1XNRL

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xnrL00
4AYBG 4JOIC 2VS1A 3GTGH 2ALYB 4JYAL 4AYBE 4LF7Q 2OCEA 2K5VA 1D8LA 4DUYL 1XNQL 4DV6L 1KL9A 5IP7H 3RLNA 1S72A 4DK6C 2HHHQ 2YYZA 5M5WH 5LMNW 1NMGA 4HJ7A 5JEAJ 2B63G 1Q82C 1N36Q 1I94L 1HNWQ 2R93H 4GS3A 5IT9c 3OTOL 4DR7L 1VCIA 2ZM6L 2JA7H 3I4MH 1CKNA 2DUDA 2UXDL 5J3BA 4JI7Q 3NBHB 3GTMH 4OX9Q 4DV5L 1VQPA 1YNXA 4AIMA 4B3SL 4EQ5A 3RR5A 2UUBL 2R7DA 4DAMA 4LF8Q 1L1OB 3S14H 2VQEQ 5JJIA 4BXXG 1WYDA 2OQ0A 3S16H 5DLQE 1EUJA 1Q8KA 2PMZE 3UDFA 3HOWG 4P73A 1GO3E 4JI6L 1FVIA 4LNQA 1PH3A 3RZOH 2R92H 3E9IA 3F1ZA 1OTCA 3FKIH 3CC7A 1B8AA 4DR5L 1K3RA 4R4OA 4IO9A 2UXCL 4KHPQ 1VQGA 5ELNA 4DNIA 1BKBA 1EIFA 2K14A 1Q81C 1D7QA 4DR1L 1HH2P 1NMFA 1UE7A 1Q1BA 2KBNA 3BZCA 5C44G 3S1MH 2MO1A 5EAYA 2NN6G 5C0XG 1BBWA 3W1BA 3T1YL 2JA7G 3I4MG 1PV4A 4UY8C 2L15A 2VQFQ 3TRZA 4LFBQ 1L0WA 2NZHA 3PIOA 3CF5A 1KRTA 5GQOA 4A3EH 1K83H 3STBD 3T1HL 3J81c 3S15H 2KHJA 1YZ6A 2E8GA 2IX0A 1K73C 1N34L 4JYAQ 2GVBA 4R4IA 2QA4A 2ATWA 4LW1A 2Q2IA 4DUYQ 2PI2E 1HR0W 4DV6Q 1XNQQ 2KCMA 1HZ9A 4JBWA 4LUZA 4UP9A 2GN5A 1G6PA 4R1JA 2VZAA 3RN2A 2UXBL 4IPGA 1L2FA 1JJ2A 1KRSA 3KJOA 3G6EA 5IYDH 4JBMA 1Q12A 2EXDA 4A3MG 1WI5A 4DAYB 1V9PA 2JEBI 2K5HA 1I94Q 1X55A 3GDEA 3PO3G 3OTOQ 4DR7Q 1FL0A 2ZM6Q 4A3JH 2WB1G 3HOXG 2UXDQ 1T9HA 2PNHA 1I5FA 2WP8J 2I5HA 4DV5Q 4GOPB 4A3LH 1BVSA 1HR0L 1CKMA 1XTDA 1PVOA 4MZ9A 4B3SQ 2R7FA 1J6QA 5BR8L 3BU2A 2UUBQ 3GTJH 5C0XI 1YITA 4DUZL 1VQLA 1Q86C 4H02A 1L1OC 3U4VA 4Y7NH 3J81i 1KHIA 1K9MC 1TWAH 3A74A 4A3DG 1I3QH 1OXSC 1A0IA 5H1SE 3VDYA 4JI6Q 2BH2A 1NBWA 3FHWA 3S1NH 5GAGC 4A3DH 4OXPA 2K75A 5C3EH 4DR5Q 4PZ7A 4KLKA 2UXCQ 3H3VH 5IYDG 3G4SA 4JG2A 4A3KH 3PV0A 5IYBH 4HJAA 3WWVA 5GAHC 4DR1Q 3HOVH 3CCJA 3S24A 3H15A 2JK8A 3Q8DA 3T1YQ 4A3JG 1GKHA 2I0QA 1SROA 2MNAA 4A3LG 4B3RL 3T1HQ 2Z0SA 2B29A 2ID0A 4GLAC 2F3IA 1X9NA 1NTGA 2R6GA 3CP0A 3PIPA 2Q2TA 1N34Q 4A76A 1PH7A 1WJJA 1Y1VH 4POFA 4X6AH 3CPFA 1SN8A 3CCUA 4JI1L 4HIMA 4GNXA 4L5RC 2R7ZH 1C7YA 4IPCA 4A3BG 2UXBQ 1N9WA 2NVQH 3TS2A 1MIUA 3H0GH 3PCOB 1W2BA 4LF9L 4GN4B 5ELOA 1IYJB 3SGIA 3W5OA 1WOCA 3ER0A 1VQEA 4YCWA 1YHAA 4OWTB 2E2JH 4LFCL 4DV1Q 4K0KL 3CCSA 4GKKL 1A62A 1U5KA 1YBYA 5LMUL 2NZOA 1MJEA 4Y52H 4YY3L 4DV0L 4OWWB 4ME3A 3KDFA 4GOPC 1HR0Q 4PZ8A 3CCLA 3OYYA 4NB3A 4BY1H 4BBSG 5BR8Q 4C3JH 1VQAA 3S2DH 2K50A 1NJIC 4DUZQ 4P71A 3S2HH 1Y1VG 4NXNL 1ASYA 4X66L 2UU9L 3D0FA 3GTOH 1MJCA 4GN5A 4JI5L 2WFWA 2XGTA 2JJQA 3I7FA 1UE6A 1SLJA 2E2HH 1V43A 1A8VA 3H0GG 2C35B 1QUQA 4IJHA 3EIVA 5IP9H 2YV5A 4A3CH 5JEAG 2XTIA 1G291 1Y1WH 3CQZH 2VUMH 2KCTA 3I56A 2AKWB 2ZTEA 1CUKA 4LUOA 1RIPA 1U0LA 3B6YA 1KIXA 4OWXB 3UDGA 3H3VI 4B3RQ 4R4CA 3PO2H 1QVGA 1M1KC 3NENA 4OONA 4IPHA 5C4JH 3M3YH 2Z6KA 4TVAB 3RNUA 2N49A 1EQRA 4KI0A 3GTKH 2F4VL 1O7IA 3M9BA 4JI1Q 4BBRH 1X56A 5IP7G 2LSSA 3UDXA 3KF8B 5IYCH 4LUVA 4DV4L 1HJPA 1IBLL 4XIGS 3ULPA 4LF9Q 3KJPA 4YHHL 1VQJA 5M3FH 3AFPA 1FJGL 4IFDJ 3TEHB 1DGSA 3L2PA 4LFCQ 2VY3A 4A3CG 4K0KQ 1YHQA 4GKKQ 3EN2A 2R93G 1X65A 5LMUQ 3U50C 5IWAL 4YY3Q 3K8AA 4DV0Q 3UDIA 4A93H 1Y1WG 2CFMA 3JC66 1YJ9A 4HIDA 3U4ZA 1JB7A 3M85A 1K8AC 3HOYH 1H95A 2HQLA 5FJ8H 3ZJYC 3CXCA 3CAMA 2BA1A 5AJ3L 4XTCS 3CD6A 1HZAA 3CC4A 4NXNQ 4X66Q 3PSIA 2UU9Q 1OXTA 4JI5Q 2D0PA 1I6HH 4BBRG 1Q1EA 2KHIA 3CMAA 1E1TA 1PYSB 4HIOA 3CC2A 3HKZG 3BZKA 1VQMA 5IYCG 4WJ4A 2R92G 1X6OA 2OWOA 3FKIG 3CCMA 1VQOA 2N3SA 3J80c 1C0AA 5FLXc 4UP7A 5M3FG 2VL6A 4DV1L 2NVTH 3CCQA 3U58A 1MKHA 5M3MH 1XPRA 2UUAQ 2HT1A 1JT8A 2WB1E 1VQDA 1K8GA 3K81C 4X64L 4A93G 1K0RA 5K36G 1JJCB 1QZGA 3F2CA 4P72A 4GNXB 1VQHA 4A3EG 3HOYG 4DV3L 1N33L 1PA6A 1XMQL 2HIVA 3STBC 4QGUA 4HIKA 4JI0L 1PH6A 4OO1G 1BBUA 2F4VQ 4YCUA 4LWCA 3PUYA 1AE3A 1EIYB 4AQYL 3PUXA 4DV4Q 2IY5B 1IBLQ 2QGQA 1E1OA 4JCVE 4PZ6A 3NEMA 4JBKA 1N32L 3GTQH 4YHHQ 1FJGQ 1YIJA 2ASBA 1LTLA 1IXRA 2CWAA 2K4KA 3KDFB 1LUZA 3E9HA 3J80i 5IWAQ 2AHOB 4IPDA 3S17H 2OQKA 3BJUA 2RHSB 2WAQG 1CSQA 4NXML 1XPUA 1VQ6A 4PMWA 1HZBA 3PF4A 4YWMA 1IZ6A 3KF6A 3TREA 2JEAI 1LM0A 2VNUD 2B3GA 4A3IH 2OTJA 1XMOL 5AJ3Q 4RMFA 2CKZB 1QUQB 2PQAA 1EYGA 1PYBA 2Y0SG 1VQFA 3AQQA 2F52A 4UPAA 4DR3L 1S40A 1LYLA 2Y0SE 1JMCA 4DK3C 3S1QH 3A5UA 4R4QA 5C3EG 2NVYH 3CMEA 2BH8A 4HJ9A 3G48A 3I4NH 4OO1I 1E7ZA 5E7NA 5M5XH 1SRUA 1JE5A 4A3KG 1ASZA 2HIXA 3HOVG 5IYBG 1CKOA 1E24A 4DKAC 1VS0A 4R4TA 4X65L 1PH9A 2D0OA 4X64Q 2ZJPA 1IBKL 5GADC 5FLMH 1KXLA 4L5SA 1VQ7A 3AYHB 3PUZA 4JOIA 4DV3Q 4GNXC 1XMQQ 1NE3A 4B3ML 1N33Q 4A4IA 4POGA 4JI0Q 3I4OA 2PI2A 1XNRL 2B63H 1TWCH 1E3PA 4HJ8A 1P16A 1Q46A 3F8TA 4NPSA 3TQYA 1YEZA 3E0EA 3UE1A 4AQYQ 2RF4A 4J15A 4LF4L 2R7ZG 4DR6L 1VQ4A 1JJGA 4A3FH 1GM5A 2LXKA 1N32Q 1I50H 2A19A 1TWGH 2RHQB 3ERSX 2IHFA 3I4NG 1X54A 2RCNA 1VQ9A 3MXNB 4B3TL 4LFAL 5IE8A 3M7NA 2FXQA 4ALPA 4JI4L 4JI2L 4BY7H 3FP9A 4O0AA 4QJFA 1VQIA 2ZTDA 4YWLA 1G51A 1S3OA 3IRBA 1CSPA 1SR3A 1PHJA 1SE8A 1E22A 1OXXK 2EIFA 4NXMQ 4BXXH 1W3SA 4PG3A 1VQCA 5GAEC 3CCVA 1IL2A 3HOWH 1PFSA 4BY1G 5FLMG 3M4PA 4EX5A 1XMOQ 1QVFA 4L5TA 1PH8A 4GLVB 1VQBA 4IOCA 1IBML 4X62Q 2JA5H 1HNZL 5C44H 4DR3Q 4GN3B 4A3FG 2OTLA 2MO0A 1EQQA 3K80C 2JA6H 2JA8H 5IP9G 1OXUA 2YTXA 4JBJA 3DLLA 4P75A 3TS0A 1WCMH 1J5EQ 4IFDG 2A1AA 2Q2UA 2QEXA 1YHBA 3LGJA 5M5YH 4X65Q 2UUAL 2VUMG 4BY7G 1IBKQ 2Z6KC 5LMNL 4O2DA 2VW9A 3HOZH 1Z47A 1KAWA 4FDBA 2YU9H 1VQ5A 3PO2G 3PUWA 4WJ3M 4HJ5A 4B3MQ 4C3IH 4GKJL 4APVA 1XNRQ 2DGYA 2NVXH 2UUCL 4QQBX 3PF5A 3AEVA 4A3MH 4LF4Q 4JV5L 5C0XJ 1TWFH 3PO3H 4DR6Q 2JA5G 1FGUA 3F2BA 2A8VA 4JI8L 2CQOA 2CCZA 3HKZE 3HOXH 1HZCA 3KLWA 3L0OA 4P74A 2I5LX 5C4XH 1X3FA 2E5LL 3JAMc 3RLOA 1QVCA 1R9TH 4IJLA 4LFAQ 4B3TQ 4C2MH 2JA6G 2JA8G 4DR4L 1HNXL 1KD1C 1UEBA 3KF6B 4JI4Q 1WCMG 4JI2Q 3J7A5 2ZTCA 3GO5A 4LF6L 3AFQA 3EBEA 4L5QA 4DV7L 1AE2A 1X3EA 2K5NA 4JI3L 4DV2L 3CW2C 1QZHA 1KQSA 3D31A 4UP8A 1YI2A 2PQAB 3HOZG 4IFDI 5FJ8G 1X3GA 4DR2L 1YJNA 1L1OA 2MFIA 4BA1I 1VQ8A 1AH9A 2CWPA 2IHEA 3W1GA 1IBMQ 2Q2HA 1SMXA 1HNZQ 3L7ZC 3HOUH 2H5XA 1EFWA 3RN5A 1VQNA 3MEFA 4LF5L 3A0JA 1P8LA 2ZJQA 4A3GH 2IT1A 5C4XG 2K52A 2JA9A 1M90C 3GD7A 1OXVA 3JAMi 4C3HH 1GVPA 3K0XA 3PUVA 1UE5A 2I5MX 5M3MG 4QIWE 3M4QA 1UE1A 3G71A 2NN6I 3ULJA 1YJWA 2N78A 2YTVA 1NY4A 1C9OA 2WAQE 1KC8C 5LMNQ 4LF7L 4IOAA 5JJKA 4QL5A 3RZDH 1EWIA 1WFQA 2AMCB 1Z9FA 1PH2A 3GTPH 4A3BH 2HHHL 1XJVA 4GKJQ 3GTLH 3HFZB 2D62A 3UE0A 1A63A 1UWVA 2UUCQ 2KENA 4AH6A 1TXYA 4A75A 4TQUS 2N8NA 2IX1A 4JC0A 3PGZA 4X62L 3HKSA 1N36L 3J7ZC 2JQOA 1XPOA 4JV5Q 1HNWL 2EQSA 2AWNA 4JI8Q 1Q7YC 3HOUG 3RLFA 4YCVA 2V1CC 4JI7L 3CPWA 3F2DA 1EOVA 2E5LQ 2YTYA 4OX9L 1RL2A 3A5ZB 1TWHH 4RG1A 1J5EL 4A3GG 4DR4Q 4MNOA 1B70B 3ULLA 1Y14B 1HNXQ 4BBSH 5IY0A 4MTNA 2AWOA 2ZJRA 3OW2A 4LF6Q 5GROA 2ES2A 1PH1A 4LF8L 3DM3A 3KOJA 4DV7Q 4GOPA 2BA0A 4DV2Q 2VQEL 3S1RH 1PH5A 5HY6A 4JI3Q 3KFUA 1YVCA 4DPGA 1SFOH 2MQHA 4DR2Q 3NELA 2LXJA 4A3IG 2JE6I 3CCEA 1CKNB 3ICEA 3K7AH 3I55A 3CCRA 2GVAA 4KHPL 4YWKA 4GLXA 5HGQA 1VQKA 4KHZA 1N8RC 4LF5Q 1GD7A 2E2IH 3K7UC 4BA2I 1B7YB 3M4OH 3J81j 2VQFL 4LFBL 1PH4A 1V1QA 3I2ZA 4QY7A 5JJLA 3KYHC
chains in the Genus database with same CATH superfamily
4RCNA 3GTGH 4JYAL 3RZDB 1PXUA 1S72A 2RDFA 4DK6C 3HGBA 4A3IB 2HHHQ 4A3BB 3D6WA 3GTLB 3VR2A 2CW0D 5JEAJ 2B2VA 5CV4A 2Z1CA 3EA6A 1N36Q 1AW7A 2XVSA 1CZWA 5C0XH 3M7GA 4JW0A 3OTOL 2ZM6L 4GZYC 2XIWA 1GUNA 4OX9Q 1UEAB 3VYUA 4AIMA 1KDBA 4B3SL 2R7DA 4HCEA 1W6KA 3OWFA 3S1RB 1S4ZA 5JJIA 1RJTA 2OQ0A 2HCCA 3VYRA 2PMZE 5KYIA 1TU2B 1SFOB 4JI6L 2R92H 3E9IA 1TWCB 2K5WA 3FKIH 3CC7A 4R4OA 1SBBB 1JWMD 3K7AB 3TP7A 5ELNA 1F2ZA 5A2QE 4ILWA 2L11A 4EVOA 5C0XG 2NN6G 1PV4A 5K36H 4LFBQ 1L0WA 3CF5A 3NUCA 4A3EH 3STBD 3S15H 2KHJA 5CBEE 2GVBA 4K6LA 2QA4A 1KLUD 2PI2E 4DUYQ 1XNQQ 3HOWB 4LUZA 4LK1C 5E4XA 2EY6A 3J81E 4ZLTF 2UXBL 1KABA 4FF4A 2PW7A 1MSGA 1KRSA 3KJOA 1Q12A 4A3MG 2L9HA 1FL0A 4DGZA 4GOPB 3D4WA 1YITA 4DUZL 1Y8PB 2N55A 1L1OC 1D2BA 1CQVA 2DY7A 3Q22A 1K9MC 1CZGA 1OXSC 3VDYA 1LT3D 2FMCA 5TSSA 2F0EA 1G2SA 3MFYA 3RZOB 5GAGC 5C3EH 1PTOD 5IIFA 2V4DA 1SE4A 4KLKA 4PZ7A 4V190 2UXCQ 2K6AA 4DR1Q 3HOVH 3S24A 4FO2A 2I0QA 1EZ8A 3T1HQ 2Z0SA 5I6WA 2EY1A 2R6GA 2HUGA 3CP0A 5EBDA 1Y1VH 4X6AH 3PQIA 2B2UC 2NBFA 4A3DB 4L5RC 1SNMA 1SYBA 3P20A 1C7YA 1IW7C 1N9WA 2CVRA 3MWYW 2VXWA 5ELOA 2EYOA 3W5OA 5JEAH 1ESFA 4M1UB 5JAVA 1D5ZC 2EYPA 4K0KL 1YBYA 2NZOA 2WV6D 2FJ2A 4CJ0B 1HTPA 3OYYA 5ELEA 3S2DH 2O5JC 2BDNA 2K50A 1NJIC 1Q8IA 3SDZA 1Y1VG 1ASYA 1FNVA 2LMCB 1MJCA 4JI5L 3Q0AA 1TWAB 2RDGA 1S5FD 3I7FA 4XT1B 2XWBB 2XWJB 1ML0D 5JEAG 3VR3A 5C3XA 4F8MA 3QIAA 4FF2A 1WVLA 5EPLA 1Y1WH 1TS3A 3CQZH 2AKWB 2B2WA 1KIXA 1TS4A 3B6YA 4NW2A 3K59A 4HTHA 4K5VA 1WD1A 5C4JH 3M3YH 1EQRA 4DNRB 2EY2A 1LTTD 1O7IA 4JI1Q 1H9SB 5IP7G 1STAA 4CKEA 2HD3A 1EZ6A 1HTLD 4DV4L 3H6MA 4XIGS 3ULPA 3KJPA 3NHHA 4FXGC 4LFCQ 3TP6A 2R93G 4OIJA 4GKKQ 5KNDA 4LJZC 5IWAL 4YY3Q 4IUTA 3WOFA 4DV0Q 3UDIA 1Y1WG 3JC66 1JB3A 5IOCA 4CJ2C 3URYA 1JB7A 1NR2A 1A3UA 1IYUA 3ZJYC 3I70A 2BA1A 4TSSA 2UU9Q 1JC7A 2D0PA 2L0CA 1I6HH 3K0YA 3CC2A 1Q1EA 3E0JA 1E1TA 2MHVA 2J4XA 5FO8B 1C0AA 3J80c 4G7HC 4L6TB 4C56C 1BXTA 4V0BA 1XYIA 3U58A 1XPRA 2HCIA 2HT1A 2L12A 3FMCA 2M00A 1R4QB 3K81C 4P2CB 2IL8A 4GNXB 1N33L 3OMGA 3GTKB 1GHJA 4YCUA 3MVVA 5KGUA 3PUYA 1AE3A 4RHRA 4AQYL 2A6EC 3HKZB 3SEBA 5IGBA 1IBLQ 3AMUA 2IY5B 2R92B 3HZXA 4PZ6A 4JBKA 3AU7A 3GTQH 1YIJA 1KDCA 2MPMA 1DM0B 1LT6D 3J80i 3S9WA 3K5OA 1UAPA 2IPKD 2OQKA 3BJUA 1TVXA 4NXML 1IKMA 1HZBA 3HOYB 3KF6A 3TREA 2JEAI 2PNRC 1LM0A 2F0GA 3ND9A 