1XNRL

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xnrL00
3J81j 1N9WA 2VL6A 1IBML 2IT1A 4LFCQ 2Y0SE 5C44H 4A3LH 1OXTA 1PH3A 4B3SQ 2IHEA 2KHIA 1M90C 1HNWL 1MKHA 1OXVA 2I5HA 4APVA 3GTJH 3G6EA 5LMNL 1CKNA 2BA1A 4DK6C 4JI8L 1VQKA 1VQ6A 1PFSA 3K7UC 4LF5L 1E1TA 2BH2A 4R4CA 3L7ZC 1BKBA 3ERSX 4X64L 3M85A 4IFDG 4IFDJ 4P71A 4Y7NH 1GO3E 4X66L 1OXXK 3CC4A 2ZJRA 4OX9Q 2R93H 5GAHC 3K0XA 3K81C 4LFAL 4DR2L 1YITA 4JI3Q 1WFQA 3KYHC 4YCUA 4JYAL 4R4QA 3EIVA 1G291 1GM5A 4DNIA 3JAMi 1A0IA 1QZGA 2UUAL 1TXYA 1PYBA 4P73A 1SROA 1B70B 2UXDL 4HJ7A 2RCNA 2JJQA 1FVIA 5FLMG 4LF9L 1Q1EA 3FP9A 3PO3H 1HZAA 1V1QA 1VQGA 4GOPB 3D0FA 4JI0Q 4JI4Q 2QEXA 2NVTH 4KHPL 1J6QA 4X6AH 1KL9A 1PV4A 2PQAB 1XPOA 1IBLL 3RLOA 2GVAA 4JI6L 4DR4Q 3K8AA 2HIVA 3RR5A 1JJGA 5IY0A 2K75A 1E22A 1CSQA 4GN4B 1YJWA 3AYHB 1VQBA 1S40A 1S72A 2VQFQ 4LF4L 1N33L 4GKKL 2ID0A 1Y1VH 2OQ0A 2AHOB 3E9IA 2KENA 4GNXA 5GAGC 4B3TL 4UP9A 2OCEA 4MTNA 4X65Q 4LFCL 4DV0Q 4JI1Q 3KDFB 4C2MH 1XMOQ 3KF6A 3UDFA 1TWFH 4QJFA 1W3SA 4L5RC 3S16H 1IBKQ 5JJIA 1YJ9A 3H0GG 4XTCS 3PF5A 1XMOL 1SFOH 4A3LG 4GLAC 5C44G 2HT1A 1YBYA 1XNRQ 2F52A 2JQOA 1YEZA 4B3MQ 2A1AA 3K80C 2B63H 5ELNA 4OX9L 1JJCB 1EQRA 5BR8L 1Z47A 4IJLA 4LF7Q 4IPDA 4DV7Q 2HHHL 1C9OA 2R93G 3ZJYC 4YCWA 2AWNA 1W2BA 1Q82C 4GKJQ 3BU2A 3NEMA 5IWAL 1OXSC 2IHFA 2I5LX 4HJ8A 3PUZA 2HIXA 5GROA 1D7QA 2NN6I 4DUYQ 4JI7L 4JI0L 3HOYG 1XPUA 2LXJA 1IBMQ 1I50H 4LW1A 4GLXA 1HR0W 2OWOA 4DR6L 3PO3G 2YU9H 1HNWQ 3I56A 2VNUD 1C7YA 5LMNQ 5ELOA 4L5SA 3F8TA 4JI8Q 1EIYB 3GTGH 1MIUA 1VQHA 2ZJQA 1U5KA 4LF5Q 5C0XG 5C0XJ 4BA1I 4YCVA 3HFZB 4A3BH 2Q2UA 1VQNA 1PH1A 4X66Q 2Z0SA 2JA7H 3ICEA 1E3PA 4LFAQ 2NZHA 4JBWA 5JEAJ 4IPGA 3TEHB 4YWLA 5JEAG 4X65L 4DV0L 4DR2Q 1I94L 1FJGQ 3M3YH 4GS3A 4JYAQ 2ZTEA 4BA2I 4WJ3M 1PA6A 2K4KA 1P8LA 2YTYA 5DLQE 3GTOH 3KFUA 1X65A 2FXQA 3A5UA 3FHWA 4OONA 3CCEA 1Q7YC 2UXDQ 4PZ7A 3BJUA 3AFQA 1Y1WH 2ATWA 1L1OB 3H3VH 4P75A 4IOCA 3CCRA 3GTQH 2GVBA 3M9BA 2Z6KA 2I5MX 3TQYA 1XJVA 1X3FA 2F4VQ 1X56A 1XNQL 3RN2A 4B3ML 4YWKA 1PVOA 3E0EA 3HOUH 4H02A 2D0OA 1YHQA 3A0JA 2PI2A 3S2HH 4LF7L 1IBLQ 3HOVH 1K0RA 4DUZL 4DV7L 4A76A 1J5EQ 2I0QA 3J7A5 2VS1A 5C4XH 4NB3A 1NBWA 2B63G 1X3GA 1AE2A 1G6PA 1PH4A 1OTCA 1R9TH 1B8AA 2B29A 1DGSA 1HH2P 5J3BA 4LF4Q 1N33Q 4GKKQ 1UWVA 2JA6H 2VQEQ 4B3TQ 3H0GH 2MNAA 4NPSA 5EAYA 3J81c 3CF5A 3GDEA 4X62L 3T1HQ 1CSPA 2AKWB 2R6GA 2Y0SG 4GN3B 2YTXA 2OTLA 2H5XA 1IZ6A 4GOPC 1Q86C 1YZ6A 3CW2C 5C3EH 2E5LQ 1VCIA 1XTDA 3GO5A 1IXRA 3MXNB 1OXUA 1VQ4A 2MQHA 1JJ2A 2UXBL 1WCMH 5M3FH 3CCLA 3HKZE 1E7ZA 2KHJA 2Q2HA 1SN8A 3TREA 5BR8Q 4DK3C 4A3KG 1PH2A 4JV5L 1FJGL 4DV6Q 1EFWA 3CMEA 2HHHQ 4JI2L 4A3BG 2NVQH 4A3MH 5M5YH 1HZCA 4IPCA 4BY1H 2JA7G 3HOYH 4KHZA 1N32L 3NELA 1A8VA 5IWAQ 3L2PA 2A19A 4WJ4A 2K5HA 4A3JH 1MJCA 3UE0A 1VQFA 1WYDA 3CCQA 2F4VL 1TWCH 1BVSA 1D8LA 3LGJA 2Q2IA 4LUOA 4OWTB 1CKNB 1HNZL 4JI7Q 5M3MG 4JOIC 4RMFA 1Y1WG 3PCOB 2JA9A 4DR6Q 1FL0A 1VQ5A 1I6HH 2UXCQ 2WFWA 3U58A 3CCUA 2PMZE 1J5EL 1N8RC 1B7YB 3HOUG 3WWVA 2OQKA 4DR5Q 4O2DA 1YIJA 4LWCA 2VY3A 3M4PA 3HOVG 1K8AC 4LF6L 3M4QA 5C4XG 2EXDA 2VQEL 3Q8DA 2QA4A 3CQZH 1I94Q 1X9NA 1PH8A 2NVYH 3GTLH 2WB1G 3T1HL 2DGYA 2JA8H 4YY3Q 1L0WA 4YHHL 2JA6G 1A62A 1NMFA 1SE8A 2EIFA 3F1ZA 3GD7A 4JC0A 3G48A 1K83H 1EWIA 5IP9H 3RNUA 2E5LL 2F3IA 1GVPA 3CCJA 4QQBX 3OTOQ 2ZJPA 2N8NA 2N78A 4AYBG 1XNQQ 3E9HA 1VQDA 1RIPA 5C3EG 2OTJA 3PUWA 5M5XH 4HJAA 1QVGA 4Y52H 4IJHA 4DV6L 4OWXB 4DUZQ 1VQ8A 2HQLA 1EIFA 1WCMG 4C3JH 2WAQG 1Q1BA 5M3FG 1TWGH 1KQSA 3S1QH 4P72A 2CKZB 4GNXB 4QGUA 4LF8L 3CP0A 3K7AH 3KF6B 2PNHA 2IY5B 4DV2L 2XGTA 1PH5A 4A3MG 5FJ8H 1IL2A 3U50C 4BY1G 4FDBA 1VQ9A 4A3GH 1QVCA 1L1OC 4X62Q 3D31A 2R92G 2UXCL 4A3JG 2DUDA 4DV3L 4A3IH 4HIOA 1NJIC 4DR1L 3OYYA 3PO2H 5IYDH 4JBJA 1WJJA 2NZOA 1Q8KA 3ULJA 4AQYL 2R7DA 4DR5L 4A3KH 1MJEA 4DV5L 3W1BA 2UXBQ 2KBNA 2ALYB 2MO0A 5FLXc 1YJNA 4A3CH 2JK8A 2E2IH 4KI0A 2ZM6Q 3CXCA 2BH8A 4IO9A 4JV5Q 5M5WH 1SR3A 1U0LA 3EN2A 3L0OA 4UP7A 3F2DA 1K73C 2KCTA 5GAEC 3NENA 2YV5A 4JI2Q 4EQ5A 1HR0L 3GTKH 3UE1A 4YY3L 2Q2TA 1N32Q 1RL2A 3CC7A 1GKHA 5GQOA 3HOWH 5M3MH 1YHAA 1YVCA 2VUMH 1EOVA 3HOXH 3OTOL 2E2JH 2JA8G 3AEVA 3U4VA 1JE5A 1YHBA 4A75A 4NXMQ 4B3RQ 1HNXQ 1HNZQ 2UUCQ 3J80c 3CCVA 3S2DH 4ME3A 3ULPA 3CC2A 2D0PA 5IP9G 4PG3A 1K3RA 1SLJA 4NXNL 1VQ7A 2NN6G 3DLLA 3RZDH 3RLNA 3I4MH 1QUQA 4JG2A 2MFIA 1QZHA 3I4OA 1I3QH 1NY4A 4LF6Q 2R7ZG 2JA5H 3CMAA 5HY6A 2UUBQ 1IYJB 4UY8C 4R4TA 3I2ZA 3UDGA 1Y14B 3GTMH 1K8GA 3G71A 2CFMA 2QGQA 2YTVA 2K50A 4OXPA 5FJ8G 4YHHQ 2RHSB 3KJOA 3JAMc 1PH7A 3BZCA 5JJLA 1M1KC 1SMXA 5IYBH 3RZOH 4B3RL 4A3DH 2CQOA 2K14A 5H1SE 5LMNW 1HZBA 3NBHB 4HIKA 4A3GG 3A5ZB 4A3IG 3T1YQ 4UPAA 3STBC 3PO2G 4AH6A 5IYDG 3UDXA 1Q12A 3A74A 1H95A 2ZM6L 4OO1I 1S3OA 3VDYA 4BY7H 3HKZG 3W5OA 2JEAI 4K0KL 1X54A 2BA0A 1YI2A 3M4OH 2L15A 4PMWA 5IP7H 4A3CG 4A93H 3W1GA 2CCZA 1XPRA 3S1RH 1EYGA 4JI5Q 4LF8Q 3KJPA 4DKAC 1KC8C 4DR7Q 3B6YA 4GOPA 3TS2A 1VQCA 2R92H 2IX0A 4DV2Q 3HOZH 1HZ9A 3S1MH 4R1JA 4NXML 2K5VA 4AIMA 1HNXL 3M7NA 4C3HH 2UUCL 2PQAA 3HOWG 1JMCA 4BBSH 1I5FA 2VUMG 2WP8J 1PHJA 3HOXG 3S17H 4DV3Q 3S1NH 1PH9A 1NE3A 4XIGS 4DR1Q 3J81i 3PUVA 1LUZA 3HKSA 4L5QA 4PZ8A 4AQYQ 1N34L 4R4IA 3PUXA 3BZKA 3RLFA 4DV5Q 3ER0A 1UE5A 4YWMA 5HGQA 3SGIA 5AJ3L 4DV1Q 3I4MG 3KDFA 1V43A 3FKIH 2UUBL 4GNXC 4A3EH 4QL5A 4A4IA 3TS0A 1HR0Q 1VQPA 2CWAA 1WOCA 4JCVE 4TVAB 4JOIA 5IYCH 4HIDA 1TWHH 2JE6I 3I4NH 3PIPA 2JA5G 4UP8A 4BXXH 1KIXA 4OO1G 5JJKA 3G4SA 4DV4L 2UU9Q 2AWOA 3PGZA 4R4OA 4EX5A 2C35B 1NTGA 4BXXG 3T1YL 3AFPA 1ASYA 1NMGA 2RHQB 1EQQA 1CKOA 2ZTCA 2ES2A 5IYBG 1X55A 5E7NA 1L2FA 3CPWA 3DM3A 1XMQL 4TQUS 4A3DG 2RF4A 3PUYA 4NXNQ 4A3FH 1YNXA 4JBMA 2WB1E 4GN5A 2R7ZH 1VS0A 4PZ6A 3ULLA 1EUJA 5IT9c 3PF4A 1VQOA 4B3SL 2A8VA 4JI5L 4BY7G 5C0XI 2K5NA 1P16A 4LFBQ 1C0AA 3IRBA 1K9MC 1KHIA 2V1CC 4OWWB 1KRTA 5IP7G 1N36Q 4A93G 4HIMA 1UE7A 3F2BA 4AYBE 2CWPA 5K36G 2LSSA 1SRUA 4GLVB 3HOZG 4QIWE 1X3EA 1LYLA 2D62A 1Q46A 3PSIA 4BBRH 4DR3Q 3RN5A 4BBSG 2IX1A 4JI3L 2R7FA 2NVXH 2WAQE 4J15A 2N3SA 1AH9A 1VQJA 3AQQA 5IE8A 2GN5A 2YYZA 4L5TA 2ZTDA 1VQIA 2EQSA 2N49A 4DV1L 3CPFA 1FGUA 2E2HH 1JT8A 5LMUQ 5C4JH 2E8GA 4K0KQ 1KD1C 4DAMA 3CCSA 3I55A 4JI4L 4HJ9A 1LM0A 2JEBI 3S24A 3STBD 1V9PA 4C3IH 3PIOA 3TRZA 3U4ZA 1L1OA 1Q81C 3FKIG 4IOAA 4HJ5A 4LNQA 4LUVA 4DR4L 1AE3A 1TWAH 4A3EG 2UU9L 3UDIA 1A63A 3KOJA 3S15H 5GADC 1PYSB 3KLWA 5IYCG 3KF8B 3I4NG 1BBWA 2Z6KC 1GD7A 4POGA 1LTLA 2VQFL 2LXKA 2MO1A 4X64Q 1QVFA 1CUKA 2KCMA 1CKMA 2B3GA 1JB7A 4DR7L 1BBUA 4JI1L 4DPGA 4P74A 5FLMH 1N34Q 3CD6A 2PI2E 3H15A 3S14H 4QY7A 3J7ZC 3OW2A 3I7FA 1IBKL 2XTIA 1Y1VG 2UUAQ 4MNOA 5AJ3Q 4A3FG 2ASBA 4LFBL 3CAMA 1Z9FA 2AMCB 4IFDI 3F2CA 1N36L 1KRSA 4RG1A 4LF9Q 1KXLA 3GTPH 1E1OA 1XNRL 2K52A 3JC66 4LUZA 1HJPA 1G51A 4ALPA 3EBEA 1ASZA 4KHPQ 4DR3L 1KAWA 4KLKA 4O0AA 4DV4Q 1VQMA 4JI6Q 1X6OA 1PH6A 1UE6A 1E24A 4MZ9A 3CCMA 1VQEA 2VW9A 1VQLA 1VQAA 4GKJL 4BBRG 1WI5A 1O7IA 2VZAA 1UEBA 4IPHA 1QUQB 4DAYB 4JBKA 1T9HA 1UE1A 1XMQQ 3PV0A 5LMUL 3H3VI 3MEFA 3J80i 4DUYL 4POFA
chains in the Genus database with same CATH superfamily
3J81j 2VL6A 1IBML 2IT1A 3ZYYX 5C44H 3SR1A 1OXTA 2B2YA 1Q3LA 2KHIA 4C56C 1MKHA 1OXVA 5LL6X 2P5ZX 1CKNA 2BA1A 4DK6C 1EEFD 4S3SA 2K04A 2RKSA 4B9WA 1PFSA 3SXHA 4CHTB 4QCLA 4IALA 1JOKA 2BCOA 4DN4M 4LFAL 5CV4A 5J1ZA 3VYSA 4DR2L 4FF4A 1H9SA 1WFQA 4R4QA 2F0TA 1G291 4MTKA 1ZXTA 5CV9A 1GM5A 3BS1A 1II3A 4DU9A 1S5CD 2RCNA 4HJ7A 2I07B 5JJZA 1EU4A 2QEXA 3HKZB 1JB3A 1PV4A 3T51B 4BWGB 3K8AA 2HIVA 4DXFA 5IY0A 1MI2A 1E22A 5C5MA 1SYFA 2XWJB 4X3KA 4J8QA 5C4JB 1EIHA 4K6LA 4DK0A 1EY5A 2OQ0A 1B2TA 3D4DA 4X65Q 2E2JB 4QJFA 2X69A 4RA8A 1G6ZA 3T13A 1CQFA 2PMZB 1KTKA 2LS01 5EQ0A 3H0GG 4FNFA 4GLAC 5C44G 2Z4IA 1EL0A 3RZDB 1XNRQ 4FXKC 4U68A 2A1AA 2B63H 3BVMA 1JJCB 1EQRA 5BR8L 4LF7Q 1BCPC 4IPDA 1STEA 1Y69U 1D5MC 2K03A 3WOEA 3ZJYC 1I4HA 1CZWA 1Q82C 4GKJQ 3NEMA 1OXSC 1CT1D 2A69C 2IHFA 2F0OA 2I5LX 4HJ8A 3PUZA 2TMPA 5AFWA 2NN6I 2BE5C 1GUOA 4RCNA 3NWSA 4Q5VA 1SNMA 5C0XJ 3HFZB 5C44B 2KEEA 2DY8A 3ICEA 1BCPF 1E3PA 2OT2A 2NZHA 5JEAJ 4NW2A 4X65L 4WJ3M 2BDOA 1P8LA 1X65A 3CCEA 1Q7YC 3AFQA 4NP5A 1Y1WH 4P75A 3Q22A 1BDOA 1K3BC 2GVBA 3M9BA 3TQYA 2F4VQ 3W3AA 1F2YA 4YWKA 1LTSD 4KHVA 3A0JA 4LF7L 3H6MA 1ZEQX 2I0QA 2EYMA 3FKIB 1HHVA 1FNWA 1JWSD 2B63G 1PH4A 1CQVA 5CBAE 1TWHB 5J3BA 4LF4Q 2G9HD 2JA6H 2VQEQ 5JVH3 5T1GA 4B3TQ 5J39A 3T1HQ 4U673 1CM9A 2EY2A 2R6GA 2YTXA 4JPBW 1Q86C 4RGTA 1YZ6A 2E5LQ 1VCIA 1TS2A 1LV9A 1NAPA 3VR5A 4JV5L 5C4HA 1EFWA 3BDCA 3CMEA 4JI2L 2NVQH 2RSNA 1DXMA 3EFXD 4BY1H 2D2CC 2A19A 5FO9B 4A3JH 1VQFA 3VR3A 2F4VL 1BVSA 3LGJA 2F0VA 2Q2IA 1CKNB 4JOIC 4DAVA 1Y1WG 3PCOB 4DR6Q 1FL0A 1I6HH 3G6JB 3NQTA 2PPBC 3GV3A 2L4NA 1B7YB 4O2DA 2EYFA 4EVOA 3M4PA 1H9SB 1K8AC 1Q90A 4C3IB 1AW7A 2EXDA 5JPMC 2VQEL 1AEXA 2Z6BA 2QA4A 1X9NA 3DEOA 3TMEA 3GTLH 2F03A 3T1HL 5A2QL 2JA6G 1A62A 1SE8A 3GD7A 3G48A 1K83H 1EWIA 2E5LL 3GP7A 2F3IA 4O42A 5ELEA 4CDDC 3A55A 3X3MA 1E2WA 1MD2D 3A56A 1VQDA 3BG3A 4NDXA 3R93A 4HJAA 1QVGA 1Y8PB 3V96A 4Y52H 3D6CA 4OWXB 4DUZQ 4C3JH 1KQSA 1STBA 1QNUA 3GTPB 3SK8A 2IY5B 2XGTA 5EPJA 2AQ3B 1IL2A 4FYDA 4BY1G 1I4QA 5BN5A 2B2VC 4NMZA 2PZWA 4X62Q 1DJRD 4A3JG 2M9VA 1S5DD 3A7LA 2B2UC 2FFKB 1IHZA 3H91A 4ZKBB 2F0QA 2JA6B 4CKCA 4ZUIA 1JE4A 5CGKA 2KBNA 2WACA 2JK8A 2E2IH 3CXCA 1U0LA 2EDGA 1EYAA 5K5PA 2KCTA 1HR0L 1S5BD 2Q2TA 1RL2A 5M3MH 2NYZD 1MSHA 4ZUJA 2F0WA 4V190 1EEID 2HDLA 1YHBA 4NKLA 1HNXQ 2KEDA 3CRLC 