1TR5A

Room temperature structure of staphylococcal nuclease variant truncated delta+phs i92e
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray and thermodynamic studies of staphylococcal nuclease variants I92E and I92K: insights into polarity of the protein interior
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 37
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2004-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1tr5A00
2F0TA 3NQTA 3TMEA 1STBA 5DEHA 1NSNS 5CV8A 2EYFA 4WRDA 4KY7A 4RKBA 1KDCA 3NXWA 5KGUA 1KAAA 1A3UA 2PQEA 2QDBA 1F2MA 1SNDA 3D4WA 3TP5A 3QOLA 4EQNA 5IODA 4KV6A 3MHBA 5K5PA 1JOQA 2ENBA 2PYKA 2EY2A 2F0SA 4OL7A 4KD4A 1STGA 3PMFA 4ID6A 4K5VA 3VA5A 4R8NA 3TP6A 5I9PA 5JAVA 2EYPA 3P75A 5CV7A 3EROA 3TP8A 5J39A 1SNOA 2PZWA 1SNPA 1SYDA 2SNMA 3C1EA 5IOCA 4IALA 2F0DA 5JOBA 5IGBA 1KABA 2EY6A 1A3TA 2F3WA 2O4XA 1ENAA 4F8MA 1TR5A 2EY1A 3NK9A 3SK4A 1SYCA 4HMIA 1EY5A 2RDFA 3MEHA 4QF4A 3BDCA 4PNYA 4RKLA 1F2YA 1STYA 1EYDA 4ZUJA 5IGDA 1EY0A 3MVVA 1U9RA 1SYGA 3QOJA 3SK8A 4N9TA 4EQOA 5ISRA 5HURA 5KIXA 4IUNA 1NUCA 4KTAA 3OWFA 5DAUA 1EY7A 5CV9A 5IIFA 4WORA 5I9OA 4KY6A 2F0OA 5CGKA 2F0EA 4K2LA 3DHQA 1EYCA 2PZTA 4KY5A 4MIUA 3T16A 1TT2A 3MZ5A 4J1MA 2PW7A 1RKNA 1KDAA 1EY4A 1KDBA 2F0MA 2F3VA 2F0VA 1EYAA 3OSOA 3QB3A 4H7BA 5KEEA 4F7XA 5CC4A 1EY6A 5NUCA 2F0FA 4J6HA 2EYHA 2SOBA 2F0HA 1SYBA 5EKKA 4I65A 5HGTA 4K2KA 3TP7A 5CV4A 5CV5A 2EY5A 5KYLA 3H6MA 3C1FA 3RUZA 1TQOA 2EYOA 4KHVA 5C4ZA 1JOOA 3SK6A 4K5WA 1A2TA 2WACA 4ODGA 3HEJA 1EZ6A 4DFAA 2OEOA 1A3VA 2EXZA 1ENCA 1II3A 3D8GA 4NP5A 1F2ZA 2KHSA 1EY9A 1SNMA 2EYJA 3BDLA 4NKLA 3NP8A 3D6CA 4PMCA 5CR3A 4YIJA 4ZQ3A 5M9OA 2EYMA 3D4DA 3P1HA 5F2DA 3SHLA 4K14A 4ME5A 5IGGA 5C3XA 4NMZA 1EZ8A 1SYEA 3ERQA 4B9XA 1SNCA 1SYFA 5I6YA 5I6WA 5KYIA 4TRDA 5EGTA 2F0LA 2LKVA 3V2TA 3ITPA 1EY8A 1STAA 3DMUA 1EQVA 2OXPA 3SR1A 2F0NA 5CV6A 4ZUIA 4EVOA 1SNQA 3S9WA 1STHA 2NUCA 4KJNA 4QB4A 4K6DA 2F0JA 2F0KA 2EYLA 2M00A 3E5SA 4PMBA 3EVQA 3U9OA 4DF7A 4DGZA 4HMJA 3LX0A 5J22A 4S3SA 4B9WA 3NUCA 2F0IA 2F0QA 2F0UA 4G57A 5C5LA 2HQEA 3MXPA 5IGFA 2F0WA 3OMGA 4E6IA 5KRUA 2F0PA 3SK5A 3OMCA 1AEXA 4K8JA 1A2UA 4QMGA 2F0GA 4EQPA 2SNSA 5C5MA 5C3WA 1JORA 2RKSA 4NDXA 5IGCA 2PW5A 3SXHA 4LAAA 1IHZA 3EJIA 4K8IA 4KD3A 3HZXA 3T13A 4HTHA 5C6AA 2OF1A 4K5XA 4KJOA 5E1FA 5J1ZA 2KQ3A 1STNA 2PZUA 5C4HA 3NHHA 4N9PA 4DU9A 1JOKA 5EKLA 5E3FA 5IGEA 4IZ8A 2RBMA 3R3OA
chains in the Genus database with same CATH superfamily
2D5DA 1N34Q 3GQBA 1STEA 3F1ZA 1H9SA 2NTTA 4RMFA 4CGYB 1H95A 3I70A 2PPBC 1S5FD 3PIPA 4KV6A 2LY7A 5G3LF 2F0SA 2DGYA 3CKIB 1LABA 3C46A 5JOBA 1YI2A 1MJCA 4ABNA 4UPAA 4X65Q 2Q2HA 1VQDA 4DR1Q 4L5TA 2Z9HA 1EY0A 2E74C 1F9RA 1EWHA 3QOJA 4EQOA 3CMAA 1HNWL 4A4IA 1CK1A 4NB3A 3CPWA 4B3TQ 1OXVA 1JT8A 1B3QA 4FP5D 3K59A 1VQNA 1AE2A 2PI2A 3M7GA 3NEMA 4A3FG 2KECA 3J81E 1B2TA 2E2JH 3LWUA 3HGBA 1JCKB 2O2LD 1RKNA 2NN6I 4GOPB 5AJ3L 3E9HA 1L0XB 2F0HA 4MNOA 4V0BA 4C1NK 4JI1Q 1EOVA 3MXNA 1WTVA 1CI3M 3P20A 3M3YH 1TWFH 1UWVA 3MEFA 4DFAA 4ODGA 1PH4A 5HY6A 2R92H 1EU3A 3KLSX 3DEPA 3NP8A 5CMDA 1EWIA 1UE5A 3SHLA 1VQBA 4ME5A 4OEMB 5C0XG 1DGSA 1SAPA 1XPUA 3K7UC 1CFMA 1SNCA 1XPOA 5KYIA 5EGTA 2R61A 2LKVA 3OPOA 1R9TH 2Y0SE 1QWYA 4HIOA 2E2HB 3MTSA 3PUXA 5M5WB 4XIGS 5J22A 1Q81C 2G9DA 4MZ9A 4JI2L 1F9PA 2F0UA 1E7ZA 4G57A 4KN7C 1NR4A 1A63A 4C3IB 2IX0A 1FNWA 4K8JA 2F0GA 2UUCL 4LF4L 3VR5A 2JA7B 4P71A 1Z47A 2WB1B 3T53B 5IGEA 1G291 4ALPA 3NTIA 1XXGA 2EYFA 3VR2A 4CKEA 3S1RB 2CW0C 3QJYA 1A3UA 1E22A 3TP5A 5BN3A 3JAMc 5C0XJ 3J7AV 4WJ3M 4AYBG 1LT4D 1G91A 5DM73 5M5XB 4XQQA 1SMYD 1P8LA 3U50C 4FYDA 2PZWA 4O2DA 3M7NA 2AUKA 3HOVG 4LF6L 2Z6BA 1KABA 3NK9A 2RHSB 2JK8A 3SK4A 1BOSA 5GAEC 1NMGA 1SLJA 1NE3A 5IGDA 3PO2G 1X55A 3OWFA 5CV9A 1C4QA 1Q12A 2F0OA 3H09A 4C3JH 5CGKA 5C44G 4C3IH 2PW7A 1RDPD 1YJ9A 1G6ZA 3RLNA 1NCVA 1CSQA 3I91A 3X3NA 5FLMG 2DNEA 3QIAA 1KRTA 2RQXA 3A54A 5H1SE 4JI0L 4O1NA 3TP7A 1LM0A 3R8BA 1YBYA 4DAYA 4DR7L 3H91A 4NXNL 5FO7B 4U673 2LXJA 4IPHA 2QCPX 1YNXA 1I6VC 1FNVA 1FNUA 5FOBB 2DJGC 3WOFA 3KOJA 5ELNA 1EZ8A 1R9TB 5K36H 1UEBA 1CA5A 3NQIA 4JI8Q 2YTYA 2RCNA 3SGIA 1JWMD 3C2PA 1CUKA 3IFTA 1YHQA 2WKCA 1PTOF 1LTTD 1I3QH 2ALYB 4GN3B 4PZ8A 4DV2Q 1SEBD 4QUFA 2N49A 4NW2A 2PMZB 3TBIB 1LTSD 2PMZE 2F3IA 2HQEA 4RGNA 5EBCA 1EIHA 5JPMC 3MFGA 4JCVE 2B39A 2RCFA 3OIPA 1RTNA 1SE3A 1WCMH 3CU7A 3MFYA 4A3MB 4DR2L 1BQQT 3D4RA 4CDCC 5IP7G 3RNUA 4KD3A 5CYUA 4LF9Q 2VUMG 1K8GA 4C3JB 1T9HA 3CRLC 1N33L 1F9QA 4CJ1B 1VQOA 2PQEA 1YZ6A 2ZTCA 1VQ6A 5CBAE 4HJ7A 5IT9c 4CJ0B 2ENBA 2NVYH 3K58A 3W5OA 4DV5L 3PSIA 2K32A 3N52A 5KNBA 4K5VA 3A56A 3R93A 1TS5A 5G3LD 3G6EA 2KOLA 4X66L 3FVQA 3AEVA 2GN5A 5T1GA 2QA4A 3TS0A 3K5OA 3PF5A 1HR0Q 4POGA 1LLRD 4PNYA 1YNJC 2N55A 1PHJA 1U9RA 2RDHA 3T1HL 1C0AA 1MGSA 1YHAA 4IUNA 3VYRA 4IFDI 5IIFA 4WORA 1Q86C 2F0EA 4K2LA 2B63B 1B9NA 3IL8A 3MXGA 4BBSH 1KDBA 3QB3A 3RD4A 2BH8A 3GTPH 3H3VC 2F0FA 4FF2A 4IFDG 1SE4A 4DR6L 3Q22A 2WINB 1E1TA 3S2HB 1V43A 2PQAA 2R93B 3DM3A 1WD1A 2D9UA 1I5FA 5CV4A 1VCIA 2A6HC 5FJ8G 4IPCA 2E2DC 2UU9L 2L12A 3ULPA 3HEJA 1BF4A 1JB7A 3I8ZA 4GKJL 5M3FH 1II3A 1DD2A 4JOIA 1D8LA 3I73A 1SFOB 2VW9A 3F2CA 3D4DA 4JI6L 1B4OA 2AWOA 5K36G 3PUVA 1EQVA 2NZHA 3MC0B 3PUWA 2WP8J 3K5MA 4QJFA 2F0KA 4PMBA 1LTBD 4DGZA 1VQMA 2ICIA 2FINB 5J3BA 5COYA 1XMOQ 1PH3A 4JPBW 1FJGQ 3H0GB 2EVBA 4PZ7A 2K4KA 4K8IA 4HJ9A 2SEBD 2L9HA 2AUJD 1KNEA 2GVBA 3EN2A 4K5XA 4YHHQ 3M3YB 2L15A 4C3IG 3SDZA 2OTJA 4X3TA 3S2HH 4OO1I 4TVAB 3NQTA 4F88A 2OWOA 1TWAH 1UAPA 4WRDA 4N8X1 3URYA 4BBSB 5IODA 1F2MA 3AFPA 1S72A 2K5DA 4DK0A 3STBD 1A8VA 2Z4HA 2HIVA 1S4ZA 3HG9A 3P75A 5CV7A 1IBKL 3CCJA 4JI8L 1TWGH 1RTOA 4YWLA 1PFSA 3D31A 2M9VA 1E24A 2IL8A 1SYCA 5C4JB 3CC4A 4UP9A 3UE0A 5IY0A 3CCLA 4B3MQ 3J7A5 4ZUJA 3G7LA 1HCZA 1A62A 2AWNA 2K5HA 2LS01 1GKHA 1MIUA 5ISRA 2C9OA 5LMUQ 1MJEA 1HZ9A 2AQ3B 3J80L 2KCCA 3TEHB 3B6YA 3FMCA 4H7BA 4G7HC 1QUQB 3CP0A 1XNRL 4IOCA 3K0YA 3Q6SA 2MP1A 3BDOA 4PMWA 1BBUA 1MSHA 1CQFA 4I65A 1MHWC 1JMCA 2K03A 2VQEL 3GO5A 4DV1Q 1E2VA 3SK6A 1PTOH 4GS3A 2NN6G 3NWSA 1PTOB 2KVMA 1AH9A 1RD9D 2Z6KA 1EYGA 2KENA 2QILA 1JR0D 5IYDG 2BA1A 1PH6A 3QG1A 1HUMA 4X65L 3CXCA 3ERQA 2CH4A 2HQLA 1K9MC 2MO1A 5DLQE 1Q82C 1STAA 2E5LL 1XMOL 1W2BA 1HFGA 1PVOA 4GNXC 1YVCA 1J5EL 2HDLA 3BYYB 1X3GA 2LFNA 1I4QA 4M8AA 1N33Q 4QB4A 2M00A 2G9HD 4DF7A 4OO1H 2AQ2B 3J80E 5KRUA 2B63H 5EPKA 3SK5A 1AEXA 1AN8A 2HHHL 1JICA 5ELOA 1VQPA 2JA7H 5IGCA 1HQMC 1FD7D 5LMUL 3GTPB 2B2YA 4Y52H 4DUZL 4GN5A 3ZJYC 1I6HH 4XQNA 2PZUA 3NE5B 3T56B 1OXTA 3R3OA 3CMEA 1SE8A 4NXML 2A6ED 4RG1A 1XNQQ 2QDBA 2MPMA 4RGMA 1Y1VB 3K7AB 4A3BG 3I72A 3PUZA 2QKIC 1JE5A 2Q2IA 1N8RC 1EQRA 3PMFA 4LF7Q 3RZOH 1I4PA 3ULJA 1PFMA 3PGZA 1A3TA 2NVQB 3ND8A 4G7OC 2R92B 1LYLA 2A69C 1BUVT 4JV5Q 2K01A 5HURA 1PA6A 2B2UA 1NUCA 3GTMH 3AQQA 3TZUA 1HUNA 5I9OA 1PRTB 2XRSD 4GN4B 2FJ2A 4KY5A 4A3MH 2IX1A 3NBIA 3ULLA 1PYWD 4HR7B 3CCVA 5D14A 2E2HH 3I4NB 2XVSA 1K3BC 4HSPA 2EYHA 1ET9A 1WTPA 3HS0C 3PQIA 4DV5Q 2UUBQ 4A3CH 4DN4M 2IPKD 3S1NH 2B3GA 4KHVA 3DLLA 4BY7G 1G8ZD 3CD6A 1KC8C 2EXZA 2VS1A 5M3FG 1H9JA 3FDTA 4A3BH 4NKLA 2UXBQ 2R93H 1IXRA 1HNZL 2R7DA 5ELCA 1ZEQX 4NMZA 1Z9FA 3ONAB 1L0WA 3VYTA 1OTCA 1F2LA 3HRZC 2DUDA 2Y0SB 2D0PA 1VQEA 5M3FB 4LF8Q 5A2QE 2IHFA 5C0XI 2F03A 4BBRH 2EJMA 3OYYA 4HCEA 3GTMB 4OHJA 2KBNA 4FDBA 1P16A 2PW5A 4CDFC 3CCQA 4A3JG 1Q1BA 2IT1A 1JJCB 1XX8A 4A3GH 3P7JA 2ICEC 1STNA 1PTOC 3BVGA 4N9PA 2OT2A 2QGQA 1KIXA 2KJXA 3S2DH 4DR6Q 5F2DA 1EIFA 5EPJA 3S1RH 1C8CA 2JQOA 2YTVA 4XXEA 1KDCA 1YNNC 4B3RL 1SNDA 2G5DA 3S15H 1Q1EA 5K5PA 3J7YW 1H9MA 1HQRD 2Q8RE 3T51B 3MAQA 1HRJA 2SNMA 2NVXB 4O0AA 5IGBA 4UY8C 2Z0SA 4KI0A 4DAVA 1LT6D 1K8MA 4HIKA 2OQ0A 3PIOA 5GQOA 1C7YA 5C0XH 1EYDA 2B2WA 2MGSA 2XSCA 5EBDA 1B7YB 2Q8TA 5KIXA 2ATWA 1Y1WG 5DM63 3AB9A 4R9WA 2A73B 4X64L 2QDLA 4K0KL 1BDOA 1O7YA 4CDEC 1WTOA 2B2UC 1X54A 3NWTA 2VUMH 4BBRB 4DV4Q 1KHIA 4OIJA 4Y7NB 3NENA 1VF7A 1KL9A 4WFN3 5EKKA 2B2TA 4I7ZC 1Y8OB 3UDFA 1D5ZC 1HA6A 3GTOH 2KHJA 1B44D 4JC0A 3RUZA 1JOOA 2HCIA 3PV0A 1DONA 1TXYA 4L5RC 1QZHA 5JJLA 4LF7L 1SNMA 2EJFC 4LF4Q 5FKAC 4X62L 1N34L 3CCMA 2ZJPA 1KTKA 2MUYA 1U5KA 5EKIA 3G6JB 3M4OH 5I6WA 4L5SA 2F0LA 2FMCA 2OXPA 2F0NA 2JEBI 5JEAH 4UDUC 3M4QA 4DAPA 4A3LH 1QNUA 5ELDA 3I4NG 1WD0A 2Z8LA 1XTDA 2F52A 3I4LA 2NVXH 1X56A 2VB3X 2EIFA 2IHEA 3K5NA 2LMCB 2J0TD 4JOIC 4DV6Q 1Y8PB 4GLXA 1EQTA 3ND9A 2B2TC 3J7AF 3T13A 4IUPA 3A0JA 1QJOA 2OF1A 1C48A 1L1OC 1V8QA 3GTKB 1BBWA 2XWJB 4QIWE 2KHIA 3TMEA 5DEHA 1NSNS 1EOTA 3S1NB 1B9MA 3HOZG 4BY1B 1KAAA 4DV7L 3IKJA 1J8IA 1BR9A 3CPFA 4C2MB 1I6HB 4JI1L 2X69A 1N36Q 1ZKOA 3PUYA 1K3RA 1TVXA 4A76A 3KF6B 