4R9WA

Crystal structure of platelet factor 4 complexed with fondaparinux
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
LQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Platelet factor 4
publication title Atomic description of the immune complex involved in heparin-induced thrombocytopenia.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4r9wA00
1SDFA 3D6WA 1HFNA 3I3CA 2B2WA 3G7LA 2NZ1D 1U4LA 1DOKA 1LV9A 2B2TC 5T1GA 1DZ1A 1WTVA 4OIKA 4XDXA 2Q8TA 3UI2A 1EOTA 2FMMA 2L12A 2HDMA 2K05A 3FDTA 4DN4M 2DY7A 2MJ8A 2B2YA 1J9OA 3F2UA 5EPJA 1WTOA 1TVXA 3LWEA 1RODA 1ICWA 4IUPA 1PFBA 4X3TA 3P7JA 1RTNA 3QO2A 1EIHA 2KUMA 5CBEE 2L11A 1EQTA 1HFGA 1U4PA 2L9HA 1WD1A 1BBXC 1KNAA 5AFWA 5EJWA 1JICA 4O42A 4XT1B 3MWYW 5EPLA 1XYIA 4CJ2C 4R8IA 2K04A 2K01A 2JP1A 4HSVA 3TN2A 2B2VC 3GV6A 2HUGA 1CA6A 4HAEA 2VXWA 1XX8A 1DOMA 2EOTA 4CJ0B 1G91A 4X3UA 1G2SA 1QG7A 2B2UC 4IUTA 1KNEA 1B50A 1B2TA 2MP1A 4MN3A 5E4XA 3DEOA 1F9QA 3MTSA 1NCVA 4U68A 1RTOA 5D14A 1S4ZA 3IFDA 4UAIA 4OIJA 5EKIA 1A15A 4IUVA 1SSOA 4LMQD 3I8ZA 1VMCA 2EE1A 1HA6A 2KECA 4HCSA 2KEDA 4ZKBB 2X69A 2X6LA 4ZKCB 1ML0D 1JE4A 5CMDA 1ILQA 3HP3A 1AZQA 1ILPA 5CORA 1HHVA 2IL8A 1BNZA 2K28A 2FFKB 5DNFA 1CA5A 4ZAIA 1CM9A 1VMPA 2B2WC 1J8IA 2XIWA 1SAPA 2Q8RE 1X3QA 1NR4A 3ONAB 2L1BA 1X3PA 5COYA 1MGSA 3SVMA 2B2YC 1MSHA 2J7ZA 2RSOA 1WVLA 1WTPA 1GUWA 4ZLTF 1B3AA 1F9PA 1O7YA 4RA8A 2R3ZA 3Q6SA 4X3SA 2NYZD 1O80A 1BO0A 5D65A 3TZDA 2SDFA 2FHTA 2MPMA 1IKLA 4HEDA 5CBAE 3IL8A 4XT3B 1G2TA 2B2TA 5T1IA 2KOLA 3R93A 2FJ2A 4R9WA 2FINB 2KVMA 2RA4A 1C8CA 4MHEA 3FPUB 2H1EA 1F2LA 2KEEA 4IURA 1F9RA 2BDNA 1WTQA 1BF4A 1RJTA 1B53A 2M2LA 2HCIA 1WD0A 1HUNA 3N52A 1NAPA 4RWSC 1MSGA 2K1BA 3I91A 2DY8A 4RAUC 1U4MA 5EQ0A 3I90A 1PFNA 1WTRA 4IUQA 1X32A 1DONA 2N55A 1E0BA 2B2VA 2X6GA 5E4WC 5JJZA 1EIGA 1PLFA 3KBXA 2JYOA 4CJ1B 1WTWA 1QNKA 2EPBA 2HDLA 1AZPA 1NR2A 2NWGA 2B2UA 2K03A 1IKMA 4IUUA 1PDQA 1RHPA 3DM1A 1PFMA 4X3KA 1HRJA 1F9SA 1HUMA 1QE6A 2HCCA 3GV3A 1U4RA 2RSNA 2CVRA 4QUFA 1O7ZA 4QUCA 1IL8A 1WTXA 1EL0A 2MGSA 1Q3LA 1B4OA 4ZK9B 1AP0A 3KUPA 1ESRA 2RVLA 1DOLA 5EPKA 2N88A 2D9UA 2L4NA 3DEPA 3H91A 1MI2A 1ZXTA 1M8AA 4NW2A 1G6ZA
chains in the Genus database with same CATH superfamily
1LT6D 2LY7A 1J5EQ 3NWSA 1HTLD 1GHKA 1DZ1A 3CCRA 1LTRD 1Q7YC 3S1MH 2EYMA 3H3VI 3LWUA 3FDTA 4K0KL 3J7YW 4FO2A 2UUCL 2A5HA 1U4PA 2XRSD 1R9TH 1BBWA 5EJWA 1HR0L 1YHAA 2OTJA 2DJFC 4QQBX 4DV1L 5C4JB 3AFPA 4DR6Q 4M1UB 5ELBA 1B2TA 2LXJA 3M4OH 5GROA 2Y0SB 3X3NA 1PZID 4LMQD 2IHEA 1GKHA 4NXNL 2SNMA 4WRDA 4ZKCB 4X62L 4I7AA 4LF5L 1Y1VH 2A69D 4R8NA 4DV7L 3OWEB 3NHHA 3PF5A 2QEXA 3HOVH 1QCBD 4K14A 5JAVA 5LMNL 5I6WA 1PH4A 1SYFA 4DR7Q 1X54A 2YYZA 2UXDQ 3STBD 4XQJA 4BY1H 5DLQE 2R7ZB 1Q12A 4AIMA 1BKBA 4HEDA 4OHJA 3H0GG 1S3OA 2JA8B 5M3FH 1SYDA 1X55A 2F0WA 4EX5A 5LL6X 3DWQA 3EQLC 1LO5D 4CDDC 4YHHL 1B53A 1PYWD 2Q2IA 2Z4HA 1HZCA 4P2CB 3SK6A 1U9RA 1EU3A 4G7OC 2EY1A 5LHY1 5JJZA 4M8AA 2NWGA 4CKCA 2OXPA 1DXMA 3OMCA 2WV6D 1F9SA 2UUBQ 5K36G 2WINB 5C4JH 3D4WA 3AFQA 4JI2L 1VQDA 1E2WA 2NTTA 1B4OA 4KJOA 1D8LA 2F0IA 1YJ9A 3F2BA 2RVLA 2ZM6L 4B9WA 2QILA 3LNNA 5A2QL 1CZGA 5C4XH 3A54A 5G3LD 1IHZA 1VQ4A 1JJGA 4L8JA 5M5WB 2F0UA 2PMZE 3MXNA 4PNYA 3VDYA 4DAVA 3M3YB 1PVOA 2E2HB 2CWAA 5BN4A 1ICWA 3ZJYC 2I0QA 1R4PB 1H9JA 3CD6A 5IWAL 4A3MB 1RDPD 3L0OA 1Y14B 1FJGQ 4GKKL 4A3JH 4R8IA 2O2LD 4HSVA 4RMFA 2VXWA 2K5HA 2CH4W 3EFXD 1QG7A 5HGQA 1AEXA 3A7AB 1XNQQ 2JA9A 1KAAA 1K0SA 2R7DA 1TS2A 4EGVA 3A8JE 3U9SA 4JYAQ 3F2CA 4H0LC 3H15A 2L55A 4EQOA 5EKIA 1II3A 1A15A 3T1YQ 1B7YB 3HOXB 1A2TA 4N8X1 1V1PB 3MXUA 1CSPA 2IX0A 2ASBA 4DUYQ 2XNAC 4C3JH 2LMCB 5EKKA 4A3FB 4C3IH 1TWFB 4BA2I 5C5LA 4Q0FA 4JVZA 2DNEA 1NNXA 3F1ZA 4LUOA 5CV7A 1R4QB 2RQXA 4DK0A 1E7ZA 2GA4B 1QNUA 2Q8RE 1TWCB 4J6HA 2K14A 3PIO3 4NMZA 1F9PA 2H5XA 1N36L 1U0LA 4Y7NH 3CCJA 1TS3A 4JOIA 3T51B 2WACA 4JI7L 2B2TA 4L5RC 4KLKA 3C1FA 1OXVA 3ITPA 2PO4A 3J81j 1KTKA 4IFDJ 5FLXL 1TIID 2QW7A 2E2HH 1X3EA 3MAQA 3H0GB 4OO1H 1JT8A 1SE2A 4GKJQ 1SRUA 4WJ3M 1Q82C 3BZDB 1HZAA 1O7IA 5M9OA 2FMCA 2JYOA 4B3ML 3QG1A 4R4OA 3EBEA 3M4YA 2A69C 1GUSA 1ENFA 3PCOB 1U4RA 4BA1I 2VZAA 1PTOB 3D4RA 4BBSG 3OWFA 1YITA 1K8AC 1S5BD 4LF4L 4UY8C 3STBC 3ND8A 2ID0A 1V43A 2G9HD 4L63B 3BYTB 4K8JA 2HQEA 2IT1A 2E5LL 1ENCA 1FYCA 1NUCA 4DXGA 3GO5A 4ZUIA 3KLSA 3GTQH 1UE1A 4O42A 1JC7A 4CJ2C 1TU2B 3TS0A 1WYDA 4OXPA 1VQOA 1A6XA 2Z0SA 3OIQA 1PHJA 1K83B 1B9NA 4K2LA 1S4ZA 2F3WA 5ISRA 2PYKA 4OX9Q 4DGZA 5CV9A 2RDFA 3H0GH 4IUNA 4IN3A 4FXDA 4LF7Q 1XPOA 1VQ9A 1STEA 4LNQA 1BNZA 2K28A 2FFKB 2EJGC 2EDGA 1PH3A 4QF4A 4F7XA 2F52A 3ONAB 5COYA 2AWNA 1JOKA 4DF7A 2Z1CA 3PO3G 4A3CG 1GUWA 2BE5D 5ELFA 2R61A 1PTOH 3TP5A 1Y8NB 2PMZB 3KF8B 1O80A 1VQJA 2D0OA 3VYUA 3G6EA 3UDGA 1HZ9A 2HQLA 4GNXC 1EY9A 5K36H 1SMXA 3NUCA 4YWKA 5JPNC 3CXCA 2VW9A 1T5XD 2F4IA 1YNND 3NQIA 4DAYA 4H7BA 3AU7A 3RZDB 5CR3A 5EBCA 4GOPC 2B2VA 1YZ6A 4H44C 4XIGS 3S1QB 1IBKL 1F2ZA 2QCPX 2HDLA 1KLUD 1IKMA 3RLFA 1PDQA 4ZCKA 2O4XA 1QE6A 5JEAG 4IPCA 1ASZA 4X65L 4GN5A 2TSSA 2RKSA 3PIPA 1GM5A 1LM0A 4QUCA 3RN5A 4JI1L 5J3BA 1PRTD 1KD1C 3RD4A 1L1OA 3PF4A 1EIFA 3KFUA 3DEPA 4LF9Q 2AMCB 3OW2A 3BYYB 4OL7A 3MXGA 5IGCA 2PNHA 1WTHA 1GVPA 2KHJA 3D6WA 1MJEA 1BOSA 3OHXC 1D5MC 1HNZL 1H9KA 4QL5A 4PQXA 1ENAA 2PZWA 1LTSD 1IYUA 2B39A 5M3MG 1AW7A 1WD1A 2SEBD 3TREA 4ABNA 4H13C 5FO8B 4LW1A 4YY3L 4HJAA 1PH5A 1PXUA 1HNWQ 2NVXB 1Z7TA 4K6DA 2KCTA 5AJ3L 4POGA 1C7YA 4B3MQ 3MEHA 3S14B 2OEOA 4DV0Q 1IZ6A 1HA6A 2CQOA 1IBML 4QY7A 5CMDA 4A3LG 3S1QH 2PW5A 2GVBA 3J81E 2C35B 4AYBG 1Q46A 4RG1A 2YU9H 5EAYA 3HOUB 1OXUA 4TKOB 4CBVA 3K6OA 2K32A 3I4MG 4JI4L 1CKNB 2EY2A 2K52A 2WB1E 3FKIB 4OWWB 5C44G 1VQLA 1K3RA 4R4IA 3MA2B 5TSSA 3I70A 1E2ZA 5ELEA 3D3RA 2JA7H 3FEWX 3PO3B 4BBSH 4ID6A 2BH8A 4NXML 4IURA 3OPOA 4F88A 1VF7A 2A8VA 4DU9A 5FK9C 3E0EA 4RAUC 2K1BA 2F0FA 2YTVA 1TR5A 1QVGA 2G5DA 2R7FA 1VQCA 4IJHA 1XPUA 4R1JA 4DR3L 1J5EL 2FXQA 1KRSA 2Z9HA 2F0QA 4X3KA 4O2DA 3WDNA 3GTGB 2NVXH 1XMOQ 1N32Q 4DNRB 1LT4D 3GTPB 2EIFA 3M7NA 2EZVA 4A4IA 4X6AH 4Y52H 1H9RA 4LUZA 2NTSA 4B3SQ 3H3VC 2BE5C 3KDFB 2I07B 1SLJA 4KI0A 1H95A 1X6OA 1HXYD 1U4LA 4A3KG 4BXXG 1PZJD 3N6RA 4DN4M 4J1MA 2Y0SE 5EPJA 5M3FG 2E2JH 1I6VC 4R4CA 4N9TA 2RDHA 4MTKA 1YNNC 3QOLA 5IGBA 1TKWB 3OIPA 2KA7A 3I4LA 2HUGA 3GP7A 2PI2A 5ELDA 5I9OA 1K9MC 4CGYB 4IOAA 1NBWA 1LYLA 4PMBA 1GUGA 4X3UA 1G91A 2HD3A 2PCFB 2CHBD 4CDEC 4CKEA 4KHPQ 3PO3H 4A3CH 4QIWB 4DR7L 1SBBB 2UXDL 3SEBA 5D14A 3IFDA 5KRUA 3E6ZX 5GAEC 5IP9G 3J81c 1PRTC 3RMHA 4DV5Q 3BJUA 5CV4A 3L7ZC 4A3GB 2F4VL 5D3DA 4DV2Q 4A3EG 1EZ6A 3ZYYX 1V1PA 4K6LA 2PQEA 3VYSA 1Q1BA 5C4XG 1NY4A 2J7ZA 1WTPA 4EVOA 3S17B 2K5WA 4AYBB 5CBAE 3HOWB 4P71A 1DGSA 5IT9E 1G2TA 4KY7A 2K5DA 2K5NA 4HJ8A 5JEAH 1VQBA 1IL2A 4R9WA 2KVMA 1J6QA 4MHEA 2UUBL 3I4MB 3S1MB 4FF2A 1ONLA 2D5DA 2V1CC 1SJHD 1RJTA 4IPDA 3VA7A 1N34Q 4IUQA 1R9TB 2ZT9C 3PO2G 1YEZA 1YNJD 3H3VH 5IY0A 3M4PA 3RN2A 3C2PA 3A5UA 3GQBA 2B2UA 4KY5A 2F0HA 2HCCA 3W5OA 2CVRA 4JC0A 3UE1A 2CW0D 5M3MH 2PI2E 3M4OB 4C3IG 1E1TA 2QEJC 5IOCA 3K0YA 1I3QB 4IZ8A 4MNOA 3RR5A 3UDIA 2F0MA 4ZQ3A 1FJGL 2NVTH 4ZUJA 1Y1VB 2A74C 1LLRD 2WAQG 4HMJA 2E2IH 2UXCQ 2WB1B 1B1ZA 1XNQL 1EOTA 3Q22A 4NKLA 4JYAL 2C9OA 4UP8A 1L1OB 5I6YA 1HH2P 2RF4A 3PUZA 1CSQA 1EIHA 3T1YL 4TVAB 5CBEE 2AUKA 1S5ED 4QB4A 1KNAA 2ZTCA 4EQNA 4BY1B 4DUYL 4JI3Q 1STBA 4A3LH 4DV3Q 3KYHC 4KKUA 5J22A 5DM63 1Y8OB 3S17H 3K59A 5M3FB 2DUDA 4DR2Q 3CCLA 4X66Q 1MJCA 5GADC 3T1HQ 2KCNA 4DR3Q 2E2DC 4KMUC 1I4HA 2Q2UA 5E4XA 1A2UA 3DEOA 1F9QA 3I4MH 1NCVA 1UE6A 1EY4A 3FMCA 3CPWA 2CFMA 5C44H 4G7HC 4HCSA 1L0XB 4IFDI 3HP3A 1CUKA 3NP8A 4A3IH 1IBLQ 2IL8A 1GUOA 4R4QA 1EFID 1CA5A 1HQMC 3S15B 1J8IA 3SR1A 2MO0A 4APVA 1UAPA 3AYHB 2VUMG 2EYLA 5IT9c 5JPMC 4GKJL 2QF7A 4F87A 1I3QH 1PH6A 2UUAQ 3KJPA 1EU4A 1EFWA 5I9PA 5C4XB 1VQHA 4WJWA 1C8CA 3KF8A 3CCQA 2KEEA 3CRKC 1UE7A 2HIXA 4JI6Q 4C56C 1BCPD 2MUYA 1WD0A 1I4RA 3DWPA 1G8ZD 1VQPA 2F0EA 1Z9FA 3NSWA 5BR8Q 1U4MA 4PG3A 3RLOA 2XN9C 2YTXA 1BBUA 4JPBW 4AQYQ 1FL0A 1PLFA 1HNXL 1MKHA 2ALYB 4JCVE 2XGTA 4A3KH 4BXXH 4A3JB 2JEBI 3HKZG 1D7QA 1F2YA 3GV3A 2F0JA 2MFIA 4L5SA 2Z6KC 4RGNA 4QUFA 2F4VQ 4MIUA 5FLMG 2MGSA 4OGQC 4DR1Q 3PO2B 1TWAB 4J8QA 3RUZA 4JK1C 4RKLA 3S16H 3PSIA 1DOLA 2D9UA 4ZRZA 3IL8A 5M5XH 4NW2A 4LJZC 1XTCD 1Q8IA 2QGQA 3I3CA 4C3JB 4FNFA 1FGBD 1UNSA 4C3IB 1E24A 3NPPA 1GUTA 2K05A 2KHIA 4L6TB 3S15H 1TVXA 3U50C 3MZ5A 5IP9H 1PFBA 1PYSB 3P7JA 3S9WA 4OX9L 2ZTEA 2CH4A 3TMEA 2JE6I 3CW2C 2R92G 4Y7NB 2ICIA 4LF7L 1LTID 4A3EH 3FP9A 4C1NK 1PV4A 1YNJC 2EYOA 1G2SA 2VQEQ 4K5XA 4G7ZC 4OELB 1XNRQ 3HZXA 3PUYA 