2F3WA

Solution structure of 1-110 fragment of staphylococcal nuclease in 2m tmao
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
110
structure length
110
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Folding stability and cooperativity of the three forms of 1-110 residues fragment of staphylococcal nuclease
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 11
structure length 110
sequence length 110
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f3wA00
1TR5A 1EY9A 5CV7A 3NXWA 3V2TA 4WORA 3T16A 4F7XA 5I6WA 5ISRA 4K5VA 3D4DA 4KJNA 5E1FA 2RDFA 3NP8A 2F0GA 1SYCA 2F0EA 4EQPA 3C1EA 4DFAA 4N9TA 4PNYA 2OEOA 5I9PA 4NP5A 2O4XA 2EY6A 5J39A 4K5WA 2F0UA 1STNA 4HMIA 5DEHA 5IIFA 5CC4A 3TMEA 3SHLA 1RKNA 3BDLA 1EQVA 2EY5A 2EYPA 4KD4A 3D8GA 4K2KA 4KY6A 5E3FA 5I6YA 1JORA 2EYHA 3SK8A 1A3UA 1EYAA 2F0MA 1SYBA 3TP8A 2SNSA 2EYFA 1A2UA 1KDCA 4ZQ3A 3TP7A 5IGBA 1ENCA 2PYKA 1A3TA 3MXPA 3ITPA 3OSOA 1STHA 2F0NA 2EXZA 4OL7A 3NUCA 4DF7A 5IOCA 3MHBA 3S9WA 1SYEA 4NKLA 4YIJA 4QF4A 2F0IA 1EZ8A 3ERQA 4I65A 5C3WA 1EYCA 1SNMA 1STYA 1F2ZA 4J6HA 2M00A 5IGGA 5M9OA 2EYLA 2F0LA 3QOJA 3D4WA 5C5MA 3SK6A 1EY6A 1KDAA 1JOOA 4PMCA 2F0JA 4S3SA 4K8IA 1JOKA 4HMJA 5CV6A 3C1FA 3D6CA 3U9OA 2EY2A 3HZXA 1EZ6A 3NHHA 2OF1A 4K2LA 2F0SA 4K14A 2PZUA 4TRDA 5EKLA 4KV6A 3MEHA 4PMBA 4DGZA 3BDCA 1A2TA 2F0DA 2F0WA 1SNOA 1SNPA 1STAA 1KDBA 2ENBA 2SOBA 3EVQA 4ME5A 2PW7A 4KHVA 2SNMA 4ID6A 4N9PA 1EY7A 4RKLA 5IODA 4E6IA 5KRUA 4IUNA 5IGCA 3OMGA 4K5XA 1NSNS 1NUCA 5CV9A 1STGA 2HQEA 3SXHA 3H6MA 5EGTA 4F8MA 3QB3A 5JOBA 2F3WA 1U9RA 2QDBA 5J1ZA 2LKVA 3T13A 3EJIA 5IGEA 4MIUA 3SK4A 4HTHA 1SYDA 1TT2A 3QOLA 2EYOA 4KTAA 4EQNA 2F0FA 5KEEA 4G57A 4K8JA 3TP5A 5J22A 2NUCA 4R8NA 4WRDA 5IGFA 2F0QA 2WACA 5HGTA 3MVVA 4ZUJA 1EYDA 2F0OA 5C6AA 3MZ5A 5CV5A 3VA5A 1IHZA 2PZTA 5KGUA 2EYMA 1SNDA 1KAAA 4NMZA 1EY8A 3RUZA 5CR3A 4DU9A 1AEXA 5JAVA 5CV4A 4NDXA 4RKBA 3TP6A 1II3A 3OWFA 1KABA 2KHSA 3P75A 5C5LA 3DMUA 3DHQA 3HEJA 1F2YA 4B9XA 4QMGA 5NUCA 1STBA 4EQOA 2F0TA 5KYLA 3SR1A 2F3VA 2OXPA 3PMFA 5IGDA 1EY0A 1SYFA 1EY4A 2F0VA 5DAUA 5C3XA 2F0KA 5C4HA 5CV8A 5HURA 1ENAA 1F2MA 5KYIA 3OMCA 4H7BA 2KQ3A 1SNCA 3E5SA 4LAAA 2RBMA 5EKKA 3LX0A 5CGKA 1A3VA 5K5PA 5KIXA 1EY5A 3R3OA 4IZ8A 2PZWA 4K6DA 4QB4A 3NK9A 4KJOA 4B9WA 4EVOA 4J1MA 1JOQA 2PW5A 4KY5A 3NQTA 3SK5A 2EY1A 5F2DA 1SNQA 2RKSA 1TQOA 2EYJA 5I9OA 3EROA 4KY7A 4ZUIA 1SYGA 5C4ZA 2PQEA 4ODGA 2F0PA 3P1HA 2F0HA 4KD3A 4IALA
chains in the Genus database with same CATH superfamily
4RMFA 5CBAE 1HNZQ 3KBGA 1A6XA 4DR2Q 5JJZA 5IIFA 1I94L 3KBXA 3TMEA 3F2UA 3KFUA 1NR4A 2ICIA 2Z1CA 4K2KA 2C5CA 1EFID 1V1PA 1JORA 1A3UA 3GQBA 2F0MA 2EYFA 4O2DA 2E2JH 1TKWB 4WJ3M 5IP7H 4KK7A 3ITPA 3BYTB 4IPHA 3I4NH 1SYEA 1YZ6A 3CD6A 2BDOA 2IT1A 1IW7D 2B2VC 3LWEA 3NSWA 2EE1A 2R93B 1K83B 2WB1B 4WJWA 3JAMc 3R2TA 4AIMA 3GV6A 1BBXC 5CV6A 1JWSD 3LWUA 2PMZE 4BBRB 4K14A 2PZUA 2JA6G 2E2DC 1IBLL 3ND9A 4DV4L 5C4XH 1KDBA 1LTAD 3K5OA 1A62A 1WJJA 3IFDA 2E2IH 1SXTA 5TSSA 5JJLA 2RHSB 5CV9A 1HH2P 5JOBA 1I6HB 4FF2A 3F2DA 1HA6A 3ND8A 3OYYA 4P74A 4UP9A 4CKBA 1B1ZA 4G7HC 4MIUA 4GKJL 2IL8A 2L9HA 4FDBA 3CCUA 3PIPA 2QEJC 2AUKA 5KEEA 4R8NA 1Q1EA 1ILQA 3MVVA 1KXLA 4DUYL 3F1ZA 4LF4L 1QCBD 4ZLTF 4FXDA 1G6PA 4A3LG 1EYGA 3OWFA 3DHQA 3BU2A 4QMGA 3MXNA 1AZPA 5KYLA 1N33L 5DAUA 2B39A 1ASYA 3L0OA 2B8FA 5I2YA 1YITA 4BBSH 2KQ3A 4OHJA 2VZAA 4X64Q 1IKLA 2FJ2A 5CGKA 1F77A 4RAUC 1S3OA 4HJAA 2D2CC 2JSOA 5ELEA 4BS9A 2UUAL 2WINB 4R8IA 2CCZA 5I9OA 2RSOA 4KY7A 4GZYC 4ZUIA 3I70A 3RMHA 1EIFA 2RCFA 3T1HQ 3KOJA 4UP8A 3W3AA 3OWEB 3NXWA 4DV6L 3QG1A 5E1FA 2FFKB 1SYCA 2YTXA 4EQPA 4CBVA 4CGYB 2B2TA 1TWGH 3RLOA 2NN6G 2F0UA 2P5ZX 3ONAB 1SEBD 1NTGA 1RKNA 4ZYSA 1WYDA 1EQVA 2EY5A 4HCSA 4Q5VA 1X3PA 4KN4C 2K14A 2NVYB 3PO2G 1EOTA 3T56B 1I94Q 5JEAH 4PZ8A 1JR0D 4YWKA 1I4GA 4YHHL 1A8VA 2PYKA 3OSOA 2F0NA 1BBUA 1T9HA 2EXZA 1TU2B 2F1MA 4OGQC 4DF7A 1WD0A 1D8LA 1L1OA 4QF4A 2Z4HA 2D5DA 3U9SA 2PNRC 3MC0B 1EYCA 5C3WA 2Q2IA 4J6HA 3D4WA 2Y0SG 1TWAB 2XGTA 2WKDA 1VQMA 1ZXTA 4CJ2C 1G2TA 1C7YA 3S2DH 1CUKA 2B63H 2JA8H 1I3QH 1ZKOA 3K58A 1I4PA 2L0CA 3OOCA 1GUGA 4IOAA 3S1QH 3LGJA 4PZ7A 1NSNS 2R92B 1IBLQ 1KLUD 1U9RA 2AQ3B 2QDBA 4DAVA 1P16A 5IGEA 2EYOA 4BY7H 1PYWD 1KQSA 2LXKA 4ALPA 3I73A 4GKJQ 4X66Q 3C2PA 1W6JA 4A3EG 3EA6A 4TVAB 2KHSA 4DUYQ 4LF4Q 2ICEC 1VQOA 3HOYG 4QY7A 1Q81C 2OTLA 2JEAI 3HOVH 3SGIA 2UU9Q 1GHKA 2CQAA 2KECA 3LX0A 4B3TQ 4Y7NH 1N33Q 5EPLA 4IZ8A 2DNEA 1EQTA 1CKNB 2PW5A 4X3SA 5F2DA 1SNQA 1VQAA 2DY8A 2K32A 1PRTC 1MD2D 2Z0SA 3HOWB 4A3BH 5LHY1 2K03A 3GTQB 5IE8A 1WCMG 1NY4A 2VNUD 3CCJA 3GO5A 1GUOA 3X3NA 5ISRA 3EBEA 4IPGA 4UAIA 3HKZB 3K59A 1PV4A 1SE3A 2PCFB 5DEHA 4DV6Q 1SROA 4LUZA 3SHLA 1UWVA 4M1UB 2SNSA 2JA6B 2JYOA 5IYDH 4JBMA 1XPOA 4K6LA 2M2LA 2F52A 1QUQA 4JI2Q 4N8FA 2MNAA 4R4OA 2VW9A 3S1NB 3R93A 1L1OC 3HGBA 1DOKA 2A6EC 2XIWA 2UXDQ 3HKSA 2WAQE 3NPPA 3SK6A 1FNUA 2GVBA 3RLNA 1FYCA 2K50A 3DM3A 4EQ5A 2R7ZB 1IBKQ 3CC2A 4DV5L 3FKIB 2ZTDA 3H0GH 4IPCA 3FEWX 3H09A 3I55A 1MGSA 5K5PA 1SNPA 1B4OA 1L2FA 2K75A 2PW7A 4JBWA 4DR3L 4A3GH 1FD7D 1LTID 1HZ9A 4DK1A 2K5QA 3G6JB 4V0BA 1VMCA 1A0IA 5FJ8G 3BG3A 1OO9B 4RGTA 2VB3X 3G48A 4JCVE 1V8QA 2CHBD 5J22A 1LLRD 3S17H 1Q8IA 5E7NA 3J80i 2KUMA 1Q3LA 1JICA 1QB5D 4GLXA 1IW7C 4APVA 2RCNA 3RUZA 3TS2A 1Q90A 1XNQL 1EQRA 4A3IG 2R3ZA 3GTOH 4JPBW 1PRTF 5BN4A 4LF9Q 2VQFL 2F3IA 3M3YB 5K36H 3KLSA 1B53A 3WOFA 1SNCA 2O5JC 3NTIA 2PZWA 3NK9A 4A3JH 1H9MA 2Q8TA 4A93H 1N32Q 2F4IA 2JA5B 4C1NK 3E6ZX 1OXUA 1SBBB 2F0PA 4POGA 4IALA 1EY9A 5C3EG 1E22A 1BKBA 2RF4A 4X65L 1Y1WB 4K5VA 2KBNA 3FMCA 1V1QA 2ES2A 5C0XJ 1E1OA 1TWHH 3D6WA 1DZ1A 3U4ZA 2EZVA 2NVTH 4DV2L 1B2TA 4DNRB 1X3GA 3FHWA 1B9NA 1IKMA 4AYBB 4KKUA 5IGBA 4TSSA 3I4MB 1WCMH 1CZWA 4C3IB 4LFBL 1RL2A 5ELOA 1PH5A 4IPDA 4QJFA 3HG9A 1F9QA 3CKIB 3LNNA 3J80c 4OX9L 4IOCA 1Z47A 5A35A 1MJCA 3A56A 1KAWA 4A3FB 3M4PA 1GJXA 1MBYA 2DNCA 4BWGB 3UDIA 2E2HB 3U9OA 3NEMA 4IFDH 3A74A 4JI7Q 4KV6A 2EJMA 1AE2A 1VQJA 3G7LA 3M4OB 3BDCA 2ZXOA 4OXPA 5M3MG 4A3KG 1Q7YC 4JI0L 3GTMB 4DR7L 3EVQA 4A3EB 4DV5Q 5KRUA 2VQEQ 3BZDB 2X6LA 4R1JA 2HQEA 4YCUA 3HOUB 5EGTA 3ICEA 5J1ZA 1KNEA 4DR3Q 5IWAL 3HOYB 3S1RB 3PSIA 2WIIB 4R4IA 1AFPA 2ZTCA 3J81L 2NUCA 4TKOB 2G5DA 2Z4IA 5L37A 3BVZA 1K3RA 3V96A 4KN7C 3G6EA 4BY1B 3BYYB 4JG2A 2RDGA 4NXML 4YY3L 1SAPA 1O7YA 1II3A 1HZBA 3HKZE 3I4OA 4B9XA 3RN5A 1LV9A 1YJ9A 4JI4L 1G6ZA 1WOCA 3GTKH 3PMFA 2OWOA 4PQXA 2F0VA 5LMNQ 1HR0Q 2R93G 5FJ8H 2ZXRA 5KYIA 2WB1G 4H7BA 3NENA 1PA6A 3JAME 1XNQQ 1B3QA 3E5SA 3J7YW 1ILPA 1YNJD 1A3VA 1V9PA 2VQFQ 1PTOH 2R6GA 4QB4A 1RHPA 2WFWA 2AMCB 4FNFA 1S40A 1AZQA 3W5OA 3C3LA 3S16H 1PFSA 3KF6A 1WI5A 1LT4D 2FMMA 2VL6A 1Q46A 1XPUA 4A3IH 1H9SB 1PHJA 5FLXE 1I4HA 4PNYA 4C56C 3Q0AA 3L9AX 4K5WA 1F2LA 1VQPA 4CDCC 1XXGA 2NVXB 4XQQA 5KNBA 1DOLA 1HHVA 2NVQB 1K0RA 2TMPA 4NB3A 3VYRA 2L5TA 3W1BA 1L0XB 1VMPA 3W2DA 4RCNA 1RD9D 2EJGC 3CCSA 2N88A 2BCOA 3JC66 3K7UC 4I65A 1NBWA 5FLMG 2I5HA 3UE1A 1N34L 4LFBQ 3VDYA 4JI3L 1JOOA 4S3SA 2L4NA 1JOKA 1EEID 2K33A 3RR5A 4OX9Q 4HJ5A 1M1KC 2NWGA 1UEBA 2NZ1D 3NHHA 3JAML 4DXFA 2KA7A 3M85A 3MEHA 5LMNW 3Q22A 1HR0W 1RF2D 2ENBA 3N52A 1D7QA 3I7FA 2G9DA 3KUPA 5D3IB 2HDLA 4JI0Q 3CCQA 4IFDI 2KVMA 4MZ9A 5M5WB 4DR6Q 1CT1D 1PZKD 1BDOA 1SE2A 5FLXL 2Z6KC 2AQ2B 3AFPA 4RFBA 3TQYA 5IWAQ 4QUFA 3WWVA 1B7YB 4POFA 2B2UC 4JI1Q 1HNXQ 1EYDA 1UNSA 3S1MH 3OPOA 2VY3A 5KGUA 1GUTA 5M3MH 1CK1A 2E74C 5C44B 5JAVA 3L3OC 1VS0A 4ZRZA 3PUYA 1LT3D 5C0XH 5C3EB 4DAMA 4NXMQ 4YY3Q 1QJOA 3KDFB 1HZAA 1QVFA 4JI4Q 1EWCA 3GTPB 3NWTA 1EIGA 1EY5A 4RGOS 4KI0A 4AYBE 1SR3A 3BZKA 4KY5A 5ELFA 1VQKA 4DK3C 2MHVA 2DY7A 2FINB 1U4PA 5C4ZA 2MPMA 3NTHA 4EQNA 2EDGA 1JJGA 1XPRA 1D2BA 2RVLA 1PH3A 2UUCL 1YIJA 2YYZA 1IXRA 4Z9CB 1KD1C 4KLKA 1BNZA 2R93H 5I9PA 2EY6A 3M7NA 4KY6A 4OIKA 2ZJRA 3GTLB 5IYBG 3Q24A 4KKSA 3CQZB 1EYAA 4BBRH 4QGUA 3CMAA 1HRJA 3NBHB 2QEXA 5FO7B 1R9TB 3K7AB 3TP7A 4A3KB 4PMWA 1JJCB 1ET6A 4ZKCB 4QQBX 4PZ6A 3K5MA 4OL7A 1CKNA 1VQFA 4QIWE 1S5DD 4NKLA 2R61A 2MGSA 2HCCA 1R4QB 1I6HH 1DOMA 1TS2A 1IZ6A 2ZT9C 2F0JA 2R7DA 1VF5C 2EY2A 2B29A 1XMQL 1LUZA 1QILA 3GP7A 3HOWG 1O7ZA 3A0JA 2H1EA 1I5FA 3D0FA 2CFMA 5IGCA 1EU4A 1P8LA 3OMGA 4F88A 1MI2A 1SFOB 4G7OC 1BXTA 1ICWA 4AQYL 3HKZG 4DV7L 5FLMH 1X55A 2O2LD 4DNIA 3NELA 2K5NA 3TEHB 3CW2C 1KLGD 3GTJB 3FRPB 1YHQA 3L2PA 1VQLA 5C6AA 5CV5A 1IHZA 2PZTA 1NMFA 2QKIC 3T1YL 2DJGC 4DU9A 4JI5Q 1Y1VB 1PDQA 1MSGA 1CI3M 2BH8A 3ER0A 2AKWB 1O7IA 1RCVD 2F3VA 4LFCL 4NPSA 1H9KA 3KYHC 1F9RA 1G8ZD 1DXMA 2R7ZG 2K28A 1TWFB 2WAQB 1A63A 3PO3B 3X3MA 4B9WA 4MTNA 2QF7A 3FKIG 2NVYH 5C0XI 3K80C 4A4IA 1AN8A 1TQOA 5LL6X 4DR4L 4UPAA 3K5NA 2JEBI 