1XMQL

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xmqL00
4LF6L 2F4VQ 1KHIA 4BXXH 2ALYB 1XMQQ 4AYBG 4WJ4A 3HOUH 4X64Q 2OWOA 4JI2L 3J7ZC 1Q12A 1N33Q 1CKNB 2EXDA 4JCVE 1KQSA 4OWWB 1NJIC 1I5FA 4B3ML 4GKKL 3U4VA 4YCUA 2K5HA 2R6GA 3S2DH 1D7QA 3KOJA 5ELOA 3RN5A 1M1KC 3UDGA 1X65A 2E2IH 4R4QA 1N36L 2E2HH 2A1AA 2UXBL 3M85A 1JMCA 5M5XH 1GVPA 1Q1BA 3KJOA 4A3MG 1PH6A 1HNZQ 4P74A 3HOXG 3I4OA 2IX0A 4JI0Q 5JJLA 2F52A 1PA6A 2QGQA 3I2ZA 4QJFA 3KLWA 3G71A 2CFMA 2CQOA 3MXNB 3T1YL 1EQQA 2Z6KC 2PMZE 3W5OA 1VQCA 2KHIA 3RLNA 3TQYA 4BY7H 4DNIA 1QUQB 4Y7NH 3A5UA 4DR6Q 4A3EG 3NBHB 3RNUA 4UP9A 1S40A 2YV5A 4B3SL 1Y1WG 2Q2UA 4DV7L 2K14A 2VL6A 2ZM6L 3A5ZB 4AQYL 4TQUS 1VCIA 4RG1A 4DV0Q 3KFUA 4A3GH 3PCOB 3PSIA 4AIMA 1HNXL 4OX9Q 2JK8A 2OCEA 4DKAC 2UUAL 4JYAL 2E8GA 4HIDA 2N78A 3S1NH 2GVBA 3S2HH 1CKMA 3CAMA 4QIWE 1JT8A 5LMNW 3TRZA 2A8VA 2VY3A 4L5RC 1V43A 2Z6KA 1QVFA 3S16H 1J5EQ 4PMWA 3CCEA 1GO3E 1P16A 4B3TL 3K8AA 1A8VA 2UUCL 4JI7Q 5C4XH 3KF6A 5M3FH 5IYBH 1HNWQ 1I94L 3PUXA 4QY7A 4PZ7A 3W1BA 4LF8L 3CD6A 3FHWA 2JA7H 5GAEC 3CCUA 3J81j 2RHSB 4DUZQ 5M3MH 4LFAL 4LF4Q 1BBWA 1K3RA 4DR3L 1HR0Q 4POGA 4OWXB 1BVSA 4LFBQ 3SGIA 2L15A 1XPRA 4P75A 4DV6Q 4OO1I 1UE1A 5IY0A 3GDEA 2QEXA 2R93H 1CKNA 4BY1G 1QVCA 2OQ0A 4A3IH 2H5XA 4JV5L 1PH2A 2R7ZG 5FJ8H 5K36G 4KHPL 5C0XI 1YVCA 3A74A 4MNOA 4JI8L 1IBKQ 4QQBX 4IPDA 1UEBA 3M7NA 5JEAJ 1AH9A 1C7YA 1IZ6A 1E1TA 3CMAA 1CSPA 3NEMA 2CWPA 1A0IA 1L0WA 3TS2A 1EQRA 4A3FH 1OXXK 2MO1A 4DUYL 1YIJA 2R92G 2ZTCA 1KD1C 1K83H 1YHBA 2K5NA 4YWLA 3RLOA 1QZGA 4HJ7A 1RL2A 5JEAG 2GN5A 3S24A 4HJ5A 1PH7A 2ES2A 4GNXA 1VQNA 4DR7Q 2CKZB 1OXUA 3PUYA 2Z0SA 1XTDA 2VQEQ 4JI4Q 4BBSG 1EOVA 3ULPA 5AJ3Q 1SN8A 1UE7A 3M9BA 5IYDG 2JA8H 3H3VH 2D0OA 4X65L 4DR5Q 1N34L 1VQOA 1TWFH 3CCVA 3OW2A 1SLJA 5BR8L 4HJ8A 1KC8C 1K8AC 2UU9L 1X3FA 1EYGA 1A62A 4DV1Q 1S72A 3TEHB 3GTPH 3S15H 4DR4L 4A3DG 1I3QH 2K4KA 1NMGA 3H0GH 1U5KA 4UP8A 3HOVH 5JJKA 4LUZA 4JI6Q 4X66Q 5E7NA 1YJWA 1Y14B 1HZ9A 2LSSA 3F2BA 2N8NA 3RR5A 1O7IA 4X62Q 1FJGQ 4YY3Q 1FGUA 2UUBL 4IPGA 3K7AH 5GQOA 2LXKA 1B7YB 4PZ6A 1B8AA 4LUVA 4KLKA 2AHOB 4IJHA 3KF6B 2NN6I 1Z47A 4LF5L 3HKZE 3NELA 4K0KL 4YHHQ 1CSQA 3A0JA 3RLFA 2VW9A 4A75A 2JA6H 1UE5A 3CC2A 5C44G 4EQ5A 3F2CA 2MO0A 4A3KH 1VQBA 1C9OA 1D8LA 1PYSB 3HKZG 5FLMH 2NVQH 4A3BH 2MQHA 1SR3A 4JI3L 1UE6A 3W1GA 3K80C 1VQEA 2PNHA 2D62A 2ATWA 4DR2Q 4YCVA 1PV4A 3S1RH 4IPHA 5LMNQ 4GLXA 3EBEA 3CQZH 4WJ3M 3NENA 3CCMA 3D0FA 3CPFA 1IBMQ 3PO2G 3U50C 4L5TA 1PH8A 2BA0A 3D31A 5M5WH 4BBRG 4UP7A 1VQDA 3BZCA 2JA5G 4A3CG 2ZJRA 1Q7YC 1T9HA 4JI5L 4GOPC 3HOWH 1IYJB 1AE2A 2JE6I 3AEVA 5IP7G 4GKJL 3GTOH 2HIVA 4LF8Q 1IBLQ 4HJ9A 4EX5A 1PH4A 3KF8B 1X9NA 1XMOL 3ULJA 4LF9L 3I4MG 1N9WA 5FLMG 3I4NH 3CCRA 4GNXB 4BXXG 2E5LL 3T1HL 3STBC 2B29A 1YBYA 2OTLA 3HOUG 2WFWA 2UXCL 5IT9c 3GTJH 4YCWA 1J6QA 5IWAL 1UWVA 2F3IA 4DK6C 4NPSA 3PF4A 1VQKA 4HIKA 2WP8J 2UXDQ 1KL9A 3HKSA 3HFZB 4XTCS 1PH9A 4DR1L 3IRBA 4DV4Q 4LWCA 4LFCQ 4B3RQ 1JJCB 3F2DA 1X6OA 4DV2Q 2K52A 4QL5A 1VQMA 2MFIA 3I7FA 4JI1Q 4A93H 2VQFL 4X6AH 1E22A 2ZTEA 1PFSA 4DV3L 3CCLA 1C0AA 1X55A 5IYCH 3PO3H 5HGQA 4QGUA 1LUZA 1JE5A 3J81i 4AH6A 4A3JH 3FKIH 4JOIC 5M5YH 1SRUA 2R7DA 4JBWA 1Y1VH 4BY7G 1TWGH 3KJPA 4NXML 3L0OA 3J81c 3CPWA 5H1SE 1NY4A 2JJQA 2AMCB 1ASYA 4X64L 4JBJA 1U0LA 1Q8KA 4A4IA 2Q2IA 3S1MH 2F4VL 1BKBA 3UDFA 4C3IH 2K50A 1Q81C 2JEBI 3UE1A 1XMQL 3WWVA 5IP9H 4A3GG 3GTLH 4RMFA 2UU9Q 1OXVA 3AFPA 4DV5Q 1N33L 2E2JH 4IOAA 5JJIA 2XGTA 1XNRQ 4APVA 3E9HA 1TWHH 3M4PA 2HHHQ 2IHFA 4IPCA 2BH2A 4A3LH 3CCSA 2ID0A 2A19A 2VNUD 1WCMH 4O2DA 3ERSX 5GAGC 1I50H 2LXJA 4JOIA 3UDIA 2YTYA 2WAQE 4LW1A 4GLAC 1HNZL 5DLQE 2BH8A 4LF5Q 5M3FG 5C4XG 5IYBG 4K0KQ 3HOYH 2C35B 1WOCA 5FLXc 2I0QA 3BZKA 2JA7G 1W3SA 3OTOQ 4UPAA 2WAQG 5C3EH 1GD7A 2ASBA 1KAWA 1YZ6A 1PH1A 5M3MG 5IP9G 1PYBA 3PF5A 3HOZH 2OQKA 1HZCA 4DR6L 1BBUA 2OTJA 4JI2Q 1XPUA 3ULLA 2KCMA 2YTXA 1KXLA 1VQIA 1FL0A 1VQHA 3JC66 3UE0A 4P73A 4IOCA 4A3IG 2R93G 4B3MQ 5GADC 3L2PA 4DV0L 4GKKQ 4GN3B 1HH2P 5FJ8G 3M4QA 4OX9L 4DPGA 2CCZA 4A3CH 1PHJA 4GOPB 4MTNA 4DAYB 1SE8A 1K73C 2NVYH 3MEFA 2FXQA 3PV0A 4R4CA 3PIPA 1N36Q 3BJUA 1OXTA 4JC0A 1VQ8A 2UXBQ 1W2BA 1SROA 3LGJA 1PH5A 4A3FG 3EN2A 1J5EL 1VQJA 3T1YQ 2B63H 1IXRA 2E5LQ 3E0EA 1LTLA 4LF6Q 4LF7L 4R4TA 2GVAA 1HNWL 1MIUA 4P72A 2VUMH 4OONA 3STBD 1LYLA 2JA8G 4IFDJ 1MJCA 1L2FA 1EFWA 4DUZL 4PG3A 4YWMA 4B3SQ 4LF4L 4DV7Q 1HR0L 3JAMi 2RHQB 1VQ9A 2ZM6Q 4AQYQ 1CUKA 4BA2I 1A63A 3CMEA 1E1OA 4JBMA 2NZHA 1PH3A 1HNXQ 4IFDG 1B70B 4C3JH 1TWCH 1X3EA 2UUAQ 2ZJQA 2ZTDA 4JYAQ 1SMXA 3GO5A 1YITA 1EWIA 3PUZA 1K9MC 3H0GG 1SFOH 3GTQH 3HOVG 2AWOA 2NN6G 3UDXA 1ASZA 4GLVB 3H15A 4BA1I 4KI0A 3RN2A 1IBKL 1V9PA 1N32L 3CW2C 2IHEA 4B3TQ 2UUCQ 4C3HH 4NXMQ 2N49A 2KENA 3PIOA 3HOXH 1VQLA 3S1QH 4ALPA 1I94Q 3DM3A 3S17H 2JA6G 1YEZA 4A3KG 4FDBA 4DR7L 1X54A 4LUOA 2MNAA 5J3BA 4LFAQ 2VQEL 4JI4L 3K0XA 4GN4B 4GN5A 4XIGS 5AJ3L 3I55A 3DLLA 3CCJA 1Z9FA 4DR3Q 1K0RA 4R1JA 3KYHC 3J80i 2AWNA 4A3EH 4UY8C 1XPOA 1HZBA 1XNQL 4JBKA 3J80c 1Y1WH 4DR5L 1N8RC 1DGSA 4JV5Q 1VQGA 1MJEA 1JJ2A 1L1OC 4OWTB 1GM5A 2Y0SE 4KHPQ 4DV1L 4JG2A 3F1ZA 3ZJYC 3CCQA 1EUJA 2HQLA 2AKWB 4JI8Q 1JJGA 3HOWG 1KRTA 5LMUL 2RF4A 4GOPA 2ZJPA 2HT1A 4JI6L 2Y0SG 4X66L 1K8GA 4MZ9A 3AQQA 4X62L 1FJGL 2QA4A 4YY3L 1X3GA 4DUYQ 2VZAA 1E24A 3U58A 1IL2A 1Q1EA 3GTMH 2KBNA 5GROA 3I4NG 4NXNL 2HIXA 4GS3A 4HJAA 1V1QA 2PI2A 1QVGA 4OXPA 4YHHL 3CF5A 2Q2TA 1M90C 1LM0A 2I5MX 2NVTH 1VQ7A 2YTVA 4H02A 3G6EA 3GD7A 1TWAH 2JQOA 4X65Q 1L1OA 1N34Q 3F8TA 1NBWA 4NB3A 2N3SA 4L5QA 5BR8Q 1WFQA 3S14H 1VQPA 1EIFA 2K5VA 1TXYA 2JA9A 4DR2L 4LNQA 3J7A5 4DR4Q 4PZ8A 5LMNL 1YJNA 4BY1H 3G4SA 3TREA 1IBML 2R7ZH 4A93G 4POFA 3Q8DA 5IYCG 1XJVA 2YU9H 4A3JG 2UUBQ 5EAYA 3GTGH 3PO3G 3KDFA 3AFQA 3FKIG 4LF7Q 4DK3C 2K75A 1Y1VG 1G51A 4IJLA 2PI2E 1GKHA 1E7ZA 2PQAA 1IBLL 2R7FA 4JI0L 2R92H 4J15A 2I5HA 1OTCA 2CWAA 5C0XJ 1MKHA 1VS0A 1YHAA 4ME3A 1Q82C 3L7ZC 3TS0A 3CXCA 4GNXC 4P71A 4OO1G 2NZOA 1VQ5A 3M4OH 4BBSH 2B63G 2NVXH 1YJ9A 1YNXA 4JI3Q 1PVOA 5C0XG 5IYDH 3EIVA 2UXDL 4HIMA 2VS1A 1NE3A 4DV4L 4A3LG 3CP0A 1Q46A 1R9TH 4LFCL 4B3RL 4YWKA 2KHJA 1WCMG 4O0AA 4R4IA 4A3DH 1N32Q 2Q2HA 2DGYA 4DV2L 2IX1A 2IT1A 3U4ZA 3GTKH 1I6HH 4JI5Q 3ER0A 4JI1L 4DAMA 1JB7A 3K81C 3BU2A 5ELNA 4GKJQ 1HJPA 1HZAA 1G6PA 3HOYG 2B3GA 5HY6A 1XMOQ 5C3EG 1VQAA 4LF9Q 1WJJA 1H95A 4JI7L 3HOZG 3T1HQ 1QUQA 3OYYA 2EQSA 1G291 4L5SA 2UXCQ 2XTIA 3E9IA 1Q86C 3CC4A 2V1CC 5C4JH 1NMFA 1XNQQ 1KIXA 5C44H 4A76A 2JEAI 1YI2A 5IWAQ 3RZDH 5IE8A 1OXSC 1L1OB 3ICEA 4LFBL 1HR0W 1QZHA 3H3VI 3G48A 3PUWA 1P8LA 3PUVA 4DV5L 3M3YH 4DR1Q 4Y52H 4KHZA 1CKOA 1VQFA 1FVIA 3JAMc 5GAHC 4DV6L 5LMUQ 1S3OA 4A3BG 1XNRL 1EIYB 1VQ6A 3RZOH 3K7UC 1AE3A 3PGZA 2HHHL 1WI5A 2VQFQ 3PO2H 4IFDI 2WB1E 4C2MH 1RIPA 4BBRH 1KRSA 4R4OA 4DV3Q 4IO9A 2JA5H 1VQ4A 3CC7A 2RCNA 3FP9A 4HIOA 2KCTA 3KDFB 3VDYA 4NXNQ 1NTGA 3B6YA 3I56A 1E3PA 2DUDA 5IP7H 2WB1G 4A3MH 2EIFA 2VUMG 2D0PA 2PQAB 2YYZA 3AYHB 2IY5B 2I5LX 3OTOL 2BA1A 4AYBE 1WYDA 1X56A 1YHQA 3I4MH 4TVAB
chains in the Genus database with same CATH superfamily
2F4VQ 2ZXRA 4AYBG 4WJ4A 1HFGA 1Q12A 4PNYA 5DM73 2EXDA 4JCVE 1G6ZA 1NJIC 4GKKL 2K5HA 3KOJA 1Q8IA 1LTID 3UDGA 1X65A 1EYCA 1N36L 1BNZA 1LTGD 2UXBL 1JMCA 3KJOA 1GVPA 4HSPA 3H6MA 2B2WC 2QGQA 1U4MA 3I2ZA 2HQEA 5CMDA 3KLWA 3MXNB 5C4JB 1EQQA 2Z6KC 4K5XA 2F0EA 1NSNS 5J22A 1QUQB 1Q90A 2CHBD 4UP9A 1Y1WG 3A5ZB 4QF4A 1VCIA 4A3GH 1H9JA 4K2KA 4L8JA 4AIMA 4OX9Q 4IZ8A 4FF4A 2L4NA 1ZKOA 4HIDA 1WTQA 2JA5B 3S2HH 1KLUD 1DOKA 1JT8A 4IUUA 5LMNW 4OEMB 4A3MB 2GA4B 2B2YC 4G4KA 4NW2A 4QUFA 5A35A 1F9SA 5C5MA 4B3TL 2UUCL 1A2UA 5C4XH 2ZXPA 3HEJA 1PRTC 5IYBH 4PZ7A 4ILWA 3FHWA 2JA7H 5GAEC 3DXJC 3H3VC 2RHSB 4DUZQ 3I91A 1BBWA 1BVSA 1SJHD 4OHJA 4DV6Q 4NKLA 3D4DA 3SHLA 1JC7A 4A3IH 2R93H 2H5XA 2F0LA 3CRLC 1JOOA 2FMCA 4MNOA 4JI8L 4IPDA 1IBKQ 1UEBA 3NTIA 5LL6X 3QR8A 1AH9A 1C7YA 1CSPA 4QMGA 1L0WA 2EYFA 4V0BA 1OXXK 1KTKA 1K28A 4LF6Q 4K14A 3S24A 4HJ5A 1VQNA 3PUYA 4MTKA 1VDZA 1EOVA 3M7GA 1PFMA 3CU7A 2PW7A 3S1NB 2B2VC 2IJ0A 4X65L 4DR5Q 5IT9L 1TWFH 1SLJA 1UEAB 1CA6A 2UU9L 1X3FA 4KKSA 1A62A 4IFDH 2AUKA 3TEHB 3L3OC 3S16B 4CJ1B 4A3DG 2K4KA 3ZYYX 1NMGA 2B2UC 5JJKA 4IUQA 4F7XA 2EE1A 4X66Q 4FF3A 5E7NA 1Y14B 4X62Q 1E2VA 1O7IA 4RGMA 3BVMA 4IN3A 1YNJC 1Z47A 4K0KL 1SJED 2AQ2B 3CC2A 2F4IA 1C9OA 3J81L 1D8LA 3OWEB 3SEBA 2MQHA 1VMCA 3FEWX 2EJGC 1PV4A 3EBEA 3K57A 3NENA 3CCMA 3D0FA 3CPFA 1IBMQ 3NQTA 4L5TA 3U50C 3D31A 4BBRG 1VQDA 1M8AA 2EYMA 1AE2A 3SR1A 4GKJL 5I6WA 4HJ9A 1IKLA 2KOLA 2JA8B 3ULJA 3I4MG 5HURA 4RA8A 5FLMG 5BN4A 4BXXG 4OIKA 3MFYA 3HOUG 2WFWA 4LK1C 3TP7A 3GTPB 1J6QA 2HDMA 3A54A 2EYJA 2CH4W 1O80A 2UXDQ 5EJWA 2DN8A 4ZK9B 3VYTA 1NUCA 3IRBA 4DV4Q 2L5TA 4LFCQ 3VA5A 4FNFA 1X6OA 3K7AB 5EBDA 1VQMA 1PDQA 2MFIA 1CZWA 2FJ2A 4A93H 1HCZA 3KUPA 3A7AB 2L12A 2BDNA 1X55A 3PO3H 5TSSA 3C1EA 3OSOA 4RGTA 4JBWA 4DN4M 4BY7G 4NXML 3WDNA 3D6WA 4A3BB 3IKJA 2F0IA 3S1MH 2L55A 2F4VL 3D4WA 2K50A 3P7JA 3QO2A 4RMFA 1OXVA 4IUVA 4DV5Q 5M5WB 2E2JH 2LMCB 2F0JA 4KY5A 4APVA 2PW5A 3E9HA 1LTAD 4IPCA 4N8FA 1Y8NB 4KTAA 5GAGC 1D5XC 4XYOA 3HOYH 1F2YA 5FLXc 1WOCA 2F0KA 3TN2A 2I0QA 3RD4A 3BZKA 1W3SA 2Z6BA 5KNBA 4UPAA 4C3IG 3GTJB 1S5DD 3BDLA 1GD7A 4XYQA 1KAWA 1YZ6A 5M3MG 5IP9G 4KY7A 5CC4A 4ZYSA 3HOZH 3C1FA 1CTMA 1LTSD 2K6AA 3TMEA 5IOCA 1B53A 3HRZC 2KCMA 4YIJA 3TSSA 1VQIA 1FL0A 1VQHA 2XVSA 5A2QL 4IOCA 1FR3A 4GN3B 1HH2P 5FJ8G 4OX9L 4XQJA 4GOPB 3IFDA 