1HR0W

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
b'AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hr0W00
2QGQA 1X55A 3SGIA 1HNWQ 2MO0A 3HOUH 4WJ4A 4GOPC 1U0LA 2JA9A 1IBMQ 3MEFA 1CSPA 1XNRL 2WB1E 3U4VA 3HOYG 5IY0A 3S16H 2V1CC 3M4PA 4A93H 2A19A 5IYBG 1EIFA 1V43A 3B6YA 3M9BA 2VNUD 2UUCL 3JC66 5IP7H 1UE5A 2JJQA 4JI6Q 1KQSA 1VQJA 2YYZA 4DV0L 2KHIA 4KLKA 1GO3E 3U58A 5JJLA 5GROA 4GKKL 4QY7A 4OWTB 2EIFA 5C3EH 3J7A5 2WAQE 4Y7NH 4HJ8A 2BA1A 4IPCA 1MJEA 3HOZG 1ASZA 4P75A 1TWAH 3U4ZA 3UE1A 4X62L 2UXBQ 4DNIA 4DV6L 4POFA 4DV2Q 1LYLA 4DK3C 4A3EG 4YHHQ 5GAHC 4DR2L 1VQ8A 1Q86C 2OWOA 3RNUA 4OX9L 3I7FA 2R92H 4JI8L 1ASYA 1HZ9A 3KOJA 1LM0A 4XTCS 5GADC 1Q46A 1YHAA 4LF7Q 2JA8H 3CP0A 5M5WH 1MJCA 2AHOB 1CKOA 1HR0L 1CSQA 3W5OA 4X65L 4GNXC 1VQ5A 3CMEA 1PH6A 3HOWH 4J15A 3EIVA 4JYAQ 4IFDJ 3AQQA 1HNWL 4JBWA 2I5MX 4JI3Q 4A3IH 1I94Q 1PA6A 1N32L 2JQOA 4LFBQ 1GVPA 4BY7H 2ATWA 4UP7A 3CC4A 2DGYA 1IBML 1BBUA 4DR3Q 4LUVA 4LF6Q 2I5HA 3CCQA 1VQHA 3A74A 2IX1A 3GTLH 2HIXA 2LSSA 3A0JA 4JV5L 4GN3B 1OXSC 2CQOA 2Q2IA 3CC7A 3PSIA 4IPGA 4DUYQ 1FJGQ 2E5LL 3ULLA 1HH2P 4C3JH 2D62A 3KDFB 4AIMA 4X66Q 1K73C 1NJIC 2R7FA 5C0XI 2MNAA 4JI7Q 4LF4L 2JA6H 3ICEA 1BBWA 1M90C 5ELOA 4PZ6A 2UUAQ 4A3CH 5C44H 1AE3A 1XMOQ 2PI2E 1I50H 2UXBL 1PH7A 1GM5A 1WOCA 4O2DA 4BA2I 4B3MQ 1IBLQ 4HIMA 1E24A 3BU2A 4NB3A 4BBRG 1QUQB 3J81i 4IOCA 2UU9Q 3CCMA 3DM3A 1YHBA 4NXNL 4YY3Q 3BZKA 3H0GH 5M3MG 1HNZQ 3CD6A 3HKSA 3MXNB 1RL2A 4DV7Q 3TS2A 3A5ZB 4A3JG 2C35B 3K7UC 2ZJRA 4HIDA 4TVAB 1OTCA 4DR4Q 1C9OA 1YI2A 5IP9G 1YIJA 1I94L 4DV1Q 2CFMA 1VQFA 1Y1WH 1T9HA 4JG2A 3OW2A 5M5YH 1UE6A 4PG3A 3PIPA 3WWVA 1KIXA 1XPOA 4B3SL 3RN2A 3KDFA 3KLWA 2NN6I 2QEXA 2JA7G 5E7NA 3EN2A 3OTOQ 1Y1VG 2VQFQ 4O0AA 4P74A 3RZDH 4LF6L 4YWMA 2E2JH 4JI4Q 1SR3A 3F8TA 2RHQB 4A3KG 4L5TA 3CAMA 3GDEA 3L2PA 3PO2H 1P8LA 2RHSB 4A3GG 5IYCG 1QUQA 4ALPA 3CCRA 1TWHH 4B3RQ 3CXCA 3KF6B 4A3BH 1VQLA 4LFAQ 2F52A 3FP9A 4LUZA 1HZCA 2AWOA 4OONA 2PNHA 3K7AH 1X9NA 4A3MH 2HHHL 2JK8A 4DKAC 4PMWA 3KJPA 4A3DH 1E7ZA 1G291 1S3OA 3PCOB 2AWNA 1Q1BA 2Z6KC 1YJNA 1J5EQ 1O7IA 2KENA 4YY3L 4DR1L 4LFCQ 2MO1A 4GLAC 3DLLA 4L5RC 1PFSA 1SN8A 2VQEL 2NN6G 1N36L 1YVCA 4FDBA 3RN5A 3PV0A 2YV5A 1XPRA 4OO1I 1L1OC 1TWGH 3AFPA 1A63A 1HR0W 4X64Q 1YBYA 3I4MH 3L7ZC 3KF6A 4GLXA 4KHPL 2YTXA 3UE0A 3FKIH 1H95A 3F2DA 1HZBA 3NELA 4GN4B 4YWLA 5JJIA 1PH1A 4APVA 3CMAA 3I4NG 3E0EA 1HNXQ 4HJ5A 4JI2L 2F4VL 2YTYA 3TQYA 3HOUG 5GAGC 2ES2A 2EXDA 3BZCA 3KF8B 4AYBG 1VQOA 1JB7A 1NE3A 4OXPA 1Q1EA 4B3RL 4JOIA 4POGA 3K8AA 1JJCB 1NMGA 4A3FH 1Q82C 3TRZA 1KAWA 5IYBH 2B29A 1OXXK 2MQHA 4C3HH 3K80C 3PUZA 1QZHA 4JI5L 3KFUA 2JEBI 2VUMH 2PMZE 1D8LA 5IP7G 3J80c 4YCUA 2YTVA 3S1NH 2CWPA 1FGUA 3TREA 1A0IA 4GN5A 4ME3A 3HOVH 1A8VA 1VQIA 2JA5H 3S14H 4LF8L 1IL2A 4A3EH 5EAYA 4R4CA 2PI2A 2L15A 1N8RC 1EFWA 4KI0A 4MZ9A 2GVBA 4X64L 4UPAA 1W3SA 2NVQH 3BJUA 5IWAQ 1YHQA 2UUBQ 4NXMQ 2JA8G 3G71A 5C4XH 2E8GA 2H5XA 3HOWG 1HNXL 4LF9Q 3CW2C 4GKJQ 1YEZA 3CPWA 3GTQH 4GOPB 1SRUA 2ALYB 2WFWA 1P16A 4P73A 4JI6L 1EQRA 4DV3Q 3M85A 4QGUA 3S2DH 4BY7G 4DR7Q 3PUXA 4BY1G 1J6QA 5FJ8G 1VQKA 1JJGA 4HIOA 4BXXH 4A4IA 4KHZA 1VQCA 5C0XJ 1X6OA 1OXVA 3HFZB 2B63G 3TS0A 2R7ZG 2OTJA 2N49A 1VCIA 2IHFA 3HOXH 3PO3G 1JT8A 1HZAA 4C2MH 3K81C 2IT1A 1PH9A 2KHJA 2XTIA 1E1TA 1VQDA 3HKZG 4LWCA 4DV2L 1AH9A 4YHHL 1CKMA 1EOVA 1SMXA 1I6HH 2XGTA 3M4OH 4QIWE 1SE8A 1L0WA 3S17H 2RF4A 2EQSA 1IXRA 2JA6G 1Q12A 5J3BA 3J7ZC 3S1MH 2GVAA 3GTOH 3D31A 4LF7L 2CKZB 2F3IA 2B3GA 1NY4A 2IY5B 4P71A 1SLJA 4GOPA 3UDFA 4JYAL 5IYDG 2KCMA 1VS0A 4DV5Q 1QVFA 4JI3L 5M3FG 3GTKH 4A3LG 3M7NA 4LFBL 2WP8J 4DV4Q 1XNQQ 1WCMG 2Y0SG 3NENA 2UUBL 1GD7A 4R4IA 4DR3L 3T1YQ 4R4OA 4LF9L 1KC8C 4MTNA 5C0XG 5GAEC 5IP9H 4IPDA 3G6EA 4JI1Q 2E2HH 5FLMH 1XMQQ 1WYDA 5K36G 4JC0A 1UEBA 3F1ZA 4DUYL 1VQGA 1FJGL 2JA7H 1N34Q 3I56A 4LW1A 1Y1VH 4AQYQ 3LGJA 1DGSA 4JI0Q 4X66L 5BR8Q 4LF5Q 4JI7L 4JBJA 2BH8A 1SFOH 3CCLA 3J81j 4A3KH 2UUAL 4B3SQ 5LMNQ 1XMOL 4X6AH 2AKWB 3CCJA 1PYBA 2K52A 1K9MC 3AEVA 4B3ML 5IYCH 2ZTEA 1IBLL 3GTMH 2K75A 3STBD 3VDYA 4BBSH 3PF4A 2UU9L 1XNRQ 4DAYB 4GNXA 2OQKA 4A3BG 4EX5A 2K5HA 3H15A 1HNZL 4RMFA 4DV7L 3PGZA 2UUCQ 1KRTA 3CC2A 1YZ6A 5IE8A 1K8AC 4IO9A 2IHEA 4DR4L 4DV0Q 4A3DG 2R93G 4DV5L 1X54A 5M5XH 1UE7A 4DV1L 1PH2A 1JMCA 4DPGA 2NVYH 4OWXB 1XNQL 4HJ7A 1Z47A 1IZ6A 1L2FA 1IYJB 1Y14B 2N3SA 5FLXc 2WB1G 1KRSA 3T1YL 1N33Q 3JAMc 1WJJA 3OTOL 2VQFL 5LMUQ 4MNOA 3PF5A 4X62Q 4JI4L 2R7DA 4DV6Q 1E1OA 4JI1L 1K0RA 1VQ6A 1U5KA 2FXQA 3F2BA 1XMQL 1NMFA 1VQBA 2A1AA 3W1GA 3CCVA 4R4TA 4OX9Q 1BKBA 4L5QA 3T1HQ 2HT1A 3KYHC 3F2CA 4AQYL 1G51A 2KBNA 3FHWA 2OTLA 2K50A 3A5UA 4JI0L 3I4MG 2OQ0A 4P72A 3PUVA 5BR8L 2ZJQA 1HJPA 1VQEA 3FKIG 2HQLA 2WAQG 1HR0Q 2YU9H 2CCZA 3HOYH 3S15H 2GN5A 4QL5A 3AFQA 4LFAL 1NBWA 5LMNL 1JJ2A 2ASBA 4QQBX 4DR5Q 2Q2UA 3L0OA 4A93G 1A62A 1SROA 1FL0A 3M4QA 1N32Q 1I3QH 2ZJPA 1PH5A 3GTGH 1KL9A 3S24A 1EWIA 1J5EL 4B3TQ 2VL6A 4OO1G 4LFCL 1Q7YC 1R9TH 1VQPA 2UXCQ 1TXYA 4A3FG 1YJ9A 2ZTCA 3H3VI 4R1JA 4JCVE 5C3EG 4JV5Q 3ULJA 1XPUA 3HOZH 2I5LX 4NPSA 3PUYA 2VUMG 4LNQA 2K4KA 4BA1I 2E5LQ 1Q81C 3NEMA 1S72A 4AYBE 2OCEA 2R92G 1RIPA 3I2ZA 2Q2HA 4LF4Q 4XIGS 3HOVG 1N33L 4TQUS 1B7YB 3U50C 2JA5G 2JE6I 3J81c 5LMUL 3CPFA 2UXDQ 1Q8KA 3I55A 1YITA 2NVXH 2LXKA 4HJ9A 3CCEA 1L1OB 1PHJA 1EYGA 1C0AA 1M1KC 4RG1A 4DK6C 3JAMi 3T1HL 3H3VH 1QZGA 4A3IG 2IX0A 1UWVA 3S1RH 4WJ3M 2VY3A 2QA4A 4NXNQ 4AH6A 4UP9A 3KJOA 3NBHB 2K5NA 3D0FA 1QVGA 2JEAI 5C4XG 2DUDA 1VQ4A 4K0KQ 1E3PA 3GTPH 4DR5L 3PUWA 1EUJA 3RZOH 4IFDI 1KHIA 2Z6KA 1X3EA 4HIKA 3UDGA 3PIOA 3EBEA 4L5SA 3ERSX 1NTGA 2NZHA 2PQAB 3TEHB 3GTJH 4BY1H 5FJ8H 1KD1C 4IJLA 4B3TL 1PH3A 1YJWA 1XJVA 2ID0A 1I5FA 1TWCH 3G4SA 4GS3A 4BXXG 3RLFA 2UXCL 2B63H 2R7ZH 2K5VA 3I4OA 3PO3H 3J80i 3M3YH 3HOXG 4A3CG 1B8AA 1L1OA 5C44G 1EIYB 1E22A 2CWAA 5JJKA 1X3GA 4DAMA 3ZJYC 2N8NA 2ZM6Q 1X56A 1AE2A 5JEAJ 1PH4A 4R4QA 1V1QA 2VZAA 3STBC 4BBRH 1PYSB 1S40A 3S2HH 3CCUA 3GD7A 5IWAL 4DR6Q 5M3MH 4NXML 2K14A 3H0GG 1B70B 3RR5A 3G48A 4GNXB 4JOIC 2UXDL 3UDXA 2D0PA 4A3JH 2HHHQ 5AJ3Q 3CQZH 4GKJL 2MFIA 5IYDH 3RLNA 4A3LH 2PQAA 4YCVA 3HKZE 5M3FH 4IFDG 2AMCB 2N78A 1WCMH 4DR1Q 1Y1WG 4IPHA 4DUZQ 4DV3L 1VQNA 5IT9c 4DR7L 1BVSA 2VQEQ 1MKHA 1IBKQ 1N36Q 1OXTA 4UP8A 4K0KL 1WFQA 1OXUA 4GLVB 1VQAA 1TWFH 2HIVA 3S1QH 4JBMA 3GO5A 5GQOA 5FLMG 3K0XA 3UDIA 2BA0A 3CF5A 3PO2G 4A3GH 1N9WA 3ER0A 1V9PA 2A8VA 1X65A 1VQMA 3AYHB 5ELNA 2Z0SA 3W1BA 5LMNW 4HJAA 2I0QA 4UY8C 1XTDA 4YCWA 5JEAG 2Y0SE 1CKNB 4KHPQ 4C3IH 4IOAA 2Q2TA 1C7YA 1D7QA 4JI2Q 2F4VQ 3CCSA 5H1SE 3E9IA 4Y52H 1LUZA 3RLOA 2ZM6L 4A3MG 2VW9A 5C4JH 1Z9FA 4BBSG 3ULPA 1VQ9A 2LXJA 4IJHA 1WI5A 4H02A 5HGQA 2VS1A 4DV4L 4GKKQ 4DR6L 1CUKA 2RCNA 1G6PA 1K3RA 2BH2A 4A76A 4EQ5A 4JI5Q 5AJ3L 4JBKA 1KXLA 2NZOA 3Q8DA 1JE5A 1QVCA 4LUOA 4A75A 4PZ7A 3OYYA 2E2IH 2R93H 1EQQA 1MIUA 1W2BA 4DR2Q 4DUZL 1FVIA 1X3FA 1LTLA 1UE1A 3E9HA 1K8GA 2R6GA 4JI8Q 1CKNA 1GKHA 1IBKL 1N34L 1PVOA 4QJFA 3IRBA 1YNXA 1PH8A 1VQ7A 4LF5L 1PV4A 2D0OA 4LF8Q 2KCTA 5DLQE 4YWKA 4X65Q 4OWWB 4PZ8A 2NVTH 3I4NH 1K83H 2ZTDA 5HY6A
chains in the Genus database with same CATH superfamily
4HR7B 5M5WB 2DJGC 2MO0A 3W2DA 5ISRA 1WTOA 2KCCA 4PV1C 3HOYG 4B08A 2V1CC 1EIFA 1UAPA 4C3HG 2Z8LA 3M9BA 5IP7H 2JJQA 3PO3B 5JJLA 1TR5A 1SNPA 3S9WA 2SEBD 2B2TA 4Y7NH 1ZEQX 1ASZA 4BBRB 4X62L 2UXBQ 4DNIA 3IL8A 5FLXE 4YHHQ 4XYOA 1I50B 1SYGA 4IUTA 1Q86C 4B9XA 1VQ8A 2OWOA 4OX9L 2R92H 5KNBA 1IKLA 3CQZB 1Q46A 4TKOB 2XSCA 2FMCA 5M3FB 1TIID 1L0YB 1RTOA 3W5OA 2PW7A 2Y0SB 4J15A 4KTAA 3PIO3 1BOSA 1N32L 1KLUD 3MEHA 2KVMA 3OOCA 2ZT9C 2NWGA 5CV5A 1U9RA 2IX1A 1I4PA 1CHPD 3QB3A 3GTLH 2LSSA 2B2UA 1O80A 3PSIA 3K59A 1PTOF 4C3IB 2E5LL 2F0NA 4C3JH 3KDFB 3MFYA 2R7FA 4QF4A 3VR5A 4ME5A 5BN3A 2MNAA 1M90C 4PZ6A 4RGNA 2UXBL 3ND8A 4M8AA 4DNRB 1E24A 3J81E 1U4LA 4NB3A 3NTKA 1QUQB 1Q3LA 2UU9Q 3VYUA 1YHBA 3BZKA 2E2IB 3CD6A 1A3UA 1BCPC 1F2LA 4K2LA 4LAAA 4WJWA 2C35B 5D3DA 2C9OA 2WB1B 5KRUA 1C9OA 1YI2A 1IW7C 2F0SA 4K6LA 4K5WA 3PIPA 1SSOA 4K6DA 1UNSA 1VMCA 3EQLC 2VQFQ 1PXUA 3HOUB 2WKCA 2M9VA 3HS0C 1M8AA 4JI4Q 3CAMA 3GDEA 4F7XA 5JPMC 4A3GG 3A8IE 5CORA 3CXCA 4A3BH 1VQLA 1U4RA 2F52A 4LUZA 1HZCA 2B2VA 2AWOA 4QB4A 1KNAA 4A3MH 2HHHL 4DKAC 2QF7A 2F3WA 3DMUA 1E7ZA 4LFCQ 4WRDA 3DLLA 3MZ5A 1F9RA 1DOKA 3BDLA 4KJOA 1YVCA 1EIGA 4FDBA 2EDGA 1S5BD 1SE2A 1LABA 5IT9E 4OO1I 1L1OC 1TWGH 1A63A 1TU2B 1STNA 3BG3A 3AB9A 3DWAA 3T51B 3L7ZC 2ZXRA 4TRDA 5AFWA 5CR3A 3NQIA 3F2DA 1HZBA 3NELA 4GN4B 5JJIA 1BUVT 3CMAA 4JPBW 3I4NG 4BY7B 1VDZA 1EZ6A 2NZ1D 3I4LA 5A2QE 3BZCA 4AYBG 4CGYB 1VQOA 4WORA 4JOIA 5HURA 4POGA 1JJCB 1NMGA 3AU7A 1Q82C 1SEBD 2RSNA 1BCPF 1QZHA 2JEBI 2PMZE 5IP7G 3J80c 2ENBA 4M1UB 4XQQA 4ZCKA 5C44B 4V0BA 3TREA 2RBMA 4GN5A 1TT2A 3Q22A 1WTWA 1STHA 3H0GB 2L15A 1EFWA 2SDFA 4KI0A 2BCOA 1Z7TA 2UUBQ 5I2XA 2E8GA 3NBIA 1QJOA 3U9SA 2HCCA 3TZUA 5M9OA 4GKJQ 1YEZA 3R3OA 1Y8OB 2PZTA 5FOBB 2E2JB 3M85A 2K05A 4DR7Q 1BR9A 4BY1G 5FJ8G 1VQKA 1SMYD 4BXXH 4KHZA 5C0XJ 1OXVA 2OTJA 2R7ZG 5K5PA 2IHFA 2L1BA 3HOXH 4C2MH 2KHJA 1U4MA 2XTIA 3HKZG 1C4QA 4LWCA 2K32A 1AH9A 4IUVA 1CKMA 4RH6A 1YNJD 4C3JG 1SE8A 1STBA 3S17H 2EQSA 3J7ZC 2F0OA 2GVAA 3D31A 4LF7L 4A3DB 3VYTA 2KCNA 2IY5B 2F0PA 2FJ2A 3EROA 4DXGA 2KCMA 4DV5Q 4A3LG 4LFBL 2WP8J 4DV4Q 2AUKA 1WCMG 2PYKA 2UUBL 5CMDA 3R2IA 2A68D 3KLSX 3KLSA 4R9WA 3T53B 2F0GA 1NSNS 3J80L 3J7YW 3IAYA 2VB3X 3TZDA 5IP9H 3QO2A 3I4MB 5I9PA 5E4XA 1IHZA 1WYDA 1GUTA 