5IYCH 1GUNA 1Q12A 3BS1A 1SJED 3E0EA 4LF5Q 2DN8A 2LFNA 4RHSA 2KJXA 4ZUJA 2D62A 4DK6C 4IO9A 2JXMB 2CKZB 4OO1G 3B6YA 3E3XA 1UEAB 2QDLA 2UUCQ 2ASBA 1TWAH 4HJ7A 2MQHA 3U50C 4QCLA 1OXTA 2PI2E 1CTMA 3CRKC 3SDZA 3FVQA 1A2UA 2UXDL 3OW2A 1UE6A 5H1SE 1LT6D 2GN5A 3S9WA 4YIJA 5T1GA 1YNJC 4GNXA 1BVSA 5GAEC 2R92H 1SMYD 4CHTB 1PH9A 1FL0A 5C5MA 1PTOD 2OQKA 3DM1A 2E8GA 4IJHA 3CXCA 3A7LA 3D6CA 4X3KA 2LSSA 4JYAL 1VQ7A 2F0WA 5IODA 2JA5G 4KHVA 1FVIA 4LK1C 3HOXG 1I50B 1XMQQ 4A3CG 3CCLA 2K52A 2XWBB 1Y1WG 3NE5B 2F3WA 2QA4A 1SMXA 1ASZA 5GAHC 1NE3A 2EPBA 1RDPD 2ID0A 2N3SA 4DAPA 2ATWA 4DV7Q 1G2SA 1VQGA 5HGTA 1Y8PB 3KF8B 3M7GA 1JWUD 1EUJA 4AYBG 4NMZA 1KAAA 1AEXA 4HJ8A 5CV4A 1Z7TA 3GTQH 4FXGC 3I4MG 4LJZC 4C3IG 1KABA 2PQAB 3P75A 1WTRA 4BXXG 3HP3A 4KKTA 2A69D 3F2BA 2KOLA 4DV4Q 1C4QA 1JE5A 1Q8KA 1X3EA 3J80E 4DKAC 2HD3A 1PH8A 4A3FG 1LTTD 4IUQA 3I56A 2K5HA 4DV1L 1PXUA 4LFCQ 3IKJA 2V1CC 1HJPA 1Y8NB 3NQTA 2EY1A 4A75A 1WTVA 2E76C 2J4XA 5JJKA 2JA6H 1SYGA 2UXCL 3HOZB 1IL2A 1E1TA 1NMGA 2OCEA 4DR1L 1Y69U 1NJIC 4WORA 3KLSX 5EBCA 3ERSX 3HOUG 3S1NH 1BCPD 2O4XA 1STNA 1LO5D 2XRQD 3CU7A 1I4QA 1CA5A 3S2HH 3GV3A 1U4LA 1RIPA 4M8AA 4ZQ3A 4L6TB 4BY1G 2QILA 5BR8L 4LUVA 4A3LH 2L12A 2UUAQ 1PYSB 1I6VC 1U4MA 1EZ8A 4TQUS 1DONA 4XQJA 4A3DG 4GNXC 4P75A 1BO0A 2DJFC 2PPBC 3I8ZA 2BOSA 3RN2A 2B2TC 1EY6A 2VUMB 4HCEA 4HMJA 3C1FA 1MKHA 1VQHA 3J80L 3CC4A 2L11A 5AJ3L 4L5TA 4K2LA 2VXWA 1A2TA 5M5XB 3CP0A 1M4VA 2Q8RE 4JYAQ 1SE8A 3PUXA 3PIO3 4YHHQ 5DM63 1FJGL 4O42A 1V1PB 3BVMA 3K0XA 3M3YH 4ZCKA 3SK4A 3W1GA 1KIXA 2F4VL 1SYDA 1GKHA 2NN6H 2F0FA 1S72A 4GLVB 1FGUA 1OXVA 5KNCA 1OTCA 2KCMA 3PO2H 1AW7A 3RD4A 1H95A 4GOPA 2N8NA 3AQQA 4RGNA 5CR3A 2JJQA 2JA5H 1TXYA 5M3FB 5C5LA 4ILWA 3DMUA 3UI2A 3SR1A 1Y1WH 1LYLA 3AMUA 4JW0A 2C35B 4MHEA 1DM0B 2HIVA 3I2ZA 4KMUC 1VQEA 4JI8L 1JOQA 4L5QA 1RJTA 4A3BB 3H3VH 1E24A 4HN7A 2KEEA 1M8AA 1NCVA 4DV1Q 2IPKD 3RZOB 1WTPA 4LWCA 3STBD 4RWSC 3T53B 5IT9c 3I4MH 4BXXH 3MWYW 3PGZA 4EGVA 4A76A 2HHHL 2D9UA 3K0YA 2OQ0A 1KHIA 2UXCQ 4N9TA 4DUZL 4DR1Q 2UXBL 3D3RA 4A3FH 3S14B 5CC4A 3QO2A 1HNWL 4JVZA 1MIUA 4FVMA 2E75C 2EYPA 3DEOA 3OW7A 4KD4A 1HPCA 2IJ0A 2KHIA 2B2WA 2EQSA 3DWAA 2JA9A 4LF6L 3MXNB 4XXEA 1PH7A 1O7LA 3GTMH 1K8OA 5C44G 3VYSA 4A3EH 4HIMA 3HOXB 3DWQA 2IX1A 3CPFA 1JT8A 3FP9A 1G51A 3HOUH 5BR8Q 4K0KL 1PRTB 1XX8A 1K9MC 2I5MX 3HOYH 1PFBA 3VA7A 3S1RH 1NNXA 2GA4B 1K73C 2IX0A 5CORA 3K81C 2MJ8A 4JI6L 4Y52H 1X32A 3OHXC 1SJHD 4XYOA 2YV5A 3P20A 1EY7A 3NBHA 1NUCA 4UY8C 1EIHA 4A3MB 2I5LX 3SVMA 1XYIA 1C9OA 1XNRL 4JBKA 2A73B 3CAMA 5ELCA 2VS1A 1TT2A 2N49A 3QOLA 1FJGQ 4KTAA 1TS4A 3IFTA 5D14A 3TBIB 3ULJA 1CHPD 1CQVA 3PUWA 4QL5A 2K6AA 2BA0A 1L1OB 3TZUA 1SMYC 4L5SA 4C2MB 1EY8A 4GOPC 3GTGB 4NDXA 1PTOC 4C3JB 2NN6I 1STBA 1ZEQX 2OXPA 4QIWB 5IGDA 2A5HA 1VQ6A 2Q2UA 5CV8A 1ENAA 1CZGA 1YJNA 4JBJA 1QE6A 1CSQA 5EKKA 1EQQA 1PH4A 4A3JB 4KJOA 2ZJPA 2JA7G 4J1MA 1VQ5A 2NVQH 1KRTA 1Z9FA 4JI8Q 1CKOA 3TP6A 3N6RA 4F7XA 2ALYB 3D4DA 4A3DB 1HXYD 4C3HB 1KTKA 4OWWB 4DFAA 2B2YA 4NP5A 4LW1A 1JB3A 3H3VI 2NB0A 2HHHQ 5LL6S 2I0QA 3PV0A 3ZJYC 4R9WA 2UXBQ 3PUVA 1UAPA 1MSHA 3WDNA 2A69C 3RNUA 2CH4A 4QUCA 2IY5B 3TSSA 1Y1VG 2QW7A 3D4RA 1PH1A 3C46A 2K5WA 3NQIA 4KHPL 4YCVA 2M00A 5DM73 4L8JA 2JQOA 4HIDA 1E0BA 3PIP3 1GOZA 4UHVA 5M5WH 3A8IE 4X65Q 3QR8A 5BN5A 2WAQG 1EEFD 1PH6A 4K0KQ 3KK7A 4XTCS 3PO3G 1B70B 2KEDA 1DCZA 4TRDA 5I2XA 4JC0A 4WFN3 1T5EA 4DV2Q 5J39A 4UP7A 1BCPC 4RKLA 1LTLA 5JPMC 5C44H 2FMCA 2K05A 4IUNA 1V1OA 1PFNA 5C3EH 1VF7A 2KCTA 4OWXB 1BUVT 2LKVA 3T13A 3IAYA 1PTOF 1EL0A 3GTPH 1CQFA 1YJWA 1QUQB 5J3BA 1AE3A 4ABNA 2AWOA 2BE5D 1W3SA 4DR2L 4LF8L 4I7ZC 3CMEA 4GN3B 4HJ9A 1TY0A 5NUCA 1EU3A 4EQOA 5EBDA 5DLQE 4G7ZC 4DR7Q 1RTOA 4OONA 3MAQA 4OIJA 2Z8LA 1UUPA 3V05A 2CH4W 3S15B 3FPPA 1WTHA 3DWPA 3MA2B 1J5EL 3A5UA 1QNKA 3GTLH 2RHQB 1A15A 2CVRA 5GADC 5C4XG 2UUBL 3T4AC 2M9VA 3L7ZC 1R9TH 3K7AH 4A3KH 4ODGA 1ESFA 3P1HA 1K28A 3KF8A 3V2TA 3T16A 1EWHA 2NZOA 4KJNA 1HA5A 2F0GA 2FHTA 1C8CA 4H02A 2PQAA 2O5IC 2MO1A 4DNTB 4MTKA 1JMCA 1QNUA 3F2CA 1VQ4A 4F87A 3D8GA 2JP1A 1B9MA 3TP8A 3I72A 4GKKL 5EAYA 2QGQA 3UDFA 1GVPA 4OELB 1LM0A 2L55A 2LS01 3FDTA 2OT2A 2JK8A 2WP8J 2Y0SE 3E9HA 4H44C 3OIPA 3J81c 4O1NA 4BBSG 4FYDA 2F0LA 1BCPF 1LACA 1J9OA 1S5BD 1K83H 1GM5A 4KHPQ 2K1BA 4IN3A 2YTYA 3STBC 3GTJH 3RZDB 4PMBA 2NZHA 4N8X1 3J7AF 2HUGA 2SOBA 1STAA 1E2WA 1FR3A 3NWSA 1KNAA 3HOZG 3PCOB 2ZTEA 1D6EC 1VQCA 1STGA 3AFQA 1F9PA 2AHOB 4O0AA 1TWCB 3J81j 2XRSD 4ZKBB 3AYHB 3CCMA 4UDUC 4OWTB 3U58A 1TWFH 3I90A 3PO3H 1N34Q 2WACA 2JA7B 1EIYB 1E7ZA 4JI3Q 3MFGA 2G9HD 1SNDA 2EYMA 4RCOA 4HR7B 5M5YB 1I4XA 1QVCA 1J6QA 1HTPA 1ET9A 3GDEA 3QIAA 2ZXPA 2CWPA 1PLFA 1EY0A 4H0LC 4LF8Q 5EKIA 4FP5D 1F2MA 3MXUA 3OMCA 1U0LA 1WVLA 1TS3A 4H13C 1ML0D 1VDZA 2NYZD 3EFXD 2VUMG 2D0OA 2HT1A 2B63G 1VQ8A 2JA8G 4GS3A 3UDXA 2RKSA 4HEDA 1BOSA 2IHEA 5JJIA 2RSNA 1VCIA 1J5EQ 2J7ZA 1TR5A 4RG1A 2UUBQ 3TN2A 3NP8A 2LMCB 5C4JB 4IQZA 3VYTA 4LFAL 2DUDA 3Q8DA 4ME3A 4BY7G 2Q2TA 2K7VA 1X3FA 2OTJA 1S5CD 2H5XA 3BJUA 4XQNA 2EYHA 5JVH3 4AH6A 4XIGS 1KL9A 2YU9B 3M4YA 4XYQA 1EFWA 3AEVA 3PF4A 4J15A 2BA1A 4CDDC 1PH2A 3MHBA 1I50H 5M3FG 3H91A 2F0IA 2QCPX 1Q1BA 4GKKQ 5FLXc 1STYA 5HGQA 4IJLA 5G3LF 2KHJA 1R4PB 4X66L 4CJ1B 3QOJA 5ELNA 3NBIA 3HOVG 1H9JA 4JK1C 1GO3E 1KDAA 1S5FD 1V43A 4K8IA 3KF6B 4R4CA 4HAEA 4WJ4A 4A3BG 1BR9A 2E2JB 1SNOA 2A68D 4CKCA 4ME5A 2SNMA 5D3DA 2WKCA 4CKEA 4E6IA 5FO8B 2I46A 4CJ0B 3I4NB 4K5XA 2UU9L 5IT9E 1OXXK 4B3TL 4GN5A 3QB3A 3SE0A 4G4KA 2EJFC 4IUUA 1SSOA 3HFZB 1ZYRD 1TVXA 2A19A 3CHBD 1IYJB 4K8JA 1J8IA 4MN3A 2V4DA 1BBWA 2HQLA 4GN4B 1YEZA 4B3SL 4LNQA 4RA8A 5IYBH 3Q23A 1VQ9A 5IYDG 5C4XB 2B8GA 1YNND 2E2IB 3PUZA 3HOZH 1HFGA 1EOVA 1JC7A 4XT3B 2SEBD 1SYFA 2CW0D 5HURA 3SEBA 2B3GA 2K4KA 1E3PA 1FNWA 4P71A 4Q0FA 4AQYQ 3H0GG 2JN4A 2MFIA 4JI2L 1YVCA 3RLFA 3EROA 4A3GG 3HOWH 3A8JE 2F0HA 1NR2A 5CV7A 1PZJD 3VR6A 1XTCD 3H94A 1IBKL 3T1YQ 4A3MG 1ESRA 4BBSB 2XTIA 4CDEC 1K0SA 2OEOA 1HQMC 5IT9L 1JQYD 3BDLA 1PVOA 2BE5C 2VUMH 3K6OA 1KC8C 5T1IA 4LFAQ 2Q8IB 2LXJA 1B3AA 1ENCA 5M5XH 5E4XA 4FO2A 1N8RC 4C3JG 1RTNA 3FPUB 4DR4Q 3BDOA 4RGMA 1F2ZA 4X3TA 5M9OA 1TWGB 5IGGA 3IRBA 2EYLA 5K36G 4XDXA 2C9OA 5EPJA 4JV5L 3KJPA 1X3QA 2KENA 2HCIA 1IBML 2R7ZH 1EZ6A 4A3JG 2A6HD 4RHRA 2AUJD 4RH6A 2X69A 1JB7A 3FKIH 4A93G 4IFDJ 4PV1C 4LF9L 2H4OA 4GLAC 1QVGA 4NXNL 1DYQA 2AQ1B 4X3UA 4DAYB 5M3FH 3H6MA 4OO1H 4C3HG 1DGSA 4U68A 3CCVA 1WD1A 1ENFA 1PYBA 1N32L 3S2DB 3CF5A 3UDGA 5FK9C 1H9SA 2EVBA 1X65A 5IGFA 1KRSA 1I3QB 2B63B 2JA8B 1U4RA 5GQOA 5GROA 5I4DA 3VA5A 2IHFA 3A8KE 3D31A 4RKBA 4B3SQ 3RZOH 3S1QB 1HUNA 2K5VA 3HEJA 2WB1E 3R2IA 5EQ0A 1K3BC 3H3VC 1CHQD 4EX5A 2L1BA 5JVG3 1C48A 1EY4A 5C3XA 4J8QA 1U5KA 1D5XC 2N55A 2Q2HA 1TIID 4BY7B 3DUZA 1FNVA 2XVSA 3OTOL 2NTTA 3MEFA 3S14H 2RBMA 4IFDG 1CKMA 5KIXA 1PMRA 3R3OA 1Y8OB 2IW3A 1IL8A 2ZJQA 2CQOA 1CSPA 4DA2A 1SDFA 2YTVA 3T51B 3VR5A 4DR5L 3EIVA 1XWEA 1M90C 1K8GA 2XWJB 2PQEA 3P7JA 3HOXH 1QWYA 4A3CH 3J7A5 4IUTA 4BA1I 3C1EA 2PI2A 4B08A 3ULPA 2EIFA 2IX3A 3HOVB 4JI7L 3O13A 4X6AH 3EN2A 3S2HB 1K8MA 4Y7NB 3AB9A 1GD7A 2RQXA 5I6YA 5E3FA 1I4RA 1RODA 2VQEL 2Z9HA 3SK8A 1WTWA 1LABA 4C1NI 5CMDA 1GUSA 2JE6I 3KLRA 4NW2A 1QOHA 2SDFA 1D5MC 5IOCA 4DV0L 1O80A 1MJEA 5FKAC 4C3IH 3J7ZC 3DLLA 4A3MH 2NBFA 5G3LD 1YNXA 1SE4A 1E2VA 3QJYA 5IP9G 5HY6A 4FXKC 1LTRD 2RDHA 2J0TD 3KDFA 2OF1A 2E2HH 4JV5Q 4DGZA 2F0DA 1IBMQ 3GD7A 5LMNL 1HR0L 3M4OH 3MFYA 4C2MH 4P73A 3GTGH 4HIKA 4C3JH 4DN4M 1EWIA 4ULLA 3E9IA 1UE7A 1HTLD 5LMUL 4NXNQ 1O78A 3EJIA 2VB2X 4X62L 1C0AA 4DV3L 3TP5A 3H0GB 3MXGA 4I7AA 3PO2B 2A74C 2K5DA 1WTXA 1YHAA 3MZ5A 4GNXB 3TS0A 2BH2A 2GVAA 3HS0C 3TZDA 4A3GB 4OO1I 3ULLA 4BY1H 5AJ3Q 1CA6A 2AWNA 2BDNA 4DK0A 5AFWA 1F2YA 3K8AA 3J81E 5IY0A 2MP1A 3M4QA 4A3DH 4C3HH 5C4HA 3G71A 1LT5D 2Y0SB 3H15A 1LTGD 3IL8A 4MNOA 1AP0A 2A68C 1X9NA 3PF5A 5COYA 3S17B 4K6DA 1T5XD 4LMQD 4B3ML 3OTOQ 2EYJA 4LF7L 2F4VQ 3MTSA 1G91A 4L5RC 1W2BA 1CM9A 5A2QE 1VQIA 3G4SA 1ICFB 1SRUA 1ZYRC 4DR5Q 3GTOB 5I6WA 2RDFA 1H9RA 2F0EA 4HSVA 1XMOL 1UE5A 1YNNC 4DPGA 2NVXH 5CYUA 1S4ZA 4A93B 1KDCA 3MXPA 2CW0C 1WFQA 5C0XG 3NUCA 2EOTA 4DR6L 3TRZA 1PFMA 1E2ZA 1XJVA 4IUPA 1W6KA 1TWHB 4DV0Q 2NVTB 1N36L 2PNHA 5DNFA 4JI1L 1HNXL 1QZHA 2Z6KA 1IYUA 4PMCA 3A55A 4YWMA 2B2UA 1D1IA 1G291 3TREA 3HZXA 4DUZQ 2F0SA 3UE0A 3PQIA 5KNDA 3AU7A 1BQQT 2B2WC 1IYVA 2N78A 1HNWQ 1OXSC 3DXJC 1HQRD 1HZCA 1L0YB 1WCMB 4N9PA 3F8TA 5EPKA 4LF6Q 1CFMA 3QWNA 3K5LA 5A2QL 5CBEE 1DJRD 5IP9H 5D65A 2CWAA 4G57A 2XSCA 3S15H 5LMUQ 2F0QA 4BBRG 4X62Q 2L15A 3M9BA 5GAGC 2PMZB 4DV3Q 4PG3A 4LUOA 2E5LL 4V190 4B3RL 2ZM6L 3E0JA 1Z6HA 4JI6Q 4R4TA 4FF3A 4JOIA 3PIOA 3KJOA 4OEMB 2A6HC 