1K73C 1D2BA 2EJMA 5M5YB 1W2BA 1Y1VB 4MHEA 5I4DA 2NN6H 1FNVA 1VQJA 4EQNA 2E5LQ 5CYUA 1LTLA 1R4QB 1Z6HA 2AUJD 1RD9D 3VR3A 4DUZL 2IWHA 2RHQB 4R8NA 3JAMi 4AQYQ 1VQ9A 4BA2I 3V96A 1TWHB 5EKIA 2NZHA 1PH3A 1X3EA 1WCMB 2ZJQA 4JYAQ 3GO5A 2XWBB 1K9MC 3C2PA 1WD0A 3H0GG 4XDXA 1SSOA 4B08A 3HOVG 2K03A 3FPUB 1AW7A 3UDXA 3R2IA 4CDEC 1IBKL 2O4XA 2RDHA 2IHEA 1VF5C 3K58A 3Q24A 3SK5A 4XXEA 1VQLA 1RJTA 3S1QH 4ALPA 3FVQA 2JA6G 1C4QA 4FDBA 1X32A 1T5XD 3TDQA 1EY0A 5G3LD 2OTLA 3LX0A 4XIGS 1QVGA 3I55A 3MTSA 2KEEA 3J80i 2PZUA 3T56B 1XPOA 4JBKA 3J80c 1Y1WH 4DR5L 1CK1A 4JV5Q 1VQGA 2E74C 1WTOA 2Y0SE 4KHPQ 1JJGA 3I3CA 1C8CA 2Y0SG 2IW3A 3OWFA 3OMCA 4X66L 4X62L 1X3GA 3OMGA 4DUYQ 4CKEA 1WTWA 4ABNA 5GROA 1EL0A 2ENBA 4NXNL 4HJAA 4FYDA 2A74C 3NK9A 1F2ZA 3CF5A 1JCKB 2Q2TA 4H02A 3G6EA 2XRQD 3GD7A 5JVH3 1L1OA 2G5DA 1VQPA 1GJXA 4CKCA 4DR4Q 3G4SA 1TIID 1IBML 1BCPB 4C3HB 3HOXB 3JAML 3PIO3 3S17B 4A3JG 3I4NB 2PI2E 5FOBB 3VR6A 1L0YB 2R7FA 2LKVA 4DK1A 4J15A 1OTCA 3DM1A 1D5ZC 2PMZB 1MKHA 1VS0A 1YHAA 1Q82C 1PLFA 3TS0A 3CXCA 2NZOA 3MXGA 1PTOH 2NVXH 1YJ9A 4JI3Q 2C9OA 3EIVA 2UXDL 1STAA 3EA6A 2Q8RE 4DV4L 1JWSD 3CP0A 4B9XA 1R9TH 4LFCL 3GTMB 4A3DH 3J80L 1N32Q 2D2CC 4JI5Q 5G3LF 1SNMA 4DAMA 3QB3A 5ELNA 1HJPA 4DAPA 3I73A 1XXGA 5C5LA 1DONA 5E3FA 4LMQD 1XMOQ 5C3EG 2NVTB 4LF9Q 1XWEA 2JSOA 4JI7L 3EJIA 3NE5B 4H44C 3RUZA 2EYPA 2UXCQ 3OW7A 1NMFA 1G8ZD 5D3DA 1SEBD 3RZDH 1L1OB 2R7ZB 1HR0W 1PFBA 1A3TA 4DV5L 3QJYA 2YU9B 5LMUQ 1EWHA 2K1BA 1HQMC 1STHA 3P75A 1EIYB 3RZOH 4IUPA 3DWQA 2VQFQ 4IFDI 2WB1E 4BBRH 2R92B 1KRSA 4XT1B 3CC7A 1E3PA 2WB1G 3M4OB 2EIFA 1I4XA 3AYHB 2I5LX 2IX3A 4X64Q 3I4MH 4BXXH 2ALYB 1XMQQ 2K04A 5CV6A 3HOUH 2OWOA 4K6DA 4C3JG 3I90A 1N33Q 5KNCA 1KQSA 3GTKB 3K5NA 3U4VA 2PPBC 1K3BC 3S2DH 1D5MC 5E4XA 5FKAC 1D7QA 5ELOA 1M1KC 1RF2D 2EZVA 2E2HH 4V190 5M5XH 4A3MG 1Q1BA 1RDPD 1CA5A 5EQ0A 3I4OA 2IX0A 1PRTD 4JI0Q 5JJLA 2F52A 1WTPA 2CQOA 4Q0FA 3W5OA 2JYOA 2L9HA 3HKZB 1VQCA 3K5OA 4BY7H 4DNIA 3VR2A 4EQOA 3M3YB 1AFPA 2QCPX 2K14A 2VL6A 1GUWA 4EGVA 4AQYL 2CQAA 2KHSA 4DV0Q 5JPNC 5CV4A 4DKAC 4C2MB 4JYAL 2E8GA 2GVBA 4CDDC 1IYVA 1CKMA 2PO4A 3CAMA 1TQOA 4KY6A 3DHQA 1KNEA 4L5RC 2A68C 5K36H 1V43A 4PMWA 2K28A 1PYWD 1P16A 1HNWQ 3PUXA 4QY7A 3W1BA 4LF8L 3CD6A 3J81j 3DMUA 1WD1A 2EYLA 4L6TB 1EFID 5M3MH 2K5QA 2ZT9C 4LF4Q 1K3RA 4LFBQ 2RQXA 3D6CA 1UE1A 5IY0A 4MIUA 2QEXA 4BY1G 1QVCA 2NUCA 5IGFA 4JV5L 4DNTB 4JPBW 5FJ8H 5LL6S 4KHPL 1ZYRC 1LT4D 5J1ZA 3A74A 4QQBX 5JEAJ 1IZ6A 3TS2A 3CMAA 3NEMA 3NBIA 1YNJD 4RWSC 1EQRA 4HMIA 2MO1A 4DUYL 3KF8A 4YWLA 4HJ7A 1RL2A 5JEAG 2ES2A 4GNXA 2CKZB 4UDUC 4C56C 5EPJA 1SN8A 3H3VH 2F03A 2EPBA 3WOFA 3Q6SA 3S2HB 2J0TD 4LAAA 3A8KE 2IL8A 1VQOA 2P5ZX 1SYCA 1PRTF 3OW2A 4HJ8A 1UUPA 1EYGA 4DV1Q 2RA4A 1S72A 3S15H 2Z4HA 2F3WA 4DR4L 4QCLA 3H0GH 1U5KA 4UP8A 5C4XB 1TU2B 3HOVH 5C6AA 4JI6Q 3F2BA 3RR5A 1FJGQ 2JA7B 1CI3M 2E75C 1FGUA 4R8IA 4PZ6A 1SMYC 2BCOA 2XIWA 4KLKA 2AHOB 2NN6I 3TP5A 1LABA 4P2CB 4YHHQ 1UAPA 2HCIA 3RLFA 2JA6H 1UE5A 5C44G 2MO0A 2R93B 2K7VA 4A3IB 5IODA 2NVQH 3K0YA 4JI3L 4G7HC 3W1GA 3K80C 2PNHA 3D8GA 3K5MA 4PMCA 4YCVA 5LMNQ 5CV8A 4GLXA 3CQZH 4WJ3M 3GQBA 4RHSA 1GHJA 1F2LA 1PH8A 1S5ED 2BA0A 3I8ZA 1EY9A 2Z1CA 4A3CG 1A6XA 2ZJRA 1Q7YC 4JI5L 1HXYD 3EFXD 1S5BD 3AEVA 1MGSA 1V8QA 5CV5A 3KF8B 1X9NA 1XMOL 2OEOA 4LF9L 4GNXB 3P20A 3STBC 1TWFB 2B29A 2UXCL 4RCNA 5IT9c 3X3MA 1AP0A 4RCOA 4YCWA 2F3IA 2F0VA 4DK6C 1VQKA 4DA2A 1KL9A 1LT3D 2RCFA 4JW0A 4LWCA 1E2WA 3PO2B 5LHY1 3OPOA 1CT1D 4DV2Q 4K8IA 1LO5D 1B3AA 1J9OA 3DUZA 2G9HD 3I7FA 4CKBA 4JI1Q 3SXHA 2VQFL 4X6AH 4FXDA 1E22A 4A3JH 1JE5A 3HS0C 4AH6A 3J81i 4JOIC 5T1GA 2R7DA 3L0OA 3SK6A 3J81c 1ASYA 1CHQD 4KK7A 4X64L 4JBJA 1IKMA 1LACA 3UDFA 1Q81C 1XMQL 2NTTA 3E0JA 5D3IB 1F9RA 1QNKA 3AFPA 4ULLA 1N33L 3T16A 3KLSA 1SDFA 4K2LA 1PZID 4IOAA 5JJIA 1SE3A 4DGZA 3M4PA 2HHHQ 2IHFA 4RKBA 2Z4IA 1JR0D 4MN3A 3R3OA 3T13A 4O2DA 2F0PA 3ERSX 4ZUJA 3VYSA 3E6ZX 4LF5Q 5M3FG 2MHVA 2C35B 1ENFA 2HD3A 2B2TA 2OF1A 5C3EH 2OT2A 3OOCA 3PQIA 5FO7B 5IGDA 1F9QA 1L0XB 3HZXA 3ULLA 3P1HA 2YTXA 1KXLA 1STNA 1K8OA 3L2PA 4DV0L 4A93B 3M4QA 4DPGA 2CCZA 3AU7A 3VA7A 4N8X1 4MTNA 1PFNA 4E6IA 2FXQA 1TY2A 2CW0D 2WINB 2R61A 1PH5A 1SYGA 4A3FG 3NP8A 1I4GA 3NHHA 3S1MB 1TT2A 2RBMA 3T1YQ 1IXRA 5ELDA 4LF7L 1MBYA 1QG7A 2GVAA 1HNWL 1MIUA 4HAEA 4PQXA 3KBXA 5FLXE 1FGBD 2EY6A 1KLGD 5IGGA 1L2FA 1Z7TA 4LF4L 4DV7Q 4XQNA 1CUKA 1IYUA 1A63A 1E1OA 3MWYW 1HNXQ 1B70B 4C3JH 1TWCH 5CGKA 1EWIA 2G9DA 1W6KA 3HOYB 4BA1I 4KI0A 1O7YA 1DXMA 4ZKCB 5E4WC 4QUCA 3TP8A 3PIOA 3HOZB 2QF7A 4CBVA 2OXPA 1YEZA 4HMJA 4DF7A 4A3KG 3HP3A 2MNAA 1SNQA 4GN5A 4DR3Q 3CCJA 1Z9FA 1K0RA 1LLRD 3KK7A 3KYHC 5I6YA 4UY8C 1S4ZA 2RKSA 5HGTA 2FFKB 3EROA 2KCCA 1DGSA 1I3QB 4FXGC 1WTRA 2KCNA 1MJEA 1JJ2A 1GM5A 1EEFD 4DV1L 4JG2A 1EUJA 4RGOS 3KBGA 4C3HG 4GOPA 2X6LA 3HOWG 4H0LC 4JI6L 1TS3A 3FRPB 3AQQA 1FJGL 1Q1EA 1JWMD 3I4NG 4RAUC 3A55A 2AQ1B 2SEBD 4AYBB 1QJOA 2CVRA 4OXPA 5COYA 4YHHL 3NPPA 2K5DA 4ZAIA 2IPKD 3F8TA 4L5QA 2VXWA 3S14H 4DU9A 1STBA 3J7A5 5LMNL 4BY1H 1VMPA 1QB5D 1IW7C 5L37A 1PXUA 3S1QB 2LY7A 1HA5A 1D6EC 4POFA 1AZPA 4BWGB 1DYQA 4NDXA 3KDFA 3AFQA 5D65A 4IJLA 3URYA 4DK3C 1GKHA 1E7ZA 4ID6A 3H91A 1FNWA 1SYBA 4IALA 4FF1A 5C0XJ 1SNPA 4OO1G 5M9OA 1Y1WB 4GNXC 1I4PA 3SDZA 1YNXA 2EYOA 5ELCA 5C0XG 1RKNA 4F8MA 3S9WA 5JJZA 1RODA 3LWUA 1Q3LA 1HUMA 4A3LG 4EQPA 2NB0A 2F0QA 2KHJA 4O0AA 1JOQA 2Q2HA 4DV2L 3QG1A 2IX1A 1I6HH 2KA7A 4JI1L 1HZAA 3FKIB 3AMUA 3Q22A 1LT5D 2B3GA 3GV6A 2Q8TA 4S3SA 1WJJA 1H95A 5DAUA 4I65A 4ODGA 3T1HQ 3H09A 2EQSA 3TBIB 1I4QA 2M00A 3CC4A 1DD2A 3DEOA 1XNQQ 5C44H 2JEAI 1BO0A 1YI2A 2A6HC 4FO2A 5IE8A 1OXSC 2CH4A 3TP6A 2QW7A 1QZHA 3H3VI 1P8LA 2NBFA 4XT3B 3NTHA 1VQFA 3JAMc 4DV6L 5CR3A 1B9NA 4B9WA 1EY5A 1JB3A 4X3KA 1O7ZA 2F0FA 3PGZA 2J7ZA 4TKOB 4ZUIA 2HHHL 3R93A 4DV3Q 4A3CH 1E0BA 1OO9B 2RCNA 3Q0AA 5KRUA 2KCTA 3KDFB 3I56A 2DUDA 4ME5A 1CZGA 1PTOB 2BA1A 4FVMA 2NVXB 2WV6D 1WYDA 4R4QA 1YHQA 4LF6L 1PTOD 1BR9A 1D1IA 2QKIC 5IIFA 3O13A 4DXFA 5BN5A 1O7LA 1R9TB 4PV1C 1CKNB 2RSNA 4A3DB 1JICA 5C4HA 1I5FA 4YCUA 2PCFB 4N9TA 3RN5A 2A68D 3K6OA 2E2IH 2PZTA 2A1AA 1DOMA 3OIPA 3A56A 1PH6A 2B63B 1HNZQ 1X3QA 2VUMB 3SK8A 3G71A 3T1YL 1FYCA 1M4VA 3DEPA 3RZDB 3RLNA 2KHIA 4Y7NH 3A5UA 2F0TA 4DR6Q 4A3EG 1ONLA 1LTTD 2Q2UA 4DV7L 1EYDA 4TQUS 1C48A 3RZOB 2BE5C 3GTQB 3PCOB 3PSIA 1HNXL 2JK8A 1ZYRD 4OL7A 4BBRB 4XQQA 4QIWE 4H7BA 5F2DA 3TRZA 2A8VA 2VY3A 2Z6KA 1QVFA 4U673 1KDAA 3I4MB 3CCEA 3A8IE 1W6JA 1A8VA 3CRKC 2A73B 3KF6A 5M3FH 3BYTB 4HCEA 3J7AV 3BDOA 2O5JC 3VYUA 1HR0Q 4DR3L 3S2DB 5EGTA 3SGIA 1XPRA 4DXGA 4HN7A 3GDEA 5ELBA 2OQ0A 2XWJB 4GZYC 3DWPA 4IQZA 2B2YA 3X3NA 1PTOF 1SMYD 1E1TA 3NUCA 1A0IA 2QEJC 4A3FH 2ZTCA 1KD1C 1K83H 2K5NA 1BXTA 1FNUA 1RTNA 3MXUA 2K32A 4DR7Q 1OXUA 1TWAB 1VF7A 1XTDA 2VQEQ 4JI4Q 4BBSG 2I46A 3ULPA 1CHPD 1EZ6A 1GUOA 1UE7A 5IYDG 4KV6A 3CHBD 3N52A 1B50A 3CCVA 2BDOA 4RGNA 5ELFA 2PYKA 3FDTA 4LUZA 1PMRA 5E1FA 1QNUA 5GQOA 2LXKA 5M3MB 4IJHA 3R2TA 3KF6B 4CJ2C 2MUYA 1CSQA 3A0JA 2VW9A 2B2VA 4A75A 3F2CA 4A3KH 5JAVA 4J6HA 5FLMH 1SR3A 1UE6A 1WTVA 1B1ZA 4DR2Q 4KJOA 3BG3A 2B2UA 3S1RH 2EYHA 2WKDA 4IPHA 5IGEA 2B8GA 2JP1A 3MXPA 3PO2G 3OIQA 1U4PA 1E2ZA 4UP7A 3MZ5A 2JA5G 1T9HA 4GOPC 3HOWH 4TSSA 1PRTB 2R3ZA 3GTOH 1IBLQ 3EQLC 4EX5A 3I4NH 2NYZD 1B44D 2E5LL 4K5WA 3T1HL 1YBYA 2QDBA 2DJFC 1G2TA 3S15B 4NPSA 4DK0A 5EPLA 3HKSA 4XTCS 3C46A 4B3RQ 1JJCB 1GHKA 4DAYA 4QL5A 3PMFA 1UNSA 4DNRB 5CV7A 1RHPA 2ZTEA 1U9RA 4DV3L 3CCLA 2JA6B 4QGUA 2A69C 2L0CA 2MJ8A 2NVQB 1TWGH 3BYYB 3KJPA 5H1SE 1NY4A 1I6VC 1U0LA 1Q8KA 4OO1H 4C3IH 4J1MA 2A6EC 3MHBA 2FINB 2TMPA 3WWVA 3HG9A 5IP9H 3GTLH 2UU9Q 5C0XH 5IT9E 4Q5VA 4KD4A 1TY0A 1XNRQ 5KYLA 2Y0SB 4G7ZC 4A3LH 3CCSA 2A19A 2VNUD 1I50H 2LXJA 3UDIA 1F2MA 4LW1A 1HNZL 5JOBA 4K0KQ 3BVGA 3TZUA 3C3LA 2KJXA 1K8MA 2KQ3A 3D4RA 1PH1A 1EWCA 5KNDA 1PYBA 1NR4A 2OQKA 1HZCA 4DR6L 2OTJA 1V1OA 1DM0B 4JI2Q 3J81E 2F0NA 1XPUA 4A3GB 1LV9A 3UE0A 3JC66 4P73A 4B3MQ 2KEDA 1ET6A 1MD2D 2F0OA 4DAYB 2NVYH 3MEFA 4R4CA 3PIPA 4A3JB 2SNSA 3BJUA 3ONAB 3QIAA 4JC0A 1VQ8A 1SROA 1BCPC 1EY6A 1LTRD 4ZQ3A 4ZKBB 3OHXC 2RDGA 5I9PA 3E0EA 2WAQB 1RTOA 4R4TA 2XRSD 1A3UA 4OONA 4CHTB 2E2DC 2HDLA 2JA8G 1TR5A 4JK1C 1EFWA 4PG3A 4YWMA 4B3SQ 1HR0L 1J8IA 3KLRA 2ZM6Q 3CMEA 1EOTA 4JBMA 2RSOA 1JQYD 2UUAQ 1NAPA 1SFOH 2NN6G 1ASZA 4GLVB 2KUMA 3V05A 2AQ3B 3IL8A 1Y8OB 4M1UB 1N32L 3CW2C 2FHTA 4NXMQ 2KENA 1ENAA 2WIIB 1I94Q 2QILA 3AB9A 4Z9CB 4DR7L 4LFAQ 2VQEL 4JI4L 1PHJA 4GN4B 4A3BG 1SE4A 4A3EH 4PMBA 1N8RC 3R8BA 1IW7D 3J7YW 1F9PA 1L1OC 2NWGA 4OWTB 3F1ZA 3ZJYC 4FP5D 5LMUL 2RF4A 2F1MA 4O1NA 2HT1A 2WB1B 1GUNA 3SVMA 3MFGA 2H1EA 1E24A 3U58A 5K5PA 2B39A 5I2XA 2KBNA 1V1QA 4O42A 3TZDA 4BS9A 1HUNA 4C3JB 2I5MX 1TWCB 1ILQA 2JQOA 1N34Q 4WRDA 1NBWA 3FPPA 3QOLA 4NB3A 2N3SA 5BR8Q 1TS5A 1WFQA 5A2QE 2E76C 1EIFA 5D14A 1TXYA 2JA9A 4DR2L 3HGBA 4U68A 1YJNA 2F0GA 3TREA 3LNNA 3RMHA 4KD3A 4L63B 5JPMC 1BBXC 5IYCG 3GTGH 3NSWA 2UUBQ 3FKIG 5ELEA 1DCZA 1Y1VG 1G51A 2K75A 2LFNA 2VB3X 2PQAA 2WKCA 1IBLL 4JI0L 2K05A 2I5HA 1V1PA 1WVLA 1HTLD 2CWAA 3L7ZC 1ESRA 2A6HD 1VQ5A 4KKUA 1GUSA 4BBSH 5IYDH 5JVG3 4HIMA 1FD7D 2VS1A 2RVLA 1NE3A 1ZEQX 4OGQC 1Q46A 5KYIA 4B3RL 4N9PA 4R4IA 1WCMG 2IT1A 3ER0A 3PO3B 4C1NK 2EDGA 2V4DA 3BU2A 3K81C 1JB7A 1G6PA 1DOLA 1SNDA 4H13C 5HY6A 1DZ1A 1O78A 1RCVD 3NXWA 3UI2A 2FMMA 1G291 2ZXOA 3NBHA 5IGBA 3E9IA 2XTIA 3S14B 5C4JH 1D1KA 1KIXA 4IUTA 5IWAQ 4BY1B 3ND8A 2E2JB 3ICEA 