3M7GA 1SE4A 3AEVA 1WOCA 5EKLA 2HIVA 1SEBD 2CW0C 3EROA 4IUVA 3C46A 3NENA 2L0CA 3K5MA 3RZOB 3SDZA 2VY3A 2V4DA 2SOBA 2VB3X 3NTHA 3E3XA 1UEAB 5DAUA 3NWTA 1DCZA 1JOQA 4KKSA 1A3TA 3SGIA 2H4OA 1Z47A 4UP9A 1PYBA 1HR0W 2BOSA 1V1QA 4ZLTF 3DMUA 4RA8A 1A62A 3PO2H 1TWAH 1BO0A 5I4DA 4LUVA 4JI0Q 1IKLA 1EWIA 5IODA 4DUZQ 3SXHA 2NVYH 2I5LX 1FNVA 2VUMB 1PA6A 2NB0A 1CKNA 4DR5Q 2K5QA 3K5LA 3T56B 4ALPA 1UE5A 2KCCA 1UWVA 1VQ7A 4RKBA 1HUNA 3TP6A 4CDFC 2LFNA 1CHQD 3K7AH 3ER0A 3F2DA 4LF9L 2A68D 5C3XA 3J80i 3GTQB 2N55A 1KRTA 3SK8A 3P75A 4QJFA 3HFZB 4H02A 5LMNW 1S5DD 3BZCA 1VF5C 1JOOA 5CV8A 1GJXA 1LTGD 3BG3A 2E76C 1D1KA 5IYCG 1I4XA 3PUWA 3PIOA 1Q3LA 4XYOA 3J80L 1SE3A 1E22A 1TWHB 3HKZB 3IKJA 1ZXTA 5IYDG 1KABA 4P74A 4RCOA 1SFOB 3RZOH 1HFNA 1HNWL 1XJVA 1QOHA 2IWHA 5E1FA 3TP7A 2R93G 1TXYA 3KDFA 5LL6S 1Z6HA 4P73A 4DV0L 5KYLA 2J4XA 2NUCA 2JA7G 1YHQA 1BCPC 3CP0A 2A6HD 1HA5A 1I4PA 2BCOA 4FF3A 1LUZA 4RCNA 4YCVA 2JP1A 3DUZA 3U9OA 1EOVA 4N9PA 1LTBD 1EQQA 1B50A 2VUMH 5C0XI 1HNXQ 4EQ5A 3BVZA 3W2DA 1V1OA 5C4ZA 1VS0A 4U68A 2JEAI 2R92B 4B08A 4ULLA 1PH1A 1KQSA 1Y69U 3CU7A 1SXTA 2XSCA 3I8ZA 4UHVA 2KECA 1JWMD 4JG2A 4YCWA 3HOZG 4UPAA 5CGKA 5EGTA 1F77A 4FVMA 1DJRD 1X3FA 5I2XA 3VR2A 4DV6Q 1FNWA 4ZAIA 1CKMA 4P72A 4U673 1VQ8A 4KD4A 1I94Q 1BR9A 4ME5A 1VDZA 4GLAC 2WIIB 3KF6B 2K50A 4IPHA 2QDBA 4HN7A 3J81L 2RBMA 3E9IA 3OTOQ 3HRZC 4IOCA 1G51A 3CMEA 5A35A 4C3HG 1JMCA 2M9VA 3RNUA 1TWHH 1VQ5A 1VQKA 1GD7A 1SFOH 2Q2TA 1YIJA 1D1IA 1ET6A 3EVQA 5FLMH 1SMYD 1CQFA 1XMOL 4XQNA 1P16A 1N32L 2G9DA 2EJMA 1BQQT 4OO1I 3ERSX 5IGGA 2CCZA 4MZ9A 3C3LA 3QOJA 4B3SL 4DK6C 1EIGA 1FVIA 3KBXA 2KENA 5EBDA 2JA6G 1NR2A 3S24A 3JAMi 1IYJB 3NELA 4RGOS 3K5NA 1VQEA 2MNAA 1XPRA 5GAHC 1TWGB 5BN5A 4FDBA 1SE8A 2R92H 3A55A 1AP0A 3KUPA 3K5OA 1STYA 1RD9D 3JAML 2UXBQ 1NMGA 2EQSA 3EJIA 2B2WA 4Z9CB 3FRPB 4A3DG 4XXEA 2L5TA 2Z8LA 1JORA 1WI5A 2FMMA 4QIWE 2IX3A 1VQ6A 4KHPL 4GNXB 2B2YA 4RHRA 1RODA 2YU9B 3V05A 4HMIA 4J15A 1PFSA 3QO2A 5ELCA 4LWCA 1SN8A 1Q86C 1HFGA 3J7AV 2KCMA 1BBXC 3PGZA 1Y1WG 4KV6A 4DV5L 1XXGA 2A73B 1H9SB 4GOPB 2EYHA 1CFMA 3U4VA 1S5FD 2A68C 3H09A 1CA6A 3G4SA 2KHSA 4DV2L 3TDQA 3HG9A 3HGBA 3D4DA 2JA7B 3M4QA 1VQMA 4BBSB 3MTSA 5K5PA 1I4QA 1L0YB 4OEMB 1XMQQ 1NJIC 3H6MA 1LABA 4OIJA 3HOYG 1SJED 3R3OA 3VR4A 1OTCA 4IFDG 4AYBE 2X69A 2X6LA 1ML0D 1PH2A 1EEID 4C1NI 5CORA 4LFBQ 1JB3A 4N8FA 5DNFA 5IGDA 1NE3A 2DJGC 1I6HH 1NSNS 5JVH3 1NR4A 2YTYA 1X3PA 4PZ6A 1A3VA 2F3VA 3J7AF 5I2YA 3Q24A 1YI2A 1E1OA 4DNTB 2F0OA 4ODGA 4XTCS 1N34L 3Q6SA 1TWGH 1OO9B 2F0SA 2JA5G 2QKIC 1KL9A 4QMGA 2A6HC 3KJOA 1D5XC 3S2HB 3UDFA 4DR4L 2H1EA 5C3EG 5IYCH 3AB9A 3H94A 4XYQA 2MO1A 1Q1EA 4C3HB 2F03A 2JXMB 5IYDH 1LACA 3TEHB 2RCFA 2E2JB 1B9MA 1JWSD 1E0BA 4OWXB 2MHVA 3ULLA 4CJ1B 1WTWA 2R93H 3CC4A 2UXCL 3S1NH 1S72A 2RSNA 3S2DH 4PMWA 4KHVA 4A3IG 4C2MH 2LKVA 2XWJB 4WJ4A 1N8RC 1CI3M 2BH2A 2P5ZX 3CCSA 5EPKA 5ELOA 4JI3L 1C4QA 1TY0A 4DV3L 5J1ZA 4JOIC 3CCVA 4DR2L 1LV9A 2B2TC 4X66L 1WTVA 3T1HL 2E75C 4TQUS 3QB3A 1W6JA 4DAMA 3O13A 3U58A 4IUPA 1OXTA 1SMYC 2HT1A 1RTNA 2QDLA 1N9WA 4DK1A 1I5FA 3HOZH 3FVQA 1PTOF 1QJOA 4XT1B 1JR0D 4XQQA 1K3BC 5EPLA 3I56A 4A3DB 1ESFA 3L3OC 2WP8J 5KIXA 1WCMG 3GTOB 2K01A 1IBLL 4JV5Q 4BY7G 1LT5D 1QVCA 2ICEC 1KNEA 3S2HH 4HSPA 4HIDA 1QB5D 1EY5A 2JN4A 2RHQB 3BDOA 1RTOA 2TMPA 3D6CA 3W3AA 3WOEA 4FF4A 4G57A 3I73A 4C3HH 3P1HA 3BS1A 1HJPA 1SNMA 2UUAL 1EY0A 1EIYB 5L37A 1O7LA 2M00A 2OWOA 3PV0A 2LSSA 3EN2A 4JI6L 1D2BA 1EEFD 1FGUA 3K57A 2Z6BA 2O5JC 5M3MB 3SVMA 5LMUQ 3NXWA 5BR8L 4HIOA 3GTKB 2NYZD 5KEEA 1JE5A 3WWVA 2SDFA 1STGA 4AQYL 2JA6H 5IP7G 1QWYA 4JI8Q 2NVTB 3QJYA 4UDUC 1LT3D 2E2IB 4V0BA 3NTKA 3I55A 3HEJA 1CTMA 2JA5B 1L0WA 1NAPA 1EYAA 2J0TD 4AH6A 1YBYA 5FO7B 4DR1L 2N49A 1FD7D 4PZ7A 3NBIA 1PFNA 3I4OA 2EY6A 2AHOB 1DONA 2VS1A 1KC8C 2EPBA 4A3DH 1V8QA 1C9OA 4IUUA 1PRTB 1RHPA 3GTOH 1YHBA 1DD2A 2K6AA 1MIUA 1KDAA 2R6GA 2WAQE 2F0GA 3PUXA 5JVG3 1Y1WH 1W6KA 1G6PA 1A63A 1W2BA 2D2CC 3NBHA 4QCLA 5C44B 3H91A 3GTJB 1MI2A 1SNQA 1C0AA 5F2DA 3G7LA 2NZ1D 4A3IB 1MBYA 4JBJA 2VQEL 5J39A 4XDXA 2JSOA 3D8GA 4PZ8A 1XNRL 3F2UA 4JI5Q 1GOZA 3HOYH 2A6ED 3VR3A 4IFDH 4X3TA 4DR4Q 2ENBA 2L11A 2R7ZG 4UP7A 5DEHA 3GTKH 2IHFA 3JC66 1JJCB 2JA8G 1C48A 2ATWA 2B2VC 1HPCA 3GV6A 3RLNA 5C0XG 5CV6A 1KDCA 4K2KA 3TBIB 2I46A 2ZJRA 2MP1A 2I5MX 3I4NH 2E8GA 3L2PA 2EYFA 2K7VA 4BBRG 5C4HA 2JA5H 1IYVA 1STNA 2F0PA 1SSOA 4BY7B 4GZYC 4JI0L 1L1OC 1JE4A 5IGEA 4DUZL 1H9MA 1RCVD 2D62A 5C3EH 3CCEA 1CM9A 4A3KB 4DR5L 5JJIA 3OW7A 2XIWA 1JJ2A 1SAPA 3TRZA 2EJFC 2OF1A 1SROA 1PMRA 2F0DA 1SNCA 5KYIA 2UU9Q 4B3TQ 2NBFA 4A75A 3KLRA 4QGUA 3S16B 3TZDA 3DXJC 2FHTA 2MPMA 4DV4Q 4OWTB 2DN8A 3CKIB 3GTJH 5M5XB 3G48A 3KF6A 2BDOA 2GN5A 1Q90A 2QA4A 1F9RA 1U5KA 1K0RA 5D3IB 4RWSC 4HJ9A 5KNCA 4KY6A 2B3GA 3HKZE 1YJWA 3SE0A 3MEFA 3A7LA 4A3MG 2C5CA 4RGMA 4LFCQ 1AZPA 1VQNA 1QNKA 3Q8DA 1RIPA 3QIAA 2JK8A 1AN8A 4A3EB 3GTLB 2AQ1B 1GO3E 1E3PA 2LXKA 2OT2A 1JWUD 4RFBA 1STHA 1K28A 1EL0A 1TQOA 4GLVB 4IQZA 2B8FA 2NN6I 3Q23A 3R8BA 3HOXG 2WKDA 1WCMH 2EYPA 1PTOD 4BY7H 4LF8Q 4A3FG 1S5CD 2AQ2B 3GD7A 4HR7B 5T1GA 4OIKA 2VQFQ 2HHHQ 5DM73 4LF6Q 3B6YA 3CQZH 3ERQA 4DNIA 3T16A 1FNUA 1XYIA 1B8AA 4GNXA 2O5IC 3MC0B 4A3BG 3BVGA 1I4GA 1TY2A 4DV6L 3R2IA 3J7ZC 2NVYB 4CJ0B 3CC2A 1UUPA 1HZBA 1N33Q 2GVAA 1I94L 4FYDA 3VR5A 2AKWB 1H9SA 4GOPA 4S3SA 4UAIA 5E3FA 1KDBA 3OTOL 5CV5A 1A0IA 1X3GA 4HJ5A 4EQPA 5IP7H 2KEDA 3K7AB 2B29A 1ILQA 1TS5A 3W1GA 1SNOA 1CQVA 2PQAB 2WAQB 4BBRB 1RF2D 1RL2A 3CC7A 1NTGA 2L1BA 3GTLH 3FPPA 1ASYA 1MGSA 3ULJA 1B70B 3A8IE 2CKZB 3D31A 4JW0A 5FO9B 2A6EC 2EXZA 3LGJA 5NUCA 5HURA 5CYUA 5GAGC 1HCZA 2NZOA 4FXGC 4L5TA 1QZHA 4KN4C 3CHBD 2IPKD 1KIXA 4GS3A 1WTQA 4F8MA 1LTTD 4CDCC 2PNRC 3OMGA 4HIKA 4KKTA 3E9HA 3D0FA 4ILWA 2UXBL 4JBKA 1XTDA 2Z4IA 1L2FA 3BDCA 3HKSA 4G4KA 1PRTF 1HRJA 2EXDA 1HUMA 4IALA 4PV1C 1O7ZA 2VL6A 2R7ZH 1HTPA 4DKAC 1MHWC 5C3WA 2NVQB 2JA8H 1SDFA 5C0XH 3DWAA 4RHSA 1ET9A 4HJ7A 2LS01 4WFN3 2F0KA 1JQYD 2AWOA 2XRQD 1WTOA 4BBRH 1JB7A 1AH9A 1J9OA 4DA2A 4X64Q 1CZWA 1XMQL 3NBHB 4K5VA 4B3RQ 2KBNA 3K58A 3DHQA 2WFWA 3CCUA 4JBMA 1VQFA 1EQTA 2L9HA 3VA5A 1VCIA 3A5ZB 1EQVA 1JICA 3MWYW 1W3SA 3MFYA 5JEAJ 3MHBA 4LFBL 1YJNA 1K73C 1XX8A 2EOTA 1K8MA 2B2UC 2CWPA 2L15A 4K0KQ 3K81C 2Q8IB 4IJLA 2UUCQ 4A3BB 1BXTA 2ES2A 1PZKD 3CMAA 1HR0Q 3HS0C 1SNDA 4DXFA 1PH7A 5M5WH 4DV1Q 1STAA 1PTOC 2XTIA 3M3YH 3Q0AA 1VMPA 3V2TA 1RKNA 1X3QA 2D0PA 1CT1D 2EYJA 1M1KC 1K8OA 1ICFB 4A3MH 1S40A 4LK1C 3BZKA 4NXNQ 3SK5A 4X62Q 1BCPB 4LF5Q 4XT3B 5FJ8G 4NDXA 2KOLA 2ZXPA 4DV7Q 2NVQH 3KLSX 3J81i 1DM0B 1IW7D 5IYBG 2RA4A 3NE5B 4O1NA 3ULPA 1F2LA 5LMNQ 3M85A 1Q81C 2PW7A 2M2LA 2K75A 4NP5A 1PH8A 4GLXA 3HOXH 1EQRA 3I72A 3EIVA 4JBWA 4A3FH 1GHJA 5E4WC 1TWFH 3IRBA 1EWHA 3DM1A 1T9HA 2RCNA 1TWCH 1K8GA 1X65A 4YHHQ 1OXXK 3A8KE 5ELNA 5JOBA 5A2QE 1IL8A 1WTXA 4LFAL 3OSOA 4KTAA 4BWGB 2IJ0A 1MD2D 1ESRA 3SK4A 4A3BH 3GDEA 1G291 5IE8A 2VB2X 4A93G 1I50B 1G6ZA 1SYGA 4JV5L 3UE0A 5KGUA 3BVMA 1EZ8A 3E5SA 2Q8TA 1I6HB 3LWEA 3HOUG 4HIMA 3A0JA 3G71A 4JI2Q 2F0TA 2DGYA 2BA0A 3FKIG 2ZM6Q 1WJJA 4YWLA 4GN3B 1D6EC 3TN2A 4KD3A 1O78A 3PQIA 1EY6A 1LTAD 1UEBA 3BDLA 4HAEA 1DOMA 2ZJPA 2BA1A 2K33A 2ZXOA 4RH6A 2AQ3B 1SYBA 5IGFA 5LMUL 1P8LA 4ME3A 1QILA 5FOBB 3UDXA 4IO9A 5CC4A 5IWAQ 4FXKC 3IFTA 1EY8A 4GKKQ 2DNCA 4JI8L 5H1SE 2F0VA 2R93B 3TS2A 1A3UA 1F2MA 3S1NB 3U4ZA 2I5HA 3PIP3 2N8NA 3S2DB 1MSHA 2RSOA 1B44D 4C2MB 5D65A 4DK3C 3J80E 4A76A 5FLXE 1I50H 3CRLC 1K83H 3NK9A 1TT2A 1PH9A 3OOCA 2JJQA 1EYDA 3N52A 3MVVA 4CKBA 1VQAA 1X9NA 2E74C 3ICEA 4NPSA 3I90A 1N36Q 1WTRA 1B3QA 3I4NG 4Q5VA 3R2TA 3V96A 2X6GA 3HOZB 1BDOA 5M5YB 2N78A 1QUQA 4I65A 4JI7Q 5KNDA 1VQGA 1PFMA 5JJKA 4YWMA 2AUJD 4JI5L 5HGTA 1GUNA 2NN6G 3LX0A 1AFPA 5IT9L 3SHLA 1ZKOA 3MXNB 4FP5D 2B63G 2N88A 1M8AA 1NMFA 2SNSA 3I2ZA 4CHTB 3NQTA 3NTIA 1EYGA 4A3GG 4YCUA 5GQOA 2DY7A 1M90C 2YV5A 1IW7C 4I7ZC 1CHPD 3RZDH 4A93B 1SR3A 2EVBA 3BU2A 2KUMA 3VYTA 1ZYRD 1XWEA 1X56A 4LF4Q 3A56A 3HOWG 2JA6B 3P20A 2OCEA 4ZYSA 3E0JA 2IX1A 2E5LQ 2A1AA 3T13A 5C0XJ 1SYEA 3FHWA 3K80C 1YVCA 2UU9L 5KNBA 3MXPA 4B3TL 2EE1A 4POFA 3DM3A 5FJ8H 4ZKBB 4DV4L 4LFAQ 1V9PA 3KOJA 4MTNA 4O0AA 5IYBH 1ILPA 2XWBB 1HHVA 3CPFA 5M5YH 4TSSA 2Z6KA 5IIFA 3K8AA 1EY7A 1SNPA 2F0NA 3AQQA 1KHIA 1BVSA 4GN4B 5E7NA 4RGTA 2PQAA 1WVLA 3J80c 3W1BA 5FLXc 1T5EA 1O7YA 2K5VA 4X3SA 3I7FA 1Y1WB 2MQHA 5HY6A 4LFCL 1BCPF 4FF1A 2VNUD 1EUJA 2F0LA 3ND9A 3EA6A 2FJ2A 4L5QA 1Y1VG 2WB1G 3T4AC 3JAME 3S14H 2Q2HA 3WOFA 3HOVG 2HCIA 3F8TA 3QR8A 2A19A 3HOYB 1AE3A 1MSGA 2DY8A 4A93H 1OXSC 4BY1G 4NB3A 1YNXA 1X32A 4DR6L 4LF8L 3VR6A 4KK7A 5C6AA 3C1EA 1E2VA 4DFAA 4K5WA 3HOUH 1AE2A 2VQFL 2HHHL 4WORA 3VYRA 3QWNA 4LF6L 3I4NB 3PMFA 3FKIH 1D5ZC 4V190 2RDGA 2IY5B 5JJLA 1SYCA 3J7A5 4DPGA 2OTLA 1IBKQ 4HCEA 1EYCA 1DOKA 5C3EB 3UI2A 2L12A 2HDMA 1N33L 2MJ8A 3TSSA 4X65Q 2B63B 5BN3A 4JI1Q 3A74A 1EWCA 2B8GA 3NEMA 5AFWA 2WKCA 2OQ0A 2Y0SG 5G3LF 2K04A 4BS9A 3PUVA 1Q8KA 4LAAA 3URYA 1KXLA 2N3SA 1TS4A 3GTGH 3S1RB 1HNZQ 3KK7A 2NZHA 4IUTA 2F1MA 2PZUA 4DAPA 3GTPH 3GTMB 4MN3A 1IXRA 2ZJQA 3X3MA 2JQOA 4B9XA 1CKOA 2PZTA 5FKAC 1GXDC 4K8IA 2K4KA 3K0XA 1QVFA 3T53B 1VMCA 4IPGA 1DYQA 2ZTDA 1A8VA 1ZEQX 1AZQA 4PMCA 4YY3Q 4A3JG 1VQIA 1LTLA 3M9BA 2B2WC 4TRDA 1Y8PB 5AJ3Q 2ZXRA 4KJNA 3TZUA 5C5MA 3TQYA 1HQRD 4YIJA 3CF5A 2B2YC 1FR3A 1B3AA 1KLGD 2F3IA 2R3ZA 2KJXA 3JAMc 1IBMQ 3OYYA 4E6IA 1WCMB 1ZYRC 2IW3A 5T1IA 2EY5A 2RHSB 3R93A 4DAYB 4C3JG 1M4VA 2FINB 3G6JB 3FPUB 4OONA 4KN7C 4P75A 2OQKA 2BDNA 2NN6H 1BF4A 3AMUA 3CAMA 3KLWA 1KAWA 2B63H 2XVSA 1JCKB 3I91A 3CQZB 4JI4Q 1BUVT 5EQ0A 3TP8A 3IAYA 4A3GH 3KBGA 3HOVB 3L9AX 2K03A 3CCMA 4KHZA 4HTHA 3MFGA 3K7UC 4NXMQ 4X64L 3S1RH 1CK1A 3GTMH 4B3RL 1QZGA 3DLLA 4ZK9B 1QUQB 3HOWH 4OO1G 2KQ3A 2L4NA 2CQAA 4R4TA 2PPBC 1WFQA