1GUWA 4L63B 4LAAA 3CCEA 3J81i 1XNRQ 3SK5A 1HFNA 2RA4A 1VQNA 4YCWA 5JPNC 5IP7G 3OIQA 1HNZL 3Q6SA 1X54A 2EXDA 5ELDA 4FF1A 1Y14B 4KD3A 4B3MQ 3I4NG 2KCCA 5BN3A 4LF7Q 4IUVA 3CC7A 3GTKB 3ZYYX 5E4WC 1MHWC 2R7FA 2TSSA 3S24A 4HMIA 1QZGA 2XN9C 1X56A 4GOPB 1PTOB 4CDFC 1PZID 1XMOQ 3RZDH 4FF4A 1JJ2A 1SYBA 1WTOA 1VQDA 3S16B 3CQZH 2K04A 1WTQA 4KHZA 4HSPA 1A3TA 3A54A 3I4LA 4DXGA 1STHA 1XTDA 1S5ED 1SLJA 1QG7A 2B2VA 2DGYA 2A1AA 4A3IB 5ELBA 3K57A 3ERQA 1SNMA 1SN8A 3BZCA 2HIXA 5EJWA 1B50A 4IURA 2HDMA 3R8BA 1TWCH 3U4VA 2B2YC 3I3CA 4JI5L 1YBYA 3CRLC 1N36Q 3HRZC 1GXDC 4ZK9B 4U673 3CPWA 2I07B 2JA7H 5EKLA 3CCRA 5IYCG 3URYA 5FOBB 1DD2A 4YWLA 1F9SA 2KCNA 3BVGA 4ID6A 5JEAJ 1AH9A 5M5YH 2FXQA 2Z6BA 3VR4A 3SXHA 4F8MA 1PRTD 1ONLA 2X6GA 1SFOH 1GHJA 2LY7A 1X6OA 3VR3A 1HUMA 2A8VA 1TS5A 3I91A 4HTHA 2D0PA 1BF4A 4LF5L 2NTSA 2MUYA 4WRDA 4ZAIA 1JWMD 1N9WA 4HIOA 3WOEA 1D1KA 3A5ZB 2F0OA 4BA2I 3JAMi 2WV6D 2IWHA 1STEA 3TDQA 3A7AB 3EQLC 1JCKB 2MO0A 2K01A 4P72A 1YI2A 1NAPA 2R92G 1Y1VH 2E5LQ 1TY2A 3VR2A 4X64L 1LTBD 2F0TA 4B3RQ 2ZM6Q 4JOIC 4P2CB 2F0KA 5C4JH 2XNAC 1VQBA 1JE4A 4DAYA 2PO4A 4R4QA 3NTKA 4XT1B 1YHBA 1BCPB 1B44D 1HCZA 1Q82C 1UE1A 3DEPA 1L0WA 1K8AC 2A6ED 4EVOA 3T1HL 1LTSD 3J7AV 1B8AA 5JEAG 3S1MB 1D5ZC 3VYUA 2YU9H 5M3MB 2F03A 5FO9B 1Q86C 1FGBD 3KLWA
chains in the Genus database with same CATH topology
5CBAE 3KBGA 1A6XA 5JJZA 5IIFA 3KBXA 3TMEA 3F2UA 1NR4A 2ICIA 2Z1CA 4K2KA 2C5CA 1EFID 1V1PA 1JORA 1A3UA 3GQBA 2F0MA 2EYFA 1TKWB 4KK7A 3ITPA 3BYTB 1SYEA 2BDOA 2IT1A 1IW7D 2B2VC 3LWEA 3NSWA 2EE1A 2R93B 1K83B 2WB1B 4WJWA 3R2TA 3GV6A 1BBXC 5CV6A 1JWSD 3LWUA 4BBRB 4K14A 2PZUA 2E2DC 3ND9A 1KDBA 1LTAD 3K5OA 3IFDA 1SXTA 5TSSA 5CV9A 5JOBA 1I6HB 4FF2A 1HA6A 3ND8A 4CKBA 1B1ZA 4G7HC 4MIUA 2IL8A 2L9HA 2QEJC 2AUKA 5KEEA 4R8NA 1Q1EA 1ILQA 3MVVA 1QCBD 4ZLTF 4FXDA 3OWFA 3DHQA 4QMGA 3MXNA 1AZPA 5KYLA 5DAUA 2B39A 2B8FA 5I2YA 2KQ3A 4OHJA 1IKLA 2FJ2A 5CGKA 1F77A 4RAUC 2D2CC 2JSOA 5ELEA 4BS9A 2WINB 4R8IA 5I9OA 2RSOA 4KY7A 4GZYC 4ZUIA 3I70A 3RMHA 3OWEB 3NXWA 3QG1A 5E1FA 2FFKB 1SYCA 4EQPA 4CBVA 4CGYB 2B2TA 2NN6G 2F0UA 3ONAB 1SEBD 1RKNA 4ZYSA 1EQVA 2EY5A 4HCSA 4Q5VA 1X3PA 4KN4C 2NVYB 1EOTA 3T56B 5JEAH 1JR0D 1I4GA 2PYKA 3OSOA 2F0NA 4DF7A 2EXZA 2F1MA 1TU2B 4OGQC 1WD0A 4QF4A 2Z4HA 2D5DA 3U9SA 2PNRC 3MC0B 1EYCA 5C3WA 4J6HA 3D4WA 1TWAB 2WKDA 1ZXTA 4CJ2C 1G2TA 1ZKOA 3K58A 1I4PA 2L0CA 3OOCA 1GUGA 1NSNS 2R92B 1KLUD 1U9RA 2AQ3B 2QDBA 4DAVA 5IGEA 2EYOA 1PYWD 3I73A 3C2PA 1W6JA 3EA6A 2KHSA 2ICEC 2JEAI 1GHKA 2CQAA 2KECA 3LX0A 5EPLA 4IZ8A 2DNEA 1EQTA 2PW5A 4X3SA 5F2DA 1SNQA 2DY8A 2K32A 1PRTC 1MD2D 3HOWB 5LHY1 2K03A 3GTQB 2VNUD 3GO5A 1GUOA 3X3NA 5ISRA 4UAIA 3HKZB 3K59A 1SE3A 2PCFB 5DEHA 3SHLA 4M1UB 2SNSA 2JA6B 2JYOA 4K6LA 2M2LA 3S1NB 3R93A 3HGBA 1DOKA 2A6EC 2XIWA 3NPPA 3SK6A 1FNUA 2R7ZB 1FYCA 3FKIB 3FEWX 3H09A 1MGSA 5K5PA 1SNPA 1B4OA 2PW7A 4JBWA 1FD7D 1LTID 4DK1A 2K5QA 3G6JB 4V0BA 1VMCA 3BG3A 1OO9B 4RGTA 2VB3X 1V8QA 2CHBD 5J22A 1LLRD 1Q8IA 2KUMA 1Q3LA 1JICA 1QB5D 1IW7C 3RUZA 1Q90A 2R3ZA 1PRTF 5BN4A 3M3YB 5K36H 3KLSA 1B53A 3WOFA 1SNCA 2O5JC 3NTIA 2PZWA 3NK9A 1H9MA 2Q8TA 2F4IA 2JA5B 4C1NK 3E6ZX 1OXUA 1SBBB 2F0PA 4IALA 1EY9A 1Y1WB 4K5VA 3FMCA 5C0XJ 1DZ1A 3D6WA 2EZVA 1B2TA 4DNRB 1B9NA 1IKMA 4AYBB 4KKUA 5IGBA 4TSSA 3I4MB 1CZWA 4C3IB 3HG9A 1F9QA 3CKIB 3LNNA 1Z47A 5A35A 3A56A 4A3FB 1GJXA 1MBYA 2DNCA 4BWGB 2E2HB 3U9OA 4IFDH 4KV6A 2EJMA 3G7LA 3M4OB 3BDCA 2ZXOA 3GTMB 3EVQA 4A3EB 5KRUA 3BZDB 2X6LA 2HQEA 3HOUB 5EGTA 5J1ZA 1KNEA 3HOYB 3S1RB 2WIIB 1AFPA 3J81L 2NUCA 4TKOB 2Z4IA 3BVZA 3V96A 4KN7C 4BY1B 3BYYB 2RDGA 1SAPA 1O7YA 1II3A 4B9XA 1LV9A 1G6ZA 3PMFA 4PQXA 2F0VA 2ZXRA 5KYIA 4H7BA 3JAME 3E5SA 3J7YW 1ILPA 1YNJD 1A3VA 1PTOH 2R6GA 4QB4A 1RHPA 4FNFA 1AZQA 3C3LA 1LT4D 2FMMA 1H9SB 5FLXE 1I4HA 4PNYA 4C56C 3Q0AA 3L9AX 4K5WA 1F2LA 1XXGA 2NVXB 4XQQA 5KNBA 1DOLA 1HHVA 2NVQB 3VYRA 2TMPA 2L5TA 1L0XB 1VMPA 3W2DA 4RCNA 1RD9D 2EJGC 2N88A 2BCOA 4I65A 1JOOA 4S3SA 2L4NA 1JOKA 1EEID 2K33A 2NWGA 2NZ1D 3NHHA 3JAML 4DXFA 2KA7A 3M85A 3MEHA 3Q22A 1RF2D 2ENBA 3N52A 2G9DA 3KUPA 5D3IB 2HDLA 4IFDI 2KVMA 5M5WB 1CT1D 1PZKD 1BDOA 1SE2A 5FLXL 4RFBA 2AQ2B 4QUFA 2B2UC 1EYDA 1UNSA 3OPOA 5KGUA 1GUTA 1CK1A 2E74C 5C44B 5JAVA 3L3OC 4ZRZA 3PUYA 1LT3D 5C0XH 5C3EB 1QJOA 1EWCA 3GTPB 3NWTA 1EIGA 1EY5A 4RGOS 4KI0A 4KY5A 5ELFA 2MHVA 2DY7A 2FINB 1U4PA 5C4ZA 2MPMA 3NTHA 4EQNA 2EDGA 1D2BA 2RVLA 2YYZA 4Z9CB 1BNZA 5I9PA 2EY6A 3M7NA 4KY6A 4OIKA 3GTLB 3Q24A 4KKSA 3CQZB 1EYAA 1HRJA 1R9TB 5FO7B 3K7AB 3TP7A 4A3KB 4PMWA 1ET6A 4ZKCB 3K5MA 4OL7A 1S5DD 4NKLA 2R61A 2MGSA 2HCCA 1R4QB 1DOMA 1TS2A 2ZT9C 2F0JA 1VF5C 2EY2A 1QILA 3GP7A 1O7ZA 2H1EA 5IGCA 1EU4A 3OMGA 4F88A 1MI2A 1SFOB 4G7OC 1BXTA 1ICWA 2O2LD 1KLGD 3GTJB 3FRPB 5C6AA 5CV5A 1IHZA 2PZTA 2QKIC 4DU9A 1Y1VB 1PDQA 1MSGA 1CI3M 1RCVD 2F3VA 1H9KA 1F9RA 1G8ZD 1DXMA 2K28A 1TWFB 2WAQB 3PO3B 3X3MA 4B9WA 2QF7A 5C0XI 1AN8A 1TQOA 5LL6X 3K5NA 2JEBI 1GUNA 1Q12A 3BS1A 1SJED 2DN8A 2LFNA 4RHSA 2KJXA 4ZUJA 2D62A 2JXMB 4OO1G 1UEAB 4QCLA 1OXTA 1CTMA 3CRKC 3SDZA 3FVQA 1A2UA 1LT6D 3S9WA 4YIJA 5T1GA 1YNJC 1SMYD 4CHTB 5C5MA 1PTOD 3DM1A 3A7LA 3D6CA 4X3KA 2F0WA 5IODA 4KHVA 4LK1C 1I50B 2XWBB 3NE5B 2F3WA 2EPBA 1RDPD 2ID0A 4DAPA 1G2SA 5HGTA 1Y8PB 3M7GA 1JWUD 4NMZA 1KAAA 1AEXA 5CV4A 1Z7TA 4FXGC 4LJZC 4C3IG 1KABA 3P75A 1WTRA 3HP3A 4KKTA 2A69D 2KOLA 1C4QA 3J80E 1LTTD 4IUQA 1PXUA 3IKJA 1Y8NB 3NQTA 2EY1A 1WTVA 2E76C 2J4XA 1SYGA 3HOZB 1Y69U 4WORA 3KLSX 5EBCA 1BCPD 2O4XA 1STNA 1LO5D 2XRQD 3CU7A 1I4QA 1CA5A 3GV3A 1U4LA 4M8AA 4ZQ3A 4L6TB 2QILA 2L12A 1U4MA 1I6VC 1EZ8A 4TQUS 1DONA 4XQJA 1BO0A 2PPBC 3I8ZA 2BOSA 2B2TC 1EY6A 2VUMB 4HCEA 4HMJA 3C1FA 3J80L 2L11A 4K2LA 2VXWA 1A2TA 5M5XB 1M4VA 2Q8RE 3PUXA 3PIO3 5DM63 4O42A 1V1PB 3BVMA 3SK4A 1SYDA 2NN6H 2F0FA 1OXVA 5KNCA 1AW7A 3RD4A 4RGNA 5CR3A 5M3FB 5C5LA 4ILWA 3DMUA 3UI2A 3SR1A 3AMUA 4MHEA 1DM0B 4KMUC 1JOQA 1RJTA 4A3BB 4HN7A 2KEEA 1M8AA 1NCVA 2IPKD 3RZOB 1WTPA 4RWSC 3T53B 3MWYW 4EGVA 2D9UA 3K0YA 4N9TA 3D3RA 3S14B 5CC4A 3QO2A 4FVMA 2E75C 2EYPA 3DEOA 3OW7A 4KD4A 1HPCA 2IJ0A 2B2WA 3DWAA 4XXEA 1O7LA 1K8OA 3VYSA 3HOXB 3DWQA 2IX1A 1PRTB 1XX8A 1PFBA 3VA7A 2GA4B 2IX0A 5CORA 2MJ8A 1X32A 3OHXC 1SJHD 4XYOA 3P20A 1EY7A 3NBHA 1NUCA 1EIHA 4A3MB 3SVMA 1XYIA 2A73B 5ELCA 1TT2A 3QOLA 4KTAA 1TS4A 3IFTA 5D14A 3TBIB 1CHPD 1CQVA 3PUWA 2K6AA 2BA0A 3TZUA 1SMYC 4C2MB 1EY8A 3GTGB 4NDXA 1PTOC 4C3JB 2NN6I 1STBA 1ZEQX 2OXPA 4QIWB 5IGDA 2A5HA 5CV8A 1ENAA 1CZGA 1QE6A 5EKKA 4A3JB 4KJOA 4J1MA 3TP6A 3N6RA 4F7XA 3D4DA 4A3DB 1HXYD 4C3HB 1KTKA 4DFAA 2B2YA 4NP5A 1JB3A 2NB0A 5LL6S 3PV0A 4R9WA 3PUVA 1UAPA 1MSHA 3WDNA 2A69C 4QUCA 3TSSA 3D4RA 3C46A 2K5WA 3NQIA 5DM73 2M00A 4L8JA 1E0BA 3PIP3 1GOZA 3A8IE 5BN5A 1EEFD 3KK7A 4XTCS 2KEDA 1DCZA 4TRDA 5I2XA 4WFN3 1T5EA 5J39A 1BCPC 4RKLA 5JPMC 2FMCA 2K05A 4IUNA 1V1OA 1PFNA 1VF7A 1BUVT 2LKVA 3T13A 3IAYA 1PTOF 1EL0A 1CQFA 4ABNA 2AWOA 2BE5D 4I7ZC 1TY0A 5NUCA 1EU3A 4EQOA 5EBDA 4G7ZC 1RTOA 3MAQA 4OIJA 2Z8LA 1UUPA 3V05A 3S15B 3FPPA 3DWPA 3MA2B 1QNKA 1A15A 2CVRA 3T4AC 2M9VA 3L7ZC 4ODGA 1ESFA 3P1HA 3KF8A 3V2TA 3T16A 1EWHA 4KJNA 1HA5A 2F0GA 2FHTA 1C8CA 2O5IC 4DNTB 1QNUA 4F87A 3D8GA 2JP1A 1B9MA 3TP8A 3I72A 2L55A 2LS01 3FDTA 2OT2A 2WP8J 4H44C 3OIPA 4O1NA 4FYDA 2F0LA 1BCPF 1LACA 1J9OA 1S5BD 2K1BA 4IN3A 3RZDB 4PMBA 3J7AF 2HUGA 2SOBA 1STAA 1E2WA 1FR3A 1KNAA 3NWSA 1D6EC 1STGA 1F9PA 1TWCB 2XRSD 4ZKBB 4UDUC 3I90A 2WACA 2JA7B 3MFGA 2G9HD 1SNDA 2EYMA 4RCOA 4HR7B 5M5YB 1I4XA 1HTPA 1ET9A 3QIAA 2ZXPA 1PLFA 1EY0A 4H0LC 5EKIA 4FP5D 1F2MA 3MXUA 3OMCA 1WVLA 1TS3A 4H13C 1ML0D 1VDZA 2NYZD 3EFXD 2RKSA 4HEDA 1BOSA 2RSNA 1VCIA 2J7ZA 1TR5A 3TN2A 3NP8A 2LMCB 5C4JB 4IQZA 3VYTA 2K7VA 1S5CD 4XQNA 5JVH3 2EYHA 4XIGS 2YU9B 3M4YA 4XYQA 2BA1A 3MHBA 3H91A 2F0IA 2QCPX 1Q1BA 1STYA 5G3LF 1R4PB 4CJ1B 3QOJA 3NBIA 1H9JA 4JK1C 1KDAA 1S5FD 1V43A 4K8IA 4HAEA 1BR9A 2E2JB 1SNOA 2A68D 4CKCA 4ME5A 2SNMA 5D3DA 2WKCA 4CKEA 4E6IA 5FO8B 2I46A 4CJ0B 3I4NB 4K5XA 5IT9E 1OXXK 3QB3A 3SE0A 4G4KA 2EJFC 4IUUA 1SSOA 1ZYRD 1TVXA 3CHBD 4K8JA 1J8IA 4MN3A 2V4DA 4RA8A 3Q23A 5C4XB 2B8GA 1YNND 2E2IB 3PUZA 1HFGA 1JC7A 4XT3B 2SEBD 1SYFA 2CW0D 5HURA 3SEBA 1FNWA 4Q0FA 3RLFA 3EROA 3A8JE 2F0HA 1NR2A 5CV7A 1PZJD 3VR6A 1XTCD 3H94A 1ESRA 4BBSB 2OEOA 1HQMC 5IT9L 1JQYD 3BDLA 2BE5C 3K6OA 5T1IA 2Q8IB 1B3AA 1ENCA 5E4XA 4FO2A 4C3JG 1RTNA 3FPUB 3BDOA 4RGMA 1F2ZA 4X3TA 5M9OA 1TWGB 5IGGA 5K36G 2EYLA 4XDXA 2C9OA 5EPJA 1X3QA 2HCIA 1EZ6A 2A6HD 4RHRA 2AUJD 4RH6A 2X69A 4IFDJ 4PV1C 2H4OA 1DYQA 2AQ1B 4X3UA 3H6MA 4OO1H 4C3HG 4U68A 1WD1A 1ENFA 3S2DB 5FK9C 1H9SA 2EVBA 5IGFA 2B63B 2JA8B 1I3QB 1U4RA 5I4DA 3VA5A 3A8KE 3D31A 