3E6ZX

1.0 a structure of cusf-w44a-cu(ii) residues 10-88 from escherichia coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
EAQPQVISATGVVKGIDLESKKITIHHDPIAAVNAPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusF
publication title Tryptophan Cu(I)-pi interaction fine-tunes the metal binding properties of the bacterial metallochaperone CusF
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3e6zX01
2VB2X 3E6ZX 2VB3X 1ZEQX 2QCPX 2L55A 3TDQA
chains in the Genus database with same CATH superfamily
1NE3A 1TY0A 2EZVA 2R92H 4UDUC 5M3FB 1TT2A 3LWEA 2KJXA 2JA9A 1YNJD 5LMNW 1QJOA 2F0MA 1U0LA 2AWNA 3A7AB 2RDGA 4DR2Q 5GAGC 2LXKA 1Q90A 4B3SQ 1E2VA 4JPBW 1LTLA 2KECA 1GO3E 2VNUD 1JE5A 4DV4L 4C2MB 3ERSX 1EIYB 1J8IA 1GUSA 4JBWA 4CKEA 4FF4A 4K5VA 2EY1A 3KOJA 5KNBA 5KYIA 3HKZB 3CKIB 1TXYA 1D8LA 5M5YH 5G3LF 4GZYC 2DUDA 1X3FA 2YU9B 3OHXC 1E3PA 4FXKC 2MQHA 5M3FG 5ELOA 3KJPA 4LF8L 1S5BD 3HFZB 1VQOA 1JWUD 1EFWA 3J7AF 2EDGA 3W2DA 5EKLA 5EQ0A 4Y7NH 5C4XH 1JOQA 4BY1B 2EIFA 1SXTA 2ZM6Q 5CR3A 1NMGA 2K14A 1E1OA 4R9WA 4DR4Q 5DEHA 2B39A 5CBAE 4KKUA 1PFSA 2BCOA 3X3NA 3A5UA 1SMXA 3VR3A 2UXCL 1H9KA 5CV4A 3PO2H 3MA2B 3BG3A 1VQKA 2B2YC 1VDZA 3HKZG 1Y1VH 1I6VC 1SJHD 1GUNA 4CGYB 3NEMA 3NK9A 1CQVA 5ELBA 3FDTA 5C0XH 3KUPA 2ASBA 2RDFA 4GOPC 3NBIA 5D3IB 4X64Q 1OO9B 4A3EG 1PZKD 1XNRQ 3NSWA 4DR7Q 5CORA 1SYGA 1S3OA 4FDBA 3FEWX 3T1YQ 4QQBX 1D5XC 4O0AA 5DM63 1SE3A 1UAPA 1I4GA 1WTOA 2OWOA 5EPKA 2E2IH 4JI3Q 4R8NA 3I2ZA 4X6AH 3OMGA 4DXFA 4IPCA 4K6LA 4GNXB 2PMZB 2NVTH 1EWIA 3IFTA 3I4NH 4RAUC 4DU9A 3X3MA 4CJ2C 1G6ZA 3KF6A 3U4VA 1XTDA 1L0WA 2MNAA 2NYZD 1BDOA 1STYA 2F0UA 3AYHB 3RN5A 1YIJA 2VZAA 5IP9H 1IZ6A 1VQNA 2K04A 3B6YA 5JJZA 4R4IA 4F7XA 1OXSC 1U4LA 4A3KH 3RZDB 1I50B 1X3QA 1CHQD 2WAQG 3N6RA 4DV6L 1ZEQX 2N8NA 2KHJA 2N3SA 1CKNA 2AHOB 4K0KL 1EYCA 3VA5A 1TWAH 4DV2Q 4PMCA 4ALPA 1QNKA 2KEDA 1W6JA 1KRTA 3S24A 2QF7A 5JOBA 2G9HD 1IBLL 1YVCA 3AFQA 3BDOA 1PTOH 1VQEA 1SAPA 4XQNA 3FRPB 1T5XD 4OHJA 2CH4A 1JOOA 5IYBH 1UE5A 4JI5Q 2NZ1D 3D6CA 1AE2A 4J1MA 1DXMA 2UUBQ 2Q8RE 2JA8G 1YI2A 2JE6I 2A1AA 2I0QA 1X9NA 1HZAA 4C1NK 5KEEA 4O2DA 4XQJA 2F0EA 4DAMA 4DR3L 2JEBI 1FL0A 1BNZA 1CA5A 5LHY1 1VQ9A 1CSQA 1MGSA 1HZBA 3A8JE 3NWTA 2F0LA 4LFCL 1LTSD 3M4QA 1MD2D 3QIAA 1AFPA 1TS3A 4Y52H 3KYHC 1VCIA 4NKLA 3IAYA 2QKIC 3SK8A 1PRTD 3HOUH 1K8AC 5IGEA 2EYLA 5GAEC 2RSOA 3BVZA 4LFAL 2Z8LA 2UXDL 2HIVA 3I73A 4OO1G 4JI0Q 5CBEE 1FVIA 2A68C 4BY7H 3PGZA 4N8FA 3A8KE 3K57A 5K36H 5M5YB 1KABA 1ENFA 2CWAA 3CMEA 1EY8A 5K5PA 1YJ9A 2JA7H 4RKBA 4DR2L 4Q0FA 3CCVA 5T1IA 4DR5Q 4A3GB 4GKJQ 4B3SL 5C4XB 4KHVA 2FINB 1SE2A 1SROA 3ND8A 4IQZA 1PA6A 2D62A 2KUMA 1IKMA 4TKOB 1LLRD 5IOCA 2QILA 1NJIC 3VDYA 1JC7A 1VQFA 4R4QA 4K8IA 4DF7A 3PO2B 1A6XA 1TR5A 5NUCA 1Y1VB 1ESFA 4KK7A 1D5MC 1EY6A 1YNND 2PQEA 3HS0C 3EVQA 2GVAA 2F1MA 4J15A 4HJ8A 4JV5L 3SK4A 4K8JA 2K03A 3ITPA 5C0XJ 2ZM6L 5T1GA 2AKWB 5CV5A 4A3GG 4FF2A 4DR4L 4KMUC 1XMQQ 5C3EG 1YBYA 3M3YB 3K5LA 5C4XG 1PH9A 4M8AA 3PF4A 3H0GG 1A3TA 1PYBA 2R6GA 2E2IB 1HFGA 1B7YB 4HJ9A 2F0HA 1V43A 4CJ1B 1KXLA 1VQHA 3JC66 1VQJA 2R7ZH 2NVTB 1STNA 4ULLA 1SNPA 1SJED 3DMUA 3CW2C 2EY6A 3AB9A 3SEBA 1AZPA 5JPMC 1U9RA 1LTTD 5IYDG 1XNRL 1SLJA 3GTGB 2Q2UA 1N32L 4A3BH 3LGJA 2WIIB 5D14A 5GADC 3BDCA 1MBYA 1Q82C 1JB7A 5IGDA 2FMMA 4P73A 1H95A 2K5WA 1PH8A 4H13C 3RZOB 3STBC 2VQEL 2UXBL 4LW1A 2HT1A 1WD0A 3DEPA 1K3BC 2IW3A 3HOXB 3MXGA 1O78A 1TWGH 2RKSA 4JI6Q 3K8AA 3KF8B 1JOKA 1CUKA 5HGTA 1Z6HA 2A74C 2B2VA 3Q8DA 1PTOB 1TIID 1Q46A 3PO3B 3CD6A 1DD2A 1S5FD 1X3GA 2OTLA 1JT8A 3P75A 5AJ3L 3C46A 1RL2A 4ZYSA 2PQAB 5IP9G 4LUOA 3L3OC 1D6EC 3NBHA 2VS1A 3NUCA 3S15B 2AUJD 3OMCA 3I8ZA 1KAWA 3I4MH 1STEA 4O42A 3KBXA 3KDFB 5FLMG 1HCZA 1NSNS 3OOCA 1JJCB 2O4XA 4ZUIA 4JI8Q 1JWMD 3I90A 4ZUJA 3R2IA 3DWAA 3CPWA 3HOXG 4WJ4A 3PUYA 2A8VA 1MKHA 2EYPA 1GHKA 4DR1L 3A74A 3MEFA 1HNXQ 2I5HA 1LT6D 1PTOF 5C3XA 3PO3G 1CSPA 1BBWA 1Q8KA 3M7GA 2F0SA 1L1OB 3D4RA 2EYOA 2VXWA 4AH6A 4LF5L 1HHVA 4JI5L 4L6TB 1DOKA 5IYBG 2JYOA 5EGTA 2F0JA 5FLXL 3JAME 3MVVA 3S14H 4LFBL 5CMDA 1RIPA 2SNSA 5DLQE 4PZ8A 3HOUB 1V1QA 5FOBB 4DPGA 5IODA 5FKAC 1VQAA 3J7AV 1GXDC 1TWFH 2L0CA 2EE1A 3G7LA 3SR1A 2PNRC 1WTWA 5IGBA 4X3UA 1H9SB 5C6AA 4JCVE 5C44H 4JI2L 1OXTA 3JAML 1CQFA 1XNQL 3TBIB 4IUQA 4A3CG 1RHPA 2KCNA 3E9HA 2PYKA 5BR8L 3KLWA 1EIGA 2JA7B 3TREA 3F2CA 2UUAQ 3S1MH 1HZCA 1B53A 4XQQA 3E0EA 4QUFA 3CCLA 5C5LA 1HR0L 4KY5A 1S40A 4N9PA 1L0XB 2KA7A 3UI2A 4HIDA 5FO8B 1FYCA 4OIJA 2G9DA 1LO5D 5I2YA 2LS01 5M3MG 3TDQA 1XMOL 5LMUQ 1N36Q 4P75A 3QO2A 4HEDA 1N34L 4XDXA 4F87A 2E2JH 2EVBA 2K50A 4NDXA 2IJ0A 4XXEA 1B1ZA 4HCSA 1W3SA 2F0FA 1G6PA 4X66Q 1KQSA 1DM0B 3HOYB 3GTLH 2B8FA 4H44C 4R8IA 5GQOA 1D1IA 4DR5L 1K3RA 4G57A 1HZ9A 2QW7A 1K28A 2H5XA 1PZJD 2NZHA 4ME5A 2NVXH 4EQPA 1EZ8A 4OELB 4K14A 5TSSA 1T9HA 3BZDB 4K2KA 1O80A 4BXXH 1Y69U 1LTRD 3NTHA 1S4ZA 5E4WC 3NP8A 4DV0L 1FNWA 2KBNA 3J81E 3T16A 3IFDA 1PRTB 2B63B 2Z9HA 1BUVT 2OCEA 2R7ZB 3J80E 2NN6G 5E1FA 3HOYG 4A76A 2XIWA 2PCFB 4DUYL 1RDPD 3AFPA 4A3BB 3J81L 3BYYB 4QUCA 4DK3C 1SMYC 1WOCA 2F0PA 2BE5D 4XYQA 1AH9A 1DZ1A 4MN3A 5FO7B 3QB3A 5IP7G 4IPGA 2ATWA 1X32A 2QA4A 1V1PA 3EBEA 3TEHB 1BF4A 2EYHA 3D31A 2VUMH 2KHIA 3S9WA 3CAMA 2CW0D 2B63G 1PRTF 1ENAA 2J7ZA 3EN2A 4C3HH 1TWGB 3CRKC 3PUVA 4BBSH 2K75A 4C3JG 1BQQT 3U9OA 1FNVA 5JEAG 1DGSA 3M4PA 1VQ4A 1A8VA 2DJFC 2YV5A 3HKSA 4HJ7A 4P72A 2B2VC 1NNXA 1HNWQ 4V0BA 3F2DA 1CI3M 1PFNA 2Y0SE 2F0GA 4P2CB 2JA6H 4JI4Q 3LWUA 1B2TA 1OXUA 1U5KA 1AEXA 5I6WA 3W1GA 4YWLA 2KQ3A 4DNTB 1TKWB 5M5XH 3I4MB 2E5LL 3I72A 1KDAA 4R4TA 3HOWH 3K7AB 1F2MA 3M4YA 3MXNB 1GUGA 4A3JH 4X62Q 3OTOQ 4JI6L 2RCFA 3TZUA 1LYLA 3ULPA 4GLAC 2E74C 4QMGA 2M2LA 2F0IA 2K01A 1F77A 2CVRA 3FKIB 2BDNA 2PZUA 2MO1A 3QOJA 3AU7A 2RDHA 3PIOA 3MFGA 1PH4A 2NZOA 3U58A 4NPSA 4UY8C 3F1ZA 4DR6Q 2L1BA 4IO9A 3A5ZB 1BXTA 1A0IA 4JI8L 3I4MG 1C4QA 1KL9A 2QCPX 4A3FB 3A8IE 1EIHA 1KDCA 1TWFB 4KI0A 1TU2B 3Q22A 1LTID 1FGUA 2KCTA 2IHEA 4EQOA 4OWXB 1HNXL 1YHQA 5C44B 1I4QA 3KLRA 4S3SA 4KY7A 3VR4A 3TP7A 1H9SA 3FKIG 5BN3A 2E2HB 4V190 4KTAA 3C3LA 3NQIA 5IT9c 2EJGC 4JVZA 2N55A 4DAYB 1BBUA 2ZJPA 5ELDA 1BBXC 1DONA 5KNDA 5IYCG 3S1MB 4ZRZA 3CXCA 4IOAA 2E8GA 3W5OA 2XSCA 1GVPA 4HSPA 1Q1EA 4B3MQ 2UU9Q 1CZGA 1TS4A 4GKKL 1SR3A 4K2LA 4A3FG 2F4IA 1PMRA 3GO5A 1HNZL 1NBWA 2VQFL 1Y1WG 4NMZA 5AFWA 1VQBA 4IN3A 4DV7Q 1GD7A 1UE1A 3EQLC 1HJPA 2D5DA 2F0QA 2E2JB 2JA5B 4MTKA 4P74A 1EQTA 2QEJC 3VYUA 1ILQA 3FPPA 3GTLB 4DV3L 2WB1E 3BZKA 1VQLA 2Q2IA 3OSOA 1K83H 2OXPA 3GTQH 1SFOH 1ZYRD 2NVXB 2Q2HA 3HOVH 4B3TQ 4AYBB 1SYCA 2NVYB 2IWHA 1I5FA 2NB0A 4KJNA 1N36L 4A3MB 1PTOD 4ID6A 5EBCA 4AQYL 1EYGA 4A3LH 1QUQB 1BO0A 4IUNA 3NQTA 3T1HQ 1YNJC 1M1KC 1PDQA 2CQOA 1S5ED 4PMBA 4X66L 2HQLA 2JA5G 4YWMA 2OF1A 3RR5A 3C2PA 3EROA 2WACA 4IUUA 1WTQA 3CCQA 2D9UA 2RBMA 1RCVD 5A2QE 4BY1G 4HJAA 2R93H 3J7ZC 1PH1A 4YCVA 1PH2A 4FXDA 1W6KA 2AQ3B 1ICWA 1R4QB 1CM9A 4AYBG 1ASYA 3I91A 1J5EL 1LT3D 4A3MG 5D3DA 1H9MA 5D65A 1UUPA 2SOBA 5BN4A 3UE1A 1LUZA 5A2QL 1YNXA 2VUMB 2N88A 5FO9B 2A69D 5I6YA 2KEEA 3C1FA 3BVMA 1VQPA 4JI7Q 4BBSB 4KHPL 4TVAB 3E3XA 2JSOA 5A35A 3OIQA 1IBKL 4JYAQ 2IY5B 1C8CA 1M90C 3R93A 1JICA 1KNEA 2XWJB 5E4XA 1PXUA 2JA6B 1PLFA 3ULJA 4IUTA 1QVCA 4YHHQ 1A63A 1JMCA 2CQAA 3PV0A 5IIFA 1DOMA 2DNCA 5M5XB 4A3IH 2EXDA 4QL5A 3SDZA 2YTXA 4A3JB 5DNFA 4IFDI 4F88A 2RVLA 3MXNA 1HPCA 1IHZA 3EIVA 3V96A 1G91A 3OWFA 4PG3A 4KD4A 5KIXA 4UPAA 3VR5A 2Z6BA 1I4XA 3H09A 3WOEA 4JOIA 2X6GA 1CA6A 1RJTA 2D0PA 3BDLA 3TS2A 2AWOA 1MHWC 2CKZB 1SNDA 4L5SA 3GTOB 1HTLD 4X62L 2HHHQ 1VQCA 4IJHA 3RLOA 1N9WA 3RD4A 3MFYA 3QWNA 4LJZC 1NY4A 5EPJA 4X65L 1EQRA 1MJCA 2JN4A 1I3QB 3EFXD 1U4PA 1XJVA 1J6QA 4DUZQ 2ICEC 2R92B 2F0OA 1FNUA 4LF6Q 1HXYD 2JP1A 1FJGQ 2X69A 3A55A 1IBMQ 2EJMA 2EOTA 3M7NA 5GROA 4QIWE 4POGA 3CC4A 4B3RQ 1OXVA 2WP8J 3K58A 2EY5A 3S1QH 5IY0A 5HY6A 1E1TA 3QJYA 1PFMA 4R4OA 3RLNA 3CCEA 3SK5A 2SNMA 4KN7C 2K4KA 2B2TA 4CDEC 4KKTA 1YJNA 4DNIA 1ICFB 2K28A 3G71A 2Z0SA 1SYDA 2B2UA 2R92G 1BCPB 4JBJA 2JQOA 3CRLC 1EU3A 4EX5A 3VYTA 4Y7NB 