chains in the Genus database with same CATH topology
1LT6D 2LY7A 3NWSA 1HTLD 1GHKA 1DZ1A 1LTRD 2EYMA 3LWUA 3FDTA 3J7YW 4FO2A 2A5HA 1U4PA 2XRSD 5EJWA 5C4JB 4M1UB 5ELBA 1B2TA 2Y0SB 3X3NA 1PZID 4LMQD 2SNMA 4WRDA 4ZKCB 2A69D 4R8NA 3OWEB 3NHHA 1QCBD 4K14A 5JAVA 5I6WA 1SYFA 2YYZA 4XQJA 2R7ZB 1Q12A 4HEDA 4OHJA 2JA8B 1SYDA 2F0WA 5LL6X 3DWQA 3EQLC 1LO5D 1B53A 1PYWD 2Z4HA 4P2CB 3SK6A 1U9RA 1EU3A 4G7OC 2EY1A 5LHY1 5JJZA 4M8AA 2NWGA 4CKCA 2OXPA 1DXMA 3OMCA 2WV6D 1F9SA 5K36G 2WINB 3D4WA 1E2WA 2NTTA 1B4OA 4KJOA 2F0IA 2RVLA 4B9WA 2QILA 3LNNA 5A2QL 1CZGA 3A54A 5G3LD 1IHZA 4L8JA 5M5WB 2F0UA 3MXNA 4PNYA 2E2HB 4DAVA 3M3YB 5BN4A 1ICWA 1R4PB 1H9JA 4A3MB 1RDPD 4R8IA 2O2LD 4HSVA 2VXWA 3EFXD 1QG7A 1AEXA 3A7AB 1KAAA 1TS2A 4EGVA 3A8JE 3U9SA 4H0LC 2L55A 4EQOA 5EKIA 1II3A 1A15A 3HOXB 1A2TA 1V1PB 3MXUA 2IX0A 2XNAC 2LMCB 5EKKA 4A3FB 1TWFB 4BA2I 5C5LA 4Q0FA 2DNEA 5CV7A 1R4QB 2RQXA 4DK0A 2GA4B 1QNUA 2Q8RE 1TWCB 4J6HA 3PIO3 4NMZA 1F9PA 1TS3A 3T51B 2WACA 2B2TA 3C1FA 1OXVA 3ITPA 2PO4A 1KTKA 4IFDJ 5FLXL 1TIID 3MAQA 3H0GB 4OO1H 1SE2A 3BZDB 5M9OA 2FMCA 2JYOA 3QG1A 3M4YA 2A69C 1GUSA 1ENFA 1U4RA 4BA1I 1PTOB 3D4RA 3OWFA 1S5BD 3ND8A 2ID0A 1V43A 2G9HD 4L63B 3BYTB 4K8JA 2HQEA 2IT1A 1ENCA 1FYCA 1NUCA 4DXGA 3GO5A 4ZUIA 3KLSA 4O42A 1JC7A 4CJ2C 1TU2B 1A6XA 3OIQA 1K83B 1B9NA 4K2LA 1S4ZA 2F3WA 5ISRA 2PYKA 4DGZA 5CV9A 2RDFA 4IUNA 4IN3A 4FXDA 1STEA 1BNZA 2K28A 2FFKB 2EJGC 2EDGA 4QF4A 4F7XA 3ONAB 5COYA 2AWNA 1JOKA 4DF7A 2Z1CA 1GUWA 2BE5D 5ELFA 2R61A 1PTOH 3TP5A 1Y8NB 2PMZB 1O80A 3VYUA 1EY9A 5K36H 3NUCA 5JPNC 1T5XD 2F4IA 1YNND 3NQIA 4DAYA 4H7BA 3AU7A 3RZDB 5CR3A 5EBCA 2B2VA 4H44C 4XIGS 3S1QB 1F2ZA 2QCPX 2HDLA 1KLUD 1IKMA 3RLFA 1PDQA 2O4XA 1QE6A 5JEAG 2TSSA 2RKSA 4QUCA 1PRTD 3RD4A 3DEPA 3BYYB 4OL7A 3MXGA 5IGCA 3D6WA 1BOSA 3OHXC 1D5MC 1H9KA 4PQXA 1ENAA 2PZWA 1LTSD 1IYUA 2B39A 1AW7A 1WD1A 2SEBD 4ABNA 4H13C 5FO8B 1PXUA 2NVXB 1Z7TA 4K6DA 3MEHA 3S14B 2OEOA 1HA6A 5CMDA 2PW5A 3J81E 3HOUB 1OXUA 4TKOB 4CBVA 3K6OA 2K32A 2EY2A 3FKIB 3MA2B 5TSSA 3I70A 1E2ZA 5ELEA 3D3RA 3FEWX 3PO3B 4ID6A 4IURA 3OPOA 4F88A 1VF7A 4DU9A 5FK9C 4RAUC 2K1BA 2F0FA 1TR5A 2F0QA 4X3KA 3WDNA 3GTGB 4DNRB 1LT4D 3GTPB 3M7NA 2EZVA 1H9RA 2NTSA 3H3VC 2BE5C 2I07B 4KI0A 1HXYD 1U4LA 1PZJD 3N6RA 4DN4M 4J1MA 5EPJA 1I6VC 4N9TA 2RDHA 1YNNC 3QOLA 5IGBA 1TKWB 3OIPA 2KA7A 3I4LA 2HUGA 3GP7A 5ELDA 5I9OA 4CGYB 4PMBA 1G91A 1GUGA 4X3UA 2PCFB 2CHBD 4CKEA 4QIWB 1SBBB 3SEBA 5D14A 3IFDA 5KRUA 3E6ZX 1PRTC 3RMHA 5CV4A 3L7ZC 4A3GB 5D3DA 1EZ6A 3ZYYX 1V1PA 4K6LA 2PQEA 3VYSA 1Q1BA 2J7ZA 1WTPA 4EVOA 3S17B 2K5WA 4AYBB 5CBAE 3HOWB 5IT9E 1G2TA 4KY7A 2K5DA 5JEAH 4R9WA 2KVMA 4MHEA 3I4MB 3S1MB 4FF2A 1ONLA 2D5DA 1SJHD 1RJTA 3VA7A 4IUQA 1R9TB 2ZT9C 1YNJD 3C2PA 3GQBA 2B2UA 4KY5A 2F0HA 2HCCA 2CVRA 2CW0D 3M4OB 4C3IG 2QEJC 5IOCA 3K0YA 1I3QB 4IZ8A 2F0MA 4ZQ3A 4ZUJA 1Y1VB 2A74C 1LLRD 4HMJA 2WB1B 1B1ZA 1EOTA 3Q22A 4NKLA 2C9OA 5I6YA 3PUZA 1EIHA 5CBEE 2AUKA 1S5ED 4QB4A 1KNAA 4EQNA 4BY1B 1STBA 4KKUA 5J22A 5DM63 1Y8OB 3K59A 5M3FB 2KCNA 2E2DC 4KMUC 1I4HA 5E4XA 1A2UA 3DEOA 1F9QA 1NCVA 1EY4A 3FMCA 4G7HC 4HCSA 1L0XB 4IFDI 3HP3A 3NP8A 2IL8A 1GUOA 1EFID 1CA5A 1HQMC 3S15B 1J8IA 3SR1A 1UAPA 2EYLA 5JPMC 2QF7A 4F87A 1EU4A 5I9PA 5C4XB 4WJWA 1C8CA 3KF8A 2KEEA 3CRKC 4C56C 1BCPD 2MUYA 1WD0A 1I4RA 3DWPA 1G8ZD 2F0EA 3NSWA 1U4MA 2XN9C 1PLFA 4A3JB 2JEBI 1F2YA 3GV3A 2F0JA 4RGNA 4QUFA 4MIUA 2MGSA 4OGQC 3PO2B 1TWAB 4J8QA 3RUZA 4JK1C 4RKLA 1DOLA 2D9UA 4ZRZA 3IL8A 4NW2A 4LJZC 1XTCD 1Q8IA 3I3CA 4C3JB 4FNFA 1FGBD 1UNSA 4C3IB 3NPPA 1GUTA 2K05A 4L6TB 1TVXA 3MZ5A 1PFBA 3P7JA 3S9WA 3TMEA 2JE6I 4Y7NB 2ICIA 1LTID 4C1NK 1YNJC 2EYOA 1G2SA 4K5XA 4G7ZC 3HZXA 3PUYA 3M7GA 1SE4A 5EKLA 1SEBD 2CW0C 3EROA 4IUVA 3C46A 2L0CA 3K5MA 3RZOB 3SDZA 2V4DA 2SOBA 2VB3X 3NTHA 1UEAB 5DAUA 3NWTA 1DCZA 1JOQA 4KKSA 1A3TA 2H4OA 1Z47A 2BOSA 4ZLTF 3DMUA 4RA8A 1BO0A 5I4DA 1IKLA 5IODA 3SXHA 1FNVA 2VUMB 2NB0A 2K5QA 3K5LA 3T56B 2KCCA 1HUNA 4RKBA 3TP6A 2LFNA 1CHQD 2A68D 5C3XA 3GTQB 2N55A 3SK8A 3P75A 1S5DD 1VF5C 1JOOA 5CV8A 1GJXA 1LTGD 3BG3A 2E76C 1D1KA 1I4XA 3PUWA 1Q3LA 4XYOA 3J80L 1SE3A 1TWHB 3HKZB 3IKJA 1ZXTA 1KABA 4RCOA 1SFOB 1HFNA 1QOHA 2IWHA 5E1FA 3TP7A 5LL6S 1Z6HA 5KYLA 2J4XA 2NUCA 1BCPC 2A6HD 1HA5A 1I4PA 2BCOA 4FF3A 4RCNA 2JP1A 3DUZA 3U9OA 4N9PA 1LTBD 1B50A 5C0XI 3BVZA 3W2DA 1V1OA 5C4ZA 4U68A 2JEAI 2R92B 4B08A 4ULLA 1Y69U 3CU7A 1SXTA 2XSCA 3I8ZA 2KECA 1JWMD 5CGKA 5EGTA 1F77A 4FVMA 1DJRD 5I2XA 3VR2A 1FNWA 4ZAIA 4U673 4KD4A 1BR9A 4ME5A 1VDZA 2WIIB 2QDBA 4HN7A 3J81L 2RBMA 3HRZC 5A35A 4C3HG 2M9VA 1D1IA 1ET6A 3EVQA 1SMYD 1CQFA 4XQNA 2G9DA 2EJMA 1BQQT 4OO1I 5IGGA 3C3LA 3QOJA 1EIGA 3KBXA 5EBDA 1NR2A 4RGOS 3K5NA 1TWGB 5BN5A 3A55A 1AP0A 3KUPA 3K5OA 1STYA 1RD9D 3JAML 3EJIA 2B2WA 4Z9CB 3FRPB 4XXEA 2L5TA 2Z8LA 1JORA 2FMMA 2IX3A 2B2YA 4RHRA 1RODA 2YU9B 3V05A 4HMIA 3QO2A 5ELCA 1HFGA 3J7AV 1BBXC 4KV6A 1XXGA 2A73B 1H9SB 2EYHA 1CFMA 1S5FD 2A68C 3H09A 1CA6A 2KHSA 3TDQA 3HG9A 3HGBA 3D4DA 2JA7B 4BBSB 3MTSA 5K5PA 1I4QA 1L0YB 3H6MA 1LABA 4OIJA 1SJED 3R3OA 3VR4A 4IFDG 2X69A 2X6LA 1ML0D 1EEID 4C1NI 5CORA 1JB3A 5DNFA 5IGDA 1NSNS 5JVH3 1NR4A 1X3PA 1A3VA 2F3VA 3J7AF 5I2YA 3Q24A 4DNTB 2F0OA 4ODGA 4XTCS 3Q6SA 1OO9B 2F0SA 2QKIC 4QMGA 2A6HC 1D5XC 3S2HB 2H1EA 3AB9A 3H94A 4XYQA 4C3HB 1Q1EA 2F03A 2JXMB 1LACA 2E2JB 1B9MA 1JWSD 1E0BA 2MHVA 4CJ1B 1WTWA 2RSNA 4PMWA 4KHVA 2LKVA 2XWJB 1CI3M 5EPKA 1C4QA 1TY0A 5J1ZA 1LV9A 2B2TC 1WTVA 2E75C 4TQUS 3QB3A 1W6JA 3O13A 4IUPA 1OXTA 1SMYC 1RTNA 4DK1A 3FVQA 1PTOF 1QJOA 4XT1B 1JR0D 4XQQA 5EPLA 4A3DB 1ESFA 3L3OC 2WP8J 5KIXA 3GTOB 2K01A 1LT5D 2ICEC 1KNEA 4HSPA 1QB5D 1EY5A 3WOEA 3BDOA 1RTOA 2TMPA 3D6CA 3W3AA 4FF4A 4G57A 3I73A 3P1HA 3BS1A 1SNMA 1EY0A 1O7LA 2M00A 3PV0A 1D2BA 1EEFD 3K57A 2O5JC 5M3MB 3SVMA 3NXWA 3GTKB 2NYZD 5KEEA 2SDFA 1STGA 1QWYA 2NVTB 3QJYA 4UDUC 1LT3D 2E2IB 4V0BA 3NTKA 3HEJA 1CTMA 2JA5B 1NAPA 1EYAA 2J0TD 5FO7B 1FD7D 3NBIA 1PFNA 2EY6A 1DONA 2EPBA 1V8QA 4IUUA 1PRTB 1RHPA 1DD2A 2K6AA 1KDAA 2R6GA 2F0GA 3PUXA 5JVG3 1W6KA 4QCLA 2D2CC 3NBHA 5C44B 3H91A 3GTJB 1MI2A 1SNQA 5F2DA 3G7LA 2NZ1D 4A3IB 1MBYA 5J39A 4XDXA 2JSOA 3D8GA 3F2UA 1GOZA 2A6ED 3VR3A 4IFDH 4X3TA 2ENBA 2L11A 5DEHA 1C48A 2B2VC 1HPCA 3GV6A 5C0XG 5CV6A 1KDCA 4K2KA 3TBIB 2I46A 2MP1A 2EYFA 2K7VA 5C4HA 1IYVA 1STNA 2F0PA 1SSOA 4BY7B 4GZYC 1JE4A 5IGEA 1H9MA 1RCVD 2D62A 1CM9A 4A3KB 3OW7A 2XIWA 1SAPA 2EJFC 2OF1A 1PMRA 2F0DA 1SNCA 5KYIA 2NBFA 3KLRA 3S16B 3TZDA 3DXJC 2FHTA 2MPMA 2DN8A 3CKIB 5M5XB 2BDOA 1Q90A 1F9RA 5D3IB 4RWSC 5KNCA 4KY6A 3SE0A 3A7LA 2C5CA 4RGMA 1AZPA 1QNKA 3QIAA 1AN8A 4A3EB 3GTLB 2AQ1B 2OT2A 4RFBA 1JWUD 1STHA 1EL0A 1TQOA 4IQZA 2B8FA 2NN6I 3Q23A 3R8BA 2WKDA 2EYPA 1PTOD 1S5CD 2AQ2B 3GD7A 4HR7B 5T1GA 4OIKA 5DM73 3ERQA 3T16A 1FNUA 1XYIA 2O5IC 3MC0B 3BVGA 1I4GA 1TY2A 3R2IA 2NVYB 4CJ0B 1UUPA 4FYDA 3VR5A 1H9SA 4S3SA 4UAIA 5E3FA 1KDBA 5CV5A 4EQPA 2KEDA 3K7AB 1ILQA 1TS5A 1SNOA 1CQVA 2WAQB 4BBRB 1RF2D 2L1BA 3FPPA 1MGSA 3A8IE 3D31A 5FO9B 2A6EC 2EXZA 5NUCA 5HURA 5CYUA 1HCZA 4FXGC 4KN4C 3CHBD 2IPKD 1WTQA 4F8MA 1LTTD 2PNRC 3OMGA 4KKTA 4ILWA 2Z4IA 3BDCA 4G4KA 1PRTF 1HRJA 1HUMA 4IALA 4PV1C 1O7ZA 1HTPA 5C3WA 2NVQB 1SDFA 5C0XH 3DWAA 4RHSA 1ET9A 2LS01 4WFN3 2F0KA 1JQYD 2AWOA 2XRQD 1WTOA 1J9OA 4DA2A 1CZWA 4K5VA 3K58A 3DHQA 1EQTA 2L9HA 3VA5A 1VCIA 1EQVA 1JICA 3MWYW 3MFYA 5JEAJ 3MHBA 1XX8A 2EOTA 1K8MA 2B2UC 2Q8IB 4A3BB 1BXTA 1PZKD 3HS0C 1SNDA 