1TR5A

Room temperature structure of staphylococcal nuclease variant truncated delta+phs i92e
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title X-ray and thermodynamic studies of staphylococcal nuclease variants I92E and I92K: insights into polarity of the protein interior
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2004-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1tr5A00
3TP8A 1SYCA 5C4ZA 3D8GA 2F0HA 3MZ5A 4TRDA 3C1FA 4DFAA 3TMEA 1EZ8A 5C3WA 4IZ8A 3H6MA 1EYAA 1EZ6A 1ENCA 2F0LA 2WACA 1KABA 4K8IA 2RDFA 3R3OA 4K6DA 4NMZA 2F0OA 3V2TA 2KQ3A 3P75A 4B9XA 3NHHA 1SNMA 5C4HA 3NUCA 1TQOA 5CR3A 4EQPA 5IIFA 5KYIA 1SYDA 5F2DA 4ZUIA 4PMCA 5ISRA 3DMUA 4F7XA 4WORA 1RKNA 2OXPA 2F3WA 3EVQA 3QOJA 5J1ZA 4ME5A 3TP6A 2EYHA 2QDBA 2PW7A 3BDCA 1TT2A 4KY6A 5JOBA 4KV6A 2O4XA 4KJNA 4DGZA 5IGDA 5I9OA 4S3SA 4WRDA 4NKLA 5I6WA 3HZXA 1JORA 3EROA 1EYDA 4K2KA 3T13A 2F0SA 3MVVA 2F0EA 2F0JA 3DHQA 4ODGA 1SNQA 4PMBA 1A2TA 5CV7A 4B9WA 1SNDA 3S9WA 3D4DA 4NDXA 4RKLA 3MXPA 3SK6A 5E3FA 1TR5A 2F0DA 2EYLA 2OF1A 5IGCA 2EY1A 4G57A 1II3A 2F0PA 4DU9A 2F0QA 4IUNA 2EXZA 1JOKA 2F0TA 4QB4A 4KD3A 4QF4A 2M00A 2RKSA 2EYPA 4KTAA 1NUCA 5I9PA 1EQVA 1SNPA 4DF7A 3OSOA 3NP8A 3C1EA 2EY2A 4K5XA 5C5LA 5JAVA 5CGKA 3SK5A 1STGA 4HTHA 4F8MA 1EY0A 1IHZA 3OMCA 2KHSA 5CV6A 4R8NA 2SNMA 4HMIA 4EQOA 2EYJA 1EY5A 2EYFA 4KY7A 5E1FA 4ZUJA 2PW5A 5C6AA 1STBA 5IGFA 4N9TA 4IALA 2LKVA 3SXHA 4RKBA 3U9OA 1SNCA 2PQEA 3TP5A 4EQNA 4E6IA 4I65A 2NUCA 5IGBA 5EKLA 4K5WA 5I6YA 5J22A 1F2MA 2EY6A 2F0MA 3QB3A 3SK8A 3P1HA 1NSNS 2F0KA 5CC4A 3D4WA 4K2LA 3MHBA 4PNYA 2ENBA 4YIJA 5DAUA 4KY5A 2F3VA 3ERQA 4J6HA 5NUCA 3ITPA 1JOQA 3EJIA 1STYA 1AEXA 2F0FA 2SOBA 3PMFA 4K14A 4K8JA 1U9RA 3E5SA 1SNOA 1STAA 1A3UA 4K5VA 4KHVA 1SYGA 2F0UA 3SHLA 3T16A 5J39A 1ENAA 3MEHA 1SYFA 2F0NA 5K5PA 2PYKA 1JOOA 1F2YA 1KDCA 2F0WA 4ID6A 5CV4A 3QOLA 2PZWA 2PZTA 1EY8A 1SYBA 2OEOA 4EVOA 3NQTA 3LX0A 3OMGA 3D6CA 5HGTA 2PZUA 5IGGA 4J1MA 3NK9A 4H7BA 4KD4A 1EY9A 5M9OA 3VA5A 1EY4A 1KDBA 1KDAA 1STHA 2EYMA 3NXWA 5KIXA 4QMGA 5C5MA 4MIUA 2F0IA 1F2ZA 1A2UA 2F0GA 5CV9A 1EYCA 2F0VA 1A3TA 5EKKA 5IODA 3HEJA 3OWFA 4OL7A 3SK4A 2HQEA 4KJOA 5IOCA 4NP5A 2EY5A 5DEHA 5KGUA 4ZQ3A 5EGTA 4LAAA 5KRUA 1EY6A 3BDLA 5KYLA 1SYEA 1STNA 2EYOA 5C3XA 5CV5A 2RBMA 5HURA 4N9PA 3TP7A 3SR1A 3RUZA 1KAAA 1EY7A 1A3VA 5IGEA 5CV8A 4HMJA 2SNSA 5KEEA
chains in the Genus database with same CATH superfamily
2IHEA 1EOTA 1ML0D 1SYCA 1MD2D 3D8GA 1MJEA 2VW9A 3R93A 1BVSA 2K52A 4JI7Q 2EOTA 4NXMQ 1SR3A 2H4OA 2RDFA 4OIKA 3CKIB 2K5DA 4ZYSA 2XRSD 5IYDG 5KNDA 1FL0A 4F7XA 2B2TA 1WYDA 3R2IA 3HOUH 1Y8PB 5C44H 2PW7A 1L0XB 1D5XC 5C3EH 4U673 2IX3A 1DCZA 1JE4A 1CA5A 2KCCA 2JA7B 5AJ3L 2BDOA 3FPUB 3A7AB 1SNDA 1Z7TA 1QCBD 4O42A 5E3FA 2F0DA 1DZ1A 5FO8B 4OX9Q 2KCMA 3V05A 2R6GA 1JB3A 1RTNA 3F8TA 4APVA 2D0OA 4LF6Q 3GTMB 2B63G 1BCPC 4A3GG 4IUTA 4HCSA 4LF4L 1EWIA 1IW7D 1VQ9A 5FO9B 1A62A 4C3JG 2DJGC 2PMZB 4WJ4A 1S40A 1SE4A 4EQNA 3HP3A 3OOCA 1I5FA 5E4XA 2FFKB 2ZM6L 1CHQD 4R1JA 5LL6X 2JA7H 3VR5A 1K8OA 5CC4A 3MHBA 5DAUA 2F03A 1I94Q 4DV5L 1MGSA 1Y1WG 4RHSA 4CDDC 4JBJA 1VQMA 5GAGC 1ENAA 2N88A 2BOSA 3GTMH 4GOPC 3MXUA 1F9QA 4DXFA 4H44C 3NK9A 1ICFB 4RGTA 1EY4A 1XNRL 2VUMB 1IXRA 3PO3G 1XPUA 1EIYB 3DEOA 4X62L 3GTJB 2BA1A 1PH2A 3ULJA 1SLJA 3C46A 3RZOB 2MNAA 1W2BA 1RD9D 3GV6A 2JEBI 1CQVA 2PPBC 1K3BC 3K7UC 2DY7A 4Q0FA 4G7HC 1GXDC 1EUJA 4K8IA 1X56A 1AP0A 3NPPA 2AMCB 3I4OA 5KYIA 1N32Q 2L1BA 2LMCB 4PMCA 5J1ZA 3J80i 4GN5A 4LFAQ 2VUMH 1M8AA 2OT2A 1M90C 4A3MB 4DR2L 4H0LC 3L0OA 4TVAB 3H0GB 3GTJH 4HAEA 2CH4W 2F0SA 2UXBL 3DHQA 3KF6A 1Q86C 1BOSA 3P7JA 3RZOH 1D7QA 5FJ8G 3CC7A 4RKLA 3SK6A 1HHVA 4XQJA 1B7YB 1PA6A 4YCUA 2B2UC 1O7YA 2RKSA 2Y0SB 4NW2A 2O5JC 2RDHA 1JR0D 1KC8C 4A3EG 2SNMA 1XTDA 4RGOS 1O78A 3KBXA 5E1FA 3JC66 4O0AA 5IGFA 4N9TA 1GJXA 1TIID 1G91A 4A3MH 1JICA 1GOZA 1RF2D 1VMPA 2PO4A 5A35A 1WFQA 4I65A 3G48A 2QCPX 1KRTA 3H0GH 2RCFA 4H02A 5COYA 3STBD 2XRQD 3P1HA 3AFQA 1N36Q 4PNYA 3VR3A 4A3FG 2HUGA 1PTOB 4J6HA 3T1YL 2SOBA 1A15A 1STAA 1D5MC 4KN7C 3KLRA 2PYKA 3ZYYX 1OTCA 4XTCS 4ID6A 4LMQD 2NTSA 2DN8A 1SMYC 2E5LL 3LGJA 3A56A 4POFA 4R4IA 5IYBG 1LTID 3QIAA 5JPMC 5BR8Q 3TS0A 1TU2B 4CDEC 4QMGA 4AQYL 2ZT9C 1WTHA 1F2ZA 1RHPA 1QZHA 4JOIA 4GNXC 3CW2C 4HJ7A 5DEHA 3HKZG 5KRUA 