4RKBA 3S1QB 1HUNA 3HEJA 3R2IA 5EQ0A 3H3VC 1CHQD 2L1BA 5JVG3 1C48A 1EY4A 5C3XA 4J8QA 1D5XC 2N55A 1TIID 4BY7B 3DUZA 1FNVA 2XVSA 2NTTA 2RBMA 4IFDG 5KIXA 1PMRA 3R3OA 1Y8OB 2IW3A 1IL8A 4DA2A 1SDFA 3T51B 3VR5A 1XWEA 2XWJB 2PQEA 3P7JA 1QWYA 4IUTA 4BA1I 3C1EA 4B08A 3HOVB 2IX3A 3O13A 3S2HB 1K8MA 4Y7NB 3AB9A 2RQXA 5I6YA 5E3FA 1I4RA 1RODA 3SK8A 1WTWA 1LABA 4C1NI 5CMDA 1GUSA 2JE6I 3KLRA 4NW2A 1QOHA 2SDFA 1D5MC 5IOCA 1O80A 5FKAC 2NBFA 5G3LD 1SE4A 1E2VA 3QJYA 4FXKC 1LTRD 2RDHA 2J0TD 2OF1A 4DGZA 2F0DA 3GD7A 3MFYA 4DN4M 4ULLA 1HTLD 1O78A 3EJIA 2VB2X 3TP5A 3H0GB 3MXGA 3PO2B 2A74C 2K5DA 1WTXA 3MZ5A 3HS0C 3TZDA 4A3GB 4OO1I 1CA6A 2AWNA 2BDNA 4DK0A 5AFWA 1F2YA 3J81E 2MP1A 5C4HA 1LT5D 2Y0SB 1LTGD 3IL8A 1AP0A 2A68C 5COYA 3S17B 4K6DA 1T5XD 4LMQD 2EYJA 1G91A 3MTSA 1CM9A 5A2QE 1ZYRC 3GTOB 5I6WA 2RDFA 1H9RA 2F0EA 4HSVA 1YNNC 5CYUA 1S4ZA 4A93B 1KDCA 3MXPA 2CW0C 5C0XG 3NUCA 2EOTA 1PFMA 1E2ZA 4IUPA 1W6KA 1TWHB 2NVTB 5DNFA 1IYUA 4PMCA 3A55A 2B2UA 1D1IA 1G291 3HZXA 2F0SA 5KNDA 3AU7A 1BQQT 2B2WC 1IYVA 1OXSC 3DXJC 1HQRD 1L0YB 1WCMB 4N9PA 5EPKA 1CFMA 3QWNA 3K5LA 5A2QL 5CBEE 1DJRD 5D65A 4G57A 2XSCA 2F0QA 2PMZB 4V190 3E0JA 1Z6HA 4FF3A 2A6HC 1GUWA 4L63B 4LAAA 3SK5A 1HFNA 2RA4A 5JPNC 3OIQA 3Q6SA 5ELDA 4FF1A 4KD3A 2KCCA 5BN3A 4IUVA 3GTKB 3ZYYX 5E4WC 2TSSA 4HMIA 2XN9C 1PTOB 1PZID 4FF4A 1SYBA 1WTOA 3S16B 2K04A 1WTQA 4KHZA 4HSPA 1A3TA 3A54A 3I4LA 4DXGA 1STHA 1S5ED 1QG7A 2B2VA 4A3IB 5ELBA 3K57A 3ERQA 1SNMA 5EJWA 1B50A 4IURA 2HDMA 3R8BA 2B2YC 3I3CA 3CRLC 3HRZC 1GXDC 4ZK9B 4U673 2I07B 5EKLA 3URYA 5FOBB 1DD2A 1F9SA 2KCNA 3BVGA 4ID6A 5JEAJ 3VR4A 3SXHA 4F8MA 1PRTD 1ONLA 2X6GA 1GHJA 2LY7A 3VR3A 1HUMA 1TS5A 3I91A 4HTHA 1BF4A 2NTSA 2MUYA 4WRDA 4ZAIA 1JWMD 3WOEA 1D1KA 2F0OA 4BA2I 2WV6D 2IWHA 1STEA 3TDQA 3A7AB 3EQLC 1JCKB 2K01A 1NAPA 1TY2A 3VR2A 1LTBD 2F0TA 4P2CB 2F0KA 2XNAC 1JE4A 4DAYA 2PO4A 3NTKA 4XT1B 1BCPB 1B44D 1HCZA 3DEPA 2A6ED 4EVOA 1LTSD 3J7AV 5JEAG 3S1MB 1D5ZC 3VYUA 5M3MB 2F03A 5FO9B 1FGBD 3W3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TR5 A;  1EY9 A;  5CV7 A;  3NXW A;  3V2T A;  4WOR A;  3T16 A;  4F7X A;  5I6W A;  5ISR A;  4K5V A;  3D4D A;  4KJN A;  5E1F A;  2RDF A;  3NP8 A;  2F0G A;  1SYC A;  2F0E A;  4EQP A;  3C1E A;  4DFA A;  4N9T A;  4PNY A;  2OEO A;  5I9P A;  4NP5 A;  2O4X A;  2EY6 A;  5J39 A;  4K5W A;  2F0U A;  1STN A;  4HMI A;  5DEH A;  5IIF A;  5CC4 A;  3TME A;  3SHL A;  1RKN A;  3BDL A;  1EQV A;  2EY5 A;  2EYP A;  4KD4 A;  3D8G A;  4K2K A;  4KY6 A;  5E3F A;  5I6Y A;  1JOR A;  2EYH A;  3SK8 A;  1A3U A;  1EYA A;  2F0M A;  1SYB A;  3TP8 A;  2SNS A;  2EYF A;  1A2U A;  1KDC A;  4ZQ3 A;  3TP7 A;  5IGB A;  1ENC A;  2PYK A;  1A3T A;  3MXP A;  3ITP A;  3OSO A;  1STH A;  2F0N A;  2EXZ A;  4OL7 A;  3NUC A;  4DF7 A;  5IOC A;  3MHB A;  3S9W A;  1SYE A;  4NKL A;  4YIJ A;  4QF4 A;  2F0I A;  1EZ8 A;  3ERQ A;  4I65 A;  5C3W A;  1EYC A;  1SNM A;  1STY A;  1F2Z A;  4J6H A;  2M00 A;  5IGG A;  5M9O A;  2EYL A;  2F0L A;  3QOJ A;  3D4W A;  5C5M A;  3SK6 A;  1EY6 A;  1KDA A;  1JOO A;  4PMC A;  2F0J A;  4S3S A;  4K8I A;  1JOK A;  4HMJ A;  5CV6 A;  3C1F A;  3D6C A;  3U9O A;  2EY2 A;  3HZX A;  1EZ6 A;  3NHH A;  2OF1 A;  4K2L A;  2F0S A;  4K14 A;  2PZU A;  4TRD A;  5EKL A;  4KV6 A;  3MEH A;  4PMB A;  4DGZ A;  3BDC A;  1A2T A;  2F0D A;  2F0W A;  1SNO A;  1SNP A;  1STA A;  1KDB A;  2ENB A;  2SOB A;  3EVQ A;  4ME5 A;  2PW7 A;  4KHV A;  2SNM A;  4ID6 A;  4N9P A;  1EY7 A;  4RKL A;  5IOD A;  4E6I A;  5KRU A;  4IUN A;  5IGC A;  3OMG A;  4K5X A;  1NSN S;  1NUC A;  5CV9 A;  1STG A;  2HQE A;  3SXH A;  3H6M A;  5EGT A;  4F8M A;  3QB3 A;  5JOB A;  2F3W A;  1U9R A;  2QDB A;  5J1Z A;  2LKV A;  3T13 A;  3EJI A;  5IGE A;  4MIU A;  3SK4 A;  4HTH A;  1SYD A;  1TT2 A;  3QOL A;  2EYO A;  4KTA A;  4EQN A;  2F0F A;  5KEE A;  4G57 A;  4K8J A;  3TP5 A;  5J22 A;  2NUC A;  4R8N A;  4WRD A;  5IGF A;  2F0Q A;  2WAC A;  5HGT A;  3MVV A;  4ZUJ A;  1EYD A;  2F0O A;  5C6A A;  3MZ5 A;  5CV5 A;  3VA5 A;  1IHZ A;  2PZT A;  5KGU A;  2EYM A;  1SND A;  1KAA A;  4NMZ A;  1EY8 A;  3RUZ A;  5CR3 A;  4DU9 A;  1AEX A;  5JAV A;  5CV4 A;  4NDX A;  4RKB A;  3TP6 A;  1II3 A;  3OWF A;  1KAB A;  2KHS A;  3P75 A;  5C5L A;  3DMU A;  3DHQ A;  3HEJ A;  1F2Y A;  4B9X A;  4QMG A;  5NUC A;  1STB A;  4EQO A;  2F0T A;  5KYL A;  3SR1 A;  2F3V A;  2OXP A;  3PMF A;  5IGD A;  1EY0 A;  1SYF A;  1EY4 A;  2F0V A;  5DAU A;  5C3X A;  2F0K A;  5C4H A;  5CV8 A;  5HUR A;  1ENA A;  1F2M A;  5KYI A;  3OMC A;  4H7B A;  2KQ3 A;  1SNC A;  3E5S A;  4LAA A;  2RBM A;  5EKK A;  3LX0 A;  5CGK A;  1A3V A;  5K5P A;  5KIX A;  1EY5 A;  3R3O A;  4IZ8 A;  2PZW A;  4K6D A;  4QB4 A;  3NK9 A;  4KJO A;  4B9W A;  4EVO A;  4J1M A;  1JOQ A;  2PW5 A;  4KY5 A;  3NQT A;  3SK5 A;  2EY1 A;  5F2D A;  1SNQ A;  2RKS A;  1TQO A;  2EYJ A;  5I9O A;  3ERO A;  4KY7 A;  4ZUI A;  1SYG A;  5C4Z A;  2PQE A;  4ODG A;  2F0P A;  3P1H A;  2F0H A;  4KD3 A;  4IAL A; 
#chains in the Genus database with same CATH topology
 4RMF A;  5CBA E;  1HNZ Q;  3KBG A;  1A6X A;  4DR2 Q;  5JJZ A;  5IIF A;  1I94 L;  3KBX A;  3TME A;  3F2U A;  3KFU A;  1NR4 A;  2ICI A;  2Z1C A;  4K2K A;  2C5C A;  1EFI D;  1V1P A;  1JOR A;  1A3U A;  3GQB A;  2F0M A;  2EYF A;  4O2D A;  2E2J H;  1TKW B;  4WJ3 M;  5IP7 H;  4KK7 A;  3ITP A;  3BYT B;  4IPH A;  3I4N H;  1SYE A;  1YZ6 A;  3CD6 A;  2BDO A;  2IT1 A;  1IW7 D;  2B2V C;  3LWE A;  3NSW A;  2EE1 A;  2R93 B;  1K83 B;  2WB1 B;  4WJW A;  3JAM c;  3R2T A;  4AIM A;  3GV6 A;  1BBX C;  5CV6 A;  1JWS D;  3LWU A;  2PMZ E;  4BBR B;  4K14 A;  2PZU A;  2JA6 G;  2E2D C;  1IBL L;  3ND9 A;  4DV4 L;  5C4X H;  1KDB A;  1LTA D;  3K5O A;  1A62 A;  1WJJ A;  3IFD A;  2E2I H;  1SXT A;  5TSS A;  5JJL A;  2RHS B;  5CV9 A;  1HH2 P;  5JOB A;  1I6H B;  4FF2 A;  3F2D A;  1HA6 A;  3ND8 A;  3OYY A;  4P74 A;  4UP9 A;  4CKB A;  1B1Z A;  4G7H C;  4MIU A;  4GKJ L;  2IL8 A;  2L9H A;  4FDB A;  3CCU A;  3PIP A;  2QEJ C;  2AUK A;  5KEE A;  4R8N A;  1Q1E A;  1ILQ A;  3MVV A;  1KXL A;  4DUY L;  3F1Z A;  4LF4 L;  1QCB D;  4ZLT F;  4FXD A;  1G6P A;  4A3L G;  1EYG A;  3OWF A;  3DHQ A;  3BU2 A;  4QMG A;  3MXN A;  1AZP A;  5KYL A;  1N33 L;  5DAU A;  2B39 A;  1ASY A;  3L0O A;  2B8F A;  5I2Y A;  1YIT A;  4BBS H;  2KQ3 A;  4OHJ A;  2VZA A;  4X64 Q;  1IKL A;  2FJ2 A;  5CGK A;  1F77 A;  4RAU C;  1S3O A;  4HJA A;  2D2C C;  2JSO A;  5ELE A;  4BS9 A;  2UUA L;  2WIN B;  4R8I A;  2CCZ A;  5I9O A;  2RSO A;  4KY7 A;  4GZY C;  4ZUI A;  3I70 A;  3RMH A;  1EIF A;  2RCF A;  3T1H Q;  3KOJ A;  4UP8 A;  3W3A A;  3OWE B;  3NXW A;  4DV6 L;  3QG1 A;  5E1F A;  2FFK B;  1SYC A;  2YTX A;  4EQP A;  4CBV A;  4CGY B;  2B2T A;  1TWG H;  3RLO A;  2NN6 G;  2F0U A;  2P5Z X;  3ONA B;  1SEB D;  1NTG A;  1RKN A;  4ZYS A;  1WYD A;  1EQV A;  2EY5 A;  4HCS A;  4Q5V A;  1X3P A;  4KN4 C;  2K14 A;  2NVY B;  3PO2 G;  1EOT A;  3T56 B;  1I94 Q;  5JEA H;  4PZ8 A;  1JR0 D;  4YWK A;  1I4G A;  4YHH L;  1A8V A;  2PYK A;  3OSO A;  2F0N A;  1BBU A;  1T9H A;  2EXZ A;  1TU2 B;  2F1M A;  4OGQ C;  4DF7 A;  1WD0 A;  1D8L A;  1L1O A;  4QF4 A;  2Z4H A;  2D5D A;  3U9S A;  2PNR C;  3MC0 B;  1EYC A;  5C3W A;  2Q2I A;  4J6H A;  3D4W A;  2Y0S G;  1TWA B;  2XGT A;  2WKD A;  1VQM A;  1ZXT A;  4CJ2 C;  1G2T A;  1C7Y A;  3S2D H;  1CUK A;  2B63 H;  2JA8 H;  1I3Q H;  1ZKO A;  3K58 A;  1I4P A;  2L0C A;  3OOC A;  1GUG A;  4IOA A;  3S1Q H;  3LGJ A;  4PZ7 A;  1NSN S;  2R92 B;  1IBL Q;  1KLU D;  1U9R A;  2AQ3 B;  2QDB A;  4DAV A;  1P16 A;  5IGE A;  2EYO A;  4BY7 H;  1PYW D;  1KQS A;  2LXK A;  4ALP A;  3I73 A;  4GKJ Q;  4X66 Q;  3C2P A;  1W6J A;  4A3E G;  3EA6 A;  4TVA B;  2KHS A;  4DUY Q;  4LF4 Q;  2ICE C;  1VQO A;  3HOY G;  4QY7 A;  1Q81 C;  2OTL A;  2JEA I;  3HOV H;  3SGI A;  2UU9 Q;  1GHK A;  2CQA A;  2KEC A;  3LX0 A;  4B3T Q;  4Y7N H;  1N33 Q;  5EPL A;  4IZ8 A;  2DNE A;  1EQT A;  1CKN B;  2PW5 A;  4X3S A;  5F2D A;  1SNQ A;  1VQA A;  2DY8 A;  2K32 A;  1PRT C;  1MD2 D;  2Z0S A;  3HOW B;  4A3B H;  5LHY 1;  2K03 A;  3GTQ B;  5IE8 A;  1WCM G;  1NY4 A;  2VNU D;  3CCJ A;  3GO5 A;  1GUO A;  3X3N A;  5ISR A;  3EBE A;  4IPG A;  4UAI A;  3HKZ B;  3K59 A;  1PV4 A;  1SE3 A;  2PCF B;  5DEH A;  4DV6 Q;  1SRO A;  4LUZ A;  3SHL A;  1UWV A;  4M1U B;  2SNS A;  2JA6 B;  2JYO A;  5IYD H;  4JBM A;  1XPO A;  4K6L A;  2M2L A;  2F52 A;  1QUQ A;  4JI2 Q;  4N8F A;  2MNA A;  4R4O A;  2VW9 A;  3S1N B;  3R93 A;  1L1O C;  3HGB A;  1DOK A;  2A6E C;  2XIW A;  2UXD Q;  3HKS A;  2WAQ E;  3NPP A;  3SK6 A;  1FNU A;  2GVB A;  3RLN A;  1FYC A;  2K50 A;  3DM3 A;  4EQ5 A;  2R7Z B;  1IBK Q;  3CC2 A;  4DV5 L;  3FKI B;  2ZTD A;  3H0G H;  4IPC A;  3FEW X;  3H09 A;  3I55 A;  1MGS A;  5K5P A;  1SNP A;  1B4O A;  1L2F A;  2K75 A;  2PW7 A;  4JBW A;  4DR3 L;  4A3G H;  1FD7 D;  1LTI D;  1HZ9 A;  4DK1 A;  2K5Q A;  3G6J B;  4V0B A;  1VMC A;  1A0I A;  5FJ8 G;  3BG3 A;  1OO9 B;  4RGT A;  2VB3 X;  3G48 A;  4JCV E;  1V8Q A;  2CHB D;  5J22 A;  1LLR D;  3S17 H;  1Q8I A;  5E7N A;  3J80 i;  2KUM A;  1Q3L A;  1JIC A;  1QB5 D;  4GLX A;  1IW7 C;  4APV A;  2RCN A;  3RUZ A;  3TS2 A;  1Q90 A;  1XNQ L;  1EQR A;  4A3I G;  2R3Z A;  3GTO H;  4JPB W;  1PRT F;  5BN4 A;  4LF9 Q;  2VQF L;  2F3I A;  3M3Y B;  5K36 H;  3KLS A;  1B53 A;  3WOF A;  1SNC A;  2O5J C;  3NTI A;  2PZW A;  3NK9 A;  4A3J H;  1H9M A;  2Q8T A;  4A93 H;  1N32 Q;  2F4I A;  2JA5 B;  4C1N K;  3E6Z X;  1OXU A;  1SBB B;  2F0P A;  4POG A;  4IAL A;  1EY9 A;  5C3E G;  1E22 A;  1BKB A;  2RF4 A;  4X65 L;  1Y1W B;  4K5V A;  2KBN A;  3FMC A;  1V1Q A;  2ES2 A;  5C0X J;  1E1O A;  1TWH H;  3D6W A;  1DZ1 A;  3U4Z A;  2EZV A;  2NVT H;  4DV2 L;  1B2T A;  4DNR B;  1X3G A;  3FHW A;  1B9N A;  1IKM A;  4AYB B;  4KKU A;  5IGB A;  4TSS A;  3I4M B;  1WCM H;  1CZW A;  4C3I B;  4LFB L;  1RL2 A;  5ELO A;  1PH5 A;  4IPD A;  4QJF A;  3HG9 A;  1F9Q A;  3CKI B;  3LNN A;  3J80 c;  4OX9 L;  4IOC A;  1Z47 A;  5A35 A;  1MJC A;  3A56 A;  1KAW A;  4A3F B;  3M4P A;  1GJX A;  1MBY A;  2DNC A;  4BWG B;  3UDI A;  2E2H B;  3U9O A;  3NEM A;  4IFD H;  3A74 A;  4JI7 Q;  4KV6 A;  2EJM A;  1AE2 A;  1VQJ A;  3G7L A;  3M4O B;  3BDC A;  2ZXO A;  4OXP A;  5M3M G;  4A3K G;  1Q7Y C;  4JI0 L;  3GTM B;  4DR7 L;  3EVQ A;  4A3E B;  4DV5 Q;  5KRU A;  2VQE Q;  3BZD B;  2X6L A;  4R1J A;  2HQE A;  4YCU A;  3HOU B;  5EGT A;  3ICE A;  5J1Z A;  1KNE A;  4DR3 Q;  5IWA L;  3HOY B;  3S1R B;  3PSI A;  2WII B;  4R4I A;  1AFP A;  2ZTC A;  3J81 L;  2NUC A;  4TKO B;  2G5D A;  2Z4I A;  5L37 A;  3BVZ A;  1K3R A;  3V96 A;  4KN7 C;  3G6E A;  4BY1 B;  3BYY B;  4JG2 A;  2RDG A;  4NXM L;  4YY3 L;  1SAP A;  1O7Y A;  1II3 A;  1HZB A;  3HKZ E;  3I4O A;  4B9X A;  3RN5 A;  1LV9 A;  1YJ9 A;  4JI4 L;  1G6Z A;  1WOC A;  3GTK H;  3PMF A;  2OWO A;  4PQX A;  2F0V A;  5LMN Q;  1HR0 Q;  2R93 G;  5FJ8 H;  2ZXR A;  5KYI A;  2WB1 G;  4H7B A;  3NEN A;  1PA6 A;  3JAM E;  1XNQ Q;  1B3Q A;  3E5S A;  3J7Y W;  1ILP A;  1YNJ D;  1A3V A;  1V9P A;  2VQF Q;  1PTO H;  2R6G A;  4QB4 A;  1RHP A;  2WFW A;  2AMC B;  4FNF A;  1S40 A;  1AZQ A;  3W5O A;  3C3L A;  3S16 H;  1PFS A;  3KF6 A;  1WI5 A;  1LT4 D;  2FMM A;  2VL6 A;  1Q46 A;  1XPU A;  4A3I H;  1H9S B;  1PHJ A;  5FLX E;  1I4H A;  4PNY A;  4C56 C;  3Q0A A;  3L9A X;  4K5W A;  1F2L A;  1VQP A;  4CDC C;  1XXG A;  2NVX B;  4XQQ A;  5KNB A;  1DOL A;  1HHV A;  2NVQ B;  1K0R A;  2TMP A;  4NB3 A;  3VYR A;  2L5T A;  3W1B A;  1L0X B;  1VMP A;  3W2D A;  4RCN A;  1RD9 D;  2EJG C;  3CCS A;  2N88 A;  2BCO A;  3JC6 6;  3K7U C;  4I65 A;  1NBW A;  5FLM G;  2I5H A;  3UE1 A;  1N34 L;  4LFB Q;  3VDY A;  4JI3 L;  1JOO A;  4S3S A;  2L4N A;  1JOK A;  1EEI D;  2K33 A;  3RR5 A;  4OX9 Q;  4HJ5 A;  1M1K C;  2NWG A;  1UEB A;  2NZ1 D;  3NHH A;  3JAM L;  4DXF A;  2KA7 A;  3M85 A;  3MEH A;  5LMN W;  3Q22 A;  1HR0 W;  1RF2 D;  2ENB A;  3N52 A;  1D7Q A;  3I7F A;  2G9D A;  3KUP A;  5D3I B;  2HDL A;  4JI0 Q;  3CCQ A;  4IFD I;  2KVM A;  4MZ9 A;  5M5W B;  4DR6 Q;  1CT1 D;  1PZK D;  1BDO A;  1SE2 A;  5FLX L;  2Z6K C;  2AQ2 B;  3AFP A;  4RFB A;  3TQY A;  5IWA Q;  4QUF A;  3WWV A;  1B7Y B;  4POF A;  2B2U C;  4JI1 Q;  1HNX Q;  1EYD A;  1UNS A;  3S1M H;  3OPO A;  2VY3 A;  5KGU A;  1GUT A;  5M3M H;  1CK1 A;  2E74 C;  5C44 B;  5JAV A;  3L3O C;  1VS0 A;  4ZRZ A;  3PUY A;  1LT3 D;  5C0X H;  5C3E B;  4DAM A;  4NXM Q;  4YY3 Q;  1QJO A;  3KDF B;  1HZA A;  1QVF A;  4JI4 Q;  1EWC A;  3GTP B;  3NWT A;  1EIG A;  1EY5 A;  4RGO S;  4KI0 A;  4AYB E;  1SR3 A;  3BZK A;  4KY5 A;  5ELF A;  1VQK A;  4DK3 C;  2MHV A;  2DY7 A;  2FIN B;  1U4P A;  5C4Z A;  2MPM A;  3NTH A;  4EQN A;  2EDG A;  1JJG A;  1XPR A;  1D2B A;  2RVL A;  1PH3 A;  2UUC L;  1YIJ A;  2YYZ A;  1IXR A;  4Z9C B;  1KD1 C;  4KLK A;  1BNZ A;  2R93 H;  5I9P A;  2EY6 A;  3M7N A;  4KY6 A;  4OIK A;  2ZJR A;  3GTL B;  5IYB G;  3Q24 A;  4KKS A;  3CQZ B;  1EYA A;  4BBR H;  4QGU A;  3CMA A;  1HRJ A;  3NBH B;  2QEX A;  5FO7 B;  1R9T B;  3K7A B;  3TP7 A;  4A3K B;  4PMW A;  1JJC B;  1ET6 A;  4ZKC B;  4QQB X;  4PZ6 A;  3K5M A;  4OL7 A;  1CKN A;  1VQF A;  4QIW E;  1S5D D;  4NKL A;  2R61 A;  2MGS A;  2HCC A;  1R4Q B;  1I6H H;  1DOM A;  1TS2 A;  1IZ6 A;  2ZT9 C;  2F0J A;  2R7D A;  1VF5 C;  2EY2 A;  2B29 A;  1XMQ L;  1LUZ A;  1QIL A;  3GP7 A;  3HOW G;  1O7Z A;  3A0J A;  2H1E A;  1I5F A;  3D0F A;  2CFM A;  5IGC A;  1EU4 A;  1P8L A;  3OMG A;  4F88 A;  1MI2 A;  1SFO B;  4G7O C;  1BXT A;  1ICW A;  4AQY L;  3HKZ G;  4DV7 L;  5FLM H;  1X55 A;  2O2L D;  4DNI A;  3NEL A;  2K5N A;  3TEH B;  3CW2 C;  1KLG D;  3GTJ B;  3FRP B;  1YHQ A;  3L2P A;  1VQL A;  5C6A A;  5CV5 A;  1IHZ A;  2PZT A;  1NMF A;  2QKI C;  3T1Y L;  2DJG C;  4DU9 A;  4JI5 Q;  1Y1V B;  1PDQ A;  1MSG A;  1CI3 M;  2BH8 A;  3ER0 A;  2AKW B;  1O7I A;  1RCV D;  2F3V A;  4LFC L;  4NPS A;  1H9K A;  3KYH C;  1F9R A;  1G8Z D;  1DXM A;  2R7Z G;  2K28 A;  1TWF B;  2WAQ B;  1A63 A;  3PO3 B;  3X3M A;  4B9W A;  4MTN A;  2QF7 A;  3FKI G;  2NVY H;  5C0X I;  3K80 C;  4A4I A;  1AN8 A;  1TQO A;  5LL6 X;  4DR4 L;  4UPA A;  3K5N A;  2JEB I;  5IYC H;  1GUN A;  1Q12 A;  3BS1 A;  1SJE D;  3E0E A;  4LF5 Q;  2DN8 A;  2LFN A;  4RHS A;  2KJX A;  4ZUJ A;  2D62 A;  4DK6 C;  4IO9 A;  2JXM B;  2CKZ B;  4OO1 G;  3B6Y A;  3E3X A;  1UEA B;  2QDL A;  2UUC Q;  2ASB A;  1TWA H;  4HJ7 A;  2MQH A;  3U50 C;  4QCL A;  1OXT A;  2PI2 E;  1CTM A;  3CRK C;  3SDZ A;  3FVQ A;  1A2U A;  2UXD L;  3OW2 A;  1UE6 A;  5H1S E;  1LT6 D;  2GN5 A;  3S9W A;  4YIJ A;  5T1G A;  1YNJ C;  4GNX A;  1BVS A;  5GAE C;  2R92 H;  1SMY D;  4CHT B;  1PH9 A;  1FL0 A;  5C5M A;  1PTO D;  2OQK A;  3DM1 A;  2E8G A;  4IJH A;  3CXC A;  3A7L A;  3D6C A;  4X3K A;  2LSS A;  4JYA L;  1VQ7 A;  2F0W A;  5IOD A;  2JA5 G;  4KHV A;  1FVI A;  4LK1 C;  3HOX G;  1I50 B;  1XMQ Q;  4A3C G;  3CCL A;  2K52 A;  2XWB B;  1Y1W G;  3NE5 B;  2F3W A;  2QA4 A;  1SMX A;  1ASZ A;  5GAH C;  1NE3 A;  2EPB A;  1RDP D;  2ID0 A;  2N3S A;  4DAP A;  2ATW A;  4DV7 Q;  1G2S A;  1VQG A;  5HGT A;  1Y8P B;  3KF8 B;  3M7G A;  1JWU D;  1EUJ A;  4AYB G;  4NMZ A;  1KAA A;  1AEX A;  4HJ8 A;  5CV4 A;  1Z7T A;  3GTQ H;  4FXG C;  3I4M G;  4LJZ C;  4C3I G;  1KAB A;  2PQA B;  3P75 A;  1WTR A;  4BXX G;  3HP3 A;  4KKT A;  2A69 D;  3F2B A;  2KOL A;  4DV4 Q;  1C4Q A;  1JE5 A;  1Q8K A;  1X3E A;  3J80 E;  4DKA C;  2HD3 A;  1PH8 A;  4A3F G;  1LTT D;  4IUQ A;  3I56 A;  2K5H A;  4DV1 L;  1PXU A;  4LFC Q;  3IKJ A;  2V1C C;  1HJP A;  1Y8N B;  3NQT A;  2EY1 A;  4A75 A;  1WTV A;  2E76 C;  2J4X A;  5JJK A;  2JA6 H;  1SYG A;  2UXC L;  3HOZ B;  1IL2 A;  1E1T A;  1NMG A;  2OCE A;  4DR1 L;  1Y69 U;  1NJI C;  4WOR A;  3KLS X;  5EBC A;  3ERS X;  3HOU G;  3S1N H;  1BCP D;  2O4X A;  1STN A;  1LO5 D;  2XRQ D;  3CU7 A;  1I4Q A;  1CA5 A;  3S2H H;  3GV3 A;  1U4L A;  1RIP A;  4M8A A;  4ZQ3 A;  4L6T B;  4BY1 G;  2QIL A;  5BR8 L;  4LUV A;  4A3L H;  2L12 A;  2UUA Q;  1PYS B;  1I6V C;  1U4M A;  1EZ8 A;  4TQU S;  1DON A;  4XQJ A;  4A3D G;  4GNX C;  4P75 A;  1BO0 A;  2DJF C;  2PPB C;  3I8Z A;  2BOS A;  3RN2 A;  2B2T C;  1EY6 A;  2VUM B;  4HCE A;  4HMJ A;  3C1F A;  1MKH A;  1VQH A;  3J80 L;  3CC4 A;  2L11 A;  5AJ3 L;  4L5T A;  4K2L A;  2VXW A;  1A2T A;  5M5X B;  3CP0 A;  1M4V A;  2Q8R E;  4JYA Q;  1SE8 A;  3PUX A;  3PIO 3;  4YHH Q;  5DM6 3;  1FJG L;  4O42 A;  1V1P B;  3BVM A;  3K0X A;  3M3Y H;  4ZCK A;  3SK4 A;  3W1G A;  1KIX A;  2F4V L;  1SYD A;  1GKH A;  2NN6 H;  2F0F A;  1S72 A;  4GLV B;  1FGU A;  1OXV A;  5KNC A;  1OTC A;  2KCM A;  3PO2 H;  1AW7 A;  3RD4 A;  1H95 A;  4GOP A;  2N8N A;  3AQQ A;  4RGN A;  5CR3 A;  2JJQ A;  2JA5 H;  1TXY A;  5M3F B;  5C5L A;  4ILW A;  3DMU A;  3UI2 A;  3SR1 A;  1Y1W H;  1LYL A;  3AMU A;  4JW0 A;  2C35 B;  4MHE A;  1DM0 B;  2HIV A;  3I2Z A;  4KMU C;  1VQE A;  4JI8 L;  1JOQ A;  4L5Q A;  1RJT A;  4A3B B;  3H3V H;  1E24 A;  4HN7 A;  2KEE A;  1M8A A;  1NCV A;  4DV1 Q;  2IPK D;  3RZO B;  1WTP A;  4LWC A;  3STB D;  4RWS C;  3T53 B;  5IT9 c;  3I4M H;  4BXX H;  3MWY W;  3PGZ A;  4EGV A;  4A76 A;  2HHH L;  2D9U A;  3K0Y A;  2OQ0 A;  1KHI A;  2UXC Q;  