3A7LA 4A93H 2JJQA 3QG1A 5DM73 3UDIA 5IE8A 1K83B 2A6ED 1HTPA 2IX1A 2K32A 2IX0A 1G2SA 2V1CC 3TQYA 1SFOB 2E76C 4XT1B 4B9XA 5EPLA 1HH2P 3L2PA 1A62A 1N8RC 1EY4A 2OQ0A 4A3DH 1ET9A 4DK1A 4FF3A 3DXJC 1KLGD 3PSIA 2K5VA 2AMCB 1QWYA 5C4JH 1UE6A 2ZJQA 1UWVA 1WCMH 4ZK9B 5I9OA 2Q8IB 4GLVB 4GN5A 2NBFA 1VMPA 2EY2A 1VF7A 4LF4Q 5J3BA 1BCPF 2K5NA 1I4HA 4J6HA 4MHEA 3UE0A 3E5SA 5JPNC 1LTBD 1TWHH 2R93B 2BA1A 3UDFA 4JI1Q 1UE7A 1N33Q 4DV1Q 1AN8A 4HAEA 4I65A 2HCIA 3NXWA 3PO2G 1SDFA 4HIKA 1HRJA 4RG1A 1E7ZA 1Y1VG 3PUWA 4NP5A 2CH4W 4GNXA 4X3SA 5I4DA 3I4NB 1K0RA 4X64L 4CHTB 5C0XG 4RH6A 2SEBD 3GTMH 4LF9Q 3J80c 4DR7L 2ZXRA 3T1YL 1GM5A 1XPUA 4H02A 2K7VA 1O7ZA 2R93G 4JI3L 3O13A 3HOZH 1A3VA 4GOPB 5EKIA 1AW7A 3M85A 4A3KB 2I46A 5IGCA 2ALYB 3NPPA 1EUJA 3SVMA 2BOSA 3H15A 2I5MX 5BN5A 1YHAA 1TWAB 1YNNC 2F0DA 3H6MA 1EQQA 4TQUS 4CDCC 1QOHA 4LWCA 5LL6X 3I4NG 3J81j 4DFAA 1WTVA 1B70B 3TZDA 3CCRA 1F9QA 4C3IH 3A56A 4IZ8A 2WB1B 1JB3A 1EFID 2XTIA 1EY7A 2NTSA 3HKZE 1YZ6A 4IFDH 4U68A 4JOIC 1K0SA 4A3KG 3PF5A 4DV2L 5JJIA 2K52A 1AZQA 4G7OC 1E22A 4POFA 1EY9A 2O5JC 4LUZA 1JE4A 3HGBA 5FLXE 1RKNA 2K5HA 4EGVA 2K33A 1IL2A 4U673 2HCCA 3TRZA 3S2DH 3W1BA 1B3AA 3FPUB 1STGA 3M4OH 1LT5D 1PV4A 3IL8A 1LACA 3OWEB 3QR8A 4A4IA 4AIMA 2UUBL 3A54A 2DY8A 1F9PA 1M4VA 2MJ8A 1NTGA 5JVG3 1R9TH 1XPRA 5KGUA 1WFQA 4ILWA 5EBDA 4B9WA 3I7FA 3CC2A 2F3IA 3IKJA 3D8GA 3ICEA 1A2TA 2LSSA 3KK7A 4OO1I 3MAQA 1V1OA 2J4XA 2IHFA 3R8BA 2C5CA 4YY3Q 4BY7B 3H94A 1O7IA 4G4KA 4PZ6A 2XWBB 2B2TC 1PH6A 1X65A 3U50C 2WAQE 3CQZH 4LF6L 1WYDA 1HR0W 1E0BA 2R61A 2D0OA 5LMNQ 2B2UC 3TS0A 4PV1C 2PMZE 2HQEA 4A93B 2P5ZX 4PZ7A 2C35B 2KCMA 1G8ZD 3F2BA 5M3FH 3DUZA 4L5QA 3DWPA 3HOUG 3DM3A 4JI0L 3JAMi 1HQMC 2XRSD 4LMQD 1WD1A 2FHTA 5I2XA 4RCOA 5ELNA 4JBMA 4LF8Q 1VQGA 4A3DB 1X6OA 4BY7G 3I70A 5K36G 4KD3A 5C4JB 2A6HD 5ELEA 3BYTB 3EJIA 1VQMA 1WCMB 1X54A 1E24A 1RF2D 5FJ8H 1ILPA 3PIP3 3FP9A 4L5TA 4GKJL 4RCNA 2JA7G 3R2TA 1BKBA 2EXZA 4WRDA 3I55A 1D1KA 4FXGC 2XRQD 4A93G 2PW5A 3D4DA 4K6DA 2YU9H 4DXGA 3BJUA 1JR0D 1XYIA 1GHJA 4A3EH 3F8TA 4OXPA 3DWQA 4A3DG 2Z4IA 3E6ZX 1L2FA 4L5RC 4DA2A 3PCOB 1V9PA 1X3PA 2ID0A 5COYA 3Q23A 3AQQA 4OGQC 4GNXC 1GUOA 1JJGA 1SE8A 4K5WA 4YCWA 3GTMB 1ESRA 2KVMA 3F2UA 5ELCA 1XMQL 4KN4C 4RHSA 1Q86C 3K5OA 2SDFA 3HG9A 3RN2A 4JI1L 1YJWA 2CWPA 4G7HC 3S17H 1P8LA 1GOZA 4QIWB 3HOZB 3NE5B 3I4OA 1RD9D 2Z6KA 1CKMA 1SN8A 1OTCA 1EU4A 4KLKA 3K81C 2MHVA 2A73B 2UUCQ 3Q24A 3ZJYC 4DAVA 2R7ZG 3CF5A 1IW7D 1CZWA 1KAAA 1KHIA 4FP5D 1WTXA 3J81i 2Q2TA 4LF9L 1IYVA 3KF8A 2ZTDA 4Q5VA 1WI5A 3P1HA 4C3IB 4A3BG 3J80i 4K0KQ 2WKCA 2F0VA 4CJ0B 4E6IA 1YITA 3S16H 5JJKA 3HOZG 3KF6B 2PQAA 4PMWA 2QDLA 4X3KA 4IFDJ 2L5TA 1UNSA 4ME3A 1IBLQ 1EOVA 4PNYA 4FVMA 3BS1A 2E75C 3KDFA 4ZKCB 1QILA 2IPKD 3SHLA 2HUGA 1WTRA 1YEZA 4IURA 1BCPD 3E9IA 2V4DA 3V2TA 1F2YA 2QGQA 3KJOA 4EQNA 2JA8H 3A0JA 3G48A 1CKNB 1KC8C 3HZXA 5CV8A 3M9BA 4I7AA 3S2DB 2DGYA 3M4OB 1MSHA 2BE5C 1ASZA 2B3GA 3NELA 4C3IG 3H91A 1L1OA 1ZKOA 2LFNA 4NXNQ 1SBBB 4LK1C 4KKSA 4RKLA 4I7ZC 1GUTA 3GDEA 3K5NA 1R9TB 4DR3Q 1QCBD 5E7NA 3S14B 2CW0C 1TQOA 1PFBA 3TP5A 3ER0A 1LT4D 2G5DA 4LFCQ 4BBRH 2VW9A 1Z9FA 4RMFA 3ONAB 1EEID 3DLLA 2BDOA 3MWYW 2R7DA 4R4CA 4DAPA 4O1NA 1MSGA 2L12A 1JWSD 3FVQA 3WWVA 1S5CD 4OO1H 2DNEA 5C3WA 2UXDQ 4KHZA 2FJ2A 4ABNA 5L37A 4WJ3M 2FMCA 1GKHA 1XTCD 3GV3A 3HP3A 2Z4HA 1CT1D 4YY3L 2HIXA 3VYRA 2CCZA 4UP8A 1Y8PB 5C44G 1PH5A 1PVOA 1PYSB 3NWSA 4PQXA 1BR9A 5LMNL 1STAA 2F0KA 4TSSA 2LMCB 2YTYA 1KDBA 3CCMA 2MUYA 1EYDA 3OIPA 2UUAL 1VQIA 1CFMA 4LNQA 2F3VA 3K7UC 4N9TA 4MNOA 4RGTA 3VR6A 1EOTA 1IKLA 3ULLA 3D3RA 1SNCA 3AEVA 1Q7YC 3RLFA 3J7YW 4QB4A 1NMFA 1B8AA 4HTHA 3G4SA 1MI2A 3TP6A 5LMUL 4JC0A 2WFWA 2OTJA 1PZID 1QNUA 4A3EB 4A3GH 1L0YB 5IWAQ 3FHWA 1KD1C 3BU2A 3DEOA 3LX0A 5C3EH 4JV5Q 4OX9Q 5E3FA 3DM1A 1H9RA 1ENCA 2GVBA 4LF7Q 1A15A 2EJFC 3H0GH 1F9SA 2NN6I 2X6LA 1K9MC 3MC0B 1U4RA 4GN4B 5FJ8G 1PH7A 4IUVA 1XXGA 2WV6D 2NVQH 3PQIA 1H9JA 4IPHA 3UDGA 5CGKA 2QEXA 5IGGA 3S17B 4CKBA 5M9OA 1TS5A 1WTPA 2LKVA 4BXXG 1TWCH 1J9OA 5IYDH 1EY5A 1NR4A 2Z6KC 4A75A 4FF1A 2NUCA 2K5DA 1N32Q 3M3YH 1B50A 4C3HB 3R3OA 2EPBA 2VY3A 5DAUA 2MP1A 2WAQB 4MZ9A 2PO4A 1ZYRC 2DN8A 5J22A 4NXMQ 4IPDA 3CC7A 2K05A 1I94Q 1PHJA 2H1EA 1PTOC 4HMJA 1Q3LA 2VQEQ 3VA7A 2UXBQ 4MTNA 2L15A 4X3TA 4GLXA 3S16B 3C1EA 1Q1BA 2PZTA 5CYUA 1QZHA 1SYFA 2JEAI 2E2DC 3GTGH 1G51A 4DK0A 3HOWB 4OL7A 4WFN3 3TN2A 1IL8A 2UUCL 2VUMG 4HMIA 4DK6C 1HUMA 3KLSA 5AJ3Q 2B8GA 4OIKA 1M8AA 4C3HG 2PNHA 1CKOA 2JA8B 1NCVA 1Y8OB 4BBSG 1HNWL 3FMCA 3G6EA 4HSVA 5FLMH 3U4ZA 3PUXA 3RZOH 1DCZA 2HD3A 1ML0D 3HEJA 4JI4L 3SK6A 5F2DA 4QGUA 3HOXH 1CK1A 1LV9A 3G6JB 3S1RH 2JA6G 1L1OC 4GS3A 3K59A 1B44D 4DN4M 2A69C 3L9AX 5IGFA 1MJEA 3PO3H 4EVOA 3K6OA 4B08A 2EQSA 3OTOL 4DR1Q 3MEHA 3HOWG 4IJLA 4A3JG 2A68D 3E0JA 3KLSX 3NBHB 4Z9CB 4BBRB 2PW7A 3S15H 4LF5Q 2O2LD 4OONA 4HJ5A 1I4RA 5FLXc 1QB5D 1VS0A 2O5IC 2F4VQ 1XPOA 3GD7A 2FFKB 4NXNL 4XTCS 2ZTCA 4LFBQ 3BVGA 2J0TD 4DR6L 1EIFA 2ZXPA 4RHRA 4UHVA 4DAYA 2WINB 3JAMc 3EA6A 2F52A 5JAVA 4A3CH 2NTTA 4JI2Q 5IT9E 1XNQQ 2B2WA 2AQ2B 1E2ZA 3RMHA 1IYUA 1Y8NB 1VQDA 3SE0A 4BBRG 5C5MA 5BR8Q 1C9OA 2CFMA 1STBA 1HR0Q 1GJXA 5IT9L 3S1NH 5LL6S 4ZQ3A 4HIMA 4CBVA 5M3MH 3GTPH 3MXPA 3GTJH 2Y0SB 1V8QA 2HDMA 1G2TA 4H0LC 4C56C 1D7QA 1X3EA 2B29A 4QY7A 1XMOQ 4B3ML 2UU9L 3GTQB 2RHSB 1N34Q 2XVSA 3HOVB 1K8OA 4DV7L 2DJGC 4DV5Q 5FK9C 3MXUA 2YTVA 4DKAC 1AP0A 4TRDA 2L4NA 1QUQA 2K6AA 3T13A 2ZT9C 4CDDC 3WOFA 5C3EB 2IL8A 2PZWA 3K0XA 2L55A 5CC4A 3H0GB 1PRTC 2VB2X 3T51B 4QJFA 5JVH3 4HCEA 1VQ7A 1Q81C 2Y0SG 1SNMA 1XWEA 4GN3B 3OPOA 5CV9A 5KNCA 1P16A 4DV0Q 2NVQB 4B3TL 1I6HH 3STBD 3D6WA 1T5EA 3HOVG 2NN6H 3HOYH 3T1HL 1TWCB 2TMPA 5IWAL 3LNNA 4A3LG 1K8MA 1KRSA 2F0TA 5EJWA 1EZ6A 4CDFC 4OX9L 3BZCA 3J81c 4LF7L 3P20A 4HIOA 1QVFA 4DUYQ 2LY7A 4JBKA 2ICIA 5M5WH 4QF4A 1UEBA 3PMFA 2A6EC 5KRUA 2A19A 4ODGA 5IP7H 1X56A 1VQ6A 1VQ8A 2QDBA 1X55A 2I07B 1DJRD 4WORA 1NAPA 1S72A 3U9SA 3MZ5A 1F9RA 2B63H 1SE4A 3CCJA 5HGQA 4ZAIA 2ZJRA 3H3VI 4LAAA 1NR2A 5EAYA 3VR2A 4C3JH 2MGSA 2XGTA 4L8JA 1BVSA 2K5QA 5JEAH 3CCSA 1EL0A 1RODA 3VYSA 4A3IB 3V05A 2PI2A 3N52A 4QCLA 5C4HA 1A2UA 4JI7L 1HA5A 2OEOA 1QG7A 4NXML 2YYZA 1Z47A 3MHBA 3CMAA 2AQ1B 5G3LD 4JYAL 1I94L 2EYMA 1V1PB 4RGOS 1LM0A 2CHBD 1B9MA 2N49A 3S2HH 2E5LQ 3GTKH 3DHQA 3S1RB 4YHHL 2AUKA 1SNQA 3P7JA 3GV6A 1IXRA 1S5DD 4ZKBB 2Q8TA 2WKDA 4A3IG 1WTHA 2BH8A 1FR3A 2I5LX 2XNAC 4BWGB 3J7A5 1HA6A 1VQ5A 4RA8A 1SSOA 1EWCA 3CHBD 3IRBA 4CKCA 1ZXTA 5J39A 3T56B 1K8GA 5C4ZA 2LXJA 4JG2A 4L63B 4AYBE 1Q8IA 4NB3A 4HN7A 3K80C 1B4OA 3K7AH 2WB1G 4RFBA 2KCCA 3NHHA 1A3UA 4K5XA 2MPMA 1MIUA 2FXQA 3Q0AA 4KY6A 2F0WA 3CP0A 2HHHL 3FKIH 2RQXA 1EWHA 1TY2A 2OQKA 4UP9A 4OEMB 3S1QB 4IUPA 3TSSA 1JJ2A 2JXMB 1JCKB 2B2WC 5IYCH 1EEFD 1TS2A 1HQRD 4DUZL 1O7YA 2D2CC 2F4VL 1LTGD 1O7LA 1D5ZC 3OYYA 2K1BA 1FJGL 3I3CA 4RGMA 2BA0A 4FNFA 1Q12A 4A3FH 1IBML 4DV4Q 3S1NB 3NTKA 4XT3B 5M3MB 3GTPB 1Y1WH 1W2BA 3NENA 3GTJB 4GKKQ 3PUZA 4B3RL 1G291 2L11A 2L9HA 1HNZQ 2VQFQ 1C0AA 2M9VA 1FD7D 3UDXA 1EY0A 2E2HH 2RHQB 3L0OA 3ZYYX 2Z1CA 2GN5A 1STHA 1HFNA 3K5MA 3TP8A 2DY7A 4N8X1 4FO2A 4FYDA 4DV3Q 4LUVA 1VMCA 1B3QA 3K0YA 4UP7A 4C2MH 4C1NI 2ZTEA 1K73C 1FGBD 1GUWA 2EYJA 1SYEA 1C48A 1TVXA 1BOSA 2H4OA 2KHSA 2PI2E 4RWSC 5H1SE 1I4PA 3T4AC 2UXCQ 4YIJA 3L7ZC 4AQYQ 1TWHB 1SMYD 1VF5C 1KNAA 2JA5H 4KV6A 1SNOA 3W3AA 2A5HA 1SEBD 4OWWB 2MFIA 1I6HB 5JJLA 4DV5L 3CCUA 3URYA 4MIUA 4EQ5A 3RUZA 2F3WA 5CV7A 5ELFA 3H3VC 3D0FA 4BY1H 1OXXK 1AE3A 4YWKA 1HUNA 3GQBA 4J8QA 2N78A 3D4WA 4YCUA 1QZGA 1WCMG 3GP7A 2RSNA 3TMEA 4LF4L 5C0XI 5M5WB 2NVYH 4NW2A 2JK8A 1IYJB 4A3MH 1ET6A 2B2YA 1PYWD 1DYQA 2HDLA 1XX8A 5J1ZA 4ZCKA 1J5EQ 2EYFA 2PPBC 1N33L 3AMUA 3CPFA 4DV1L 1SYBA 4M1UB 1SRUA 4GOPA 5EKKA 4C3JB 1B9NA 2A6HC 4KHPQ 1RTOA 2VL6A 5JEAJ 1RTNA 3PIPA 1U4MA 2C9OA 1IBKQ 1PH3A 3RNUA 3H3VH 2OT2A 3KFUA 1YHBA 1DOLA 3CU7A 3J80L 3PIO3 4DV6Q 3Q6SA 1EQVA 4BA1I 4UAIA 3S2HB 1Z7TA 1UEAB 2F03A 3GTKB 4IALA 4H7BA 2XN9C 2IT1A 3HRZC 4BS9A 5GAHC 1EYAA 1KLUD 5ISRA 2RA4A 2M00A 1R4PB 4JW0A 3T53B 3ERQA 1II3A 3RZDH 4IOCA 3ND9A 2R3ZA 1I50H 4HR7B 3NTIA 2MO0A 3KBGA 3WDNA 5HURA 5KYLA 1WVLA 4WJWA 3SGIA 2KOLA 1F2ZA 2KENA 3SXHA 3MTSA 2ZXOA 4F8MA 1QVGA 3I4LA 2ES2A 1KIXA 4IFDG 4KJOA 1LTAD 3I56A 1NUCA 4BA2I 4DNRB 3OW2A 4X65Q 2IX3A 1IW7C 4G7ZC 1E2WA 2VB3X 1LABA 4XYOA 1ONLA 2R7FA 1CHPD 1D2BA 4APVA 1JQYD 3QOLA 2ENBA 1QE6A 1WJJA 4R1JA 1CTMA 2TSSA 3CQZB 3OW7A 3GTOH 4OWTB 4XIGS 1JORA 5I9PA 4P71A 5CV6A 2RF4A 2BH2A 4DGZA 4JK1C 2NWGA 4ZLTF 1C7YA 1Y1WB 4LFAQ 4RGNA 2RCNA 2F0NA 1KTKA 1Y14B 1F2LA 1BCPC 2GA4B 1I3QH