1G2TA 1PTOH 1TY2A 4OWTB 4X3KA 4IFDH 2JE6I 3C3LA 5EAYA 1CUKA 1EZ8A 4RA8A 1B50A 2F4IA 2WB1G 4GKKQ 1A6XA 4JBKA 4JI2Q 2WACA 1YBYA 2BA0A 3H15A 1KXLA 2XIWA 5LMUQ 1M1KC 2K7VA 3J81E 1BDOA 4R4OA 1HNXQ 1L2FA 1K0RA 3BZKA 2MPMA 1P16A 2AUJD 5I6WA 1V1OA 1VQHA 3EROA 1UEBA 5IP7H 3NENA 4DV2L 4V190 1FNVA 1YITA 4LF5L 1S5FD 3E9HA 2PI2A 4NXNQ 1YJNA 1SEBD 2G5DA 1HR0W 5IGCA 5GAEC 2F0PA 1UWVA 1X54A 2JJQA 4DKAC 4DPGA 2AQ1B 4HJ8A 3A74A 4QIWE 1VQFA 1NUCA 2KEDA 1F9PA 4RFBA 3C1EA 1LTSD 4M8AA 3SK5A 3HOXG 3ND8A 4FXKC 3MAQA 2OQKA 1LTTD 1EFID 4CGYB 1ICWA 3H3VI 3L2PA 1PV4A 2M9VA 1NAPA 2AHOB 4K0KQ 4N8FA 2CKZB 4KMUC 2O2LD 1ET9A 5IYCH 5ELCA 1EQQA 3RLOA 2OQ0A 4NPSA 2E2HB 4JBMA 4KK7A 1VQ4A 2BE5C 4K8JA 1GVPA 3A55A 2DGYA 4A3BG 4Y52H 5J39A 1NNXA 1QZGA 5EPKA 1QNUA 1E22A 4QUCA 2OEOA 1F2LA 3OMGA 5HGTA 1Y8NB 4NB3A 1HPCA 2A68D 2QW7A 4DR6Q 3T1HQ 1YHQA 2F0VA 2UUCQ 4FF2A 4JBWA 1OO9B 4XQNA 3BDLA 5GROA 1BKBA 4DV1Q 4N9PA 2NVYB 2E2HH 1SN8A 1EY7A 2RSOA 3JAML 1HR0L 1PFNA 3CMEA 4L5TA 2VQFL 4OO1G 1RODA 1NBWA 4P2CB 5EPLA 1MJCA 2Y0SE 1EZ6A 3CQZB 1XMQQ 1KABA 5JJLA 4K6DA 3FKIB 3P75A 1C9OA 3FDTA 1PH8A 1Y1VB 4JCVE 5IIFA 2JA5B 2ZTCA 3QO2A 3AEVA 4WORA 2F3WA 3CRLC 3J7A5 1CQFA 1UE5A 4WFN3 2K5NA 4JI3L 2UU9L 2XSCA 3WWVA 3HZXA 1FGUA 1T5EA 1T9HA 4K2KA 2KBNA 4FF3A 3I4NB 2F0EA 2GVAA 4JI6Q 3F2DA 2NVYH 3A54A 3AFPA 4L5SA 1G51A 2CW0D 4FXGC 1EWCA 2Z1CA 1CI3M 2HDMA 1FGBD 3E0JA 2EYPA 1F77A 4P73A 3TRZA 3CQZH 3KJPA 3FKIH 2BCOA 3HG9A 1Y1VH 3U9SA 4RCOA 2JA5H 2A6HC 3I4LA 3F1ZA 5T1GA 1JE5A 2AUKA 2AWNA 2NBFA 4IURA 3MTSA 2DNCA 2IW3A 2X6LA 1BXTA 5FLMH 4DK3C 3VA7A 1YNJD 3UDGA 4RAUC 2EIFA 2D2CC 2NZHA 2Z8LA 2ALYB 1D6EC 5J22A 1SMXA 1K8AC 3I4NH 2RQXA 1GUGA 1IBLQ 1UE1A 2BH8A 2TSSA 2WP8J 2F3VA 3J80L 1OXXK 3OIPA 1BCPF 3OTOL 4FO2A 2CVRA 2F52A 2RF4A 3CCMA 4BY1B 4AYBB 4OEMB 3HOUG 1Q1BA 3J81c 5C44G 1VQ7A 3E9IA 1UE7A 5CV4A 1MSGA 2EZVA 4DR5L 1AE3A 1LT6D 4JI8Q 4HIMA 5M9OA 3WOFA 1R4QB 1AW7A 1LYLA 5FO7B 1WTRA 3J7YW 2WIIB 4J8QA 4B08A 2KCNA 1FJGL 1N34Q 1ESFA 5KGUA 3MEFA 3HOZB 1EYGA 1Q1EA 2UXCQ 2DJFC 5CV8A 3K6OA 5LMNL 4ZKBB 4BY1H 1HTPA 1AFPA 3C1FA 4JW0A 2L4NA 1PZID 2E76C 3LNNA 2Q8RE 1D5ZC 1PZJD 3X3MA 3L3OC 2JXMB 4B9XA 4FF1A 4PG3A 3HOVB 1PTOC 2JA7G 4PMWA 3BDCA 2PNHA 2RDGA 4A3KB 3UDFA 3PUVA 2UUBQ 1TWGB 4DV4L 2E74C 2EJFC 2L0CA 4B3TL 1H9MA 1U0LA 2A69D 5CORA 1YNXA 3HOZH 5CYUA 3W5OA 1A2TA 3VYSA 2OTJA 3MXPA 1MKHA 2EYLA 4U68A 2XN9C 4LUOA 1PH5A 4IJHA 2R92B 3SVMA 4DV7L 2B3GA 1DYQA 4B3ML 4HTHA 4ULLA 4DV0L 4ZLTF 2K50A 1H9SA 1V43A 4OELB 4LF8L 2KHSA 1FR3A 3K7AB 4JI1Q 3GTKB 4DUZQ 1STBA 1QUQB 4GKJL 2GVBA 4R4CA 1LM0A 5C0XI 4Q5VA 5IT9L 4A3KH 2PQAB 4BBSB 2HCCA 1TWGH 1LTBD 1PMRA 2EY6A 2F0MA 3QJYA 3TN2A 2J7ZA 1NSNS 1LO5D 2JA9A 4I7ZC 3S15B 1CKNB 2ENBA 2IX1A 5ELOA 4XQQA 4QY7A 1VQ5A 2A73B 3F2UA 1BNZA 4H13C 2R61A 1VQAA 2R92H 4X65Q 2VUMG 1S5ED 3D31A 2N3SA 5D14A 1KTKA 1V9PA 2CCZA 3K7AH 3LX0A 3GTKH 5EPJA 1QUQA 1X55A 1EY9A 4Z9CB 1KDAA 3PIOA 2PQAA 1J5EQ 1K8MA 4BBSH 3DWQA 2F0GA 2ZXRA 1A3TA 2Z9HA 2HQEA 1XPOA 3J7ZC 1GHJA 4IPHA 4AH6A 1MI2A 5KYLA 1Q82C 1SYEA 3M7NA 3S15H 5CV5A 3W2DA 1B2TA 2CQAA 5JJZA 3G4SA 4N8X1 3RUZA 1PXUA 1EIGA 4YHHL 4HEDA 2IT1A 3CCUA 4YY3L 1TXYA 1SE2A 1UEAB 4A3MG 3KDFA 2GN5A 4UY8C 4QCLA 3I7FA 1KL9A 4CKEA 2L12A 3CCSA 1U4LA 2JSOA 2N55A 1YNNC 2N78A 2Z6KC 1XXGA 1EQTA 1L1OA 3OYYA 1O7IA 3OWEB 4FXDA 3EVQA 3I8ZA 1SFOB 4UHVA 2JN4A 3ER0A 4KY6A 2B29A 1LT4D 2KEEA 4DGZA 3AMUA 2XTIA 2B39A 4X66Q 3UI2A 1EYDA 4XYOA 2N49A 2Y0SG 3NTHA 3GTQB 1Y14B 2DNEA 5CBEE 4L5RC 2Z0SA 3GTLB 1QNKA 4IUNA 4X6AH 1JOKA 1VQ8A 5E4WC 2HDLA 5EQ0A 4AYBE 2A6ED 3KJOA 1SNPA 2WFWA 4DF7A 4XDXA 1XMOQ 2J0TD 3HOVH 2YTYA 2UXDL 5EJWA 3LWUA 3NSWA 5IP9H 3A7LA 1SFOH 1CKOA 1DOKA 3TP5A 2JP1A 3DM3A 1NR2A 2EDGA 4WJ3M 4G4KA 2B2WA 1IL2A 1V1PA 4RG1A 3CCRA 3GTPB 1LABA 1Q8KA 5JVH3 4LFBQ 1SBBB 3DEPA 3GTQH 1YVCA 4BBRB 4BY7G 2C9OA 5NUCA 1BBUA 1JOQA 4DV3Q 5FOBB 1UNSA 3GTLH 4KHVA 5AFWA 2VB2X 1W3SA 2K04A 5D65A 1EY8A 2ZXOA 4RMFA 1HRJA 5ELEA 1WCMB 5IP7G 3JAMi 3D6CA 5IGGA 2SEBD 3PUZA 4B3SQ 5C5MA 2KJXA 3Q24A 4G7ZC 3OWFA 2MFIA 3MXNA 3GTPH 4DV6Q 4LAAA 1XNQL 1EY6A 2VS1A 4RH6A 4BBRH 2D0PA 4PQXA 3J7AV 1ET6A 1SDFA 4ALPA 4A3JB 3TEHB 5C4ZA 2F0HA 3F2CA 1IBML 1J8IA 4KN4C 3KBGA 3TZUA 4IZ8A 1V8QA 1PFBA 4P72A 3L7ZC 1WCMH 3VR6A 5IYCG 1Q3LA 3QOJA 5M5XB 1YHBA 2A19A 2QDBA 1KNEA 