2F3WA

Solution structure of 1-110 fragment of staphylococcal nuclease in 2m tmao
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
110
structure length
110
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folding stability and cooperativity of the three forms of 1-110 residues fragment of staphylococcal nuclease
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 11
structure length 110
sequence length 110
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f3wA00
3D8GA 2NUCA 3DMUA 4R8NA 5KYLA 4KJNA 5IGGA 4K2LA 2EY2A 2PW5A 4N9PA 5CV5A 3TP6A 4B9WA 1SYFA 1TQOA 1A2TA 5CV4A 1EYCA 3QOJA 5I9PA 3SXHA 4KY7A 5E1FA 1IHZA 2F0FA 2F0NA 1SYGA 1SYDA 1TT2A 1SNQA 1EY9A 3ERQA 4NMZA 5E3FA 5I6WA 2RDFA 2SNSA 3P75A 5IGBA 5KRUA 4K8IA 3NUCA 5EKLA 5J22A 2EYLA 5KGUA 1STHA 5C4ZA 4IUNA 5IGFA 3PMFA 4DFAA 5IGEA 1NUCA 2F0GA 4WRDA 1A2UA 2F0WA 2F0SA 4KD3A 2F0UA 3NHHA 2F0DA 5KIXA 5CR3A 1EQVA 5IIFA 2SOBA 4QF4A 1EY6A 3HZXA 2HQEA 3H6MA 4K8JA 5EGTA 2RKSA 1STAA 4IALA 4F8MA 5C3XA 4I65A 5CV8A 1SNMA 4KV6A 2F3VA 3MEHA 3MZ5A 4K5VA 1A3VA 1STNA 1AEXA 2PZTA 3P1HA 1SNOA 3SK5A 4S3SA 5HURA 5C6AA 5IGDA 1TR5A 1SYBA 5CGKA 1JOKA 4G57A 4OL7A 1EY8A 2RBMA 1SNPA 5DAUA 3SK4A 1EZ6A 1KDCA 2OXPA 2F0EA 1A3TA 3D4WA 3NK9A 4K14A 3SK8A 3R3OA 5ISRA 4MIUA 2PZUA 4KY6A 4KY5A 3D4DA 5DEHA 4DF7A 1NSNS 2F0OA 4EQOA 3U9OA 1EY5A 1U9RA 3C1FA 1STBA 2EY5A 2EY1A 2PW7A 2QDBA 2EYFA 1EY7A 2PYKA 4LAAA 3TP5A 4DGZA 2EYJA 5M9OA 4K6DA 3V2TA 4KJOA 2F0LA 1SNCA 1KABA 3DHQA 2EYPA 2WACA 3SHLA 3TP8A 2ENBA 2O4XA 3HEJA 3SR1A 3NXWA 5EKKA 4NKLA 4IZ8A 2EYOA 4ME5A 1EYDA 3NP8A 3QB3A 4HTHA 3EROA 5F2DA 1F2ZA 3OWFA 2F0PA 2PQEA 4KD4A 3TMEA 4EQPA 2OF1A 4ODGA 5C4HA 1ENCA 1F2MA 4ID6A 2F0HA 4WORA 2F0TA 2F0MA 5CV7A 3VA5A 5I9OA 5IGCA 4HMJA 5CV9A 3MVVA 1EY0A 3BDLA 4ZUIA 2KQ3A 1STGA 2LKVA 1JOQA 4B9XA 4NP5A 4PNYA 4KTAA 4ZUJA 5CV6A 5J1ZA 3OSOA 4QMGA 5KEEA 4K5WA 3OMCA 5HGTA 3E5SA 4NDXA 4F7XA 1KAAA 1SYEA 2F0JA 3OMGA 3SK6A 4TRDA 3LX0A 5C5LA 5NUCA 2M00A 4N9TA 5IODA 1A3UA 3NQTA 4RKBA 1EY4A 2EYMA 4H7BA 4J1MA 1EZ8A 4QB4A 3T16A 1KDAA 5CC4A 3TP7A 3EVQA 1EYAA 1KDBA 4ZQ3A 3RUZA 4E6IA 1II3A 3EJIA 1JORA 4PMBA 1STYA 1JOOA 3ITPA 2EXZA 4KHVA 4EQNA 2EYHA 5JAVA 2F3WA 2KHSA 3T13A 4EVOA 1F2YA 1SYCA 4J6HA 5C5MA 5KYIA 2F0VA 2OEOA 4K5XA 2F0IA 3QOLA 1RKNA 3C1EA 5IOCA 3MXPA 4YIJA 5JOBA 4PMCA 2EY6A 3S9WA 2SNMA 1ENAA 3MHBA 4HMIA 5I6YA 3D6CA 5K5PA 2PZWA 2F0KA 1SNDA 2F0QA 4DU9A 5C3WA 3BDCA 5J39A 4K2KA 4RKLA
chains in the Genus database with same CATH superfamily
1CM9A 3TEHB 4NPSA 3PO3G 5EPLA 4A3BG 1ILPA 1H9SB 3KF6B 2PW5A 4IFDG 3FMCA 3J80E 1KLUD 3SXHA 4JI3L 2F0NA 1TWHH 5GQOA 1IXRA 1CHQD 1F77A 1HNWL 2XGTA 3S17H 1I5FA 4IUTA 3K0YA 4JC0A 1SROA 1TWFB 3NHHA 4CKEA 3TN2A 2XIWA 4P74A 1PH5A 5LMUQ 2A68D 4K8JA 4A3GG 1N8RC 1VF5C 3SEBA 1NAPA 1VDZA 3K8AA 2JP1A 1EOVA 1SDFA 5I4DA 1FGBD 2F03A 1G6PA 5EJWA 2NVQB 1NNXA 4JI8L 1GUTA 3WOFA 1CUKA 1N36L 2PQAB 4X66Q 3CP0A 5M5YB 5C4XG 2B63H 4YCVA 1OXUA 2UUBL 1XNRQ 3H09A 1EIHA 4DR5Q 4DAMA 3J80L 1X56A 4YWLA 2PMZB 4DR3Q 3CCLA 3BYTB 4X62Q 2EYOA 2B39A 4NXNL 5I2YA 1RDPD 1YVCA 3JAME 1AZPA 4PQXA 2WAQG 1XNQQ 2I5HA 3TMEA 4JI5L 3G6JB 3E9IA 2L5TA 1L1OB 4DAYB 1ONLA 5CBEE 5BN3A 3J7AF 1LABA 1NR4A 2BA1A 2KQ3A 4O2DA 5JJKA 4CDDC 3IRBA 4UHVA 1HRJA 1D5ZC 4KTAA 4X3UA 1B70B 1D1IA 5M5WB 2JA6G 5HGTA 1X65A 1E24A 2CW0C 1GUOA 1SE3A 5KNCA 5NUCA 4N9TA 4FF2A 4GLVB 4OWXB 3GTLB 1WD0A 3I4MG 2MFIA 1HZ9A 4CKCA 3HOZH 4IJHA 5C4JH 1F2YA 1U4PA 2M2LA 1U4MA 4P73A 3S24A 3DEOA 1CK1A 2A69C 3CCSA 4YIJA 2UXDL 4POGA 3AB9A 5IP7H 4BBRG 1IBKQ 4HMIA 2PZWA 3CAMA 1EUJA 4UP7A 3CC7A 2KCNA 4DR4L 1MKHA 1VQHA 1L1OC 5IYCG 4WJ3M 1SYFA 3J7YW 2GA4B 3AU7A 3MFYA 3K6OA 4A93H 5BN5A 2R61A 4NMZA 4RH6A 3I70A 1LTAD 1G2TA 1I4PA 1AFPA 1VQFA 5CR3A 1DOLA 2PO4A 4O42A 2NZOA 5CV8A 1EU3A 2I0QA 5C6AA 1Q86C 4ZK9B 4GZYC 4A3DB 4P2CB 1WD1A 1E3PA 3NK9A 1FD7D 3M7NA 1DD2A 1P8LA 4A3FH 2CQAA 3PUYA 4DR7L 4GKJQ 1X3GA 3CU7A 1I3QB 5A35A 1GUGA 4DR1L 3GTPB 4JBMA 1HNXL 2K01A 2HUGA 1S5CD 1SNCA 3SHLA 2HCIA 3FKIB 2R92B 1K8GA 1IKLA 4JI6Q 4DV2Q 2IT1A 4QIWE 1K9MC 1WFQA 3GTMB 1A15A 2GN5A 4LUZA 1LLRD 4JG2A 4JI7L 3I4NB 2UUBQ 2R93B 1F2MA 5C0XG 5EBCA 2NB0A 3PIPA 5GAEC 2R3ZA 3IAYA 2Z6BA 1H95A 1PFBA 1VCIA 4OWWB 1N33Q 2B8GA 1YJ9A 4DN4M 3W3AA 2E2DC 5C44G 1O7LA 1XNQL 2JA9A 1V9PA 1EU4A 3KF8B 4G7ZC 1K0SA 2OTLA 1A0IA 3I3CA 4GOPB 2FINB 3QWNA 3W2DA 5C0XH 1XJVA 1BQQT 4DUZQ 3TQYA 1RD9D 3T13A 1B1ZA 2KBNA 5LMNW 2L0CA 1QUQB 1ILQA 1IBMQ 1YHBA 4XDXA 3C1EA 4XQNA 1HJPA 5IE8A 5DM63 4PMCA 4A3IB 2UUCL 1QG7A 3KLSX 4BA1I 4YY3L 3S2DB 2B2YC 3Q24A 3CXCA 1KNAA 1B2TA 4FO2A 5AFWA 3NSWA 5FK9C 1PHJA 4RGTA 2EY2A 3AMUA 3J7A5 2RQXA 1EYCA 3TBIB 2DN8A 2JA8B 1ESRA 4ABNA 4LF7Q 2Q2IA 5H1SE 1FL0A 1I50B 3ERQA 3P75A 4K8IA 1SBBB 3NWTA 4DR2Q 2RVLA 2JEBI 2ZJRA 1S40A 1HA5A 2F4VL 4H44C 1Q90A 2E2IH 1XMOL 1AZQA 1SFOB 1AH9A 4DUYL 5EGTA 3C46A 3HGBA 3GTMH 3L3OC 1KLGD 1SNMA 1XTCD 3MEHA 2PZTA 2BE5C 2R93H 2NN6I 2D2CC 1V1OA 3MTSA 4MNOA 3S17B 5JJLA 2UUAQ 2K5QA 1PFSA 3FVQA 3GD7A 3NENA 3R93A 2O5JC 4JI7Q 3RR5A 4R4CA 5ELCA 2OT2A 4LFCQ 2NVTH 3TS0A 1SE8A 3TP8A 2FXQA 2ENBA 3SR1A 4DV1L 3S15H 3CHBD 4ME5A 1HNXQ 3QB3A 2E2JH 1B8AA 2JA7G 1QE6A 4CJ2C 4FF3A 2VY3A 2VUMH 1KXLA 1SMYD 2LXKA 4RHSA 5JEAG 3M3YH 2A74C 2MO1A 4DK0A 3BDLA 3E0EA 4APVA 2RHQB 1GOZA 3PGZA 2V1CC 1WYDA 1PYSB 1WI5A 3L7ZC 4I7ZC 4QMGA 1J5EL 1Z9FA 4A3EB 1Q7YC 1SE2A 4DV7L 2YYZA 2M9VA 4HEDA 4J1MA 4B3SL 2XNAC 1BCPD 3EVQA 3K59A 2B2VC 1GVPA 3LWUA 3NEMA 3G71A 3STBD 3J81c 1W6KA 4C2MB 2HT1A 4K5XA 4KN7C 5IOCA 1H9MA 1WJJA 5LL6S 3AEVA 1SFOH 4XIGS 4OEMB 1I4QA 1CQFA 2Q8IB 5JJIA 4AQYQ 4DU9A 1LO5D 3IKJA 1SLJA 2K52A 3M4OB 3VYSA 4HJ8A 1WTVA 1A62A 1O80A 1Q8IA 5C4JB 1I6VC 4OIJA 1E1TA 4B9WA 1Y1VH 1A2TA 4UP8A 4RWSC 1X55A 4B3MQ 1BCPF 1XPOA 4M8AA 5FOBB 5LMNL 2UUCQ 1EY9A 1HHVA 4UDUC 4TKOB 2EJGC 5C4ZA 4KN4C 4N8X1 1BCPC 3HOWB 2F0DA 2MO0A 2F52A 4LUVA 4B3SQ 4IALA 3CC2A 1HUMA 1IKMA 3FPUB 1G51A 2G9DA 1B3QA 3E6ZX 3P1HA 4DUYQ 5DLQE 3M3YB 4OL7A 2I46A 3T1YQ 1X3EA 3NWSA 3S1QH 2PMZE 3A5ZB 4K14A 3GO5A 4FXGC 4DK3C 1I6HB 4JOIC 2KHIA 2H4OA 1Y14B 5M5XH 1FJGL 5M3MG 4A3EH 1EY5A 1V43A 1VQJA 2UU9Q 3I55A 4FXKC 1B7YB 3BVMA 2YTXA 2MNAA 3BVGA 2O4XA 2WB1E 2F1MA 2D9UA 4KLKA 4HJ9A 4LNQA 1NMGA 1Y1WG 1LT4D 2EDGA 3CPFA 1WVLA 1ENCA 5HGQA 5I9OA 1CA6A 1SSOA 3T1HL 5CV9A 4V0BA 1WCMG 4IFDJ 3Q23A 4KKSA 4IUUA 4LF6Q 4ILWA 3CCQA 3F1ZA 4JBWA 1YNXA 3J81E 2E5LQ 4LJZC 5JPMC 3SGIA 1HH2P 2Q2HA 3CCUA 1JJGA 3VR4A 3HKZG 2UXCL 4F7XA 4X6AH 3FEWX 4LMQD 1EL0A 2M00A 4IJLA 3NQTA 5CC4A 1KRSA 4L5TA 1BF4A 4B3RL 2DNEA 1PH4A 2L55A 2OQ0A 4OWTB 1QVCA 3H94A 1JWUD 2K1BA 4DV4L 5DNFA 3S1MH 2IW3A 4HJAA 4XT1B 3OIPA 4JV5L 1D6EC 4YWKA 3S9WA 2K7VA 3MHBA 3D6CA 2FJ2A 5FLXc 1JB7A 1DXMA 3UDXA 4X62L 2F0QA 1WOCA 3BG3A 3H3VH 5GAGC 4R8NA 4OO1G 1U4LA 3CW2C 5FLXE 4KJNA 4LWCA 2PI2A 3VYUA 3TP6A 4NXNQ 2I07B 3PQIA 1IL2A 3ND8A 3J7AV 1NJIC 1HTPA 1PZKD 5E3FA 2RDFA 2SNSA 5AJ3L 3LGJA 3J80c 1XPRA 1IBLL 2R7ZB 2NVXB 4I7AA 2E76C 1NUCA 2Q2TA 3V96A 1C8CA 1N32L 2R92H 1X3FA 4ZLTF 2ZM6Q 1Q3LA 2AMCB 1JB3A 1PH3A 4IPCA 1S5ED 4GLAC 4PZ6A 3CQZH 1T5EA 1BDOA 1JJ2A 1DGSA 1SYBA 2IX1A 1UE6A 2R6GA 1S5DD 2OXPA 1QVGA 2F0EA 3D4WA 4PMWA 3G6EA 1V1PB 4OGQC 1KL9A 4XYOA 4HCSA 2PZUA 2V4DA 4DF7A 4BS9A 4OXPA 1JCKB 1NSNS 4C1NK 1GM5A 1HQRD 5JPNC 1MIUA 1ZXTA 1OO9B 2YU9B 2BH8A 3BU2A 1RF2D 3WOEA 1K28A 2XRSD 3FRPB 5D3IB 2ZXRA 3EFXD 4R1JA 4O0AA 3Q22A 1PLFA 2NYZD 4JW0A 1KTKA 1E0BA 1I4RA 3EIVA 1EY0A 3A55A 1BCPB 1NY4A 2HDLA 1TS3A 5IWAQ 4K6LA 1VQ8A 1XX8A 2E2JB 3OMGA 5IP9G 5FO8B 1RHPA 4KKUA 3FPPA 1EY4A 3JC66 1G8ZD 1U5KA 5K36H 1GUWA 2KEEA 1JOOA 3ITPA 2L12A 4WJWA 3TS2A 1B9MA 4X64L 5IT9c 4GLXA 3KDFB 2PNRC 4AH6A 5EAYA 2R7ZG 3KJPA 4DV6L 3GTJB 5C3WA 3OWEB 4QY7A 4L63B 3GP7A 5IY0A 5BR8L 3DMUA 3GTLH 1YZ6A 3KLWA 1H9RA 2XRQD 4DV2L 4A3MB 1MSHA 1AE3A 1LTBD 1WTOA 1HR0W 4GOPA 5IGFA 2IL8A 3G48A 1EQTA 4IPDA 2E74C 4CGYB 4HIDA 5IIFA 3S15B 1TS4A 2FFKB 4XQQA 3PF5A 5L37A 4B3RQ 2GVBA 3SK5A 4X65Q 2QA4A 1YHAA 3ND9A 1FNWA 4C3IB 1R9TH 1OXTA 2K5NA 5ELOA 2B2TC 3JAMc 4B3TL 2JA6B 4MIUA 2DGYA 1BBUA 1Y8PB 5ELNA 1IYUA 1SJHD 1S4ZA 2PPBC 2PW7A 3K5LA 4LAAA 3K7UC 2EYJA 2LS01 1DONA 2PCFB 1CQVA 1LT3D 3V2TA 3HOUB 3DHQA 3NTIA 2KECA 1F9PA 1EFID 3P7JA 5E4WC 1R4PB 2EJMA 1C0AA 1VQCA 2AWOA 2HD3A 3K57A 2LFNA 1F2ZA 3QJYA 5F2DA 1WTXA 3K81C 1TWCH 4WORA 5CV7A 2LSSA 3GTGB 2LMCB 3CC4A 3ULPA 1PH6A 3K58A 3DXJC 4BXXH 4RHRA 2NVYB 3V05A 5M3MB 2MJ8A 3O13A 1B3AA 1MD2D 4IPGA 2EIFA 2KHJA 3VR6A 3JAMi 1SYEA 1YNNC 2H5XA 1Y1VB 3I4NH 2SEBD 3KOJA 4DV6Q 2AKWB 2JA7H 1GHKA 3EJIA 3X3NA 3EBEA 2WB1G 1EWIA 2DJFC 1PZJD 2E2HH 2F0VA 2F0IA 4G7OC 1HXYD 4LF4Q 4FP5D 1E2WA 2CW0D 