3E6ZX

1.0 a structure of cusf-w44a-cu(ii) residues 10-88 from escherichia coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
EAQPQVISATGVVKGIDLESKKITIHHDPIAAVNAPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Cation efflux system protein cusF
publication title Tryptophan Cu(I)-pi interaction fine-tunes the metal binding properties of the bacterial metallochaperone CusF
pubmed doi rcsb
source organism Escherichia coli
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3e6zX01
1ZEQX 3TDQA 2L55A 3E6ZX 2VB3X 2QCPX 2VB2X
chains in the Genus database with same CATH superfamily
4OGQC 1PVOA 1HH2P 5DM73 3ULPA 2C5CA 4LMQD 4ZLTF 1TWHB 5CMDA 4EQPA 1D1KA 4IJHA 3VYTA 4HJ9A 4RGMA 4HTHA 5EKIA 1HR0Q 1SMXA 2HHHQ 3Q22A 1SFOB 4A3BH 4PZ8A 4BBSH 5EAYA 4A4IA 2PPBC 1EIHA 5C5LA 4LF7L 2EZVA 1I50B 1ENFA 2A69C 4YWMA 1A62A 5I2YA 3FVQA 2JA5H 3KJOA 2K5VA 2Q8IB 4RHRA 2A69D 1OXSC 1KC8C 1Y8OB 3I4MH 3NPPA 3FPPA 2EXZA 4KV6A 2ZXOA 4K5WA 4GN4B 3W5OA 3BZDB 5M5XB 4DV6L 3RMHA 2J7ZA 1SJHD 4HR7B 1C8CA 2ASBA 3OHXC 4RWSC 1JJGA 4K6LA 1A2TA 3KF6B 4UPAA 5C3EG 1PDQA 1PFSA 1RF2D 4LUOA 1EYAA 4QIWB 2PQAB 1I3QH 1IW7C 2A74C 1GHJA 2L12A 4IZ8A 1A3TA 5K5PA 5ELDA 1C7YA 2WIIB 1FGUA 4X65Q 1IW7D 4XT1B 4TRDA 5E7NA 1CUKA 4OWXB 4H0LC 5A35A 1QVCA 4DV2Q 1LTLA 1YZ6A 4NMZA 1KNEA 3NTKA 3CRKC 3JAME 3UDIA 1XMQL 3F2DA 3D4WA 2R7ZH 1SR3A 3PUWA 2A73B 4Q0FA 5JPMC 4HJ8A 1PH5A 2M00A 3IFTA 1K28A 1YJWA 3PSIA 2VQEL 3CRLC 1S3OA 3X3MA 2SEBD 1L1OC 2I5HA 2B63G 1LTID 1QG7A 4Y52H 5ELEA 3SK4A 3VR4A 1VQPA 1PTOH 1ML0D 2MGSA 5T1GA 3Q8DA 4RGNA 4DR1L 2K52A 4ZYSA 5BR8Q 3M4PA 2FJ2A 4EQ5A 1EQTA 4C3IB 4DV7Q 1JQYD 1QNUA 4A3EB 1GUOA 2BDNA 1GOZA 3D6CA 2MNAA 3K5NA 4GNXB 2F0SA 4EQNA 4KHZA 3D31A 3HOVH 4MHEA 2VQFL 4OXPA 3H3VH 1IL8A 1D1IA 2UUAL 4GN3B 3M9BA 3SDZA 2F0JA 4ZKCB 1B50A 3SK6A 2H4OA 1JICA 4DNIA 4KN7C 2MUYA 5I4DA 1X3PA 5DLQE 1TWAH 1P16A 4FYDA 3BDLA 2PI2A 1H9SA 3TP5A 1K83B 4BWGB 1JORA 4J8QA 3ND8A 1C4QA 3G7LA 3GTGH 1KXLA 2R7FA 4B9XA 1EZ8A 1RIPA 5GADC 3RN5A 1S5ED 2NZOA 1SJED 1OXVA 3KF8A 4IN3A 1N32L 1KDBA 2DGYA 2R93B 1C48A 1FD7D 4UP7A 1KRTA 3H3VI 4DV1L 4J15A 4LF6L 3J81L 1V8QA 3DM1A 1BBXC 1PYSB 1Q46A 3QB3A 1UE1A 2NN6H 1LTTD 4QQBX 2B29A 5IGFA 2Z0SA 1WCMB 3OMGA 3FKIH 1HJPA 4IUPA 4JI8L 1FR3A 4JI2Q 2CCZA 1K3BC 4A3FH 4CKBA 2KCCA 3FEWX 1MJEA 1IBKL 1I94Q 4GOPC 3K7UC 3ER0A 1Y1VG 2M2LA 3TP8A 1GUNA 2R6GA 4ZCKA 4B3SQ 2EJFC 1A6XA 1EY7A 3S1RH 4JI7L 3GTQB 4BY7H 1PA6A 2K33A 2N88A 2ENBA 2NN6I 2OTJA 5I2XA 2NYZD 5C4JH 3J80E 4A3GH 3HKZB 3I91A 4HJ5A 4K14A 4BXXG 2CVRA 2RSOA 3R2IA 5LL6S 4C1NI 4B3TL 3MXPA 4QMGA 4YCWA 2YTVA 3OOCA 3HOUB 3PGZA 1ILPA 3UDGA 2UUBL 4ULLA 1ZKOA 1JWUD 3W1BA 5C3WA 2F0GA 2K32A 1EY0A 1G2SA 2LXKA 2Z1CA 5HGTA 3NHHA 2P5ZX 3EFXD 4YHHL 4AYBG 5C0XH 1CKNA 1V1PB 1B3QA 5FO8B 1TWHH 1U4PA 3PUXA 1F9SA 1PTOC 3NTIA 2R92G 2AQ2B 1XPRA 1Q1BA 2GA4B 3OTOL 2AHOB 1ZXTA 4A93B 1PTOD 5IP7H 4DR4Q 4MTNA 1J9OA 1XTCD 1SFOH 3S2DH 3CQZH 4HJ7A 4BY1H 3PO2H 3A55A 1STGA 1EU4A 1ONLA 1TR5A 3BVZA 4K0KQ 3V2TA 4IUQA 1AH9A 3DWAA 2DY7A 1I50H 4DV0L 3S1NB 3BZCA 1KLUD 1E0BA 2F0WA 2PYKA 3H3VC 4E6IA 3TN2A 1RODA 4FF2A 3KLSX 2UXDL 4BBRH 5C0XI 4JK1C 4XT3B 5HURA 5IGBA 2L1BA 2HT1A 1K8OA 5E1FA 4A3DB 3K5MA 3RN2A 1VQBA 1NAPA 5M5XH 3K59A 3DEOA 5J39A 2NVXB 1X56A 4LFAQ 1Y8PB 4QUFA 4KMUC 5ELOA 2F0IA 3S24A 4PV1C 4DR3Q 2I0QA 2EYFA 4DF7A 2K5QA 3BYTB 5JVG3 1DONA 1Q82C 3TP6A 5FLXE 2ZTDA 3KDFB 4K5VA 3N52A 1B9NA 2PZWA 1MSGA 3HKSA 4JI1Q 1VQ7A 4UP8A 4B3MQ 2NVYB 3JC66 1L0XB 2ZXRA 3GTLB 4DK3C 1VF7A 3AB9A 4P71A 2D5DA 4DV4Q 1S5FD 3BDOA 3BVGA 4V0BA 1CM9A 1S40A 2QF7A 4IPCA 4DAVA 3J7AF 1KQSA 1N8RC 1STEA 3WOEA 1L1OB 2KCTA 3S15H 2XIWA 2F0NA 3I4NB 5CR3A 3VR6A 4HCSA 5LMNL 1HCZA 1SYDA 1U0LA 4HEDA 4KKSA 3T1YL 2ZM6L 4IJLA 4LF4L 3BDCA 2B2UC 2RDFA 4HIMA 3HP3A 4H02A 4DAYA 4AQYL 2JK8A 2E2DC 3TZUA 1H9KA 2CKZB 1K9MC 2WACA 2Z6KA 4L6TB 1GKHA 1PHJA 4UHVA 4M8AA 1WD1A 3TBIB 1YHAA 2CH4W 4DUYL 1M90C 1NSNS 3NK9A 1WVLA 1IYUA 1TS4A 1E7ZA 3PIPA 5BN5A 1ILQA 2YTXA 2K6AA 4JOIA 2LXJA 1HUNA 3LWUA 1PRTC 2K5HA 2F4IA 1CI3M 2QGQA 4JI6Q 1SMYD 3NQTA 1QUQB 3SGIA 4A3BB 5I6WA 4X66Q 4BBSB 3H94A 1PFNA 1VDZA 2PO4A 2ICIA 1LABA 5BN4A 4K2KA 2B2VA 5KNCA 4X6AH 1SXTA 5M5WH 1R9TB 4IUNA 3A54A 4U673 1SNOA 3L0OA 4YY3L 4IPHA 2E2HH 1N33L 3PUVA 1WTXA 1LM0A 3L7ZC 4A3IB 2N55A 1B4OA 2YU9B 3WDNA 4C3HB 5IWAQ 2CHBD 4NPSA 3QOJA 2YTYA 4H13C 2KENA 3B6YA 3A8KE 1LV9A 4PZ6A 2RHQB 4XYOA 4QJFA 1JJ2A 2OWOA 2HQEA 2KECA 4RCNA 5EKLA 5IYCH 1TWGB 1JT8A 5JOBA 4GOPB 3PCOB 1YNXA 2EJMA 1XMOQ 4IALA 4Y7NH 4JBKA 3MVVA 3GTQH 1ICWA 5FLMH 1VQMA 2B2WC 1PFMA 2L11A 3DHQA 2E5LQ 3OSOA 2B39A 5IIFA 1G6PA 4RMFA 2JA9A 1EIYB 3HZXA 3I72A 3SR1A 3DXJC 2Q2TA 2RBMA 5BN3A 3TQYA 5DNFA 1KRSA 1X3EA 2G9DA 2PI2E 2XN9C 4IPGA 3H15A 1F77A 4LW1A 3WWVA 2EYPA 1EIFA 2F0DA 4KY5A 3NEMA 5IP9H 4YCVA 3A56A 2G5DA 3T1HQ 4JV5L 1EU3A 4YWKA 4A3CG 1SE3A 5C4HA 4DAMA 5L37A 4DXGA 1XXGA 1N9WA 2K03A 1PTOB 2L4NA 4A3MH 5IT9L 1OXUA 4A93H 3A8IE 3SK8A 1YIJA 1Q1EA 1YBYA 3RD4A 4ALPA 4LFBQ 1AP0A 4A3EG 2UXCL 5J22A 2O5JC 3FDTA 4UY8C 3MZ5A 5CBEE 1NJIC 2XNAC 2R3ZA 2R7DA 1GUTA 4WFN3 2WB1G 2RDHA 3M4YA 1A2UA 1FVIA 4APVA 3J81i 3Q0AA 3CCRA 3S1NH 5IYBG 2KA7A 3HOVB 1IBML 4LF8L 1BCPC 4ZKBB 4IUVA 1B9MA 3KF6A 2YV5A 3VYRA 3TRZA 2O4XA 1O80A 2SNSA 2PQAA 2K50A 5IGDA 1SLJA 2NVXH 3RLNA 3QJYA 3C2PA 1BO0A 4CJ1B 1EYCA 3GTGB 2LS01 3O13A 3H6MA 5GAGC 1JR0D 2R93G 2XVSA 3F2CA 5JJLA 2IJ0A 3NBHB 2F0EA 3GTPB 3K57A 1K73C 2AKWB 4X64Q 1SE4A 3J7AV 2I46A 1VQFA 1TXYA 1QWYA 3C1EA 1ESFA 5GQOA 1L0WA 4LF9L 2VXWA 1TT2A 4MNOA 3GTLH 3VDYA 2JEBI 1YHQA 3FP9A 5FK9C 1EYGA 5COYA 2VW9A 3VA7A 2MO1A 2F52A 3FKIB 1PH2A 4RKBA 2ZT9C 4FXDA 5GAHC 2N3SA 4A3FB 1AZPA 1GUSA 2Y0SB 1TS3A 5IGGA 1NTGA 4ME3A 4QUCA 2B2YC 2D2CC 2IHFA 5IE8A 2A5HA 3T4AC 4CKCA 4B3RL 3URYA 3W3AA 4R4CA 5M3MH 1CQVA 3PUYA 3S1RB 4ILWA 2JA7B 1DZ1A 1X65A 3E9HA 4BY7B 4U68A 2D0PA 3EIVA 1A3UA 1E2ZA 3BZKA 1N36Q 4OX9L 2VS1A 4A3GB 4DR2L 5LMUQ 4CGYB 1AE3A 1QOHA 4GNXA 2VB3X 3HOUG 4OO1H 5C5MA 3V96A 1MI2A 4L5SA 1UAPA 1AN8A 1ICFB 3SVMA 1HNWQ 5JPNC 1HHVA 2IX0A 4EQOA 2QEXA 1SBBB 4A3KB 2NVQH 3NTHA 1EIGA 1YITA 2B63H 1MD2D 1WD0A 3HOYG 1M8AA 3CW2C 3IFDA 4XQJA 1QVGA 5M5YB 1Q8IA 1CKOA 1YI2A 3HOWB 2WP8J 2JA8H 5KYIA 2CFMA 4OWTB 1EQVA 1KL9A 2NB0A 1PRTB 4PG3A 4YWLA 2A1AA 1LTAD 4JI3Q 3S2DB 3CQZB 4BY1B 4OO1I 3PO2B 1K3RA 1GO3E 1RDPD 1J5EQ 2XWBB 1KAWA 4LFCL 1D7QA 2EE1A 5M3FG 4A75A 1R9TH 3T51B 3TSSA 1VS0A 5T1IA 2AUKA 1F9PA 3PO3H 1HZCA 4A3DG 4BBRB 2ZJPA 1QZGA 3AEVA 5ELFA 4A3IH 2YU9H 4JI7Q 4JG2A 4AYBE 4C3HH 5DM63 5FJ8H 1Z7TA 4M1UB 2E2IB 3HOXG 1B7YB 4JI5Q 3MXUA 1EY9A 1EY4A 1V1OA 2K5DA 1HNXL 2GN5A 3J7A5 3IRBA 1WTVA 1EWCA 3V05A 2JSOA 1HNZQ 1TWGH 4RGOS 4ZK9B 4HIOA 1GHKA 3FHWA 2JA6H 4FF1A 2A68C 4CDCC 4R4QA 3A8JE 1IBLL 2A68D 1D8LA 3GP7A 1HRJA 1KDAA 4OL7A 1QJOA 1VQ6A 4DR7L 1G6ZA 3S17B 1EEFD 1HZ9A 1F9RA 2ZTCA 4IOAA 2UXBL 3HOZB 3I7FA 1VQNA 2JN4A 1V1PA 4IUTA 5EKKA 4KKUA 3I4NG 2IPKD 2WKDA 4LF5L 3KLRA 1MSHA 3S15B 4IFDH 1YNJC 2M9VA 4DR5Q 4GLVB 2Z6BA 1YNJD 3NQIA 4J6HA 1Z47A 2Q2IA 2F4VQ 5C44H 4A3LG 1FNUA 4PMCA 5HY6A 1Y14B 5IOCA 5C0XJ 2NVTH 2UUCL 2NUCA 3LWEA 4A3JB 1EL0A 1G291 1QZHA 4JI4Q 2UU9L 4GKJL 1XX8A 2NZHA 2OT2A 1EWIA 4DUZQ 4ZAIA 4IFDI 4K2LA 1EEID 3K0YA 1BCPB 1VQJA 2H1EA 4OHJA 3AMUA 2K01A 3MFGA 4DKAC 2LY7A 3I73A 3HGBA 2HDLA 3K0XA 2N78A 3TEHB 1LTBD 4UDUC 3NWSA 4X3TA 2VY3A 1F2MA 3RLOA 4A3BG 2PCFB 2A19A 3SE0A 4BBSG 3KDFA 3OWFA 3BJUA 4JI0L 3MEHA 1Q7YC 3CC4A 4NXML 1NE3A 1EY8A 2KBNA 4LNQA 3BVMA 5M5WB 1EFID 1X54A 2JA5G 1VQ5A 3E6ZX 4GN5A 3UI2A 3SEBA 4DV5L 1CHPD 1WI5A 3I4MG 1F2LA 1KDCA 4IUUA 2E2HB 3GTPH 3G71A 4ME5A 4XYQA 3EA6A 1GM5A 1LUZA 3VYUA 2F03A 5K36H 3K6OA 4FO2A 2LKVA 2F0FA 4LAAA 3KBXA 2FFKB 1IYJB 5D14A 3CU7A 5HGQA 1SNPA 2LFNA 1Q3LA 3F1ZA 1L1OA 3G4SA 3RNUA 2OF1A 4DAPA 2L5TA 3E0EA 4QL5A 2WV6D 1STNA 2BCOA 1Q90A 4OIJA 5JEAG 1XTDA 1LTRD 2F1MA 1HFGA 4GKKQ 3K7AH 3MAQA 3NWTA 1PH4A 1TVXA 1JB7A 1HR0L 4Y7NB 1NMGA 3JAML 2HHHL 1HA6A 1KAAA 2JA7H 5A2QL 3IL8A 2R7ZG 4XIGS 1T5XD 2DNEA 1NUCA 1VQLA 4IQZA 4BA2I 1TS2A 3T13A 