3E6ZX

1.0 a structure of cusf-w44a-cu(ii) residues 10-88 from escherichia coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
b'EAQPQVISATGVVKGIDLESKKITIHHDPIAAVNAPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusF
publication title Tryptophan Cu(I)-pi interaction fine-tunes the metal binding properties of the bacterial metallochaperone CusF
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3e6zX01
2L55A 2QCPX 3E6ZX 1ZEQX 2VB3X 2VB2X 3TDQA
chains in the Genus database with same CATH superfamily
4CDDC 2WKCA 4DV1Q 3RLOA 1OO9B 3M4OB 1KHIA 4A3GB 3H09A 4KHPQ 1HNWL 5IYCG 2XRQD 2VQFQ 5E7NA 3K5MA 3AYHB 3CQZH 1G8ZD 4OGQC 4EQ5A 3I73A 2EJMA 2EZVA 2NVQH 3ONAB 3DM3A 5BN4A 1VQBA 4EQOA 4K5XA 1WTOA 2N49A 3KLWA 4LF7L 2Z8LA 4IUPA 4BBSH 3GTMH 3BDCA 5IT9E 2IL8A 3M4PA 1JWUD 1O78A 1XTCD 4MHEA 3R8BA 1R9TH 3RZDB 3MHBA 1NNXA 2EYLA 2NN6H 4PZ8A 1BXTA 3I55A 1KRSA 1F2ZA 3KK7A 4A4IA 1CKNB 2PW7A 2R93H 1LTGD 1QJOA 1NY4A 2SEBD 2L9HA 3H6MA 3AQQA 1IKMA 1EY7A 5A2QL 5FLXc 1BNZA 4C3IB 1VQKA 2A5HA 2N78A 1JOKA 3OW2A 2R3ZA 3CU7A 4FF4A 1T5XD 5ELBA 3H3VI 1ASZA 1XWEA 2KHJA 2OEOA 2F0GA 2ASBA 4F88A 5FO8B 3PO3B 2Z4HA 1SNOA 4YY3Q 1SLJA 4A3KB 5C44G 2PMZE 4LF5Q 3D6CA 1VS0A 4CHTB 1IL2A 4DR5L 1SMYD 2IPKD 3A8JE 4OWTB 4A3JH 3M4YA 3HOYG 1OXXK 1CHQD 2KOLA 1RF2D 1GJXA 3TQYA 3P1HA 3FHWA 2QW7A 4HR7B 1CI3M 2QDLA 1YNXA 1EUJA 5M3FG 3WWVA 4P75A 3CCQA 4HCEA 1VF7A 5E4XA 1QWYA 1IXRA 4L8JA 1S4ZA 4JI7L 2PQEA 3CHBD 2WV6D 2WAQG 4A3DH 4QGUA 2R7ZG 5IGGA 1YNND 5FLXE 2LY7A 4C3JB 2ZJRA 5C4ZA 4L5TA 3QOJA 2IY5B 5EKKA 2F0JA 2KHSA 3MZ5A 1S72A 4FDBA 1YEZA 2YV5A 3W1BA 1JE5A 5K36G 3ULPA 1C4QA 4R4QA 4K6DA 4G57A 2F0TA 5C4XH 3S1RB 1PH3A 3UE0A 4YCWA 2QA4A 2N88A 5IODA 1ENAA 5M5WB 1S3OA 1LACA 2HQEA 2JA7G 4DK1A 1AFPA 2QGQA 1J9OA 1OTCA 3NWTA 5FJ8H 2E5LL 2Y0SE 1J5EQ 5M3MG 1ENFA 1SMYC 1XNRL 1A62A 3VR2A 4IOCA 3TZUA 4BBRG 5L37A 3KOJA 4IALA 3EA6A 1WTQA 4ZQ3A 3GTPB 4A3GG 1EYCA 4RWSC 2UUBL 1STAA 2WACA 1I3QB 1T5EA 3CAMA 1X9NA 5FLMH 1K8OA 3NEMA 4K0KQ 4RGOS 4NDXA 1STEA 3QB3A 5JOBA 1XXGA 1YNNC 3GTOB 2M9VA 3FMCA 3LWEA 4HTHA 3DM1A 3CKIB 3P75A 4HMJA 4R4OA 3FKIG 5IP9H 2E2HH 4R8IA 1K28A 3KF6B 1VQIA 3V2TA 3NWSA 4K2KA 1U0LA 1SFOB 5EBCA 1BBXC 1IW7D 2BOSA 1PFBA 3HZXA 1G2TA 4LF6Q 2KENA 1Q82C 2UXBL 1NJIC 2JP1A 1TIID 1CA5A 1E22A 1VQJA 5K5PA 2EXZA 3W2DA 4ZAIA 4FF1A 3AEVA 3D8GA 4DR4Q 1NE3A 1BCPF 5M5YH 4C3IG 4I7ZC 1XMOQ 4DV2Q 1Y1WG 1Q86C 3HOUB 4DNIA 4LF9L 3CCSA 2L1BA 1WTPA 4A3EB 4X64Q 1XPOA 5G3LD 2M2LA 4BY1H 3HEJA 1AW7A 4ULLA 1C48A 3S1NH 4B9XA 3DWAA 4P74A 4HIKA 4WJ4A 4Y7NH 2PO4A 2VUMH 1XX8A 3S1QH 4PZ6A 1SROA 3A8IE 4TRDA 3R3OA 1YHAA 4MIUA 4HSPA 1CQFA 2CKZB 3TS2A 1TS5A 3HOWB 2C5CA 2ZTDA 5FK9C 2DGYA 3PUVA 2C35B 2D0OA 2E2JH 2LFNA 4KV6A 1Q1EA 4WFN3 1IW7C 2HHHQ 3SE0A 3Q23A 2JA6B 4YIJA 3TN2A 3MA2B 3C46A 4XIGS 3KDFB 2F4VL 3FEWX 3CC2A 2A1AA 4YHHQ 1SYCA 1H9MA 4A3FG 1X54A 4C1NI 2YU9B 1E2VA 2JXMB 3I4MB 1VQ8A 3DEPA 1QOHA 4DR3Q 4AQYQ 2SOBA 2B8FA 2JN4A 3NBIA 2BA0A 2ICEC 2Z6BA 3G7LA 5IYBG 2DJFC 1Y8NB 2I07B 2RCNA 3A56A 2D2CC 5J1ZA 3ZJYC 3IL8A 3PUXA 4UAIA 4OO1I 1TWCH 2KEEA 1EFWA 4GLXA 4DK3C 3PO2H 1WTXA 1QE6A 1CUKA 2JA9A 3LNNA 4EGVA 3GTJH 3T1YQ 2HT1A 2EPBA 4DR6L 1XNQQ 1U4RA 3A54A 2H5XA 1VQCA 1PZID 4JI5Q 1I6HH 4MZ9A 2B63H 2KCTA 1EOTA 5ELOA 2K5HA 1WTVA 2ZXPA 4RHSA 4HAEA 1SNDA 2FHTA 5JEAG 3S16H 1UE7A 3JAMc 3G6JB 1SR3A 1GKHA 1SE2A 1U9RA 5DLQE 3SK4A 2F0DA 2WB1G 4DV6Q 1Q90A 3HOVG 1XPRA 1LTAD 2IJ0A 3BVMA 2YTVA 3H94A 3S2DH 4IUQA 1JB3A 1SYBA 1FD7D 1STNA 2B39A 2EOTA 4BA2I 5IE8A 3HS0C 5HGTA 2J7ZA 3FP9A 2G9DA 1A3TA 2B2WC 1PDQA 3S1MH 3K58A 5J3BA 2NWGA 1JR0D 5CBAE 4U68A 3OPOA 4RG1A 1R4QB 3MEHA 4KHVA 2ID0A 4DF7A 3DHQA 4EQPA 1B50A 1Q1BA 3MTSA 4GN5A 4K6LA 5C0XJ 1EFID 4LUVA 1SE3A 3I4NB 4H0LC 2TMPA 4KMUC 3J81c 2JA8B 2AWNA 5CORA 5CV8A 3S14H 1NMFA 3A55A 4JI2Q 5FOBB 1K83H 2CCZA 1K3BC 4DR7L 4DXGA 4NXML 3PF4A 4XQJA 5C3EH 2B2VC 1PRTB 1HNZQ 2NZ1D 2R61A 1SNMA 4DV3L 1CK1A 4RGNA 3JAME 1QUQA 4ZYSA 3Q22A 1HRJA 3I4LA 3TP8A 2KEDA 1AZQA 5IP7G 1K9MC 3AB9A 2BE5D 1IBLL 3T51B 1PYSB 2B2VA 4C1NK 3H3VC 3ERSX 2EY2A 4QQBX 5KGUA 2EXDA 4Q5VA 5EQ0A 4NB3A 4B08A 5HURA 2M00A 4A93B 1FNUA 3KJOA 4O42A 1KIXA 1SE4A 4GNXB 3CRLC 5EGTA 4Y52H 1P8LA 3P7JA 4X6AH 4XQQA 3K5LA 4JPBW 2JYOA 2K04A 3NE5B 2EQSA 1J6QA 2F3VA 3T4AC 3RZOH 3I4MG 3MFYA 3MXPA 1D2BA 2PZWA 4E6IA 5CMDA 3BDLA 1L2FA 1Y1VH 1TS2A 2LS01 4JI3Q 5IWAL 2OTJA 4OWWB 1NBWA 3J81E 2O5IC 3RN2A 1HR0W 4OIKA 3ULJA 4FO2A 4HIOA 4GKJL 5BN3A 1E1OA 3GTKH 3LX0A 4LUOA 1VQHA 4DUZQ 2R92H 3KYHC 1RJTA 4HJ7A 1E24A 3ND8A 2R7FA 1YI2A 4R9WA 3VYSA 4PMCA 3CCEA 5BR8Q 1MJEA 4B3RQ 5T1IA 2B3GA 3NK9A 3K7AB 3U58A 2EVBA 1W6KA 4KKTA 4R8NA 3UI2A 4LK1C 1E2ZA 1CM9A 1I50B 5HGQA 1JOOA 2BE5C 1C8CA 4KJOA 1SMXA 3T56B 3H91A 1VQ4A 4JI6Q 2D9UA 4A3MH 3I3CA 3F1ZA 1VQ6A 1CZWA 3TP5A 4BY7H 2PCFB 4WORA 3KUPA 2RDFA 1EYGA 1JJ2A 3DWQA 3WOFA 2XWJB 2ZT9C 2MUYA 1HUNA 2F52A 3I90A 5AJ3Q 4N9PA 4NP5A 5M5XB 4IOAA 4OO1G 1DD2A 3J7YW 4L6TB 1OXVA 4AH6A 3CCVA 2XN9C 3TP6A 4NXNQ 1Y8OB 1SJED 1JORA 5DNFA 3S15H 1JWMD 3HOXH 4I7AA 4GKKQ 3H15A 3BS1A 4IURA 2EJFC 4P72A 2OTLA 1DONA 1HHVA 4IPGA 1CT1D 4U673 3PCOB 3Q0AA 2C9OA 1QVGA 4DUYQ 2BCOA 1TY2A 4ZLTF 2CQAA 5EKLA 1SNCA 5DM73 2ATWA 4QJFA 4X3TA 3G71A 1V1OA 1WFQA 2NN6I 3S2HB 1DJRD 4HJ8A 3T16A 3I4NG 4GLVB 2PMZB 5IYCH 1DGSA 3M3YH 3A74A 3VYTA 4LF8Q 4KI0A 2PNHA 1STGA 3NQTA 4LW1A 1Y14B 1QCBD 2V1CC 1EOVA 5D14A 3UDXA 4YWMA 2IX1A 2B29A 4QF4A 3Q8DA 3CQZB 1P16A 2L5TA 4NPSA 4B3TL 2K33A 1QILA 1H9KA 1U4MA 2NVQB 1MBYA 2QILA 1TWGH 3RLFA 1SE8A 4A3IG 1YNJD 3H0GG 2L11A 4BS9A 1LT3D 3HKZE 3PMFA 4JG2A 5FO9B 1XMQL 4BBSB 2RSOA 3J80i 3GTMB 5JVG3 5GAGC 2HQLA 2I5HA 4FNFA 1D5MC 4LFAQ 1HUMA 3OWEB 5JPNC 3L7ZC 3BYYB 3GTQH 1BF4A 1EU4A 4FXGC 2F0SA 5IGFA 5KYLA 1TY0A 3DLLA 3K80C 5D3IB 1B8AA 1EL0A 1EQVA 1W2BA 4OEMB 4ALPA 4XDXA 4C56C 4XYOA 1BVSA 4CDCC 4A76A 2JE6I 4IUUA 3HP3A 4IUNA 1RKNA 3AMUA 5C44H 2K5DA 2QKIC 1VQAA 4JVZA 1M1KC 1KRTA 2Y0SB 3OTOQ 4B3MQ 3HOYH 1B3AA 1SYFA 5A2QE 2CH4W 4DAMA 4J6HA 2PI2E 2ZXRA 3MXGA 1PRTD 3V96A 1V43A 4A3JB 1BR9A 1SYDA 2G5DA 4JC0A 3AFQA 4KTAA 4F7XA 4X62Q 5M3FH 4CBVA 4N9TA 1LTRD 4OONA 1JJCB 1YNJC 1PTOD 1STYA 4L5RC 4PQXA 1ET9A 1QNKA 1MD2D 1X56A 1GXDC 2K50A 1PH4A 1NR2A 1QB5D 1SEBD 2HDLA 1KLUD 1EY8A 3QG1A 4H44C 2R7ZH 2UXDL 5DEHA 3VR3A 3TZDA 2L15A 2SNMA 4X3SA 5J39A 3FPUB 4JK1C 3EQLC 4UP8A 4A3DB 3J7ZC 5K36H 2BA1A 3URYA 2RDGA 2K5WA 2GA4B 3QIAA 4MTNA 3MC0B 2NZOA 2UUCQ 1DM0B 2K5VA 1AE3A 2AUJD 2JA7H 1L1OC 4CJ0B 5JJLA 2K28A 4CKCA 5C4XB 1LYLA 1LTSD 4DV7Q 4OX9Q 3DWPA 5C0XG 1A63A 2TSSA 1PMRA 4JV5L 5M3MH 2EYFA 2F0VA 1BO0A 3J80L 3J7AV 2MFIA 3F8TA 2EYPA 1L1OA 4LFCQ 3PGZA 1SNQA 3CF5A 1LTBD 4BBRH 1EY5A 1PXUA 4C2MH 4KY5A 3D6WA 3KLRA 3PIO3 4RGMA 1PRTC 1VQ5A 4GN3B 2Z9HA 1TWHH 1QUQB 4QUCA 4GOPC 4HIMA 5NUCA 1FNWA 1TWFH 3NENA 3U50C 2LMCB 2F0NA 3NXWA 5LHY1 5CV4A 2ZXOA 2D0PA 3L2PA 4A3GH 4RGTA 1PTOC 2MO1A 4L5SA 2K14A 4LAAA 4L5QA 1N33Q 1EYDA 3C2PA 3HOZB 2VQEQ 1WOCA 2RA4A 4GOPA 1M4VA 1EIGA 1AE2A 1V1QA 3BZCA 1IBML 4GNXC 3FKIH 3V05A 1AZPA 3KJPA 4B3SQ 1RIPA 1S5FD 1KDCA 2EDGA 2WAQE 3E0EA 3TSSA 4DV5L 3EN2A 2L0CA 4ZKCB 3GDEA 3RZDH 2E2HB 3BZDB 1N36L 1ICFB 4GNXA 1N9WA 2CH4A 3RMHA 5C3XA 4LF4Q 1E1TA 3E0JA 1WCMG 3BZKA 4DV4Q 4X3UA 1RHPA 3KBXA 1QNUA 3R2IA 3PIP3 3VYRA 1JB7A 4DV1L 1I94Q 4NMZA 3MEFA 3CMEA 1Y1WH 1Q3LA 2PZTA 4JBKA 4AYBG 4JOIC 2PYKA 2Q2IA 1TU2B 3X3MA 2K1BA 4KHPL 5M5YB 2A6HD 2VQFL 3F2BA 3LWUA 2RKSA 1KABA 1LTTD 4WJ3M 1KL9A 3NHHA 1DYQA 4JOIA 5EJWA 3C3LA 1VQMA 1V9PA 1UE6A 4BY1B 4HSVA 4X66Q 3J7A5 4BXXG 4QCLA 3CCRA 2MGSA 3S1NB 1IBKQ 1CKMA 5M9OA 1ESRA 3LGJA 4ME5A 4Y7NB 2VXWA 4XQNA 4HJAA 5TSSA 3S1QB 1GHKA 2R6GA 2JQOA 5AFWA 2PI2A 2ZM6Q 1VF5C 3K7UC 4X3KA 1PZKD 3I7FA 3QOLA 4ID6A 2F0MA 1NTGA 2E2JB 2H4OA 4OELB 1RL2A 1A2UA 4A3FH 2DUDA 5C4JB 3NBHA 3RNUA 3STBD 3F2CA 1GHJA 1K8GA 1I4PA 3ICEA 2K05A 2K4KA 2SNSA 1A6XA 3K57A 4QIWE 4YY3L 1R4PB 2PPBC 5I2XA 3M4QA 5IYBH 4LF5L 3SXHA 1EWIA 2A6HC 4XTCS 5ELCA 4XXEA 2YTXA 1PLFA 2A74C 2IT1A 2PNRC 3PO3G 1I6VC 4A3KG 5CR3A 1N34Q 3PUWA 