2A19A 4HSVA 1V1PA 1YJWA 1G6ZA 4MTKA 2R93G 4OO1H 4LF7L 4A3CH 1BKBA 1AE2A 2HDMA 4ZKCB 4U673 3R8BA 1E22A 4AYBE 1VQBA 4OHJA 3S1QB 2TMPA 1PDQA 2N55A 2R92G 2G9HD 1WTWA 4A3LH 5IGBA 2BDNA 2FHTA 2ZTCA 1O7ZA 2NN6G 2EYLA 4UPAA 3OW7A 1STHA 4K0KL 4QQBX 1A2UA 3BJUA 3L2PA 4IO9A 3NPPA 2WP8J 3HZXA 4IOAA 1MI2A 2RKSA 4C3HB 3CPWA 2F4VQ 4GKKQ 1Z6HA 2JA8H 3D6WA 1TWCB 1C9OA 5KNDA 2QKIC 2N8NA 2Z4HA 2EJFC 2JXMB 3U9SA 3KLRA 3RZOH 2EPBA 4TQUS 1EZ6A 3SK8A 1A3TA 3C2PA 3KUPA 2KCMA 2EY5A 3E9HA 2L9HA 1EIGA 2R7FA 3CQZB 2EYPA 2OWOA 3N52A 4BBSH 2YTYA 1KHIA 2JA7B 3NP8A 5E4XA 3HOVH 4IUQA 1CZGA 1TWGB 4PV1C 2F0HA 3W5OA 3BZKA 3BS1A 3S1NB 4ZUIA 2NVTB 1ZYRD 1B9NA 1JOQA 4K0KQ 3OSOA 3L0OA 4BY7B 2B2VA 4L8JA 4NDXA 3VR5A 5FLMG 3GTJH 4FDBA 3T53B 4R4TA 5JAVA 2CCZA 1I4HA 2EYHA 4LFAL 1LYLA 5M3FH 1UWVA 3NE5B 3R2TA 2D5DA 2EXDA 1A8VA 2OEOA 1H9SA 3HKZB 3VYTA 4C3IG 2JEAI 4A3MH 1EEFD 3MXPA 4CDFC 1PYBA 1LV9A 3ULJA 2JN4A 1GXDC 1SNDA 3GTQB 4YHHL 1VQEA 2K6AA 2VNUD 4A3CG 4DAYA 5KYLA 4DR3L 3H15A 1J9OA 1SEBD 4C2MH 2A6HC 1TQOA 4JI6L 3G4SA 3K5MA 1M8AA 1DZ1A 2Z9HA 3CCRA 4QCLA 4NB3A 1Y1WB 4A3IG 4KHPQ 3OHXC 2F0SA 4HIMA 5ELEA 1AW7A 4HIKA 4OONA 3A8JE 2D62A 4G4KA 3UE0A 3K0XA 5T1GA 2VW9A 2XWJB 3HOUH 1H9JA 4ZRZA 1Q1BA 3ONAB 1BBXC 1KQSA 3S1NH 3BZDB 1KDCA 4HJ5A 1YITA 1DM0B 2K03A 4KY6A 4KY5A 2F0OA 3U9OA 4MTNA 2R7ZH 4DGZA 1QCBD 4X65L 3KK7A 4C3HG 1D5MC 2VL6A 2Q8TA 3S2HH 2X69A 1U4RA 2QW7A 3LWEA 1BUVT 4N8FA 4YY3Q 3A56A 3I4NG 2VXWA 1QNUA 3HOWG 1B53A 2CHBD 4CKBA 4TVAB 1V8QA 3R2IA 2JA6H 4EQPA 1HA6A 1J6QA 3BYYB 4RAUC 3PUVA 2F0TA 3S16H 2ZJQA 4HMJA 5M5XB 1G91A 4IFDI 1IW7C 3H3VI 2E2HB 5CYUA 1RTOA 2RHSB 2B2UC 2C9OA 1YI2A 2AUJD 1HFNA 5TSSA 4TRDA 3I72A 4UAIA 3H0GH 5LMUL 2B2UA 2Z8LA 1HQMC 3TP7A 3DUZA 4BBSG 1HTLD 2N88A 3I91A 4JI1L 1LTID 2RDGA 1K0RA 1PH2A 1IBKL 1HCZA 2NN6H 3ERSX 3UDGA 5M3MH 4A3EG 1JT8A 3PV0A 2KUMA 1C48A 2AQ2B 2UUAL 2WINB 2IX3A 1Y1VG 2HHHQ 2RSNA 2J4XA 2WV6D 1DYQA 4RKLA 1RIPA 1TWAH 1QZGA 3ZJYC 4K2LA 4C3IH 4N9PA 4DR6L 3S14H 2AWNA 2VB3X 3G7LA 4CBVA 2K05A 1BOSA 1W2BA 4O1NA 1RJTA 4JCVE 3AYHB 3RZDB 3NTHA 1EWHA 4FNFA 3CF5A 1ZYRC 3OOCA 2F0WA 3S1RB 4IOCA 5M5YH 3URYA 1B44D 2N3SA 3H6MA 1PH9A 4G7HC 4Q5VA 2Z6KA 1NMFA 5CORA 3J7ZC 1IYVA 5C0XJ 3H3VC 2F3VA 4DV7Q 1AP0A 3PIOA 2D0OA 3HKSA 4X3SA 1XXGA 1VQKA 2BOSA 1OXXK 3NBIA 2F4IA 5CGKA 1IL8A 3HOXH 2ASBA 5IYCH 2JQOA 4MZ9A 1EEID 5EQ0A 4L5SA 2KEDA 4NW2A 3ZYYX 4EQOA 3GTOB 1K8MA 1L2FA 1EY7A 1M1KC 1HPCA 1DCZA 4JBKA 5COYA 5EKKA 1UNSA 4NKLA 5IWAL 2XVSA 2WAQB 2IHFA 2IWHA 5C4HA 4H0LC 1T9HA 1Y8NB 4A75A 1R9TB 1RTNA 5EBDA 3TZDA 1WTHA 2CWAA 3S2DH 3A74A 4ZUJA 1IYJB 3PUWA 1ET6A 1XWEA 5KEEA 1EOTA 4DUZL 5FLXL 2QEJC 5JVG3 3EA6A 4X3TA 3M7GA 3PSIA 3H91A 1MSGA 2Z1CA 5D14A 1XMQQ 1W3SA 3PUXA 1AN8A 4A3KH 2X6LA 4DA2A 5C5MA 4IFDH 4A93B 2CH4A 4JI2L 3A8KE 4OX9L 1ENAA 2ZJPA 2K5VA 3VA7A 1GO3E 2A1AA 4KK7A 1UAPA 2F0KA 2JYOA 5J3BA 3HS0C 1VQAA 4K2KA 1EQRA 1Z47A 2NUCA 3I90A 3OYYA 1B4OA 2ATWA 5CV4A 1YBYA 2VQEQ 3QOJA 4KY7A 3IL8A 1N34L 4GNXC 1VQ7A 3FKIG 4PZ8A 2QDLA 4FXDA 1TS5A 2A68C 4BY1H 2CFMA 1L0YB 5EKLA 3WDNA 3UDIA 4A3JG 5IGEA 3T1HQ 1BR9A 1VS0A 2B8FA 2P5ZX 4LF6L 2N78A 1X54A 4NXML 1I3QH 3I4OA 1STAA 3P20A 4FYDA 2MP1A 3S2HB 4KV6A 4PNYA 2VUMB 5HURA 4CHTB 2MHVA 1TR5A 3MFGA 4DV1Q 2N49A 1EY8A 1IZ6A 5HY6A 1Y1WH 1A63A 2WB1B 4A3DG 1LTLA 3TSSA 4DV4Q 3R3OA 1JE5A 1OXSC 1T5XD 1UEBA 1GKHA 2F3IA 1O78A 1STBA 2EYFA 3M4PA 1JR0D 4P72A 4JYAL 2B2WA 4J8QA 3U50C 3HOZG 2VQFL 1WTQA 1SR3A 1J5EQ 4A3DH 3KLSA 5GROA 5IGCA 4DV3Q 1LTRD 2NVQH 3K80C 2DNCA 5ELBA 2DJGC 4OO1I 1UE5A 4AYBG 4B9XA 3FHWA 4IPHA 1CKMA 2H1EA 5J1ZA 5CV6A 1PH7A 1EFWA 3DWPA 4DKAC 1HZCA 3HOUG 1JE4A 1B50A 1BXTA 1QWYA 2EOTA 2EYMA 5JEAH 4QB4A 4BA2I 1EYAA 1O7YA 2E8GA 3NELA 4JI2Q 1JORA 3OTOQ 3ER0A 4KHVA 3MXUA 2LXJA 2B29A 4XT3B 4LF4L 3MXNB 3S14B 1KAWA 1PTOH 3PUZA 4X3KA 2HQLA 1VQ6A 2JA5B 1TS2A 3T1YL 2A6EC 3EQLC 4AQYL 2RCFA 4A3FG 1I50H 2EY6A 1A6XA 1YNJD 2K5DA 4JI0L 4B3TQ 1HUNA 3BDCA 1QUQA 4JI1Q 2Q2UA 3QIAA 3PO3H 2E2IB 3TZUA 4BY7H 3PF4A 1HNZL 5CBAE 1Q12A 2KCTA 2ZM6L 1U0LA 2WIIB 4HSPA 1WCMB 1IHZA 2A73B 2ZT9C 2AQ1B 4A3MG 1H9KA 2J7ZA 5J22A 3U4VA 3D0FA 4RCOA 1PRTC 1CSPA 3TREA 2RDHA 4Z9CB 3E3XA 1YEZA 2AQ3B 4DV5L 5C44H 3GTOH 2HQEA 4LW1A 1Z7TA 1PA6A 5FKAC 4JPBW 4QUFA 5C3XA 3GTQH 4BY1G 4XTCS 3NBHA 3EN2A 1DOKA 3KBGA 1TKWB 2C35B 1SNOA 4HAEA 2Y0SE 1VQOA 5FJ8H 4G57A 3VDYA 1M90C 2RBMA 1OTCA 1QNKA 1SNPA 4RGMA 2KENA 4DR1Q 3S1RH 1CKOA 5ISRA 2J0TD 2VB2X 1G291 2QDBA 4X64Q 1ASZA 4KJOA 1BNZA 4CDCC 3C3LA 1NE3A 1CKNB 3NXWA 4EGVA 3CKIB 4ME3A 4YCUA 1Q82C 4F87A 3OWFA 2UXCQ 5FLMH 4KD4A 3KJOA 3I8ZA 4KMUC 3RLNA 5C4XH 1HNWQ 1SMYC 3HOYH 3A7LA 2JE6I 3LNNA 1PZID 4LFAQ 3T4AC 1VQNA 3PO3B 1SN8A 1QJOA 3OMCA 2XWBB 2F0JA 3HOVB 5C5LA 3KFUA 5CMDA 1K8OA 1EZ8A 4GN3B 3T16A 3RZDH 3MEFA 1KDBA 3RUZA 5BR8Q 1EQQA 1N33L 2CH4W 3MAQA 1UE1A 4C3JH 1FNVA 2MQHA 1RKNA 3Q6SA 5JOBA 1QB5D 1LTTD 3S16B 5IYBH 4P75A 5I6YA 3IFTA 4BWGB 2L15A 5IT9L 3X3MA 4BBRH 1GUSA 1MJCA 3NQIA 5D3DA 2EE1A 1X3QA 4H13C 4KHZA 4YHHQ 4DK6C 5M3FB 1KC8C 3F2DA 2OQKA 4OX9Q 3A0JA 1Q81C 3DWAA 1VQMA 5ELFA 3I4MH 2L11A 5FO7B 1PTOC 3NUCA 2Y0SB 3PMFA 4A3KG 2F0GA 1RODA 2BH2A 1I6HH 2F0UA 3M4OH 5GAHC 1K3BC 4LF9Q 4L5QA 1PFMA 1Y69U 3U4ZA 4UP9A 2RA4A 3I2ZA 3MZ5A 4JI4Q 4YWMA 4ZKBB 4C1NI 2KJXA 1K83H 1ML0D 3HOYB 4DR7Q 2IPKD 1IBML 4BXXG 3HKZE 2BA0A 3F2UA 3HOWH 2HIXA 1F9SA 2JK8A 3D4DA 4HCEA 3DM1A 1D5XC 3RMHA 1SMXA 3BZCA 2YTVA 3GTKH 2ICEC 3BVZA 4K6DA 1NTGA 2PQAA 2F0LA 2JJQA 5IYBG 2L4NA 3D4RA 2IX0A 4IZ8A 2XN9C 2K4KA 2WKDA 3Q0AA 4HTHA 4GN5A 4C3JB 1S3OA 4L5RC 4Y52H 1TY2A 3CRKC 1YNND 4LUOA 3MVVA 3H0GG 2JA8G 3CMAA 1KD1C 2JA5H 2MPMA 4A3GH 1IBLQ 4NP5A 1KIXA 4FF4A 4WFN3 1KAAA 1A3UA 2CWPA 4RKBA 3AQQA 5C3EH 3NTKA 1KDAA 1N9WA 1VMCA 4E6IA 4QUCA 1RCVD 4BY1B 2L1BA 3A7AB 4PZ7A 1HZAA 1BBWA 1SXTA 2GVAA 3GV3A 4LF5Q 3MWYW 3HFZB 5KYIA 4IUPA 2OCEA 2CVRA 1CTMA 4CJ0B 3MA2B 3H0GB 1TIID 1EYGA 2VQFQ 1D2BA 4DV0Q 5IP7G 3D8GA 1HR0Q 3D3RA 4IUVA 4HIOA 2KVMA 1G2SA 1PMRA 1I4XA 1JMCA 4FF1A 1DJRD 2QCPX 5E1FA 4JI0Q 1SYGA 1TT2A 3RLOA 1Q46A 1Y8OB 4POFA 1FGUA 2KA7A 3DM3A 1PV4A 5KGUA 4R9WA 4B3ML 2VZAA 2G5DA 2UXBL 2ZXOA 4GNXB 2Z6KC 3MXGA 3PO2H 3KF6A 4KD3A 4A3BB 4AIMA 5KIXA 1L1OA 1EQVA 4RGOS 2B63B 2O2LD 4QF4A 4JI4L 5I2XA 4A3JH 1GUNA 1L0XB 1MGSA 5A2QL 2Z4IA 4K5VA 1STNA 2RF4A 2QF7A 4JK1C 4GOPC 1KNEA 2IY5B 2MUYA 1XNRL 4R4OA 4DNRB 4Y7NB 5EPJA 1LM0A 1JWMD 1U9RA 3C1FA 1D7QA 3TP5A 1M4VA 1CSQA 4RA8A 1FVIA 4OIKA 3FDTA 2WKCA 4F88A 4DR6Q 5M3FG 1YHQA 3J81j 1PRTD 3UE1A 5IP9H 2PQEA 1SE4A 3I73A 3HOXB 3ICEA 1FYCA 4RG1A 2MGSA 4ID6A 1SRUA 4DR2L 2F0MA 4KHPL 5C3EG 2IJ0A 1PTOD 4MN3A 2ID0A 4L6TB 4JI5Q 4LF8L 4ALPA 1PXUA 1XMQL 2SDFA 5G3LF 3AFQA 4DNIA 2KCCA 4B08A 1SAPA 2XSCA 3PCOB 3PO2G 4NXMQ 3LX0A 5ELDA 4BBRB 2VUMG 5DM73 4A4IA 2EXZA 3HRZC 1SYCA 4J6HA 1JC7A 3QG1A 2A69D 4JI8Q 4A3BH 4LFCL 5JVH3 1CI3M 1VQ5A 1N34Q 4X66L 3UDFA 3B6YA 2K14A 5G3LD 5J39A 4RGNA 1LUZA 5EPKA 4GNXA 1YJNA 4R4IA 1N32Q 1PTOF 2ZTDA 4ZYSA 3QO2A 3KYHC 3W1GA 2JSOA 4DV0L 1F9RA 5I9PA 4C56C 1PRTB 4JVZA 1PRTF 1UEAB 2HCCA 4R4QA 1CFMA 5A2QE 1IW7D 3M85A 1TXYA 4IUNA 1PTOB 2B2YA 1X6OA 2NBFA 2PNHA 4WRDA 3TDQA 1C4QA 1LTGD 4UY8C 2NWGA 1P16A 4PG3A 5AJ3Q 3TRZA 4A93G 4YCWA 3HP3A 3A54A 3CCVA 1SJED 1K73C 3RD4A 1VQ9A 4FVMA 2RSOA 1AEXA 2YV5A 3FKIH 4DPGA 2K5HA 1MHWC 4IQZA 5IGDA 2K75A 1VQGA 1TU2B 4JV5Q 1UUPA 5IYDG 1HZBA 2UXDQ 2K33A 2AHOB 1CKNA 1QVFA 2B2WC 2Q8RE 3RN5A 3GTGH 1NCVA 1BVSA 3VA5A 1ICWA 2E75C 2PYKA 2QGQA 3W1BA 3MXNA 4WJ4A 3CCMA 2WACA 3HEJA 4DNTB 3K7AH 2EZVA 1HFGA 5C44B 4Q0FA 3VR3A 1K83B 3DLLA 2VQEL 1Q1EA 5D65A 4QL5A 3K5NA 3M9BA 2F0PA 1ZEQX 4ODGA 1WTRA 2XTIA 2LY7A 2KOLA 1TY0A 1D8LA 5BN4A 4XQJA 4KKTA 1MBYA 3HG9A 2JA5G 2A8VA 2K32A 1EIYB 3SK6A 2YU9H 1X9NA 4GN4B 3PIP3 4LFBL 1OXVA 1STEA 3JAML 1I94Q 4ZQ3A 1JICA 2K50A 2A6HD 4EVOA 2E5LL 1VQDA 4DAPA 2NVYH 4GKJL 2A6ED 1E2VA 2WFWA 2ALYB 2BCOA 1N36Q 3NBHB 3STBC 4OELB 2Y0SG 1L0WA 1D1KA 4EX5A 1XPUA 3PO2B 1GHJA 5C3EB 1TWFH 5IGGA 2HHHL 3WWVA 3F2BA 3HOXG 5CV5A 1XMOQ 2HIVA 1E7ZA 1S5BD 3CRLC 3CCEA 2F0FA 1SNQA 4RCNA 4LF8Q 1PH1A 2FMMA 5KRUA 3HOZB 3UI2A 4DXFA 1VQ4A 3RZOB 2QILA 4QJFA 3GTKB 1NBWA 3KBXA 1YIJA 3IFDA 1I4GA 4Y7NH 2B2TA 1S72A 4A3LG 1ESFA 4R8IA 3GQBA 3SE0A 4ZCKA 2SOBA 5KNBA 2CQOA 4ZAIA 4ULLA 1CHPD 4I65A 3N6RA 1K8AC 3QR8A 1JJCB 1WCMH 1J8IA 1A3VA 1CZWA 1BO0A 5GADC 4S3SA 1CT1D 2DUDA 4CJ1B 4QGUA 1TWHB 2K04A 3A5UA 2EVBA 3RN2A 1NR2A 1WTPA 3SK4A 3D31A 5DEHA 3I4MB 3J81L 4LF5L 1ICFB 3CMEA 4A3JB 1QILA 3M4QA 2DY7A 4DAVA 4H02A 1KABA 3J81i 3T56B 1QZHA 1HNZQ 1O7IA 2C5CA 4J15A 2B63G 4XXEA 1LTSD 2TSSA 1PH8A 2ZXPA 1QOHA 2I5LX 2ES2A 4JOIA 2OF1A 2ZTEA 3RLFA 4MHEA 2UXBQ 4LK1C 4JI3Q 