4DXFA 1STAA 1PTOC 3Q0AA 1VMPA 3V2TA 1RKNA 1X3QA 1CT1D 2EYJA 1K8OA 4LK1C 3SK5A 1BCPB 4XT3B 4NDXA 2KOLA 2ZXPA 3KLSX 1DM0B 1IW7D 2RA4A 3NE5B 4O1NA 1F2LA 3M85A 2PW7A 2M2LA 4NP5A 3I72A 4JBWA 1GHJA 5E4WC 1EWHA 3DM1A 1OXXK 3A8KE 5JOBA 5A2QE 1IL8A 1WTXA 3OSOA 4KTAA 4BWGB 2IJ0A 1MD2D 1ESRA 3SK4A 1G291 2VB2X 1I50B 1G6ZA 1SYGA 5KGUA 3BVMA 1EZ8A 3E5SA 2Q8TA 1I6HB 3LWEA 2F0TA 2BA0A 1D6EC 3TN2A 4KD3A 1O78A 1EY6A 1LTAD 3BDLA 4HAEA 1DOMA 2BA1A 2K33A 2ZXOA 4RH6A 2AQ3B 1SYBA 5IGFA 1QILA 5FOBB 5CC4A 4FXKC 3IFTA 1EY8A 2DNCA 2F0VA 2R93B 1A3UA 1F2MA 3S1NB 3PIP3 3S2DB 1MSHA 2RSOA 1B44D 4C2MB 5D65A 3J80E 5FLXE 3CRLC 3NK9A 1TT2A 3OOCA 1EYDA 3N52A 3MVVA 4CKBA 2E74C 3I90A 1WTRA 4Q5VA 3R2TA 3V96A 2X6GA 3HOZB 1BDOA 5M5YB 4I65A 5KNDA 1PFMA 2AUJD 5HGTA 1GUNA 2NN6G 3LX0A 1AFPA 5IT9L 3SHLA 1ZKOA 4FP5D 2N88A 1M8AA 2SNSA 4CHTB 3NQTA 3NTIA 2DY7A 4I7ZC 1IW7C 1CHPD 4A93B 2EVBA 2KUMA 3VYTA 1ZYRD 1XWEA 3A56A 2JA6B 3P20A 4ZYSA 3E0JA 2IX1A 3T13A 5C0XJ 1SYEA 5KNBA 3MXPA 2EE1A 4ZKBB 1ILPA 2XWBB 1HHVA 4TSSA 5IIFA 1EY7A 1SNPA 2F0NA 4RGTA 1WVLA 1T5EA 1O7YA 4X3SA 1Y1WB 1BCPF 4FF1A 2VNUD 2F0LA 3ND9A 3EA6A 2FJ2A 3T4AC 3JAME 3WOFA 2HCIA 3HOYB 1MSGA 2DY8A 1OXSC 1X32A 3VR6A 4KK7A 5C6AA 3C1EA 1E2VA 4DFAA 4K5WA 4WORA 3VYRA 3QWNA 3I4NB 3PMFA 1D5ZC 4V190 2RDGA 1SYCA 4HCEA 1EYCA 1DOKA 5C3EB 3UI2A 2L12A 2HDMA 2MJ8A 3TSSA 2B63B 5BN3A 1EWCA 2B8GA 5AFWA 2WKCA 5G3LF 2K04A 4BS9A 3PUVA 4LAAA 3URYA 1TS4A 3S1RB 3KK7A 4IUTA 2F1MA 2PZUA 4DAPA 3GTMB 4MN3A 3X3MA 4B9XA 2PZTA 5FKAC 1GXDC 4K8IA 3T53B 1VMCA 1DYQA 1ZEQX 1AZQA 4PMCA 2B2WC 4TRDA 1Y8PB 2ZXRA 4KJNA 3TZUA 5C5MA 1HQRD 4YIJA 2B2YC 1FR3A 1B3AA 1KLGD 2R3ZA 2KJXA 4E6IA 1WCMB 1ZYRC 2IW3A 5T1IA 2EY5A 3R93A 4C3JG 1M4VA 2FINB 3G6JB 3FPUB 4KN7C 2BDNA 2NN6H 1BF4A 3AMUA 2XVSA 1JCKB 3I91A 3CQZB 1BUVT 5EQ0A 3TP8A 3IAYA 3KBGA 3HOVB 3L9AX 2K03A 4KHZA 4HTHA 3MFGA 1CK1A 4ZK9B 4OO1G 2KQ3A 2L4NA 2CQAA 2PPBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SDF A;  3D6W A;  1HFN A;  3I3C A;  2B2W A;  3G7L A;  2NZ1 D;  1U4L A;  1DOK A;  1LV9 A;  2B2T C;  5T1G A;  1DZ1 A;  1WTV A;  4OIK A;  4XDX A;  2Q8T A;  3UI2 A;  1EOT A;  2FMM A;  2L12 A;  2HDM A;  2K05 A;  3FDT A;  4DN4 M;  2DY7 A;  2MJ8 A;  2B2Y A;  1J9O A;  3F2U A;  5EPJ A;  1WTO A;  1TVX A;  3LWE A;  1ROD A;  1ICW A;  4IUP A;  1PFB A;  4X3T A;  3P7J A;  1RTN A;  3QO2 A;  1EIH A;  2KUM A;  5CBE E;  2L11 A;  1EQT A;  1HFG A;  1U4P A;  2L9H A;  1WD1 A;  1BBX C;  1KNA A;  5AFW A;  5EJW A;  1JIC A;  4O42 A;  4XT1 B;  3MWY W;  5EPL A;  1XYI A;  4CJ2 C;  4R8I A;  2K04 A;  2K01 A;  2JP1 A;  4HSV A;  3TN2 A;  2B2V C;  3GV6 A;  2HUG A;  1CA6 A;  4HAE A;  2VXW A;  1XX8 A;  1DOM A;  2EOT A;  4CJ0 B;  1G91 A;  4X3U A;  1G2S A;  1QG7 A;  2B2U C;  4IUT A;  1KNE A;  1B50 A;  1B2T A;  2MP1 A;  4MN3 A;  5E4X A;  3DEO A;  1F9Q A;  3MTS A;  1NCV A;  4U68 A;  1RTO A;  5D14 A;  1S4Z A;  3IFD A;  4UAI A;  4OIJ A;  5EKI A;  1A15 A;  4IUV A;  1SSO A;  4LMQ D;  3I8Z A;  1VMC A;  2EE1 A;  1HA6 A;  2KEC A;  4HCS A;  2KED A;  4ZKB B;  2X69 A;  2X6L A;  4ZKC B;  1ML0 D;  1JE4 A;  5CMD A;  1ILQ A;  3HP3 A;  1AZQ A;  1ILP A;  5COR A;  1HHV A;  2IL8 A;  1BNZ A;  2K28 A;  2FFK B;  5DNF A;  1CA5 A;  4ZAI A;  1CM9 A;  1VMP A;  2B2W C;  1J8I A;  2XIW A;  1SAP A;  2Q8R E;  1X3Q A;  1NR4 A;  3ONA B;  2L1B A;  1X3P A;  5COY A;  1MGS A;  3SVM A;  2B2Y C;  1MSH A;  2J7Z A;  2RSO A;  1WVL A;  1WTP A;  1GUW A;  4ZLT F;  1B3A A;  1F9P A;  1O7Y A;  4RA8 A;  2R3Z A;  3Q6S A;  4X3S A;  2NYZ D;  1O80 A;  1BO0 A;  5D65 A;  3TZD A;  2SDF A;  2FHT A;  2MPM A;  1IKL A;  4HED A;  5CBA E;  3IL8 A;  4XT3 B;  1G2T A;  2B2T A;  5T1I A;  2KOL A;  3R93 A;  2FJ2 A;  4R9W A;  2FIN B;  2KVM A;  2RA4 A;  1C8C A;  4MHE A;  3FPU B;  2H1E A;  1F2L A;  2KEE A;  4IUR A;  1F9R A;  2BDN A;  1WTQ A;  1BF4 A;  1RJT A;  1B53 A;  2M2L A;  2HCI A;  1WD0 A;  1HUN A;  3N52 A;  1NAP A;  4RWS C;  1MSG A;  2K1B A;  3I91 A;  2DY8 A;  4RAU C;  1U4M A;  5EQ0 A;  3I90 A;  1PFN A;  1WTR A;  4IUQ A;  1X32 A;  1DON A;  2N55 A;  1E0B A;  2B2V A;  2X6G A;  5E4W C;  5JJZ A;  1EIG A;  1PLF A;  3KBX A;  2JYO A;  4CJ1 B;  1WTW A;  1QNK A;  2EPB A;  2HDL A;  1AZP A;  1NR2 A;  2NWG A;  2B2U A;  2K03 A;  1IKM A;  4IUU A;  1PDQ A;  1RHP A;  3DM1 A;  1PFM A;  4X3K A;  1HRJ A;  1F9S A;  1HUM A;  1QE6 A;  2HCC A;  3GV3 A;  1U4R A;  2RSN A;  2CVR A;  4QUF A;  1O7Z A;  4QUC A;  1IL8 A;  1WTX A;  1EL0 A;  2MGS A;  1Q3L A;  1B4O A;  4ZK9 B;  1AP0 A;  3KUP A;  1ESR A;  2RVL A;  1DOL A;  5EPK A;  2N88 A;  2D9U A;  2L4N A;  3DEP A;  3H91 A;  1MI2 A;  1ZXT A;  1M8A A;  4NW2 A;  1G6Z A; 
#chains in the Genus database with same CATH topology
 1LT6 D;  2LY7 A;  1J5E Q;  3NWS A;  1HTL D;  1GHK A;  1DZ1 A;  3CCR A;  1LTR D;  1Q7Y C;  3S1M H;  2EYM A;  3H3V I;  3LWU A;  3FDT A;  4K0K L;  3J7Y W;  4FO2 A;  2UUC L;  2A5H A;  1U4P A;  2XRS D;  1R9T H;  1BBW A;  5EJW A;  1HR0 L;  1YHA A;  2OTJ A;  2DJF C;  4QQB X;  4DV1 L;  5C4J B;  3AFP A;  4DR6 Q;  4M1U B;  5ELB A;  1B2T A;  2LXJ A;  3M4O H;  5GRO A;  2Y0S B;  3X3N A;  1PZI D;  4LMQ D;  2IHE A;  1GKH A;  4NXN L;  2SNM A;  4WRD A;  4ZKC B;  4X62 L;  4I7A A;  4LF5 L;  1Y1V H;  2A69 D;  4R8N A;  4DV7 L;  3OWE B;  3NHH A;  3PF5 A;  2QEX A;  3HOV H;  1QCB D;  4K14 A;  5JAV A;  5LMN L;  5I6W A;  1PH4 A;  1SYF A;  4DR7 Q;  1X54 A;  2YYZ A;  2UXD Q;  3STB D;  4XQJ A;  4BY1 H;  5DLQ E;  2R7Z B;  1Q12 A;  4AIM A;  1BKB A;  4HED A;  4OHJ A;  3H0G G;  1S3O A;  2JA8 B;  5M3F H;  1SYD A;  1X55 A;  2F0W A;  4EX5 A;  5LL6 X;  3DWQ A;  3EQL C;  1LO5 D;  4CDD C;  4YHH L;  1B53 A;  1PYW D;  2Q2I A;  2Z4H A;  1HZC A;  4P2C B;  3SK6 A;  1U9R A;  1EU3 A;  4G7O C;  2EY1 A;  5LHY 1;  5JJZ A;  4M8A A;  2NWG A;  4CKC A;  2OXP A;  1DXM A;  3OMC A;  2WV6 D;  1F9S A;  2UUB Q;  5K36 G;  2WIN B;  5C4J H;  3D4W A;  3AFQ A;  4JI2 L;  1VQD A;  1E2W A;  2NTT A;  1B4O A;  4KJO A;  1D8L A;  2F0I A;  1YJ9 A;  3F2B A;  2RVL A;  2ZM6 L;  4B9W A;  2QIL A;  3LNN A;  5A2Q L;  1CZG A;  5C4X H;  3A54 A;  5G3L D;  1IHZ A;  1VQ4 A;  1JJG A;  4L8J A;  5M5W B;  2F0U A;  2PMZ E;  3MXN A;  4PNY A;  3VDY A;  4DAV A;  3M3Y B;  1PVO A;  2E2H B;  2CWA A;  5BN4 A;  1ICW A;  3ZJY C;  2I0Q A;  1R4P B;  1H9J A;  3CD6 A;  5IWA L;  4A3M B;  1RDP D;  3L0O A;  1Y14 B;  1FJG Q;  4GKK L;  4A3J H;  4R8I A;  2O2L D;  4HSV A;  4RMF A;  2VXW A;  2K5H A;  2CH4 W;  3EFX D;  1QG7 A;  5HGQ A;  1AEX A;  3A7A B;  1XNQ Q;  2JA9 A;  1KAA A;  1K0S A;  2R7D A;  1TS2 A;  4EGV A;  3A8J E;  3U9S A;  4JYA Q;  3F2C A;  4H0L C;  3H15 A;  2L55 A;  4EQO A;  5EKI A;  1II3 A;  1A15 A;  3T1Y Q;  1B7Y B;  3HOX B;  1A2T A;  4N8X 1;  1V1P B;  3MXU A;  1CSP A;  2IX0 A;  2ASB A;  4DUY Q;  2XNA C;  4C3J H;  2LMC B;  5EKK A;  4A3F B;  4C3I H;  1TWF B;  4BA2 I;  5C5L A;  4Q0F A;  4JVZ A;  2DNE A;  1NNX A;  3F1Z A;  4LUO A;  5CV7 A;  1R4Q B;  2RQX A;  4DK0 A;  1E7Z A;  2GA4 B;  1QNU A;  2Q8R E;  1TWC B;  4J6H A;  2K14 A;  3PIO 3;  4NMZ A;  1F9P A;  2H5X A;  1N36 L;  1U0L A;  4Y7N H;  3CCJ A;  1TS3 A;  4JOI A;  3T51 B;  2WAC A;  4JI7 L;  2B2T A;  4L5R C;  4KLK A;  3C1F A;  1OXV A;  3ITP A;  2PO4 A;  3J81 j;  1KTK A;  4IFD J;  5FLX L;  1TII D;  2QW7 A;  2E2H H;  1X3E A;  3MAQ A;  3H0G B;  4OO1 H;  1JT8 A;  1SE2 A;  4GKJ Q;  1SRU A;  4WJ3 M;  1Q82 C;  3BZD B;  1HZA A;  1O7I A;  5M9O A;  2FMC A;  2JYO A;  4B3M L;  3QG1 A;  4R4O A;  3EBE A;  3M4Y A;  2A69 C;  1GUS A;  1ENF A;  3PCO B;  1U4R A;  4BA1 I;  2VZA A;  1PTO B;  3D4R A;  4BBS G;  3OWF A;  1YIT A;  1K8A C;  1S5B D;  4LF4 L;  4UY8 C;  3STB C;  3ND8 A;  2ID0 A;  1V43 A;  2G9H D;  4L63 B;  3BYT B;  4K8J A;  2HQE A;  2IT1 A;  2E5L L;  1ENC A;  1FYC A;  1NUC A;  4DXG A;  3GO5 A;  4ZUI A;  3KLS A;  3GTQ H;  1UE1 A;  4O42 A;  1JC7 A;  4CJ2 C;  1TU2 B;  3TS0 A;  1WYD A;  4OXP A;  1VQO A;  1A6X A;  2Z0S A;  3OIQ A;  1PHJ A;  1K83 B;  1B9N A;  4K2L A;  1S4Z A;  2F3W A;  5ISR A;  2PYK A;  4OX9 Q;  4DGZ A;  5CV9 A;  2RDF A;  3H0G H;  4IUN A;  4IN3 A;  4FXD A;  4LF7 Q;  1XPO A;  1VQ9 A;  1STE A;  4LNQ A;  1BNZ A;  2K28 A;  2FFK B;  2EJG C;  2EDG A;  1PH3 A;  4QF4 A;  4F7X A;  2F52 A;  3ONA B;  5COY A;  2AWN A;  1JOK A;  4DF7 A;  2Z1C A;  3PO3 G;  4A3C G;  1GUW A;  2BE5 D;  5ELF A;  2R61 A;  1PTO H;  3TP5 A;  1Y8N B;  2PMZ B;  3KF8 B;  1O80 A;  1VQJ A;  2D0O A;  3VYU A;  3G6E A;  3UDG A;  1HZ9 A;  2HQL A;  4GNX C;  1EY9 A;  5K36 H;  1SMX A;  3NUC A;  4YWK A;  5JPN