1SYGA

Engineering alternative beta-turn types in staphylococcal nuclease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKANNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Engineering alternative beta-turn types in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 40
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sygA00
1STAA 4KD3A 4B9XA 1JOKA 3LX0A 1EYAA 2F0OA 2F0IA 3NXWA 5I6YA 1EY6A 4K2LA 3SR1A 2PW5A 3EVQA 5J39A 3T16A 5KYLA 4MIUA 4K5VA 2F3VA 4RKLA 1SNDA 5KIXA 2KHSA 4NDXA 1EZ8A 1SNOA 1TQOA 2EYJA 2F0UA 2OEOA 3BDCA 3NP8A 2EY5A 3P75A 3QOLA 4ODGA 5CV5A 5E3FA 4N9TA 4DFAA 1A3TA 5C6AA 1NSNS 1TR5A 2F0MA 3P1HA 1SYDA 1KAAA 1STGA 2SNSA 4ID6A 5IGCA 1EY4A 4J6HA 1EZ6A 1ENAA 1ENCA 2F0QA 2ENBA 3NK9A 2F3WA 5EKLA 3RUZA 1A3VA 3SK5A 4IZ8A 4KD4A 5HGTA 3TP7A 3TP6A 5I6WA 5C4ZA 2QDBA 3D4DA 1EY5A 5CR3A 5CV6A 4HMIA 3E5SA 3NHHA 1AEXA 3D4WA 3H6MA 3PMFA 4HMJA 2F0VA 4NKLA 1NUCA 1SYEA 3SK8A 5I9OA 2OF1A 4ME5A 5E1FA 4KJNA 2HQEA 2F0WA 4IUNA 5CC4A 2PQEA 2WACA 1SYGA 2F0FA 3MVVA 5C3XA 3D6CA 4PNYA 4K2KA 2EXZA 1F2MA 3OMCA 4WORA 3HZXA 4S3SA 1KDAA 4N9PA 2EYOA 5C3WA 1STYA 2F0KA 4KY6A 4WRDA 2F0HA 2F0NA 4YIJA 5DAUA 5DEHA 4DF7A 4K14A 2NUCA 2F0LA 2PZTA 4H7BA 4J1MA 4KY7A 4LAAA 1SNCA 2F0SA 3NUCA 4G57A 2EY1A 3ERQA 5CV8A 5IGEA 2F0PA 4OL7A 4QMGA 5IGBA 3OMGA 2PZWA 5F2DA 2SOBA 5IOCA 1EY7A 2M00A 3DHQA 3S9WA 1KDCA 1SYCA 3QB3A 4NMZA 1SNQA 1U9RA 1KABA 2EYFA 1SNMA 4K5XA 4RKBA 1EQVA 1TT2A 3SK4A 4DGZA 3T13A 1JORA 3MEHA 2EYMA 1RKNA 2F0EA 3TP5A 2LKVA 5J22A 1JOQA 1A3UA 1A2TA 1KDBA 4KV6A 5K5PA 3C1EA 3C1FA 4R8NA 3DMUA 5KEEA 3TMEA 4HTHA 4PMCA 2KQ3A 4PMBA 1SNPA 1STNA 1F2YA 4ZQ3A 5J1ZA 5NUCA 4ZUJA 3U9OA 4B9WA 5HURA 1IHZA 4EQOA 4IALA 3ITPA 1EYDA 2F0DA 1EY0A 5C5MA 4E6IA 5CV4A 3D8GA 4K8JA 2EYHA 5KRUA 3NQTA 4ZUIA 3SXHA 2EYLA 3TP8A 1A2UA 2F0TA 1SYFA 5JOBA 1JOOA 4I65A 4K8IA 5CV9A 1II3A 5KYIA 2SNMA 2EY2A 3MXPA 5EGTA 4DU9A 5JAVA 3MHBA 5ISRA 2O4XA 4K5WA 2F0JA 3EROA 3MZ5A 4KHVA 4NP5A 5C5LA 3R3OA 4KY5A 2RBMA 2F0GA 4QF4A 1EY9A 3OWFA 3SK6A 5IGGA 3HEJA 5IIFA 3V2TA 5IGFA 2PW7A 1EY8A 1EYCA 4TRDA 3BDLA 1STHA 5IGDA 5CV7A 4EVOA 5I9PA 3EJIA 4QB4A 5IODA 4KJOA 4F8MA 3OSOA 2PZUA 2EYPA 3QOJA 5EKKA 5KGUA 1SYBA 4KTAA 2RDFA 3SHLA 5C4HA 1F2ZA 4EQPA 2OXPA 4K6DA 3VA5A 2PYKA 5CGKA 2RKSA 1STBA 4F7XA 5M9OA 2EY6A 4EQNA
chains in the Genus database with same CATH superfamily
3S2DB 1I3QB 3OIQA 4XT1B 2HCCA 5DLQE 3K80C 1JT8A 1XTDA 1HJPA 2QEJC 4G7ZC 2ZXRA 4LJZC 1I4HA 3CU7A 5EQ0A 4BA2I 1WFQA 3NWSA 3QG1A 2PMZE 5EBCA 1LYLA 3CC4A 5FO9B 1C8CA 3A54A 2F0QA 4GN5A 1JMCA 4GOPB 4GNXC 1MD2D 3P7JA 2QF7A 5KNDA 1BXTA 2PO4A 2L9HA 5I9OA 3S16H 2OF1A 5LMNQ 1CI3M 3QO2A 3PO2G 4IUNA 4O2DA 1X32A 4AH6A 1VQKA 1SYGA 2ZT9C 5C3XA 3WDNA 2CWPA 3HZXA 3CHBD 2CFMA 3I2ZA 4KY7A 1TWGH 4H7BA 3TRZA 4DAMA 1SNCA 2F0SA 2K04A 3IRBA 4C3JG 3J7AV 1RCVD 1UE5A 3JAMc 3A74A 5F2DA 2YTYA 4WJ4A 3O13A 1SJHD 5M3MG 1EOTA 5IYDG 1LTGD 1SSOA 4LWCA 3M4PA 1WTHA 1PLFA 3TP5A 2KCNA 1DZ1A 1K0RA 2HDMA 5BR8L 2EZVA 2YV5A 3KF8A 5EBDA 1IHZA 2R93H 2XTIA 2KEDA 4GLAC 3J7A5 5CV4A 3D8GA 4BY7B 3ICEA 1PA6A 2XSCA 3CCVA 4DNIA 1BDOA 1B3AA 1TVXA 5ELBA 4LF8L 3CMAA 4UAIA 1BBXC 3K5OA 1CA5A 1TWFB 3PSIA 3M4YA 2MO1A 2O4XA 1MIUA 2K1BA 1ICWA 1I94Q 2OTJA 1QUQB 4XYOA 2VUMG 3AU7A 3OIPA 1IBKL 4A93G 4RMFA 4TRDA 3HG9A 3TBIB 3PGZA 5IODA 1KAWA 4CJ2C 5KGUA 3UDIA 3I7FA 4A3CH 1M90C 3ZYYX 1VQGA 4FXDA 1UE7A 4IJHA 4JOIC 3K7AB 3W1GA 4KKSA 5JJIA 1OXVA 5AJ3Q 1Q81C 2KHSA 2MQHA 4B3MQ 1SMYC 3H0GH 5FLMG 2JA5G 2QCPX 1STGA 2GA4B 1SE8A 1CQVA 3BYTB 2VZAA 1BCPF 3S17B 2KOLA 3G71A 2JYOA 1J6QA 3HOVB 3BDOA 5C3EH 4FXKC 1V43A 4CDDC 3HKZB 2MHVA 3DXJC 1PYBA 3G7LA 4KJNA 2WAQB 1ZEQX 1Y8NB 4A3FH 5M5XH 3I4NG 1VQIA 2SDFA 3OMCA 3VYUA 3PF5A 1I6HH 3MXGA 4AYBB 3LGJA 1PTOF 1HFNA 5IGBA 1NTGA 3DHQA 1IW7C 2HD3A 4LF8Q 4C3IB 3A5UA 2OTLA 1WCMG 4DAPA 4RKBA 5JJLA 1J5EQ 1QZHA 3CXCA 3K5NA 3JAMi 5JJKA 3OPOA 2RDGA 5C4JB 1F9SA 2KQ3A 1IBKQ 3SEBA 5IY0A 1AZPA 1B2TA 3PUZA 2F0DA 2B39A 1XNRL 2NBFA 4DR6L 1K83H 3DEOA 3SXHA 5C4XG 1NAPA 3RN2A 2F0TA 1X3GA 5GADC 3NQIA 4X65Q 2SNMA 1HR0W 3HKZE 3HOZH 3MHBA 1U5KA 4KY5A 4IUPA 5CBEE 2D0OA 1JWSD 2ZTEA 1K3RA 3FPPA 4KMUC 4JPBW 3NENA 4BA1I 4IPDA 1L1OA 3EQLC 4L5QA 4RGTA 1HTPA 1ONLA 4U673 2I46A 4Y52H 4AYBE 3QOJA 5EJWA 1SBBB 2C9OA 4LF4L 2SOBA 4LFCL 3MFGA 2HQLA 1PTOC 2L12A 3HOUG 1EY6A 2IX1A 4C2MH 2E2IH 4ZRZA 4RKLA 1JJGA 2BE5C 3D31A 2EQSA 2WIIB 1HTLD 5E3FA 1GHKA 2EY5A 5CV5A 4KKTA 2MUYA 2Q8IB 3RMHA 1KC8C 2EXDA 3CC7A 4LF7Q 5IYBH 1MBYA 1PYSB 3RLFA 4B08A 2AQ3B 3CF5A 4YCWA 4KD4A 3G4SA 3FKIG 3T1HL 1OXSC 5EPJA 1CK1A 3CCRA 3PMFA 1YHBA 4DXFA 2E2JB 5KNCA 1B70B 1X65A 4NB3A 1E1OA 3PQIA 1MJEA 2KECA 4YIJA 2F0KA 2J7ZA 1R4QB 2A1AA 3RUZA 2WKCA 4KHPL 2Y0SB 4IPGA 1VQJA 3MEFA 3H3VI 3OMGA 1GUOA 2JSOA 5IOCA 4LF6L 1SROA 4A3EH 1BBUA 5M3FH 2B2VA 4JI2L 5ELDA 4IO9A 1BR9A 3QB3A 3T13A 1U4RA 3OTOL 3S14B 3Q24A 3J7AF 3S2HH 3PV0A 3CC2A 1AE2A 5FLXE 2JA7H 2WB1B 3TS2A 4YHHQ 5FJ8H 2WINB 2KCCA 3ERSX 1WTOA 3E9IA 4HCSA 1WTXA 4LFCQ 5JPMC 4NXNQ 2O5JC 4AQYQ 2Q8TA 3I70A 4DU9A 1WD1A 1PTOH 1T5XD 2Z6KA 1HCZA 1R4PB 1QOHA 4BBRH 4QQBX 1EIHA 4GKJQ 2N55A 1UNSA 1S5BD 1EYCA 1I4RA 4JVZA 4NPSA 3HS0C 3T4AC 1BCPB 4QCLA 1D5MC 4IOCA 3EN2A 4X62Q 2Q2UA 2BDNA 2Y0SE 4KLKA 4DV2Q 1JICA 2DN8A 5G3LF 4F7XA 1XMQL 2VY3A 4X66L 1F9QA 5JEAH 4O0AA 2F0OA 2HT1A 4HSVA 2C5CA 4K2LA 1NBWA 3GTPH 3WWVA 1B44D 1SNDA 1KL9A 3K58A 3HOXH 3VR4A 2ZJPA 3M3YB 1EIFA 3KK7A 3TZDA 1WTRA 3KF6A 4JI4L 1CKNB 2R93G 3BG3A 2WB1E 5DM63 2ASBA 1PXUA 3CCQA 1JWMD 4QIWE 3BVZA 5IWAL 2K52A 4L5TA 1ML0D 5CR3A 2NVTH 5ELCA 4R4TA 1MHWC 4LF5Q 1J8IA 1Z9FA 3AB9A 5CORA 4LMQD 2F4VL 1EEFD 1VQFA 5TSSA 1VF5C 4JBMA 3KBGA 3D6CA 3NBIA 1CA6A 3OTOQ 1IL8A 4KY6A 1WJJA 2YYZA 5DEHA 3S15B 2CWAA 3NBHB 4G57A 3QJYA 4K0KL 2NVYH 4JYAQ 1QZGA 4WJWA 4DV3Q 4A3CG 1SMYD 1KDCA 1Q3LA 1SNQA 3J80E 3UI2A 3DLLA 3GTOH 3MEHA 1LTSD 1STEA 4GLXA 2WFWA 3D4RA 3H0GG 2R7ZB 2UUAL 4Q0FA 2NZ1D 3DMUA 1K8GA 4HTHA 1HR0Q 1Y8PB 1LV9A 3V96A 1PH8A 2G9HD 2NVQB 2B2WC 3E0JA 1ASZA 1CKOA 4G7HC 5A2QE 5C3EG 3TSSA 1CZGA 3CRKC 3F8TA 5CV9A 2K50A 4ALPA 4JV5L 2QEXA 3I8ZA 2QA4A 4A3MB 4BY1H 4A3FG 2RBMA 4DK1A 1CM9A 5M3MB 4OHJA 3KLRA 1F2LA 3S1NH 2HUGA 3M7GA 2Z8LA 4IUTA 2PW7A 4A3IH 1VQ7A 1S4ZA 4DV7Q 4BBSB 2N78A 2I0QA 4JI4Q 2DUDA 3M85A 1U4LA 3SHLA 2RDFA 3URYA 4G4KA 1B53A 1TWAB 3MXNA 2EY6A 4X64Q 3LX0A 2VW9A 2PI2E 3Q0AA 1OTCA 4OWWB 1LTTD 5J3BA 1AP0A 3H3VH 4DAYA 1O7YA 5KIXA 1YJ9A 3GDEA 1K28A 1K8MA 4ODGA 3KF8B 4IFDH 1D1IA 1E2WA 2D9UA 1CUKA 1LLRD 2VQFQ 2BA1A 2ENBA 4DAVA 4K0KQ 3RN5A 1JB3A 1BF4A 4DV4L 4L8JA 1Y1VB 1E7ZA 3I4OA 3BZDB 3A7LA 4CDCC 4JI6Q 2AKWB 3HOZG 5M5YB 2EE1A 2E5LL 5GROA 1IZ6A 3FHWA 4N8X1 4GOPC 4DUYL 1QNKA 5E4WC 4IURA 2BOSA 4JI1L 1ICFB 1S40A 1PTOD 2VQEQ 1BO0A 5HGTA 2Q8RE 1PYWD 4HJ8A 4MZ9A 2EIFA 2B8GA 2BE5D 5EPLA 3X3MA 4FO2A 1AE3A 5BN4A 4DR1L 2A6HC 1YZ6A 1SE2A 3UDGA 4DKAC 3NEMA 4PV1C 2IJ0A 3SK4A 1JOQA 2PPBC 4DNRB 2Q2HA 3LWEA 1XTCD 1PRTF 2H5XA 2A6EC 3KJOA 4Y7NB 1TWCH 5IYBG 4KKUA 1EY0A 4DV6Q 5KRUA 1Q8IA 2K01A 2E2HH 4DPGA 1TY0A 1FR3A 1XPOA 1N33L 3K81C 2O2LD 4YWKA 2A8VA 1NJIC 2PNRC 4A3JH 1EU4A 2H4OA 1KRTA 1B8AA 4QF4A 3ONAB 3TEHB 2FHTA 1E0BA 3TREA 5IGDA 1I3QH 3S2DH 4NW2A 2PMZB 2B63G 5JPNC 1UUPA 1NE3A 5C4HA 5JEAJ 4A3EG 5M3FG 3HOYG 4MTNA 1WVLA 3NWTA 4YWMA 1E1TA 4MIUA 2E5LQ 4HIOA 2UXBQ 4QJFA 4JG2A 4OEMB 3CCMA 4NDXA 2MO0A 4DR4Q 1FNWA 2BA0A 1NMFA 4JI1Q 3RLNA 5CBAE 4HIMA 1Q8KA 2Z6KC 1EEID 3W3AA 1QVCA 1G6PA 2I5HA 1N36Q 3M4OH 3NK9A 4LFAQ 5FK9C 5FJ8G 4DR1Q 4H13C 3TP7A 5C4ZA 1QE6A 4ME3A 2PI2A 4HMJA 5ELFA 1G2TA 4H44C 4BBRG 4PNYA 4RWSC 1F2MA 1L1OB 1WTQA 2F0HA 4YCVA 2XRQD 1D1KA 4GLVB 4J1MA 1JCKB 1VMCA 1QCBD 1U4PA 4R4QA 3I4MB 4CHTB 4XQQA 1VQLA 3GTMB 1HZAA 1BBWA 5JEAG 1PH9A 1N33Q 4CGYB 2CKZB 3IFDA 4KN7C 4QY7A 1KDBA 4JBJA 2RA4A 3FKIB 3HOXG 4BY7H 3S1MB 1YITA 4HJ5A 5GAEC 3A56A 1Q46A 1YJNA 4ZQ3A 2IX0A 1WOCA 2JA6G 2KJXA 3PO3B 2J4XA 1TWFH 4FF2A 4RHRA 2UUCQ 1CHPD 5C5MA 1HUNA 1F77A 2NN6H 4POGA 4RGOS 1VQPA 4LUVA 1Z47A 3R93A 2XWJB 3RZOB 1VF7A 4JI5Q 4DK6C 3OW7A 2NB0A 1KXLA 1HHVA 4B3SQ 3WOEA 2JXMB 1GUTA 4IOAA 3HEJA 5IIFA 4M1UB 2XWBB 3K7AH 2D5DA 3ZJYC 2PCFB 1O7LA 4Z9CB 5EKKA 1Y1WG 4YY3L 1F2ZA 2Q2TA 1JE5A 3A8JE 5LMUL 4DR5L 4QL5A 1SN8A 1IL2A 4DV5L 4K5VA 1DXMA 3S17H 2L4NA 1JC7A 5EKIA 5ELEA 2B2TC 1FNUA 4IFDJ 3DM3A 1KNEA 3HOVH 3J81E 4JBKA 1NSNS 3P1HA 2L5TA 3GTQB 4GKKL 4ID6A 1LUZA 1FL0A 4X3KA 1CFMA 1PV4A 3K8AA 3G6JB 1ENAA 1H9SA 2F3WA 1DOLA 3E3XA 3GP7A 1JJCB 1ASYA 2F4IA 4MTKA 3TP6A 5I6WA 1MJCA 3D4DA 1I4PA 4G7OC 1PDQA 1GUNA 4UPAA 2LFNA 4ME5A 1SAPA 2Z6BA 2B2UC 1W6KA 2M9VA 1PRTB 4A3BB 4A3IG 4S3SA 1E24A 1EWHA 4C3IH 4QUFA 4OX9L 