4Q0F A;  1Y1V B;  3S14 H;  4NP5 A;  2NN6 H;  2K5N A;  2YU9 H;  4Z9C B;  4RAU C;  3G71 A;  3S16 H;  4A3G H;  1CI3 M;  4DAM A;  1GUG A;  4P72 A;  5M5W B;  1K8A C;  1LTB D;  3NSW A;  3RLF A;  4A75 A;  2B2W C;  4HED A;  2PCF B;  1DD2 A;  4PZ8 A;  2NVY H;  1QVG A;  1UAP A;  4EX5 A;  4LFA L;  2DJF C;  2E5L L;  1TT2 A;  5IP7 G;  1V1O A;  4ME3 A;  5FJ8 H;  4XIG S;  4XQQ A;  4A3F H;  2A68 C;  3WWV A;  1G8Z D;  2PO4 A;  3EBE A;  3Q24 A;  4A3K G;  4DUZ L;  3HOZ G;  2WB1 B;  5I9P A;  4HIO A;  1TS5 A;  4GN3 B;  3CCR A;  4OWX B;  3T13 A;  1VQ7 A;  2J0T D;  1SYG A;  2UXD Q;  2R92 G;  3BS1 A;  1YI2 A;  3HOU B;  3TRE A;  4FXK C;  2O5J C;  5CYU A;  2MO1 A;  1ENA A;  1KHI A;  1EY9 A;  1SYF A;  2K04 A;  5HUR A;  3NTK A;  5LMN Q;  2E2J H;  1JOR A;  3ULP A;  1TS3 A;  1YJW A;  1PZK D;  4EQN A;  3J80 L;  1N8R C;  5GQO A;  2EYM A;  2E75 C;  2SNM A;  2F0P A;  2MQH A;  3GTP B;  1FJG L;  4A3J H;  2DUD A;  1XNQ Q;  1QE6 A;  3A55 A;  2VB3 X;  4RCN A;  5FK9 C;  5NUC A;  1EYA A;  1STY A;  2K01 A;  1PMR A;  3WDN A;  4DGZ A;  1IZ6 A;  3N6R A;  1GUS A;  1XPO A;  1VQA A;  1SYB A;  1LAB A;  5M3F H;  3GTG H;  4K2L A;  5CV5 A;  3I72 A;  1GUO A;  1PH3 A;  3KOJ A;  2OTL A;  4C1N K;  4ZRZ A;  2ZXR A;  4KHP L;  4KD3 A;  4C3J G;  5D3I B;  1ICW A;  4B3M Q;  3OSO A;  2K14 A;  3ERQ A;  4JI4 Q;  4IPH A;  1Y1W G;  4BY7 G;  1DZ1 A;  1B70 B;  3CF5 A;  4JC0 A;  1GHK A;  4BY7 H;  3KF6 B;  4G7Z C;  1FGU A;  3HOW B;  1I50 B;  5K36 G;  3E0E A;  2ZTC A;  2B8F A;  4H13 C;  3SE0 A;  2WFW A;  4AIM A;  4F8M A;  1Q3L A;  2QCP X;  2L15 A;  3VDY A;  3FEW X;  3K5M A;  4AQY L;  1ET6 A;  1TS4 A;  2ASB A;  1NJI C;  1EY5 A;  4TKO B;  5JJK A;  1LTT D;  2D9U A;  1A8V A;  1KAB A;  4AYB E;  2AUK A;  2ZM6 Q;  4B08 A;  3M3Y B;  4ZYS A;  1K83 B;  1O78 A;  3BJU A;  1RTN A;  1SNO A;  1PTO B;  1LAC A;  5JJI A;  2JA5 H;  4C2M H;  4A76 A;  1E2Z A;  1ET9 A;  1WTO A;  5IWA Q;  1PH4 A;  4GKK Q;  3OPO A;  2B2Y C;  4IUT A;  3OIQ A;  5JEA J;  2CQO A;  4A93 H;  4NXN Q;  1UE1 A;  2KA7 A;  2Q2H A;  5J1Z A;  4DNI A;  1SFO B;  5KEE A;  3QWN A;  1NUC A;  3HKZ B;  4O42 A;  4K2K A;  4DV1 L;  1ILP A;  4YHH Q;  1BR9 A;  2SNS A;  2WII B;  3AYH B;  3Q6S