1XMQL

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16s ribosomal RNA
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xmqL00
4KLKA 2VQEQ 1PFSA 1G51A 3KLWA 2KHJA 4L5RC 4X62L 3F8TA 1RIPA 5GADC 4JI0Q 2ZJPA 2UUCL 5ELOA 5M5WH 2ZJRA 1UE7A 3UDIA 2ZTEA 3G6EA 3LGJA 4MZ9A 4LF6L 4NPSA 2R92H 4BA2I 4JYAQ 1YIJA 4BBRH 3CCJA 1Q82C 5GQOA 1XPUA 3GO5A 5FLMG 2F4VQ 3AYHB 1V9PA 1E24A 1X54A 3PV0A 4LFAL 2KBNA 4HIDA 3CC4A 3TS2A 4GOPC 3PIPA 3OTOQ 4GKKL 4R4OA 1YHAA 4DR4L 2YTYA 3RLNA 5K36G 4JV5Q 4A3GH 1CKOA 1EOVA 2WB1E 3E9HA 4X6AH 3GTOH 1BBWA 1FVIA 2JK8A 4TVAB 4UP8A 3UE0A 4LF8L 4A3LH 3U58A 1N32L 2RF4A 2K5VA 3I4NH 4LNQA 1UE6A 5M3MH 3HOUG 5IWAQ 2VUMG 2RHSB 1AE3A 2K5NA 3NEMA 5J3BA 4HJ9A 2D0OA 5H1SE 3K81C 3EIVA 3Q8DA 3T1HQ 4DV5Q 4JI3Q 4DR1Q 4B3RQ 1LUZA 2IHFA 1VQOA 1N8RC 3FKIG 1K9MC 4P72A 1YEZA 1UE1A 5FJ8G 4EX5A 2XTIA 4HIOA 1VQ5A 1QUQA 1N34Q 2UXCL 4K0KQ 3MXNB 2R92G 4JC0A 3TEHB 1Q1EA 1YVCA 2JA6H 3F2BA 1N36Q 5C3EG 4B3TQ 4AH6A 3OW2A 1VQHA 1VQBA 3ER0A 4GLVB 4IOAA 3CPWA 1IBKL 1QVCA 4LFBQ 4XIGS 2WAQE 2A8VA 3KF6B 1IBLQ 1XMQL 4X65Q 3CPFA 2Z6KA 1CUKA 5LMNL 4DUZL 1SN8A 4JCVE 1AE2A 3WWVA 2ZJQA 1XNQQ 4DK3C 4X65L 2N78A 4GOPB 3BU2A 4L5TA 4IFDI 3I55A 2JEAI 1HNWQ 1KQSA 1HZAA 2PQAA 4P75A 5IY0A 5C0XG 4IO9A 1N33L 2ID0A 4BBSG 4LFBL 1TWFH 2UUAL 4GKJQ 4YHHL 4BXXH 1EIFA 3L2PA 4PZ8A 4DV7L 2VUMH 3FKIH 2Y0SE 2KCTA 1G291 4OX9Q 2IX0A 3STBC 4X66Q 1SFOH 1PHJA 4LUOA 4DKAC 1PH6A 1V1QA 1XMQQ 4QL5A 4A3JH 3S1MH 1L2FA 2KHIA 2QEXA 5IYCG 3TQYA 4DV6L 4AIMA 1IYJB 2Q2UA 1XMOQ 4B3SL 4IJLA 1L1OC 4XTCS 1VQJA 4DV2L 2BH2A 1FJGQ 2E2JH 2JA5G 2Q2IA 3S1QH 5IYDG 3D31A 3B6YA 4A3FG 1U0LA 4JBJA 1H95A 3BZCA 2RCNA 1A63A 1EFWA 1HNXL 4KHPL 1MKHA 1VQ4A 2UXBL 2YV5A 4DAMA 4JBKA 3RLFA 4JI2Q 3AFPA 4QY7A 1C7YA 4NXML 2B63G 4YHHQ 3KF6A 3CCEA 4LF5L 1HNXQ 3BZKA 3CXCA 3S16H 2JE6I 1BBUA 3PSIA 4UPAA 2ZTCA 1JE5A 3H3VH 4DV3Q 4UP9A 2R93H 1RL2A 3A5ZB 4GS3A 1Y14B 4MTNA 4AYBE 2F4VL 4JOIC 3S14H 1C0AA 3HOYG 1E3PA 4BY7G 3PIOA 4LF9Q 4KHPQ 1N9WA 2D0PA 2LXJA 3FHWA 3I4OA 3T1YQ 1S40A 1M90C 3K8AA 4LF6Q 3DLLA 3ULPA 1EYGA 1VQ6A 4LF9L 2EIFA 2BA0A 1P16A 4R4TA 4BA1I 5EAYA 3CCLA 4LFCL 2GVBA 1VQEA 1K3RA 5JEAJ 1E1TA 1KL9A 3H0GH 1YJNA 2MNAA 4DV4L 3HOXH 4LFCQ 2Q2TA 3L0OA 1KRTA 1J5EL 4JI6Q 1SLJA 4LF5Q 3J80i 5C4XH 2RHQB 2QGQA 2V1CC 1HZBA 2E5LQ 3GTKH 3HOZH 1QUQB 2OCEA 4IFDJ 1ASYA 2K52A 2AMCB 2MQHA 4IPDA 2R6GA 4NB3A 4A76A 4A93H 4YY3L 2PNHA 4PZ6A 2YTVA 1R9TH 4X64L 3UDGA 3HOVH 2UXDL 3E0EA 3GDEA 1SE8A 4L5SA 1WCMG 4KI0A 1TWCH 4JI0L 1Q86C 4JI4L 2ATWA 5C44H 4DR2Q 2ES2A 1HR0W 5M3MG 4LWCA 1YITA 1XJVA 2B63H 2VQEL 4HJ8A 4A75A 3RN2A 3RN5A 1QVGA 1LM0A 2OTJA 1OXVA 2CWAA 2Z6KC 4YY3Q 4DUYL 2ZTDA 1U5KA 3H15A 2NVXH 4APVA 3OTOL 3A74A 3CC7A 3GD7A 1LTLA 3HOWH 2CFMA 2JJQA 1W2BA 1SMXA 5IP9H 3F2DA 5JJLA 1VQLA 1GD7A 4PMWA 1DGSA 4X64Q 4A3IG 1HH2P 4YCVA 5HY6A 1N34L 2I0QA 5GAGC 3FP9A 3W5OA 4DPGA 1PH5A 2FXQA 1PYSB 3G71A 5ELNA 1HR0Q 1B8AA 2LXKA 3CCQA 3CMAA 4JI4Q 3PUZA 4GKJL 1XNRL 1HNZQ 3G4SA 2MO0A 4A3EH 1GM5A 1I94L 1VQMA 2R7DA 4O0AA 2DGYA 4IOCA 3NBHB 3J81i 4QGUA 3GTJH 4DV2Q 3S1RH 4Y52H 4ME3A 3PUWA 2WAQG 1A8VA 5IYBH 3F1ZA 1PH3A 4B3TL 4A3CH 3BJUA 1JJCB 3E9IA 4NXNQ 3GTMH 2AWNA 1MJEA 1HR0L 2UXCQ 1X56A 2NVYH 3M4PA 3ZJYC 1WCMH 3L7ZC 3JAMi 1VQPA 2NVQH 2N49A 4OX9L 3DM3A 4BY1H 5C0XI 3G48A 1FGUA 1TWGH 3I2ZA 1QVFA 4WJ4A 2UUBQ 5IE8A 3K80C 1PA6A 5M3FG 4DV6Q 4OWWB 3PUVA 4FDBA 1X3GA 3PO3G 2ZM6Q 4GLAC 1G6PA 2UU9Q 3F2CA 2I5LX 1NTGA 2HHHL 3KDFA 1XNQL 3TRZA 1VQCA 2D62A 2N8NA 1KIXA 4C3JH 1WJJA 1YHQA 2JA8H 2E8GA 1IBLL 1L1OB 1FL0A 1P8LA 2R7ZG 3CW2C 1JT8A 1OXUA 3S24A 1YZ6A 4IPHA 1PH2A 2MO1A 4HIKA 2QA4A 3GTGH 4DR3L 2K14A 3KDFB 3JC66 3KF8B 4JBWA 1PH7A 3I4MH 1Y1VH 3HKZE 5IYDH 1TWAH 4DV0L 4P73A 4BBRG 4B3SQ 4GNXC 2Q2HA 5C4JH 3GTPH 5BR8L 4QJFA 4R4QA 1KXLA 1NJIC 3UDXA 1Y1WG 3PF4A 4AYBG 1I6HH 4L5QA 1X65A 2VZAA 3AQQA 1B7YB 1L0WA 1VQ7A 4DK6C 2JA9A 3S15H 2EXDA 1O7IA 2UU9L 2OTLA 3RNUA 1TWHH 3K7UC 4R4IA 3NENA 4QIWE 2JA8G 4QQBX 5FLXc 1XTDA 3KJPA 3PUXA 3S17H 1S3OA 3I4MG 2YTXA 3PF5A 4YWKA 2YYZA 1NMFA 2L15A 4GN5A 3M9BA 4DR1L 2MFIA 1KAWA 2CWPA 4C3IH 3J80c 2CCZA 4GKKQ 2JA6G 4ALPA 4IPGA 3CMEA 1VQGA 1VQAA 2GVAA 1UWVA 2KENA 4R1JA 2PI2E 2Z0SA 3RR5A 4Y7NH 5C0XJ 1MIUA 3VDYA 2HIXA 2JQOA 4AQYQ 1ASZA 2HT1A 4A3DG 2DUDA 4JI6L 1X55A 2OWOA 2ASBA 1SROA 1Y1VG 2B29A 1XPOA 3J7ZC 2UUAQ 3I4NG 1K8AC 1VQKA 1WOCA 1EQRA 3CCVA 5LMNW 2PQAB 1WI5A 1HNZL 4JBMA 2KCMA 4X66L 3EBEA 3U50C 3KJOA 4A3GG 5IT9c 4GN4B 1E7ZA 1B70B 3S1NH 2VL6A 4DR7Q 3U4VA 1I5FA 3I56A 5LMUQ 5C44G 5AJ3Q 1Y1WH 4GNXB 2E5LL 3CC2A 4RG1A 4B3ML 1Q46A 3CQZH 3ERSX 1Q1BA 5IWAL 4PG3A 2WP8J 5GAEC 2NZOA 2ALYB 4P71A 4YCWA 1OXXK 2IT1A 1BVSA 4YWMA 3IRBA 5IYCH 4A4IA 4GLXA 4BBSH 1N32Q 4JI7L 3JAMc 1E22A 4A3BH 1J6QA 4LF4L 1FJGL 4OO1I 1CKNA 2PI2A 3CF5A 4A3CG 4DR5L 4YWLA 3S2HH 1IBKQ 1KC8C 3J81c 3SGIA 2UUBL 3CCMA 4A3MG 4B3RL 1HNWL 4EQ5A 1K0RA 2K4KA 1YBYA 2I5HA 3HFZB 1N36L 2AKWB 1YHBA 4DAYB 4C2MH 3M4OH 3W1GA 4OO1G 1KHIA 3PGZA 2IX1A 2K75A 4LUVA 1UE5A 2UXBQ 4OXPA 2E2IH 5DLQE 2JA5H 4J15A 2BA1A 1HJPA 2R7FA 4BXXG 4PZ7A 1VQIA 4X62Q 2N3SA 5GAHC 1PYBA 3M3YH 1J5EQ 1YJWA 3W1BA 1JB7A 4YCUA 4DR6L 2A1AA 1X6OA 4BY1G 4TQUS 1LYLA 4JI1Q 3UDFA 3M4QA 4A3BG 1PH8A 2I5MX 3H0GG 3T1YL 1X9NA 1E1OA 1Q12A 2NN6I 5M3FH 1CSPA 3HOWG 4POFA 3J7A5 1JJGA 3HKZG 3CP0A 5FJ8H 4OWTB 5C4XG 4DV7Q 1QZHA 3STBD 4UP7A 1PH9A 1I3QH 1WFQA 3I7FA 3KYHC 4IPCA 4HJ5A 2F52A 5GROA 4IJHA 1UEBA 3U4ZA 1EWIA 4DV3L 4LFAQ 3T1HL 4RMFA 4A3EG 2HQLA 4LF7Q 3ULJA 1EIYB 2R93G 2K50A 5JEAG 1BKBA 2A19A 3MEFA 1HZ9A 2AHOB 5IYBG 4JOIA 3GTLH 5BR8Q 3ULLA 4JI3L 1OXSC 1CSQA 4LF8Q 1VQNA 3KFUA 1D7QA 1Z9FA 1EQQA 4LF4Q 3EN2A 2B3GA 5LMUL 2WB1G 4MNOA 5JJKA 4HJAA 1NBWA 4P74A 1MJCA 3CCSA 1VQ8A 2OQ0A 3CD6A 1IL2A 1GVPA 1GO3E 5M5YH 4DR3Q 3RLOA 1VQ9A 5E7NA 1EUJA 1M1KC 3HOYH 4BY7H 3KOJA 4DR4Q 2F3IA 1TXYA 4DV0Q 1WYDA 4DV4Q 1L1OA 1OXTA 1YNXA 4POGA 3D0FA 2VW9A 5C3EH 1SR3A 4A3JG 1XNRQ 3HOVG 2OQKA 4AQYL 1VCIA 2BH8A 2UXDQ 3ICEA 4WJ3M 1W3SA 4LW1A 4JI7Q 2JA7G 1Z47A 1NY4A 4A3KG 4LF7L 1Q81C 4B3MQ 4KHZA 4OONA 2UUCQ 2YU9H 3HOZG 1PVOA 1QZGA 1AH9A 2VS1A 3HKSA 2XGTA 4UY8C 4DNIA 1N33Q 5JJIA 3K0XA 1JMCA 4JV5L 4C3HH 2NN6G 2CKZB 5M5XH 2HHHQ 4JG2A 2K5HA 4DUYQ 4DR7L 2HIVA 2VQFQ 1X3FA 2CQOA 1I50H 4LUZA 5LMNQ 4DUZQ 3TREA 2JEBI 1PH4A 4DR2L 2ZM6L 3PO3H 4JI5L 4DV1Q 1KRSA 2C35B 4HIMA 1K73C 4DV5L 2NZHA 3A0JA 3TS0A 4OWXB 1CKNB 5HGQA 4GN3B 4H02A 4O2DA 1IBML 2IHEA 5AJ3L 2E2HH 3H3VI 1C9OA 2NVTH 2H5XA 1K83H 4JI8Q 5IP7H 2JA7H 2Y0SG 1XPRA 3RZDH 3OYYA 1KD1C 5IP9G 2R7ZH 1X3EA 3PO2G 4K0KL 4JI2L 4JI8L 1PH1A 4NXNL 3CCRA 1V43A 4A3IH 4A3FH 1VS0A 1SRUA 3A5UA 4A3MH 4DR6Q 2EQSA 3AEVA 4A93G 5FLMH 1JJ2A 3GTQH 1T9HA 2GN5A 1IBMQ 4A3DH 3RZOH 2VNUD 4NXMQ 1XMOL 3K7AH 1S72A 4DR5Q 4A3KH 2LSSA 1YJ9A 1Q7YC 4DV1L 4HJ7A 4JI5Q 1D8LA 3M7NA 1NE3A 1GKHA 2WFWA 1A62A 4JI1L 1PV4A 1HZCA 3CAMA 1VQFA 1Q8KA 3AFQA 1IXRA 3PCOB 2VQFL 3NELA 2AWOA 1OTCA 1CKMA 3J81j 4GNXA 1YI2A 2VY3A 1K8GA 2PMZE 1I94Q 4IFDG 1IZ6A 2IY5B 4A3LG 1A0IA 4GOPA 3UE1A 3M85A 3PUYA 3PO2H 4R4CA 1NMGA 3HOUH 4JYAL 3CCUA 3S2DH 1VQDA 3HOXG 5IP7G
chains in the Genus database with same CATH superfamily
5A35A 4G7OC 4KJOA 5LL6X 4C3IG 1PFSA 3SEBA 3KLWA 2MUYA 1RIPA 1AW7A 1SNOA 2F4IA 4JI0Q 4ZK9B 3PQIA 1EIGA 3DEPA 1STGA 2F0OA 3G6EA 2O4XA 4NPSA 2R92H 1RDPD 4BA2I 1JC7A 3T13A 4QIWB 5FLMG 2C9OA 3AYHB 3BG3A 3LWEA 3PV0A 4HIDA 3C1EA 3PIPA 1YHAA 2YTYA 3MC0B 3RLNA 1YNNC 4A3GH 3HG9A 1CKOA 3QG1A 2WB1E 1S5ED 3E9HA 3I73A 1FVIA 4UP8A 4LF8L 1CA5A 3U58A 1V1PA 2K5VA 4A3BB 1UE6A 4AYBB 2LY7A 1AE3A 5J3BA 2D0OA 1NR4A 3EIVA 4IZ8A 2ICEC 2RKSA 5EPJA 4CKBA 4C3JG 2E76C 4P72A 2EJFC 5BN3A 1YEZA 1STHA 2H4OA 2XTIA 4EQNA 4FXGC 4J8QA 2EYFA 1WTXA 3TEHB 4AH6A 2R7ZB 4CDEC 1B3QA 3K0YA 4GLVB 3J7YW 4ZYSA 2WAQE 1LTRD 2A8VA 1XMQL 3CPFA 3MXGA 1SN8A 1ENFA 3N52A 1TR5A 5HURA 2PO4A 4GOPB 1HNWQ 1S5CD 2PQAA 2LKVA 1I3QB 2EPBA 5C0XG 4IO9A 4BBSG 3A56A 4GKJQ 4M1UB 1Q8IA 2NTTA 4PZ8A 4FO2A 3FKIH 2KCTA 1DJRD 4OX9Q 1I4GA 1SFOH 1PHJA 3T4AC 1LTBD 1KTKA 2LFNA 1ILPA 1I4XA 4A3JH 4LF4L 3TQYA 1JR0D 4AIMA 4RGMA 1FJGQ 2JA5G 1UAPA 1PTOF 4JBJA 2F0HA 3SDZA 5C3EB 2RCNA 2PQEA 1MKHA 2UXBL 5M5YB 4NXML 4JI2Q 4QY7A 5IODA 4YHHQ 3CCEA 4LF5L 3NE5B 4RH6A 1BBUA 4P2CB 1PRTB 2ZTCA 4DV3Q 4UP9A 1A6XA 1RL2A 2O2LD 1UNSA 1S5BD 2OT2A 1Y14B 5J1ZA 3HOYG 4BY7G 4XT1B 3K5NA 1SNDA 1JORA 1TS4A 3C3LA 3K8AA 1ENCA 4LF6Q 3DLLA 1BDOA 2EIFA 3CCLA 5EAYA 2HCIA 2IW3A 3H0GH 1YJNA 5E4WC 2BDNA 2MNAA 3HOXH 1J5EL 1JWMD 4JI6Q 1SLJA 3J80i 2QGQA 3S1QB 2AMCB 4IPDA 1DONA 5BN4A 4PMBA 4IUVA 2UXDL 4L5SA 1WCMG 4BY1B 5E1FA 5I9PA 4KI0A 2ICIA 2B8FA 1EL0A 4JI4L 5C44H 2ES2A 2D2CC 2QILA 5M3MG 1QNKA 1YITA 1XJVA 4K2LA 4R8NA 1R4PB 3A55A 3A7LA 3Q23A 4HJ8A 3RN5A 5ISRA 1OXVA 2CWAA 2OTJA 2ZTDA 3QR8A 1PTOD 5E4XA 3H15A 1H9MA 1PRTC 4APVA 1PXUA 3GD7A 1O7YA 1W2BA 2A6EC 2R61A 2BE5D 4NKLA 1N34L 2I0QA 1C4QA 1YNJD 3FP9A 4DPGA 5GAGC 3HOWB 2L9HA 1PYSB 1PFNA 5ELNA 2LXKA 1PZKD 1B9MA 3MA2B 2K04A 3G4SA 2J0TD 5C5LA 4C1NI 1GUNA 2K5WA 1I50B 4JPBW 4DV2Q 2Z6BA 4QGUA 5I4DA 4ME3A 4A3CH 3F1ZA 1AFPA 3E9IA 4NXNQ 3GTMH 2B2VC 2PNRC 2NVYH 3ZJYC 1VQPA 1PTOH 1IW7D 4A3DB 3NWSA 5C0XI 2HUGA 1A3VA 1TWGH 3I2ZA 4WJ4A 1QVFA 5CV5A 3K80C 2NBFA 2XN9C 2PZUA 4UAIA 2EYPA 1X3GA 3PO3G 1D1KA 1G6PA 2B2TA 4XQQA 3E6ZX 1YHQA 2JA8H 1L1OB 1FL0A 5FKAC 1WTHA 1QNUA 2VUMB 3GTJB 5C3WA 4CJ2C 3S24A 1PH2A 4ULLA 3GV6A 4B9XA 3JC66 1CQVA 2G9DA 3LWUA 3HKZE 4BBRG 3Q0AA 4QJFA 1HXYD 