4N9T A;  4DUZ L;  4DR1 Q;  2UXB L;  3D3R A;  4A3F H;  3S14 B;  5CC4 A;  3QO2 A;  1HNW L;  4JVZ A;  1MIU A;  4FVM A;  2E75 C;  2EYP A;  3DEO A;  3OW7 A;  4KD4 A;  1HPC A;  2IJ0 A;  2KHI A;  2B2W A;  2EQS A;  3DWA A;  2JA9 A;  4LF6 L;  3MXN B;  4XXE A;  1PH7 A;  1O7L A;  3GTM H;  1K8O A;  5C44 G;  3VYS A;  4A3E H;  4HIM A;  3HOX B;  3DWQ A;  2IX1 A;  3CPF A;  1JT8 A;  3FP9 A;  1G51 A;  3HOU H;  5BR8 Q;  4K0K L;  1PRT B;  1XX8 A;  1K9M C;  2I5M X;  3HOY H;  1PFB A;  3VA7 A;  3S1R H;  1NNX A;  2GA4 B;  1K73 C;  2IX0 A;  5COR A;  3K81 C;  2MJ8 A;  4JI6 L;  4Y52 H;  1X32 A;  3OHX C;  1SJH D;  4XYO A;  2YV5 A;  3P20 A;  1EY7 A;  3NBH A;  1NUC A;  4UY8 C;  1EIH A;  4A3M B;  2I5L X;  3SVM A;  1XYI A;  1C9O A;  1XNR L;  4JBK A;  2A73 B;  3CAM A;  5ELC A;  2VS1 A;  1TT2 A;  2N49 A;  3QOL A;  1FJG Q;  4KTA A;  1TS4 A;  3IFT A;  5D14 A;  3TBI B;  3ULJ A;  1CHP D;  1CQV A;  3PUW A;  4QL5 A;  2K6A A;  2BA0 A;  1L1O B;  3TZU A;  1SMY C;  4L5S A;  4C2M B;  1EY8 A;  4GOP C;  3GTG B;  4NDX A;  1PTO C;  4C3J B;  2NN6 I;  1STB A;  1ZEQ X;  2OXP A;  4QIW B;  5IGD A;  2A5H A;  1VQ6 A;  2Q2U A;  5CV8 A;  1ENA A;  1CZG A;  1YJN A;  4JBJ A;  1QE6 A;  1CSQ A;  5EKK A;  1EQQ A;  1PH4 A;  4A3J B;  4KJO A;  2ZJP A;  2JA7 G;  4J1M A;  1VQ5 A;  2NVQ H;  1KRT A;  1Z9F A;  4JI8 Q;  1CKO A;  3TP6 A;  3N6R A;  4F7X A;  2ALY B;  3D4D A;  4A3D B;  1HXY D;  4C3H B;  1KTK A;  4OWW B;  4DFA A;  2B2Y A;  4NP5 A;  4LW1 A;  1JB3 A;  3H3V I;  2NB0 A;  2HHH Q;  5LL6 S;  2I0Q A;  3PV0 A;  3ZJY C;  4R9W A;  2UXB Q;  3PUV A;  1UAP A;  1MSH A;  3WDN A;  2A69 C;  3RNU A;  2CH4 A;  4QUC A;  2IY5 B;  3TSS A;  1Y1V G;  2QW7 A;  3D4R A;  1PH1 A;  3C46 A;  2K5W A;  3NQI A;  4KHP L;  4YCV A;  2M00 A;  5DM7 3;  4L8J A;  2JQO A;  4HID A;  1E0B A;  3PIP 3;  1GOZ A;  4UHV A;  5M5W H;  3A8I E;  4X65 Q;  3QR8 A;  5BN5 A;  2WAQ G;  1EEF D;  1PH6 A;  4K0K Q;  3KK7 A;  4XTC S;  3PO3 G;  1B70 B;  2KED A;  1DCZ A;  4TRD A;  5I2X A;  4JC0 A;  4WFN 3;  1T5E A;  4DV2 Q;  5J39 A;  4UP7 A;  1BCP C;  4RKL A;  1LTL A;  5JPM C;  5C44 H;  2FMC A;  2K05 A;  4IUN A;  1V1O A;  1PFN A;  5C3E H;  1VF7 A;  2KCT A;  4OWX B;  1BUV T;  2LKV A;  3T13 A;  3IAY A;  1PTO F;  1EL0 A;  3GTP H;  1CQF A;  1YJW A;  1QUQ B;  5J3B A;  1AE3 A;  4ABN A;  2AWO A;  2BE5 D;  1W3S A;  4DR2 L;  4LF8 L;  4I7Z C;  3CME A;  4GN3 B;  4HJ9 A;  1TY0 A;  5NUC A;  1EU3 A;  4EQO A;  5EBD A;  5DLQ E;  4G7Z C;  4DR7 Q;  1RTO A;  4OON A;  3MAQ A;  4OIJ A;  2Z8L A;  1UUP A;  3V05 A;  2CH4 W;  3S15 B;  3FPP A;  1WTH A;  3DWP A;  3MA2 B;  1J5E L;  3A5U A;  1QNK A;  3GTL H;  2RHQ B;  1A15 A;  2CVR A;  5GAD C;  5C4X G;  2UUB L;  3T4A C;  2M9V A;  3L7Z C;  1R9T H;  3K7A H;  4A3K H;  4ODG A;  1ESF A;  3P1H A;  1K28 A;  3KF8 A;  3V2T A;  3T16 A;  1EWH A;  2NZO A;  4KJN A;  1HA5 A;  2F0G A;  2FHT A;  1C8C A;  4H02 A;  2PQA A;  2O5I C;  2MO1 A;  4DNT B;  4MTK A;  1JMC A;  1QNU A;  3F2C A;  1VQ4 A;  4F87 A;  3D8G A;  2JP1 A;  1B9M A;  3TP8 A;  3I72 A;  4GKK L;  5EAY A;  2QGQ A;  3UDF A;  1GVP A;  4OEL B;  1LM0 A;  2L55 A;  2LS0 1;  3FDT A;  2OT2 A;  2JK8 A;  2WP8 J;  2Y0S E;  3E9H A;  4H44 C;  3OIP A;  3J81 c;  4O1N A;  4BBS G;  4FYD A;  2F0L A;  1BCP F;  1LAC A;  1J9O A;  1S5B D;  1K83 H;  1GM5 A;  4KHP Q;  2K1B A;  4IN3 A;  2YTY A;  3STB C;  3GTJ H;  3RZD B;  4PMB A;  2NZH A;  4N8X 1;  3J7A F;  2HUG A;  2SOB A;  1STA A;  1E2W A;  1FR3 A;  3NWS A;  1KNA A;  3HOZ G;  3PCO B;  2ZTE A;  1D6E C;  1VQC A;  1STG A;  3AFQ A;  1F9P A;  2AHO B;  4O0A A;  1TWC B;  3J81 j;  2XRS D;  4ZKB B;  3AYH B;  3CCM A;  4UDU C;  4OWT B;  3U58 A;  1TWF H;  3I90 A;  3PO3 H;  1N34 Q;  2WAC A;  2JA7 B;  1EIY B;  1E7Z A;  4JI3 Q;  3MFG A;  2G9H D;  1SND A;  2EYM A;  4RCO A;  4HR7 B;  5M5Y B;  1I4X A;  1QVC A;  1J6Q A;  1HTP A;  1ET9 A;  3GDE A;  3QIA A;  2ZXP A;  2CWP A;  1PLF A;  1EY0 A;  4H0L C;  4LF8 Q;  5EKI A;  4FP5 D;  1F2M A;  3MXU A;  3OMC A;  1U0L A;  1WVL A;  1TS3 A;  4H13 C;  1ML0 D;  1VDZ A;  2NYZ D;  3EFX D;  2VUM G;  2D0O A;  2HT1 A;  2B63 G;  1VQ8 A;  2JA8 G;  4GS3 A;  3UDX A;  2RKS A;  4HED A;  1BOS A;  2IHE A;  5JJI A;  2RSN A;  1VCI A;  1J5E Q;  2J7Z A;  1TR5 A;  4RG1 A;  2UUB Q;  3TN2 A;  3NP8 A;  2LMC B;  5C4J B;  4IQZ A;  3VYT A;  4LFA L;  2DUD A;  3Q8D A;  4ME3 A;  4BY7 G;  2Q2T A;  2K7V A;  1X3F A;  2OTJ A;  1S5C D;  2H5X A;  3BJU A;  4XQN A;  2EYH A;  5JVH 3;  4AH6 A;  4XIG S;  1KL9 A;  2YU9 B;  3M4Y A;  4XYQ A;  1EFW A;  3AEV A;  3PF4 A;  4J15 A;  2BA1 A;  4CDD C;  1PH2 A;  3MHB A;  1I50 H;  5M3F G;  3H91 A;  2F0I A;  2QCP X;  1Q1B A;  4GKK Q;  5FLX c;  1STY A;  5HGQ A;  4IJL A;  5G3L F;  2KHJ A;  1R4P B;  4X66 L;  4CJ1 B;  3QOJ A;  5ELN A;  3NBI A;  3HOV G;  1H9J A;  4JK1 C;  1GO3 E;  1KDA A;  1S5F D;  1V43 A;  4K8I A;  3KF6 B;  4R4C A;  4HAE A;  4WJ4 A;  4A3B G;  1BR9 A;  2E2J B;  1SNO A;  2A68 D;  4CKC A;  4ME5 A;  2SNM A;  5D3D A;  2WKC A;  4CKE A;  4E6I A;  5FO8 B;  2I46 A;  4CJ0 B;  3I4N B;  4K5X A;  2UU9 L;  5IT9 E;  1OXX K;  4B3T L;  4GN5 A;  3QB3 A;  3SE0 A;  4G4K A;  2EJF C;  4IUU A;  1SSO A;  3HFZ B;  1ZYR D;  1TVX A;  2A19 A;  3CHB D;  1IYJ B;  4K8J A;  1J8I A;  4MN3 A;  2V4D A;  1BBW A;  2HQL A;  4GN4 B;  1YEZ A;  4B3S L;  4LNQ A;  4RA8 A;  5IYB H;  3Q23 A;  1VQ9 A;  5IYD G;  5C4X B;  2B8G A;  1YNN D;  2E2I B;  3PUZ A;  3HOZ H;  1HFG A;  1EOV A;  1JC7 A;  4XT3 B;  2SEB D;  1SYF A;  2CW0 D;  5HUR A;  3SEB A;  2B3G A;  2K4K A;  1E3P A;  1FNW A;  4P71 A;  4Q0F A;  4AQY Q;  3H0G G;  2JN4 A;  2MFI A;  4JI2 L;  1YVC A;  3RLF A;  3ERO A;  4A3G G;  3HOW H;  3A8J E;  2F0H A;  1NR2 A;  5CV7 A;  1PZJ D;  3VR6 A;  1XTC D;  3H94 A;  1IBK L;  3T1Y Q;  4A3M G;  1ESR A;  4BBS B;  2XTI A;  4CDE C;  1K0S A;  2OEO A;  1HQM C;  5IT9 L;  1JQY D;  3BDL A;  1PVO A;  2BE5 C;  2VUM H;  3K6O A;  1KC8 C;  5T1I A;  4LFA Q;  2Q8I B;  2LXJ A;  1B3A A;  1ENC A;  5M5X H;  5E4X A;  4FO2 A;  1N8R C;  4C3J G;  1RTN A;  3FPU B;  4DR4 Q;  3BDO A;  4RGM A;  1F2Z A;  4X3T A;  5M9O A;  1TWG B;  5IGG A;  3IRB A;  2EYL A;  5K36 G;  4XDX A;  2C9O A;  5EPJ A;  4JV5 L;  3KJP A;  1X3Q A;  2KEN A;  2HCI A;  1IBM L;  2R7Z H;  1EZ6 A;  4A3J G;  2A6H D;  4RHR A;  2AUJ D;  4RH6 A;  2X69 A;  1JB7 A;  3FKI H;  4A93 G;  4IFD J;  4PV1 C;  4LF9 L;  2H4O A;  4GLA C;  1QVG A;  4NXN L;  1DYQ A;  2AQ1 B;  4X3U A;  4DAY B;  5M3F H;  3H6M A;  4OO1 H;  4C3H G;  1DGS A;  4U68 A;  3CCV A;  1WD1 A;  1ENF A;  1PYB A;  1N32 L;  3S2D B;  3CF5 A;  3UDG A;  5FK9 C;  1H9S A;  2EVB A;  1X65 A;  5IGF A;  1KRS A;  1I3Q B;  2B63 B;  2JA8 B;  1U4R A;  5GQO A;  5GRO A;  5I4D A;  3VA5 A;  2IHF A;  3A8K E;  3D31 A;  4RKB A;  4B3S Q;  3RZO H;  3S1Q B;  1HUN A;  2K5V A;  3HEJ A;  2WB1 E;  3R2I A;  5EQ0 A;  1K3B C;  3H3V C;  1CHQ D;  4EX5 A;  2L1B A;  5JVG 3;  1C48 A;  1EY4 A;  5C3X A;  4J8Q A;  1U5K A;  1D5X C;  2N55 A;  2Q2H A;  1TII D;  4BY7 B;  3DUZ A;  1FNV A;  2XVS A;  3OTO L;  2NTT A;  3MEF A;  3S14 H;  2RBM A;  4IFD G;  1CKM A;  5KIX A;  1PMR A;  3R3O A;  1Y8O B;  2IW3 A;  1IL8 A;  2ZJQ A;  2CQO A;  1CSP A;  4DA2 A;  1SDF A;  2YTV A;  3T51 B;  3VR5 A;  4DR5 L;  3EIV A;  1XWE A;  1M90 C;  1K8G A;  2XWJ B;  2PQE A;  3P7J A;  3HOX H;  1QWY A;  4A3C H;  3J7A 5;  4IUT A;  4BA1 I;  3C1E A;  2PI2 A;  4B08 A;  3ULP A;  2EIF A;  2IX3 A;  3HOV B;  4JI7 L;  3O13 A;  4X6A H;  3EN2 A;  3S2H B;  1K8M A;  4Y7N B;  3AB9 A;  1GD7 A;  2RQX A;  5I6Y A;  5E3F A;  1I4R A;  1ROD A;  2VQE L;  2Z9H A;  3SK8 A;  1WTW A;  1LAB A;  4C1N I;  5CMD A;  1GUS A;  2JE6 I;  3KLR A;  4NW2 A;  1QOH A;  2SDF A;  1D5M C;  5IOC A;  4DV0 L;  1O80 A;  1MJE A;  5FKA C;  4C3I H;  3J7Z C;  3DLL A;  4A3M H;  2NBF A;  5G3L D;  1YNX A;  1SE4 A;  1E2V A;  3QJY A;  5IP9 G;  5HY6 A;  4FXK C;  1LTR D;  2RDH A;  2J0T D;  3KDF A;  2OF1 A;  2E2H H;  4JV5 Q;  4DGZ A;  2F0D A;  1IBM Q;  3GD7 A;  5LMN L;  1HR0 L;  3M4O H;  3MFY A;  4C2M H;  4P73 A;  3GTG H;  4HIK A;  4C3J H;  4DN4 M;  1EWI A;  4ULL A;  3E9I A;  1UE7 A;  1HTL D;  5LMU L;  4NXN Q;  1O78 A;  3EJI A;  2VB2 X;  4X62 L;  1C0A A;  4DV3 L;  3TP5 A;  3H0G B;  3MXG A;  4I7A A;  3PO2 B;  2A74 C;  2K5D A;  1WTX A;  1YHA A;  3MZ5 A;  4GNX B;  3TS0 A;  2BH2 A;  2GVA A;  3HS0 C;  3TZD A;  4A3G B;  4OO1 I;  3ULL A;  4BY1 H;  5AJ3 Q;  1CA6 A;  2AWN A;  2BDN A;  4DK0 A;  5AFW A;  1F2Y A;  3K8A A;  3J81 E;  5IY0 A;  2MP1 A;  3M4Q A;  4A3D H;  4C3H H;  5C4H A;  3G71 A;  1LT5 D;  2Y0S B;  3H15 A;  1LTG D;  3IL8 A;  4MNO