1S40A 5IP9G 1M4VA 4DR3Q 2EYPA 1X9NA 4UP8A 1V1QA 3M4YA 1VQKA 4X6AH 2VQEQ 2B2YC 1LTLA 1KLGD 1S5BD 4IFDH 1GOZA 4HN7A 2FHTA 1IZ6A 1SMYC 2HHHQ 3S16H 2EPBA 4A3JB 2HD3A 3S16B 1FVIA 1O7IA 1VQAA 3HP3A 2Q8IB 1JWSD 4DXGA 1X3FA 1I3QB 2NVQH 4U68A 1TKWB 1EIYB 2B2WC 2E76C 4P72A 2CFMA 4HJ8A 3AU7A 1U4PA 4IFDJ 1CHPD 4X3SA 1WTHA 2ZXPA 3TRZA 2B2VC 1R4QB 1Y14B 1ONLA 4KKUA 1DOMA 4LF8L 2ZXRA 2PI2E 3S1MB 1D1IA 3BS1A 1XPRA 1A2TA 2B8GA 4PQXA 1HH2P 2QW7A 4R1JA 3KF8B 4BXXG 4FXKC 2EDGA 3OW2A 2ZTDA 5C4XG 1GXDC 1SYEA 2WKDA 1ASYA 4FF1A 3CRKC 5I4DA 3FP9A 3GTQB 2IW3A 1WTRA 3S9WA 2UUAL 2K6AA 1AW7A 1STHA 2EOTA 3KK7A 1IKMA 4HMJA 2F0IA 5EAYA 2K5VA 3I4OA 2HIXA 3PO3H 1JORA 4ZK9B 2K28A 4NDXA 4IPDA 1I94L 4A3LG 4CKCA 4OXPA 5C6AA 1WYDA 1VQ9A 1EEID 4GNXB 1X32A 4DKAC 1G2SA 3NPPA 4DU9A 1JOKA 3KBXA 1QNKA 1TWCB 4IJHA 1SDFA 2RSOA 2TSSA 4JI5Q 4RKBA 1VQ7A 2H4OA 5KNDA 1IW7D 3PO3G 1JOQA 1NY4A 3HOYH 4OL7A 3VR3A 1TWHH 3HOYB 1AP0A 3TP6A 3S1QB 2BE5C 4A3IG 2D62A 1RCVD 4A3DG 4F8MA 1ZYRC 1W6JA 2B8FA 4HMIA 1FR3A 1RODA 1YITA 5C4XB 2XIWA 1DYQA 4JI3L 2VQFL 2M2LA 1B8AA 3BVZA 1GUGA 4Q0FA 4RGTA 2KCNA 4TKOB 1EY7A 4LUZA 2YYZA 3DHQA 2L5TA 2JXMB 2ZM6Q 1KD1C 1TY2A 1WCMG 1K0RA 1DZ1A 2ZJQA 4A3GB 3A8JE 2VY3A 4XYOA 2SOBA 5M5YB 1CQVA 3H0GH 4DV6L 4ZYSA 4ZLTF 3ERSX 3NBHB 3TSSA 2QEXA 3J81j 1TQOA 1N9WA 3KLSA 3HOUB 2JSOA 1ENCA 3T4AC 2IX3A 2Q2UA 5A35A 1G2TA 4IUTA 2BOSA 1KAWA 1NAPA 3ICEA 4QL5A 4HAEA 2OCEA 5CV6A 4ZUIA 4JI5L 4EVOA 4XQJA 3U9SA 4K0KQ 3VR4A 4A3JH 1D5MC 4X3UA 1GD7A 4GOPA 1WVLA 2BDNA 2Z4IA 4P73A 5C5LA 3R2TA 2F0WA 1DXMA 4KLKA 4NPSA 1B1ZA 2F0PA 5C3WA 2N88A 5C44H 3JAME 1Y8NB 4X66Q 3IAYA 2AKWB 1HZAA 1O7ZA 2A8VA 4IZ8A 2RBMA 1ET6A 3LWEA 3CAMA 5T1IA 3Q0AA 2KUMA 3OWEB 2JN4A 3OIQA 2E8GA 5KGUA 1HR0W 2WAQE 1IW7C 2CHBD 3S17H 4DV1L 2RHQB 4A3EB 3G48A 1IBML 2A69D 1HJPA 5I9PA 5J39A 1GUWA 1PH2A 4R4TA 3A5UA 3UDGA 4IALA 2F0DA 1VMPA 1H9RA 4BY1H 3HOUG 2EY6A 4IQZA 2K50A 2ZM6L 5I2YA 4JBMA 4KHPL 3J80i 4C1NI 2R7ZG 2JYOA 5EPLA 4RKLA 3GDEA 3TN2A 4RA8A 2MJ8A 4A3IH 4KTAA 3J81i 2E75C 4A3FH 1LTRD 2FMMA 4LUVA 2TMPA 4YCUA 2F4IA 5M5WH 3VR6A 4KHZA 4CHTB 3I4NH 3BJUA 5JVG3 4B08A 3VDYA 1OO9B 5IYCG 2L11A 4F7XA 2OQKA 2AQ1B 5BN4A 3RN5A 1BBXC 1PYSB 2R3ZA 1XYIA 1LV9A 1SBBB 2CW0D 2Z1CA 2C5CA 2ZT9C 1GHKA 4WJWA 1V9PA 5IYCH 4PV1C 1GUNA 1Z6HA 3BDLA 3CQZB 1PMRA 4LJZC 4JI0Q 2NVTH 2MFIA 1VQHA 4B9XA 2NVTB 1SYFA 1HHVA 3OHXC 1Y1VG 3FEWX 1BCPF 2BDOA 3KBGA 1WTQA 4LFCL 2A1AA 3NSWA 4JI2Q 4KJNA 1MBYA 4ILWA 3U9OA 4DXFA 4S3SA 3A7LA 5FLXc 3BZDB 1B50A 1A0IA 4QMGA 4LF5L 2SNSA 4C3HH 3SEBA 4WJ4A 4B3SL 1GVPA 3KJOA 2XRQD 4LAAA 3U4ZA 1JE4A 3CCEA 2JA8H 1XNRQ 4JYAL 5J1ZA 3BYTB 4A3FB 1W3SA 1CKNA 3K80C 1LO5D 3J80c 3KFUA 4JV5L 5E4WC 1HZCA 4HSVA 1SR3A 5EJWA 2GVAA 5GAGC 1XMQL 1MI2A 5CV8A 4KY7A 4GLAC 4P75A 4XT1B 4GKKQ 4EQNA 3QOLA 4JBKA 2UU9Q 3F2UA 2PNHA 5C3EB 1E1OA 2YV5A 4KKTA 3NELA 1JB3A 5JAVA 3I4MB 1SNOA 1SYDA 3C1EA 1Y1WB 2YTXA 4V190 2K5WA 3OTOQ 3CF5A 1ML0D 2AHOB 2I5HA 1F2YA 1VQCA 3HKZE 1RL2A 2D0OA 4DV3Q 4R4OA 3RZDB 2PO4A 4NXMQ 2Z6KC 3GD7A 1QOHA 2R6GA 3Q23A 1DOKA 4GNXA 3BU2A 1CM9A 2KEEA 4IOAA 3OSOA 1CTMA 3K6OA 4IUQA 4XT3B 4QY7A 4B3ML 1CSPA 3GTOB 1K73C 4IN3A 3S1MH 5CV5A 2JJQA 1ICWA 1J5EQ 1HR0L 1ESFA 4DNRB 2LXKA 2KHSA 1YHBA 3T1YQ 3TS2A 1EY9A 1IBLL 5CORA 2EYMA 4YHHL 1K83H 2I46A 4A93H 5LL6S 1PFBA 5ELEA 1IYJB 4XTCS 2YU9H 2VB2X 3AYHB 4FNFA 1SE2A 5JEAG 1PRTC 3W1GA 4IO9A 1IBMQ 4AYBB 1WTXA 4JI6Q 4A3IB 2RVLA 1D2BA 3FPPA 1V1OA 5A2QL 4A3DH 4BWGB 2H1EA 3MXPA 1I50H 3NTKA 1NTGA 3RZDH 2PQAB 3OMGA 2LSSA 4LNQA 3OMCA 3KF6A 1A2UA 2EJGC 4JG2A 5C5MA 5E7NA 4A3KH 4LF6Q 2BA0A 1UE7A 1V1PB 4GKKL 1IHZA 2IJ0A 4R4IA 3HZXA 3F2DA 3E6ZX 1NJIC 2JA8G 1C9OA 3NBHA 1U4MA 2BCOA 3NHHA 4QIWB 1Q8KA 1TWCH 1E2ZA 4L5QA 1WOCA 2E2IH 3RLFA 4I7AA 2E2IB 1FYCA 5D3IB 1AE3A 1KNAA 1I4XA 3WDNA 3I4MH 4ID6A 2K7VA 3S2DB 4AQYL 3VA5A 4R8NA 4BA1I 1CKNB 1Y1WH 4Q5VA 1RF2D 1SNPA 1Y1VH 1ILPA 1L1OA 2I0QA 3AMUA 2F3WA 2UUCQ 2EY1A 2YU9B 2K05A 4POFA 1D6EC 1K8OA 3RZOB 1BVSA 4KMUC 1SJHD 1Q46A 1ILQA 2K14A 3DWAA 2JA7G 3GV3A 3L7ZC 3W1BA 1K28A 1PDQA 5IT9E 1AZPA 3VYSA 3KF8A 2ID0A 4DUYL 1TY0A 1XMQQ 4MIUA 3TDQA 3OOCA 1VS0A 4FXDA 4OONA 4C3HB 4FO2A 2NN6H 1QVGA 2EE1A 1KDAA 1EY4A 4BXXH 2F0VA 1HXYD 4OWTB 2KCMA 5CC4A 3RN2A 4OWXB 3MWYW 5C3EG 3CCRA 2L1BA 1CT1D 2EY5A 4Z9CB 1PLFA 4B3RQ 2F4VQ 4N8FA 2GA4B 1EZ6A 3PCOB 2MO0A 1KLUD 4JI3Q 1UNSA 4L8JA 3D8GA 2VXWA 1K83B 4PMCA 2I5MX 3HOXG 2R7FA 2R7ZH 4K14A 5AJ3Q 2B29A 3HOUH 3EIVA 4F87A 4A3BB 3K0XA 2L0CA 2UUAQ 3S14B 1FL0A 1QG7A 2VQFQ 1Q7YC 5IT9L 1SNQA 3J7ZC 3I55A 5L37A 3SE0A 4DV0L 5IWAQ 1N32L 2EYLA 4HEDA 2IY5B 1H9KA 3LX0A 2XWBB 4ZAIA 1OXSC 2NZ1D 2A19A 3NUCA 1J6QA 5C4JH 2DJFC 1O78A 1X3QA 3IFDA 1B70B 4LK1C 4E6IA 1DCZA 2PCFB 3FKIB 1LT5D 2N8NA 3A8IE 2RKSA 1EL0A 1I4GA 2K5NA 4MTKA 3KLRA 3F2BA 3EJIA 4JBWA 5IYBH 3KLWA 2KQ3A 3M9BA 1VQ8A 5JVH3 3KDFA 1MKHA 3M85A 2F0TA 4DR5L 3H0GG 1STBA 1SRUA 4H44C 3NXWA 3QO2A 4DV4L 1YIJA 1TWHB 2WB1G 1S3OA 1DOLA 1TU2B 1STGA 3LNNA 3QR8A 5FO9B 1I4HA 3TP8A 3E9IA 1JQYD 4QGUA 4DR7Q 4BBSG 4JYAQ 1PH5A 4A3EH 5FLMH 1EY5A 4OELB 1GO3E 1IBLQ 3KUPA 3BDCA 3PF4A 2NWGA 3QWNA 4RHRA 3J81L 5I2XA 1K0SA 4A3DB 4L6TB 1UE1A 1L1OB 1EYCA 1NBWA 3HKSA 1SN8A 4J1MA 4DR1L 1PFNA 4TSSA 4DPGA 3JAMi 1JJ2A 4A3KB 3U4VA 3R2IA 4R4CA 4RCNA 4B3TL 3JAML 5JJZA 2MHVA 1A15A 2XN9C 1W6KA 1VDZA 1SSOA 1CA6A 4Y7NH 1WTWA 4HIMA 2K1BA 2CQAA 1VQFA 2A74C 1HNWQ 4DR5Q 3HOWG 1F2ZA 3H3VH 3CQZH 4RFBA 4YIJA 3T1HQ 1T5EA 2BE5D 5IGGA 4KKSA 3GP7A 3I2ZA 2J4XA 2E5LQ 4EX5A 2OTLA 1F77A 2CKZB 2O5JC 1PRTF 2DN8A 3ITPA 3A5ZB 3K8AA 2K75A 3HKZB 5ELFA 1JJGA 3E0EA 3M4OB 2F0JA 4A75A 4FF4A 1LTID 4ZKBB 4NXNQ 5GROA 3CHBD 5IYDH 3BG3A 5JJKA 1EQQA 2RSNA 3DUZA 3GTQH 4CBVA 3GTJH 4CKBA 5C4XH 1IBKQ 4FXGC 1Z7TA 2A6HD 3TREA 1YJNA 3HOZB 4R8IA 4HJ5A 1YNND 3H3VI 4KJOA 4YWMA 4BA2I 4A3EG 4IUVA 1OXXK 1CKOA 5FLXE 3W2DA 3CC7A 4RGOS 5IP7H 4JK1C 2WAQB 2BH2A 1QUQA 1LUZA 3MHBA 3E3XA 3GTKH 4JI7L 3A74A 2KA7A 3V05A 2EY2A 3VA7A 1S5DD 2ZXOA 4RAUC 3G4SA 4JI7Q 4DV2L 3DWPA 3RMHA 1EIGA 1M1KC 4O42A 4BY1G 5IOCA 1PZKD 1EWCA 4X3KA 4B3SQ 4OWWB 3HOWH 2O4XA 2X6LA 3FPUB 3MEHA 1VQIA 4CJ2C 4FF3A 1SROA 3K57A 4A93G 1STYA 1YNJD 1VQ5A 2UXCL 1X3PA 4N9TA 4J8QA 5LL6X 1TIID 1Q90A 1M8AA 5IE8A 1PH9A 2ES2A 5DAUA 3GTGH 2K52A 5BR8Q 5IP9H 5GADC 1V1PA 1IKLA 1HNXL 4H0LC 1YEZA 3MZ5A 3WWVA 2NB0A 2X6GA 2QF7A 4XYQA 4QCLA 1HFNA 3BZKA 1HNXQ 5E1FA 2F3VA 4BY7B 2B2VA 2I5LX 3HOZH 1CZWA 1E3PA 3UI2A 5FLXL 1PV4A 1BNZA 3K7AH 1VF5C 3HOXB 4JI4L 4DNIA 2WFWA 1SFOH 1HZBA 2EQSA 3C1FA 1FGBD 1S5ED 4QQBX 2OEOA 2Y0SG 4DV7Q 1X65A 1HNZQ 4PZ6A 1N36L 1EU4A 4UP7A 5KNCA 2CH4W 3PO2B 2N78A 2F1MA 3A7AB 3PO2H 4DK1A 1EEFD 2CWPA 2CCZA 1VQGA 4M1UB 3MXNB 4AIMA 1AZQA 1B3AA 4DR4L 3HOVH 1Q3LA 3I3CA 2ZJRA 1LT3D 1UEAB 4B9WA 4DR4Q 4DR3L 4R4QA 3M4PA 1IYUA 3L2PA 4C56C 2UXDL 3EQLC 3Q8DA 4HCSA 3N6RA 1CKMA 1X3EA 4LF5Q 4K6LA 5JEAJ 2RDGA 2F4VL 3CC2A 1WJJA 1EFID 3GTLB 1A6XA 2IWHA 5E3FA 4EQPA 2HUGA 3AFQA 4LFBL 4C3HG 1QVFA 1RJTA 3D4WA 1NNXA 2L55A 3L3OC 4JI4Q 4MTNA 1J9OA 2PYKA 4ZRZA 4YCWA 1IYVA 3HKZG 1UUPA 1JC7A 1U4LA 5LHY1 3EA6A 2QEJC 4YY3L 2CQOA 3S14H 1GUSA 1TR5A 1LTGD 1PRTD 1HTLD 5D65A 2RDFA 3CCSA 3MXUA 3S17B 4QF4A 5M3MG 3CW2C 3DEOA 3HOYG 1QCBD 1RIPA 1WCMB 3I4MG 1SYGA 1QILA 1VQJA 4A3KG 1WFQA 4OX9L 1AFPA 1FGUA 3HOVB 1LACA 4CDDC 1PYBA 1VMCA 3FKIH 4EGVA 1QB5D 3FHWA 5M3MB 2O5IC 4DA2A 2V4DA 4LFAL 4BS9A 3UDIA 3PIP3 2F0MA 3I56A 5KEEA 4MN3A 1EY6A 1CZGA 4DNTB 4J6HA 3V96A 1XTCD 1SYBA 3EBEA 3S15B 5GAHC 5HGTA 1BCPD 4K2KA 3UDXA 4KK7A 3J81c 3H6MA 3VYUA 1KQSA 4A3GG 4KHPQ 4K5WA 2WACA 3F8TA 2HT1A 1B53A 3JC66 2MNAA 3H15A 2L4NA 4ME3A 4MHEA 2R92G 3L0OA 2R7ZB 5CR3A 1G51A 4A93B 3U58A 1UE6A 5FO8B 2JE6I 3SVMA 3WOEA 4TRDA 3HOWB 4GKJQ 4AYBE 3DMUA 3SR1A 4RCOA 4ZKCB 4GLVB 4FVMA 4OIKA 4DK6C 1D5XC 1I4RA 3E5SA 4UHVA 1S5CD 3EVQA 5ELBA 5LMNW 1ZXTA 2JP1A 1XNQL 5E4XA 4LW1A 2VUMB 2JA5G 4XDXA 3DXJC 3BVMA 3IRBA 2R93G 1L0YB 4L63B 4HJAA 2DNCA 4G4KA 4BY7H 4J15A 2XNAC 3DM1A 5EKLA 4H02A 1BCPC 5C44B 1SXTA 4A3CG 2JA6B 3G71A 2A6EC 4ULLA 2JA6H 1TWFB 3TZDA 3TQYA 3D3RA 2JA8B 4KN4C 3ZYYX 1EFWA 4AQYQ 2EZVA 2K04A 1ZYRD 3D6WA 2UXBL 4C3JG 4KD4A 2NVYB 3EROA 1PH7A 1MD2D 5M5XH 1I94Q 3K5LA 1EUJA 3HFZB 5C3EH 1KRSA 2SDFA 1NR2A 1U4RA 5LMNQ 2JA5H 2N3SA 2CWAA 1LTAD 2HCCA 3SK8A 3E0JA 4YWKA 5IYBG 4EQ5A 1GM5A 1TS4A 3ER0A 3T16A 1TT2A 4P74A 5NUCA 4DUZQ 3PO3B 3GTGB 2WB1E 5KYLA 4A3MG 2DY7A 1F9SA 4IUUA 4LFCQ 4G7ZC 1NMFA 4LF9L 1XJVA 2PNRC 1A3VA 4NP5A 2WV6D 4DR2Q 2EYJA 2NBFA 3L9AX 4ZQ3A 2JA6G 3HOXH 1Y69U 4RH6A 5C3XA 3H94A 5I6YA 2WAQG 2VZAA 1O7LA 3V2TA 1GJXA 1OXUA 1BKBA 1EY8A 2A5HA 2D2CC 3UE1A 3DWQA 1T5XD 3KDFB 4DV0Q 5BR8L 4JBJA 3RLOA 3S1QH 3FKIG 1RHPA 1G6PA 2FFKB 4LWCA 4DV3L 1SMXA 1TS3A 2ZTEA 4YY3Q 1JWUD 2UXCQ 2F0QA 5IGFA 1IL8A 3I7FA 5M3MH 2KEDA 1H9SB 3OTOL 3C3LA 2UUBL 5DNFA 4RWSC 2NTSA 1DJRD 5D3DA 4RHSA 2XTIA 3K81C 4HTHA 3RR5A 3X3MA 1U0LA 1ESRA 3GTJB 2I07B 2JEAI 2A68C 1I50B 1PTOD 4GZYC 1PH8A 1GUOA 2Q2TA 1K8AC 4IPGA 4JVZA 2B63G 4LFAQ 3PIO3 2CVRA 4DAMA 2P5ZX 4HIDA 2FXQA 4AH6A 1BCPB 3LGJA 4OO1G 1TWAB 3EFXD 1HA5A 1TS2A 1SJED 1PZID 2UXDQ 1YJWA 2WIIB 4DAYB 5LMNL 3GTLH 1R4PB 2JA9A 1PH1A 2C35B 1L2FA 1D1KA 4DUYQ 1TWGB 1ENAA 2V1CC 4P2CB 4LMQD 2K5QA 4IURA 1QVCA 2JA5B 1DM0B 4X62Q 1HTPA 2XGTA 3D0FA 3I90A 1D7QA 5EQ0A 3MVVA 4H13C 1GHJA 3GV6A 5TSSA 1X6OA 4TQUS 5AFWA 3W3AA 3Q24A 4KY6A 2RF4A 3O13A 3S24A 2PZTA 5IWAL 4GOPC 1ENFA 3A8KE 4LFBQ 3NTHA 4DK3C 4PG3A 1EYAA 4IJLA 1E0BA 1GUTA 2A68D 2DY8A 4UAIA 4LUOA 1CHQD 1IL2A 1MSGA 1N32Q 2KCTA 3STBC 3KYHC 2EYOA 1ASZA 5C4ZA 2ASBA 1QZGA 4BBRG 2VNUD 5HGQA 1M90C 4YCVA 2NYZD 5BN5A 3D6CA 1E2WA 5M9OA 3P1HA 1VQLA 2J7ZA 3CCUA 1ICFB 2AMCB 4QUCA 1XWEA 1Q8IA 3BZCA 2EXDA 1QE6A 4X64Q 1VQ4A 1FJGL 4OGQC 5FK9C 1BO0A 2NUCA 4K6DA 5JPNC 1BXTA 3A55A 5CBEE 2RA4A 2E2JB 3KJPA 1PXUA 4APVA 4JW0A 5M5YH 1KXLA 3OW7A 4ZCKA 5JJIA 3SXHA 3MA2B 2NZOA 1O80A 1HPCA 2H5XA 3FRPB 2K33A 2HDMA 1PZJD 2VL6A 5C4HA 1WI5A 4OX9Q 5FJ8H 3T1YL 2MQHA 4C2MH