2PQAA 1EYGA 1PYBA 2Y0SG 1VQFA 4DK3C 4KKUA 2EJFC 4HJ9A 3I4NH 1XWEA 1SRUA 3CRLC 3V96A 2ICIA 4A3KG 1IKLA 1Y8OB 5IYBG 1CKOA 4QIWB 1E24A 4DNTB 2EDGA 5M3MB 4FXDA 1D1IA 3FDTA 5FLMH 3AYHB 3PUZA 4DV3Q 1NE3A 4B3ML 4JI0Q 3VA7A 2OT2A 4XQNA 1AP0A 1GUWA 1MBYA 5DEHA 1KNEA 2RHQB 1I4QA 3I4NG 1X54A 4B3TL 2JSOA 2SNMA 4LFAL 4JI2L 5I4DA 3NWSA 1PHJA 1SR3A 4XXEA 2VB2X 3V2TA 4X3UA 1VQCA 5FLMG 3OIPA 3N6RA 2M9VA 2IX3A 1PH8A 1DJRD 1ICFB 4GLVB 1VQBA 3W3AA 5C44H 4DR3Q 4GN3B 1AEXA 1B44D 2MO0A 2WACA 2E74C 5CV8A 3K80C 2AQ1B 3A7LA 1CFMA 2YTXA 4JBJA 3DLLA 2EJGC 4FNFA 2Q2UA 4HCSA 5M5YH 1B3AA 2VUMG 4OHJA 4O2DA 1J9OA 2VW9A 1EYCA 1Z47A 3IAYA 1KAWA 2K1BA 2PO4A 1XNRQ 5IGDA 1JWSD 2NVXH 3AEVA 3MEHA 1RCVD 3F2BA 3DWQA 2CCZA 3HOXH 5LHY1 1JOQA 3JAMc 3RLOA 2K01A 2F0HA 1KD1C 3I8ZA 3CQZB 2MUYA 2ZTCA 2F0WA 3GO5A 3J7A5 1QZHA 4DV7L 3TZUA 1X3PA 4DV2L 2F0FA 2B2TC 2NWGA 1M4VA 1TY2A 2PMZB 3D31A 2DJGC 5EJWA 5L37A 5FJ8G 5C4JB 5CV7A 3M3YB 4DR2L 1L1OA 2MFIA 3W1GA 1IBMQ 1F9SA 2Q2HA 1SMXA 1GJXA 1HNZQ 2PQEA 3RN5A 4MTKA 4UDUC 1S5ED 2NUCA 2IT1A 2JA6B 4HAEA 2JA9A 1M90C 3JAMi 2WINB 3G71A 4ZK9B 2YTVA 1NY4A 4LF7L 4QL5A 3RZDH 2AMCB 1IW7D 2BDOA 2J0TD 4A3BH 1SE3A 4F7XA 3GTLH 3UE0A 4C3IB 1A63A 1LO5D 2B2UA 2K33A 1TXYA 2KENA 4AH6A 1LTSD 2LKVA 3C3LA 4JV5Q 1HNWL 2F03A 1RKNA 4JI7L 3A5ZB 4DAYA 4QUCA 5JOBA 1JWUD 1B70B 1Y14B 1W6JA 2Q8RE 5JPNC 3QOJA 1PH5A 3S1RH 3MXUA 3KFUA 4DPGA 3T51B 2EE1A 1HRJA 1SFOH 2RA4A 4A3IG 3CCEA 3A54A 2RVLA 3K7AH 3I55A 5J1ZA 2GVAA 3CCRA 2QKIC 4GLXA 2Z8LA 4K2KA 5HGQA 3RD4A 3HOUB 1D6EC 4QCLA 2B8FA 1B7YB 1R4PB 3L9AX 4NDXA 4BS9A 1BCPB 2VQFL 1V1QA 3R93A 3I2ZA 1PZID 2F0SA 1QWYA 1NNXA 5A2QL 3LNNA 2F0MA 2OCEA 1BDOA 2K5VA 1D8LA 3QB3A 4DV6L 2EYJA 2OEOA 4ZKCB 3ONAB 3MHBA 5T1IA 1TS5A 4H44C 1SYFA 1Q82C 1I94L 4U673 5IT9c 4DR7L 2GA4B 2DUDA 4RGMA 4KD4A 5J3BA 3DM1A 4DV5L 1JR0D 1ZKOA 4MN3A 1YNXA 1VQPA 5I2YA 4EQ5A 2SOBA 4AYBB 3HRZC 1SDFA 3SR1A 5BN3A 4XQJA 2VQEQ 4BXXG 5KNCA 1WTWA 2HQEA 5DLQE 1SE2A 1Q8KA 3HOWG 4P73A 3RZOH 4DR5L 5EQ0A 3GV3A 4KHPQ 1VQGA 3WDNA 1BKBA 1O78A 2KBNA 2PPBC 1QJOA 2E2IB 4UY8C 3QR8A 4HMJA 1ILQA 1KRTA 2P5ZX 1JOKA 2KCCA 1YZ6A 2IX0A 1N34L 4M8AA 4JYAQ 4OO1H 2Q8IB 3A8JE 4LW1A 4KJOA 2A6ED 4A3DH 1HR0W 4PQXA 5G3LF 3RN2A 2A68C 4KY5A 4IPGA 2X6LA 1L2FA 1JJ2A 4PMBA 2EXZA 1QNKA 2JEBI 5C44B 2CH4A 3GDEA 3PO3G 1CHQD 3OTOQ 1F9QA 2ZM6Q 4NKLA 2EYMA 2WP8J 3DEOA 3IKJA 3J80E 4A3LH 1PVOA 2ZXRA 4B3SQ 2RDHA 5BR8L 5M5YB 3NP8A 1VQLA 1Q86C 3KK7A 4IQZA 3S14B 1STEA 1TWAH 4C1NI 4A3DG 1BR9A 1SNDA 2BOSA 4JI6Q 3FHWA 4OXPA 4YIJA 4HJAA 3NPPA 5D14A 3U9OA 2JK8A 1AFPA 2KECA 4A3LG 2MNAA 2B29A 2ID0A 4GLAC 1NTGA 1LTGD 5ELCA 3PIPA 1G2TA 4A76A 1WJJA 1SN8A 3CCUA 4HIMA 2KJXA 2UXBQ 2NVQH 1MIUA 1AZQA 3I72A 3PCOB 4LF9L 5EGTA 4YCWA 3ER0A 1ONLA 1YHAA 1U9RA 1DOLA 3CCSA 1A62A 1U5KA 5LMUL 1A15A 4Y52H 3LWUA 1ILPA 5KEEA 3T16A 2C9OA 4GOPC 3DWAA 1LTBD 4BY1H 5DM63 1BO0A 1GHKA 4DUZQ 4P71A 1SMYC 3LWEA 4Y7NB 2EOTA 3D0FA 1BQQT 4GN5A 1DCZA 2XGTA 1NSNS 1SLJA 4ODGA 3V05A 1CM9A 1E2ZA 1QUQA 3GQBA 1VMCA 3K58A 5IP9H 2YV5A 2JP1A 4J8QA 4KN4C 1STBA 1CUKA 1E2WA 2O2LD 1U0LA 2EYFA 3C1EA 3NTIA 5CYUA 1A6XA 2KUMA 3A55A 3NENA 4OONA 1M1KC 3OHXC 1L0XB 2ENBA 1K8OA 2N49A 3GTKH 3M9BA 3R8BA 1X56A 1O7LA 2R7ZB 2LSSA 1PTOF 1ZYRC 3KF8B 3UDXA 4RFBA 1NAPA 1TIID 1HQRD 5BN4A 1G8ZD 1VQJA 4KV6A 1FJGL 1TKWB 1DGSA 4K0KQ 3TP8A 3U50C 1I4GA 1GUOA 1LLRD 2H4OA 3U4ZA 4FP5D 3M85A 1WTQA 1K8AC 3HOYH 1FYCA 2HQLA 2I46A 2RQXA 1QB5D 1X32A 2G5DA 3CAMA 2NB0A 2B2TA 1PRTB 4JI5Q 3X3MA 3P75A 5DAUA 5EKKA 3I91A 1PYSB 4K8IA 3HKZG 3BZKA 2E2HB 4WJ4A 1V1PB 1MSHA 2R92G 1K0SA 3FKIG 3CCMA 2FINB 5FLXc 2VL6A 1LACA 3CCQA 1MKHA 5M3MH 2WB1E 1VQDA 1K8GA 4FVMA 3JAME 1K0RA 2Q8TA 5K36G 1IL8A 2ZXOA 4A3EG 3PO2B 3HOYG 1PA6A 1BBUA 1EIYB 2O5IC 4BBRB 5C6AA 1H9RA 4DV4Q 2QGQA 1E1OA 1N32L 3OWEB 4H13C 3T4AC 1LTLA 4O42A 3KDFB 1LUZA 1AN8A 3FVQA 2AHOB 5IWAQ 4A93B 4IPDA 2ZT9C 1XPUA 2VNUD 2OTJA 1XMOL 1DXMA 5LL6S 4G7OC 4FYDA 2F0IA 3AQQA 1EYDA 1LTRD 4UPAA 1S40A 3IFTA 3BVMA 1LYLA 2Y0SE 1JMCA 4I65A 2C5CA 3NXWA 5C3EG 4OO1I 5E7NA 4F88A 2WKDA 4PV1C 3HOVG 1VS0A 4R4TA 1K8MA 3NQTA 1U4RA 1JORA 3N52A 3MXGA 4GNXC 1N33Q 2M2LA 3I4OA 2B63H 1E3PA 4HJ8A 3NE5B 3F8TA 4NPSA 3UE1A 4AQYQ 4DR6L 5JVH3 1EQVA 2EYHA 2JXMB 1SNPA 4K2LA 1AZPA 1D5MC 2IHFA 2RCNA 4IUQA 4OEMB 2FXQA 3F2UA 2F1MA 4JI4L 1FR3A 4YWLA 2ZXPA 3IRBA 5DM73 3S17B 4NXMQ 1SE8A 1E22A 1W3SA 1IL2A 5I2XA 4EX5A 3C46A 2F0QA 1QNUA 2KVMA 4G57A 1EY7A 5FLXL 2NVQB 1S5BD 2OTLA 1EQQA 2NVYB 4KKTA 1EY5A 5DNFA 2JA6H 5M5XB 1OXUA 4P75A 1J5EQ 2LFNA 5IT9E 3NWTA 4N8X1 4R9WA 3QOLA 3R2IA 2A68D 4BY1B 2YU9H 1VQ5A 4RAUC 4B3MQ 4C3IH 4QQBX 1UNSA 1STGA 3PF5A 3TP5A 1ENFA 1TWFH 5EPJA 1FGUA 4JI8L 4A3FB 1E2VA 3KLWA 4ZQ3A 1X3FA 2QDLA 1I50B 2QILA 2E5LL 1QVCA 4IJLA 4LFAQ 4B3TQ 1Z6HA 2JA6G 1HNXL 1U4MA 1MHWC 4JI2Q 2EYLA 2AUJD 1SEBD 4LF6L 1RDPD 4ZAIA 4DXFA 1X3EA 2J7ZA 4XYQA 4UP8A 1TR5A 1X3GA 1CHPD 4BA1I 1VDZA 2XN9C 4C3IG 1G6ZA 2F0NA 1TT2A 2JA5B 4EQOA 3HOUH 1HQMC 5ISRA 4LF5L 1P8LA 5E3FA 2JA8B 5KNBA 3VR6A 1F2YA 1GVPA 2NYZD 3A56A 3H94A 2NN6I 1YJWA 5CMDA 2WAQE 5JJKA 1PH2A 3HOZB 3O13A 3HFZB 2D62A 1A3TA 4A75A 4TQUS 1PLFA 3OSOA 1SXTA 3HKSA 1MGSA 2NZ1D 2JQOA 3J7ZC 1WTXA 3E5SA 3HOUG 3RLFA 2V1CC 1LT4D 3F2DA 1H9JA 2A6HC 5C4XB 2YTYA 5D3IB 1J5EL 4C2MB 1L0YB 4BBSH 4OIKA 1SMYD 4MTNA 2ZJRA 4LF8L 5GROA 4RKBA 5IGCA 1PH1A 3DM3A 4DV7Q 4GOPA 2BA0A 4DV2Q 2K03A 2Z4HA 1DYQA 1YVCA 1STNA 5CGKA 1NR4A 3DUZA 1O80A 4DR2Q 1SSOA 5IGFA 3RUZA 1VQKA 2OF1A 4KD3A 1GD7A 4ZRZA 3KBGA 4RKLA 2E2IH 4BA2I 1HA5A 4A3GB 1EIHA 5C4HA 1PH4A 2LS01 4QY7A 5JVG3 3K6OA 2PW5A 4O1NA 1EEFD 1KDAA 4LMQD 4AYBG 2ALYB 3IL8A 4LF7Q 1II3A 1ZYRD 2DNEA 3RLNA 3J7YW 3PIP3 1DOMA 4HJ7A 2R61A 1HNWQ 1QE6A 1F2LA 2OXPA 4ZUJA 2UXDL 4JI7Q 3NBHB 2K05A 2RBMA 1BUVT 3VYTA 1EWHA 1I6VC 1TWHB 5NUCA 3RR5A 2UUBL 1PDQA 2MJ8A 3S14H 1WYDA 5ELDA 3S16H 1B50A 2F0LA 3EVQA 1SNOA 4XYOA 1V8QA 1FVIA 4LNQA 1PH3A 2B63B 1K3RA 4DNIA 1EY4A 1UUPA 2K14A 1HH2P 1NMFA 3BDOA 1Q1BA 1UE7A 5C44G 3TDQA 2B8GA 2MO1A 1RD9D 5EAYA 1BBWA 3W1BA 4CDDC 3T1YL 1TY0A 4CDFC 3PMFA 3MTSA 2VQFQ 3TRZA 2K04A 2DN8A 1BCPC 5GQOA 1HCZA 4R8NA 3J81c 2E8GA 2IWHA 1K73C 2Q2IA 4DV6Q 5CC4A 2KCMA 1HZ9A 4UP9A 1EL0A 1G6PA 4KN7C 4R1JA 1QOHA 1BF4A 1EOTA 5M5WB 1FNUA 5IYDH 1SJHD 3G6EA 2EXDA 1I94Q 1H9SA 1WI5A 2R93B 4DR7Q 1JE4A 3I4MB 2JA7B 3HOXG 4ABNA 1T9HA 2PNHA 3GTMB 2I5HA 4DV5Q 3SHLA 3MAQA 1HR0L 1XTDA 4MZ9A 1EY6A 2LY7A 3BU2A 3KBXA 3GTJH 3D3RA 1IYVA 1JOOA 4NP5A 4Y7NH 3J81i 1KHIA 2YU9B 2BH2A 4DR5Q 3I4LA 5IYDG 1TWFB 4JG2A 3WWVA 2IW3A 2XRQD 2DY8A 2WB1B 3CCJA 3S1MB 2D2CC 4EGVA 3OMCA 1A2TA 1SYCA 1GKHA 1QCBD 4BWGB 1SROA 2F0UA 4B3RL 1K83B 1CQFA 1X9NA 1HUNA 2F3IA 1N34Q 2PYKA 4DK1A 3CPFA 1SYDA 5ELBA 4GNXA 2R7ZH 2L5TA 5KYLA 2AQ3B 4A3BG 3TS2A 1W2BA 3SGIA 1WOCA 5CV6A 4DV1Q 4H0LC 4A3JB 4HMIA 3J7AF 3BVGA 4ME3A 4PZ8A 1RTNA 2FFKB 5BR8Q 4C3JH 2BE5C 1BNZA 1ZEQX 3S2HH 4NXNL 5ELFA 4X66L 2EVBA 3QO2A 2Y0SB 3NK9A 1UE6A 2E2HH 4J1MA 3BDLA 3S1NB 1A8VA 2C35B 4DF7A 4IJHA 3EIVA 4A3CH 4A3KB 2XTIA 1G291 3J81L 3I56A 1A3VA 2ZTEA 1RIPA 4OWXB 3UDGA 3H3VI 4EQPA 4BBSB 4R4CA 3PO2H 1EU3A 2B2YC 3HS0C 1OO9B 4TVAB 3RNUA 4KI0A 2KEDA 2F4VL 4KY6A 4BBRH 4N9PA 3QWNA 1BOSA 5IYCH 1HJPA 3H0GB 1NUCA 4LF9Q 2JYOA 4YHHL 2FMMA 3AFPA 1I4RA 1KTKA 4A3CG 2VY3A 2SNSA 1YHQA 2N88A 5LMUQ 3K8AA 4A93H 2CFMA 3OIQA 4HIDA 5JJZA 3SE0A 1H95A 3CXCA 1S5CD 1WTHA 5AJ3L 4K14A 3PSIA 1OXTA 3GTOB 2QDBA 4BBRG 3CMAA 1ET9A 5IYCG 1X6OA 4XQQA 2OWOA 1PTOB 1EWCA 1VQOA 5J22A 4IURA 4UP7A 4DV1L 1F77A 1SYEA 1JT8A 2KHSA 2VUMB 3P7JA 4X64L 4A93G 2HDLA 1JJCB 1TQOA 4CHTB 3F2CA 3IFDA 3VA5A 4IUUA 1ENCA 1XMQL 3FRPB 2HIVA 1JICA 4HIKA 2KQ3A 1PH6A 2E76C 4OO1G 2CH4W 3S16B 4R8IA 4LWCA 3CRKC 4IUNA 2A6HD 2H1EA 4KJNA 1FJGQ 5M3FB 1H9KA 2ASBA 2CWAA 4IUVA 3E9HA 3A7AB 3S17H 2RSNA 1VQ6A 1CSQA 3MFGA 1WD0A 1F2MA 4OL7A 1PFMA 2B3GA 4RHSA 4QB4A 3TBIB 1B3QA 4RMFA 1PRTC 2E2DC 3EFXD 1D1KA 2JN4A 3K5LA 1BCPF 4R4QA 2NVYH 3CMEA 2BH8A 4K6DA 1E7ZA 5M5XH 2NVTB 4H7BA 5LL6X 4DKAC 1ET6A 4X65L 2WAQB 1PH9A 1IBKL 3BVZA 4JK1C 5I6YA 4HEDA 5GADC 3DWPA 1KXLA 3U9SA 4L5SA 1VQ7A 3GTJB 3QG1A 2EJMA 2PI2A 3P1HA 1P16A 3UI2A 1S5DD 3E0EA 4LF4L 1JJGA 2RF4A 1GXDC 4A3FH 2XRSD 4LAAA 1N32Q 2ICEC 1I50H 1TWGH 1ICWA 4K5WA 4XDXA 1LT5D 3M7NA 5IE8A 4ALPA 1RHPA 4CDCC 1S3OA 1CSPA 1OXXK 2X69A 2SEBD 3CCVA 1PFSA 4BY1G 3G7LA 1STHA 3M4PA 1XMOQ 1VF5C 1B2TA 4C1NK 2PZUA 2PZWA 2JA5H 3S1QB 4RGNA 1PYWD 2NN6H 4A3FG 1C48A 1U4LA 1BCPD 3SK6A 2JA8H 3CHBD 5IP9G 3I73A 4DAVA 4I7AA 5T1GA 4CDEC 3TS0A 4K8JA 2KEEA 4ULLA 2QEXA 4ME5A 3LGJA 2UUAL 2Z6KC 1F9PA 5LMNL 3MXNA 2A69C 3HOZH 4PNYA 4FDBA 4C3JB 3NSWA 3R2TA 4HJ5A 3ZYYX 4FF3A 4GKJL 3S2HB 1GUSA 2UUCL 1PZKD 4A3MH 4DR6Q 2JA5G 2A8VA 1A2UA 2I5LX 2F0TA 5C4XH 4FXKC 4DR4L 2NTSA 4C2MH 2JA8G 3KF6B 1ZXTA 4JI4Q 2AUKA 4BY7B 4L5QA 2K5NA 2NTTA 1EIGA 5CORA 3CW2C 4JI3L 4G7ZC 1HFNA 2PQAB 2XNAC 3HOZG 4IFDI 4Z9CB 1AH9A 2CWPA 3Q24A 2G9DA 4IUPA 2F0OA 2H5XA 5C3WA 1SYGA 3A0JA 2F3WA 3MA2B 4FF1A 5CV5A 2QF7A 2ZJQA 4A3GH 5C4XG 1XX8A 2K52A 3GD7A 1OXVA 1WCMB 3PUVA 5M3MG 5D65A 3M4QA 1KC8C 1LTAD 1F9RA 5KIXA 1WFQA 1Z9FA 1D5XC 5C5LA 3D4RA 3GP7A 3TMEA 2HHHL 4WJWA 3D4DA 1UWVA 2N8NA 4JC0A 4WFN3 3FPUB 1N36L 1O7ZA 1XPOA 3PO3B 1HXYD 2EQSA 4JI8Q 1Q7YC 5C4ZA 4YCVA 1EOVA 2E5LQ 4OX9L 1HA6A 1TWHH 1R9TB 4A3GG 1B53A 2BE5D 4MNOA 3ULLA 1HNXQ 3ND8A 1KLGD 4LF6Q 1EYAA 1SNCA 3KOJA 3VR4A 1E0BA 2MQHA 1SJED 3MC0B 1VF7A 1RODA 4DAPA 1N8RC 4LF5Q 