chains in the Genus database with same CATH topology
1TY0A 2EZVA 4UDUC 5M3FB 1TT2A 3LWEA 2KJXA 1YNJD 1QJOA 2F0MA 2AWNA 3A7AB 2RDGA 1Q90A 1E2VA 2KECA 2VNUD 4C2MB 1J8IA 1GUSA 4JBWA 4CKEA 4FF4A 4K5VA 2EY1A 5KNBA 5KYIA 3HKZB 3CKIB 5G3LF 4GZYC 2YU9B 3OHXC 4FXKC 1S5BD 1JWUD 3J7AF 2EDGA 3W2DA 5EKLA 5EQ0A 1JOQA 4BY1B 1SXTA 5CR3A 4R9WA 5DEHA 2B39A 5CBAE 4KKUA 2BCOA 3X3NA 3VR3A 1H9KA 5CV4A 3MA2B 3BG3A 2B2YC 1VDZA 1I6VC 1SJHD 1GUNA 4CGYB 3NK9A 1CQVA 5ELBA 3FDTA 5C0XH 3KUPA 2RDFA 3NBIA 5D3IB 1OO9B 1PZKD 3NSWA 5CORA 1SYGA 3FEWX 1D5XC 5DM63 1SE3A 1UAPA 1I4GA 1WTOA 5EPKA 4R8NA 3OMGA 4DXFA 4K6LA 2PMZB 3IFTA 4RAUC 4DU9A 3X3MA 4CJ2C 1G6ZA 2NYZD 1BDOA 1STYA 2F0UA 2K04A 5JJZA 3RZDB 4F7XA 1OXSC 1U4LA 1I50B 1X3QA 1CHQD 3N6RA 1ZEQX 1EYCA 3VA5A 4PMCA 1QNKA 2KEDA 1W6JA 2QF7A 5JOBA 2G9HD 3BDOA 1PTOH 1SAPA 4XQNA 3FRPB 1T5XD 4OHJA 1JOOA 2NZ1D 3D6CA 4J1MA 1DXMA 2Q8RE 2JE6I 4C1NK 5KEEA 4XQJA 2F0EA 2JEBI 1BNZA 1CA5A 5LHY1 1MGSA 3A8JE 3NWTA 2F0LA 1LTSD 1MD2D 3QIAA 1AFPA 1TS3A 1VCIA 4NKLA 3IAYA 2QKIC 3SK8A 1PRTD 5IGEA 2EYLA 2RSOA 3BVZA 2Z8LA 3I73A 4OO1G 5CBEE 2A68C 3K57A 3A8KE 5K36H 5M5YB 1KABA 1ENFA 1EY8A 5K5PA 4RKBA 4Q0FA 5T1IA 4A3GB 5C4XB 4KHVA 2FINB 1SE2A 3ND8A 4IQZA 2D62A 2KUMA 1IKMA 4TKOB 1LLRD 5IOCA 2QILA 1JC7A 3PO2B 4K8IA 4DF7A 1A6XA 1TR5A 5NUCA 1Y1VB 1ESFA 4KK7A 1D5MC 1EY6A 1YNND 2PQEA 3HS0C 3EVQA 2F1MA 3SK4A 4K8JA 2K03A 3ITPA 5C0XJ 5T1GA 5CV5A 4FF2A 4KMUC 3M3YB 3K5LA 4M8AA 1A3TA 2R6GA 2E2IB 1HFGA 2F0HA 1V43A 4CJ1B 2NVTB 1STNA 4ULLA 1SNPA 1SJED 3DMUA 2EY6A 3AB9A 3SEBA 1AZPA 5JPMC 1U9RA 1LTTD 3GTGB 2WIIB 5D14A 3BDCA 1MBYA 5IGDA 2FMMA 2K5WA 4H13C 3RZOB 1WD0A 3DEPA 2IW3A 3HOXB 3MXGA 1O78A 2RKSA 1JOKA 5HGTA 1Z6HA 2A74C 2B2VA 1PTOB 1TIID 3PO3B 1DD2A 1S5FD 3P75A 3C46A 4ZYSA 3L3OC 1D6EC 3NBHA 3NUCA 3S15B 2AUJD 3OMCA 3I8ZA 1STEA 4O42A 3KBXA 1HCZA 1NSNS 3OOCA 2O4XA 4ZUIA 1JWMD 3I90A 4ZUJA 3R2IA 3DWAA 3PUYA 2EYPA 1GHKA 1LT6D 1PTOF 5C3XA 3M7GA 2F0SA 3D4RA 2EYOA 2VXWA 1HHVA 4L6TB 1DOKA 2JYOA 5EGTA 2F0JA 5FLXL 3JAME 3MVVA 5CMDA 2SNSA 3HOUB 5FOBB 5IODA 5FKAC 3J7AV 1GXDC 2L0CA 2EE1A 3G7LA 3SR1A 2PNRC 1WTWA 5IGBA 4X3UA 1H9SB 5C6AA 1OXTA 3JAML 1CQFA 3TBIB 4IUQA 1RHPA 2KCNA 2PYKA 1EIGA 2JA7B 1B53A 4XQQA 4QUFA 5C5LA 4KY5A 4N9PA 1L0XB 2KA7A 3UI2A 5FO8B 1FYCA 4OIJA 2G9DA 1LO5D 5I2YA 2LS01 3TDQA 3QO2A 4HEDA 4XDXA 4F87A 2EVBA 4NDXA 2IJ0A 4XXEA 1B1ZA 4HCSA 2F0FA 1DM0B 3HOYB 4H44C 2B8FA 4R8IA 1D1IA 4G57A 1PZJD 4ME5A 4EQPA 1EZ8A 4K14A 5TSSA 3BZDB 4K2KA 1O80A 1Y69U 1LTRD 3NTHA 1S4ZA 5E4WC 3NP8A 1FNWA 3J81E 3T16A 3IFDA 1PRTB 2B63B 1BUVT 2R7ZB 3J80E 2NN6G 5E1FA 2XIWA 2PCFB 1RDPD 4A3BB 3J81L 3BYYB 4QUCA 1SMYC 2F0PA 2BE5D 4XYQA 1DZ1A 4MN3A 5FO7B 3QB3A 1X32A 1V1PA 1BF4A 2EYHA 3D31A 3S9WA 2CW0D 1PRTF 1ENAA 2J7ZA 1TWGB 3CRKC 3PUVA 4C3JG 1BQQT 3U9OA 1FNVA 5JEAG 2B2VC 4V0BA 1CI3M 1PFNA 4P2CB 2F0GA 3LWUA 1B2TA 1OXUA 1AEXA 5I6WA 2KQ3A 4DNTB 1TKWB 3I4MB 3I72A 1KDAA 3K7AB 1F2MA 3M4YA 1GUGA 3TZUA 2E74C 4QMGA 2M2LA 2F0IA 2K01A 1F77A 2CVRA 3FKIB 2BDNA 2PZUA 3QOJA 3AU7A 2RDHA 3MFGA 2L1BA 1BXTA 1C4QA 2QCPX 4A3FB 3A8IE 1EIHA 1KDCA 1TWFB 4KI0A 1TU2B 3Q22A 1LTID 4EQOA 5C44B 1I4QA 3KLRA 4S3SA 4KY7A 3VR4A 3TP7A 1H9SA 5BN3A 2E2HB 4V190 4KTAA 3C3LA 3NQIA 2EJGC 2N55A 5ELDA 1BBXC 1DONA 5KNDA 3S1MB 4ZRZA 2XSCA 4HSPA 1Q1EA 1CZGA 1TS4A 4K2LA 2F4IA 1PMRA 3GO5A 4NMZA 5AFWA 4IN3A 3EQLC 2D5DA 2F0QA 2E2JB 2JA5B 1EQTA 2QEJC 3VYUA 1ILQA 3FPPA 3GTLB 3OSOA 2OXPA 1ZYRD 2NVXB 4AYBB 1SYCA 2NVYB 2IWHA 2NB0A 4KJNA 4A3MB 1PTOD 4ID6A 5EBCA 1BO0A 4IUNA 3NQTA 1YNJC 1PDQA 1S5ED 4PMBA 2OF1A 3C2PA 3EROA 2WACA 4IUUA 1WTQA 2D9UA 2RBMA 1RCVD 5A2QE 4FXDA 1W6KA 2AQ3B 1ICWA 1R4QB 1CM9A 3I91A 1LT3D 5D3DA 5D65A 1H9MA 1UUPA 2SOBA 5BN4A 5A2QL 2VUMB 2N88A 5FO9B 2A69D 5I6YA 2KEEA 3C1FA 3BVMA 4BBSB 2JSOA 5A35A 3OIQA 1C8CA 3R93A 1JICA 1KNEA 2XWJB 5E4XA 1PXUA 2JA6B 1PLFA 4IUTA 2CQAA 3PV0A 5IIFA 1DOMA 2DNCA 5M5XB 3SDZA 4A3JB 5DNFA 4IFDI 4F88A 2RVLA 3MXNA 1HPCA 1IHZA 3V96A 1G91A 3OWFA 4KD4A 5KIXA 3VR5A 1I4XA 3H09A 3WOEA 2X6GA 1CA6A 1RJTA 3BDLA 2AWOA 1SNDA 3GTOB 1HTLD 3RD4A 3MFYA 3QWNA 4LJZC 5EPJA 1I3QB 3EFXD 1U4PA 2ICEC 2R92B 2F0OA 1FNUA 1HXYD 2JP1A 2X69A 3A55A 2EJMA 2EOTA 3M7NA 1OXVA 2WP8J 3K58A 2EY5A 3QJYA 1PFMA 3SK5A 2SNMA 4KN7C 2B2TA 4KKTA 2K28A 1SYDA 2B2UA 1BCPB 3CRLC 1EU3A 3VYTA 4Y7NB 3A7LA 3QG1A 5DM73 2IX1A 1K83B 2A6ED 1HTPA 2K32A 2IX0A 1G2SA 1SFOB 2E76C 4XT1B 4B9XA 5EPLA 1EY4A 1ET9A 4DK1A 4FF3A 3DXJC 1KLGD 1QWYA 4ZK9B 5I9OA 2Q8IB 2NBFA 1VMPA 2EY2A 1VF7A 1BCPF 1I4HA 4J6HA 4MHEA 3E5SA 5JPNC 1LTBD 2R93B 2BA1A 1AN8A 4HAEA 4I65A 2HCIA 3NXWA 1SDFA 1HRJA 3PUWA 4NP5A 4X3SA 5I4DA 3I4NB 4CHTB 5C0XG 4RH6A 2SEBD 2ZXRA 2K7VA 1O7ZA 3O13A 1A3VA 5EKIA 1AW7A 3M85A 4A3KB 2I46A 5IGCA 3NPPA 3SVMA 2BOSA 5BN5A 1TWAB 1YNNC 2F0DA 3H6MA 4TQUS 1QOHA 5LL6X 4DFAA 1WTVA 3TZDA 1F9QA 3A56A 4IZ8A 2WB1B 1JB3A 1EFID 1EY7A 2NTSA 4IFDH 4U68A 1AZQA 4G7OC 1EY9A 2O5JC 1JE4A 3HGBA 5FLXE 1RKNA 4EGVA 2K33A 4U673 2HCCA 1B3AA 3FPUB 1STGA 1LT5D 3IL8A 1LACA 3OWEB 3A54A 2DY8A 1F9PA 1M4VA 2MJ8A 5JVG3 5KGUA 4ILWA 5EBDA 4B9WA 3IKJA 3D8GA 1A2TA 3KK7A 4OO1I 3MAQA 1V1OA 2J4XA 3R8BA 2C5CA 4BY7B 3H94A 4G4KA 2XWBB 2B2TC 1E0BA 2R61A 2B2UC 4PV1C 2HQEA 4A93B 1G8ZD 3DUZA 3DWPA 1HQMC 2XRSD 4LMQD 1WD1A 2FHTA 5I2XA 4RCOA 4A3DB 3I70A 5K36G 4KD3A 5C4JB 2A6HD 5ELEA 3BYTB 3EJIA 1WCMB 1RF2D 1ILPA 3PIP3 4RCNA 3R2TA 2EXZA 4WRDA 1D1KA 4FXGC 2XRQD 2PW5A 3D4DA 4K6DA 4DXGA 1JR0D 1XYIA 1GHJA 3DWQA 2Z4IA 3E6ZX 4DA2A 2ID0A 1X3PA 5COYA 3Q23A 4OGQC 1GUOA 4K5WA 3GTMB 1ESRA 2KVMA 3F2UA 5ELCA 4KN4C 4RHSA 3K5OA 2SDFA 3HG9A 4G7HC 1GOZA 4QIWB 3HOZB 3NE5B 1RD9D 1EU4A 2MHVA 2A73B 3Q24A 4DAVA 1IW7D 1CZWA 1KAAA 4FP5D 1WTXA 1IYVA 3KF8A 4Q5VA 3P1HA 4C3IB 2WKCA 2F0VA 4CJ0B 4E6IA 4PMWA 4X3KA 4IFDJ 2L5TA 1UNSA 4PNYA 4FVMA 3BS1A 2E75C 4ZKCB 1QILA 2IPKD 3SHLA 2HUGA 1WTRA 4IURA 1BCPD 2V4DA 3V2TA 1F2YA 4EQNA 3HZXA 5CV8A 3S2DB 3M4OB 1MSHA 2BE5C 4C3IG 3H91A 1ZKOA 2LFNA 1SBBB 4LK1C 4KKSA 4RKLA 4I7ZC 1GUTA 3K5NA 1R9TB 1QCBD 3S14B 2CW0C 1TQOA 1PFBA 3TP5A 1LT4D 3ONAB 1EEID 2BDOA 3MWYW 4DAPA 4O1NA 1MSGA 2L12A 1JWSD 3FVQA 1S5CD 4OO1H 2DNEA 5C3WA 4KHZA 2FJ2A 4ABNA 2FMCA 3GV3A 1XTCD 3HP3A 2Z4HA 1CT1D 3VYRA 1Y8PB 3NWSA 4PQXA 1BR9A 1STAA 2F0KA 4TSSA 2LMCB 1KDBA 2MUYA 1EYDA 3OIPA 1CFMA 2F3VA 4N9TA 3VR6A 4RGTA 1EOTA 1IKLA 3D3RA 1SNCA 3RLFA 3J7YW 4QB4A 4HTHA 1MI2A 3TP6A 1PZID 1QNUA 4A3EB 1L0YB 3DEOA 3LX0A 5E3FA 3DM1A 1H9RA 1ENCA 1A15A 2EJFC 1F9SA 2NN6I 2X6LA 3MC0B 1U4RA 4IUVA 1XXGA 2WV6D 1H9JA 5CGKA 5IGGA 3S17B 4CKBA 5M9OA 1TS5A 1WTPA 2LKVA 1J9OA 1EY5A 1NR4A 4FF1A 2NUCA 2K5DA 1B50A 4C3HB 3R3OA 2EPBA 5DAUA 2MP1A 2WAQB 2PO4A 1ZYRC 2DN8A 5J22A 2K05A 2H1EA 1PTOC 4HMJA 1Q3LA 3VA7A 4X3TA 3S16B 3C1EA 1Q1BA 2PZTA 5CYUA 1SYFA 2JEAI 2E2DC 3HOWB 4DK0A 4OL7A 4WFN3 3TN2A 1IL8A 4HMIA 1HUMA 3KLSA 2B8GA 4OIKA 1M8AA 4C3HG 2JA8B 1NCVA 1Y8OB 3FMCA 4HSVA 3PUXA 1DCZA 1ML0D 3HEJA 3SK6A 5F2DA 1CK1A 1LV9A 3G6JB 3K59A 1B44D 4DN4M 2A69C 3L9AX 5IGFA 4EVOA 3K6OA 4B08A 3MEHA 2A68D 3E0JA 3KLSX 4Z9CB 4BBRB 2PW7A 2O2LD 1I4RA 1QB5D 2O5IC 3GD7A 2FFKB 4XTCS 3BVGA 2J0TD 2ZXPA 4RHRA 4DAYA 2WINB 3EA6A 5JAVA 2NTTA 5IT9E 2B2WA 2AQ2B 1E2ZA 3RMHA 1IYUA 1Y8NB 3SE0A 5C5MA 1STBA 1GJXA 5IT9L 5LL6S 4ZQ3A 4CBVA 3MXPA 2Y0SB 1V8QA 2HDMA 1G2TA 4H0LC 4C56C 3GTQB 2XVSA 3HOVB 1K8OA 5FK9C 3MXUA 1AP0A 4TRDA 2L4NA 2K6AA 3T13A 2ZT9C 5C3EB 3WOFA 2IL8A 2PZWA 2L55A 5CC4A 3H0GB 1PRTC 2VB2X 3T51B 5JVH3 4HCEA 1SNMA 1XWEA 5KNCA 3OPOA 5CV9A 2NVQB 3D6WA 