1NJIC 5T1GA 4AYBG 1I6HH 3BVZA 2VZAA 1B7YB 1O7IA 5JOBA 1TWHH 4R4IA 2JA8G 4QQBX 5FLXc 3F2UA 1Z7TA 3Q24A 4HAEA 2L15A 1KAWA 1PFMA 2CWPA 2CCZA 2F0TA 1F77A 4DR3L 4R1JA 2PI2E 4AQYQ 1RODA 2DUDA 1J9OA 1X55A 2RSNA 3ND8A 4CJ0B 1SE3A 2E2IB 1KABA 2DNEA 1VMCA 1H9JA 1WOCA 1EQRA 2PQAB 2XRSD 3P1HA 4R9WA 3K59A 1WI5A 4FXDA 1HNZL 4JBMA 4MN3A 4K2KA 3KJOA 5C0XH 5IT9c 4DR7Q 2VL6A 3U4VA 2FJ2A 2NVYB 4GNXB 1SYCA 1LT3D 3ITPA 2WP8J 3TDQA 3IRBA 3R2IA 1N32Q 1DZ1A 2FHTA 3JAMc 1J6QA 3S16B 2PI2A 2FMCA 5JEAH 2R93B 1IBKQ 5A2QE 3I91A 2KCNA 4EQ5A 1HRJA 2K4KA 1VF7A 3EVQA 2AKWB 4C2MH 3W1GA 2K75A 3OPOA 2UXBQ 3T56B 2R7FA 4BXXG 1B1ZA 3J81E 1PYBA 5DM63 3M3YH 3W1BA 1JB7A 4DR6L 2A1AA 1X6OA 4RCOA 4C1NK 5C44B 1EU3A 3M4QA 4O42A 2RCFA 5M5WB 2B63B 1B4OA 3FMCA 3H0GG 1X9NA 3S1NB 5M3FH 1CSPA 2XVSA 2DJGC 3HKZG 5FJ8H 5COYA 1QZHA 3GQBA 1D5ZC 3I7FA 4IPCA 4HJ5A 5GROA 1WD1A 4IJHA 1UEBA 3K57A 4Q0FA 2E2DC 1T5EA 3DWAA 3T1HL 4RMFA 4A3GB 2EJMA 3MTSA 4A3EG 2HQLA 1LV9A 2BDOA 2K50A 2K6AA 4CKEA 1JICA 2IWHA 1EQTA 2AHOB 3OWFA 3GTLH 4A3JB 3JAML 1Z9FA 3NBHA 3J80L 3TZDA 2WB1G 3S1RB 2QKIC 1WTWA 1S5FD 4K5XA 2B2YA 3BDOA 3GTMB 5M5YH 1TWCB 1PYWD 3L9AX 3KOJA 2F3IA 1ML0D 3P75A 1TXYA 4A3EB 4NMZA 5JVG3 1OXTA 2F0FA 4DAVA 3D0FA 3AMUA 1STEA 2BH8A 2BCOA 1SJHD 3NTIA 2KUMA 2B2TC 4NW2A 3D4RA 1NY4A 2IPKD 4LF7L 2AUJD 1PVOA 2VS1A 5IGGA 1QCBD 2RA4A 4YIJA 1JMCA 3JAME 1TVXA 2HHHQ 2N88A 4JG2A 2K5HA 1EY6A 1CI3M 4DUYQ 4LUZA 2JEBI 5CORA 4WFN3 3PO3H 4IUUA 1HUNA 4DV5L 3A0JA 3TS0A 3LNNA 3BS1A 1EYDA 1IBML 3V96A 5AJ3L 2E2HH 1L0XB 2H5XA 1K83H 1GHJA 2P5ZX 3I70A 5ELEA 3OYYA 5IP9G 3PO2G 1LTID 3EJIA 1PH1A 1V43A 1VS0A 3A5UA 4XYQA 2ZXRA 2JYOA 1IKLA 1MSGA 3VYRA 2NVQB 1JJ2A 2GN5A 1IBMQ 4A3DH 3RZOH 2C5CA 1XMOL 3K7AH 1YJ9A 4JI5Q 1D8LA 1K8OA 4JI1L 3NWTA 1BUVT 1OTCA 1Q8KA 1IXRA 1B50A 2CH4A 1CKMA 3VYUA 1XWEA 1II3A 1YI2A 1IW7C 5DAUA 4BS9A 2IY5B 4A3LG 2B2WC 4GOPA 4LAAA 3KLSA 3VA5A 3PO2H 2JXMB 2X6GA 4H13C 2EY6A 3HOXG 4XT3B 4HCSA 4B9WA 1FNUA 4B08A 4HCEA 4L5RC 3F8TA 3R3OA 2VB3X 5ELOA 2ZJRA 3KBXA 5NUCA 2ZTEA 4KTAA 3KLSX 3LGJA 4LF6L 1YIJA 1GUGA 3CCJA 2KA7A 5GQOA 1V9PA 2F3WA 2HDMA 3W2DA 1PLFA 2B2WA 4GOPC 4GKKL 4R4OA 4PNYA 4DR4L 5K36G 4UDUC 2L5TA 3RUZA 2KECA 1BBWA 2JK8A 4TVAB 1IL8A 2E74C 1N32L 1HFGA 4K5WA 3HOUG 2WIIB 5EPLA 3NEMA 4DAYA 3P20A 4JI3Q 3T1HQ 3QOLA 3PO3B 1HUMA 3KF8A 1K9MC 4HIOA 1R9TB 1VQ5A 4K0KQ 2R92G 2JA5B 4JC0A 1Q1EA 2PW5A 5KYLA 2JA6H 1BXTA 4CHTB 4CKCA 5C3EG 3OW2A 1C48A 3S17B 1VQBA 3QIAA 1EWHA 1U4PA 2PW7A 4IUPA 3CPWA 1IBKL 4LFBQ 1IBLQ 5FOBB 2Z6KA 1F9SA 1CUKA 4FVMA 4DUZL 1QE6A 1AE2A 1XNQQ 1CQFA 4KK7A 4K6LA 4DN4M 1U4LA 4DNRB 3H09A 2JEAI 3NSWA 1HZAA 4OO1H 5IY0A 5M5XB 3TN2A 1N33L 2ID0A 1A3TA 1TWFH 1EIFA 2KJXA 2Y0SE 3MXUA 1G291 4X66Q 2EZVA 2K7VA 4DKAC 1PH6A 1XMQQ 5JVH3 1L2FA 4B3SL 3GTOH 5IYCG 4DV6L 2RVLA 4XTCS 3FRPB 2Q2IA 3S1QH 3B6YA 5CBAE 1A63A 1AP0A 1HNXL 3I8ZA 3RLFA 1C7YA 2B63G 4Z9CB 3KF6A 1HNXQ 3BZKA 3TBIB 1JE5A 5IT9L 2R93H 1Q90A 2A68D 1U4RA 5ELDA 1LTAD 5M9OA 4KHPQ 1N9WA 2D0PA 2L1BA 2LXJA 3T1YQ 2AQ3B 1X3PA 1S40A 5D14A 3A54A 4RWSC 4EQPA 4LF9L 1P16A 4QUFA 2ZXPA 1VQEA 1SJED 4FF4A 5JEAJ 4KD3A 4DV4L 5C4HA 4A93B 3GTKH 2EVBA 1BR9A 2Q8RE 2K52A 4A76A 2MQHA 1IYVA 2SOBA 4A93H 1STAA 1FGBD 3V05A 2YTVA 1R9TH 3UDGA 2D9UA 5JPNC 3E0EA 1BNZA 3OW7A 1SE8A 1IKMA 1WTQA 4DU9A 1KNAA 1TWCH 1RTOA 1Q86C 1HR0W 1IYUA 3FEWX 4LWCA 1NUCA 3RN2A 3OMGA 1QVGA 1F2LA 2HQEA 3QOJA 4DUYL 4LMQD 1U5KA 3SVMA 3FVQA 4L8JA 3QO2A 3GTLB 2AQ2B 1TS3A 1SMYD 1SMXA 5IP9H 4RA8A 2OF1A 3CRLC 1VQLA 4PMWA 5CV7A 1HH2P 4DF7A 1JOKA 3W5OA 1PH5A 3G71A 4JI4Q 5CR3A 3PUZA 4GKJL 1HNZQ 5DNFA 2NYZD 4O0AA 2DGYA 4Y52H 1X3QA 5IYBH 2F3VA 3BJUA 1JJCB 1HR0L 1JOOA 2UXCQ 3M4PA 3JAMi 1WCMH 1YNND 3SR1A 5KNBA 1SYEA 3QJYA 1PRTD 2KEDA 5M3FG 3EFXD 2KEEA 2UU9Q 2PPBC 1XYIA 1XNQL 3TRZA 2KOLA 2D62A 2N8NA 4C3JH 1WJJA 1IBLL 1BCPD 1FD7D 4FF2A 1S5DD 2DN8A 2R7ZG 1OXUA 3M7GA 4IPHA 4K8IA 2MO1A 2K14A 1PH7A 4JBWA 5I6YA 2IX3A 3G6JB 4HSVA 2Z4HA 1TWAH 4P73A 4B3SQ 4GNXC 1Y1WB 3GTPH 2FFKB 4R4QA 1RTNA 2L11A 3M4YA 3ZYYX 1Y1WG 1X65A 3AQQA 5DM73 2EXDA 3O13A 2OTLA 4TSSA 1E2VA 2X69A 5D3IB 3NENA 3MWYW 4QIWE 5G3LD 3U9SA 1CFMA 2V4DA 3PUXA 1V8QA 3EROA 3PF5A 4YWKA 1NMFA 4DR1L 1FYCA 2RDFA 3I4LA 4HN7A 1LT4D 3J80c 2JA6G 3CMEA 4Y7NH 3HZXA 2KENA 1EQQA 2MGSA 5C0XJ 2HIXA 2WINB 2OWOA 3OHXC 1SROA 2XIWA 4V190 2UUAQ 5C4JB 1AEXA 3I4NG 1HA5A 1K8AC 4DXFA 2PZWA 4HSPA 2MPMA 3I3CA 3U50C 4GN4B 1B70B 3S1NH 3I56A 4OIJA 4HR7B 1EIHA 1Q46A 3FPUB 3ERSX 1Q1BA 4HTHA 2SDFA 2NZOA 1MD2D 2F0DA 1NNXA 2IT1A 4H7BA 4YWMA 5IYCH 4GLXA 4BBSH 1T5XD 4OO1I 4PMCA 3URYA 4R8IA 3S2HH 1KC8C 2UUBL 4A3MG 1HNWL 4B3RL 5G3LF 3HFZB 1PRTF 1YBYA 2F0IA 2I5HA 3UI2A 4DAYB 4G7ZC 2B2YC 3S2HB 4IUNA 3M4OH 3WOEA 3NP8A 3AU7A 2TMPA 1UE5A 1ICFB 3CKIB 1M8AA 5DLQE 4J15A 4L6TB 2JA5H 2BA1A 3MVVA 4KD4A 2F0SA 1EY4A 1VQIA 2F1MA 2N3SA 1I4RA 1YJWA 3TZUA 4YCUA 3DEOA 4TQUS 2I5MX 3T1YL 4A3MB 3NHHA 4POFA 1JJGA 3CP0A 4OWTB 3I72A 3PIO3 3STBD 1WFQA 4G4KA 3KYHC 1GUOA 5KYIA 4DNTB 4DV3L 4S3SA 2O5JC 1Q3LA 1KDCA 3NK9A 4LF7Q 5JEAG 1SNPA 4F88A 2E75C 4LF8Q 1CSQA 1VQNA 2MJ8A 3D4WA 4MNOA 1ET9A 5JJKA 1Y8PB 4OHJA 5C3XA 3CCSA 2XWBB 4DR3Q 3KK7A 2Y0SB 4DR4Q 3M3YB 1ONLA 3BYYB 1JCKB 1SYDA 5C3EH 1SR3A 1XNRQ 1K83B 2OQKA 3HOVG 4JK1C 3DHQA 4LW1A 1MI2A 1Z47A 2IJ0A 1Q81C 4B3MQ 4KHZA 2UUCQ 2TSSA 1CM9A 3HKSA 5EKKA 3C1FA 4JV5L 3RZOB 2M00A 1SNMA 3FPPA 1I4QA 2A6ED 1ET6A 1BCPB 4PV1C 4DR7L 2HIVA 2RDHA 3GTGB 4DUZQ 1U4MA 1PH4A 3TP6A 3D6WA 3D3RA 2A69D 4DV1Q 2PYKA 3ERQA 4H02A 2IHEA 3R93A 3GTPB 4FXKC 2NVTH 3ND9A 4ZQ3A 1PFBA 5T1IA 3RZDH 1K3BC 2R7ZH 1X3EA 2Z9HA 1B53A 4K0KL 4JI8L 3VYSA 4J6HA 3Q22A 4NXNL 4A3IH 5EGTA 1SRUA 1J8IA 3C2PA 5KNCA 3BYTB 5LL6S 4NXMQ 3T53B 3H6MA 4C3IB 1GKHA 3RMHA 4QF4A 4LK1C 1VQFA 3AFQA 4XDXA 2VQFL 2AWOA 3DM1A 2I46A 2L0CA 5C5MA 1K8GA 3HOUB 5I9OA 4IFDG 1IZ6A 1STYA 1E2WA 2F0MA 3VR6A 2L12A 3M85A 1EU4A 2JA7B 4RKLA 3CCUA 4JYAL 3MXNA 1MBYA 3HOZB 4KLKA 5JPMC 3NTKA 5E3FA 2KHJA 2A6HC 4X62L 1RKNA 3D6CA 5GADC 2UUCL 2LS01 2ZXOA 5M5WH 1UE7A 2B2UC 3OOCA 2UXDQ 4JYAQ 1JB3A 1HPCA 2RDGA 2BE5C 2EJGC 1XPUA 1RCVD 1E0BA 1E24A 3TS2A 1S4ZA 1RF2D 2WAQB 2YU9B 5J39A 2Q8IB 1EOVA 1WTVA 1G8ZD 3MHBA 1TKWB 1EY5A 4A3LH 3UE0A 1QJOA 4LNQA 5M3MH 1KLGD 2HCCA 5IWAQ 4K6DA 1EY7A 2VUMG 2K5NA 1I6VC 2PZTA 4DXGA 1XXGA 1KDBA 3K81C 1BO0A 1LT5D 5TSSA 2J4XA 4DV5Q 4B3RQ 1TWFB 1N8RC 1GHKA 3EQLC 1YNJC 4HEDA 3T16A 4CDCC 5FJ8G 3MFGA 1QUQA 3MXNB 3TSSA 1YVCA 3F2BA 2VXWA 4B3TQ 1VQHA 3ER0A 1I6HB 1MHWC 4L63B 3K5MA 3WWVA 4DK3C 1XTCD 3NBIA 3IFTA 2PCFB 3KBGA 3BU2A 3I55A 1KQSA 1SBBB 2H1EA 4EGVA 4ODGA 2K28A 1HA6A 4BXXH 4FP5D 3EA6A 3L2PA 1DM0B 4DV7L 1SMYC 3STBC 1ESFA 1Y69U 4LUOA 3A8KE 1V1QA 2Q2UA 1XMOQ 1VQJA 2BH2A 2DY8A 3MEHA 3NXWA 2HD3A 1A2UA 2LMCB 4HMIA 4NDXA 3X3MA 4DAMA 2BOSA 3AFPA 2A73B 3OWEB 3DUZA 4UPAA 3MZ5A 3R8BA 1E2ZA 4ABNA 4AYBE 4MTNA 3S14H 2F4VL 1C0AA 1E3PA 3PIOA 4EVOA 3I4OA 1A15A 5BN5A 1VQ6A 3ULPA 1EYGA 2BA0A 2SEBD 1TY0A 4LFCL 2GVBA 1K3RA 1E1TA 4JVZA 2EYHA 4NP5A 1DXMA 2NB0A 4LFCQ 2Q2TA 1KRTA 3D4DA 2E5LQ 3IFDA 5C4XH 2WV6D 1HZBA 5D65A 3VR3A 2F0GA 1ASYA 4NB3A 2R6GA 1CTMA 4YY3L 4XQNA 3W3AA 3C46A 3GDEA 2EYJA 2EXZA 3SE0A 3MAQA 4JI0L 4ZKBB 2B63H 3IAYA 1LM0A 4YY3Q 1QOHA 1GOZA 1Y8NB 2NVXH 1GJXA 3SK4A 4KV6A 3CC7A 4G7HC 5J22A 3HOWH 5JJLA 1GD7A 1EOTA 4X64Q 4A3IG 2F0PA 3GV3A 4YCVA 2EYOA 5HGTA 2FXQA 3G7LA 3PIP3 3CMAA 4KN7C 5FO8B 1G91A 1D1IA 2NN6H 1I94L 4ZLTF 2F0WA 3S1RH 4RGTA 1JE4A 4K5VA 3PUWA 1PH3A 1A8VA 1WD0A 4B3TL 4X3UA 1EY8A 1EZ8A 2G5DA 2AWNA 2JSOA 1MJEA 3L7ZC 2NVQH 2N55A 2N49A 3DM3A 3J81L 3G48A 4N9TA 1FGUA 3RZDB 2UUBQ 5IE8A 3NPPA 2A5HA 3H91A 3SK6A 4DV6Q 4OWWB 2Q8TA 4FNFA 2ZM6Q 4GLAC 4KY6A 4RFBA 3F2CA 1NTGA 2HHHL 3HEJA 2B2UA 4J1MA 4X3KA 2A74C 2E8GA 1P8LA 2DY7A 2I07B 3K5LA 2DJFC 1ZYRD 5FLXE 1JT8A 1YZ6A 2B8GA 1X32A 4KY5A 3BDCA 2O5IC 1K0SA 3KF8B 5ELBA 3I4MH 1Y1VH 1ZKOA 5IYDH 2F0UA 4E6IA 5C4JH 1BBXC 2E2HB 3SK5A 3S15B 1KXLA 3HS0C 1TWHB 4L5QA 2L4NA 2FINB 3VA7A 2RSOA 2JA9A 1L0YB 3S15H 2UU9L 3RNUA 1LLRD 4XXEA 2EYLA 1XTDA 1PZID 3KJPA 3S17H 5IOCA 2YTXA 3ONAB 2YYZA 4GN5A 3M9BA 2MFIA 4GKKQ 3S9WA 4U68A 1DOMA 1VQAA 1VQGA 2CVRA 1I4HA 4XYOA 3RR5A 3OTOQ 3VDYA 3I4MG 4BBSB 1MIUA 2CW0D 2JQOA 2HT1A 4JI6L 5FO9B 2QW7A 1U9RA 3IL8A 4DK1A 1XPOA 3J7ZC 1QWYA 4DGZA 1VQKA 2QDLA 4CBVA 5EQ0A 2A68C 4DK0A 4N8X1 1KLUD 1JQYD 1DOLA 1ZEQX 1EQVA 3EBEA 4F8MA 3H3VC 5CC4A 4K8JA 5AJ3Q 2EYMA 1Y1WH 4PQXA 2E5LL 1TS5A 4KMUC 4RG1A 5AFWA 4B3ML 1TWGB 5KIXA 1LT6D 3WDNA 1KAAA 2ALYB 1O7LA 4YCWA 4Y7NB 1OXXK 1BVSA 3OIQA 4A4IA 2KHSA 5CGKA 1E22A 4A3BH 1FJGL 1EYCA 1CKNA 3Q6SA 2AUKA 4A3CG 1F9PA 2ZT9C 3H0GB 3TMEA 3RD4A 1N36L 4N9PA 5C4XB 2EOTA 1F2MA 1KHIA 3PGZA 4LUVA 2IL8A 4OXPA 1HJPA 3FDTA 3FKIB 4KKTA 4PZ7A 1BQQT 3BDLA 5GAHC 1JWUD 2XNAC 5FLXL 1J5EQ 1LTGD 2MP1A 1WCMB 4BY1G 5I2YA 4IURA 3T51B 2CQAA 2L55A 3UDFA 4A3BG 1Q12A 5CV8A 5C4XG 5C4ZA 1I3QH 2F52A 3U4ZA 4LFAQ 2F0JA 2F03A 1BCPC 5FO7B 2A19A 3MEFA 5I2XA 5IYBG 5BR8Q 3ULLA 4V0BA 5FK9C 4JI3L 1W6KA 1D7QA 3I90A 2B3GA 5K5PA 4HJAA 1ILQA 3DMUA 5K36H 2OQ0A 3GP7A 1GO3E 1VQ9A 1HTPA 3RLOA 1BF4A 1EUJA 3VR5A 3NQTA 3P7JA 2MHVA 4A3FB 1VMPA 5EKLA 1XX8A 4DV4Q 3DWPA 4POGA 4A3JG 1VCIA 3SHLA 4MHEA 1W3SA 4JI7Q 4WJ3M 2RBMA 2JA7G 4A3KG 3TP7A 4OONA 3HOZG 3CU7A 1QZGA 1AH9A 2XGTA 4UY8C 1N33Q 3K0XA 2WKDA 4C3HH 2CKZB 4RGOS 2XSCA 2VQFQ 2ENBA 1KNEA 2QCPX 4KJNA 4KKUA 3DWQA 4DR2L 3K5OA 2ZM6L 2SNSA 2JN4A 1AZPA 3CRKC 1KRSA 2C35B 3HP3A 4MIUA 5ELFA 