4ME3A 4XYOA 4CJ0B 2D0PA 2NVQB 4PG3A 1G91A 4BY1B 3L9AX 2E2DC 4A3JB 3E0JA 3I4OA 4KD3A 1O78A 1X32A 2EYLA 5LL6S 1KAAA 4C3JG 1I6HB 4UHVA 4TSSA 1IYJB 3UDGA 2B2YC 1SMYD 1TS3A 2K7VA 2CFMA 2K50A 2K28A 4KD4A 3NTHA 3JAMc 3BZCA 3QG1A 3FVQA 2DJFC 2K14A 5LMNW 5IGBA 1GUWA 4KKSA 2JXMB 4PQXA 3OIQA 1R4QB 2XN9C 4F8MA 1HQMC 2WV6D 4HMJA 3A74A 1WVLA 4G4KA 4KJNA 3R2IA 4OO1I 3VDYA 4RGMA 2JEAI 1K83B 4DK1A 2OF1A 3WOFA 4PMWA 4XT3B 1SJHD 2EVBA 5IP7H 2F0KA 1XPRA 3B6YA 3TS2A 5D3IB 1TVXA 1HNXL 4C3HH 2DJGC 2PQAA 4ILWA 5COYA 4C3JB 1U4RA 1ONLA 1NE3A 3NBIA 1HA5A 1LUZA 4L5QA 2K33A 5CR3A 1T5EA 1KLUD 3BZKA 1CA6A 5HGQA 3LNNA 1TY2A 2E76C 5C5LA 3VA5A 4QL5A 2CWAA 3LWEA 4JCVE 4TVAB 1A6XA 4UP8A 2UU9Q 2MPMA 4EX5A 2E2IB 3J81E 2PCFB 3I3CA 5E7NA 5FOBB 2X6LA 3JAME 4NXNQ 1EQTA 2R61A 4MIUA 3SK4A 5M3MB 4PZ6A 3ULLA 5ELCA 1EUJA 5C4ZA 1LACA 1QE6A 2I46A 1R4PB 3TBIB 4X3UA 1KHIA 2V1CC 1SYCA 2HD3A 5IP7G 3HG9A 1N36Q 4HIMA 3HOVB 1BXTA 2CWPA 3SK6A 2EXZA 4QIWE 5FLXL 2D62A 2QEJC 1XTCD 3RN5A 2IX1A 4C3HG 2N3SA 1MBYA 1SYBA 3Q24A 2IW3A 1VQIA 2ZT9C 3Q23A 3CPFA 4V0BA 3V05A 4JI4L 3I55A 3MZ5A 1LM0A 1YNJC 3PIOA 2ICEC 4IOAA 1Z6HA 1Q81C 3J80L 4HJ5A 4LNQA 4DR4L 1TWAH 2UU9L 3UDIA 4RFBA 3S15H 5GADC 1XWEA 3AMUA 3KLWA 5IGCA 5EPKA 1GD7A 1SYGA 1GUGA 4HAEA 2H4OA 2WIIB 1CUKA 1CKMA 1BBUA 1V1PA 4ZCKA 1LTBD 3J7ZC 2XTIA 1Y1VG 2ASBA 4C3HB 2F3WA 3CAMA 1Z9FA 3T16A 1N36L 1LTGD 1HRJA 1B1ZA 2FMMA 4ALPA 3EBEA 2GA4B 1U9RA 5ELFA 1CHQD 2SNSA 2DNEA 1A3UA 1CTMA 2VZAA 1O7ZA 4JBKA 5E4WC 2JA8B 3MEFA 1F9QA 4POFA 1WTWA 4ZYSA 4LFCQ 3D3RA 3U9OA 1PH3A 2IHEA 5KNDA 1HNWL 3QOLA 4APVA 3G6EA 4JI8L 2PYKA 4IZ8A 2F0NA 2F0UA 4XDXA 4R4CA 2BH2A 3RMHA 4IFDJ 2R93H 1GO3E 2ZJRA 3K81C 5BN4A 4JI3Q 1JICA 4JYAL 2MJ8A 4DNIA 3JAMi 1QZGA 1DONA 1PYBA 2Q8TA 5ISRA 1SROA 1B70B 2UXDL 2O4XA 1Q1EA 3FP9A 3PO3H 1EZ8A 1V1QA 1VQGA 4KY5A 4H0LC 1EIGA 1AZPA 2PQAB 1XPOA 1IBLL 4HCEA 2F0DA 4GN4B 3L3OC 4QMGA 1HA6A 1UEAB 1VQBA 1GUNA 1N33L 3DHQA 3W2DA 2KENA 4GNXA 1TWAB 4UP9A 2AQ2B 4LFCL 3S15B 4JI1Q 4C2MH 3KF6A 1TWFH 1W3SA 1WTOA 4L5RC 1HXYD 1IBKQ 1NCVA 1YJ9A 1UAPA 1SFOH 2JQOA 5JVG3 1YEZA 3K80C 4XXEA 4CJ2C 1G2TA 1Z47A 4IUNA 3HP3A 1SBBB 4WJWA 4DFAA 1GXDC 2R93G 2AWNA 3E5SA 4K5WA 3MTSA 1ESFA 3NTIA 3GTMB 2A6HD 2HIXA 3OIPA 1B50A 3I8ZA 5GROA 4DUYQ 4JI7L 4DA2A 2EJFC 1XPUA 2EYPA 3I4LA 5BN3A 1I50H 1IBMQ 3BZDB 3PO3G 3A54A 2VNUD 1JOOA 2RQXA 2OEOA 1LT5D 3SK5A 2XVSA 2JA7H 1GUSA 1VF7A 4LFAQ 4JBWA 4DR2Q 5J22A 1I94L 4YWLA 3MXPA 3M3YH 4BA2I 3DXJC 1PA6A 2K4KA 2YTYA 5DLQE 3KFUA 4BBSB 5EJWA 3BJUA 3H3VH 4CGYB 2R93B 2NBFA 3NP8A 2F0FA 1X56A 4H02A 2D0OA 1YHQA 3GQBA 3PQIA 3DWQA 4HN7A 4A76A 4ULLA 1J5EQ 2VS1A 1C48A 4NB3A 1X3GA 3PO3B 1G6PA 2MHVA 5A2QE 1UUPA 1ML0D 1LTID 1V1PB 1B8AA 2B29A 2EYJA 1R9TH 1OTCA 3I4NB 1HQRD 3H0GH 2MNAA 4G7OC 5D14A 3CF5A 3HRZC 1LT4D 2L1BA 1SSOA 4UAIA 2H5XA 1XTDA 2D5DA 5EKKA 4IUPA 1OXUA 2UXBL 1G8ZD 3MFGA 2C9OA 1WCMH 5M3FH 1TWFB 3I72A 1WD0A 3A8JE 4DK3C 5BR8Q 1PH2A 3QOJA 1IYVA 4DV6Q 1SNOA 3BDLA 1SFOB 1HZCA 3NSWA 2EE1A 5IGEA 2JA7G 3NQIA 2A68D 1A8VA 1EOTA 1D5XC 5TSSA 2PO4A 1A2UA 1MJCA 1TWCH 1D8LA 4LUOA 1EZ6A 1HNZL 2NVXB 1VQ5A 3TP8A 1ZYRD 1J5EL 3FEWX 2A6ED 2OQKA 5DNFA 3UI2A 1I50B 4LJZC 1D1KA 1JOQA 2J7ZA 1L0WA 4YHHL 3NPPA 4JC0A 1QNKA 1S5FD 4QQBX 5FKAC 2JA7B 4F7XA 3M3YB 3DWAA 3A8KE 5M5XH 4DV6L 4DAPA 1WCMG 5M3FG 3S1QH 1Q1BA 1TWGH 1STYA 4P72A 4JVZA 4GNXB 4LF8L 1PYWD 3K7AH 1IW7D 2A74C 3KF6B 2PNHA 1T5XD 5EBCA 1ENFA 1SNDA 2ENBA 2NZ1D 3WDNA 2R92G 2DUDA 4HIOA 4DR1L 1R9TB 1WJJA 1Q8KA 3KUPA 1EY7A 2L12A 4LK1C 5ELDA 4HTHA 4QUFA 1YNNC 3W1BA 3H0GB 3S9WA 2ALYB 5FLXc 1YJNA 4A3CH 2QDLA 3P1HA 4JV5Q 2BH8A 1U4PA 4K6DA 3EN2A 4DF7A 4UP7A 3D4RA 3KBXA 2YV5A 4JI2Q 4EQ5A 3UE1A 2DNCA 4QIWB 3CC7A 1DM0B 1WCMB 5M3FB 3AEVA 1JE5A 1EFID 1RDPD 3J80c 2L55A 3S2DH 2NTSA 3K5LA 5E4XA 3VR2A 3C46A 3R3OA 1QUQA 5HURA 4JG2A 2F4IA 5I6WA 4KKTA 1STNA 2RDGA 1NY4A 2R7ZG 3D4WA 2CH4W 3BYTB 1HFNA 1WD1A 2HCCA 5HY6A 1B9MA 3DMUA 4J1MA 1S5ED 1K8GA 4BXXH 2YTVA 3MFYA 4EQPA 3K5MA 5JJLA 3LWUA 2A6HC 1M1KC 5IYBH 3RZOH 2CQOA 1NUCA 2F0EA 2XWBB 1PRTD 3A5ZB 3STBC 1HCZA 2VXWA 5E1FA 1EYCA 1H95A 3NHHA 3X3NA 3W5OA 1WTQA 5JAVA 3OMGA 1WTVA 3E6ZX 1K8OA 4A3CG 4A93H 1G2SA 4JI5Q 3OOCA 4K8JA 2B63B 3HOZH 4XQQA 1ICFB 2SDFA 1I5FA 1PHJA 4I7ZC 3S1QB 3HKSA 3K7AB 4PZ8A 5ELBA 5KYLA 3IFDA 4M8AA 4YWMA 3J80E 1ZKOA 5AJ3L 1QCBD 3H3VC 1XX8A 4GNXC 4A4IA 3TS0A 1J9OA 1HR0Q 1WOCA 4HIDA 3PIPA 3PIP3 1KIXA 4OO1G 4ZQ3A 2Z9HA 2AWOA 2JSOA 1NTGA 4BXXG 2LMCB 3FMCA 1B3AA 1CKOA 4ABNA 4CDEC 5IYBG 3CPWA 3DM3A 1PDQA 4A3FH 2WB1E 2Q8IB 1Y1WB 1EY9A 4B3SL 3URYA 5I9OA 2A8VA 4JI5L 3TP5A 1C0AA 3IRBA 2K5DA 2KCNA 3S2DB 1FNUA 4OWWB 4A93G 4AYBE 4Q0FA 3MA2B 2D9UA 3HOZG 4BBRH 4DR3Q 2PZTA 2R7FA 2C5CA 1RD9D 2F0HA 5KGUA 1AH9A 3AQQA 1PRTB 3CKIB 1PTOH 3QO2A 1JT8A 1ZYRC 3P20A 2E8GA 1KD1C 3CCSA 3RZOB 2A6EC 4HJ9A 3A7AB 3BYYB 1PTOD 1AE3A 2CHBD 2NB0A 1BBWA 1QILA 1RF2D 2F0IA 2IPKD 2VQFL 4G7HC 1QVFA 1A3TA 4A93B 3RUZA 3HGBA 1JB7A 4DR7L 4DPGA 5FLMH 1KDBA 3S14H 3CU7A 1EWCA 4EQNA 3HOZB 1FR3A 3TP7A 1CI3M 4A3FG 4IFDI 3F2CA 1QWYA 3NE5B 5CV8A 2LKVA 4RG1A 2K01A 3BDOA 4RWSC 2K52A 2CQAA 1BO0A 1E0BA 1HJPA 2QCPX 1ASZA 3OW7A 4DR3L 4ZKCB 4JI6Q 1X6OA 3OWFA 2L9HA 3CCMA 1SE2A 5L37A 2VW9A 5C6AA 1VQAA 1ILPA 4BBRG 3GTLB 1QUQB 1T9HA 5E3FA 1ENCA 3PV0A 3J80i 1SJED 4ZLTF 2ZXOA 2Z1CA 3NTKA 3Q0AA 3GTJH 5LMNL 4J6HA 1XXGA 4ZK9B 4LF5L 5JPNC 4A3FB 3P7JA 4O1NA 1BKBA 3M85A 4P71A 4Y7NH 4X66L 1OXXK 4OX9Q 1KABA 1SYDA 1YITA 1VMPA 3C2PA 1GHJA 3KYHC 3EIVA 1A0IA 1TXYA 4OGQC 5CMDA 3OWEB 4H13C 4KTAA 2JJQA 1FVIA 4RH6A 5FLMG 2KCCA 1HZAA 4BBRB 4JI4Q 2J0TD 3D0FA 2NVTH 1V1OA 3ONAB 1J6QA 1KL9A 5C0XH 4DR4Q 4JI6L 3RLOA 2GVAA 2B39A 1JJGA 2K75A 1M8AA 1CSQA 3K0YA 1BR9A 1YJWA 5JEAH 2ICIA 5IT9L 4ODGA 2F0MA 3TN2A 1A2TA 4R9WA 4GKKL 2ID0A 1Y1VH 2AHOB 2JP1A 2WKCA 4TRDA 4KK7A 4MTNA 1XMOQ 2EY1A 4DV0Q 1WTXA 3UDFA 5DM63 1HPCA 1LT3D 3QJYA 4IUVA 1D6EC 3PF5A 1DOLA 3ND8A 2F52A 1HFGA 4B3MQ 3S14B 1STGA 5ELNA 4OX9L 3ERQA 5KRUA 4IJLA 2HHHL 2H1EA 2MUYA 1LO5D 2FINB 4YCWA 1W2BA 4QB4A 3BU2A 5IWAL 3LX0A 4OIKA 1PRTF 1WTPA 3HOYG 5EGTA 1SE4A 2TSSA 4LW1A 1TS4A 4GLXA 4R8IA 2F0GA 2OWOA 1ENAA 2YU9H 1HNWQ 3I56A 1C7YA 5ELOA 4L5SA 4JI8Q 1EIYB 1MIUA 1U5KA 5C0XG 4L8JA 2CW0D 4BA1I 4YCVA 4G7ZC 4IUUA 2Q2UA 1VQNA 3I90A 2Z0SA 2V4DA 2O2LD 3TEHB 5JEAG 1XMOL 4DV0L 3GTJB 2PQEA 4JYAQ 4GS3A 3GTOH 1QB5D 3H94A 4OONA 2UXDQ 4PZ7A 3G7LA 5NUCA 5I9PA 4Y7NB 4IOCA 3GTQH 2B2WA 4HEDA 1XJVA 1X3FA 4RKLA 1XNQL 1JORA 3RN2A 4B3ML 3E0EA 3QWNA 1WTRA 2O5IC 3HOUH 1IBLQ 4KN7C 1K0RA 1K0SA 1SEBD 3J7A5 2XIWA 2IWHA 3DUZA 4IURA 1C8CA 1AE2A 5HGTA 4X3SA 2EJMA 3QB3A 1DGSA 1HH2P 1N33Q 1UWVA 2JN4A 3QIAA 4F87A 4CKBA 1PMRA 1GUTA 3GDEA 5G3LD 1CSPA 2Y0SG 2L0CA 4GN3B 4KJOA 1S4ZA 3N6RA 4P2CB 5C3EH 3CW2C 2PNRC 3GO5A 2XRSD 1Y1VB 1IXRA 4G57A 1I6VC 2KUMA 4LMQD 2EZVA 1E7ZA 2KHJA 1F2LA 1SN8A 4A3KG 1IKLA 4EQOA 1U4LA 5M5YH 1N32L 4KHZA 3L2PA 4WJ4A 1BBXC 2K5HA 3CCQA 4WFN3 4JI7Q 3EVQA 1PFBA 1KNAA 3K6OA 4RMFA 2A69D 2UXCQ 2NTTA 3U58A 1HUMA 3CCUA 3I73A 3HOUG 2BE5D 3WWVA 2G5DA 3ITPA 5DM73 1PTOF 1SMYC 4IUQA 4LF6L 3M4QA 1BNZA 1C4QA 3Q8DA 2YU9B 1I94Q 2NVYH 2WB1G 4M1UB 1SXTA 2PZUA 5CBEE 1PLFA 3N52A 4KV6A 2NN6H 1TU2B 2N8NA 4YIJA 3FPUB 4XYQA 4AYBG 3E9HA 1GOZA 5C3EG 2OTJA 3PUWA 3GTOB 4IJHA 1ET9A 1EIFA 4XQNA 4QGUA 3GTQB 3CP0A 1K8MA 2NUCA 3HOUB 4DV2L 1PH5A 3K5NA 1FNVA 2B8FA 3U50C 4DGZA 2R3ZA 1AN8A 5IODA 1BUVT 2EPBA 4A3GH 1QVCA 2UXCL 3D31A 4DV3L 5A35A 5M9OA 5IYDH 2PW5A 2WB1B 2NZOA 4AQYL 2XRQD 2R7DA 1MJEA 1B4OA 4DV5L 2UXBQ 4K5VA 4QF4A 3D6WA 3Q6SA 2HUGA 1SR3A 3F2DA 3L0OA 5JOBA 4RGOS 3T56B 5C3EB 3GTKH 2B8GA 4B08A 3VA7A 5GQOA 3HOWH 3J7AF 1YVCA 4BS9A 4L63B 3HOXH 3IFTA 2E2JH 3U4VA 1LTAD 1HNZQ 3ULPA 3CC2A 1K3RA 5M5YB 1I4XA 1EWHA 2NN6G 3DLLA 3RZDH 1K28A 2KHSA 5D65A 5IOCA 1RODA 3TP6A 3I4MH 1QZHA 3J81L 1I3QH 3JAML 2UUBQ 4K2LA 4MN3A 1Y14B 3HZXA 1O7YA 3G71A 1RJTA 4YHHQ 3KJOA 2RHSB 1ICWA 2AQ1B 4HSVA 4A3DH 3VR6A 4HIKA 4A3GG 1PZJD 2DN8A 5IYDG 2NVYB 3UDXA 4C2MB 1Q12A 3NXWA 1AFPA 5I2XA 2FJ2A 4BY7H 2F3VA 3HKZG 4K0KL 1X54A 2N88A 3M4OH 2L15A 3U9SA 1UNSA 3W1GA 2CW0C 2WINB 2B2TA 4LF8Q 3KJPA 5CV5A 4GOPA 2JYOA 2R92H 1HZ9A 4R1JA 3M7NA 3HOWG 3HOXG 3S17H 3S1NH 4FXDA 4XIGS 3MXGA 4DR1Q 4CDCC 1N34L 4R4IA 3DM1A 5CORA 1LLRD 1VMCA 4FXGC 1UE5A 2XNAC 2EY5A 1Y8NB 3I4MG 4A3GB 3KDFA 1V43A 1JCKB 3FKIH 2UUBL 1DOKA 3TZUA 2A5HA 1VQPA 4C1NI 1TWHH 4K14A 1LTTD 4DV4L 3PGZA 4R4OA 1F9PA 3GV6A 2C35B 3AFPA 4N8FA 1NMGA 2AUKA 1EQQA 2ZXPA 1EYDA 1CFMA 1VF5C 4H7BA 2ZTCA 4PMCA 1FYCA 1X55A 4A3DG 3GTKB 1XMQL 3OMCA 2QDBA 2RF4A 2K32A 3HOWB 4JBMA 4GN5A 2R7ZH 5IT9c 3HOXB 2IJ0A 2RDHA 4PMBA 4GZYC 5C3WA 5EKLA 3EJIA 4BY7G 1P16A 3VR4A 1K9MC 2K6AA 2CH4A 1KRTA 3F2BA 3NUCA 1F9SA 4JK1C 1E2VA 1SRUA 1MHWC 3I4MB 4GLVB 3E3XA 1I4GA 1X3EA 1I3QB 1IL8A 2WAQE 1SYEA 1AP0A 1MSGA 2GN5A 5G3LF 2YYZA 2ZTDA 3FPPA 4HSPA 5F2DA 1FGUA 2E2HH 2WKDA 4WORA 3KBGA 5CC4A 4A3DB 2XSCA 3S24A 3TRZA 3HEJA 1V9PA 4C3IH 1L1OA 3FKIG 1A63A 3KOJA 4IFDH 1PYSB 2L5TA 4BY7B 2B2WC 1EY8A 3FDTA 1TR5A 1MGSA 3KLSX 4PV1C 4POGA 1LTLA 3M4OB 2LXKA 4X64Q 1H9JA 1B44D 1QJOA 4N9PA 2B3GA 2R92B 3CD6A 2PI2E 4QY7A 1TWCB 3AB9A 3OW2A 2UUAQ 5JJIA 4HR7B 5AJ3Q 2M00A 1HUNA 4OO1H 1KRSA 4LF9Q 3S17B 3S1NB 1D1IA 1KXLA 3GTPH 4CDFC 1XNRL 5IT9E 3JC66 1QG7A 3C3LA 4KHPQ 3MHBA 5KEEA 2IX3A 3MVVA 4OELB 1KAWA 3MXNA 4O0AA 4LAAA 1VQMA 1E24A 4MZ9A 1VQEA 1VQLA 4GKJL 1WI5A 1O7IA 1UE1A 3H3VI 4KKUA 5CV6A 4TKOB 