4R9WA

Crystal structure of platelet factor 4 complexed with fondaparinux
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
LQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet factor 4
publication title Atomic description of the immune complex involved in heparin-induced thrombocytopenia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 10
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4r9wA00
1MSGA 4O42A 2B2WC 3KBXA 1X3QA 1MI2A 2B2VC 1ESRA 2MGSA 1O7YA 2DY7A 5EQ0A 1WD1A 1ILPA 1ILQA 2VXWA 2FINB 1E0BA 4ZKCB 1C8CA 5D14A 1HFNA 2B2TA 2MP1A 1EQTA 3D6WA 3FDTA 4CJ0B 1BF4A 1U4LA 2KVMA 5EJWA 2RSNA 2RA4A 3TN2A 4XT3B 1F9QA 1IKMA 1X3PA 1HUNA 1MSHA 2B2YC 2X6GA 3TZDA 2FHTA 3DEPA 1RTOA 5E4XA 2XIWA 4MN3A 1JICA 1B3AA 1MGSA 1PFBA 1PFNA 1QG7A 3I90A 3N52A 2SDFA 4UAIA 5CORA 5T1IA 1BBXC 4ZK9B 1BNZA 1SDFA 1F9PA 2X69A 2KECA 1HA6A 2KOLA 3GV3A 3R93A 5JJZA 2HUGA 2L4NA 1J8IA 1NCVA 3ONAB 4IUPA 3MWYW 1SAPA 1TVXA 4CJ2C 1PDQA 4CJ1B 3IFDA 1ML0D 3G7LA 2HCCA 2X6LA 4QUCA 1B2TA 5EPKA 1Q3LA 3SVMA 1NR4A 1O80A 2L12A 1IL8A 2K04A 3KUPA 5CBAE 1WTRA 1WTOA 4OIKA 1PLFA 2IL8A 3DM1A 1CA6A 2KUMA 1WD0A 1HUMA 1XX8A 3I91A 5EKIA 1NAPA 1NR2A 4OIJA 2N88A 4U68A 2FJ2A 1U4MA 1KNEA 1EIHA 1J9OA 2B2UA 4DN4M 2K28A 1DONA 1EL0A 1LV9A 1RTNA 2B2TC 4X3TA 1G2TA 3I3CA 4ZKBB 2M2LA 3HP3A 4HSVA 1B4OA 4LMQD 4X3SA 1CA5A 1U4PA 1S4ZA 2KEDA 4R9WA 2DY8A 5COYA 1DOMA 1RODA 3Q6SA 5DNFA 1WVLA 1AP0A 1XYIA 1CM9A 4ZLTF 3IL8A 4X3UA 2JYOA 3UI2A 2N55A 1BO0A 2MPMA 1AZPA 3QO2A 4IUQA 2EOTA 1A15A 1F9SA 2B2WA 2FFKB 1M8AA 1B53A 2R3ZA 4HAEA 2Q8RE 4XT1B 2K05A 2B2VA 2HDMA 2KEEA 1WTQA 1IKLA 2RSOA 1G91A 3FPUB 1QE6A 1DOLA 2L9HA 3DEOA 4X3KA 5E4WC 5T1GA 4HEDA 3P7JA 2FMMA 2HDLA 1KNAA 3LWEA 1QNKA 1X32A 3H91A 4R8IA 4RA8A 4RWSC 5D65A 1F2LA 4IUTA 2NZ1D 2EPBA 2Q8TA 1GUWA 1U4RA 3GV6A 2RVLA 1JE4A 2NWGA 4IUVA 1HFGA 2J7ZA 2B2YA 1VMCA 1G2SA 2L11A 1HRJA 2B2UC 1O7ZA 1PFMA 2K01A 1WTWA 1SSOA 5EPJA 1EOTA 2NYZD 4QUFA 1AZQA 1VMPA 2HCIA 1DZ1A 4NW2A 5EPLA 4IURA 1RJTA 1F9RA 1ZXTA 2BDNA 2L1BA 1ICWA 5AFWA 1HHVA 2H1EA 1EIGA 3I8ZA 1WTPA 2MJ8A 1B50A 1G6ZA 2K1BA 1DOKA 2CVRA 4XDXA 2EE1A 3F2UA 2D9UA 4RAUC 5CMDA 1RHPA 1WTXA 4MHEA 2JP1A 4ZAIA 3MTSA 5CBEE 1WTVA 4IUUA 4HCSA 2K03A
chains in the Genus database with same CATH superfamily
1I94L 3GTGB 1X3QA 4EX5A 4CKBA 2QF7A 1JT8A 2YTYA 1AEXA 2IX0A 5JEAJ 2B2TA 4A3EG 3CCEA 4A3DB 1DJRD 4JI3L 4DR3Q 2DNEA 4HCEA 1L2FA 3CXCA 4EGVA 5CV9A 1EYCA 1O78A 3BDCA 5E4XA 5JEAH 1XPRA 4MN3A 2NN6H 2O5IC 3A5ZB 1BBXC 2Q2HA 4XYOA 4WORA 5DEHA 1VQHA 3VDYA 1Z9FA 4CDFC 1X55A 1PTOB 2RHQB 2L4NA 3T13A 4YWMA 3GTQH 1BXTA 4HSPA 4Q0FA 4B3TQ 3KFUA 3BYTB 5CBAE 1ASYA 4IO9A 3S1RB 2UXBQ 2PO4A 1S5CD 1CA6A 2HIXA 1EY0A 2OXPA 3S15H 4FVMA 2UU9L 2K5QA 1TWFB 1E2VA 1HNXQ 3NBHB 3PIPA 1EY9A 4QF4A 4QMGA 5D3IB 4LFCQ 4K8IA 1XNRL 1XWEA 1I6HB 5IODA 1JOKA 2NVQB 1L0XB 4BBSH 4B3RL 5C4XG 1I94Q 3K81C 1K3BC 3CCQA 5FLXL 4YCUA 3EVQA 2JSOA 1I3QB 4C1NI 1PTOH 2NVTB 2V1CC 4POFA 4JI3Q 1XNQL 4HJ9A 5JJLA 3S1RH 1ET9A 3DWAA 3KLSX 3PUYA 1H9SA 4A3EH 4RCOA 4L8JA 1K8GA 5A35A 1C9OA 3JC66 4DU9A 3QWNA 2EJMA 3S1QH 1SR3A 3I55A 1BBWA 3F2UA 4F8MA 4V190 4A3GG 1QUQA 2B63B 3H6MA 5FOBB 5ELEA 3T56B 1DM0B 3K0XA 2TSSA 3KF6B 4IUUA 2ZTDA 4ODGA 1FJGQ 4XYQA 1UE5A 2F0OA 1NMGA 4HMIA 3I70A 1QNUA 3ITPA 4XT3B 2B29A 2RHSB 5G3LD 5KRUA 4V0BA 1XNRQ 1PFBA 3VA5A 1M90C 2I5HA 4ZK9B 4A3GB 3PUWA 4FYDA 4B3RQ 3TBIB 5LL6X 4A93B 4Y52H 1K9MC 4DXFA 4LUOA 1SN8A 5EKKA 1SAPA 4L63B 1E1TA 2HCCA 1SYBA 5C4XH 1O80A 2K04A 3R8BA 3ND9A 1WTOA 4KHZA 4IPDA 3NP8A 1XNQQ 4K6DA 1PZKD 3NQIA 4OEMB 4DGZA 3OSOA 1VQ4A 1FL0A 3BZKA 3I3CA 3MFGA 4NKLA 2A19A 4DNTB 4OX9L 1Y1WB 2Z6KA 4R9WA 1OXUA 2MQHA 1K3RA 4DFAA 1NSNS 3K80C 3IL8A 1LT3D 4J1MA 5M5WB 3HOZB 2HQLA 3DWQA 2B2WA 2JE6I 1PYWD 3ICEA 3A55A 4HIOA 2QA4A 3EQLC 4GNXA 3SDZA 4UHVA 1O7LA 1WYDA 4ZUJA 4RA8A 1C7YA 2K5DA 3N6RA 1BCPC 2SEBD 1GUWA 1FR3A 2NBFA 4ME3A 5IGCA 3KDFA 2L11A 4JPBW 2QGQA 1VS0A 5DM73 1T5XD 2O4XA 3CCVA 3S17H 1HHVA 2F0MA 1K83B 3HOYB 4EQPA 3KLRA 5C5MA 2D9UA 3CP0A 4RAUC 1W6KA 4C3IG 1CSPA 1GUNA 3WOFA 2DGYA 3Q22A 2IHFA 1LTBD 2HD3A 4GN5A 2UXCL 1C48A 3CPFA 1O7YA 1SE8A 1ILPA 4IPGA 4ZKCB 4WFN3 3M7NA 4A3IB 4PZ8A 3MXPA 5C44H 3BS1A 5M5XB 3S1MH 3K57A 2RSNA 4OX9Q 2X6GA 1R4PB 1BKBA 4NB3A 1MGSA 1UEBA 2CFMA 4RCNA 1SMYC 2VY3A 2AQ1B 2ES2A 2JA5B 1DD2A 3CRLC 3GV3A 3S16B 2OQ0A 2I5MX 3K6OA 3RLOA 1NCVA 5I2YA 2KHJA 1H9KA 2PW7A 1JB3A 1Q12A 1IW7D 1VQ6A 1SROA 2VB3X 3SEBA 4K5XA 5HY6A 3W3AA 1B44D 5E3FA 2B2TC 3TRZA 4JOIC 4CKEA 3NHHA 3I73A 1Y1VG 5C5LA 3HOUH 1VQDA 1YBYA 4BY7G 1E2WA 1K28A 4J15A 2F4VL 4CHTB 2BE5C 2YTVA 1CT1D 2A68C 2EOTA 3GO5A 2UXCQ 3C1FA 4C3IH 3QOJA 4DR1L 4FF3A 1P16A 1VQAA 1STBA 3M4QA 4XQJA 1X56A 5EKLA 3I4MG 2RDGA 2K5HA 2NWGA 4IQZA 1HFGA 2EY1A 2J7ZA 1Y1VB 3A7LA 1PFMA 4JG2A 1Q46A 4LF4L 4IURA 1PTOF 1R9TH 1W2BA 2HHHL 1KDCA 4M1UB 2F0PA 1B50A 4DUZQ 1ZEQX 2CH4W 3QJYA 4ZAIA 4JBKA 2A74C 4GS3A 4JW0A 2XWJB 4O2DA 3FMCA 4S3SA 2N49A 1KXLA 4L5SA 1BR9A 3I4MB 2MGSA 1ENAA 2ZTCA 3SR1A 4JI4L 1QCBD 3K5NA 1LUZA 4IALA 5M5YH 1QWYA 2WP8J 3S14B 1QZGA 4JI7L 3HG9A 1EQTA 4XQNA 2Q2TA 2M00A 2NZOA 1IKMA 1I4HA 2A69D 1STNA 1JICA 2F52A 3GQBA 2E75C 4UDUC 4IFDI 3GTMH 4BY7H 2EJFC 1GXDC 1TWCH 2P5ZX 1S40A 4KHPL 1IHZA 2EVBA 4DR1Q 1Q86C 3C3LA 2UUAL 3U50C 5IIFA 3G6EA 1ML0D 1OO9B 2G5DA 3A0JA 3F8TA 1TIID 2RCNA 1QOHA 2AWOA 1QVCA 3VYRA 2J4XA 2QEJC 3PGZA 4BBRG 3J7AF 1EU4A 1GHKA 1XX8A 3TEHB 4OIJA 3TP7A 3TP8A 4JBJA 1LV9A 1WCMH 2XWBB 3H0GG 4X3TA 1G2TA 1Q82C 4LF4Q 4ZKBB 3KF6A 3EN2A 2HHHQ 3U9SA 1CA5A 5J39A 3UDFA 4R4IA 2JK8A 4C3JB 2DY8A 1TWHB 4PMWA 4JI0L 2MPMA 4QJFA 1WI5A 1AZPA 2ZTEA 1U0LA 1B53A 3UDIA 4JI4Q 2A6HD 5LMUL 1EU3A 3A8IE 1EEFD 4IUNA 1QUQB 4X66L 3HOVB 5HGQA 1QNKA 4JI7Q 4NXML 1F2LA 3W2DA 2F3VA 2ICIA 3FPPA 4JYAL 3HKSA 2B2YA 1WTWA 3MVVA 5ELCA 2XNAC 2VS1A 2JA7G 1Q1BA 2I5LX 3MEFA 1LM0A 1PH7A 3IFTA 2R7DA 3RD4A 3H3VH 3PUVA 4KHPQ 5ELBA 1WTPA 3X3NA 1HJPA 2UUAQ 4A3FB 4JI6Q 4CDDC 4L6TB 2F0WA 4NXNL 1DGSA 2B2WC 1UE7A 4LAAA 1MI2A 4PMCA 2DNCA 4GNXC 2JA6B 3NWSA 4K0KL 1JJCB 2VQFL 3J7AV 2EYFA 2D2CC 4BBRH 1CK1A 5J1ZA 4DPGA 1L0YB 1S5DD 2WINB 5C0XI 4A3KB 1MSHA 3H0GH 2XIWA 1JOQA 1B9NA 2KCTA 1SFOB 2KOLA 2RCFA 2ZJRA 2VUMG 4G7OC 5LMUQ 2WKDA 5IP9G 4CJ1B 1PMRA 4X66Q 3NSWA 5GAEC 5G3LF 4KKUA 1YI2A 2DJFC 4RGOS 5C4ZA 4NXMQ 4JC0A 2KCCA 3BVZA 3VR4A 1AE2A 2K5NA 2UUCL 4JYAQ 4GNXB 1F2ZA 3FEWX 3AU7A 1VQKA 1U4MA 3G71A 1J9OA 1EL0A 3NPPA 3MEHA 3HP3A 2FXQA 4KMUC 4RHSA 1MIUA 3NK9A 4PV1C 1I50H 3Q8DA 2JA7H 2VUMB 2F0JA 2K75A 2KJXA 1KD1C 2F0UA 4WRDA 4ALPA 1TR5A 1IYUA 5I9OA 4NXNQ 2RBMA 3FKIB 4K0KQ 1TWAH 1WOCA 2VQFQ 4H13C 2E5LL 3IKJA 4HEDA 1KNAA 3LWEA 1X32A 3LNNA 4HMJA 3KOJA 5D65A 4KD3A 2OWOA 1N8RC 2NTTA 2A6EC 2PMZE 3CC7A 5KNBA 2JQOA 2K01A 2Y0SB 4BY1B 1GOZA 1EY7A 2D0OA 5J3BA 3I56A 1LABA 3GTKH 3GTOH 1FD7D 1N36Q 4L5RC 3CMAA 2GA4B 5GAGC 5LMNQ 3GDEA 3NEMA 5JAVA 3DLLA 4H02A 3A5UA 4FF4A 3HOXG 4GLXA 4LUVA 2BA1A 3E6ZX 2AWNA 4RFBA 5C3XA 2E76C 4M8AA 4DKAC 2VNUD 1C8CA 2C5CA 3D4WA 4CJ0B 1HNXL 1D1IA 1N34Q 3GTQB 4UP8A 2KBNA 1MJCA 2F0GA 2DJGC 1X3PA 3ND8A 3M7GA 1PTOC 2ZM6L 3HOWH 1HZBA 2VB2X 3CU7A 3CCRA 1IXRA 3L7ZC 2F0LA 1PFNA 5L37A 1PH5A 3SE0A 1VQMA 1F9PA 2L0CA 2PMZB 1W6JA 4OWXB 3S9WA 4R8NA 5JVG3 1VQLA 1Q90A 1T5EA 4OGQC 2DUDA 4FXKC 1XPUA 3S15B 1YVCA 3Q24A 2E5LQ 2X6LA 5I9PA 1NR4A 1N9WA 4A3CH 4IFDJ 4A4IA 1KHIA 1WD0A 2H5XA 1PHJA 3RN5A 1NAPA 4IFDH 2VW9A 4BBSB 5JPNC 1ENFA 4LMQD 1S3OA 1GHJA 2PNHA 3KF8B 3A74A 1SNMA 3A8KE 3BVGA 1OXSC 4IJHA 1PYSB 3FRPB 1II3A 2F3IA 1K0RA 1STHA 1YNND 2V4DA 2EXDA 3NUCA 1FJGL 1M8AA 2Q8RE 4ME5A 2ZJPA 2HDMA 4A3EB 3HOXH 2GVAA 4AQYL 3OHXC 3S1QB 1VQBA 3E9HA 2NZ1D 2Q8TA 5CGKA 1I4XA 2ZM6Q 3K5MA 4IUVA 4YCWA 4RG1A 1VMPA 1L0WA 2F0HA 2MHVA 4NW2A 2DN8A 1EQQA 1VF7A 1NNXA 3NTIA 1RHPA 4DV4Q 5EAYA 3PIP3 4O42A 3NE5B 4HIMA 4QB4A 1CKNA 2E2JB 1HTLD 1LYLA 3LX0A 2EYLA 2IPKD 3GTLH 1CI3M 1RIPA 3CKIB 1Q81C 3I4NG 3FDTA 4K5WA 3KJPA 1A3VA 3A8JE 3QG1A 2OQKA 2B2YC 2PPBC 5C4XB 4JBMA 2IHEA 1LTLA 3TS2A 1C0AA 2PNRC 2CQAA 2QDLA 3RZDH 1PFSA 2F0KA 4J8QA 2I07B 1X65A 1HA5A 3M9BA 4N9PA 2HUGA 1D5XC 1UNSA 1SEBD 3IFDA 4AQYQ 1NJIC 4LUZA 2N3SA 3OWEB 1MKHA 1PH2A 1V1QA 2E2DC 4LK1C 5GAHC 3OIQA 3UE0A 1OXTA 2PZUA 3HKZE 5EKIA 2Z6BA 4C56C 4DAMA 2E2JH 1DONA 5C4JH 4F87A 2UXDL 1NTGA 4RMFA 4L5TA 1JWSD 1GUGA 1X9NA 3CCMA 4HSVA 4K14A 2OTLA 2R7FA 2B8GA 1S4ZA 4X6AH 3HKZG 3HFZB 1JR0D 3G48A 2KENA 2JA9A 1XXGA 1AP0A 5JJIA 4X3UA 4NPSA 1CSQA 3MC0B 3PSIA 4LF7L 3NQTA 2WV6D 5C3EG 4FP5D 3RMHA 5C44G 4UP9A 3D6CA 2KEEA 4TRDA 1N33L 5E4WC 3DEOA 1KL9A 5I6YA 4JV5L 4PG3A 1LTSD 3J80E 5BR8Q 3S17B 