1HR0W

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hr0W00
5H1SE 3KF6A 3F2BA 1YNXA 4X64L 1NE3A 4A3LG 4DR5L 4JI1L 1C9OA 1N36Q 2IY5B 4YHHL 1J5EQ 1JE5A 1X3GA 1XPUA 4BBSG 4JI3L 1HNZQ 5C4XH 2JE6I 5GAHC 3S14H 1A0IA 3HOXH 2CCZA 3T1HL 1S3OA 2E5LQ 1XMQQ 4YWLA 1L0WA 4A3IG 4R4CA 1XNRQ 4X66Q 1P8LA 4GNXA 2UUAQ 5ELOA 1H95A 2R7DA 4LUVA 1JMCA 2N78A 5LMNL 3S2DH 3UE0A 1AE2A 4A3BG 5ELNA 2QA4A 4DR6L 5DLQE 4YCVA 3TS2A 2KENA 1B70B 1FL0A 2UUBQ 5GADC 3J81j 4JYAL 3J81c 1N32Q 3J80c 1MIUA 4XTCS 1Q86C 5IP7H 5LMUQ 1FJGL 2N3SA 4A3JG 1KD1C 2KBNA 2BH2A 3STBD 2WAQE 3E9HA 3K7AH 2Y0SG 3KJOA 4LF7L 3HOWH 4JI4Q 2NVXH 4GN5A 3HFZB 1YJ9A 1VQEA 3NENA 4DAYB 2HT1A 2FXQA 3STBC 3CCSA 3L0OA 4HIDA 3HOYH 4DK6C 4GKKL 1Y1VH 1HR0Q 3LGJA 3A5UA 2LSSA 2ZM6L 3CXCA 2JA5H 4LNQA 2JEAI 1VQPA 4IPGA 3AQQA 2NZOA 2PMZE 4IPHA 3H15A 3D31A 4DV1Q 4L5TA 3G4SA 1N36L 2K14A 3TREA 4C3JH 1J5EL 5FLMH 3K8AA 1HNZL 4Y52H 3IRBA 4C3HH 1D7QA 3RZDH 2ZTDA 2EQSA 1PH6A 5J3BA 1KHIA 2Z6KA 4JI5Q 2JA7H 4BY7H 1A63A 1CKMA 2VS1A 1VCIA 3JC66 1DGSA 3F2DA 1XMQL 2ES2A 1XNRL 4X66L 4QIWE 1Q82C 4OWTB 2Z0SA 2JA6H 3ICEA 2YV5A 3G48A 4JI0Q 5C44G 1SN8A 2R93G 2UUBL 2JA8G 3I4NH 4JV5L 2KCTA 2PQAA 3KOJA 3AFPA 2F4VQ 5LMUL 1HZBA 3J81i 2R92H 4AYBE 2CKZB 2AHOB 1TWCH 3GTKH 2VZAA 2PI2E 1I6HH 4A3DG 1GKHA 4B3TQ 4QQBX 4JI4L 1M90C 2I5MX 1YVCA 5IP9H 5M3MG 1EOVA 1XPOA 4GLVB 5LMNW 3PCOB 1V9PA 4DV3Q 1VQOA 5IY0A 1FGUA 1HJPA 1LYLA 1YJWA 2L15A 2YYZA 1GO3E 1HR0L 1VQ9A 5FJ8H 4LFBL 5JEAJ 1UWVA 3RNUA 1NY4A 4JG2A 2H5XA 1YEZA 3CCUA 5JJIA 3HKZG 1JT8A 2KHIA 1Z47A 2YTYA 2ZTCA 4EQ5A 2R7FA 1HH2P 2RHQB 4DV1L 1CKOA 1PHJA 1PYBA 1TWHH 3DM3A 1VQ7A 1C0AA 1Y14B 3EN2A 3S1MH 1N33Q 3HOXG 1VQHA 1Q7YC 1WI5A 1IYJB 1VQ6A 2WB1E 1Q46A 4HIMA 5IYBH 4NB3A 3JAMc 2KHJA 2GVAA 3CD6A 2B3GA 2HHHQ 2YTXA 3PUXA 3CCLA 2HIXA 4C3IH 1PH7A 5IWAQ 1PV4A 4JI0L 4X65L 3CCQA 2AWNA 3I7FA 2N49A 1OXVA 4DK3C 5IP7G 5M3FH 1KQSA 4L5SA 4L5RC 1EUJA 2F4VL 4DR4Q 1YHAA 1OXUA 1JJ2A 4A3KH 2UXBL 4POFA 3EIVA 1QVCA 4OXPA 1E3PA 2WFWA 1VQDA 5EAYA 3HOUH 2UXDL 4LF8Q 3H0GH 4B3TL 1BVSA 1QUQA 3T1YQ 4A3GH 4A93G 1IBLL 1TXYA 3A0JA 4A3EH 3S2HH 4DUYL 1VQJA 2ID0A 2E8GA 4R4QA 1YI2A 1XTDA 3TEHB 1ASZA 2OTJA 3KF8B 1E1OA 1HZAA 3PUZA 1P16A 2DUDA 3PO2H 3S15H 3F1ZA 4DV7L 4OO1G 2VQEQ 2R7ZH 2K5VA 4IFDI 3PF5A 4LF9L 2F52A 4LFCL 4LUOA 4DR1L 4R1JA 4YCUA 4LF5Q 1L1OC 1N33L 1WYDA 3KDFB 5JEAG 1HNWQ 3ZJYC 1VQLA 2B29A 3CPWA 1EQRA 1V43A 1Q12A 4BXXH 4YWMA 5IYCH 1EWIA 4GOPB 3U4VA 1OXSC 2Y0SE 2HHHL 3S1QH 4HIKA 3KLWA 3JAMi 4HJAA 1R9TH 4A3CH 5IWAL 3I4NG 2HIVA 1XNQQ 2K75A 2GVBA 1HR0W 3CC2A 4K0KQ 4R4TA 1I5FA 1CSPA 1BBUA 3B6YA 1WOCA 4DV6Q 1VQMA 1MKHA 5IE8A 3UDIA 4BY1H 1NMGA 5C0XJ 3WWVA 5C3EG 1GVPA 4DR4L 2OQKA 4BBRG 3CC7A 2OTLA 4GOPC 2IX0A 1N34Q 1Y1WH 2B63G 1KXLA 3S24A 4LF8L 1X65A 1VQ4A 2ZTEA 3T1YL 3M85A 1CKNB 2UU9Q 2JA9A 1TWGH 1KRTA 3HOZG 4A3FH 3PV0A 1A8VA 3CP0A 1VQCA 3RLFA 1PH3A 2K5HA 3PGZA 1VQBA 1NJIC 2JEBI 3U58A 2KCMA 3I4MG 1D8LA 2E2HH 1X56A 2AMCB 4LWCA 2VQEL 1GM5A 1VQFA 4B3MQ 4LF4Q 3RLNA 3RN5A 4BBSH 4IJLA 3ULLA 1CUKA 1X3FA 1X3EA 5HY6A 4DV2Q 4DR2Q 3L7ZC 3CCEA 4B3SQ 4OX9Q 3BZCA 4JI2Q 3A74A 5BR8Q 2F3IA 5IYBG 3GTPH 3K7UC 4BA2I 3PUVA 2ZJRA 1SR3A 1HNWL 1JB7A 4X6AH 2JJQA 4UPAA 1IL2A 2VUMH 2ZJQA 2BH8A 4AIMA 3HKSA 2E5LL 5M3FG 3Q8DA 3SGIA 2MNAA 3W1GA 4GNXC 2VQFQ 1X9NA 1N8RC 1XNQL 3GTOH 2UUAL 4JBKA 4YWKA 1B8AA 3E9IA 2VNUD 4DV6L 2CWPA 4UY8C 1N32L 4JOIA 1SE8A 2I5LX 4AQYQ 1K0RA 4LFAQ 3HOUG 2DGYA 3U4ZA 1N34L 1NMFA 3HKZE 4A3GG 2LXKA 3I56A 3ULPA 4A3EG 1X6OA 2WAQG 3TS0A 5C0XG 3VDYA 1KC8C 2MFIA 2UU9L 1MJCA 4OONA 3F2CA 2R7ZG 1UE5A 1I3QH 5C4JH 4KHPQ 4B3ML 4LF4L 1NBWA 4A3IH 4UP9A 4DV2L 1VS0A 4DR2L 4OX9L 4B3SL 3EBEA 4KHZA 4HJ5A 5BR8L 4JI2L 1JJGA 4A3BH 3K80C 3MEFA 4MTNA 3KJPA 1UE1A 1Q1EA 2PQAB 4A3CG 3CQZH 1K73C 1AH9A 1T9HA 3GTQH 2Z6KC 4JI6Q 4Y7NH 3I4OA 2E2JH 3KFUA 4JI5L 2D62A 4A3JH 1KL9A 2YTVA 3CMAA 1TWAH 3ER0A 1PH4A 4L5QA 3OYYA 2NZHA 1A62A 2Q2IA 4AH6A 1LTLA 3FP9A 4DV5Q 1E1TA 1UE6A 1Y1WG 3CAMA 4NXNQ 4AQYL 3RLOA 3L2PA 4LFAL 3UDGA 1N9WA 1EIYB 2CQOA 3GD7A 3BU2A 3FHWA 3M9BA 3HOWG 4IOCA 4A3FG 4DR7Q 4MNOA 3M4QA 4R4IA 1VQNA 1BBWA 3RN2A 3HOYG 2R6GA 4JI7Q 5E7NA 2ZJPA 1SMXA 2IHEA 4NXMQ 5IYDH 1E22A 1Y1VG 1EFWA 1L1OB 3ULJA 2N8NA 1YZ6A 2EIFA 3I2ZA 3PUWA 5GAGC 2EXDA 4BA1I 4DV3L 1HZCA 3M4PA 4RG1A 2QEXA 2JA5G 3PO3H 1VQ5A 2RF4A 3CCVA 1SRUA 4GLAC 1Z9FA 3H3VI 3M7NA 2GN5A 5FLMG 2NN6I 2ATWA 4P74A 3S1NH 4IFDG 2BA1A 4UP8A 3G6EA 2R93H 2JA8H 5HGQA 3PIPA 4PMWA 2JA7G 4P73A 4BY7G 2CFMA 3CCMA 2WB1G 4JI6L 4JBMA 2MO1A 2JA6G 3AFQA 4QJFA 1UEBA 4LF7Q 3GO5A 4KI0A 1PFSA 1K9MC 2ASBA 5K36G 2UUCQ 4A3DH 4DV5L 2R92G 3ERSX 4GKKQ 4X62Q 4APVA 4H02A 1AE3A 3FKIH 3CC4A 1RL2A 3PSIA 4HIOA 4QY7A 3UE1A 4IOAA 1CKNA 1EYGA 3HOVH 2I5HA 1MJEA 4PG3A 5IP9G 3F8TA 4DR3Q 3KF6B 2OCEA 2K4KA 1PH5A 3RR5A 1M1KC 2A19A 3NELA 1PH1A 2PI2A 4JBWA 4JI7L 4LF6Q 1SLJA 4NXML 1EIFA 5GQOA 5GROA 1E7ZA 5FJ8G 3CW2C 2VY3A 4QL5A 1XMOQ 3J7A5 2AWOA 2K5NA 1PH2A 3GTJH 4DNIA 3S1RH 1QVFA 2NVQH 4GNXB 1K83H 4O0AA 1WFQA 4JV5Q 1KIXA 1VQGA 4LW1A 1S40A 1XJVA 4LF5L 1TWFH 1YHQA 1PH9A 3H3VH 2Q2UA 1X55A 1QZGA 4C2MH 1OXXK 1G291 4DR7L 1FVIA 2YU9H 1XPRA 2WP8J 1YITA 1IZ6A 1O7IA 3TRZA 2UUCL 1NTGA 3J7ZC 3K0XA 2XGTA 4JCVE 3A5ZB 4DV4Q 4K0KL 3OTOQ 1SFOH 4A93H 1WJJA 4X62L 4DV0Q 4DUZQ 4A3KG 4LFBQ 2D0PA 4UP7A 4IO9A 1B7YB 2V1CC 1C7YA 1K3RA 1WCMH 1QVGA 3H0GG 4OWXB 4ME3A 3GTMH 1J6QA 4A3MH 3CCJA 3BJUA 1JJCB 2CWAA 5IYDG 4DR3L 4GKJQ 3TQYA 2UXCQ 1KAWA 5M5YH 1I94Q 4LF6L 4TQUS 1K8AC 3PO3G 1EQQA 3CCRA 4P75A 4EX5A 4A3LH 1U5KA 4A76A 5AJ3Q 3PO2G 3BZKA 1QZHA 5C4XG 1XMOL 4IFDJ 1YHBA 5M5WH 3E0EA 1GD7A 4X65Q 2NVTH 5M5XH 3W5OA 1S72A 1BKBA 3U50C 3M3YH 2QGQA 3PF4A 4YY3Q 2HQLA 2LXJA 4WJ4A 1IBKQ 1Q8KA 2D0OA 3PUYA 3GDEA 3UDXA 3PIOA 1HNXQ 2JK8A 4BXXG 3J80i 1PYSB 1OXTA 1SROA 2K50A 2Q2HA 5IYCG 1IBMQ 3AEVA 2UXBQ 3NBHB 5C3EH 1Q81C 3KYHC 5C0XI 2K52A 4BBRH 4RMFA 4DAMA 2UXDQ 2B63H 3CMEA 4ALPA 2E2IH 2PNHA 3CPFA 2IT1A 1UE7A 3AYHB 4NPSA 4R4OA 4JI8Q 1V1QA 4PZ6A 3NEMA 4PZ8A 4BY1G 2VQFL 4DUYQ 1IBLQ 3GTGH 2IHFA 2RCNA 3FKIG 5GAEC 4DV4L 4HJ9A 1YJNA 3OTOL 4B3RQ 4JBJA 2VL6A 3I55A 3HOZH 4JOIC 4DV0L 4DUZL 1PH8A 1W3SA 4DKAC 3HOVG 4DV7Q 4P71A 2JQOA 3G71A 4QGUA 2IX1A 1RIPA 2A1AA 4AYBG 3S17H 2ALYB 3I4MH 1IXRA 1VQIA 1KRSA 4X64Q 4DR1Q 1G51A 4LFCQ 4LF9Q 4GN4B 2OWOA 4OWWB 4GKJL 2UXCL 4DR5Q 4LUZA 4JI1Q 4XIGS 4YHHQ 2I0QA 1L1OA 4P72A 1I94L 3OW2A 1LM0A 4JI3Q 2BA0A 4TVAB 4DPGA 1YBYA 1E24A 4PZ7A 5AJ3L 2AKWB 1K8GA 2VW9A 3T1HQ 3DLLA 1CSQA 1HZ9A 2XTIA 3MXNB 4KHPL 5IT9c 3GTLH 1PVOA 4MZ9A 5LMNQ 2OQ0A 5JJKA 4YY3L 4DR6Q 2C35B 2MO0A 1IBKL 3KDFA 1OTCA 3K81C 1I50H 3S16H 2NN6G 1HNXL 2VUMG 5FLXc 5C44H 4A75A 1VQAA 4JYAQ 4HJ7A 1VQ8A 1IBML 1FJGQ 3M4OH 4GN3B 2Q2TA 4GOPA 4KLKA 4GLXA 4FDBA 4IJHA 4JC0A 1PA6A 4GS3A 4IPDA 1VQKA 1LUZA 4A4IA 1G6PA 1L2FA 4JI8L 4O2DA 2A8VA 4WJ3M 4IPCA 3D0FA 5JJLA 1U0LA 1Q1BA 4YCWA 1W2BA 1QUQB 4POGA 1YIJA 3CF5A 4B3RL 1WCMG 2MQHA 1ASYA 5M3MH 2NVYH 4J15A 3UDFA 4NXNL 4HJ8A 4A3MG 3RZOH 1X54A 3W1BA 4OO1I 2ZM6Q 2RHSB
chains in the Genus database with same CATH superfamily
3KF6A 3F2BA 3RZOB 4YIJA 5F2DA 2EY6A 4H44C 3NTHA 4DR5L 3R3OA 1N36Q 5FLXE 3NE5B 1XPUA 2JE6I 4IZ8A 3VR3A 1DD2A 1ICWA 3HOXH 2EZVA 4L8JA 1B9MA 4A3IG 2A6ED 1H95A 2UUAQ 4RCNA 2RSNA 1G2TA 1AE2A 3NP8A 2EY2A 4HSVA 4YCVA 2UUBQ 1FL0A 1V1PA 3S2DB 1N32Q 2RDGA 3J80c 5KNCA 4XTCS 4CJ0B 5LMUQ 2N3SA 1SNMA 2B39A 4A3JG 1KD1C 4QMGA 2B2UC 3I91A 4LF7L 3IFDA 4GN5A 3E6ZX 3HFZB 3VYUA 3NENA 3HOWB 3STBC 3HRZC 4HIDA 3FPPA 5KNDA 4DK6C 2HCCA 5T1GA 3LGJA 3HOYB 2ZM6L 2F0FA 4LNQA 1EZ6A 1VQPA 4IPGA 1Y1VB 4IN3A 1BOSA 2PMZE 1KDAA 3WOEA 3H15A 4DV1Q 2JA5B 5DAUA 4C3JH 1SNOA 3GTPB 4XQQA 2ZTDA 2EQSA 3MEHA 5LL6X 2JA7H 3SK5A 3ICEA 4QIWE 3FEWX 3G48A 1TKWB 2WKCA 1WD1A 3OIQA 1SN8A 2R93G 3DXJC 2MJ8A 4CKBA 2AHOB 3GTKH 3I4LA 2R92B 3J7YW 2FINB 4JI4L 4QQBX 1JORA 1QNUA 4RKLA 3PCOB 1V9PA 5IY0A 1UUPA 2JN4A 3DEOA 1HFNA 5JEAJ 3RNUA 3AMUA 1H9RA 3ERQA 4KV6A 5C4XG 1PYBA 1TWHH 1Y14B 4ABNA 3EROA 1WTHA 2Q8TA 1VQ6A 2WB1E 1Q46A 4HIMA 3V2TA 3MXNA 2KHJA 1CTMA 2OT2A 3VYRA 2B3GA 2HHHQ 5ELCA 3NSWA 1JWUD 2N49A 5IP7G 4UHVA 1IKLA 1WTWA 3QR8A 2Q8IB 1EUJA 1TIID 2XWBB 5M3FB 4MTKA 2LS01 1IW7C 4POFA 3H91A 3EIVA 1A3TA 2RQXA 2WFWA 1VQDA 4A3KB 4LF8Q 1MHWC 4B3TL 1BVSA 1QUQA 1DM0B 1TXYA 1GUWA 3S2HH 2WACA 4DUYL 1YI2A 1JC7A 1XTDA 1B9NA 2OTJA 1BUVT 4JPBW 1CA5A 5ISRA 3PO2B 4LF9L 2F52A 4R1JA 4YCUA 1LT5D 5FO7B 4FF4A 1ESRA 2G5DA 5ELEA 4CDDC 2B29A 1V43A 3OPOA 2QKIC 1OXSC 4DR7Q 3S1QH 4HIKA 4A3CH 3I73A 5IWAL 2IX3A 4ZRZA 4K2KA 4I65A 3VYTA 1HR0W 3CC2A 3IKJA 4R4TA 1I5FA 1VQMA 1WOCA 4DV6Q 1MKHA 5IE8A 4UDUC 3J80L 4BY1H 3WWVA 4UAIA 5C3EG 1E2VA 5CORA 4BBRG 2IX0A 1Y1WH 3LX0A 2B2WA 1GJXA 3FMCA 1JB3A 4Q0FA 2L9HA 4MHEA 1A8VA 3FPUB 3RLFA 1XXGA 3BVGA 4FXGC 1KTKA 1O7ZA 2K5HA 4A3FB 3AB9A 3U58A 3I4MG 2E2HH 3OW7A 1GM5A 4V0BA 1SNDA 2NUCA 1BCPF 1CUKA 4DR2Q 1GXDC 3OSOA 2F4IA 2RVLA 3CCEA 3GTPH 2F3IA 2F3WA 2PYKA 3A8KE 4ZUJA 5C6AA 4BA2I 4KKSA 1STHA 1UAPA 1XWEA 3GV3A 1HNWL 3K5MA 1JB7A 4UPAA 2VUMH 4FYDA 1O80A 1ESFA 3HKSA 3T51B 2NZ1D 5M3FG 1SMYD 2VNUD 3C3LA 2CWPA 2Z9HA 4LFAQ 4HTHA 1PMRA 3ULPA 4A3EG 3MZ5A 5C0XG 1PTOD 3VA5A 4A3MB 3DWPA 5FO9B 2RSOA 1T5XD 5I9OA 1MJCA 1STGA 5DEHA 4KHPQ 4B3ML 2DNEA 5C4JB 1I3QB 4K2LA 5KEEA 1VS0A 4DV2L 2F0GA 4KHZA 4HJ5A 3M3YB 5IGCA 2WINB 2WKDA 3I8ZA 3MEFA 1BXTA 4NMZA 1UE1A 2PQAB 1K73C 1AH9A 5G3LF 4A3BB 4ZUIA 3KFUA 2WIIB 4JI5L 3CQZB 4DXFA 1TWAH 