4HIMA 2NZHA 4ZKCB 1K73C 4FYDA 2EE1A 2CW0C 4GN3B 1GUSA 4O2DA 1C9OA 5KRUA 1MSHA 5IP7H 2JA7H 2Y0SG 1XPRA 2JA6B 3VR2A 2KCCA 1CZWA 5M3FB 3AEVA 4OGQC 5FLMH 3GTQH 1F2YA 2VNUD 3PMFA 4IALA 4MTKA 4ID6A 4QCLA 4DV1L 3M7NA 4C3JB 4KKSA 1HZCA 3PCOB 3NELA 2D5DA 3J81j 4GNXA 1HFNA 2VY3A 3A7AB 3AB9A 4IQZA 1VF5C 3PO2B 1NAPA 2PMZE 1DD2A 1A0IA 2G9HD 2DNCA 3UE1A 1CZGA 1ZXTA 3PUYA 3HOXB 1NMGA 1VQDA 4RCNA 2X6LA 1H9KA 1PTOB 4DFAA 2VQEQ 1W6JA 1CA6A 1G51A 1G2TA 2OXPA 3I4MB 1GUWA 2ZJPA 4BBRB 1EEID 1PMRA 3UDIA 4DA2A 4ILWA 4MZ9A 1TQOA 4BBRH 1HQMC 1A2TA 1Q82C 2A69C 1V1OA 1HHVA 3GO5A 2F4VQ 1X54A 4LFAL 2KBNA 1I4PA 3CC4A 2QDBA 4WORA 4JV5Q 5EBDA 4I65A 4FF3A 5D3DA 5L37A 4X6AH 4RGNA 2RF4A 1QB5D 3I4NH 5CMDA 1A3UA 1Y1VB 2RHSB 1NCVA 3WOFA 4CDDC 4HJ9A 5H1SE 3Q8DA 4DR1Q 3QB3A 1LUZA 2IHFA 1VQOA 1WVLA 1SYGA 3FKIG 4EQOA 1UE1A 4EX5A 2R92B 2UXCL 1N34Q 4WRDA 1KDAA 4C56C 1D5XC 1N36Q 2F0EA 4ZUJA 4IOAA 1H9RA 1QVCA 4XIGS 3H94A 3KF6B 5ELCA 4X65Q 3K58A 5LMNL 4JCVE 2ZJQA 2F0LA 4X65L 1ENAA 2N78A 5I6WA 4IFDI 4L5TA 4JW0A 4P75A 3KLRA 4LFBL 2UUAL 4YHHL 1QILA 4RAUC 2VUMH 1R4QB 1F9QA 5M3MB 5CV6A 3TP8A 2IX0A 2F0KA 2F0NA 4QL5A 3A8JE 3S1MH 1O7ZA 2KHIA 2QEXA 4M8AA 1IYJB 2NVTB 1LO5D 4IJLA 1L1OC 4DV2L 4OELB 1STBA 2PMZB 2E2JH 3S1MB 5IYDG 3D31A 4A3FG 3GTOB 1U0LA 1H95A 3BZCA 1EFWA 3HGBA 4KHPL 1VQ4A 2YV5A 4JBKA 4KHVA 3S16H 2K01A 3CXCA 2JE6I 3PSIA 3H3VH 4A3KB 3A5ZB 4GS3A 1D5MC 1TU2B 4JOIC 1ICWA 1EFID 4BWGB 4LF9Q 4RKBA 1EZ6A 3FHWA 1M90C 2M2LA 4R4TA 3LX0A 3OMCA 4BA1I 2JP1A 1HQRD 2K1BA 3GTKB 1KL9A 1DYQA 2HDLA 3L0OA 1DOKA 3S2DB 3VYTA 4LF5Q 2RHQB 5KGUA 2V1CC 1RHPA 3HOZH 4IFDJ 1QUQB 2OCEA 3L3OC 4GZYC 1ZYRC 1TWAB 2PNHA 2Z4IA 4PZ6A 4OIKA 4X64L 3HOVH 1G2SA 1RD9D 1SAPA 2ATWA 3GTQB 4ZUIA 4ZCKA 4DR2Q 1D2BA 1EEFD 2VQEL 4A75A 1V1PB 3K7AB 3VR4A 4F7XA 4OEMB 5F2DA 2Z6KC 3SK8A 1C8CA 5EJWA 1Y8OB 3OTOL 2NWGA 4LJZC 3A74A 1FNVA 3IKJA 1LTLA 2CFMA 2JJQA 3F2DA 1DGSA 5HY6A 1LABA 1TIID 1WTOA 1STNA 1EWCA 2AQ1B 3HKZB 2EY2A 1HR0Q 1B8AA 3N6RA 4C2MB 3CCQA 2Z8LA 1XNRL 1CK1A 2R3ZA 2MO0A 4A3EH 5KEEA 1GM5A 1VQMA 2R7DA 4H44C 4IOCA 3NBHB 3J81i 1IHZA 5CV9A 3GTJH 2WAQG 1GUTA 1X56A 1O80A 2QEJC 4I7ZC 2NZ1D 2K33A 4OX9L 1EY9A 2Z1CA 1UEAB 4BY1H 2B2VA 1B44D 1PA6A 1F9RA 1OO9B 1D6EC 5EPKA 3PUVA 4FDBA 2I5LX 4K14A 4I7AA 5A2QL 3KDFA 1BOSA 1SEBD 2KVMA 5JJZA 1VQCA 1KIXA 2A6HD 3U9OA 3CW2C 1CT1D 3D8GA 2RQXA 3OSOA 4QMGA 1SFOB 4HIKA 2QA4A 3GTGH 1B3AA 5IGCA 3KDFB 1UUPA 5DEHA 4DV0L 2Q2HA 5BR8L 4KY7A 1HTLD 3UDXA 3PF4A 1VDZA 4N8FA 2B39A 1L0WA 1VQ7A 4DK6C 3MFYA 5EBCA 3K7UC 1DCZA 1SYBA 4RHRA 2QF7A 1TS2A 2M9VA 5IGBA 1S3OA 3R2TA 1NR2A 1SNQA 2K5DA 5CYUA 2F0VA 4C3IH 4OL7A 4ALPA 4IPGA 4XQJA 2GVAA 1UWVA 2Z0SA 4A3DG 1ASZA 2GA4B 5LHY1 1AZQA 2ASBA 5C6AA 1K28A 1Y1VG 3I4NB 2B29A 3NUCA 5IGEA 3CCVA 5LMNW 2J7ZA 2KCMA 1ESRA 4X66L 3HOYB 2EY1A 4BY7B 1B9NA 4A3GG 1E7ZA 1I5FA 4O1NA 5LMUQ 5C44G 3J7AV 4G57A 3CC2A 1O78A 3CQZH 5IWAL 1WTRA 4PG3A 5GAEC 1TY2A 3DXJC 2K32A 4P71A 2K5QA 2XRQD 4CGYB 1SYFA 4ZAIA 3CQZB 4JI7L 1GXDC 4U673 4ME5A 3CF5A 4DR5L 3V2TA 4X3SA 4YWLA 3J81c 3SGIA 3CCMA 1PZJD 1K0RA 3NTHA 1YHBA 3HRZC 1SNCA 4OO1G 2IX1A 5CBEE 2WB1B 2E2IH 2CHBD 1LTTD 1JOQA 2KQ3A 4X62Q 3J7AF 1SDFA 4UHVA 1FNWA 1PDQA 4H0LC 2SNMA 4IUTA 1LYLA 4JI1Q 4A3IB 4IFDH 1PH8A 1SE4A 3TP5A 1E1OA 2NN6I 3HOWG 3J7A5 4DV7Q 4UP7A 1PH9A 2EY5A 5JAVA 1WTPA 3OIPA 1EWIA 2FMMA 1H9SB 1SSOA 1K8MA 3KUPA 1QG7A 3ULJA 4QB4A 1EIYB 2R93G 1BKBA 2NVXB 4IN3A 1HZ9A 4JOIA 5KNDA 1OXSC 2K03A 3KFUA 4HMJA 4WJWA 4LF4Q 1EY0A 1CHQD 3EN2A 5LMUL 4KN4C 1NBWA 1Z6HA 4P74A 1MJCA 4Q5VA 4RHSA 1VQ8A 3CD6A 3A8IE 3CHBD 1GVPA 1IL2A 5E7NA 1CHPD 3J80E 1M1KC 3HOYH 4BY7H 4DV0Q 1WYDA 1L1OA 1YNXA 2CH4W 4CDFC 3HOVB 1JWSD 2VW9A 1SXTA 3SXHA 1H9SA 4AQYL 1G6ZA 5IIFA 1MGSA 3ICEA 1BCPF 5IGDA 4X3TA 3K6OA 2YU9H 3X3NA 3MXPA 3E0JA 1LTSD 2OEOA 4DNIA 3S14B 5JJIA 2WKCA 2NN6G 5M5XH 5CV4A 1X3FA 2CQOA 1F2ZA 1I50H 3QWNA 5LMNQ 3TREA 1PTOC 3M4OB 4JI5L 3BVMA 2JA8B 1LACA 2NTSA 3NQIA 4F87A 2XWJB 1CKNB 4OWXB 5HGQA 3H3VI 3E3XA 4QUCA 3E5SA 4JI8Q 2WACA 1KD1C 2E2JB 4ZRZA 2K05A 4JI2L 4TKOB 1TT2A 3CCRA 4A3FH 4A3MH 3BVGA 2EQSA 4DR6Q 4A93G 2NUCA 1T9HA 4FF1A 4C3HB 4CJ1B 1S72A 4DR5Q 4A3KH 5EKIA 2LSSA 4C3HG 1B2TA 1Q7YC 4HJ7A 1NE3A 5IT9E 2WFWA 1A62A 1M4VA 1SE2A 3CAMA 1PV4A 1AN8A 5IGFA 3BZDB 4DAPA 4IUQA 1HCZA 1FR3A 1NSNS 2F0QA 1I94Q 1RJTA 1EYAA 4R4CA 2VB2X 3HOUH 2EDGA 3S2DH 4TRDA 5IP7G
chains in the Genus database with same CATH topology
4KLKA 2VQEQ 1PFSA 1G51A 3KLWA 2KHJA 4L5RC 4X62L 3F8TA 1RIPA 5GADC 4JI0Q 2ZJPA 2UUCL 5ELOA 5M5WH 2ZJRA 1UE7A 3UDIA 2ZTEA 3G6EA 3LGJA 4MZ9A 4LF6L 4NPSA 2R92H 4BA2I 4JYAQ 1YIJA 4BBRH 3CCJA 1Q82C 5GQOA 1XPUA 3GO5A 5FLMG 2F4VQ 3AYHB 1V9PA 1E24A 1X54A 3PV0A 4LFAL 2KBNA 4HIDA 3CC4A 3TS2A 4GOPC 3PIPA 3OTOQ 4GKKL 4R4OA 1YHAA 4DR4L 2YTYA 3RLNA 5K36G 4JV5Q 4A3GH 1CKOA 1EOVA 2WB1E 3E9HA 4X6AH 3GTOH 1BBWA 1FVIA 2JK8A 4TVAB 4UP8A 3UE0A 4LF8L 4A3LH 3U58A 1N32L 2RF4A 2K5VA 3I4NH 4LNQA 1UE6A 5M3MH 3HOUG 5IWAQ 2VUMG 2RHSB 1AE3A 2K5NA 3NEMA 5J3BA 4HJ9A 2D0OA 5H1SE 3K81C 3EIVA 3Q8DA 3T1HQ 4DV5Q 4JI3Q 4DR1Q 4B3RQ 1LUZA 2IHFA 1VQOA 1N8RC 3FKIG 1K9MC 4P72A 1YEZA 1UE1A 5FJ8G 4EX5A 2XTIA 4HIOA 1VQ5A 1QUQA 1N34Q 2UXCL 4K0KQ 3MXNB 2R92G 4JC0A 3TEHB 1Q1EA 1YVCA 2JA6H 3F2BA 1N36Q 5C3EG 4B3TQ 4AH6A 3OW2A 1VQHA 1VQBA 3ER0A 4GLVB 4IOAA 3CPWA 1IBKL 1QVCA 4LFBQ 4XIGS 2WAQE 2A8VA 3KF6B 1IBLQ 1XMQL 4X65Q 3CPFA 2Z6KA 1CUKA 5LMNL 4DUZL 1SN8A 4JCVE 1AE2A 3WWVA 2ZJQA 1XNQQ 4DK3C 4X65L 2N78A 4GOPB 3BU2A 4L5TA 4IFDI 3I55A 2JEAI 1HNWQ 1KQSA 1HZAA 2PQAA 4P75A 5IY0A 5C0XG 4IO9A 1N33L 2ID0A 4BBSG 4LFBL 1TWFH 2UUAL 4GKJQ 4YHHL 4BXXH 1EIFA 3L2PA 4PZ8A 4DV7L 2VUMH 3FKIH 2Y0SE 2KCTA 1G291 4OX9Q 2IX0A 3STBC 4X66Q 1SFOH 1PHJA 4LUOA 4DKAC 1PH6A 1V1QA 1XMQQ 4QL5A 4A3JH 3S1MH 1L2FA 2KHIA 2QEXA 5IYCG 3TQYA 4DV6L 4AIMA 1IYJB 2Q2UA 1XMOQ 4B3SL 4IJLA 1L1OC 4XTCS 1VQJA 4DV2L 2BH2A 1FJGQ 2E2JH 2JA5G 2Q2IA 3S1QH 5IYDG 3D31A 3B6YA 4A3FG 1U0LA 4JBJA 1H95A 3BZCA 2RCNA 1A63A 1EFWA 1HNXL 4KHPL 1MKHA 1VQ4A 2UXBL 2YV5A 4DAMA 4JBKA 3RLFA 4JI2Q 3AFPA 4QY7A 1C7YA 4NXML 2B63G 4YHHQ 3KF6A 3CCEA 4LF5L 1HNXQ 3BZKA 3CXCA 3S16H 2JE6I 1BBUA 3PSIA 4UPAA 2ZTCA 1JE5A 3H3VH 4DV3Q 4UP9A 2R93H 1RL2A 3A5ZB 4GS3A 1Y14B 4MTNA 4AYBE 2F4VL 4JOIC 3S14H 1C0AA 3HOYG 1E3PA 4BY7G 3PIOA 4LF9Q 4KHPQ 1N9WA 2D0PA 2LXJA 3FHWA 3I4OA 3T1YQ 1S40A 1M90C 3K8AA 4LF6Q 3DLLA 3ULPA 1EYGA 1VQ6A 4LF9L 2EIFA 2BA0A 1P16A 4R4TA 4BA1I 5EAYA 3CCLA 4LFCL 2GVBA 1VQEA 1K3RA 5JEAJ 1E1TA 1KL9A 3H0GH 1YJNA 2MNAA 4DV4L 3HOXH 4LFCQ 2Q2TA 3L0OA 1KRTA 1J5EL 4JI6Q 1SLJA 4LF5Q 3J80i 5C4XH 2RHQB 2QGQA 2V1CC 1HZBA 2E5LQ 3GTKH 3HOZH 1QUQB 2OCEA 4IFDJ 1ASYA 2K52A 2AMCB 2MQHA 4IPDA 2R6GA 4NB3A 4A76A 4A93H 4YY3L 2PNHA 4PZ6A 2YTVA 1R9TH 4X64L 3UDGA 3HOVH 2UXDL 3E0EA 3GDEA 1SE8A 4L5SA 1WCMG 4KI0A 1TWCH 4JI0L 1Q86C 4JI4L 2ATWA 5C44H 4DR2Q 2ES2A 1HR0W 5M3MG 4LWCA 1YITA 1XJVA 2B63H 2VQEL 4HJ8A 4A75A 3RN2A 3RN5A 1QVGA 1LM0A 2OTJA 1OXVA 2CWAA 2Z6KC 4YY3Q 4DUYL 2ZTDA 1U5KA 3H15A 2NVXH 4APVA 3OTOL 3A74A 3CC7A 3GD7A 1LTLA 3HOWH 2CFMA 2JJQA 1W2BA 1SMXA 5IP9H 3F2DA 5JJLA 1VQLA 1GD7A 4PMWA 1DGSA 4X64Q 4A3IG 1HH2P 4YCVA 5HY6A 1N34L 2I0QA 5GAGC 3FP9A 3W5OA 4DPGA 1PH5A 2FXQA 1PYSB 3G71A 5ELNA 1HR0Q 1B8AA 2LXKA 3CCQA 3CMAA 4JI4Q 3PUZA 4GKJL 1XNRL 1HNZQ 3G4SA 2MO0A 4A3EH 1GM5A 1I94L 1VQMA 2R7DA 4O0AA 2DGYA 4IOCA 3NBHB 3J81i 4QGUA 3GTJH 4DV2Q 3S1RH 4Y52H 4ME3A 3PUWA 2WAQG 1A8VA 5IYBH 3F1ZA 1PH3A 4B3TL 4A3CH 3BJUA 1JJCB 3E9IA 4NXNQ 3GTMH 2AWNA 1MJEA 1HR0L 2UXCQ 1X56A 2NVYH 3M4PA 3ZJYC 1WCMH 3L7ZC 3JAMi 1VQPA 2NVQH 2N49A 4OX9L 3DM3A 4BY1H 5C0XI 3G48A 1FGUA 1TWGH 3I2ZA 1QVFA 4WJ4A 2UUBQ 5IE8A 3K80C 1PA6A 5M3FG 4DV6Q 4OWWB 3PUVA 4FDBA 1X3GA 3PO3G 2ZM6Q 4GLAC 1G6PA 2UU9Q 3F2CA 2I5LX 1NTGA 2HHHL 3KDFA 1XNQL 3TRZA 1VQCA 2D62A 2N8NA 1KIXA 4C3JH 1WJJA 1YHQA 2JA8H 2E8GA 1IBLL 1L1OB 1FL0A 1P8LA 2R7ZG 3CW2C 1JT8A 1OXUA 3S24A 1YZ6A 4IPHA 1PH2A 2MO1A 4HIKA 2QA4A 3GTGH 4DR3L 2K14A 3KDFB 3JC66 3KF8B 4JBWA 1PH7A 3I4MH 1Y1VH 3HKZE 5IYDH 1TWAH 4DV0L 4P73A 4BBRG 4B3SQ 4GNXC 2Q2HA 5C4JH 3GTPH 5BR8L 4QJFA 4R4QA 1KXLA 1NJIC 3UDXA 1Y1WG 3PF4A 4AYBG 1I6HH 4L5QA 1X65A 2VZAA 3AQQA 1B7YB 1L0WA 1VQ7A 4DK6C 2JA9A 3S15H 2EXDA 1O7IA 2UU9L 2OTLA 3RNUA 1TWHH 3K7UC 4R4IA 3NENA 4QIWE 2JA8G 4QQBX 5FLXc 1XTDA 3KJPA 3PUXA 3S17H 1S3OA 3I4MG 2YTXA 3PF5A 4YWKA 2YYZA 1NMFA 2L15A 4GN5A 3M9BA 4DR1L 2MFIA 1KAWA 2CWPA 4C3IH 3J80c 2CCZA 4GKKQ 2JA6G 4ALPA 4IPGA 3CMEA 1VQGA 1VQAA 2GVAA 1UWVA 2KENA 4R1JA 2PI2E 2Z0SA 3RR5A 4Y7NH 5C0XJ 1MIUA 3VDYA 2HIXA 2JQOA 4AQYQ 1ASZA 2HT1A 4A3DG 2DUDA 4JI6L 1X55A 2OWOA 2ASBA 1SROA 1Y1VG 2B29A 1XPOA 3J7ZC 2UUAQ 3I4NG 1K8AC 1VQKA 1WOCA 1EQRA 3CCVA 5LMNW 2PQAB 1WI5A 1HNZL 4JBMA 2KCMA 4X66L 3EBEA 3U50C 3KJOA 4A3GG 5IT9c 4GN4B 1E7ZA 1B70B 3S1NH 2VL6A 4DR7Q 3U4VA 1I5FA 3I56A 5LMUQ 5C44G 5AJ3Q 1Y1WH 4GNXB 2E5LL 3CC2A 4RG1A 4B3ML 1Q46A 3CQZH 3ERSX 1Q1BA 5IWAL 4PG3A 2WP8J 5GAEC 2NZOA 2ALYB 4P71A 4YCWA 1OXXK 2IT1A 1BVSA 4YWMA 3IRBA 5IYCH 4A4IA 4GLXA 4BBSH 1N32Q 4JI7L 3JAMc 1E22A 4A3BH 1J6QA 4LF4L 1FJGL 4OO1I 1CKNA 2PI2A 3CF5A 4A3CG 4DR5L 4YWLA 3S2HH 1IBKQ 1KC8C 3J81c 3SGIA 2UUBL 3CCMA 4A3MG 4B3RL 1HNWL 4EQ5A 1K0RA 2K4KA 1YBYA 2I5HA 3HFZB 1N36L 2AKWB 1YHBA 4DAYB 4C2MH 3M4OH 3W1GA 4OO1G 1KHIA 3PGZA 2IX1A 2K75A 4LUVA 1UE5A 2UXBQ 4OXPA 2E2IH 5DLQE 2JA5H 4J15A 2BA1A 1HJPA 2R7FA 4BXXG 4PZ7A 1VQIA 4X62Q 2N3SA 5GAHC 1PYBA 3M3YH 1J5EQ 1YJWA 