1VQOA 2K5VA 1SYDA 3QR8A 2Z9HA 1U4RA 2KHSA 1FGUA 4JI2L 4XIGS 4HJAA 1HRJA 4YCVA 3I4NH 1SSOA 3CQZH 2NZHA 1JOOA 1YHBA 1GO3E 4LF8L 2ZXOA 4KI0A 4DK6C 3PF5A 1JJGA 1VQFA 3PO3G 2H1EA 2MJ8A 2OEOA 1HQRD 5C44B 1IBKL 3PO2G 1PH3A 1NBWA 2F0DA 5A2QE 1KAAA 3MTSA 4N8FA 2A1AA 2UUBL 3S1MB 1E7ZA 4TQUS 1ESRA 4GN4B 1MJEA 2O2LD 1D2BA 2EJGC 1NY4A 1ONLA 1BDOA 3J7YW 3OOCA 2D0PA 3HOUG 1YITA 2PZTA 2UXDQ 2KA7A 2SNSA 1O7IA 2RA4A 2HIVA 1JCKB 2YU9H 4U673 5IGEA 3AMUA 3J80i 2F0VA 2RF4A 4LF7Q 2R93G 4C1NK 2C9OA 5IWAL 4A3MG 1BUVT 2F0QA 1HNWL 1N33Q 3PUXA 1PRTF 1B2TA 3D31A 4JV5Q 5C3EH 4N8X1 3OTOL 2JA8G 5KEEA 3HOUB 3U9OA 4JCVE 2MNAA 4JI2Q 2ASBA 3TP6A 4BXXH 2F4IA 4DV6L 2Z4IA 4FO2A 5CV7A 5CC4A 1MBYA 3RUZA 1HXYD 2TMPA 2CHBD 4C3IB 4LF8Q 1EY5A 1LTRD 1B4OA 5IP7G 3H09A 2E8GA 4GKJL 4GZYC 1IBKQ 3HZXA 3OPOA 5FO8B 4DUZL 3LGJA 2JXMB 3J80c 3CF5A 1KDBA 5ELFA 2UUBQ 1XTCD 3PO3H 4UY8C 5IGDA 1A15A 1F9SA 3I4LA 3QOLA 4PZ7A 3AEVA 3PO2H 1GUOA 2B2VA 1WTQA 4ILWA 2ZXPA 3AFQA 1ZYRD 1EWHA 2B8FA 2Q2IA 2AKWB 1R9TB 5FLMG 5DLQE 4KY7A 4EQ5A 2MUYA 1BOSA 1G2SA 5IYCH 1IW7C 2ZT9C 4QUFA 1I4PA 3CPWA 2N8NA 4K2LA 4R4OA 5M3FG 4K5VA 5EPLA 1K8AC 4KJNA 2L1BA 5IWAQ 4A75A 2Z0SA 4GLAC 1Q8KA 1HNWQ 5M5YB 1DOKA 1M4VA 1I4QA 1CZWA 2EE1A 2R93H 5D3DA 1EYDA 3M4YA 2AUKA 1WTVA 4A3MH 4H7BA 1X3FA 3U4VA 3OTOQ 4OWWB 3PUZA 4IOAA 1WCMG 4JI8Q 5EBCA 2CW0D 3BJUA 2Z8LA 2BCOA 3SK4A 1AW7A 3KF8A 4O1NA 3NTKA 2JA8H 4DV6Q 2R92G 1VQNA 4HIKA 2NTSA 1F2MA 4OL7A 4KV6A 3GTMB 3KK7A 1TWCB 3PF4A 2EYOA 4BY7B 4LJZC 4B3ML 3HEJA 3HS0C 5H1SE 4KY5A 4GKJQ 1FNVA 1LTAD 3DEPA 2AHOB 1SBBB 5IP7H 2X69A 2KECA 4OONA 5FJ8G 1ET6A 4GLVB 5JJZA 5LMNW 1YIJA 3S24A 5ISRA 1VQ9A 1EZ8A 4DUYL 1WCMB 3B6YA 3G7LA 4R4CA 1LTID 2LFNA 4NDXA 3KUPA 5FK9C 2K33A 3VR6A 1WTHA 2AQ2B 4F88A 1VQGA 2R7ZH 4CKCA 2KUMA 2NVYH 4WJWA 2XVSA 5FLMH 1KAWA 4DN4M 4LF6L 1F2YA 4OO1I 2NVXH 3D8GA 4YIJA 1EQVA 3SGIA 3BG3A 2EY6A 4XQQA 4BS9A 3DMUA 1DOMA 5M3FH 5C4HA 4JI6L 1A8VA 1YHQA 4KTAA 4LNQA 2A69C 4G7ZC 4FDBA 1G91A 4I65A 4DR4L 2FMMA 2HDLA 4DNRB 3AYHB 4C3HG 2ZXRA 2NN6I 3J80L 3M4OH 3TSSA 4IUTA 4B9WA 4B3MQ 4LFBL 2LY7A 1U9RA 1KTKA 1CKNB 3L0OA 3OW7A 4DR5L 1SNCA 5KNDA 3H15A 1JJ2A 1KABA 2R92H 2WB1E 3CRKC 3EA6A 3TS0A 2F0NA 1FNWA 3U4ZA 2Q2UA 4KY6A 1I5FA 2F3WA 1F9RA 4Z9CB 3W1BA 4BA2I 3NENA 3K7AH 4DUYQ 1VQPA 3J7A5 4BBRB 4IN3A 4K2KA 3T53B 2WB1G 1VQ5A 1UE6A 2K52A 5FJ8H 1YZ6A 2SNMA 4DA2A 2PCFB 5FO7B 1LO5D 4JI5Q 2QILA 1LT4D 3H0GB 2E2IH 4HR7B 1D6EC 1LTTD 1ILQA 2BH8A 3BZDB 5JOBA 1RD9D 1UWVA 1EZ6A 5FO9B 4LF6Q 1CTMA 3MXNB 1GD7A 3D6WA 5TSSA 5EJWA 2A6HC 2LXJA 2Z6KC 3EBEA 3G4SA 1I4GA 2FHTA 3GP7A 1K8MA 3ERQA 1PZID 3ULPA 4UP7A 1TVXA 2EYJA 1FVIA 3GTPH 3D0FA 3SVMA 4DR4Q 1HTPA 3OW2A 4OIKA 1B70B 1I50B 4LFBQ 2ID0A 3CC4A 1PRTD 2JA7B 4DR5Q 1EYAA 1ASZA 3D4DA 3QB3A 3UDXA 2EQSA 4U68A 1RKNA 3TDQA 4C3HH 2B2UA 2QCPX 3SK8A 1TY0A 4EQOA 1Z47A 5M3MG 3EROA 1N36L 1TWAB 4CDEC 5LMNL 3CCJA 1SNQA 1KLUD 2E74C 4ZUIA 2O5JC 3OYYA 4IOCA 4L5QA 1FGBD 2JYOA 1E1OA 1KQSA 1VF5C 1R4QB 4KLKA 4DV5L 4R4QA 3GTKB 2MO0A 3GTOB 5HGTA 2KQ3A 4P2CB 3URYA 3HOWG 4RWSC 3T1YL 1Q8IA 1HCZA 1N34L 2JN4A 5BN3A 2QKIC 3TP5A 2XRQD 1NE3A 2G9HD 5M3MB 3CD6A 3AB9A 4DK1A 2BDOA 3L3OC 5K36H 1LLRD 2HCIA 1B1ZA 1RCVD 3BZCA 4LW1A 4RGMA 3V05A 2E2HH 3S1NH 3KLSA 4A3CG 5J22A 1IBLL 3R2TA 1TWGH 2K1BA 4DV0Q 3LWUA 1HZAA 5CMDA 3GD7A 3C1EA 5GQOA 4OWTB 1PRTB 2RDFA 4IFDG 3KBXA 3HOWB 4DAYA 2B2VC 4HJ8A 4A3JH 3RLFA 5EQ0A 3S2DH 3NBIA 2VXWA 3ZYYX 3AQQA 1Y8OB 3ZJYC 4YHHL 3E0JA 3STBD 1HFNA 2K5WA 1DXMA 4YY3L 1Y8NB 1ZKOA 4RH6A 3W5OA 1XPOA 5IYDG 4QL5A 1D7QA 2WAQE 2EYPA 3V96A 5M3MH 1B3AA 4A3BG 2K6AA 1BCPF 2F0IA 3I90A 4PQXA 2R6GA 1EOVA 4DV7L 4QCLA 1SDFA 4QIWE 3K0YA 2Q8IB 2IT1A 3Q23A 3VYSA 5IGGA 2BH2A 4WJ3M 3MAQA 4DV5Q 2MFIA 1JB7A 1D5ZC 1PZJD 4CGYB 2ALYB 3MFYA 1V8QA 1Q3LA 2WAQG 2L12A 2MO1A 4X64Q 1TT2A 1X54A 2AMCB 5DAUA 3T1YQ 3KBGA 4CBVA 1TXYA 4HN7A 5EGTA 1KNEA 1AFPA 1SNPA 1KIXA 2K28A 1SLJA 1YJNA 3U58A 1EY8A 2M2LA 5IYBG 4LF5L 4GN3B 1I6VC 2LS01 1EIYB 3HOXB 1KC8C 1S5BD 1IBLQ 2D5DA 2YV5A 5COYA 5EBDA 1G51A 3CCLA 4RGTA 4A3DG 1HH2P 4JI1Q 1XYIA 3IAYA 1GJXA 4DV4L 1JMCA 4C2MH 4IUQA 2WAQB 2YTXA 1DYQA 4GOPA 1IKLA 1B9MA 2L5TA 1UE1A 2H4OA 2PI2E 4YHHQ 3EJIA 3H91A 3MZ5A 4YY3Q 2XRSD 5KYLA 4HJ7A 1QVFA 1JE4A 1CKOA 1Y8PB 1O7ZA 4GKKL 2EIFA 3C2PA 1PA6A 1PV4A 3S2HH 4DV7Q 4ZRZA 1KDAA 3A54A 1TY2A 4JOIA 1K0SA 5IYDH 1ZXTA 1D1KA 3CAMA 5C0XG 4A3BH 1D5MC 3GTLB 3M3YH 3I72A 4XDXA 3Q0AA 4FXDA 2JP1A 5CBEE 4QGUA 1TS2A 1L1OB 3FHWA 4BWGB 4HTHA 3E0EA 4ZCKA 3A56A 2R61A 3D3RA 1Q7YC 3RZDB 3RZOH 1AH9A 3HGBA 3CMEA 4Y7NH 1YNNC 4DF7A 1GM5A 2B3GA 3SHLA 1BF4A 5CYUA 4LF5Q 2WIIB 3GTGH 3ULLA 3E5SA 4EQNA 1RTOA 1YNJD 3CW2C 1QG7A 3N52A 1M1KC 5IYBH 3MXUA 2OF1A 3BDLA 4B9XA 1SYGA 1HA6A 3R93A 1VQJA 4A3DH 4IUPA 2D62A 3KYHC 5C4JB 4CJ2C 1CHQD 2WKCA 1IL8A 1BBUA 5M9OA 4PZ6A 2NB0A 4MNOA 5BR8L 1SRUA 3OMGA 4PMBA 4RHRA 1YNJC 2B63G 3PIOA 1HUMA 4P75A 4APVA 5IY0A 1EIHA 2FJ2A 1QJOA 1VQIA 1PXUA 4I7AA 4ABNA 4GKKQ 1IZ6A 4WJ4A 5GADC 1PVOA 2PZWA 1MHWC 1V9PA 3P1HA 5C0XJ 2KEDA 3RR5A 4RKBA 5NUCA 1PH4A 4LWCA 1A2TA 1RODA 1WVLA 1VQCA 1CM9A 1G6PA 3UI2A 2KCMA 3ERSX 3SXHA 3PIO3 5C0XH 1TWFH 4LFAL 1ENCA 3MXNA 2Z1CA 4IPCA 1IBML 3TZUA 4FF2A 3I4NB 3PMFA 3OIPA 2PQAB 3CQZB 1Z7TA 1XMQL 3H94A 3OWFA 4A93G 4N9TA 1I6HH 3X3MA 5GROA 1CQFA 4IPHA 1A6XA 1PYBA 2NVQH 4BA1I 4DNIA 2CQOA 1V1PA 1E22A 3M85A 2J0TD 3K5LA 2VQEL 2UU9Q 2B2UC 1FYCA 1I3QH 4H0LC 4RKLA 4AYBE 4FNFA 1RF2D 1STEA 4HIDA 2BDNA 3V2TA 2NVTH 1EIGA 1J5EL 3DUZA 3R2IA 3VR3A 1SE3A 3J81E 5HURA 4ZYSA 1Y1WG 3BDOA 1H9RA 4BXXG 1TQOA 2K7VA 1MSGA 2A5HA 1E3PA 1Q1EA 4AYBG 2YU9B 3VYTA 1H9JA 4DR7L 2OT2A 3HOZG 2ENBA 3HKZB 4OXPA 3T51B 2K32A 3T1HL 4DV1L 3NWTA 2B63H 2EZVA 3FP9A 3E3XA 3TZDA 2A8VA 1BQQT 5C3EB 5CV5A 3UE1A 5AFWA 1LT6D 4G4KA 5T1IA 1T9HA 1UEAB 4LFAQ 1SJED 1IBMQ 1B7YB 1BCPD 5I2XA 4AYBB 3BVMA 1XMQQ 3SK5A 4QUCA 1JWUD 4R1JA 1E24A 1CKMA 3KLWA 4P73A 1GUTA 5IYCG 1STYA 2IL8A 3EIVA 3F2CA 3HOYG 3DM1A 4A3GH 2F0FA 3H3VI 4A93H 3J81i 2N88A 1OTCA 2VQEQ 3PO3B 4JBWA 2QW7A 1JE5A 3PV0A 2L15A 3PO2B 1XTDA 1EFID 1MD2D 1HPCA 4XXEA 4X3SA 4A3IG 1J5EQ 3D4RA 1STGA 5KGUA 2VL6A 5DNFA 3NXWA 5DM63 3K59A 2F1MA 1EWIA 2IJ0A 2SOBA 4K8JA 4AH6A 3QO2A 1EUJA 3A7AB 1ESFA 1JWMD 2FFKB 3R3OA 5LL6S 4JI8L 5C3WA 2F0TA 1QB5D 2RSOA 1SMXA 2WACA 1Y1WH 1X6OA 2JA5G 3FPUB 1BVSA 3P75A 4DR7Q 1V43A 4DR6L 4H44C 2IX3A 3T1HQ 4DV1Q 1SMYD 4MTKA 2EPBA 4DAYB 5M5WH 3HOZH 1B3QA 3BYYB 3RNUA 4E6IA 2R93B 1VMCA 3J81c 4A3MB 5EPJA 1EOTA 2RDHA 1KRSA 1NUCA 1BCPB 2PYKA 1N32L 1QZHA 1YNXA 2JA8B 1OXXK 1YJWA 1K8OA 2R7ZG 4IJLA 1VQ8A 1D8LA 4OHJA 2K03A 3T16A 1XMOL 5JJKA 2IW3A 4GOPC 3L9AX 2FINB 2N78A 1SXTA 3RN2A 1K83H 3HOYH 5JVH3 3CHBD 1G8ZD 3DWPA 2BE5D 4DV2L 4KKTA 1F9QA 2A68D 1PH1A 1CZGA 1TS5A 1EYGA 1LTGD 1CHPD 1ZYRC 1DCZA 4X62L 4UAIA 2EYMA 4LF9L 4NP5A 3DHQA 4A3IH 1Y69U 2R7ZB 2NVYB 2BA0A 5M5XH 3ONAB 3MWYW 4OELB 1PDQA 1TS4A 4MZ9A 5EPKA 3F2BA 4DR6Q 3ER0A 3MA2B 2IY5B 2NVXB 1SNDA 2I0QA 3GTJB 5JPMC 1A3TA 2JA5H 1PH9A 3S16H 2QEXA 4GOPB 5M3FB 1HR0W 5BN4A 3G6JB 4JK1C 1S5ED 1V1OA 3F1ZA 3PQIA 2ZJQA 2CW0C 2HQEA 1N32Q 2KHIA 1L1OA 5CR3A 4YWLA 1CFMA 4X65L 1H9MA 3M4OB 2AQ3B 2F0EA 1G291 1A3UA 5IT9E 1EY4A 3JAME 1PH8A 3H3VC 3BU2A 1XMOQ 1VCIA 2R92B 1SJHD 2PI2A 2R3ZA 4KK7A 4JI5L 1FNUA 4KD4A 4DV3L 1QE6A 2L9HA 3K7UC 3P7JA 1AN8A 2AUJD 4UPAA 3NBHA 2IX1A 1VDZA 3K7AB 2EYHA 1SE4A 4DV2Q 3VR5A 2HT1A 5ELNA 3VA7A 3GTJH 4Q5VA 3L2PA 1XJVA 5LHY1 1SYEA 1AZQA 4FF1A 4X62Q 2CWPA 3QIAA 4LF9Q 2G9DA 2JEAI 2E2IB 1VQ7A 3MHBA 4MIUA 4XTCS 2EXZA 4TKOB 3I8ZA 4J6HA 1A62A 1WTXA 2GN5A 3J81L 3UDGA 4ID6A 2F4VQ 2JJQA 1Y1VH 5ELOA 4C3JG 4A76A 4KN4C 1JC7A 1HNZL 1E0BA 2RQXA 2XGTA 2XN9C 3I2ZA 5D14A 2A73B 1GKHA 3JAMi 1P8LA 4KKSA 2MP1A 5AJ3L 1U4LA 1WJJA 1NMFA 2KVMA 3TN2A 3HOVG 5F2DA 3GTPB 3I4MH 4X65Q 2XTIA 2PQAA 1OXVA 5CORA 5IE8A 1BNZA 4EVOA 5A2QL 2NUCA 1E2ZA 3ULJA 3S14H 4I7ZC 5I6WA 5I4DA 2QDBA 4C3HB 1H9SB 2I46A 4DV3Q 1YHAA 1IL2A 1TKWB 3J81j 1JORA 1HUNA 1S5FD 2L55A 2K4KA 1PLFA 1EIFA 5KYIA 3TMEA 5K36G 4A3FG 4QQBX 2PQEA 1A2UA 5IT9c 1YJ9A 3M4PA 4KHVA 1RTNA 2RKSA 3JAMc 1IYJB 2JA6G 2WB1B 1V1PB 5ELDA 1K73C 3J7ZC 4B3SL 4DV0L 4A3JG 5CV6A 2LMCB 1F77A 3NTHA 3Q6SA 5E1FA 4ZLTF 3HRZC 5BN5A 1UAPA 3RLNA 2N55A 4A3KG 1BO0A 4P72A 2EY2A 1C4QA 2EY5A 3DM3A 5FLXE 4HAEA 1JQYD 4R4TA 1KRTA 3NELA 4F7XA 1HNZQ 3IRBA 3P20A 5E7NA 4C3JH 3FVQA 1EWCA 1HR0L 3DXJC 1TWHH 3K8AA 3EFXD 4FXGC 4R8IA 3CC2A 4POGA 3S1NB 2E2HB 1KLGD 5AJ3Q 1YEZA 1EQRA 2ATWA 1TWGB 2F0SA 2RVLA 3OMCA 4ULLA 3VYUA 4DR2L 3WDNA 2F03A 4A3JB 1DZ1A 1ICFB 1PRTC 2ICEC 3HOVH 2GVBA 1SNOA 1RJTA 4KJOA 2VZAA 2KCNA 3S2DB 1ICWA 5K5PA 1LACA 1G6ZA 1Z6HA 5IGFA 4A3LG 4JI0Q 4MHEA 4G7HC 4YWKA 1TU2B 3WWVA 4HCSA 4X64L 2FMCA 5FKAC 2OCEA 5KNCA 3K5OA 3O13A 2DY7A 2IWHA 1WD1A 1LT5D 1HZ9A 1S72A 1UUPA 3C46A 3FKIG 4DK0A 4A3FH 1H95A 1HQMC 2Y0SE 5IGBA 1GVPA 1HZCA 4K6LA 4DK3C 2WFWA 3CCUA 3E9IA 4B3SQ 2JA6H 3KJOA 1IYVA 3TREA 5C6AA 1SYFA 2SDFA 4JI1L 2JEBI 4OO1G 2CWAA 4ZQ3A 2Y0SG 1SE2A 4BY1G 3KDFB 4RGNA 1J8IA 1I4RA 3AFPA 2A6ED 4A3KH 1WFQA 3I4OA 1Y14B 1HR0Q 4TVAB 4O0AA 1WTRA 2LXKA 1A63A 2Z4HA 2K14A 4PNYA 1SFOH 1RDPD 3I91A 2OTJA 1NR2A 1CQVA 4DR2Q 4QY7A 4C2MB 5CV4A 4TSSA 5JEAG 4DXGA 1STAA 1VQEA 3TQYA 2NN6G 4NMZA 5FLXc 5IOCA 4KN7C 4DR3L 1U4PA 1RL2A 1J6QA 3STBC 3F2DA 5CV8A 1QILA 3PCOB 2YYZA 5IT9L 1CUKA 2XSCA 1A0IA 3JAML 1GUSA 4JVZA 4P74A 2M9VA 5KIXA 4XT1B 2K05A 3WOEA 4A3LH 2C35B 1U5KA 4P71A 3S2HB 1PTOD 1DOLA 2B39A 4X3KA 5T1GA 3I7FA 4B3TL 2VUMH 2CCZA 1EFWA 2UXBL 3T4AC 5IP9H 2UUCQ 4B08A 4A3BB 1PH6A 3M3YB 2K50A 3K58A 1X3EA 3GV6A 4DAPA 3FKIH 4CDCC 2CKZB 3W1GA 1B8AA 3CCSA 4HJ5A 2NYZD 4AIMA 1QVGA 3MXGA 4MTNA 1EY6A 1TS3A 1L1OC 1AE3A 2LSSA 2PW5A 4G57A 4LFCL 2EDGA 3SK6A 3VR2A 4DAVA 4BBSG 2CH4A 3RZOB 2LKVA 2CVRA 4QIWB 1EEID 4Y7NB 1W3SA 4OO1H 1X3GA 4IZ8A 2BOSA 1SYCA 4BY1H