chains in the Genus database with same CATH topology
2D5DA 3GQBA 1STEA 1H9SA 2NTTA 4CGYB 3I70A 2PPBC 1S5FD 4KV6A 2LY7A 5G3LF 2F0SA 3CKIB 1LABA 3C46A 5JOBA 4ABNA 1EY0A 2E74C 1F9RA 1EWHA 3QOJA 4EQOA 1CK1A 1OXVA 4FP5D 3K59A 1B2TA 3M7GA 2KECA 3J81E 3LWUA 3HGBA 1JCKB 2O2LD 1RKNA 2NN6I 1L0XB 2F0HA 4V0BA 4C1NK 3MXNA 1WTVA 1CI3M 3P20A 4DFAA 4ODGA 1EU3A 3KLSX 3DEPA 3NP8A 5CMDA 3SHLA 4ME5A 5C0XG 1SAPA 1CFMA 1SNCA 5KYIA 5EGTA 2R61A 2LKVA 3OPOA 1QWYA 2E2HB 3MTSA 3PUXA 5M5WB 4XIGS 5J22A 2G9DA 1F9PA 2F0UA 4G57A 4KN7C 1NR4A 4C3IB 2IX0A 1FNWA 4K8JA 2F0GA 3VR5A 2JA7B 1Z47A 2WB1B 3T53B 5IGEA 1G291 3NTIA 1XXGA 2EYFA 3VR2A 4CKEA 3S1RB 2CW0C 3QJYA 1A3UA 3TP5A 5BN3A 5C0XJ 3J7AV 1LT4D 1G91A 5DM73 5M5XB 4XQQA 1SMYD 4FYDA 2PZWA 3M7NA 2AUKA 1KABA 3NK9A 3SK4A 1BOSA 5IGDA 3OWFA 5CV9A 1C4QA 1Q12A 2F0OA 3H09A 5CGKA 2PW7A 1RDPD 1G6ZA 1NCVA 3I91A 3X3NA 2DNEA 3QIAA 2RQXA 3A54A 4O1NA 3TP7A 3R8BA 4DAYA 3H91A 5FO7B 4U673 2QCPX 1I6VC 1FNVA 1FNUA 5FOBB 3WOFA 1EZ8A 1R9TB 5K36H 1CA5A 3NQIA 1JWMD 3C2PA 3IFTA 2WKCA 1PTOF 1LTTD 1SEBD 4QUFA 4NW2A 2PMZB 3TBIB 1LTSD 2HQEA 4RGNA 5EBCA 1EIHA 5JPMC 3MFGA 2B39A 3OIPA 1RTNA 1SE3A 3CU7A 3MFYA 4A3MB 1BQQT 3D4RA 4KD3A 5CYUA 4C3JB 3CRLC 1F9QA 4CJ1B 2PQEA 5CBAE 3K58A 4CJ0B 2ENBA 2K32A 3N52A 5KNBA 4K5VA 3A56A 3R93A 1TS5A 5G3LD 2KOLA 3FVQA 5T1GA 3K5OA 1LLRD 4PNYA 1YNJC 2N55A 1U9RA 2RDHA 1MGSA 4IUNA 3VYRA 4IFDI 5IIFA 4WORA 2F0EA 4K2LA 2B63B 1B9NA 3IL8A 3MXGA 1KDBA 3QB3A 3RD4A 3H3VC 2F0FA 4FF2A 4IFDG 1SE4A 3S2HB 3Q22A 2WINB 1V43A 2R93B 1WD1A 2D9UA 5CV4A 1VCIA 2A6HC 2E2DC 2L12A 1BF4A 3HEJA 3I8ZA 1II3A 1DD2A 3I73A 1SFOB 3D4DA 1B4OA 2AWOA 5K36G 3PUVA 1EQVA 3MC0B 3PUWA 2WP8J 3K5MA 2F0KA 4PMBA 1LTBD 4DGZA 2ICIA 2FINB 5COYA 3H0GB 2EVBA 4K8IA 2SEBD 2L9HA 2AUJD 1KNEA 4K5XA 3M3YB 4C3IG 3SDZA 4X3TA 4OO1I 3NQTA 4F88A 1UAPA 4WRDA 3URYA 4BBSB 5IODA 1F2MA 2K5DA 4DK0A 2Z4HA 1S4ZA 3HG9A 3P75A 5CV7A 1RTOA 3D31A 2M9VA 2IL8A 1SYCA 5C4JB 4ZUJA 3G7LA 1HCZA 2AWNA 2LS01 5ISRA 2C9OA 2AQ3B 3J80L 2KCCA 3FMCA 4H7BA 4G7HC 3K0YA 3Q6SA 2MP1A 3BDOA 4PMWA 1MSHA 1CQFA 4I65A 2K03A 3GO5A 1E2VA 3SK6A 1PTOH 2NN6G 3NWSA 1PTOB 2KVMA 1RD9D 2QILA 1JR0D 2BA1A 3QG1A 1HUMA 3ERQA 1STAA 1HFGA 2HDLA 3BYYB 2LFNA 4M8AA 1I4QA 4QB4A 2M00A 2G9HD 4DF7A 4OO1H 2AQ2B 3J80E 5KRUA 5EPKA 3SK5A 1AEXA 1AN8A 1JICA 5IGCA 1HQMC 1FD7D 3GTPB 2B2YA 4XQNA 2PZUA 3NE5B 3T56B 1OXTA 3R3OA 2A6ED 2QDBA 2MPMA 4RGMA 1Y1VB 3K7AB 3I72A 3PUZA 2QKIC 3PMFA 1I4PA 1PFMA 1A3TA 2NVQB 3ND8A 4G7OC 2R92B 2A69C 1BUVT 2K01A 5HURA 2B2UA 1NUCA 3TZUA 1HUNA 5I9OA 1PRTB 2XRSD 2FJ2A 4KY5A 2IX1A 3NBIA 1PYWD 4HR7B 5D14A 3I4NB 2XVSA 4HSPA 2EYHA 1ET9A 1WTPA 3HS0C 4DN4M 2IPKD 4KHVA 1G8ZD 2EXZA 1H9JA 3FDTA 4NKLA 5ELCA 1ZEQX 4NMZA 3ONAB 3VYTA 1F2LA 2Y0SB 3HRZC 5M3FB 5A2QE 5C0XI 2F03A 2EJMA 4HCEA 3GTMB 4OHJA 2PW5A 1Q1BA 2IT1A 1XX8A 3P7JA 2ICEC 1STNA 1PTOC 3BVGA 4N9PA 2OT2A 2KJXA 5F2DA 5EPJA 1C8CA 4XXEA 1KDCA 1YNNC 1SNDA 1Q1EA 5K5PA 3J7YW 1H9MA 1HQRD 2Q8RE 3T51B 3MAQA 1HRJA 2SNMA 2NVXB 5IGBA 4KI0A 4DAVA 1LT6D 1K8MA 5C0XH 1EYDA 2B2WA 2MGSA 2XSCA 5EBDA 2Q8TA 5KIXA 5DM63 3AB9A 4R9WA 2A73B 1BDOA 1O7YA 1WTOA 2B2UC 3NWTA 4BBRB 4Y7NB 4OIJA 1VF7A 4WFN3 5EKKA 2B2TA 4I7ZC 1Y8OB 1HA6A 1D5ZC 1B44D 3RUZA 1JOOA 2HCIA 3PV0A 1DONA 1SNMA 2EJFC 5FKAC 1KTKA 2MUYA 5EKIA 3G6JB 5I6WA 2F0LA 2FMCA 2OXPA 2F0NA 2JEBI 5JEAH 4UDUC 4DAPA 1QNUA 5ELDA 1WD0A 2Z8LA 3I4LA 2VB3X 3K5NA 2LMCB 2J0TD 1Y8PB 1EQTA 3ND9A 2B2TC 3J7AF 3T13A 4IUPA 1QJOA 2OF1A 1C48A 1V8QA 3GTKB 2XWJB 3TMEA 5DEHA 1NSNS 1EOTA 3S1NB 1B9MA 4BY1B 1KAAA 3IKJA 1J8IA 1BR9A 4C2MB 1I6HB 2X69A 1ZKOA 3PUYA 1TVXA 1M4VA 2EYPA 3M4YA 2B2YC 1KLGD 1S5BD 4IFDH 1GOZA 4HN7A 2FHTA 1SMYC 2EPBA 4A3JB 3S16B 3HP3A 2Q8IB 1JWSD 4DXGA 1I3QB 4U68A 1TKWB 2B2WC 2E76C 3AU7A 1U4PA 4IFDJ 1CHPD 4X3SA 2ZXPA 2B2VC 1R4QB 1ONLA 4KKUA 1DOMA 2ZXRA 3S1MB 1D1IA 3BS1A 1A2TA 2B8GA 4PQXA 4FXKC 2EDGA 1GXDC 1SYEA 2WKDA 4FF1A 3CRKC 5I4DA 3GTQB 2IW3A 1WTRA 3S9WA 2K6AA 1AW7A 1STHA 2EOTA 3KK7A 1IKMA 4HMJA 2F0IA 1JORA 4ZK9B 2K28A 4NDXA 4CKCA 5C6AA 1EEID 1X32A 1G2SA 3NPPA 4DU9A 1JOKA 3KBXA 1QNKA 1TWCB 1SDFA 2RSOA 2TSSA 4RKBA 2H4OA 5KNDA 1IW7D 1JOQA 4OL7A 3VR3A 3HOYB 1AP0A 3TP6A 3S1QB 2BE5C 2D62A 1RCVD 4F8MA 1ZYRC 1W6JA 2B8FA 4HMIA 1FR3A 1RODA 5C4XB 2XIWA 1DYQA 2M2LA 3BVZA 1GUGA 4Q0FA 4RGTA 2KCNA 4TKOB 1EY7A 2YYZA 3DHQA 2L5TA 2JXMB 1TY2A 1DZ1A 4A3GB 3A8JE 4XYOA 2SOBA 5M5YB 1CQVA 4ZYSA 4ZLTF 3TSSA 1TQOA 3KLSA 3HOUB 2JSOA 1ENCA 3T4AC 2IX3A 5A35A 1G2TA 4IUTA 2BOSA 1NAPA 4HAEA 5CV6A 4ZUIA 4EVOA 4XQJA 3U9SA 3VR4A 1WVLA 1D5MC 4X3UA 2BDNA 2Z4IA 5C5LA 3R2TA 2F0WA 1DXMA 1B1ZA 2F0PA 5C3WA 2N88A 3JAME 1Y8NB 3IAYA 1O7ZA 4IZ8A 2RBMA 1ET6A 3LWEA 5T1IA 3Q0AA 2KUMA 3OWEB 3OIQA 5KGUA 1IW7C 2CHBD 4A3EB 2A69D 5I9PA 5J39A 1GUWA 4IALA 2F0DA 1VMPA 1H9RA 2EY6A 4IQZA 5I2YA 4C1NI 2JYOA 5EPLA 4RKLA 3TN2A 4RA8A 2MJ8A 4KTAA 2E75C 1LTRD 2FMMA 2TMPA 2F4IA 3VR6A 4KHZA 4CHTB 5JVG3 4B08A 1OO9B 2L11A 4F7XA 5BN4A 2AQ1B 1BBXC 2R3ZA 1XYIA 1LV9A 1SBBB 2CW0D 2Z1CA 2C5CA 2ZT9C 1GHKA 4WJWA 4PV1C 1GUNA 1Z6HA 3BDLA 3CQZB 1PMRA 4LJZC 4B9XA 2NVTB 1SYFA 1HHVA 3OHXC 3FEWX 1BCPF 2BDOA 3KBGA 1WTQA 3NSWA 4KJNA 1MBYA 4ILWA 3U9OA 4DXFA 4S3SA 3A7LA 3BZDB 1B50A 4QMGA 2SNSA 3SEBA 2XRQD 4LAAA 1JE4A 5J1ZA 3BYTB 4A3FB 1LO5D 5E4WC 4HSVA 5EJWA 1MI2A 5CV8A 4KY7A 4XT1B 4EQNA 3QOLA 3F2UA 5C3EB 4KKTA 1JB3A 5JAVA 3I4MB 1SNOA 1SYDA 3C1EA 1Y1WB 4V190 2K5WA 1ML0D 1F2YA 3RZDB 2PO4A 3GD7A 1QOHA 2R6GA 3Q23A 1DOKA 1CM9A 2KEEA 3OSOA 1CTMA 3K6OA 4IUQA 4XT3B 3GTOB 4IN3A 5CV5A 1ICWA 1ESFA 4DNRB 2KHSA 1EY9A 5CORA 2EYMA 2I46A 5LL6S 1PFBA 5ELEA 4XTCS 2VB2X 4FNFA 1SE2A 5JEAG 1PRTC 4AYBB 1WTXA 4A3IB 2RVLA 1D2BA 3FPPA 1V1OA 5A2QL 4BWGB 2H1EA 3MXPA 3NTKA 3OMGA 3OMCA 1A2UA 2EJGC 5C5MA 2BA0A 1V1PB 1IHZA 2IJ0A 3HZXA 3E6ZX 3NBHA 1U4MA 2BCOA 3NHHA 4QIWB 1E2ZA 3RLFA 2E2IB 1FYCA 5D3IB 1KNAA 1I4XA 3WDNA 4ID6A 2K7VA 3S2DB 3VA5A 4R8NA 4BA1I 4Q5VA 1RF2D 1SNPA 1ILPA 3AMUA 2F3WA 2EY1A 2YU9B 2K05A 1D6EC 1K8OA 3RZOB 4KMUC 1SJHD 1ILQA 3DWAA 3GV3A 3L7ZC 1PDQA 1AZPA 5IT9E 3VYSA 3KF8A 2ID0A 1TY0A 4MIUA 3TDQA 3OOCA 4FXDA 4C3HB 4FO2A 2NN6H 2EE1A 1KDAA 1EY4A 2F0VA 1HXYD 5CC4A 3MWYW 2L1BA 1CT1D 2EY5A 4Z9CB 1PLFA 2GA4B 1EZ6A 1KLUD 1UNSA 4L8JA 3D8GA 2VXWA 1K83B 4PMCA 4K14A 4F87A 4A3BB 2L0CA 3S14B 1QG7A 5IT9L 1SNQA 3SE0A 2EYLA 4HEDA 1H9KA 3LX0A 2XWBB 4ZAIA 1OXSC 2NZ1D 3NUCA 1O78A 1X3QA 3IFDA 4LK1C 4E6IA 1DCZA 2PCFB 3FKIB 1LT5D 3A8IE 2RKSA 1EL0A 1I4GA 3KLRA 3EJIA 4JBWA 2KQ3A 5JVH3 3M85A 2F0TA 1STBA 4H44C 3NXWA 3QO2A 1TWHB 1DOLA 1TU2B 1STGA 3LNNA 5FO9B 1I4HA 3TP8A 1JQYD 1EY5A 3KUPA 3BDCA 2NWGA 3QWNA 4RHRA 3J81L 5I2XA 4A3DB 4L6TB 1EYCA 4J1MA 1PFNA 4TSSA 4A3KB 3R2IA 4RCNA 3JAML 5JJZA 2MHVA 1A15A 2XN9C 1W6KA 1VDZA 1SSOA 1CA6A 1WTWA 2K1BA 2CQAA 2A74C 1F2ZA 4RFBA 4YIJA 1T5EA 2BE5D 5IGGA 4KKSA 3GP7A 2J4XA 1F77A 2O5JC 1PRTF 2DN8A 3ITPA 3HKZB 5ELFA 3M4OB 4FF4A 2F0JA 1LTID 4ZKBB 3CHBD 3BG3A 2RSNA 3DUZA 4CBVA 4CKBA 4FXGC 1Z7TA 2A6HD 3HOZB 4R8IA 1YNND 4KJOA 4BA2I 4IUVA 1OXXK 5FLXE 3W2DA 4RGOS 4JK1C 2WAQB 3MHBA 2KA7A 3V05A 2EY2A 3VA7A 1S5DD 2ZXOA 4RAUC 3DWPA 3RMHA 1EIGA 4O42A 5IOCA 1PZKD 1EWCA 4X3KA 2O4XA 2X6LA 3FPUB 3MEHA 4CJ2C 4FF3A 3K57A 1STYA 1YNJD 1X3PA 4N9TA 4J8QA 5LL6X 1TIID 1Q90A 1M8AA 5DAUA 1V1PA 1IKLA 4H0LC 3MZ5A 2NB0A 2X6GA 2QF7A 4XYQA 4QCLA 1HFNA 5E1FA 2F3VA 4BY7B 2B2VA 