2A5HA 2E2JB 4K6DA 2LFNA 2O5JC 4DV5Q 1D1KA 1SNQA 1EQTA 4QB4A 1J8IA 4NP5A 5KGUA 4NXNQ 4AQYL 1V8QA 2N88A 1EIYB 3NWSA 3FHWA 2OF1A 1RODA 1CI3M 3OWEB 4A3FG 4MNOA 4R4IA 1SJED 1R4PB 4JI7Q 5E7NA 1E22A 1JQYD 3BDLA 4IALA 1EFWA 3PUWA 1YZ6A 3I2ZA 5GAGC 4G7ZC 2EXDA 4DV3L 3TSSA 1AEXA 1DONA 3C1FA 1VQ5A 1SEBD 2F0DA 4RGTA 3H3VI 2ATWA 4P74A 4IFDG 3I3CA 5DM63 2K5DA 2JA8H 3RMHA 5HGQA 3N6RA 3CCMA 3EJIA 4JI6L 3Q6SA 3P1HA 1HTLD 2QILA 4IUUA 4LF7Q 2B2UA 1PFSA 1K9MC 1RF2D 3CHBD 4CDEC 1WD0A 2QEJC 2K05A 3N52A 3J81L 4A3DB 5M3MB 1RL2A 1LABA 1EY0A 3LWUA 5K5PA 5I2YA 5BN4A 3F8TA 2F0SA 1CHQD 3RR5A 2A19A 3I72A 2PI2A 1SLJA 3HKZB 1EIFA 5KYLA 3CW2C 2AWOA 3T53B 1QVFA 1ONLA 5KRUA 1KIXA 5JJZA 2F0PA 4LF5L 1TWFH 1STBA 2F1MA 2Q2UA 1STNA 4C3IG 1OXXK 3CRLC 2WP8J 2L5TA 2Z4IA 1EY9A 4C2MB 2UUCL 1NTGA 4K0KL 4JCVE 2JSOA 4ZAIA 3H94A 1PTOH 4X62L 4DV0Q 1PRTC 1EY8A 4OWXB 4ME3A 4A3MH 3CCJA 3NUCA 5IYDG 1WCMB 4DR3L 4GKJQ 2HD3A 1KAWA 1I94Q 2VB2X 3CCRA 4A3LH 3WDNA 5JEAH 1QZHA 1EY5A 3U9OA 1XMOL 3I90A 1K3BC 1SYGA 3U50C 3M3YH 2QGQA 2HQLA 1O7LA 1H9KA 1G8ZD 3GDEA 1QILA 3I4NB 4BXXG 1SROA 1UEAB 3BDCA 5CV6A 3M4YA 4NDXA 5C0XI 2K52A 3JAML 1S5DD 1CA6A 1BDOA 4N8X1 1WTXA 3DMUA 1UE7A 1EOTA 2PW5A 1SYDA 4DUYQ 2IHFA 2RCNA 4HJ9A 3OTOL 3D8GA 4JBJA 5COYA 3TBIB 1HUNA 3GTGB 3FRPB 1W6KA 4P71A 3G71A 3HOZB 2KEDA 4LF9Q 4X64Q 2I07B 4PV1C 3OW2A 4JI3Q 2BA0A 5AJ3L 1D5MC 3KF8A 1K8GA 1SYCA 1HZ9A 2NB0A 5IT9c 3GTLH 1PZJD 1OTCA 2AQ1B 1BBXC 2NN6G 4X3TA 4JYAQ 5FLXc 1KNEA 3DHQA 1FJGQ 4GN3B 1FD7D 4IUTA 4EQPA 3SE0A 3MXUA 3CU7A 5CMDA 4DGZA 4IPDA 3TP8A 1QB5D 1G6PA 1L2FA 4JI8L 2HDMA 1U0LA 4A3GB 4HEDA 4POGA 2CW0C 3TZDA 1WCMG 3U9SA 1DOMA 1ASYA 5M3MH 4R8IA 4HJ8A 1ZEQX 3K5LA 1TY2A 1B53A 1NE3A 4JI1L 4YHHL 1J5EQ 1X3GA 2K1BA 2R61A 3OHXC 4Z9CB 3TDQA 3C2PA 3S14H 1IYVA 1S3OA 2L12A 1XMQQ 4YWLA 1F9SA 2D9UA 3QB3A 1SSOA 4X66Q 4FXKC 5ELOA 2NWGA 3MHBA 2R7DA 3HOXB 1AW7A 4DR6L 1B70B 2J4XA 2A6EC 5GADC 1IKMA 5CGKA 1B44D 4IUPA 4K6LA 1PRTB 4DAPA 3KJOA 5KYIA 5LL6S 4S3SA 1Q8IA 2A68D 1VQEA 4DAYB 1FGBD 2FXQA 2LY7A 4EQOA 3G6JB 1WTQA 1F77A 1Y8OB 2FMCA 2LSSA 2JEAI 1RTNA 4FO2A 3AQQA 4IPHA 4BBSB 2K14A 3QG1A 3K8AA 3K57A 1HNZL 3IRBA 4U673 3X3NA 4C3HH 3RZDH 1D7QA 3GQBA 2F0WA 5J3BA 1EQVA 1KHIA 4JI5Q 4BY7H 1SXTA 4LK1C 1DGSA 2ES2A 1XNRL 4B08A 2JA6H 2JA7B 2YV5A 3HZXA 1S4ZA 3T56B 2CHBD 3I4NH 2DN8A 2HDLA 1G91A 2KCTA 5IIFA 2F4VQ 3H3VC 4HR7B 1HZBA 2VZAA 2PI2E 3FDTA 1I6HH 3GTKB 5C3WA 1GKHA 1LT4D 3UI2A 1IHZA 3HP3A 1YVCA 5T1IA 5LMNW 4DV3Q 1HJPA 3SR1A 1GO3E 1HR0L 2XRSD 5FJ8H 4LFBL 3P20A 1UWVA 1JT8A 1NY4A 2RCFA 5JJIA 2D2CC 2KHIA 1PHJA 1C0AA 1CKOA 3T13A 1VQ7A 1N33Q 3HOXG 1TWHB 1E2WA 4NB3A 1I4HA 2GVAA 3GTQB 5IT9L 1QNKA 4JI0L 4X65L 3CCQA 4L5SA 2BCOA 1HRJA 1QE6A 2N55A 1YHAA 1QVCA 1LV9A 3HGBA 2HQEA 3H0GH 3T1YQ 4A3GH 4A93G 2MGSA 2WAQB 3S2HB 4HCEA 1E1OA 1P16A 2DUDA 3S15H 1A3UA 1IL8A 1C4QA 4DV7L 1PRTF 2R7ZH 4C3JG 3R2IA 4LUOA 3ND8A 1EEFD 4LF5Q 1WYDA 3KDFB 2VXWA 2OXPA 5IYCH 4DXGA 4IURA 4GOPB 3U4VA 1SDFA 2HIVA 1S5FD 2CH4A 3D3RA 3S1QB 2R3ZA 4K0KQ 1CSPA 2K33A 3UDIA 2K04A 5C0XJ 3G7LA 1AFPA 1CHPD 4DR4L 5J39A 1LTSD 2M2LA 4BY1B 2B63G 2X6LA 3S24A 5JVG3 3DUZA 1Y1WB 1X65A 2IW3A 2ZTEA 1YNJD 4DAYA 1CKNB 1NR2A 1STEA 4CHTB 5KNBA 3ONAB 4WFN3 2DJFC 3PV0A 4J6HA 2KUMA 3CP0A 4ZYSA 1B50A 2H1EA 2C9OA 3PGZA 3SK8A 1D8LA 3MVVA 1SNPA 1SJHD 1X56A 2VQEL 4LF4Q 1VQFA 4BBSH 2D5DA 1X3FA 5HY6A 4OX9Q 1XX8A 2E2HB 3BZCA 3A74A 5BR8Q 3PUVA 3TN2A 4X6AH 2BDNA 1IL2A 2ZJQA 2B8FA 4AIMA 2VUMB 4GNXC 5EPLA 5I4DA 3W1GA 1XNQL 1I4PA 4YWKA 3E9IA 2KHSA 4QUFA 3NWTA 5E1FA 1U4MA 4NKLA 3NBHA 1SMYC 4IUNA 3EFXD 3U4ZA 1N34L 1NMFA 3HKZE 3MA2B 4OL7A 4B9WA 3OOCA 3I56A 4EGVA 1X6OA 2WAQG 1KC8C 4K5WA 3DM1A 5J22A 2F0TA 2UU9L 4KD3A 2PW7A 4DK1A 1WTRA 1PTOC 1UE5A 1DCZA 1J9OA 4A3IH 1HPCA 4B3SL 2AUKA 3EBEA 1JWSD 4JI2L 4PMBA 3KJPA 1Q1EA 4EQNA 4A3CG 1T9HA 3GTQH 2KJXA 4A3JH 1KL9A 2PO4A 1BCPD 1PH4A 2E2IB 3OYYA 1KLUD 2F0UA 1SFOB 5C5LA 2NZHA 1A62A 1TWAB 1E0BA 4AH6A 1LTLA 1Y1WG 4TKOB 1PZKD 2Y0SB 3L2PA 3UDGA 4XDXA 2P5ZX 4ID6A 1E2ZA 4O42A 3BU2A 3M9BA 4G7OC 3HOWG 4IOCA 1RDPD 4CBVA 4X3KA 3M4QA 1BBWA 3RN2A 1LTAD 3HOYG 2DJGC 2ZJPA 1Y1VG 3TP6A 1GHJA 3MXGA 2JA5G 1LTRD 4RG1A 2F0OA 2KVMA 5M9OA 1VF7A 1B3QA 2RF4A 1SRUA 1Z9FA 3M7NA 5FLMG 2O5IC 3S1NH 5ELDA 2R93H 3S16B 1I6VC 2JA8B 3A56A 3AFQA 3H09A 3GO5A 1NR4A 3LWEA 2ZXOA 2EE1A 1Z7TA 4LAAA 2B8GA 2R92G 3FVQA 3IL8A 4APVA 1AE3A 3CC4A 5CBAE 1DYQA 2MUYA 2NVYB 3TP5A 3GTMB 4IOAA 1HTPA 1CKNA 1MD2D 5C5MA 2I5HA 3HOVH 1F2YA 5IP9G 4H7BA 1PH5A 4FXDA 1NAPA 2K4KA 4JBWA 4NXML 3J7AV 5GQOA 2F0HA 4DNRB 1E7ZA 5HURA 2A73B 2B2YC 2VY3A 2K6AA 2K5NA 4CGYB 2BOSA 1EEID 3GTJH 4GNXB 1K83H 1PFMA 2KOLA 1S40A 2MP1A 1PZID 5EPKA 3H3VH 1XYIA 1M4VA 1TWFB 2B2TC 2EYPA 1G291 2FFKB 1WTPA 3NXWA 1FVIA 4RHSA 5TSSA 3E0JA 3TRZA 1HCZA 3J7ZC 4FF2A 3A5ZB 1MI2A 1EFID 1WJJA 1GUNA 5EBDA 4A3KG 3TP7A 4LFBQ 2BE5D 2V1CC 2IJ0A 1PTOB 5A2QE 3BJUA 5FOBB 3Q0AA 2CWAA 2XRQD 3J80E 2UXCQ 4J8QA 4LF6L 1NCVA 4TQUS 4A76A 3K58A 3PO2G 4X65Q 1LTGD 1S72A 2F0IA 1BKBA 3PF4A 4HN7A 3OMGA 1JOQA 4DN4M 1Q8KA 2D0OA 1U9RA 4KY6A 3J80i 2K50A 4OIJA 4DNTB 4ZKBB 5C3EH 3BYYB 4C56C 4BBRH 1TWCB 5ELBA 4ALPA 2E2IH 1SFOH 3AYHB 4RHRA 2VQFL 1BR9A 4PZ6A 3NEMA 3OWFA 2EY5A 2EYLA 1EYAA 5GAEC 4DV4L 1YJNA 1HUMA 2VL6A 3MTSA 3I55A 4DUZL 5BN3A 4DV7Q 1I4XA 4QGUA 2IX1A 1RIPA 2A1AA 3KLRA 3I4MH 1IXRA 1CZGA 1I4GA 1JCKB 1HXYD 4DR5Q 4XIGS 3NBIA 2EYOA 1KDCA 5L37A 4TVAB 4XT3B 5EKLA 1YBYA 2VW9A 5E3FA 1CSQA 3SK6A 4MN3A 3VR2A 4MZ9A 1PVOA 2OQ0A 4YY3L 1F2LA 4DK0A 3GTLB 1IBKL 2XIWA 3S16H 1HNXL 1XTCD 5C44H 1IBML 1LACA 4FP5D 4FDBA 3K5NA 3I70A 5IODA 2A8VA 4WJ3M 4IPCA 1ET9A 3QO2A 5C0XH 4YCWA 1JWMD 4B3RL 4WORA 2MQHA 3A7AB 2NVYH 4A3MG 2O4XA 3GTMH 3A55A 2ZM6Q 2RHSB 1JOKA 1YNXA 1A3VA 3PQIA 2OEOA 4A3LG 3OIPA 2QDLA 2RDHA 1JE5A 2IPKD 2K5WA 2PMZB 1ILPA 2RBMA 3T1HL 1L0WA 4CJ2C 1PTOF 2Z8LA 1P8LA 4GNXA 3S14B 4J1MA 4LUVA 1H9MA 5LMNL 1BNZA 1UNSA 4A3BG 5ELNA 3TS2A 1EIHA 1F9QA 2KENA 3E3XA 4QIWB 1MIUA 3SK4A 1ZKOA 2C5CA 4I7ZC 2SDFA 1SYBA 3K0YA 2WAQE 3E9HA 3K7AH 4JI4Q 2NVXH 1KLGD 1YJ9A 2HT1A 3O13A 1LT3D 3CXCA 2A68C 1HFGA 2NZOA 3D31A 3NK9A 4G7HC 1N36L 3J81E 3PMFA 3TREA 3EVQA 4CDFC 1TR5A 1B1ZA 1A63A 1CKMA 2H4OA 1VCIA 2VS1A 3JC66 4C3HB 3RZDB 5EGTA 4OWTB 4BY7B 2F0QA 4Q5VA 3CRKC 2JA6B 2UUBL 4JV5L 1CK1A 4U68A 3NTIA 2PQAA 1HQRD 5LMUL 3J81i 2CKZB 1TWCH 1RTOA 2Z1CA 4PQXA 4A3DG 1L0XB 1EYCA 1S5ED 4B3TQ 2K03A 1M90C 2ZXPA 2I5MX 3IFTA 5M3MG 1I6HB 1F2ZA 1HQMC 5CR3A 4BWGB 2L15A 1VQ9A 1MBYA 4JG2A 1SE3A 3HKZG 2EYMA 1CT1D 1Z47A 3ND9A 2ZTCA 2IY5B 4DV1L 3DM3A 2JYOA 1HHVA 3S1MH 4PNYA 4F8MA 5JPMC 1EY6A 1WI5A 1IYJB 1Y8PB 5IYBH 4FF3A 2KEEA 4HMIA 4H0LC 3CD6A 2JXMB 2HIXA 2NBFA 4C3IH 1PH7A 5IWAQ 2A69D 3I7FA 2HCIA 1KQSA 4XXEA 4DAVA 1EU3A 2TSSA 1FNVA 5DNFA 5D14A 1OXUA 1W6JA 2UXBL 1RKNA 4OXPA 3HOUH 2K01A 2UXDL 1STYA 4KN4C 4DA2A 2SEBD 3H0GB 1HA6A 2ID0A 2E8GA 4R4QA 3JAME 2RDFA 3EA6A 3TEHB 2F0NA 1HZAA 3PUZA 2QF7A 4OO1G 1V1OA 3PO3B 1VF5C 2QW7A 3A8IE 3S15B 1KNAA 4IFDI 4DR1L 2R7ZB 1L1OC 1Y69U 1HNWQ 3ZJYC 3CPWA 1EQRA 1SE2A 4BXXH 4YWMA 4DF7A 1EWIA 2B2TA 4KN7C 4FF1A 2HHHL 2Y0SE 3JAMi 4HJAA 1R9TH 3I4NG 3BYTB 2GVBA 1SNCA 1D1IA 1NMGA 1T5EA 3CC7A 2OTLA 4GOPC 4LF8L 1VQ4A 1PLFA 2X69A 1TWGH 1KRTA 3HOZG 4AYBB 2EXZA 2EYFA 1VQCA 1YNJC 1NJIC 2MPMA 2O2LD 2AMCB 4B3MQ 2GA4B 3RN5A 4H13C 3ULLA 4DV2Q 1X3EA 2DY8A 2BDOA 3L7ZC 2NVQB 2EJMA 1JICA 2ZJRA 1SR3A 5CV8A 2NN6H 4K5VA 1QG7A 3D4WA 2E5LL 3Q8DA 2MNAA 3K59A 1X9NA 1A2UA 2VQFQ 4JBKA 4DV6L 4RGNA 1CQVA 1G6ZA 2KA7A 3QWNA 5K36H 1AZQA 4AQYQ 1K0RA 2B2WC 2EJGC 4A3GG 3DEPA 1AN8A 1GUSA 4XT1B 4OONA 3F2CA 2R7ZG 3P75A 1GUOA 1RHPA 4R8NA 1PFNA 1ZYRD 3MFYA 4UP9A 4DR2L 3V05A 4C1NK 1LTBD 4A3IB 1JJGA 3K80C 4MTNA 2FHTA 2FJ2A 1FNUA 2Z6KC 1K8MA 4Y7NH 4JI6Q 3I4OA 1BQQT 5I6YA 2Q8RE 3CMAA 4L5QA 4A3JB 1X32A 4G57A 1DJRD 1UE6A 4V190 3CAMA 5FLXL 4LFAL 1BCPC 1OO9B 1N9WA 2L0CA 1ILQA 2CQOA 5IGEA 1SYFA 1VMPA 4RFBA 1FYCA 2R6GA 3NTKA 1SMXA 2IHEA 1EIGA 1L1OB 3ULJA 1LT6D 2N8NA 4BBSG 4BA1I 3PO3H 2Z6BA 1ICFB 4O1NA 3CCVA 4KJOA 3BVMA 4GLAC 2GN5A 2NN6I 5EJWA 1FNWA 3G6EA 4K8IA 3PIPA 1F9RA 4PMWA 4P73A 2JA7G 3S1NB 1STAA 4OELB 2ZXRA 2MO1A 3M4OB 2R93B 3GV6A 1UEBA 3WOFA 2ASBA 4KI0A 4HAEA 4RKBA 2VB3X 4KKUA 2UUCQ 1RCVD 5C4HA 1II3A 1I4RA 4DV5L 4X62Q 4H02A 3FKIH 5IT9E 2EYJA 1EY4A 4FNFA 2HUGA 4QUCA 3UE1A 4K8JA 1MJEA 3S9WA 4DR3Q 1M1KC 4OGQC 4ULLA 1PH1A 3HOVB 4JI7L 5EQ0A 1L0YB 5C4XB 3C1EA 2M9VA 4ZKCB 1I4QA 1XMOQ 1LLRD 1PH2A 1R4QB 1EWHA 3R93A 1ML0D 3S1RH 2NVQH 4JV5Q 1WFQA 3GTJB 5CC4A 1B2TA 1VQGA 5HGTA 5D65A 1BO0A 4DFAA 1XJVA 1K83B 1YHQA 2E76C 3ITPA 1X55A 1TS2A 1DZ1A 1IZ6A 1O7IA 1SAPA 3RUZA 1A6XA 3OTOQ 3QIAA 4A93H 3ZYYX 4IO9A 1B7YB 2F0LA 2PZWA 4N8FA 1C7YA 1NNXA 2PZTA 1TS3A 4CJ1B 1QVGA 1J6QA 1JJCB 2MHVA 2BE5C 3TQYA 5M5YH 2XVSA 1SE4A 4EX5A 1U5KA 3GP7A 5AJ3Q 3BZKA 2A6HD 4IFDJ 1YHBA 5M5WH 3E0EA 2NVTH 5M5XH 3D6CA 3W5OA 4DU9A 2IL8A 4P2CB 5IGDA 2LXJA 4WJ4A 1EWCA 3UDXA 4F87A 2AQ2B 1OXTA 3AEVA 1PDQA 2UXBQ 2E2DC 1Q81C 2I46A 3KYHC 1BCPB 2UXDQ 2B63H 5C3EB 3CMEA 2PNHA 2SNMA 4BBRB 2IT1A 4R4OA 2EOTA 3L3OC 4JI8Q 1V1QA 4PZ8A 4WJWA 4BY1G 3Q24A 4CDCC 4JOIC 4DV0L 3W2DA 1D5ZC 3HOVG 2JQOA 1X3PA 2ALYB 3HEJA 1VQIA 4DR1Q 1GUGA 2B2VC 5E4WC 4OWWB 4GKJL 4JI1Q 3I4MB 4YHHQ 4LMQD 1L1OA 2I0QA 1I94L 4DPGA 1E24A 4PZ7A 1QOHA 4F7XA 5KIXA 5FO8B 3SXHA 2XTIA 4RA8A 4L63B 3BZDB 2EVBA 4DR6Q 2MO0A 1JE4A 1JR0D 3KDFA 3K81C 1I50H 1NUCA 3KBXA 2VUMG 1YNND 