chains in the Genus database with same CATH topology
3GTGB 1X3QA 4CKBA 2QF7A 1AEXA 2IX0A 5JEAJ 2B2TA 4A3DB 1DJRD 2DNEA 4HCEA 4EGVA 5CV9A 1EYCA 1O78A 3BDCA 5E4XA 5JEAH 4MN3A 2NN6H 2O5IC 1BBXC 4XYOA 4WORA 5DEHA 3T13A 1PTOB 2L4NA 1BXTA 4HSPA 4Q0FA 3BYTB 5CBAE 3S1RB 2PO4A 1S5CD 1CA6A 1EY0A 2OXPA 4FVMA 2K5QA 1TWFB 1E2VA 1EY9A 4QF4A 4QMGA 5D3IB 4K8IA 1XWEA 1I6HB 5IODA 1JOKA 2NVQB 1L0XB 5FLXL 3EVQA 2JSOA 1I3QB 4C1NI 1PTOH 2NVTB 1ET9A 3DWAA 3KLSX 3PUYA 1H9SA 4RCOA 4L8JA 5A35A 4DU9A 3QWNA 2EJMA 3F2UA 4F8MA 4V190 2B63B 3H6MA 5FOBB 5ELEA 3T56B 1DM0B 2TSSA 4IUUA 4ODGA 4XYQA 2F0OA 4HMIA 3I70A 1QNUA 3ITPA 4XT3B 5G3LD 5KRUA 4V0BA 1PFBA 3VA5A 4ZK9B 4A3GB 3PUWA 4FYDA 3TBIB 5LL6X 4A93B 4DXFA 5EKKA 1SAPA 4L63B 2HCCA 1SYBA 1O80A 2K04A 3R8BA 3ND9A 1WTOA 4KHZA 3NP8A 4K6DA 1PZKD 3NQIA 4DGZA 3OSOA 3I3CA 3MFGA 4NKLA 4DNTB 1Y1WB 4R9WA 1OXUA 4DFAA 1NSNS 3IL8A 1LT3D 4J1MA 5M5WB 3HOZB 3DWQA 2B2WA 2JE6I 1PYWD 3A55A 3EQLC 3SDZA 1O7LA 4ZUJA 4RA8A 2K5DA 3N6RA 1BCPC 2SEBD 1GUWA 1FR3A 2NBFA 5IGCA 2L11A 5DM73 1T5XD 2O4XA 1HHVA 2F0MA 1K83B 3HOYB 4EQPA 3KLRA 5C5MA 2D9UA 4RAUC 4C3IG 1W6KA 1GUNA 3WOFA 3Q22A 1LTBD 1C48A 1O7YA 1ILPA 4ZKCB 4WFN3 3M7NA 4A3IB 3MXPA 3BS1A 5M5XB 3K57A 2RSNA 2X6GA 1R4PB 1MGSA 4RCNA 1SMYC 2AQ1B 2JA5B 1DD2A 3CRLC 3GV3A 3S16B 3K6OA 1NCVA 5I2YA 1H9KA 2PW7A 1JB3A 1Q12A 1IW7D 2VB3X 3SEBA 4K5XA 3W3AA 1B44D 5E3FA 2B2TC 4CKEA 3NHHA 3I73A 5C5LA 1E2WA 4CHTB 2BE5C 1CT1D 2A68C 2EOTA 3GO5A 3C1FA 3QOJA 4FF3A 1STBA 4XQJA 5EKLA 2RDGA 2NWGA 4IQZA 1HFGA 2EY1A 2J7ZA 1Y1VB 3A7LA 1PFMA 4IURA 1PTOF 1KDCA 4M1UB 2F0PA 1B50A 1ZEQX 3QJYA 4ZAIA 2A74C 2XWJB 3FMCA 4S3SA 1BR9A 3I4MB 2MGSA 1ENAA 3SR1A 1QCBD 3K5NA 4IALA 1QWYA 2WP8J 3S14B 3HG9A 1EQTA 4XQNA 2M00A 1IKMA 1I4HA 2A69D 1STNA 1JICA 3GQBA 2E75C 4UDUC 4IFDI 2EJFC 1GXDC 1IHZA 2EVBA 3C3LA 5IIFA 1ML0D 1OO9B 1TIID 1QOHA 2AWOA 3VYRA 2J4XA 2QEJC 3J7AF 1EU4A 1GHKA 1XX8A 4OIJA 3TP7A 3TP8A 1LV9A 2XWBB 4X3TA 1G2TA 4ZKBB 3U9SA 1CA5A 5J39A 4C3JB 2DY8A 1TWHB 4PMWA 2MPMA 1AZPA 1B53A 2A6HD 1EU3A 3A8IE 1EEFD 4IUNA 3HOVB 1QNKA 1F2LA 3W2DA 2F3VA 2ICIA 3FPPA 2B2YA 1WTWA 3MVVA 5ELCA 2XNAC 1Q1BA 3IFTA 3RD4A 3PUVA 5ELBA 1WTPA 3X3NA 4A3FB 4L6TB 2F0WA 2B2WC 4LAAA 1MI2A 4PMCA 2DNCA 2JA6B 3NWSA 3J7AV 2EYFA 2D2CC 1CK1A 5J1ZA 1L0YB 1S5DD 2WINB 5C0XI 4A3KB 1MSHA 2XIWA 1JOQA 1B9NA 1SFOB 2KOLA 4G7OC 2WKDA 4CJ1B 1PMRA 3NSWA 5G3LF 4KKUA 4RGOS 5C4ZA 2KCCA 3BVZA 3VR4A 1F2ZA 3FEWX 3AU7A 1U4MA 1J9OA 1EL0A 3NPPA 3MEHA 3HP3A 4KMUC 4RHSA 4PV1C 3NK9A 2VUMB 2F0JA 2KJXA 2F0UA 4WRDA 1TR5A 1IYUA 5I9OA 2RBMA 3FKIB 4H13C 3IKJA 4HEDA 1KNAA 3LWEA 1X32A 3LNNA 4HMJA 5D65A 4KD3A 2NTTA 2A6EC 5KNBA 2K01A 2Y0SB 4BY1B 1GOZA 1EY7A 1LABA 1FD7D 2GA4B 5JAVA 4FF4A 2BA1A 3E6ZX 2AWNA 4RFBA 5C3XA 2E76C 4M8AA 2VNUD 1C8CA 2C5CA 3D4WA 4CJ0B 1D1IA 3GTQB 2F0GA 1X3PA 3ND8A 3M7GA 1PTOC 2VB2X 3CU7A 3L7ZC 2F0LA 1PFNA 3SE0A 1F9PA 2L0CA 2PMZB 1W6JA 3S9WA 4R8NA 5JVG3 1Q90A 1T5EA 4OGQC 4FXKC 3S15B 3Q24A 2X6LA 5I9PA 1NR4A 4IFDJ 1WD0A 1NAPA 4IFDH 4BBSB 5JPNC 1ENFA 4LMQD 1GHJA 1SNMA 3A8KE 3BVGA 1OXSC 3FRPB 1II3A 1STHA 1YNND 2V4DA 3NUCA 1M8AA 2Q8RE 4ME5A 2HDMA 4A3EB 3OHXC 3S1QB 2NZ1D 5CGKA 2Q8TA 1I4XA 3K5MA 4IUVA 1VMPA 2F0HA 2MHVA 4NW2A 2DN8A 1VF7A 3NTIA 1RHPA 3PIP3 4O42A 3NE5B 4QB4A 2E2JB 1HTLD 3LX0A 2EYLA 2IPKD 1CI3M 3CKIB 3FDTA 4K5WA 1A3VA 3A8JE 3QG1A 2B2YC 2PPBC 5C4XB 2PNRC 2CQAA 2F0KA 4J8QA 2I07B 1HA5A 4N9PA 2HUGA 1D5XC 1UNSA 1SEBD 3IFDA 3OWEB 2E2DC 4LK1C 3OIQA 1OXTA 2PZUA 5EKIA 4C56C 1DONA 4F87A 1JWSD 1GUGA 4HSVA 4K14A 2B8GA 1S4ZA 1JR0D 1XXGA 1AP0A 4X3UA 3MC0B 3NQTA 2WV6D 4FP5D 3RMHA 3D6CA 2KEEA 4TRDA 5E4WC 3DEOA 5I6YA 1LTSD 3J80E 3S17B 1SYDA 1U4RA 2KHSA 4XIGS 1HRJA 1SSOA 1JOOA 2ZXOA 4KI0A 2H1EA 2MJ8A 2OEOA 1HQRD 5C44B 5A2QE 2F0DA 1KAAA 3MTSA 3S1MB 4TQUS 1ESRA 2O2LD 1D2BA 2EJGC 1ONLA 1BDOA 3J7YW 3OOCA 2PZTA 2KA7A 2SNSA 2RA4A 1JCKB 4U673 5IGEA 3AMUA 2F0VA 4C1NK 2C9OA 1BUVT 2F0QA 3PUXA 1PRTF 1B2TA 3D31A 5KEEA 3HOUB 3U9OA 3TP6A 2F4IA 2Z4IA 4FO2A 5CV7A 5CC4A 1MBYA 3RUZA 1HXYD 2TMPA 2CHBD 4C3IB 1EY5A 1LTRD 1B4OA 3H09A 4GZYC 3HZXA 3OPOA 5FO8B 2JXMB 1KDBA 5ELFA 1XTCD 5IGDA 1A15A 1F9SA 3I4LA 3QOLA 1GUOA 2B2VA 1WTQA 4ILWA 2ZXPA 1ZYRD 1EWHA 2B8FA 1R9TB 4KY7A 2MUYA 1BOSA 1G2SA 1IW7C 2ZT9C 4QUFA 1I4PA 4K2LA 4K5VA 5EPLA 4KJNA 2L1BA 5M5YB 1DOKA 1M4VA 1I4QA 1CZWA 2EE1A 5D3DA 1EYDA 3M4YA 2AUKA 1WTVA 4H7BA 3PUZA 5EBCA 2CW0D 2Z8LA 2BCOA 3SK4A 1AW7A 3KF8A 4O1NA 3NTKA 2NTSA 1F2MA 4OL7A 4KV6A 3GTMB 3KK7A 1TWCB 4BY7B 2EYOA 4LJZC 3HEJA 3HS0C 4KY5A 1FNVA 1LTAD 3DEPA 1SBBB 2X69A 2KECA 1ET6A 5JJZA 5ISRA 1EZ8A 1WCMB 3G7LA 1LTID 2LFNA 4NDXA 3KUPA 5FK9C 2K33A 3VR6A 2AQ2B 4F88A 4CKCA 2KUMA 4WJWA 2XVSA 4DN4M 1F2YA 4OO1I 3D8GA 4YIJA 1EQVA 3BG3A 2EY6A 4XQQA 4BS9A 3DMUA 1DOMA 5C4HA 4KTAA 2A69C 4G7ZC 1G91A 4I65A 2FMMA 2HDLA 4DNRB 4C3HG 2ZXRA 2NN6I 3J80L 3TSSA 4IUTA 4B9WA 2LY7A 1U9RA 1KTKA 3OW7A 1SNCA 5KNDA 1KABA 3CRKC 3EA6A 2F0NA 1FNWA 4KY6A 2F3WA 1F9RA 4Z9CB 4BA2I 4BBRB 4IN3A 4K2KA 3T53B 2SNMA 4DA2A 2PCFB 5FO7B 1LO5D 2QILA 1LT4D 3H0GB 4HR7B 1D6EC 1LTTD 1ILQA 3BZDB 5JOBA 1RD9D 1EZ6A 5FO9B 1CTMA 3D6WA 5TSSA 5EJWA 2A6HC 1I4GA 2FHTA 3GP7A 1K8MA 3ERQA 1PZID 1TVXA 2EYJA 3SVMA 1HTPA 4OIKA 1I50B 2ID0A 1PRTD 2JA7B 1EYAA 3D4DA 3QB3A 4U68A 1RKNA 3TDQA 2B2UA 2QCPX 3SK8A 1TY0A 4EQOA 1Z47A 3EROA 1TWAB 1SNQA 1KLUD 2E74C 4ZUIA 2O5JC 1FGBD 2JYOA 1VF5C 1R4QB 3GTKB 3GTOB 5HGTA 2KQ3A 4P2CB 3URYA 4RWSC 1Q8IA 1HCZA 5BN3A 2QKIC 3TP5A 2XRQD 2G9HD 5M3MB 3AB9A 4DK1A 2BDOA 3L3OC 5K36H 1LLRD 2HCIA 1B1ZA 1RCVD 4RGMA 3V05A 3KLSA 5J22A 3R2TA 2K1BA 3LWUA 5CMDA 3GD7A 3C1EA 1PRTB 2RDFA 4IFDG 3KBXA 3HOWB 4DAYA 2B2VC 3RLFA 5EQ0A 3NBIA 2VXWA 3ZYYX 1Y8OB 3E0JA 1HFNA 2K5WA 1DXMA 1Y8NB 1ZKOA 4RH6A 2EYPA 3V96A 1B3AA 2K6AA 1BCPF 2F0IA 3I90A 4PQXA 2R6GA 4QCLA 1SDFA 3K0YA 2Q8IB 2IT1A 3Q23A 3VYSA 5IGGA 3MAQA 1D5ZC 1PZJD 4CGYB 3MFYA 1V8QA 1Q3LA 2L12A 1TT2A 5DAUA 3KBGA 4CBVA 4HN7A 5EGTA 1KNEA 1AFPA 1SNPA 2K28A 1EY8A 2M2LA 1I6VC 2LS01 3HOXB 1S5BD 2D5DA 5EBDA 5COYA 4RGTA 1XYIA 3IAYA 1GJXA 4IUQA 2WAQB 1DYQA 1B9MA 1IKLA 2L5TA 2H4OA 3EJIA 3H91A 3MZ5A 2XRSD 5KYLA 1JE4A 1Y8PB 1O7ZA 3C2PA 4ZRZA 1KDAA 3A54A 1TY2A 1ZXTA 1D1KA 5C0XG 1D5MC 3GTLB 3I72A 4XDXA 3Q0AA 4FXDA 2JP1A 5CBEE 1TS2A 4BWGB 4HTHA 3A56A 2R61A 3D3RA 3RZDB 3HGBA 1YNNC 4DF7A 3SHLA 1BF4A 5CYUA 2WIIB 3E5SA 4EQNA 1RTOA 1YNJD 1QG7A 3N52A 3MXUA 2OF1A 3BDLA 4B9XA 1SYGA 1HA6A 3R93A 4IUPA 2D62A 5C4JB 4CJ2C 1CHQD 2WKCA 1IL8A 5M9OA 2NB0A 3OMGA 4PMBA 4RHRA 1YNJC 1HUMA 1EIHA 2FJ2A 1QJOA 1PXUA 4ABNA 2PZWA 3P1HA 5C0XJ 2KEDA 4RKBA 5NUCA 1A2TA 1RODA 1WVLA 1CM9A 3UI2A 3SXHA 3PIO3 5C0XH 1ENCA 3MXNA 2Z1CA 3TZUA 4FF2A 3I4NB 3PMFA 3OIPA 3CQZB 1Z7TA 3H94A 3OWFA 4N9TA 3X3MA 1CQFA 1A6XA 4BA1I 1V1PA 3M85A 2J0TD 3K5LA 2B2UC 1FYCA 4H0LC 4RKLA 4FNFA 1RF2D 1STEA 2BDNA 3V2TA 1EIGA 3DUZA 3R2IA 3VR3A 1SE3A 3J81E 5HURA 4ZYSA 3BDOA 1H9RA 1TQOA 2K7VA 1MSGA 2A5HA 1Q1EA 2YU9B 3VYTA 1H9JA 2OT2A 2ENBA 3HKZB 3T51B 2K32A 3NWTA 2EZVA 3TZDA 1BQQT 5C3EB 5CV5A 5AFWA 1LT6D 4G4KA 5T1IA 1UEAB 1SJED 1BCPD 5I2XA 4AYBB 3BVMA 3SK5A 4QUCA 1JWUD 1GUTA 1STYA 2IL8A 3DM1A 2F0FA 2N88A 3PO3B 4JBWA 3PV0A 3PO2B 1EFID 1MD2D 1HPCA 4XXEA 4X3SA 3D4RA 1STGA 5KGUA 5DNFA 3NXWA 5DM63 3K59A 2F1MA 4K8JA 2IJ0A 2SOBA 3QO2A 3A7AB 1ESFA 1JWMD 2FFKB 3R3OA 5LL6S 5C3WA 2F0TA 1QB5D 2RSOA 2WACA 3FPUB 3P75A 1V43A 4H44C 2IX3A 1SMYD 