1N33L 1EEID 2O4XA 2MUYA 2B2YA 4BS9A 3IFTA 1HFNA 4C56C 3CP0A 3KF6B 2PCFB 1VQDA 5IWAQ 2R7ZB 1TWHB 1HCZA 3PIPA 2NVXB 2PNRC 1LTAD 2LY7A 4DV2Q 4NDXA 4CJ0B 1ASZA 5C4XB 4DUYQ 4A3JH 2RA4A 3S1QB 3MC0B 3S2HB 2UUAL 2WKCA 1J6QA 5JAVA 3J80E 1U4MA 4YCVA 4IJLA 1STGA 4UDUC 2LXJA 4KKUA 2NVTB 2EYFA 2EXDA 2Z4IA 5M5XH 3KLSA 1IBKL 1E2VA 1MIUA 1BCPD 4JV5L 4RKBA 2O5IC 4E6IA 3VR2A 2VQEL 2R7ZH 1TWHH 2NVXH 2MP1A 2EE1A 4FP5D 3FP9A 1E2WA 1A8VA 1NMGA 3M9BA 4A3LH 3ITPA 5C4XH 4TQUS 1S5DD 2F0FA 3S1QH 2NN6H 3E5SA 4J15A 4YWKA 3T16A 1HNZL 3S2HH 3E3XA 1Z9FA 2YYZA 1R9TB 4LFCL 4DR4Q 2V1CC 3CD6A 4IUUA 5T1IA 4B3RL 2PZTA 3QG1A 4JI7L 4NXML 2NVTH 1MHWC 4H7BA 3OW2A 3VA5A 2EYMA 4JI4Q 3NBHA 1PH7A 2F0IA 4DAMA 3HOWG 2B2VC 4OIJA 4FF4A 2HQLA 2WINB 4NP5A 1IL8A 1CHPD 5JPNC 1VQNA 1LT5D 3SR1A 3CCEA 3FKIG 2WAQB 1Y1VG 4BWGB 2JA5G 3KF8B 2F4VQ 4OX9L 2ICIA 1R9TH 1C0AA 2H1EA 4RHRA 3EFXD 5L37A 3AYHB 2XNAC 4XYQA 3BS1A 2M2LA 3V2TA 2Q2IA 3Q22A 5I2XA 5CR3A 4LF6L 5F2DA 3I4NG 1GUOA 2I5MX 1J9OA 2B8GA 2Z4HA 4BA2I 3BU2A 1XWEA 4I7AA 1AN8A 5C0XJ 1WTVA 4JYAQ 2I0QA 2UU9Q 5E7NA 3KOJA 2NTTA 1F9SA 2Q2TA 5IT9E 3MFYA 4JI5Q 3D4DA 3KF8A 2JA6B 1ZYRC 1SE3A 1I94L 2EXZA 1EQRA 3PSIA 1YHAA 1EEFD 4PZ7A 4KTAA 5M3MB 2VZAA 2YV5A 3FVQA 1ENFA 5BN3A 2Q2UA 2PMZE 1JMCA 1SXTA 1AZQA 3WDNA 5CV6A 4EQOA 4CDCC 2BDNA 1BBWA 5TSSA 4C3HB 4DR3Q 4KLKA 4GN4B 2KVMA 3I4MG 1Q7YC 1PRTC 2KA7A 1Q81C 3FHWA 1SNCA 2QF7A 4IPGA 1I6VC 4L63B 1O7LA 3ULPA 2OTLA 1W6KA 4BY1G 4AYBG 4R8IA 1VS0A 4C2MB 5JVG3 1I4GA 1H9KA 3GP7A 4OGQC 4JI0Q 2ZTDA 2B2TC 3AU7A 2HHHQ 2VY3A 1WJJA 4KY5A 1T5XD 1EFWA 3WOEA 1K8GA 3M7GA 2JA6H 1Y69U 2H5XA 2YTVA 4OXPA 1U9RA 1QWYA 1E7ZA 3PV0A 2F0UA 3DWAA 1WVLA 1Q12A 1PVOA 1S4ZA 5M3MH 1O7ZA 1KDCA 4A3IB 5BN5A 1CM9A 3BVGA 3HOYG 1I50B 4IQZA 5JEAG 4IUVA 2D62A 3D0FA 3HOZG 5M5YB 1I6HB 4C3HH 3K59A 1KDBA 3CC4A 1U5KA 1SMYD 1N32L 4HSVA 3CMAA 1EYCA 1SROA 1GM5A 1QILA 1NR4A 2R7DA 3BJUA 2N8NA 4LFAL 4C2MH 2K33A 2F1MA 2K32A 5HURA 4JPBW 3HGBA 1LV9A 4KKSA 3J80c 4LF7L 3A8KE 3NBIA 5EKIA 5LMNQ 1SJHD 3PO2B 4LUVA 1YIJA 1XJVA 1GUSA 4A3IH 5C3WA 4A3KG 2NB0A 1HUMA 1I50H 3NEMA 5HY6A 5G3LF 1SNMA 4KHPQ 5M5YH 4QQBX 5GAHC 1I6HH 4ME5A 2LS01 4KV6A 4KJNA 1OXVA 1PH1A 2E2IB 4DR7Q 1PYBA 3M85A 2R92G 4X64Q 3CU7A 2F0JA 2R3ZA 4MZ9A 2JA8B 1KHIA 4ME3A 5CV7A 2YTXA 2TMPA 1C48A 3BDOA 3J81j 4Y7NB 1N36L 4TKOB 1PH9A 2ASBA 3PO2H 4KD3A 5BN4A 1IYJB 5M5WB 1X3QA 1VQCA 1E1TA 5C5LA 5ELDA 4OO1I 1CFMA 4A93B 3ONAB 2EYJA 1EY5A 1G6PA 1LUZA 1TS2A 1TWCB 1ONLA 4IALA 5BR8L 2IPKD 5ELFA 1HZAA 2E2IH 3I2ZA 1HZBA 3NTIA 3SK8A 1GHKA 1HZ9A 4PZ8A 2JA8H 4CJ1B 3S17B 4A3LG 3Q0AA 3NELA 4Y7NH 1STYA 2WAQE 1D1IA 4C3IB 4JVZA 1VQPA 1SYGA 3IKJA 5M5WH 2JK8A 4OHJA 2ES2A 1G8ZD 1VDZA 1JJ2A 1PYSB 2BE5D 2PZWA 4L8JA 4DR1Q 3OIQA 4A93H 4EVOA 4JI2L 1AH9A 3K5NA 3LWEA 4XIGS 1CK1A 5KIXA 4IUQA 5LMUL 3B6YA 1TWCH 3T53B 1LTGD 5IT9c 3FEWX 1HNXL 4LF9Q 2ID0A 1HZCA 3GV3A 4ZCKA 2PI2E 2K5QA 1G6ZA 3A5ZB 3URYA 3S17H 1TWFB 1HXYD 3HOVG 5IYBH 4C3IH 5H1SE 4NXNL 3OPOA 3RD4A 5C3EG 4UAIA 5FKAC 1RJTA 2K75A 2IX0A 3N52A 5IP9G 1ASYA 2MJ8A 1HNWQ 4EX5A 1HUNA 2X69A 3G6EA 3A8IE 2K01A 1HJPA 3K0XA 3S1NB 4ZKCB 2E75C 4DNTB 4RGMA 1RKNA 3KYHC 1VQGA 3TP6A 2Z6BA 1QOHA 1ILQA 3PGZA 4K0KL 3M4QA 3PIO3 1SE8A 3RZDB 4R4TA 4CJ2C 2IHFA 3W3AA 5KNBA 1TWFH 2BH2A 3A8JE 3S9WA 1E1OA 3CF5A 2EY1A 1II3A 3TS2A 4JOIC 1VF5C 2M00A 2JQOA 1EIHA 5I4DA 1GO3E 1U4PA 1EQVA 3DLLA 1H9SB 3EA6A 2ICEC 4MN3A 1VMCA 3VYUA 2NZOA 3S1NH 4F8MA 1H95A 4X3UA 3CCLA 3A0JA 3Q23A 2K6AA 2NYZD 3ZJYC 4BBRG 3BZDB 1S5CD 2PQEA 3D6WA 4DXGA 4A3BB 3H3VH 1O80A 1FD7D 2A6HD 4DR6L 3RZDH 4ZRZA 3T1HL 5AJ3Q 3I91A 2UUCL 1X3FA 1B3QA 4K2LA 3U4VA 3UE0A 3G6JB 1E24A 4DV1L 4K14A 2Q2HA 2HIXA 2X6GA 1WTQA 2VB3X 2LSSA 4X3TA 3A5UA 4LF4Q 2R93B 1SYBA 3R8BA 5JJIA 1XMQL 2CHBD 1XTCD 4BXXH 4ABNA 1KLGD 2ZM6Q 4A3BH 3S1MB 4A3JG 1IZ6A 4CKCA 2K5VA 5IOCA 1U4RA 2B2UA 2G9DA 3H94A 4DV5Q 1TKWB 1PZKD 3P20A 1HA6A 2QA4A 2QEJC 4JI6L 4HMJA 1YJ9A 5IE8A 1K73C 2XWJB 5CBAE 3MZ5A 3KDFB 3ERSX 3I3CA 3TDQA 1N9WA 2R93H 4NMZA 2D9UA 1L1OB 1S3OA 4LUZA 1BR9A 3J81L 3NHHA 3PUWA 1XNRQ 3NUCA 1A0IA 4X62Q 2QDLA 1HH2P 1JT8A 1C8CA 4OWWB 3S1MH 5C4XG 2CFMA 2NN6G 3CCJA 1N8RC 3PF4A 1PTOD 3CCVA 4HJ9A 2OWOA 1DOLA 1D2BA 3MVVA 1ESRA 4ODGA 1WOCA 1FVIA 1JCKB 5LHY1 1IBLL 1DONA 1IW7C 3H0GG 1EL0A 3K5MA 1BQQT 4MTKA 4HSPA 4LNQA 1HA5A 