4EQNA 4KKSA 5EKIA 3J81j 1SNQA 4LFBL 2Z6BA 1WTPA 1KNAA 4C3HB 2AQ2B 2EPBA 2F0JA 4JOIC 2VS1A 4AYBE 4DUYL 1XNQL 2B2YA 1KL9A 5IP7H 3GTPB 2YYZA 4NMZA 3H91A 3ITPA 5M5WH 5LMNW 1NMGA 1YNNC 3DHQA 2B63G 5FO7B 1FNWA 2Z4IA 4IALA 2R93H 4GS3A 1EY9A 4OELB 1VCIA 2JA7H 3I4MH 1CKNA 2FHTA 3GTMH 4L8JA 2O4XA 1BBXC 1QG7A 1IHZA 5IGEA 1PRTF 5COYA 4DAMA 3W2DA 1L1OB 1YNJC 4DXGA 4LF8Q 1GUTA 1RTOA 4G4KA 2L55A 4CGYB 1EUJA 1I4PA 3UDFA 1DONA 1GO3E 4KMUC 3F1ZA 3Q23A 4RH6A 1OTCA 1B8AA 4IO9A 2UXCL 5HURA 1EIFA 1Q81C 1D7QA 3E3XA 4DR1L 1EQTA 3BZCA 4X3SA 3S1MH 1HPCA 3I4MG 2JA7G 1TWGB 2QW7A 4MHEA 1KAAA 2L15A 3M4OB 1DZ1A 2NZHA 3PIOA 1PFNA 1K83H 3T1HL 1GOZA 3TN2A 3I3CA 2B39A 5FO9B 3GTGB 4R4IA 5IODA 2ATWA 3TSSA 1ENAA 5JPMC 4JBWA 2GN5A 5FKAC 1PZJD 2VZAA 5AFWA 4JPBW 2X6GA 4RCOA 4JBMA 4DAYB 3R3OA 1V9PA 4PMCA 2K5HA 1WTRA 1G91A 1X55A 3KF8A 4UAIA 4A3JH 5FK9C 2WB1G 2UXDQ 4KTAA 1I5FA 1BVSA 2A74C 1CKMA 2K5QA 2R7FA 1J6QA 3BYYB 2F3VA 1HFGA 3MXPA 3BS1A 1T5EA 5C0XI 2UUBQ 1FD7D 1PRTD 3NQIA 4TKOB 4H02A 3U4VA 1Y8NB 3A8KE 3A74A 1I3QH 2I07B 1A0IA 5H1SE 1NBWA 3S1NH 2K75A 3FKIB 4A3MB 3H3VH 3G4SA 4A3KH 3PV0A 5IYBH 1CA5A 2EY5A 5GAHC 4J6HA 1V1PA 1JCKB 3H15A 2MP1A 3Q8DA 3T1YQ 4A3JG 4OGQC 4KK7A 3EQLC 1XTCD 4DFAA 5CBAE 4A3EB 1JQYD 4HN7A 3S15B 2Q2TA 3LX0A 1PH7A 4POFA 2QEJC 4E6IA 3MZ5A 4JI1L 1PFBA 4IPCA 4ID6A 4X3TA 2K32A 4DN4M 3H0GH 4GN4B 1IYJB 1CT1D 1VQEA 2E2JH 4OWTB 5I9PA 4LFCL 2PZTA 4GKKL 1MJEA 4YY3L 4DV0L 4OWWB 1MI2A 3HP3A 3KDFA 1HR0Q 3CCLA 3VYSA 4NB3A 3C2PA 4BBSG 1VQAA 3T53B 2UU9L 1C4QA 3DMUA 3GTOH 2WFWA 4N8FA 2JJQA 3SK8A 5FOBB 2BCOA 1V43A 5C3EB 3H0GG 1PTOH 5EBCA 4U68A 2TMPA 3HOVB 3KUPA 4N9TA 4RGTA 2VUMH 2KCTA 4L63B 1CK1A 1H9MA 2A69D 4LUOA 2EZVA 2CHBD 4B3RQ 3OOCA 3DXJC 1QVGA 4IPHA 3SK4A 2Z6KA 2A5HA 2K5DA 1Y1VB 2K7VA 3BG3A 2CQAA 2B2VC 3DEPA 2SDFA 3J80L 1B4OA 4LUVA 2F0PA 1IBLL 5E1FA 1ESRA 5M3FH 4IFDJ 2CW0C 5D3DA 3TEHB 2DNCA 2IJ0A 3L2PA 3EN2A 1X65A 1YJ9A 1LTID 5M9OA 4UHVA 1HUMA 1WTOA 3L3OC 5FJ8H 3S2DB 4XTCS 3CD6A 1HZAA 3BZDB 3CC4A 4NXNQ 2VB3X 4X66Q 2F4IA 2RSOA 3E6ZX 2KHIA 4HIOA 1X3QA 1VQMA 1J8IA 2KOLA 2N3SA 1B9MA 3NTHA 5M3FG 2NVTH 3OW7A 3H3VC 3AB9A 1I4HA 4S3SA 1Y1WB 5FLXE 1C8CA 1QZGA 1T5XD 4P72A 1VQHA 4RGOS 4DV3L 3STBC 4QGUA 4JI0L 2F4VQ 2MGSA 1STYA 2WKCA 4WORA 3PUXA 2G9HD 1FGBD 4ZKBB 3TZDA 4JCVE 3NEMA 4ZCKA 4RWSC 3BYTB 4CJ1B 3NTKA 4YHHQ 2WIIB 1IXRA 2K4KA 1SAPA 1CI3M 1XXGA 2RHSB 2WAQG 1CA6A 2D9UA 4PMWA 3PF4A 4YWMA 1K3BC 4DA2A 1IZ6A 4B9WA 4A3IH 1Q3LA 5AJ3Q 1EY8A 2CKZB 1QUQB 5EKLA 1I6HB 2RKSA 2F52A 3S1QH 4DR3L 2L1BA 3A5UA 4B9XA 3OPOA 3G48A 3WOEA 1PTOC 1JE5A 1ASZA 2HIXA 3SK5A 3RMHA 4CKCA 2D0OA 3A8IE 1EU4A 4X64Q 2ZJPA 5E4WC 3EROA 3X3NA 5K5PA 2XSCA 4WRDA 4JOIA 2DJFC 1YNND 1XMQQ 4A4IA 4POGA 5CV9A 1XNRL 1TWCH 1Q46A 4HR7B 1I3QB 1YEZA 3TQYA 1NCVA 2R7ZG 4J15A 3BDCA 5A35A 1HHVA 1VQ4A 1GM5A 2LXKA 4X3KA 3FEWX 2A19A 3ERSX 2R3ZA 3GTQB 3KLRA 2TSSA 4IFDH 1VQ9A 2L4NA 3MXNB 1YNJD 2QCPX 4BY7H 3FP9A 4O0AA 2KA7A 1VQIA 2E75C 2ZTDA 4QJFA 1G51A 4IN3A 3NBIA 2EIFA 4BXXH 4RA8A 4PG3A 1LV9A 5GAEC 3HOWH 3G6JB 4C3JG 1QVFA 4L5TA 1V1OA 4IOCA 3I90A 1IBML 2KCNA 4X62Q 3JAML 3J7AV 1HNZL 3KLSX 1I4XA 3T13A 3I4NB 2E2JB 2B2WC 1WCMH 4IFDG 4Q5VA 2A1AA 2K28A 3C1FA 1YHBA 1EEID 4X65Q 4BY7G 1IBKQ 5J39A 3EJIA 3T56B 3PO2G 5HGTA 2PCFB 3PUWA 4WJ3M 2D5DA 4APVA 2DGYA 1RF2D 3CKIB 4KHVA 4ZYSA 1Q90A 4LF4Q 4JV5L 5C0XJ 3PO3H 4QUFA 2CQOA 3HKZE 1HZCA 3L0OA 4P74A 5F2DA 1LABA 3SVMA 1DOKA 1R9TH 4F87A 3M4YA 1UEBA 1WCMG 1EY0A 3NBHA 3AFQA 3EBEA 1KQSA 1AE2A 4QMGA 3VR5A 2F0DA 1YI2A 3GV6A 4QF4A 4KY7A 1GUGA 1YJNA 1VQ8A 1WTVA 4K5XA 2IHEA 2F0KA 3H09A 3D8GA 3L7ZC 1EFWA 1VQNA 5EPKA 3MEFA 4B08A 4Q0FA 2F0VA 1EFID 3HG9A 2A73B 3K5MA 4C3HH 3K0XA 1UE5A 2I5MX 4QIWE 1B9NA 1UE1A 3ULJA 5BN5A 2UUAQ 2N78A 4XT3B 3SXHA 1C9OA 3HEJA 4IOAA 5LMNQ 2HDMA 3PIO3 3FPPA 4JVZA 1EWIA 5I9OA 1K28A 1Z7TA 4HSPA 3GTPH 2Z9HA 1Y69U 5IGGA 1XJVA 3ERQA 4GKJQ 3CU7A 2UUCQ 2NVXB 2IX1A 4X62L 3PGZA 1QILA 4I7ZC 1PMRA 4MIUA 2AWNA 4CKBA 3K57A 1B1ZA 3HOXB 4CBVA 3CPWA 1RL2A 1M8AA 1VMPA 1MD2D 4RG1A 4DR4Q 5CR3A 5IY0A 4C3HG 2AWOA 3OW2A 2ES2A 1CTMA 4JI3Q 2VQEL 1TS2A 5HY6A 4DU9A 4HSVA 2RCFA 1U4PA 1DD2A 3NELA 2LXJA 5IT9L 2JE6I 5G3LD 4DK0A 1CKNB 3KLSA 3ICEA 4IZ8A 4KHPL 4ZUIA 4YWKA 3D6CA 5KRUA 4KHZA 3Q6SA 1O7YA 3QJYA 3K7UC 5C5MA 3M4OH 5JJLA 3K5NA 4TRDA 3KYHC
chains in the Genus database with same CATH topology
4AYBG 4JOIC 2VS1A 3GTGH 2ALYB 4JYAL 4AYBE 4LF7Q 2OCEA 2K5VA 1D8LA 4DUYL 1XNQL 4DV6L 1KL9A 5IP7H 3RLNA 1S72A 4DK6C 2HHHQ 2YYZA 5M5WH 5LMNW 1NMGA 4HJ7A 5JEAJ 2B63G 1Q82C 1N36Q 1I94L 1HNWQ 2R93H 4GS3A 5IT9c 3OTOL 4DR7L 1VCIA 2ZM6L 2JA7H 3I4MH 1CKNA 2DUDA 2UXDL 5J3BA 4JI7Q 3NBHB 3GTMH 4OX9Q 4DV5L 1VQPA 1YNXA 4AIMA 4B3SL 4EQ5A 3RR5A 2UUBL 2R7DA 4DAMA 4LF8Q 1L1OB 3S14H 2VQEQ 5JJIA 4BXXG 1WYDA 2OQ0A 3S16H 5DLQE 1EUJA 1Q8KA 2PMZE 3UDFA 3HOWG 4P73A 1GO3E 4JI6L 1FVIA 4LNQA 1PH3A 3RZOH 2R92H 3E9IA 3F1ZA 1OTCA 3FKIH 3CC7A 1B8AA 4DR5L 1K3RA 4R4OA 4IO9A 2UXCL 4KHPQ 1VQGA 5ELNA 4DNIA 1BKBA 1EIFA 2K14A 1Q81C 1D7QA 4DR1L 1HH2P 1NMFA 1UE7A 1Q1BA 2KBNA 3BZCA 5C44G 3S1MH 2MO1A 5EAYA 2NN6G 5C0XG 1BBWA 3W1BA 3T1YL 2JA7G 3I4MG 1PV4A 4UY8C 2L15A 2VQFQ 3TRZA 4LFBQ 1L0WA 2NZHA 3PIOA 3CF5A 1KRTA 5GQOA 4A3EH 1K83H 3STBD 3T1HL 3J81c 3S15H 2KHJA 1YZ6A 2E8GA 2IX0A 1K73C 1N34L 4JYAQ 2GVBA 4R4IA 2QA4A 2ATWA 4LW1A 2Q2IA 4DUYQ 2PI2E 1HR0W 4DV6Q 1XNQQ 2KCMA 1HZ9A 4JBWA 4LUZA 4UP9A 2GN5A 1G6PA 4R1JA 2VZAA 3RN2A 2UXBL 4IPGA 1L2FA 1JJ2A 1KRSA 3KJOA 3G6EA 5IYDH 4JBMA 1Q12A 2EXDA 4A3MG 1WI5A 4DAYB 1V9PA 2JEBI 2K5HA 1I94Q 1X55A 3GDEA 3PO3G 3OTOQ 4DR7Q 1FL0A 2ZM6Q 4A3JH 2WB1G 3HOXG 2UXDQ 1T9HA 2PNHA 1I5FA 2WP8J 2I5HA 4DV5Q 4GOPB 4A3LH 1BVSA 1HR0L 1CKMA 1XTDA 1PVOA 4MZ9A 4B3SQ 2R7FA 1J6QA 5BR8L 3BU2A 2UUBQ 3GTJH 5C0XI 1YITA 4DUZL 1VQLA 1Q86C 4H02A 1L1OC 3U4VA 4Y7NH 3J81i 1KHIA 1K9MC 1TWAH 3A74A 4A3DG 1I3QH 1OXSC 1A0IA 5H1SE 3VDYA 4JI6Q 2BH2A 1NBWA 3FHWA 3S1NH 5GAGC 4A3DH 4OXPA 2K75A 5C3EH 4DR5Q 4PZ7A 4KLKA 2UXCQ 3H3VH 5IYDG 3G4SA 4JG2A 4A3KH 3PV0A 5IYBH 4HJAA 3WWVA 5GAHC 4DR1Q 3HOVH 3CCJA 3S24A 3H15A 2JK8A 3Q8DA 3T1YQ 4A3JG 1GKHA 2I0QA 1SROA 2MNAA 4A3LG 4B3RL 3T1HQ 2Z0SA 2B29A 2ID0A 4GLAC 2F3IA 1X9NA 1NTGA 2R6GA 3CP0A 3PIPA 2Q2TA 1N34Q 4A76A 1PH7A 1WJJA 1Y1VH 4POFA 4X6AH 3CPFA 1SN8A 3CCUA 4JI1L 4HIMA 4GNXA 4L5RC 2R7ZH 1C7YA 4IPCA 4A3BG 2UXBQ 1N9WA 2NVQH 3TS2A 1MIUA 3H0GH 3PCOB 1W2BA 4LF9L 4GN4B 5ELOA 1IYJB 3SGIA 3W5OA 1WOCA 3ER0A 1VQEA 4YCWA 1YHAA 4OWTB 2E2JH 4LFCL 4DV1Q 4K0KL 3CCSA 4GKKL 1A62A 1U5KA 1YBYA 5LMUL 2NZOA 1MJEA 4Y52H 4YY3L 4DV0L 4OWWB 4ME3A 3KDFA 4GOPC 1HR0Q 4PZ8A 3CCLA 3OYYA 4NB3A 4BY1H 4BBSG 5BR8Q 4C3JH 1VQAA 3S2DH 2K50A 1NJIC 4DUZQ 4P71A 3S2HH 1Y1VG 4NXNL 1ASYA 4X66L 2UU9L 3D0FA 3GTOH 1MJCA 4GN5A 4JI5L 2WFWA 2XGTA 2JJQA 3I7FA 1UE6A 1SLJA 2E2HH 1V43A 1A8VA 3H0GG 2C35B 1QUQA 4IJHA 3EIVA 5IP9H 2YV5A 4A3CH 5JEAG 2XTIA 1G291 1Y1WH 3CQZH 2VUMH 2KCTA 3I56A 2AKWB 2ZTEA 1CUKA 4LUOA 1RIPA 1U0LA 3B6YA 1KIXA 4OWXB 3UDGA 3H3VI 4B3RQ 4R4CA 3PO2H 1QVGA 1M1KC 3NENA 4OONA 4IPHA 5C4JH 3M3YH 2Z6KA 4TVAB 3RNUA 2N49A 1EQRA 4KI0A 3GTKH 2F4VL 1O7IA 3M9BA 4JI1Q 4BBRH 1X56A 5IP7G 2LSSA 3UDXA 3KF8B 5IYCH 4LUVA 4DV4L 1HJPA 1IBLL 4XIGS 3ULPA 4LF9Q 3KJPA 4YHHL 1VQJA 5M3FH 3AFPA 1FJGL 4IFDJ 3TEHB 1DGSA 3L2PA 4LFCQ 2VY3A 4A3CG 4K0KQ 1YHQA 4GKKQ 3EN2A 2R93G 1X65A 5LMUQ 3U50C 5IWAL 4YY3Q 3K8AA 4DV0Q 3UDIA 4A93H 1Y1WG 2CFMA 3JC66 1YJ9A 4HIDA 3U4ZA 1JB7A 3M85A 1K8AC 3HOYH 1H95A 2HQLA 5FJ8H 3ZJYC 3CXCA 3CAMA 2BA1A 5AJ3L 4XTCS 3CD6A 1HZAA 3CC4A 4NXNQ 4X66Q 3PSIA 2UU9Q 1OXTA 4JI5Q 2D0PA 1I6HH 4BBRG 1Q1EA 2KHIA 3CMAA 1E1TA 1PYSB 4HIOA 3CC2A 3HKZG 3BZKA 1VQMA 5IYCG 4WJ4A 2R92G 1X6OA 2OWOA 3FKIG 3CCMA 1VQOA 2N3SA 3J80c 1C0AA 5FLXc 4UP7A 5M3FG 2VL6A 4DV1L 2NVTH 3CCQA 3U58A 1MKHA 5M3MH 1XPRA 2UUAQ 2HT1A 1JT8A 2WB1E 1VQDA 1K8GA 3K81C 4X64L 4A93G 1K0RA 5K36G 1JJCB 1QZGA 3F2CA 4P72A 4GNXB 1VQHA 4A3EG 3HOYG 4DV3L 1N33L 1PA6A 1XMQL 2HIVA 3STBC 4QGUA 4HIKA 4JI0L 1PH6A 4OO1G 1BBUA 2F4VQ 4YCUA 4LWCA 3PUYA 1AE3A 1EIYB 4AQYL 3PUXA 4DV4Q 2IY5B 1IBLQ 2QGQA 1E1OA 4JCVE 4PZ6A 3NEMA 4JBKA 1N32L 3GTQH 4YHHQ 1FJGQ 1YIJA 2ASBA 1LTLA 1IXRA 2CWAA 2K4KA 3KDFB 1LUZA 3E9HA 3J80i 5IWAQ 2AHOB 4IPDA 3S17H 2OQKA 3BJUA 2RHSB 2WAQG 1CSQA 4NXML 1XPUA 1VQ6A 4PMWA 1HZBA 3PF4A 4YWMA 1IZ6A 3KF6A 3TREA 2JEAI 1LM0A 2VNUD 2B3GA 4A3IH 2OTJA 1XMOL 5AJ3Q 4RMFA 2CKZB 1QUQB 2PQAA 1EYGA 1PYBA 2Y0SG 1VQFA 3AQQA 2F52A 4UPAA 4DR3L 1S40A 1LYLA 2Y0SE 1JMCA 4DK3C 3S1QH 3A5UA 4R4QA 5C3EG 2NVYH 3CMEA 2BH8A 4HJ9A 3G48A 3I4NH 4OO1I 1E7ZA 5E7NA 5M5XH 1SRUA 1JE5A 4A3KG 1ASZA 2HIXA 3HOVG 5IYBG 1CKOA 1E24A 4DKAC 1VS0A 4R4TA 4X65L 1PH9A 2D0OA 4X64Q 2ZJPA 1IBKL 5GADC 5FLMH 1KXLA 4L5SA 1VQ7A 3AYHB 3PUZA 4JOIA 4DV3Q 4GNXC 1XMQQ 1NE3A 4B3ML 1N33Q 4A4IA 4POGA 4JI0Q 3I4OA 2PI2A 1XNRL 2B63H 1TWCH 1E3PA 4HJ8A 1P16A 1Q46A 3F8TA 4NPSA 3TQYA 1YEZA 3E0EA 3UE1A 4AQYQ 2RF4A 4J15A 4LF4L 2R7ZG 4DR6L 1VQ4A 1JJGA 4A3FH 1GM5A 2LXKA 1N32Q 1I50H 2A19A 1TWGH 2RHQB 3ERSX 2IHFA 3I4NG 1X54A 2RCNA 1VQ9A 3MXNB 4B3TL 4LFAL 5IE8A 3M7NA 2FXQA 4ALPA 4JI4L 4JI2L 4BY7H 3FP9A 4O0AA 4QJFA 1VQIA 2ZTDA 4YWLA 1G51A 1S3OA 3IRBA 1CSPA 1SR3A 1PHJA 1SE8A 1E22A 1OXXK 2EIFA 4NXMQ 4BXXH 1W3SA 4PG3A 1VQCA 5GAEC 3CCVA 1IL2A 3HOWH 1PFSA 4BY1G 5FLMG 3M4PA 4EX5A 1XMOQ 1QVFA 4L5TA 1PH8A 4GLVB 1VQBA 4IOCA 1IBML 4X62Q 2JA5H 1HNZL 5C44H 4DR3Q 4GN3B 4A3FG 2OTLA 2MO0A 1EQQA 3K80C 2JA6H 