1LACA 4CDEC 1W6JA 3FP9A 2NZ1D 1VMPA 3SDZA 1VQPA 1ASYA 2NTTA 1TWAB 4K5WA 1I94L 3E5SA 3GTPH 5IODA 4HJ7A 1TWGH 1VF7A 5C4XB 4PMBA 1STYA 3KF8A 3CCJA 1LT6D 1TVXA 2KHSA 1VQLA 3OPOA 2I5MX 1FJGQ 4HN7A 1E2ZA 3T51B 3BDOA 1JWSD 4IN3A 5M5WH 1PFNA 2BDOA 1XTDA 4LFBQ 4A3GB 1EIFA 1F2LA 4DXGA 3DEPA 1LT5D 3F2CA 3VYRA 1VQIA 1XYIA 5JEAJ 2K5WA 1K3RA 2FMCA 4A76A 2VS1A 5FJ8G 2RCNA 1SYDA 2EQSA 2X6GA 5I6WA 3DWQA 2B3GA 5EKIA 1E1OA 5JJZA 3CD6A 4C3JG 4DK1A 4DFAA 1CA5A 5LMNQ 4XYQA 2DY8A 5K36G 1KRTA 4A3FB 3VR2A 3I4LA 2D0PA 4RMFA 1EY6A 4GS3A 2O5IC 1RL2A 4EQ5A 5LL6X 4A3IH 4F8MA 3SVMA 3GDEA 3GV6A 5C0XI 3KDFA 2UU9L 1GJXA 5FO9B 4JYAQ 4LF9L 4TSSA 1JOKA 2Z0SA 3L9AX 5DAUA 2PI2E 4DR5L 4BY7G 1F9QA 3HOYG 1ZKOA 4V190 2OTJA 3I7FA 3MC0B 2IHEA 1X3PA 2NTSA 2ICIA 4AYBB 2EY1A 3OIQA 1FNUA 4DV3L 1PYWD 5M9OA 1Q8KA 1EWCA 1S5FD 2K28A 3A8IE 1EYDA 3E0JA 4U68A 4IURA 3EROA 4C3HH 4A3KB 4P71A 3I56A 2NZHA 5T1IA 3M4YA 2CKZB 1V1QA 2R7DA 1GD7A 3S1MB 1STGA 2LKVA 1ENFA 3AFPA 3OTOL 5IYDH 5E7NA 3OW2A 3U58A 2WAQE 2AUKA 3K7AB 1PVOA 2A5HA 4RFBA 5LHY1 2QEXA 1R4QB 1JQYD 1MJEA 4GKKL 5IT9E 3PIO3 4DV5Q 4HR7B 3J80i 4H7BA 4M1UB 1C7YA 1YNJC 2BE5D 4BBSB 1ET9A 1II3A 1HR0L 4EQNA 4DR4Q 2F3WA 1FR3A 3HOVG 1UE7A 1X32A 4JBJA 3QOLA 1DOMA 3RNUA 3K5OA 2SNMA 3F8TA 3ULLA 4QIWB 4KI0A 2NVXH 5K5PA 3Q8DA
chains in the Genus database with same CATH topology
1CM9A 5EPLA 1ILPA 1H9SB 2PW5A 4IFDG 3FMCA 3J80E 1KLUD 3SXHA 2F0NA 1CHQD 1F77A 4IUTA 3K0YA 4CKEA 1TWFB 3NHHA 3TN2A 2XIWA 2A68D 4K8JA 1VF5C 3SEBA 1NAPA 1VDZA 2JP1A 1SDFA 5I4DA 1FGBD 2F03A 5EJWA 2NVQB 1GUTA 3WOFA 5M5YB 1OXUA 3H09A 1EIHA 3J80L 2PMZB 3BYTB 2EYOA 2B39A 5I2YA 1RDPD 3JAME 1AZPA 4PQXA 3TMEA 3G6JB 2L5TA 1ONLA 5CBEE 5BN3A 3J7AF 1LABA 1NR4A 2BA1A 2KQ3A 1HRJA 1D5ZC 4KTAA 4X3UA 1D1IA 5M5WB 5HGTA 2CW0C 1GUOA 1SE3A 5KNCA 5NUCA 4N9TA 4FF2A 3GTLB 1WD0A 4CKCA 1F2YA 1U4PA 2M2LA 1U4MA 3DEOA 1CK1A 2A69C 4YIJA 3AB9A 4HMIA 2PZWA 2KCNA 1SYFA 3J7YW 2GA4B 3AU7A 3MFYA 3K6OA 5BN5A 2R61A 4NMZA 4RH6A 3I70A 1LTAD 1G2TA 1I4PA 1AFPA 5CR3A 1DOLA 2PO4A 4O42A 5CV8A 1EU3A 5C6AA 4ZK9B 4GZYC 4A3DB 4P2CB 1WD1A 3NK9A 1FD7D 3M7NA 1DD2A 2CQAA 3PUYA 3CU7A 1I3QB 5A35A 1GUGA 3GTPB 2K01A 2HUGA 1S5CD 1SNCA 3SHLA 2HCIA 3FKIB 2R92B 1IKLA 2IT1A 3GTMB 1A15A 1LLRD 3I4NB 2R93B 1F2MA 5C0XG 5EBCA 2NB0A 2R3ZA 3IAYA 1PFBA 1VCIA 2B8GA 4DN4M 3W3AA 2E2DC 1O7LA 1EU4A 4G7ZC 3I3CA 2FINB 3QWNA 3W2DA 5C0XH 1BQQT 1RD9D 3T13A 1B1ZA 2L0CA 1ILQA 4XDXA 3C1EA 4XQNA 5DM63 4PMCA 4A3IB 1QG7A 3KLSX 4BA1I 3S2DB 2B2YC 3Q24A 1KNAA 1B2TA 4FO2A 5AFWA 3NSWA 5FK9C 4RGTA 2EY2A 3AMUA 2RQXA 1EYCA 3TBIB 2DN8A 2JA8B 1ESRA 4ABNA 1I50B 3ERQA 3P75A 4K8IA 1SBBB 3NWTA 2RVLA 2JEBI 1HA5A 4H44C 1Q90A 1AZQA 1SFOB 5EGTA 3C46A 3HGBA 3L3OC 1KLGD 1SNMA 1XTCD 3MEHA 2PZTA 2BE5C 2NN6I 2D2CC 1V1OA 3MTSA 3S17B 2K5QA 3FVQA 3GD7A 3R93A 2O5JC 5ELCA 2OT2A 3TP8A 2ENBA 3SR1A 3CHBD 4ME5A 3QB3A 1QE6A 4CJ2C 4FF3A 1SMYD 5JEAG 4RHSA 2A74C 4DK0A 3BDLA 1GOZA 3L7ZC 4I7ZC 4QMGA 4A3EB 1SE2A 2YYZA 2M9VA 4HEDA 4J1MA 2XNAC 1BCPD 3EVQA 3K59A 2B2VC 3LWUA 1W6KA 4C2MB 4K5XA 4KN7C 5IOCA 1H9MA 5LL6S 4XIGS 1I4QA 1CQFA 2Q8IB 4DU9A 1LO5D 3IKJA 3M4OB 3VYSA 1WTVA 1O80A 1Q8IA 5C4JB 1I6VC 4OIJA 4B9WA 1A2TA 4RWSC 1BCPF 4M8AA 5FOBB 1EY9A 1HHVA 4UDUC 4TKOB 2EJGC 5C4ZA 4KN4C 1BCPC 3HOWB 2F0DA 4IALA 1HUMA 1IKMA 3FPUB 2G9DA 3E6ZX 3P1HA 3M3YB 4OL7A 2I46A 3NWSA 4K14A 3GO5A 4FXGC 1I6HB 2H4OA 1V43A 1EY5A 4FXKC 3BVMA 3BVGA 2O4XA 2F1MA 2D9UA 1LT4D 2EDGA 1WVLA 1ENCA 5I9OA 1CA6A 1SSOA 5CV9A 4V0BA 4IFDJ 3Q23A 4KKSA 4IUUA 4ILWA 4JBWA 3J81E 4LJZC 5JPMC 3VR4A 4F7XA 3FEWX 4LMQD 1EL0A 2M00A 3NQTA 5CC4A 1BF4A 2DNEA 2L55A 3H94A 1JWUD 2K1BA 5DNFA 2IW3A 4XT1B 3OIPA 1D6EC 3S9WA 2K7VA 3MHBA 3D6CA 2FJ2A 1DXMA 2F0QA 3BG3A 4R8NA 4OO1G 1U4LA 5FLXE 4KJNA 3VYUA 3TP6A 2I07B 3ND8A 3J7AV 1HTPA 1PZKD 5E3FA 2RDFA 2SNSA 2R7ZB 2NVXB 2E76C 1NUCA 3V96A 1C8CA 4ZLTF 1Q3LA 1JB3A 1S5ED 1T5EA 1BDOA 1SYBA 2IX1A 2R6GA 1S5DD 2OXPA 2F0EA 3D4WA 4PMWA 1V1PB 4OGQC 4XYOA 4HCSA 2PZUA 2V4DA 4DF7A 4BS9A 1JCKB 1NSNS 4C1NK 1HQRD 5JPNC 1ZXTA 1OO9B 2YU9B 1RF2D 3WOEA 2XRSD 3FRPB 5D3IB 2ZXRA 3EFXD 3Q22A 1PLFA 2NYZD 1KTKA 1E0BA 1I4RA 1EY0A 3A55A 1BCPB 2HDLA 1TS3A 4K6LA 1XX8A 2E2JB 3OMGA 5FO8B 1RHPA 4KKUA 3FPPA 1EY4A 1G8ZD 5K36H 1GUWA 2KEEA 1JOOA 3ITPA 2L12A 4WJWA 1B9MA 2PNRC 3GTJB 5C3WA 3OWEB 4L63B 3GP7A 3DMUA 1H9RA 2XRQD 4A3MB 1MSHA 1LTBD 1WTOA 5IGFA 2IL8A 1EQTA 2E74C 4CGYB 5IIFA 3S15B 1TS4A 2FFKB 4XQQA 3SK5A 3ND9A 1FNWA 4C3IB 1OXTA 2B2TC 2JA6B 4MIUA 1Y8PB 1IYUA 2PPBC 1SJHD 1S4ZA 2PW7A 3K5LA 4LAAA 2EYJA 2LS01 1DONA 2PCFB 1CQVA 1LT3D 3HOUB 3V2TA 3DHQA 3NTIA 2KECA 1F9PA 1EFID 3P7JA 5E4WC 1R4PB 2EJMA 2AWOA 3K57A 2LFNA 1F2ZA 3QJYA 5F2DA 1WTXA 4WORA 5CV7A 3GTGB 2LMCB 3K58A 3DXJC 4RHRA 2NVYB 3V05A 5M3MB 2MJ8A 3O13A 1B3AA 1MD2D 3VR6A 1SYEA 1YNNC 1Y1VB 2SEBD 1GHKA 3EJIA 3X3NA 1PZJD 2F0VA 2F0IA 4G7OC 1HXYD 4FP5D 1E2WA 2CW0D 4HSVA 1V1PA 1G6ZA 4OO1H 2HDMA 4ZKCB 4U673 3R8BA 4OHJA 3S1QB 2TMPA 1PDQA 2N55A 2G9HD 1WTWA 5IGBA 2BDNA 2FHTA 1O7ZA 2NN6G 2EYLA 3OW7A 1STHA 1A2UA 3NPPA 2WP8J 3HZXA 1MI2A 2RKSA 4C3HB 1Z6HA 3D6WA 1TWCB 5KNDA 2QKIC 2Z4HA 2EJFC 2JXMB 3U9SA 3KLRA 2EPBA 4TQUS 1EZ6A 3SK8A 1A3TA 3C2PA 3KUPA 2EY5A 2L9HA 1EIGA 3CQZB 2EYPA 3N52A 2JA7B 3NP8A 5E4XA 4IUQA 1CZGA 1TWGB 4PV1C 2F0HA 3BS1A 3S1NB 4ZUIA 2NVTB 1ZYRD 1B9NA 1JOQA 3OSOA 4BY7B 2B2VA 4L8JA 4NDXA 3VR5A 3T53B 5JAVA 1I4HA 2EYHA 3NE5B 3R2TA 2D5DA 2OEOA 1H9SA 3VYTA 2JEAI 4C3IG 3HKZB 1EEFD 3MXPA 1LV9A 1GXDC 1SNDA 3GTQB 2K6AA 2VNUD 4DAYA 5KYLA 1J9OA 1SEBD 2A6HC 1TQOA 3K5MA 1M8AA 1DZ1A 4QCLA 1Y1WB 3OHXC 2F0SA 5ELEA 1AW7A 3A8JE 2D62A 4G4KA 5T1GA 2XWJB 1H9JA 4ZRZA 1Q1BA 3ONAB 1BBXC 3BZDB 1KDCA 1DM0B 2K03A 4KY6A 4KY5A 2F0OA 3U9OA 4DGZA 1QCBD 3KK7A 4C3HG 1D5MC 2Q8TA 2X69A 1U4RA 3LWEA 1BUVT 3A56A 2VXWA 1QNUA 1B53A 2CHBD 4CKBA 1V8QA 3R2IA 4EQPA 1HA6A 3BYYB 4RAUC 3PUVA 2F0TA 4HMJA 5M5XB 1G91A 4IFDI 1IW7C 2E2HB 5CYUA 1RTOA 2B2UC 2C9OA 2AUJD 1HFNA 5TSSA 4TRDA 3I72A 4UAIA 2B2UA 2Z8LA 1HQMC 3TP7A 3DUZA 1HTLD 2N88A 3I91A 1LTID 2RDGA 1HCZA 2NN6H 2KUMA 1C48A 3PV0A 2AQ2B 2WINB 2IX3A 2RSNA 2J4XA 2WV6D 1DYQA 4RKLA 4K2LA 4N9PA 2AWNA 2VB3X 3G7LA 4CBVA 2K05A 1BOSA 4O1NA 1RJTA 3RZDB 3NTHA 1EWHA 4FNFA 1ZYRC 3OOCA 2F0WA 3S1RB 3URYA 1B44D 3H6MA 4G7HC 4Q5VA 5CORA 1IYVA 5C0XJ 3H3VC 2F3VA 1AP0A 4X3SA 1XXGA 2BOSA 1OXXK 3NBIA 2F4IA 5CGKA 1IL8A 1EEID 5EQ0A 2KEDA 4NW2A 3ZYYX 4EQOA 3GTOB 1K8MA 1EY7A 1HPCA 1DCZA 5COYA 5EKKA 1UNSA 4NKLA 2XVSA 2WAQB 2IWHA 5C4HA 4H0LC 1Y8NB 1R9TB 1RTNA 5EBDA 3TZDA 4ZUJA 3PUWA 1ET6A 1XWEA 5KEEA 1EOTA 5FLXL 2QEJC 5JVG3 3EA6A 4X3TA 3M7GA 3H91A 1MSGA 2Z1CA 5D14A 3PUXA 1AN8A 2X6LA 4DA2A 5C5MA 4IFDH 4A93B 3A8KE 1ENAA 3VA7A 4KK7A 1UAPA 2F0KA 2JYOA 3HS0C 4K2KA 1Z47A 2NUCA 3I90A 1B4OA 5CV4A 3QOJA 4KY7A 3IL8A 4FXDA 1TS5A 2A68C 5EKLA 1L0YB 3WDNA 5IGEA 1BR9A 2B8FA 1STAA 3P20A 4FYDA 2MP1A 3S2HB 4KV6A 4PNYA 2VUMB 5HURA 4CHTB 2MHVA 1TR5A 3MFGA 1EY8A 2WB1B 3TSSA 3R3OA 1OXSC 1T5XD 1O78A 1STBA 2EYFA 1JR0D 2B2WA 4J8QA 1WTQA 3KLSA 5IGCA 1LTRD 2DNCA 5ELBA 4OO1I 4B9XA 2H1EA 5J1ZA 5CV6A 3DWPA 1JE4A 1B50A 1BXTA 1QWYA 2EOTA 2EYMA 5JEAH 4QB4A 4BA2I 1EYAA 1O7YA 1JORA 4KHVA 3MXUA 4XT3B 3S14B 1PTOH 3PUZA 4X3KA 2JA5B 1TS2A 2A6EC 3EQLC 2EY6A 1A6XA 1YNJD 2K5DA 1HUNA 3BDCA 3QIAA 2E2IB 3TZUA 5CBAE 1Q12A 2WIIB 4HSPA 1WCMB 1IHZA 2A73B 2ZT9C 2AQ1B 1H9KA 2J7ZA 5J22A 4RCOA 1PRTC 2RDHA 4Z9CB 2AQ3B 2HQEA 1Z7TA 5FKAC 5C3XA 4QUFA 4XTCS 3NBHA 1DOKA 1TKWB 3KBGA 1SNOA 4HAEA 4G57A 2RBMA 1QNKA 1SNPA 4RGMA 5ISRA 2J0TD 2VB2X 1G291 2QDBA 4KJOA 1BNZA 3C3LA 3NXWA 4EGVA 3CKIB 4F87A 3OWFA 4KD4A 3I8ZA 4KMUC 1SMYC 3A7LA 2JE6I 3LNNA 1PZID 3T4AC 3PO3B 1QJOA 3OMCA 2XWBB 2F0JA 3HOVB 5C5LA 5CMDA 1K8OA 1EZ8A 3T16A 3RUZA 1KDBA 3MAQA 1FNVA 1RKNA 3Q6SA 5JOBA 1QB5D 1LTTD 3S16B 5I6YA 3IFTA 4BWGB 5IT9L 3X3MA 1GUSA 3NQIA 5D3DA 2EE1A 1X3QA 4H13C 4KHZA 5M3FB 3DWAA 5ELFA 2L11A 5FO7B 1PTOC 3NUCA 2Y0SB 3PMFA 2F0GA 1RODA 2F0UA 1PFMA 1Y69U 2RA4A 3MZ5A 4ZKBB 4C1NI 2KJXA 1ML0D 3HOYB 2IPKD 2BA0A 3F2UA 1F9SA 3D4DA 4HCEA 3DM1A 1D5XC 3RMHA 2ICEC 3BVZA 4K6DA 2F0LA 2L4NA 3D4RA 2IX0A 4IZ8A 2XN9C 2WKDA 3Q0AA 4HTHA 4C3JB 1TY2A 3CRKC 1YNND 3MVVA 2MPMA 4NP5A 4FF4A 4WFN3 1KAAA 1A3UA 4RKBA 3NTKA 1KDAA 1VMCA 4E6IA 4QUCA 1RCVD 4BY1B 2L1BA 3A7AB 1SXTA 3GV3A 3MWYW 5KYIA 4IUPA 2CVRA 1CTMA 4CJ0B 3MA2B 3H0GB 1TIID 1D2BA 3D8GA 3D3RA 4IUVA 2KVMA 1G2SA 1PMRA 1I4XA 4FF1A 1DJRD 2QCPX 5E1FA 1SYGA 1TT2A 1Y8OB 2KA7A 5KGUA 4R9WA 2ZXOA 3MXGA 4KD3A 4A3BB 5KIXA 4RGOS 1EQVA 2B63B 2O2LD 4QF4A 5I2XA 1GUNA 1L0XB 1MGSA 5A2QL 2Z4IA 4K5VA 1STNA 2QF7A 4JK1C 1KNEA 2MUYA 4DNRB 4Y7NB 5EPJA 1JWMD 1U9RA 3C1FA 3TP5A 1M4VA 4RA8A 