4A75A 1VQAA 3QOJA 1VQ8A 3M4OH 4L6TB 4GOPA 4KLKA 5EKKA 5C44B 1EU4A 3URYA 4JC0A 1PA6A 4GS3A 4XQJA 1Y8NB 4A4IA 1CZWA 5JOBA 2IWHA 4K14A 1W2BA 2XWJB 1YIJA 3CF5A 4A3EB 1CM9A 4J15A 3RZOH 1K0SA 1X54A 2Q2TA 5G3LD 5H1SE 3VR4A 4X64L 2QDBA 4XYQA 3TZUA 1C9OA 5JPNC 4JI3L 1HNZQ 3QJYA 5C4XH 4CKCA 5GAHC 1A0IA 2CCZA 2E5LQ 3J7AF 4R4CA 1XNRQ 5A2QL 1ENFA 3SVMA 1H9SB 2N78A 1JMCA 3S2DH 1ENAA 2QCPX 3UE0A 3VR6A 2QA4A 3BS1A 5DLQE 5I9PA 3VA7A 3J81j 4JYAL 3DWQA 3X3MA 4LJZC 3J81c 1Q86C 5IP7H 2EDGA 2L4NA 1FJGL 4HMJA 2KBNA 5CV7A 2BH2A 3STBD 2L55A 2Y0SG 3HOWH 4KMUC 3K7AB 3HOYH 4K5XA 3CCSA 3L0OA 3A54A 2NVXB 4GKKL 1Y1VH 1HR0Q 5CV5A 3A5UA 2JA5H 3F2UA 1M8AA 3C46A 4L5TA 2XSCA 3G4SA 1J5EL 4KD4A 5FLMH 4OHJA 4Y52H 2DY7A 3T16A 1PH6A 2Z6KA 1Q3LA 4ZQ3A 1XMQL 1S5CD 3F2DA 4X66L 1Q82C 4E6IA 2Z0SA 4JI0Q 3GTOB 5C44G 1A15A 5EPJA 2E75C 5IOCA 2JA8G 1K8OA 3KOJA 3AFPA 5C4ZA 1EL0A 3VYSA 2R92H 4AYBE 4XQNA 2SNSA 3BG3A 1LTTD 4OIKA 5IP9H 4I7AA 1EOVA 1XPOA 1U4PA 1IYUA 4GLVB 1YJWA 1N8RC 1VQOA 1FGUA 1LYLA 2YYZA 1TVXA 2PPBC 4QF4A 2H5XA 1MGSA 1YEZA 3CCUA 1NSNS 2YTYA 4EQ5A 2R7FA 1HH2P 2RHQB 5LHY1 3EN2A 1FR3A 3L9AX 1VQHA 1Q7YC 2K32A 4ODGA 3S1MB 3JAMc 1GUTA 2YTXA 3PUXA 3CCLA 2FMMA 3M7GA 1PV4A 1Q90A 2E74C 2AWNA 5AFWA 5FK9C 1IW7D 1OXVA 4DK3C 4C3IB 5M3FH 1DXMA 1BF4A 2PCFB 4L5RC 2F4VL 4DR4Q 2A69C 4C1NI 5CBEE 1JJ2A 4A3KH 1RD9D 2G9HD 3HS0C 4RAUC 1C48A 1E3PA 5EAYA 1GOZA 2KCNA 1CFMA 4JVZA 1LO5D 3NQTA 3SHLA 4B9XA 3K5OA 3HOUB 1IBLL 3A0JA 4A3EH 1VQJA 4N9PA 1HA5A 3BVZA 1ASZA 3KF8B 3PO2H 3F1ZA 2EJFC 2VQEQ 2K5VA 2LKVA 3PF5A 4LFCL 3K6OA 3KLSX 5CYUA 1B4OA 4MIUA 1N33L 2X6GA 4FVMA 3T4AC 2K7VA 4RWSC 3IAYA 5JEAG 1VQLA 1Q12A 1H9SA 1O7YA 3KLWA 1XNQQ 4XYOA 2K75A 3KUPA 2A74C 1U4LA 1R9TB 3B6YA 1BBUA 1QWYA 4KHVA 1GVPA 1U4RA 5EBCA 2OQKA 4IUQA 1N34Q 1KXLA 2NTSA 3MWYW 3T1YL 2K5QA 3M85A 1PYWD 2UU9Q 2JA9A 3Q23A 4KJNA 4A3FH 4ZLTF 1K28A 1PH3A 1TWGB 4ME5A 2F0EA 5D3DA 1VQBA 1ZXTA 2JEBI 2KCMA 4LWCA 3D6WA 3P7JA 2JP1A 3RLNA 1D2BA 5ELFA 4IJLA 1WTOA 4B3SQ 4JI2Q 5IYBG 3K7UC 2JJQA 4F88A 4OEMB 4IFDH 2BH8A 3SGIA 3GTOH 2F3VA 2UUAL 2YU9B 5JVH3 1B8AA 2WB1B 3KBGA 5BN5A 1F9PA 4UY8C 1WTVA 1N32L 4JOIA 1TS4A 1SE8A 2I5LX 4EVOA 3HOUG 2DGYA 2ICEC 5JAVA 4HCSA 4HSPA 3TMEA 4G4KA 2LXKA 3BDOA 3TS0A 2B2VA 4NW2A 3VDYA 1KABA 4IQZA 2MFIA 2M00A 2NTTA 5E4XA 1G2SA 2PZUA 2L1BA 5C4JH 1I3QH 3SEBA 4JW0A 4LF4L 1NBWA 5EKIA 1DOKA 3AU7A 4OX9L 2G9DA 4RH6A 5BR8L 2CH4W 4A3BH 4RGMA 1ZYRC 3CQZH 1X3QA 1S5BD 2E2JH 5A35A 2D62A 2YTVA 4Y7NB 4ZK9B 3ER0A 4ZCKA 2PQEA 2Q2IA 3MAQA 3QOLA 3FP9A 1E1TA 4BS9A 3KLSA 3R8BA 3RLOA 2F0JA 1D6EC 1JOOA 2AQ3B 2RKSA 3GD7A 4JK1C 1AZPA 4RCOA 3S17B 1VQNA 4NXMQ 2ZT9C 5IYDH 2V4DA 4N9TA 3NQIA 4CKEA 2EIFA 2ICIA 3E5SA 1HZCA 3M4PA 2B2YA 2QEXA 2ENBA 1A2TA 2F0KA 4KY5A 4PMCA 4C3HG 2BA1A 4UP8A 2LMCB 4BY7G 2CFMA 2L11A 2WB1G 2DNCA 4JBMA 2JA6G 1PFBA 1KAAA 3Q22A 1H9JA 4QJFA 4ILWA 5K36G 1EYDA 4A3DH 3MC0B 2F0VA 2XN9C 3ERSX 4GKKQ 3R2TA 2F03A 1AP0A 2TMPA 2J0TD 3LNNA 3SDZA 1TU2B 3EQLC 3PSIA 2CVRA 3FKIB 4QY7A 4HIOA 1EYGA 4PG3A 5NUCA 3KF6B 2OCEA 3NELA 4LF6Q 4IUVA 3DWAA 5GROA 5FJ8G 1MSGA 4QL5A 1TQOA 5CV9A 3J7A5 2SOBA 4M1UB 1RJTA 3NPPA 4DNIA 3OMCA 3RD4A 4O0AA 4TSSA 1LTID 4LW1A 3S1RB 5IGFA 1PH9A 1V1PB 4R9WA 4M8AA 5D3IB 1ET6A 4X3UA 1QZGA 1PXUA 4C2MH 5I2XA 4DR7L 2YU9H 1XPRA 2RA4A 2XNAC 1YITA 1PRTD 3H6MA 1CQFA 3A8JE 3K0XA 2XGTA 5CV4A 4DV4Q 4DUZQ 2EYHA 3A7LA 2D0PA 4UP7A 3D4DA 4A93B 1K3RA 2EPBA 1WCMH 3H0GG 1O78A 4OO1H 3D4RA 2WV6D 3MXPA 4GZYC 3NHHA 1K8AC 4C3JB 1EQQA 3PO3G 3PIO3 4P75A 5M5YB 1DOLA 1VMCA 1D5XC 2F0MA 1B3AA 1GD7A 5C3XA 5IGBA 2CQAA 5M5WB 2NVTB 4YY3Q 1VDZA 5M5XB 1IBKQ 2A6HC 3PUYA 3PIOA 1HNXQ 2JK8A 1PYSB 5IYCG 2Q2HA 1IBMQ 3NBHB 1C8CA 2Z4HA 2PNRC 1QJOA 4RMFA 4DAMA 4TRDA 5DM73 3CPFA 2AUJD 2KCCA 4NPSA 4KKTA 5IGGA 1IBLQ 3GTGH 2B63B 1TT2A 2K28A 3FKIG 1KDBA 5FKAC 4B3RQ 4KTAA 3HOZH 1PH8A 4QCLA 3CKIB 1W3SA 4DKAC 2J7ZA 1WVLA 2KQ3A 4AYBG 1TY0A 3S17H 1KRSA 4KK7A 4LFCQ 1G51A 4GN4B 2OWOA 1QCBD 1Z6HA 4LUZA 2UXCL 4P72A 1LM0A 2AKWB 5J1ZA 3PIP3 1EY7A 3DLLA 3T1HQ 3MXNB 4KHPL 1SYEA 5LMNQ 5JJKA 1SBBB 3KK7A 4KY7A 2C35B 3MFGA 3HG9A 4HJ7A 3VR5A 1I50B 3W3AA 1MSHA 4GLXA 4IJHA 2CW0D 1VQKA 1LUZA 1YNNC 1GHKA 1TS5A 4O2DA 2KECA 2EY1A 5I6WA 2NYZD 3D0FA 1Q1BA 1QUQB 4WRDA 4X3SA 1ENCA 1EZ8A 3UDFA 4NXNL 4OO1I 5JJLA 3W1BA 1F2MA 3V96A 4RGOS
chains in the Genus database with same CATH topology
5H1SE 3KF6A 3F2BA 1YNXA 4X64L 1NE3A 4A3LG 4DR5L 4JI1L 1C9OA 1N36Q 2IY5B 4YHHL 1J5EQ 1JE5A 1X3GA 1XPUA 4BBSG 4JI3L 1HNZQ 5C4XH 2JE6I 5GAHC 3S14H 1A0IA 3HOXH 2CCZA 3T1HL 1S3OA 2E5LQ 1XMQQ 4YWLA 1L0WA 4A3IG 4R4CA 1XNRQ 4X66Q 1P8LA 4GNXA 2UUAQ 5ELOA 1H95A 2R7DA 4LUVA 1JMCA 2N78A 5LMNL 3S2DH 3UE0A 1AE2A 4A3BG 5ELNA 2QA4A 4DR6L 5DLQE 4YCVA 3TS2A 2KENA 1B70B 1FL0A 2UUBQ 5GADC 3J81j 4JYAL 3J81c 1N32Q 3J80c 1MIUA 4XTCS 1Q86C 5IP7H 5LMUQ 1FJGL 2N3SA 4A3JG 1KD1C 2KBNA 2BH2A 3STBD 2WAQE 3E9HA 3K7AH 2Y0SG 3KJOA 4LF7L 3HOWH 4JI4Q 2NVXH 4GN5A 3HFZB 1YJ9A 1VQEA 3NENA 4DAYB 2HT1A 2FXQA 3STBC 3CCSA 3L0OA 4HIDA 3HOYH 4DK6C 4GKKL 1Y1VH 1HR0Q 3LGJA 3A5UA 2LSSA 2ZM6L 3CXCA 2JA5H 4LNQA 2JEAI 1VQPA 4IPGA 3AQQA 2NZOA 2PMZE 4IPHA 3H15A 3D31A 4DV1Q 4L5TA 3G4SA 1N36L 2K14A 3TREA 4C3JH 1J5EL 5FLMH 3K8AA 1HNZL 4Y52H 3IRBA 4C3HH 1D7QA 3RZDH 2ZTDA 2EQSA 1PH6A 5J3BA 1KHIA 2Z6KA 4JI5Q 2JA7H 4BY7H 1A63A 1CKMA 2VS1A 1VCIA 3JC66 1DGSA 3F2DA 1XMQL 2ES2A 1XNRL 4X66L 4QIWE 1Q82C 4OWTB 2Z0SA 2JA6H 3ICEA 2YV5A 3G48A 4JI0Q 5C44G 1SN8A 2R93G 2UUBL 2JA8G 3I4NH 4JV5L 2KCTA 2PQAA 3KOJA 3AFPA 2F4VQ 5LMUL 1HZBA 3J81i 2R92H 4AYBE 2CKZB 2AHOB 1TWCH 3GTKH 2VZAA 2PI2E 1I6HH 4A3DG 1GKHA 4B3TQ 4QQBX 4JI4L 1M90C 2I5MX 1YVCA 5IP9H 5M3MG 1EOVA 1XPOA 4GLVB 5LMNW 3PCOB 1V9PA 4DV3Q 1VQOA 5IY0A 1FGUA 1HJPA 1LYLA 1YJWA 2L15A 2YYZA 1GO3E 1HR0L 1VQ9A 5FJ8H 4LFBL 5JEAJ 1UWVA 3RNUA 1NY4A 4JG2A 2H5XA 1YEZA 3CCUA 5JJIA 3HKZG 1JT8A 2KHIA 1Z47A 2YTYA 2ZTCA 4EQ5A 2R7FA 1HH2P 2RHQB 4DV1L 1CKOA 1PHJA 1PYBA 1TWHH 3DM3A 1VQ7A 1C0AA 1Y14B 3EN2A 3S1MH 1N33Q 3HOXG 1VQHA 1Q7YC 1WI5A 1IYJB 1VQ6A 2WB1E 1Q46A 4HIMA 5IYBH 4NB3A 3JAMc 2KHJA 2GVAA 3CD6A 2B3GA 2HHHQ 2YTXA 3PUXA 3CCLA 2HIXA 4C3IH 1PH7A 5IWAQ 1PV4A 4JI0L 4X65L 3CCQA 2AWNA 3I7FA 2N49A 1OXVA 4DK3C 5IP7G 5M3FH 1KQSA 4L5SA 4L5RC 1EUJA 2F4VL 4DR4Q 1YHAA 1OXUA 1JJ2A 4A3KH 2UXBL 4POFA 3EIVA 1QVCA 4OXPA 1E3PA 2WFWA 1VQDA 5EAYA 3HOUH 2UXDL 4LF8Q 3H0GH 4B3TL 1BVSA 1QUQA 3T1YQ 4A3GH 4A93G 1IBLL 1TXYA 3A0JA 4A3EH 3S2HH 4DUYL 1VQJA 2ID0A 2E8GA 4R4QA 1YI2A 1XTDA 3TEHB 1ASZA 2OTJA 3KF8B 1E1OA 1HZAA 3PUZA 1P16A 2DUDA 3PO2H 3S15H 3F1ZA 4DV7L 4OO1G 2VQEQ 2R7ZH 2K5VA 4IFDI 3PF5A 4LF9L 2F52A 4LFCL 4LUOA 4DR1L 4R1JA 4YCUA 4LF5Q 1L1OC 1N33L 1WYDA 3KDFB 5JEAG 1HNWQ 3ZJYC 1VQLA 2B29A 3CPWA 1EQRA 1V43A 1Q12A 4BXXH 4YWMA 5IYCH 1EWIA 4GOPB 3U4VA 1OXSC 2Y0SE 2HHHL 3S1QH 4HIKA 3KLWA 3JAMi 4HJAA 1R9TH 4A3CH 5IWAL 3I4NG 2HIVA 1XNQQ 2K75A 2GVBA 1HR0W 3CC2A 4K0KQ 4R4TA 1I5FA 1CSPA 1BBUA 3B6YA 1WOCA 4DV6Q 1VQMA 1MKHA 5IE8A 3UDIA 4BY1H 1NMGA 5C0XJ 3WWVA 5C3EG 1GVPA 4DR4L 2OQKA 4BBRG 3CC7A 2OTLA 4GOPC 2IX0A 1N34Q 1Y1WH 2B63G 1KXLA 3S24A 4LF8L 1X65A 1VQ4A 2ZTEA 3T1YL 3M85A 1CKNB 2UU9Q 2JA9A 1TWGH 1KRTA 3HOZG 4A3FH 3PV0A 1A8VA 3CP0A 1VQCA 3RLFA 1PH3A 2K5HA 3PGZA 1VQBA 1NJIC 2JEBI 3U58A 2KCMA 3I4MG 1D8LA 2E2HH 1X56A 2AMCB 4LWCA 2VQEL 1GM5A 1VQFA 4B3MQ 4LF4Q 3RLNA 3RN5A 4BBSH 4IJLA 3ULLA 1CUKA 1X3FA 1X3EA 5HY6A 4DV2Q 4DR2Q 3L7ZC 3CCEA 4B3SQ 4OX9Q 3BZCA 4JI2Q 3A74A 5BR8Q 2F3IA 5IYBG 3GTPH 3K7UC 4BA2I 3PUVA 2ZJRA 1SR3A 1HNWL 1JB7A 4X6AH 2JJQA 4UPAA 1IL2A 2VUMH 2ZJQA 2BH8A 4AIMA 3HKSA 2E5LL 5M3FG 3Q8DA 3SGIA 2MNAA 3W1GA 4GNXC 2VQFQ 1X9NA 1N8RC 1XNQL 3GTOH 2UUAL 4JBKA 4YWKA 1B8AA 3E9IA 2VNUD 4DV6L 2CWPA 4UY8C 1N32L 4JOIA 1SE8A 2I5LX 4AQYQ 1K0RA 4LFAQ 3HOUG 2DGYA 3U4ZA 1N34L 1NMFA 3HKZE 4A3GG 2LXKA 3I56A 3ULPA 4A3EG 1X6OA 2WAQG 3TS0A 5C0XG 3VDYA 1KC8C 2MFIA 2UU9L 1MJCA 4OONA 3F2CA 2R7ZG 1UE5A 1I3QH 5C4JH 4KHPQ 4B3ML 4LF4L 1NBWA 4A3IH 4UP9A 4DV2L 1VS0A 4DR2L 4OX9L 4B3SL 3EBEA 4KHZA 4HJ5A 5BR8L 4JI2L 1JJGA 4A3BH 3K80C 3MEFA 4MTNA 3KJPA 1UE1A 1Q1EA 2PQAB 4A3CG 3CQZH 1K73C 1AH9A 1T9HA 3GTQH 2Z6KC 4JI6Q 4Y7NH 3I4OA 2E2JH 3KFUA 4JI5L 2D62A 4A3JH 1KL9A 2YTVA 3CMAA 1TWAH 3ER0A 1PH4A 4L5QA 3OYYA 2NZHA 1A62A 2Q2IA 4AH6A 1LTLA 3FP9A 4DV5Q 1E1TA 1UE6A 1Y1WG 3CAMA 4NXNQ 4AQYL 3RLOA 3L2PA 4LFAL 3UDGA 1N9WA 1EIYB 2CQOA 3GD7A 3BU2A 3FHWA 3M9BA 3HOWG 4IOCA 4A3FG 4DR7Q 4MNOA 3M4QA 4R4IA 1VQNA 1BBWA 3RN2A 3HOYG 2R6GA 4JI7Q 5E7NA 2ZJPA 1SMXA 2IHEA 4NXMQ 5IYDH 1E22A 1Y1VG 1EFWA 1L1OB 3ULJA 2N8NA 1YZ6A 2EIFA 3I2ZA 3PUWA 5GAGC 2EXDA 4BA1I 4DV3L 1HZCA 3M4PA 4RG1A 2QEXA 2JA5G 3PO3H 1VQ5A 2RF4A 3CCVA 1SRUA 4GLAC 1Z9FA 3H3VI 3M7NA 2GN5A 5FLMG 2NN6I 2ATWA 4P74A 3S1NH 4IFDG 2BA1A 4UP8A 3G6EA 2R93H 2JA8H 5HGQA 3PIPA 4PMWA 2JA7G 4P73A 4BY7G 2CFMA 3CCMA 2WB1G 4JI6L 4JBMA 2MO1A 2JA6G 3AFQA 4QJFA 1UEBA 4LF7Q 3GO5A 4KI0A 1PFSA 1K9MC 2ASBA 5K36G 2UUCQ 4A3DH 4DV5L 2R92G 3ERSX 4GKKQ 4X62Q 4APVA 4H02A 1AE3A 3FKIH 3CC4A 1RL2A 3PSIA 4HIOA 4QY7A 3UE1A 4IOAA 1CKNA 1EYGA 3HOVH 2I5HA 1MJEA 4PG3A 5IP9G 3F8TA 4DR3Q 3KF6B 2OCEA 2K4KA 1PH5A 3RR5A 1M1KC 2A19A 3NELA 1PH1A 2PI2A 4JBWA 4JI7L 4LF6Q 1SLJA 4NXML 1EIFA 5GQOA 5GROA 1E7ZA 5FJ8G 3CW2C 2VY3A 4QL5A 1XMOQ 3J7A5 2AWOA 2K5NA 1PH2A 3GTJH 4DNIA 3S1RH 1QVFA 2NVQH 4GNXB 1K83H 4O0AA 1WFQA 4JV5Q 1KIXA 1VQGA 4LW1A 1S40A 1XJVA 4LF5L 1TWFH 1YHQA 1PH9A 3H3VH 2Q2UA 1X55A 1QZGA 