1CZWA 3UI2A 5FLXL 1BNZA 1VF5C 3HOXB 3C1FA 1FGBD 1S5ED 2OEOA 1EU4A 5KNCA 3PO2B 2F1MA 3A7AB 4DK1A 1EEFD 4M1UB 1AZQA 1B3AA 1Q3LA 3I3CA 1LT3D 1UEAB 4B9WA 1IYUA 4C56C 3EQLC 4HCSA 3N6RA 4K6LA 5JEAJ 2RDGA 1EFID 3GTLB 1A6XA 2IWHA 5E3FA 4EQPA 2HUGA 4C3HG 1RJTA 3D4WA 2L55A 3L3OC 1J9OA 2PYKA 4ZRZA 1IYVA 1UUPA 1JC7A 1U4LA 5LHY1 3EA6A 2QEJC 1GUSA 1TR5A 1LTGD 1PRTD 1HTLD 5D65A 2RDFA 3MXUA 3S17B 4QF4A 3DEOA 1QCBD 1WCMB 1SYGA 1QILA 1AFPA 3HOVB 1LACA 1VMCA 4EGVA 1QB5D 5M3MB 2O5IC 4DA2A 2V4DA 4BS9A 3PIP3 2F0MA 5KEEA 4MN3A 1EY6A 1CZGA 4DNTB 4J6HA 3V96A 1XTCD 1SYBA 3S15B 5HGTA 1BCPD 4K2KA 4KK7A 3H6MA 3VYUA 4K5WA 2WACA 1B53A 2L4NA 4MHEA 2R7ZB 5CR3A 4A93B 5FO8B 2JE6I 3SVMA 3WOEA 4TRDA 3HOWB 3DMUA 3SR1A 4RCOA 4ZKCB 4FVMA 4OIKA 1D5XC 1I4RA 3E5SA 1S5CD 3EVQA 5ELBA 1ZXTA 2JP1A 5E4XA 2VUMB 4XDXA 3DXJC 3BVMA 1L0YB 4L63B 2DNCA 4G4KA 2XNAC 3DM1A 5EKLA 1BCPC 5C44B 1SXTA 2JA6B 2A6EC 4ULLA 1TWFB 3TZDA 3D3RA 2JA8B 4KN4C 3ZYYX 2EZVA 2K04A 1ZYRD 3D6WA 4C3JG 4KD4A 2NVYB 3EROA 1MD2D 3K5LA 2SDFA 1NR2A 1U4RA 2HCCA 1LTAD 3SK8A 3E0JA 1TS4A 3T16A 1TT2A 5NUCA 3PO3B 3GTGB 5KYLA 2DY7A 1F9SA 4IUUA 4G7ZC 2PNRC 1A3VA 4NP5A 2WV6D 2EYJA 2NBFA 3L9AX 4ZQ3A 1Y69U 4RH6A 5C3XA 3H94A 5I6YA 1O7LA 3V2TA 1GJXA 1OXUA 1EY8A 2A5HA 2D2CC 3DWQA 1T5XD 1RHPA 2FFKB 1TS3A 1JWUD 2F0QA 5IGFA 1IL8A 2KEDA 1H9SB 3C3LA 5DNFA 4RWSC 2NTSA 1DJRD 5D3DA 4RHSA 4HTHA 3X3MA 1ESRA 3GTJB 2I07B 2JEAI 2A68C 1I50B 1PTOD 4GZYC 1GUOA 3PIO3 2CVRA 1BCPB 4OO1G 1TWAB 3EFXD 1HA5A 1TS2A 1SJED 1PZID 2WIIB 1R4PB 1D1KA 1TWGB 1ENAA 4P2CB 4LMQD 2K5QA 4IURA 2JA5B 1DM0B 1HTPA 3I90A 5EQ0A 3MVVA 4H13C 1GHJA 3GV6A 5TSSA 4TQUS 5AFWA 3W3AA 3Q24A 4KY6A 3O13A 2PZTA 1ENFA 3A8KE 3NTHA 1EYAA 1E0BA 1GUTA 2A68D 2DY8A 4UAIA 1CHQD 1MSGA 2EYOA 5C4ZA 2VNUD 2NYZD 5BN5A 3D6CA 1E2WA 5M9OA 3P1HA 2J7ZA 4QUCA 1XWEA 1Q8IA 1QE6A 4OGQC 5FK9C 1BO0A 2NUCA 4K6DA 5JPNC 1BXTA 3A55A 5CBEE 2RA4A 2E2JB 1PXUA 3OW7A 3SXHA 3MA2B 1O80A 1HPCA 3FRPB 2K33A 2HDMA 1PZJD 5C4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0T A;  3NQT A;  3TME A;  1STB A;  5DEH A;  1NSN S;  5CV8 A;  2EYF A;  4WRD A;  4KY7 A;  4RKB A;  1KDC A;  3NXW A;  5KGU A;  1KAA A;  1A3U A;  2PQE A;  2QDB A;  1F2M A;  1SND A;  3D4W A;  3TP5 A;  3QOL A;  4EQN A;  5IOD A;  4KV6 A;  3MHB A;  5K5P A;  1JOQ A;  2ENB A;  2PYK A;  2EY2 A;  2F0S A;  4OL7 A;  4KD4 A;  1STG A;  3PMF A;  4ID6 A;  4K5V A;  3VA5 A;  4R8N A;  3TP6 A;  5I9P A;  5JAV A;  2EYP A;  3P75 A;  5CV7 A;  3ERO A;  3TP8 A;  5J39 A;  1SNO A;  2PZW A;  1SNP A;  1SYD A;  2SNM A;  3C1E A;  5IOC A;  4IAL A;  2F0D A;  5JOB A;  5IGB A;  1KAB A;  2EY6 A;  1A3T A;  2F3W A;  2O4X A;  1ENA A;  4F8M A;  1TR5 A;  2EY1 A;  3NK9 A;  3SK4 A;  1SYC A;  4HMI A;  1EY5 A;  2RDF A;  3MEH A;  4QF4 A;  3BDC A;  4PNY A;  4RKL A;  1F2Y A;  1STY A;  1EYD A;  4ZUJ A;  5IGD A;  1EY0 A;  3MVV A;  1U9R A;  1SYG A;  3QOJ A;  3SK8 A;  4N9T A;  4EQO A;  5ISR A;  5HUR A;  5KIX A;  4IUN A;  1NUC A;  4KTA A;  3OWF A;  5DAU A;  1EY7 A;  5CV9 A;  5IIF A;  4WOR A;  5I9O A;  4KY6 A;  2F0O A;  5CGK A;  2F0E A;  4K2L A;  3DHQ A;  1EYC A;  2PZT A;  4KY5 A;  4MIU A;  3T16 A;  1TT2 A;  3MZ5 A;  4J1M A;  2PW7 A;  1RKN A;  1KDA A;  1EY4 A;  1KDB A;  2F0M A;  2F3V A;  2F0V A;  1EYA A;  3OSO A;  3QB3 A;  4H7B A;  5KEE A;  4F7X A;  5CC4 A;  1EY6 A;  5NUC A;  2F0F A;  4J6H A;  2EYH A;  2SOB A;  2F0H A;  1SYB A;  5EKK A;  4I65 A;  5HGT A;  4K2K A;  3TP7 A;  5CV4 A;  5CV5 A;  2EY5 A;  5KYL A;  3H6M A;  3C1F A;  3RUZ A;  1TQO A;  2EYO A;  4KHV A;  5C4Z A;  1JOO A;  3SK6 A;  4K5W A;  1A2T A;  2WAC A;  4ODG A;  3HEJ A;  1EZ6 A;  4DFA A;  2OEO A;  1A3V A;  2EXZ A;  1ENC A;  1II3 A;  3D8G A;  4NP5 A;  1F2Z A;  2KHS A;  1EY9 A;  1SNM A;  2EYJ A;  3BDL A;  4NKL A;  3NP8 A;  3D6C A;  4PMC A;  5CR3 A;  4YIJ A;  4ZQ3 A;  5M9O A;  2EYM A;  3D4D A;  3P1H A;  5F2D A;  3SHL A;  4K14 A;  4ME5 A;  5IGG A;  5C3X A;  4NMZ A;  1EZ8 A;  1SYE A;  3ERQ A;  4B9X A;  1SNC A;  1SYF A;  5I6Y A;  5I6W A;  5KYI A;  4TRD A;  5EGT A;  2F0L A;  2LKV A;  3V2T A;  3ITP A;  1EY8 A;  1STA A;  3DMU A;  1EQV A;  2OXP A;  3SR1 A;  2F0N A;  5CV6 A;  4ZUI A;  4EVO A;  1SNQ A;  3S9W A;  1STH A;  2NUC A;  4KJN A;  4QB4 A;  4K6D A;  2F0J A;  2F0K A;  2EYL A;  2M00 A;  3E5S A;  4PMB A;  3EVQ A;  3U9O A;  4DF7 A;  4DGZ A;  4HMJ A;  3LX0 A;  5J22 A;  4S3S A;  4B9W A;  3NUC A;  2F0I A;  2F0Q A;  2F0U A;  4G57 A;  5C5L A;  2HQE A;  3MXP A;  5IGF A;  2F0W A;  3OMG A;  4E6I A;  5KRU A;  2F0P A;  3SK5 A;  3OMC A;  1AEX A;  4K8J A;  1A2U A;  4QMG A;  2F0G A;  4EQP A;  2SNS A;  5C5M A;  5C3W A;  1JOR A;  2RKS A;  4NDX A;  5IGC A;  2PW5 A;  3SXH A;  4LAA A;  1IHZ A;  3EJI A;  4K8I A;  4KD3 A;  3HZX A;  3T13 A;  4HTH A;  5C6A A;  2OF1 A;  4K5X A;  4KJO A;  5E1F A;  5J1Z A;  2KQ3 A;  1STN A;  2PZU A;  5C4H A;  3NHH A;  4N9P A;  4DU9 A;  1JOK A;  5EKL A;  5E3F A;  5IGE A;  4IZ8 A;  2RBM A;  3R3O A; 
#chains in the Genus database with same CATH topology
 2D5D A;  1N34 Q;  3GQB A;  1STE A;  3F1Z A;  1H9S A;  2NTT A;  4RMF A;  4CGY B;  1H95 A;  3I70 A;  2PPB C;  1S5F D;  3PIP A;  4KV6 A;  2LY7 A;  5G3L F;  2F0S A;  2DGY A;  3CKI B;  1LAB A;  3C46 A;  5JOB A;  1YI2 A;  1MJC A;  4ABN A;  4UPA A;  4X65 Q;  2Q2H A;  1VQD A;  4DR1 Q;  4L5T A;  2Z9H A;  1EY0 A;  2E74 C;  1F9R A;  1EWH A;  3QOJ A;  4EQO A;  3CMA A;  1HNW L;  4A4I A;  1CK1 A;  4NB3 A;  3CPW A;  4B3T Q;  1OXV A;  1JT8 A;  1B3Q A;  4FP5 D;  3K59 A;  1VQN A;  1AE2 A;  2PI2 A;  3M7G A;  3NEM A;  4A3F G;  2KEC A;  3J81 E;  1B2T A;  2E2J H;  3LWU A;  3HGB A;  1JCK B;  2O2L D;  1RKN A;  2NN6 I;  4GOP B;  5AJ3 L;  3E9H A;  1L0X B;  2F0H A;  4MNO A;  4V0B A;  4C1N K;  4JI1 Q;  1EOV A;  3MXN A;  1WTV A;  1CI3 M;  3P20 A;  3M3Y H;  1TWF H;  1UWV A;  3MEF A;  4DFA A;  4ODG A;  1PH4 A;  5HY6 A;  2R92 H;  1EU3 A;  3KLS X;  3DEP A;  3NP8 A;  5CMD A;  1EWI A;  1UE5 A;  3SHL A;  1VQB A;  4ME5 A;  4OEM B;  5C0X G;  1DGS A;  1SAP A;  1XPU A;  3K7U C;  1CFM A;  1SNC A;  1XPO A;  5KYI A;  5EGT A;  2R61 A;  2LKV A;  3OPO A;  1R9T H;  2Y0S E;  1QWY A;  4HIO A;  2E2H B;  3MTS A;  3PUX A;  5M5W B;  4XIG S;  5J22 A;  1Q81 C;  2G9D A;  4MZ9 A;  4JI2 L;  1F9P A;  2F0U A;  1E7Z A;  4G57 A;  4KN7 C;  1NR4 A;  1A63 A;  4C3I B;  2IX0 A;  1FNW A;  4K8J A;  2F0G A;  2UUC L;  4LF4 L;  3VR5 A;  2JA7 B;  4P71 A;  1Z47 A;  2WB1 B;  3T53 B;  5IGE A;  1G29 1;  4ALP A;  3NTI A;  1XXG A;  2EYF A;  3VR2 A;  4CKE A;  3S1R B;  2CW0 C;  3QJY A;  1A3U A;  1E22 A;  3TP5 A;  5BN3 A;  3JAM c;  5C0X J;  3J7A V;  4WJ3 M;  4AYB G;  1LT4 D;  1G91 A;  5DM7 3;  5M5X B;  4XQQ A;  1SMY D;  1P8L A;  3U50 C;  4FYD A;  2PZW A;  4O2D A;  3M7N A;  2AUK A;  3HOV G;  4LF6 L;  2Z6B A;  1KAB A;  3NK9 A;  2RHS B;  2JK8 A;  3SK4 A;  1BOS A;  5GAE C;  1NMG A;  1SLJ A;  1NE3 A;  5IGD A;  3PO2 G;  1X55 A;  3OWF A;  5CV9 A;  1C4Q A;  1Q12 A;  2F0O A;  3H09 A;  4C3J H;  5CGK A;  5C44 G;  4C3I H;  2PW7 A;  1RDP D;  1YJ9 A;  1G6Z A;  3RLN A;  1NCV A;  1CSQ A;  3I91 A;  3X3N A;  5FLM G;  2DNE A;  3QIA A;  1KRT A;  2RQX A;  3A54 A;  5H1S E;  4JI0 L;  4O1N A;  3TP7 A;  1LM0 A;  3R8B A;  1YBY A;  4DAY A;  4DR7 L;  3H91 A;  4NXN L;  5FO7 B;  4U67 3;  2LXJ A;  4IPH A;  2QCP X;  1YNX A;  1I6V C;  1FNV A;  1FNU A;  5FOB B;  2DJG C;  3WOF A;  3KOJ A;  5ELN A;  1EZ8 A;  1R9T B;  5K36 H;  1UEB A;  1CA5 A;  3NQI A;  4JI8 Q;  2YTY A;  2RCN A;  3SGI A;  1JWM D;  3C2P A;  1CUK A;  3IFT A;  1YHQ A;  2WKC A;  1PTO F;  1LTT D;  1I3Q H;  2ALY B;  4GN3 B;  4PZ8 A;  4DV2 Q;  1SEB D;  4QUF A;  2N49 A;  4NW2 A;  2PMZ B;  3TBI B;  1LTS D;  2PMZ E;  2F3I A;  2HQE A;  4RGN A;  5EBC A;  1EIH A;  5JPM C;  3MFG A;  4JCV E;  2B39 A;  2RCF A;  3OIP A;  1RTN A;  1SE3 A;  1WCM H;  3CU7 A;  3MFY A;  4A3M B;  4DR2 L;  1BQQ T;  3D4R A;  4CDC C;  5IP7 G;  3RNU A;  4KD3 A;  5CYU A;  4LF9 Q;  2VUM G;  1K8G A;  4C3J B;  1T9H A;  3CRL C;  1N33 L;  1F9Q A;  4CJ1 B;  1VQO A;  2PQE A;  1YZ6 A;  2ZTC A;  1VQ6 A;  5CBA E;  4HJ7 A;  5IT9 c;  4CJ0 B;  2ENB A;  2NVY H;  3K58 A;  3W5O A;  4DV5 L;  3PSI A;  2K32 A;  3N52 A;  5KNB A;  4K5V A;  3A56 A;  3R93 A;  1TS5 A;  5G3L D;  3G6E A;  2KOL A;  4X66 L;  3FVQ A;  3AEV A;  2GN5 A;  5T1G A;  2QA4 A;  3TS0 A;  3K5O A;  3PF5 A;  1HR0 Q;  4POG A;  1LLR D;  4PNY A;  1YNJ C;  2N55 A;  1PHJ A;  1U9R A;  2RDH A;  3T1H L;  1C0A A;  1MGS A;  1YHA A;  4IUN A;  3VYR A;  4IFD I;  5IIF A;  4WOR A;  1Q86 C;  2F0E A;  4K2L A;  2B63 B;  1B9N A;  3IL8 A;  3MXG A;  4BBS H;  