1KNAA 3GD7A 3Q8DA 4GNXA 4IOAA 3CHBD 2I5HA 3PQIA 4A3CH 1LTRD 4JI8L 4ZUJA 2VXWA 2ZJRA 4DR2Q 1DD2A 1B1ZA 1VQOA 1V1PB 3U9OA 4LJZC 2UXBQ 1EIFA 2DUDA 4XXEA 3QB3A 3U4ZA 1N34L 4DN4M 3Q6SA 5GQOA 1SJED 4YIJA 5JEAJ 3PIP3 3EJIA 3H09A 4BA1I 2KECA 2UXCL 4FNFA 4A3DB 1JJGA 3AB9A 1X65A 5DM73 2EVBA 1PRTF 4LFCQ 4GZYC 1YZ6A 2QKIC 4B3RQ 1MBYA 3HRZC 1STEA 3HFZB 3NXWA 4IFDG 4MIUA 2WAQG 4LW1A 3TREA 3MXNB 3DWPA 3I70A 5EKKA 3MA2B 4OL7A 2UUBL 4FDBA 4ZQ3A 3T1YQ 1GUNA 4DAYA 1STNA 5FLXL 5C3XA 2F3IA 5G3LD 4IFDI 2XVSA 3NE5B 5IGEA 4QL5A 3TP8A 3PUYA 1WTOA 1VCIA 4XT1B 4DK6C 1X9NA 4POGA 3JAME 4A3DH 3QR8A 2E5LQ 3EBEA 4F88A 1ENCA 2F0OA 4DNIA 4EQ5A 1NTGA 2RSNA 4AQYQ 1Q8IA 1X3EA 1E3PA 5K36H 2OXPA 4JI1L 4IN3A 1E0BA 3SEBA 1CKMA 3E0EA 1YNND 1QB5D 4GLVB 4DUZL 2EPBA 3EQLC 2JA6G 2HIVA 4S3SA 4NKLA 5D3IB 2CQOA 1UUPA 1X32A 1QVGA 4WJWA 4AIMA 3SDZA 5M3MG 4A4IA 1LACA 1KRSA 1OXSC 2QILA 1TR5A 3FPPA 2OF1A 2AQ2B 2F0QA 5DM63 1CSPA 4UP7A 4C3HG 2FXQA 4CDFC 1PFMA 1LTLA 4C1NK 1DJRD 1BO0A 1IKMA 2ZJQA 1CZGA 1Q46A 4X65L 4QIWB 4EGVA 3I55A 1VQKA 1PHJA 3GTOB 5C6AA 2Q8IB 3R2TA 2PW5A 3STBC 2FHTA 4C1NI 1TS3A 3RNUA 2LKVA 4KI0A 1ILPA 4HIOA 1F9RA 5EKLA 4K5WA 1J5EL 5C0XH 4LF5Q 3S1RB 4A3IG 3BVZA 3U50C 5M3FB 2JYOA 2E2DC 3RN2A 1GUTA 1SNOA 4DA2A 3BYTB 4MHEA 3IFDA 1D1KA 4R9WA 1X3GA 1SRUA 3L9AX 3H3VC 4RGNA 4DK1A 4FYDA 1HFGA 4OONA 1BBXC 3V96A 3NBHB 3NQTA 3PF5A 3GTOH 1JWUD 2PZUA 3RLNA 4IO9A 1A2UA 4DAPA 5CV9A 1I4HA 1B70B 2LXKA 3TBIB 1C7YA 3RMHA 2MO0A 3S1RH 3PO2G 2QGQA 1VQLA 2JEAI 4X66L 4V0BA 2RHSB 1X6OA 2L9HA 3J7AF 5M3FH 3TP7A 4QGUA 5KNCA 4YCWA 4QB4A 5KEEA 4LWCA 4LF7Q 4TRDA 3S24A 3CC2A 2WKDA 4DFAA 2C35B 3DXJC 5DLQE 4DNRB 3H6MA 3GTGB 4IOCA 2A5HA 4HJ5A 5C4HA 1XMOL 1VQBA 1I3QB 4ZUIA 4GS3A 2JA8G 3I56A 3K5LA 4GN3B 1LLRD 3M4PA 3RLFA 5I9OA 3X3NA 4RWSC 1JORA 4CKBA 1RL2A 3VYTA 1SNQA 4UPAA 1W6JA 5C4JB 1HR0Q 4LFBL 3S14B 4A93G 2VQFQ 2Q8TA 3UDXA 2SDFA 5FLMG 3U58A 4DU9A 3UE1A 3BVMA 4DV3L 4HJAA 1WTWA 1K28A 4DK0A 3GTGH 2J4XA 2EY2A 4JC0A 1I3QH 1B8AA 4JI3Q 5ELBA 2HT1A 1QG7A 4BY7B 1ZXTA 1VF7A 4C3IG 3ULLA 2I46A 5IGBA 4B3SL 1SSOA 1I4RA 2B63B 2FMCA 3E6ZX 4A3GB 4GLXA 2KOLA 5IYDH 1I4QA 3TQYA 5IY0A 1L1OC 4C3JB 2F0KA 1CTMA 3D4WA 3JAMc 5C4JH 3ICEA 4DV6L 3S14H 1PTOF 1WTPA 3K8AA 4MNOA 4RCNA 1HTLD 3SHLA 1G2SA 2F0NA 1H9JA 3TZDA 3QOLA 1B3AA 2A68C 4DAVA 2K1BA 1Y1WB 2MO1A 1WD0A 4HN7A 3S2DB 4BY7H 3HS0C 1XYIA 5IODA 1VQEA 2B63H 5DNFA 3J81i 4A3GH 3I90A 3H91A 2EY5A 1KIXA 5EGTA 4C3JH 1JB7A 1RTOA 3K80C 4F87A 4O1NA 1L0WA 4P74A 3OTOQ 1OXTA 1MSHA 2AKWB 1TVXA 5IWAL 1A3VA 2KCTA 3PO3B 4ILWA 1K83B 2IL8A 1L0YB 2B2WC 2G9HD 1DGSA 2B8FA 2IJ0A 4DUYL 4DR5Q 4QUFA 1R4PB 3PCOB 1NCVA 4YWMA 2RCNA 3R3OA 5A2QL 3MWYW 1GKHA 2A8VA 1Y1WH 1XPRA 1KD1C 1SYDA 1I4PA 3S2DH 1HQRD 1IYVA 3G7LA 3CPFA 2IY5B 1FJGQ 5JOBA 1JJCB 1FNWA 2V4DA 2R7FA 3GQBA 4TSSA 4WRDA 3OW7A 3GO5A 4MTNA 2CW0C 3M3YB 1TS5A 2L11A 3GDEA 4PMBA 4B9WA 1E2ZA 4M1UB 1CA6A 3PO3H 2EJGC 4G57A 3RR5A 1K83H 1TY0A 1CZWA 4BXXG 2D5DA 5I9PA 2P5ZX 3KUPA 1NJIC 1ZYRD 2MGSA 1PH3A 4DR4L 1YNJC 3M4OB 1B9NA 1NMFA 1B4OA 2ZXPA 1BF4A 3PUXA 4DV4Q 4B3TQ 4JI4L 2FINB 1VQ6A 4CBVA 1SAPA 2K5HA 2KHIA 1F2MA 3M3YH 4A3EB 1PRTD 3ND9A 4UP9A 1EOVA 2R93G 2Z6KA 4UP8A 4BBSG 1GUWA 3VYRA 3CCQA 2B2YC 4IFDJ 4K5VA 1IYUA 3W1BA 4DV7Q 3I73A 3MXGA 1SYFA 4B3MQ 5FLXE 3K81C 3HOWB 2F4VL 4DV0Q 2L55A 1LT3D 4LF8Q 1EU4A 4A3FB 5FJ8H 2CWPA 3M4OH 4GKJQ 4PV1C 2E8GA 2HCIA 2KUMA 5CMDA 4GLAC 2HD3A 3AQQA 1TS4A 3HEJA 1PDQA 3SK4A 3SE0A 1DM0B 2FJ2A 3FMCA 4A3EH 1BCPB 3NQIA 1DOMA 5JJKA 1EWHA 3N6RA 4JYAL 1RDPD 2RBMA 1KLUD 3CPWA 3DUZA 1KAWA 4A3CG 4JI5L 1D8LA 4HIKA 5LMNW 4GKKL 1QVFA 3TMEA 2DY8A 3HKZB 1C4QA 3HOWH 1EYAA 5I2YA 4A3FH 3W1GA 2CH4A 5LL6S 4JG2A 2KQ3A 1S5BD 1QE6A 3D3RA 4A76A 3VR4A 2WV6D 1TQOA 4EQPA 3UDIA 4PZ6A 3DMUA 1K3RA 1X3PA 3BG3A 2A69C 4X3SA 2EYHA 1UE6A 1TT2A 2WB1B 5J3BA 4DR3L 5IGDA 2VL6A 3T13A 2K4KA 4GOPB 1AZPA 1B44D 2K5WA 3F2BA 2K14A 4JK1C 4HIDA 1JWMD 4YHHQ 4JI0L 1FYCA 2HHHL 4YY3Q 4YWLA 4L5QA 2F0TA 3EIVA 4HCEA 1HQMC 3I4MB 1TWAB 2VNUD 3OSOA 4K5XA 2EJMA 4KHZA 2NVQB 2A74C 2IWHA 3BZCA 3NWSA 1AE2A 1YI2A 1EY0A 1G291 1IHZA 3OMCA 5EBDA 4HMIA 4KY7A 3OHXC 4LK1C 2K05A 2L5TA 2XWBB 3QWNA 2AQ3B 1RCVD 4G7OC 1QJOA 3HOXB 1VQJA 4GOPA 2K03A 4A3DG 1P8LA 2NWGA 2A1AA 3HOYB 3NWTA 1AEXA 1WD1A 3PMFA 1A3UA 1OXUA 3IL8A 3KK7A 3I4MH 5K36G 