3E6ZX

1.0 a structure of cusf-w44a-cu(ii) residues 10-88 from escherichia coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
EAQPQVISATGVVKGIDLESKKITIHHDPIAAVNAPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryptophan Cu(I)-pi interaction fine-tunes the metal binding properties of the bacterial metallochaperone CusF
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Cation efflux system protein cusF
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11604 CusF_Ec Copper binding periplasmic protein CusF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.320 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3e6zX01
2L55A 2QCPX 2VB2X 3E6ZX 3TDQA 2VB3X 1ZEQX
chains in the Genus database with same CATH superfamily
3S2DB 1QE6A 3EA6A 3CAMA 3M4YA 3SK4A 5C4ZA 3SE0A 2B8FA 1Q90A 3JAME 3I4LA 5M5WB 3S17H 4TKOB 2NVXB 2EY5A 5IGDA 3GTKH 1SROA 1A2TA 4EQOA 5EJWA 1LUZA 3JAMc 2UXCQ 2EDGA 3PMFA 3ONAB 5IP7G 3GTGB 1KAWA 1ESRA 1FJGL 3T13A 4G4KA 5CC4A 3JAML 4V0BA 4HJ5A 2WB1B 1STYA 1PHJA 3CMAA 4KD4A 4LF6Q 1FGUA 4JBJA 1HNZL 2KHJA 4QIWB 2F4VQ 1D5XC 2WFWA 2PYKA 2ZJQA 2LSSA 1D8LA 2KCTA 1FVIA 2ZXRA 2A74C 4DUZQ 1T5XD 1SDFA 3BVGA 3TRZA 5C5MA 1CHPD 2D2CC 3X3MA 4FF3A 1VQHA 2Z6BA 1CT1D 2L9HA 2LXKA 4HIKA 1S5ED 2LXJA 3T1YQ 1F9SA 4A3IH 4C3JG 5L37A 2RDHA 5CV8A 4G7HC 1XMQL 3CD6A 4XIGS 1J6QA 3KBGA 3HOXG 1SFOH 4DNTB 2ICIA 4K5WA 2PCFB 1YJWA 2PPBC 2HHHQ 4KJNA 2KJXA 2FHTA 4XQNA 4B3RL 5K36G 3AU7A 2EE1A 2O4XA 4BXXG 4CJ1B 4OIJA 1TQOA 3F2BA 3ULJA 4MTNA 5FO8B 2MO1A 4DA2A 2HIVA 1JORA 4A3MH 4DR1L 4DR5Q 3NXWA 1HR0W 4OELB 4KKTA 5FLMH 2JYOA 1VF7A 2HHHL 2L12A 5M3MG 1CSPA 1DOKA 2Q8TA 1WTPA 4OX9L 2EJGC 5C6AA 1HNXL 2AUJD 1AW7A 3J7ZC 1N36L 3I4NH 1P16A 3U4ZA 1K3BC 2RHQB 1XMQQ 4BBSG 2AUKA 1KC8C 3LX0A 3HS0C 3W2DA 3BZKA 4J15A 1PTOH 2F0NA 2JEBI 4K5XA 1ILPA 1QG7A 3PUWA 1KDCA 2UU9L 2RF4A 2JE6I 3H0GG 2PNRC 3OMCA 2R92H 1TS5A 1X56A 4UP9A 2J4XA 4GZYC 1K83B 4DUZL 1BCPB 3NTHA 4AYBB 1GOZA 3D6WA 2K32A 5JOBA 2CW0C 2L11A 3OWFA 3VR2A 1PV4A 1MBYA 2NVQB 3S2HH 2RQXA 1Q82C 5ELEA 4FF1A 5IODA 2DJFC 5IGEA 3PUXA 4DAVA 2H1EA 2K6AA 2CVRA 4DV0L 1QNUA 4IJLA 1I4GA 1TS4A 3J7A5 1KHIA 5BN5A 2IWHA 5CV4A 3M9BA 3CKIB 5EQ0A 1ONLA 5FJ8H 4DR4L 3KLRA 3AYHB 1IL2A 3DEOA 2NVTH 5T1GA 1CK1A 1X3PA 2PZTA 5I2XA 4B3MQ 1BCPD 4OHJA 2IX3A 4A3LH 4L8JA 4PV1C 5M3MB 2K4KA 4N9TA 3HP3A 4H44C 2NTSA 3KDFA 3HOWG 5KYLA 2Q2TA 2K03A 2WACA 1V1OA 5EBDA 4IFDG 2K5VA 1JWMD 1N32L 3J81L 3NEMA 3G6JB 1ASZA 3MHBA 3HZXA 4IUVA 1L2FA 5JVH3 1WTOA 4X3UA 3C1FA 1YHBA 4N9PA 2R92G 1JJCB 5JPMC 4DV4Q 1E3PA 2A69C 3OW2A 2F0PA 2H5XA 4GKKQ 1NJIC 5JVG3 3NENA 4LF8Q 2I46A 4M8AA 4OO1H 2RA4A 3I4MG 1X9NA 1GHJA 3Q24A 4HSVA 3U58A 4OO1G 4XTCS 2D62A 1LO5D 3CCQA 1VQIA 1L0YB 2Y0SG 1GD7A 2F0LA 1HRJA 1KIXA 2D5DA 1LV9A 1OXSC 5T1IA 4JCVE 2F3WA 3T1HQ 3KJOA 3VA7A 2QDBA 3CRKC 1LTID 3CC2A 3V96A 4DK1A 1BNZA 2JA7B 1VQPA 5IYDG 1S5BD 2RDGA 1HJPA 5IGFA 3DM3A 2A69D 4ZRZA 4MN3A 3HEJA 1Y69U 5C5LA 3HKSA 1PVOA 1Z47A 1LLRD 1YNXA 2K50A 4IJHA 1TWHH 1DJRD 2D9UA 2QEXA 1WTRA 1TY2A 2OEOA 1S4ZA 3D8GA 4R4QA 3GDEA 1XPOA 1RJTA 3I3CA 2VQEQ 4UP8A 4KMUC 3EJIA 4DR6Q 1EYAA 3MA2B 1KNEA 2B2TA 2BH8A 2IY5B 3J80c 5C4XB 1WOCA 3J80i 5C0XJ 5CV7A 1X3GA 4JW0A 1STNA 5I4DA 3X3NA 3AMUA 2A6ED 1ESFA 1EWHA 3NE5B 5BR8Q 1M90C 1EYDA 1F9PA 4JBWA 2VW9A 1MD2D 3STBC 3W1BA 1KD1C 2PNHA 1SBBB 2BH2A 2QCPX 2I5LX 4RGMA 1O80A 2SNSA 1EEID 3W3AA 4KK7A 4A3JB 2ZM6Q 1G8ZD 1PTOF 4KN7C 1B4OA 1I50H 1C8CA 2PQAA 1JT8A 1N9WA 4ODGA 3K0XA 2AQ1B 4ZUJA 1NMFA 1KDBA 5M5XH 4IUQA 2WKCA 1VMPA 2E5LL 4GLXA 4POGA 3BU2A 4H7BA 3HOUB 3A5UA 2J0TD 1B9MA 2F0EA 1TKWB 3GTQH 2EYMA 1EQRA 1NNXA 1AH9A 3GTJB 1G91A 1CA6A 4X6AH 1TWAB 4ALPA 3RR5A 1EL0A 1B70B 4G7ZC 4DAYA 3KLSX 2D0PA 2DY8A 2Y0SE 4S3SA 4XYQA 3GD7A 2QGQA 1FJGQ 4ID6A 3SK6A 3MWYW 2Z8LA 3HOVH 1NSNS 2JN4A 4IURA 2EXDA 2K75A 1V1PB 3J7AV 4O2DA 1GUOA 5A2QL 2XIWA 4AH6A 3P20A 3J7YW 3UI2A 1IYUA 4B08A 1L1OB 3TZDA 4BA2I 3D4WA 3D3RA 5TSSA 4LAAA 4MHEA 1U4RA 4AYBG 2LY7A 1XMOQ 2E2HH 2I5MX 2SEBD 1Q8IA 1V8QA 3SHLA 1PH7A 1BBWA 4A4IA 5CORA 2G5DA 1TWFB 2CQAA 1VQ7A 1TR5A 1NCVA 3TMEA 5A2QE 5IE8A 1T5EA 4RGTA 2K33A 4FDBA 1AZPA 1F77A 2F0SA 4OIKA 4PG3A 2DGYA 2A68D 1JE4A 1J8IA 4DR7L 2EJFC 2XWJB 4JG2A 1VCIA 3CCLA 2GN5A 2X6LA 1PYSB 3R93A 1GJXA 1UEBA 4DV2Q 3MXGA 5GAHC 2XWBB 3CW2C 1A2UA 4IFDJ 3ZYYX 1E0BA 3M4OH 3I70A 4HSPA 1XWEA 5JEAJ 1HCZA 5ELBA 2Z0SA 4IN3A 5IT9E 1SAPA 1J5EL 2EIFA 3RMHA 2WP8J 5HURA 3PUYA 4DV5Q 2KUMA 1SMXA 2BA0A 1N34Q 3FPPA 4RCOA 5H1SE 1WTWA 1SYCA 2NB0A 3NPPA 2NZOA 1K0RA 1VQEA 1OXVA 2BCOA 3PO3H 2KEDA 3DMUA 5FOBB 2CFMA 1PH5A 3HKZE 1PRTC 1VQ4A 4YCWA 5JAVA 3J80E 3HOWB 2RBMA 4HMIA 4DV7L 3F8TA 2RVLA 4KTAA 3HOYB 4LMQD 4E6IA 3O13A 1I6VC 1CKOA 2GVBA 2ZTCA 1YBYA 5LL6S 1DGSA 5I6WA 5J22A 4TRDA 1U4MA 4CGYB 4OWTB 4DV3L 1SYFA 1A3UA 3GTMB 1R9TB 3EFXD 4R4OA 2NVYH 1BXTA 3L7ZC 1YJ9A 3CF5A 3B6YA 2E75C 1JWUD 1X3QA 5IGBA 1BBXC 1HA6A 1HXYD 4ZYSA 3PIP3 1DM0B 4CHTB 4A3FG 2EY1A 5CYUA 1Q7YC 4LUZA 3S1NH 1NY4A 3VYUA 4DAYB 5IP9H 5KNCA 3SEBA 4YY3Q 3GTKB 4UAIA 1WFQA 5KGUA 1SFOB 3GTLH 1YHAA 4GKJL 3N52A 3DLLA 4HEDA 1TWGH 3L2PA 4PZ6A 4JI0L 1NBWA 4XQQA 1B1ZA 3DWQA 3QWNA 1EYCA 3CCMA 1N36Q 2B2YC 3RLNA 3NSWA 4IFDI 4Y7NH 2EYFA 1JE5A 4K8IA 4KN4C 2PMZE 4C3JH 5JJLA 2JA8B 4I7AA 2GA4B 2YYZA 1LACA 1VQ5A 2MPMA 1K73C 3TP7A 2Q2IA 4GN3B 2WB1G 1SNDA 5IYCH 2I07B 3C46A 3EN2A 1NUCA 2Q8RE 2R7ZH 2ALYB 2PI2E 4BBSB 1STAA 1U0LA 4KJOA 2N78A 3TP6A 4A93H 4WJWA 2E76C 1Y1VH 2HDLA 1A15A 2LS01 1PFNA 3GTOH 2WV6D 1R9TH 2XN9C 1QILA 1I50B 2ZTEA 1FNVA 1EWCA 4HMJA 4OGQC 4IOCA 1W2BA 1HHVA 5LMNQ 3K8AA 3HOUH 3K58A 2X69A 1YITA 3H91A 1SE3A 2EZVA 1IBKL 1EY6A 3UDGA 3DHQA 4V190 4A3LG 2BDOA 5K5PA 2KQ3A 1HNXQ 3EVQA 4JI1L 4B3SQ 1CHQD 4DV6L 1RODA 1VQOA 4JBMA 3OIQA 4IUNA 2EYHA 1LTAD 1IBLQ 3OIPA 3S16H 4L63B 2B2VA 2PI2A 4LF9Q 2K05A 4X64Q 1STGA 1PLFA 1DXMA 2F1MA 4C1NK 2NN6G 3RZOB 3KBXA 3CPFA 2CQOA 4OWXB 4Y52H 2UXDL 5EPKA 2VUMG 3CC4A 2VQEL 4DR6L 2MP1A 1MI2A 3CQZH 2H4OA 1PDQA 4UPAA 4L5SA 1KRSA 1L0XB 4CDFC 3GV6A 4IZ8A 1WD0A 1D6EC 3Q23A 2L15A 1J9OA 3ND8A 4R4CA 2R7ZG 1XTCD 1STHA 1WJJA 4RFBA 3J81E 2MFIA 1E24A 1VQDA 1LTSD 4HJ7A 3CCJA 4HJ8A 1EFID 3BVZA 2N3SA 2WB1E 4C2MB 5M3MH 3WOEA 3MZ5A 2F4VL 1RDPD 4ULLA 1HR0L 4A3CH 2EOTA 2YU9H 2G9HD 3NQIA 2X6GA 4DUYQ 1JOQA 4JBKA 1N33Q 4IFDH 2F0FA 2FFKB 1E2ZA 3I56A 4LF9L 3PIO3 4XT3B 3PV0A 1HZCA 4N8FA 1MIUA 3GTMH 3K5MA 4JI7L 4TQUS 3NWSA 3MFGA 1PH8A 5CBAE 3U9OA 4RAUC 2FMMA 3I91A 3CCEA 3J81j 2ZJRA 2MHVA 3K7UC 1S72A 5DLQE 4X66L 5BN3A 5C3WA 1TS2A 1WVLA 4YY3L 4GS3A 5IT9c 5GROA 3CPWA 5LMNL 5IYBG 3OYYA 2A6EC 1JOOA 2ICEC 2YU9B 2WIIB 5IGCA 5I2YA 3BDCA 2HD3A 5EKLA 5FJ8G 2B2TC 3G7LA 2AKWB 3A54A 1A8VA 1JC7A 2CWAA 2CW0D 3ULLA 4LF8L 2ASBA 1K9MC 1EIYB 1EEFD 1GUGA 2KA7A 3W5OA 4KY5A 2NVTB 2B63H 1EZ6A 3IFTA 4KHZA 2QILA 4HIOA 4LF4L 4CKEA 1RL2A 4ZQ3A 3I2ZA 4CDCC 3TN2A 3I4MB 3BVMA 3GTOB 1N32Q 1Y1VB 2VXWA 3AB9A 3UDXA 4CKCA 4X62L 1V43A 4NP5A 4YWLA 3SK5A 2F0OA 4RHRA 3QJYA 3E9IA 3V05A 2DJGC 4XYOA 4LF7L 2F0VA 1G51A 5FKAC 1JJ2A 3PF4A 1TVXA 3HFZB 1GVPA 4GOPB 3AFQA 2WAQB 4FVMA 1N34L 3H3VC 5FK9C 2HQEA 4JI8L 4DV5L 2NZ1D 4CDDC 3MXUA 4X62Q 4IPDA 1I94Q 1DD2A 2AHOB 5FLXE 2F3VA 2F0UA 2OWOA 4YHHQ 1ENCA 3ITPA 3T51B 3K0YA 1B44D 4QCLA 4QGUA 1VQLA 5C0XG 2Z4HA 2NN6H 4BBRG 3S15H 3CHBD 2JEAI 4WFN3 5JJKA 4A3DG 1RF2D 2PMZB 1E2VA 2VUMH 1QVFA 1QUQA 4KKSA 1VMCA 5M3FG 3E3XA 4UY8C 1F2LA 2E8GA 1LT3D 3C3LA 2R61A 2EYOA 1KLGD 1AE3A 3PCOB 2KECA 3J80L 3GTJH 1VF5C 4B3TL 1CZGA 2VNUD 3BYTB 2E2IH 3QR8A 1SE2A 3OTOL 2R7ZB 3KK7A 2RDFA 4F87A 1MJEA 1X3FA 4JI6L 4PQXA 3SK8A 4X66Q 4BY7H 3S15B 3PSIA 1QB5D 1TIID 3M4PA 5M5XB 2NVXH 4K5VA 5D65A 4L6TB 1EOVA 3A55A 1CKMA 2R3ZA 1O7ZA 2B8GA 4C3JB 1OTCA 1LT6D 1JB3A 1LYLA 5M9OA 4C3HB 2NWGA 1JOKA 2IHEA 2B3GA 2UUAL 3HOXB 2UXDQ 4RGNA 2E2IB 1DZ1A 4IALA 2KBNA 3C2PA 2R6GA 4NXNL 1X6OA 1XPUA 4K6LA 4QB4A 5CBEE 4IOAA 5A35A 4DF7A 2Z6KA 3NTKA 3HOZG 4NB3A 4LFBQ 1PZJD 1C9OA 2N55A 1FR3A 2PZWA 1YIJA 5IP7H 5KIXA 3S1MB 4JI2L 4RCNA 3R2TA 3KFUA 4FXDA 1CZWA 4JI1Q 3BDOA 1RIPA 1Q86C 1H9RA 1MKHA 