1T5EA 2NN6H 1TWCB 2TMPA 3LNNA 1K8MA 2F0TA 5EJWA 1EZ6A 3P20A 2LY7A 2ICIA 4QF4A 3PMFA 2A6EC 5KRUA 4ODGA 2QDBA 2I07B 1DJRD 4WORA 1NAPA 3U9SA 3MZ5A 1F9RA 1SE4A 4ZAIA 4LAAA 1NR2A 3VR2A 2MGSA 4L8JA 2K5QA 5JEAH 1EL0A 1RODA 3VYSA 4A3IB 3V05A 3N52A 4QCLA 5C4HA 1A2UA 1HA5A 2OEOA 1QG7A 2YYZA 1Z47A 3MHBA 2AQ1B 5G3LD 2EYMA 1V1PB 4RGOS 2CHBD 1B9MA 3DHQA 3S1RB 2AUKA 1SNQA 3P7JA 3GV6A 1S5DD 4ZKBB 2Q8TA 2WKDA 1FR3A 2XNAC 4BWGB 1HA6A 4RA8A 1SSOA 1EWCA 3CHBD 4CKCA 1ZXTA 5J39A 3T56B 5C4ZA 4L63B 1Q8IA 4HN7A 1B4OA 4RFBA 2KCCA 3NHHA 1A3UA 4K5XA 2MPMA 3Q0AA 4KY6A 2F0WA 2RQXA 1EWHA 1TY2A 3S1QB 4IUPA 3TSSA 2JXMB 1JCKB 2B2WC 1EEFD 1TS2A 1HQRD 1O7YA 2D2CC 1LTGD 1O7LA 1D5ZC 2K1BA 3I3CA 4RGMA 2BA0A 4FNFA 1Q12A 3S1NB 3NTKA 4XT3B 5M3MB 3GTPB 3GTJB 3PUZA 1G291 2L11A 2L9HA 2M9VA 1FD7D 1EY0A 3ZYYX 2Z1CA 1STHA 1HFNA 3K5MA 3TP8A 2DY7A 4FO2A 4FYDA 1VMCA 3K0YA 4C1NI 1FGBD 1GUWA 2EYJA 1SYEA 1C48A 1TVXA 1BOSA 2H4OA 2KHSA 4RWSC 1I4PA 3T4AC 4YIJA 3L7ZC 1TWHB 1SMYD 1VF5C 1KNAA 4KV6A 1SNOA 3W3AA 2A5HA 1SEBD 1I6HB 3URYA 4MIUA 3RUZA 2F3WA 5CV7A 5ELFA 3H3VC 1OXXK 1HUNA 3GQBA 4J8QA 3D4WA 3GP7A 2RSNA 3TMEA 5C0XI 5M5WB 4NW2A 1ET6A 2B2YA 1PYWD 1DYQA 2HDLA 1XX8A 5J1ZA 2EYFA 2PPBC 3AMUA 1SYBA 4M1UB 5EKKA 4C3JB 1B9NA 2A6HC 1RTOA 5JEAJ 1RTNA 1U4MA 2C9OA 2OT2A 1DOLA 3CU7A 3J80L 3PIO3 3Q6SA 1EQVA 4BA1I 4UAIA 3S2HB 1Z7TA 1UEAB 2F03A 3GTKB 4IALA 4H7BA 2XN9C 2IT1A 3HRZC 4BS9A 1EYAA 1KLUD 5ISRA 2RA4A 2M00A 1R4PB 3T53B 3ERQA 1II3A 3ND9A 2R3ZA 4HR7B 3NTIA 3KBGA 3WDNA 5HURA 5KYLA 1WVLA 4WJWA 2KOLA 1F2ZA 3SXHA 3MTSA 2ZXOA 4F8MA 3I4LA 4IFDG 4KJOA 1LTAD 1NUCA 4BA2I 4DNRB 2IX3A 1IW7C 4G7ZC 1E2WA 2VB3X 1LABA 4XYOA 1ONLA 1CHPD 1D2BA 1JQYD 3QOLA 2ENBA 1QE6A 1CTMA 2TSSA 3CQZB 3OW7A 4XIGS 1JORA 5I9PA 5CV6A 4DGZA 4JK1C 2NWGA 4ZLTF 1Y1WB 4RGNA 2F0NA 1KTKA 1F2LA 1BCPC 2GA4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB2 X;  3E6Z X;  2VB3 X;  1ZEQ X;  2QCP X;  2L55 A;  3TDQ A; 
#chains in the Genus database with same CATH topology
 1NE3 A;  1TY0 A;  2EZV A;  2R92 H;  4UDU C;  5M3F B;  1TT2 A;  3LWE A;  2KJX A;  2JA9 A;  1YNJ D;  5LMN W;  1QJO A;  2F0M A;  1U0L A;  2AWN A;  3A7A B;  2RDG A;  4DR2 Q;  5GAG C;  2LXK A;  1Q90 A;  4B3S Q;  1E2V A;  4JPB W;  1LTL A;  2KEC A;  1GO3 E;  2VNU D;  1JE5 A;  4DV4 L;  4C2M B;  3ERS X;  1EIY B;  1J8I A;  1GUS A;  4JBW A;  4CKE A;  4FF4 A;  4K5V A;  2EY1 A;  3KOJ A;  5KNB A;  5KYI A;  3HKZ B;  3CKI B;  1TXY A;  1D8L A;  5M5Y H;  5G3L F;  4GZY C;  2DUD A;  1X3F A;  2YU9 B;  3OHX C;  1E3P A;  4FXK C;  2MQH A;  5M3F G;  5ELO A;  3KJP A;  4LF8 L;  1S5B D;  3HFZ B;  1VQO A;  1JWU D;  1EFW A;  3J7A F;  2EDG A;  3W2D A;  5EKL A;  5EQ0 A;  4Y7N H;  5C4X H;  1JOQ A;  4BY1 B;  2EIF A;  1SXT A;  2ZM6 Q;  5CR3 A;  1NMG A;  2K14 A;  1E1O A;  4R9W A;  4DR4 Q;  5DEH A;  2B39 A;  5CBA E;  4KKU A;  1PFS A;  2BCO A;  3X3N A;  3A5U A;  1SMX A;  3VR3 A;  2UXC L;  1H9K A;  5CV4 A;  3PO2 H;  3MA2 B;  3BG3 A;  1VQK A;  2B2Y C;  1VDZ A;  3HKZ G;  1Y1V H;  1I6V C;  1SJH D;  1GUN A;  4CGY B;  3NEM A;  3NK9 A;  1CQV A;  5ELB A;  3FDT A;  5C0X H;  3KUP A;  2ASB A;  2RDF A;  4GOP C;  3NBI A;  5D3I B;  4X64 Q;  1OO9 B;  4A3E G;  1PZK D;  1XNR Q;  3NSW A;  4DR7 Q;  5COR A;  1SYG A;  1S3O A;  4FDB A;  3FEW X;  3T1Y Q;  4QQB X;  1D5X C;  4O0A A;  5DM6 3;  1SE3 A;  1UAP A;  1I4G A;  1WTO A;  2OWO A;  5EPK A;  2E2I H;  4JI3 Q;  4R8N A;  3I2Z A;  4X6A H;  3OMG A;  4DXF A;  4IPC A;  4K6L A;  4GNX B;  2PMZ B;  2NVT H;  1EWI A;  3IFT A;  3I4N H;  4RAU C;  4DU9 A;  3X3M A;  4CJ2 C;  1G6Z A;  3KF6 A;  3U4V A;  1XTD A;  1L0W A;  2MNA A;  2NYZ D;  1BDO A;  1STY A;  2F0U A;  3AYH B;  3RN5 A;  1YIJ A;  2VZA A;  5IP9 H;  1IZ6 A;  1VQN A;  2K04 A;  3B6Y A;  5JJZ A;  4R4I A;  4F7X A;  1OXS C;  1U4L A;  4A3K H;  3RZD B;  1I50 B;  1X3Q A;  1CHQ D;  2WAQ G;  3N6R A;  4DV6 L;  1ZEQ X;  2N8N A;  2KHJ A;  2N3S A;  1CKN A;  2AHO B;  4K0K L;  1EYC A;  3VA5 A;  1TWA H;  4DV2 Q;  4PMC A;  4ALP A;  1QNK A;  2KED A;  1W6J A;  1KRT A;  3S24 A;  2QF7 A;  5JOB A;  2G9H D;  1IBL L;  1YVC A;  3AFQ A;  3BDO A;  1PTO H;  1VQE A;  1SAP A;  4XQN A;  3FRP B;  1T5X D;  4OHJ A;  2CH4 A;  1JOO A;  5IYB H;  1UE5 A;  4JI5 Q;  2NZ1 D;  3D6C A;  1AE2 A;  4J1M A;  1DXM A;  2UUB Q;  2Q8R E;  2JA8 G;  1YI2 A;  2JE6 I;  2A1A A;  2I0Q A;  1X9N A;  1HZA A;  4C1N K;  5KEE A;  4O2D A;  4XQJ A;  2F0E A;  4DAM A;  4DR3 L;  2JEB I;  1FL0 A;  1BNZ A;  1CA5 A;  5LHY 1;  1VQ9 A;  1CSQ A;  1MGS A;  1HZB A;  3A8J E;  3NWT A;  2F0L A;  4LFC L;  1LTS D;  3M4Q A;  1MD2 D;  3QIA A;  1AFP A;  1TS3 A;  4Y52 H;  3KYH C;  1VCI A;  4NKL A;  3IAY A;  2QKI C;  3SK8 A;  1PRT D;  3HOU H;  1K8A C;  5IGE A;  2EYL A;  5GAE C;  2RSO A;  3BVZ A;  4LFA L;  2Z8L A;  2UXD L;  2HIV A;  3I73 A;  4OO1 G;  4JI0 Q;  5CBE E;  1FVI A;  2A68 C;  4BY7 H;  3PGZ A;  4N8F A;  3A8K E;  3K57 A;  5K36 H;  5M5Y B;  1KAB A;  1ENF A;  2CWA A;  3CME A;  1EY8 A;  5K5P A;  1YJ9 A;  2JA7 H;  4RKB A;  4DR2 L;  4Q0F A;  3CCV A;  5T1I A;  4DR5 Q;  4A3G B;  4GKJ Q;  4B3S L;  5C4X B;  4KHV A;  2FIN B;  1SE2 A;  1SRO A;  3ND8 A;  4IQZ A;  1PA6 A;  2D62 A;  2KUM A;  1IKM A;  4TKO B;  1LLR D;  5IOC A;  2QIL A;  1NJI C;  3VDY A;  1JC7 A;  1VQF A;  4R4Q A;  4K8I A;  4DF7 A;  3PO2 B;  1A6X A;  1TR5 A;  5NUC A;  1Y1V B;  1ESF A;  4KK7 A;  1D5M C;  1EY6 A;  1YNN D;  2PQE A;  3HS0 C;  3EVQ A;  2GVA A;  2F1M A;  4J15 A;  4HJ8 A;  4JV5 L;  3SK4 A;  4K8J A;  2K03 A;  3ITP A;  5C0X J;  2ZM6 L;  5T1G A;  2AKW B;  5CV5 A;  4A3G G;  4FF2 A;  4DR4 L;  4KMU C;  1XMQ Q;  5C3E G;  1YBY A;  3M3Y B;  3K5L A;  5C4X G;  1PH9 A;  4M8A A;  3PF4 A;  3H0G G;  1A3T A;  1PYB A;  2R6G A;  2E2I B;  1HFG A;  1B7Y B;  4HJ9 A;  2F0H A;  1V43 A;  4CJ1 B;  1KXL A;  1VQH A;  3JC6 6;  1VQJ A;  2R7Z H;  2NVT B;  1STN A;  4ULL A;  1SNP A;  1SJE D;  3DMU A;  3CW2 C;  2EY6 A;  3AB9 A;  3SEB A;  1AZP A;  5JPM C;  1U9R A;  1LTT D;  5IYD G;  1XNR L;  1SLJ A;  3GTG B;  2Q2U A;  1N32 L;  4A3B H;  3LGJ A;  2WII B;  5D14 A;  5GAD C;  3BDC A;  1MBY A;  1Q82 C;  1JB7 A;  5IGD A;  2FMM A;  4P73 A;  1H95 A;  2K5W A;  1PH8 A;  4H13 C;  3RZO B;  3STB C;  2VQE L;  2UXB L;  4LW1 A;  2HT1 A;  1WD0 A;  3DEP A;  1K3B C;  2IW3 A;  3HOX B;  3MXG A;  1O78 A;  1TWG H;  2RKS A;  4JI6 Q;  3K8A A;  3KF8 B;  1JOK A;  1CUK A;  5HGT A;  1Z6H A;  2A74 C;  2B2V A;  3Q8D A;  1PTO B;  1TII D;  1Q46 A;  3PO3 B;  3CD6 A;  1DD2 A;  1S5F D;  1X3G A;  2OTL A;  1JT8 A;  3P75 A;  5AJ3 L;  3C46 A;  1RL2 A;  4ZYS A;  2PQA B;  5IP9 G;  4LUO A;  3L3O C;  1D6E C;  3NBH A;  2VS1 A;  3NUC A;  3S15 B;  2AUJ D;  3OMC A;  3I8Z A;  1KAW A;  3I4M H;  1STE A;  4O42 A;  3KBX A;  3KDF B;  5FLM G;  1HCZ A;  1NSN S;  3OOC A;  1JJC B;  2O4X A;  4ZUI A;  4JI8 Q;  1JWM D;  3I90 A;  4ZUJ A;  3R2I A;  3DWA A;  3CPW A;  3HOX G;  4WJ4 A;  3PUY A;  2A8V A;  1MKH A;  2EYP A;  1GHK A;  4DR1 L;  3A74 A;  3MEF A;  1HNX Q;  2I5H A;  1LT6 D;  1PTO F;  5C3X A;  3PO3 G;  1CSP A;  1BBW A;  1Q8K A;  3M7G A;  2F0S A;  1L1O B;  3D4R A;  2EYO A;  2VXW A;  4AH6 A;  4LF5 L;  1HHV A;  4JI5 L;  4L6T B;  1DOK A;  5IYB G;  2JYO A;  5EGT A;  2F0J A;  5FLX L;  3JAM E;  3MVV A;  3S14 H;  4LFB L;  5CMD A;  1RIP A;  2SNS A;  5DLQ E;  4PZ8 A;  3HOU B;  1V1Q A;  5FOB B;  4DPG A;  5IOD A;  5FKA C;  1VQA A;  3J7A V;  1GXD C;  1TWF H;  2L0C A;  2EE1 A;  3G7L A;  3SR1 A;  2PNR C;  1WTW A;  5IGB A;  4X3U A;  1H9S B;  5C6A A;  4JCV E;  5C44 H;  4JI2 L;  1OXT A;  3JAM L;  1CQF A;  1XNQ L;  3TBI B;  4IUQ A;  4A3C G;  1RHP A;  2KCN A;  3E9H A;  2PYK A;  5BR8 L;  3KLW A;  1EIG A;  2JA7 B;  3TRE A;  3F2C A;  2UUA Q;  3S1M H;  1HZC A;  1B53 A;  4XQQ A;  3E0E A;  4QUF A;  3CCL A;  5C5L A;  1HR0 L;  4KY5 A;  1S40 A;  4N9P A;  1L0X B;  2KA7 A;  3UI2 A;  4HID A;  5FO8 B;  1FYC A;  4OIJ A;  2G9D A;  1LO5 D;  5I2Y A;  2LS0 1;  5M3M G;  3TDQ A;  1XMO L;  5LMU Q;  1N36 Q;  4P75 A;  