4R9WA

Crystal structure of platelet factor 4 complexed with fondaparinux
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
LQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic description of the immune complex involved in heparin-induced thrombocytopenia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Platelet factor 4
total genus 10
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4r9wA00
1Q3LA 1ML0D 4ZLTF 1BF4A 3G7LA 3H91A 1CA5A 1BBXC 2XIWA 4IUPA 1MGSA 4QUCA 2MJ8A 1HRJA 5EKIA 5D14A 1MSHA 2B2TC 4HEDA 1X3PA 3DEPA 3FDTA 4R9WA 5AFWA 1DOLA 2DY7A 3F2UA 1JE4A 1HFNA 1PFMA 2K03A 2K1BA 2MGSA 5COYA 5D65A 1F2LA 1KNAA 1BNZA 1IKMA 2JYOA 2RA4A 1GUWA 4R8IA 1O80A 5CORA 2SDFA 4ZKBB 1WTWA 1NAPA 2K28A 4XT1B 1O7YA 1WVLA 1HUMA 2MPMA 3IL8A 1RTNA 1U4MA 1SDFA 2X6GA 2NYZD 3I90A 4ZK9B 1EL0A 4ZAIA 2B2UC 2NZ1D 2K01A 1M8AA 3GV6A 3N52A 2RSNA 5DNFA 1G6ZA 2NWGA 1J8IA 1IKLA 1DZ1A 5T1GA 2DY8A 1RTOA 4MHEA 2IL8A 1X3QA 2KEDA 2HCIA 4MN3A 1ESRA 2KECA 3MWYW 4RAUC 4XT3B 5JJZA 2H1EA 1ILQA 1S4ZA 2HDMA 1HA6A 1G2TA 4XDXA 4OIJA 2N55A 2R3ZA 2J7ZA 1WTPA 4QUFA 1QE6A 3TZDA 2L1BA 5E4WC 4CJ1B 4DN4M 2D9UA 4X3TA 1LV9A 1NR4A 1PLFA 1SAPA 4IURA 1WTQA 1WD0A 2FINB 2B2WC 2JP1A 4HCSA 1B2TA 1DOMA 5T1IA 2FHTA 2B2TA 1U4PA 2FJ2A 1B53A 2Q8RE 1F9RA 1E0BA 1NCVA 2KUMA 3I8ZA 4IUQA 4LMQD 3Q6SA 1WTOA 2FMMA 2B2VA 3KBXA 1TVXA 1WTVA 3UI2A 2VXWA 1AZQA 1XX8A 1U4RA 2K04A 1F9QA 2MP1A 3IFDA 1EIGA 5EPKA 4CJ2C 1EIHA 5CBEE 1RODA 1PDQA 1EOTA 1PFNA 1VMCA 4IUTA 1PFBA 1NR2A 3R93A 1MSGA 2B2WA 1SSOA 2BDNA 4HAEA 5EPLA 3TN2A 1QG7A 1AZPA 1WD1A 3FPUB 1U4LA 2N88A 1RHPA 3QO2A 4IUVA 4OIKA 4X3SA 2L12A 3DM1A 4ZKCB 2EE1A 1EQTA 1DOKA 1G2SA 3D6WA 3GV3A 2B2UA 2K05A 2M2LA 3HP3A 2L11A 4X3UA 2KEEA 1ICWA 2X69A 4RWSC 1C8CA 1F9SA 1IL8A 2KOLA 2EOTA 2CVRA 1ZXTA 2B2YA 2EPBA 4X3KA 1KNEA 1MI2A 1B4OA 3MTSA 1ILPA 1WTXA 2RSOA 5E4XA 4HSVA 2HDLA 3I91A 1XYIA 2HCCA 2RVLA 1B50A 1HHVA 2X6LA 3DEOA 3LWEA 3KUPA 1CA6A 1X32A 1CM9A 5EJWA 1F9PA 2B2YC 5CBAE 1RJTA 1A15A 1B3AA 4NW2A 1G91A 3I3CA 1VMPA 2L4NA 2B2VC 3P7JA 4UAIA 2HUGA 1AP0A 3ONAB 2Q8TA 2KVMA 5EPJA 1HFGA 1J9OA 2FFKB 4IUUA 1JICA 4U68A 1BO0A 1DONA 4RA8A 1HUNA 5CMDA 3SVMA 4O42A 1WTRA 5EQ0A 2L9HA 4CJ0B 1O7ZA 1QNKA
chains in the Genus database with same CATH superfamily
1HQMC 2UXDL 1BF4A 4DV3L 2UXDQ 3NBHA 3PF5A 2ZT9C 3H3VC 2F0LA 2VL6A 2JEAI 1GUSA 3L2PA 2JA9A 2E5LQ 1PH7A 4KMUC 5CORA 1TWCB 1WOCA 3A7LA 1HTPA 1BCPB 1CKOA 1XXGA 4LF6Q 5M5WB 4A3EH 3GTPB 2F0VA 4LAAA 4I7ZC 5ELOA 5JPNC 1VQ8A 1LTLA 3M4PA 5C3EH 1CHQD 4DKAC 3H94A 5FK9C 5IT9c 1S4ZA 3SEBA 2UU9Q 5CYUA 1HA6A 3KYHC 4C3IH 5JVH3 1JB3A 3HOVH 1QE6A 1SNQA 2JA7G 4CKBA 1KLGD 4HCSA 2ZM6Q 4FXKC 4FF3A 4IPGA 2EXZA 5IOCA 1FGUA 1GD7A 3G48A 5DAUA 3PO2G 3HKSA 1N8RC 4WORA 1Y1VH 1AH9A 3TMEA 3P75A 3HOVG 2ZTDA 4IUTA 3CHBD 3P20A 2NVXB 5ELEA 3GTMB 1KLUD 4JVZA 1BR9A 1EQTA 5KNDA 2K4KA 4QIWB 4Q0FA 3SXHA 1OXSC 2QKIC 4POGA 4DV6Q 2C9OA 3A8JE 4RCNA 3QOJA 2G9HD 1ILPA 1JMCA 3PSIA 1D1IA 5TSSA 2HDLA 5I6WA 3M4QA 2L55A 4BY1B 1C0AA 1D7QA 2EY2A 4DAPA 4EQNA 2JA5H 1VQGA 4GZYC 1X32A 1CM9A 1SBBB 5IGFA 1F9PA 5M5WH 5CV4A 1KRTA 4G7HC 3HZXA 2KHIA 1VMPA 3C1EA 4ZYSA 3FKIB 3HKZE 2NZOA 4CKEA 4HMIA 3GP7A 1YNJC 4X64Q 1EOVA 2JA6B 4B3TQ 3M3YH 4Q5VA 3KBGA 1YBYA 2K5QA 3MFGA 4R4CA 4J1MA 1E2VA 1GOZA 1BDOA 2FXQA 5BN5A 1V1QA 3HKZB 2F0FA 2QDLA 1X3PA 1EQQA 3RNUA 1MHWC 1VQ9A 3GTGH 3VDYA 4F8MA 3J81j 3E0JA 2JJQA 4O2DA 4LFCL 2UU9L 3S16H 4A3FB 1Q90A 4IZ8A 4BY1G 2IW3A 1A6XA 5L37A 4LF9Q 1AEXA 5E1FA 3WDNA 4K2LA 4PV1C 3PIPA 3PO3H 3MA2B 3N52A 2RSNA 4WJ4A 2EYOA 5K36H 3SK5A 3RD4A 4DA2A 4KKUA 4UHVA 4IPDA 1PTOC 1H95A 3OIPA 1Y8OB 1BBWA 1ILQA 1QJOA 2A6HC 4DAMA 3AU7A 3KK7A 2ASBA 2WACA 3E9HA 4OL7A 3VA7A 1VQKA 1G51A 2PPBC 1VQ6A 4PNYA 4XYOA 2RDGA 2Q8RE 5C4XH 3D4WA 2KUMA 3EQLC 3I8ZA 3PMFA 4YY3Q 4RGNA 5C3WA 4YY3L 2GVBA 1LTBD 1WTHA 1KTKA 4ID6A 3DHQA 1VMCA 2R92H 4H02A 1CFMA 1QUQB 1TWHH 5LMUL 1AZPA 4IUVA 1KAAA 1VQPA 4A4IA 3OMGA 4B3RL 4XIGS 3RZOH 5DM73 1B1ZA 4FDBA 1VQLA 3D6CA 5DLQE 4HJ5A 5C44B 2OTJA 1ICWA 4GOPC 2PNRC 1HCZA 4C3JG 3Q0AA 4BXXG 1MI2A 4DXGA 1CSQA 4P73A 3ZYYX 1K9MC 3HOYG 1K83H 4LF8L 2E2DC 4LK1C 4JI4Q 2PMZE 3NK9A 4KN7C 2K5NA 1A0IA 4A76A 1N34Q 4OX9L 1V8QA 1CK1A 2Z6KA 4G4KA 3VR3A 1N34L 2PMZB 1HUNA 4TQUS 1IBMQ 1IL2A 3UDFA 2LY7A 5C4ZA 1AZQA 2BA1A 3BVZA 4DUZQ 4R4TA 1IZ6A 3NHHA 4KJOA 3DLLA 4A3CH 1U0LA 1K3RA 3GTOB 1YHBA 3GDEA 2YTXA 1C7YA 1GUTA 1MD2D 3S24A 4FO2A 2F4VQ 1LUZA 1A2TA 4OHJA 1YVCA 2E5LL 3GTMH 1X55A 1NAPA 2K28A 4GKKQ 1VQHA 4CKCA 4A3MB 2MPMA 3HGBA 2X6GA 4HTHA 1FYCA 1EY8A 4DPGA 2SNMA 4JI2L 1J5EQ 2HD3A 2NB0A 3OW7A 5KYIA 3BVGA 4DV6L 2CW0C 2J4XA 4FF2A 5IT9L 1UE6A 3FKIG 1GUOA 1PH5A 1SAPA 2FINB 2AWNA 4DUYL 1R4QB 2QEXA 4E6IA 3EIVA 1N33Q 1WTVA 4LMQD 3Q6SA 5EKKA 3RLFA 5ELCA 5C6AA 3A54A 3A55A 1RODA 2OWOA 1Q12A 4PZ8A 1H9MA 4ZKCB 1FNWA 1TS4A 3A7AB 4QL5A 1EU3A 1BCPC 1SFOH 2B3GA 1EIFA 2YTVA 1TQOA 4KI0A 1HXYD 2UUAL 4DK6C 2N8NA 4WJWA 3MZ5A 3H0GB 3J81i 1W6JA 1FNVA 3J7A5 4JBWA 1D5ZC 3NXWA 4JI8Q 1B7YB 1K83B 1JOQA 4YHHL 2F03A 3CCMA 3M9BA 2JE6I 2JEBI 2PZTA 1QWYA 1XPUA 3I4MG 4ZQ3A 4DR7Q 1LT5D 1RJTA 1S5DD 1ENCA 2L4NA 2B2VC 1X65A 4PMWA 3I4OA 1STEA 2FFKB 4IUUA 2F0GA 1PH2A 5FO9B 1BXTA 5FLXL 4HJ9A 3HOXB 3E6ZX 1ASYA 2BCOA 1A62A 2TSSA 2E2IB 1JWUD 4A3BG 1K8GA 3HOZB 3ULJA 1EWCA 1HTLD 5LL6X 1EFWA 4R9WA 1B8AA 5AJ3Q 4GNXA 4MNOA 5GROA 1Q81C 3NPPA 4IFDI 1PFSA 4JI1L 1IYJB 1GJXA 3LX0A 1IXRA 1GKHA 2JA8H 3CKIB 2K01A 4A93B 1UEBA 4GKJL 5DNFA 4JI7Q 3QOLA 2L5TA 1LT6D 2ZXOA 2A6HD 4RAUC 3JAMc 3K59A 4B3SQ 2HT1A 3M4OH 2H5XA 4RHRA 3NTKA 3G6JB 3S16B 4K6DA 4XQQA 3TBIB 3CAMA 2QEJC 4XDXA 2F0KA 2XN9C 1Y1VG 4IFDJ 5G3LF 3VYUA 1QB5D 3J80c 1B53A 4YCUA 4BY7G 5IODA 3QIAA 3NWSA 4C3HH 3UI2A 3HG9A 1XWEA 3W1GA 2DGYA 2MP1A 4K2KA 1TWGH 3TQYA 4ALPA 2F0MA 3J7ZC 3H09A 5I2XA 2F52A 2JN4A 3L7ZC 2K5DA 3TP7A 1EFID 4KY5A 1Q86C 3D6WA 2R7FA 2D5DA 4A3JB 4EX5A 5KYLA 4A3GB 1SE4A 1FR3A 1EY7A 2OQKA 1TU2B 4EQOA 1UE1A 3F8TA 4IPHA 1XJVA 4DV3Q 3PCOB 1GUNA 2BH2A 5M3MB 2I0QA 1A15A 4TRDA 3GTKH 1E1TA 4RKBA 3IKJA 1ET6A 1K3BC 1L0WA 5LHY1 2IY5B 5IGBA 5CC4A 5IT9E 1WTRA 4O42A 3V05A 2JSOA 5GADC 2LXJA 1NTGA 4KKSA 2N3SA 2RF4A 4LW1A 1BBUA 4A3JH 3GTLH 2MNAA 2KJXA 4EGVA 2Z0SA 1X9NA 2UXCQ 1PH8A 3S1NH 4DU9A 5CGKA 2VQFL 2Z8LA 1I6VC 3MXGA 5COYA 1PYSB 1BNZA 3S15H 4APVA 4C3JH 5J22A 4FF1A 3H0GH 3AYHB 2B63G 1VF7A 3K7UC 3G6EA 3KLWA 5M3MG 3L9AX 4ZK9B 3WOEA 3GV6A 2R93H 5IYBH 1QOHA 3MXNA 4HIOA 3FEWX 2HQEA 2HIXA 3MWYW 1TS5A 4A3GG 1DM0B 2IHFA 3BG3A 4OIJA 5FLXE 3CRKC 3KF8A 1WTPA 1SMXA 2IJ0A 1PZKD 2L1BA 2PQAA 2PO4A 3SK6A 5ELNA 4DXFA 4IUQA 1P8LA 2R7ZH 3GTQB 3S17B 1T9HA 4P71A 4NMZA 3TZUA 4BBRB 1XNRL 1EY4A 4C2MB 2EQSA 1TXYA 1PFNA 3GTGB 2PQAB 5F2DA 1D1KA 1SYFA 3PQIA 3OTOL 1RHPA 4Z9CB 3DM1A 4X62L 2E2JB 1EIYB 1V43A 2B2UA 3CU7A 1I94Q 1Y1WH 4KY6A 4OXPA 3GTPH 4HMJA 4OWXB 3VYSA 1IL8A 3N6RA 2EOTA 3P1HA 4X3KA 2Y0SG 2Z6KC 5HURA 2RVLA 1D8LA 1HR0L 4BBSG 4GN4B 4DNIA 4JI6L 3PIO3 3I4NG 2ZJRA 5C5LA 2VNUD 3AFPA 3EA6A 3S1RB 5JOBA 1E7ZA 4P72A 2I5MX 1JOKA 5IE8A 2EYMA 2A1AA 4A3BB 4A3LH 2B8GA 1I5FA 1ML0D 2IX1A 1E3PA 1YIJA 4B9XA 1O7LA 1Y8PB 3H3VI 1UE7A 1DCZA 3E3XA 4U673 2L0CA 1UUPA 1PFMA 3TS0A 5GQOA 3I4MH 2BE5D 4QIWE 1YNND 1HUMA 1PRTD 2ATWA 1RTNA 2NZHA 4K0KQ 1XNQQ 1DJRD 4DR1Q 3EROA 4GOPB 1VQ5A 3SK4A 4JI8L 2CFMA 2LFNA 1BCPD 1G291 3DWPA 3J81L 2IL8A 1WJJA 4LF5L 1X3QA 3S17H 1CHPD 2KEDA 4KN4C 1ESRA 5C3EB 1Q46A 5I9OA 1WFQA 5FO8B 1IYVA 1JC7A 1Z9FA 2JA7B 3TEHB 4X6AH 3S9WA 4K6LA 4CJ1B 4EVOA 2ZXRA 2E74C 2VUMG 2XRQD 1SMYD 4NDXA 4L5RC 3HOWG 4PZ7A 4NPSA 2F0IA 3RR5A 4B3SL 1E0BA 5IWAQ 3J80L 4BY7H 2NN6I 1VF5C 4LFAQ 2F0TA 2VXWA 1TWCH 4ODGA 1T5EA 1XX8A 3PGZA 1PDQA 1CQVA 2BDNA 4IALA 1S72A 4JI1Q 2RCFA 1KAWA 1U4LA 1AN8A 1VQCA 4X3SA 2IHEA 5IGGA 3PO3B 2N49A 3ERQA 2D62A 3HP3A 4S3SA 5ELDA 4X3UA 3S15B 2UUBL 2XTIA 2Z6BA 3I7FA 2K5WA 3WOFA 4N8X1 2YTYA 2JK8A 3V2TA 3CXCA 3PV0A 2RQXA 3W2DA 5E4XA 4LF7L 3C2PA 3OOCA 4GS3A 3W1BA 1JT8A 2ICIA 2HHHL 4BY7B 1SYDA 2EJFC 3RN5A 3RZDB 1CSPA 4NW2A 1JJCB 2HUGA 4A3LG 4KHZA 1IBKL 3W5OA 1SR3A 5FJ8H 2H4OA 4DK3C 3FKIH 4JOIA 4BA1I 2HHHQ 3CC7A 5LL6S 3RMHA 2LMCB 3BZDB 1Q3LA 4HR7B 3VYRA 1DGSA 1SLJA 5C0XI 3KOJA 1MGSA 3I73A 5EGTA 1VDZA 5J1ZA 1B44D 5D14A 4KLKA 2K32A 4R1JA 2F3IA 1N9WA 1SNDA 1UE5A 4A3FG 2K1BA 2PNHA 1KNAA 2NBFA 2NN6G 2JA8G 2JYOA 2AWOA 1GUWA 1HR0W 4NXNQ 1JJGA 4KD4A 4IO9A 2Q8IB 2XRSD 1LTTD 1U5KA 1KD1C 1O7IA 1U4MA 2RDHA 1SNPA 4KV6A 1HR0Q 2KCCA 4LF8Q 1R4PB 4A93H 2B8FA 1J8IA 2DY8A 5GAEC 1F2ZA 5I4DA 4JYAL 2HDMA 1G2TA 3L3OC 3HOWH 3NBIA 3U50C 4QUFA 5M3FH 4OWTB 2WB1E 4DN4M 4DR6Q 1STGA 4X3TA 