1VQ6A 4OL7A 4QMGA 1MSGA 4HIKA 2XIWA 1V1QA 4X3SA 3DEPA 3BZCA 1N34L 1SYCA 5LL6S 4CKEA 2FMCA 1SJED 5A35A 5C4JH 3RLOA 1V8QA 1EQVA 1LT4D 1LTBD 3KBXA 1WTPA 2EJFC 3D3RA 1P16A 3MXUA 4R8NA 3KF6B 1IBLL 1H95A 5KEEA 2LSSA 5BR8Q 3A5ZB 4B9WA 2Q2IA 1XX8A 3I4LA 4LFBL 5EPKA 4IALA 1D2BA 4P2CB 1UAPA 3Q23A 2ZXOA 1VCIA 1CHQD 4YY3Q 4DV0L 2EOTA 1HQMC 3L2PA 2A5HA 3K59A 4JI7L 2K5VA 1WI5A 3I72A 3A0JA 2XNAC 4PG3A 1FGBD 4DV5Q 2L55A 1NR2A 2B2YA 5DNFA 2A6HD 3STBC 3F1ZA 2I5MX 3V2TA 1E3PA 5IGFA 3CCUA 1X3EA 5K36H 3RZDH 2EJMA 4JCVE 1SMXA 1HPCA 3GQBA 3WOFA 1QVGA 2PZUA 3BVGA 2CH4W 2OXPA 4K6DA 4K6LA 2AQ1B 2RHQB 4EGVA 4KD3A 1K0SA 2XVSA 1BCPC 3L3OC 3F2DA 1VMPA 2A6ED 1I50B 2KA7A 5C6AA 2K7VA 3A8KE 1A63A 3VR2A 1HRJA 2KCMA 2Z1CA 4R9WA 4A3FB 2E2JH 3GTLB 3CQZB 3SK5A 1IXRA 3I91A 2E8GA 4F87A 1KLGD 4BWGB 2JA8B 2L0CA 2HQEA 4DN4M 4I7ZC 1MSHA 1ZKOA 1IBLQ 4DXGA 1IYJB 2DJFC 3HOWH 5CC4A 1XMOL 1BNZA 4UY8C 5IGEA 1X6OA 3MXNB 4JI0L 3Q6SA 1XPRA 4DV0Q 2DJGC 3S14H 3S9WA 1X55A 4XQNA 4DAYB 2BH2A 3MFYA 2CH4A 2E2DC 4DNTB 1GJXA 4AIMA 3C1FA 3KJPA 4BXXH 4HJ7A 4XTCS 4PMCA 1R9TB 4DV1L 5HURA 5H1SE 1K8OA 1S5FD 3CPWA 4A3DB 1VQ5A 3ND8A 5I2YA 1XNRQ 1A2UA 4DR6Q 1IKLA 4HEDA 4TSSA 1L0YB 4PMWA 2E75C 2LXKA 3M9BA 3T53B 4APVA 1HH2P 4IFDI 2QGQA 4IJLA 2ALYB 2F3IA 1RHPA 2EJGC 4C3HB 3NE5B 4CDFC 3UE0A 4JI3L 4F88A 4BS9A 4OO1H 4EVOA 1E2ZA 1I4GA 4QB4A 1GUWA 4KTAA 3VA5A 2B29A 4YCUA 4A4IA 2A68C 4J8QA 4QIWB 2F1MA 1STAA 2GVBA 4B9XA 4LF4Q 1EYAA 2DNEA 2F0IA 3A55A 2R92H 1H9MA 5J39A 5KYLA 3IKJA 2YU9B 4O42A 4EQ5A 4BY7G 2F0UA 3CCEA 1KRSA 4GN4B 1JQYD 3CKIB 1SYDA 4A3GH 1GOZA 4C1NI 1TXYA 2CHBD 3JAME 1BKBA 1DOKA 1UEBA 1PH2A 3W1BA 1A3VA 1LACA 3Q22A 2NN6G 4FF1A 4JI0Q 3CCLA 3FVQA 3OOCA 2O5IC 2B63B 1N32L 5M5WB 3T1HQ 5IP9H 1EWIA 1VS0A 2JEBI 2CQOA 3S15H 3OW2A 1D6EC 2ZJQA 5M3FB 3HOYB 2BDOA 2BH8A 2MFIA 3GTJH 3MWYW 4IUQA 3F2UA 1UWVA 1HZ9A 2VXWA 1PMRA 1K3BC 4ULLA 4DV1Q 4HJAA 2K5WA 1D7QA 2RVLA 3NUCA 3ULJA 1PH4A 3ERQA 1A62A 1Q90A 2K5HA 1I4QA 4KHPQ 3DWAA 1EY7A 4R4CA 5JJZA 2R7ZH 3DWQA 1KIXA 4LF6Q 3LNNA 5C44H 4JI2Q 1IYUA 2EYFA 4OWXB 3U58A 2AHOB 2NVQH 1HA5A 1SEBD 4L5RC 4R4IA 1EQQA 3KYHC 2JN4A 2K05A 4GNXA 4A3LH 2K5QA 2A69C 3TQYA 1VQNA 2N88A 4K8JA 2AUKA 1JR0D 3TP8A 3GTGB 4A3MH 3QIAA 1CKMA 1AN8A 1PFSA 5M3MH 4XIGS 4I65A 4K8IA 3I56A 4M8AA 1QB5D 4BBSH 3B6YA 2QDLA 1S72A 4NP5A 2KUMA 5C5LA 2R3ZA 3AYHB 1HZCA 3VDYA 2VL6A 1TWAH 1EUJA 1FJGL 3KLSX 3ULPA 1YJWA 1AW7A 1LTAD 4CKBA 2FFKB 4B3TL 3AEVA 5GAHC 3PO2B 4POFA 2ZXPA 1X3QA 5I4DA 4EQPA 1B9NA 4GS3A 2RKSA 1SFOB 2JA6B 1M1KC 1JOKA 4H02A 1XMQQ 2AMCB 4P73A 4X66Q 1FGUA 1PHJA 1XYIA 3T16A 4PZ7A 4C3JB 2A74C 4DR7L 1RF2D 4XQJA 1IYVA 3C46A 2MGSA 1GUGA 3VR5A 3NP8A 1FYCA 4IN3A 4L63B 4N9TA 1A3TA 2IY5B 1Y1VH 4UDUC 1RIPA 1UEAB 2Z4IA 5M5YH 1HFGA 2M2LA 1G291 1I5FA 3KUPA 4IZ8A 1CZWA 5IYCH 3STBD 2KEEA 2IT1A 2UU9L 2HHHL 5IWAQ 4P72A 3NHHA 1K8AC 4FDBA 1Y1WB 3N6RA 5E1FA 2PQEA 3ULLA 3R8BA 3MVVA 3X3NA 3R2IA 4K2KA 2F4VQ 1F9RA 1V1PA 5K36G 1STYA 2NN6I 2F0NA 1BCPD 4JOIA 5E7NA 5CV7A 2RHSB 1KTKA 2VUMB 3UDFA 1C0AA 2PZWA 2B3GA 1L1OC 2M00A 3UDXA 4A93B 2SEBD 4B3RL 1RTNA 4NMZA 2NTTA 4UP9A 1SNMA 4CJ1B 2F0EA 4XYQA 3M4QA 1A2TA 4KV6A 1WYDA 5CMDA 2WV6D 4A3KH 2UUAQ 3U9OA 1FJGQ 3Q8DA 3IFTA 1H9SB 3ITPA 2R6GA 2JA9A 3S1NB 1K9MC 3OHXC 4RCNA 4N8FA 4A3IB 2JA5B 4FNFA 2NWGA 1X3FA 2NVXB 1VQBA 2F0JA 4JV5Q 2KBNA 4DR7Q 3R3OA 5FLXL 2K5NA 5LL6X 3OWFA 5IGGA 4FF4A 2J0TD 2HCIA 3HOWG 2QW7A 3NELA 1KQSA 3MA2B 5KNBA 1ZXTA 3J7YW 2ATWA 1ENFA 5FOBB 2LXJA 4LF9L 1EIYB 2D62A 3H91A 5IP7H 3I4NB 4EQNA 5JVG3 1LT3D 2R7FA 3TDQA 1G51A 5I6YA 2HHHQ 2DNCA 1S5ED 2B2VC 4DFAA 1Q1BA 1JJ2A 1KAAA 5C0XH 2KVMA 4DK3C 1WCMB 4P71A 3GTKB 2PQAA 2OT2A 1I6VC 4A75A 3S24A 3DWPA 2MP1A 1O7ZA 2CW0C 1WTVA 1PVOA 4DV4Q 1EY5A 5T1IA 3J81i 3PIPA 3TS0A 1VQ9A 3NTIA 3D4WA 5LMNL 1FD7D 1CQFA 4X6AH 4LUZA 5C4XB 2RSNA 3I4MH 4DUYQ 1TS4A 2A68D 5DM73 3GTMH 4OO1G 5C3WA 2UUBL 2OCEA 1X9NA 1TWHB 2PZTA 1B50A 3VYRA 1M8AA 2JA7G 4DA2A 2F0PA 4NXML 1PRTC 3I55A 3S1RB 3FKIH 1MI2A 3S1MH 2A73B 1U0LA 5IT9E 2R92G 2UXCL 3L0OA 1KLUD 4K5XA 3PO3H 2F52A 1RKNA 2E2HB 1Q7YC 4Q5VA 3F2BA 1YNJC 1T9HA 1VQDA 3VA7A 3HOUB 1GXDC 3FEWX 4A3GG 1PH1A 3F2CA 5NUCA 4MNOA 2ZTCA 1V9PA 3RZOH 5BN5A 1EOVA 3I3CA 1VQOA 2G5DA 4FYDA 3PUXA 4LF9Q 1VQ8A 4JI8L 3J80L 1LO5D 1HNXL 3PUWA 1N8RC 5IP9G 1XNQL 2JJQA 1I94L 2TMPA 1B1ZA 3T1YL 3K6OA 3BVMA 1E2VA 1SE3A 1SXTA 2RCNA 1Z7TA 1YNNC 3EJIA 4F8MA 5FLXc 5A2QL 3CCJA 3GV6A 4C1NK 2ZTDA 2PYKA 1QWYA 2XRSD 3C2PA 3S1QB 2R7ZG 1YNXA 4UP7A 5AJ3L 5C44G 3GTQH 3M4OB 1ESFA 3SR1A 1W6JA 2A69D 2Z9HA 4IUVA 2LY7A 4B3ML 2NZHA 1M4VA 1SNOA 1GKHA 1PFMA 3CRLC 3AMUA 1SDFA 4A3LG 1BOSA 3PIO3 2K33A 1H9JA 2UUBQ 3R2TA 1EZ6A 4WJ3M 2X6LA 5G3LD 3FMCA 4DR2L 1SLJA 4A3MG 1LT6D 4NXMQ 1B9MA 4A3BH 1LABA 4NKLA 4BBSG 2F0VA 2UXCQ 1SYEA 5D14A 1OXXK 1PZID 1LM0A 2E76C 2K4KA 1FVIA 2MPMA 2K03A 1X54A 1ZYRC 3BU2A 3S16B 3K57A 4UHVA 4OGQC 4CBVA 2JK8A 3K7UC 5FKAC 4X3UA 3HKSA 5FO7B 4C56C 3M7NA 2Z4HA 4JI8Q 2KHIA 3OYYA 2LS01 1HNXQ 1TWGB 1J5EL 1KABA 1VQEA 1XNQQ 4DUZL 3FRPB 4OO1I 1EU3A 2EYMA 1B3QA 4BY1G 1HNZL 1TY2A 3T1YQ 1IKMA 1Y1VG 2JEAI 2K6AA 4PMBA 1PH6A 1O80A 2CQAA 2KENA 1EYDA 1XXGA 3A8IE 4X65L 5IYCG 3NTKA 1DD2A 1II3A 2R93B 1VQCA 2EY2A 5JAVA 5EGTA 2AQ2B 2HIXA 1CT1D 5HY6A 3J80c 4CKCA 1PZKD 1S5DD 5AFWA 4IFDG 5BN3A 2IX3A 3C3LA 1YBYA 1J9OA 3A7AB 3OSOA 2JP1A 4O1NA 1I50H 5CGKA 4DR2Q 1STBA 4JBWA 4LUOA 1RJTA 3H94A 3K5MA 1GVPA 2V4DA 5CYUA 5LMUQ 1DM0B 4RGMA 4DR5Q 4RCOA 3NTHA 3CPFA 2B2WA 3GTLH 3P75A 4GNXB 3N52A 3J81j 3CQZH 4HN7A 5C0XJ 4LF7L 4A3KG 1JE4A 2SNSA 4QGUA 2PNHA 3PUYA 3CP0A 2IWHA 1EY4A 4GKKQ 4J6HA 4J15A 2JA8H 1O7IA 2KCTA 3KDFA 3H0GB 1GD7A 1EFID 2R61A 1LT5D 2K75A 1A6XA 3E5SA 2B8FA 3H6MA 1GUSA 1NUCA 2RQXA 4DUZQ 4HSPA 1YI2A 4ZAIA 3AQQA 1YVCA 2WACA 1PFBA 5C3EB 3CAMA 1HNZQ 2EXZA 4JC0A 2IPKD 3JC66 2EYOA 2OQ0A 4ZLTF 2R7DA 2VB2X 4LAAA 4UP8A 1TKWB 5GQOA 4IQZA 5IT9L 4FF3A 3FDTA 5IP7G 5M5XB 3T56B 4OX9Q 3HP3A 5JVH3 1QJOA 3BYYB 1DCZA 1TU2B 1Q86C 2YTXA 5L37A 1W3SA 4L6TB 1Y69U 2H1EA 1F9PA 1I6HB 4TVAB 3RR5A 1D5ZC 1R9TH 3I90A 1RDPD 4DR3L 1EYGA 1K73C 1N34Q 4A3JG 1TT2A 4DGZA 1JORA 2WAQE 4OONA 5J22A 1WTWA 3VYTA 4A3DH 3G48A 3TZUA 1OXUA 4IPHA 2K32A 1GO3E 2I07B 2CW0D 4XT3B 4XXEA 5C0XG 1F2YA 4ZUJA 1ESRA 1VQAA 1AZQA 4LFBQ 4YHHL 3KOJA 2AWNA 2DY7A 1GM5A 4NXNL 5I2XA 4GOPA 1VDZA 4RA8A 4AQYL 3VR6A 3RZDB 4OIKA 4P74A 4C3HH 5JOBA 3PIOA 5KYIA 3MXPA 1CSQA 2ICIA 4JI7Q 3AFPA 1G2SA 3V05A 1UE1A 1K83B 4GKJL 4U68A 3MZ5A 3D6WA 4KK7A 3I4MG 1OO9B 3VR3A 4KN4C 1PRTD 3SK6A 3SDZA 2AUJD 1V1PB 3GD7A 1KD1C 4X62L 3HOZB 2TSSA 2OWOA 4DV2L 3J80i 2FINB 2EYPA 3QWNA 2YU9H 1BUVT 1G8ZD 1D8LA 1B7YB 2X6GA 1YNJD 3NXWA 2VNUD 1HUMA 5GAGC 1CSPA 3PO3G 3EVQA 1Y8OB 2IHEA 1A8VA 2CCZA 2EVBA 3TN2A 2EYJA 3IAYA 2OEOA 3DM1A 3QOLA 4DF7A 1AFPA 2F0MA 4CJ0B 4C2MB 1L2FA 2E2IB 5IGCA 2B63H 5M5WH 1G6ZA 4OIJA 1ENCA 2MNAA 4R4OA 1TS2A 5D3DA 1PH5A 3CD6A 1BVSA 1W2BA 1X56A 3HOYH 3HOWB 4LF5L 2N3SA 3M3YH 4KI0A 1ET6A 1YNND 4DR3Q 4ILWA 2F0WA 3J81L 1QUQA 3IL8A 2DY8A 2UXDL 4V0BA 4N9PA 5ELOA 1BQQT 3LWUA 4X3TA 2Z0SA 5DAUA 1VQMA 4K14A 1VQ4A 2F0LA 3OWEB 1LTRD 4JYAL 4DV3L 5CV8A 4RFBA 1XMOQ 1O78A 2RDHA 4P75A 1Q1EA 2F03A 3U4ZA 1H9KA 4HR7B 2XN9C 2HIVA 5E4XA 5IT9c 4ZKBB 2L1BA 3PCOB 3BS1A 4A3EB 4L5SA 1HR0L 1DGSA 2C35B 3GTGH 1VQHA 1HNWL 3TMEA 1EL0A 5J1ZA 2PQAB 2GN5A 5COYA 1G91A 2ICEC 2JE6I 1KHIA 2MJ8A 3RNUA 3L7ZC 3S2HB 5ELNA 2N8NA 4A3BG 1JOOA 4FVMA 1CTMA 1ZYRD 3T51B 2JA7B 2XGTA 3W5OA 4GN3B 5ISRA 2VS1A 2ZJRA 5C0XI 1QNUA 4KHVA 3PO2H 1NR4A 4JW0A 3EBEA 2IW3A 2QILA 2F0GA 2LMCB 4TQUS 4DV7L 2R92B 3HOVG 2K28A 1SFOH 4XDXA 2JA6H 5IE8A 1RODA 1PTOB 3KLWA 5I9PA 1ET9A 1RL2A 4JI3Q 3KLSA 1ILQA 3PIP3 4FXGC 4BBRB 2I5LX 3HKZG 3ND9A 1XPUA 3K5LA 4C3JH 4OELB 3ER0A 1L0WA 1ILPA 4X64L 2WAQG 4A3GB 4PQXA 1NY4A 3CCSA 3H3VC 1HQRD 5IYDH 3AFQA 1S5CD 2OQKA 4LW1A 3W2DA 3SGIA 4AYBG 2ZM6L 1GHJA 1EZ8A 1TQOA 4ABNA 3MAQA 3H09A 4I7AA 4EX5A 3K0XA 2UXDQ 4OWTB 2VQFL 3GTPB 4PZ6A 1HZBA 1SR3A 4C3IG 3PUVA 1Y1WH 5EKLA 4OXPA 3HOXB 1LTID 3GTJB 1C7YA 4JI6L 4HJ9A 1Z6HA 4LK1C 4HMIA 2EDGA 3SK8A 4LNQA 1NCVA 1HXYD 1N32Q 2YTVA 5HGQA 1YIJA 2L15A 2F0FA 3H15A 2VUMH 1MKHA 1IBML 1RD9D 5C44B 2NVTB 2VQEL 4WORA 4A93H 4RAUC 1HNWQ 1PH3A 1DOMA 1A0IA 1Q12A 2NUCA 3J81c 2JQOA 2EY1A 2B2YC 2DGYA 3BZKA 2EPBA 5LHY1 5LMNW 1TS5A 5D3IB 1SRUA 1XJVA 2B2TA 3HGBA 2NVYB 2D2CC 3FPUB 3FP9A 4FP5D 1A3UA 5K5PA 2WKDA 1QILA 4R1JA 3U50C 4IUUA 5FLMH 2X69A 1QG7A 2JA5H 1IW7D 1PH7A 3GTOB 1PZJD 4YWLA 4DV6L 4HIDA 2NTSA 2JA8G 2NVXH 2EYHA 4HCEA 4ZUIA 1YHQA 3E0EA 4R8IA 4RGNA 5EAYA 1N9WA 2B2UA 2BCOA 3EFXD 1C48A 1SYFA 1TIID 3SE0A 2RF4A 1EQRA 4Y7NH 4ZCKA 1H9RA 3UE1A 4A76A 2ZM6Q 1YEZA 1C4QA 2ID0A 4HAEA 3U9SA 3PF4A 1HA6A 1EY9A 2KHJA 3QR8A 3I4NH 1EY8A 1V1OA 3BDLA 1STHA 2A19A 4GZYC 5FO8B 1PFNA 4BY1B 1SYBA 4B3TQ 4RH6A 3VYSA 2RSOA 1EQTA 4PZ8A 4V190 3KFUA 1NMGA 3HRZC 4ZK9B 4JK1C 3MC0B 2L11A 2UXBL 2PW5A 1WCMH 3GTKH 1JWUD 1D5XC 2F3VA 4DR4L 3HFZB 4A3DG 2K14A 1L0XB 1Y14B 3BDCA 2FJ2A 2Y0SG 3EA6A 2QKIC 1A15A 1DYQA 1TR5A 2NYZD 1IBMQ 4ZKCB 1N36L 1WD0A 1EFWA 4LFAL 4KHZA 4QUCA 5C4XH 4TKOB 3RD4A 1KNAA 1DONA 2VB3X 4C3HG 2QDBA 4RG1A 5CV6A 1YHAA 3L9AX 1DJRD 2FXQA 1E22A 1AEXA 2UU9Q 1MGSA 3GV3A 1TWHH 2ES2A 3I73A 2WB1G 3EIVA 2G9DA 4BXXG 3S1RH 3JAML 1KDAA 3U4VA 4WRDA 1C9OA 4H0LC 4RHSA 1UE6A 1QVFA 4A3KB 2GVAA 2FMMA 2V1CC 1SE4A 3CW2C 3HOUH 1U9RA 5T1GA 4B3RQ 1XWEA 4MN3A 3CMEA 4MHEA 4ZYSA 3NPPA 2LKVA 3C1EA 4WFN3 2WP8J 3P20A 1T5EA 1EIGA 1SNPA 1STNA 2HDLA 2UUCL 3K0YA 3NSWA 1CKNA 1P8LA 4EQOA 3BJUA 4E6IA 4IPCA 3KDFB 1TS3A 2E74C 3NQTA 2EYLA 1JB7A 1RTOA 2D0PA 2N49A 1B4OA 1TWCB 2IHFA 3SVMA 4JI5L 4CDEC 2NZOA 4B3SL 3D0FA 4K5WA 3EROA 1I4XA 3E6ZX 1NNXA 2RCFA 1X3PA 5D65A 1S3OA 1AH9A 2IL8A 3MTSA 3DUZA 3E9HA 1Q82C 3S1QH 2CVRA 2K5DA 1OXTA 2P5ZX 4A3JB 1EWCA 1FNVA 3GO5A 4DK0A 4KJOA 1U4MA 2AWOA 3NBHA 3G6EA 1LTLA 5M9OA 3J7ZC
