1XMQL

Crystal structure of t6a37-asllysuuu aaa-mrna bound to the decoding center
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16s ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xmqL00
2PQAA 4ME3A 4A3IG 4DAMA 4HJAA 1B70B 4R4CA 3GTKH 4A3MH 2XTIA 2UXCQ 4KLKA 1EFWA 3BZKA 4OX9L 3RLFA 2UUBQ 1K8AC 1BBWA 3J81i 5IY0A 1HH2P 3FHWA 2K5VA 2UUCL 3STBD 3H3VI 4A3JG 2AWNA 3H0GH 4DV4Q 1M1KC 1BVSA 4BBRH 4HIMA 3I4MG 2EQSA 3F1ZA 1IZ6A 5FLMG 1JJ2A 1HZCA 1G51A 1B8AA 3LGJA 4DK6C 3S2HH 4JI8Q 4DV6Q 4DR2L 1QVCA 1I94L 1PH7A 4OONA 1OTCA 1C0AA 1OXVA 4POGA 3A0JA 2JA6H 1LTLA 4DNIA 3M4OH 1KIXA 2MNAA 1RL2A 2QEXA 4DR3L 2UUAQ 4DV2Q 3NEMA 4JI1Q 4LF7L 2JA8H 1HNZQ 2UXDL 4UP7A 4NB3A 1XNQL 2ZM6Q 1YNXA 3PV0A 5ELNA 2UXCL 1VQCA 4DKAC 4A3BG 3EIVA 4JCVE 2UUBL 2R7ZH 4OXPA 4DR4Q 4LF4L 1HZBA 2UXBQ 4JI4Q 4IO9A 2N78A 2YTXA 4DV1L 3H3VH 4APVA 1X56A 2QA4A 4DV4L 1PH5A 1PYSB 4LUVA 3UE0A 2OQKA 3OTOQ 1SN8A 1IL2A 3DM3A 5DLQE 3UDXA 4BXXG 3J81c 4JI8L 1EIFA 4DV6L 4LFAQ 1Z47A 4AIMA 4DR5Q 2WFWA 4AQYQ 1AE2A 3HOWH 4IFDI 1JT8A 1VQDA 2AHOB 3L7ZC 3TREA 2IY5B 1S40A 3PUZA 3J7ZC 1YEZA 2HIXA 1HZ9A 2Y0SG 5IYCH 4K0KL 2VUMH 2UUAL 1UE1A 1GO3E 2IT1A 4DV2L 4JI1L 1FJGQ 3CMEA 1XMQQ 1HNZL 3K7UC 2VZAA 5JEAJ 2ZM6L 4P71A 4DUYQ 1W2BA 4C2MH 1Q86C 3TS2A 4A3GH 1PH2A 4JV5Q 1X9NA 3CMAA 3PUVA 1IBLQ 3K81C 4JI6Q 4DR4L 2V1CC 4OWWB 2C35B 4QY7A 1VQMA 1EQRA 4JI4L 2UXBL 2IX1A 3GDEA 2Q2HA 4GOPB 1Y14B 3I2ZA 3ULPA 3S2DH 2YU9H 2OCEA 4B3SQ 1KQSA 2WP8J 2KCTA 2RHSB 5IYBH 3OTOL 4GNXB 3T1YQ 4YWLA 4LF6Q 4UY8C 4LF8Q 3BJUA 4A4IA 4BY7H 1BBUA 1XPUA 1VQNA 1S3OA 2BA1A 4IJHA 1SLJA 4TVAB 2YV5A 4DR5L 2HIVA 4AQYL 4LFAL 4JI0Q 3RN2A 4R4QA 2MFIA 2R7DA 3U4ZA 4A3DG 3BZCA 1Q1EA 3S24A 5LMNQ 3AQQA 2Z0SA 1YI2A 4JI2Q 4EQ5A 3CCQA 3J80i 1XMQL 4JI3L 1HJPA 5IP9H 1A62A 5IWAQ 1Y1VG 4DUYL 4A3CH 2B63G 4YWKA 5GROA 3PIOA 4JV5L 1X3GA 1PH1A 1IBLL 3WWVA 4JI6L 3NBHB 1SMXA 4PMWA 4IOCA 4H02A 4LWCA 2ID0A 1A8VA 1E1OA 1WCMH 4L5SA 3PUYA 1X65A 4P74A 4B3SL 4MNOA 1TWHH 1K9MC 1SR3A 2N49A 1NE3A 1TWGH 4P73A 4POFA 1TWCH 2Q2TA 3I4NG 2R92H 3FKIH 1K8GA 4GS3A 1WI5A 3T1YL 2EXDA 1L1OC 4LF6L 2JEAI 4LF8L 1OXUA 3PO2G 2K50A 3M4QA 1OXXK 1PH4A 1YJNA 1K3RA 3S17H 1UWVA 4WJ3M 1Y1WG 4JI0L 1KRSA 3CC7A 1N33Q 2JA7G 4XIGS 2HQLA 3ULLA 1WYDA 3E9HA 1HR0Q 2YTYA 5LMNL 2CQOA 1X3FA 4OWTB 5ELOA 5C0XG 4JI2L 1B7YB 1PA6A 5IWAL 3GTLH 4HJ5A 1YHAA 3KF8B 1VQ8A 4HIOA 3AYHB 3CP0A 2VS1A 4EX5A 2JK8A 4GKJQ 4X62Q 3M85A 4BBSH 1G6PA 3K8AA 1E1TA 1VCIA 2ZTDA 4TQUS 4X65Q 3H15A 4IFDG 1K0RA 2E2IH 3J80c 5IP7H 3GO5A 5M3FH 2PI2E 4AYBE 5C44H 4JG2A 4A93H 2PNHA 5C4XG 4DUZQ 4AH6A 3M9BA 1VQ5A 2PI2A 2E2JH 1TWFH 2GVAA 3G71A 1N33L 1LUZA 1OXSC 4AYBG 3G4SA 1HR0L 3HKZG 1VQFA 3HOZH 1PH8A 3HKSA 2GN5A 3UDFA 1N32Q 1L1OA 2R93G 1VQOA 1UEBA 1NMGA 4X62L 4OO1I 5AJ3Q 2CWAA 3CQZH 3S1MH 4X65L 2LXJA 3RZDH 1SFOH 4DV0Q 1EWIA 3G48A 4IPDA 1P16A 4UPAA 5J3BA 4X66Q 4LF5Q 2IX0A 5M5XH 2BH2A 1NMFA 4GLXA 2ASBA 4YCWA 1I50H 4LUZA 5IYDH 1Q8KA 1NY4A 4L5RC 4LFBQ 1A63A 2OWOA 1PVOA 3HOXG 4GOPC 2HT1A 3KJOA 5C3EH 4DUZL 4A3LH 2BH8A 3HFZB 1G291 3RR5A 4YCUA 3HOYG 2NVYH 1PV4A 3CPWA 1AE3A 4GNXC 1ASZA 2Q2IA 3OW2A 2Y0SE 1CUKA 4PZ6A 3JAMi 5GADC 2Z6KC 1QVFA 1FVIA 5E7NA 3CCSA 1QZGA 2F52A 4IPGA 3STBC 4A3MG 1YBYA 1VQ6A 1OXTA 4JC0A 1EIYB 3HOVH 2YYZA 4FDBA 1N32L 3RN5A 5GAHC 1XNRQ 2JEBI 1KRTA 4JBWA 1CKMA 2D0OA 3T1HQ 1GKHA 5BR8Q 3H0GG 4DV0L 3AEVA 3TQYA 4RMFA 4X66L 4BBRG 5M3MH 4UP8A 1XPOA 2K4KA 4BY1H 4DV3Q 4LF5L 5JJKA 2K5HA 3CCUA 5JJLA 1YJWA 4LFBL 2KCMA 1L0WA 1PH6A 3M3YH 1YHBA 4YHHQ 2JA9A 1YIJA 1S72A 1MJEA 4A3EH 4L5TA 2JA6G 3TRZA 4LFCQ 1I3QH 4BA1I 1O7IA 2DUDA 1JB7A 3KFUA 1JJCB 2JA8G 3PO3H 3E0EA 5FJ8H 4GKKQ 2JA5H 1CKNB 1KC8C 1N34Q 4GLAC 4GOPA 2R7ZG 4DR1Q 1UE5A 2JQOA 1PH3A 2LXKA 4QL5A 1XNRL 3JAMc 4O2DA 2I5LX 2I0QA 4L5QA 3W1BA 3CCVA 3T1HL 5BR8L 4C3IH 3PIPA 1K83H 4GNXA 1FJGL 4X6AH 3W5OA 3SGIA 1VQLA 5M5YH 1HNXQ 1XMOQ 2MO1A 4DV3L 2Z6KA 1FGUA 4PZ7A 1KL9A 4A3FH 4NPSA 4A3KH 1MKHA 2HHHQ 2E8GA 1C9OA 4YHHL 2E2HH 1YITA 3HOWG 3CCJA 1C7YA 1VQ9A 2E5LQ 4LNQA 1Z9FA 1KD1C 3KDFA 4DAYB 3S1QH 4JOIC 4OO1G 2JJQA 5IYCG 2MQHA 4A3IH 4LFCL 4GN3B 3RLNA 1VQ7A 2VUMG 1HNWQ 3K7AH 4DR6Q 1VQIA 3GD7A 1PH9A 3CCLA 2K5NA 4R4OA 2VNUD 2VW9A 2NZHA 4GKKL 3UE1A 1E3PA 1U5KA 1SROA 1V1QA 1W3SA 2I5MX 2K52A 1VQ4A 2A1AA 1N34L 4A3GG 1QUQB 4A3JH 4DR1L 3CXCA 1Q12A 4PG3A 3AFQA 5HY6A 3I4MH 5FLMH 3KF6B 1VQPA 4NXNQ 4JYAQ 2CFMA 3RLOA 4B3MQ 3CCMA 3J7A5 3KYHC 1GM5A 1L2FA 1HNXL 1XMOL 1R9TH 3EN2A 2KHJA 3I4OA 4PZ8A 5IYBG 3F2CA 3NELA 2L15A 4IPHA 4Y7NH 3PO3G 4BY7G 2HHHL 1K73C 2NVQH 3ER0A 1PHJA 1NTGA 2D62A 2K75A 4JBMA 2E5LL 2WB1G 1UE7A 3PF5A 4MZ9A 1AH9A 1HNWL 3GTMH 3HKZE 1H95A 4DR6L 4A3BH 3CC2A 4IJLA 3NENA 2PQAB 1MJCA 5IP9G 3CCRA 1XPRA 3ICEA 4UP9A 5FLXc 1E22A 4A3CG 1LYLA 1CKOA 1M90C 4QGUA 4KHPQ 3CC4A 3U50C 5GAGC 2YTVA 4X64Q 1FL0A 3PCOB 2B3GA 1WCMG 4C3JH 1V9PA 2F3IA 4JOIA 4NXNL 4JYAL 2D0PA 1Q81C 1QZHA 1YVCA 1KHIA 2BA0A 4BXXH 3AFPA 3K80C 1GD7A 1U0LA 2R92G 3S14H 3FKIG 4GKJL 3GTPH 2AWOA 4OWXB 2KBNA 2CWPA 5IT9c 4LF4Q 1PYBA 2FXQA 4DV1Q 5C0XJ 2WAQE 1L1OB 1JE5A 4HIDA 1IBKQ 3BU2A 2Q2UA 2IHFA 3MXNB 4XTCS 2ES2A 4HIKA 2UU9Q 3S1NH 3S16H 2B29A 3IRBA 1N36Q 1Q7YC 5JEAG 3F2BA 2CKZB 2WAQG 2QGQA 1CSPA 1ASYA 4IFDJ 3RNUA 1EUJA 2OTLA 1VQHA 4BBSG 4KHPL 4Y52H 4R4IA 2ZTEA 4RG1A 4X64L 4GN4B 4B3TQ 3PUXA 5GAEC 4K0KQ 2NN6I 3OYYA 2XGTA 2I5HA 1MIUA 1TXYA 5IP7G 3I55A 1EOVA 5M3FG 4B3RQ 4YWMA 4HJ7A 2K14A 3MEFA 3GTQH 3UDIA 5C44G 4A93G 2VL6A 3B6YA 5LMUQ 4DK3C 1XJVA 3ULJA 1D7QA 1HZAA 5AJ3L 4JI5Q 1BKBA 2OTJA 5LMNW 4C3HH 3U58A 4A3DH 1DGSA 3CF5A 1JJGA 3PUWA 3W1GA 2RHQB 3J81j 4A76A 2AKWB 1V43A 5C0XI 4HJ9A 1XTDA 1PFSA 2GVBA 5HGQA 1VS0A 3S1RH 1IBKL 1Y1VH 2PMZE 4J15A 1X55A 4QJFA 2LSSA 3G6EA 2B63H 1UE6A 3HOZG 2JE6I 2UU9L 3GTJH 2R7FA 1N36L 1VQEA 1E7ZA 2OQ0A 2RF4A 1RIPA 3GTGH 1KAWA 1VQGA 2RCNA 3PF4A 4NXMQ 2NVTH 5JJIA 4YY3Q 4KHZA 3CW2C 1NBWA 3CD6A 2IHEA 2R6GA 4R4TA 2ZJRA 4B3TL 1IXRA 1Q1BA 5C4JH 3I4NH 1I5FA 3D0FA 2CCZA 1KXLA 4P72A 3L0OA 3F2DA 1IBMQ 4JI3Q 3PO2H 5IYDG 2MO0A 4DR7Q 4B3RL 1X54A 1WOCA 4KI0A 5LMUL 2KENA 1Y1WH 1HR0W 3CPFA 4IPCA 2VY3A 4JI5L 5C3EG 4HJ8A 3ZJYC 3CAMA 2JA7H 4JBJA 4A3LG 4WJ4A 4IOAA 5GQOA 1VQJA 1X6OA 2NZOA 3VDYA 4GLVB 2KHIA 2N8NA 3KOJA 4JI7Q 4BA2I 4LUOA 3TEHB 1CKNA 1J6QA 1P8LA 1EQQA 1I6HH 3F8TA 3U4VA 3FP9A 4DV5Q 3HOUH 4MTNA 3A5ZB 4P75A 2ZTCA 1E24A 3KLWA 1LM0A 3HOVG 1JMCA 4NXML 3GTOH 1N8RC 4YY3L 1TWAH 4ALPA 3TS0A 1YHQA 4QQBX 2H5XA 4YCVA 3RZOH 2A19A 3L2PA 4O0AA 1YJ9A 4BY1G 5M3MG 3I56A 3KDFB 4LF9Q 1XNQQ 3E9IA 5C4XH 3CCEA 1IBML 1VQAA 2N3SA 4QIWE 2VQEQ 4DR7L 3A74A 4JBKA 4DV7Q 3I7FA 1YZ6A 1J5EQ 2ZJPA 2VQFQ 1EYGA 5EAYA 1N9WA 1VQBA 3PSIA 2F4VQ 3JC66 3K0XA 4A3EG 1NJIC 2WB1E 4JI7L 1QVGA 1SE8A 2A8VA 2NN6G 3PGZA 3EBEA 4OX9Q 3DLLA 1Q46A 1QUQA 2DGYA 3D31A 5H1SE 4DV5L 5FJ8G 2R93H 2JA5G 2UUCQ 3KF6A 3M4PA 1WJJA 1D8LA 3A5UA 3UDGA 1Q82C 2NVXH 3Q8DA 4LW1A 5IE8A 3KJPA 2ZJQA 2ALYB 4A75A 3S15H 1CSQA 4R1JA 3HOXH 4DR2Q 4LF9L 1I94Q 2EIFA 2VQEL 4GN5A 4A3FG 1T9HA 3HOYH 1X3EA 4DV7L 3HOUG 3M7NA 2AMCB 4DPGA 4A3KG 1WFQA 1J5EL 2ATWA 3ERSX 1SRUA 2VQFL 4DR3Q 1GVPA 1VQKA 2F4VL 4B3ML 1A0IA 5M5WH 4LF7Q 2UXDQ 5K36G 1IYJB
chains in the Genus database with same CATH superfamily
2PQAA 1ESRA 1RDPD 1B70B 1EEFD 2UXCQ 4KLKA 1E2VA 5C3XA 1BCPB 3J81i 1F2ZA 4ODGA 2AWNA 3H0GH 1UUPA 1BVSA 5FLMG 3T4AC 4FF4A 3S2HH 3LGJA 4DK6C 4DR2L 4YIJA 3MEHA 1QVCA 3I3CA 4TKOB 1GHKA 1PH7A 1AEXA 3A0JA 2WV6D 1KIXA 1RL2A 1DOKA 4LF7L 2UXDL 4UP7A 2CQAA 4I65A 4KV6A 1WVLA 2EY5A 1YNXA 1GUSA 4A3MB 4DKAC 4JCVE 1EZ8A 2UUBL 2R7ZH 2F0EA 1CA5A 4JI4Q 2N78A 2YTXA 3H3VH 3M4YA 3MTSA 3SK5A 1SXTA 4DV4L 1PH5A 2F0FA 4OL7A 3KLSA 4C3JG 4DNRB 3UDXA 4DV6L 1Z47A 4DR5Q 4RAUC 1AE2A 1H9SB 1EIGA 5JPMC 2AHOB 3TREA 1S40A 3PUZA 2HIXA 3M4OB 2IT1A 3NSWA 5IIFA 4DV2L 1O7LA 1HNZL 1SBBB 3HZXA 1LTRD 3I8ZA 1BCPD 1W2BA 2O2LD 3PUVA 4JI6Q 4DR4L 1VQMA 2UXBL 1EQRA 4J6HA 2IX1A 4GOPB 2B39A 2YU9H 2C5CA 4K14A 2NWGA 3O13A 4LF6Q 1XWEA 1I4QA 2QCPX 1S3OA 2BA1A 4IJHA 4AQYL 2YV5A 1CHPD 4JI0Q 3HOWB 1HTLD 1D2BA 3RN2A 2R7DA 1I4PA 3BZCA 2J7ZA 2VUMB 2Z0SA 2L55A 4JI2Q 4ID6A 1CFMA 1A62A 5IWAQ 1STHA 2V4DA 2KQ3A 3D3RA 4YWKA 1SJHD 4JV5L 1X3GA 2LS01 1PH1A 3WWVA 4H02A 3TP6A 1EY7A 1E1OA 2PO4A 5E3FA 4MNOA 3SE0A 3S2DB 1BCPF 1NE3A 2Q2TA 4H7BA 1VDZA 2R92H 3BDOA 1K8GA 3PO2G 1YJNA 1UEAB 3ND8A 1UWVA 3CC7A 3OWFA 1B50A 2B2YA 3E9HA 2YTYA 2HDMA 2CQOA 4OWTB 2A74C 1E0BA 5JEAH 3KF8B 2XNAC 4HIOA 4GKJQ 1S5ED 2KCNA 4BBSH 3K8AA 2ZTDA 2BE5C 4TQUS 1SEBD 2H4OA 3J80c 1EWCA 5M3FH 2PI2E 2KEDA 1TWGB 1J8IA 4DF7A 4A93H 1TS5A 3FKIB 1RODA 2X69A 1D1KA 5COYA 3M9BA 5IGGA 1AN8A 3G71A 1LTID 3AMUA 1OXSC 4G4KA 3U9SA 1PH8A 1A3VA 4UDUC 3G7LA 1N32Q 1L1OA 4RA8A 1UEBA 4X62L 5AJ3Q 3CQZH 3S1MH 4X65L 3RZDH 4DV0Q 2EE1A 4IPDA 2AQ3B 4X66Q 2E2IB 4YCWA 1I50H 4LUZA 5IYDH 2BDNA 3H3VC 2HT1A 3E5SA 3KJOA 1KDBA 4DUZL 1U4RA 1G291 3RR5A 1QJOA 5KIXA 1TU2B 3HOYG 3L3OC 1PV4A 5J1ZA 2E2JB 4GNXC 1ASZA 1HUMA 2QF7A 2Q2IA 4MTKA 2Y0SE 1LACA 5EBCA 1WTWA 5GADC 1QVFA 3HOZB 3URYA 1R4PB 2F52A 4IPGA 2KVMA 3STBC 4JC0A 4FDBA 3GV3A 3PQIA 1XNRQ 1CKMA 1AFPA 1XXGA 4F88A 2PMZB 3H0GG 1SFOB 3AEVA 3TQYA 4BY1H 5M5XB 2K5HA 4LAAA 3CCUA 4LFBL 2KCMA 1L0WA 1EY9A 1YHBA 4RH6A 4YHHQ 5C3EB 2QKIC 1YIJA 1TVXA 2K6AA 1STEA 1B3QA 4CJ2C 4LFCQ 2NYZD 1B2TA 2F0PA 2DUDA 1BOSA 3PO3H 3E0EA 2A5HA 2WKCA 4M8AA 1N34Q 2R7ZG 2JQOA 4QL5A 3SEBA 3J80E 4TRDA 3W1BA 3CCVA 3T1HL 1EEID 1GHJA 4RGMA 4X6AH 3W5OA 1STNA 3A55A 1XMOQ 