4OIKA 3FDTA 2WKCA 4F88A 1PRTD 2PQEA 1SE4A 3I73A 3HOXB 1FYCA 2MGSA 4ID6A 2F0MA 2IJ0A 1PTOD 4MN3A 2ID0A 4L6TB 1PXUA 2SDFA 5G3LF 2KCCA 4B08A 1SAPA 2XSCA 3LX0A 5ELDA 4BBRB 5DM73 2EXZA 3HRZC 1SYCA 4J6HA 1JC7A 3QG1A 2A69D 5JVH3 1CI3M 5G3LD 5J39A 4RGNA 5EPKA 1PTOF 4ZYSA 3QO2A 2JSOA 1F9RA 5I9PA 4C56C 1PRTB 1PRTF 1UEAB 2HCCA 1CFMA 5A2QE 1IW7D 3M85A 4IUNA 1PTOB 2B2YA 2NBFA 4WRDA 3TDQA 1C4QA 1LTGD 2NWGA 3HP3A 3A54A 1SJED 3RD4A 4FVMA 2RSOA 1AEXA 4IQZA 5IGDA 1TU2B 1UUPA 2K33A 2B2WC 2Q8RE 1NCVA 3VA5A 1ICWA 2E75C 2PYKA 3MXNA 2WACA 3HEJA 4DNTB 2EZVA 1HFGA 5C44B 4Q0FA 3VR3A 1K83B 1Q1EA 5D65A 3K5NA 2F0PA 1ZEQX 4ODGA 1WTRA 2LY7A 2KOLA 1TY0A 5BN4A 4XQJA 4KKTA 1MBYA 3HG9A 2K32A 3SK6A 3PIP3 1OXVA 1STEA 3JAML 4ZQ3A 1JICA 2A6HD 4EVOA 4DAPA 2A6ED 1E2VA 2BCOA 1D1KA 3PO2B 1GHJA 5C3EB 5IGGA 5CV5A 1S5BD 3CRLC 2F0FA 1SNQA 4RCNA 2FMMA 5KRUA 3HOZB 3UI2A 4DXFA 3RZOB 2QILA 3GTKB 3KBXA 3IFDA 1I4GA 2B2TA 1ESFA 4R8IA 3GQBA 3SE0A 2SOBA 5KNBA 4ZAIA 4ULLA 1CHPD 4I65A 3N6RA 1J8IA 1A3VA 1CZWA 1BO0A 4S3SA 1CT1D 4CJ1B 1TWHB 2K04A 2EVBA 1NR2A 1WTPA 3SK4A 3D31A 5DEHA 3I4MB 3J81L 4A3JB 1QILA 2DY7A 4DAVA 1KABA 3T56B 2C5CA 4XXEA 1LTSD 2TSSA 2ZXPA 1QOHA 2OF1A 3RLFA 4MHEA 4LK1C 1LACA 1W6JA 2NZ1D 1VMPA 3SDZA 2NTTA 1TWAB 4K5WA 3E5SA 5IODA 1VF7A 5C4XB 4PMBA 1STYA 3KF8A 1LT6D 1TVXA 2KHSA 3OPOA 4HN7A 1E2ZA 3T51B 3BDOA 1JWSD 4IN3A 1PFNA 2BDOA 4A3GB 1F2LA 4DXGA 3DEPA 1LT5D 3VYRA 1XYIA 5JEAJ 2K5WA 2FMCA 1SYDA 2X6GA 5I6WA 3DWQA 5EKIA 5JJZA 4C3JG 4DK1A 4DFAA 1CA5A 4XYQA 2DY8A 5K36G 4A3FB 3VR2A 3I4LA 1EY6A 2O5IC 5LL6X 4F8MA 3SVMA 3GV6A 5C0XI 1GJXA 5FO9B 4TSSA 1JOKA 3L9AX 5DAUA 1F9QA 1ZKOA 4V190 3MC0B 1X3PA 2NTSA 4AYBB 2ICIA 2EY1A 3OIQA 1FNUA 1PYWD 5M9OA 1EWCA 1S5FD 2K28A 3A8IE 1EYDA 3E0JA 4U68A 4IURA 3EROA 4A3KB 5T1IA 3M4YA 3S1MB 1STGA 2LKVA 1ENFA 2AUKA 3K7AB 2A5HA 4RFBA 5LHY1 1R4QB 1JQYD 5IT9E 3PIO3 4HR7B 4H7BA 4M1UB 1YNJC 2BE5D 4BBSB 1ET9A 1II3A 4EQNA 2F3WA 1FR3A 1X32A 3QOLA 1DOMA 3K5OA 2SNMA 4QIWB 4KI0A 5K5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8G A;  2NUC A;  3DMU A;  4R8N A;  5KYL A;  4KJN A;  5IGG A;  4K2L A;  2EY2 A;  2PW5 A;  4N9P A;  5CV5 A;  3TP6 A;  4B9W A;  1SYF A;  1TQO A;  1A2T A;  5CV4 A;  1EYC A;  3QOJ A;  5I9P A;  3SXH A;  4KY7 A;  5E1F A;  1IHZ A;  2F0F A;  2F0N A;  1SYG A;  1SYD A;  1TT2 A;  1SNQ A;  1EY9 A;  3ERQ A;  4NMZ A;  5E3F A;  5I6W A;  2RDF A;  2SNS A;  3P75 A;  5IGB A;  5KRU A;  4K8I A;  3NUC A;  5EKL A;  5J22 A;  2EYL A;  5KGU A;  1STH A;  5C4Z A;  4IUN A;  5IGF A;  3PMF A;  4DFA A;  5IGE A;  1NUC A;  2F0G A;  4WRD A;  1A2U A;  2F0W A;  2F0S A;  4KD3 A;  2F0U A;  3NHH A;  2F0D A;  5KIX A;  5CR3 A;  1EQV A;  5IIF A;  2SOB A;  4QF4 A;  1EY6 A;  3HZX A;  2HQE A;  3H6M A;  4K8J A;  5EGT A;  2RKS A;  1STA A;  4IAL A;  4F8M A;  5C3X A;  4I65 A;  5CV8 A;  1SNM A;  4KV6 A;  2F3V A;  3MEH A;  3MZ5 A;  4K5V A;  1A3V A;  1STN A;  1AEX A;  2PZT A;  3P1H A;  1SNO A;  3SK5 A;  4S3S A;  5HUR A;  5C6A A;  5IGD A;  1TR5 A;  1SYB A;  5CGK A;  1JOK A;  4G57 A;  4OL7 A;  1EY8 A;  2RBM A;  1SNP A;  5DAU A;  3SK4 A;  1EZ6 A;  1KDC A;  2OXP A;  2F0E A;  1A3T A;  3D4W A;  3NK9 A;  4K14 A;  3SK8 A;  3R3O A;  5ISR A;  4MIU A;  2PZU A;  4KY6 A;  4KY5 A;  3D4D A;  5DEH A;  4DF7 A;  1NSN S;  2F0O A;  4EQO A;  3U9O A;  1EY5 A;  1U9R A;  3C1F A;  1STB A;  2EY5 A;  2EY1 A;  2PW7 A;  2QDB A;  2EYF A;  1EY7 A;  2PYK A;  4LAA A;  3TP5 A;  4DGZ A;  2EYJ A;  5M9O A;  4K6D A;  3V2T A;  4KJO A;  2F0L A;  1SNC A;  1KAB A;  3DHQ A;  2EYP A;  2WAC A;  3SHL A;  3TP8 A;  2ENB A;  2O4X A;  3HEJ A;  3SR1 A;  3NXW A;  5EKK A;  4NKL A;  4IZ8 A;  2EYO A;  4ME5 A;  1EYD A;  3NP8 A;  3QB3 A;  4HTH A;  3ERO A;  5F2D A;  1F2Z A;  3OWF A;  2F0P A;  2PQE A;  4KD4 A;  3TME A;  4EQP A;  2OF1 A;  4ODG A;  5C4H A;  1ENC A;  1F2M A;  4ID6 A;  2F0H A;  4WOR A;  2F0T A;  2F0M A;  5CV7 A;  3VA5 A;  5I9O A;  5IGC A;  4HMJ A;  5CV9 A;  3MVV A;  1EY0 A;  3BDL A;  4ZUI A;  2KQ3 A;  1STG A;  2LKV A;  1JOQ A;  4B9X A;  4NP5 A;  4PNY A;  4KTA A;  4ZUJ A;  5CV6 A;  5J1Z A;  3OSO A;  4QMG A;  5KEE A;  4K5W A;  3OMC A;  5HGT A;  3E5S A;  4NDX A;  4F7X A;  1KAA A;  1SYE A;  2F0J A;  3OMG A;  3SK6 A;  4TRD A;  3LX0 A;  5C5L A;  5NUC A;  2M00 A;  4N9T A;  5IOD A;  1A3U A;  3NQT A;  4RKB A;  1EY4 A;  2EYM A;  4H7B A;  4J1M A;  1EZ8 A;  4QB4 A;  3T16 A;  1KDA A;  5CC4 A;  3TP7 A;  3EVQ A;  1EYA A;  1KDB A;  4ZQ3 A;  3RUZ A;  4E6I A;  1II3 A;  3EJI A;  1JOR A;  4PMB A;  1STY A;  1JOO A;  3ITP A;  2EXZ A;  4KHV A;  4EQN A;  2EYH A;  5JAV A;  2F3W A;  2KHS A;  3T13 A;  4EVO A;  1F2Y A;  1SYC A;  4J6H A;  5C5M A;  5KYI A;  2F0V A;  2OEO A;  4K5X A;  2F0I A;  3QOL A;  1RKN A;  3C1E A;  5IOC A;  3MXP A;  4YIJ A;  5JOB A;  4PMC A;  2EY6 A;  3S9W A;  2SNM A;  1ENA A;  3MHB A;  4HMI A;  5I6Y A;  3D6C A;  5K5P A;  2PZW A;  2F0K A;  1SND A;  2F0Q A;  4DU9 A;  5C3W A;  3BDC A;  5J39 A;  4K2K A;  4RKL A; 
#chains in the Genus database with same CATH topology
 1CM9 A;  3TEH B;  4NPS A;  3PO3 G;  5EPL A;  4A3B G;  1ILP A;  1H9S B;  3KF6 B;  2PW5 A;  4IFD G;  3FMC A;  3J80 E;  1KLU D;  3SXH A;  4JI3 L;  2F0N A;  1TWH H;  5GQO A;  1IXR A;  1CHQ D;  1F77 A;  1HNW L;  2XGT A;  3S17 H;  1I5F A;  4IUT A;  3K0Y A;  4JC0 A;  1SRO A;  1TWF B;  3NHH A;  4CKE A;  3TN2 A;  2XIW A;  4P74 A;  1PH5 A;  5LMU Q;  2A68 D;  4K8J A;  4A3G G;  1N8R C;  1VF5 C;  3SEB A;  1NAP A;  1VDZ A;  3K8A A;  2JP1 A;  1EOV A;  1SDF A;  5I4D A;  1FGB D;  2F03 A;  1G6P A;  5EJW A;  2NVQ B;  1NNX A;  4JI8 L;  1GUT A;  3WOF A;  1CUK A;  1N36 L;  2PQA B;  4X66 Q;  3CP0 A;  5M5Y B;  5C4X G;  2B63 H;  4YCV A;  1OXU A;  2UUB L;  1XNR Q;  3H09 A;  1EIH A;  4DR5 Q;  4DAM A;  3J80 L;  1X56 A;  4YWL A;  2PMZ B;  4DR3 Q;  3CCL A;  3BYT B;  4X62 Q;  2EYO A;  2B39 A;  4NXN L;  5I2Y A;  1RDP D;  1YVC A;  3JAM E;  1AZP A;  4PQX A;  2WAQ G;  1XNQ Q;  2I5H A;  3TME A;  4JI5 L;  3G6J B;  3E9I A;  2L5T A;  1L1O B;  4DAY B;  1ONL A;  5CBE E;  5BN3 A;  3J7A F;  1LAB A;  1NR4 A;  2BA1 A;  2KQ3 A;  4O2D A;  5JJK A;  4CDD C;  3IRB A;  4UHV A;  1HRJ A;  1D5Z C;  4KTA A;  4X3U A;  1B70 B;  1D1I A;  5M5W B;  2JA6 G;  5HGT A;  1X65 A;  1E24 A;  2CW0 C;  1GUO A;  1SE3 A;  5KNC A;  5NUC A;  4N9T A;  4FF2 A;  4GLV B;  4OWX B;  3GTL B;  1WD0 A;  3I4M G;  2MFI A;  1HZ9 A;  4CKC A;  3HOZ H;  4IJH A;  5C4J H;  1F2Y A;  1U4P A;  2M2L A;  1U4M A;  4P73 A;  3S24 A;  3DEO A;  1CK1 A;  2A69 C;  3CCS A;  4YIJ A;  2UXD L;  4POG A;  3AB9 A;  5IP7 H;  4BBR G;  1IBK Q;  4HMI A;  2PZW A;  3CAM A;  1EUJ A;  4UP7 A;  3CC7 A;  2KCN A;  4DR4 L;  1MKH A;  1VQH A;  1L1O C;  5IYC G;  4WJ3 M;  1SYF A;  3J7Y W;  2GA4 B;  3AU7 A;  3MFY A;  3K6O A;  4A93 H;  5BN5 A;  2R61 A;  4NMZ A;  4RH6 A;  3I70 A;  1LTA D;  1G2T A;  1I4P A;  1AFP A;  1VQF A;  5CR3 A;  1DOL A;  2PO4 A;  4O42 A;  2NZO A;  5CV8 A;  1EU3 A;  2I0Q A;  5C6A A;  1Q86 C;  4ZK9 B;  4GZY C;  4A3D B;  4P2C B;  1WD1 A;  1E3P A;  3NK9 A;  1FD7 D;  3M7N A;  1DD2 A;  1P8L A;  4A3F H;  2CQA A;  3PUY A;  4DR7 L;  4GKJ Q;  1X3G A;  3CU7 A;  1I3Q B;  5A35 A;  1GUG A;  4DR1 L;  3GTP B;  4JBM A;  1HNX L;  2K01 A;  2HUG A;  1S5C D;  1SNC A;  3SHL A;  2HCI A;  3FKI B;  2R92 B;  1K8G A;  1IKL A;  4JI6 Q;  4DV2 Q;  2IT1 A;  4QIW E;  1K9M C;  1WFQ A;  3GTM B;  1A15 A;  2GN5 A;  4LUZ A;  1LLR D;  4JG2 A;  4JI7 L;  3I4N B;  2UUB Q;  2R93 B;  1F2M A;  5C0X G;  5EBC A;  2NB0 A;  3PIP A;  5GAE C;  2R3Z A;  3IAY A;  2Z6B A;  1H95 A;  1PFB A;  1VCI A;  4OWW B;  1N33 Q;  2B8G A;  1YJ9 A;  4DN4 M;  3W3A A;  2E2D C;  5C44 G;  1O7L A;  1XNQ L;  2JA9 A;  1V9P A;  1EU4 A;  3KF8 B;  4G7Z C;  1K0S A;  2OTL A;  1A0I A;  3I3C A;  4GOP B;  2FIN B;  3QWN A;  3W2D A;  5C0X H;  1XJV A;  1BQQ T;  4DUZ Q;  3TQY A;  1RD9 D;  3T13 A;  1B1Z A;  2KBN A;  5LMN W;  2L0C A;  1QUQ B;  1ILQ A;  1IBM Q;  1YHB A;  4XDX A;  3C1E A;  4XQN A;  1HJP A;  5IE8 A;  5DM6 3;  4PMC A;  4A3I B;  2UUC L;  1QG7 A;  3KLS X;  4BA1 I;  4YY3 L;  3S2D B;  2B2Y C;  3Q24 A;  3CXC A;  1KNA A;  1B2T A;  4FO2 A;  5AFW A;  3NSW A;  5FK9 C;  1PHJ A;  4RGT A;  2EY2 A;  3AMU A;  3J7A 5;  2RQX A;  1EYC A;  3TBI B;  2DN8 A;  2JA8 B;  1ESR A;  4ABN A;  4LF7 Q;  2Q2I A;  5H1S E;  1FL0 A;  1I50 B;  3ERQ A;  3P75 A;  4K8I A;  1SBB B;  3NWT A;  4DR2 Q;  2RVL A;  2JEB I;  2ZJR A;  1S40 A;  1HA5 A;  2F4V L;  4H44 C;  1Q90 A;  2E2I H;  1XMO L;  1AZQ A;  1SFO B;  1AH9 A;  4DUY L;  5EGT A;  3C46 A;  3HGB A;  3GTM H;  3L3O C;  1KLG D;  1SNM A;  