C;  3CXC A;  2VW9 A;  1T5X D;  2F4I A;  1YNN D;  3NQI A;  4DAY A;  4H7B A;  3AU7 A;  3RZD B;  5CR3 A;  5EBC A;  4GOP C;  2B2V A;  1YZ6 A;  4H44 C;  4XIG S;  3S1Q B;  1IBK L;  1F2Z A;  2QCP X;  2HDL A;  1KLU D;  1IKM A;  3RLF A;  1PDQ A;  4ZCK A;  2O4X A;  1QE6 A;  5JEA G;  4IPC A;  1ASZ A;  4X65 L;  4GN5 A;  2TSS A;  2RKS A;  3PIP A;  1GM5 A;  1LM0 A;  4QUC A;  3RN5 A;  4JI1 L;  5J3B A;  1PRT D;  1KD1 C;  3RD4 A;  1L1O A;  3PF4 A;  1EIF A;  3KFU A;  3DEP A;  4LF9 Q;  2AMC B;  3OW2 A;  3BYY B;  4OL7 A;  3MXG A;  5IGC A;  2PNH A;  1WTH A;  1GVP A;  2KHJ A;  3D6W A;  1MJE A;  1BOS A;  3OHX C;  1D5M C;  1HNZ L;  1H9K A;  4QL5 A;  4PQX A;  1ENA A;  2PZW A;  1LTS D;  1IYU A;  2B39 A;  5M3M G;  1AW7 A;  1WD1 A;  2SEB D;  3TRE A;  4ABN A;  4H13 C;  5FO8 B;  4LW1 A;  4YY3 L;  4HJA A;  1PH5 A;  1PXU A;  1HNW Q;  2NVX B;  1Z7T A;  4K6D A;  2KCT A;  5AJ3 L;  4POG A;  1C7Y A;  4B3M Q;  3MEH A;  3S14 B;  2OEO A;  4DV0 Q;  1IZ6 A;  1HA6 A;  2CQO A;  1IBM L;  4QY7 A;  5CMD A;  4A3L G;  3S1Q H;  2PW5 A;  2GVB A;  3J81 E;  2C35 B;  4AYB G;  1Q46 A;  4RG1 A;  2YU9 H;  5EAY A;  3HOU B;  1OXU A;  4TKO B;  4CBV A;  3K6O A;  2K32 A;  3I4M G;  4JI4 L;  1CKN B;  2EY2 A;  2K52 A;  2WB1 E;  3FKI B;  4OWW B;  5C44 G;  1VQL A;  1K3R A;  4R4I A;  3MA2 B;  5TSS A;  3I70 A;  1E2Z A;  5ELE A;  3D3R A;  2JA7 H;  3FEW X;  3PO3 B;  4BBS H;  4ID6 A;  2BH8 A;  4NXM L;  4IUR A;  3OPO A;  4F88 A;  1VF7 A;  2A8V A;  4DU9 A;  5FK9 C;  3E0E A;  4RAU C;  2K1B A;  2F0F A;  2YTV A;  1TR5 A;  1QVG A;  2G5D A;  2R7F A;  1VQC A;  4IJH A;  1XPU A;  4R1J A;  4DR3 L;  1J5E L;  2FXQ A;  1KRS A;  2Z9H A;  2F0Q A;  4X3K A;  4O2D A;  3WDN A;  3GTG B;  2NVX H;  1XMO Q;  1N32 Q;  4DNR B;  1LT4 D;  3GTP B;  2EIF A;  3M7N A;  2EZV A;  4A4I A;  4X6A H;  4Y52 H;  1H9R A;  4LUZ A;  2NTS A;  4B3S Q;  3H3V C;  2BE5 C;  3KDF B;  2I07 B;  1SLJ A;  4KI0 A;  1H95 A;  1X6O A;  1HXY D;  1U4L A;  4A3K G;  4BXX G;  1PZJ D;  3N6R A;  4DN4 M;  4J1M A;  2Y0S E;  5EPJ A;  5M3F G;  2E2J H;  1I6V C;  4R4C A;  4N9T A;  2RDH A;  4MTK A;  1YNN C;  3QOL A;  5IGB A;  1TKW B;  3OIP A;  2KA7 A;  3I4L A;  2HUG A;  3GP7 A;  2PI2 A;  5ELD A;  5I9O A;  1K9M C;  4CGY B;  4IOA A;  1NBW A;  1LYL A;  4PMB A;  1GUG A;  4X3U A;  1G91 A;  2HD3 A;  2PCF B;  2CHB D;  4CDE C;  4CKE A;  4KHP Q;  3PO3 H;  4A3C H;  4QIW B;  4DR7 L;  1SBB B;  2UXD L;  3SEB A;  5D14 A;  3IFD A;  5KRU A;  3E6Z X;  5GAE C;  5IP9 G;  3J81 c;  1PRT C;  3RMH A;  4DV5 Q;  3BJU A;  5CV4 A;  3L7Z C;  4A3G B;  2F4V L;  5D3D A;  4DV2 Q;  4A3E G;  1EZ6 A;  3ZYY X;  1V1P A;  4K6L A;  2PQE A;  3VYS A;  1Q1B A;  5C4X G;  1NY4 A;  2J7Z A;  1WTP A;  4EVO A;  3S17 B;  2K5W A;  4AYB B;  5CBA E;  3HOW B;  4P71 A;  1DGS A;  5IT9 E;  1G2T A;  4KY7 A;  2K5D A;  2K5N A;  4HJ8 A;  5JEA H;  1VQB A;  1IL2 A;  4R9W A;  2KVM A;  1J6Q A;  4MHE A;  2UUB L;  3I4M B;  3S1M B;  4FF2 A;  1ONL A;  2D5D A;  2V1C C;  1SJH D;  1RJT A;  4IPD A;  3VA7 A;  1N34 Q;  4IUQ A;  1R9T B;  2ZT9 C;  3PO2 G;  1YEZ A;  1YNJ D;  3H3V H;  5IY0 A;  3M4P A;  3RN2 A;  3C2P A;  3A5U A;  3GQB A;  2B2U A;  4KY5 A;  2F0H A;  2HCC A;  3W5O A;  2CVR A;  4JC0 A;  3UE1 A;  2CW0 D;  5M3M H;  2PI2 E;  3M4O B;  4C3I G;  1E1T A;  2QEJ C;  5IOC A;  3K0Y A;  1I3Q B;  4IZ8 A;  4MNO A;  3RR5 A;  3UDI A;  2F0M A;  4ZQ3 A;  1FJG L;  2NVT H;  4ZUJ A;  1Y1V B;  2A74 C;  1LLR D;  2WAQ G;  4HMJ A;  2E2I H;  2UXC Q;  2WB1 B;  1B1Z A;  1XNQ L;  1EOT A;  3Q22 A;  4NKL A;  4JYA L;  2C9O A;  4UP8 A;  1L1O B;  5I6Y A;  1HH2 P;  2RF4 A;  3PUZ A;  1CSQ A;  1EIH A;  3T1Y L;  4TVA B;  5CBE E;  2AUK A;  1S5E D;  4QB4 A;  1KNA A;  2ZTC A;  4EQN A;  4BY1 B;  4DUY L;  4JI3 Q;  1STB A;  4A3L H;  4DV3 Q;  3KYH C;  4KKU A;  5J22 A;  5DM6 3;  1Y8O B;  3S17 H;  3K59 A;  5M3F B;  2DUD A;  4DR2 Q;  3CCL A;  4X66 Q;  1MJC A;  5GAD C;  3T1H Q;  2KCN A;  4DR3 Q;  2E2D C;  4KMU C;  1I4H A;  2Q2U A;  5E4X A;  1A2U A;  3DEO A;  1F9Q A;  3I4M H;  1NCV A;  1UE6 A;  1EY4 A;  3FMC A;  3CPW A;  2CFM A;  5C44 H;  4G7H C;  4HCS A;  1L0X B;  4IFD I;  3HP3 A;  1CUK A;  3NP8 A;  4A3I H;  1IBL Q;  2IL8 A;  1GUO A;  4R4Q A;  1EFI D;  1CA5 A;  1HQM C;  3S15 B;  1J8I A;  3SR1 A;  2MO0 A;  4APV A;  1UAP A;  3AYH B;  2VUM G;  2EYL A;  5IT9 c;  5JPM C;  4GKJ L;  2QF7 A;  4F87 A;  1I3Q H;  1PH6 A;  2UUA Q;  3KJP A;  1EU4 A;  1EFW A;  5I9P A;  5C4X B;  1VQH A;  4WJW A;  1C8C A;  3KF8 A;  3CCQ A;  2KEE A;  3CRK C;  1UE7 A;  2HIX A;  4JI6 Q;  4C56 C;  1BCP D;  2MUY A;  1WD0 A;  1I4R A;  3DWP A;  1G8Z D;  1VQP A;  2F0E A;  1Z9F A;  3NSW A;  5BR8 Q;  1U4M A;  4PG3 A;  3RLO A;  2XN9 C;  2YTX A;  1BBU A;  4JPB W;  4AQY Q;  1FL0 A;  1PLF A;  1HNX L;  1MKH A;  2ALY B;  4JCV E;  2XGT A;  4A3K H;  4BXX H;  4A3J B;  2JEB I;  3HKZ G;  1D7Q A;  1F2Y A;  3GV3 A;  2F0J A;  2MFI A;  4L5S A;  2Z6K C;  4RGN A;  4QUF A;  2F4V Q;  4MIU A;  5FLM G;  2MGS A;  4OGQ C;  4DR1 Q;  3PO2 B;  1TWA B;  4J8Q A;  3RUZ A;  4JK1 C;  4RKL A;  3S16 H;  3PSI A;  1DOL A;  2D9U A;  4ZRZ A;  3IL8 A;  5M5X H;  4NW2 A;  4LJZ C;  1XTC D;  1Q8I A;  2QGQ A;  3I3C A;  4C3J B;  4FNF A;  1FGB D;  1UNS A;  4C3I B;  1E24 A;  3NPP A;  1GUT A;  2K05 A;  2KHI A;  4L6T B;  3S15 H;  1TVX A;  3U50 C;  3MZ5 A;  5IP9 H;  1PFB A;  1PYS B;  3P7J A;  3S9W A;  4OX9 L;  2ZTE A;  2CH4 A;  3TME A;  2JE6 I;  3CW2 C;  2R92 G;  4Y7N B;  2ICI A;  4LF7 L;  1LTI D;  4A3E H;  3FP9 A;  4C1N K;  1PV4 A;  1YNJ C;  2EYO A;  1G2S A;  2VQE Q;  4K5X A;  4G7Z C;  4OEL B;  1XNR Q;  3HZX A;  3PUY A;  3M7G A;  1SE4 A;  3AEV A;  1WOC A;  5EKL A;  2HIV A;  1SEB D;  2CW0 C;  3ERO A;  4IUV A;  3C46 A;  3NEN A;  2L0C A;  3K5M A;  3RZO B;  3SDZ A;  2VY3 A;  2V4D A;  2SOB A;  2VB3 X;  3NTH A;  3E3X A;  1UEA B;  5DAU A;  3NWT A;  1DCZ A;  1JOQ A;  4KKS A;  1A3T A;  3SGI A;  2H4O A;  1Z47 A;  4UP9 A;  1PYB A;  1HR0 W;  2BOS A;  1V1Q A;  4ZLT F;  3DMU A;  4RA8 A;  1A62 A;  3PO2 H;  1TWA H;  1BO0 A;  5I4D A;  4LUV A;  4JI0 Q;  1IKL A;  1EWI A;  5IOD A;  4DUZ Q;  3SXH A;  2NVY H;  2I5L X;  1FNV A;  2VUM B;  1PA6 A;  2NB0 A;  1CKN A;  4DR5 Q;  2K5Q A;  3K5L A;  3T56 B;  4ALP A;  1UE5 A;  2KCC A;  1UWV A;  1VQ7 A;  4RKB A;  1HUN A;  3TP6 A;  4CDF C;  2LFN A;  1CHQ D;  3K7A H;  3ER0 A;  3F2D A;  4LF9 L;  2A68 D;  5C3X A;  3J80 i;  3GTQ B;  2N55 A;  1KRT A;  3SK8 A;  3P75 A;  4QJF A;  3HFZ B;  4H02 A;  5LMN W;  1S5D D;  3BZC A;  1VF5 C;  1JOO A;  5CV8 A;  1GJX A;  1LTG D;  3BG3 A;  2E76 C;  1D1K A;  5IYC G;  1I4X A;  3PUW A;  3PIO A;  1Q3L A;  4XYO A;  3J80 L;  1SE3 A;  1E22 A;  1TWH B;  3HKZ B;  3IKJ A;  1ZXT A;  5IYD G;  1KAB A;  4P74 A;  4RCO A;  1SFO B;  3RZO H;  1HFN A;  1HNW L;  1XJV A;  1QOH A;  2IWH A;  5E1F A;  3TP7 A;  2R93 G;  1TXY A;  3KDF A;  5LL6 S;  1Z6H A;  4P73 A;  4DV0 L;  5KYL A;  2J4X A;  2NUC A;  2JA7 G;  1YHQ A;  1BCP C;  3CP0 A;  2A6H D;  1HA5 A;  1I4P A;  2BCO A;  4FF3 A;  1LUZ A;  4RCN A;  4YCV A;  2JP1 A;  3DUZ A;  3U9O A;  1EOV A;  4N9P A;  1LTB D;  1EQQ A;  1B50 A;  2VUM H;  5C0X I;  1HNX Q;  4EQ5 A;  3BVZ A;  3W2D A;  1V1O A;  5C4Z A;  1VS0 A;  4U68 A;  2JEA I;  2R92 B;  4B08 A;  4ULL A;  1PH1 A;  1KQS A;  1Y69 U;  3CU7 A;  1SXT A;  2XSC A;  3I8Z A;  4UHV A;  2KEC A;  1JWM D;  4JG2 A;  4YCW A;  3HOZ G;  4UPA A;  5CGK A;  5EGT A;  1F77 A;  4FVM A;  1DJR D;  1X3F A;  5I2X A;  3VR2 A;  4DV6 Q;  1FNW A;  4ZAI A;  1CKM A;  4P72 A;  4U67 3;  1VQ8 A;  4KD4 A;  1I94 Q;  1BR9 A;  4ME5 A;  1VDZ A;  4GLA C;  2WII B;  3KF6 B;  2K50 A;  4IPH A;  2QDB A;  4HN7 A;  3J81 L;  2RBM A;  3E9I A;  3OTO Q;  3HRZ C;  4IOC A;  1G51 A;  3CME A;  5A35 A;  4C3H G;  1JMC A;  2M9V A;  3RNU A;  1TWH H;  1VQ5 A;  1VQK A;  1GD7 A;  1SFO H;  2Q2T A;  1YIJ A;  1D1I A;  1ET6 A;  3EVQ A;  5FLM H;  1SMY D;  1CQF A;  1XMO L;  4XQN A;  1P16 A;  1N32 L;  2G9D A;  2EJM A;  1BQQ T;  4OO1 I;  3ERS X;  5IGG A;  2CCZ A;  4MZ9 A;  3C3L A;  3QOJ A;  4B3S L;  4DK6 C;  1EIG A;  1FVI A;  3KBX A;  2KEN A;  5EBD A;  2JA6 G;  1NR2 A;  3S24 A;  3JAM i;  1IYJ B;  3NEL A;  4RGO S;  3K5N A;  1VQE A;  2MNA A;  1XPR A;  5GAH C;  1TWG B;  5BN5 A;  4FDB A;  1SE8 A;  2R92 H;  3A55 A;  1AP0 A;  3KUP A;  3K5O A;  1STY A;  1RD9 D;  3JAM L;  2UXB Q;  1NMG A;  2EQS A;  3EJI A;  2B2W A;  4Z9C B;  3FRP B;  4A3D G;  4XXE A;  2L5T A;  2Z8L A;  1JOR A;  1WI5 A;  2FMM A;  4QIW E;  2IX3 A;  1VQ6 A;  4KHP L;  4GNX B;  2B2Y A;  4RHR A;  1ROD