1HZBA 4UP9A 3CCRA 4OELB 1NJIC 1STYA 2VW9A 2R7DA 5A2QL 1F9RA 5C3EG 1WTOA 1EQRA 3FP9A 5IGDA 4G57A 3J80i 3IFTA 1XNQL 1EOTA 4G7OC 1NNXA 3C3LA 3AB9A 2KQ3A 2WP8J 3STBC 1NMGA 3BVMA 1TIID 1LTAD 1QNUA 2JA5G 1XMOQ 2KEEA 2SEBD 3R2IA 4RWSC 5CR3A 1LACA 1ASZA 4AYBG 1B4OA 2KA7A 4JI5L 2QW7A 1EEID 1TT2A 2MO0A 3EVQA 4A3DB 1RCVD 2MQHA 1SE3A 5ELBA 1IBML 1LTRD 1B3QA 2V1CC 1G91A 3H15A 5BN4A 1A3VA 1JJ2A 3TP5A 1L0YB 2IX3A 4U68A 4IOCA 1V1OA 5C5MA 4L5SA 5M5XH 3NP8A 1I4XA 1SJHD 4J8QA 1SNMA 4NP5A 2VQFQ 1O78A 2UXCL 3LGJA 4CJ0B 2C35B 2JA6G 3D3RA 3GTLB 4GLXA 1WCMH 4JPBW 1PH9A 3NWTA 5GAGC 2Y0SB 3JAMi 4EQPA 1HRJA 1FL0A 1I4PA 4DUYQ 3O13A 2VS1A 1DOLA 4CGYB 2F1MA 1HZ9A 2VB3X 4TSSA 1I50H 1EYAA 1K0RA 3UDXA 3I70A 2OCEA 4QMGA 3I4NH 1SNOA 2CCZA 3K5OA 3RLNA 2NN6H 1XMQL 3OTOQ 4DV1Q 1RKNA 5EBDA 3CCUA 1EL0A 2QF7A 1QVGA 2NVTB 3TDQA 1G6ZA 4DK0A 5BN3A 4X66Q 1NY4A 2B39A 2UUCL 3LNNA 1SRUA 3URYA 1IBKQ 2F0QA 4C3HG 2E76C 1FVIA 1OXXK 3Q8DA 1ENFA 3KF8B 3UDGA 2V4DA 3FPPA 4MTNA 3CPWA 4DFAA 4IURA 1WTQA 1B70B 1DOMA 5T1IA 3PIOA 2E2HH 1U4PA 1GO3E 2OT2A 2M9VA 3MXNB 4QB4A 2Z4IA 3KDFB 1PH1A 1K8MA 1SROA 4BBSH 4HAEA 5EPLA 4DV4L 3KF6A 3JC66 4H13C 4LFCQ 3J7YW 5HGTA 4A3MH 4WFN3 1MIUA 4L6TB 1WYDA 1EZ6A 1Z6HA 4KD3A 3S2HH 4DR4Q 3GTQH 2R7ZB 4HIMA 2OQ0A 1Q1BA 1CQFA 3PO3G 3A74A 3SGIA 1EWIA 2CKZB 4KHVA 2F0WA 2CVRA 1VQIA 5JJLA 1N32Q 1F2YA 4PG3A 5IYCG 4HSVA 2J0TD 3CCSA 3C46A 1S5ED 4QCLA 4F7XA 5CV7A 2I07B 2WIIB 1YJ9A 2A68D 1AE3A 3DMUA 4GN3B 1IBLQ 3TP6A 1BKBA 1H9JA 1Q8KA 1N36L 3T1YQ 2KVMA 5EPJA 3OMCA 4X62Q 5FJ8G 1VQEA 3VR6A 3NBHB 2Z9HA 5M5XB 2BDOA 1YHQA 4J15A 1O7ZA 3G7LA 5E3FA 1XNRQ 1CA5A 5KEEA 1KQSA 1TR5A 1MSHA 3DEPA 4MZ9A 4HJ7A 1HPCA 5M5YB 4QY7A 3ND9A 1E2ZA 2Z4HA 3PUXA 1F2LA 1N36Q 1XTCD 1RDPD 2QCPX 1KC8C 4R8IA 3I55A 2F4VL 4NXML 2A69D 1O7YA 3RZOB 1CI3M 5DM63 3MXUA 3MVVA 4YCWA 4LFBL 2EY5A 4IOAA 4GNXC 2B2UC 3E0EA 5NUCA 1IW7D 1TWFB 3PUYA 4HN7A 5FLMG 4HJ8A 2ZXPA 4WJ3M 5EKLA 1CTMA 3CW2C 4PMCA 2YU9H 2ID0A 5C44H 2F3VA 3TS2A 4HIDA 2WAQE 2UUAQ 3I72A 1Y1WG 4J6HA 1GUGA 2BH8A 2F4IA 3KJPA 4A3JG 4H7BA 1MJCA 2XVSA 3VR4A 1X54A 3K81C 5I6YA 1SEBD 3HKZG 2WAQB 1JWSD 5FO7B 2E2IH 2YU9B 3NENA 3I4NB 2NVQH 4GKJQ 4B3TL 3ULPA 4ULLA 4LFBQ 5C0XJ 1VQFA 4A93G 4CBVA 3R93A 1MSGA 3ITPA 4LF6L 2EY6A 4FP5D 1STHA 1QG7A 4OO1H 3EJIA 1UNSA 1YJWA 2N88A 3A5ZB 3U58A 5FLXc 4R4IA 2EYLA 1FNUA 5IYDG 4B3RQ 3PUWA 3ND8A 3HFZB 3MXPA 4CHTB 3HOYH 2X69A 1C8CA 3V96A 1ZKOA 3MTSA 3S1QH 2CQAA 4DR3Q 3HOVB 4I65A 5JPMC 3HRZC 3D8GA 4RG1A 3OW2A 3NSWA 3HOXH 2K75A 3KUPA 3K8AA 1I3QB 2B2YC 4CDEC 1TWAB 4MTKA 4V0BA 1UEAB 3CQZB 4DR5Q 1BO0A 1PHJA 2IPKD 1YHAA 3K7AB 4RA8A 4ZUIA 3Q23A 3FVQA 3I4MB 3KLSX 2JA6H 3CMEA 2M00A 1X6OA 2I5HA 4LF9L 3BDCA 1M1KC 2DN8A 2IT1A 1KABA 5C4HA 1HZAA 3CC4A 2B2TC 4F88A 5IP7G 1J6QA 1QZGA 1SJED 4RGOS 4KY7A 1EQVA 2EYPA 2TMPA 1SNCA 2B63B 3S1MH 4IN3A 4DV5L 2HIVA 4A3EG 2B63H 1O80A 1Z7TA 4CDDC 1WTWA 2ICEC 1ENAA 3S2DB 4A3IG 4C1NI 4BBSB 2EYHA 4GNXB 5D3IB 4BY1H 4QF4A 2OTLA 2ZTEA 4ZAIA 4DF7A 3CD6A 2A6ED 1IYUA 4JCVE 2A74C 1DZ1A 1EYGA 2AUKA 4JC0A 4DAVA 1PH3A 4YWMA 3VR2A 3CP0A 1HNZL 3OPOA 2XSCA 1GM5A 1BOSA 4DR5L 1JCKB 2B29A 1EU4A 1KDCA 3K0YA 1RL2A 1JORA 5DEHA 1LV9A 1NR4A 3M7NA 2F3WA 1RD9D 2I46A 1YEZA 4IJHA 1Y1WB 4X66L 5LMNL 3A8IE 1I4QA 2XNAC 3T51B 4TVAB 5LMNQ 3PUVA 4PQXA 3H3VH 3X3MA 1SSOA 5JEAJ 3MEFA 2KCTA 2MFIA 3G4SA 3RLOA 2VB2X 4DR6L 1DOKA 2LSSA 3T1YL 1C48A 2YV5A 4OWWB 1EY0A 1TWAH 4ABNA 4YCVA 2K33A 4B3MQ 1MKHA 4ME3A 2CH4A 1W2BA 3ERSX 1XYIA 4DUZL 3FMCA 4L8JA 2WKDA 3J7AF 1AW7A 1Q8IA 1XTDA 1W6KA 5EJWA 1LABA 1K8AC 3M7GA 4DR4L 3J81E 3NTHA 1VQDA 1GHKA 3BYTB 2F0NA 1J9OA 4HSPA 2WB1B 2UXBL 2CH4W 3AMUA 3SE0A 4DV7L 4A3BH 2JQOA 5IGEA 1EEFD 2L9HA 2F0SA 1HNWL 4M1UB 3M3YB 5C4XB 1BBXC 3OWFA 3ZJYC 2MUYA 1TS3A 2MJ8A 4C3IG 4B9WA 4LF4Q 3J80E 1SE2A 3S1NB 3UDIA 4LNQA 2K7VA 1EYDA 1I6HB 2K14A 2L15A 5D65A 5C44G 2NVYB 1E22A 2PW5A 4NB3A 2LS01 1Y14B 2MHVA 2A8VA 4UY8C 2QDBA 4JI2Q 1CT1D 5A35A 1EUJA 3HOUH 5I2YA 4AQYQ 4N8FA 4OGQC 4ILWA 2R7ZG 2PW7A 5KNBA 2H1EA 1XMQQ 1C9OA 3D4RA 1PZID 2LKVA 4K8JA 2J7ZA 1K73C 2A69C 1YI2A 2PZUA 4ZCKA 1SE8A 2F0HA 4LJZC 4K5WA 3UE0A 4A75A 1PXUA 4A3GH 4KHPQ 4NKLA 2QA4A 3A0JA 3T1HL 2NVQB 2K04A 5EPKA 1F9QA 3PUZA 3K57A 1K0SA 1TWHB 4H0LC 4DV7Q 2ZJQA 2RHSB 5FLMH 1JQYD 4OIKA 3Q24A 5M3MH 4RMFA 2R61A 1VS0A 3T13A 3HOUB 3K6OA 2M2LA 4OX9Q 1CKNB 5K36G 4DAYB 2CHBD 2F0EA 3T4AC 3H6MA 4FYDA 1KHIA 5ELFA 3R2TA 4HIKA 3KFUA 2D0PA 2NVYH 2LXKA 4KTAA 1H9SB 1KDBA 1Q1EA 2WFWA 4JV5Q 4B3ML 5HGQA 5LMNW 1HZCA 5D3DA 4BS9A 5CBAE 4C56C 1SXTA 3WWVA 1CKNA 1C4QA 3J7AV 3P7JA 2AQ2B 3FHWA 3CRLC 1HFGA 2A5HA 4C1NK 1DYQA 4JK1C 5LMUQ 1RIPA 4AQYL 1TY2A 1HNXQ 5EQ0A 3K0XA 3K5NA 5J39A 1E24A 3NQTA 3KDFA 1YITA 1NUCA 2Q2IA 4RKLA 1OO9B 4JI3Q 4JOIC 3FDTA 3VR5A 3F2UA 3NE5B 3TP8A 3JAML 2AHOB 5IYCH 4DR2Q 1L1OA 3F2BA 4O1NA 4JBMA 1X3EA 2EY1A 1IBLL 2K5VA 1PRTC 4A3IH 1AE2A 3HEJA 2R93G 1BCPF 2BE5C 1HNZQ 4LF4L 4A3DG 1VQOA 3SK8A 2WKCA 4JI0L 3K80C 5T1GA 4I7AA 5IIFA 1EZ8A 1PA6A 1HNWQ 1N32L 1PTOF 4P75A 2EYFA 4XT3B 2G9DA 2KECA 2E75C 2Q2HA 3D0FA 2JA5B 4OO1G 2A6EC 2O2LD 1L1OC 2JA7H 5EAYA 3QJYA 3RN2A 1PLFA 3SR1A 2R92G 1LTSD 1B2TA 1OXVA 3A8KE 4GLVB 1GXDC 1TS2A 5BR8L 3KBXA 4IFDG 1ZYRD 2NUCA 2RHQB 1U4RA 1UAPA 1NE3A 4X64L 1EIGA 1NMFA 4CJ2C 3DXJC 1AFPA 4RH6A 3FPUB 1JWMD 1LTGD 4UPAA 4LUOA 1XPRA 1HH2P 2L11A 1A3TA 4XYQA 1VQ7A 2JA8B 3BDLA 3AFQA 2ZJPA 2B2YA 2O4XA 1KNEA 2DJFC 1YZ6A 2XWBB 1QZHA 1QUQA 3NUCA 1SYCA 4JBJA 2HCCA 4DR3L 2RCNA 4C3JB 2NVTH 2N78A 4UP7A 4H44C 5IP9G 1W3SA 1KRSA 1CA6A 2DNEA 1YJNA 4IQZA 3D4DA 1LT3D 4DAYA 3SDZA 2I5LX 4BBRH 5JVG3 3ONAB 1LTID 4O0AA 1HA5A 3RUZA 3I2ZA 3U9OA 3SVMA 4M8AA 4DV0L 5C4JB 2EIFA 4LFAL 3LWUA 2XIWA 3F2CA 5JJIA 4IUPA 4DV0Q 2O5JC 5EKIA 1EYCA 2ZM6L 1OXUA 1TWGB 2Q2UA 1TKWB 3R8BA 1HFNA 5K5PA 1CUKA 2K03A 1YNXA 4C3HB 1CZGA 4N9TA 2SDFA 4ZKBB 1LM0A 2AQ1B 3VA5A 1IW7C 4KJNA 2SOBA 3QB3A 2NYZD 4LF5Q 1FJGQ 3K5LA 2ES2A 2PI2A 3HOYB 3OIQA 2BA0A 3ICEA 3OSOA 3EFXD 1I6HH 4MHEA 1EY6A 2ALYB 1DXMA 2IWHA 4Y7NB 3MAQA 1Q7YC 4K0KL 3M4OB 2HCIA 5GAHC 4DK1A 4KK7A 4K5XA 1JE5A 5KRUA 3L0OA 2E8GA 3HOWB 1XMOL 4IJLA 3TZDA 3AQQA 2PCFB 3HOZG 1R9TB 3ULLA 2AUJD 2D2CC 4RFBA 1OTCA 1K28A 2FMMA 1I4HA 3HOXG 1KXLA 2PYKA 1G6PA 3AEVA 3S14H 1KL9A 1EIHA 1VCIA 4FNFA 1PYBA 1V1PB 4L5QA 1FJGL 1PFBA 1NBWA 1NR2A 2B2WA 4HJAA 2R92B 3TN2A 2VUMB 2DUDA 2UUBQ 2RDFA 3FRPB 3B6YA 4LUVA 2EYJA 2F0OA 2CWPA 1PH6A 2R6GA 1FD7D 3KJOA 3NEMA 4XTCS 1F9SA 3CCEA 4OONA 1KIXA 1WTXA 1H9RA 1Y8NB 3IRBA 1K8OA 1XPOA 4AYBB 3H0GG 1STNA 1V9PA 2XWJB 2K6AA 1I4GA 5IWAL 2R93B 4WRDA 3DEOA 4OEMB 3LWEA 4QJFA 1S5BD 4G7ZC 1QVCA 1B3AA 2KENA 3I3CA 4AH6A 3BU2A 5I9PA 4AYBE 2K5HA 3GTKB 1GHJA 4POFA 5KIXA 1EY9A 4DV4Q 3OWEB 2NTTA 2EXDA 3KLRA 2PQEA 5C0XH 3S14B 3TREA 3CC2A 1IHZA 3PO2B 1F2MA 4PMBA 4X65L 2K52A 4HEDA 1HJPA 1R9TH 4JG2A 4OO1I 4UDUC 1VQ4A 1FGBD 4DV2Q 2O5IC 3GO5A 2NTSA 4ME5A 2WV6D 1WVLA 3HOUG 3CMAA 4DR7L 3IL8A 1Q82C 3UE1A 3IAYA 1MJEA 2G5DA 1PVOA 1STAA 2RBMA 2NZ1D 2BOSA 1KDAA 2ZTCA 3GD7A 4YWKA 3CCJA 4LF7Q 4ZRZA 1PTOH 4GOPA 1CKMA 5M9OA 1S3OA 1WCMG 5FOBB 1A8VA 4KKTA 2WAQG 2R3ZA 3NTIA 4EQ5A 1ONLA 4F87A 2F0PA 4XQJA 1WD0A 2EJMA 2FHTA 2B2TA 4K5VA 2FJ2A 3OYYA 4JI6Q 1NCVA 3CQZH 1M90C 3E9IA 1TVXA 4DGZA 3T1HQ 1E1OA 1VQJA 3X3NA 2KHJA 4JW0A 2NVXH 1D5MC 4A3KB 1A3UA 1ESFA 1JR0D 2F0UA 2AQ3B 2L12A 1L0XB 4LWCA 1G2SA 3QWNA 1I94L 2YYZA 1PRTB 5IP9H 3VYTA 1QILA 2KOLA 1D6EC 5CV9A 1J5EL 4BXXH 4C2MH 4RHSA 2RSOA 4C3IB 3K5MA 3S1MB 1QCBD 4TKOB 4N9PA 4P2CB 5IGCA 3MC0B 5JEAG 5JAVA 2X6LA 3C1FA 3BJUA 3CCQA 1L1OB 2JXMB 5M3FB 3BZCA 1H9KA 3GQBA 4FVMA 2WB1G 4Y52H 3NQIA 3MFYA 3W3AA 3QR8A 3K7AH 3A5UA 2VQEQ 5CMDA 2UUCQ 1SYBA 1S5FD 1U9RA 3S2DH 3PO2H 5ISRA 3H91A 1Y69U 3S2HB 1I3QH 3CCLA 2EDGA 3M4YA 4GN5A 1BUVT 3Q22A 1LT4D 3E5SA 2DY7A 3STBD 4DV1L 3QG1A 4R4QA 4B08A 3SHLA 2HQLA 1SFOB 2MGSA 1DD2A 4A3DH 1IKMA 1X56A 3T53B 4ZUJA 1X3FA 2RKSA 4JYAQ 4RGMA 3MEHA 5E7NA 4QQBX 5CV8A 4L63B 2OEOA 2AMCB 2D0OA 1SDFA 3I90A 3TRZA 4MIUA 3U9SA 2OF1A 1VQMA 5CV6A 2KCNA 4YWLA 4JI0Q 1CZWA 1I4RA 2P5ZX 1N33L 1UWVA 4MN3A 1HQRD 4FF4A 4R8NA 2CW0D 3F2DA 2F0JA 1LO5D 4NXNL 3I4LA 1PTOD 4IPCA 3U4ZA 1NSNS 4DNTB 5E4WC 4DR2L 1JOOA 2Q2TA 1LLRD 2D9UA 4A3KG 4JBKA 2E2JH 1S5CD 1A2UA 4GLAC 3CCVA 1D2BA 2B2VA 3K58A 2QILA 1H9SA 1A63A 5G3LD 3DUZA 4JI5Q 3OHXC 4RGTA 1HHVA 3T16A 3MHBA 3GTJB 1G8ZD 4A3KH 4L5TA 3BS1A 2VQEL 1WD1A 4UP8A 4GKKL 5IYBG 4HCEA 1STBA 4A3IB 4BA2I 3GV3A 3PF4A 4DNRB 4DV2L 1WCMB 3NELA 1QVFA 4R4OA 4A3EB 1PMRA 3RZDH 1SYEA 3GTOH 2AKWB 4JV5L 2EPBA 2K50A 4IUNA 5BR8Q 1II3A 1PZJD 4K8IA 2ENBA 4P74A 1EY5A 5IYDH 2PI2E 3BDOA 3CPFA 5C0XG 1X3GA 2VY3A 5HY6A 1PYWD 3BZKA 1PTOB 5J3BA 1GVPA 5A2QE 3KLSA 2KCMA 2UXBQ 2DNCA 1AP0A 2Q8TA 1TWFH 4BWGB 5IP7H 1JICA 3S1QB 3KF6B 1DONA 5KNCA 2CQOA 4BBRG 4JI4L 4ZLTF 1BQQT 1VQAA 4JI7L 5C4JH 1PH4A 4FXDA 2A73B 4KHPL 2VZAA 4QUCA 1S40A 1TY0A 1ZEQX 1VQNA 5M5YH 5AFWA 1B9MA 5JJKA 4PZ6A 1JE4A 3CF5A 5KGUA 2RA4A 4XQNA 4XT1B 3G71A 2Y0SE 2MO1A 4AIMA 3A56A 1SMYC 2EVBA 2EZVA 4A3FH 2F0DA 1ICFB 1OXTA 3I56A 4FXGC 1M8AA 1EWHA 2Z1CA 2NWGA 1IKLA 2XGTA 1RTOA 3BYYB 4CDFC 1D5XC 4DR1L 1B9NA 1HNXL 1E2WA 3HS0C 1T5XD 5JJZA 2OXPA 1BVSA 3S1RH 4K14A 4YIJA 1SN8A 4IFDH 2CWAA 1YNJD 4V190 1P16A 2N55A 1ET9A 3TSSA 5IY0A 1Z47A 2B2WC 2JP1A 1YNNC 3D31A 4A3CG 2E2HB 2IX0A 2GA4B 4RCOA 5M3FG 1MBYA 3EBEA 5C4XG 4X65Q 2GN5A 1LYLA 4Y7NH 4CDCC 4YHHQ 3DWQA 5H1SE 4QGUA 3HOZH 5JEAH 4XXEA 3IFDA 5CBEE 2C5CA 3DM3A 2GVAA 3GTJH 2VUMH 5C3XA 3QO2A 1M4VA 5FKAC 2EE1A 1RF2D 2K05A 3EN2A 1PRTF 4DV5Q 3J81c 5EBCA 2FMCA 3F1ZA 1VQBA 1F77A 2KHSA 1SYGA 2PZWA 3JAME 1ZXTA 3ER0A 2SNSA 1V1PA 1I50B 3I91A 5CV5A 3U4VA 2WINB 3M85A 1WI5A 2A68C 3DWAA 3PIP3 1B50A 4A3MG 2DJGC 4LUZA 1PV4A 2EJGC 4NXMQ 1Y1VB 4UAIA 2QGQA 3T56B 5AJ3L 3R3OA 1ZYRC 4JI3L 1L2FA 2A19A 2KBNA 1JB7A 1QNKA