3QO2 A;  4HED A;  1N34 L;  4XDX A;  4F87 A;  2E2J H;  2EVB A;  2K50 A;  4NDX A;  2IJ0 A;  4XXE A;  1B1Z A;  4HCS A;  1W3S A;  2F0F A;  1G6P A;  4X66 Q;  1KQS A;  1DM0 B;  3HOY B;  3GTL H;  2B8F A;  4H44 C;  4R8I A;  5GQO A;  1D1I A;  4DR5 L;  1K3R A;  4G57 A;  1HZ9 A;  2QW7 A;  1K28 A;  2H5X A;  1PZJ D;  2NZH A;  4ME5 A;  2NVX H;  4EQP A;  1EZ8 A;  4OEL B;  4K14 A;  5TSS A;  1T9H A;  3BZD B;  4K2K A;  1O80 A;  4BXX H;  1Y69 U;  1LTR D;  3NTH A;  1S4Z A;  5E4W C;  3NP8 A;  4DV0 L;  1FNW A;  2KBN A;  3J81 E;  3T16 A;  3IFD A;  1PRT B;  2B63 B;  2Z9H A;  1BUV T;  2OCE A;  2R7Z B;  3J80 E;  2NN6 G;  5E1F A;  3HOY G;  4A76 A;  2XIW A;  2PCF B;  4DUY L;  1RDP D;  3AFP A;  4A3B B;  3J81 L;  3BYY B;  4QUC A;  4DK3 C;  1SMY C;  1WOC A;  2F0P A;  2BE5 D;  4XYQ A;  1AH9 A;  1DZ1 A;  4MN3 A;  5FO7 B;  3QB3 A;  5IP7 G;  4IPG A;  2ATW A;  1X32 A;  2QA4 A;  1V1P A;  3EBE A;  3TEH B;  1BF4 A;  2EYH A;  3D31 A;  2VUM H;  2KHI A;  3S9W A;  3CAM A;  2CW0 D;  2B63 G;  1PRT F;  1ENA A;  2J7Z A;  3EN2 A;  4C3H H;  1TWG B;  3CRK C;  3PUV A;  4BBS H;  2K75 A;  4C3J G;  1BQQ T;  3U9O A;  1FNV A;  5JEA G;  1DGS A;  3M4P A;  1VQ4 A;  1A8V A;  2DJF C;  2YV5 A;  3HKS A;  4HJ7 A;  4P72 A;  2B2V C;  1NNX A;  1HNW Q;  4V0B A;  3F2D A;  1CI3 M;  1PFN A;  2Y0S E;  2F0G A;  4P2C B;  2JA6 H;  4JI4 Q;  3LWU A;  1B2T A;  1OXU A;  1U5K A;  1AEX A;  5I6W A;  3W1G A;  4YWL A;  2KQ3 A;  4DNT B;  1TKW B;  5M5X H;  3I4M B;  2E5L L;  3I72 A;  1KDA A;  4R4T A;  3HOW H;  3K7A B;  1F2M A;  3M4Y A;  3MXN B;  1GUG A;  4A3J H;  4X62 Q;  3OTO Q;  4JI6 L;  2RCF A;  3TZU A;  1LYL A;  3ULP A;  4GLA C;  2E74 C;  4QMG A;  2M2L A;  2F0I A;  2K01 A;  1F77 A;  2CVR A;  3FKI B;  2BDN A;  2PZU A;  2MO1 A;  3QOJ A;  3AU7 A;  2RDH A;  3PIO A;  3MFG A;  1PH4 A;  2NZO A;  3U58 A;  4NPS A;  4UY8 C;  3F1Z A;  4DR6 Q;  2L1B A;  4IO9 A;  3A5Z B;  1BXT A;  1A0I A;  4JI8 L;  3I4M G;  1C4Q A;  1KL9 A;  2QCP X;  4A3F B;  3A8I E;  1EIH A;  1KDC A;  1TWF B;  4KI0 A;  1TU2 B;  3Q22 A;  1LTI D;  1FGU A;  2KCT A;  2IHE A;  4EQO A;  4OWX B;  1HNX L;  1YHQ A;  5C44 B;  1I4Q A;  3KLR A;  4S3S A;  4KY7 A;  3VR4 A;  3TP7 A;  1H9S A;  3FKI G;  5BN3 A;  2E2H B;  4V19 0;  4KTA A;  3C3L A;  3NQI A;  5IT9 c;  2EJG C;  4JVZ A;  2N55 A;  4DAY B;  1BBU A;  2ZJP A;  5ELD A;  1BBX C;  1DON A;  5KND A;  5IYC G;  3S1M B;  4ZRZ A;  3CXC A;  4IOA A;  2E8G A;  3W5O A;  2XSC A;  1GVP A;  4HSP A;  1Q1E A;  4B3M Q;  2UU9 Q;  1CZG A;  1TS4 A;  4GKK L;  1SR3 A;  4K2L A;  4A3F G;  2F4I A;  1PMR A;  3GO5 A;  1HNZ L;  1NBW A;  2VQF L;  1Y1W G;  4NMZ A;  5AFW A;  1VQB A;  4IN3 A;  4DV7 Q;  1GD7 A;  1UE1 A;  3EQL C;  1HJP A;  2D5D A;  2F0Q A;  2E2J B;  2JA5 B;  4MTK A;  4P74 A;  1EQT A;  2QEJ C;  3VYU A;  1ILQ A;  3FPP A;  3GTL B;  4DV3 L;  2WB1 E;  3BZK A;  1VQL A;  2Q2I A;  3OSO A;  1K83 H;  2OXP A;  3GTQ H;  1SFO H;  1ZYR D;  2NVX B;  2Q2H A;  3HOV H;  4B3T Q;  4AYB B;  1SYC A;  2NVY B;  2IWH A;  1I5F A;  2NB0 A;  4KJN A;  1N36 L;  4A3M B;  1PTO D;  4ID6 A;  5EBC A;  4AQY L;  1EYG A;  4A3L H;  1QUQ B;  1BO0 A;  4IUN A;  3NQT A;  3T1H Q;  1YNJ C;  1M1K C;  1PDQ A;  2CQO A;  1S5E D;  4PMB A;  4X66 L;  2HQL A;  2JA5 G;  4YWM A;  2OF1 A;  3RR5 A;  3C2P A;  3ERO A;  2WAC A;  4IUU A;  1WTQ A;  3CCQ A;  2D9U A;  2RBM A;  1RCV D;  5A2Q E;  4BY1 G;  4HJA A;  2R93 H;  3J7Z C;  1PH1 A;  4YCV A;  1PH2 A;  4FXD A;  1W6K A;  2AQ3 B;  1ICW A;  1R4Q B;  1CM9 A;  4AYB G;  1ASY A;  3I91 A;  1J5E L;  1LT3 D;  4A3M G;  5D3D A;  1H9M A;  5D65 A;  1UUP A;  2SOB A;  5BN4 A;  3UE1 A;  1LUZ A;  5A2Q L;  1YNX A;  2VUM B;  2N88 A;  5FO9 B;  2A69 D;  5I6Y A;  2KEE A;  3C1F A;  3BVM A;  1VQP A;  4JI7 Q;  4BBS B;  4KHP L;  4TVA B;  3E3X A;  2JSO A;  5A35 A;  3OIQ A;  1IBK L;  4JYA Q;  2IY5 B;  1C8C A;  1M90 C;  3R93 A;  1JIC A;  1KNE A;  2XWJ B;  5E4X A;  1PXU A;  2JA6 B;  1PLF A;  3ULJ A;  4IUT A;  1QVC A;  4YHH Q;  1A63 A;  1JMC A;  2CQA A;  3PV0 A;  5IIF A;  1DOM A;  2DNC A;  5M5X B;  4A3I H;  2EXD A;  4QL5 A;  3SDZ A;  2YTX A;  4A3J B;  5DNF A;  4IFD I;  4F88 A;  2RVL A;  3MXN A;  1HPC A;  1IHZ A;  3EIV A;  3V96 A;  1G91 A;  3OWF A;  4PG3 A;  4KD4 A;  5KIX A;  4UPA A;  3VR5 A;  2Z6B A;  1I4X A;  3H09 A;  3WOE A;  4JOI A;  2X6G A;  1CA6 A;  1RJT A;  2D0P A;  3BDL A;  3TS2 A;  2AWO A;  1MHW C;  2CKZ B;  1SND A;  4L5S A;  3GTO B;  1HTL D;  4X62 L;  2HHH Q;  1VQC A;  4IJH A;  3RLO A;  1N9W A;  3RD4 A;  3MFY A;  3QWN A;  4LJZ C;  1NY4 A;  5EPJ A;  4X65 L;  1EQR A;  1MJC A;  2JN4 A;  1I3Q B;  3EFX D;  1U4P A;  1XJV A;  1J6Q A;  4DUZ Q;  2ICE C;  2R92 B;  2F0O A;  1FNU A;  4LF6 Q;  1HXY D;  2JP1 A;  1FJG Q;  2X69 A;  3A55 A;  1IBM Q;  2EJM A;  2EOT A;  3M7N A;  5GRO A;  4QIW E;  4POG A;  3CC4 A;  4B3R Q;  1OXV A;  2WP8 J;  3K58 A;  2EY5 A;  3S1Q H;  5IY0 A;  5HY6 A;  1E1T A;  3QJY A;  1PFM A;  4R4O A;  3RLN A;  3CCE A;  3SK5 A;  2SNM A;  4KN7 C;  2K4K A;  2B2T A;  4CDE C;  4KKT A;  1YJN A;  4DNI A;  1ICF B;  2K28 A;  3G71 A;  2Z0S A;  1SYD A;  2B2U A;  2R92 G;  1BCP B;  4JBJ A;  2JQO A;  3CRL C;  1EU3 A;  4EX5 A;  3VYT A;  4Y7N B;  3A7L A;  4A93 H;  2JJQ A;  3QG1 A;  5DM7 3;  3UDI A;  5IE8 A;  1K83 B;  2A6E D;  1HTP A;  2IX1 A;  2K32 A;  2IX0 A;  1G2S A;  2V1C C;  3TQY A;  1SFO B;  2E76 C;  4XT1 B;  4B9X A;  5EPL A;  1HH2 P;  3L2P A;  1A62 A;  1N8R C;  1EY4 A;  2OQ0 A;  4A3D H;  1ET9 A;  4DK1 A;  4FF3 A;  3DXJ C;  1KLG D;  3PSI A;  2K5V A;  2AMC B;  1QWY A;  5C4J H;  1UE6 A;  2ZJQ A;  1UWV A;  1WCM H;  4ZK9 B;  5I9O A;  2Q8I B;  4GLV B;  4GN5 A;  2NBF A;  1VMP A;  2EY2 A;  1VF7 A;  4LF4 Q;  5J3B A;  1BCP F;  2K5N A;  1I4H A;  4J6H A;  4MHE A;  3UE0 A;  3E5S A;  5JPN C;  1LTB D;  1TWH H;  2R93 B;  2BA1 A;  3UDF A;  4JI1 Q;  1UE7 A;  1N33 Q;  4DV1 Q;  1AN8 A;  4HAE A;  4I65 A;  2HCI A;  3NXW A;  3PO2 G;  1SDF A;  4HIK A;  1HRJ A;  4RG1 A;  1E7Z A;  1Y1V G;  3PUW A;  4NP5 A;  2CH4 W;  4GNX A;  4X3S A;  5I4D A;  3I4N B;  1K0R A;  4X64 L;  4CHT B;  5C0X G;  4RH6 A;  2SEB D;  3GTM H;  4LF9 Q;  3J80 c;  4DR7 L;  2ZXR A;  3T1Y L;  1GM5 A;  1XPU A;  4H02 A;  2K7V A;  1O7Z A;  2R93 G;  4JI3 L;  3O13 A;  3HOZ H;  1A3V A;  4GOP B;  5EKI A;  1AW7 A;  3M85 A;  4A3K B;  2I46 A;  5IGC A;  2ALY B;  3NPP A;  1EUJ A;  3SVM A;  2BOS A;  3H15 A;  2I5M X;  5BN5 A;  1YHA A;  1TWA B;  1YNN C;  2F0D A;  3H6M A;  1EQQ A;  4TQU S;  4CDC C;  1QOH A;  4LWC A;  5LL6 X;  3I4N G;  3J81 j;  4DFA A;  1WTV A;  1B70 B;  3TZD A;  3CCR A;  1F9Q A;  4C3I H;  3A56 A;  4IZ8 A;  2WB1 B;  1JB3 A;  1EFI D;  2XTI A;  1EY7 A;  2NTS A;  3HKZ E;  1YZ6 A;  4IFD H;  4U68 A;  4JOI C;  1K0S A;  4A3K G;  3PF5 A;  4DV2 L;  5JJI A;  2K52 A;  1AZQ A;  4G7O C;  1E22 A;  4POF A;  1EY9 A;  2O5J C;  4LUZ A;  1JE4 A;  3HGB A;  5FLX E;  1RKN A;  2K5H A;  4EGV A;  2K33 A;  1IL2 A;  4U67 3;  2HCC A;  3TRZ A;  3S2D H;  3W1B A;  1B3A A;  3FPU B;  1STG A;  3M4O H;  1LT5 D;  1PV4 A;  3IL8 A;  1LAC A;  3OWE B;  3QR8 A;  4A4I A;  4AIM A;  2UUB L;  3A54 A;  2DY8 A;  1F9P A;  1M4V A;  2MJ8 A;  1NTG A;  5JVG 3;  1R9T H;  1XPR A;  5KGU A;  1WFQ A;  4ILW A;  5EBD A;  4B9W A;  3I7F A;  3CC2 A;  2F3I A;  3IKJ A;  3D8G A;  3ICE A;  1A2T A;  2LSS A;  3KK7 A;  4OO1 I;  3MAQ A;  1V1O A;  2J4X A;  2IHF A;  3R8B A;  2C5C A;  4YY3 Q;  4BY7 B;  3H94 A;  1O7I A;  4G4K A;  4PZ6 A;  2XWB B;  2B2T C;  1PH6 A;  1X65 A;  3U50 C;  2WAQ E;  3CQZ H;  4LF6 L;  1WYD A;  1HR0 W;  1E0B A;  2R61 A;  2D0O A;  5LMN Q;  2B2U C;  3TS0 A;  4PV1 C;  2PMZ E;  2HQE A;  4A93 B;  2P5Z X;  4PZ7 A;  2C35 B;  2KCM A;  1G8Z D;  3F2B A;  5M3F H;  3DUZ A;  4L5Q A;  3DWP A;  3HOU G;  3DM3 A;  4JI0 L;  3JAM i;  1HQM C;  2XRS D;  4LMQ D;  1WD1 A;  2FHT A;  5I2X A;  4RCO A;  5ELN A;  4JBM A;  4LF8 Q;  1VQG A;  4A3D B;  1X6O A;  4BY7 G;  3I70 A;  5K36 G;  4KD3 A;  5C4J B;  2A6H D;  5ELE A;  3BYT B;  3EJI A;  1VQM A;  