4LFBL 1KDBA 3G48A 3PUVA 4DR1Q 1IL8A 4Y52H 4KHZA 1CKOA 1U4LA 1ZXTA 5GAHC 1HRJA 1S3OA 1YNNC 1XNRL 5FO9B 1VQ6A 3K7UC 1AE3A 5EKLA 3PO2H 2Q8IB 4K8JA 1RIPA 1A3VA 2JA5H 2B63G 1VQ4A 4NXNQ 3FP9A 2X69A 2NZ1D 4A3MH 2VUMG 2DY7A 2D0PA 2PQAB 2YYZA 2IY5B 1V1PB 4A4IA 1QWYA 3VR4A 3CKIB 1CQVA 1KHIA 4RHRA 2BE5D 3W3AA 4JI2L 3J7ZC 2EXZA 3W2DA 2M9VA 3MEHA 4OWWB 1HFNA 1I6HB 4CGYB 4B3ML 4DFAA 2R6GA 3BZDB 3PIP3 3T51B 4DAVA 3JAME 3M85A 1EY4A 2F0HA 1Y8PB 4P74A 3HOXG 1EIHA 1B9MA 1PA6A 1XX8A 2O2LD 4QJFA 3I72A 2CFMA 5C44B 2DJGC 3FMCA 2F0DA 2PMZE 3TQYA 1B2TA 1SBBB 2SDFA 5C3XA 3NBHB 3RNUA 1S40A 2YV5A 1KDCA 4B3SL 2QDLA 2ZM6L 1ESFA 4RG1A 3KFUA 1R4PB 2OCEA 2UUAL 2MGSA 3S1NH 2N78A 4X3SA 2K5WA 1STYA 4NP5A 3M4YA 3J80E 1KNAA 4F87A 3S16H 1J5EQ 1GO3E 4JI7Q 3K8AA 4RKLA 1I94L 4NMZA 3T4AC 3CCUA 1QE6A 4LFAL 5JEAH 2D5DA 4POGA 4OWXB 1EY8A 2L15A 2DNEA 4P75A 1LT6D 4OO1I 2E2IB 1ET9A 1CKNA 4ZCKA 1PH2A 2R7ZG 2ICEC 2XNAC 5K36G 1H9SA 5C0XI 1YVCA 2WACA 3N6RA 5CV9A 2H4OA 3M7NA 2XSCA 2EOTA 1GOZA 2CWPA 1SYDA 4Y7NB 4ZLTF 1YIJA 3G6JB 4I7ZC 1EIGA 1JE4A 2R92G 1YHBA 1QZGA 3NWTA 3RLOA 1PH7A 2GN5A 5CBAE 4RH6A 3I70A 2Z0SA 1A2TA 1U4RA 5AJ3Q 2F3VA 1SNCA 3M9BA 2JA8H 3MA2B 2D0OA 3NQIA 1N34L 4UAIA 5BR8L 1XYIA 3QOJA 1KC8C 1K8AC 2TSSA 3GTPH 4KN4C 3A7LA 1I3QH 3BVZA 4CDCC 1S5FD 3ITPA 4QB4A 5M3FB 1LTBD 1II3A 1YJWA 2LSSA 1HZ9A 4FF2A 2N8NA 4YY3Q 2UUBL 4IPGA 1EYAA 3K7AH 1B7YB 1B8AA 1MSHA 4LUVA 4X3UA 1HQRD 4LF5L 3HKZE 3NELA 1S5CD 2L1BA 4EQ5A 2MP1A 4X3TA 1VQBA 1PYSB 3HKZG 4F88A 4G7OC 4A3BH 1XTCD 5C4ZA 2DY8A 2C5CA 1VQEA 2K01A 2D62A 4KN7C 2ATWA 1QILA 3T53B 1CQFA 4FXKC 2A5HA 1JORA 2EY1A 1TKWB 3L9AX 1AZQA 1H9SB 4A3FB 5M5WH 1G91A 2F0MA 3E3XA 2CW0C 1K83B 3BZCA 2M2LA 1TVXA 2F0SA 1IYJB 1SAPA 2A69D 2JE6I 5IP7G 1H9RA 2HIVA 1TS2A 4LF8Q 1BF4A 1PH4A 2HUGA 1N9WA 4TRDA 5EKKA 3CCRA 5FLXL 2A6ED 1H9MA 3ERQA 2J4XA 3Q23A 3GTJH 1T5EA 5IWAL 3PF4A 1UWVA 4HIKA 2WP8J 3HFZB 1PH9A 1B4OA 4DR1L 4WORA 3VYRA 4UHVA 3F2DA 2K52A 3H94A 3SK4A 1K0SA 1TS4A 2B2WA 1PFSA 1C0AA 2LS01 5IYCH 5HGQA 4A3KB 1LUZA 3FKIH 5M5YH 1SRUA 1Y1VH 5J39A 3CPWA 2JJQA 2AMCB 3HOUB 3U9OA 1SNOA 2Q2IA 1BKBA 2B2TC 1ENCA 3S1RB 1MSGA 2JEBI 3UE1A 2MPMA 4A3GG 5EPKA 1HTPA 1BQQT 3GP7A 1HPCA 5FK9C 1HHVA 1PZKD 2F0WA 3U9SA 3HOWB 2E2HB 2PQEA 2XGTA 2EY2A 3GTOB 5M5XB 1TWHH 1BCPD 2BH2A 1JOKA 2ID0A 1WCMH 4HCSA 4JOIA 3EVQA 3LWEA 1ML0D 1WTHA 2YTYA 4WFN3 2WAQE 4GLAC 5C4XG 5DLQE 2BH8A 5BN3A 1I4HA 5IYBG 1A15A 4BY7B 2JA7G 3OTOQ 1BDOA 1EEID 2WAQG 2ASBA 2N88A 1EU4A 4IUNA 3PF5A 5KGUA 1BBUA 1HA6A 1ICFB 1KABA 3G7LA 2R93G 4A3IG 3A8JE 5GADC 4GKKQ 2HCCA 1GUGA 3MC0B 4CDFC 1JWUD 1EU3A 1SE8A 3PV0A 5ISRA 1WTXA 1STEA 1N36Q 2UXBQ 1OXTA 4RFBA 1TWGB 2N55A 3LGJA 3EN2A 3F2UA 1J5EL 2X6GA 2B63H 2VB2X 4C3IB 4P72A 5NUCA 2VUMH 3GTLB 2KECA 3STBD 2EVBA 1LYLA 1SYFA 4IFDJ 1MJCA 1ICWA 2PZWA 4OELB 2O5IC 1F77A 3QWNA 4IFDG 2PNRC 2ZTDA 5KIXA 1SMXA 3I4LA 1I50B 4IURA 3PUZA 1YITA 3GTQH 1NR2A 5KEEA 3NTKA 2AWOA 2JN4A 2Z8LA 3E5SA 5EBCA 3H15A 2F0UA 3RN2A 1SXTA 1V9PA 1EZ8A 4B3TQ 2UUCQ 4C3HH 2N49A 5FO8B 3HOXH 1EQVA 3VR5A 3DM3A 3S17H 3ND9A 4CJ0B 3K5LA 2BOSA 1X54A 4LUOA 2SOBA 5J3BA 3K0XA 2JXMB 4HEDA 5AJ3L 3DLLA 1BCPF 4R1JA 2AWNA 1STGA 1CM9A 1HZBA 1XNQL 4I7AA 2NVYB 5DEHA 3NWSA 1NNXA 3H0GB 3HOVB 3CCQA 3WOEA 2HQLA 2AKWB 5T1IA 4JI8Q 4HR7B 1KRTA 4JVZA 2K33A 2ZJPA 1K8GA 4MZ9A 3GV3A 3SE0A 2NTSA 2QA4A 4YY3L 1IL2A 3GTMH 2VZAA 1AN8A 2HIXA 4GS3A 5I9OA 5CBEE 2PI2A 1MI2A 1PZJD 1SYEA 1M90C 1LM0A 3IFTA 1PTOC 2NVTH 1VQ7A 2YTVA 4K5VA 3MAQA 4KMUC 1TWAH 4LJZC 4X65Q 1SFOB 1ILPA 1Y69U 1H9KA 3CQZB 5AFWA 2K5VA 4EVOA 4LNQA 1MHWC 4PZ8A 1GUTA 3BS1A 2R7ZH 4A93G 2Z9HA 3Q8DA 1XJVA 2D9UA 4HSVA 2YU9H 4HTHA 5EAYA 4ZRZA 3PO3G 2I07B 5DNFA 4LF7Q 4A3EB 2R92H 2L11A 2ICIA 4KHVA 4K6LA 4M8AA 5IGCA 4ME3A 4P71A 1G2SA 2EJFC 3M4OH 4KJNA 1PVOA 2KVMA 1CFMA 2DNCA 3BDCA 5C3WA 1YNND 3IAYA 3DWAA 5DM63 3MVVA 3D3RA 4YWKA 3V2TA 2DGYA 4QIWB 3U4ZA 3GTKH 4OIJA 1B3QA 1BOSA 4KKTA 1QOHA 2B8FA 4GKJQ 3HOYG 3MXNA 1EY7A 1I4RA 1VQAA 4C1NI 2SNMA 4WJWA 1SE2A 3HOZG 1QUQA 1EQTA 3OYYA 4L5SA 1QCBD 1Q86C 1IHZA 2RDFA 2V1CC 4A76A 1BUVT 5CORA 3PUWA 3M3YH 1FVIA 4G57A 3K59A 3GTGB 1KAAA 1DJRD 1NCVA 4R9WA 2XN9C 1GXDC 1AEXA 1WI5A 4C2MH 5I2YA 4R4OA 4IO9A 4HIOA 3VDYA 5C3EB 1NTGA 3B6YA 3KLSX 5IP7H 4BBSB 1X3PA 4J8QA 3OTOL 3J7AF 4AYBE 1X56A 2EY5A 4TVAB
chains in the Genus database with same CATH topology
4LF6L 2F4VQ 1KHIA 4BXXH 2ALYB 1XMQQ 4AYBG 4WJ4A 3HOUH 4X64Q 2OWOA 4JI2L 3J7ZC 1Q12A 1N33Q 1CKNB 2EXDA 4JCVE 1KQSA 4OWWB 1NJIC 1I5FA 4B3ML 4GKKL 3U4VA 4YCUA 2K5HA 2R6GA 3S2DH 1D7QA 3KOJA 5ELOA 3RN5A 1M1KC 3UDGA 1X65A 2E2IH 4R4QA 1N36L 2E2HH 2A1AA 2UXBL 3M85A 1JMCA 5M5XH 1GVPA 1Q1BA 3KJOA 4A3MG 1PH6A 1HNZQ 4P74A 3HOXG 3I4OA 2IX0A 4JI0Q 5JJLA 2F52A 1PA6A 2QGQA 3I2ZA 4QJFA 3KLWA 3G71A 2CFMA 2CQOA 3MXNB 3T1YL 1EQQA 2Z6KC 2PMZE 3W5OA 1VQCA 2KHIA 3RLNA 3TQYA 4BY7H 4DNIA 1QUQB 4Y7NH 3A5UA 4DR6Q 4A3EG 3NBHB 3RNUA 4UP9A 1S40A 2YV5A 4B3SL 1Y1WG 2Q2UA 4DV7L 2K14A 2VL6A 2ZM6L 3A5ZB 4AQYL 4TQUS 1VCIA 4RG1A 4DV0Q 3KFUA 4A3GH 3PCOB 3PSIA 4AIMA 1HNXL 4OX9Q 2JK8A 2OCEA 4DKAC 2UUAL 4JYAL 2E8GA 4HIDA 2N78A 3S1NH 2GVBA 3S2HH 1CKMA 3CAMA 4QIWE 1JT8A 5LMNW 3TRZA 2A8VA 2VY3A 4L5RC 1V43A 2Z6KA 1QVFA 3S16H 1J5EQ 4PMWA 3CCEA 1GO3E 1P16A 4B3TL 3K8AA 1A8VA 2UUCL 4JI7Q 5C4XH 3KF6A 5M3FH 5IYBH 1HNWQ 1I94L 3PUXA 4QY7A 4PZ7A 3W1BA 4LF8L 3CD6A 3FHWA 2JA7H 5GAEC 3CCUA 3J81j 2RHSB 4DUZQ 5M3MH 4LFAL 4LF4Q 1BBWA 1K3RA 4DR3L 1HR0Q 4POGA 4OWXB 1BVSA 4LFBQ 3SGIA 2L15A 1XPRA 4P75A 4DV6Q 4OO1I 1UE1A 5IY0A 3GDEA 2QEXA 2R93H 1CKNA 4BY1G 1QVCA 2OQ0A 4A3IH 2H5XA 4JV5L 1PH2A 2R7ZG 5FJ8H 5K36G 4KHPL 5C0XI 1YVCA 3A74A 4MNOA 4JI8L 1IBKQ 4QQBX 4IPDA 1UEBA 3M7NA 5JEAJ 1AH9A 1C7YA 1IZ6A 1E1TA 3CMAA 1CSPA 3NEMA 2CWPA 1A0IA 1L0WA 3TS2A 1EQRA 4A3FH 1OXXK 2MO1A 4DUYL 1YIJA 2R92G 2ZTCA 1KD1C 1K83H 1YHBA 2K5NA 4YWLA 3RLOA 1QZGA 4HJ7A 1RL2A 5JEAG 2GN5A 3S24A 4HJ5A 1PH7A 2ES2A 4GNXA 1VQNA 4DR7Q 2CKZB 1OXUA 3PUYA 2Z0SA 1XTDA 2VQEQ 4JI4Q 4BBSG 1EOVA 3ULPA 5AJ3Q 1SN8A 1UE7A 3M9BA 5IYDG 2JA8H 3H3VH 2D0OA 4X65L 4DR5Q 1N34L 1VQOA 1TWFH 3CCVA 3OW2A 1SLJA 5BR8L 4HJ8A 1KC8C 1K8AC 2UU9L 1X3FA 1EYGA 1A62A 4DV1Q 1S72A 3TEHB 3GTPH 3S15H 4DR4L 4A3DG 1I3QH 2K4KA 1NMGA 3H0GH 1U5KA 4UP8A 3HOVH 5JJKA 4LUZA 4JI6Q 4X66Q 5E7NA 1YJWA 1Y14B 1HZ9A 2LSSA 3F2BA 2N8NA 3RR5A 1O7IA 4X62Q 1FJGQ 4YY3Q 1FGUA 2UUBL 4IPGA 3K7AH 5GQOA 2LXKA 1B7YB 4PZ6A 1B8AA 4LUVA 4KLKA 2AHOB 4IJHA 3KF6B 2NN6I 1Z47A 4LF5L 3HKZE 3NELA 4K0KL 4YHHQ 1CSQA 3A0JA 3RLFA 2VW9A 4A75A 2JA6H 1UE5A 3CC2A 5C44G 4EQ5A 3F2CA 2MO0A 4A3KH 1VQBA 1C9OA 1D8LA 1PYSB 3HKZG 5FLMH 2NVQH 4A3BH 2MQHA 1SR3A 4JI3L 1UE6A 3W1GA 3K80C 1VQEA 2PNHA 2D62A 2ATWA 4DR2Q 4YCVA 1PV4A 3S1RH 4IPHA 5LMNQ 4GLXA 3EBEA 3CQZH 4WJ3M 3NENA 3CCMA 3D0FA 3CPFA 1IBMQ 3PO2G 3U50C 4L5TA 1PH8A 2BA0A 3D31A 5M5WH 4BBRG 4UP7A 1VQDA 3BZCA 2JA5G 4A3CG 2ZJRA 1Q7YC 1T9HA 4JI5L 4GOPC 3HOWH 1IYJB 1AE2A 2JE6I 3AEVA 5IP7G 4GKJL 3GTOH 2HIVA 4LF8Q 1IBLQ 4HJ9A 4EX5A 1PH4A 3KF8B 1X9NA 1XMOL 3ULJA 4LF9L 3I4MG 1N9WA 5FLMG 3I4NH 3CCRA 4GNXB 4BXXG 2E5LL 3T1HL 3STBC 2B29A 1YBYA 2OTLA 3HOUG 2WFWA 2UXCL 5IT9c 3GTJH 4YCWA 1J6QA 5IWAL 1UWVA 2F3IA 4DK6C 4NPSA 3PF4A 1VQKA 4HIKA 2WP8J 2UXDQ 1KL9A 3HKSA 3HFZB 4XTCS 1PH9A 4DR1L 3IRBA 4DV4Q 4LWCA 4LFCQ 4B3RQ 1JJCB 3F2DA 1X6OA 4DV2Q 2K52A 4QL5A 1VQMA 2MFIA 3I7FA 4JI1Q 4A93H 2VQFL 4X6AH 1E22A 2ZTEA 1PFSA 4DV3L 3CCLA 1C0AA 1X55A 5IYCH 3PO3H 5HGQA 4QGUA 1LUZA 1JE5A 3J81i 4AH6A 4A3JH 3FKIH 4JOIC 5M5YH 1SRUA 2R7DA 4JBWA 1Y1VH 4BY7G 1TWGH 3KJPA 4NXML 3L0OA 3J81c 3CPWA 5H1SE 1NY4A 2JJQA 2AMCB 1ASYA 4X64L 4JBJA 1U0LA 1Q8KA 4A4IA 2Q2IA 3S1MH 2F4VL 1BKBA 3UDFA 4C3IH 2K50A 1Q81C 2JEBI 3UE1A 1XMQL 3WWVA 5IP9H 4A3GG 3GTLH 4RMFA 2UU9Q 1OXVA 3AFPA 4DV5Q 1N33L 2E2JH 4IOAA 5JJIA 2XGTA 1XNRQ 4APVA 3E9HA 1TWHH 3M4PA 2HHHQ 2IHFA 4IPCA 2BH2A 4A3LH 3CCSA 2ID0A 2A19A 2VNUD 1WCMH 4O2DA 3ERSX 5GAGC 1I50H 2LXJA 4JOIA 3UDIA 2YTYA 2WAQE 4LW1A 4GLAC 1HNZL 5DLQE 2BH8A 4LF5Q 5M3FG 5C4XG 5IYBG 4K0KQ 3HOYH 2C35B 1WOCA 5FLXc 2I0QA 3BZKA 2JA7G 1W3SA 3OTOQ 4UPAA 2WAQG 5C3EH 1GD7A 2ASBA 1KAWA 1YZ6A 1PH1A 5M3MG 5IP9G 1PYBA 3PF5A 3HOZH 2OQKA 1HZCA 4DR6L 1BBUA 2OTJA 4JI2Q 1XPUA 3ULLA 2KCMA 2YTXA 1KXLA 1VQIA 1FL0A 1VQHA 3JC66 3UE0A 4P73A 4IOCA 4A3IG 2R93G 4B3MQ 5GADC 3L2PA 4DV0L 4GKKQ 4GN3B 1HH2P 5FJ8G 3M4QA 4OX9L 4DPGA 2CCZA 4A3CH 1PHJA 4GOPB 4MTNA 4DAYB 1SE8A 1K73C 2NVYH 3MEFA 2FXQA 3PV0A 4R4CA 3PIPA 1N36Q 3BJUA 1OXTA 4JC0A 1VQ8A 2UXBQ 1W2BA 1SROA 3LGJA 1PH5A 4A3FG 3EN2A 1J5EL 1VQJA 3T1YQ 2B63H 1IXRA 2E5LQ 3E0EA 1LTLA 4LF6Q 4LF7L 4R4TA 2GVAA 1HNWL 1MIUA 4P72A 2VUMH 4OONA 3STBD 1LYLA 2JA8G 4IFDJ 1MJCA 1L2FA 1EFWA 4DUZL 4PG3A 4YWMA 4B3SQ 4LF4L 4DV7Q 1HR0L 3JAMi 2RHQB 1VQ9A 2ZM6Q 4AQYQ 1CUKA 4BA2I 1A63A 3CMEA 1E1OA 4JBMA 2NZHA 1PH3A 1HNXQ 4IFDG 1B70B 4C3JH 1TWCH 1X3EA 2UUAQ 2ZJQA 2ZTDA 4JYAQ 1SMXA 3GO5A 1YITA 1EWIA 3PUZA 1K9MC 3H0GG 1SFOH 3GTQH 3HOVG 2AWOA 2NN6G 3UDXA 1ASZA 4GLVB 3H15A 4BA1I 4KI0A 3RN2A 1IBKL 1V9PA 1N32L 3CW2C 2IHEA 4B3TQ 2UUCQ 4C3HH 4NXMQ 2N49A 2KENA 3PIOA 3HOXH 1VQLA 3S1QH 4ALPA 1I94Q 3DM3A 3S17H 2JA6G 1YEZA 4A3KG 4FDBA 4DR7L 1X54A 4LUOA 2MNAA 5J3BA 4LFAQ 2VQEL 4JI4L 3K0XA 4GN4B 4GN5A 4XIGS 5AJ3L 3I55A 3DLLA 3CCJA 1Z9FA 4DR3Q 1K0RA 4R1JA 3KYHC 3J80i 2AWNA 4A3EH 4UY8C 1XPOA 1HZBA 1XNQL 4JBKA 3J80c 1Y1WH 4DR5L 1N8RC 1DGSA 4JV5Q 1VQGA 1MJEA 1JJ2A 1L1OC 4OWTB 1GM5A 2Y0SE 4KHPQ 