A;  4NMZ A;  4KHP Q;  3H0G G;  3Q0A A;  1YHQ A;  1TQO A;  1SRO A;  4B3R L;  4DNR B;  3D4R A;  2E8G A;  4G57 A;  1TWG H;  5GRO A;  1IYJ B;  4X3U A;  3PF5 A;  1IYV A;  3VYS A;  3K57 A;  4FDB A;  2K6A A;  4DV0 Q;  4M8A A;  4BBS B;  4DR7 L;  2BE5 C;  2F0D A;  2ICI A;  3AMU A;  1PZI D;  4DR2 Q;  3H94 A;  1KXL A;  1LYL A;  5FOB B;  1HR0 W;  1CZW A;  2DGY A;  1X65 A;  4GKJ Q;  1OTC A;  2UUB Q;  1PZJ D;  1WFQ A;  1VQ5 A;  1RIP A;  3BZD B;  2IL8 A;  4DR1 L;  1VQG A;  2IHE A;  4ME5 A;  1KLU D;  4IUR A;  1JR0 D;  2WB1 G;  3FDT A;  4BWG B;  1B3Q A;  1AZQ A;  2MP1 A;  3S1Q B;  3H6M A;  3I4O A;  1HZC A;  1HA5 A;  4JCV E;  4HMI A;  1BBU A;  4WJW A;  3Q22 A;  3TRZ A;  2OWO A;  1NCV A;  4DAY B;  2NVX B;  2K75 A;  4C2M B;  1GUW A;  2XRS D;  3ND9 A;  1BUV T;  2FIN B;  1S5E D;  1V9P A;  3L9A X;  2BA0 A;  2TMP A;  1VMC A;  4JI7 Q;  4HJ5 A;  4OHJ A;  4A3L G;  2NYZ D;  2A74 C;  2E76 C;  1YBY A;  2R93 H;  1BNZ A;  4CDE C;  3K5N A;  2UUC Q;  1X3E A;  5JVH 3;  1DYQ A;  2BA1 A;  1S5D D;  2YTX A;  3NBI A;  1G6P A;  4LAA A;  1KQS A;  4DV0 L;  1PRT D;  2K03 A;  1X56 A;  4Y7N H;  4A3G G;  4FYD A;  4QJF A;  5FO9 B;  3PUV A;  2QF7 A;  3G6E A;  1IBL L;  1P8L A;  2HD3 A;  2RHQ B;  1HXY D;  2UXB Q;  1VQC A;  1S40 A;  3NHH A;  3IL8 A;  1Y8N B;  1Q12 A;  1H9S B;  4DR7 Q;  2F0V A;  3KDF B;  5C4X H;  3NP8 A;  1C8C A;  1S5C D;  1X55 A;  2D0P A;  3VYT A;  1P16 A;  1C9O A;  3F2D A;  4JPB W;  3MXP A;  4F7X A;  4R4T A;  5ELO A;  3CU7 A;  3NQI A;  3W2D A;  1PTO H;  1TVX A;  4TVA B;  2JSO A;  2D62 A;  1M1K C;  2EYF A;  3OYY A;  3H3V I;  1N33 L;  4IUQ A;  1K83 H;  1W3S A;  3LWU A;  4DR4 Q;  1I4G A;  5ELD A;  3TZD A;  3PQI A;  2NZ1 D;  4K8J A;  3FRP B;  2B63 G;  1LM0 A;  4IFD G;  5JPN C;  1GKH A;  3GO5 A;  3LX0 A;  4A3D B;  4R4C A;  1YNJ C;  4GLV B;  2QIL A;  3I4M B;  3BVZ A;  2X69 A;  5FLX E;  3CKI B;  5T1I A;  3NBH B;  2F3I A;  4H02 A;  2A73 B;  5E4W C;  5M3M B;  2A6E C;  3R3O A;  3NXW A;  5D65 A;  3TS0 A;  1NSN S;  3UDX A;  4EQP A;  3MEH A;  4HSV A;  4YCW A;  2RDG A;  1GHJ A;  3KF6 A;  3NWT A;  1Y8O B;  1E0B A;  2KUM A;  4OWW B;  4EQ5 A;  5IT9 E;  1NY4 A;  2KBN A;  3I3C A;  1X9N A;  1A6X A;  3S1Q H;  