4UP9A 3R93A 1WFQA 2KQ3A 4NXNQ 4QIWE 2I07B 1YJNA 4A3KH 3MEFA 1XJVA 3E5SA 3RLFA 1X6OA 1ET9A 3VR5A 2EIFA 3UE0A 1TS5A 5M5YH 3HOWH 5JJKA 1GVPA 1QUQA 3D6WA 1E22A 1AW7A 3HG9A 4QY7A 2C35B 4LUVA 4A3MB 1X3QA 1EQRA 1II3A 1R4PB 1XNQQ 2N8NA 5IYDH 1TU2B 4X65L 2TMPA 3CD6A 3J81c 1X32A 3HOVG 3HRZC 2B2TC 1SYGA 4LJZC 3K5OA 2D62A 1TKWB 2IT1A 4DV2L 1BBWA 4RHSA 3I90A 2OTLA 1NY4A 1KD1C 3OMCA 1QB5D 1VMCA 3A7LA 4JVZA 2EYHA 4R9WA 3CMEA 1RCVD 1W6JA 2E2IH 4RH6A 1NR2A 3STBC 4FP5D 4I7AA 3K81C 4GOPA 2LMCB 1TWFB 3CCJA 4X62L 4FXGC 3STBD 2DJGC 1KIXA 1XNRQ 1D6EC 1CHQD 1A0IA 2ZJRA 2KEEA 1BNZA 2OCEA 3FPUB 2WB1E 1N34Q 1PZKD 1RHPA 3CCUA 2WAQE 1B8AA 2OXPA 2NN6G 4DFAA 2VUMH 3RZOH 4C56C 5BR8L 1FJGQ 4DU9A 3L2PA 3I8ZA 4QCLA 1JB3A 1DYQA 4C3JH 3Q6SA 3VR3A 4TSSA 4DV7L 3S17H 4ODGA 1QVFA 2F0LA 1K0RA 3FKIG 4A3FG 3D8GA 2Y0SG 1SYEA 3OIPA 1E1OA 1ENAA 3KYHC 5NUCA 3HOZH 4FVMA 3MC0B 2D0OA 3BU2A 3CP0A 5D65A 5CV6A 3KJPA 1BDOA 5M3MB 3GTOH 4BY7G 4NB3A 4O2DA 1Y1WH 1TWCH 3A0JA 1ASYA 3J80L 3S1QB 1LLRD 2HD3A 2ES2A 1UEAB 4HN7A 3K5LA 2AWNA 2B8GA 3DM3A 4BS9A 1GUGA 4DXFA 5H1SE 2F3VA 1W6KA 4JYAQ 2IX1A 4A3JH 1H9MA 2BE5C 4HSVA 3H09A 1CA6A 1I4HA 1VQHA 2Z4IA 1FNWA 1BVSA 1SE2A 2BE5D 4KD4A 3P1HA 3ZJYC 3M4OH 2NVQB 2RHSB 1DOMA 2B63B 5C0XG 4JBWA 4G7HC 1I6HB 3I56A 1VQIA 5I9PA 2JA8B 1CZGA 5D3DA 3CCMA 1BR9A 5J3BA 5IP7G 3X3NA 2E8GA 1SMYC 4X3SA 4F8MA 1V9PA 4BY1G 1W2BA 1H9JA 3PO2G 3U9OA 1Q12A 4JI2L 4DR6Q 5KGUA 2EOTA 2PMZB 2RF4A 3NBHA 3CC2A 5C4XH 3DWPA 5G3LF 2MP1A 1I94L 1HQRD 3AFPA 2NZ1D 3SXHA 3QG1A 4B3SL 4POGA 1AZQA 3C3LA 1EQQA 5CV5A 4BBRG 1ENCA 2PZUA 3MFYA 3PO3B 1Q86C 2XRSD 1TY2A 5EPJA 3W2DA 3PIP3 2E74C 3NE5B 3EQLC 4Z9CB 1FL0A 4DV3Q 4XQQA 1IKLA 1TIID 3SK5A 5AJ3Q 3T53B 4DR2Q 1M1KC 3UDXA 3CC7A 5JJIA 1OTCA 1D2BA 1PMRA 4N8FA 1BKBA 2B3GA 5FLXL 2QDLA 3I70A 5EGTA 4LUZA 3ULJA 2F3WA 1EYDA 2F0VA 3C46A 2JA6B 1QCBD 1ASZA 3GO5A 1A8VA 1UUPA 2B2UA 2AWOA 4WRDA 4DR4L 3CPFA 3OW2A 2QW7A 2JQOA 1MIUA 1SNQA 4P75A 2KUMA 4K0KL 2KJXA 1CZWA 2XSCA 4KN4C 4CDEC 1CK1A 3H0GH 1A3VA 4R8IA 1JE5A 2DN8A 4XTCS 3M7GA 2A6EC 5EBCA 1JE4A 3J7YW 1IL2A 1LT4D 5I6YA 5AFWA 4F7XA 3TS2A 3DWQA 3G6JB 4LF7Q 2N49A 4HIKA 1ZYRC 2NWGA 5ISRA 2A6ED 2PW5A 1VQ9A 1Y1VB 2Q8RE 2VB2X 4GLXA 4K8IA 4L63B 1ZYRD 1SNCA 1EUJA 1STHA 4KI0A 3PF5A 1G8ZD 4I65A 4FDBA 4HMIA 1GUWA 1W3SA 4LFAL 5C44B 1CSQA 4JCVE 4A76A 1SYCA 2F0QA 3FRPB 3GTJB 5EJWA 1PZJD 4DV6Q 2NVTB 4GS3A 1HZBA 4DR3L 3I3CA 2KHIA 4C3IG 3A74A 4JW0A 3KLSA 4P73A 1PH3A 4R4OA 5DEHA 4CJ2C 1O7YA 1HTPA 2F3IA 1UEBA 4X3UA 2XWJB 1NCVA 3TZDA 3ND9A 4RG1A 1MGSA 4JI1L 3P7JA 1V1QA 1Q8KA 4N8X1 3E3XA 4B3ML 4DK0A 4AYBB 1PH8A 1H95A 1K0SA 3GD7A 2BOSA 3ULLA 4DV4L 1HTLD 1BUVT 1C0AA 2MJ8A 1LTGD 1RTOA 1B2TA 3CHBD 1PXUA 1F9QA 2SNMA 2NTSA 2F0TA 5FOBB 1LT5D 1XMQQ 2RKSA 3HFZB 1TWFH 3LGJA 2VQEQ 3PV0A 3JAMi 1Z6HA 1C9OA 2EYLA 3KOJA 2F0HA 2EQSA 3EJIA 3M4QA 2B2WA 1X3FA 2V4DA 4FF4A 4QGUA 3QR8A 2Q2UA 1NR4A 4YCUA 4G7OC 5F2DA 1LT6D 3RUZA 5GAEC 1JOQA 1WTPA 2K5NA 3E0JA 2JXMB 4HIDA 1WCMG 3S14H 4N9TA 4DR1Q 1SROA 1LTSD 5C3EH 5IYCG 1WTWA 1VF5C 2JP1A 1X55A 2PNRC 1DGSA 3TMEA 5IT9c 2QILA 3NENA 4PMWA 1EY5A 1U9RA 3RZDH 2L55A 3K7AB 3OW7A 2VQFQ 5FLMG 2UUAQ 4JI6L 5KRUA 3S1QH 1WTHA 4NW2A 4KTAA 3HKZG 4IFDJ 1DXMA 4X66L 4B08A 3I4LA 5KEEA 3CAMA 2FHTA 4KHPL 2EYJA 5JJZA 4L5RC 1JOOA 3NELA 2X69A 1DM0B 3S9WA 1PTOF 1IZ6A 5IP9G 1FNVA 1I6HH 3NUCA 1N32Q 4KJOA 5KYLA 5IWAL 1MKHA 2KEDA 1WTRA 1S5CD 2EDGA 2SDFA 4A3MG 1UE7A 4X3KA 3U9SA 5IGCA 4DV1Q 4A93G 1JWMD 4LF6Q 1KTKA 1GXDC 2ZTEA 2DJFC 3G6EA 5CV7A 4WJ3M 1JCKB 1EWHA 2KCMA 4JPBW 1BF4A 2CH4A 5CV9A 3K8AA 1SE8A 4JI8Q 2EY6A 2K5WA 2HQLA 4L5TA 1XMOL 1DD2A 2EY2A 1VMPA 2V1CC 1IBKQ 1DOLA 2K05A 4O0AA 1Y8NB 2EXDA 2HDMA 2G9HD 1STBA 3IKJA 2E5LL 5FO7B 1A63A 4IO9A 3OIQA 3T16A 3U50C 3DLLA 1WOCA 4K5XA 1EOTA 3KK7A 1LT3D 2B2YA 4KJNA 2KOLA 3GTMH 4B3TQ 4JBMA 3U4ZA 3TP7A 3K58A 4NDXA 2UUBQ 4EVOA 1U4LA 3J80i 2K4KA 3T1HL 3TS0A 4LK1C 2GVBA 5G3LD 1RL2A 2FMMA 4YHHQ 5KNDA 2A6HC 3MWYW 2MQHA 2DUDA 3D4RA 2Z4HA 3M7NA 1WTOA 4KY7A 1CA5A 3PF4A 3RZOB 2VUMB 2A6HD 4PQXA 3J81E 4LFBL 4C3JB 1X3GA 3I4OA 2BDOA 1WYDA 3OTOQ 3CKIB 1VQKA 2L9HA 1I4PA 3OYYA 2OQKA 2JEAI 5JEAH 2RA4A 1HUMA 3T56B 5M3MG 2ALYB 2XRQD 4DV0Q 1Y1VH 1JOKA 4O1NA 3GTOB 2UXDQ 1Y1WB 1HZAA 1TWCB 3MXGA 5A2QE 5JVH3 4KKTA 3H91A 5M9OA 2KHJA 4OO1G 3GTJH 1GD7A 1IHZA 2HCCA 2D9UA 4BXXH 3ZYYX 4OIKA 2L15A 4X62Q 3BG3A 2HIVA 3OPOA 2Y0SE 3M4OB 4CDFC 3GTKB 4X64L 4G7ZC 1PRTF 4CHTB 5C3XA 2JA8G 3MXNB 1PH6A 1B53A 1S4ZA 2FXQA 3L3OC 5ELBA 1XPUA 1QE6A 4P2CB 2BH8A 1UE6A 2R61A 3NP8A 2R92H 1B1ZA 1SRUA 2ZJQA 4J1MA 3NBIA 5CC4A 4C2MB 4XDXA 2X6GA 1ZEQX 2F0MA 5CV4A 3CPWA 2MO0A 5C4XB 4RAUC 1M4VA 1SN8A 3D3RA 5D3IB 4YIJA 2RQXA 2WB1B 1HR0W 4R8NA 1I4GA 2EY5A 2WAQB 3PMFA 3PO3G 2RCNA 3D4DA 1YHBA 3QOLA 1U4MA 3GV6A 1S72A 3S2HH 5TSSA 2BA1A 1J8IA 4A3IG 4UAIA 4V190 4C3HG 5FJ8G 1N36L 1VQEA 5LMNQ 5LMUL 3F8TA 4G57A 2J0TD 1PFBA 3DMUA 1QILA 2E2JH 4BA1I 5CYUA 3T1YQ 1G51A 2ZM6Q 1HNWL 4KHVA 4LF4Q 1E1TA 3Q24A 2PNHA 4AQYQ 2HUGA 2OEOA 3C1FA 1CSPA 2Z9HA 3KUPA 1B70B 1O7ZA 2E76C 1U4RA 2JA6G 2WKCA 2DY8A 1BBUA 1YEZA 1JJCB 2RDGA 4QB4A 4FNFA 3R3OA 2O2LD 4S3SA 4JI3L 3Q23A 4DUYQ 1I6VC 1VQDA 2E75C 5CGKA 2CQAA 1PYBA 1I4QA 3M3YB 4F87A 1J5EL 5FKAC 4HSPA 1B44D 3H0GB 2YYZA 5C6AA 2J4XA 5IODA 1DJRD 1RD9D 1YVCA 1HA5A 1KLGD 4IFDG 1NBWA 3S1MH 1EFWA 2EY1A 3EN2A 3GV3A 3CCVA 4R4IA 3L9AX 4YY3Q 3PUZA 5C44G 2VL6A 1B3AA 4JI5L 3PQIA 1N33Q 2FMCA 4K8JA 1YNNC 1BOSA 4CBVA 3I2ZA 2RSNA 1YNND 1HNZL 3GDEA 3TREA 2A8VA 1PH7A 4FF3A 2ID0A 1BCPF 2H5XA 1VQ4A 5LL6X 3MHBA 1SEBD 1K8GA 4EX5A 4ZQ3A 1BXTA 2QKIC 1D5MC 1D5XC 3EROA 4JBJA 3HOYB 4HJAA 1OO9B 4CKEA 1I4XA 5E4WC 3ERSX 1SNDA 3K80C 4RGTA 5EPLA 1WTQA 1IKMA 2HCIA 1SYBA 2IL8A 2K1BA 5I9OA 1VQ8A 2NBFA 3F2UA 1LYLA 4DK1A 4IOCA 1QNKA 4NP5A 4KY6A 1BQQT 3G48A 4KD3A 1X9NA 3WOFA 3JAMc 1LACA 5M3FB 5LMNW 4DR5L 2VNUD 2Z6KC 5IY0A 2F4VL 1EZ6A 5K36G 1SDFA 4I7ZC 4JV5Q 2EYOA 1TQOA 1HQMC 1VCIA 2OQ0A 3HOXB 1ET6A 1XPOA 1NMFA 4L5QA 4JI4L 3S14B 4JOIC 3LNNA 3TDQA 4MIUA 1RJTA 3UDFA 5GROA 1STYA 5C3EB 1K8MA 4DUZL 2UXCQ 5C4ZA 1H9SB 2EVBA 2PZTA 4EGVA 4PMBA 2K7VA 4DK6C 3U58A 4GZYC 2NTTA 4G4KA 2B2VC 2PQEA 1KHIA 1F2ZA 2JA7G 3RZDB 1IBMQ 4LF8Q 3KF8B 1T5EA 5EQ0A 5CORA 1KABA 4DA2A 1P8LA 3ITPA 1ESRA 3QIAA 4RA8A 3KBGA 4AIMA 4DGZA 4A3GG 3MTSA 3R2TA 2ATWA 5DAUA 3S16B 1CT1D 4RCOA 2B2TA 1VQAA 4F88A 1DCZA 2JJQA 2EPBA 4A3KG 4DNRB 2QCPX 1MBYA 2HIXA 2IWHA 4Q5VA 2K28A 4B9WA 3GTKH 3HOWG 1R4QB 2O5IC 1FYCA 1EY6A 2FINB 2WFWA 1XWEA 1UWVA 3AQQA 5ELCA 4A3CH 4PNYA 1WJJA 3HEJA 3P75A 3NXWA 2WINB 1CQFA 5IT9E 3A5UA 5IYDG 4LF9Q 4C3IH 2RCFA 3HKZE 4C2MH 1K8AC 4ZUJA 4A3EH 4IURA 4MZ9A 2IY5B 1SAPA 1TY0A 1SNMA 1XYIA 1E2WA 4ID6A 4GKKL 2I5LX 2F0PA 5IYBH 5EPKA 1RKNA 4B3RQ 1OXXK 1YJ9A 1AE2A 5J1ZA 1PLFA 1PRTD 3OWEB 4XXEA 1K83H 3CCSA 4GLAC 1CKNB 4NXNL 4OX9Q 4KHPQ 4OELB 2QEJC 2ICEC 3GTMB 5KNBA 3KLWA 2K04A 3A7AB 4ABNA 5IGEA 4OONA 4JC0A 1IYVA 4HMJA 3J80c 2JA5B 3CCEA 2R93H 2KCNA 3I4MB 2L0CA 3UE1A 3VA5A 2VUMG 1VQOA 2LSSA 4C3JG 1E2VA 5CBAE 2XTIA 1WCMH 4WJWA 3VR2A 2CW0C 1XNQL 3CMAA 4K6DA 3M3YH 3A5ZB 4KK7A 4LWCA 3DUZA 2I5MX 4KLKA 3HOZG 1I3QB 3RR5A 2CW0D 2JYOA 3AYHB 4WORA 3EVQA 5E4XA 3DEPA 4R4TA 3R8BA 1Z9FA 4ZRZA 4C1NK 1U5KA 4XQNA 3U4VA 4LFCQ 2MFIA 2Q8TA 3GQBA 3J81j 2DNCA 3W1GA 1EOVA 1Y1WG 4CDDC 3AU7A 3CCQA 1HFNA 4OWWB 3N6RA 1KNAA 2R7ZB 2ZXPA 2PW7A 3F2BA 3CCLA 1PH1A 3D0FA 4A3JG 1XNRL 2AMCB 1O7LA 3HOUH 1DOKA 3LX0A 1HNXQ 2KVMA 2Z8LA 1G91A 1SYFA 4TKOB 5JAVA 1N34L 2VZAA 3NSWA 3CXCA 4WJ4A 4P72A 1A15A 2MHVA 1FJGL 3HOYH 4DN4M 5FO9B 2F0KA 2GVAA 1PYWD 2RVLA 5FLXc 1CTMA 2R92B 1IBLQ 5EBDA 1I4RA 2JE6I 5C4XG 4DR7Q 4ZUIA 2AQ1B 2TSSA 2X6LA 2IHEA 1D5ZC 4N9PA 4AH6A 4O42A 2UXBQ 3PIOA 2WAQG 3SHLA 4GNXC 1RTNA 4DAYB 5M3FH 1S5DD 1I5FA 4CJ0B 1S5BD 3S2HB 1JWSD 4H44C 1BCPD 4LF5Q 3QWNA 4HCEA 4A3DH 1VQGA 1T9HA 1TWAB 4JYAL 1HPCA 2AQ3B 5KIXA 2E2JB 1E24A 3HOXH 1Y69U 2EYMA 4DPGA 1OXTA 1IXRA 2Q2HA 1UNSA 1HXYD 2UUCQ 2PMZE 3PIO3 1L0YB 1G2TA 3BYYB 3VYSA 3ICEA 1GJXA 3IAYA 2UU9Q 4GKJQ 1H9RA 2BA0A 1V43A 1Q81C 1MHWC 4FXKC 1LO5D 1UE5A 5E3FA 1CFMA 2XGTA 3P20A 2MPMA 3HS0C 2EJGC 1JC7A 4IPDA 2K14A 2KHSA 4R1JA 5JEAJ 1FGBD 2NVYH 2QDBA 3BS1A 4DR6L 2SOBA 1L2FA 1VQCA 3ONAB 4L8JA 4NKLA 2QA4A 3H0GG 2CQOA 3S16H 2AUJD 2B8FA 3KFUA 3MXNA 4JI0Q 2C9OA 4NXMQ 4PZ7A 4QF4A 2CWPA 3J7ZC 1NNXA 1SSOA 2K75A 2BH2A 1MJCA 3I4NH 3E9IA 4RKLA 3CF5A 5ELNA 3S1MB 1J6QA 1AFPA 1AEXA 1PZID 2F0UA 1CKMA 4DV5Q 4DV3L 4H7BA 1PH9A 2F0OA 3EBEA 1O78A 2IW3A 4POFA 3MA2B 3QO2A 2IX3A 5AJ3L 4RFBA 5C4JB 3M85A 4HAEA 4TQUS 4A3LH 4MTKA 2CWAA 4P74A 5CV8A 1F2YA 1STAA 1JMCA 4MN3A 4OEMB 3ERQA 3I55A 1PV4A 1E3PA 1O7IA 3FMCA 3AFQA 4TVAB 5LHY1 4DNTB