4DV1L 4JG2A 3F1ZA 3ZJYC 3CCQA 1EUJA 2HQLA 2AKWB 4JI8Q 1JJGA 3HOWG 1KRTA 5LMUL 2RF4A 4GOPA 2ZJPA 2HT1A 4JI6L 2Y0SG 4X66L 1K8GA 4MZ9A 3AQQA 4X62L 1FJGL 2QA4A 4YY3L 1X3GA 4DUYQ 2VZAA 1E24A 3U58A 1IL2A 1Q1EA 3GTMH 2KBNA 5GROA 3I4NG 4NXNL 2HIXA 4GS3A 4HJAA 1V1QA 2PI2A 1QVGA 4OXPA 4YHHL 3CF5A 2Q2TA 1M90C 1LM0A 2I5MX 2NVTH 1VQ7A 2YTVA 4H02A 3G6EA 3GD7A 1TWAH 2JQOA 4X65Q 1L1OA 1N34Q 3F8TA 1NBWA 4NB3A 2N3SA 4L5QA 5BR8Q 1WFQA 3S14H 1VQPA 1EIFA 2K5VA 1TXYA 2JA9A 4DR2L 4LNQA 3J7A5 4DR4Q 4PZ8A 5LMNL 1YJNA 4BY1H 3G4SA 3TREA 1IBML 2R7ZH 4A93G 4POFA 3Q8DA 5IYCG 1XJVA 2YU9H 4A3JG 2UUBQ 5EAYA 3GTGH 3PO3G 3KDFA 3AFQA 3FKIG 4LF7Q 4DK3C 2K75A 1Y1VG 1G51A 4IJLA 2PI2E 1GKHA 1E7ZA 2PQAA 1IBLL 2R7FA 4JI0L 2R92H 4J15A 2I5HA 1OTCA 2CWAA 5C0XJ 1MKHA 1VS0A 1YHAA 4ME3A 1Q82C 3L7ZC 3TS0A 3CXCA 4GNXC 4P71A 4OO1G 2NZOA 1VQ5A 3M4OH 4BBSH 2B63G 2NVXH 1YJ9A 1YNXA 4JI3Q 1PVOA 5C0XG 5IYDH 3EIVA 2UXDL 4HIMA 2VS1A 1NE3A 4DV4L 4A3LG 3CP0A 1Q46A 1R9TH 4LFCL 4B3RL 4YWKA 2KHJA 1WCMG 4O0AA 4R4IA 4A3DH 1N32Q 2Q2HA 2DGYA 4DV2L 2IX1A 2IT1A 3U4ZA 3GTKH 1I6HH 4JI5Q 3ER0A 4JI1L 4DAMA 1JB7A 3K81C 3BU2A 5ELNA 4GKJQ 1HJPA 1HZAA 1G6PA 3HOYG 2B3GA 5HY6A 1XMOQ 5C3EG 1VQAA 4LF9Q 1WJJA 1H95A 4JI7L 3HOZG 3T1HQ 1QUQA 3OYYA 2EQSA 1G291 4L5SA 2UXCQ 2XTIA 3E9IA 1Q86C 3CC4A 2V1CC 5C4JH 1NMFA 1XNQQ 1KIXA 5C44H 4A76A 2JEAI 1YI2A 5IWAQ 3RZDH 5IE8A 1OXSC 1L1OB 3ICEA 4LFBL 1HR0W 1QZHA 3H3VI 3G48A 3PUWA 1P8LA 3PUVA 4DV5L 3M3YH 4DR1Q 4Y52H 4KHZA 1CKOA 1VQFA 1FVIA 3JAMc 5GAHC 4DV6L 5LMUQ 1S3OA 4A3BG 1XNRL 1EIYB 1VQ6A 3RZOH 3K7UC 1AE3A 3PGZA 2HHHL 1WI5A 2VQFQ 3PO2H 4IFDI 2WB1E 4C2MH 1RIPA 4BBRH 1KRSA 4R4OA 4DV3Q 4IO9A 2JA5H 1VQ4A 3CC7A 2RCNA 3FP9A 4HIOA 2KCTA 3KDFB 3VDYA 4NXNQ 1NTGA 3B6YA 3I56A 1E3PA 2DUDA 5IP7H 2WB1G 4A3MH 2EIFA 2VUMG 2D0PA 2PQAB 2YYZA 3AYHB 2IY5B 2I5LX 3OTOL 2BA1A 4AYBE 1WYDA 1X56A 1YHQA 3I4MH 4TVAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 L;  2F4V Q;  1KHI A;  4BXX H;  2ALY B;  1XMQ Q;  4AYB G;  4WJ4 A;  3HOU H;  4X64 Q;  2OWO A;  4JI2 L;  3J7Z C;  1Q12 A;  1N33 Q;  1CKN B;  2EXD A;  4JCV E;  1KQS A;  4OWW B;  1NJI C;  1I5F A;  4B3M L;  4GKK L;  3U4V A;  4YCU A;  2K5H A;  2R6G A;  3S2D H;  1D7Q A;  3KOJ A;  5ELO A;  3RN5 A;  1M1K C;  3UDG A;  1X65 A;  2E2I H;  4R4Q A;  1N36 L;  2E2H H;  2A1A A;  2UXB L;  3M85 A;  1JMC A;  5M5X H;  1GVP A;  1Q1B A;  3KJO A;  4A3M G;  1PH6 A;  1HNZ Q;  4P74 A;  3HOX G;  3I4O A;  2IX0 A;  4JI0 Q;  5JJL A;  2F52 A;  1PA6 A;  2QGQ A;  3I2Z A;  4QJF A;  3KLW A;  3G71 A;  2CFM A;  2CQO A;  3MXN B;  3T1Y L;  1EQQ A;  2Z6K C;  2PMZ E;  3W5O A;  1VQC A;  2KHI A;  3RLN A;  3TQY A;  4BY7 H;  4DNI A;  1QUQ B;  4Y7N H;  3A5U A;  4DR6 Q;  4A3E G;  3NBH B;  3RNU A;  4UP9 A;  1S40 A;  2YV5 A;  4B3S L;  1Y1W G;  2Q2U A;  4DV7 L;  2K14 A;  2VL6 A;  2ZM6 L;  3A5Z B;  4AQY L;  4TQU S;  1VCI A;  4RG1 A;  4DV0 Q;  3KFU A;  4A3G H;  3PCO B;  3PSI A;  4AIM A;  1HNX L;  4OX9 Q;  2JK8 A;  2OCE A;  4DKA C;  2UUA L;  4JYA L;  2E8G A;  4HID A;  2N78 A;  3S1N H;  2GVB A;  3S2H H;  1CKM A;  3CAM A;  4QIW E;  1JT8 A;  5LMN W;  3TRZ A;  2A8V A;  2VY3 A;  4L5R C;  1V43 A;  2Z6K A;  1QVF A;  3S16 H;  1J5E Q;  4PMW A;  3CCE A;  1GO3 E;  1P16 A;  4B3T L;  3K8A A;  1A8V A;  2UUC L;  4JI7 Q;  5C4X H;  3KF6 A;  5M3F H;  5IYB H;  1HNW Q;  1I94 L;  3PUX A;  4QY7 A;  4PZ7 A;  3W1B A;  4LF8 L;  3CD6 A;  3FHW A;  2JA7 H;  5GAE C;  3CCU A;  3J81 j;  2RHS B;  4DUZ Q;  5M3M H;  4LFA L;  4LF4 Q;  1BBW A;  1K3R A;  4DR3 L;  1HR0 Q;  4POG A;  4OWX B;  1BVS A;  4LFB Q;  3SGI A;  2L15 A;  1XPR A;  4P75 A;  4DV6 Q;  4OO1 I;  1UE1 A;  5IY0 A;  3GDE A;  2QEX A;  2R93 H;  1CKN A;  4BY1 G;  1QVC A;  2OQ0 A;  4A3I H;  2H5X A;  4JV5 L;  1PH2 A;  2R7Z G;  5FJ8 H;  5K36 G;  4KHP L;  5C0X I;  1YVC A;  3A74 A;  4MNO A;  4JI8 L;  1IBK Q;  4QQB X;  4IPD A;  1UEB A;  3M7N A;  5JEA J;  1AH9 A;  1C7Y A;  1IZ6 A;  1E1T A;  3CMA A;  1CSP A;  3NEM A;  2CWP A;  1A0I A;  1L0W A;  3TS2 A;  1EQR A;  4A3F H;  1OXX K;  2MO1 A;  4DUY L;  1YIJ A;  2R92 G;  2ZTC A;  1KD1 C;  1K83 H;  1YHB A;  2K5N A;  4YWL A;  3RLO A;  1QZG A;  4HJ7 A;  1RL2 A;  5JEA G;  2GN5 A;  3S24 A;  4HJ5 A;  1PH7 A;  2ES2 A;  4GNX A;  1VQN A;  4DR7 Q;  2CKZ B;  1OXU A;  3PUY A;  2Z0S A;  1XTD A;  2VQE Q;  4JI4 Q;  4BBS G;  1EOV A;  3ULP A;  5AJ3 Q;  1SN8 A;  1UE7 A;  3M9B A;  5IYD G;  2JA8 H;  3H3V H;  2D0O A;  4X65 L;  4DR5 Q;  1N34 L;  1VQO A;  1TWF H;  3CCV A;  3OW2 A;  1SLJ A;  5BR8 L;  4HJ8 A;  1KC8 C;  1K8A C;  2UU9 L;  1X3F A;  1EYG A;  1A62 A;  4DV1 Q;  1S72 A;  3TEH B;  3GTP H;  3S15 H;  4DR4 L;  4A3D G;  1I3Q H;  2K4K A;  1NMG A;  3H0G H;  1U5K A;  4UP8 A;  3HOV H;  5JJK A;  4LUZ A;  4JI6 Q;  4X66 Q;  5E7N A;  1YJW A;  1Y14 B;  1HZ9 A;  2LSS A;  3F2B A;  2N8N A;  3RR5 A;  1O7I A;  4X62 Q;  1FJG Q;  4YY3 Q;  1FGU A;  2UUB L;  4IPG A;  3K7A H;  5GQO A;  2LXK A;  1B7Y B;  4PZ6 A;  1B8A A;  4LUV A;  4KLK A;  2AHO B;  4IJH A;  3KF6 B;  2NN6 I;  1Z47 A;  4LF5 L;  3HKZ E;  3NEL A;  4K0K L;  4YHH Q;  1CSQ A;  3A0J A;  3RLF A;  2VW9 A;  4A75 A;  2JA6 H;  1UE5 A;  3CC2 A;  5C44 G;  4EQ5 A;  3F2C A;  2MO0 A;  4A3K H;  1VQB A;  1C9O A;  1D8L A;  1PYS B;  3HKZ G;  5FLM H;  2NVQ H;  4A3B H;  2MQH A;  1SR3 A;  4JI3 L;  1UE6 A;  3W1G A;  3K80 C;  1VQE A;  2PNH A;  2D62 A;  2ATW A;  4DR2 Q;  4YCV A;  1PV4 A;  3S1R H;  4IPH A;  5LMN Q;  4GLX A;  3EBE A;  3CQZ H;  4WJ3 M;  3NEN A;  3CCM A;  3D0F A;  3CPF A;  1IBM Q;  3PO2 G;  3U50 C;  4L5T A;  1PH8 A;  2BA0 A;  3D31 A;  5M5W H;  4BBR G;  4UP7 A;  1VQD A;  3BZC A;  2JA5 G;  4A3C G;  2ZJR A;  1Q7Y C;  1T9H A;  4JI5 L;  4GOP C;  3HOW H;  1IYJ B;  1AE2 A;  2JE6 I;  3AEV A;  5IP7 G;  4GKJ L;  3GTO H;  2HIV A;  4LF8 Q;  1IBL Q;  4HJ9 A;  4EX5 A;  1PH4 A;  3KF8 B;  1X9N A;  1XMO L;  3ULJ A;  4LF9 L;  3I4M G;  1N9W A;  5FLM G;  3I4N H;  3CCR A;  4GNX B;  4BXX G;  2E5L L;  3T1H L;  3STB C;  2B29 A;  1YBY A;  2OTL A;  3HOU G;  2WFW A;  2UXC L;  5IT9 c;  3GTJ H;  4YCW A;  1J6Q A;  5IWA L;  1UWV A;  2F3I A;  4DK6 C;  4NPS A;  3PF4 A;  1VQK A;  4HIK A;  2WP8 J;  2UXD Q;  1KL9 A;  3HKS A;  3HFZ B;  4XTC S;  1PH9 A;  4DR1 L;  3IRB A;  4DV4 Q;  4LWC A;  4LFC Q;  4B3R Q;  1JJC B;  3F2D A;  1X6O A;  4DV2 Q;  2K52 A;  4QL5 A;  1VQM A;  2MFI A;  3I7F A;  4JI1 Q;  4A93 H;  2VQF L;  4X6A H;  1E22 A;  2ZTE A;  1PFS A;  4DV3 L;  3CCL A;  1C0A A;  1X55 A;  5IYC H;  3PO3 H;  5HGQ A;  4QGU A;  1LUZ A;  1JE5 A;  3J81 i;  4AH6 A;  4A3J H;  3FKI H;  4JOI C;  5M5Y H;  1SRU A;  2R7D A;  4JBW A;  1Y1V H;  4BY7 G;  1TWG H;  3KJP A;  4NXM L;  3L0O A;  3J81 c;  3CPW A;  5H1S E;  1NY4 A;  2JJQ A;  2AMC B;  1ASY A;  4X64 L;  4JBJ A;  1U0L A;  1Q8K A;  4A4I A;  2Q2I A;  3S1M H;  2F4V L;  1BKB A;  3UDF A;  4C3I H;  2K50 A;  1Q81 C;  2JEB I;  3UE1 A;  1XMQ L;  3WWV A;  5IP9 H;  4A3G G;  3GTL H;  4RMF A;  2UU9 Q;  1OXV A;  3AFP A;  4DV5 Q;  1N33 L;  2E2J H;  4IOA A;  5JJI A;  2XGT A;  1XNR Q;  4APV A;  3E9H A;  1TWH H;  3M4P A;  2HHH Q;  2IHF A;  4IPC A;  2BH2 A;  4A3L H;  3CCS A;  2ID0 A;  2A19 A;  2VNU D;  1WCM H;  4O2D A;  3ERS X;  5GAG C;  1I50 H;  2LXJ A;  4JOI A;  3UDI A;  2YTY A;  2WAQ E;  4LW1 A;  4GLA C;  1HNZ L;  5DLQ E;  2BH8 A;  4LF5 Q;  5M3F G;  5C4X G;  5IYB G;  4K0K Q;  3HOY H;  2C35 B;  1WOC A;  5FLX c;  2I0Q A;  3BZK A;  2JA7 G;  1W3S A;  3OTO Q;  4UPA A;  2WAQ G;  5C3E H;  1GD7 A;  2ASB A;  1KAW A;  1YZ6 A;  1PH1 A;  5M3M G;  5IP9 G;  1PYB A;  3PF5 A;  3HOZ H;  2OQK A;  1HZC A;  4DR6 L;  1BBU A;  2OTJ A;  4JI2 Q;  1XPU A;  3ULL A;  2KCM A;  2YTX A;  1KXL A;  1VQI A;  1FL0 A;  1VQH A;  3JC6 6;  3UE0 A;  4P73 A;  4IOC A;  4A3I G;  2R93 G;  4B3M Q;  5GAD C;  3L2P A;  4DV0 L;  4GKK Q;  4GN3 B;  1HH2 P;  5FJ8 G;  3M4Q A;  4OX9 L;  4DPG A;  2CCZ A;  4A3C H;  1PHJ A;  4GOP B;  4MTN A;  4DAY B;  1SE8 A;  1K73 C;  2NVY H;  3MEF A;  2FXQ A;  3PV0 A;  4R4C A;  3PIP A;  1N36 Q;  3BJU A;  1OXT A;  4JC0 A;  1VQ8 A;  2UXB Q;  1W2B A;  1SRO A;  3LGJ A;  1PH5 A;  4A3F G;  3EN2 A;  1J5E L;  1VQJ A;  3T1Y Q;  2B63 H;  1IXR A;  2E5L Q;  3E0E A;  1LTL A;  4LF6 Q;  4LF7 L;  4R4T A;  2GVA A;  1HNW L;  1MIU A;  4P72 A;  2VUM H;  4OON A;  3STB D;  1LYL A;  2JA8 G;  4IFD J;  1MJC A;  1L2F A;  1EFW A;  4DUZ L;  4PG3 A;  4YWM A;  4B3S Q;  4LF4 L;  4DV7 Q;  1HR0 L;  3JAM i;  2RHQ B;  1VQ9 A;  2ZM6 Q;  4AQY Q;  1CUK A;  4BA2 I;  1A63 A;  3CME A;  1E1O A;  4JBM A;  2NZH A;  1PH3 A;  1HNX Q;  4IFD G;  1B70 B;  4C3J H;  1TWC H;  1X3E A;  2UUA Q;  2ZJQ A;  2ZTD A;  4JYA Q;  1SMX A;  3GO5 A;  1YIT A;  1EWI A;  3PUZ A;  1K9M C;  3H0G G;  1SFO H;  3GTQ H;  3HOV G;  2AWO A;  2NN6 G;  3UDX A;  1ASZ A;  4GLV B;  3H15 A;  4BA1 I;  4KI0 A;  3RN2 A;  1IBK L;  1V9P A;  1N32 L;  3CW2 C;  2IHE A;  4B3T Q;  2UUC Q;  4C3H H;  4NXM Q;  2N49 A;  2KEN A;  3PIO A;  3HOX H;  1VQL A;  3S1Q H;  4ALP A;  1I94 Q;  3DM3 A;  3S17 H;  2JA6 G;  1YEZ A;  4A3K G;  4FDB A;  4DR7 L;  1X54 A;  4LUO A;  2MNA A;  5J3B A;  4LFA Q;  2VQE L;  4JI4 L;  3K0X A;  4GN4 B;  4GN5 A;  4XIG S;  5AJ3 L;  3I55 A;  3DLL A;  3CCJ A;  1Z9F A;  4DR3 Q;  1K0R A;  4R1J A;  3KYH C;  3J80 i;  2AWN A;  4A3E H;  4UY8 C;  1XPO A;  1HZB A;  1XNQ L;  4JBK A;  3J80 c;  1Y1W H;  4DR5 L;  1N8R C;  1DGS