1KDB A;  3QB3 A;  3RD4 A;  2BH8 A;  3GTP H;  3H3V C;  2F0F A;  4FF2 A;  4IFD G;  1SE4 A;  4DR6 L;  3Q22 A;  2WIN B;  1E1T A;  3S2H B;  1V43 A;  2PQA A;  2R93 B;  3DM3 A;  1WD1 A;  2D9U A;  1I5F A;  5CV4 A;  1VCI A;  2A6H C;  5FJ8 G;  4IPC A;  2E2D C;  2UU9 L;  2L12 A;  3ULP A;  3HEJ A;  1BF4 A;  1JB7 A;  3I8Z A;  4GKJ L;  5M3F H;  1II3 A;  1DD2 A;  4JOI A;  1D8L A;  3I73 A;  1SFO B;  2VW9 A;  3F2C A;  3D4D A;  4JI6 L;  1B4O A;  2AWO A;  5K36 G;  3PUV A;  1EQV A;  2NZH A;  3MC0 B;  3PUW A;  2WP8 J;  3K5M A;  4QJF A;  2F0K A;  4PMB A;  1LTB D;  4DGZ A;  1VQM A;  2ICI A;  2FIN B;  5J3B A;  5COY A;  1XMO Q;  1PH3 A;  4JPB W;  1FJG Q;  3H0G B;  2EVB A;  4PZ7 A;  2K4K A;  4K8I A;  4HJ9 A;  2SEB D;  2L9H A;  2AUJ D;  1KNE A;  2GVB A;  3EN2 A;  4K5X A;  4YHH Q;  3M3Y B;  2L15 A;  4C3I G;  3SDZ A;  2OTJ A;  4X3T A;  3S2H H;  4OO1 I;  4TVA B;  3NQT A;  4F88 A;  2OWO A;  1TWA H;  1UAP A;  4WRD A;  4N8X 1;  3URY A;  4BBS B;  5IOD A;  1F2M A;  3AFP A;  1S72 A;  2K5D A;  4DK0 A;  3STB D;  1A8V A;  2Z4H A;  2HIV A;  1S4Z A;  3HG9 A;  3P75 A;  5CV7 A;  1IBK L;  3CCJ A;  4JI8 L;  1TWG H;  1RTO A;  4YWL A;  1PFS A;  3D31 A;  2M9V A;  1E24 A;  2IL8 A;  1SYC A;  5C4J B;  3CC4 A;  4UP9 A;  3UE0 A;  5IY0 A;  3CCL A;  4B3M Q;  3J7A 5;  4ZUJ A;  3G7L A;  1HCZ A;  1A62 A;  2AWN A;  2K5H A;  2LS0 1;  1GKH A;  1MIU A;  5ISR A;  2C9O A;  5LMU Q;  1MJE A;  1HZ9 A;  2AQ3 B;  3J80 L;  2KCC A;  3TEH B;  3B6Y A;  3FMC A;  4H7B A;  4G7H C;  1QUQ B;  3CP0 A;  1XNR L;  4IOC A;  3K0Y A;  3Q6S A;  2MP1 A;  3BDO A;  4PMW A;  1BBU A;  1MSH A;  1CQF A;  4I65 A;  1MHW C;  1JMC A;  2K03 A;  2VQE L;  3GO5 A;  4DV1 Q;  1E2V A;  3SK6 A;  1PTO H;  4GS3 A;  2NN6 G;  3NWS A;  1PTO B;  2KVM A;  1AH9 A;  1RD9 D;  2Z6K A;  1EYG A;  2KEN A;  2QIL A;  1JR0 D;  5IYD G;  2BA1 A;  1PH6 A;  3QG1 A;  1HUM A;  4X65 L;  3CXC A;  3ERQ A;  2CH4 A;  2HQL A;  1K9M C;  2MO1 A;  5DLQ E;  1Q82 C;  1STA A;  2E5L L;  1XMO L;  1W2B A;  1HFG A;  1PVO A;  4GNX C;  1YVC A;  1J5E L;  2HDL A;  3BYY B;  1X3G A;  2LFN A;  1I4Q A;  4M8A A;  1N33 Q;  4QB4 A;  2M00 A;  2G9H D;  4DF7 A;  4OO1 H;  2AQ2 B;  3J80 E;  5KRU A;  2B63 H;  5EPK A;  3SK5 A;  1AEX A;  1AN8 A;  2HHH L;  1JIC A;  5ELO A;  1VQP A;  2JA7 H;  5IGC A;  1HQM C;  1FD7 D;  5LMU L;  3GTP B;  2B2Y A;  4Y52 H;  4DUZ L;  4GN5 A;  3ZJY C;  1I6H H;  4XQN A;  2PZU A;  3NE5 B;  3T56 B;  1OXT A;  3R3O A;  3CME A;  1SE8 A;  4NXM L;  2A6E D;  4RG1 A;  1XNQ Q;  2QDB A;  2MPM A;  4RGM A;  1Y1V B;  3K7A B;  4A3B G;  3I72 A;  3PUZ A;  2QKI C;  1JE5 A;  2Q2I A;  1N8R C;  1EQR A;  3PMF A;  4LF7 Q;  3RZO H;  1I4P A;  3ULJ A;  1PFM A;  3PGZ A;  1A3T A;  2NVQ B;  3ND8 A;  4G7O C;  2R92 B;  1LYL A;  2A69 C;  1BUV T;  4JV5 Q;  2K01 A;  5HUR A;  1PA6 A;  2B2U A;  1NUC A;  3GTM H;  3AQQ A;  3TZU A;  1HUN A;  5I9O A;  1PRT B;  2XRS D;  4GN4 B;  2FJ2 A;  4KY5 A;  4A3M H;  2IX1 A;  3NBI A;  3ULL A;  1PYW D;  4HR7 B;  3CCV A;  5D14 A;  2E2H H;  3I4N B;  2XVS A;  1K3B C;  4HSP A;  2EYH A;  1ET9 A;  1WTP A;  3HS0 C;  3PQI A;  4DV5 Q;  2UUB Q;  4A3C H;  4DN4 M;  2IPK D;  3S1N H;  2B3G A;  4KHV A;  3DLL A;  4BY7 G;  1G8Z D;  3CD6 A;  1KC8 C;  2EXZ A;  2VS1 A;  5M3F G;  1H9J A;  3FDT A;  4A3B H;  4NKL A;  2UXB Q;  2R93 H;  1IXR A;  1HNZ L;  2R7D A;  5ELC A;  1ZEQ X;  4NMZ A;  1Z9F A;  3ONA B;  1L0W A;  3VYT A;  1OTC A;  1F2L A;  3HRZ C;  2DUD A;  2Y0S B;  2D0P A;  1VQE A;  5M3F B;  4LF8 Q;  5A2Q E;  2IHF A;  5C0X I;  2F03 A;  4BBR H;  2EJM A;  3OYY A;  4HCE A;  3GTM B;  4OHJ A;  2KBN A;  4FDB A;  1P16 A;  2PW5 A;  4CDF C;  3CCQ A;  4A3J G;  1Q1B A;  2IT1 A;  1JJC B;  1XX8 A;  4A3G H;  3P7J A;  2ICE C;  1STN A;  1PTO C;  3BVG A;  4N9P A;  2OT2 A;  2QGQ A;  1KIX A;  2KJX A;  3S2D H;  4DR6 Q;  5F2D A;  1EIF A;  5EPJ A;  3S1R H;  1C8C A;  2JQO A;  2YTV A;  4XXE A;  1KDC A;  1YNN C;  4B3R L;  1SND A;  2G5D A;  3S15 H;  1Q1E A;  5K5P A;  3J7Y W;  1H9M A;  1HQR D;  2Q8R E;  3T51 B;  3MAQ A;  1HRJ A;  2SNM A;  2NVX B;  4O0A A;  5IGB A;  4UY8 C;  2Z0S A;  4KI0 A;  4DAV A;  1LT6 D;  1K8M A;  4HIK A;  2OQ0 A;  3PIO A;  5GQO A;  1C7Y A;  5C0X H;  1EYD A;  2B2W A;  2MGS A;  2XSC A;  5EBD A;  1B7Y B;  2Q8T A;  5KIX A;  2ATW A;  1Y1W G;  5DM6 3;  3AB9 A;  4R9W A;  2A73 B;  4X64 L;  2QDL A;  4K0K L;  1BDO A;  1O7Y A;  4CDE C;  1WTO A;  2B2U C;  1X54 A;  3NWT A;  2VUM H;  4BBR B;  4DV4 Q;  1KHI A;  4OIJ A;  4Y7N B;  3NEN A;  1VF7 A;  1KL9 A;  4WFN 3;  5EKK A;  2B2T A;  4I7Z C;  1Y8O B;  3UDF A;  1D5Z C;  1HA6 A;  3GTO H;  2KHJ A;  1B44 D;  4JC0 A;  3RUZ A;  1JOO A;  2HCI A;  3PV0 A;  1DON A;  1TXY A;  4L5R C;  1QZH A;  5JJL A;  4LF7 L;  1SNM A;  2EJF C;  4LF4 Q;  5FKA C;  4X62 L;  1N34 L;  3CCM A;  2ZJP A;  1KTK A;  2MUY A;  1U5K A;  5EKI A;  3G6J B;  3M4O H;  5I6W A;  4L5S A;  2F0L A;  2FMC A;  2OXP A;  2F0N A;  2JEB I;  5JEA H;  4UDU C;  3M4Q A;  4DAP A;  4A3L H;  1QNU A;  5ELD A;  3I4N G;  1WD0 A;  2Z8L A;  1XTD A;  2F52 A;  3I4L A;  2NVX H;  1X56 A;  2VB3 X;  2EIF A;  2IHE A;  3K5N A;  2LMC B;  2J0T D;  4JOI C;  4DV6 Q;  1Y8P B;  4GLX A;  1EQT A;  3ND9 A;  2B2T C;  3J7A F;  3T13 A;  4IUP A;  3A0J A;  1QJO A;  2OF1 A;  1C48 A;  1L1O C;  1V8Q A;  3GTK B;  1BBW A;  2XWJ B;  4QIW E;  2KHI A;  3TME A;  5DEH A;  1NSN S;  1EOT A;  3S1N B;  1B9M A;  3HOZ G;  4BY1 B;  1KAA A;  4DV7 L;  3IKJ A;  1J8I A;  1BR9 A;  3CPF A;  4C2M B;  1I6H B;  4JI1 L;  2X69 A;  1N36 Q;  1ZKO A;  3PUY A;  1K3R A;  1TVX A;  4A76 A;  3KF6 B;  1S40 A;  5IP9 G;  1M4V A;  4DR3 Q;  2EYP A;  1X9N A;  4UP8 A;  1V1Q A;  3M4Y A;  1VQK A;  4X6A H;  2VQE Q;  2B2Y C;  1LTL A;  1KLG D;  1S5B D;  4IFD H;  1GOZ A;  4HN7 A;  2FHT A;  1IZ6 A;  1SMY C;  2HHH Q;  3S16 H;  2EPB A;  4A3J B;  2HD3 A;  3S16 B;  1FVI A;  1O7I A;  1VQA A;  3HP3 A;  2Q8I B;  1JWS D;  4DXG A;  1X3F A;  1I3Q B;  2NVQ H;  4U68 A;  1TKW B;  1EIY B;  2B2W C;  2E76 C;  4P72 A;  2CFM A;  4HJ8 A;  3AU7 A;  1U4P A;  4IFD J;  1CHP D;  4X3S A;  1WTH A;  2ZXP A;  3TRZ A;  2B2V C;  1R4Q B;  1Y14 B;  1ONL A;  4KKU A;  1DOM A;  4LF8 L;  2ZXR A;  2PI2 E;  3S1M B;  1D1I A;  3BS1 A;  1XPR A;  1A2T A;  2B8G A;  4PQX A;  1HH2 P;  2QW7 A;  4R1J A;  3KF8 B;  4BXX G;  4FXK C;  2EDG A;  3OW2 A;  2ZTD A;  5C4X G;  1GXD C;  1SYE A;  2WKD A;  1ASY A;  4FF1 A;  3CRK C;  5I4D A;  3FP9 A;  3GTQ B;  2IW3 A;  1WTR A;  3S9W A;  2UUA L;  2K6A A;  1AW7 A;  1STH A;  2EOT A;  3KK7 A;  1IKM A;  4HMJ A;  2F0I A;  5EAY A;  2K5V A;  3I4O A;  2HIX A;  3PO3 H;  1JOR A;  4ZK9 B;  2K28 A;  4NDX A;  4IPD A;  1I94 L;  4A3L G;  4CKC A;  4OXP A;  5C6A A;  1WYD A;  1VQ9 A;  1EEI D;  4GNX B;  1X32 A;  4DKA C;  1G2S A;  3NPP A;  4DU9 A;  1JOK A;  3KBX A;  1QNK A;  1TWC B;  4IJH A;  1SDF A;  2RSO A;  2TSS A;  4JI5 Q;  4RKB A;  1VQ7 A;  2H4O A;  5KND A;  1IW7 D;  3PO3 G;  1JOQ A;  1NY4 A;  3HOY H;  4OL7 A;  3VR3 A;  1TWH H;  3HOY B;  1AP0 A;  3TP6 A;  3S1Q B;  2BE5 C;  4A3I G;  2D62 A;  1RCV D;  4A3D G;  4F8M A;  1ZYR C;  1W6J A;  2B8F A;  4HMI A;  1FR3 A;  1ROD A;  1YIT A;  5C4X B;  2XIW A;  1DYQ A;  4JI3 L;  2VQF L;  2M2L A;  1B8A A;  3BVZ A;  1GUG A;  4Q0F A;  4RGT A;  2KCN A;  4TKO B;  1EY7 A;  4LUZ A;  2YYZ A;  3DHQ A;  2L5T A;  2JXM B;  2ZM6 Q;  1KD1 C;  1TY2 A;  1WCM G;  1K0R A;  1DZ1 A;  2ZJQ A;  4A3G B;  3A8J E;  2VY3 A;  4XYO A;  2SOB A;  5M5Y B;  1CQV A;  3H0G H;  4DV6 L;  4ZYS A;  4ZLT F;  3ERS X;  3NBH B;  3TSS A;  2QEX A;  3J81 j;  1TQO A;  1N9W A;  3KLS A;  3HOU B;  2JSO A;  1ENC A;  3T4A C;  2IX3 A;  2Q2U A;  5A35 A;  1G2T A;  4IUT A;  2BOS A;  1KAW A;  1NAP A;  3ICE A;  4QL5 A;  4HAE A;  2OCE A;  5CV6 A;  4ZUI A;  4JI5 L;  4EVO A;  4XQJ A;  3U9S A;  4K0K Q;  3VR4 A;  4A3J H;  1D5M C;  4X3U A;  1GD7 A;  4GOP A;  1WVL A;  2BDN A;  2Z4I A;  4P73 A;  5C5L A;  3R2T A;  2F0W A;  1DXM A;  4KLK A;  4NPS A;  1B1Z A;  2F0P A;  5C3W A;  2N88 A;  5C44 H;  3JAM E;  1Y8N B;  4X66 Q;  3IAY A;  2AKW B;  1HZA A;  1O7Z A;  2A8V A;  4IZ8 A;  2RBM A;  1ET6 A;  3LWE A;  3CAM A;  5T1I A;  3Q0A A;  2KUM A;  3OWE B;  2JN4 A;  3OIQ A;  2E8G A;  5KGU A;  1HR0 W;  2WAQ E;  1IW7 C;  2CHB D;  3S17 H;  4DV1 L;  2RHQ B;  4A3E B;  3G48 A;  1IBM L;  2A69 D;  1HJP A;  5I9P A;  5J39 A;  1GUW A;  1PH2 A;  4R4T A;  3A5U A;  3UDG A;  4IAL A;  2F0D A;  1VMP A;  1H9R A;  4BY1 H;  3HOU G;  2EY6 A;  4IQZ A;  2K50 A;  2ZM6 L;  5I2Y A;  4JBM A;  4KHP L;  3J80 i;  4C1N I;  2R7Z G;  2JYO A;  5EPL A;  4RKL A;  3GDE A;  3TN2 A;  4RA8 