1SYGA

Engineering alternative beta-turn types in staphylococcal nuclease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKANNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Engineering alternative beta-turn types in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 40
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sygA00
1NUCA 3QOLA 3TP8A 4DFAA 2OEOA 2WACA 3ITPA 2F0TA 4J1MA 3TP5A 1A3VA 2F3VA 4PMCA 1RKNA 5CV8A 3H6MA 4J6HA 1EY9A 1A3UA 5ISRA 3HEJA 3P75A 4K2LA 4PNYA 4WORA 1EZ8A 4KJOA 4N9PA 4K5XA 2F0VA 2PW7A 5C3XA 5IGCA 1II3A 1JORA 2KHSA 4ID6A 4QB4A 3E5SA 4K8IA 1KDAA 3BDLA 1STYA 2F0UA 2NUCA 5J1ZA 5KIXA 3NQTA 1EY4A 4OL7A 4F7XA 2F0IA 3TMEA 2QDBA 5CV9A 2PW5A 3BDCA 4DU9A 3MZ5A 4ME5A 1TT2A 1SNMA 1TQOA 4NDXA 4S3SA 5IGGA 2EY6A 4HMIA 3D4DA 2EYJA 3NXWA 2O4XA 2EYHA 2SNSA 4IALA 4IUNA 2F0OA 5E1FA 5I9PA 3DMUA 4KD3A 5M9OA 1F2MA 2RBMA 3D4WA 3RUZA 5C4ZA 3S9WA 1SNOA 1EY6A 1SNDA 1TR5A 1KDCA 2EXZA 2PQEA 5NUCA 1STHA 3SK5A 5HGTA 3U9OA 5DAUA 1EQVA 3P1HA 2PZUA 4HTHA 1EZ6A 5KEEA 4RKLA 1SYCA 2F0EA 5DEHA 3SXHA 4R8NA 5IGEA 4K6DA 1STGA 2F0LA 3HZXA 1SNCA 2OF1A 2F0HA 2EY5A 5CR3A 5IGDA 5KYIA 3D8GA 2EY1A 1A2UA 4LAAA 1EYCA 3QOJA 3ERQA 3NP8A 1IHZA 1ENCA 3QB3A 3TP6A 1EY8A 2F0WA 3SHLA 2EYFA 3MEHA 3NK9A 5CC4A 5KGUA 4KY6A 1JOKA 2LKVA 2EYLA 5EKKA 3SK6A 5CV4A 5IIFA 1SYEA 2F0PA 1A2TA 4K14A 3MXPA 5I9OA 4IZ8A 2F0MA 5CGKA 1F2YA 1F2ZA 1STAA 4K5WA 4ZUJA 3SR1A 5EKLA 3TP7A 4H7BA 2EYOA 3T13A 4WRDA 1EYAA 4I65A 4NKLA 1KABA 3R3OA 5CV6A 3T16A 4B9XA 5J39A 4HMJA 3MHBA 5KRUA 5JOBA 5HURA 4EQOA 2F0JA 5IGBA 2F3WA 1AEXA 4F8MA 1KAAA 1ENAA 4KY7A 2EYPA 4EQNA 1JOQA 4ODGA 4ZUIA 4B9WA 5CV5A 5KYLA 3OMCA 4QMGA 4G57A 3EVQA 2M00A 2PZWA 3C1FA 4KHVA 2F0DA 2EYMA 5EGTA 1SNQA 4MIUA 5IGFA 4K2KA 5E3FA 3OSOA 4KD4A 4NP5A 2EY2A 4QF4A 2F0NA 2F0GA 5J22A 3DHQA 1EY5A 3NUCA 2PYKA 5CV7A 1EYDA 4DGZA 4EVOA 5C3WA 2KQ3A 1U9RA 1EY7A 2RDFA 3OMGA 5F2DA 1KDBA 2RKSA 3C1EA 4N9TA 1EY0A 4KTAA 2F0SA 4ZQ3A 2PZTA 1STBA 3LX0A 5I6YA 2F0QA 5IOCA 1SYFA 3PMFA 2F0FA 2OXPA 4PMBA 4K5VA 4KV6A 1SYGA 5C5MA 3V2TA 3OWFA 5IODA 2HQEA 4YIJA 5K5PA 4NMZA 3SK8A 3D6CA 3VA5A 2ENBA 5I6WA 1SYBA 2SNMA 4EQPA 3EJIA 1NSNS 3NHHA 4RKBA 4KJNA 5C6AA 1A3TA 1STNA 5C5LA 4KY5A 3SK4A 5C4HA 1JOOA 2SOBA 5JAVA 4E6IA 2F0KA 4K8JA 4TRDA 4DF7A 3MVVA 3EROA 1SYDA 1SNPA
chains in the Genus database with same CATH superfamily
5BN4A 1I50B 1PMRA 2BH8A 1TKWB 2CWAA 2JP1A 3CW2C 2H4OA 4PMCA 1AZPA 2ZXPA 1M1KC 1Z9FA 4AH6A 3D6WA 5IWAQ 3T4AC 1II3A 4BS9A 4NXMQ 1H9JA 4QB4A 5JEAJ 4A93G 5IYBG 3H91A 4OEMB 1GKHA 1ESFA 4BWGB 1JWSD 2CH4W 4A3KH 1HHVA 1TY0A 4BA1I 1CZWA 1TQOA 1NCVA 2RHQB 1YZ6A 1YNND 3TRZA 4K0KQ 5M9OA 1SE3A 4LFCL 3F1ZA 4IJLA 1DZ1A 3OIPA 2EXZA 3M4YA 3A7AB 2IX1A 5DAUA 4QCLA 3P1HA 4DV6L 4BY7B 1NBWA 2L9HA 3KLSA 4JI3L 4O2DA 3VYUA 3Q0AA 3S1RH 4DNIA 2K33A 4AIMA 1RHPA 1VQPA 1PH3A 2EY1A 3SEBA 3QOJA 2NTSA 4X62Q 4A93H 4DV6Q 5E7NA 4JI3Q 1BO0A 1VQFA 1SMYC 3J80L 4G7OC 5IIFA 4RG1A 1ICFB 3T56B 5M5XH 3HKZB 1NR4A 2IHFA 3PUWA 2R6GA 1GXDC 3EFXD 1HRJA 4YHHL 4DXFA 4B9XA 1TWCB 3BVGA 2VW9A 2PQAB 3HOXB 4EQNA 1JOQA 2RF4A 4DV0L 3E9HA 3ZJYC 2DY7A 3H15A 4YHHQ 1HNZL 2I46A 3S24A 2PYKA 2KCTA 3CPWA 3HOZH 4XTCS 4JOIC 3I72A 3I56A 1AH9A 1DONA 4DV0Q 2PCFB 2Z1CA 1QVGA 3BJUA 1CKOA 3K5MA 3NPPA 4GKJL 1CA6A 4Q0FA 1CUKA 3JAML 1CQVA 4RKBA 4X65L 1GVPA 2MQHA 3CHBD 1R4PB 1F2LA 1A6XA 1K83B 4IPCA 3KF8B 3GD7A 4DF7A 5EKIA 5K36G 2R7DA 4GKJQ 3PUXA 3T53B 3W5OA 3RD4A 5L37A 3M7GA 4X65Q 1SJED 4BXXH 4PZ8A 2UXCL 2D5DA 1G2SA 2MFIA 3RZOH 3V96A 4XQQA 3S1NB 1SSOA 2MJ8A 1EY4A 3FHWA 4JOIA 1D5XC 3GTMB 4AQYL 2EJGC 3PUYA 1U4LA 5JPMC 4S3SA 1L0YB 2D0PA 2N55A 4FXDA 3U9SA 4HJ5A 1GOZA 4AYBE 5ELDA 4U673 4CDEC 2VQEL 4AQYQ 1WTQA 5C44G 3NTHA 2L11A 2WB1G 1SYCA 2RSOA 1EWCA 1E22A 4JI5L 4IUVA 2VQEQ 3TQYA 1Q3LA 1TS4A 1IHZA 1ENCA 1TWFH 2WAQG 4N8X1 2JA7B 1G91A 2HHHQ 1IXRA 1VQOA 1MJCA 1BCPF 2IW3A 2HUGA 1E1OA 1SBBB 1J8IA 4JI5Q 3J81j 4KK7A 1EEFD 1EUJA 1IZ6A 4JI7L 1DXMA 3SR1A 4H7BA 4IO9A 1F9QA 3T13A 3VR3A 1PTOF 4RGMA 2RCFA 4M8AA 3QG1A 2A74C 4A3MB 1JE4A 3OW2A 2JA5G 1CI3M 4QMGA 3SE0A 3HOUH 1VF5C 5A2QL 2XIWA 1S72A 4C3JG 1UE1A 3M4OH 3A0JA 4HJ7A 4UP9A 4HN7A 3GQBA 5FLXc 3BZKA 5JEAH 1VQDA 1C7YA 3H94A 2ZXOA 1QCBD 4IQZA 4A3GG 2F0SA 4KI0A 5EPKA 2AMCB 2PZTA 2F0QA 1S3OA 3PMFA 5IE8A 3S15H 5IODA 3SK8A 1EIFA 2OCEA 2HT1A 2KJXA 3MFGA 1EOVA 1NSNS 5C6AA 1CKMA 3S14B 5C4HA 1HUMA 1CK1A 4B3TQ 1DOLA 1N34Q 5EQ0A 1WI5A 2JA5H 2YTVA 1KL9A 1PH6A 4X3UA 5ISRA 3BU2A 5EPJA 2XTIA 4OELB 4A3KB 1F77A 1GHJA 3K7AH 2F0VA 4ZRZA 1HUNA 2HIVA 4APVA 2Y0SE 3NQIA 4JI0L 2Z0SA 1STYA 1TWHH 4C2MH 2HCCA 4MZ9A 4A3GH 2Z6KA 3PUZA 4F7XA 2OTJA 1BNZA 3DWPA 3MZ5A 4HJ8A 3FRPB 1SRUA 1XYIA 3D4DA 3T51B 3AU7A 4B9WA 2SNSA 2AWNA 3W3AA 3S1RB 4JI0Q 2RBMA 4R4TA 3U9OA 4BBSG 2F3IA 3IFDA 2RHSB 3EBEA 3G4SA 4CJ1B 1X32A 3NSWA 2PMZB 5M5XB 5IT9c 4XYQA 3L3OC 3ND9A 1N8RC 1EYCA 1HNWQ 3I4NH 1ML0D 4LF6L 4H0LC 3SHLA 1BOSA 4X66Q 1FGBD 1ILQA 1JB3A 3H3VI 4IFDH 5TSSA 3U50C 4K14A 3PCOB 5ELOA 1DCZA 1FJGL 1A62A 2BDNA 4NB3A 1VMPA 3L7ZC 2B2YC 2K5VA 3J7YW 3T1YL 5J39A 1SFOB 4BBSH 1KNEA 3MHBA 5HURA 1GUGA 1SMXA 1KAAA 3J7AF 5H1SE 1OXUA 3HOZB 1MSHA 4ODGA 1RTNA 1GUSA 5CV5A 1FJGQ 1SEBD 1NNXA 4MHEA 2F0DA 3DUZA 1J9OA 5E3FA 3T1YQ 1HH2P 3U58A 2K04A 2V1CC 3OOCA 5J22A 5FLMH 2NVXH 4H13C 5C3WA 1I6VC 2ZT9C 3KBXA 5ELFA 4DAYA 3GTPB 4A3BH 3G71A 2VZAA 3I55A 1WOCA 4LMQD 3EQLC 3AFPA 5HGQA 4G4KA 1STBA 1WTHA 4PMBA 4KV6A 3V2TA 1JJ2A 3FP9A 4P75A 3GTKH 2DJGC 4HAEA 4BBRB 4HIDA 1VQ7A 1PRTD 1SYBA 3MWYW 2ZTEA 4HCEA 4EQPA 1G6ZA 4JI2L 3JC66 2LXKA 3L2PA 1ILPA 1C48A 3TP8A 2A68C 4Y52H 3AQQA 4KN7C 1I4HA 4J6HA 1RF2D 1IKMA 3P75A 2Q8IB 1D1IA 2OQKA 5EJWA 3CCUA 2A6HD 1HXYD 2MPMA 2CKZB 3N52A 2E74C 2WV6D 2R93B 4OGQC 1O7ZA 1N9WA 1BQQT 1LTID 5CYUA 1XMQQ 4B3ML 1D7QA 4ME5A 1WTOA 2JYOA 2EYHA 2AWOA 3D4WA 2B2VA 4FNFA 2CFMA 4UP7A 2PQEA 3OIQA 1N32L 3CC7A 2P5ZX 1TWFB 4DV2Q 3Q6SA 1G51A 4EX5A 1BBUA 1IBLL 5FO7B 5GAEC 4DV3L 5D14A 4OWTB 1CM9A 2UXBQ 4QJFA 3RLFA 1B53A 3PV0A 5C3EG 1A2UA 1FNWA 2E8GA 1GUWA 2QA4A 1EY8A 2CQOA 1QZHA 2VY3A 3NK9A 3B6YA 1X3EA 2E5LQ 4C1NI 1L1OA 1YNNC 1L1OB 2ZM6Q 4RGNA 2PI2A 3BG3A 1F2ZA 1STAA 1IW7C 2MNAA 1I6HH 1UE7A 3CCJA 3HOUB 1YJWA 3U4VA 3J81E 2NTTA 1KABA 3AYHB 1D6EC 2AKWB 2R7FA 1J6QA 4A3FH 3NBIA 4JPBW 4BY1B 2N88A 5IYDG 2UXDQ 5EGTA 2XRQD 5C3EH 4IN3A 2A1AA 3MFYA 1NE3A 2WIIB 2N8NA 3A74A 2BCOA 4AYBG 1K0RA 4L5TA 3J80i 1PTOH 1JC7A 2K6AA 2RA4A 2RVLA 1PH5A 3OMGA 1WTVA 3C1EA 3PIOA 1BBXC 1WTWA 1HR0W 1I94L 4FYDA 2OXPA 5C5MA 2QKIC 2EE1A 1SLJA 2ENBA 4RHSA 3C46A 4DV7L 4C56C 3BYTB 3K7AB 5JAVA 1LTBD 3PO2H 2X6LA 1PFSA 4LF7L 2ASBA 1Y1WH 3MVVA 1SYDA 4G7ZC 5IYDH 1HNXQ 1A3UA 1KRSA 4DV7Q 4DR6L 1TS2A 1F9SA 3CKIB 3PGZA 4LFAL 3OPOA 4LNQA 3HOVG 3CXCA 4DR1Q 2BH2A 4IPHA 3TMEA 4JI4Q 1IBMQ 4CDCC 2PO4A 3KF6A 5IGGA 1U4RA 3KF6B 4CKBA 4HMIA 3HOWG 5LMUQ 2Q8TA 3BYYB 4LFAQ 5C4ZA 3JAMi 2H1EA 3PO3H 4ALPA 5LL6X 3WWVA 1Q8KA 1MHWC 1XXGA 1V8QA 3SK5A 3I4NB 3VYTA 3S2DH 1RCVD 1K8GA 3J7A5 4OIKA 4K6DA 4F87A 3HZXA 3QJYA 4A3JG 5KYIA 2D2CC 2KEEA 4KLKA 3K58A 2QEXA 3I73A 4DAPA 1VQNA 1N33L 1JWMD 1R9TH 1QUQA 4CKEA 1J5EL 1QUQB 4OO1H 1YNXA 3CC2A 1B50A 1HQMC 3G7LA 1ZYRD 3IFTA 1IYUA 2K75A 3CAMA 3J81c 5C0XI 1N33Q 1V1PA 1RDPD 4ZUJA 3KJPA 1V1PB 2ATWA 4QY7A 2R7ZG 1B70B 1CSPA 2E75C 2UUAL 2BDOA 2Y0SG 4CJ0B 1BF4A 4MTNA 4GNXA 5EPLA 1ENAA 4A3BB 3VYSA 3GP7A 1YITA 2XVSA 2FMMA 4DA2A 2J0TD 3KBGA 5FOBB 1ESRA 2KHJA 2AQ1B 2NVYH 2QDLA 3F8TA 1WCMH 3LWUA 3CQZH 2RDFA 3R93A 1A8VA 3BDOA 1KDBA 1EQTA 3E0EA 1H9MA 1QE6A 3TN2A 1XJVA 3OW7A 1GM5A 1CFMA 5AJ3L 2F0FA 5EBDA 2R92G 3GV3A 5LMNL 1LLRD 4A3DB 1LT3D 1D1KA 3IL8A 4MTKA 4NMZA 3T1HL 1TS5A 1WFQA 4DR2Q 1JE5A 4QIWB 5C5LA 2E2IB 1E2VA 4EQ5A 3I4LA 1BXTA 2AUKA 1E2ZA 2K32A 5LMNQ 2CW0D 1C8CA 4B3SL 2K5QA 1A3VA 3TP5A 2VUMB 1RKNA 3NBHA 3FMCA 3NBHB 4POFA 4X3KA 4FP5D 2UUBL 4J15A 1Z6HA 1KDAA 3BDLA 4PQXA 3NQTA 4A3LG 1CSQA 2NWGA 2HQLA 2B8FA 4IUQA 1VDZA 5D65A 5ELBA 2I07B 3NXWA 1XPOA 3NTIA 3GTLH 2MGSA 4NXML 5FK9C 5BR8L 1YBYA 3GTGH 1B8AA 4UDUC 3HOYH 1KDCA 1Q12A 2YTXA 5NUCA 5C4XG 1Q46A 4LFBL 3L9AX 1AZQA 2NVTH 4L5SA 3Q22A 1VQ8A 1P16A 1DM0B 5I4DA 2KUMA 1UUPA 4K0KL 1EIHA 1K8AC 5BR8Q 3BZCA 2B2TC 5C4JB 5IP7G 4X3TA 1QZGA 4LFBQ 4DNTB 1OO9B 2VS1A 5M3FH 4A3FB 4DK6C 1A2TA 2JE6I 1EQQA 3RMHA 2E2JB 2N49A 1X3GA 4X62L 3H3VH 3NELA 1YEZA 1LTGD 2JJQA 3LWEA 2JA8G 3T16A 3UDIA 2K5NA 5C4XH 4JI6Q 2H5XA 5M5YH 4JBWA 3PF5A 3ER0A 2R61A 2LMCB 5E4XA 1VQMA 3I2ZA 1XTCD 2A6ED 1SDFA 1HFNA 2EJMA 3P20A 4G57A 2ZJQA 5IYBH 2PZWA 2A69D 2OT2A 3J80E 1FGUA 1Y69U 2B2TA 2KCCA 1YNJD 1MI2A 3GO5A 1I4RA 3GDEA 1G6PA 2OQ0A 1X3PA 1Q90A 2K14A 3PO2B 3E3XA 