1B9NA 1N9WA 4A3LH 2Y0SE 5I2YA 4B3SQ 5FLXE 1M90C 2I5HA 2K05A 3NWTA 1GHKA 5M5XB 4C3IG 1VQKA 4WRDA 1VQ6A 3K7UC 4OL7A 1E1TA 4R8NA 2R7ZB 3L7ZC 3ERSX 4X64L 4IFDG 1TWGB 1D7QA 5GAHC 3K0XA 1F77A 3EROA 1KDAA 4YCUA 3VYTA 1SNQA 4RKBA 3NK9A 2UUAL 4DNRB 4OHJA 4P73A 3TSSA 2DY7A 4PNYA 3HS0C 3MXUA 2QF7A 4LF9L 1U4MA 4GOPB 4ZRZA 2SOBA 4JI0Q 3SVMA 4KHPL 3SHLA 4FF3A 4X6AH 1TT2A 4RHSA 1STHA 2QW7A 2MGSA 3RR5A 1VDZA 1WTHA 1RTOA 2E2HB 3QR8A 1YNJD 3SEBA 3AYHB 1S40A 1S72A 3V2TA 2VQFQ 4LF4L 5C3XA 3E9IA 1SE3A 2KVMA 5GAGC 4B3TL 4DR7Q 1EY6A 2CVRA 2OCEA 3KDFB 4FO2A 3S16H 1LT6D 1PZID 2QILA 3T53B 3CRKC 4XTCS 4A3LG 1FGBD 1BQQT 2KA7A 2HT1A 1YBYA 5I4DA 3TDQA 2A68C 3J7AV 5IGFA 3MEHA 4DV7Q 4KY6A 1C9OA 4N9TA 3H09A 3K5OA 4EGVA 2RBMA 3OHXC 2M2LA 1TS5A 2K5QA 4JI0L 2LXJA 1HR0W 3OPOA 4DR6L 4QUCA 1JWUD 4C1NK 5LMNQ 5FO8B 3F8TA 4CJ1B 3GTGH 1VQHA 2ZJQA 4LF5Q 2BOSA 4A3BH 4DNTB 1PH1A 4X66Q 2A73B 2MP1A 4IPGA 1FJGQ 1ILQA 1TQOA 2RVLA 2ZTEA 4F88A 2FXQA 3A5UA 3FHWA 1OO9B 1EQVA 2NWGA 2ATWA 1L1OB 2RSOA 1D2BA 3CCRA 2Z6KA 2I5MX 4OEMB 1PVOA 1DYQA 1IW7C 3NBHA 2PI2A 3S2HH 3HOVH 4DUZL 4DV7L 2KQ3A 5C4XH 4I65A 1NBWA 1STAA 1Q8IA 1RKNA 4RCOA 2Z4HA 4GKKQ 1H9RA 2E74C 1ESRA 4NPSA 5EAYA 3J81c 4X62L 1RHPA 2AKWB 2B2TC 2X6GA 2OTLA 4GOPC 1IZ6A 4H44C 5I6YA 1JWMD 4HCSA 3MXNB 1VQ4A 2MQHA 3C1FA 4KMUC 1JJ2A 3CCLA 3HKZE 2Q2HA 3F2UA 3TREA 3S16B 1FJGL 2HHHQ 4A3BG 4A3MH 4IPCA 3HOYH 3NELA 5IWAQ 1F2MA 1X3QA 4IN3A 1NR2A 4ME5A 5DAUA 3DEPA 3EA6A 3UE0A 1WYDA 2BDNA 4K8IA 1EU3A 4OWTB 4I7AA 5M3MG 1O7LA 2JA9A 3T4AC 2FMCA 4CBVA 2N55A 1L0XB 3BVGA 2WFWA 2PMZE 1JQYD 1PTOB 1KDCA 1N8RC 3C1EA 3DWPA 4DR5Q 3MC0B 2F0LA 4JW0A 4LWCA 1YIJA 2VY3A 3HOVG 1PFNA 3OSOA 1I4RA 5C4XG 1O80A 1PRTC 3CQZH 1PH8A 4FP5D 2DGYA 2JA8H 1CZGA 3GTGB 4YY3Q 3EQLC 5IIFA 1SNPA 1NMFA 2EIFA 3F1ZA 2L11A 4OIJA 4MHEA 1CK1A 4A3BB 5DEHA 5IP9H 3RNUA 2EY6A 2OXPA 1GVPA 5FK9C 4B9XA 2F1MA 3OTOQ 3CCJA 2ZJPA 2N78A 2F0PA 1XNQQ 1RIPA 3I70A 1V8QA 2AUJD 1KLGD 2FHTA 3K58A 4K5XA 1VQ8A 4UDUC 1TIID 2HQLA 3CHBD 2WAQG 4XQJA 2CKZB 2IL8A 1DOMA 3P75A 4A3MG 2LFNA 4Z9CB 1LABA 5FJ8H 3S2HB 2F0JA 4ID6A 4FDBA 5CV7A 4X3TA 1VQ9A 5C4XB 1L1OC 3KF8A 4A3IH 5FO7B 1NJIC 3PO2H 3OYYA 1W6KA 4JBJA 1FD7D 1KNEA 3ULJA 4DR5L 4A3KH 1CA5A 1J8IA 4E6IA 2MO0A 4KI0A 2ZM6Q 1PXUA 4IO9A 5M5WH 1K73C 3MWYW 1TY0A 2RCFA 1PZKD 5GAEC 3NENA 5KIXA 1BF4A 1NNXA 1NSNS 4YY3L 4HMIA 3PIO3 4FF2A 1N32Q 1DD2A 1ET6A 1GKHA 3O13A 4CKEA 1HTLD 1YHAA 2VUMH 1EY4A 1EOVA 2O5JC 2WAQB 3OTOL 2JA8G 2EYHA 3K59A 2RA4A 4NXMQ 4A75A 4B3RQ 2UUCQ 3CCVA 4IQZA 5IP9G 4A3MB 1F9RA 1SLJA 4NXNL 1VQ7A 3HOYB 3RLNA 1H9KA 4DAYA 1CHPD 2KJXA 2MFIA 1L0YB 3KLSA 1GJXA 2NVTB 1IYUA 1A15A 3R2TA 4LF6Q 1NR4A 2JA5H 2E75C 3KLRA 1E2ZA 3CMAA 2VB2X 3IKJA 2Z8LA 4UY8C 4R4TA 3I2ZA 3GTMH 2J4XA 2QGQA 5FJ8G 4OXPA 1PH7A 1W6JA 5KNBA 1PFMA 1SMXA 5H1SE 1F2ZA 1HZBA 3NBHB 5T1IA 4A3IG 1JC7A 4UPAA 3T1YQ 4FF1A 3CQZB 4AH6A 3PO2G 1PTOC 2ZM6L 5KNCA 1S3OA 4FVMA 2BA0A 5EBDA 1YI2A 5KYIA 4K2KA 2CCZA 3S1RH 4IUTA 1EYGA 5K36H 4DKAC 1KC8C 1VQCA 2IX0A 1BCPD 3J7YW 4DV2Q 1IKMA 3S1MH 4RGNA 4NXML 3FRPB 2K5VA 4AIMA 4BBSH 4B3RL 2UUCL 1JMCA 2VUMG 1RTNA 2WP8J 3D8GA 2G9DA 4DV3Q 1D5ZC 1PH9A 3J81i 3PUVA 4AQYQ 2Y0SB 3PUXA 3RLFA 4DV5Q 3ER0A 3SGIA 3IAYA 4DV1Q 1DCZA 1XYIA 2EJGC 4A3IB 3PO2B 4A3EH 3SDZA 2VB3X 1YNND 3CC4A 5IYCH 3I4NH 3K57A 4JOIA 2JE6I 5JJKA 4A3KB 2JA5G 3I91A 1JR0D 1HTPA 1Z7TA 3G4SA 2HDMA 4RHRA 4DXGA 2SEBD 3T1YL 1ASYA 2F0SA 1AZQA 2RHQB 5M5WB 5D3DA 2HCIA 1BOSA 2ES2A 2HQEA 1L2FA 4TQUS 3IL8A 3PUYA 1A3VA 1YNXA 2VUMB 1VS0A 2ZXRA 3VYRA 3PF4A 1VQOA 1SNCA 5C0XI 2K5NA 4LFBQ 1B3QA 3AU7A 5LHY1 3VYUA 1LTRD 3RD4A 1UE7A 3MAQA 5K36G 3A8IE 1QOHA 1Y8OB 2LSSA 2LY7A 2PW7A 3ND9A 1DZ1A 1LYLA 1Q46A 3PSIA 3R8BA 4BBSG 4JI3L 2NVXH 4J15A 4XT1B 5CYUA 5IGGA 2JA5B 1H9MA 5IGDA 1VQJA 5IE8A 4L5TA 4DV1L 2EQSA 2N49A 4L6TB 4N8X1 2QKIC 1SDFA 5LMUQ 2KECA 4AYBB 5EPLA 5C4JH 4K0KQ 4DAMA 5EKIA 2B2VA 2JEBI 3STBD 3U4ZA 4RAUC 4LUVA 2B2UA 4A3EG 4KY7A 5IYCG 3I4NG 3KF8B 2K1BA 2Z6KC 2Q8RE 1BCPB 3SE0A 2MO1A 1RCVD 2KCMA 3S1RB 1X3PA 2EOTA 2K5WA 4P74A 4JI1L 1N34Q 3H15A 3S1MB 3PMFA 3M4YA 3I7FA 1IBKL 4LFBL 4MNOA 3M7GA 2AMCB 1B53A 1I4PA 3TZDA 1E1OA 4KN4C 4LUZA 1SAPA 1G51A 3KK7A 4KLKA 2EYOA 4DV4Q 1PH6A 1UE6A 4A3EB 1TKWB 1UEBA 4ZAIA 4IPHA 4DAYB 1EY0A 3BVZA 1XMQQ 2SNMA 5LMUL 1M4VA 4DUYL 2KOLA 2RDFA
chains in the Genus database with same CATH topology
3J81j 1N9WA 2VL6A 1IBML 2IT1A 4LFCQ 2Y0SE 5C44H 4A3LH 1OXTA 1PH3A 4B3SQ 2IHEA 2KHIA 1M90C 1HNWL 1MKHA 1OXVA 2I5HA 4APVA 3GTJH 3G6EA 5LMNL 1CKNA 2BA1A 4DK6C 4JI8L 1VQKA 1VQ6A 1PFSA 3K7UC 4LF5L 1E1TA 2BH2A 4R4CA 3L7ZC 1BKBA 3ERSX 4X64L 3M85A 4IFDG 4IFDJ 4P71A 4Y7NH 1GO3E 4X66L 1OXXK 3CC4A 2ZJRA 4OX9Q 2R93H 5GAHC 3K0XA 3K81C 4LFAL 4DR2L 1YITA 4JI3Q 1WFQA 3KYHC 4YCUA 4JYAL 4R4QA 3EIVA 1G291 1GM5A 4DNIA 3JAMi 1A0IA 1QZGA 2UUAL 1TXYA 1PYBA 4P73A 1SROA 1B70B 2UXDL 4HJ7A 2RCNA 2JJQA 1FVIA 5FLMG 4LF9L 1Q1EA 3FP9A 3PO3H 1HZAA 1V1QA 1VQGA 4GOPB 3D0FA 4JI0Q 4JI4Q 2QEXA 2NVTH 4KHPL 1J6QA 4X6AH 1KL9A 1PV4A 2PQAB 1XPOA 1IBLL 3RLOA 2GVAA 4JI6L 4DR4Q 3K8AA 2HIVA 3RR5A 1JJGA 5IY0A 2K75A 1E22A 1CSQA 4GN4B 1YJWA 3AYHB 1VQBA 1S40A 1S72A 2VQFQ 4LF4L 1N33L 4GKKL 2ID0A 1Y1VH 2OQ0A 2AHOB 3E9IA 2KENA 4GNXA 5GAGC 4B3TL 4UP9A 2OCEA 4MTNA 4X65Q 4LFCL 4DV0Q 4JI1Q 3KDFB 4C2MH 1XMOQ 3KF6A 3UDFA 1TWFH 4QJFA 1W3SA 4L5RC 3S16H 1IBKQ 5JJIA 1YJ9A 3H0GG 4XTCS 3PF5A 1XMOL 1SFOH 4A3LG 4GLAC 5C44G 2HT1A 1YBYA 1XNRQ 2F52A 2JQOA 1YEZA 4B3MQ 2A1AA 3K80C 2B63H 5ELNA 4OX9L 1JJCB 1EQRA 5BR8L 1Z47A 4IJLA 4LF7Q 4IPDA 4DV7Q 2HHHL 1C9OA 2R93G 3ZJYC 4YCWA 2AWNA 1W2BA 1Q82C 4GKJQ 3BU2A 3NEMA 5IWAL 1OXSC 2IHFA 2I5LX 4HJ8A 3PUZA 2HIXA 5GROA 1D7QA 2NN6I 4DUYQ 4JI7L 4JI0L 3HOYG 1XPUA 2LXJA 1IBMQ 1I50H 4LW1A 4GLXA 1HR0W 2OWOA 4DR6L 3PO3G 2YU9H 1HNWQ 3I56A 2VNUD 1C7YA 5LMNQ 5ELOA 4L5SA 3F8TA 4JI8Q 1EIYB 3GTGH 1MIUA 1VQHA 2ZJQA 1U5KA 4LF5Q 5C0XG 5C0XJ 4BA1I 4YCVA 3HFZB 4A3BH 2Q2UA 1VQNA 1PH1A 4X66Q 2Z0SA 2JA7H 3ICEA 1E3PA 4LFAQ 2NZHA 4JBWA 5JEAJ 4IPGA 3TEHB 4YWLA 5JEAG 4X65L 4DV0L 4DR2Q 1I94L 1FJGQ 3M3YH 4GS3A 4JYAQ 2ZTEA 4BA2I 4WJ3M 1PA6A 2K4KA 1P8LA 2YTYA 5DLQE 3GTOH 3KFUA 1X65A 2FXQA 3A5UA 3FHWA 4OONA 3CCEA 1Q7YC 2UXDQ 4PZ7A 3BJUA 3AFQA 1Y1WH 2ATWA 1L1OB 3H3VH 4P75A 4IOCA 3CCRA 3GTQH 2GVBA 3M9BA 2Z6KA 2I5MX 3TQYA 1XJVA 1X3FA 2F4VQ 1X56A 1XNQL 3RN2A 4B3ML 4YWKA 1PVOA 3E0EA 3HOUH 4H02A 2D0OA 1YHQA 3A0JA 2PI2A 3S2HH 4LF7L 1IBLQ 3HOVH 1K0RA 4DUZL 4DV7L 4A76A 1J5EQ 2I0QA 3J7A5 2VS1A 5C4XH 4NB3A 1NBWA 2B63G 1X3GA 1AE2A 1G6PA 1PH4A 1OTCA 1R9TH 1B8AA 2B29A 1DGSA 1HH2P 5J3BA 4LF4Q 1N33Q 4GKKQ 1UWVA 2JA6H 2VQEQ 4B3TQ 3H0GH 2MNAA 4NPSA 5EAYA 3J81c 3CF5A 3GDEA 4X62L 3T1HQ 1CSPA 2AKWB 2R6GA 2Y0SG 4GN3B 2YTXA 2OTLA 2H5XA 1IZ6A 4GOPC 1Q86C 1YZ6A 3CW2C 5C3EH 2E5LQ 1VCIA 1XTDA 3GO5A 1IXRA 3MXNB 1OXUA 1VQ4A 2MQHA 1JJ2A 2UXBL 1WCMH 5M3FH 3CCLA 3HKZE 1E7ZA 2KHJA 2Q2HA 1SN8A 3TREA 5BR8Q 4DK3C 4A3KG 1PH2A 4JV5L 1FJGL 4DV6Q 1EFWA 3CMEA 2HHHQ 4JI2L 4A3BG 2NVQH 4A3MH 5M5YH 1HZCA 4IPCA 4BY1H 2JA7G 3HOYH 4KHZA 1N32L 3NELA 1A8VA 5IWAQ 3L2PA 2A19A 4WJ4A 2K5HA 4A3JH 1MJCA 3UE0A 1VQFA 1WYDA 3CCQA 2F4VL 1TWCH 1BVSA 1D8LA 3LGJA 2Q2IA 4LUOA 4OWTB 1CKNB 1HNZL 4JI7Q 5M3MG 4JOIC 4RMFA 1Y1WG 3PCOB 2JA9A 4DR6Q 1FL0A 1VQ5A 1I6HH 2UXCQ 2WFWA 3U58A 3CCUA 2PMZE 1J5EL 1N8RC 1B7YB 3HOUG 3WWVA 2OQKA 4DR5Q 4O2DA 1YIJA 4LWCA 2VY3A 3M4PA 3HOVG 1K8AC 4LF6L 3M4QA 5C4XG 2EXDA 2VQEL 3Q8DA 2QA4A 3CQZH 1I94Q 1X9NA 1PH8A 2NVYH 3GTLH 2WB1G 3T1HL 2DGYA 2JA8H 4YY3Q 1L0WA 4YHHL 2JA6G 1A62A 1NMFA 1SE8A 2EIFA 3F1ZA 3GD7A 4JC0A 3G48A 1K83H 1EWIA 5IP9H 3RNUA 2E5LL 2F3IA 1GVPA 3CCJA 4QQBX 3OTOQ 2ZJPA 2N8NA 2N78A 4AYBG 1XNQQ 3E9HA 1VQDA 1RIPA 5C3EG 2OTJA 3PUWA 5M5XH 4HJAA 1QVGA 4Y52H 4IJHA 4DV6L 4OWXB 4DUZQ 1VQ8A 2HQLA 1EIFA 1WCMG 4C3JH 2WAQG 1Q1BA 5M3FG 1TWGH 1KQSA 3S1QH 4P72A 2CKZB 4GNXB 4QGUA 4LF8L 3CP0A 3K7AH 3KF6B 2PNHA 2IY5B 4DV2L 2XGTA 1PH5A 4A3MG 5FJ8H 1IL2A 3U50C 4BY1G 4FDBA 1VQ9A 4A3GH 1QVCA 1L1OC 4X62Q 3D31A 2R92G 2UXCL 4A3JG 2DUDA 4DV3L 4A3IH 4HIOA 1NJIC 4DR1L 3OYYA 3PO2H 5IYDH 4JBJA 1WJJA 2NZOA 1Q8KA 3ULJA 4AQYL 2R7DA 4DR5L 4A3KH 1MJEA 4DV5L 3W1BA 2UXBQ 2KBNA 2ALYB 2MO0A 5FLXc 1YJNA 4A3CH 2JK8A 2E2IH 4KI0A 2ZM6Q 3CXCA 2BH8A 4IO9A 4JV5Q 5M5WH 1SR3A 1U0LA 3EN2A 3L0OA 4UP7A 3F2DA 1K73C 2KCTA 5GAEC 3NENA 2YV5A 4JI2Q 4EQ5A 1HR0L 3GTKH 3UE1A 4YY3L 2Q2TA 1N32Q 1RL2A 3CC7A 1GKHA 5GQOA 3HOWH 5M3MH 1YHAA 1YVCA 2VUMH 1EOVA 3HOXH 3OTOL 2E2JH 2JA8G 3AEVA 3U4VA 1JE5A 1YHBA 4A75A 4NXMQ 4B3RQ 1HNXQ 1HNZQ 2UUCQ 3J80c 3CCVA 3S2DH 4ME3A 3ULPA 3CC2A 2D0PA 5IP9G 4PG3A 1K3RA 1SLJA 4NXNL 1VQ7A 2NN6G 3DLLA 3RZDH 3RLNA 3I4MH 1QUQA 4JG2A 2MFIA 1QZHA 3I4OA 1I3QH 1NY4A 4LF6Q 2R7ZG 2JA5H 3CMAA 5HY6A 2UUBQ 1IYJB 4UY8C 4R4TA 3I2ZA 3UDGA 1Y14B 3GTMH 1K8GA 3G71A 2CFMA 2QGQA 2YTVA 2K50A 4OXPA 5FJ8G 4YHHQ 2RHSB 3KJOA 3JAMc 1PH7A 3BZCA 5JJLA 1M1KC 1SMXA 5IYBH 3RZOH 4B3RL 4A3DH 2CQOA 2K14A 5H1SE 5LMNW 1HZBA 3NBHB 4HIKA 4A3GG 3A5ZB 4A3IG 3T1YQ 4UPAA 3STBC 3PO2G 4AH6A 5IYDG 3UDXA 1Q12A 3A74A 1H95A 2ZM6L 4OO1I 1S3OA 3VDYA 4BY7H 3HKZG 3W5OA 2JEAI 4K0KL 1X54A 2BA0A 1YI2A 3M4OH 2L15A 4PMWA 5IP7H 4A3CG 4A93H 3W1GA 2CCZA 1XPRA 3S1RH 1EYGA 4JI5Q 4LF8Q 3KJPA 4DKAC 1KC8C 4DR7Q 3B6YA 4GOPA 3TS2A 1VQCA 2R92H 2IX0A 4DV2Q 3HOZH 1HZ9A 3S1MH 4R1JA 4NXML 2K5VA 4AIMA 1HNXL 3M7NA 4C3HH 2UUCL 2PQAA 3HOWG 1JMCA 4BBSH 1I5FA 2VUMG 2WP8J 1PHJA 3HOXG 3S17H 4DV3Q 3S1NH 1PH9A 