4H0LC 4FXGC 2O5IC 2QDBA 1IYVA 5LL6X 1MGSA 5DM63 1MKHA 1C9OA 2F0MA 4FO2A 1YITA 4LNQA 1STYA 4A3EB 1JOOA 4DAYB 1RJTA 3S1QH 2JJQA 1SAPA 2B2UA 1LT5D 1A2UA 3GD7A 3MZ5A 1WD1A 4R4OA 4GKKL 3QWNA 1G8ZD 1U5KA 1SROA 1VQ4A 1QUQB 3CXCA 3AFQA 3HRZC 1SYCA 1NR2A 4B3MQ 3KYHC 3OMCA 1V8QA 5M5YB 2FINB 4B08A 5I9PA 2ZXOA 3DMUA 3ITPA 2HHHL 4JBMA 2E2HB 2Z1CA 2WB1G 3J81E 1AH9A 4A3IB 3GTMH 1WTHA 4DR6L 2PQAB 1MJCA 1XPRA 3NPPA 5HGTA 4CHTB 1BR9A 4F7XA 1HQMC 1TR5A 3I4MB 2B2WA 4C1NI 1KHIA 1Y69U 1ENFA 3W3AA 1GD7A 1U0LA 2R92G 2FHTA 3GTPH 5JVG3 1PYBA 2FXQA 5C6AA 5JPNC 1JE5A 1GJXA 2Q2UA 4IUTA 2IHFA 4XTCS 1KNEA 3R93A 2CHBD 3S16H 1N36Q 4XQQA 5JEAG 2I07B 2CKZB 2TMPA 3AU7A 4Q0FA 2WAQG 5D3IB 1CSPA 1KDCA 5AFWA 3RNUA 1EUJA 4BBSG 4KHPL 2PQEA 4B3TQ 1YNJC 4GN4B 3D6WA 1TXYA 5M3FG 1W6KA 3CKIB 4YWMA 2K14A 3MEFA 3GTQH 4A93G 4HCEA 4DK3C 2EJMA 1BKBA 5I4DA 1QG7A 1MSHA 1HA6A 2B2UC 4ME5A 4A3DH 3PUWA 1B3AA 2AKWB 1V43A 1L0XB 2GVBA 1PFSA 5CGKA 1IBKL 1Y1VH 2PMZE 1Y8OB 2B63H 1UE6A 3ERQA 1UAPA 3S1NB 5KEEA 3DWPA 3GTJH 1AP0A 2EYFA 1RIPA 1KAWA 2B2VA 3QR8A 4NXMQ 1BXTA 3P75A 4KHZA 3SK6A 1NBWA 2IHEA 3NE5B 4CDEC 1Q1BA 1I5FA 2ICEC 2CCZA 4V0BA 4IURA 5IYDG 4B3RL 4WJWA 1SYDA 1CQVA 1WOCA 4O42A 2AUKA 4IPCA 4KMUC 2VY3A 3ZJYC 3CAMA 2L11A 3QG1A 1IL8A 1B44D 3MHBA 4BA2I 1CKNA 1M4VA 1P8LA 1EQQA 4Q5VA 3U4VA 3FP9A 4DV5Q 2EYOA 3HOUH 1QOHA 2WACA 3GTGB 1G2TA 3H94A 1II3A 3DWQA 4R9WA 1N8RC 3GTOH 4IFDH 2NVTB 3C46A 4BY1G 4LF9Q 4CDDC 2JSOA 1ENAA 1VQAA 4DR7L 3A74A 5LHY1 3D8GA 4DV7Q 1EU4A 1Y1WB 1EYGA 2JA7B 4G7HC 1NJIC 2XIWA 1S5FD 4JI7L 1S5DD 5NUCA 1H9JA 1I6HB 1Q46A 3D31A 1SMYC 1JC7A 2R93H 5T1GA 4JK1C 4LK1C 5BN4A 3GV6A 4LW1A 1Q82C 2ALYB 3W2DA 2DJFC 1TWAB 3S15H 1CSQA 3OW7A 4S3SA 2OEOA 2BCOA 3HOXH 2FFKB 1SE3A 4UHVA 5EPKA 1T9HA 1X3EA 3M7NA 1LTSD 4M1UB 4CGYB 4DR3Q 4K5XA 2F4VL 4IUNA 5M5WH 3X3NA 4AYBB 1XNQQ 5KYLA 4OIKA 3GTKH 1TS2A 3ONAB 1SNMA 2XTIA 1QILA 3BZKA 1YNNC 1F2YA 3RLFA 4P2CB 4OX9L 1HH2P 2UUCL 3STBD 1WTXA 1NUCA 4BBRH 1T5EA 2EQSA 1PRTC 5EGTA 2F0UA 3TBIB 4QB4A 2D5DA 1OTCA 3K5OA 3NQTA 4XT3B 1LTLA 4DNIA 2JA6H 1M8AA 2RDGA 2EYJA 2UUAQ 3T51B 2SDFA 5E4XA 3OMGA 4G7OC 4JI1Q 2JA8H 3VA5A 3V2TA 5IGEA 1PMRA 2ZM6Q 1ZEQX 3PV0A 1SNDA 1VQCA 2RSNA 4OXPA 3F2UA 4IO9A 1KTKA 1DOLA 2F0WA 5C4HA 1EL0A 3Q6SA 1PYSB 2F0GA 1EFID 2OQKA 3HS0C 3OHXC 4JI8L 2K5QA 4OELB 1EY8A 4IFDI 5EPLA 1CK1A 1PZJD 3J7ZC 4K0KL 4EQOA 1HZ9A 2Y0SG 2KJXA 3NBIA 4RKLA 2G5DA 1XMQQ 3K7UC 2VZAA 4P71A 4DUYQ 1Q86C 2RDHA 3LNNA 1IBLQ 4OGQC 2C35B 2Q2HA 1Y14B 4B3SQ 5FLXE 1KQSA 2WP8J 2RHSB 3OTOL 1IW7D 3T1YQ 4YWLA 2B8FA 1BBUA 1F77A 4UAIA 1OO9B 5ISRA 4LFAL 3J81L 3VYRA 2HIVA 1FNVA 1NR4A 2MFIA 4LJZC 3U4ZA 4A3DG 2A69C 2RKSA 1YI2A 3AQQA 3T53B 4EQ5A 3J80i 1HJPA 4X3KA 5IP9H 1Y1VG 5IT9E 5J39A 4A3CH 2B63G 5GROA 4C2MB 4A3GB 5HURA 2K03A 5I9OA 4IOCA 4LWCA 2ID0A 3PUYA 4P74A 4FNFA 1SR3A 4P73A 1TWCH 2RA4A 4QIWB 4GS3A 2EXDA 4FP5D 2EPBA 4HN7A 4LF8L 1OXUA 4BY7B 3A56A 1PH4A 1C4QA 3S17H 1PXUA 4CJ1B 1N33Q 4XIGS 2HQLA 5LMNL 1ESFA 1X3FA 2L9HA 4K5VA 2SOBA 1NSNS 3MXPA 3GTLH 4HJ5A 1VQ8A 3CP0A 2JK8A 3A7LA 4N8FA 3I72A 1VCIA 4RKBA 1J9OA 3H15A 3HKZB 4IFDG 1K0RA 1WCMB 2ICIA 3GO5A 4KJOA 1TWHB 3EROA 1CQFA 1YNJD 4AYBE 5C44H 4IUPA 1S5CD 4RGOS 2QW7A 3NTKA 4IZ8A 1TWFH 5TSSA 1LUZA 3HG9A 5A2QE 1HR0L 1HCZA 5JJZA 3A8IE 1LO5D 5K5PA 2R93G 2LXJA 5D3DA 1EWIA 1X3PA 2CVRA 3HGBA 1S5BD 1NMFA 1Q8KA 4U68A 1NY4A 4XYQA 1RF2D 4KY5A 2K7VA 1PVOA 3HOXG 2D9UA 4XYOA 1QB5D 1WD0A 2BH8A 2XSCA 3P20A 3NTHA 3FVQA 4YCUA 2NVYH 3CPWA 4FF1A 2CW0C 2MPMA 3VYSA 4N8X1 1VF7A 2Z6KC 1F2MA 1FVIA 5E7NA 3CCSA 1L0YB 4HTHA 3BZDB 1EY0A 1YBYA 1VQ6A 3HOVH 2YYZA 5GAHC 3K5NA 3FEWX 4HMIA 4JVZA 1D5MC 1ICWA 4RMFA 4BBRG 5M3MH 2NBFA 4LF5L 1XPOA 2K4KA 1TT2A 5JJLA 1F2LA 5F2DA 2IJ0A 4Z9CB 1PRTB 2JA9A 1S72A 4KY6A 4L5TA 3KUPA 1B9NA 3J7YW 2JA6G 1IKMA 4IUQA 2NN6H 3KFUA 2JA8G 2HCIA 5EKIA 1CZWA 5FJ8H 1CKNB 3R3OA 1DD2A 2F0JA 4DR1Q 4EQNA 5KGUA 1PH3A 1GOZA 3JAMc 1PTOH 4O2DA 2I0QA 4XT1B 5BR8L 4GNXA 1K83H 1DZ1A 1VQLA 1TS4A 2MO1A 4DV3L 4CBVA 2PPBC 1KL9A 3I4LA 4I7ZC 4KN7C 4NPSA 4A3FH 3DWAA 4A3KH 3M3YB 5D14A 2E5LQ 1Z9FA 1KD1C 4JOIC 3EVQA 5IGFA 4GN3B 1VQ7A 1HNWQ 5KNDA 3K7AH 1I3QB 3TP7A 1VQIA 2A73B 2RCFA 1BBXC 2HQEA 3CCLA 3NBHA 2X6LA 2VW9A 2JA5B 1E3PA 2A1AA 3TZUA 4A3JH 4PG3A 4X3SA 4NXNQ 1CZGA 4JYAQ 3RLOA 4RGNA 3J7A5 2F0TA 4C3IB 1STGA 1DONA 4K2KA 1HPCA 1HNXL 1R9TH 3EN2A 2KHJA 3I4OA 3K5MA 1A3TA 4IPHA 1K73C 2NVQH 1HTPA 3OPOA 4N9TA 2D2CC 4CDFC 1O78A 3HKZE 1H95A 5M9OA 4A3BH 3CC2A 2K5WA 5IP9G 2P5ZX 4A3CG 1M90C 4X64Q 2NTTA 3QIAA 1V9PA 1Q81C 1Z7TA 4XQJA 3K80C 3C1EA 3S14H 2AWOA 3U9OA 5G3LF 4Y7NB 1GUNA 3BVGA 2SNMA 4F8MA 2L0CA 1O7YA 5C0XJ 5CV8A 1FNWA 5C5MA 2A6HC 5CV4A 3BU2A 4PMCA 3NUCA 1I4XA 1PRTF 2ES2A 4HIKA 5A35A 1E2WA 2F0DA 1CTMA 3IRBA 3F2BA 3FDTA 5FLXL 4Y52H 4ZKBB 3BVZA 4K0KQ 1BO0A 5GAEC 2NN6I 2XGTA 2LFNA 4C3JB 4WFN3 1EOVA 4HJ7A 1RCVD 5C44G 3B6YA 3OIQA 1LT3D 1D7QA 3ULJA 1WTQA 4JI5Q 5LMNW 4ZAIA 4C3HH 5I6WA 1LT4D 3CRLC 1DGSA 3HP3A 4NW2A 2J4XA 5IT9L 3J81j 3DUZA 4A76A 5C0XI 1XTDA 3S1RH 5ELDA 4J15A 2LSSA 4HSPA 1FR3A 2JE6I 2UU9L 1DM0B 1VQEA 3D4WA 2RF4A 2F03A 1JOQA 2C9OA 2KOLA 4BS9A 2HCCA 2ZJRA 1G91A 3I4NH 1KXLA 3F2DA 1B4OA 4R8NA 1HFNA 2Q8TA 2EYPA 1X54A 4KI0A 1PTOC 5LMUL 2J0TD 1HR0W 3CPFA 1JWSD 1JWMD 1B1ZA 4WJ4A 1K8MA 2NTSA 4IOAA 5GQOA 1VQJA 2NZOA 3K58A 4GLVB 2N8NA 1O7ZA 3KOJA 3NWSA 3F8TA 1CM9A 2F4IA 3ZYYX 1A2TA 4J8QA 4MTNA 2EY6A 4MHEA 3KLWA 3HOVG 1JMCA 2PZUA 4YY3L 4QQBX 4YCVA 4OIJA 3RZOH 2E2DC 5C4JB 2WKDA 3NXWA 5M3MG 5JJIA 5C4XH 1IBML 5EKLA 2N3SA 1A3UA 2VQEQ 3J7AV 5IOCA 3PO2B 4DXFA 2CH4W 1J5EQ 4O1NA 3N6RA 5EAYA 3VYUA 3VR3A 1VQBA 3K0XA 3VR5A 1QVGA 2F0SA 3TP5A 4HMJA 2NN6G 3Q0AA 4QMGA 2E74C 5FJ8G 3H91A 1LLRD 1D8LA 3A5UA 4H13C 3Q8DA 4A75A 2LMCB 2PW5A 1JWUD 1SYEA 3Q24A 4DR2Q 4GN5A 4A3FG 1DOMA 4A3KG 4DPGA 2ATWA 2VQFL 3D4DA 1GVPA 1K0SA 4GZYC 1VQKA 4FVMA 4LF7Q 2UXDQ 2G9HD 1H9KA 1QZHA 4ME3A 4DAMA 4HJAA 3IKJA 4A3MH 1DXMA 2UUBQ 1K8AC 3RUZA 1BBWA 4IUUA 5IY0A 3FHWA 2FJ2A 1JCKB 2K5VA 4V190 2RDFA 4A3JG 1F9RA 4DV4Q 2NVXB 4HIMA 3QOLA 3F1ZA 1IZ6A 1HUNA 3NHHA 3TDQA 4DV6Q 5I6YA 1I94L 2B2TC 5ELFA 1F9SA 3HOYB 3M4OH 1MSGA 2QEXA 2RBMA 3MXNA 4DV2Q 5JVH3 1HNZQ 2A6EC 3MVVA 1JB3A 2UXCL 4A3BG 1GUTA 1GUOA 3I90A 4ZUIA 4DR4Q 4LF4L 1HZBA 2UXBQ 3R8BA 5DAUA 2ZXPA 5CR3A 1X56A 4RHRA 4ZUJA 3H0GB 4LUVA 2PZWA 1F9PA 3T16A 1SN8A 3DM3A 3S2HB 3OIPA 4AQYQ 2XRSD 3HOWH 4I7AA 1JT8A 2IY5B 3L7ZC 1YEZA 3QB3A 5IYCH 2VUMH 3CMEA 1A6XA 3TN2A 1BUVT 3BS1A 5CBAE 4JV5Q 2R7ZB 2V1CC 3WOEA 5FOBB 4QY7A 3X3MA 1V1PA 4JI4L 5FKAC 3I2ZA 3ULPA 1MD2D 3S2DH 2OCEA 4CDCC 4EQPA 2KCTA 4GNXB 1U4PA 4RFBA 2QEJC 4DR5L 4C3HG 1EOTA 3UI2A 2BE5D 3S24A 3CCQA 2ZT9C 1SNQA 4G7ZC 4BWGB 3LX0A 2F0OA 4JI6L 3NBHB 4PMWA 1A8VA 2YU9B 1TWGH 2N49A 4WORA 1NAPA 5T1IA 3I4NG 3FKIH 2EYLA 1WI5A 3NQIA 4LF6L 1VF5C 3C2PA 3M4QA 5EKKA 1OXXK 2K04A 3SK4A 4WJ3M 3MWYW 4JI0L 1Q3LA 2WB1B 3ULLA 1WYDA 2F0QA 3ND9A 1IYUA 5ELOA 1WTOA 4JI2L 1B7YB 3E0JA 3K6OA 5IWAL 1PA6A 2IX3A 2E76C 2VS1A 4B9WA 4X62Q 3M85A 1G6PA 3E3XA 1E1TA 4X65Q 2RQXA 5I2XA 3S9WA 2WINB 2E2IH 5FO9B 1SNOA 3RD4A 1H9MA 2R92B 1HA5A 2PNHA 5C4XG 4DUZQ 2KHSA 4AH6A 1VQ5A 2E2JH 1I4HA 2GVAA 3BVMA 4KY7A 3BYYB 3HKZG 3HOZH 2GN5A 4IQZA 3UDFA 1I6VC 4ZRZA 1VQOA 2WAQB 1NMGA 2CWAA 4G57A 4BBSB 5CV5A 5E4WC 1SFOH 1P16A 4UPAA 5M5XH 3CU7A 1XX8A 2BH2A 3G6JB 2ASBA 4XXEA 1SDFA 3J80L 5M3FB 3MA2B 4LFBQ 4A93B 4GOPC 5IODA 5C3EH 3EFXD 4A3LH 3I70A 3WDNA 4FXKC 4QUFA 3OW2A 1TKWB 2AQ2B 2R61A 3JAMi 2KUMA 1BQQT 1ILQA 2Z4HA 5EQ0A 4A3MG 3VR2A 2K1BA 3I73A 1N32L 1EIYB 4QF4A 3RN5A 4FYDA 1SYGA 2JEBI 1EQVA 4JBWA 2D0OA 2L5TA 2FMMA 3CQZB 3T1HQ 3S1MB 4DV0L 3RZDB 2L4NA 1ZXTA 4OEMB 4X66L 5CV6A 1I50B 1T5XD 1ONLA 1PH6A 2XRQD 2BOSA 1MJEA 4A3EH 3TRZA 4KD3A 1FYCA 2K01A 1JB7A 4TSSA 1JJCB 2Z8LA 4GKKQ 1PZKD 3K59A 4EGVA 1PTOF 1UE5A 1XNRL 4N9PA 4L8JA 2I5LX 4L5QA 3R2IA 3PIPA 1FJGL 4XQNA 3SGIA 2XN9C 5M5YH 4BY1B 3EJIA 1G2SA 2HD3A 1FGUA 2Z6KA 2L1BA 2HHHQ 5KNBA 2E8GA 1PFNA 1RTOA 1TQOA 4YHHL 2E2HH 3HOWG 3CCJA 1C7YA 1VQ9A 1PLFA 3IFDA 5K36H 5IYCG 2MQHA 4A3IH 4LFCL 3RLNA 2VUMG 4DR6Q 4HSVA 1PH9A 3PO3B 3LWEA 2VNUD 4PV1C 4CKBA 1QCBD 1V1QA 2MUYA 2K52A 2NB0A 1WTVA 1N34L 2NZ1D 1RD9D 1Q12A 1GXDC 2EJFC 3BG3A 1ILPA 3I4MH 1VQPA 1EIHA 3H09A 1GM5A 3NWTA 5C3WA 5KYIA 3A8JE 1XMOL 4PZ8A 1NNXA 1QNUA 2NUCA 1VMCA 5JAVA 1WTRA 1PHJA 2D62A 2F0IA 4IN3A 1CA6A 1UNSA 3S1QB 3DM1A 1B9MA 4MIUA 1SNPA 4IJLA 3NENA 1ZKOA 1O80A 2MGSA 4UP9A 1D5ZC 2K05A 2SEBD 4QGUA 4KHPQ 3CC4A 5GAGC 2F0HA 1FL0A 1H9RA 2DNEA 3PCOB 2F3IA 2JN4A 4JOIA 5KNCA 1YVCA 5DEHA 4BXXH 4PQXA 1BDOA 2L12A 3FKIG 1EYCA 5IGCA 4C1NK 1G6ZA 4OWXB 2KBNA 2CWPA 3RMHA 4DAVA 4LF4Q 1ZYRC 4RCOA 1U4MA 1EWHA 2WAQE 1HHVA 2RSOA 4HIDA 1IBKQ 1S4ZA 3KK7A 1I4RA 3MXNB 3GTMB 3S1NH 2O4XA 1JICA 3A8KE 1Q7YC 4ZKCB 4XDXA 2QGQA 1HRJA 1VQHA 2DJGC 4R4IA 3OYYA 2I5HA 3I55A 4WRDA 4B3RQ 4L63B 3UDIA 3MXGA 2Z4IA 3GTPB 3MXUA 2OTJA 4KJNA 3NK9A 3CF5A 2R3ZA 1JJGA 2Y0SB 5D65A 2RHQB 5ELBA 4E6IA 3A54A 4DGZA 4QJFA 3G6EA 3HOZG 3J7AF 3QOJA 3S16B 4PNYA 1N36L 1E7ZA 2OQ0A 2EYHA 3GTGH 1D1IA 2TSSA 1VQGA 2RCNA 2NVTH 3SR1A 5KRUA 3K0YA 4J1MA 3T13A 1LT6D 2R6GA 4R4TA 4B3TL 1IXRA 1V1PB 3TSSA 2F1MA 1MBYA 2F0KA 2A68C 2DY8A 4DK1A 4U673 4P72A 3L0OA 2K32A 4K2LA 4NKLA 1F9QA 4DR7Q 3GTQB 4OHJA 1SMYD 1Y1WH 2JA7H 2IW3A 5C3EG 4HJ8A 4A3LG 3SVMA 4JBJA 4A3DB 3BDCA 3MFYA 1JQYD 3PMFA 4JI7Q 1X6OA 5C0XH 1J6QA 3WOFA 1I6HH 1Y1VB 2WIIB 1Z6HA 4KN4C 4ILWA 2B63B 3N52A 4FF3A 