2WAQB 1QNUA 2IPKD 5CBEE 4LW1A 1Y1VH 3LGJA 4X66L 4JI7L 5I9OA 2BH8A 1S5FD 1B2TA 3J81j 4A3KH 2UUAL 2RQXA 2ZXOA 5LMNQ 4X6AH 1AW7A 3K6OA 4B3ML 4A3FB 3GTMH 1X32A 4BBSH 4C3HB 1U4PA 1GOZA 2RKSA 4DAYB 1LT3D 2OQKA 4A3BG 1E2WA 4RMFA 2EE1A 4DV7L 2HUGA 1JWSD 2UUCQ 5IGGA 1K8AC 4DR4L 4DV0Q 5CV8A 1Z6HA 1X54A 2ICIA 5M5XH 4DV5L 4DV1L 3IFDA 1IZ6A 1I4HA 1Y14B 3JAMc 3OTOL 1SNDA 1B50A 2XVSA 1BXTA 1E1OA 2MGSA 4CDCC 1VQ6A 4OGQC 1VQBA 4FF2A 1GUWA 2EYHA 3SK6A 2HT1A 3KYHC 1G51A 4P72A 1C0AA 4QUCA 4C1NK 3AFQA 2Z1CA 5LMNL 3I8ZA 4A93G 1ICWA 3M4QA 2ZJPA 4K5XA 3NSWA 1EWIA 1J5EL 4R8NA 2A69D 1Q7YC 1VQPA 1TS4A 2UXCQ 4FYDA 1DYQA 4KD4A 3H3VI 4U68A 5C3EG 3D4WA 3HOZH 1MHWC 1RD9D 1GJXA 3PUYA 2KEDA 4NDXA 3NEMA 1FR3A 1GUOA 1RIPA 5ELFA 1LTAD 1F9SA 4TQUS 2MJ8A 5KYLA 1EWCA 3GTKB 3VR6A 1KDAA 1YITA 2NVXH 2LXKA 1SNCA 1PHJA 2EYFA 3JAME 4DK6C 4A3IG 1UWVA 2QA4A 4NXNQ 4UP9A 3MXPA 2E2HB 5J39A 1QVGA 3R93A 4PMCA 5CGKA 2R61A 1EUJA 3RZOH 3NWSA 2Z6KA 1V8QA 1X3EA 4HIKA 3UDGA 3ERSX 3GTJH 2NZHA 5CYUA 2PQEA 1EYAA 3P1HA 2L0CA 1KD1C 1XJVA 1HA5A 3JAML 5JJZA 4GS3A 1EQVA 3RLFA 4BXXG 4A3GB 2UXCL 1I4RA 2K5VA 4MTKA 1HFNA 3HOXG 4A3CG 1J9OA 1H9RA 1E22A 5FO9B 1QWYA 3ZJYC 1AE2A 5JEAJ 1PH4A 4ABNA 2VZAA 1LTGD 4EQPA 3S2HH 4FXKC 4DR6Q 3D6WA 5M3MH 4NMZA 1CI3M 4A3JH 5AJ3Q 1X3QA 4YCVA 3SHLA 1F77A 1WTHA 2N78A 2QKIC 5J22A 4DR1Q 3T16A 5JAVA 1Y1WG 1VQNA 1BVSA 2VQEQ 1MKHA 4ZUIA 1N36Q 1IBKQ 3K5MA 5C0XH 1VQAA 1CZGA 2LY7A 3Q6SA 1TWFH 3NHHA 3K0XA 3UDIA 1TS3A 2YU9B 2BA0A 2F0HA 2PPBC 3AYHB 4HJAA 1NNXA 4BWGB 1EYDA 1SE4A 2TMPA 2PNRC 4AYBB 4DAVA 2B2YA 1KAAA 1PRTB 1RF2D 1LUZA 5C4JH 4H44C 4BBSG 5EKIA 3ULPA 4IJHA 1VQ9A 2B8FA 1MSGA 4XQNA 3MXNA 1Y8NB 4DR6L 2O4XA 1BCPB 4JI5Q 5AJ3L 4JBKA 3CU7A 1S5ED 2OT2A 4PZ7A 4CJ1B 1EQQA 1W2BA 1K8GA 3A8JE 4JI8Q 1IBKL 2C5CA 1T5XD 2G9DA 4LF8Q 4X65Q 3S1RB 4QUFA 4FF1A 2ZTDA 3S16H 3P7JA 4QIWB 1EY9A 4JW0A 4O1NA 2JA9A 3G6JB 4I7ZC 1IBMQ 4ZLTF 2NUCA 5IY0A 3TBIB 2A19A 4ODGA 4BY1B 5DM63 1TWCB 5EGTA 2R7ZB 2YYZA 1IL8A 2KHIA 3G7LA 5GROA 3HKZB 3D3RA 1AZQA 3OIQA 1LLRD 1MJEA 3HOZG 1XYIA 1TWAH 3U4ZA 3UE1A 1HCZA 4POFA 4DV2Q 1LYLA 4DK3C 3NQTA 3SVMA 3A54A 4CKEA 3RNUA 4JI8L 4C56C 1HZ9A 4XTCS 1YHAA 5HGTA 1ZYRD 5FK9C 1HR0L 4X65L 4V190 1QOHA 3MHBA 1WCMB 3CMEA 1PH6A 1C8CA 4JYAQ 4IFDJ 3I3CA 4IUNA 5CBAE 1I94Q 4JI3Q 1GVPA 1ENCA 1MD2D 4UP7A 3S1QB 2JXMB 1IBML 3TP8A 1PZID 4N8FA 4DR3Q 4KN4C 4LUVA 4IALA 4LF6Q 1V1PA 1VQHA 3A74A 3V2TA 2HIXA 3A0JA 4JV5L 1RCVD 4DU9A 2Q2IA 2BOSA 2D62A 1D2BA 1JWMD 1K73C 2JA6H 1BBWA 1XMOQ 1AE3A 3I90A 1WOCA 2M00A 1PTOH 3BU2A 4IOCA 3DM3A 4YY3Q 2EJFC 5M3MG 1HNZQ 1LO5D 3TS2A 4A3JG 4HCEA 4K14A 2ZJRA 4HIDA 3VYRA 4KKTA 4CJ0B 1I94L 3C1EA 2CFMA 1SNOA 1T9HA 1UE6A 4PG3A 3SXHA 3K5OA 3KLWA 2NVTB 2NN6I 5E7NA 3EN2A 3RZDH 4LF6L 1JE4A 3H3VC 3F8TA 1MBYA 5C3XA 2IW3A 4I7AA 3NK9A 3PO2H 1P8LA 2RHSB 3URYA 5IGFA 5E3FA 2L4NA 4A93B 5JEAH 2BE5C 1TWHH 4B3RQ 2WKDA 1JOQA 4LFAQ 1WTXA 4S3SA 3K7AH 4PQXA 2JK8A 2JN4A 3NTIA 5C3EB 4PNYA 3CHBD 1YJNA 2EYJA 2KENA 2MHVA 4YY3L 2MO1A 4L5RC 2Q8RE 1A2UA 3QR8A 4HN7A 2HCIA 1XPRA 2JA8B 3P75A 1ZKOA 3Q0AA 3HOWB 1SNQA 1YBYA 5D65A 1ZXTA 4GLXA 4KHPL 2YTXA 3UE0A 1H95A 4A3IB 4APVA 2L9HA 3NP8A 3TN2A 3J7AF 4JI2L 2F4VL 4H0LC 1F2YA 3K5LA 3TQYA 1PFBA 2ES2A 1SYFA 2E75C 4HMJA 2EXDA 2DNCA 5FO7B 4B3RL 4QMGA 3NPPA 1UEAB 4HSVA 5IYBH 2MQHA 1OXXK 4K8IA 4F87A 3K57A 2F0QA 4J8QA 3HOXB 2E74C 1A0IA 5KYIA 4JK1C 3HOVH 1A8VA 3S14H 2H4OA 2AQ2B 4XQJA 4A3EH 5EAYA 4R4CA 3LX0A 2CH4W 1N8RC 3KF8A 4DGZA 1HA6A 2NVQH 3SK8A 4DN4M 4NXMQ 5I2YA 2H5XA 1Y1WB 5M5YB 1DOLA 3CW2C 5IGCA 1D5MC 3CPWA 3GTQH 3ZYYX 1SRUA 2ALYB 1EQRA 5CV7A 1J6QA 2A68C 2E76C 2KHSA 4HIOA 4J1MA 3VA7A 2B63G 2N49A 1VCIA 4CDFC 1D1KA 1CQVA 1E1TA 1PRTC 1W6KA 4YHHL 2A6HC 5CV6A 2XGTA 2CW0D 3KBGA 1WTQA 3M4OH 1I6HH 1LTTD 2JA6G 5IGEA 1E2ZA 3FVQA 4BBSB 2CKZB 2NTTA 1XX8A 3SE0A 1SLJA 1CM9A 4GOPA 1GXDC 1VS0A 2OXPA 4IFDH 1QVFA 1SJED 1GHJA 4Q5VA 3M7NA 1AZPA 2RDHA 1I6VC 4RWSC 4DFAA 2B39A 1AP0A 1KC8C 2B2TC 5LHY1 4EQNA 3FKIB 3F1ZA 3I73A 2XWJB 2JA7H 2PMZB 1DGSA 2J0TD 4JI0Q 4I65A 4LF5Q 4JBJA 3HGBA 4B3SQ 1TQOA 2OF1A 3AEVA 5IYCH 2KUMA 3STBD 4MHEA 1PFMA 3MFGA 2UU9L 1XNRQ 4GNXA 2VUMB 3BDCA 4DNTB 1STGA 2P5ZX 4DF7A 2F0IA 3S1NB 1G6ZA 2MPMA 2JP1A 1KRTA 5IE8A 2F4IA 2IHEA 4DA2A 2R93G 2JA5B 2B2UC 4DPGA 2B2WA 2NVYH 1RJTA 1KLGD 1AEXA 1I4GA 4HMIA 4IUUA 2N3SA 3VR2A 3MVVA 1N33Q 1WJJA 2VQFL 5LMUQ 2Q8TA 1JR0D 4JI4L 1FYCA 4DV6Q 1EY6A 3WOFA 1K0RA 2K01A 1NMFA 2EZVA 2A1AA 3CCVA 3FPUB 2K04A 1PRTF 1H9SA 5C4XB 4RGMA 1TS2A 3EVQA 2K50A 3QIAA 4JI0L 3PUVA 1VQEA 1MI2A 2CCZA 3S15H 3S2DB 2A6ED 3RMHA 4DR5Q 3L0OA 2Q2UA 1A62A 1EIHA 1SROA 1FL0A 2K5WA 3DWPA 1I3QH 3GTGH 3S24A 1SYBA 3LWEA 2VL6A 1DM0B 1ET9A 3M4YA 4LFCL 2QEJC 5EKLA 1R9TH 1YJ9A 2CH4A 4R1JA 2E2DC 4RA8A 1PTOD 1Y69U 4LNQA 3S1MB 4CHTB 1Q81C 1WTRA 3GTOB 1S72A 4IZ8A 2R92G 4LF4Q 3HOVG 4XIGS 4OIJA 1N33L 1H9MA 4UHVA 1B7YB 2LFNA 1FD7D 2JE6I 5LMUL 3C46A 1STEA 1PDQA 1Q8KA 1LTSD 2UXDQ 3S2HB 4HJ9A 3GP7A 4OIKA 5FKAC 2B2VC 1HUNA 1M1KC 1PZJD 1QZGA 2IX0A 4H7BA 1SBBB 1DONA 1EZ8A 3D0FA 2JEAI 1VQ4A 1E3PA 4DR5L 4OEMB 1FNWA 1A3VA 3PIOA 1SFOB 4EVOA 4IJLA 1EWHA 1YJWA 2L55A 3G4SA 2F0LA 1J8IA 3J80E 1TVXA 2KJXA 3I4OA 3PO3H 3WOEA 3D4DA 1TY0A 1X3GA 2Q8IB 4ULLA 5BN4A 3K58A 1V1QA 4BBRH 1ILPA 3BVMA 4NKLA 4XXEA 1EQTA 3RR5A 2UXDL 4JOIC 3H09A 2ICEC 4IN3A 1EY8A 3CQZH 4GKJL 2MFIA 5IYDH 3RLNA 5M3FH 4IFDG 3KK7A 1GUSA 4DUZQ 4DR7L 1STYA 4UP8A 3OWFA 1WFQA 1IYUA 3V05A 4JBMA 3IKJA 5GQOA 5K36H 2J4XA 3ER0A 2A8VA 3HOYB 5JPNC 1X65A 3KBXA 5ELNA 1CHQD 5LMNW 1BO0A 1XTDA 5DEHA 5IGBA 1B3QA 4C3IH 3H6MA 4KKSA 4MN3A 2EPBA 1D7QA 2SNMA 2VXWA 3OW7A 1GHKA 4A3MG 2J7ZA 2F1MA 2ZXPA 1Z9FA 2F0DA 4DV4L 2VS1A 2PZUA 1DXMA 1G6PA 1BCPD 1A15A 3MWYW 1Y8PB 2BH2A 3E0JA 1JE5A 4CBVA 1IW7D 4HTHA 2PW5A 3OYYA 2E2IH 3AMUA 2O5JC 3A7LA 5J1ZA 3RD4A 4DUZL 3E9HA 1CKNA 1W6JA 1PVOA 3IRBA 1HUMA 4OELB 1VQ7A 3HP3A 1T5EA 5DLQE 4LMQD 3CKIB 2O5IC 1X55A 1HNWQ 1S5CD 3HOUH 4WJ4A 2KEEA 1U0LA 1ZYRC 2K6AA 5I4DA 3MEFA 1CSPA 4L63B 1E2VA 3FEWX 3M4PA 1V43A 3OMGA 2UUCL 3JC66 1UE5A 4JI6Q 1KQSA 2B63B 4KHVA 4DV0L 3U58A 3M3YB 4OO1H 3GQBA 4OWTB 2EIFA 2WAQE 2BA1A 1V1PB 2XRQD 1PFNA 5GAHC 3C3LA 3ONAB 1YNNC 1ASYA 1LM0A 1SDFA 2AUJD 4NP5A 4ZQ3A 3CP0A 1MJCA 2AHOB 1CKOA 1CSQA 2DN8A 4ID6A 1K8MA 1VQ5A 3AQQA 1HNWL 1M4VA 2I5MX 5EQ0A 1PA6A 2JQOA 1K8OA 4BY7H 3MXGA 2ATWA 1F2ZA 3H94A 2F0UA 2I5HA 1HXYD 5TSSA 1OXSC 2CQOA 4RAUC 3QOLA 4IPGA 4DUYQ 1FJGQ 1E0BA 1HH2P 4ILWA 1D5ZC 1NJIC 3ICEA 2QDBA 2X69A 4RCOA 5C44H 5C5MA 2G5DA 3SDZA 1TWHB 2PI2E 5C4HA 2EYPA 3MXUA 5E1FA 5F2DA 3TP6A 4CDDC 1IBLQ 1HQMC 4BBRG 3J81i 1JC7A 4NXNL 3H0GH 1D6EC 3KUPA 4RGTA 2R93B 2WINB 3HKSA 2K1BA 2CVRA 1K0SA 2X6GA 3K7UC 4C1NI 5KEEA 5IP9G 2K7VA 2SOBA 4JG2A 5COYA 3WWVA 1XPOA 3I4NB 1K83B 1LTID 1Y1VG 4O0AA 4YWMA 2E2JH 4ZUJA 4A3KG 2EYMA 4L5TA 1B4OA 5G3LF 5I6WA 1JCKB 2I07B 3L2PA 1AN8A 1VF5C 4EQOA 2EY5A 2WACA 4ALPA 5DM73 5C5LA 1L0XB 3FP9A 2R3ZA 1EEID 2PNHA 1JORA 1JOKA 4A3DH 3OIPA 1IKMA 1G291 3PCOB 4Y7NB 2Z6KC 2KOLA 1O7IA 4DR1L 1JOOA 1WD1A 1PFSA 1SN8A 2VQEL 1N36L 1KABA 3SR1A 2R92B 3RN5A 3PV0A 3MA2B 5LL6X 2EYLA 3AFPA 1HR0W 3I4MH 3KF6A 5FO8B 4YWLA 1HPCA 2XRSD 1PH1A 3E0EA 1HNXQ 4HJ5A 2LKVA 1EEFD 3HOUG 1KNEA 5DAUA 1O78A 3KF8B 4N8X1 3D6CA 1JB7A 3GTLB 3K8AA 4H13C 4A3FH 4TSSA 2MP1A 4C3HH 3PUZA 4JI5L 3KFUA 4C3JB 2YTVA 1CK1A 1FGUA 2HQEA 4ME3A 1VQIA 3TP5A 1I6HB 2Z6BA 4LF8L 1HTPA 2B2YC 2PI2A 1O7YA 2RDGA 4MZ9A 2GVBA 4UPAA 1W3SA 1XTCD 2XWBB 2BDOA 1SYDA 5IWAQ 3R2TA 5DNFA 4K5VA 3FRPB 1HNXL 4LF9Q 1B53A 3ERQA 3M7GA 4GOPB 3D4RA 1QILA 2WFWA 1P16A 4P73A 4DV3Q 4QGUA 4BY7G 1JJGA 4A4IA 1X6OA 4DAPA 1JT8A 2A5HA 3K81C 1CFMA 1SJHD 5T1IA 4DV2L 3OPOA 4A3BB 3H91A 1R4PB 3EA6A 3VR3A 5D14A 1SMXA 3NXWA 1EY4A 4QIWE 4A3MB 1L0WA 1IXRA 5J3BA 1CA6A 2F3IA 5EPJA 2B3GA 1NY4A 5L37A 3DHQA 3Q24A 4JYAL 1EY0A 3PIP3 1BNZA 4JI3L 3GTKH 3NUCA 3N6RA 1XNQQ 2SNSA 1RKNA 1GD7A 1S4ZA 2CQAA 1TY2A 4DR3L 4R4OA 1LT6D 1TWGB 4LF9L 1HQRD 4KKUA 4L8JA 4F88A 5C0XG 3E3XA 4IPDA 4JI1Q 2E2HH 2DY7A 4JC0A 4FP5D 1ENFA 1VQGA 1ML0D 3I91A 1ILQA 5JVG3 1N34Q 1HRJA 5BR8Q 3FMCA 3CCLA 4X3KA 3O13A 1G2TA 1XMOL 1CA5A 5KIXA 1B9MA 2K52A 2MUYA 2ZTEA 4KK7A 1H9SB 3VDYA 2F0KA 3PF4A 4FF3A 4IUQA 2I46A 1PYWD 4EX5A 2K5HA 1LT4D 3K0YA 3V96A 1HNZL 3PGZA 3CRKC 3CC2A 1YZ6A 4J6HA 4NW2A 4IO9A 4A3DG 2RDFA 1UE7A 1XNQL 1Z47A 1L2FA 1IYJB 5FLXc 4MIUA 1KRSA 3BVGA 2F3VA 2HDLA 5KNCA 3KLRA 1SNMA 2GA4B 2KA7A 5ELDA 4X62Q 2R7DA 3NTHA 4JI1L 2FXQA 1LV9A 3F2BA 5I6YA 3QJYA 1G91A 4OX9Q 1BKBA 4Z9CB 4ZKBB 5C3WA 3T1HQ 2F0MA 2KBNA 3FHWA 3I4MG 3A5UA 2ZJQA 5BR8L 2YU9H 2WAQG 4FNFA 4QL5A 2FHTA 4LFAL 1NBWA 1JJ2A 4QQBX 1Q8IA 3L9AX 1N32Q 1DD2A 1KL9A 1F9QA 2RSOA 4KY7A 4B3TQ 3BYYB 4C2MB 4FF4A 1NUCA 1SMYC 1TXYA 4A3FG 2ZTCA 4JCVE 3ULJA 4NPSA 3S17B 4IUPA 2X6LA 2E5LQ 1BBXC 1YNJC 2OCEA 3ND9A 3BDOA 3I2ZA 2WIIB 1QB5D 1CQFA 4ZAIA 3J81c 1BDOA 3VYSA 1EFID 3I55A 4UDUC 3CCEA 1K28A 4HCSA 3OHXC 1EYGA 4RG1A 3JAMi 3T1HL 1II3A 3S1RH 2F0WA 2VY3A 3KJOA 2K5NA 1D1IA 2DUDA 4K0KQ 3GTPH 3PUWA 3BS1A 5EPLA 1KHIA 1Y1VB 4O42A 4G7ZC 3EBEA 3TEHB 1NTGA 2KECA 1B44D 5ELBA 5FJ8H 4A3KB 5FLXL 4B3TL 4BY1H 1OO9B 3I72A 1TWCH 3OWEB 2R7ZH 3TSSA 3SEBA 1QE6A 3GTMB 1L1OA 1EIYB 5JJKA 2CWAA 4DAMA 2N8NA 3CRLC 1X56A 2RCFA 4R4QA 3GV6A 2K5DA 4RHRA 1PYSB 2D5DA 1S40A 3NBHA 3CCUA 1LTBD 4NXML 1ESFA 1EOTA 3G48A 5M5XB 1RDPD 2D0PA 2XNAC 2HHHQ 2K03A 4A3LH 2PQAA 2IJ0A 1WCMH 2L5TA 4ZK9B 3C1FA 5IT9c 2PO4A 4JVZA 1OXTA 