1NE3A 4XIGS 4DR1Q 3J81i 3PUVA 1LUZA 3HKSA 4L5QA 4PZ8A 4AQYQ 1N34L 4R4IA 3PUXA 3BZKA 3RLFA 4DV5Q 3ER0A 1UE5A 4YWMA 5HGQA 3SGIA 5AJ3L 4DV1Q 3I4MG 3KDFA 1V43A 3FKIH 2UUBL 4GNXC 4A3EH 4QL5A 4A4IA 3TS0A 1HR0Q 1VQPA 2CWAA 1WOCA 4JCVE 4TVAB 4JOIA 5IYCH 4HIDA 1TWHH 2JE6I 3I4NH 3PIPA 2JA5G 4UP8A 4BXXH 1KIXA 4OO1G 5JJKA 3G4SA 4DV4L 2UU9Q 2AWOA 3PGZA 4R4OA 4EX5A 2C35B 1NTGA 4BXXG 3T1YL 3AFPA 1ASYA 1NMGA 2RHQB 1EQQA 1CKOA 2ZTCA 2ES2A 5IYBG 1X55A 5E7NA 1L2FA 3CPWA 3DM3A 1XMQL 4TQUS 4A3DG 2RF4A 3PUYA 4NXNQ 4A3FH 1YNXA 4JBMA 2WB1E 4GN5A 2R7ZH 1VS0A 4PZ6A 3ULLA 1EUJA 5IT9c 3PF4A 1VQOA 4B3SL 2A8VA 4JI5L 4BY7G 5C0XI 2K5NA 1P16A 4LFBQ 1C0AA 3IRBA 1K9MC 1KHIA 2V1CC 4OWWB 1KRTA 5IP7G 1N36Q 4A93G 4HIMA 1UE7A 3F2BA 4AYBE 2CWPA 5K36G 2LSSA 1SRUA 4GLVB 3HOZG 4QIWE 1X3EA 1LYLA 2D62A 1Q46A 3PSIA 4BBRH 4DR3Q 3RN5A 4BBSG 2IX1A 4JI3L 2R7FA 2NVXH 2WAQE 4J15A 2N3SA 1AH9A 1VQJA 3AQQA 5IE8A 2GN5A 2YYZA 4L5TA 2ZTDA 1VQIA 2EQSA 2N49A 4DV1L 3CPFA 1FGUA 2E2HH 1JT8A 5LMUQ 5C4JH 2E8GA 4K0KQ 1KD1C 4DAMA 3CCSA 3I55A 4JI4L 4HJ9A 1LM0A 2JEBI 3S24A 3STBD 1V9PA 4C3IH 3PIOA 3TRZA 3U4ZA 1L1OA 1Q81C 3FKIG 4IOAA 4HJ5A 4LNQA 4LUVA 4DR4L 1AE3A 1TWAH 4A3EG 2UU9L 3UDIA 1A63A 3KOJA 3S15H 5GADC 1PYSB 3KLWA 5IYCG 3KF8B 3I4NG 1BBWA 2Z6KC 1GD7A 4POGA 1LTLA 2VQFL 2LXKA 2MO1A 4X64Q 1QVFA 1CUKA 2KCMA 1CKMA 2B3GA 1JB7A 4DR7L 1BBUA 4JI1L 4DPGA 4P74A 5FLMH 1N34Q 3CD6A 2PI2E 3H15A 3S14H 4QY7A 3J7ZC 3OW2A 3I7FA 1IBKL 2XTIA 1Y1VG 2UUAQ 4MNOA 5AJ3Q 4A3FG 2ASBA 4LFBL 3CAMA 1Z9FA 2AMCB 4IFDI 3F2CA 1N36L 1KRSA 4RG1A 4LF9Q 1KXLA 3GTPH 1E1OA 1XNRL 2K52A 3JC66 4LUZA 1HJPA 1G51A 4ALPA 3EBEA 1ASZA 4KHPQ 4DR3L 1KAWA 4KLKA 4O0AA 4DV4Q 1VQMA 4JI6Q 1X6OA 1PH6A 1UE6A 1E24A 4MZ9A 3CCMA 1VQEA 2VW9A 1VQLA 1VQAA 4GKJL 4BBRG 1WI5A 1O7IA 2VZAA 1UEBA 4IPHA 1QUQB 4DAYB 4JBKA 1T9HA 1UE1A 1XMQQ 3PV0A 5LMUL 3H3VI 3MEFA 3J80i 4DUYL 4POFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 j;  1N9W A;  2VL6 A;  1IBM L;  2IT1 A;  4LFC Q;  2Y0S E;  5C44 H;  4A3L H;  1OXT A;  1PH3 A;  4B3S Q;  2IHE A;  2KHI A;  1M90 C;  1HNW L;  1MKH A;  1OXV A;  2I5H A;  4APV A;  3GTJ H;  3G6E A;  5LMN L;  1CKN A;  2BA1 A;  4DK6 C;  4JI8 L;  1VQK A;  1VQ6 A;  1PFS A;  3K7U C;  4LF5 L;  1E1T A;  2BH2 A;  4R4C A;  3L7Z C;  1BKB A;  3ERS X;  4X64 L;  3M85 A;  4IFD G;  4IFD J;  4P71 A;  4Y7N H;  1GO3 E;  4X66 L;  1OXX K;  3CC4 A;  2ZJR A;  4OX9 Q;  2R93 H;  5GAH C;  3K0X A;  3K81 C;  4LFA L;  4DR2 L;  1YIT A;  4JI3 Q;  1WFQ A;  3KYH C;  4YCU A;  4JYA L;  4R4Q A;  3EIV A;  1G29 1;  1GM5 A;  4DNI A;  3JAM i;  1A0I A;  1QZG A;  2UUA L;  1TXY A;  1PYB A;  4P73 A;  1SRO A;  1B70 B;  2UXD L;  4HJ7 A;  2RCN A;  2JJQ A;  1FVI A;  5FLM G;  4LF9 L;  1Q1E A;  3FP9 A;  3PO3 H;  1HZA A;  1V1Q A;  1VQG A;  4GOP B;  3D0F A;  4JI0 Q;  4JI4 Q;  2QEX A;  2NVT H;  4KHP L;  1J6Q A;  4X6A H;  1KL9 A;  1PV4 A;  2PQA B;  1XPO A;  1IBL L;  3RLO A;  2GVA A;  4JI6 L;  4DR4 Q;  3K8A A;  2HIV A;  3RR5 A;  1JJG A;  5IY0 A;  2K75 A;  1E22 A;  1CSQ A;  4GN4 B;  1YJW A;  3AYH B;  1VQB A;  1S40 A;  1S72 A;  2VQF Q;  4LF4 L;  1N33 L;  4GKK L;  2ID0 A;  1Y1V H;  2OQ0 A;  2AHO B;  3E9I A;  2KEN A;  4GNX A;  5GAG C;  4B3T L;  4UP9 A;  2OCE A;  4MTN A;  4X65 Q;  4LFC L;  4DV0 Q;  4JI1 Q;  3KDF B;  4C2M H;  1XMO Q;  3KF6 A;  3UDF A;  1TWF H;  4QJF A;  1W3S A;  4L5R C;  3S16 H;  1IBK Q;  5JJI A;  1YJ9 A;  3H0G G;  4XTC S;  3PF5 A;  1XMO L;  1SFO H;  4A3L G;  4GLA C;  5C44 G;  2HT1 A;  1YBY A;  1XNR Q;  2F52 A;  2JQO A;  1YEZ A;  4B3M Q;  2A1A A;  3K80 C;  2B63 H;  5ELN A;  4OX9 L;  1JJC B;  1EQR A;  5BR8 L;  1Z47 A;  4IJL A;  4LF7 Q;  4IPD A;  4DV7 Q;  2HHH L;  1C9O A;  2R93 G;  3ZJY C;  4YCW A;  2AWN A;  1W2B A;  1Q82 C;  4GKJ Q;  3BU2 A;  3NEM A;  5IWA L;  1OXS C;  2IHF A;  2I5L X;  4HJ8 A;  3PUZ A;  2HIX A;  5GRO A;  1D7Q A;  2NN6 I;  4DUY Q;  4JI7 L;  4JI0 L;  3HOY G;  1XPU A;  2LXJ A;  1IBM Q;  1I50 H;  4LW1 A;  4GLX A;  1HR0 W;  2OWO A;  4DR6 L;  3PO3 G;  2YU9 H;  1HNW Q;  3I56 A;  2VNU D;  1C7Y A;  5LMN Q;  5ELO A;  4L5S A;  3F8T A;  4JI8 Q;  1EIY B;  3GTG H;  1MIU A;  1VQH A;  2ZJQ A;  1U5K A;  4LF5 Q;  5C0X G;  5C0X J;  4BA1 I;  4YCV A;  3HFZ B;  4A3B H;  2Q2U A;  1VQN A;  1PH1 A;  4X66 Q;  2Z0S A;  2JA7 H;  3ICE A;  1E3P A;  4LFA Q;  2NZH A;  4JBW A;  5JEA J;  4IPG A;  3TEH B;  4YWL A;  5JEA G;  4X65 L;  4DV0 L;  4DR2 Q;  1I94 L;  1FJG Q;  3M3Y H;  4GS3 A;  4JYA Q;  2ZTE A;  4BA2 I;  4WJ3 M;  1PA6 A;  2K4K A;  1P8L A;  2YTY A;  5DLQ E;  3GTO H;  3KFU A;  1X65 A;  2FXQ A;  3A5U A;  3FHW A;  4OON A;  3CCE A;  1Q7Y C;  2UXD Q;  4PZ7 A;  3BJU A;  3AFQ A;  1Y1W H;  2ATW A;  1L1O B;  3H3V H;  4P75 A;  4IOC A;  3CCR A;  3GTQ H;  2GVB A;  3M9B A;  2Z6K A;  2I5M X;  3TQY A;  1XJV A;  1X3F A;  2F4V Q;  1X56 A;  1XNQ L;  3RN2 A;  4B3M L;  4YWK A;  1PVO A;  3E0E A;  3HOU H;  4H02 A;  2D0O A;  1YHQ A;  3A0J A;  2PI2 A;  3S2H H;  4LF7 L;  1IBL Q;  3HOV H;  1K0R A;  4DUZ L;  4DV7 L;  4A76 A;  1J5E Q;  2I0Q A;  3J7A 5;  2VS1 A;  5C4X H;  4NB3 A;  1NBW A;  2B63 G;  1X3G A;  1AE2 A;  1G6P A;  1PH4 A;  1OTC A;  1R9T H;  1B8A A;  2B29 A;  1DGS A;  1HH2 P;  5J3B A;  4LF4 Q;  1N33 Q;  4GKK Q;  1UWV A;  2JA6 H;  2VQE Q;  4B3T Q;  3H0G H;  2MNA A;  4NPS A;  5EAY A;  3J81 c;  3CF5 A;  3GDE A;  4X62 L;  3T1H Q;  1CSP A;  2AKW B;  2R6G A;  2Y0S G;  4GN3 B;  2YTX A;  2OTL A;  2H5X A;  1IZ6 A;  4GOP C;  1Q86 C;  1YZ6 A;  3CW2 C;  5C3E H;  2E5L Q;  1VCI A;  1XTD A;  3GO5 A;  1IXR A;  3MXN B;  1OXU A;  1VQ4 A;  2MQH A;  1JJ2 A;  2UXB L;  1WCM H;  5M3F H;  3CCL A;  3HKZ E;  1E7Z A;  2KHJ A;  2Q2H A;  1SN8 A;  3TRE A;  5BR8 Q;  4DK3 C;  4A3K G;  1PH2 A;  4JV5 L;  1FJG L;  4DV6 Q;  1EFW A;  3CME A;  2HHH Q;  4JI2 L;  4A3B G;  2NVQ H;  4A3M H;  5M5Y H;  1HZC A;  4IPC A;  4BY1 H;  2JA7 G;  3HOY H;  4KHZ A;  1N32 L;  3NEL A;  1A8V A;  5IWA Q;  3L2P A;  2A19 A;  4WJ4 A;  2K5H A;  4A3J H;  1MJC A;  3UE0 A;  1VQF A;  1WYD A;  3CCQ A;  2F4V L;  1TWC H;  1BVS A;  1D8L A;  3LGJ A;  2Q2I A;  4LUO A;  4OWT B;  1CKN B;  1HNZ L;  4JI7 Q;  5M3M G;  4JOI C;  4RMF A;  1Y1W G;  3PCO B;  2JA9 A;  4DR6 Q;  1FL0 A;  1VQ5 A;  1I6H H;  2UXC Q;  2WFW A;  3U58 A;  3CCU A;  2PMZ E;  1J5E L;  1N8R C;  1B7Y B;  3HOU G;  3WWV A;  2OQK A;  4DR5 Q;  4O2D A;  1YIJ A;  4LWC A;  2VY3 A;  3M4P A;  3HOV G;  1K8A C;  4LF6 L;  3M4Q A;  5C4X G;  2EXD A;  2VQE L;  3Q8D A;  2QA4 A;  3CQZ H;  1I94 Q;  1X9N A;  1PH8 A;  2NVY H;  3GTL H;  2WB1 G;  3T1H L;  2DGY A;  2JA8 H;  4YY3 Q;  1L0W A;  4YHH L;  2JA6 G;  1A62 A;  1NMF A;  1SE8 A;  2EIF A;  3F1Z A;  3GD7 A;  4JC0 A;  3G48 A;  1K83 H;  1EWI A;  5IP9 H;  3RNU A;  2E5L L;  2F3I A;  1GVP A;  3CCJ A;  4QQB X;  3OTO Q;  2ZJP A;  2N8N A;  2N78 A;  4AYB G;  1XNQ Q;  3E9H A;  1VQD A;  1RIP A;  5C3E G;  2OTJ A;  3PUW A;  5M5X H;  4HJA A;  1QVG A;  4Y52 H;  4IJH A;  4DV6 L;  4OWX B;  4DUZ Q;  1VQ8 A;  2HQL A;  1EIF A;  1WCM G;  4C3J H;  2WAQ G;  1Q1B A;  5M3F G;  1TWG H;  1KQS A;  3S1Q H;  4P72 A;  2CKZ B;  4GNX B;  4QGU A;  4LF8 L;  3CP0 A;  3K7A H;  3KF6 B;  2PNH A;  2IY5 B;  4DV2 L;  2XGT A;  1PH5 A;  4A3M G;  5FJ8 H;  1IL2 A;  3U50 C;  4BY1 G;  4FDB A;  1VQ9 A;  4A3G H;  1QVC A;  1L1O C;  4X62 Q;  3D31 A;  2R92 G;  2UXC L;  4A3J G;  2DUD A;  4DV3 L;  4A3I H;  4HIO A;  1NJI C;  4DR1 L;  3OYY A;  3PO2 H;  5IYD H;  4JBJ A;  1WJJ A;  2NZO A;  1Q8K A;  3ULJ A;  4AQY L;  2R7D A;  4DR5 L;  4A3K H;  1MJE A;  4DV5 L;  3W1B A;  2UXB Q;  2KBN A;  2ALY B;  2MO0 A;  5FLX c;  1YJN A;  4A3C H;  2JK8 A;  2E2I H;  4KI0 A;  2ZM6 Q;  3CXC A;  2BH8 A;  4IO9 A;  4JV5 Q;  5M5W H;  1SR3 A;  1U0L A;  3EN2 A;  3L0O A;  4UP7 A;  3F2D A;  1K73 C;  2KCT A;  5GAE C;  3NEN A;  2YV5 A;  4JI2 Q;  4EQ5 A;  1HR0 L;  3GTK H;  3UE1 A;  4YY3 L;  2Q2T A;  1N32 Q;  1RL2 A;  3CC7 A;  1GKH A;  5GQO A;  3HOW H;  5M3M H;  1YHA A;  1YVC A;  2VUM H;  1EOV A;  3HOX H;  3OTO L;  2E2J H;  2JA8 G;  3AEV A;  3U4V A;  1JE5 A;  1YHB A;  4A75 A;  4NXM Q;  4B3R Q;  1HNX Q;  1HNZ Q;  2UUC Q;  3J80 c;  3CCV A;  3S2D H;  4ME3 A;  3ULP A;  3CC2 A;  2D0P A;  5IP9 G;  4PG3 A;  1K3R A;  1SLJ A;  4NXN L;  1VQ7 A;  2NN6 G;  3DLL A;  3RZD H;  3RLN A;  3I4M H;  1QUQ A;  4JG2 A;  2MFI A;  1QZH A;  3I4O A;  1I3Q H;  1NY4 A;  4LF6 Q;  2R7Z G;  2JA5 H;  3CMA A;  5HY6 A;  2UUB Q;  1IYJ B;  4UY8 C;  4R4T A;  3I2Z A;  3UDG A;  1Y14 B;  3GTM H;  1K8G A;  3G71 A;  2CFM A;  2QGQ A;  2YTV A;  2K50 A;  4OXP A;  5FJ8 G;  4YHH Q;  2RHS B;  3KJO A;  3JAM c;  1PH7 A;  3BZC A;  5JJL A;  1M1K C;  1SMX A;  5IYB H;  3RZO H;  4B3R L;  4A3D H;  2CQO A;  2K14 A;  5H1S E;  5LMN W;  1HZB A;  3NBH B;  4HIK A;  4A3G G;  3A5Z B;  4A3I G;  3T1Y Q;  4UPA A;  3STB C;  3PO2 G;  4AH6 A;  5IYD G;  3UDX A;  1Q12 A;  3A74 A;  1H95 A;  2ZM6 L;  4OO1 I;  1S3O A;  3VDY A;  4BY7 H;  3HKZ G;  3W5O A;  2JEA I;  4K0K L;  1X54 A;  2BA0 A;  1YI2 A;  3M4O H;  2L15 A;  4PMW A;  5IP7 H;  4A3C G;  4A93 H;  3W1G A;  2CCZ A;  1XPR A;  3S1R H;  1EYG A;  4JI5 Q;  4LF8 Q;  3KJP A;  4DKA C;  1KC8 C;  4DR7 Q;  3B6Y A;  4GOP A;  3TS2 A;  1VQC A;  2R92 H;  2IX0 A;  4DV2 Q;  3HOZ H;  1HZ9 A;  3S1M H;  4R1J A;  4NXM L;  2K5V A;  4AIM A;  1HNX L;  3M7N A;  4C3H H;  2UUC L;  2PQA A;  3HOW G;  1JMC A;  4BBS