4U68A 3UDFA 5FO9B 4XIGS 4CHTB 2QGQA 4FF1A 3IKJA 2B63G 5JPNC 5C0XJ 1LT5D 2LFNA 3CF5A 1GUNA 3URYA 4LF9L 3A8IE 1X56A 1N36Q 1K8MA 4HJAA 3A5UA 4L5RC 2B39A 3PO3B 3HGBA 1EWHA 2NUCA 5KIXA 1YJ9A 4LF9Q 2AQ3B 1PYWD 4C3HG 3S2DB 5EBCA 1XNQQ 3M3YH 1JICA 3JAME 2L12A 1E7ZA 3EIVA 2ZJPA 4NPSA 4RCNA 2DGYA 5I9PA 1SE8A 1VMCA 2K4KA 1EY6A 2F1MA 5FLXL 3RZDH 4XDXA 4JYAQ 4R4IA 2NVQB 2JK8A 3ZYYX 2OTLA 2IY5B 2ICEC 5HY6A 2AUJD 4KKUA 3WOFA 3S1MB 2R93G 2KENA 4Y7NH 4DUZL 4C3IG 3FKIG 1QOHA 3KFUA 2J4XA 1YVCA 2EDGA 1PH2A 2K03A 1BDOA 1M4VA 1GUOA 2ZXRA 2JA6G 3STBD 3CU7A 3ONAB 1PRTB 3HKZE 3TP7A 1E3PA 1F9RA 5K36H 4DUZQ 4NKLA 5BN5A 2HHHL 2L55A 2NVYB 5GAHC 4JI1L 5IGBA 4XT3B 1ET9A 3CQZB 1B2TA 3O13A 5JVG3 5A35A 4GOPA 1Y1VB 2M00A 4GOPB 3H0GG 5E4WC 1Q81C 1SNQA 1H9RA 1HZBA 4K2KA 1LUZA 2X6GA 2EY2A 1O7IA 5KNDA 3UE0A 1QILA 4JI1Q 3NUCA 1Y8OB 4A3IB 3FKIH 1LO5D 1HZ9A 1K8OA 3F2DA 3Q24A 1EY0A 4QL5A 5I6YA 2JA6H 3A54A 2B2UA 1NMGA 5C44H 3F2CA 2HQEA 2MP1A 3HRZC 2WINB 1FL0A 1VQ4A 5DM63 3F2UA 2KOLA 3C3LA 1VQBA 4A3EG 1STNA 4E6IA 4XXEA 2WP8J 5A2QE 2WACA 4RGTA 2Z6BA 1YHBA 4A75A 2BE5D 3I4MB 4LW1A 1PYSB 1B7YB 1U4PA 2Z6KC 4RFBA 4QQBX 4K5XA 2Q2TA 2I5MX 3I8ZA 4ID6A 1O7LA 4B3TL 1N34L 3GTGB 2EIFA 3RNUA 1MD2D 4DV4L 3TS0A 2F0IA 3KLRA 2QDBA 2Z8LA 1NJIC 1BCPD 2NVTB 4TVAB 4LUZA 3BS1A 4IALA 1ET6A 3R8BA 2K5DA 2TMPA 4IUNA 1KTKA 4GN5A 4RA8A 1TWAH 1HR0Q 3NTKA 1PTOD 4DV4Q 1QG7A 2QF7A 4GS3A 1OXTA 2RQXA 5C0XG 4C3JH 1ASZA 5M3FB 2QEJC 1HJPA 2SEBD 4LUOA 1X9NA 2IT1A 1PFNA 1D5ZC 1BUVT 1UE5A 2I0QA 1G291 4YCUA 4DR7Q 2LKVA 4GN3B 4UAIA 3SK6A 5D3DA 4PV1C 2MO1A 2KBNA 3A8KE 2JSOA 5M3MG 4IZ8A 1XTDA 2PPBC 1HNWL 4WJ3M 2KVMA 4A93B 1L0WA 2EYOA 3DEPA 1EYAA 4I65A 4WRDA 1SXTA 4X66L 1WTXA 5IY0A 5JOBA 3CMAA 2F0JA 5C0XH 4CJ2C 4P73A 1CA5A 2CVRA 1FR3A 1RIPA 1WJJA 1QWYA 1UE6A 2LS01 1Y8PB 4PZ7A 3GV6A 1KRTA 1EOTA 4MIUA 4ZYSA 1PH9A 1VQAA 3DHQA 1PVOA 4OXPA 1HQRD 4POGA 4DUYL 2RKSA 4KTAA 4GLAC 1I5FA 2XWJB 2KA7A 3M4QA 2XN9C 3CMEA 4R9WA 1CTMA 3K0YA 2SNMA 3VYRA 2CH4A 3CCEA 4DUYQ 3UDGA 4RGOS 1IYVA 1G2TA 1FYCA 1SNPA 1B3QA 3MA2B 4J1MA 2F3VA 3QIAA 1EY9A 1Y8NB 4FVMA 3MAQA 4DAYB 2VL6A 4FXGC 4YWLA 4WJWA 2MUYA 3PIO3 2JEBI 5CORA 3V05A 2B2VC 3RZDB 4A3DG 3UDXA 1OXVA 1O7YA 4TKOB 1M90C 1JR0D 4GN4B 3RZOB 3RUZA 4R4OA 1FD7D 2ZJRA 1SNDA 2XSCA 1B4OA 1CHQD 4JI8L 5HGTA 1Z7TA 1PDQA 4Y7NB 2PZUA 3UI2A 1XMQL 2VUMG 4JCVE 2D62A 2K1BA 1CKNA 2Z9HA 1CKNB 2F0LA 1SNCA 5CR3A 2IWHA 3D8GA 1L1OC 4JI8Q 2PMZE 2XWBB 4P72A 4DV2L 4OWXB 5J3BA 4IUUA 5KGUA 4KHPL 1JOKA 3G6JB 4DK0A 2IL8A 4YWKA 3RLNA 2UXBL 3TZUA 1XWEA 1VQKA 4GKKQ 1B9NA 2K5HA 2XGTA 4KHPQ 2E5LL 4EQOA 4GLXA 2KEDA 2ZM6L 1QNKA 4JV5L 3RN5A 3CCQA 2G9HD 1IL8A 3M85A 3E6ZX 4DAMA 5C44B 3N6RA 2UU9L 1K73C 2TSSA 1VQ9A 1HTPA 3KLWA 2GN5A 3DWAA 4G7HC 1EYDA 2WB1B 4JV5Q 5F2DA 2I5HA 2UXDL 1S5FD 2YU9H 1M8AA 1ICWA 1T9HA 2CHBD 3LX0A 2E2HH 1I50H 4BY7G 1SJHD 3Q23A 2UU9Q 2IPKD 3M4OB 2B29A 2SDFA 1LTAD 2K5WA 2WAQB 4RHRA 4CGYB 4XT1B 1KHIA 4DR4L 4DR5Q 5CBAE 1AE2A 5DM73 3K57A 1PFBA 4DPGA 2VB3X 2RDHA 3QOLA 3CCMA 3S15B 1RTOA 1UEAB 3HEJA 1YIJA 4DR4Q 3HKZG 1EZ8A 3D3RA 5KNCA 1NR2A 4RAUC 1EU4A 1D5MC 4K8IA 1PFMA 2JA5B 3LNNA 1HNXL 1V9PA 2AQ2B 4PMWA 4BY7H 4C3JB 3HOXG 1ZEQX 4NDXA 1DOKA 1SNMA 4KD3A 2ZTDA 4C2MB 1TIID 1TWHB 4DR1L 4A3GB 1X3QA 1STHA 1HPCA 2DY8A 2YV5A 1EQVA 3KOJA 4JI4L 4HTHA 4KMUC 1IBML 1SE4A 1I4QA 1XNRQ 3QO2A 4ZAIA 3SXHA 2IJ0A 5LMUL 2EZVA 3DWQA 3KK7A 1KAWA 4O1NA 4CDDC 4DKAC 3CRLC 1TWCH 2HDMA 4BA2I 1X6OA 2F4IA 2NN6G 1HFGA 3CCVA 5FJ8G 4GNXC 3E9IA 2JQOA 3PSIA 2PI2E 4DN4M 4XQJA 3QR8A 2JA9A 1LV9A 4O42A 1VQLA 3PF4A 5M5WH 4F8MA 5IP9G 3DM1A 1KC8C 2M9VA 1JMCA 4RH6A 3HOVH 1DGSA 5CBEE 3C1FA 2EYMA 2N78A 2XNAC 5G3LF 4BBSB 3VR4A 3D4RA 2C9OA 4H44C 5CV7A 3F2BA 2VQFL 1RJTA 4ILWA 3HOWH 1U9RA 2IX0A 1VQ6A 2A5HA 2AHOB 1K83H 4XQNA 2J7ZA 5FJ8H 3MXUA 1AP0A 2NVXB 1LYLA 1V1QA 1E0BA 1VF7A 2VQFQ 4GNXB 1CQFA 4KKSA 4KY5A 5ELNA 1LTRD 4FDBA 4A3JH 2NBFA 1NUCA 1B9MA 2E2DC 3GTKB 2JA7G 1I4XA 3GTMH 2BA1A 1OXXK 1JCKB 4DR2L 4Z9CB 1SROA 4KJOA 4OONA 4P74A 5IGCA 1QVFA 3ULJA 4R4QA 3A5ZB 3E5SA 4DR3L 1UNSA 2HDLA 2RSNA 5G3LD 4IFDI 5COYA 1LT4D 4A3MG 2R7ZH 2WFWA 3TREA 3DMUA 4DR3Q 1H95A 2WKDA 1EEID 2A73B 4A76A 3A55A 3MTSA 2JA7H 2Z4HA 2F0EA 3W1BA 3HKSA 4C1NK 1STGA 4QGUA 1NY4A 5IGDA 3ERSX 4LWCA 1WTPA 1X54A 2NZHA 3R2IA 5DNFA 2O5JC 2R92H 2A68D 1KD1C 4UHVA 4LF4Q 2EXDA 3M7NA 1L2FA 4A3MH 3K80C 2IX3A 1PA6A 1ENFA 2LSSA 4R8IA 1VQCA 2GVBA 3NE5B 1X65A 2NB0A 4MNOA 4A3KG 5CV6A 1FNVA 2NZOA 3J7ZC 1IBKQ 1MSGA 4CDFC 1LTLA 4KHZA 5KYLA 2YU9B 1I6HB 1DJRD 3K81C 3OTOL 4DAVA 3K6OA 2E2HB 5FO8B 4A3LH 4JI6L 2PNHA 3IAYA 1AFPA 3KLSX 3S14H 3KYHC 1BCPB 1S5CD 3OTOQ 1BR9A 5IOCA 5C3EB 3S2HH 3R2TA 2YTYA 4IOCA 1PTOB 3X3MA 3NHHA 4JBJA 4JG2A 1JOOA 1XPUA 2A8VA 4K8JA 2K05A 5IP7H 5JJZA 1FVIA 4QIWE 4DFAA 1IW7D 2X69A 1R4QB 3TEHB 3AFQA 3H6MA 5CV8A 4K2LA 4OIJA 1PH8A 1HZCA 1UEBA 1QB5D 4N9PA 4LJZC 4HIKA 3HS0C 4M1UB 1Y1WB 4LFCQ 3K59A 1VQGA 4ZKBB 2Q2IA 3OWEB 4PG3A 1N36L 2JA8H 3NEMA 1EL0A 1TT2A 4AYBB 3HOZG 3PIPA 1LTTD 2MHVA 1HCZA 1TR5A 5GROA 1WD0A 1VQ5A 1XNQL 5GAGC 1EWIA 3S16H 5KEEA 1JJGA 3HP3A 3NWTA 2PQAA 2L5TA 3FPUB 5CMDA 3L0OA 3ERQA 1W2BA 3FEWX 1JT8A 4JYAL 4BBRG 1PRTC 2E76C 4YCVA 1RL2A 4KY6A 1SFOH 4BXXG 4NXNL 3DXJC 5JJIA 5M5WB 2B63H 4DXGA 2Q2UA 4IFDJ 2JEAI 2M2LA 5FLXE 4K5WA 1VS0A 3HOVB 1R9TB 2F52A 5JJKA 4GOPC 1HNZQ 2F4VL 4PZ6A 4HMJA 1Q1BA 4R1JA 4NXNQ 3BVMA 2ZTCA 2A6HC 3GTPH 3HOWB 1U0LA 4KY7A 4P2CB 3GTQH 4DNRB 3OMCA 2LY7A 3EVQA 3KF8A 4Q5VA 5LHY1 2DNCA 4C3HH 1TWGH 2F4VQ 3CCSA 2BOSA 4QF4A 2F0GA 3AMUA 4BBRH 1V1OA 2B2UC 3DM3A 2KQ3A 1E2WA 1I4PA 2D9UA 1GHKA 1W3SA 1BBWA 4ZQ3A 2FXQA 4A3JB 2JXMB 1EFID 4FO2A 3KDFA 1C0AA 3KDFB 3OWFA 1FNUA 1BVSA 2R3ZA 4YIJA 4HCSA 1CZGA 1WCMB 4XYOA 3VA7A 1Q82C 4MN3A 2UXCQ 3J80c 4ZK9B 2A19A 2NYZD 2KCMA 2KCNA 4KN4C 4IUPA 1O80A 2R93H 1XX8A 3MXGA 2NN6I 2R7ZB 4C3IH 4PNYA 4RMFA 2EOTA 2Y0SB 4HEDA 4J8QA 1JORA 2PW7A 5C3XA 4L6TB 2BA0A 1PV4A 4ABNA 1DYQA 2RCNA 3S1QH 4OO1I 3HOUG 3LGJA 3WDNA 2F0UA 1EYGA 5J1ZA 3SVMA 1WVLA 5IT9E 5IT9L 4CKCA 3BDCA 3CPFA 2EYJA 4YCWA 4BY1G 5JEAG 4WJ4A 1WD1A 1F2MA 1EIGA 2K7VA 2QILA 3FDTA 3H0GH 3WOEA 2R92B 5LMNW 1X55A 2FFKB 2G9DA 1EZ6A 3NENA 1E24A 2FMCA 4HSVA 3H3VC 3K0XA 5DEHA 1A63A 3GTLB 5AFWA 5IGEA 2YYZA 3J81i 1HR0L 2OF1A 3HOYB 1KIXA 4LAAA 3JAMc 2ICIA 1YI2A 4JI7Q 3EA6A 5BN3A 3A7LA 3OHXC 2KHIA 1MGSA 1PH7A 4A3EH 2F0PA 3P7JA 4BY1H 1VQIA 5DLQE 2F0MA 3E0JA 4DV5L 1PXUA 3RN2A 5GADC 5EKLA 4QUCA 1EFWA 1P8LA 4TQUS 3AEVA 4DR7L 1SR3A 2GVAA 2EJFC 4L63B 4JBMA 4DV5Q 1PH4A 3K5NA 4IPDA 4KHVA 1DOMA 1PH1A 2ID0A 1GJXA 5JVH3 4IPGA 5C4XB 3GTJH 4NP5A 3S2HB 3M9BA 3GTOH 3X3NA 5M5YB 3VR2A 3CCRA 1EY7A 4DV1L 2VXWA 1H9KA 2K01A 3I4NG 1SYFA 1KXLA 1TXYA 3I4OA 5IYCG 4FXKC 3D6CA 4IFDG 4DV1Q 5JJLA 1D2BA 3NWSA 1QNUA 2ALYB 4QUFA 4IUTA 2F0TA 2NZ1D 2D0OA 2JA8B 3VR6A 1IKLA 1ZYRC 5M3MH 1HA6A 1ASYA 3ULPA 2FHTA 4OL7A 3A8JE 5CV9A 5FLMG 1SMYD 1PLFA 1TVXA 1MJEA 3S16B 3AB9A 1K0SA 5IYCH 4A3BG 4JVZA 2EY6A 4RWSC 1ONLA 1PRTF 3S9WA 2N3SA 1EU3A 4JK1C 1NMFA 3K7UC 2DN8A 2VNUD 4N8FA 3M3YB 4LF6Q 3IRBA 1AN8A 2FINB 1I3QH 2CQAA 2B63B 1NAPA 2F0HA 1XPRA 3TBIB 4ME3A 4ZKCB 3TP6A 1LM0A 2F0WA 5EKKA 4K6LA 1A15A 3ND8A 5CV4A 3MEFA 5LL6S 4ZLTF 1W6KA 4A3CG 1SYEA 3GTQB 2EPBA 5CGKA 2CW0C 5GQOA 1SAPA 3U4ZA 2FJ2A 4JBKA 4WFN3 2KECA 4JC0A 1NTGA 4HSPA 4C3HB 1TWGB 4X64L 3KUPA 4B3RL 1Q7YC 5KRUA 2EVBA 2MO0A 1RODA 2EYPA 4ZUIA 1O78A 2B2YA 4GKKL 1VQJA 3G6EA 1LABA 3S17H 4O0AA 3BVZA 4B3RQ 4X64Q 2C5CA 4A3DH 2UUCL 3J7AV 4DGZA 4EVOA 3I3CA 1SN8A 3TZDA 2L4NA 1HTLD 4JI2Q 4A3CH 2B3GA 2E2IH 3H09A 1Q1EA 2EQSA 3I90A 1KQSA 4K5VA 2JN4A 1SE2A 2UUCQ 1B44D 2VUMH 3ULLA 1VQEA 1G8ZD 2I5LX 4C3IB 3FKIB 5FKAC 1B3AA 1MKHA 1A3TA 1MBYA 4OHJA 1CT1D 4H02A 2LXJA 1XMOL 2JA6B 4B08A 3S1QB 1PHJA 1LTSD 3ITPA 2OEOA 2OWOA 2HIXA 4B3MQ 1T5EA 3M4PA 4A3FG 4WORA 4F88A 3CC4A 4DR5L 2G5DA 2KHSA 4I7ZC 1XMOQ 3DEOA 2WKCA 1D8LA 1EIYB 4LF5L 2Q2HA 3CRKC 3PUVA 1N32Q 3H0GB 2PW5A 1EQRA 1IBLQ 3K5OA 3UE1A 4DV3Q 2A6EC 1K3RA 4LF5Q 5C4JH 1WTRA 1S5ED 2A69C 1K9MC 1SNOA 2QCPX 4V190 1YNJC 4JW0A 4CBVA 4FF2A 5T1IA 3CD6A 3J81L 4RKLA 2CWPA 4LK1C 2HD3A 4R8NA 3PO2G 4A3EB 1TWAB 1F9PA 2EY5A 1Y1WG 2V4DA 3D0FA 4HR7B 1PZID 2E2JH 3NP8A 1Y14B 1JQYD 3MEHA 3K8AA 3FPPA 1XNRL 1GD7A 2K52A 3A56A 3G48A 3MXPA 5I9OA 2QW7A 1OXSC 4EGVA 2XRSD 1TY2A 1HA5A 1H9SA 4OWWB 4HIMA 1RD9D 1H9SB 3QWNA 3GTJB 1HZAA 5ELCA 4DK1A 3GTOB 2Z4IA 1T5XD 1AEXA 1E1TA 1GUTA 3PO3G 1KLUD 1I94Q 4L5QA 1S40A 3D31A 3OSOA 4R4CA 2O5IC 1C9OA 1LACA 4FF4A 3HOXH 4LUVA 2IHEA 2GA4B 1DD2A 3SGIA 1YJNA 4N9TA 1S5BD 4LF7Q 1QVCA 2L0CA 2WB1E 1L0XB 1I4GA 3BZDB 1LT6D 1SYGA 1S4ZA 1Q8IA 4OO1G 5K5PA 3MXNA 2Q8RE 2CCZA 5EAYA 3MXNB 1K28A 3I91A 3TDQA 3EJIA 4DR6Q 2VB2X 4LF8L 2WAQE 2DUDA 5M3MB 4ULLA 4TRDA 4KKTA 3EROA 1U5KA 2SOBA 1IYJB 4UY8C 3TSSA 4OX9L 1A0IA 3VDYA 4X6AH 4LF8Q 4IJHA 3STBC 3ICEA 3PQIA 4IURA 1U4MA 2DJFC 2ES2A 2NN6H 2B2WC 4L8JA 4I7AA 2DNEA 1TS3A 1BKBA 5I2XA 4OX9Q 3HG9A 4ZCKA 1ZXTA 3CCLA 1YHAA 4DU9A 3I70A 1WCMG 5ELEA 1Q86C 2O4XA 2NVQH 2PNRC 2F0OA 5E1FA 5IP9H 1I3QB 1Y1VG 3RR5A 4HJ9A 3S1NH 5T1GA 1V43A 3TS2A 4TSSA 2B8GA 1WYDA 5D3IB 2F03A 3S1MH 3DLLA 1J5EQ 4A3IG 4UP8A 1YHQA 1K3BC 4YY3L 1VCIA 1X3FA 3RLOA 4UPAA 1CHPD 1JWUD 1ZKOA 1C4QA 1IL2A 3QB3A 4RCOA 2K50A 2EYFA 2UUAQ 1OTCA 2B2WA 1W6JA 5CC4A 5I2YA 4FF3A 4GZYC 3C2PA 3K5LA 4YY3Q 2EYLA 4X3SA 2HCIA 1Z47A 3HFZB 1JB7A 1F2YA 3PIP3 3EN2A 1UWVA 1Y1VH 1TU2B 3S17B 4A4IA 2BE5C 1AW7A 3R3OA 3I4MG 4LF4L 3OYYA 3VR5A 3MC0B 2F3WA 1KLGD 4A3IH 4V0BA 4HIOA 2O2LD 4NW2A 3HOYG 5AJ3Q 1BCPC 1UAPA 5IGFA 3Q8DA 3W2DA 4IOAA 4KD4A 2F0NA 1GO3E 1IBKL 1EY5A 2C35B 3T1HQ 1PZJD 5KNBA 3CP0A 4YWMA 2L1BA 1PTOC 1VQHA 1AE3A 3I7FA 1JJCB 1S5DD 2K28A 3SDZA 3KJOA 4B3SQ 2L15A 1QJOA 4DK3C 3VA5A 5M3FG 5I6WA 4GLVB 1KNAA 3I4MH 1STEA 4KJNA 4P71A 1PZKD 5IWAL 2RDGA 3SK4A 1PYBA 2UUBQ 1MIUA 2F0KA 1B1ZA 3W1GA 3FVQA