chains in the Genus database with same CATH topology
3S2DB 1I3QB 3OIQA 4XT1B 2HCCA 2QEJC 4G7ZC 2ZXRA 4LJZC 1I4HA 3CU7A 5EQ0A 4BA2I 3NWSA 3QG1A 5EBCA 5FO9B 1C8CA 3A54A 2F0QA 1MD2D 3P7JA 2QF7A 5KNDA 1BXTA 2PO4A 2L9HA 5I9OA 2OF1A 1CI3M 3QO2A 4IUNA 1X32A 1SYGA 2ZT9C 5C3XA 3WDNA 3HZXA 3CHBD 4KY7A 4H7BA 1SNCA 2F0SA 2K04A 4C3JG 3J7AV 1RCVD 5F2DA 3O13A 1SJHD 1EOTA 1LTGD 1SSOA 1PLFA 3TP5A 2KCNA 1DZ1A 2HDMA 2EZVA 3KF8A 5EBDA 1IHZA 2KEDA 5CV4A 3D8GA 4BY7B 2XSCA 1BDOA 1B3AA 1TVXA 5ELBA 4UAIA 1BBXC 3K5OA 1CA5A 1TWFB 3M4YA 2O4XA 2K1BA 1ICWA 4XYOA 3AU7A 3OIPA 4TRDA 3HG9A 3TBIB 5IODA 5KGUA 4CJ2C 3ZYYX 4FXDA 3K7AB 4KKSA 1OXVA 2KHSA 1SMYC 2QCPX 1STGA 2GA4B 1CQVA 3BYTB 1BCPF 3S17B 2KOLA 2JYOA 3HOVB 3BDOA 4FXKC 1V43A 3HKZB 2MHVA 3DXJC 3G7LA 4KJNA 2WAQB 1ZEQX 1Y8NB 2SDFA 3OMCA 3VYUA 3MXGA 4AYBB 1PTOF 1HFNA 5IGBA 3DHQA 1IW7C 4C3IB 4DAPA 4RKBA 3K5NA 3OPOA 2RDGA 5C4JB 1F9SA 2KQ3A 3SEBA 1AZPA 1B2TA 3PUZA 2F0DA 2B39A 2NBFA 3DEOA 3SXHA 1NAPA 2F0TA 3NQIA 2SNMA 3MHBA 4KY5A 4IUPA 5CBEE 1JWSD 3FPPA 4KMUC 4BA1I 3EQLC 4RGTA 1HTPA 4U673 2I46A 3QOJA 5EJWA 1SBBB 2C9OA 2SOBA 3MFGA 1PTOC 2L12A 1EY6A 2IX1A 4ZRZA 4RKLA 2BE5C 3D31A 2WIIB 1HTLD 5E3FA 1GHKA 2EY5A 5CV5A 4KKTA 2MUYA 2Q8IB 3RMHA 1MBYA 4B08A 3RLFA 2AQ3B 4KD4A 1OXSC 5EPJA 1CK1A 3PMFA 4DXFA 2E2JB 5KNCA 2KECA 4YIJA 2F0KA 2J7ZA 1R4QB 3RUZA 2WKCA 2Y0SB 3OMGA 1GUOA 2JSOA 5IOCA 2B2VA 5ELDA 1BR9A 3QB3A 3T13A 1U4RA 3S14B 3Q24A 3J7AF 3PV0A 5FLXE 2WB1B 2WINB 2KCCA 1WTOA 4HCSA 1WTXA 5JPMC 2O5JC 2Q8TA 3I70A 4DU9A 1WD1A 1PTOH 1T5XD 1HCZA 1R4PB 1QOHA 1EIHA 2N55A 1UNSA 1S5BD 1EYCA 1I4RA 3HS0C 3T4AC 1BCPB 4QCLA 1D5MC 2BDNA 1JICA 2DN8A 5G3LF 4F7XA 5JEAH 1F9QA 2F0OA 4HSVA 2C5CA 4K2LA 1B44D 1SNDA 3K58A 3VR4A 3M3YB 3KK7A 3TZDA 1WTRA 3BG3A 5DM63 1PXUA 1JWMD 3BVZA 1ML0D 5CR3A 5ELCA 1J8IA 3AB9A 5CORA 4LMQD 1EEFD 5TSSA 1VF5C 3KBGA 3D6CA 3NBIA 1CA6A 1IL8A 4KY6A 5DEHA 2YYZA 3S15B 4G57A 3QJYA 4WJWA 1SMYD 1KDCA 1Q3LA 1SNQA 3J80E 3UI2A 3MEHA 1LTSD 1STEA 3D4RA 2R7ZB 4Q0FA 2NZ1D 3DMUA 4HTHA 1Y8PB 1LV9A 3V96A 2G9HD 2NVQB 2B2WC 3E0JA 4G7HC 5A2QE 3TSSA 1CZGA 3CRKC 5CV9A 3I8ZA 4A3MB 4DK1A 2RBMA 1CM9A 5M3MB 4OHJA 3KLRA 1F2LA 2HUGA 3M7GA 2Z8LA 4IUTA 2PW7A 1S4ZA 4BBSB 3M85A 1U4LA 3SHLA 2RDFA 3URYA 4G4KA 1B53A 1TWAB 3MXNA 2EY6A 3LX0A 3Q0AA 1LTTD 1AP0A 4DAYA 1O7YA 5KIXA 1K8MA 4ODGA 4IFDH 1D1IA 1E2WA 2D9UA 1LLRD 2BA1A 2ENBA 4DAVA 1BF4A 1JB3A 4L8JA 1Y1VB 3BZDB 3A7LA 5M5YB 2EE1A 1QNKA 5E4WC 4IURA 2BOSA 1PTOD 1BO0A 5HGTA 2Q8RE 1PYWD 5EPLA 5BN4A 2B8GA 2BE5D 3X3MA 4FO2A 2A6HC 1SE2A 4PV1C 2IJ0A 3SK4A 1JOQA 2PPBC 4DNRB 3LWEA 1XTCD 1PRTF 2A6EC 4Y7NB 4KKUA 1EY0A 5KRUA 1Q8IA 2K01A 1TY0A 1FR3A 2O2LD 2PNRC 1EU4A 2H4OA 4QF4A 3ONAB 2FHTA 1E0BA 5IGDA 4NW2A 2PMZB 5JPNC 1UUPA 5C4HA 5JEAJ 1WVLA 3NWTA 4MIUA 4NDXA 1FNWA 2BA0A 5CBAE 1EEID 3W3AA 3NK9A 5FK9C 4H13C 3TP7A 5C4ZA 1QE6A 4HMJA 5ELFA 1G2TA 4H44C 4PNYA 4RWSC 1F2MA 1WTQA 2F0HA 2XRQD 1D1KA 4J1MA 1JCKB 1VMCA 1QCBD 1U4PA 3I4MB 4CHTB 4XQQA 3GTMB 5JEAG 4CGYB 3IFDA 4KN7C 1KDBA 2RA4A 3FKIB 3S1MB 3A56A 4ZQ3A 2IX0A 2KJXA 3PO3B 2J4XA 4FF2A 4RHRA 1CHPD 5C5MA 1HUNA 1F77A 2NN6H 4RGOS 1Z47A 3R93A 2XWJB 3RZOB 1VF7A 3OW7A 2NB0A 1HHVA 3WOEA 2JXMB 1GUTA 3HEJA 5IIFA 4M1UB 2XWBB 2D5DA 2PCFB 1O7LA 4Z9CB 5EKKA 1F2ZA 3A8JE 4K5VA 1DXMA 2L4NA 1JC7A 5EKIA 5ELEA 2B2TC 1FNUA 4IFDJ 1KNEA 3J81E 1NSNS 3P1HA 2L5TA 3GTQB 4ID6A 4X3KA 1CFMA 3G6JB 1ENAA 1H9SA 2F3WA 1DOLA 3GP7A 2F4IA 3TP6A 5I6WA 3D4DA 1I4PA 4G7OC 1PDQA 1GUNA 2LFNA 4ME5A 1SAPA 2B2UC 1W6KA 2M9VA 1PRTB 4A3BB 4S3SA 1EWHA 4QUFA 4OL7A 4QMGA 1MSGA 2XIWA 4X3SA 3DEPA 1SYCA 5LL6S 4CKEA 2FMCA 1SJED 5A35A 1V8QA 1EQVA 1LT4D 1LTBD 3KBXA 1WTPA 2EJFC 3D3RA 4R8NA 3MXUA 5KEEA 4B9WA 1XX8A 3I4LA 5EPKA 4IALA 1D2BA 4P2CB 1UAPA 3Q23A 2ZXOA 1VCIA 1CHQD 2EOTA 1HQMC 2A5HA 3K59A 3I72A 2XNAC 1FGBD 2L55A 1NR2A 2B2YA 5DNFA 2A6HD 3V2TA 5IGFA 5K36H 2EJMA 1HPCA 3GQBA 3WOFA 2PZUA 3BVGA 2OXPA 4K6DA 4K6LA 2AQ1B 4EGVA 4KD3A 2XVSA 1BCPC 3L3OC 1VMPA 2A6ED 1I50B 2KA7A 5C6AA 2K7VA 3A8KE 3VR2A 1HRJA 2Z1CA 4R9WA 4A3FB 3GTLB 3CQZB 3SK5A 3I91A 4F87A 1KLGD 4BWGB 2JA8B 2L0CA 2HQEA 4DN4M 4I7ZC 1MSHA 1ZKOA 4DXGA 5CC4A 1BNZA 5IGEA 3Q6SA 3S9WA 4XQNA 3MFYA 2E2DC 4DNTB 1GJXA 3C1FA 4XTCS 4PMCA 1R9TB 5HURA 1K8OA 1S5FD 4A3DB 3ND8A 5I2YA 1A2UA 1IKLA 4HEDA 4TSSA 1L0YB 4PMWA 2E75C 3T53B 4IFDI 1RHPA 2EJGC 4C3HB 3NE5B 4F88A 4BS9A 4OO1H 4EVOA 1E2ZA 1I4GA 4QB4A 1GUWA 4KTAA 3VA5A 2A68C 4QIWB 4J8QA 2F1MA 1STAA 4B9XA 1EYAA 2DNEA 2F0IA 3A55A 1H9MA 5J39A 5KYLA 3IKJA 2YU9B 4O42A 2F0UA 1JQYD 3CKIB 1SYDA 1GOZA 4C1NI 2CHBD 3JAME 1DOKA 1A3VA 1LACA 3Q22A 2NN6G 4FF1A 3FVQA 3OOCA 2O5IC 2B63B 5M5WB 2JEBI 1D6EC 5M3FB 3HOYB 2BDOA 3MWYW 4IUQA 3F2UA 2VXWA 1PMRA 4ULLA 2K5WA 2RVLA 3NUCA 3ERQA 1Q90A 1I4QA 3DWAA 1EY7A 5JJZA 3DWQA 3LNNA 1IYUA 2EYFA 1HA5A 1SEBD 2K05A 2K5QA 2A69C 2N88A 4K8JA 2AUKA 1JR0D 3TP8A 3GTGB 3QIAA 1AN8A 4XIGS 4I65A 4K8IA 4M8AA 1QB5D 4NP5A 2KUMA 5C5LA 2R3ZA 3KLSX 1AW7A 1LTAD 4CKBA 2FFKB 3PO2B 2ZXPA 1X3QA 5I4DA 4EQPA 1B9NA 2RKSA 1SFOB 2JA6B 1JOKA 1XYIA 3T16A 4C3JB 2A74C 1RF2D 4XQJA 1IYVA 3C46A 2MGSA 1GUGA 3VR5A 3NP8A 1FYCA 4IN3A 4L63B 4N9TA 1A3TA 4UDUC 1UEAB 2Z4IA 1HFGA 2M2LA 1G291 3KUPA 4IZ8A 1CZWA 2KEEA 2IT1A 3NHHA 1Y1WB 3N6RA 5E1FA 2PQEA 3R8BA 3MVVA 3X3NA 3R2IA 4K2KA 1F9RA 1V1PA 5K36G 1STYA 2NN6I 2F0NA 1BCPD 5CV7A 1KTKA 2VUMB 2PZWA 4A93B 2M00A 2SEBD 1RTNA 4NMZA 2NTTA 1SNMA 4CJ1B 2F0EA 4XYQA 1A2TA 4KV6A 5CMDA 2WV6D 3U9OA 3IFTA 1H9SB 3ITPA 2R6GA 3S1NB 3OHXC 4RCNA 4A3IB 2JA5B 4FNFA 2NWGA 2NVXB 2F0JA 3R3OA 5FLXL 5LL6X 3OWFA 5IGGA 4FF4A 2J0TD 2HCIA 3MA2B 5KNBA 1ZXTA 3J7YW 1ENFA 5FOBB 2D62A 3H91A 3I4NB 4EQNA 5JVG3 1LT3D 3TDQA 5I6YA 2DNCA 1S5ED 2B2VC 4DFAA 1Q1BA 1KAAA 5C0XH 2KVMA 1WCMB 3GTKB 2OT2A 1I6VC 3DWPA 2MP1A 1O7ZA 2CW0C 1WTVA 1EY5A 5T1IA 3NTIA 3D4WA 1FD7D 1CQFA 5C4XB 2RSNA 1TS4A 2A68D 5DM73 4OO1G 5C3WA 1TWHB 2PZTA 1B50A 3VYRA 1M8AA 4DA2A 2F0PA 1PRTC 3S1RB 1MI2A 2A73B 5IT9E 1KLUD 4K5XA 1RKNA 2E2HB 4Q5VA 1YNJC 3VA7A 3HOUB 1GXDC 3FEWX 5NUCA 5BN5A 3I3CA 4FYDA 3PUXA 3J80L 1LO5D 3PUWA 2TMPA 1B1ZA 3K6OA 3BVMA 1E2VA 1SE3A 1SXTA 1Z7TA 1YNNC 3EJIA 4F8MA 5A2QL 3GV6A 4C1NK 2PYKA 1QWYA 2XRSD 3C2PA 3S1QB 3M4OB 1ESFA 3SR1A 1W6JA 2A69D 4IUVA 2LY7A 1M4VA 1SNOA 1PFMA 3CRLC 3AMUA 1SDFA 1BOSA 3PIO3 2K33A 1H9JA 3R2TA 1EZ6A 2X6LA 5G3LD 3FMCA 1LT6D 1B9MA 1LABA 4NKLA 2F0VA 1SYEA 5D14A 1OXXK 1PZID 2E76C 2MPMA 2K03A 1ZYRC 3S16B 3K57A 4OGQC 4CBVA 5FKAC 4X3UA 5FO7B 4C56C 3M7NA 2Z4HA 2LS01 1TWGB 1KABA 3FRPB 4OO1I 1EU3A 2EYMA 1TY2A 1IKMA 2JEAI 2K6AA 4PMBA 1O80A 2CQAA 1EYDA 1XXGA 3A8IE 3NTKA 1DD2A 1II3A 2R93B 2EY2A 5JAVA 5EGTA 2AQ2B 1CT1D 4CKCA 1PZKD 1S5DD 5AFWA 4IFDG 5BN3A 2IX3A 3C3LA 1J9OA 3A7AB 3OSOA 2JP1A 4O1NA 5CGKA 4JBWA 1STBA 1RJTA 3H94A 3K5MA 5CYUA 2V4DA 1DM0B 4RGMA 4RCOA 3NTHA 2B2WA 3P75A 3N52A 4HN7A 5C0XJ 1JE4A 2SNSA 3PUYA 2IWHA 1EY4A 4J6HA 3H0GB 1EFID 2R61A 1LT5D 1A6XA 3E5SA 2B8FA 3H6MA 1GUSA 1NUCA 2RQXA 4HSPA 4ZAIA 2WACA 1PFBA 5C3EB 2EXZA 2IPKD 2EYOA 4ZLTF 2VB2X 4LAAA 1TKWB 4IQZA 5IT9L 4FF3A 3FDTA 5M5XB 3T56B 3HP3A 5JVH3 1QJOA 3BYYB 1DCZA 1TU2B 4L6TB 1Y69U 2H1EA 1F9PA 1I6HB 1D5ZC 3I90A 1RDPD 1TT2A 4DGZA 1JORA 5J22A 1WTWA 3VYTA 3TZUA 1OXUA 2K32A 2I07B 2CW0D 4XT3B 4XXEA 5C0XG 1F2YA 4ZUJA 1ESRA 1AZQA 2AWNA 2DY7A 5I2XA 1VDZA 4RA8A 3VR6A 3RZDB 4OIKA 5JOBA 5KYIA 3MXPA 2ICIA 1G2SA 3V05A 1K83B 4U68A 3MZ5A 3D6WA 4KK7A 1OO9B 3VR3A 4KN4C 1PRTD 