A;  2YU9 B;  3V05 A;  4HMI A;  4J15 A;  1PFS A;  3QO2 A;  5ELC A;  4LWC A;  1SN8 A;  1Q86 C;  1HFG A;  3J7A V;  2KCM A;  1BBX C;  3PGZ A;  1Y1W G;  4KV6 A;  4DV5 L;  1XXG A;  2A73 B;  1H9S B;  4GOP B;  2EYH A;  1CFM A;  3U4V A;  1S5F D;  2A68 C;  3H09 A;  1CA6 A;  3G4S A;  2KHS A;  4DV2 L;  3TDQ A;  3HG9 A;  3HGB A;  3D4D A;  2JA7 B;  3M4Q A;  1VQM A;  4BBS B;  3MTS A;  5K5P A;  1I4Q A;  1L0Y B;  4OEM B;  1XMQ Q;  1NJI C;  3H6M A;  1LAB A;  4OIJ A;  3HOY G;  1SJE D;  3R3O A;  3VR4 A;  1OTC A;  4IFD G;  4AYB E;  2X69 A;  2X6L A;  1ML0 D;  1PH2 A;  1EEI D;  4C1N I;  5COR A;  4LFB Q;  1JB3 A;  4N8F A;  5DNF A;  5IGD A;  1NE3 A;  2DJG C;  1I6H H;  1NSN S;  5JVH 3;  1NR4 A;  2YTY A;  1X3P A;  4PZ6 A;  1A3V A;  2F3V A;  3J7A F;  5I2Y A;  3Q24 A;  1YI2 A;  1E1O A;  4DNT B;  2F0O A;  4ODG A;  4XTC S;  1N34 L;  3Q6S A;  1TWG H;  1OO9 B;  2F0S A;  2JA5 G;  2QKI C;  1KL9 A;  4QMG A;  2A6H C;  3KJO A;  1D5X C;  3S2H B;  3UDF A;  4DR4 L;  2H1E A;  5C3E G;  5IYC H;  3AB9 A;  3H94 A;  4XYQ A;  2MO1 A;  1Q1E A;  4C3H B;  2F03 A;  2JXM B;  5IYD H;  1LAC A;  3TEH B;  2RCF A;  2E2J B;  1B9M A;  1JWS D;  1E0B A;  4OWX B;  2MHV A;  3ULL A;  4CJ1 B;  1WTW A;  2R93 H;  3CC4 A;  2UXC L;  3S1N H;  1S72 A;  2RSN A;  3S2D H;  4PMW A;  4KHV A;  4A3I G;  4C2M H;  2LKV A;  2XWJ B;  4WJ4 A;  1N8R C;  1CI3 M;  2BH2 A;  2P5Z X;  3CCS A;  5EPK A;  5ELO A;  4JI3 L;  1C4Q A;  1TY0 A;  4DV3 L;  5J1Z A;  4JOI C;  3CCV A;  4DR2 L;  1LV9 A;  2B2T C;  4X66 L;  1WTV A;  3T1H L;  2E75 C;  4TQU S;  3QB3 A;  1W6J A;  4DAM A;  3O13 A;  3U58 A;  4IUP A;  1OXT A;  1SMY C;  2HT1 A;  1RTN A;  2QDL A;  1N9W A;  4DK1 A;  1I5F A;  3HOZ H;  3FVQ A;  1PTO F;  1QJO A;  4XT1 B;  1JR0 D;  4XQQ A;  1K3B C;  5EPL A;  3I56 A;  4A3D B;  1ESF A;  3L3O C;  2WP8 J;  5KIX A;  1WCM G;  3GTO B;  2K01 A;  1IBL L;  4JV5 Q;  4BY7 G;  1LT5 D;  1QVC A;  2ICE C;  1KNE A;  3S2H H;  4HSP A;  4HID A;  1QB5 D;  1EY5 A;  2JN4 A;  2RHQ B;  3BDO A;  1RTO A;  2TMP A;  3D6C A;  3W3A A;  3WOE A;  4FF4 A;  4G57 A;  3I73 A;  4C3H H;  3P1H A;  3BS1 A;  1HJP A;  1SNM A;  2UUA L;  1EY0 A;  1EIY B;  5L37 A;  1O7L A;  2M00 A;  2OWO A;  3PV0 A;  2LSS A;  3EN2 A;  4JI6 L;  1D2B A;  1EEF D;  1FGU A;  3K57 A;  2Z6B A;  2O5J C;  5M3M B;  3SVM A;  5LMU Q;  3NXW A;  5BR8 L;  4HIO A;  3GTK B;  2NYZ D;  5KEE A;  1JE5 A;  3WWV A;  2SDF A;  1STG A;  4AQY L;  2JA6 H;  5IP7 G;  1QWY A;  4JI8 Q;  2NVT B;  3QJY A;  4UDU C;  1LT3 D;  2E2I B;  4V0B A;  3NTK A;  3I55 A;  3HEJ A;  1CTM A;  2JA5 B;  1L0W A;  1NAP A;  1EYA A;  2J0T D;  4AH6 A;  1YBY A;  5FO7 B;  4DR1 L;  2N49 A;  1FD7 D;  4PZ7 A;  3NBI A;  1PFN A;  3I4O A;  2EY6 A;  2AHO B;  1DON A;  2VS1 A;  1KC8 C;  2EPB A;  4A3D H;  1V8Q A;  1C9O A;  4IUU A;  1PRT B;  1RHP A;  3GTO H;  1YHB A;  1DD2 A;  2K6A A;  1MIU A;  1KDA A;  2R6G A;  2WAQ E;  2F0G A;  3PUX A;  5JVG 3;  1Y1W H;  1W6K A;  1G6P A;  1A63 A;  1W2B A;  2D2C C;  3NBH A;  4QCL A;  5C44 B;  3H91 A;  3GTJ B;  1MI2 A;  1SNQ A;  1C0A A;  5F2D A;  3G7L A;  2NZ1 D;  4A3I B;  1MBY A;  4JBJ A;  2VQE L;  5J39 A;  4XDX A;  2JSO A;  3D8G A;  4PZ8 A;  1XNR L;  3F2U A;  4JI5 Q;  1GOZ A;  3HOY H;  2A6E D;  3VR3 A;  4IFD H;  4X3T A;  4DR4 Q;  2ENB A;  2L11 A;  2R7Z G;  4UP7 A;  5DEH A;  3GTK H;  2IHF A;  3JC6 6;  1JJC B;  2JA8 G;  1C48 A;  2ATW A;  2B2V C;  1HPC A;  3GV6 A;  3RLN A;  5C0X G;  5CV6 A;  1KDC A;  4K2K A;  3TBI B;  2I46 A;  2ZJR A;  2MP1 A;  2I5M X;  3I4N H;  2E8G A;  3L2P A;  2EYF A;  2K7V A;  4BBR G;  5C4H A;  2JA5 H;  1IYV A;  1STN A;  2F0P A;  1SSO A;  4BY7 B;  4GZY C;  4JI0 L;  1L1O C;  1JE4 A;  5IGE A;  4DUZ L;  1H9M A;  1RCV D;  2D62 A;  5C3E H;  3CCE A;  1CM9 A;  4A3K B;  4DR5 L;  5JJI A;  3OW7 A;  2XIW A;  1JJ2 A;  1SAP A;  3TRZ A;  2EJF C;  2OF1 A;  1SRO A;  1PMR A;  2F0D A;  1SNC A;  5KYI A;  2UU9 Q;  4B3T Q;  2NBF A;  4A75 A;  3KLR A;  4QGU A;  3S16 B;  3TZD A;  3DXJ C;  2FHT A;  2MPM A;  4DV4 Q;  4OWT B;  2DN8 A;  3CKI B;  3GTJ H;  5M5X B;  3G48 A;  3KF6 A;  2BDO A;  2GN5 A;  1Q90 A;  2QA4 A;  1F9R A;  1U5K A;  1K0R A;  5D3I B;  4RWS C;  4HJ9 A;  5KNC A;  4KY6 A;  2B3G A;  3HKZ E;  1YJW A;  3SE0 A;  3MEF A;  3A7L A;  4A3M G;  2C5C A;  4RGM A;  4LFC Q;  1AZP A;  1VQN A;  1QNK A;  3Q8D A;  1RIP A;  3QIA A;  2JK8 A;  1AN8 A;  4A3E B;  3GTL B;  2AQ1 B;  1GO3 E;  1E3P A;  2LXK A;  2OT2 A;  1JWU D;  4RFB A;  1STH A;  1K28 A;  1EL0 A;  1TQO A;  4GLV B;  4IQZ A;  2B8F A;  2NN6 I;  3Q23 A;  3R8B A;  3HOX G;  2WKD A;  1WCM H;  2EYP A;  1PTO D;  4BY7 H;  4LF8 Q;  4A3F G;  1S5C D;  2AQ2 B;  3GD7 A;  4HR7 B;  5T1G A;  4OIK A;  2VQF Q;  2HHH Q;  5DM7 3;  4LF6 Q;  3B6Y A;  3CQZ H;  3ERQ A;  4DNI A;  3T16 A;  1FNU A;  1XYI A;  1B8A A;  4GNX A;  2O5I C;  3MC0 B;  4A3B G;  3BVG A;  1I4G A;  1TY2 A;  4DV6 L;  3R2I A;  3J7Z C;  2NVY B;  4CJ0 B;  3CC2 A;  1UUP A;  1HZB A;  1N33 Q;  2GVA A;  1I94 L;  4FYD A;  3VR5 A;  2AKW B;  1H9S A;  4GOP A;  4S3S A;  4UAI A;  5E3F A;  1KDB A;  3OTO L;  5CV5 A;  1A0I A;  1X3G A;  4HJ5 A;  4EQP A;  5IP7 H;  2KED A;  3K7A B;  2B29 A;  1ILQ A;  1TS5 A;  3W1G A;  1SNO A;  1CQV A;  2PQA B;  2WAQ B;  4BBR B;  1RF2 D;  1RL2 A;  3CC7 A;  1NTG A;  2L1B A;  3GTL H;  3FPP A;  1ASY A;  1MGS A;  3ULJ A;  1B70 B;  3A8I E;  2CKZ B;  3D31 A;  4JW0 A;  5FO9 B;  2A6E C;  2EXZ A;  3LGJ A;  5NUC A;  5HUR A;  5CYU A;  5GAG C;  1HCZ A;  2NZO A;  4FXG C;  4L5T A;  1QZH A;  4KN4 C;  3CHB D;  2IPK D;  1KIX A;  4GS3 A;  1WTQ A;  4F8M A;  1LTT D;  4CDC C;  2PNR C;  3OMG A;  4HIK A;  4KKT A;  3E9H A;  3D0F A;  4ILW A;  2UXB L;  4JBK A;  1XTD A;  2Z4I A;  1L2F A;  3BDC A;  3HKS A;  4G4K A;  1PRT F;  1HRJ A;  2EXD A;  1HUM A;  4IAL A;  4PV1 C;  1O7Z A;  2VL6 A;  2R7Z H;  1HTP A;  4DKA C;  1MHW C;  5C3W A;  2NVQ B;  2JA8 H;  1SDF A;  5C0X H;  3DWA A;  4RHS A;  1ET9 A;  4HJ7 A;  2LS0 1;  4WFN 3;  2F0K A;  1JQY D;  2AWO A;  2XRQ D;  1WTO A;  4BBR H;  1JB7 A;  1AH9 A;  1J9O A;  4DA2 A;  4X64 Q;  1CZW A;  1XMQ L;  3NBH B;  4K5V A;  4B3R Q;  2KBN A;  3K58 A;  3DHQ A;  2WFW A;  3CCU A;  4JBM A;  1VQF A;  1EQT A;  2L9H A;  3VA5 A;  1VCI A;  3A5Z B;  1EQV A;  1JIC A;  3MWY W;  1W3S A;  3MFY A;  5JEA J;  3MHB A;  4LFB L;  1YJN A;  1K73 C;  1XX8 A;  2EOT A;  1K8M A;  2B2U C;  2CWP A;  2L15 A;  4K0K Q;  3K81 C;  2Q8I B;  4IJL A;  2UUC Q;  4A3B B;  1BXT A;  2ES2 A;  1PZK D;  3CMA A;  1HR0 Q;  3HS0 C;  1SND A;  4DXF A;  1PH7 A;  5M5W H;  4DV1 Q;  1STA A;  1PTO C;  2XTI A;  3M3Y H;  3Q0A A;  1VMP A;  3V2T A;  1RKN A;  1X3Q A;  2D0P A;  1CT1 D;  2EYJ A;  1M1K C;  1K8O A;  1ICF B;  4A3M H;  1S40 A;  4LK1 C;  3BZK A;  4NXN Q;  3SK5 A;  4X62 Q;  1BCP B;  4LF5 Q;  4XT3 B;  5FJ8 G;  4NDX A;  2KOL A;  2ZXP A;  4DV7 Q;  2NVQ H;  3KLS X;  3J81 i;  1DM0 B;  1IW7 D;  5IYB G;  2RA4 A;  3NE5 B;  4O1N A;  3ULP A;  1F2L A;  5LMN Q;  3M85 A;  1Q81 C;  2PW7 A;  2M2L A;  2K75 A;  4NP5 A;  1PH8 A;  4GLX A;  3HOX H;  1EQR A;  3I72 A;  3EIV A;  4JBW A;  4A3F H;  1GHJ A;  5E4W C;  1TWF H;  3IRB A;  1EWH A;  3DM1 A;  1T9H A;  2RCN A;  1TWC H;  1K8G A;  1X65 A;  4YHH Q;  1OXX K;  3A8K E;  5ELN A;  5JOB A;  5A2Q E;  1IL8 A;  1WTX A;  4LFA L;  3OSO A;  4KTA A;  4BWG B;  2IJ0 A;  1MD2 D;  1ESR A;  3SK4 A;  4A3B H;  3GDE A;  1G29 1;  5IE8 A;  2VB2 X;  4A93 G;  1I50 B;  1G6Z A;  1SYG A;  4JV5 L;  3UE0 A;  5KGU A;  3BVM A;  1EZ8 A;  3E5S A;  2Q8T A;  1I6H B;  3LWE A;  3HOU G;  4HIM A;  3A0J A;  3G71 A;  4JI2 Q;  2F0T A;  2DGY A;  2BA0 A;  3FKI G;  2ZM6 Q;  1WJJ A;  4YWL A;  4GN3 B;  1D6E C;  3TN2 A;  4KD3 A;  1O78 A;  3PQI A;  1EY6 A;  1LTA D;  1UEB A;  3BDL A;  4HAE A;  1DOM A;  2ZJP A;  2BA1 A;  2K33 A;  2ZXO A;  4RH6 A;  2AQ3 B;  1SYB A;  5IGF A;  5LMU L;  1P8L A;  4ME3 A;  1QIL A;  5FOB B;  3UDX A;  4IO9 A;  5CC4 A;  5IWA Q;  4FXK C;  3IFT A;  1EY8 A;  4GKK Q;  2DNC A;  4JI8 L;  5H1S E;  2F0V A;  2R93 B;  3TS2 A;  1A3U A;  1F2M A;  3S1N B;  3U4Z A;  2I5H A;  3PIP 3;  2N8N A;  3S2D B;  1MSH A;  2RSO A;  1B44 D;  4C2M B;  5D65 A;  4DK3 C;  3J80 E;  4A76 A;  5FLX E;  1I50 H;  3CRL C;  1K83 H;  3NK9 A;  1TT2 A;  1PH9 A;  3OOC A;  2JJQ A;  1EYD A;  3N52 A;  3MVV A;  4CKB A;  1VQA A;  1X9N A;  2E74 C;  3ICE A;  4NPS A;  3I90 A;  1N36 Q;  1WTR A;  1B3Q A;  3I4N G;  4Q5V A;  3R2T A;  3V96 A;  2X6G A;  3HOZ B;  1BDO A;  5M5Y B;  2N78 A;  1QUQ A;  4I65 A;  4JI7 Q;  5KND A;  1VQG A;  1PFM A;  5JJK A;  4YWM A;  