4P75A 3GTJB 1E24A 4DA2A 4NXML 2ZXRA 4DK0A 1TWAH 3TS0A 2H5XA 4O0AA 3I56A 5CBEE 3KDFB 2QILA 3CCEA 4QIWE 1EY5A 1YNND 1LTTD 3P7JA 3I7FA 5G3LD 4NMZA 1N9WA 2K5DA 2F4VQ 3JC66 4A3EG 2F0NA 3E6ZX 2F0VA 2OXPA 1STBA 1ML0D 1HXYD 2XWJB 1EYAA 2A8VA 1PRTD 4ZK9B 1X3QA 4OX9Q 3DLLA 5H1SE 4DV5L 3HOUB 4JPBW 2UUCQ 1KDAA 3SK8A 3KF6A 4DFAA 4LMQD 3UDGA 5IGDA 1LTAD 2EVBA 3GTOB 3KJPA 1WTPA 1KLGD 4HEDA 1E2ZA 1CI3M 4R1JA 4CJ0B 4LF9L 2EIFA 2LKVA 1IKLA 3VYTA 4DV7L 2AMCB 5I2YA 1SRUA 3NP8A 3TMEA 5C5LA 5K36G 1IYJB 4HR7B 4A3IG 4R4CA 2IL8A 4EVOA 1EFWA 1Q8IA 2R93B 3H3VI 1EU3A 2HDLA 1M1KC 3I4MG 1JJ2A 3S15B 1HZCA 1G51A 2JYOA 3GQBA 4K6DA 1B8AA 4JI8Q 4KKSA 3HOXB 3JAME 4OONA 1C0AA 3OOCA 1OXVA 4POGA 5FO7B 3IL8A 2MNAA 4DR3L 3PIP3 3NEMA 5M5WB 3K5LA 4NB3A 1XNQL 3V05A 5EJWA 3GTKB 5ELNA 3DEPA 5DNFA 3EIVA 3FPPA 2K33A 4DV1L 4APVA 4IALA 2QA4A 4NDXA 5FO8B 1BNZA 1CHQD 3UE0A 4BBRB 2A69D 3OTOQ 1IL2A 1R4QB 2K28A 5DLQE 4BXXG 3J81c 1EIFA 3T56B 4LFAQ 4AIMA 2WFWA 3BYTB 5CYUA 1VQDA 4OO1H 2JA6B 3L9AX 1UE1A 1EQTA 1GO3E 2UUAL 4JI1L 2BDOA 1FJGQ 2JA8B 5JEAJ 2ZM6L 1QE6A 4C2MH 3TS2A 4A3GH 1PH2A 1A15A 3CMAA 1X9NA 3K81C 4KKUA 5IGBA 4OWWB 2B2TA 2B2YC 1SNCA 1VMPA 3A7AB 3GDEA 5EBDA 1DYQA 3SDZA 5CORA 5IYBH 4UY8C 4LF8Q 3BJUA 4A4IA 4BY7H 1XPUA 1VQNA 1AW7A 1SLJA 4TVAB 2VB3X 1DCZA 4R4QA 1V1OA 1Q1EA 5LMNQ 4F87A 1XMQL 4JI3L 2JXMB 2F3WA 4DUYL 5A2QL 3PIOA 3V96A 1TIID 3OSOA 1IBLL 1SMXA 5DM73 1WCMH 4L5SA 1X65A 4B3SL 1TWHH 3IFTA 1K9MC 2SNSA 4POFA 3FRPB 3T1YL 1L1OC 2JEAI 1EY6A 2PW7A 2K50A 3KLRA 1K3RA 4H44C 1Y1WG 1KRSA 2JA7G 1HR0Q 2OT2A 1ZYRD 1IW7C 5C0XG 1MI2A 1XTCD 4KKTA 2HUGA 1YHAA 2VXWA 5C4ZA 2H1EA 3AYHB 4EX5A 4JW0A 5L37A 1RTNA 1ENCA 3C3LA 3QO2A 4KK7A 1B53A 5IP7H 5LL6S 2CW0D 3VR6A 1XYIA 1TWCB 1W6JA 1KAAA 4JG2A 4KTAA 2MHVA 2PI2A 3S17B 1N33L 1KABA 3C1FA 4AYBG 3G4SA 2X6GA 2KECA 1VQFA 2RVLA 5CC4A 3HKSA 3GTLB 4DAPA 4OO1I 3OWEB 2DN8A 3KLSX 4ZYSA 1Y8NB 3G48A 5J3BA 1TS3A 4LF5Q 2IX0A 1PFMA 1C8CA 4GLXA 4L5RC 3EQLC 1A63A 2XWBB 5C44B 2OWOA 2EXZA 2A68D 3SXHA 3HEJA 4QCLA 4FF2A 3HFZB 1AE3A 1TWFB 5JOBA 1CUKA 4PZ6A 3D6CA 3QJYA 1QZGA 2E75C 4KHVA 3NTIA 2G9DA 2PYKA 1OXTA 4K8IA 2IWHA 1KRTA 1U9RA 1GKHA 5BR8Q 5E1FA 1STAA 2PCFB 5JJKA 2FMCA 4UP8A 4DV3Q 1YJWA 1IHZA 1C48A 1H9SA 1Q90A 3M3YH 1LV9A 2MP1A 4QUCA 1JE4A 2NVYB 4K8JA 1TY0A 1I3QH 4BA1I 1AZQA 1O7IA 4ZQ3A 3MC0B 1GUGA 2Z6BA 2JA5H 1KC8C 2B8GA 1RHPA 2EDGA 4GLAC 4GOPA 1AZPA 3HOVB 1PYWD 2LXKA 3K57A 4C3IH 3MAQA 4NP5A 2AUJD 1HNXQ 5M3MB 5CV9A 4RWSC 5ELCA 4PZ7A 5J22A 4ZCKA 3P1HA 1MHWC 3FMCA 1ET9A 3M7GA 3D4RA 1LTGD 3KDFA 4RHSA 4OO1G 5BN5A 1BCPC 2B2WC 2LY7A 2OF1A 2K5NA 2NZHA 3UE1A 2I5MX 1W3SA 2EOTA 4A3GG 4L6TB 4DR1L 4ABNA 3AB9A 1PZID 3H6MA 2KEEA 5HY6A 5FLMH 1PTOB 3KF6B 2CFMA 3JAML 3CCMA 1K83B 1L2FA 2A6HD 3GP7A 5IYBG 1SYBA 3F2CA 3NELA 2L15A 4Y7NH 3PO3G 4BY7G 4A3FB 4DXGA 4A3KB 3ER0A 1NTGA 2K75A 3CHBD 2E5LL 3I91A 2N88A 3CRKC 2KA7A 1UE7A 2EY2A 3PF5A 4MZ9A 1HNWL 1KLUD 3KF8A 3K7AB 2N55A 1ET6A 4PMBA 4DN4M 3CCRA 1NCVA 3ICEA 1EY4A 2Z9HA 5FLXc 1E22A 1FD7D 4HAEA 1LYLA 1PFBA 1D5XC 4K6LA 1CKOA 2KCCA 3U50C 4A3JB 2YTVA 2Q8IB 2GA4B 2B3GA 1WCMG 4C3JH 1SE2A 4NXNL 2IPKD 2D0PA 4JYAL 2JP1A 1SJED 2EYMA 2BA0A 3BDLA 3AFPA 4MN3A 3KBXA 1R9TB 4GKJL 2M00A 2B2VC 3IAYA 5IT9c 3Q22A 4DV1Q 2NVQB 1L1OB 1K28A 2EJGC 5BN3A 1DJRD 1Y8PB 2UU9Q 4A3BB 2B29A 4FXDA 3DEOA 3Q23A 1U4LA 4IFDJ 1ASYA 1LABA 2I46A 2F0LA 3SHLA 1PTOD 3TZDA 3VA7A 2OTLA 2ZTEA 2XVSA 3DHQA 4RG1A 4X64L 3PUXA 4X3TA 1MIUA 4RCNA 5IP7G 2F3VA 2QDLA 4ZLTF 2EZVA 4X3UA 3PIO3 4RGTA 2VL6A 2MJ8A 3S14B 5LMUQ 1XJVA 1JORA 1HZAA 5AJ3L 1EZ6A 3U58A 3W1GA 1KNAA 4HJ9A 5HGQA 1VS0A 4CKEA 1X55A 1HQRD 5EPJA 4ULLA 2PNRC 2R7FA 3VR4A 1QNKA 3DXJC 3PF4A 3FPUB 4YY3Q 3CW2C 3KBGA 3CD6A 5C4JH 3D0FA 2PZTA 1IBMQ 4JI3Q 1ICFB 1SSOA 3PO2H 3MFGA 2MO0A 1X32A 1PDQA 2KENA 5CV7A 1I4GA 4JI5L 4C3HB 1BF4A 3VDYA 2KHIA 4LUOA 2M9VA 3TEHB 3S1RB 4DU9A 2AQ1B 3A5ZB 2ZTCA 3EA6A 1LM0A 1D6EC 4ALPA 1YHQA 2CH4A 2A19A 3L2PA 1YJ9A 3I4NB 1QWYA 1RKNA 1K3BC 3E9IA 5FK9C 4JBKA 1SE4A 1YZ6A 4IUVA 4KD4A 4DAYA 2ZJPA 2VQFQ 1JOKA 2ENBA 3PSIA 2WB1E 1SE8A 1TY2A 1K8OA 3PGZA 3EBEA 1QUQA 2DGYA 2O5JC 1LTBD 2DNCA 2JA5G 3R2TA 4B9XA 2VB2X 2M2LA 4C56C 3M4PA 1WJJA 1FNUA 4HCSA 2NVXH 2ZJQA 5IE8A 1CT1D 1SYFA 1JR0D 4C3IG 3RZOB 5CMDA 2A6ED 2Q8RE 4CKCA 4K5WA 2DY7A 1I94Q 5C4XB 2VQEL 2EY1A 1EYDA 4R8IA 5ELEA 3HOYH 3HOUG 1GUWA 3TP8A 1J5EL 1WFQA 3ERSX 4B3ML 1A0IA 4DNTB 1FGBD 1HFGA 3LWUA
chains in the Genus database with same CATH topology
2PQAA 4ME3A 4A3IG 4DAMA 4HJAA 1B70B 4R4CA 3GTKH 4A3MH 2XTIA 2UXCQ 4KLKA 1EFWA 3BZKA 4OX9L 3RLFA 2UUBQ 1K8AC 1BBWA 3J81i 5IY0A 1HH2P 3FHWA 2K5VA 2UUCL 3STBD 3H3VI 4A3JG 2AWNA 3H0GH 4DV4Q 1M1KC 1BVSA 4BBRH 4HIMA 3I4MG 2EQSA 3F1ZA 1IZ6A 5FLMG 1JJ2A 1HZCA 1G51A 1B8AA 3LGJA 4DK6C 3S2HH 4JI8Q 4DV6Q 4DR2L 1QVCA 1I94L 1PH7A 4OONA 1OTCA 1C0AA 1OXVA 4POGA 3A0JA 2JA6H 1LTLA 4DNIA 3M4OH 1KIXA 2MNAA 1RL2A 2QEXA 4DR3L 2UUAQ 4DV2Q 3NEMA 4JI1Q 4LF7L 2JA8H 1HNZQ 2UXDL 4UP7A 4NB3A 1XNQL 2ZM6Q 1YNXA 3PV0A 5ELNA 2UXCL 1VQCA 4DKAC 4A3BG 3EIVA 4JCVE 2UUBL 2R7ZH 4OXPA 4DR4Q 4LF4L 1HZBA 2UXBQ 4JI4Q 4IO9A 2N78A 2YTXA 4DV1L 3H3VH 4APVA 1X56A 2QA4A 4DV4L 1PH5A 1PYSB 4LUVA 3UE0A 2OQKA 3OTOQ 1SN8A 1IL2A 3DM3A 5DLQE 3UDXA 4BXXG 3J81c 4JI8L 1EIFA 4DV6L 4LFAQ 1Z47A 4AIMA 4DR5Q 2WFWA 4AQYQ 1AE2A 3HOWH 4IFDI 1JT8A 1VQDA 2AHOB 3L7ZC 3TREA 2IY5B 1S40A 3PUZA 3J7ZC 1YEZA 2HIXA 1HZ9A 2Y0SG 5IYCH 4K0KL 2VUMH 2UUAL 1UE1A 1GO3E 2IT1A 4DV2L 4JI1L 1FJGQ 3CMEA 1XMQQ 1HNZL 3K7UC 2VZAA 5JEAJ 2ZM6L 4P71A 4DUYQ 1W2BA 4C2MH 1Q86C 3TS2A 4A3GH 1PH2A 4JV5Q 1X9NA 3CMAA 3PUVA 1IBLQ 3K81C 4JI6Q 4DR4L 2V1CC 4OWWB 2C35B 4QY7A 1VQMA 1EQRA 4JI4L 2UXBL 2IX1A 3GDEA 2Q2HA 4GOPB 1Y14B 3I2ZA 3ULPA 3S2DH 2YU9H 2OCEA 4B3SQ 1KQSA 2WP8J 2KCTA 2RHSB 5IYBH 3OTOL 4GNXB 3T1YQ 4YWLA 4LF6Q 4UY8C 4LF8Q 3BJUA 4A4IA 4BY7H 1BBUA 1XPUA 1VQNA 1S3OA 2BA1A 4IJHA 1SLJA 4TVAB 2YV5A 4DR5L 2HIVA 4AQYL 4LFAL 4JI0Q 3RN2A 4R4QA 2MFIA 2R7DA 3U4ZA 4A3DG 3BZCA 1Q1EA 3S24A 5LMNQ 3AQQA 2Z0SA 1YI2A 4JI2Q 4EQ5A 3CCQA 3J80i 1XMQL 4JI3L 1HJPA 5IP9H 1A62A 5IWAQ 1Y1VG 4DUYL 4A3CH 2B63G 4YWKA 5GROA 3PIOA 4JV5L 1X3GA 1PH1A 1IBLL 3WWVA 4JI6L 3NBHB 1SMXA 4PMWA 4IOCA 4H02A 4LWCA 2ID0A 1A8VA 1E1OA 1WCMH 4L5SA 3PUYA 1X65A 4P74A 4B3SL 4MNOA 1TWHH 1K9MC 1SR3A 2N49A 1NE3A 1TWGH 4P73A 4POFA 1TWCH 2Q2TA 3I4NG 2R92H 3FKIH 1K8GA 4GS3A 1WI5A 3T1YL 2EXDA 1L1OC 4LF6L 2JEAI 4LF8L 1OXUA 3PO2G 2K50A 3M4QA 1OXXK 1PH4A 1YJNA 1K3RA 3S17H 1UWVA 4WJ3M 1Y1WG 4JI0L 1KRSA 3CC7A 1N33Q 2JA7G 4XIGS 2HQLA 3ULLA 1WYDA 3E9HA 1HR0Q 2YTYA 5LMNL 2CQOA 1X3FA 4OWTB 5ELOA 5C0XG 4JI2L 1B7YB 1PA6A 5IWAL 3GTLH 4HJ5A 1YHAA 3KF8B 1VQ8A 4HIOA 3AYHB 3CP0A 2VS1A 4EX5A 2JK8A 4GKJQ 4X62Q 3M85A 4BBSH 1G6PA 3K8AA 1E1TA 1VCIA 2ZTDA 4TQUS 4X65Q 3H15A 4IFDG 1K0RA 2E2IH 3J80c 5IP7H 3GO5A 5M3FH 2PI2E 4AYBE 5C44H 4JG2A 4A93H 2PNHA 5C4XG 4DUZQ 4AH6A 3M9BA 1VQ5A 2PI2A 2E2JH 1TWFH 2GVAA 3G71A 1N33L 1LUZA 1OXSC 4AYBG 3G4SA 1HR0L 3HKZG 1VQFA 3HOZH 1PH8A 3HKSA 2GN5A 3UDFA 1N32Q 1L1OA 2R93G 1VQOA 1UEBA 1NMGA 4X62L 4OO1I 5AJ3Q 2CWAA 3CQZH 3S1MH 4X65L 2LXJA 3RZDH 1SFOH 4DV0Q 1EWIA 3G48A 4IPDA 1P16A 4UPAA 5J3BA 4X66Q 4LF5Q 2IX0A 5M5XH 2BH2A 1NMFA 4GLXA 2ASBA 4YCWA 1I50H 4LUZA 5IYDH 1Q8KA 1NY4A 4L5RC 4LFBQ 1A63A 2OWOA 1PVOA 3HOXG 4GOPC 2HT1A 3KJOA 5C3EH 4DUZL 4A3LH 2BH8A 3HFZB 1G291 3RR5A 4YCUA 3HOYG 2NVYH 1PV4A 3CPWA 1AE3A 4GNXC 1ASZA 2Q2IA 3OW2A 2Y0SE 1CUKA 4PZ6A 3JAMi 5GADC 2Z6KC 1QVFA 1FVIA 5E7NA 3CCSA 1QZGA 2F52A 4IPGA 3STBC 4A3MG 1YBYA 1VQ6A 1OXTA 4JC0A 1EIYB 3HOVH 2YYZA 4FDBA 1N32L 3RN5A 5GAHC 1XNRQ 2JEBI 1KRTA 4JBWA 1CKMA 2D0OA 3T1HQ 1GKHA 5BR8Q 3H0GG 4DV0L 3AEVA 3TQYA 4RMFA 4X66L 4BBRG 5M3MH 4UP8A 1XPOA 2K4KA 4BY1H 4DV3Q 4LF5L 5JJKA 2K5HA 3CCUA 5JJLA 1YJWA 4LFBL 2KCMA 1L0WA 1PH6A 3M3YH 1YHBA 4YHHQ 2JA9A 1YIJA 1S72A 1MJEA 4A3EH 4L5TA 2JA6G 3TRZA 4LFCQ 1I3QH 4BA1I 1O7IA 2DUDA 1JB7A 3KFUA 1JJCB 2JA8G 3PO3H 3E0EA 5FJ8H 4GKKQ 2JA5H 1CKNB 1KC8C 1N34Q 4GLAC 4GOPA 2R7ZG 4DR1Q 1UE5A 2JQOA 1PH3A 2LXKA 4QL5A 1XNRL 3JAMc 4O2DA 2I5LX 2I0QA 4L5QA 3W1BA 3CCVA 3T1HL 5BR8L 4C3IH 3PIPA 1K83H 4GNXA 1FJGL 4X6AH 3W5OA 3SGIA 1VQLA 5M5YH 1HNXQ 1XMOQ 2MO1A 4DV3L 2Z6KA 1FGUA 4PZ7A 1KL9A 4A3FH 4NPSA 4A3KH 1MKHA 2HHHQ 2E8GA 1C9OA 4YHHL 2E2HH 1YITA 3HOWG 3CCJA 1C7YA 1VQ9A 2E5LQ 4LNQA 1Z9FA 1KD1C 3KDFA 4DAYB 3S1QH 4JOIC 4OO1G 2JJQA 5IYCG 2MQHA 4A3IH 4LFCL 4GN3B 3RLNA 1VQ7A 2VUMG 1HNWQ 3K7AH 4DR6Q 1VQIA 3GD7A 1PH9A 3CCLA 2K5NA 4R4OA 2VNUD 2VW9A 2NZHA 4GKKL 3UE1A 1E3PA 1U5KA 1SROA 1V1QA 1W3SA 2I5MX 2K52A 1VQ4A 2A1AA 1N34L 4A3GG 1QUQB 4A3JH 4DR1L 3CXCA 1Q12A 4PG3A 3AFQA 5HY6A 3I4MH 5FLMH 3KF6B 1VQPA 4NXNQ 4JYAQ 2CFMA 3RLOA 4B3MQ 3CCMA 3J7A5 3KYHC 1GM5A 1L2FA 1HNXL 1XMOL 1R9TH 3EN2A 2KHJA 3I4OA 4PZ8A 5IYBG 3F2CA 3NELA 2L15A 4IPHA 4Y7NH 3PO3G 4BY7G 2HHHL 1K73C 2NVQH 3ER0A 1PHJA 1NTGA 2D62A 2K75A 4JBMA 2E5LL 2WB1G 1UE7A 3PF5A 4MZ9A 1AH9A 1HNWL 3GTMH 3HKZE 1H95A 4DR6L 4A3BH 3CC2A 4IJLA 3NENA 2PQAB 1MJCA 5IP9G 3CCRA 1XPRA 3ICEA 4UP9A 5FLXc 1E22A 4A3CG 1LYLA 1CKOA 1M90C 4QGUA 4KHPQ 3CC4A 3U50C 5GAGC 2YTVA 4X64Q 1FL0A 3PCOB 2B3GA 1WCMG 4C3JH 1V9PA 2F3IA 4JOIA 4NXNL 4JYAL 2D0PA 1Q81C 1QZHA 1YVCA 1KHIA 2BA0A 4BXXH 3AFPA 3K80C 1GD7A 1U0LA 2R92G 3S14H 3FKIG 4GKJL 3GTPH 2AWOA 4OWXB 2KBNA 2CWPA 5IT9c 4LF4Q 1PYBA 2FXQA 4DV1Q 5C0XJ 2WAQE 1L1OB 1JE5A 4HIDA 1IBKQ 3BU2A 2Q2UA 2IHFA 3MXNB 4XTCS 2ES2A 4HIKA 2UU9Q 3S1NH 3S16H 2B29A 