2JA8H 5IP9G 1OXUA 2YTXA 4JBJA 3DLLA 4P75A 3TS0A 1WCMH 1J5EQ 4IFDG 2A1AA 2Q2UA 2QEXA 1YHBA 3LGJA 5M5YH 4X65Q 2UUAL 2VUMG 4BY7G 1IBKQ 2Z6KC 5LMNL 4O2DA 2VW9A 3HOZH 1Z47A 1KAWA 4FDBA 2YU9H 1VQ5A 3PO2G 3PUWA 4WJ3M 4HJ5A 4B3MQ 4C3IH 4GKJL 4APVA 1XNRQ 2DGYA 2NVXH 2UUCL 4QQBX 3PF5A 3AEVA 4A3MH 4LF4Q 4JV5L 5C0XJ 1TWFH 3PO3H 4DR6Q 2JA5G 1FGUA 3F2BA 2A8VA 4JI8L 2CQOA 2CCZA 3HKZE 3HOXH 1HZCA 3KLWA 3L0OA 4P74A 2I5LX 5C4XH 1X3FA 2E5LL 3JAMc 3RLOA 1QVCA 1R9TH 4IJLA 4LFAQ 4B3TQ 4C2MH 2JA6G 2JA8G 4DR4L 1HNXL 1KD1C 1UEBA 3KF6B 4JI4Q 1WCMG 4JI2Q 3J7A5 2ZTCA 3GO5A 4LF6L 3AFQA 3EBEA 4L5QA 4DV7L 1AE2A 1X3EA 2K5NA 4JI3L 4DV2L 3CW2C 1QZHA 1KQSA 3D31A 4UP8A 1YI2A 2PQAB 3HOZG 4IFDI 5FJ8G 1X3GA 4DR2L 1YJNA 1L1OA 2MFIA 4BA1I 1VQ8A 1AH9A 2CWPA 2IHEA 3W1GA 1IBMQ 2Q2HA 1SMXA 1HNZQ 3L7ZC 3HOUH 2H5XA 1EFWA 3RN5A 1VQNA 3MEFA 4LF5L 3A0JA 1P8LA 2ZJQA 4A3GH 2IT1A 5C4XG 2K52A 2JA9A 1M90C 3GD7A 1OXVA 3JAMi 4C3HH 1GVPA 3K0XA 3PUVA 1UE5A 2I5MX 5M3MG 4QIWE 3M4QA 1UE1A 3G71A 2NN6I 3ULJA 1YJWA 2N78A 2YTVA 1NY4A 1C9OA 2WAQE 1KC8C 5LMNQ 4LF7L 4IOAA 5JJKA 4QL5A 3RZDH 1EWIA 1WFQA 2AMCB 1Z9FA 1PH2A 3GTPH 4A3BH 2HHHL 1XJVA 4GKJQ 3GTLH 3HFZB 2D62A 3UE0A 1A63A 1UWVA 2UUCQ 2KENA 4AH6A 1TXYA 4A75A 4TQUS 2N8NA 2IX1A 4JC0A 3PGZA 4X62L 3HKSA 1N36L 3J7ZC 2JQOA 1XPOA 4JV5Q 1HNWL 2EQSA 2AWNA 4JI8Q 1Q7YC 3HOUG 3RLFA 4YCVA 2V1CC 4JI7L 3CPWA 3F2DA 1EOVA 2E5LQ 2YTYA 4OX9L 1RL2A 3A5ZB 1TWHH 4RG1A 1J5EL 4A3GG 4DR4Q 4MNOA 1B70B 3ULLA 1Y14B 1HNXQ 4BBSH 5IY0A 4MTNA 2AWOA 2ZJRA 3OW2A 4LF6Q 5GROA 2ES2A 1PH1A 4LF8L 3DM3A 3KOJA 4DV7Q 4GOPA 2BA0A 4DV2Q 2VQEL 3S1RH 1PH5A 5HY6A 4JI3Q 3KFUA 1YVCA 4DPGA 1SFOH 2MQHA 4DR2Q 3NELA 2LXJA 4A3IG 2JE6I 3CCEA 1CKNB 3ICEA 3K7AH 3I55A 3CCRA 2GVAA 4KHPL 4YWKA 4GLXA 5HGQA 1VQKA 4KHZA 1N8RC 4LF5Q 1GD7A 2E2IH 3K7UC 4BA2I 1B7YB 3M4OH 3J81j 2VQFL 4LFBL 1PH4A 1V1QA 3I2ZA 4QY7A 5JJLA 3KYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB G;  4JOI C;  2VS1 A;  3GTG H;  2ALY B;  4JYA L;  4AYB E;  4LF7 Q;  2OCE A;  2K5V A;  1D8L A;  4DUY L;  1XNQ L;  4DV6 L;  1KL9 A;  5IP7 H;  3RLN A;  1S72 A;  4DK6 C;  2HHH Q;  2YYZ A;  5M5W H;  5LMN W;  1NMG A;  4HJ7 A;  5JEA J;  2B63 G;  1Q82 C;  1N36 Q;  1I94 L;  1HNW Q;  2R93 H;  4GS3 A;  5IT9 c;  3OTO L;  4DR7 L;  1VCI A;  2ZM6 L;  2JA7 H;  3I4M H;  1CKN A;  2DUD A;  2UXD L;  5J3B A;  4JI7 Q;  3NBH B;  3GTM H;  4OX9 Q;  4DV5 L;  1VQP A;  1YNX A;  4AIM A;  4B3S L;  4EQ5 A;  3RR5 A;  2UUB L;  2R7D A;  4DAM A;  4LF8 Q;  1L1O B;  3S14 H;  2VQE Q;  5JJI A;  4BXX G;  1WYD A;  2OQ0 A;  3S16 H;  5DLQ E;  1EUJ A;  1Q8K A;  2PMZ E;  3UDF A;  3HOW G;  4P73 A;  1GO3 E;  4JI6 L;  1FVI A;  4LNQ A;  1PH3 A;  3RZO H;  2R92 H;  3E9I A;  3F1Z A;  1OTC A;  3FKI H;  3CC7 A;  1B8A A;  4DR5 L;  1K3R A;  4R4O A;  4IO9 A;  2UXC L;  4KHP Q;  1VQG A;  5ELN A;  4DNI A;  1BKB A;  1EIF A;  2K14 A;  1Q81 C;  1D7Q A;  4DR1 L;  1HH2 P;  1NMF A;  1UE7 A;  1Q1B A;  2KBN A;  3BZC A;  5C44 G;  3S1M H;  2MO1 A;  5EAY A;  2NN6 G;  5C0X G;  1BBW A;  3W1B A;  3T1Y L;  2JA7 G;  3I4M G;  1PV4 A;  4UY8 C;  2L15 A;  2VQF Q;  3TRZ A;  4LFB Q;  1L0W A;  2NZH A;  3PIO A;  3CF5 A;  1KRT A;  5GQO A;  4A3E H;  1K83 H;  3STB D;  3T1H L;  3J81 c;  3S15 H;  2KHJ A;  1YZ6 A;  2E8G A;  2IX0 A;  1K73 C;  1N34 L;  4JYA Q;  2GVB A;  4R4I A;  2QA4 A;  2ATW A;  4LW1 A;  2Q2I A;  4DUY Q;  2PI2 E;  1HR0 W;  4DV6 Q;  1XNQ Q;  2KCM A;  1HZ9 A;  4JBW A;  4LUZ A;  4UP9 A;  2GN5 A;  1G6P A;  4R1J A;  2VZA A;  3RN2 A;  2UXB L;  4IPG A;  1L2F A;  1JJ2 A;  1KRS A;  3KJO A;  3G6E A;  5IYD H;  4JBM A;  1Q12 A;  2EXD A;  4A3M G;  1WI5 A;  4DAY B;  1V9P A;  2JEB I;  2K5H A;  1I94 Q;  1X55 A;  3GDE A;  3PO3 G;  3OTO Q;  4DR7 Q;  1FL0 A;  2ZM6 Q;  4A3J H;  2WB1 G;  3HOX G;  2UXD Q;  1T9H A;  2PNH A;  1I5F A;  2WP8 J;  2I5H A;  4DV5 Q;  4GOP B;  4A3L H;  1BVS A;  1HR0 L;  1CKM A;  1XTD A;  1PVO A;  4MZ9 A;  4B3S Q;  2R7F A;  1J6Q A;  5BR8 L;  3BU2 A;  2UUB Q;  3GTJ H;  5C0X I;  1YIT A;  4DUZ L;  1VQL A;  1Q86 C;  4H02 A;  1L1O C;  3U4V A;  4Y7N H;  3J81 i;  1KHI A;  1K9M C;  1TWA H;  3A74 A;  4A3D G;  1I3Q H;  1OXS C;  1A0I A;  5H1S E;  3VDY A;  4JI6 Q;  2BH2 A;  1NBW A;  3FHW A;  3S1N H;  5GAG C;  4A3D H;  4OXP A;  2K75 A;  5C3E H;  4DR5 Q;  4PZ7 A;  4KLK A;  2UXC Q;  3H3V H;  5IYD G;  3G4S A;  4JG2 A;  4A3K H;  3PV0 A;  5IYB H;  4HJA A;  3WWV A;  5GAH C;  4DR1 Q;  3HOV H;  3CCJ A;  3S24 A;  3H15 A;  2JK8 A;  3Q8D A;  3T1Y Q;  4A3J G;  1GKH A;  2I0Q A;  1SRO A;  2MNA A;  4A3L G;  4B3R L;  3T1H Q;  2Z0S A;  2B29 A;  2ID0 A;  4GLA C;  2F3I A;  1X9N A;  1NTG A;  2R6G A;  3CP0 A;  3PIP A;  2Q2T A;  1N34 Q;  4A76 A;  1PH7 A;  1WJJ A;  1Y1V H;  4POF A;  4X6A H;  3CPF A;  1SN8 A;  3CCU A;  4JI1 L;  4HIM A;  4GNX A;  4L5R C;  2R7Z H;  1C7Y A;  4IPC A;  4A3B G;  2UXB Q;  1N9W A;  2NVQ H;  3TS2 A;  1MIU A;  3H0G H;  3PCO B;  1W2B A;  4LF9 L;  4GN4 B;  5ELO A;  1IYJ B;  3SGI A;  3W5O A;  1WOC A;  3ER0 A;  1VQE A;  4YCW A;  1YHA A;  4OWT B;  2E2J H;  4LFC L;  4DV1 Q;  4K0K L;  3CCS A;  4GKK L;  1A62 A;  1U5K A;  1YBY A;  5LMU L;  2NZO A;  1MJE A;  4Y52 H;  4YY3 L;  4DV0 L;  4OWW B;  4ME3 A;  3KDF A;  4GOP C;  1HR0 Q;  4PZ8 A;  3CCL A;  3OYY A;  4NB3 A;  4BY1 H;  4BBS G;  5BR8 Q;  4C3J H;  1VQA A;  3S2D H;  2K50 A;  1NJI C;  4DUZ Q;  4P71 A;  3S2H H;  1Y1V G;  4NXN L;  1ASY A;  4X66 L;  2UU9 L;  3D0F A;  3GTO H;  1MJC A;  4GN5 A;  4JI5 L;  2WFW A;  2XGT A;  2JJQ A;  3I7F A;  1UE6 A;  1SLJ A;  2E2H H;  1V43 A;  1A8V A;  3H0G G;  2C35 B;  1QUQ A;  4IJH A;  3EIV A;  5IP9 H;  2YV5 A;  4A3C H;  5JEA G;  2XTI A;  1G29 1;  1Y1W H;  3CQZ H;  2VUM H;  2KCT A;  3I56 A;  2AKW B;  2ZTE A;  1CUK A;  4LUO A;  1RIP A;  1U0L A;  3B6Y A;  1KIX A;  4OWX B;  3UDG A;  3H3V I;  4B3R Q;  4R4C A;  3PO2 H;  1QVG A;  1M1K C;  3NEN A;  4OON A;  4IPH A;  5C4J H;  3M3Y H;  2Z6K A;  4TVA B;  3RNU A;  2N49 A;  1EQR A;  4KI0 A;  3GTK H;  2F4V L;  1O7I A;  3M9B A;  4JI1 Q;  4BBR H;  1X56 A;  5IP7 G;  2LSS A;  3UDX A;  3KF8 B;  5IYC H;  4LUV A;  4DV4 L;  1HJP A;  1IBL L;  4XIG S;  3ULP A;  4LF9 Q;  3KJP A;  4YHH L;  1VQJ A;  5M3F H;  3AFP A;  1FJG L;  4IFD J;  3TEH B;  1DGS A;  3L2P A;  4LFC Q;  2VY3 A;  4A3C G;  4K0K Q;  1YHQ A;  4GKK Q;  3EN2 A;  2R93 G;  1X65 A;  5LMU Q;  3U50 C;  5IWA L;  4YY3 Q;  3K8A A;  4DV0 Q;  3UDI A;  4A93 H;  1Y1W G;  2CFM A;  3JC6 6;  1YJ9 A;  4HID A;  3U4Z A;  1JB7 A;  3M85 A;  1K8A C;  3HOY H;  1H95 A;  2HQL A;  5FJ8 H;  3ZJY C;  3CXC A;  3CAM A;  2BA1 A;  5AJ3 L;  4XTC S;  3CD6 A;  1HZA A;  3CC4 A;  4NXN Q;  4X66 Q;  3PSI A;  2UU9 Q;  1OXT A;  4JI5 Q;  2D0P A;  1I6H H;  4BBR G;  1Q1E A;  2KHI A;  3CMA A;  1E1T A;  1PYS B;  4HIO A;  3CC2 A;  3HKZ G;  3BZK A;  1VQM A;  5IYC G;  4WJ4 A;  2R92 G;  1X6O A;  2OWO A;  3FKI G;  3CCM A;  1VQO A;  2N3S A;  3J80 c;  1C0A A;  5FLX c;  4UP7 A;  5M3F G;  2VL6 A;  4DV1 L;  2NVT H;  3CCQ A;  3U58 A;  1MKH A;  5M3M H;  1XPR A;  2UUA Q;  2HT1 A;  1JT8 A;  2WB1 E;  1VQD A;  1K8G A;  3K81 C;  4X64 L;  4A93 G;  1K0R A;  5K36 G;  1JJC B;  1QZG A;  3F2C A;  4P72 A;  4GNX B;  1VQH A;  4A3E G;  3HOY G;  4DV3 L;  1N33 L;  1PA6 A;  1XMQ L;  2HIV A;  3STB C;  4QGU A;  4HIK A;  4JI0 L;  1PH6 A;  4OO1 G;  1BBU A;  2F4V Q;  4YCU A;  4LWC A;  3PUY A;  1AE3 A;  1EIY B;  4AQY L;  3PUX A;  4DV4 Q;  2IY5 B;  1IBL Q;  2QGQ A;  1E1O A;  4JCV E;  4PZ6 A;  3NEM A;  4JBK A;  1N32 L;  3GTQ H;  4YHH Q;  1FJG Q;  1YIJ A;  2ASB A;  1LTL A;  1IXR A;  2CWA A;  2K4K A;  3KDF B;  1LUZ A;  3E9H A;  3J80 i;  5IWA Q;  2AHO B;  4IPD A;  3S17 H;  2OQK A;  3BJU A;  2RHS B;  2WAQ G;  1CSQ A;  4NXM L;  1XPU A;  1VQ6 A;  4PMW A;  1HZB A;  3PF4 A;  4YWM A;  1IZ6 A;  3KF6 A;  3TRE A;  2JEA I;  1LM0 A;  2VNU D;  2B3G A;  4A3I H;  2OTJ A;  1XMO L;  5AJ3 Q;  4RMF A;  2CKZ B;  1QUQ B;  2PQA A;  1EYG A;  1PYB A;  2Y0S G;  1VQF A;  3AQQ A;  2F52 A;  4UPA A;  4DR3 L;  1S40 A;  1LYL A;  2Y0S E;  1JMC A;  4DK3 C;  3S1Q H;  3A5U A;  4R4Q A;  5C3E G;  2NVY H;  3CME A;  2BH8 A;  4HJ9 A;  3G48 A;  3I4N H;  4OO1 I;  1E7Z A;  5E7N A;  5M5X H;  1SRU A;  1JE5 A;  4A3K G;  1ASZ A;  2HIX A;  3HOV G;  5IYB G;  1CKO A;  1E24 A;  4DKA C;  1VS0 A;  4R4T A;  4X65 L;  1PH9 A;  2D0O A;  4X64 Q;  2ZJP A;  1IBK L;  5GAD C;  5FLM H;  1KXL A;  4L5S A;  1VQ7 A;  3AYH B;  3PUZ A;  4JOI A;  4DV3 Q;  4GNX C;  1XMQ Q;  1NE3 A;  4B3M L;  1N33 Q;  4A4I A;  4POG A;  4JI0 Q;  3I4O A;  2PI2 A;  1XNR L;  2B63 H;  1TWC H;  1E3P A;  4HJ8 A;  1P16 A;  1Q46 A;  3F8T A;  4NPS A;  3TQY A;  1YEZ A;  3E0E A;  3UE1 A;  4AQY Q;  2RF4 A;  4J15 A;  4LF4 L;  2R7Z G;  4DR6 L;  1VQ4 A;  1JJG A;  4A3F H;  1GM5 A;  2LXK A;  1N32 Q;  1I50 H;  2A19 A;  1TWG H;  2RHQ B;  3ERS X;  2IHF A;  3I4N G;  1X54 A;  2RCN A;  1VQ9 A;  3MXN B;  4B3T L;  4LFA L;  5IE8 A;  3M7N A;  2FXQ A;  4ALP A;  4JI4 L;  4JI2 L;  4BY7 H;  3FP9 A;  4O0A A;  4QJF A;  1VQI A;  2ZTD A;  4YWL A;  1G51 A;  1S3O A;  3IRB A;  1CSP A;  1SR3 A;  1PHJ A;  1SE8 A;  1E22 A;  1OXX K;  2EIF A;  4NXM Q;  4BXX H;  1W3S A;  4PG3 A;  1VQC A;  5GAE C;  3CCV A;  1IL2 A;  3HOW H;  1PFS A;  4BY1 G;  5FLM G;  3M4P A;  4EX5 A;  1XMO Q;  1QVF A;  4L5T A;  1PH8 A;  4GLV B;  1VQB A;  4IOC A;  1IBM L;  4X62 Q;  2JA5 H;  1HNZ L;  5C44 H;  4DR3 Q;  4GN3 B;  4A3F G;  2OTL A;  2MO0 A;  1EQQ A;  3K80 C;  2JA6 H;  2JA8 H;  5IP9 G;  1OXU A;  2YTX A;  4JBJ A;  3DLL A;  4P75 A;  3TS0 A;  1WCM H;  1J5E Q;  4IFD G;  2A1A A;  2Q2U A;  2QEX A;  1YHB A;  3LGJ A;  5M5Y H;  4X65 Q;  2UUA L;  2VUM G;  4BY7 G;  1IBK Q;  2Z6K C;  5LMN L;  4O2D A;  2VW9 A;  3HOZ H;  1Z47 A;  1KAW A;  4FDB A;  2YU9 H;  1VQ5 A;  3PO2 G;  3PUW A;  4WJ3 M;  4HJ5 A;  4B3M Q;  4C3I H;  4GKJ L;  4APV A;  1XNR Q;  2DGY A;  2NVX H;  2UUC L;  4QQB X;  3PF5 A;  3AEV A;  4A3M H;  4LF4 Q;  4JV5 L;  5C0X J;  1TWF H;  3PO3 H;  4DR6 Q;  2JA5 G;  1FGU A;  3F2B A;  2A8V A;  4JI8 L;  2CQO A;  2CCZ A;  3HKZ E;  3HOX H;  1HZC A;  3KLW A;  3L0O A;  4P74 A;  2I5L X;  5C4X H;  1X3F A;  2E5L L;  3JAM c;  3RLO A;  1QVC A;  1R9T H;  4IJL A;  4LFA Q;  4B3T Q;  4C2M H;  2JA6 G;  2JA8 G;  4DR4 L;  1HNX L;  1KD1 C;  1UEB A;  3KF6 B;  4JI4 Q;  1WCM G;  4JI2 Q;  3J7A 5;  2ZTC A;  3GO5 A;  4LF6 L;  3AFQ A;  3EBE A;  4L5Q A;  4DV7 L;  1AE2 A;  1X3E A;  2K5N A;  4JI3 L;  4DV2 L;  3CW2 C;  1QZH A;  1KQS A;  3D31 A;  4UP8 A;  1YI2 A;  2PQA B;  3HOZ G;  4IFD I;  5FJ8 G;  1X3G A;  4DR2 L;  1YJN A;  1L1O A;  2MFI A;  4BA1 I;  1VQ8 A;  1AH9 A;  2CWP A;  2IHE A;  3W1G A;  1IBM Q;  2Q2H A;  1SMX A;  1HNZ Q;  3L7Z C;  3HOU H;  2H5X A;  1EFW A;  3RN5 A;  1VQN A;  3MEF A;  4LF5 L;  3A0J A;  1P8L A;  2ZJQ A;  4A3G H;  2IT1 A;  5C4X G;  2K52 A;  2JA9 A;  1M90 C;  3GD7 A;  1OXV A;  3JAM i;  4C3H H;  1GVP A;  3K0X A;  3PUV A;  1UE5 A;  2I5M X;  5M3M G;  4QIW E;  3M4Q A;  1UE1 A;  3G71 A;  2NN6 I;  3ULJ A;  1YJW A;  2N78 A;  2YTV A;  1NY4 A;  1C9O A;  2WAQ E;  1KC8 C;  5LMN Q;  4LF7 L;  4IOA A;  5JJK A;  4QL5 A;  3RZD H;  1EWI A;  1WFQ A;  2AMC B;  1Z9F A;  1PH2 A;  3GTP H;  4A3B H;  2HHH L;  1XJV A;  4GKJ Q;  3GTL H;  3HFZ B;  2D62 A;  3UE0 A;  1A63 A;  1UWV A;  2UUC Q;  2KEN A;  4AH6 A;  1TXY A;  4A75 A;  4TQU S;  2N8N A;  2IX1 A;  4JC0 A;  3PGZ A;  4X62 L;  3HKS A;  1N36 L;  3J7Z C;  2JQO A;  1XPO A;  4JV5 Q;  1HNW L;  2EQS A;  2AWN A;  4JI8 Q;  1Q7Y C;  3HOU G;  3RLF A;  4YCV A;  2V1C C;  4JI7 L;  3CPW A;  3F2D A;  1EOV A;  2E5L Q;  2YTY A;  4OX9 L;  1RL2 A;  3A5Z B;  1TWH H;  4RG1 A;  1J5E L;  4A3G G;  4DR4 Q;  4MNO A;  1B70 B;  3ULL A;  1Y14 B;  1HNX Q;  4BBS H;  5IY0 A;  4MTN A;  2AWO A;  2ZJR A;  3OW2 A;  4LF6 Q;  5GRO A;  2ES2 A;  1PH1 A;  4LF8 L;  3DM3 A;  3KOJ A;  4DV7 Q;  4GOP A;  2BA0 A;  4DV2 Q;  2VQE L;  3S1R H;  1PH5 A;  5HY6 A;  4JI3 Q;  3KFU A;  1YVC A;  4DPG A;  1SFO H;  2MQH A;  4DR2 Q;  3NEL A;  2LXJ A;  4A3I G;  2JE6 I;  3CCE A;  1CKN B;  3ICE A;  3K7A H;  3I55 A;  3CCR A;  2GVA A;  4KHP L;  4YWK A;  4GLX A;  5HGQ A;  1VQK A;  4KHZ A;  1N8R C;  4LF5 Q;  1GD7 A;  2E2I H;  3K7U C;  4BA2 I;  1B7Y B;  3M4O H;  3J81 j;  2VQF L;  4LFB L;  1PH4 A;  1V1Q A;  3I2Z A;  4QY7 A;  5JJL A;  3KYH C; 
#chains in the Genus database with same CATH topology
 4RCN A;  3GTG H;  4JYA L;  3RZD B;  1PXU A;  1S72 A;  2RDF A;  4DK6 C;  3HGB A;  4A3I B;  2HHH Q;  4A3B B;  3D6W A;  3GTL B;  3VR2 A;  2CW0 D;  5JEA J;  2B2V A;  5CV4 A;  2Z1C A;  3EA6 A;  1N36 Q;  1AW7 A;  2XVS A;  1CZW A;  5C0X H;  3M7G A;  4JW0 A;  3OTO L;  2ZM6 L;  4GZY C;  2XIW A;  1GUN A;  4OX9 Q;  1UEA B;  3VYU A;  4AIM A;  1KDB A;  4B3S L;  2R7D A;  4HCE A;  1W6K A;  3OWF A;  3S1R B;  1S4Z A;  5JJI A;  1RJT A;  2OQ0 A;  2HCC A;  3VYR A;  2PMZ E;  5KYI A;  1TU2 B;  1SFO B;  4JI6 L;  2R92 H;  3E9I A;  1TWC B;  2K5W A;  3FKI H;  3CC7 A;  4R4O A;  1SBB B;  1JWM D;  3K7A B;  3TP7 A;  5ELN A;  1F2Z A;  5A2Q E;  4ILW A;  2L11 A;  4EVO A;  5C0X G;  2NN6 G;  1PV4 A;  5K36 H;  4LFB Q;  1L0W A;  3CF5 A;  3NUC A;  4A3E H;  3STB D;  3S15 H;  2KHJ A;  5CBE E;  2GVB A;  4K6L A;  2QA4 A;  1KLU D;  2PI2 E;  4DUY Q;  1XNQ Q;  3HOW B;  4LUZ A;  4LK1 C;  5E4X A;  2EY6 A;  3J81 E;  4ZLT F;  2UXB L;  1KAB A;  4FF4 A;  2PW7 A;  1MSG A;  1KRS A;  3KJO A;  1Q12 A;  4A3M G;  2L9H A;  1FL0 A;  4DGZ A;  4GOP B;  3D4W A;  1YIT A;  4DUZ L;  1Y8P B;  2N55 A;  1L1O C;  1D2B A;  1CQV A;  2DY7 A;  3Q22 A;  1K9M C;  1CZG A;  1OXS C;  3VDY A;  1LT3 D;  2FMC A;  5TSS A;  2F0E A;  1G2S A;  3MFY A;  3RZO B;  5GAG C;  5C3E H;  1PTO D;  5IIF A;  2V4D A;  1SE4 A;  4KLK A;  4PZ7 A;  4V19 0;  2UXC Q;  2K6A A;  4DR1 Q;  3HOV H;  3S24 A;  4FO2 A;  2I0Q A;  1EZ8 A;  3T1H Q;  2Z0S A;  5I6W A;  2EY1 A;  2R6G A;  2HUG A;  3CP0 A;  5EBD A;  1Y1V H;  4X6A H;  3PQI A;  2B2U C;  2NBF A;  4A3D B;  4L5R C;  1SNM A;  1SYB A;  3P20 A;  1C7Y A;  1IW7 C;  1N9W A;  2CVR A;  3MWY W;  2VXW A;  5ELO A;  2EYO A;  3W5O A;  5JEA H;  1ESF A;  4M1U B;  5JAV A;  1D5Z C;  2EYP A;  4K0K L;  1YBY A;  2NZO A;  2WV6 D;  2FJ2 A;  4CJ0 B;  1HTP A;  3OYY A;  5ELE A;  3S2D H;  2O5J C;  2BDN A;  2K50 A;  1NJI C;  1Q8I A;  3SDZ A;  1Y1V G;  1ASY A;  1FNV A;  2LMC B;  1MJC A;  4JI5 L;  3Q0A A;  1TWA B;  2RDG A;  1S5F D;  3I7F A;  4XT1 B;  2XWB B;  2XWJ B;  1ML0 D;  5JEA G;  3VR3 A;  5C3X A;  4F8M A;  3QIA A;  4FF2 A;  1WVL A;  5EPL A;  1Y1W H;  1TS3 A;  3CQZ H;  2AKW B;  2B2W A;  1KIX A;  1TS4 A;  3B6Y A;  4NW2 A;  3K59 A;  4HTH A;  4K5V A;  1WD1 A;  5C4J H;  3M3Y H;  1EQR A;  4DNR B;  2EY2 A;  1LTT D;  1O7I A;  4JI1 Q;  1H9S B;  5IP7 G;  1STA A;  4CKE A;  2HD3 A;  1EZ6 A;  1HTL D;  4DV4 L;  3H6M A;  4XIG S;  3ULP A;  3KJP A;  3NHH A;  4FXG C;  4LFC Q;  3TP6 A;  2R93 G;  4OIJ A;  4GKK Q;  5KND A;  4LJZ C;  5IWA L;  4YY3 Q;  4IUT A;  3WOF A;  4DV0 Q;  3UDI A;  1Y1W G;  3JC6 6;  1JB3 A;  5IOC A;  4CJ2 C;  3URY A;  1JB7 A;  1NR2 A;  1A3U A;  1IYU A;  3ZJY C;  3I70 A;  2BA1 A;  4TSS A;  2UU9 Q;  1JC7 A;  2D0P A;  2L0C A;  1I6H H;  3K0Y A;  3CC2 A;  1Q1E A;  3E0J A;  1E1T A;  2MHV A;  2J4X A;  5FO8 B;  1C0A A;  3J80 c;  4G7H C;  4L6T B;  4C56 C;  1BXT A;  4V0B A;  1XYI A;  3U58 A;  1XPR A;  2HCI A;  2HT1 A;  2L12 A;  3FMC A;  2M00 A;  1R4Q B;  3K81 C;  4P2C B;  2IL8 A;  4GNX B;  1N33 L;  3OMG A;  3GTK B;  1GHJ A;  4YCU A;  3MVV A;  5KGU A;  3PUY A;  1AE3 A;  4RHR A;  4AQY L;  2A6E C;  3HKZ B;  3SEB A;  5IGB A;  1IBL Q;  3AMU A;  2IY5 B;  2R92 B;  3HZX A;  4PZ6 A;  4JBK A;  3AU7 A;  3GTQ H;  1YIJ A;  1KDC A;  2MPM A;  1DM0 B;  1LT6 D;  3J80 i;  3S9W A;  3K5O A;  1UAP A;  2IPK D;  2OQK A;  3BJU A;  1TVX A;  4NXM L;  1IKM A;  1HZB A;  3HOY B;  3KF6 A;  3TRE A;  2JEA I;  2PNR C;  1LM0 A;  2F0G A;  3ND9 A;  2PQA A;  1EYG A;  1PYB A;  2Y0S G;  1VQF A;  4DK3 C;  4KKU A;  2EJF C;  4HJ9 A;  3I4N H;  1XWE A;  1SRU A;  3CRL C;  3V96 A;  2ICI A;  4A3K G;  1IKL A;  1Y8O B;  5IYB G;  1CKO A;  4QIW B;  1E24 A;  4DNT B;  2EDG A;  5M3M B;  4FXD A;  1D1I A;  3FDT A;  5FLM H;  3AYH B;  3PUZ A;  4DV3 Q;  1NE3 A;  4B3M L;  4JI0 Q;  3VA7 A;  2OT2 A;  4XQN A;  1AP0 A;  1GUW A;  1MBY A;  5DEH A;  1KNE A;  2RHQ B;  1I4Q A;  3I4N G;  1X54 A;  4B3T L;  2JSO A;  2SNM A;  4LFA L;  4JI2 L;  5I4D A;  3NWS A;  1PHJ A;  1SR3 A;  4XXE A;  2VB2 X;  3V2T A;  4X3U A;  1VQC A;  5FLM G;  3OIP A;  3N6R A;  2M9V A;  2IX3 A;  1PH8 A;  1DJR D;  1ICF B;  4GLV B;  1VQB A;  3W3A A;  5C44 H;  4DR3 Q;  4GN3 B;  1AEX A;  1B44 D;  2MO0 A;  2WAC A;  2E74 C;  5CV8 A;  3K80 C;  2AQ1 B;  3A7L A;  1CFM A;  2YTX A;  4JBJ A;  3DLL A;  2EJG C;  4FNF A;  2Q2U A;  4HCS A;  5M5Y H;  1B3A A;  2VUM G;  4OHJ A;  4O2D A;  1J9O A;  2VW9 A;  1EYC A;  1Z47 A;  3IAY A;  1KAW A;  2K1B A;  2PO4 A;  1XNR Q;  5IGD A;  1JWS D;  2NVX H;  3AEV A;  3MEH A;  1RCV D;  3F2B A;  3DWQ A;  2CCZ A;  3HOX H;  5LHY 1;  1JOQ A;  3JAM c;  3RLO A;  2K01 A;  2F0H A;  1KD1 C;  3I8Z A;  3CQZ B;  2MUY A;  2ZTC A;  2F0W A;  3GO5 A;  3J7A 5;  1QZH A;  4DV7 L;  3TZU A;  1X3P A;  4DV2 L;  2F0F A;  2B2T C;  2NWG A;  1M4V A;  1TY2 A;  2PMZ B;  3D31 A;  2DJG C;  5EJW A;  5L37 A;  5FJ8 G;  5C4J B;  5CV7 A;  3M3Y B;  4DR2 L;  1L1O A;  2MFI A;  3W1G A;  1IBM Q;  1F9S A;  2Q2H A;  1SMX A;  1GJX A;  1HNZ Q;  2PQE A;  3RN5 A;  4MTK A;  4UDU C;  1S5E D;  2NUC A;  2IT1 A;  2JA6 B;  4HAE A;  2JA9 A;  1M90 C;  3JAM i;  2WIN B;  3G71 A;  4ZK9 B;  2YTV A;  1NY4 A;  4LF7 L;  4QL5 A;  3RZD H;  2AMC B;  1IW7 D;  2BDO A;  2J0T D;  4A3B H;  1SE3 A;  4F7X A;  3GTL H;  3UE0 A;  4C3I B;  1A63 A;  1LO5 D;  2B2U A;  2K33 A;  1TXY A;  2KEN A;  4AH6 A;  1LTS D;  2LKV A;  3C3L A;  4JV5 Q;  1HNW L;  2F03 A;  1RKN A;  4JI7 L;  3A5Z B;  4DAY A;  4QUC A;  5JOB A;  1JWU D;  1B70 B;  1Y14 B;  1W6J A;  2Q8R E;  5JPN C;  3QOJ A;  1PH5 A;  3S1R H;  3MXU A;  3KFU A;  4DPG A;  3T51 B;  2EE1 A;  1HRJ A;  1SFO H;  2RA4 A;  4A3I G;  3CCE A;  3A54 A;  2RVL A;  3K7A H;  3I55 A;  5J1Z A;  2GVA A;  3CCR A;  2QKI C;  4GLX A;  2Z8L A;  4K2K A;  5HGQ A;  3RD4 A;  3HOU B;  1D6E C;  4QCL A;  2B8F A;  1B7Y B;  1R4P B;  3L9A X;  4NDX A;  4BS9 A;  1BCP B;  2VQF L;  1V1Q A;  3R93 A;  3I2Z A;  1PZI D;  2F0S A;  1QWY A;  1NNX A;  5A2Q L;  3LNN A;  2F0M A;  2OCE A;  1BDO A;  2K5V A;  1D8L A;  3QB3 A;  4DV6 L;  2EYJ A;  2OEO A;  4ZKC B;  3ONA B;  3MHB A;  5T1I A;  1TS5 A;  4H44 C;  1SYF A;  1Q82 C;  1I94 L;  4U67 3;  5IT9 c;  4DR7 L;  2GA4 B;  2DUD A;  4RGM A;  4KD4 A;  5J3B A;  3DM1 A;  4DV5 L;  1JR0 D;  1ZKO A;  4MN3 A;  1YNX A;  1VQP A;  5I2Y A;  4EQ5 A;  2SOB A;  4AYB B;  3HRZ C;  1SDF A;  