4IUVA 2DY8A 5I9OA 2XIWA 2OT2A 2BH8A 2PW5A 3S17H 3PO2B 5LMNQ 4Q0FA 4K14A 1S5DD 5C6AA 4G4KA 2FFKB 3GP7A 4EQNA 5C4HA 4A3BB 1HZCA 3HOZG 2HIXA 2A8VA 1HPCA 1I6HB 1SN8A 5ISRA 1MI2A 3EFXD 4JBMA 1HZ9A 2MPMA 5JEAH 3GTOH 4HIDA 2DNEA 1EQQA 3STBC 4C3JG 3HOVH 2G9HD 4R4TA 3IAYA 3S16B 1I5FA 4IPDA 2B2TA 2NVXH 3NTIA 4KN4C 4IFDH 1EEFD 5IGBA 1WTHA 1J5EL 2IW3A 2KUMA 3S2DB 5IYDG 1TR5A 4KD3A 2N55A 1SBBB 4J15A 3T13A 2AQ2B 4X65Q 2UUAQ 3S1MB 2VB3X 1UUPA 5GAHC 1GM5A 3L9AX 1CQVA 3U9SA 1G2SA 4DV0Q 5IGEA 1WTWA 1MGSA 1HR0Q 2AQ3B 4K0KL 2XTIA 4DAPA 3PIPA 1RODA 3DXJC 1VQNA 1HH2P 3TBIB 4C3HB 1H9RA 2Q8TA 1K83B 1TT2A 1X55A 1I4HA 1L0XB 3IRBA 3D4DA 5IP7H 5C3EB 3SK6A 2JA5B 2K01A 4DR1Q 4JBJA 3ERQA 1SSOA 4LF6L 4DAVA 1L0YB 1G6PA 1K8MA 1QVFA 2E2IB 2NTSA 3IKJA 4DR4L 1MSHA 4KK7A 2NVYH 3KBGA 4ZK9B 5A35A 1Q46A 2XSCA 3I91A 5EBDA 4DV2L 2F0LA 3N52A 1K73C 3I4MH 3GD7A 3GTLH 1G91A 4RKBA 4X64L 4DFAA 4DR2L 1PH7A 2CFMA 3EVQA 1FVIA 3RZOB 1Q8KA 5KRUA 2ALYB 3MXNB 4LFBQ 5IOCA 1L1OB 2N3SA 1HXYD 1ENCA 2X69A 1Y1VB 1U4PA 3HOUG 1LT6D 4I65A 1N32Q 1W6JA 4A3EG 2Z0SA 1K3RA 3QR8A 4AIMA 3GTKB 1M8AA 1JOQA 4JI1Q 3SHLA 2RF4A 5JPMC 2R92B 3U4VA 1B1ZA 5I4DA 4WRDA 3KLSX 1VQOA 5COYA 1BQQT 3D0FA 4GOPB 1S5ED 5CV6A 3D4RA 2VB2X 2HHHL 1PTOB 4DPGA 2LXJA 3FVQA 3HOWG 5E4WC 4A3BG 1TWAH 1JCKB 4YHHL 4EX5A 1ILPA 1IKLA 5KYIA 4KHZA 3O13A 4IO9A 3GTGH 3RUZA 2V4DA 2NYZD 4JI0Q 2JA6G 4IZ8A 4BY7B 4FP5D 4DR3L 4AQYL 3CPFA 5LL6S 1ILQA 1I4GA 1YVCA 5EKIA 4OO1H 4H13C 1Y69U 3HKZB 3VA5A 2VS1A 3QJYA 1OXTA 5IGCA 1GUSA 1E7ZA 5LMUQ 3KF8A 1MSGA 1Z47A 4V0BA 1GOZA 4KKSA 4MNOA 4JYAQ 3T1YL 1X65A 3OSOA 4B9WA 1EY6A 3S15B 1IYVA 1FJGQ 1II3A 1KNAA 3HOXB 3MWYW 1XNQL 4K2LA 2VL6A 2FMCA 3RLNA 4JI4Q 4JI5L 3BG3A 2AUKA 3VR4A 4ABNA 1F77A 4JI8Q 4EVOA 1BBWA 1OXUA 4RCNA 3I4OA 1VDZA 1VQFA 4KJNA 1A3UA 1X3GA 2VNUD 1BCPD 3TMEA 1ONLA 3I56A 3W1GA 5FO7B 4C3HG 1BDOA 1PH2A 2F0UA 1DOKA 1GUOA 3M3YB 4DV6L 3G48A 1I4RA 1DCZA 2Z4IA 4JW0A 5C3EG 3ULLA 2FINB 4P71A 3NP8A 1B44D 1A3VA 1Z9FA 3FPPA 3T1HL 2JA5G 2K52A 2A19A 2ZTEA 1VQDA 4A3IH 3H0GH 1HNWQ 1G51A 2D62A 3BJUA 2F0PA 1F9SA 3NBHB 2WINB 3E6ZX 1TWGB 2EY6A 2CWPA 2OCEA 3BYTB 5ELFA 3CP0A 2NVTH 2B2UC 1HNXL 4KN7C 2SDFA 1KXLA 1O7YA 2I46A 2EYMA 1IYJB 4LF7Q 2F0OA 1B9NA 3M85A 1EIHA 4CJ2C 3K5OA 4ZUIA 2B2UA 4IUTA 2IX3A 3R93A 1FL0A 1QVCA 2J0TD 1H9JA 5E1FA 4DAYA 1MIUA 2F0QA 4IPCA 3K59A 4JI2L 3ITPA 4FXDA 2BDOA 2F1MA 3HRZC 4DNRB 1IL8A 1VQPA 3RR5A 1HNZL 4UY8C 4DK6C 2F03A 2JA8G 3S9WA 1BCPC 3CC4A 5C44B 2X6GA 1GUWA 2O2LD 3VDYA 3Q6SA 3CCUA 1RTOA 2IX0A 3HOYB 1A15A 4LUZA 5JJKA 1DOLA 2OQKA 1UE5A 2R7DA 3GO5A 3HFZB 1ML0D 2WKDA 1D7QA 1PYBA 2OWOA 2UU9L 2Q2UA 5F2DA 3CMAA 2UXCL 2MP1A 5IIFA 5JJZA 2BDNA 2CW0C 4DR5Q 1AH9A 1PVOA 1KNEA 1RD9D 4A3CG 2HUGA 4A93G 1K8AC 1EQTA 5I2YA 3MVVA 2XWBB 1EWCA 1E3PA 3J80c 4UHVA 1R9TB 4JI3L 3UDGA 2F0KA 2WAQB 1SJHD 1MHWC 3SEBA 2R7ZB 2QEXA 2JEBI 1HA6A 3ZYYX 1VQLA 2F3IA 2L12A 4A3LG 2R93B 5G3LF 1SNPA 1C0AA 2K32A 1D1KA 3L0OA 4DUZL 4JI7Q 1CZGA 3ND9A 1WD0A 3A0JA 1SYGA 3G6EA 3M7NA 2JJQA 5BR8L 2F3WA 5C0XH 2RCFA 3HGBA 1MKHA 5ELDA 2JA7B 5C5LA 3CRKC 1WVLA 4PNYA 2ZJQA 2RHQB 1ET6A 5M3MB 4JI6L 3W5OA 1PFSA 3CCJA 3OMGA 4BBRB 2MJ8A 1EWHA 4H02A 4C2MB 1UNSA 2XGTA 1SRUA 2E5LQ 1TWHB 1TQOA 1KQSA 1XNRQ 1TWFB 1EY0A 5C3WA 3J80E 2A73B 1STHA 5AJ3L 1PH6A 1H9SA 3AFPA 3BDOA 3CPWA 1QZHA 1CTMA 2UUBQ 4NXNL 4L63B 4TVAB 1KD1C 1G6ZA 1X3EA 2A69C 3FKIB 4N8FA 4YWLA 5LL6X 4XT1B 3GV3A 3MAQA 4GKKL 4IQZA 4UPAA 4V190 1Q81C 1WCMH 3Q24A 2MQHA 5JEAJ 2ZTCA 4DUYL 4KD4A 1BOSA 2KA7A 1KDBA 3E9IA 1HFNA 4HN7A 1B53A 1JE4A 2DN8A 1WYDA 4QIWB 1TS3A 3FRPB 1MJCA 5E3FA 1RTNA 3MXNA 4IFDJ 3E5SA 2HDMA 3T53B 3OWFA 4LF8L 1HA5A 1Y1WB 3K5NA 3OIQA 2UXBQ 2F0WA 1PZJD 1GUNA 1SDFA 3MXUA 1TS4A 3M4OH 1W3SA 1HFGA 1KAAA 2JSOA 1V8QA 2EY1A 4RA8A 4UP9A 4CDEC 1WTRA 4BXXH 1VQGA 3D3RA 5IT9L 5CGKA 1B3QA 2PQAA 2ICIA 1DXMA 3KLSA 4LF9Q 1DZ1A 5CBEE 3E9HA 4HJ9A 2GVAA 1NR4A 2EYOA 1YHQA 1D8LA 2X6LA 2Q8RE 1FR3A 5I6YA 4M1UB 4LFAL 3J7AF 2K75A 2RVLA 4RAUC 5EAYA 3TS0A 4LJZC 1JWSD 4FXKC 5KNCA 1B4OA 3SR1A 4UDUC 2KCCA 4OWXB 1XTDA 2EJGC 4BBSG 3TP7A 4ME3A 3D4WA 1PFNA 3KF8B 2KQ3A 1LUZA 3QWNA 2A68D 5JAVA 1EIFA 1JJGA 4F87A 4OIJA 4A3FB 2NN6G 3MFGA 3KFUA 4DGZA 4C3IH 2R93G 2F0FA 2JK8A 1QG7A 3UDFA 1NSNS 3OTOL 2F4VQ 4B3ML 4AYBE 2DY7A 3PO3H 5D65A 3K6OA 1F9PA 2OQ0A 4A3KH 1PHJA 4IJLA 4G7HC 2L55A 2Y0SG 3M9BA 2NTTA 1WI5A 1ZEQX 4X62L 2LSSA 2LKVA 4IFDI 1EEID 1NMGA 1LTID 3UE1A 1F9RA 1YITA 3CCLA 4F8MA 4N8X1 4LNQA 2VUMB 1ASYA 4A3JG 5I6WA 3S17B 1D5XC 1F2MA 2OXPA 5FLXL 2NBFA 3NSWA 4NW2A 4H7BA 4CKEA 4G7ZC 1PA6A 2NUCA 3HOZH 1Q7YC 5I9PA 1TXYA 3NELA 1IZ6A 2MHVA 1HZBA 1STBA 4DR6Q 1LO5D 1YJWA 3M7GA 4XYQA 3VR6A 2EE1A 1U4LA 3X3NA 2A68C 4C3JH 2MNAA 3VA7A 3H3VH 2WP8J 2UUCL 1UEBA 3TRZA 4PG3A 1VQ7A 4A3DG 4QB4A 2WB1B 1C9OA 4DV7L 1NAPA 4OL7A 4OX9L 3HOVB 3PSIA 3S1RH 2E2DC 2NVXB 1UEAB 5M5WH 5IYDH 4DAYB 2AQ1B 4LFCL 4ZRZA 2HCCA 5C4XG 3BVZA 4ODGA 3RN5A 1HTLD 1LT4D 1BKBA 4HCSA 2RHSB 1TWCB 1AEXA 4TSSA 2I5LX 1X3PA 5FJ8G 4DNTB 2N8NA 1CA6A 1FGBD 2CHBD 1H95A 1N33L 2Q2TA 4CJ1B 1KTKA 2VQEL 1YHBA 1LABA 2K5QA 3GTJB 1X3QA 1C7YA 4ILWA 4KY7A 1BCPB 1XJVA 2J4XA 3BU2A 4DR2Q 3C1FA 3GTPH 4RH6A 4CKBA 1I3QH 2EYJA 3QO2A 4HEDA 4PMBA 2IHEA 1CKOA 1KAWA 1TVXA 3WDNA 4B3SL 1JQYD 5EPLA 2QEJC 1PH5A 2B63B 4QMGA 2E8GA 2B2TC 3EIVA 2ZJPA 5FLMG 3PIOA 5GAEC 2L4NA 1YJ9A 1EU3A 2DNCA 1D1IA 2CVRA 5GQOA 4DR7Q 4LF4L 4Z9CB 4NXMQ 1VQEA 2E74C 4DV4L 2BH2A 1FYCA 2E75C 2NB0A 1SFOH 4DV3Q 1J8IA 5IP9G 1GD7A 2B8GA 1PH1A 1B70B 1I94L 3GV6A 4RKLA 1NUCA 3K81C 3OOCA 1VCIA 5DM63 1IBLQ 5C4JH 3I2ZA 4CDFC 3JC66 1S5BD 2NVYB 2XNAC 3HKSA 1LTLA 1Q12A 1V1PA 3F2DA 4KKUA 1S40A 1Z6HA 4MN3A 3GTLB 1S5CD 3HOUH 1D5ZC 1F9QA 4A3EH 4X66L 4PMWA 1GUGA 5KEEA 4IN3A 1A8VA 4K8IA 1IBKL 2YYZA 2Z6KC 2I5MX 3BVGA 2RSNA 2AMCB 1JMCA 1O7IA 2CWAA 1SXTA 5IWAQ 5KNBA 3UDIA 4BY1G 2JEAI 3S14B 2HCIA 4BWGB 4RMFA 1G291 3OMCA 2Z6KA 3K8AA 1E2WA 5CC4A 2ZM6L 4GKJQ 1UE1A 1H9SB 2VUMG 3CW2C 3HOWH 4A3BH 5D3DA 3K0XA 4P2CB 4TQUS 1EY4A 4HJ5A 4OHJA 1FGUA 5CV9A 3SK5A 2VW9A 1TWAB 2WB1E 2KCNA 2JA6H 4XT3B 5ELEA 1VQ9A 1LV9A 1YBYA 4WJWA 3GTGB 1D6EC 1XMOL 1SAPA 2FJ2A 2RQXA 1GO3E 2YU9H 4OXPA 3JAMi 3OIPA 3J81j 1CHPD 3EBEA 4YWKA 3OYYA 3NTHA 5JVH3 4K8JA 4BA1I 2QCPX 1N34L 4K5VA 5KIXA 1HTPA 5T1GA 3T1HQ 4IFDG 2E76C 4NKLA 3IFTA 3HG9A 1LM0A 3EROA 1CKNA 1NCVA 5DAUA 3C1EA 4TKOB 5LMNL 2XVSA 3N6RA 1PRTF 2KHIA 1A0IA 2O4XA 4YCVA 3L3OC 3RD4A 2K7VA 1KLGD 1PTOF 2CQOA 5LMNW 1YIJA 1HNXQ 3PO2G 1JC7A 2PQAB 3GQBA 5ELNA 1ICWA 4PV1C 1U5KA 2B2WA 4RFBA 2K03A 2AKWB 1PH8A 5HY6A 1BBUA 2HD3A 3B6YA 3I8ZA 5GADC 3J81i 1PV4A 1M90C 3P20A 2F0EA 1ESFA 3A5UA 4ZUJA 4C3HH 1OXSC 3PUZA 4UP7A 4YCUA 4GLAC 4A3MB 2LXKA 2OF1A 2EYHA 3CD6A 2B63G 3K0YA 1UWVA 1XYIA 3PV0A 1E0BA 3DUZA 3A5ZB 2IWHA 1BUVT 2JA5H 3SGIA 1X6OA 1HJPA 4RHRA 2ES2A 1B7YB 1RCVD 4A3IB 3H0GB 2HIVA 3E3XA 2E2IH 4IJHA 4J1MA 2FMMA 2PZUA 3TEHB 4FYDA 4X65L 2UUAL 3VYUA 4KLKA 3VR5A 4B3TQ 4QL5A 2Z1CA 2UU9Q 2NVTB 2KCMA 2WIIB 2UXCQ 2I0QA 3FDTA 1WD1A 1EQRA 1AN8A 4FVMA 3U9OA 5J22A 4DV0L 1XMQQ 1EIYB 2YTYA 1HR0L 1Y8PB 4M8AA 4JCVE 4DXFA 2P5ZX 1AP0A 1HCZA 3A7AB 1EZ8A 3JAML 1JICA 5KNDA 3A8KE 3I4NH 1KC8C 2RBMA 4FF3A 2JA8H 4LMQD 3CC7A 2AWOA 1O7ZA 5FKAC 1K0SA 1I4QA 3ER0A 2AHOB 2F4IA 2EIFA 3DEOA 2QDBA 3WOEA 1YJNA 1HQMC 4LWCA 3TDQA 4DR1L 5CYUA 3PF5A 1IHZA 4O0AA 1F2YA 2Q8IB 2MO0A 1CSPA 1T9HA 1PH9A 1JT8A 3NUCA 5CV7A 3OHXC 1UAPA 1PYWD 3I72A 2A6ED 1PTOH 4HMIA 4R4IA 1EY9A 5EPKA 1RDPD 1ZKOA 5C0XI 4R4CA 3R2TA 2EY5A 4QY7A 4DA2A 2KVMA 3SK8A 5BN5A 4DKAC 4APVA 3I70A 1VMCA 1Q8IA 2CW0D 4A3CH 4A93H 2GN5A 1GVPA 3G4SA 1EYAA 4GN4B 3TREA 3J81L 2GVBA 5IY0A 4K5WA 1ZXTA 1ZYRD 4LFBL 3SDZA 3OW7A 1QZGA 3EJIA 4A3LH 3W3AA 5C5MA 3KF6A 1N32L 3GTQB 3PUYA 3S24A 3DMUA 2H1EA 3NPPA 4DK0A 1XPUA 2O5JC 5JJIA 4ZKBB 2UXDQ 4GZYC 4RCOA 2QF7A 4JI1L 1Y1VG 2FXQA 2RDHA 2Q2HA 2F0HA 4POGA 3A7LA 1TKWB 3F2UA 3NTKA 4MTKA 1O7LA 2NZHA 1EZ6A 4FF2A 4O1NA 1IYUA 1A2TA 2R92G 1B9MA 4ZCKA 3D31A 3K7AH 2KBNA 1HZAA 2A6EC 1I50H 4GS3A 3U4ZA 4DN4M 1FNVA 1X32A 1CSQA 1GUTA 1KDAA 1WJJA 4O2DA 3SVMA 4JV5Q 5EPJA 4JI0L 4G7OC 3AU7A 3NQIA 1N8RC 2WFWA 1F2LA 1Z7TA 4DU9A 5M3FB 4P73A 2B2YC 1B2TA 4A3MG 2VZAA 1L0WA 5GROA 2K5NA 5LMUL 4BY7G 1LT5D 2F0IA 1ZYRC 1K0RA 1VMPA 2B2YA 5M5XH 3HKZG 4QUFA 4S3SA 4JYAL 2A69D 1V1PB 4CGYB 1CFMA 2D5DA 3IFDA 1FJGL 5H1SE 1O80A 4R1JA 1IBMQ 3KDFA 3PQIA 4POFA 5IGDA 4A75A 5IT9c 4B3RL 1WCMB 4JI4L 2IHFA 2KECA 1SYEA 1YZ6A 3CXCA 1I4XA 2VY3A 4DV5Q 3HOXG 2XRSD 5CV5A 4JI8L 4JBWA 1N36Q 4J8QA 2KJXA 2DJGC 4PZ7A 3CCMA 2ENBA 4IPHA 1HQRD 4AYBB 1LLRD 4KY6A 3S2HH 2K6AA 1X3FA 1DOMA 1PFMA