chains in the Genus database with same CATH topology
5BN4A 1I50B 1PMRA 2JP1A 1TKWB 2H4OA 4PMCA 1AZPA 2ZXPA 3D6WA 3T4AC 1II3A 4BS9A 1H9JA 4QB4A 5JEAJ 3H91A 1ESFA 4BWGB 1JWSD 1HHVA 1TY0A 4BA1I 1CZWA 1TQOA 1NCVA 1YNND 5M9OA 1SE3A 1DZ1A 3OIPA 2EXZA 3M4YA 3A7AB 2IX1A 5DAUA 4QCLA 3P1HA 4BY7B 2L9HA 3KLSA 3VYUA 3Q0AA 2K33A 1RHPA 2EY1A 3SEBA 3QOJA 2NTSA 1BO0A 3J80L 1SMYC 4G7OC 5IIFA 3T56B 3HKZB 1NR4A 3PUWA 2R6GA 1GXDC 3EFXD 1HRJA 4DXFA 4B9XA 1TWCB 3BVGA 3HOXB 4EQNA 1JOQA 2DY7A 2I46A 2PYKA 4XTCS 3I72A 1DONA 2PCFB 2Z1CA 3K5MA 3NPPA 1CA6A 4Q0FA 3JAML 1CQVA 4RKBA 3CHBD 1R4PB 1F2LA 1A6XA 1K83B 4DF7A 3GD7A 5EKIA 5K36G 3PUXA 3T53B 3RD4A 3M7GA 1SJED 2D5DA 1G2SA 3V96A 4XQQA 3S1NB 1SSOA 2MJ8A 1EY4A 3GTMB 1D5XC 2EJGC 3PUYA 1U4LA 5JPMC 4S3SA 1L0YB 2N55A 4FXDA 3U9SA 1GOZA 5ELDA 4U673 1WTQA 3NTHA 2L11A 1SYCA 2RSOA 1EWCA 4IUVA 1Q3LA 1TS4A 1IHZA 1ENCA 2JA7B 1G91A 1BCPF 2IW3A 2HUGA 1J8IA 1SBBB 4KK7A 1EEFD 1DXMA 3SR1A 4H7BA 1F9QA 3T13A 3VR3A 1PTOF 4RGMA 4M8AA 3QG1A 2A74C 4A3MB 1JE4A 1CI3M 4QMGA 3SE0A 1VF5C 5A2QL 2XIWA 4C3JG 4HN7A 3GQBA 5JEAH 3H94A 2ZXOA 1QCBD 4IQZA 2F0SA 4KI0A 5EPKA 2PZTA 2F0QA 3PMFA 5IODA 3SK8A 2KJXA 3MFGA 1NSNS 5C6AA 3S14B 5C4HA 1HUMA 1CK1A 1DOLA 5EQ0A 4X3UA 5ISRA 5EPJA 4A3KB 1F77A 1GHJA 2F0VA 4ZRZA 1HUNA 3NQIA 1STYA 2HCCA 3PUZA 4F7XA 1BNZA 3DWPA 3MZ5A 3FRPB 1XYIA 3D4DA 3T51B 3AU7A 4B9WA 2SNSA 2AWNA 3W3AA 3S1RB 2RBMA 3U9OA 3IFDA 4CJ1B 1X32A 3NSWA 2PMZB 5M5XB 4XYQA 3L3OC 3ND9A 1EYCA 1ML0D 4H0LC 3SHLA 1BOSA 1FGBD 1JB3A 1ILQA 4IFDH 5TSSA 4K14A 1DCZA 2BDNA 1VMPA 3L7ZC 2B2YC 3J7YW 5J39A 1SFOB 1KNEA 3MHBA 5HURA 1GUGA 1KAAA 3J7AF 1OXUA 3HOZB 1MSHA 4ODGA 1RTNA 1GUSA 5CV5A 1SEBD 4MHEA 2F0DA 3DUZA 1J9OA 5E3FA 2K04A 3OOCA 5J22A 4H13C 5C3WA 1I6VC 2ZT9C 3KBXA 5ELFA 4DAYA 3GTPB 4LMQD 3EQLC 4G4KA 1STBA 4PMBA 4KV6A 3V2TA 4HAEA 4BBRB 1PRTD 1SYBA 4EQPA 3MWYW 4HCEA 1G6ZA 1ILPA 1C48A 3TP8A 2A68C 4KN7C 1I4HA 4J6HA 1RF2D 1IKMA 3P75A 2Q8IB 1D1IA 5EJWA 2A6HD 1HXYD 2MPMA 3N52A 2E74C 2WV6D 2R93B 4OGQC 1O7ZA 1BQQT 1LTID 5CYUA 4ME5A 1WTOA 2JYOA 2EYHA 2AWOA 3D4WA 2B2VA 4FNFA 2PQEA 3OIQA 1TWFB 3Q6SA 5FO7B 5D14A 1CM9A 3RLFA 1B53A 3PV0A 1A2UA 1FNWA 1GUWA 1EY8A 3NK9A 4C1NI 1YNNC 4RGNA 3BG3A 1STAA 1F2ZA 1IW7C 3HOUB 3J81E 2NTTA 1KABA 1D6EC 3NBIA 4BY1B 2N88A 5EGTA 2XRQD 4IN3A 3MFYA 2WIIB 2BCOA 1PTOH 1JC7A 2K6AA 2RA4A 2RVLA 3OMGA 1WTVA 3C1EA 1BBXC 1WTWA 4FYDA 2OXPA 5C5MA 2QKIC 2EE1A 2ENBA 4RHSA 3C46A 4C56C 3BYTB 3K7AB 5JAVA 1LTBD 2X6LA 3MVVA 1SYDA 4G7ZC 1A3UA 1TS2A 1F9SA 3CKIB 3OPOA 3TMEA 2PO4A 5IGGA 1U4RA 4CKBA 4HMIA 2Q8TA 3BYYB 5C4ZA 2H1EA 5LL6X 3SK5A 1XXGA 1V8QA 3I4NB 3VYTA 1RCVD 4OIKA 4K6DA 4F87A 3HZXA 3QJYA 5KYIA 2D2CC 2KEEA 3K58A 3I73A 4DAPA 1JWMD 4CKEA 4OO1H 1B50A 1HQMC 3G7LA 1ZYRD 3IFTA 1IYUA 5C0XI 1V1PA 1RDPD 4ZUJA 1V1PB 2E75C 2BDOA 4CJ0B 1BF4A 5EPLA 1ENAA 4A3BB 3VYSA 3GP7A 2XVSA 2FMMA 4DA2A 2J0TD 3KBGA 5FOBB 1ESRA 2AQ1B 3LWUA 2RDFA 3R93A 3BDOA 1KDBA 1EQTA 1H9MA 1QE6A 3TN2A 3OW7A 1CFMA 2F0FA 5EBDA 3GV3A 1LLRD 4A3DB 1LT3D 1D1KA 3IL8A 4NMZA 1TS5A 4QIWB 5C5LA 2E2IB 1E2VA 3I4LA 1BXTA 2AUKA 1E2ZA 2K32A 2CW0D 1C8CA 2K5QA 1A3VA 3TP5A 2VUMB 1RKNA 3NBHA 3FMCA 4X3KA 4FP5D 1Z6HA 1KDAA 3BDLA 4PQXA 3NQTA 2NWGA 2B8FA 4IUQA 1VDZA 5D65A 5ELBA 2I07B 3NXWA 3NTIA 2MGSA 5FK9C 4UDUC 1KDCA 1Q12A 5NUCA 3L9AX 1AZQA 3Q22A 1DM0B 5I4DA 2KUMA 1UUPA 1EIHA 5C4JB 2B2TC 4X3TA 4DNTB 1OO9B 4A3FB 1A2TA 2JE6I 3RMHA 2E2JB 1LTGD 3LWEA 3T16A 4JBWA 2R61A 2LMCB 5E4XA 1XTCD 2A6ED 1SDFA 1HFNA 2EJMA 3P20A 4G57A 2PZWA 2A69D 2OT2A 3J80E 1Y69U 2B2TA 2KCCA 1YNJD 1MI2A 3GO5A 1I4RA 1X3PA 1Q90A 3PO2B 4U68A 5FO9B 4XIGS 4CHTB 4FF1A 3IKJA 5JPNC 5C0XJ 1LT5D 2LFNA 1GUNA 3URYA 3A8IE 1K8MA 2B39A 3PO3B 3HGBA 1EWHA 2NUCA 5KIXA 2AQ3B 1PYWD 4C3HG 3S2DB 5EBCA 1JICA 3JAME 2L12A 4RCNA 5I9PA 1VMCA 1EY6A 2F1MA 5FLXL 4XDXA 2NVQB 3ZYYX 2ICEC 2AUJD 4KKUA 3WOFA 3S1MB 4C3IG 1QOHA 2J4XA 2EDGA 2K03A 1BDOA 1M4VA 1GUOA 2ZXRA 3CU7A 3ONAB 1PRTB 3TP7A 1F9RA 5K36H 4NKLA 5BN5A 2L55A 2NVYB 5IGBA 4XT3B 1ET9A 3CQZB 1B2TA 3O13A 5JVG3 5A35A 1Y1VB 2M00A 5E4WC 1SNQA 1H9RA 4K2KA 2X6GA 2EY2A 5KNDA 1QILA 3NUCA 1Y8OB 4A3IB 1LO5D 1K8OA 3Q24A 1EY0A 5I6YA 3A54A 2B2UA 2HQEA 2MP1A 3HRZC 2WINB 5DM63 3F2UA 2KOLA 3C3LA 1STNA 4E6IA 4XXEA 2WP8J 5A2QE 2WACA 4RGTA 2BE5D 3I4MB 1U4PA 4RFBA 4K5XA 3I8ZA 4ID6A 1O7LA 3GTGB 1MD2D 2F0IA 3KLRA 2QDBA 2Z8LA 1BCPD 2NVTB 3BS1A 4IALA 1ET6A 3R8BA 2K5DA 2TMPA 4IUNA 1KTKA 4RA8A 3NTKA 1PTOD 1QG7A 2QF7A 1OXTA 2RQXA 5C0XG 5M3FB 2QEJC 2SEBD 2IT1A 1PFNA 1D5ZC 1BUVT 1G291 2LKVA 4UAIA 3SK6A 5D3DA 4PV1C 3A8KE 2JSOA 4IZ8A 2PPBC 2KVMA 4A93B 2EYOA 4WRDA 3DEPA 1EYAA 4I65A 1SXTA 1WTXA 5JOBA 2F0JA 5C0XH 4CJ2C 1CA5A 2CVRA 1FR3A 1QWYA 2LS01 1Y8PB 3GV6A 1EOTA 4MIUA 4ZYSA 3DHQA 1HQRD 2RKSA 4KTAA 2XWJB 2KA7A 2XN9C 4R9WA 1CTMA 3K0YA 2SNMA 3VYRA 4RGOS 1IYVA 1G2TA 1FYCA 1SNPA 3MA2B 4J1MA 2F3VA 3QIAA 1EY9A 1Y8NB 4FVMA 3MAQA 4FXGC 4WJWA 2MUYA 3PIO3 2JEBI 5CORA 3V05A 2B2VC 3RZDB 1OXVA 1O7YA 4TKOB 1JR0D 3RZOB 3RUZA 1FD7D 1SNDA 2XSCA 1B4OA 1CHQD 5HGTA 1Z7TA 1PDQA 4Y7NB 2PZUA 3UI2A 2D62A 2K1BA 2F0LA 1SNCA 5CR3A 2IWHA 3D8GA 2XWBB 4IUUA 5KGUA 1JOKA 3G6JB 4DK0A 2IL8A 3TZUA 1XWEA 1B9NA 4EQOA 2KEDA 1QNKA 2G9HD 1IL8A 3M85A 3E6ZX 5C44B 3N6RA 2TSSA 1HTPA 3DWAA 4G7HC 1EYDA 2WB1B 5F2DA 1S5FD 1M8AA 1ICWA 2CHBD 3LX0A 1SJHD 3Q23A 2IPKD 3M4OB 2SDFA 1LTAD 2K5WA 2WAQB 4RHRA 4CGYB 4XT1B 5CBAE 5DM73 3K57A 1PFBA 2VB3X 2RDHA 3QOLA 3S15B 1RTOA 1UEAB 3HEJA 1EZ8A 3D3RA 5KNCA 1NR2A 4RAUC 1EU4A 1D5MC 4K8IA 1PFMA 2JA5B 3LNNA 2AQ2B 4PMWA 4C3JB 1ZEQX 4NDXA 1DOKA 1SNMA 4KD3A 4C2MB 1TIID 1TWHB 4A3GB 1X3QA 1STHA 1HPCA 2DY8A 1EQVA 4HTHA 4KMUC 1SE4A 1I4QA 3QO2A 4ZAIA 3SXHA 2IJ0A 2EZVA 3DWQA 3KK7A 4O1NA 3CRLC 2HDMA 4BA2I 2F4IA 2NN6G 1HFGA 4DN4M 4XQJA 1LV9A 4O42A 4F8MA 3DM1A 2M9VA 4RH6A 5CBEE 3C1FA 2EYMA 2XNAC 5G3LF 4BBSB 3VR4A 3D4RA 2C9OA 4H44C 5CV7A 1RJTA 4ILWA 1U9RA 2IX0A 2A5HA 4XQNA 2J7ZA 3MXUA 1AP0A 2NVXB 1E0BA 1VF7A 1CQFA 4KKSA 4KY5A 1LTRD 2NBFA 1NUCA 1B9MA 2E2DC 3GTKB 1I4XA 2BA1A 1OXXK 1JCKB 4Z9CB 4KJOA 5IGCA 3E5SA 1UNSA 2HDLA 2RSNA 5G3LD 4IFDI 5COYA 1LT4D 3DMUA 2WKDA 1EEID 2A73B 3A55A 3MTSA 2Z4HA 2F0EA 4C1NK 1STGA 5IGDA 1WTPA 3R2IA 5DNFA 2O5JC 2A68D 3M7NA 2IX3A 1ENFA 4R8IA 3NE5B 2NB0A 5CV6A 1FNVA 1MSGA 4KHZA 5KYLA 2YU9B 1I6HB 1DJRD 4DAVA 3K6OA 2E2HB 5FO8B 3IAYA 1AFPA 3KLSX 1BCPB 1S5CD 1BR9A 5IOCA 5C3EB 3R2TA 1PTOB 3X3MA 3NHHA 1JOOA 4K8JA 2K05A 5JJZA 4DFAA 1IW7D 2X69A 1R4QB 5CV8A 3H6MA 4K2LA 4OIJA 1QB5D 4N9PA 4LJZC 3HS0C 4M1UB 1Y1WB 3K59A 4ZKBB 3OWEB 1EL0A 1TT2A 4AYBB 1LTTD 2MHVA 1HCZA 1TR5A 1WD0A 5KEEA 3HP3A 3NWTA 2L5TA 3FPUB 5CMDA 3ERQA 3FEWX 1PRTC 2E76C 4KY6A 3DXJC 5M5WB 4DXGA 4IFDJ 2JEAI 2M2LA 5FLXE 4K5WA 3HOVB 1R9TB 4HMJA 1Q1BA 3BVMA 2A6HC 3HOWB 4KY7A 4P2CB 4DNRB 3OMCA 2LY7A 3EVQA 3KF8A 4Q5VA 5LHY1 2DNCA 2BOSA 4QF4A 2F0GA 3AMUA 1V1OA 2B2UC 2KQ3A 1E2WA 1I4PA 2D9UA 1GHKA 4ZQ3A 4A3JB 2JXMB 1EFID 4FO2A 3OWFA 1FNUA 2R3ZA 4YIJA 4HCSA 1CZGA 1WCMB 4XYOA 3VA7A 4MN3A 4ZK9B 2NYZD 4KN4C 2KCNA 4IUPA 1O80A 1XX8A 3MXGA 2NN6I 2R7ZB 4PNYA 2EOTA 2Y0SB 4HEDA 4J8QA 1JORA 2PW7A 5C3XA 4L6TB 2BA0A 4ABNA 1DYQA 4OO1I 3WDNA 2F0UA 5J1ZA 3SVMA 1WVLA 5IT9E 5IT9L 4CKCA 3BDCA 2EYJA 5JEAG 1WD1A 1F2MA 1EIGA 2K7VA 2QILA 3FDTA 3WOEA 2R92B 2FFKB 2G9DA 1EZ6A 2FMCA 4HSVA 3H3VC 5DEHA 3GTLB 5AFWA 5IGEA 2YYZA 2OF1A 3HOYB 4LAAA 2ICIA 3EA6A 5BN3A 3A7LA 3OHXC 1MGSA 2F0PA 3P7JA 2F0MA 3E0JA 1PXUA 