3SR1 A;  5BN3 A;  4XQJ A;  2VQE Q;  4BXX G;  5KNC A;  1WTW A;  2HQE A;  5DLQ E;  1SE2 A;  1Q8K A;  3HOW G;  4P73 A;  3RZO H;  4DR5 L;  5EQ0 A;  3GV3 A;  4KHP Q;  1VQG A;  3WDN A;  1BKB A;  1O78 A;  2KBN A;  2PPB C;  1QJO A;  2E2I B;  4UY8 C;  3QR8 A;  4HMJ A;  1ILQ A;  1KRT A;  2P5Z X;  1JOK A;  2KCC A;  1YZ6 A;  2IX0 A;  1N34 L;  4M8A A;  4JYA Q;  4OO1 H;  2Q8I B;  3A8J E;  4LW1 A;  4KJO A;  2A6E D;  4A3D H;  1HR0 W;  4PQX A;  5G3L F;  3RN2 A;  2A68 C;  4KY5 A;  4IPG A;  2X6L A;  1L2F A;  1JJ2 A;  4PMB A;  2EXZ A;  1QNK A;  2JEB I;  5C44 B;  2CH4 A;  3GDE A;  3PO3 G;  1CHQ D;  3OTO Q;  1F9Q A;  2ZM6 Q;  4NKL A;  2EYM A;  2WP8 J;  3DEO A;  3IKJ A;  3J80 E;  4A3L H;  1PVO A;  2ZXR A;  4B3S Q;  2RDH A;  5BR8 L;  5M5Y B;  3NP8 A;  1VQL A;  1Q86 C;  3KK7 A;  4IQZ A;  3S14 B;  1STE A;  1TWA H;  4C1N I;  4A3D G;  1BR9 A;  1SND A;  2BOS A;  4JI6 Q;  3FHW A;  4OXP A;  4YIJ A;  4HJA A;  3NPP A;  5D14 A;  3U9O A;  2JK8 A;  1AFP A;  2KEC A;  4A3L G;  2MNA A;  2B29 A;  2ID0 A;  4GLA C;  1NTG A;  1LTG D;  5ELC A;  3PIP A;  1G2T A;  4A76 A;  1WJJ A;  1SN8 A;  3CCU A;  4HIM A;  2KJX A;  2UXB Q;  2NVQ H;  1MIU A;  1AZQ A;  3I72 A;  3PCO B;  4LF9 L;  5EGT A;  4YCW A;  3ER0 A;  1ONL A;  1YHA A;  1U9R A;  1DOL A;  3CCS A;  1A62 A;  1U5K A;  5LMU L;  1A15 A;  4Y52 H;  3LWU A;  1ILP A;  5KEE A;  3T16 A;  2C9O A;  4GOP C;  3DWA A;  1LTB D;  4BY1 H;  5DM6 3;  1BO0 A;  1GHK A;  4DUZ Q;  4P71 A;  1SMY C;  3LWE A;  4Y7N B;  2EOT A;  3D0F A;  1BQQ T;  4GN5 A;  1DCZ A;  2XGT A;  1NSN S;  1SLJ A;  4ODG A;  3V05 A;  1CM9 A;  1E2Z A;  1QUQ A;  3GQB A;  1VMC A;  3K58 A;  5IP9 H;  2YV5 A;  2JP1 A;  4J8Q A;  4KN4 C;  1STB A;  1CUK A;  1E2W A;  2O2L D;  1U0L A;  2EYF A;  3C1E A;  3NTI A;  5CYU A;  1A6X A;  2KUM A;  3A55 A;  3NEN A;  4OON A;  1M1K C;  3OHX C;  1L0X B;  2ENB A;  1K8O A;  2N49 A;  3GTK H;  3M9B A;  3R8B A;  1X56 A;  1O7L A;  2R7Z B;  2LSS A;  1PTO F;  1ZYR C;  3KF8 B;  3UDX A;  4RFB A;  1NAP A;  1TII D;  1HQR D;  5BN4 A;  1G8Z D;  1VQJ A;  4KV6 A;  1FJG L;  1TKW B;  1DGS A;  4K0K Q;  3TP8 A;  3U50 C;  1I4G A;  1GUO A;  1LLR D;  2H4O A;  3U4Z A;  4FP5 D;  3M85 A;  1WTQ A;  1K8A C;  3HOY H;  1FYC A;  2HQL A;  2I46 A;  2RQX A;  1QB5 D;  1X32 A;  2G5D A;  3CAM A;  2NB0 A;  2B2T A;  1PRT B;  4JI5 Q;  3X3M A;  3P75 A;  5DAU A;  5EKK A;  3I91 A;  1PYS B;  4K8I A;  3HKZ G;  3BZK A;  2E2H B;  4WJ4 A;  1V1P B;  1MSH A;  2R92 G;  1K0S A;  3FKI G;  3CCM A;  2FIN B;  5FLX c;  2VL6 A;  1LAC A;  3CCQ A;  1MKH A;  5M3M H;  2WB1 E;  1VQD A;  1K8G A;  4FVM A;  3JAM E;  1K0R A;  2Q8T A;  5K36 G;  1IL8 A;  2ZXO A;  4A3E G;  3PO2 B;  3HOY G;  1PA6 A;  1BBU A;  1EIY B;  2O5I C;  4BBR B;  5C6A A;  1H9R A;  4DV4 Q;  2QGQ A;  1E1O A;  1N32 L;  3OWE B;  4H13 C;  3T4A C;  1LTL A;  4O42 A;  3KDF B;  1LUZ A;  1AN8 A;  3FVQ A;  2AHO B;  5IWA Q;  4A93 B;  4IPD A;  2ZT9 C;  1XPU A;  2VNU D;  2OTJ A;  1XMO L;  1DXM A;  5LL6 S;  4G7O C;  4FYD A;  2F0I A;  3AQQ A;  1EYD A;  1LTR D;  4UPA A;  1S40 A;  3IFT A;  3BVM A;  1LYL A;  2Y0S E;  1JMC A;  4I65 A;  2C5C A;  3NXW A;  5C3E G;  4OO1 I;  5E7N A;  4F88 A;  2WKD A;  4PV1 C;  3HOV G;  1VS0 A;  4R4T A;  1K8M A;  3NQT A;  1U4R A;  1JOR A;  3N52 A;  3MXG A;  4GNX C;  1N33 Q;  2M2L A;  3I4O A;  2B63 H;  1E3P A;  4HJ8 A;  3NE5 B;  3F8T A;  4NPS A;  3UE1 A;  4AQY Q;  4DR6 L;  5JVH 3;  1EQV A;  2EYH A;  2JXM B;  1SNP A;  4K2L A;  1AZP A;  1D5M C;  2IHF A;  2RCN A;  4IUQ A;  4OEM B;  2FXQ A;  3F2U A;  2F1M A;  4JI4 L;  1FR3 A;  4YWL A;  2ZXP A;  3IRB A;  5DM7 3;  3S17 B;  4NXM Q;  1SE8 A;  1E22 A;  1W3S A;  1IL2 A;  5I2X A;  4EX5 A;  3C46 A;  2F0Q A;  1QNU A;  2KVM A;  4G57 A;  1EY7 A;  5FLX L;  2NVQ B;  1S5B D;  2OTL A;  1EQQ A;  2NVY B;  4KKT A;  1EY5 A;  5DNF A;  2JA6 H;  5M5X B;  1OXU A;  4P75 A;  1J5E Q;  2LFN A;  5IT9 E;  3NWT A;  4N8X 1;  4R9W A;  3QOL A;  3R2I A;  2A68 D;  4BY1 B;  2YU9 H;  1VQ5 A;  4RAU C;  4B3M Q;  4C3I H;  4QQB X;  1UNS A;  1STG A;  3PF5 A;  3TP5 A;  1ENF A;  1TWF H;  5EPJ A;  1FGU A;  4JI8 L;  4A3F B;  1E2V A;  3KLW A;  4ZQ3 A;  1X3F A;  2QDL A;  1I50 B;  2QIL A;  2E5L L;  1QVC A;  4IJL A;  4LFA Q;  4B3T Q;  1Z6H A;  2JA6 G;  1HNX L;  1U4M A;  1MHW C;  4JI2 Q;  2EYL A;  2AUJ D;  1SEB D;  4LF6 L;  1RDP D;  4ZAI A;  4DXF A;  1X3E A;  2J7Z A;  4XYQ A;  4UP8 A;  1TR5 A;  1X3G A;  1CHP D;  4BA1 I;  1VDZ A;  2XN9 C;  4C3I G;  1G6Z A;  2F0N A;  1TT2 A;  2JA5 B;  4EQO A;  3HOU H;  1HQM C;  5ISR A;  4LF5 L;  1P8L A;  5E3F A;  2JA8 B;  5KNB A;  3VR6 A;  1F2Y A;  1GVP A;  2NYZ D;  3A56 A;  3H94 A;  2NN6 I;  1YJW A;  5CMD A;  2WAQ E;  5JJK A;  1PH2 A;  3HOZ B;  3O13 A;  3HFZ B;  2D62 A;  1A3T A;  4A75 A;  4TQU S;  1PLF A;  3OSO A;  1SXT A;  3HKS A;  1MGS A;  2NZ1 D;  2JQO A;  3J7Z C;  1WTX A;  3E5S A;  3HOU G;  3RLF A;  2V1C C;  1LT4 D;  3F2D A;  1H9J A;  2A6H C;  5C4X B;  2YTY A;  5D3I B;  1J5E L;  4C2M B;  1L0Y B;  4BBS H;  4OIK A;  1SMY D;  4MTN A;  2ZJR A;  4LF8 L;  5GRO A;  4RKB A;  5IGC A;  1PH1 A;  3DM3 A;  4DV7 Q;  4GOP A;  2BA0 A;  4DV2 Q;  2K03 A;  2Z4H A;  1DYQ A;  1YVC A;  1STN A;  5CGK A;  1NR4 A;  3DUZ A;  1O80 A;  4DR2 Q;  1SSO A;  5IGF A;  3RUZ A;  1VQK A;  2OF1 A;  4KD3 A;  1GD7 A;  4ZRZ A;  3KBG A;  4RKL A;  2E2I H;  4BA2 I;  1HA5 A;  4A3G B;  1EIH A;  5C4H A;  1PH4 A;  2LS0 1;  4QY7 A;  5JVG 3;  3K6O A;  2PW5 A;  4O1N A;  1EEF D;  1KDA A;  4LMQ D;  4AYB G;  2ALY B;  3IL8 A;  4LF7 Q;  1II3 A;  1ZYR D;  2DNE A;  3RLN A;  3J7Y W;  3PIP 3;  1DOM A;  4HJ7 A;  2R61 A;  1HNW Q;  1QE6 A;  1F2L A;  2OXP A;  4ZUJ A;  2UXD L;  4JI7 Q;  3NBH B;  2K05 A;  2RBM A;  1BUV T;  3VYT A;  1EWH A;  1I6V C;  1TWH B;  5NUC A;  3RR5 A;  2UUB L;  1PDQ A;  2MJ8 A;  3S14 H;  1WYD A;  5ELD A;  3S16 H;  1B50 A;  2F0L A;  3EVQ A;  1SNO A;  4XYO A;  1V8Q A;  1FVI A;  4LNQ A;  1PH3 A;  2B63 B;  1K3R A;  4DNI A;  1EY4 A;  1UUP A;  2K14 A;  1HH2 P;  1NMF A;  3BDO A;  1Q1B A;  1UE7 A;  5C44 G;  3TDQ A;  2B8G A;  2MO1 A;  1RD9 D;  5EAY A;  1BBW A;  3W1B A;  4CDD C;  3T1Y L;  1TY0 A;  4CDF C;  3PMF A;  3MTS A;  2VQF Q;  3TRZ A;  2K04 A;  2DN8 A;  1BCP C;  5GQO A;  1HCZ A;  4R8N A;  3J81 c;  2E8G A;  2IWH A;  1K73 C;  2Q2I A;  4DV6 Q;  5CC4 A;  2KCM A;  1HZ9 A;  4UP9 A;  1EL0 A;  1G6P A;  4KN7 C;  4R1J A;  1QOH A;  1BF4 A;  1EOT A;  5M5W B;  1FNU A;  5IYD H;  1SJH D;  3G6E A;  2EXD A;  1I94 Q;  1H9S A;  1WI5 A;  2R93 B;  4DR7 Q;  1JE4 A;  3I4M B;  2JA7 B;  3HOX G;  4ABN A;  1T9H A;  2PNH A;  3GTM B;  2I5H A;  4DV5 Q;  3SHL A;  3MAQ A;  1HR0 L;  1XTD A;  4MZ9 A;  1EY6 A;  2LY7 A;  3BU2 A;  3KBX A;  3GTJ H;  3D3R A;  1IYV A;  1JOO A;  4NP5 A;  4Y7N H;  3J81 i;  1KHI A;  2YU9 B;  2BH2 A;  4DR5 Q;  3I4L A;  5IYD G;  1TWF B;  4JG2 A;  3WWV A;  2IW3 A;  2XRQ D;  2DY8 A;  2WB1 B;  3CCJ A;  3S1M B;  2D2C C;  4EGV A;  3OMC A;  1A2T A;  1SYC A;  1GKH A;  1QCB D;  4BWG B;  1SRO A;  2F0U A;  4B3R L;  1K83 B;  1CQF A;  1X9N A;  1HUN A;  2F3I A;  1N34 Q;  2PYK A;  4DK1 A;  3CPF A;  1SYD A;  5ELB A;  4GNX A;  2R7Z H;  2L5T A;  5KYL A;  2AQ3 B;  4A3B G;  3TS2 A;  1W2B A;  3SGI A;  1WOC A;  5CV6 A;  4DV1 Q;  4H0L C;  4A3J B;  4HMI A;  3J7A F;  3BVG A;  4ME3 A;  4PZ8 A;  1RTN A;  2FFK B;  5BR8 Q;  4C3J H;  2BE5 C;  1BNZ A;  1ZEQ X;  3S2H H;  4NXN L;  5ELF A;  4X66 L;  2EVB A;  3QO2 A;  2Y0S B;  3NK9 A;  1UE6 A;  2E2H H;  4J1M A;  3BDL A;  3S1N B;  1A8V A;  2C35 B;  4DF7 A;  4IJH A;  3EIV A;  4A3C H;  4A3K B;  2XTI A;  1G29 1;  3J81 L;  3I56 A;  1A3V A;  2ZTE A;  1RIP A;  4OWX B;  3UDG A;  3H3V I;  4EQP A;  4BBS B;  4R4C A;  3PO2 H;  1EU3 A;  2B2Y C;  3HS0 C;  1OO9 B;  4TVA B;  3RNU A;  4KI0 A;  2KED A;  2F4V L;  4KY6 A;  4BBR H;  4N9P A;  3QWN A;  1BOS A;  5IYC H;  1HJP A;  3H0G B;  1NUC A;  4LF9 Q;  2JYO A;  4YHH L;  2FMM A;  3AFP A;  1I4R A;  1KTK A;  4A3C G;  2VY3 A;  2SNS A;  1YHQ A;  2N88 A;  5LMU Q;  3K8A A;  4A93 H;  2CFM A;  3OIQ A;  4HID A;  5JJZ A;  3SE0 A;  1H95 A;  3CXC A;  1S5C D;  1WTH A;  5AJ3 L;  4K14 A;  3PSI A;  1OXT A;  3GTO B;  2QDB A;  4BBR G;  3CMA A;  1ET9 A;  5IYC G;  1X6O A;  4XQQ A;  2OWO A;  1PTO B;  1EWC A;  1VQO A;  5J22 A;  4IUR A;  4UP7 A;  4DV1 L;  1F77 A;  1SYE A;  1JT8 A;  2KHS A;  2VUM B;  3P7J A;  4X64 L;  4A93 G;  2HDL A;  1JJC B;  1TQO A;  4CHT B;  3F2C A;  3IFD A;  3VA5 A;  4IUU A;  1ENC A;  1XMQ L;  3FRP B;  2HIV A;  1JIC A;  4HIK A;  2KQ3 A;  1PH6 A;  2E76 C;  4OO1 G;  2CH4 W;  3S16 B;  4R8I A;  4LWC A;  3CRK C;  4IUN A;  2A6H D;  2H1E A;  4KJN A;  1FJG Q;  5M3F B;  1H9K A;  2ASB A;  2CWA A;  4IUV A;  3E9H A;  3A7A B;  3S17 H;  2RSN A;  1VQ6 A;  1CSQ A;  3MFG A;  1WD0 A;  1F2M A;  4OL7 A;  1PFM A;  2B3G A;  4RHS A;  4QB4 A;  3TBI B;  1B3Q A;  4RMF A;  1PRT C;  2E2D C;  3EFX D;  1D1K A;  2JN4 A;  3K5L A;  1BCP F;  4R4Q A;  2NVY H;  3CME A;  2BH8 A;  4K6D A;  1E7Z A;  5M5X H;  2NVT B;  4H7B A;  5LL6 X;  4DKA C;  1ET6 A;  4X65 L;  2WAQ B;  1PH9 A;  1IBK L;  3BVZ A;  4JK1 C;  5I6Y A;  4HED A;  5GAD C;  3DWP A;  1KXL A;  3U9S A;  4L5S A;  1VQ7 A;  3GTJ B;  3QG1 A;  2EJM A;  2PI2 A;  3P1H A;  1P16 A;  3UI2 A;  1S5D D;  3E0E A;  4LF4 L;  1JJG A;  2RF4 A;  1GXD C;  4A3F H;  2XRS D;  4LAA A;  1N32 Q;  2ICE C;  1I50 