chains in the Genus database with same CATH topology
4OGQC 5DM73 2C5CA 4LMQD 4ZLTF 1TWHB 5CMDA 4EQPA 1D1KA 3VYTA 4RGMA 4HTHA 5EKIA 3Q22A 1SFOB 1EIHA 2PPBC 5C5LA 2EZVA 1I50B 1ENFA 2A69C 5I2YA 3FVQA 2Q8IB 4RHRA 2A69D 1OXSC 1Y8OB 3NPPA 3FPPA 2EXZA 4KV6A 2ZXOA 4K5WA 3BZDB 5M5XB 3RMHA 2J7ZA 1SJHD 4HR7B 1C8CA 3OHXC 4RWSC 4K6LA 1A2TA 1PDQA 1RF2D 1EYAA 4QIWB 1IW7C 2A74C 1GHJA 2L12A 4IZ8A 1A3TA 5K5PA 5ELDA 2WIIB 1IW7D 4XT1B 4TRDA 4H0LC 5A35A 4NMZA 1KNEA 3NTKA 3CRKC 3JAME 3D4WA 3PUWA 2A73B 4Q0FA 5JPMC 2M00A 3IFTA 3CRLC 3X3MA 2SEBD 1LTID 1QG7A 5ELEA 3SK4A 3VR4A 1PTOH 1ML0D 2MGSA 5T1GA 4RGNA 4ZYSA 2FJ2A 1EQTA 4C3IB 1JQYD 1QNUA 4A3EB 1GUOA 2BDNA 1GOZA 3D6CA 3K5NA 2F0SA 4EQNA 4KHZA 3D31A 4MHEA 1IL8A 1D1IA 3SDZA 1B50A 2F0JA 4ZKCB 3SK6A 2H4OA 1JICA 4KN7C 2MUYA 5I4DA 1X3PA 4FYDA 3BDLA 1H9SA 3TP5A 1K83B 4BWGB 1JORA 4J8QA 3ND8A 1C4QA 3G7LA 4B9XA 1EZ8A 1S5ED 1SJED 1OXVA 3KF8A 4IN3A 1KDBA 2R93B 1C48A 1FD7D 3J81L 1V8QA 3DM1A 1BBXC 3QB3A 2NN6H 1LTTD 5IGFA 1WCMB 3OMGA 4IUPA 1FR3A 4CKBA 2KCCA 3FEWX 2M2LA 3TP8A 1GUNA 2R6GA 2EJFC 1A6XA 1EY7A 3GTQB 2K33A 2N88A 2ENBA 2NN6I 5I2XA 2NYZD 3J80E 3HKZB 3I91A 4K14A 2CVRA 2RSOA 3R2IA 5LL6S 4C1NI 3MXPA 4QMGA 3OOCA 3HOUB 1ILPA 4ULLA 1ZKOA 1JWUD 5C3WA 2F0GA 2K32A 1EY0A 1G2SA 2Z1CA 5HGTA 3NHHA 3EFXD 5C0XH 1V1PB 5FO8B 1U4PA 3PUXA 1F9SA 1PTOC 3NTIA 2AQ2B 1Q1BA 2GA4B 4A93B 1ZXTA 1PTOD 1J9OA 1XTCD 3A55A 1STGA 1EU4A 1ONLA 1TR5A 3BVZA 3V2TA 4IUQA 3DWAA 2DY7A 3S1NB 1KLUD 1E0BA 2F0WA 2PYKA 3H3VC 4E6IA 3TN2A 1RODA 4FF2A 3KLSX 5C0XI 4JK1C 4XT3B 5HURA 5IGBA 2L1BA 1K8OA 5E1FA 4A3DB 3K5MA 1NAPA 3K59A 3DEOA 5J39A 2NVXB 1Y8PB 4QUFA 4KMUC 2F0IA 4PV1C 2EYFA 4DF7A 2K5QA 3BYTB 5JVG3 1DONA 3TP6A 5FLXE 4K5VA 3N52A 1B9NA 2PZWA 1MSGA 2NVYB 1L0XB 2ZXRA 3GTLB 1VF7A 3AB9A 2D5DA 1S5FD 3BDOA 3BVGA 4V0BA 1CM9A 2QF7A 4DAVA 3J7AF 1STEA 3WOEA 2XIWA 2F0NA 3I4NB 5CR3A 3VR6A 4HCSA 1HCZA 1SYDA 4HEDA 4KKSA 3BDCA 2B2UC 2RDFA 3HP3A 4DAYA 2E2DC 3TZUA 1H9KA 2WACA 4L6TB 4M8AA 1WD1A 3TBIB 1NSNS 3NK9A 1WVLA 1IYUA 1TS4A 5BN5A 1ILQA 2K6AA 1HUNA 3LWUA 1PRTC 2F4IA 1CI3M 1SMYD 3NQTA 4A3BB 5I6WA 4BBSB 3H94A 1PFNA 1VDZA 2PO4A 2ICIA 1LABA 5BN4A 4K2KA 2B2VA 5KNCA 1SXTA 1R9TB 4IUNA 3A54A 4U673 1SNOA 3PUVA 1WTXA 3L7ZC 4A3IB 2N55A 1B4OA 2YU9B 3WDNA 4C3HB 2CHBD 3QOJA 4H13C 3A8KE 1LV9A 4XYOA 2HQEA 2KECA 4RCNA 5EKLA 1TWGB 5JOBA 2EJMA 4IALA 3MVVA 1ICWA 2B2WC 1PFMA 2L11A 3DHQA 3OSOA 2B39A 5IIFA 3HZXA 3I72A 3SR1A 3DXJC 2RBMA 5BN3A 5DNFA 2G9DA 2XN9C 1F77A 2EYPA 2F0DA 4KY5A 3A56A 1EU3A 1SE3A 5C4HA 4DXGA 1XXGA 2K03A 1PTOB 2L4NA 5IT9L 1OXUA 3A8IE 3SK8A 1Q1EA 3RD4A 1AP0A 5J22A 2O5JC 3FDTA 3MZ5A 5CBEE 2XNAC 2R3ZA 1GUTA 4WFN3 2RDHA 3M4YA 1A2UA 3Q0AA 2KA7A 3HOVB 1BCPC 4ZKBB 4IUVA 1B9MA 3VYRA 2O4XA 1O80A 2SNSA 5IGDA 3QJYA 3C2PA 1BO0A 4CJ1B 1EYCA 3GTGB 2LS01 3O13A 3H6MA 1JR0D 2XVSA 2IJ0A 2F0EA 3GTPB 3K57A 1SE4A 3J7AV 2I46A 1QWYA 3C1EA 1ESFA 2VXWA 1TT2A 2JEBI 5FK9C 5COYA 3VA7A 3FKIB 4RKBA 2ZT9C 4FXDA 1AZPA 4A3FB 1GUSA 2Y0SB 1TS3A 5IGGA 4QUCA 2B2YC 2D2CC 2A5HA 3T4AC 4CKCA 3URYA 3W3AA 1CQVA 3PUYA 3S1RB 4ILWA 2JA7B 1DZ1A 4BY7B 4U68A 1A3UA 1E2ZA 4A3GB 4CGYB 1QOHA 2VB3X 4OO1H 5C5MA 3V96A 1MI2A 1UAPA 1AN8A 3SVMA 1HHVA 5JPNC 2IX0A 4EQOA 1SBBB 4A3KB 3NTHA 1EIGA 1MD2D 1WD0A 1M8AA 3IFDA 4XQJA 5M5YB 1Q8IA 3HOWB 2WP8J 5KYIA 1EQVA 2NB0A 1PRTB 1LTAD 3S2DB 3CQZB 4BY1B 4OO1I 3PO2B 1RDPD 2XWBB 2EE1A 3T51B 3TSSA 5T1IA 2AUKA 1F9PA 4BBRB 5ELFA 5DM63 1Z7TA 4M1UB 2E2IB 3MXUA 1EY9A 1EY4A 1V1OA 2K5DA 1WTVA 1EWCA 3V05A 2JSOA 4RGOS 4ZK9B 1GHKA 4FF1A 2A68C 3A8JE 2A68D 3GP7A 1HRJA 1KDAA 4OL7A 1QJOA 1G6ZA 3S17B 1EEFD 1F9RA 3HOZB 1V1PA 4IUTA 5EKKA 4KKUA 2IPKD 2WKDA 3KLRA 1MSHA 3S15B 4IFDH 1YNJC 2M9VA 1YNJD 3NQIA 4J6HA 1Z47A 1FNUA 4PMCA 5C0XJ 5IOCA 2NUCA 3LWEA 4A3JB 1EL0A 1G291 1XX8A 2OT2A 4ZAIA 4IFDI 4K2LA 1EEID 3K0YA 1BCPB 4OHJA 2H1EA 3AMUA 2K01A 3MFGA 2LY7A 3I73A 3HGBA 2HDLA 1LTBD 4UDUC 3NWSA 4X3TA 1F2MA 2PCFB 3SE0A 3OWFA 3MEHA 1EY8A 3BVMA 5M5WB 1EFID 3E6ZX 3UI2A 3SEBA 1CHPD 1F2LA 1KDCA 4IUUA 2E2HB 4ME5A 4XYQA 3EA6A 3VYUA 2F03A 5K36H 3K6OA 4FO2A 2LKVA 2F0FA 4LAAA 3KBXA 2FFKB 5D14A 3CU7A 1SNPA 2LFNA 1Q3LA 2OF1A 4DAPA 2L5TA 2WV6D 1STNA 2BCOA 1Q90A 4OIJA 5JEAG 1LTRD 2F1MA 1HFGA 3MAQA 3NWTA 1TVXA 4Y7NB 3JAML 1HA6A 1KAAA 5A2QL 3IL8A 4XIGS 1T5XD 2DNEA 1NUCA 4IQZA 4BA2I 1TS2A 3T13A 3R93A 2KQ3A 2I07B 3E5SA 3RLFA 1ET9A 3VR5A 1TS5A 3D6WA 1AW7A 3HG9A 4A3MB 1X3QA 1II3A 1R4PB 1TU2B 2TMPA 1X32A 3HRZC 2B2TC 1SYGA 4LJZC 3K5OA 2D62A 1TKWB 2IT1A 4RHSA 3I90A 3OMCA 1QB5D 1VMCA 3A7LA 2EYHA 4R9WA 1RCVD 1W6JA 4RH6A 1NR2A 4FP5D 2LMCB 1TWFB 4FXGC 1D6EC 1CHQD 2KEEA 1BNZA 3FPUB 1PZKD 1RHPA 2OXPA 2NN6G 4DFAA 4C56C 4DU9A 3I8ZA 4QCLA 1JB3A 1DYQA 3Q6SA 3VR3A 4TSSA 4ODGA 2F0LA 3D8GA 1SYEA 3OIPA 1ENAA 5NUCA 4FVMA 3MC0B 5D65A 5CV6A 1BDOA 5M3MB 3J80L 3S1QB 1LLRD 1UEAB 4HN7A 3K5LA 2AWNA 2B8GA 4BS9A 4DXFA 1GUGA 2F3VA 1W6KA 2IX1A 1H9MA 2BE5C 4HSVA 3H09A 1CA6A 1I4HA 2Z4IA 1FNWA 1SE2A 2BE5D 4KD4A 3P1HA 2NVQB 1DOMA 2B63B 5C0XG 4JBWA 4G7HC 1I6HB 5I9PA 2JA8B 1CZGA 5D3DA 1BR9A 3X3NA 1SMYC 4X3SA 4F8MA 1H9JA 3U9OA 1Q12A 5KGUA 2EOTA 2PMZB 3NBHA 3DWPA 5G3LF 2MP1A 1HQRD 2NZ1D 3SXHA 3QG1A 1AZQA 3C3LA 5CV5A 1ENCA 2PZUA 3MFYA 3PO3B 2XRSD 1TY2A 5EPJA 3W2DA 3PIP3 2E74C 3NE5B 3EQLC 4Z9CB 4XQQA 1IKLA 1TIID 3SK5A 3T53B 1D2BA 1PMRA 5FLXL 3I70A 5EGTA 2F3WA 1EYDA 2F0VA 3C46A 2JA6B 1QCBD 3GO5A 1UUPA 2B2UA 2AWOA 4WRDA 1SNQA 2KUMA 2KJXA 1CZWA 2XSCA 4KN4C 1CK1A 1A3VA 4R8IA 2DN8A 4XTCS 3M7GA 2A6EC 5EBCA 1JE4A 3J7YW 1LT4D 5I6YA 5AFWA 4F7XA 3DWQA 3G6JB 1ZYRC 2NWGA 5ISRA 2A6ED 2PW5A 1Y1VB 2Q8RE 2VB2X 4K8IA 4L63B 1ZYRD 1SNCA 1STHA 4KI0A 1G8ZD 4I65A 4HMIA 1GUWA 5C44B 1SYCA 2F0QA 3FRPB 3GTJB 5EJWA 1PZJD 2NVTB 3I3CA 4C3IG 3KLSA 5DEHA 4CJ2C 1O7YA 1HTPA 4X3UA 2XWJB 1NCVA 3TZDA 3ND9A 1MGSA 3P7JA 4DK0A 4AYBB 3GD7A 2BOSA 1HTLD 1BUVT 2MJ8A 1LTGD 1RTOA 1B2TA 3CHBD 1PXUA 1F9QA 2SNMA 2NTSA 2F0TA 5FOBB 1LT5D 2RKSA 3PV0A 1Z6HA 2EYLA 2F0HA 3EJIA 2B2WA 4FF4A 2V4DA 1NR4A 4G7OC 5F2DA 1LT6D 3RUZA 1JOQA 1WTPA 3E0JA 2JXMB 4N9TA 1LTSD 1WTWA 1VF5C 2JP1A 2PNRC 3TMEA 2QILA 4PMWA 1EY5A 1U9RA 2L55A 3K7AB 3OW7A 5KRUA 4NW2A 4KTAA 4IFDJ 1DXMA 4B08A 3I4LA 5KEEA 2FHTA 2EYJA 5JJZA 1JOOA 2X69A 1DM0B 3S9WA 1PTOF 1FNVA 3NUCA 4KJOA 5KYLA 2KEDA 1WTRA 1S5CD 2EDGA 2SDFA 3U9SA 4X3KA 5IGCA 1JWMD 1KTKA 1GXDC 5CV7A 1JCKB 1EWHA 1BF4A 5CV9A 2EY6A 2K5WA 1DD2A 2EY2A 1VMPA 1DOLA 2K05A 1Y8NB 2HDMA 2G9HD 1STBA 3IKJA 5FO7B 3OIQA 3T16A 4K5XA 1EOTA 3KK7A 1LT3D 2B2YA 4KJNA 2KOLA 3TP7A 3K58A 4NDXA 4EVOA 1U4LA 4LK1C 5G3LD 2FMMA 5KNDA 2A6HC 3MWYW 3D4RA 2Z4HA 3M7NA 1WTOA 4KY7A 1CA5A 3RZOB 2VUMB 2A6HD 4PQXA 3J81E 4C3JB 2BDOA 3CKIB 2L9HA 1I4PA 2JEAI 5JEAH 2RA4A 1HUMA 3T56B 2XRQD 1JOKA 4O1NA 3GTOB 1Y1WB 1TWCB 3MXGA 5A2QE 5JVH3 4KKTA 3H91A 5M9OA 4OO1G 1IHZA 2HCCA 2D9UA 3ZYYX 4OIKA 3BG3A 3OPOA 3M4OB 3GTKB 4G7ZC 1PRTF 4CHTB 5C3XA 1B53A 1S4ZA 3L3OC 5ELBA 1QE6A 4P2CB 2R61A 3NP8A 1B1ZA 4J1MA 3NBIA 5CC4A 4C2MB 4XDXA 2X6GA 1ZEQX 2F0MA 5CV4A 5C4XB 4RAUC 1M4VA 3D3RA 5D3IB 4YIJA 2RQXA 2WB1B 4R8NA 1I4GA 2EY5A 2WAQB 3PMFA 3D4DA 3QOLA 1U4MA 3GV6A 5TSSA 2BA1A 1J8IA 4UAIA 4V190 4C3HG 4G57A 2J0TD 1PFBA 3DMUA 1QILA 4BA1I 5CYUA 4KHVA 3Q24A 2HUGA 2OEOA 3C1FA 3KUPA 1O7ZA 2E76C 1U4RA 2WKCA 2DY8A 2RDGA 4QB4A 4FNFA 3R3OA 2O2LD 4S3SA 3Q23A 1I6VC 2E75C 5CGKA 2CQAA 1I4QA 3M3YB 4F87A 5FKAC 4HSPA 1B44D 3H0GB 2YYZA 5C6AA 2J4XA 5IODA 1DJRD 1RD9D 1HA5A 1KLGD 4IFDG 