chains in the Genus database with same CATH topology
1HQMC 1BF4A 3NBHA 2ZT9C 3H3VC 2F0LA 2JEAI 1GUSA 4KMUC 5CORA 1TWCB 3A7LA 1HTPA 1BCPB 1XXGA 5M5WB 3GTPB 2F0VA 4LAAA 4I7ZC 5JPNC 1CHQD 3H94A 5FK9C 1S4ZA 3SEBA 5CYUA 1HA6A 5JVH3 1JB3A 1QE6A 1SNQA 4CKBA 1KLGD 4HCSA 4FXKC 4FF3A 2EXZA 5IOCA 5DAUA 4WORA 3TMEA 3P75A 4IUTA 3CHBD 3P20A 2NVXB 5ELEA 3GTMB 1KLUD 1BR9A 1EQTA 5KNDA 4QIWB 4Q0FA 3SXHA 1OXSC 2QKIC 2C9OA 3A8JE 4RCNA 3QOJA 2G9HD 1ILPA 1D1IA 5TSSA 2HDLA 5I6WA 2L55A 4BY1B 2EY2A 4DAPA 4EQNA 4GZYC 1X32A 1CM9A 1SBBB 5IGFA 1F9PA 5CV4A 4G7HC 3HZXA 1VMPA 3C1EA 4ZYSA 3FKIB 4CKEA 4HMIA 3GP7A 1YNJC 2JA6B 4Q5VA 3KBGA 2K5QA 3MFGA 4J1MA 1E2VA 1GOZA 1BDOA 5BN5A 3HKZB 2F0FA 1X3PA 4F8MA 3E0JA 4A3FB 1Q90A 4IZ8A 2IW3A 1A6XA 1AEXA 5E1FA 3WDNA 4K2LA 4PV1C 3MA2B 3N52A 2RSNA 2EYOA 5K36H 3SK5A 3RD4A 4DA2A 4KKUA 1PTOC 3OIPA 1Y8OB 1ILQA 1QJOA 2A6HC 3AU7A 3KK7A 2WACA 4OL7A 3VA7A 2PPBC 4PNYA 4XYOA 2RDGA 2Q8RE 3D4WA 2KUMA 3EQLC 3I8ZA 3PMFA 4RGNA 5C3WA 1LTBD 1KTKA 4ID6A 3DHQA 1VMCA 1CFMA 1AZPA 4IUVA 1KAAA 3OMGA 4XIGS 5DM73 1B1ZA 3D6CA 5C44B 1ICWA 2PNRC 1HCZA 4C3JG 3Q0AA 1MI2A 4DXGA 3ZYYX 2E2DC 4LK1C 3NK9A 4KN7C 1V8QA 1CK1A 4G4KA 3VR3A 2PMZB 1HUNA 4TQUS 2LY7A 5C4ZA 1AZQA 2BA1A 3BVZA 3NHHA 4KJOA 3GTOB 1GUTA 1MD2D 4FO2A 1A2TA 4OHJA 1NAPA 2K28A 4CKCA 4A3MB 2MPMA 3HGBA 2X6GA 4HTHA 1FYCA 1EY8A 2SNMA 2NB0A 3OW7A 5KYIA 3BVGA 2CW0C 2J4XA 4FF2A 5IT9L 1GUOA 1SAPA 2FINB 2AWNA 1R4QB 4E6IA 1WTVA 4LMQD 3Q6SA 5EKKA 3RLFA 5ELCA 5C6AA 3A54A 3A55A 1RODA 1Q12A 1H9MA 4ZKCB 1TS4A 1FNWA 3A7AB 1EU3A 1BCPC 1TQOA 4KI0A 1HXYD 4WJWA 3MZ5A 3H0GB 1W6JA 1FNVA 4JBWA 1D5ZC 3NXWA 1K83B 1JOQA 2F03A 2JE6I 2JEBI 2PZTA 1QWYA 4ZQ3A 1LT5D 1RJTA 1S5DD 1ENCA 2L4NA 2B2VC 4PMWA 1STEA 2FFKB 4IUUA 2F0GA 5FO9B 1BXTA 5FLXL 3HOXB 3E6ZX 2BCOA 2TSSA 2E2IB 1JWUD 3HOZB 1EWCA 1HTLD 5LL6X 4R9WA 3NPPA 4IFDI 1GJXA 3LX0A 3CKIB 2K01A 4A93B 5DNFA 3QOLA 2L5TA 1LT6D 2ZXOA 3K59A 4RAUC 2A6HD 4RHRA 3NTKA 3G6JB 3S16B 4K6DA 4XQQA 3TBIB 2QEJC 4XDXA 2F0KA 2XN9C 4IFDJ 5G3LF 3VYUA 1QB5D 1B53A 5IODA 3QIAA 3NWSA 3UI2A 3HG9A 1XWEA 2MP1A 4K2KA 2F0MA 3H09A 5I2XA 3L7ZC 2K5DA 3TP7A 1EFID 4KY5A 3D6WA 2D5DA 4A3JB 5KYLA 4A3GB 1SE4A 1FR3A 1EY7A 1TU2B 4EQOA 1GUNA 5M3MB 1A15A 4TRDA 4RKBA 3IKJA 1ET6A 5LHY1 5IGBA 5CC4A 5IT9E 1WTRA 4O42A 3V05A 2JSOA 4KKSA 2KJXA 4EGVA 4DU9A 5CGKA 2Z8LA 1I6VC 3MXGA 5COYA 1BNZA 5J22A 4FF1A 1VF7A 3L9AX 4ZK9B 3WOEA 3GV6A 1QOHA 3MXNA 3FEWX 2HQEA 3MWYW 1TS5A 1DM0B 3BG3A 4OIJA 5FLXE 3CRKC 3KF8A 1WTPA 2IJ0A 1PZKD 2L1BA 2PO4A 3SK6A 4DXFA 4IUQA 3GTQB 3S17B 4NMZA 3TZUA 4BBRB 1EY4A 4C2MB 1PFNA 3GTGB 5F2DA 1D1KA 1SYFA 1RHPA 4Z9CB 3DM1A 2E2JB 1V43A 2B2UA 3CU7A 4KY6A 4HMJA 3VYSA 1IL8A 3N6RA 2EOTA 3P1HA 4X3KA 5HURA 2RVLA 3PIO3 5C5LA 2VNUD 3EA6A 3S1RB 5JOBA 1JOKA 2EYMA 4A3BB 2B8GA 1ML0D 2IX1A 4B9XA 1O7LA 1Y8PB 1DCZA 4U673 2L0CA 1UUPA 1PFMA 2BE5D 1YNND 1HUMA 1PRTD 1RTNA 1DJRD 3EROA 3SK4A 2LFNA 1BCPD 1G291 3DWPA 3J81L 2IL8A 1X3QA 1CHPD 2KEDA 4KN4C 1ESRA 5C3EB 5I9OA 5FO8B 1IYVA 1JC7A 2JA7B 3S9WA 4K6LA 4CJ1B 4EVOA 2ZXRA 2E74C 2XRQD 1SMYD 4NDXA 2F0IA 1E0BA 3J80L 2NN6I 1VF5C 2F0TA 2VXWA 4ODGA 1T5EA 1XX8A 1PDQA 1CQVA 2BDNA 4IALA 1U4LA 4X3SA 1AN8A 5IGGA 3PO3B 3ERQA 2D62A 3HP3A 4S3SA 5ELDA 4X3UA 3S15B 2K5WA 3WOFA 3V2TA 3PV0A 2RQXA 3W2DA 5E4XA 3C2PA 3OOCA 2ICIA 4BY7B 1SYDA 2EJFC 3RZDB 4NW2A 2HUGA 4KHZA 2H4OA 4BA1I 5LL6S 3RMHA 2LMCB 3BZDB 1Q3LA 4HR7B 3VYRA 5C0XI 1MGSA 3I73A 5EGTA 1VDZA 5J1ZA 1B44D 5D14A 2K32A 1SNDA 2K1BA 1KNAA 2NBFA 2NN6G 2JYOA 2AWOA 1GUWA 4KD4A 2Q8IB 2XRSD 1LTTD 1U4MA 2RDHA 1SNPA 4KV6A 2KCCA 1R4PB 2B8FA 1J8IA 2DY8A 1F2ZA 5I4DA 2HDMA 1G2TA 3L3OC 3NBIA 4QUFA 4DN4M 1STGA 4X3TA 1STYA 5A2QL 1F9RA 1WTOA 5IGDA 4G57A 3IFTA 4G7OC 1EOTA 3C3LA 3AB9A 2KQ3A 2WP8J 3BVMA 1TIID 1LTAD 1QNUA 2KEEA 2SEBD 3R2IA 4RWSC 5CR3A 1LACA 1B4OA 2KA7A 1EEID 1TT2A 3EVQA 4A3DB 1RCVD 1SE3A 5ELBA 1LTRD 1G91A 5BN4A 1A3VA 3TP5A 1L0YB 2IX3A 4U68A 1V1OA 5C5MA 3NP8A 1I4XA 1SJHD 4J8QA 1SNMA 4NP5A 1O78A 4CJ0B 3D3RA 3GTLB 3NWTA 2Y0SB 1HRJA 4EQPA 1I4PA 3O13A 1DOLA 4CGYB 2F1MA 2VB3X 4TSSA 1EYAA 3I70A 4QMGA 1SNOA 3K5OA 2NN6H 1RKNA 5EBDA 1EL0A 2QF7A 2NVTB 3TDQA 1G6ZA 4DK0A 5BN3A 2B39A 3LNNA 3URYA 2F0QA 4C3HG 2E76C 1OXXK 1ENFA 2V4DA 3FPPA 4DFAA 4IURA 1WTQA 1DOMA 5T1IA 1U4PA 2OT2A 2M9VA 4QB4A 2Z4IA 1K8MA 4HAEA 5EPLA 4H13C 3J7YW 5HGTA 4WFN3 4L6TB 1EZ6A 1Z6HA 4KD3A 2R7ZB 1Q1BA 1CQFA 4KHVA 2F0WA 2CVRA 1F2YA 4HSVA 2J0TD 3C46A 1S5ED 4QCLA 4F7XA 5CV7A 2I07B 2WIIB 2A68D 3DMUA 3TP6A 1H9JA 2KVMA 5EPJA 3OMCA 3VR6A 5M5XB 2BDOA 1O7ZA 3G7LA 5E3FA 1CA5A 5KEEA 1TR5A 1MSHA 3DEPA 1HPCA 5M5YB 3ND9A 1E2ZA 2Z4HA 3PUXA 1F2LA 1XTCD 1RDPD 2QCPX 4R8IA 2A69D 1O7YA 3RZOB 1CI3M 5DM63 3MXUA 3MVVA 2EY5A 2B2UC 5NUCA 1IW7D 1TWFB 3PUYA 4HN7A 2ZXPA 5EKLA 1CTMA 4PMCA 2ID0A 2F3VA 3I72A 4J6HA 1GUGA 2F4IA 4H7BA 2XVSA 3VR4A 5I6YA 1SEBD 2WAQB 1JWSD 5FO7B 2YU9B 3I4NB 4ULLA 5C0XJ 4CBVA 3R93A 1MSGA 3ITPA 2EY6A 4FP5D 1STHA 1QG7A 4OO1H 3EJIA 1UNSA 2N88A 2EYLA 1FNUA 3PUWA 3ND8A 3MXPA 4CHTB 2X69A 1C8CA 3V96A 1ZKOA 3MTSA 2CQAA 3HOVB 4I65A 5JPMC 3HRZC 3D8GA 3NSWA 3KUPA 1I3QB 2B2YC 1TWAB 4V0BA 1UEAB 3CQZB 1BO0A 2IPKD 3K7AB 4RA8A 4ZUIA 3Q23A 3FVQA 3I4MB 3KLSX 2M00A 3BDCA 2DN8A 2IT1A 1KABA 5C4HA 2B2TC 4F88A 1SJED 4RGOS 4KY7A 1EQVA 2EYPA 2TMPA 1SNCA 2B63B 4IN3A 1O80A 1Z7TA 1WTWA 2ICEC 1ENAA 3S2DB 4C1NI 4BBSB 2EYHA 5D3IB 4QF4A 4ZAIA 4DF7A 2A6ED 1IYUA 2A74C 1DZ1A 2AUKA 4DAVA 3VR2A 3OPOA 2XSCA 1BOSA 1JCKB 3K0YA 1EU4A 1KDCA 1JORA 5DEHA 1LV9A 1NR4A 3M7NA 2F3WA 1RD9D 2I46A 1Y1WB 3A8IE 1I4QA 2XNAC 3T51B 3PUVA 4PQXA 3X3MA 1SSOA 5JEAJ 2VB2X 1DOKA 1C48A 1EY0A 4ABNA 2K33A 1XYIA 3FMCA 4L8JA 2WKDA 3J7AF 1AW7A 1Q8IA 1W6KA 5EJWA 1LABA 3M7GA 3J81E 3NTHA 1GHKA 3BYTB 2F0NA 1J9OA 4HSPA 2WB1B 3AMUA 3SE0A 5IGEA 1EEFD 2L9HA 2F0SA 4M1UB 3M3YB 5C4XB 1BBXC 3OWFA 2MUYA 1TS3A 2MJ8A 4C3IG 4B9WA 3J80E 1SE2A 3S1NB 2K7VA 1EYDA 1I6HB 5D65A 2NVYB 2PW5A 2LS01 2MHVA 2QDBA 1CT1D 5A35A 5I2YA 4OGQC 4ILWA 2PW7A 5KNBA 2H1EA 3D4RA 1PZID 2LKVA 4K8JA 2J7ZA 2A69C 2PZUA 2F0HA 4LJZC 4K5WA 1PXUA 4NKLA 2NVQB 2K04A 5EPKA 1F9QA 3PUZA 3K57A 1TWHB 4H0LC 1JQYD 4OIKA 3Q24A 2R61A 3T13A 3HOUB 3K6OA 2M2LA 5K36G 2CHBD 2F0EA 3T4AC 3H6MA 4FYDA 5ELFA 3R2TA 4KTAA 1H9SB 1KDBA 1Q1EA 5D3DA 4BS9A 5CBAE 4C56C 1SXTA 1C4QA 3J7AV 3P7JA 2AQ2B 3CRLC 1HFGA 2A5HA 4C1NK 1DYQA 4JK1C 1TY2A 5EQ0A 3K5NA 5J39A 3NQTA 1NUCA 4RKLA 1OO9B 3FDTA 3VR5A 3F2UA 3NE5B 3TP8A 3JAML 4O1NA 2EY1A 1PRTC 3HEJA 1BCPF 2BE5C 3SK8A 2WKCA 5T1GA 5IIFA 1EZ8A 1PTOF 2EYFA 4XT3B 2G9DA 2KECA 2E75C 2JA5B 4OO1G 2A6EC 2O2LD 3QJYA 1PLFA 3SR1A 1B2TA 1LTSD 1OXVA 3A8KE 1GXDC 1TS2A 4IFDG 3KBXA 1ZYRD 2NUCA 1U4RA 1UAPA 1EIGA 4CJ2C 3DXJC 1AFPA 4RH6A 3FPUB 1JWMD 1LTGD 2L11A 1A3TA 4XYQA 2JA8B 3BDLA 2B2YA 2O4XA 1KNEA 2XWBB 3NUCA 1SYCA 2HCCA 4C3JB 4H44C 1CA6A 2DNEA 4IQZA 3D4DA 1LT3D 4DAYA 3SDZA 5JVG3 3ONAB 1LTID 1HA5A 3RUZA 3U9OA 3SVMA 4M8AA 5C4JB 3LWUA 2XIWA 4IUPA 2O5JC 5EKIA 1EYCA 1OXUA 1TWGB 1TKWB 3R8BA 1HFNA 5K5PA 2K03A 4C3HB 1CZGA 4N9TA 2SDFA 4ZKBB 2AQ1B 3VA5A 1IW7C 4KJNA 2SOBA 3QB3A 2NYZD 3K5LA 3HOYB 3OIQA 2BA0A 3OSOA 3EFXD 4MHEA 1EY6A 1DXMA 2IWHA 4Y7NB 3MAQA 3M4OB 2HCIA 4DK1A 4KK7A 4K5XA 5KRUA 3HOWB 3TZDA 2PCFB 1R9TB 2AUJD 2D2CC 4RFBA 2FMMA 1I4HA 2PYKA 1EIHA 1VCIA 4FNFA 1V1PB 1PFBA 1NR2A 2R92B 2B2WA 3TN2A 2VUMB 2RDFA 3FRPB 2EYJA 2F0OA 2R6GA 1FD7D 4XTCS 1F9SA 1WTXA 1H9RA 1Y8NB 