A;  4JV5 Q;  1VQG A;  1MJE A;  1JJ2 A;  1L1O C;  4OWT B;  1GM5 A;  2Y0S E;  4KHP Q;  4DV1 L;  4JG2 A;  3F1Z A;  3ZJY C;  3CCQ A;  1EUJ A;  2HQL A;  2AKW B;  4JI8 Q;  1JJG A;  3HOW G;  1KRT A;  5LMU L;  2RF4 A;  4GOP A;  2ZJP A;  2HT1 A;  4JI6 L;  2Y0S G;  4X66 L;  1K8G A;  4MZ9 A;  3AQQ A;  4X62 L;  1FJG L;  2QA4 A;  4YY3 L;  1X3G A;  4DUY Q;  2VZA A;  1E24 A;  3U58 A;  1IL2 A;  1Q1E A;  3GTM H;  2KBN A;  5GRO A;  3I4N G;  4NXN L;  2HIX A;  4GS3 A;  4HJA A;  1V1Q A;  2PI2 A;  1QVG A;  4OXP A;  4YHH L;  3CF5 A;  2Q2T A;  1M90 C;  1LM0 A;  2I5M X;  2NVT H;  1VQ7 A;  2YTV A;  4H02 A;  3G6E A;  3GD7 A;  1TWA H;  2JQO A;  4X65 Q;  1L1O A;  1N34 Q;  3F8T A;  1NBW A;  4NB3 A;  2N3S A;  4L5Q A;  5BR8 Q;  1WFQ A;  3S14 H;  1VQP A;  1EIF A;  2K5V A;  1TXY A;  2JA9 A;  4DR2 L;  4LNQ A;  3J7A 5;  4DR4 Q;  4PZ8 A;  5LMN L;  1YJN A;  4BY1 H;  3G4S A;  3TRE A;  1IBM L;  2R7Z H;  4A93 G;  4POF A;  3Q8D A;  5IYC G;  1XJV A;  2YU9 H;  4A3J G;  2UUB Q;  5EAY A;  3GTG H;  3PO3 G;  3KDF A;  3AFQ A;  3FKI G;  4LF7 Q;  4DK3 C;  2K75 A;  1Y1V G;  1G51 A;  4IJL A;  2PI2 E;  1GKH A;  1E7Z A;  2PQA A;  1IBL L;  2R7F A;  4JI0 L;  2R92 H;  4J15 A;  2I5H A;  1OTC A;  2CWA A;  5C0X J;  1MKH A;  1VS0 A;  1YHA A;  4ME3 A;  1Q82 C;  3L7Z C;  3TS0 A;  3CXC A;  4GNX C;  4P71 A;  4OO1 G;  2NZO A;  1VQ5 A;  3M4O H;  4BBS H;  2B63 G;  2NVX H;  1YJ9 A;  1YNX A;  4JI3 Q;  1PVO A;  5C0X G;  5IYD H;  3EIV A;  2UXD L;  4HIM A;  2VS1 A;  1NE3 A;  4DV4 L;  4A3L G;  3CP0 A;  1Q46 A;  1R9T H;  4LFC L;  4B3R L;  4YWK A;  2KHJ A;  1WCM G;  4O0A A;  4R4I A;  4A3D H;  1N32 Q;  2Q2H A;  2DGY A;  4DV2 L;  2IX1 A;  2IT1 A;  3U4Z A;  3GTK H;  1I6H H;  4JI5 Q;  3ER0 A;  4JI1 L;  4DAM A;  1JB7 A;  3K81 C;  3BU2 A;  5ELN A;  4GKJ Q;  1HJP A;  1HZA A;  1G6P A;  3HOY G;  2B3G A;  5HY6 A;  1XMO Q;  5C3E G;  1VQA A;  4LF9 Q;  1WJJ A;  1H95 A;  4JI7 L;  3HOZ G;  3T1H Q;  1QUQ A;  3OYY A;  2EQS A;  1G29 1;  4L5S A;  2UXC Q;  2XTI A;  3E9I A;  1Q86 C;  3CC4 A;  2V1C C;  5C4J H;  1NMF A;  1XNQ Q;  1KIX A;  5C44 H;  4A76 A;  2JEA I;  1YI2 A;  5IWA Q;  3RZD H;  5IE8 A;  1OXS C;  1L1O B;  3ICE A;  4LFB L;  1HR0 W;  1QZH A;  3H3V I;  3G48 A;  3PUW A;  1P8L A;  3PUV A;  4DV5 L;  3M3Y H;  4DR1 Q;  4Y52 H;  4KHZ A;  1CKO A;  1VQF A;  1FVI A;  3JAM c;  5GAH C;  4DV6 L;  5LMU Q;  1S3O A;  4A3B G;  1XNR L;  1EIY B;  1VQ6 A;  3RZO H;  3K7U C;  1AE3 A;  3PGZ A;  2HHH L;  1WI5 A;  2VQF Q;  3PO2 H;  4IFD I;  2WB1 E;  4C2M H;  1RIP A;  4BBR H;  1KRS A;  4R4O A;  4DV3 Q;  4IO9 A;  2JA5 H;  1VQ4 A;  3CC7 A;  2RCN A;  3FP9 A;  4HIO A;  2KCT A;  3KDF B;  3VDY A;  4NXN Q;  1NTG A;  3B6Y A;  3I56 A;  1E3P A;  2DUD A;  5IP7 H;  2WB1 G;  4A3M H;  2EIF A;  2VUM G;  2D0P A;  2PQA B;  2YYZ A;  3AYH B;  2IY5 B;  2I5L X;  3OTO L;  2BA1 A;  4AYB E;  1WYD A;  1X56 A;  1YHQ A;  3I4M H;  4TVA B; 
#chains in the Genus database with same CATH topology
 2F4V Q;  2ZXR A;  4AYB G;  4WJ4 A;  1HFG A;  1Q12 A;  4PNY A;  5DM7 3;  2EXD A;  4JCV E;  1G6Z A;  1NJI C;  4GKK L;  2K5H A;  3KOJ A;  1Q8I A;  1LTI D;  3UDG A;  1X65 A;  1EYC A;  1N36 L;  1BNZ A;  1LTG D;  2UXB L;  1JMC A;  3KJO A;  1GVP A;  4HSP A;  3H6M A;  2B2W C;  2QGQ A;  1U4M A;  3I2Z A;  2HQE A;  5CMD A;  3KLW A;  3MXN B;  5C4J B;  1EQQ A;  2Z6K C;  4K5X A;  2F0E A;  1NSN S;  5J22 A;  1QUQ B;  1Q90 A;  2CHB D;  4UP9 A;  1Y1W G;  3A5Z B;  4QF4 A;  1VCI A;  4A3G H;  1H9J A;  4K2K A;  4L8J A;  4AIM A;  4OX9 Q;  4IZ8 A;  4FF4 A;  2L4N A;  1ZKO A;  4HID A;  1WTQ A;  2JA5 B;  3S2H H;  1KLU D;  1DOK A;  1JT8 A;  4IUU A;  5LMN W;  4OEM B;  4A3M B;  2GA4 B;  2B2Y C;  4G4K A;  4NW2 A;  4QUF A;  5A35 A;  1F9S A;  5C5M A;  4B3T L;  2UUC L;  1A2U A;  5C4X H;  2ZXP A;  3HEJ A;  1PRT C;  5IYB H;  4PZ7 A;  4ILW A;  3FHW A;  2JA7 H;  5GAE C;  3DXJ C;  3H3V C;  2RHS B;  4DUZ Q;  3I91 A;  1BBW A;  1BVS A;  1SJH D;  4OHJ A;  4DV6 Q;  4NKL A;  3D4D A;  3SHL A;  1JC7 A;  4A3I H;  2R93 H;  2H5X A;  2F0L A;  3CRL C;  1JOO A;  2FMC A;  4MNO A;  4JI8 L;  4IPD A;  1IBK Q;  1UEB A;  3NTI A;  5LL6 X;  3QR8 A;  1AH9 A;  1C7Y A;  1CSP A;  4QMG A;  1L0W A;  2EYF A;  4V0B A;  1OXX K;  1KTK A;  1K28 A;  4LF6 Q;  4K14 A;  3S24 A;  4HJ5 A;  1VQN A;  3PUY A;  4MTK A;  1VDZ A;  1EOV A;  3M7G A;  1PFM A;  3CU7 A;  2PW7 A;  3S1N B;  2B2V C;  2IJ0 A;  4X65 L;  4DR5 Q;  5IT9 L;  1TWF H;  1SLJ A;  1UEA B;  1CA6 A;  2UU9 L;  1X3F A;  4KKS A;  1A62 A;  4IFD H;  2AUK A;  3TEH B;  3L3O C;  3S16 B;  4CJ1 B;  4A3D G;  2K4K A;  3ZYY X;  1NMG A;  2B2U C;  5JJK A;  4IUQ A;  4F7X A;  2EE1 A;  4X66 Q;  4FF3 A;  5E7N A;  1Y14 B;  4X62 Q;  1E2V A;  1O7I A;  4RGM A;  3BVM A;  4IN3 A;  1YNJ C;  1Z47 A;  4K0K L;  1SJE D;  2AQ2 B;  3CC2 A;  2F4I A;  1C9O A;  3J81 L;  1D8L A;  3OWE B;  3SEB A;  2MQH A;  1VMC A;  3FEW X;  2EJG C;  1PV4 A;  3EBE A;  3K57 A;  3NEN A;  3CCM A;  3D0F A;  3CPF A;  1IBM Q;  3NQT A;  4L5T A;  3U50 C;  3D31 A;  4BBR G;  1VQD A;  1M8A A;  2EYM A;  1AE2 A;  3SR1 A;  4GKJ L;  5I6W A;  4HJ9 A;  1IKL A;  2KOL A;  2JA8 B;  3ULJ A;  3I4M G;  5HUR A;  4RA8 A;  5FLM G;  5BN4 A;  4BXX G;  4OIK A;  3MFY A;  3HOU G;  2WFW A;  4LK1 C;  3TP7 A;  3GTP B;  1J6Q A;  2HDM A;  3A54 A;  2EYJ A;  2CH4 W;  1O80 A;  2UXD Q;  5EJW A;  2DN8 A;  4ZK9 B;  3VYT A;  1NUC A;  3IRB A;  4DV4 Q;  2L5T A;  4LFC Q;  3VA5 A;  4FNF A;  1X6O A;  3K7A B;  5EBD A;  1VQM A;  1PDQ A;  2MFI A;  1CZW A;  2FJ2 A;  4A93 H;  1HCZ A;  3KUP A;  3A7A B;  2L12 A;  2BDN A;  1X55 A;  3PO3 H;  5TSS A;  3C1E A;  3OSO A;  4RGT A;  4JBW A;  4DN4 M;  4BY7 G;  4NXM L;  3WDN A;  3D6W A;  4A3B B;  3IKJ A;  2F0I A;  3S1M H;  2L55 A;  2F4V L;  3D4W A;  2K50 A;  3P7J A;  3QO2 A;  4RMF A;  1OXV A;  4IUV A;  4DV5 Q;  5M5W B;  2E2J H;  2LMC B;  2F0J A;  4KY5 A;  4APV A;  2PW5 A;  3E9H A;  1LTA D;  4IPC A;  4N8F A;  1Y8N B;  4KTA A;  5GAG C;  1D5X C;  4XYO A;  3HOY H;  1F2Y A;  5FLX c;  1WOC A;  2F0K A;  3TN2 A;  2I0Q A;  3RD4 A;  3BZK A;  1W3S A;  2Z6B A;  5KNB A;  4UPA A;  4C3I G;  3GTJ B;  1S5D D;  3BDL A;  1GD7 A;  4XYQ A;  1KAW A;  1YZ6 A;  5M3M G;  5IP9 G;  4KY7 A;  5CC4 A;  4ZYS A;  3HOZ H;  3C1F A;  1CTM A;  1LTS D;  2K6A A;  3TME A;  5IOC A;  1B53 A;  3HRZ C;  2KCM A;  4YIJ A;  3TSS A;  1VQI A;  1FL0 A;  1VQH A;  2XVS A;  5A2Q L;  4IOC A;  1FR3 A;  4GN3 B;  1HH2 P;  5FJ8 G;  4OX9 L;  4XQJ A;  4GOP B;  3IFD A;  1K73 C;  1D2B A;  2EJM A;  5M5Y B;  1W2B A;  1Y1V B;  4MHE A;  5I4D A;  2NN6 H;  1FNV A;  1VQJ A;  4EQN A;  2E5L Q;  5CYU A;  1LTL A;  1R4Q B;  1Z6H A;  2AUJ D;  1RD9 D;  3VR3 A;  4DUZ L;  2IWH A;  2RHQ B;  4R8N A;  3JAM i;  4AQY Q;  1VQ9 A;  4BA2 I;  3V96 A;  1TWH B;  5EKI A;  2NZH A;  1PH3 A;  1X3E A;  1WCM B;  2ZJQ A;  4JYA Q;  3GO5 A;  2XWB B;  1K9M C;  3C2P A;  1WD0 A;  3H0G G;  4XDX A;  1SSO A;  4B08 A;  3HOV G;  2K03 A;  3FPU B;  1AW7 A;  3UDX A;  3R2I A;  4CDE C;  1IBK L;  2O4X A;  2RDH A;  2IHE A;  1VF5 C;  3K58 A;  3Q24 A;  3SK5 A;  4XXE A;  1VQL A;  1RJT A;  3S1Q H;  4ALP A;  3FVQ A;  2JA6 G;  1C4Q A;  4FDB A;  1X32 A;  1T5X D;  3TDQ A;  1EY0 A;  5G3L D;  2OTL A;  3LX0 A;  4XIG S;  1QVG A;  3I55 A;  3MTS A;  2KEE A;  3J80 i;  2PZU A;  3T56 B;  1XPO A;  4JBK A;  3J80 c;  1Y1W H;  4DR5 L;  1CK1 A;  4JV5 Q;  1VQG A;  2E74 C;  1WTO A;  2Y0S E;  4KHP Q;  1JJG A;  3I3C A;  1C8C A;  2Y0S G;  2IW3 A;  3OWF A;  3OMC A;  4X66 L;  4X62 L;  1X3G A;  3OMG A;  4DUY Q;  4CKE A;  1WTW A;  4ABN A;  5GRO A;  1EL0 A;  2ENB A;  4NXN L;  4HJA A;  4FYD A;  2A74 C;  3NK9 A;  1F2Z A;  3CF5 A;  1JCK B;  2Q2T A;  4H02 A;  3G6E A;  2XRQ D;  3GD7 A;  5JVH 3;  1L1O A;  2G5D A;  1VQP A;  1GJX A;  4CKC A;  4DR4 Q;  3G4S A;  1TII D;  1IBM L;  1BCP B;  4C3H B;  3HOX B;  3JAM L;  3PIO 3;  3S17 B;  4A3J G;  3I4N B;  2PI2 E;  5FOB B;  3VR6 A;  1L0Y B;  2R7F A;  2LKV A;  4DK1 A;  4J15 A;  1OTC A;  3DM1 A;  1D5Z C;  2PMZ B;  1MKH A;  1VS0 A;  1YHA A;  1Q82 C;  1PLF A;  3TS0 A;  3CXC A;  2NZO A;  3MXG A;  1PTO H;  2NVX H;  1YJ9 A;  4JI3 Q;  2C9O A;  3EIV A;  2UXD L;  1STA A;  3EA6 A;  2Q8R E;  4DV4 L;  1JWS D;  3CP0 A;  4B9X A;  1R9T H;  4LFC L;  3GTM B;  4A3D H;  3J80 L;  1N32 Q;  2D2C C;  4JI5 Q;  5G3L F;  1SNM A;  4DAM A;  3QB3 A;  5ELN A;  1HJP A;  4DAP A;  3I73 A;  1XXG A;  5C5L A;  1DON A;  5E3F A;  4LMQ D;  1XMO Q;  5C3E G;  2NVT B;  4LF9 Q;  1XWE A;  2JSO A;  4JI7 L;  3EJI A;  3NE5 B;  4H44 C;  3RUZ A;  2EYP A;  2UXC Q;  3OW7 A;  1NMF A;  1G8Z D;  5D3D A;  1SEB D;  3RZD H;  1L1O B;  2R7Z B;  1HR0 W;  1PFB A;  1A3T A;  4DV5 L;  3QJY A;  2YU9 B;  5LMU Q;  1EWH A;  2K1B A;  1HQM C;  1STH A;  3P75 A;  1EIY B;  3RZO H;  4IUP A;  3DWQ A;  2VQF Q;  4IFD I;  2WB1 E;  4BBR H;  2R92 B;  1KRS A;  4XT1 B;  3CC7 A;  1E3P A;  2WB1 G;  3M4O B;  2EIF A;  1I4X A;  3AYH B;  2I5L X;  2IX3 A;  4X64 Q;  3I4M H;  4BXX H;  2ALY B;  1XMQ Q;  2K04 A;  5CV6 A;  3HOU H;  2OWO A;  4K6D A;  4C3J G;  3I90 A;  1N33 Q;  5KNC A;  1KQS A;  3GTK B;  3K5N A;  3U4V A;  2PPB C;  1K3B C;  3S2D H;  1D5M C;  5E4X A;  5FKA C;  1D7Q A;  5ELO A;  1M1K C;  1RF2 D;  2EZV A;  2E2H H;  4V19 0;  5M5X H;  4A3M G;  1Q1B A;  1RDP D;  1CA5 A;  5EQ0 A;  3I4O A;  2IX0 A;  1PRT D;  4JI0 Q;  5JJL A;  2F52 A;  1WTP A;  