3W1BA 1JB7A 4YCUA 4DR6L 2A1AA 1X6OA 4BY1G 4TQUS 1LYLA 4JI1Q 3UDFA 3M4QA 4A3BG 1PH8A 2I5MX 3H0GG 3T1YL 1X9NA 1E1OA 1Q12A 2NN6I 5M3FH 1CSPA 3HOWG 4POFA 3J7A5 1JJGA 3HKZG 3CP0A 5FJ8H 4OWTB 5C4XG 4DV7Q 1QZHA 3STBD 4UP7A 1PH9A 1I3QH 1WFQA 3I7FA 3KYHC 4IPCA 4HJ5A 2F52A 5GROA 4IJHA 1UEBA 3U4ZA 1EWIA 4DV3L 4LFAQ 3T1HL 4RMFA 4A3EG 2HQLA 4LF7Q 3ULJA 1EIYB 2R93G 2K50A 5JEAG 1BKBA 2A19A 3MEFA 1HZ9A 2AHOB 5IYBG 4JOIA 3GTLH 5BR8Q 3ULLA 4JI3L 1OXSC 1CSQA 4LF8Q 1VQNA 3KFUA 1D7QA 1Z9FA 1EQQA 4LF4Q 3EN2A 2B3GA 5LMUL 2WB1G 4MNOA 5JJKA 4HJAA 1NBWA 4P74A 1MJCA 3CCSA 1VQ8A 2OQ0A 3CD6A 1IL2A 1GVPA 1GO3E 5M5YH 4DR3Q 3RLOA 1VQ9A 5E7NA 1EUJA 1M1KC 3HOYH 4BY7H 3KOJA 4DR4Q 2F3IA 1TXYA 4DV0Q 1WYDA 4DV4Q 1L1OA 1OXTA 1YNXA 4POGA 3D0FA 2VW9A 5C3EH 1SR3A 4A3JG 1XNRQ 3HOVG 2OQKA 4AQYL 1VCIA 2BH8A 2UXDQ 3ICEA 4WJ3M 1W3SA 4LW1A 4JI7Q 2JA7G 1Z47A 1NY4A 4A3KG 4LF7L 1Q81C 4B3MQ 4KHZA 4OONA 2UUCQ 2YU9H 3HOZG 1PVOA 1QZGA 1AH9A 2VS1A 3HKSA 2XGTA 4UY8C 4DNIA 1N33Q 5JJIA 3K0XA 1JMCA 4JV5L 4C3HH 2NN6G 2CKZB 5M5XH 2HHHQ 4JG2A 2K5HA 4DUYQ 4DR7L 2HIVA 2VQFQ 1X3FA 2CQOA 1I50H 4LUZA 5LMNQ 4DUZQ 3TREA 2JEBI 1PH4A 4DR2L 2ZM6L 3PO3H 4JI5L 4DV1Q 1KRSA 2C35B 4HIMA 1K73C 4DV5L 2NZHA 3A0JA 3TS0A 4OWXB 1CKNB 5HGQA 4GN3B 4H02A 4O2DA 1IBML 2IHEA 5AJ3L 2E2HH 3H3VI 1C9OA 2NVTH 2H5XA 1K83H 4JI8Q 5IP7H 2JA7H 2Y0SG 1XPRA 3RZDH 3OYYA 1KD1C 5IP9G 2R7ZH 1X3EA 3PO2G 4K0KL 4JI2L 4JI8L 1PH1A 4NXNL 3CCRA 1V43A 4A3IH 4A3FH 1VS0A 1SRUA 3A5UA 4A3MH 4DR6Q 2EQSA 3AEVA 4A93G 5FLMH 1JJ2A 3GTQH 1T9HA 2GN5A 1IBMQ 4A3DH 3RZOH 2VNUD 4NXMQ 1XMOL 3K7AH 1S72A 4DR5Q 4A3KH 2LSSA 1YJ9A 1Q7YC 4DV1L 4HJ7A 4JI5Q 1D8LA 3M7NA 1NE3A 1GKHA 2WFWA 1A62A 4JI1L 1PV4A 1HZCA 3CAMA 1VQFA 1Q8KA 3AFQA 1IXRA 3PCOB 2VQFL 3NELA 2AWOA 1OTCA 1CKMA 3J81j 4GNXA 1YI2A 2VY3A 1K8GA 2PMZE 1I94Q 4IFDG 1IZ6A 2IY5B 4A3LG 1A0IA 4GOPA 3UE1A 3M85A 3PUYA 3PO2H 4R4CA 1NMGA 3HOUH 4JYAL 3CCUA 3S2DH 1VQDA 3HOXG 5IP7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLK A;  2VQE Q;  1PFS A;  1G51 A;  3KLW A;  2KHJ A;  4L5R C;  4X62 L;  3F8T A;  1RIP A;  5GAD C;  4JI0 Q;  2ZJP A;  2UUC L;  5ELO A;  5M5W H;  2ZJR A;  1UE7 A;  3UDI A;  2ZTE A;  3G6E A;  3LGJ A;  4MZ9 A;  4LF6 L;  4NPS A;  2R92 H;  4BA2 I;  4JYA Q;  1YIJ A;  4BBR H;  3CCJ A;  1Q82 C;  5GQO A;  1XPU A;  3GO5 A;  5FLM G;  2F4V Q;  3AYH B;  1V9P A;  1E24 A;  1X54 A;  3PV0 A;  4LFA L;  2KBN A;  4HID A;  3CC4 A;  3TS2 A;  4GOP C;  3PIP A;  3OTO Q;  4GKK L;  4R4O A;  1YHA A;  4DR4 L;  2YTY A;  3RLN A;  5K36 G;  4JV5 Q;  4A3G H;  1CKO A;  1EOV A;  2WB1 E;  3E9H A;  4X6A H;  3GTO H;  1BBW A;  1FVI A;  2JK8 A;  4TVA B;  4UP8 A;  3UE0 A;  4LF8 L;  4A3L H;  3U58 A;  1N32 L;  2RF4 A;  2K5V A;  3I4N H;  4LNQ A;  1UE6 A;  5M3M H;  3HOU G;  5IWA Q;  2VUM G;  2RHS B;  1AE3 A;  2K5N A;  3NEM A;  5J3B A;  4HJ9 A;  2D0O A;  5H1S E;  3K81 C;  3EIV A;  3Q8D A;  3T1H Q;  4DV5 Q;  4JI3 Q;  4DR1 Q;  4B3R Q;  1LUZ A;  2IHF A;  1VQO A;  1N8R C;  3FKI G;  1K9M C;  4P72 A;  1YEZ A;  1UE1 A;  5FJ8 G;  4EX5 A;  2XTI A;  4HIO A;  1VQ5 A;  1QUQ A;  1N34 Q;  2UXC L;  4K0K Q;  3MXN B;  2R92 G;  4JC0 A;  3TEH B;  1Q1E A;  1YVC A;  2JA6 H;  3F2B A;  1N36 Q;  5C3E G;  4B3T Q;  4AH6 A;  3OW2 A;  1VQH A;  1VQB A;  3ER0 A;  4GLV B;  4IOA A;  3CPW A;  1IBK L;  1QVC A;  4LFB Q;  4XIG S;  2WAQ E;  2A8V A;  3KF6 B;  1IBL Q;  1XMQ L;  4X65 Q;  3CPF A;  2Z6K A;  1CUK A;  5LMN L;  4DUZ L;  1SN8 A;  4JCV E;  1AE2 A;  3WWV A;  2ZJQ A;  1XNQ Q;  4DK3 C;  4X65 L;  2N78 A;  4GOP B;  3BU2 A;  4L5T A;  4IFD I;  3I55 A;  2JEA I;  1HNW Q;  1KQS A;  1HZA A;  2PQA A;  4P75 A;  5IY0 A;  5C0X G;  4IO9 A;  1N33 L;  2ID0 A;  4BBS G;  4LFB L;  1TWF H;  2UUA L;  4GKJ Q;  4YHH L;  4BXX H;  1EIF A;  3L2P A;  4PZ8 A;  4DV7 L;  2VUM H;  3FKI H;  2Y0S E;  2KCT A;  1G29 1;  4OX9 Q;  2IX0 A;  3STB C;  4X66 Q;  1SFO H;  1PHJ A;  4LUO A;  4DKA C;  1PH6 A;  1V1Q A;  1XMQ Q;  4QL5 A;  4A3J H;  3S1M H;  1L2F A;  2KHI A;  2QEX A;  5IYC G;  3TQY A;  4DV6 L;  4AIM A;  1IYJ B;  2Q2U A;  1XMO Q;  4B3S L;  4IJL A;  1L1O C;  4XTC S;  1VQJ A;  4DV2 L;  2BH2 A;  1FJG Q;  2E2J H;  2JA5 G;  2Q2I A;  3S1Q H;  5IYD G;  3D31 A;  3B6Y A;  4A3F G;  1U0L A;  4JBJ A;  1H95 A;  3BZC A;  2RCN A;  1A63 A;  1EFW A;  1HNX L;  4KHP L;  1MKH A;  1VQ4 A;  2UXB L;  2YV5 A;  4DAM A;  4JBK A;  3RLF A;  4JI2 Q;  3AFP A;  4QY7 A;  1C7Y A;  4NXM L;  2B63 G;  4YHH Q;  3KF6 A;  3CCE A;  4LF5 L;  1HNX Q;  3BZK A;  3CXC A;  3S16 H;  2JE6 I;  1BBU A;  3PSI A;  4UPA A;  2ZTC A;  1JE5 A;  3H3V H;  4DV3 Q;  4UP9 A;  2R93 H;  1RL2 A;  3A5Z B;  4GS3 A;  1Y14 B;  4MTN A;  4AYB E;  2F4V L;  4JOI C;  3S14 H;  1C0A A;  3HOY G;  1E3P A;  4BY7 G;  3PIO A;  4LF9 Q;  4KHP Q;  1N9W A;  2D0P A;  2LXJ A;  3FHW A;  3I4O A;  3T1Y Q;  1S40 A;  1M90 C;  3K8A A;  4LF6 Q;  3DLL A;  3ULP A;  1EYG A;  1VQ6 A;  4LF9 L;  2EIF A;  2BA0 A;  1P16 A;  4R4T A;  4BA1 I;  5EAY A;  3CCL A;  4LFC L;  2GVB A;  1VQE A;  1K3R A;  5JEA J;  1E1T A;  1KL9 A;  3H0G H;  1YJN A;  2MNA A;  4DV4 L;  3HOX H;  4LFC Q;  2Q2T A;  3L0O A;  1KRT A;  1J5E L;  4JI6 Q;  1SLJ A;  4LF5 Q;  3J80 i;  5C4X H;  2RHQ B;  2QGQ A;  2V1C C;  1HZB A;  2E5L Q;  3GTK H;  3HOZ H;  1QUQ B;  2OCE A;  4IFD J;  1ASY A;  2K52 A;  2AMC B;  2MQH A;  4IPD A;  2R6G A;  4NB3 A;  4A76 A;  4A93 H;  4YY3 L;  2PNH A;  4PZ6 A;  2YTV A;  1R9T H;  4X64 L;  3UDG A;  3HOV H;  2UXD L;  3E0E A;  3GDE A;  1SE8 A;  4L5S A;  1WCM G;  4KI0 A;  1TWC H;  4JI0 L;  1Q86 C;  4JI4 L;  2ATW A;  5C44 H;  4DR2 Q;  2ES2 A;  1HR0 W;  5M3M G;  4LWC A;  1YIT A;  1XJV A;  2B63 H;  2VQE L;  4HJ8 A;  4A75 A;  3RN2 A;  3RN5 A;  1QVG A;  1LM0 A;  2OTJ A;  1OXV A;  2CWA A;  2Z6K C;  4YY3 Q;  4DUY L;  2ZTD A;  1U5K A;  3H15 A;  2NVX H;  4APV A;  3OTO L;  3A74 A;  3CC7 A;  3GD7 A;  1LTL A;  3HOW H;  2CFM A;  2JJQ A;  1W2B A;  1SMX A;  5IP9 H;  3F2D A;  5JJL A;  1VQL A;  1GD7 A;  4PMW A;  1DGS A;  4X64 Q;  4A3I G;  1HH2 P;  4YCV A;  5HY6 A;  1N34 L;  2I0Q A;  5GAG C;  3FP9 A;  3W5O A;  4DPG A;  1PH5 A;  2FXQ A;  1PYS B;  3G71 A;  5ELN A;  1HR0 Q;  1B8A A;  2LXK A;  3CCQ A;  3CMA A;  4JI4 Q;  3PUZ A;  4GKJ L;  1XNR L;  1HNZ Q;  3G4S A;  2MO0 A;  4A3E H;  1GM5 A;  1I94 L;  1VQM A;  2R7D A;  4O0A A;  2DGY A;  4IOC A;  3NBH B;  3J81 i;  4QGU A;  3GTJ H;  4DV2 Q;  3S1R H;  4Y52 H;  4ME3 A;  3PUW A;  2WAQ G;  1A8V A;  5IYB H;  3F1Z A;  1PH3 A;  4B3T L;  4A3C H;  3BJU A;  1JJC B;  3E9I A;  4NXN Q;  3GTM H;  2AWN A;  1MJE A;  1HR0 L;  2UXC Q;  1X56 A;  2NVY H;  3M4P A;  3ZJY C;  1WCM H;  3L7Z C;  3JAM i;  1VQP A;  2NVQ H;  2N49 A;  4OX9 L;  3DM3 A;  4BY1 H;  5C0X I;  3G48 A;  1FGU A;  1TWG H;  3I2Z A;  1QVF A;  4WJ4 A;  2UUB Q;  5IE8 A;  3K80 C;  1PA6 A;  5M3F G;  4DV6 Q;  4OWW B;  3PUV A;  4FDB A;  1X3G A;  3PO3 G;  2ZM6 Q;  4GLA C;  1G6P A;  2UU9 Q;  3F2C A;  2I5L X;  1NTG A;  2HHH L;  3KDF A;  1XNQ L;  3TRZ A;  1VQC A;  2D62 A;  2N8N A;  1KIX A;  4C3J H;  1WJJ A;  1YHQ A;  2JA8 H;  2E8G A;  1IBL L;  1L1O B;  1FL0 A;  1P8L A;  2R7Z G;  3CW2 C;  1JT8 A;  1OXU A;  3S24 A;  1YZ6 A;  4IPH A;  1PH2 A;  2MO1 A;  4HIK A;  2QA4 A;  3GTG H;  4DR3 L;  2K14 A;  3KDF B;  3JC6 6;  3KF8 B;  4JBW A;  1PH7 A;  3I4M H;  1Y1V H;  3HKZ E;  5IYD H;  1TWA H;  4DV0 L;  4P73 A;  4BBR G;  4B3S Q;  4GNX C;  2Q2H A;  5C4J H;  3GTP H;  5BR8 L;  4QJF A;  4R4Q A;  1KXL A;  1NJI C;  3UDX A;  1Y1W G;  3PF4 A;  4AYB G;  1I6H H;  4L5Q A;  1X65 A;  2VZA A;  3AQQ A;  1B7Y B;  1L0W A;  1VQ7 A;  4DK6 C;  2JA9 A;  3S15 H;  2EXD A;  1O7I A;  2UU9 L;  2OTL A;  3RNU A;  1TWH H;  3K7U C;  4R4I A;  3NEN A;  4QIW E;  2JA8 G;  4QQB X;  5FLX c;  1XTD A;  3KJP A;  3PUX A;  3S17 H;  1S3O A;  3I4M G;  2YTX A;  3PF5 A;  4YWK A;  2YYZ A;  1NMF A;  2L15 A;  4GN5 A;  3M9B A;  4DR1 L;  2MFI A;  1KAW A;  2CWP A;  4C3I H;  3J80 c;  2CCZ A;  4GKK Q;  2JA6 G;  4ALP A;  4IPG A;  3CME A;  1VQG A;  1VQA A;  2GVA A;  1UWV A;  2KEN A;  4R1J A;  2PI2 E;  2Z0S A;  3RR5 A;  4Y7N H;  5C0X J;  1MIU A;  3VDY A;  2HIX A;  2JQO A;  4AQY Q;  1ASZ A;  2HT1 A;  4A3D G;  2DUD A;  4JI6 L;  1X55 A;  2OWO A;  2ASB A;  1SRO A;  1Y1V G;  2B29 A;  1XPO A;  3J7Z C;  2UUA Q;  3I4N G;  1K8A C;  1VQK A;  1WOC A;  1EQR A;  3CCV A;  5LMN W;  2PQA B;  1WI5 A;  1HNZ L;  4JBM A;  2KCM A;  4X66 L;  3EBE A;  3U50 C;  3KJO A;  4A3G G;  5IT9 c;  4GN4 B;  1E7Z A;  1B70 B;  3S1N H;  2VL6 A;  4DR7 Q;  3U4V A;  1I5F A;  3I56 A;  5LMU Q;  5C44 G;  5AJ3 Q;  1Y1W H;  4GNX B;  2E5L L;  3CC2 A;  4RG1 A;  4B3M L;  1Q46 A;  3CQZ H;  3ERS X;  1Q1B A;  5IWA L;  4PG3 A;  2WP8 J;  5GAE C;  2NZO A;  2ALY B;  4P71 A;  4YCW A;  1OXX K;  2IT1 A;  1BVS A;  4YWM A;  3IRB A;  5IYC H;  4A4I A;  4GLX A;  4BBS H;  1N32 Q;  4JI7 L;  3JAM c;  1E22 A;  4A3B H;  1J6Q A;  4LF4 L;  1FJG L;  4OO1 I;  1CKN A;  2PI2 A;  3CF5 A;  4A3C G;  4DR5 L;  4YWL A;  3S2H H;  1IBK Q;  1KC8 C;  3J81 c;  3SGI A;  2UUB L;  3CCM A;  4A3M G;  4B3R L;  1HNW L;  4EQ5 A;  1K0R A;  2K4K A;  1YBY A;  2I5H A;  3HFZ B;  1N36 L;  2AKW B;  1YHB A;  4DAY B;  4C2M H;  3M4O H;  3W1G A;  4OO1 G;  1KHI A;  3PGZ A;  2IX1 A;  2K75 A;  4LUV A;  1UE5 A;  2UXB Q;  4OXP A;  2E2I H;  5DLQ E;  2JA5 H;  4J15 A;  2BA1 A;  1HJP A;  2R7F A;  4BXX G;  4PZ7 A;  1VQI A;  4X62 Q;  2N3S