chains in the Genus database with same CATH topology
2WKCA 1OO9B 3M4OB 4A3GB 3H09A 2XRQD 3K5MA 1G8ZD 4OGQC 3I73A 2EJMA 2EZVA 3ONAB 5BN4A 4EQOA 4K5XA 1WTOA 2Z8LA 4IUPA 3BDCA 5IT9E 2IL8A 1JWUD 1O78A 1XTCD 4MHEA 3R8BA 3RZDB 3MHBA 2EYLA 2NN6H 1BXTA 1F2ZA 3KK7A 2PW7A 1LTGD 1QJOA 2SEBD 2L9HA 3H6MA 1IKMA 1EY7A 5A2QL 1BNZA 4C3IB 2A5HA 1JOKA 2R3ZA 3CU7A 4FF4A 1T5XD 5ELBA 1XWEA 2OEOA 2F0GA 4F88A 5FO8B 3PO3B 2Z4HA 1SNOA 4A3KB 3D6CA 4CHTB 1SMYD 2IPKD 3A8JE 3M4YA 1OXXK 1CHQD 2KOLA 1RF2D 1GJXA 3P1HA 4HR7B 1CI3M 4HCEA 1VF7A 5E4XA 1QWYA 4L8JA 1S4ZA 2PQEA 3CHBD 2WV6D 5IGGA 1YNND 5FLXE 2LY7A 4C3JB 5C4ZA 3QOJA 5EKKA 2F0JA 2KHSA 3MZ5A 5K36G 1C4QA 4K6DA 4G57A 2F0TA 3S1RB 2N88A 5IODA 1ENAA 5M5WB 1LACA 2HQEA 4DK1A 1AFPA 1J9OA 3NWTA 1ENFA 1SMYC 3VR2A 3TZUA 4IALA 3EA6A 1WTQA 4ZQ3A 3GTPB 1EYCA 4RWSC 1STAA 2WACA 1I3QB 1T5EA 1K8OA 4RGOS 4NDXA 1STEA 3QB3A 5JOBA 1XXGA 1YNNC 3GTOB 2M9VA 3FMCA 3LWEA 4HTHA 3DM1A 3CKIB 3P75A 4HMJA 4R8IA 3V2TA 3NWSA 4K2KA 1SFOB 5EBCA 1BBXC 1IW7D 2BOSA 1PFBA 3HZXA 1G2TA 2JP1A 1TIID 1CA5A 5K5PA 2EXZA 3W2DA 4ZAIA 4FF1A 3D8GA 1BCPF 4C3IG 4I7ZC 3HOUB 2L1BA 1WTPA 4A3EB 5G3LD 2M2LA 3HEJA 1AW7A 4ULLA 1C48A 4B9XA 3DWAA 2PO4A 1XX8A 3A8IE 4TRDA 3R3OA 4MIUA 4HSPA 1CQFA 1TS5A 3HOWB 2C5CA 5FK9C 3PUVA 2LFNA 4KV6A 1Q1EA 4WFN3 1IW7C 3SE0A 3Q23A 2JA6B 4YIJA 3TN2A 3MA2B 3C46A 4XIGS 3FEWX 1SYCA 1H9MA 4C1NI 2YU9B 1E2VA 2JXMB 3I4MB 3DEPA 1QOHA 2SOBA 2B8FA 3NBIA 2BA0A 2ICEC 3G7LA 1Y8NB 2I07B 3A56A 2D2CC 5J1ZA 3IL8A 3PUXA 4UAIA 4OO1I 2KEEA 1WTXA 1QE6A 3LNNA 4EGVA 2EPBA 1U4RA 3A54A 1PZID 1EOTA 1WTVA 2ZXPA 4RHSA 4HAEA 1SNDA 2FHTA 5JEAG 3G6JB 1SE2A 1U9RA 3SK4A 2F0DA 1Q90A 1LTAD 2IJ0A 3BVMA 3H94A 4IUQA 1JB3A 1SYBA 1FD7D 1STNA 2B39A 2EOTA 4BA2I 3HS0C 5HGTA 2J7ZA 2G9DA 1A3TA 2B2WC 1PDQA 3K58A 2NWGA 5CBAE 1JR0D 4U68A 3OPOA 1R4QB 3MEHA 4KHVA 2ID0A 4DF7A 3DHQA 4EQPA 1B50A 1Q1BA 3MTSA 4K6LA 5C0XJ 1EFID 1SE3A 3I4NB 4H0LC 2TMPA 4KMUC 2JA8B 2AWNA 5CORA 5CV8A 3A55A 5FOBB 4DXGA 4XQJA 2B2VC 1PRTB 2NZ1D 2R61A 1SNMA 1CK1A 4RGNA 3JAME 4ZYSA 3Q22A 1HRJA 3I4LA 3TP8A 2KEDA 1AZQA 3AB9A 2BE5D 3T51B 2B2VA 4C1NK 3H3VC 2EY2A 5KGUA 4Q5VA 5EQ0A 4B08A 5HURA 2M00A 4A93B 1FNUA 4O42A 1SE4A 3CRLC 5EGTA 3P7JA 4XQQA 3K5LA 2JYOA 2K04A 3NE5B 2F3VA 3T4AC 3MFYA 3MXPA 1D2BA 2PZWA 4E6IA 5CMDA 3BDLA 1TS2A 2LS01 3J81E 2O5IC 4OIKA 4FO2A 5BN3A 3LX0A 1RJTA 3ND8A 4R9WA 3VYSA 4PMCA 5T1IA 3NK9A 3K7AB 2EVBA 1W6KA 4KKTA 4R8NA 3UI2A 4LK1C 1E2ZA 1CM9A 1I50B 1JOOA 2BE5C 1C8CA 4KJOA 3T56B 3H91A 2D9UA 3I3CA 1CZWA 3TP5A 2PCFB 4WORA 3KUPA 2RDFA 3DWQA 3WOFA 2XWJB 2ZT9C 2MUYA 1HUNA 3I90A 4N9PA 4NP5A 5M5XB 4OO1G 1DD2A 3J7YW 4L6TB 1OXVA 2XN9C 3TP6A 1Y8OB 1SJED 1JORA 5DNFA 1JWMD 3BS1A 4IURA 2EJFC 1DONA 1HHVA 1CT1D 4U673 3Q0AA 2C9OA 2BCOA 1TY2A 4ZLTF 2CQAA 5EKLA 1SNCA 5DM73 4X3TA 1V1OA 2NN6I 3S2HB 1DJRD 3T16A 2PMZB 3VYTA 4KI0A 1STGA 3NQTA 1QCBD 5D14A 2IX1A 4QF4A 3CQZB 2L5TA 2K33A 1QILA 1H9KA 1U4MA 2NVQB 1MBYA 2QILA 3RLFA 1YNJD 2L11A 4BS9A 1LT3D 3PMFA 5FO9B 4BBSB 2RSOA 3GTMB 5JVG3 4FNFA 1D5MC 1HUMA 3OWEB 5JPNC 3L7ZC 3BYYB 1BF4A 1EU4A 4FXGC 2F0SA 5IGFA 5KYLA 1TY0A 5D3IB 1EL0A 1EQVA 4XDXA 4C56C 4XYOA 2JE6I 4IUUA 3HP3A 4IUNA 1RKNA 3AMUA 2K5DA 2QKIC 2Y0SB 1B3AA 1SYFA 5A2QE 4J6HA 2ZXRA 3MXGA 1PRTD 3V96A 1V43A 4A3JB 1BR9A 1SYDA 4F7XA 4KTAA 4CBVA 4N9TA 1LTRD 1YNJC 1PTOD 1STYA 4PQXA 1ET9A 1QNKA 1MD2D 1GXDC 1NR2A 1QB5D 1SEBD 2HDLA 1KLUD 1EY8A 3QG1A 4H44C 5DEHA 3VR3A 3TZDA 2SNMA 4X3SA 5J39A 3FPUB 4JK1C 3EQLC 4A3DB 5K36H 2BA1A 3URYA 2RDGA 2K5WA 2GA4B 3QIAA 3MC0B 1DM0B 2AUJD 4CJ0B 2K28A 4CKCA 5C4XB 1LTSD 3DWPA 5C0XG 2TSSA 1PMRA 2EYFA 2F0VA 1BO0A 3J80L 3J7AV 2EYPA 1SNQA 1LTBD 1EY5A 1PXUA 4KY5A 3D6WA 3KLRA 3PIO3 4RGMA 1PRTC 4QUCA 5NUCA 1FNWA 2LMCB 2F0NA 3NXWA 5LHY1 5CV4A 2ZXOA 4RGTA 1PTOC 4LAAA 3HOZB 1EYDA 3C2PA 2RA4A 1M4VA 1EIGA 3V05A 1AZPA 1S5FD 1KDCA 2EDGA 3TSSA 4ZKCB 2L0CA 2E2HB 3BZDB 3RMHA 5C3XA 3E0JA 4X3UA 1RHPA 3KBXA 1QNUA 3R2IA 3PIP3 3VYRA 4NMZA 1Q3LA 2PZTA 2PYKA 1TU2B 3X3MA 2K1BA 5M5YB 2A6HD 3LWUA 2RKSA 1KABA 1LTTD 3NHHA 1DYQA 5EJWA 3C3LA 4BY1B 4HSVA 4QCLA 2MGSA 3S1NB 5M9OA 1ESRA 4Y7NB 4ME5A 2VXWA 4XQNA 5TSSA 3S1QB 1GHKA 2R6GA 5AFWA 1VF5C 4X3KA 1PZKD 3QOLA 4ID6A 2F0MA 2E2JB 2H4OA 1A2UA 5C4JB 3NBHA 1GHJA 1I4PA 2K05A 2SNSA 1A6XA 3K57A 1R4PB 2PPBC 5I2XA 3SXHA 2A6HC 5ELCA 4XXEA 4XTCS 1PLFA 2A74C 2IT1A 2PNRC 1I6VC 5CR3A 3PUWA 4IUVA 2DY8A 5I9OA 2XIWA 2OT2A 2PW5A 3PO2B 4Q0FA 4K14A 1S5DD 5C6AA 4G4KA 2FFKB 3GP7A 4EQNA 5C4HA 4A3BB 1HPCA 1I6HB 5ISRA 1MI2A 3EFXD 2MPMA 5JEAH 2DNEA 4C3JG 2G9HD 3IAYA 3S16B 2B2TA 3NTIA 4KN4C 4IFDH 1EEFD 5IGBA 2IW3A 2KUMA 3S2DB 1TR5A 4KD3A 2N55A 1SBBB 3T13A 2AQ2B 3S1MB 2VB3X 1UUPA 3L9AX 1CQVA 3U9SA 1G2SA 5IGEA 1WTWA 1MGSA 2AQ3B 4DAPA 1RODA 3DXJC 3TBIB 4C3HB 1H9RA 2Q8TA 1K83B 1TT2A 1I4HA 1L0XB 3D4DA 5C3EB 3SK6A 2JA5B 2K01A 3ERQA 1SSOA 4DAVA 1L0YB 1K8MA 2E2IB 2NTSA 3IKJA 1MSHA 4KK7A 3KBGA 4ZK9B 5A35A 2XSCA 3I91A 5EBDA 2F0LA 3N52A 3GD7A 1G91A 4RKBA 4DFAA 3EVQA 3RZOB 5KRUA 5IOCA 1HXYD 1ENCA 2X69A 1Y1VB 1U4PA 1LT6D 4I65A 1W6JA 3GTKB 1M8AA 1JOQA 3SHLA 5JPMC 2R92B 1B1ZA 5I4DA 4WRDA 3KLSX 5COYA 1BQQT 1S5ED 5CV6A 3D4RA 2VB2X 1PTOB 3FVQA 5E4WC 1JCKB 1ILPA 1IKLA 5KYIA 4KHZA 3O13A 3RUZA 2V4DA 2NYZD 4IZ8A 4BY7B 4FP5D 5LL6S 1ILQA 1I4GA 5EKIA 4OO1H 4H13C 1Y69U 3HKZB 3VA5A 3QJYA 1OXTA 5IGCA 1GUSA 3KF8A 1MSGA 1Z47A 4V0BA 1GOZA 4KKSA 3OSOA 4B9WA 1EY6A 3S15B 1IYVA 1II3A 1KNAA 3HOXB 3MWYW 4K2LA 2FMCA 3BG3A 2AUKA 3VR4A 4ABNA 1F77A 4EVOA 1OXUA 4RCNA 1VDZA 4KJNA 1A3UA 2VNUD 1BCPD 3TMEA 1ONLA 5FO7B 4C3HG 1BDOA 2F0UA 1DOKA 1GUOA 3M3YB 1I4RA 1DCZA 2Z4IA 2FINB 3NP8A 1B44D 1A3VA 3FPPA 2D62A 2F0PA 1F9SA 2WINB 3E6ZX 1TWGB 2EY6A 3BYTB 5ELFA 2B2UC 4KN7C 2SDFA 1O7YA 2I46A 2EYMA 2F0OA 1B9NA 3M85A 1EIHA 4CJ2C 3K5OA 4ZUIA 2B2UA 4IUTA 2IX3A 3R93A 2J0TD 1H9JA 5E1FA 4DAYA 2F0QA 3K59A 3ITPA 4FXDA 2BDOA 2F1MA 3HRZC 4DNRB 1IL8A 2F03A 3S9WA 1BCPC 5C44B 2X6GA 1GUWA 2O2LD 3Q6SA 1RTOA 2IX0A 3HOYB 1A15A 1DOLA 3GO5A 1ML0D 2WKDA 5F2DA 2MP1A 5IIFA 5JJZA 2BDNA 2CW0C 1KNEA 1RD9D 2HUGA 1EQTA 5I2YA 3MVVA 2XWBB 1EWCA 1R9TB 2F0KA 2WAQB 1SJHD 3SEBA 2R7ZB 2JEBI 1HA6A 3ZYYX 2L12A 2R93B 5G3LF 1SNPA 2K32A 1D1KA 1CZGA 3ND9A 1WD0A 1SYGA 3M7NA 2F3WA 5C0XH 3HGBA 5ELDA 2JA7B 5C5LA 3CRKC 1WVLA 4PNYA 1ET6A 5M3MB 3OMGA 4BBRB 2MJ8A 1EWHA 4C2MB 1UNSA 1TWHB 1TQOA 1TWFB 1EY0A 5C3WA 3J80E 2A73B 1STHA 1H9SA 3BDOA 1CTMA 4L63B 1G6ZA 2A69C 3FKIB 5LL6X 4XT1B 3GV3A 3MAQA 4IQZA 4V190 3Q24A 5JEAJ 4KD4A 1BOSA 2KA7A 1KDBA 1HFNA 4HN7A 1B53A 1JE4A 2DN8A 4QIWB 1TS3A 3FRPB 5E3FA 1RTNA 3MXNA 4IFDJ 3E5SA 2HDMA 3T53B 3OWFA 1HA5A 1Y1WB 3K5NA 3OIQA 2F0WA 1PZJD 1GUNA 1SDFA 3MXUA 1TS4A 1HFGA 1KAAA 2JSOA 1V8QA 2EY1A 4RA8A 1WTRA 3D3RA 5IT9L 5CGKA 2ICIA 1DXMA 3KLSA 1DZ1A 5CBEE 1NR4A 2EYOA 2X6LA 2Q8RE 1FR3A 5I6YA 4M1UB 3J7AF 2RVLA 4RAUC 4LJZC 1JWSD 4FXKC 5KNCA 1B4OA 3SR1A 4UDUC 2KCCA 2EJGC 3TP7A 3D4WA 1PFNA 2KQ3A 3QWNA 2A68D 5JAVA 4F87A 4OIJA 4A3FB 2NN6G 3MFGA 4DGZA 2F0FA 1QG7A 1NSNS 2DY7A 5D65A 3K6OA 1F9PA 4G7HC 2L55A 2NTTA 1ZEQX 2LKVA 4IFDI 1EEID 1LTID 1F9RA 4F8MA 2VUMB 5I6WA 3S17B 1D5XC 1F2MA 2OXPA 5FLXL 2NBFA 3NSWA 4NW2A 4H7BA 4CKEA 4G7ZC 2NUCA 5I9PA 2MHVA 1STBA 1LO5D 3M7GA 4XYQA 3VR6A 2EE1A 1U4LA 3X3NA 2A68C 3VA7A 2WP8J 4QB4A 2WB1B 1NAPA 4OL7A 3HOVB 2E2DC 2NVXB 1UEAB 2AQ1B 4ZRZA 2HCCA 3BVZA 4ODGA 1HTLD 1LT4D 4HCSA 1TWCB 1AEXA 4TSSA 1X3PA 4DNTB 1CA6A 1FGBD 2CHBD 4CJ1B 1KTKA 2K5QA 1LABA 3GTJB 1X3QA 4ILWA 4KY7A 1BCPB 2J4XA 3C1FA 4RH6A 