A;  2MJ8 A;  4A3I H;  4KTA A;  3J81 i;  2E75 C;  4A3F H;  1LTR D;  2FMM A;  4LUV A;  2TMP A;  4YCU A;  2F4I A;  5M5W H;  3VR6 A;  4KHZ A;  4CHT B;  3I4N H;  3BJU A;  5JVG 3;  4B08 A;  3VDY A;  1OO9 B;  5IYC G;  2L11 A;  4F7X A;  2OQK A;  2AQ1 B;  5BN4 A;  3RN5 A;  1BBX C;  1PYS B;  2R3Z A;  1XYI A;  1LV9 A;  1SBB B;  2CW0 D;  2Z1C A;  2C5C A;  2ZT9 C;  1GHK A;  4WJW A;  1V9P A;  5IYC H;  4PV1 C;  1GUN A;  1Z6H A;  3BDL A;  3CQZ B;  1PMR A;  4LJZ C;  4JI0 Q;  2NVT H;  2MFI A;  1VQH A;  4B9X A;  2NVT B;  1SYF A;  1HHV A;  3OHX C;  1Y1V G;  3FEW X;  1BCP F;  2BDO A;  3KBG A;  1WTQ A;  4LFC L;  2A1A A;  3NSW A;  4JI2 Q;  4KJN A;  1MBY A;  4ILW A;  3U9O A;  4DXF A;  4S3S A;  3A7L A;  5FLX c;  3BZD B;  1B50 A;  1A0I A;  4QMG A;  4LF5 L;  2SNS A;  4C3H H;  3SEB A;  4WJ4 A;  4B3S L;  1GVP A;  3KJO A;  2XRQ D;  4LAA A;  3U4Z A;  1JE4 A;  3CCE A;  2JA8 H;  1XNR Q;  4JYA L;  5J1Z A;  3BYT B;  4A3F B;  1W3S A;  1CKN A;  3K80 C;  1LO5 D;  3J80 c;  3KFU A;  4JV5 L;  5E4W C;  1HZC A;  4HSV A;  1SR3 A;  5EJW A;  2GVA A;  5GAG C;  1XMQ L;  1MI2 A;  5CV8 A;  4KY7 A;  4GLA C;  4P75 A;  4XT1 B;  4GKK Q;  4EQN A;  3QOL A;  4JBK A;  2UU9 Q;  3F2U A;  2PNH A;  5C3E B;  1E1O A;  2YV5 A;  4KKT A;  3NEL A;  1JB3 A;  5JAV A;  3I4M B;  1SNO A;  1SYD A;  3C1E A;  1Y1W B;  2YTX A;  4V19 0;  2K5W A;  3OTO Q;  3CF5 A;  1ML0 D;  2AHO B;  2I5H A;  1F2Y A;  1VQC A;  3HKZ E;  1RL2 A;  2D0O A;  4DV3 Q;  4R4O A;  3RZD B;  2PO4 A;  4NXM Q;  2Z6K C;  3GD7 A;  1QOH A;  2R6G A;  3Q23 A;  1DOK A;  4GNX A;  3BU2 A;  1CM9 A;  2KEE A;  4IOA A;  3OSO A;  1CTM A;  3K6O A;  4IUQ A;  4XT3 B;  4QY7 A;  4B3M L;  1CSP A;  3GTO B;  1K73 C;  4IN3 A;  3S1M H;  5CV5 A;  2JJQ A;  1ICW A;  1J5E Q;  1HR0 L;  1ESF A;  4DNR B;  2LXK A;  2KHS A;  1YHB A;  3T1Y Q;  3TS2 A;  1EY9 A;  1IBL L;  5COR A;  2EYM A;  4YHH L;  1K83 H;  2I46 A;  4A93 H;  5LL6 S;  1PFB A;  5ELE A;  1IYJ B;  4XTC S;  2YU9 H;  2VB2 X;  3AYH B;  4FNF A;  1SE2 A;  5JEA G;  1PRT C;  3W1G A;  4IO9 A;  1IBM Q;  4AYB B;  1WTX A;  4JI6 Q;  4A3I B;  2RVL A;  1D2B A;  3FPP A;  1V1O A;  5A2Q L;  4A3D H;  4BWG B;  2H1E A;  3MXP A;  1I50 H;  3NTK A;  1NTG A;  3RZD H;  2PQA B;  3OMG A;  2LSS A;  4LNQ A;  3OMC A;  3KF6 A;  1A2U A;  2EJG C;  4JG2 A;  5C5M A;  5E7N A;  4A3K H;  4LF6 Q;  2BA0 A;  1UE7 A;  1V1P B;  4GKK L;  1IHZ A;  2IJ0 A;  4R4I A;  3HZX A;  3F2D A;  3E6Z X;  1NJI C;  2JA8 G;  1C9O A;  3NBH A;  1U4M A;  2BCO A;  3NHH A;  4QIW B;  1Q8K A;  1TWC H;  1E2Z A;  4L5Q A;  1WOC A;  2E2I H;  3RLF A;  4I7A A;  2E2I B;  1FYC A;  5D3I B;  1AE3 A;  1KNA A;  1I4X A;  3WDN A;  3I4M H;  4ID6 A;  2K7V A;  3S2D B;  4AQY L;  3VA5 A;  4R8N A;  4BA1 I;  1CKN B;  1Y1W H;  4Q5V A;  1RF2 D;  1SNP A;  1Y1V H;  1ILP A;  1L1O A;  2I0Q A;  3AMU A;  2F3W A;  2UUC Q;  2EY1 A;  2YU9 B;  2K05 A;  4POF A;  1D6E C;  1K8O A;  3RZO B;  1BVS A;  4KMU C;  1SJH D;  1Q46 A;  1ILQ A;  2K14 A;  3DWA A;  2JA7 G;  3GV3 A;  3L7Z C;  3W1B A;  1K28 A;  1PDQ A;  5IT9 E;  1AZP A;  3VYS A;  3KF8 A;  2ID0 A;  4DUY L;  1TY0 A;  1XMQ Q;  4MIU A;  3TDQ A;  3OOC A;  1VS0 A;  4FXD A;  4OON A;  4C3H B;  4FO2 A;  2NN6 H;  1QVG A;  2EE1 A;  1KDA A;  1EY4 A;  4BXX H;  2F0V A;  1HXY D;  4OWT B;  2KCM A;  5CC4 A;  3RN2 A;  4OWX B;  3MWY W;  5C3E G;  3CCR A;  2L1B A;  1CT1 D;  2EY5 A;  4Z9C B;  1PLF A;  4B3R Q;  2F4V Q;  4N8F A;  2GA4 B;  1EZ6 A;  3PCO B;  2MO0 A;  1KLU D;  4JI3 Q;  1UNS A;  4L8J A;  3D8G A;  2VXW A;  1K83 B;  4PMC A;  2I5M X;  3HOX G;  2R7F A;  2R7Z H;  4K14 A;  5AJ3 Q;  2B29 A;  3HOU H;  3EIV A;  4F87 A;  4A3B B;  3K0X A;  2L0C A;  2UUA Q;  3S14 B;  1FL0 A;  1QG7 A;  2VQF Q;  1Q7Y C;  5IT9 L;  1SNQ A;  3J7Z C;  3I55 A;  5L37 A;  3SE0 A;  4DV0 L;  5IWA Q;  1N32 L;  2EYL A;  4HED A;  2IY5 B;  1H9K A;  3LX0 A;  2XWB B;  4ZAI A;  1OXS C;  2NZ1 D;  2A19 A;  3NUC A;  1J6Q A;  5C4J H;  2DJF C;  1O78 A;  1X3Q A;  3IFD A;  1B70 B;  4LK1 C;  4E6I A;  1DCZ A;  2PCF B;  3FKI B;  1LT5 D;  2N8N A;  3A8I E;  2RKS A;  1EL0 A;  1I4G A;  2K5N A;  4MTK A;  3KLR A;  3F2B A;  3EJI A;  4JBW A;  5IYB H;  3KLW A;  2KQ3 A;  3M9B A;  1VQ8 A;  5JVH 3;  3KDF A;  1MKH A;  3M85 A;  2F0T A;  4DR5 L;  3H0G G;  1STB A;  1SRU A;  4H44 C;  3NXW A;  3QO2 A;  4DV4 L;  1YIJ A;  1TWH B;  2WB1 G;  1S3O A;  1DOL A;  1TU2 B;  1STG A;  3LNN A;  3QR8 A;  5FO9 B;  1I4H A;  3TP8 A;  3E9I A;  1JQY D;  4QGU A;  4DR7 Q;  4BBS G;  4JYA Q;  1PH5 A;  4A3E H;  5FLM H;  1EY5 A;  4OEL B;  1GO3 E;  1IBL Q;  3KUP A;  3BDC A;  3PF4 A;  2NWG A;  3QWN A;  4RHR A;  3J81 L;  5I2X A;  1K0S A;  4A3D B;  4L6T B;  1UE1 A;  1L1O B;  1EYC A;  1NBW A;  3HKS A;  1SN8 A;  4J1M A;  4DR1 L;  1PFN A;  4TSS A;  4DPG A;  3JAM i;  1JJ2 A;  4A3K B;  3U4V A;  3R2I A;  4R4C A;  4RCN A;  4B3T L;  3JAM L;  5JJZ A;  2MHV A;  1A15 A;  2XN9 C;  1W6K A;  1VDZ A;  1SSO A;  1CA6 A;  4Y7N H;  1WTW A;  4HIM A;  2K1B A;  2CQA A;  1VQF A;  2A74 C;  1HNW Q;  4DR5 Q;  3HOW G;  1F2Z A;  3H3V H;  3CQZ H;  4RFB A;  4YIJ A;  3T1H Q;  1T5E A;  2BE5 D;  5IGG A;  4KKS A;  3GP7 A;  3I2Z A;  2J4X A;  2E5L Q;  4EX5 A;  2OTL A;  1F77 A;  2CKZ B;  2O5J C;  1PRT F;  2DN8 A;  3ITP A;  3A5Z B;  3K8A A;  2K75 A;  3HKZ B;  5ELF A;  1JJG A;  3E0E A;  3M4O B;  2F0J A;  4A75 A;  4FF4 A;  1LTI D;  4ZKB B;  4NXN Q;  5GRO A;  3CHB D;  5IYD H;  3BG3 A;  5JJK A;  1EQQ A;  2RSN A;  3DUZ A;  3GTQ H;  4CBV A;  3GTJ H;  4CKB A;  5C4X H;  1IBK Q;  4FXG C;  1Z7T A;  2A6H D;  3TRE A;  1YJN A;  3HOZ B;  4R8I A;  4HJ5 A;  1YNN D;  3H3V I;  4KJO A;  4YWM A;  4BA2 I;  4A3E G;  4IUV A;  1OXX K;  1CKO A;  5FLX E;  3W2D A;  3CC7 A;  4RGO S;  5IP7 H;  4JK1 C;  2WAQ B;  2BH2 A;  1QUQ A;  1LUZ A;  3MHB A;  3E3X A;  3GTK H;  4JI7 L;  3A74 A;  2KA7 A;  3V05 A;  2EY2 A;  3VA7 A;  1S5D D;  2ZXO A;  4RAU C;  3G4S A;  4JI7 Q;  4DV2 L;  3DWP A;  3RMH A;  1EIG A;  1M1K C;  4O42 A;  4BY1 G;  5IOC A;  1PZK D;  1EWC A;  4X3K A;  4B3S Q;  4OWW B;  3HOW H;  2O4X A;  2X6L A;  3FPU B;  3MEH A;  1VQI A;  4CJ2 C;  4FF3 A;  1SRO A;  3K57 A;  4A93 G;  1STY A;  1YNJ D;  1VQ5 A;  2UXC L;  1X3P A;  4N9T A;  4J8Q A;  5LL6 X;  1TII D;  1Q90 A;  1M8A A;  5IE8 A;  1PH9 A;  2ES2 A;  5DAU A;  3GTG H;  2K52 A;  5BR8 Q;  5IP9 H;  5GAD C;  1V1P A;  1IKL A;  1HNX L;  4H0L C;  1YEZ A;  3MZ5 A;  3WWV A;  2NB0 A;  2X6G A;  2QF7 A;  4XYQ A;  4QCL A;  1HFN A;  3BZK A;  1HNX Q;  5E1F A;  2F3V A;  4BY7 B;  2B2V A;  2I5L X;  3HOZ H;  1CZW A;  1E3P A;  3UI2 A;  5FLX L;  1PV4 A;  1BNZ A;  3K7A H;  1VF5 C;  3HOX B;  4JI4 L;  4DNI A;  2WFW A;  1SFO H;  1HZB A;  2EQS A;  3C1F A;  1FGB D;  1S5E D;  4QQB X;  2OEO A;  2Y0S G;  4DV7 Q;  1X65 A;  1HNZ Q;  4PZ6 A;  1N36 L;  1EU4 A;  4UP7 A;  5KNC A;  2CH4 W;  3PO2 B;  2N78 A;  2F1M A;  3A7A B;  3PO2 H;  4DK1 A;  1EEF D;  2CWP A;  2CCZ A;  1VQG A;  4M1U B;  3MXN B;  4AIM A;  1AZQ A;  1B3A A;  4DR4 L;  3HOV H;  1Q3L A;  3I3C A;  2ZJR A;  1LT3 D;  1UEA B;  4B9W A;  4DR4 Q;  4DR3 L;  4R4Q A;  3M4P A;  1IYU A;  3L2P A;  4C56 C;  2UXD L;  3EQL C;  3Q8D A;  4HCS A;  3N6R A;  1CKM A;  1X3E A;  4LF5 Q;  4K6L A;  5JEA J;  2RDG A;  2F4V L;  3CC2 A;  1WJJ A;  1EFI D;  3GTL B;  1A6X A;  2IWH A;  5E3F A;  4EQP A;  2HUG A;  3AFQ A;  4LFB L;  4C3H G;  1QVF A;  1RJT A;  3D4W A;  1NNX A;  2L55 A;  3L3O C;  4JI4 Q;  4MTN A;  1J9O A;  2PYK A;  4ZRZ A;  4YCW A;  1IYV A;  3HKZ G;  1UUP A;  1JC7 A;  1U4L A;  5LHY 1;  3EA6 A;  2QEJ C;  4YY3 L;  2CQO A;  3S14 H;  1GUS A;  1TR5 A;  1LTG D;  1PRT D;  1HTL D;  5D65 A;  2RDF A;  3CCS A;  3MXU A;  3S17 B;  4QF4 A;  5M3M G;  3CW2 C;  3DEO A;  3HOY G;  1QCB D;  1RIP A;  1WCM B;  3I4M G;  1SYG A;  1QIL A;  1VQJ A;  4A3K G;  1WFQ A;  4OX9 L;  1AFP A;  1FGU A;  3HOV B;  1LAC A;  4CDD C;  1PYB A;  1VMC A;  3FKI H;  4EGV A;  1QB5 D;  3FHW A;  5M3M B;  2O5I C;  4DA2 A;  2V4D A;  4LFA L;  4BS9 A;  3UDI A;  3PIP 3;  2F0M A;  3I56 A;  5KEE A;  4MN3 A;  1EY6 A;  1CZG A;  4DNT B;  4J6H A;  3V96 A;  1XTC D;  1SYB A;  3EBE A;  3S15 B;  5GAH C;  5HGT A;  1BCP D;  4K2K A;  3UDX A;  4KK7 A;  3J81 c;  3H6M A;  3VYU A;  1KQS A;  4A3G G;  4KHP Q;  4K5W A;  2WAC A;  3F8T A;  2HT1 A;  1B53 A;  3JC6 6;  2MNA A;  3H15 A;  2L4N A;  4ME3 A;  4MHE A;  2R92 G;  3L0O A;  2R7Z B;  5CR3 A;  1G51 A;  4A93 B;  3U58 A;  1UE6 A;  5FO8 B;  2JE6 I;  3SVM A;  3WOE A;  4TRD A;  3HOW B;  4GKJ Q;  4AYB E;  3DMU A;  3SR1 A;  4RCO A;  4ZKC B;  4GLV B;  4FVM A;  4OIK A;  4DK6 C;  1D5X C;  1I4R A;  3E5S A;  