2EY1A 3GV3A 3L9AX 3PUZA 1B3AA 2FMCA 4K8JA 1YNNC 1BOSA 4CBVA 2RSNA 1YNND 4FF3A 2ID0A 1BCPF 5LL6X 3MHBA 1SEBD 4ZQ3A 1BXTA 2QKIC 1D5MC 1D5XC 3EROA 3HOYB 1OO9B 4CKEA 1I4XA 5E4WC 1SNDA 4RGTA 5EPLA 1WTQA 1IKMA 2HCIA 1SYBA 2IL8A 2K1BA 5I9OA 2NBFA 3F2UA 4DK1A 1QNKA 4NP5A 4KY6A 1BQQT 4KD3A 3WOFA 1LACA 5M3FB 2VNUD 1EZ6A 5K36G 1SDFA 4I7ZC 2EYOA 1TQOA 1HQMC 1VCIA 3HOXB 1ET6A 3S14B 3LNNA 3TDQA 4MIUA 1RJTA 1STYA 5C3EB 1K8MA 5C4ZA 1H9SB 2EVBA 2PZTA 4EGVA 4PMBA 2K7VA 4GZYC 2NTTA 4G4KA 2B2VC 2PQEA 1F2ZA 3RZDB 1T5EA 5EQ0A 5CORA 1KABA 4DA2A 3ITPA 1ESRA 3QIAA 4RA8A 3KBGA 4DGZA 3MTSA 3R2TA 5DAUA 3S16B 1CT1D 4RCOA 2B2TA 4F88A 1DCZA 2EPBA 4DNRB 2QCPX 1MBYA 2IWHA 4Q5VA 2K28A 4B9WA 1R4QB 2O5IC 1FYCA 1EY6A 2FINB 1XWEA 5ELCA 4PNYA 3HEJA 3P75A 3NXWA 2WINB 1CQFA 5IT9E 4ZUJA 4IURA 1SAPA 1TY0A 1SNMA 1XYIA 1E2WA 4ID6A 2F0PA 5EPKA 1RKNA 1OXXK 5J1ZA 1PLFA 1PRTD 3OWEB 4XXEA 2QEJC 2ICEC 3GTMB 5KNBA 2K04A 3A7AB 4ABNA 5IGEA 1IYVA 4HMJA 2JA5B 2KCNA 3I4MB 2L0CA 3VA5A 4C3JG 1E2VA 5CBAE 4WJWA 3VR2A 2CW0C 4K6DA 4KK7A 3DUZA 1I3QB 2CW0D 2JYOA 4WORA 3EVQA 5E4XA 3DEPA 3R8BA 4ZRZA 4C1NK 4XQNA 2Q8TA 3GQBA 2DNCA 3AU7A 1HFNA 3N6RA 1KNAA 2R7ZB 2ZXPA 2PW7A 1O7LA 1DOKA 3LX0A 2KVMA 2Z8LA 1G91A 1SYFA 4TKOB 5JAVA 3NSWA 1A15A 2MHVA 4DN4M 5FO9B 2F0KA 1PYWD 2RVLA 1CTMA 2R92B 5EBDA 1I4RA 2JE6I 4ZUIA 2AQ1B 2TSSA 2X6LA 1D5ZC 4N9PA 4O42A 3SHLA 1RTNA 1S5DD 4CJ0B 1S5BD 3S2HB 1JWSD 4H44C 1BCPD 3QWNA 4HCEA 1TWAB 1HPCA 2AQ3B 5KIXA 2E2JB 1Y69U 2EYMA 1OXTA 1UNSA 1HXYD 3PIO3 1L0YB 1G2TA 3BYYB 3VYSA 1GJXA 3IAYA 1H9RA 2BA0A 1V43A 1LO5D 4FXKC 5E3FA 1CFMA 3P20A 2MPMA 3HS0C 2EJGC 1JC7A 2KHSA 5JEAJ 1FGBD 2QDBA 3BS1A 2SOBA 3ONAB 4L8JA 4NKLA 2AUJD 2B8FA 3MXNA 2C9OA 4QF4A 1SSOA 4RKLA 3S1MB 1AFPA 1AEXA 1PZID 2F0UA 4H7BA 2F0OA 1O78A 2IW3A 3MA2B 3QO2A 2IX3A 4RFBA 5C4JB 3M85A 4HAEA 4TQUS 5CV8A 1F2YA 1STAA 4MN3A 3ERQA 3FMCA 5LHY1 4DNTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZEQ X;  3TDQ A;  2L55 A;  3E6Z X;  2VB3 X;  2QCP X;  2VB2 X; 
#chains in the Genus database with same CATH topology
 4OGQ C;  1PVO A;  1HH2 P;  5DM7 3;  3ULP A;  2C5C A;  4LMQ D;  4ZLT F;  1TWH B;  5CMD A;  4EQP A;  1D1K A;  4IJH A;  3VYT A;  4HJ9 A;  4RGM A;  4HTH A;  5EKI A;  1HR0 Q;  1SMX A;  2HHH Q;  3Q22 A;  1SFO B;  4A3B H;  4PZ8 A;  4BBS H;  5EAY A;  4A4I A;  2PPB C;  1EIH A;  5C5L A;  4LF7 L;  2EZV A;  1I50 B;  1ENF A;  2A69 C;  4YWM A;  1A62 A;  5I2Y A;  3FVQ A;  2JA5 H;  3KJO A;  2K5V A;  2Q8I B;  4RHR A;  2A69 D;  1OXS C;  1KC8 C;  1Y8O B;  3I4M H;  3NPP A;  3FPP A;  2EXZ A;  4KV6 A;  2ZXO A;  4K5W A;  4GN4 B;  3W5O A;  3BZD B;  5M5X B;  4DV6 L;  3RMH A;  2J7Z A;  1SJH D;  4HR7 B;  1C8C A;  2ASB A;  3OHX C;  4RWS C;  1JJG A;  4K6L A;  1A2T A;  3KF6 B;  4UPA A;  5C3E G;  1PDQ A;  1PFS A;  1RF2 D;  4LUO A;  1EYA A;  4QIW B;  2PQA B;  1I3Q H;  1IW7 C;  2A74 C;  1GHJ A;  2L12 A;  4IZ8 A;  1A3T A;  5K5P A;  5ELD A;  1C7Y A;  2WII B;  1FGU A;  4X65 Q;  1IW7 D;  4XT1 B;  4TRD A;  5E7N A;  1CUK A;  4OWX B;  4H0L C;  5A35 A;  1QVC A;  4DV2 Q;  1LTL A;  1YZ6 A;  4NMZ A;  1KNE A;  3NTK A;  3CRK C;  3JAM E;  3UDI A;  1XMQ L;  3F2D A;  3D4W A;  2R7Z H;  1SR3 A;  3PUW A;  2A73 B;  4Q0F A;  5JPM C;  4HJ8 A;  1PH5 A;  2M00 A;  3IFT A;  1K28 A;  1YJW A;  3PSI A;  2VQE L;  3CRL C;  1S3O A;  3X3M A;  2SEB D;  1L1O C;  2I5H A;  2B63 G;  1LTI D;  1QG7 A;  4Y52 H;  5ELE A;  3SK4 A;  3VR4 A;  1VQP A;  1PTO H;  1ML0 D;  2MGS A;  5T1G A;  3Q8D A;  4RGN A;  4DR1 L;  2K52 A;  4ZYS A;  5BR8 Q;  3M4P A;  2FJ2 A;  4EQ5 A;  1EQT A;  4C3I B;  4DV7 Q;  1JQY D;  1QNU A;  4A3E B;  1GUO A;  2BDN A;  1GOZ A;  3D6C A;  2MNA A;  3K5N A;  4GNX B;  2F0S A;  4EQN A;  4KHZ A;  3D31 A;  3HOV H;  4MHE A;  2VQF L;  4OXP A;  3H3V H;  1IL8 A;  1D1I A;  2UUA L;  4GN3 B;  3M9B A;  3SDZ A;  2F0J A;  4ZKC B;  1B50 A;  3SK6 A;  2H4O A;  1JIC A;  4DNI A;  4KN7 C;  2MUY A;  5I4D A;  1X3P A;  5DLQ E;  1TWA H;  1P16 A;  4FYD A;  3BDL A;  2PI2 A;  1H9S A;  3TP5 A;  1K83 B;  4BWG B;  1JOR A;  4J8Q A;  3ND8 A;  1C4Q A;  3G7L A;  3GTG H;  1KXL A;  2R7F A;  4B9X A;  1EZ8 A;  1RIP A;  5GAD C;  3RN5 A;  1S5E D;  2NZO A;  1SJE D;  1OXV A;  3KF8 A;  4IN3 A;  1N32 L;  1KDB A;  2DGY A;  2R93 B;  1C48 A;  1FD7 D;  4UP7 A;  1KRT A;  3H3V I;  4DV1 L;  4J15 A;  4LF6 L;  3J81 L;  1V8Q A;  3DM1 A;  1BBX C;  1PYS B;  1Q46 A;  3QB3 A;  1UE1 A;  2NN6 H;  1LTT D;  4QQB X;  2B29 A;  5IGF A;  2Z0S A;  1WCM B;  3OMG A;  3FKI H;  1HJP A;  4IUP A;  4JI8 L;  1FR3 A;  4JI2 Q;  2CCZ A;  1K3B C;  4A3F H;  4CKB A;  2KCC A;  3FEW X;  1MJE A;  1IBK L;  1I94 Q;  4GOP C;  3K7U C;  3ER0 A;  1Y1V G;  2M2L A;  3TP8 A;  1GUN A;  2R6G A;  4ZCK A;  4B3S Q;  2EJF C;  1A6X A;  1EY7 A;  3S1R H;  4JI7 L;  3GTQ B;  4BY7 H;  1PA6 A;  2K33 A;  2N88 A;  2ENB A;  2NN6 I;  2OTJ A;  5I2X A;  2NYZ D;  5C4J H;  3J80 E;  4A3G H;  3HKZ B;  3I91 A;  4HJ5 A;  4K14 A;  4BXX G;  2CVR A;  2RSO A;  3R2I A;  5LL6 S;  4C1N I;  4B3T L;  3MXP A;  4QMG A;  4YCW A;  2YTV A;  3OOC A;  3HOU B;  3PGZ A;  1ILP A;  3UDG A;  2UUB L;  4ULL A;  1ZKO A;  1JWU D;  3W1B A;  5C3W A;  2F0G A;  2K32 A;  1EY0 A;  1G2S A;  2LXK A;  2Z1C A;  5HGT A;  3NHH A;  2P5Z X;  3EFX D;  4YHH L;  4AYB G;  5C0X H;  1CKN A;  1V1P B;  1B3Q A;  5FO8 B;  1TWH H;  1U4P A;  3PUX A;  1F9S A;  1PTO C;  3NTI A;  2R92 G;  2AQ2 B;  1XPR A;  1Q1B A;  2GA4 B;  3OTO L;  2AHO B;  1ZXT A;  4A93 B;  1PTO D;  5IP7 H;  4DR4 Q;  4MTN A;  1J9O A;  1XTC D;  1SFO H;  3S2D H;  3CQZ H;  4HJ7 A;  4BY1 H;  3PO2 H;  3A55 A;  1STG A;  1EU4 A;  1ONL A;  1TR5 A;  3BVZ A;  4K0K Q;  3V2T A;  4IUQ A;  1AH9 A;  3DWA A;  2DY7 A;  1I50 H;  4DV0 L;  3S1N B;  3BZC A;  1KLU D;  1E0B A;  2F0W A;  2PYK A;  3H3V C;  4E6I A;  3TN2 A;  1ROD A;  4FF2 A;  3KLS X;  2UXD L;  4BBR H;  5C0X I;  4JK1 C;  4XT3 B;  5HUR A;  5IGB A;  2L1B A;  2HT1 A;  1K8O A;  5E1F A;  4A3D B;  3K5M A;  3RN2 A;  1VQB A;  1NAP A;  5M5X H;  3K59 A;  3DEO A;  5J39 A;  2NVX B;  1X56 A;  4LFA Q;  1Y8P B;  4QUF A;  4KMU C;  5ELO A;  2F0I A;  3S24 A;  4PV1 C;  4DR3 Q;  2I0Q A;  2EYF A;  4DF7 A;  2K5Q A;  3BYT B;  5JVG 3;  1DON A;  1Q82 C;  3TP6 A;  5FLX E;  2ZTD A;  3KDF B;  4K5V A;  3N52 A;  1B9N A;  2PZW A;  1MSG A;  3HKS A;  4JI1 Q;  1VQ7 A;  4UP8 A;  4B3M Q;  2NVY B;  3JC6 6;  1L0X B;  2ZXR A;  3GTL B;  4DK3 C;  1VF7 A;  3AB9 A;  4P71 A;  2D5D A;  4DV4 Q;  1S5F D;  3BDO A;  3BVG A;  4V0B A;  1CM9 A;  1S40 A;  2QF7 A;  4IPC A;  4DAV A;  3J7A F;  1KQS A;  1N8R C;  1STE A;  3WOE A;  1L1O B;  2KCT A;  3S15 H;  2XIW A;  2F0N A;  3I4N B;  5CR3 A;  3VR6 A;  4HCS A;  5LMN L;  1HCZ A;  1SYD A;  1U0L A;  4HED A;  4KKS A;  3T1Y L;  2ZM6 L;  4IJL A;  4LF4 L;  3BDC A;  2B2U C;  2RDF A;  4HIM A;  3HP3 A;  4H02 A;  4DAY A;  4AQY L;  2JK8 A;  2E2D C;  3TZU A;  1H9K A;  2CKZ B;  1K9M C;  2WAC A;  2Z6K A;  4L6T B;  1GKH A;  1PHJ A;  4UHV A;  4M8A A;  1WD1 A;  3TBI B;  1YHA A;  2CH4 W;  4DUY L;  1M90 C;  1NSN S;  3NK9 A;  1WVL A;  1IYU A;  1TS4 A;  1E7Z A;  3PIP A;  5BN5 A;  1ILQ A;  2YTX A;  2K6A A;  4JOI A;  2LXJ A;  1HUN A;  3LWU A;  1PRT C;  2K5H A;  2F4I A;  1CI3 M;  2QGQ A;  4JI6 Q;  1SMY D;  3NQT A;  1QUQ B;  3SGI A;  4A3B B;  5I6W A;  4X66 Q;  4BBS B;  3H94 A;  1PFN A;  1VDZ A;  2PO4 A;  2ICI A;  1LAB A;  5BN4 A;  4K2K A;  2B2V A;  5KNC A;  4X6A H;  1SXT A;  5M5W H;  1R9T B;  4IUN A;  3A54 A;  4U67 3;  1SNO A;  3L0O A;  4YY3 L;  4IPH A;  2E2H H;  1N33 L;  3PUV A;  1WTX A;  1LM0 A;  3L7Z C;  4A3I B;  2N55 A;  1B4O A;  2YU9 B;  3WDN A;  4C3H B;  5IWA Q;  2CHB D;  4NPS A;  3QOJ A;  2YTY A;  4H13 C;  2KEN A;  3B6Y A;  3A8K E;  1LV9 A;  4PZ6 A;  2RHQ B;  4XYO A;  4QJF A;  1JJ2 A;  2OWO A;  2HQE A;  2KEC A;  4RCN A;  5EKL A;  5IYC H;  1TWG B;  1JT8 A;  5JOB A;  4GOP B;  3PCO B;  1YNX A;  2EJM A;  1XMO Q;  4IAL A;  4Y7N H;  4JBK A;  3MVV A;  3GTQ H;  1ICW A;  5FLM H;  1VQM A;  2B2W C;  1PFM A;  2L11 A;  3DHQ A;  2E5L Q;  3OSO A;  2B39 A;  5IIF A;  1G6P A;  4RMF A;  2JA9 A;  1EIY B;  3HZX A;  3I72 A;  3SR1 A;  3DXJ C;  2Q2T A;  2RBM A;  5BN3 A;  3TQY A;  5DNF A;  1KRS A;  1X3E A;  2G9D A;  2PI2 E;  2XN9 C;  4IPG A;  3H15 A;  1F77 A;  4LW1 A;  3WWV A;  2EYP A;  1EIF A;  2F0D A;  4KY5 A;  3NEM A;  5IP9 H;  4YCV A;  3A56 A;  2G5D A;  3T1H Q;  4JV5 L;  1EU3 A;  4YWK A;  4A3C G;  1SE3 A;  5C4H A;  4DAM A;  5L37 A;  4DXG A;  1XXG A;  1N9W A;  2K03 A;  1PTO B;  2L4N A;  4A3M H;  5IT9 L;  1OXU A;  4A93 H;  3A8I E;  3SK8 A;  1YIJ A;  1Q1E A;  1YBY A;  3RD4 A;  4ALP A;  4LFB Q;  1AP0 A;  4A3E G;  2UXC L;  5J22 A;  2O5J C;  3FDT A;  4UY8 C;  3MZ5 A;  5CBE E;  1NJI C;  2XNA C;  2R3Z A;  2R7D A;  1GUT A;  4WFN 3;  2WB1 G;  2RDH A;  3M4Y A;  1A2U A;  1FVI A;  4APV A;  3J81 i;  3Q0A A;  3CCR A;  3S1N H;  5IYB G;  2KA7 A;  3HOV B;  1IBM L;  4LF8 L;  1BCP C;  4ZKB B;  4IUV A;  1B9M A;  3KF6 A;  2YV5 A;  3VYR A;  3TRZ A;  2O4X A;  1O80 A;  2SNS A;  2PQA A;  2K50 A;  5IGD A;  1SLJ A;  2NVX H;  3RLN A;  3QJY A;  3C2P A;  1BO0 A;  4CJ1 B;  1EYC A;  3GTG B;  2LS0 1;  3O13 A;  3H6M A;  5GAG C;  1JR0 D;  2R93 G;  2XVS A;  3F2C A;  5JJL A;  2IJ0 A;  3NBH B;  2F0E A;  3GTP B;  3K57 A;  1K73 C;  2AKW B;  4X64 Q;  1SE4 A;  3J7A V;  2I46 A;  1VQF A;  1TXY A;  1QWY A;  3C1E A;  1ESF A;  5GQO A;  1L0W A;  4LF9 L;  2VXW A;  1TT2 A;  4MNO A;  3GTL H;  3VDY A;  2JEB I;  1YHQ A;  3FP9 A;  5FK9 C;  1EYG A;  5COY A;  2VW9 A;  3VA7 A;  2MO1 A;  2F52 A;  3FKI B;  1PH2 A;  4RKB A;  2ZT9 C;  4FXD A;  5GAH C;  2N3S A;  4A3F B;  1AZP A;  1GUS A;  2Y0S B;  1TS3 A;  5IGG A;  1NTG A;  4ME3 A;  4QUC A;  2B2Y C;  2D2C C;  2IHF A;  5IE8 A;  2A5H A;  3T4A C;  4CKC A;  4B3R L;  3URY A;  3W3A A;  4R4C A;  5M3M H;  1CQV A;  3PUY A;  3S1R B;  4ILW A;  2JA7 B;  1DZ1 A;  1X65 A;  3E9H A;  4BY7 B;  4U68 A;  2D0P A;  3EIV A;  1A3U A;  1E2Z A;  3BZK A;  1N36 Q;  4OX9 L;  2VS1 A;  4A3G B;  4DR2 L;  5LMU Q;  4CGY B;  1AE3 A;  1QOH A;  4GNX A;  2VB3 X;  3HOU G;  4OO1 H;  5C5M A;  3V96 A;  1MI2 A;  4L5S A;  1UAP A;  1AN8 A;  1ICF B;  3SVM A;  1HNW Q;  5JPN C;  1HHV A;  2IX0 A;  4EQO A;  2QEX A;  1SBB B;  4A3K B;  2NVQ H;  3NTH A;  1EIG A;  1YIT A;  2B63 H;  1MD2 D;  1WD0 A;  3HOY G;  1M8A A;  3CW2 C;  3IFD A;  4XQJ A;  1QVG A;  5M5Y B;  1Q8I A;  1CKO A;  1YI2 A;  3HOW B;  2WP8 J;  2JA8 H;  5KYI A;  2CFM A;  4OWT B;  1EQV A;  1KL9 A;  2NB0 A;  1PRT B;  4PG3 A;  4YWL A;  2A1A A;  1LTA D;  4JI3 Q;  3S2D B;  3CQZ B;  4BY1 B;  4OO1 I;  3PO2 B;  1K3R A;  1GO3 E;  1RDP D;  1J5E Q;  2XWB B;  1KAW A;  4LFC L;  1D7Q A;  2EE1 A;  5M3F G;  4A75 A;  1R9T H;  3T51 B;  3TSS A;  1VS0 A;  5T1I A;  2AUK A;  1F9P A;  3PO3 H;  1HZC A;  4A3D G;  4BBR B;  2ZJP A;  1QZG A;  3AEV A;  5ELF A;  4A3I H;  2YU9 H;  4JI7 Q;  4JG2 A;  4AYB E;  4C3H H;  5DM6 3;  5FJ8 H;  1Z7T A;  4M1U B;  2E2I B;  3HOX G;  1B7Y B;  4JI5 Q;  3MXU A;  1EY9 A;  1EY4 A;  1V1O A;  2K5D A;  1HNX L;  2GN5 A;  3J7A 5;  3IRB A;  1WTV A;  1EWC A;  3V05 A;  2JSO A;  1HNZ Q;  1TWG H;  4RGO S;  4ZK9 B;  4HIO A;  1GHK A;  3FHW A;  2JA6 H;  4FF1 A;  2A68 C;  4CDC C;  4R4Q A;  3A8J E;  1IBL L;  2A68 D;  1D8L A;  3GP7 A;  1HRJ A;  1KDA A;  4OL7 A;  1QJO A;  1VQ6 A;  4DR7 L;  1G6Z A;  3S17 B;  1EEF D;  1HZ9 A;  1F9R A;  2ZTC A;  4IOA A;  2UXB L;  3HOZ B;  3I7F A;  1VQN A;  2JN4 A;  1V1P A;  4IUT A;  5EKK A;  4KKU A;  3I4N G;  2IPK D;  2WKD A;  4LF5 L;  3KLR A;  1MSH A;  3S15 B;  4IFD H;  1YNJ C;  2M9V A;  4DR5 Q;  4GLV B;  2Z6B A;  1YNJ D;  3NQI A;  4J6H A;  1Z47 A;  2Q2I A;  2F4V Q;  5C44 H;  4A3L G;  1FNU A;  4PMC A;  5HY6 A;  1Y14 B;  5IOC A;  5C0X J;  2NVT H;  2UUC L;  2NUC A;  3LWE A;  4A3J B;  1EL0 A;  1G29 1;  1QZH A;  4JI4 Q;  2UU9 L;  4GKJ L;  1XX8 A;  2NZH A;  2OT2 A;  1EWI A;  4DUZ Q;  4ZAI A;  4IFD I;  4K2L A;  1EEI D;  3K0Y A;  1BCP B;  1VQJ A;  2H1E A;  4OHJ A;  3AMU A;  2K01 A;  3MFG A;  4DKA C;  2LY7 A;  3I73 A;  3HGB A;  2HDL A;  3K0X A;  2N78 A;  3TEH B;  1LTB D;  4UDU C;  3NWS A;  4X3T A;  2VY3 A;  1F2M A;  3RLO A;  4A3B G;  2PCF B;  2A19 A;  3SE0 A;  4BBS G;  3KDF A;  3OWF A;  3BJU A;  4JI0 L;  3MEH A;  1Q7Y C;  3CC4 A;  4NXM L;  1NE3 A;  1EY8 A;  2KBN A;  4LNQ A;  3BVM A;  5M5W B;  1EFI D;  1X54 A;  2JA5 G;  1VQ5 A;  3E6Z X;  4GN5 A;  3UI2 A;  3SEB A;  4DV5 L;  1CHP D;  1WI5 A;  3I4M G;  1F2L A;  1KDC A;  4IUU A;  2E2H B;  3GTP H;  3G71 A;  4ME5 A;  4XYQ A;  3EA6 A;  1GM5 A;  1LUZ A;  3VYU A;  2F03 A;  5K36 H;  3K6O A;  4FO2 A;  2LKV A;  2F0F A;  4LAA A;  3KBX A;  2FFK B;  1IYJ B;  5D14 A;  3CU7 A;  5HGQ A;  1SNP A;  2LFN A;  1Q3L A;  3F1Z A;  1L1O A;  3G4S A;  3RNU A;  2OF1 A;  4DAP A;  2L5T A;  3E0E A;  4QL5 A;  2WV6 D;  1STN A;  2BCO A;  1Q90 A;  4OIJ A;  5JEA G;  1XTD A;  1LTR D;  2F1M A;  1HFG A;  4GKK Q;  3K7A H;  3MAQ A;  3NWT A;  1PH4 A;  1TVX A;  1JB7 A;  1HR0 L;  4Y7N B;  1NMG A;  3JAM L;  2HHH L;  1HA6 A;  1KAA A;  2JA7 H;  5A2Q L;  3IL8 A;  2R7Z G;  4XIG S;  1T5X D;  2DNE A;  1NUC A;  1VQL A;  4IQZ A;  4BA2 I;  1TS2 A;  3T13 A;  4UP9 A;  3R93 A;  1WFQ A;  2KQ3 A;  4NXN Q;  4QIW E;  2I07 B;  1YJN A;  4A3K H;  3MEF A;  1XJV A;  3E5S A;  3RLF A;  1X6O A;  1ET9 A;  3VR5 A;  2EIF A;  3UE0 A;  1TS5 A;  5M5Y H;  3HOW H;  5JJK A;  1GVP A;  1QUQ A;  3D6W A;  1E22 A;  1AW7 A;  3HG9 A;  4QY7 A;  2C35 B;  4LUV A;  4A3M B;  1X3Q A;  1EQR A;  1II3 A;  1R4P B;  1XNQ Q;  2N8N A;  5IYD H;  1TU2 B;  4X65 L;  2TMP A;  3CD6 A;  3J81 c;  1X32 A;  3HOV G;  3HRZ C;  2B2T C;  1SYG A;  4LJZ C;  3K5O A;  2D62 A;  1TKW B;  2IT1 A;  4DV2 L;  1BBW A;  4RHS A;  3I90 A;  2OTL A;  1NY4 A;  1KD1 C;  3OMC A;  1QB5 D;  1VMC A;  3A7L A;  4JVZ A;  2EYH A;  4R9W A;  3CME A;  1RCV D;  1W6J A;  2E2I H;  4RH6 A;  1NR2 A;  3STB C;  4FP5 D;  4I7A A;  3K81 C;  4GOP A;  2LMC B;  1TWF B;  3CCJ A;  4X62 L;  4FXG C;  3STB D;  2DJG C;  1KIX A;  1XNR Q;  1D6E C;  1CHQ D;  1A0I A;  2ZJR A;  2KEE A;  1BNZ A;  2OCE A;  3FPU B;  2WB1 E;  1N34 Q;  1PZK D;  1RHP A;  3CCU A;  2WAQ E;  1B8A A;  2OXP A;  2NN6 G;  4DFA A;  2VUM H;  3RZO H;  4C56 C;  5BR8 L;  1FJG Q;  4DU9 A;  3L2P A;  3I8Z A;  4QCL A;  1JB3 A;  1DYQ A;  4C3J H;  3Q6S A;  3VR3 A;  4TSS A;  4DV7 L;  3S17 H;  4ODG A;  1QVF A;  2F0L A;  1K0R A;  3FKI G;  4A3F G;  3D8G A;  2Y0S G;  1SYE A;  3OIP A;  1E1O A;  1ENA A;  3KYH C;  5NUC A;  3HOZ H;  4FVM A;  3MC0 B;  2D0O A;  3BU2 A;  3CP0 A;  5D65 A;  5CV6 A;  3KJP A;  1BDO A;  5M3M B;  3GTO H;  4BY7 G;  4NB3 A;  4O2D A;  1Y1W H;  1TWC H;  3A0J A;  1ASY A;  3J80 L;  3S1Q B;  1LLR D;  2HD3 A;  2ES2 A;  1UEA B;  4HN7 A;  3K5L A;  2AWN A;  2B8G A;  3DM3 A;  4BS9 A;  1GUG A;  4DXF A;  5H1S E;  2F3V A;  1W6K A;  4JYA Q;  2IX1 A;  4A3J H;  1H9M A;  2BE5 C;  4HSV A;  3H09 A;  1CA6 A;  1I4H A;  1VQH A;  2Z4I A;  1FNW A;  1BVS A;  1SE2 A;  2BE5 D;  4KD4 A;  3P1H A;  3ZJY C;  3M4O H;  2NVQ B;  2RHS B;  1DOM A;  2B63 B;  5C0X G;  4JBW A;  4G7H C;  1I6H B;  3I56 A;  1VQI A;  5I9P A;  2JA8 B;  1CZG A;  5D3D A;  3CCM A;  1BR9 A;  5J3B A;  5IP7 G;  3X3N A;  2E8G A;  1SMY C;  4X3S A;  4F8M A;  1V9P A;  4BY1 G;  1W2B A;  1H9J A;  3PO2 G;  3U9O A;  1Q12 A;  4JI2 L;  4DR6 Q;  5KGU A;  2EOT A;  2PMZ B;  2RF4 A;  3NBH A;  3CC2 A;  5C4X H;  3DWP A;  5G3L F;  2MP1 A;  1I94 L;  1HQR D;  3AFP A;  2NZ1 D;  3SXH A;  3QG1 A;  4B3S L;  4POG A;  1AZQ A;  3C3L A;  1EQQ A;  5CV5 A;  4BBR G;  1ENC A;  2PZU A;  3MFY A;  3PO3 B;  1Q86 C;  2XRS D;  1TY2 A;  5EPJ A;  3W2D A;  3PIP 3;  2E74 C;  3NE5 B;  3EQL C;  4Z9C B;  1FL0 A;  4DV3 Q;  4XQQ A;  1IKL A;  1TII D;  3SK5 A;  5AJ3 Q;  3T53 B;  4DR2 Q;  1M1K C;  3UDX A;  3CC7 A;  5JJI A;  1OTC A;  1D2B A;  1PMR A;  4N8F A;  1BKB A;  2B3G A;  5FLX L;  2QDL A;  3I70 A;  5EGT A;  4LUZ A;  3ULJ A;  2F3W A;  1EYD A;  2F0V A;  3C46 A;  2JA6 B;  1QCB D;  1ASZ A;  3GO5 A;  1A8V A;  1UUP A;  2B2U A;  2AWO A;  4WRD A;  4DR4 