3SK6A 3SDZA 2AUJD 1V1PB 3GD7A 3HOZB 2TSSA 2FINB 2EYPA 3QWNA 1BUVT 1G8ZD 2X6GA 1YNJD 3NXWA 2VNUD 1HUMA 3EVQA 1Y8OB 2EVBA 3TN2A 2EYJA 3IAYA 2OEOA 3DM1A 3QOLA 4DF7A 1AFPA 2F0MA 4CJ0B 4C2MB 2E2IB 5IGCA 1G6ZA 4OIJA 1ENCA 1TS2A 5D3DA 3HOWB 4KI0A 1ET6A 1YNND 4ILWA 2F0WA 3J81L 3IL8A 2DY8A 4V0BA 4N9PA 1BQQT 3LWUA 4X3TA 5DAUA 4K14A 2F0LA 3OWEB 1LTRD 5CV8A 4RFBA 1O78A 2RDHA 1Q1EA 2F03A 1H9KA 4HR7B 2XN9C 5E4XA 4ZKBB 2L1BA 3BS1A 4A3EB 1EL0A 3TMEA 5J1ZA 5COYA 1G91A 2ICEC 2JE6I 2MJ8A 3L7ZC 3S2HB 1JOOA 4FVMA 1CTMA 1ZYRD 3T51B 2JA7B 5ISRA 5C0XI 1QNUA 4KHVA 1NR4A 2IW3A 2QILA 2F0GA 2LMCB 4TQUS 2R92B 2K28A 4XDXA 1RODA 1PTOB 5I9PA 1ET9A 3KLSA 1ILQA 3PIP3 4FXGC 4BBRB 3ND9A 3K5LA 1ILPA 4A3GB 4PQXA 3H3VC 1HQRD 1S5CD 3W2DA 1GHJA 1EZ8A 1TQOA 4ABNA 3MAQA 3H09A 3GTPB 4C3IG 3PUVA 5EKLA 3HOXB 1LTID 3GTJB 1Z6HA 4LK1C 4HMIA 2EDGA 3SK8A 1NCVA 1HXYD 2F0FA 2NVTB 1RD9D 5C44B 4WORA 4RAUC 1DOMA 1Q12A 2NUCA 2EY1A 2B2YC 5LHY1 2EPBA 1TS5A 5D3IB 2B2TA 3HGBA 2NVYB 2D2CC 3FPUB 4FP5D 1A3UA 5K5PA 2WKDA 1QILA 4IUUA 2X69A 1QG7A 1IW7D 3GTOB 1PZJD 2NTSA 2EYHA 4HCEA 4ZUIA 4R8IA 4RGNA 2B2UA 2BCOA 3EFXD 1C48A 1SYFA 1TIID 3SE0A 1H9RA 2ID0A 1C4QA 4HAEA 3U9SA 1HA6A 1EY9A 1EY8A 1V1OA 3BDLA 1STHA 4GZYC 5FO8B 1PFNA 4BY1B 1SYBA 4RH6A 3VYSA 2RSOA 1EQTA 4V190 3HRZC 4ZK9B 4JK1C 3MC0B 2L11A 2PW5A 1JWUD 1D5XC 2F3VA 1L0XB 3BDCA 2FJ2A 3EA6A 2QKIC 1A15A 1DYQA 1TR5A 2NYZD 4ZKCB 1WD0A 4KHZA 4QUCA 4TKOB 3RD4A 1KNAA 1DONA 2VB3X 4C3HG 2QDBA 5CV6A 3L9AX 1DJRD 1AEXA 1MGSA 3GV3A 3I73A 2G9DA 3JAML 1KDAA 4WRDA 4H0LC 4RHSA 4A3KB 2FMMA 1SE4A 1U9RA 5T1GA 1XWEA 4MN3A 4ZYSA 4MHEA 3NPPA 2LKVA 3C1EA 4WFN3 2WP8J 3P20A 1T5EA 1EIGA 1SNPA 1STNA 2HDLA 3K0YA 3NSWA 4EQOA 4E6IA 1TS3A 2E74C 3NQTA 2EYLA 1RTOA 1B4OA 1TWCB 3SVMA 4K5WA 3EROA 1I4XA 3E6ZX 1X3PA 5D65A 2IL8A 3MTSA 3DUZA 2CVRA 2K5DA 1OXTA 4A3JB 1EWCA 1FNVA 3GO5A 4DK0A 4KJOA 1U4MA 2AWOA 3NBHA 1ONLA 5M9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STA A;  4KD3 A;  4B9X A;  1JOK A;  3LX0 A;  1EYA A;  2F0O A;  2F0I A;  3NXW A;  5I6Y A;  1EY6 A;  4K2L A;  3SR1 A;  2PW5 A;  3EVQ A;  5J39 A;  3T16 A;  5KYL A;  4MIU A;  4K5V A;  2F3V A;  4RKL A;  1SND A;  5KIX A;  2KHS A;  4NDX A;  1EZ8 A;  1SNO A;  1TQO A;  2EYJ A;  2F0U A;  2OEO A;  3BDC A;  3NP8 A;  2EY5 A;  3P75 A;  3QOL A;  4ODG A;  5CV5 A;  5E3F A;  4N9T A;  4DFA A;  1A3T A;  5C6A A;  1NSN S;  1TR5 A;  2F0M A;  3P1H A;  1SYD A;  1KAA A;  1STG A;  2SNS A;  4ID6 A;  5IGC A;  1EY4 A;  4J6H A;  1EZ6 A;  1ENA A;  1ENC A;  2F0Q A;  2ENB A;  3NK9 A;  2F3W A;  5EKL A;  3RUZ A;  1A3V A;  3SK5 A;  4IZ8 A;  4KD4 A;  5HGT A;  3TP7 A;  3TP6 A;  5I6W A;  5C4Z A;  2QDB A;  3D4D A;  1EY5 A;  5CR3 A;  5CV6 A;  4HMI A;  3E5S A;  3NHH A;  1AEX A;  3D4W A;  3H6M A;  3PMF A;  4HMJ A;  2F0V A;  4NKL A;  1NUC A;  1SYE A;  3SK8 A;  5I9O A;  2OF1 A;  4ME5 A;  5E1F A;  4KJN A;  2HQE A;  2F0W A;  4IUN A;  5CC4 A;  2PQE A;  2WAC A;  1SYG A;  2F0F A;  3MVV A;  5C3X A;  3D6C A;  4PNY A;  4K2K A;  2EXZ A;  1F2M A;  3OMC A;  4WOR A;  3HZX A;  4S3S A;  1KDA A;  4N9P A;  2EYO A;  5C3W A;  1STY A;  2F0K A;  4KY6 A;  4WRD A;  2F0H A;  2F0N A;  4YIJ A;  5DAU A;  5DEH A;  4DF7 A;  4K14 A;  2NUC A;  2F0L A;  2PZT A;  4H7B A;  4J1M A;  4KY7 A;  4LAA A;  1SNC A;  2F0S A;  3NUC A;  4G57 A;  2EY1 A;  3ERQ A;  5CV8 A;  5IGE A;  2F0P A;  4OL7 A;  4QMG A;  5IGB A;  3OMG A;  2PZW A;  5F2D A;  2SOB A;  5IOC A;  1EY7 A;  2M00 A;  3DHQ A;  3S9W A;  1KDC A;  1SYC A;  3QB3 A;  4NMZ A;  1SNQ A;  1U9R A;  1KAB A;  2EYF A;  1SNM A;  4K5X A;  4RKB A;  1EQV A;  1TT2 A;  3SK4 A;  4DGZ A;  3T13 A;  1JOR A;  3MEH A;  2EYM A;  1RKN A;  2F0E A;  3TP5 A;  2LKV A;  5J22 A;  1JOQ A;  1A3U A;  1A2T A;  1KDB A;  4KV6 A;  5K5P A;  3C1E A;  3C1F A;  4R8N A;  3DMU A;  5KEE A;  3TME A;  4HTH A;  4PMC A;  2KQ3 A;  4PMB A;  1SNP A;  1STN A;  1F2Y A;  4ZQ3 A;  5J1Z A;  5NUC A;  4ZUJ A;  3U9O A;  4B9W A;  5HUR A;  1IHZ A;  4EQO A;  4IAL A;  3ITP A;  1EYD A;  2F0D A;  1EY0 A;  5C5M A;  4E6I A;  5CV4 A;  3D8G A;  4K8J A;  2EYH A;  5KRU A;  3NQT A;  4ZUI A;  3SXH A;  2EYL A;  3TP8 A;  1A2U A;  2F0T A;  1SYF A;  5JOB A;  1JOO A;  4I65 A;  4K8I A;  5CV9 A;  1II3 A;  5KYI A;  2SNM A;  2EY2 A;  3MXP A;  5EGT A;  4DU9 A;  5JAV A;  3MHB A;  5ISR A;  2O4X A;  4K5W A;  2F0J A;  3ERO A;  3MZ5 A;  4KHV A;  4NP5 A;  5C5L A;  3R3O A;  4KY5 A;  2RBM A;  2F0G A;  4QF4 A;  1EY9 A;  3OWF A;  3SK6 A;  5IGG A;  3HEJ A;  5IIF A;  3V2T A;  5IGF A;  2PW7 A;  1EY8 A;  1EYC A;  4TRD A;  3BDL A;  1STH A;  5IGD A;  5CV7 A;  4EVO A;  5I9P A;  3EJI A;  4QB4 A;  5IOD A;  4KJO A;  4F8M A;  3OSO A;  2PZU A;  2EYP A;  3QOJ A;  5EKK A;  5KGU A;  1SYB A;  4KTA A;  2RDF A;  3SHL A;  5C4H A;  1F2Z A;  4EQP A;  2OXP A;  4K6D A;  3VA5 A;  2PYK A;  5CGK A;  2RKS A;  1STB A;  4F7X A;  5M9O A;  2EY6 A;  4EQN A; 
#chains in the Genus database with same CATH topology
 3S2D B;  1I3Q B;  3OIQ A;  4XT1 B;  2HCC A;  5DLQ E;  3K80 C;  1JT8 A;  1XTD A;  1HJP A;  2QEJ C;  4G7Z C;  2ZXR A;  4LJZ C;  1I4H A;  3CU7 A;  5EQ0 A;  4BA2 I;  1WFQ A;  3NWS A;  3QG1 A;  2PMZ E;  5EBC A;  1LYL A;  3CC4 A;  5FO9 B;  1C8C A;  3A54 A;  2F0Q A;  4GN5 A;  1JMC A;  4GOP B;  4GNX C;  1MD2 D;  3P7J A;  2QF7 A;  5KND A;  1BXT A;  2PO4 A;  2L9H A;  5I9O A;  3S16 H;  2OF1 A;  5LMN Q;  1CI3 M;  3QO2 A;  3PO2 G;  4IUN A;  4O2D A;  1X32 A;  4AH6 A;  1VQK A;  1SYG A;  2ZT9 C;  5C3X A;  3WDN A;  2CWP A;  3HZX A;  3CHB D;  2CFM A;  3I2Z A;  4KY7 A;  1TWG H;  4H7B A;  3TRZ A;  4DAM A;  1SNC A;  2F0S A;  2K04 A;  3IRB A;  4C3J G;  3J7A V;  1RCV D;  1UE5 A;  3JAM c;  3A74 A;  5F2D A;  2YTY A;  4WJ4 A;  3O13 A;  1SJH D;  5M3M G;  1EOT A;  5IYD G;  1LTG D;  1SSO A;  4LWC A;  3M4P A;  1WTH A;  1PLF A;  3TP5 A;  2KCN A;  1DZ1 A;  1K0R A;  2HDM A;  5BR8 L;  2EZV A;  2YV5 A;  3KF8 A;  5EBD A;  1IHZ A;  2R93 H;  2XTI A;  2KED A;  4GLA C;  3J7A 5;  5CV4 A;  3D8G A;  4BY7 B;  3ICE A;  1PA6 A;  2XSC A;  3CCV A;  4DNI A;  1BDO A;  1B3A A;  1TVX A;  5ELB A;  4LF8 L;  3CMA A;  4UAI A;  1BBX C;  3K5O A;  1CA5 A;  1TWF B;  3PSI A;  3M4Y A;  2MO1 A;  2O4X A;  1MIU A;  2K1B A;  1ICW A;  1I94 Q;  2OTJ A;  1QUQ B;  4XYO A;  2VUM G;  3AU7 A;  3OIP A;  1IBK L;  4A93 G;  4RMF A;  4TRD A;  3HG9 A;  3TBI B;  3PGZ A;  5IOD A;  1KAW A;  4CJ2 C;  5KGU A;  3UDI A;  3I7F A;  4A3C H;  1M90 C;  3ZYY X;  1VQG A;  4FXD A;  1UE7 A;  4IJH A;  4JOI C;  3K7A B;  3W1G A;  4KKS A;  5JJI A;  1OXV A;  5AJ3 Q;  1Q81 C;  2KHS A;  2MQH A;  4B3M Q;  1SMY C;  3H0G H;  5FLM G;  2JA5 G;  2QCP X;  1STG A;  2GA4 B;  1SE8 A;  1CQV A;  3BYT B;  2VZA A;  1BCP F;  3S17 B;  2KOL A;  3G71 A;  2JYO A;  1J6Q A;  3HOV B;  3BDO A;  5C3E H;  4FXK C;  1V43 A;  4CDD C;  3HKZ B;  2MHV A;  3DXJ C;  1PYB A;  3G7L A;  4KJN A;  2WAQ B;  1ZEQ X;  1Y8N B;  4A3F H;  5M5X H;  3I4N G;  1VQI A;  2SDF A;  3OMC A;  3VYU A;  3PF5 A;  1I6H H;  3MXG A;  4AYB B;  3LGJ A;  1PTO F;  1HFN A;  5IGB A;  1NTG A;  3DHQ A;  1IW7 C;  2HD3 A;  4LF8 Q;  4C3I B;  3A5U A;  2OTL A;  1WCM G;  4DAP A;  4RKB A;  5JJL A;  1J5E Q;  1QZH A;  3CXC A;  3K5N A;  3JAM i;  5JJK A;  3OPO A;  2RDG A;  5C4J B;  1F9S A;  2KQ3 A;  1IBK Q;  3SEB A;  5IY0 A;  1AZP A;  1B2T A;  3PUZ A;  2F0D A;  2B39 A;  1XNR L;  2NBF A;  4DR6 L;  1K83 H;  3DEO A;  3SXH A;  5C4X G;  1NAP A;  3RN2 A;  2F0T A;  1X3G A;  5GAD C;  3NQI A;  4X65 Q;  2SNM A;  1HR0 W;  3HKZ E;  3HOZ H;  3MHB A;  1U5K A;  4KY5 A;  4IUP A;  5CBE E;  2D0O A;  1JWS D;  2ZTE A;  1K3R A;  3FPP A;  4KMU C;  4JPB W;  3NEN A;  4BA1 I;  4IPD A;  1L1O A;  3EQL C;  4L5Q A;  4RGT A;  1HTP A;  1ONL A;  4U67 3;  2I46 A;  4Y52 H;  4AYB E;  3QOJ A;  5EJW A;  1SBB B;  2C9O A;  4LF4 L;  2SOB A;  4LFC L;  3MFG A;  2HQL A;  1PTO C;  2L12 A;  3HOU G;  1EY6 A;  2IX1 A;  4C2M H;  2E2I H;  4ZRZ A;  4RKL A;  1JJG A;  2BE5 C;  3D31 A;  2EQS A;  2WII B;  1HTL D;  5E3F A;  1GHK A;  2EY5 A;  5CV5 A;  4KKT A;  2MUY A;  2Q8I B;  3RMH A;  1KC8 C;  2EXD A;  3CC7 A;  4LF7 Q;  5IYB H;  1MBY A;  1PYS B;  3RLF A;  4B08 A;  2AQ3 B;  3CF5 A;  4YCW A;  4KD4 A;  3G4S A;  3FKI G;  3T1H L;  1OXS C;  5EPJ A;  1CK1 A;  3CCR A;  3PMF A;  1YHB A;  4DXF A;  2E2J B;  5KNC A;  1B70 B;  1X65 A;  4NB3 A;  1E1O A;  3PQI A;  1MJE A;  2KEC A;  4YIJ A;  2F0K A;  2J7Z A;  1R4Q B;  2A1A A;  3RUZ A;  2WKC A;  4KHP L;  2Y0S B;  4IPG A;  1VQJ A;  3MEF A;  3H3V I;  3OMG A;  1GUO A;  2JSO A;  5IOC A;  4LF6 L;  1SRO A;  4A3E H;  1BBU A;  5M3F H;  2B2V A;  