5EKLA 4QUCA 4TQUS 2EJFC 4L63B 3K5NA 4KHVA 1DOMA 1GJXA 2ID0A 5JVH3 5C4XB 3S2HB 4NP5A 3X3NA 5M5YB 3VR2A 1EY7A 2VXWA 1H9KA 2K01A 1SYFA 4FXKC 3D6CA 4IFDG 1D2BA 3NWSA 1QNUA 4QUFA 4IUTA 2F0TA 2NZ1D 2JA8B 3VR6A 1IKLA 1ZYRC 1HA6A 2FHTA 4OL7A 3A8JE 5CV9A 1SMYD 1PLFA 1TVXA 3S16B 3AB9A 2EY6A 4RWSC 1ONLA 1PRTF 3S9WA 1EU3A 4JK1C 2DN8A 2VNUD 3M3YB 1AN8A 2FINB 2B63B 2CQAA 1NAPA 2F0HA 3TBIB 4ZKCB 3TP6A 2F0WA 5EKKA 4K6LA 1A15A 3ND8A 5CV4A 4ZLTF 5LL6S 1W6KA 1SYEA 3GTQB 2EPBA 5CGKA 2CW0C 1SAPA 2FJ2A 4WFN3 2KECA 4HSPA 4C3HB 1TWGB 3KUPA 5KRUA 2EVBA 1RODA 2EYPA 4ZUIA 1O78A 2B2YA 1LABA 3BVZA 2C5CA 3J7AV 4DGZA 4EVOA 3I3CA 3TZDA 2L4NA 1HTLD 3H09A 1Q1EA 3I90A 4K5VA 1SE2A 1B44D 1G8ZD 4C3IB 3FKIB 5FKAC 1B3AA 1A3TA 1MBYA 4OHJA 1CT1D 2JA6B 4B08A 3S1QB 1LTSD 2OEOA 3ITPA 1T5EA 4WORA 4F88A 2KHSA 4I7ZC 3DEOA 2WKCA 3CRKC 3PUVA 3H0GB 2PW5A 3K5OA 2A6EC 1WTRA 1S5ED 2A69C 1SNOA 2QCPX 4V190 1YNJC 4CBVA 4FF2A 5T1IA 3J81L 4RKLA 4LK1C 4R8NA 4A3EB 1TWAB 1F9PA 2EY5A 2V4DA 4HR7B 1PZID 3NP8A 1JQYD 3MEHA 3FPPA 3A56A 3MXPA 5I9OA 1OXSC 4EGVA 2XRSD 1TY2A 1H9SA 1HA5A 1RD9D 1H9SB 3QWNA 3GTJB 4DK1A 5ELCA 3GTOB 2Z4IA 1T5XD 1AEXA 1GUTA 1KLUD 3D31A 3OSOA 2O5IC 1LACA 4FF4A 2GA4B 1DD2A 4N9TA 1S5BD 2L0CA 1L0XB 1I4GA 3BZDB 1LT6D 1SYGA 1S4ZA 1Q8IA 4OO1G 5K5PA 3MXNA 2Q8RE 3I91A 3TDQA 3EJIA 2VB2X 5M3MB 4ULLA 4TRDA 4KKTA 3EROA 2SOBA 3TSSA 4IURA 1U4MA 2NN6H 2B2WC 4L8JA 2DNEA 1TS3A 5I2XA 3HG9A 1ZXTA 4DU9A 3I70A 5ELEA 2O4XA 2PNRC 2F0OA 5E1FA 1I3QB 5T1GA 1V43A 4TSSA 2B8GA 5D3IB 2F03A 1VCIA 1CHPD 1JWUD 1ZKOA 1C4QA 3QB3A 4RCOA 2EYFA 2B2WA 1W6JA 5CC4A 5I2YA 4FF3A 4GZYC 3C2PA 3K5LA 2EYLA 4X3SA 2HCIA 1Z47A 1F2YA 3PIP3 1TU2B 3S17B 2BE5C 1AW7A 3R3OA 3VR5A 3MC0B 2F3WA 1KLGD 4V0BA 2O2LD 4NW2A 1BCPC 1UAPA 5IGFA 3W2DA 4KD4A 2F0NA 1EY5A 1PZJD 5KNBA 2L1BA 1PTOC 1S5DD 2K28A 3SDZA 1QJOA 3VA5A 5I6WA 1KNAA 1STEA 4KJNA 1PZKD 2RDGA 3SK4A 2F0KA 1B1ZA 3FVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUC A;  3QOL A;  3TP8 A;  4DFA A;  2OEO A;  2WAC A;  3ITP A;  2F0T A;  4J1M A;  3TP5 A;  1A3V A;  2F3V A;  4PMC A;  1RKN A;  5CV8 A;  3H6M A;  4J6H A;  1EY9 A;  1A3U A;  5ISR A;  3HEJ A;  3P75 A;  4K2L A;  4PNY A;  4WOR A;  1EZ8 A;  4KJO A;  4N9P A;  4K5X A;  2F0V A;  2PW7 A;  5C3X A;  5IGC A;  1II3 A;  1JOR A;  2KHS A;  4ID6 A;  4QB4 A;  3E5S A;  4K8I A;  1KDA A;  3BDL A;  1STY A;  2F0U A;  2NUC A;  5J1Z A;  5KIX A;  3NQT A;  1EY4 A;  4OL7 A;  4F7X A;  2F0I A;  3TME A;  2QDB A;  5CV9 A;  2PW5 A;  3BDC A;  4DU9 A;  3MZ5 A;  4ME5 A;  1TT2 A;  1SNM A;  1TQO A;  4NDX A;  4S3S A;  5IGG A;  2EY6 A;  4HMI A;  3D4D A;  2EYJ A;  3NXW A;  2O4X A;  2EYH A;  2SNS A;  4IAL A;  4IUN A;  2F0O A;  5E1F A;  5I9P A;  3DMU A;  4KD3 A;  5M9O A;  1F2M A;  2RBM A;  3D4W A;  3RUZ A;  5C4Z A;  3S9W A;  1SNO A;  1EY6 A;  1SND A;  1TR5 A;  1KDC A;  2EXZ A;  2PQE A;  5NUC A;  1STH A;  3SK5 A;  5HGT A;  3U9O A;  5DAU A;  1EQV A;  3P1H A;  2PZU A;  4HTH A;  1EZ6 A;  5KEE A;  4RKL A;  1SYC A;  2F0E A;  5DEH A;  3SXH A;  4R8N A;  5IGE A;  4K6D A;  1STG A;  2F0L A;  3HZX A;  1SNC A;  2OF1 A;  2F0H A;  2EY5 A;  5CR3 A;  5IGD A;  5KYI A;  3D8G A;  2EY1 A;  1A2U A;  4LAA A;  1EYC A;  3QOJ A;  3ERQ A;  3NP8 A;  1IHZ A;  1ENC A;  3QB3 A;  3TP6 A;  1EY8 A;  2F0W A;  3SHL A;  2EYF A;  3MEH A;  3NK9 A;  5CC4 A;  5KGU A;  4KY6 A;  1JOK A;  2LKV A;  2EYL A;  5EKK A;  3SK6 A;  5CV4 A;  5IIF A;  1SYE A;  2F0P A;  1A2T A;  4K14 A;  3MXP A;  5I9O A;  4IZ8 A;  2F0M A;  5CGK A;  1F2Y A;  1F2Z A;  1STA A;  4K5W A;  4ZUJ A;  3SR1 A;  5EKL A;  3TP7 A;  4H7B A;  2EYO A;  3T13 A;  4WRD A;  1EYA A;  4I65 A;  4NKL A;  1KAB A;  3R3O A;  5CV6 A;  3T16 A;  4B9X A;  5J39 A;  4HMJ A;  3MHB A;  5KRU A;  5JOB A;  5HUR A;  4EQO A;  2F0J A;  5IGB A;  2F3W A;  1AEX A;  4F8M A;  1KAA A;  1ENA A;  4KY7 A;  2EYP A;  4EQN A;  1JOQ A;  4ODG A;  4ZUI A;  4B9W A;  5CV5 A;  5KYL A;  3OMC A;  4QMG A;  4G57 A;  3EVQ A;  2M00 A;  2PZW A;  3C1F A;  4KHV A;  2F0D A;  2EYM A;  5EGT A;  1SNQ A;  4MIU A;  5IGF A;  4K2K A;  5E3F A;  3OSO A;  4KD4 A;  4NP5 A;  2EY2 A;  4QF4 A;  2F0N A;  2F0G A;  5J22 A;  3DHQ A;  1EY5 A;  3NUC A;  2PYK A;  5CV7 A;  1EYD A;  4DGZ A;  4EVO A;  5C3W A;  2KQ3 A;  1U9R A;  1EY7 A;  2RDF A;  3OMG A;  5F2D A;  1KDB A;  2RKS A;  3C1E A;  4N9T A;  1EY0 A;  4KTA A;  2F0S A;  4ZQ3 A;  2PZT A;  1STB A;  3LX0 A;  5I6Y A;  2F0Q A;  5IOC A;  1SYF A;  3PMF A;  2F0F A;  2OXP A;  4PMB A;  4K5V A;  4KV6 A;  1SYG A;  5C5M A;  3V2T A;  3OWF A;  5IOD A;  2HQE A;  4YIJ A;  5K5P A;  4NMZ A;  3SK8 A;  3D6C A;  3VA5 A;  2ENB A;  5I6W A;  1SYB A;  2SNM A;  4EQP A;  3EJI A;  1NSN S;  3NHH A;  4RKB A;  4KJN A;  5C6A A;  1A3T A;  1STN A;  5C5L A;  4KY5 A;  3SK4 A;  5C4H A;  1JOO A;  2SOB A;  5JAV A;  4E6I A;  2F0K A;  4K8J A;  4TRD A;  4DF7 A;  3MVV A;  3ERO A;  1SYD A;  1SNP A; 
#chains in the Genus database with same CATH topology
 5BN4 A;  1I50 B;  1PMR A;  2BH8 A;  1TKW B;  2CWA A;  2JP1 A;  3CW2 C;  2H4O A;  4PMC A;  1AZP A;  2ZXP A;  1M1K C;  1Z9F A;  4AH6 A;  3D6W A;  5IWA Q;  3T4A C;  1II3 A;  4BS9 A;  4NXM Q;  1H9J A;  4QB4 A;  5JEA J;  4A93 G;  5IYB G;  3H91 A;  4OEM B;  1GKH A;  1ESF A;  4BWG B;  1JWS D;  2CH4 W;  4A3K H;  1HHV A;  1TY0 A;  4BA1 I;  1CZW A;  1TQO A;  1NCV A;  2RHQ B;  1YZ6 A;  1YNN D;  3TRZ A;  4K0K Q;  5M9O A;  1SE3 A;  4LFC L;  3F1Z A;  4IJL A;  1DZ1 A;  3OIP A;  2EXZ A;  3M4Y A;  3A7A B;  2IX1 A;  5DAU A;  4QCL A;  3P1H A;  4DV6 L;  4BY7 B;  1NBW A;  2L9H A;  3KLS A;  4JI3 L;  4O2D A;  3VYU A;  3Q0A A;  3S1R H;  4DNI A;  2K33 A;  4AIM A;  1RHP A;  1VQP A;  1PH3 A;  2EY1 A;  3SEB A;  3QOJ A;  2NTS A;  4X62 Q;  4A93 H;  4DV6 Q;  5E7N A;  4JI3 Q;  1BO0 A;  1VQF A;  1SMY C;  3J80 L;  4G7O C;  5IIF A;  4RG1 A;  1ICF B;  3T56 B;  5M5X H;  3HKZ B;  1NR4 A;  2IHF A;  3PUW A;  2R6G A;  1GXD C;  3EFX D;  1HRJ A;  4YHH L;  4DXF A;  4B9X A;  1TWC B;  3BVG A;  2VW9 A;  2PQA B;  3HOX B;  4EQN A;  1JOQ A;  2RF4 A;  4DV0 L;  3E9H A;  3ZJY C;  2DY7 A;  3H15 A;  4YHH Q;  1HNZ L;  2I46 A;  3S24 A;  2PYK A;  2KCT A;  3CPW A;  3HOZ H;  4XTC S;  4JOI C;  3I72 A;  3I56 A;  1AH9 A;  1DON A;  4DV0 Q;  2PCF B;  2Z1C A;  1QVG A;  3BJU A;  1CKO A;  3K5M A;  3NPP A;  4GKJ L;  1CA6 A;  4Q0F A;  1CUK A;  3JAM L;  1CQV A;  4RKB A;  4X65 L;  1GVP A;  2MQH A;  3CHB D;  1R4P B;  1F2L A;  1A6X A;  1K83 B;  4IPC A;  3KF8 B;  3GD7 A;  4DF7 A;  5EKI A;  5K36 G;  2R7D A;  4GKJ Q;  3PUX A;  3T53 B;  3W5O A;  3RD4 A;  5L37 A;  3M7G A;  4X65 Q;  1SJE D;  4BXX H;  4PZ8 A;  2UXC L;  2D5D A;  1G2S A;  2MFI A;  3RZO H;  3V96 A;  4XQQ A;  3S1N B;  1SSO A;  2MJ8 A;  1EY4 A;  3FHW A;  4JOI A;  1D5X C;  3GTM B;  4AQY L;  2EJG C;  3PUY A;  1U4L A;  5JPM C;  4S3S A;  1L0Y B;  2D0P A;  2N55 A;  4FXD A;  3U9S A;  4HJ5 A;  1GOZ A;  4AYB E;  5ELD A;  4U67 3;  4CDE C;  2VQE L;  4AQY Q;  1WTQ A;  5C44 G;  3NTH A;  2L11 A;  2WB1 G;  1SYC A;  2RSO A;  1EWC A;  1E22 A;  4JI5 L;  4IUV A;  2VQE Q;  3TQY A;  1Q3L A;  1TS4 A;  1IHZ A;  1ENC A;  1TWF H;  2WAQ G;  4N8X 1;  2JA7 B;  1G91 A;  2HHH Q;  1IXR A;  1VQO A;  1MJC A;  1BCP F;  2IW3 A;  2HUG A;  1E1O A;  1SBB B;  1J8I A;  4JI5 Q;  3J81 j;  4KK7 A;  1EEF D;  1EUJ A;  1IZ6 A;  4JI7 L;  1DXM A;  3SR1 A;  4H7B A;  4IO9 A;  1F9Q A;  3T13 A;  3VR3 A;  1PTO F;  4RGM A;  2RCF A;  4M8A A;  3QG1 A;  2A74 C;  4A3M B;  1JE4 A;  3OW2 A;  2JA5 G;  1CI3 M;  4QMG A;  3SE0 A;  3HOU H;  1VF5 C;  5A2Q L;  2XIW A;  1S72 A;  4C3J G;  1UE1 A;  3M4O H;  3A0J A;  4HJ7 A;  4UP9 A;  4HN7 A;  3GQB A;  5FLX c;  3BZK A;  5JEA H;  1VQD A;  1C7Y A;  3H94 A;  2ZXO A;  1QCB D;  4IQZ A;  4A3G G;  2F0S A;  4KI0 A;  5EPK A;  2AMC B;  2PZT A;  2F0Q A;  1S3O A;  3PMF A;  5IE8 A;  3S15 H;  5IOD A;  3SK8 A;  1EIF A;  2OCE A;  2HT1 A;  2KJX A;  3MFG A;  1EOV A;  1NSN S;  5C6A A;  1CKM A;  3S14 B;  5C4H A;  1HUM A;  1CK1 A;  4B3T Q;  1DOL A;  1N34 Q;  5EQ0 A;  1WI5 A;  2JA5 H;  2YTV A;  1KL9 A;  1PH6 A;  4X3U A;  5ISR A;  3BU2 A;  5EPJ A;  2XTI A;  4OEL B;  4A3K B;  1F77 A;  1GHJ A;  3K7A H;  2F0V A;  4ZRZ A;  1HUN A;  2HIV A;  4APV A;  2Y0S E;  3NQI A;  4JI0 L;  2Z0S A;  1STY A;  1TWH H;  4C2M H;  2HCC A;  4MZ9 A;  4A3G H;  2Z6K A;  3PUZ A;  4F7X A;  2OTJ A;  1BNZ A;  3DWP A;  3MZ5 A;  4HJ8 A;  3FRP B;  1SRU A;  1XYI A;  3D4D A;  3T51 B;  3AU7 A;  4B9W A;  2SNS A;  2AWN A;  3W3A A;  3S1R B;  4JI0 Q;  2RBM A;  4R4T A;  3U9O A;  4BBS G;  2F3I A;  3IFD A;  2RHS B;  3EBE A;  3G4S A;  4CJ1 B;  1X32 A;  3NSW A;  2PMZ B;  5M5X B;  5IT9 c;  4XYQ A;  3L3O C;  3ND9 A;  1N8R C;  1EYC A;  1HNW Q;  3I4N H;  1ML0 D;  4LF6 L;  4H0L C;  3SHL A;  1BOS A;  4X66 Q;  1FGB D;  1ILQ A;  1JB3 A;  3H3V I;  4IFD H;  5TSS A;  3U50 C;  4K14 A;  3PCO B;  5ELO A;  1DCZ A;  1FJG L;  1A62 A;  2BDN A;  4NB3 A;  1VMP A;  3L7Z C;  2B2Y C;  2K5V A;  3J7Y W;  3T1Y L;  5J39 A;  1SFO B;  4BBS H;  1KNE A;  3MHB A;  5HUR A;  1GUG A;  1SMX A;  1KAA A;  3J7A F;  5H1S E;  1OXU A;  3HOZ B;  1MSH A;  4ODG A;  1RTN A;  1GUS A;  5CV5 A;  1FJG Q;  1SEB D;  1NNX A;  4MHE A;  2F0D A;  3DUZ A;  1J9O A;  5E3F A;  3T1Y Q;  1HH2 P;  3U58 A;  2K04 A;  2V1C C;  3OOC A;  5J22 A;  5FLM H;  2NVX H;  4H13 C;  5C3W A;  1I6V C;  2ZT9 C;  3KBX A;  5ELF A;  4DAY A;  3GTP B;  4A3B H;  3G71 A;  2VZA A;  3I55 A;  1WOC A;  4LMQ D;  3EQL C;  3AFP A;  5HGQ A;  4G4K A;  1STB A;  1WTH A;  4PMB A;  4KV6 A;  3V2T A;  1JJ2 A;  3FP9 A;  4P75 A;  3GTK H;  2DJG C;  4HAE A;  4BBR B;  4HID A;  1VQ7 A;  1PRT D;  1SYB A;  3MWY W;  2ZTE A;  4HCE A;  4EQP A;  1G6Z A;  4JI2 L;  3JC6 6;  2LXK A;  3L2P A;  1ILP A;  1C48 A;  3TP8 A;  2A68 C;  4Y52 H;  3AQQ A;  4KN7 C;  1I4H A;  4J6H A;  1RF2 D;  1IKM A;  3P75 A;  2Q8I B;  1D1I A;  2OQK A;  5EJW A;  3CCU A;  2A6H D;  1HXY D;  2MPM A;  2CKZ B;  3N52 A;  2E74 C;  2WV6 D;  2R93 B;  4OGQ C;  1O7Z A;  1N9W A;  1BQQ T;  1LTI D;  5CYU A;  1XMQ Q;  4B3M L;  1D7Q A;  4ME5 A;  1WTO A;  2JYO A;  2EYH A;  2AWO A;  3D4W A;  2B2V A;  4FNF A;  2CFM A;  4UP7 A;  2PQE A;  3OIQ A;  1N32 L;  3CC7 A;  2P5Z X;  1TWF B;  4DV2 Q;  3Q6S A;  1G51 A;  4EX5 A;  1BBU A;  1IBL L;  5FO7 B;  5GAE C;  4DV3 L;  5D14 A;  4OWT B;  1CM9 A;  2UXB Q;  4QJF A;  3RLF A;  1B53 A;  3PV0 A;  5C3E G;  1A2U A;  1FNW A;  2E8G A;  1GUW A;  2QA4 A;  1EY8 A;  2CQO A;  1QZH A;  2VY3 A;  3NK9 A;  3B6Y A;  1X3E A;  2E5L Q;  4C1N I;  1L1O A;  1YNN C;  1L1O B;  2ZM6 Q;  4RGN A;  2PI2 A;  3BG3 A;  1F2Z A;  1STA A;  1IW7 C;  2MNA A;  1I6H H;  1UE7 A;  3CCJ A;  3HOU B;  1YJW A;  3U4V A;  3J81 E;  2NTT A;  1KAB A;  3AYH B;  1D6E C;  2AKW B;  2R7F A;  1J6Q A;  4A3F H;  3NBI A;  4JPB W;  4BY1 B;  2N88 A;  5IYD G;  2UXD Q;  5EGT A;  2XRQ D;  5C3E H;  4IN3 A;  2A1A A;  3MFY A;  1NE3 A;  2WII B;  2N8N A;  3A74 A;  2BCO A;  4AYB G;  1K0R A;  4L5T A;  3J80 i;  1PTO H;  1JC7 A;  2K6A A;  2RA4 A;  2RVL A;  1PH5 A;  3OMG A;  1WTV A;  3C1E A;  3PIO A;  1BBX C;  1WTW A;  1HR0 W;  1I94 L;  4FYD A;  2OXP A;  5C5M A;  2QKI C;  2EE1 A;  1SLJ A;  2ENB A;  4RHS A;  3C46 A;  4DV7 L;  4C56 C;  3BYT B;  3K7A B;  5JAV A;  1LTB D;  3PO2 H;  2X6L A;  1PFS A;  4LF7 L;  2ASB A;  1Y1W H;  3MVV A;  1SYD A;  4G7Z C;  5IYD H;  1HNX Q;  1A3U A;  1KRS A;  4DV7 Q;  4DR6 L;  1TS2 A;  1F9S A;  3CKI B;  3PGZ A;  4LFA L;  3OPO A;  4LNQ A;  3HOV G;  3CXC A;  4DR1 Q;  2BH2 A;  4IPH A;  3TME A;  4JI4 Q;  1IBM Q;  4CDC C;  2PO4 A;  3KF6 A;  5IGG A;  1U4R A;  3KF6 B;  4CKB A;  4HMI A;  3HOW G;  5LMU Q;  2Q8T A;  3BYY B;  4LFA Q;  5C4Z A;  3JAM i;  2H1E A;  3PO3 H;  4ALP A;  5LL6 X;  3WWV A;  1Q8K A;  1MHW C;  1XXG A;  1V8Q A;  3SK5 A;  3I4N B;  3VYT A;  3S2D H;  1RCV D;  1K8G A;  3J7A 5;  4OIK A;  4K6D A;  4F87 A;  3HZX A;  3QJY A;  4A3J G;  5KYI A;  2D2C C;  2KEE A;  4KLK A;  3K58 A;  2QEX A;  3I73 A;  4DAP A;  1VQN A;  1N33 L;  1JWM D;  1R9T H;  1QUQ A;  4CKE A;  1J5E L;  1QUQ B;  4OO1 H;  1YNX A;  3CC2 A;  1B50 A;  1HQM C;  3G7L A;  1ZYR D;  3IFT A;  1IYU A;  2K75 A;  3CAM A;  3J81 c;  5C0X I;  1N33 Q;  1V1P A;  1RDP D;  4ZUJ A;  3KJP A;  1V1P B;  2ATW A;  4QY7 A;  2R7Z G;  1B70 B;  1CSP A;  2E75 C;  2UUA L;  2BDO A;  2Y0S G;  4CJ0 B;  1BF4 A;  4MTN A;  4GNX A;  5EPL A;  1ENA A;  4A3B B;  3VYS A;  3GP7 A;  1YIT A;  2XVS A;  2FMM A;  4DA2 A;  2J0T D;  3KBG A;  5FOB B;  1ESR A;  2KHJ A;  2AQ1 B;  2NVY H;  2QDL A;  3F8T A;  1WCM H;  3LWU A;  3CQZ H;  2RDF A;  3R93 A;  1A8V A;  3BDO A;  1KDB A;  1EQT A;  3E0E A;  1H9M A;  1QE6 A;  3TN2 A;  1XJV A;  3OW7 A;  1GM5 A;  1CFM A;  5AJ3 L;  2F0F A;  5EBD A;  2R92 G;  3GV3 A;  5LMN L;  1LLR D;  4A3D B;  1LT3 D;  1D1K A;  3IL8 A;  4MTK A;  4NMZ A;  3T1H L;  1TS5 A;  1WFQ A;  4DR2 Q;  1JE5 A;  4QIW B;  5C5L A;  2E2I B;  1E2V A;  4EQ5 A;  3I4L A;  1BXT A;  2AUK A;  1E2Z A;  2K32 A;  5LMN Q;  2CW0 D;  1C8C A;  4B3S L;  2K5Q A;  1A3V A;  3TP5 A;  2VUM B;  1RKN A;  3NBH A;  3FMC A;  3NBH B;  4POF A;  4X3K A;  4FP5 D;  2UUB L;  4J15 A;  1Z6H A;  1KDA A;  3BDL A;  4PQX A;  3NQT A;  4A3L G;  1CSQ A;  2NWG A;  2HQL A;  2B8F A;  4IUQ A;  1VDZ A;  5D65 A;  5ELB A;  2I07 B;  3NXW A;  1XPO A;  3NTI A;  3GTL H;  2MGS A;  4NXM L;  5FK9 C;  5BR8 L;  1YBY A;  3GTG H;  1B8A A;  4UDU C;  3HOY H;  1KDC A;  1Q12 A;  2YTX A;  5NUC A;  5C4X G;  1Q46 A;  4LFB L;  3L9A X;  1AZQ A;  2NVT H;  4L5S A;  3Q22 A;  1VQ8 A;  1P16 A;  1DM0 B;  5I4D A;  2KUM A;  1UUP A;  4K0K L;  1EIH A;  1K8A C;  5BR8 Q;  3BZC A;  2B2T C;  5C4J B;  5IP7 G;  4X3T A;  1QZG A;  4LFB Q;  4DNT B;  1OO9 B;  2VS1 A;  5M3F H;  4A3F B;  4DK6 C;  1A2T A;  2JE6 I;  1EQQ A;  3RMH A;  2E2J B;  2N49 A;  1X3G A;  4X62 L;  3H3V H;  3NEL A;  1YEZ A;  1LTG D;  2JJQ A;  3LWE A;  2JA8 G;  3T16 A;  3UDI A;  2K5N A;  5C4X H;  4JI6 Q;  2H5X A;  5M5Y H;  4JBW A;  3PF5 A;  3ER0 A;  2R61 A;  2LMC B;  5E4X A;  1VQM A;  3I2Z A;  1XTC D;  2A6E D;  1SDF A;  1HFN A;  2EJM A;  3P20 A;  4G57 A;  2ZJQ A;  5IYB H;  2PZW A;  2A69 D;  2OT2 A;  3J80 E;  1FGU A;  1Y69 U;  2B2T A;  2KCC A;  1YNJ D;  1MI2 A;  3GO5 A;  1I4R A;  3GDE A;  1G6P A;  2OQ0 A;  1X3P A;  1Q90 A;  2K14 A;  3PO2 B;  3E3X A;  4U68 A;  3UDF A;  5FO9 B;  4XIG S;  4CHT B;  2QGQ A;  4FF1 A;  3IKJ A;  2B63 G;  5JPN C;  5C0X J;  1LT5 D;  2LFN A;  3CF5 A;  1GUN A;  3URY A;  4LF9 L;  3A8I E;  1X56 A;  1N36 Q;  1K8M A;  4HJA A;  3A5U A;  4L5R C;  2B39 A;  3PO3 B;  3HGB A;  1EWH A;  2NUC A;  5KIX A;  1YJ9 A;  4LF9 Q;  2AQ3 B;  1PYW D;  4C3H G;  3S2D B;  5EBC A;  1XNQ Q;  3M3Y H;  1JIC A;  3JAM E;  2L12 A;  1E7Z A;  3EIV A;  2ZJP A;  4NPS A;  4RCN A;  2DGY A;  5I9P A;  1SE8 A;  1VMC A;  2K4K A;  1EY6 A;  2F1M A;  5FLX L;  3RZD H;  4XDX A;  4JYA Q;  4R4I A;  2NVQ B;  2JK8 A;  3ZYY X;  2OTL A;  2IY5 B;  2ICE C;  5HY6 A;  2AUJ D;  4KKU A;  3WOF A;  3S1M B;  2R93 G;  2KEN A;  4Y7N H;  4DUZ L;  4C3I G;  3FKI G;  1QOH A;  3KFU A;  2J4X A;  1YVC A;  2EDG A;  1PH2 A;  2K03 A;  1BDO A;  1M4V A;  1GUO A;  2ZXR A;  2JA6 G;  3STB D;  3CU7 A;  3ONA B;  1PRT B;  3HKZ E;  3TP7 A;  1E3P A;  1F9R A;  5K36 H;  4DUZ Q;  4NKL A;  5BN5 A;  2HHH L;  2L55 A;  2NVY B;  5GAH C;  4JI1 L;  5IGB A;  4XT3 B;  1ET9 A;  3CQZ B;  1B2T A;  3O13 A;  5JVG 3;  5A35 A;  4GOP A;  1Y1V B;  2M00 A;  4GOP B;  3H0G G;  5E4W C;  1Q81 C;  1SNQ A;  1H9R A;  1HZB A;  4K2K A;  1LUZ A;  2X6G A;  2EY2 A;  1O7I A;  5KND A;  3UE0 A;  1QIL A;  4JI1 Q;  3NUC A;  1Y8O B;  4A3I B;  3FKI H;  1LO5 D;  1HZ9 A;  1K8O A;  3F2D A;  3Q24 A;  1EY0 A;  4QL5 A;  5I6Y A;  2JA6 H;  3A54 A;  2B2U A;  1NMG A;  5C44 H;  3F2C A;  2HQE A;  2MP1 A;  3HRZ C;  2WIN B;  1FL0 A;  1VQ4 A;  5DM6 3;  3F2U A;  2KOL A;  3C3L A;  1VQB A;  4A3E G;  1STN A;  4E6I A;  4XXE A;  2WP8 J;  5A2Q E;  2WAC A;  4RGT A;  2Z6B A;  1YHB A;  4A75 A;  2BE5 D;  3I4M B;  4LW1 A;  1PYS B;  1B7Y B;  1U4P A;  2Z6K C;  4RFB A;  4QQB X;  4K5X A;  2Q2T A;  2I5M X;  3I8Z A;  4ID6 A;  1O7L A;  4B3T L;  1N34 L;  3GTG B;  2EIF A;  3RNU A;  1MD2 D;  4DV4 L;  3TS0 A;  2F0I A;  3KLR A;  2QDB A;  2Z8L A;  1NJI C;  1BCP D;  2NVT B;  4TVA B;  4LUZ A;  3BS1 A;  4IAL A;  1ET6 A;  3R8B A;  2K5D A;  2TMP A;  4IUN A;  1KTK A;  4GN5 A;  4RA8 A;  1TWA H;  1HR0 Q;  3NTK A;  1PTO D;  4DV4 Q;  1QG7 A;  2QF7 A;  4GS3 A;  1OXT A;  2RQX A;  5C0X G;  4C3J H;  1ASZ A;  5M3F B;  2QEJ C;  1HJP A;  2SEB D;  4LUO A;  1X9N A;  2IT1 A;  1PFN A;  1D5Z C;  1BUV T;  1UE5 A;  2I0Q A;  1G29 1;  4YCU A;  4DR7 Q;  2LKV A;  4GN3 B;  4UAI A;  3SK6 A;  5D3D A;  4PV1 C;  2MO1 A;  2KBN A;  3A8K E;  2JSO A;  5M3M G;  4IZ8 A;  1XTD A;  2PPB C;  1HNW L;  4WJ3 M;  2KVM A;  4A93 B;  1L0W A;  2EYO A;  3DEP A;  1EYA A;  4I65 A;  4WRD A;  1SXT A;  4X66 L;  1WTX A;  5IY0 A;  5JOB A;  3CMA A;  2F0J A;  5C0X H;  4CJ2 C;  4P73 A;  1CA5 A;  2CVR A;  1FR3 A;  1RIP A;  1WJJ A;  1QWY A;  1UE6 A;  2LS0 1;  1Y8P B;  4PZ7 A;  3GV6 A;  1KRT A;  1EOT A;  4MIU A;  4ZYS A;  1PH9 A;  1VQA A;  3DHQ A;  1PVO A;  4OXP A;  1HQR D;  4POG A;  4DUY L;  2RKS A;  4KTA A;  4GLA C;  1I5F A;  