4UHV A;  1S5C D;  3EVQ A;  5ELB A;  5LMN W;  1ZXT A;  2JP1 A;  1XNQ L;  5E4X A;  4LW1 A;  2VUM B;  2JA5 G;  4XDX A;  3DXJ C;  3BVM A;  3IRB A;  2R93 G;  1L0Y B;  4L63 B;  4HJA A;  2DNC A;  4G4K A;  4BY7 H;  4J15 A;  2XNA C;  3DM1 A;  5EKL A;  4H02 A;  1BCP C;  5C44 B;  1SXT A;  4A3C G;  2JA6 B;  3G71 A;  2A6E C;  4ULL A;  2JA6 H;  1TWF B;  3TZD A;  3TQY A;  3D3R A;  2JA8 B;  4KN4 C;  3ZYY X;  1EFW A;  4AQY Q;  2EZV A;  2K04 A;  1ZYR D;  3D6W A;  2UXB L;  4C3J G;  4KD4 A;  2NVY B;  3ERO A;  1PH7 A;  1MD2 D;  5M5X H;  1I94 Q;  3K5L A;  1EUJ A;  3HFZ B;  5C3E H;  1KRS A;  2SDF A;  1NR2 A;  1U4R A;  5LMN Q;  2JA5 H;  2N3S A;  2CWA A;  1LTA D;  2HCC A;  3SK8 A;  3E0J A;  4YWK A;  5IYB G;  4EQ5 A;  1GM5 A;  1TS4 A;  3ER0 A;  3T16 A;  1TT2 A;  4P74 A;  5NUC A;  4DUZ Q;  3PO3 B;  3GTG B;  2WB1 E;  5KYL A;  4A3M G;  2DY7 A;  1F9S A;  4IUU A;  4LFC Q;  4G7Z C;  1NMF A;  4LF9 L;  1XJV A;  2PNR C;  1A3V A;  4NP5 A;  2WV6 D;  4DR2 Q;  2EYJ A;  2NBF A;  3L9A X;  4ZQ3 A;  2JA6 G;  3HOX H;  1Y69 U;  4RH6 A;  5C3X A;  3H94 A;  5I6Y A;  2WAQ G;  2VZA A;  1O7L A;  3V2T A;  1GJX A;  1OXU A;  1BKB A;  1EY8 A;  2A5H A;  2D2C C;  3UE1 A;  3DWQ A;  1T5X D;  3KDF B;  4DV0 Q;  5BR8 L;  4JBJ A;  3RLO A;  3S1Q H;  3FKI G;  1RHP A;  1G6P A;  2FFK B;  4LWC A;  4DV3 L;  1SMX A;  1TS3 A;  2ZTE A;  4YY3 Q;  1JWU D;  2UXC Q;  2F0Q A;  5IGF A;  1IL8 A;  3I7F A;  5M3M H;  2KED A;  1H9S B;  3OTO L;  3C3L A;  2UUB L;  5DNF A;  4RWS C;  2NTS A;  1DJR D;  5D3D A;  4RHS A;  2XTI A;  3K81 C;  4HTH A;  3RR5 A;  3X3M A;  1U0L A;  1ESR A;  3GTJ B;  2I07 B;  2JEA I;  2A68 C;  1I50 B;  1PTO D;  4GZY C;  1PH8 A;  1GUO A;  2Q2T A;  1K8A C;  4IPG A;  4JVZ A;  2B63 G;  4LFA Q;  3PIO 3;  2CVR A;  4DAM A;  2P5Z X;  4HID A;  2FXQ A;  4AH6 A;  1BCP B;  3LGJ A;  4OO1 G;  1TWA B;  3EFX D;  1HA5 A;  1TS2 A;  1SJE D;  1PZI D;  2UXD Q;  1YJW A;  2WII B;  4DAY B;  5LMN L;  3GTL H;  1R4P B;  2JA9 A;  1PH1 A;  2C35 B;  1L2F A;  1D1K A;  4DUY Q;  1TWG B;  1ENA A;  2V1C C;  4P2C B;  4LMQ D;  2K5Q A;  4IUR A;  1QVC A;  2JA5 B;  1DM0 B;  4X62 Q;  1HTP A;  2XGT A;  3D0F A;  3I90 A;  1D7Q A;  5EQ0 A;  3MVV A;  4H13 C;  1GHJ A;  3GV6 A;  5TSS A;  1X6O A;  4TQU S;  5AFW A;  3W3A A;  3Q24 A;  4KY6 A;  2RF4 A;  3O13 A;  3S24 A;  2PZT A;  5IWA L;  4GOP C;  1ENF A;  3A8K E;  4LFB Q;  3NTH A;  4DK3 C;  4PG3 A;  1EYA A;  4IJL A;  1E0B A;  1GUT A;  2A68 D;  2DY8 A;  4UAI A;  4LUO A;  1CHQ D;  1IL2 A;  1MSG A;  1N32 Q;  2KCT A;  3STB C;  3KYH C;  2EYO A;  1ASZ A;  5C4Z A;  2ASB A;  1QZG A;  4BBR G;  2VNU D;  5HGQ A;  1M90 C;  4YCV A;  2NYZ D;  5BN5 A;  3D6C A;  1E2W A;  5M9O A;  3P1H A;  1VQL A;  2J7Z A;  3CCU A;  1ICF B;  2AMC B;  4QUC A;  1XWE A;  1Q8I A;  3BZC A;  2EXD A;  1QE6 A;  4X64 Q;  1VQ4 A;  1FJG L;  4OGQ C;  5FK9 C;  1BO0 A;  2NUC A;  4K6D A;  5JPN C;  1BXT A;  3A55 A;  5CBE E;  2RA4 A;  2E2J B;  3KJP A;  1PXU A;  4APV A;  4JW0 A;  5M5Y H;  1KXL A;  3OW7 A;  4ZCK A;  5JJI A;  3SXH A;  3MA2 B;  2NZO A;  1O80 A;  1HPC A;  2H5X A;  3FRP B;  2K33 A;  2HDM A;  1PZJ D;  2VL6 A;  5C4H A;  1WI5 A;  4OX9 Q;  5FJ8 H;  3T1Y L;  2MQH A;  4C2M H; 
#chains in the Genus database with same CATH homology
 2D5D A;  3GQB A;  1STE A;  1H9S A;  2NTT A;  4CGY B;  3I70 A;  2PPB C;  1S5F D;  4KV6 A;  2LY7 A;  5G3L F;  2F0S A;  3CKI B;  1LAB A;  3C46 A;  5JOB A;  4ABN A;  1EY0 A;  2E74 C;  1F9R A;  1EWH A;  3QOJ A;  4EQO A;  1CK1 A;  1OXV A;  4FP5 D;  3K59 A;  1B2T A;  3M7G A;  2KEC A;  3J81 E;  3LWU A;  3HGB A;  1JCK B;  2O2L D;  1RKN A;  2NN6 I;  1L0X B;  2F0H A;  4V0B A;  4C1N K;  3MXN A;  1WTV A;  1CI3 M;  3P20 A;  4DFA A;  4ODG A;  1EU3 A;  3KLS X;  3DEP A;  3NP8 A;  5CMD A;  3SHL A;  4ME5 A;  5C0X G;  1SAP A;  1CFM A;  1SNC A;  5KYI A;  5EGT A;  2R61 A;  2LKV A;  3OPO A;  1QWY A;  2E2H B;  3MTS A;  3PUX A;  5M5W B;  4XIG S;  5J22 A;  2G9D A;  1F9P A;  2F0U A;  4G57 A;  4KN7 C;  1NR4 A;  4C3I B;  2IX0 A;  1FNW A;  4K8J A;  2F0G A;  3VR5 A;  2JA7 B;  1Z47 A;  2WB1 B;  3T53 B;  5IGE A;  1G29 1;  3NTI A;  1XXG A;  2EYF A;  3VR2 A;  4CKE A;  3S1R B;  2CW0 C;  3QJY A;  1A3U A;  3TP5 A;  5BN3 A;  5C0X J;  3J7A V;  1LT4 D;  1G91 A;  5DM7 3;  5M5X B;  4XQQ A;  1SMY D;  4FYD A;  2PZW A;  3M7N A;  2AUK A;  1KAB A;  3NK9 A;  3SK4 A;  1BOS A;  5IGD A;  3OWF A;  5CV9 A;  1C4Q A;  1Q12 A;  2F0O A;  3H09 A;  5CGK A;  2PW7 A;  1RDP D;  1G6Z A;  1NCV A;  3I91 A;  3X3N A;  2DNE A;  3QIA A;  2RQX A;  3A54 A;  4O1N A;  3TP7 A;  3R8B A;  4DAY A;  3H91 A;  5FO7 B;  4U67 3;  2QCP X;  1I6V C;  1FNV A;  1FNU A;  5FOB B;  3WOF A;  1EZ8 A;  1R9T B;  5K36 H;  1CA5 A;  3NQI A;  1JWM D;  3C2P A;  3IFT A;  2WKC A;  1PTO F;  1LTT D;  1SEB D;  4QUF A;  4NW2 A;  2PMZ B;  3TBI B;  1LTS D;  2HQE A;  4RGN A;  5EBC A;  1EIH A;  5JPM C;  3MFG A;  2B39 A;  3OIP A;  1RTN A;  1SE3 A;  3CU7 A;  3MFY A;  4A3M B;  1BQQ T;  3D4R A;  4KD3 A;  5CYU A;  4C3J B;  3CRL C;  1F9Q A;  4CJ1 B;  2PQE A;  5CBA E;  3K58 A;  4CJ0 B;  2ENB A;  2K32 A;  3N52 A;  5KNB A;  4K5V A;  3A56 A;  3R93 A;  1TS5 A;  5G3L D;  2KOL A;  3FVQ A;  5T1G A;  3K5O A;  1LLR D;  4PNY A;  1YNJ C;  2N55 A;  1U9R A;  2RDH A;  1MGS A;  4IUN A;  3VYR A;  4IFD I;  5IIF A;  4WOR A;  2F0E A;  4K2L A;  2B63 B;  1B9N A;  3IL8 A;  3MXG A;  1KDB A;  3QB3 A;  3RD4 A;  3H3V C;  2F0F A;  4FF2 A;  4IFD G;  1SE4 A;  3S2H B;  3Q22 A;  2WIN B;  1V43 A;  2R93 B;  1WD1 A;  2D9U A;  5CV4 A;  1VCI A;  2A6H C;  2E2D C;  2L12 A;  1BF4 A;  3HEJ A;  3I8Z A;  1II3 A;  1DD2 A;  3I73 A;  1SFO B;  3D4D A;  1B4O A;  2AWO A;  5K36 G;  3PUV A;  1EQV A;  3MC0 B;  3PUW A;  2WP8 J;  3K5M A;  2F0K A;  4PMB A;  1LTB D;  4DGZ A;  2ICI A;  2FIN B;  5COY A;  3H0G B;  2EVB A;  4K8I A;  2SEB D;  2L9H A;  2AUJ D;  1KNE A;  4K5X A;  3M3Y B;  4C3I G;  3SDZ A;  4X3T A;  4OO1 I;  3NQT A;  4F88 A;  1UAP A;  4WRD A;  3URY A;  4BBS B;  5IOD A;  1F2M A;  2K5D A;  4DK0 A;  2Z4H A;  1S4Z A;  3HG9 A;  3P75 A;  5CV7 A;  1RTO A;  3D31 A;  2M9V A;  2IL8 A;  1SYC A;  5C4J B;  4ZUJ A;  3G7L A;  1HCZ A;  2AWN A;  2LS0 1;  5ISR A;  2C9O A;  2AQ3 B;  3J80 L;  2KCC A;  3FMC A;  4H7B A;  4G7H C;  3K0Y A;  3Q6S A;  2MP1 A;  3BDO A;  4PMW A;  1MSH A;  1CQF A;  4I65 A;  2K03 A;  3GO5 A;  1E2V A;  3SK6 A;  1PTO H;  2NN6 G;  3NWS A;  1PTO B;  2KVM A;  1RD9 D;  2QIL A;  1JR0 D;  2BA1 A;  3QG1 A;  1HUM A;  3ERQ A;  1STA A;  1HFG A;  2HDL A;  3BYY B;  2LFN A;  4M8A A;  1I4Q A;  4QB4 A;  2M00 A;  2G9H D;  4DF7 A;  4OO1 H;  2AQ2 B;  3J80 E;  5KRU A;  5EPK A;  3SK5 A;  1AEX A;  1AN8 A;  1JIC A;  5IGC A;  1HQM C;  1FD7 D;  3GTP B;  2B2Y A;  4XQN A;  2PZU A;  3NE5 B;  3T56 B;  1OXT A;  3R3O A;  2A6E D;  2QDB A;  2MPM A;  4RGM A;  1Y1V B;  3K7A B;  3I72 A;  3PUZ A;  2QKI C;  3PMF A;  1I4P A;  1PFM A;  1A3T A;  2NVQ B;  3ND8 A;  4G7O C;  2R92 B;  2A69 C;  1BUV T;  2K01 A;  5HUR A;  2B2U A;  1NUC A;  3TZU A;  1HUN A;  5I9O A;  1PRT B;  2XRS D;  2FJ2 A;  4KY5 A;  2IX1 A;  3NBI A;  1PYW D;  4HR7 B;  5D14 A;  3I4N B;  2XVS A;  4HSP A;  2EYH A;  1ET9 A;  1WTP A;  3HS0 C;  4DN4 M;  2IPK D;  4KHV A;  1G8Z D;  2EXZ A;  1H9J A;  3FDT A;  4NKL A;  5ELC A;  1ZEQ X;  4NMZ A;  3ONA B;  3VYT A;  1F2L A;  2Y0S B;  3HRZ C;  5M3F B;  5A2Q E;  5C0X I;  2F03 A;  2EJM A;  4HCE A;  3GTM B;  4OHJ A;  2PW5 A;  1Q1B A;  2IT1 A;  1XX8 A;  3P7J A;  2ICE C;  1STN A;  1PTO C;  3BVG A;  4N9P A;  2OT2 A;  2KJX A;  5F2D A;  5EPJ A;  1C8C A;  4XXE A;  1KDC A;  1YNN C;  1SND A;  1Q1E A;  5K5P A;  3J7Y W;  1H9M A;  1HQR D;  2Q8R E;  3T51 B;  3MAQ A;  1HRJ A;  2SNM A;  2NVX B;  5IGB A;  4KI0 A;  4DAV A;  1LT6 D;  1K8M A;  5C0X H;  1EYD A;  2B2W A;  2MGS A;  2XSC A;  5EBD A;  2Q8T A;  5KIX A;  5DM6 3;  3AB9 A;  4R9W A;  2A73 B;  1BDO A;  1O7Y A;  1WTO A;  2B2U C;  3NWT A;  4BBR B;  4Y7N B;  4OIJ A;  1VF7 A;  4WFN 3;  5EKK A;  2B2T A;  4I7Z C;  1Y8O B;  1HA6 A;  1D5Z C;  1B44 D;  3RUZ A;  1JOO A;  2HCI A;  3PV0 A;  1DON A;  1SNM A;  2EJF C;  5FKA C;  1KTK A;  2MUY A;  5EKI A;  3G6J B;  5I6W A;  2F0L A;  2FMC A;  2OXP A;  2F0N A;  2JEB I;  5JEA H;  4UDU C;  4DAP A;  1QNU A;  5ELD A;  1WD0 A;  2Z8L A;  3I4L A;  2VB3 X;  3K5N A;  2LMC B;  2J0T D;  1Y8P B;  1EQT A;  3ND9 A;  2B2T C;  3J7A F;  3T13 A;  4IUP A;  1QJO A;  2OF1 A;  1C48 A;  1V8Q A;  3GTK B;  2XWJ B;  3TME A;  5DEH A;  1NSN S;  1EOT A;  3S1N B;  1B9M A;  4BY1 B;  1KAA A;  3IKJ A;  1J8I A;  1BR9 A;  4C2M B;  1I6H B;  2X69 A;  1ZKO A;  3PUY A;  