3MEHA 1TWAH 3KFUA 1B9MA 1JOOA 2F0WA 2NVQH 2UXDQ 5EBCA 4KD4A 1PH6A 4XT3B 4CHTB 1EU3A 4KHPL 1K0SA 2OCEA 2ZJPA 3HOXH 1Z6HA 3IRBA 1I4XA 1WCMG 2NZ1D 4DR7L 1XX8A 1IKLA 3VDYA 2EYOA 3HOYH 2MHVA 3O13A 3NTKA 1VQIA 3EN2A 5JEAH 4X64L 1KAAA 2E2JB 3C2PA 4QJFA 1V1QA 4IPCA 5HGQA 3K57A 2YU9B 2I5LX 5GADC 2F0LA 1Z47A 1BUVT 2CWAA 2L15A 3CXCA 5C0XG 2EQSA 3D4RA 4KKTA 3DM1A 4HR7B 5ISRA 3CRKC 4OWXB 4FVMA 4ZAIA 3S16B 3HKSA 1JQYD 1XNQQ 1FNUA 2XGTA 1WI5A 5ELNA 3SGIA 3K5OA 1NY4A 4O2DA 1B53A 3MFGA 1DXMA 5FLXc 2A6EC 5FK9C 1IBMQ 3I72A 2MQHA 2E2JH 2I07B 1CSQA 2ZTEA 1WTXA 1K9MC 3RN5A 4ZK9B 4QF4A 2KENA 4GNXB 2R7ZG 2YU9H 2B2VA 4IUPA 3NP8A 3K58A 1ZEQX 5CGKA 4A75A 4IPDA 4R4QA 4R8NA 1N33Q 3FRPB 4DR1L 4OO1H 5M3FG 3S16H 2QEXA 3SXHA 2NUCA 1A63A 4P71A 1GD7A 1S72A 3T56B 5I6YA 4LF9L 5D3DA 2NN6I 3KLWA 2C5CA 1H9RA 1M4VA 1Q90A 3ERQA 3IAYA 1YJWA 1PLFA 2ATWA 2UUAQ 1KQSA 1CKNA 1PFSA 1NE3A 3M4YA 5K5PA 1UAPA 3HKZE 1F2YA 1HNWL 2LFNA 1PRTB 3G71A 3TSSA 1Y8OB 1PH4A 1IBKQ 1RIPA 4L6TB 3T4AC 2KHJA 3K0YA 4J1MA 3T51B 4JV5Q 1QVCA 3BYYB 1STHA 3HOUB 2VQEQ 5C44B 5A2QE 1JC7A 1JWSD 5C3EB 2WB1E 4K6LA 1CT1D 2K28A 3CAMA 4KJOA 4DAYB 4P75A 2RVLA 2AWOA 2GA4B 3KLSX 2RHQB 1YEZA 1PYWD 1HNZQ 2FMMA 2SNSA 1ZKOA
chains in the Genus database with same CATH topology
1EOTA 1ML0D 1SYCA 1MD2D 3D8GA 3R93A 2EOTA 2H4OA 2RDFA 4OIKA 3CKIB 2K5DA 4ZYSA 2XRSD 5KNDA 4F7XA 2B2TA 3R2IA 1Y8PB 2PW7A 1L0XB 1D5XC 4U673 2IX3A 1JE4A 1DCZA 1CA5A 2KCCA 2JA7B 2BDOA 3FPUB 3A7AB 1SNDA 1Z7TA 1QCBD 4O42A 5E3FA 2F0DA 1DZ1A 5FO8B 3V05A 2R6GA 1JB3A 1RTNA 3GTMB 1BCPC 4IUTA 4HCSA 1IW7D 5FO9B 4C3JG 2PMZB 1SE4A 4EQNA 3HP3A 3OOCA 5E4XA 2FFKB 1CHQD 5LL6X 3VR5A 1K8OA 5CC4A 3MHBA 5DAUA 2F03A 1MGSA 4RHSA 1ENAA 2N88A 2BOSA 3MXUA 1F9QA 4DXFA 4H44C 3NK9A 4RGTA 1EY4A 2VUMB 3DEOA 3GTJB 2BA1A 3C46A 3RZOB 1RD9D 3GV6A 2JEBI 1CQVA 2PPBC 2DY7A 4Q0FA 4G7HC 1GXDC 4K8IA 1AP0A 3NPPA 5KYIA 2L1BA 2LMCB 4PMCA 5J1ZA 1M8AA 2OT2A 4A3MB 4H0LC 3H0GB 4HAEA 2F0SA 3DHQA 1BOSA 3P7JA 4RKLA 3SK6A 1HHVA 4XQJA 2B2UC 1O7YA 2RKSA 2Y0SB 4NW2A 2O5JC 2RDHA 1JR0D 2SNMA 4RGOS 1O78A 3KBXA 5E1FA 5IGFA 4N9TA 1GJXA 1TIID 1G91A 1JICA 1GOZA 1RF2D 1VMPA 2PO4A 5A35A 4I65A 2QCPX 5COYA 2XRQD 3P1HA 4PNYA 3VR3A 2HUGA 1PTOB 4J6HA 2SOBA 1A15A 1STAA 1D5MC 4KN7C 3KLRA 2PYKA 3ZYYX 4XTCS 4ID6A 4LMQD 2NTSA 2DN8A 1SMYC 3A56A 1LTID 3QIAA 5JPMC 1TU2B 4QMGA 2ZT9C 1F2ZA 1RHPA 5DEHA 5KRUA 1G2TA 1PTOH 1TY2A 4X3KA 4IFDH 2JE6I 3C3LA 1EZ8A 4RA8A 1B50A 2F4IA 1A6XA 2WACA 2BA0A 2XIWA 2K7VA 3J81E 1BDOA 2MPMA 2AUJD 5I6WA 1V1OA 3EROA 4V190 1FNVA 1S5FD 1SEBD 5IGCA 2F0PA 2AQ1B 1NUCA 2KEDA 1F9PA 4RFBA 3C1EA 1LTSD 4M8AA 3SK5A 3ND8A 4FXKC 3MAQA 1LTTD 1EFID 4CGYB 1ICWA 2M9VA 1NAPA 4KMUC 2O2LD 1ET9A 5ELCA 2E2HB 4KK7A 2BE5C 4K8JA 3A55A 5J39A 5EPKA 1QNUA 4QUCA 2OEOA 1F2LA 3OMGA 5HGTA 1Y8NB 1HPCA 2A68D 2F0VA 4FF2A 4JBWA 1OO9B 4XQNA 3BDLA 4N9PA 2NVYB 1EY7A 2RSOA 3JAML 1PFNA 4OO1G 1RODA 4P2CB 5EPLA 1EZ6A 3CQZB 1KABA 4K6DA 3FKIB 3P75A 3FDTA 1Y1VB 5IIFA 2JA5B 3QO2A 4WORA 2F3WA 3CRLC 1CQFA 4WFN3 2XSCA 3HZXA 1T5EA 4K2KA 4FF3A 3I4NB 2F0EA 3A54A 2Z1CA 2CW0D 1EWCA 4FXGC 1CI3M 2HDMA 1FGBD 3E0JA 2EYPA 1F77A 2BCOA 3HG9A 3U9SA 4RCOA 2A6HC 3I4LA 5T1GA 2AUKA 2AWNA 2NBFA 4IURA 3MTSA 2DNCA 2IW3A 2X6LA 1BXTA 3VA7A 1YNJD 4RAUC 2D2CC 2Z8LA 1D6EC 5J22A 2RQXA 1GUGA 2TSSA 2WP8J 2F3VA 3J80L 1OXXK 3OIPA 1BCPF 4FO2A 2CVRA 4BY1B 4AYBB 1Q1BA 5CV4A 1MSGA 2EZVA 1LT6D 5M9OA 3WOFA 1R4QB 1AW7A 5FO7B 1WTRA 3J7YW 2WIIB 4J8QA 4B08A 2KCNA 1ESFA 5KGUA 3HOZB 1Q1EA 5CV8A 3K6OA 4ZKBB 1HTPA 1AFPA 3C1FA 2L4NA 1PZID 2E76C 3LNNA 2Q8RE 1D5ZC 1PZJD 3X3MA 3L3OC 2JXMB 4B9XA 4FF1A 1PTOC 4PMWA 3BDCA 2RDGA 4A3KB 3PUVA 1TWGB 2E74C 2EJFC 2L0CA 1H9MA 2A69D 5CORA 5CYUA 1A2TA 3VYSA 3MXPA 2EYLA 4U68A 2XN9C 2R92B 3SVMA 1DYQA 4HTHA 4ULLA 4ZLTF 1H9SA 1V43A 2KHSA 1FR3A 3K7AB 3GTKB 1STBA 4Q5VA 5C0XI 5IT9L 4BBSB 2HCCA 1LTBD 1PMRA 2EY6A 2F0MA 3QJYA 3TN2A 2J7ZA 1NSNS 1LO5D 4I7ZC 3S15B 2ENBA 2IX1A 4XQQA 2A73B 3F2UA 1BNZA 4H13C 2R61A 1S5ED 3D31A 5D14A 1KTKA 3LX0A 5EPJA 1EY9A 4Z9CB 1KDAA 1K8MA 3DWQA 2F0GA 2ZXRA 1A3TA 2HQEA 1GHJA 1MI2A 5KYLA 1SYEA 3M7NA 5CV5A 3W2DA 1B2TA 2CQAA 5JJZA 3RUZA 1PXUA 1EIGA 4HEDA 2IT1A 1SE2A 1UEAB 4QCLA 4CKEA 2L12A 3HOVB 1U4LA 2JSOA 2N55A 1YNNC 1XXGA 1EQTA 3OWEB 4FXDA 3EVQA 3I8ZA 1SFOB 4KY6A 1LT4D 2KEEA 