2XWJ B;  2KA7 A;  3M4Q A;  2XN9 C;  3CME A;  4R9W A;  1CTM A;  3K0Y A;  2SNM A;  3VYR A;  2CH4 A;  3CCE A;  4DUY Q;  3UDG A;  4RGO S;  1IYV A;  1G2T A;  1FYC A;  1SNP A;  1B3Q A;  3MA2 B;  4J1M A;  2F3V A;  3QIA A;  1EY9 A;  1Y8N B;  4FVM A;  3MAQ A;  4DAY B;  2VL6 A;  4FXG C;  4YWL A;  4WJW A;  2MUY A;  3PIO 3;  2JEB I;  5COR A;  3V05 A;  2B2V C;  3RZD B;  4A3D G;  3UDX A;  1OXV A;  1O7Y A;  4TKO B;  1M90 C;  1JR0 D;  4GN4 B;  3RZO B;  3RUZ A;  4R4O A;  1FD7 D;  2ZJR A;  1SND A;  2XSC A;  1B4O A;  1CHQ D;  4JI8 L;  5HGT A;  1Z7T A;  1PDQ A;  4Y7N B;  2PZU A;  3UI2 A;  1XMQ L;  2VUM G;  4JCV E;  2D62 A;  2K1B A;  1CKN A;  2Z9H A;  1CKN B;  2F0L A;  1SNC A;  5CR3 A;  2IWH A;  3D8G A;  1L1O C;  4JI8 Q;  2PMZ E;  2XWB B;  4P72 A;  4DV2 L;  4OWX B;  5J3B A;  4IUU A;  5KGU A;  4KHP L;  1JOK A;  3G6J B;  4DK0 A;  2IL8 A;  4YWK A;  3RLN A;  2UXB L;  3TZU A;  1XWE A;  1VQK A;  4GKK Q;  1B9N A;  2K5H A;  2XGT A;  4KHP Q;  2E5L L;  4EQO A;  4GLX A;  2KED A;  2ZM6 L;  1QNK A;  4JV5 L;  3RN5 A;  3CCQ A;  2G9H D;  1IL8 A;  3M85 A;  3E6Z X;  4DAM A;  5C44 B;  3N6R A;  2UU9 L;  1K73 C;  2TSS A;  1VQ9 A;  1HTP A;  3KLW A;  2GN5 A;  3DWA A;  4G7H C;  1EYD A;  2WB1 B;  4JV5 Q;  5F2D A;  2I5H A;  2UXD L;  1S5F D;  2YU9 H;  1M8A A;  1ICW A;  1T9H A;  2CHB D;  3LX0 A;  2E2H H;  1I50 H;  4BY7 G;  1SJH D;  3Q23 A;  2UU9 Q;  2IPK D;  3M4O B;  2B29 A;  2SDF A;  1LTA D;  2K5W A;  2WAQ B;  4RHR A;  4CGY B;  4XT1 B;  1KHI A;  4DR4 L;  4DR5 Q;  5CBA E;  1AE2 A;  5DM7 3;  3K57 A;  1PFB A;  4DPG A;  2VB3 X;  2RDH A;  3QOL A;  3CCM A;  3S15 B;  1RTO A;  1UEA B;  3HEJ A;  1YIJ A;  4DR4 Q;  3HKZ G;  1EZ8 A;  3D3R A;  5KNC A;  1NR2 A;  4RAU C;  1EU4 A;  1D5M C;  4K8I A;  1PFM A;  2JA5 B;  3LNN A;  1HNX L;  1V9P A;  2AQ2 B;  4PMW A;  4BY7 H;  4C3J B;  3HOX G;  1ZEQ X;  4NDX A;  1DOK A;  1SNM A;  4KD3 A;  2ZTD A;  4C2M B;  1TII D;  1TWH B;  4DR1 L;  4A3G B;  1X3Q A;  1STH A;  1HPC A;  2DY8 A;  2YV5 A;  1EQV A;  3KOJ A;  4JI4 L;  4HTH A;  4KMU C;  1IBM L;  1SE4 A;  1I4Q A;  1XNR Q;  3QO2 A;  4ZAI A;  3SXH A;  2IJ0 A;  5LMU L;  2EZV A;  3DWQ A;  3KK7 A;  1KAW A;  4O1N A;  4CDD C;  4DKA C;  3CRL C;  1TWC H;  2HDM A;  4BA2 I;  1X6O A;  2F4I A;  2NN6 G;  1HFG A;  3CCV A;  5FJ8 G;  4GNX C;  3E9I A;  2JQO A;  3PSI A;  2PI2 E;  4DN4 M;  4XQJ A;  3QR8 A;  2JA9 A;  1LV9 A;  4O42 A;  1VQL A;  3PF4 A;  5M5W H;  4F8M A;  5IP9 G;  3DM1 A;  1KC8 C;  2M9V A;  1JMC A;  4RH6 A;  3HOV H;  1DGS A;  5CBE E;  3C1F A;  2EYM A;  2N78 A;  2XNA C;  5G3L F;  4BBS B;  3VR4 A;  3D4R A;  2C9O A;  4H44 C;  5CV7 A;  3F2B A;  2VQF L;  1RJT A;  4ILW A;  3HOW H;  1U9R A;  2IX0 A;  1VQ6 A;  2A5H A;  2AHO B;  1K83 H;  4XQN A;  2J7Z A;  5FJ8 H;  3MXU A;  1AP0 A;  2NVX B;  1LYL A;  1V1Q A;  1E0B A;  1VF7 A;  2VQF Q;  4GNX B;  1CQF A;  4KKS A;  4KY5 A;  5ELN A;  1LTR D;  4FDB A;  4A3J H;  2NBF A;  1NUC A;  1B9M A;  2E2D C;  3GTK B;  2JA7 G;  1I4X A;  3GTM H;  2BA1 A;  1OXX K;  1JCK B;  4DR2 L;  4Z9C B;  1SRO A;  4KJO A;  4OON A;  4P74 A;  5IGC A;  1QVF A;  3ULJ A;  4R4Q A;  3A5Z B;  3E5S A;  4DR3 L;  1UNS A;  2HDL A;  2RSN A;  5G3L D;  4IFD I;  5COY A;  1LT4 D;  4A3M G;  2R7Z H;  2WFW A;  3TRE A;  3DMU A;  4DR3 Q;  1H95 A;  2WKD A;  1EEI D;  2A73 B;  4A76 A;  3A55 A;  3MTS A;  2JA7 H;  2Z4H A;  2F0E A;  3W1B A;  3HKS A;  4C1N K;  1STG A;  4QGU A;  1NY4 A;  5IGD A;  3ERS X;  4LWC A;  1WTP A;  1X54 A;  2NZH A;  3R2I A;  5DNF A;  2O5J C;  2R92 H;  2A68 D;  1KD1 C;  4UHV A;  4LF4 Q;  2EXD A;  3M7N A;  1L2F A;  4A3M H;  3K80 C;  2IX3 A;  1PA6 A;  1ENF A;  2LSS A;  4R8I A;  1VQC A;  2GVB A;  3NE5 B;  1X65 A;  2NB0 A;  4MNO A;  4A3K G;  5CV6 A;  1FNV A;  2NZO A;  3J7Z C;  1IBK Q;  1MSG A;  4CDF C;  1LTL A;  4KHZ A;  5KYL A;  2YU9 B;  1I6H B;  1DJR D;  3K81 C;  3OTO L;  4DAV A;  3K6O A;  2E2H B;  5FO8 B;  4A3L H;  4JI6 L;  2PNH A;  3IAY A;  1AFP A;  3KLS X;  3S14 H;  3KYH C;  1BCP B;  1S5C D;  3OTO Q;  1BR9 A;  5IOC A;  5C3E B;  3S2H H;  3R2T A;  2YTY A;  4IOC A;  1PTO B;  3X3M A;  3NHH A;  4JBJ A;  4JG2 A;  1JOO A;  1XPU A;  2A8V A;  4K8J A;  2K05 A;  5IP7 H;  5JJZ A;  1FVI A;  4QIW E;  4DFA A;  1IW7 D;  2X69 A;  1R4Q B;  3TEH B;  3AFQ A;  3H6M A;  5CV8 A;  4K2L A;  4OIJ A;  1PH8 A;  1HZC A;  1UEB A;  1QB5 D;  4N9P A;  4LJZ C;  4HIK A;  3HS0 C;  4M1U B;  1Y1W B;  4LFC Q;  3K59 A;  1VQG A;  4ZKB B;  2Q2I A;  3OWE B;  4PG3 A;  1N36 L;  2JA8 H;  3NEM A;  1EL0 A;  1TT2 A;  4AYB B;  3HOZ G;  3PIP A;  1LTT D;  2MHV A;  1HCZ A;  1TR5 A;  5GRO A;  1WD0 A;  1VQ5 A;  1XNQ L;  5GAG C;  1EWI A;  3S16 H;  5KEE A;  1JJG A;  3HP3 A;  3NWT A;  2PQA A;  2L5T A;  3FPU B;  5CMD A;  3L0O A;  3ERQ A;  1W2B A;  3FEW X;  1JT8 A;  4JYA L;  4BBR G;  1PRT C;  2E76 C;  4YCV A;  1RL2 A;  4KY6 A;  1SFO H;  4BXX G;  4NXN L;  3DXJ C;  5JJI A;  5M5W B;  2B63 H;  4DXG A;  2Q2U A;  4IFD J;  2JEA I;  2M2L A;  5FLX E;  4K5W A;  1VS0 A;  3HOV B;  1R9T B;  2F52 A;  5JJK A;  4GOP C;  1HNZ Q;  2F4V L;  4PZ6 A;  4HMJ A;  1Q1B A;  4R1J A;  4NXN Q;  3BVM A;  2ZTC A;  2A6H C;  3GTP H;  3HOW B;  1U0L A;  4KY7 A;  4P2C B;  3GTQ H;  4DNR B;  3OMC A;  2LY7 A;  3EVQ A;  3KF8 A;  4Q5V A;  5LHY 1;  2DNC A;  4C3H H;  1TWG H;  2F4V Q;  3CCS A;  2BOS A;  4QF4 A;  2F0G A;  3AMU A;  4BBR H;  1V1O A;  2B2U C;  3DM3 A;  2KQ3 A;  1E2W A;  1I4P A;  2D9U A;  1GHK A;  1W3S A;  1BBW A;  4ZQ3 A;  2FXQ A;  4A3J B;  2JXM B;  1EFI D;  4FO2 A;  3KDF A;  1C0A A;  3KDF B;  3OWF A;  1FNU A;  1BVS A;  2R3Z A;  4YIJ A;  4HCS A;  1CZG A;  1WCM B;  4XYO A;  3VA7 A;  1Q82 C;  4MN3 A;  2UXC Q;  3J80 c;  4ZK9 B;  2A19 A;  2NYZ D;  2KCM A;  2KCN A;  4KN4 C;  4IUP A;  1O80 A;  2R93 H;  1XX8 A;  3MXG A;  2NN6 I;  2R7Z B;  4C3I H;  4PNY A;  4RMF A;  2EOT A;  2Y0S B;  4HED A;  4J8Q A;  1JOR A;  2PW7 A;  5C3X A;  4L6T B;  2BA0 A;  1PV4 A;  4ABN A;  1DYQ A;  2RCN A;  3S1Q H;  4OO1 I;  3HOU G;  3LGJ A;  3WDN A;  2F0U A;  1EYG A;  5J1Z A;  3SVM A;  1WVL A;  5IT9 E;  5IT9 L;  4CKC A;  3BDC A;  3CPF A;  2EYJ A;  4YCW A;  4BY1 G;  5JEA G;  4WJ4 A;  1WD1 A;  1F2M A;  1EIG A;  2K7V A;  2QIL A;  3FDT A;  3H0G H;  3WOE A;  2R92 B;  5LMN W;  1X55 A;  2FFK B;  2G9D A;  1EZ6 A;  3NEN A;  1E24 A;  2FMC A;  4HSV A;  3H3V C;  3K0X A;  5DEH A;  1A63 A;  3GTL B;  5AFW A;  5IGE A;  2YYZ A;  3J81 i;  1HR0 L;  2OF1 A;  3HOY B;  1KIX A;  4LAA A;  3JAM c;  2ICI A;  1YI2 A;  4JI7 Q;  3EA6 A;  5BN3 A;  3A7L A;  3OHX C;  2KHI A;  1MGS A;  1PH7 A;  4A3E H;  2F0P A;  3P7J A;  4BY1 H;  1VQI A;  5DLQ E;  2F0M A;  3E0J A;  4DV5 L;  1PXU A;  3RN2 A;  5GAD C;  5EKL A;  4QUC A;  1EFW A;  1P8L A;  4TQU S;  3AEV A;  4DR7 L;  1SR3 A;  2GVA A;  2EJF C;  4L63 B;  4JBM A;  4DV5 Q;  1PH4 A;  3K5N A;  4IPD A;  4KHV A;  1DOM A;  1PH1 A;  2ID0 A;  1GJX A;  5JVH 3;  4IPG A;  5C4X B;  3GTJ H;  4NP5 A;  3S2H B;  3M9B A;  3GTO H;  3X3N A;  5M5Y B;  3VR2 A;  3CCR A;  1EY7 A;  4DV1 L;  2VXW A;  1H9K A;  2K01 A;  3I4N G;  1SYF A;  1KXL A;  1TXY A;  3I4O A;  5IYC G;  4FXK C;  3D6C A;  4IFD G;  4DV1 Q;  5JJL A;  1D2B A;  3NWS A;  1QNU A;  2ALY B;  4QUF A;  4IUT A;  2F0T A;  2NZ1 D;  2D0O A;  2JA8 B;  3VR6 A;  1IKL A;  1ZYR C;  5M3M H;  1HA6 A;  1ASY A;  3ULP A;  2FHT A;  4OL7 A;  3A8J E;  5CV9 A;  5FLM G;  1SMY D;  1PLF A;  1TVX A;  1MJE A;  3S16 B;  3AB9 A;  1K0S A;  5IYC H;  4A3B G;  4JVZ A;  2EY6 A;  4RWS C;  1ONL A;  1PRT F;  3S9W A;  2N3S A;  1EU3 A;  4JK1 C;  1NMF A;  3K7U C;  2DN8 A;  2VNU D;  4N8F A;  3M3Y B;  4LF6 Q;  3IRB A;  1AN8 A;  2FIN B;  1I3Q H;  2CQA A;  2B63 B;  1NAP A;  2F0H A;  1XPR A;  3TBI B;  4ME3 A;  4ZKC B;  3TP6 A;  1LM0 A;  2F0W A;  5EKK A;  4K6L A;  1A15 A;  3ND8 A;  5CV4 A;  3MEF A;  5LL6 S;  4ZLT F;  1W6K A;  4A3C G;  1SYE A;  3GTQ B;  2EPB A;  5CGK A;  2CW0 C;  5GQO A;  1SAP A;  3U4Z A;  2FJ2 A;  4JBK A;  4WFN 3;  2KEC A;  4JC0 A;  1NTG A;  4HSP A;  4C3H B;  1TWG B;  4X64 L;  3KUP A;  4B3R L;  1Q7Y C;  5KRU A;  2EVB A;  2MO0 A;  1ROD A;  2EYP A;  4ZUI A;  1O78 A;  2B2Y A;  4GKK L;  1VQJ A;  3G6E A;  1LAB A;  3S17 H;  4O0A A;  3BVZ A;  4B3R Q;  4X64 Q;  2C5C A;  4A3D H;  2UUC L;  3J7A V;  4DGZ A;  4EVO A;  3I3C A;  1SN8 A;  3TZD A;  2L4N A;  1HTL D;  4JI2 Q;  4A3C H;  2B3G A;  2E2I H;  3H09 A;  1Q1E A;  2EQS A;  3I90 A;  1KQS A;  4K5V A;  2JN4 A;  1SE2 A;  2UUC Q;  1B44 D;  2VUM H;  3ULL A;  1VQE A;  1G8Z D;  2I5L X;  4C3I B;  3FKI B;  5FKA C;  1B3A A;  1MKH A;  1A3T A;  1MBY A;  4OHJ A;  