2CQO A;  4Q0F A;  3W5O A;  2JYO A;  2L9H A;  3HKZ B;  1VQC A;  3K5O A;  4BY7 H;  4DNI A;  3VR2 A;  4EQO A;  3M3Y B;  1AFP A;  2QCP X;  2K14 A;  2VL6 A;  1GUW A;  4EGV A;  4AQY L;  2CQA A;  2KHS A;  4DV0 Q;  5JPN C;  5CV4 A;  4DKA C;  4C2M B;  4JYA L;  2E8G A;  2GVB A;  4CDD C;  1IYV A;  1CKM A;  2PO4 A;  3CAM A;  1TQO A;  4KY6 A;  3DHQ A;  1KNE A;  4L5R C;  2A68 C;  5K36 H;  1V43 A;  4PMW A;  2K28 A;  1PYW D;  1P16 A;  1HNW Q;  3PUX A;  4QY7 A;  3W1B A;  4LF8 L;  3CD6 A;  3J81 j;  3DMU A;  1WD1 A;  2EYL A;  4L6T B;  1EFI D;  5M3M H;  2K5Q A;  2ZT9 C;  4LF4 Q;  1K3R A;  4LFB Q;  2RQX A;  3D6C A;  1UE1 A;  5IY0 A;  4MIU A;  2QEX A;  4BY1 G;  1QVC A;  2NUC A;  5IGF A;  4JV5 L;  4DNT B;  4JPB W;  5FJ8 H;  5LL6 S;  4KHP L;  1ZYR C;  1LT4 D;  5J1Z A;  3A74 A;  4QQB X;  5JEA J;  1IZ6 A;  3TS2 A;  3CMA A;  3NEM A;  3NBI A;  1YNJ D;  4RWS C;  1EQR A;  4HMI A;  2MO1 A;  4DUY L;  3KF8 A;  4YWL A;  4HJ7 A;  1RL2 A;  5JEA G;  2ES2 A;  4GNX A;  2CKZ B;  4UDU C;  4C56 C;  5EPJ A;  1SN8 A;  3H3V H;  2F03 A;  2EPB A;  3WOF A;  3Q6S A;  3S2H B;  2J0T D;  4LAA A;  3A8K E;  2IL8 A;  1VQO A;  2P5Z X;  1SYC A;  1PRT F;  3OW2 A;  4HJ8 A;  1UUP A;  1EYG A;  4DV1 Q;  2RA4 A;  1S72 A;  3S15 H;  2Z4H A;  2F3W A;  4DR4 L;  4QCL A;  3H0G H;  1U5K A;  4UP8 A;  5C4X B;  1TU2 B;  3HOV H;  5C6A A;  4JI6 Q;  3F2B A;  3RR5 A;  1FJG Q;  2JA7 B;  1CI3 M;  2E75 C;  1FGU A;  4R8I A;  4PZ6 A;  1SMY C;  2BCO A;  2XIW A;  4KLK A;  2AHO B;  2NN6 I;  3TP5 A;  1LAB A;  4P2C B;  4YHH Q;  1UAP A;  2HCI A;  3RLF A;  2JA6 H;  1UE5 A;  5C44 G;  2MO0 A;  2R93 B;  2K7V A;  4A3I B;  5IOD A;  2NVQ H;  3K0Y A;  4JI3 L;  4G7H C;  3W1G A;  3K80 C;  2PNH A;  3D8G A;  3K5M A;  4PMC A;  4YCV A;  5LMN Q;  5CV8 A;  4GLX A;  3CQZ H;  4WJ3 M;  3GQB A;  4RHS A;  1GHJ A;  1F2L A;  1PH8 A;  1S5E D;  2BA0 A;  3I8Z A;  1EY9 A;  2Z1C A;  4A3C G;  1A6X A;  2ZJR A;  1Q7Y C;  4JI5 L;  1HXY D;  3EFX D;  1S5B D;  3AEV A;  1MGS A;  1V8Q A;  5CV5 A;  3KF8 B;  1X9N A;  1XMO L;  2OEO A;  4LF9 L;  4GNX B;  3P20 A;  3STB C;  1TWF B;  2B29 A;  2UXC L;  4RCN A;  5IT9 c;  3X3M A;  1AP0 A;  4RCO A;  4YCW A;  2F3I A;  2F0V A;  4DK6 C;  1VQK A;  4DA2 A;  1KL9 A;  1LT3 D;  2RCF A;  4JW0 A;  4LWC A;  1E2W A;  3PO2 B;  5LHY 1;  3OPO A;  1CT1 D;  4DV2 Q;  4K8I A;  1LO5 D;  1B3A A;  1J9O A;  3DUZ A;  2G9H D;  3I7F A;  4CKB A;  4JI1 Q;  3SXH A;  2VQF L;  4X6A H;  4FXD A;  1E22 A;  4A3J H;  1JE5 A;  3HS0 C;  4AH6 A;  3J81 i;  4JOI C;  5T1G A;  2R7D A;  3L0O A;  3SK6 A;  3J81 c;  1ASY A;  1CHQ D;  4KK7 A;  4X64 L;  4JBJ A;  1IKM A;  1LAC A;  3UDF A;  1Q81 C;  1XMQ L;  2NTT A;  3E0J A;  5D3I B;  1F9R A;  1QNK A;  3AFP A;  4ULL A;  1N33 L;  3T16 A;  3KLS A;  1SDF A;  4K2L A;  1PZI D;  4IOA A;  5JJI A;  1SE3 A;  4DGZ A;  3M4P A;  2HHH Q;  2IHF A;  4RKB A;  2Z4I A;  1JR0 D;  4MN3 A;  3R3O A;  3T13 A;  4O2D A;  2F0P A;  3ERS X;  4ZUJ A;  3VYS A;  3E6Z X;  4LF5 Q;  5M3F G;  2MHV A;  2C35 B;  1ENF A;  2HD3 A;  2B2T A;  2OF1 A;  5C3E H;  2OT2 A;  3OOC A;  3PQI A;  5FO7 B;  5IGD A;  1F9Q A;  1L0X B;  3HZX A;  3ULL A;  3P1H A;  2YTX A;  1KXL A;  1STN A;  1K8O A;  3L2P A;  4DV0 L;  4A93 B;  3M4Q A;  4DPG A;  2CCZ A;  3AU7 A;  3VA7 A;  4N8X 1;  4MTN A;  1PFN A;  4E6I A;  2FXQ A;  1TY2 A;  2CW0 D;  2WIN B;  2R61 A;  1PH5 A;  1SYG A;  4A3F G;  3NP8 A;  1I4G A;  3NHH A;  3S1M B;  1TT2 A;  2RBM A;  3T1Y Q;  1IXR A;  5ELD A;  4LF7 L;  1MBY A;  1QG7 A;  2GVA A;  1HNW L;  1MIU A;  4HAE A;  4PQX A;  3KBX A;  5FLX E;  1FGB D;  2EY6 A;  1KLG D;  5IGG A;  1L2F A;  1Z7T A;  4LF4 L;  4DV7 Q;  4XQN A;  1CUK A;  1IYU A;  1A63 A;  1E1O A;  3MWY W;  1HNX Q;  1B70 B;  4C3J H;  1TWC H;  5CGK A;  1EWI A;  2G9D A;  1W6K A;  3HOY B;  4BA1 I;  4KI0 A;  1O7Y A;  1DXM A;  4ZKC B;  5E4W C;  4QUC A;  3TP8 A;  3PIO A;  3HOZ B;  2QF7 A;  4CBV A;  2OXP A;  1YEZ A;  4HMJ A;  4DF7 A;  4A3K G;  3HP3 A;  2MNA A;  1SNQ A;  4GN5 A;  4DR3 Q;  3CCJ A;  1Z9F A;  1K0R A;  1LLR D;  3KK7 A;  3KYH C;  5I6Y A;  4UY8 C;  1S4Z A;  2RKS A;  5HGT A;  2FFK B;  3ERO A;  2KCC A;  1DGS A;  1I3Q B;  4FXG C;  1WTR A;  2KCN A;  1MJE A;  1JJ2 A;  1GM5 A;  1EEF D;  4DV1 L;  4JG2 A;  1EUJ A;  4RGO S;  3KBG A;  4C3H G;  4GOP A;  2X6L A;  3HOW G;  4H0L C;  4JI6 L;  1TS3 A;  3FRP B;  3AQQ A;  1FJG L;  1Q1E A;  1JWM D;  3I4N G;  4RAU C;  3A55 A;  2AQ1 B;  2SEB D;  4AYB B;  1QJO A;  2CVR A;  4OXP A;  5COY A;  4YHH L;  3NPP A;  2K5D A;  4ZAI A;  2IPK D;  3F8T A;  4L5Q A;  2VXW A;  3S14 H;  4DU9 A;  1STB A;  3J7A 5;  5LMN L;  4BY1 H;  1VMP A;  1QB5 D;  1IW7 C;  5L37 A;  1PXU A;  3S1Q B;  2LY7 A;  1HA5 A;  1D6E C;  4POF A;  1AZP A;  4BWG B;  1DYQ A;  4NDX A;  3KDF A;  3AFQ A;  5D65 A;  4IJL A;  3URY A;  4DK3 C;  1GKH A;  1E7Z A;  4ID6 A;  3H91 A;  1FNW A;  1SYB A;  4IAL A;  4FF1 A;  5C0X J;  1SNP A;  4OO1 G;  5M9O A;  1Y1W B;  4GNX C;  1I4P A;  3SDZ A;  1YNX A;  2EYO A;  5ELC A;  5C0X G;  1RKN A;  4F8M A;  3S9W A;  5JJZ A;  1ROD A;  3LWU A;  1Q3L A;  1HUM A;  4A3L G;  4EQP A;  2NB0 A;  2F0Q A;  2KHJ A;  4O0A A;  1JOQ A;  2Q2H A;  4DV2 L;  3QG1 A;  2IX1 A;  1I6H H;  2KA7 A;  4JI1 L;  1HZA A;  3FKI B;  3AMU A;  3Q22 A;  1LT5 D;  2B3G A;  3GV6 A;  2Q8T A;  4S3S A;  1WJJ A;  1H95 A;  5DAU A;  4I65 A;  4ODG A;  3T1H Q;  3H09 A;  2EQS A;  3TBI B;  1I4Q A;  2M00 A;  3CC4 A;  1DD2 A;  3DEO A;  1XNQ Q;  5C44 H;  2JEA I;  1BO0 A;  1YI2 A;  2A6H C;  4FO2 A;  5IE8 A;  1OXS C;  2CH4 A;  3TP6 A;  2QW7 A;  1QZH A;  3H3V I;  1P8L A;  2NBF A;  4XT3 B;  3NTH A;  1VQF A;  3JAM c;  4DV6 L;  5CR3 A;  1B9N A;  4B9W A;  1EY5 A;  1JB3 A;  4X3K A;  1O7Z A;  2F0F A;  3PGZ A;  2J7Z A;  4TKO B;  4ZUI A;  2HHH L;  3R93 A;  4DV3 Q;  4A3C H;  1E0B A;  1OO9 B;  2RCN A;  3Q0A A;  5KRU A;  2KCT A;  3KDF B;  3I56 A;  2DUD A;  4ME5 A;  1CZG A;  1PTO B;  2BA1 A;  4FVM A;  2NVX B;  2WV6 D;  1WYD A;  4R4Q A;  1YHQ A;  4LF6 L;  1PTO D;  1BR9 A;  1D1I A;  2QKI C;  5IIF A;  3O13 A;  4DXF A;  5BN5 A;  1O7L A;  1R9T B;  4PV1 C;  1CKN B;  2RSN A;  4A3D B;  1JIC A;  5C4H A;  1I5F A;  4YCU A;  2PCF B;  4N9T A;  3RN5 A;  2A68 D;  3K6O A;  2E2I H;  2PZT A;  2A1A A;  1DOM A;  3OIP A;  3A56 A;  1PH6 A;  2B63 B;  1HNZ Q;  1X3Q A;  2VUM B;  3SK8 A;  3G71 A;  3T1Y L;  1FYC A;  1M4V A;  3DEP A;  3RZD B;  3RLN A;  2KHI A;  4Y7N H;  3A5U A;  2F0T A;  4DR6 Q;  4A3E G;  1ONL A;  1LTT D;  2Q2U A;  4DV7 L;  1EYD A;  4TQU S;  1C48 A;  3RZO B;  2BE5 C;  3GTQ B;  3PCO B;  3PSI A;  1HNX L;  2JK8 A;  1ZYR D;  4OL7 A;  4BBR B;  4XQQ A;  4QIW E;  4H7B A;  5F2D A;  3TRZ A;  2A8V A;  2VY3 A;  2Z6K A;  1QVF A;  4U67 3;  1KDA A;  3I4M B;  3CCE A;  3A8I E;  1W6J A;  1A8V A;  3CRK C;  2A73 B;  3KF6 A;  5M3F H;  3BYT B;  4HCE A;  3J7A V;  3BDO A;  2O5J C;  3VYU A;  1HR0 Q;  4DR3 L;  3S2D B;  5EGT A;  3SGI A;  1XPR A;  4DXG A;  4HN7 A;  3GDE A;  5ELB A;  2OQ0 A;  2XWJ B;  4GZY C;  3DWP A;  4IQZ A;  2B2Y A;  3X3N A;  1PTO F;  1SMY D;  1E1T A;  3NUC A;  1A0I A;  2QEJ C;  4A3F H;  2ZTC A;  1KD1 C;  1K83 H;  2K5N A;  1BXT A;  1FNU A;  1RTN A;  3MXU A;  2K32 A;  4DR7 Q;  1OXU A;  1TWA B;  1VF7 A;  1XTD A;  2VQE Q;  4JI4 Q;  4BBS G;  2I46 A;  3ULP A;  1CHP D;  1EZ6 A;  1GUO A;  1UE7 A;  5IYD G;  4KV6 A;  3CHB D;  3N52 A;  1B50 A;  3CCV A;  2BDO A;  4RGN A;  5ELF A;  2PYK A;  3FDT A;  4LUZ A;  1PMR A;  5E1F A;  1QNU A;  5GQO A;  2LXK A;  5M3M B;  4IJH A;  3R2T A;  3KF6 B;  4CJ2 C;  2MUY A;  1CSQ A;  3A0J A;  2VW9 A;  2B2V A;  4A75 A;  3F2C A;  4A3K H;  5JAV A;  4J6H A;  5FLM H;  1SR3 A;  1UE6 A;  1WTV A;  1B1Z A;  4DR2 Q;  4KJO A;  3BG3 A;  2B2U A;  3S1R H;  2EYH A;  2WKD A;  4IPH A;  5IGE A;  2B8G A;  2JP1 A;  3MXP A;  3PO2 G;  3OIQ A;  1U4P A;  1E2Z A;  4UP7 A;  3MZ5 A;  2JA5 G;  1T9H A;  4GOP C;  3HOW H;  4TSS A;  1PRT B;  2R3Z A;  3GTO H;  1IBL Q;  3EQL C;  4EX5 A;  3I4N H;  2NYZ D;  1B44 D;  2E5L L;  4K5W A;  3T1H L;  1YBY A;  2QDB A;  2DJF C;  1G2T A;  3S15 B;  4NPS A;  4DK0 A;  5EPL A;  3HKS A;  4XTC S;  3C46 A;  4B3R Q;  1JJC B;  1GHK A;  4DAY A;  4QL5 A;  3PMF A;  1UNS A;  4DNR B;  5CV7 A;  1RHP A;  2ZTE A;  1U9R A;  4DV3 L;  3CCL A;  2JA6 B;  4QGU A;  2A69 C;  2L0C A;  2MJ8 A;  2NVQ B;  1TWG H;  3BYY B;  3KJP A;  5H1S E;  1NY4 A;  1I6V C;  1U0L A;  1Q8K A;  4OO1 H;  4C3I H;  4J1M A;  2A6E C;  3MHB A;  2FIN B;  2TMP A;  3WWV A;  3HG9 A;  5IP9 H;  3GTL H;  2UU9 Q;  5C0X H;  5IT9 E;  4Q5V A;  4KD4 A;  1TY0 A;  1XNR Q;  5KYL A;  2Y0S B;  4G7Z C;  4A3L H;  3CCS A;  2A19 A;  2VNU D;  1I50 H;  2LXJ A;  3UDI A;  1F2M A;  4LW1 A;  1HNZ L;  5JOB A;  4K0K Q;  3BVG A;  3TZU A;  3C3L A;  2KJX A;  1K8M A;  2KQ3 A;  3D4R A;  1PH1 A;  1EWC A;  5KND A;  1PYB A;  1NR4 A;  2OQK A;  1HZC A;  4DR6 L;  2OTJ A;  1V1O A;  1DM0 B;  4JI2 Q;  3J81 E;  2F0N A;  1XPU A;  4A3G B;  1LV9 A;  3UE0 A;  3JC6 6;  4P73 A;  4B3M Q;  2KED A;  1ET6 A;  1MD2 D;  2F0O A;  4DAY B;  2NVY H;  3MEF A;  4R4C A;  3PIP A;  4A3J B;  2SNS A;  3BJU A;  3ONA B;  3QIA A;  4JC0 A;  1VQ8 A;  1SRO A;  1BCP C;  1EY6 A;  1LTR D;  4ZQ3 A;  4ZKB B;  3OHX C;  2RDG A;  5I9P A;  3E0E A;  2WAQ B;  1RTO A;  4R4T A;  2XRS D;  1A3U A;  4OON A;  4CHT B;  2E2D C;  2HDL A;  2JA8 G;  1TR5 A;  4JK1 C;  1EFW A;  4PG3 A;  4YWM