4CKBA 2EYJA 3QO2A 4HEDA 4PMBA 3WDNA 1TVXA 1JQYD 5EPLA 2QEJC 2B63B 4QMGA 2B2TC 2L4NA 1EU3A 2DNCA 1D1IA 2CVRA 4Z9CB 2E74C 1FYCA 2E75C 2NB0A 1J8IA 2B8GA 3GV6A 4RKLA 1NUCA 3OOCA 5DM63 1VCIA 1S5BD 2NVYB 2XNAC 1Q12A 1V1PA 4KKUA 1Z6HA 4MN3A 3GTLB 1S5CD 1D5ZC 1F9QA 4PMWA 1GUGA 5KEEA 4IN3A 4K8IA 2YYZA 3BVGA 2RSNA 1SXTA 5KNBA 2JEAI 3S14B 2HCIA 4BWGB 1G291 3OMCA 5CC4A 1E2WA 1H9SB 5D3DA 4P2CB 4TQUS 1EY4A 4OHJA 5CV9A 3SK5A 1TWAB 2KCNA 4XT3B 5ELEA 1LV9A 4WJWA 3GTGB 1D6EC 1SAPA 2FJ2A 2RQXA 3OIPA 1CHPD 3NTHA 5JVH3 4K8JA 4BA1I 2QCPX 4K5VA 5KIXA 1HTPA 5T1GA 4IFDG 2E76C 4NKLA 3IFTA 3HG9A 3EROA 1NCVA 5DAUA 3C1EA 4TKOB 2XVSA 3N6RA 1PRTF 2O4XA 3L3OC 3RD4A 2K7VA 1KLGD 1PTOF 1JC7A 3GQBA 1ICWA 4PV1C 2B2WA 4RFBA 2K03A 3I8ZA 3P20A 2F0EA 1ESFA 4ZUJA 1OXSC 3PUZA 4A3MB 2OF1A 2EYHA 3K0YA 1XYIA 3PV0A 1E0BA 3DUZA 2IWHA 1BUVT 4RHRA 1RCVD 4A3IB 3H0GB 4J1MA 2FMMA 2PZUA 4FYDA 3VYUA 3VR5A 2Z1CA 2NVTB 2WIIB 3FDTA 1WD1A 1AN8A 4FVMA 3U9OA 5J22A 1Y8PB 4M8AA 4DXFA 1AP0A 1HCZA 3A7AB 1EZ8A 3JAML 1JICA 5KNDA 3A8KE 2RBMA 4FF3A 4LMQD 2AWOA 1O7ZA 5FKAC 1I4QA 2F4IA 3DEOA 2QDBA 3WOEA 1HQMC 3TDQA 5CYUA 1IHZA 2Q8IB 1F2YA 3NUCA 5CV7A 3OHXC 1UAPA 1PYWD 3I72A 2A6ED 1PTOH 4HMIA 1EY9A 5EPKA 1RDPD 1ZKOA 5C0XI 3R2TA 2EY5A 4DA2A 2KVMA 3SK8A 5BN5A 3I70A 1VMCA 1Q8IA 2CW0D 1EYAA 3J81L 4K5WA 1ZXTA 1ZYRD 3SDZA 3OW7A 3EJIA 3W3AA 5C5MA 3GTQB 3PUYA 3DMUA 2H1EA 3NPPA 4DK0A 2O5JC 4ZKBB 4GZYC 4RCOA 2QF7A 2RDHA 2F0HA 3A7LA 1TKWB 3F2UA 3NTKA 1O7LA 1EZ6A 4FF2A 4O1NA 1IYUA 1A2TA 1B9MA 3D31A 2A6EC 4DN4M 1FNVA 1X32A 1GUTA 1KDAA 3SVMA 5EPJA 4G7OC 3AU7A 3NQIA 1F2LA 1Z7TA 4DU9A 5M3FB 2B2YC 1B2TA 1LT5D 2F0IA 1ZYRC 1VMPA 2B2YA 4QUFA 4S3SA 2A69D 1V1PB 4CGYB 1CFMA 2D5DA 3IFDA 1O80A 5IGDA 1WCMB 2KECA 1SYEA 1I4XA 2XRSD 5CV5A 4JBWA 4J8QA 2KJXA 2ENBA 1HQRD 4AYBB 1LLRD 4KY6A 2K6AA 1DOMA 1PFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L55 A;  2QCP X;  3E6Z X;  1ZEQ X;  2VB3 X;  2VB2 X;  3TDQ A; 
#chains in the Genus database with same CATH topology
 4CDD C;  2WKC A;  4DV1 Q;  3RLO A;  1OO9 B;  3M4O B;  1KHI A;  4A3G B;  3H09 A;  4KHP Q;  1HNW L;  5IYC G;  2XRQ D;  2VQF Q;  5E7N A;  3K5M A;  3AYH B;  3CQZ H;  1G8Z D;  4OGQ C;  4EQ5 A;  3I73 A;  2EJM A;  2EZV A;  2NVQ H;  3ONA B;  3DM3 A;  5BN4 A;  1VQB A;  4EQO A;  4K5X A;  1WTO A;  2N49 A;  3KLW A;  4LF7 L;  2Z8L A;  4IUP A;  4BBS H;  3GTM H;  3BDC A;  5IT9 E;  2IL8 A;  3M4P A;  1JWU D;  1O78 A;  1XTC D;  4MHE A;  3R8B A;  1R9T H;  3RZD B;  3MHB A;  1NNX A;  2EYL A;  2NN6 H;  4PZ8 A;  1BXT A;  3I55 A;  1KRS A;  1F2Z A;  3KK7 A;  4A4I A;  1CKN B;  2PW7 A;  2R93 H;  1LTG D;  1QJO A;  1NY4 A;  2SEB D;  2L9H A;  3H6M A;  3AQQ A;  1IKM A;  1EY7 A;  5A2Q L;  5FLX c;  1BNZ A;  4C3I B;  1VQK A;  2A5H A;  2N78 A;  1JOK A;  3OW2 A;  2R3Z A;  3CU7 A;  4FF4 A;  1T5X D;  5ELB A;  3H3V I;  1ASZ A;  1XWE A;  2KHJ A;  2OEO A;  2F0G A;  2ASB A;  4F88 A;  5FO8 B;  3PO3 B;  2Z4H A;  1SNO A;  4YY3 Q;  1SLJ A;  4A3K B;  5C44 G;  2PMZ E;  4LF5 Q;  3D6C A;  1VS0 A;  4CHT B;  1IL2 A;  4DR5 L;  1SMY D;  2IPK D;  3A8J E;  4OWT B;  4A3J H;  3M4Y A;  3HOY G;  1OXX K;  1CHQ D;  2KOL A;  1RF2 D;  1GJX A;  3TQY A;  3P1H A;  3FHW A;  2QW7 A;  4HR7 B;  1CI3 M;  2QDL A;  1YNX A;  1EUJ A;  5M3F G;  3WWV A;  4P75 A;  3CCQ A;  4HCE A;  1VF7 A;  5E4X A;  1QWY A;  1IXR A;  4L8J A;  1S4Z A;  4JI7 L;  2PQE A;  3CHB D;  2WV6 D;  2WAQ G;  4A3D H;  4QGU A;  2R7Z G;  5IGG A;  1YNN D;  5FLX E;  2LY7 A;  4C3J B;  2ZJR A;  5C4Z A;  4L5T A;  3QOJ A;  2IY5 B;  5EKK A;  2F0J A;  2KHS A;  3MZ5 A;  1S72 A;  4FDB A;  1YEZ A;  2YV5 A;  3W1B A;  1JE5 A;  5K36 G;  3ULP A;  1C4Q A;  4R4Q A;  4K6D A;  4G57 A;  2F0T A;  5C4X H;  3S1R B;  1PH3 A;  3UE0 A;  4YCW A;  2QA4 A;  2N88 A;  5IOD A;  1ENA A;  5M5W B;  1S3O A;  1LAC A;  2HQE A;  2JA7 G;  4DK1 A;  1AFP A;  2QGQ A;  1J9O A;  1OTC A;  3NWT A;  5FJ8 H;  2E5L L;  2Y0S E;  1J5E Q;  5M3M G;  1ENF A;  1SMY C;  1XNR L;  1A62 A;  3VR2 A;  4IOC A;  3TZU A;  4BBR G;  5L37 A;  3KOJ A;  4IAL A;  3EA6 A;  1WTQ A;  4ZQ3 A;  3GTP B;  4A3G G;  1EYC A;  4RWS C;  2UUB L;  1STA A;  2WAC A;  1I3Q B;  1T5E A;  3CAM A;  1X9N A;  5FLM H;  1K8O A;  3NEM A;  4K0K Q;  4RGO S;  4NDX A;  1STE A;  3QB3 A;  5JOB A;  1XXG A;  1YNN C;  3GTO B;  2M9V A;  3FMC A;  3LWE A;  4HTH A;  3DM1 A;  3CKI B;  3P75 A;  4HMJ A;  4R4O A;  3FKI G;  5IP9 H;  2E2H H;  4R8I A;  1K28 A;  3KF6 B;  1VQI A;  3V2T A;  3NWS A;  4K2K A;  1U0L A;  1SFO B;  5EBC A;  1BBX C;  1IW7 D;  2BOS A;  1PFB A;  3HZX A;  1G2T A;  4LF6 Q;  2KEN A;  1Q82 C;  2UXB L;  1NJI C;  2JP1 A;  1TII D;  1CA5 A;  1E22 A;  1VQJ A;  5K5P A;  2EXZ A;  3W2D A;  4ZAI A;  4FF1 A;  3AEV A;  3D8G A;  4DR4 Q;  1NE3 A;  1BCP F;  5M5Y H;  4C3I G;  4I7Z C;  1XMO Q;  4DV2 Q;  1Y1W G;  1Q86 C;  3HOU B;  4DNI A;  4LF9 L;  3CCS A;  2L1B A;  1WTP A;  4A3E B;  4X64 Q;  1XPO A;  5G3L D;  2M2L A;  4BY1 H;  3HEJ A;  1AW7 A;  4ULL A;  1C48 A;  3S1N H;  4B9X A;  3DWA A;  4P74 A;  4HIK A;  4WJ4 A;  4Y7N H;  2PO4 A;  2VUM H;  1XX8 A;  3S1Q H;  4PZ6 A;  1SRO A;  3A8I E;  4TRD A;  3R3O A;  1YHA A;  4MIU A;  4HSP A;  1CQF A;  2CKZ B;  3TS2 A;  1TS5 A;  3HOW B;  2C5C A;  2ZTD A;  5FK9 C;  2DGY A;  3PUV A;  2C35 B;  2D0O A;  2E2J H;  2LFN A;  4KV6 A;  1Q1E A;  4WFN 3;  1IW7 C;  2HHH Q;  3SE0 A;  3Q23 A;  2JA6 B;  4YIJ A;  3TN2 A;  3MA2 B;  3C46 A;  4XIG S;  3KDF B;  2F4V L;  3FEW X;  3CC2 A;  2A1A A;  4YHH Q;  1SYC A;  1H9M A;  4A3F G;  1X54 A;  4C1N I;  2YU9 B;  1E2V A;  2JXM B;  3I4M B;  1VQ8 A;  3DEP A;  1QOH A;  4DR3 Q;  4AQY Q;  2SOB A;  2B8F A;  2JN4 A;  3NBI A;  2BA0 A;  2ICE C;  2Z6B A;  3G7L A;  5IYB G;  2DJF C;  1Y8N B;  2I07 B;  2RCN A;  3A56 A;  2D2C C;  5J1Z A;  3ZJY C;  3IL8 A;  3PUX A;  4UAI A;  4OO1 I;  1TWC H;  2KEE A;  1EFW A;  4GLX A;  4DK3 C;  3PO2 H;  1WTX A;  1QE6 A;  1CUK A;  2JA9 A;  3LNN A;  4EGV A;  3GTJ H;  3T1Y Q;  2HT1 A;  2EPB A;  4DR6 L;  1XNQ Q;  1U4R A;  3A54 A;  2H5X A;  1VQC A;  1PZI D;  4JI5 Q;  1I6H H;  4MZ9 A;  2B63 H;  2KCT A;  1EOT A;  5ELO A;  2K5H A;  1WTV A;  2ZXP A;  4RHS A;  4HAE A;  1SND A;  2FHT A;  5JEA G;  3S16 H;  1UE7 A;  3JAM c;  3G6J B;  1SR3 A;  1GKH A;  1SE2 A;  1U9R A;  5DLQ E;  3SK4 A;  2F0D A;  2WB1 G;  4DV6 Q;  1Q90 A;  3HOV G;  1XPR A;  1LTA D;  2IJ0 A;  3BVM A;  2YTV A;  3H94 A;  3S2D H;  4IUQ A;  1JB3 A;  1SYB A;  1FD7 D;  1STN A;  2B39 A;  2EOT A;  4BA2 I;  5IE8 A;  3HS0 C;  5HGT A;  2J7Z A;  3FP9 A;  2G9D A;  1A3T A;  2B2W C;  1PDQ A;  3S1M H;  3K58 A;  5J3B A;  2NWG A;  1JR0 D;  5CBA E;  4U68 A;  3OPO A;  4RG1 A;  1R4Q B;  3MEH A;  4KHV A;  2ID0 A;  4DF7 A;  3DHQ A;  4EQP A;  1B50 A;  1Q1B A;  3MTS A;  4GN5 A;  4K6L A;  5C0X J;  1EFI D;  4LUV A;  1SE3 A;  3I4N B;  4H0L C;  2TMP A;  4KMU C;  3J81 c;  2JA8 B;  2AWN A;  5COR A;  5CV8 A;  3S14 H;  1NMF A;  3A55 A;  4JI2 Q;  5FOB B;  1K83 H;  2CCZ A;  1K3B C;  4DR7 L;  4DXG A;  4NXM L;  3PF4 A;  4XQJ A;  5C3E H;  2B2V C;  1PRT B;  1HNZ Q;  2NZ1 D;  2R61 A;  1SNM A;  4DV3 L;  1CK1 A;  4RGN A;  3JAM E;  1QUQ A;  4ZYS A;  3Q22 A;  1HRJ A;  3I4L A;  3TP8 A;  2KED A;  1AZQ A;  5IP7 G;  1K9M C;  3AB9 A;  2BE5 D;  1IBL L;  3T51 B;  1PYS B;  2B2V A;  4C1N K;  3H3V C;  3ERS X;  2EY2 A;  4QQB X;  5KGU A;  2EXD A;  4Q5V A;  5EQ0 A;  4NB3 A;  4B08 A;  5HUR A;  2M00 A;  4A93 B;  1FNU A;  3KJO A;  4O42 A;  1KIX A;  1SE4 A;  4GNX B;  3CRL C;  5EGT A;  4Y52 H;  1P8L A;  3P7J A;  4X6A H;  4XQQ A;  3K5L A;  4JPB W;  2JYO A;  2K04 A;  3NE5 B;  2EQS A;  1J6Q A;  2F3V A;  3T4A C;  3RZO H;  3I4M G;  3MFY A;  3MXP A;  1D2B A;  2PZW A;  4E6I A;  5CMD A;  3BDL A;  1L2F A;  1Y1V H;  1TS2 A;  2LS0 1;  4JI3 Q;  5IWA L;  2OTJ A;  4OWW B;  1NBW A;  3J81 E;  2O5I C;  3RN2 A;  1HR0 W;  4OIK A;  3ULJ A;  4FO2 A;  4HIO A;  4GKJ L;  5BN3 A;  1E1O A;  3GTK H;  3LX0 A;  4LUO A;  1VQH A;  4DUZ Q;  2R92 H;  3KYH C;  1RJT A;  4HJ7 A;  1E24 A;  