4K0KL 1OXUA 4GLVB 3S1QH 3DXJC 1O7LA 1PZKD 2A74C 3TDQA 3PO2G 4DK0A 1MSHA 1N9WA 1JICA 3Q23A 1VQMA 5KGUA 3QOJA 2I0QA 4UY8C 3J81L 5JEAG 2Y0SE 1CKNB 4X3UA 4FVMA 4IOAA 2Q2TA 1C7YA 5BN5A 2EJMA 3E9IA 4P2CB 1ONLA 4RKLA 4G4KA 4RGOS 2OEOA 3HOZB 3X3NA 2PZWA 5JVH3 3SK5A 4GKKQ 2A69C 1CUKA 2NN6H 2RCNA 1K3RA 4HSPA 4EQ5A 3T56B 2DJFC 2NZOA 3Q8DA 4LUOA 1QVCA 4A75A 1F2MA 4DR2Q 1FVIA 1LTLA 2R6GA 2NVXB 2Z4IA 1GKHA 3A7AB 1K3BC 1EL0A 3PMFA 1YNXA 1PH8A 4LF5L 1PV4A 4YWKA 4PZ8A 2NVTH 3BVZA 2QCPX 5HY6A 4B3SL 3FDTA 2QGQA 3SGIA 3P20A 4GOPC 2BE5D 3VR4A 3PQIA 4CKCA 3RZOB 1XNRL 2WB1E 2XIWA 1MGSA 3U4VA 3GTJB 4A93H 5IYBG 3A56A 3B6YA 2VNUD 1VQJA 1JB3A 5IT9L 4KLKA 1GO3E 3VA5A 2EJGC 4GKKL 4QY7A 3J7A5 5C3EH 1O7ZA 2QDLA 1SYCA 4HJ8A 4IPCA 4P75A 2NTSA 3T13A 4DV6L 4KV6A 4A3EG 5M3MB 1GUGA 4DR2L 3ITPA 3I7FA 4A3JB 3KOJA 3RUZA 5A2QL 1B9NA 5GADC 1FNVA 4LF7Q 2JA8H 5M5WH 3SK4A 4GNXC 3HOWH 3EFXD 3EIVA 2EY2A 5EBDA 1LT5D 1FNUA 4JBWA 3J7AV 4A3IH 1DOMA 4LFBQ 4X3SA 2NB0A 1TWFB 3CC4A 2DNEA 2B8GA 1BBUA 2B2WC 4X3TA 3CCQA 4GN3B 5CC4A 3CC7A 2A73B 3U9OA 3ULLA 4AIMA 4X66Q 4JI7Q 5C0XI 3TMEA 4LF4L 4UAIA 4A3CH 5ELOA 3T4AC 5C4JB 2UUAQ 1I50H 1EYCA 1PH7A 1VF7A 1GM5A 4O2DA 4BA2I 1IYVA 4B3MQ 4HIMA 2DY8A 1QG7A 1X3PA 2PCFB 4KN7C 3CCMA 1RTNA 3L3OC 3MXNB 1RL2A 4DV7Q 2EVBA 3A5ZB 2RA4A 4DR4Q 4TVAB 1OTCA 1YIJA 4DV1Q 2IX3A 1VQFA 1Y1WH 3OMCA 1KIXA 3OW2A 5M5YH 3RN2A 3KDFA 2QEXA 2JA7G 3S16B 3OTOQ 4P74A 1B1ZA 1I4QA 1SR3A 2RHQB 4F8MA 3K5NA 3MAQA 2F0VA 1PRTD 2A6HD 2N55A 1QUQA 5IYCG 4IURA 3CCRA 3KF6B 5EJWA 2EYOA 1R4QB 4RFBA 4OONA 4EGVA 2IWHA 4XT3B 1X9NA 4WFN3 3DEOA 3DEPA 3QWNA 4PMWA 1TS5A 3KJPA 1S3OA 2AWNA 1Q1BA 1J5EQ 1RHPA 3DM1A 1TWAB 4GLAC 2NN6G 2XN9C 1DJRD 3R8BA 3TP7A 2YV5A 1HFGA 4U673 4B9WA 4ZYSA 4X64Q 5IGDA 3FKIH 2F0FA 4IQZA 3N52A 5KNDA 1SXTA 4CKBA 2BDNA 2YTYA 1CZWA 1F9PA 5GAGC 2L11A 1NE3A 4OXPA 5ELEA 1Q1EA 1I4XA 4HAEA 2FMMA 3TRZA 1KAWA 2B29A 3K80C 4KMUC 5D3IB 2VUMH 1D8LA 2JA6B 4YCUA 4BS9A 4RCNA 3S1NH 2CWPA 2AQ1B 4Q0FA 2FFKB 1A6XA 1XWEA 2JA5H 1PTOB 3QG1A 1IL2A 3MTSA 1V1OA 1D5XC 3A55A 4X64L 2QILA 2F0EA 1ICFB 3BJUA 1YHQA 1B3AA 4QCLA 2JA8G 3G71A 5C4XH 2CHBD 3HOWG 1WTPA 1XXGA 3HG9A 4XT1B 3RZDB 4JI6L 3S2DH 1JWUD 5IODA 1DCZA 3PUXA 1ET6A 3PO2B 2QW7A 1VQCA 1GUNA 3HFZB 3TS0A 2TSSA 4R8IA 3PO3G 1HZAA 2IT1A 1PH9A 1VQDA 1EOVA 5CV9A 3WDNA 1CTMA 3K7AB 2JYOA 3HRZC 2RF4A 3S1MH 1VMPA 1Q12A 3GTOH 1G8ZD 4P71A 3MC0B 2NBFA 5IOCA 1C48A 3UDFA 1LACA 5IYDG 1EY7A 1QCBD 2G9HD 5M3FG 1WTVA 3NENA 2Y0SG 1EU4A 4R4IA 3T1YQ 1UUPA 1KDCA 1ENAA 4MTNA 5GAEC 3G6EA 1WD0A 2F0JA 4XYQA 5FLMH 1XMQQ 1TKWB 5K36G 1UEBA 5IIFA 4DUYL 1FJGL 5C6AA 3I56A 4AQYQ 2F03A 2K28A 1FGBD 1SFOH 4C3IG 2K33A 1A2TA 5A35A 2AKWB 3CCJA 4G7HC 1PYBA 1K9MC 1IBLL 2Z4HA 2K75A 1SYEA 1STAA 1QNKA 3EJIA 1NR2A 3H15A 1NCVA 5CV4A 4CJ2C 4FXGC 1EU3A 5EKKA 3HOVB 1H9KA 3F2UA 1PH2A 5EPKA 1JMCA 3S14B 4OWXB 3BYTB 3W3AA 4HJ7A 4A3EB 2V4DA 2WB1G 2N88A 3E5SA 3LWUA 3T1YL 3NWTA 4DXFA 4MNOA 3PF5A 2FINB 2K5QA 1DZ1A 2NVQB 1HHVA 1U5KA 1XMQL 5C4ZA 3IFTA 3W1GA 4R4TA 4L5QA 1NAPA 1KDBA 3F2CA 2OTLA 4AQYL 2EY1A 4DAYA 1AFPA 2OQ0A 3GTQB 1HJPA 3FKIG 2HQLA 1HR0Q 3HZXA 3HOYH 3C2PA 2GN5A 2O2LD 2ASBA 3D8GA 4FXDA 1PH5A 3X3MA 3GTPB 5NUCA 2L12A 4G57A 2F0TA 3HEJA 2NYZD 4LJZC 4OO1G 1Q90A 4CDEC 4KJNA 2HDMA 4JV5Q 1XPUA 1BF4A 2I5LX 3M4OB 5T1GA 2VUMG 2K4KA 4BA1I 4AYBE 4E6IA 2CW0C 1EY5A 2Q2HA 3I70A 3U50C 2JA5G 4OL7A 3CPFA 1SAPA 1L1OB 4XDXA 3UI2A 3H3VH 5EBCA 4WJ3M 4G7OC 4AH6A 4N9TA 3NBHB 4N9PA 4DK1A 5C4XG 5E4WC 1PLFA 3GV3A 2JA7B 4IFDI 2EOTA 4L5SA 1KTKA 1ESRA 2PQAB 4K8JA 4KD3A 1PH3A 1NR4A 2ID0A 2Z9HA 1I5FA 2B63H 4ZKCB 3LNNA 3J80i 3M3YH 1CT1D 1B8AA 5G3LD 5C44G 1LTRD 1RODA 2ZM6Q 1PMRA 2LS01 1YNND 4KY6A 3DWQA 4FO2A 3STBC 2EXZA 2KQ3A 3GD7A 5IWAL 2K14A 2AQ3B 3H0GG 1B70B 4GNXB 1A3TA 2EY6A 3UDXA 2NVYB 1BQQT 3BZDB 4LK1C 3HKZE 2AMCB 4RHSA 4IPHA 5LL6S 4DV3L 4KY5A 2IL8A 4K2KA 4HEDA 2HD3A 2HIVA 3GO5A 5FLMG 3CF5A 4A3GH 1V9PA 2JSOA 3S15B 2Z0SA 3W1BA 4KHPQ 4YCWA 2D9UA 3OSOA 2WV6D 1I3QB 3A8KE 4OHJA 3GTGB 4JI2Q 2F4VQ 3CCSA 5H1SE 2A6EC 2H1EA 4Y52H 1SE3A 3RLOA 2ZM6L 5JOBA 2VW9A 1R9TB 1WVLA 2M2LA 2LXJA 1H9JA 1WI5A 4H02A 1S5DD 5HGQA 4PMBA 3NE5B 1G2SA 4YIJA 1HTLD 2RVLA 4A76A 4RKBA 1KXLA 2R93H 1PTOC 4GZYC 4ZRZA 1MIUA 2D2CC 2LMCB 5ELCA 1X3FA 1UE1A 1N34L 1JQYD 4QJFA 3E6ZX 3DUZA 4L6TB 2D0OA 2KCTA 4OWWB 2VB2X 3I4NH 1K83H 2DGYA 3FPPA
chains in the Genus database with same CATH topology
2QGQA 1X55A 3SGIA 1HNWQ 2MO0A 3HOUH 4WJ4A 4GOPC 1U0LA 2JA9A 1IBMQ 3MEFA 1CSPA 1XNRL 2WB1E 3U4VA 3HOYG 5IY0A 3S16H 2V1CC 3M4PA 4A93H 2A19A 5IYBG 1EIFA 1V43A 3B6YA 3M9BA 2VNUD 2UUCL 3JC66 5IP7H 1UE5A 2JJQA 4JI6Q 1KQSA 1VQJA 2YYZA 4DV0L 2KHIA 4KLKA 1GO3E 3U58A 5JJLA 5GROA 4GKKL 4QY7A 4OWTB 2EIFA 5C3EH 3J7A5 2WAQE 4Y7NH 4HJ8A 2BA1A 4IPCA 1MJEA 3HOZG 1ASZA 4P75A 1TWAH 3U4ZA 3UE1A 4X62L 2UXBQ 4DNIA 4DV6L 4POFA 4DV2Q 1LYLA 4DK3C 4A3EG 4YHHQ 5GAHC 4DR2L 1VQ8A 1Q86C 2OWOA 3RNUA 4OX9L 3I7FA 2R92H 4JI8L 1ASYA 1HZ9A 3KOJA 1LM0A 4XTCS 5GADC 1Q46A 1YHAA 4LF7Q 2JA8H 3CP0A 5M5WH 1MJCA 2AHOB 1CKOA 1HR0L 1CSQA 3W5OA 4X65L 4GNXC 1VQ5A 3CMEA 1PH6A 3HOWH 4J15A 3EIVA 4JYAQ 4IFDJ 3AQQA 1HNWL 4JBWA 2I5MX 4JI3Q 4A3IH 1I94Q 1PA6A 1N32L 2JQOA 4LFBQ 1GVPA 4BY7H 2ATWA 4UP7A 3CC4A 2DGYA 1IBML 1BBUA 4DR3Q 4LUVA 4LF6Q 2I5HA 3CCQA 1VQHA 3A74A 2IX1A 3GTLH 2HIXA 2LSSA 3A0JA 4JV5L 4GN3B 1OXSC 2CQOA 2Q2IA 3CC7A 3PSIA 4IPGA 4DUYQ 1FJGQ 2E5LL 3ULLA 1HH2P 4C3JH 2D62A 3KDFB 4AIMA 4X66Q 1K73C 1NJIC 2R7FA 5C0XI 2MNAA 4JI7Q 4LF4L 2JA6H 3ICEA 1BBWA 1M90C 5ELOA 4PZ6A 2UUAQ 4A3CH 5C44H 1AE3A 1XMOQ 2PI2E 1I50H 2UXBL 1PH7A 1GM5A 1WOCA 4O2DA 4BA2I 4B3MQ 1IBLQ 4HIMA 1E24A 3BU2A 4NB3A 4BBRG 1QUQB 3J81i 4IOCA 2UU9Q 3CCMA 3DM3A 1YHBA 4NXNL 4YY3Q 3BZKA 3H0GH 5M3MG 1HNZQ 3CD6A 3HKSA 3MXNB 1RL2A 4DV7Q 3TS2A 3A5ZB 4A3JG 2C35B 3K7UC 2ZJRA 4HIDA 4TVAB 1OTCA 4DR4Q 1C9OA 1YI2A 5IP9G 1YIJA 1I94L 4DV1Q 2CFMA 1VQFA 1Y1WH 1T9HA 4JG2A 3OW2A 5M5YH 1UE6A 4PG3A 3PIPA 3WWVA 1KIXA 1XPOA 4B3SL 3RN2A 3KDFA 3KLWA 2NN6I 2QEXA 2JA7G 5E7NA 3EN2A 3OTOQ 1Y1VG 2VQFQ 4O0AA 4P74A 3RZDH 4LF6L 4YWMA 2E2JH 4JI4Q 1SR3A 3F8TA 2RHQB 4A3KG 4L5TA 3CAMA 3GDEA 3L2PA 3PO2H 1P8LA 2RHSB 4A3GG 5IYCG 1QUQA 4ALPA 3CCRA 1TWHH 4B3RQ 3CXCA 3KF6B 4A3BH 1VQLA 4LFAQ 2F52A 3FP9A 4LUZA 1HZCA 2AWOA 4OONA 2PNHA 3K7AH 1X9NA 4A3MH 2HHHL 2JK8A 4DKAC 4PMWA 3KJPA 4A3DH 1E7ZA 1G291 1S3OA 3PCOB 2AWNA 1Q1BA 2Z6KC 1YJNA 1J5EQ 1O7IA 2KENA 4YY3L 4DR1L 4LFCQ 2MO1A 4GLAC 3DLLA 4L5RC 1PFSA 1SN8A 2VQEL 2NN6G 1N36L 1YVCA 4FDBA 3RN5A 3PV0A 2YV5A 1XPRA 4OO1I 1L1OC 1TWGH 3AFPA 1A63A 1HR0W 4X64Q 1YBYA 3I4MH 3L7ZC 3KF6A 4GLXA 4KHPL 2YTXA 3UE0A 3FKIH 1H95A 3F2DA 1HZBA 3NELA 4GN4B 4YWLA 5JJIA 1PH1A 4APVA 3CMAA 3I4NG 3E0EA 1HNXQ 4HJ5A 4JI2L 2F4VL 2YTYA 3TQYA 3HOUG 5GAGC 2ES2A 2EXDA 3BZCA 3KF8B 4AYBG 1VQOA 1JB7A 1NE3A 4OXPA 1Q1EA 4B3RL 4JOIA 4POGA 3K8AA 1JJCB 1NMGA 4A3FH 1Q82C 3TRZA 1KAWA 5IYBH 2B29A 1OXXK 2MQHA 4C3HH 3K80C 3PUZA 1QZHA 4JI5L 3KFUA 2JEBI 2VUMH 2PMZE 1D8LA 5IP7G 3J80c 4YCUA 2YTVA 3S1NH 2CWPA 1FGUA 3TREA 1A0IA 4GN5A 4ME3A 3HOVH 1A8VA 1VQIA 2JA5H 3S14H 4LF8L 1IL2A 4A3EH 5EAYA 4R4CA 2PI2A 2L15A 1N8RC 1EFWA 4KI0A 4MZ9A 2GVBA 4X64L 4UPAA 1W3SA 2NVQH 3BJUA 5IWAQ 1YHQA 2UUBQ 4NXMQ 2JA8G 3G71A 5C4XH 2E8GA 2H5XA 3HOWG 1HNXL 4LF9Q 3CW2C 4GKJQ 1YEZA 3CPWA 3GTQH 4GOPB 1SRUA 2ALYB 2WFWA 1P16A 4P73A 4JI6L 1EQRA 4DV3Q 3M85A 4QGUA 3S2DH 4BY7G 4DR7Q 3PUXA 4BY1G 1J6QA 5FJ8G 1VQKA 1JJGA 4HIOA 4BXXH 4A4IA 4KHZA 1VQCA 5C0XJ 1X6OA 1OXVA 3HFZB 2B63G 3TS0A 2R7ZG 2OTJA 2N49A 1VCIA 2IHFA 3HOXH 3PO3G 1JT8A 1HZAA 4C2MH 3K81C 2IT1A 1PH9A 2KHJA 2XTIA 1E1TA 1VQDA 3HKZG 4LWCA 4DV2L 1AH9A 4YHHL 1CKMA 1EOVA 1SMXA 1I6HH 2XGTA 3M4OH 4QIWE 1SE8A 1L0WA 3S17H 2RF4A 2EQSA 1IXRA 2JA6G 1Q12A 5J3BA 3J7ZC 3S1MH 2GVAA 3GTOH 3D31A 4LF7L 2CKZB 2F3IA 2B3GA 1NY4A 2IY5B 4P71A 1SLJA 4GOPA 3UDFA 4JYAL 5IYDG 2KCMA 1VS0A 4DV5Q 1QVFA 4JI3L 5M3FG 3GTKH 4A3LG 3M7NA 4LFBL 2WP8J 4DV4Q 1XNQQ 1WCMG 2Y0SG 3NENA 2UUBL 1GD7A 4R4IA 4DR3L 3T1YQ 4R4OA 4LF9L 1KC8C 4MTNA 5C0XG 5GAEC 5IP9H 4IPDA 3G6EA 4JI1Q 2E2HH 5FLMH 1XMQQ 1WYDA 5K36G 4JC0A 1UEBA 3F1ZA 4DUYL 1VQGA 1FJGL 2JA7H 1N34Q 3I56A 4LW1A 1Y1VH 4AQYQ 3LGJA 1DGSA 4JI0Q 4X66L 5BR8Q 4LF5Q 4JI7L 4JBJA 2BH8A 1SFOH 3CCLA 3J81j 4A3KH 2UUAL 4B3SQ 5LMNQ 1XMOL 4X6AH 2AKWB 3CCJA 1PYBA 2K52A 1K9MC 3AEVA 4B3ML 5IYCH 2ZTEA 1IBLL 3GTMH 2K75A 3STBD 3VDYA 4BBSH 3PF4A 2UU9L 1XNRQ 4DAYB 4GNXA 2OQKA 4A3BG 4EX5A 2K5HA 3H15A 1HNZL 4RMFA 4DV7L 3PGZA 2UUCQ 1KRTA 3CC2A 1YZ6A 5IE8A 1K8AC 4IO9A 2IHEA 4DR4L 4DV0Q 4A3DG 2R93G 4DV5L 1X54A 5M5XH 1UE7A 4DV1L 1PH2A 1JMCA 4DPGA 2NVYH 4OWXB 1XNQL 4HJ7A 1Z47A 1IZ6A 1L2FA 1IYJB 1Y14B 2N3SA 5FLXc 2WB1G 1KRSA 3T1YL 1N33Q 3JAMc 1WJJA 3OTOL 2VQFL 5LMUQ 4MNOA 3PF5A 4X62Q 4JI4L 2R7DA 4DV6Q 1E1OA 4JI1L 1K0RA 1VQ6A 1U5KA 2FXQA 3F2BA 1XMQL 1NMFA 1VQBA 2A1AA 3W1GA 3CCVA 4R4TA 4OX9Q 1BKBA 4L5QA 3T1HQ 2HT1A 3KYHC 3F2CA 4AQYL 1G51A 2KBNA 3FHWA 2OTLA 2K50A 3A5UA 4JI0L 3I4MG 2OQ0A 4P72A 3PUVA 5BR8L 2ZJQA 1HJPA 1VQEA 3FKIG 2HQLA 2WAQG 1HR0Q 2YU9H 2CCZA 3HOYH 3S15H 2GN5A 4QL5A 3AFQA 4LFAL 1NBWA 5LMNL 1JJ2A 2ASBA 4QQBX 4DR5Q 2Q2UA 3L0OA 4A93G 1A62A 1SROA 1FL0A 3M4QA 1N32Q 1I3QH 2ZJPA 1PH5A 3GTGH 1KL9A 3S24A 1EWIA 1J5EL 4B3TQ 2VL6A 4OO1G 4LFCL 1Q7YC 1R9TH 1VQPA 2UXCQ 1TXYA 4A3FG 1YJ9A 2ZTCA 3H3VI 4R1JA 4JCVE 5C3EG 4JV5Q 3ULJA 1XPUA 3HOZH 2I5LX 4NPSA 3PUYA 2VUMG 4LNQA 2K4KA 4BA1I 2E5LQ 1Q81C 3NEMA 1S72A 