3IRBA 1N36Q 1Q7YC 5JEAG 3F2BA 2CKZB 2WAQG 2QGQA 1CSPA 1ASYA 4IFDJ 3RNUA 1EUJA 2OTLA 1VQHA 4BBSG 4KHPL 4Y52H 4R4IA 2ZTEA 4RG1A 4X64L 4GN4B 4B3TQ 3PUXA 5GAEC 4K0KQ 2NN6I 3OYYA 2XGTA 2I5HA 1MIUA 1TXYA 5IP7G 3I55A 1EOVA 5M3FG 4B3RQ 4YWMA 4HJ7A 2K14A 3MEFA 3GTQH 3UDIA 5C44G 4A93G 2VL6A 3B6YA 5LMUQ 4DK3C 1XJVA 3ULJA 1D7QA 1HZAA 5AJ3L 4JI5Q 1BKBA 2OTJA 5LMNW 4C3HH 3U58A 4A3DH 1DGSA 3CF5A 1JJGA 3PUWA 3W1GA 2RHQB 3J81j 4A76A 2AKWB 1V43A 5C0XI 4HJ9A 1XTDA 1PFSA 2GVBA 5HGQA 1VS0A 3S1RH 1IBKL 1Y1VH 2PMZE 4J15A 1X55A 4QJFA 2LSSA 3G6EA 2B63H 1UE6A 3HOZG 2JE6I 2UU9L 3GTJH 2R7FA 1N36L 1VQEA 1E7ZA 2OQ0A 2RF4A 1RIPA 3GTGH 1KAWA 1VQGA 2RCNA 3PF4A 4NXMQ 2NVTH 5JJIA 4YY3Q 4KHZA 3CW2C 1NBWA 3CD6A 2IHEA 2R6GA 4R4TA 2ZJRA 4B3TL 1IXRA 1Q1BA 5C4JH 3I4NH 1I5FA 3D0FA 2CCZA 1KXLA 4P72A 3L0OA 3F2DA 1IBMQ 4JI3Q 3PO2H 5IYDG 2MO0A 4DR7Q 4B3RL 1X54A 1WOCA 4KI0A 5LMUL 2KENA 1Y1WH 1HR0W 3CPFA 4IPCA 2VY3A 4JI5L 5C3EG 4HJ8A 3ZJYC 3CAMA 2JA7H 4JBJA 4A3LG 4WJ4A 4IOAA 5GQOA 1VQJA 1X6OA 2NZOA 3VDYA 4GLVB 2KHIA 2N8NA 3KOJA 4JI7Q 4BA2I 4LUOA 3TEHB 1CKNA 1J6QA 1P8LA 1EQQA 1I6HH 3F8TA 3U4VA 3FP9A 4DV5Q 3HOUH 4MTNA 3A5ZB 4P75A 2ZTCA 1E24A 3KLWA 1LM0A 3HOVG 1JMCA 4NXML 3GTOH 1N8RC 4YY3L 1TWAH 4ALPA 3TS0A 1YHQA 4QQBX 2H5XA 4YCVA 3RZOH 2A19A 3L2PA 4O0AA 1YJ9A 4BY1G 5M3MG 3I56A 3KDFB 4LF9Q 1XNQQ 3E9IA 5C4XH 3CCEA 1IBML 1VQAA 2N3SA 4QIWE 2VQEQ 4DR7L 3A74A 4JBKA 4DV7Q 3I7FA 1YZ6A 1J5EQ 2ZJPA 2VQFQ 1EYGA 5EAYA 1N9WA 1VQBA 3PSIA 2F4VQ 3JC66 3K0XA 4A3EG 1NJIC 2WB1E 4JI7L 1QVGA 1SE8A 2A8VA 2NN6G 3PGZA 3EBEA 4OX9Q 3DLLA 1Q46A 1QUQA 2DGYA 3D31A 5H1SE 4DV5L 5FJ8G 2R93H 2JA5G 2UUCQ 3KF6A 3M4PA 1WJJA 1D8LA 3A5UA 3UDGA 1Q82C 2NVXH 3Q8DA 4LW1A 5IE8A 3KJPA 2ZJQA 2ALYB 4A75A 3S15H 1CSQA 4R1JA 3HOXH 4DR2Q 4LF9L 1I94Q 2EIFA 2VQEL 4GN5A 4A3FG 1T9HA 3HOYH 1X3EA 4DV7L 3HOUG 3M7NA 2AMCB 4DPGA 4A3KG 1WFQA 1J5EL 2ATWA 3ERSX 1SRUA 2VQFL 4DR3Q 1GVPA 1VQKA 2F4VL 4B3ML 1A0IA 5M5WH 4LF7Q 2UXDQ 5K36G 1IYJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQA A;  4ME3 A;  4A3I G;  4DAM A;  4HJA A;  1B70 B;  4R4C A;  3GTK H;  4A3M H;  2XTI A;  2UXC Q;  4KLK A;  1EFW A;  3BZK A;  4OX9 L;  3RLF A;  2UUB Q;  1K8A C;  1BBW A;  3J81 i;  5IY0 A;  1HH2 P;  3FHW A;  2K5V A;  2UUC L;  3STB D;  3H3V I;  4A3J G;  2AWN A;  3H0G H;  4DV4 Q;  1M1K C;  1BVS A;  4BBR H;  4HIM A;  3I4M G;  2EQS A;  3F1Z A;  1IZ6 A;  5FLM G;  1JJ2 A;  1HZC A;  1G51 A;  1B8A A;  3LGJ A;  4DK6 C;  3S2H H;  4JI8 Q;  4DV6 Q;  4DR2 L;  1QVC A;  1I94 L;  1PH7 A;  4OON A;  1OTC A;  1C0A A;  1OXV A;  4POG A;  3A0J A;  2JA6 H;  1LTL A;  4DNI A;  3M4O H;  1KIX A;  2MNA A;  1RL2 A;  2QEX A;  4DR3 L;  2UUA Q;  4DV2 Q;  3NEM A;  4JI1 Q;  4LF7 L;  2JA8 H;  1HNZ Q;  2UXD L;  4UP7 A;  4NB3 A;  1XNQ L;  2ZM6 Q;  1YNX A;  3PV0 A;  5ELN A;  2UXC L;  1VQC A;  4DKA C;  4A3B G;  3EIV A;  4JCV E;  2UUB L;  2R7Z H;  4OXP A;  4DR4 Q;  4LF4 L;  1HZB A;  2UXB Q;  4JI4 Q;  4IO9 A;  2N78 A;  2YTX A;  4DV1 L;  3H3V H;  4APV A;  1X56 A;  2QA4 A;  4DV4 L;  1PH5 A;  1PYS B;  4LUV A;  3UE0 A;  2OQK A;  3OTO Q;  1SN8 A;  1IL2 A;  3DM3 A;  5DLQ E;  3UDX A;  4BXX G;  3J81 c;  4JI8 L;  1EIF A;  4DV6 L;  4LFA Q;  1Z47 A;  4AIM A;  4DR5 Q;  2WFW A;  4AQY Q;  1AE2 A;  3HOW H;  4IFD I;  1JT8 A;  1VQD A;  2AHO B;  3L7Z C;  3TRE A;  2IY5 B;  1S40 A;  3PUZ A;  3J7Z C;  1YEZ A;  2HIX A;  1HZ9 A;  2Y0S G;  5IYC H;  4K0K L;  2VUM H;  2UUA L;  1UE1 A;  1GO3 E;  2IT1 A;  4DV2 L;  4JI1 L;  1FJG Q;  3CME A;  1XMQ Q;  1HNZ L;  3K7U C;  2VZA A;  5JEA J;  2ZM6 L;  4P71 A;  4DUY Q;  1W2B A;  4C2M H;  1Q86 C;  3TS2 A;  4A3G H;  1PH2 A;  4JV5 Q;  1X9N A;  3CMA A;  3PUV A;  1IBL Q;  3K81 C;  4JI6 Q;  4DR4 L;  2V1C C;  4OWW B;  2C35 B;  4QY7 A;  1VQM A;  1EQR A;  4JI4 L;  2UXB L;  2IX1 A;  3GDE A;  2Q2H A;  4GOP B;  1Y14 B;  3I2Z A;  3ULP A;  3S2D H;  2YU9 H;  2OCE A;  4B3S Q;  1KQS A;  2WP8 J;  2KCT A;  2RHS B;  5IYB H;  3OTO L;  4GNX B;  3T1Y Q;  4YWL A;  4LF6 Q;  4UY8 C;  4LF8 Q;  3BJU A;  4A4I A;  4BY7 H;  1BBU A;  1XPU A;  1VQN A;  1S3O A;  2BA1 A;  4IJH A;  1SLJ A;  4TVA B;  2YV5 A;  4DR5 L;  2HIV A;  4AQY L;  4LFA L;  4JI0 Q;  3RN2 A;  4R4Q A;  2MFI A;  2R7D A;  3U4Z A;  4A3D G;  3BZC A;  1Q1E A;  3S24 A;  5LMN Q;  3AQQ A;  2Z0S A;  1YI2 A;  4JI2 Q;  4EQ5 A;  3CCQ A;  3J80 i;  1XMQ L;  4JI3 L;  1HJP A;  5IP9 H;  1A62 A;  5IWA Q;  1Y1V G;  4DUY L;  4A3C H;  2B63 G;  4YWK A;  5GRO A;  3PIO A;  4JV5 L;  1X3G A;  1PH1 A;  1IBL L;  3WWV A;  4JI6 L;  3NBH B;  1SMX A;  4PMW A;  4IOC A;  4H02 A;  4LWC A;  2ID0 A;  1A8V A;  1E1O A;  1WCM H;  4L5S A;  3PUY A;  1X65 A;  4P74 A;  4B3S L;  4MNO A;  1TWH H;  1K9M C;  1SR3 A;  2N49 A;  1NE3 A;  1TWG H;  4P73 A;  4POF A;  1TWC H;  2Q2T A;  3I4N G;  2R92 H;  3FKI H;  1K8G A;  4GS3 A;  1WI5 A;  3T1Y L;  2EXD A;  1L1O C;  4LF6 L;  2JEA I;  4LF8 L;  1OXU A;  3PO2 G;  2K50 A;  3M4Q A;  1OXX K;  1PH4 A;  1YJN A;  1K3R A;  3S17 H;  1UWV A;  4WJ3 M;  1Y1W G;  4JI0 L;  1KRS A;  3CC7 A;  1N33 Q;  2JA7 G;  4XIG S;  2HQL A;  3ULL A;  1WYD A;  3E9H A;  1HR0 Q;  2YTY A;  5LMN L;  2CQO A;  1X3F A;  4OWT B;  5ELO A;  5C0X G;  4JI2 L;  1B7Y B;  1PA6 A;  5IWA L;  3GTL H;  4HJ5 A;  1YHA A;  3KF8 B;  1VQ8 A;  4HIO A;  3AYH B;  3CP0 A;  2VS1 A;  4EX5 A;  2JK8 A;  4GKJ Q;  4X62 Q;  3M85 A;  4BBS H;  1G6P A;  3K8A A;  1E1T A;  1VCI A;  2ZTD A;  4TQU S;  4X65 Q;  3H15 A;  4IFD G;  1K0R A;  2E2I H;  3J80 c;  5IP7 H;  3GO5 A;  5M3F H;  2PI2 E;  4AYB E;  5C44 H;  4JG2 A;  4A93 H;  2PNH A;  5C4X G;  4DUZ Q;  4AH6 A;  3M9B A;  1VQ5 A;  2PI2 A;  2E2J H;  1TWF H;  2GVA A;  3G71 A;  1N33 L;  1LUZ A;  1OXS C;  4AYB G;  3G4S A;  1HR0 L;  3HKZ G;  1VQF A;  3HOZ H;  1PH8 A;  3HKS A;  2GN5 A;  3UDF A;  1N32 Q;  1L1O A;  2R93 G;  1VQO A;  1UEB A;  1NMG A;  4X62 L;  4OO1 I;  5AJ3 Q;  2CWA A;  3CQZ H;  3S1M H;  4X65 L;  2LXJ A;  3RZD H;  1SFO H;  4DV0 Q;  1EWI A;  3G48 A;  4IPD A;  1P16 A;  4UPA A;  5J3B A;  4X66 Q;  4LF5 Q;  2IX0 A;  5M5X H;  2BH2 A;  1NMF A;  4GLX A;  2ASB A;  4YCW A;  1I50 H;  4LUZ A;  5IYD H;  1Q8K A;  1NY4 A;  4L5R C;  4LFB Q;  1A63 A;  2OWO A;  1PVO A;  3HOX G;  4GOP C;  2HT1 A;  3KJO A;  5C3E H;  4DUZ L;  4A3L H;  2BH8 A;  3HFZ B;  1G29 1;  3RR5 A;  4YCU A;  3HOY G;  2NVY H;  1PV4 A;  3CPW A;  1AE3 A;  4GNX C;  1ASZ A;  2Q2I A;  3OW2 A;  2Y0S E;  1CUK A;  4PZ6 A;  3JAM i;  5GAD C;  2Z6K C;  1QVF A;  1FVI A;  5E7N A;  3CCS A;  1QZG A;  2F52 A;  4IPG A;  3STB C;  4A3M G;  1YBY A;  1VQ6 A;  1OXT A;  4JC0 A;  1EIY B;  3HOV H;  2YYZ A;  4FDB A;  1N32 L;  3RN5 A;  5GAH C;  1XNR Q;  2JEB I;  1KRT A;  4JBW A;  1CKM A;  2D0O A;  3T1H Q;  1GKH A;  5BR8 Q;  3H0G G;  4DV0 L;  3AEV A;  3TQY A;  4RMF A;  4X66 L;  4BBR G;  5M3M H;  4UP8 A;  1XPO A;  2K4K A;  4BY1 H;  4DV3 Q;  4LF5 L;  5JJK A;  2K5H A;  3CCU A;  5JJL A;  1YJW A;  4LFB L;  2KCM A;  1L0W A;  1PH6 A;  3M3Y H;  1YHB A;  4YHH Q;  2JA9 A;  1YIJ A;  1S72 A;  1MJE A;  4A3E H;  4L5T A;  2JA6 G;  3TRZ A;  4LFC Q;  1I3Q H;  4BA1 I;  1O7I A;  2DUD A;  1JB7 A;  3KFU A;  1JJC B;  2JA8 G;  3PO3 H;  3E0E A;  5FJ8 H;  4GKK Q;  2JA5 H;  1CKN B;  1KC8 C;  1N34 Q;  4GLA C;  4GOP A;  2R7Z G;  4DR1 Q;  1UE5 A;  2JQO A;  1PH3 A;  2LXK A;  4QL5 A;  1XNR L;  3JAM c;  4O2D A;  2I5L X;  2I0Q A;  4L5Q A;  3W1B A;  3CCV A;  3T1H L;  5BR8 L;  4C3I H;  3PIP A;  1K83 H;  4GNX A;  1FJG L;  4X6A H;  3W5O A;  3SGI A;  1VQL A;  5M5Y H;  1HNX Q;  1XMO Q;  2MO1 A;  4DV3 L;  2Z6K A;  1FGU A;  4PZ7 A;  1KL9 A;  4A3F H;  4NPS A;  4A3K H;  1MKH A;  2HHH Q;  2E8G A;  1C9O A;  4YHH L;  2E2H H;  1YIT A;  3HOW G;  3CCJ A;  1C7Y A;  1VQ9 A;  2E5L Q;  4LNQ A;  1Z9F A;  1KD1 C;  3KDF A;  4DAY B;  3S1Q H;  4JOI C;  4OO1 G;  2JJQ A;  5IYC G;  2MQH A;  4A3I H;  4LFC L;  4GN3 B;  3RLN A;  1VQ7 A;  2VUM G;  1HNW Q;  3K7A H;  4DR6 Q;  1VQI A;  3GD7 A;  1PH9 A;  3CCL A;  2K5N A;  4R4O A;  2VNU D;  2VW9 A;  2NZH A;  4GKK L;  3UE1 A;  1E3P A;  1U5K A;  1SRO A;  1V1Q A;  1W3S A;  2I5M X;  2K52 A;  1VQ4 A;  2A1A A;  1N34 L;  4A3G G;  1QUQ B;  4A3J H;  4DR1 L;  3CXC A;  1Q12 A;  4PG3 A;  3AFQ A;  5HY6 A;  3I4M H;  5FLM H;  3KF6 B;  1VQP A;  4NXN Q;  4JYA Q;  2CFM A;  3RLO A;  4B3M Q;  3CCM A;  3J7A 5;  3KYH C;  1GM5 A;  1L2F A;  1HNX L;  1XMO L;  1R9T H;  3EN2 A;  2KHJ A;  3I4O A;  4PZ8 A;  5IYB G;  3F2C A;  3NEL A;  2L15 A;  4IPH A;  4Y7N H;  3PO3 G;  4BY7 G;  2HHH L;  1K73 C;  2NVQ H;  3ER0 A;  1PHJ A;  1NTG A;  2D62 A;  2K75 A;  4JBM A;  2E5L L;  2WB1 G;  1UE7 A;  3PF5 A;  4MZ9 A;  1AH9 A;  1HNW L;  3GTM H;  3HKZ E;  1H95 A;  4DR6 L;  4A3B H;  3CC2 A;  4IJL A;  3NEN A;  2PQA B;  1MJC A;  5IP9 G;  3CCR A;  1XPR A;  3ICE A;  4UP9 A;  5FLX c;  1E22 A;  4A3C G;  1LYL A;  1CKO A;  1M90 C;  4QGU A;  4KHP Q;  3CC4 A;  3U50 C;  5GAG C;  2YTV A;  4X64 Q;  1FL0 A;  3PCO B;  2B3G A;  1WCM G;  4C3J H;  1V9P A;  2F3I A;  4JOI A;  4NXN L;  4JYA L;  2D0P A;  1Q81 C;  1QZH A;  1YVC A;  1KHI A;  2BA0 A;  4BXX H;  3AFP A;  3K80 C;  1GD7 A;  1U0L A;  2R92 G;  3S14 H;  3FKI G;  4GKJ L;  3GTP H;  2AWO A;  4OWX B;  2KBN A;  2CWP A;  5IT9 c;  4LF4 Q;  1PYB A;  2FXQ A;  4DV1 Q;  5C0X J;  2WAQ E;  1L1O B;  1JE5 A;  4HID A;  1IBK Q;  3BU2 A;  2Q2U A;  2IHF A;  3MXN B;  4XTC S;  2ES2 A;  4HIK A;  2UU9 Q;  