3ND8 A;  2R7F A;  1YI2 A;  4R9W A;  3VYS A;  4PMC A;  3CCE A;  5BR8 Q;  1MJE A;  4B3R Q;  5T1I A;  2B3G A;  3NK9 A;  3K7A B;  3U58 A;  2EVB A;  1W6K A;  4KKT A;  4R8N A;  3UI2 A;  4LK1 C;  1E2Z A;  1CM9 A;  1I50 B;  5HGQ A;  1JOO A;  2BE5 C;  1C8C A;  4KJO A;  1SMX A;  3T56 B;  3H91 A;  1VQ4 A;  4JI6 Q;  2D9U A;  4A3M H;  3I3C A;  3F1Z A;  1VQ6 A;  1CZW A;  3TP5 A;  4BY7 H;  2PCF B;  4WOR A;  3KUP A;  2RDF A;  1EYG A;  1JJ2 A;  3DWQ A;  3WOF A;  2XWJ B;  2ZT9 C;  2MUY A;  1HUN A;  2F52 A;  3I90 A;  5AJ3 Q;  4N9P A;  4NP5 A;  5M5X B;  4IOA A;  4OO1 G;  1DD2 A;  3J7Y W;  4L6T B;  1OXV A;  4AH6 A;  3CCV A;  2XN9 C;  3TP6 A;  4NXN Q;  1Y8O B;  1SJE D;  1JOR A;  5DNF A;  3S15 H;  1JWM D;  3HOX H;  4I7A A;  4GKK Q;  3H15 A;  3BS1 A;  4IUR A;  2EJF C;  4P72 A;  2OTL A;  1DON A;  1HHV A;  4IPG A;  1CT1 D;  4U67 3;  3PCO B;  3Q0A A;  2C9O A;  1QVG A;  4DUY Q;  2BCO A;  1TY2 A;  4ZLT F;  2CQA A;  5EKL A;  1SNC A;  5DM7 3;  2ATW A;  4QJF A;  4X3T A;  3G71 A;  1V1O A;  1WFQ A;  2NN6 I;  3S2H B;  1DJR D;  4HJ8 A;  3T16 A;  3I4N G;  4GLV B;  2PMZ B;  5IYC H;  1DGS A;  3M3Y H;  3A74 A;  3VYT A;  4LF8 Q;  4KI0 A;  2PNH A;  1STG A;  3NQT A;  4LW1 A;  1Y14 B;  1QCB D;  2V1C C;  1EOV A;  5D14 A;  3UDX A;  4YWM A;  2IX1 A;  2B29 A;  4QF4 A;  3Q8D A;  3CQZ B;  1P16 A;  2L5T A;  4NPS A;  4B3T L;  2K33 A;  1QIL A;  1H9K A;  1U4M A;  2NVQ B;  1MBY A;  2QIL A;  1TWG H;  3RLF A;  1SE8 A;  4A3I G;  1YNJ D;  3H0G G;  2L11 A;  4BS9 A;  1LT3 D;  3HKZ E;  3PMF A;  4JG2 A;  5FO9 B;  1XMQ L;  4BBS B;  2RSO A;  3J80 i;  3GTM B;  5JVG 3;  5GAG C;  2HQL A;  2I5H A;  4FNF A;  1D5M C;  4LFA Q;  1HUM A;  3OWE B;  5JPN C;  3L7Z C;  3BYY B;  3GTQ H;  1BF4 A;  1EU4 A;  4FXG C;  2F0S A;  5IGF A;  5KYL A;  1TY0 A;  3DLL A;  3K80 C;  5D3I B;  1B8A A;  1EL0 A;  1EQV A;  1W2B A;  4OEM B;  4ALP A;  4XDX A;  4C56 C;  4XYO A;  1BVS A;  4CDC C;  4A76 A;  2JE6 I;  4IUU A;  3HP3 A;  4IUN A;  1RKN A;  3AMU A;  5C44 H;  2K5D A;  2QKI C;  1VQA A;  4JVZ A;  1M1K C;  1KRT A;  2Y0S B;  3OTO Q;  4B3M Q;  3HOY H;  1B3A A;  1SYF A;  5A2Q E;  2CH4 W;  4DAM A;  4J6H A;  2PI2 E;  2ZXR A;  3MXG A;  1PRT D;  3V96 A;  1V43 A;  4A3J B;  1BR9 A;  1SYD A;  2G5D A;  4JC0 A;  3AFQ A;  4KTA A;  4F7X A;  4X62 Q;  5M3F H;  4CBV A;  4N9T A;  1LTR D;  4OON A;  1JJC B;  1YNJ C;  1PTO D;  1STY A;  4L5R C;  4PQX A;  1ET9 A;  1QNK A;  1MD2 D;  1X56 A;  1GXD C;  2K50 A;  1PH4 A;  1NR2 A;  1QB5 D;  1SEB D;  2HDL A;  1KLU D;  1EY8 A;  3QG1 A;  4H44 C;  2R7Z H;  2UXD L;  5DEH A;  3VR3 A;  3TZD A;  2L15 A;  2SNM A;  4X3S A;  5J39 A;  3FPU B;  4JK1 C;  3EQL C;  4UP8 A;  4A3D B;  3J7Z C;  5K36 H;  2BA1 A;  3URY A;  2RDG A;  2K5W A;  2GA4 B;  3QIA A;  4MTN A;  3MC0 B;  2NZO A;  2UUC Q;  1DM0 B;  2K5V A;  1AE3 A;  2AUJ D;  2JA7 H;  1L1O C;  4CJ0 B;  5JJL A;  2K28 A;  4CKC A;  5C4X B;  1LYL A;  1LTS D;  4DV7 Q;  4OX9 Q;  3DWP A;  5C0X G;  1A63 A;  2TSS A;  1PMR A;  4JV5 L;  5M3M H;  2EYF A;  2F0V A;  1BO0 A;  3J80 L;  3J7A V;  2MFI A;  3F8T A;  2EYP A;  1L1O A;  4LFC Q;  3PGZ A;  1SNQ A;  3CF5 A;  1LTB D;  4BBR H;  1EY5 A;  1PXU A;  4C2M H;  4KY5 A;  3D6W A;  3KLR A;  3PIO 3;  4RGM A;  1PRT C;  1VQ5 A;  4GN3 B;  2Z9H A;  1TWH H;  1QUQ B;  4QUC A;  4GOP C;  4HIM A;  5NUC A;  1FNW A;  1TWF H;  3NEN A;  3U50 C;  2LMC B;  2F0N A;  3NXW A;  5LHY 1;  5CV4 A;  2ZXO A;  2D0P A;  3L2P A;  4A3G H;  4RGT A;  1PTO C;  2MO1 A;  4L5S A;  2K14 A;  4LAA A;  4L5Q A;  1N33 Q;  1EYD A;  3C2P A;  3HOZ B;  2VQE Q;  1WOC A;  2RA4 A;  4GOP A;  1M4V A;  1EIG A;  1AE2 A;  1V1Q A;  3BZC A;  1IBM L;  4GNX C;  3FKI H;  3V05 A;  1AZP A;  3KJP A;  4B3S Q;  1RIP A;  1S5F D;  1KDC A;  2EDG A;  2WAQ E;  3E0E A;  3TSS A;  4DV5 L;  3EN2 A;  2L0C A;  4ZKC B;  3GDE A;  3RZD H;  2E2H B;  3BZD B;  1N36 L;  1ICF B;  4GNX A;  1N9W A;  2CH4 A;  3RMH A;  5C3X A;  4LF4 Q;  1E1T A;  3E0J A;  1WCM G;  3BZK A;  4DV4 Q;  4X3U A;  1RHP A;  3KBX A;  1QNU A;  3R2I A;  3PIP 3;  3VYR A;  1JB7 A;  4DV1 L;  1I94 Q;  4NMZ A;  3MEF A;  3CME A;  1Y1W H;  1Q3L A;  2PZT A;  4JBK A;  4AYB G;  4JOI C;  2PYK A;  2Q2I A;  1TU2 B;  3X3M A;  2K1B A;  4KHP L;  5M5Y B;  2A6H D;  2VQF L;  3F2B A;  3LWU A;  2RKS A;  1KAB A;  1LTT D;  4WJ3 M;  1KL9 A;  3NHH A;  1DYQ A;  4JOI A;  5EJW A;  3C3L A;  1VQM A;  1V9P A;  1UE6 A;  4BY1 B;  4HSV A;  4X66 Q;  3J7A 5;  4BXX G;  4QCL A;  3CCR A;  2MGS A;  3S1N B;  1IBK Q;  1CKM A;  5M9O A;  1ESR A;  3LGJ A;  4ME5 A;  4Y7N B;  2VXW A;  4XQN A;  4HJA A;  5TSS A;  3S1Q B;  1GHK A;  2R6G A;  2JQO A;  5AFW A;  2PI2 A;  2ZM6 Q;  1VF5 C;  3K7U C;  4X3K A;  1PZK D;  3I7F A;  3QOL A;  4ID6 A;  2F0M A;  1NTG A;  2E2J B;  2H4O A;  4OEL B;  1RL2 A;  1A2U A;  4A3F H;  2DUD A;  5C4J B;  3NBH A;  3RNU A;  3STB D;  3F2C A;  1GHJ A;  1K8G A;  1I4P A;  3ICE A;  2K05 A;  2K4K A;  2SNS A;  1A6X A;  3K57 A;  4QIW E;  4YY3 L;  1R4P B;  2PPB C;  5I2X A;  3M4Q A;  5IYB H;  4LF5 L;  3SXH A;  1EWI A;  2A6H C;  4XTC S;  5ELC A;  4XXE A;  2YTX A;  1PLF A;  2A74 C;  2IT1 A;  2PNR C;  3PO3 G;  1I6V C;  4A3K G;  5CR3 A;  1N34 Q;  3PUW A;  4IUV A;  2DY8 A;  5I9O A;  2XIW A;  2OT2 A;  2BH8 A;  2PW5 A;  3S17 H;  3PO2 B;  5LMN Q;  4Q0F A;  4K14 A;  1S5D D;  5C6A A;  4G4K A;  2FFK B;  3GP7 A;  4EQN A;  5C4H A;  4A3B B;  1HZC A;  3HOZ G;  2HIX A;  2A8V A;  1HPC A;  1I6H B;  1SN8 A;  5ISR A;  1MI2 A;  3EFX D;  4JBM A;  1HZ9 A;  2MPM A;  5JEA H;  3GTO H;  4HID A;  2DNE A;  1EQQ A;  3STB C;  4C3J G;  3HOV H;  2G9H D;  4R4T A;  3IAY A;  3S16 B;  1I5F A;  4IPD A;  2B2T A;  2NVX H;  3NTI A;  4KN4 C;  4IFD H;  1EEF D;  5IGB A;  1WTH A;  1J5E L;  2IW3 A;  2KUM A;  3S2D B;  5IYD G;  1TR5 A;  4KD3 A;  2N55 A;  1SBB B;  4J15 A;  3T13 A;  2AQ2 B;  4X65 Q;  2UUA Q;  3S1M B;  2VB3 X;  1UUP A;  5GAH C;  1GM5 A;  3L9A X;  1CQV A;  3U9S A;  1G2S A;  4DV0 Q;  5IGE A;  1WTW A;  1MGS A;  1HR0 Q;  2AQ3 B;  4K0K L;  2XTI A;  4DAP A;  3PIP A;  1ROD A;  3DXJ C;  1VQN A;  1HH2 P;  3TBI B;  4C3H B;  1H9R A;  2Q8T A;  1K83 B;  1TT2 A;  1X55 A;  1I4H A;  1L0X B;  3IRB A;  3D4D A;  5IP7 H;  5C3E B;  3SK6 A;  2JA5 B;  2K01 A;  4DR1 Q;  4JBJ A;  3ERQ A;  1SSO A;  4LF6 L;  4DAV A;  1L0Y B;  1G6P A;  1K8M A;  1QVF A;  2E2I B;  2NTS A;  3IKJ A;  4DR4 L;  1MSH A;  4KK7 A;  2NVY H;  3KBG A;  4ZK9 B;  5A35 A;  1Q46 A;  2XSC A;  3I91 A;  5EBD A;  4DV2 L;  2F0L A;  3N52 A;  1K73 C;  3I4M H;  3GD7 A;  3GTL H;  1G91 A;  4RKB A;  4X64 L;  4DFA A;  4DR2 L;  1PH7 A;  2CFM A;  3EVQ A;  1FVI A;  3RZO B;  1Q8K A;  5KRU A;  2ALY B;  3MXN B;  4LFB Q;  5IOC A;  1L1O B;  2N3S A;  1HXY D;  1ENC A;  2X69 A;  1Y1V B;  1U4P A;  3HOU G;  1LT6 D;  4I65 A;  1N32 Q;  1W6J A;  4A3E G;  2Z0S A;  1K3R A;  3QR8 A;  4AIM A;  3GTK B;  1M8A A;  1JOQ A;  4JI1 Q;  3SHL A;  2RF4 A;  5JPM C;  2R92 B;  3U4V A;  1B1Z A;  5I4D A;  4WRD A;  3KLS X;  1VQO A;  5COY A;  1BQQ T;  3D0F A;  4GOP B;  1S5E D;  5CV6 A;  3D4R A;  2VB2 X;  2HHH L;  1PTO B;  4DPG A;  2LXJ A;  3FVQ A;  3HOW G;  5E4W C;  4A3B G;  1TWA H;  1JCK B;  4YHH L;  4EX5 A;  1ILP A;  1IKL A;  5KYI A;  4KHZ A;  3O13 A;  4IO9 A;  3GTG H;  3RUZ A;  2V4D A;  2NYZ D;  4JI0 Q;  2JA6 G;  4IZ8 A;  4BY7 B;  4FP5 D;  4DR3 L;  4AQY L;  3CPF A;  5LL6 S;  1ILQ A;  1I4G A;  1YVC A;  5EKI A;  4OO1 H;  4H13 C;  1Y69 U;  3HKZ B;  3VA5 A;  2VS1 A;  3QJY A;  1OXT A;  5IGC A;  1GUS A;  1E7Z A;  5LMU Q;  3KF8 A;  1MSG A;  1Z47 A;  4V0B A;  1GOZ A;  4KKS A;  4MNO A;  4JYA Q;  3T1Y L;  1X65 A;  3OSO A;  4B9W A;  1EY6 A;  3S15 B;  1IYV A;  1FJG Q;  1II3 A;  1KNA A;  3HOX B;  3MWY W;  1XNQ L;  4K2L A;  2VL6 A;  2FMC A;  3RLN A;  4JI4 Q;  4JI5 L;  3BG3 A;  2AUK A;  3VR4 A;  4ABN A;  1F77 A;  4JI8 Q;  4EVO A;  1BBW A;  1OXU A;  4RCN A;  3I4O A;  1VDZ A;  1VQF A;  4KJN A;  1A3U A;  1X3G A;  2VNU D;  1BCP D;  3TME A;  1ONL A;  3I56 A;  3W1G A;  5FO7 B;  4C3H G;  