4K14A 2VL6A 4YWKA 1E1TA 4BA1I 1CTMA 4HTHA 2NVQH 4C1NI 3T1YL 4EGVA 3QOLA 4J6HA 1PTOB 4ZCKA 4FYDA 1H9KA 2IW3A 4JV5Q 1SNCA 3A74A 1JMCA 5EKIA 3MXNA 1B9NA 4OONA 3S1MH 4JYAL 1K8MA 1UEAB 1TS3A 2RSNA 1TWCH 5LHY1 1A63A 3EROA 3LWUA 3Q0AA 4C56C 2PO4A 1EWIA 3PGZA 1PYWD 1WCMH 4C3HG 1L0WA 1WCMG 3CP0A 3QB3A 1JICA 4KV6A 1S5CD 4A3KG 1C48A 5C4JB 3I4OA 4GN5A 2R93H 2UXCL 4DNIA 2O5JC 4GNXB 1VDZA 2VY3A 2Q2HA 1EY8A 2JK8A 1VQNA 1KTKA 4GOPA 2K28A 1XNQL 3NBIA 4P73A 5CV6A 3MXNB 3FVQA 1KLUD 3E5SA 3OWEB 4A3MG 5LMNW 2OCEA 5EPLA 4FP5D 1R4QB 4C3HH 1XXGA 2ZXPA 3TBIB 1VS0A 3JC66 2IPKD 4FNFA 2PW7A 1SJHD 1HTLD 4KHPQ 2KHIA 4KY7A 4LF6L 1H95A 1Z7TA 3HKZB 5DEHA 5ELNA 1NE3A 3PUZA 5C0XH 1JJGA 1LTTD 1ENFA 1SNOA 3MVVA 3UE0A 1KXLA 1I94L 4OO1I 1DOLA 1VQMA 2Z4IA 4DAMA 2YTXA 4QMGA 2ES2A 2B29A 3T53B 3S1NB 1F9RA 2L1BA 3KLWA 4K2KA 1ET9A 1Y1WH 5IYCG 5IOCA 5IP9G 4H0LC 1XNRL 3A0JA 1G6ZA 5EPJA 2A68C 5GQOA 5KRUA 1YNNC 3T1HL 5LL6X 3CCRA 1M8AA 3ICEA 5M5WH 2IJ0A 4IQZA 1C0AA 2PQEA 1WI5A 3H0GB 2AWOA 2Z1CA 4B9WA 1CA5A 1K8GA 4LF5L 1YNND 4TSSA 4RKBA 5C4XH 1L1OA 2WAQE 3NWTA 2IL8A 2HCIA 2JA7H 3CU7A 1BOSA 2NUCA 1QZHA 2K1BA 4JOIA 4P75A 4QIWE 4U68A 4X65L 4Q0FA 1ICWA 2JA5B 2K52A 1F2MA 1B8AA 1SXTA 3S2DH 1C4QA 1XPRA 2UUAQ 2A8VA 1Y8PB 1O78A 2JP1A 5I9PA 4JYAQ 1D5MC 3PO2H 1WTQA 1YNJD 3I8ZA 2K5HA 3K5LA 3MC0B 2QF7A 1RKNA 3D4DA 2IT1A 1CM9A 2B63B 1K0SA 2ID0A 4DU9A 2SDFA 3BZDB 4GN4B 3FRPB 4P2CB 4ZKCB 1BF4A 2JA5H 1BUVT 2UU9Q 1KABA 3K59A 3S1QB 3VA5A 5EGTA 3FDTA 2CHBD 1I4QA 3NBHA 3K81C 1CQFA 4DXFA 4BBSH 3NK9A 5CMDA 4DN4M 5CV9A 4DR5L 4A76A 2Q8IB 4HCEA 3MEHA 4DV0Q 1VQ6A 5COYA 1AFPA 1X65A 4OL7A 4NDXA 1YJNA 2F0MA 3UDIA 5C3EG 1EIFA 4UHVA 1A3TA 3G71A 1IYVA 1HTPA 3D4RA 4HAEA 5FO7B 1W6KA 1BDOA 1DCZA 3S14B 1FL0A 1MHWC 1HFGA 4DV6Q 3HG9A 4K0KQ 5DM63 4C3IH 3TDQA 1H9JA 1I4RA 1XYIA 4APVA 4A93G 1PRTF 2YTVA 4YWMA 3DM1A 1UUPA 1I5FA 3RD4A 4DK6C 3F1ZA 2OXPA 2QKIC 4LFBL 1GKHA 3WOFA 4DR3L 1ET6A 4DXGA 4NPSA 2JA6B 4DNRB 1I4HA 5BN4A 1UE6A 3S2HB 1OXXK 3FKIH 1AE2A 1QVGA 1EQVA 1XJVA 3KF6A 2K5QA 3H15A 1QJOA 4X3SA 2F0WA 4HJ9A 4X65Q 3VR6A 2RKSA 1R4PB 1VQ8A 1OXTA 2SNMA 3H3VH 1ZYRC 1Z9FA 3RN2A 2WINB 1B7YB 4A3DH 4JI0Q 1KAAA 4HIMA 1A62A 3AQQA 4A3KH 1HQMC 5M3FH 4YCVA 4LF5Q 2M2LA 3OHXC 5DAUA 1ZEQX 3L9AX 4JC0A 5C4JH 3FEWX 3URYA 3HOYH 3HGBA 2O2LD 2Q2UA 4A93B 2PZUA 4A3GB 1HUMA 2KCCA 3EQLC 1SSOA 5FLXL 4WJ4A 5EBCA 4K2LA 3T56B 5ISRA 4B3ML 1RTNA 1GUWA 1JR0D 3K6OA 1LABA 4PMCA 1PH2A 2JJQA 3NHHA 3AEVA 2KENA 2JA7G 1SMYD 1PA6A 3G4SA 1O7YA 1IBMQ 3NELA 1EOTA 3LNNA 4B9XA 4PMWA 2XNAC 5M3FB 2NTTA 2NN6I 1S40A 1UAPA 4LF4Q 2N88A 2R92B 1GO3E 2OF1A 4UDUC 4R1JA 1WD1A 3HRZC 3CCSA 4A3DB 4JI3Q 4RHSA 2EYLA 4MZ9A 1WTHA 3NQTA 1WYDA 2DN8A 2VS1A 4A3CG 1D2BA 1FNWA 4RGOS 2K5WA 1CQVA 1CUKA 2QDLA 3MEFA 4DGZA 5K36H 5HY6A 2V1CC 1EZ8A 1TXYA 1IZ6A 4BXXH 1HH2P 3NTIA 3T16A 3U9SA 1VQCA 2UUCQ 1TT2A 2EY6A 1HZBA 1STBA 2MO0A 2NYZD 3D0FA 4A3GG 3H09A 3T4AC 5JEAH 3ER0A 3PIPA 1JCKB 4A3IB 1SR3A 4RH6A 1U5KA 4NMZA 4FXGC 4LK1C 1SE4A 2E2HB 3I4NG 4TVAB 3HKZG 4EQNA 1LT5D 3GTLB 3TP5A 1EQQA 2F0DA 1PH6A 3Q22A 5IWAQ 1UE5A 4Y7NB 2LKVA 1PTOC 1VQJA 1VQGA 3OPOA 3RLFA 3VYSA 3Q8DA 3E9HA 4NXMQ 1VQFA 3JAMi 2QW7A 1XTDA 4DFAA 1A3VA 3BZCA 1ZKOA 3E6ZX 5J39A 1EIHA 4RKLA 4POFA 4JK1C 3HOWH 3VR3A 1UE7A 3EBEA 1SN8A 1T9HA 4GNXC 1YVCA 1RTOA 3DWAA 2R93G 1Y1VG 1XMOL 4QUCA 1SYBA 2XRSD 2R93B 3TP8A 2DUDA 3R8BA 2F0KA 4ZKBB 4LNQA 2V4DA 2AQ3B 3Q6SA 1PRTD 2M9VA 3P1HA 4A3EB 3HOVG 1F9QA 1JB7A 4K0KL 2EVBA 5BR8L 3SDZA 1HZAA 3CC7A 2OTJA 1LT4D 3MXPA 2Z6KC 1U4PA 3DWPA 4PZ8A 1C7YA 2OTLA 1B3AA 1SYGA 4P74A 3K7AB 3NUCA 2NZHA 4FF2A 3U50C 2F3IA 4L5RC 1TWFH 2ZXOA 1A6XA 1QVCA 4DR7Q 3S17B 2B2UC 3K57A 4U673 3NP8A 2UUBL 4KI0A 3KF8A 2SOBA 1E2WA 2NBFA 3FKIB 3CCUA 2RCFA 1K8AC 1GXDC 4DR3Q 4B3RQ 3GTPB 4FO2A 2GVAA 3TSSA 1TWCB 4IPGA 4XT1B 5E4WC 2AMCB 4B3SL 4DKAC 4R8NA 1PZID 1TY0A 2QA4A 5IIFA 1I3QH 4G57A 4IPHA 1D7QA 4JPBW 1S5FD 1RD9D 3H94A 5GAGC 1PYBA 4ZLTF 1SLJA 1SEBD 1NR2A 4N8X1 5AFWA 1KQSA 5DM73 2MUYA 4EVOA 2CH4A 4ZAIA 4H13C 5I6YA 3W1GA 2LMCB 5ELCA 2QEJC 4OX9Q 1U4LA 4WJ3M 3I4MH 4IUUA 1B3QA 1CI3M 3TS0A 1EY7A 1GM5A 4QJFA 2CKZB 2FMCA 1Q1EA 3ERQA 3N6RA 2EY2A 3HOUG 1HZ9A 3RZDH 4CDEC 5C0XI 4GKKL 2MGSA 1TU2B 4JI5Q 1ILQA 3M3YH 2DY7A 4X64L 3IFDA 2JA6G 3GTQB 1QUQB 4XDXA 1EY5A 1M4VA 2KVMA 4LUVA 3HOXH 1PXUA 3DEPA 5KNDA 2JA9A 2K01A 2RCNA 1TWAH 1QCBD 3I55A 3MAQA 2F0QA 2KEEA 1HPCA 4LFAQ 4R9WA 4DV1L 3MFYA 2B2WA 4G7OC 4KY6A 3S1RH 1FNUA 2JA8G 1XNRQ 2MJ8A 3I73A 1HUNA 3CQZB 1WTVA 2BOSA 2FJ2A 2CCZA 3KOJA 5CV5A 3A7AB 3BS1A 1BCPC 4UP7A 3GP7A 2JA5G 5IYBH 3S1QH 2FINB 1NAPA 3FKIG 1VQAA 2JXMB 1N8RC 4DV2L 1DONA 4O1NA 4PZ7A 4DV4L 4OWWB 2AWNA 4RA8A 1VQ9A 4DUYL 4YHHL 2R7FA 5C4XG 3J7AF 4JI4L 3S24A 3CRLC 4EX5A 5HGTA 5E3FA 3TREA 2RHSB 3HOZB 3SR1A 5F2DA 4IO9A 4YIJA 3ERSX 4ZK9B 5M5YH 1PH3A 2BA1A 4JI8Q 3K7AH 4ZUIA 1RCVD 1PRTB 2XTIA 2F52A 1Z6HA 4A3FB 4DV1Q 3F2DA 2UUCL 4LWCA 4IUPA 1H9MA 3CMEA 3P75A 2B2WC 1I6HH 1CSQA 1V9PA 1X55A 4YCUA 1FYCA 1TWHB 3VDYA 4GOPC 5NUCA 4P72A 2A5HA 2KCMA 1IYJB 3K5OA 4LW1A 1G2TA 2TMPA 2HT1A 4ME3A 5M5YB 5IY0A 4JI4Q 1YZ6A 5FLMG 4DR2Q 3A7LA 5JEAG 3SGIA 1I4XA 1BR9A 4F7XA 4MIUA 1IBML 1FGBD 3F2UA 1EU4A 3IKJA 1Y8OB 4HJAA 3DXJC 1TWGB 3GV3A 1SNQA 2PQAB 1HR0Q 1O7IA 2P5ZX 3V2TA 1S3OA 4LFCL 1GHKA 4AQYQ 1BQQT 3K5NA 4WRDA 3PO3G 4A3BB 4XXEA 5IGGA 4QY7A 4QUFA 5AJ3L 4LFAL 1PFSA 1E7ZA 2B63G 3QIAA 1BKBA 1Q12A 5CGKA 3KDFB 1LM0A 4RG1A 2Z9HA 1KDAA 4WORA 1A0IA 1X3EA 1V1QA 3M7NA 4LJZC 4JVZA 5D14A 4EQ5A 1NTGA 5LMUQ 1Y1WG 1MGSA 1II3A 1JWSD 1MSHA 4CBVA 4GLVB 1B50A 2C35B 4LFCQ 4BY7B 1P8LA 4HCSA 1STEA 4BY7G 1DYQA 2XVSA 1EU3A 2K14A 5E1FA 2VB2X 2XSCA 2K04A 4HR7B 2LFNA 3M3YB 1EIGA 1WCMB 5EAYA 1Q81C 1KRTA 2OQ0A 4A3BG 4DR2L 2IHFA 1X32A 4K6DA 3KF6B 3J81c 1AP0A 1OXUA 4JV5L 2KCNA 1AEXA 3VR5A 3GO5A 2E2JB 2WKDA 5FLXc 2ZM6L 5IT9L 2IX0A 3PF5A 1CKNA 3FMCA 1Y8NB 3GTPH 3RLOA 1VQKA 5ELFA 4QQBX 3D6CA 4GLAC 5C3EH 3CCVA 3OMGA 4BWGB 2XGTA 5AJ3Q 1IKLA 1PH9A 1V1PA 2EJMA 2HCCA 4BY1B 4AQYL 4BY1H 1G2SA 3PUVA 1LTRD 4O0AA 1GUSA 1IW7C 1UE1A 4DR1Q 4NXNQ 1QZGA 2K5NA 3C1EA 4C3IG 4NXML 4ABNA 4DV3Q 1DOMA 2ZJPA 2M00A 4DAPA 2E2JH 1EQTA 4NKLA 2MNAA 1L1OC 1K83H 3BG3A 2B2YA 2B39A 3KF8B 4O42A 4IPCA 4J8QA 2ATWA 1H9SB 5FO9B 4DV7Q 3H3VI 1LTLA 3LGJA 1G6PA 2A19A 5IYDH 4A3MB 3PO3B 1B2TA 4QL5A 4GKJQ 1D1KA 2E2DC 2EPBA 4GNXA 3E0JA 1E22A 1ML0D 3I72A 4R4IA 5JPNC 3IL8A 2L4NA 3IAYA 3M7GA 2OQKA 5KYIA 4FF4A 3A56A 2DNCA 2A1AA 5DNFA 1SJED 2J7ZA 1BO0A 1J5EQ 1MSGA 2CH4W 4BBRB 4MNOA 4NW2A 4CKBA 1HNZQ 2L55A 5HGQA 5E4XA 5KNBA 3SVMA 3J81i 3FP9A 4R8IA 4ILWA 1H9SA 4KD3A 1IKMA 3HOYG 1NR4A 3NBHB 1N33L 1RHPA 2JA6H 2I0QA 1U9RA 4FXKC 2G9DA 4I65A 1I4PA 1M1KC 5KEEA 3U4VA 3KYHC 1PTOD 2EXZA 2OT2A 2Y0SB 4LUOA 3F2CA 3AFPA 1IXRA 4PNYA 2ZTDA 3BDLA 1IW7D 4F88A 2NVYB 5J3BA 1EYGA 1CKNB 2TSSA 5C4HA 2L5TA 4M1UB 2A73B 4ME5A 1K8OA 5CR3A 1PH4A 1XNQQ 1HQRD 2WAQG 3QOJA 5D3DA 1HNWL 3RNUA 3ULPA 2A6HD 2KOLA 3TZUA 2R7DA 1JQYD 1Q46A 4A3JG 2JQOA 2F0JA 2ZT9C 4H02A 1ASYA 3S14H 1SYDA 5C44B 3UDFA 5C44G 4JI7Q 2IX1A 2UXBQ 4DK0A 4F8MA 1KL9A 4C3IB 4JI5L 1ICFB 2O5IC 3DUZA 4CJ0B 3OOCA 3GTGH 2D0OA 3G6EA 3ZJYC 2BE5D 2N8NA 2KHSA 2VUMB 1PMRA 3BJUA 3K80C 5JJZA 4A3BH 3LWEA 3RUZA 4BS9A 5J1ZA 3IRBA 3G48A 1X54A 5I9OA 4OEMB 3E0EA 2BDNA 2E5LQ 3M85A 3S9WA 1YHQA 4AIMA 1K3RA 4A3KB 2C9OA 4HN7A 1E1OA 4RWSC 1YNJC 4A3JH 4CJ2C 4X3TA 1XX8A 4KHVA 2E74C 1SMYC 3WDNA 2F0TA 3R2IA 2HDMA 2EYPA 4A75A 2EYJA 4Q5VA 1PH1A 1IBKQ 3R3OA 3H0GH 1Q8KA 1EY4A 3SXHA 3HOZH 1LTGD 3PO2B 4EQPA 4DR4Q 2EQSA 1QNKA 1YEZA 4BY1G 2DNEA 3A8KE 2FXQA 4A3FH 4MTKA 4P71A 3S1RB 1Y1WB 4A3GH 3WWVA 2B2UA 2UUBQ 3M4OB 3STBD 3TS2A 1EY0A 2K5DA 2YV5A 1FD7D 3OW7A 1HA5A 2F0IA 3A5ZB 5EKKA 1I6HB 1F2YA 4HIDA 2BE5C 3QO2A 5D3IB 1AZQA 1ZYRD 4PMBA 3VYTA 3GQBA 2RSOA 5C44H 1YI2A 2VB3X 5G3LD 2UXBL 4QF4A 1EFWA 4KLKA 3RN5A 1F2ZA 4K8JA 1NMGA 5E7NA 4C2MH 5LMUL 2MQHA 1BVSA 4J1MA 2YTYA 1W3SA 3TEHB 1PFMA 4JI6Q 2A6HC 4A3IG 1BCPF 2JSOA 3OTOQ 3A8IE 3KLSA 4RMFA 4R4TA 3A8JE 3D31A 1WTXA 4LF7Q 4JI2Q 3PO2G 1GUTA 3UE1A 4XQJA 2F0GA 3BYYB 5GAEC 1MJCA 3ND9A 4A3EG 3HOVB 1HFNA 2VZAA 1UNSA 4AYBE 4L5TA 5C3XA 2C5CA 1EUJA 5IWAL 1IL8A 2K7VA 2B2VC 1KNAA 3L0OA 2HUGA 3VR4A 1G291 3FPUB 2I5HA 3QG1A 1VQBA 3OSOA 3I7FA 1IBLL 4I7ZC 2F0HA 1PZKD 3VYRA 1CFMA 3S16B 2F4IA 1Q1BA 3KUPA 4L5QA 1D5ZC 1HNWQ 2HIXA 4KKUA 1GUNA 3CXCA 1IHZA 3P7JA 4Z9CB 2F03A 3L3OC 1UWVA 5GADC 3PIOA 2HQLA 1OO9B 4X3KA 5ELOA 1SYEA 4DK3C 1K28A 1SNPA 4IUTA 2N49A 4BBRH 1QWYA 1EY9A 3MTSA 1Y14B 1S5DD 2CWPA 3RZDB 4B3TQ 5ELDA 1SRUA 2AQ2B 3I90A 5JJIA 1ENAA 3FHWA 2VQFL 1BBUA 1Q3LA 1ZXTA 3KJPA 3PQIA 1D1IA 1B53A 3I4NB 2PW5A 3H6MA 3TQYA 4JOIC 5G3LF 1W6JA 4JI3L 3M4QA 5C3EB 1AN8A 3EIVA 4KHPL 1PFBA 2ENBA 1O7LA 4DPGA 4A3EH 1QOHA 2VQFQ 2JA8H 3RZOH 2XRQD 1LTBD 1SNMA 2L0CA 1I3QB 1SE8A 4OXPA