4C2MH 1OXXK 1G291 4DR7L 1FVIA 2YU9H 1XPRA 2WP8J 1YITA 1IZ6A 1O7IA 3TRZA 2UUCL 1NTGA 3J7ZC 3K0XA 2XGTA 4JCVE 3A5ZB 4DV4Q 4K0KL 3OTOQ 1SFOH 4A93H 1WJJA 4X62L 4DV0Q 4DUZQ 4A3KG 4LFBQ 2D0PA 4UP7A 4IO9A 1B7YB 2V1CC 1C7YA 1K3RA 1WCMH 1QVGA 3H0GG 4OWXB 4ME3A 3GTMH 1J6QA 4A3MH 3CCJA 3BJUA 1JJCB 2CWAA 5IYDG 4DR3L 4GKJQ 3TQYA 2UXCQ 1KAWA 5M5YH 1I94Q 4LF6L 4TQUS 1K8AC 3PO3G 1EQQA 3CCRA 4P75A 4EX5A 4A3LH 1U5KA 4A76A 5AJ3Q 3PO2G 3BZKA 1QZHA 5C4XG 1XMOL 4IFDJ 1YHBA 5M5WH 3E0EA 1GD7A 4X65Q 2NVTH 5M5XH 3W5OA 1S72A 1BKBA 3U50C 3M3YH 2QGQA 3PF4A 4YY3Q 2HQLA 2LXJA 4WJ4A 1IBKQ 1Q8KA 2D0OA 3PUYA 3GDEA 3UDXA 3PIOA 1HNXQ 2JK8A 4BXXG 3J80i 1PYSB 1OXTA 1SROA 2K50A 2Q2HA 5IYCG 1IBMQ 3AEVA 2UXBQ 3NBHB 5C3EH 1Q81C 3KYHC 5C0XI 2K52A 4BBRH 4RMFA 4DAMA 2UXDQ 2B63H 3CMEA 4ALPA 2E2IH 2PNHA 3CPFA 2IT1A 1UE7A 3AYHB 4NPSA 4R4OA 4JI8Q 1V1QA 4PZ6A 3NEMA 4PZ8A 4BY1G 2VQFL 4DUYQ 1IBLQ 3GTGH 2IHFA 2RCNA 3FKIG 5GAEC 4DV4L 4HJ9A 1YJNA 3OTOL 4B3RQ 4JBJA 2VL6A 3I55A 3HOZH 4JOIC 4DV0L 4DUZL 1PH8A 1W3SA 4DKAC 3HOVG 4DV7Q 4P71A 2JQOA 3G71A 4QGUA 2IX1A 1RIPA 2A1AA 4AYBG 3S17H 2ALYB 3I4MH 1IXRA 1VQIA 1KRSA 4X64Q 4DR1Q 1G51A 4LFCQ 4LF9Q 4GN4B 2OWOA 4OWWB 4GKJL 2UXCL 4DR5Q 4LUZA 4JI1Q 4XIGS 4YHHQ 2I0QA 1L1OA 4P72A 1I94L 3OW2A 1LM0A 4JI3Q 2BA0A 4TVAB 4DPGA 1YBYA 1E24A 4PZ7A 5AJ3L 2AKWB 1K8GA 2VW9A 3T1HQ 3DLLA 1CSQA 1HZ9A 2XTIA 3MXNB 4KHPL 5IT9c 3GTLH 1PVOA 4MZ9A 5LMNQ 2OQ0A 5JJKA 4YY3L 4DR6Q 2C35B 2MO0A 1IBKL 3KDFA 1OTCA 3K81C 1I50H 3S16H 2NN6G 1HNXL 2VUMG 5FLXc 5C44H 4A75A 1VQAA 4JYAQ 4HJ7A 1VQ8A 1IBML 1FJGQ 3M4OH 4GN3B 2Q2TA 4GOPA 4KLKA 4GLXA 4FDBA 4IJHA 4JC0A 1PA6A 4GS3A 4IPDA 1VQKA 1LUZA 4A4IA 1G6PA 1L2FA 4JI8L 4O2DA 2A8VA 4WJ3M 4IPCA 3D0FA 5JJLA 1U0LA 1Q1BA 4YCWA 1W2BA 1QUQB 4POGA 1YIJA 3CF5A 4B3RL 1WCMG 2MQHA 1ASYA 5M3MH 2NVYH 4J15A 3UDFA 4NXNL 4HJ8A 4A3MG 3RZOH 1X54A 3W1BA 4OO1I 2ZM6Q 2RHSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1S E;  3KF6 A;  3F2B A;  1YNX A;  4X64 L;  1NE3 A;  4A3L G;  4DR5 L;  4JI1 L;  1C9O A;  1N36 Q;  2IY5 B;  4YHH L;  1J5E Q;  1JE5 A;  1X3G A;  1XPU A;  4BBS G;  4JI3 L;  1HNZ Q;  5C4X H;  2JE6 I;  5GAH C;  3S14 H;  1A0I A;  3HOX H;  2CCZ A;  3T1H L;  1S3O A;  2E5L Q;  1XMQ Q;  4YWL A;  1L0W A;  4A3I G;  4R4C A;  1XNR Q;  4X66 Q;  1P8L A;  4GNX A;  2UUA Q;  5ELO A;  1H95 A;  2R7D A;  4LUV A;  1JMC A;  2N78 A;  5LMN L;  3S2D H;  3UE0 A;  1AE2 A;  4A3B G;  5ELN A;  2QA4 A;  4DR6 L;  5DLQ E;  4YCV A;  3TS2 A;  2KEN A;  1B70 B;  1FL0 A;  2UUB Q;  5GAD C;  3J81 j;  4JYA L;  3J81 c;  1N32 Q;  3J80 c;  1MIU A;  4XTC S;  1Q86 C;  5IP7 H;  5LMU Q;  1FJG L;  2N3S A;  4A3J G;  1KD1 C;  2KBN A;  2BH2 A;  3STB D;  2WAQ E;  3E9H A;  3K7A H;  2Y0S G;  3KJO A;  4LF7 L;  3HOW H;  4JI4 Q;  2NVX H;  4GN5 A;  3HFZ B;  1YJ9 A;  1VQE A;  3NEN A;  4DAY B;  2HT1 A;  2FXQ A;  3STB C;  3CCS A;  3L0O A;  4HID A;  3HOY H;  4DK6 C;  4GKK L;  1Y1V H;  1HR0 Q;  3LGJ A;  3A5U A;  2LSS A;  2ZM6 L;  3CXC A;  2JA5 H;  4LNQ A;  2JEA I;  1VQP A;  4IPG A;  3AQQ A;  2NZO A;  2PMZ E;  4IPH A;  3H15 A;  3D31 A;  4DV1 Q;  4L5T A;  3G4S A;  1N36 L;  2K14 A;  3TRE A;  4C3J H;  1J5E L;  5FLM H;  3K8A A;  1HNZ L;  4Y52 H;  3IRB A;  4C3H H;  1D7Q A;  3RZD H;  2ZTD A;  2EQS A;  1PH6 A;  5J3B A;  1KHI A;  2Z6K A;  4JI5 Q;  2JA7 H;  4BY7 H;  1A63 A;  1CKM A;  2VS1 A;  1VCI A;  3JC6 6;  1DGS A;  3F2D A;  1XMQ L;  2ES2 A;  1XNR L;  4X66 L;  4QIW E;  1Q82 C;  4OWT B;  2Z0S A;  2JA6 H;  3ICE A;  2YV5 A;  3G48 A;  4JI0 Q;  5C44 G;  1SN8 A;  2R93 G;  2UUB L;  2JA8 G;  3I4N H;  4JV5 L;  2KCT A;  2PQA A;  3KOJ A;  3AFP A;  2F4V Q;  5LMU L;  1HZB A;  3J81 i;  2R92 H;  4AYB E;  2CKZ B;  2AHO B;  1TWC H;  3GTK H;  2VZA A;  2PI2 E;  1I6H H;  4A3D G;  1GKH A;  4B3T Q;  4QQB X;  4JI4 L;  1M90 C;  2I5M X;  1YVC A;  5IP9 H;  5M3M G;  1EOV A;  1XPO A;  4GLV B;  5LMN W;  3PCO B;  1V9P A;  4DV3 Q;  1VQO A;  5IY0 A;  1FGU A;  1HJP A;  1LYL A;  1YJW A;  2L15 A;  2YYZ A;  1GO3 E;  1HR0 L;  1VQ9 A;  5FJ8 H;  4LFB L;  5JEA J;  1UWV A;  3RNU A;  1NY4 A;  4JG2 A;  2H5X A;  1YEZ A;  3CCU A;  5JJI A;  3HKZ G;  1JT8 A;  2KHI A;  1Z47 A;  2YTY A;  2ZTC A;  4EQ5 A;  2R7F A;  1HH2 P;  2RHQ B;  4DV1 L;  1CKO A;  1PHJ A;  1PYB A;  1TWH H;  3DM3 A;  1VQ7 A;  1C0A A;  1Y14 B;  3EN2 A;  3S1M H;  1N33 Q;  3HOX G;  1VQH A;  1Q7Y C;  1WI5 A;  1IYJ B;  1VQ6 A;  2WB1 E;  1Q46 A;  4HIM A;  5IYB H;  4NB3 A;  3JAM c;  2KHJ A;  2GVA A;  3CD6 A;  2B3G A;  2HHH Q;  2YTX A;  3PUX A;  3CCL A;  2HIX A;  4C3I H;  1PH7 A;  5IWA Q;  1PV4 A;  4JI0 L;  4X65 L;  3CCQ A;  2AWN A;  3I7F A;  2N49 A;  1OXV A;  4DK3 C;  5IP7 G;  5M3F H;  1KQS A;  4L5S A;  4L5R C;  1EUJ A;  2F4V L;  4DR4 Q;  1YHA A;  1OXU A;  1JJ2 A;  4A3K H;  2UXB L;  4POF A;  3EIV A;  1QVC A;  4OXP A;  1E3P A;  2WFW A;  1VQD A;  5EAY A;  3HOU H;  2UXD L;  4LF8 Q;  3H0G H;  4B3T L;  1BVS A;  1QUQ A;  3T1Y Q;  4A3G H;  4A93 G;  1IBL L;  1TXY A;  3A0J A;  4A3E H;  3S2H H;  4DUY L;  1VQJ A;  2ID0 A;  2E8G A;  4R4Q A;  1YI2 A;  1XTD A;  3TEH B;  1ASZ A;  2OTJ A;  3KF8 B;  1E1O A;  1HZA A;  3PUZ A;  1P16 A;  2DUD A;  3PO2 H;  3S15 H;  3F1Z A;  4DV7 L;  4OO1 G;  2VQE Q;  2R7Z H;  2K5V A;  4IFD I;  3PF5 A;  4LF9 L;  2F52 A;  4LFC L;  4LUO A;  4DR1 L;  4R1J A;  4YCU A;  4LF5 Q;  1L1O C;  1N33 L;  1WYD A;  3KDF B;  5JEA G;  1HNW Q;  3ZJY C;  1VQL A;  2B29 A;  3CPW A;  1EQR A;  1V43 A;  1Q12 A;  4BXX H;  4YWM A;  5IYC H;  1EWI A;  4GOP B;  3U4V A;  1OXS C;  2Y0S E;  2HHH L;  3S1Q H;  4HIK A;  3KLW A;  3JAM i;  4HJA A;  1R9T H;  4A3C H;  5IWA L;  3I4N G;  2HIV A;  1XNQ Q;  2K75 A;  2GVB A;  1HR0 W;  3CC2 A;  4K0K Q;  4R4T A;  1I5F A;  1CSP A;  1BBU A;  3B6Y A;  1WOC A;  4DV6 Q;  1VQM A;  1MKH A;  5IE8 A;  3UDI A;  4BY1 H;  1NMG A;  5C0X J;  3WWV A;  5C3E G;  1GVP A;  4DR4 L;  2OQK A;  4BBR G;  3CC7 A;  2OTL A;  4GOP C;  2IX0 A;  1N34 Q;  1Y1W H;  2B63 G;  1KXL A;  3S24 A;  4LF8 L;  1X65 A;  1VQ4 A;  2ZTE A;  3T1Y L;  3M85 A;  1CKN B;  2UU9 Q;  2JA9 A;  1TWG H;  1KRT A;  3HOZ G;  4A3F H;  3PV0 A;  1A8V A;  3CP0 A;  1VQC A;  3RLF A;  1PH3 A;  2K5H A;  3PGZ A;  1VQB A;  1NJI C;  2JEB I;  3U58 A;  2KCM A;  3I4M G;  1D8L A;  2E2H H;  1X56 A;  2AMC B;  4LWC A;  2VQE L;  1GM5 A;  1VQF A;  4B3M Q;  4LF4 Q;  3RLN A;  3RN5 A;  4BBS H;  4IJL A;  3ULL A;  1CUK A;  1X3F A;  1X3E A;  5HY6 A;  4DV2 Q;  4DR2 Q;  3L7Z C;  3CCE A;  4B3S Q;  4OX9 Q;  3BZC A;  4JI2 Q;  3A74 A;  5BR8 Q;  2F3I A;  5IYB G;  3GTP H;  3K7U C;  4BA2 I;  3PUV A;  2ZJR A;  1SR3 A;  1HNW L;  1JB7 A;  4X6A H;  2JJQ A;  4UPA A;  1IL2 A;  2VUM H;  2ZJQ A;  2BH8 A;  4AIM A;  3HKS A;  2E5L L;  5M3F G;  3Q8D A;  3SGI A;  2MNA A;  3W1G A;  4GNX C;  2VQF Q;  1X9N A;  1N8R C;  1XNQ L;  3GTO H;  2UUA L;  4JBK A;  4YWK A;  1B8A A;  3E9I A;  2VNU D;  4DV6 L;  2CWP A;  4UY8 C;  1N32 L;  4JOI A;  1SE8 A;  2I5L X;  4AQY Q;  1K0R A;  4LFA Q;  3HOU G;  2DGY A;  3U4Z A;  1N34 L;  1NMF A;  3HKZ E;  4A3G G;  2LXK A;  3I56 A;  3ULP A;  4A3E G;  1X6O A;  2WAQ G;  3TS0 A;  5C0X G;  3VDY A;  1KC8 C;  2MFI A;  2UU9 L;  1MJC A;  4OON A;  3F2C A;  2R7Z G;  1UE5 A;  1I3Q H;  5C4J H;  4KHP Q;  4B3M L;  4LF4 L;  1NBW A;  4A3I H;  4UP9 A;  4DV2 L;  1VS0 A;  4DR2 L;  4OX9 L;  4B3S L;  3EBE A;  4KHZ A;  4HJ5 A;  5BR8 L;  4JI2 L;  1JJG A;  4A3B H;  3K80 C;  3MEF A;  4MTN A;  3KJP A;  1UE1 A;  1Q1E A;  2PQA B;  4A3C G;  3CQZ H;  1K73 C;  1AH9 A;  1T9H A;  3GTQ H;  2Z6K C;  4JI6 Q;  4Y7N H;  3I4O A;  2E2J H;  3KFU A;  4JI5 L;  2D62 A;  4A3J H;  1KL9 A;  2YTV A;  3CMA A;  1TWA H;  3ER0 A;  1PH4 A;  4L5Q A;  3OYY A;  2NZH A;  1A62 A;  2Q2I A;  4AH6 A;  1LTL A;  3FP9 A;  4DV5 Q;  1E1T A;  1UE6 A;  1Y1W G;  3CAM A;  4NXN Q;  4AQY L;  3RLO A;  3L2P A;  4LFA L;  3UDG A;  1N9W A;  1EIY B;  2CQO A;  3GD7 A;  3BU2 A;  3FHW A;  3M9B A;  3HOW G;  4IOC A;  4A3F G;  4DR7 Q;  4MNO A;  3M4Q A;  4R4I A;  1VQN A;  1BBW A;  3RN2 A;  3HOY G;  2R6G A;  4JI7 Q;  5E7N A;  2ZJP A;  1SMX A;  2IHE A;  4NXM Q;  5IYD H;  1E22 A;  1Y1V G;  1EFW A;  1L1O B;  3ULJ A;  2N8N A;  1YZ6 A;  2EIF A;  3I2Z A;  3PUW A;  5GAG C;  2EXD A;  4BA1 I;  4DV3 L;  1HZC A;  3M4P A;  4RG1 A;  2QEX A;  2JA5 G;  3PO3 H;  1VQ5 A;  2RF4 A;  3CCV A;  1SRU A;  4GLA C;  1Z9F A;  3H3V I;  3M7N A;  2GN5 A;  5FLM G;  2NN6 I;  2ATW A;  4P74 A;  3S1N H;  4IFD G;  2BA1 A;  4UP8 A;  3G6E A;  2R93 H;  2JA8 H;  5HGQ A;  3PIP A;  4PMW A;  2JA7 G;  4P73 A;  4BY7 G;  2CFM A;  3CCM A;  2WB1 G;  4JI6 L;  4JBM A;  2MO1 A;  2JA6 G;  3AFQ A;  4QJF A;  1UEB A;  4LF7 Q;  3GO5 A;  4KI0 A;  1PFS A;  1K9M C;  2ASB A;  5K36 G;  2UUC Q;  4A3D H;  4DV5 L;  2R92 G;  3ERS X;  4GKK Q;  4X62 Q;  4APV A;  4H02 A;  1AE3 A;  3FKI H;  3CC4 A;  1RL2 A;  3PSI A;  4HIO A;  4QY7 A;  3UE1 A;  4IOA A;  1CKN A;  1EYG A;  3HOV H;  2I5H A;  1MJE A;  4PG3 A;  5IP9 G;  3F8T A;  4DR3 Q;  3KF6 B;  2OCE A;  2K4K A;  1PH5 A;  3RR5 A;  1M1K C;  2A19 A;  3NEL A;  1PH1 A;  2PI2 A;  4JBW A;  4JI7 L;  4LF6 Q;  1SLJ A;  4NXM L;  1EIF A;  5GQO A;  5GRO A;  1E7Z A;  5FJ8 G;  3CW2 C;  2VY3 A;  4QL5 A;  1XMO Q;  3J7A 5;  2AWO A;  2K5N A;  1PH2 A;  3GTJ H;  4DNI A;  3S1R H;  1QVF A;  2NVQ H;  4GNX B;  1K83 H;  4O0A A;  1WFQ A;  4JV5 Q;  1KIX A;  1VQG A;  4LW1 A;  1S40 