4JI2 L;  5ELD A;  4IO9 A;  1BR9 A;  3QB3 A;  3T13 A;  1U4R A;  3OTO L;  3S14 B;  3Q24 A;  3J7A F;  3S2H H;  3PV0 A;  3CC2 A;  1AE2 A;  5FLX E;  2JA7 H;  2WB1 B;  3TS2 A;  4YHH Q;  5FJ8 H;  2WIN B;  2KCC A;  3ERS X;  1WTO A;  3E9I A;  4HCS A;  1WTX A;  4LFC Q;  5JPM C;  4NXN Q;  2O5J C;  4AQY Q;  2Q8T A;  3I70 A;  4DU9 A;  1WD1 A;  1PTO H;  1T5X D;  2Z6K A;  1HCZ A;  1R4P B;  1QOH A;  4BBR H;  4QQB X;  1EIH A;  4GKJ Q;  2N55 A;  1UNS A;  1S5B D;  1EYC A;  1I4R A;  4JVZ A;  4NPS A;  3HS0 C;  3T4A C;  1BCP B;  4QCL A;  1D5M C;  4IOC A;  3EN2 A;  4X62 Q;  2Q2U A;  2BDN A;  2Y0S E;  4KLK A;  4DV2 Q;  1JIC A;  2DN8 A;  5G3L F;  4F7X A;  1XMQ L;  2VY3 A;  4X66 L;  1F9Q A;  5JEA H;  4O0A A;  2F0O A;  2HT1 A;  4HSV A;  2C5C A;  4K2L A;  1NBW A;  3GTP H;  3WWV A;  1B44 D;  1SND A;  1KL9 A;  3K58 A;  3HOX H;  3VR4 A;  2ZJP A;  3M3Y B;  1EIF A;  3KK7 A;  3TZD A;  1WTR A;  3KF6 A;  4JI4 L;  1CKN B;  2R93 G;  3BG3 A;  2WB1 E;  5DM6 3;  2ASB A;  1PXU A;  3CCQ A;  1JWM D;  4QIW E;  3BVZ A;  5IWA L;  2K52 A;  4L5T A;  1ML0 D;  5CR3 A;  2NVT H;  5ELC A;  4R4T A;  1MHW C;  4LF5 Q;  1J8I A;  1Z9F A;  3AB9 A;  5COR A;  4LMQ D;  2F4V L;  1EEF D;  1VQF A;  5TSS A;  1VF5 C;  4JBM A;  3KBG A;  3D6C A;  3NBI A;  1CA6 A;  3OTO Q;  1IL8 A;  4KY6 A;  1WJJ A;  2YYZ A;  5DEH A;  3S15 B;  2CWA A;  3NBH B;  4G57 A;  3QJY A;  4K0K L;  2NVY H;  4JYA Q;  1QZG A;  4WJW A;  4DV3 Q;  4A3C G;  1SMY D;  1KDC A;  1Q3L A;  1SNQ A;  3J80 E;  3UI2 A;  3DLL A;  3GTO H;  3MEH A;  1LTS D;  1STE A;  4GLX A;  2WFW A;  3D4R A;  3H0G G;  2R7Z B;  2UUA L;  4Q0F A;  2NZ1 D;  3DMU A;  1K8G A;  4HTH A;  1HR0 Q;  1Y8P B;  1LV9 A;  3V96 A;  1PH8 A;  2G9H D;  2NVQ B;  2B2W C;  3E0J A;  1ASZ A;  1CKO A;  4G7H C;  5A2Q E;  5C3E G;  3TSS A;  1CZG A;  3CRK C;  3F8T A;  5CV9 A;  2K50 A;  4ALP A;  4JV5 L;  2QEX A;  3I8Z A;  2QA4 A;  4A3M B;  4BY1 H;  4A3F G;  2RBM A;  4DK1 A;  1CM9 A;  5M3M B;  4OHJ A;  3KLR A;  1F2L A;  3S1N H;  2HUG A;  3M7G A;  2Z8L A;  4IUT A;  2PW7 A;  4A3I H;  1VQ7 A;  1S4Z A;  4DV7 Q;  4BBS B;  2N78 A;  2I0Q A;  4JI4 Q;  2DUD A;  3M85 A;  1U4L A;  3SHL A;  2RDF A;  3URY A;  4G4K A;  1B53 A;  1TWA B;  3MXN A;  2EY6 A;  4X64 Q;  3LX0 A;  2VW9 A;  2PI2 E;  3Q0A A;  1OTC A;  4OWW B;  1LTT D;  5J3B A;  1AP0 A;  3H3V H;  4DAY A;  1O7Y A;  5KIX A;  1YJ9 A;  3GDE A;  1K28 A;  1K8M A;  4ODG A;  3KF8 B;  4IFD H;  1D1I A;  1E2W A;  2D9U A;  1CUK A;  1LLR D;  2VQF Q;  2BA1 A;  2ENB A;  4DAV A;  4K0K Q;  3RN5 A;  1JB3 A;  1BF4 A;  4DV4 L;  4L8J A;  1Y1V B;  1E7Z A;  3I4O A;  3BZD B;  3A7L A;  4CDC C;  4JI6 Q;  2AKW B;  3HOZ G;  5M5Y B;  2EE1 A;  2E5L L;  5GRO A;  1IZ6 A;  3FHW A;  4N8X 1;  4GOP C;  4DUY L;  1QNK A;  5E4W C;  4IUR A;  2BOS A;  4JI1 L;  1ICF B;  1S40 A;  1PTO D;  2VQE Q;  1BO0 A;  5HGT A;  2Q8R E;  1PYW D;  4HJ8 A;  4MZ9 A;  2EIF A;  2B8G A;  2BE5 D;  5EPL A;  3X3M A;  4FO2 A;  1AE3 A;  5BN4 A;  4DR1 L;  2A6H C;  1YZ6 A;  1SE2 A;  3UDG A;  4DKA C;  3NEM A;  4PV1 C;  2IJ0 A;  3SK4 A;  1JOQ A;  2PPB C;  4DNR B;  2Q2H A;  3LWE A;  1XTC D;  1PRT F;  2H5X A;  2A6E C;  3KJO A;  4Y7N B;  1TWC H;  5IYB G;  4KKU A;  1EY0 A;  4DV6 Q;  5KRU A;  1Q8I A;  2K01 A;  2E2H H;  4DPG A;  1TY0 A;  1FR3 A;  1XPO A;  1N33 L;  3K81 C;  2O2L D;  4YWK A;  2A8V A;  1NJI C;  2PNR C;  4A3J H;  1EU4 A;  2H4O A;  1KRT A;  1B8A A;  4QF4 A;  3ONA B;  3TEH B;  2FHT A;  1E0B A;  3TRE A;  5IGD A;  1I3Q H;  3S2D H;  4NW2 A;  2PMZ B;  2B63 G;  5JPN C;  1UUP A;  1NE3 A;  5C4H A;  5JEA J;  4A3E G;  5M3F G;  3HOY G;  4MTN A;  1WVL A;  3NWT A;  4YWM A;  1E1T A;  4MIU A;  2E5L Q;  4HIO A;  2UXB Q;  4QJF A;  4JG2 A;  4OEM B;  3CCM A;  4NDX A;  2MO0 A;  4DR4 Q;  1FNW A;  2BA0 A;  1NMF A;  4JI1 Q;  3RLN A;  5CBA E;  4HIM A;  1Q8K A;  2Z6K C;  1EEI D;  3W3A A;  1QVC A;  1G6P A;  2I5H A;  1N36 Q;  3M4O H;  3NK9 A;  4LFA Q;  5FK9 C;  5FJ8 G;  4DR1 Q;  4H13 C;  3TP7 A;  5C4Z A;  1QE6 A;  4ME3 A;  2PI2 A;  4HMJ A;  5ELF A;  1G2T A;  4H44 C;  4BBR G;  4PNY A;  4RWS C;  1F2M A;  1L1O B;  1WTQ A;  2F0H A;  4YCV A;  2XRQ D;  1D1K A;  4GLV B;  4J1M A;  1JCK B;  1VMC A;  1QCB D;  1U4P A;  4R4Q A;  3I4M B;  4CHT B;  4XQQ A;  1VQL A;  3GTM B;  1HZA A;  1BBW A;  5JEA G;  1PH9 A;  1N33 Q;  4CGY B;  2CKZ B;  3IFD A;  4KN7 C;  4QY7 A;  1KDB A;  4JBJ A;  2RA4 A;  3FKI B;  3HOX G;  4BY7 H;  3S1M B;  1YIT A;  4HJ5 A;  5GAE C;  3A56 A;  1Q46 A;  1YJN A;  4ZQ3 A;  2IX0 A;  1WOC A;  2JA6 G;  2KJX A;  3PO3 B;  2J4X A;  1TWF H;  4FF2 A;  4RHR A;  2UUC Q;  1CHP D;  5C5M A;  1HUN A;  1F77 A;  2NN6 H;  4POG A;  4RGO S;  1VQP A;  4LUV A;  1Z47 A;  3R93 A;  2XWJ B;  3RZO B;  1VF7 A;  4JI5 Q;  4DK6 C;  3OW7 A;  2NB0 A;  1KXL A;  1HHV A;  4B3S Q;  3WOE A;  2JXM B;  1GUT A;  4IOA A;  3HEJ A;  5IIF A;  4M1U B;  2XWB B;  3K7A H;  2D5D A;  3ZJY C;  2PCF B;  1O7L A;  4Z9C B;  5EKK A;  1Y1W G;  4YY3 L;  1F2Z A;  2Q2T A;  1JE5 A;  3A8J E;  5LMU L;  4DR5 L;  4QL5 A;  1SN8 A;  1IL2 A;  4DV5 L;  4K5V A;  1DXM A;  3S17 H;  2L4N A;  1JC7 A;  5EKI A;  5ELE A;  2B2T C;  1FNU A;  4IFD J;  3DM3 A;  1KNE A;  3HOV H;  3J81 E;  4JBK A;  1NSN S;  3P1H A;  2L5T A;  3GTQ B;  4GKK L;  4ID6 A;  1LUZ A;  1FL0 A;  4X3K A;  1CFM A;  1PV4 A;  3K8A A;  3G6J B;  1ENA A;  1H9S A;  2F3W A;  1DOL A;  3E3X A;  3GP7 A;  1JJC B;  1ASY A;  2F4I A;  4MTK A;  3TP6 A;  5I6W A;  1MJC A;  3D4D A;  1I4P A;  4G7O C;  1PDQ A;  1GUN A;  4UPA A;  2LFN A;  4ME5 A;  1SAP A;  2Z6B A;  2B2U C;  1W6K A;  2M9V A;  1PRT B;  4A3B B;  4A3I G;  4S3S A;  1E24 A;  1EWH A;  4C3I H;  4QUF A;  4OX9 L;  1VQ6 A;  4OL7 A;  4QMG A;  1MSG A;  4HIK A;  2XIW A;  1V1Q A;  4X3S A;  3DEP A;  3BZC A;  1N34 L;  1SYC A;  5LL6 S;  4CKE A;  2FMC A;  1SJE D;  5A35 A;  5C4J H;  3RLO A;  1V8Q A;  1EQV A;  1LT4 D;  1LTB D;  3KBX A;  1WTP A;  2EJF C;  3D3R A;  1P16 A;  3MXU A;  4R8N A;  3KF6 B;  1IBL L;  1H95 A;  5KEE A;  2LSS A;  5BR8 Q;  3A5Z B;  4B9W A;  2Q2I A;  1XX8 A;  3I4L A;  4LFB L;  5EPK A;  4IAL A;  1D2B A;  4P2C B;  1UAP A;  3Q23 A;  2ZXO A;  1VCI A;  1CHQ D;  4YY3 Q;  4DV0 L;  2EOT A;  1HQM C;  3L2P A;  2A5H A;  3K59 A;  4JI7 L;  2K5V A;  1WI5 A;  3I72 A;  3A0J A;  2XNA C;  4PG3 A;  1FGB D;  4DV5 Q;  2L55 A;  1NR2 A;  2B2Y A;  5DNF A;  2A6H D;  3STB C;  3F1Z A;  2I5M X;  3V2T A;  1E3P A;  5IGF A;  3CCU A;  1X3E A;  5K36 H;  3RZD H;  2EJM A;  4JCV E;  1SMX A;  1HPC A;  3GQB A;  3WOF A;  1QVG A;  2PZU A;  3BVG A;  2CH4 W;  2OXP A;  4K6D A;  4K6L A;  2AQ1 B;  2RHQ B;  4EGV A;  4KD3 A;  1K0S A;  2XVS A;  1BCP C;  3L3O C;  3F2D A;  1VMP A;  2A6E D;  1I50 B;  2KA7 A;  5C6A A;  2K7V A;  3A8K E;  1A63 A;  3VR2 A;  1HRJ A;  2KCM A;  2Z1C A;  4R9W A;  4A3F B;  2E2J H;  3GTL B;  3CQZ B;  3SK5 A;  1IXR A;  3I91 A;  2E8G A;  4F87 A;  1KLG D;  4BWG B;  2JA8 B;  2L0C A;  2HQE A;  4DN4 M;  4I7Z C;  1MSH A;  1ZKO A;  1IBL Q;  4DXG A;  1IYJ B;  2DJF C;  3HOW H;  5CC4 A;  1XMO L;  1BNZ A;  4UY8 C;  5IGE A;  1X6O A;  3MXN B;  4JI0 L;  3Q6S A;  1XPR A;  4DV0 Q;  2DJG C;  3S14 H;  3S9W A;  1X55 A;  4XQN A;  4DAY B;  2BH2 A;  3MFY A;  2CH4 A;  2E2D C;  4DNT B;  1GJX A;  4AIM A;  3C1F A;  3KJP A;  4BXX H;  4HJ7 A;  4XTC S;  4PMC A;  1R9T B;  4DV1 L;  5HUR A;  5H1S E;  1K8O A;  1S5F D;  3CPW A;  4A3D B;  1VQ5 A;  3ND8 A;  5I2Y A;  1XNR Q;  1A2U A;  4DR6 Q;  1IKL A;  4HED A;  4TSS A;  1L0Y B;  4PMW A;  2E75 C;  2LXK A;  3M9B A;  3T53 B;  4APV A;  1HH2 P;  4IFD I;  2QGQ A;  4IJL A;  2ALY B;  2F3I A;  1RHP A;  2EJG C;  4C3H B;  3NE5 B;  4CDF C;  3UE0 A;  4JI3 L;  4F88 A;  4BS9 A;  4OO1 H;  4EVO A;  1E2Z A;  1I4G A;  4QB4 A;  1GUW A;  4KTA A;  3VA5 A;  2B29 A;  4YCU A;  4A4I A;  2A68 C;  4J8Q A;  4QIW B;  2F1M A;  1STA A;  2GVB A;  4B9X A;  4LF4 Q;  1EYA A;  2DNE A;  2F0I A;  3A55 A;  2R92 H;  1H9M A;  5J39 A;  5KYL A;  3IKJ A;  2YU9 B;  4O42 A;  4EQ5 A;  4BY7 G;  2F0U A;  3CCE A;  1KRS A;  4GN4 B;  1JQY D;  3CKI B;  1SYD A;  4A3G H;  1GOZ A;  4C1N I;  1TXY A;  2CHB D;  3JAM E;  1BKB A;  1DOK A;  1UEB A;  1PH2 A;  3W1B A;  1A3V A;  1LAC A;  3Q22 A;  2NN6 G;  4FF1 A;  4JI0 Q;  3CCL A;  3FVQ A;  3OOC A;  2O5I C;  2B63 B;  1N32 L;  5M5W B;  3T1H Q;  5IP9 H;  1EWI A;  1VS0 A;  2JEB I;  2CQO A;  3S15 H;  3OW2 A;  1D6E C;  2ZJQ A;  5M3F B;  3HOY B;  2BDO A;  2BH8 A;  2MFI A;  3GTJ H;  3MWY W;  4IUQ A;  3F2U A;  1UWV A;  1HZ9 A;  2VXW A;  1PMR A;  1K3B C;  4ULL A;  4DV1 Q;  4HJA A;  2K5W A;  1D7Q A;  2RVL A;  3NUC A;  