2AUJ D;  4JI5 L;  5HGT A;  1GUN A;  2NN6 G;  3LX0 A;  1AFP A;  5IT9 L;  3SHL A;  1ZKO A;  3MXN B;  4FP5 D;  2B63 G;  2N88 A;  1M8A A;  1NMF A;  2SNS A;  3I2Z A;  4CHT B;  3NQT A;  3NTI A;  1EYG A;  4A3G G;  4YCU A;  5GQO A;  2DY7 A;  1M90 C;  2YV5 A;  1IW7 C;  4I7Z C;  1CHP D;  3RZD H;  4A93 B;  1SR3 A;  2EVB A;  3BU2 A;  2KUM A;  3VYT A;  1ZYR D;  1XWE A;  1X56 A;  4LF4 Q;  3A56 A;  3HOW G;  2JA6 B;  3P20 A;  2OCE A;  4ZYS A;  3E0J A;  2IX1 A;  2E5L Q;  2A1A A;  3T13 A;  5C0X J;  1SYE A;  3FHW A;  3K80 C;  1YVC A;  2UU9 L;  5KNB A;  3MXP A;  4B3T L;  2EE1 A;  4POF A;  3DM3 A;  5FJ8 H;  4ZKB B;  4DV4 L;  4LFA Q;  1V9P A;  3KOJ A;  4MTN A;  4O0A A;  5IYB H;  1ILP A;  2XWB B;  1HHV A;  3CPF A;  5M5Y H;  4TSS A;  2Z6K A;  5IIF A;  3K8A A;  1EY7 A;  1SNP A;  2F0N A;  3AQQ A;  1KHI A;  1BVS A;  4GN4 B;  5E7N A;  4RGT A;  2PQA A;  1WVL A;  3J80 c;  3W1B A;  5FLX c;  1T5E A;  1O7Y A;  2K5V A;  4X3S A;  3I7F A;  1Y1W B;  2MQH A;  5HY6 A;  4LFC L;  1BCP F;  4FF1 A;  2VNU D;  1EUJ A;  2F0L A;  3ND9 A;  3EA6 A;  2FJ2 A;  4L5Q A;  1Y1V G;  2WB1 G;  3T4A C;  3JAM E;  3S14 H;  2Q2H A;  3WOF A;  3HOV G;  2HCI A;  3F8T A;  3QR8 A;  2A19 A;  3HOY B;  1AE3 A;  1MSG A;  2DY8 A;  4A93 H;  1OXS C;  4BY1 G;  4NB3 A;  1YNX A;  1X32 A;  4DR6 L;  4LF8 L;  3VR6 A;  4KK7 A;  5C6A A;  3C1E A;  1E2V A;  4DFA A;  4K5W A;  3HOU H;  1AE2 A;  2VQF L;  2HHH L;  4WOR A;  3VYR A;  3QWN A;  4LF6 L;  3I4N B;  3PMF A;  3FKI H;  1D5Z C;  4V19 0;  2RDG A;  2IY5 B;  5JJL A;  1SYC A;  3J7A 5;  4DPG A;  2OTL A;  1IBK Q;  4HCE A;  1EYC A;  1DOK A;  5C3E B;  3UI2 A;  2L12 A;  2HDM A;  1N33 L;  2MJ8 A;  3TSS A;  4X65 Q;  2B63 B;  5BN3 A;  4JI1 Q;  3A74 A;  1EWC A;  2B8G A;  3NEM A;  5AFW A;  2WKC A;  2OQ0 A;  2Y0S G;  5G3L F;  2K04 A;  4BS9 A;  3PUV A;  1Q8K A;  4LAA A;  3URY A;  1KXL A;  2N3S A;  1TS4 A;  3GTG H;  3S1R B;  1HNZ Q;  3KK7 A;  2NZH A;  4IUT A;  2F1M A;  2PZU A;  4DAP A;  3GTP H;  3GTM B;  4MN3 A;  1IXR A;  2ZJQ A;  3X3M A;  2JQO A;  4B9X A;  1CKO A;  2PZT A;  5FKA C;  1GXD C;  4K8I A;  2K4K A;  3K0X A;  1QVF A;  3T53 B;  1VMC A;  4IPG A;  1DYQ A;  2ZTD A;  1A8V A;  1ZEQ X;  1AZQ A;  4PMC A;  4YY3 Q;  4A3J G;  1VQI A;  1LTL A;  3M9B A;  2B2W C;  4TRD A;  1Y8P B;  5AJ3 Q;  2ZXR A;  4KJN A;  3TZU A;  5C5M A;  3TQY A;  1HQR D;  4YIJ A;  3CF5 A;  2B2Y C;  1FR3 A;  1B3A A;  1KLG D;  2F3I A;  2R3Z A;  2KJX A;  3JAM c;  1IBM Q;  3OYY A;  4E6I A;  1WCM B;  1ZYR C;  2IW3 A;  5T1I A;  2EY5 A;  2RHS B;  3R93 A;  4DAY B;  4C3J G;  1M4V A;  2FIN B;  3G6J B;  3FPU B;  4OON A;  4KN7 C;  4P75 A;  2OQK A;  2BDN A;  2NN6 H;  1BF4 A;  3AMU A;  3CAM A;  3KLW A;  1KAW A;  2B63 H;  2XVS A;  1JCK B;  3I91 A;  3CQZ B;  4JI4 Q;  1BUV T;  5EQ0 A;  3TP8 A;  3IAY A;  4A3G H;  3KBG A;  3HOV B;  3L9A X;  2K03 A;  3CCM A;  4KHZ A;  4HTH A;  3MFG A;  3K7U C;  4NXM Q;  4X64 L;  3S1R H;  1CK1 A;  3GTM H;  4B3R L;  1QZG A;  3DLL A;  4ZK9 B;  1QUQ B;  3HOW H;  4OO1 G;  2KQ3 A;  2L4N A;  2CQA A;  4R4T A;  2PPB C;  1WFQ A; 
#chains in the Genus database with same CATH homology
 1LT6 D;  2LY7 A;  3NWS A;  1HTL D;  1GHK A;  1DZ1 A;  1LTR D;  2EYM A;  3LWU A;  3FDT A;  3J7Y W;  4FO2 A;  2A5H A;  1U4P A;  2XRS D;  5EJW A;  5C4J B;  4M1U B;  5ELB A;  1B2T A;  2Y0S B;  3X3N A;  1PZI D;  4LMQ D;  2SNM A;  4WRD A;  4ZKC B;  2A69 D;  4R8N A;  3OWE B;  3NHH A;  1QCB D;  4K14 A;  5JAV A;  5I6W A;  1SYF A;  2YYZ A;  4XQJ A;  2R7Z B;  1Q12 A;  4HED A;  4OHJ A;  2JA8 B;  1SYD A;  2F0W A;  5LL6 X;  3DWQ A;  3EQL C;  1LO5 D;  1B53 A;  1PYW D;  2Z4H A;  4P2C B;  3SK6 A;  1U9R A;  1EU3 A;  4G7O C;  2EY1 A;  5LHY 1;  5JJZ A;  4M8A A;  2NWG A;  4CKC A;  2OXP A;  1DXM A;  3OMC A;  2WV6 D;  1F9S A;  5K36 G;  2WIN B;  3D4W A;  1E2W A;  2NTT A;  1B4O A;  4KJO A;  2F0I A;  2RVL A;  4B9W A;  2QIL A;  3LNN A;  5A2Q L;  1CZG A;  3A54 A;  5G3L D;  1IHZ A;  4L8J A;  5M5W B;  2F0U A;  3MXN A;  4PNY A;  2E2H B;  4DAV A;  3M3Y B;  5BN4 A;  1ICW A;  1R4P B;  1H9J A;  4A3M B;  1RDP D;  4R8I A;  2O2L D;  4HSV A;  2VXW A;  3EFX D;  1QG7 A;  1AEX A;  3A7A B;  1KAA A;  1TS2 A;  4EGV A;  3A8J E;  3U9S A;  4H0L C;  2L55 A;  4EQO A;  5EKI A;  1II3 A;  1A15 A;  3HOX B;  1A2T A;  1V1P B;  3MXU A;  2IX0 A;  2XNA C;  2LMC B;  5EKK A;  4A3F B;  1TWF B;  4BA2 I;  5C5L A;  4Q0F A;  2DNE A;  5CV7 A;  1R4Q B;  2RQX A;  4DK0 A;  2GA4 B;  1QNU A;  2Q8R E;  1TWC B;  4J6H A;  3PIO 3;  4NMZ A;  1F9P A;  1TS3 A;  3T51 B;  2WAC A;  2B2T A;  3C1F A;  1OXV A;  3ITP A;  2PO4 A;  1KTK A;  4IFD J;  5FLX L;  1TII D;  3MAQ A;  3H0G B;  4OO1 H;  1SE2 A;  3BZD B;  5M9O A;  2FMC A;  2JYO A;  3QG1 A;  3M4Y A;  2A69 C;  1GUS A;  1ENF A;  1U4R A;  4BA1 I;  1PTO B;  3D4R A;  3OWF A;  1S5B D;  3ND8 A;  2ID0 A;  1V43 A;  2G9H D;  4L63 B;  3BYT B;  4K8J A;  2HQE A;  2IT1 A;  1ENC A;  1FYC A;  1NUC A;  4DXG A;  3GO5 A;  4ZUI A;  3KLS A;  4O42 A;  1JC7 A;  4CJ2 C;  1TU2 B;  1A6X A;  3OIQ A;  1K83 B;  1B9N A;  4K2L A;  1S4Z A;  2F3W A;  5ISR A;  2PYK A;  4DGZ A;  5CV9 A;  2RDF A;  4IUN A;  4IN3 A;  4FXD A;  1STE A;  1BNZ A;  2K28 A;  2FFK B;  2EJG C;  2EDG A;  4QF4 A;  4F7X A;  3ONA B;  5COY A;  2AWN A;  1JOK A;  4DF7 A;  2Z1C A;  1GUW A;  2BE5 D;  5ELF A;  2R61 A;  1PTO H;  3TP5 A;  1Y8N B;  2PMZ B;  1O80 A;  3VYU A;  1EY9 A;  5K36 H;  3NUC A;  5JPN C;  1T5X D;  2F4I A;  1YNN D;  3NQI A;  4DAY A;  4H7B A;  3AU7 A;  3RZD B;  5CR3 A;  5EBC A;  2B2V A;  4H44 C;  4XIG S;  3S1Q B;  1F2Z A;  2QCP X;  2HDL A;  1KLU D;  1IKM A;  3RLF A;  1PDQ A;  2O4X A;  1QE6 A;  5JEA G;  2TSS A;  2RKS A;  4QUC A;  1PRT D;  3RD4 A;  3DEP A;  3BYY B;  4OL7 A;  3MXG A;  5IGC A;  3D6W A;  1BOS A;  3OHX C;  1D5M C;  1H9K A;  4PQX A;  1ENA A;  2PZW A;  1LTS D;  1IYU A;  2B39 A;  1AW7 A;  1WD1 A;  2SEB D;  4ABN A;  4H13 C;  5FO8 B;  1PXU A;  2NVX B;  1Z7T A;  4K6D A;  3MEH A;  3S14 B;  2OEO A;  1HA6 A;  5CMD A;  2PW5 A;  3J81 E;  3HOU B;  1OXU A;  4TKO B;  4CBV A;  3K6O A;  2K32 A;  2EY2 A;  3FKI B;  3MA2 B;  5TSS A;  3I70 A;  1E2Z A;  5ELE A;  3D3R A;  3FEW X;  3PO3 B;  4ID6 A;  4IUR A;  3OPO A;  4F88 A;  1VF7 A;  4DU9 A;  5FK9 C;  4RAU C;  2K1B A;  2F0F A;  1TR5 A;  2F0Q A;  4X3K A;  3WDN A;  3GTG B;  4DNR B;  1LT4 D;  3GTP B;  3M7N A;  2EZV A;  1H9R A;  2NTS A;  3H3V C;  2BE5 C;  2I07 B;  4KI0 A;  1HXY D;  1U4L A;  1PZJ D;  3N6R A;  4DN4 M;  4J1M A;  5EPJ A;  1I6V C;  4N9T A;  2RDH A;  1YNN C;  3QOL A;  5IGB A;  1TKW B;  3OIP A;  2KA7 A;  3I4L A;  2HUG A;  3GP7 A;  5ELD A;  5I9O A;  4CGY B;  4PMB A;  1G91 A;  1GUG A;  4X3U A;  2PCF B;  2CHB D;  4CKE A;  4QIW B;  1SBB B;  3SEB A;  5D14 A;  3IFD A;  5KRU A;  3E6Z X;  1PRT C;  3RMH A;  5CV4 A;  3L7Z C;  4A3G B;  5D3D A;  1EZ6 A;  3ZYY X;  1V1P A;  4K6L A;  2PQE A;  3VYS A;  1Q1B A;  2J7Z A;  1WTP A;  4EVO A;  3S17 B;  2K5W A;  4AYB B;  5CBA E;  3HOW B;  5IT9 E;  1G2T A;  4KY7 A;  2K5D A;  5JEA H;  4R9W A;  2KVM A;  4MHE A;  3I4M B;  3S1M B;  4FF2 A;  1ONL A;  2D5D A;  1SJH D;  1RJT A;  3VA7 A;  4IUQ A;  1R9T B;  2ZT9 C;  1YNJ D;  3C2P A;  3GQB A;  2B2U A;  4KY5 A;  2F0H A;  2HCC A;  2CVR A;  2CW0 D;  3M4O B;  4C3I G;  2QEJ C;  5IOC A;  3K0Y A;  1I3Q B;  4IZ8 A;  2F0M A;  4ZQ3 A;  4ZUJ A;  1Y1V B;  2A74 C;  1LLR D;  4HMJ A;  2WB1 B;  1B1Z A;  1EOT A;  3Q22 A;  4NKL A;  2C9O A;  5I6Y A;  3PUZ A;  1EIH A;  5CBE E;  2AUK A;  1S5E D;  4QB4 A;  1KNA A;  4EQN A;  4BY1 B;  1STB A;  4KKU A;  5J22 A;  5DM6 3;  1Y8O B;  3K59 A;  5M3F B;  2KCN A;  2E2D C;  4KMU C;  1I4H A;  5E4X A;  1A2U A;  3DEO A;  1F9Q A;  1NCV A;  1EY4 A;  3FMC A;  4G7H C;  4HCS A;  1L0X B;  4IFD I;  3HP3 A;  3NP8 A;  2IL8 A;  1GUO A;  1EFI D;  1CA5 A;  1HQM C;  3S15 B;  1J8I A;  3SR1 A;  1UAP A;  2EYL A;  5JPM C;  2QF7 A;  4F87 A;  1EU4 A;  5I9P A;  5C4X B;  4WJW A;  1C8C A;  3KF8 A;  2KEE A;  3CRK C;  4C56 C;  1BCP D;  2MUY A;  1WD0 A;  1I4R A;  3DWP A;  1G8Z D;  2F0E A;  3NSW A;  1U4M A;  2XN9 C;  1PLF A;  4A3J B;  2JEB I;  1F2Y A;  3GV3 A;  2F0J A;  4RGN A;  4QUF A;  4MIU A;  2MGS A;  4OGQ C;  3PO2 B;  1TWA B;  4J8Q A;  3RUZ A;  4JK1 C;  4RKL A;  1DOL A;  2D9U A;  4ZRZ A;  3IL8 A;  4NW2 A;  4LJZ C;  1XTC D;  1Q8I A;  3I3C A;  4C3J B;  4FNF A;  1FGB D;  1UNS A;  4C3I B;  3NPP A;  1GUT A;  2K05 A;  4L6T B;  1TVX A;  3MZ5 A;  1PFB A;  3P7J A;  3S9W A;  3TME A;  2JE6 I;  4Y7N B;  2ICI A;  1LTI D;  4C1N K;  1YNJ C;  2EYO A;  1G2S