4AYBE 2OCEA 2R92G 1RIPA 3I2ZA 2Q2HA 4LF4Q 4XIGS 3HOVG 1N33L 4TQUS 1B7YB 3U50C 2JA5G 2JE6I 3J81c 5LMUL 3CPFA 2UXDQ 1Q8KA 3I55A 1YITA 2NVXH 2LXKA 4HJ9A 3CCEA 1L1OB 1PHJA 1EYGA 1C0AA 1M1KC 4RG1A 4DK6C 3JAMi 3T1HL 3H3VH 1QZGA 4A3IG 2IX0A 1UWVA 3S1RH 4WJ3M 2VY3A 2QA4A 4NXNQ 4AH6A 4UP9A 3KJOA 3NBHB 2K5NA 3D0FA 1QVGA 2JEAI 5C4XG 2DUDA 1VQ4A 4K0KQ 1E3PA 3GTPH 4DR5L 3PUWA 1EUJA 3RZOH 4IFDI 1KHIA 2Z6KA 1X3EA 4HIKA 3UDGA 3PIOA 3EBEA 4L5SA 3ERSX 1NTGA 2NZHA 2PQAB 3TEHB 3GTJH 4BY1H 5FJ8H 1KD1C 4IJLA 4B3TL 1PH3A 1YJWA 1XJVA 2ID0A 1I5FA 1TWCH 3G4SA 4GS3A 4BXXG 3RLFA 2UXCL 2B63H 2R7ZH 2K5VA 3I4OA 3PO3H 3J80i 3M3YH 3HOXG 4A3CG 1B8AA 1L1OA 5C44G 1EIYB 1E22A 2CWAA 5JJKA 1X3GA 4DAMA 3ZJYC 2N8NA 2ZM6Q 1X56A 1AE2A 5JEAJ 1PH4A 4R4QA 1V1QA 2VZAA 3STBC 4BBRH 1PYSB 1S40A 3S2HH 3CCUA 3GD7A 5IWAL 4DR6Q 5M3MH 4NXML 2K14A 3H0GG 1B70B 3RR5A 3G48A 4GNXB 4JOIC 2UXDL 3UDXA 2D0PA 4A3JH 2HHHQ 5AJ3Q 3CQZH 4GKJL 2MFIA 5IYDH 3RLNA 4A3LH 2PQAA 4YCVA 3HKZE 5M3FH 4IFDG 2AMCB 2N78A 1WCMH 4DR1Q 1Y1WG 4IPHA 4DUZQ 4DV3L 1VQNA 5IT9c 4DR7L 1BVSA 2VQEQ 1MKHA 1IBKQ 1N36Q 1OXTA 4UP8A 4K0KL 1WFQA 1OXUA 4GLVB 1VQAA 1TWFH 2HIVA 3S1QH 4JBMA 3GO5A 5GQOA 5FLMG 3K0XA 3UDIA 2BA0A 3CF5A 3PO2G 4A3GH 1N9WA 3ER0A 1V9PA 2A8VA 1X65A 1VQMA 3AYHB 5ELNA 2Z0SA 3W1BA 5LMNW 4HJAA 2I0QA 4UY8C 1XTDA 4YCWA 5JEAG 2Y0SE 1CKNB 4KHPQ 4C3IH 4IOAA 2Q2TA 1C7YA 1D7QA 4JI2Q 2F4VQ 3CCSA 5H1SE 3E9IA 4Y52H 1LUZA 3RLOA 2ZM6L 4A3MG 2VW9A 5C4JH 1Z9FA 4BBSG 3ULPA 1VQ9A 2LXJA 4IJHA 1WI5A 4H02A 5HGQA 2VS1A 4DV4L 4GKKQ 4DR6L 1CUKA 2RCNA 1G6PA 1K3RA 2BH2A 4A76A 4EQ5A 4JI5Q 5AJ3L 4JBKA 1KXLA 2NZOA 3Q8DA 1JE5A 1QVCA 4LUOA 4A75A 4PZ7A 3OYYA 2E2IH 2R93H 1EQQA 1MIUA 1W2BA 4DR2Q 4DUZL 1FVIA 1X3FA 1LTLA 1UE1A 3E9HA 1K8GA 2R6GA 4JI8Q 1CKNA 1GKHA 1IBKL 1N34L 1PVOA 4QJFA 3IRBA 1YNXA 1PH8A 1VQ7A 4LF5L 1PV4A 2D0OA 4LF8Q 2KCTA 5DLQE 4YWKA 4X65Q 4OWWB 4PZ8A 2NVTH 3I4NH 1K83H 2ZTDA 5HY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGQ A;  1X55 A;  3SGI A;  1HNW Q;  2MO0 A;  3HOU H;  4WJ4 A;  4GOP C;  1U0L A;  2JA9 A;  1IBM Q;  3MEF A;  1CSP A;  1XNR L;  2WB1 E;  3U4V A;  3HOY G;  5IY0 A;  3S16 H;  2V1C C;  3M4P A;  4A93 H;  2A19 A;  5IYB G;  1EIF A;  1V43 A;  3B6Y A;  3M9B A;  2VNU D;  2UUC L;  3JC6 6;  5IP7 H;  1UE5 A;  2JJQ A;  4JI6 Q;  1KQS A;  1VQJ A;  2YYZ A;  4DV0 L;  2KHI A;  4KLK A;  1GO3 E;  3U58 A;  5JJL A;  5GRO A;  4GKK L;  4QY7 A;  4OWT B;  2EIF A;  5C3E H;  3J7A 5;  2WAQ E;  4Y7N H;  4HJ8 A;  2BA1 A;  4IPC A;  1MJE A;  3HOZ G;  1ASZ A;  4P75 A;  1TWA H;  3U4Z A;  3UE1 A;  4X62 L;  2UXB Q;  4DNI A;  4DV6 L;  4POF A;  4DV2 Q;  1LYL A;  4DK3 C;  4A3E G;  4YHH Q;  5GAH C;  4DR2 L;  1VQ8 A;  1Q86 C;  2OWO A;  3RNU A;  4OX9 L;  3I7F A;  2R92 H;  4JI8 L;  1ASY A;  1HZ9 A;  3KOJ A;  1LM0 A;  4XTC S;  5GAD C;  1Q46 A;  1YHA A;  4LF7 Q;  2JA8 H;  3CP0 A;  5M5W H;  1MJC A;  2AHO B;  1CKO A;  1HR0 L;  1CSQ A;  3W5O A;  4X65 L;  4GNX C;  1VQ5 A;  3CME A;  1PH6 A;  3HOW H;  4J15 A;  3EIV A;  4JYA Q;  4IFD J;  3AQQ A;  1HNW L;  4JBW A;  2I5M X;  4JI3 Q;  4A3I H;  1I94 Q;  1PA6 A;  1N32 L;  2JQO A;  4LFB Q;  1GVP A;  4BY7 H;  2ATW A;  4UP7 A;  3CC4 A;  2DGY A;  1IBM L;  1BBU A;  4DR3 Q;  4LUV A;  4LF6 Q;  2I5H A;  3CCQ A;  1VQH A;  3A74 A;  2IX1 A;  3GTL H;  2HIX A;  2LSS A;  3A0J A;  4JV5 L;  4GN3 B;  1OXS C;  2CQO A;  2Q2I A;  3CC7 A;  3PSI A;  4IPG A;  4DUY Q;  1FJG Q;  2E5L L;  3ULL A;  1HH2 P;  4C3J H;  2D62 A;  3KDF B;  4AIM A;  4X66 Q;  1K73 C;  1NJI C;  2R7F A;  5C0X I;  2MNA A;  4JI7 Q;  4LF4 L;  2JA6 H;  3ICE A;  1BBW A;  1M90 C;  5ELO A;  4PZ6 A;  2UUA Q;  4A3C H;  5C44 H;  1AE3 A;  1XMO Q;  2PI2 E;  1I50 H;  2UXB L;  1PH7 A;  1GM5 A;  1WOC A;  4O2D A;  4BA2 I;  4B3M Q;  1IBL Q;  4HIM A;  1E24 A;  3BU2 A;  4NB3 A;  4BBR G;  1QUQ B;  3J81 i;  4IOC A;  2UU9 Q;  3CCM A;  3DM3 A;  1YHB A;  4NXN L;  4YY3 Q;  3BZK A;  3H0G H;  5M3M G;  1HNZ Q;  3CD6 A;  3HKS A;  3MXN B;  1RL2 A;  4DV7 Q;  3TS2 A;  3A5Z B;  4A3J G;  2C35 B;  3K7U C;  2ZJR A;  4HID A;  4TVA B;  1OTC A;  4DR4 Q;  1C9O A;  1YI2 A;  5IP9 G;  1YIJ A;  1I94 L;  4DV1 Q;  2CFM A;  1VQF A;  1Y1W H;  1T9H A;  4JG2 A;  3OW2 A;  5M5Y H;  1UE6 A;  4PG3 A;  3PIP A;  3WWV A;  1KIX A;  1XPO A;  4B3S L;  3RN2 A;  3KDF A;  3KLW A;  2NN6 I;  2QEX A;  2JA7 G;  5E7N A;  3EN2 A;  3OTO Q;  1Y1V G;  2VQF Q;  4O0A A;  4P74 A;  3RZD H;  4LF6 L;  4YWM A;  2E2J H;  4JI4 Q;  1SR3 A;  3F8T A;  2RHQ B;  4A3K G;  4L5T A;  3CAM A;  3GDE A;  3L2P A;  3PO2 H;  1P8L A;  2RHS B;  4A3G G;  5IYC G;  1QUQ A;  4ALP A;  3CCR A;  1TWH H;  4B3R Q;  3CXC A;  3KF6 B;  4A3B H;  1VQL A;  4LFA Q;  2F52 A;  3FP9 A;  4LUZ A;  1HZC A;  2AWO A;  4OON A;  2PNH A;  3K7A H;  1X9N A;  4A3M H;  2HHH L;  2JK8 A;  4DKA C;  4PMW A;  3KJP A;  4A3D H;  1E7Z A;  1G29 1;  1S3O A;  3PCO B;  2AWN A;  1Q1B A;  2Z6K C;  1YJN A;  1J5E Q;  1O7I A;  2KEN A;  4YY3 L;  4DR1 L;  4LFC Q;  2MO1 A;  4GLA C;  3DLL A;  4L5R C;  1PFS A;  1SN8 A;  2VQE L;  2NN6 G;  1N36 L;  1YVC A;  4FDB A;  3RN5 A;  3PV0 A;  2YV5 A;  1XPR A;  4OO1 I;  1L1O C;  1TWG H;  3AFP A;  1A63 A;  1HR0 W;  4X64 Q;  1YBY A;  3I4M H;  3L7Z C;  3KF6 A;  4GLX A;  4KHP L;  2YTX A;  3UE0 A;  3FKI H;  1H95 A;  3F2D A;  1HZB A;  3NEL A;  4GN4 B;  4YWL A;  5JJI A;  1PH1 A;  4APV A;  3CMA A;  3I4N G;  3E0E A;  1HNX Q;  4HJ5 A;  4JI2 L;  2F4V L;  2YTY A;  3TQY A;  3HOU G;  5GAG C;  2ES2 A;  2EXD A;  3BZC A;  3KF8 B;  4AYB G;  1VQO A;  1JB7 A;  1NE3 A;  4OXP A;  1Q1E A;  4B3R L;  4JOI A;  4POG A;  3K8A A;  1JJC B;  1NMG A;  4A3F H;  1Q82 C;  3TRZ A;  1KAW A;  5IYB H;  2B29 A;  1OXX K;  2MQH A;  4C3H H;  3K80 C;  3PUZ A;  1QZH A;  4JI5 L;  3KFU A;  2JEB I;  2VUM H;  2PMZ E;  1D8L A;  5IP7 G;  3J80 c;  4YCU A;  2YTV A;  3S1N H;  2CWP A;  1FGU A;  3TRE A;  1A0I A;  4GN5 A;  4ME3 A;  3HOV H;  1A8V A;  1VQI A;  2JA5 H;  3S14 H;  4LF8 L;  1IL2 A;  4A3E H;  5EAY A;  4R4C A;  2PI2 A;  2L15 A;  1N8R C;  1EFW A;  4KI0 A;  4MZ9 A;  2GVB A;  4X64 L;  4UPA A;  1W3S A;  2NVQ H;  3BJU A;  5IWA Q;  1YHQ A;  2UUB Q;  4NXM Q;  2JA8 G;  3G71 A;  5C4X H;  2E8G A;  2H5X A;  3HOW G;  1HNX L;  4LF9 Q;  3CW2 C;  4GKJ Q;  1YEZ A;  3CPW A;  3GTQ H;  4GOP B;  1SRU A;  2ALY B;  2WFW A;  1P16 A;  4P73 A;  4JI6 L;  1EQR A;  4DV3 Q;  3M85 A;  4QGU A;  3S2D H;  4BY7 G;  4DR7 Q;  3PUX A;  4BY1 G;  1J6Q A;  5FJ8 G;  1VQK A;  1JJG A;  4HIO A;  4BXX H;  4A4I A;  4KHZ A;  1VQC A;  5C0X J;  1X6O A;  1OXV A;  3HFZ B;  2B63 G;  3TS0 A;  2R7Z G;  2OTJ A;  2N49 A;  1VCI A;  2IHF A;  3HOX H;  3PO3 G;  1JT8 A;  1HZA A;  4C2M H;  3K81 C;  2IT1 A;  1PH9 A;  2KHJ A;  2XTI A;  1E1T A;  1VQD A;  3HKZ G;  4LWC A;  4DV2 L;  1AH9 A;  4YHH L;  1CKM A;  1EOV A;  1SMX A;  1I6H H;  2XGT A;  3M4O H;  4QIW E;  1SE8 A;  1L0W A;  3S17 H;  2RF4 A;  2EQS A;  1IXR A;  2JA6 G;  1Q12 A;  5J3B A;  3J7Z C;  3S1M H;  2GVA A;  3GTO H;  3D31 A;  4LF7 L;  2CKZ B;  2F3I A;  2B3G A;  1NY4 A;  2IY5 B;  4P71 A;  1SLJ A;  4GOP A;  3UDF A;  4JYA L;  5IYD G;  2KCM A;  1VS0 A;  4DV5 Q;  1QVF A;  4JI3 L;  5M3F G;  3GTK H;  4A3L G;  3M7N A;  4LFB L;  2WP8 J;  4DV4 Q;  1XNQ Q;  1WCM G;  2Y0S G;  3NEN A;  2UUB L;  1GD7 A;  4R4I A;  4DR3 L;  3T1Y Q;  4R4O A;  4LF9 L;  1KC8 C;  4MTN A;  5C0X G;  5GAE C;  5IP9 H;  4IPD A;  3G6E A;  4JI1 Q;  2E2H H;  5FLM H;  1XMQ Q;  1WYD A;  5K36 G;  4JC0 A;  1UEB A;  3F1Z A;  4DUY L;  1VQG A;  1FJG L;  2JA7 H;  1N34 Q;  3I56 A;  4LW1 A;  1Y1V H;  4AQY Q;  3LGJ A;  1DGS A;  4JI0 Q;  4X66 L;  5BR8 Q;  4LF5 Q;  4JI7 L;  4JBJ A;  2BH8 A;  1SFO H;  3CCL A;  3J81 j;  4A3K H;  2UUA L;  4B3S Q;  5LMN Q;  1XMO L;  4X6A H;  2AKW B;  3CCJ A;  1PYB A;  2K52 A;  1K9M C;  3AEV A;  4B3M L;  5IYC H;  2ZTE A;  1IBL L;  3GTM H;  2K75 A;  3STB D;  3VDY A;  4BBS H;  3PF4 A;  2UU9 L;  1XNR Q;  4DAY B;  4GNX A;  2OQK A;  4A3B G;  4EX5 A;  2K5H A;  3H15 A;  1HNZ L;  4RMF A;  4DV7 L;  3PGZ A;  2UUC Q;  1KRT A;  3CC2 A;  1YZ6 A;  5IE8 A;  1K8A C;  4IO9 A;  2IHE A;  4DR4 L;  4DV0 Q;  4A3D G;  2R93 G;  4DV5 L;  1X54 A;  5M5X H;  1UE7 A;  4DV1 L;  1PH2 A;  1JMC A;  4DPG A;  2NVY H;  4OWX B;  1XNQ L;  4HJ7 A;  1Z47 A;  1IZ6 A;  1L2F A;  1IYJ B;  1Y14 B;  2N3S A;  5FLX c;  2WB1 G;  1KRS A;  3T1Y L;  1N33 Q;  3JAM c;  1WJJ A;  3OTO L;  2VQF L;  5LMU Q;  4MNO A;  3PF5 A;  4X62 Q;  4JI4 L;  2R7D A;  4DV6 Q;  1E1O A;  4JI1 L;  1K0R A;  1VQ6 A;  1U5K A;  2FXQ A;  3F2B A;  1XMQ L;  1NMF A;  1VQB A;  2A1A A;  3W1G A;  3CCV A;  4R4T A;  4OX9 Q;  1BKB A;  4L5Q A;  3T1H Q;  2HT1 A;  3KYH C;  3F2C A;  4AQY L;  1G51 A;  2KBN A;  3FHW A;  2OTL A;  2K50 A;  3A5U A;  4JI0 L;  3I4M G;  2OQ0 A;  4P72 A;  3PUV A;  5BR8 L;  2ZJQ A;  1HJP A;  1VQE A;  3FKI G;  2HQL A;  2WAQ G;  1HR0 Q;  2YU9 H;  2CCZ A;  3HOY H;  3S15 H;  2GN5 A;  4QL5 A;  3AFQ A;  4LFA L;  1NBW A;  5LMN L;  1JJ2 A;  2ASB A;  4QQB X;  4DR5 Q;  2Q2U A;  3L0O A;  4A93 G;  1A62 A;  1SRO A;  1FL0 A;  3M4Q A;  1N32 Q;  1I3Q H;  2ZJP A;  1PH5 A;  3GTG H;  1KL9 A;  3S24 A;  1EWI A;  1J5E L;  4B3T Q;  2VL6 A;  4OO1 G;  4LFC L;  1Q7Y C;  1R9T H;  1VQP A;  2UXC Q;  1TXY A;  4A3F G;  1YJ9 A;  2ZTC A;  3H3V I;  4R1J A;  4JCV E;  5C3E G;  4JV5 Q;  3ULJ A;  1XPU A;  3HOZ H;  2I5L X;  4NPS A;  3PUY A;  2VUM G;  4LNQ A;  2K4K A;  4BA1 I;  2E5L Q;  1Q81 C;  3NEM A;  1S72 A;  4AYB E;  2OCE A;  2R92 G;  1RIP A;  3I2Z A;  2Q2H A;  4LF4 Q;  4XIG S;  3HOV G;  1N33 L;  4TQU S;  1B7Y B;  3U50 C;  2JA5 G;  2JE6 I;  3J81 c;  5LMU L;  3CPF A;  2UXD Q;  1Q8K A;  3I55 A;  1YIT A;  2NVX H;  2LXK A;  4HJ9 A;  3CCE A;  1L1O B;  1PHJ A;  1EYG A;  1C0A A;  1M1K C;  4RG1 A;  4DK6 C;  3JAM i;  3T1H L;  3H3V H;  1QZG A;  4A3I G;  2IX0 A;  1UWV A;  3S1R H;  4WJ3 M;  2VY3 A;  2QA4 A;  4NXN Q;  4AH6 A;  4UP9 A;  3KJO A;  3NBH B;  2K5N A;  3D0F A;  1QVG A;  2JEA I;  5C4X G;  2DUD A;  1VQ4 A;  4K0K Q;  1E3P A;  3GTP H;  4DR5 L;  3PUW A;  1EUJ A;  3RZO H;  4IFD I;  1KHI A;  2Z6K A;  1X3E A;  4HIK A;  3UDG A;  3PIO A;  3EBE A;  4L5S A;  3ERS X;  1NTG A;  2NZH A;  2PQA B;  3TEH B;  3GTJ H;  4BY1 H;  5FJ8 H;  1KD1 C;  4IJL A;  4B3T L;  1PH3 A;  1YJW A;  1XJV A;  2ID0 A;  1I5F A;  1TWC H;  3G4S A;  4GS3 A;  4BXX G;  3RLF A;  2UXC L;  2B63 H;  2R7Z H;  2K5V A;  3I4O A;  3PO3 H;  3J80 i;  3M3Y H;  3HOX G;  4A3C G;  1B8A A;  1L1O A;  5C44 G;  1EIY B;  1E22 A;  2CWA A;  5JJK A;  1X3G A;  4DAM A;  3ZJY C;  2N8N A;  2ZM6 Q;  1X56 A;  1AE2 A;  5JEA J;  1PH4 A;  4R4Q A;  1V1Q A;  2VZA A;  3STB C;  4BBR H;  1PYS B;  1S40 A;  3S2H H;  3CCU A;  3GD7 A;  5IWA L;  4DR6 Q;  5M3M H;  4NXM L;  2K14 A;  3H0G G;  1B70 B;  3RR5 A;  3G48 A;  4GNX B;  4JOI C;  2UXD L;  3UDX A;  2D0P A;  4A3J H;  2HHH Q;  5AJ3 Q;  3CQZ H;  4GKJ L;  2MFI A;  5IYD H;  3RLN A;  4A3L H;  2PQA A;  4YCV A;  3HKZ E;  5M3F H;  4IFD G;  2AMC B;  2N78 A;  1WCM H;  4DR1 Q;  1Y1W G;  4IPH A;  4DUZ Q;  4DV3 L;  1VQN A;  5IT9 c;  4DR7 L;  1BVS A;  2VQE Q;  1MKH A;  1IBK Q;  1N36 Q;  1OXT A;  4UP8 A;  4K0K L;  1WFQ A;  1OXU A;  4GLV B;  1VQA A;  1TWF H;  2HIV A;  3S1Q H;  4JBM A;  3GO5 A;  5GQO A;  5FLM G;  3K0X A;  3UDI A;  2BA0 A;  3CF5 A;  3PO2 G;  4A3G H;  1N9W A;  3ER0 A;  1V9P A;  2A8V A;  1X65 A;  1VQM A;  3AYH B;  5ELN A;  2Z0S A;  3W1B A;  5LMN W;  4HJA A;  2I0Q A;  4UY8 C;  1XTD A;  4YCW A;  5JEA G;  2Y0S E;  1CKN B;  4KHP Q;  4C3I H;  4IOA A;  2Q2T A;  1C7Y A;  1D7Q A;  4JI2 Q;  2F4V Q;  3CCS A;  5H1S E;  3E9I A;  4Y52 H;  1LUZ A;  3RLO A;  2ZM6 L;  4A3M G;  2VW9 A;  5C4J H;  1Z9F A;  4BBS G;  3ULP A;  1VQ9 A;  2LXJ A;  4IJH A;  1WI5 A;  4H02 A;  5HGQ A;  2VS1 A;  4DV4 L;  4GKK Q;  4DR6 L;  1CUK A;  2RCN A;  1G6P A;  1K3R A;  2BH2 A;  4A76 A;  4EQ5 A;  4JI5 Q;  5AJ3 L;  4JBK A;  1KXL A;  2NZO A;  3Q8D A;  1JE5 A;  1QVC A;  4LUO A;  4A75 A;  4PZ7 A;  3OYY A;  2E2I H;  2R93 H;  1EQQ A;  1MIU A;  1W2B A;  4DR2 Q;  4DUZ L;  1FVI A;  1X3F A;  1LTL A;  1UE1 A;  3E9H A;  1K8G A;  2R6G A;  4JI8 Q;  1CKN A;  1GKH A;  1IBK L;  1N34 L;  1PVO A;  4QJF A;  3IRB A;  1YNX A;  1PH8 A;  1VQ7 A;  4LF5 L;  1PV4 A;  2D0O A;  4LF8 Q;  2KCT A;  5DLQ E;  4YWK A;  4X65 Q;  4OWW B;  4PZ8 A;  2NVT H;  3I4N H;  1K83 H;  2ZTD A;  5HY6 A; 
#chains in the Genus database with same CATH topology
 4HR7 B;  5M5W B;  2DJG C;  2MO0 A;  3W2D A;  5ISR A;  1WTO A;  2KCC A;  4PV1 C;  3HOY G;  4B08 A;  2V1C C;  1EIF A;  1UAP A;  4C3H G;  2Z8L A;  3M9B A;  5IP7 H;  2JJQ A;  3PO3 B;  5JJL A;  1TR5 A;  1SNP A;  3S9W A;  2SEB D;  2B2T A;  4Y7N H;  1ZEQ X;  1ASZ A;  4BBR B;  4X62 L;  2UXB Q;  4DNI A;  3IL8 A;  5FLX E;  4YHH Q;  4XYO A;  1I50 B;  1SYG A;  4IUT A;  1Q86 C;  4B9X A;  1VQ8 A;  2OWO A;  4OX9 L;  2R92 H;  5KNB A;  1IKL A;  3CQZ B;  1Q46 A;  4TKO B;  2XSC A;  2FMC A;  5M3F B;  1TII D;  1L0Y B;  1RTO A;  3W5O A;  2PW7 A;  2Y0S B;  4J15 A;  4KTA A;  3PIO 3;  1BOS A;  1N32 L;  1KLU D;  3MEH A;  2KVM A;  3OOC A;  2ZT9 C;  2NWG A;  5CV5 A;  1U9R A;  2IX1 A;  1I4P A;  1CHP D;  3QB3 A;  3GTL H;  2LSS A;  2B2U A;  1O80 A;  3PSI A;  3K59 A;  1PTO F;  4C3I B;  2E5L L;  2F0N A;  4C3J H;  3KDF B;  3MFY A;  2R7F A;  4QF4 A;  3VR5 A;  4ME5 A;  5BN3 A;  2MNA A;  1M90 C;  4PZ6 A;  4RGN A;  2UXB L;  3ND8 A;  4M8A A;  4DNR B;  1E24 A;  3J81 E;  1U4L A;  4NB3 A;  3NTK A;  1QUQ B;  1Q3L A;  2UU9 Q;  3VYU A;  1YHB A;  3BZK A;  2E2I B;  3CD6 A;  1A3U A;  1BCP C;  1F2L A;  4K2L A;  4LAA A;  4WJW A;  2C35 B;  5D3D A;  2C9O A;  2WB1 B;  5KRU A;  1C9O A;  1YI2 A;  1IW7 C;  2F0S A;  4K6L A;  4K5W A;  3PIP A;  1SSO A;  4K6D A;  1UNS A;  1VMC A;  3EQL C;  2VQF Q;  1PXU A;  3HOU B;  2WKC A;  2M9V A;  3HS0 C;  1M8A A;  4JI4 Q;  3CAM A;  3GDE A;  4F7X A;  5JPM C;  4A3G G;  3A8I E;  5COR A;  3CXC A;  4A3B H;  1VQL A;  1U4R A;  2F52 A;  4LUZ A;  1HZC A;  2B2V A;  2AWO A;  4QB4 A;  1KNA A;  4A3M H;  2HHH L;  4DKA C;  2QF7 A;  2F3W A;  3DMU A;  1E7Z A;  4LFC Q;  4WRD A;  3DLL A;  3MZ5 A;  1F9R A;  1DOK A;  3BDL A;  4KJO A;  1YVC A;  1EIG A;  4FDB A;  2EDG A;  1S5B D;  1SE2 A;  1LAB A;  5IT9 E;  4OO1 I;  1L1O C;  1TWG H;  1A63 A;  1TU2 B;  1STN A;  3BG3 A;  3AB9 A;  3DWA A;  3T51 B;  3L7Z C;  2ZXR A;  4TRD A;  5AFW A;  5CR3 A;  3NQI A;  3F2D A;  1HZB A;  3NEL A;  4GN4 B;  5JJI A;  1BUV T;  3CMA A;  4JPB W;  3I4N G;  4BY7 B;  1VDZ A;  1EZ6 A;  2NZ1 D;  3I4L A;  5A2Q E;  3BZC A;  4AYB G;  4CGY B;  1VQO A;  4WOR A;  4JOI A;  5HUR A;  4POG A;  1JJC B;  1NMG A;  3AU7 A;  1Q82 C;  1SEB D;  2RSN A;  1BCP F;  1QZH A;  2JEB I;  2PMZ E;  5IP7 G;  3J80 c;  2ENB A;  4M1U B;  4XQQ A;  4ZCK A;  5C44 B;  4V0B A;  3TRE A;  2RBM A;  4GN5 A;  1TT2 A;  3Q22 A;  1WTW A;  1STH A;  3H0G B;  2L15 A;  1EFW A;  2SDF A;  4KI0 A;  2BCO A;  1Z7T A;  2UUB Q;  5I2X A;  2E8G A;  3NBI A;  1QJO A;  3U9S A;  2HCC A;  3TZU A;  5M9O A;  4GKJ Q;  1YEZ A;  3R3O A;  1Y8O B;  2PZT A;  5FOB B;  2E2J B;  3M85 A;  2K05 A;  4DR7 Q;  1BR9 A;  4BY1 G;  5FJ8 G;  1VQK A;  1SMY D;  4BXX H;  4KHZ A;  5C0X J;  1OXV A;  2OTJ A;  2R7Z G;  5K5P A;  2IHF A;  2L1B A;  3HOX H;  4C2M H;  2KHJ A;  1U4M A;  2XTI A;  3HKZ G;  1C4Q A;  4LWC A;  2K32 A;  1AH9 A;  4IUV A;  1CKM A;  4RH6 A;  1YNJ D;  4C3J G;  1SE8 A;  1STB A;  3S17 H;  2EQS A;  3J7Z C;  2F0O A;  2GVA A;  3D31 A;  4LF7 L;  4A3D B;  3VYT A;  2KCN A;  2IY5 B;  2F0P A;  2FJ2 A;  3ERO A;  4DXG A;  2KCM A;  4DV5 Q;  4A3L G;  4LFB L;  2WP8 J;  4DV4 Q;  2AUK A;  1WCM G;  2PYK A;  2UUB L;  5CMD A;  3R2I A;  2A68 D;  3KLS X;  3KLS A;  4R9W A;  3T53 B;  2F0G A;  1NSN S;  3J80 L;  3J7Y W;  3IAY A;  2VB3 X;  3TZD A;  5IP9 H;  3QO2 A;  3I4M B;  5I9P A;  5E4X A;  1IHZ A;  1WYD A;  1GUT A;  2WAQ B;  1QNU A;  2IPK D;  5CBE E;  4LW1 A;  1Y1V H;  3LGJ A;  4X66 L;  4JI7 L;  5I9O A;  2BH8 A;  1S5F D;  1B2T A;  3J81 j;  4A3K H;  2UUA L;  2RQX A;  2ZXO A;  5LMN Q;  4X6A H;  1AW7 A;  3K6O A;  4B3M L;  4A3F B;  3GTM H;  1X32 A;  4BBS H;  4C3H B;  1U4P A;  1GOZ A;  2RKS A;  4DAY B;  1LT3 D;  2OQK A;  4A3B G;  1E2W A;  4RMF A;  2EE1 A;  4DV7 L;  2HUG A;  1JWS D;  2UUC Q;  5IGG A;  1K8A C;  4DR4 L;  4DV0 Q;  5CV8 A;  1Z6H A;  1X54 A;  2ICI A;  5M5X H;  4DV5 L;  4DV1 L;  3IFD A;  1IZ6 A;  1I4H A;  1Y14 B;  3JAM c;  3OTO L;  1SND A;  1B50 A;  2XVS A;  1BXT A;  1E1O A;  2MGS A;  4CDC C;  1VQ6 A;  4OGQ C;  1VQB A;  4FF2 A;  1GUW A;  2EYH A;  3SK6 A;  2HT1 A;  3KYH C;  1G51 A;  4P72 A;  1C0A A;  4QUC A;  4C1N K;  3AFQ A;  2Z1C A;  5LMN L;  3I8Z A;  4A93 G;  1ICW A;  3M4Q A;  2ZJP A;  4K5X A;  3NSW A;  1EWI A;  1J5E L;  4R8N A;  2A69 D;  1Q7Y C;  1VQP A;  1TS4 A;  2UXC Q;  4FYD A;  1DYQ A;  4KD4 A;  3H3V I;  4U68 A;  5C3E G;  3D4W A;  3HOZ H;  1MHW C;  1RD9 D;  1GJX A;  3PUY A;  2KED A;  4NDX A;  3NEM A;  1FR3 A;  1GUO A;  1RIP A;  5ELF A;  1LTA D;  1F9S A;  4TQU S;  2MJ8 A;  5KYL A;  1EWC A;  3GTK B;  3VR6 A;  1KDA A;  1YIT A;  2NVX H;  2LXK A;  1SNC A;  1PHJ A;  2EYF A;  3JAM E;  4DK6 C;  4A3I G;  1UWV A;  2QA4 A;  4NXN Q;  4UP9 A;  3MXP A;  2E2H B;  5J39 A;  1QVG A;  3R93 A;  4PMC A;  5CGK A;  2R61 A;  1EUJ A;  3RZO H;  3NWS A;  2Z6K A;  1V8Q A;  1X3E A;  4HIK A;  3UDG A;  3ERS X;  3GTJ H;  2NZH A;  5CYU A;  2PQE A;  1EYA A;  3P1H A;  2L0C A;  1KD1 C;  1XJV A;  1HA5 A;  3JAM L;  5JJZ A;  4GS3 A;  1EQV A;  3RLF A;  4BXX G;  4A3G B;  2UXC L;  1I4R A;  2K5V A;  4MTK A;  1HFN A;  3HOX G;  4A3C G;  1J9O A;  1H9R A;  1E22 A;  5FO9 B;  1QWY A;  3ZJY C;  1AE2 A;  5JEA J;  1PH4 A;  4ABN A;  2VZA A;  1LTG D;  4EQP A;  3S2H H;  4FXK C;  4DR6 Q;  3D6W A;  5M3M H;  4NMZ A;  1CI3 M;  4A3J H;  5AJ3 Q;  1X3Q A;  4YCV A;  3SHL A;  1F77 A;  1WTH A;  2N78 A;  2QKI C;  5J22 A;  4DR1 Q;  3T16 A;  5JAV A;  1Y1W G;  1VQN A;  1BVS A;  2VQE Q;  1MKH A;  4ZUI A;  1N36 Q;  1IBK Q;  3K5M A;  5C0X H;  1VQA A;  1CZG A;  2LY7 A;  3Q6S A;  1TWF H;  3NHH A;  3K0X A;  3UDI A;  1TS3 A;  2YU9 B;  2BA0 A;  2F0H A;  2PPB C;  3AYH B;  4HJA A;  1NNX A;  4BWG B;  1EYD A;  1SE4 A;  2TMP A;  2PNR C;  4AYB B;  4DAV A;  2B2Y A;  1KAA A;  1PRT B;  1RF2 D;  1LUZ A;  5C4J H;  4H44 C;  4BBS G;  5EKI A;  3ULP A;  4IJH A;  1VQ9 A;  2B8F A;  1MSG A;  4XQN A;  3MXN A;  1Y8N B;  4DR6 L;  2O4X A;  1BCP B;  4JI5 Q;  5AJ3 L;  4JBK A;  3CU7 A;  1S5E D;  2OT2 A;  4PZ7 A;  4CJ1 B;  1EQQ A;  1W2B A;  1K8G A;  3A8J E;  4JI8 Q;  1IBK L;  2C5C A;  1T5X D;  2G9D A;  4LF8 Q;  4X65 Q;  3S1R B;  4QUF A;  4FF1 A;  2ZTD A;  3S16 H;  3P7J A;  4QIW B;  1EY9 A;  4JW0 A;  4O1N A;  2JA9 A;  3G6J B;  4I7Z C;  1IBM Q;  4ZLT F;  2NUC A;  5IY0 A;  3TBI B;  2A19 A;  4ODG A;  4BY1 