chains in the Genus database with same CATH topology
3S2DB 1QE6A 3EA6A 3M4YA 3SK4A 5C4ZA 3SE0A 2B8FA 1Q90A 3JAME 3I4LA 5M5WB 4TKOB 2NVXB 2EY5A 5IGDA 1A2TA 4EQOA 5EJWA 2EDGA 3PMFA 3ONAB 3GTGB 1ESRA 3T13A 4G4KA 5CC4A 3JAML 4V0BA 2WB1B 1STYA 4KD4A 4QIWB 1D5XC 2PYKA 2ZXRA 2A74C 1T5XD 1SDFA 3BVGA 5C5MA 1CHPD 2D2CC 3X3MA 4FF3A 1CT1D 2L9HA 1S5ED 1F9SA 4C3JG 2RDHA 5CV8A 4G7HC 4XIGS 3KBGA 4DNTB 2ICIA 4K5WA 2PCFB 2PPBC 4KJNA 2KJXA 2FHTA 4XQNA 5K36G 3AU7A 2EE1A 2O4XA 4CJ1B 4OIJA 1TQOA 5FO8B 4DA2A 1JORA 3NXWA 4KKTA 2JYOA 1VF7A 2L12A 1DOKA 2Q8TA 1WTPA 2EJGC 5C6AA 2AUJD 1AW7A 2AUKA 3LX0A 3HS0C 3W2DA 1PTOH 2F0NA 2JEBI 4K5XA 1ILPA 1QG7A 3PUWA 1KDCA 2JE6I 2PNRC 3OMCA 1TS5A 2J4XA 4GZYC 1K83B 1BCPB 3NTHA 4AYBB 1GOZA 3D6WA 2K32A 5JOBA 2CW0C 2L11A 3OWFA 3VR2A 1MBYA 2NVQB 2RQXA 5ELEA 4FF1A 5IODA 5IGEA 3PUXA 4DAVA 2H1EA 2K6AA 2CVRA 1QNUA 1I4GA 1TS4A 5BN5A 2IWHA 5CV4A 3CKIB 5EQ0A 1ONLA 3KLRA 3DEOA 5T1GA 1CK1A 1X3PA 2PZTA 5I2XA 1BCPD 4OHJA 2IX3A 4L8JA 4PV1C 5M3MB 4N9TA 3HP3A 4H44C 2NTSA 5KYLA 2K03A 2WACA 1V1OA 5EBDA 4IFDG 1JWMD 3J81L 3G6JB 3MHBA 3HZXA 4IUVA 5JVH3 1WTOA 4X3UA 3C1FA 4N9PA 5JPMC 2A69C 2F0PA 5JVG3 2I46A 4M8AA 4OO1H 2RA4A 1GHJA 3Q24A 4HSVA 4OO1G 4XTCS 2D62A 1LO5D 1L0YB 2F0LA 1HRJA 2D5DA 1LV9A 1OXSC 5T1IA 2F3WA 3VA7A 2QDBA 3CRKC 1LTID 3V96A 4DK1A 1BNZA 2JA7B 1S5BD 2RDGA 5IGFA 2A69D 4ZRZA 4MN3A 3HEJA 1Y69U 5C5LA 1Z47A 1LLRD 1DJRD 2D9UA 1WTRA 1TY2A 2OEOA 1S4ZA 3D8GA 1RJTA 3I3CA 4KMUC 3EJIA 1EYAA 3MA2B 1KNEA 2B2TA 5C4XB 5C0XJ 5CV7A 1STNA 5I4DA 3X3NA 3AMUA 2A6ED 1ESFA 1EWHA 3NE5B 1EYDA 1F9PA 4JBWA 1MD2D 1SBBB 2QCPX 4RGMA 1O80A 2SNSA 4A3JB 1EEID 3W3AA 4KK7A 1G8ZD 1PTOF 4KN7C 1B4OA 1C8CA 4ODGA 2AQ1B 4ZUJA 1KDBA 4IUQA 2WKCA 1VMPA 4H7BA 3HOUB 2J0TD 1B9MA 2F0EA 1TKWB 2EYMA 3GTJB 1G91A 1CA6A 1TWAB 1EL0A 4G7ZC 4DAYA 3KLSX 4S3SA 2DY8A 4XYQA 3GD7A 4ID6A 3SK6A 3MWYW 2Z8LA 1NSNS 4IURA 1V1PB 3J7AV 1GUOA 5A2QL 2XIWA 3J7YW 3P20A 3UI2A 1IYUA 4B08A 3TZDA 4BA2I 3D4WA 5TSSA 3D3RA 4LAAA 4MHEA 1U4RA 2LY7A 2SEBD 1Q8IA 1V8QA 3SHLA 5CORA 1TWFB 2CQAA 1TR5A 1NCVA 3TMEA 5A2QE 1AZPA 1T5EA 2K33A 4RGTA 1F77A 2F0SA 4OIKA 2A68D 1JE4A 1J8IA 2EJFC 2XWJB 1VCIA 2X6LA 1GJXA 3R93A 3MXGA 2XWBB 1A2UA 4IFDJ 3ZYYX 1E0BA 3I70A 4HSPA 1XWEA 5JEAJ 1HCZA 5ELBA 4IN3A 5IT9E 1SAPA 3RMHA 2WP8J 5HURA 3PUYA 2KUMA 2BA0A 3FPPA 4RCOA 1WTWA 1SYCA 2NB0A 3NPPA 2BCOA 1OXVA 2KEDA 3DMUA 5FOBB 1PRTC 5JAVA 3J80E 3HOWB 2RBMA 4HMIA 2RVLA 4KTAA 3HOYB 4LMQD 4E6IA 3O13A 1I6VC 5LL6S 5J22A 5I6WA 4TRDA 1U4MA 4CGYB 1SYFA 1A3UA 3GTMB 1R9TB 3EFXD 1BXTA 3L7ZC 2E75C 1JWUD 1X3QA 5IGBA 1BBXC 1HA6A 1HXYD 4ZYSA 3PIP3 1DM0B 4CHTB 2EY1A 5CYUA 5KNCA 3VYUA 3SEBA 3GTKB 4UAIA 5KGUA 1SFOB 3N52A 4HEDA 4XQQA 1B1ZA 3DWQA 3QWNA 1EYCA 2B2YC 3NSWA 4IFDI 2EYFA 4K8IA 4KN4C 2JA8B 2GA4B 2YYZA 1LACA 2MPMA 3TP7A 1SNDA 2I07B 3C46A 1NUCA 2Q8RE 4BBSB 1STAA 3TP6A 4KJOA 4WJWA 2E76C 2LS01 2HDLA 1A15A 1PFNA 2WV6D 2XN9C 1QILA 1I50B 4HMJA 1FNVA 1EWCA 4OGQC 1HHVA 3K58A 2X69A 3H91A 1SE3A 2EZVA 1EY6A 3DHQA 4V190 2BDOA 5K5PA 2KQ3A 3EVQA 1CHQD 1RODA 3OIQA 4IUNA 2EYHA 1LTAD 3OIPA 4L63B 2B2VA 2K05A 1STGA 1PLFA 1DXMA 2F1MA 4C1NK 2NN6G 3RZOB 3KBXA 5EPKA 2MP1A 1MI2A 2H4OA 1PDQA 1L0XB 3GV6A 4IZ8A 1WD0A 1D6EC 3Q23A 1J9OA 3ND8A 1XTCD 1STHA 4RFBA 3J81E 1LTSD 1EFID 3BVZA 4C2MB 3WOEA 3MZ5A 1RDPD 4ULLA 2EOTA 2G9HD 3NQIA 2X6GA 1JOQA 4IFDH 2F0FA 2FFKB 1E2ZA 3PIO3 4XT3B 3PV0A 3K5MA 4TQUS 3NWSA 3MFGA 5CBAE 3U9OA 4RAUC 2FMMA 3I91A 2MHVA 5BN3A 5C3WA 1TS2A 1WVLA 2A6EC 1JOOA 2ICEC 2YU9B 2WIIB 5IGCA 5I2YA 3BDCA 5EKLA 2B2TC 3G7LA 3A54A 1JC7A 2CW0D 1EEFD 1GUGA 2KA7A 4KY5A 2NVTB 1EZ6A 3IFTA 4KHZA 2QILA 4CKEA 4ZQ3A 3TN2A 3I4MB 3BVMA 3GTOB 1Y1VB 2VXWA 3AB9A 4CKCA 1V43A 4NP5A 3SK5A 2F0OA 4RHRA 3QJYA 3V05A 4XYOA 2F0VA 5FKAC 1TVXA 2WAQB 4FVMA 3H3VC 5FK9C 2HQEA 2NZ1D 3MXUA 1DD2A 5FLXE 2F3VA 2F0UA 1ENCA 3ITPA 3T51B 3K0YA 1B44D 4QCLA 5C0XG 2Z4HA 2NN6H 3CHBD 2JEAI 4WFN3 1RF2D 2PMZB 1E2VA 4KKSA 1VMCA 1F2LA 1LT3D 2R61A 2EYOA 1KLGD 2KECA 3J80L 1VF5C 1CZGA 2VNUD 3BYTB 1SE2A 2R7ZB 3KK7A 2RDFA 4F87A 4PQXA 3SK8A 3S15B 1QB5D 1TIID 5M5XB 4K5VA 5D65A 4L6TB 3A55A 2R3ZA 1O7ZA 2B8GA 4C3JB 1LT6D 1JB3A 5M9OA 4C3HB 2NWGA 1JOKA 3HOXB 4RGNA 2E2IB 1DZ1A 4IALA 3C2PA 2R6GA 4K6LA 4QB4A 5CBEE 5A35A 4DF7A 3NTKA 1PZJD 2N55A 1FR3A 2PZWA 3S1MB 5KIXA 4RCNA 3R2TA 4FXDA 1CZWA 3BDOA 1H9RA 4K14A 4BA1I 1CTMA 4HTHA 4C1NI 4EGVA 3QOLA 4J6HA 1PTOB 4FYDA 1H9KA 2IW3A 1SNCA 5EKIA 3MXNA 1B9NA 1K8MA 1UEAB 1TS3A 2RSNA 5LHY1 3EROA 3LWUA 3Q0AA 4C56C 2PO4A 1PYWD 4C3HG 3QB3A 1JICA 4KV6A 1S5CD 1C48A 5C4JB 2O5JC 1VDZA 1EY8A 1KTKA 2K28A 3NBIA 5CV6A 3FVQA 1KLUD 3E5SA 3OWEB 5EPLA 4FP5D 1R4QB 1XXGA 2ZXPA 3TBIB 2IPKD 4FNFA 2PW7A 1SJHD 1HTLD 4KY7A 1Z7TA 3HKZB 5DEHA 3PUZA 5C0XH 1LTTD 1ENFA 1SNOA 3MVVA 4OO1I 1DOLA 2Z4IA 4QMGA 3T53B 3S1NB 1F9RA 2L1BA 4K2KA 1ET9A 5IOCA 4H0LC 1G6ZA 5EPJA 2A68C 5KRUA 1YNNC 5LL6X 1M8AA 2IJ0A 4IQZA 2PQEA 3H0GB 2AWOA 2Z1CA 4B9WA 1CA5A 1YNND 4TSSA 4RKBA 3NWTA 2IL8A 2HCIA 3CU7A 1BOSA 2NUCA 2K1BA 4U68A 4Q0FA 1ICWA 2JA5B 1F2MA 1SXTA 1C4QA 1Y8PB 1O78A 2JP1A 5I9PA 1D5MC 1WTQA 1YNJD 3I8ZA 3K5LA 3MC0B 2QF7A 1RKNA 3D4DA 2IT1A 1CM9A 2B63B 2ID0A 4DU9A 2SDFA 3BZDB 3FRPB 4P2CB 4ZKCB 1BF4A 1BUVT 1KABA 3K59A 3S1QB 3VA5A 5EGTA 3FDTA 2CHBD 1I4QA 3NBHA 1CQFA 4DXFA 3NK9A 5CMDA 4DN4M 5CV9A 2Q8IB 4HCEA 3MEHA 5COYA 1AFPA 4OL7A 4NDXA 2F0MA 1A3TA 1IYVA 1HTPA 3D4RA 4HAEA 5FO7B 1W6KA 1BDOA 1DCZA 3S14B 1HFGA 3HG9A 5DM63 3TDQA 1H9JA 1I4RA 1XYIA 1PRTF 3DM1A 1UUPA 3RD4A 2OXPA 2QKIC 3WOFA 1ET6A 4DXGA 2JA6B 4DNRB 1I4HA 5BN4A 3S2HB 1OXXK 1EQVA 2K5QA 1QJOA 4X3SA 2F0WA 3VR6A 2RKSA 1R4PB 1OXTA 2SNMA 1ZYRC 2WINB 1KAAA 1HQMC 2M2LA 3OHXC 5DAUA 1ZEQX 3L9AX 3FEWX 3URYA 3HGBA 2O2LD 4A93B 2PZUA 4A3GB 1HUMA 2KCCA 3EQLC 1SSOA 5FLXL 5EBCA 4K2LA 3T56B 5ISRA 1RTNA 1GUWA 1JR0D 3K6OA 1LABA 4PMCA 3NHHA 1SMYD 1O7YA 1EOTA 3LNNA 4B9XA 4PMWA 2XNAC 5M3FB 2NTTA 2NN6I 2R92B 1UAPA 2N88A 2OF1A 4UDUC 1WD1A 3HRZC 4A3DB 4RHSA 2EYLA 3NQTA 2DN8A 1D2BA 1FNWA 4RGOS 2K5WA 1CQVA 4DGZA 5K36H 1EZ8A 3NTIA 3T16A 3U9SA 1TT2A 2EY6A 1STBA 2NYZD 3H09A 3T4AC 5JEAH 1JCKB 4A3IB 4RH6A 4NMZA 4FXGC 4LK1C 1SE4A 2E2HB 4EQNA 1LT5D 3GTLB 3TP5A 2F0DA 3Q22A 4Y7NB 2LKVA 1PTOC 3OPOA 3RLFA 3VYSA 4DFAA 1A3VA 1ZKOA 3E6ZX 5J39A 1EIHA 4RKLA 4JK1C 3VR3A 1RTOA 3DWAA 4QUCA 1SYBA 2XRSD 2R93B 3TP8A 3R8BA 2F0KA 4ZKBB 2V4DA 2AQ3B 3Q6SA 1PRTD 2M9VA 3P1HA 4A3EB 1F9QA 2EVBA 3SDZA 1LT4D 3MXPA 1U4PA 3DWPA 1B3AA 1SYGA 3K7AB 3NUCA 4FF2A 2ZXOA 1A6XA 3S17B 2B2UC 3K57A 4U673 3NP8A 4KI0A 3KF8A 2SOBA 1E2WA 2NBFA 3FKIB 1GXDC 3GTPB 4FO2A 3TSSA 1TWCB 4XT1B 5E4WC 4R8NA 1PZID 1TY0A 5IIFA 4G57A 1S5FD 1RD9D 3H94A 4ZLTF 1SEBD 1NR2A 5AFWA 5DM73 2MUYA 4EVOA 4ZAIA 4H13C 5I6YA 2LMCB 5ELCA 2QEJC 1U4LA 4IUUA 1CI3M 1EY7A 2FMCA 1Q1EA 3ERQA 3N6RA 2EY2A 5C0XI 2MGSA 1TU2B 1ILQA 2DY7A 3IFDA 3GTQB 4XDXA 1EY5A 1M4VA 2KVMA 1PXUA 3DEPA 5KNDA 2K01A 1QCBD 3MAQA 2F0QA 2KEEA 1HPCA 4R9WA 3MFYA 2B2WA 4G7OC 4KY6A 1FNUA 2MJ8A 3I73A 1HUNA 3CQZB 1WTVA 2BOSA 2FJ2A 5CV5A 3A7AB 3BS1A 1BCPC 3GP7A 2FINB 1NAPA 2JXMB 1DONA 4O1NA 2AWNA 4RA8A 3J7AF 3CRLC 5HGTA 5E3FA 3HOZB 3SR1A 5F2DA 4YIJA 4ZK9B 2BA1A 4ZUIA 1RCVD 1PRTB 1Z6HA 4A3FB 4IUPA 1H9MA 3P75A 2B2WC 1FYCA 1TWHB 5NUCA 2A5HA 3K5OA 1G2TA 2TMPA 5M5YB 3A7LA 5JEAG 1I4XA 1BR9A 4F7XA 4MIUA 1FGBD 3F2UA 1EU4A 3IKJA 1Y8OB 3DXJC 