A;  4K5X A;  4G7Z C;  3HZX A;  3PUY A;  3M7G A;  1SE4 A;  5EKL A;  1SEB D;  2CW0 C;  3ERO A;  4IUV A;  3C46 A;  2L0C A;  3K5M A;  3RZO B;  3SDZ A;  2V4D A;  2SOB A;  2VB3 X;  3NTH A;  1UEA B;  5DAU A;  3NWT A;  1DCZ A;  1JOQ A;  4KKS A;  1A3T A;  2H4O A;  1Z47 A;  2BOS A;  4ZLT F;  3DMU A;  4RA8 A;  1BO0 A;  5I4D A;  1IKL A;  5IOD A;  3SXH A;  1FNV A;  2VUM B;  2NB0 A;  2K5Q A;  3K5L A;  3T56 B;  2KCC A;  1HUN A;  4RKB A;  3TP6 A;  2LFN A;  1CHQ D;  2A68 D;  5C3X A;  3GTQ B;  2N55 A;  3SK8 A;  3P75 A;  1S5D D;  1VF5 C;  1JOO A;  5CV8 A;  1GJX A;  1LTG D;  3BG3 A;  2E76 C;  1D1K A;  1I4X A;  3PUW A;  1Q3L A;  4XYO A;  3J80 L;  1SE3 A;  1TWH B;  3HKZ B;  3IKJ A;  1ZXT A;  1KAB A;  4RCO A;  1SFO B;  1HFN A;  1QOH A;  2IWH A;  5E1F A;  3TP7 A;  5LL6 S;  1Z6H A;  5KYL A;  2J4X A;  2NUC A;  1BCP C;  2A6H D;  1HA5 A;  1I4P A;  2BCO A;  4FF3 A;  4RCN A;  2JP1 A;  3DUZ A;  3U9O A;  4N9P A;  1LTB D;  1B50 A;  5C0X I;  3BVZ A;  3W2D A;  1V1O A;  5C4Z A;  4U68 A;  2JEA I;  2R92 B;  4B08 A;  4ULL A;  1Y69 U;  3CU7 A;  1SXT A;  2XSC A;  3I8Z A;  2KEC A;  1JWM D;  5CGK A;  5EGT A;  1F77 A;  4FVM A;  1DJR D;  5I2X A;  3VR2 A;  1FNW A;  4ZAI A;  4U67 3;  4KD4 A;  1BR9 A;  4ME5 A;  1VDZ A;  2WII B;  2QDB A;  4HN7 A;  3J81 L;  2RBM A;  3HRZ C;  5A35 A;  4C3H G;  2M9V A;  1D1I A;  1ET6 A;  3EVQ A;  1SMY D;  1CQF A;  4XQN A;  2G9D A;  2EJM A;  1BQQ T;  4OO1 I;  5IGG A;  3C3L A;  3QOJ A;  1EIG A;  3KBX A;  5EBD A;  1NR2 A;  4RGO S;  3K5N A;  1TWG B;  5BN5 A;  3A55 A;  1AP0 A;  3KUP A;  3K5O A;  1STY A;  1RD9 D;  3JAM L;  3EJI A;  2B2W A;  4Z9C B;  3FRP B;  4XXE A;  2L5T A;  2Z8L A;  1JOR A;  2FMM A;  2IX3 A;  2B2Y A;  4RHR A;  1ROD A;  2YU9 B;  3V05 A;  4HMI A;  3QO2 A;  5ELC A;  1HFG A;  3J7A V;  1BBX C;  4KV6 A;  1XXG A;  2A73 B;  1H9S B;  2EYH A;  1CFM A;  1S5F D;  2A68 C;  3H09 A;  1CA6 A;  2KHS A;  3TDQ A;  3HG9 A;  3HGB A;  3D4D A;  2JA7 B;  4BBS B;  3MTS A;  5K5P A;  1I4Q A;  1L0Y B;  3H6M A;  1LAB A;  4OIJ A;  1SJE D;  3R3O A;  3VR4 A;  4IFD G;  2X69 A;  2X6L A;  1ML0 D;  1EEI D;  4C1N I;  5COR A;  1JB3 A;  5DNF A;  5IGD A;  1NSN S;  5JVH 3;  1NR4 A;  1X3P A;  1A3V A;  2F3V A;  3J7A F;  5I2Y A;  3Q24 A;  4DNT B;  2F0O A;  4ODG A;  4XTC S;  3Q6S A;  1OO9 B;  2F0S A;  2QKI C;  4QMG A;  2A6H C;  1D5X C;  3S2H B;  2H1E A;  3AB9 A;  3H94 A;  4XYQ A;  4C3H B;  1Q1E A;  2F03 A;  2JXM B;  1LAC A;  2E2J B;  1B9M A;  1JWS D;  1E0B A;  2MHV A;  4CJ1 B;  1WTW A;  2RSN A;  4PMW A;  4KHV A;  2LKV A;  2XWJ B;  1CI3 M;  5EPK A;  1C4Q A;  1TY0 A;  5J1Z A;  1LV9 A;  2B2T C;  1WTV A;  2E75 C;  4TQU S;  3QB3 A;  1W6J A;  3O13 A;  4IUP A;  1OXT A;  1SMY C;  1RTN A;  4DK1 A;  3FVQ A;  1PTO F;  1QJO A;  4XT1 B;  1JR0 D;  4XQQ A;  5EPL A;  4A3D B;  1ESF A;  3L3O C;  2WP8 J;  5KIX A;  3GTO B;  2K01 A;  1LT5 D;  2ICE C;  1KNE A;  4HSP A;  1QB5 D;  1EY5 A;  3WOE A;  3BDO A;  1RTO A;  2TMP A;  3D6C A;  3W3A A;  4FF4 A;  4G57 A;  3I73 A;  3P1H A;  3BS1 A;  1SNM A;  1EY0 A;  1O7L A;  2M00 A;  3PV0 A;  1D2B A;  1EEF D;  3K57 A;  2O5J C;  5M3M B;  3SVM A;  3NXW A;  3GTK B;  2NYZ D;  5KEE A;  2SDF A;  1STG A;  1QWY A;  2NVT B;  3QJY A;  4UDU C;  1LT3 D;  2E2I B;  4V0B A;  3NTK A;  3HEJ A;  1CTM A;  2JA5 B;  1NAP A;  1EYA A;  2J0T D;  5FO7 B;  1FD7 D;  3NBI A;  1PFN A;  2EY6 A;  1DON A;  2EPB A;  1V8Q A;  4IUU A;  1PRT B;  1RHP A;  1DD2 A;  2K6A A;  1KDA A;  2R6G A;  2F0G A;  3PUX A;  5JVG 3;  1W6K A;  4QCL A;  2D2C C;  3NBH A;  5C44 B;  3H91 A;  3GTJ B;  1MI2 A;  1SNQ A;  5F2D A;  3G7L A;  2NZ1 D;  4A3I B;  1MBY A;  5J39 A;  4XDX A;  2JSO A;  3D8G A;  3F2U A;  1GOZ A;  2A6E D;  3VR3 A;  4IFD H;  4X3T A;  2ENB A;  2L11 A;  5DEH A;  1C48 A;  2B2V C;  1HPC A;  3GV6 A;  5C0X G;  5CV6 A;  1KDC A;  4K2K A;  3TBI B;  2I46 A;  2MP1 A;  2EYF A;  2K7V A;  5C4H A;  1IYV A;  1STN A;  2F0P A;  1SSO A;  4BY7 B;  4GZY C;  1JE4 A;  5IGE A;  1H9M A;  1RCV D;  2D62 A;  1CM9 A;  4A3K B;  3OW7 A;  2XIW A;  1SAP A;  2EJF C;  2OF1 A;  1PMR A;  2F0D A;  1SNC A;  5KYI A;  2NBF A;  3KLR A;  3S16 B;  3TZD A;  3DXJ C;  2FHT A;  2MPM A;  2DN8 A;  3CKI B;  5M5X B;  2BDO A;  1Q90 A;  1F9R A;  5D3I B;  4RWS C;  5KNC A;  4KY6 A;  3SE0 A;  3A7L A;  2C5C A;  4RGM A;  1AZP A;  1QNK A;  3QIA A;  1AN8 A;  4A3E B;  3GTL B;  2AQ1 B;  2OT2 A;  4RFB A;  1JWU D;  1STH A;  1EL0 A;  1TQO A;  4IQZ A;  2B8F A;  2NN6 I;  3Q23 A;  3R8B A;  2WKD A;  2EYP A;  1PTO D;  1S5C D;  2AQ2 B;  3GD7 A;  4HR7 B;  5T1G A;  4OIK A;  5DM7 3;  3ERQ A;  3T16 A;  1FNU A;  1XYI A;  2O5I C;  3MC0 B;  3BVG A;  1I4G A;  1TY2 A;  3R2I A;  2NVY B;  4CJ0 B;  1UUP A;  4FYD A;  3VR5 A;  1H9S A;  4S3S A;  4UAI A;  5E3F A;  1KDB A;  5CV5 A;  4EQP A;  2KED A;  3K7A B;  1ILQ A;  1TS5 A;  1SNO A;  1CQV A;  2WAQ B;  4BBR B;  1RF2 D;  2L1B A;  3FPP A;  1MGS A;  3A8I E;  3D31 A;  5FO9 B;  2A6E C;  2EXZ A;  5NUC A;  5HUR A;  5CYU A;  1HCZ A;  4FXG C;  4KN4 C;  3CHB D;  2IPK D;  1WTQ A;  4F8M A;  1LTT D;  2PNR C;  3OMG A;  4KKT A;  4ILW A;  2Z4I A;  3BDC A;  4G4K A;  1PRT F;  1HRJ A;  1HUM A;  4IAL A;  4PV1 C;  1O7Z A;  1HTP A;  5C3W A;  2NVQ B;  1SDF A;  5C0X H;  3DWA A;  4RHS A;  1ET9 A;  2LS0 1;  4WFN 3;  2F0K A;  1JQY D;  2AWO A;  2XRQ D;  1WTO A;  1J9O A;  4DA2 A;  1CZW A;  4K5V A;  3K58 A;  3DHQ A;  1EQT A;  2L9H A;  3VA5 A;  1VCI A;  1EQV A;  1JIC A;  3MWY W;  3MFY A;  5JEA J;  3MHB A;  1XX8 A;  2EOT A;  1K8M A;  2B2U C;  2Q8I B;  4A3B B;  1BXT A;  1PZK D;  3HS0 C;  1SND A;  4DXF A;  1STA A;  1PTO C;  3Q0A A;  1VMP A;  3V2T A;  1RKN A;  1X3Q A;  1CT1 D;  2EYJ A;  1K8O A;  4LK1 C;  3SK5 A;  1BCP B;  4XT3 B;  4NDX A;  2KOL A;  2ZXP A;  3KLS X;  1DM0 B;  1IW7 D;  2RA4 A;  3NE5 B;  4O1N A;  1F2L A;  3M85 A;  2PW7 A;  2M2L A;  4NP5 A;  3I72 A;  4JBW A;  1GHJ A;  5E4W C;  1EWH A;  3DM1 A;  1OXX K;  3A8K E;  5JOB A;  5A2Q E;  1IL8 A;  1WTX A;  3OSO A;  4KTA A;  4BWG B;  2IJ0 A;  1MD2 D;  1ESR A;  3SK4 A;  1G29 1;  2VB2 X;  1I50 B;  1G6Z A;  1SYG A;  5KGU A;  3BVM A;  1EZ8 A;  3E5S A;  2Q8T A;  1I6H B;  3LWE A;  2F0T A;  2BA0 A;  1D6E C;  3TN2 A;  4KD3 A;  1O78 A;  1EY6 A;  1LTA D;  3BDL A;  4HAE A;  1DOM A;  2BA1 A;  2K33 A;  2ZXO A;  4RH6 A;  2AQ3 B;  1SYB A;  5IGF A;  1QIL A;  5FOB B;  5CC4 A;  4FXK C;  3IFT A;  1EY8 A;  2DNC A;  2F0V A;  2R93 B;  1A3U A;  1F2M A;  3S1N B;  3PIP 3;  3S2D B;  1MSH A;  2RSO A;  1B44 D;  4C2M B;  5D65 A;  3J80 E;  5FLX E;  3CRL C;  3NK9 A;  1TT2 A;  3OOC A;  1EYD A;  3N52 A;  3MVV A;  4CKB A;  2E74 C;  3I90 A;  1WTR A;  4Q5V A;  3R2T A;  3V96 A;  2X6G A;  3HOZ B;  1BDO A;  5M5Y B;  4I65 A;  5KND A;  1PFM A;  2AUJ D;  5HGT A;  1GUN A;  2NN6 G;  3LX0 A;  1AFP A;  5IT9 L;  3SHL A;  1ZKO A;  4FP5 D;  2N88 A;  1M8A A;  2SNS A;  4CHT B;  3NQT A;  3NTI A;  2DY7 A;  4I7Z C;  1IW7 C;  1CHP D;  4A93 B;  2EVB A;  2KUM A;  3VYT A;  1ZYR D;  1XWE A;  3A56 A;  2JA6 B;  3P20 A;  4ZYS A;  3E0J A;  2IX1 A;  3T13 A;  5C0X J;  1SYE A;  5KNB A;  3MXP A;  2EE1 A;  4ZKB B;  1ILP A;  2XWB B;  1HHV A;  4TSS A;  5IIF A;  1EY7 A;  1SNP A;  2F0N A;  4RGT A;  1WVL A;  1T5E A;  1O7Y A;  4X3S A;  1Y1W B;  1BCP F;  4FF1 A;  2VNU D;  2F0L A;  3ND9 A;  3EA6 A;  2FJ2 A;  3T4A C;  3JAM E;  3WOF A;  2HCI A;  3HOY B;  1MSG A;  2DY8 A;  1OXS C;  1X32 A;  3VR6 A;  4KK7 A;  5C6A A;  3C1E A;  1E2V A;  4DFA A;  4K5W A;  4WOR A;  3VYR A;  3QWN A;  3I4N B;  3PMF A;  1D5Z C;  4V19 0;  2RDG A;  1SYC A;  4HCE A;  1EYC A;  1DOK A;  5C3E B;  3UI2 A;  2L12 A;  2HDM A;  2MJ8 A;  3TSS A;  2B63 B;  5BN3 A;  1EWC A;  2B8G A;  5AFW A;  2WKC A;  5G3L F;  2K04 A;  4BS9 A;  3PUV A;  4LAA A;  3URY A;  1TS4 A;  3S1R B;  3KK7 A;  4IUT A;  2F1M A;  2PZU A;  4DAP A;  3GTM B;  4MN3 A;  3X3M A;  4B9X A;  2PZT A;  5FKA C;  1GXD C;  4K8I A;  3T53 B;  1VMC A;  1DYQ A;  1ZEQ X;  1AZQ A;  4PMC A;  2B2W C;  4TRD A;  1Y8P B;  2ZXR A;  4KJN A;  3TZU A;  5C5M A;  1HQR D;  4YIJ A;  2B2Y C;  1FR3 A;  1B3A A;  1KLG D;  2R3Z A;  2KJX A;  4E6I A;  1WCM B;  1ZYR C;  2IW3 A;  5T1I A;  2EY5 A;  3R93 A;  4C3J G;  1M4V A;  2FIN B;  3G6J B;  3FPU B;  4KN7 C;  2BDN A;  2NN6 H;  1BF4 A;  3AMU A;  2XVS A;  1JCK B;  3I91 A;  3CQZ B;  1BUV T;  5EQ0 A;  3TP8 A;  3IAY A;  3KBG A;  3HOV B;  3L9A X;  2K03 A;  4KHZ A;  4HTH A;  3MFG A;  1CK1 A;  4ZK9 B;  4OO1 G;  2KQ3 A;  2L4N A;  2CQA A;  2PPB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...