1R4Q B;  4GNX A;  5H1S E;  4DV5 Q;  1YIT A;  1B53 A;  5LMU L;  1FD7 D;  3HKZ G;  5FKA C;  1G6Z A;  4U67 3;  3D31 A;  5EBC A;  2VUM H;  1HFG A;  5M3F B;  3SK6 A;  3SR1 A;  2EYL A;  1JIC A;  1TR5 A;  1CHP D;  5IP9 H;  1HR0 L;  3K80 C;  1JWU D;  3UDF A;  1MHW C;  2I0Q A;  4FF2 A;  4J8Q A;  2HCC A;  4EQO A;  3TP6 A;  4A3J B;  1MD2 D;  1JOQ A;  1PTO D;  2F0F A;  2RA4 A;  1YHB A;  3MAQ A;  3NEL A;  5M5W H;  2J7Z A;  3OHX C;  4IFD I;  4AYB G;  5C0X J;  3HFZ B;  4JI6 L;  1GUT A;  5E1F A;  4BBS G;  1LT4 D;  3CQZ H;  2AHO B;  1LTG D;  2B2U A;  3CCM A;  2O5I C;  4FO2 A;  3H09 A;  5C5M A;  4ABN A;  2I5H A;  5M3F G;  2EJG C;  4DR1 Q;  4HSP A;  4QGU A;  1YIJ A; 
#chains in the Genus database with same CATH homology
 3RZO H;  1NMF A;  2A1A A;  4GKJ L;  3W5O A;  1MJC A;  4LFC L;  4B3M L;  3S1R H;  1CKO A;  1L1O A;  1BKB A;  2QGQ A;  3M4Q A;  2PI2 E;  3STB C;  5C0X G;  3J7Z C;  2RF4 A;  2VY3 A;  3KF8 B;  4A3J G;  1A0I A;  4HJ8 A;  3RZD H;  1KD1 C;  2NN6 G;  1MJE A;  1HR0 Q;  2PQA B;  1AE3 A;  4A3F G;  2FXQ A;  2JA5 G;  1IBK Q;  1TWA H;  4BBR H;  4IPD A;  5IYB H;  3H15 A;  1OXT A;  2KHI A;  4GLX A;  2ZJR A;  1XPU A;  3PO3 G;  2E2H H;  3CXC A;  1XNQ L;  4JI5 Q;  2PNH A;  4JYA L;  1HZB A;  4JI1 Q;  3HOW G;  1PH5 A;  2UUA L;  1Q7Y C;  4JI3 L;  2VW9 A;  1QVC A;  3ULJ A;  5GAD C;  3ULL A;  4LUZ A;  4UP8 A;  5C44 H;  4Y52 H;  4DV6 L;  4DV5 L;  2N8N A;  1X3F A;  1X3G A;  1N32 L;  3A0J A;  2Z0S A;  2WP8 J;  3FKI G;  5AJ3 L;  3JAM c;  3HOY G;  1V43 A;  3EIV A;  5IYC G;  4WJ3 M;  1KRT A;  3BZC A;  4LWC A;  4DV2 L;  2VQE L;  3S1N H;  1WYD A;  3PCO B;  1SR3 A;  4C3J H;  4DV1 Q;  3HOV G;  2GVA A;  1FVI A;  3A74 A;  3PV0 A;  4JOI C;  5LMN W;  3BZK A;  1EIY B;  1K0R A;  4LF4 L;  1E3P A;  4DK6 C;  2ZJP A;  1CSQ A;  2ID0 A;  2WB1 E;  4MTN A;  5JEA G;  1CKM A;  2MNA A;  1ASZ A;  4LF6 L;  2R7Z G;  1HNX Q;  3U58 A;  2YTY A;  5HGQ A;  2AMC B;  3L0O A;  1JJG A;  4A3E H;  2K4K A;  4ALP A;  4LFB Q;  4O2D A;  1BVS A;  2JEA I;  1J5E L;  1NE3 A;  4JI5 L;  2PMZ E;  2R92 H;  1GO3 E;  1WOC A;  3A5U A;  2NN6 I;  1I94 Q;  1IBL Q;  1KIX A;  3GD7 A;  4L5S A;  4NXM L;  4YWL A;  1CKN B;  1EIF A;  4LUV A;  4A3D