2EPBA 3BYYB 4E6IA 2R93B 1VMCA 4A3MB 5EPJA 1EOTA 2RDHA 1NUCA 1BCPB 2PYKA 2JA8B 1OXXK 1K8OA 4OHJA 2K03A 3T16A 2IW3A 3L9AX 2FINB 1SXTA 5JVH3 3CHBD 1G8ZD 3DWPA 2BE5D 4KKTA 1F9QA 2A68D 1CZGA 1TS5A 1LTGD 1CHPD 1ZYRC 1DCZA 4UAIA 2EYMA 2R7ZB 4NP5A 3DHQA 1Y69U 2NVYB 2BA0A 3ONAB 3MWYW 1PDQA 1TS4A 5EPKA 2NVXB 3MA2B 1SNDA 3GTJB 5JPMC 1A3TA 5M3FB 5BN4A 3G6JB 4JK1C 1S5ED 1V1OA 2CW0C 2HQEA 5CR3A 1CFMA 1H9MA 3M4OB 2AQ3B 2F0EA 1G291 1A3UA 5IT9E 1EY4A 3JAME 3H3VC 1VCIA 2R92B 1SJHD 2R3ZA 4KK7A 1FNUA 4KD4A 1QE6A 2L9HA 3P7JA 1AN8A 2AUJD 3NBHA 2IX1A 1VDZA 3K7AB 2EYHA 1SE4A 3VR5A 3VA7A 4Q5VA 5LHY1 1SYEA 1AZQA 4FF1A 3QIAA 2G9DA 2JEAI 2E2IB 3MHBA 4MIUA 4XTCS 2EXZA 4TKOB 3I8ZA 4J6HA 1WTXA 3J81L 4ID6A 4C3JG 4KN4C 1JC7A 1E0BA 2RQXA 2XN9C 5D14A 2A73B 4KKSA 2MP1A 1U4LA 2KVMA 3TN2A 5F2DA 3GTPB 1OXVA 5CORA 1BNZA 4EVOA 5A2QL 2NUCA 1E2ZA 4I7ZC 5I6WA 5I4DA 2QDBA 4C3HB 1H9SB 2I46A 1TKWB 1JORA 1HUNA 1S5FD 2L55A 1PLFA 5KYIA 3TMEA 5K36G 2PQEA 1A2UA 4KHVA 1RTNA 2RKSA 2WB1B 1V1PB 5ELDA 5CV6A 2LMCB 1F77A 3NTHA 3Q6SA 5E1FA 4ZLTF 3HRZC 5BN5A 1UAPA 2N55A 1BO0A 2EY2A 1C4QA 2EY5A 5FLXE 4HAEA 1JQYD 4F7XA 3P20A 3FVQA 1EWCA 3DXJC 3EFXD 4FXGC 4R8IA 3S1NB 2E2HB 1KLGD 1TWGB 2F0SA 2RVLA 3OMCA 4ULLA 3VYUA 3WDNA 2F03A 4A3JB 1DZ1A 1PRTC 2ICEC 4KJOA 1SNOA 1RJTA 3S2DB 2KCNA 1ICWA 5K5PA 1LACA 1G6ZA 1Z6HA 5IGFA 4MHEA 4G7HC 1TU2B 4HCSA 2FMCA 5FKAC 5KNCA 3K5OA 3O13A 2DY7A 2IWHA 1WD1A 1LT5D 1UUPA 3C46A 4DK0A 1HQMC 5IGBA 4K6LA 1IYVA 5C6AA 1SYFA 2SDFA 2JEBI 4OO1G 4ZQ3A 1SE2A 4RGNA 1J8IA 1I4RA 2A6ED 1WTRA 2Z4HA 4PNYA 1RDPD 3I91A 1NR2A 1CQVA 4C2MB 5CV4A 4TSSA 5JEAG 4DXGA 1STAA 2NN6G 4NMZA 5IOCA 4KN7C 1U4PA 5CV8A 1QILA 2YYZA 5IT9L 2XSCA 3JAML 1GUSA 2M9VA 5KIXA 4XT1B 2K05A 3WOEA 3S2HB 1PTOD 1DOLA 2B39A 4X3KA 5T1GA 3T4AC 4A3BB 4B08A 3M3YB 3K58A 3GV6A 4DAPA 2NYZD 3MXGA 1EY6A 1TS3A 2PW5A 4G57A 3SK6A 2EDGA 3VR2A 4DAVA 3RZOB 2LKVA 2CVRA 4QIWB 1EEID 4Y7NB 4OO1H 4IZ8A 2BOSA 1SYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSG A;  4O42 A;  2B2W C;  3KBX A;  1X3Q A;  1MI2 A;  2B2V C;  1ESR A;  2MGS A;  1O7Y A;  2DY7 A;  5EQ0 A;  1WD1 A;  1ILP A;  1ILQ A;  2VXW A;  2FIN B;  1E0B A;  4ZKC B;  1C8C A;  5D14 A;  1HFN A;  2B2T A;  2MP1 A;  1EQT A;  3D6W A;  3FDT A;  4CJ0 B;  1BF4 A;  1U4L A;  2KVM A;  5EJW A;  2RSN A;  2RA4 A;  3TN2 A;  4XT3 B;  1F9Q A;  1IKM A;  1X3P A;  1HUN A;  1MSH A;  2B2Y C;  2X6G A;  3TZD A;  2FHT A;  3DEP A;  1RTO A;  5E4X A;  2XIW A;  4MN3 A;  1JIC A;  1B3A A;  1MGS A;  1PFB A;  1PFN A;  1QG7 A;  3I90 A;  3N52 A;  2SDF A;  4UAI A;  5COR A;  5T1I A;  1BBX C;  4ZK9 B;  1BNZ A;  1SDF A;  1F9P A;  2X69 A;  2KEC A;  1HA6 A;  2KOL A;  3GV3 A;  3R93 A;  5JJZ A;  2HUG A;  2L4N A;  1J8I A;  1NCV A;  3ONA B;  4IUP A;  3MWY W;  1SAP A;  1TVX A;  4CJ2 C;  1PDQ A;  4CJ1 B;  3IFD A;  1ML0 D;  3G7L A;  2HCC A;  2X6L A;  4QUC A;  1B2T A;  5EPK A;  1Q3L A;  3SVM A;  1NR4 A;  1O80 A;  2L12 A;  1IL8 A;  2K04 A;  3KUP A;  5CBA E;  1WTR A;  1WTO A;  4OIK A;  1PLF A;  2IL8 A;  3DM1 A;  1CA6 A;  2KUM A;  1WD0 A;  1HUM A;  1XX8 A;  3I91 A;  5EKI A;  1NAP A;  1NR2 A;  4OIJ A;  2N88 A;  4U68 A;  2FJ2 A;  1U4M A;  1KNE A;  1EIH A;  1J9O A;  2B2U A;  4DN4 M;  2K28 A;  1DON A;  1EL0 A;  1LV9 A;  1RTN A;  2B2T C;  4X3T A;  1G2T A;  3I3C A;  4ZKB B;  2M2L A;  3HP3 A;  4HSV A;  1B4O A;  4LMQ D;  4X3S A;  1CA5 A;  1U4P A;  1S4Z A;  2KED A;  4R9W A;  2DY8 A;  5COY A;  1DOM A;  1ROD A;  3Q6S A;  5DNF A;  1WVL A;  1AP0 A;  1XYI A;  1CM9 A;  4ZLT F;  3IL8 A;  4X3U A;  2JYO A;  3UI2 A;  2N55 A;  1BO0 A;  2MPM A;  1AZP A;  3QO2 A;  4IUQ A;  2EOT A;  1A15 A;  1F9S A;  2B2W A;  2FFK B;  1M8A A;  1B53 A;  2R3Z A;  4HAE A;  2Q8R E;  4XT1 B;  2K05 A;  2B2V A;  2HDM A;  2KEE A;  1WTQ A;  1IKL A;  2RSO A;  1G91 A;  3FPU B;  1QE6 A;  1DOL A;  2L9H A;  3DEO A;  4X3K A;  5E4W C;  5T1G A;  4HED A;  3P7J A;  2FMM A;  2HDL A;  1KNA A;  3LWE A;  1QNK A;  1X32 A;  3H91 A;  4R8I A;  4RA8 A;  4RWS C;  5D65 A;  1F2L A;  4IUT A;  2NZ1 D;  2EPB A;  2Q8T A;  1GUW A;  1U4R A;  3GV6 A;  2RVL A;  1JE4 A;  2NWG A;  4IUV A;  1HFG A;  2J7Z A;  2B2Y A;  1VMC A;  1G2S A;  2L11 A;  1HRJ A;  2B2U C;  1O7Z A;  1PFM A;  2K01 A;  1WTW A;  1SSO A;  5EPJ A;  1EOT A;  2NYZ D;  4QUF A;  1AZQ A;  1VMP A;  2HCI A;  1DZ1 A;  4NW2 A;  5EPL A;  4IUR A;  1RJT A;  1F9R A;  1ZXT A;  2BDN A;  2L1B A;  1ICW A;  5AFW A;  1HHV A;  2H1E A;  1EIG A;  3I8Z A;  1WTP A;  2MJ8 A;  1B50 A;  1G6Z A;  2K1B A;  1DOK A;  2CVR A;  4XDX A;  2EE1 A;  3F2U A;  2D9U A;  4RAU C;  5CMD A;  1RHP A;  1WTX A;  4MHE A;  2JP1 A;  4ZAI A;  3MTS A;  5CBE E;  1WTV A;  4IUU A;  4HCS A;  2K03 A; 
#chains in the Genus database with same CATH topology
 1I94 L;  3GTG B;  1X3Q A;  4EX5 A;  4CKB A;  2QF7 A;  1JT8 A;  2YTY A;  1AEX A;  2IX0 A;  5JEA J;  2B2T A;  4A3E G;  3CCE A;  4A3D B;  1DJR D;  4JI3 L;  4DR3 Q;  2DNE A;  4HCE A;  1L2F A;  3CXC A;  4EGV A;  5CV9 A;  1EYC A;  1O78 A;  3BDC A;  5E4X A;  5JEA H;  1XPR A;  4MN3 A;  2NN6 H;  2O5I C;  3A5Z B;  1BBX C;  2Q2H A;  4XYO A;  4WOR A;  5DEH A;  1VQH A;  3VDY A;  1Z9F A;  4CDF C;  1X55 A;  1PTO B;  2RHQ B;  2L4N A;  3T13 A;  4YWM A;  3GTQ H;  1BXT A;  4HSP A;  4Q0F A;  4B3T Q;  3KFU A;  3BYT B;  5CBA E;  1ASY A;  4IO9 A;  3S1R B;  2UXB Q;  2PO4 A;  1S5C D;  1CA6 A;  2HIX A;  1EY0 A;  2OXP A;  3S15 H;  4FVM A;  2UU9 L;  2K5Q A;  1TWF B;  1E2V A;  1HNX Q;  3NBH B;  3PIP A;  1EY9 A;  4QF4 A;  4QMG A;  5D3I B;  4LFC Q;  4K8I A;  1XNR L;  1XWE A;  1I6H B;  5IOD A;  1JOK A;  2NVQ B;  1L0X B;  4BBS H;  4B3R L;  5C4X G;  1I94 Q;  3K81 C;  1K3B C;  3CCQ A;  5FLX L;  4YCU A;  3EVQ A;  2JSO A;  1I3Q B;  4C1N I;  1PTO H;  2NVT B;  2V1C C;  4POF A;  4JI3 Q;  1XNQ L;  4HJ9 A;  5JJL A;  3S1R H;  1ET9 A;  3DWA A;  3KLS X;  3PUY A;  1H9S A;  4A3E H;  4RCO A;  4L8J A;  1K8G A;  5A35 A;  1C9O A;  3JC6 6;  4DU9 A;  3QWN A;  2EJM A;  3S1Q H;  1SR3 A;  3I55 A;  1BBW A;  3F2U A;  4F8M A;  4V19 0;  4A3G G;  1QUQ A;  2B63 B;  3H6M A;  5FOB B;  5ELE A;  3T56 B;  1DM0 B;  3K0X A;  2TSS A;  3KF6 B;  4IUU A;  2ZTD A;  4ODG A;  1FJG Q;  4XYQ A;  1UE5 A;  2F0O A;  1NMG A;  4HMI A;  3I70 A;  1QNU A;  3ITP A;  4XT3 B;  2B29 A;  2RHS B;  5G3L D;  5KRU A;  4V0B A;  1XNR Q;  1PFB A;  3VA5 A;  1M90 C;  2I5H A;  4ZK9 B;  4A3G B;  3PUW A;  4FYD A;  4B3R Q;  3TBI B;  5LL6 X;  4A93 B;  4Y52 H;  1K9M C;  4DXF A;  4LUO A;  1SN8 A;  5EKK A;  1SAP A;  4L63 B;  1E1T A;  2HCC A;  1SYB A;  5C4X H;  1O80 A;  2K04 A;  3R8B A;  3ND9 A;  1WTO A;  4KHZ A;  4IPD A;  3NP8 A;  1XNQ Q;  4K6D A;  1PZK D;  3NQI A;  4OEM B;  4DGZ A;  3OSO A;  1VQ4 A;  1FL0 A;  3BZK A;  3I3C A;  3MFG A;  4NKL A;  2A19 A;  4DNT B;  4OX9 L;  1Y1W B;  2Z6K A;  4R9W A;  1OXU A;  2MQH A;  1K3R A;  4DFA A;  1NSN S;  3K80 C;  3IL8 A;  1LT3 D;  4J1M A;  5M5W B;  3HOZ B;  2HQL A;  3DWQ A;  2B2W A;  2JE6 I;  1PYW D;  3ICE A;  3A55 A;  4HIO A;  2QA4 A;  3EQL C;  4GNX A;  3SDZ A;  4UHV A;  1O7L A;  1WYD A;  4ZUJ A;  4RA8 A;  1C7Y A;  2K5D A;  3N6R A;  1BCP C;  2SEB D;  1GUW A;  1FR3 A;  2NBF A;  4ME3 A;  5IGC A;  3KDF A;  2L11 A;  4JPB W;  2QGQ A;  1VS0 A;  5DM7 3;  1T5X D;  2O4X A;  3CCV A;  3S17 H;  1HHV A;  2F0M A;  1K83 B;  3HOY B;  4EQP A;  3KLR A;  5C5M A;  2D9U A;  3CP0 A;  4RAU C;  1W6K A;  4C3I G;  1CSP A;  1GUN A;  3WOF A;  2DGY A;  3Q22 A;  2IHF A;  1LTB D;  2HD3 A;  4GN5 A;  2UXC L;  1C48 A;  3CPF A;  1O7Y A;  1SE8 A;  1ILP A;  4IPG A;  4ZKC B;  4WFN 3;  3M7N A;  4A3I B;  4PZ8 A;  3MXP A;  5C44 H;  3BS1 A;  5M5X B;  3S1M H;  3K57 A;  2RSN A;  4OX9 Q;  2X6G A;  1R4P B;  1BKB A;  4NB3 A;  1MGS A;  1UEB A;  2CFM A;  4RCN A;  1SMY C;  2VY3 A;  2AQ1 B;  2ES2 A;  2JA5 B;  1DD2 A;  3CRL C;  3GV3 A;  3S16 B;  2OQ0 A;  2I5M X;  3K6O A;  3RLO A;  1NCV A;  5I2Y A;  2KHJ A;  1H9K A;  2PW7 A;  1JB3 A;  1Q12 A;  1IW7 D;  1VQ6 A;  1SRO A;  2VB3 X;  3SEB A;  4K5X A;  5HY6 A;  3W3A A;  1B44 D;  5E3F A;  2B2T C;  3TRZ A;  4JOI C;  4CKE A;  3NHH A;  3I73 A;  1Y1V G;  5C5L A;  3HOU H;  1VQD A;  1YBY A;  4BY7 G;  1E2W A;  1K28 A;  4J15 A;  2F4V L;  4CHT B;  2BE5 C;  2YTV A;  1CT1 D;  2A68 C;  2EOT A;  3GO5 A;  2UXC Q;  3C1F A;  4C3I H;  3QOJ A;  4DR1 L;  4FF3 A;  1P16 A;  1VQA A;  1STB A;  3M4Q A;  4XQJ A;  1X56 A;  5EKL A;  3I4M G;  2RDG A;  2K5H A;  2NWG A;  4IQZ A;  1HFG A;  2EY1 A;  2J7Z A;  1Y1V B;  3A7L A;  1PFM A;  4JG2 A;  1Q46 A;  4LF4 L;  4IUR A;  1PTO F;  1R9T H;  1W2B