1CT1 D;  4H02 A;  2LXJ A;  1XMO L;  2JA6 B;  4B08 A;  3S1Q B;  1PHJ A;  1LTS D;  3ITP A;  2OEO A;  2OWO A;  2HIX A;  4B3M Q;  1T5E A;  3M4P A;  4A3F G;  4WOR A;  4F88 A;  3CC4 A;  4DR5 L;  2G5D A;  2KHS A;  4I7Z C;  1XMO Q;  3DEO A;  2WKC A;  1D8L A;  1EIY B;  4LF5 L;  2Q2H A;  3CRK C;  3PUV A;  1N32 Q;  3H0G B;  2PW5 A;  1EQR A;  1IBL Q;  3K5O A;  3UE1 A;  4DV3 Q;  2A6E C;  1K3R A;  4LF5 Q;  5C4J H;  1WTR A;  1S5E D;  2A69 C;  1K9M C;  1SNO A;  2QCP X;  4V19 0;  1YNJ C;  4JW0 A;  4CBV A;  4FF2 A;  5T1I A;  3CD6 A;  3J81 L;  4RKL A;  2CWP A;  4LK1 C;  2HD3 A;  4R8N A;  3PO2 G;  4A3E B;  1TWA B;  1F9P A;  2EY5 A;  1Y1W G;  2V4D A;  3D0F A;  4HR7 B;  1PZI D;  2E2J H;  3NP8 A;  1Y14 B;  1JQY D;  3MEH A;  3K8A A;  3FPP A;  1XNR L;  1GD7 A;  2K52 A;  3A56 A;  3G48 A;  3MXP A;  5I9O A;  2QW7 A;  1OXS C;  4EGV A;  2XRS D;  1TY2 A;  1HA5 A;  1H9S A;  4OWW B;  4HIM A;  1RD9 D;  1H9S B;  3QWN A;  3GTJ B;  1HZA A;  5ELC A;  4DK1 A;  3GTO B;  2Z4I A;  1T5X D;  1AEX A;  1E1T A;  1GUT A;  3PO3 G;  1KLU D;  1I94 Q;  4L5Q A;  1S40 A;  3D31 A;  3OSO A;  4R4C A;  2O5I C;  1C9O A;  1LAC A;  4FF4 A;  3HOX H;  4LUV A;  2IHE A;  2GA4 B;  1DD2 A;  3SGI A;  1YJN A;  4N9T A;  1S5B D;  4LF7 Q;  1QVC A;  2L0C A;  2WB1 E;  1L0X B;  1I4G A;  3BZD B;  1LT6 D;  1SYG A;  1S4Z A;  1Q8I A;  4OO1 G;  5K5P A;  3MXN A;  2Q8R E;  2CCZ A;  5EAY A;  3MXN B;  1K28 A;  3I91 A;  3TDQ A;  3EJI A;  4DR6 Q;  2VB2 X;  4LF8 L;  2WAQ E;  2DUD A;  5M3M B;  4ULL A;  4TRD A;  4KKT A;  3ERO A;  1U5K A;  2SOB A;  1IYJ B;  4UY8 C;  3TSS A;  4OX9 L;  1A0I A;  3VDY A;  4X6A H;  4LF8 Q;  4IJH A;  3STB C;  3ICE A;  3PQI A;  4IUR A;  1U4M A;  2DJF C;  2ES2 A;  2NN6 H;  2B2W C;  4L8J A;  4I7A A;  2DNE A;  1TS3 A;  1BKB A;  5I2X A;  4OX9 Q;  3HG9 A;  4ZCK A;  1ZXT A;  3CCL A;  1YHA A;  4DU9 A;  3I70 A;  1WCM G;  5ELE A;  1Q86 C;  2O4X A;  2NVQ H;  2PNR C;  2F0O A;  5E1F A;  5IP9 H;  1I3Q B;  1Y1V G;  3RR5 A;  4HJ9 A;  3S1N H;  5T1G A;  1V43 A;  3TS2 A;  4TSS A;  2B8G A;  1WYD A;  5D3I B;  2F03 A;  3S1M H;  3DLL A;  1J5E Q;  4A3I G;  4UP8 A;  1YHQ A;  1K3B C;  4YY3 L;  1VCI A;  1X3F A;  3RLO A;  4UPA A;  1CHP D;  1JWU D;  1ZKO A;  1C4Q A;  1IL2 A;  3QB3 A;  4RCO A;  2K50 A;  2EYF A;  2UUA Q;  1OTC A;  2B2W A;  1W6J A;  5CC4 A;  5I2Y A;  4FF3 A;  4GZY C;  3C2P A;  3K5L A;  4YY3 Q;  2EYL A;  4X3S A;  2HCI A;  1Z47 A;  3HFZ B;  1JB7 A;  1F2Y A;  3PIP 3;  3EN2 A;  1UWV A;  1Y1V H;  1TU2 B;  3S17 B;  4A4I A;  2BE5 C;  1AW7 A;  3R3O A;  3I4M G;  4LF4 L;  3OYY A;  3VR5 A;  3MC0 B;  2F3W A;  1KLG D;  4A3I H;  4V0B A;  4HIO A;  2O2L D;  4NW2 A;  3HOY G;  5AJ3 Q;  1BCP C;  1UAP A;  5IGF A;  3Q8D A;  3W2D A;  4IOA A;  4KD4 A;  2F0N A;  1GO3 E;  1IBK L;  1EY5 A;  2C35 B;  3T1H Q;  1PZJ D;  5KNB A;  3CP0 A;  4YWM A;  2L1B A;  1PTO C;  1VQH A;  1AE3 A;  3I7F A;  1JJC B;  1S5D D;  2K28 A;  3SDZ A;  3KJO A;  4B3S Q;  2L15 A;  1QJO A;  4DK3 C;  3VA5 A;  5M3F G;  5I6W A;  4GLV B;  1KNA A;  3I4M H;  1STE A;  4KJN A;  4P71 A;  1PZK D;  5IWA L;  2RDG A;  3SK4 A;  1PYB A;  2UUB Q;  1MIU A;  2F0K A;  1B1Z A;  3W1G A;  3FVQ A; 
#chains in the Genus database with same CATH homology
 5BN4 A;  1I50 B;  1PMR A;  2JP1 A;  1TKW B;  2H4O A;  4PMC A;  1AZP A;  2ZXP A;  3D6W A;  3T4A C;  1II3 A;  4BS9 A;  1H9J A;  4QB4 A;  5JEA J;  3H91 A;  1ESF A;  4BWG B;  1JWS D;  1HHV A;  1TY0 A;  4BA1 I;  1CZW A;  1TQO A;  1NCV A;  1YNN D;  5M9O A;  1SE3 A;  1DZ1 A;  3OIP A;  2EXZ A;  3M4Y A;  3A7A B;  2IX1 A;  5DAU A;  4QCL A;  3P1H A;  4BY7 B;  2L9H A;  3KLS A;  3VYU A;  3Q0A A;  2K33 A;  1RHP A;  2EY1 A;  3SEB A;  3QOJ A;  2NTS A;  1BO0 A;  3J80 L;  1SMY C;  4G7O C;  5IIF A;  3T56 B;  3HKZ B;  1NR4 A;  3PUW A;  2R6G A;  1GXD C;  3EFX D;  1HRJ A;  4DXF A;  4B9X A;  1TWC B;  3BVG A;  3HOX B;  4EQN A;  1JOQ A;  2DY7 A;  2I46 A;  2PYK A;  4XTC S;  3I72 A;  1DON A;  2PCF B;  2Z1C A;  3K5M A;  3NPP A;  1CA6 A;  4Q0F A;  3JAM L;  1CQV A;  4RKB A;  3CHB D;  1R4P B;  1F2L A;  1A6X A;  1K83 B;  4DF7 A;  3GD7 A;  5EKI A;  5K36 G;  3PUX A;  3T53 B;  3RD4 A;  3M7G A;  1SJE D;  2D5D A;  1G2S A;  3V96 A;  4XQQ A;  3S1N B;  1SSO A;  2MJ8 A;  1EY4 A;  3GTM B;  1D5X C;  2EJG C;  3PUY A;  1U4L A;  5JPM C;  4S3S A;  1L0Y B;  2N55 A;  4FXD A;  3U9S A;  1GOZ A;  5ELD A;  4U67 3;  1WTQ A;  3NTH A;  2L11 A;  1SYC A;  2RSO A;  1EWC A;  4IUV A;  1Q3L A;  1TS4 A;  1IHZ A;  1ENC A;  2JA7 B;  1G91 A;  1BCP F;  2IW3 A;  2HUG A;  1J8I A;  1SBB B;  4KK7 A;  1EEF D;  1DXM A;  3SR1 A;  4H7B A;  1F9Q A;  3T13 A;  3VR3 A;  1PTO F;  4RGM A;  4M8A A;  3QG1 A;  2A74 C;  4A3M B;  1JE4 A;  1CI3 M;  4QMG A;  3SE0 A;  1VF5 C;  5A2Q L;  2XIW A;  4C3J G;  4HN7 A;  3GQB A;  5JEA H;  3H94 A;  2ZXO A;  1QCB D;  4IQZ A;  2F0S A;  4KI0 A;  5EPK A;  2PZT A;  2F0Q A;  3PMF A;  5IOD A;  3SK8 A;  2KJX A;  3MFG A;  1NSN S;  5C6A A;  3S14 B;  5C4H A;  1HUM A;  1CK1 A;  1DOL A;  5EQ0 A;  4X3U A;  5ISR A;  5EPJ A;  4A3K B;  1F77 A;  1GHJ A;  2F0V A;  4ZRZ A;  1HUN A;  3NQI A;  1STY A;  2HCC A;  3PUZ A;  4F7X A;  1BNZ A;  3DWP A;  3MZ5 A;  3FRP B;  1XYI A;  3D4D A;  3T51 B;  3AU7 A;  4B9W A;  2SNS A;  2AWN A;  3W3A A;  3S1R B;  2RBM A;  3U9O A;  3IFD A;  4CJ1 B;  1X32 A;  3NSW A;  2PMZ B;  5M5X B;  4XYQ A;  3L3O C;  3ND9 A;  1EYC A;  1ML0 D;  4H0L C;  3SHL A;  1BOS A;  1FGB D;  1JB3 A;  1ILQ A;  4IFD H;  5TSS A;  4K14 A;  1DCZ A;  2BDN A;  1VMP A;  3L7Z C;  2B2Y C;  3J7Y W;  5J39 A;  1SFO B;  1KNE A;  3MHB A;  5HUR A;  1GUG A;  1KAA A;  3J7A F;  1OXU A;  3HOZ B;  1MSH A;  4ODG A;  1RTN A;  1GUS A;  5CV5 A;  1SEB D;  4MHE A;  2F0D A;  3DUZ A;  1J9O A;  5E3F A;  2K04 A;  3OOC A;  5J22 A;  4H13 C;  5C3W A;  1I6V C;  2ZT9 C;  3KBX A;  5ELF A;  4DAY A;  3GTP B;  4LMQ D;  3EQL C;  4G4K A;  1STB A;  4PMB A;  4KV6 A;  3V2T A;  4HAE A;  4BBR B;  1PRT D;  1SYB A;  4EQP A;  3MWY W;  4HCE A;  1G6Z A;  1ILP A;  1C48 A;  3TP8 A;  2A68 C;  4KN7 C;  1I4H A;  4J6H A;  1RF2 D;  1IKM A;  3P75 A;  2Q8I B;  1D1I A;  5EJW A;  2A6H D;  1HXY D;  2MPM A;  3N52 A;  2E74 C;  2WV6 D;  2R93 B;  4OGQ C;  1O7Z A;  1BQQ T;  1LTI D;  5CYU A;  4ME5 A;  1WTO A;  2JYO A;  2EYH A;  2AWO A;  3D4W A;  2B2V A;  4FNF A;  2PQE A;  3OIQ A;  1TWF B;  3Q6S A;  5FO7 B;  5D14 A;  1CM9 A;  3RLF A;  1B53 A;  3PV0 A;  1A2U A;  1FNW A;  1GUW A;  1EY8 A;  3NK9 A;  4C1N I;  1YNN C;  4RGN A;  3BG3 A;  1STA A;  1F2Z A;  1IW7 C;  3HOU B;  3J81 E;  2NTT A;  1KAB A;  1D6E C;  3NBI A;  4BY1 B;  2N88 A;  5EGT A;  2XRQ D;  4IN3 A;  3MFY A;  2WII B;  2BCO A;  1PTO H;  1JC7 A;  2K6A A;  2RA4 A;  2RVL A;  3OMG A;  1WTV A;  3C1E A;  1BBX C;  1WTW A;  4FYD A;  2OXP A;  5C5M A;  2QKI C;  2EE1 A;  2ENB A;  4RHS A;  3C46 A;  4C56 C;  3BYT B;  3K7A B;  5JAV A;  1LTB D;  2X6L A;  3MVV A;  1SYD A;  4G7Z C;  1A3U A;  1TS2 A;  1F9S A;  3CKI B;  3OPO A;  3TME A;  2PO4 A;  5IGG A;  1U4R A;  4CKB A;  4HMI A;  2Q8T A;  3BYY B;  5C4Z A;  2H1E A;  5LL6 X;  3SK5 A;  1XXG A;  1V8Q A;  3I4N B;  3VYT A;  1RCV D;  4OIK A;  4K6D A;  4F87 A;  3HZX A;  3QJY A;  5KYI A;  2D2C C;  2KEE A;  3K58 A;  3I73 A;  4DAP A;  1JWM D;  4CKE A;  4OO1 H;  1B50 A;  1HQM C;  3G7L A;  1ZYR D;  3IFT A;  1IYU A;  5C0X I;  1V1P A;  1RDP D;  4ZUJ A;  1V1P B;  2E75 C;  2BDO A;  4CJ0 B;  1BF4 A;  5EPL A;  1ENA A;  4A3B B;  3VYS A;  3GP7 A;  2XVS A;  2FMM A;  4DA2 A;  2J0T D;  3KBG A;  5FOB B;  1ESR A;  2AQ1 B;  3LWU A;  2RDF A;  3R93 A;  3BDO A;  1KDB A;  1EQT A;  1H9M A;  1QE6 A;  3TN2 A;  3OW7 A;  1CFM A;  2F0F A;  5EBD A;  3GV3 A;  1LLR D;  4A3D B;  1LT3 D;  1D1K A;  3IL8 A;  4NMZ A;  1TS5 A;  4QIW B;  5C5L A;  2E2I B;  1E2V A;  3I4L A;  1BXT A;  2AUK A;  1E2Z A;  2K32 A;  2CW0 D;  1C8C A;  2K5Q A;  1A3V A;  3TP5 A;  2VUM B;  1RKN A;  3NBH A;  3FMC A;  4X3K A;  4FP5 D;  1Z6H A;  1KDA A;  3BDL A;  4PQX A;  3NQT A;  2NWG A;  2B8F A;  4IUQ A;  1VDZ A;  5D65 A;  5ELB A;  2I07 B;  3NXW A;  3NTI A;  2MGS A;  5FK9 C;  4UDU C;  1KDC A;  1Q12 A;  5NUC A;  3L9A X;  1AZQ A;  3Q22 A;  1DM0 B;  5I4D A;  2KUM A;  1UUP A;  1EIH A;  5C4J B;  2B2T C;  4X3T A;  4DNT B;  1OO9 B;  4A3F B;  1A2T A;  2JE6 I;  3RMH A;  2E2J B;  1LTG D;  3LWE A;  3T16 A;  4JBW A;  2R61 A;  2LMC B;  5E4X A;  1XTC D;  2A6E D;  1SDF A;  1HFN A;  2EJM A;  3P20 A;  4G57 A;  2PZW A;  2A69 D;  2OT2 A;  3J80 E;  1Y69 U;  2B2T A;  2KCC A;  1YNJ D;  1MI2 A;  3GO5 A;  1I4R A;  1X3P A;  1Q90 A;  3PO2 B;  4U68 A;  5FO9 B;  4XIG