3S1N H;  3S16 H;  2B29 A;  3IRB A;  1N36 Q;  1Q7Y C;  5JEA G;  3F2B A;  2CKZ B;  2WAQ G;  2QGQ A;  1CSP A;  1ASY A;  4IFD J;  3RNU A;  1EUJ A;  2OTL A;  1VQH A;  4BBS G;  4KHP L;  4Y52 H;  4R4I A;  2ZTE A;  4RG1 A;  4X64 L;  4GN4 B;  4B3T Q;  3PUX A;  5GAE C;  4K0K Q;  2NN6 I;  3OYY A;  2XGT A;  2I5H A;  1MIU A;  1TXY A;  5IP7 G;  3I55 A;  1EOV A;  5M3F G;  4B3R Q;  4YWM A;  4HJ7 A;  2K14 A;  3MEF A;  3GTQ H;  3UDI A;  5C44 G;  4A93 G;  2VL6 A;  3B6Y A;  5LMU Q;  4DK3 C;  1XJV A;  3ULJ A;  1D7Q A;  1HZA A;  5AJ3 L;  4JI5 Q;  1BKB A;  2OTJ A;  5LMN W;  4C3H H;  3U58 A;  4A3D H;  1DGS A;  3CF5 A;  1JJG A;  3PUW A;  3W1G A;  2RHQ B;  3J81 j;  4A76 A;  2AKW B;  1V43 A;  5C0X I;  4HJ9 A;  1XTD A;  1PFS A;  2GVB A;  5HGQ A;  1VS0 A;  3S1R H;  1IBK L;  1Y1V H;  2PMZ E;  4J15 A;  1X55 A;  4QJF A;  2LSS A;  3G6E A;  2B63 H;  1UE6 A;  3HOZ G;  2JE6 I;  2UU9 L;  3GTJ H;  2R7F A;  1N36 L;  1VQE A;  1E7Z A;  2OQ0 A;  2RF4 A;  1RIP A;  3GTG H;  1KAW A;  1VQG A;  2RCN A;  3PF4 A;  4NXM Q;  2NVT H;  5JJI A;  4YY3 Q;  4KHZ A;  3CW2 C;  1NBW A;  3CD6 A;  2IHE A;  2R6G A;  4R4T A;  2ZJR A;  4B3T L;  1IXR A;  1Q1B A;  5C4J H;  3I4N H;  1I5F A;  3D0F A;  2CCZ A;  1KXL A;  4P72 A;  3L0O A;  3F2D A;  1IBM Q;  4JI3 Q;  3PO2 H;  5IYD G;  2MO0 A;  4DR7 Q;  4B3R L;  1X54 A;  1WOC A;  4KI0 A;  5LMU L;  2KEN A;  1Y1W H;  1HR0 W;  3CPF A;  4IPC A;  2VY3 A;  4JI5 L;  5C3E G;  4HJ8 A;  3ZJY C;  3CAM A;  2JA7 H;  4JBJ A;  4A3L G;  4WJ4 A;  4IOA A;  5GQO A;  1VQJ A;  1X6O A;  2NZO A;  3VDY A;  4GLV B;  2KHI A;  2N8N A;  3KOJ A;  4JI7 Q;  4BA2 I;  4LUO A;  3TEH B;  1CKN A;  1J6Q A;  1P8L A;  1EQQ A;  1I6H H;  3F8T A;  3U4V A;  3FP9 A;  4DV5 Q;  3HOU H;  4MTN A;  3A5Z B;  4P75 A;  2ZTC A;  1E24 A;  3KLW A;  1LM0 A;  3HOV G;  1JMC A;  4NXM L;  3GTO H;  1N8R C;  4YY3 L;  1TWA H;  4ALP A;  3TS0 A;  1YHQ A;  4QQB X;  2H5X A;  4YCV A;  3RZO H;  2A19 A;  3L2P A;  4O0A A;  1YJ9 A;  4BY1 G;  5M3M G;  3I56 A;  3KDF B;  4LF9 Q;  1XNQ Q;  3E9I A;  5C4X H;  3CCE A;  1IBM L;  1VQA A;  2N3S A;  4QIW E;  2VQE Q;  4DR7 L;  3A74 A;  4JBK A;  4DV7 Q;  3I7F A;  1YZ6 A;  1J5E Q;  2ZJP A;  2VQF Q;  1EYG A;  5EAY A;  1N9W A;  1VQB A;  3PSI A;  2F4V Q;  3JC6 6;  3K0X A;  4A3E G;  1NJI C;  2WB1 E;  4JI7 L;  1QVG A;  1SE8 A;  2A8V A;  2NN6 G;  3PGZ A;  3EBE A;  4OX9 Q;  3DLL A;  1Q46 A;  1QUQ A;  2DGY A;  3D31 A;  5H1S E;  4DV5 L;  5FJ8 G;  2R93 H;  2JA5 G;  2UUC Q;  3KF6 A;  3M4P A;  1WJJ A;  1D8L A;  3A5U A;  3UDG A;  1Q82 C;  2NVX H;  3Q8D A;  4LW1 A;  5IE8 A;  3KJP A;  2ZJQ A;  2ALY B;  4A75 A;  3S15 H;  1CSQ A;  4R1J A;  3HOX H;  4DR2 Q;  4LF9 L;  1I94 Q;  2EIF A;  2VQE L;  4GN5 A;  4A3F G;  1T9H A;  3HOY H;  1X3E A;  4DV7 L;  3HOU G;  3M7N A;  2AMC B;  4DPG A;  4A3K G;  1WFQ A;  1J5E L;  2ATW A;  3ERS X;  1SRU A;  2VQF L;  4DR3 Q;  1GVP A;  1VQK A;  2F4V L;  4B3M L;  1A0I A;  5M5W H;  4LF7 Q;  2UXD Q;  5K36 G;  1IYJ B; 
#chains in the Genus database with same CATH topology
 2PQA A;  1ESR A;  1RDP D;  1B70 B;  1EEF D;  2UXC Q;  4KLK A;  1E2V A;  5C3X A;  1BCP B;  3J81 i;  1F2Z A;  4ODG A;  2AWN A;  3H0G H;  1UUP A;  1BVS A;  5FLM G;  3T4A C;  4FF4 A;  3S2H H;  3LGJ A;  4DK6 C;  4DR2 L;  4YIJ A;  3MEH A;  1QVC A;  3I3C A;  4TKO B;  1GHK A;  1PH7 A;  1AEX A;  3A0J A;  2WV6 D;  1KIX A;  1RL2 A;  1DOK A;  4LF7 L;  2UXD L;  4UP7 A;  2CQA A;  4I65 A;  4KV6 A;  1WVL A;  2EY5 A;  1YNX A;  1GUS A;  4A3M B;  4DKA C;  4JCV E;  1EZ8 A;  2UUB L;  2R7Z H;  2F0E A;  1CA5 A;  4JI4 Q;  2N78 A;  2YTX A;  3H3V H;  3M4Y A;  3MTS A;  3SK5 A;  1SXT A;  4DV4 L;  1PH5 A;  2F0F A;  4OL7 A;  3KLS A;  4C3J G;  4DNR B;  3UDX A;  4DV6 L;  1Z47 A;  4DR5 Q;  4RAU C;  1AE2 A;  1H9S B;  1EIG A;  5JPM C;  2AHO B;  3TRE A;  1S40 A;  3PUZ A;  2HIX A;  3M4O B;  2IT1 A;  3NSW A;  5IIF A;  4DV2 L;  1O7L A;  1HNZ L;  1SBB B;  3HZX A;  1LTR D;  3I8Z A;  1BCP D;  1W2B A;  2O2L D;  3PUV A;  4JI6 Q;  4DR4 L;  1VQM A;  2UXB L;  1EQR A;  4J6H A;  2IX1 A;  4GOP B;  2B39 A;  2YU9 H;  2C5C A;  4K14 A;  2NWG A;  3O13 A;  4LF6 Q;  1XWE A;  1I4Q A;  2QCP X;  1S3O A;  2BA1 A;  4IJH A;  4AQY L;  2YV5 A;  1CHP D;  4JI0 Q;  3HOW B;  1HTL D;  1D2B A;  3RN2 A;  2R7D A;  1I4P A;  3BZC A;  2J7Z A;  2VUM B;  2Z0S A;  2L55 A;  4JI2 Q;  4ID6 A;  1CFM A;  1A62 A;  5IWA Q;  1STH A;  2V4D A;  2KQ3 A;  3D3R A;  4YWK A;  1SJH D;  4JV5 L;  1X3G A;  2LS0 1;  1PH1 A;  3WWV A;  4H02 A;  3TP6 A;  1EY7 A;  1E1O A;  2PO4 A;  5E3F A;  4MNO A;  3SE0 A;  3S2D B;  1BCP F;  1NE3 A;  2Q2T A;  4H7B A;  1VDZ A;  2R92 H;  3BDO A;  1K8G A;  3PO2 G;  1YJN A;  1UEA B;  3ND8 A;  1UWV A;  3CC7 A;  3OWF A;  1B50 A;  2B2Y A;  3E9H A;  2YTY A;  2HDM A;  2CQO A;  4OWT B;  2A74 C;  1E0B A;  5JEA H;  3KF8 B;  2XNA C;  4HIO A;  4GKJ Q;  1S5E D;  2KCN A;  4BBS H;  3K8A A;  2ZTD A;  2BE5 C;  4TQU S;  1SEB D;  2H4O A;  3J80 c;  1EWC A;  5M3F H;  2PI2 E;  2KED A;  1TWG B;  1J8I A;  4DF7 A;  4A93 H;  1TS5 A;  3FKI B;  1ROD A;  2X69 A;  1D1K A;  5COY A;  3M9B A;  5IGG A;  1AN8 A;  3G71 A;  1LTI D;  3AMU A;  1OXS C;  4G4K A;  3U9S A;  1PH8 A;  1A3V A;  4UDU C;  3G7L A;  1N32 Q;  1L1O A;  4RA8 A;  1UEB A;  4X62 L;  5AJ3 Q;  3CQZ H;  3S1M H;  4X65 L;  3RZD H;  4DV0 Q;  2EE1 A;  4IPD A;  2AQ3 B;  4X66 Q;  2E2I B;  4YCW A;  1I50 H;  4LUZ A;  5IYD H;  2BDN A;  3H3V C;  2HT1 A;  3E5S A;  3KJO A;  1KDB A;  4DUZ L;  1U4R A;  1G29 1;  3RR5 A;  1QJO A;  5KIX A;  1TU2 B;  3HOY G;  3L3O C;  1PV4 A;  5J1Z A;  2E2J B;  4GNX C;  1ASZ A;  1HUM A;  2QF7 A;  2Q2I A;  4MTK A;  2Y0S E;  1LAC A;  5EBC A;  1WTW A;  5GAD C;  1QVF A;  3HOZ B;  3URY A;  1R4P B;  2F52 A;  4IPG A;  2KVM A;  3STB C;  4JC0 A;  4FDB A;  3GV3 A;  3PQI A;  1XNR Q;  1CKM A;  1AFP A;  1XXG A;  4F88 A;  2PMZ B;  3H0G G;  1SFO B;  3AEV A;  3TQY A;  4BY1 H;  5M5X B;  2K5H A;  4LAA A;  3CCU A;  4LFB L;  2KCM A;  1L0W A;  1EY9 A;  1YHB A;  4RH6 A;  4YHH Q;  5C3E B;  2QKI C;  1YIJ A;  1TVX A;  2K6A A;  1STE A;  1B3Q A;  4CJ2 C;  4LFC Q;  2NYZ D;  1B2T A;  2F0P A;  2DUD A;  1BOS A;  3PO3 H;  3E0E A;  2A5H A;  2WKC A;  4M8A A;  1N34 Q;  2R7Z G;  2JQO A;  4QL5 A;  3SEB A;  3J80 E;  4TRD A;  3W1B A;  3CCV A;  3T1H L;  1EEI D;  1GHJ A;  4RGM A;  4X6A H;  3W5O A;  1STN A;  3A55 A;  1XMO Q;  4H0L C;  4FXG C;  2O5I C;  2QDB A;  1IYV A;  5LL6 X;  1MGS A;  5DM6 3;  1MKH A;  1C9O A;  2F0M A;  4FO2 A;  1YIT A;  4LNQ A;  1STY A;  4A3E B;  1JOO A;  4DAY B;  1RJT A;  3S1Q H;  2JJQ A;  1SAP A;  2B2U A;  1LT5 D;  1A2U A;  3GD7 A;  3MZ5 A;  1WD1 A;  4R4O A;  4GKK L;  3QWN A;  1G8Z D;  1U5K A;  1SRO A;  1VQ4 A;  1QUQ B;  3CXC A;  3AFQ A;  3HRZ C;  1SYC A;  1NR2 A;  4B3M Q;  3KYH C;  3OMC A;  1V8Q A;  5M5Y B;  2FIN B;  4B08 A;  5I9P A;  2ZXO A;  3DMU A;  3ITP A;  2HHH L;  4JBM A;  2E2H B;  2Z1C A;  2WB1 G;  3J81 E;  1AH9 A;  4A3I B;  3GTM H;  1WTH A;  4DR6 L;  2PQA B;  1MJC A;  1XPR A;  3NPP A;  5HGT A;  4CHT B;  1BR9 A;  4F7X A;  1HQM C;  1TR5 A;  3I4M B;  2B2W A;  4C1N I;  1KHI A;  1Y69 U;  1ENF A;  3W3A A;  1GD7 A;  1U0L A;  2R92 G;  2FHT A;  3GTP H;  5JVG 3;  1PYB A;  2FXQ A;  5C6A A;  5JPN C;  1JE5 A;  1GJX A;  2Q2U A;  4IUT A;  2IHF A;  4XTC S;  1KNE A;  3R93 A;  2CHB D;  3S16 H;  1N36 Q;  4XQQ A;  5JEA G;  2I07 B;  2CKZ B;  2TMP A;  3AU7 A;  4Q0F A;  2WAQ G;  5D3I B;  1CSP A;  1KDC A;  5AFW A;  3RNU A;  1EUJ A;  4BBS G;  4KHP L;  2PQE A;  4B3T Q;  1YNJ C;  4GN4 B;  3D6W A;  1TXY A;  5M3F G;  1W6K A;  3CKI B;  4YWM A;  2K14 A;  3MEF A;  3GTQ H;  4A93 G;  4HCE A;  4DK3 C;  2EJM A;  1BKB A;  5I4D A;  1QG7 A;  1MSH A;  1HA6 A;  2B2U C;  4ME5 A;  4A3D H;  3PUW A;  1B3A A;  2AKW B;  1V43 A;  1L0X B;  2GVB A;  1PFS A;  5CGK A;  1IBK L;  1Y1V H;  2PMZ E;  1Y8O B;  2B63 H;  1UE6 A;  3ERQ A;  1UAP A;  3S1N B;  5KEE A;  3DWP A;  3GTJ H;  1AP0 A;  2EYF A;  1RIP A;  1KAW A;  2B2V A;  3QR8 A;  4NXM Q;  1BXT A;  3P75 A;  4KHZ A;  3SK6 A;  1NBW A;  2IHE A;  3NE5 B;  4CDE C;  1Q1B A;  1I5F A;  2ICE C;  2CCZ A;  4V0B A;  4IUR A;  5IYD G;  4B3R L;  4WJW A;  1SYD A;  1CQV A;  1WOC A;  4O42 A;  2AUK A;  4IPC A;  4KMU C;  2VY3 A;  3ZJY C;  3CAM A;  2L11 A;  3QG1 A;  1IL8 A;  1B44 D;  3MHB A;  4BA2 I;  1CKN A;  1M4V A;  1P8L A;  1EQQ A;  4Q5V A;  3U4V A;  3FP9 A;  4DV5 Q;  2EYO A;  3HOU H;  1QOH A;  2WAC A;  3GTG B;  1G2T A;  3H94 A;  1II3 A;  3DWQ A;  4R9W A;  1N8R C;  3GTO H;  4IFD H;  2NVT B;  3C46 A;  4BY1 G;  4LF9 Q;  4CDD C;  2JSO A;  1ENA A;  1VQA A;  4DR7 L;  3A74 A;  5LHY 1;  3D8G A;  4DV7 Q;  1EU4 A;  1Y1W B;  1EYG A;  2JA7 B;  4G7H C;  1NJI C;  2XIW A;  1S5F D;  4JI7 L;  1S5D D;  5NUC A;  1H9J A;  1I6H B;  1Q46 A;  3D31 A;  1SMY C;  1JC7 A;  2R93 H;  5T1G A;  4JK1 C;  4LK1 C;  5BN4 A;  3GV6 A;  4LW1 A;  1Q82 C;  2ALY B;  3W2D A;  2DJF C;  1TWA B;  3S15 H;  1CSQ A;  3OW7 A;  4S3S A;  2OEO A;  2BCO A;  3HOX H;  2FFK B;  1SE3 A;  4UHV A;  5EPK A;  1T9H A;  1X3E A;  3M7N A;  1LTS D;  4M1U B;  4CGY B;  4DR3 Q;  4K5X A;  2F4V L;  4IUN A;  5M5W H;  3X3N A;  4AYB B;  1XNQ Q;  5KYL A;  4OIK A;  3GTK H;  1TS2 A;  3ONA B;  1SNM A;  2XTI A;  1QIL A;  3BZK A;  1YNN C;  1F2Y A;  3RLF A;  4P2C B;  4OX9 L;  1HH2 P;  2UUC L;  3STB D;  1WTX A;  1NUC A;  4BBR H;  1T5E A;  2EQS A;  1PRT