1BDO A;  1PH2 A;  2F0U A;  1DOK A;  1GUO A;  3M3Y B;  4DV6 L;  3G48 A;  1I4R A;  1DCZ A;  2Z4I A;  4JW0 A;  5C3E G;  3ULL A;  2FIN B;  4P71 A;  3NP8 A;  1B44 D;  1A3V A;  1Z9F A;  3FPP A;  3T1H L;  2JA5 G;  2K52 A;  2A19 A;  2ZTE A;  1VQD A;  4A3I H;  3H0G H;  1HNW Q;  1G51 A;  2D62 A;  3BJU A;  2F0P A;  1F9S A;  3NBH B;  2WIN B;  3E6Z X;  1TWG B;  2EY6 A;  2CWP A;  2OCE A;  3BYT B;  5ELF A;  3CP0 A;  2NVT H;  2B2U C;  1HNX L;  4KN7 C;  2SDF A;  1KXL A;  1O7Y A;  2I46 A;  2EYM A;  1IYJ B;  4LF7 Q;  2F0O A;  1B9N A;  3M85 A;  1EIH A;  4CJ2 C;  3K5O A;  4ZUI A;  2B2U A;  4IUT A;  2IX3 A;  3R93 A;  1FL0 A;  1QVC A;  2J0T D;  1H9J A;  5E1F A;  4DAY A;  1MIU A;  2F0Q A;  4IPC A;  3K59 A;  4JI2 L;  3ITP A;  4FXD A;  2BDO A;  2F1M A;  3HRZ C;  4DNR B;  1IL8 A;  1VQP A;  3RR5 A;  1HNZ L;  4UY8 C;  4DK6 C;  2F03 A;  2JA8 G;  3S9W A;  1BCP C;  3CC4 A;  5C44 B;  2X6G A;  1GUW A;  2O2L D;  3VDY A;  3Q6S A;  3CCU A;  1RTO A;  2IX0 A;  3HOY B;  1A15 A;  4LUZ A;  5JJK A;  1DOL A;  2OQK A;  1UE5 A;  2R7D A;  3GO5 A;  3HFZ B;  1ML0 D;  2WKD A;  1D7Q A;  1PYB A;  2OWO A;  2UU9 L;  2Q2U A;  5F2D A;  3CMA A;  2UXC L;  2MP1 A;  5IIF A;  5JJZ A;  2BDN A;  2CW0 C;  4DR5 Q;  1AH9 A;  1PVO A;  1KNE A;  1RD9 D;  4A3C G;  2HUG A;  4A93 G;  1K8A C;  1EQT A;  5I2Y A;  3MVV A;  2XWB B;  1EWC A;  1E3P A;  3J80 c;  4UHV A;  1R9T B;  4JI3 L;  3UDG A;  2F0K A;  2WAQ B;  1SJH D;  1MHW C;  3SEB A;  2R7Z B;  2QEX A;  2JEB I;  1HA6 A;  3ZYY X;  1VQL A;  2F3I A;  2L12 A;  4A3L G;  2R93 B;  5G3L F;  1SNP A;  1C0A A;  2K32 A;  1D1K A;  3L0O A;  4DUZ L;  4JI7 Q;  1CZG A;  3ND9 A;  1WD0 A;  3A0J A;  1SYG A;  3G6E A;  3M7N A;  2JJQ A;  5BR8 L;  2F3W A;  5C0X H;  2RCF A;  3HGB A;  1MKH A;  5ELD A;  2JA7 B;  5C5L A;  3CRK C;  1WVL A;  4PNY A;  2ZJQ A;  2RHQ B;  1ET6 A;  5M3M B;  4JI6 L;  3W5O A;  1PFS A;  3CCJ A;  3OMG A;  4BBR B;  2MJ8 A;  1EWH A;  4H02 A;  4C2M B;  1UNS A;  2XGT A;  1SRU A;  2E5L Q;  1TWH B;  1TQO A;  1KQS A;  1XNR Q;  1TWF B;  1EY0 A;  5C3W A;  3J80 E;  2A73 B;  1STH A;  5AJ3 L;  1PH6 A;  1H9S A;  3AFP A;  3BDO A;  3CPW A;  1QZH A;  1CTM A;  2UUB Q;  4NXN L;  4L63 B;  4TVA B;  1KD1 C;  1G6Z A;  1X3E A;  2A69 C;  3FKI B;  4N8F A;  4YWL A;  5LL6 X;  4XT1 B;  3GV3 A;  3MAQ A;  4GKK L;  4IQZ A;  4UPA A;  4V19 0;  1Q81 C;  1WCM H;  3Q24 A;  2MQH A;  5JEA J;  2ZTC A;  4DUY L;  4KD4 A;  1BOS A;  2KA7 A;  1KDB A;  3E9I A;  1HFN A;  4HN7 A;  1B53 A;  1JE4 A;  2DN8 A;  1WYD A;  4QIW B;  1TS3 A;  3FRP B;  1MJC A;  5E3F A;  1RTN A;  3MXN A;  4IFD J;  3E5S A;  2HDM A;  3T53 B;  3OWF A;  4LF8 L;  1HA5 A;  1Y1W B;  3K5N A;  3OIQ A;  2UXB Q;  2F0W A;  1PZJ D;  1GUN A;  1SDF A;  3MXU A;  1TS4 A;  3M4O H;  1W3S A;  1HFG A;  1KAA A;  2JSO A;  1V8Q A;  2EY1 A;  4RA8 A;  4UP9 A;  4CDE C;  1WTR A;  4BXX H;  1VQG A;  3D3R A;  5IT9 L;  5CGK A;  1B3Q A;  2PQA A;  2ICI A;  1DXM A;  3KLS A;  4LF9 Q;  1DZ1 A;  5CBE E;  3E9H A;  4HJ9 A;  2GVA A;  1NR4 A;  2EYO A;  1YHQ A;  1D8L A;  2X6L A;  2Q8R E;  1FR3 A;  5I6Y A;  4M1U B;  4LFA L;  3J7A F;  2K75 A;  2RVL A;  4RAU C;  5EAY A;  3TS0 A;  4LJZ C;  1JWS D;  4FXK C;  5KNC A;  1B4O A;  3SR1 A;  4UDU C;  2KCC A;  4OWX B;  1XTD A;  2EJG C;  4BBS G;  3TP7 A;  4ME3 A;  3D4W A;  1PFN A;  3KF8 B;  2KQ3 A;  1LUZ A;  3QWN A;  2A68 D;  5JAV A;  1EIF A;  1JJG A;  4F87 A;  4OIJ A;  4A3F B;  2NN6 G;  3MFG A;  3KFU A;  4DGZ A;  4C3I H;  2R93 G;  2F0F A;  2JK8 A;  1QG7 A;  3UDF A;  1NSN S;  3OTO L;  2F4V Q;  4B3M L;  4AYB E;  2DY7 A;  3PO3 H;  5D65 A;  3K6O A;  1F9P A;  2OQ0 A;  4A3K H;  1PHJ A;  4IJL A;  4G7H C;  2L55 A;  2Y0S G;  3M9B A;  2NTT A;  1WI5 A;  1ZEQ X;  4X62 L;  2LSS A;  2LKV A;  4IFD I;  1EEI D;  1NMG A;  1LTI D;  3UE1 A;  1F9R A;  1YIT A;  3CCL A;  4F8M A;  4N8X 1;  4LNQ A;  2VUM B;  1ASY A;  4A3J G;  5I6W A;  3S17 B;  1D5X C;  1F2M A;  2OXP A;  5FLX L;  2NBF A;  3NSW A;  4NW2 A;  4H7B A;  4CKE A;  4G7Z C;  1PA6 A;  2NUC A;  3HOZ H;  1Q7Y C;  5I9P A;  1TXY A;  3NEL A;  1IZ6 A;  2MHV A;  1HZB A;  1STB A;  4DR6 Q;  1LO5 D;  1YJW A;  3M7G A;  4XYQ A;  3VR6 A;  2EE1 A;  1U4L A;  3X3N A;  2A68 C;  4C3J H;  2MNA A;  3VA7 A;  3H3V H;  2WP8 J;  2UUC L;  1UEB A;  3TRZ A;  4PG3 A;  1VQ7 A;  4A3D G;  4QB4 A;  2WB1 B;  1C9O A;  4DV7 L;  1NAP A;  4OL7 A;  4OX9 L;  3HOV B;  3PSI A;  3S1R H;  2E2D C;  2NVX B;  1UEA B;  5M5W H;  5IYD H;  4DAY B;  2AQ1 B;  4LFC L;  4ZRZ A;  2HCC A;  5C4X G;  3BVZ A;  4ODG A;  3RN5 A;  1HTL D;  1LT4 D;  1BKB A;  4HCS A;  2RHS B;  1TWC B;  1AEX A;  4TSS A;  2I5L X;  1X3P A;  5FJ8 G;  4DNT B;  2N8N A;  1CA6 A;  1FGB D;  2CHB D;  1H95 A;  1N33 L;  2Q2T A;  4CJ1 B;  1KTK A;  2VQE L;  1YHB A;  1LAB A;  2K5Q A;  3GTJ B;  1X3Q A;  1C7Y A;  4ILW A;  4KY7 A;  1BCP B;  1XJV A;  2J4X A;  3BU2 A;  4DR2 Q;  3C1F A;  3GTP H;  4RH6 A;  4CKB A;  1I3Q H;  2EYJ A;  3QO2 A;  4HED A;  4PMB A;  2IHE A;  1CKO A;  1KAW A;  1TVX A;  3WDN A;  4B3S L;  1JQY D;  5EPL A;  2QEJ C;  1PH5 A;  2B63 B;  4QMG A;  2E8G A;  2B2T C;  3EIV A;  2ZJP A;  5FLM G;  3PIO A;  5GAE C;  2L4N A;  1YJ9 A;  1EU3 A;  2DNC A;  1D1I A;  2CVR A;  5GQO A;  4DR7 Q;  4LF4 L;  4Z9C B;  4NXM Q;  1VQE A;  2E74 C;  4DV4 L;  2BH2 A;  1FYC A;  2E75 C;  2NB0 A;  1SFO H;  4DV3 Q;  1J8I A;  5IP9 G;  1GD7 A;  2B8G A;  1PH1 A;  1B70 B;  1I94 L;  3GV6 A;  4RKL A;  1NUC A;  3K81 C;  3OOC A;  1VCI A;  5DM6 3;  1IBL Q;  5C4J H;  3I2Z A;  4CDF C;  3JC6 6;  1S5B D;  2NVY B;  2XNA C;  3HKS A;  1LTL A;  1Q12 A;  1V1P A;  3F2D A;  4KKU A;  1S40 A;  1Z6H A;  4MN3 A;  3GTL B;  1S5C D;  3HOU H;  1D5Z C;  1F9Q A;  4A3E H;  4X66 L;  4PMW A;  1GUG A;  5KEE A;  4IN3 A;  1A8V A;  4K8I A;  1IBK L;  2YYZ A;  2Z6K C;  2I5M X;  3BVG A;  2RSN A;  2AMC B;  1JMC A;  1O7I A;  2CWA A;  1SXT A;  5IWA Q;  5KNB A;  3UDI A;  4BY1 G;  2JEA I;  3S14 B;  2HCI A;  4BWG B;  4RMF A;  1G29 1;  3OMC A;  2Z6K A;  3K8A A;  1E2W A;  5CC4 A;  2ZM6 L;  4GKJ Q;  1UE1 A;  1H9S B;  2VUM G;  3CW2 C;  3HOW H;  4A3B H;  5D3D A;  3K0X A;  4P2C B;  4TQU S;  1EY4 A;  4HJ5 A;  4OHJ A;  1FGU A;  5CV9 A;  3SK5 A;  2VW9 A;  1TWA B;  2WB1 E;  2KCN A;  2JA6 H;  4XT3 B;  5ELE A;  1VQ9 A;  1LV9 A;  1YBY A;  4WJW A;  3GTG B;  1D6E C;  1XMO L;  1SAP A;  2FJ2 A;  2RQX A;  1GO3 E;  2YU9 H;  4OXP A;  3JAM i;  3OIP A;  3J81 j;  1CHP D;  3EBE A;  4YWK A;  3OYY A;  3NTH A;  5JVH 3;  4K8J A;  4BA1 I;  2QCP X;  1N34 L;  4K5V A;  5KIX A;  1HTP A;  5T1G A;  3T1H Q;  4IFD G;  2E76 C;  4NKL A;  3IFT A;  3HG9 A;  1LM0 A;  3ERO A;  1CKN A;  1NCV A;  5DAU A;  3C1E A;  4TKO B;  5LMN L;  2XVS A;  3N6R A;  1PRT F;  2KHI A;  1A0I A;  2O4X A;  4YCV A;  3L3O C;  3RD4 A;  2K7V A;  1KLG D;  1PTO F;  2CQO A;  5LMN W;  1YIJ A;  1HNX Q;  3PO2 G;  1JC7 A;  2PQA B;  3GQB A;  5ELN A;  1ICW A;  4PV1 C;  1U5K A;  2B2W A;  4RFB A;  2K03 A;  2AKW B;  1PH8 A;  5HY6 A;  1BBU A;  2HD3 A;  3B6Y A;  3I8Z A;  5GAD C;  3J81 i;  1PV4 A;  1M90 C;  3P20 A;  2F0E A;  1ESF A;  3A5U A;  4ZUJ A;  4C3H H;  1OXS C;  3PUZ A;  4UP7 A;  4YCU A;  4GLA C;  4A3M B;  2LXK A;  2OF1 A;  2EYH A;  3CD6 A;  2B63 G;  3K0Y A;  1UWV A;  1XYI A;  3PV0 A;  1E0B A;  3DUZ A;  3A5Z B;  2IWH A;  1BUV T;  2JA5 H;  3SGI A;  1X6O A;  1HJP A;  4RHR A;  2ES2 A;  1B7Y B;  1RCV D;  4A3I B;  3H0G B;  2HIV A;  3E3X A;  2E2I H;  4IJH A;  4J1M A;  2FMM A;  2PZU A;  3TEH B;  4FYD A;  4X65 L;  2UUA L;  3VYU A;  4KLK A;  3VR5 A;  4B3T Q;  4QL5 A;  2Z1C A;  2UU9 Q;  2NVT B;  2KCM A;  2WII B;  2UXC Q;  2I0Q A;  3FDT A;  1WD1 A;  1EQR A;  1AN8 A;  4FVM A;  3U9O A;  5J22 A;  4DV0 L;  1XMQ Q;  1EIY B;  2YTY A;  1HR0 L;  1Y8P B;  4M8A A;  4JCV E;  4DXF A;  2P5Z X;  1AP0 A;  1HCZ A;  3A7A B;  1EZ8 A;  3JAM L;  1JIC A;  5KND A;  3A8K E;  3I4N H;  1KC8 C;  2RBM A;  4FF3 A;  2JA8 H;  4LMQ D;  3CC7 A;  2AWO A;  1O7Z A;  5FKA C;  1K0S A;  1I4Q A;  3ER0 A;  2AHO B;  2F4I