1XTC D;  3MEH A;  2PZT A;  2BE5 C;  2R93 H;  2NN6 I;  2D2C C;  1V1O A;  3MTS A;  4MNO A;  3S17 B;  5JJL A;  2UUA Q;  2K5Q A;  1PFS A;  3FVQ A;  3GD7 A;  3NEN A;  3R93 A;  2O5J C;  4JI7 Q;  3RR5 A;  4R4C A;  5ELC A;  2OT2 A;  4LFC Q;  2NVT H;  3TS0 A;  1SE8 A;  3TP8 A;  2FXQ A;  2ENB A;  3SR1 A;  4DV1 L;  3S15 H;  3CHB D;  4ME5 A;  1HNX Q;  3QB3 A;  2E2J H;  1B8A A;  2JA7 G;  1QE6 A;  4CJ2 C;  4FF3 A;  2VY3 A;  2VUM H;  1KXL A;  1SMY D;  2LXK A;  4RHS A;  5JEA G;  3M3Y H;  2A74 C;  2MO1 A;  4DK0 A;  3BDL A;  3E0E A;  4APV A;  2RHQ B;  1GOZ A;  3PGZ A;  2V1C C;  1WYD A;  1PYS B;  1WI5 A;  3L7Z C;  4I7Z C;  4QMG A;  1J5E L;  1Z9F A;  4A3E B;  1Q7Y C;  1SE2 A;  4DV7 L;  2YYZ A;  2M9V A;  4HED A;  4J1M A;  4B3S L;  2XNA C;  1BCP D;  3EVQ A;  3K59 A;  2B2V C;  1GVP A;  3LWU A;  3NEM A;  3G71 A;  3STB D;  3J81 c;  1W6K A;  4C2M B;  2HT1 A;  4K5X A;  4KN7 C;  5IOC A;  1H9M A;  1WJJ A;  5LL6 S;  3AEV A;  1SFO H;  4XIG S;  4OEM B;  1I4Q A;  1CQF A;  2Q8I B;  5JJI A;  4AQY Q;  4DU9 A;  1LO5 D;  3IKJ A;  1SLJ A;  2K52 A;  3M4O B;  3VYS A;  4HJ8 A;  1WTV A;  1A62 A;  1O80 A;  1Q8I A;  5C4J B;  1I6V C;  4OIJ A;  1E1T A;  4B9W A;  1Y1V H;  1A2T A;  4UP8 A;  4RWS C;  1X55 A;  4B3M Q;  1BCP F;  1XPO A;  4M8A A;  5FOB B;  5LMN L;  2UUC Q;  1EY9 A;  1HHV A;  4UDU C;  4TKO B;  2EJG C;  5C4Z A;  4KN4 C;  4N8X 1;  1BCP C;  3HOW B;  2F0D A;  2MO0 A;  2F52 A;  4LUV A;  4B3S Q;  4IAL A;  3CC2 A;  1HUM A;  1IKM A;  3FPU B;  1G51 A;  2G9D A;  1B3Q A;  3E6Z X;  3P1H A;  4DUY Q;  5DLQ E;  3M3Y B;  4OL7 A;  2I46 A;  3T1Y Q;  1X3E A;  3NWS A;  3S1Q H;  2PMZ E;  3A5Z B;  4K14 A;  3GO5 A;  4FXG C;  4DK3 C;  1I6H B;  4JOI C;  2KHI A;  2H4O A;  1Y14 B;  5M5X H;  1FJG L;  5M3M G;  4A3E H;  1EY5 A;  1V43 A;  1VQJ A;  2UU9 Q;  3I55 A;  4FXK C;  1B7Y B;  3BVM A;  2YTX A;  2MNA A;  3BVG A;  2O4X A;  2WB1 E;  2F1M A;  2D9U A;  4KLK A;  4HJ9 A;  4LNQ A;  1NMG A;  1Y1W G;  1LT4 D;  2EDG A;  3CPF A;  1WVL A;  1ENC A;  5HGQ A;  5I9O A;  1CA6 A;  1SSO A;  3T1H L;  5CV9 A;  4V0B A;  1WCM G;  4IFD J;  3Q23 A;  4KKS A;  4IUU A;  4LF6 Q;  4ILW A;  3CCQ A;  3F1Z A;  4JBW A;  1YNX A;  3J81 E;  2E5L Q;  4LJZ C;  5JPM C;  3SGI A;  1HH2 P;  2Q2H A;  3CCU A;  1JJG A;  3VR4 A;  3HKZ G;  2UXC L;  4F7X A;  4X6A H;  3FEW X;  4LMQ D;  1EL0 A;  2M00 A;  4IJL A;  3NQT A;  5CC4 A;  1KRS A;  4L5T A;  1BF4 A;  4B3R L;  2DNE A;  1PH4 A;  2L55 A;  2OQ0 A;  4OWT B;  1QVC A;  3H94 A;  1JWU D;  2K1B A;  4DV4 L;  5DNF A;  3S1M H;  2IW3 A;  4HJA A;  4XT1 B;  3OIP A;  4JV5 L;  1D6E C;  4YWK A;  3S9W A;  2K7V A;  3MHB A;  3D6C A;  2FJ2 A;  5FLX c;  1JB7 A;  1DXM A;  3UDX A;  4X62 L;  2F0Q A;  1WOC A;  3BG3 A;  3H3V H;  5GAG C;  4R8N A;  4OO1 G;  1U4L A;  3CW2 C;  5FLX E;  4KJN A;  4LWC A;  2PI2 A;  3VYU A;  3TP6 A;  4NXN Q;  2I07 B;  3PQI A;  1IL2 A;  3ND8 A;  3J7A V;  1NJI C;  1HTP A;  1PZK D;  5E3F A;  2RDF A;  2SNS A;  5AJ3 L;  3LGJ A;  3J80 c;  1XPR A;  1IBL L;  2R7Z B;  2NVX B;  4I7A A;  2E76 C;  1NUC A;  2Q2T A;  3V96 A;  1C8C A;  1N32 L;  2R92 H;  1X3F A;  4ZLT F;  2ZM6 Q;  1Q3L A;  2AMC B;  1JB3 A;  1PH3 A;  4IPC A;  1S5E D;  4GLA C;  4PZ6 A;  3CQZ H;  1T5E A;  1BDO A;  1JJ2 A;  1DGS A;  1SYB A;  2IX1 A;  1UE6 A;  2R6G A;  1S5D D;  2OXP A;  1QVG A;  2F0E A;  3D4W A;  4PMW A;  3G6E A;  1V1P B;  4OGQ C;  1KL9 A;  4XYO A;  4HCS A;  2PZU A;  2V4D A;  4DF7 A;  4BS9 A;  4OXP A;  1JCK B;  1NSN S;  4C1N K;  1GM5 A;  1HQR D;  5JPN C;  1MIU A;  1ZXT A;  1OO9 B;  2YU9 B;  2BH8 A;  3BU2 A;  1RF2 D;  3WOE A;  1K28 A;  2XRS D;  3FRP B;  5D3I B;  2ZXR A;  3EFX D;  4R1J A;  4O0A A;  3Q22 A;  1PLF A;  2NYZ D;  4JW0 A;  1KTK A;  1E0B A;  1I4R A;  3EIV A;  1EY0 A;  3A55 A;  1BCP B;  1NY4 A;  2HDL A;  1TS3 A;  5IWA Q;  4K6L A;  1VQ8 A;  1XX8 A;  2E2J B;  3OMG A;  5IP9 G;  5FO8 B;  1RHP A;  4KKU A;  3FPP A;  1EY4 A;  3JC6 6;  1G8Z D;  1U5K A;  5K36 H;  1GUW A;  2KEE A;  1JOO A;  3ITP A;  2L12 A;  4WJW A;  3TS2 A;  1B9M A;  4X64 L;  5IT9 c;  4GLX A;  3KDF B;  2PNR C;  4AH6 A;  5EAY A;  2R7Z G;  3KJP A;  4DV6 L;  3GTJ B;  5C3W A;  3OWE B;  4QY7 A;  4L63 B;  3GP7 A;  5IY0 A;  5BR8 L;  3DMU A;  3GTL H;  1YZ6 A;  3KLW A;  1H9R A;  2XRQ D;  4DV2 L;  4A3M B;  1MSH A;  1AE3 A;  1LTB D;  1WTO A;  1HR0 W;  4GOP A;  5IGF A;  2IL8 A;  3G48 A;  1EQT A;  4IPD A;  2E74 C;  4CGY B;  4HID A;  5IIF A;  3S15 B;  1TS4 A;  2FFK B;  4XQQ A;  3PF5 A;  5L37 A;  4B3R Q;  2GVB A;  3SK5 A;  4X65 Q;  2QA4 A;  1YHA A;  3ND9 A;  1FNW A;  4C3I B;  1R9T H;  1OXT A;  2K5N A;  5ELO A;  2B2T C;  3JAM c;  4B3T L;  2JA6 B;  4MIU A;  2DGY A;  1BBU A;  1Y8P B;  5ELN A;  1IYU A;  1SJH D;  1S4Z A;  2PPB C;  2PW7 A;  3K5L A;  4LAA A;  3K7U C;  2EYJ A;  2LS0 1;  1DON A;  2PCF B;  1CQV A;  1LT3 D;  3V2T A;  3HOU B;  3DHQ A;  3NTI A;  2KEC A;  1F9P A;  1EFI D;  3P7J A;  5E4W C;  1R4P B;  2EJM A;  1C0A A;  1VQC A;  2AWO A;  2HD3 A;  3K57 A;  2LFN A;  1F2Z A;  3QJY A;  5F2D A;  1WTX A;  3K81 C;  1TWC H;  4WOR A;  5CV7 A;  2LSS A;  3GTG B;  2LMC B;  3CC4 A;  3ULP A;  1PH6 A;  3K58 A;  3DXJ C;  4BXX H;  4RHR A;  2NVY B;  3V05 A;  5M3M B;  2MJ8 A;  3O13 A;  1B3A A;  1MD2 D;  4IPG A;  2EIF A;  2KHJ A;  3VR6 A;  3JAM i;  1SYE A;  1YNN C;  2H5X A;  1Y1V B;  3I4N H;  2SEB D;  3KOJ A;  4DV6 Q;  2AKW B;  2JA7 H;  1GHK A;  3EJI A;  3X3N A;  3EBE A;  2WB1 G;  1EWI A;  2DJF C;  1PZJ D;  2E2H H;  2F0V A;  2F0I A;  4G7O C;  1HXY D;  4LF4 Q;  4FP5 D;  1E2W A;  2CW0 D;  2A19 A;  4HSV A;  1V1P A;  1YJW A;  1G6Z A;  4MTK A;  2R93 G;  4OO1 H;  4LF7 L;  4A3C H;  1BKB A;  1AE2 A;  2HDM A;  4ZKC B;  4U67 3;  3R8B A;  1E22 A;  4AYB E;  1VQB A;  4OHJ A;  3S1Q B;  2TMP A;  1PDQ A;  2N55 A;  2R92 G;  2G9H D;  1WTW A;  4A3L H;  5IGB A;  2BDN A;  2FHT A;  2ZTC A;  1O7Z A;  2NN6 G;  2EYL A;  4UPA A;  3OW7 A;  1STH A;  4K0K L;  4QQB X;  1A2U A;  3BJU A;  3L2P A;  4IO9 A;  3NPP A;  2WP8 J;  3HZX A;  4IOA A;  1MI2 A;  2RKS A;  4C3H B;  3CPW A;  2F4V Q;  4GKK Q;  1Z6H A;  2JA8 H;  3D6W A;  1TWC B;  1C9O A;  5KND A;  2QKI C;  2N8N A;  2Z4H A;  2EJF C;  2JXM B;  3U9S A;  3KLR A;  3RZO H;  2EPB A;  4TQU S;  1EZ6 A;  3SK8 A;  1A3T A;  3C2P A;  3KUP A;  2KCM A;  2EY5 A;  3E9H A;  2L9H A;  1EIG A;  2R7F A;  3CQZ B;  2EYP A;  2OWO A;  3N52 A;  4BBS H;  2YTY A;  1KHI A;  2JA7 B;  3NP8 A;  5E4X A;  3HOV H;  4IUQ A;  1CZG A;  1TWG B;  4PV1 C;  2F0H A;  3W5O A;  3BZK A;  3BS1 A;  3S1N B;  4ZUI A;  2NVT B;  1ZYR D;  1B9N A;  1JOQ A;  4K0K Q;  3OSO A;  3L0O A;  4BY7 B;  2B2V A;  4L8J A;  4NDX A;  3VR5 A;  5FLM G;  3GTJ H;  4FDB A;  3T53 B;  4R4T A;  5JAV A;  2CCZ A;  1I4H A;  2EYH A;  4LFA L;  1LYL A;  5M3F H;  1UWV A;  3NE5 B;  3R2T A;  2D5D A;  2EXD A;  1A8V A;  2OEO A;  1H9S A;  3HKZ B;  3VYT A;  4C3I G;  2JEA I;  4A3M H;  1EEF D;  3MXP A;  4CDF C;  1PYB A;  1LV9 A;  3ULJ A;  2JN4 A;  1GXD C;  1SND A;  3GTQ B;  4YHH L;  1VQE A;  2K6A A;  2VNU D;  4A3C G;  4DAY A;  5KYL A;  4DR3 L;  3H15 A;  1J9O A;  1SEB D;  4C2M H;  2A6H C;  1TQO A;  4JI6 L;  3G4S A;  3K5M A;  1M8A A;  1DZ1 A;  2Z9H A;  3CCR A;  4QCL A;  4NB3 A;  1Y1W B;  4A3I G;  4KHP Q;  3OHX C;  2F0S A;  4HIM A;  5ELE A;  1AW7 A;  4HIK A;  4OON A;  3A8J E;  2D62 A;  4G4K A;  3UE0 A;  3K0X A;  5T1G A;  2VW9 A;  2XWJ B;  3HOU H;  1H9J A;  4ZRZ A;  1Q1B A;  3ONA B;  1BBX C;  1KQS A;  3S1N H;  3BZD B;  1KDC A;  4HJ5 A;  1YIT A;  1DM0 B;  2K03 A;  4KY6 A;  4KY5 A;  2F0O A;  3U9O A;  4MTN A;  2R7Z H;  4DGZ A;  1QCB D;  4X65 L;  3KK7 A;  4C3H G;  1D5M C;  2VL6 A;  2Q8T A;  3S2H H;  2X69 A;  1U4R A;  2QW7 A;  3LWE A;  1BUV T;  4N8F A;  4YY3 Q;  3A56 A;  3I4N G;  2VXW A;  1QNU A;  3HOW G;  1B53 A;  2CHB D;  4CKB A;  4TVA B;  1V8Q A;  3R2I A;  2JA6 H;  4EQP A;  1HA6 A;  1J6Q A;  3BYY B;  4RAU C;  3PUV A;  2F0T A;  3S16 H;  2ZJQ A;  4HMJ A;  5M5X B;  1G91 A;  4IFD I;  1IW7 C;  3H3V I;  2E2H B;  5CYU A;  1RTO A;  2RHS B;  2B2U C;  2C9O A;  1YI2 A;  2AUJ D;  1HFN A;  5TSS A;  4TRD A;  3I72 A;  4UAI A;  3H0G H;  5LMU L;  2B2U A;  2Z8L A;  1HQM C;  3TP7 A;  3DUZ A;  4BBS G;  1HTL D;  2N88 A;  3I91 A;  4JI1 L;  1LTI D;  2RDG A;  1K0R A;  1PH2 A;  1IBK L;  1HCZ A;  2NN6 H;  3ERS X;  3UDG A;  5M3M H;  4A3E G;  1JT8 A;  3PV0 A;  2KUM A;  1C48 A;  2AQ2 B;  2UUA L;  2WIN B;  2IX3 A;  1Y1V G;  2HHH Q;  2RSN A;  2J4X A;  2WV6 D;  1DYQ A;  4RKL A;  1RIP A;  1TWA H;  1QZG A;  3ZJY C;  4K2L A;  4C3I H;  4N9P A;  4DR6 L;  3S14 H;  2AWN A;  2VB3 X;  3G7L A;  4CBV A;  2K05 A;  1BOS A;  1W2B A;  4O1N A;  1RJT A;  4JCV E;  3AYH B;  3RZD B;  3NTH A;  1EWH A;  4FNF A;  3CF5 A;  1ZYR C;  3OOC A;  2F0W A;  3S1R B;  4IOC A;  5M5Y H;  3URY A;  1B44 D;  2N3S A;  3H6M A;  1PH9 A;  4G7H C;  4Q5V A;  2Z6K A;  1NMF A;  5COR A;  3J7Z C;  1IYV A;  5C0X J;  3H3V C;  2F3V A;  4DV7 Q;  1AP0 A;  3PIO A;  2D0O A;  3HKS A;  4X3S A;  1XXG A;  1VQK A;  2BOS A;  1OXX K;  3NBI A;  2F4I A;  5CGK A;  1IL8 A;  3HOX H;  2ASB A;  5IYC H;  2JQO A;  4MZ9 A;  1EEI D;  5EQ0 A;  4L5S A;  2KED A;  4NW2 A;  3ZYY X;  4EQO A;  3GTO B;  1K8M A;  1L2F A;  1EY7 A;  1M1K C;  1HPC A;  1DCZ A;  4JBK A;  5COY A;  5EKK A;  1UNS A;  4NKL A;  5IWA L;  2XVS A;  2WAQ B;  2IHF A;  2IWH A;  5C4H A;  4H0L C;  1T9H A;  1Y8N B;  4A75 A;  1R9T B;  1RTN A;  5EBD A;  3TZD A;  1WTH A;  2CWA A;  3S2D H;  3A74 A;  4ZUJ A;  1IYJ B;  3PUW A;  1ET6 A;  1XWE A;  5KEE A;  1EOT A;  4DUZ L;  5FLX L;  2QEJ C;  5JVG 3;  3EA6 A;  4X3T A;  3M7G A;  3PSI A;  3H91 A;  1MSG A;  2Z1C A;  5D14 A;  1XMQ Q;  1W3S A;  3PUX A;  1AN8 A;  4A3K H;  2X6L A;  4DA2 A;  5C5M A;  4IFD H;  4A93 B;  2CH4 A;  4JI2 L;  3A8K E;  4OX9 L;  1ENA A;  2ZJP A;  2K5V A;  3VA7 A;  1GO3 E;  2A1A A;  4KK7 A;  1UAP A;  2F0K A;  2JYO A;  5J3B A;  3HS0 C;  1VQA A;  4K2K A;  1EQR A;  1Z47 A;  2NUC A;  3I90 A;  3OYY A;  1B4O A;  2ATW A;  5CV4 A;  1YBY A;  2VQE Q;  3QOJ A;  4KY7 A;  3IL8 A;  1N34 L;  4GNX C;  1VQ7 A;  3FKI G;  4PZ8 A;  2QDL A;  4FXD A;  1TS5 A;  2A68 C;  4BY1 H;  2CFM A;  1L0Y B;  5EKL A;  3WDN A;  3UDI A;  4A3J G;  5IGE A;  3T1H Q;  1BR9 A;  1VS0 A;  2B8F A;  2P5Z X;  4LF6 L;  2N78 A;  1X54 A;  4NXM L;  1I3Q H;  3I4O A;  1STA A;  3P20 A;  4FYD A;  2MP1 A;  3S2H B;  4KV6 A;  4PNY A;  2VUM B;  5HUR A;  4CHT B;  2MHV A;  1TR5 A;  3MFG A;  4DV1 Q;  2N49 A;  1EY8 A;  1IZ6 A;  5HY6 A;  1Y1W H;  1A63 A;  2WB1 B;  4A3D G;  1LTL A;  3TSS A;  4DV4 Q;  3R3O A;  1JE5 A;  1OXS C;  1T5X D;  1UEB A;  1GKH A;  2F3I A;  1O78 A;  1STB A;  2EYF A;  3M4P A;  1JR0 D;  4P72 A;  4JYA L;  2B2W A;  4J8Q A;  3U50 C;  3HOZ G;  2VQF L;  1WTQ A;  1SR3 A;  1J5E Q;  4A3D H;  3KLS A;  5GRO A;  5IGC A;  4DV3 Q;  1LTR D;  2NVQ H;  3K80 C;  2DNC A;  5ELB A;  2DJG C;  4OO1 I;  1UE5 A;  4AYB G;  4B9X A;  3FHW A;  4IPH A;  1CKM A;  2H1E A;  5J1Z A;  5CV6 A;  1PH7 A;  1EFW A;  3DWP A;  4DKA C;  1HZC A;  3HOU G;  1JE4 A;  1B50 A;  1BXT A;  1QWY A;  2EOT A;  2EYM A;  5JEA H;  4QB4 A;  4BA2 I;  1EYA A;  1O7Y A;  2E8G A;  3NEL A;  4JI2 Q;  1JOR A;  3OTO Q;  3ER0 A;  4KHV A;  3MXU A;  2LXJ A;  2B29 A;  4XT3 B;  4LF4 L;  3MXN B;  3S14 B;  1KAW A;  1PTO H;  3PUZ A;  4X3K A;  2HQL A;  1VQ6 A;  2JA5 B;  1TS2 A;  3T1Y L;  2A6E C;  3EQL C;  4AQY L;  2RCF A;  4A3F G;  1I50 H;  2EY6 A;  1A6X A;  1YNJ D;  2K5D A;  4JI0 L;  4B3T Q;  1HUN A;  3BDC A;  1QUQ A;  4JI1 Q;  2Q2U A;  3QIA A;  3PO3 H;  2E2I B;  3TZU A;  4BY7 H;  3PF4 A;  1HNZ L;  5CBA E;  1Q12 A;  2KCT A;  2ZM6 L;  1U0L A;  2WII B;  4HSP A;  1WCM B;  1IHZ A;  2A73 B;  2ZT9 C;  2AQ1 B;  4A3M G;  1H9K A;  2J7Z A;  5J22 A;  3U4V A;  3D0F A;  4RCO A;  1PRT C;  1CSP A;  3TRE A;  2RDH A;  4Z9C B;  3E3X A;  1YEZ A;  2AQ3 B;  4DV5 L;  5C44 H;  3GTO H;  2HQE A;  4LW1 A;  1Z7T A;  1PA6 A;  5FKA C;  4JPB W;  4QUF A;  5C3X A;  3GTQ H;  4BY1 G;  4XTC S;  3NBH A;  3EN2 A;  1DOK A;  3KBG A;  1TKW B;  2C35 B;  1SNO A;  4HAE A;  2Y0S E;  1VQO A;  5FJ8 H;  4G57 A;  3VDY A;  1M90 C;  2RBM A;  1OTC A;  1QNK A;  1SNP A;  4RGM A;  2KEN A;  4DR1 Q;  3S1R H;  1CKO A;  5ISR A;  2J0T D;  2VB2 X;  1G29 1;  2QDB A;  4X64 Q;  1ASZ A;  4KJO A;  1BNZ A;  4CDC C;  3C3L A;  1NE3 A;  1CKN B;  3NXW A;  4EGV A;  3CKI B;  4ME3 A;  4YCU A;  1Q82 C;  4F87 A;  3OWF A;  2UXC Q;  5FLM H;  4KD4 A;  3KJO A;  3I8Z A;  4KMU C;  3RLN A;  5C4X H;  1HNW Q;  1SMY C;  3HOY H;  3A7L A;  2JE6 I;  3LNN A;  1PZI D;  4LFA Q;  3T4A C;  1VQN A;  3PO3 B;  1SN8 A;  1QJO A;  3OMC A;  2XWB B;  2F0J A;  3HOV B;  5C5L A;  3KFU A;  5CMD A;  1K8O A;  1EZ8 A;  4GN3 B;  3T16 A;  3RZD H;  3MEF A;  1KDB A;  3RUZ A;  5BR8 Q;  1EQQ A;  1N33 L;  2CH4 W;  3MAQ A;  1UE1 A;  4C3J H;  1FNV A;  2MQH A;  1RKN A;  3Q6S A;  5JOB A;  1QB5 D;  1LTT D;  3S16 B;  5IYB H;  4P75 A;  5I6Y A;  3IFT A;  4BWG B;  2L15 A;  5IT9 L;  3X3M A;  4BBR H;  1GUS A;  1MJC A;  3NQI A;  5D3D A;  2EE1 A;  1X3Q A;  4H13 C;  4KHZ A;  4YHH Q;  4DK6 C;  5M3F B;  1KC8 C;  3F2D A;  2OQK A;  4OX9 Q;  3A0J A;  1Q81 C;  3DWA A;  1VQM A;  5ELF A;  3I4M H;  2L11 A;  5FO7 B;  1PTO C;  3NUC A;  2Y0S B;  3PMF A;  4A3K G;  2F0G A;  1ROD A;  2BH2 A;  1I6H H;  2F0U A;  3M4O H;  5GAH C;  1K3B C;  4LF9 Q;  4L5Q A;  1PFM A;  1Y69 U;  3U4Z A;  4UP9 A;  2RA4 A;  3I2Z A;  3MZ5 A;  4JI4 Q;  4YWM A;  4ZKB B;  4C1N I;  2KJX A;  1K83 H;  1ML0 D;  3HOY B;  4DR7 Q;  2IPK D;  1IBM L;  4BXX G;  3HKZ E;  2BA0 A;  3F2U A;  3HOW H;  2HIX A;  1F9S A;  2JK8 A;  3D4D A;  4HCE A;  3DM1 A;  1D5X C;  3RMH A;  1SMX A;  3BZC A;  2YTV A;  3GTK H;  2ICE C;  3BVZ A;  4K6D A;  1NTG A;  2PQA A;  2F0L A;  2JJQ A;  5IYB G;  2L4N A;  3D4R A;  2IX0 A;  4IZ8 A;  2XN9 C;  2K4K A;  2WKD A;  3Q0A A;  4HTH A;  4GN5 A;  4C3J B;  1S3O A;  4L5R C;  4Y52 H;  1TY2 A;  3CRK C;  1YNN D;  4LUO A;  3MVV A;  3H0G G;  2JA8 G;  3CMA A;  1KD1 C;  2JA5 H;  2MPM A;  4A3G H;  1IBL Q;  4NP5 A;  1KIX A;  4FF4 A;  4WFN 3;  1KAA A;  1A3U A;  2CWP A;  4RKB A;  3AQQ A;  5C3E H;  3NTK A;  1KDA A;  1N9W A;  1VMC A;  4E6I A;  4QUC A;  1RCV D;  4BY1 B;  2L1B A;  3A7A B;  4PZ7 A;  1HZA A;  1BBW A;  1SXT A;  2GVA A;  3GV3 A;  4LF5 Q;  3MWY W;  3HFZ B;  5KYI A;  4IUP A;  2OCE A;  2CVR A;  1CTM A;  4CJ0 B;  3MA2 B;  3H0G B;  1TII D;  1EYG A;  2VQF Q;  1D2B A;  4DV0 Q;  5IP7 G;  3D8G A;  1HR0 Q;  3D3R A;  4IUV A;  4HIO A;  2KVM A;  1G2S A;  1PMR A;  1I4X A;  1JMC A;  4FF1 A;  1DJR D;  2QCP X;  5E1F A;  4JI0 Q;  1SYG A;  1TT2 A;  3RLO A;  1Q46 A;  1Y8O B;  4POF A;  1FGU A;  2KA7 A;  3DM3 A;  1PV4 A;  5KGU A;  4R9W A;  4B3M L;  2VZA A;  2G5D A;  2UXB L;  2ZXO A;  4GNX B;  2Z6K C;  3MXG A;  3PO2 H;  3KF6 A;  4KD3 A;  4A3B B;  4AIM A;  5KIX A;  1L1O A;  1EQV A;  4RGO S;  2B63 B;  2O2L D;  4QF4 A;  4JI4 L;  5I2X A;  4A3J H;  1GUN A;  1L0X B;  1MGS A;  5A2Q L;  2Z4I A;  4K5V A;  1STN A;  2RF4 A;  2QF7 A;  4JK1 C;  4GOP C;  1KNE A;  2IY5 B;  2MUY A;  1XNR L;  4R4O A;  4DNR B;  4Y7N B;  5EPJ A;  1LM0 A;  1JWM D;  1U9R A;  3C1F A;  1D7Q A;  3TP5 A;  1M4V A;  1CSQ A;  4RA8 A;  1FVI A;  4OIK A;  3FDT A;  2WKC A;  4F88 A;  4DR6 Q;  5M3F G;  1YHQ A;  3J81 j;  1PRT D;  3UE1 A;  5IP9 H;  2PQE A;  1SE4 A;  3I73 A;  3HOX B;  3ICE A;  1FYC A;  4RG1 A;  2MGS A;  4ID6 A;  1SRU A;  4DR2 L;  2F0M A;  4KHP L;  5C3E G;  2IJ0 A;  1PTO D;  4MN3 A;  2ID0 A;  4L6T B;  4JI5 Q;  4LF8 L;  4ALP A;  1PXU A;  1XMQ L;  2SDF A;  5G3L F;  3AFQ A;  4DNI A;  2KCC A;  4B08 A;  1SAP A;  2XSC A;  3PCO B;  3PO2 G;  4NXM Q;  3LX0 A;  5ELD A;  4BBR B;  2VUM G;  5DM7 3;  4A4I A;  2EXZ A;  3HRZ C;  1SYC A;  4J6H A;  1JC7 A;  3QG1 A;  2A69 D;  4JI8 Q;  4A3B H;  4LFC L;  5JVH 3;  1CI3 M;  1VQ5 A;  1N34 Q;  4X66 L;  3UDF A;  3B6Y A;  2K14 A;  5G3L D;  5J39 A;  4RGN A;  1LUZ A;  5EPK A;  4GNX A;  1YJN A;  4R4I A;  1N32 Q;  1PTO F;  2ZTD A;  4ZYS A;  3QO2 A;  3KYH C;  3W1G A;  2JSO A;  4DV0 L;  1F9R A;  5I9P A;  4C56 C;  1PRT B;  4JVZ A;  1PRT F;  1UEA B;  2HCC A;  4R4Q A;  1CFM A;  5A2Q E;  1IW7 D;  3M85 A;  1TXY A;  4IUN A;  1PTO B;  2B2Y A;  1X6O A;  2NBF A;  2PNH A;  4WRD A;  3TDQ A;  1C4Q A;  1LTG D;  4UY8 C;  2NWG A;  1P16 A;  4PG3 A;  5AJ3 Q;  3TRZ A;  4A93 G;  4YCW A;  3HP3 A;  3A54 A;  3CCV A;  1SJE D;  1K73 C;  3RD4 A;  1VQ9 A;  4FVM A;  2RSO A;  1AEX A;  2YV5 A;  3FKI H;  4DPG A;  2K5H A;  1MHW C;  4IQZ A;  5IGD A;  2K75 A;  1VQG A;  1TU2 B;  4JV5 Q;  1UUP A;  5IYD G;  1HZB A;  2UXD Q;  2K33 A;  2AHO B;  1CKN A;  1QVF A;  2B2W C;  2Q8R E;  3RN5 A;  3GTG H;  1NCV A;  1BVS A;  3VA5 A;  1ICW A;  2E75 C;  2PYK A;  2QGQ A;  3W1B A;  3MXN A;  4WJ4 A;  3CCM A;  2WAC A;  3HEJ A;  4DNT B;  3K7A H;  2EZV A;  1HFG A;  5C44 B;  4Q0F A;  3VR3 A;  1K83 B;  3DLL A;  2VQE L;  1Q1E A;  5D65 A;  4QL5 A;  3K5N A;  3M9B A;  2F0P A;  1ZEQ X;  4ODG A;  1WTR A;  2XTI A;  2LY7 A;  2KOL A;  1TY0 A;  1D8L A;  5BN4 A;  4XQJ A;  4KKT A;  1MBY A;  3HG9 A;  2JA5 G;  2A8V A;  2K32 A;  1EIY B;  3SK6 A;  2YU9 H;  1X9N A;  4GN4 B;  3PIP 3;  4LFB L;  1OXV A;  1STE A;  3JAM L;  1I94 Q;  4ZQ3 A;  1JIC A;  2K50 A;  2A6H D;  4EVO A;  2E5L