1TWGB 3GV3A 1SNQA 3V2TA 1GHKA 1BQQT 3K5NA 4WRDA 4A3BB 4XXEA 5IGGA 4QUFA 3QIAA 1Q12A 5CGKA 1KDAA 4WORA 3M7NA 4LJZC 5D14A 1MGSA 1II3A 1JWSD 1MSHA 4CBVA 1B50A 4BY7B 4HCSA 1STEA 1DYQA 2XVSA 1EU3A 5E1FA 2VB2X 2XSCA 2K04A 4HR7B 2LFNA 3M3YB 1EIGA 1WCMB 1X32A 4K6DA 1AP0A 1OXUA 2KCNA 1AEXA 3VR5A 3GO5A 2E2JB 2WKDA 5IT9L 2IX0A 3FMCA 1Y8NB 5ELFA 3D6CA 3OMGA 4BWGB 1IKLA 1V1PA 2EJMA 2HCCA 4BY1B 1G2SA 3PUVA 1LTRD 1GUSA 1IW7C 3C1EA 4C3IG 4ABNA 1DOMA 2M00A 4DAPA 1EQTA 4NKLA 3BG3A 2B2YA 2B39A 4O42A 4J8QA 1H9SB 5FO9B 4A3MB 3PO3B 1B2TA 1D1KA 2E2DC 2EPBA 3E0JA 1ML0D 3I72A 5JPNC 3IL8A 2L4NA 3IAYA 3M7GA 5KYIA 4FF4A 3A56A 2DNCA 5DNFA 1SJED 2J7ZA 1BO0A 1MSGA 4BBRB 4NW2A 4CKBA 2L55A 5E4XA 5KNBA 3SVMA 4R8IA 4ILWA 1H9SA 4KD3A 1IKMA 1NR4A 1RHPA 1U9RA 4FXKC 2G9DA 4I65A 1I4PA 5KEEA 1PTOD 2EXZA 2OT2A 2Y0SB 4PNYA 3BDLA 1IW7D 4F88A 2NVYB 2TSSA 5C4HA 2L5TA 4M1UB 2A73B 4ME5A 1K8OA 5CR3A 1HQRD 3QOJA 5D3DA 2A6HD 2KOLA 3TZUA 1JQYD 2F0JA 2ZT9C 1SYDA 5C44B 2IX1A 4DK0A 4F8MA 4C3IB 2O5IC 3DUZA 4CJ0B 3OOCA 2BE5D 2KHSA 2VUMB 1PMRA 5JJZA 3LWEA 3RUZA 4BS9A 5J1ZA 5I9OA 2BDNA 3M85A 3S9WA 4A3KB 2C9OA 4HN7A 4RWSC 1YNJC 4CJ2C 4X3TA 1XX8A 4KHVA 2E74C 1SMYC 3WDNA 2F0TA 3R2IA 2HDMA 2EYPA 2EYJA 4Q5VA 3R3OA 1EY4A 3SXHA 1LTGD 3PO2B 4EQPA 1QNKA 2DNEA 3A8KE 3S1RB 1Y1WB 2B2UA 3M4OB 1EY0A 2K5DA 1FD7D 3OW7A 1HA5A 2F0IA 5EKKA 1I6HB 1F2YA 2BE5C 3QO2A 5D3IB 1AZQA 1ZYRD 4PMBA 3VYTA 3GQBA 2RSOA 2VB3X 5G3LD 4QF4A 1F2ZA 4K8JA 4J1MA 1PFMA 2A6HC 1BCPF 2JSOA 3A8IE 3KLSA 3A8JE 3D31A 1WTXA 1GUTA 4XQJA 2F0GA 3BYYB 3ND9A 3HOVB 1HFNA 1UNSA 5C3XA 2C5CA 1IL8A 2K7VA 2B2VC 1KNAA 2HUGA 3VR4A 1G291 3FPUB 3QG1A 3OSOA 4I7ZC 2F0HA 1PZKD 3VYRA 1CFMA 3S16B 2F4IA 1Q1BA 3KUPA 1D5ZC 4KKUA 1GUNA 1IHZA 3P7JA 4Z9CB 2F03A 3L3OC 1OO9B 4X3KA 1SYEA 1SNPA 4IUTA 1QWYA 1EY9A 3MTSA 1S5DD 3RZDB 5ELDA 2AQ2B 3I90A 1ENAA 1Q3LA 1ZXTA 1D1IA 1B53A 3I4NB 2PW5A 3H6MA 5G3LF 1W6JA 5C3EB 1AN8A 1PFBA 2ENBA 1O7LA 1QOHA 2XRQD 1LTBD 1SNMA 2L0CA 1I3QB 3C3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L55 A;  2QCP X;  2VB2 X;  3E6Z X;  3TDQ A;  2VB3 X;  1ZEQ X; 
#chains in the Genus database with same CATH topology
 3S2D B;  1QE6 A;  3EA6 A;  3CAM A;  3M4Y A;  3SK4 A;  5C4Z A;  3SE0 A;  2B8F A;  1Q90 A;  3JAM E;  3I4L A;  5M5W B;  3S17 H;  4TKO B;  2NVX B;  2EY5 A;  5IGD A;  3GTK H;  1SRO A;  1A2T A;  4EQO A;  5EJW A;  1LUZ A;  3JAM c;  2UXC Q;  2EDG A;  3PMF A;  3ONA B;  5IP7 G;  3GTG B;  1KAW A;  1ESR A;  1FJG L;  3T13 A;  4G4K A;  5CC4 A;  3JAM L;  4V0B A;  4HJ5 A;  2WB1 B;  1STY A;  1PHJ A;  3CMA A;  4KD4 A;  4LF6 Q;  1FGU A;  4JBJ A;  1HNZ L;  2KHJ A;  4QIW B;  2F4V Q;  1D5X C;  2WFW A;  2PYK A;  2ZJQ A;  2LSS A;  1D8L A;  2KCT A;  1FVI A;  2ZXR A;  2A74 C;  4DUZ Q;  1T5X D;  1SDF A;  3BVG A;  3TRZ A;  5C5M A;  1CHP D;  2D2C C;  3X3M A;  4FF3 A;  1VQH A;  2Z6B A;  1CT1 D;  2L9H A;  2LXK A;  4HIK A;  1S5E D;  2LXJ A;  3T1Y Q;  1F9S A;  4A3I H;  4C3J G;  5L37 A;  2RDH A;  5CV8 A;  4G7H C;  1XMQ L;  3CD6 A;  4XIG S;  1J6Q A;  3KBG A;  3HOX G;  1SFO H;  4DNT B;  2ICI A;  4K5W A;  2PCF B;  1YJW A;  2PPB C;  2HHH Q;  4KJN A;  2KJX A;  2FHT A;  4XQN A;  4B3R L;  5K36 G;  3AU7 A;  2EE1 A;  2O4X A;  4BXX G;  4CJ1 B;  4OIJ A;  1TQO A;  3F2B A;  3ULJ A;  4MTN A;  5FO8 B;  2MO1 A;  4DA2 A;  2HIV A;  1JOR A;  4A3M H;  4DR1 L;  4DR5 Q;  3NXW A;  1HR0 W;  4OEL B;  4KKT A;  5FLM H;  2JYO A;  1VF7 A;  2HHH L;  2L12 A;  5M3M G;  1CSP A;  1DOK A;  2Q8T A;  1WTP A;  4OX9 L;  2EJG C;  5C6A A;  1HNX L;  2AUJ D;  1AW7 A;  3J7Z C;  1N36 L;  3I4N H;  1P16 A;  3U4Z A;  1K3B C;  2RHQ B;  1XMQ Q;  4BBS G;  2AUK A;  1KC8 C;  3LX0 A;  3HS0 C;  3W2D A;  3BZK A;  4J15 A;  1PTO H;  2F0N A;  2JEB I;  4K5X A;  1ILP A;  1QG7 A;  3PUW A;  1KDC A;  2UU9 L;  2RF4 A;  2JE6 I;  3H0G G;  2PNR C;  3OMC A;  2R92 H;  1TS5 A;  1X56 A;  4UP9 A;  2J4X A;  4GZY C;  1K83 B;  4DUZ L;  1BCP B;  3NTH A;  4AYB B;  1GOZ A;  3D6W A;  2K32 A;  5JOB A;  2CW0 C;  2L11 A;  3OWF A;  3VR2 A;  1PV4 A;  1MBY A;  2NVQ B;  3S2H H;  2RQX A;  1Q82 C;  5ELE A;  4FF1 A;  5IOD A;  2DJF C;  5IGE A;  3PUX A;  4DAV A;  2H1E A;  2K6A A;  2CVR A;  4DV0 L;  1QNU A;  4IJL A;  1I4G A;  1TS4 A;  3J7A 5;  1KHI A;  5BN5 A;  2IWH A;  5CV4 A;  3M9B A;  3CKI B;  5EQ0 A;  1ONL A;  5FJ8 H;  4DR4 L;  3KLR A;  3AYH B;  1IL2 A;  3DEO A;  2NVT H;  5T1G A;  1CK1 A;  1X3P A;  2PZT A;  5I2X A;  4B3M Q;  1BCP D;  4OHJ A;  2IX3 A;  4A3L H;  4L8J A;  4PV1 C;  5M3M B;  2K4K A;  4N9T A;  3HP3 A;  4H44 C;  2NTS A;  3KDF A;  3HOW G;  5KYL A;  2Q2T A;  2K03 A;  2WAC A;  1V1O A;  5EBD A;  4IFD G;  2K5V A;  1JWM D;  1N32 L;  3J81 L;  3NEM A;  3G6J B;  1ASZ A;  3MHB A;  3HZX A;  4IUV A;  1L2F A;  5JVH 3;  1WTO A;  4X3U A;  3C1F A;  1YHB A;  4N9P A;  2R92 G;  1JJC B;  5JPM C;  4DV4 Q;  1E3P A;  2A69 C;  3OW2 A;  2F0P A;  2H5X A;  4GKK Q;  1NJI C;  5JVG 3;  3NEN A;  4LF8 Q;  2I46 A;  4M8A A;  4OO1 H;  2RA4 A;  3I4M G;  1X9N A;  1GHJ A;  3Q24 A;  4HSV A;  3U58 A;  4OO1 G;  4XTC S;  2D62 A;  1LO5 D;  3CCQ A;  1VQI A;  1L0Y B;  2Y0S G;  1GD7 A;  2F0L A;  1HRJ A;  1KIX A;  2D5D A;  1LV9 A;  1OXS C;  5T1I A;  4JCV E;  2F3W A;  3T1H Q;  3KJO A;  3VA7 A;  2QDB A;  3CRK C;  1LTI D;  3CC2 A;  3V96 A;  4DK1 A;  1BNZ A;  2JA7 B;  1VQP A;  5IYD G;  1S5B D;  2RDG A;  1HJP A;  5IGF A;  3DM3 A;  2A69 D;  4ZRZ A;  4MN3 A;  3HEJ A;  1Y69 U;  5C5L A;  3HKS A;  1PVO A;  1Z47 A;  1LLR D;  1YNX A;  2K50 A;  4IJH A;  1TWH H;  1DJR D;  2D9U A;  2QEX A;  1WTR A;  1TY2 A;  2OEO A;  1S4Z A;  3D8G A;  4R4Q A;  3GDE A;  1XPO A;  1RJT A;  3I3C A;  2VQE Q;  4UP8 A;  4KMU C;  3EJI A;  4DR6 Q;  1EYA A;  3MA2 B;  1KNE A;  2B2T A;  2BH8 A;  2IY5 B;  3J80 c;  5C4X B;  1WOC A;  3J80 i;  5C0X J;  5CV7 A;  1X3G A;  4JW0 A;  1STN A;  5I4D A;  3X3N A;  3AMU A;  2A6E D;  1ESF A;  1EWH A;  3NE5 B;  5BR8 Q;  1M90 C;  1EYD A;  1F9P A;  4JBW A;  2VW9 A;  1MD2 D;  3STB C;  3W1B A;  1KD1 C;  2PNH A;  1SBB B;  2BH2 A;  2QCP X;  2I5L X;  4RGM A;  1O80 A;  2SNS A;  1EEI D;  3W3A A;  4KK7 A;  4A3J B;  2ZM6 Q;  1G8Z D;  1PTO F;  4KN7 C;  1B4O A;  1I50 H;  1C8C A;  2PQA A;  1JT8 A;  1N9W A;  4ODG A;  3K0X A;  2AQ1 B;  4ZUJ A;  1NMF A;  1KDB A;  5M5X H;  4IUQ A;  2WKC A;  1VMP A;  2E5L L;  4GLX A;  4POG A;  3BU2 A;  4H7B A;  3HOU B;  3A5U A;  2J0T D;  1B9M A;  2F0E A;  1TKW B;  3GTQ H;  2EYM A;  1EQR A;  1NNX A;  1AH9 A;  3GTJ B;  1G91 A;  1CA6 A;  4X6A H;  1TWA B;  4ALP A;  3RR5 A;  1EL0 A;  1B70 B;  4G7Z C;  4DAY A;  3KLS X;  2D0P A;  2DY8 A;  2Y0S E;  4S3S A;  4XYQ A;  3GD7 A;  2QGQ A;  1FJG Q;  4ID6 A;  3SK6 A;  3MWY W;  2Z8L A;  3HOV H;  1NSN S;  2JN4 A;  4IUR A;  2EXD A;  2K75 A;  1V1P B;  3J7A V;  4O2D A;  1GUO A;  5A2Q L;  2XIW A;  4AH6 A;  3P20 A;  3J7Y W;  3UI2 A;  1IYU A;  4B08 A;  1L1O B;  3TZD A;  4BA2 I;  3D4W A;  3D3R A;  5TSS A;  4LAA A;  4MHE A;  1U4R A;  4AYB G;  2LY7 A;  1XMO Q;  2E2H H;  2I5M X;  2SEB D;  1Q8I A;  1V8Q A;  3SHL A;  1PH7 A;  1BBW A;  4A4I A;  5COR A;  2G5D A;  1TWF B;  2CQA A;  1VQ7 A;  1TR5 A;  1NCV A;  3TME A;  5A2Q E;  5IE8 A;  1T5E A;  4RGT A;  2K33 A;  4FDB A;  1AZP A;  1F77 A;  2F0S A;  4OIK A;  4PG3 A;  2DGY A;  2A68 D;  1JE4 A;  1J8I A;  4DR7 L;  2EJF C;  2XWJ B;  4JG2 A;  1VCI A;  3CCL A;  2GN5 A;  2X6L A;  1PYS B;  3R93 A;  1GJX A;  1UEB A;  4DV2 Q;  3MXG A;  5GAH C;  2XWB B;  3CW2 C;  1A2U A;  4IFD J;  3ZYY X;  1E0B A;  3M4O H;  3I70 A;  4HSP A;  1XWE A;  5JEA J;  1HCZ A;  5ELB A;  2Z0S A;  4IN3 A;  5IT9 E;  1SAP A;  1J5E L;  2EIF A;  3RMH A;  2WP8 J;  5HUR A;  3PUY A;  4DV5 Q;  2KUM A;  1SMX A;  2BA0 A;  1N34 Q;  3FPP A;  4RCO A;  5H1S E;  1WTW A;  1SYC A;  2NB0 A;  3NPP A;  2NZO A;  1K0R A;  1VQE A;  1OXV A;  2BCO A;  3PO3 H;  2KED A;  3DMU A;  5FOB B;  2CFM A;  1PH5 A;  3HKZ E;  1PRT C;  1VQ4 A;  4YCW A;  5JAV A;  3J80 E;  3HOW B;  2RBM A;  4HMI A;  4DV7 L;  3F8T A;  2RVL A;  4KTA A;  3HOY B;  4LMQ D;  4E6I