1K8OA 4AYBB 1STNA 2XWJB 2K6AA 1I4GA 2R93B 4WRDA 3DEOA 3LWEA 1S5BD 4G7ZC 1B3AA 3I3CA 5I9PA 3GTKB 1GHJA 5KIXA 1EY9A 3OWEB 2NTTA 3S14B 3KLRA 2PQEA 5C0XH 1IHZA 3PO2B 1F2MA 4PMBA 4HEDA 4OO1I 4UDUC 1FGBD 2O5IC 3GO5A 2NTSA 4ME5A 2WV6D 1WVLA 3IL8A 3IAYA 1STAA 2RBMA 2NZ1D 2BOSA 1KDAA 3GD7A 4ZRZA 1PTOH 5M9OA 5FOBB 4KKTA 2R3ZA 3NTIA 4F87A 1ONLA 2F0PA 4XQJA 1WD0A 2EJMA 2FHTA 2B2TA 4K5VA 2FJ2A 1NCVA 1TVXA 4DGZA 3X3NA 1D5MC 4A3KB 1A3UA 1ESFA 1JR0D 2F0UA 2AQ3B 2L12A 1L0XB 1G2SA 3QWNA 2YYZA 1PRTB 3VYTA 1QILA 2KOLA 1D6EC 5CV9A 4RHSA 2RSOA 4C3IB 3K5MA 3S1MB 1QCBD 4TKOB 4N9PA 4P2CB 5IGCA 3MC0B 5JEAG 5JAVA 2X6LA 3C1FA 2JXMB 5M3FB 1H9KA 3GQBA 4FVMA 3NQIA 3MFYA 3W3AA 5CMDA 1SYBA 1S5FD 1U9RA 5ISRA 3H91A 1Y69U 3S2HB 2EDGA 3M4YA 1BUVT 3Q22A 1LT4D 3E5SA 2DY7A 3QG1A 4B08A 3SHLA 1SFOB 2MGSA 1DD2A 1IKMA 3T53B 4ZUJA 2RKSA 4RGMA 3MEHA 5CV8A 4L63B 2OEOA 1SDFA 3I90A 4MIUA 3U9SA 2OF1A 5CV6A 2KCNA 1CZWA 1I4RA 4MN3A 1HQRD 4FF4A 4R8NA 2CW0D 2F0JA 1LO5D 3I4LA 1PTOD 1NSNS 4DNTB 5E4WC 1JOOA 1LLRD 2D9UA 1S5CD 1A2UA 1D2BA 2B2VA 3K58A 2QILA 1H9SA 5G3LD 3DUZA 3OHXC 4RGTA 1HHVA 3T16A 3MHBA 3GTJB 1G8ZD 3BS1A 1WD1A 4HCEA 1STBA 4A3IB 4BA2I 3GV3A 4DNRB 1WCMB 4A3EB 1PMRA 1SYEA 2EPBA 4IUNA 1II3A 1PZJD 4K8IA 2ENBA 1EY5A 3BDOA 5C0XG 1PYWD 1PTOB 5A2QE 3KLSA 2DNCA 1AP0A 2Q8TA 4BWGB 3S1QB 1JICA 1DONA 5KNCA 4ZLTF 1BQQT 4FXDA 2A73B 4QUCA 1TY0A 1ZEQX 5AFWA 1B9MA 1JE4A 5KGUA 2RA4A 4XQNA 4XT1B 3A56A 1SMYC 2EVBA 2EZVA 2F0DA 1OXTA 4FXGC 1M8AA 1EWHA 2Z1CA 2NWGA 1IKLA 3BYYB 1RTOA 1D5XC 1B9NA 1E2WA 3HS0C 1T5XD 5JJZA 2OXPA 4K14A 4YIJA 4IFDH 1YNJD 4V190 2N55A 1ET9A 3TSSA 1Z47A 2B2WC 2JP1A 1YNNC 3D31A 2E2HB 2IX0A 2GA4B 4RCOA 1MBYA 3DWQA 5JEAH 4XXEA 3IFDA 5CBEE 2C5CA 5C3XA 3QO2A 1M4VA 5FKAC 2EE1A 1RF2D 2K05A 1PRTF 5EBCA 2FMCA 1F77A 2KHSA 1SYGA 2PZWA 3JAME 1ZXTA 2SNSA 1V1PA 1I50B 3I91A 5CV5A 2WINB 3M85A 2A68C 3DWAA 3PIP3 1B50A 2EJGC 1Y1VB 4UAIA 3T56B 3R3OA 1ZYRC 1QNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3L A;  1ML0 D;  4ZLT F;  1BF4 A;  3G7L A;  3H91 A;  1CA5 A;  1BBX C;  2XIW A;  4IUP A;  1MGS A;  4QUC A;  2MJ8 A;  1HRJ A;  5EKI A;  5D14 A;  1MSH A;  2B2T C;  4HED A;  1X3P A;  3DEP A;  3FDT A;  4R9W A;  5AFW A;  1DOL A;  2DY7 A;  3F2U A;  1JE4 A;  1HFN A;  1PFM A;  2K03 A;  2K1B A;  2MGS A;  5COY A;  5D65 A;  1F2L A;  1KNA A;  1BNZ A;  1IKM A;  2JYO A;  2RA4 A;  1GUW A;  4R8I A;  1O80 A;  5COR A;  2SDF A;  4ZKB B;  1WTW A;  1NAP A;  2K28 A;  4XT1 B;  1O7Y A;  1WVL A;  1HUM A;  2MPM A;  3IL8 A;  1RTN A;  1U4M A;  1SDF A;  2X6G A;  2NYZ D;  3I90 A;  4ZK9 B;  1EL0 A;  4ZAI A;  2B2U C;  2NZ1 D;  2K01 A;  1M8A A;  3GV6 A;  3N52 A;  2RSN A;  5DNF A;  1G6Z A;  2NWG A;  1J8I A;  1IKL A;  1DZ1 A;  5T1G A;  2DY8 A;  1RTO A;  4MHE A;  2IL8 A;  1X3Q A;  2KED A;  2HCI A;  4MN3 A;  1ESR A;  2KEC A;  3MWY W;  4RAU C;  4XT3 B;  5JJZ A;  2H1E A;  1ILQ A;  1S4Z A;  2HDM A;  1HA6 A;  1G2T A;  4XDX A;  4OIJ A;  2N55 A;  2R3Z A;  2J7Z A;  1WTP A;  4QUF A;  1QE6 A;  3TZD A;  2L1B A;  5E4W C;  4CJ1 B;  4DN4 M;  2D9U A;  4X3T A;  1LV9 A;  1NR4 A;  1PLF A;  1SAP A;  4IUR A;  1WTQ A;  1WD0 A;  2FIN B;  2B2W C;  2JP1 A;  4HCS A;  1B2T A;  1DOM A;  5T1I A;  2FHT A;  2B2T A;  1U4P A;  2FJ2 A;  1B53 A;  2Q8R E;  1F9R A;  1E0B A;  1NCV A;  2KUM A;  3I8Z A;  4IUQ A;  4LMQ D;  3Q6S A;  1WTO A;  2FMM A;  2B2V A;  3KBX A;  1TVX A;  1WTV A;  3UI2 A;  2VXW A;  1AZQ A;  1XX8 A;  1U4R A;  2K04 A;  1F9Q A;  2MP1 A;  3IFD A;  1EIG A;  5EPK A;  4CJ2 C;  1EIH A;  5CBE E;  1ROD A;  1PDQ A;  1EOT A;  1PFN A;  1VMC A;  4IUT A;  1PFB A;  1NR2 A;  3R93 A;  1MSG A;  2B2W A;  1SSO A;  2BDN A;  4HAE A;  5EPL A;  3TN2 A;  1QG7 A;  1AZP A;  1WD1 A;  3FPU B;  1U4L A;  2N88 A;  1RHP A;  3QO2 A;  4IUV A;  4OIK A;  4X3S A;  2L12 A;  3DM1 A;  4ZKC B;  2EE1 A;  1EQT A;  1DOK A;  1G2S A;  3D6W A;  3GV3 A;  2B2U A;  2K05 A;  2M2L A;  3HP3 A;  2L11 A;  4X3U A;  2KEE A;  1ICW A;  2X69 A;  4RWS C;  1C8C A;  1F9S A;  1IL8 A;  2KOL A;  2EOT A;  2CVR A;  1ZXT A;  2B2Y A;  2EPB A;  4X3K A;  1KNE A;  1MI2 A;  1B4O A;  3MTS A;  1ILP A;  1WTX A;  2RSO A;  5E4X A;  4HSV A;  2HDL A;  3I91 A;  1XYI A;  2HCC A;  2RVL A;  1B50 A;  1HHV A;  2X6L A;  3DEO A;  3LWE A;  3KUP A;  1CA6 A;  1X32 A;  1CM9 A;  5EJW A;  1F9P A;  2B2Y C;  5CBA E;  1RJT A;  1A15 A;  1B3A A;  4NW2 A;  1G91 A;  3I3C A;  1VMP A;  2L4N A;  2B2V C;  3P7J A;  4UAI A;  2HUG A;  1AP0 A;  3ONA B;  2Q8T A;  2KVM A;  5EPJ A;  1HFG A;  1J9O A;  2FFK B;  4IUU A;  1JIC A;  4U68 A;  1BO0 A;  1DON A;  4RA8 A;  1HUN A;  5CMD A;  3SVM A;  4O42 A;  1WTR A;  5EQ0 A;  2L9H A;  4CJ0 B;  1O7Z A;  1QNK A; 
#chains in the Genus database with same CATH topology
 1HQM C;  2UXD L;  1BF4 A;  4DV3 L;  2UXD Q;  3NBH A;  3PF5 A;  2ZT9 C;  3H3V C;  2F0L A;  2VL6 A;  2JEA I;  1GUS A;  3L2P A;  2JA9 A;  2E5L Q;  1PH7 A;  4KMU C;  5COR A;  1TWC B;  1WOC A;  3A7L A;  1HTP A;  1BCP B;  1CKO A;  1XXG A;  4LF6 Q;  5M5W B;  4A3E H;  3GTP B;  2F0V A;  4LAA A;  4I7Z C;  5ELO A;  5JPN C;  1VQ8 A;  1LTL A;  3M4P A;  5C3E H;  1CHQ D;  4DKA C;  3H94 A;  5FK9 C;  5IT9 c;  1S4Z A;  3SEB A;  2UU9 Q;  5CYU A;  1HA6 A;  3KYH C;  4C3I H;  5JVH 3;  1JB3 A;  3HOV H;  1QE6 A;  1SNQ A;  2JA7 G;  4CKB A;  1KLG D;  4HCS A;  2ZM6 Q;  4FXK C;  4FF3 A;  4IPG A;  2EXZ A;  5IOC A;  1FGU A;  1GD7 A;  3G48 A;  5DAU A;  3PO2 G;  3HKS A;  1N8R C;  4WOR A;  1Y1V H;  1AH9 A;  3TME A;  3P75 A;  3HOV G;  2ZTD A;  4IUT A;  3CHB D;  3P20 A;  2NVX B;  5ELE A;  3GTM B;  1KLU D;  4JVZ A;  1BR9 A;  1EQT A;  5KND A;  2K4K A;  4QIW B;  4Q0F A;  3SXH A;  1OXS C;  2QKI C;  4POG A;  4DV6 Q;  2C9O A;  3A8J E;  4RCN A;  3QOJ A;  2G9H D;  1ILP A;  1JMC A;  3PSI A;  1D1I A;  5TSS A;  2HDL A;  5I6W A;  3M4Q A;  2L55 A;  4BY1 B;  1C0A A;  1D7Q A;  2EY2 A;  4DAP A;  4EQN A;  2JA5 H;  1VQG A;  4GZY C;  1X32 A;  1CM9 A;  1SBB B;  5IGF A;  1F9P A;  5M5W H;  5CV4 A;  1KRT A;  4G7H C;  3HZX A;  2KHI A;  1VMP A;  3C1E A;  4ZYS A;  3FKI B;  3HKZ E;  2NZO A;  4CKE A;  4HMI A;  3GP7 A;  1YNJ C;  4X64 Q;  1EOV A;  2JA6 B;  4B3T Q;  3M3Y H;  4Q5V A;  3KBG A;  1YBY A;  2K5Q A;  3MFG A;  4R4C A;  4J1M A;  1E2V A;  1GOZ A;  1BDO A;  2FXQ A;  5BN5 A;  1V1Q A;  3HKZ B;  2F0F A;  2QDL A;  1X3P A;  1EQQ A;  3RNU A;  1MHW C;  1VQ9 A;  3GTG H;  3VDY A;  4F8M A;  3J81 j;  3E0J A;  2JJQ A;  4O2D A;  4LFC L;  2UU9 L;  3S16 H;  4A3F B;  1Q90 A;  4IZ8 A;  4BY1 G;  2IW3 A;  1A6X A;  5L37 A;  4LF9 Q;  1AEX A;  5E1F A;  3WDN A;  4K2L A;  4PV1 C;  3PIP A;  3PO3 H;  3MA2 B;  3N52 A;  2RSN A;  4WJ4 A;  2EYO A;  5K36 H;  3SK5 A;  3RD4 A;  4DA2 A;  4KKU A;  4UHV A;  4IPD A;  1PTO C;  1H95 A;  3OIP A;  1Y8O B;  1BBW A;  1ILQ A;  1QJO A;  2A6H C;  4DAM A;  3AU7 A;  3KK7 A;  2ASB A;  2WAC A;  3E9H A;  4OL7 A;  3VA7 A;  1VQK A;  1G51 A;  2PPB C;  1VQ6 A;  4PNY A;  4XYO A;  2RDG A;  2Q8R E;  5C4X H;  3D4W A;  2KUM A;  3EQL C;  3I8Z A;  3PMF A;  4YY3 Q;  4RGN A;  5C3W A;  4YY3 L;  2GVB A;  1LTB D;  1WTH A;  1KTK A;  4ID6 A;  3DHQ A;  1VMC A;  2R92 H;  4H02 A;  1CFM A;  1QUQ B;  1TWH H;  5LMU L;  1AZP A;  4IUV A;  1KAA A;  1VQP A;  4A4I A;  3OMG A;  4B3R L;  4XIG S;  3RZO H;  5DM7 3;  1B1Z A;  4FDB A;  1VQL A;  3D6C A;  5DLQ E;  4HJ5 A;  5C44 B;  2OTJ A;  1ICW A;  4GOP C;  2PNR C;  1HCZ A;  4C3J G;  3Q0A A;  4BXX G;  1MI2 A;  4DXG A;  1CSQ A;  4P73 A;  3ZYY X;  1K9M C;  3HOY G;  1K83 H;  4LF8 L;  2E2D C;  4LK1 C;  4JI4 Q;  2PMZ E;  3NK9 A;  4KN7 C;  2K5N A;  1A0I A;  4A76 A;  1N34 Q;  4OX9 L;  1V8Q A;  1CK1 A;  2Z6K A;  4G4K A;  3VR3 A;  1N34 L;  2PMZ B;  1HUN A;  4TQU S;  1IBM Q;  1IL2 A;  3UDF A;  2LY7 A;  5C4Z A;  1AZQ A;  2BA1 A;  3BVZ A;  4DUZ Q;  4R4T A;  1IZ6 A;  3NHH A;  4KJO A;  3DLL A;  4A3C H;  1U0L A;  1K3R A;  3GTO B;  1YHB A;  3GDE A;  2YTX A;  1C7Y A;  1GUT A;  1MD2 D;  3S24 A;  4FO2 A;  2F4V Q;  1LUZ A;  1A2T A;  4OHJ A;  1YVC A;  2E5L L;  3GTM H;  1X55 A;  1NAP A;  2K28 A;  4GKK Q;  1VQH A;  4CKC A;  4A3M B;  2MPM A;  3HGB A;  2X6G A;  4HTH A;  1FYC A;  1EY8 A;  4DPG A;  2SNM A;  4JI2 L;  1J5E Q;  2HD3 A;  2NB0 A;  3OW7 A;  5KYI A;  3BVG A;  4DV6 L;  2CW0 C;  2J4X A;  4FF2 A;  5IT9 L;  1UE6 A;  3FKI G;  1GUO A;  1PH5 A;  1SAP A;  2FIN B;  2AWN A;  4DUY L;  1R4Q B;  2QEX A;  4E6I A;  3EIV A;  1N33 Q;  1WTV A;  4LMQ D;  3Q6S A;  5EKK A;  3RLF A;  5ELC A;  5C6A A;  3A54 A;  3A55 A;  1ROD A;  2OWO A;  1Q12 A;  4PZ8 A;  1H9M A;  4ZKC B;  