1WCM B;  1X54 A;  1E24 A;  1RF2 D;  5FJ8 H;  1ILP A;  3PIP 3;  3FP9 A;  4L5T A;  4GKJ L;  4RCN A;  2JA7 G;  3R2T A;  1BKB A;  2EXZ A;  4WRD A;  3I55 A;  1D1K A;  4FXG C;  2XRQ D;  4A93 G;  2PW5 A;  3D4D A;  4K6D A;  2YU9 H;  4DXG A;  3BJU A;  1JR0 D;  1XYI A;  1GHJ A;  4A3E H;  3F8T A;  4OXP A;  3DWQ A;  4A3D G;  2Z4I A;  3E6Z X;  1L2F A;  4L5R C;  4DA2 A;  3PCO B;  1V9P A;  1X3P A;  2ID0 A;  5COY A;  3Q23 A;  3AQQ A;  4OGQ C;  4GNX C;  1GUO A;  1JJG A;  1SE8 A;  4K5W A;  4YCW A;  3GTM B;  1ESR A;  2KVM A;  3F2U A;  5ELC A;  1XMQ L;  4KN4 C;  4RHS A;  1Q86 C;  3K5O A;  2SDF A;  3HG9 A;  3RN2 A;  4JI1 L;  1YJW A;  2CWP A;  4G7H C;  3S17 H;  1P8L A;  1GOZ A;  4QIW B;  3HOZ B;  3NE5 B;  3I4O A;  1RD9 D;  2Z6K A;  1CKM A;  1SN8 A;  1OTC A;  1EU4 A;  4KLK A;  3K81 C;  2MHV A;  2A73 B;  2UUC Q;  3Q24 A;  3ZJY C;  4DAV A;  2R7Z G;  3CF5 A;  1IW7 D;  1CZW A;  1KAA A;  1KHI A;  4FP5 D;  1WTX A;  3J81 i;  2Q2T A;  4LF9 L;  1IYV A;  3KF8 A;  2ZTD A;  4Q5V A;  1WI5 A;  3P1H A;  4C3I B;  4A3B G;  3J80 i;  4K0K Q;  2WKC A;  2F0V A;  4CJ0 B;  4E6I A;  1YIT A;  3S16 H;  5JJK A;  3HOZ G;  3KF6 B;  2PQA A;  4PMW A;  2QDL A;  4X3K A;  4IFD J;  2L5T A;  1UNS A;  4ME3 A;  1IBL Q;  1EOV A;  4PNY A;  4FVM A;  3BS1 A;  2E75 C;  3KDF A;  4ZKC B;  1QIL A;  2IPK D;  3SHL A;  2HUG A;  1WTR A;  1YEZ A;  4IUR A;  1BCP D;  3E9I A;  2V4D A;  3V2T A;  1F2Y A;  2QGQ A;  3KJO A;  4EQN A;  2JA8 H;  3A0J A;  3G48 A;  1CKN B;  1KC8 C;  3HZX A;  5CV8 A;  3M9B A;  4I7A A;  3S2D B;  2DGY A;  3M4O B;  1MSH A;  2BE5 C;  1ASZ A;  2B3G A;  3NEL A;  4C3I G;  3H91 A;  1L1O A;  1ZKO A;  2LFN A;  4NXN Q;  1SBB B;  4LK1 C;  4KKS A;  4RKL A;  4I7Z C;  1GUT A;  3GDE A;  3K5N A;  1R9T B;  4DR3 Q;  1QCB D;  5E7N A;  3S14 B;  2CW0 C;  1TQO A;  1PFB A;  3TP5 A;  3ER0 A;  1LT4 D;  2G5D A;  4LFC Q;  4BBR H;  2VW9 A;  1Z9F A;  4RMF A;  3ONA B;  1EEI D;  3DLL A;  2BDO A;  3MWY W;  2R7D A;  4R4C A;  4DAP A;  4O1N A;  1MSG A;  2L12 A;  1JWS D;  3FVQ A;  3WWV A;  1S5C D;  4OO1 H;  2DNE A;  5C3W A;  2UXD Q;  4KHZ A;  2FJ2 A;  4ABN A;  5L37 A;  4WJ3 M;  2FMC A;  1GKH A;  1XTC D;  3GV3 A;  3HP3 A;  2Z4H A;  1CT1 D;  4YY3 L;  2HIX A;  3VYR A;  2CCZ A;  4UP8 A;  1Y8P B;  5C44 G;  1PH5 A;  1PVO A;  1PYS B;  3NWS A;  4PQX A;  1BR9 A;  5LMN L;  1STA A;  2F0K A;  4TSS A;  2LMC B;  2YTY A;  1KDB A;  3CCM A;  2MUY A;  1EYD A;  3OIP A;  2UUA L;  1VQI A;  1CFM A;  4LNQ A;  2F3V A;  3K7U C;  4N9T A;  4MNO A;  4RGT A;  3VR6 A;  1EOT A;  1IKL A;  3ULL A;  3D3R A;  1SNC A;  3AEV A;  1Q7Y C;  3RLF A;  3J7Y W;  4QB4 A;  1NMF A;  1B8A A;  4HTH A;  3G4S A;  1MI2 A;  3TP6 A;  5LMU L;  4JC0 A;  2WFW A;  2OTJ A;  1PZI D;  1QNU A;  4A3E B;  4A3G H;  1L0Y B;  5IWA Q;  3FHW A;  1KD1 C;  3BU2 A;  3DEO A;  3LX0 A;  5C3E H;  4JV5 Q;  4OX9 Q;  5E3F A;  3DM1 A;  1H9R A;  1ENC A;  2GVB A;  4LF7 Q;  1A15 A;  2EJF C;  3H0G H;  1F9S A;  2NN6 I;  2X6L A;  1K9M C;  3MC0 B;  1U4R A;  4GN4 B;  5FJ8 G;  1PH7 A;  4IUV A;  1XXG A;  2WV6 D;  2NVQ H;  3PQI A;  1H9J A;  4IPH A;  3UDG A;  5CGK A;  2QEX A;  5IGG A;  3S17 B;  4CKB A;  5M9O A;  1TS5 A;  1WTP A;  2LKV A;  4BXX G;  1TWC H;  1J9O A;  5IYD H;  1EY5 A;  1NR4 A;  2Z6K C;  4A75 A;  4FF1 A;  2NUC A;  2K5D A;  1N32 Q;  3M3Y H;  1B50 A;  4C3H B;  3R3O A;  2EPB A;  2VY3 A;  5DAU A;  2MP1 A;  2WAQ B;  4MZ9 A;  2PO4 A;  1ZYR C;  2DN8 A;  5J22 A;  4NXM Q;  4IPD A;  3CC7 A;  2K05 A;  1I94 Q;  1PHJ A;  2H1E A;  1PTO C;  4HMJ A;  1Q3L A;  2VQE Q;  3VA7 A;  2UXB Q;  4MTN A;  2L15 A;  4X3T A;  4GLX A;  3S16 B;  3C1E A;  1Q1B A;  2PZT A;  5CYU A;  1QZH A;  1SYF A;  2JEA I;  2E2D C;  3GTG H;  1G51 A;  4DK0 A;  3HOW B;  4OL7 A;  4WFN 3;  3TN2 A;  1IL8 A;  2UUC L;  2VUM G;  4HMI A;  4DK6 C;  1HUM A;  3KLS A;  5AJ3 Q;  2B8G A;  4OIK A;  1M8A A;  4C3H G;  2PNH A;  1CKO A;  2JA8 B;  1NCV A;  1Y8O B;  4BBS G;  1HNW L;  3FMC A;  3G6E A;  4HSV A;  5FLM H;  3U4Z A;  3PUX A;  3RZO H;  1DCZ A;  2HD3 A;  1ML0 D;  3HEJ A;  4JI4 L;  3SK6 A;  5F2D A;  4QGU A;  3HOX H;  1CK1 A;  1LV9 A;  3G6J B;  3S1R H;  2JA6 G;  1L1O C;  4GS3 A;  3K59 A;  1B44 D;  4DN4 M;  2A69 C;  3L9A X;  5IGF A;  1MJE A;  3PO3 H;  4EVO A;  3K6O A;  4B08 A;  2EQS A;  3OTO L;  4DR1 Q;  3MEH A;  3HOW G;  4IJL A;  4A3J G;  2A68 D;  3E0J A;  3KLS X;  3NBH B;  4Z9C B;  4BBR B;  2PW7 A;  3S15 H;  4LF5 Q;  2O2L D;  4OON A;  4HJ5 A;  1I4R A;  5FLX c;  1QB5 D;  1VS0 A;  2O5I C;  2F4V Q;  1XPO A;  3GD7 A;  2FFK B;  4NXN L;  4XTC S;  2ZTC A;  4LFB Q;  3BVG A;  2J0T D;  4DR6 L;  1EIF A;  2ZXP A;  4RHR A;  4UHV A;  4DAY A;  2WIN B;  3JAM c;  3EA6 A;  2F52 A;  5JAV A;  4A3C H;  2NTT A;  4JI2 Q;  5IT9 E;  1XNQ Q;  2B2W A;  2AQ2 B;  1E2Z A;  3RMH A;  1IYU A;  1Y8N B;  1VQD A;  3SE0 A;  4BBR G;  5C5M A;  5BR8 Q;  1C9O A;  2CFM A;  1STB A;  1HR0 Q;  1GJX A;  5IT9 L;  3S1N H;  5LL6 S;  4ZQ3 A;  4HIM A;  4CBV A;  5M3M H;  3GTP H;  3MXP A;  3GTJ H;  2Y0S B;  1V8Q A;  2HDM A;  1G2T A;  4H0L C;  4C56 C;  1D7Q A;  1X3E A;  2B29 A;  4QY7 A;  1XMO Q;  4B3M L;  2UU9 L;  3GTQ B;  2RHS B;  1N34 Q;  2XVS A;  3HOV B;  1K8O A;  4DV7 L;  2DJG C;  4DV5 Q;  5FK9 C;  3MXU A;  2YTV A;  4DKA C;  1AP0 A;  4TRD A;  2L4N A;  1QUQ A;  2K6A A;  3T13 A;  2ZT9 C;  4CDD C;  3WOF A;  5C3E B;  2IL8 A;  2PZW A;  3K0X A;  2L55 A;  5CC4 A;  3H0G B;  1PRT C;  2VB2 X;  3T51 B;  4QJF A;  5JVH 3;  4HCE A;  1VQ7 A;  1Q81 C;  2Y0S G;  1SNM A;  1XWE A;  4GN3 B;  3OPO A;  5CV9 A;  5KNC A;  1P16 A;  4DV0 Q;  2NVQ B;  4B3T L;  1I6H H;  3STB D;  3D6W A;  1T5E A;  3HOV G;  2NN6 H;  3HOY H;  3T1H L;  1TWC B;  2TMP A;  5IWA L;  3LNN A;  4A3L G;  1K8M A;  1KRS A;  2F0T A;  5EJW A;  1EZ6 A;  4CDF C;  4OX9 L;  3BZC A;  3J81 c;  4LF7 L;  3P20 A;  4HIO A;  1QVF A;  4DUY Q;  2LY7 A;  4JBK A;  2ICI A;  5M5W H;  4QF4 A;  1UEB A;  3PMF A;  2A6E C;  5KRU A;  2A19 A;  4ODG A;  5IP7 H;  1X56 A;  1VQ6 A;  1VQ8 A;  2QDB A;  1X55 A;  2I07 B;  1DJR D;  4WOR A;  1NAP A;  1S72 A;  3U9S A;  3MZ5 A;  1F9R A;  2B63 H;  1SE4 A;  3CCJ A;  5HGQ A;  4ZAI A;  2ZJR A;  3H3V I;  4LAA A;  1NR2 A;  5EAY A;  3VR2 A;  4C3J H;  2MGS A;  2XGT A;  4L8J A;  1BVS A;  2K5Q A;  5JEA H;  3CCS A;  1EL0 A;  1ROD A;  3VYS A;  4A3I B;  3V05 A;  2PI2 A;  3N52 A;  4QCL A;  5C4H A;  1A2U A;  4JI7 L;  1HA5 A;  2OEO A;  1QG7 A;  4NXM L;  2YYZ A;  1Z47 A;  3MHB A;  3CMA A;  2AQ1 B;  5G3L D;  4JYA L;  1I94 L;  2EYM A;  1V1P B;  4RGO S;  1LM0 A;  2CHB D;  1B9M A;  2N49 A;  3S2H H;  2E5L Q;  3GTK H;  3DHQ A;  3S1R B;  4YHH L;  2AUK A;  1SNQ A;  3P7J A;  3GV6 A;  1IXR A;  1S5D D;  4ZKB B;  2Q8T A;  2WKD A;  4A3I G;  1WTH A;  2BH8 A;  1FR3 A;  2I5L X;  2XNA C;  4BWG B;  3J7A 5;  1HA6 A;  1VQ5 A;  4RA8 A;  1SSO A;  1EWC A;  3CHB D;  3IRB A;  4CKC A;  1ZXT A;  5J39 A;  3T56 B;  1K8G A;  5C4Z A;  2LXJ A;  4JG2 A;  4L63 B;  4AYB E;  1Q8I A;  4NB3 A;  4HN7 A;  3K80 C;  1B4O A;  3K7A H;  2WB1 G;  4RFB A;  2KCC A;  3NHH A;  1A3U A;  4K5X A;  2MPM A;  1MIU A;  2FXQ A;  3Q0A A;  4KY6 A;  2F0W A;  3CP0 A;  2HHH L;  3FKI H;  2RQX A;  1EWH A;  1TY2 A;  2OQK A;  4UP9 A;  4OEM B;  3S1Q B;  4IUP A;  3TSS A;  1JJ2 A;  2JXM B;  1JCK B;  2B2W C;  5IYC H;  1EEF D;  1TS2 A;  1HQR D;  4DUZ L;  1O7Y A;  2D2C C;  2F4V L;  1LTG D;  1O7L A;  1D5Z C;  3OYY A;  2K1B A;  1FJG L;  3I3C A;  4RGM A;  2BA0 A;  4FNF A;  1Q12 A;  4A3F H;  1IBM L;  4DV4 Q;  3S1N B;  3NTK A;  4XT3 B;  5M3M B;  3GTP B;  1Y1W H;  1W2B A;  3NEN A;  3GTJ B;  4GKK Q;  3PUZ A;  4B3R L;  1G29 1;  2L11 A;  2L9H A;  1HNZ Q;  2VQF Q;  1C0A A;  2M9V A;  1FD7 D;  3UDX A;  1EY0 A;  2E2H H;  2RHQ B;  3L0O A;  3ZYY X;  2Z1C A;  2GN5 A;  1STH A;  1HFN A;  3K5M A;  3TP8 A;  2DY7 A;  4N8X 1;  4FO2 A;  4FYD A;  4DV3 Q;  4LUV A;  1VMC A;  1B3Q A;  3K0Y A;  4UP7 A;  4C2M H;  4C1N I;  2ZTE A;  1K73 C;  1FGB D;  1GUW A;  2EYJ A;  1SYE A;  1C48 A;  1TVX A;  1BOS A;  