C;  5EGT A;  2F0U A;  3TBI B;  4QB4 A;  2D5D A;  1OTC A;  3K5O A;  3NQT A;  4XT3 B;  1LTL A;  4DNI A;  2JA6 H;  1M8A A;  2RDG A;  2EYJ A;  2UUA Q;  3T51 B;  2SDF A;  5E4X A;  3OMG A;  4G7O C;  4JI1 Q;  2JA8 H;  3VA5 A;  3V2T A;  5IGE A;  1PMR A;  2ZM6 Q;  1ZEQ X;  3PV0 A;  1SND A;  1VQC A;  2RSN A;  4OXP A;  3F2U A;  4IO9 A;  1KTK A;  1DOL A;  2F0W A;  5C4H A;  1EL0 A;  3Q6S A;  1PYS B;  2F0G A;  1EFI D;  2OQK A;  3HS0 C;  3OHX C;  4JI8 L;  2K5Q A;  4OEL B;  1EY8 A;  4IFD I;  5EPL A;  1CK1 A;  1PZJ D;  3J7Z C;  4K0K L;  4EQO A;  1HZ9 A;  2Y0S G;  2KJX A;  3NBI A;  4RKL A;  2G5D A;  1XMQ Q;  3K7U C;  2VZA A;  4P71 A;  4DUY Q;  1Q86 C;  2RDH A;  3LNN A;  1IBL Q;  4OGQ C;  2C35 B;  2Q2H A;  1Y14 B;  4B3S Q;  5FLX E;  1KQS A;  2WP8 J;  2RHS B;  3OTO L;  1IW7 D;  3T1Y Q;  4YWL A;  2B8F A;  1BBU A;  1F77 A;  4UAI A;  1OO9 B;  5ISR A;  4LFA L;  3J81 L;  3VYR A;  2HIV A;  1FNV A;  1NR4 A;  2MFI A;  4LJZ C;  3U4Z A;  4A3D G;  2A69 C;  2RKS A;  1YI2 A;  3AQQ A;  3T53 B;  4EQ5 A;  3J80 i;  1HJP A;  4X3K A;  5IP9 H;  1Y1V G;  5IT9 E;  5J39 A;  4A3C H;  2B63 G;  5GRO A;  4C2M B;  4A3G B;  5HUR A;  2K03 A;  5I9O A;  4IOC A;  4LWC A;  2ID0 A;  3PUY A;  4P74 A;  4FNF A;  1SR3 A;  4P73 A;  1TWC H;  2RA4 A;  4QIW B;  4GS3 A;  2EXD A;  4FP5 D;  2EPB A;  4HN7 A;  4LF8 L;  1OXU A;  4BY7 B;  3A56 A;  1PH4 A;  1C4Q A;  3S17 H;  1PXU A;  4CJ1 B;  1N33 Q;  4XIG S;  2HQL A;  5LMN L;  1ESF A;  1X3F A;  2L9H A;  4K5V A;  2SOB A;  1NSN S;  3MXP A;  3GTL H;  4HJ5 A;  1VQ8 A;  3CP0 A;  2JK8 A;  3A7L A;  4N8F A;  3I72 A;  1VCI A;  4RKB A;  1J9O A;  3H15 A;  3HKZ B;  4IFD G;  1K0R A;  1WCM B;  2ICI A;  3GO5 A;  4KJO A;  1TWH B;  3ERO A;  1CQF A;  1YNJ D;  4AYB E;  5C44 H;  4IUP A;  1S5C D;  4RGO S;  2QW7 A;  3NTK A;  4IZ8 A;  1TWF H;  5TSS A;  1LUZ A;  3HG9 A;  5A2Q E;  1HR0 L;  1HCZ A;  5JJZ A;  3A8I E;  1LO5 D;  5K5P A;  2R93 G;  2LXJ A;  5D3D A;  1EWI A;  1X3P A;  2CVR A;  3HGB A;  1S5B D;  1NMF A;  1Q8K A;  4U68 A;  1NY4 A;  4XYQ A;  1RF2 D;  4KY5 A;  2K7V A;  1PVO A;  3HOX G;  2D9U A;  4XYO A;  1QB5 D;  1WD0 A;  2BH8 A;  2XSC A;  3P20 A;  3NTH A;  3FVQ A;  4YCU A;  2NVY H;  3CPW A;  4FF1 A;  2CW0 C;  2MPM A;  3VYS A;  4N8X 1;  1VF7 A;  2Z6K C;  1F2M A;  1FVI A;  5E7N A;  3CCS A;  1L0Y B;  4HTH A;  3BZD B;  1EY0 A;  1YBY A;  1VQ6 A;  3HOV H;  2YYZ A;  5GAH C;  3K5N A;  3FEW X;  4HMI A;  4JVZ A;  1D5M C;  1ICW A;  4RMF A;  4BBR G;  5M3M H;  2NBF A;  4LF5 L;  1XPO A;  2K4K A;  1TT2 A;  5JJL A;  1F2L A;  5F2D A;  2IJ0 A;  4Z9C B;  1PRT B;  2JA9 A;  1S72 A;  4KY6 A;  4L5T A;  3KUP A;  1B9N A;  3J7Y W;  2JA6 G;  1IKM A;  4IUQ A;  2NN6 H;  3KFU A;  2JA8 G;  2HCI A;  5EKI A;  1CZW A;  5FJ8 H;  1CKN B;  3R3O A;  1DD2 A;  2F0J A;  4DR1 Q;  4EQN A;  5KGU A;  1PH3 A;  1GOZ A;  3JAM c;  1PTO H;  4O2D A;  2I0Q A;  4XT1 B;  5BR8 L;  4GNX A;  1K83 H;  1DZ1 A;  1VQL A;  1TS4 A;  2MO1 A;  4DV3 L;  4CBV A;  2PPB C;  1KL9 A;  3I4L A;  4I7Z C;  4KN7 C;  4NPS A;  4A3F H;  3DWA A;  4A3K H;  3M3Y B;  5D14 A;  2E5L Q;  1Z9F A;  1KD1 C;  4JOI C;  3EVQ A;  5IGF A;  4GN3 B;  1VQ7 A;  1HNW Q;  5KND A;  3K7A H;  1I3Q B;  3TP7 A;  1VQI A;  2A73 B;  2RCF A;  1BBX C;  2HQE A;  3CCL A;  3NBH A;  2X6L A;  2VW9 A;  2JA5 B;  1E3P A;  2A1A A;  3TZU A;  4A3J H;  4PG3 A;  4X3S A;  4NXN Q;  1CZG A;  4JYA Q;  3RLO A;  4RGN A;  3J7A 5;  2F0T A;  4C3I B;  1STG A;  1DON A;  4K2K A;  1HPC A;  1HNX L;  1R9T H;  3EN2 A;  2KHJ A;  3I4O A;  3K5M A;  1A3T A;  4IPH A;  1K73 C;  2NVQ H;  1HTP A;  3OPO A;  4N9T A;  2D2C C;  4CDF C;  1O78 A;  3HKZ E;  1H95 A;  5M9O A;  4A3B H;  3CC2 A;  2K5W A;  5IP9 G;  2P5Z X;  4A3C G;  1M90 C;  4X64 Q;  2NTT A;  3QIA A;  1V9P A;  1Q81 C;  1Z7T A;  4XQJ A;  3K80 C;  3C1E A;  3S14 H;  2AWO A;  3U9O A;  5G3L F;  4Y7N B;  1GUN A;  3BVG A;  2SNM A;  4F8M A;  2L0C A;  1O7Y A;  5C0X J;  5CV8 A;  1FNW A;  5C5M A;  2A6H C;  5CV4 A;  3BU2 A;  4PMC A;  3NUC A;  1I4X A;  1PRT F;  2ES2 A;  4HIK A;  5A35 A;  1E2W A;  2F0D A;  1CTM A;  3IRB A;  3F2B A;  3FDT A;  5FLX L;  4Y52 H;  4ZKB B;  3BVZ A;  4K0K Q;  1BO0 A;  5GAE C;  2NN6 I;  2XGT A;  2LFN A;  4C3J B;  4WFN 3;  1EOV A;  4HJ7 A;  1RCV D;  5C44 G;  3B6Y A;  3OIQ A;  1LT3 D;  1D7Q A;  3ULJ A;  1WTQ A;  4JI5 Q;  5LMN W;  4ZAI A;  4C3H H;  5I6W A;  1LT4 D;  3CRL C;  1DGS A;  3HP3 A;  4NW2 A;  2J4X A;  5IT9 L;  3J81 j;  3DUZ A;  4A76 A;  5C0X I;  1XTD A;  3S1R H;  5ELD A;  4J15 A;  2LSS A;  4HSP A;  1FR3 A;  2JE6 I;  2UU9 L;  1DM0 B;  1VQE A;  3D4W A;  2RF4 A;  2F03 A;  1JOQ A;  2C9O A;  2KOL A;  4BS9 A;  2HCC A;  2ZJR A;  1G91 A;  3I4N H;  1KXL A;  3F2D A;  1B4O A;  4R8N A;  1HFN A;  2Q8T A;  2EYP A;  1X54 A;  4KI0 A;  1PTO C;  5LMU L;  2J0T D;  1HR0 W;  3CPF A;  1JWS D;  1JWM D;  1B1Z A;  4WJ4 A;  1K8M A;  2NTS A;  4IOA A;  5GQO A;  1VQJ A;  2NZO A;  3K58 A;  4GLV B;  2N8N A;  1O7Z A;  3KOJ A;  3NWS A;  3F8T A;  1CM9 A;  2F4I A;  3ZYY X;  1A2T A;  4J8Q A;  4MTN A;  2EY6 A;  4MHE A;  3KLW A;  3HOV G;  1JMC A;  2PZU A;  4YY3 L;  4QQB X;  4YCV A;  4OIJ A;  3RZO H;  2E2D C;  5C4J B;  2WKD A;  3NXW A;  5M3M G;  5JJI A;  5C4X H;  1IBM L;  5EKL A;  2N3S A;  1A3U A;  2VQE Q;  3J7A V;  5IOC A;  3PO2 B;  4DXF A;  2CH4 W;  1J5E Q;  4O1N A;  3N6R A;  5EAY A;  3VYU A;  3VR3 A;  1VQB A;  3K0X A;  3VR5 A;  1QVG A;  2F0S A;  3TP5 A;  4HMJ A;  2NN6 G;  3Q0A A;  4QMG A;  2E74 C;  5FJ8 G;  3H91 A;  1LLR D;  1D8L A;  3A5U A;  4H13 C;  3Q8D A;  4A75 A;  2LMC B;  2PW5 A;  1JWU D;  1SYE A;  3Q24 A;  4DR2 Q;  4GN5 A;  4A3F G;  1DOM A;  4A3K G;  4DPG A;  2ATW A;  2VQF L;  3D4D A;  1GVP A;  1K0S A;  4GZY C;  1VQK A;  4FVM A;  4LF7 Q;  2UXD Q;  2G9H D;  1H9K A;  1QZH A;  4ME3 A;  4DAM A;  4HJA A;  3IKJ A;  4A3M H;  1DXM A;  2UUB Q;  1K8A C;  3RUZ A;  1BBW A;  4IUU A;  5IY0 A;  3FHW A;  2FJ2 A;  1JCK B;  2K5V A;  4V19 0;  2RDF A;  4A3J G;  1F9R A;  4DV4 Q;  2NVX B;  4HIM A;  3QOL A;  3F1Z A;  1IZ6 A;  1HUN A;  3NHH A;  3TDQ A;  4DV6 Q;  5I6Y A;  1I94 L;  2B2T C;  5ELF A;  1F9S A;  3HOY B;  3M4O H;  1MSG A;  2QEX A;  2RBM A;  3MXN A;  4DV2 Q;  5JVH 3;  1HNZ Q;  2A6E C;  3MVV A;  1JB3 A;  2UXC L;  4A3B G;  1GUT A;  1GUO A;  3I90 A;  4ZUI A;  4DR4 Q;  4LF4 L;  1HZB A;  2UXB Q;  3R8B A;  5DAU A;  2ZXP A;  5CR3 A;  1X56 A;  4RHR A;  4ZUJ A;  3H0G B;  4LUV A;  2PZW A;  1F9P A;  3T16 A;  1SN8 A;  3DM3 A;  3S2H B;  3OIP A;  4AQY Q;  2XRS D;  3HOW H;  4I7A A;  1JT8 A;  2IY5 B;  3L7Z C;  1YEZ A;  3QB3 A;  5IYC H;  2VUM H;  3CME A;  1A6X A;  3TN2 A;  1BUV T;  3BS1 A;  5CBA E;  4JV5 Q;  2R7Z B;  2V1C C;  3WOE A;  5FOB B;  4QY7 A;  3X3M A;  1V1P A;  4JI4 L;  5FKA C;  3I2Z A;  3ULP A;  1MD2 D;  3S2D H;  2OCE A;  4CDC C;  4EQP A;  2KCT A;  4GNX B;  1U4P A;  4RFB A;  2QEJ C;  4DR5 L;  4C3H G;  1EOT A;  3UI2 A;  2BE5 D;  3S24 A;  3CCQ A;  2ZT9 C;  1SNQ A;  4G7Z C;  4BWG B;  3LX0 A;  2F0O A;  4JI6 L;  3NBH B;  4PMW A;  1A8V A;  2YU9 B;  1TWG H;  2N49 A;  4WOR A;  1NAP A;  5T1I A;  3I4N G;  3FKI H;  2EYL A;  1WI5 A;  3NQI A;  4LF6 L;  1VF5 C;  3C2P A;  3M4Q A;  5EKK A;  1OXX K;  2K04 A;  3SK4 A;  4WJ3 M;  3MWY W;  4JI0 L;  1Q3L A;  2WB1 B;  3ULL A;  1WYD A;  2F0Q A;  3ND9 A;  1IYU A;  5ELO A;  1WTO A;  4JI2 L;  1B7Y B;  3E0J A;  3K6O A;  5IWA L;  1PA6 A;  2IX3 A;  2E76 C;  2VS1 A;  4B9W A;  4X62 Q;  3M85 A;  1G6P A;  3E3X A;  1E1T A;  4X65 Q;  2RQX A;  5I2X A;  3S9W A;  2WIN B;  2E2I H;  5FO9 B;  1SNO A;  3RD4 A;  1H9M A;  2R92 B;  1HA5 A;  2PNH A;  5C4X G;  4DUZ Q;  2KHS A;  4AH6 A;  1VQ5 A;  2E2J H;  1I4H A;  2GVA A;  3BVM A;  4KY7 A;  3BYY B;  3HKZ G;  3HOZ H;  2GN5 A;  4IQZ A;  3UDF A;  1I6V C;  4ZRZ A;  1VQO A;  2WAQ B;  1NMG A;  2CWA A;  4G57 A;  4BBS B;  5CV5 A;  5E4W C;  1SFO H;  1P16 A;  4UPA A;  5M5X H;  3CU7 A;  1XX8 A;  2BH2 A;  3G6J B;  2ASB A;  4XXE A;  1SDF A;  3J80 L;  5M3F B;  3MA2 B;  4LFB Q;  4A93 B;  4GOP C;  5IOD A;  5C3E H;  3EFX D;  4A3L H;  3I70 A;  3WDN A;  4FXK C;  4QUF A;  3OW2 A;  1TKW B;  2AQ2 B;  2R61 A;  3JAM i;  2KUM A;  1BQQ T;  1ILQ A;  2Z4H A;  5EQ0 A;  4A3M G;  3VR2 A;  2K1B A;  3I73 A;  1N32 L;  1EIY B;  4QF4 A;  3RN5 A;  4FYD A;  1SYG A;  2JEB I;  1EQV A;  4JBW A;  2D0O A;  2L5T A;  2FMM A;  3CQZ B;  3T1H Q;  3S1M B;  4DV0 L;  3RZD B;  2L4N A;  1ZXT A;  4OEM B;  4X66 L;  5CV6 A;  1I50 B;  1T5X D;  1ONL A;  1PH6 A;  2XRQ D;  2BOS A;  1MJE A;  4A3E H;  3TRZ A;  4KD3 A;  1FYC A;  2K01 A;  1JB7 A;  4TSS A;  1JJC B;  2Z8L A;  4GKK Q;  1PZK D;  3K59 A;  4EGV A;  1PTO F;  1UE5 A;  1XNR L;  4N9P A;  4L8J A;  2I5L X;  4L5Q A;  3R2I A;  3PIP A;  1FJG L;  4XQN A;  3SGI A;  2XN9 C;  5M5Y H;  4BY1 B;  3EJI A;  1G2S A;  2HD3 A;  1FGU A;  2Z6K A;  2L1B A;  2HHH Q;  5KNB A;  2E8G A;  1PFN A;  1RTO A;  1TQO A;  4YHH L;  2E2H H;  3HOW G;  3CCJ A;  1C7Y A;  1VQ9 A;  1PLF A;  3IFD A;  5K36 H;  5IYC G;  2MQH A;  4A3I H;  4LFC L;  3RLN A;  2VUM G;  4DR6 Q;  4HSV A;  1PH9 A;  3PO3 B;  3LWE A;  2VNU D;  4PV1 C;  4CKB A;  1QCB D;  1V1Q A;  2MUY A;  2K52 A;  2NB0 A;  1WTV A;  1N34 L;  2NZ1 D;  1RD9 D;  1Q12 A;  1GXD C;  2EJF C;  3BG3 A;  1ILP A;  3I4M H;  1VQP A;  1EIH A;  3H09 A;  1GM5 A;  3NWT A;  5C3W A;  5KYI A;  3A8J E;  1XMO L;  4PZ8 A;  1NNX A;  1QNU A;  2NUC A;  1VMC A;  5JAV A;  1WTR A;  1PHJ A;  2D62 A;  2F0I A;  4IN3 A;  1CA6 A;  1UNS A;  3S1Q B;  3DM1 A;  1B9M A;  4MIU A;  1SNP A;  4IJL A;  3NEN A;  1ZKO A;  1O80 A;  2MGS A;  4UP9 A;  1D5Z C;  2K05 A;  2SEB D;  4QGU A;  4KHP Q;  3CC4 A;  5GAG C;  2F0H A;  1FL0 A;  1H9R A;  2DNE A;  3PCO B;  2F3I A;  2JN4 A;  4JOI A;  5KNC A;  1YVC A;  5DEH A;  4BXX H;  4PQX A;  1BDO A;  2L12 A;  3FKI G;  1EYC A;  5IGC A;  4C1N K;  1G6Z A;  4OWX B;  2KBN A;  2CWP A;  3RMH A;  4DAV A;  4LF4 Q;  1ZYR C;  4RCO A;  1U4M A;  1EWH A;  2WAQ E;  1HHV A;  2RSO A;  4HID A;  1IBK Q;  1S4Z A;  3KK7 A;  1I4R A;  3MXN B;  3GTM B;  3S1N H;  2O4X A;  1JIC A;  3A8K E;  1Q7Y C;  4ZKC B;  4XDX A;  2QGQ A;  1HRJ A;  1VQH A;  2DJG C;  4R4I A;  3OYY A;  2I5H A;  3I55 A;  4WRD A;  4B3R Q;  4L63 B;  3UDI A;  3MXG A;  2Z4I A;  3GTP B;  3MXU A;  2OTJ A;  4KJN A;  3NK9 A;  3CF5 A;  2R3Z A;  1JJG A;  2Y0S B;  5D65 A;  2RHQ B;  5ELB A;  4E6I A;  3A54 A;  4DGZ A;  4QJF A;  3G6E A;  3HOZ G;  3J7A F;  3QOJ A;  3S16 B;  4PNY A;  1N36 L;  1E7Z A;  2OQ0 A;  2EYH A;  3GTG H;  1D1I A;  2TSS A;  1VQG A;  2RCN A;  2NVT H;  3SR1 A;  5KRU A;  3K0Y A;  4J1M A;  3T13 A;  1LT6 D;  2R6G A;  4R4T A;  4B3T L;  1IXR A;  1V1P B;  3TSS A;  2F1M A;  1MBY A;  2F0K A;  2A68 C;  2DY8 A;  4DK1 A;  4U67 3;  4P72 A;  3L0O A;  2K32 A;  4K2L A;  4NKL A;  1F9Q A;  4DR7 Q;  3GTQ B;  4OHJ A;  1SMY D;  1Y1W H;  2JA7 H;  2IW3 A;  5C3E G;  4HJ8 A;  4A3L G;  3SVM A;  4JBJ A;  4A3D B;  3BDC A;  3MFY A;  1JQY D;  3PMF A;  4JI7 Q;  1X6O A;  5C0X H;  1J6Q A;  3WOF A;  1I6H H;  1Y1V B;  2WII B;  1Z6H A;  4KN4 C;  4ILW A;  2B63 B;  3N52 A;  4FF3 A;  4P75 A;  3GTJ B;  1E24 A;  4DA2 A;  4NXM L;  2ZXR A;  4DK0 A;  1TWA H;  3TS0 A;  2H5X A;  4O0A A;  3I56 A;  5CBE E;  3KDF B;  2QIL A;  3CCE A;  4QIW E;  1EY5 A;  1YNN D;  1LTT D;  3P7J A;  3I7F A;  5G3L D;  4NMZ A;  1N9W A;  2K5D A;  2F4V Q;  3JC6 6;  4A3E G;  2F0N A;  3E6Z X;  2F0V A;  2OXP A;  1STB A;  1ML0 D;  1HXY D;  2XWJ B;  1EYA A;  2A8V A;  1PRT D;  4ZK9 B;  1X3Q A;  4OX9 Q;  3DLL A;  5H1S E;  4DV5 L;  3HOU B;  4JPB W;  2UUC Q;  1KDA A;  3SK8 A;  3KF6 A;  4DFA A;  4LMQ D;  3UDG A;  5IGD A;  1LTA D;  2EVB A;  3GTO B;  3KJP A;  1WTP A;  1KLG D;  4HED A;  1E2Z A;  1CI3 M;  4R1J A;  4CJ0 B;  4LF9 L;  2EIF A;  2LKV A;  1IKL A;  3VYT A;  4DV7 L;  2AMC B;  5I2Y A;  1SRU A;  3NP8 A;  3TME A;  5C5L A;  5K36 G;  1IYJ B;  4HR7 B;  4A3I G;  4R4C A;  2IL8 A;  4EVO A;  1EFW A;  1Q8I A;  2R93 B;  3H3V I;  1EU3 A;  2HDL A;  1M1K C;  3I4M G;  1JJ2 A;  3S15 B;  1HZC A;  1G51 A;  2JYO A;  3GQB A;  4K6D A;  1B8A A;  4JI8 Q;  4KKS A;  3HOX B;  3JAM E;  4OON A;  1C0A A;  3OOC A;  1OXV A;  4POG A;  5FO7 B;  3IL8 A;  2MNA A;  4DR3 L;  3PIP 3;  3NEM A;  5M5W B;  3K5L A;  4NB3 A;  1XNQ L;  3V05 A;  5EJW A;  3GTK B;  5ELN A;  3DEP A;  5DNF A;  3EIV A;  3FPP A;  2K33 A;  4DV1 L;  4APV A;  4IAL A;  2QA4 A;  4NDX A;  5FO8 B;  1BNZ A;  1CHQ D;  3UE0 A;  4BBR B;  2A69 D;  3OTO Q;  1IL2 A;  1R4Q B;  2K28 A;  5DLQ E;  4BXX G;  3J81 c;  1EIF A;  3T56 B;  4LFA Q;  4AIM A;  2WFW A;  3BYT B;  5CYU A;  1VQD A;  4OO1 H;  2JA6 B;  3L9A X;  1UE1 A;  1EQT A;  1GO3 E;  2UUA L;  4JI1 L;  2BDO A;  1FJG Q;  2JA8 B;  5JEA J;  2ZM6 L;  1QE6 A;  4C2M H;  3TS2 A;  4A3G H;  1PH2 A;  1A15 A;  3CMA A;  1X9N A;  3K81 C;  4KKU A;  5IGB A;  4OWW B;  2B2T A;  2B2Y C;  1SNC A;  1VMP A;  3A7A B;  3GDE A;  5EBD A;  1DYQ A;  3SDZ A;  5COR A;  5IYB H;  4UY8 C;  4LF8 Q;  3BJU A;  4A4I A;  4BY7 H;  1XPU A;  1VQN A;  1AW7 A;  1SLJ A;  4TVA B;  2VB3 X;  1DCZ A;  4R4Q A;  1V1O A;  1Q1E A;  5LMN Q;  4F87 A;  1XMQ L;  4JI3 L;  2JXM B;  2F3W A;  4DUY L;  5A2Q L;  3PIO A;  3V96 A;  1TII D;  3OSO A;  1IBL L;  1SMX A;  5DM7 3;  1WCM H;  4L5S A;  1X65 A;  4B3S L;  1TWH H;  3IFT A;  1K9M C;  2SNS A;  4POF A;  3FRP B;  3T1Y L;  1L1O C;  2JEA I;  1EY6 A;  2PW7 A;  2K50 A;  3KLR A;  1K3R A;  4H44 C;  1Y1W G;  1KRS A;  2JA7 G;  1HR0 Q;  2OT2 A;  1ZYR D;  1IW7 C;  5C0X G;  1MI2 A;  1XTC D;  4KKT A;  2HUG A;  1YHA A;  2VXW A;  5C4Z A;  2H1E A;  3AYH B;  4EX5 A;  4JW0 A;  5L37 A;  1RTN A;  1ENC A;  3C3L A;  3QO2 A;  4KK7 A;  1B53 A;  5IP7 H;  5LL6 S;  2CW0 D;  3VR6 A;  1XYI A;  1TWC B;  1W6J A;  1KAA A;  4JG2 A;  4KTA A;  2MHV A;  2PI2 A;  3S17 B;  1N33 L;  1KAB A;  3C1F A;  4AYB G;  3G4S A;  2X6G A;  2KEC A;  1VQF A;  2RVL A;  5CC4 A;  3HKS A;  3GTL B;  4DAP A;  4OO1 I;  3OWE B;  2DN8 A;  3KLS X;  4ZYS A;  1Y8N B;  3G48 A;  5J3B A;  1TS3 A;  4LF5 Q;  2IX0 A;  1PFM A;  1C8C A;  4GLX A;  4L5R C;  3EQL C;  1A63 A;  2XWB B;  5C44 B;  2OWO A;  2EXZ A;  2A68 D;  3SXH A;  3HEJ A;  4QCL A;  4FF2 A;  3HFZ B;  1AE3 A;  1TWF B;  5JOB A;  1CUK A;  4PZ6 A;  3D6C A;  3QJY A;  1QZG A;  2E75 C;  4KHV A;  3NTI A;  2G9D A;  2PYK A;  1OXT A;  4K8I A;  2IWH A;  1KRT A;  1U9R A;  1GKH A;  5BR8 Q;  5E1F A;  1STA A;  2PCF B;  5JJK A;  2FMC A;  4UP8 A;  4DV3 Q;  1YJW A;  1IHZ A;  1C48 A;  1H9S A;  1Q90 A;  3M3Y H;  1LV9 A;  2MP1 A;  4QUC A;  1JE4 A;  2NVY B;  4K8J A;  1TY0 A;  1I3Q H;  4BA1 I;  1AZQ A;  1O7I A;  4ZQ3 A;  3MC0 B;  1GUG A;  2Z6B A;  2JA5 H;  1KC8 C;  2B8G A;  1RHP A;  2EDG A;  4GLA C;  4GOP A;  1AZP A;  3HOV B;  1PYW D;  2LXK A;  3K57 A;  4C3I H;  3MAQ A;  4NP5 A;  2AUJ D;  1HNX Q;  5M3M B;  5CV9 A;  4RWS C;  5ELC A;  4PZ7 A;  5J22 A;  4ZCK A;  3P1H A;  1MHW C;  3FMC A;  1ET9 A;  3M7G A;  3D4R A;  1LTG D;  3KDF A;  4RHS A;  4OO1 G;  5BN5 A;  1BCP C;  2B2W C;  2LY7 A;  2OF1 A;  2K5N A;  2NZH A;  3UE1 A;  2I5M X;  1W3S A;  2EOT A;  4A3G G;  4L6T B;  4DR1 L;  4ABN A;  3AB9 A;  1PZI D;  3H6M A;  2KEE A;  5HY6 A;  5FLM H;  1PTO B;  3KF6 B;  2CFM A;  3JAM L;  3CCM A;  1K83 B;  1L2F A;  2A6H D;  3GP7 A;  5IYB G;  1SYB A;  3F2C A;  3NEL A;  2L15 A;  4Y7N H;  3PO3 G;  4BY7 G;  4A3F B;  4DXG A;  4A3K B;  3ER0 A;  1NTG A;  2K75 A;  3CHB D;  2E5L L;  3I91 A;  2N88 A;  3CRK C;  2KA7 A;  1UE7 A;  2EY2 A;  3PF5 A;  4MZ9 A;  1HNW L;  1KLU D;  3KF8 A;  3K7A B;  2N55 A;  1ET6 A;  4PMB A;  4DN4 M;  3CCR A;  1NCV A;  3ICE A;  1EY4 A;  2Z9H A;  5FLX c;  1E22 A;  1FD7 D;  4HAE A;  1LYL A;  1PFB A;  1D5X C;  4K6L A;  1CKO A;  2KCC A;  3U50 C;  4A3J B;  2YTV A;  2Q8I B;  2GA4 B;  2B3G A;  1WCM G;  4C3J H;  1SE2 A;  4NXN L;  2IPK D;  2D0P A;  4JYA L;  2JP1 A;  1SJE D;  2EYM A;  2BA0 A;  3BDL A;  3AFP A;  4MN3 A;  3KBX A;  1R9T B;  4GKJ L;  2M00 A;  2B2V C;  3IAY A;  5IT9 c;  3Q22 A;  4DV1 Q;  2NVQ B;  1L1O B;  1K28 A;  2EJG C;  5BN3 A;  1DJR D;  1Y8P B;  2UU9 Q;  4A3B B;  2B29 A;  4FXD A;  3DEO A;  3Q23 A;  1U4L A;  4IFD J;  1ASY A;  1LAB A;  2I46 A;  2F0L A;  3SHL A;  1PTO D;  3TZD A;  3VA7 A;  2OTL A;  2ZTE A;  2XVS A;  3DHQ A;  4RG1 A;  4X64 L;  3PUX A;  4X3T A;  1MIU A;  4RCN A;  5IP7 G;  2F3V A;  2QDL A;  4ZLT F;  2EZV A;  4X3U A;  3PIO 3;  4RGT A;  2VL6 A;  2MJ8 A;  3S14 B;  5LMU Q;  1XJV A;  1JOR A;  1HZA A;  5AJ3 L;  1EZ6 A;  3U58 A;  3W1G A;  1KNA A;  4HJ9 A;  5HGQ A;  1VS0 A;  4CKE A;  1X55 A;  1HQR D;  5EPJ A;  4ULL A;  2PNR C;  2R7F A;  3VR4 A;  1QNK A;  3DXJ C;  3PF4 A;  3FPU B;  4YY3 Q;  3CW2 C;  3KBG A;  3CD6 A;  5C4J H;  3D0F A;  2PZT A;  1IBM Q;  4JI3 Q;  1ICF B;  1SSO A;  3PO2 H;  3MFG A;  2MO0 A;  1X32 A;  1PDQ A;  2KEN A;  5CV7 A;  1I4G A;  4JI5 L;  4C3H B;  1BF4 A;  3VDY A;  2KHI A;  4LUO A;  2M9V A;  3TEH B;  3S1R B;  4DU9 A;  2AQ1 B;  3A5Z B;  2ZTC A;  3EA6 A;  1LM0 A;  1D6E C;  4ALP A;  1YHQ A;  2CH4 A;  2A19 A;  3L2P A;  1YJ9 A;  3I4N B;  1QWY A;  1RKN A;  1K3B C;  3E9I A;  5FK9 C;  4JBK A;  1SE4 A;  1YZ6 A;  4IUV A;  4KD4 A;  4DAY A;  2ZJP A;  2VQF Q;  1JOK A;  2ENB A;  3PSI A;  2WB1 E;  1SE8 A;  1TY2 A;  1K8O A;  3PGZ A;  3EBE A;  1QUQ A;  2DGY A;  2O5J C;  1LTB D;  2DNC A;  2JA5 G;  3R2T A;  4B9X A;  2VB2 X;  2M2L A;  4C56 C;  3M4P A;  1WJJ A;  1FNU A;  4HCS A;  2NVX H;  2ZJQ A;  5IE8 A;  1CT1 D;  1SYF A;  1JR0 D;  4C3I G;  3RZO B;  5CMD A;  2A6E D;  2Q8R E;  4CKC A;  4K5W A;  2DY7 A;  1I94 Q;  5C4X B;  2VQE L;  2EY1 A;  1EYD A;  4R8I A;  5ELE A;  3HOY H;  3HOU G;  1GUW A;  3TP8 A;  1J5E L;  1WFQ A;  3ERS X;  4B3M L;  1A0I A;  4DNT B;  1FGB D;  1HFG A;  3LWU A; 
#chains in the Genus database with same CATH homology