A;  2HHH L;  1KDC A;  4M1U B;  2F0P A;  1B50 A;  4DUZ Q;  1ZEQ X;  2CH4 W;  3QJY A;  4ZAI A;  4JBK A;  2A74 C;  4GS3 A;  4JW0 A;  2XWJ B;  4O2D A;  3FMC A;  4S3S A;  2N49 A;  1KXL A;  4L5S A;  1BR9 A;  3I4M B;  2MGS A;  1ENA A;  2ZTC A;  3SR1 A;  4JI4 L;  1QCB D;  3K5N A;  1LUZ A;  4IAL A;  5M5Y H;  1QWY A;  2WP8 J;  3S14 B;  1QZG A;  4JI7 L;  3HG9 A;  1EQT A;  4XQN A;  2Q2T A;  2M00 A;  2NZO A;  1IKM A;  1I4H A;  2A69 D;  1STN A;  1JIC A;  2F52 A;  3GQB A;  2E75 C;  4UDU C;  4IFD I;  3GTM H;  4BY7 H;  2EJF C;  1GXD C;  1TWC H;  2P5Z X;  1S40 A;  4KHP L;  1IHZ A;  2EVB A;  4DR1 Q;  1Q86 C;  3C3L A;  2UUA L;  3U50 C;  5IIF A;  3G6E A;  1ML0 D;  1OO9 B;  2G5D A;  3A0J A;  3F8T A;  1TII D;  2RCN A;  1QOH A;  2AWO A;  1QVC A;  3VYR A;  2J4X A;  2QEJ C;  3PGZ A;  4BBR G;  3J7A F;  1EU4 A;  1GHK A;  1XX8 A;  3TEH B;  4OIJ A;  3TP7 A;  3TP8 A;  4JBJ A;  1LV9 A;  1WCM H;  2XWB B;  3H0G G;  4X3T A;  1G2T A;  1Q82 C;  4LF4 Q;  4ZKB B;  3KF6 A;  3EN2 A;  2HHH Q;  3U9S A;  1CA5 A;  5J39 A;  3UDF A;  4R4I A;  2JK8 A;  4C3J B;  2DY8 A;  1TWH B;  4PMW A;  4JI0 L;  2MPM A;  4QJF A;  1WI5 A;  1AZP A;  2ZTE A;  1U0L A;  1B53 A;  3UDI A;  4JI4 Q;  2A6H D;  5LMU L;  1EU3 A;  3A8I E;  1EEF D;  4IUN A;  1QUQ B;  4X66 L;  3HOV B;  5HGQ A;  1QNK A;  4JI7 Q;  4NXM L;  1F2L A;  3W2D A;  2F3V A;  2ICI A;  3FPP A;  4JYA L;  3HKS A;  2B2Y A;  1WTW A;  3MVV A;  5ELC A;  2XNA C;  2VS1 A;  2JA7 G;  1Q1B A;  2I5L X;  3MEF A;  1LM0 A;  1PH7 A;  3IFT A;  2R7D A;  3RD4 A;  3H3V H;  3PUV A;  4KHP Q;  5ELB A;  1WTP A;  3X3N A;  1HJP A;  2UUA Q;  4A3F B;  4JI6 Q;  4CDD C;  4L6T B;  2F0W A;  4NXN L;  1DGS A;  2B2W C;  1UE7 A;  4LAA A;  1MI2 A;  4PMC A;  2DNC A;  4GNX C;  2JA6 B;  3NWS A;  4K0K L;  1JJC B;  2VQF L;  3J7A V;  2EYF A;  2D2C C;  4BBR H;  1CK1 A;  5J1Z A;  4DPG A;  1L0Y B;  1S5D D;  2WIN B;  5C0X I;  4A3K B;  1MSH A;  3H0G H;  2XIW A;  1JOQ A;  1B9N A;  2KCT A;  1SFO B;  2KOL A;  2RCF A;  2ZJR A;  2VUM G;  4G7O C;  5LMU Q;  2WKD A;  5IP9 G;  4CJ1 B;  1PMR A;  4X66 Q;  3NSW A;  5GAE C;  5G3L F;  4KKU A;  1YI2 A;  2DJF C;  4RGO S;  5C4Z A;  4NXM Q;  4JC0 A;  2KCC A;  3BVZ A;  3VR4 A;  1AE2 A;  2K5N A;  2UUC L;  4JYA Q;  4GNX B;  1F2Z A;  3FEW X;  3AU7 A;  1VQK A;  1U4M A;  3G71 A;  1J9O A;  1EL0 A;  3NPP A;  3MEH A;  3HP3 A;  2FXQ A;  4KMU C;  4RHS A;  1MIU A;  3NK9 A;  4PV1 C;  1I50 H;  3Q8D A;  2JA7 H;  2VUM B;  2F0J A;  2K75 A;  2KJX A;  1KD1 C;  2F0U A;  4WRD A;  4ALP A;  1TR5 A;  1IYU A;  5I9O A;  4NXN Q;  2RBM A;  3FKI B;  4K0K Q;  1TWA H;  1WOC A;  2VQF Q;  4H13 C;  2E5L L;  3IKJ A;  4HED A;  1KNA A;  3LWE A;  1X32 A;  3LNN A;  4HMJ A;  3KOJ A;  5D65 A;  4KD3 A;  2OWO A;  1N8R C;  2NTT A;  2A6E C;  2PMZ E;  3CC7 A;  5KNB A;  2JQO A;  2K01 A;  2Y0S B;  4BY1 B;  1GOZ A;  1EY7 A;  2D0O A;  5J3B A;  3I56 A;  1LAB A;  3GTK H;  3GTO H;  1FD7 D;  1N36 Q;  4L5R C;  3CMA A;  2GA4 B;  5GAG C;  5LMN Q;  3GDE A;  3NEM A;  5JAV A;  3DLL A;  4H02 A;  3A5U A;  4FF4 A;  3HOX G;  4GLX A;  4LUV A;  2BA1 A;  3E6Z X;  2AWN A;  4RFB A;  5C3X A;  2E76 C;  4M8A A;  4DKA C;  2VNU D;  1C8C A;  2C5C A;  3D4W A;  4CJ0 B;  1HNX L;  1D1I A;  1N34 Q;  3GTQ B;  4UP8 A;  2KBN A;  1MJC A;  2F0G A;  2DJG C;  1X3P A;  3ND8 A;  3M7G A;  1PTO C;  2ZM6 L;  3HOW H;  1HZB A;  2VB2 X;  3CU7 A;  3CCR A;  1IXR A;  3L7Z C;  2F0L A;  1PFN A;  5L37 A;  1PH5 A;  3SE0 A;  1VQM A;  1F9P A;  2L0C A;  2PMZ B;  1W6J A;  4OWX B;  3S9W A;  4R8N A;  5JVG 3;  1VQL A;  1Q90 A;  1T5E A;  4OGQ C;  2DUD A;  4FXK C;  1XPU A;  3S15 B;  1YVC A;  3Q24 A;  2E5L Q;  2X6L A;  5I9P A;  1NR4 A;  1N9W A;  4A3C H;  4IFD J;  4A4I A;  1KHI A;  1WD0 A;  2H5X A;  1PHJ A;  3RN5 A;  1NAP A;  4IFD H;  2VW9 A;  4BBS B;  5JPN C;  1ENF A;  4LMQ D;  1S3O A;  1GHJ A;  2PNH A;  3KF8 B;  3A74 A;  1SNM A;  3A8K E;  3BVG A;  1OXS C;  4IJH A;  1PYS B;  3FRP B;  1II3 A;  2F3I A;  1K0R A;  1STH A;  1YNN D;  2V4D A;  2EXD A;  3NUC A;  1FJG L;  1M8A A;  2Q8R E;  4ME5 A;  2ZJP A;  2HDM A;  4A3E B;  3HOX H;  2GVA A;  4AQY L;  3OHX C;  3S1Q B;  1VQB A;  3E9H A;  2NZ1 D;  2Q8T A;  5CGK A;  1I4X A;  2ZM6 Q;  3K5M A;  4IUV A;  4YCW A;  4RG1 A;  1VMP A;  1L0W A;  2F0H A;  2MHV A;  4NW2 A;  2DN8 A;  1EQQ A;  1VF7 A;  1NNX A;  3NTI A;  1RHP A;  4DV4 Q;  5EAY A;  3PIP 3;  4O42 A;  3NE5 B;  4HIM A;  4QB4 A;  1CKN A;  2E2J B;  1HTL D;  1LYL A;  3LX0 A;  2EYL A;  2IPK D;  3GTL H;  1CI3 M;  1RIP A;  3CKI B;  1Q81 C;  3I4N G;  3FDT A;  4K5W A;  3KJP A;  1A3V A;  3A8J E;  3QG1 A;  2OQK A;  2B2Y C;  2PPB C;  5C4X B;  4JBM A;  2IHE A;  1LTL A;  3TS2 A;  1C0A A;  2PNR C;  2CQA A;  2QDL A;  3RZD H;  1PFS A;  2F0K A;  4J8Q A;  2I07 B;  1X65 A;  1HA5 A;  3M9B A;  4N9P A;  2HUG A;  1D5X C;  1UNS A;  1SEB D;  3IFD A;  4AQY Q;  1NJI C;  4LUZ A;  2N3S A;  3OWE B;  1MKH A;  1PH2 A;  1V1Q A;  2E2D C;  4LK1 C;  5GAH C;  3OIQ A;  3UE0 A;  1OXT A;  2PZU A;  3HKZ E;  5EKI A;  2Z6B A;  4C56 C;  4DAM A;  2E2J H;  1DON A;  5C4J H;  4F87 A;  2UXD L;  1NTG A;  4RMF A;  4L5T A;  1JWS D;  1GUG A;  1X9N A;  3CCM A;  4HSV A;  4K14 A;  2OTL A;  2R7F A;  2B8G A;  1S4Z A;  4X6A H;  3HKZ G;  3HFZ B;  1JR0 D;  3G48 A;  2KEN A;  2JA9 A;  1XXG A;  1AP0 A;  5JJI A;  4X3U A;  4NPS A;  1CSQ A;  3MC0 B;  3PSI A;  4LF7 L;  3NQT A;  2WV6 D;  5C3E G;  4FP5 D;  3RMH A;  5C44 G;  4UP9 A;  3D6C A;  2KEE A;  4TRD A;  1N33 L;  5E4W C;  3DEO A;  1KL9 A;  5I6Y A;  4JV5 L;  4PG3 A;  1LTS D;  3J80 E;  5BR8 Q;  3S17 B;  1VQO A;  2K5V A;  1SYD A;  3QR8 A;  2Z9H A;  1U4R A;  2KHS A;  1FGU A;  4JI2 L;  4XIG S;  4HJA A;  1HRJ A;  4YCV A;  3I4N H;  1SSO A;  3CQZ H;  2NZH A;  1JOO A;  1YHB A;  1GO3 E;  4LF8 L;  2ZXO A;  4KI0 A;  4DK6 C;  3PF5 A;  1JJG A;  1VQF A;  3PO3 G;  2H1E A;  2MJ8 A;  2OEO A;  1HQR D;  5C44 B;  1IBK L;  3PO2 G;  1PH3 A;  1NBW A;  2F0D A;  5A2Q E;  1KAA A;  3MTS A;  4N8F A;  2A1A A;  2UUB L;  3S1M B;  1E7Z A;  4TQU S;  1ESR A;  4GN4 B;  1MJE A;  2O2L D;  1D2B A;  2EJG C;  1NY4 A;  1ONL A;  1BDO A;  3J7Y W;  3OOC A;  2D0P A;  3HOU G;  1YIT A;  2PZT A;  2UXD Q;  2KA7 A;  2SNS A;  1O7I A;  2RA4 A;  2HIV A;  1JCK B;  2YU9 H;  4U67 3;  5IGE A;  3AMU A;  3J80 i;  2F0V A;  2RF4 A;  4LF7 Q;  2R93 G;  4C1N K;  2C9O A;  5IWA L;  4A3M G;  1BUV T;  2F0Q A;  1HNW L;  1N33 Q;  3PUX A;  1PRT F;  1B2T A;  3D31 A;  4JV5 Q;  5C3E H;  4N8X 1;  3OTO L;  2JA8 G;  5KEE A;  3HOU B;  3U9O A;  4JCV E;  2MNA A;  4JI2 Q;  2ASB A;  3TP6 A;  4BXX H;  2F4I A;  4DV6 L;  2Z4I A;  4FO2 A;  5CV7 A;  5CC4 A;  1MBY A;  3RUZ A;  1HXY D;  2TMP A;  2CHB D;  4C3I B;  4LF8 Q;  1EY5 A;  1LTR D;  1B4O A;  5IP7 G;  3H09 A;  2E8G A;  4GKJ L;  4GZY C;  1IBK Q;  3HZX A;  3OPO A;  5FO8 B;  4DUZ L;  3LGJ A;  2JXM B;  3J80 c;  3CF5 A;  1KDB A;  5ELF A;  2UUB Q;  1XTC D;  3PO3 H;  4UY8 C;  5IGD A;  1A15 A;  1F9S A;  3I4L A;  3QOL A;  4PZ7 A;  3AEV A;  3PO2 H;  1GUO A;  2B2V A;  1WTQ A;  4ILW A;  2ZXP A;  3AFQ A;  1ZYR D;  1EWH A;  2B8F A;  2Q2I A;  2AKW B;  1R9T B;  5FLM G;  5DLQ E;  4KY7 A;  4EQ5 A;  2MUY A;  1BOS A;  1G2S A;  5IYC H;  1IW7 C;  2ZT9 C;  4QUF A;  1I4P A;  3CPW A;  2N8N A;  4K2L A;  4R4O A;  5M3F G;  4K5V A;  5EPL A;  1K8A C;  4KJN A;  2L1B A;  5IWA Q;  4A75 A;  2Z0S A;  4GLA C;  1Q8K A;  1HNW Q;  5M5Y B;  1DOK A;  1M4V A;  1I4Q A;  1CZW A;  2EE1 A;  2R93 H;  5D3D A;  1EYD A;  3M4Y A;  2AUK A;  1WTV A;  4A3M H;  4H7B A;  1X3F A;  3U4V A;  3OTO Q;  4OWW B;  3PUZ A;  4IOA A;  1WCM G;  4JI8 Q;  5EBC A;  2CW0 D;  3BJU A;  2Z8L A;  2BCO A;  3SK4 A;  1AW7 A;  3KF8 A;  4O1N A;  3NTK A;  2JA8 H;  4DV6 Q;  2R92 G;  1VQN A;  4HIK A;  2NTS A;  1F2M A;  4OL7 A;  4KV6 A;  3GTM B;  3KK7 A;  1TWC B;  3PF4 A;  2EYO A;  4BY7 B;  4LJZ C;  4B3M L;  3HEJ A;  3HS0 C;  5H1S E;  4KY5 A;  4GKJ Q;  1FNV A;  1LTA D;  3DEP A;  2AHO B;  1SBB B;  5IP7 H;  2X69 A;  2KEC A;  4OON A;  5FJ8 G;  1ET6 A;  4GLV B;  5JJZ A;  5LMN W;  1YIJ A;  3S24 A;  5ISR A;  1VQ9 A;  1EZ8 A;  4DUY L;  1WCM B;  3B6Y A;  3G7L A;  4R4C A;  1LTI D;  2LFN A;  4NDX A;  3KUP A;  5FK9 C;  2K33 A;  3VR6 A;  1WTH A;  2AQ2 B;  4F88 A;  1VQG A;  2R7Z H;  4CKC A;  2KUM A;  2NVY H;  4WJW A;  2XVS A;  5FLM H;  1KAW A;  4DN4 M;  4LF6 L;  1F2Y A;  4OO1 I;  2NVX H;  3D8G A;  4YIJ A;  1EQV A;  3SGI A;  3BG3 A;  2EY6 A;  4XQQ A;  4BS9 A;  3DMU A;  1DOM A;  5M3F H;  5C4H A;  4JI6 L;  1A8V A;  1YHQ A;  4KTA A;  4LNQ A;  2A69 C;  4G7Z