A;  4B3S Q;  1HR0 L;  1J8I A;  3KLR A;  2ZM6 Q;  3CME A;  1EOT A;  4JBM A;  2RSO A;  1JQY D;  2UUA Q;  1NAP A;  1SFO H;  2NN6 G;  1ASZ A;  4GLV B;  2KUM A;  3V05 A;  2AQ3 B;  3IL8 A;  1Y8O B;  4M1U B;  1N32 L;  3CW2 C;  2FHT A;  4NXM Q;  2KEN A;  1ENA A;  2WII B;  1I94 Q;  2QIL A;  3AB9 A;  4Z9C B;  4DR7 L;  4LFA Q;  2VQE L;  4JI4 L;  1PHJ A;  4GN4 B;  4A3B G;  1SE4 A;  4A3E H;  4PMB A;  1N8R C;  3R8B A;  1IW7 D;  3J7Y W;  1F9P A;  1L1O C;  2NWG A;  4OWT B;  3F1Z A;  3ZJY C;  4FP5 D;  5LMU L;  2RF4 A;  2F1M A;  4O1N A;  2HT1 A;  2WB1 B;  1GUN A;  3SVM A;  3MFG A;  2H1E A;  1E24 A;  3U58 A;  5K5P A;  2B39 A;  5I2X A;  2KBN A;  1V1Q A;  4O42 A;  3TZD A;  4BS9 A;  1HUN A;  4C3J B;  2I5M X;  1TWC B;  1ILQ A;  2JQO A;  1N34 Q;  4WRD A;  1NBW A;  3FPP A;  3QOL A;  4NB3 A;  2N3S A;  5BR8 Q;  1TS5 A;  1WFQ A;  5A2Q E;  2E76 C;  1EIF A;  5D14 A;  1TXY A;  2JA9 A;  4DR2 L;  3HGB A;  4U68 A;  1YJN A;  2F0G A;  3TRE A;  3LNN A;  3RMH A;  4KD3 A;  4L63 B;  5JPM C;  1BBX C;  5IYC G;  3GTG H;  3NSW A;  2UUB Q;  3FKI G;  5ELE A;  1DCZ A;  1Y1V G;  1G51 A;  2K75 A;  2LFN A;  2VB3 X;  2PQA A;  2WKC A;  1IBL L;  4JI0 L;  2K05 A;  2I5H A;  1V1P A;  1WVL A;  1HTL D;  2CWA A;  3L7Z C;  1ESR A;  2A6H D;  1VQ5 A;  4KKU A;  1GUS A;  4BBS H;  5IYD H;  5JVG 3;  4HIM A;  1FD7 D;  2VS1 A;  2RVL A;  1NE3 A;  1ZEQ X;  4OGQ C;  1Q46 A;  5KYI A;  4B3R L;  4N9P A;  4R4I A;  1WCM G;  2IT1 A;  3ER0 A;  3PO3 B;  4C1N K;  2EDG A;  2V4D A;  3BU2 A;  3K81 C;  1JB7 A;  1G6P A;  1DOL A;  1SND A;  4H13 C;  5HY6 A;  1DZ1 A;  1O78 A;  1RCV D;  3NXW A;  3UI2 A;  2FMM A;  1G29 1;  2ZXO A;  3NBH A;  5IGB A;  3E9I A;  2XTI A;  3S14 B;  5C4J H;  1D1K A;  1KIX A;  4IUT A;  5IWA Q;  4BY1 B;  3ND8 A;  2E2J B;  3ICE A;  4LFB L;  1KDB A;  3G48 A;  3PUV A;  4DR1 Q;  1IL8 A;  4Y52 H;  4KHZ A;  1CKO A;  1U4L A;  1ZXT A;  5GAH C;  1HRJ A;  1S3O A;  1YNN C;  1XNR L;  5FO9 B;  1VQ6 A;  3K7U C;  1AE3 A;  5EKL A;  3PO2 H;  2Q8I B;  4K8J A;  1RIP A;  1A3V A;  2JA5 H;  2B63 G;  1VQ4 A;  4NXN Q;  3FP9 A;  2X69 A;  2NZ1 D;  4A3M H;  2VUM G;  2DY7 A;  2D0P A;  2PQA B;  2YYZ A;  2IY5 B;  1V1P B;  4A4I A;  1QWY A;  3VR4 A;  3CKI B;  1CQV A;  1KHI A;  4RHR A;  2BE5 D;  3W3A A;  4JI2 L;  3J7Z C;  2EXZ A;  3W2D A;  2M9V A;  3MEH A;  4OWW B;  1HFN A;  1I6H B;  4CGY B;  4B3M L;  4DFA A;  2R6G A;  3BZD B;  3PIP 3;  3T51 B;  4DAV A;  3JAM E;  3M85 A;  1EY4 A;  2F0H A;  1Y8P B;  4P74 A;  3HOX G;  1EIH A;  1B9M A;  1PA6 A;  1XX8 A;  2O2L D;  4QJF A;  3I72 A;  2CFM A;  5C44 B;  2DJG C;  3FMC A;  2F0D A;  2PMZ E;  3TQY A;  1B2T A;  1SBB B;  2SDF A;  5C3X A;  3NBH B;  3RNU A;  1S40 A;  2YV5 A;  1KDC A;  4B3S L;  2QDL A;  2ZM6 L;  1ESF A;  4RG1 A;  3KFU A;  1R4P B;  2OCE A;  2UUA L;  2MGS A;  3S1N H;  2N78 A;  4X3S A;  2K5W A;  1STY A;  4NP5 A;  3M4Y A;  3J80 E;  1KNA A;  4F87 A;  3S16 H;  1J5E Q;  1GO3 E;  4JI7 Q;  3K8A A;  4RKL A;  1I94 L;  4NMZ A;  3T4A C;  3CCU A;  1QE6 A;  4LFA L;  5JEA H;  2D5D A;  4POG A;  4OWX B;  1EY8 A;  2L15 A;  2DNE A;  4P75 A;  1LT6 D;  4OO1 I;  2E2I B;  1ET9 A;  1CKN A;  4ZCK A;  1PH2 A;  2R7Z G;  2ICE C;  2XNA C;  5K36 G;  1H9S A;  5C0X I;  1YVC A;  2WAC A;  3N6R A;  5CV9 A;  2H4O A;  3M7N A;  2XSC A;  2EOT A;  1GOZ A;  2CWP A;  1SYD A;  4Y7N B;  4ZLT F;  1YIJ A;  3G6J B;  4I7Z C;  1EIG A;  1JE4 A;  2R92 G;  1YHB A;  1QZG A;  3NWT A;  3RLO A;  1PH7 A;  2GN5 A;  5CBA E;  4RH6 A;  3I70 A;  2Z0S A;  1A2T A;  1U4R A;  5AJ3 Q;  2F3V A;  1SNC A;  3M9B A;  2JA8 H;  3MA2 B;  2D0O A;  3NQI A;  1N34 L;  4UAI A;  5BR8 L;  1XYI A;  3QOJ A;  1KC8 C;  1K8A C;  2TSS A;  3GTP H;  4KN4 C;  3A7L A;  1I3Q H;  3BVZ A;  4CDC C;  1S5F D;  3ITP A;  4QB4 A;  5M3F B;  1LTB D;  1II3 A;  1YJW A;  2LSS A;  1HZ9 A;  4FF2 A;  2N8N A;  4YY3 Q;  2UUB L;  4IPG A;  1EYA A;  3K7A H;  1B7Y B;  1B8A A;  1MSH A;  4LUV A;  4X3U A;  1HQR D;  4LF5 L;  3HKZ E;  3NEL A;  1S5C D;  2L1B A;  4EQ5 A;  2MP1 A;  4X3T A;  1VQB A;  1PYS B;  3HKZ G;  4F88 A;  4G7O C;  4A3B H;  1XTC D;  5C4Z A;  2DY8 A;  2C5C A;  1VQE A;  2K01 A;  2D62 A;  4KN7 C;  2ATW A;  1QIL A;  3T53 B;  1CQF A;  4FXK C;  2A5H A;  1JOR A;  2EY1 A;  1TKW B;  3L9A X;  1AZQ A;  1H9S B;  4A3F B;  5M5W H;  1G91 A;  2F0M A;  3E3X A;  2CW0 C;  1K83 B;  3BZC A;  2M2L A;  1TVX A;  2F0S A;  1IYJ B;  1SAP A;  2A69 D;  2JE6 I;  5IP7 G;  1H9R A;  2HIV A;  1TS2 A;  4LF8 Q;  1BF4 A;  1PH4 A;  2HUG A;  1N9W A;  4TRD A;  5EKK A;  3CCR A;  5FLX L;  2A6E D;  1H9M A;  3ERQ A;  2J4X A;  3Q23 A;  3GTJ H;  1T5E A;  5IWA L;  3PF4 A;  1UWV A;  4HIK A;  2WP8 J;  3HFZ B;  1PH9 A;  1B4O A;  4DR1 L;  4WOR A;  3VYR A;  4UHV A;  3F2D A;  2K52 A;  3H94 A;  3SK4 A;  1K0S A;  1TS4 A;  2B2W A;  1PFS A;  1C0A A;  2LS0 1;  5IYC H;  5HGQ A;  4A3K B;  1LUZ A;  3FKI H;  5M5Y H;  1SRU A;  1Y1V H;  5J39 A;  3CPW A;  2JJQ A;  2AMC B;  3HOU B;  3U9O A;  1SNO A;  2Q2I A;  1BKB A;  2B2T C;  1ENC A;  3S1R B;  1MSG A;  2JEB I;  3UE1 A;  2MPM A;  4A3G G;  5EPK A;  1HTP A;  1BQQ T;  3GP7 A;  1HPC A;  5FK9 C;  1HHV A;  1PZK D;  2F0W A;  3U9S A;  3HOW B;  2E2H B;  2PQE A;  2XGT A;  2EY2 A;  3GTO B;  5M5X B;  1TWH H;  1BCP D;  2BH2 A;  1JOK A;  2ID0 A;  1WCM H;  4HCS A;  4JOI A;  3EVQ A;  3LWE A;  1ML0 D;  1WTH A;  2YTY A;  4WFN 3;  2WAQ E;  4GLA C;  5C4X G;  5DLQ E;  2BH8 A;  5BN3 A;  1I4H A;  5IYB G;  1A15 A;  4BY7 B;  2JA7 G;  3OTO Q;  1BDO A;  1EEI D;  2WAQ G;  2ASB A;  2N88 A;  1EU4 A;  4IUN A;  3PF5 A;  5KGU A;  1BBU A;  1HA6 A;  1ICF B;  1KAB A;  3G7L A;  2R93 G;  4A3I G;  3A8J E;  5GAD C;  4GKK Q;  2HCC A;  1GUG A;  3MC0 B;  4CDF C;  1JWU D;  1EU3 A;  1SE8 A;  3PV0 A;  5ISR A;  1WTX A;  1STE A;  1N36 Q;  2UXB Q;  1OXT A;  4RFB A;  1TWG B;  2N55 A;  3LGJ A;  3EN2 A;  3F2U A;  1J5E L;  2X6G A;  2B63 H;  2VB2 X;  4C3I B;  4P72 A;  5NUC A;  2VUM H;  3GTL B;  2KEC A;  3STB D;  2EVB A;  1LYL A;  1SYF A;  4IFD J;  1MJC A;  1ICW A;  2PZW A;  4OEL B;  2O5I C;  1F77 A;  3QWN A;  4IFD G;  2PNR C;  2ZTD A;  5KIX A;  1SMX A;  3I4L A;  1I50 B;  4IUR A;  3PUZ A;  1YIT A;  3GTQ H;  1NR2 A;  5KEE A;  3NTK A;  2AWO A;  2JN4 A;  2Z8L A;  3E5S A;  5EBC A;  3H15 A;  2F0U A;  3RN2 A;  1SXT A;  1V9P A;  1EZ8 A;  4B3T Q;  2UUC Q;  4C3H H;  2N49 A;  5FO8 B;  3HOX H;  1EQV A;  3VR5 A;  3DM3 A;  3S17 H;  3ND9 A;  4CJ0 B;  3K5L A;  2BOS A;  1X54 A;  4LUO A;  2SOB A;  5J3B A;  3K0X A;  2JXM B;  4HED A;  5AJ3 L;  3DLL A;  1BCP F;  4R1J A;  2AWN A;  1STG A;  1CM9 A;  1HZB A;  1XNQ L;  4I7A A;  2NVY B;  5DEH A;  3NWS A;  1NNX A;  3H0G B;  3HOV B;  3CCQ A;  3WOE A;  2HQL A;  2AKW B;  5T1I A;  4JI8 Q;  4HR7 B;  1KRT A;  4JVZ A;  2K33 A;  2ZJP A;  1K8G A;  4MZ9 A;  3GV3 A;  3SE0 A;  2NTS A;  2QA4 A;  4YY3 L;  1IL2 A;  3GTM H;  2VZA A;  1AN8 A;  2HIX A;  4GS3 A;  5I9O A;  5CBE E;  2PI2 A;  1MI2 A;  1PZJ D;  1SYE A;  1M90 C;  1LM0 A;  3IFT A;  1PTO C;  2NVT H;  1VQ7 A;  2YTV A;  4K5V A;  3MAQ A;  4KMU C;  1TWA H;  4LJZ C;  4X65 Q;  1SFO B;  1ILP A;  1Y69 U;  1H9K A;  3CQZ B;  5AFW A;  2K5V A;  4EVO A;  4LNQ A;  1MHW C;  4PZ8 A;  1GUT A;  3BS1 A;  2R7Z H;  4A93 G;  2Z9H A;  3Q8D A;  1XJV A;  2D9U A;  4HSV A;  2YU9 H;  4HTH A;  5EAY A;  4ZRZ A;  3PO3 G;  2I07 B;  5DNF A;  4LF7 Q;  4A3E B;  2R92 H;  2L11 A;  2ICI A;  4KHV A;  4K6L A;  4M8A A;  5IGC A;  4ME3 A;  4P71 A;  1G2S A;  2EJF C;  3M4O H;  4KJN A;  1PVO A;  2KVM A;  1CFM A;  2DNC A;  3BDC A;  5C3W A;  1YNN D;  3IAY A;  3DWA A;  5DM6 3;  3MVV A;  3D3R A;  4YWK A;  3V2T A;  2DGY A;  4QIW B;  3U4Z A;  3GTK H;  4OIJ A;  1B3Q A;  1BOS A;  4KKT A;  1QOH A;  2B8F A;  4GKJ Q;  3HOY G;  3MXN A;  1EY7 A;  1I4R A;  1VQA A;  4C1N I;  2SNM A;  4WJW A;  1SE2 A;  3HOZ G;  1QUQ A;  1EQT A;  3OYY A;  4L5S A;  1QCB D;  1Q86 C;  1IHZ A;  2RDF A;  2V1C C;  4A76 A;  1BUV T;  5COR A;  3PUW A;  3M3Y H;  1FVI A;  4G57 A;  3K59 A;  3GTG B;  1KAA A;  1DJR D;  1NCV A;  4R9W A;  2XN9 C;  1GXD C;  1AEX A;  1WI5 A;  4C2M H;  5I2Y A;  4R4O A;  4IO9 A;  4HIO A;  3VDY A;  5C3E B;  1NTG A;  3B6Y A;  3KLS X;  5IP7 H;  4BBS B;  1X3P A;  4J8Q A;  3OTO L;  3J7A F;  4AYB E;  1X56 A;  2EY5 A;  4TVA B; 
#chains in the Genus database with same CATH homology