H;  1I5F A;  2VUM G;  2WP8 J;  1PHJ A;  3HOX G;  3S17 H;  4DV3 Q;  3S1N H;  1PH9 A;  1NE3 A;  4XIG S;  4DR1 Q;  3J81 i;  3PUV A;  1LUZ A;  3HKS A;  4L5Q A;  4PZ8 A;  4AQY Q;  1N34 L;  4R4I A;  3PUX A;  3BZK A;  3RLF A;  4DV5 Q;  3ER0 A;  1UE5 A;  4YWM A;  5HGQ A;  3SGI A;  5AJ3 L;  4DV1 Q;  3I4M G;  3KDF A;  1V43 A;  3FKI H;  2UUB L;  4GNX C;  4A3E H;  4QL5 A;  4A4I A;  3TS0 A;  1HR0 Q;  1VQP A;  2CWA A;  1WOC A;  4JCV E;  4TVA B;  4JOI A;  5IYC H;  4HID A;  1TWH H;  2JE6 I;  3I4N H;  3PIP A;  2JA5 G;  4UP8 A;  4BXX H;  1KIX A;  4OO1 G;  5JJK A;  3G4S A;  4DV4 L;  2UU9 Q;  2AWO A;  3PGZ A;  4R4O A;  4EX5 A;  2C35 B;  1NTG A;  4BXX G;  3T1Y L;  3AFP A;  1ASY A;  1NMG A;  2RHQ B;  1EQQ A;  1CKO A;  2ZTC A;  2ES2 A;  5IYB G;  1X55 A;  5E7N A;  1L2F A;  3CPW A;  3DM3 A;  1XMQ L;  4TQU S;  4A3D G;  2RF4 A;  3PUY A;  4NXN Q;  4A3F H;  1YNX A;  4JBM A;  2WB1 E;  4GN5 A;  2R7Z H;  1VS0 A;  4PZ6 A;  3ULL A;  1EUJ A;  5IT9 c;  3PF4 A;  1VQO A;  4B3S L;  2A8V A;  4JI5 L;  4BY7 G;  5C0X I;  2K5N A;  1P16 A;  4LFB Q;  1C0A A;  3IRB A;  1K9M C;  1KHI A;  2V1C C;  4OWW B;  1KRT A;  5IP7 G;  1N36 Q;  4A93 G;  4HIM A;  1UE7 A;  3F2B A;  4AYB E;  2CWP A;  5K36 G;  2LSS A;  1SRU A;  4GLV B;  3HOZ G;  4QIW E;  1X3E A;  1LYL A;  2D62 A;  1Q46 A;  3PSI A;  4BBR H;  4DR3 Q;  3RN5 A;  4BBS G;  2IX1 A;  4JI3 L;  2R7F A;  2NVX H;  2WAQ E;  4J15 A;  2N3S A;  1AH9 A;  1VQJ A;  3AQQ A;  5IE8 A;  2GN5 A;  2YYZ A;  4L5T A;  2ZTD A;  1VQI A;  2EQS A;  2N49 A;  4DV1 L;  3CPF A;  1FGU A;  2E2H H;  1JT8 A;  5LMU Q;  5C4J H;  2E8G A;  4K0K Q;  1KD1 C;  4DAM A;  3CCS A;  3I55 A;  4JI4 L;  4HJ9 A;  1LM0 A;  2JEB I;  3S24 A;  3STB D;  1V9P A;  4C3I H;  3PIO A;  3TRZ A;  3U4Z A;  1L1O A;  1Q81 C;  3FKI G;  4IOA A;  4HJ5 A;  4LNQ A;  4LUV A;  4DR4 L;  1AE3 A;  1TWA H;  4A3E G;  2UU9 L;  3UDI A;  1A63 A;  3KOJ A;  3S15 H;  5GAD C;  1PYS B;  3KLW A;  5IYC G;  3KF8 B;  3I4N G;  1BBW A;  2Z6K C;  1GD7 A;  4POG A;  1LTL A;  2VQF L;  2LXK A;  2MO1 A;  4X64 Q;  1QVF A;  1CUK A;  2KCM A;  1CKM A;  2B3G A;  1JB7 A;  4DR7 L;  1BBU A;  4JI1 L;  4DPG A;  4P74 A;  5FLM H;  1N34 Q;  3CD6 A;  2PI2 E;  3H15 A;  3S14 H;  4QY7 A;  3J7Z C;  3OW2 A;  3I7F A;  1IBK L;  2XTI A;  1Y1V G;  2UUA Q;  4MNO A;  5AJ3 Q;  4A3F G;  2ASB A;  4LFB L;  3CAM A;  1Z9F A;  2AMC B;  4IFD I;  3F2C A;  1N36 L;  1KRS A;  4RG1 A;  4LF9 Q;  1KXL A;  3GTP H;  1E1O A;  1XNR L;  2K52 A;  3JC6 6;  4LUZ A;  1HJP A;  1G51 A;  4ALP A;  3EBE A;  1ASZ A;  4KHP Q;  4DR3 L;  1KAW A;  4KLK A;  4O0A A;  4DV4 Q;  1VQM A;  4JI6 Q;  1X6O A;  1PH6 A;  1UE6 A;  1E24 A;  4MZ9 A;  3CCM A;  1VQE A;  2VW9 A;  1VQL A;  1VQA A;  4GKJ L;  4BBR G;  1WI5 A;  1O7I A;  2VZA A;  1UEB A;  4IPH A;  1QUQ B;  4DAY B;  4JBK A;  1T9H A;  1UE1 A;  1XMQ Q;  3PV0 A;  5LMU L;  3H3V I;  3MEF A;  3J80 i;  4DUY L;  4POF A; 
#chains in the Genus database with same CATH topology
 3J81 j;  2VL6 A;  1IBM L;  2IT1 A;  3ZYY X;  5C44 H;  3SR1 A;  1OXT A;  2B2Y A;  1Q3L A;  2KHI A;  4C56 C;  1MKH A;  1OXV A;  5LL6 X;  2P5Z X;  1CKN A;  2BA1 A;  4DK6 C;  1EEF D;  4S3S A;  2K04 A;  2RKS A;  4B9W A;  1PFS A;  3SXH A;  4CHT B;  4QCL A;  4IAL A;  1JOK A;  2BCO A;  4DN4 M;  4LFA L;  5CV4 A;  5J1Z A;  3VYS A;  4DR2 L;  4FF4 A;  1H9S A;  1WFQ A;  4R4Q A;  2F0T A;  1G29 1;  4MTK A;  1ZXT A;  5CV9 A;  1GM5 A;  3BS1 A;  1II3 A;  4DU9 A;  1S5C D;  2RCN A;  4HJ7 A;  2I07 B;  5JJZ A;  1EU4 A;  2QEX A;  3HKZ B;  1JB3 A;  1PV4 A;  3T51 B;  4BWG B;  3K8A A;  2HIV A;  4DXF A;  5IY0 A;  1MI2 A;  1E22 A;  5C5M A;  1SYF A;  2XWJ B;  4X3K A;  4J8Q A;  5C4J B;  1EIH A;  4K6L A;  4DK0 A;  1EY5 A;  2OQ0 A;  1B2T A;  3D4D A;  4X65 Q;  2E2J B;  4QJF A;  2X69 A;  4RA8 A;  1G6Z A;  3T13 A;  1CQF A;  2PMZ B;  1KTK A;  2LS0 1;  5EQ0 A;  3H0G G;  4FNF A;  4GLA C;  5C44 G;  2Z4I A;  1EL0 A;  3RZD B;  1XNR Q;  4FXK C;  4U68 A;  2A1A A;  2B63 H;  3BVM A;  1JJC B;  1EQR A;  5BR8 L;  4LF7 Q;  1BCP C;  4IPD A;  1STE A;  1Y69 U;  1D5M C;  2K03 A;  3WOE A;  3ZJY C;  1I4H A;  1CZW A;  1Q82 C;  4GKJ Q;  3NEM A;  1OXS C;  1CT1 D;  2A69 C;  2IHF A;  2F0O A;  2I5L X;  4HJ8 A;  3PUZ A;  2TMP A;  5AFW A;  2NN6 I;  2BE5 C;  1GUO A;  4RCN A;  3NWS A;  4Q5V A;  1SNM A;  5C0X J;  3HFZ B;  5C44 B;  2KEE A;  2DY8 A;  3ICE A;  1BCP F;  1E3P A;  2OT2 A;  2NZH A;  5JEA J;  4NW2 A;  4X65 L;  4WJ3 M;  2BDO A;  1P8L A;  1X65 A;  3CCE A;  1Q7Y C;  3AFQ A;  4NP5 A;  1Y1W H;  4P75 A;  3Q22 A;  1BDO A;  1K3B C;  2GVB A;  3M9B A;  3TQY A;  2F4V Q;  3W3A A;  1F2Y A;  4YWK A;  1LTS D;  4KHV A;  3A0J A;  4LF7 L;  3H6M A;  1ZEQ X;  2I0Q A;  2EYM A;  3FKI B;  1HHV A;  1FNW A;  1JWS D;  2B63 G;  1PH4 A;  1CQV A;  5CBA E;  1TWH B;  5J3B A;  4LF4 Q;  2G9H D;  2JA6 H;  2VQE Q;  5JVH 3;  5T1G A;  4B3T Q;  5J39 A;  3T1H Q;  4U67 3;  1CM9 A;  2EY2 A;  2R6G A;  2YTX A;  4JPB W;  1Q86 C;  4RGT A;  1YZ6 A;  2E5L Q;  1VCI A;  1TS2 A;  1LV9 A;  1NAP A;  3VR5 A;  4JV5 L;  5C4H A;  1EFW A;  3BDC A;  3CME A;  4JI2 L;  2NVQ H;  2RSN A;  1DXM A;  3EFX D;  4BY1 H;  2D2C C;  2A19 A;  5FO9 B;  4A3J H;  1VQF A;  3VR3 A;  2F4V L;  1BVS A;  3LGJ A;  2F0V A;  2Q2I A;  1CKN B;  4JOI C;  4DAV A;  1Y1W G;  3PCO B;  4DR6 Q;  1FL0 A;  1I6H H;  3G6J B;  3NQT A;  2PPB C;  3GV3 A;  2L4N A;  1B7Y B;  4O2D A;  2EYF A;  4EVO A;  3M4P A;  1H9S B;  1K8A C;  1Q90 A;  4C3I B;  1AW7 A;  2EXD A;  5JPM C;  2VQE L;  1AEX A;  2Z6B A;  2QA4 A;  1X9N A;  3DEO A;  3TME A;  3GTL H;  2F03 A;  3T1H L;  5A2Q L;  2JA6 G;  1A62 A;  1SE8 A;  3GD7 A;  3G48 A;  1K83 H;  1EWI A;  2E5L L;  3GP7 A;  2F3I A;  4O42 A;  5ELE A;  4CDD C;  3A55 A;  3X3M A;  1E2W A;  1MD2 D;  3A56 A;  1VQD A;  3BG3 A;  4NDX A;  3R93 A;  4HJA A;  1QVG A;  1Y8P B;  3V96 A;  4Y52 H;  3D6C A;  4OWX B;  4DUZ Q;  4C3J H;  1KQS A;  1STB A;  1QNU A;  3GTP B;  3SK8 A;  2IY5 B;  2XGT A;  5EPJ A;  2AQ3 B;  1IL2 A;  4FYD A;  4BY1 G;  1I4Q A;  5BN5 A;  2B2V C;  4NMZ A;  2PZW A;  4X62 Q;  1DJR D;  4A3J G;  2M9V A;  1S5D D;  3A7L A;  2B2U C;  2FFK B;  1IHZ A;  3H91 A;  4ZKB B;  2F0Q A;  2JA6 B;  4CKC A;  4ZUI A;  1JE4 A;  5CGK A;  2KBN A;  2WAC A;  2JK8 A;  2E2I H;  3CXC A;  1U0L A;  2EDG A;  1EYA A;  5K5P A;  2KCT A;  1HR0 L;  1S5B D;  2Q2T A;  1RL2 A;  5M3M H;  2NYZ D;  1MSH A;  4ZUJ A;  2F0W A;  4V19 0;  1EEI D;  2HDL A;  1YHB A;  4NKL A;  1HNX Q;  2KED A;  3CRL C;  4ME3 A;  4XYO A;  4CJ0 B;  2D0P A;  2NVQ B;  4PG3 A;  1G91 A;  4BY1 B;  3L9A X;  2E2D C;  4A3J B;  3E0J A;  3I4O A;  4KD3 A;  1O78 A;  1X32 A;  2EYL A;  5LL6 S;  1KAA A;  4C3J G;  1I6H B;  4UHV A;  4TSS A;  1IYJ B;  3UDG A;  2B2Y C;  1SMY D;  1TS3 A;  2K7V A;  2CFM A;  2K50 A;  2K28 A;  4KD4 A;  3NTH A;  3JAM c;  3BZC A;  3QG1 A;  3FVQ A;  2DJF C;  2K14 A;  5LMN W;  5IGB A;  1GUW A;  4KKS A;  2JXM B;  4PQX A;  3OIQ A;  1R4Q B;  2XN9 C;  4F8M A;  1HQM C;  2WV6 D;  4HMJ A;  3A74 A;  1WVL A;  4G4K A;  4KJN A;  3R2I A;  4OO1 I;  3VDY A;  4RGM A;  2JEA I;  1K83 B;  4DK1 A;  2OF1 A;  3WOF A;  4PMW A;  4XT3 B;  1SJH D;  2EVB A;  5IP7 H;  2F0K A;  1XPR A;  3B6Y A;  3TS2 A;  5D3I B;  1TVX A;  1HNX L;  4C3H H;  2DJG C;  2PQA A;  4ILW A;  5COY A;  4C3J B;  1U4R A;  1ONL A;  1NE3 A;  3NBI A;  1HA5 A;  1LUZ A;  4L5Q A;  2K33 A;  5CR3 A;  1T5E A;  1KLU D;  3BZK A;  1CA6 A;  5HGQ A;  3LNN A;  1TY2 A;  2E76 C;  5C5L A;  3VA5 A;  4QL5 A;  2CWA A;  3LWE A;  4JCV E;  4TVA B;  1A6X A;  4UP8 A;  2UU9 Q;  2MPM A;  4EX5 A;  2E2I B;  3J81 E;  2PCF B;  3I3C A;  5E7N A;  5FOB B;  2X6L A;  3JAM E;  4NXN Q;  1EQT A;  2R61 A;  4MIU A;  3SK4 A;  5M3M B;  4PZ6 A;  3ULL A;  5ELC A;  1EUJ A;  5C4Z A;  1LAC A;  1QE6 A;  2I46 A;  1R4P B;  3TBI B;  4X3U A;  1KHI A;  2V1C C;  1SYC A;  2HD3 A;  5IP7 G;  3HG9 A;  1N36 Q;  4HIM A;  3HOV B;  1BXT A;  2CWP A;  3SK6 A;  2EXZ A;  4QIW E;  5FLX L;  2D62 A;  2QEJ C;  1XTC D;  3RN5 A;  2IX1 A;  4C3H G;  2N3S A;  1MBY A;  1SYB A;  3Q24 A;  2IW3 A;  1VQI A;  2ZT9 C;  3Q23 A;  3CPF A;  4V0B A;  3V05 A;  4JI4 L;  3I55 A;  3MZ5 A;  1LM0 A;  1YNJ C;  3PIO A;  2ICE C;  4IOA A;  1Z6H A;  1Q81 C;  3J80 L;  4HJ5 A;  4LNQ A;  4DR4 L;  1TWA H;  2UU9 L;  3UDI A;  4RFB A;  3S15 H;  5GAD C;  1XWE A;  3AMU A;  3KLW A;  5IGC A;  5EPK A;  1GD7 A;  1SYG A;  1GUG A;  4HAE A;  2H4O A;  2WII B;  1CUK A;  1CKM A;  1BBU A;  1V1P A;  4ZCK A;  1LTB D;  3J7Z C;  2XTI A;  1Y1V G;  2ASB A;  4C3H B;  2F3W A;  3CAM A;  1Z9F A;  3T16 A;  1N36 L;  1LTG D;  1HRJ A;  1B1Z A;  2FMM A;  4ALP A;  3EBE A;  2GA4 B;  1U9R A;  5ELF A;  1CHQ D;  2SNS A;  2DNE A;  1A3U A;  1CTM A;  2VZA A;  1O7Z A;  4JBK A;  5E4W C;  2JA8 B;  3MEF A;  1F9Q A;  4POF A;  1WTW A;  4ZYS A;  4LFC Q;  3D3R A;  3U9O A;  1PH3 A;  2IHE A;  5KND A;  1HNW L;  3QOL A;  4APV A;  3G6E A;  4JI8 L;  2PYK A;  4IZ8 A;  2F0N A;  2F0U A;  4XDX A;  4R4C A;  2BH2 A;  3RMH A;  4IFD J;  2R93 H;  1GO3 E;  2ZJR A;  3K81 C;  5BN4 A;  4JI3 Q;  1JIC A;  4JYA L;  2MJ8 A;  4DNI A;  3JAM i;  1QZG A;  1DON A;  1PYB A;  2Q8T A;  5ISR A;  1SRO A;  1B70 B;  2UXD L;  2O4X A;  1Q1E A;  3FP9 A;  3PO3 H;  1EZ8 A;  1V1Q A;  1VQG A;  4KY5 A;  4H0L C;  1EIG A;  1AZP A;  2PQA B;  1XPO A;  1IBL L;  4HCE A;  2F0D A;  4GN4 B;  3L3O C;  4QMG A;  