1FNW A;  1TS4 A;  3A7A B;  4QL5 A;  1EU3 A;  1BCP C;  1SFO H;  2B3G A;  1EIF A;  2YTV A;  1TQO A;  4KI0 A;  1HXY D;  2UUA L;  4DK6 C;  2N8N A;  4WJW A;  3MZ5 A;  3H0G B;  3J81 i;  1W6J A;  1FNV A;  3J7A 5;  4JBW A;  1D5Z C;  3NXW A;  4JI8 Q;  1B7Y B;  1K83 B;  1JOQ A;  4YHH L;  2F03 A;  3CCM A;  3M9B A;  2JE6 I;  2JEB I;  2PZT A;  1QWY A;  1XPU A;  3I4M G;  4ZQ3 A;  4DR7 Q;  1LT5 D;  1RJT A;  1S5D D;  1ENC A;  2L4N A;  2B2V C;  1X65 A;  4PMW A;  3I4O A;  1STE A;  2FFK B;  4IUU A;  2F0G A;  1PH2 A;  5FO9 B;  1BXT A;  5FLX L;  4HJ9 A;  3HOX B;  3E6Z X;  1ASY A;  2BCO A;  1A62 A;  2TSS A;  2E2I B;  1JWU D;  4A3B G;  1K8G A;  3HOZ B;  3ULJ A;  1EWC A;  1HTL D;  5LL6 X;  1EFW A;  4R9W A;  1B8A A;  5AJ3 Q;  4GNX A;  4MNO A;  5GRO A;  1Q81 C;  3NPP A;  4IFD I;  1PFS A;  4JI1 L;  1IYJ B;  1GJX A;  3LX0 A;  1IXR A;  1GKH A;  2JA8 H;  3CKI B;  2K01 A;  4A93 B;  1UEB A;  4GKJ L;  5DNF A;  4JI7 Q;  3QOL A;  2L5T A;  1LT6 D;  2ZXO A;  2A6H D;  4RAU C;  3JAM c;  3K59 A;  4B3S Q;  2HT1 A;  3M4O H;  2H5X A;  4RHR A;  3NTK A;  3G6J B;  3S16 B;  4K6D A;  4XQQ A;  3TBI B;  3CAM A;  2QEJ C;  4XDX A;  2F0K A;  2XN9 C;  1Y1V G;  4IFD J;  5G3L F;  3VYU A;  1QB5 D;  3J80 c;  1B53 A;  4YCU A;  4BY7 G;  5IOD A;  3QIA A;  3NWS A;  4C3H H;  3UI2 A;  3HG9 A;  1XWE A;  3W1G A;  2DGY A;  2MP1 A;  4K2K A;  1TWG H;  3TQY A;  4ALP A;  2F0M A;  3J7Z C;  3H09 A;  5I2X A;  2F52 A;  2JN4 A;  3L7Z C;  2K5D A;  3TP7 A;  1EFI D;  4KY5 A;  1Q86 C;  3D6W A;  2R7F A;  2D5D A;  4A3J B;  4EX5 A;  5KYL A;  4A3G B;  1SE4 A;  1FR3 A;  1EY7 A;  2OQK A;  1TU2 B;  4EQO A;  1UE1 A;  3F8T A;  4IPH A;  1XJV A;  4DV3 Q;  3PCO B;  1GUN A;  2BH2 A;  5M3M B;  2I0Q A;  1A15 A;  4TRD A;  3GTK H;  1E1T A;  4RKB A;  3IKJ A;  1ET6 A;  1K3B C;  1L0W A;  5LHY 1;  2IY5 B;  5IGB A;  5CC4 A;  5IT9 E;  1WTR A;  4O42 A;  3V05 A;  2JSO A;  5GAD C;  2LXJ A;  1NTG A;  4KKS A;  2N3S A;  2RF4 A;  4LW1 A;  1BBU A;  4A3J H;  3GTL H;  2MNA A;  2KJX A;  4EGV A;  2Z0S A;  1X9N A;  2UXC Q;  1PH8 A;  3S1N H;  4DU9 A;  5CGK A;  2VQF L;  2Z8L A;  1I6V C;  3MXG A;  5COY A;  1PYS B;  1BNZ A;  3S15 H;  4APV A;  4C3J H;  5J22 A;  4FF1 A;  3H0G H;  3AYH B;  2B63 G;  1VF7 A;  3K7U C;  3G6E A;  3KLW A;  5M3M G;  3L9A X;  4ZK9 B;  3WOE A;  3GV6 A;  2R93 H;  5IYB H;  1QOH A;  3MXN A;  4HIO A;  3FEW X;  2HQE A;  2HIX A;  3MWY W;  1TS5 A;  4A3G G;  1DM0 B;  2IHF A;  3BG3 A;  4OIJ A;  5FLX E;  3CRK C;  3KF8 A;  1WTP A;  1SMX A;  2IJ0 A;  1PZK D;  2L1B A;  2PQA A;  2PO4 A;  3SK6 A;  5ELN A;  4DXF A;  4IUQ A;  1P8L A;  2R7Z H;  3GTQ B;  3S17 B;  1T9H A;  4P71 A;  4NMZ A;  3TZU A;  4BBR B;  1XNR L;  1EY4 A;  4C2M B;  2EQS A;  1TXY A;  1PFN A;  3GTG B;  2PQA B;  5F2D A;  1D1K A;  1SYF A;  3PQI A;  3OTO L;  1RHP A;  4Z9C B;  3DM1 A;  4X62 L;  2E2J B;  1EIY B;  1V43 A;  2B2U A;  3CU7 A;  1I94 Q;  1Y1W H;  4KY6 A;  4OXP A;  3GTP H;  4HMJ A;  4OWX B;  3VYS A;  1IL8 A;  3N6R A;  2EOT A;  3P1H A;  4X3K A;  2Y0S G;  2Z6K C;  5HUR A;  2RVL A;  1D8L A;  1HR0 L;  4BBS G;  4GN4 B;  4DNI A;  4JI6 L;  3PIO 3;  3I4N G;  2ZJR A;  5C5L A;  2VNU D;  3AFP A;  3EA6 A;  3S1R B;  5JOB A;  1E7Z A;  4P72 A;  2I5M X;  1JOK A;  5IE8 A;  2EYM A;  2A1A A;  4A3B B;  4A3L H;  2B8G A;  1I5F A;  1ML0 D;  2IX1 A;  1E3P A;  1YIJ A;  4B9X A;  1O7L A;  1Y8P B;  3H3V I;  1UE7 A;  1DCZ A;  3E3X A;  4U67 3;  2L0C A;  1UUP A;  1PFM A;  3TS0 A;  5GQO A;  3I4M H;  2BE5 D;  4QIW E;  1YNN D;  1HUM A;  1PRT D;  2ATW A;  1RTN A;  2NZH A;  4K0K Q;  1XNQ Q;  1DJR D;  4DR1 Q;  3ERO A;  4GOP B;  1VQ5 A;  3SK4 A;  4JI8 L;  2CFM A;  2LFN A;  1BCP D;  1G29 1;  3DWP A;  3J81 L;  2IL8 A;  1WJJ A;  4LF5 L;  1X3Q A;  3S17 H;  1CHP D;  2KED A;  4KN4 C;  1ESR A;  5C3E B;  1Q46 A;  5I9O A;  1WFQ A;  5FO8 B;  1IYV A;  1JC7 A;  1Z9F A;  2JA7 B;  3TEH B;  4X6A H;  3S9W A;  4K6L A;  4CJ1 B;  4EVO A;  2ZXR A;  2E74 C;  2VUM G;  2XRQ D;  1SMY D;  4NDX A;  4L5R C;  3HOW G;  4PZ7 A;  4NPS A;  2F0I A;  3RR5 A;  4B3S L;  1E0B A;  5IWA Q;  3J80 L;  4BY7 H;  2NN6 I;  1VF5 C;  4LFA Q;  2F0T A;  2VXW A;  1TWC H;  4ODG A;  1T5E A;  1XX8 A;  3PGZ A;  1PDQ A;  1CQV A;  2BDN A;  4IAL A;  1S72 A;  4JI1 Q;  2RCF A;  1KAW A;  1U4L A;  1AN8 A;  1VQC A;  4X3S A;  2IHE A;  5IGG A;  3PO3 B;  2N49 A;  3ERQ A;  2D62 A;  3HP3 A;  4S3S A;  5ELD A;  4X3U A;  3S15 B;  2UUB L;  2XTI A;  2Z6B A;  3I7F A;  2K5W A;  3WOF A;  4N8X 1;  2YTY A;  2JK8 A;  3V2T A;  3CXC A;  3PV0 A;  2RQX A;  3W2D A;  5E4X A;  4LF7 L;  3C2P A;  3OOC A;  4GS3 A;  3W1B A;  1JT8 A;  2ICI A;  2HHH L;  4BY7 B;  1SYD A;  2EJF C;  3RN5 A;  3RZD B;  1CSP A;  4NW2 A;  1JJC B;  2HUG A;  4A3L G;  4KHZ A;  1IBK L;  3W5O A;  1SR3 A;  5FJ8 H;  2H4O A;  4DK3 C;  3FKI H;  4JOI A;  4BA1 I;  2HHH Q;  3CC7 A;  5LL6 S;  3RMH A;  2LMC B;  3BZD B;  1Q3L A;  4HR7 B;  3VYR A;  1DGS A;  1SLJ A;  5C0X I;  3KOJ A;  1MGS A;  3I73 A;  5EGT A;  1VDZ A;  5J1Z A;  1B44 D;  5D14 A;  4KLK A;  2K32 A;  4R1J A;  2F3I A;  1N9W A;  1SND A;  1UE5 A;  4A3F G;  2K1B A;  2PNH A;  1KNA A;  2NBF A;  2NN6 G;  2JA8 G;  2JYO A;  2AWO A;  1GUW A;  1HR0 W;  4NXN Q;  1JJG A;  4KD4 A;  4IO9 A;  2Q8I B;  2XRS D;  1LTT D;  1U5K A;  1KD1 C;  1O7I A;  1U4M A;  2RDH A;  1SNP A;  4KV6 A;  1HR0 Q;  2KCC A;  4LF8 Q;  1R4P B;  4A93 H;  2B8F A;  1J8I A;  2DY8 A;  5GAE C;  1F2Z A;  5I4D A;  4JYA L;  2HDM A;  1G2T A;  3L3O C;  3HOW H;  3NBI A;  3U50 C;  4QUF A;  5M3F H;  4OWT B;  2WB1 E;  4DN4 M;  4DR6 Q;  1STG A;  4X3T A;  1HZB A;  4UP9 A;  3CCR A;  4OEL B;  1NJI C;  1STY A;  2VW9 A;  2R7D A;  5A2Q L;  1F9R A;  5C3E G;  1WTO A;  1EQR A;  3FP9 A;  5IGD A;  4G57 A;  3J80 i;  3IFT A;  1XNQ L;  1EOT A;  4G7O C;  1NNX A;  3C3L A;  3AB9 A;  2KQ3 A;  2WP8 J;  3STB C;  1NMG A;  3BVM A;  1TII D;  1LTA D;  1QNU A;  2JA5 G;  1XMO Q;  2KEE A;  2SEB D;  3R2I A;  4RWS C;  5CR3 A;  1LAC A;  1ASZ A;  4AYB G;  1B4O A;  2KA7 A;  4JI5 L;  2QW7 A;  1EEI D;  1TT2 A;  2MO0 A;  3EVQ A;  4A3D B;  1RCV D;  2MQH A;  1SE3 A;  5ELB A;  1IBM L;  1LTR D;  1B3Q A;  2V1C C;  1G91 A;  3H15 A;  5BN4 A;  1A3V A;  1JJ2 A;  3TP5 A;  1L0Y B;  2IX3 A;  4U68 A;  4IOC A;  1V1O A;  5C5M A;  4L5S A;  5M5X H;  3NP8 A;  1I4X A;  1SJH D;  4J8Q A;  1SNM A;  4NP5 A;  2VQF Q;  1O78 A;  2UXC L;  3LGJ A;  4CJ0 B;  2C35 B;  2JA6 G;  3D3R A;  3GTL B;  4GLX A;  1WCM H;  4JPB W;  1PH9 A;  3NWT A;  5GAG C;  2Y0S B;  3JAM i;  4EQP A;  1HRJ A;  1FL0 A;  1I4P A;  4DUY Q;  3O13 A;  2VS1 A;  1DOL A;  4CGY B;  2F1M A;  1HZ9 A;  2VB3 X;  4TSS A;  1I50 H;  1EYA A;  1K0R A;  3UDX A;  3I70 A;  2OCE A;  4QMG A;  3I4N H;  1SNO A;  2CCZ A;  3K5O A;  3RLN A;  2NN6 H;  1XMQ L;  3OTO Q;  4DV1 Q;  1RKN A;  5EBD A;  3CCU A;  1EL0 A;  2QF7 A;  1QVG A;  2NVT B;  3TDQ A;  1G6Z A;  4DK0 A;  5BN3 A;  4X66 Q;  1NY4 A;  2B39 A;  2UUC L;  3LNN A;  1SRU A;  3URY A;  1IBK Q;  2F0Q A;  4C3H G;  2E76 C;  1FVI A;  1OXX K;  3Q8D A;  1ENF A;  3KF8 B;  3UDG A;  2V4D A;  3FPP A;  4MTN A;  3CPW A;  4DFA A;  4IUR A;  1WTQ A;  1B70 B;  1DOM A;  5T1I A;  3PIO A;  2E2H H;  1U4P A;  1GO3 E;  2OT2 A;  2M9V A;  3MXN B;  4QB4 A;  2Z4I A;  3KDF B;  1PH1 A;  1K8M A;  1SRO A;  4BBS H;  4HAE A;  5EPL A;  4DV4 L;  3KF6 A;  3JC6 6;  4H13 C;  4LFC Q;  3J7Y W;  5HGT A;  4A3M H;  4WFN 3;  1MIU A;  4L6T B;  1WYD A;  1EZ6 A;  1Z6H A;  4KD3 A;  3S2H H;  4DR4 Q;  3GTQ H;  2R7Z B;  4HIM A;  2OQ0 A;  1Q1B A;  1CQF A;  3PO3 G;  3A74 A;  3SGI A;  1EWI A;  2CKZ B;  4KHV A;  2F0W A;  2CVR A;  1VQI A;  5JJL A;  1N32 Q;  1F2Y A;  4PG3 A;  5IYC G;  4HSV A;  2J0T D;  3CCS A;  3C46 A;  1S5E D;  4QCL A;  4F7X A;  5CV7 A;  2I07 B;  2WII B;  1YJ9 A;  2A68 D;  1AE3 A;  3DMU A;  4GN3 B;  1IBL Q;  3TP6 A;  1BKB A;  1H9J A;  1Q8K A;  1N36 L;  3T1Y Q;  2KVM A;  5EPJ A;  3OMC A;  4X62 Q;  5FJ8 G;  1VQE A;  3VR6 A;  3NBH B;  2Z9H A;  5M5X B;  2BDO A;  1YHQ A;  4J15 A;  1O7Z A;  3G7L A;  5E3F A;  1XNR Q;  1CA5 A;  5KEE A;  1KQS A;  1TR5 A;  1MSH A;  3DEP A;  4MZ9 A;  4HJ7 A;  1HPC A;  5M5Y B;  4QY7 A;  3ND9 A;  1E2Z A;  2Z4H A;  3PUX A;  1F2L A;  1N36 Q;  1XTC D;  1RDP D;  2QCP X;  1KC8 C;  4R8I A;  3I55 A;  2F4V L;  4NXM L;  2A69 D;  1O7Y A;  3RZO B;  1CI3 M;  5DM6 3;  3MXU A;  3MVV A;  4YCW A;  4LFB L;  2EY5 A;  4IOA A;  4GNX C;  2B2U C;  3E0E A;  5NUC A;  1IW7 D;  1TWF B;  3PUY A;  4HN7 A;  5FLM G;  4HJ8 A;  2ZXP A;  4WJ3 M;  5EKL A;  1CTM A;  3CW2 C;  4PMC A;  2YU9 H;  