A;  3O13 A;  1I6V C;  1CKO A;  2GVB A;  2ZTC A;  1YBY A;  5LL6 S;  1DGS A;  5I6W A;  5J22 A;  4TRD A;  1U4M A;  4CGY B;  4OWT B;  4DV3 L;  1SYF A;  1A3U A;  3GTM B;  1R9T B;  3EFX D;  4R4O A;  2NVY H;  1BXT A;  3L7Z C;  1YJ9 A;  3CF5 A;  3B6Y A;  2E75 C;  1JWU D;  1X3Q A;  5IGB A;  1BBX C;  1HA6 A;  1HXY D;  4ZYS A;  3PIP 3;  1DM0 B;  4CHT B;  4A3F G;  2EY1 A;  5CYU A;  1Q7Y C;  4LUZ A;  3S1N H;  1NY4 A;  3VYU A;  4DAY B;  5IP9 H;  5KNC A;  3SEB A;  4YY3 Q;  3GTK B;  4UAI A;  1WFQ A;  5KGU A;  1SFO B;  3GTL H;  1YHA A;  4GKJ L;  3N52 A;  3DLL A;  4HED A;  1TWG H;  3L2P A;  4PZ6 A;  4JI0 L;  1NBW A;  4XQQ A;  1B1Z A;  3DWQ A;  3QWN A;  1EYC A;  3CCM A;  1N36 Q;  2B2Y C;  3RLN A;  3NSW A;  4IFD I;  4Y7N H;  2EYF A;  1JE5 A;  4K8I A;  4KN4 C;  2PMZ E;  4C3J H;  5JJL A;  2JA8 B;  4I7A A;  2GA4 B;  2YYZ A;  1LAC A;  1VQ5 A;  2MPM A;  1K73 C;  3TP7 A;  2Q2I A;  4GN3 B;  2WB1 G;  1SND A;  5IYC H;  2I07 B;  3C46 A;  3EN2 A;  1NUC A;  2Q8R E;  2R7Z H;  2ALY B;  2PI2 E;  4BBS B;  1STA A;  1U0L A;  4KJO A;  2N78 A;  3TP6 A;  4A93 H;  4WJW A;  2E76 C;  1Y1V H;  2HDL A;  1A15 A;  2LS0 1;  1PFN A;  3GTO H;  2WV6 D;  1R9T H;  2XN9 C;  1QIL A;  1I50 B;  2ZTE A;  1FNV A;  1EWC A;  4HMJ A;  4OGQ C;  4IOC A;  1W2B A;  1HHV A;  5LMN Q;  3K8A A;  3HOU H;  3K58 A;  2X69 A;  1YIT A;  3H91 A;  1SE3 A;  2EZV A;  1IBK L;  1EY6 A;  3UDG A;  3DHQ A;  4V19 0;  4A3L G;  2BDO A;  5K5P A;  2KQ3 A;  1HNX Q;  3EVQ A;  4JI1 L;  4B3S Q;  1CHQ D;  4DV6 L;  1ROD A;  1VQO A;  4JBM A;  3OIQ A;  4IUN A;  2EYH A;  1LTA D;  1IBL Q;  3OIP A;  3S16 H;  4L63 B;  2B2V A;  2PI2 A;  4LF9 Q;  2K05 A;  4X64 Q;  1STG A;  1PLF A;  1DXM A;  2F1M A;  4C1N K;  2NN6 G;  3RZO B;  3KBX A;  3CPF A;  2CQO A;  4OWX B;  4Y52 H;  2UXD L;  5EPK A;  2VUM G;  3CC4 A;  2VQE L;  4DR6 L;  2MP1 A;  1MI2 A;  3CQZ H;  2H4O A;  1PDQ A;  4UPA A;  4L5S A;  1KRS A;  1L0X B;  4CDF C;  3GV6 A;  4IZ8 A;  1WD0 A;  1D6E C;  3Q23 A;  2L15 A;  1J9O A;  3ND8 A;  4R4C A;  2R7Z G;  1XTC D;  1STH A;  1WJJ A;  4RFB A;  3J81 E;  2MFI A;  1E24 A;  1VQD A;  1LTS D;  4HJ7 A;  3CCJ A;  4HJ8 A;  1EFI D;  3BVZ A;  2N3S A;  2WB1 E;  4C2M B;  5M3M H;  3WOE A;  3MZ5 A;  2F4V L;  1RDP D;  4ULL A;  1HR0 L;  4A3C H;  2EOT A;  2YU9 H;  2G9H D;  3NQI A;  2X6G A;  4DUY Q;  1JOQ A;  4JBK A;  1N33 Q;  4IFD H;  2F0F A;  2FFK B;  1E2Z A;  3I56 A;  4LF9 L;  3PIO 3;  4XT3 B;  3PV0 A;  1HZC A;  4N8F A;  1MIU A;  3GTM H;  3K5M A;  4JI7 L;  4TQU S;  3NWS A;  3MFG A;  1PH8 A;  5CBA E;  3U9O A;  4RAU C;  2FMM A;  3I91 A;  3CCE A;  3J81 j;  2ZJR A;  2MHV A;  3K7U C;  1S72 A;  5DLQ E;  4X66 L;  5BN3 A;  5C3W A;  1TS2 A;  1WVL A;  4YY3 L;  4GS3 A;  5IT9 c;  5GRO A;  3CPW A;  5LMN L;  5IYB G;  3OYY A;  2A6E C;  1JOO A;  2ICE C;  2YU9 B;  2WII B;  5IGC A;  5I2Y A;  3BDC A;  2HD3 A;  5EKL A;  5FJ8 G;  2B2T C;  3G7L A;  2AKW B;  3A54 A;  1A8V A;  1JC7 A;  2CWA A;  2CW0 D;  3ULL A;  4LF8 L;  2ASB A;  1K9M C;  1EIY B;  1EEF D;  1GUG A;  2KA7 A;  3W5O A;  4KY5 A;  2NVT B;  2B63 H;  1EZ6 A;  3IFT A;  4KHZ A;  2QIL A;  4HIO A;  4LF4 L;  4CKE A;  1RL2 A;  4ZQ3 A;  3I2Z A;  4CDC C;  3TN2 A;  3I4M B;  3BVM A;  3GTO B;  1N32 Q;  1Y1V B;  2VXW A;  3AB9 A;  3UDX A;  4CKC A;  4X62 L;  1V43 A;  4NP5 A;  4YWL A;  3SK5 A;  2F0O A;  4RHR A;  3QJY A;  3E9I A;  3V05 A;  2DJG C;  4XYO A;  4LF7 L;  2F0V A;  1G51 A;  5FKA C;  1JJ2 A;  3PF4 A;  1TVX A;  3HFZ B;  1GVP A;  4GOP B;  3AFQ A;  2WAQ B;  4FVM A;  1N34 L;  3H3V C;  5FK9 C;  2HQE A;  4JI8 L;  4DV5 L;  2NZ1 D;  4CDD C;  3MXU A;  4X62 Q;  4IPD A;  1I94 Q;  1DD2 A;  2AHO B;  5FLX E;  2F3V A;  2F0U A;  2OWO A;  4YHH Q;  1ENC A;  3ITP A;  3T51 B;  3K0Y A;  1B44 D;  4QCL A;  4QGU A;  1VQL A;  5C0X G;  2Z4H A;  2NN6 H;  4BBR G;  3S15 H;  3CHB D;  2JEA I;  4WFN 3;  5JJK A;  4A3D G;  1RF2 D;  2PMZ B;  1E2V A;  2VUM H;  1QVF A;  1QUQ A;  4KKS A;  1VMC A;  5M3F G;  3E3X A;  4UY8 C;  1F2L A;  2E8G A;  1LT3 D;  3C3L A;  2R61 A;  2EYO A;  1KLG D;  1AE3 A;  3PCO B;  2KEC A;  3J80 L;  3GTJ H;  1VF5 C;  4B3T L;  1CZG A;  2VNU D;  3BYT B;  2E2I H;  3QR8 A;  1SE2 A;  3OTO L;  2R7Z B;  3KK7 A;  2RDF A;  4F87 A;  1MJE A;  1X3F A;  4JI6 L;  4PQX A;  3SK8 A;  4X66 Q;  4BY7 H;  3S15 B;  3PSI A;  1QB5 D;  1TII D;  3M4P A;  5M5X B;  2NVX H;  4K5V A;  5D65 A;  4L6T B;  1EOV A;  3A55 A;  1CKM A;  2R3Z A;  1O7Z A;  2B8G A;  4C3J B;  1OTC A;  1LT6 D;  1JB3 A;  1LYL A;  5M9O A;  4C3H B;  2NWG A;  1JOK A;  2IHE A;  2B3G A;  2UUA L;  3HOX B;  2UXD Q;  4RGN A;  2E2I B;  1DZ1 A;  4IAL A;  2KBN A;  3C2P A;  2R6G A;  4NXN L;  1X6O A;  1XPU A;  4K6L A;  4QB4 A;  5CBE E;  4IOA A;  5A35 A;  4DF7 A;  2Z6K A;  3NTK A;  3HOZ G;  4NB3 A;  4LFB Q;  1PZJ D;  1C9O A;  2N55 A;  1FR3 A;  2PZW A;  1YIJ A;  5IP7 H;  5KIX A;  3S1M B;  4JI2 L;  4RCN A;  3R2T A;  3KFU A;  4FXD A;  1CZW A;  4JI1 Q;  3BDO A;  1RIP A;  1Q86 C;  1H9R A;  1MKH A;  4K14 A;  2VL6 A;  4YWK A;  1E1T A;  4BA1 I;  1CTM A;  4HTH A;  2NVQ H;  4C1N I;  3T1Y L;  4EGV A;  3QOL A;  4J6H A;  1PTO B;  4ZCK A;  4FYD A;  1H9K A;  2IW3 A;  4JV5 Q;  1SNC A;  3A74 A;  1JMC A;  5EKI A;  3MXN A;  1B9N A;  4OON A;  3S1M H;  4JYA L;  1K8M A;  1UEA B;  1TS3 A;  2RSN A;  1TWC H;  5LHY 1;  1A63 A;  3ERO A;  3LWU A;  3Q0A A;  4C56 C;  2PO4 A;  1EWI A;  3PGZ A;  1PYW D;  1WCM H;  4C3H G;  1L0W A;  1WCM G;  3CP0 A;  3QB3 A;  1JIC A;  4KV6 A;  1S5C D;  4A3K G;  1C48 A;  5C4J B;  3I4O A;  4GN5 A;  2R93 H;  2UXC L;  4DNI A;  2O5J C;  4GNX B;  1VDZ A;  2VY3 A;  2Q2H A;  1EY8 A;  2JK8 A;  1VQN A;  1KTK A;  4GOP A;  2K28 A;  1XNQ L;  3NBI A;  4P73 A;  5CV6 A;  3MXN B;  3FVQ A;  1KLU D;  3E5S A;  3OWE B;  4A3M G;  5LMN W;  2OCE A;  5EPL A;  4FP5 D;  1R4Q B;  4C3H H;  1XXG A;  2ZXP A;  3TBI B;  1VS0 A;  3JC6 6;  2IPK D;  4FNF A;  2PW7 A;  1SJH D;  1HTL D;  4KHP Q;  2KHI A;  4KY7 A;  4LF6 L;  1H95 A;  1Z7T A;  3HKZ B;  5DEH A;  5ELN A;  1NE3 A;  3PUZ A;  5C0X H;  1JJG A;  1LTT D;  1ENF A;  1SNO A;  3MVV A;  3UE0 A;  1KXL A;  1I94 L;  4OO1 I;  1DOL A;  1VQM A;  2Z4I A;  4DAM A;  2YTX A;  4QMG A;  2ES2 A;  2B29 A;  3T53 B;  3S1N B;  1F9R A;  2L1B A;  3KLW A;  4K2K A;  1ET9 A;  1Y1W H;  5IYC G;  5IOC A;  5IP9 G;  4H0L C;  1XNR L;  3A0J A;  1G6Z A;  5EPJ A;  2A68 C;  5GQO A;  5KRU A;  1YNN C;  3T1H L;  5LL6 X;  3CCR A;  1M8A A;  3ICE A;  5M5W H;  2IJ0 A;  4IQZ A;  1C0A A;  2PQE A;  1WI5 A;  3H0G B;  2AWO A;  2Z1C A;  4B9W A;  1CA5 A;  1K8G A;  4LF5 L;  1YNN D;  4TSS A;  4RKB A;  5C4X H;  1L1O A;  2WAQ E;  3NWT A;  2IL8 A;  2HCI A;  2JA7 H;  3CU7 A;  1BOS A;  2NUC A;  1QZH A;  2K1B A;  4JOI A;  4P75 A;  4QIW E;  4U68 A;  4X65 L;  4Q0F A;  1ICW A;  2JA5 B;  2K52 A;  1F2M A;  1B8A A;  1SXT A;  3S2D H;  1C4Q A;  1XPR A;  2UUA Q;  2A8V A;  1Y8P B;  1O78 A;  2JP1 A;  5I9P A;  4JYA Q;  1D5M C;  3PO2 H;  1WTQ A;  1YNJ D;  3I8Z A;  2K5H A;  3K5L A;  3MC0 B;  2QF7 A;  1RKN A;  3D4D A;  2IT1 A;  1CM9 A;  2B63 B;  1K0S A;  2ID0 A;  4DU9 A;  2SDF A;  3BZD B;  4GN4 B;  3FRP B;  4P2C B;  4ZKC B;  1BF4 A;  2JA5 H;  1BUV T;  2UU9 Q;  1KAB A;  3K59 A;  3S1Q B;  3VA5 A;  5EGT A;  3FDT A;  2CHB D;  1I4Q A;  3NBH A;  3K81 C;  1CQF A;  4DXF A;  4BBS H;  3NK9 A;  5CMD A;  4DN4 M;  5CV9 A;  4DR5 L;  4A76 A;  2Q8I B;  4HCE A;  3MEH A;  4DV0 Q;  1VQ6 A;  5COY A;  1AFP A;  1X65 A;  4OL7 A;  4NDX A;  1YJN A;  2F0M A;  3UDI A;  5C3E G;  1EIF A;  4UHV A;  1A3T A;  3G71 A;  1IYV A;  1HTP A;  3D4R A;  4HAE A;  5FO7 B;  1W6K A;  1BDO A;  1DCZ A;  3S14 B;  1FL0 A;  1MHW C;  1HFG A;  4DV6 Q;  3HG9 A;  4K0K Q;  5DM6 3;  4C3I H;  3TDQ A;  1H9J A;  1I4R A;  1XYI A;  4APV A;  4A93 G;  1PRT F;  2YTV A;  4YWM A;  3DM1 A;  1UUP A;  1I5F A;  3RD4 A;  4DK6 C;  3F1Z A;  2OXP A;  2QKI C;  4LFB L;  1GKH A;  3WOF A;  4DR3 L;  1ET6 A;  4DXG A;  4NPS A;  2JA6 B;  4DNR B;  1I4H A;  5BN4 A;  1UE6 A;  3S2H B;  1OXX K;  3FKI H;  1AE2 A;  1QVG