H;  1TWG H;  1ICW A;  4K5W A;  4XDX A;  1LT5 D;  3M7N A;  5IE8 A;  4ALP A;  1RHP A;  4CDC C;  1S3O A;  1CSP A;  1OXX K;  2X69 A;  2SEB D;  3CCV A;  1PFS A;  4BY1 G;  3G7L A;  1STH A;  3M4P A;  1XMO Q;  1VF5 C;  1B2T A;  4C1N K;  2PZU A;  2PZW A;  2JA5 H;  3S1Q B;  4RGN A;  1PYW D;  2NN6 H;  4A3F G;  1C48 A;  1U4L A;  1BCP D;  3SK6 A;  2JA8 H;  3CHB D;  5IP9 G;  3I73 A;  4DAV A;  4I7A A;  5T1G A;  4CDE C;  3TS0 A;  4K8J A;  2KEE A;  4ULL A;  2QEX A;  4ME5 A;  3LGJ A;  2UUA L;  2Z6K C;  1F9P A;  5LMN L;  3MXN A;  2A69 C;  3HOZ H;  4PNY A;  4FDB A;  4C3J B;  3NSW A;  3R2T A;  4HJ5 A;  3ZYY X;  4FF3 A;  4GKJ L;  3S2H B;  1GUS A;  2UUC L;  1PZK D;  4A3M H;  4DR6 Q;  2JA5 G;  2A8V A;  1A2U A;  2I5L X;  2F0T A;  5C4X H;  4FXK C;  4DR4 L;  2NTS A;  4C2M H;  2JA8 G;  3KF6 B;  1ZXT A;  4JI4 Q;  2AUK A;  4BY7 B;  4L5Q A;  2K5N A;  2NTT A;  1EIG A;  5COR A;  3CW2 C;  4JI3 L;  4G7Z C;  1HFN A;  2PQA B;  2XNA C;  3HOZ G;  4IFD I;  4Z9C B;  1AH9 A;  2CWP A;  3Q24 A;  2G9D A;  4IUP A;  2F0O A;  2H5X A;  5C3W A;  1SYG A;  3A0J A;  2F3W A;  3MA2 B;  4FF1 A;  5CV5 A;  2QF7 A;  2ZJQ A;  4A3G H;  5C4X G;  1XX8 A;  2K52 A;  3GD7 A;  1OXV A;  1WCM B;  3PUV A;  5M3M G;  5D65 A;  3M4Q A;  1KC8 C;  1LTA D;  1F9R A;  5KIX A;  1WFQ A;  1Z9F A;  1D5X C;  5C5L A;  3D4R A;  3GP7 A;  3TME A;  2HHH L;  4WJW A;  3D4D A;  1UWV A;  2N8N A;  4JC0 A;  4WFN 3;  3FPU B;  1N36 L;  1O7Z A;  1XPO A;  3PO3 B;  1HXY D;  2EQS A;  4JI8 Q;  1Q7Y C;  5C4Z A;  4YCV A;  1EOV A;  2E5L Q;  4OX9 L;  1HA6 A;  1TWH H;  1R9T B;  4A3G G;  1B53 A;  2BE5 D;  4MNO A;  3ULL A;  1HNX Q;  3ND8 A;  1KLG D;  4LF6 Q;  1EYA A;  1SNC A;  3KOJ A;  3VR4 A;  1E0B A;  2MQH A;  1SJE D;  3MC0 B;  1VF7 A;  1ROD A;  4DAP A;  1N8R C;  4LF5 Q;  4EQN A;  4KKS A;  5EKI A;  3J81 j;  1SNQ A;  4LFB L;  2Z6B A;  1WTP A;  1KNA A;  4C3H B;  2AQ2 B;  2EPB A;  2F0J A;  4JOI C;  2VS1 A;  4AYB E;  4DUY L;  1XNQ L;  2B2Y A;  1KL9 A;  5IP7 H;  3GTP B;  2YYZ A;  4NMZ A;  3H91 A;  3ITP A;  5M5W H;  5LMN W;  1NMG A;  1YNN C;  3DHQ A;  2B63 G;  5FO7 B;  1FNW A;  2Z4I A;  4IAL A;  2R93 H;  4GS3 A;  1EY9 A;  4OEL B;  1VCI A;  2JA7 H;  3I4M H;  1CKN A;  2FHT A;  3GTM H;  4L8J A;  2O4X A;  1BBX C;  1QG7 A;  1IHZ A;  5IGE A;  1PRT F;  5COY A;  4DAM A;  3W2D A;  1L1O B;  1YNJ C;  4DXG A;  4LF8 Q;  1GUT A;  1RTO A;  4G4K A;  2L55 A;  4CGY B;  1EUJ A;  1I4P A;  3UDF A;  1DON A;  1GO3 E;  4KMU C;  3F1Z A;  3Q23 A;  4RH6 A;  1OTC A;  1B8A A;  4IO9 A;  2UXC L;  5HUR A;  1EIF A;  1Q81 C;  1D7Q A;  3E3X A;  4DR1 L;  1EQT A;  3BZC A;  4X3S A;  3S1M H;  1HPC A;  3I4M G;  2JA7 G;  1TWG B;  2QW7 A;  4MHE A;  1KAA A;  2L15 A;  3M4O B;  1DZ1 A;  2NZH A;  3PIO A;  1PFN A;  1K83 H;  3T1H L;  1GOZ A;  3TN2 A;  3I3C A;  2B39 A;  5FO9 B;  3GTG B;  4R4I A;  5IOD A;  2ATW A;  3TSS A;  1ENA A;  5JPM C;  4JBW A;  2GN5 A;  5FKA C;  1PZJ D;  2VZA A;  5AFW A;  4JPB W;  2X6G A;  4RCO A;  4JBM A;  4DAY B;  3R3O A;  1V9P A;  4PMC A;  2K5H A;  1WTR A;  1G91 A;  1X55 A;  3KF8 A;  4UAI A;  4A3J H;  5FK9 C;  2WB1 G;  2UXD Q;  4KTA A;  1I5F A;  1BVS A;  2A74 C;  1CKM A;  2K5Q A;  2R7F A;  1J6Q A;  3BYY B;  2F3V A;  1HFG A;  3MXP A;  3BS1 A;  1T5E A;  5C0X I;  2UUB Q;  1FD7 D;  1PRT D;  3NQI A;  4TKO B;  4H02 A;  3U4V A;  1Y8N B;  3A8K E;  3A74 A;  1I3Q H;  2I07 B;  1A0I A;  5H1S E;  1NBW A;  3S1N H;  2K75 A;  3FKI B;  4A3M B;  3H3V H;  3G4S A;  4A3K H;  3PV0 A;  5IYB H;  1CA5 A;  2EY5 A;  5GAH C;  4J6H A;  1V1P A;  1JCK B;  3H15 A;  2MP1 A;  3Q8D A;  3T1Y Q;  4A3J G;  4OGQ C;  4KK7 A;  3EQL C;  1XTC D;  4DFA A;  5CBA E;  4A3E B;  1JQY D;  4HN7 A;  3S15 B;  2Q2T A;  3LX0 A;  1PH7 A;  4POF A;  2QEJ C;  4E6I A;  3MZ5 A;  4JI1 L;  1PFB A;  4IPC A;  4ID6 A;  4X3T A;  2K32 A;  4DN4 M;  3H0G H;  4GN4 B;  1IYJ B;  1CT1 D;  1VQE A;  2E2J H;  4OWT B;  5I9P A;  4LFC L;  2PZT A;  4GKK L;  1MJE A;  4YY3 L;  4DV0 L;  4OWW B;  1MI2 A;  3HP3 A;  3KDF A;  1HR0 Q;  3CCL A;  3VYS A;  4NB3 A;  3C2P A;  4BBS G;  1VQA A;  3T53 B;  2UU9 L;  1C4Q A;  3DMU A;  3GTO H;  2WFW A;  4N8F A;  2JJQ A;  3SK8 A;  5FOB B;  2BCO A;  1V43 A;  5C3E B;  3H0G G;  1PTO H;  5EBC A;  4U68 A;  2TMP A;  3HOV B;  3KUP A;  4N9T A;  4RGT A;  2VUM H;  2KCT A;  4L63 B;  1CK1 A;  1H9M A;  2A69 D;  4LUO A;  2EZV A;  2CHB D;  4B3R Q;  3OOC A;  3DXJ C;  1QVG A;  4IPH A;  3SK4 A;  2Z6K A;  2A5H A;  2K5D A;  1Y1V B;  2K7V A;  3BG3 A;  2CQA A;  2B2V C;  3DEP A;  2SDF A;  3J80 L;  1B4O A;  4LUV A;  2F0P A;  1IBL L;  5E1F A;  1ESR A;  5M3F H;  4IFD J;  2CW0 C;  5D3D A;  3TEH B;  2DNC A;  2IJ0 A;  3L2P A;  3EN2 A;  1X65 A;  1YJ9 A;  1LTI D;  5M9O A;  4UHV A;  1HUM A;  1WTO A;  3L3O C;  5FJ8 H;  3S2D B;  4XTC S;  3CD6 A;  1HZA A;  3BZD B;  3CC4 A;  4NXN Q;  2VB3 X;  4X66 Q;  2F4I A;  2RSO A;  3E6Z X;  2KHI A;  4HIO A;  1X3Q A;  1VQM A;  1J8I A;  2KOL A;  2N3S A;  1B9M A;  3NTH A;  5M3F G;  2NVT H;  3OW7 A;  3H3V C;  3AB9 A;  1I4H A;  4S3S A;  1Y1W B;  5FLX E;  1C8C A;  1QZG A;  1T5X D;  4P72 A;  1VQH A;  4RGO S;  4DV3 L;  3STB C;  4QGU A;  4JI0 L;  2F4V Q;  2MGS A;  1STY A;  2WKC A;  4WOR A;  3PUX A;  2G9H D;  1FGB D;  4ZKB B;  3TZD A;  4JCV E;  3NEM A;  4ZCK A;  4RWS C;  3BYT B;  4CJ1 B;  3NTK A;  4YHH Q;  2WII B;  1IXR A;  2K4K A;  1SAP A;  1CI3 M;  1XXG A;  2RHS B;  2WAQ G;  1CA6 A;  2D9U A;  4PMW A;  3PF4 A;  4YWM A;  1K3B C;  4DA2 A;  1IZ6 A;  4B9W A;  4A3I H;  1Q3L A;  5AJ3 Q;  1EY8 A;  2CKZ B;  1QUQ B;  5EKL A;  1I6H B;  2RKS A;  2F52 A;  3S1Q H;  4DR3 L;  2L1B A;  3A5U A;  4B9X A;  3OPO A;  3G48 A;  3WOE A;  1PTO C;  1JE5 A;  1ASZ A;  2HIX A;  3SK5 A;  3RMH A;  4CKC A;  2D0O A;  3A8I E;  1EU4 A;  4X64 Q;  2ZJP A;  5E4W C;  3ERO A;  3X3N A;  5K5P A;  2XSC A;  4WRD A;  4JOI A;  2DJF C;  1YNN D;  1XMQ Q;  4A4I A;  4POG A;  5CV9 A;  1XNR L;  1TWC H;  1Q46 A;  4HR7 B;  1I3Q B;  1YEZ A;  3TQY A;  1NCV A;  2R7Z G;  4J15 A;  3BDC A;  5A35 A;  1HHV A;  1VQ4 A;  1GM5 A;  2LXK A;  4X3K A;  3FEW X;  2A19 A;  3ERS X;  2R3Z A;  3GTQ B;  3KLR A;  2TSS A;  4IFD H;  1VQ9 A;  2L4N A;  3MXN B;  1YNJ D;  2QCP X;  4BY7 H;  3FP9 A;  4O0A A;  2KA7 A;  1VQI A;  2E75 C;  2ZTD A;  4QJF A;  1G51 A;  4IN3 A;  3NBI A;  2EIF A;  4BXX H;  4RA8 A;  4PG3 A;  1LV9 A;  5GAE C;  3HOW H;  3G6J B;  4C3J G;  1QVF A;  4L5T A;  1V1O A;  4IOC A;  3I90 A;  1IBM L;  2KCN A;  4X62 Q;  3JAM L;  3J7A V;  1HNZ L;  3KLS X;  1I4X A;  3T13 A;  3I4N B;  2E2J B;  2B2W C;  1WCM H;  4IFD G;  4Q5V A;  2A1A A;  2K28 A;  3C1F A;  1YHB A;  1EEI D;  4X65 Q;  4BY7 G;  1IBK Q;  5J39 A;  3EJI A;  3T56 B;  3PO2 G;  5HGT A;  2PCF B;  3PUW A;  4WJ3 M;  2D5D A;  4APV A;  2DGY A;  1RF2 D;  3CKI B;  4KHV A;  4ZYS A;  1Q90 A;  4LF4 Q;  4JV5 L;  5C0X J;  3PO3 H;  4QUF A;  2CQO A;  3HKZ E;  1HZC A;  3L0O A;  4P74 A;  5F2D A;  1LAB A;  3SVM A;  1DOK A;  1R9T H;  4F87 A;  3M4Y A;  1UEB A;  1WCM G;  1EY0 A;  3NBH A;  3AFQ A;  3EBE A;  1KQS A;  1AE2 A;  4QMG A;  3VR5 A;  2F0D A;  1YI2 A;  3GV6 A;  4QF4 A;  4KY7 A;  1GUG A;  1YJN A;  1VQ8 A;  1WTV A;  4K5X A;  2IHE A;  2F0K A;  3H09 A;  3D8G A;  3L7Z C;  1EFW A;  1VQN A;  5EPK A;  3MEF A;  4B08 A;  4Q0F A;  2F0V A;  1EFI D;  3HG9 A;  2A73 B;  3K5M A;  4C3H H;  3K0X A;  1UE5 A;  2I5M X;  4QIW E;  1B9N A;  1UE1 A;  3ULJ A;  5BN5 A;  2UUA Q;  2N78 A;  4XT3 B;  3SXH A;  1C9O A;  3HEJ A;  4IOA A;  5LMN Q;  2HDM A;  3PIO 3;  3FPP A;  4JVZ A;  1EWI A;  5I9O A;  1K28 A;  1Z7T A;  4HSP A;  3GTP H;  2Z9H A;  1Y69 U;  5IGG A;  1XJV A;  3ERQ A;  4GKJ Q;  3CU7 A;  2UUC Q;  2NVX B;  2IX1 A;  4X62 L;  3PGZ A;  1QIL A;  4I7Z C;  1PMR A;  4MIU A;  2AWN A;  4CKB A;  3K57 A;  1B1Z A;  3HOX B;  4CBV A;  3CPW A;  1RL2 A;  1M8A A;  1VMP A;  1MD2 D;  4RG1 A;  4DR4 Q;  5CR3 A;  5IY0 A;  4C3H G;  2AWO A;  3OW2 A;  2ES2 A;  1CTM A;  4JI3 Q;  2VQE L;  1TS2 A;  5HY6 A;  4DU9 A;  4HSV A;  2RCF A;  1U4P A;  1DD2 A;  3NEL A;  2LXJ A;  5IT9 L;  2JE6 I;  5G3L D;  4DK0 A;  1CKN B;  3KLS A;  3ICE A;  4IZ8 A;  4KHP L;  4ZUI A;  4YWK A;  3D6C A;  5KRU A;  4KHZ A;  3Q6S A;  1O7Y A;  3QJY A;  3K7U C;  5C5M A;  3M4O H;  5JJL A;  3K5N A;  4TRD A;  3KYH C; 
#chains in the Genus database with same CATH homology