3ULJ A;  1PH4 A;  3ERQ A;  1A62 A;  1Q90 A;  2K5H A;  1I4Q A;  4KHP Q;  3DWA A;  1EY7 A;  4R4C A;  5JJZ A;  2R7Z H;  3DWQ A;  1KIX A;  4LF6 Q;  3LNN A;  5C44 H;  4JI2 Q;  1IYU A;  2EYF A;  4OWX B;  3U58 A;  2AHO B;  2NVQ H;  1HA5 A;  1SEB D;  4L5R C;  4R4I A;  1EQQ A;  3KYH C;  2JN4 A;  2K05 A;  4GNX A;  4A3L H;  2K5Q A;  2A69 C;  3TQY A;  1VQN A;  2N88 A;  4K8J A;  2AUK A;  1JR0 D;  3TP8 A;  3GTG B;  4A3M H;  3QIA A;  1CKM A;  1AN8 A;  1PFS A;  5M3M H;  4XIG S;  4I65 A;  4K8I A;  3I56 A;  4M8A A;  1QB5 D;  4BBS H;  3B6Y A;  2QDL A;  1S72 A;  4NP5 A;  2KUM A;  5C5L A;  2R3Z A;  3AYH B;  1HZC A;  3VDY A;  2VL6 A;  1TWA H;  1EUJ A;  1FJG L;  3KLS X;  3ULP A;  1YJW A;  1AW7 A;  1LTA D;  4CKB A;  2FFK B;  4B3T L;  3AEV A;  5GAH C;  3PO2 B;  4POF A;  2ZXP A;  1X3Q A;  5I4D A;  4EQP A;  1B9N A;  4GS3 A;  2RKS A;  1SFO B;  2JA6 B;  1M1K C;  1JOK A;  4H02 A;  1XMQ Q;  2AMC B;  4P73 A;  4X66 Q;  1FGU A;  1PHJ A;  1XYI A;  3T16 A;  4PZ7 A;  4C3J B;  2A74 C;  4DR7 L;  1RF2 D;  4XQJ A;  1IYV A;  3C46 A;  2MGS A;  1GUG A;  3VR5 A;  3NP8 A;  1FYC A;  4IN3 A;  4L63 B;  4N9T A;  1A3T A;  2IY5 B;  1Y1V H;  4UDU C;  1RIP A;  1UEA B;  2Z4I A;  5M5Y H;  1HFG A;  2M2L A;  1G29 1;  1I5F A;  3KUP A;  4IZ8 A;  1CZW A;  5IYC H;  3STB D;  2KEE A;  2IT1 A;  2UU9 L;  2HHH L;  5IWA Q;  4P72 A;  3NHH A;  1K8A C;  4FDB A;  1Y1W B;  3N6R A;  5E1F A;  2PQE A;  3ULL A;  3R8B A;  3MVV A;  3X3N A;  3R2I A;  4K2K A;  2F4V Q;  1F9R A;  1V1P A;  5K36 G;  1STY A;  2NN6 I;  2F0N A;  1BCP D;  4JOI A;  5E7N A;  5CV7 A;  2RHS B;  1KTK A;  2VUM B;  3UDF A;  1C0A A;  2PZW A;  2B3G A;  1L1O C;  2M00 A;  3UDX A;  4A93 B;  2SEB D;  4B3R L;  1RTN A;  4NMZ A;  2NTT A;  4UP9 A;  1SNM A;  4CJ1 B;  2F0E A;  4XYQ A;  3M4Q A;  1A2T A;  4KV6 A;  1WYD A;  5CMD A;  2WV6 D;  4A3K H;  2UUA Q;  3U9O A;  1FJG Q;  3Q8D A;  3IFT A;  1H9S B;  3ITP A;  2R6G A;  2JA9 A;  3S1N B;  1K9M C;  3OHX C;  4RCN A;  4N8F A;  4A3I B;  2JA5 B;  4FNF A;  2NWG A;  1X3F A;  2NVX B;  1VQB A;  2F0J A;  4JV5 Q;  2KBN A;  4DR7 Q;  3R3O A;  5FLX L;  2K5N A;  5LL6 X;  3OWF A;  5IGG A;  4FF4 A;  2J0T D;  2HCI A;  3HOW G;  2QW7 A;  3NEL A;  1KQS A;  3MA2 B;  5KNB A;  1ZXT A;  3J7Y W;  2ATW A;  1ENF A;  5FOB B;  2LXJ A;  4LF9 L;  1EIY B;  2D62 A;  3H91 A;  5IP7 H;  3I4N B;  4EQN A;  5JVG 3;  1LT3 D;  2R7F A;  3TDQ A;  1G51 A;  5I6Y A;  2HHH Q;  2DNC A;  1S5E D;  2B2V C;  4DFA A;  1Q1B A;  1JJ2 A;  1KAA A;  5C0X H;  2KVM A;  4DK3 C;  1WCM B;  4P71 A;  3GTK B;  2PQA A;  2OT2 A;  1I6V C;  4A75 A;  3S24 A;  3DWP A;  2MP1 A;  1O7Z A;  2CW0 C;  1WTV A;  1PVO A;  4DV4 Q;  1EY5 A;  5T1I A;  3J81 i;  3PIP A;  3TS0 A;  1VQ9 A;  3NTI A;  3D4W A;  5LMN L;  1FD7 D;  1CQF A;  4X6A H;  4LUZ A;  5C4X B;  2RSN A;  3I4M H;  4DUY Q;  1TS4 A;  2A68 D;  5DM7 3;  3GTM H;  4OO1 G;  5C3W A;  2UUB L;  2OCE A;  1X9N A;  1TWH B;  2PZT A;  1B50 A;  3VYR A;  1M8A A;  2JA7 G;  4DA2 A;  2F0P A;  4NXM L;  1PRT C;  3I55 A;  3S1R B;  3FKI H;  1MI2 A;  3S1M H;  2A73 B;  1U0L A;  5IT9 E;  2R92 G;  2UXC L;  3L0O A;  1KLU D;  4K5X A;  3PO3 H;  2F52 A;  1RKN A;  2E2H B;  1Q7Y C;  4Q5V A;  3F2B A;  1YNJ C;  1T9H A;  1VQD A;  3VA7 A;  3HOU B;  1GXD C;  3FEW X;  4A3G G;  1PH1 A;  3F2C A;  5NUC A;  4MNO A;  2ZTC A;  1V9P A;  3RZO H;  5BN5 A;  1EOV A;  3I3C A;  1VQO A;  2G5D A;  4FYD A;  3PUX A;  4LF9 Q;  1VQ8 A;  4JI8 L;  3J80 L;  1LO5 D;  1HNX L;  3PUW A;  1N8R C;  5IP9 G;  1XNQ L;  2JJQ A;  1I94 L;  2TMP A;  1B1Z A;  3T1Y L;  3K6O A;  3BVM A;  1E2V A;  1SE3 A;  1SXT A;  2RCN A;  1Z7T A;  1YNN C;  3EJI A;  4F8M A;  5FLX c;  5A2Q L;  3CCJ A;  3GV6 A;  4C1N K;  2ZTD A;  2PYK A;  1QWY A;  2XRS D;  3C2P A;  3S1Q B;  2R7Z G;  1YNX A;  4UP7 A;  5AJ3 L;  5C44 G;  3GTQ H;  3M4O B;  1ESF A;  3SR1 A;  1W6J A;  2A69 D;  2Z9H A;  4IUV A;  2LY7 A;  4B3M L;  2NZH A;  1M4V A;  1SNO A;  1GKH A;  1PFM A;  3CRL C;  3AMU A;  1SDF A;  4A3L G;  1BOS A;  3PIO 3;  2K33 A;  1H9J A;  2UUB Q;  3R2T A;  1EZ6 A;  4WJ3 M;  2X6L A;  5G3L D;  3FMC A;  4DR2 L;  1SLJ A;  4A3M G;  1LT6 D;  4NXM Q;  1B9M A;  4A3B H;  1LAB A;  4NKL A;  4BBS G;  2F0V A;  2UXC Q;  1SYE A;  5D14 A;  1OXX K;  1PZI D;  1LM0 A;  2E76 C;  2K4K A;  1FVI A;  2MPM A;  2K03 A;  1X54 A;  1ZYR C;  3BU2 A;  3S16 B;  3K57 A;  4UHV A;  4OGQ C;  4CBV A;  2JK8 A;  3K7U C;  5FKA C;  4X3U A;  3HKS A;  5FO7 B;  4C56 C;  3M7N A;  2Z4H A;  4JI8 Q;  2KHI A;  3OYY A;  2LS0 1;  1HNX Q;  1TWG B;  1J5E L;  1KAB A;  1VQE A;  1XNQ Q;  4DUZ L;  3FRP B;  4OO1 I;  1EU3 A;  2EYM A;  1B3Q A;  4BY1 G;  1HNZ L;  1TY2 A;  3T1Y Q;  1IKM A;  1Y1V G;  2JEA I;  2K6A A;  4PMB A;  1PH6 A;  1O80 A;  2CQA A;  2KEN A;  1EYD A;  1XXG A;  3A8I E;  4X65 L;  5IYC G;  3NTK A;  1DD2 A;  1II3 A;  2R93 B;  1VQC A;  2EY2 A;  5JAV A;  5EGT A;  2AQ2 B;  2HIX A;  1CT1 D;  5HY6 A;  3J80 c;  4CKC A;  1PZK D;  1S5D D;  5AFW A;  4IFD G;  5BN3 A;  2IX3 A;  3C3L A;  1YBY A;  1J9O A;  3A7A B;  3OSO A;  2JP1 A;  4O1N A;  1I50 H;  5CGK A;  4DR2 Q;  1STB A;  4JBW A;  4LUO A;  1RJT A;  3H94 A;  3K5M A;  1GVP A;  2V4D A;  5CYU A;  5LMU Q;  1DM0 B;  4RGM A;  4DR5 Q;  4RCO A;  3NTH A;  3CPF A;  2B2W A;  3GTL H;  3P75 A;  4GNX B;  3N52 A;  3J81 j;  3CQZ H;  4HN7 A;  5C0X J;  4LF7 L;  4A3K G;  1JE4 A;  2SNS A;  4QGU A;  2PNH A;  3PUY A;  3CP0 A;  2IWH A;  1EY4 A;  4GKK Q;  4J6H A;  4J15 A;  2JA8 H;  1O7I A;  2KCT A;  3KDF A;  3H0G B;  1GD7 A;  1EFI D;  2R61 A;  1LT5 D;  2K75 A;  1A6X A;  3E5S A;  2B8F A;  3H6M A;  1GUS A;  1NUC A;  2RQX A;  4DUZ Q;  4HSP A;  1YI2 A;  4ZAI A;  3AQQ A;  1YVC A;  2WAC A;  1PFB A;  5C3E B;  3CAM A;  1HNZ Q;  2EXZ A;  4JC0 A;  2IPK D;  3JC6 6;  2EYO A;  2OQ0 A;  4ZLT F;  2R7D A;  2VB2 X;  4LAA A;  4UP8 A;  1TKW B;  5GQO A;  4IQZ A;  5IT9 L;  4FF3 A;  3FDT A;  5IP7 G;  5M5X B;  3T56 B;  4OX9 Q;  3HP3 A;  5JVH 3;  1QJO A;  3BYY B;  1DCZ A;  1TU2 B;  1Q86 C;  2YTX A;  5L37 A;  1W3S A;  4L6T B;  1Y69 U;  2H1E A;  1F9P A;  1I6H B;  4TVA B;  3RR5 A;  1D5Z C;  1R9T H;  3I90 A;  1RDP D;  4DR3 L;  1EYG A;  1K73 C;  1N34 Q;  4A3J G;  1TT2 A;  4DGZ A;  1JOR A;  2WAQ E;  4OON A;  5J22 A;  1WTW A;  3VYT A;  4A3D H;  3G48 A;  3TZU A;  1OXU A;  4IPH A;  2K32 A;  1GO3 E;  2I07 B;  2CW0 D;  4XT3 B;  4XXE A;  5C0X G;  1F2Y A;  4ZUJ A;  1ESR A;  1VQA A;  1AZQ A;  4LFB Q;  4YHH L;  3KOJ A;  2AWN A;  2DY7 A;  1GM5 A;  4NXN L;  5I2X A;  4GOP A;  1VDZ A;  4RA8 A;  4AQY L;  3VR6 A;  3RZD B;  4OIK A;  4P74 A;  4C3H H;  5JOB A;  3PIO A;  5KYI A;  3MXP A;  1CSQ A;  2ICI A;  4JI7 Q;  3AFP A;  1G2S A;  3V05 A;  1UE1 A;  1K83 B;  4GKJ L;  4U68 A;  3MZ5 A;  3D6W A;  4KK7 A;  3I4M G;  1OO9 B;  3VR3 A;  4KN4 C;  1PRT D;  3SK6 A;  3SDZ A;  2AUJ D;  1V1P B;  3GD7 A;  1KD1 C;  4X62 L;  3HOZ B;  2TSS A;  2OWO A;  4DV2 L;  3J80 i;  2FIN B;  2EYP A;  3QWN A;  2YU9 H;  1BUV T;  1G8Z D;  1D8L A;  1B7Y B;  2X6G A;  1YNJ D;  3NXW A;  2VNU D;  1HUM A;  5GAG C;  1CSP A;  3PO3 G;  3EVQ A;  1Y8O B;  2IHE A;  1A8V A;  2CCZ A;  2EVB A;  3TN2 A;  2EYJ A;  3IAY A;  2OEO A;  3DM1 A;  3QOL A;  4DF7 A;  1AFP A;  2F0M A;  4CJ0 B;  4C2M B;  1L2F A;  2E2I B;  5IGC A;  2B63 H;  5M5W H;  1G6Z A;  4OIJ A;  1ENC A;  2MNA A;  4R4O A;  1TS2 A;  5D3D A;  1PH5 A;  3CD6 A;  1BVS A;  1W2B A;  1X56 A;  3HOY H;  3HOW B;  4LF5 L;  2N3S A;  3M3Y H;  4KI0 A;  1ET6 A;  1YNN D;  4DR3 Q;  4ILW A;  2F0W A;  3J81 L;  1QUQ A;  3IL8 A;  2DY8 A;  2UXD L;  4V0B A;  4N9P A;  5ELO A;  1BQQ T;  3LWU A;  4X3T A;  2Z0S A;  5DAU A;  1VQM A;  4K14 A;  1VQ4 A;  2F0L A;  3OWE B;  1LTR D;  4JYA L;  4DV3 L;  5CV8 A;  4RFB A;  1XMO Q;  1O78 A;  2RDH A;  4P75 A;  1Q1E A;  2F03 A;  3U4Z A;  1H9K A;  4HR7 B;  2XN9 C;  2HIV A;  5E4X A;  5IT9 c;  4ZKB B;  2L1B A;  3PCO B;  3BS1 A;  4A3E B;  4L5S A;  1HR0 L;  1DGS A;  2C35 B;  3GTG H;  1VQH A;  1HNW L;  3TME A;  1EL0 A;  5J1Z A;  2PQA B;  2GN5 A;  5COY A;  1G91 A;  2ICE C;  2JE6 I;  1KHI A;  2MJ8 A;  3RNU A;  3L7Z C;  3S2H B;  5ELN A;  2N8N A;  4A3B G;  1JOO A;  4FVM A;  1CTM A;  1ZYR D;  3T51 B;  2JA7 B;  2XGT A;  3W5O A;  4GN3 B;  5ISR A;  2VS1 A;  2ZJR A;  5C0X I;  1QNU A;  4KHV A;  3PO2 H;  1NR4 A;  4JW0 A;  3EBE A;  2IW3 A;  2QIL A;  2F0G A;  2LMC B;  4TQU S;  4DV7 L;  2R92 B;  3HOV G;  2K28 A;  1SFO H;  4XDX A;  2JA6 H;  5IE8 A;  1ROD A;  1PTO B;  3KLW A;  5I9P A;  1ET9 A;  1RL2 A;  4JI3 Q;  3KLS A;  1ILQ A;  3PIP 3;  4FXG C;  4BBR B;  2I5L X;  3HKZ G;  3ND9 A;  1XPU A;  