A;  1XJV A;  4LF5 L;  1TWF H;  1YHQ A;  1PH9 A;  3H3V H;  2Q2U A;  1X55 A;  1QZG A;  4C2M H;  1OXX K;  1G29 1;  4DR7 L;  1FVI A;  2YU9 H;  1XPR A;  2WP8 J;  1YIT A;  1IZ6 A;  1O7I A;  3TRZ A;  2UUC L;  1NTG A;  3J7Z C;  3K0X A;  2XGT A;  4JCV E;  3A5Z B;  4DV4 Q;  4K0K L;  3OTO Q;  1SFO H;  4A93 H;  1WJJ A;  4X62 L;  4DV0 Q;  4DUZ Q;  4A3K G;  4LFB Q;  2D0P A;  4UP7 A;  4IO9 A;  1B7Y B;  2V1C C;  1C7Y A;  1K3R A;  1WCM H;  1QVG A;  3H0G G;  4OWX B;  4ME3 A;  3GTM H;  1J6Q A;  4A3M H;  3CCJ A;  3BJU A;  1JJC B;  2CWA A;  5IYD G;  4DR3 L;  4GKJ Q;  3TQY A;  2UXC Q;  1KAW A;  5M5Y H;  1I94 Q;  4LF6 L;  4TQU S;  1K8A C;  3PO3 G;  1EQQ A;  3CCR A;  4P75 A;  4EX5 A;  4A3L H;  1U5K A;  4A76 A;  5AJ3 Q;  3PO2 G;  3BZK A;  1QZH A;  5C4X G;  1XMO L;  4IFD J;  1YHB A;  5M5W H;  3E0E A;  1GD7 A;  4X65 Q;  2NVT H;  5M5X H;  3W5O A;  1S72 A;  1BKB A;  3U50 C;  3M3Y H;  2QGQ A;  3PF4 A;  4YY3 Q;  2HQL A;  2LXJ A;  4WJ4 A;  1IBK Q;  1Q8K A;  2D0O A;  3PUY A;  3GDE A;  3UDX A;  3PIO A;  1HNX Q;  2JK8 A;  4BXX G;  3J80 i;  1PYS B;  1OXT A;  1SRO A;  2K50 A;  2Q2H A;  5IYC G;  1IBM Q;  3AEV A;  2UXB Q;  3NBH B;  5C3E H;  1Q81 C;  3KYH C;  5C0X I;  2K52 A;  4BBR H;  4RMF A;  4DAM A;  2UXD Q;  2B63 H;  3CME A;  4ALP A;  2E2I H;  2PNH A;  3CPF A;  2IT1 A;  1UE7 A;  3AYH B;  4NPS A;  4R4O A;  4JI8 Q;  1V1Q A;  4PZ6 A;  3NEM A;  4PZ8 A;  4BY1 G;  2VQF L;  4DUY Q;  1IBL Q;  3GTG H;  2IHF A;  2RCN A;  3FKI G;  5GAE C;  4DV4 L;  4HJ9 A;  1YJN A;  3OTO L;  4B3R Q;  4JBJ A;  2VL6 A;  3I55 A;  3HOZ H;  4JOI C;  4DV0 L;  4DUZ L;  1PH8 A;  1W3S A;  4DKA C;  3HOV G;  4DV7 Q;  4P71 A;  2JQO A;  3G71 A;  4QGU A;  2IX1 A;  1RIP A;  2A1A A;  4AYB G;  3S17 H;  2ALY B;  3I4M H;  1IXR A;  1VQI A;  1KRS A;  4X64 Q;  4DR1 Q;  1G51 A;  4LFC Q;  4LF9 Q;  4GN4 B;  2OWO A;  4OWW B;  4GKJ L;  2UXC L;  4DR5 Q;  4LUZ A;  4JI1 Q;  4XIG S;  4YHH Q;  2I0Q A;  1L1O A;  4P72 A;  1I94 L;  3OW2 A;  1LM0 A;  4JI3 Q;  2BA0 A;  4TVA B;  4DPG A;  1YBY A;  1E24 A;  4PZ7 A;  5AJ3 L;  2AKW B;  1K8G A;  2VW9 A;  3T1H Q;  3DLL A;  1CSQ A;  1HZ9 A;  2XTI A;  3MXN B;  4KHP L;  5IT9 c;  3GTL H;  1PVO A;  4MZ9 A;  5LMN Q;  2OQ0 A;  5JJK A;  4YY3 L;  4DR6 Q;  2C35 B;  2MO0 A;  1IBK L;  3KDF A;  1OTC A;  3K81 C;  1I50 H;  3S16 H;  2NN6 G;  1HNX L;  2VUM G;  5FLX c;  5C44 H;  4A75 A;  1VQA A;  4JYA Q;  4HJ7 A;  1VQ8 A;  1IBM L;  1FJG Q;  3M4O H;  4GN3 B;  2Q2T A;  4GOP A;  4KLK A;  4GLX A;  4FDB A;  4IJH A;  4JC0 A;  1PA6 A;  4GS3 A;  4IPD A;  1VQK A;  1LUZ A;  4A4I A;  1G6P A;  1L2F A;  4JI8 L;  4O2D A;  2A8V A;  4WJ3 M;  4IPC A;  3D0F A;  5JJL A;  1U0L A;  1Q1B A;  4YCW A;  1W2B A;  1QUQ B;  4POG A;  1YIJ A;  3CF5 A;  4B3R L;  1WCM G;  2MQH A;  1ASY A;  5M3M H;  2NVY H;  4J15 A;  3UDF A;  4NXN L;  4HJ8 A;  4A3M G;  3RZO H;  1X54 A;  3W1B A;  4OO1 I;  2ZM6 Q;  2RHS B; 
#chains in the Genus database with same CATH topology
 3KF6 A;  3F2B A;  3RZO B;  4YIJ A;  5F2D A;  2EY6 A;  4H44 C;  3NTH A;  4DR5 L;  3R3O A;  1N36 Q;  5FLX E;  3NE5 B;  1XPU A;  2JE6 I;  4IZ8 A;  3VR3 A;  1DD2 A;  1ICW A;  3HOX H;  2EZV A;  4L8J A;  1B9M A;  4A3I G;  2A6E D;  1H95 A;  2UUA Q;  4RCN A;  2RSN A;  1G2T A;  1AE2 A;  3NP8 A;  2EY2 A;  4HSV A;  4YCV A;  2UUB Q;  1FL0 A;  1V1P A;  3S2D B;  1N32 Q;  2RDG A;  3J80 c;  5KNC A;  4XTC S;  4CJ0 B;  5LMU Q;  2N3S A;  1SNM A;  2B39 A;  4A3J G;  1KD1 C;  4QMG A;  2B2U C;  3I91 A;  4LF7 L;  3IFD A;  4GN5 A;  3E6Z X;  3HFZ B;  3VYU A;  3NEN A;  3HOW B;  3STB C;  3HRZ C;  4HID A;  3FPP A;  5KND A;  4DK6 C;  2HCC A;  5T1G A;  3LGJ A;  3HOY B;  2ZM6 L;  2F0F A;  4LNQ A;  1EZ6 A;  1VQP A;  4IPG A;  1Y1V B;  4IN3 A;  1BOS A;  2PMZ E;  1KDA A;  3WOE A;  3H15 A;  4DV1 Q;  2JA5 B;  5DAU A;  4C3J H;  1SNO A;  3GTP B;  4XQQ A;  2ZTD A;  2EQS A;  3MEH A;  5LL6 X;  2JA7 H;  3SK5 A;  3ICE A;  4QIW E;  3FEW X;  3G48 A;  1TKW B;  2WKC A;  1WD1 A;  3OIQ A;  1SN8 A;  2R93 G;  3DXJ C;  2MJ8 A;  4CKB A;  2AHO B;  3GTK H;  3I4L A;  2R92 B;  3J7Y W;  2FIN B;  4JI4 L;  4QQB X;  1JOR A;  1QNU A;  4RKL A;  3PCO B;  1V9P A;  5IY0 A;  1UUP A;  2JN4 A;  3DEO A;  1HFN A;  5JEA J;  3RNU A;  3AMU A;  1H9R A;  3ERQ A;  4KV6 A;  5C4X G;  1PYB A;  1TWH H;  1Y14 B;  4ABN A;  3ERO A;  1WTH A;  2Q8T A;  1VQ6 A;  2WB1 E;  1Q46 A;  4HIM A;  3V2T A;  3MXN A;  2KHJ A;  1CTM A;  2OT2 A;  3VYR A;  2B3G A;  2HHH Q;  5ELC A;  3NSW A;  1JWU D;  2N49 A;  5IP7 G;  4UHV A;  1IKL A;  1WTW A;  3QR8 A;  2Q8I B;  1EUJ A;  1TII D;  2XWB B;  5M3F B;  4MTK A;  2LS0 1;  1IW7 C;  4POF A;  3H91 A;  3EIV A;  1A3T A;  2RQX A;  2WFW A;  1VQD A;  4A3K B;  4LF8 Q;  1MHW C;  4B3T L;  1BVS A;  1QUQ A;  1DM0 B;  1TXY A;  1GUW A;  3S2H H;  2WAC A;  4DUY L;  1YI2 A;  1JC7 A;  1XTD A;  1B9N A;  2OTJ A;  1BUV T;  4JPB W;  1CA5 A;  5ISR A;  3PO2 B;  4LF9 L;  2F52 A;  4R1J A;  4YCU A;  1LT5 D;  5FO7 B;  4FF4 A;  1ESR A;  2G5D A;  5ELE A;  4CDD C;  2B29 A;  1V43 A;  3OPO A;  2QKI C;  1OXS C;  4DR7 Q;  3S1Q H;  4HIK A;  4A3C H;  3I73 A;  5IWA L;  2IX3 A;  4ZRZ A;  4K2K A;  4I65 A;  3VYT A;  1HR0 W;  3CC2 A;  3IKJ A;  4R4T A;  1I5F A;  1VQM A;  1WOC A;  4DV6 Q;  1MKH A;  5IE8 A;  4UDU C;  3J80 L;  4BY1 H;  3WWV A;  4UAI A;  5C3E G;  1E2V A;  5COR A;  4BBR G;  2IX0 A;  1Y1W H;  3LX0 A;  2B2W A;  1GJX A;  3FMC A;  1JB3 A;  4Q0F A;  2L9H A;  4MHE A;  1A8V A;  3FPU B;  3RLF A;  1XXG A;  3BVG A;  4FXG C;  1KTK A;  1O7Z A;  2K5H A;  4A3F B;  3AB9 A;  3U58 A;  3I4M G;  2E2H H;  3OW7 A;  1GM5 A;  4V0B A;  1SND A;  2NUC A;  1BCP F;  1CUK A;  4DR2 Q;  1GXD C;  3OSO A;  2F4I A;  2RVL A;  3CCE A;  3GTP H;  2F3I A;  2F3W A;  2PYK A;  3A8K E;  4ZUJ A;  5C6A A;  4BA2 I;  4KKS A;  1STH A;  1UAP A;  1XWE A;  3GV3 A;  1HNW L;  3K5M A;  1JB7 A;  4UPA A;  2VUM H;  4FYD A;  1O80 A;  1ESF A;  3HKS A;  3T51 B;  2NZ1 D;  5M3F G;  1SMY D;  2VNU D;  3C3L A;  2CWP A;  2Z9H A;  4LFA Q;  4HTH A;  1PMR A;  3ULP A;  4A3E G;  3MZ5 A;  5C0X G;  1PTO D;  3VA5 A;  4A3M B;  3DWP A;  5FO9 B;  2RSO A;  1T5X D;  5I9O A;  1MJC A;  1STG A;  5DEH A;  4KHP Q;  4B3M L;  2DNE A;  5C4J B;  1I3Q B;  4K2L A;  5KEE A;  1VS0 A;  4DV2 L;  2F0G A;  4KHZ A;  4HJ5 A;  3M3Y B;  5IGC A;  2WIN B;  2WKD A;  3I8Z A;  3MEF A;  1BXT A;  4NMZ A;  1UE1 A;  2PQA B;  1K73 C;  1AH9 A;  5G3L F;  4A3B B;  4ZUI A;  3KFU A;  2WII B;  4JI5 L;  3CQZ B;  4DXF A;  1TWA H;  2A5H A;  2E2J B;  4K6D A;  2LFN A;  2O5J C;  4DV5 Q;  1D1K A;  1SNQ A;  1EQT A;  4QB4 A;  1J8I A;  4NP5 A;  5KGU A;  4NXN Q;  4AQY L;  1V8Q A;  2N88 A;  1EIY B;  3NWS A;  3FHW A;  2OF1 A;  1ROD A;  1CI3 M;  3OWE B;  4A3F G;  4MNO A;  4R4I A;  1SJE D;  1R4P B;  4JI7 Q;  5E7N A;  1E22 A;  1JQY D;  3BDL A;  4IAL A;  1EFW A;  3PUW A;  1YZ6 A;  3I2Z A;  5GAG C;  4G7Z C;  2EXD A;  4DV3 L;  3TSS A;  1AEX A;  1DON A;  3C1F A;  1VQ5 A;  1SEB D;  2F0D A;  4RGT A;  3H3V I;  2ATW A;  4P74 A;  4IFD G;  3I3C A;  5DM6 3;  2K5D A;  2JA8 H;  3RMH A;  5HGQ A;  3N6R A;  3CCM A;  3EJI A;  4JI6 L;  3Q6S A;  3P1H A;  1HTL D;  2QIL A;  4IUU A;  4LF7 Q;  2B2U A;  1PFS A;  1K9M C;  1RF2 D;  3CHB D;  4CDE C;  1WD0 A;  2QEJ C;  2K05 A;  3N52 A;  3J81 L;  4A3D B;  5M3M B;  1RL2 A;  1LAB A;  1EY0 A;  3LWU A;  5K5P A;  5I2Y A;  5BN4 A;  3F8T A;  2F0S A;  1CHQ D;  3RR5 A;  2A19 A;  3I72 A;  2PI2 A;  1SLJ A;  3HKZ B;  1EIF A;  5KYL A;  3CW2 C;  2AWO A;  3T53 B;  1QVF A;  1ONL A;  5KRU A;  1KIX A;  5JJZ A;  2F0P A;  4LF5 L;  1TWF H;  1STB A;  2F1M A;  2Q2U A;  1STN A;  4C3I G;  1OXX K;  3CRL C;  2WP8 J;  2L5T A;  2Z4I A;  1EY9 A;  4C2M B;  2UUC L;  1NTG A;  4K0K L;  4JCV E;  2JSO A;  4ZAI A;  3H94 A;  1PTO H;  4X62 L;  4DV0 Q;  1PRT C;  1EY8 A;  4OWX B;  4ME3 A;  4A3M H;  3CCJ A;  3NUC A;  5IYD G;  1WCM B;  4DR3 L;  4GKJ Q;  2HD3 A;  1KAW A;  1I94 Q;  2VB2 X;  3CCR A;  4A3L H;  3WDN A;  5JEA H;  1QZH A;  1EY5 A;  3U9O A;  1XMO L;  3I90 A;  1K3B C;  1SYG A;  3U50 C;  3M3Y H;  2QGQ A;  2HQL A;  1O7L A;  1H9K A;  1G8Z D;  3GDE A;  1QIL A;  3I4N B;  4BXX G;  1SRO A;  1UEA B;  3BDC A;  5CV6 A;  3M4Y A;  4NDX A;  5C0X I;  2K52 A;  3JAM L;  1S5D D;  1CA6 A;  1BDO A;  4N8X 1;  1WTX A;  3DMU A;  1UE7 A;  1EOT A;  2PW5 A;  1SYD A;  4DUY Q;  2IHF A;  2RCN A;  4HJ9 A;  3OTO L;  3D8G A;  4JBJ A;  5COY A;  3TBI B;  1HUN A;  3GTG B;  3FRP B;  1W6K A;  4P71 A;  3G71 A;  3HOZ B;  2KED A;  4LF9 Q;  4X64 Q;  2I07 B;  4PV1 C;  3OW2 A;  4JI3 Q;  2BA0 A;  5AJ3 L;  1D5M C;  3KF8 A;  1K8G A;  1SYC A;  1HZ9 A;  2NB0 A;  5IT9 c;  3GTL H;  1PZJ D;  1OTC A;  2AQ1 B;  1BBX C;  2NN6 G;  4X3T A;  4JYA Q;  5FLX c;  1KNE A;  3DHQ A;  1FJG Q;  4GN3 B;  1FD7 D;  4IUT A;  4EQP A;  3SE0 A;  3MXU A;  3CU7 A;  5CMD A;  4DGZ A;  4IPD A;  3TP8 A;  1QB5 D;  1G6P A;  1L2F A;  4JI8 L;  2HDM A;  1U0L A;  4A3G B;  4HED A;  4POG A;  2CW0 C;  3TZD A;  1WCM G;  3U9S A;  1DOM A;  1ASY A;  5M3M H;  4R8I A;  4HJ8 A;  1ZEQ X;  3K5L A;  1TY2 A;  1B53 A;  1NE3 A;  4JI1 L;  4YHH L;  1J5E Q;  1X3G A;  2K1B A;  2R61 A;  3OHX C;  4Z9C B;  3TDQ A;  3C2P A;  3S14 H;  1IYV A;  1S3O A;  2L12 A;  1XMQ Q;  4YWL A;  1F9S A;  2D9U A;  3QB3 A;  1SSO A;  4X66 Q;  4FXK C;  5ELO A;  2NWG A;  3MHB A;  2R7D A;  3HOX B;  1AW7 A;  4DR6 L;  1B70 B;  