1HA6 A;  1UEA B;  1VQB A;  1GUN A;  1N33 L;  3DHQ A;  3W2D A;  2KEN A;  4GNX A;  1TWA B;  4UP9 A;  2AQ2 B;  4LFC L;  3S15 B;  4JI1 Q;  4C2M H;  3KF6 A;  1TWF H;  1W3S A;  1WTO A;  4L5R C;  1HXY D;  1IBK Q;  1NCV A;  1YJ9 A;  1UAP A;  1SFO H;  2JQO A;  5JVG 3;  1YEZ A;  3K80 C;  4XXE A;  4CJ2 C;  1G2T A;  1Z47 A;  4IUN A;  3HP3 A;  1SBB B;  4WJW A;  4DFA A;  1GXD C;  2R93 G;  2AWN A;  3E5S A;  4K5W A;  3MTS A;  1ESF A;  3NTI A;  3GTM B;  2A6H D;  2HIX A;  3OIP A;  1B50 A;  3I8Z A;  5GRO A;  4DUY Q;  4JI7 L;  4DA2 A;  2EJF C;  1XPU A;  2EYP A;  3I4L A;  5BN3 A;  1I50 H;  1IBM Q;  3BZD B;  3PO3 G;  3A54 A;  2VNU D;  1JOO A;  2RQX A;  2OEO A;  1LT5 D;  3SK5 A;  2XVS A;  2JA7 H;  1GUS A;  1VF7 A;  4LFA Q;  4JBW A;  4DR2 Q;  5J22 A;  1I94 L;  4YWL A;  3MXP A;  3M3Y H;  4BA2 I;  3DXJ C;  1PA6 A;  2K4K A;  2YTY A;  5DLQ E;  3KFU A;  4BBS B;  5EJW A;  3BJU A;  3H3V H;  4CGY B;  2R93 B;  2NBF A;  3NP8 A;  2F0F A;  1X56 A;  4H02 A;  2D0O A;  1YHQ A;  3GQB A;  3PQI A;  3DWQ A;  4HN7 A;  4A76 A;  4ULL A;  1J5E Q;  2VS1 A;  1C48 A;  4NB3 A;  1X3G A;  3PO3 B;  1G6P A;  2MHV A;  5A2Q E;  1UUP A;  1ML0 D;  1LTI D;  1V1P B;  1B8A A;  2B29 A;  2EYJ A;  1R9T H;  1OTC A;  3I4N B;  1HQR D;  3H0G H;  2MNA A;  4G7O C;  5D14 A;  3CF5 A;  3HRZ C;  1LT4 D;  2L1B A;  1SSO A;  4UAI A;  2H5X A;  1XTD A;  2D5D A;  5EKK A;  4IUP A;  1OXU A;  2UXB L;  1G8Z D;  3MFG A;  2C9O A;  1WCM H;  5M3F H;  1TWF B;  3I72 A;  1WD0 A;  3A8J E;  4DK3 C;  5BR8 Q;  1PH2 A;  3QOJ A;  1IYV A;  4DV6 Q;  1SNO A;  3BDL A;  1SFO B;  1HZC A;  3NSW A;  2EE1 A;  5IGE A;  2JA7 G;  3NQI A;  2A68 D;  1A8V A;  1EOT A;  1D5X C;  5TSS A;  2PO4 A;  1A2U A;  1MJC A;  1TWC H;  1D8L A;  4LUO A;  1EZ6 A;  1HNZ L;  2NVX B;  1VQ5 A;  3TP8 A;  1ZYR D;  1J5E L;  3FEW X;  2A6E D;  2OQK A;  5DNF A;  3UI2 A;  1I50 B;  4LJZ C;  1D1K A;  1JOQ A;  2J7Z A;  1L0W A;  4YHH L;  3NPP A;  4JC0 A;  1QNK A;  1S5F D;  4QQB X;  5FKA C;  2JA7 B;  4F7X A;  3M3Y B;  3DWA A;  3A8K E;  5M5X H;  4DV6 L;  4DAP A;  1WCM G;  5M3F G;  3S1Q H;  1Q1B A;  1TWG H;  1STY A;  4P72 A;  4JVZ A;  4GNX B;  4LF8 L;  1PYW D;  3K7A H;  1IW7 D;  2A74 C;  3KF6 B;  2PNH A;  1T5X D;  5EBC A;  1ENF A;  1SND A;  2ENB A;  2NZ1 D;  3WDN A;  2R92 G;  2DUD A;  4HIO A;  4DR1 L;  1R9T B;  1WJJ A;  1Q8K A;  3KUP A;  1EY7 A;  2L12 A;  4LK1 C;  5ELD A;  4HTH A;  4QUF A;  1YNN C;  3W1B A;  3H0G B;  3S9W A;  2ALY B;  5FLX c;  1YJN A;  4A3C H;  2QDL A;  3P1H A;  4JV5 Q;  2BH8 A;  1U4P A;  4K6D A;  3EN2 A;  4DF7 A;  4UP7 A;  3D4R A;  3KBX A;  2YV5 A;  4JI2 Q;  4EQ5 A;  3UE1 A;  2DNC A;  4QIW B;  3CC7 A;  1DM0 B;  1WCM B;  5M3F B;  3AEV A;  1JE5 A;  1EFI D;  1RDP D;  3J80 c;  2L55 A;  3S2D H;  2NTS A;  3K5L A;  5E4X A;  3VR2 A;  3C46 A;  3R3O A;  1QUQ A;  5HUR A;  4JG2 A;  2F4I A;  5I6W A;  4KKT A;  1STN A;  2RDG A;  1NY4 A;  2R7Z G;  3D4W A;  2CH4 W;  3BYT B;  1HFN A;  1WD1 A;  2HCC A;  5HY6 A;  1B9M A;  3DMU A;  4J1M A;  1S5E D;  1K8G A;  4BXX H;  2YTV A;  3MFY A;  4EQP A;  3K5M A;  5JJL A;  3LWU A;  2A6H C;  1M1K C;  5IYB H;  3RZO H;  2CQO A;  1NUC A;  2F0E A;  2XWB B;  1PRT D;  3A5Z B;  3STB C;  1HCZ A;  2VXW A;  5E1F A;  1EYC A;  1H95 A;  3NHH A;  3X3N A;  3W5O A;  1WTQ A;  5JAV A;  3OMG A;  1WTV A;  3E6Z X;  1K8O A;  4A3C G;  4A93 H;  1G2S A;  4JI5 Q;  3OOC A;  4K8J A;  2B63 B;  3HOZ H;  4XQQ A;  1ICF B;  2SDF A;  1I5F A;  1PHJ A;  4I7Z C;  3S1Q B;  3HKS A;  3K7A B;  4PZ8 A;  5ELB A;  5KYL A;  3IFD A;  4M8A A;  4YWM A;  3J80 E;  1ZKO A;  5AJ3 L;  1QCB D;  3H3V C;  1XX8 A;  4GNX C;  4A4I A;  3TS0 A;  1J9O A;  1HR0 Q;  1WOC A;  4HID A;  3PIP A;  3PIP 3;  1KIX A;  4OO1 G;  4ZQ3 A;  2Z9H A;  2AWO A;  2JSO A;  1NTG A;  4BXX G;  2LMC B;  3FMC A;  1B3A A;  1CKO A;  4ABN A;  4CDE C;  5IYB G;  3CPW A;  3DM3 A;  1PDQ A;  4A3F H;  2WB1 E;  2Q8I B;  1Y1W B;  1EY9 A;  4B3S L;  3URY A;  5I9O A;  2A8V A;  4JI5 L;  3TP5 A;  1C0A A;  3IRB A;  2K5D A;  2KCN A;  3S2D B;  1FNU A;  4OWW B;  4A93 G;  4AYB E;  4Q0F A;  3MA2 B;  2D9U A;  3HOZ G;  4BBR H;  4DR3 Q;  2PZT A;  2R7F A;  2C5C A;  1RD9 D;  2F0H A;  5KGU A;  1AH9 A;  3AQQ A;  1PRT B;  3CKI B;  1PTO H;  3QO2 A;  1JT8 A;  1ZYR C;  3P20 A;  2E8G A;  1KD1 C;  3CCS A;  3RZO B;  2A6E C;  4HJ9 A;  3A7A B;  3BYY B;  1PTO D;  1AE3 A;  2CHB D;  2NB0 A;  1BBW A;  1QIL A;  1RF2 D;  2F0I A;  2IPK D;  2VQF L;  4G7H C;  1QVF A;  1A3T A;  4A93 B;  3RUZ A;  3HGB A;  1JB7 A;  4DR7 L;  4DPG A;  5FLM H;  1KDB A;  3S14 H;  3CU7 A;  1EWC A;  4EQN A;  3HOZ B;  1FR3 A;  3TP7 A;  1CI3 M;  4A3F G;  4IFD I;  3F2C A;  1QWY A;  3NE5 B;  5CV8 A;  2LKV A;  4RG1 A;  2K01 A;  3BDO A;  4RWS C;  2K52 A;  2CQA A;  1BO0 A;  1E0B A;  1HJP A;  2QCP X;  1ASZ A;  3OW7 A;  4DR3 L;  4ZKC B;  4JI6 Q;  1X6O A;  3OWF A;  2L9H A;  3CCM A;  1SE2 A;  5L37 A;  2VW9 A;  5C6A A;  1VQA A;  1ILP A;  4BBR G;  3GTL B;  1QUQ B;  1T9H A;  5E3F A;  1ENC A;  3PV0 A;  3J80 i;  1SJE D;  4ZLT F;  2ZXO A;  2Z1C A;  3NTK A;  3Q0A A;  3GTJ H;  5LMN L;  4J6H A;  1XXG A;  4ZK9 B;  4LF5 L;  5JPN C;  4A3F B;  3P7J A;  4O1N A;  1BKB A;  3M85 A;  4P71 A;  4Y7N H;  4X66 L;  1OXX K;  4OX9 Q;  1KAB A;  1SYD A;  1YIT A;  1VMP A;  3C2P A;  1GHJ A;  3KYH C;  3EIV A;  1A0I A;  1TXY A;  4OGQ C;  5CMD A;  3OWE B;  4H13 C;  4KTA A;  2JJQ A;  1FVI A;  4RH6 A;  5FLM G;  2KCC A;  1HZA A;  4BBR B;  4JI4 Q;  2J0T D;  3D0F A;  2NVT H;  1V1O A;  3ONA B;  1J6Q A;  1KL9 A;  5C0X H;  4DR4 Q;  4JI6 L;  3RLO A;  2GVA A;  2B39 A;  1JJG A;  2K75 A;  1M8A A;  1CSQ A;  3K0Y A;  1BR9 A;  1YJW A;  5JEA H;  2ICI A;  5IT9 L;  4ODG A;  2F0M A;  3TN2 A;  1A2T A;  4R9W A;  4GKK L;  2ID0 A;  1Y1V H;  2AHO B;  2JP1 A;  2WKC A;  4TRD A;  4KK7 A;  4MTN A;  1XMO Q;  2EY1 A;  4DV0 Q;  1WTX A;  3UDF A;  5DM6 3;  1HPC A;  1LT3 D;  3QJY A;  4IUV A;  1D6E C;  3PF5 A;  1DOL A;  3ND8 A;  2F52 A;  1HFG A;  4B3M Q;  3S14 B;  1STG A;  5ELN A;  4OX9 L;  3ERQ A;  5KRU A;  4IJL A;  2HHH L;  2H1E A;  2MUY A;  1LO5 D;  2FIN B;  4YCW A;  1W2B A;  4QB4 A;  3BU2 A;  5IWA L;  3LX0 A;  4OIK A;  1PRT F;  1WTP A;  3HOY G;  5EGT A;  1SE4 A;  2TSS A;  4LW1 A;  1TS4 A;  4GLX A;  4R8I A;  2F0G A;  2OWO A;  1ENA A;  2YU9 H;  1HNW Q;  3I56 A;  1C7Y A;  5ELO A;  4L5S A;  4JI8 Q;  1EIY B;  1MIU A;  1U5K A;  5C0X G;  4L8J A;  2CW0 D;  4BA1 I;  4YCV A;  4G7Z C;  4IUU A;  2Q2U A;  1VQN A;  3I90 A;  2Z0S A;  2V4D A;  2O2L D;  3TEH B;  5JEA G;  1XMO L;  4DV0 L;  3GTJ B;  2PQE A;  4JYA Q;  4GS3 A;  3GTO H;  1QB5 D;  3H94 A;  4OON A;  2UXD Q;  4PZ7 A;  3G7L A;  5NUC A;  5I9P A;  4Y7N B;  4IOC A;  3GTQ H;  2B2W A;  4HED A;  1XJV A;  1X3F A;  4RKL A;  1XNQ L;  1JOR A;  3RN2 A;  4B3M L;  3E0E A;  3QWN A;  1WTR A;  2O5I C;  3HOU H;  1IBL Q;  4KN7 C;  1K0R A;  1K0S A;  1SEB D;  3J7A 5;  2XIW A;  2IWH A;  3DUZ A;  4IUR A;  1C8C A;  1AE2 A;  5HGT A;  4X3S A;  2EJM A;  3QB3 A;  1DGS A;  1HH2 P;  1N33 Q;  1UWV A;  2JN4 A;  3QIA A;  4F87 A;  4CKB A;  1PMR A;  1GUT A;  3GDE A;  5G3L D;  1CSP A;  2Y0S G;  2L0C A;  4GN3 B;  4KJO A;  1S4Z A;  3N6R A;  4P2C B;  5C3E H;  3CW2 C;  2PNR C;  3GO5 A;  2XRS D;  1Y1V B;  1IXR A;  4G57 A;  1I6V C;  2KUM A;  4LMQ D;  2EZV A;  1E7Z A;  2KHJ A;  1F2L A;  1SN8 A;  4A3K G;  1IKL A;  4EQO A;  1U4L A;  5M5Y H;  1N32 L;  4KHZ A;  3L2P A;  4WJ4 A;  1BBX C;  2K5H A;  3CCQ A;  4WFN 3;  4JI7 Q;  3EVQ A;  1PFB A;  1KNA A;  3K6O A;  4RMF A;  2A69 D;  2UXC Q;  2NTT A;  3U58 A;  1HUM A;  3CCU A;  3I73 A;  3HOU G;  2BE5 D;  3WWV A;  2G5D A;  3ITP A;  5DM7 3;  1PTO F;  1SMY C;  4IUQ A;  4LF6 L;  3M4Q A;  1BNZ A;  1C4Q A;  3Q8D A;  2YU9 B;  1I94 Q;  2NVY H;  2WB1 G;  4M1U B;  1SXT A;  2PZU A;  5CBE E;  1PLF A;  3N52 A;  4KV6 A;  2NN6 H;  1TU2 B;  2N8N A;  4YIJ A;  3FPU B;  4XYQ A;  4AYB G;  3E9H A;  1GOZ A;  5C3E G;  2OTJ A;  3PUW A;  3GTO B;  4IJH A;  1ET9 A;  1EIF A;  4XQN A;  4QGU A;  3GTQ B;  3CP0 A;  1K8M A;  2NUC A;  3HOU B;  4DV2 L;  1PH5 A;  3K5N A;  1FNV A;  2B8F A;  3U50 C;  4DGZ A;  2R3Z A;  1AN8 A;  5IOD A;  1BUV T;  2EPB A;  4A3G H;  1QVC A;  2UXC L;  3D31 A;  4DV3 L;  5A35 A;  5M9O A;  5IYD H;  2PW5 A;  2WB1 B;  2NZO A;  4AQY L;  2XRQ D;  2R7D A;  1MJE A;  1B4O A;  4DV5 L;  2UXB Q;  4K5V A;  4QF4 A;  3D6W A;  3Q6S A;  2HUG A;  1SR3 A;  3F2D A;  3L0O A;  5JOB A;  4RGO S;  3T56 B;  5C3E B;  3GTK H;  2B8G A;  4B08 A;  3VA7 A;  5GQO A;  3HOW H;  3J7A F;  1YVC A;  4BS9 A;  4L63 B;  3HOX H;  3IFT A;  2E2J H;  3U4V A;  1LTA D;  1HNZ Q;  3ULP A;  3CC2 A;  1K3R A;  5M5Y B;  1I4X A;  1EWH A;  2NN6 G;  3DLL A;  3RZD H;  1K28 A;  2KHS A;  5D65 A;  5IOC A;  1ROD A;  3TP6 A;  3I4M H;  1QZH A;  3J81 L;  1I3Q H;  3JAM L;  2UUB Q;  4K2L A;  4MN3 A;  1Y14 B;  3HZX A;  1O7Y A;  3G71 A;  1RJT A;  4YHH Q;  3KJO A;  2RHS B;  1ICW A;  2AQ1 B;  4HSV A;  4A3D H;  3VR6 A;  4HIK A;  4A3G G;  1PZJ D;  2DN8 A;  5IYD G;  2NVY B;  3UDX A;  4C2M B;  1Q12 A;  3NXW A;  1AFP A;  5I2X A;  2FJ2 A;  4BY7 H;  2F3V A;  3HKZ G;  4K0K L;  1X54 A;  2N88 A;  3M4O H;  2L15 A;  3U9S A;  1UNS A;  3W1G A;  2CW0 C;  2WIN B;  2B2T A;  4LF8 Q;  3KJP A;  5CV5 A;  4GOP A;  2JYO A;  2R92 H;  1HZ9 A;  4R1J A;  3M7N A;  3HOW G;  3HOX G;  3S17 H;  3S1N H;  4FXD A;  4XIG S;  3MXG