A;  2EIF A;  3DEO A;  2QDB A;  3WOE A;  1YJN A;  1HQM C;  4LWC A;  3TDQ A;  4DR1 L;  5CYU A;  3PF5 A;  1IHZ A;  4O0A A;  1F2Y A;  2Q8I B;  2MO0 A;  1CSP A;  1T9H A;  1PH9 A;  1JT8 A;  3NUC A;  5CV7 A;  3OHX C;  1UAP A;  1PYW D;  3I72 A;  2A6E D;  1PTO H;  4HMI A;  4R4I A;  1EY9 A;  5EPK A;  1RDP D;  1ZKO A;  5C0X I;  4R4C A;  3R2T A;  2EY5 A;  4QY7 A;  4DA2 A;  2KVM A;  3SK8 A;  5BN5 A;  4DKA C;  4APV A;  3I70 A;  1VMC A;  1Q8I A;  2CW0 D;  4A3C H;  4A93 H;  2GN5 A;  1GVP A;  3G4S A;  1EYA A;  4GN4 B;  3TRE A;  3J81 L;  2GVB A;  5IY0 A;  4K5W A;  1ZXT A;  1ZYR D;  4LFB L;  3SDZ A;  3OW7 A;  1QZG A;  3EJI A;  4A3L H;  3W3A A;  5C5M A;  3KF6 A;  1N32 L;  3GTQ B;  3PUY A;  3S24 A;  3DMU A;  2H1E A;  3NPP A;  4DK0 A;  1XPU A;  2O5J C;  5JJI A;  4ZKB B;  2UXD Q;  4GZY C;  4RCO A;  2QF7 A;  4JI1 L;  1Y1V G;  2FXQ A;  2RDH A;  2Q2H A;  2F0H A;  4POG A;  3A7L A;  1TKW B;  3F2U A;  3NTK A;  4MTK A;  1O7L A;  2NZH A;  1EZ6 A;  4FF2 A;  4O1N A;  1IYU A;  1A2T A;  2R92 G;  1B9M A;  4ZCK A;  3D31 A;  3K7A H;  2KBN A;  1HZA A;  2A6E C;  1I50 H;  4GS3 A;  3U4Z A;  4DN4 M;  1FNV A;  1X32 A;  1CSQ A;  1GUT A;  1KDA A;  1WJJ A;  4O2D A;  3SVM A;  4JV5 Q;  5EPJ A;  4JI0 L;  4G7O C;  3AU7 A;  3NQI A;  1N8R C;  2WFW A;  1F2L A;  1Z7T A;  4DU9 A;  5M3F B;  4P73 A;  2B2Y C;  1B2T A;  4A3M G;  2VZA A;  1L0W A;  5GRO A;  2K5N A;  5LMU L;  4BY7 G;  1LT5 D;  2F0I A;  1ZYR C;  1K0R A;  1VMP A;  2B2Y A;  5M5X H;  3HKZ G;  4QUF A;  4S3S A;  4JYA L;  2A69 D;  1V1P B;  4CGY B;  1CFM A;  2D5D A;  3IFD A;  1FJG L;  5H1S E;  1O80 A;  4R1J A;  1IBM Q;  3KDF A;  3PQI A;  4POF A;  5IGD A;  4A75 A;  5IT9 c;  4B3R L;  1WCM B;  4JI4 L;  2IHF A;  2KEC A;  1SYE A;  1YZ6 A;  3CXC A;  1I4X A;  2VY3 A;  4DV5 Q;  3HOX G;  2XRS D;  5CV5 A;  4JI8 L;  4JBW A;  1N36 Q;  4J8Q A;  2KJX A;  2DJG C;  4PZ7 A;  3CCM A;  2ENB A;  4IPH A;  1HQR D;  4AYB B;  1LLR D;  4KY6 A;  3S2H H;  2K6A A;  1X3F A;  1DOM A;  1PFM A; 
#chains in the Genus database with same CATH homology
 2WKC A;  1OO9 B;  3M4O B;  4A3G B;  3H09 A;  2XRQ D;  3K5M A;  1G8Z D;  4OGQ C;  3I73 A;  2EJM A;  2EZV A;  3ONA B;  5BN4 A;  4EQO A;  4K5X A;  1WTO A;  2Z8L A;  4IUP A;  3BDC A;  5IT9 E;  2IL8 A;  1JWU D;  1O78 A;  1XTC D;  4MHE A;  3R8B A;  3RZD B;  3MHB A;  2EYL A;  2NN6 H;  1BXT A;  1F2Z A;  3KK7 A;  2PW7 A;  1LTG D;  1QJO A;  2SEB D;  2L9H A;  3H6M A;  1IKM A;  1EY7 A;  5A2Q L;  1BNZ A;  4C3I B;  2A5H A;  1JOK A;  2R3Z A;  3CU7 A;  4FF4 A;  1T5X D;  5ELB A;  1XWE A;  2OEO A;  2F0G A;  4F88 A;  5FO8 B;  3PO3 B;  2Z4H A;  1SNO A;  4A3K B;  3D6C A;  4CHT B;  1SMY D;  2IPK D;  3A8J E;  3M4Y A;  1OXX K;  1CHQ D;  2KOL A;  1RF2 D;  1GJX A;  3P1H A;  4HR7 B;  1CI3 M;  4HCE A;  1VF7 A;  5E4X A;  1QWY A;  4L8J A;  1S4Z A;  2PQE A;  3CHB D;  2WV6 D;  5IGG A;  1YNN D;  5FLX E;  2LY7 A;  4C3J B;  5C4Z A;  3QOJ A;  5EKK A;  2F0J A;  2KHS A;  3MZ5 A;  5K36 G;  1C4Q A;  4K6D A;  4G57 A;  2F0T A;  3S1R B;  2N88 A;  5IOD A;  1ENA A;  5M5W B;  1LAC A;  2HQE A;  4DK1 A;  1AFP A;  1J9O A;  3NWT A;  1ENF A;  1SMY C;  3VR2 A;  3TZU A;  4IAL A;  3EA6 A;  1WTQ A;  4ZQ3 A;  3GTP B;  1EYC A;  4RWS C;  1STA A;  2WAC A;  1I3Q B;  1T5E A;  1K8O A;  4RGO S;  4NDX A;  1STE A;  3QB3 A;  5JOB A;  1XXG A;  1YNN C;  3GTO B;  2M9V A;  3FMC A;  3LWE A;  4HTH A;  3DM1 A;  3CKI B;  3P75 A;  4HMJ A;  4R8I A;  3V2T A;  3NWS A;  4K2K A;  1SFO B;  5EBC A;  1BBX C;  1IW7 D;  2BOS A;  1PFB A;  3HZX A;  1G2T A;  2JP1 A;  1TII D;  1CA5 A;  5K5P A;  2EXZ A;  3W2D A;  4ZAI A;  4FF1 A;  3D8G A;  1BCP F;  4C3I G;  4I7Z C;  3HOU B;  2L1B A;  1WTP A;  4A3E B;  5G3L D;  2M2L A;  3HEJ A;  1AW7 A;  4ULL A;  1C48 A;  4B9X A;  3DWA A;  2PO4 A;  1XX8 A;  3A8I E;  4TRD A;  3R3O A;  4MIU A;  4HSP A;  1CQF A;  1TS5 A;  3HOW B;  2C5C A;  5FK9 C;  3PUV A;  2LFN A;  4KV6 A;  1Q1E A;  4WFN 3;  1IW7 C;  3SE0 A;  3Q23 A;  2JA6 B;  4YIJ A;  3TN2 A;  3MA2 B;  3C46 A;  4XIG S;  3FEW X;  1SYC A;  1H9M A;  4C1N I;  2YU9 B;  1E2V A;  2JXM B;  3I4M B;  3DEP A;  1QOH A;  2SOB A;  2B8F A;  3NBI A;  2BA0 A;  2ICE C;  3G7L A;  1Y8N B;  2I07 B;  3A56 A;  2D2C C;  5J1Z A;  3IL8 A;  3PUX A;  4UAI A;  4OO1 I;  2KEE A;  1WTX A;  1QE6 A;  3LNN A;  4EGV A;  2EPB A;  1U4R A;  3A54 A;  1PZI D;  1EOT A;  1WTV A;  2ZXP A;  4RHS A;  4HAE A;  1SND A;  2FHT A;  5JEA G;  3G6J B;  1SE2 A;  1U9R A;  3SK4 A;  2F0D A;  1Q90 A;  1LTA D;  2IJ0 A;  3BVM A;  3H94 A;  4IUQ A;  1JB3 A;  1SYB A;  1FD7 D;  1STN A;  2B39 A;  2EOT A;  4BA2 I;  3HS0 C;  5HGT A;  2J7Z A;  2G9D A;  1A3T A;  2B2W C;  1PDQ A;  3K58 A;  2NWG A;  5CBA E;  1JR0 D;  4U68 A;  3OPO A;  1R4Q B;  3MEH A;  4KHV A;  2ID0 A;  4DF7 A;  3DHQ A;  4EQP A;  1B50 A;  1Q1B A;  3MTS A;  4K6L A;  5C0X J;  1EFI D;  1SE3 A;  3I4N B;  4H0L C;  2TMP A;  4KMU C;  2JA8 B;  2AWN A;  5COR A;  5CV8 A;  3A55 A;  5FOB B;  4DXG A;  4XQJ A;  2B2V C;  1PRT B;  2NZ1 D;  2R61 A;  1SNM A;  1CK1 A;  4RGN A;  3JAM E;  4ZYS A;  3Q22 A;  1HRJ A;  3I4L A;  3TP8 A;  2KED A;  1AZQ A;  3AB9 A;  2BE5 D;  3T51 B;  2B2V A;  4C1N K;  3H3V C;  2EY2 A;  5KGU A;  4Q5V A;  5EQ0 A;  4B08 A;  5HUR A;  2M00 A;  4A93 B;  1FNU A;  4O42 A;  1SE4 A;  3CRL C;  5EGT A;  3P7J A;  4XQQ A;  3K5L A;  2JYO A;  2K04 A;  3NE5 B;  2F3V A;  3T4A C;  3MFY A;  3MXP A;  1D2B A;  2PZW A;  4E6I A;  5CMD A;  3BDL A;  1TS2 A;  2LS0 1;  3J81 E;  2O5I C;  4OIK A;  4FO2 A;  5BN3 A;  3LX0 A;  1RJT A;  3ND8 A;  4R9W A;  3VYS A;  4PMC A;  5T1I A;  3NK9 A;  3K7A B;  2EVB A;  1W6K A;  4KKT A;  4R8N A;  3UI2 A;  4LK1 C;  1E2Z A;  1CM9 A;  1I50 B;  1JOO A;  2BE5 C;  1C8C A;  4KJO A;  3T56 B;  3H91 A;  2D9U A;  3I3C A;  1CZW A;  3TP5 A;  2PCF B;  4WOR A;  3KUP A;  2RDF A;  3DWQ A;  3WOF A;  2XWJ B;  2ZT9 C;  2MUY A;  1HUN A;  3I90 A;  4N9P A;  4NP5 A;  5M5X B;  4OO1 G;  1DD2 A;  3J7Y W;  4L6T B;  1OXV A;  2XN9 C;  3TP6 A;  1Y8O B;  1SJE D;  1JOR A;  5DNF A;  1JWM D;  3BS1 A;  4IUR A;  2EJF C;  1DON A;  1HHV A;  1CT1 D;  4U67 3;  3Q0A A;  2C9O A;  2BCO A;  1TY2 A;  4ZLT F;  2CQA A;  5EKL A;  1SNC A;  5DM7 3;  4X3T A;  1V1O A;  2NN6 I;  3S2H B;  1DJR D;  3T16 A;  2PMZ B;  3VYT A;  4KI0 A;  1STG A;  3NQT A;  1QCB D;  5D14 A;  2IX1 A;  4QF4 A;  3CQZ B;  2L5T A;  2K33 A;  1QIL A;  1H9K A;  1U4M A;  2NVQ B;  1MBY A;  2QIL A;  3RLF A;  1YNJ D;  2L11 A;  4BS9 A;  1LT3 D;  3PMF A;  5FO9 B;  4BBS B;  2RSO A;  3GTM B;  5JVG 3;  4FNF A;  1D5M C;  1HUM A;  3OWE B;  5JPN C;  3L7Z C;  3BYY B;  1BF4 A;  1EU4 A;  4FXG C;  2F0S A;  5IGF A;  5KYL A;  1TY0 A;  5D3I B;  1EL0 A;  1EQV A;  4XDX A;  4C56 C;  4XYO A;  2JE6 I;  4IUU A;  3HP3 A;  4IUN A;  1RKN A;  3AMU A;  2K5D A;  2QKI C;  2Y0S B;  1B3A A;  1SYF A;  5A2Q E;  4J6H A;  2ZXR A;  3MXG A;  1PRT D;  3V96 A;  1V43 A;  4A3J B;  1BR9 A;  1SYD A;  4F7X A;  4KTA A;  4CBV A;  4N9T A;  1LTR D;  1YNJ C;  1PTO D;  1STY A;  4PQX A;  1ET9 A;  1QNK A;  1MD2 D;  1GXD C;  1NR2 A;  1QB5 D;  1SEB D;  2HDL A;  1KLU D;  1EY8 A;  3QG1 A;  4H44 C;  5DEH A;  3VR3 A;  3TZD A;  2SNM A;  4X3S A;  5J39 A;  3FPU B;  4JK1 C;  3EQL C;  4A3D B;  5K36 H;  2BA1 A;  3URY A;  2RDG A;  2K5W A;  2GA4 B;  3QIA A;  3MC0 B;  1DM0 B;  2AUJ D;  4CJ0 B;  2K28 A;  4CKC A;  5C4X B;  1LTS D;  3DWP A;  5C0X G;  2TSS A;  1PMR A;  2EYF A;  2F0V A;  1BO0 A;  3J80 L;  3J7A V;  2EYP A;  1SNQ A;  1LTB D;  1EY5 A;  1PXU A;  4KY5 A;  3D6W A;  3KLR A;  3PIO 3;  4RGM A;  1PRT C;  4QUC A;  5NUC A;  1FNW A;  2LMC B;  2F0N A;  3NXW A;  5LHY 1;  5CV4 A;  2ZXO A;  4RGT A;  1PTO C;  4LAA A;  3HOZ B;  1EYD A;  3C2P A;  2RA4 A;  1M4V A;  1EIG A;  3V05 A;  1AZP A;  1S5F D;  1KDC A;  2EDG A;  3TSS A;  4ZKC B;  2L0C A;  2E2H B;  3BZD B;  3RMH A;  5C3X A;  3E0J A;  4X3U A;  1RHP A;  3KBX A;  1QNU A;  3R2I A;  3PIP 3;  3VYR A;  4NMZ A;  1Q3L A;  2PZT A;  2PYK A;  1TU2 B;  3X3M A;  2K1B A;  5M5Y