2J4X A;  2A6E C;  5GAD C;  1IKM A;  5CGK A;  1B44 D;  4IUP A;  4K6L A;  1PRT B;  4DAP A;  3KJO A;  5KYI A;  5LL6 S;  4S3S A;  1Q8I A;  2A68 D;  1VQE A;  4DAY B;  1FGB D;  2FXQ A;  2LY7 A;  4EQO A;  3G6J B;  1WTQ A;  1F77 A;  1Y8O B;  2FMC A;  2LSS A;  2JEA I;  1RTN A;  4FO2 A;  3AQQ A;  4IPH A;  4BBS B;  2K14 A;  3QG1 A;  3K8A A;  3K57 A;  1HNZ L;  3IRB A;  4U67 3;  3X3N A;  4C3H H;  3RZD H;  1D7Q A;  3GQB A;  2F0W A;  5J3B A;  1EQV A;  1KHI A;  4JI5 Q;  4BY7 H;  1SXT A;  4LK1 C;  1DGS A;  2ES2 A;  1XNR L;  4B08 A;  2JA6 H;  2JA7 B;  2YV5 A;  3HZX A;  1S4Z A;  3T56 B;  2CHB D;  3I4N H;  2DN8 A;  2HDL A;  1G91 A;  2KCT A;  5IIF A;  2F4V Q;  3H3V C;  4HR7 B;  1HZB A;  2VZA A;  2PI2 E;  3FDT A;  1I6H H;  3GTK B;  5C3W A;  1GKH A;  1LT4 D;  3UI2 A;  1IHZ A;  3HP3 A;  1YVC A;  5T1I A;  5LMN W;  4DV3 Q;  1HJP A;  3SR1 A;  1GO3 E;  1HR0 L;  2XRS D;  5FJ8 H;  4LFB L;  3P20 A;  1UWV A;  1JT8 A;  1NY4 A;  2RCF A;  5JJI A;  2D2C C;  2KHI A;  1PHJ A;  1C0A A;  1CKO A;  3T13 A;  1VQ7 A;  1N33 Q;  3HOX G;  1TWH B;  1E2W A;  4NB3 A;  1I4H A;  2GVA A;  3GTQ B;  5IT9 L;  1QNK A;  4JI0 L;  4X65 L;  3CCQ A;  4L5S A;  2BCO A;  1HRJ A;  1QE6 A;  2N55 A;  1YHA A;  1QVC A;  1LV9 A;  3HGB A;  2HQE A;  3H0G H;  3T1Y Q;  4A3G H;  4A93 G;  2MGS A;  2WAQ B;  3S2H B;  4HCE A;  1E1O A;  1P16 A;  2DUD A;  3S15 H;  1A3U A;  1IL8 A;  1C4Q A;  4DV7 L;  1PRT F;  2R7Z H;  4C3J G;  3R2I A;  4LUO A;  3ND8 A;  1EEF D;  4LF5 Q;  1WYD A;  3KDF B;  2VXW A;  2OXP A;  5IYC H;  4DXG A;  4IUR A;  4GOP B;  3U4V A;  1SDF A;  2HIV A;  1S5F D;  2CH4 A;  3D3R A;  3S1Q B;  2R3Z A;  4K0K Q;  1CSP A;  2K33 A;  3UDI A;  2K04 A;  5C0X J;  3G7L A;  1AFP A;  1CHP D;  4DR4 L;  5J39 A;  1LTS D;  2M2L A;  4BY1 B;  2B63 G;  2X6L A;  3S24 A;  5JVG 3;  3DUZ A;  1Y1W B;  1X65 A;  2IW3 A;  2ZTE A;  1YNJ D;  4DAY A;  1CKN B;  1NR2 A;  1STE A;  4CHT B;  5KNB A;  3ONA B;  4WFN 3;  2DJF C;  3PV0 A;  4J6H A;  2KUM A;  3CP0 A;  4ZYS A;  1B50 A;  2H1E A;  2C9O A;  3PGZ A;  3SK8 A;  1D8L A;  3MVV A;  1SNP A;  1SJH D;  1X56 A;  2VQE L;  4LF4 Q;  1VQF A;  4BBS H;  2D5D A;  1X3F A;  5HY6 A;  4OX9 Q;  1XX8 A;  2E2H B;  3BZC A;  3A74 A;  5BR8 Q;  3PUV A;  3TN2 A;  4X6A H;  2BDN A;  1IL2 A;  2ZJQ A;  2B8F A;  4AIM A;  2VUM B;  4GNX C;  5EPL A;  5I4D A;  3W1G A;  1XNQ L;  1I4P A;  4YWK A;  3E9I A;  2KHS A;  4QUF A;  3NWT A;  5E1F A;  1U4M A;  4NKL A;  3NBH A;  1SMY C;  4IUN A;  3EFX D;  3U4Z A;  1N34 L;  1NMF A;  3HKZ E;  3MA2 B;  4OL7 A;  4B9W A;  3OOC A;  3I56 A;  4EGV A;  1X6O A;  2WAQ G;  1KC8 C;  4K5W A;  3DM1 A;  5J22 A;  2F0T A;  2UU9 L;  4KD3 A;  2PW7 A;  4DK1 A;  1WTR A;  1PTO C;  1UE5 A;  1DCZ A;  1J9O A;  4A3I H;  1HPC A;  4B3S L;  2AUK A;  3EBE A;  1JWS D;  4JI2 L;  4PMB A;  3KJP A;  1Q1E A;  4EQN A;  4A3C G;  1T9H A;  3GTQ H;  2KJX A;  4A3J H;  1KL9 A;  2PO4 A;  1BCP D;  1PH4 A;  2E2I B;  3OYY A;  1KLU D;  2F0U A;  1SFO B;  5C5L A;  2NZH A;  1A62 A;  1TWA B;  1E0B A;  4AH6 A;  1LTL A;  1Y1W G;  4TKO B;  1PZK D;  2Y0S B;  3L2P A;  3UDG A;  4XDX A;  2P5Z X;  4ID6 A;  1E2Z A;  4O42 A;  3BU2 A;  3M9B A;  4G7O C;  3HOW G;  4IOC A;  1RDP D;  4CBV A;  4X3K A;  3M4Q A;  1BBW A;  3RN2 A;  1LTA D;  3HOY G;  2DJG C;  2ZJP A;  1Y1V G;  3TP6 A;  1GHJ A;  3MXG A;  2JA5 G;  1LTR D;  4RG1 A;  2F0O A;  2KVM A;  5M9O A;  1VF7 A;  1B3Q A;  2RF4 A;  1SRU A;  1Z9F A;  3M7N A;  5FLM G;  2O5I C;  3S1N H;  5ELD A;  2R93 H;  3S16 B;  1I6V C;  2JA8 B;  3A56 A;  3AFQ A;  3H09 A;  3GO5 A;  1NR4 A;  3LWE A;  2ZXO A;  2EE1 A;  1Z7T A;  4LAA A;  2B8G A;  2R92 G;  3FVQ A;  3IL8 A;  4APV A;  1AE3 A;  3CC4 A;  5CBA E;  1DYQ A;  2MUY A;  2NVY B;  3TP5 A;  3GTM B;  4IOA A;  1HTP A;  1CKN A;  1MD2 D;  5C5M A;  2I5H A;  3HOV H;  1F2Y A;  5IP9 G;  4H7B A;  1PH5 A;  4FXD A;  1NAP A;  2K4K A;  4JBW A;  4NXM L;  3J7A V;  5GQO A;  2F0H A;  4DNR B;  1E7Z A;  5HUR A;  2A73 B;  2B2Y C;  2VY3 A;  2K6A A;  2K5N A;  4CGY B;  2BOS A;  1EEI D;  3GTJ H;  4GNX B;  1K83 H;  1PFM A;  2KOL A;  1S40 A;  2MP1 A;  1PZI D;  5EPK A;  3H3V H;  1XYI A;  1M4V A;  1TWF B;  2B2T C;  2EYP A;  1G29 1;  2FFK B;  1WTP A;  3NXW A;  1FVI A;  4RHS A;  5TSS A;  3E0J A;  3TRZ A;  1HCZ A;  3J7Z C;  4FF2 A;  3A5Z B;  1MI2 A;  1EFI D;  1WJJ A;  1GUN A;  5EBD A;  4A3K G;  3TP7 A;  4LFB Q;  2BE5 D;  2V1C C;  2IJ0 A;  1PTO B;  5A2Q E;  3BJU A;  5FOB B;  3Q0A A;  2CWA A;  2XRQ D;  3J80 E;  2UXC Q;  4J8Q A;  4LF6 L;  1NCV A;  4TQU S;  4A76 A;  3K58 A;  3PO2 G;  4X65 Q;  1LTG D;  1S72 A;  2F0I A;  1BKB A;  3PF4 A;  4HN7 A;  3OMG A;  1JOQ A;  4DN4 M;  1Q8K A;  2D0O A;  1U9R A;  4KY6 A;  3J80 i;  2K50 A;  4OIJ A;  4DNT B;  4ZKB B;  5C3E H;  3BYY B;  4C56 C;  4BBR H;  1TWC B;  5ELB A;  4ALP A;  2E2I H;  1SFO H;  3AYH B;  4RHR A;  2VQF L;  1BR9 A;  4PZ6 A;  3NEM A;  3OWF A;  2EY5 A;  2EYL A;  1EYA A;  5GAE C;  4DV4 L;  1YJN A;  1HUM A;  2VL6 A;  3MTS A;  3I55 A;  4DUZ L;  5BN3 A;  4DV7 Q;  1I4X A;  4QGU A;  2IX1 A;  1RIP A;  2A1A A;  3KLR A;  3I4M H;  1IXR A;  1CZG A;  1I4G A;  1JCK B;  1HXY D;  4DR5 Q;  4XIG S;  3NBI A;  2EYO A;  1KDC A;  5L37 A;  4TVA B;  4XT3 B;  5EKL A;  1YBY A;  2VW9 A;  5E3F A;  1CSQ A;  3SK6 A;  4MN3 A;  3VR2 A;  4MZ9 A;  1PVO A;  2OQ0 A;  4YY3 L;  1F2L A;  4DK0 A;  3GTL B;  1IBK L;  2XIW A;  3S16 H;  1HNX L;  1XTC D;  5C44 H;  1IBM L;  1LAC A;  4FP5 D;  4FDB A;  3K5N A;  3I70 A;  5IOD A;  2A8V A;  4WJ3 M;  4IPC A;  1ET9 A;  3QO2 A;  5C0X H;  4YCW A;  1JWM D;  4B3R L;  4WOR A;  2MQH A;  3A7A B;  2NVY H;  4A3M G;  2O4X A;  3GTM H;  3A55 A;  2ZM6 Q;  2RHS B;  1JOK A;  1YNX A;  1A3V A;  3PQI A;  2OEO A;  4A3L G;  3OIP A;  2QDL A;  2RDH A;  1JE5 A;  2IPK D;  2K5W A;  2PMZ B;  1ILP A;  2RBM A;  3T1H L;  1L0W A;  4CJ2 C;  1PTO F;  2Z8L A;  1P8L A;  4GNX A;  3S14 B;  4J1M A;  4LUV A;  1H9M A;  5LMN L;  1BNZ A;  1UNS A;  4A3B G;  5ELN A;  3TS2 A;  1EIH A;  1F9Q A;  2KEN A;  3E3X A;  4QIW B;  1MIU A;  3SK4 A;  1ZKO A;  2C5C A;  4I7Z C;  2SDF A;  1SYB A;  3K0Y A;  2WAQ E;  3E9H A;  3K7A H;  4JI4 Q;  2NVX H;  1KLG D;  1YJ9 A;  2HT1 A;  3O13 A;  1LT3 D;  3CXC A;  2A68 C;  1HFG A;  2NZO A;  3D31 A;  3NK9 A;  4G7H C;  1N36 L;  3J81 E;  3PMF A;  3TRE A;  3EVQ A;  4CDF C;  1TR5 A;  1B1Z A;  1A63 A;  1CKM A;  2H4O A;  1VCI A;  2VS1 A;  3JC6 6;  4C3H B;  3RZD B;  5EGT A;  4OWT B;  4BY7 B;  2F0Q A;  4Q5V A;  3CRK C;  2JA6 B;  2UUB L;  4JV5 L;  1CK1 A;  4U68 A;  3NTI A;  2PQA A;  1HQR D;  5LMU L;  3J81 i;  2CKZ B;  1TWC H;  1RTO A;  2Z1C A;  4PQX A;  4A3D G;  1L0X B;  1EYC A;  1S5E D;  4B3T Q;  2K03 A;  1M90 C;  2ZXP A;  2I5M X;  3IFT A;  5M3M G;  1I6H B;  1F2Z A;  1HQM C;  5CR3 A;  4BWG B;  2L15 A;  1VQ9 A;  1MBY A;  4JG2 A;  1SE3 A;  3HKZ G;  2EYM A;  1CT1 D;  1Z47 A;  3ND9 A;  2ZTC A;  2IY5 B;  4DV1 L;  3DM3 A;  2JYO A;  1HHV A;  3S1M H;  4PNY A;  4F8M A;  5JPM C;  1EY6 A;  1WI5 A;  1IYJ B;  1Y8P B;  5IYB H;  4FF3 A;  2KEE A;  4HMI A;  4H0L C;  3CD6 A;  2JXM B;  2HIX A;  2NBF A;  4C3I H;  1PH7 A;  5IWA Q;  2A69 D;  3I7F A;  2HCI A;  1KQS A;  4XXE A;  4DAV A;  1EU3 A;  2TSS A;  1FNV A;  5DNF A;  5D14 A;  1OXU A;  1W6J A;  2UXB L;  1RKN A;  4OXP A;  3HOU H;  2K01 A;  2UXD L;  1STY A;  4KN4 C;  4DA2 A;  2SEB D;  3H0G B;  1HA6 A;  2ID0 A;  2E8G A;  4R4Q A;  3JAM E;  2RDF A;  3EA6 A;  3TEH B;  2F0N A;  1HZA A;  3PUZ A;  2QF7 A;  4OO1 G;  1V1O A;  3PO3 B;  1VF5 C;  2QW7 A;  3A8I E;  3S15 B;  1KNA A;  4IFD I;  4DR1 L;  2R7Z B;  1L1O C;  1Y69 U;  1HNW Q;  3ZJY C;  3CPW A;  1EQR A;  1SE2 A;  4BXX H;  4YWM A;  4DF7 A;  1EWI A;  2B2T A;  4KN7 C;  4FF1 A;  2HHH L;  2Y0S E;  3JAM i;  4HJA A;  1R9T H;  3I4N G;  3BYT B;  2GVB A;  1SNC A;  1D1I A;  1NMG A;  1T5E A;  3CC7 A;  2OTL A;  4GOP C;  4LF8 L;  1VQ4 A;  1PLF A;  2X69 A;  1TWG H;  1KRT A;  3HOZ G;  4AYB B;  2EXZ A;  2EYF A;  1VQC A;  1YNJ C;  1NJI C;  2MPM A;  2O2L D;  2AMC B;  4B3M Q;  2GA4 B;  3RN5 A;  4H13 C;  3ULL A;  4DV2 Q;  1X3E A;  2DY8 A;  2BDO A;  3L7Z C;  2NVQ B;  2EJM A;  1JIC A;  2ZJR A;  1SR3 A;  5CV8 A;  2NN6 H;  4K5V A;  1QG7 A;  3D4W A;  2E5L L;  3Q8D A;  2MNA A;  3K59 A;  1X9N A;  1A2U A;  2VQF Q;  4JBK A;  4DV6 L;  4RGN A;  1CQV A;  1G6Z A;  2KA7 A;  3QWN A;  5K36 H;  1AZQ A;  4AQY Q;  1K0R A;  2B2W C;  2EJG C;  4A3G G;  3DEP A;  1AN8 A;  1GUS A;  4XT1 B;  4OON A;  3F2C A;  2R7Z G;  3P75 A;  1GUO A;  1RHP A;  4R8N A;  1PFN A;  1ZYR D;  3MFY A;  4UP9 A;  4DR2 L;  3V05 A;  4C1N K;  1LTB D;  4A3I B;  1JJG A;  3K80 C;  4MTN A;  2FHT A;  2FJ2 A;  1FNU A;  2Z6K C;  1K8M A;  4Y7N H;  4JI6 Q;  3I4O A;  1BQQ T;  5I6Y A;  2Q8R E;  3CMA A;  4L5Q A;  4A3J B;  1X32 A;  4G57 A;  1DJR D;  1UE6 A;  4V19 0;  3CAM A;  5FLX L;  4LFA L;  1BCP C;  1OO9 B;  1N9W A;  2L0C A;  1ILQ A;  2CQO A;  5IGE A;  1SYF A;  1VMP A;  4RFB A;  1FYC A;  2R6G A;  3NTK A;  1SMX A;  2IHE A;  1EIG A;  1L1O B;  3ULJ A;  1LT6 D;  2N8N A;  4BBS G;  4BA1 I;  3PO3 H;  2Z6B A;  1ICF B;  4O1N A;  3CCV A;  4KJO A;  3BVM A;  4GLA C;  2GN5 A;  2NN6 I;  5EJW A;  1FNW A;  3G6E A;  4K8I A;  3PIP A;  1F9R A;  4PMW A;  4P73 A;  2JA7 G;  3S1N B;  1STA A;  4OEL B;  2ZXR A;  2MO1 A;  3M4O B;  2R93 B;  3GV6 A;  1UEB A;  3WOF A;  2ASB A;  4KI0 A;  4HAE A;  4RKB