2ID0 A;  5C44 H;  2F3V A;  3TS2 A;  4HID A;  2WAQ E;  2UUA Q;  3I72 A;  1Y1W G;  4J6H A;  1GUG A;  2BH8 A;  2F4I A;  3KJP A;  4A3J G;  4H7B A;  1MJC A;  2XVS A;  3VR4 A;  1X54 A;  3K81 C;  5I6Y A;  1SEB D;  3HKZ G;  2WAQ B;  1JWS D;  5FO7 B;  2E2I H;  2YU9 B;  3NEN A;  3I4N B;  2NVQ H;  4GKJ Q;  4B3T L;  3ULP A;  4ULL A;  4LFB Q;  5C0X J;  1VQF A;  4A93 G;  4CBV A;  3R93 A;  1MSG A;  3ITP A;  4LF6 L;  2EY6 A;  4FP5 D;  1STH A;  1QG7 A;  4OO1 H;  3EJI A;  1UNS A;  1YJW A;  2N88 A;  3A5Z B;  3U58 A;  5FLX c;  4R4I A;  2EYL A;  1FNU A;  5IYD G;  4B3R Q;  3PUW A;  3ND8 A;  3HFZ B;  3MXP A;  4CHT B;  3HOY H;  2X69 A;  1C8C A;  3V96 A;  1ZKO A;  3MTS A;  3S1Q H;  2CQA A;  4DR3 Q;  3HOV B;  4I65 A;  5JPM C;  3HRZ C;  3D8G A;  4RG1 A;  3OW2 A;  3NSW A;  3HOX H;  2K75 A;  3KUP A;  3K8A A;  1I3Q B;  2B2Y C;  4CDE C;  1TWA B;  4MTK A;  4V0B A;  1UEA B;  3CQZ B;  4DR5 Q;  1BO0 A;  1PHJ A;  2IPK D;  1YHA A;  3K7A B;  4RA8 A;  4ZUI A;  3Q23 A;  3FVQ A;  3I4M B;  3KLS X;  2JA6 H;  3CME A;  2M00 A;  1X6O A;  2I5H A;  4LF9 L;  3BDC A;  1M1K C;  2DN8 A;  2IT1 A;  1KAB A;  5C4H A;  1HZA A;  3CC4 A;  2B2T C;  4F88 A;  5IP7 G;  1J6Q A;  1QZG A;  1SJE D;  4RGO S;  4KY7 A;  1EQV A;  2EYP A;  2TMP A;  1SNC A;  2B63 B;  3S1M H;  4IN3 A;  4DV5 L;  2HIV A;  4A3E G;  2B63 H;  1O80 A;  1Z7T A;  4CDD C;  1WTW A;  2ICE C;  1ENA A;  3S2D B;  4A3I G;  4C1N I;  4BBS B;  2EYH A;  4GNX B;  5D3I B;  4BY1 H;  4QF4 A;  2OTL A;  2ZTE A;  4ZAI A;  4DF7 A;  3CD6 A;  2A6E D;  1IYU A;  4JCV E;  2A74 C;  1DZ1 A;  1EYG A;  2AUK A;  4JC0 A;  4DAV A;  1PH3 A;  4YWM A;  3VR2 A;  3CP0 A;  1HNZ L;  3OPO A;  2XSC A;  1GM5 A;  1BOS A;  4DR5 L;  1JCK B;  2B29 A;  1EU4 A;  1KDC A;  3K0Y A;  1RL2 A;  1JOR A;  5DEH A;  1LV9 A;  1NR4 A;  3M7N A;  2F3W A;  1RD9 D;  2I46 A;  1YEZ A;  4IJH A;  1Y1W B;  4X66 L;  5LMN L;  3A8I E;  1I4Q A;  2XNA C;  3T51 B;  4TVA B;  5LMN Q;  3PUV A;  4PQX A;  3H3V H;  3X3M A;  1SSO A;  5JEA J;  3MEF A;  2KCT A;  2MFI A;  3G4S A;  3RLO A;  2VB2 X;  4DR6 L;  1DOK A;  2LSS A;  3T1Y L;  1C48 A;  2YV5 A;  4OWW B;  1EY0 A;  1TWA H;  4ABN A;  4YCV A;  2K33 A;  4B3M Q;  1MKH A;  4ME3 A;  2CH4 A;  1W2B A;  3ERS X;  1XYI A;  4DUZ L;  3FMC A;  4L8J A;  2WKD A;  3J7A F;  1AW7 A;  1Q8I A;  1XTD A;  1W6K A;  5EJW A;  1LAB A;  1K8A C;  3M7G A;  4DR4 L;  3J81 E;  3NTH A;  1VQD A;  1GHK A;  3BYT B;  2F0N A;  1J9O A;  4HSP A;  2WB1 B;  2UXB L;  2CH4 W;  3AMU A;  3SE0 A;  4DV7 L;  4A3B H;  2JQO A;  5IGE A;  1EEF D;  2L9H A;  2F0S A;  1HNW L;  4M1U B;  3M3Y B;  5C4X B;  1BBX C;  3OWF A;  3ZJY C;  2MUY A;  1TS3 A;  2MJ8 A;  4C3I G;  4B9W A;  4LF4 Q;  3J80 E;  1SE2 A;  3S1N B;  3UDI A;  4LNQ A;  2K7V A;  1EYD A;  1I6H B;  2K14 A;  2L15 A;  5D65 A;  5C44 G;  2NVY B;  1E22 A;  2PW5 A;  4NB3 A;  2LS0 1;  1Y14 B;  2MHV A;  2A8V A;  4UY8 C;  2QDB A;  4JI2 Q;  1CT1 D;  5A35 A;  1EUJ A;  3HOU H;  5I2Y A;  4AQY Q;  4N8F A;  4OGQ C;  4ILW A;  2R7Z G;  2PW7 A;  5KNB A;  2H1E A;  1XMQ Q;  1C9O A;  3D4R A;  1PZI D;  2LKV A;  4K8J A;  2J7Z A;  1K73 C;  2A69 C;  1YI2 A;  2PZU A;  4ZCK A;  1SE8 A;  2F0H A;  4LJZ C;  4K5W A;  3UE0 A;  4A75 A;  1PXU A;  4A3G H;  4KHP Q;  4NKL A;  2QA4 A;  3A0J A;  3T1H L;  2NVQ B;  2K04 A;  5EPK A;  1F9Q A;  3PUZ A;  3K57 A;  1K0S A;  1TWH B;  4H0L C;  4DV7 Q;  2ZJQ A;  2RHS B;  5FLM H;  1JQY D;  4OIK A;  3Q24 A;  5M3M H;  4RMF A;  2R61 A;  1VS0 A;  3T13 A;  3HOU B;  3K6O A;  2M2L A;  4OX9 Q;  1CKN B;  5K36 G;  4DAY B;  2CHB D;  2F0E A;  3T4A C;  3H6M A;  4FYD A;  1KHI A;  5ELF A;  3R2T A;  4HIK A;  3KFU A;  2D0P A;  2NVY H;  2LXK A;  4KTA A;  1H9S B;  1KDB A;  1Q1E A;  2WFW A;  4JV5 Q;  4B3M L;  5HGQ A;  5LMN W;  1HZC A;  5D3D A;  4BS9 A;  5CBA E;  4C56 C;  1SXT A;  3WWV A;  1CKN A;  1C4Q A;  3J7A V;  3P7J A;  2AQ2 B;  3FHW A;  3CRL C;  1HFG A;  2A5H A;  4C1N K;  1DYQ A;  4JK1 C;  5LMU Q;  1RIP A;  4AQY L;  1TY2 A;  1HNX Q;  5EQ0 A;  3K0X A;  3K5N A;  5J39 A;  1E24 A;  3NQT A;  3KDF A;  1YIT A;  1NUC A;  2Q2I A;  4RKL A;  1OO9 B;  4JI3 Q;  4JOI C;  3FDT A;  3VR5 A;  3F2U A;  3NE5 B;  3TP8 A;  3JAM L;  2AHO B;  5IYC H;  4DR2 Q;  1L1O A;  3F2B A;  4O1N A;  4JBM A;  1X3E A;  2EY1 A;  1IBL L;  2K5V A;  1PRT C;  4A3I H;  1AE2 A;  3HEJ A;  2R93 G;  1BCP F;  2BE5 C;  1HNZ Q;  4LF4 L;  4A3D G;  1VQO A;  3SK8 A;  2WKC A;  4JI0 L;  3K80 C;  5T1G A;  4I7A A;  5IIF A;  1EZ8 A;  1PA6 A;  1HNW Q;  1N32 L;  1PTO F;  4P75 A;  2EYF A;  4XT3 B;  2G9D A;  2KEC A;  2E75 C;  2Q2H A;  3D0F A;  2JA5 B;  4OO1 G;  2A6E C;  2O2L D;  1L1O C;  2JA7 H;  5EAY A;  3QJY A;  3RN2 A;  1PLF A;  3SR1 A;  2R92 G;  1LTS D;  1B2T A;  1OXV A;  3A8K E;  4GLV B;  1GXD C;  1TS2 A;  5BR8 L;  3KBX A;  4IFD G;  1ZYR D;  2NUC A;  2RHQ B;  1U4R A;  1UAP A;  1NE3 A;  4X64 L;  1EIG A;  1NMF A;  4CJ2 C;  3DXJ C;  1AFP A;  4RH6 A;  3FPU B;  1JWM D;  1LTG D;  4UPA A;  4LUO A;  1XPR A;  1HH2 P;  2L11 A;  1A3T A;  4XYQ A;  1VQ7 A;  2JA8 B;  3BDL A;  3AFQ A;  2ZJP A;  2B2Y A;  2O4X A;  1KNE A;  2DJF C;  1YZ6 A;  2XWB B;  1QZH A;  1QUQ A;  3NUC A;  1SYC A;  4JBJ A;  2HCC A;  4DR3 L;  2RCN A;  4C3J B;  2NVT H;  2N78 A;  4UP7 A;  4H44 C;  5IP9 G;  1W3S A;  1KRS A;  1CA6 A;  2DNE A;  1YJN A;  4IQZ A;  3D4D A;  1LT3 D;  4DAY A;  3SDZ A;  2I5L X;  4BBR H;  5JVG 3;  3ONA B;  1LTI D;  4O0A A;  1HA5 A;  3RUZ A;  3I2Z A;  3U9O A;  3SVM A;  4M8A A;  4DV0 L;  5C4J B;  2EIF A;  4LFA L;  3LWU A;  2XIW A;  3F2C A;  5JJI A;  4IUP A;  4DV0 Q;  2O5J C;  5EKI A;  1EYC A;  2ZM6 L;  1OXU A;  1TWG B;  2Q2U A;  1TKW B;  3R8B A;  1HFN A;  5K5P A;  1CUK A;  2K03 A;  1YNX A;  4C3H B;  1CZG A;  4N9T A;  2SDF A;  4ZKB B;  1LM0 A;  2AQ1 B;  3VA5 A;  1IW7 C;  4KJN A;  2SOB A;  3QB3 A;  2NYZ D;  4LF5 Q;  1FJG Q;  3K5L A;  2ES2 A;  2PI2 A;  3HOY B;  3OIQ A;  2BA0 A;  3ICE A;  3OSO A;  3EFX D;  1I6H H;  4MHE A;  1EY6 A;  2ALY B;  1DXM A;  2IWH A;  4Y7N B;  3MAQ A;  1Q7Y C;  4K0K L;  3M4O B;  2HCI A;  5GAH C;  4DK1 A;  4KK7 A;  4K5X A;  1JE5 A;  5KRU A;  3L0O A;  2E8G A;  3HOW B;  1XMO L;  4IJL A;  3TZD A;  3AQQ A;  2PCF B;  3HOZ G;  1R9T B;  3ULL A;  2AUJ D;  2D2C C;  4RFB A;  1OTC A;  1K28 A;  2FMM A;  1I4H A;  3HOX G;  1KXL A;  2PYK A;  1G6P A;  3AEV A;  3S14 H;  1KL9 A;  1EIH A;  1VCI A;  4FNF A;  1PYB A;  1V1P B;  4L5Q A;  1FJG L;  1PFB A;  1NBW A;  1NR2 A;  2B2W A;  4HJA A;  2R92 B;  3TN2 A;  2VUM B;  2DUD A;  2UUB Q;  2RDF A;  3FRP B;  3B6Y A;  4LUV A;  2EYJ A;  2F0O A;  2CWP A;  1PH6 A;  2R6G A;  1FD7 D;  3KJO A;  3NEM A;  4XTC S;  1F9S A;  3CCE A;  4OON A;  1KIX A;  1WTX A;  1H9R A;  1Y8N B;  3IRB A;  1K8O A;  1XPO A;  4AYB B;  3H0G G;  1STN A;  1V9P A;  2XWJ B;  2K6A A;  1I4G A;  5IWA L;  2R93 B;  4WRD A;  3DEO A;  4OEM B;  3LWE A;  4QJF A;  1S5B D;  4G7Z C;  1QVC A;  1B3A A;  2KEN A;  3I3C A;  4AH6 A;  3BU2 A;  5I9P A;  4AYB E;  2K5H A;  3GTK B;  1GHJ A;  4POF A;  5KIX A;  1EY9 A;  4DV4 Q;  3OWE B;  2NTT A;  2EXD A;  3KLR A;  2PQE A;  5C0X H;  3S14 B;  3TRE A;  3CC2 A;  1IHZ A;  3PO2 B;  1F2M A;  4PMB A;  4X65 L;  2K52 A;  4HED A;  1HJP A;  1R9T H;  4JG2 A;  4OO1 I;  4UDU C;  1VQ4 A;  1FGB D;  4DV2 Q;  2O5I C;  3GO5 A;  2NTS A;  4ME5 A;  2WV6 D;  1WVL A;  3HOU G;  3CMA A;  4DR7 L;  3IL8 A;  1Q82 C;  3UE1 A;  3IAY A;  1MJE A;  2G5D A;  1PVO A;  1STA A;  2RBM A;  2NZ1 D;  2BOS A;  1KDA A;  2ZTC A;  3GD7 A;  4YWK A;  3CCJ A;  4LF7 Q;  4ZRZ A;  1PTO H;  4GOP A;  1CKM A;  5M9O A;  1S3O A;  1WCM G;  5FOB B;  1A8V A;  4KKT A;  2WAQ G;  2R3Z A;  3NTI A;  4EQ5 A;  1ONL A;  4F87 A;  2F0P A;  4XQJ A;  1WD0 A;  2EJM A;  2FHT A;  2B2T A;  4K5V A;  2FJ2 A;  3OYY A;  4JI6 Q;  1NCV A;  3CQZ H;  1M90 C;  3E9I A;  1TVX A;  4DGZ A;  3T1H Q;  1E1O A;  1VQJ A;  3X3N A;  2KHJ A;  4JW0 A;  2NVX H;  1D5M C;  4A3K B;  1A3U A;  1ESF A;  1JR0 D;  2F0U A;  2AQ3 B;  2L12 A;  1L0X B;  4LWC A;  1G2S A;  3QWN A;  1I94 L;  2YYZ A;  1PRT B;  5IP9 H;  3VYT A;  1QIL A;  2KOL A;  1D6E C;  5CV9 A;  1J5E L;  4BXX H;  4C2M H;  4RHS A;  2RSO A;  4C3I B;  3K5M A;  3S1M B;  1QCB D;  4TKO B;  4N9P A;  4P2C B;  5IGC A;  3MC0 B;  5JEA G;  5JAV A;  2X6L A;  3C1F A;  3BJU A;  3CCQ A;  1L1O B;  2JXM B;  5M3F B;  3BZC A;  1H9K A;  3GQB A;  4FVM A;  2WB1 G;  4Y52 H;  3NQI A;  3MFY A;  3W3A A;  3QR8 A;  3K7A H;  3A5U A;  2VQE Q;  5CMD A;  2UUC Q;  1SYB A;  1S5F D;  1U9R A;  3S2D H;  3PO2 H;  5ISR A;  3H91 A;  1Y69 U;  3S2H