1TVX A;  1M4V A;  2EYP A;  3M4Y A;  2B2Y C;  1KLG D;  1S5B D;  4IFD H;  1GOZ A;  4HN7 A;  2FHT A;  1SMY C;  2EPB A;  4A3J B;  3S16 B;  3HP3 A;  2Q8I B;  1JWS D;  4DXG A;  1I3Q B;  4U68 A;  1TKW B;  2B2W C;  2E76 C;  3AU7 A;  1U4P A;  4IFD J;  1CHP D;  4X3S A;  2ZXP A;  2B2V C;  1R4Q B;  1ONL A;  4KKU A;  1DOM A;  2ZXR A;  3S1M B;  1D1I A;  3BS1 A;  1A2T A;  2B8G A;  4PQX A;  4FXK C;  2EDG A;  1GXD C;  1SYE A;  2WKD A;  4FF1 A;  3CRK C;  5I4D A;  3GTQ B;  2IW3 A;  1WTR A;  3S9W A;  2K6A A;  1AW7 A;  1STH A;  2EOT A;  3KK7 A;  1IKM A;  4HMJ A;  2F0I A;  1JOR A;  4ZK9 B;  2K28 A;  4NDX A;  4CKC A;  5C6A A;  1EEI D;  1X32 A;  1G2S A;  3NPP A;  4DU9 A;  1JOK A;  3KBX A;  1QNK A;  1TWC B;  1SDF A;  2RSO A;  2TSS A;  4RKB A;  2H4O A;  5KND A;  1IW7 D;  1JOQ A;  4OL7 A;  3VR3 A;  3HOY B;  1AP0 A;  3TP6 A;  3S1Q B;  2BE5 C;  2D62 A;  1RCV D;  4F8M A;  1ZYR C;  1W6J A;  2B8F A;  4HMI A;  1FR3 A;  1ROD A;  5C4X B;  2XIW A;  1DYQ A;  2M2L A;  3BVZ A;  1GUG A;  4Q0F A;  4RGT A;  2KCN A;  4TKO B;  1EY7 A;  2YYZ A;  3DHQ A;  2L5T A;  2JXM B;  1TY2 A;  1DZ1 A;  4A3G B;  3A8J E;  4XYO A;  2SOB A;  5M5Y B;  1CQV A;  4ZYS A;  4ZLT F;  3TSS A;  1TQO A;  3KLS A;  3HOU B;  2JSO A;  1ENC A;  3T4A C;  2IX3 A;  5A35 A;  1G2T A;  4IUT A;  2BOS A;  1NAP A;  4HAE A;  5CV6 A;  4ZUI A;  4EVO A;  4XQJ A;  3U9S A;  3VR4 A;  1WVL A;  1D5M C;  4X3U A;  2BDN A;  2Z4I A;  5C5L A;  3R2T A;  2F0W A;  1DXM A;  1B1Z A;  2F0P A;  5C3W A;  2N88 A;  3JAM E;  1Y8N B;  3IAY A;  1O7Z A;  4IZ8 A;  2RBM A;  1ET6 A;  3LWE A;  5T1I A;  3Q0A A;  2KUM A;  3OWE B;  3OIQ A;  5KGU A;  1IW7 C;  2CHB D;  4A3E B;  2A69 D;  5I9P A;  5J39 A;  1GUW A;  4IAL A;  2F0D A;  1VMP A;  1H9R A;  2EY6 A;  4IQZ A;  5I2Y A;  4C1N I;  2JYO A;  5EPL A;  4RKL A;  3TN2 A;  4RA8 A;  2MJ8 A;  4KTA A;  2E75 C;  1LTR D;  2FMM A;  2TMP A;  2F4I A;  3VR6 A;  4KHZ A;  4CHT B;  5JVG 3;  4B08 A;  1OO9 B;  2L11 A;  4F7X A;  5BN4 A;  2AQ1 B;  1BBX C;  2R3Z A;  1XYI A;  1LV9 A;  1SBB B;  2CW0 D;  2Z1C A;  2C5C A;  2ZT9 C;  1GHK A;  4WJW A;  4PV1 C;  1GUN A;  1Z6H A;  3BDL A;  3CQZ B;  1PMR A;  4LJZ C;  4B9X A;  2NVT B;  1SYF A;  1HHV A;  3OHX C;  3FEW X;  1BCP F;  2BDO A;  3KBG A;  1WTQ A;  3NSW A;  4KJN A;  1MBY A;  4ILW A;  3U9O A;  4DXF A;  4S3S A;  3A7L A;  3BZD B;  1B50 A;  4QMG A;  2SNS A;  3SEB A;  2XRQ D;  4LAA A;  1JE4 A;  5J1Z A;  3BYT B;  4A3F B;  1LO5 D;  5E4W C;  4HSV A;  5EJW A;  1MI2 A;  5CV8 A;  4KY7 A;  4XT1 B;  4EQN A;  3QOL A;  3F2U A;  5C3E B;  4KKT A;  1JB3 A;  5JAV A;  3I4M B;  1SNO A;  1SYD A;  3C1E A;  1Y1W B;  4V19 0;  2K5W A;  1ML0 D;  1F2Y A;  3RZD B;  2PO4 A;  3GD7 A;  1QOH A;  2R6G A;  3Q23 A;  1DOK A;  1CM9 A;  2KEE A;  3OSO A;  1CTM A;  3K6O A;  4IUQ A;  4XT3 B;  3GTO B;  4IN3 A;  5CV5 A;  1ICW A;  1ESF A;  4DNR B;  2KHS A;  1EY9 A;  5COR A;  2EYM A;  2I46 A;  5LL6 S;  1PFB A;  5ELE A;  4XTC S;  2VB2 X;  4FNF A;  1SE2 A;  5JEA G;  1PRT C;  4AYB B;  1WTX A;  4A3I B;  2RVL A;  1D2B A;  3FPP A;  1V1O A;  5A2Q L;  4BWG B;  2H1E A;  3MXP A;  3NTK A;  3OMG A;  3OMC A;  1A2U A;  2EJG C;  5C5M A;  2BA0 A;  1V1P B;  1IHZ A;  2IJ0 A;  3HZX A;  3E6Z X;  3NBH A;  1U4M A;  2BCO A;  3NHH A;  4QIW B;  1E2Z A;  3RLF A;  2E2I B;  1FYC A;  5D3I B;  1KNA A;  1I4X A;  3WDN A;  4ID6 A;  2K7V A;  3S2D B;  3VA5 A;  4R8N A;  4BA1 I;  4Q5V A;  1RF2 D;  1SNP A;  1ILP A;  3AMU A;  2F3W A;  2EY1 A;  2YU9 B;  2K05 A;  1D6E C;  1K8O A;  3RZO B;  4KMU C;  1SJH D;  1ILQ A;  3DWA A;  3GV3 A;  3L7Z C;  1PDQ A;  1AZP A;  5IT9 E;  3VYS A;  3KF8 A;  2ID0 A;  1TY0 A;  4MIU A;  3TDQ A;  3OOC A;  4FXD A;  4C3H B;  4FO2 A;  2NN6 H;  2EE1 A;  1KDA A;  1EY4 A;  2F0V A;  1HXY D;  5CC4 A;  3MWY W;  2L1B A;  1CT1 D;  2EY5 A;  4Z9C B;  1PLF A;  2GA4 B;  1EZ6 A;  1KLU D;  1UNS A;  4L8J A;  3D8G A;  2VXW A;  1K83 B;  4PMC A;  4K14 A;  4F87 A;  4A3B B;  2L0C A;  3S14 B;  1QG7 A;  5IT9 L;  1SNQ A;  3SE0 A;  2EYL A;  4HED A;  1H9K A;  3LX0 A;  2XWB B;  4ZAI A;  1OXS C;  2NZ1 D;  3NUC A;  1O78 A;  1X3Q A;  3IFD A;  4LK1 C;  4E6I A;  1DCZ A;  2PCF B;  3FKI B;  1LT5 D;  3A8I E;  2RKS A;  1EL0 A;  1I4G A;  3KLR A;  3EJI A;  4JBW A;  2KQ3 A;  5JVH 3;  3M85 A;  2F0T A;  1STB A;  4H44 C;  3NXW A;  3QO2 A;  1TWH B;  1DOL A;  1TU2 B;  1STG A;  3LNN A;  5FO9 B;  1I4H A;  3TP8 A;  1JQY D;  1EY5 A;  3KUP A;  3BDC A;  2NWG A;  3QWN A;  4RHR A;  3J81 L;  5I2X A;  4A3D B;  4L6T B;  1EYC A;  4J1M A;  1PFN A;  4TSS A;  4A3K B;  3R2I A;  4RCN A;  3JAM L;  5JJZ A;  2MHV A;  1A15 A;  2XN9 C;  1W6K A;  1VDZ A;  1SSO A;  1CA6 A;  1WTW A;  2K1B A;  2CQA A;  2A74 C;  1F2Z A;  4RFB A;  4YIJ A;  1T5E A;  2BE5 D;  5IGG A;  4KKS A;  3GP7 A;  2J4X A;  1F77 A;  2O5J C;  1PRT F;  2DN8 A;  3ITP A;  3HKZ B;  5ELF A;  3M4O B;  4FF4 A;  2F0J A;  1LTI D;  4ZKB B;  3CHB D;  3BG3 A;  2RSN A;  3DUZ A;  4CBV A;  4CKB A;  4FXG C;  1Z7T A;  2A6H D;  3HOZ B;  4R8I A;  1YNN D;  4KJO A;  4BA2 I;  4IUV A;  1OXX K;  5FLX E;  3W2D A;  4RGO S;  4JK1 C;  2WAQ B;  3MHB A;  2KA7 A;  3V05 A;  2EY2 A;  3VA7 A;  1S5D D;  2ZXO A;  4RAU C;  3DWP A;  3RMH A;  1EIG A;  4O42 A;  5IOC A;  1PZK D;  1EWC A;  4X3K A;  2O4X A;  2X6L A;  3FPU B;  3MEH A;  4CJ2 C;  4FF3 A;  3K57 A;  1STY A;  1YNJ D;  1X3P A;  4N9T A;  4J8Q A;  5LL6 X;  1TII D;  1Q90 A;  1M8A A;  5DAU A;  1V1P A;  1IKL A;  4H0L C;  3MZ5 A;  2NB0 A;  2X6G A;  2QF7 A;  4XYQ A;  4QCL A;  1HFN A;  5E1F A;  2F3V A;  4BY7 B;  2B2V A;  1CZW A;  3UI2 A;  5FLX L;  1BNZ A;  1VF5 C;  3HOX B;  3C1F A;  1FGB D;  1S5E D;  2OEO A;  1EU4 A;  5KNC A;  3PO2 B;  2F1M A;  3A7A B;  4DK1 A;  1EEF D;  4M1U B;  1AZQ A;  1B3A A;  1Q3L A;  3I3C A;  1LT3 D;  1UEA B;  4B9W A;  1IYU A;  4C56 C;  3EQL C;  4HCS A;  3N6R A;  4K6L A;  5JEA J;  2RDG A;  1EFI D;  3GTL B;  1A6X A;  2IWH A;  5E3F A;  4EQP A;  2HUG A;  4C3H G;  1RJT A;  3D4W A;  2L55 A;  3L3O C;  1J9O A;  2PYK A;  4ZRZ A;  1IYV A;  1UUP A;  1JC7 A;  1U4L A;  5LHY 1;  3EA6 A;  2QEJ C;  1GUS A;  1TR5 A;  1LTG D;  1PRT D;  1HTL D;  5D65 A;  2RDF A;  3MXU A;  3S17 B;  4QF4 A;  3DEO A;  1QCB D;  1WCM B;  1SYG A;  1QIL A;  1AFP A;  3HOV B;  1LAC A;  1VMC A;  4EGV A;  1QB5 D;  5M3M B;  2O5I C;  4DA2 A;  2V4D A;  4BS9 A;  3PIP 3;  2F0M A;  5KEE A;  4MN3 A;  1EY6 A;  1CZG A;  4DNT B;  4J6H A;  3V96 A;  1XTC D;  1SYB A;  3S15 B;  5HGT A;  1BCP D;  4K2K A;  4KK7 A;  3H6M A;  3VYU A;  4K5W A;  2WAC A;  1B53 A;  2L4N A;  4MHE A;  2R7Z B;  5CR3 A;  4A93 B;  5FO8 B;  2JE6 I;  3SVM A;  3WOE A;  4TRD A;  3HOW B;  3DMU A;  3SR1 A;  4RCO A;  4ZKC B;  4FVM A;  4OIK A;  1D5X C;  1I4R A;  3E5S A;  1S5C D;  3EVQ A;  5ELB A;  1ZXT A;  2JP1 A;  5E4X A;  2VUM B;  4XDX A;  3DXJ C;  3BVM A;  1L0Y B;  4L63 B;  2DNC A;  4G4K A;  2XNA C;  3DM1 A;  5EKL A;  1BCP C;  5C44 B;  1SXT A;  2JA6 B;  2A6E C;  4ULL A;  1TWF B;  3TZD A;  3D3R A;  2JA8 B;  4KN4 C;  3ZYY X;  2EZV A;  2K04 A;  1ZYR D;  3D6W A;  4C3J G;  4KD4 A;  2NVY B;  3ERO A;  1MD2 D;  3K5L A;  2SDF A;  1NR2 A;  1U4R A;  2HCC A;  1LTA D;  3SK8 A;  3E0J A;  1TS4 A;  3T16 A;  1TT2 A;  5NUC A;  3PO3 B;  3GTG B;  5KYL A;  2DY7 A;  1F9S A;  4IUU A;  4G7Z C;  2PNR C;  1A3V A;  4NP5 A;  2WV6 D;  2EYJ A;  2NBF A;  3L9A X;  4ZQ3 A;  1Y69 U;  4RH6 A;  5C3X A;  3H94 A;  5I6Y A;  1O7L A;  3V2T A;  1GJX A;  1OXU A;  1EY8 A;  2A5H A;  2D2C C;  3DWQ A;  1T5X D;  1RHP A;  2FFK B;  1TS3 A;  1JWU D;  2F0Q A;  5IGF A;  1IL8 A;  2KED A;  1H9S B;  3C3L A;  5DNF A;  4RWS C;  2NTS A;  1DJR D;  5D3D A;  4RHS A;  4HTH A;  3X3M A;  1ESR A;  3GTJ B;  2I07 B;  2JEA I;  2A68 C;  1I50 B;  1PTO D;  4GZY C;  1GUO A;  3PIO 3;  2CVR A;  1BCP B;  4OO1 G;  1TWA B;  3EFX D;  1HA5 A;  1TS2 A;  1SJE D;  1PZI D;  2WII B;  1R4P B;  1D1K A;  1TWG B;  1ENA A;  4P2C B;  4LMQ D;  2K5Q A;  4IUR A;  2JA5 B;  1DM0 B;  1HTP A;  3I90 A;  5EQ0 A;  3MVV A;  4H13 C;  1GHJ A;  3GV6 A;  5TSS A;  4TQU S;  5AFW A;  3W3A A;  3Q24 A;  4KY6 A;  3O13 A;  2PZT A;  1ENF A;  3A8K E;  3NTH A;  1EYA A;  1E0B A;  1GUT A;  2A68 D;  2DY8 A;  4UAI A;  1CHQ D;  1MSG A;  2EYO A;  5C4Z A;  2VNU D;  2NYZ D;  5BN5 A;  3D6C A;  1E2W A;  5M9O A;  3P1H A;  2J7Z A;  4QUC A;  1XWE A;  1Q8I A;  1QE6 A;  4OGQ C;  5FK9 C;  1BO0 A;  2NUC A;  4K6D A;  5JPN C;  1BXT A;  3A55 A;  5CBE E;  2RA4 A;  2E2J B;  1PXU A;  3OW7 A;  3SXH A;  3MA2 B;  1O80 A;  1HPC A;  3FRP B;  2K33 A;  2HDM A;  1PZJ D;  5C4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...