L;  1VQD A;  4DAP A;  2NVY H;  4GKJ L;  2A6E D;  1E2V A;  2WFW A;  2ALY B;  2BCO A;  1N36 Q;  3NBH B;  3STB C;  4OEL B;  2Y0S G;  1L0W A;  1D1K A;  4EX5 A;  1XPU A;  3PO2 B;  1GHJ A;  5C3E B;  1TWF H;  5IGG A;  2HHH L;  3WWV A;  3F2B A;  3HOX G;  5CV5 A;  1XMO Q;  2HIV A;  1E7Z A;  1S5B D;  3CRL C;  3CCE A;  2F0F A;  1SNQ A;  4RCN A;  4LF8 Q;  1PH1 A;  2FMM A;  5KRU A;  3HOZ B;  3UI2 A;  4DXF A;  1VQ4 A;  3RZO B;  2QIL A;  4QJF A;  3GTK B;  1NBW A;  3KBX A;  1YIJ A;  3IFD A;  1I4G A;  4Y7N H;  2B2T A;  1S72 A;  4A3L G;  1ESF A;  4R8I A;  3GQB A;  3SE0 A;  4ZCK A;  2SOB A;  5KNB A;  2CQO A;  4ZAI A;  4ULL A;  1CHP D;  4I65 A;  3N6R A;  1K8A C;  3QR8 A;  1JJC B;  1WCM H;  1J8I A;  1A3V A;  1CZW A;  1BO0 A;  5GAD C;  4S3S A;  1CT1 D;  2DUD A;  4CJ1 B;  4QGU A;  1TWH B;  2K04 A;  3A5U A;  2EVB A;  3RN2 A;  1NR2 A;  1WTP A;  3SK4 A;  3D31 A;  5DEH A;  3I4M B;  3J81 L;  4LF5 L;  1ICF B;  3CME A;  4A3J B;  1QIL A;  3M4Q A;  2DY7 A;  4DAV A;  4H02 A;  1KAB A;  3J81 i;  3T56 B;  1QZH A;  1HNZ Q;  1O7I A;  2C5C A;  4J15 A;  2B63 G;  4XXE A;  1LTS D;  2TSS A;  1PH8 A;  2ZXP A;  1QOH A;  2I5L X;  2ES2 A;  4JOI A;  2OF1 A;  2ZTE A;  3RLF A;  4MHE A;  2UXB Q;  4LK1 C;  4JI3 Q;  1LAC A;  4CDE C;  1W6J A;  3FP9 A;  2NZ1 D;  1VMP A;  3SDZ A;  1VQP A;  1ASY A;  2NTT A;  1TWA B;  4K5W A;  1I94 L;  3E5S A;  3GTP H;  5IOD A;  4HJ7 A;  1TWG H;  1VF7 A;  5C4X B;  4PMB A;  1STY A;  3KF8 A;  3CCJ A;  1LT6 D;  1TVX A;  2KHS A;  1VQL A;  3OPO A;  2I5M X;  1FJG Q;  4HN7 A;  1E2Z A;  3T51 B;  3BDO A;  1JWS D;  4IN3 A;  5M5W H;  1PFN A;  2BDO A;  1XTD A;  4LFB Q;  4A3G B;  1EIF A;  1F2L A;  4DXG A;  3DEP A;  1LT5 D;  3F2C A;  3VYR A;  1VQI A;  1XYI A;  5JEA J;  2K5W A;  1K3R A;  2FMC A;  4A76 A;  2VS1 A;  5FJ8 G;  2RCN A;  1SYD A;  2EQS A;  2X6G A;  5I6W A;  3DWQ A;  2B3G A;  5EKI A;  1E1O A;  5JJZ A;  3CD6 A;  4C3J G;  4DK1 A;  4DFA A;  1CA5 A;  5LMN Q;  4XYQ A;  2DY8 A;  5K36 G;  1KRT A;  4A3F B;  3VR2 A;  3I4L A;  2D0P A;  4RMF A;  1EY6 A;  4GS3 A;  2O5I C;  1RL2 A;  4EQ5 A;  5LL6 X;  4A3I H;  4F8M A;  3SVM A;  3GDE A;  3GV6 A;  5C0X I;  3KDF A;  2UU9 L;  1GJX A;  5FO9 B;  4JYA Q;  4LF9 L;  4TSS A;  1JOK A;  2Z0S A;  3L9A X;  5DAU A;  2PI2 E;  4DR5 L;  4BY7 G;  1F9Q A;  3HOY G;  1ZKO A;  4V19 0;  2OTJ A;  3I7F A;  3MC0 B;  2IHE A;  1X3P A;  2NTS A;  2ICI A;  4AYB B;  2EY1 A;  3OIQ A;  1FNU A;  4DV3 L;  1PYW D;  5M9O A;  1Q8K A;  1EWC A;  1S5F D;  2K28 A;  3A8I E;  1EYD A;  3E0J A;  4U68 A;  4IUR A;  3ERO A;  4C3H H;  4A3K B;  4P71 A;  3I56 A;  2NZH A;  5T1I A;  3M4Y A;  2CKZ B;  1V1Q A;  2R7D A;  1GD7 A;  3S1M B;  1STG A;  2LKV A;  1ENF A;  3AFP A;  3OTO L;  5IYD H;  5E7N A;  3OW2 A;  3U58 A;  2WAQ E;  2AUK A;  3K7A B;  1PVO A;  2A5H A;  4RFB A;  5LHY 1;  2QEX A;  1R4Q B;  1JQY D;  1MJE A;  4GKK L;  5IT9 E;  3PIO 3;  4DV5 Q;  4HR7 B;  3J80 i;  4H7B A;  4M1U B;  1C7Y A;  1YNJ C;  2BE5 D;  4BBS B;  1ET9 A;  1II3 A;  1HR0 L;  4EQN A;  4DR4 Q;  2F3W A;  1FR3 A;  3HOV G;  1UE7 A;  1X32 A;  4JBJ A;  3QOL A;  1DOM A;  3RNU A;  3K5O A;  2SNM A;  3F8T A;  3ULL A;  4QIW B;  4KI0 A;  2NVX H;  5K5P A;  3Q8D A; 
#chains in the Genus database with same CATH homology
 1CM9 A;  5EPL A;  1ILP A;  1H9S B;  2PW5 A;  4IFD G;  3FMC A;  3J80 E;  1KLU D;  3SXH A;  2F0N A;  1CHQ D;  1F77 A;  4IUT A;  3K0Y A;  4CKE A;  1TWF B;  3NHH A;  3TN2 A;  2XIW A;  2A68 D;  4K8J A;  1VF5 C;  3SEB A;  1NAP A;  1VDZ A;  2JP1 A;  1SDF A;  5I4D A;  1FGB D;  2F03 A;  5EJW A;  2NVQ B;  1GUT A;  3WOF A;  5M5Y B;  1OXU A;  3H09 A;  1EIH A;  3J80 L;  2PMZ B;  3BYT B;  2EYO A;  2B39 A;  5I2Y A;  1RDP D;  3JAM E;  1AZP A;  4PQX A;  3TME A;  3G6J B;  2L5T A;  1ONL A;  5CBE E;  5BN3 A;  3J7A F;  1LAB A;  1NR4 A;  2BA1 A;  2KQ3 A;  1HRJ A;  1D5Z C;  4KTA A;  4X3U A;  1D1I A;  5M5W B;  5HGT A;  2CW0 C;  1GUO A;  1SE3 A;  5KNC A;  5NUC A;  4N9T A;  4FF2 A;  3GTL B;  1WD0 A;  4CKC A;  1F2Y A;  1U4P A;  2M2L A;  1U4M A;  3DEO A;  1CK1 A;  2A69 C;  4YIJ A;  3AB9 A;  4HMI A;  2PZW A;  2KCN A;  1SYF A;  3J7Y W;  2GA4 B;  3AU7 A;  3MFY A;  3K6O A;  5BN5 A;  2R61 A;  4NMZ A;  4RH6 A;  3I70 A;  1LTA D;  1G2T A;  1I4P A;  1AFP A;  5CR3 A;  1DOL A;  2PO4 A;  4O42 A;  5CV8 A;  1EU3 A;  5C6A A;  4ZK9 B;  4GZY C;  4A3D B;  4P2C B;  1WD1 A;  3NK9 A;  1FD7 D;  3M7N A;  1DD2 A;  2CQA A;  3PUY A;  3CU7 A;  1I3Q B;  5A35 A;  1GUG A;  3GTP B;  2K01 A;  2HUG A;  1S5C D;  1SNC A;  3SHL A;  2HCI A;  3FKI B;  2R92 B;  1IKL A;  2IT1 A;  3GTM B;  1A15 A;  1LLR D;  3I4N B;  2R93 B;  1F2M A;  5C0X G;  5EBC A;  2NB0 A;  2R3Z A;  3IAY A;  1PFB A;  1VCI A;  2B8G A;  4DN4 M;  3W3A A;  2E2D C;  1O7L A;  1EU4 A;  4G7Z C;  3I3C A;  2FIN B;  3QWN A;  3W2D A;  5C0X H;  1BQQ T;  1RD9 D;  3T13 A;  1B1Z A;  2L0C A;  1ILQ A;  4XDX A;  3C1E A;  4XQN A;  5DM6 3;  4PMC A;  4A3I B;  1QG7 A;  3KLS X;  4BA1 I;  3S2D B;  2B2Y C;  3Q24 A;  1KNA A;  1B2T A;  4FO2 A;  5AFW A;  3NSW A;  5FK9 C;  4RGT A;  2EY2 A;  3AMU A;  2RQX A;  1EYC A;  3TBI B;  2DN8 A;  2JA8 B;  1ESR A;  4ABN A;  1I50 B;  3ERQ A;  3P75 A;  4K8I A;  1SBB B;  3NWT A;  2RVL A;  2JEB I;  1HA5 A;  4H44 C;  1Q90 A;  1AZQ A;  1SFO B;  5EGT A;  3C46 A;  3HGB A;  3L3O C;  1KLG D;  1SNM A;  1XTC D;  3MEH A;  2PZT A;  2BE5 C;  2NN6 I;  2D2C C;  1V1O A;  3MTS A;  3S17 B;  2K5Q A;  3FVQ A;  3GD7 A;  3R93 A;  2O5J C;  5ELC A;  2OT2 A;  3TP8 A;  2ENB A;  3SR1 A;  3CHB D;  4ME5 A;  3QB3 A;  1QE6 A;  4CJ2 C;  4FF3 A;  1SMY D;  5JEA G;  4RHS A;  2A74 C;  4DK0 A;  3BDL A;  1GOZ A;  3L7Z C;  4I7Z C;  4QMG A;  4A3E B;  1SE2 A;  2YYZ A;  2M9V A;  4HED A;  4J1M A;  2XNA C;  1BCP D;  3EVQ A;  3K59 A;  2B2V C;  3LWU A;  1W6K A;  4C2M B;  4K5X A;  4KN7 C;  5IOC A;  1H9M A;  5LL6 S;  4XIG S;  1I4Q A;  1CQF A;  2Q8I B;  4DU9 A;  1LO5 D;  3IKJ A;  3M4O B;  3VYS A;  1WTV A;  1O80 A;  1Q8I A;  5C4J B;  1I6V C;  4OIJ A;  4B9W A;  1A2T A;  4RWS C;  1BCP F;  4M8A A;  5FOB B;  1EY9 A;  1HHV A;  4UDU C;  4TKO B;  2EJG C;  5C4Z A;  4KN4 C;  1BCP C;  3HOW B;  2F0D A;  4IAL A;  1HUM A;  1IKM A;  3FPU B;  2G9D A;  3E6Z X;  3P1H A;  3M3Y B;  4OL7 A;  2I46 A;  3NWS A;  4K14 A;  3GO5 A;  4FXG C;  1I6H B;  2H4O A;  1V43 A;  1EY5 A;  4FXK C;  3BVM A;  3BVG A;  2O4X A;  2F1M A;  2D9U A;  1LT4 D;  2EDG A;  1WVL A;  1ENC A;  5I9O A;  1CA6 A;  1SSO A;  5CV9 A;  4V0B A;  4IFD J;  3Q23 A;  4KKS A;  4IUU A;  4ILW A;  4JBW A;  3J81 E;  4LJZ C;  5JPM C;  3VR4 A;  4F7X A;  3FEW X;  4LMQ D;  1EL0 A;  2M00 A;  3NQT A;  5CC4 A;  1BF4 A;  2DNE A;  2L55 A;  3H94 A;  1JWU D;  2K1B A;  5DNF A;  2IW3 A;  4XT1 B;  3OIP A;  1D6E C;  3S9W A;  2K7V A;  3MHB A;  3D6C A;  2FJ2 A;  1DXM A;  2F0Q A;  3BG3 A;  4R8N A;  4OO1 G;  1U4L A;  5FLX E;  4KJN A;  3VYU A;  3TP6 A;  2I07 B;  3ND8 A;  3J7A V;  1HTP A;  1PZK D;  5E3F A;  2RDF A;  2SNS A;  2R7Z B;  2NVX B;  2E76 C;  1NUC A;  3V96 A;  1C8C A;  4ZLT F;  1Q3L A;  1JB3 A;  1S5E D;  1T5E A;  1BDO A;  1SYB A;  2IX1 A;  2R6G A;  1S5D D;  2OXP A;  2F0E A;  3D4W A;  4PMW A;  1V1P B;  4OGQ C;  4XYO A;  4HCS A;  2PZU A;  2V4D A;  4DF7 A;  4BS9 A;  1JCK B;  1NSN S;  4C1N K;  1HQR D;  5JPN C;  1ZXT A;  1OO9 B;  2YU9 B;  1RF2 D;  3WOE A;  2XRS D;  3FRP B;  5D3I B;  2ZXR A;  3EFX D;  3Q22 A;  1PLF A;  2NYZ D;  1KTK A;  1E0B A;  1I4R A;  1EY0 A;  3A55 A;  1BCP B;  2HDL A;  1TS3 A;  4K6L A;  1XX8 A;  2E2J B;  3OMG A;  5FO8 B;  1RHP A;  4KKU A;  3FPP A;  1EY4 A;  1G8Z D;  5K36 H;  1GUW A;  2KEE A;  1JOO A;  3ITP A;  2L12 A;  4WJW A;  1B9M A;  2PNR C;  3GTJ B;  5C3W A;  3OWE B;  4L63 B;  3GP7 A;  3DMU A;  1H9R A;  2XRQ D;  4A3M B;  1MSH A;  1LTB D;  1WTO A;  5IGF A;  2IL8 A;  1EQT A;  2E74 C;  4CGY B;  5IIF A;  3S15 B;  1TS4 A;  2FFK B;  4XQQ A;  3SK5 A;  3ND9 A;  1FNW A;  4C3I B;  1OXT A;  2B2T C;  2JA6 B;  4MIU A;  1Y8P B;  1IYU A;  2PPB C;  1SJH D;  1S4Z A;  2PW7 A;  3K5L A;  4LAA A;  2EYJ A;  2LS0 1;  1DON A;  2PCF B;  1CQV A;  1LT3 D;  3HOU B;  3V2T A;  3DHQ A;  3NTI A;  2KEC A;  1F9P A;  1EFI D;  3P7J A;  5E4W C;  1R4P B;  2EJM A;  2AWO A;  3K57 A;  2LFN A;  1F2Z A;  3QJY A;  5F2D A;  1WTX A;  4WOR A;  5CV7 A;  3GTG B;  2LMC B;  3K58 A;  3DXJ C;  4RHR A;  2NVY B;  3V05 A;  5M3M B;  2MJ8 A;  3O13 A;  1B3A A;  1MD2 D;  3VR6 A;  1SYE A;  1YNN C;  1Y1V B;  2SEB D;  1GHK A;  3EJI A;  3X3N A;  1PZJ D;  2F0V A;  2F0I A;  4G7O C;  1HXY D;  4FP5 D;  1E2W A;  2CW0 D;  4HSV A;  1V1P A;  1G6Z A;  4OO1 H;  2HDM A;  4ZKC