C;  4FDB A;  1G91 A;  4I65 A;  4DR4 L;  2FMM A;  2HDL A;  4DNR B;  3AYH B;  4C3H G;  2ZXR A;  2NN6 I;  3J80 L;  3M4O H;  3TSS A;  4IUT A;  4B9W A;  4B3M Q;  4LFB L;  2LY7 A;  1U9R A;  1KTK A;  1CKN B;  3L0O A;  3OW7 A;  4DR5 L;  1SNC A;  5KND A;  3H15 A;  1JJ2 A;  1KAB A;  2R92 H;  2WB1 E;  3CRK C;  3EA6 A;  3TS0 A;  2F0N A;  1FNW A;  3U4Z A;  2Q2U A;  4KY6 A;  1I5F A;  2F3W A;  1F9R A;  4Z9C B;  3W1B A;  4BA2 I;  3NEN A;  3K7A H;  4DUY Q;  1VQP A;  3J7A 5;  4BBR B;  4IN3 A;  4K2K A;  3T53 B;  2WB1 G;  1VQ5 A;  1UE6 A;  2K52 A;  5FJ8 H;  1YZ6 A;  2SNM A;  4DA2 A;  2PCF B;  5FO7 B;  1LO5 D;  4JI5 Q;  2QIL A;  1LT4 D;  3H0G B;  2E2I H;  4HR7 B;  1D6E C;  1LTT D;  1ILQ A;  2BH8 A;  3BZD B;  5JOB A;  1RD9 D;  1UWV A;  1EZ6 A;  5FO9 B;  4LF6 Q;  1CTM A;  3MXN B;  1GD7 A;  3D6W A;  5TSS A;  5EJW A;  2A6H C;  2LXJ A;  2Z6K C;  3EBE A;  3G4S A;  1I4G A;  2FHT A;  3GP7 A;  1K8M A;  3ERQ A;  1PZI D;  3ULP A;  4UP7 A;  1TVX A;  2EYJ A;  1FVI A;  3GTP H;  3D0F A;  3SVM A;  4DR4 Q;  1HTP A;  3OW2 A;  4OIK A;  1B70 B;  1I50 B;  4LFB Q;  2ID0 A;  3CC4 A;  1PRT D;  2JA7 B;  4DR5 Q;  1EYA A;  1ASZ A;  3D4D A;  3QB3 A;  3UDX A;  2EQS A;  4U68 A;  1RKN A;  3TDQ A;  4C3H H;  2B2U A;  2QCP X;  3SK8 A;  1TY0 A;  4EQO A;  1Z47 A;  5M3M G;  3ERO A;  1N36 L;  1TWA B;  4CDE C;  5LMN L;  3CCJ A;  1SNQ A;  1KLU D;  2E74 C;  4ZUI A;  2O5J C;  3OYY A;  4IOC A;  4L5Q A;  1FGB D;  2JYO A;  1E1O A;  1KQS A;  1VF5 C;  1R4Q B;  4KLK A;  4DV5 L;  4R4Q A;  3GTK B;  2MO0 A;  3GTO B;  5HGT A;  2KQ3 A;  4P2C B;  3URY A;  3HOW G;  4RWS C;  3T1Y L;  1Q8I A;  1HCZ A;  1N34 L;  2JN4 A;  5BN3 A;  2QKI C;  3TP5 A;  2XRQ D;  1NE3 A;  2G9H D;  5M3M B;  3CD6 A;  3AB9 A;  4DK1 A;  2BDO A;  3L3O C;  5K36 H;  1LLR D;  2HCI A;  1B1Z A;  1RCV D;  3BZC A;  4LW1 A;  4RGM A;  3V05 A;  2E2H H;  3S1N H;  3KLS A;  4A3C G;  5J22 A;  1IBL L;  3R2T A;  1TWG H;  2K1B A;  4DV0 Q;  3LWU A;  1HZA A;  5CMD A;  3GD7 A;  3C1E A;  5GQO A;  4OWT B;  1PRT B;  2RDF A;  4IFD G;  3KBX A;  3HOW B;  4DAY A;  2B2V C;  4HJ8 A;  4A3J H;  3RLF A;  5EQ0 A;  3S2D H;  3NBI A;  2VXW A;  3ZYY X;  3AQQ A;  1Y8O B;  3ZJY C;  4YHH L;  3E0J A;  3STB D;  1HFN A;  2K5W A;  1DXM A;  4YY3 L;  1Y8N B;  1ZKO A;  4RH6 A;  3W5O A;  1XPO A;  5IYD G;  4QL5 A;  1D7Q A;  2WAQ E;  2EYP A;  3V96 A;  5M3M H;  1B3A A;  4A3B G;  2K6A A;  1BCP F;  2F0I A;  3I90 A;  4PQX A;  2R6G A;  1EOV A;  4DV7 L;  4QCL A;  1SDF A;  4QIW E;  3K0Y A;  2Q8I B;  2IT1 A;  3Q23 A;  3VYS A;  5IGG A;  2BH2 A;  4WJ3 M;  3MAQ A;  4DV5 Q;  2MFI A;  1JB7 A;  1D5Z C;  1PZJ D;  4CGY B;  2ALY B;  3MFY A;  1V8Q A;  1Q3L A;  2WAQ G;  2L12 A;  2MO1 A;  4X64 Q;  1TT2 A;  1X54 A;  2AMC B;  5DAU A;  3T1Y Q;  3KBG A;  4CBV A;  1TXY A;  4HN7 A;  5EGT A;  1KNE A;  1AFP A;  1SNP A;  1KIX A;  2K28 A;  1SLJ A;  1YJN A;  3U58 A;  1EY8 A;  2M2L A;  5IYB G;  4LF5 L;  4GN3 B;  1I6V C;  2LS0 1;  1EIY B;  3HOX B;  1KC8 C;  1S5B D;  1IBL Q;  2D5D A;  2YV5 A;  5COY A;  5EBD A;  1G51 A;  3CCL A;  4RGT A;  4A3D G;  1HH2 P;  4JI1 Q;  1XYI A;  3IAY A;  1GJX A;  4DV4 L;  1JMC A;  4C2M H;  4IUQ A;  2WAQ B;  2YTX A;  1DYQ A;  4GOP A;  1IKL A;  1B9M A;  2L5T A;  1UE1 A;  2H4O A;  2PI2 E;  4YHH Q;  3EJI A;  3H91 A;  3MZ5 A;  4YY3 Q;  2XRS D;  5KYL A;  4HJ7 A;  1QVF A;  1JE4 A;  1CKO A;  1Y8P B;  1O7Z A;  4GKK L;  2EIF A;  3C2P A;  1PA6 A;  1PV4 A;  3S2H H;  4DV7 Q;  4ZRZ A;  1KDA A;  3A54 A;  1TY2 A;  4JOI A;  1K0S A;  5IYD H;  1ZXT A;  1D1K A;  3CAM A;  5C0X G;  4A3B H;  1D5M C;  3GTL B;  3M3Y H;  3I72 A;  4XDX A;  3Q0A A;  4FXD A;  2JP1 A;  5CBE E;  4QGU A;  1TS2 A;  1L1O B;  3FHW A;  4BWG B;  4HTH A;  3E0E A;  4ZCK A;  3A56 A;  2R61 A;  3D3R A;  1Q7Y C;  3RZD B;  3RZO H;  1AH9 A;  3HGB A;  3CME A;  4Y7N H;  1YNN C;  4DF7 A;  1GM5 A;  2B3G A;  3SHL A;  1BF4 A;  5CYU A;  4LF5 Q;  2WII B;  3GTG H;  3ULL A;  3E5S A;  4EQN A;  1RTO A;  1YNJ D;  3CW2 C;  1QG7 A;  3N52 A;  1M1K C;  5IYB H;  3MXU A;  2OF1 A;  3BDL A;  4B9X A;  1SYG A;  1HA6 A;  3R93 A;  1VQJ A;  4A3D H;  4IUP A;  2D62 A;  3KYH C;  5C4J B;  4CJ2 C;  1CHQ D;  2WKC A;  1IL8 A;  1BBU A;  5M9O A;  4PZ6 A;  2NB0 A;  4MNO A;  5BR8 L;  1SRU A;  3OMG A;  4PMB A;  4RHR A;  1YNJ C;  2B63 G;  3PIO A;  1HUM A;  4P75 A;  4APV A;  5IY0 A;  1EIH A;  2FJ2 A;  1QJO A;  1VQI A;  1PXU A;  4I7A A;  4ABN A;  4GKK Q;  1IZ6 A;  4WJ4 A;  5GAD C;  1PVO A;  2PZW A;  1MHW C;  1V9P A;  3P1H A;  5C0X J;  2KED A;  3RR5 A;  4RKB A;  5NUC A;  1PH4 A;  4LWC A;  1A2T A;  1ROD A;  1WVL A;  1VQC A;  1CM9 A;  1G6P A;  3UI2 A;  2KCM A;  3ERS X;  3SXH A;  3PIO 3;  5C0X H;  1TWF H;  4LFA L;  1ENC A;  3MXN A;  2Z1C A;  4IPC A;  1IBM L;  3TZU A;  4FF2 A;  3I4N B;  3PMF A;  3OIP A;  2PQA B;  3CQZ B;  1Z7T A;  1XMQ L;  3H94 A;  3OWF A;  4A93 G;  4N9T A;  1I6H H;  3X3M A;  5GRO A;  1CQF A;  4IPH A;  1A6X A;  1PYB A;  2NVQ H;  4BA1 I;  4DNI A;  2CQO A;  1V1P A;  1E22 A;  3M85 A;  2J0T D;  3K5L A;  2VQE L;  2UU9 Q;  2B2U C;  1FYC A;  1I3Q H;  4H0L C;  4RKL A;  4AYB E;  4FNF A;  1RF2 D;  1STE A;  4HID A;  2BDN A;  3V2T A;  2NVT H;  1EIG A;  1J5E L;  3DUZ A;  3R2I A;  3VR3 A;  1SE3 A;  3J81 E;  5HUR A;  4ZYS A;  1Y1W G;  3BDO A;  1H9R A;  4BXX G;  1TQO A;  2K7V A;  1MSG A;  2A5H A;  1E3P A;  1Q1E A;  4AYB G;  2YU9 B;  3VYT A;  1H9J A;  4DR7 L;  2OT2 A;  3HOZ G;  2ENB A;  3HKZ B;  4OXP A;  3T51 B;  2K32 A;  3T1H L;  4DV1 L;  3NWT A;  2B63 H;  2EZV A;  3FP9 A;  3E3X A;  3TZD A;  2A8V A;  1BQQ T;  5C3E B;  5CV5 A;  3UE1 A;  5AFW A;  1LT6 D;  4G4K A;  5T1I A;  1T9H A;  1UEA B;  4LFA Q;  1SJE D;  1IBM Q;  1B7Y B;  1BCP D;  5I2X A;  4AYB B;  3BVM A;  1XMQ Q;  3SK5 A;  4QUC A;  1JWU D;  4R1J A;  1E24 A;  1CKM A;  3KLW A;  4P73 A;  1GUT A;  5IYC G;  1STY A;  2IL8 A;  3EIV A;  3F2C A;  3HOY G;  3DM1 A;  4A3G H;  2F0F A;  3H3V I;  4A93 H;  3J81 i;  2N88 A;  1OTC A;  2VQE Q;  3PO3 B;  4JBW A;  2QW7 A;  1JE5 A;  3PV0 A;  2L15 A;  3PO2 B;  1XTD A;  1EFI D;  1MD2 D;  1HPC A;  4XXE A;  4X3S A;  4A3I G;  1J5E Q;  3D4R A;  1STG A;  5KGU A;  2VL6 A;  5DNF A;  3NXW A;  5DM6 3;  3K59 A;  2F1M A;  1EWI A;  2IJ0 A;  2SOB A;  4K8J A;  4AH6 A;  3QO2 A;  1EUJ A;  3A7A B;  1ESF A;  1JWM D;  2FFK B;  3R3O A;  5LL6 S;  4JI8 L;  5C3W A;  2F0T A;  1QB5 D;  2RSO A;  1SMX A;  2WAC A;  1Y1W H;  1X6O A;  2JA5 G;  3FPU B;  1BVS A;  3P75 A;  4DR7 Q;  1V43 A;  4DR6 L;  4H44 C;  2IX3 A;  3T1H Q;  4DV1 Q;  1SMY D;  4MTK A;  2EPB A;  4DAY B;  5M5W H;  3HOZ H;  1B3Q A;  3BYY B;  3RNU A;  4E6I A;  2R93 B;  1VMC A;  3J81 c;  4A3M B;  5EPJ A;  1EOT A;  2RDH A;  1KRS A;  1NUC A;  1BCP B;  2PYK A;  1N32 L;  1QZH A;  1YNX A;  2JA8 B;  1OXX K;  1YJW A;  1K8O A;  2R7Z G;  4IJL A;  1VQ8 A;  1D8L A;  4OHJ A;  2K03 A;  3T16 A;  1XMO L;  5JJK A;  2IW3 A;  4GOP C;  3L9A X;  2FIN B;  2N78 A;  1SXT A;  3RN2 A;  1K83 H;  3HOY H;  5JVH 3;  3CHB D;  1G8Z D;  3DWP A;  2BE5 D;  4DV2 L;  4KKT A;  1F9Q A;  2A68 D;  1PH1 A;  1CZG A;  1TS5 A;  1EYG A;  1LTG D;  1CHP D;  1ZYR C;  1DCZ A;  4X62 L;  4UAI A;  2EYM A;  4LF9 L;  4NP5 A;  3DHQ A;  4A3I H;  1Y69 U;  2R7Z B;  2NVY B;  2BA0 A;  5M5X H;  3ONA B;  3MWY W;  4OEL B;  1PDQ A;  1TS4 A;  4MZ9 A;  5EPK A;  3F2B A;  4DR6 Q;  3ER0 A;  3MA2 B;  2IY5 B;  2NVX B;  1SND A;  2I0Q A;  3GTJ B;  5JPM C;  1A3T A;  2JA5 H;  1PH9 A;  3S16 H;  2QEX A;  4GOP B;  5M3F B;  1HR0 W;  5BN4 A;  3G6J B;  4JK1 C;  1S5E D;  1V1O A;  3F1Z A;  3PQI A;  2ZJQ A;  2CW0 C;  2HQE A;  1N32 Q;  2KHI A;  1L1O A;  5CR3 A;  4YWL A;  1CFM A;  4X65 L;  1H9M A;  3M4O B;  2AQ3 B;  2F0E A;  1G29 1;  1A3U A;  5IT9 E;  1EY4 A;  3JAM E;  1PH8 A;  3H3V C;  3BU2 A;  1XMO Q;  1VCI A;  2R92 B;  1SJH D;  2PI2 A;  2R3Z A;  4KK7 A;  4JI5 L;  1FNU A;  4KD4 A;  4DV3 L;  1QE6 A;  2L9H A;  3K7U C;  3P7J A;  1AN8 A;  2AUJ D;  4UPA A;  3NBH A;  2IX1 A;  1VDZ A;  3K7A B;  2EYH A;  1SE4 A;  4DV2 Q;  3VR5 A;  2HT1 A;  5ELN A;  3VA7 A;  3GTJ H;  4Q5V A;  3L2P A;  1XJV A;  5LHY 1;  1SYE A;  1AZQ A;  4FF1 A;  4X62 Q;  2CWP A;  3QIA A;  4LF9 Q;  2G9D A;  2JEA I;  2E2I B;  1VQ7 A;  3MHB A;  4MIU A;  4XTC S;  2EXZ A;  4TKO B;  3I8Z A;  4J6H A;  1A62 A;  1WTX A;  2GN5 A;  3J81 L;  3UDG A;  4ID6 A;  2F4V Q;  2JJQ A;  1Y1V H;  5ELO A;  4C3J G;  4A76 A;  4KN4 C;  1JC7 A;  1HNZ L;  1E0B A;  2RQX A;  2XGT A;  2XN9 C;  3I2Z A;  5D14 A;  2A73 B;  1GKH A;  3JAM i;  1P8L A;  4KKS A;  2MP1 A;  5AJ3 L;  1U4L