2H4O A;  2KHS A;  2PI2 E;  4RWS C;  5H1S E;  1I4P A;  3T4A C;  2UXC Q;  4YIJ A;  3L7Z C;  4AQY Q;  1TWH B;  1SMY D;  1VF5 C;  1KNA A;  2JA5 H;  4KV6 A;  1SNO A;  3W3A A;  2A5H A;  1SEB D;  4OWW B;  2MFI A;  1I6H B;  5JJL A;  4DV5 L;  3CCU A;  3URY A;  4MIU A;  4EQ5 A;  3RUZ A;  2F3W A;  5CV7 A;  5ELF A;  3H3V C;  3D0F A;  4BY1 H;  1OXX K;  1AE3 A;  4YWK A;  1HUN A;  3GQB A;  4J8Q A;  2N78 A;  3D4W A;  4YCU A;  1QZG A;  1WCM G;  3GP7 A;  2RSN A;  3TME A;  4LF4 L;  5C0X I;  5M5W B;  2NVY H;  4NW2 A;  2JK8 A;  1IYJ B;  4A3M H;  1ET6 A;  2B2Y A;  1PYW D;  1DYQ A;  2HDL A;  1XX8 A;  5J1Z A;  4ZCK A;  1J5E Q;  2EYF A;  2PPB C;  1N33 L;  3AMU A;  3CPF A;  4DV1 L;  1SYB A;  4M1U B;  1SRU A;  4GOP A;  5EKK A;  4C3J B;  1B9N A;  2A6H C;  4KHP Q;  1RTO A;  2VL6 A;  5JEA J;  1RTN A;  3PIP A;  1U4M A;  2C9O A;  1IBK Q;  1PH3 A;  3RNU A;  3H3V H;  2OT2 A;  3KFU A;  1YHB A;  1DOL A;  3CU7 A;  3J80 L;  3PIO 3;  4DV6 Q;  3Q6S A;  1EQV A;  4BA1 I;  4UAI A;  3S2H B;  1Z7T A;  1UEA B;  2F03 A;  3GTK B;  4IAL A;  4H7B A;  2XN9 C;  2IT1 A;  3HRZ C;  4BS9 A;  5GAH C;  1EYA A;  1KLU D;  5ISR A;  2RA4 A;  2M00 A;  1R4P B;  4JW0 A;  3T53 B;  3ERQ A;  1II3 A;  3RZD H;  4IOC A;  3ND9 A;  2R3Z A;  1I50 H;  4HR7 B;  3NTI A;  2MO0 A;  3KBG A;  3WDN A;  5HUR A;  5KYL A;  1WVL A;  4WJW A;  3SGI A;  2KOL A;  1F2Z A;  2KEN A;  3SXH A;  3MTS A;  2ZXO A;  4F8M A;  1QVG A;  3I4L A;  2ES2 A;  1KIX A;  4IFD G;  4KJO A;  1LTA D;  3I56 A;  1NUC A;  4BA2 I;  4DNR B;  3OW2 A;  4X65 Q;  2IX3 A;  1IW7 C;  4G7Z C;  1E2W A;  2VB3 X;  1LAB A;  4XYO A;  1ONL A;  2R7F A;  1CHP D;  1D2B A;  4APV A;  1JQY D;  3QOL A;  2ENB A;  1QE6 A;  1WJJ A;  4R1J A;  1CTM A;  2TSS A;  3CQZ B;  3OW7 A;  3GTO H;  4OWT B;  4XIG S;  1JOR A;  5I9P A;  4P71 A;  5CV6 A;  2RF4 A;  2BH2 A;  4DGZ A;  4JK1 C;  2NWG A;  4ZLT F;  1C7Y A;  1Y1W B;  4LFA Q;  4RGN A;  2RCN A;  2F0N A;  1KTK A;  1Y14 B;  1F2L A;  1BCP C;  2GA4 B;  1I3Q H; 
#chains in the Genus database with same CATH homology
 1TY0 A;  2EZV A;  4UDU C;  5M3F B;  1TT2 A;  3LWE A;  2KJX A;  1YNJ D;  1QJO A;  2F0M A;  2AWN A;  3A7A B;  2RDG A;  1Q90 A;  1E2V A;  2KEC A;  2VNU D;  4C2M B;  1J8I A;  1GUS A;  4JBW A;  4CKE A;  4FF4 A;  4K5V A;  2EY1 A;  5KNB A;  5KYI A;  3HKZ B;  3CKI B;  5G3L F;  4GZY C;  2YU9 B;  3OHX C;  4FXK C;  1S5B D;  1JWU D;  3J7A F;  2EDG A;  3W2D A;  5EKL A;  5EQ0 A;  1JOQ A;  4BY1 B;  1SXT A;  5CR3 A;  4R9W A;  5DEH A;  2B39 A;  5CBA E;  4KKU A;  2BCO A;  3X3N A;  3VR3 A;  1H9K A;  5CV4 A;  3MA2 B;  3BG3 A;  2B2Y C;  1VDZ A;  1I6V C;  1SJH D;  1GUN A;  4CGY B;  3NK9 A;  1CQV A;  5ELB A;  3FDT A;  5C0X H;  3KUP A;  2RDF A;  3NBI A;  5D3I B;  1OO9 B;  1PZK D;  3NSW A;  5COR A;  1SYG A;  3FEW X;  1D5X C;  5DM6 3;  1SE3 A;  1UAP A;  1I4G A;  1WTO A;  5EPK A;  4R8N A;  3OMG A;  4DXF A;  4K6L A;  2PMZ B;  3IFT A;  4RAU C;  4DU9 A;  3X3M A;  4CJ2 C;  1G6Z A;  2NYZ D;  1BDO A;  1STY A;  2F0U A;  2K04 A;  5JJZ A;  3RZD B;  4F7X A;  1OXS C;  1U4L A;  1I50 B;  1X3Q A;  1CHQ D;  3N6R A;  1ZEQ X;  1EYC A;  3VA5 A;  4PMC A;  1QNK A;  2KED A;  1W6J A;  2QF7 A;  5JOB A;  2G9H D;  3BDO A;  1PTO H;  1SAP A;  4XQN A;  3FRP B;  1T5X D;  4OHJ A;  1JOO A;  2NZ1 D;  3D6C A;  4J1M A;  1DXM A;  2Q8R E;  2JE6 I;  4C1N K;  5KEE A;  4XQJ A;  2F0E A;  2JEB I;  1BNZ A;  1CA5 A;  5LHY 1;  1MGS A;  3A8J E;  3NWT A;  2F0L A;  1LTS D;  1MD2 D;  3QIA A;  1AFP A;  1TS3 A;  1VCI A;  4NKL A;  3IAY A;  2QKI C;  3SK8 A;  1PRT D;  5IGE A;  2EYL A;  2RSO A;  3BVZ A;  2Z8L A;  3I73 A;  4OO1 G;  5CBE E;  2A68 C;  3K57 A;  3A8K E;  5K36 H;  5M5Y B;  1KAB A;  1ENF A;  1EY8 A;  5K5P A;  4RKB A;  4Q0F A;  5T1I A;  4A3G B;  5C4X B;  4KHV A;  2FIN B;  1SE2 A;  3ND8 A;  4IQZ A;  2D62 A;  2KUM A;  1IKM A;  4TKO B;  1LLR D;  5IOC A;  2QIL A;  1JC7 A;  3PO2 B;  4K8I A;  4DF7 A;  1A6X A;  1TR5 A;  5NUC A;  1Y1V B;  1ESF A;  4KK7 A;  1D5M C;  1EY6 A;  1YNN D;  2PQE A;  3HS0 C;  3EVQ A;  2F1M A;  3SK4 A;  4K8J A;  2K03 A;  3ITP A;  5C0X J;  5T1G A;  5CV5 A;  4FF2 A;  4KMU C;  3M3Y B;  3K5L A;  4M8A A;  1A3T A;  2R6G A;  2E2I B;  1HFG A;  2F0H A;  1V43 A;  4CJ1 B;  2NVT B;  1STN A;  4ULL A;  1SNP A;  1SJE D;  3DMU A;  2EY6 A;  3AB9 A;  3SEB A;  1AZP A;  5JPM C;  1U9R A;  1LTT D;  3GTG B;  2WII B;  5D14 A;  3BDC A;  1MBY A;  5IGD A;  2FMM A;  2K5W A;  4H13 C;  3RZO B;  1WD0 A;  3DEP A;  2IW3 A;  3HOX B;  3MXG A;  1O78 A;  2RKS A;  1JOK A;  5HGT A;  1Z6H A;  2A74 C;  2B2V A;  1PTO B;  1TII D;  3PO3 B;  1DD2 A;  1S5F D;  3P75 A;  3C46 A;  4ZYS A;  3L3O C;  1D6E C;  3NBH A;  3NUC A;  3S15 B;  2AUJ D;  3OMC A;  3I8Z A;  1STE A;  4O42 A;  3KBX A;  1HCZ A;  1NSN S;  3OOC A;  2O4X A;  4ZUI A;  1JWM D;  3I90 A;  4ZUJ A;  3R2I A;  3DWA A;  3PUY A;  2EYP A;  1GHK A;  1LT6 D;  1PTO F;  5C3X A;  3M7G A;  2F0S A;  3D4R A;  2EYO A;  2VXW A;  1HHV A;  4L6T B;  1DOK A;  2JYO A;  5EGT A;  2F0J A;  5FLX L;  3JAM E;  3MVV A;  5CMD A;  2SNS A;  3HOU B;  5FOB B;  5IOD A;  5FKA C;  3J7A V;  1GXD C;  2L0C A;  2EE1 A;  3G7L A;  3SR1 A;  2PNR C;  1WTW A;  5IGB A;  4X3U A;  1H9S B;  5C6A A;  1OXT A;  3JAM L;  1CQF A;  3TBI B;  4IUQ A;  1RHP A;  2KCN A;  2PYK A;  1EIG A;  2JA7 B;  1B53 A;  4XQQ A;  4QUF A;  5C5L A;  4KY5 A;  4N9P A;  1L0X B;  2KA7 A;  3UI2 A;  5FO8 B;  1FYC A;  4OIJ A;  2G9D A;  1LO5 D;  5I2Y A;  2LS0 1;  3TDQ A;  3QO2 A;  4HED A;  4XDX A;  4F87 A;  2EVB A;  4NDX A;  2IJ0 A;  4XXE A;  1B1Z A;  4HCS A;  2F0F A;  1DM0 B;  3HOY B;  4H44 C;  2B8F A;  4R8I A;  1D1I A;  4G57 A;  1PZJ D;  4ME5 A;  4EQP A;  1EZ8 A;  4K14 A;  5TSS A;  3BZD B;  4K2K A;  1O80 A;  1Y69 U;  1LTR D;  3NTH A;  1S4Z A;  5E4W C;  3NP8 A;  1FNW A;  3J81 E;  3T16 A;  3IFD A;  1PRT B;  2B63 B;  1BUV T;  2R7Z B;  3J80 E;  2NN6 G;  5E1F A;  2XIW A;  2PCF B;  1RDP D;  4A3B B;  3J81 L;  3BYY B;  4QUC A;  1SMY C;  2F0P A;  2BE5 D;  4XYQ A;  1DZ1 A;  4MN3 A;  5FO7 B;  3QB3 A;  1X32 A;  1V1P A;  1BF4 A;  2EYH A;  3D31 A;  3S9W A;  2CW0 D;  1PRT F;  1ENA A;  2J7Z A;  1TWG B;  3CRK C;  3PUV A;  4C3J G;  1BQQ T;  3U9O A;  1FNV A;  5JEA G;  2B2V C;  4V0B A;  1CI3 M;  1PFN A;  4P2C B;  2F0G A;  3LWU A;  1B2T A;  1OXU A;  1AEX A;  5I6W A;  2KQ3 A;  4DNT B;  1TKW B;  3I4M B;  3I72 A;  1KDA A;  3K7A B;  1F2M A;  3M4Y A;  1GUG A;  3TZU A;  2E74 C;  4QMG A;  2M2L A;  2F0I A;  2K01 A;  1F77 A;  2CVR A;  3FKI B;  2BDN A;  2PZU A;  3QOJ A;  3AU7 A;  2RDH A;  3MFG A;  2L1B A;  1BXT A;  1C4Q A;  2QCP X;  4A3F B;  3A8I E;  1EIH A;  1KDC A;  1TWF B;  4KI0 A;  1TU2 B;  3Q22 A;  1LTI D;  4EQO A;  5C44 B;  1I4Q A;  3KLR A;  4S3S A;  4KY7 A;  3VR4 A;  3TP7 A;  1H9S A;  5BN3 A;  2E2H B;  4V19 0;  4KTA A;  3C3L A;  3NQI A;  2EJG C;  2N55 A;  5ELD A;  1BBX C;  1DON A;  5KND A;  3S1M B;  4ZRZ A;  2XSC A;  4HSP A;  1Q1E A;  1CZG A;  1TS4 A;  4K2L A;  2F4I A;  1PMR A;  3GO5 A;  4NMZ A;  5AFW A;  4IN3 A;  3EQL C;  2D5D A;  2F0Q A;  2E2J B;  2JA5 B;  1EQT A;  2QEJ C;  3VYU A;  1ILQ A;  3FPP A;  3GTL B;  3OSO A;  2OXP A;  1ZYR D;  2NVX B;  4AYB B;  1SYC A;  2NVY B;  2IWH A;  2NB0 A;  4KJN A;  4A3M B;  1PTO D;  4ID6 A;  5EBC A;  1BO0 A;  4IUN A;  3NQT A;  1YNJ C;  1PDQ A;  1S5E D;  4PMB A;  2OF1 A;  3C2P A;  3ERO A;  2WAC A;  4IUU A;  1WTQ A;  2D9U A;  2RBM A;  1RCV D;  5A2Q E;  4FXD A;  1W6K A;  2AQ3 B;  1ICW A;  1R4Q B;  1CM9 A;  3I91 A;  1LT3 D;  5D3D A;  5D65 A;  1H9M A;  1UUP A;  2SOB A;  5BN4 A;  5A2Q L;  2VUM B;  2N88 A;  5FO9 B;  2A69 D;  5I6Y A;  2KEE A;  3C1F A;  3BVM A;  4BBS B;  2JSO A;  5A35 A;  3OIQ A;  1C8C A;  3R93 A;  1JIC A;  1KNE A;  2XWJ B;  5E4X A;  1PXU A;  2JA6 B;  1PLF A;  4IUT A;  2CQA A;  3PV0 A;  5IIF A;  1DOM A;  2DNC A;  5M5X B;  3SDZ A;  4A3J B;  5DNF A;  4IFD I;  4F88 A;  2RVL A;  3MXN A;  1HPC A;  1IHZ A;  3V96 A;  1G91 A;  3OWF A;  4KD4 A;  5KIX A;  3VR5 A;  1I4X