A;  1AP0 A;  2A68 C;  1X9N A;  3PF5 A;  5COY A;  3S17 B;  4K6D A;  1T5X D;  4LMQ D;  4B3M L;  3OTO Q;  2EYJ A;  4LF7 L;  2F4V Q;  3MTS A;  1G91 A;  4L5R C;  1W2B A;  1CM9 A;  5A2Q E;  1VQI A;  3G4S A;  1ICF B;  1SRU A;  1ZYR C;  4DR5 Q;  3GTO B;  5I6W A;  2RDF A;  1H9R A;  2F0E A;  4HSV A;  1XMO L;  1UE5 A;  1YNN C;  4DPG A;  2NVX H;  5CYU A;  1S4Z A;  4A93 B;  1KDC A;  3MXP A;  2CW0 C;  1WFQ A;  5C0X G;  3NUC A;  2EOT A;  4DR6 L;  3TRZ A;  1PFM A;  1E2Z A;  1XJV A;  4IUP A;  1W6K A;  1TWH B;  4DV0 Q;  2NVT B;  1N36 L;  2PNH A;  5DNF A;  4JI1 L;  1HNX L;  1QZH A;  2Z6K A;  1IYU A;  4PMC A;  3A55 A;  4YWM A;  2B2U A;  1D1I A;  1G29 1;  3TRE A;  3HZX A;  4DUZ Q;  2F0S A;  3UE0 A;  3PQI A;  5KND A;  3AU7 A;  1BQQ T;  2B2W C;  1IYV A;  2N78 A;  1HNW Q;  1OXS C;  3DXJ C;  1HQR D;  1HZC A;  1L0Y B;  1WCM B;  4N9P A;  3F8T A;  5EPK A;  4LF6 Q;  1CFM A;  3QWN A;  3K5L A;  5A2Q L;  5CBE E;  1DJR D;  5IP9 H;  5D65 A;  2CWA A;  4G57 A;  2XSC A;  3S15 H;  5LMU Q;  2F0Q A;  4BBR G;  4X62 Q;  2L15 A;  3M9B A;  5GAG C;  2PMZ B;  4DV3 Q;  4PG3 A;  4LUO A;  2E5L L;  4V19 0;  4B3R L;  2ZM6 L;  3E0J A;  1Z6H A;  4JI6 Q;  4R4T A;  4FF3 A;  4JOI A;  3PIO A;  3KJO A;  4OEM B;  2A6H C;  1GUW A;  4L63 B;  4LAA A;  3CCE A;  3J81 i;  1XNR Q;  3SK5 A;  1HFN A;  2RA4 A;  1VQN A;  4YCW A;  5JPN C;  5IP7 G;  3OIQ A;  1HNZ L;  3Q6S A;  1X54 A;  2EXD A;  5ELD A;  4FF1 A;  1Y14 B;  4KD3 A;  4B3M Q;  3I4N G;  2KCC A;  5BN3 A;  4LF7 Q;  4IUV A;  3CC7 A;  3GTK B;  3ZYY X;  5E4W C;  1MHW C;  2R7F A;  2TSS A;  3S24 A;  4HMI A;  1QZG A;  2XN9 C;  1X56 A;  4GOP B;  1PTO B;  4CDF C;  1PZI D;  1XMO Q;  3RZD H;  4FF4 A;  1JJ2 A;  1SYB A;  1WTO A;  1VQD A;  3S16 B;  3CQZ H;  2K04 A;  1WTQ A;  4KHZ A;  4HSP A;  1A3T A;  3A54 A;  3I4L A;  4DXG A;  1STH A;  1XTD A;  1S5E D;  1SLJ A;  1QG7 A;  2B2V A;  2DGY A;  2A1A A;  4A3I B;  5ELB A;  3K57 A;  3ERQ A;  1SNM A;  1SN8 A;  3BZC A;  2HIX A;  5EJW A;  1B50 A;  4IUR A;  2HDM A;  3R8B A;  1TWC H;  3U4V A;  2B2Y C;  3I3C A;  4JI5 L;  1YBY A;  3CRL C;  1N36 Q;  3HRZ C;  1GXD C;  4ZK9 B;  4U67 3;  3CPW A;  2I07 B;  2JA7 H;  5EKL A;  3CCR A;  5IYC G;  3URY A;  5FOB B;  1DD2 A;  4YWL A;  1F9S A;  2KCN A;  3BVG A;  4ID6 A;  5JEA J;  1AH9 A;  5M5Y H;  2FXQ A;  2Z6B A;  3VR4 A;  3SXH A;  4F8M A;  1PRT D;  1ONL A;  2X6G A;  1SFO H;  1GHJ A;  2LY7 A;  1X6O A;  3VR3 A;  1HUM A;  2A8V A;  1TS5 A;  3I91 A;  4HTH A;  2D0P A;  1BF4 A;  4LF5 L;  2NTS A;  2MUY A;  4WRD A;  4ZAI A;  1JWM D;  1N9W A;  4HIO A;  3WOE A;  1D1K A;  3A5Z B;  2F0O A;  4BA2 I;  3JAM i;  2WV6 D;  2IWH A;  1STE A;  3TDQ A;  3A7A B;  3EQL C;  1JCK B;  2MO0 A;  2K01 A;  4P72 A;  1YI2 A;  1NAP A;  2R92 G;  1Y1V H;  2E5L Q;  1TY2 A;  3VR2 A;  4X64 L;  1LTB D;  2F0T A;  4B3R Q;  2ZM6 Q;  4JOI C;  4P2C B;  2F0K A;  5C4J H;  2XNA C;  1VQB A;  1JE4 A;  4DAY A;  2PO4 A;  4R4Q A;  3NTK A;  4XT1 B;  1YHB A;  1BCP B;  1B44 D;  1HCZ A;  1Q82 C;  1UE1 A;  3DEP A;  1L0W A;  1K8A C;  2A6E D;  4EVO A;  3T1H L;  1LTS D;  3J7A V;  1B8A A;  5JEA G;  3S1M B;  1D5Z C;  3VYU A;  2YU9 H;  5M3M B;  2F03 A;  5FO9 B;  1Q86 C;  1FGB D;  3KLW A; 
#chains in the Genus database with same CATH homology
 5CBA E;  3KBG A;  1A6X A;  5JJZ A;  5IIF A;  3KBX A;  3TME A;  3F2U A;  1NR4 A;  2ICI A;  2Z1C A;  4K2K A;  2C5C A;  1EFI D;  1V1P A;  1JOR A;  1A3U A;  3GQB A;  2F0M A;  2EYF A;  1TKW B;  4KK7 A;  3ITP A;  3BYT B;  1SYE A;  2BDO A;  2IT1 A;  1IW7 D;  2B2V C;  3LWE A;  3NSW A;  2EE1 A;  2R93 B;  1K83 B;  2WB1 B;  4WJW A;  3R2T A;  3GV6 A;  1BBX C;  5CV6 A;  1JWS D;  3LWU A;  4BBR B;  4K14 A;  2PZU A;  2E2D C;  3ND9 A;  1KDB A;  1LTA D;  3K5O A;  3IFD A;  1SXT A;  5TSS A;  5CV9 A;  5JOB A;  1I6H B;  4FF2 A;  1HA6 A;  3ND8 A;  4CKB A;  1B1Z A;  4G7H C;  4MIU A;  2IL8 A;  2L9H A;  2QEJ C;  2AUK A;  5KEE A;  4R8N A;  1Q1E A;  1ILQ A;  3MVV A;  1QCB D;  4ZLT F;  4FXD A;  3OWF A;  3DHQ A;  4QMG A;  3MXN A;  1AZP A;  5KYL A;  5DAU A;  2B39 A;  2B8F A;  5I2Y A;  2KQ3 A;  4OHJ A;  1IKL A;  2FJ2 A;  5CGK A;  1F77 A;  4RAU C;  2D2C C;  2JSO A;  5ELE A;  4BS9 A;  2WIN B;  4R8I A;  5I9O A;  2RSO A;  4KY7 A;  4GZY C;  4ZUI A;  3I70 A;  3RMH A;  3OWE B;  3NXW A;  3QG1 A;  5E1F A;  2FFK B;  1SYC A;  4EQP A;  4CBV A;  4CGY B;  2B2T A;  2NN6 G;  2F0U A;  3ONA B;  1SEB D;  1RKN A;  4ZYS A;  1EQV A;  2EY5 A;  4HCS A;  4Q5V A;  1X3P A;  4KN4 C;  2NVY B;  1EOT A;  3T56 B;  5JEA H;  1JR0 D;  1I4G A;  2PYK A;  3OSO A;  2F0N A;  4DF7 A;  2EXZ A;  2F1M A;  1TU2 B;  4OGQ C;  1WD0 A;  4QF4 A;  2Z4H A;  2D5D A;  3U9S A;  2PNR C;  3MC0 B;  1EYC A;  5C3W A;  4J6H A;  3D4W A;  1TWA B;  2WKD A;  1ZXT A;  4CJ2 C;  1G2T A;  1ZKO A;  3K58 A;  1I4P A;  2L0C A;  3OOC A;  1GUG A;  1NSN S;  2R92 B;  1KLU D;  1U9R A;  2AQ3 B;  2QDB A;  4DAV A;  5IGE A;  2EYO A;  1PYW D;  3I73 A;  3C2P A;  1W6J A;  3EA6 A;  2KHS A;  2ICE C;  2JEA I;  1GHK A;  2CQA A;  2KEC A;  3LX0 A;  5EPL A;  4IZ8 A;  2DNE A;  1EQT A;  2PW5 A;  4X3S A;  5F2D A;  1SNQ A;  2DY8 A;  2K32 A;  1PRT C;  1MD2 D;  3HOW B;  5LHY 1;  2K03 A;  3GTQ B;  2VNU D;  3GO5 A;  1GUO A;  3X3N A;  5ISR A;  4UAI A;  3HKZ B;  3K59 A;  1SE3 A;  2PCF B;  5DEH A;  3SHL A;  4M1U B;  2SNS A;  2JA6 B;  2JYO A;  4K6L A;  2M2L A;  3S1N B;  3R93 A;  3HGB A;  1DOK A;  2A6E C;  2XIW A;  3NPP A;  3SK6 A;  1FNU A;  2R7Z B;  1FYC A;  3FKI B;  3FEW X;  3H09 A;  1MGS A;  5K5P A;  1SNP A;  1B4O A;  2PW7 A;  4JBW A;  1FD7 D;  1LTI D;  4DK1 A;  2K5Q A;  3G6J B;  4V0B A;  1VMC A;  3BG3 A;  1OO9 B;  4RGT A;  2VB3 X;  1V8Q A;  2CHB D;  5J22 A;  1LLR D;  1Q8I A;  2KUM A;  1Q3L A;  1JIC A;  1QB5 D;  1IW7 C;  3RUZ A;  1Q90 A;  2R3Z A;  1PRT F;  5BN4 A;  3M3Y B;  5K36 H;  3KLS A;  1B53 A;  3WOF A;  1SNC A;  2O5J C;  3NTI A;  2PZW A;  3NK9 A;  1H9M A;  2Q8T A;  2F4I A;  2JA5 B;  4C1N K;  3E6Z X;  1OXU A;  1SBB B;  2F0P A;  4IAL A;  1EY9 A;  1Y1W B;  4K5V A;  3FMC A;  5C0X J;  1DZ1 A;  3D6W A;  2EZV A;  1B2T A;  4DNR B;  1B9N A;  1IKM A;  4AYB B;  4KKU A;  5IGB A;  4TSS A;  3I4M B;  1CZW A;  4C3I B;  3HG9 A;  1F9Q A;  3CKI B;  3LNN A;  1Z47 A;  5A35 A;  3A56 A;  4A3F B;  1GJX A;  1MBY A;  2DNC A;  4BWG B;  2E2H B;  3U9O A;  4IFD H;  4KV6 A;  2EJM A;  3G7L A;  3M4O B;  3BDC A;  2ZXO A;  3GTM B;  3EVQ A;  4A3E B;  5KRU A;  3BZD B;  2X6L A;  2HQE A;  3HOU B;  5EGT A;  5J1Z A;  1KNE A;  3HOY B;  3S1R B;  2WII B;  1AFP A;  3J81 L;  2NUC A;  4TKO B;  2Z4I A;  3BVZ A;  3V96 A;  4KN7 C;  4BY1 B;  3BYY B;  2RDG A;  1SAP A;  1O7Y A;  1II3 A;  4B9X A;  1LV9 A;  1G6Z A;  3PMF A;  4PQX A;  2F0V A;  2ZXR A;  5KYI A;  4H7B A;  3JAM E;  3E5S A;  3J7Y W;  1ILP A;  1YNJ D;  1A3V A;  1PTO H;  2R6G A;  4QB4 A;  1RHP A;  4FNF A;  1AZQ A;  3C3L A;  1LT4 D;  2FMM A;  1H9S B;  5FLX E;  1I4H A;  4PNY A;  4C56 C;  3Q0A A;  3L9A X;  4K5W A;  1F2L A;  1XXG A;  2NVX B;  4XQQ A;  5KNB A;  1DOL A;  1HHV A;  2NVQ B;  3VYR A;  2TMP A;  2L5T A;  1L0X B;  1VMP A;  3W2D A;  4RCN A;  1RD9 D;  2EJG C;  2N88 A;  2BCO A;  4I65 A;  1JOO A;  4S3S A;  2L4N A;  1JOK A;  1EEI D;  2K33 A;  2NWG A;  2NZ1 D;  3NHH A;  3JAM L;  4DXF A;  2KA7 A;  3M85 A;  3MEH A;  3Q22 A;  1RF2 D;  2ENB A;  3N52 A;  2G9D A;  3KUP A;  5D3I B;  2HDL A;  4IFD I;  2KVM A;  5M5W B;  1CT1 D;  1PZK D;  1BDO A;  1SE2 A;  5FLX L;  4RFB A;  2AQ2 B;  4QUF A;  2B2U C;  1EYD A;  1UNS A;  3OPO A;  5KGU A;  1GUT A;  1CK1 A;  2E74 C;  5C44 B;  5JAV A;  3L3O C;  4ZRZ A;  3PUY A;  1LT3 D;  5C0X H;  5C3E B;  1QJO A;  1EWC A;  3GTP B;  3NWT A;  1EIG A;  1EY5 A;  4RGO S;  4KI0 A;  4KY5 A;  5ELF A;  2MHV A;  2DY7 A;  2FIN B;  1U4P A;  5C4Z A;  2MPM A;  3NTH A;  4EQN A;  2EDG A;  1D2B A;  2RVL A;  2YYZ A;  4Z9C B;  1BNZ A;  5I9P A;  2EY6 A;  3M7N A;  4KY6 A;  4OIK A;  3GTL B;  3Q24 A;  4KKS A;  3CQZ B;  1EYA A;  1HRJ A;  1R9T B;  5FO7 B;  3K7A B;  3TP7 A;  4A3K B;  4PMW A;  1ET6 A;  4ZKC B;  3K5M A;  4OL7 A;  1S5D D;  4NKL A;  2R61 A;  2MGS A;  2HCC A;  1R4Q B;  1DOM A;  1TS2 A;  2ZT9 C;  2F0J A;  1VF5 C;  2EY2 A;  1QIL A;  3GP7 A;  1O7Z A;  2H1E A;  5IGC A;  1EU4 A;  3OMG A;  4F88 A;  1MI2 A;  1SFO B;  4G7O C;  1BXT A;  1ICW A;  2O2L D;  1KLG D;  3GTJ B;  3FRP B;  5C6A A;  5CV5 A;  1IHZ A;  2PZT A;  2QKI C;  4DU9 A;  1Y1V B;  1PDQ A;  1MSG A;  1CI3 M;  1RCV D;  2F3V A;  1H9K A;  1F9R A;  1G8Z D;  1DXM A;  2K28 A;  1TWF B;  2WAQ B;  3PO3 B;  3X3M A;  4B9W A;  2QF7 A;  5C0X I;  1AN8 A;  1TQO A;  5LL6 X;  3K5N