A;  5GAH C;  1PYB A;  3M3Y H;  1J5E Q;  1YJW A;  3W1B A;  1JB7 A;  4YCU A;  4DR6 L;  2A1A A;  1X6O A;  4BY1 G;  4TQU S;  1LYL A;  4JI1 Q;  3UDF A;  3M4Q A;  4A3B G;  1PH8 A;  2I5M X;  3H0G G;  3T1Y L;  1X9N A;  1E1O A;  1Q12 A;  2NN6 I;  5M3F H;  1CSP A;  3HOW G;  4POF A;  3J7A 5;  1JJG A;  3HKZ G;  3CP0 A;  5FJ8 H;  4OWT B;  5C4X G;  4DV7 Q;  1QZH A;  3STB D;  4UP7 A;  1PH9 A;  1I3Q H;  1WFQ A;  3I7F A;  3KYH C;  4IPC A;  4HJ5 A;  2F52 A;  5GRO A;  4IJH A;  1UEB A;  3U4Z A;  1EWI A;  4DV3 L;  4LFA Q;  3T1H L;  4RMF A;  4A3E G;  2HQL A;  4LF7 Q;  3ULJ A;  1EIY B;  2R93 G;  2K50 A;  5JEA G;  1BKB A;  2A19 A;  3MEF A;  1HZ9 A;  2AHO B;  5IYB G;  4JOI A;  3GTL H;  5BR8 Q;  3ULL A;  4JI3 L;  1OXS C;  1CSQ A;  4LF8 Q;  1VQN A;  3KFU A;  1D7Q A;  1Z9F A;  1EQQ A;  4LF4 Q;  3EN2 A;  2B3G A;  5LMU L;  2WB1 G;  4MNO A;  5JJK A;  4HJA A;  1NBW A;  4P74 A;  1MJC A;  3CCS A;  1VQ8 A;  2OQ0 A;  3CD6 A;  1IL2 A;  1GVP A;  1GO3 E;  5M5Y H;  4DR3 Q;  3RLO A;  1VQ9 A;  5E7N A;  1EUJ A;  1M1K C;  3HOY H;  4BY7 H;  3KOJ A;  4DR4 Q;  2F3I A;  1TXY A;  4DV0 Q;  1WYD A;  4DV4 Q;  1L1O A;  1OXT A;  1YNX A;  4POG A;  3D0F A;  2VW9 A;  5C3E H;  1SR3 A;  4A3J G;  1XNR Q;  3HOV G;  2OQK A;  4AQY L;  1VCI A;  2BH8 A;  2UXD Q;  3ICE A;  4WJ3 M;  1W3S A;  4LW1 A;  4JI7 Q;  2JA7 G;  1Z47 A;  1NY4 A;  4A3K G;  4LF7 L;  1Q81 C;  4B3M Q;  4KHZ A;  4OON A;  2UUC Q;  2YU9 H;  3HOZ G;  1PVO A;  1QZG A;  1AH9 A;  2VS1 A;  3HKS A;  2XGT A;  4UY8 C;  4DNI A;  1N33 Q;  5JJI A;  3K0X A;  1JMC A;  4JV5 L;  4C3H H;  2NN6 G;  2CKZ B;  5M5X H;  2HHH Q;  4JG2 A;  2K5H A;  4DUY Q;  4DR7 L;  2HIV A;  2VQF Q;  1X3F A;  2CQO A;  1I50 H;  4LUZ A;  5LMN Q;  4DUZ Q;  3TRE A;  2JEB I;  1PH4 A;  4DR2 L;  2ZM6 L;  3PO3 H;  4JI5 L;  4DV1 Q;  1KRS A;  2C35 B;  4HIM A;  1K73 C;  4DV5 L;  2NZH A;  3A0J A;  3TS0 A;  4OWX B;  1CKN B;  5HGQ A;  4GN3 B;  4H02 A;  4O2D A;  1IBM L;  2IHE A;  5AJ3 L;  2E2H H;  3H3V I;  1C9O A;  2NVT H;  2H5X A;  1K83 H;  4JI8 Q;  5IP7 H;  2JA7 H;  2Y0S G;  1XPR A;  3RZD H;  3OYY A;  1KD1 C;  5IP9 G;  2R7Z H;  1X3E A;  3PO2 G;  4K0K L;  4JI2 L;  4JI8 L;  1PH1 A;  4NXN L;  3CCR A;  1V43 A;  4A3I H;  4A3F H;  1VS0 A;  1SRU A;  3A5U A;  4A3M H;  4DR6 Q;  2EQS A;  3AEV A;  4A93 G;  5FLM H;  1JJ2 A;  3GTQ H;  1T9H A;  2GN5 A;  1IBM Q;  4A3D H;  3RZO H;  2VNU D;  4NXM Q;  1XMO L;  3K7A H;  1S72 A;  4DR5 Q;  4A3K H;  2LSS A;  1YJ9 A;  1Q7Y C;  4DV1 L;  4HJ7 A;  4JI5 Q;  1D8L A;  3M7N A;  1NE3 A;  1GKH A;  2WFW A;  1A62 A;  4JI1 L;  1PV4 A;  1HZC A;  3CAM A;  1VQF A;  1Q8K A;  3AFQ A;  1IXR A;  3PCO B;  2VQF L;  3NEL A;  2AWO A;  1OTC A;  1CKM A;  3J81 j;  4GNX A;  1YI2 A;  2VY3 A;  1K8G A;  2PMZ E;  1I94 Q;  4IFD G;  1IZ6 A;  2IY5 B;  4A3L G;  1A0I A;  4GOP A;  3UE1 A;  3M85 A;  3PUY A;  3PO2 H;  4R4C A;  1NMG A;  3HOU H;  4JYA L;  3CCU A;  3S2D H;  1VQD A;  3HOX G;  5IP7 G; 
#chains in the Genus database with same CATH topology
 5A35 A;  4G7O C;  4KJO A;  5LL6 X;  4C3I G;  1PFS A;  3SEB A;  3KLW A;  2MUY A;  1RIP A;  1AW7 A;  1SNO A;  2F4I A;  4JI0 Q;  4ZK9 B;  3PQI A;  1EIG A;  3DEP A;  1STG A;  2F0O A;  3G6E A;  2O4X A;  4NPS A;  2R92 H;  1RDP D;  4BA2 I;  1JC7 A;  3T13 A;  4QIW B;  5FLM G;  2C9O A;  3AYH B;  3BG3 A;  3LWE A;  3PV0 A;  4HID A;  3C1E A;  3PIP A;  1YHA A;  2YTY A;  3MC0 B;  3RLN A;  1YNN C;  4A3G H;  3HG9 A;  1CKO A;  3QG1 A;  2WB1 E;  1S5E D;  3E9H A;  3I73 A;  1FVI A;  4UP8 A;  4LF8 L;  1CA5 A;  3U58 A;  1V1P A;  2K5V A;  4A3B B;  1UE6 A;  4AYB B;  2LY7 A;  1AE3 A;  5J3B A;  2D0O A;  1NR4 A;  3EIV A;  4IZ8 A;  2ICE C;  2RKS A;  5EPJ A;  4CKB A;  4C3J G;  2E76 C;  4P72 A;  2EJF C;  5BN3 A;  1YEZ A;  1STH A;  2H4O A;  2XTI A;  4EQN A;  4FXG C;  4J8Q A;  2EYF A;  1WTX A;  3TEH B;  4AH6 A;  2R7Z B;  4CDE C;  1B3Q A;  3K0Y A;  4GLV B;  3J7Y W;  4ZYS A;  2WAQ E;  1LTR D;  2A8V A;  1XMQ L;  3CPF A;  3MXG A;  1SN8 A;  1ENF A;  3N52 A;  1TR5 A;  5HUR A;  2PO4 A;  4GOP B;  1HNW Q;  1S5C D;  2PQA A;  2LKV A;  1I3Q B;  2EPB A;  5C0X G;  4IO9 A;  4BBS G;  3A56 A;  4GKJ Q;  4M1U B;  1Q8I A;  2NTT A;  4PZ8 A;  4FO2 A;  3FKI H;  2KCT A;  1DJR D;  4OX9 Q;  1I4G A;  1SFO H;  1PHJ A;  3T4A C;  1LTB D;  1KTK A;  2LFN A;  1ILP A;  1I4X A;  4A3J H;  4LF4 L;  3TQY A;  1JR0 D;  4AIM A;  4RGM A;  1FJG Q;  2JA5 G;  1UAP A;  1PTO F;  4JBJ A;  2F0H A;  3SDZ A;  5C3E B;  2RCN A;  2PQE A;  1MKH A;  2UXB L;  5M5Y B;  4NXM L;  4JI2 Q;  4QY7 A;  5IOD A;  4YHH Q;  3CCE A;  4LF5 L;  3NE5 B;  4RH6 A;  1BBU A;  4P2C B;  1PRT B;  2ZTC A;  4DV3 Q;  4UP9 A;  1A6X A;  1RL2 A;  2O2L D;  1UNS A;  1S5B D;  2OT2 A;  1Y14 B;  5J1Z A;  3HOY G;  4BY7 G;  4XT1 B;  3K5N A;  1SND A;  1JOR A;  1TS4 A;  3C3L A;  3K8A A;  1ENC A;  4LF6 Q;  3DLL A;  1BDO A;  2EIF A;  3CCL A;  5EAY A;  2HCI A;  2IW3 A;  3H0G H;  1YJN A;  5E4W C;  2BDN A;  2MNA A;  3HOX H;  1J5E L;  1JWM D;  4JI6 Q;  1SLJ A;  3J80 i;  2QGQ A;  3S1Q B;  2AMC B;  4IPD A;  1DON A;  5BN4 A;  4PMB A;  4IUV A;  2UXD L;  4L5S A;  1WCM G;  4BY1 B;  5E1F A;  5I9P A;  4KI0 A;  2ICI A;  2B8F A;  1EL0 A;  4JI4 L;  5C44 H;  2ES2 A;  2D2C C;  2QIL A;  5M3M G;  1QNK A;  1YIT A;  1XJV A;  4K2L A;  4R8N A;  1R4P B;  3A55 A;  3A7L A;  3Q23 A;  4HJ8 A;  3RN5 A;  5ISR A;  1OXV A;  2CWA A;  2OTJ A;  2ZTD A;  3QR8 A;  1PTO D;  5E4X A;  3H15 A;  1H9M A;  1PRT C;  4APV A;  1PXU A;  3GD7 A;  1O7Y A;  1W2B A;  2A6E C;  2R61 A;  2BE5 D;  4NKL A;  1N34 L;  2I0Q A;  1C4Q A;  1YNJ D;  3FP9 A;  4DPG A;  5GAG C;  3HOW B;  2L9H A;  1PYS B;  1PFN A;  5ELN A;  2LXK A;  1PZK D;  1B9M A;  3MA2 B;  2K04 A;  3G4S A;  2J0T D;  5C5L A;  4C1N I;  1GUN A;  2K5W A;  1I50 B;  4JPB W;  4DV2 Q;  2Z6B A;  4QGU A;  5I4D A;  4ME3 A;  4A3C H;  3F1Z A;  1AFP A;  3E9I A;  4NXN Q;  3GTM H;  2B2V C;  2PNR C;  2NVY H;  3ZJY C;  1VQP A;  1PTO H;  1IW7 D;  4A3D B;  3NWS A;  5C0X I;  2HUG A;  1A3V A;  1TWG H;  3I2Z A;  4WJ4 A;  1QVF A;  5CV5 A;  3K80 C;  2NBF A;  2XN9 C;  2PZU A;  4UAI A;  2EYP A;  1X3G A;  3PO3 G;  1D1K A;  1G6P A;  2B2T A;  4XQQ A;  3E6Z X;  1YHQ A;  2JA8 H;  1L1O B;  1FL0 A;  5FKA C;  1WTH A;  1QNU A;  2VUM B;  3GTJ B;  5C3W A;  4CJ2 C;  3S24 A;  1PH2 A;  4ULL A;  3GV6 A;  4B9X A;  3JC6 6;  1CQV A;  2G9D A;  3LWU A;  3HKZ E;  4BBR G;  3Q0A A;  4QJF A;  1HXY D;  1NJI C;  5T1G A;  4AYB G;  1I6H H;  3BVZ A;  2VZA A;  1B7Y B;  1O7I A;  5JOB A;  1TWH H;  4R4I A;  2JA8 G;  4QQB X;  5FLX c;  3F2U A;  1Z7T A;  3Q24 A;  4HAE A;  2L15 A;  1KAW A;  1PFM A;  2CWP A;  2CCZ A;  2F0T A;  1F77 A;  4DR3 L;  4R1J A;  2PI2 E;  4AQY Q;  1ROD A;  2DUD A;  1J9O A;  1X55 A;  2RSN A;  3ND8 A;  4CJ0 B;  1SE3 A;  2E2I B;  1KAB A;  2DNE A;  1VMC A;  1H9J A;  1WOC A;  1EQR A;  2PQA B;  2XRS D;  3P1H A;  4R9W A;  3K59 A;  1WI5 A;  4FXD A;  1HNZ L;  4JBM A;  4MN3 A;  4K2K A;  3KJO A;  5C0X H;  5IT9 c;  4DR7 Q;  2VL6 A;  3U4V A;  2FJ2 A;  2NVY B;  4GNX B;  1SYC A;  1LT3 D;  3ITP A;  2WP8 J;  3TDQ A;  3IRB A;  3R2I A;  1N32 Q;  1DZ1 A;  2FHT A;  3JAM c;  1J6Q A;  3S16 B;  2PI2 A;  2FMC A;  5JEA H;  2R93 B;  1IBK Q;  5A2Q E;  3I91 A;  2KCN A;  4EQ5 A;  1HRJ A;  2K4K A;  1VF7 A;  3EVQ A;  2AKW B;  4C2M H;  3W1G A;  2K75 A;  3OPO A;  2UXB Q;  3T56 B;  2R7F A;  4BXX G;  1B1Z A;  3J81 E;  1PYB A;  5DM6 3;  3M3Y H;  3W1B A;  1JB7 A;  4DR6 L;  2A1A A;  1X6O A;  4RCO A;  4C1N K;  5C44 B;  1EU3 A;  3M4Q A;  4O42 A;  2RCF A;  5M5W B;  2B63 B;  1B4O A;  3FMC A;  3H0G G;  1X9N A;  3S1N B;  5M3F H;  1CSP A;  2XVS A;  2DJG C;  3HKZ G;  5FJ8 H;  5COY A;  1QZH A;  3GQB A;  1D5Z C;  3I7F A;  4IPC A;  4HJ5 A;  5GRO A;  1WD1 A;  4IJH A;  1UEB A;  3K57 A;  4Q0F A;  2E2D C;  1T5E A;  3DWA A;  3T1H L;  4RMF A;  4A3G B;  2EJM A;  3MTS A;  4A3E G;  2HQL A;  1LV9 A;  2BDO A;  2K50 A;  2K6A A;  4CKE A;  1JIC A;  2IWH A;  1EQT A;  2AHO B;  3OWF A;  3GTL H;  4A3J B;  3JAM L;  1Z9F A;  3NBH A;  3J80 L;  3TZD A;  2WB1 G;  3S1R B;  2QKI C;  1WTW A;  1S5F D;  4K5X A;  2B2Y A;  3BDO A;  3GTM B;  5M5Y H;  1TWC B;  1PYW D;  3L9A X;  3KOJ A;  2F3I A;  1ML0 D;  3P75 A;  1TXY A;  4A3E B;  4NMZ A;  5JVG 3;  1OXT A;  2F0F A;  4DAV A;  3D0F A;  3AMU A;  1STE A;  2BH8 A;  2BCO A;  1SJH D;  3NTI A;  2KUM A;  2B2T C;  4NW2 A;  3D4R A;  1NY4 A;  2IPK D;  4LF7 L;  2AUJ D;  1PVO A;  2VS1 A;  5IGG A;  1QCB D;  2RA4 A;  4YIJ A;  1JMC A;  3JAM E;  1TVX A;  2HHH Q;  2N88 A;  4JG2 A;  2K5H A;  1EY6 A;  1CI3 M;  4DUY Q;  4LUZ A;  2JEB I;  5COR A;  4WFN 3;  3PO3 H;  4IUU A;  1HUN A;  4DV5 L;  3A0J A;  3TS0 A;  3LNN A;  3BS1 A;  1EYD A;  1IBM L;  3V96 A;  5AJ3 L;  2E2H H;  1L0X B;  2H5X A;  1K83 H;  1GHJ A;  2P5Z X;  3I70 A;  5ELE A;  3OYY A;  5IP9 G;  3PO2 G;  1LTI D;  3EJI A;  1PH1 A;  1V43 A;  1VS0 A;  3A5U A;  4XYQ A;  2ZXR A;  2JYO A;  1IKL A;  1MSG A;  3VYR A;  2NVQ B;  1JJ2 A;  2GN5 A;  1IBM Q;  4A3D H;  3RZO H;  2C5C A;  1XMO L;  3K7A H;  1YJ9 A;  4JI5 Q;  1D8L A;  1K8O A;  4JI1 L;  3NWT A;  1BUV T;  1OTC A;  1Q8K A;  1IXR A;  1B50 A;  2CH4 A;  1CKM A;  3VYU A;  1XWE A;  1II3 A;  1YI2 A;  1IW7 C;  5DAU A;  4BS9 A;  2IY5 B;  4A3L G;  2B2W C;  4GOP A;  4LAA A;  3KLS A;  3VA5 A;  3PO2 H;  2JXM B;  2X6G A;  4H13 C;  2EY6 A;  3HOX G;  4XT3 B;  4HCS A;  4B9W A;  1FNU A;  4B08 A;  4HCE A;  4L5R C;  3F8T A;  3R3O A;  2VB3 X;  5ELO A;  2ZJR A;  3KBX A;  5NUC A;  2ZTE A;  4KTA A;  3KLS X;  3LGJ A;  4LF6 L;  1YIJ A;  1GUG A;  3CCJ A;  2KA7 A;  5GQO A;  1V9P A;  2F3W A;  2HDM A;  3W2D A;  1PLF A;  2B2W A;  4GOP C;  4GKK L;  4R4O A;  4PNY A;  4DR4 L;  5K36 G;  4UDU C;  2L5T A;  3RUZ A;  2KEC A;  1BBW A;  2JK8 A;  4TVA B;  1IL8 A;  2E74 C;  1N32 L;  1HFG A;  4K5W A;  3HOU G;  2WII B;  5EPL A;  3NEM A;  4DAY A;  3P20 A;  4JI3 Q;  3T1H Q;  3QOL A;  3PO3 B;  1HUM A;  3KF8 A;  1K9M C;  4HIO A;  1R9T B;  1VQ5 A;  4K0K Q;  2R92 G;  2JA5 B;  4JC0 A;  1Q1E A;  2PW5 A;  5KYL A;  2JA6 H;  1BXT A;  4CHT B;  4CKC A;  5C3E G;  3OW2 A;  1C48 A;  3S17 B;  1VQB A;  3QIA A;  1EWH A;  1U4P A;  2PW7 A;  4IUP A;  3CPW A;  1IBK L;  4LFB Q;  1IBL Q;  5FOB B;  2Z6K A;  1F9S A;  1CUK A;  4FVM A;  4DUZ L;  1QE6 A;  1AE2 A;  1XNQ Q;  1CQF A;  4KK7 A;  4K6L A;  4DN4 M;  1U4L A;  4DNR B;  3H09 A;  2JEA I;  3NSW A;  1HZA A;  4OO1 H;  5IY0 A;  5M5X B;  3TN2 A;  1N33 L;  2ID0 A;  1A3T A;  1TWF H;  1EIF A;  2KJX A;  2Y0S E;  3MXU A;  1G29 1;  4X66 Q;  2EZV A;  2K7V A;  4DKA C;  1PH6 A;  1XMQ Q;  5JVH 3;  1L2F A;  4B3S L;  3GTO H;  5IYC G;  4DV6 L;  2RVL A;  4XTC S;  3FRP B;  2Q2I A;  3S1Q H;  3B6Y A;  5CBA E;  1A63 A;  1AP0 A;  1HNX L;  3I8Z A;  3RLF A;  1C7Y A;  2B63 G;  4Z9C B;  3KF6 A;  1HNX Q;  3BZK A;  3TBI B;  1JE5 A;  5IT9 L;  2R93 H;  1Q90 A;  2A68 D;  1U4R A;  5ELD A;  1LTA D;  5M9O A;  4KHP Q;  1N9W A;  2D0P A;  2L1B A;  2LXJ A;  3T1Y Q;  2AQ3 B;  1X3P A;  1S40 A;  5D14 A;  3A54 A;  4RWS C;  4EQP A;  4LF9 L;  1P16 A;  4QUF A;  2ZXP A;  1VQE A;  1SJE D;  4FF4 A;  5JEA J;  4KD3 A;  4DV4 L;  5C4H A;  4A93 B;  3GTK H;  2EVB A;  1BR9 A;  2Q8R E;  2K52 A;  4A76 A;  2MQH A;  1IYV A;  2SOB A;  4A93 H;  1STA A;  1FGB D;  3V05 A;  2YTV A;  1R9T H;  3UDG A;  2D9U A;  5JPN C;  3E0E A;  1BNZ A;  3OW7 A;  1SE8 A;  1IKM A;  1WTQ A;  4DU9 A;  1KNA A;  1TWC H;  1RTO A;  1Q86 C;  1HR0 W;  1IYU A;  3FEW X;  4LWC A;  1NUC A;  3RN2 A;  3OMG A;  1QVG A;  1F2L A;  2HQE A;  3QOJ A;  4DUY L;  4LMQ D;  1U5K A;  3SVM A;  3FVQ A;  4L8J A;  3QO2 A;  3GTL B;  2AQ2 B;  1TS3 A;  1SMY D;  1SMX A;  5IP9 H;  4RA8 A;  2OF1 A;  3CRL C;  1VQL A;  4PMW A;  5CV7 A;  1HH2 P;  4DF7 A;  1JOK A;  3W5O A;  1PH5 A;  3G71 A;  4JI4 Q;  5CR3 A;  3PUZ A;  4GKJ L;  1HNZ Q;  5DNF A;  2NYZ D;  4O0A A;  2DGY A;  4Y52 H;  1X3Q A;  5IYB H;  2F3V A;  3BJU A;  1JJC B;  1HR0 L;  1JOO A;  2UXC Q;  3M4P A;  3JAM i;  1WCM H;  1YNN D;  3SR1 A;  5KNB A;  1SYE A;  3QJY A;  1PRT D;  2KED A;  5M3F G;  3EFX D;  2KEE A;  2UU9 Q;  2PPB C;  1XYI A;  1XNQ L;  3TRZ A;  2KOL A;  2D62 A;  2N8N A;  4C3J H;  1WJJ A;  1IBL L;  1BCP D;  1FD7 D;  4FF2 A;  1S5D D;  2DN8 A;  2R7Z G;  1OXU A;  3M7G A;  4IPH A;  4K8I A;  2MO1 A;  2K14 A;  1PH7 A;  4JBW A;  5I6Y A;  2IX3 A;  3G6J B;  4HSV A;  2Z4H A;  1TWA H;  4P73 A;  4B3S Q;  4GNX C;  1Y1W B;  3GTP H;  2FFK B;  4R4Q A;  1RTN A;  2L11 A;  3M4Y A;  3ZYY X;  1Y1W G;  1X65 A;  3AQQ A;  5DM7 3;  2EXD A;  3O13 A;  2OTL A;  4TSS A;  1E2V A;  2X69 A;  5D3I B;  3NEN A;  3MWY W;  4QIW E;  5G3L D;  3U9S A;  1CFM A;  2V4D A;  3PUX A;  1V8Q A;  3ERO A;  3PF5 A;  4YWK A;  1NMF A;  4DR1 L;  1FYC A;  2RDF A;  3I4L A;  4HN7 A;  1LT4 D;  3J80 c;  2JA6 G;  3CME A;  4Y7N H;  3HZX A;  2KEN A;  1EQQ A;  2MGS A;  5C0X J;  2HIX A;  2WIN B;  2OWO A;  3OHX C;  1SRO A;  2XIW A;  4V19 0;  2UUA Q;  5C4J B;  1AEX A;  3I4N G;  1HA5 A;  1K8A C;  4DXF A;  2PZW A;  4HSP A;  2MPM A;  3I3C A;  3U50 C;  4GN4 B;  1B70 B;  3S1N H;  3I56 A;  4OIJ A;  4HR7 B;  1EIH A;  1Q46 A;  3FPU B;  3ERS X;  1Q1B A;  4HTH A;  2SDF A;  2NZO A;  1MD2 D;  2F0D A;  1NNX A;  2IT1 A;  4H7B A;  4YWM A;  5IYC H;  4GLX A;  4BBS H;  1T5X D;  4OO1 I;  4PMC A;  3URY A;  4R8I A;  3S2H H;  1KC8 C;  2UUB L;  4A3M G;  1HNW L;  4B3R L;  5G3L F;  3HFZ B;  1PRT F;  1YBY A;  2F0I A;  2I5H A;  3UI2 A;  4DAY B;  4G7Z C;  2B2Y C;  3S2H B;  4IUN A;  3M4O H;  3WOE A;  3NP8 A;  3AU7 A;  2TMP A;  1UE5 A;  1ICF B;  3CKI B;  1M8A A;  5DLQ E;  4J15 A;  4L6T B;  2JA5 H;  2BA1 A;  3MVV A;  4KD4 A;  2F0S A;  1EY4 A;  1VQI A;  2F1M A;  2N3S A;  1I4R A;  1YJW A;  3TZU A;  4YCU A;  3DEO A;  4TQU S;  2I5M X;  3T1Y L;  4A3M B;  3NHH A;  4POF A;  1JJG A;  3CP0 A;  4OWT B;  3I72 A;  3PIO 3;  3STB D;  1WFQ A;  4G4K A;  3KYH C;  1GUO A;  5KYI A;  4DNT B;  4DV3 L;  4S3S A;  2O5J C;  1Q3L A;  1KDC A;  3NK9 A;  4LF7 Q;  5JEA G;  1SNP A;  4F88 A;  2E75 C;  4LF8 Q;  1CSQ A;  1VQN A;  2MJ8 A;  3D4W A;  4MNO A;  1ET9 A;  5JJK A;  1Y8P B;  4OHJ A;  5C3X A;  3CCS A;  2XWB B;  4DR3 Q;  3KK7 A;  2Y0S B;  4DR4 Q;  3M3Y B;  1ONL A;  3BYY B;  1JCK B;  1SYD A;  5C3E H;  1SR3 A;  1XNR Q;  1K83 B;  2OQK A;  3HOV G;  4JK1 C;  3DHQ A;  4LW1 A;  1MI2 A;  1Z47 A;  2IJ0 A;  1Q81 C;  4B3M Q;  4KHZ A;  2UUC Q;  2TSS A;  1CM9 A;  3HKS A;  5EKK A;  3C1F A;  4JV5 L;  3RZO B;  2M00 A;  1SNM A;  3FPP A;  1I4Q A;  2A6E D;  1ET6 A;  1BCP B;  4PV1 C;  4DR7 L;  2HIV A;  2RDH A;  3GTG B;  4DUZ Q;  1U4M A;  1PH4 A;  3TP6 A;  3D6W A;  3D3R A;  2A69 D;  4DV1 Q;  2PYK A;  3ERQ A;  4H02 A;  2IHE A;  3R93 A;  3GTP B;  4FXK C;  2NVT H;  3ND9 A;  4ZQ3 A;  1PFB A;  5T1I A;  3RZD H;  1K3B C;  2R7Z H;  1X3E A;  2Z9H A;  1B53 A;  4K0K L;  4JI8 L;  3VYS A;  4J6H A;  3Q22 A;  4NXN L;  4A3I H;  5EGT A;  1SRU A;  1J8I A;  3C2P A;  5KNC A;  3BYT B;  5LL6 S;  4NXM Q;  3T53 B;  3H6M A;  4C3I B;  1GKH A;  3RMH A;  4QF4 A;  4LK1 C;  1VQF A;  3AFQ A;  4XDX A;  2VQF L;  2AWO A;  3DM1 A;  2I46 A;  2L0C A;  5C5M A;  1K8G A;  3HOU B;  5I9O A;  4IFD G;  1IZ6 A;  1STY A;  1E2W A;  2F0M A;  3VR6 A;  2L12 A;  3M85 A;  1EU4 A;  2JA7 B;  4RKL A;  3CCU A;  4JYA L;  3MXN A;  1MBY A;  3HOZ B;  4KLK A;  5JPM C;  3NTK A;  5E3F A;  2KHJ A;  2A6H C;  4X62 L;  1RKN A;  3D6C A;  5GAD C;  2UUC L;  2LS0 1;  2ZXO A;  5M5W H;  1UE7 A;  2B2U C;  3OOC A;  2UXD Q;  4JYA Q;  1JB3 A;  1HPC A;  2RDG A;  2BE5 C;  2EJG C;  1XPU A;  1RCV D;  1E0B A;  1E24 A;  3TS2 A;  1S4Z A;  1RF2 D;  2WAQ B;  2YU9 B;  5J39 A;  2Q8I B;  1EOV A;  1WTV A;  1G8Z D;  3MHB A;  1TKW B;  1EY5 A;  4A3L H;  3UE0 A;  1QJO A;  4LNQ A;  5M3M H;  1KLG D;  2HCC A;  5IWA Q;  4K6D A;  1EY7 A;  2VUM G;  2K5N A;  1I6V C;  2PZT A;  4DXG A;  1XXG A;  1KDB A;  3K81 C;  1BO0 A;  1LT5 D;  5TSS A;  2J4X A;  4DV5 Q;  4B3R Q;  1TWF B;  1N8R C;  1GHK A;  3EQL C;  1YNJ C;  4HED A;  3T16 A;  4CDC C;  5FJ8 G;  3MFG A;  1QUQ A;  3MXN B;  3TSS A;  1YVC A;  3F2B A;  2VXW A;  4B3T Q;  1VQH A;  3ER0 A;  1I6H B;  1MHW C;  4L63 B;  3K5M A;  3WWV A;  4DK3 C;  1XTC D;  3NBI A;  3IFT A;  2PCF B;  3KBG A;  3BU2 A;  3I55 A;  1KQS A;  1SBB B;  2H1E A;  4EGV A;  4ODG A;  2K28 A;  1HA6 A;  4BXX H;  4FP5 D;  3EA6 A;  3L2P A;  1DM0 B;  4DV7 L;  1SMY C;  3STB C;  1ESF A;  1Y69 U;  4LUO A;  3A8K E;  1V1Q A;  2Q2U A;  1XMO Q;  1VQJ A;  2BH2 A;  2DY8 A;  3MEH A;  3NXW A;  2HD3 A;  1A2U A;  2LMC B;  4HMI A;  4NDX A;  3X3M A;  4DAM A;  2BOS A;  3AFP A;  2A73 B;  3OWE B;  3DUZ A;  4UPA A;  3MZ5 A;  3R8B A;  1E2Z A;  4ABN A;  4AYB E;  4MTN A;  3S14 H;  2F4V L;  1C0A A;  1E3P A;  3PIO A;  4EVO A;  3I4O A;  1A15 A;  5BN5 A;  1VQ6 A;  3ULP A;  1EYG A;  2BA0 A;  2SEB D;  1TY0 A;  4LFC L;  2GVB A;  1K3R A;  1E1T A;  4JVZ A;  2EYH A;  4NP5 A;  1DXM A;  2NB0 A;  4LFC Q;  2Q2T A;  1KRT A;  3D4D A;  2E5L Q;  3IFD A;  5C4X H;  2WV6 D;  1HZB A;  5D65 A;  3VR3 A;  2F0G A;  1ASY A;  4NB3 A;  2R6G A;  1CTM A;  4YY3 L;  4XQN A;  3W3A A;  3C46 A;  3GDE A;  2EYJ A;  2EXZ A;  3SE0 A;  3MAQ A;  4JI0 L;  4ZKB B;  2B63 H;  3IAY A;  1LM0 A;  4YY3 Q;  1QOH A;  1GOZ A;  1Y8N B;  2NVX H;  1GJX A;  3SK4 A;  4KV6 A;  3CC7 A;  4G7H C;  5J22 A;  3HOW H;  5JJL A;  1GD7 A;  1EOT A;  4X64 Q;  4A3I G;  2F0P A;  3GV3 A;  4YCV A;  2EYO A;  5HGT A;  2FXQ A;  3G7L A;  3PIP 3;  3CMA A;  4KN7 C;  5FO8 B;  1G91 A;  1D1I A;  2NN6 H;  1I94 L;  4ZLT F;  2F0W A;  3S1R H;  4RGT A;  1JE4 A;  4K5V A;  3PUW A;  1PH3 A;  1A8V A;  1WD0 A;  4B3T L;  4X3U A;  1EY8 A;  1EZ8 A;  2G5D A;  2AWN A;  2JSO A;  1MJE A;  3L7Z C;  2NVQ H;  2N55 A;  2N49 A;  3DM3 A;  3J81 L;  3G48 A;  4N9T A;  1FGU A;  3RZD B;  2UUB Q;  5IE8 A;  3NPP A;  2A5H A;  3H91 A;  3SK6 A;  4DV6 Q;  4OWW B;  2Q8T A;  4FNF A;  2ZM6 Q;  4GLA C;  4KY6 A;  4RFB A;  3F2C A;  1NTG A;  2HHH L;  3HEJ A;  2B2U A;  4J1M A;  4X3K A;  2A74 C;  2E8G A;  1P8L A;  2DY7 A;  2I07 B;  3K5L A;  2DJF C;  1ZYR D;  5FLX E;  1JT8 A;  1YZ6 A;  2B8G A;  1X32 A;  4KY5 A;  3BDC A;  2O5I C;  1K0S A;  3KF8 B;  5ELB A;  3I4M H;  1Y1V H;  1ZKO A;  5IYD H;  2F0U A;  4E6I A;  5C4J H;  1BBX C;  2E2H B;  3SK5 A;  3S15 B;  1KXL A;  3HS0 C;  1TWH B;  4L5Q A;  2L4N A;  2FIN B;  3VA7 A;  2RSO A;  2JA9 A;  1L0Y B;  3S15 H;  2UU9 L;  3RNU A;  1LLR D;  4XXE A;  2EYL A;  1XTD A;  1PZI D;  3KJP A;  3S17 H;  5IOC A;  2YTX A;  3ONA B;  2YYZ A;  4GN5 A;  3M9B A;  2MFI A;  4GKK Q;  3S9W A;  4U68 A;  1DOM A;  1VQA A;  1VQG A;  2CVR A;  1I4H A;  4XYO A;  3RR5 A;  3OTO Q;  3VDY A;  3I4M G;  4BBS B;  1MIU A;  2CW0 D;  2JQO A;  2HT1 A;  4JI6 L;  5FO9 B;  2QW7 A;  1U9R A;  3IL8 A;  4DK1 A;  1XPO A;  3J7Z C;  1QWY A;  4DGZ A;  1VQK A;  2QDL A;  4CBV A;  5EQ0 A;  2A68 C;  4DK0 A;  4N8X 1;  1KLU D;  1JQY D;  1DOL A;  1ZEQ X;  1EQV A;  3EBE A;  4F8M A;  3H3V C;  5CC4 A;  4K8J A;  5AJ3 Q;  2EYM A;  1Y1W H;  4PQX A;  2E5L L;  1TS5 A;  4KMU C;  4RG1 A;  5AFW A;  4B3M L;  1TWG B;  5KIX A;  1LT6 D;  3WDN A;  1KAA A;  2ALY B;  1O7L A;  4YCW A;  4Y7N B;  1OXX K;  1BVS A;  3OIQ A;  4A4I A;  2KHS A;  5CGK A;  1E22 A;  4A3B H;  1FJG L;  1EYC A;  1CKN A;  3Q6S A;  2AUK A;  4A3C G;  1F9P A;  2ZT9 C;  3H0G B;  3TME A;  3RD4 A;  1N36 L;  4N9P A;  5C4X B;  2EOT A;  1F2M A;  1KHI A;  3PGZ A;  4LUV A;  2IL8 A;  4OXP A;  1HJP A;  3FDT A;  3FKI B;  4KKT A;  4PZ7 A;  1BQQ T;  3BDL A;  5GAH C;  1JWU D;  2XNA C;  5FLX L;  1J5E Q;  1LTG D;  2MP1 A;  1WCM B;  4BY1 G;  5I2Y A;  4IUR A;  3T51 B;  2CQA A;  2L55 A;  3UDF A;  4A3B G;  1Q12 A;  5CV8 A;  5C4X G;  5C4Z A;  1I3Q H;  2F52 A;  3U4Z A;  4LFA Q;  2F0J A;  2F03 A;  1BCP C;  5FO7 B;  2A19 A;  3MEF A;  5I2X A;  5IYB G;  5BR8 Q;  3ULL A;  4V0B A;  5FK9 C;  4JI3 L;  1W6K A;  1D7Q A;  3I90 A;  2B3G A;  5K5P A;  4HJA A;  1ILQ A;  3DMU A;  5K36 H;  2OQ0 A;  3GP7 A;  1GO3 E;  1VQ9 A;  1HTP A;  3RLO A;  1BF4 A;  1EUJ A;  3VR5 A;  3NQT A;  3P7J A;  2MHV A;  4A3F B;  1VMP A;  5EKL A;  1XX8 A;  4DV4 Q;  3DWP A;  4POG A;  4A3J G;  1VCI A;  3SHL A;  4MHE A;  1W3S A;  4JI7 Q;  4WJ3 M;  2RBM A;  2JA7 G;  4A3K G;  3TP7 A;  4OON A;  3HOZ G;  3CU7 A;  1QZG A;  1AH9 A;  2XGT A;  4UY8 C;  1N33 Q;  3K0X A;  2WKD A;  4C3H H;  2CKZ B;  4RGO S;  2XSC A;  2VQF Q;  2ENB A;  1KNE A;  2QCP X;  4KJN A;  4KKU A;  3DWQ A;  4DR2 L;  3K5O A;  2ZM6 L;  2SNS A;  2JN4 A;  1AZP A;  3CRK C;  1KRS A;  2C35 B;  3HP3 A;  4MIU A;  5ELF A;  4HIM A;  2NZH A;  4ZKC B;  1K73 C;  4FYD A;  2EE1 A;  2CW0 C;  4GN3 B;  1GUS A;  4O2D A;  1C9O A;  5KRU A;  1MSH A;  5IP7 H;  2JA7 H;  2Y0S G;  1XPR A;  2JA6 B;  3VR2 A;  2KCC A;  1CZW A;  5M3F B;  3AEV A;  4OGQ C;  5FLM H;  3GTQ H;  1F2Y A;  2VNU D;  3PMF A;  4IAL A;  4MTK A;  4ID6 A;  4QCL A;  4DV1 L;  3M7N A;  4C3J B;  4KKS A;  1HZC A;  3PCO B;  3NEL A;  2D5D A;  3J81 j;  4GNX A;  1HFN A;  2VY3 A;  3A7A B;  3AB9 A;  4IQZ A;  1VF5 C;  3PO2 B;  1NAP A;  2PMZ E;  1DD2 A;  1A0I A;  2G9H D;  2DNC A;  3UE1 A;  1CZG A;  1ZXT A;  3PUY A;  3HOX B;  1NMG A;  1VQD A;  4RCN A;  2X6L A;  1H9K A;  1PTO B;  4DFA A;  2VQE Q;  1W6J A;  1CA6 A;  1G51 A;  1G2T A;  2OXP A;  3I4M B;  1GUW A;  2ZJP A;  4BBR B;  1EEI D;  1PMR A;  3UDI A;  4DA2 A;  4ILW A;  4MZ9 A;  1TQO A;  4BBR H;  1HQM C;  1A2T A;  1Q82 C;  2A69 C;  1V1O A;  1HHV A;  3GO5 A;  2F4V Q;  1X54 A;  4LFA L;  2KBN A;  1I4P A;  3CC4 A;  2QDB A;  4WOR A;  4JV5 Q;  5EBD A;  4I65 A;  4FF3 A;  5D3D A;  5L37 A;  4X6A H;  4RGN A;  2RF4 A;  1QB5 D;  3I4N H;  5CMD A;  1A3U A;  1Y1V B;  2RHS B;  1NCV A;  3WOF A;  4CDD C;  4HJ9 A;  5H1S E;  3Q8D A;  4DR1 Q;  3QB3 A;  1LUZ A;  2IHF A;  1VQO A;  1WVL A;  1SYG A;  3FKI G;  4EQO A;  1UE1 A;  4EX5 A;  2R92 B;  2UXC L;  1N34 Q;  4WRD A;  1KDA A;  4C56 C;  1D5X C;  1N36 Q;  2F0E A;  4ZUJ A;  4IOA A;  1H9R A;  1QVC A;  4XIG S;  3H94 A;  3KF6 B;  5ELC A;  4X65 Q;  3K58 A;  5LMN L;  4JCV E;  2ZJQ A;  2F0L A;  4X65 L;  1ENA A;  2N78 A;  5I6W A;  4IFD I;  4L5T A;  4JW0 A;  4P75 A;  3KLR A;  4LFB L;  2UUA L;  4YHH L;  1QIL A;  4RAU C;  2VUM H;  1R4Q B;  1F9Q A;  5M3M B;  5CV6 A;  3TP8 A;  2IX0 A;  2F0K A;  2F0N A;  4QL5 A;  3A8J E;  3S1M H;  1O7Z A;  2KHI A;  2QEX A;  4M8A A;  1IYJ B;  2NVT B;  1LO5 D;  4IJL A;  1L1O C;  4DV2 L;  4OEL B;  1STB A;  2PMZ B;  2E2J H;  3S1M B;  5IYD G;  3D31 A;  4A3F G;  3GTO B;  1U0L A;  1H95 A;  3BZC A;  1EFW A;  3HGB A;  4KHP L;  1VQ4 A;  2YV5 A;  4JBK A;  4KHV A;  3S16 H;  2K01 A;  3CXC A;  2JE6 I;  3PSI A;  3H3V H;  4A3K B;  3A5Z B;  4GS3 A;  1D5M C;  1TU2 B;  4JOI C;  1ICW A;  1EFI D;  4BWG B;  4LF9 Q;  4RKB A;  1EZ6 A;  3FHW A;  1M90 C;  2M2L A;  4R4T A;  3LX0 A;  3OMC A;  4BA1 I;  2JP1 A;  1HQR D;  2K1B A;  3GTK B;  1KL9 A;  1DYQ A;  2HDL A;  3L0O A;  1DOK A;  3S2D B;  3VYT A;  4LF5 Q;  2RHQ B;  5KGU A;  2V1C C;  1RHP A;  3HOZ H;  4IFD J;  1QUQ B;  2OCE A;  3L3O C;  4GZY C;  1ZYR C;  1TWA B;  2PNH A;  2Z4I A;  4PZ6 A;  4OIK A;  4X64 L;  3HOV H;  1G2S A;  1RD9 D;  1SAP A;  2ATW A;  3GTQ B;  4ZUI A;  4ZCK A;  4DR2 Q;  1D2B A;  1EEF D;  2VQE L;  4A75 A;  1V1P B;  3K7A B;  3VR4 A;  4F7X A;  4OEM B;  5F2D A;  2Z6K C;  3SK8 A;  1C8C A;  5EJW A;  1Y8O B;  3OTO L;  2NWG A;  4LJZ C;  3A74 A;  1FNV A;  3IKJ A;  1LTL A;  2CFM A;  2JJQ A;  3F2D A;  1DGS A;  5HY6 A;  1LAB A;  1TII D;  1WTO A;  1STN A;  1EWC A;  2AQ1 B;  3HKZ B;  2EY2 A;  1HR0 Q;  1B8A A;  3N6R A;  4C2M B;  3CCQ A;  2Z8L A;  1XNR L;  1CK1 A;  2R3Z A;  2MO0 A;  4A3E H;  5KEE A;  1GM5 A;  1VQM A;  2R7D A;  4H44 C;  4IOC A;  3NBH B;  3J81 i;  1IHZ A;  5CV9 A;  3GTJ H;  2WAQ G;  1GUT A;  1X56 A;  1O80 A;  2QEJ C;  4I7Z C;  2NZ1 D;  2K33 A;  4OX9 L;  1EY9 A;  2Z1C A;  1UEA B;  4BY1 H;  2B2V A;  1B44 D;  1PA6 A;  1F9R A;  1OO9 B;  1D6E C;  5EPK A;  3PUV A;  4FDB A;  2I5L X;  4K14 A;  4I7A A;  5A2Q L;  3KDF A;  1BOS A;  1SEB D;  2KVM A;  5JJZ A;  1VQC A;  1KIX A;  2A6H D;  3U9O A;  3CW2 C;  1CT1 D;  3D8G A;  2RQX A;  3OSO A;  4QMG A;  1SFO B;  4HIK A;  2QA4 A;  3GTG H;  1B3A A;  5IGC A;  3KDF B;  1UUP A;  5DEH A;  4DV0 L;  2Q2H A;  5BR8 L;  4KY7 A;  1HTL D;  3UDX A;  3PF4 A;  1VDZ A;  4N8F A;  2B39 A;  1L0W A;  1VQ7 A;  4DK6 C;  3MFY A;  5EBC A;  3K7U C;  1DCZ A;  1SYB A;  4RHR A;  2QF7 A;  1TS2 A;  2M9V A;  5IGB A;  1S3O A;  3R2T A;  1NR2 A;  1SNQ A;  2K5D A;  5CYU A;  2F0V A;  4C3I H;  4OL7 A;  4ALP A;  4IPG A;  4XQJ A;  2GVA A;  1UWV A;  2Z0S A;  4A3D G;  1ASZ A;  2GA4 B;  5LHY 1;  1AZQ A;  2ASB A;  5C6A A;  1K28 A;  1Y1V G;  3I4N B;  2B29 A;  3NUC A;  5IGE A;  3CCV A;  5LMN W;  2J7Z A;  2KCM A;  1ESR A;  4X66 L;  3HOY B;  2EY1 A;  4BY7 B;  1B9N A;  4A3G G;  1E7Z A;  1I5F A;  4O1N A;  5LMU Q;  5C44 G;  3J7A V;  4G57 A;  3CC2 A;  1O78 A;  3CQZ H;  5IWA L;  1WTR A;  4PG3 A;  5GAE C;  1TY2 A;  3DXJ C;  2K32 A;  4P71 A;  2K5Q A;  2XRQ D;  4CGY B;  1SYF A;  4ZAI A;  3CQZ B;  4JI7 L;  1GXD C;  4U67 3;  4ME5 A;  3CF5 A;  4DR5 L;  3V2T A;  4X3S A;  4YWL A;  3J81 c;  3SGI A;  3CCM A;  1PZJ D;  1K0R A;  3NTH A;  1YHB A;  3HRZ C;  1SNC A;  4OO1 G;  2IX1 A;  5CBE E;  2WB1 B;  2E2I H;  2CHB D;  1LTT D;  1JOQ A;  2KQ3 A;  4X62 Q;  3J7A F;  1SDF A;  4UHV A;  1FNW A;  1PDQ A;  4H0L C;  2SNM A;  4IUT A;  1LYL A;  4JI1 Q;  4A3I B;  4IFD H;  1PH8 A;  1SE4 A;  3TP5 A;  1E1O A;  2NN6 I;  3HOW G;  3J7A 5;  4DV7 Q;  4UP7 A;  1PH9 A;  2EY5 A;  5JAV A;  1WTP A;  3OIP A;  1EWI A;  2FMM A;  1H9S B;  1SSO A;  1K8M A;  3KUP A;  1QG7 A;  3ULJ A;  4QB4 A;  1EIY B;  2R93 G;  1BKB A;  2NVX B;  4IN3 A;  1HZ9 A;  4JOI A;  5KND A;  1OXS C;  2K03 A;  3KFU A;  4HMJ A;  4WJW A;  4LF4 Q;  1EY0 A;  1CHQ D;  3EN2 A;  5LMU L;  4KN4 C;  1NBW A;  1Z6H A;  4P74 A;  1MJC A;  4Q5V A;  4RHS A;  1VQ8 A;  3CD6 A;  3A8I E;  3CHB D;  1GVP A;  1IL2 A;  5E7N A;  1CHP D;  3J80 E;  1M1K C;  3HOY H;  4BY7 H;  4DV0 Q;  1WYD A;  1L1O A;  1YNX A;  2CH4 W;  4CDF C;  3HOV B;  1JWS D;  2VW9 A;  1SXT A;  3SXH A;  1H9S A;  4AQY L;  1G6Z A;  5IIF A;  1MGS A;  3ICE A;  1BCP F;  5IGD A;  4X3T A;  3K6O A;  2YU9 H;  3X3N A;  3MXP A;  3E0J A;  1LTS D;  2OEO A;  4DNI A;  3S14 B;  5JJI A;  2WKC A;  2NN6 G;  5M5X H;  5CV4 A;  1X3F A;  2CQO A;  1F2Z A;  1I50 H;  3QWN A;  5LMN Q;  3TRE A;  1PTO C;  3M4O B;  4JI5 L;  3BVM A;  2JA8 B;  1LAC A;  2NTS A;  3NQI A;  4F87 A;  2XWJ B;  1CKN B;  4OWX B;  5HGQ A;  3H3V I;  3E3X A;  4QUC A;  3E5S A;  4JI8 Q;  2WAC A;  1KD1 C;  2E2J B;  4ZRZ A;  2K05 A;  4JI2 L;  4TKO B;  1TT2 A;  3CCR A;  4A3F H;  4A3M H;  3BVG A;  2EQS A;  4DR6 Q;  4A93 G;  2NUC A;  1T9H A;  4FF1 A;  4C3H B;  4CJ1 B;  1S72 A;  4DR5 Q;  4A3K H;  5EKI A;  2LSS A;  4C3H G;  1B2T A;  1Q7Y C;  4HJ7 A;  1NE3 A;  5IT9 E;  2WFW A;  1A62 A;  1M4V A;  1SE2 A;  3CAM A;  1PV4 A;  1AN8 A;  5IGF A;  3BZD B;  4DAP A;  4IUQ A;  1HCZ A;  1FR3 A;  1NSN S;  2F0Q A;  1I94 Q;  1RJT A;  1EYA A;  4R4C A;  2VB2 X;  3HOU H;  2EDG A;  3S2D H;  4TRD A;  5IP7 G; 
#chains in the Genus database with same CATH homology