A;  1WJJ A;  1NMF A;  2KVM A;  3TN2 A;  3HOV G;  5F2D A;  3GTP B;  3I4M H;  4X65 Q;  2XTI A;  2PQA A;  1OXV A;  5COR A;  5IE8 A;  1BNZ A;  4EVO A;  5A2Q L;  2NUC A;  1E2Z A;  3ULJ A;  3S14 H;  4I7Z C;  5I6W A;  5I4D A;  2QDB A;  4C3H B;  1H9S B;  2I46 A;  4DV3 Q;  1YHA A;  1IL2 A;  1TKW B;  3J81 j;  1JOR A;  1HUN A;  1S5F D;  2L55 A;  2K4K A;  1PLF A;  1EIF A;  5KYI A;  3TME A;  5K36 G;  4A3F G;  4QQB X;  2PQE A;  1A2U A;  5IT9 c;  1YJ9 A;  3M4P A;  4KHV A;  1RTN A;  2RKS A;  3JAM c;  1IYJ B;  2JA6 G;  2WB1 B;  1V1P B;  5ELD A;  1K73 C;  3J7Z C;  4B3S L;  4DV0 L;  4A3J G;  5CV6 A;  2LMC B;  1F77 A;  3NTH A;  3Q6S A;  5E1F A;  4ZLT F;  3HRZ C;  5BN5 A;  1UAP A;  3RLN A;  2N55 A;  4A3K G;  1BO0 A;  4P72 A;  2EY2 A;  1C4Q A;  2EY5 A;  3DM3 A;  5FLX E;  4HAE A;  1JQY D;  4R4T A;  1KRT A;  3NEL A;  4F7X A;  1HNZ Q;  3IRB A;  3P20 A;  5E7N A;  4C3J H;  3FVQ A;  1EWC A;  1HR0 L;  3DXJ C;  1TWH H;  3K8A A;  3EFX D;  4FXG C;  4R8I A;  3CC2 A;  4POG A;  3S1N B;  2E2H B;  1KLG D;  5AJ3 Q;  1YEZ A;  1EQR A;  2ATW A;  1TWG B;  2F0S A;  2RVL A;  3OMC A;  4ULL A;  3VYU A;  4DR2 L;  3WDN A;  2F03 A;  4A3J B;  1DZ1 A;  1ICF B;  1PRT C;  2ICE C;  3HOV H;  2GVB A;  1SNO A;  1RJT A;  4KJO A;  2VZA A;  2KCN A;  3S2D B;  1ICW A;  5K5P A;  1LAC A;  1G6Z A;  1Z6H A;  5IGF A;  4A3L G;  4JI0 Q;  4MHE A;  4G7H C;  4YWK A;  1TU2 B;  3WWV A;  4HCS A;  4X64 L;  2FMC A;  5FKA C;  2OCE A;  5KNC A;  3K5O A;  3O13 A;  2DY7 A;  2IWH A;  1WD1 A;  1LT5 D;  1HZ9 A;  1S72 A;  1UUP A;  3C46 A;  3FKI G;  4DK0 A;  4A3F H;  1H95 A;  1HQM C;  2Y0S E;  5IGB A;  1GVP A;  1HZC A;  4K6L A;  4DK3 C;  2WFW A;  3CCU A;  3E9I A;  4B3S Q;  2JA6 H;  3KJO A;  1IYV A;  3TRE A;  5C6A A;  1SYF A;  2SDF A;  4JI1 L;  2JEB I;  4OO1 G;  2CWA A;  4ZQ3 A;  2Y0S G;  1SE2 A;  4BY1 G;  3KDF B;  4RGN A;  1J8I A;  1I4R A;  3AFP A;  2A6E D;  4A3K H;  1WFQ A;  3I4O A;  1Y14 B;  1HR0 Q;  4TVA B;  4O0A A;  1WTR A;  2LXK A;  1A63 A;  2Z4H A;  2K14 A;  4PNY A;  1SFO H;  1RDP D;  3I91 A;  2OTJ A;  1NR2 A;  1CQV A;  4DR2 Q;  4QY7 A;  4C2M B;  5CV4 A;  4TSS A;  5JEA G;  4DXG A;  1STA A;  1VQE A;  3TQY A;  2NN6 G;  4NMZ A;  5FLX c;  5IOC A;  4KN7 C;  4DR3 L;  1U4P A;  1RL2 A;  1J6Q A;  3STB C;  3F2D A;  5CV8 A;  1QIL A;  3PCO B;  2YYZ A;  5IT9 L;  1CUK A;  2XSC A;  1A0I A;  3JAM L;  1GUS A;  4JVZ A;  4P74 A;  2M9V A;  5KIX A;  4XT1 B;  2K05 A;  3WOE A;  4A3L H;  2C35 B;  1U5K A;  4P71 A;  3S2H B;  1PTO D;  1DOL A;  2B39 A;  4X3K A;  5T1G A;  3I7F A;  4B3T L;  2VUM H;  2CCZ A;  1EFW A;  2UXB L;  3T4A C;  5IP9 H;  2UUC Q;  4B08 A;  4A3B B;  1PH6 A;  3M3Y B;  2K50 A;  3K58 A;  1X3E A;  3GV6 A;  4DAP A;  3FKI H;  4CDC C;  2CKZ B;  3W1G A;  1B8A A;  3CCS A;  4HJ5 A;  2NYZ D;  4AIM A;  1QVG A;  3MXG A;  4MTN A;  1EY6 A;  1TS3 A;  1L1O C;  1AE3 A;  2LSS A;  2PW5 A;  4G57 A;  4LFC L;  2EDG A;  3SK6 A;  3VR2 A;  4DAV A;  4BBS G;  2CH4 A;  3RZO B;  2LKV A;  2CVR A;  4QIW B;  1EEI D;  4Y7N B;  1W3S A;  4OO1 H;  1X3G A;  4IZ8 A;  2BOS A;  1SYC A;  4BY1 H; 
#chains in the Genus database with same CATH homology
 3GTG B;  1X3Q A;  4CKB A;  2QF7 A;  1AEX A;  2IX0 A;  5JEA J;  2B2T A;  4A3D B;  1DJR D;  2DNE A;  4HCE A;  4EGV A;  5CV9 A;  1EYC A;  1O78 A;  3BDC A;  5E4X A;  5JEA H;  4MN3 A;  2NN6 H;  2O5I C;  1BBX C;  4XYO A;  4WOR A;  5DEH A;  3T13 A;  1PTO B;  2L4N A;  1BXT A;  4HSP A;  4Q0F A;  3BYT B;  5CBA E;  3S1R B;  2PO4 A;  1S5C D;  1CA6 A;  1EY0 A;  2OXP A;  4FVM A;  2K5Q A;  1TWF B;  1E2V A;  1EY9 A;  4QF4 A;  4QMG A;  5D3I B;  4K8I A;  1XWE A;  1I6H B;  5IOD A;  1JOK A;  2NVQ B;  1L0X B;  5FLX L;  3EVQ A;  2JSO A;  1I3Q B;  4C1N I;  1PTO H;  2NVT B;  1ET9 A;  3DWA A;  3KLS X;  3PUY A;  1H9S A;  4RCO A;  4L8J A;  5A35 A;  4DU9 A;  3QWN A;  2EJM A;  3F2U A;  4F8M A;  4V19 0;  2B63 B;  3H6M A;  5FOB B;  5ELE A;  3T56 B;  1DM0 B;  2TSS A;  4IUU A;  4ODG A;  4XYQ A;  2F0O A;  4HMI A;  3I70 A;  1QNU A;  3ITP A;  4XT3 B;  5G3L D;  5KRU A;  4V0B A;  1PFB A;  3VA5 A;  4ZK9 B;  4A3G B;  3PUW A;  4FYD A;  3TBI B;  5LL6 X;  4A93 B;  4DXF A;  5EKK A;  1SAP A;  4L63 B;  2HCC A;  1SYB A;  1O80 A;  2K04 A;  3R8B A;  3ND9 A;  1WTO A;  4KHZ A;  3NP8 A;  4K6D A;  1PZK D;  3NQI A;  4DGZ A;  3OSO A;  3I3C A;  3MFG A;  4NKL A;  4DNT B;  1Y1W B;  4R9W A;  1OXU A;  4DFA A;  1NSN S;  3IL8 A;  1LT3 D;  4J1M A;  5M5W B;  3HOZ B;  3DWQ A;  2B2W A;  2JE6 I;  1PYW D;  3A55 A;  3EQL C;  3SDZ A;  1O7L A;  4ZUJ A;  4RA8 A;  2K5D A;  3N6R A;  1BCP C;  2SEB D;  1GUW A;  1FR3 A;  2NBF A;  5IGC A;  2L11 A;  5DM7 3;  1T5X D;  2O4X A;  1HHV A;  2F0M A;  1K83 B;  3HOY B;  4EQP A;  3KLR A;  5C5M A;  2D9U A;  4RAU C;  4C3I G;  1W6K A;  1GUN A;  3WOF A;  3Q22 A;  1LTB D;  1C48 A;  1O7Y A;  1ILP A;  4ZKC B;  4WFN 3;  3M7N A;  4A3I B;  3MXP A;  3BS1 A;  5M5X B;  3K57 A;  2RSN A;  2X6G A;  1R4P B;  1MGS A;  4RCN A;  1SMY C;  2AQ1 B;  2JA5 B;  1DD2 A;  3CRL C;  3GV3 A;  3S16 B;  3K6O A;  1NCV A;  5I2Y A;  1H9K A;  2PW7 A;  1JB3 A;  1Q12 A;  1IW7 D;  2VB3 X;  3SEB A;  4K5X A;  3W3A A;  1B44 D;  5E3F A;  2B2T C;  4CKE A;  3NHH A;  3I73 A;  5C5L A;  1E2W A;  4CHT B;  2BE5 C;  1CT1 D;  2A68 C;  2EOT A;  3GO5 A;  3C1F A;  3QOJ A;  4FF3 A;  1STB A;  4XQJ A;  5EKL A;  2RDG A;  2NWG A;  4IQZ A;  1HFG A;  2EY1 A;  2J7Z A;  1Y1V B;  3A7L A;  1PFM A;  4IUR A;  1PTO F;  1KDC A;  4M1U B;  2F0P A;  1B50 A;  1ZEQ X;  3QJY A;  4ZAI A;  2A74 C;  2XWJ B;  3FMC A;  4S3S A;  1BR9 A;  3I4M B;  2MGS A;  1ENA A;  3SR1 A;  1QCB D;  3K5N A;  4IAL A;  1QWY A;  2WP8 J;  3S14 B;  3HG9 A;  1EQT A;  4XQN A;  2M00 A;  1IKM A;  1I4H A;  2A69 D;  1STN A;  1JIC A;  3GQB A;  2E75 C;  4UDU C;  4IFD I;  2EJF C;  1GXD C;  1IHZ A;  2EVB A;  3C3L A;  5IIF A;  1ML0 D;  1OO9 B;  1TII D;  1QOH A;  2AWO A;  3VYR A;  2J4X A;  2QEJ C;  3J7A F;  1EU4 A;  1GHK A;  1XX8 A;  4OIJ A;  3TP7 A;  3TP8 A;  1LV9 A;  2XWB B;  4X3T A;  1G2T A;  4ZKB B;  3U9S A;  1CA5 A;  5J39 A;  4C3J B;  2DY8 A;  1TWH B;  4PMW A;  2MPM A;  1AZP A;  1B53 A;  2A6H D;  1EU3 A;  3A8I E;  1EEF D;  4IUN A;  3HOV B;  1QNK A;  1F2L A;  3W2D A;  2F3V A;  2ICI A;  3FPP A;  2B2Y A;  1WTW A;  3MVV A;  5ELC A;  2XNA C;  1Q1B A;  3IFT A;  3RD4 A;  3PUV A;  5ELB A;  1WTP A;  3X3N A;  4A3F B;  4L6T B;  2F0W A;  2B2W C;  4LAA A;  1MI2 A;  4PMC A;  2DNC A;  2JA6 B;  3NWS A;  3J7A V;  2EYF A;  2D2C C;  1CK1 A;  5J1Z A;  1L0Y B;  1S5D D;  2WIN B;  5C0X I;  4A3K B;  1MSH A;  2XIW A;  1JOQ A;  1B9N A;  1SFO B;  2KOL A;  4G7O C;  2WKD A;  4CJ1 B;  1PMR A;  3NSW A;  5G3L F;  4KKU A;  4RGO S;  5C4Z A;  2KCC A;  3BVZ A;  3VR4 A;  1F2Z A;  3FEW X;  3AU7 A;  1U4M A;  1J9O A;  1EL0 A;  3NPP A;  3MEH A;  3HP3 A;  4KMU C;  4RHS A;  4PV1 C;  3NK9 A;  2VUM B;  2F0J A;  2KJX A;  2F0U A;  4WRD A;  1TR5 A;  1IYU A;  5I9O A;  2RBM A;  3FKI B;  4H13 C;  3IKJ A;  4HED A;  1KNA A;  3LWE A;  1X32 A;  3LNN A;  4HMJ A;  5D65 A;  4KD3 A;  2NTT A;  2A6E C;  5KNB A;  2K01 A;  2Y0S B;  4BY1 B;  1GOZ A;  1EY7 A;  1LAB A;  1FD7 D;  2GA4 B;  5JAV A;  4FF4 A;  2BA1 A;  3E6Z X;  2AWN A;  4RFB A;  5C3X A;  2E76 C;  4M8A A;  2VNU D;  1C8C A;  2C5C A;  3D4W A;  4CJ0 B;  1D1I A;  3GTQ B;  2F0G A;  1X3P A;  3ND8 A;  3M7G A;  1PTO C;  2VB2 X;  3CU7 A;  3L7Z C;  2F0L A;  1PFN A;  3SE0 A;  1F9P A;  2L0C A;  2PMZ B;  1W6J A;  3S9W A;  4R8N A;  5JVG 3;  1Q90 A;  1T5E A;  4OGQ C;  4FXK C;  3S15 B;  3Q24 A;  2X6L A;  5I9P A;  1NR4 A;  4IFD J;  1WD0 A;  1NAP A;  4IFD H;  4BBS B;  5JPN C;  1ENF A;  4LMQ D;  1GHJ A;  1SNM A;  3A8K E;  3BVG A;  1OXS C;  3FRP B;  1II3 A;  1STH A;  1YNN D;  2V4D A;  3NUC A;  1M8A A;  2Q8R E;  4ME5 A;  2HDM A;  4A3E B;  3OHX C;  3S1Q B;  2NZ1 D;  5CGK A;  2Q8T A;  1I4X A;  3K5M A;  4IUV A;  1VMP A;  2F0H A;  2MHV A;  4NW2 A;  2DN8 A;  1VF7 A;  3NTI A;  1RHP A;  3PIP 3;  4O42 A;  3NE5 B;  4QB4 A;  2E2J B;  1HTL D;  3LX0 A;  2EYL A;  2IPK D;  1CI3 M;  3CKI B;  3FDT A;  4K5W A;  1A3V A;  3A8J E;  3QG1 A;  2B2Y C;  2PPB C;  5C4X B;  2PNR C;  2CQA A;  2F0K A;  4J8Q A;  2I07 B;  1HA5 A;  4N9P A;  2HUG A;  1D5X C;  1UNS A;  1SEB D;  3IFD A;  3OWE B;  2E2D C;  4LK1 C;  3OIQ A;  1OXT A;  2PZU A;  5EKI A;  4C56 C;  1DON A;  4F87 A;  1JWS D;  1GUG A;  4HSV A;  4K14 A;  2B8G A;  1S4Z A;  1JR0 D;  1XXG A;  1AP0 A;  4X3U A;  3MC0 B;  3NQT A;  2WV6 D;  4FP5 D;  3RMH A;  3D6C A;  2KEE A;  4TRD A;  5E4W C;  3DEO A;  5I6Y