A;  4DR1 Q;  4CDC C;  1N34 L;  4R4I A;  3DM1 A;  5COR A;  1LLR D;  1VMC A;  4FXG C;  1UE5 A;  2XNA C;  2EY5 A;  1Y8N B;  3I4M G;  4A3G B;  3KDF A;  1V43 A;  1JCK B;  3FKI H;  2UUB L;  1DOK A;  3TZU A;  2A5H A;  1VQP A;  4C1N I;  1TWH H;  4K14 A;  1LTT D;  4DV4 L;  3PGZ A;  4R4O A;  1F9P A;  3GV6 A;  2C35 B;  3AFP A;  4N8F A;  1NMG A;  2AUK A;  1EQQ A;  2ZXP A;  1EYD A;  1CFM A;  1VF5 C;  4H7B A;  2ZTC A;  4PMC A;  1FYC A;  1X55 A;  4A3D G;  3GTK B;  1XMQ L;  3OMC A;  2QDB A;  2RF4 A;  2K32 A;  3HOW B;  4JBM A;  4GN5 A;  2R7Z H;  5IT9 c;  3HOX B;  2IJ0 A;  2RDH A;  4PMB A;  4GZY C;  5C3W A;  5EKL A;  3EJI A;  4BY7 G;  1P16 A;  3VR4 A;  1K9M C;  2K6A A;  2CH4 A;  1KRT A;  3F2B A;  3NUC A;  1F9S A;  4JK1 C;  1E2V A;  1SRU A;  1MHW C;  3I4M B;  4GLV B;  3E3X A;  1I4G A;  1X3E A;  1I3Q B;  1IL8 A;  2WAQ E;  1SYE A;  1AP0 A;  1MSG A;  2GN5 A;  5G3L F;  2YYZ A;  2ZTD A;  3FPP A;  4HSP A;  5F2D A;  1FGU A;  2E2H H;  2WKD A;  4WOR A;  3KBG A;  5CC4 A;  4A3D B;  2XSC A;  3S24 A;  3TRZ A;  3HEJ A;  1V9P A;  4C3I H;  1L1O A;  3FKI G;  1A63 A;  3KOJ A;  4IFD H;  1PYS B;  2L5T A;  4BY7 B;  2B2W C;  1EY8 A;  3FDT A;  1TR5 A;  1MGS A;  3KLS X;  4PV1 C;  4POG A;  1LTL A;  3M4O B;  2LXK A;  4X64 Q;  1H9J A;  1B44 D;  1QJO A;  4N9P A;  2B3G A;  2R92 B;  3CD6 A;  2PI2 E;  4QY7 A;  1TWC B;  3AB9 A;  3OW2 A;  2UUA Q;  5JJI A;  4HR7 B;  5AJ3 Q;  2M00 A;  1HUN A;  4OO1 H;  1KRS A;  4LF9 Q;  3S17 B;  3S1N B;  1D1I A;  1KXL A;  3GTP H;  4CDF C;  1XNR L;  5IT9 E;  3JC6 6;  1QG7 A;  3C3L A;  4KHP Q;  3MHB A;  5KEE A;  2IX3 A;  3MVV A;  4OEL B;  1KAW A;  3MXN A;  4O0A A;  4LAA A;  1VQM A;  1E24 A;  4MZ9 A;  1VQE A;  1VQL A;  4GKJ L;  1WI5 A;  1O7I A;  1UE1 A;  3H3V I;  4KKU A;  5CV6 A;  4TKO B;  1B9N A;  1N9W A;  4A3L H;  2Y0S E;  5I2Y A;  4B3S Q;  5FLX E;  1M90 C;  2I5H A;  2K05 A;  3NWT A;  1GHK A;  5M5X B;  4C3I G;  1VQK A;  4WRD A;  1VQ6 A;  3K7U C;  4OL7 A;  1E1T A;  4R8N A;  2R7Z B;  3L7Z C;  3ERS X;  4X64 L;  4IFD G;  1TWG B;  1D7Q A;  5GAH C;  3K0X A;  1F77 A;  3ERO A;  1KDA A;  4YCU A;  3VYT A;  1SNQ A;  4RKB A;  3NK9 A;  2UUA L;  4DNR B;  4OHJ A;  4P73 A;  3TSS A;  2DY7 A;  4PNY A;  3HS0 C;  3MXU A;  2QF7 A;  4LF9 L;  1U4M A;  4GOP B;  4ZRZ A;  2SOB A;  4JI0 Q;  3SVM A;  4KHP L;  3SHL A;  4FF3 A;  4X6A H;  1TT2 A;  4RHS A;  1STH A;  2QW7 A;  2MGS A;  3RR5 A;  1VDZ A;  1WTH A;  1RTO A;  2E2H B;  3QR8 A;  1YNJ D;  3SEB A;  3AYH B;  1S40 A;  1S72 A;  3V2T A;  2VQF Q;  4LF4 L;  5C3X A;  3E9I A;  1SE3 A;  2KVM A;  5GAG C;  4B3T L;  4DR7 Q;  1EY6 A;  2CVR A;  2OCE A;  3KDF B;  4FO2 A;  3S16 H;  1LT6 D;  1PZI D;  2QIL A;  3T53 B;  3CRK C;  4XTC S;  4A3L G;  1FGB D;  1BQQ T;  2KA7 A;  2HT1 A;  1YBY A;  5I4D A;  3TDQ A;  2A68 C;  3J7A V;  5IGF A;  3MEH A;  4DV7 Q;  4KY6 A;  1C9O A;  4N9T A;  3H09 A;  3K5O A;  4EGV A;  2RBM A;  3OHX C;  2M2L A;  1TS5 A;  2K5Q A;  4JI0 L;  2LXJ A;  1HR0 W;  3OPO A;  4DR6 L;  4QUC A;  1JWU D;  4C1N K;  5LMN Q;  5FO8 B;  3F8T A;  4CJ1 B;  3GTG H;  1VQH A;  2ZJQ A;  4LF5 Q;  2BOS A;  4A3B H;  4DNT B;  1PH1 A;  4X66 Q;  2A73 B;  2MP1 A;  4IPG A;  1FJG Q;  1ILQ A;  1TQO A;  2RVL A;  2ZTE A;  4F88 A;  2FXQ A;  3A5U A;  3FHW A;  1OO9 B;  1EQV A;  2NWG A;  2ATW A;  1L1O B;  2RSO A;  1D2B A;  3CCR A;  2Z6K A;  2I5M X;  4OEM B;  1PVO A;  1DYQ A;  1IW7 C;  3NBH A;  2PI2 A;  3S2H H;  3HOV H;  4DUZ L;  4DV7 L;  2KQ3 A;  5C4X H;  4I65 A;  1NBW A;  1STA A;  1Q8I A;  1RKN A;  4RCO A;  2Z4H A;  4GKK Q;  1H9R A;  2E74 C;  1ESR A;  4NPS A;  5EAY A;  3J81 c;  4X62 L;  1RHP A;  2AKW B;  2B2T C;  2X6G A;  2OTL A;  4GOP C;  1IZ6 A;  4H44 C;  5I6Y A;  1JWM D;  4HCS A;  3MXN B;  1VQ4 A;  2MQH A;  3C1F A;  4KMU C;  1JJ2 A;  3CCL A;  3HKZ E;  2Q2H A;  3F2U A;  3TRE A;  3S16 B;  1FJG L;  2HHH Q;  4A3B G;  4A3M H;  4IPC A;  3HOY H;  3NEL A;  5IWA Q;  1F2M A;  1X3Q A;  4IN3 A;  1NR2 A;  4ME5 A;  5DAU A;  3DEP A;  3EA6 A;  3UE0 A;  1WYD A;  2BDN A;  4K8I A;  1EU3 A;  4OWT B;  4I7A A;  5M3M G;  1O7L A;  2JA9 A;  3T4A C;  2FMC A;  4CBV A;  2N55 A;  1L0X B;  3BVG A;  2WFW A;  2PMZ E;  1JQY D;  1PTO B;  1KDC A;  1N8R C;  3C1E A;  3DWP A;  4DR5 Q;  3MC0 B;  2F0L A;  4JW0 A;  4LWC A;  1YIJ A;  2VY3 A;  3HOV G;  1PFN A;  3OSO A;  1I4R A;  5C4X G;  1O80 A;  1PRT C;  3CQZ H;  1PH8 A;  4FP5 D;  2DGY A;  2JA8 H;  1CZG A;  3GTG B;  4YY3 Q;  3EQL C;  5IIF A;  1SNP A;  1NMF A;  2EIF A;  3F1Z A;  2L11 A;  4OIJ A;  4MHE A;  1CK1 A;  4A3B B;  5DEH A;  5IP9 H;  3RNU A;  2EY6 A;  2OXP A;  1GVP A;  5FK9 C;  4B9X A;  2F1M A;  3OTO Q;  3CCJ A;  2ZJP A;  2N78 A;  2F0P A;  1XNQ Q;  1RIP A;  3I70 A;  1V8Q A;  2AUJ D;  1KLG D;  2FHT A;  3K58 A;  4K5X A;  1VQ8 A;  4UDU C;  1TII D;  2HQL A;  3CHB D;  2WAQ G;  4XQJ A;  2CKZ B;  2IL8 A;  1DOM A;  3P75 A;  4A3M G;  2LFN A;  4Z9C B;  1LAB A;  5FJ8 H;  3S2H B;  2F0J A;  4ID6 A;  4FDB A;  5CV7 A;  4X3T A;  1VQ9 A;  5C4X B;  1L1O C;  3KF8 A;  4A3I H;  5FO7 B;  1NJI C;  3PO2 H;  3OYY A;  1W6K A;  4JBJ A;  1FD7 D;  1KNE A;  3ULJ A;  4DR5 L;  4A3K H;  1CA5 A;  1J8I A;  4E6I A;  2MO0 A;  4KI0 A;  2ZM6 Q;  1PXU A;  4IO9 A;  5M5W H;  1K73 C;  3MWY W;  1TY0 A;  2RCF A;  1PZK D;  5GAE C;  3NEN A;  5KIX A;  1BF4 A;  1NNX A;  1NSN S;  4YY3 L;  4HMI A;  3PIO 3;  4FF2 A;  1N32 Q;  1DD2 A;  1ET6 A;  1GKH A;  3O13 A;  4CKE A;  1HTL D;  1YHA A;  2VUM H;  1EY4 A;  1EOV A;  2O5J C;  2WAQ B;  3OTO L;  2JA8 G;  2EYH A;  3K59 A;  2RA4 A;  4NXM Q;  4A75 A;  4B3R Q;  2UUC Q;  3CCV A;  4IQZ A;  5IP9 G;  4A3M B;  1F9R A;  1SLJ A;  4NXN L;  1VQ7 A;  3HOY B;  3RLN A;  1H9K A;  4DAY A;  1CHP D;  2KJX A;  2MFI A;  1L0Y B;  3KLS A;  1GJX A;  2NVT B;  1IYU A;  1A15 A;  3R2T A;  4LF6 Q;  1NR4 A;  2JA5 H;  2E75 C;  3KLR A;  1E2Z A;  3CMA A;  2VB2 X;  3IKJ A;  2Z8L A;  4UY8 C;  4R4T A;  3I2Z A;  3GTM H;  2J4X A;  2QGQ A;  5FJ8 G;  4OXP A;  1PH7 A;  1W6J A;  5KNB A;  1PFM A;  1SMX A;  5H1S E;  1F2Z A;  1HZB A;  3NBH B;  5T1I A;  4A3I G;  1JC7 A;  4UPA A;  3T1Y Q;  4FF1 A;  3CQZ B;  4AH6 A;  3PO2 G;  1PTO C;  2ZM6 L;  5KNC A;  1S3O A;  4FVM A;  2BA0 A;  5EBD A;  1YI2 A;  5KYI A;  4K2K A;  2CCZ A;  3S1R H;  4IUT A;  1EYG A;  5K36 H;  4DKA C;  1KC8 C;  1VQC A;  2IX0 A;  1BCP D;  3J7Y W;  4DV2 Q;  1IKM A;  3S1M H;  4RGN A;  4NXM L;  3FRP B;  2K5V A;  4AIM A;  4BBS H;  4B3R L;  2UUC L;  1JMC A;  2VUM G;  1RTN A;  2WP8 J;  3D8G A;  2G9D A;  4DV3 Q;  1D5Z C;  1PH9 A;  3J81 i;  3PUV A;  4AQY Q;  2Y0S B;  3PUX A;  3RLF A;  4DV5 Q;  3ER0 A;  3SGI A;  3IAY A;  4DV1 Q;  1DCZ A;  1XYI A;  2EJG C;  4A3I B;  3PO2 B;  4A3E H;  3SDZ A;  2VB3 X;  1YNN D;  3CC4 A;  5IYC H;  3I4N H;  3K57 A;  4JOI A;  2JE6 I;  5JJK A;  4A3K B;  2JA5 G;  3I91 A;  1JR0 D;  1HTP A;  1Z7T A;  3G4S A;  2HDM A;  4RHR A;  4DXG A;  2SEB D;  3T1Y L;  1ASY A;  2F0S A;  1AZQ A;  2RHQ B;  5M5W B;  5D3D A;  2HCI A;  1BOS A;  2ES2 A;  2HQE A;  1L2F A;  4TQU S;  3IL8 A;  3PUY A;  1A3V A;  1YNX A;  2VUM B;  1VS0 A;  2ZXR A;  3VYR A;  3PF4 A;  1VQO A;  1SNC A;  5C0X I;  2K5N A;  4LFB Q;  1B3Q A;  3AU7 A;  5LHY 1;  3VYU A;  1LTR D;  3RD4 A;  1UE7 A;  3MAQ A;  5K36 G;  3A8I E;  1QOH A;  1Y8O B;  2LSS A;  2LY7 A;  2PW7 A;  3ND9 A;  1DZ1 A;  1LYL A;  1Q46 A;  3PSI A;  3R8B A;  4BBS G;  4JI3 L;  2NVX H;  4J15 A;  4XT1 B;  5CYU A;  5IGG A;  2JA5 B;  1H9M A;  5IGD A;  1VQJ A;  5IE8 A;  4L5T A;  4DV1 L;  2EQS A;  2N49 A;  4L6T B;  4N8X 1;  2QKI C;  1SDF A;  5LMU Q;  2KEC A;  4AYB B;  5EPL A;  5C4J H;  4K0K Q;  4DAM A;  5EKI A;  2B2V A;  2JEB I;  3STB D;  3U4Z A;  4RAU C;  4LUV A;  2B2U A;  4A3E G;  4KY7 A;  5IYC G;  3I4N G;  3KF8 B;  2K1B A;  2Z6K C;  2Q8R E;  1BCP B;  3SE0 A;  2MO1 A;  1RCV D;  2KCM A;  3S1R B;  1X3P A;  2EOT A;  2K5W A;  4P74 A;  4JI1 L;  1N34 Q;  3H15 A;  3S1M B;  3PMF A;  3M4Y A;  3I7F A;  1IBK L;  4LFB L;  4MNO A;  3M7G A;  2AMC B;  1B53 A;  1I4P A;  3TZD A;  1E1O A;  4KN4 C;  4LUZ A;  1SAP A;  1G51 A;  3KK7 A;  4KLK A;  2EYO A;  4DV4 Q;  1PH6 A;  1UE6 A;  4A3E B;  1TKW B;  1UEB A;  4ZAI A;  4IPH A;  4DAY B;  1EY0 A;  3BVZ A;  1XMQ Q;  2SNM A;  5LMU L;  1M4V A;  4DUY L;  2KOL A;  2RDF A; 
#chains in the Genus database with same CATH homology