B;  5DM6 3;  1TWC B;  5EGT A;  2R7Z B;  2YYZ A;  1IL8 A;  2KHI A;  3G7L A;  5GRO A;  3HKZ B;  3D3R A;  1AZQ A;  3OIQ A;  1LLR D;  1MJE A;  3HOZ G;  1XYI A;  1TWA H;  3U4Z A;  3UE1 A;  1HCZ A;  4POF A;  4DV2 Q;  1LYL A;  4DK3 C;  3NQT A;  3SVM A;  3A54 A;  4CKE A;  3RNU A;  4JI8 L;  4C56 C;  1HZ9 A;  4XTC S;  1YHA A;  5HGT A;  1ZYR D;  5FK9 C;  1HR0 L;  4X65 L;  4V19 0;  1QOH A;  3MHB A;  1WCM B;  3CME A;  1PH6 A;  1C8C A;  4JYA Q;  4IFD J;  3I3C A;  4IUN A;  5CBA E;  1I94 Q;  4JI3 Q;  1GVP A;  1ENC A;  1MD2 D;  4UP7 A;  3S1Q B;  2JXM B;  1IBM L;  3TP8 A;  1PZI D;  4N8F A;  4DR3 Q;  4KN4 C;  4LUV A;  4IAL A;  4LF6 Q;  1V1P A;  1VQH A;  3A74 A;  3V2T A;  2HIX A;  3A0J A;  4JV5 L;  1RCV D;  4DU9 A;  2Q2I A;  2BOS A;  2D62 A;  1D2B A;  1JWM D;  1K73 C;  2JA6 H;  1BBW A;  1XMO Q;  1AE3 A;  3I90 A;  1WOC A;  2M00 A;  1PTO H;  3BU2 A;  4IOC A;  3DM3 A;  4YY3 Q;  2EJF C;  5M3M G;  1HNZ Q;  1LO5 D;  3TS2 A;  4A3J G;  4HCE A;  4K14 A;  2ZJR A;  4HID A;  3VYR A;  4KKT A;  4CJ0 B;  1I94 L;  3C1E A;  2CFM A;  1SNO A;  1T9H A;  1UE6 A;  4PG3 A;  3SXH A;  3K5O A;  3KLW A;  2NVT B;  2NN6 I;  5E7N A;  3EN2 A;  3RZD H;  4LF6 L;  1JE4 A;  3H3V C;  3F8T A;  1MBY A;  5C3X A;  2IW3 A;  4I7A A;  3NK9 A;  3PO2 H;  1P8L A;  2RHS B;  3URY A;  5IGF A;  5E3F A;  2L4N A;  4A93 B;  5JEA H;  2BE5 C;  1TWH H;  4B3R Q;  2WKD A;  1JOQ A;  4LFA Q;  1WTX A;  4S3S A;  3K7A H;  4PQX A;  2JK8 A;  2JN4 A;  3NTI A;  5C3E B;  4PNY A;  3CHB D;  1YJN A;  2EYJ A;  2KEN A;  2MHV A;  4YY3 L;  2MO1 A;  4L5R C;  2Q8R E;  1A2U A;  3QR8 A;  4HN7 A;  2HCI A;  1XPR A;  2JA8 B;  3P75 A;  1ZKO A;  3Q0A A;  3HOW B;  1SNQ A;  1YBY A;  5D65 A;  1ZXT A;  4GLX A;  4KHP L;  2YTX A;  3UE0 A;  1H95 A;  4A3I B;  4APV A;  2L9H A;  3NP8 A;  3TN2 A;  3J7A F;  4JI2 L;  2F4V L;  4H0L C;  1F2Y A;  3K5L A;  3TQY A;  1PFB A;  2ES2 A;  1SYF A;  2E75 C;  4HMJ A;  2EXD A;  2DNC A;  5FO7 B;  4B3R L;  4QMG A;  3NPP A;  1UEA B;  4HSV A;  5IYB H;  2MQH A;  1OXX K;  4K8I A;  4F87 A;  3K57 A;  2F0Q A;  4J8Q A;  3HOX B;  2E74 C;  1A0I A;  5KYI A;  4JK1 C;  3HOV H;  1A8V A;  3S14 H;  2H4O A;  2AQ2 B;  4XQJ A;  4A3E H;  5EAY A;  4R4C A;  3LX0 A;  2CH4 W;  1N8R C;  3KF8 A;  4DGZ A;  1HA6 A;  2NVQ H;  3SK8 A;  4DN4 M;  4NXM Q;  5I2Y A;  2H5X A;  1Y1W B;  5M5Y B;  1DOL A;  3CW2 C;  5IGC A;  1D5M C;  3CPW A;  3GTQ H;  3ZYY X;  1SRU A;  2ALY B;  1EQR A;  5CV7 A;  1J6Q A;  2A68 C;  2E76 C;  2KHS A;  4HIO A;  4J1M A;  3VA7 A;  2B63 G;  2N49 A;  1VCI A;  4CDF C;  1D1K A;  1CQV A;  1E1T A;  1PRT C;  1W6K A;  4YHH L;  2A6H C;  5CV6 A;  2XGT A;  2CW0 D;  3KBG A;  1WTQ A;  3M4O H;  1I6H H;  1LTT D;  2JA6 G;  5IGE A;  1E2Z A;  3FVQ A;  4BBS B;  2CKZ B;  2NTT A;  1XX8 A;  3SE0 A;  1SLJ A;  1CM9 A;  4GOP A;  1GXD C;  1VS0 A;  2OXP A;  4IFD H;  1QVF A;  1SJE D;  1GHJ A;  4Q5V A;  3M7N A;  1AZP A;  2RDH A;  1I6V C;  4RWS C;  4DFA A;  2B39 A;  1AP0 A;  1KC8 C;  2B2T C;  5LHY 1;  4EQN A;  3FKI B;  3F1Z A;  3I73 A;  2XWJ B;  2JA7 H;  2PMZ B;  1DGS A;  2J0T D;  4JI0 Q;  4I65 A;  4LF5 Q;  4JBJ A;  3HGB A;  4B3S Q;  1TQO A;  2OF1 A;  3AEV A;  5IYC H;  2KUM A;  3STB D;  4MHE A;  1PFM A;  3MFG A;  2UU9 L;  1XNR Q;  4GNX A;  2VUM B;  3BDC A;  4DNT B;  1STG A;  2P5Z X;  4DF7 A;  2F0I A;  3S1N B;  1G6Z A;  2MPM A;  2JP1 A;  1KRT A;  5IE8 A;  2F4I A;  2IHE A;  4DA2 A;  2R93 G;  2JA5 B;  2B2U C;  4DPG A;  2B2W A;  2NVY H;  1RJT A;  1KLG D;  1AEX A;  1I4G A;  4HMI A;  4IUU A;  2N3S A;  3VR2 A;  3MVV A;  1N33 Q;  1WJJ A;  2VQF L;  5LMU Q;  2Q8T A;  1JR0 D;  4JI4 L;  1FYC A;  4DV6 Q;  1EY6 A;  3WOF A;  1K0R A;  2K01 A;  1NMF A;  2EZV A;  2A1A A;  3CCV A;  3FPU B;  2K04 A;  1PRT F;  1H9S A;  5C4X B;  4RGM A;  1TS2 A;  3EVQ A;  2K50 A;  3QIA A;  4JI0 L;  3PUV A;  1VQE A;  1MI2 A;  2CCZ A;  3S15 H;  3S2D B;  2A6E D;  3RMH A;  4DR5 Q;  3L0O A;  2Q2U A;  1A62 A;  1EIH A;  1SRO A;  1FL0 A;  2K5W A;  3DWP A;  1I3Q H;  3GTG H;  3S24 A;  1SYB A;  3LWE A;  2VL6 A;  1DM0 B;  1ET9 A;  3M4Y A;  4LFC L;  2QEJ C;  5EKL A;  1R9T H;  1YJ9 A;  2CH4 A;  4R1J A;  2E2D C;  4RA8 A;  1PTO D;  1Y69 U;  4LNQ A;  3S1M B;  4CHT B;  1Q81 C;  1WTR A;  3GTO B;  1S72 A;  4IZ8 A;  2R92 G;  4LF4 Q;  3HOV G;  4XIG S;  4OIJ A;  1N33 L;  1H9M A;  4UHV A;  1B7Y B;  2LFN A;  1FD7 D;  2JE6 I;  5LMU L;  3C46 A;  1STE A;  1PDQ A;  1Q8K A;  1LTS D;  2UXD Q;  3S2H B;  4HJ9 A;  3GP7 A;  4OIK A;  5FKA C;  2B2V C;  1HUN A;  1M1K C;  1PZJ D;  1QZG A;  2IX0 A;  4H7B A;  1SBB B;  1DON A;  1EZ8 A;  3D0F A;  2JEA I;  1VQ4 A;  1E3P A;  4DR5 L;  4OEM B;  1FNW A;  1A3V A;  3PIO A;  1SFO B;  4EVO A;  4IJL A;  1EWH A;  1YJW A;  2L55 A;  3G4S A;  2F0L A;  1J8I A;  3J80 E;  1TVX A;  2KJX A;  3I4O A;  3PO3 H;  3WOE A;  3D4D A;  1TY0 A;  1X3G A;  2Q8I B;  4ULL A;  5BN4 A;  3K58 A;  1V1Q A;  4BBR H;  1ILP A;  3BVM A;  4NKL A;  4XXE A;  1EQT A;  3RR5 A;  2UXD L;  4JOI C;  3H09 A;  2ICE C;  4IN3 A;  1EY8 A;  3CQZ H;  4GKJ L;  2MFI A;  5IYD H;  3RLN A;  5M3F H;  4IFD G;  3KK7 A;  1GUS A;  4DUZ Q;  4DR7 L;  1STY A;  4UP8 A;  3OWF A;  1WFQ A;  1IYU A;  3V05 A;  4JBM A;  3IKJ A;  5GQO A;  5K36 H;  2J4X A;  3ER0 A;  2A8V A;  3HOY B;  5JPN C;  1X65 A;  3KBX A;  5ELN A;  1CHQ D;  5LMN W;  1BO0 A;  1XTD A;  5DEH A;  5IGB A;  1B3Q A;  4C3I H;  3H6M A;  4KKS A;  4MN3 A;  2EPB A;  1D7Q A;  2SNM A;  2VXW A;  3OW7 A;  1GHK A;  4A3M G;  2J7Z A;  2F1M A;  2ZXP A;  1Z9F A;  2F0D A;  4DV4 L;  2VS1 A;  2PZU A;  1DXM A;  1G6P A;  1BCP D;  1A15 A;  3MWY W;  1Y8P B;  2BH2 A;  3E0J A;  1JE5 A;  4CBV A;  1IW7 D;  4HTH A;  2PW5 A;  3OYY A;  2E2I H;  3AMU A;  2O5J C;  3A7L A;  5J1Z A;  3RD4 A;  4DUZ L;  3E9H A;  1CKN A;  1W6J A;  1PVO A;  3IRB A;  1HUM A;  4OEL B;  1VQ7 A;  3HP3 A;  1T5E A;  5DLQ E;  4LMQ D;  3CKI B;  2O5I C;  1X55 A;  1HNW Q;  1S5C D;  3HOU H;  4WJ4 A;  2KEE A;  1U0L A;  1ZYR C;  2K6A A;  5I4D A;  3MEF A;  1CSP A;  4L63 B;  1E2V A;  3FEW X;  3M4P A;  1V43 A;  3OMG A;  2UUC L;  3JC6 6;  1UE5 A;  4JI6 Q;  1KQS A;  2B63 B;  4KHV A;  4DV0 L;  3U58 A;  3M3Y B;  4OO1 H;  3GQB A;  4OWT B;  2EIF A;  2WAQ E;  2BA1 A;  1V1P B;  2XRQ D;  1PFN A;  5GAH C;  3C3L A;  3ONA B;  1YNN C;  1ASY A;  1LM0 A;  1SDF A;  2AUJ D;  4NP5 A;  4ZQ3 A;  3CP0 A;  1MJC A;  2AHO B;  1CKO A;  1CSQ A;  2DN8 A;  4ID6 A;  1K8M A;  1VQ5 A;  3AQQ A;  1HNW L;  1M4V A;  2I5M X;  5EQ0 A;  1PA6 A;  2JQO A;  1K8O A;  4BY7 H;  3MXG A;  2ATW A;  1F2Z A;  3H94 A;  2F0U A;  2I5H A;  1HXY D;  5TSS A;  1OXS C;  2CQO A;  4RAU C;  3QOL A;  4IPG A;  4DUY Q;  1FJG Q;  1E0B A;  1HH2 P;  4ILW A;  1D5Z C;  1NJI C;  3ICE A;  2QDB A;  2X69 A;  4RCO A;  5C44 H;  5C5M A;  2G5D A;  3SDZ A;  1TWH B;  2PI2 E;  5C4H A;  2EYP A;  3MXU A;  5E1F A;  5F2D A;  3TP6 A;  4CDD C;  1IBL Q;  1HQM C;  4BBR G;  3J81 i;  1JC7 A;  4NXN L;  3H0G H;  1D6E C;  3KUP A;  4RGT A;  2R93 B;  2WIN B;  3HKS A;  2K1B A;  2CVR A;  1K0S A;  2X6G A;  3K7U C;  4C1N I;  5KEE A;  5IP9 G;  2K7V A;  2SOB A;  4JG2 A;  5COY A;  3WWV A;  1XPO A;  3I4N B;  1K83 B;  1LTI D;  1Y1V G;  4O0A A;  4YWM A;  2E2J H;  4ZUJ A;  4A3K G;  2EYM A;  4L5T A;  1B4O A;  5G3L F;  5I6W A;  1JCK B;  2I07 B;  3L2P A;  1AN8 A;  1VF5 C;  4EQO A;  2EY5 A;  2WAC A;  4ALP A;  5DM7 3;  5C5L A;  1L0X B;  3FP9 A;  2R3Z A;  1EEI D;  2PNH A;  1JOR A;  1JOK A;  4A3D H;  3OIP A;  1IKM A;  1G29 1;  3PCO B;  4Y7N B;  2Z6K C;  2KOL A;  1O7I A;  4DR1 L;  1JOO A;  1WD1 A;  1PFS A;  1SN8 A;  2VQE L;  1N36 L;  1KAB A;  3SR1 A;  2R92 B;  3RN5 A;  3PV0 A;  3MA2 B;  5LL6 X;  2EYL A;  3AFP A;  1HR0 W;  3I4M H;  3KF6 A;  5FO8 B;  4YWL A;  1HPC A;  2XRS D;  1PH1 A;  3E0E A;  1HNX Q;  4HJ5 A;  2LKV A;  1EEF D;  3HOU G;  1KNE A;  5DAU A;  1O78 A;  3KF8 B;  4N8X 1;  3D6C A;  1JB7 A;  3GTL B;  3K8A A;  4H13 C;  4A3F H;  4TSS A;  2MP1 A;  4C3H H;  3PUZ A;  4JI5 L;  3KFU A;  4C3J B;  2YTV A;  1CK1 A;  1FGU A;  2HQE A;  4ME3 A;  1VQI A;  3TP5 A;  1I6H B;  2Z6B A;  4LF8 L;  1HTP A;  2B2Y C;  2PI2 A;  1O7Y A;  2RDG A;  4MZ9 A;  2GVB A;  4UPA A;  1W3S A;  1XTC D;  2XWB B;  2BDO A;  1SYD A;  5IWA Q;  3R2T A;  5DNF A;  4K5V A;  3FRP B;  1HNX L;  4LF9 Q;  1B53 A;  3ERQ A;  3M7G A;  4GOP B;  3D4R A;  1QIL A;  2WFW A;  1P16 A;  4P73 A;  4DV3 Q;  4QGU A;  4BY7 G;  1JJG A;  4A4I A;  1X6O A;  4DAP A;  1JT8 A;  2A5H A;  3K81 C;  1CFM A;  1SJH D;  5T1I A;  4DV2 L;  3OPO A;  4A3B B;  3H91 A;  1R4P B;  3EA6 A;  3VR3 A;  5D14 A;  1SMX A;  3NXW A;  1EY4 A;  4QIW E;  4A3M B;  1L0W A;  1IXR A;  5J3B A;  1CA6 A;  2F3I A;  5EPJ A;  2B3G A;  1NY4 A;  5L37 A;  3DHQ A;  3Q24 A;  4JYA L;  1EY0 A;  3PIP 3;  1BNZ A;  4JI3 L;  3GTK H;  3NUC A;  3N6R A;  1XNQ Q;  2SNS A;  1RKN A;  1GD7 A;  1S4Z A;  2CQA A;  1TY2 A;  4DR3 L;  4R4O A;  1LT6 D;  1TWG B;  4LF9 L;  1HQR D;  4KKU A;  4L8J A;  4F88 A;  5C0X G;  3E3X A;  4IPD A;  4JI1 Q;  2E2H H;  2DY7 A;  4JC0 A;  4FP5 D;  1ENF A;  1VQG A;  1ML0 D;  3I91 A;  1ILQ A;  5JVG 3;  1N34 Q;  1HRJ A;  5BR8 Q;  3FMC A;  3CCL A;  4X3K A;  3O13 A;  1G2T A;  1XMO L;  1CA5 A;  5KIX A;  1B9M A;  2K52 A;  2MUY A;  2ZTE A;  4KK7 A;  1H9S B;  3VDY A;  2F0K A;  3PF4 A;  4FF3 A;  4IUQ A;  2I46 A;  1PYW D;  4EX5 A;  2K5H A;  1LT4 D;  3K0Y A;  3V96 A;  1HNZ L;  