A;  1EQV A;  1XJV A;  3KF6 A;  2K5Q A;  3H15 A;  1QJO A;  4X3S A;  2F0W A;  4HJ9 A;  4X65 Q;  3VR6 A;  2RKS A;  1R4P B;  1VQ8 A;  1OXT A;  2SNM A;  3H3V H;  1ZYR C;  1Z9F A;  3RN2 A;  2WIN B;  1B7Y B;  4A3D H;  4JI0 Q;  1KAA A;  4HIM A;  1A62 A;  3AQQ A;  4A3K H;  1HQM C;  5M3F H;  4YCV A;  4LF5 Q;  2M2L A;  3OHX C;  5DAU A;  1ZEQ X;  3L9A X;  4JC0 A;  5C4J H;  3FEW X;  3URY A;  3HOY H;  3HGB A;  2O2L D;  2Q2U A;  4A93 B;  2PZU A;  4A3G B;  1HUM A;  2KCC A;  3EQL C;  1SSO A;  5FLX L;  4WJ4 A;  5EBC A;  4K2L A;  3T56 B;  5ISR A;  4B3M L;  1RTN A;  1GUW A;  1JR0 D;  3K6O A;  1LAB A;  4PMC A;  1PH2 A;  2JJQ A;  3NHH A;  3AEV A;  2KEN A;  2JA7 G;  1SMY D;  1PA6 A;  3G4S A;  1O7Y A;  1IBM Q;  3NEL A;  1EOT A;  3LNN A;  4B9X A;  4PMW A;  2XNA C;  5M3F B;  2NTT A;  2NN6 I;  1S40 A;  1UAP A;  4LF4 Q;  2N88 A;  2R92 B;  1GO3 E;  2OF1 A;  4UDU C;  4R1J A;  1WD1 A;  3HRZ C;  3CCS A;  4A3D B;  4JI3 Q;  4RHS A;  2EYL A;  4MZ9 A;  1WTH A;  3NQT A;  1WYD A;  2DN8 A;  2VS1 A;  4A3C G;  1D2B A;  1FNW A;  4RGO S;  2K5W A;  1CQV A;  1CUK A;  2QDL A;  3MEF A;  4DGZ A;  5K36 H;  5HY6 A;  2V1C C;  1EZ8 A;  1TXY A;  1IZ6 A;  4BXX H;  1HH2 P;  3NTI A;  3T16 A;  3U9S A;  1VQC A;  2UUC Q;  1TT2 A;  2EY6 A;  1HZB A;  1STB A;  2MO0 A;  2NYZ D;  3D0F A;  4A3G G;  3H09 A;  3T4A C;  5JEA H;  3ER0 A;  3PIP A;  1JCK B;  4A3I B;  1SR3 A;  4RH6 A;  1U5K A;  4NMZ A;  4FXG C;  4LK1 C;  1SE4 A;  2E2H B;  3I4N G;  4TVA B;  3HKZ G;  4EQN A;  1LT5 D;  3GTL B;  3TP5 A;  1EQQ A;  2F0D A;  1PH6 A;  3Q22 A;  5IWA Q;  1UE5 A;  4Y7N B;  2LKV A;  1PTO C;  1VQJ A;  1VQG A;  3OPO A;  3RLF A;  3VYS A;  3Q8D A;  3E9H A;  4NXM Q;  1VQF A;  3JAM i;  2QW7 A;  1XTD A;  4DFA A;  1A3V A;  3BZC A;  1ZKO A;  3E6Z X;  5J39 A;  1EIH A;  4RKL A;  4POF A;  4JK1 C;  3HOW H;  3VR3 A;  1UE7 A;  3EBE A;  1SN8 A;  1T9H A;  4GNX C;  1YVC A;  1RTO A;  3DWA A;  2R93 G;  1Y1V G;  1XMO L;  4QUC A;  1SYB A;  2XRS D;  2R93 B;  3TP8 A;  2DUD A;  3R8B A;  2F0K A;  4ZKB B;  4LNQ A;  2V4D A;  2AQ3 B;  3Q6S A;  1PRT D;  2M9V A;  3P1H A;  4A3E B;  3HOV G;  1F9Q A;  1JB7 A;  4K0K L;  2EVB A;  5BR8 L;  3SDZ A;  1HZA A;  3CC7 A;  2OTJ A;  1LT4 D;  3MXP A;  2Z6K C;  1U4P A;  3DWP A;  4PZ8 A;  1C7Y A;  2OTL A;  1B3A A;  1SYG A;  4P74 A;  3K7A B;  3NUC A;  2NZH A;  4FF2 A;  3U50 C;  2F3I A;  4L5R C;  1TWF H;  2ZXO A;  1A6X A;  1QVC A;  4DR7 Q;  3S17 B;  2B2U C;  3K57 A;  4U67 3;  3NP8 A;  2UUB L;  4KI0 A;  3KF8 A;  2SOB A;  1E2W A;  2NBF A;  3FKI B;  3CCU A;  2RCF A;  1K8A C;  1GXD C;  4DR3 Q;  4B3R Q;  3GTP B;  4FO2 A;  2GVA A;  3TSS A;  1TWC B;  4IPG A;  4XT1 B;  5E4W C;  2AMC B;  4B3S L;  4DKA C;  4R8N A;  1PZI D;  1TY0 A;  2QA4 A;  5IIF A;  1I3Q H;  4G57 A;  4IPH A;  1D7Q A;  4JPB W;  1S5F D;  1RD9 D;  3H94 A;  5GAG C;  1PYB A;  4ZLT F;  1SLJ A;  1SEB D;  1NR2 A;  4N8X 1;  5AFW A;  1KQS A;  5DM7 3;  2MUY A;  4EVO A;  2CH4 A;  4ZAI A;  4H13 C;  5I6Y A;  3W1G A;  2LMC B;  5ELC A;  2QEJ C;  4OX9 Q;  1U4L A;  4WJ3 M;  3I4M H;  4IUU A;  1B3Q A;  1CI3 M;  3TS0 A;  1EY7 A;  1GM5 A;  4QJF A;  2CKZ B;  2FMC A;  1Q1E A;  3ERQ A;  3N6R A;  2EY2 A;  3HOU G;  1HZ9 A;  3RZD H;  4CDE C;  5C0X I;  4GKK L;  2MGS A;  1TU2 B;  4JI5 Q;  1ILQ A;  3M3Y H;  2DY7 A;  4X64 L;  3IFD A;  2JA6 G;  3GTQ B;  1QUQ B;  4XDX A;  1EY5 A;  1M4V A;  2KVM A;  4LUV A;  3HOX H;  1PXU A;  3DEP A;  5KND A;  2JA9 A;  2K01 A;  2RCN A;  1TWA H;  1QCB D;  3I55 A;  3MAQ A;  2F0Q A;  2KEE A;  1HPC A;  4LFA Q;  4R9W A;  4DV1 L;  3MFY A;  2B2W A;  4G7O C;  4KY6 A;  3S1R H;  1FNU A;  2JA8 G;  1XNR Q;  2MJ8 A;  3I73 A;  1HUN A;  3CQZ B;  1WTV A;  2BOS A;  2FJ2 A;  2CCZ A;  3KOJ A;  5CV5 A;  3A7A B;  3BS1 A;  1BCP C;  4UP7 A;  3GP7 A;  2JA5 G;  5IYB H;  3S1Q H;  2FIN B;  1NAP A;  3FKI G;  1VQA A;  2JXM B;  1N8R C;  4DV2 L;  1DON A;  4O1N A;  4PZ7 A;  4DV4 L;  4OWW B;  2AWN A;  4RA8 A;  1VQ9 A;  4DUY L;  4YHH L;  2R7F A;  5C4X G;  3J7A F;  4JI4 L;  3S24 A;  3CRL C;  4EX5 A;  5HGT A;  5E3F A;  3TRE A;  2RHS B;  3HOZ B;  3SR1 A;  5F2D A;  4IO9 A;  4YIJ A;  3ERS X;  4ZK9 B;  5M5Y H;  1PH3 A;  2BA1 A;  4JI8 Q;  3K7A H;  4ZUI A;  1RCV D;  1PRT B;  2XTI A;  2F52 A;  1Z6H A;  4A3F B;  4DV1 Q;  3F2D A;  2UUC L;  4LWC A;  4IUP A;  1H9M A;  3CME A;  3P75 A;  2B2W C;  1I6H H;  1CSQ A;  1V9P A;  1X55 A;  4YCU A;  1FYC A;  1TWH B;  3VDY A;  4GOP C;  5NUC A;  4P72 A;  2A5H A;  2KCM A;  1IYJ B;  3K5O A;  4LW1 A;  1G2T A;  2TMP A;  2HT1 A;  4ME3 A;  5M5Y B;  5IY0 A;  4JI4 Q;  1YZ6 A;  5FLM G;  4DR2 Q;  3A7L A;  5JEA G;  3SGI A;  1I4X A;  1BR9 A;  4F7X A;  4MIU A;  1IBM L;  1FGB D;  3F2U A;  1EU4 A;  3IKJ A;  1Y8O B;  4HJA A;  3DXJ C;  1TWG B;  3GV3 A;  1SNQ A;  2PQA B;  1HR0 Q;  1O7I A;  2P5Z X;  3V2T A;  1S3O A;  4LFC L;  1GHK A;  4AQY Q;  1BQQ T;  3K5N A;  4WRD A;  3PO3 G;  4A3B B;  4XXE A;  5IGG A;  4QY7 A;  4QUF A;  5AJ3 L;  4LFA L;  1PFS A;  1E7Z A;  2B63 G;  3QIA A;  1BKB A;  1Q12 A;  5CGK A;  3KDF B;  1LM0 A;  4RG1 A;  2Z9H A;  1KDA A;  4WOR A;  1A0I A;  1X3E A;  1V1Q A;  3M7N A;  4LJZ C;  4JVZ A;  5D14 A;  4EQ5 A;  1NTG A;  5LMU Q;  1Y1W G;  1MGS A;  1II3 A;  1JWS D;  1MSH A;  4CBV A;  4GLV B;  1B50 A;  2C35 B;  4LFC Q;  4BY7 B;  1P8L A;  4HCS A;  1STE A;  4BY7 G;  1DYQ A;  2XVS A;  1EU3 A;  2K14 A;  5E1F A;  2VB2 X;  2XSC A;  2K04 A;  4HR7 B;  2LFN A;  3M3Y B;  1EIG A;  1WCM B;  5EAY A;  1Q81 C;  1KRT A;  2OQ0 A;  4A3B G;  4DR2 L;  2IHF A;  1X32 A;  4K6D A;  3KF6 B;  3J81 c;  1AP0 A;  1OXU A;  4JV5 L;  2KCN A;  1AEX A;  3VR5 A;  3GO5 A;  2E2J B;  2WKD A;  5FLX c;  2ZM6 L;  5IT9 L;  2IX0 A;  3PF5 A;  1CKN A;  3FMC A;  1Y8N B;  3GTP H;  3RLO A;  1VQK A;  5ELF A;  4QQB X;  3D6C A;  4GLA C;  5C3E H;  3CCV A;  3OMG A;  4BWG B;  2XGT A;  5AJ3 Q;  1IKL A;  1PH9 A;  1V1P A;  2EJM A;  2HCC A;  4BY1 B;  4AQY L;  4BY1 H;  1G2S A;  3PUV A;  1LTR D;  4O0A A;  1GUS A;  1IW7 C;  1UE1 A;  4DR1 Q;  4NXN Q;  1QZG A;  2K5N A;  3C1E A;  4C3I G;  4NXM L;  4ABN A;  4DV3 Q;  1DOM A;  2ZJP A;  2M00 A;  4DAP A;  2E2J H;  1EQT A;  4NKL A;  2MNA A;  1L1O C;  1K83 H;  3BG3 A;  2B2Y A;  2B39 A;  3KF8 B;  4O42 A;  4IPC A;  4J8Q A;  2ATW A;  1H9S B;  5FO9 B;  4DV7 Q;  3H3V I;  1LTL A;  3LGJ A;  1G6P A;  2A19 A;  5IYD H;  4A3M B;  3PO3 B;  1B2T A;  4QL5 A;  4GKJ Q;  1D1K A;  2E2D C;  2EPB A;  4GNX A;  3E0J A;  1E22 A;  1ML0 D;  3I72 A;  4R4I A;  5JPN C;  3IL8 A;  2L4N A;  3IAY A;  3M7G A;  2OQK A;  5KYI A;  4FF4 A;  3A56 A;  2DNC A;  2A1A A;  5DNF A;  1SJE D;  2J7Z A;  1BO0 A;  1J5E Q;  1MSG A;  2CH4 W;  4BBR B;  4MNO A;  4NW2 A;  4CKB A;  1HNZ Q;  2L55 A;  5HGQ A;  5E4X A;  5KNB A;  3SVM A;  3J81 i;  3FP9 A;  4R8I A;  4ILW A;  1H9S A;  4KD3 A;  1IKM A;  3HOY G;  1NR4 A;  3NBH B;  1N33 L;  1RHP A;  2JA6 H;  2I0Q A;  1U9R A;  4FXK C;  2G9D A;  4I65 A;  1I4P A;  1M1K C;  5KEE A;  3U4V A;  3KYH C;  1PTO D;  2EXZ A;  2OT2 A;  2Y0S B;  4LUO A;  3F2C A;  3AFP A;  1IXR A;  4PNY A;  2ZTD A;  3BDL A;  1IW7 D;  4F88 A;  2NVY B;  5J3B A;  1EYG A;  1CKN B;  2TSS A;  5C4H A;  2L5T A;  4M1U B;  2A73 B;  4ME5 A;  1K8O A;  5CR3 A;  1PH4 A;  1XNQ Q;  1HQR D;  2WAQ G;  3QOJ A;  5D3D A;  1HNW L;  3RNU A;  3ULP A;  2A6H D;  2KOL A;  3TZU A;  2R7D A;  1JQY D;  1Q46 A;  4A3J G;  2JQO A;  2F0J A;  2ZT9 C;  4H02 A;  1ASY A;  3S14 H;  1SYD A;  5C44 B;  3UDF A;  5C44 G;  4JI7 Q;  2IX1 A;  2UXB Q;  4DK0 A;  4F8M A;  1KL9 A;  4C3I B;  4JI5 L;  1ICF B;  2O5I C;  3DUZ A;  4CJ0 B;  3OOC A;  3GTG H;  2D0O A;  3G6E A;  3ZJY C;  2BE5 D;  2N8N A;  2KHS A;  2VUM B;  1PMR A;  3BJU A;  3K80 C;  5JJZ A;  4A3B H;  3LWE A;  3RUZ A;  4BS9 A;  5J1Z A;  3IRB A;  3G48 A;  1X54 A;  5I9O A;  4OEM B;  3E0E A;  2BDN A;  2E5L Q;  3M85 A;  3S9W A;  1YHQ A;  4AIM A;  1K3R A;  4A3K B;  2C9O A;  4HN7 A;  1E1O A;  4RWS C;  1YNJ C;  4A3J H;  4CJ2 C;  4X3T A;  1XX8 A;  4KHV A;  2E74 C;  1SMY C;  3WDN A;  2F0T A;  3R2I