4DGZA 3AMUA 2B39A 3UI2A 1EYDA 4XYOA 3NTHA 3GTQB 2DNEA 5CBEE 3GTLB 1QNKA 4IUNA 1JOKA 5E4WC 2HDLA 5EQ0A 2A6ED 1SNPA 4DF7A 4XDXA 2J0TD 5EJWA 3LWUA 3NSWA 3A7LA 1DOKA 3TP5A 2JP1A 1NR2A 2EDGA 4G4KA 2B2WA 1V1PA 3GTPB 1LABA 5JVH3 1SBBB 3DEPA 4BBRB 2C9OA 5NUCA 1JOQA 5FOBB 1UNSA 4KHVA 5AFWA 2VB2X 2K04A 5D65A 1EY8A 2ZXOA 1HRJA 5ELEA 1WCMB 3D6CA 5IGGA 2SEBD 3PUZA 5C5MA 2KJXA 3Q24A 4G7ZC 3OWFA 3MXNA 4LAAA 1EY6A 4RH6A 4PQXA 3J7AV 1ET6A 1SDFA 4A3JB 5C4ZA 2F0HA 1J8IA 4KN4C 3KBGA 3TZUA 4IZ8A 1V8QA 1PFBA 3L7ZC 3VR6A 1Q3LA 3QOJA 5M5XB 2QDBA 1KNEA 1EEID 2O4XA 2MUYA 2B2YA 4BS9A 3IFTA 1HFNA 4C56C 2PCFB 2R7ZB 1TWHB 1HCZA 2NVXB 2PNRC 1LTAD 2LY7A 4NDXA 4CJ0B 5C4XB 2RA4A 3S1QB 3MC0B 3S2HB 2WKCA 5JAVA 3J80E 1U4MA 1STGA 4UDUC 4KKUA 2NVTB 2EYFA 2Z4IA 3KLSA 1E2VA 1BCPD 4RKBA 2O5IC 4E6IA 3VR2A 2MP1A 2EE1A 4FP5D 1E2WA 3ITPA 4TQUS 1S5DD 2F0FA 2NN6H 3E5SA 3T16A 2YYZA 1R9TB 4IUUA 5T1IA 2PZTA 3QG1A 4H7BA 3VA5A 2EYMA 3NBHA 2F0IA 2B2VC 4OIJA 4FF4A 2WINB 4NP5A 1IL8A 1CHPD 5JPNC 1LT5D 3SR1A 2WAQB 4BWGB 2ICIA 2H1EA 4RHRA 3EFXD 2XNAC 4XYQA 3BS1A 2M2LA 3V2TA 3Q22A 5I2XA 5CR3A 5F2DA 1GUOA 1J9OA 2B8GA 2Z4HA 4BA2I 1XWEA 1AN8A 5C0XJ 1WTVA 2NTTA 1F9SA 5IT9E 3MFYA 3D4DA 3KF8A 2JA6B 1ZYRC 1SE3A 2EXZA 1EEFD 4KTAA 5M3MB 3FVQA 1ENFA 5BN3A 1SXTA 1AZQA 3WDNA 5CV6A 4EQOA 2BDNA 5TSSA 4C3HB 2KVMA 1PRTC 2KA7A 1SNCA 2QF7A 1I6VC 4L63B 1O7LA 1W6KA 4R8IA 4C2MB 5JVG3 1I4GA 1H9KA 3GP7A 4OGQC 2B2TC 3AU7A 4KY5A 1T5XD 3WOEA 3M7GA 1Y69U 1U9RA 1QWYA 3PV0A 2F0UA 3DWAA 1WVLA 1Q12A 1S4ZA 1O7ZA 1KDCA 4A3IB 5BN5A 1CM9A 3BVGA 1I50B 4IQZA 5JEAG 4IUVA 2D62A 5M5YB 1I6HB 3K59A 1KDBA 1SMYD 4HSVA 1EYCA 1QILA 1NR4A 2K33A 2F1MA 2K32A 5HURA 3HGBA 1LV9A 4KKSA 3A8KE 3NBIA 5EKIA 1SJHD 3PO2B 1GUSA 5C3WA 2NB0A 1HUMA 5G3LF 1SNMA 4ME5A 2LS01 4KV6A 4KJNA 1OXVA 2E2IB 3M85A 3CU7A 2F0JA 2R3ZA 2JA8B 5CV7A 2TMPA 1C48A 3BDOA 4Y7NB 4TKOB 4KD3A 5BN4A 5M5WB 1X3QA 5C5LA 5ELDA 4OO1I 1CFMA 4A93B 3ONAB 2EYJA 1EY5A 1TS2A 1TWCB 1ONLA 4IALA 2IPKD 5ELFA 3NTIA 3SK8A 1GHKA 4CJ1B 3S17B 3Q0AA 1STYA 1D1IA 4C3IB 1SYGA 3IKJA 4OHJA 1G8ZD 1VDZA 2BE5D 2PZWA 4L8JA 3OIQA 4EVOA 3K5NA 3LWEA 4XIGS 1CK1A 5KIXA 4IUQA 3T53B 1LTGD 3FEWX 2ID0A 3GV3A 2K5QA 1G6ZA 3URYA 1TWFB 1HXYD 3OPOA 3RD4A 4UAIA 5FKAC 1RJTA 2IX0A 3N52A 2MJ8A 1HUNA 2X69A 3A8IE 2K01A 3S1NB 4ZKCB 2E75C 4DNTB 4RGMA 1RKNA 3TP6A 1QOHA 1ILQA 3PIO3 3RZDB 4CJ2C 3W3AA 5KNBA 3A8JE 3S9WA 2EY1A 1II3A 1VF5C 2M00A 1EIHA 5I4DA 1U4PA 1EQVA 1H9SB 3EA6A 2ICEC 4MN3A 1VMCA 3VYUA 4F8MA 4X3UA 3Q23A 2K6AA 2NYZD 3BZDB 1S5CD 2PQEA 3D6WA 4DXGA 4A3BB 1O80A 1FD7D 2A6HD 4ZRZA 3I91A 4K2LA 3G6JB 4K14A 2X6GA 1WTQA 2VB3X 4X3TA 2R93B 1SYBA 3R8BA 2CHBD 1XTCD 4ABNA 1KLGD 3S1MB 4CKCA 5IOCA 1U4RA 2B2UA 2G9DA 3H94A 1TKWB 1PZKD 3P20A 1HA6A 2QEJC 4HMJA 2XWJB 5CBAE 3MZ5A 3I3CA 3TDQA 4NMZA 2D9UA 1BR9A 3J81L 3NHHA 3PUWA 3NUCA 1C8CA 2NN6G 1PTOD 1DOLA 1D2BA 3MVVA 1ESRA 4ODGA 1JCKB 5LHY1 1DONA 1IW7C 1EL0A 3K5MA 1BQQT 4HSPA 1HA5A 1KNAA 3GD7A 3CHBD 1LTRD 4ZUJA 2VXWA 1DD2A 1B1ZA 1V1PB 3U9OA 4LJZC 4XXEA 3QB3A 4DN4M 3Q6SA 1SJED 4YIJA 5JEAJ 3PIP3 3EJIA 3H09A 4BA1I 2KECA 4FNFA 4A3DB 3AB9A 5DM73 2EVBA 1PRTF 4GZYC 2QKIC 1MBYA 3HRZC 1STEA 3NXWA 4IFDG 4MIUA 3DWPA 3I70A 5EKKA 3MA2B 4OL7A 4ZQ3A 1GUNA 4DAYA 1STNA 5FLXL 5C3XA 5G3LD 4IFDI 2XVSA 3NE5B 5IGEA 3TP8A 3PUYA 1WTOA 1VCIA 4XT1B 3JAME 4F88A 1ENCA 2F0OA 2RSNA 1Q8IA 5K36H 2OXPA 4IN3A 1E0BA 3SEBA 1YNND 1QB5D 2EPBA 3EQLC 4S3SA 4NKLA 5D3IB 1UUPA 1X32A 4WJWA 3SDZA 1LACA 1OXSC 2QILA 1TR5A 2OF1A 3FPPA 2AQ2B 2F0QA 5DM63 4C3HG 1PFMA 4C1NK 1DJRD 1BO0A 1IKMA 1CZGA 4QIWB 4EGVA 3GTOB 5C6AA 2Q8IB 2PW5A 3R2TA 2FHTA 4C1NI 1TS3A 2LKVA 4KI0A 1ILPA 1F9RA 5EKLA 4K5WA 5C0XH 3S1RB 3BVZA 5M3FB 2JYOA 2E2DC 1GUTA 1SNOA 4DA2A 3BYTB 4MHEA 3IFDA 1D1KA 4R9WA 3L9AX 3H3VC 4RGNA 4DK1A 4FYDA 1HFGA 1BBXC 3V96A 3NQTA 1JWUD 2PZUA 1A2UA 4DAPA 5CV9A 1I4HA 3TBIB 3RMHA 2JEAI 4V0BA 2L9HA 3J7AF 3TP7A 5KNCA 4QB4A 5KEEA 4TRDA 2WKDA 4DFAA 3DXJC 4DNRB 3H6MA 3GTGB 2A5HA 5C4HA 1I3QB 4ZUIA 3K5LA 1LLRD 3RLFA 5I9OA 3X3NA 4RWSC 1JORA 4CKBA 3VYTA 1SNQA 1W6JA 5C4JB 3S14B 2Q8TA 2SDFA 4DU9A 3BVMA 1WTWA 4DK0A 2J4XA 2EY2A 5ELBA 1QG7A 4BY7B 1ZXTA 1VF7A 4C3IG 2I46A 5IGBA 1SSOA 1I4RA 2B63B 2FMCA 3E6ZX 4A3GB 2KOLA 1I4QA 4C3JB 2F0KA 1CTMA 3D4WA 1PTOF 1WTPA 4RCNA 1HTLD 3SHLA 1G2SA 2F0NA 