H;  2CKZ B;  4LFA Q;  5C4J H;  4LFB L;  5E7N A;  3GTP H;  4XTC S;  4PZ6 A;  1PV4 A;  1N33 Q;  1U5K A;  2HIV A;  2LSS A;  3M85 A;  1EQQ A;  1VQK A;  1Z9F A;  4KHZ A;  3F2C A;  1W2B A;  1SRU A;  5EAY A;  1I3Q H;  4LF9 Q;  4AH6 A;  1L0W A;  1E7Z A;  4HIM A;  1O7I A;  4IJH A;  1HNZ Q;  1SLJ A;  4HIK A;  4LF4 Q;  2K5V A;  4GN5 A;  4A3K H;  4X64 L;  3S14 H;  3DLL A;  2EQS A;  2WAQ G;  3CCL A;  2MO0 A;  2K5N A;  2YU9 H;  2KHJ A;  4BY1 G;  1PH7 A;  1A63 A;  2I5L X;  3G71 A;  3S16 H;  4A3G H;  4DAM A;  5HY6 A;  3F1Z A;  4P72 A;  2Y0S G;  1QUQ B;  1XPR A;  3A5Z B;  4QIW E;  1HNW L;  3FP9 A;  2AWO A;  2RHS B;  1K8A C;  3RLF A;  3J81 j;  4A75 A;  4A3D G;  2UXB L;  1NBW A;  1VQI A;  2ES2 A;  3T1Y L;  1Q82 C;  4DK3 C;  3PF4 A;  3CCJ A;  4PZ8 A;  4LF6 Q;  2NVY H;  1QVG A;  2IY5 B;  4POG A;  5IYC H;  1HZ9 A;  1TWC H;  4EX5 A;  4X66 Q;  4LFA L;  2E5L L;  2E5L Q;  2R6G A;  5IP7 G;  3CPW A;  1JJ2 A;  4GOP C;  4ME3 A;  5FJ8 H;  4XIG S;  4YWK A;  2PI2 A;  4A3F H;  4LF9 L;  3WWV A;  1EQR A;  1NMG A;  1EYG A;  1SFO H;  3J81 i;  3GTM H;  2QA4 A;  5LMU Q;  3EBE A;  4A3K G;  2R7Z H;  4DUZ L;  1K8G A;  1S3O A;  3HOZ G;  4HIO A;  2GVB A;  4GN3 B;  4LF7 Q;  1L1O B;  3K7U C;  4MZ9 A;  3E9I A;  3CCR A;  3CCQ A;  3HOZ H;  4OWX B;  4KLK A;  5C44 G;  1KAW A;  1VQ7 A;  4A3E G;  2BH8 A;  3I56 A;  2UXD Q;  2IHF A;  1I94 L;  3ER0 A;  3CC7 A;  2R92 G;  4OXP A;  1YI2 A;  2UU9 L;  4B3T Q;  3TRE A;  1N34 Q;  3S15 H;  2MO1 A;  4IO9 A;  4JI2 Q;  1KHI A;  2E2J H;  5LMN Q;  1SE8 A;  3ULP A;  4GLA C;  1YJW A;  3H3V H;  5FLM H;  1QZG A;  1N8R C;  1JB7 A;  2UUC L;  5GQO A;  3W1G A;  4B3S L;  2NVQ H;  1QVF A;  4OWT B;  1PHJ A;  1VQ9 A;  5ELN A;  3AFQ A;  2MQH A;  4POF A;  1E1T A;  3M9B A;  2CWA A;  4J15 A;  1FJG L;  1DGS A;  1EOV A;  2VQF Q;  4JV5 L;  4IPG A;  4A3J H;  2OCE A;  2DUD A;  1XNQ Q;  1D7Q A;  4K0K Q;  4DR5 Q;  4TQU S;  4JI0 L;  4LF7 L;  1IZ6 A;  1WCM G;  4DV3 Q;  2OQ0 A;  3CC4 A;  1PYS B;  4DR4 L;  2CWP A;  1MIU A;  3K0X A;  3HOW H;  1I6H H;  1XPO A;  4JBM A;  4LF8 Q;  2D0O A;  1JT8 A;  1VQA A;  4JBJ A;  4YCU A;  1N9W A;  5M3F H;  4LFC Q;  1Q1E A;  1YHA A;  3B6Y A;  1IBM Q;  3GTG H;  4K0K L;  