 4KLK A;  2VQE Q;  1PFS A;  1G51 A;  3KLW A;  2KHJ A;  4L5R C;  4X62 L;  3F8T A;  1RIP A;  5GAD C;  4JI0 Q;  2ZJP A;  2UUC L;  5ELO A;  5M5W H;  2ZJR A;  1UE7 A;  3UDI A;  2ZTE A;  3G6E A;  3LGJ A;  4MZ9 A;  4LF6 L;  4NPS A;  2R92 H;  4BA2 I;  4JYA Q;  1YIJ A;  4BBR H;  3CCJ A;  1Q82 C;  5GQO A;  1XPU A;  3GO5 A;  5FLM G;  2F4V Q;  3AYH B;  1V9P A;  1E24 A;  1X54 A;  3PV0 A;  4LFA L;  2KBN A;  4HID A;  3CC4 A;  3TS2 A;  4GOP C;  3PIP A;  3OTO Q;  4GKK L;  4R4O A;  1YHA A;  4DR4 L;  2YTY A;  3RLN A;  5K36 G;  4JV5 Q;  4A3G H;  1CKO A;  1EOV A;  2WB1 E;  3E9H A;  4X6A H;  3GTO H;  1BBW A;  1FVI A;  2JK8 A;  4TVA B;  4UP8 A;  3UE0 A;  4LF8 L;  4A3L H;  3U58 A;  1N32 L;  2RF4 A;  2K5V A;  3I4N H;  4LNQ A;  1UE6 A;  5M3M H;  3HOU G;  5IWA Q;  2VUM G;  2RHS B;  1AE3 A;  2K5N A;  3NEM A;  5J3B A;  4HJ9 A;  2D0O A;  5H1S E;  3K81 C;  3EIV A;  3Q8D A;  3T1H Q;  4DV5 Q;  4JI3 Q;  4DR1 Q;  4B3R Q;  1LUZ A;  2IHF A;  1VQO A;  1N8R C;  3FKI G;  1K9M C;  4P72 A;  1YEZ A;  1UE1 A;  5FJ8 G;  4EX5 A;  2XTI A;  4HIO A;  1VQ5 A;  1QUQ A;  1N34 Q;  2UXC L;  4K0K Q;  3MXN B;  2R92 G;  4JC0 A;  3TEH B;  1Q1E A;  1YVC A;  2JA6 H;  3F2B A;  1N36 Q;  5C3E G;  4B3T Q;  4AH6 A;  3OW2 A;  1VQH A;  1VQB A;  3ER0 A;  4GLV B;  4IOA A;  3CPW A;  1IBK L;  1QVC A;  4LFB Q;  4XIG S;  2WAQ E;  2A8V A;  3KF6 B;  1IBL Q;  1XMQ L;  4X65 Q;  3CPF A;  2Z6K A;  1CUK A;  5LMN L;  4DUZ L;  1SN8 A;  4JCV E;  1AE2 A;  3WWV A;  2ZJQ A;  1XNQ Q;  4DK3 C;  4X65 L;  2N78 A;  4GOP B;  3BU2 A;  4L5T A;  4IFD I;  3I55 A;  2JEA I;  1HNW Q;  1KQS A;  1HZA A;  2PQA A;  4P75 A;  5IY0 A;  5C0X G;  4IO9 A;  1N33 L;  2ID0 A;  4BBS G;  4LFB L;  1TWF H;  2UUA L;  4GKJ Q;  4YHH L;  4BXX H;  1EIF A;  3L2P A;  4PZ8 A;  4DV7 L;  2VUM H;  3FKI H;  2Y0S E;  2KCT A;  1G29 1;  4OX9 Q;  2IX0 A;  3STB C;  4X66 Q;  1SFO H;  1PHJ A;  4LUO A;  4DKA C;  1PH6 A;  1V1Q A;  1XMQ Q;  4QL5 A;  4A3J H;  3S1M H;  1L2F A;  2KHI A;  2QEX A;  5IYC G;  3TQY A;  4DV6 L;  4AIM A;  1IYJ B;  2Q2U A;  1XMO Q;  4B3S L;  4IJL A;  1L1O C;  4XTC S;  1VQJ A;  4DV2 L;  2BH2 A;  1FJG Q;  2E2J H;  2JA5 G;  2Q2I A;  3S1Q H;  5IYD G;  3D31 A;  3B6Y A;  4A3F G;  1U0L A;  4JBJ A;  1H95 A;  3BZC A;  2RCN A;  1A63 A;  1EFW A;  1HNX L;  4KHP L;  1MKH A;  1VQ4 A;  2UXB L;  2YV5 A;  4DAM A;  4JBK A;  3RLF A;  4JI2 Q;  3AFP A;  4QY7 A;  1C7Y A;  4NXM L;  2B63 G;  4YHH Q;  3KF6 A;  3CCE A;  4LF5 L;  1HNX Q;  3BZK A;  3CXC A;  3S16 H;  2JE6 I;  1BBU A;  3PSI A;  4UPA A;  2ZTC A;  1JE5 A;  3H3V H;  4DV3 Q;  4UP9 A;  2R93 H;  1RL2 A;  3A5Z B;  4GS3 A;  1Y14 B;  4MTN A;  4AYB E;  2F4V L;  4JOI C;  3S14 H;  1C0A A;  3HOY G;  1E3P A;  4BY7 G;  3PIO A;  4LF9 Q;  4KHP Q;  1N9W A;  2D0P A;  2LXJ A;  3FHW A;  3I4O A;  3T1Y Q;  1S40 A;  1M90 C;  3K8A A;  4LF6 Q;  3DLL A;  3ULP A;  1EYG A;  1VQ6 A;  4LF9 L;  2EIF A;  2BA0 A;  1P16 A;  4R4T A;  4BA1 I;  5EAY A;  3CCL A;  4LFC L;  2GVB A;  1VQE A;  1K3R A;  5JEA J;  1E1T A;  1KL9 A;  3H0G H;  1YJN A;  2MNA A;  4DV4 L;  3HOX H;  4LFC Q;  2Q2T A;  3L0O A;  1KRT A;  1J5E L;  4JI6 Q;  1SLJ A;  4LF5 Q;  3J80 i;  5C4X H;  2RHQ B;  2QGQ A;  2V1C C;  1HZB A;  2E5L Q;  3GTK H;  3HOZ H;  1QUQ B;  2OCE A;  4IFD J;  1ASY A;  2K52 A;  2AMC B;  2MQH A;  4IPD A;  2R6G A;  4NB3 A;  4A76 A;  4A93 H;  4YY3 L;  2PNH A;  4PZ6 A;  2YTV A;  1R9T H;  4X64 L;  3UDG A;  3HOV H;  2UXD L;  3E0E A;  3GDE A;  1SE8 A;  4L5S A;  1WCM G;  4KI0 A;  1TWC H;  4JI0 L;  1Q86 C;  4JI4 L;  2ATW A;  5C44 H;  4DR2 Q;  2ES2 A;  1HR0 W;  5M3M G;  4LWC A;  1YIT A;  1XJV A;  2B63 H;  2VQE L;  4HJ8 A;  4A75 A;  3RN2 A;  3RN5 A;  1QVG A;  1LM0 A;  2OTJ A;  1OXV A;  2CWA A;  2Z6K C;  4YY3 Q;  4DUY L;  2ZTD A;  1U5K A;  3H15 A;  2NVX H;  4APV A;  3OTO L;  3A74 A;  3CC7 A;  3GD7 A;  1LTL A;  3HOW H;  2CFM A;  2JJQ A;  1W2B A;  1SMX A;  5IP9 H;  3F2D A;  5JJL A;  1VQL A;  1GD7 A;  4PMW A;  1DGS A;  4X64 Q;  4A3I G;  1HH2 P;  4YCV A;  5HY6 A;  1N34 L;  2I0Q A;  5GAG C;  3FP9 A;  3W5O A;  4DPG A;  1PH5 A;  2FXQ A;  1PYS B;  3G71 A;  5ELN A;  1HR0 Q;  1B8A A;  2LXK A;  3CCQ A;  3CMA A;  4JI4 Q;  3PUZ A;  4GKJ L;  1XNR L;  1HNZ Q;  3G4S A;  2MO0 A;  4A3E H;  1GM5 A;  1I94 L;  1VQM A;  2R7D A;  4O0A A;  2DGY A;  4IOC A;  3NBH B;  3J81 i;  4QGU A;  3GTJ H;  4DV2 Q;  3S1R H;  4Y52 H;  4ME3 A;  3PUW A;  2WAQ G;  1A8V A;  5IYB H;  3F1Z A;  1PH3 A;  4B3T L;  4A3C H;  3BJU A;  1JJC B;  3E9I A;  4NXN Q;  3GTM H;  2AWN A;  1MJE A;  1HR0 L;  2UXC Q;  1X56 A;  2NVY H;  3M4P A;  3ZJY C;  1WCM H;  3L7Z C;  3JAM i;  1VQP A;  2NVQ H;  2N49 A;  4OX9 L;  3DM3 A;  4BY1 H;  5C0X I;  3G48 A;  1FGU A;  1TWG H;  3I2Z A;  1QVF A;  4WJ4 A;  2UUB Q;  5IE8 A;  3K80 C;  1PA6 A;  5M3F G;  4DV6 Q;  4OWW B;  3PUV A;  4FDB A;  1X3G A;  3PO3 G;  2ZM6 Q;  4GLA C;  1G6P A;  2UU9 Q;  3F2C A;  2I5L X;  1NTG A;  2HHH L;  3KDF A;  1XNQ L;  3TRZ A;  1VQC A;  2D62 A;  2N8N A;  1KIX A;  4C3J H;  1WJJ A;  1YHQ A;  2JA8 H;  2E8G A;  1IBL L;  1L1O B;  1FL0 A;  1P8L A;  2R7Z G;  3CW2 C;  1JT8 A;  1OXU A;  3S24 A;  1YZ6 A;  4IPH A;  1PH2 A;  2MO1 A;  4HIK A;  2QA4 A;  3GTG H;  4DR3 L;  2K14 A;  3KDF B;  3JC6 6;  3KF8 B;  4JBW A;  1PH7 A;  3I4M H;  1Y1V H;  3HKZ E;  5IYD H;  1TWA H;  4DV0 L;  4P73 A;  4BBR G;  4B3S Q;  4GNX C;  2Q2H A;  5C4J H;  3GTP H;  5BR8 L;  4QJF A;  4R4Q A;  1KXL A;  1NJI C;  3UDX A;  1Y1W G;  3PF4 A;  4AYB G;  1I6H H;  4L5Q A;  1X65 A;  2VZA A;  3AQQ A;  1B7Y B;  1L0W A;  1VQ7 A;  4DK6 C;  2JA9 A;  3S15 H;  2EXD A;  1O7I A;  2UU9 L;  2OTL A;  3RNU A;  1TWH H;  3K7U C;  4R4I A;  3NEN A;  4QIW E;  2JA8 G;  4QQB X;  5FLX c;  1XTD A;  3KJP A;  3PUX A;  3S17 H;  1S3O A;  3I4M G;  2YTX A;  3PF5 A;  4YWK A;  2YYZ A;  1NMF A;  2L15 A;  4GN5 A;  3M9B A;  4DR1 L;  2MFI A;  1KAW A;  2CWP A;  4C3I H;  3J80 c;  2CCZ A;  4GKK Q;  2JA6 G;  4ALP A;  4IPG A;  3CME A;  1VQG A;  1VQA A;  2GVA A;  1UWV A;  2KEN A;  4R1J A;  2PI2 E;  2Z0S A;  3RR5 A;  4Y7N H;  5C0X J;  1MIU A;  3VDY A;  2HIX A;  2JQO A;  4AQY Q;  1ASZ A;  2HT1 A;  4A3D G;  2DUD A;  4JI6 L;  1X55 A;  2OWO A;  2ASB A;  1SRO A;  1Y1V G;  2B29 A;  1XPO A;  3J7Z C;  2UUA Q;  3I4N G;  1K8A C;  1VQK A;  1WOC A;  1EQR A;  3CCV A;  5LMN W;  2PQA B;  1WI5 A;  1HNZ L;  4JBM A;  2KCM A;  4X66 L;  3EBE A;  3U50 C;  3KJO A;  4A3G G;  5IT9 c;  4GN4 B;  1E7Z A;  1B70 B;  3S1N H;  2VL6 A;  4DR7 Q;  3U4V A;  1I5F A;  3I56 A;  5LMU Q;  5C44 G;  5AJ3 Q;  1Y1W H;  4GNX B;  2E5L L;  3CC2 A;  4RG1 A;  4B3M L;  1Q46 A;  3CQZ H;  3ERS X;  1Q1B A;  5IWA L;  4PG3 A;  2WP8 J;  5GAE C;  2NZO A;  2ALY B;  4P71 A;  4YCW A;  1OXX K;  2IT1 A;  1BVS A;  4YWM A;  3IRB A;  5IYC H;  4A4I A;  4GLX A;  4BBS H;  1N32 Q;  4JI7 L;  3JAM c;  1E22 A;  4A3B H;  1J6Q A;  4LF4 L;  1FJG L;  4OO1 I;  1CKN A;  2PI2 A;  3CF5 A;  4A3C G;  4DR5 L;  4YWL A;  3S2H H;  1IBK Q;  1KC8 C;  3J81 c;  3SGI A;  2UUB L;  3CCM A;  4A3M G;  4B3R L;  1HNW L;  4EQ5 A;  1K0R A;  2K4K A;  1YBY A;  2I5H A;  3HFZ B;  1N36 L;  2AKW B;  1YHB A;  4DAY B;  4C2M H;  3M4O H;  3W1G A;  4OO1 G;  1KHI A;  3PGZ A;  2IX1 A;  2K75 A;  4LUV A;  1UE5 A;  2UXB Q;  4OXP A;  2E2I H;  5DLQ E;  2JA5 H;  4J15 A;  2BA1 A;  1HJP A;  2R7F A;  4BXX G;  4PZ7 A;  1VQI A;  4X62 Q;  2N3S A;  5GAH C;  1PYB A;  3M3Y H;  1J5E Q;  1YJW A;  3W1B A;  1JB7 A;  4YCU A;  4DR6 L;  2A1A A;  1X6O A;  4BY1 G;  4TQU S;  1LYL A;  4JI1 Q;  3UDF A;  3M4Q A;  4A3B G;  1PH8 A;  2I5M X;  3H0G G;  3T1Y L;  1X9N A;  1E1O A;  1Q12 A;  2NN6 I;  5M3F H;  1CSP A;  3HOW G;  4POF A;  3J7A 5;  1JJG A;  3HKZ G;  3CP0 A;  5FJ8 H;  4OWT B;  5C4X G;  4DV7 Q;  1QZH A;  3STB D;  4UP7 A;  1PH9 A;  1I3Q H;  1WFQ A;  3I7F A;  3KYH C;  4IPC A;  4HJ5 A;  2F52 A;  5GRO A;  4IJH A;  1UEB A;  3U4Z A;  1EWI A;  4DV3 L;  4LFA Q;  3T1H L;  4RMF A;  4A3E G;  2HQL A;  4LF7 Q;  3ULJ A;  1EIY B;  2R93 G;  2K50 A;  5JEA G;  1BKB A;  2A19 A;  3MEF A;  1HZ9 A;  2AHO B;  5IYB G;  4JOI A;  3GTL H;  5BR8 Q;  3ULL A;  4JI3 L;  1OXS C;  1CSQ A;  4LF8 Q;  1VQN A;  3KFU A;  1D7Q A;  1Z9F A;  1EQQ A;  4LF4 Q;  3EN2 A;  2B3G A;  5LMU L;  2WB1 G;  4MNO A;  5JJK A;  4HJA A;  1NBW A;  4P74 A;  1MJC A;  3CCS A;  1VQ8 A;  2OQ0 A;  3CD6 A;  1IL2 A;  1GVP A;  1GO3 E;  5M5Y H;  4DR3 Q;  3RLO A;  1VQ9 A;  5E7N A;  1EUJ A;  1M1K C;  3HOY H;  4BY7 H;  3KOJ A;  4DR4 Q;  2F3I A;  1TXY A;  4DV0 Q;  1WYD A;  4DV4 Q;  1L1O A;  1OXT A;  1YNX A;  4POG A;  3D0F A;  2VW9 A;  5C3E H;  1SR3 A;  4A3J G;  1XNR Q;  3HOV G;  2OQK A;  4AQY L;  1VCI A;  2BH8 A;  2UXD Q;  3ICE A;  4WJ3 M;  1W3S A;  4LW1 A;  4JI7 Q;  2JA7 G;  1Z47 A;  1NY4 A;  4A3K G;  4LF7 L;  1Q81 C;  4B3M Q;  4KHZ A;  4OON A;  2UUC Q;  2YU9 H;  3HOZ G;  1PVO A;  1QZG A;  1AH9 A;  2VS1 A;  3HKS A;  2XGT A;  4UY8 C;  4DNI A;  1N33 Q;  5JJI A;  3K0X A;  1JMC A;  4JV5 L;  4C3H H;  2NN6 G;  2CKZ B;  5M5X H;  2HHH Q;  4JG2 A;  2K5H A;  4DUY Q;  4DR7 L;  2HIV A;  2VQF Q;  1X3F A;  2CQO A;  1I50 H;  4LUZ A;  5LMN Q;  4DUZ Q;  3TRE A;  2JEB I;  1PH4 A;  4DR2 L;  2ZM6 L;  3PO3 H;  4JI5 L;  4DV1 Q;  1KRS A;  2C35 B;  4HIM A;  1K73 C;  4DV5 L;  2NZH A;  3A0J A;  3TS0 A;  4OWX B;  1CKN B;  5HGQ A;  4GN3 B;  4H02 A;  4O2D A;  1IBM L;  2IHE A;  5AJ3 L;  2E2H H;  3H3V I;  1C9O A;  2NVT H;  2H5X A;  1K83 H;  4JI8 Q;  5IP7 H;  2JA7 H;  2Y0S G;  1XPR A;  3RZD H;  3OYY A;  1KD1 C;  5IP9 G;  2R7Z H;  1X3E A;  3PO2 G;  4K0K L;  4JI2 L;  4JI8 L;  1PH1 A;  4NXN L;  3CCR A;  1V43 A;  4A3I H;  4A3F H;  1VS0 A;  1SRU A;  3A5U A;  4A3M H;  4DR6 Q;  2EQS A;  3AEV A;  4A93 G;  5FLM H;  1JJ2 A;  3GTQ H;  1T9H A;  2GN5 A;  1IBM Q;  4A3D H;  3RZO H;  2VNU D;  4NXM Q;  1XMO L;  3K7A H;  1S72 A;  4DR5 Q;  4A3K H;  2LSS A;  1YJ9 A;  1Q7Y C;  4DV1 L;  4HJ7 A;  4JI5 Q;  1D8L A;  3M7N A;  1NE3 A;  1GKH A;  2WFW A;  1A62 A;  4JI1 L;  1PV4 A;  1HZC A;  3CAM A;  1VQF A;  1Q8K A;  3AFQ A;  1IXR A;  3PCO B;  2VQF L;  3NEL A;  2AWO A;  1OTC A;  1CKM A;  3J81 j;  4GNX A;  1YI2 A;  2VY3 A;  1K8G A;  2PMZ E;  1I94 Q;  4IFD G;  1IZ6 A;  2IY5 B;  4A3L G;  1A0I A;  4GOP A;  3UE1 A;  3M85 A;  3PUY A;  3PO2 H;  4R4C A;  1NMG A;  3HOU H;  4JYA L;  3CCU A;  3S2D H;  1VQD A;  3HOX G;  5IP7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...