A;  2HDM A;  2EYP A;  4A75 A;  2EYJ A;  4Q5V A;  1PH1 A;  1IBK Q;  3R3O A;  3H0G H;  1Q8K A;  1EY4 A;  3SXH A;  3HOZ H;  1LTG D;  3PO2 B;  4EQP A;  4DR4 Q;  2EQS A;  1QNK A;  1YEZ A;  4BY1 G;  2DNE A;  3A8K E;  2FXQ A;  4A3F H;  4MTK A;  4P71 A;  3S1R B;  1Y1W B;  4A3G H;  3WWV A;  2B2U A;  2UUB Q;  3M4O B;  3STB D;  3TS2 A;  1EY0 A;  2K5D A;  2YV5 A;  1FD7 D;  3OW7 A;  1HA5 A;  2F0I A;  3A5Z B;  5EKK A;  1I6H B;  1F2Y A;  4HID A;  2BE5 C;  3QO2 A;  5D3I B;  1AZQ A;  1ZYR D;  4PMB A;  3VYT A;  3GQB A;  2RSO A;  5C44 H;  1YI2 A;  2VB3 X;  5G3L D;  2UXB L;  4QF4 A;  1EFW A;  4KLK A;  3RN5 A;  1F2Z A;  4K8J A;  1NMG A;  5E7N A;  4C2M H;  5LMU L;  2MQH A;  1BVS A;  4J1M A;  2YTY A;  1W3S A;  3TEH B;  1PFM A;  4JI6 Q;  2A6H C;  4A3I G;  1BCP F;  2JSO A;  3OTO Q;  3A8I E;  3KLS A;  4RMF A;  4R4T A;  3A8J E;  3D31 A;  1WTX A;  4LF7 Q;  4JI2 Q;  3PO2 G;  1GUT A;  3UE1 A;  4XQJ A;  2F0G A;  3BYY B;  5GAE C;  1MJC A;  3ND9 A;  4A3E G;  3HOV B;  1HFN A;  2VZA A;  1UNS A;  4AYB E;  4L5T A;  5C3X A;  2C5C A;  1EUJ A;  5IWA L;  1IL8 A;  2K7V A;  2B2V C;  1KNA A;  3L0O A;  2HUG A;  3VR4 A;  1G29 1;  3FPU B;  2I5H A;  3QG1 A;  1VQB A;  3OSO A;  3I7F A;  1IBL L;  4I7Z C;  2F0H A;  1PZK D;  3VYR A;  1CFM A;  3S16 B;  2F4I A;  1Q1B A;  3KUP A;  4L5Q A;  1D5Z C;  1HNW Q;  2HIX A;  4KKU A;  1GUN A;  3CXC A;  1IHZ A;  3P7J A;  4Z9C B;  2F03 A;  3L3O C;  1UWV A;  5GAD C;  3PIO A;  2HQL A;  1OO9 B;  4X3K A;  5ELO A;  1SYE A;  4DK3 C;  1K28 A;  1SNP A;  4IUT A;  2N49 A;  4BBR H;  1QWY A;  1EY9 A;  3MTS A;  1Y14 B;  1S5D D;  2CWP A;  3RZD B;  4B3T Q;  5ELD A;  1SRU A;  2AQ2 B;  3I90 A;  5JJI A;  1ENA A;  3FHW A;  2VQF L;  1BBU A;  1Q3L A;  1ZXT A;  3KJP A;  3PQI A;  1D1I A;  1B53 A;  3I4N B;  2PW5 A;  3H6M A;  3TQY A;  4JOI C;  5G3L F;  1W6J A;  4JI3 L;  3M4Q A;  5C3E B;  1AN8 A;  3EIV A;  4KHP L;  1PFB A;  2ENB A;  1O7L A;  4DPG A;  4A3E H;  1QOH A;  2VQF Q;  2JA8 H;  3RZO H;  2XRQ D;  1LTB D;  1SNM A;  2L0C A;  1I3Q B;  1SE8 A;  4OXP A; 
#chains in the Genus database with same CATH homology
 3S2D B;  1QE6 A;  3EA6 A;  3M4Y A;  3SK4 A;  5C4Z A;  3SE0 A;  2B8F A;  1Q90 A;  3JAM E;  3I4L A;  5M5W B;  4TKO B;  2NVX B;  2EY5 A;  5IGD A;  1A2T A;  4EQO A;  5EJW A;  2EDG A;  3PMF A;  3ONA B;  3GTG B;  1ESR A;  3T13 A;  4G4K A;  5CC4 A;  3JAM L;  4V0B A;  2WB1 B;  1STY A;  4KD4 A;  4QIW B;  1D5X C;  2PYK A;  2ZXR A;  2A74 C;  1T5X D;  1SDF A;  3BVG A;  5C5M A;  1CHP D;  2D2C C;  3X3M A;  4FF3 A;  1CT1 D;  2L9H A;  1S5E D;  1F9S A;  4C3J G;  2RDH A;  5CV8 A;  4G7H C;  4XIG S;  3KBG A;  4DNT B;  2ICI A;  4K5W A;  2PCF B;  2PPB C;  4KJN A;  2KJX A;  2FHT A;  4XQN A;  5K36 G;  3AU7 A;  2EE1 A;  2O4X A;  4CJ1 B;  4OIJ A;  1TQO A;  5FO8 B;  4DA2 A;  1JOR A;  3NXW A;  4KKT A;  2JYO A;  1VF7 A;  2L12 A;  1DOK A;  2Q8T A;  1WTP A;  2EJG C;  5C6A A;  2AUJ D;  1AW7 A;  2AUK A;  3LX0 A;  3HS0 C;  3W2D A;  1PTO H;  2F0N A;  2JEB I;  4K5X A;  1ILP A;  1QG7 A;  3PUW A;  1KDC A;  2JE6 I;  2PNR C;  3OMC A;  1TS5 A;  2J4X A;  4GZY C;  1K83 B;  1BCP B;  3NTH A;  4AYB B;  1GOZ A;  3D6W A;  2K32 A;  5JOB A;  2CW0 C;  2L11 A;  3OWF A;  3VR2 A;  1MBY A;  2NVQ B;  2RQX A;  5ELE A;  4FF1 A;  5IOD A;  5IGE A;  3PUX A;  4DAV A;  2H1E A;  2K6A A;  2CVR A;  1QNU A;  1I4G A;  1TS4 A;  5BN5 A;  2IWH A;  5CV4 A;  3CKI B;  5EQ0 A;  1ONL A;  3KLR A;  3DEO A;  5T1G A;  1CK1 A;  1X3P A;  2PZT A;  5I2X A;  1BCP D;  4OHJ A;  2IX3 A;  4L8J A;  4PV1 C;  5M3M B;  4N9T A;  3HP3 A;  4H44 C;  2NTS A;  5KYL A;  2K03 A;  2WAC A;  1V1O A;  5EBD A;  4IFD G;  1JWM D;  3J81 L;  3G6J B;  3MHB A;  3HZX A;  4IUV A;  5JVH 3;  1WTO A;  4X3U A;  3C1F A;  4N9P A;  5JPM C;  2A69 C;  2F0P A;  5JVG 3;  2I46 A;  4M8A A;  4OO1 H;  2RA4 A;  1GHJ A;  3Q24 A;  4HSV A;  4OO1 G;  4XTC S;  2D62 A;  1LO5 D;  1L0Y B;  2F0L A;  1HRJ A;  2D5D A;  1LV9 A;  1OXS C;  5T1I A;  2F3W A;  3VA7 A;  2QDB A;  3CRK C;  1LTI D;  3V96 A;  4DK1 A;  1BNZ A;  2JA7 B;  1S5B D;  2RDG A;  5IGF A;  2A69 D;  4ZRZ A;  4MN3 A;  3HEJ A;  1Y69 U;  5C5L A;  1Z47 A;  1LLR D;  1DJR D;  2D9U A;  1WTR A;  1TY2 A;  2OEO A;  1S4Z A;  3D8G A;  1RJT A;  3I3C A;  4KMU C;  3EJI A;  1EYA A;  3MA2 B;  1KNE A;  2B2T A;  5C4X B;  5C0X J;  5CV7 A;  1STN A;  5I4D A;  3X3N A;  3AMU A;  2A6E D;  1ESF A;  1EWH A;  3NE5 B;  1EYD A;  1F9P A;  4JBW A;  1MD2 D;  1SBB B;  2QCP X;  4RGM A;  1O80 A;  2SNS A;  4A3J B;  1EEI D;  3W3A A;  4KK7 A;  1G8Z D;  1PTO F;  4KN7 C;  1B4O A;  1C8C A;  4ODG A;  2AQ1 B;  4ZUJ A;  1KDB A;  4IUQ A;  2WKC A;  1VMP A;  4H7B A;  3HOU B;  2J0T D;  1B9M A;  2F0E A;  1TKW B;  2EYM A;  3GTJ B;  1G91 A;  1CA6 A;  1TWA B;  1EL0 A;  4G7Z C;  4DAY A;  3KLS X;  4S3S A;  2DY8 A;  4XYQ A;  3GD7 A;  4ID6 A;  3SK6 A;  3MWY W;  2Z8L A;  1NSN S;  4IUR A;  1V1P B;  3J7A V;  1GUO A;  5A2Q L;  2XIW A;  3J7Y W;  3P20 A;  3UI2 A;  1IYU A;  4B08 A;  3TZD A;  4BA2 I;  3D4W A;  5TSS A;  3D3R A;  4LAA A;  4MHE A;  1U4R A;  2LY7 A;  2SEB D;  1Q8I A;  1V8Q A;  3SHL A;  5COR A;  1TWF B;  2CQA A;  1TR5 A;  1NCV A;  3TME A;  5A2Q E;  1AZP A;  1T5E A;  2K33 A;  4RGT A;  1F77 A;  2F0S A;  4OIK A;  2A68 D;  1JE4 A;  1J8I A;  2EJF C;  2XWJ B;  1VCI A;  2X6L A;  1GJX A;  3R93 A;  3MXG A;  2XWB B;  1A2U A;  4IFD J;  3ZYY X;  1E0B A;  3I70 A;  4HSP A;  1XWE A;  5JEA J;  1HCZ A;  5ELB A;  4IN3 A;  5IT9 E;  1SAP A;  3RMH A;  2WP8 J;  5HUR A;  3PUY A;  2KUM A;  2BA0 A;  3FPP A;  4RCO A;  1WTW A;  1SYC A;  2NB0 A;  3NPP A;  2BCO A;  1OXV A;  2KED A;  3DMU A;  5FOB B;  1PRT C;  5JAV A;  3J80 E;  3HOW B;  2RBM A;  4HMI A;  2RVL A;  4KTA A;  3HOY B;  4LMQ D;  4E6I A;  3O13 A;  1I6V C;  5LL6 S;  5J22 A;  5I6W A;  4TRD A;  1U4M A;  4CGY B;  1SYF A;  1A3U A;  3GTM B;  1R9T B;  3EFX D;  1BXT A;  3L7Z C;  2E75 C;  1JWU D;  1X3Q A;  5IGB A;  1BBX C;  1HA6 A;  1HXY D;  4ZYS A;  3PIP 3;  1DM0 B;  4CHT B;  2EY1 A;  5CYU A;  5KNC A;  3VYU A;  3SEB A;  3GTK B;  4UAI A;  5KGU A;  1SFO B;  3N52 A;  4HED A;  4XQQ A;  1B1Z A;  3DWQ A;  3QWN A;  1EYC A;  2B2Y C;  3NSW A;  4IFD I;  2EYF A;  4K8I A;  4KN4 C;  2JA8 B;  2GA4 B;  2YYZ A;  1LAC A;  2MPM A;  3TP7 A;  1SND A;  2I07 B;  3C46 A;  1NUC A;  2Q8R E;  4BBS B;  1STA A;  3TP6 A;  4KJO A;  4WJW A;  2E76 C;  2LS0 1;  2HDL A;  1A15 A;  1PFN A;  2WV6 D;  2XN9 C;  1QIL A;  1I50 B;  4HMJ A;  1FNV A;  1EWC A;  4OGQ C;  1HHV A;  3K58 A;  2X69 A;  3H91 A;  1SE3 A;  2EZV A;  1EY6 A;  3DHQ A;  4V19 0;  2BDO A;  5K5P A;  2KQ3 A;  3EVQ A;  1CHQ D;  1ROD A;  3OIQ A;  4IUN A;  2EYH A;  1LTA D;  3OIP A;  4L63 B;  2B2V A;  2K05 A;  1STG A;  1PLF A;  1DXM A;  2F1M A;  4C1N K;  2NN6 G;  3RZO B;  3KBX A;  5EPK A;  2MP1 A;  1MI2 A;  2H4O A;  1PDQ A;  1L0X B;  3GV6 A;  4IZ8 A;  1WD0 A;  1D6E C;  3Q23 A;  1J9O A;  3ND8 A;  1XTC D;  1STH A;  4RFB A;  3J81 E;  1LTS D;  1EFI D;  3BVZ A;  4C2M B;  3WOE A;  3MZ5 A;  1RDP D;  4ULL A;  2EOT A;  2G9H D;  3NQI A;  2X6G A;  1JOQ A;  4IFD H;  2F0F A;  2FFK B;  1E2Z A;  3PIO 3;  4XT3 B;  3PV0 A;  3K5M A;  4TQU S;  3NWS A;  3MFG A;  5CBA E;  3U9O A;  4RAU C;  2FMM A;  3I91 A;  2MHV A;  5BN3 A;  5C3W A;  1TS2 A;  1WVL A;  2A6E C;  1JOO A;  2ICE C;  2YU9 B;  2WII B;  5IGC A;  5I2Y A;  3BDC A;  5EKL A;  2B2T C;  3G7L A;  3A54 A;  1JC7 A;  2CW0 D;  1EEF D;  1GUG A;  2KA7 A;  4KY5 A;  2NVT B;  1EZ6 A;  3IFT A;  4KHZ A;  2QIL A;  4CKE A;  4ZQ3 A;  3TN2 A;  3I4M B;  3BVM A;  3GTO B;  1Y1V B;  2VXW A;  3AB9 A;  4CKC A;  1V43 A;  4NP5 A;  3SK5 A;  2F0O A;  4RHR A;  3QJY A;  3V05 A;  4XYO A;  2F0V A;  5FKA C;  1TVX A;  2WAQ B;  4FVM A;  3H3V C;  5FK9 C;  2HQE A;  2NZ1 D;  3MXU A;  1DD2 A;  5FLX E;  2F3V A;  2F0U A;  1ENC A;  3ITP A;  3T51 B;  3K0Y A;  1B44 D;  4QCL A;  5C0X G;  2Z4H A;  2NN6 H;  3CHB D;  2JEA I;  4WFN 3;  1RF2 D;  2PMZ B;  1E2V A;  4KKS A;  1VMC A;  1F2L A;  1LT3 D;  2R61 A;  2EYO A;  1KLG D;  2KEC