B;  1I3Q H;  3CCL A;  2EDG A;  3M4Y A;  4GN5 A;  1BUV T;  3Q22 A;  1LT4 D;  3E5S A;  2DY7 A;  3STB D;  4DV1 L;  3QG1 A;  4R4Q A;  4B08 A;  3SHL A;  2HQL A;  1SFO B;  2MGS A;  1DD2 A;  4A3D H;  1IKM A;  1X56 A;  3T53 B;  4ZUJ A;  1X3F A;  2RKS A;  4JYA Q;  4RGM A;  3MEH A;  5E7N A;  4QQB X;  5CV8 A;  4L63 B;  2OEO A;  2AMC B;  2D0O A;  1SDF A;  3I90 A;  3TRZ A;  4MIU A;  3U9S A;  2OF1 A;  1VQM A;  5CV6 A;  2KCN A;  4YWL A;  4JI0 Q;  1CZW A;  1I4R A;  2P5Z X;  1N33 L;  1UWV A;  4MN3 A;  1HQR D;  4FF4 A;  4R8N A;  2CW0 D;  3F2D A;  2F0J A;  1LO5 D;  4NXN L;  3I4L A;  1PTO D;  4IPC A;  3U4Z A;  1NSN S;  4DNT B;  5E4W C;  4DR2 L;  1JOO A;  2Q2T A;  1LLR D;  2D9U A;  4A3K G;  4JBK A;  2E2J H;  1S5C D;  1A2U A;  4GLA C;  3CCV A;  1D2B A;  2B2V A;  3K58 A;  2QIL A;  1H9S A;  1A63 A;  5G3L D;  3DUZ A;  4JI5 Q;  3OHX C;  4RGT A;  1HHV A;  3T16 A;  3MHB A;  3GTJ B;  1G8Z D;  4A3K H;  4L5T A;  3BS1 A;  2VQE L;  1WD1 A;  4UP8 A;  4GKK L;  5IYB G;  4HCE A;  1STB A;  4A3I B;  4BA2 I;  3GV3 A;  3PF4 A;  4DNR B;  4DV2 L;  1WCM B;  3NEL A;  1QVF A;  4R4O A;  4A3E B;  1PMR A;  3RZD H;  1SYE A;  3GTO H;  2AKW B;  4JV5 L;  2EPB A;  2K50 A;  4IUN A;  5BR8 Q;  1II3 A;  1PZJ D;  4K8I A;  2ENB A;  4P74 A;  1EY5 A;  5IYD H;  2PI2 E;  3BDO A;  3CPF A;  5C0X G;  1X3G A;  2VY3 A;  5HY6 A;  1PYW D;  3BZK A;  1PTO B;  5J3B A;  1GVP A;  5A2Q E;  3KLS A;  2KCM A;  2UXB Q;  2DNC A;  1AP0 A;  2Q8T A;  1TWF H;  4BWG B;  5IP7 H;  1JIC A;  3S1Q B;  3KF6 B;  1DON A;  5KNC A;  2CQO A;  4BBR G;  4JI4 L;  4ZLT F;  1BQQ T;  1VQA A;  4JI7 L;  5C4J H;  1PH4 A;  4FXD A;  2A73 B;  4KHP L;  2VZA A;  4QUC A;  1S40 A;  1TY0 A;  1ZEQ X;  1VQN A;  5M5Y H;  5AFW A;  1B9M A;  5JJK A;  4PZ6 A;  1JE4 A;  3CF5 A;  5KGU A;  2RA4 A;  4XQN A;  4XT1 B;  3G71 A;  2Y0S E;  2MO1 A;  4AIM A;  3A56 A;  1SMY C;  2EVB A;  2EZV A;  4A3F H;  2F0D A;  1ICF B;  1OXT A;  3I56 A;  4FXG C;  1M8A A;  1EWH A;  2Z1C A;  2NWG A;  1IKL A;  2XGT A;  1RTO A;  3BYY B;  4CDF C;  1D5X C;  4DR1 L;  1B9N A;  1HNX L;  1E2W A;  3HS0 C;  1T5X D;  5JJZ A;  2OXP A;  1BVS A;  3S1R H;  4K14 A;  4YIJ A;  1SN8 A;  4IFD H;  2CWA A;  1YNJ D;  4V19 0;  1P16 A;  2N55 A;  1ET9 A;  3TSS A;  5IY0 A;  1Z47 A;  2B2W C;  2JP1 A;  1YNN C;  3D31 A;  4A3C G;  2E2H B;  2IX0 A;  2GA4 B;  4RCO A;  5M3F G;  1MBY A;  3EBE A;  5C4X G;  4X65 Q;  2GN5 A;  1LYL A;  4Y7N H;  4CDC C;  4YHH Q;  3DWQ A;  5H1S E;  4QGU A;  3HOZ H;  5JEA H;  4XXE A;  3IFD A;  5CBE E;  2C5C A;  3DM3 A;  2GVA A;  3GTJ H;  2VUM H;  5C3X A;  3QO2 A;  1M4V A;  5FKA C;  2EE1 A;  1RF2 D;  2K05 A;  3EN2 A;  1PRT F;  4DV5 Q;  3J81 c;  5EBC A;  2FMC A;  3F1Z A;  1VQB A;  1F77 A;  2KHS A;  1SYG A;  2PZW A;  3JAM E;  1ZXT A;  3ER0 A;  2SNS A;  1V1P A;  1I50 B;  3I91 A;  5CV5 A;  3U4V A;  2WIN B;  3M85 A;  1WI5 A;  2A68 C;  3DWA A;  3PIP 3;  1B50 A;  4A3M G;  2DJG C;  4LUZ A;  1PV4 A;  2EJG C;  4NXM Q;  1Y1V B;  4UAI A;  2QGQ A;  3T56 B;  5AJ3 L;  3R3O A;  1ZYR C;  4JI3 L;  1L2F A;  2A19 A;  2KBN A;  1JB7 A;  1QNK A; 
#chains in the Genus database with same CATH homology
 1HQM C;  1BF4 A;  3NBH A;  2ZT9 C;  3H3V C;  2F0L A;  2JEA I;  1GUS A;  4KMU C;  5COR A;  1TWC B;  3A7L A;  1HTP A;  1BCP B;  1XXG A;  5M5W B;  3GTP B;  2F0V A;  4LAA A;  4I7Z C;  5JPN C;  1CHQ D;  3H94 A;  5FK9 C;  1S4Z A;  3SEB A;  5CYU A;  1HA6 A;  5JVH 3;  1JB3 A;  1QE6 A;  1SNQ A;  4CKB A;  1KLG D;  4HCS A;  4FXK C;  4FF3 A;  2EXZ A;  5IOC A;  5DAU A;  4WOR A;  3TME A;  3P75 A;  4IUT A;  3CHB D;  3P20 A;  2NVX B;  5ELE A;  3GTM B;  1KLU D;  1BR9 A;  1EQT A;  5KND A;  4QIW B;  4Q0F A;  3SXH A;  1OXS C;  2QKI C;  2C9O A;  3A8J E;  4RCN A;  3QOJ A;  2G9H D;  1ILP A;  1D1I A;  5TSS A;  2HDL A;  5I6W A;  2L55 A;  4BY1 B;  2EY2 A;  4DAP A;  4EQN A;  4GZY C;  1X32 A;  1CM9 A;  1SBB B;  5IGF A;  1F9P A;  5CV4 A;  4G7H C;  3HZX A;  1VMP A;  3C1E A;  4ZYS A;  3FKI B;  4CKE A;  4HMI A;  3GP7 A;  1YNJ C;  2JA6 B;  4Q5V A;  3KBG A;  2K5Q A;  3MFG A;  4J1M A;  1E2V A;  1GOZ A;  1BDO A;  5BN5 A;  3HKZ B;  2F0F A;  1X3P A;  4F8M A;  3E0J A;  4A3F B;  1Q90 A;  4IZ8 A;  2IW3 A;  1A6X A;  1AEX A;  5E1F A;  3WDN A;  4K2L A;  4PV1 C;  3MA2 B;  3N52 A;  2RSN A;  2EYO A;  5K36 H;  3SK5 A;  3RD4 A;  4DA2 A;  4KKU A;  1PTO C;  3OIP A;  1Y8O B;  1ILQ A;  1QJO A;  2A6H C;  3AU7 A;  3KK7 A;  2WAC A;  4OL7 A;  3VA7 A;  2PPB C;  4PNY A;  4XYO A;  2RDG A;  2Q8R E;  3D4W A;  2KUM A;  3EQL C;  3I8Z A;  3PMF A;  4RGN A;  5C3W A;  1LTB D;  1KTK A;  4ID6 A;  3DHQ A;  1VMC A;  1CFM A;  1AZP A;  4IUV A;  1KAA A;  3OMG A;  4XIG S;  5DM7 3;  1B1Z A;  3D6C A;  5C44 B;  1ICW A;  2PNR C;  1HCZ A;  4C3J G;  3Q0A A;  1MI2 A;  4DXG A;  3ZYY X;  2E2D C;  4LK1 C;  3NK9 A;  4KN7 C;  1V8Q A;  1CK1 A;  4G4K A;  3VR3 A;  2PMZ B;  1HUN A;  4TQU S;  2LY7 A;  5C4Z A;  1AZQ A;  2BA1 A;  3BVZ A;  3NHH A;  4KJO A;  3GTO B;  1GUT A;  1MD2 D;  4FO2 A;  1A2T A;  4OHJ A;  1NAP A;  2K28 A;  4CKC A;  4A3M B;  2MPM A;  3HGB A;  2X6G A;  4HTH A;  1FYC A;  1EY8 A;  2SNM A;  2NB0 A;  3OW7 A;  5KYI A;  3BVG A;  2CW0 C;  2J4X A;  4FF2 A;  5IT9 L;  1GUO A;  1SAP A;  2FIN B;  2AWN A;  1R4Q B;  4E6I A;  1WTV A;  4LMQ D;  3Q6S A;  5EKK A;  3RLF A;  5ELC A;  5C6A A;  3A54 A;  3A55 A;  1ROD A;  1Q12 A;  1H9M A;  4ZKC B;  1TS4 A;  1FNW A;  3A7A B;  1EU3 A;  1BCP C;  1TQO A;  4KI0 A;  1HXY D;  4WJW A;  3MZ5 A;  3H0G B;  1W6J A;  1FNV A;  4JBW A;  1D5Z C;  3NXW A;  1K83 B;  1JOQ A;  2F03 A;  2JE6 I;  2JEB I;  2PZT A;  1QWY A;  4ZQ3 A;  1LT5 D;  1RJT A;  1S5D D;  1ENC A;  2L4N A;  2B2V C;  4PMW A;  1STE A;  2FFK B;  4IUU A;  2F0G A;  5FO9 B;  1BXT A;  5FLX L;  3HOX B;  3E6Z X;  2BCO A;  2TSS A;  2E2I B;  1JWU D;  3HOZ B;  1EWC A;  1HTL D;  5LL6 X;  4R9W A;  3NPP A;  4IFD I;  1GJX A;  3LX0 A;  3CKI B;  2K01 A;  4A93 B;  5DNF A;  3QOL A;  2L5T A;  1LT6 D;  2ZXO A;  3K59 A;  4RAU C;  2A6H D;  4RHR A;  3NTK A;  3G6J B;  3S16 B;  4K6D A;  4XQQ A;  3TBI B;  2QEJ C;  4XDX A;  2F0K A;  2XN9 C;  4IFD J;  5G3L F;  3VYU A;  1QB5 D;  1B53 A;  5IOD A;  3QIA A;  3NWS A;  3UI2 A;  3HG9 A;  1XWE A;  2MP1 A;  4K2K A;  2F0M A;  3H09 A;  5I2X A;  3L7Z C;  2K5D A;  3TP7 A;  1EFI D;  4KY5 A;  3D6W A;  2D5D A;  4A3J B;  5KYL A;  4A3G B;  1SE4 A;  1FR3 A;  1EY7 A;  1TU2 B;  4EQO A;  1GUN A;  5M3M B;  1A15 A;  4TRD A;  4RKB A;  3IKJ A;  1ET6 A;  5LHY 1;  5IGB A;  5CC4 A;  5IT9 E;  1WTR A;  4O42 A;  3V05 A;  2JSO A;  4KKS A;  2KJX A;  4EGV A;  4DU9 A;  5CGK A;  2Z8L A;  1I6V C;  3MXG A;  5COY A;  1BNZ A;  5J22 A;  4FF1 A;  1VF7 A;  3L9A X;  4ZK9 B;  3WOE A;  3GV6 A;  1QOH A;  3MXN A;  3FEW X;  2HQE A;  3MWY W;  1TS5 A;  1DM0 B;  3BG3 A;  4OIJ A;  5FLX E;  3CRK C;  3KF8 A;  1WTP A;  2IJ0 A;  1PZK D;  2L1B A;  2PO4 A;  3SK6 A;  4DXF A;  4IUQ A;  3GTQ B;  3S17 B;  4NMZ A;  3TZU A;  4BBR B;  1EY4 A;  4C2M B;  1PFN A;  3GTG B;  5F2D A;  1D1K A;  1SYF A;  1RHP A;  4Z9C B;  3DM1 A;  2E2J B;  1V43 A;  2B2U A;  3CU7 A;  4KY6 A;  4HMJ A;  3VYS A;  1IL8 A;  3N6R A;  2EOT A;  3P1H A;  4X3K A;  5HUR A;  2RVL A;  3PIO 3;  5C5L A;  2VNU D;  3EA6 A;  3S1R B;  5JOB A;  1JOK A;  2EYM A;  4A3B B;  2B8G A;  1ML0 D;  2IX1 A;  4B9X A;  1O7L A;  1Y8P B;  1DCZ A;  4U67 3;  2L0C A;  1UUP A;  1PFM A;  2BE5 D;  1YNN D;  1HUM A;  1PRT D;  1RTN A;  1DJR D;  3ERO A;  3SK4 A;  2LFN A;  1BCP D;  1G29 1;  3DWP A;  3J81 L;  2IL8 A;  1X3Q A;  1CHP D;  2KED A;  4KN4 C;  1ESR A;  5C3E B;  5I9O A;  5FO8 B;  1IYV A;  1JC7 A;  2JA7 B;  3S9W A;  4K6L A;  4CJ1 B;  4EVO A;  2ZXR A;  2E74 C;  2XRQ D;  1SMY D;  4NDX A;  2F0I A;  1E0B A;  3J80 L;  2NN6 I;  1VF5 C;  2F0T A;  2VXW A;  4ODG A;  1T5E A;  1XX8 A;  1PDQ A;  1CQV A;  2BDN A;  4IAL A;  1U4L A;  4X3S A;  1AN8 A;  5IGG A;  3PO3 B;  3ERQ A;  2D62 A;  3HP3 A;  4S3S A;  5ELD A;  4X3U A;  3S15 B;  2K5W A;  3WOF A;  3V2T A;  3PV0 A;  2RQX A;  3W2D A;  5E4X A;  3C2P A;  3OOC A;  2ICI A;  4BY7 B;  1SYD A;  2EJF C;  3RZD B;  4NW2 A;  2HUG A;  4KHZ A;  2H4O A;  4BA1 I;  5LL6 S;  3RMH A;  2LMC B;  3BZD B;  1Q3L A;  4HR7 B;  3VYR A;  5C0X I;  1MGS A;  3I73 A;  5EGT A;  1VDZ A;  5J1Z A;  1B44 D;  5D14 A;  2K32 A;  1SND A;  2K1B A;  1KNA A;  2NBF A;  2NN6 G;  2JYO A;  2AWO A;  1GUW A;  4KD4 A;  2Q8I B;  2XRS D;  1LTT D;  1U4M A;  2RDH A;  1SNP A;  4KV6 A;  2KCC A;  1R4P B;  2B8F A;  1J8I A;  2DY8 A;  1F2Z A;  5I4D A;  2HDM A;  1G2T A;  3L3O C;  3NBI