L;  3CPF A;  3OW2 A;  2QW7 A;  2JQO A;  1MIU A;  1SNQ A;  4P75 A;  2KUM A;  4K0K L;  2KJX A;  1CZW A;  2XSC A;  4KN4 C;  4CDE C;  1CK1 A;  3H0G H;  1A3V A;  4R8I A;  1JE5 A;  2DN8 A;  4XTC S;  3M7G A;  2A6E C;  5EBC A;  1JE4 A;  3J7Y W;  1IL2 A;  1LT4 D;  5I6Y A;  5AFW A;  4F7X A;  3TS2 A;  3DWQ A;  3G6J B;  4LF7 Q;  2N49 A;  4HIK A;  1ZYR C;  2NWG A;  5ISR A;  2A6E D;  2PW5 A;  1VQ9 A;  1Y1V B;  2Q8R E;  2VB2 X;  4GLX A;  4K8I A;  4L63 B;  1ZYR D;  1SNC A;  1EUJ A;  1STH A;  4KI0 A;  3PF5 A;  1G8Z D;  4I65 A;  4FDB A;  4HMI A;  1GUW A;  1W3S A;  4LFA L;  5C44 B;  1CSQ A;  4JCV E;  4A76 A;  1SYC A;  2F0Q A;  3FRP B;  3GTJ B;  5EJW A;  1PZJ D;  4DV6 Q;  2NVT B;  4GS3 A;  1HZB A;  4DR3 L;  3I3C A;  2KHI A;  4C3I G;  3A74 A;  4JW0 A;  3KLS A;  4P73 A;  1PH3 A;  4R4O A;  5DEH A;  4CJ2 C;  1O7Y A;  1HTP A;  2F3I A;  1UEB A;  4X3U A;  2XWJ B;  1NCV A;  3TZD A;  3ND9 A;  4RG1 A;  1MGS A;  4JI1 L;  3P7J A;  1V1Q A;  1Q8K A;  4N8X 1;  3E3X A;  4B3M L;  4DK0 A;  4AYB B;  1PH8 A;  1H95 A;  1K0S A;  3GD7 A;  2BOS A;  3ULL A;  4DV4 L;  1HTL D;  1BUV T;  1C0A A;  2MJ8 A;  1LTG D;  1RTO A;  1B2T A;  3CHB D;  1PXU A;  1F9Q A;  2SNM A;  2NTS A;  2F0T A;  5FOB B;  1LT5 D;  1XMQ Q;  2RKS A;  3HFZ B;  1TWF H;  3LGJ A;  2VQE Q;  3PV0 A;  3JAM i;  1Z6H A;  1C9O A;  2EYL A;  3KOJ A;  2F0H A;  2EQS A;  3EJI A;  3M4Q A;  2B2W A;  1X3F A;  2V4D A;  4FF4 A;  4QGU A;  3QR8 A;  2Q2U A;  1NR4 A;  4YCU A;  4G7O C;  5F2D A;  1LT6 D;  3RUZ A;  5GAE C;  1JOQ A;  1WTP A;  2K5N A;  3E0J A;  2JXM B;  4HID A;  1WCM G;  3S14 H;  4N9T A;  4DR1 Q;  1SRO A;  1LTS D;  5C3E H;  5IYC G;  1WTW A;  1VF5 C;  2JP1 A;  1X55 A;  2PNR C;  1DGS A;  3TME A;  5IT9 c;  2QIL A;  3NEN A;  4PMW A;  1EY5 A;  1U9R A;  3RZD H;  2L55 A;  3K7A B;  3OW7 A;  2VQF Q;  5FLM G;  2UUA Q;  4JI6 L;  5KRU A;  3S1Q H;  1WTH A;  4NW2 A;  4KTA A;  3HKZ G;  4IFD J;  1DXM A;  4X66 L;  4B08 A;  3I4L A;  5KEE A;  3CAM A;  2FHT A;  4KHP L;  2EYJ A;  5JJZ A;  4L5R C;  1JOO A;  3NEL A;  2X69 A;  1DM0 B;  3S9W A;  1PTO F;  1IZ6 A;  5IP9 G;  1FNV A;  1I6H H;  3NUC A;  1N32 Q;  4KJO A;  5KYL A;  5IWA L;  1MKH A;  2KED A;  1WTR A;  1S5C D;  2EDG A;  2SDF A;  4A3M G;  1UE7 A;  4X3K A;  3U9S A;  5IGC A;  4DV1 Q;  4A93 G;  1JWM D;  4LF6 Q;  1KTK A;  1GXD C;  2ZTE A;  2DJF C;  3G6E A;  5CV7 A;  4WJ3 M;  1JCK B;  1EWH A;  2KCM A;  4JPB W;  1BF4 A;  2CH4 A;  5CV9 A;  3K8A A;  1SE8 A;  4JI8 Q;  2EY6 A;  2K5W A;  2HQL A;  4L5T A;  1XMO L;  1DD2 A;  2EY2 A;  1VMP A;  2V1C C;  1IBK Q;  1DOL A;  2K05 A;  4O0A A;  1Y8N B;  2EXD A;  2HDM A;  2G9H D;  1STB A;  3IKJ A;  2E5L L;  5FO7 B;  1A63 A;  4IO9 A;  3OIQ A;  3T16 A;  3U50 C;  3DLL A;  1WOC A;  4K5X A;  1EOT A;  3KK7 A;  1LT3 D;  2B2Y A;  4KJN A;  2KOL A;  3GTM H;  4B3T Q;  4JBM A;  3U4Z A;  3TP7 A;  3K58 A;  4NDX A;  2UUB Q;  4EVO A;  1U4L A;  3J80 i;  2K4K A;  3T1H L;  3TS0 A;  4LK1 C;  2GVB A;  5G3L D;  1RL2 A;  2FMM A;  4YHH Q;  5KND A;  2A6H C;  3MWY W;  2MQH A;  2DUD A;  3D4R A;  2Z4H A;  3M7N A;  1WTO A;  4KY7 A;  1CA5 A;  3PF4 A;  3RZO B;  2VUM B;  2A6H D;  4PQX A;  3J81 E;  4LFB L;  4C3J B;  1X3G A;  3I4O A;  2BDO A;  1WYD A;  3OTO Q;  3CKI B;  1VQK A;  2L9H A;  1I4P A;  3OYY A;  2OQK A;  2JEA I;  5JEA H;  2RA4 A;  1HUM A;  3T56 B;  5M3M G;  2ALY B;  2XRQ D;  4DV0 Q;  1Y1V H;  1JOK A;  4O1N A;  3GTO B;  2UXD Q;  1Y1W B;  1HZA A;  1TWC B;  3MXG A;  5A2Q E;  5JVH 3;  4KKT A;  3H91 A;  5M9O A;  2KHJ A;  4OO1 G;  3GTJ H;  1GD7 A;  1IHZ A;  2HCC A;  2D9U A;  4BXX H;  3ZYY X;  4OIK A;  2L15 A;  4X62 Q;  3BG3 A;  2HIV A;  3OPO A;  2Y0S E;  3M4O B;  4CDF C;  3GTK B;  4X64 L;  4G7Z C;  1PRT F;  4CHT B;  5C3X A;  2JA8 G;  3MXN B;  1PH6 A;  1B53 A;  1S4Z A;  2FXQ A;  3L3O C;  5ELB A;  1XPU A;  1QE6 A;  4P2C B;  2BH8 A;  1UE6 A;  2R61 A;  3NP8 A;  2R92 H;  1B1Z A;  1SRU A;  2ZJQ A;  4J1M A;  3NBI A;  5CC4 A;  4C2M B;  4XDX A;  2X6G A;  1ZEQ X;  2F0M A;  5CV4 A;  3CPW A;  2MO0 A;  5C4X B;  4RAU C;  1M4V A;  1SN8 A;  3D3R A;  5D3I B;  4YIJ A;  2RQX A;  2WB1 B;  1HR0 W;  4R8N A;  1I4G A;  2EY5 A;  2WAQ B;  3PMF A;  3PO3 G;  2RCN A;  3D4D A;  1YHB A;  3QOL A;  1U4M A;  3GV6 A;  1S72 A;  3S2H H;  5TSS A;  2BA1 A;  1J8I A;  4A3I G;  4UAI A;  4V19 0;  4C3H G;  5FJ8 G;  1N36 L;  1VQE A;  5LMN Q;  5LMU L;  3F8T A;  4G57 A;  2J0T D;  1PFB A;  3DMU A;  1QIL A;  2E2J H;  4BA1 I;  5CYU A;  3T1Y Q;  1G51 A;  2ZM6 Q;  1HNW L;  4KHV A;  4LF4 Q;  1E1T A;  3Q24 A;  2PNH A;  4AQY Q;  2HUG A;  2OEO A;  3C1F A;  1CSP A;  2Z9H A;  3KUP A;  1B70 B;  1O7Z A;  2E76 C;  1U4R A;  2JA6 G;  2WKC A;  2DY8 A;  1BBU A;  1YEZ A;  1JJC B;  2RDG A;  4QB4 A;  4FNF A;  3R3O A;  2O2L D;  4S3S A;  4JI3 L;  3Q23 A;  4DUY Q;  1I6V C;  1VQD A;  2E75 C;  5CGK A;  2CQA A;  1PYB A;  1I4Q A;  3M3Y B;  4F87 A;  1J5E L;  5FKA C;  4HSP A;  1B44 D;  3H0G B;  2YYZ A;  5C6A A;  2J4X A;  5IOD A;  1DJR D;  1RD9 D;  1YVC A;  1HA5 A;  1KLG D;  4IFD G;  1NBW A;  3S1M H;  1EFW A;  2EY1 A;  3EN2 A;  3GV3 A;  3CCV A;  4R4I A;  3L9A X;  4YY3 Q;  3PUZ A;  5C44 G;  2VL6 A;  1B3A A;  4JI5 L;  3PQI A;  1N33 Q;  2FMC A;  4K8J A;  1YNN C;  1BOS A;  4CBV A;  3I2Z A;  2RSN A;  1YNN D;  1HNZ L;  3GDE A;  3TRE A;  2A8V A;  1PH7 A;  4FF3 A;  2ID0 A;  1BCP F;  2H5X A;  1VQ4 A;  5LL6 X;  3MHB A;  1SEB D;  1K8G A;  4EX5 A;  4ZQ3 A;  1BXT A;  2QKI C;  1D5M C;  1D5X C;  3ERO A;  4JBJ A;  3HOY B;  4HJA A;  1OO9 B;  4CKE A;  1I4X A;  5E4W C;  3ERS X;  1SND A;  3K80 C;  4RGT A;  5EPL A;  1WTQ A;  1IKM A;  2HCI A;  1SYB A;  2IL8 A;  2K1B A;  5I9O A;  1VQ8 A;  2NBF A;  3F2U A;  1LYL A;  4DK1 A;  4IOC A;  1QNK A;  4NP5 A;  4KY6 A;  1BQQ T;  3G48 A;  4KD3 A;  1X9N A;  3WOF A;  3JAM c;  1LAC A;  5M3F B;  5LMN W;  4DR5 L;  2VNU D;  2Z6K C;  5IY0 A;  2F4V L;  1EZ6 A;  5K36 G;  1SDF A;  4I7Z C;  4JV5 Q;  2EYO A;  1TQO A;  1HQM C;  1VCI A;  2OQ0 A;  3HOX B;  1ET6 A;  1XPO A;  1NMF A;  4L5Q A;  4JI4 L;  3S14 B;  4JOI C;  3LNN A;  3TDQ A;  4MIU A;  1RJT A;  3UDF A;  5GRO A;  1STY A;  5C3E B;  1K8M A;  4DUZ L;  2UXC Q;  5C4Z A;  1H9S B;  2EVB A;  2PZT A;  4EGV A;  4PMB A;  2K7V A;  4DK6 C;  3U58 A;  4GZY C;  2NTT A;  4G4K A;  2B2V C;  2PQE A;  1KHI A;  1F2Z A;  2JA7 G;  3RZD B;  1IBM Q;  4LF8 Q;  3KF8 B;  1T5E A;  5EQ0 A;  5COR A;  1KAB A;  4DA2 A;  1P8L A;  3ITP A;  1ESR A;  3QIA A;  4RA8 A;  3KBG A;  4AIM A;  4DGZ A;  4A3G G;  3MTS A;  3R2T A;  2ATW A;  5DAU A;  3S16 B;  1CT1 D;  4RCO A;  2B2T A;  1VQA A;  4F88 A;  1DCZ A;  2JJQ A;  2EPB A;  4A3K G;  4DNR B;  2QCP X;  1MBY A;  2HIX A;  2IWH A;  4Q5V A;  2K28 A;  4B9W A;  3GTK H;  3HOW G;  1R4Q B;  2O5I C;  1FYC A;  1EY6 A;  2FIN B;  2WFW A;  1XWE A;  1UWV A;  3AQQ A;  5ELC A;  4A3C H;  4PNY A;  1WJJ A;  3HEJ A;  3P75 A;  3NXW A;  2WIN B;  1CQF A;  5IT9 E;  3A5U A;  5IYD G;  4LF9 Q;  4C3I H;  2RCF A;  3HKZ E;  4C2M H;  1K8A C;  4ZUJ A;  4A3E H;  4IUR A;  4MZ9 A;  2IY5 B;  1SAP A;  1TY0 A;  1SNM A;  1XYI A;  1E2W A;  4ID6 A;  4GKK L;  2I5L X;  2F0P A;  5IYB H;  5EPK A;  1RKN A;  4B3R Q;  1OXX K;  1YJ9 A;  1AE2 A;  5J1Z A;  1PLF A;  1PRT D;  3OWE B;  4XXE A;  1K83 H;  3CCS A;  4GLA C;  1CKN B;  4NXN L;  4OX9 Q;  4KHP Q;  4OEL B;  2QEJ C;  2ICE C;  3GTM B;  5KNB A;  3KLW A;  2K04 A;  3A7A B;  4ABN A;  5IGE A;  4OON A;  4JC0 A;  1IYV A;  4HMJ A;  3J80 c;  2JA5 B;  3CCE A;  2R93 H;  2KCN A;  3I4M B;  2L0C A;  3UE1 A;  3VA5 A;  2VUM G;  1VQO A;  2LSS A;  4C3J G;  1E2V A;  5CBA E;  2XTI A;  1WCM H;  4WJW A;  3VR2 A;  2CW0 C;  1XNQ L;  3CMA A;  4K6D A;  3M3Y H;  3A5Z B;  4KK7 A;  4LWC A;  3DUZ A;  2I5M X;  4KLK A;  3HOZ G;  1I3Q B;  3RR5 A;  2CW0 D;  2JYO A;  3AYH B;  4WOR A;  3EVQ A;  5E4X A;  3DEP A;  4R4T A;  3R8B A;  1Z9F A;  4ZRZ A;  4C1N K;  1U5K A;  4XQN A;  3U4V A;  4LFC Q;  2MFI A;  2Q8T A;  3GQB A;  3J81 j;  2DNC A;  3W1G A;  1EOV A;  1Y1W G;  4CDD C;  3AU7 