1H9JA 3TZDA 3QOLA 1B3AA 2A68C 4DAVA 2K1BA 1Y1WB 1WD0A 4HN7A 3S2DB 3HS0C 1XYIA 5IODA 5DNFA 3I90A 3H91A 2EY5A 5EGTA 1RTOA 4F87A 4O1NA 1OXTA 1MSHA 1TVXA 1A3VA 3PO3B 4ILWA 1K83B 2IL8A 1L0YB 2B2WC 2G9HD 2B8FA 2IJ0A 4QUFA 1R4PB 1NCVA 3R3OA 5A2QL 3MWYW 1SYDA 1I4PA 1HQRD 1IYVA 3G7LA 5JOBA 1FNWA 2V4DA 3GQBA 4TSSA 4WRDA 3OW7A 3GO5A 2CW0C 3M3YB 1TS5A 2L11A 4PMBA 4B9WA 1E2ZA 4M1UB 1CA6A 2EJGC 4G57A 1TY0A 1CZWA 2D5DA 5I9PA 3KUPA 1ZYRD 2MGSA 1YNJC 3M4OB 1B9NA 1B4OA 2ZXPA 1BF4A 3PUXA 2FINB 4CBVA 1SAPA 1F2MA 4A3EB 1PRTD 3ND9A 1GUWA 3VYRA 2B2YC 4IFDJ 4K5VA 1IYUA 3I73A 3MXGA 1SYFA 5FLXE 3HOWB 2L55A 1LT3D 1EU4A 4A3FB 4PV1C 2HCIA 2KUMA 5CMDA 1TS4A 3HEJA 1PDQA 3SK4A 3SE0A 1DM0B 2FJ2A 3FMCA 1BCPB 3NQIA 1DOMA 1EWHA 3N6RA 1RDPD 2RBMA 1KLUD 3DUZA 3TMEA 2DY8A 3HKZB 1C4QA 1EYAA 5I2YA 5LL6S 2KQ3A 1S5BD 1QE6A 3D3RA 3VR4A 2WV6D 1TQOA 4EQPA 3DMUA 1X3PA 3BG3A 2A69C 4X3SA 2EYHA 1TT2A 2WB1B 5IGDA 3T13A 1AZPA 1B44D 2K5WA 4JK1C 1JWMD 1FYCA 2F0TA 4HCEA 1HQMC 3I4MB 1TWAB 2VNUD 3OSOA 4K5XA 2EJMA 4KHZA 2NVQB 2A74C 2IWHA 3NWSA 1EY0A 1G291 1IHZA 3OMCA 5EBDA 4HMIA 4KY7A 3OHXC 4LK1C 2K05A 2L5TA 2XWBB 3QWNA 2AQ3B 1RCVD 4G7OC 1QJOA 3HOXB 2K03A 2NWGA 3HOYB 3NWTA 1AEXA 1WD1A 3PMFA 1A3UA 1OXUA 3IL8A 3KK7A 5K36G 3MEHA 1B9MA 1JOOA 2F0WA 5EBCA 4KD4A 4XT3B 4CHTB 1EU3A 1Z6HA 1I4XA 2NZ1D 1XX8A 1IKLA 2EYOA 2MHVA 3O13A 3NTKA 5JEAH 1KAAA 2E2JB 3C2PA 3K57A 2YU9B 2F0LA 1Z47A 1BUVT 5C0XG 3D4RA 4KKTA 3DM1A 4HR7B 5ISRA 3CRKC 4FVMA 4ZAIA 3S16B 1JQYD 1FNUA 3K5OA 1B53A 3MFGA 1DXMA 2A6EC 5FK9C 3I72A 2I07B 1WTXA 4ZK9B 4QF4A 2B2VA 4IUPA 3NP8A 3K58A 1ZEQX 5CGKA 4R8NA 3FRPB 4OO1H 3SXHA 2NUCA 3T56B 5I6YA 5D3DA 2NN6I 2C5CA 1H9RA 1M4VA 1Q90A 3ERQA 3IAYA 1PLFA 3M4YA 5K5PA 1UAPA 1F2YA 2LFNA 1PRTB 3TSSA 1Y8OB 4L6TB 3T4AC 3K0YA 4J1MA 3T51B 3BYYB 1STHA 3HOUB 5C44B 5A2QE 1JC7A 1JWSD 5C3EB 4K6LA 1CT1D 2K28A 4KJOA 2RVLA 2AWOA 2GA4B 3KLSX 1PYWD 2FMMA 2SNSA 1ZKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP8 A;  1SYC A;  5C4Z A;  3D8G A;  2F0H A;  3MZ5 A;  4TRD A;  3C1F A;  4DFA A;  3TME A;  1EZ8 A;  5C3W A;  4IZ8 A;  3H6M A;  1EYA A;  1EZ6 A;  1ENC A;  2F0L A;  2WAC A;  1KAB A;  4K8I A;  2RDF A;  3R3O A;  4K6D A;  4NMZ A;  2F0O A;  3V2T A;  2KQ3 A;  3P75 A;  4B9X A;  3NHH A;  1SNM A;  5C4H A;  3NUC A;  1TQO A;  5CR3 A;  4EQP A;  5IIF A;  5KYI A;  1SYD A;  5F2D A;  4ZUI A;  4PMC A;  5ISR A;  3DMU A;  4F7X A;  4WOR A;  1RKN A;  2OXP A;  2F3W A;  3EVQ A;  3QOJ A;  5J1Z A;  4ME5 A;  3TP6 A;  2EYH A;  2QDB A;  2PW7 A;  3BDC A;  1TT2 A;  4KY6 A;  5JOB A;  4KV6 A;  2O4X A;  4KJN A;  4DGZ A;  5IGD A;  5I9O A;  4S3S A;  4WRD A;  4NKL A;  5I6W A;  3HZX A;  1JOR A;  3ERO A;  1EYD A;  4K2K A;  3T13 A;  2F0S A;  3MVV A;  2F0E A;  2F0J A;  3DHQ A;  4ODG A;  1SNQ A;  4PMB A;  1A2T A;  5CV7 A;  4B9W A;  1SND A;  3S9W A;  3D4D A;  4NDX A;  4RKL A;  3MXP A;  3SK6 A;  5E3F A;  1TR5 A;  2F0D A;  2EYL A;  2OF1 A;  5IGC A;  2EY1 A;  4G57 A;  1II3 A;  2F0P A;  4DU9 A;  2F0Q A;  4IUN A;  2EXZ A;  1JOK A;  2F0T A;  4QB4 A;  4KD3 A;  4QF4 A;  2M00 A;  2RKS A;  2EYP A;  4KTA A;  1NUC A;  5I9P A;  1EQV A;  1SNP A;  4DF7 A;  3OSO A;  3NP8 A;  3C1E A;  2EY2 A;  4K5X A;  5C5L A;  5JAV A;  5CGK A;  3SK5 A;  1STG A;  4HTH A;  4F8M A;  1EY0 A;  1IHZ A;  3OMC A;  2KHS A;  5CV6 A;  4R8N A;  2SNM A;  4HMI A;  4EQO A;  2EYJ A;  1EY5 A;  2EYF A;  4KY7 A;  5E1F A;  4ZUJ A;  2PW5 A;  5C6A A;  1STB A;  5IGF A;  4N9T A;  4IAL A;  2LKV A;  3SXH A;  4RKB A;  3U9O A;  1SNC A;  2PQE A;  3TP5 A;  4EQN A;  4E6I A;  4I65 A;  2NUC A;  5IGB A;  5EKL A;  4K5W A;  5I6Y A;  5J22 A;  1F2M A;  2EY6 A;  2F0M A;  3QB3 A;  3SK8 A;  3P1H A;  1NSN S;  2F0K A;  5CC4 A;  3D4W A;  4K2L A;  3MHB A;  4PNY A;  2ENB A;  4YIJ A;  5DAU A;  4KY5 A;  2F3V A;  3ERQ A;  4J6H A;  5NUC A;  3ITP A;  1JOQ A;  3EJI A;  1STY A;  1AEX A;  2F0F A;  2SOB A;  3PMF A;  4K14 A;  4K8J A;  1U9R A;  3E5S A;  1SNO A;  1STA A;  1A3U A;  4K5V A;  4KHV A;  1SYG A;  2F0U A;  3SHL A;  3T16 A;  5J39 A;  1ENA A;  3MEH A;  1SYF A;  2F0N A;  5K5P A;  2PYK A;  1JOO A;  1F2Y A;  1KDC A;  2F0W A;  4ID6 A;  5CV4 A;  3QOL A;  2PZW A;  2PZT A;  1EY8 A;  1SYB A;  2OEO A;  4EVO A;  3NQT A;  3LX0 A;  3OMG A;  3D6C A;  5HGT A;  2PZU A;  5IGG A;  4J1M A;  3NK9 A;  4H7B A;  4KD4 A;  1EY9 A;  5M9O A;  3VA5 A;  1EY4 A;  1KDB A;  1KDA A;  1STH A;  2EYM A;  3NXW A;  5KIX A;  4QMG A;  5C5M A;  4MIU A;  2F0I A;  1F2Z A;  1A2U A;  2F0G A;  5CV9 A;  1EYC A;  2F0V A;  1A3T A;  5EKK A;  5IOD A;  3HEJ A;  3OWF A;  4OL7 A;  3SK4 A;  2HQE A;  4KJO A;  5IOC A;  4NP5 A;  2EY5 A;  5DEH A;  5KGU A;  4ZQ3 A;  5EGT A;  4LAA A;  5KRU A;  1EY6 A;  3BDL A;  5KYL A;  1SYE A;  1STN A;  2EYO A;  5C3X A;  5CV5 A;  2RBM A;  5HUR A;  4N9P A;  3TP7 A;  3SR1 A;  3RUZ A;  1KAA A;  1EY7 A;  1A3V A;  5IGE A;  5CV8 A;  4HMJ A;  2SNS A;  5KEE A; 