B;  4U67 3;  3R8B A;  4OHJ A;  3S1Q B;  2TMP A;  1PDQ A;  2N55 A;  2G9H D;  1WTW A;  5IGB A;  2BDN A;  2FHT A;  1O7Z A;  2NN6 G;  2EYL A;  3OW7 A;  1STH A;  1A2U A;  3NPP A;  2WP8 J;  3HZX A;  1MI2 A;  2RKS A;  4C3H B;  1Z6H A;  3D6W A;  1TWC B;  5KND A;  2QKI C;  2Z4H A;  2EJF C;  2JXM B;  3U9S A;  3KLR A;  2EPB A;  4TQU S;  1EZ6 A;  3SK8 A;  1A3T A;  3C2P A;  3KUP A;  2EY5 A;  2L9H A;  1EIG A;  3CQZ B;  2EYP A;  3N52 A;  2JA7 B;  3NP8 A;  5E4X A;  4IUQ A;  1CZG A;  1TWG B;  4PV1 C;  2F0H A;  3BS1 A;  3S1N B;  4ZUI A;  2NVT B;  1ZYR D;  1B9N A;  1JOQ A;  3OSO A;  4BY7 B;  2B2V A;  4L8J A;  4NDX A;  3VR5 A;  3T53 B;  5JAV A;  1I4H A;  2EYH A;  3NE5 B;  3R2T A;  2D5D A;  2OEO A;  1H9S A;  3VYT A;  2JEA I;  4C3I G;  3HKZ B;  1EEF D;  3MXP A;  1LV9 A;  1GXD C;  1SND A;  3GTQ B;  2K6A A;  2VNU D;  4DAY A;  5KYL A;  1J9O A;  1SEB D;  2A6H C;  1TQO A;  3K5M A;  1M8A A;  1DZ1 A;  4QCL A;  1Y1W B;  3OHX C;  2F0S A;  5ELE A;  1AW7 A;  3A8J E;  2D62 A;  4G4K A;  5T1G A;  2XWJ B;  1H9J A;  4ZRZ A;  1Q1B A;  3ONA B;  1BBX C;  3BZD B;  1KDC A;  1DM0 B;  2K03 A;  4KY6 A;  4KY5 A;  2F0O A;  3U9O A;  4DGZ A;  1QCB D;  3KK7 A;  4C3H G;  1D5M C;  2Q8T A;  2X69 A;  1U4R A;  3LWE A;  1BUV T;  3A56 A;  2VXW A;  1QNU A;  1B53 A;  2CHB D;  4CKB A;  1V8Q A;  3R2I A;  4EQP A;  1HA6 A;  3BYY B;  4RAU C;  3PUV A;  2F0T A;  4HMJ A;  5M5X B;  1G91 A;  4IFD I;  1IW7 C;  2E2H B;  5CYU A;  1RTO A;  2B2U C;  2C9O A;  2AUJ D;  1HFN A;  5TSS A;  4TRD A;  3I72 A;  4UAI A;  2B2U A;  2Z8L A;  1HQM C;  3TP7 A;  3DUZ A;  1HTL D;  2N88 A;  3I91 A;  1LTI D;  2RDG A;  1HCZ A;  2NN6 H;  2KUM A;  1C48 A;  3PV0 A;  2AQ2 B;  2WIN B;  2IX3 A;  2RSN A;  2J4X A;  2WV6 D;  1DYQ A;  4RKL A;  4K2L A;  4N9P A;  2AWN A;  2VB3 X;  3G7L A;  4CBV A;  2K05 A;  1BOS A;  4O1N A;  1RJT A;  3RZD B;  3NTH A;  1EWH A;  4FNF A;  1ZYR C;  3OOC A;  2F0W A;  3S1R B;  3URY A;  1B44 D;  3H6M A;  4G7H C;  4Q5V A;  5COR A;  1IYV A;  5C0X J;  3H3V C;  2F3V A;  1AP0 A;  4X3S A;  1XXG A;  2BOS A;  1OXX K;  3NBI A;  2F4I A;  5CGK A;  1IL8 A;  1EEI D;  5EQ0 A;  2KED A;  4NW2 A;  3ZYY X;  4EQO A;  3GTO B;  1K8M A;  1EY7 A;  1HPC A;  1DCZ A;  5COY A;  5EKK A;  1UNS A;  4NKL A;  2XVS A;  2WAQ B;  2IWH A;  5C4H A;  4H0L C;  1Y8N B;  1R9T B;  1RTN A;  5EBD A;  3TZD A;  4ZUJ A;  3PUW A;  1ET6 A;  1XWE A;  5KEE A;  1EOT A;  5FLX L;  2QEJ C;  5JVG 3;  3EA6 A;  4X3T A;  3M7G A;  3H91 A;  1MSG A;  2Z1C A;  5D14 A;  3PUX A;  1AN8 A;  2X6L A;  4DA2 A;  5C5M A;  4IFD H;  4A93 B;  3A8K E;  1ENA A;  3VA7 A;  4KK7 A;  1UAP A;  2F0K A;  2JYO A;  3HS0 C;  4K2K A;  1Z47 A;  2NUC A;  3I90 A;  1B4O A;  5CV4 A;  3QOJ A;  4KY7 A;  3IL8 A;  4FXD A;  1TS5 A;  2A68 C;  5EKL A;  1L0Y B;  3WDN A;  5IGE A;  1BR9 A;  2B8F A;  1STA A;  3P20 A;  4FYD A;  2MP1 A;  3S2H B;  4KV6 A;  4PNY A;  2VUM B;  5HUR A;  4CHT B;  2MHV A;  1TR5 A;  3MFG A;  1EY8 A;  2WB1 B;  3TSS A;  3R3O A;  1OXS C;  1T5X D;  1O78 A;  1STB A;  2EYF A;  1JR0 D;  2B2W A;  4J8Q A;  1WTQ A;  3KLS A;  5IGC A;  1LTR D;  2DNC A;  5ELB A;  4OO1 I;  4B9X A;  2H1E A;  5J1Z A;  5CV6 A;  3DWP A;  1JE4 A;  1B50 A;  1BXT A;  1QWY A;  2EOT A;  2EYM A;  5JEA H;  4QB4 A;  4BA2 I;  1EYA A;  1O7Y A;  1JOR A;  4KHV A;  3MXU A;  4XT3 B;  3S14 B;  1PTO H;  3PUZ A;  4X3K A;  2JA5 B;  1TS2 A;  2A6E C;  3EQL C;  2EY6 A;  1A6X A;  1YNJ D;  2K5D A;  1HUN A;  3BDC A;  3QIA A;  2E2I B;  3TZU A;  5CBA E;  1Q12 A;  2WII B;  4HSP A;  1WCM B;  1IHZ A;  2A73 B;  2ZT9 C;  2AQ1 B;  1H9K A;  2J7Z A;  5J22 A;  4RCO A;  1PRT C;  2RDH A;  4Z9C B;  2AQ3 B;  2HQE A;  1Z7T A;  5FKA C;  5C3X A;  4QUF A;  4XTC S;  3NBH A;  1DOK A;  1TKW B;  3KBG A;  1SNO A;  4HAE A;  4G57 A;  2RBM A;  1QNK A;  1SNP A;  4RGM A;  5ISR A;  2J0T D;  2VB2 X;  1G29 1;  2QDB A;  4KJO A;  1BNZ A;  3C3L A;  3NXW A;  4EGV A;  3CKI B;  4F87 A;  3OWF A;  4KD4 A;  3I8Z A;  4KMU C;  1SMY C;  3A7L A;  2JE6 I;  3LNN A;  1PZI D;  3T4A C;  3PO3 B;  1QJO A;  3OMC A;  2XWB B;  2F0J A;  3HOV B;  5C5L A;  5CMD A;  1K8O A;  1EZ8 A;  3T16 A;  3RUZ A;  1KDB A;  3MAQ A;  1FNV A;  1RKN A;  3Q6S A;  5JOB A;  1QB5 D;  1LTT D;  3S16 B;  5I6Y A;  3IFT A;  4BWG B;  5IT9 L;  3X3M A;  1GUS A;  3NQI A;  5D3D A;  2EE1 A;  1X3Q A;  4H13 C;  4KHZ A;  5M3F B;  3DWA A;  5ELF A;  2L11 A;  5FO7 B;  1PTO C;  3NUC A;  2Y0S B;  3PMF A;  2F0G A;  1ROD A;  2F0U A;  1PFM A;  1Y69 U;  2RA4 A;  3MZ5 A;  4ZKB B;  4C1N I;  2KJX A;  1ML0 D;  3HOY B;  2IPK D;  2BA0 A;  3F2U A;  1F9S A;  3D4D A;  4HCE A;  3DM1 A;  1D5X C;  3RMH A;  2ICE C;  3BVZ A;  4K6D A;  2F0L A;  2L4N A;  3D4R A;  2IX0 A;  4IZ8 A;  2XN9 C;  2WKD A;  3Q0A A;  4HTH A;  4C3J B;  1TY2 A;  3CRK C;  1YNN D;  3MVV A;  2MPM A;  4NP5 A;  4FF4 A;  4WFN 3;  1KAA A;  1A3U A;  4RKB A;  3NTK A;  1KDA A;  1VMC A;  4E6I A;  4QUC A;  1RCV D;  4BY1 B;  2L1B A;  3A7A B;  1SXT A;  3GV3 A;  3MWY W;  5KYI A;  4IUP A;  2CVR A;  1CTM A;  4CJ0 B;  3MA2 B;  3H0G B;  1TII D;  1D2B A;  3D8G A;  3D3R A;  4IUV A;  2KVM A;  1G2S A;  1PMR A;  1I4X A;  4FF1 A;  1DJR D;  2QCP X;  5E1F A;  1SYG A;  1TT2 A;  1Y8O B;  2KA7 A;  5KGU A;  4R9W A;  2ZXO A;  3MXG A;  4KD3 A;  4A3B B;  5KIX A;  4RGO S;  1EQV A;  2B63 B;  2O2L D;  4QF4 A;  5I2X A;  1GUN A;  1L0X B;  1MGS A;  5A2Q L;  2Z4I A;  4K5V A;  1STN A;  2QF7 A;  4JK1 C;  1KNE A;  2MUY A;  4DNR B;  4Y7N B;  5EPJ A;  1JWM D;  1U9R A;  3C1F A;  3TP5 A;  1M4V A;  4RA8 A;  4OIK A;  3FDT A;  2WKC A;  4F88 A;  1PRT D;  2PQE A;  1SE4 A;  3I73 A;  3HOX B;  1FYC A;  2MGS A;  4ID6 A;  2F0M A;  2IJ0 A;  1PTO D;  4MN3 A;  2ID0 A;  4L6T B;  1PXU A;  2SDF A;  5G3L F;  2KCC A;  4B08 A;  1SAP A;  2XSC A;  3LX0 A;  5ELD A;  4BBR B;  5DM7 3;  2EXZ A;  3HRZ C;  1SYC A;  4J6H A;  1JC7 A;  3QG1 A;  2A69 D;  5JVH 3;  1CI3 M;  5G3L D;  5J39 A;  4RGN A;  5EPK A;  1PTO F;  4ZYS A;  3QO2 A;  2JSO A;  1F9R A;  5I9P A;  4C56 C;  1PRT B;  1PRT F;  1UEA B;  2HCC A;  1CFM A;  5A2Q E;  1IW7 D;  3M85 A;  4IUN A;  1PTO B;  2B2Y A;  2NBF A;  4WRD A;  3TDQ A;  1C4Q A;  1LTG D;  2NWG A;  3HP3 A;  3A54 A;  1SJE D;  3RD4 A;  4FVM A;  2RSO A;  1AEX A;  4IQZ A;  5IGD A;  1TU2 B;  1UUP A;  2K33 A;  2B2W C;  2Q8R E;  1NCV A;  3VA5 A;  1ICW A;  2E75 C;  2PYK A;  3MXN A;  2WAC A;  3HEJ A;  4DNT B;  2EZV A;  1HFG A;  5C44 B;  4Q0F A;  3VR3 A;  1K83 B;  1Q1E A;  5D65 A;  3K5N A;  2F0P A;  1ZEQ X;  4ODG A;  1WTR A;  2LY7 A;  2KOL A;  1TY0 A;  5BN4 A;  4XQJ A;  4KKT A;  1MBY A;  3HG9 A;  2K32 A;  3SK6 A;  3PIP 3;  1OXV A;  1STE A;  3JAM L;  4ZQ3 A;  1JIC A;  2A6H D;  4EVO A;  4DAP A;  2A6E D;  1E2V A;  2BCO A;  1D1K A;  3PO2 B;  1GHJ A;  5C3E B;  5IGG A;  5CV5 A;  1S5B D;  3CRL C;  2F0F A;  1SNQ A;  4RCN A;  2FMM A;  5KRU A;  3HOZ B;  3UI2 A;  4DXF A;  3RZO B;  2QIL A;  3GTK B;  3KBX A;  3IFD A;  1I4G A;  2B2T A;  1ESF A;  4R8I A;  3GQB A;  3SE0 A;  2SOB A;  5KNB A;  4ZAI A;  4ULL A;  1CHP D;  4I65 A;  3N6R A;  1J8I A;  1A3V A;  1CZW A;  1BO0 A;  4S3S A;  1CT1 D;  4CJ1 B;  1TWH B;  2K04 A;  2EVB A;  1NR2 A;  1WTP A;  3SK4 A;  3D31 A;  5DEH A;  3I4M B;  3J81 L;  4A3J B;  1QIL A;  2DY7 A;  4DAV A;  1KAB A;  3T56 B;  2C5C A;  4XXE A;  1LTS D;  2TSS A;  2ZXP A;  1QOH A;  2OF1 A;  3RLF A;  4MHE A;  4LK1 C;  1LAC A;  1W6J A;  2NZ1 D;  1VMP A;  3SDZ A;  2NTT A;  1TWA B;  4K5W A;  3E5S A;  5IOD A;  1VF7 A;  5C4X B;  4PMB A;  1STY A;  3KF8 A;  1LT6 D;  1TVX A;  2KHS A;  3OPO A;  4HN7 A;  1E2Z A;  3T51 B;  3BDO A;  1JWS D;  4IN3 A;  1PFN A;  2BDO A;  4A3G B;  1F2L A;  4DXG A;  3DEP A;  1LT5 D;  3VYR A;  1XYI A;  5JEA J;  2K5W A;  2FMC A;  1SYD A;  2X6G A;  5I6W A;  3DWQ A;  5EKI A;  5JJZ A;  4C3J G;  4DK1 A;  4DFA A;  1CA5 A;  4XYQ A;  2DY8 A;  5K36 G;  4A3F B;  3VR2 A;  3I4L A;  1EY6 A;  2O5I C;  5LL6 X;  4F8M A;  3SVM A;  3GV6 A;  5C0X I;  1GJX A;  5FO9 B;  4TSS A;  1JOK A;  3L9A X;  5DAU A;  1F9Q A;  1ZKO A;  4V19 0;  3MC0 B;  1X3P A;  2NTS A;  4AYB B;  2ICI A;  2EY1 A;  3OIQ A;  1FNU A;  1PYW D;  5M9O A;  1EWC A;  1S5F D;  2K28 A;  3A8I E;  1EYD A;  3E0J A;  4U68 A;  4IUR A;  3ERO A;  4A3K B;  5T1I A;  3M4Y A;  3S1M B;  1STG A;  2LKV A;  1ENF A;  2AUK A;  3K7A B;  2A5H A;  4RFB A;  5LHY 1;  1R4Q B;  1JQY D;  5IT9 E;  3PIO 3;  4HR7 B;  4H7B A;  4M1U B;  1YNJ C;  2BE5 D;  4BBS B;  1ET9 A;  1II3 A;  4EQN A;  2F3W A;  1FR3 A;  1X32 A;  3QOL A;  1DOM A;  3K5O A;  2SNM A;  4QIW B;  4KI0 A;  5K5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...