A;  2VB3 X;  4KKU A;  2UUC Q;  1RCV D;  5C4H A;  1II3 A;  1I4R A;  4DV5 L;  4X62 Q;  4H02 A;  3FKI H;  5IT9 E;  2EYJ A;  1EY4 A;  4FNF A;  2HUG A;  4QUC A;  3UE1 A;  4K8J A;  1MJE A;  3S9W A;  4DR3 Q;  1M1K C;  4OGQ C;  4ULL A;  1PH1 A;  3HOV B;  4JI7 L;  5EQ0 A;  1L0Y B;  5C4X B;  3C1E A;  2M9V A;  4ZKC B;  1I4Q A;  1XMO Q;  1LLR D;  1PH2 A;  1R4Q B;  1EWH A;  3R93 A;  1ML0 D;  3S1R H;  2NVQ H;  4JV5 Q;  1WFQ A;  3GTJ B;  5CC4 A;  1B2T A;  1VQG A;  5HGT A;  5D65 A;  1BO0 A;  4DFA A;  1XJV A;  1K83 B;  1YHQ A;  2E76 C;  3ITP A;  1X55 A;  1TS2 A;  1DZ1 A;  1IZ6 A;  1O7I A;  1SAP A;  3RUZ A;  1A6X A;  3OTO Q;  3QIA A;  4A93 H;  3ZYY X;  4IO9 A;  1B7Y B;  2F0L A;  2PZW A;  4N8F A;  1C7Y A;  1NNX A;  2PZT A;  1TS3 A;  4CJ1 B;  1QVG A;  1J6Q A;  1JJC B;  2MHV A;  2BE5 C;  3TQY A;  5M5Y H;  2XVS A;  1SE4 A;  4EX5 A;  1U5K A;  3GP7 A;  5AJ3 Q;  3BZK A;  2A6H D;  4IFD J;  1YHB A;  5M5W H;  3E0E A;  2NVT H;  5M5X H;  3D6C A;  3W5O A;  4DU9 A;  2IL8 A;  4P2C B;  5IGD A;  2LXJ A;  4WJ4 A;  1EWC A;  3UDX A;  4F87 A;  2AQ2 B;  1OXT A;  3AEV A;  1PDQ A;  2UXB Q;  2E2D C;  1Q81 C;  2I46 A;  3KYH C;  1BCP B;  2UXD Q;  2B63 H;  5C3E B;  3CME A;  2PNH A;  2SNM A;  4BBR B;  2IT1 A;  4R4O A;  2EOT A;  3L3O C;  4JI8 Q;  1V1Q A;  4PZ8 A;  4WJW A;  4BY1 G;  3Q24 A;  4CDC C;  4JOI C;  4DV0 L;  3W2D A;  1D5Z C;  3HOV G;  2JQO A;  1X3P A;  2ALY B;  3HEJ A;  1VQI A;  4DR1 Q;  1GUG A;  2B2V C;  5E4W C;  4OWW B;  4GKJ L;  4JI1 Q;  3I4M B;  4YHH Q;  4LMQ D;  1L1O A;  2I0Q A;  1I94 L;  4DPG A;  1E24 A;  4PZ7 A;  1QOH A;  4F7X A;  5KIX A;  5FO8 B;  3SXH A;  2XTI A;  4RA8 A;  4L63 B;  3BZD B;  2EVB A;  4DR6 Q;  2MO0 A;  1JE4 A;  1JR0 D;  3KDF A;  3K81 C;  1I50 H;  1NUC A;  3KBX A;  2VUM G;  1YNN D;  4A75 A;  1VQA A;  3QOJ A;  1VQ8 A;  3M4O H;  4L6T B;  4GOP A;  4KLK A;  5EKK A;  5C44 B;  1EU4 A;  3URY A;  4JC0 A;  1PA6 A;  4GS3 A;  4XQJ A;  1Y8N B;  4A4I A;  1CZW A;  5JOB A;  2IWH A;  4K14 A;  1W2B A;  2XWJ B;  1YIJ A;  3CF5 A;  4A3E B;  1CM9 A;  4J15 A;  3RZO H;  1K0S A;  1X54 A;  2Q2T A;  5G3L D;  5H1S E;  3VR4 A;  4X64 L;  2QDB A;  4XYQ A;  3TZU A;  1C9O A;  5JPN C;  4JI3 L;  1HNZ Q;  3QJY A;  5C4X H;  4CKC A;  5GAH C;  1A0I A;  2CCZ A;  2E5L Q;  3J7A F;  4R4C A;  1XNR Q;  5A2Q L;  1ENF A;  3SVM A;  1H9S B;  2N78 A;  1JMC A;  3S2D H;  1ENA A;  2QCP X;  3UE0 A;  3VR6 A;  2QA4 A;  3BS1 A;  5DLQ E;  5I9P A;  3VA7 A;  3J81 j;  4JYA L;  3DWQ A;  3X3M A;  4LJZ C;  3J81 c;  1Q86 C;  5IP7 H;  2EDG A;  2L4N A;  1FJG L;  4HMJ A;  2KBN A;  5CV7 A;  2BH2 A;  3STB D;  2L55 A;  2Y0S G;  3HOW H;  4KMU C;  3K7A B;  3HOY H;  4K5X A;  3CCS A;  3L0O A;  3A54 A;  2NVX B;  4GKK L;  1Y1V H;  1HR0 Q;  5CV5 A;  3A5U A;  2JA5 H;  3F2U A;  1M8A A;  3C46 A;  4L5T A;  2XSC A;  3G4S A;  1J5E L;  4KD4 A;  5FLM H;  4OHJ A;  4Y52 H;  2DY7 A;  3T16 A;  1PH6 A;  2Z6K A;  1Q3L A;  4ZQ3 A;  1XMQ L;  1S5C D;  3F2D A;  4X66 L;  1Q82 C;  4E6I A;  2Z0S A;  4JI0 Q;  3GTO B;  5C44 G;  1A15 A;  5EPJ A;  2E75 C;  5IOC A;  2JA8 G;  1K8O A;  3KOJ A;  3AFP A;  5C4Z A;  1EL0 A;  3VYS A;  2R92 H;  4AYB E;  4XQN A;  2SNS A;  3BG3 A;  1LTT D;  4OIK A;  5IP9 H;  4I7A A;  1EOV A;  1XPO A;  1U4P A;  1IYU A;  4GLV B;  1YJW A;  1N8R C;  1VQO A;  1FGU A;  1LYL A;  2YYZ A;  1TVX A;  2PPB C;  4QF4 A;  2H5X A;  1MGS A;  1YEZ A;  3CCU A;  1NSN S;  2YTY A;  4EQ5 A;  2R7F A;  1HH2 P;  2RHQ B;  5LHY 1;  3EN2 A;  1FR3 A;  3L9A X;  1VQH A;  1Q7Y C;  2K32 A;  4ODG A;  3S1M B;  3JAM c;  1GUT A;  2YTX A;  3PUX A;  3CCL A;  2FMM A;  3M7G A;  1PV4 A;  1Q90 A;  2E74 C;  2AWN A;  5AFW A;  5FK9 C;  1IW7 D;  1OXV A;  4DK3 C;  4C3I B;  5M3F H;  1DXM A;  1BF4 A;  2PCF B;  4L5R C;  2F4V L;  4DR4 Q;  2A69 C;  4C1N I;  5CBE E;  1JJ2 A;  4A3K H;  1RD9 D;  2G9H D;  3HS0 C;  4RAU C;  1C48 A;  1E3P A;  5EAY A;  1GOZ A;  2KCN A;  1CFM A;  4JVZ A;  1LO5 D;  3NQT A;  3SHL A;  4B9X A;  3K5O A;  3HOU B;  1IBL L;  3A0J A;  4A3E H;  1VQJ A;  4N9P A;  1HA5 A;  3BVZ A;  1ASZ A;  3KF8 B;  3PO2 H;  3F1Z A;  2EJF C;  2VQE Q;  2K5V A;  2LKV A;  3PF5 A;  4LFC L;  3K6O A;  3KLS X;  5CYU A;  1B4O A;  4MIU A;  1N33 L;  2X6G A;  4FVM A;  3T4A C;  2K7V A;  4RWS C;  3IAY A;  5JEA G;  1VQL A;  1Q12 A;  1H9S A;  1O7Y A;  3KLW A;  1XNQ Q;  4XYO A;  2K75 A;  3KUP A;  2A74 C;  1U4L A;  1R9T B;  3B6Y A;  1BBU A;  1QWY A;  4KHV A;  1GVP A;  1U4R A;  5EBC A;  2OQK A;  4IUQ A;  1N34 Q;  1KXL A;  2NTS A;  3MWY W;  3T1Y L;  2K5Q A;  3M85 A;  1PYW D;  2UU9 Q;  2JA9 A;  3Q23 A;  4KJN A;  4A3F H;  4ZLT F;  1K28 A;  1PH3 A;  1TWG B;  4ME5 A;  2F0E A;  5D3D A;  1VQB A;  1ZXT A;  2JEB I;  2KCM A;  4LWC A;  3D6W A;  3P7J A;  2JP1 A;  3RLN A;  1D2B A;  5ELF A;  4IJL A;  1WTO A;  4B3S Q;  4JI2 Q;  5IYB G;  3K7U C;  2JJQ A;  4F88 A;  4OEM B;  4IFD H;  2BH8 A;  3SGI A;  3GTO H;  2F3V A;  2UUA L;  2YU9 B;  5JVH 3;  1B8A A;  2WB1 B;  3KBG A;  5BN5 A;  1F9P A;  4UY8 C;  1WTV A;  1N32 L;  4JOI A;  1TS4 A;  1SE8 A;  2I5L X;  4EVO A;  3HOU G;  2DGY A;  2ICE C;  5JAV A;  4HCS A;  4HSP A;  3TME A;  4G4K A;  2LXK A;  3BDO A;  3TS0 A;  2B2V A;  4NW2 A;  3VDY A;  1KAB A;  4IQZ A;  2MFI A;  2M00 A;  2NTT A;  5E4X A;  1G2S A;  2PZU A;  2L1B A;  5C4J H;  1I3Q H;  3SEB A;  4JW0 A;  4LF4 L;  1NBW A;  5EKI A;  1DOK A;  3AU7 A;  4OX9 L;  2G9D A;  4RH6 A;  5BR8 L;  2CH4 W;  4A3B H;  4RGM A;  1ZYR C;  3CQZ H;  1X3Q A;  1S5B D;  2E2J H;  5A35 A;  2D62 A;  2YTV A;  4Y7N B;  4ZK9 B;  3ER0 A;  4ZCK A;  2PQE A;  2Q2I A;  3MAQ A;  3QOL A;  3FP9 A;  1E1T A;  4BS9 A;  3KLS A;  3R8B A;  3RLO A;  2F0J A;  1D6E C;  1JOO A;  2AQ3 B;  2RKS A;  3GD7 A;  4JK1 C;  1AZP A;  4RCO A;  3S17 B;  1VQN A;  4NXM Q;  2ZT9 C;  5IYD H;  2V4D A;  4N9T A;  3NQI A;  4CKE A;  2EIF A;  2ICI A;  3E5S A;  1HZC A;  3M4P A;  2B2Y A;  2QEX A;  2ENB A;  1A2T A;  2F0K A;  4KY5 A;  4PMC A;  4C3H G;  2BA1 A;  4UP8 A;  2LMC B;  4BY7 G;  2CFM A;  2L11 A;  2WB1 G;  2DNC A;  4JBM A;  2JA6 G;  1PFB A;  1KAA A;  3Q22 A;  1H9J A;  4QJF A;  4ILW A;  5K36 G;  1EYD A;  4A3D H;  3MC0 B;  2F0V A;  2XN9 C;  3ERS X;  4GKK Q;  3R2T A;  2F03 A;  1AP0 A;  2TMP A;  2J0T D;  3LNN A;  3SDZ A;  1TU2 B;  3EQL C;  3PSI A;  2CVR A;  3FKI B;  4QY7 A;  4HIO A;  1EYG A;  4PG3 A;  5NUC A;  3KF6 B;  2OCE A;  3NEL A;  4LF6 Q;  4IUV A;  3DWA A;  5GRO A;  5FJ8 G;  1MSG A;  4QL5 A;  1TQO A;  5CV9 A;  3J7A 5;  2SOB A;  4M1U B;  1RJT A;  3NPP A;  4DNI A;  3OMC A;  3RD4 A;  4O0A A;  4TSS A;  1LTI D;  4LW1 A;  3S1R B;  5IGF A;  1PH9 A;  1V1P B;  4R9W A;  4M8A A;  5D3I B;  1ET6 A;  4X3U A;  1QZG A;  1PXU A;  4C2M H;  5I2X A;  4DR7 L;  2YU9 H;  1XPR A;  2RA4 A;  2XNA C;  1YIT A;  1PRT D;  3H6M A;  1CQF A;  3A8J E;  3K0X A;  2XGT A;  5CV4 A;  4DV4 Q;  4DUZ Q;  2EYH A;  3A7L A;  2D0P A;  4UP7 A;  3D4D A;  4A93 B;  1K3R A;  2EPB A;  1WCM H;  3H0G G;  1O78 A;  4OO1 H;  3D4R A;  2WV6 D;  3MXP A;  4GZY C;  3NHH A;  1K8A C;  4C3J B;  1EQQ A;  3PO3 G;  3PIO 3;  4P75 A;  5M5Y B;  1DOL A;  1VMC A;  1D5X C;  2F0M A;  1B3A A;  1GD7 A;  5C3X A;  5IGB A;  2CQA A;  5M5W B;  2NVT B;  4YY3 Q;  1VDZ A;  5M5X B;  1IBK Q;  2A6H C;  3PUY A;  3PIO A;  1HNX Q;  2JK8 A;  1PYS B;  5IYC G;  2Q2H A;  1IBM Q;  3NBH B;  1C8C A;  2Z4H A;  2PNR C;  1QJO A;  4RMF A;  4DAM A;  4TRD A;  5DM7 3;  3CPF A;  2AUJ D;  2KCC A;  4NPS A;  4KKT A;  5IGG A;  1IBL Q;  3GTG H;  2B63 B;  1TT2 A;  2K28 A;  3FKI G;  1KDB A;  5FKA C;  4B3R Q;  4KTA A;  3HOZ H;  1PH8 A;  4QCL A;  3CKI B;  1W3S A;  4DKA C;  2J7Z A;  1WVL A;  2KQ3 A;  4AYB G;  1TY0 A;  3S17 H;  1KRS A;  4KK7 A;  4LFC Q;  1G51 A;  4GN4 B;  2OWO A;  1QCB D;  1Z6H A;  4LUZ A;  2UXC L;  4P72 A;  1LM0 A;  2AKW B;  5J1Z A;  3PIP 3;  1EY7 A;  3DLL A;  3T1H Q;  3MXN B;  4KHP L;  1SYE A;  5LMN Q;  5JJK A;  1SBB B;  3KK7 A;  4KY7 A;  2C35 B;  3MFG A;  3HG9 A;  4HJ7 A;  3VR5 A;  1I50 B;  3W3A A;  1MSH A;  4GLX A;  4IJH A;  2CW0 D;  1VQK A;  1LUZ A;  1YNN C;  1GHK A;  1TS5 A;  4O2D A;  2KEC A;  2EY1 A;  5I6W A;  2NYZ D;  3D0F A;  1Q1B A;  1QUQ B;  4WRD A;  4X3S A;  1ENC A;  1EZ8 A;  3UDF A;  4NXN L;  4OO1 I;  5JJL A;  3W1B A;  1F2M A;  3V96 A;  4RGO S; 
#chains in the Genus database with same CATH homology