 3J81 j;  1N9W A;  2VL6 A;  1IBM L;  2IT1 A;  4LFC Q;  2Y0S E;  5C44 H;  4A3L H;  1OXT A;  1PH3 A;  4B3S Q;  2IHE A;  2KHI A;  1M90 C;  1HNW L;  1MKH A;  1OXV A;  2I5H A;  4APV A;  3GTJ H;  3G6E A;  5LMN L;  1CKN A;  2BA1 A;  4DK6 C;  4JI8 L;  1VQK A;  1VQ6 A;  1PFS A;  3K7U C;  4LF5 L;  1E1T A;  2BH2 A;  4R4C A;  3L7Z C;  1BKB A;  3ERS X;  4X64 L;  3M85 A;  4IFD G;  4IFD J;  4P71 A;  4Y7N H;  1GO3 E;  4X66 L;  1OXX K;  3CC4 A;  2ZJR A;  4OX9 Q;  2R93 H;  5GAH C;  3K0X A;  3K81 C;  4LFA L;  4DR2 L;  1YIT A;  4JI3 Q;  1WFQ A;  3KYH C;  4YCU A;  4JYA L;  4R4Q A;  3EIV A;  1G29 1;  1GM5 A;  4DNI A;  3JAM i;  1A0I A;  1QZG A;  2UUA L;  1TXY A;  1PYB A;  4P73 A;  1SRO A;  1B70 B;  2UXD L;  4HJ7 A;  2RCN A;  2JJQ A;  1FVI A;  5FLM G;  4LF9 L;  1Q1E A;  3FP9 A;  3PO3 H;  1HZA A;  1V1Q A;  1VQG A;  4GOP B;  3D0F A;  4JI0 Q;  4JI4 Q;  2QEX A;  2NVT H;  4KHP L;  1J6Q A;  4X6A H;  1KL9 A;  1PV4 A;  2PQA B;  1XPO A;  1IBL L;  3RLO A;  2GVA A;  4JI6 L;  4DR4 Q;  3K8A A;  2HIV A;  3RR5 A;  1JJG A;  5IY0 A;  2K75 A;  1E22 A;  1CSQ A;  4GN4 B;  1YJW A;  3AYH B;  1VQB A;  1S40 A;  1S72 A;  2VQF Q;  4LF4 L;  1N33 L;  4GKK L;  2ID0 A;  1Y1V H;  2OQ0 A;  2AHO B;  3E9I A;  2KEN A;  4GNX A;  5GAG C;  4B3T L;  4UP9 A;  2OCE A;  4MTN A;  4X65 Q;  4LFC L;  4DV0 Q;  4JI1 Q;  3KDF B;  4C2M H;  1XMO Q;  3KF6 A;  3UDF A;  1TWF H;  4QJF A;  1W3S A;  4L5R C;  3S16 H;  1IBK Q;  5JJI A;  1YJ9 A;  3H0G G;  4XTC S;  3PF5 A;  1XMO L;  1SFO H;  4A3L G;  4GLA C;  5C44 G;  2HT1 A;  1YBY A;  1XNR Q;  2F52 A;  2JQO A;  1YEZ A;  4B3M Q;  2A1A A;  3K80 C;  2B63 H;  5ELN A;  4OX9 L;  1JJC B;  1EQR A;  5BR8 L;  1Z47 A;  4IJL A;  4LF7 Q;  4IPD A;  4DV7 Q;  2HHH L;  1C9O A;  2R93 G;  3ZJY C;  4YCW A;  2AWN A;  1W2B A;  1Q82 C;  4GKJ Q;  3BU2 A;  3NEM A;  5IWA L;  1OXS C;  2IHF A;  2I5L X;  4HJ8 A;  3PUZ A;  2HIX A;  5GRO A;  1D7Q A;  2NN6 I;  4DUY Q;  4JI7 L;  4JI0 L;  3HOY G;  1XPU A;  2LXJ A;  1IBM Q;  1I50 H;  4LW1 A;  4GLX A;  1HR0 W;  2OWO A;  4DR6 L;  3PO3 G;  2YU9 H;  1HNW Q;  3I56 A;  2VNU D;  1C7Y A;  5LMN Q;  5ELO A;  4L5S A;  3F8T A;  4JI8 Q;  1EIY B;  3GTG H;  1MIU A;  1VQH A;  2ZJQ A;  1U5K A;  4LF5 Q;  5C0X G;  5C0X J;  4BA1 I;  4YCV A;  3HFZ B;  4A3B H;  2Q2U A;  1VQN A;  1PH1 A;  4X66 Q;  2Z0S A;  2JA7 H;  3ICE A;  1E3P A;  4LFA Q;  2NZH A;  4JBW A;  5JEA J;  4IPG A;  3TEH B;  4YWL A;  5JEA G;  4X65 L;  4DV0 L;  4DR2 Q;  1I94 L;  1FJG Q;  3M3Y H;  4GS3 A;  4JYA Q;  2ZTE A;  4BA2 I;  4WJ3 M;  1PA6 A;  2K4K A;  1P8L A;  2YTY A;  5DLQ E;  3GTO H;  3KFU A;  1X65 A;  2FXQ A;  3A5U A;  3FHW A;  4OON A;  3CCE A;  1Q7Y C;  2UXD Q;  4PZ7 A;  3BJU A;  3AFQ A;  1Y1W H;  2ATW A;  1L1O B;  3H3V H;  4P75 A;  4IOC A;  3CCR A;  3GTQ H;  2GVB A;  3M9B A;  2Z6K A;  2I5M X;  3TQY A;  1XJV A;  1X3F A;  2F4V Q;  1X56 A;  1XNQ L;  3RN2 A;  4B3M L;  4YWK A;  1PVO A;  3E0E A;  3HOU H;  4H02 A;  2D0O A;  1YHQ A;  3A0J A;  2PI2 A;  3S2H H;  4LF7 L;  1IBL Q;  3HOV H;  1K0R A;  4DUZ L;  4DV7 L;  4A76 A;  1J5E Q;  2I0Q A;  3J7A 5;  2VS1 A;  5C4X H;  4NB3 A;  1NBW A;  2B63 G;  1X3G A;  1AE2 A;  1G6P A;  1PH4 A;  1OTC A;  1R9T H;  1B8A A;  2B29 A;  1DGS A;  1HH2 P;  5J3B A;  4LF4 Q;  1N33 Q;  4GKK Q;  1UWV A;  2JA6 H;  2VQE Q;  4B3T Q;  3H0G H;  2MNA A;  4NPS A;  5EAY A;  3J81 c;  3CF5 A;  3GDE A;  4X62 L;  3T1H Q;  1CSP A;  2AKW B;  2R6G A;  2Y0S G;  4GN3 B;  2YTX A;  2OTL A;  2H5X A;  1IZ6 A;  4GOP C;  1Q86 C;  1YZ6 A;  3CW2 C;  5C3E H;  2E5L Q;  1VCI A;  1XTD A;  3GO5 A;  1IXR A;  3MXN B;  1OXU A;  1VQ4 A;  2MQH A;  1JJ2 A;  2UXB L;  1WCM H;  5M3F H;  3CCL A;  3HKZ E;  1E7Z A;  2KHJ A;  2Q2H A;  1SN8 A;  3TRE A;  5BR8 Q;  4DK3 C;  4A3K G;  1PH2 A;  4JV5 L;  1FJG L;  4DV6 Q;  1EFW A;  3CME A;  2HHH Q;  4JI2 L;  4A3B G;  2NVQ H;  4A3M H;  5M5Y H;  1HZC A;  4IPC A;  4BY1 H;  2JA7 G;  3HOY H;  4KHZ A;  1N32 L;  3NEL A;  1A8V A;  5IWA Q;  3L2P A;  2A19 A;  4WJ4 A;  2K5H A;  4A3J H;  1MJC A;  3UE0 A;  1VQF A;  1WYD A;  3CCQ A;  2F4V L;  1TWC H;  1BVS A;  1D8L A;  3LGJ A;  2Q2I A;  4LUO A;  4OWT B;  1CKN B;  1HNZ L;  4JI7 Q;  5M3M G;  4JOI C;  4RMF A;  1Y1W G;  3PCO B;  2JA9 A;  4DR6 Q;  1FL0 A;  1VQ5 A;  1I6H H;  2UXC Q;  2WFW A;  3U58 A;  3CCU A;  2PMZ E;  1J5E L;  1N8R C;  1B7Y B;  3HOU G;  3WWV A;  2OQK A;  4DR5 Q;  4O2D A;  1YIJ A;  4LWC A;  2VY3 A;  3M4P A;  3HOV G;  1K8A C;  4LF6 L;  3M4Q A;  5C4X G;  2EXD A;  2VQE L;  3Q8D A;  2QA4 A;  3CQZ H;  1I94 Q;  1X9N A;  1PH8 A;  2NVY H;  3GTL H;  2WB1 G;  3T1H L;  2DGY A;  2JA8 H;  4YY3 Q;  1L0W A;  4YHH L;  2JA6 G;  1A62 A;  1NMF A;  1SE8 A;  2EIF A;  3F1Z A;  3GD7 A;  4JC0 A;  3G48 A;  1K83 H;  1EWI A;  5IP9 H;  3RNU A;  2E5L L;  2F3I A;  1GVP A;  3CCJ A;  4QQB X;  3OTO Q;  2ZJP A;  2N8N A;  2N78 A;  4AYB G;  1XNQ Q;  3E9H A;  1VQD A;  1RIP A;  5C3E G;  2OTJ A;  3PUW A;  5M5X H;  4HJA A;  1QVG A;  4Y52 H;  4IJH A;  4DV6 L;  4OWX B;  4DUZ Q;  1VQ8 A;  2HQL A;  1EIF A;  1WCM G;  4C3J H;  2WAQ G;  1Q1B A;  5M3F G;  1TWG H;  1KQS A;  3S1Q H;  4P72 A;  2CKZ B;  4GNX B;  4QGU A;  4LF8 L;  3CP0 A;  3K7A H;  3KF6 B;  2PNH A;  2IY5 B;  4DV2 L;  2XGT A;  1PH5 A;  4A3M G;  5FJ8 H;  1IL2 A;  3U50 C;  4BY1 G;  4FDB A;  1VQ9 A;  4A3G H;  1QVC A;  1L1O C;  4X62 Q;  3D31 A;  2R92 G;  2UXC L;  4A3J G;  2DUD A;  4DV3 L;  4A3I H;  4HIO A;  1NJI C;  4DR1 L;  3OYY A;  3PO2 H;  5IYD H;  4JBJ A;  1WJJ A;  2NZO A;  1Q8K A;  3ULJ A;  4AQY L;  2R7D A;  4DR5 L;  4A3K H;  1MJE A;  4DV5 L;  3W1B A;  2UXB Q;  2KBN A;  2ALY B;  2MO0 A;  5FLX c;  1YJN A;  4A3C H;  2JK8 A;  2E2I H;  4KI0 A;  2ZM6 Q;  3CXC A;  2BH8 A;  4IO9 A;  4JV5 Q;  5M5W H;  1SR3 A;  1U0L A;  3EN2 A;  3L0O A;  4UP7 A;  3F2D A;  1K73 C;  2KCT A;  5GAE C;  3NEN A;  2YV5 A;  4JI2 Q;  4EQ5 A;  1HR0 L;  3GTK H;  3UE1 A;  4YY3 L;  2Q2T A;  1N32 Q;  1RL2 A;  3CC7 A;  1GKH A;  5GQO A;  3HOW H;  5M3M H;  1YHA A;  1YVC A;  2VUM H;  1EOV A;  3HOX H;  3OTO L;  2E2J H;  2JA8 G;  3AEV A;  3U4V A;  1JE5 A;  1YHB A;  4A75 A;  4NXM Q;  4B3R Q;  1HNX Q;  1HNZ Q;  2UUC Q;  3J80 c;  3CCV A;  3S2D H;  4ME3 A;  3ULP A;  3CC2 A;  2D0P A;  5IP9 G;  4PG3 A;  1K3R A;  1SLJ A;  4NXN L;  1VQ7 A;  2NN6 G;  3DLL A;  3RZD H;  3RLN A;  3I4M H;  1QUQ A;  4JG2 A;  2MFI A;  1QZH A;  3I4O A;  1I3Q H;  1NY4 A;  4LF6 Q;  2R7Z G;  2JA5 H;  3CMA A;  5HY6 A;  2UUB Q;  1IYJ B;  4UY8 C;  4R4T A;  3I2Z A;  3UDG A;  1Y14 B;  3GTM H;  1K8G A;  3G71 A;  2CFM A;  2QGQ A;  2YTV A;  2K50 A;  4OXP A;  5FJ8 G;  4YHH Q;  2RHS B;  3KJO A;  3JAM c;  1PH7 A;  3BZC A;  5JJL A;  1M1K C;  1SMX A;  5IYB H;  3RZO H;  4B3R L;  4A3D H;  2CQO A;  2K14 A;  5H1S E;  5LMN W;  1HZB A;  3NBH B;  4HIK A;  4A3G G;  3A5Z B;  4A3I G;  3T1Y Q;  4UPA A;  3STB C;  3PO2 G;  4AH6 A;  5IYD G;  3UDX A;  1Q12 A;  3A74 A;  1H95 A;  2ZM6 L;  4OO1 I;  1S3O A;  3VDY A;  4BY7 H;  3HKZ G;  3W5O A;  2JEA I;  4K0K L;  1X54 A;  2BA0 A;  1YI2 A;  3M4O H;  2L15 A;  4PMW A;  5IP7 H;  4A3C G;  4A93 H;  3W1G A;  2CCZ A;  1XPR A;  3S1R H;  1EYG A;  4JI5 Q;  4LF8 Q;  3KJP A;  4DKA C;  1KC8 C;  4DR7 Q;  3B6Y A;  4GOP A;  3TS2 A;  1VQC A;  2R92 H;  2IX0 A;  4DV2 Q;  3HOZ H;  1HZ9 A;  3S1M H;  4R1J A;  4NXM L;  2K5V A;  4AIM A;  1HNX L;  3M7N A;  4C3H H;  2UUC L;  2PQA A;  3HOW G;  1JMC A;  4BBS H;  1I5F A;  2VUM G;  2WP8 J;  1PHJ A;  3HOX G;  3S17 H;  4DV3 Q;  3S1N H;  1PH9 A;  1NE3 A;  4XIG S;  4DR1 Q;  3J81 i;  3PUV A;  1LUZ A;  3HKS A;  4L5Q A;  4PZ8 A;  4AQY Q;  1N34 L;  4R4I A;  3PUX A;  3BZK A;  3RLF A;  4DV5 Q;  3ER0 A;  1UE5 A;  4YWM A;  5HGQ A;  3SGI A;  5AJ3 L;  4DV1 Q;  3I4M G;  3KDF A;  1V43 A;  3FKI H;  2UUB L;  4GNX C;  4A3E H;  4QL5 A;  4A4I A;  3TS0 A;  1HR0 Q;  1VQP A;  2CWA A;  1WOC A;  4JCV E;  4TVA B;  4JOI A;  5IYC H;  4HID A;  1TWH H;  2JE6 I;  3I4N H;  3PIP A;  2JA5 G;  4UP8 A;  4BXX H;  1KIX A;  4OO1 G;  5JJK A;  3G4S A;  4DV4 L;  2UU9 Q;  2AWO A;  3PGZ A;  4R4O A;  4EX5 A;  2C35 B;  1NTG A;  4BXX G;  3T1Y L;  3AFP A;  1ASY A;  1NMG A;  2RHQ B;  1EQQ A;  1CKO A;  2ZTC A;  2ES2 A;  5IYB G;  1X55 A;  5E7N A;  1L2F A;  3CPW A;  3DM3 A;  1XMQ L;  4TQU S;  4A3D G;  2RF4 A;  3PUY A;  4NXN Q;  4A3F H;  1YNX A;  4JBM A;  2WB1 E;  4GN5 A;  2R7Z H;  1VS0 A;  4PZ6 A;  3ULL A;  1EUJ A;  5IT9 c;  3PF4 A;  1VQO A;  4B3S L;  2A8V A;  4JI5 L;  4BY7 G;  5C0X I;  2K5N A;  1P16 A;  4LFB Q;  1C0A A;  3IRB A;  1K9M C;  1KHI A;  2V1C C;  4OWW B;  1KRT A;  5IP7 G;  1N36 Q;  4A93 G;  4HIM A;  1UE7 A;  3F2B A;  4AYB E;  2CWP A;  5K36 G;  2LSS A;  1SRU A;  4GLV B;  3HOZ G;  4QIW E;  1X3E A;  1LYL A;  2D62 A;  1Q46 A;  3PSI A;  4BBR H;  4DR3 Q;  3RN5 A;  4BBS G;  2IX1 A;  4JI3 L;  2R7F A;  2NVX H;  2WAQ E;  4J15 A;  2N3S A;  1AH9 A;  1VQJ A;  3AQQ A;  5IE8 A;  2GN5 A;  2YYZ A;  4L5T A;  2ZTD A;  1VQI A;  2EQS A;  2N49 A;  4DV1 L;  3CPF A;  1FGU A;  2E2H H;  1JT8 A;  5LMU Q;  5C4J H;  2E8G A;  4K0K Q;  1KD1 C;  4DAM A;  3CCS A;  3I55 A;  4JI4 L;  4HJ9 A;  1LM0 A;  2JEB I;  3S24 A;  3STB D;  1V9P A;  4C3I H;  3PIO A;  3TRZ A;  3U4Z A;  1L1O A;  1Q81 C;  3FKI G;  4IOA A;  4HJ5 A;  4LNQ A;  4LUV A;  4DR4 L;  1AE3 A;  1TWA H;  4A3E G;  2UU9 L;  3UDI A;  1A63 A;  3KOJ A;  3S15 H;  5GAD C;  1PYS B;  3KLW A;  5IYC G;  3KF8 B;  3I4N G;  1BBW A;  2Z6K C;  1GD7 A;  4POG A;  1LTL A;  2VQF L;  2LXK A;  2MO1 A;  4X64 Q;  1QVF A;  1CUK A;  2KCM A;  1CKM A;  2B3G A;  1JB7 A;  4DR7 L;  1BBU A;  4JI1 L;  4DPG A;  4P74 A;  5FLM H;  1N34 Q;  3CD6 A;  2PI2 E;  3H15 A;  3S14 H;  4QY7 A;  3J7Z C;  3OW2 A;  3I7F A;  1IBK L;  2XTI A;  1Y1V G;  2UUA Q;  4MNO A;  5AJ3 Q;  4A3F G;  2ASB A;  4LFB L;  3CAM A;  1Z9F A;  2AMC B;  4IFD I;  3F2C A;  1N36 L;  1KRS A;  4RG1 A;  4LF9 Q;  1KXL A;  3GTP H;  1E1O A;  1XNR L;  2K52 A;  3JC6 6;  4LUZ A;  1HJP A;  1G51 A;  4ALP A;  3EBE A;  1ASZ A;  4KHP Q;  4DR3 L;  1KAW A;  4KLK A;  4O0A A;  4DV4 Q;  1VQM A;  4JI6 Q;  1X6O A;  1PH6 A;  1UE6 A;  1E24 A;  4MZ9 A;  3CCM A;  1VQE A;  2VW9 A;  1VQL A;  1VQA A;  4GKJ L;  4BBR G;  1WI5 A;  1O7I A;  2VZA A;  1UEB A;  4IPH A;  1QUQ B;  4DAY B;  4JBK A;  1T9H A;  1UE1 A;  1XMQ Q;  3PV0 A;  5LMU L;  3H3V I;  3MEF A;  3J80 i;  4DUY L;  4POF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...