A;  3CCQ A;  1HFN A;  4OWW B;  3N6R A;  1KNA A;  2R7Z B;  2ZXP A;  2PW7 A;  3F2B A;  3CCL A;  1PH1 A;  3D0F A;  4A3J G;  1XNR L;  2AMC B;  1O7L A;  3HOU H;  1DOK A;  3LX0 A;  1HNX Q;  2KVM A;  2Z8L A;  1G91 A;  1SYF A;  4TKO B;  5JAV A;  1N34 L;  2VZA A;  3NSW A;  3CXC A;  4WJ4 A;  4P72 A;  1A15 A;  2MHV A;  1FJG L;  3HOY H;  4DN4 M;  5FO9 B;  2F0K A;  2GVA A;  1PYW D;  2RVL A;  5FLX c;  1CTM A;  2R92 B;  1IBL Q;  5EBD A;  1I4R A;  2JE6 I;  5C4X G;  4DR7 Q;  4ZUI A;  2AQ1 B;  2TSS A;  2X6L A;  2IHE A;  1D5Z C;  4N9P A;  4AH6 A;  4O42 A;  2UXB Q;  3PIO A;  2WAQ G;  3SHL A;  4GNX C;  1RTN A;  4DAY B;  5M3F H;  1S5D D;  1I5F A;  4CJ0 B;  1S5B D;  3S2H B;  1JWS D;  4H44 C;  1BCP D;  4LF5 Q;  3QWN A;  4HCE A;  4A3D H;  1VQG A;  1T9H A;  1TWA B;  4JYA L;  1HPC A;  2AQ3 B;  5KIX A;  2E2J B;  1E24 A;  3HOX H;  1Y69 U;  2EYM A;  4DPG A;  1OXT A;  1IXR A;  2Q2H A;  1UNS A;  1HXY D;  2UUC Q;  2PMZ E;  3PIO 3;  1L0Y B;  1G2T A;  3BYY B;  3VYS A;  3ICE A;  1GJX A;  3IAY A;  2UU9 Q;  4GKJ Q;  1H9R A;  2BA0 A;  1V43 A;  1Q81 C;  1MHW C;  4FXK C;  1LO5 D;  1UE5 A;  5E3F A;  1CFM A;  2XGT A;  3P20 A;  2MPM A;  3HS0 C;  2EJG C;  1JC7 A;  4IPD A;  2K14 A;  2KHS A;  4R1J A;  5JEA J;  1FGB D;  2NVY H;  2QDB A;  3BS1 A;  4DR6 L;  2SOB A;  1L2F A;  1VQC A;  3ONA B;  4L8J A;  4NKL A;  2QA4 A;  3H0G G;  2CQO A;  3S16 H;  2AUJ D;  2B8F A;  3KFU A;  3MXN A;  4JI0 Q;  2C9O A;  4NXM Q;  4PZ7 A;  4QF4 A;  2CWP A;  3J7Z C;  1NNX A;  1SSO A;  2K75 A;  2BH2 A;  1MJC A;  3I4N H;  3E9I A;  4RKL A;  3CF5 A;  5ELN A;  3S1M B;  1J6Q A;  1AFP A;  1AEX A;  1PZI D;  2F0U A;  1CKM A;  4DV5 Q;  4DV3 L;  4H7B A;  1PH9 A;  2F0O A;  3EBE A;  1O78 A;  2IW3 A;  4POF A;  3MA2 B;  3QO2 A;  2IX3 A;  5AJ3 L;  4RFB A;  5C4J B;  3M85 A;  4HAE A;  4TQU S;  4A3L H;  4MTK A;  2CWA A;  4P74 A;  5CV8 A;  1F2Y A;  1STA A;  1JMC A;  4MN3 A;  4OEM B;  3ERQ A;  3I55 A;  1PV4 A;  1E3P A;  1O7I A;  3FMC A;  3AFQ A;  4TVA B;  5LHY 1;  4DNT B; 
#chains in the Genus database with same CATH homology
 4OGQ C;  5DM7 3;  2C5C A;  4LMQ D;  4ZLT F;  1TWH B;  5CMD A;  4EQP A;  1D1K A;  3VYT A;  4RGM A;  4HTH A;  5EKI A;  3Q22 A;  1SFO B;  1EIH A;  2PPB C;  5C5L A;  2EZV A;  1I50 B;  1ENF A;  2A69 C;  5I2Y A;  3FVQ A;  2Q8I B;  4RHR A;  2A69 D;  1OXS C;  1Y8O B;  3NPP A;  3FPP A;  2EXZ A;  4KV6 A;  2ZXO A;  4K5W A;  3BZD B;  5M5X B;  3RMH A;  2J7Z A;  1SJH D;  4HR7 B;  1C8C A;  3OHX C;  4RWS C;  4K6L A;  1A2T A;  1PDQ A;  1RF2 D;  1EYA A;  4QIW B;  1IW7 C;  2A74 C;  1GHJ A;  2L12 A;  4IZ8 A;  1A3T A;  5K5P A;  5ELD A;  2WII B;  1IW7 D;  4XT1 B;  4TRD A;  4H0L C;  5A35 A;  4NMZ A;  1KNE A;  3NTK A;  3CRK C;  3JAM E;  3D4W A;  3PUW A;  2A73 B;  4Q0F A;  5JPM C;  2M00 A;  3IFT A;  3CRL C;  3X3M A;  2SEB D;  1LTI D;  1QG7 A;  5ELE A;  3SK4 A;  3VR4 A;  1PTO H;  1ML0 D;  2MGS A;  5T1G A;  4RGN A;  4ZYS A;  2FJ2 A;  1EQT A;  4C3I B;  1JQY D;  1QNU A;  4A3E B;  1GUO A;  2BDN A;  1GOZ A;  3D6C A;  3K5N A;  2F0S A;  4EQN A;  4KHZ A;  3D31 A;  4MHE A;  1IL8 A;  1D1I A;  3SDZ A;  1B50 A;  2F0J A;  4ZKC B;  3SK6 A;  2H4O A;  1JIC A;  4KN7 C;  2MUY A;  5I4D A;  1X3P A;  4FYD A;  3BDL A;  1H9S A;  3TP5 A;  1K83 B;  4BWG B;  1JOR A;  4J8Q A;  3ND8 A;  1C4Q A;  3G7L A;  4B9X A;  1EZ8 A;  1S5E D;  1SJE D;  1OXV A;  3KF8 A;  4IN3 A;  1KDB A;  2R93 B;  1C48 A;  1FD7 D;  3J81 L;  1V8Q A;  3DM1 A;  1BBX C;  3QB3 A;  2NN6 H;  1LTT D;  5IGF A;  1WCM B;  3OMG A;  4IUP A;  1FR3 A;  4CKB A;  2KCC A;  3FEW X;  2M2L A;  3TP8 A;  1GUN A;  2R6G A;  2EJF C;  1A6X A;  1EY7 A;  3GTQ B;  2K33 A;  2N88 A;  2ENB A;  2NN6 I;  5I2X A;  2NYZ D;  3J80 E;  3HKZ B;  3I91 A;  4K14 A;  2CVR A;  2RSO A;  3R2I A;  5LL6 S;  4C1N I;  3MXP A;  4QMG A;  3OOC A;  3HOU B;  1ILP A;  4ULL A;  1ZKO A;  1JWU D;  5C3W A;  2F0G A;  2K32 A;  1EY0 A;  1G2S A;  2Z1C A;  5HGT A;  3NHH A;  3EFX D;  5C0X H;  1V1P B;  5FO8 B;  1U4P A;  3PUX A;  1F9S A;  1PTO C;  3NTI A;  2AQ2 B;  1Q1B A;  2GA4 B;  4A93 B;  1ZXT A;  1PTO D;  1J9O A;  1XTC D;  3A55 A;  1STG A;  1EU4 A;  1ONL A;  1TR5 A;  3BVZ A;  3V2T A;  4IUQ A;  3DWA A;  2DY7 A;  3S1N B;  1KLU D;  1E0B A;  2F0W A;  2PYK A;  3H3V C;  4E6I A;  3TN2 A;  1ROD A;  4FF2 A;  3KLS X;  5C0X I;  4JK1 C;  4XT3 B;  5HUR A;  5IGB A;  2L1B A;  1K8O A;  5E1F A;  4A3D B;  3K5M A;  1NAP A;  3K59 A;  3DEO A;  5J39 A;  2NVX B;  1Y8P B;  4QUF A;  4KMU C;  2F0I A;  4PV1 C;  2EYF A;  4DF7 A;  2K5Q A;  3BYT B;  5JVG 3;  1DON A;  3TP6 A;  5FLX E;  4K5V A;  3N52 A;  1B9N A;  2PZW A;  1MSG A;  2NVY B;  1L0X B;  2ZXR A;  3GTL B;  1VF7 A;  3AB9 A;  2D5D A;  1S5F D;  3BDO A;  3BVG A;  4V0B A;  1CM9 A;  2QF7 A;  4DAV A;  3J7A F;  1STE A;  3WOE A;  2XIW A;  2F0N A;  3I4N B;  5CR3 A;  3VR6 A;  4HCS A;  1HCZ A;  1SYD A;  4HED A;  4KKS A;  3BDC A;  2B2U C;  2RDF A;  3HP3 A;  4DAY A;  2E2D C;  3TZU A;  1H9K A;  2WAC A;  4L6T B;  4M8A A;  1WD1 A;  3TBI B;  1NSN S;  3NK9 A;  1WVL A;  1IYU A;  1TS4 A;  5BN5 A;  1ILQ A;  2K6A A;  1HUN A;  3LWU A;  1PRT C;  2F4I A;  1CI3 M;  1SMY D;  3NQT A;  4A3B B;  5I6W A;  4BBS B;  3H94 A;  1PFN A;  1VDZ A;  2PO4 A;  2ICI A;  1LAB A;  5BN4 A;  4K2K A;  2B2V A;  5KNC A;  1SXT A;  1R9T B;  4IUN A;  3A54 A;  4U67 3;  1SNO A;  3PUV A;  1WTX A;  3L7Z C;  4A3I B;  2N55 A;  1B4O A;  2YU9 B;  3WDN A;  4C3H B;  2CHB D;  3QOJ A;  4H13 C;  3A8K E;  1LV9 A;  4XYO A;  2HQE A;  2KEC A;  4RCN A;  5EKL A;  1TWG B;  5JOB A;  2EJM A;  4IAL A;  3MVV A;  1ICW A;  2B2W C;  1PFM A;  2L11 A;  3DHQ A;  3OSO A;  2B39 A;  5IIF A;  3HZX A;  3I72 A;  3SR1 A;  3DXJ C;  2RBM A;  5BN3 A;  5DNF A;  2G9D A;  2XN9 C;  1F77 A;  2EYP A;  2F0D A;  4KY5 A;  3A56 A;  1EU3 A;  1SE3 A;  5C4H A;  4DXG A;  1XXG A;  2K03 A;  1PTO B;  2L4N A;  5IT9 L;  1OXU A;  3A8I E;  3SK8 A;  1Q1E A;  3RD4 A;  1AP0 A;  5J22 A;  2O5J C;  3FDT A;  3MZ5 A;  5CBE E;  2XNA C;  2R3Z A;  1GUT A;  4WFN 3;  2RDH A;  3M4Y A;  1A2U A;  3Q0A A;  2KA7 A;  3HOV B;  1BCP C;  4ZKB B;  4IUV A;  1B9M A;  3VYR A;  2O4X A;  1O80 A;  2SNS A;  5IGD A;  3QJY A;  3C2P A;  1BO0 A;  4CJ1 B;  1EYC A;  3GTG B;  2LS0 1;  3O13 A;  3H6M A;  1JR0 D;  2XVS A;  2IJ0 A;  2F0E A;  3GTP B;  3K57 A;  1SE4 A;  3J7A V;  2I46 A;  1QWY A;  3C1E A;  1ESF A;  2VXW A;  1TT2 A;  2JEB I;  5FK9 C;  5COY A;  3VA7 A;  3FKI B;  4RKB A;  2ZT9 C;  4FXD A;  1AZP A;  4A3F B;  1GUS A;  2Y0S B;  1TS3 A;  5IGG A;  4QUC A;  2B2Y C;  2D2C C;  2A5H A;  3T4A C;  4CKC A;  3URY A;  3W3A A;  1CQV A;  3PUY A;  3S1R B;  4ILW A;  2JA7 B;  1DZ1 A;  4BY7 B;  4U68 A;  1A3U A;  1E2Z A;  4A3G B;  4CGY B;  1QOH A;  2VB3 X;  4OO1 H;  5C5M A;  3V96 A;  1MI2 A;  1UAP A;  1AN8 A;  3SVM A;  1HHV A;  5JPN C;  2IX0 A;  4EQO A;  1SBB B;  4A3K B;  3NTH A;  1EIG A;  1MD2 D;  1WD0 A;  1M8A A;  3IFD A;  4XQJ A;  5M5Y B;  1Q8I A;  3HOW B;  2WP8 J;  5KYI A;  1EQV A;  2NB0 A;  1PRT B;  1LTA D;  3S2D B;  3CQZ B;  4BY1 B;  4OO1 I;  3PO2 B;  1RDP D;  2XWB B;  2EE1 A;  3T51 B;  3TSS A;  5T1I A;  2AUK A;  1F9P A;  4BBR B;  5ELF A;  5DM6 3;  1Z7T A;  4M1U B;  2E2I B;  3MXU A;  1EY9 A;  1EY4 A;  1V1O A;  2K5D A;  1WTV A;  1EWC A;  3V05 A;  2JSO A;  4RGO S;  4ZK9 B;  1GHK A;  4FF1 A;  2A68 C;  3A8J E;  2A68 D;  3GP7 A;  1HRJ A;  1KDA A;  4OL7 A;  1QJO A;  1G6Z A;  3S17 B;  1EEF D;  1F9R A;  3HOZ B;  1V1P A;  4IUT A;  5EKK A;  4KKU A;  2IPK D;  2WKD A;  3KLR A;  1MSH A;  3S15 B;  4IFD H;  1YNJ C;  2M9V A;  1YNJ D;  3NQI A;  4J6H A;  1Z47 A;  1FNU A;  4PMC A;  5C0X J;  5IOC A;  2NUC A;  3LWE A;  4A3J B;  1EL0 A;  1G29 1;  1XX8 A;  2OT2 A;  4ZAI A;  4IFD I;  4K2L A;  1EEI D;  3K0Y A;  1BCP B;  4OHJ A;  2H1E A;  3AMU A;  2K01 A;  3MFG A;  2LY7 A;  3I73 A;  3HGB A;  2HDL A;  1LTB D;  4UDU C;  3NWS A;  4X3T A;  1F2M A;  2PCF B;  3SE0 A;  3OWF A;  3MEH A;  1EY8 A;  3BVM A;  5M5W B;  1EFI D;  3E6Z X;  3UI2 A;  3SEB A;  1CHP