A;  2JEB I;  1GUN A;  1Q12 A;  3BS1 A;  1SJE D;  2DN8 A;  2LFN A;  4RHS A;  2KJX A;  4ZUJ A;  2D62 A;  2JXM B;  4OO1 G;  1UEA B;  4QCL A;  1OXT A;  1CTM A;  3CRK C;  3SDZ A;  3FVQ A;  1A2U A;  1LT6 D;  3S9W A;  4YIJ A;  5T1G A;  1YNJ C;  1SMY D;  4CHT B;  5C5M A;  1PTO D;  3DM1 A;  3A7L A;  3D6C A;  4X3K A;  2F0W A;  5IOD A;  4KHV A;  4LK1 C;  1I50 B;  2XWB B;  3NE5 B;  2F3W A;  2EPB A;  1RDP D;  2ID0 A;  4DAP A;  1G2S A;  5HGT A;  1Y8P B;  3M7G A;  1JWU D;  4NMZ A;  1KAA A;  1AEX A;  5CV4 A;  1Z7T A;  4FXG C;  4LJZ C;  4C3I G;  1KAB A;  3P75 A;  1WTR A;  3HP3 A;  4KKT A;  2A69 D;  2KOL A;  1C4Q A;  3J80 E;  1LTT D;  4IUQ A;  1PXU A;  3IKJ A;  1Y8N B;  3NQT A;  2EY1 A;  1WTV A;  2E76 C;  2J4X A;  1SYG A;  3HOZ B;  1Y69 U;  4WOR A;  3KLS X;  5EBC A;  1BCP D;  2O4X A;  1STN A;  1LO5 D;  2XRQ D;  3CU7 A;  1I4Q A;  1CA5 A;  3GV3 A;  1U4L A;  4M8A A;  4ZQ3 A;  4L6T B;  2QIL A;  2L12 A;  1U4M A;  1I6V C;  1EZ8 A;  4TQU S;  1DON A;  4XQJ A;  1BO0 A;  2PPB C;  3I8Z A;  2BOS A;  2B2T C;  1EY6 A;  2VUM B;  4HCE A;  4HMJ A;  3C1F A;  3J80 L;  2L11 A;  4K2L A;  2VXW A;  1A2T A;  5M5X B;  1M4V A;  2Q8R E;  3PUX A;  3PIO 3;  5DM6 3;  4O42 A;  1V1P B;  3BVM A;  3SK4 A;  1SYD A;  2NN6 H;  2F0F A;  1OXV A;  5KNC A;  1AW7 A;  3RD4 A;  4RGN A;  5CR3 A;  5M3F B;  5C5L A;  4ILW A;  3DMU A;  3UI2 A;  3SR1 A;  3AMU A;  4MHE A;  1DM0 B;  4KMU C;  1JOQ A;  1RJT A;  4A3B B;  4HN7 A;  2KEE A;  1M8A A;  1NCV A;  2IPK D;  3RZO B;  1WTP A;  4RWS C;  3T53 B;  3MWY W;  4EGV A;  2D9U A;  3K0Y A;  4N9T A;  3D3R A;  3S14 B;  5CC4 A;  3QO2 A;  4FVM A;  2E75 C;  2EYP A;  3DEO A;  3OW7 A;  4KD4 A;  1HPC A;  2IJ0 A;  2B2W A;  3DWA A;  4XXE A;  1O7L A;  1K8O A;  3VYS A;  3HOX B;  3DWQ A;  2IX1 A;  1PRT B;  1XX8 A;  1PFB A;  3VA7 A;  2GA4 B;  2IX0 A;  5COR A;  2MJ8 A;  1X32 A;  3OHX C;  1SJH D;  4XYO A;  3P20 A;  1EY7 A;  3NBH A;  1NUC A;  1EIH A;  4A3M B;  3SVM A;  1XYI A;  2A73 B;  5ELC A;  1TT2 A;  3QOL A;  4KTA A;  1TS4 A;  3IFT A;  5D14 A;  3TBI B;  1CHP D;  1CQV A;  3PUW A;  2K6A A;  2BA0 A;  3TZU A;  1SMY C;  4C2M B;  1EY8 A;  3GTG B;  4NDX A;  1PTO C;  4C3J B;  2NN6 I;  1STB A;  1ZEQ X;  2OXP A;  4QIW B;  5IGD A;  2A5H A;  5CV8 A;  1ENA A;  1CZG A;  1QE6 A;  5EKK A;  4A3J B;  4KJO A;  4J1M A;  3TP6 A;  3N6R A;  4F7X A;  3D4D A;  4A3D B;  1HXY D;  4C3H B;  1KTK A;  4DFA A;  2B2Y A;  4NP5 A;  1JB3 A;  2NB0 A;  5LL6 S;  3PV0 A;  4R9W A;  3PUV A;  1UAP A;  1MSH A;  3WDN A;  2A69 C;  4QUC A;  3TSS A;  3D4R A;  3C46 A;  2K5W A;  3NQI A;  5DM7 3;  2M00 A;  4L8J A;  1E0B A;  3PIP 3;  1GOZ A;  3A8I E;  5BN5 A;  1EEF D;  3KK7 A;  4XTC S;  2KED A;  1DCZ A;  4TRD A;  5I2X A;  4WFN 3;  1T5E A;  5J39 A;  1BCP C;  4RKL A;  5JPM C;  2FMC A;  2K05 A;  4IUN A;  1V1O A;  1PFN A;  1VF7 A;  1BUV T;  2LKV A;  3T13 A;  3IAY A;  1PTO F;  1EL0 A;  1CQF A;  4ABN A;  2AWO A;  2BE5 D;  4I7Z C;  1TY0 A;  5NUC A;  1EU3 A;  4EQO A;  5EBD A;  4G7Z C;  1RTO A;  3MAQ A;  4OIJ A;  2Z8L A;  1UUP A;  3V05 A;  3S15 B;  3FPP A;  3DWP A;  3MA2 B;  1QNK A;  1A15 A;  2CVR A;  3T4A C;  2M9V A;  3L7Z C;  4ODG A;  1ESF A;  3P1H A;  3KF8 A;  3V2T A;  3T16 A;  1EWH A;  4KJN A;  1HA5 A;  2F0G A;  2FHT A;  1C8C A;  2O5I C;  4DNT B;  1QNU A;  4F87 A;  3D8G A;  2JP1 A;  1B9M A;  3TP8 A;  3I72 A;  2L55 A;  2LS0 1;  3FDT A;  2OT2 A;  2WP8 J;  4H44 C;  3OIP A;  4O1N A;  4FYD A;  2F0L A;  1BCP F;  1LAC A;  1J9O A;  1S5B D;  2K1B A;  4IN3 A;  3RZD B;  4PMB A;  3J7A F;  2HUG A;  2SOB A;  1STA A;  1E2W A;  1FR3 A;  1KNA A;  3NWS A;  1D6E C;  1STG A;  1F9P A;  1TWC B;  2XRS D;  4ZKB B;  4UDU C;  3I90 A;  2WAC A;  2JA7 B;  3MFG A;  2G9H D;  1SND A;  2EYM A;  4RCO A;  4HR7 B;  5M5Y B;  1I4X A;  1HTP A;  1ET9 A;  3QIA A;  2ZXP A;  1PLF A;  1EY0 A;  4H0L C;  5EKI A;  4FP5 D;  1F2M A;  3MXU A;  3OMC A;  1WVL A;  1TS3 A;  4H13 C;  1ML0 D;  1VDZ A;  2NYZ D;  3EFX D;  2RKS A;  4HED A;  1BOS A;  2RSN A;  1VCI A;  2J7Z A;  1TR5 A;  3TN2 A;  3NP8 A;  2LMC B;  5C4J B;  4IQZ A;  3VYT A;  2K7V A;  1S5C D;  4XQN A;  5JVH 3;  2EYH A;  4XIG S;  2YU9 B;  3M4Y A;  4XYQ A;  2BA1 A;  3MHB A;  3H91 A;  2F0I A;  2QCP X;  1Q1B A;  1STY A;  5G3L F;  1R4P B;  4CJ1 B;  3QOJ A;  3NBI A;  1H9J A;  4JK1 C;  1KDA A;  1S5F D;  1V43 A;  4K8I A;  4HAE A;  1BR9 A;  2E2J B;  1SNO A;  2A68 D;  4CKC A;  4ME5 A;  2SNM A;  5D3D A;  2WKC A;  4CKE A;  4E6I A;  5FO8 B;  2I46 A;  4CJ0 B;  3I4N B;  4K5X A;  5IT9 E;  1OXX K;  3QB3 A;  3SE0 A;  4G4K A;  2EJF C;  4IUU A;  1SSO A;  1ZYR D;  1TVX A;  3CHB D;  4K8J A;  1J8I A;  4MN3 A;  2V4D A;  4RA8 A;  3Q23 A;  5C4X B;  2B8G A;  1YNN D;  2E2I B;  3PUZ A;  1HFG A;  1JC7 A;  4XT3 B;  2SEB D;  1SYF A;  2CW0 D;  5HUR A;  3SEB A;  1FNW A;  4Q0F A;  3RLF A;  3ERO A;  3A8J E;  2F0H A;  1NR2 A;  5CV7 A;  1PZJ D;  3VR6 A;  1XTC D;  3H94 A;  1ESR A;  4BBS B;  2OEO A;  1HQM C;  5IT9 L;  1JQY D;  3BDL A;  2BE5 C;  3K6O A;  5T1I A;  2Q8I B;  1B3A A;  1ENC A;  5E4X A;  4FO2 A;  4C3J G;  1RTN A;  3FPU B;  3BDO A;  4RGM A;  1F2Z A;  4X3T A;  5M9O A;  1TWG B;  5IGG A;  5K36 G;  2EYL A;  4XDX A;  2C9O A;  5EPJ A;  1X3Q A;  2HCI A;  1EZ6 A;  2A6H D;  4RHR A;  2AUJ D;  4RH6 A;  2X69 A;  4IFD J;  4PV1 C;  2H4O A;  1DYQ A;  2AQ1 B;  4X3U A;  3H6M A;  4OO1 H;  4C3H G;  4U68 A;  1WD1 A;  1ENF A;  3S2D B;  5FK9 C;  1H9S A;  2EVB A;  5IGF A;  2B63 B;  2JA8 B;  1I3Q B;  1U4R A;  5I4D A;  3VA5 A;  3A8K E;  3D31 A;  4RKB A;  3S1Q B;  1HUN A;  3HEJ A;  3R2I A;  5EQ0 A;  3H3V C;  1CHQ D;  2L1B A;  5JVG 3;  1C48 A;  1EY4 A;  5C3X A;  4J8Q A;  1D5X C;  2N55 A;  1TII D;  4BY7 B;  3DUZ A;  1FNV A;  2XVS A;  2NTT A;  2RBM A;  4IFD G;  5KIX A;  1PMR A;  3R3O A;  1Y8O B;  2IW3 A;  1IL8 A;  4DA2 A;  1SDF A;  3T51 B;  3VR5 A;  1XWE A;  2XWJ B;  2PQE A;  3P7J A;  1QWY A;  4IUT A;  4BA1 I;  3C1E A;  4B08 A;  3HOV B;  2IX3 A;  3O13 A;  3S2H B;  1K8M A;  4Y7N B;  3AB9 A;  2RQX A;  5I6Y A;  5E3F A;  1I4R A;  1ROD A;  3SK8 A;  1WTW A;  1LAB A;  4C1N I;  5CMD A;  1GUS A;  2JE6 I;  3KLR A;  4NW2 A;  1QOH A;  2SDF A;  1D5M C;  5IOC A;  1O80 A;  5FKA C;  2NBF A;  5G3L D;  1SE4 A;  1E2V A;  3QJY A;  4FXK C;  1LTR D;  2RDH A;  2J0T D;  2OF1 A;  4DGZ A;  2F0D A;  3GD7 A;  3MFY A;  4DN4 M;  4ULL A;  1HTL D;  1O78 A;  3EJI A;  2VB2 X;  3TP5 A;  3H0G B;  3MXG A;  3PO2 B;  2A74 C;  2K5D A;  1WTX A;  3MZ5 A;  3HS0 C;  3TZD A;  4A3G B;  4OO1 I;  1CA6 A;  2AWN A;  2BDN A;  4DK0 A;  5AFW A;  1F2Y A;  3J81 E;  2MP1 A;  5C4H A;  1LT5 D;  2Y0S B;  1LTG D;  3IL8 A;  1AP0 A;  2A68 C;  5COY A;  3S17 B;  4K6D A;  1T5X D;  4LMQ D;  2EYJ A;  1G91 A;  3MTS A;  1CM9 A;  5A2Q E;  1ZYR C;  3GTO B;  5I6W A;  2RDF A;  1H9R A;  2F0E A;  4HSV A;  1YNN C;  5CYU A;  1S4Z A;  4A93 B;  1KDC A;  3MXP A;  2CW0 C;  5C0X G;  3NUC A;  2EOT A;  1PFM A;  1E2Z A;  4IUP A;  1W6K A;  1TWH B;  2NVT B;  5DNF A;  1IYU A;  4PMC A;  3A55 A;  2B2U A;  1D1I A;  1G29 1;  3HZX A;  2F0S A;  5KND A;  3AU7 A;  1BQQ T;  2B2W C;  1IYV A;  1OXS C;  3DXJ C;  1HQR D;  1L0Y B;  1WCM B;  4N9P A;  5EPK A;  1CFM A;  3QWN A;  3K5L A;  5A2Q L;  5CBE E;  1DJR D;  5D65 A;  4G57 A;  2XSC A;  2F0Q A;  2PMZ B;  4V19 0;  3E0J A;  1Z6H A;  4FF3 A;  2A6H C;  1GUW A;  4L63 B;  4LAA A;  3SK5 A;  1HFN A;  2RA4 A;  5JPN C;  3OIQ A;  3Q6S A;  5ELD A;  4FF1 A;  4KD3 A;  2KCC A;  5BN3 A;  4IUV A;  3GTK B;  3ZYY X;  5E4W C;  2TSS A;  4HMI A;  2XN9 C;  1PTO B;  1PZI D;  4FF4 A;  1SYB A;  1WTO A;  3S16 B;  2K04 A;  1WTQ A;  4KHZ A;  4HSP A;  1A3T A;  3A54 A;  3I4L A;  4DXG A;  1STH A;  1S5E D;  1QG7 A;  2B2V A;  4A3I B;  5ELB A;  3K57 A;  3ERQ A;  1SNM A;  5EJW A;  1B50 A;  4IUR A;  2HDM A;  3R8B A;  2B2Y C;  3I3C A;  3CRL C;  3HRZ C;  1GXD C;  4ZK9 B;  4U67 3;  2I07 B;  5EKL A;  3URY A;  5FOB B;  1DD2 A;  1F9S A;  2KCN A;  3BVG A;  4ID6 A;  5JEA J;  3VR4 A;  3SXH A;  4F8M A;  1PRT D;  1ONL A;  2X6G A;  1GHJ A;  2LY7 A;  3VR3 A;  1HUM A;  1TS5 A;  3I91 A;  4HTH A;  1BF4 A;  2NTS A;  2MUY A;  4WRD A;  4ZAI A;  1JWM D;  3WOE A;  1D1K A;  2F0O A;  4BA2 I;  2WV6 D;  2IWH A;  1STE A;  3TDQ A;  3A7A B;  3EQL C;  1JCK B;  2K01 A;  1NAP A;  1TY2 A;  3VR2 A;  1LTB D;  2F0T A;  4P2C B;  2F0K A;  2XNA C;  1JE4 A;  4DAY A;  2PO4 A;  3NTK A;  4XT1 B;  1BCP B;  1B44 D;  1HCZ A;  3DEP A;  2A6E D;  4EVO A;  1LTS D;  3J7A V;  5JEA G;  3S1M B;  1D5Z C;  3VYU A;  5M3M B;  2F03 A;  5FO9 B;  1FGB D;  3W3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...