 2PQA A;  4ME3 A;  4A3I G;  4DAM A;  4HJA A;  1B70 B;  4R4C A;  3GTK H;  4A3M H;  2XTI A;  2UXC Q;  4KLK A;  1EFW A;  3BZK A;  4OX9 L;  3RLF A;  2UUB Q;  1K8A C;  1BBW A;  3J81 i;  5IY0 A;  1HH2 P;  3FHW A;  2K5V A;  2UUC L;  3STB D;  3H3V I;  4A3J G;  2AWN A;  3H0G H;  4DV4 Q;  1M1K C;  1BVS A;  4BBR H;  4HIM A;  3I4M G;  2EQS A;  3F1Z A;  1IZ6 A;  5FLM G;  1JJ2 A;  1HZC A;  1G51 A;  1B8A A;  3LGJ A;  4DK6 C;  3S2H H;  4JI8 Q;  4DV6 Q;  4DR2 L;  1QVC A;  1I94 L;  1PH7 A;  4OON A;  1OTC A;  1C0A A;  1OXV A;  4POG A;  3A0J A;  2JA6 H;  1LTL A;  4DNI A;  3M4O H;  1KIX A;  2MNA A;  1RL2 A;  2QEX A;  4DR3 L;  2UUA Q;  4DV2 Q;  3NEM A;  4JI1 Q;  4LF7 L;  2JA8 H;  1HNZ Q;  2UXD L;  4UP7 A;  4NB3 A;  1XNQ L;  2ZM6 Q;  1YNX A;  3PV0 A;  5ELN A;  2UXC L;  1VQC A;  4DKA C;  4A3B G;  3EIV A;  4JCV E;  2UUB L;  2R7Z H;  4OXP A;  4DR4 Q;  4LF4 L;  1HZB A;  2UXB Q;  4JI4 Q;  4IO9 A;  2N78 A;  2YTX A;  4DV1 L;  3H3V H;  4APV A;  1X56 A;  2QA4 A;  4DV4 L;  1PH5 A;  1PYS B;  4LUV A;  3UE0 A;  2OQK A;  3OTO Q;  1SN8 A;  1IL2 A;  3DM3 A;  5DLQ E;  3UDX A;  4BXX G;  3J81 c;  4JI8 L;  1EIF A;  4DV6 L;  4LFA Q;  1Z47 A;  4AIM A;  4DR5 Q;  2WFW A;  4AQY Q;  1AE2 A;  3HOW H;  4IFD I;  1JT8 A;  1VQD A;  2AHO B;  3L7Z C;  3TRE A;  2IY5 B;  1S40 A;  3PUZ A;  3J7Z C;  1YEZ A;  2HIX A;  1HZ9 A;  2Y0S G;  5IYC H;  4K0K L;  2VUM H;  2UUA L;  1UE1 A;  1GO3 E;  2IT1 A;  4DV2 L;  4JI1 L;  1FJG Q;  3CME A;  1XMQ Q;  1HNZ L;  3K7U C;  2VZA A;  5JEA J;  2ZM6 L;  4P71 A;  4DUY Q;  1W2B A;  4C2M H;  1Q86 C;  3TS2 A;  4A3G H;  1PH2 A;  4JV5 Q;  1X9N A;  3CMA A;  3PUV A;  1IBL Q;  3K81 C;  4JI6 Q;  4DR4 L;  2V1C C;  4OWW B;  2C35 B;  4QY7 A;  1VQM A;  1EQR A;  4JI4 L;  2UXB L;  2IX1 A;  3GDE A;  2Q2H A;  4GOP B;  1Y14 B;  3I2Z A;  3ULP A;  3S2D H;  2YU9 H;  2OCE A;  4B3S Q;  1KQS A;  2WP8 J;  2KCT A;  2RHS B;  5IYB H;  3OTO L;  4GNX B;  3T1Y Q;  4YWL A;  4LF6 Q;  4UY8 C;  4LF8 Q;  3BJU A;  4A4I A;  4BY7 H;  1BBU A;  1XPU A;  1VQN A;  1S3O A;  2BA1 A;  4IJH A;  1SLJ A;  4TVA B;  2YV5 A;  4DR5 L;  2HIV A;  4AQY L;  4LFA L;  4JI0 Q;  3RN2 A;  4R4Q A;  2MFI A;  2R7D A;  3U4Z A;  4A3D G;  3BZC A;  1Q1E A;  3S24 A;  5LMN Q;  3AQQ A;  2Z0S A;  1YI2 A;  4JI2 Q;  4EQ5 A;  3CCQ A;  3J80 i;  1XMQ L;  4JI3 L;  1HJP A;  5IP9 H;  1A62 A;  5IWA Q;  1Y1V G;  4DUY L;  4A3C H;  2B63 G;  4YWK A;  5GRO A;  3PIO A;  4JV5 L;  1X3G A;  1PH1 A;  1IBL L;  3WWV A;  4JI6 L;  3NBH B;  1SMX A;  4PMW A;  4IOC A;  4H02 A;  4LWC A;  2ID0 A;  1A8V A;  1E1O A;  1WCM H;  4L5S A;  3PUY A;  1X65 A;  4P74 A;  4B3S L;  4MNO A;  1TWH H;  1K9M C;  1SR3 A;  2N49 A;  1NE3 A;  1TWG H;  4P73 A;  4POF A;  1TWC H;  2Q2T A;  3I4N G;  2R92 H;  3FKI H;  1K8G A;  4GS3 A;  1WI5 A;  3T1Y L;  2EXD A;  1L1O C;  4LF6 L;  2JEA I;  4LF8 L;  1OXU A;  3PO2 G;  2K50 A;  3M4Q A;  1OXX K;  1PH4 A;  1YJN A;  1K3R A;  3S17 H;  1UWV A;  4WJ3 M;  1Y1W G;  4JI0 L;  1KRS A;  3CC7 A;  1N33 Q;  2JA7 G;  4XIG S;  2HQL A;  3ULL A;  1WYD A;  3E9H A;  1HR0 Q;  2YTY A;  5LMN L;  2CQO A;  1X3F A;  4OWT B;  5ELO A;  5C0X G;  4JI2 L;  1B7Y B;  1PA6 A;  5IWA L;  3GTL H;  4HJ5 A;  1YHA A;  3KF8 B;  1VQ8 A;  4HIO A;  3AYH B;  3CP0 A;  2VS1 A;  4EX5 A;  2JK8 A;  4GKJ Q;  4X62 Q;  3M85 A;  4BBS H;  1G6P A;  3K8A A;  1E1T A;  1VCI A;  2ZTD A;  4TQU S;  4X65 Q;  3H15 A;  4IFD G;  1K0R A;  2E2I H;  3J80 c;  5IP7 H;  3GO5 A;  5M3F H;  2PI2 E;  4AYB E;  5C44 H;  4JG2 A;  4A93 H;  2PNH A;  5C4X G;  4DUZ Q;  4AH6 A;  3M9B A;  1VQ5 A;  2PI2 A;  2E2J H;  1TWF H;  2GVA A;  3G71 A;  1N33 L;  1LUZ A;  1OXS C;  4AYB G;  3G4S A;  1HR0 L;  3HKZ G;  1VQF A;  3HOZ H;  1PH8 A;  3HKS A;  2GN5 A;  3UDF A;  1N32 Q;  1L1O A;  2R93 G;  1VQO A;  1UEB A;  1NMG A;  4X62 L;  4OO1 I;  5AJ3 Q;  2CWA A;  3CQZ H;  3S1M H;  4X65 L;  2LXJ A;  3RZD H;  1SFO H;  4DV0 Q;  1EWI A;  3G48 A;  4IPD A;  1P16 A;  4UPA A;  5J3B A;  4X66 Q;  4LF5 Q;  2IX0 A;  5M5X H;  2BH2 A;  1NMF A;  4GLX A;  2ASB A;  4YCW A;  1I50 H;  4LUZ A;  5IYD H;  1Q8K A;  1NY4 A;  4L5R C;  4LFB Q;  1A63 A;  2OWO A;  1PVO A;  3HOX G;  4GOP C;  2HT1 A;  3KJO A;  5C3E H;  4DUZ L;  4A3L H;  2BH8 A;  3HFZ B;  1G29 1;  3RR5 A;  4YCU A;  3HOY G;  2NVY H;  1PV4 A;  3CPW A;  1AE3 A;  4GNX C;  1ASZ A;  2Q2I A;  3OW2 A;  2Y0S E;  1CUK A;  4PZ6 A;  3JAM i;  5GAD C;  2Z6K C;  1QVF A;  1FVI A;  5E7N A;  3CCS A;  1QZG A;  2F52 A;  4IPG A;  3STB C;  4A3M G;  1YBY A;  1VQ6 A;  1OXT A;  4JC0 A;  1EIY B;  3HOV H;  2YYZ A;  4FDB A;  1N32 L;  3RN5 A;  5GAH C;  1XNR Q;  2JEB I;  1KRT A;  4JBW A;  1CKM A;  2D0O A;  3T1H Q;  1GKH A;  5BR8 Q;  3H0G G;  4DV0 L;  3AEV A;  3TQY A;  4RMF A;  4X66 L;  4BBR G;  5M3M H;  4UP8 A;  1XPO A;  2K4K A;  4BY1 H;  4DV3 Q;  4LF5 L;  5JJK A;  2K5H A;  3CCU A;  5JJL A;  1YJW A;  4LFB L;  2KCM A;  1L0W A;  1PH6 A;  3M3Y H;  1YHB A;  4YHH Q;  2JA9 A;  1YIJ A;  1S72 A;  1MJE A;  4A3E H;  4L5T A;  2JA6 G;  3TRZ A;  4LFC Q;  1I3Q H;  4BA1 I;  1O7I A;  2DUD A;  1JB7 A;  3KFU A;  1JJC B;  2JA8 G;  3PO3 H;  3E0E A;  5FJ8 H;  4GKK Q;  2JA5 H;  1CKN B;  1KC8 C;  1N34 Q;  4GLA C;  4GOP A;  2R7Z G;  4DR1 Q;  1UE5 A;  2JQO A;  1PH3 A;  2LXK A;  4QL5 A;  1XNR L;  3JAM c;  4O2D A;  2I5L X;  2I0Q A;  4L5Q A;  3W1B A;  3CCV A;  3T1H L;  5BR8 L;  4C3I H;  3PIP A;  1K83 H;  4GNX A;  1FJG L;  4X6A H;  3W5O A;  3SGI A;  1VQL A;  5M5Y H;  1HNX Q;  1XMO Q;  2MO1 A;  4DV3 L;  2Z6K A;  1FGU A;  4PZ7 A;  1KL9 A;  4A3F H;  4NPS A;  4A3K H;  1MKH A;  2HHH Q;  2E8G A;  1C9O A;  4YHH L;  2E2H H;  1YIT A;  3HOW G;  3CCJ A;  1C7Y A;  1VQ9 A;  2E5L Q;  4LNQ A;  1Z9F A;  1KD1 C;  3KDF A;  4DAY B;  3S1Q H;  4JOI C;  4OO1 G;  2JJQ A;  5IYC G;  2MQH A;  4A3I H;  4LFC L;  4GN3 B;  3RLN A;  1VQ7 A;  2VUM G;  1HNW Q;  3K7A H;  4DR6 Q;  1VQI A;  3GD7 A;  1PH9 A;  3CCL A;  2K5N A;  4R4O A;  2VNU D;  2VW9 A;  2NZH A;  4GKK L;  3UE1 A;  1E3P A;  1U5K A;  1SRO A;  1V1Q A;  1W3S A;  2I5M X;  2K52 A;  1VQ4 A;  2A1A A;  1N34 L;  4A3G G;  1QUQ B;  4A3J H;  4DR1 L;  3CXC A;  1Q12 A;  4PG3 A;  3AFQ A;  5HY6 A;  3I4M H;  5FLM H;  3KF6 B;  1VQP A;  4NXN Q;  4JYA Q;  2CFM A;  3RLO A;  4B3M Q;  3CCM A;  3J7A 5;  3KYH C;  1GM5 A;  1L2F A;  1HNX L;  1XMO L;  1R9T H;  3EN2 A;  2KHJ A;  3I4O A;  4PZ8 A;  5IYB G;  3F2C A;  3NEL A;  2L15 A;  4IPH A;  4Y7N H;  3PO3 G;  4BY7 G;  2HHH L;  1K73 C;  2NVQ H;  3ER0 A;  1PHJ A;  1NTG A;  2D62 A;  2K75 A;  4JBM A;  2E5L L;  2WB1 G;  1UE7 A;  3PF5 A;  4MZ9 A;  1AH9 A;  1HNW L;  3GTM H;  3HKZ E;  1H95 A;  4DR6 L;  4A3B H;  3CC2 A;  4IJL A;  3NEN A;  2PQA B;  1MJC A;  5IP9 G;  3CCR A;  1XPR A;  3ICE A;  4UP9 A;  5FLX c;  1E22 A;  4A3C G;  1LYL A;  1CKO A;  1M90 C;  4QGU A;  4KHP Q;  3CC4 A;  3U50 C;  5GAG C;  2YTV A;  4X64 Q;  1FL0 A;  3PCO B;  2B3G A;  1WCM G;  4C3J H;  1V9P A;  2F3I A;  4JOI A;  4NXN L;  4JYA L;  2D0P A;  1Q81 C;  1QZH A;  1YVC A;  1KHI A;  2BA0 A;  4BXX H;  3AFP A;  3K80 C;  1GD7 A;  1U0L A;  2R92 G;  3S14 H;  3FKI G;  4GKJ L;  3GTP H;  2AWO A;  4OWX B;  2KBN A;  2CWP A;  5IT9 c;  4LF4 Q;  1PYB A;  2FXQ A;  4DV1 Q;  5C0X J;  2WAQ E;  1L1O B;  1JE5 A;  4HID A;  1IBK Q;  3BU2 A;  2Q2U A;  2IHF A;  3MXN B;  4XTC S;  2ES2 A;  4HIK A;  2UU9 Q;  3S1N H;  3S16 H;  2B29 A;  3IRB A;  1N36 Q;  1Q7Y C;  5JEA G;  3F2B A;  2CKZ B;  2WAQ G;  2QGQ A;  1CSP A;  1ASY A;  4IFD J;  3RNU A;  1EUJ A;  2OTL A;  1VQH A;  4BBS G;  4KHP L;  4Y52 H;  4R4I A;  2ZTE A;  4RG1 A;  4X64 L;  4GN4 B;  4B3T Q;  3PUX A;  5GAE C;  4K0K Q;  2NN6 I;  3OYY A;  2XGT A;  2I5H A;  1MIU A;  1TXY A;  5IP7 G;  3I55 A;  1EOV A;  5M3F G;  4B3R Q;  4YWM A;  4HJ7 A;  2K14 A;  3MEF A;  3GTQ H;  3UDI A;  5C44 G;  4A93 G;  2VL6 A;  3B6Y A;  5LMU Q;  4DK3 C;  1XJV A;  3ULJ A;  1D7Q A;  1HZA A;  5AJ3 L;  4JI5 Q;  1BKB A;  2OTJ A;  5LMN W;  4C3H H;  3U58 A;  4A3D H;  1DGS A;  3CF5 A;  1JJG A;  3PUW A;  3W1G A;  2RHQ B;  3J81 j;  4A76 A;  2AKW B;  1V43 A;  5C0X I;  4HJ9 A;  1XTD A;  1PFS A;  2GVB A;  5HGQ A;  1VS0 A;  3S1R H;  1IBK L;  1Y1V H;  2PMZ E;  4J15 A;  1X55 A;  4QJF A;  2LSS A;  3G6E A;  2B63 H;  1UE6 A;  3HOZ G;  2JE6 I;  2UU9 L;  3GTJ H;  2R7F A;  1N36 L;  1VQE A;  1E7Z A;  2OQ0 A;  2RF4 A;  1RIP A;  3GTG H;  1KAW A;  1VQG A;  2RCN A;  3PF4 A;  4NXM Q;  2NVT H;  5JJI A;  4YY3 Q;  4KHZ A;  3CW2 C;  1NBW A;  3CD6 A;  2IHE A;  2R6G A;  4R4T A;  2ZJR A;  4B3T L;  1IXR A;  1Q1B A;  5C4J H;  3I4N H;  1I5F A;  3D0F A;  2CCZ A;  1KXL A;  4P72 A;  3L0O A;  3F2D A;  1IBM Q;  4JI3 Q;  3PO2 H;  5IYD G;  2MO0 A;  4DR7 Q;  4B3R L;  1X54 A;  1WOC A;  4KI0 A;  5LMU L;  2KEN A;  1Y1W H;  1HR0 W;  3CPF A;  4IPC A;  2VY3 A;  4JI5 L;  5C3E G;  4HJ8 A;  3ZJY C;  3CAM A;  2JA7 H;  4JBJ A;  4A3L G;  4WJ4 A;  4IOA A;  5GQO A;  1VQJ A;  1X6O A;  2NZO A;  3VDY A;  4GLV B;  2KHI A;  2N8N A;  3KOJ A;  4JI7 Q;  4BA2 I;  4LUO A;  3TEH B;  1CKN A;  1J6Q A;  1P8L A;  1EQQ A;  1I6H H;  3F8T A;  3U4V A;  3FP9 A;  4DV5 Q;  3HOU H;  4MTN A;  3A5Z B;  4P75 A;  2ZTC A;  1E24 A;  3KLW A;  1LM0 A;  3HOV G;  1JMC A;  4NXM L;  3GTO H;  1N8R C;  4YY3 L;  1TWA H;  4ALP A;  3TS0 A;  1YHQ A;  4QQB X;  2H5X A;  4YCV A;  3RZO H;  2A19 A;  3L2P A;  4O0A A;  1YJ9 A;  4BY1 G;  5M3M G;  3I56 A;  3KDF B;  4LF9 Q;  1XNQ Q;  3E9I A;  5C4X H;  3CCE A;  1IBM L;  1VQA A;  2N3S A;  4QIW E;  2VQE Q;  4DR7 L;  3A74 A;  4JBK A;  4DV7 Q;  3I7F A;  1YZ6 A;  1J5E Q;  2ZJP A;  2VQF Q;  1EYG A;  5EAY A;  1N9W A;  1VQB A;  3PSI A;  2F4V Q;  3JC6 6;  3K0X A;  4A3E G;  1NJI C;  2WB1 E;  4JI7 L;  1QVG A;  1SE8 A;  2A8V A;  2NN6 G;  3PGZ A;  3EBE A;  4OX9 Q;  3DLL A;  1Q46 A;  1QUQ A;  2DGY A;  3D31 A;  5H1S E;  4DV5 L;  5FJ8 G;  2R93 H;  2JA5 G;  2UUC Q;  3KF6 A;  3M4P A;  1WJJ A;  1D8L A;  3A5U A;  3UDG A;  1Q82 C;  2NVX H;  3Q8D A;  4LW1 A;  5IE8 A;  3KJP A;  2ZJQ A;  2ALY B;  4A75 A;  3S15 H;  1CSQ A;  4R1J A;  3HOX H;  4DR2 Q;  4LF9 L;  1I94 Q;  2EIF A;  2VQE L;  4GN5 A;  4A3F G;  1T9H A;  3HOY H;  1X3E A;  4DV7 L;  3HOU G;  3M7N A;  2AMC B;  4DPG A;  4A3K G;  1WFQ A;  1J5E L;  2ATW A;  3ERS X;  1SRU A;  2VQF L;  4DR3 Q;  1GVP A;  1VQK A;  2F4V L;  4B3M L;  1A0I A;  5M5W H;  4LF7 Q;  2UXD Q;  5K36 G;  1IYJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...