S;  4CHT B;  4FF1 A;  3IKJ A;  5JPN C;  5C0X J;  1LT5 D;  2LFN A;  1GUN A;  3URY A;  3A8I E;  1K8M A;  2B39 A;  3PO3 B;  3HGB A;  1EWH A;  2NUC A;  5KIX A;  2AQ3 B;  1PYW D;  4C3H G;  3S2D B;  5EBC A;  1JIC A;  3JAM E;  2L12 A;  4RCN A;  5I9P A;  1VMC A;  1EY6 A;  2F1M A;  5FLX L;  4XDX A;  2NVQ B;  3ZYY X;  2ICE C;  2AUJ D;  4KKU A;  3WOF A;  3S1M B;  4C3I G;  1QOH A;  2J4X A;  2EDG A;  2K03 A;  1BDO A;  1M4V A;  1GUO A;  2ZXR A;  3CU7 A;  3ONA B;  1PRT B;  3TP7 A;  1F9R A;  5K36 H;  4NKL A;  5BN5 A;  2L55 A;  2NVY B;  5IGB A;  4XT3 B;  1ET9 A;  3CQZ B;  1B2T A;  3O13 A;  5JVG 3;  5A35 A;  1Y1V B;  2M00 A;  5E4W C;  1SNQ A;  1H9R A;  4K2K A;  2X6G A;  2EY2 A;  5KND A;  1QIL A;  3NUC A;  1Y8O B;  4A3I B;  1LO5 D;  1K8O A;  3Q24 A;  1EY0 A;  5I6Y A;  3A54 A;  2B2U A;  2HQE A;  2MP1 A;  3HRZ C;  2WIN B;  5DM6 3;  3F2U A;  2KOL A;  3C3L A;  1STN A;  4E6I A;  4XXE A;  2WP8 J;  5A2Q E;  2WAC A;  4RGT A;  2BE5 D;  3I4M B;  1U4P A;  4RFB A;  4K5X A;  3I8Z A;  4ID6 A;  1O7L A;  3GTG B;  1MD2 D;  2F0I A;  3KLR A;  2QDB A;  2Z8L A;  1BCP D;  2NVT B;  3BS1 A;  4IAL A;  1ET6 A;  3R8B A;  2K5D A;  2TMP A;  4IUN A;  1KTK A;  4RA8 A;  3NTK A;  1PTO D;  1QG7 A;  2QF7 A;  1OXT A;  2RQX A;  5C0X G;  5M3F B;  2QEJ C;  2SEB D;  2IT1 A;  1PFN A;  1D5Z C;  1BUV T;  1G29 1;  2LKV A;  4UAI A;  3SK6 A;  5D3D A;  4PV1 C;  3A8K E;  2JSO A;  4IZ8 A;  2PPB C;  2KVM A;  4A93 B;  2EYO A;  4WRD A;  3DEP A;  1EYA A;  4I65 A;  1SXT A;  1WTX A;  5JOB A;  2F0J A;  5C0X H;  4CJ2 C;  1CA5 A;  2CVR A;  1FR3 A;  1QWY A;  2LS0 1;  1Y8P B;  3GV6 A;  1EOT A;  4MIU A;  4ZYS A;  3DHQ A;  1HQR D;  2RKS A;  4KTA A;  2XWJ B;  2KA7 A;  2XN9 C;  4R9W A;  1CTM A;  3K0Y A;  2SNM A;  3VYR A;  4RGO S;  1IYV A;  1G2T A;  1FYC A;  1SNP A;  3MA2 B;  4J1M A;  2F3V A;  3QIA A;  1EY9 A;  1Y8N B;  4FVM A;  3MAQ A;  4FXG C;  4WJW A;  2MUY A;  3PIO 3;  2JEB I;  5COR A;  3V05 A;  2B2V C;  3RZD B;  1OXV A;  1O7Y A;  4TKO B;  1JR0 D;  3RZO B;  3RUZ A;  1FD7 D;  1SND A;  2XSC A;  1B4O A;  1CHQ D;  5HGT A;  1Z7T A;  1PDQ A;  4Y7N B;  2PZU A;  3UI2 A;  2D62 A;  2K1B A;  2F0L A;  1SNC A;  5CR3 A;  2IWH A;  3D8G A;  2XWB B;  4IUU A;  5KGU A;  1JOK A;  3G6J B;  4DK0 A;  2IL8 A;  3TZU A;  1XWE A;  1B9N A;  4EQO A;  2KED A;  1QNK A;  2G9H D;  1IL8 A;  3M85 A;  3E6Z X;  5C44 B;  3N6R A;  2TSS A;  1HTP A;  3DWA A;  4G7H C;  1EYD A;  2WB1 B;  5F2D A;  1S5F D;  1M8A A;  1ICW A;  2CHB D;  3LX0 A;  1SJH D;  3Q23 A;  2IPK D;  3M4O B;  2SDF A;  1LTA D;  2K5W A;  2WAQ B;  4RHR A;  4CGY B;  4XT1 B;  5CBA E;  5DM7 3;  3K57 A;  1PFB A;  2VB3 X;  2RDH A;  3QOL A;  3S15 B;  1RTO A;  1UEA B;  3HEJ A;  1EZ8 A;  3D3R A;  5KNC A;  1NR2 A;  4RAU C;  1EU4 A;  1D5M C;  4K8I A;  1PFM A;  2JA5 B;  3LNN A;  2AQ2 B;  4PMW A;  4C3J B;  1ZEQ X;  4NDX A;  1DOK A;  1SNM A;  4KD3 A;  4C2M B;  1TII D;  1TWH B;  4A3G B;  1X3Q A;  1STH A;  1HPC A;  2DY8 A;  1EQV A;  4HTH A;  4KMU C;  1SE4 A;  1I4Q A;  3QO2 A;  4ZAI A;  3SXH A;  2IJ0 A;  2EZV A;  3DWQ A;  3KK7 A;  4O1N A;  3CRL C;  2HDM A;  4BA2 I;  2F4I A;  2NN6 G;  1HFG A;  4DN4 M;  4XQJ A;  1LV9 A;  4O42 A;  4F8M A;  3DM1 A;  2M9V A;  4RH6 A;  5CBE E;  3C1F A;  2EYM A;  2XNA C;  5G3L F;  4BBS B;  3VR4 A;  3D4R A;  2C9O A;  4H44 C;  5CV7 A;  1RJT A;  4ILW A;  1U9R A;  2IX0 A;  2A5H A;  4XQN A;  2J7Z A;  3MXU A;  1AP0 A;  2NVX B;  1E0B A;  1VF7 A;  1CQF A;  4KKS A;  4KY5 A;  1LTR D;  2NBF A;  1NUC A;  1B9M A;  2E2D C;  3GTK B;  1I4X A;  2BA1 A;  1OXX K;  1JCK B;  4Z9C B;  4KJO A;  5IGC A;  3E5S A;  1UNS A;  2HDL A;  2RSN A;  5G3L D;  4IFD I;  5COY A;  1LT4 D;  3DMU A;  2WKD A;  1EEI D;  2A73 B;  3A55 A;  3MTS A;  2Z4H A;  2F0E A;  4C1N K;  1STG A;  5IGD A;  1WTP A;  3R2I A;  5DNF A;  2O5J C;  2A68 D;  3M7N A;  2IX3 A;  1ENF A;  4R8I A;  3NE5 B;  2NB0 A;  5CV6 A;  1FNV A;  1MSG A;  4KHZ A;  5KYL A;  2YU9 B;  1I6H B;  1DJR D;  4DAV A;  3K6O A;  2E2H B;  5FO8 B;  3IAY A;  1AFP A;  3KLS X;  1BCP B;  1S5C D;  1BR9 A;  5IOC A;  5C3E B;  3R2T A;  1PTO B;  3X3M A;  3NHH A;  1JOO A;  4K8J A;  2K05 A;  5JJZ A;  4DFA A;  1IW7 D;  2X69 A;  1R4Q B;  5CV8 A;  3H6M A;  4K2L A;  4OIJ A;  1QB5 D;  4N9P A;  4LJZ C;  3HS0 C;  4M1U B;  1Y1W B;  3K59 A;  4ZKB B;  3OWE B;  1EL0 A;  1TT2 A;  4AYB B;  1LTT D;  2MHV A;  1HCZ A;  1TR5 A;  1WD0 A;  5KEE A;  3HP3 A;  3NWT A;  2L5T A;  3FPU B;  5CMD A;  3ERQ A;  3FEW X;  1PRT C;  2E76 C;  4KY6 A;  3DXJ C;  5M5W B;  4DXG A;  4IFD J;  2JEA I;  2M2L A;  5FLX E;  4K5W A;  3HOV B;  1R9T B;  4HMJ A;  1Q1B A;  3BVM A;  2A6H C;  3HOW B;  4KY7 A;  4P2C B;  4DNR B;  3OMC A;  2LY7 A;  3EVQ A;  3KF8 A;  4Q5V A;  5LHY 1;  2DNC A;  2BOS A;  4QF4 A;  2F0G A;  3AMU A;  1V1O A;  2B2U C;  2KQ3 A;  1E2W A;  1I4P A;  2D9U A;  1GHK A;  4ZQ3 A;  4A3J B;  2JXM B;  1EFI D;  4FO2 A;  3OWF A;  1FNU A;  2R3Z A;  4YIJ A;  4HCS A;  1CZG A;  1WCM B;  4XYO A;  3VA7 A;  4MN3 A;  4ZK9 B;  2NYZ D;  4KN4 C;  2KCN A;  4IUP A;  1O80 A;  1XX8 A;  3MXG A;  2NN6 I;  2R7Z B;  4PNY A;  2EOT A;  2Y0S B;  4HED A;  4J8Q A;  1JOR A;  2PW7 A;  5C3X A;  4L6T B;  2BA0 A;  4ABN A;  1DYQ A;  4OO1 I;  3WDN A;  2F0U A;  5J1Z A;  3SVM A;  1WVL A;  5IT9 E;  5IT9 L;  4CKC A;  3BDC A;  2EYJ A;  5JEA G;  1WD1 A;  1F2M A;  1EIG A;  2K7V A;  2QIL A;  3FDT A;  3WOE A;  2R92 B;  2FFK B;  2G9D A;  1EZ6 A;  2FMC A;  4HSV A;  3H3V C;  5DEH A;  3GTL B;  5AFW A;  5IGE A;  2YYZ A;  2OF1 A;  3HOY B;  4LAA A;  2ICI A;  3EA6 A;  5BN3 A;  3A7L A;  3OHX C;  1MGS A;  2F0P A;  3P7J A;  2F0M A;  3E0J A;  1PXU A;  5EKL A;  4QUC A;  4TQU S;  2EJF C;  4L63 B;  3K5N A;  4KHV A;  1DOM A;  1GJX A;  2ID0 A;  5JVH 3;  5C4X B;  3S2H B;  4NP5 A;  3X3N A;  5M5Y B;  3VR2 A;  1EY7 A;  2VXW A;  1H9K A;  2K01 A;  1SYF A;  4FXK C;  3D6C A;  4IFD G;  1D2B A;  3NWS A;  1QNU A;  4QUF A;  4IUT A;  2F0T A;  2NZ1 D;  2JA8 B;  3VR6 A;  1IKL A;  1ZYR C;  1HA6 A;  2FHT A;  4OL7 A;  3A8J E;  5CV9 A;  1SMY D;  1PLF A;  1TVX A;  3S16 B;  3AB9 A;  2EY6 A;  4RWS C;  1ONL A;  1PRT F;  3S9W A;  1EU3 A;  4JK1 C;  2DN8 A;  2VNU D;  3M3Y B;  1AN8 A;  2FIN B;  2B63 B;  2CQA A;  1NAP A;  2F0H A;  3TBI B;  4ZKC B;  3TP6 A;  2F0W A;  5EKK A;  4K6L A;  1A15 A;  3ND8 A;  5CV4 A;  4ZLT F;  5LL6 S;  1W6K A;  1SYE A;  3GTQ B;  2EPB A;  5CGK A;  2CW0 C;  1SAP A;  2FJ2 A;  4WFN 3;  2KEC A;  4HSP A;  4C3H B;  1TWG B;  3KUP A;  5KRU A;  2EVB A;  1ROD A;  2EYP A;  4ZUI A;  1O78 A;  2B2Y A;  1LAB A;  3BVZ A;  2C5C A;  3J7A V;  4DGZ A;  4EVO A;  3I3C A;  3TZD A;  2L4N A;  1HTL D;  3H09 A;  1Q1E A;  3I90 A;  4K5V A;  1SE2 A;  1B44 D;  1G8Z D;  4C3I B;  3FKI B;  5FKA C;  1B3A A;  1A3T A;  1MBY A;  4OHJ A;  1CT1 D;  2JA6 B;  4B08 A;  3S1Q B;  1LTS D;  2OEO A;  3ITP A;  1T5E A;  4WOR A;  4F88 A;  2KHS A;  4I7Z C;  3DEO A;  2WKC A;  3CRK C;  3PUV A;  3H0G B;  2PW5 A;  3K5O A;  2A6E C;  1WTR A;  1S5E D;  2A69 C;  1SNO A;  2QCP X;  4V19 0;  1YNJ C;  4CBV A;  4FF2 A;  5T1I A;  3J81 L;  4RKL A;  4LK1 C;  4R8N A;  4A3E B;  1TWA B;  1F9P A;  2EY5 A;  2V4D A;  4HR7 B;  1PZI D;  3NP8 A;  1JQY D;  3MEH A;  3FPP A;  3A56 A;  3MXP A;  5I9O A;  1OXS C;  4EGV A;  2XRS D;  1TY2 A;  1H9S A;  1HA5 A;  1RD9 D;  1H9S B;  3QWN A;  3GTJ B;  4DK1 A;  5ELC A;  3GTO B;  2Z4I A;  1T5X D;  1AEX A;  1GUT A;  1KLU D;  3D31 A;  3OSO A;  2O5I C;  1LAC A;  4FF4 A;  2GA4 B;  1DD2 A;  4N9T A;  1S5B D;  2L0C A;  1L0X B;  1I4G A;  3BZD B;  1LT6 D;  1SYG A;  1S4Z A;  1Q8I A;  4OO1 G;  5K5P A;  3MXN A;  2Q8R E;  3I91 A;  3TDQ A;  3EJI A;  2VB2 X;  5M3M B;  4ULL A;  4TRD A;  4KKT A;  3ERO A;  2SOB A;  3TSS A;  4IUR A;  1U4M A;  2NN6 H;  2B2W C;  4L8J A;  2DNE A;  1TS3 A;  5I2X A;  3HG9 A;  1ZXT A;  4DU9 A;  3I70 A;  5ELE A;  2O4X A;  2PNR C;  2F0O A;  5E1F A;  1I3Q B;  5T1G A;  1V43 A;  4TSS A;  2B8G A;  5D3I B;  2F03 A;  1VCI A;  1CHP D;  1JWU D;  1ZKO A;  1C4Q A;  3QB3 A;  4RCO A;  2EYF A;  2B2W A;  1W6J A;  5CC4 A;  5I2Y A;  4FF3 A;  4GZY C;  3C2P A;  3K5L A;  2EYL A;  4X3S A;  2HCI A;  1Z47 A;  1F2Y A;  3PIP 3;  1TU2 B;  3S17 B;  2BE5 C;  1AW7 A;  3R3O A;  3VR5 A;  3MC0 B;  2F3W A;  1KLG D;  4V0B A;  2O2L D;  4NW2 A;  1BCP C;  1UAP A;  5IGF A;  3W2D A;  4KD4 A;  2F0N A;  1EY5 A;  1PZJ D;  5KNB A;  2L1B A;  1PTO C;  1S5D D;  2K28 A;  3SDZ A;  1QJO A;  3VA5 A;  5I6W A;  1KNA A;  1STE A;  4KJN A;  1PZK D;  2RDG A;  3SK4 A;  2F0K A;  1B1Z A;  3FVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...