A;  1LTS D;  3J80 E;  3S17 B;  1SYD A;  1U4R A;  2KHS A;  4XIG S;  1HRJ A;  1SSO A;  1JOO A;  2ZXO A;  4KI0 A;  2H1E A;  2MJ8 A;  2OEO A;  1HQR D;  5C44 B;  5A2Q E;  2F0D A;  1KAA A;  3MTS A;  3S1M B;  4TQU S;  1ESR A;  2O2L D;  1D2B A;  2EJG C;  1ONL A;  1BDO A;  3J7Y W;  3OOC A;  2PZT A;  2KA7 A;  2SNS A;  2RA4 A;  1JCK B;  4U67 3;  5IGE A;  3AMU A;  2F0V A;  4C1N K;  2C9O A;  1BUV T;  2F0Q A;  3PUX A;  1PRT F;  1B2T A;  3D31 A;  5KEE A;  3HOU B;  3U9O A;  3TP6 A;  2F4I A;  2Z4I A;  4FO2 A;  5CV7 A;  5CC4 A;  1MBY A;  3RUZ A;  1HXY D;  2TMP A;  2CHB D;  4C3I B;  1EY5 A;  1LTR D;  1B4O A;  3H09 A;  4GZY C;  3HZX A;  3OPO A;  5FO8 B;  2JXM B;  1KDB A;  5ELF A;  1XTC D;  5IGD A;  1A15 A;  1F9S A;  3I4L A;  3QOL A;  1GUO A;  2B2V A;  1WTQ A;  4ILW A;  2ZXP A;  1ZYR D;  1EWH A;  2B8F A;  1R9T B;  4KY7 A;  2MUY A;  1BOS A;  1G2S A;  1IW7 C;  2ZT9 C;  4QUF A;  1I4P A;  4K2L A;  4K5V A;  5EPL A;  4KJN A;  2L1B A;  5M5Y B;  1DOK A;  1M4V A;  1I4Q A;  1CZW A;  2EE1 A;  5D3D A;  1EYD A;  3M4Y A;  2AUK A;  1WTV A;  4H7B A;  3PUZ A;  5EBC A;  2CW0 D;  2Z8L A;  2BCO A;  3SK4 A;  1AW7 A;  3KF8 A;  4O1N A;  3NTK A;  2NTS A;  1F2M A;  4OL7 A;  4KV6 A;  3GTM B;  3KK7 A;  1TWC B;  4BY7 B;  2EYO A;  4LJZ C;  3HEJ A;  3HS0 C;  4KY5 A;  1FNV A;  1LTA D;  3DEP A;  1SBB B;  2X69 A;  2KEC A;  1ET6 A;  5JJZ A;  5ISR A;  1EZ8 A;  1WCM B;  3G7L A;  1LTI D;  2LFN A;  4NDX A;  3KUP A;  5FK9 C;  2K33 A;  3VR6 A;  2AQ2 B;  4F88 A;  4CKC A;  2KUM A;  4WJW A;  2XVS A;  4DN4 M;  1F2Y A;  4OO1 I;  3D8G A;  4YIJ A;  1EQV A;  3BG3 A;  2EY6 A;  4XQQ A;  4BS9 A;  3DMU A;  1DOM A;  5C4H A;  4KTA A;  2A69 C;  4G7Z C;  1G91 A;  4I65 A;  2FMM A;  2HDL A;  4DNR B;  4C3H G;  2ZXR A;  2NN6 I;  3J80 L;  3TSS A;  4IUT A;  4B9W A;  2LY7 A;  1U9R A;  1KTK A;  3OW7 A;  1SNC A;  5KND A;  1KAB A;  3CRK C;  3EA6 A;  2F0N A;  1FNW A;  4KY6 A;  2F3W A;  1F9R A;  4Z9C B;  4BA2 I;  4BBR B;  4IN3 A;  4K2K A;  3T53 B;  2SNM A;  4DA2 A;  2PCF B;  5FO7 B;  1LO5 D;  2QIL A;  1LT4 D;  3H0G B;  4HR7 B;  1D6E C;  1LTT D;  1ILQ A;  3BZD B;  5JOB A;  1RD9 D;  1EZ6 A;  5FO9 B;  1CTM A;  3D6W A;  5TSS A;  5EJW A;  2A6H C;  1I4G A;  2FHT A;  3GP7 A;  1K8M A;  3ERQ A;  1PZI D;  1TVX A;  2EYJ A;  3SVM A;  1HTP A;  4OIK A;  1I50 B;  2ID0 A;  1PRT D;  2JA7 B;  1EYA A;  3D4D A;  3QB3 A;  4U68 A;  1RKN A;  3TDQ A;  2B2U A;  2QCP X;  3SK8 A;  1TY0 A;  4EQO A;  1Z47 A;  3ERO A;  1TWA B;  1SNQ A;  1KLU D;  2E74 C;  4ZUI A;  2O5J C;  1FGB D;  2JYO A;  1VF5 C;  1R4Q B;  3GTK B;  3GTO B;  5HGT A;  2KQ3 A;  4P2C B;  3URY A;  4RWS C;  1Q8I A;  1HCZ A;  5BN3 A;  2QKI C;  3TP5 A;  2XRQ D;  2G9H D;  5M3M B;  3AB9 A;  4DK1 A;  2BDO A;  3L3O C;  5K36 H;  1LLR D;  2HCI A;  1B1Z A;  1RCV D;  4RGM A;  3V05 A;  3KLS A;  5J22 A;  3R2T A;  2K1B A;  3LWU A;  5CMD A;  3GD7 A;  3C1E A;  1PRT B;  2RDF A;  4IFD G;  3KBX A;  3HOW B;  4DAY A;  2B2V C;  3RLF A;  5EQ0 A;  3NBI A;  2VXW A;  3ZYY X;  1Y8O B;  3E0J A;  1HFN A;  2K5W A;  1DXM A;  1Y8N B;  1ZKO A;  4RH6 A;  2EYP A;  3V96 A;  1B3A A;  2K6A A;  1BCP F;  2F0I A;  3I90 A;  4PQX A;  2R6G A;  4QCL A;  1SDF A;  3K0Y A;  2Q8I B;  2IT1 A;  3Q23 A;  3VYS A;  5IGG A;  3MAQ A;  1D5Z C;  1PZJ D;  4CGY B;  3MFY A;  1V8Q A;  1Q3L A;  2L12 A;  1TT2 A;  5DAU A;  3KBG A;  4CBV A;  4HN7 A;  5EGT A;  1KNE A;  1AFP A;  1SNP A;  2K28 A;  1EY8 A;  2M2L A;  1I6V C;  2LS0 1;  3HOX B;  1S5B D;  2D5D A;  5EBD A;  5COY A;  4RGT A;  1XYI A;  3IAY A;  1GJX A;  4IUQ A;  2WAQ B;  1DYQ A;  1B9M A;  1IKL A;  2L5T A;  2H4O A;  3EJI A;  3H91 A;  3MZ5 A;  2XRS D;  5KYL A;  1JE4 A;  1Y8P B;  1O7Z A;  3C2P A;  4ZRZ A;  1KDA A;  3A54 A;  1TY2 A;  1ZXT A;  1D1K A;  5C0X G;  1D5M C;  3GTL B;  3I72 A;  4XDX A;  3Q0A A;  4FXD A;  2JP1 A;  5CBE E;  1TS2 A;  4BWG B;  4HTH A;  3A56 A;  2R61 A;  3D3R A;  3RZD B;  3HGB A;  1YNN C;  4DF7 A;  3SHL A;  1BF4 A;  5CYU A;  2WII B;  3E5S A;  4EQN A;  1RTO A;  1YNJ D;  1QG7 A;  3N52 A;  3MXU A;  2OF1 A;  3BDL A;  4B9X A;  1SYG A;  1HA6 A;  3R93 A;  4IUP A;  2D62 A;  5C4J B;  4CJ2 C;  1CHQ D;  2WKC A;  1IL8 A;  5M9O A;  2NB0 A;  3OMG A;  4PMB A;  4RHR A;  1YNJ C;  1HUM A;  1EIH A;  2FJ2 A;  1QJO A;  1PXU A;  4ABN A;  2PZW A;  3P1H A;  5C0X J;  2KED A;  4RKB A;  5NUC A;  1A2T A;  1ROD A;  1WVL A;  1CM9 A;  3UI2 A;  3SXH A;  3PIO 3;  5C0X H;  1ENC A;  3MXN A;  2Z1C A;  3TZU A;  4FF2 A;  3I4N B;  3PMF A;  3OIP A;  3CQZ B;  1Z7T A;  3H94 A;  3OWF A;  4N9T A;  3X3M A;  1CQF A;  1A6X A;  4BA1 I;  1V1P A;  3M85 A;  2J0T D;  3K5L A;  2B2U C;  1FYC A;  4H0L C;  4RKL A;  4FNF A;  1RF2 D;  1STE A;  2BDN A;  3V2T A;  1EIG A;  3DUZ A;  3R2I A;  3VR3 A;  1SE3 A;  3J81 E;  5HUR A;  4ZYS A;  3BDO A;  1H9R A;  1TQO A;  2K7V A;  1MSG A;  2A5H A;  1Q1E A;  2YU9 B;  3VYT A;  1H9J A;  2OT2 A;  2ENB A;  3HKZ B;  3T51 B;  2K32 A;  3NWT A;  2EZV A;  3TZD A;  1BQQ T;  5C3E B;  5CV5 A;  5AFW A;  1LT6 D;  4G4K A;  5T1I A;  1UEA B;  1SJE D;  1BCP D;  5I2X A;  4AYB B;  3BVM A;  3SK5 A;  4QUC A;  1JWU D;  1GUT A;  1STY A;  2IL8 A;  3DM1 A;  2F0F A;  2N88 A;  3PO3 B;  4JBW A;  3PV0 A;  3PO2 B;  1EFI D;  1MD2 D;  1HPC A;  4XXE A;  4X3S A;  3D4R A;  1STG A;  5KGU A;  5DNF A;  3NXW A;  5DM6 3;  3K59 A;  2F1M A;  4K8J A;  2IJ0 A;  2SOB A;  3QO2 A;  3A7A B;  1ESF A;  1JWM D;  2FFK B;  3R3O A;  5LL6 S;  5C3W A;  2F0T A;  1QB5 D;  2RSO A;  2WAC A;  3FPU B;  3P75 A;  1V43 A;  4H44 C;  2IX3 A;  1SMY D;  2EPB A;  3BYY B;  4E6I A;  2R93 B;  1VMC A;  4A3M B;  5EPJ A;  1EOT A;  2RDH A;  1NUC A;  1BCP B;  2PYK A;  2JA8 B;  1OXX K;  1K8O A;  4OHJ A;  2K03 A;  3T16 A;  2IW3 A;  3L9A X;  2FIN B;  1SXT A;  5JVH 3;  3CHB D;  1G8Z D;  3DWP A;  2BE5 D;  4KKT A;  1F9Q A;  2A68 D;  1CZG A;  1TS5 A;  1LTG D;  1CHP D;  1ZYR C;  1DCZ A;  4UAI A;  2EYM A;  2R7Z B;  4NP5 A;  3DHQ A;  1Y69 U;  2NVY B;  2BA0 A;  3ONA B;  3MWY W;  1PDQ A;  1TS4 A;  5EPK A;  2NVX B;  3MA2 B;  1SND A;  3GTJ B;  5JPM C;  1A3T A;  5M3F B;  5BN4 A;  3G6J B;  4JK1 C;  1S5E D;  1V1O A;  2CW0 C;  2HQE A;  5CR3 A;  1CFM A;  1H9M A;  3M4O B;  2AQ3 B;  2F0E A;  1G29 1;  1A3U A;  5IT9 E;  1EY4 A;  3JAM E;  3H3V C;  1VCI A;  2R92 B;  1SJH D;  2R3Z A;  4KK7 A;  1FNU A;  4KD4 A;  1QE6 A;  2L9H A;  3P7J A;  1AN8 A;  2AUJ D;  3NBH A;  2IX1 A;  1VDZ A;  3K7A B;  2EYH A;  1SE4 A;  3VR5 A;  3VA7 A;  4Q5V A;  5LHY 1;  1SYE A;  1AZQ A;  4FF1 A;  3QIA A;  2G9D A;  2JEA I;  2E2I B;  3MHB A;  4MIU A;  4XTC S;  2EXZ A;  4TKO B;  3I8Z A;  4J6H A;  1WTX A;  3J81 L;  4ID6 A;  4C3J G;  4KN4 C;  1JC7 A;  1E0B A;  2RQX A;  2XN9 C;  5D14 A;  2A73 B;  4KKS A;  2MP1 A;  1U4L A;  2KVM A;  3TN2 A;  5F2D A;  3GTP B;  1OXV A;  5COR A;  1BNZ A;  4EVO A;  5A2Q L;  2NUC A;  1E2Z A;  4I7Z C;  5I6W A;  5I4D A;  2QDB A;  4C3H B;  1H9S B;  2I46 A;  1TKW B;  1JOR A;  1HUN A;  1S5F D;  2L55 A;  1PLF A;  5KYI A;  3TME A;  5K36 G;  2PQE A;  1A2U A;  4KHV A;  1RTN A;  2RKS A;  2WB1 B;  1V1P B;  5ELD A;  5CV6 A;  2LMC B;  1F77 A;  3NTH A;  3Q6S A;  5E1F A;  4ZLT F;  3HRZ C;  5BN5 A;  1UAP A;  2N55 A;  1BO0 A;  2EY2 A;  1C4Q A;  2EY5 A;  5FLX E;  4HAE A;  1JQY D;  4F7X A;  3P20 A;  3FVQ A;  1EWC A;  3DXJ C;  3EFX D;  4FXG C;  4R8I A;  3S1N B;  2E2H B;  1KLG D;  1TWG B;  2F0S A;  2RVL A;  3OMC A;  4ULL A;  3VYU A;  3WDN A;  2F03 A;  4A3J B;  1DZ1 A;  1PRT C;  2ICE C;  4KJO A;  1SNO A;  1RJT A;  3S2D B;  2KCN A;  1ICW A;  5K5P A;  1LAC A;  1G6Z A;  1Z6H A;  5IGF A;  4MHE A;  4G7H C;  1TU2 B;  4HCS A;  2FMC A;  5FKA C;  5KNC A;  3K5O A;  3O13 A;  2DY7 A;  2IWH A;  1WD1 A;  1LT5 D;  1UUP A;  3C46 A;  4DK0 A;  1HQM C;  5IGB A;  4K6L A;  1IYV A;  5C6A A;  1SYF A;  2SDF A;  2JEB I;  4OO1 G;  4ZQ3 A;  1SE2 A;  4RGN A;  1J8I A;  1I4R A;  2A6E D;  1WTR A;  2Z4H A;  4PNY A;  1RDP D;  3I91 A;  1NR2 A;  1CQV A;  4C2M B;  5CV4 A;  4TSS A;  5JEA G;  4DXG A;  1STA A;  2NN6 G;  4NMZ A;  5IOC A;  4KN7 C;  1U4P A;  5CV8 A;  1QIL A;  2YYZ A;  5IT9 L;  2XSC A;  3JAM L;  1GUS A;  2M9V A;  5KIX A;  4XT1 B;  2K05 A;  3WOE A;  3S2H B;  1PTO D;  1DOL A;  2B39 A;  4X3K A;  5T1G A;  3T4A C;  4A3B B;  4B08 A;  3M3Y B;  3K58 A;  3GV6 A;  4DAP A;  2NYZ D;  3MXG A;  1EY6 A;  1TS3 A;  2PW5 A;  4G57 A;  3SK6 A;  2EDG A;  3VR2 A;  4DAV A;  3RZO B;  2LKV A;  2CVR A;  4QIW B;  1EEI D;  4Y7N B;  4OO1 H;  4IZ8 A;  2BOS A;  1SYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...