3PGZ A;  3CRK C;  3CC2 A;  1YZ6 A;  4J6H A;  4NW2 A;  4IO9 A;  4A3D G;  2RDF A;  1UE7 A;  1XNQ L;  1Z47 A;  1L2F A;  1IYJ B;  5FLX c;  4MIU A;  1KRS A;  3BVG A;  2F3V A;  2HDL A;  5KNC A;  3KLR A;  1SNM A;  2GA4 B;  2KA7 A;  5ELD A;  4X62 Q;  2R7D A;  3NTH A;  4JI1 L;  2FXQ A;  1LV9 A;  3F2B A;  5I6Y A;  3QJY A;  1G91 A;  4OX9 Q;  1BKB A;  4Z9C B;  4ZKB B;  5C3W A;  3T1H Q;  2F0M A;  2KBN A;  3FHW A;  3I4M G;  3A5U A;  2ZJQ A;  5BR8 L;  2YU9 H;  2WAQ G;  4FNF A;  4QL5 A;  2FHT A;  4LFA L;  1NBW A;  1JJ2 A;  4QQB X;  1Q8I A;  3L9A X;  1N32 Q;  1DD2 A;  1KL9 A;  1F9Q A;  2RSO A;  4KY7 A;  4B3T Q;  3BYY B;  4C2M B;  4FF4 A;  1NUC A;  1SMY C;  1TXY A;  4A3F G;  2ZTC A;  4JCV E;  3ULJ A;  4NPS A;  3S17 B;  4IUP A;  2X6L A;  2E5L Q;  1BBX C;  1YNJ C;  2OCE A;  3ND9 A;  3BDO A;  3I2Z A;  2WII B;  1QB5 D;  1CQF A;  4ZAI A;  3J81 c;  1BDO A;  3VYS A;  1EFI D;  3I55 A;  4UDU C;  3CCE A;  1K28 A;  4HCS A;  3OHX C;  1EYG A;  4RG1 A;  3JAM i;  3T1H L;  1II3 A;  3S1R H;  2F0W A;  2VY3 A;  3KJO A;  2K5N A;  1D1I A;  2DUD A;  4K0K Q;  3GTP H;  3PUW A;  3BS1 A;  5EPL A;  1KHI A;  1Y1V B;  4O42 A;  4G7Z C;  3EBE A;  3TEH B;  1NTG A;  2KEC A;  1B44 D;  5ELB A;  5FJ8 H;  4A3K B;  5FLX L;  4B3T L;  4BY1 H;  1OO9 B;  3I72 A;  1TWC H;  3OWE B;  2R7Z H;  3TSS A;  3SEB A;  1QE6 A;  3GTM B;  1L1O A;  1EIY B;  5JJK A;  2CWA A;  4DAM A;  2N8N A;  3CRL C;  1X56 A;  2RCF A;  4R4Q A;  3GV6 A;  2K5D A;  4RHR A;  1PYS B;  2D5D A;  1S40 A;  3NBH A;  3CCU A;  1LTB D;  4NXM L;  1ESF A;  1EOT A;  3G48 A;  5M5X B;  1RDP D;  2D0P A;  2XNA C;  2HHH Q;  2K03 A;  4A3L H;  2PQA A;  2IJ0 A;  1WCM H;  2L5T A;  4ZK9 B;  3C1F A;  5IT9 c;  2PO4 A;  4JVZ A;  1OXT A;  4K0K L;  1OXU A;  4GLV B;  3S1Q H;  3DXJ C;  1O7L A;  1PZK D;  2A74 C;  3TDQ A;  3PO2 G;  4DK0 A;  1MSH A;  1N9W A;  1JIC A;  3Q23 A;  1VQM A;  5KGU A;  3QOJ A;  2I0Q A;  4UY8 C;  3J81 L;  5JEA G;  2Y0S E;  1CKN B;  4X3U A;  4FVM A;  4IOA A;  2Q2T A;  1C7Y A;  5BN5 A;  2EJM A;  3E9I A;  4P2C B;  1ONL A;  4RKL A;  4G4K A;  4RGO S;  2OEO A;  3HOZ B;  3X3N A;  2PZW A;  5JVH 3;  3SK5 A;  4GKK Q;  2A69 C;  1CUK A;  2NN6 H;  2RCN A;  1K3R A;  4HSP A;  4EQ5 A;  3T56 B;  2DJF C;  2NZO A;  3Q8D A;  4LUO A;  1QVC A;  4A75 A;  1F2M A;  4DR2 Q;  1FVI A;  1LTL A;  2R6G A;  2NVX B;  2Z4I A;  1GKH A;  3A7A B;  1K3B C;  1EL0 A;  3PMF A;  1YNX A;  1PH8 A;  4LF5 L;  1PV4 A;  4YWK A;  4PZ8 A;  2NVT H;  3BVZ A;  2QCP X;  5HY6 A;  4B3S L;  3FDT A;  2QGQ A;  3SGI A;  3P20 A;  4GOP C;  2BE5 D;  3VR4 A;  3PQI A;  4CKC A;  3RZO B;  1XNR L;  2WB1 E;  2XIW A;  1MGS A;  3U4V A;  3GTJ B;  4A93 H;  5IYB G;  3A56 A;  3B6Y A;  2VNU D;  1VQJ A;  1JB3 A;  5IT9 L;  4KLK A;  1GO3 E;  3VA5 A;  2EJG C;  4GKK L;  4QY7 A;  3J7A 5;  5C3E H;  1O7Z A;  2QDL A;  1SYC A;  4HJ8 A;  4IPC A;  4P75 A;  2NTS A;  3T13 A;  4DV6 L;  4KV6 A;  4A3E G;  5M3M B;  1GUG A;  4DR2 L;  3ITP A;  3I7F A;  4A3J B;  3KOJ A;  3RUZ A;  5A2Q L;  1B9N A;  5GAD C;  1FNV A;  4LF7 Q;  2JA8 H;  5M5W H;  3SK4 A;  4GNX C;  3HOW H;  3EFX D;  3EIV A;  2EY2 A;  5EBD A;  1LT5 D;  1FNU A;  4JBW A;  3J7A V;  4A3I H;  1DOM A;  4LFB Q;  4X3S A;  2NB0 A;  1TWF B;  3CC4 A;  2DNE A;  2B8G A;  1BBU A;  2B2W C;  4X3T A;  3CCQ A;  4GN3 B;  5CC4 A;  3CC7 A;  2A73 B;  3U9O A;  3ULL A;  4AIM A;  4X66 Q;  4JI7 Q;  5C0X I;  3TME A;  4LF4 L;  4UAI A;  4A3C H;  5ELO A;  3T4A C;  5C4J B;  2UUA Q;  1I50 H;  1EYC A;  1PH7 A;  1VF7 A;  1GM5 A;  4O2D A;  4BA2 I;  1IYV A;  4B3M Q;  4HIM A;  2DY8 A;  1QG7 A;  1X3P A;  2PCF B;  4KN7 C;  3CCM A;  1RTN A;  3L3O C;  3MXN B;  1RL2 A;  4DV7 Q;  2EVB A;  3A5Z B;  2RA4 A;  4DR4 Q;  4TVA B;  1OTC A;  1YIJ A;  4DV1 Q;  2IX3 A;  1VQF A;  1Y1W H;  3OMC A;  1KIX A;  3OW2 A;  5M5Y H;  3RN2 A;  3KDF A;  2QEX A;  2JA7 G;  3S16 B;  3OTO Q;  4P74 A;  1B1Z A;  1I4Q A;  1SR3 A;  2RHQ B;  4F8M A;  3K5N A;  3MAQ A;  2F0V A;  1PRT D;  2A6H D;  2N55 A;  1QUQ A;  5IYC G;  4IUR A;  3CCR A;  3KF6 B;  5EJW A;  2EYO A;  1R4Q B;  4RFB A;  4OON A;  4EGV A;  2IWH A;  4XT3 B;  1X9N A;  4WFN 3;  3DEO A;  3DEP A;  3QWN A;  4PMW A;  1TS5 A;  3KJP A;  1S3O A;  2AWN A;  1Q1B A;  1J5E Q;  1RHP A;  3DM1 A;  1TWA B;  4GLA C;  2NN6 G;  2XN9 C;  1DJR D;  3R8B A;  3TP7 A;  2YV5 A;  1HFG A;  4U67 3;  4B9W A;  4ZYS A;  4X64 Q;  5IGD A;  3FKI H;  2F0F A;  4IQZ A;  3N52 A;  5KND A;  1SXT A;  4CKB A;  2BDN A;  2YTY A;  1CZW A;  1F9P A;  5GAG C;  2L11 A;  1NE3 A;  4OXP A;  5ELE A;  1Q1E A;  1I4X A;  4HAE A;  2FMM A;  3TRZ A;  1KAW A;  2B29 A;  3K80 C;  4KMU C;  5D3I B;  2VUM H;  1D8L A;  2JA6 B;  4YCU A;  4BS9 A;  4RCN A;  3S1N H;  2CWP A;  2AQ1 B;  4Q0F A;  2FFK B;  1A6X A;  1XWE A;  2JA5 H;  1PTO B;  3QG1 A;  1IL2 A;  3MTS A;  1V1O A;  1D5X C;  3A55 A;  4X64 L;  2QIL A;  2F0E A;  1ICF B;  3BJU A;  1YHQ A;  1B3A A;  4QCL A;  2JA8 G;  3G71 A;  5C4X H;  2CHB D;  3HOW G;  1WTP A;  1XXG A;  3HG9 A;  4XT1 B;  3RZD B;  4JI6 L;  3S2D H;  1JWU D;  5IOD A;  1DCZ A;  3PUX A;  1ET6 A;  3PO2 B;  2QW7 A;  1VQC A;  1GUN A;  3HFZ B;  3TS0 A;  2TSS A;  4R8I A;  3PO3 G;  1HZA A;  2IT1 A;  1PH9 A;  1VQD A;  1EOV A;  5CV9 A;  3WDN A;  1CTM A;  3K7A B;  2JYO A;  3HRZ C;  2RF4 A;  3S1M H;  1VMP A;  1Q12 A;  3GTO H;  1G8Z D;  4P71 A;  3MC0 B;  2NBF A;  5IOC A;  1C48 A;  3UDF A;  1LAC A;  5IYD G;  1EY7 A;  1QCB D;  2G9H D;  5M3F G;  1WTV A;  3NEN A;  2Y0S G;  1EU4 A;  4R4I A;  3T1Y Q;  1UUP A;  1KDC A;  1ENA A;  4MTN A;  5GAE C;  3G6E A;  1WD0 A;  2F0J A;  4XYQ A;  5FLM H;  1XMQ Q;  1TKW B;  5K36 G;  1UEB A;  5IIF A;  4DUY L;  1FJG L;  5C6A A;  3I56 A;  4AQY Q;  2F03 A;  2K28 A;  1FGB D;  1SFO H;  4C3I G;  2K33 A;  1A2T A;  5A35 A;  2AKW B;  3CCJ A;  4G7H C;  1PYB A;  1K9M C;  1IBL L;  2Z4H A;  2K75 A;  1SYE A;  1STA A;  1QNK A;  3EJI A;  1NR2 A;  3H15 A;  1NCV A;  5CV4 A;  4CJ2 C;  4FXG C;  1EU3 A;  5EKK A;  3HOV B;  1H9K A;  3F2U A;  1PH2 A;  5EPK A;  1JMC A;  3S14 B;  4OWX B;  3BYT B;  3W3A A;  4HJ7 A;  4A3E B;  2V4D A;  2WB1 G;  2N88 A;  3E5S A;  3LWU A;  3T1Y L;  3NWT A;  4DXF A;  4MNO A;  3PF5 A;  2FIN B;  2K5Q A;  1DZ1 A;  2NVQ B;  1HHV A;  1U5K A;  1XMQ L;  5C4Z A;  3IFT A;  3W1G A;  4R4T A;  4L5Q A;  1NAP A;  1KDB A;  3F2C A;  2OTL A;  4AQY L;  2EY1 A;  4DAY A;  1AFP A;  2OQ0 A;  3GTQ B;  1HJP A;  3FKI G;  2HQL A;  1HR0 Q;  3HZX A;  3HOY H;  3C2P A;  2GN5 A;  2O2L D;  2ASB A;  3D8G A;  4FXD A;  1PH5 A;  3X3M A;  3GTP B;  5NUC A;  2L12 A;  4G57 A;  2F0T A;  3HEJ A;  2NYZ D;  4LJZ C;  4OO1 G;  1Q90 A;  4CDE C;  4KJN A;  2HDM A;  4JV5 Q;  1XPU A;  1BF4 A;  2I5L X;  3M4O B;  5T1G A;  2VUM G;  2K4K A;  4BA1 I;  4AYB E;  4E6I A;  2CW0 C;  1EY5 A;  2Q2H A;  3I70 A;  3U50 C;  2JA5 G;  4OL7 A;  3CPF A;  1SAP A;  1L1O B;  4XDX A;  3UI2 A;  3H3V H;  5EBC A;  4WJ3 M;  4G7O C;  4AH6 A;  4N9T A;  3NBH B;  4N9P A;  4DK1 A;  5C4X G;  5E4W C;  1PLF A;  3GV3 A;  2JA7 B;  4IFD I;  2EOT A;  4L5S A;  1KTK A;  1ESR A;  2PQA B;  4K8J A;  4KD3 A;  1PH3 A;  1NR4 A;  2ID0 A;  2Z9H A;  1I5F A;  2B63 H;  4ZKC B;  3LNN A;  3J80 i;  3M3Y H;  1CT1 D;  1B8A A;  5G3L D;  5C44 G;  1LTR D;  1ROD A;  2ZM6 Q;  1PMR A;  2LS0 1;  1YNN D;  4KY6 A;  3DWQ A;  4FO2 A;  3STB C;  2EXZ A;  2KQ3 A;  3GD7 A;  5IWA L;  2K14 A;  2AQ3 B;  3H0G G;  1B70 B;  4GNX B;  1A3T A;  2EY6 A;  3UDX A;  2NVY B;  1BQQ T;  3BZD B;  4LK1 C;  3HKZ E;  2AMC B;  4RHS A;  4IPH A;  5LL6 S;  4DV3 L;  4KY5 A;  2IL8 A;  4K2K A;  4HED A;  2HD3 A;  2HIV A;  3GO5 A;  5FLM G;  3CF5 A;  4A3G H;  1V9P A;  2JSO A;  3S15 B;  2Z0S A;  3W1B A;  4KHP Q;  4YCW A;  2D9U A;  3OSO A;  2WV6 D;  1I3Q B;  3A8K E;  4OHJ A;  3GTG B;  4JI2 Q;  2F4V Q;  3CCS A;  5H1S E;  2A6E C;  2H1E A;  4Y52 H;  1SE3 A;  3RLO A;  2ZM6 L;  5JOB A;  2VW9 A;  1R9T B;  1WVL A;  2M2L A;  2LXJ A;  1H9J A;  1WI5 A;  4H02 A;  1S5D D;  5HGQ A;  4PMB A;  3NE5 B;  1G2S A;  4YIJ A;  1HTL D;  2RVL A;  4A76 A;  4RKB A;  1KXL A;  2R93 H;  1PTO C;  4GZY C;  4ZRZ A;  1MIU A;  2D2C C;  2LMC B;  5ELC A;  1X3F A;  1UE1 A;  1N34 L;  1JQY D;  4QJF A;  3E6Z X;  3DUZ A;  4L6T B;  2D0O A;  2KCT A;  4OWW B;  2VB2 X;  3I4N H;  1K83 H;  2DGY A;  3FPP A; 
#chains in the Genus database with same CATH homology