1PH3 A;  4JI0 Q;  3KOJ A;  2OTL A;  4GNX C;  1VQP A;  4A3C H;  4UPA A;  4B3R Q;  3S1M H;  4RMF A;  4KHP L;  4QL5 A;  2N3S A;  2OTJ A;  3PO2 H;  4UY8 C;  4YY3 Q;  2ZTD A;  2HQL A;  3CPF A;  4B3M Q;  4C3H H;  2HIX A;  4X65 Q;  4L5R C;  1XMO Q;  3T1Y Q;  2K14 A;  2IX0 A;  3U4V A;  4JI4 Q;  4IPH A;  5BR8 Q;  3G4S A;  1Y1W G;  4BY7 G;  4AQY Q;  1B70 B;  1KRS A;  3NEM A;  4R4I A;  1YNX A;  4LF5 Q;  3CF5 A;  2UU9 Q;  4JC0 A;  3HOX G;  4A3M H;  4BY7 H;  1I50 H;  1LUZ A;  3CC2 A;  1VQJ A;  2Z6K C;  3KF6 B;  3GTJ H;  2UUA Q;  1PFS A;  2EXD A;  1FGU A;  3JC6 6;  5K36 G;  3E9H A;  2F52 A;  3E0E A;  4DUY Q;  3UDG A;  2UXD L;  2ZTC A;  4LUO A;  2UXC L;  3RNU A;  2WFW A;  1VQF A;  4AIM A;  1IBK L;  1VQ8 A;  1UWV A;  1Q1B A;  2L15 A;  3VDY A;  2JEB I;  4AQY L;  2ASB A;  4A93 G;  1TWF H;  3GDE A;  1NJI C;  4P75 A;  5JJK A;  2N49 A;  3PO2 G;  2K52 A;  1H95 A;  1A8V A;  1YJ9 A;  1GM5 A;  1TWH H;  4GOP B;  4AYB E;  2PQA A;  4P73 A;  2Z6K A;  2ZM6 Q;  3W1B A;  3TEH B;  4NXM Q;  2XGT A;  4L5T A;  5IY0 A;  4YWM A;  1CSP A;  3BJU A;  3U50 C;  2BH2 A;  2YYZ A;  3AQQ A;  3CAM A;  3CCE A;  4DR3 L;  4X6A H;  1Y1V H;  4A3M G;  4RG1 A;  4R4Q A;  5FLX c;  2NVX H;  5JJI A;  3PUX A;  2JA5 H;  3EN2 A;  4NB3 A;  4C2M H;  4A76 A;  2A8V A;  1WI5 A;  2NVT H;  1PH4 A;  3HOX H;  4GKK Q;  5IWA Q;  2JA8 G;  3UDI A;  1JE5 A;  4DR6 L;  1K3R A;  4X62 Q;  1EUJ A;  3AFP A;  3I7F A;  3KDF A;  4GS3 A;  3PIP A;  4DV7 L;  3I4M H;  1HNX L;  1HNW Q;  5JEA J;  4JG2 A;  2CQO A;  2R7D A;  3I4N H;  4A93 H;  4NXN Q;  1UE1 A;  3Q8D A;  1PH1 A;  2Q2H A;  3CCU A;  4X64 Q;  2F4V Q;  4DNI A;  3T1H Q;  1XMQ L;  5GAH C;  3HOY H;  3S2H H;  3ERS X;  4QY7 A;  2UUB L;  4DV1 L;  2VS1 A;  1Q86 C;  3RR5 A;  4B3S Q;  4YHH Q;  2C35 B;  1E22 A;  1VCI A;  1XMO L;  1I5F A;  1C7Y A;  2YV5 A;  4BBR G;  5IYB G;  5C3E G;  4DV6 Q;  1EFW A;  2RCN A;  1N32 Q;  1PH2 A;  1XTD A;  3CMA A;  3GTO H;  3AYH B;  2K50 A;  1E1O A;  4JI3 Q;  1Y1W H;  3H0G G;  4KHP Q;  4GN4 B;  4JI1 L;  3TQY A;  1YHQ A;  2XTI A;  2IX1 A;  1SRO A;  4B3R L;  1YZ6 A;  4IOC A;  1V1Q A;  2E8G A;  4A3I G;  1J5E Q;  1TWG H;  3NEN A;  5GRO A;  3PIO A;  1IYJ B;  2EIF A;  2VQF