3K5L A;  4C3J H;  4OEL B;  3ER0 A;  1L0W A;  1ILP A;  4X64 L;  2WAQ G;  4A3G B;  4PQX A;  1NY4 A;  3CCS A;  3H3V C;  1HQR D;  5IYD H;  3AFQ A;  1S5C D;  2OQK A;  4LW1 A;  3W2D A;  3SGI A;  4AYB G;  2ZM6 L;  1GHJ A;  1EZ8 A;  1TQO A;  4ABN A;  3MAQ A;  3H09 A;  4I7A A;  4EX5 A;  3K0X A;  2UXD Q;  4OWT B;  2VQF L;  3GTP B;  4PZ6 A;  1HZB A;  1SR3 A;  4C3I G;  3PUV A;  1Y1W H;  5EKL A;  4OXP A;  3HOX B;  1LTI D;  3GTJ B;  1C7Y A;  4JI6 L;  4HJ9 A;  1Z6H A;  4LK1 C;  4HMI A;  2EDG A;  3SK8 A;  4LNQ A;  1NCV A;  1HXY D;  1N32 Q;  2YTV A;  5HGQ A;  1YIJ A;  2L15 A;  2F0F A;  3H15 A;  2VUM H;  1MKH A;  1IBM L;  1RD9 D;  5C44 B;  2NVT B;  2VQE L;  4WOR A;  4A93 H;  4RAU C;  1HNW Q;  1PH3 A;  1DOM A;  1A0I A;  1Q12 A;  2NUC A;  3J81 c;  2JQO A;  2EY1 A;  2B2Y C;  2DGY A;  3BZK A;  2EPB A;  5LHY 1;  5LMN W;  1TS5 A;  5D3I B;  1SRU A;  1XJV A;  2B2T A;  3HGB A;  2NVY B;  2D2C C;  3FPU B;  3FP9 A;  4FP5 D;  1A3U A;  5K5P A;  2WKD A;  1QIL A;  4R1J A;  3U50 C;  4IUU A;  5FLM H;  2X69 A;  1QG7 A;  2JA5 H;  1IW7 D;  1PH7 A;  3GTO B;  1PZJ D;  4YWL A;  4DV6 L;  4HID A;  2NTS A;  2JA8 G;  2NVX H;  2EYH A;  4HCE A;  4ZUI A;  1YHQ A;  3E0E A;  4R8I A;  4RGN A;  5EAY A;  1N9W A;  2B2U A;  2BCO A;  3EFX D;  1C48 A;  1SYF A;  1TII D;  3SE0 A;  2RF4 A;  1EQR A;  4Y7N H;  4ZCK A;  1H9R A;  3UE1 A;  4A76 A;  2ZM6 Q;  1YEZ A;  1C4Q A;  2ID0 A;  4HAE A;  3U9S A;  3PF4 A;  1HA6 A;  1EY9 A;  2KHJ A;  3QR8 A;  3I4N H;  1EY8 A;  1V1O A;  3BDL A;  1STH A;  2A19 A;  4GZY C;  5FO8 B;  1PFN A;  4BY1 B;  1SYB A;  4B3T Q;  4RH6 A;  3VYS A;  2RSO A;  1EQT A;  4PZ8 A;  4V19 0;  3KFU A;  1NMG A;  3HRZ C;  4ZK9 B;  4JK1 C;  3MC0 B;  2L11 A;  2UXB L;  2PW5 A;  1WCM H;  3GTK H;  1JWU D;  1D5X C;  2F3V A;  4DR4 L;  3HFZ B;  4A3D G;  2K14 A;  1L0X B;  1Y14 B;  3BDC A;  2FJ2 A;  2Y0S G;  3EA6 A;  2QKI C;  1A15 A;  1DYQ A;  1TR5 A;  2NYZ D;  1IBM Q;  4ZKC B;  1N36 L;  1WD0 A;  1EFW A;  4LFA L;  4KHZ A;  4QUC A;  5C4X H;  4TKO B;  3RD4 A;  1KNA A;  1DON A;  2VB3 X;  4C3H G;  2QDB A;  4RG1 A;  5CV6 A;  1YHA A;  3L9A X;  1DJR D;  2FXQ A;  1E22 A;  1AEX A;  2UU9 Q;  1MGS A;  3GV3 A;  1TWH H;  2ES2 A;  3I73 A;  2WB1 G;  3EIV A;  2G9D A;  4BXX G;  3S1R H;  3JAM L;  1KDA A;  3U4V A;  4WRD A;  1C9O A;  4H0L C;  4RHS A;  1UE6 A;  1QVF A;  4A3K B;  2GVA A;  2FMM A;  2V1C C;  1SE4 A;  3CW2 C;  3HOU H;  1U9R A;  5T1G A;  4B3R Q;  1XWE A;  4MN3 A;  3CME A;  4MHE A;  4ZYS A;  3NPP A;  2LKV A;  3C1E A;  4WFN 3;  2WP8 J;  3P20 A;  1T5E A;  1EIG A;  1SNP A;  1STN A;  2HDL A;  2UUC L;  3K0Y A;  3NSW A;  1CKN A;  1P8L A;  4EQO A;  3BJU A;  4E6I A;  4IPC A;  3KDF B;  1TS3 A;  2E74 C;  3NQT A;  2EYL A;  1JB7 A;  1RTO A;  2D0P A;  2N49 A;  1B4O A;  1TWC B;  2IHF A;  3SVM A;  4JI5 L;  4CDE C;  2NZO A;  4B3S L;  3D0F A;  4K5W A;  3ERO A;  1I4X A;  3E6Z X;  1NNX A;  2RCF A;  1X3P A;  5D65 A;  1S3O A;  1AH9 A;  2IL8 A;  3MTS A;  3DUZ A;  3E9H A;  1Q82 C;  3S1Q H;  2CVR A;  2K5D A;  1OXT A;  2P5Z X;  4A3J B;  1EWC A;  1FNV A;  3GO5 A;  4DK0 A;  4KJO A;  1U4M A;  2AWO A;  3NBH A;  3G6E A;  1LTL A;  5M9O A;  3J7Z C; 
#chains in the Genus database with same CATH homology
 3S2D B;  1I3Q B;  3OIQ A;  4XT1 B;  2HCC A;  2QEJ C;  4G7Z C;  2ZXR A;  4LJZ C;  1I4H A;  3CU7 A;  5EQ0 A;  4BA2 I;  3NWS A;  3QG1 A;  5EBC A;  5FO9 B;  1C8C A;  3A54 A;  2F0Q A;  1MD2 D;  3P7J A;  2QF7 A;  5KND A;  1BXT A;  2PO4 A;  2L9H A;  5I9O A;  2OF1 A;  1CI3 M;  3QO2 A;  4IUN A;  1X32 A;  1SYG A;  2ZT9 C;  5C3X A;  3WDN A;  3HZX A;  3CHB D;  4KY7 A;  4H7B A;  1SNC A;  2F0S A;  2K04 A;  4C3J G;  3J7A V;  1RCV D;  5F2D A;  3O13 A;  1SJH D;  1EOT A;  1LTG D;  1SSO A;  1PLF A;  3TP5 A;  2KCN A;  1DZ1 A;  2HDM A;  2EZV A;  3KF8 A;  5EBD A;  1IHZ A;  2KED A;  5CV4 A;  3D8G A;  4BY7 B;  2XSC A;  1BDO A;  1B3A A;  1TVX A;  5ELB A;  4UAI A;  1BBX C;  3K5O A;  1CA5 A;  1TWF B;  3M4Y A;  2O4X A;  2K1B A;  1ICW A;  4XYO A;  3AU7 A;  3OIP A;  4TRD A;  3HG9 A;  3TBI B;  5IOD A;  5KGU A;  4CJ2 C;  3ZYY X;  4FXD A;  3K7A B;  4KKS A;  1OXV A;  2KHS A;  1SMY C;  2QCP X;  1STG A;  2GA4 B;  1CQV A;  3BYT B;  1BCP F;  3S17 B;  2KOL A;  2JYO A;  3HOV B;  3BDO A;  4FXK C;  1V43 A;  3HKZ B;  2MHV A;  3DXJ C;  3G7L A;  4KJN A;  2WAQ B;  1ZEQ X;  1Y8N B;  2SDF A;  3OMC A;  3VYU A;  3MXG A;  4AYB B;  1PTO F;  1HFN A;  5IGB A;  3DHQ A;  1IW7 C;  4C3I B;  4DAP A;  4RKB A;  3K5N A;  3OPO A;  2RDG A;  5C4J B;  1F9S A;  2KQ3 A;  3SEB A;  1AZP A;  1B2T A;  3PUZ A;  2F0D A;  2B39 A;  2NBF A;  3DEO A;  3SXH A;  1NAP A;  2F0T A;  3NQI A;  2SNM A;  3MHB A;  4KY5 A;  4IUP A;  5CBE E;  1JWS D;  3FPP A;  4KMU C;  4BA1 I;  3EQL C;  4RGT A;  1HTP A;  4U67 3;  2I46 A;  3QOJ A;  5EJW A;  1SBB B;  2C9O A;  2SOB A;  3MFG A;  1PTO C;  2L12 A;  1EY6 A;  2IX1 A;  4ZRZ A;  4RKL A;  2BE5 C;  3D31 A;  2WII B;  1HTL D;  5E3F A;  1GHK A;  2EY5 A;  5CV5 A;  4KKT A;  2MUY A;  2Q8I B;  3RMH A;  1MBY A;  4B08 A;  3RLF A;  2AQ3 B;  4KD4 A;  1OXS C;  5EPJ A;  1CK1 A;  3PMF A;  4DXF A;  2E2J B;  5KNC A;  2KEC A;  4YIJ A;  2F0K A;  2J7Z A;  1R4Q B;  3RUZ A;  2WKC A;  2Y0S B;  3OMG A;  1GUO A;  2JSO A;  5IOC A;  2B2V A;  5ELD A;  1BR9 A;  3QB3 A;  3T13 A;  1U4R A;  3S14 B;  3Q24 A;  3J7A F;  3PV0 A;  5FLX E;  2WB1 B;  2WIN B;  2KCC A;  1WTO A;  4HCS A;  1WTX A;  5JPM C;  2O5J C;  2Q8T A;  3I70 A;  4DU9 A;  1WD1 A;  1PTO H;  1T5X D;  1HCZ A;  1R4P B;  1QOH A;  1EIH A;  2N55 A;  1UNS A;  1S5B D;  1EYC A;  1I4R A;  3HS0 C;  3T4A C;  1BCP B;  4QCL A;  1D5M C;  2BDN A;  1JIC A;  2DN8 A;  5G3L F;  4F7X A;  5JEA H;  1F9Q A;  2F0O A;  4HSV A;  2C5C A;  4K2L A;  1B44 D;  1SND A;  3K58 A;  3VR4 A;  3M3Y B;  3KK7 A;  3TZD A;  1WTR A;  3BG3 A;  5DM6 3;  1PXU A;  1JWM D;  3BVZ A;  1ML0 D;  5CR3 A;  5ELC A;  1J8I A;  3AB9 A;  5COR A;  4LMQ D;  1EEF D;  5TSS A;  1VF5 C;  3KBG A;  3D6C A;  3NBI A;  1CA6 A;  1IL8 A;  4KY6 A;  5DEH A;  2YYZ A;  3S15 B;  4G57 A;  3QJY A;  4WJW A;  1SMY D;  1KDC A;  1Q3L A;  1SNQ A;  3J80 E;  3UI2 A;  3MEH A;  1LTS D;  1STE A;  3D4R A;  2R7Z B;  4Q0F A;  2NZ1 D;  3DMU A;  4HTH A;  1Y8P B;  1LV9 A;  3V96 A;  2G9H D;  2NVQ B;  2B2W C;  3E0J A;  4G7H C;  5A2Q E;  3TSS A;  1CZG A;  3CRK C;  5CV9 A;  3I8Z A;  4A3M B;  4DK1 A;  2RBM A;  1CM9 A;  5M3M B;  4OHJ A;  3KLR A;  1F2L A;  2HUG A;  3M7G A;  2Z8L A;  4IUT A;  2PW7 A;  1S4Z A;  4BBS B;  3M85 A;  1U4L A;  3SHL A;  2RDF A;  3URY A;  4G4K A;  1B53 A;  1TWA B;  3MXN A;  2EY6 A;  3LX0 A;  3Q0A A;  1LTT D;  1AP0 A;  4DAY A;  1O7Y A;  5KIX A;  1K8M A;  4ODG A;  4IFD H;  1D1I A;  1E2W A;  2D9U A;  1LLR D;  2BA1 A;  2ENB A;  4DAV A;  1BF4 A;  1JB3 A;  4L8J A;  1Y1V B;  3BZD B;  3A7L A;  5M5Y B;  2EE1 A;  1QNK A;  5E4W C;  4IUR A;  2BOS A;  1PTO D;  1BO0 A;  5HGT A;  2Q8R E;  1PYW D;  5EPL A;  5BN4 A;  2B8G A;  2BE5 D;  3X3M A;  4FO2 A;  2A6H C;  1SE2 A;  4PV1 C;  2IJ0 A;  3SK4 A;  1JOQ A;  2PPB C;  4DNR B;  3LWE A;  1XTC D;  1PRT F;  2A6E C;  4Y7N B;  4KKU A;  1EY0 A;  5KRU A;  1Q8I A;  2K01 A;  1TY0 A;  1FR3 A;  2O2L D;  2PNR C;  1EU4 A;  2H4O A;  4QF4 A;  3ONA B;  2FHT A;  1E0B A;  5IGD A;  4NW2 A;  2PMZ B;  5JPN C;  1UUP A;  5C4H A;  5JEA J;  1WVL A;  3NWT A;  4MIU A;  4NDX A;  1FNW A;  2BA0 A;  5CBA E;  1EEI D;  3W3A A;  3NK9 A;  5FK9 C;  4H13 C;  3TP7 A;  5C4Z A;  1QE6 A;  4HMJ A;  5ELF A;  1G2T A;  4H44 C;  4PNY A;  4RWS C;  1F2M A;  1WTQ A;  2F0H A;  2XRQ D;  1D1K A;  4J1M A;  1JCK B;  1VMC A;  1QCB D;  1U4P A;  3I4M B;  4CHT B;  4XQQ A;  3GTM B;  5JEA G;  4CGY B;  3IFD A;  4KN7 C;  1KDB A;  2RA4 A;  3FKI B;  3S1M B;  3A56 A;  4ZQ3 A;  2IX0 A;  2KJX A;  3PO3 B;  2J4X A;  4FF2 A;  4RHR A;  1CHP D;  5C5M A;  1HUN A;  1F77 A;  2NN6 H;  4RGO S;  1Z47 A;  3R93 A;  2XWJ B;  3RZO B;  1VF7 A;  3OW7 A;  2NB0 A;  1HHV A;  3WOE A;  2JXM B;  1GUT A;  3HEJ A;  5IIF A;  4M1U B;  2XWB B;  2D5D A;  2PCF B;  1O7L A;  4Z9C B;  5EKK A;  1F2Z A;  3A8J E;  4K5V A;  1DXM A;  2L4N A;  1JC7 A;  5EKI A;  5ELE A;  2B2T C;  1FNU A;  4IFD J;  1KNE A;  3J81 E;  1NSN S;  3P1H A;  2L5T A;  3GTQ B;  4ID6 A;  4X3K A;  1CFM A;  3G6J B;  1ENA A;  1H9S A;  2F3W A;  1DOL A;  3GP7 A;  2F4I A;  3TP6 A;  5I6W A;  3D4D A;  1I4P A;  4G7O C;  1PDQ A;  1GUN A;  2LFN A;  4ME5 A;  1SAP A;  2B2U C;  1W6K A;  2M9V A;  1PRT B;  4A3B B;  4S3S A;  1EWH A;  4QUF A;  4OL7 A;  4QMG A;  1MSG A;  2XIW A;  4X3S A;  3DEP A;  1SYC A;  5LL6 S;  4CKE A;  2FMC A;  1SJE