 4AYB G;  4JOI C;  2VS1 A;  3GTG H;  2ALY B;  4JYA L;  4AYB E;  4LF7 Q;  2OCE A;  2K5V A;  1D8L A;  4DUY L;  1XNQ L;  4DV6 L;  1KL9 A;  5IP7 H;  3RLN A;  1S72 A;  4DK6 C;  2HHH Q;  2YYZ A;  5M5W H;  5LMN W;  1NMG A;  4HJ7 A;  5JEA J;  2B63 G;  1Q82 C;  1N36 Q;  1I94 L;  1HNW Q;  2R93 H;  4GS3 A;  5IT9 c;  3OTO L;  4DR7 L;  1VCI A;  2ZM6 L;  2JA7 H;  3I4M H;  1CKN A;  2DUD A;  2UXD L;  5J3B A;  4JI7 Q;  3NBH B;  3GTM H;  4OX9 Q;  4DV5 L;  1VQP A;  1YNX A;  4AIM A;  4B3S L;  4EQ5 A;  3RR5 A;  2UUB L;  2R7D A;  4DAM A;  4LF8 Q;  1L1O B;  3S14 H;  2VQE Q;  5JJI A;  4BXX G;  1WYD A;  2OQ0 A;  3S16 H;  5DLQ E;  1EUJ A;  1Q8K A;  2PMZ E;  3UDF A;  3HOW G;  4P73 A;  1GO3 E;  4JI6 L;  1FVI A;  4LNQ A;  1PH3 A;  3RZO H;  2R92 H;  3E9I A;  3F1Z A;  1OTC A;  3FKI H;  3CC7 A;  1B8A A;  4DR5 L;  1K3R A;  4R4O A;  4IO9 A;  2UXC L;  4KHP Q;  1VQG A;  5ELN A;  4DNI A;  1BKB A;  1EIF A;  2K14 A;  1Q81 C;  1D7Q A;  4DR1 L;  1HH2 P;  1NMF A;  1UE7 A;  1Q1B A;  2KBN A;  3BZC A;  5C44 G;  3S1M H;  2MO1 A;  5EAY A;  2NN6 G;  5C0X G;  1BBW A;  3W1B A;  3T1Y L;  2JA7 G;  3I4M G;  1PV4 A;  4UY8 C;  2L15 A;  2VQF Q;  3TRZ A;  4LFB Q;  1L0W A;  2NZH A;  3PIO A;  3CF5 A;  1KRT A;  5GQO A;  4A3E H;  1K83 H;  3STB D;  3T1H L;  3J81 c;  3S15 H;  2KHJ A;  1YZ6 A;  2E8G A;  2IX0 A;  1K73 C;  1N34 L;  4JYA Q;  2GVB A;  4R4I A;  2QA4 A;  2ATW A;  4LW1 A;  2Q2I A;  4DUY Q;  2PI2 E;  1HR0 W;  4DV6 Q;  1XNQ Q;  2KCM A;  1HZ9 A;  4JBW A;  4LUZ A;  4UP9 A;  2GN5 A;  1G6P A;  4R1J A;  2VZA A;  3RN2 A;  2UXB L;  4IPG A;  1L2F A;  1JJ2 A;  1KRS A;  3KJO A;  3G6E A;  5IYD H;  4JBM A;  1Q12 A;  2EXD A;  4A3M G;  1WI5 A;  4DAY B;  1V9P A;  2JEB I;  2K5H A;  1I94 Q;  1X55 A;  3GDE A;  3PO3 G;  3OTO Q;  4DR7 Q;  1FL0 A;  2ZM6 Q;  4A3J H;  2WB1 G;  3HOX G;  2UXD Q;  1T9H A;  2PNH A;  1I5F A;  2WP8 J;  2I5H A;  4DV5 Q;  4GOP B;  4A3L H;  1BVS A;  1HR0 L;  1CKM A;  1XTD A;  1PVO A;  4MZ9 A;  4B3S Q;  2R7F A;  1J6Q A;  5BR8 L;  3BU2 A;  2UUB Q;  3GTJ H;  5C0X I;  1YIT A;  4DUZ L;  1VQL A;  1Q86 C;  4H02 A;  1L1O C;  3U4V A;  4Y7N H;  3J81 i;  1KHI A;  1K9M C;  1TWA H;  3A74 A;  4A3D G;  1I3Q H;  1OXS C;  1A0I A;  5H1S E;  3VDY A;  4JI6 Q;  2BH2 A;  1NBW A;  3FHW A;  3S1N H;  5GAG C;  4A3D H;  4OXP A;  2K75 A;  5C3E H;  4DR5 Q;  4PZ7 A;  4KLK A;  2UXC Q;  3H3V H;  5IYD G;  3G4S A;  4JG2 A;  4A3K H;  3PV0 A;  5IYB H;  4HJA A;  3WWV A;  5GAH C;  4DR1 Q;  3HOV H;  3CCJ A;  3S24 A;  3H15 A;  2JK8 A;  3Q8D A;  3T1Y Q;  4A3J G;  1GKH A;  2I0Q A;  1SRO A;  2MNA A;  4A3L G;  4B3R L;  3T1H Q;  2Z0S A;  2B29 A;  2ID0 A;  4GLA C;  2F3I A;  1X9N A;  1NTG A;  2R6G A;  3CP0 A;  3PIP A;  2Q2T A;  1N34 Q;  4A76 A;  1PH7 A;  1WJJ A;  1Y1V H;  4POF A;  4X6A H;  3CPF A;  1SN8 A;  3CCU A;  4JI1 L;  4HIM A;  4GNX A;  4L5R C;  2R7Z H;  1C7Y A;  4IPC A;  4A3B G;  2UXB Q;  1N9W A;  2NVQ H;  3TS2 A;  1MIU A;  3H0G H;  3PCO B;  1W2B A;  4LF9 L;  4GN4 B;  5ELO A;  1IYJ B;  3SGI A;  3W5O A;  1WOC A;  3ER0 A;  1VQE A;  4YCW A;  1YHA A;  4OWT B;  2E2J H;  4LFC L;  4DV1 Q;  4K0K L;  3CCS A;  4GKK L;  1A62 A;  1U5K A;  1YBY A;  5LMU L;  2NZO A;  1MJE A;  4Y52 H;  4YY3 L;  4DV0 L;  4OWW B;  4ME3 A;  3KDF A;  4GOP C;  1HR0 Q;  4PZ8 A;  3CCL A;  3OYY A;  4NB3 A;  4BY1 H;  4BBS G;  5BR8 Q;  4C3J H;  1VQA A;  3S2D H;  2K50 A;  1NJI C;  4DUZ Q;  4P71 A;  3S2H H;  1Y1V G;  4NXN L;  1ASY A;  4X66 L;  2UU9 L;  3D0F A;  3GTO H;  1MJC A;  4GN5 A;  4JI5 L;  2WFW A;  2XGT A;  2JJQ A;  3I7F A;  1UE6 A;  1SLJ A;  2E2H H;  1V43 A;  1A8V A;  3H0G G;  2C35 B;  1QUQ A;  4IJH A;  3EIV A;  5IP9 H;  2YV5 A;  4A3C H;  5JEA G;  2XTI A;  1G29 1;  1Y1W H;  3CQZ H;  2VUM H;  2KCT A;  3I56 A;  2AKW B;  2ZTE A;  1CUK A;  4LUO A;  1RIP A;  1U0L A;  3B6Y A;  1KIX A;  4OWX B;  3UDG A;  3H3V I;  4B3R Q;  4R4C A;  3PO2 H;  1QVG A;  1M1K C;  3NEN A;  4OON A;  4IPH A;  5C4J H;  3M3Y H;  2Z6K A;  4TVA B;  3RNU A;  2N49 A;  1EQR A;  4KI0 A;  3GTK H;  2F4V L;  1O7I A;  3M9B A;  4JI1 Q;  4BBR H;  1X56 A;  5IP7 G;  2LSS A;  3UDX A;  3KF8 B;  5IYC H;  4LUV A;  4DV4 L;  1HJP A;  1IBL L;  4XIG S;  3ULP A;  4LF9 Q;  3KJP A;  4YHH L;  1VQJ A;  5M3F H;  3AFP A;  1FJG L;  4IFD J;  3TEH B;  1DGS A;  3L2P A;  4LFC Q;  2VY3 A;  4A3C G;  4K0K Q;  1YHQ A;  4GKK Q;  3EN2 A;  2R93 G;  1X65 A;  5LMU Q;  3U50 C;  5IWA L;  4YY3 Q;  3K8A A;  4DV0 Q;  3UDI A;  4A93 H;  1Y1W G;  2CFM A;  3JC6 6;  1YJ9 A;  4HID A;  3U4Z A;  1JB7 A;  3M85 A;  1K8A C;  3HOY H;  1H95 A;  2HQL A;  5FJ8 H;  3ZJY C;  3CXC A;  3CAM A;  2BA1 A;  5AJ3 L;  4XTC S;  3CD6 A;  1HZA A;  3CC4 A;  4NXN Q;  4X66 Q;  3PSI A;  2UU9 Q;  1OXT A;  4JI5 Q;  2D0P A;  1I6H H;  4BBR G;  1Q1E A;  2KHI A;  3CMA A;  1E1T A;  1PYS B;  4HIO A;  3CC2 A;  3HKZ G;  3BZK A;  1VQM A;  5IYC G;  4WJ4 A;  2R92 G;  1X6O A;  2OWO A;  3FKI G;  3CCM A;  1VQO A;  2N3S A;  3J80 c;  1C0A A;  5FLX c;  4UP7 A;  5M3F G;  2VL6 A;  4DV1 L;  2NVT H;  3CCQ A;  3U58 A;  1MKH A;  5M3M H;  1XPR A;  2UUA Q;  2HT1 A;  1JT8 A;  2WB1 E;  1VQD A;  1K8G A;  3K81 C;  4X64 L;  4A93 G;  1K0R A;  5K36 G;  1JJC B;  1QZG A;  3F2C A;  4P72 A;  4GNX B;  1VQH A;  4A3E G;  3HOY G;  4DV3 L;  1N33 L;  1PA6 A;  1XMQ L;  2HIV A;  3STB C;  4QGU A;  4HIK A;  4JI0 L;  1PH6 A;  4OO1 G;  1BBU A;  2F4V Q;  4YCU A;  4LWC A;  3PUY A;  1AE3 A;  1EIY B;  4AQY L;  3PUX A;  4DV4 Q;  2IY5 B;  1IBL Q;  2QGQ A;  1E1O A;  4JCV E;  4PZ6 A;  3NEM A;  4JBK A;  1N32 L;  3GTQ H;  4YHH Q;  1FJG Q;  1YIJ A;  2ASB A;  1LTL A;  1IXR A;  2CWA A;  2K4K A;  3KDF B;  1LUZ A;  3E9H A;  3J80 i;  5IWA Q;  2AHO B;  4IPD A;  3S17 H;  2OQK A;  3BJU A;  2RHS B;  2WAQ G;  1CSQ A;  4NXM L;  1XPU A;  1VQ6 A;  4PMW A;  1HZB A;  3PF4 A;  4YWM A;  1IZ6 A;  3KF6 A;  3TRE A;  2JEA I;  1LM0 A;  2VNU D;  2B3G A;  4A3I H;  2OTJ A;  1XMO L;  5AJ3 Q;  4RMF A;  2CKZ B;  1QUQ B;  2PQA A;  1EYG A;  1PYB A;  2Y0S G;  1VQF A;  3AQQ A;  2F52 A;  4UPA A;  4DR3 L;  1S40 A;  1LYL A;  2Y0S E;  1JMC A;  4DK3 C;  3S1Q H;  3A5U A;  4R4Q A;  5C3E G;  2NVY H;  3CME A;  2BH8 A;  4HJ9 A;  3G48 A;  3I4N H;  4OO1 I;  1E7Z A;  5E7N A;  5M5X H;  1SRU A;  1JE5 A;  4A3K G;  1ASZ A;  2HIX A;  3HOV G;  5IYB G;  1CKO A;  1E24 A;  4DKA C;  1VS0 A;  4R4T A;  4X65 L;  1PH9 A;  2D0O A;  4X64 Q;  2ZJP A;  1IBK L;  5GAD C;  5FLM H;  1KXL A;  4L5S A;  1VQ7 A;  3AYH B;  3PUZ A;  4JOI A;  4DV3 Q;  4GNX C;  1XMQ Q;  1NE3 A;  4B3M L;  1N33 Q;  4A4I A;  4POG A;  4JI0 Q;  3I4O A;  2PI2 A;  1XNR L;  2B63 H;  1TWC H;  1E3P A;  4HJ8 A;  1P16 A;  1Q46 A;  3F8T A;  4NPS A;  3TQY A;  1YEZ A;  3E0E A;  3UE1 A;  4AQY Q;  2RF4 A;  4J15 A;  4LF4 L;  2R7Z G;  4DR6 L;  1VQ4 A;  1JJG A;  4A3F H;  1GM5 A;  2LXK A;  1N32 Q;  1I50 H;  2A19 A;  1TWG H;  2RHQ B;  3ERS X;  2IHF A;  3I4N G;  1X54 A;  2RCN A;  1VQ9 A;  3MXN B;  4B3T L;  4LFA L;  5IE8 A;  3M7N A;  2FXQ A;  4ALP A;  4JI4 L;  4JI2 L;  4BY7 H;  3FP9 A;  4O0A A;  4QJF A;  1VQI A;  2ZTD A;  4YWL A;  1G51 A;  1S3O A;  3IRB A;  1CSP A;  1SR3 A;  1PHJ A;  1SE8 A;  1E22 A;  1OXX K;  2EIF A;  4NXM Q;  4BXX H;  1W3S A;  4PG3 A;  1VQC A;  5GAE C;  3CCV A;  1IL2 A;  3HOW H;  1PFS A;  4BY1 G;  5FLM G;  3M4P A;  4EX5 A;  1XMO Q;  1QVF A;  4L5T A;  1PH8 A;  4GLV B;  1VQB A;  4IOC A;  1IBM L;  4X62 Q;  2JA5 H;  1HNZ L;  5C44 H;  4DR3 Q;  4GN3 B;  4A3F G;  2OTL A;  2MO0 A;  1EQQ A;  3K80 C;  2JA6 H;  2JA8 H;  5IP9 G;  1OXU A;  2YTX A;  4JBJ A;  3DLL A;  4P75 A;  3TS0 A;  1WCM H;  1J5E Q;  4IFD G;  2A1A A;  2Q2U A;  2QEX A;  1YHB A;  3LGJ A;  5M5Y H;  4X65 Q;  2UUA L;  2VUM G;  4BY7 G;  1IBK Q;  2Z6K C;  5LMN L;  4O2D A;  2VW9 A;  3HOZ H;  1Z47 A;  1KAW A;  4FDB A;  2YU9 H;  1VQ5 A;  3PO2 G;  3PUW A;  4WJ3 M;  4HJ5 A;  4B3M Q;  4C3I H;  4GKJ L;  4APV A;  1XNR Q;  2DGY A;  2NVX H;  2UUC L;  4QQB X;  3PF5 A;  3AEV A;  4A3M H;  4LF4 Q;  4JV5 L;  5C0X J;  1TWF H;  3PO3 H;  4DR6 Q;  2JA5 G;  1FGU A;  3F2B A;  2A8V A;  4JI8 L;  2CQO A;  2CCZ A;  3HKZ E;  3HOX H;  1HZC A;  3KLW A;  3L0O A;  4P74 A;  2I5L X;  5C4X H;  1X3F A;  2E5L L;  3JAM c;  3RLO A;  1QVC A;  1R9T H;  4IJL A;  4LFA Q;  4B3T Q;  4C2M H;  2JA6 G;  2JA8 G;  4DR4 L;  1HNX L;  1KD1 C;  1UEB A;  3KF6 B;  4JI4 Q;  1WCM G;  4JI2 Q;  3J7A 5;  2ZTC A;  3GO5 A;  4LF6 L;  3AFQ A;  3EBE A;  4L5Q A;  4DV7 L;  1AE2 A;  1X3E A;  2K5N A;  4JI3 L;  4DV2 L;  3CW2 C;  1QZH A;  1KQS A;  3D31 A;  4UP8 A;  1YI2 A;  2PQA B;  3HOZ G;  4IFD I;  5FJ8 G;  1X3G A;  4DR2 L;  1YJN A;  1L1O A;  2MFI A;  4BA1 I;  1VQ8 A;  1AH9 A;  2CWP A;  2IHE A;  3W1G A;  1IBM Q;  2Q2H A;  1SMX A;  1HNZ Q;  3L7Z C;  3HOU H;  2H5X A;  1EFW A;  3RN5 A;  1VQN A;  3MEF A;  4LF5 L;  3A0J A;  1P8L A;  2ZJQ A;  4A3G H;  2IT1 A;  5C4X G;  2K52 A;  2JA9 A;  1M90 C;  3GD7 A;  1OXV A;  3JAM i;  4C3H H;  1GVP A;  3K0X A;  3PUV A;  1UE5 A;  2I5M X;  5M3M G;  4QIW E;  3M4Q A;  1UE1 A;  3G71 A;  2NN6 I;  3ULJ A;  1YJW A;  2N78 A;  2YTV A;  1NY4 A;  1C9O A;  2WAQ E;  1KC8 C;  5LMN Q;  4LF7 L;  4IOA A;  5JJK A;  4QL5 A;  3RZD H;  1EWI A;  1WFQ A;  2AMC B;  1Z9F A;  1PH2 A;  3GTP H;  4A3B H;  2HHH L;  1XJV A;  4GKJ Q;  3GTL H;  3HFZ B;  2D62 A;  3UE0 A;  1A63 A;  1UWV A;  2UUC Q;  2KEN A;  4AH6 A;  1TXY A;  4A75 A;  4TQU S;  2N8N A;  2IX1 A;  4JC0 A;  3PGZ A;  4X62 L;  3HKS A;  1N36 L;  3J7Z C;  2JQO A;  1XPO A;  4JV5 Q;  1HNW L;  2EQS A;  2AWN A;  4JI8 Q;  1Q7Y C;  3HOU G;  3RLF A;  4YCV A;  2V1C C;  4JI7 L;  3CPW A;  3F2D A;  1EOV A;  2E5L Q;  2YTY A;  4OX9 L;  1RL2 A;  3A5Z B;  1TWH H;  4RG1 A;  1J5E L;  4A3G G;  4DR4 Q;  4MNO A;  1B70 B;  3ULL A;  1Y14 B;  1HNX Q;  4BBS H;  5IY0 A;  4MTN A;  2AWO A;  2ZJR A;  3OW2 A;  4LF6 Q;  5GRO A;  2ES2 A;  1PH1 A;  4LF8 L;  3DM3 A;  3KOJ A;  4DV7 Q;  4GOP A;  2BA0 A;  4DV2 Q;  2VQE L;  3S1R H;  1PH5 A;  5HY6 A;  4JI3 Q;  3KFU A;  1YVC A;  4DPG A;  1SFO H;  2MQH A;  4DR2 Q;  3NEL A;  2LXJ A;  4A3I G;  2JE6 I;  3CCE A;  1CKN B;  3ICE A;  3K7A H;  3I55 A;  3CCR A;  2GVA A;  4KHP L;  4YWK A;  4GLX A;  5HGQ A;  1VQK A;  4KHZ A;  1N8R C;  4LF5 Q;  1GD7 A;  2E2I H;  3K7U C;  4BA2 I;  1B7Y B;  3M4O H;  3J81 j;  2VQF L;  4LFB L;  1PH4 A;  1V1Q A;  3I2Z A;  4QY7 A;  5JJL A;  3KYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...