L;  4JV5 Q;  3PF5 A;  1XNR L;  2YTV A;  1Q81 C;  3RN2 A;  4FDB A;  4BA2 I;  4DV0 Q;  3M4P A;  4JI4 L;  4DR7 L;  3J81 c;  4DV3 L;  4DR2 Q;  1KXL A;  1LTL A;  1LYL A;  3KLW A;  5IP7 H;  1HR0 W;  2DGY A;  5FJ8 G;  1X65 A;  4GKJ Q;  3J80 i;  1C0A A;  5M3M H;  1YEZ A;  1PH6 A;  3AEV A;  4YHH L;  1OTC A;  2UUB Q;  2ALY B;  3BU2 A;  1A62 A;  3G48 A;  1IXR A;  2JA6 H;  1WFQ A;  5C3E H;  1RIP A;  1VQ5 A;  1FJG Q;  1IL2 A;  5C0X I;  1X54 A;  3CD6 A;  4DR1 L;  1VQG A;  4GNX B;  3S2D H;  2IHE A;  2HHH Q;  2OQK A;  1Z47 A;  1OXV A;  2ATW A;  1HH2 P;  1AE2 A;  2B29 A;  3HKS A;  3PUZ A;  4DV2 Q;  2WB1 G;  4NXN L;  1U0L A;  1VQ6 A;  3I4O A;  1QZH A;  4R1J A;  1HZC A;  4JCV E;  2VNU D;  4R4O A;  4GOP A;  1Q8K A;  4BY1 H;  4X62 L;  4JI7 L;  1BBU A;  4BXX G;  4WJ4 A;  4X65 L;  1ASY A;  1B7Y B;  2OWO A;  4B3T L;  2JA8 H;  3TRZ A;  4DAY B;  4DR6 Q;  2Q2U A;  1RL2 A;  2H5X A;  2K75 A;  4BXX H;  2CCZ A;  2JE6 I;  2N78 A;  4DR3 Q;  2Q2T A;  4KI0 A;  2MFI A;  4P71 A;  3HKZ E;  1OXX K;  3L7Z C;  1V9P A;  3D0F A;  3FKI H;  5FLM G;  2BA0 A;  3HOU H;  3M3Y H;  2LXK A;  4X66 L;  5M3M G;  4OON A;  4HJ5 A;  4JI7 Q;  2JA7 H;  4A3L G;  2R93 H;  3S24 A;  1YBY A;  5JJL A;  2Y0S E;  1VQ4 A;  1FL0 A;  2ZM6 L;  2UUC Q;  1OXU A;  1HJP A;  2JA7 G;  1X3E A;  3MXN B;  4JBW A;  3OW2 A;  3HOV H;  1BBW A;  2BA1 A;  2JA6 G;  2YTX A;  4LF8 L;  1G6P A;  3UE0 A;  4DKA C;  4JI8 L;  4OX9 L;  1KQS A;  4JI2 L;  2R7F A;  4DV0 L;  4P74 A;  1K9M C;  1Y14 B;  1N34 L;  4L5Q A;  3GTQ H;  4A4I A;  1X56 A;  4Y7N H;  3KJO A;  4A3G G;  4DR5 L;  3OTO Q;  4APV A;  1D8L A;  3DM3 A;  4QJF A;  3T1H L;  1XMQ Q;  1PH8 A;  2GN5 A;  3PUV A;  4JOI A;  2V1C C;  4DUY L;  3H0G H;  2KCT A;  3G6E A;  1IBL L;  1P8L A;  1UE5 A;  2I5M X;  2RHQ B;  3I2Z A;  2UXB Q;  4JI6 Q;  3M7N A;  1VQC A;  1TXY A;  1KC8 C;  2LXJ A;  4BBS H;  1S40 A;  2IT1 A;  3CP0 A;  1HNZ L;  4LF5 L;  1EWI A;  3K7A H;  1VQE A;  1N36 Q;  4JBK A;  5BR8 L;  1VQD A;  4DR2 L;  5LMN L;  1Q12 A;  2Q2I A;  4DR7 Q;  3MEF A;  1UE6 A;  3KDF B;  3SGI A;  5C4X H;  1X55 A;  4HJ9 A;  4DV4 L;  1GD7 A;  2D0P A;  2KEN A;  3KYH C;  1P16 A;  1C9O A;  3STB D;  4YY3 L;  3F2D A;  5IYD G;  3PGZ A;  4HID A;  2K5H A;  3KFU A;  1YVC A;  4LW1 A;  3I55 A;  4R4T A;  4IFD J;  5ELO A;  4OO1 I;  2JK8 A;  1HZA A;  1IBM L;  1L2F A;  4TVA B;  2HT1 A;  5AJ3 Q;  2D62 A;  2KCM A;  1M1K C;  3U4Z A;  3F8T A;  3OYY A;  3H3V I;  1N33 L;  1L1O C;  3RLO A;  2QEX A;  3K81 C;  1K83 H;  1W3S A;  4A3I H;  4DR4 Q;  1PVO A;  3GTL H;  1PYB A;  5IWA L;  1VQL A;  3S17 H;  4PG3 A;  1PA6 A;  1VQB A;  2B63 G;  2UXC Q;  1LM0 A;  1XNR Q;  4IFD G;  2HHH L;  1GKH A;  3GO5 A;  5IT9 c;  1VQM A;  4R4C A;  4UP9 A;  5DLQ E;  4GLV B;  3RN5 A;  3LGJ A;  5C4X G;  5M5X H;  1WJJ A;  1JJC B;  1NTG A;  3NBH B;  4DV4 Q;  2F3I A;  4H02 A;  5IP9 G;  2ZTE A;  3M4O H;  1G29 1;  3L2P A;  3CCV A;  3TS0 A;  1M90 C;  4LNQ A;  3UDX A;  4DV7 Q;  1UE7 A;  2WAQ E;  1Y1V G;  3ICE A;  4YCV A;  3IRB A;  4QQB X;  1XJV A;  4YCW A;  1J6Q A;  1SN8 A;  3KF6 A;  2AKW B;  4IJL A;  5IE8 A;  1WCM H;  1CUK A;  3UE1 A;  4OWW B;  5J3B A;  1CKN A;  4EQ5 A;  2F4V L;  4A3B G;  1GVP A;  2AWN A;  4JYA Q;  1NY4 A;  2JA9 A;  2VQE Q;  1VQH A;  1VQO A;  2KBN A;  1X9N A;  3FHW A;  3GTK H;  3S1Q H;  3CME A;  1Q46 A;  4OO1 G;  4GNX A;  4HJ7 A;  3I4N G;  5H1S E;  4DV5 Q;  4JI8 Q;  1YIT A;  4OX9 Q;  3F2B A;  1K73 C;  5LMU L;  2A19 A;  4A3C G;  3PUW A;  2B3G A;  3HKZ G;  4DUZ Q;  3HOU G;  2VUM G;  2VL6 A;  4MNO A;  4A3L H;  2R93 G;  4PZ7 A;  3PSI A;  1G51 A;  1KL9 A;  3D31 A;  4BA1 I;  4NPS A;  2VUM H;  4PMW A;  1YJN A;  2ZJQ A;  1MKH A;  2NZO A;  4DPG A;  1PH9 A;  1E24 A;  1AH9 A;  5IP9 H;  3KJP A;  1HR0 L;  1VS0 A;  2JJQ A;  4IPC A;  3PUY A;  1VQN A;  3K80 C;  5GAE C;  3UDF A;  1QUQ A;  1S72 A;  5IYD H;  4UP7 A;  1N36 L;  1R9T H;  3PO3 H;  2I0Q A;  1SMX A;  3TS2 A;  2JQO A;  4A3B H;  1X6O A;  3ZJY C;  1YHB A;  3CW2 C;  3JAM i;  3RLN A;  3NEL A;  4GKK L;  5M5W H;  1T9H A;  4IFD I;  3K8A A;  4AYB G;  5C0X J;  3HFZ B;  3J80 c;  4JI6 L;  4BBS G;  3CQZ H;  2AHO B;  3CCM A;  1JMC A;  1B8A A;  3I4M G;  5M5Y H;  2I5H A;  2VZA A;  5M3F G;  2B63 H;  4DR1 Q;  4HJA A;  4IOA A;  3OTO L;  5GAG C;  4QGU A;  3CCS A;  4O0A A;  1OXS C;  2CFM A;  4C3I H;  2NZH A;  1YIJ A;  3J7A 5;  1UEB A;  2E2I H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...