D;  5A35 A;  1V8Q A;  1EQV A;  1LT4 D;  1LTB D;  3KBX A;  1WTP A;  2EJF C;  3D3R A;  4R8N A;  3MXU A;  5KEE A;  4B9W A;  1XX8 A;  3I4L A;  5EPK A;  4IAL A;  1D2B A;  4P2C B;  1UAP A;  3Q23 A;  2ZXO A;  1VCI A;  1CHQ D;  2EOT A;  1HQM C;  2A5H A;  3K59 A;  3I72 A;  2XNA C;  1FGB D;  2L55 A;  1NR2 A;  2B2Y A;  5DNF A;  2A6H D;  3V2T A;  5IGF A;  5K36 H;  2EJM A;  1HPC A;  3GQB A;  3WOF A;  2PZU A;  3BVG A;  2OXP A;  4K6D A;  4K6L A;  2AQ1 B;  4EGV A;  4KD3 A;  2XVS A;  1BCP C;  3L3O C;  1VMP A;  2A6E D;  1I50 B;  2KA7 A;  5C6A A;  2K7V A;  3A8K E;  3VR2 A;  1HRJ A;  2Z1C A;  4R9W A;  4A3F B;  3GTL B;  3CQZ B;  3SK5 A;  3I91 A;  4F87 A;  1KLG D;  4BWG B;  2JA8 B;  2L0C A;  2HQE A;  4DN4 M;  4I7Z C;  1MSH A;  1ZKO A;  4DXG A;  5CC4 A;  1BNZ A;  5IGE A;  3Q6S A;  3S9W A;  4XQN A;  3MFY A;  2E2D C;  4DNT B;  1GJX A;  3C1F A;  4XTC S;  4PMC A;  1R9T B;  5HUR A;  1K8O A;  1S5F D;  4A3D B;  3ND8 A;  5I2Y A;  1A2U A;  1IKL A;  4HED A;  4TSS A;  1L0Y B;  4PMW A;  2E75 C;  3T53 B;  4IFD I;  1RHP A;  2EJG C;  4C3H B;  3NE5 B;  4F88 A;  4BS9 A;  4OO1 H;  4EVO A;  1E2Z A;  1I4G A;  4QB4 A;  1GUW A;  4KTA A;  3VA5 A;  2A68 C;  4QIW B;  4J8Q A;  2F1M A;  1STA A;  4B9X A;  1EYA A;  2DNE A;  2F0I A;  3A55 A;  1H9M A;  5J39 A;  5KYL A;  3IKJ A;  2YU9 B;  4O42 A;  2F0U A;  1JQY D;  3CKI B;  1SYD A;  1GOZ A;  4C1N I;  2CHB D;  3JAM E;  1DOK A;  1A3V A;  1LAC A;  3Q22 A;  2NN6 G;  4FF1 A;  3FVQ A;  3OOC A;  2O5I C;  2B63 B;  5M5W B;  2JEB I;  1D6E C;  5M3F B;  3HOY B;  2BDO A;  3MWY W;  4IUQ A;  3F2U A;  2VXW A;  1PMR A;  4ULL A;  2K5W A;  2RVL A;  3NUC A;  3ERQ A;  1Q90 A;  1I4Q A;  3DWA A;  1EY7 A;  5JJZ A;  3DWQ A;  3LNN A;  1IYU A;  2EYF A;  1HA5 A;  1SEB D;  2K05 A;  2K5Q A;  2A69 C;  2N88 A;  4K8J A;  2AUK A;  1JR0 D;  3TP8 A;  3GTG B;  3QIA A;  1AN8 A;  4XIG S;  4I65 A;  4K8I A;  4M8A A;  1QB5 D;  4NP5 A;  2KUM A;  5C5L A;  2R3Z A;  3KLS X;  1AW7 A;  1LTA D;  4CKB A;  2FFK B;  3PO2 B;  2ZXP A;  1X3Q A;  5I4D A;  4EQP A;  1B9N A;  2RKS A;  1SFO B;  2JA6 B;  1JOK A;  1XYI A;  3T16 A;  4C3J B;  2A74 C;  1RF2 D;  4XQJ A;  1IYV A;  3C46 A;  2MGS A;  1GUG A;  3VR5 A;  3NP8 A;  1FYC A;  4IN3 A;  4L63 B;  4N9T A;  1A3T A;  4UDU C;  1UEA B;  2Z4I A;  1HFG A;  2M2L A;  1G29 1;  3KUP A;  4IZ8 A;  1CZW A;  2KEE A;  2IT1 A;  3NHH A;  1Y1W B;  3N6R A;  5E1F A;  2PQE A;  3R8B A;  3MVV A;  3X3N A;  3R2I A;  4K2K A;  1F9R A;  1V1P A;  5K36 G;  1STY A;  2NN6 I;  2F0N A;  1BCP D;  5CV7 A;  1KTK A;  2VUM B;  2PZW A;  4A93 B;  2M00 A;  2SEB D;  1RTN A;  4NMZ A;  2NTT A;  1SNM A;  4CJ1 B;  2F0E A;  4XYQ A;  1A2T A;  4KV6 A;  5CMD A;  2WV6 D;  3U9O A;  3IFT A;  1H9S B;  3ITP A;  2R6G A;  3S1N B;  3OHX C;  4RCN A;  4A3I B;  2JA5 B;  4FNF A;  2NWG A;  2NVX B;  2F0J A;  3R3O A;  5FLX L;  5LL6 X;  3OWF A;  5IGG A;  4FF4 A;  2J0T D;  2HCI A;  3MA2 B;  5KNB A;  1ZXT A;  3J7Y W;  1ENF A;  5FOB B;  2D62 A;  3H91 A;  3I4N B;  4EQN A;  5JVG 3;  1LT3 D;  3TDQ A;  5I6Y A;  2DNC A;  1S5E D;  2B2V C;  4DFA A;  1Q1B A;  1KAA A;  5C0X H;  2KVM A;  1WCM B;  3GTK B;  2OT2 A;  1I6V C;  3DWP A;  2MP1 A;  1O7Z A;  2CW0 C;  1WTV A;  1EY5 A;  5T1I A;  3NTI A;  3D4W A;  1FD7 D;  1CQF A;  5C4X B;  2RSN A;  1TS4 A;  2A68 D;  5DM7 3;  4OO1 G;  5C3W A;  1TWH B;  2PZT A;  1B50 A;  3VYR A;  1M8A A;  4DA2 A;  2F0P A;  1PRT C;  3S1R B;  1MI2 A;  2A73 B;  5IT9 E;  1KLU D;  4K5X A;  1RKN A;  2E2H B;  4Q5V A;  1YNJ C;  3VA7 A;  3HOU B;  1GXD C;  3FEW X;  5NUC A;  5BN5 A;  3I3C A;  4FYD A;  3PUX A;  3J80 L;  1LO5 D;  3PUW A;  2TMP A;  1B1Z A;  3K6O A;  3BVM A;  1E2V A;  1SE3 A;  1SXT A;  1Z7T A;  1YNN C;  3EJI A;  4F8M A;  5A2Q L;  3GV6 A;  4C1N K;  2PYK A;  1QWY A;  2XRS D;  3C2P A;  3S1Q B;  3M4O B;  1ESF A;  3SR1 A;  1W6J A;  2A69 D;  4IUV A;  2LY7 A;  1M4V A;  1SNO A;  1PFM A;  3CRL C;  3AMU A;  1SDF A;  1BOS A;  3PIO 3;  2K33 A;  1H9J A;  3R2T A;  1EZ6 A;  2X6L A;  5G3L D;  3FMC A;  1LT6 D;  1B9M A;  1LAB A;  4NKL A;  2F0V A;  1SYE A;  5D14 A;  1OXX K;  1PZI D;  2E76 C;  2MPM A;  2K03 A;  1ZYR C;  3S16 B;  3K57 A;  4OGQ C;  4CBV A;  5FKA C;  4X3U A;  5FO7 B;  4C56 C;  3M7N A;  2Z4H A;  2LS0 1;  1TWG B;  1KAB A;  3FRP B;  4OO1 I;  1EU3 A;  2EYM A;  1TY2 A;  1IKM A;  2JEA I;  2K6A A;  4PMB A;  1O80 A;  2CQA A;  1EYD A;  1XXG A;  3A8I E;  3NTK A;  1DD2 A;  1II3 A;  2R93 B;  2EY2 A;  5JAV A;  5EGT A;  2AQ2 B;  1CT1 D;  4CKC A;  1PZK D;  1S5D D;  5AFW A;  4IFD G;  5BN3 A;  2IX3 A;  3C3L A;  1J9O A;  3A7A B;  3OSO A;  2JP1 A;  4O1N A;  5CGK A;  4JBW A;  1STB A;  1RJT A;  3H94 A;  3K5M A;  5CYU A;  2V4D A;  1DM0 B;  4RGM A;  4RCO A;  3NTH A;  2B2W A;  3P75 A;  3N52 A;  4HN7 A;  5C0X J;  1JE4 A;  2SNS A;  3PUY A;  2IWH A;  1EY4 A;  4J6H A;  3H0G B;  1EFI D;  2R61 A;  1LT5 D;  1A6X A;  3E5S A;  2B8F A;  3H6M A;  1GUS A;  1NUC A;  2RQX A;  4HSP A;  4ZAI A;  2WAC A;  1PFB A;  5C3E B;  2EXZ A;  2IPK D;  2EYO A;  4ZLT F;  2VB2 X;  4LAA A;  1TKW B;  4IQZ A;  5IT9 L;  4FF3 A;  3FDT A;  5M5X B;  3T56 B;  3HP3 A;  5JVH 3;  1QJO A;  3BYY B;  1DCZ A;  1TU2 B;  4L6T B;  1Y69 U;  2H1E A;  1F9P A;  1I6H B;  1D5Z C;  3I90 A;  1RDP D;  1TT2 A;  4DGZ A;  1JOR A;  5J22 A;  1WTW A;  3VYT A;  3TZU A;  1OXU A;  2K32 A;  2I07 B;  2CW0 D;  4XT3 B;  4XXE A;  5C0X G;  1F2Y A;  4ZUJ A;  1ESR A;  1AZQ A;  2AWN A;  2DY7 A;  5I2X A;  1VDZ A;  4RA8 A;  3VR6 A;  3RZD B;  4OIK A;  5JOB A;  5KYI A;  3MXP A;  2ICI A;  1G2S A;  3V05 A;  1K83 B;  4U68 A;  3MZ5 A;  3D6W A;  4KK7 A;  1OO9 B;  3VR3 A;  4KN4 C;  1PRT D;  3SK6 A;  3SDZ A;  2AUJ D;  1V1P B;  3GD7 A;  3HOZ B;  2TSS A;  2FIN B;  2EYP A;  3QWN A;  1BUV T;  1G8Z D;  2X6G A;  1YNJ D;  3NXW A;  2VNU D;  1HUM A;  3EVQ A;  1Y8O B;  2EVB A;  3TN2 A;  2EYJ A;  3IAY A;  2OEO A;  3DM1 A;  3QOL A;  4DF7 A;  1AFP A;  2F0M A;  4CJ0 B;  4C2M B;  2E2I B;  5IGC A;  1G6Z A;  4OIJ A;  1ENC A;  1TS2 A;  5D3D A;  3HOW B;  4KI0 A;  1ET6 A;  1YNN D;  4ILW A;  2F0W A;  3J81 L;  3IL8 A;  2DY8 A;  4V0B A;  4N9P A;  1BQQ T;  3LWU A;  4X3T A;  5DAU A;  4K14 A;  2F0L A;  3OWE B;  1LTR D;  5CV8 A;  4RFB A;  1O78 A;  2RDH A;  1Q1E A;  2F03 A;  1H9K A;  4HR7 B;  2XN9 C;  5E4X A;  4ZKB B;  2L1B A;  3BS1 A;  4A3E B;  1EL0 A;  3TME A;  5J1Z A;  5COY A;  1G91 A;  2ICE C;  2JE6 I;  2MJ8 A;  3L7Z C;  3S2H B;  1JOO A;  4FVM A;  1CTM A;  1ZYR D;  3T51 B;  2JA7 B;  5ISR A;  5C0X I;  1QNU A;  4KHV A;  1NR4 A;  2IW3 A;  2QIL A;  2F0G A;  2LMC B;  4TQU S;  2R92 B;  2K28 A;  4XDX A;  1ROD A;  1PTO B;  5I9P A;  1ET9 A;  3KLS A;  1ILQ A;  3PIP 3;  4FXG C;  4BBR B;  3ND9 A;  3K5L A;  1ILP A;  4A3G B;  4PQX A;  3H3V C;  1HQR D;  1S5C D;  3W2D A;  1GHJ A;  1EZ8 A;  1TQO A;  4ABN A;  3MAQ A;  3H09 A;  3GTP B;  4C3I G;  3PUV A;  5EKL A;  3HOX B;  1LTI D;  3GTJ B;  1Z6H A;  4LK1 C;  4HMI A;  2EDG A;  3SK8 A;  1NCV A;  1HXY D;  2F0F A;  2NVT B;  1RD9 D;  5C44 B;  4WOR A;  4RAU C;  1DOM A;  1Q12 A;  2NUC A;  2EY1 A;  2B2Y C;  5LHY 1;  2EPB A;  1TS5 A;  5D3I B;  2B2T A;  3HGB A;  2NVY B;  2D2C C;  3FPU B;  4FP5 D;  1A3U A;  5K5P A;  2WKD A;  1QIL A;  4IUU A;  2X69 A;  1QG7 A;  1IW7 D;  3GTO B;  1PZJ D;  2NTS A;  2EYH A;  4HCE A;  4ZUI A;  4R8I A;  4RGN A;  2B2U A;  2BCO A;  3EFX D;  1C48 A;  1SYF A;  1TII D;  3SE0 A;  1H9R A;  2ID0 A;  1C4Q A;  4HAE A;  3U9S A;  1HA6 A;  1EY9 A;  1EY8 A;  1V1O A;  3BDL A;  1STH A;  4GZY C;  5FO8 B;  1PFN A;  4BY1 B;  1SYB A;  4RH6 A;  3VYS A;  2RSO A;  1EQT A;  4V19 0;  3HRZ C;  4ZK9 B;  4JK1 C;  3MC0 B;  2L11 A;  2PW5 A;  1JWU D;  1D5X C;  2F3V A;  1L0X B;  3BDC A;  2FJ2 A;  3EA6 A;  2QKI C;  1A15 A;  1DYQ A;  1TR5 A;  2NYZ D;  4ZKC B;  1WD0 A;  4KHZ A;  4QUC A;  4TKO B;  3RD4 A;  1KNA A;  1DON A;  2VB3 X;  4C3H G;  2QDB A;  5CV6 A;  3L9A X;  1DJR D;  1AEX A;  1MGS A;  3GV3 A;  3I73 A;  2G9D A;  3JAM L;  1KDA A;  4WRD A;  4H0L C;  4RHS A;  4A3K B;  2FMM A;  1SE4 A;  1U9R A;  5T1G A;  1XWE A;  4MN3 A;  4ZYS A;  4MHE A;  3NPP A;  2LKV A;  3C1E A;  4WFN 3;  2WP8 J;  3P20 A;  1T5E A;  1EIG A;  1SNP A;  1STN A;  2HDL A;  3K0Y A;  3NSW A;  4EQO A;  4E6I A;  1TS3 A;  2E74 C;  3NQT A;  2EYL A;  1RTO A;  1B4O A;  1TWC B;  3SVM A;  4K5W A;  3ERO A;  1I4X A;  3E6Z X;  1X3P A;  5D65 A;  2IL8 A;  3MTS A;  3DUZ A;  2CVR A;  2K5D A;  1OXT A;  4A3J B;  1EWC A;  1FNV A;  3GO5 A;  4DK0 A;  4KJO A;  1U4M A;  2AWO A;  3NBH A;  1ONL A;  5M9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...