 5H1S E;  3KF6 A;  3F2B A;  1YNX A;  4X64 L;  1NE3 A;  4A3L G;  4DR5 L;  4JI1 L;  1C9O A;  1N36 Q;  2IY5 B;  4YHH L;  1J5E Q;  1JE5 A;  1X3G A;  1XPU A;  4BBS G;  4JI3 L;  1HNZ Q;  5C4X H;  2JE6 I;  5GAH C;  3S14 H;  1A0I A;  3HOX H;  2CCZ A;  3T1H L;  1S3O A;  2E5L Q;  1XMQ Q;  4YWL A;  1L0W A;  4A3I G;  4R4C A;  1XNR Q;  4X66 Q;  1P8L A;  4GNX A;  2UUA Q;  5ELO A;  1H95 A;  2R7D A;  4LUV A;  1JMC A;  2N78 A;  5LMN L;  3S2D H;  3UE0 A;  1AE2 A;  4A3B G;  5ELN A;  2QA4 A;  4DR6 L;  5DLQ E;  4YCV A;  3TS2 A;  2KEN A;  1B70 B;  1FL0 A;  2UUB Q;  5GAD C;  3J81 j;  4JYA L;  3J81 c;  1N32 Q;  3J80 c;  1MIU A;  4XTC S;  1Q86 C;  5IP7 H;  5LMU Q;  1FJG L;  2N3S A;  4A3J G;  1KD1 C;  2KBN A;  2BH2 A;  3STB D;  2WAQ E;  3E9H A;  3K7A H;  2Y0S G;  3KJO A;  4LF7 L;  3HOW H;  4JI4 Q;  2NVX H;  4GN5 A;  3HFZ B;  1YJ9 A;  1VQE A;  3NEN A;  4DAY B;  2HT1 A;  2FXQ A;  3STB C;  3CCS A;  3L0O A;  4HID A;  3HOY H;  4DK6 C;  4GKK L;  1Y1V H;  1HR0 Q;  3LGJ A;  3A5U A;  2LSS A;  2ZM6 L;  3CXC A;  2JA5 H;  4LNQ A;  2JEA I;  1VQP A;  4IPG A;  3AQQ A;  2NZO A;  2PMZ E;  4IPH A;  3H15 A;  3D31 A;  4DV1 Q;  4L5T A;  3G4S A;  1N36 L;  2K14 A;  3TRE A;  4C3J H;  1J5E L;  5FLM H;  3K8A A;  1HNZ L;  4Y52 H;  3IRB A;  4C3H H;  1D7Q A;  3RZD H;  2ZTD A;  2EQS A;  1PH6 A;  5J3B A;  1KHI A;  2Z6K A;  4JI5 Q;  2JA7 H;  4BY7 H;  1A63 A;  1CKM A;  2VS1 A;  1VCI A;  3JC6 6;  1DGS A;  3F2D A;  1XMQ L;  2ES2 A;  1XNR L;  4X66 L;  4QIW E;  1Q82 C;  4OWT B;  2Z0S A;  2JA6 H;  3ICE A;  2YV5 A;  3G48 A;  4JI0 Q;  5C44 G;  1SN8 A;  2R93 G;  2UUB L;  2JA8 G;  3I4N H;  4JV5 L;  2KCT A;  2PQA A;  3KOJ A;  3AFP A;  2F4V Q;  5LMU L;  1HZB A;  3J81 i;  2R92 H;  4AYB E;  2CKZ B;  2AHO B;  1TWC H;  3GTK H;  2VZA A;  2PI2 E;  1I6H H;  4A3D G;  1GKH A;  4B3T Q;  4QQB X;  4JI4 L;  1M90 C;  2I5M X;  1YVC A;  5IP9 H;  5M3M G;  1EOV A;  1XPO A;  4GLV B;  5LMN W;  3PCO B;  1V9P A;  4DV3 Q;  1VQO A;  5IY0 A;  1FGU A;  1HJP A;  1LYL A;  1YJW A;  2L15 A;  2YYZ A;  1GO3 E;  1HR0 L;  1VQ9 A;  5FJ8 H;  4LFB L;  5JEA J;  1UWV A;  3RNU A;  1NY4 A;  4JG2 A;  2H5X A;  1YEZ A;  3CCU A;  5JJI A;  3HKZ G;  1JT8 A;  2KHI A;  1Z47 A;  2YTY A;  2ZTC A;  4EQ5 A;  2R7F A;  1HH2 P;  2RHQ B;  4DV1 L;  1CKO A;  1PHJ A;  1PYB A;  1TWH H;  3DM3 A;  1VQ7 A;  1C0A A;  1Y14 B;  3EN2 A;  3S1M H;  1N33 Q;  3HOX G;  1VQH A;  1Q7Y C;  1WI5 A;  1IYJ B;  1VQ6 A;  2WB1 E;  1Q46 A;  4HIM A;  5IYB H;  4NB3 A;  3JAM c;  2KHJ A;  2GVA A;  3CD6 A;  2B3G A;  2HHH Q;  2YTX A;  3PUX A;  3CCL A;  2HIX A;  4C3I H;  1PH7 A;  5IWA Q;  1PV4 A;  4JI0 L;  4X65 L;  3CCQ A;  2AWN A;  3I7F A;  2N49 A;  1OXV A;  4DK3 C;  5IP7 G;  5M3F H;  1KQS A;  4L5S A;  4L5R C;  1EUJ A;  2F4V L;  4DR4 Q;  1YHA A;  1OXU A;  1JJ2 A;  4A3K H;  2UXB L;  4POF A;  3EIV A;  1QVC A;  4OXP A;  1E3P A;  2WFW A;  1VQD A;  5EAY A;  3HOU H;  2UXD L;  4LF8 Q;  3H0G H;  4B3T L;  1BVS A;  1QUQ A;  3T1Y Q;  4A3G H;  4A93 G;  1IBL L;  1TXY A;  3A0J A;  4A3E H;  3S2H H;  4DUY L;  1VQJ A;  2ID0 A;  2E8G A;  4R4Q A;  1YI2 A;  1XTD A;  3TEH B;  1ASZ A;  2OTJ A;  3KF8 B;  1E1O A;  1HZA A;  3PUZ A;  1P16 A;  2DUD A;  3PO2 H;  3S15 H;  3F1Z A;  4DV7 L;  4OO1 G;  2VQE Q;  2R7Z H;  2K5V A;  4IFD I;  3PF5 A;  4LF9 L;  2F52 A;  4LFC L;  4LUO A;  4DR1 L;  4R1J A;  4YCU A;  4LF5 Q;  1L1O C;  1N33 L;  1WYD A;  3KDF B;  5JEA G;  1HNW Q;  3ZJY C;  1VQL A;  2B29 A;  3CPW A;  1EQR A;  1V43 A;  1Q12 A;  4BXX H;  4YWM A;  5IYC H;  1EWI A;  4GOP B;  3U4V A;  1OXS C;  2Y0S E;  2HHH L;  3S1Q H;  4HIK A;  3KLW A;  3JAM i;  4HJA A;  1R9T H;  4A3C H;  5IWA L;  3I4N G;  2HIV A;  1XNQ Q;  2K75 A;  2GVB A;  1HR0 W;  3CC2 A;  4K0K Q;  4R4T A;  1I5F A;  1CSP A;  1BBU A;  3B6Y A;  1WOC A;  4DV6 Q;  1VQM A;  1MKH A;  5IE8 A;  3UDI A;  4BY1 H;  1NMG A;  5C0X J;  3WWV A;  5C3E G;  1GVP A;  4DR4 L;  2OQK A;  4BBR G;  3CC7 A;  2OTL A;  4GOP C;  2IX0 A;  1N34 Q;  1Y1W H;  2B63 G;  1KXL A;  3S24 A;  4LF8 L;  1X65 A;  1VQ4 A;  2ZTE A;  3T1Y L;  3M85 A;  1CKN B;  2UU9 Q;  2JA9 A;  1TWG H;  1KRT A;  3HOZ G;  4A3F H;  3PV0 A;  1A8V A;  3CP0 A;  1VQC A;  3RLF A;  1PH3 A;  2K5H A;  3PGZ A;  1VQB A;  1NJI C;  2JEB I;  3U58 A;  2KCM A;  3I4M G;  1D8L A;  2E2H H;  1X56 A;  2AMC B;  4LWC A;  2VQE L;  1GM5 A;  1VQF A;  4B3M Q;  4LF4 Q;  3RLN A;  3RN5 A;  4BBS H;  4IJL A;  3ULL A;  1CUK A;  1X3F A;  1X3E A;  5HY6 A;  4DV2 Q;  4DR2 Q;  3L7Z C;  3CCE A;  4B3S Q;  4OX9 Q;  3BZC A;  4JI2 Q;  3A74 A;  5BR8 Q;  2F3I A;  5IYB G;  3GTP H;  3K7U C;  4BA2 I;  3PUV A;  2ZJR A;  1SR3 A;  1HNW L;  1JB7 A;  4X6A H;  2JJQ A;  4UPA A;  1IL2 A;  2VUM H;  2ZJQ A;  2BH8 A;  4AIM A;  3HKS A;  2E5L L;  5M3F G;  3Q8D A;  3SGI A;  2MNA A;  3W1G A;  4GNX C;  2VQF Q;  1X9N A;  1N8R C;  1XNQ L;  3GTO H;  2UUA L;  4JBK A;  4YWK A;  1B8A A;  3E9I A;  2VNU D;  4DV6 L;  2CWP A;  4UY8 C;  1N32 L;  4JOI A;  1SE8 A;  2I5L X;  4AQY Q;  1K0R A;  4LFA Q;  3HOU G;  2DGY A;  3U4Z A;  1N34 L;  1NMF A;  3HKZ E;  4A3G G;  2LXK A;  3I56 A;  3ULP A;  4A3E G;  1X6O A;  2WAQ G;  3TS0 A;  5C0X G;  3VDY A;  1KC8 C;  2MFI A;  2UU9 L;  1MJC A;  4OON A;  3F2C A;  2R7Z G;  1UE5 A;  1I3Q H;  5C4J H;  4KHP Q;  4B3M L;  4LF4 L;  1NBW A;  4A3I H;  4UP9 A;  4DV2 L;  1VS0 A;  4DR2 L;  4OX9 L;  4B3S L;  3EBE A;  4KHZ A;  4HJ5 A;  5BR8 L;  4JI2 L;  1JJG A;  4A3B H;  3K80 C;  3MEF A;  4MTN A;  3KJP A;  1UE1 A;  1Q1E A;  2PQA B;  4A3C G;  3CQZ H;  1K73 C;  1AH9 A;  1T9H A;  3GTQ H;  2Z6K C;  4JI6 Q;  4Y7N H;  3I4O A;  2E2J H;  3KFU A;  4JI5 L;  2D62 A;  4A3J H;  1KL9 A;  2YTV A;  3CMA A;  1TWA H;  3ER0 A;  1PH4 A;  4L5Q A;  3OYY A;  2NZH A;  1A62 A;  2Q2I A;  4AH6 A;  1LTL A;  3FP9 A;  4DV5 Q;  1E1T A;  1UE6 A;  1Y1W G;  3CAM A;  4NXN Q;  4AQY L;  3RLO A;  3L2P A;  4LFA L;  3UDG A;  1N9W A;  1EIY B;  2CQO A;  3GD7 A;  3BU2 A;  3FHW A;  3M9B A;  3HOW G;  4IOC A;  4A3F G;  4DR7 Q;  4MNO A;  3M4Q A;  4R4I A;  1VQN A;  1BBW A;  3RN2 A;  3HOY G;  2R6G A;  4JI7 Q;  5E7N A;  2ZJP A;  1SMX A;  2IHE A;  4NXM Q;  5IYD H;  1E22 A;  1Y1V G;  1EFW A;  1L1O B;  3ULJ A;  2N8N A;  1YZ6 A;  2EIF A;  3I2Z A;  3PUW A;  5GAG C;  2EXD A;  4BA1 I;  4DV3 L;  1HZC A;  3M4P A;  4RG1 A;  2QEX A;  2JA5 G;  3PO3 H;  1VQ5 A;  2RF4 A;  3CCV A;  1SRU A;  4GLA C;  1Z9F A;  3H3V I;  3M7N A;  2GN5 A;  5FLM G;  2NN6 I;  2ATW A;  4P74 A;  3S1N H;  4IFD G;  2BA1 A;  4UP8 A;  3G6E A;  2R93 H;  2JA8 H;  5HGQ A;  3PIP A;  4PMW A;  2JA7 G;  4P73 A;  4BY7 G;  2CFM A;  3CCM A;  2WB1 G;  4JI6 L;  4JBM A;  2MO1 A;  2JA6 G;  3AFQ A;  4QJF A;  1UEB A;  4LF7 Q;  3GO5 A;  4KI0 A;  1PFS A;  1K9M C;  2ASB A;  5K36 G;  2UUC Q;  4A3D H;  4DV5 L;  2R92 G;  3ERS X;  4GKK Q;  4X62 Q;  4APV A;  4H02 A;  1AE3 A;  3FKI H;  3CC4 A;  1RL2 A;  3PSI A;  4HIO A;  4QY7 A;  3UE1 A;  4IOA A;  1CKN A;  1EYG A;  3HOV H;  2I5H A;  1MJE A;  4PG3 A;  5IP9 G;  3F8T A;  4DR3 Q;  3KF6 B;  2OCE A;  2K4K A;  1PH5 A;  3RR5 A;  1M1K C;  2A19 A;  3NEL A;  1PH1 A;  2PI2 A;  4JBW A;  4JI7 L;  4LF6 Q;  1SLJ A;  4NXM L;  1EIF A;  5GQO A;  5GRO A;  1E7Z A;  5FJ8 G;  3CW2 C;  2VY3 A;  4QL5 A;  1XMO Q;  3J7A 5;  2AWO A;  2K5N A;  1PH2 A;  3GTJ H;  4DNI A;  3S1R H;  1QVF A;  2NVQ H;  4GNX B;  1K83 H;  4O0A A;  1WFQ A;  4JV5 Q;  1KIX A;  1VQG A;  4LW1 A;  1S40 A;  1XJV A;  4LF5 L;  1TWF H;  1YHQ A;  1PH9 A;  3H3V H;  2Q2U A;  1X55 A;  1QZG A;  4C2M H;  1OXX K;  1G29 1;  4DR7 L;  1FVI A;  2YU9 H;  1XPR A;  2WP8 J;  1YIT A;  1IZ6 A;  1O7I A;  3TRZ A;  2UUC L;  1NTG A;  3J7Z C;  3K0X A;  2XGT A;  4JCV E;  3A5Z B;  4DV4 Q;  4K0K L;  3OTO Q;  1SFO H;  4A93 H;  1WJJ A;  4X62 L;  4DV0 Q;  4DUZ Q;  4A3K G;  4LFB Q;  2D0P A;  4UP7 A;  4IO9 A;  1B7Y B;  2V1C C;  1C7Y A;  1K3R A;  1WCM H;  1QVG A;  3H0G G;  4OWX B;  4ME3 A;  3GTM H;  1J6Q A;  4A3M H;  3CCJ A;  3BJU A;  1JJC B;  2CWA A;  5IYD G;  4DR3 L;  4GKJ Q;  3TQY A;  2UXC Q;  1KAW A;  5M5Y H;  1I94 Q;  4LF6 L;  4TQU S;  1K8A C;  3PO3 G;  1EQQ A;  3CCR A;  4P75 A;  4EX5 A;  4A3L H;  1U5K A;  4A76 A;  5AJ3 Q;  3PO2 G;  3BZK A;  1QZH A;  5C4X G;  1XMO L;  4IFD J;  1YHB A;  5M5W H;  3E0E A;  1GD7 A;  4X65 Q;  2NVT H;  5M5X H;  3W5O A;  1S72 A;  1BKB A;  3U50 C;  3M3Y H;  2QGQ A;  3PF4 A;  4YY3 Q;  2HQL A;  2LXJ A;  4WJ4 A;  1IBK Q;  1Q8K A;  2D0O A;  3PUY A;  3GDE A;  3UDX A;  3PIO A;  1HNX Q;  2JK8 A;  4BXX G;  3J80 i;  1PYS B;  1OXT A;  1SRO A;  2K50 A;  2Q2H A;  5IYC G;  1IBM Q;  3AEV A;  2UXB Q;  3NBH B;  5C3E H;  1Q81 C;  3KYH C;  5C0X I;  2K52 A;  4BBR H;  4RMF A;  4DAM A;  2UXD Q;  2B63 H;  3CME A;  4ALP A;  2E2I H;  2PNH A;  3CPF A;  2IT1 A;  1UE7 A;  3AYH B;  4NPS A;  4R4O A;  4JI8 Q;  1V1Q A;  4PZ6 A;  3NEM A;  4PZ8 A;  4BY1 G;  2VQF L;  4DUY Q;  1IBL Q;  3GTG H;  2IHF A;  2RCN A;  3FKI G;  5GAE C;  4DV4 L;  4HJ9 A;  1YJN A;  3OTO L;  4B3R Q;  4JBJ A;  2VL6 A;  3I55 A;  3HOZ H;  4JOI C;  4DV0 L;  4DUZ L;  1PH8 A;  1W3S A;  4DKA C;  3HOV G;  4DV7 Q;  4P71 A;  2JQO A;  3G71 A;  4QGU A;  2IX1 A;  1RIP A;  2A1A A;  4AYB G;  3S17 H;  2ALY B;  3I4M H;  1IXR A;  1VQI A;  1KRS A;  4X64 Q;  4DR1 Q;  1G51 A;  4LFC Q;  4LF9 Q;  4GN4 B;  2OWO A;  4OWW B;  4GKJ L;  2UXC L;  4DR5 Q;  4LUZ A;  4JI1 Q;  4XIG S;  4YHH Q;  2I0Q A;  1L1O A;  4P72 A;  1I94 L;  3OW2 A;  1LM0 A;  4JI3 Q;  2BA0 A;  4TVA B;  4DPG A;  1YBY A;  1E24 A;  4PZ7 A;  5AJ3 L;  2AKW B;  1K8G A;  2VW9 A;  3T1H Q;  3DLL A;  1CSQ A;  1HZ9 A;  2XTI A;  3MXN B;  4KHP L;  5IT9 c;  3GTL H;  1PVO A;  4MZ9 A;  5LMN Q;  2OQ0 A;  5JJK A;  4YY3 L;  4DR6 Q;  2C35 B;  2MO0 A;  1IBK L;  3KDF A;  1OTC A;  3K81 C;  1I50 H;  3S16 H;  2NN6 G;  1HNX L;  2VUM G;  5FLX c;  5C44 H;  4A75 A;  1VQA A;  4JYA Q;  4HJ7 A;  1VQ8 A;  1IBM L;  1FJG Q;  3M4O H;  4GN3 B;  2Q2T A;  4GOP A;  4KLK A;  4GLX A;  4FDB A;  4IJH A;  4JC0 A;  1PA6 A;  4GS3 A;  4IPD A;  1VQK A;  1LUZ A;  4A4I A;  1G6P A;  1L2F A;  4JI8 L;  4O2D A;  2A8V A;  4WJ3 M;  4IPC A;  3D0F A;  5JJL A;  1U0L A;  1Q1B A;  4YCW A;  1W2B A;  1QUQ B;  4POG A;  1YIJ A;  3CF5 A;  4B3R L;  1WCM G;  2MQH A;  1ASY A;  5M3M H;  2NVY H;  4J15 A;  3UDF A;  4NXN L;  4HJ8 A;  4A3M G;  3RZO H;  1X54 A;  3W1B A;  4OO1 I;  2ZM6 Q;  2RHS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...