D;  1F2L A;  1KDC A;  4IUU A;  2E2H B;  4ME5 A;  4XYQ A;  3EA6 A;  3VYU A;  2F03 A;  5K36 H;  3K6O A;  4FO2 A;  2LKV A;  2F0F A;  4LAA A;  3KBX A;  2FFK B;  5D14 A;  3CU7 A;  1SNP A;  2LFN A;  1Q3L A;  2OF1 A;  4DAP A;  2L5T A;  2WV6 D;  1STN A;  2BCO A;  1Q90 A;  4OIJ A;  5JEA G;  1LTR D;  2F1M A;  1HFG A;  3MAQ A;  3NWT A;  1TVX A;  4Y7N B;  3JAM L;  1HA6 A;  1KAA A;  5A2Q L;  3IL8 A;  4XIG S;  1T5X D;  2DNE A;  1NUC A;  4IQZ A;  4BA2 I;  1TS2 A;  3T13 A;  3R93 A;  2KQ3 A;  2I07 B;  3E5S A;  3RLF A;  1ET9 A;  3VR5 A;  1TS5 A;  3D6W A;  1AW7 A;  3HG9 A;  4A3M B;  1X3Q A;  1II3 A;  1R4P B;  1TU2 B;  2TMP A;  1X32 A;  3HRZ C;  2B2T C;  1SYG A;  4LJZ C;  3K5O A;  2D62 A;  1TKW B;  2IT1 A;  4RHS A;  3I90 A;  3OMC A;  1QB5 D;  1VMC A;  3A7L A;  2EYH A;  4R9W A;  1RCV D;  1W6J A;  4RH6 A;  1NR2 A;  4FP5 D;  2LMC B;  1TWF B;  4FXG C;  1D6E C;  1CHQ D;  2KEE A;  1BNZ A;  3FPU B;  1PZK D;  1RHP A;  2OXP A;  2NN6 G;  4DFA A;  4C56 C;  4DU9 A;  3I8Z A;  4QCL A;  1JB3 A;  1DYQ A;  3Q6S A;  3VR3 A;  4TSS A;  4ODG A;  2F0L A;  3D8G A;  1SYE A;  3OIP A;  1ENA A;  5NUC A;  4FVM A;  3MC0 B;  5D65 A;  5CV6 A;  1BDO A;  5M3M B;  3J80 L;  3S1Q B;  1LLR D;  1UEA B;  4HN7 A;  3K5L A;  2AWN A;  2B8G A;  4BS9 A;  4DXF A;  1GUG A;  2F3V A;  1W6K A;  2IX1 A;  1H9M A;  2BE5 C;  4HSV A;  3H09 A;  1CA6 A;  1I4H A;  2Z4I A;  1FNW A;  1SE2 A;  2BE5 D;  4KD4 A;  3P1H A;  2NVQ B;  1DOM A;  2B63 B;  5C0X G;  4JBW A;  4G7H C;  1I6H B;  5I9P A;  2JA8 B;  1CZG A;  5D3D A;  1BR9 A;  3X3N A;  1SMY C;  4X3S A;  4F8M A;  1H9J A;  3U9O A;  1Q12 A;  5KGU A;  2EOT A;  2PMZ B;  3NBH A;  3DWP A;  5G3L F;  2MP1 A;  1HQR D;  2NZ1 D;  3SXH A;  3QG1 A;  1AZQ A;  3C3L A;  5CV5 A;  1ENC A;  2PZU A;  3MFY A;  3PO3 B;  2XRS D;  1TY2 A;  5EPJ A;  3W2D A;  3PIP 3;  2E74 C;  3NE5 B;  3EQL C;  4Z9C B;  4XQQ A;  1IKL A;  1TII D;  3SK5 A;  3T53 B;  1D2B A;  1PMR A;  5FLX L;  3I70 A;  5EGT A;  2F3W A;  1EYD A;  2F0V A;  3C46 A;  2JA6 B;  1QCB D;  3GO5 A;  1UUP A;  2B2U A;  2AWO A;  4WRD A;  1SNQ A;  2KUM A;  2KJX A;  1CZW A;  2XSC A;  4KN4 C;  1CK1 A;  1A3V A;  4R8I A;  2DN8 A;  4XTC S;  3M7G A;  2A6E C;  5EBC A;  1JE4 A;  3J7Y W;  1LT4 D;  5I6Y A;  5AFW A;  4F7X A;  3DWQ A;  3G6J B;  1ZYR C;  2NWG A;  5ISR A;  2A6E D;  2PW5 A;  1Y1V B;  2Q8R E;  2VB2 X;  4K8I A;  4L63 B;  1ZYR D;  1SNC A;  1STH A;  4KI0 A;  1G8Z D;  4I65 A;  4HMI A;  1GUW A;  5C44 B;  1SYC A;  2F0Q A;  3FRP B;  3GTJ B;  5EJW A;  1PZJ D;  2NVT B;  3I3C A;  4C3I G;  3KLS A;  5DEH A;  4CJ2 C;  1O7Y A;  1HTP A;  4X3U A;  2XWJ B;  1NCV A;  3TZD A;  3ND9 A;  1MGS A;  3P7J A;  4DK0 A;  4AYB B;  3GD7 A;  2BOS A;  1HTL D;  1BUV T;  2MJ8 A;  1LTG D;  1RTO A;  1B2T A;  3CHB D;  1PXU A;  1F9Q A;  2SNM A;  2NTS A;  2F0T A;  5FOB B;  1LT5 D;  2RKS A;  3PV0 A;  1Z6H A;  2EYL A;  2F0H A;  3EJI A;  2B2W A;  4FF4 A;  2V4D A;  1NR4 A;  4G7O C;  5F2D A;  1LT6 D;  3RUZ A;  1JOQ A;  1WTP A;  3E0J A;  2JXM B;  4N9T A;  1LTS D;  1WTW A;  1VF5 C;  2JP1 A;  2PNR C;  3TME A;  2QIL A;  4PMW A;  1EY5 A;  1U9R A;  2L55 A;  3K7A B;  3OW7 A;  5KRU A;  4NW2 A;  4KTA A;  4IFD J;  1DXM A;  4B08 A;  3I4L A;  5KEE A;  2FHT A;  2EYJ A;  5JJZ A;  1JOO A;  2X69 A;  1DM0 B;  3S9W A;  1PTO F;  1FNV A;  3NUC A;  4KJO A;  5KYL A;  2KED A;  1WTR A;  1S5C D;  2EDG A;  2SDF A;  3U9S A;  4X3K A;  5IGC A;  1JWM D;  1KTK A;  1GXD C;  5CV7 A;  1JCK B;  1EWH A;  1BF4 A;  5CV9 A;  2EY6 A;  2K5W A;  1DD2 A;  2EY2 A;  1VMP A;  1DOL A;  2K05 A;  1Y8N B;  2HDM A;  2G9H D;  1STB A;  3IKJ A;  5FO7 B;  3OIQ A;  3T16 A;  4K5X A;  1EOT A;  3KK7 A;  1LT3 D;  2B2Y A;  4KJN A;  2KOL A;  3TP7 A;  3K58 A;  4NDX A;  4EVO A;  1U4L A;  4LK1 C;  5G3L D;  2FMM A;  5KND A;  2A6H C;  3MWY W;  3D4R A;  2Z4H A;  3M7N A;  1WTO A;  4KY7 A;  1CA5 A;  3RZO B;  2VUM B;  2A6H D;  4PQX A;  3J81 E;  4C3J B;  2BDO A;  3CKI B;  2L9H A;  1I4P A;  2JEA I;  5JEA H;  2RA4 A;  1HUM A;  3T56 B;  2XRQ D;  1JOK A;  4O1N A;  3GTO B;  1Y1W B;  1TWC B;  3MXG A;  5A2Q E;  5JVH 3;  4KKT A;  3H91 A;  5M9O A;  4OO1 G;  1IHZ A;  2HCC A;  2D9U A;  3ZYY X;  4OIK A;  3BG3 A;  3OPO A;  3M4O B;  3GTK B;  4G7Z C;  1PRT F;  4CHT B;  5C3X A;  1B53 A;  1S4Z A;  3L3O C;  5ELB A;  1QE6 A;  4P2C B;  2R61 A;  3NP8 A;  1B1Z A;  4J1M A;  3NBI A;  5CC4 A;  4C2M B;  4XDX A;  2X6G A;  1ZEQ X;  2F0M A;  5CV4 A;  5C4X B;  4RAU C;  1M4V A;  3D3R A;  5D3I B;  4YIJ A;  2RQX A;  2WB1 B;  4R8N A;  1I4G A;  2EY5 A;  2WAQ B;  3PMF A;  3D4D A;  3QOL A;  1U4M A;  3GV6 A;  5TSS A;  2BA1 A;  1J8I A;  4UAI A;  4V19 0;  4C3H G;  4G57 A;  2J0T D;  1PFB A;  3DMU A;  1QIL A;  4BA1 I;  5CYU A;  4KHV A;  3Q24 A;  2HUG A;  2OEO A;  3C1F A;  3KUP A;  1O7Z A;  2E76 C;  1U4R A;  2WKC A;  2DY8 A;  2RDG A;  4QB4 A;  4FNF A;  3R3O A;  2O2L D;  4S3S A;  3Q23 A;  1I6V C;  2E75 C;  5CGK A;  2CQA A;  1I4Q A;  3M3Y B;  4F87 A;  5FKA C;  4HSP A;  1B44 D;  3H0G B;  2YYZ A;  5C6A A;  2J4X A;  5IOD A;  1DJR D;  1RD9 D;  1HA5 A;  1KLG D;  4IFD G;  2EY1 A;  3GV3 A;  3L9A X;  3PUZ A;  1B3A A;  2FMC A;  4K8J A;  1YNN C;  1BOS A;  4CBV A;  2RSN A;  1YNN D;  4FF3 A;  2ID0 A;  1BCP F;  5LL6 X;  3MHB A;  1SEB D;  4ZQ3 A;  1BXT A;  2QKI C;  1D5M C;  1D5X C;  3ERO A;  3HOY B;  1OO9 B;  4CKE A;  1I4X A;  5E4W C;  1SND A;  4RGT A;  5EPL A;  1WTQ A;  1IKM A;  2HCI A;  1SYB A;  2IL8 A;  2K1B A;  5I9O A;  2NBF A;  3F2U A;  4DK1 A;  1QNK A;  4NP5 A;  4KY6 A;  1BQQ T;  4KD3 A;  3WOF A;  1LAC A;  5M3F B;  2VNU D;  1EZ6 A;  5K36 G;  1SDF A;  4I7Z C;  2EYO A;  1TQO A;  1HQM C;  1VCI A;  3HOX B;  1ET6 A;  3S14 B;  3LNN A;  3TDQ A;  4MIU A;  1RJT A;  1STY A;  5C3E B;  1K8M A;  5C4Z A;  1H9S B;  2EVB A;  2PZT A;  4EGV A;  4PMB A;  2K7V A;  4GZY C;  2NTT A;  4G4K A;  2B2V C;  2PQE A;  1F2Z A;  3RZD B;  1T5E A;  5EQ0 A;  5COR A;  1KAB A;  4DA2 A;  3ITP A;  1ESR A;  3QIA A;  4RA8 A;  3KBG A;  4DGZ A;  3MTS A;  3R2T A;  5DAU A;  3S16 B;  1CT1 D;  4RCO A;  2B2T A;  4F88 A;  1DCZ A;  2EPB A;  4DNR B;  2QCP X;  1MBY A;  2IWH A;  4Q5V A;  2K28 A;  4B9W A;  1R4Q B;  2O5I C;  1FYC A;  1EY6 A;  2FIN B;  1XWE A;  5ELC A;  4PNY A;  3HEJ A;  3P75 A;  3NXW A;  2WIN B;  1CQF A;  5IT9 E;  4ZUJ A;  4IUR A;  1SAP A;  1TY0 A;  1SNM A;  1XYI A;  1E2W A;  4ID6 A;  2F0P A;  5EPK A;  1RKN A;  1OXX K;  5J1Z A;  1PLF A;  1PRT D;  3OWE B;  4XXE A;  2QEJ C;  2ICE C;  3GTM B;  5KNB A;  2K04 A;  3A7A B;  4ABN A;  5IGE A;  1IYV A;  4HMJ A;  2JA5 B;  2KCN A;  3I4M B;  2L0C A;  3VA5 A;  4C3J G;  1E2V A;  5CBA E;  4WJW A;  3VR2 A;  2CW0 C;  4K6D A;  4KK7 A;  3DUZ A;  1I3Q B;  2CW0 D;  2JYO A;  4WOR A;  3EVQ A;  5E4X A;  3DEP A;  3R8B A;  4ZRZ A;  4C1N K;  4XQN A;  2Q8T A;  3GQB A;  2DNC A;  3AU7 A;  1HFN A;  3N6R A;  1KNA A;  2R7Z B;  2ZXP A;  2PW7 A;  1O7L A;  1DOK A;  3LX0 A;  2KVM A;  2Z8L A;  1G91 A;  1SYF A;  4TKO B;  5JAV A;  3NSW A;  1A15 A;  2MHV A;  4DN4 M;  5FO9 B;  2F0K A;  1PYW D;  2RVL A;  1CTM A;  2R92 B;  5EBD A;  1I4R A;  2JE6 I;  4ZUI A;  2AQ1 B;  2TSS A;  2X6L A;  1D5Z C;  4N9P A;  4O42 A;  3SHL A;  1RTN A;  1S5D D;  4CJ0 B;  1S5B D;  3S2H B;  1JWS D;  4H44 C;  1BCP D;  3QWN A;  4HCE A;  1TWA B;  1HPC A;  2AQ3 B;  5KIX A;  2E2J B;  1Y69 U;  2EYM A;  1OXT A;  1UNS A;  1HXY D;  3PIO 3;  1L0Y B;  1G2T A;  3BYY B;  3VYS A;  1GJX A;  3IAY A;  1H9R A;  2BA0 A;  1V43 A;  1LO5 D;  4FXK C;  5E3F A;  1CFM A;  3P20 A;  2MPM A;  3HS0 C;  2EJG C;  1JC7 A;  2KHS A;  5JEA J;  1FGB D;  2QDB A;  3BS1 A;  2SOB A;  3ONA B;  4L8J A;  4NKL A;  2AUJ D;  2B8F A;  3MXN A;  2C9O A;  4QF4 A;  1SSO A;  4RKL A;  3S1M B;  1AFP A;  1AEX A;  1PZI D;  2F0U A;  4H7B A;  2F0O A;  1O78 A;  2IW3 A;  3MA2 B;  3QO2 A;  2IX3 A;  4RFB A;  5C4J B;  3M85 A;  4HAE A;  4TQU S;  5CV8 A;  1F2Y A;  1STA A;  4MN3 A;  3ERQ A;  3FMC A;  5LHY 1;  4DNT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...