A;  3H09 A;  3WOE A;  2X6G A;  1CA6 A;  1RJT A;  3BDL A;  2AWO A;  1SND A;  3GTO B;  1HTL D;  3RD4 A;  3MFY A;  3QWN A;  4LJZ C;  5EPJ A;  1I3Q B;  3EFX D;  1U4P A;  2ICE C;  2R92 B;  2F0O A;  1FNU A;  1HXY D;  2JP1 A;  2X69 A;  3A55 A;  2EJM A;  2EOT A;  3M7N A;  1OXV A;  2WP8 J;  3K58 A;  2EY5 A;  3QJY A;  1PFM A;  3SK5 A;  2SNM A;  4KN7 C;  2B2T A;  4KKT A;  2K28 A;  1SYD A;  2B2U A;  1BCP B;  3CRL C;  1EU3 A;  3VYT A;  4Y7N B;  3A7L A;  3QG1 A;  5DM7 3;  2IX1 A;  1K83 B;  2A6E D;  1HTP A;  2K32 A;  2IX0 A;  1G2S A;  1SFO B;  2E76 C;  4XT1 B;  4B9X A;  5EPL A;  1EY4 A;  1ET9 A;  4DK1 A;  4FF3 A;  3DXJ C;  1KLG D;  1QWY A;  4ZK9 B;  5I9O A;  2Q8I B;  2NBF A;  1VMP A;  2EY2 A;  1VF7 A;  1BCP F;  1I4H A;  4J6H A;  4MHE A;  3E5S A;  5JPN C;  1LTB D;  2R93 B;  2BA1 A;  1AN8 A;  4HAE A;  4I65 A;  2HCI A;  3NXW A;  1SDF A;  1HRJ A;  3PUW A;  4NP5 A;  4X3S A;  5I4D A;  3I4N B;  4CHT B;  5C0X G;  4RH6 A;  2SEB D;  2ZXR A;  2K7V A;  1O7Z A;  3O13 A;  1A3V A;  5EKI A;  1AW7 A;  3M85 A;  4A3K B;  2I46 A;  5IGC A;  3NPP A;  3SVM A;  2BOS A;  5BN5 A;  1TWA B;  1YNN C;  2F0D A;  3H6M A;  4TQU S;  1QOH A;  5LL6 X;  4DFA A;  1WTV A;  3TZD A;  1F9Q A;  3A56 A;  4IZ8 A;  2WB1 B;  1JB3 A;  1EFI D;  1EY7 A;  2NTS A;  4IFD H;  4U68 A;  1AZQ A;  4G7O C;  1EY9 A;  2O5J C;  1JE4 A;  3HGB A;  5FLX E;  1RKN A;  4EGV A;  2K33 A;  4U67 3;  2HCC A;  1B3A A;  3FPU B;  1STG A;  1LT5 D;  3IL8 A;  1LAC A;  3OWE B;  3A54 A;  2DY8 A;  1F9P A;  1M4V A;  2MJ8 A;  5JVG 3;  5KGU A;  4ILW A;  5EBD A;  4B9W A;  3IKJ A;  3D8G A;  1A2T A;  3KK7 A;  4OO1 I;  3MAQ A;  1V1O A;  2J4X A;  3R8B A;  2C5C A;  4BY7 B;  3H94 A;  4G4K A;  2XWB B;  2B2T C;  1E0B A;  2R61 A;  2B2U C;  4PV1 C;  2HQE A;  4A93 B;  1G8Z D;  3DUZ A;  3DWP A;  1HQM C;  2XRS D;  4LMQ D;  1WD1 A;  2FHT A;  5I2X A;  4RCO A;  4A3D B;  3I70 A;  5K36 G;  4KD3 A;  5C4J B;  2A6H D;  5ELE A;  3BYT B;  3EJI A;  1WCM B;  1RF2 D;  1ILP A;  3PIP 3;  4RCN A;  3R2T A;  2EXZ A;  4WRD A;  1D1K A;  4FXG C;  2XRQ D;  2PW5 A;  3D4D A;  4K6D A;  4DXG A;  1JR0 D;  1XYI A;  1GHJ A;  3DWQ A;  2Z4I A;  3E6Z X;  4DA2 A;  2ID0 A;  1X3P A;  5COY A;  3Q23 A;  4OGQ C;  1GUO A;  4K5W A;  3GTM B;  1ESR A;  2KVM A;  3F2U A;  5ELC A;  4KN4 C;  4RHS A;  3K5O A;  2SDF A;  3HG9 A;  4G7H C;  1GOZ A;  4QIW B;  3HOZ B;  3NE5 B;  1RD9 D;  1EU4 A;  2MHV A;  2A73 B;  3Q24 A;  4DAV A;  1IW7 D;  1CZW A;  1KAA A;  4FP5 D;  1WTX A;  1IYV A;  3KF8 A;  4Q5V A;  3P1H A;  4C3I B;  2WKC A;  2F0V A;  4CJ0 B;  4E6I A;  4PMW A;  4X3K A;  4IFD J;  2L5T A;  1UNS A;  4PNY A;  4FVM A;  3BS1 A;  2E75 C;  4ZKC B;  1QIL A;  2IPK D;  3SHL A;  2HUG A;  1WTR A;  4IUR A;  1BCP D;  2V4D A;  3V2T A;  1F2Y A;  4EQN A;  3HZX A;  5CV8 A;  3S2D B;  3M4O B;  1MSH A;  2BE5 C;  4C3I G;  3H91 A;  1ZKO A;  2LFN A;  1SBB B;  4LK1 C;  4KKS A;  4RKL A;  4I7Z C;  1GUT A;  3K5N A;  1R9T B;  1QCB D;  3S14 B;  2CW0 C;  1TQO A;  1PFB A;  3TP5 A;  1LT4 D;  3ONA B;  1EEI D;  2BDO A;  3MWY W;  4DAP A;  4O1N A;  1MSG A;  2L12 A;  1JWS D;  3FVQ A;  1S5C D;  4OO1 H;  2DNE A;  5C3W A;  4KHZ A;  2FJ2 A;  4ABN A;  2FMC A;  3GV3 A;  1XTC D;  3HP3 A;  2Z4H A;  1CT1 D;  3VYR A;  1Y8P B;  3NWS A;  4PQX A;  1BR9 A;  1STA A;  2F0K A;  4TSS A;  2LMC B;  1KDB A;  2MUY A;  1EYD A;  3OIP A;  1CFM A;  2F3V A;  4N9T A;  3VR6 A;  4RGT A;  1EOT A;  1IKL A;  3D3R A;  1SNC A;  3RLF A;  3J7Y W;  4QB4 A;  4HTH A;  1MI2 A;  3TP6 A;  1PZI D;  1QNU A;  4A3E B;  1L0Y B;  3DEO A;  3LX0 A;  5E3F A;  3DM1 A;  1H9R A;  1ENC A;  1A15 A;  2EJF C;  1F9S A;  2NN6 I;  2X6L A;  3MC0 B;  1U4R A;  4IUV A;  1XXG A;  2WV6 D;  1H9J A;  5CGK A;  5IGG A;  3S17 B;  4CKB A;  5M9O A;  1TS5 A;  1WTP A;  2LKV A;  1J9O A;  1EY5 A;  1NR4 A;  4FF1 A;  2NUC A;  2K5D A;  1B50 A;  4C3H B;  3R3O A;  2EPB A;  5DAU A;  2MP1 A;  2WAQ B;  2PO4 A;  1ZYR C;  2DN8 A;  5J22 A;  2K05 A;  2H1E A;  1PTO C;  4HMJ A;  1Q3L A;  3VA7 A;  4X3T A;  3S16 B;  3C1E A;  1Q1B A;  2PZT A;  5CYU A;  1SYF A;  2JEA I;  2E2D C;  3HOW B;  4DK0 A;  4OL7 A;  4WFN 3;  3TN2 A;  1IL8 A;  4HMI A;  1HUM A;  3KLS A;  2B8G A;  4OIK A;  1M8A A;  4C3H G;  2JA8 B;  1NCV A;  1Y8O B;  3FMC A;  4HSV A;  3PUX A;  1DCZ A;  1ML0 D;  3HEJ A;  3SK6 A;  5F2D A;  1CK1 A;  1LV9 A;  3G6J B;  3K59 A;  1B44 D;  4DN4 M;  2A69 C;  3L9A X;  5IGF A;  4EVO A;  3K6O A;  4B08 A;  3MEH A;  2A68 D;  3E0J A;  3KLS X;  4Z9C B;  4BBR B;  2PW7 A;  2O2L D;  1I4R A;  1QB5 D;  2O5I C;  3GD7 A;  2FFK B;  4XTC S;  3BVG A;  2J0T D;  2ZXP A;  4RHR A;  4DAY A;  2WIN B;  3EA6 A;  5JAV A;  2NTT A;  5IT9 E;  2B2W A;  2AQ2 B;  1E2Z A;  3RMH A;  1IYU A;  1Y8N B;  3SE0 A;  5C5M A;  1STB A;  1GJX A;  5IT9 L;  5LL6 S;  4ZQ3 A;  4CBV A;  3MXP A;  2Y0S B;  1V8Q A;  2HDM A;  1G2T A;  4H0L C;  4C56 C;  3GTQ B;  2XVS A;  3HOV B;  1K8O A;  5FK9 C;  3MXU A;  1AP0 A;  4TRD A;  2L4N A;  2K6A A;  3T13 A;  2ZT9 C;  5C3E B;  3WOF A;  2IL8 A;  2PZW A;  2L55 A;  5CC4 A;  3H0G B;  1PRT C;  2VB2 X;  3T51 B;  5JVH 3;  4HCE A;  1SNM A;  1XWE A;  5KNC A;  3OPO A;  5CV9 A;  2NVQ B;  3D6W A;  1T5E A;  2NN6 H;  1TWC B;  2TMP A;  3LNN A;  1K8M A;  2F0T A;  5EJW A;  1EZ6 A;  3P20 A;  2LY7 A;  2ICI A;  4QF4 A;  3PMF A;  2A6E C;  5KRU A;  4ODG A;  2QDB A;  2I07 B;  1DJR D;  4WOR A;  1NAP A;  3U9S A;  3MZ5 A;  1F9R A;  1SE4 A;  4ZAI A;  4LAA A;  1NR2 A;  3VR2 A;  2MGS A;  4L8J A;  2K5Q A;  5JEA H;  1EL0 A;  1ROD A;  3VYS A;  4A3I B;  3V05 A;  3N52 A;  4QCL A;  5C4H A;  1A2U A;  1HA5 A;  2OEO A;  1QG7 A;  2YYZ A;  1Z47 A;  3MHB A;  2AQ1 B;  5G3L D;  2EYM A;  1V1P B;  4RGO S;  2CHB D;  1B9M A;  3DHQ A;  3S1R B;  2AUK A;  1SNQ A;  3P7J A;  3GV6 A;  1S5D D;  4ZKB B;  2Q8T A;  2WKD A;  1FR3 A;  2XNA C;  4BWG B;  1HA6 A;  4RA8 A;  1SSO A;  1EWC A;  3CHB D;  4CKC A;  1ZXT A;  5J39 A;  3T56 B;  5C4Z A;  4L63 B;  1Q8I A;  4HN7 A;  1B4O A;  4RFB A;  2KCC A;  3NHH A;  1A3U A;  4K5X A;  2MPM A;  3Q0A A;  4KY6 A;  2F0W A;  2RQX A;  1EWH A;  1TY2 A;  3S1Q B;  4IUP A;  3TSS A;  2JXM B;  1JCK B;  2B2W C;  1EEF D;  1TS2 A;  1HQR D;  1O7Y A;  2D2C C;  1LTG D;  1O7L A;  1D5Z C;  2K1B A;  3I3C A;  4RGM A;  2BA0 A;  4FNF A;  1Q12 A;  3S1N B;  3NTK A;  4XT3 B;  5M3M B;  3GTP B;  3GTJ B;  3PUZ A;  1G29 1;  2L11 A;  2L9H A;  2M9V A;  1FD7 D;  1EY0 A;  3ZYY X;  2Z1C A;  1STH A;  1HFN A;  3K5M A;  3TP8 A;  2DY7 A;  4FO2 A;  4FYD A;  1VMC A;  3K0Y A;  4C1N I;  1FGB D;  1GUW A;  2EYJ A;  1SYE A;  1C48 A;  1TVX A;  1BOS A;  2H4O A;  2KHS A;  4RWS C;  1I4P A;  3T4A C;  4YIJ A;  3L7Z C;  1TWH B;  1SMY D;  1VF5 C;  1KNA A;  4KV6 A;  1SNO A;  3W3A A;  2A5H A;  1SEB D;  1I6H B;  3URY A;  4MIU A;  3RUZ A;  2F3W A;  5CV7 A;  5ELF A;  3H3V C;  1OXX K;  1HUN A;  3GQB A;  4J8Q A;  3D4W A;  3GP7 A;  2RSN A;  3TME A;  5C0X I;  5M5W B;  4NW2 A;  1ET6 A;  2B2Y A;  1PYW D;  1DYQ A;  2HDL A;  1XX8 A;  5J1Z A;  2EYF A;  2PPB C;  3AMU A;  1SYB A;  4M1U B;  5EKK A;  4C3J B;  1B9N A;  2A6H C;  1RTO A;  5JEA J;  1RTN A;  1U4M A;  2C9O A;  2OT2 A;  1DOL A;  3CU7 A;  3J80 L;  3PIO 3;  3Q6S A;  1EQV A;  4BA1 I;  4UAI A;  3S2H B;  1Z7T A;  1UEA B;  2F03 A;  3GTK B;  4IAL A;  4H7B A;  2XN9 C;  2IT1 A;  3HRZ C;  4BS9 A;  1EYA A;  1KLU D;  5ISR A;  2RA4 A;  2M00 A;  1R4P B;  3T53 B;  3ERQ A;  1II3 A;  3ND9 A;  2R3Z A;  4HR7 B;  3NTI A;  3KBG A;  3WDN A;  5HUR A;  5KYL A;  1WVL A;  4WJW A;  2KOL A;  1F2Z A;  3SXH A;  3MTS A;  2ZXO A;  4F8M A;  3I4L A;  4IFD G;  4KJO A;  1LTA D;  1NUC A;  4BA2 I;  4DNR B;  2IX3 A;  1IW7 C;  4G7Z C;  1E2W A;  2VB3 X;  1LAB A;  4XYO A;  1ONL A;  1CHP D;  1D2B A;  1JQY D;  3QOL A;  2ENB A;  1QE6 A;  1CTM A;  2TSS A;  3CQZ B;  3OW7 A;  4XIG S;  1JOR A;  5I9P A;  5CV6 A;  4DGZ A;  4JK1 C;  2NWG A;  4ZLT F;  1Y1W B;  4RGN A;  2F0N A;  1KTK A;  1F2L A;  1BCP C;  2GA4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...