B;  2A6H D;  3LWU A;  2RKS A;  1KAB A;  1LTT D;  3NHH A;  1DYQ A;  5EJW A;  3C3L A;  4BY1 B;  4HSV A;  4QCL A;  2MGS A;  3S1N B;  5M9O A;  1ESR A;  4Y7N B;  4ME5 A;  2VXW A;  4XQN A;  5TSS A;  3S1Q B;  1GHK A;  2R6G A;  5AFW A;  1VF5 C;  4X3K A;  1PZK D;  3QOL A;  4ID6 A;  2F0M A;  2E2J B;  2H4O A;  1A2U A;  5C4J B;  3NBH A;  1GHJ A;  1I4P A;  2K05 A;  2SNS A;  1A6X A;  3K57 A;  1R4P B;  2PPB C;  5I2X A;  3SXH A;  2A6H C;  5ELC A;  4XXE A;  4XTC S;  1PLF A;  2A74 C;  2IT1 A;  2PNR C;  1I6V C;  5CR3 A;  3PUW A;  4IUV A;  2DY8 A;  5I9O A;  2XIW A;  2OT2 A;  2PW5 A;  3PO2 B;  4Q0F A;  4K14 A;  1S5D D;  5C6A A;  4G4K A;  2FFK B;  3GP7 A;  4EQN A;  5C4H A;  4A3B B;  1HPC A;  1I6H B;  5ISR A;  1MI2 A;  3EFX D;  2MPM A;  5JEA H;  2DNE A;  4C3J G;  2G9H D;  3IAY A;  3S16 B;  2B2T A;  3NTI A;  4KN4 C;  4IFD H;  1EEF D;  5IGB A;  2IW3 A;  2KUM A;  3S2D B;  1TR5 A;  4KD3 A;  2N55 A;  1SBB B;  3T13 A;  2AQ2 B;  3S1M B;  2VB3 X;  1UUP A;  3L9A X;  1CQV A;  3U9S A;  1G2S A;  5IGE A;  1WTW A;  1MGS A;  2AQ3 B;  4DAP A;  1ROD A;  3DXJ C;  3TBI B;  4C3H B;  1H9R A;  2Q8T A;  1K83 B;  1TT2 A;  1I4H A;  1L0X B;  3D4D A;  5C3E B;  3SK6 A;  2JA5 B;  2K01 A;  3ERQ A;  1SSO A;  4DAV A;  1L0Y B;  1K8M A;  2E2I B;  2NTS A;  3IKJ A;  1MSH A;  4KK7 A;  3KBG A;  4ZK9 B;  5A35 A;  2XSC A;  3I91 A;  5EBD A;  2F0L A;  3N52 A;  3GD7 A;  1G91 A;  4RKB A;  4DFA A;  3EVQ A;  3RZO B;  5KRU A;  5IOC A;  1HXY D;  1ENC A;  2X69 A;  1Y1V B;  1U4P A;  1LT6 D;  4I65 A;  1W6J A;  3GTK B;  1M8A A;  1JOQ A;  3SHL A;  5JPM C;  2R92 B;  1B1Z A;  5I4D A;  4WRD A;  3KLS X;  5COY A;  1BQQ T;  1S5E D;  5CV6 A;  3D4R A;  2VB2 X;  1PTO B;  3FVQ A;  5E4W C;  1JCK B;  1ILP A;  1IKL A;  5KYI A;  4KHZ A;  3O13 A;  3RUZ A;  2V4D A;  2NYZ D;  4IZ8 A;  4BY7 B;  4FP5 D;  5LL6 S;  1ILQ A;  1I4G A;  5EKI A;  4OO1 H;  4H13 C;  1Y69 U;  3HKZ B;  3VA5 A;  3QJY A;  1OXT A;  5IGC A;  1GUS A;  3KF8 A;  1MSG A;  1Z47 A;  4V0B A;  1GOZ A;  4KKS A;  3OSO A;  4B9W A;  1EY6 A;  3S15 B;  1IYV A;  1II3 A;  1KNA A;  3HOX B;  3MWY W;  4K2L A;  2FMC A;  3BG3 A;  2AUK A;  3VR4 A;  4ABN A;  1F77 A;  4EVO A;  1OXU A;  4RCN A;  1VDZ A;  4KJN A;  1A3U A;  2VNU D;  1BCP D;  3TME A;  1ONL A;  5FO7 B;  4C3H G;  1BDO A;  2F0U A;  1DOK A;  1GUO A;  3M3Y B;  1I4R A;  1DCZ A;  2Z4I A;  2FIN B;  3NP8 A;  1B44 D;  1A3V A;  3FPP A;  2D62 A;  2F0P A;  1F9S A;  2WIN B;  3E6Z X;  1TWG B;  2EY6 A;  3BYT B;  5ELF A;  2B2U C;  4KN7 C;  2SDF A;  1O7Y A;  2I46 A;  2EYM A;  2F0O A;  1B9N A;  3M85 A;  1EIH A;  4CJ2 C;  3K5O A;  4ZUI A;  2B2U A;  4IUT A;  2IX3 A;  3R93 A;  2J0T D;  1H9J A;  5E1F A;  4DAY A;  2F0Q A;  3K59 A;  3ITP A;  4FXD A;  2BDO A;  2F1M A;  3HRZ C;  4DNR B;  1IL8 A;  2F03 A;  3S9W A;  1BCP C;  5C44 B;  2X6G A;  1GUW A;  2O2L D;  3Q6S A;  1RTO A;  2IX0 A;  3HOY B;  1A15 A;  1DOL A;  3GO5 A;  1ML0 D;  2WKD A;  5F2D A;  2MP1 A;  5IIF A;  5JJZ A;  2BDN A;  2CW0 C;  1KNE A;  1RD9 D;  2HUG A;  1EQT A;  5I2Y A;  3MVV A;  2XWB B;  1EWC A;  1R9T B;  2F0K A;  2WAQ B;  1SJH D;  3SEB A;  2R7Z B;  2JEB I;  1HA6 A;  3ZYY X;  2L12 A;  2R93 B;  5G3L F;  1SNP A;  2K32 A;  1D1K A;  1CZG A;  3ND9 A;  1WD0 A;  1SYG A;  3M7N A;  2F3W A;  5C0X H;  3HGB A;  5ELD A;  2JA7 B;  5C5L A;  3CRK C;  1WVL A;  4PNY A;  1ET6 A;  5M3M B;  3OMG A;  4BBR B;  2MJ8 A;  1EWH A;  4C2M B;  1UNS A;  1TWH B;  1TQO A;  1TWF B;  1EY0 A;  5C3W A;  3J80 E;  2A73 B;  1STH A;  1H9S A;  3BDO A;  1CTM A;  4L63 B;  1G6Z A;  2A69 C;  3FKI B;  5LL6 X;  4XT1 B;  3GV3 A;  3MAQ A;  4IQZ A;  4V19 0;  3Q24 A;  5JEA J;  4KD4 A;  1BOS A;  2KA7 A;  1KDB A;  1HFN A;  4HN7 A;  1B53 A;  1JE4 A;  2DN8 A;  4QIW B;  1TS3 A;  3FRP B;  5E3F A;  1RTN A;  3MXN A;  4IFD J;  3E5S A;  2HDM A;  3T53 B;  3OWF A;  1HA5 A;  1Y1W B;  3K5N A;  3OIQ A;  2F0W A;  1PZJ D;  1GUN A;  1SDF A;  3MXU A;  1TS4 A;  1HFG A;  1KAA A;  2JSO A;  1V8Q A;  2EY1 A;  4RA8 A;  1WTR A;  3D3R A;  5IT9 L;  5CGK A;  2ICI A;  1DXM A;  3KLS A;  1DZ1 A;  5CBE E;  1NR4 A;  2EYO A;  2X6L A;  2Q8R E;  1FR3 A;  5I6Y A;  4M1U B;  3J7A F;  2RVL A;  4RAU C;  4LJZ C;  1JWS D;  4FXK C;  5KNC A;  1B4O A;  3SR1 A;  4UDU C;  2KCC A;  2EJG C;  3TP7 A;  3D4W A;  1PFN A;  2KQ3 A;  3QWN A;  2A68 D;  5JAV A;  4F87 A;  4OIJ A;  4A3F B;  2NN6 G;  3MFG A;  4DGZ A;  2F0F A;  1QG7 A;  1NSN S;  2DY7 A;  5D65 A;  3K6O A;  1F9P A;  4G7H C;  2L55 A;  2NTT A;  1ZEQ X;  2LKV A;  4IFD I;  1EEI D;  1LTI D;  1F9R A;  4F8M A;  2VUM B;  5I6W A;  3S17 B;  1D5X C;  1F2M A;  2OXP A;  5FLX L;  2NBF A;  3NSW A;  4NW2 A;  4H7B A;  4CKE A;  4G7Z C;  2NUC A;  5I9P A;  2MHV A;  1STB A;  1LO5 D;  3M7G A;  4XYQ A;  3VR6 A;  2EE1 A;  1U4L A;  3X3N A;  2A68 C;  3VA7 A;  2WP8 J;  4QB4 A;  2WB1 B;  1NAP A;  4OL7 A;  3HOV B;  2E2D C;  2NVX B;  1UEA B;  2AQ1 B;  4ZRZ A;  2HCC A;  3BVZ A;  4ODG A;  1HTL D;  1LT4 D;  4HCS A;  1TWC B;  1AEX A;  4TSS A;  1X3P A;  4DNT B;  1CA6 A;  1FGB D;  2CHB D;  4CJ1 B;  1KTK A;  2K5Q A;  1LAB A;  3GTJ B;  1X3Q A;  4ILW A;  4KY7 A;  1BCP B;  2J4X A;  3C1F A;  4RH6 A;  4CKB A;  2EYJ A;  3QO2 A;  4HED A;  4PMB A;  3WDN A;  1TVX A;  1JQY D;  5EPL A;  2QEJ C;  2B63 B;  4QMG A;  2B2T C;  2L4N A;  1EU3 A;  2DNC A;  1D1I A;  2CVR A;  4Z9C B;  2E74 C;  1FYC A;  2E75 C;  2NB0 A;  1J8I A;  2B8G A;  3GV6 A;  4RKL A;  1NUC A;  3OOC A;  5DM6 3;  1VCI A;  1S5B D;  2NVY B;  2XNA C;  1Q12 A;  1V1P A;  4KKU A;  1Z6H A;  4MN3 A;  3GTL B;  1S5C D;  1D5Z C;  1F9Q A;  4PMW A;  1GUG A;  5KEE A;  4IN3 A;  4K8I A;  2YYZ A;  3BVG A;  2RSN A;  1SXT A;  5KNB A;  2JEA I;  3S14 B;  2HCI A;  4BWG B;  1G29 1;  3OMC A;  5CC4 A;  1E2W A;  1H9S B;  5D3D A;  4P2C B;  4TQU S;  1EY4 A;  4OHJ A;  5CV9 A;  3SK5 A;  1TWA B;  2KCN A;  4XT3 B;  5ELE A;  1LV9 A;  4WJW A;  3GTG B;  1D6E C;  1SAP A;  2FJ2 A;  2RQX A;  3OIP A;  1CHP D;  3NTH A;  5JVH 3;  4K8J A;  4BA1 I;  2QCP X;  4K5V A;  5KIX A;  1HTP A;  5T1G A;  4IFD G;  2E76 C;  4NKL A;  3IFT A;  3HG9 A;  3ERO A;  1NCV A;  5DAU A;  3C1E A;  4TKO B;  2XVS A;  3N6R A;  1PRT F;  2O4X A;  3L3O C;  3RD4 A;  2K7V A;  1KLG D;  1PTO F;  1JC7 A;  3GQB A;  1ICW A;  4PV1 C;  2B2W A;  4RFB A;  2K03 A;  3I8Z A;  3P20 A;  2F0E A;  1ESF A;  4ZUJ A;  1OXS C;  3PUZ A;  4A3M B;  2OF1 A;  2EYH A;  3K0Y A;  1XYI A;  3PV0 A;  1E0B A;  3DUZ A;  2IWH A;  1BUV T;  4RHR A;  1RCV D;  4A3I B;  3H0G B;  4J1M A;  2FMM A;  2PZU A;  4FYD A;  3VYU A;  3VR5 A;  2Z1C A;  2NVT B;  2WII B;  3FDT A;  1WD1 A;  1AN8 A;  4FVM A;  3U9O A;  5J22 A;  1Y8P B;  4M8A A;  4DXF A;  1AP0 A;  1HCZ A;  3A7A B;  1EZ8 A;  3JAM L;  1JIC A;  5KND A;  3A8K E;  2RBM A;  4FF3 A;  4LMQ D;  2AWO A;  1O7Z A;  5FKA C;  1I4Q A;  2F4I A;  3DEO A;  2QDB A;  3WOE A;  1HQM C;  3TDQ A;  5CYU A;  1IHZ A;  2Q8I B;  1F2Y A;  3NUC A;  5CV7 A;  3OHX C;  1UAP A;  1PYW D;  3I72 A;  2A6E D;  1PTO H;  4HMI A;  1EY9 A;  5EPK A;  1RDP D;  1ZKO A;  5C0X I;  3R2T A;  2EY5 A;  4DA2 A;  2KVM A;  3SK8 A;  5BN5 A;  3I70 A;  1VMC A;  1Q8I A;  2CW0 D;  1EYA A;  3J81 L;  4K5W A;  1ZXT A;  1ZYR D;  3SDZ A;  3OW7 A;  3EJI A;  3W3A A;  5C5M A;  3GTQ B;  3PUY A;  3DMU A;  2H1E A;  3NPP A;  4DK0 A;  2O5J C;  4ZKB B;  4GZY C;  4RCO A;  2QF7 A;  2RDH A;  2F0H A;  3A7L A;  1TKW B;  3F2U A;  3NTK A;  1O7L A;  1EZ6 A;  4FF2 A;  4O1N A;  1IYU A;  1A2T A;  1B9M A;  3D31 A;  2A6E C;  4DN4 M;  1FNV A;  1X32 A;  1GUT A;  1KDA A;  3SVM A;  5EPJ A;  4G7O C;  3AU7 A;  3NQI A;  1F2L A;  1Z7T A;  4DU9 A;  5M3F B;  2B2Y C;  1B2T A;  1LT5 D;  2F0I A;  1ZYR C;  1VMP A;  2B2Y A;  4QUF A;  4S3S A;  2A69 D;  1V1P B;  4CGY B;  1CFM A;  2D5D A;  3IFD A;  1O80 A;  5IGD A;  1WCM B;  2KEC A;  1SYE A;  1I4X A;  2XRS D;  5CV5 A;  4JBW A;  4J8Q A;  2KJX A;  2ENB A;  1HQR D;  4AYB B;  1LLR D;  4KY6 A;  2K6A A;  1DOM A;  1PFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...