A;  4QUF A;  4DN4 M;  1STG A;  4X3T A;  1STY A;  5A2Q L;  1F9R A;  1WTO A;  5IGD A;  4G57 A;  3IFT A;  4G7O C;  1EOT A;  3C3L A;  3AB9 A;  2KQ3 A;  2WP8 J;  3BVM A;  1TII D;  1LTA D;  1QNU A;  2KEE A;  2SEB D;  3R2I A;  4RWS C;  5CR3 A;  1LAC A;  1B4O A;  2KA7 A;  1EEI D;  1TT2 A;  3EVQ A;  4A3D B;  1RCV D;  1SE3 A;  5ELB A;  1LTR D;  1G91 A;  5BN4 A;  1A3V A;  3TP5 A;  1L0Y B;  2IX3 A;  4U68 A;  1V1O A;  5C5M A;  3NP8 A;  1I4X A;  1SJH D;  4J8Q A;  1SNM A;  4NP5 A;  1O78 A;  4CJ0 B;  3D3R A;  3GTL B;  3NWT A;  2Y0S B;  1HRJ A;  4EQP A;  1I4P A;  3O13 A;  1DOL A;  4CGY B;  2F1M A;  2VB3 X;  4TSS A;  1EYA A;  3I70 A;  4QMG A;  1SNO A;  3K5O A;  2NN6 H;  1RKN A;  5EBD A;  1EL0 A;  2QF7 A;  2NVT B;  3TDQ A;  1G6Z A;  4DK0 A;  5BN3 A;  2B39 A;  3LNN A;  3URY A;  2F0Q A;  4C3H G;  2E76 C;  1OXX K;  1ENF A;  2V4D A;  3FPP A;  4DFA A;  4IUR A;  1WTQ A;  1DOM A;  5T1I A;  1U4P A;  2OT2 A;  2M9V A;  4QB4 A;  2Z4I A;  1K8M A;  4HAE A;  5EPL A;  4H13 C;  3J7Y W;  5HGT A;  4WFN 3;  4L6T B;  1EZ6 A;  1Z6H A;  4KD3 A;  2R7Z B;  1Q1B A;  1CQF A;  4KHV A;  2F0W A;  2CVR A;  1F2Y A;  4HSV A;  2J0T D;  3C46 A;  1S5E D;  4QCL A;  4F7X A;  5CV7 A;  2I07 B;  2WII B;  2A68 D;  3DMU A;  3TP6 A;  1H9J A;  2KVM A;  5EPJ A;  3OMC A;  3VR6 A;  5M5X B;  2BDO A;  1O7Z A;  3G7L A;  5E3F A;  1CA5 A;  5KEE A;  1TR5 A;  1MSH A;  3DEP A;  1HPC A;  5M5Y B;  3ND9 A;  1E2Z A;  2Z4H A;  3PUX A;  1F2L A;  1XTC D;  1RDP D;  2QCP X;  4R8I A;  2A69 D;  1O7Y A;  3RZO B;  1CI3 M;  5DM6 3;  3MXU A;  3MVV A;  2EY5 A;  2B2U C;  5NUC A;  1IW7 D;  1TWF B;  3PUY A;  4HN7 A;  2ZXP A;  5EKL A;  1CTM A;  4PMC A;  2ID0 A;  2F3V A;  3I72 A;  4J6H A;  1GUG A;  2F4I A;  4H7B A;  2XVS A;  3VR4 A;  5I6Y A;  1SEB D;  2WAQ B;  1JWS D;  5FO7 B;  2YU9 B;  3I4N B;  4ULL A;  5C0X J;  4CBV A;  3R93 A;  1MSG A;  3ITP A;  2EY6 A;  4FP5 D;  1STH A;  1QG7 A;  4OO1 H;  3EJI A;  1UNS A;  2N88 A;  2EYL A;  1FNU A;  3PUW A;  3ND8 A;  3MXP A;  4CHT B;  2X69 A;  1C8C A;  3V96 A;  1ZKO A;  3MTS A;  2CQA A;  3HOV B;  4I65 A;  5JPM C;  3HRZ C;  3D8G A;  3NSW A;  3KUP A;  1I3Q B;  2B2Y C;  1TWA B;  4V0B A;  1UEA B;  3CQZ B;  1BO0 A;  2IPK D;  3K7A B;  4RA8 A;  4ZUI A;  3Q23 A;  3FVQ A;  3I4M B;  3KLS X;  2M00 A;  3BDC A;  2DN8 A;  2IT1 A;  1KAB A;  5C4H A;  2B2T C;  4F88 A;  1SJE D;  4RGO S;  4KY7 A;  1EQV A;  2EYP A;  2TMP A;  1SNC A;  2B63 B;  4IN3 A;  1O80 A;  1Z7T A;  1WTW A;  2ICE C;  1ENA A;  3S2D B;  4C1N I;  4BBS B;  2EYH A;  5D3I B;  4QF4 A;  4ZAI A;  4DF7 A;  2A6E D;  1IYU A;  2A74 C;  1DZ1 A;  2AUK A;  4DAV A;  3VR2 A;  3OPO A;  2XSC A;  1BOS A;  1JCK B;  3K0Y A;  1EU4 A;  1KDC A;  1JOR A;  5DEH A;  1LV9 A;  1NR4 A;  3M7N A;  2F3W A;  1RD9 D;  2I46 A;  1Y1W B;  3A8I E;  1I4Q A;  2XNA C;  3T51 B;  3PUV A;  4PQX A;  3X3M A;  1SSO A;  5JEA J;  2VB2 X;  1DOK A;  1C48 A;  1EY0 A;  4ABN A;  2K33 A;  1XYI A;  3FMC A;  4L8J A;  2WKD A;  3J7A F;  1AW7 A;  1Q8I A;  1W6K A;  5EJW A;  1LAB A;  3M7G A;  3J81 E;  3NTH A;  1GHK A;  3BYT B;  2F0N A;  1J9O A;  4HSP A;  2WB1 B;  3AMU A;  3SE0 A;  5IGE A;  1EEF D;  2L9H A;  2F0S A;  4M1U B;  3M3Y B;  5C4X B;  1BBX C;  3OWF A;  2MUY A;  1TS3 A;  2MJ8 A;  4C3I G;  4B9W A;  3J80 E;  1SE2 A;  3S1N B;  2K7V A;  1EYD A;  1I6H B;  5D65 A;  2NVY B;  2PW5 A;  2LS0 1;  2MHV A;  2QDB A;  1CT1 D;  5A35 A;  5I2Y A;  4OGQ C;  4ILW A;  2PW7 A;  5KNB A;  2H1E A;  3D4R A;  1PZI D;  2LKV A;  4K8J A;  2J7Z A;  2A69 C;  2PZU A;  2F0H A;  4LJZ C;  4K5W A;  1PXU A;  4NKL A;  2NVQ B;  2K04 A;  5EPK A;  1F9Q A;  3PUZ A;  3K57 A;  1TWH B;  4H0L C;  1JQY D;  4OIK A;  3Q24 A;  2R61 A;  3T13 A;  3HOU B;  3K6O A;  2M2L A;  5K36 G;  2CHB D;  2F0E A;  3T4A C;  3H6M A;  4FYD A;  5ELF A;  3R2T A;  4KTA A;  1H9S B;  1KDB A;  1Q1E A;  5D3D A;  4BS9 A;  5CBA E;  4C56 C;  1SXT A;  1C4Q A;  3J7A V;  3P7J A;  2AQ2 B;  3CRL C;  1HFG A;  2A5H A;  4C1N K;  1DYQ A;  4JK1 C;  1TY2 A;  5EQ0 A;  3K5N A;  5J39 A;  3NQT A;  1NUC A;  4RKL A;  1OO9 B;  3FDT A;  3VR5 A;  3F2U A;  3NE5 B;  3TP8 A;  3JAM L;  4O1N A;  2EY1 A;  1PRT C;  3HEJ A;  1BCP F;  2BE5 C;  3SK8 A;  2WKC A;  5T1G A;  5IIF A;  1EZ8 A;  1PTO F;  2EYF A;  4XT3 B;  2G9D A;  2KEC A;  2E75 C;  2JA5 B;  4OO1 G;  2A6E C;  2O2L D;  3QJY A;  1PLF A;  3SR1 A;  1B2T A;  1LTS D;  1OXV A;  3A8K E;  1GXD C;  1TS2 A;  4IFD G;  3KBX A;  1ZYR D;  2NUC A;  1U4R A;  1UAP A;  1EIG A;  4CJ2 C;  3DXJ C;  1AFP A;  4RH6 A;  3FPU B;  1JWM D;  1LTG D;  2L11 A;  1A3T A;  4XYQ A;  2JA8 B;  3BDL A;  2B2Y A;  2O4X A;  1KNE A;  2XWB B;  3NUC A;  1SYC A;  2HCC A;  4C3J B;  4H44 C;  1CA6 A;  2DNE A;  4IQZ A;  3D4D A;  1LT3 D;  4DAY A;  3SDZ A;  5JVG 3;  3ONA B;  1LTI D;  1HA5 A;  3RUZ A;  3U9O A;  3SVM A;  4M8A A;  5C4J B;  3LWU A;  2XIW A;  4IUP A;  2O5J C;  5EKI A;  1EYC A;  1OXU A;  1TWG B;  1TKW B;  3R8B A;  1HFN A;  5K5P A;  2K03 A;  4C3H B;  1CZG A;  4N9T A;  2SDF A;  4ZKB B;  2AQ1 B;  3VA5 A;  1IW7 C;  4KJN A;  2SOB A;  3QB3 A;  2NYZ D;  3K5L A;  3HOY B;  3OIQ A;  2BA0 A;  3OSO A;  3EFX D;  4MHE A;  1EY6 A;  1DXM A;  2IWH A;  4Y7N B;  3MAQ A;  3M4O B;  2HCI A;  4DK1 A;  4KK7 A;  4K5X A;  5KRU A;  3HOW B;  3TZD A;  2PCF B;  1R9T B;  2AUJ D;  2D2C C;  4RFB A;  2FMM A;  1I4H A;  2PYK A;  1EIH A;  1VCI A;  4FNF A;  1V1P B;  1PFB A;  1NR2 A;  2R92 B;  2B2W A;  3TN2 A;  2VUM B;  2RDF A;  3FRP B;  2EYJ A;  2F0O A;  2R6G A;  1FD7 D;  4XTC S;  1F9S A;  1WTX A;  1H9R A;  1Y8N B;  1K8O A;  4AYB B;  1STN A;  2XWJ B;  2K6A A;  1I4G A;  2R93 B;  4WRD A;  3DEO A;  3LWE A;  1S5B D;  4G7Z C;  1B3A A;  3I3C A;  5I9P A;  3GTK B;  1GHJ A;  5KIX A;  1EY9 A;  3OWE B;  2NTT A;  3S14 B;  3KLR A;  2PQE A;  5C0X H;  1IHZ A;  3PO2 B;  1F2M A;  4PMB A;  4HED A;  4OO1 I;  4UDU C;  1FGB D;  2O5I C;  3GO5 A;  2NTS A;  4ME5 A;  2WV6 D;  1WVL A;  3IL8 A;  3IAY A;  1STA A;  2RBM A;  2NZ1 D;  2BOS A;  1KDA A;  3GD7 A;  4ZRZ A;  1PTO H;  5M9O A;  5FOB B;  4KKT A;  2R3Z A;  3NTI A;  4F87 A;  1ONL A;  2F0P A;  4XQJ A;  1WD0 A;  2EJM A;  2FHT A;  2B2T A;  4K5V A;  2FJ2 A;  1NCV A;  1TVX A;  4DGZ A;  3X3N A;  1D5M C;  4A3K B;  1A3U A;  1ESF A;  1JR0 D;  2F0U A;  2AQ3 B;  2L12 A;  1L0X B;  1G2S A;  3QWN A;  2YYZ A;  1PRT B;  3VYT A;  1QIL A;  2KOL A;  1D6E C;  5CV9 A;  4RHS A;  2RSO A;  4C3I B;  3K5M A;  3S1M B;  1QCB D;  4TKO B;  4N9P A;  4P2C B;  5IGC A;  3MC0 B;  5JEA G;  5JAV A;  2X6L A;  3C1F A;  2JXM B;  5M3F B;  1H9K A;  3GQB A;  4FVM A;  3NQI A;  3MFY A;  3W3A A;  5CMD A;  1SYB A;  1S5F D;  1U9R A;  5ISR A;  3H91 A;  1Y69 U;  3S2H B;  2EDG A;  3M4Y A;  1BUV T;  3Q22 A;  1LT4 D;  3E5S A;  2DY7 A;  3QG1 A;  4B08 A;  3SHL A;  1SFO B;  2MGS A;  1DD2 A;  1IKM A;  3T53 B;  4ZUJ A;  2RKS A;  4RGM A;  3MEH A;  5CV8 A;  4L63 B;  2OEO A;  1SDF A;  3I90 A;  4MIU A;  3U9S A;  2OF1 A;  5CV6 A;  2KCN A;  1CZW A;  1I4R A;  4MN3 A;  1HQR D;  4FF4 A;  4R8N A;  2CW0 D;  2F0J A;  1LO5 D;  3I4L A;  1PTO D;  1NSN S;  4DNT B;  5E4W C;  1JOO A;  1LLR D;  2D9U A;  1S5C D;  1A2U A;  1D2B A;  2B2V A;  3K58 A;  2QIL A;  1H9S A;  5G3L D;  3DUZ A;  3OHX C;  4RGT A;  1HHV A;  3T16 A;  3MHB A;  3GTJ B;  1G8Z D;  3BS1 A;  1WD1 A;  4HCE A;  1STB A;  4A3I B;  4BA2 I;  3GV3 A;  4DNR B;  1WCM B;  4A3E B;  1PMR A;  1SYE A;  2EPB A;  4IUN A;  1II3 A;  1PZJ D;  4K8I A;  2ENB A;  1EY5 A;  3BDO A;  5C0X G;  1PYW D;  1PTO B;  5A2Q E;  3KLS A;  2DNC A;  1AP0 A;  2Q8T A;  4BWG B;  3S1Q B;  1JIC A;  1DON A;  5KNC A;  4ZLT F;  1BQQ T;  4FXD A;  2A73 B;  4QUC A;  1TY0 A;  1ZEQ X;  5AFW A;  1B9M A;  1JE4 A;  5KGU A;  2RA4 A;  4XQN A;  4XT1 B;  3A56 A;  1SMY C;  2EVB A;  2EZV A;  2F0D A;  1OXT A;  4FXG C;  1M8A A;  1EWH A;  2Z1C A;  2NWG A;  1IKL A;  3BYY B;  1RTO A;  1D5X C;  1B9N A;  1E2W A;  3HS0 C;  1T5X D;  5JJZ A;  2OXP A;  4K14 A;  4YIJ A;  4IFD H;  1YNJ D;  4V19 0;  2N55 A;  1ET9 A;  3TSS A;  1Z47 A;  2B2W C;  2JP1 A;  1YNN C;  3D31 A;  2E2H B;  2IX0 A;  2GA4 B;  4RCO A;  1MBY A;  3DWQ A;  5JEA H;  4XXE A;  3IFD A;  5CBE E;  2C5C A;  5C3X A;  3QO2 A;  1M4V A;  5FKA C;  2EE1 A;  1RF2 D;  2K05 A;  1PRT F;  5EBC A;  2FMC A;  1F77 A;  2KHS A;  1SYG A;  2PZW A;  3JAM E;  1ZXT A;  2SNS A;  1V1P A;  1I50 B;  3I91 A;  5CV5 A;  2WIN B;  3M85 A;  2A68 C;  3DWA A;  3PIP 3;  1B50 A;  2EJG C;  1Y1V B;  4UAI A;  3T56 B;  3R3O A;  1ZYR C;  1QNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...