 2QGQ A;  1X55 A;  3SGI A;  1HNW Q;  2MO0 A;  3HOU H;  4WJ4 A;  4GOP C;  1U0L A;  2JA9 A;  1IBM Q;  3MEF A;  1CSP A;  1XNR L;  2WB1 E;  3U4V A;  3HOY G;  5IY0 A;  3S16 H;  2V1C C;  3M4P A;  4A93 H;  2A19 A;  5IYB G;  1EIF A;  1V43 A;  3B6Y A;  3M9B A;  2VNU D;  2UUC L;  3JC6 6;  5IP7 H;  1UE5 A;  2JJQ A;  4JI6 Q;  1KQS A;  1VQJ A;  2YYZ A;  4DV0 L;  2KHI A;  4KLK A;  1GO3 E;  3U58 A;  5JJL A;  5GRO A;  4GKK L;  4QY7 A;  4OWT B;  2EIF A;  5C3E H;  3J7A 5;  2WAQ E;  4Y7N H;  4HJ8 A;  2BA1 A;  4IPC A;  1MJE A;  3HOZ G;  1ASZ A;  4P75 A;  1TWA H;  3U4Z A;  3UE1 A;  4X62 L;  2UXB Q;  4DNI A;  4DV6 L;  4POF A;  4DV2 Q;  1LYL A;  4DK3 C;  4A3E G;  4YHH Q;  5GAH C;  4DR2 L;  1VQ8 A;  1Q86 C;  2OWO A;  3RNU A;  4OX9 L;  3I7F A;  2R92 H;  4JI8 L;  1ASY A;  1HZ9 A;  3KOJ A;  1LM0 A;  4XTC S;  5GAD C;  1Q46 A;  1YHA A;  4LF7 Q;  2JA8 H;  3CP0 A;  5M5W H;  1MJC A;  2AHO B;  1CKO A;  1HR0 L;  1CSQ A;  3W5O A;  4X65 L;  4GNX C;  1VQ5 A;  3CME A;  1PH6 A;  3HOW H;  4J15 A;  3EIV A;  4JYA Q;  4IFD J;  3AQQ A;  1HNW L;  4JBW A;  2I5M X;  4JI3 Q;  4A3I H;  1I94 Q;  1PA6 A;  1N32 L;  2JQO A;  4LFB Q;  1GVP A;  4BY7 H;  2ATW A;  4UP7 A;  3CC4 A;  2DGY A;  1IBM L;  1BBU A;  4DR3 Q;  4LUV A;  4LF6 Q;  2I5H A;  3CCQ A;  1VQH A;  3A74 A;  2IX1 A;  3GTL H;  2HIX A;  2LSS A;  3A0J A;  4JV5 L;  4GN3 B;  1OXS C;  2CQO A;  2Q2I A;  3CC7 A;  3PSI A;  4IPG A;  4DUY Q;  1FJG Q;  2E5L L;  3ULL A;  1HH2 P;  4C3J H;  2D62 A;  3KDF B;  4AIM A;  4X66 Q;  1K73 C;  1NJI C;  2R7F A;  5C0X I;  2MNA A;  4JI7 Q;  4LF4 L;  2JA6 H;  3ICE A;  1BBW A;  1M90 C;  5ELO A;  4PZ6 A;  2UUA Q;  4A3C H;  5C44 H;  1AE3 A;  1XMO Q;  2PI2 E;  1I50 H;  2UXB L;  1PH7 A;  1GM5 A;  1WOC A;  4O2D A;  4BA2 I;  4B3M Q;  1IBL Q;  4HIM A;  1E24 A;  3BU2 A;  4NB3 A;  4BBR G;  1QUQ B;  3J81 i;  4IOC A;  2UU9 Q;  3CCM A;  3DM3 A;  1YHB A;  4NXN L;  4YY3 Q;  3BZK A;  3H0G H;  5M3M G;  1HNZ Q;  3CD6 A;  3HKS A;  3MXN B;  1RL2 A;  4DV7 Q;  3TS2 A;  3A5Z B;  4A3J G;  2C35 B;  3K7U C;  2ZJR A;  4HID A;  4TVA B;  1OTC A;  4DR4 Q;  1C9O A;  1YI2 A;  5IP9 G;  1YIJ A;  1I94 L;  4DV1 Q;  2CFM A;  1VQF A;  1Y1W H;  1T9H A;  4JG2 A;  3OW2 A;  5M5Y H;  1UE6 A;  4PG3 A;  3PIP A;  3WWV A;  1KIX A;  1XPO A;  4B3S L;  3RN2 A;  3KDF A;  3KLW A;  2NN6 I;  2QEX A;  2JA7 G;  5E7N A;  3EN2 A;  3OTO Q;  1Y1V G;  2VQF Q;  4O0A A;  4P74 A;  3RZD H;  4LF6 L;  4YWM A;  2E2J H;  4JI4 Q;  1SR3 A;  3F8T A;  2RHQ B;  4A3K G;  4L5T A;  3CAM A;  3GDE A;  3L2P A;  3PO2 H;  1P8L A;  2RHS B;  4A3G G;  5IYC G;  1QUQ A;  4ALP A;  3CCR A;  1TWH H;  4B3R Q;  3CXC A;  3KF6 B;  4A3B H;  1VQL A;  4LFA Q;  2F52 A;  3FP9 A;  4LUZ A;  1HZC A;  2AWO A;  4OON A;  2PNH A;  3K7A H;  1X9N A;  4A3M H;  2HHH L;  2JK8 A;  4DKA C;  4PMW A;  3KJP A;  4A3D H;  1E7Z A;  1G29 1;  1S3O A;  3PCO B;  2AWN A;  1Q1B A;  2Z6K C;  1YJN A;  1J5E Q;  1O7I A;  2KEN A;  4YY3 L;  4DR1 L;  4LFC Q;  2MO1 A;  4GLA C;  3DLL A;  4L5R C;  1PFS A;  1SN8 A;  2VQE L;  2NN6 G;  1N36 L;  1YVC A;  4FDB A;  3RN5 A;  3PV0 A;  2YV5 A;  1XPR A;  4OO1 I;  1L1O C;  1TWG H;  3AFP A;  1A63 A;  1HR0 W;  4X64 Q;  1YBY A;  3I4M H;  3L7Z C;  3KF6 A;  4GLX A;  4KHP L;  2YTX A;  3UE0 A;  3FKI H;  1H95 A;  3F2D A;  1HZB A;  3NEL A;  4GN4 B;  4YWL A;  5JJI A;  1PH1 A;  4APV A;  3CMA A;  3I4N G;  3E0E A;  1HNX Q;  4HJ5 A;  4JI2 L;  2F4V L;  2YTY A;  3TQY A;  3HOU G;  5GAG C;  2ES2 A;  2EXD A;  3BZC A;  3KF8 B;  4AYB G;  1VQO A;  1JB7 A;  1NE3 A;  4OXP A;  1Q1E A;  4B3R L;  4JOI A;  4POG A;  3K8A A;  1JJC B;  1NMG A;  4A3F H;  1Q82 C;  3TRZ A;  1KAW A;  5IYB H;  2B29 A;  1OXX K;  2MQH A;  4C3H H;  3K80 C;  3PUZ A;  1QZH A;  4JI5 L;  3KFU A;  2JEB I;  2VUM H;  2PMZ E;  1D8L A;  5IP7 G;  3J80 c;  4YCU A;  2YTV A;  3S1N H;  2CWP A;  1FGU A;  3TRE A;  1A0I A;  4GN5 A;  4ME3 A;  3HOV H;  1A8V A;  1VQI A;  2JA5 H;  3S14 H;  4LF8 L;  1IL2 A;  4A3E H;  5EAY A;  4R4C A;  2PI2 A;  2L15 A;  1N8R C;  1EFW A;  4KI0 A;  4MZ9 A;  2GVB A;  4X64 L;  4UPA A;  1W3S A;  2NVQ H;  3BJU A;  5IWA Q;  1YHQ A;  2UUB Q;  4NXM Q;  2JA8 G;  3G71 A;  5C4X H;  2E8G A;  2H5X A;  3HOW G;  1HNX L;  4LF9 Q;  3CW2 C;  4GKJ Q;  1YEZ A;  3CPW A;  3GTQ H;  4GOP B;  1SRU A;  2ALY B;  2WFW A;  1P16 A;  4P73 A;  4JI6 L;  1EQR A;  4DV3 Q;  3M85 A;  4QGU A;  3S2D H;  4BY7 G;  4DR7 Q;  3PUX A;  4BY1 G;  1J6Q A;  5FJ8 G;  1VQK A;  1JJG A;  4HIO A;  4BXX H;  4A4I A;  4KHZ A;  1VQC A;  5C0X J;  1X6O A;  1OXV A;  3HFZ B;  2B63 G;  3TS0 A;  2R7Z G;  2OTJ A;  2N49 A;  1VCI A;  2IHF A;  3HOX H;  3PO3 G;  1JT8 A;  1HZA A;  4C2M H;  3K81 C;  2IT1 A;  1PH9 A;  2KHJ A;  2XTI A;  1E1T A;  1VQD A;  3HKZ G;  4LWC A;  4DV2 L;  1AH9 A;  4YHH L;  1CKM A;  1EOV A;  1SMX A;  1I6H H;  2XGT A;  3M4O H;  4QIW E;  1SE8 A;  1L0W A;  3S17 H;  2RF4 A;  2EQS A;  1IXR A;  2JA6 G;  1Q12 A;  5J3B A;  3J7Z C;  3S1M H;  2GVA A;  3GTO H;  3D31 A;  4LF7 L;  2CKZ B;  2F3I A;  2B3G A;  1NY4 A;  2IY5 B;  4P71 A;  1SLJ A;  4GOP A;  3UDF A;  4JYA L;  5IYD G;  2KCM A;  1VS0 A;  4DV5 Q;  1QVF A;  4JI3 L;  5M3F G;  3GTK H;  4A3L G;  3M7N A;  4LFB L;  2WP8 J;  4DV4 Q;  1XNQ Q;  1WCM G;  2Y0S G;  3NEN A;  2UUB L;  1GD7 A;  4R4I A;  4DR3 L;  3T1Y Q;  4R4O A;  4LF9 L;  1KC8 C;  4MTN A;  5C0X G;  5GAE C;  5IP9 H;  4IPD A;  3G6E A;  4JI1 Q;  2E2H H;  5FLM H;  1XMQ Q;  1WYD A;  5K36 G;  4JC0 A;  1UEB A;  3F1Z A;  4DUY L;  1VQG A;  1FJG L;  2JA7 H;  1N34 Q;  3I56 A;  4LW1 A;  1Y1V H;  4AQY Q;  3LGJ A;  1DGS A;  4JI0 Q;  4X66 L;  5BR8 Q;  4LF5 Q;  4JI7 L;  4JBJ A;  2BH8 A;  1SFO H;  3CCL A;  3J81 j;  4A3K H;  2UUA L;  4B3S Q;  5LMN Q;  1XMO L;  4X6A H;  2AKW B;  3CCJ A;  1PYB A;  2K52 A;  1K9M C;  3AEV A;  4B3M L;  5IYC H;  2ZTE A;  1IBL L;  3GTM H;  2K75 A;  3STB D;  3VDY A;  4BBS H;  3PF4 A;  2UU9 L;  1XNR Q;  4DAY B;  4GNX A;  2OQK A;  4A3B G;  4EX5 A;  2K5H A;  3H15 A;  1HNZ L;  4RMF A;  4DV7 L;  3PGZ A;  2UUC Q;  1KRT A;  3CC2 A;  1YZ6 A;  5IE8 A;  1K8A C;  4IO9 A;  2IHE A;  4DR4 L;  4DV0 Q;  4A3D G;  2R93 G;  4DV5 L;  1X54 A;  5M5X H;  1UE7 A;  4DV1 L;  1PH2 A;  1JMC A;  4DPG A;  2NVY H;  4OWX B;  1XNQ L;  4HJ7 A;  1Z47 A;  1IZ6 A;  1L2F A;  1IYJ B;  1Y14 B;  2N3S A;  5FLX c;  2WB1 G;  1KRS A;  3T1Y L;  1N33 Q;  3JAM c;  1WJJ A;  3OTO L;  2VQF L;  5LMU Q;  4MNO A;  3PF5 A;  4X62 Q;  4JI4 L;  2R7D A;  4DV6 Q;  1E1O A;  4JI1 L;  1K0R A;  1VQ6 A;  1U5K A;  2FXQ A;  3F2B A;  1XMQ L;  1NMF A;  1VQB A;  2A1A A;  3W1G A;  3CCV A;  4R4T A;  4OX9 Q;  1BKB A;  4L5Q A;  3T1H Q;  2HT1 A;  3KYH C;  3F2C A;  4AQY L;  1G51 A;  2KBN A;  3FHW A;  2OTL A;  2K50 A;  3A5U A;  4JI0 L;  3I4M G;  2OQ0 A;  4P72 A;  3PUV A;  5BR8 L;  2ZJQ A;  1HJP A;  1VQE A;  3FKI G;  2HQL A;  2WAQ G;  1HR0 Q;  2YU9 H;  2CCZ A;  3HOY H;  3S15 H;  2GN5 A;  4QL5 A;  3AFQ A;  4LFA L;  1NBW A;  5LMN L;  1JJ2 A;  2ASB A;  4QQB X;  4DR5 Q;  2Q2U A;  3L0O A;  4A93 G;  1A62 A;  1SRO A;  1FL0 A;  3M4Q A;  1N32 Q;  1I3Q H;  2ZJP A;  1PH5 A;  3GTG H;  1KL9 A;  3S24 A;  1EWI A;  1J5E L;  4B3T Q;  2VL6 A;  4OO1 G;  4LFC L;  1Q7Y C;  1R9T H;  1VQP A;  2UXC Q;  1TXY A;  4A3F G;  1YJ9 A;  2ZTC A;  3H3V I;  4R1J A;  4JCV E;  5C3E G;  4JV5 Q;  3ULJ A;  1XPU A;  3HOZ H;  2I5L X;  4NPS A;  3PUY A;  2VUM G;  4LNQ A;  2K4K A;  4BA1 I;  2E5L Q;  1Q81 C;  3NEM A;  1S72 A;  4AYB E;  2OCE A;  2R92 G;  1RIP A;  3I2Z A;  2Q2H A;  4LF4 Q;  4XIG S;  3HOV G;  1N33 L;  4TQU S;  1B7Y B;  3U50 C;  2JA5 G;  2JE6 I;  3J81 c;  5LMU L;  3CPF A;  2UXD Q;  1Q8K A;  3I55 A;  1YIT A;  2NVX H;  2LXK A;  4HJ9 A;  3CCE A;  1L1O B;  1PHJ A;  1EYG A;  1C0A A;  1M1K C;  4RG1 A;  4DK6 C;  3JAM i;  3T1H L;  3H3V H;  1QZG A;  4A3I G;  2IX0 A;  1UWV A;  3S1R H;  4WJ3 M;  2VY3 A;  2QA4 A;  4NXN Q;  4AH6 A;  4UP9 A;  3KJO A;  3NBH B;  2K5N A;  3D0F A;  1QVG A;  2JEA I;  5C4X G;  2DUD A;  1VQ4 A;  4K0K Q;  1E3P A;  3GTP H;  4DR5 L;  3PUW A;  1EUJ A;  3RZO H;  4IFD I;  1KHI A;  2Z6K A;  1X3E A;  4HIK A;  3UDG A;  3PIO A;  3EBE A;  4L5S A;  3ERS X;  1NTG A;  2NZH A;  2PQA B;  3TEH B;  3GTJ H;  4BY1 H;  5FJ8 H;  1KD1 C;  4IJL A;  4B3T L;  1PH3 A;  1YJW A;  1XJV A;  2ID0 A;  1I5F A;  1TWC H;  3G4S A;  4GS3 A;  4BXX G;  3RLF A;  2UXC L;  2B63 H;  2R7Z H;  2K5V A;  3I4O A;  3PO3 H;  3J80 i;  3M3Y H;  3HOX G;  4A3C G;  1B8A A;  1L1O A;  5C44 G;  1EIY B;  1E22 A;  2CWA A;  5JJK A;  1X3G A;  4DAM A;  3ZJY C;  2N8N A;  2ZM6 Q;  1X56 A;  1AE2 A;  5JEA J;  1PH4 A;  4R4Q A;  1V1Q A;  2VZA A;  3STB C;  4BBR H;  1PYS B;  1S40 A;  3S2H H;  3CCU A;  3GD7 A;  5IWA L;  4DR6 Q;  5M3M H;  4NXM L;  2K14 A;  3H0G G;  1B70 B;  3RR5 A;  3G48 A;  4GNX B;  4JOI C;  2UXD L;  3UDX A;  2D0P A;  4A3J H;  2HHH Q;  5AJ3 Q;  3CQZ H;  4GKJ L;  2MFI A;  5IYD H;  3RLN A;  4A3L H;  2PQA A;  4YCV A;  3HKZ E;  5M3F H;  4IFD G;  2AMC B;  2N78 A;  1WCM H;  4DR1 Q;  1Y1W G;  4IPH A;  4DUZ Q;  4DV3 L;  1VQN A;  5IT9 c;  4DR7 L;  1BVS A;  2VQE Q;  1MKH A;  1IBK Q;  1N36 Q;  1OXT A;  4UP8 A;  4K0K L;  1WFQ A;  1OXU A;  4GLV B;  1VQA A;  1TWF H;  2HIV A;  3S1Q H;  4JBM A;  3GO5 A;  5GQO A;  5FLM G;  3K0X A;  3UDI A;  2BA0 A;  3CF5 A;  3PO2 G;  4A3G H;  1N9W A;  3ER0 A;  1V9P A;  2A8V A;  1X65 A;  1VQM A;  3AYH B;  5ELN A;  2Z0S A;  3W1B A;  5LMN W;  4HJA A;  2I0Q A;  4UY8 C;  1XTD A;  4YCW A;  5JEA G;  2Y0S E;  1CKN B;  4KHP Q;  4C3I H;  4IOA A;  2Q2T A;  1C7Y A;  1D7Q A;  4JI2 Q;  2F4V Q;  3CCS A;  5H1S E;  3E9I A;  4Y52 H;  1LUZ A;  3RLO A;  2ZM6 L;  4A3M G;  2VW9 A;  5C4J H;  1Z9F A;  4BBS G;  3ULP A;  1VQ9 A;  2LXJ A;  4IJH A;  1WI5 A;  4H02 A;  5HGQ A;  2VS1 A;  4DV4 L;  4GKK Q;  4DR6 L;  1CUK A;  2RCN A;  1G6P A;  1K3R A;  2BH2 A;  4A76 A;  4EQ5 A;  4JI5 Q;  5AJ3 L;  4JBK A;  1KXL A;  2NZO A;  3Q8D A;  1JE5 A;  1QVC A;  4LUO A;  4A75 A;  4PZ7 A;  3OYY A;  2E2I H;  2R93 H;  1EQQ A;  1MIU A;  1W2B A;  4DR2 Q;  4DUZ L;  1FVI A;  1X3F A;  1LTL A;  1UE1 A;  3E9H A;  1K8G A;  2R6G A;  4JI8 Q;  1CKN A;  1GKH A;  1IBK L;  1N34 L;  1PVO A;  4QJF A;  3IRB A;  1YNX A;  1PH8 A;  1VQ7 A;  4LF5 L;  1PV4 A;  2D0O A;  4LF8 Q;  2KCT A;  5DLQ E;  4YWK A;  4X65 Q;  4OWW B;  4PZ8 A;  2NVT H;  3I4N H;  1K83 H;  2ZTD A;  5HY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...