A;  3J80 L;  1VF5 C;  1CZG A;  2VNU D;  3BYT B;  1SE2 A;  2R7Z B;  3KK7 A;  2RDF A;  4F87 A;  4PQX A;  3SK8 A;  3S15 B;  1QB5 D;  1TII D;  5M5X B;  4K5V A;  5D65 A;  4L6T B;  3A55 A;  2R3Z A;  1O7Z A;  2B8G A;  4C3J B;  1LT6 D;  1JB3 A;  5M9O A;  4C3H B;  2NWG A;  1JOK A;  3HOX B;  4RGN A;  2E2I B;  1DZ1 A;  4IAL A;  3C2P A;  2R6G A;  4K6L A;  4QB4 A;  5CBE E;  5A35 A;  4DF7 A;  3NTK A;  1PZJ D;  2N55 A;  1FR3 A;  2PZW A;  3S1M B;  5KIX A;  4RCN A;  3R2T A;  4FXD A;  1CZW A;  3BDO A;  1H9R A;  4K14 A;  4BA1 I;  1CTM A;  4HTH A;  4C1N I;  4EGV A;  3QOL A;  4J6H A;  1PTO B;  4FYD A;  1H9K A;  2IW3 A;  1SNC A;  5EKI A;  3MXN A;  1B9N A;  1K8M A;  1UEA B;  1TS3 A;  2RSN A;  5LHY 1;  3ERO A;  3LWU A;  3Q0A A;  4C56 C;  2PO4 A;  1PYW D;  4C3H G;  3QB3 A;  1JIC A;  4KV6 A;  1S5C D;  1C48 A;  5C4J B;  2O5J C;  1VDZ A;  1EY8 A;  1KTK A;  2K28 A;  3NBI A;  5CV6 A;  3FVQ A;  1KLU D;  3E5S A;  3OWE B;  5EPL A;  4FP5 D;  1R4Q B;  1XXG A;  2ZXP A;  3TBI B;  2IPK D;  4FNF A;  2PW7 A;  1SJH D;  1HTL D;  4KY7 A;  1Z7T A;  3HKZ B;  5DEH A;  3PUZ A;  5C0X H;  1LTT D;  1ENF A;  1SNO A;  3MVV A;  4OO1 I;  1DOL A;  2Z4I A;  4QMG A;  3T53 B;  3S1N B;  1F9R A;  2L1B A;  4K2K A;  1ET9 A;  5IOC A;  4H0L C;  1G6Z A;  5EPJ A;  2A68 C;  5KRU A;  1YNN C;  5LL6 X;  1M8A A;  2IJ0 A;  4IQZ A;  2PQE A;  3H0G B;  2AWO A;  2Z1C A;  4B9W A;  1CA5 A;  1YNN D;  4TSS A;  4RKB A;  3NWT A;  2IL8 A;  2HCI A;  3CU7 A;  1BOS A;  2NUC A;  2K1B A;  4U68 A;  4Q0F A;  1ICW A;  2JA5 B;  1F2M A;  1SXT A;  1C4Q A;  1Y8P B;  1O78 A;  2JP1 A;  5I9P A;  1D5M C;  1WTQ A;  1YNJ D;  3I8Z A;  3K5L A;  3MC0 B;  2QF7 A;  1RKN A;  3D4D A;  2IT1 A;  1CM9 A;  2B63 B;  2ID0 A;  4DU9 A;  2SDF A;  3BZD B;  3FRP B;  4P2C B;  4ZKC B;  1BF4 A;  1BUV T;  1KAB A;  3K59 A;  3S1Q B;  3VA5 A;  5EGT A;  3FDT A;  2CHB D;  1I4Q A;  3NBH A;  1CQF A;  4DXF A;  3NK9 A;  5CMD A;  4DN4 M;  5CV9 A;  2Q8I B;  4HCE A;  3MEH A;  5COY A;  1AFP A;  4OL7 A;  4NDX A;  2F0M A;  1A3T A;  1IYV A;  1HTP A;  3D4R A;  4HAE A;  5FO7 B;  1W6K A;  1BDO A;  1DCZ A;  3S14 B;  1HFG A;  3HG9 A;  5DM6 3;  3TDQ A;  1H9J A;  1I4R A;  1XYI A;  1PRT F;  3DM1 A;  1UUP A;  3RD4 A;  2OXP A;  2QKI C;  3WOF A;  1ET6 A;  4DXG A;  2JA6 B;  4DNR B;  1I4H A;  5BN4 A;  3S2H B;  1OXX K;  1EQV A;  2K5Q A;  1QJO A;  4X3S A;  2F0W A;  3VR6 A;  2RKS A;  1R4P B;  1OXT A;  2SNM A;  1ZYR C;  2WIN B;  1KAA A;  1HQM C;  2M2L A;  3OHX C;  5DAU A;  1ZEQ X;  3L9A X;  3FEW X;  3URY A;  3HGB A;  2O2L D;  4A93 B;  2PZU A;  4A3G B;  1HUM A;  2KCC A;  3EQL C;  1SSO A;  5FLX L;  5EBC A;  4K2L A;  3T56 B;  5ISR A;  1RTN A;  1GUW A;  1JR0 D;  3K6O A;  1LAB A;  4PMC A;  3NHH A;  1SMY D;  1O7Y A;  1EOT A;  3LNN A;  4B9X A;  4PMW A;  2XNA C;  5M3F B;  2NTT A;  2NN6 I;  2R92 B;  1UAP A;  2N88 A;  2OF1 A;  4UDU C;  1WD1 A;  3HRZ C;  4A3D B;  4RHS A;  2EYL A;  3NQT A;  2DN8 A;  1D2B A;  1FNW A;  4RGO S;  2K5W A;  1CQV A;  4DGZ A;  5K36 H;  1EZ8 A;  3NTI A;  3T16 A;  3U9S A;  1TT2 A;  2EY6 A;  1STB A;  2NYZ D;  3H09 A;  3T4A C;  5JEA H;  1JCK B;  4A3I B;  4RH6 A;  4NMZ A;  4FXG C;  4LK1 C;  1SE4 A;  2E2H B;  4EQN A;  1LT5 D;  3GTL B;  3TP5 A;  2F0D A;  3Q22 A;  4Y7N B;  2LKV A;  1PTO C;  3OPO A;  3RLF A;  3VYS A;  4DFA A;  1A3V A;  1ZKO A;  3E6Z X;  5J39 A;  1EIH A;  4RKL A;  4JK1 C;  3VR3 A;  1RTO A;  3DWA A;  4QUC A;  1SYB A;  2XRS D;  2R93 B;  3TP8 A;  3R8B A;  2F0K A;  4ZKB B;  2V4D A;  2AQ3 B;  3Q6S A;  1PRT D;  2M9V A;  3P1H A;  4A3E B;  1F9Q A;  2EVB A;  3SDZ A;  1LT4 D;  3MXP A;  1U4P A;  3DWP A;  1B3A A;  1SYG A;  3K7A B;  3NUC A;  4FF2 A;  2ZXO A;  1A6X A;  3S17 B;  2B2U C;  3K57 A;  4U67 3;  3NP8 A;  4KI0 A;  3KF8 A;  2SOB A;  1E2W A;  2NBF A;  3FKI B;  1GXD C;  3GTP B;  4FO2 A;  3TSS A;  1TWC B;  4XT1 B;  5E4W C;  4R8N A;  1PZI D;  1TY0 A;  5IIF A;  4G57 A;  1S5F D;  1RD9 D;  3H94 A;  4ZLT F;  1SEB D;  1NR2 A;  5AFW A;  5DM7 3;  2MUY A;  4EVO A;  4ZAI A;  4H13 C;  5I6Y A;  2LMC B;  5ELC A;  2QEJ C;  1U4L A;  4IUU A;  1CI3 M;  1EY7 A;  2FMC A;  1Q1E A;  3ERQ A;  3N6R A;  2EY2 A;  5C0X I;  2MGS A;  1TU2 B;  1ILQ A;  2DY7 A;  3IFD A;  3GTQ B;  4XDX A;  1EY5 A;  1M4V A;  2KVM A;  1PXU A;  3DEP A;  5KND A;  2K01 A;  1QCB D;  3MAQ A;  2F0Q A;  2KEE A;  1HPC A;  4R9W A;  3MFY A;  2B2W A;  4G7O C;  4KY6 A;  1FNU A;  2MJ8 A;  3I73 A;  1HUN A;  3CQZ B;  1WTV A;  2BOS A;  2FJ2 A;  5CV5 A;  3A7A B;  3BS1 A;  1BCP C;  3GP7 A;  2FIN B;  1NAP A;  2JXM B;  1DON A;  4O1N A;  2AWN A;  4RA8 A;  3J7A F;  3CRL C;  5HGT A;  5E3F A;  3HOZ B;  3SR1 A;  5F2D A;  4YIJ A;  4ZK9 B;  2BA1 A;  4ZUI A;  1RCV D;  1PRT B;  1Z6H A;  4A3F B;  4IUP A;  1H9M A;  3P75 A;  2B2W C;  1FYC A;  1TWH B;  5NUC A;  2A5H A;  3K5O A;  1G2T A;  2TMP A;  5M5Y B;  3A7L A;  5JEA G;  1I4X A;  1BR9 A;  4F7X A;  4MIU A;  1FGB D;  3F2U A;  1EU4 A;  3IKJ A;  1Y8O B;  3DXJ C;  1TWG B;  3GV3 A;  1SNQ A;  3V2T A;  1GHK A;  1BQQ T;  3K5N A;  4WRD A;  4A3B B;  4XXE A;  5IGG A;  4QUF A;  3QIA A;  1Q12 A;  5CGK A;  1KDA A;  4WOR A;  3M7N A;  4LJZ C;  5D14 A;  1MGS A;  1II3 A;  1JWS D;  1MSH A;  4CBV A;  1B50 A;  4BY7 B;  4HCS A;  1STE A;  1DYQ A;  2XVS A;  1EU3 A;  5E1F A;  2VB2 X;  2XSC A;  2K04 A;  4HR7 B;  2LFN A;  3M3Y B;  1EIG A;  1WCM B;  1X32 A;  4K6D A;  1AP0 A;  1OXU A;  2KCN A;  1AEX A;  3VR5 A;  3GO5 A;  2E2J B;  2WKD A;  5IT9 L;  2IX0 A;  3FMC A;  1Y8N B;  5ELF A;  3D6C A;  3OMG A;  4BWG B;  1IKL A;  1V1P A;  2EJM A;  2HCC A;  4BY1 B;  1G2S A;  3PUV A;  1LTR D;  1GUS A;  1IW7 C;  3C1E A;  4C3I G;  4ABN A;  1DOM A;  2M00 A;  4DAP A;  1EQT A;  4NKL A;  3BG3 A;  2B2Y A;  2B39 A;  4O42 A;  4J8Q A;  1H9S B;  5FO9 B;  4A3M B;  3PO3 B;  1B2T A;  1D1K A;  2E2D C;  2EPB A;  3E0J A;  1ML0 D;  3I72 A;  5JPN C;  3IL8 A;  2L4N A;  3IAY A;  3M7G A;  5KYI A;  4FF4 A;  3A56 A;  2DNC A;  5DNF A;  1SJE D;  2J7Z A;  1BO0 A;  1MSG A;  4BBR B;  4NW2 A;  4CKB A;  2L55 A;  5E4X A;  5KNB A;  3SVM A;  4R8I A;  4ILW A;  1H9S A;  4KD3 A;  1IKM A;  1NR4 A;  1RHP A;  1U9R A;  4FXK C;  2G9D A;  4I65 A;  1I4P A;  5KEE A;  1PTO D;  2EXZ A;  2OT2 A;  2Y0S B;  4PNY A;  3BDL A;  1IW7 D;  4F88 A;  2NVY B;  2TSS A;  5C4H A;  2L5T A;  4M1U B;  2A73 B;  4ME5 A;  1K8O A;  5CR3 A;  1HQR D;  3QOJ A;  5D3D A;  2A6H D;  2KOL A;  3TZU A;  1JQY D;  2F0J A;  2ZT9 C;  1SYD A;  5C44 B;  2IX1 A;  4DK0 A;  4F8M A;  4C3I B;  2O5I C;  3DUZ A;  4CJ0 B;  3OOC A;  2BE5 D;  2KHS A;  2VUM B;  1PMR A;  5JJZ A;  3LWE A;  3RUZ A;  4BS9 A;  5J1Z A;  5I9O A;  2BDN A;  3M85 A;  3S9W A;  4A3K B;  2C9O A;  4HN7 A;  4RWS C;  1YNJ C;  4CJ2 C;  4X3T A;  1XX8 A;  4KHV A;  2E74 C;  1SMY C;  3WDN A;  2F0T A;  3R2I A;  2HDM A;  2EYP A;  2EYJ A;  4Q5V A;  3R3O A;  1EY4 A;  3SXH A;  1LTG D;  3PO2 B;  4EQP A;  1QNK A;  2DNE A;  3A8K E;  3S1R B;  1Y1W B;  2B2U A;  3M4O B;  1EY0 A;  2K5D A;  1FD7 D;  3OW7 A;  1HA5 A;  2F0I A;  5EKK A;  1I6H B;  1F2Y A;  2BE5 C;  3QO2 A;  5D3I B;  1AZQ A;  1ZYR D;  4PMB A;  3VYT A;  3GQB A;  2RSO A;  2VB3 X;  5G3L D;  4QF4 A;  1F2Z A;  4K8J A;  4J1M A;  1PFM A;  2A6H C;  1BCP F;  2JSO A;  3A8I E;  3KLS A;  3A8J E;  3D31 A;  1WTX A;  1GUT A;  4XQJ A;  2F0G A;  3BYY B;  3ND9 A;  3HOV B;  1HFN A;  1UNS A;  5C3X A;  2C5C A;  1IL8 A;  2K7V A;  2B2V C;  1KNA A;  2HUG A;  3VR4 A;  1G29 1;  3FPU B;  3QG1 A;  3OSO A;  4I7Z C;  2F0H A;  1PZK D;  3VYR A;  1CFM A;  3S16 B;  2F4I A;  1Q1B A;  3KUP A;  1D5Z C;  4KKU A;  1GUN A;  1IHZ A;  3P7J A;  4Z9C B;  2F03 A;  3L3O C;  1OO9 B;  4X3K A;  1SYE A;  1SNP A;  4IUT A;  1QWY A;  1EY9 A;  3MTS A;  1S5D D;  3RZD B;  5ELD A;  2AQ2 B;  3I90 A;  1ENA A;  1Q3L A;  1ZXT A;  1D1I A;  1B53 A;  3I4N B;  2PW5 A;  3H6M A;  5G3L F;  1W6J A;  5C3E B;  1AN8 A;  1PFB A;  2ENB A;  1O7L A;  1QOH A;  2XRQ D;  1LTB D;  1SNM A;  2L0C A;  1I3Q B;  3C3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...