 4LF6 L;  2F4V Q;  1KHI A;  4BXX H;  2ALY B;  1XMQ Q;  4AYB G;  4WJ4 A;  3HOU H;  4X64 Q;  2OWO A;  4JI2 L;  3J7Z C;  1Q12 A;  1N33 Q;  1CKN B;  2EXD A;  4JCV E;  1KQS A;  4OWW B;  1NJI C;  1I5F A;  4B3M L;  4GKK L;  3U4V A;  4YCU A;  2K5H A;  2R6G A;  3S2D H;  1D7Q A;  3KOJ A;  5ELO A;  3RN5 A;  1M1K C;  3UDG A;  1X65 A;  2E2I H;  4R4Q A;  1N36 L;  2E2H H;  2A1A A;  2UXB L;  3M85 A;  1JMC A;  5M5X H;  1GVP A;  1Q1B A;  3KJO A;  4A3M G;  1PH6 A;  1HNZ Q;  4P74 A;  3HOX G;  3I4O A;  2IX0 A;  4JI0 Q;  5JJL A;  2F52 A;  1PA6 A;  2QGQ A;  3I2Z A;  4QJF A;  3KLW A;  3G71 A;  2CFM A;  2CQO A;  3MXN B;  3T1Y L;  1EQQ A;  2Z6K C;  2PMZ E;  3W5O A;  1VQC A;  2KHI A;  3RLN A;  3TQY A;  4BY7 H;  4DNI A;  1QUQ B;  4Y7N H;  3A5U A;  4DR6 Q;  4A3E G;  3NBH B;  3RNU A;  4UP9 A;  1S40 A;  2YV5 A;  4B3S L;  1Y1W G;  2Q2U A;  4DV7 L;  2K14 A;  2VL6 A;  2ZM6 L;  3A5Z B;  4AQY L;  4TQU S;  1VCI A;  4RG1 A;  4DV0 Q;  3KFU A;  4A3G H;  3PCO B;  3PSI A;  4AIM A;  1HNX L;  4OX9 Q;  2JK8 A;  2OCE A;  4DKA C;  2UUA L;  4JYA L;  2E8G A;  4HID A;  2N78 A;  3S1N H;  2GVB A;  3S2H H;  1CKM A;  3CAM A;  4QIW E;  1JT8 A;  5LMN W;  3TRZ A;  2A8V A;  2VY3 A;  4L5R C;  1V43 A;  2Z6K A;  1QVF A;  3S16 H;  1J5E Q;  4PMW A;  3CCE A;  1GO3 E;  1P16 A;  4B3T L;  3K8A A;  1A8V A;  2UUC L;  4JI7 Q;  5C4X H;  3KF6 A;  5M3F H;  5IYB H;  1HNW Q;  1I94 L;  3PUX A;  4QY7 A;  4PZ7 A;  3W1B A;  4LF8 L;  3CD6 A;  3FHW A;  2JA7 H;  5GAE C;  3CCU A;  3J81 j;  2RHS B;  4DUZ Q;  5M3M H;  4LFA L;  4LF4 Q;  1BBW A;  1K3R A;  4DR3 L;  1HR0 Q;  4POG A;  4OWX B;  1BVS A;  4LFB Q;  3SGI A;  2L15 A;  1XPR A;  4P75 A;  4DV6 Q;  4OO1 I;  1UE1 A;  5IY0 A;  3GDE A;  2QEX A;  2R93 H;  1CKN A;  4BY1 G;  1QVC A;  2OQ0 A;  4A3I H;  2H5X A;  4JV5 L;  1PH2 A;  2R7Z G;  5FJ8 H;  5K36 G;  4KHP L;  5C0X I;  1YVC A;  3A74 A;  4MNO A;  4JI8 L;  1IBK Q;  4QQB X;  4IPD A;  1UEB A;  3M7N A;  5JEA J;  1AH9 A;  1C7Y A;  1IZ6 A;  1E1T A;  3CMA A;  1CSP A;  3NEM A;  2CWP A;  1A0I A;  1L0W A;  3TS2 A;  1EQR A;  4A3F H;  1OXX K;  2MO1 A;  4DUY L;  1YIJ A;  2R92 G;  2ZTC A;  1KD1 C;  1K83 H;  1YHB A;  2K5N A;  4YWL A;  3RLO A;  1QZG A;  4HJ7 A;  1RL2 A;  5JEA G;  2GN5 A;  3S24 A;  4HJ5 A;  1PH7 A;  2ES2 A;  4GNX A;  1VQN A;  4DR7 Q;  2CKZ B;  1OXU A;  3PUY A;  2Z0S A;  1XTD A;  2VQE Q;  4JI4 Q;  4BBS G;  1EOV A;  3ULP A;  5AJ3 Q;  1SN8 A;  1UE7 A;  3M9B A;  5IYD G;  2JA8 H;  3H3V H;  2D0O A;  4X65 L;  4DR5 Q;  1N34 L;  1VQO A;  1TWF H;  3CCV A;  3OW2 A;  1SLJ A;  5BR8 L;  4HJ8 A;  1KC8 C;  1K8A C;  2UU9 L;  1X3F A;  1EYG A;  1A62 A;  4DV1 Q;  1S72 A;  3TEH B;  3GTP H;  3S15 H;  4DR4 L;  4A3D G;  1I3Q H;  2K4K A;  1NMG A;  3H0G H;  1U5K A;  4UP8 A;  3HOV H;  5JJK A;  4LUZ A;  4JI6 Q;  4X66 Q;  5E7N A;  1YJW A;  1Y14 B;  1HZ9 A;  2LSS A;  3F2B A;  2N8N A;  3RR5 A;  1O7I A;  4X62 Q;  1FJG Q;  4YY3 Q;  1FGU A;  2UUB L;  4IPG A;  3K7A H;  5GQO A;  2LXK A;  1B7Y B;  4PZ6 A;  1B8A A;  4LUV A;  4KLK A;  2AHO B;  4IJH A;  3KF6 B;  2NN6 I;  1Z47 A;  4LF5 L;  3HKZ E;  3NEL A;  4K0K L;  4YHH Q;  1CSQ A;  3A0J A;  3RLF A;  2VW9 A;  4A75 A;  2JA6 H;  1UE5 A;  3CC2 A;  5C44 G;  4EQ5 A;  3F2C A;  2MO0 A;  4A3K H;  1VQB A;  1C9O A;  1D8L A;  1PYS B;  3HKZ G;  5FLM H;  2NVQ H;  4A3B H;  2MQH A;  1SR3 A;  4JI3 L;  1UE6 A;  3W1G A;  3K80 C;  1VQE A;  2PNH A;  2D62 A;  2ATW A;  4DR2 Q;  4YCV A;  1PV4 A;  3S1R H;  4IPH A;  5LMN Q;  4GLX A;  3EBE A;  3CQZ H;  4WJ3 M;  3NEN A;  3CCM A;  3D0F A;  3CPF A;  1IBM Q;  3PO2 G;  3U50 C;  4L5T A;  1PH8 A;  2BA0 A;  3D31 A;  5M5W H;  4BBR G;  4UP7 A;  1VQD A;  3BZC A;  2JA5 G;  4A3C G;  2ZJR A;  1Q7Y C;  1T9H A;  4JI5 L;  4GOP C;  3HOW H;  1IYJ B;  1AE2 A;  2JE6 I;  3AEV A;  5IP7 G;  4GKJ L;  3GTO H;  2HIV A;  4LF8 Q;  1IBL Q;  4HJ9 A;  4EX5 A;  1PH4 A;  3KF8 B;  1X9N A;  1XMO L;  3ULJ A;  4LF9 L;  3I4M G;  1N9W A;  5FLM G;  3I4N H;  3CCR A;  4GNX B;  4BXX G;  2E5L L;  3T1H L;  3STB C;  2B29 A;  1YBY A;  2OTL A;  3HOU G;  2WFW A;  2UXC L;  5IT9 c;  3GTJ H;  4YCW A;  1J6Q A;  5IWA L;  1UWV A;  2F3I A;  4DK6 C;  4NPS A;  3PF4 A;  1VQK A;  4HIK A;  2WP8 J;  2UXD Q;  1KL9 A;  3HKS A;  3HFZ B;  4XTC S;  1PH9 A;  4DR1 L;  3IRB A;  4DV4 Q;  4LWC A;  4LFC Q;  4B3R Q;  1JJC B;  3F2D A;  1X6O A;  4DV2 Q;  2K52 A;  4QL5 A;  1VQM A;  2MFI A;  3I7F A;  4JI1 Q;  4A93 H;  2VQF L;  4X6A H;  1E22 A;  2ZTE A;  1PFS A;  4DV3 L;  3CCL A;  1C0A A;  1X55 A;  5IYC H;  3PO3 H;  5HGQ A;  4QGU A;  1LUZ A;  1JE5 A;  3J81 i;  4AH6 A;  4A3J H;  3FKI H;  4JOI C;  5M5Y H;  1SRU A;  2R7D A;  4JBW A;  1Y1V H;  4BY7 G;  1TWG H;  3KJP A;  4NXM L;  3L0O A;  3J81 c;  3CPW A;  5H1S E;  1NY4 A;  2JJQ A;  2AMC B;  1ASY A;  4X64 L;  4JBJ A;  1U0L A;  1Q8K A;  4A4I A;  2Q2I A;  3S1M H;  2F4V L;  1BKB A;  3UDF A;  4C3I H;  2K50 A;  1Q81 C;  2JEB I;  3UE1 A;  1XMQ L;  3WWV A;  5IP9 H;  4A3G G;  3GTL H;  4RMF A;  2UU9 Q;  1OXV A;  3AFP A;  4DV5 Q;  1N33 L;  2E2J H;  4IOA A;  5JJI A;  2XGT A;  1XNR Q;  4APV A;  3E9H A;  1TWH H;  3M4P A;  2HHH Q;  2IHF A;  4IPC A;  2BH2 A;  4A3L H;  3CCS A;  2ID0 A;  2A19 A;  2VNU D;  1WCM H;  4O2D A;  3ERS X;  5GAG C;  1I50 H;  2LXJ A;  4JOI A;  3UDI A;  2YTY A;  2WAQ E;  4LW1 A;  4GLA C;  1HNZ L;  5DLQ E;  2BH8 A;  4LF5 Q;  5M3F G;  5C4X G;  5IYB G;  4K0K Q;  3HOY H;  2C35 B;  1WOC A;  5FLX c;  2I0Q A;  3BZK A;  2JA7 G;  1W3S A;  3OTO Q;  4UPA A;  2WAQ G;  5C3E H;  1GD7 A;  2ASB A;  1KAW A;  1YZ6 A;  1PH1 A;  5M3M G;  5IP9 G;  1PYB A;  3PF5 A;  3HOZ H;  2OQK A;  1HZC A;  4DR6 L;  1BBU A;  2OTJ A;  4JI2 Q;  1XPU A;  3ULL A;  2KCM A;  2YTX A;  1KXL A;  1VQI A;  1FL0 A;  1VQH A;  3JC6 6;  3UE0 A;  4P73 A;  4IOC A;  4A3I G;  2R93 G;  4B3M Q;  5GAD C;  3L2P A;  4DV0 L;  4GKK Q;  4GN3 B;  1HH2 P;  5FJ8 G;  3M4Q A;  4OX9 L;  4DPG A;  2CCZ A;  4A3C H;  1PHJ A;  4GOP B;  4MTN A;  4DAY B;  1SE8 A;  1K73 C;  2NVY H;  3MEF A;  2FXQ A;  3PV0 A;  4R4C A;  3PIP A;  1N36 Q;  3BJU A;  1OXT A;  4JC0 A;  1VQ8 A;  2UXB Q;  1W2B A;  1SRO A;  3LGJ A;  1PH5 A;  4A3F G;  3EN2 A;  1J5E L;  1VQJ A;  3T1Y Q;  2B63 H;  1IXR A;  2E5L Q;  3E0E A;  1LTL A;  4LF6 Q;  4LF7 L;  4R4T A;  2GVA A;  1HNW L;  1MIU A;  4P72 A;  2VUM H;  4OON A;  3STB D;  1LYL A;  2JA8 G;  4IFD J;  1MJC A;  1L2F A;  1EFW A;  4DUZ L;  4PG3 A;  4YWM A;  4B3S Q;  4LF4 L;  4DV7 Q;  1HR0 L;  3JAM i;  2RHQ B;  1VQ9 A;  2ZM6 Q;  4AQY Q;  1CUK A;  4BA2 I;  1A63 A;  3CME A;  1E1O A;  4JBM A;  2NZH A;  1PH3 A;  1HNX Q;  4IFD G;  1B70 B;  4C3J H;  1TWC H;  1X3E A;  2UUA Q;  2ZJQ A;  2ZTD A;  4JYA Q;  1SMX A;  3GO5 A;  1YIT A;  1EWI A;  3PUZ A;  1K9M C;  3H0G G;  1SFO H;  3GTQ H;  3HOV G;  2AWO A;  2NN6 G;  3UDX A;  1ASZ A;  4GLV B;  3H15 A;  4BA1 I;  4KI0 A;  3RN2 A;  1IBK L;  1V9P A;  1N32 L;  3CW2 C;  2IHE A;  4B3T Q;  2UUC Q;  4C3H H;  4NXM Q;  2N49 A;  2KEN A;  3PIO A;  3HOX H;  1VQL A;  3S1Q H;  4ALP A;  1I94 Q;  3DM3 A;  3S17 H;  2JA6 G;  1YEZ A;  4A3K G;  4FDB A;  4DR7 L;  1X54 A;  4LUO A;  2MNA A;  5J3B A;  4LFA Q;  2VQE L;  4JI4 L;  3K0X A;  4GN4 B;  4GN5 A;  4XIG S;  5AJ3 L;  3I55 A;  3DLL A;  3CCJ A;  1Z9F A;  4DR3 Q;  1K0R A;  4R1J A;  3KYH C;  3J80 i;  2AWN A;  4A3E H;  4UY8 C;  1XPO A;  1HZB A;  1XNQ L;  4JBK A;  3J80 c;  1Y1W H;  4DR5 L;  1N8R C;  1DGS A;  4JV5 Q;  1VQG A;  1MJE A;  1JJ2 A;  1L1O C;  4OWT B;  1GM5 A;  2Y0S E;  4KHP Q;  4DV1 L;  4JG2 A;  3F1Z A;  3ZJY C;  3CCQ A;  1EUJ A;  2HQL A;  2AKW B;  4JI8 Q;  1JJG A;  3HOW G;  1KRT A;  5LMU L;  2RF4 A;  4GOP A;  2ZJP A;  2HT1 A;  4JI6 L;  2Y0S G;  4X66 L;  1K8G A;  4MZ9 A;  3AQQ A;  4X62 L;  1FJG L;  2QA4 A;  4YY3 L;  1X3G A;  4DUY Q;  2VZA A;  1E24 A;  3U58 A;  1IL2 A;  1Q1E A;  3GTM H;  2KBN A;  5GRO A;  3I4N G;  4NXN L;  2HIX A;  4GS3 A;  4HJA A;  1V1Q A;  2PI2 A;  1QVG A;  4OXP A;  4YHH L;  3CF5 A;  2Q2T A;  1M90 C;  1LM0 A;  2I5M X;  2NVT H;  1VQ7 A;  2YTV A;  4H02 A;  3G6E A;  3GD7 A;  1TWA H;  2JQO A;  4X65 Q;  1L1O A;  1N34 Q;  3F8T A;  1NBW A;  4NB3 A;  2N3S A;  4L5Q A;  5BR8 Q;  1WFQ A;  3S14 H;  1VQP A;  1EIF A;  2K5V A;  1TXY A;  2JA9 A;  4DR2 L;  4LNQ A;  3J7A 5;  4DR4 Q;  4PZ8 A;  5LMN L;  1YJN A;  4BY1 H;  3G4S A;  3TRE A;  1IBM L;  2R7Z H;  4A93 G;  4POF A;  3Q8D A;  5IYC G;  1XJV A;  2YU9 H;  4A3J G;  2UUB Q;  5EAY A;  3GTG H;  3PO3 G;  3KDF A;  3AFQ A;  3FKI G;  4LF7 Q;  4DK3 C;  2K75 A;  1Y1V G;  1G51 A;  4IJL A;  2PI2 E;  1GKH A;  1E7Z A;  2PQA A;  1IBL L;  2R7F A;  4JI0 L;  2R92 H;  4J15 A;  2I5H A;  1OTC A;  2CWA A;  5C0X J;  1MKH A;  1VS0 A;  1YHA A;  4ME3 A;  1Q82 C;  3L7Z C;  3TS0 A;  3CXC A;  4GNX C;  4P71 A;  4OO1 G;  2NZO A;  1VQ5 A;  3M4O H;  4BBS H;  2B63 G;  2NVX H;  1YJ9 A;  1YNX A;  4JI3 Q;  1PVO A;  5C0X G;  5IYD H;  3EIV A;  2UXD L;  4HIM A;  2VS1 A;  1NE3 A;  4DV4 L;  4A3L G;  3CP0 A;  1Q46 A;  1R9T H;  4LFC L;  4B3R L;  4YWK A;  2KHJ A;  1WCM G;  4O0A A;  4R4I A;  4A3D H;  1N32 Q;  2Q2H A;  2DGY A;  4DV2 L;  2IX1 A;  2IT1 A;  3U4Z A;  3GTK H;  1I6H H;  4JI5 Q;  3ER0 A;  4JI1 L;  4DAM A;  1JB7 A;  3K81 C;  3BU2 A;  5ELN A;  4GKJ Q;  1HJP A;  1HZA A;  1G6P A;  3HOY G;  2B3G A;  5HY6 A;  1XMO Q;  5C3E G;  1VQA A;  4LF9 Q;  1WJJ A;  1H95 A;  4JI7 L;  3HOZ G;  3T1H Q;  1QUQ A;  3OYY A;  2EQS A;  1G29 1;  4L5S A;  2UXC Q;  2XTI A;  3E9I A;  1Q86 C;  3CC4 A;  2V1C C;  5C4J H;  1NMF A;  1XNQ Q;  1KIX A;  5C44 H;  4A76 A;  2JEA I;  1YI2 A;  5IWA Q;  3RZD H;  5IE8 A;  1OXS C;  1L1O B;  3ICE A;  4LFB L;  1HR0 W;  1QZH A;  3H3V I;  3G48 A;  3PUW A;  1P8L A;  3PUV A;  4DV5 L;  3M3Y H;  4DR1 Q;  4Y52 H;  4KHZ A;  1CKO A;  1VQF A;  1FVI A;  3JAM c;  5GAH C;  4DV6 L;  5LMU Q;  1S3O A;  4A3B G;  1XNR L;  1EIY B;  1VQ6 A;  3RZO H;  3K7U C;  1AE3 A;  3PGZ A;  2HHH L;  1WI5 A;  2VQF Q;  3PO2 H;  4IFD I;  2WB1 E;  4C2M H;  1RIP A;  4BBR H;  1KRS A;  4R4O A;  4DV3 Q;  4IO9 A;  2JA5 H;  1VQ4 A;  3CC7 A;  2RCN A;  3FP9 A;  4HIO A;  2KCT A;  3KDF B;  3VDY A;  4NXN Q;  1NTG A;  3B6Y A;  3I56 A;  1E3P A;  2DUD A;  5IP7 H;  2WB1 G;  4A3M H;  2EIF A;  2VUM G;  2D0P A;  2PQA B;  2YYZ A;  3AYH B;  2IY5 B;  2I5L X;  3OTO L;  2BA1 A;  4AYB E;  1WYD A;  1X56 A;  1YHQ A;  3I4M H;  4TVA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...