#chains in the Genus database with same CATH topology
 2IHE A;  1EOT A;  1ML0 D;  1SYC A;  1MD2 D;  3D8G A;  1MJE A;  2VW9 A;  3R93 A;  1BVS A;  2K52 A;  4JI7 Q;  2EOT A;  4NXM Q;  1SR3 A;  2H4O A;  2RDF A;  4OIK A;  3CKI B;  2K5D A;  4ZYS A;  2XRS D;  5IYD G;  5KND A;  1FL0 A;  4F7X A;  2B2T A;  1WYD A;  3R2I A;  3HOU H;  1Y8P B;  5C44 H;  2PW7 A;  1L0X B;  1D5X C;  5C3E H;  4U67 3;  2IX3 A;  1DCZ A;  1JE4 A;  1CA5 A;  2KCC A;  2JA7 B;  5AJ3 L;  2BDO A;  3FPU B;  3A7A B;  1SND A;  1Z7T A;  1QCB D;  4O42 A;  5E3F A;  2F0D A;  1DZ1 A;  5FO8 B;  4OX9 Q;  2KCM A;  3V05 A;  2R6G A;  1JB3 A;  1RTN A;  3F8T A;  4APV A;  2D0O A;  4LF6 Q;  3GTM B;  2B63 G;  1BCP C;  4A3G G;  4IUT A;  4HCS A;  4LF4 L;  1EWI A;  1IW7 D;  1VQ9 A;  5FO9 B;  1A62 A;  4C3J G;  2DJG C;  2PMZ B;  4WJ4 A;  1S40 A;  1SE4 A;  4EQN A;  3HP3 A;  3OOC A;  1I5F A;  5E4X A;  2FFK B;  2ZM6 L;  1CHQ D;  4R1J A;  5LL6 X;  2JA7 H;  3VR5 A;  1K8O A;  5CC4 A;  3MHB A;  5DAU A;  2F03 A;  1I94 Q;  4DV5 L;  1MGS A;  1Y1W G;  4RHS A;  4CDD C;  4JBJ A;  1VQM A;  5GAG C;  1ENA A;  2N88 A;  2BOS A;  3GTM H;  4GOP C;  3MXU A;  1F9Q A;  4DXF A;  4H44 C;  3NK9 A;  1ICF B;  4RGT A;  1EY4 A;  1XNR L;  2VUM B;  1IXR A;  3PO3 G;  1XPU A;  1EIY B;  3DEO A;  4X62 L;  3GTJ B;  2BA1 A;  1PH2 A;  3ULJ A;  1SLJ A;  3C46 A;  3RZO B;  2MNA A;  1W2B A;  1RD9 D;  3GV6 A;  2JEB I;  1CQV A;  2PPB C;  1K3B C;  3K7U C;  2DY7 A;  4Q0F A;  4G7H C;  1GXD C;  1EUJ A;  4K8I A;  1X56 A;  1AP0 A;  3NPP A;  2AMC B;  3I4O A;  5KYI A;  1N32 Q;  2L1B A;  2LMC B;  4PMC A;  5J1Z A;  3J80 i;  4GN5 A;  4LFA Q;  2VUM H;  1M8A A;  2OT2 A;  1M90 C;  4A3M B;  4DR2 L;  4H0L C;  3L0O A;  4TVA B;  3H0G B;  3GTJ H;  4HAE A;  2CH4 W;  2F0S A;  2UXB L;  3DHQ A;  3KF6 A;  1Q86 C;  1BOS A;  3P7J A;  3RZO H;  1D7Q A;  5FJ8 G;  3CC7 A;  4RKL A;  3SK6 A;  1HHV A;  4XQJ A;  1B7Y B;  1PA6 A;  4YCU A;  2B2U C;  1O7Y A;  2RKS A;  2Y0S B;  4NW2 A;  2O5J C;  2RDH A;  1JR0 D;  1KC8 C;  4A3E G;  2SNM A;  1XTD A;  4RGO S;  1O78 A;  3KBX A;  5E1F A;  3JC6 6;  4O0A A;  5IGF A;  4N9T A;  1GJX A;  1TII D;  1G91 A;  4A3M H;  1JIC A;  1GOZ A;  1RF2 D;  1VMP A;  2PO4 A;  5A35 A;  1WFQ A;  4I65 A;  3G48 A;  2QCP X;  1KRT A;  3H0G H;  2RCF A;  4H02 A;  5COY A;  3STB D;  2XRQ D;  3P1H A;  3AFQ A;  1N36 Q;  4PNY A;  3VR3 A;  4A3F G;  2HUG A;  1PTO B;  4J6H A;  3T1Y L;  2SOB A;  1A15 A;  1STA A;  1D5M C;  4KN7 C;  3KLR A;  2PYK A;  3ZYY X;  1OTC A;  4XTC S;  4ID6 A;  4LMQ D;  2NTS A;  2DN8 A;  1SMY C;  2E5L L;  3LGJ A;  3A56 A;  4POF A;  4R4I A;  5IYB G;  1LTI D;  3QIA A;  5JPM C;  5BR8 Q;  3TS0 A;  1TU2 B;  4CDE C;  4QMG A;  4AQY L;  2ZT9 C;  1WTH A;  1F2Z A;  1RHP A;  1QZH A;  4JOI A;  4GNX C;  3CW2 C;  4HJ7 A;  5DEH A;  3HKZ G;  5KRU A;  1G2T A;  1PTO H;  1TY2 A;  4OWT B;  4X3K A;  4IFD H;  2JE6 I;  3C3L A;  5EAY A;  1CUK A;  1EZ8 A;  4RA8 A;  1B50 A;  2F4I A;  2WB1 G;  4GKK Q;  1A6X A;  4JBK A;  4JI2 Q;  2WAC A;  1YBY A;  2BA0 A;  3H15 A;  1KXL A;  2XIW A;  5LMU Q;  1M1K C;  2K7V A;  3J81 E;  1BDO A;  4R4O A;  1HNX Q;  1L2F A;  1K0R A;  3BZK A;  2MPM A;  1P16 A;  2AUJ D;  5I6W A;  1V1O A;  1VQH A;  3ERO A;  1UEB A;  5IP7 H;  3NEN A;  4DV2 L;  4V19 0;  1FNV A;  1YIT A;  4LF5 L;  1S5F D;  3E9H A;  2PI2 A;  4NXN Q;  1YJN A;  1SEB D;  2G5D A;  1HR0 W;  5IGC A;  5GAE C;  2F0P A;  1UWV A;  1X54 A;  2JJQ A;  4DKA C;  4DPG A;  2AQ1 B;  4HJ8 A;  3A74 A;  4QIW E;  1VQF A;  1NUC A;  2KED A;  1F9P A;  4RFB A;  3C1E A;  1LTS D;  4M8A A;  3SK5 A;  3HOX G;  3ND8 A;  4FXK C;  3MAQ A;  2OQK A;  1LTT D;  1EFI D;  4CGY B;  1ICW A;  3H3V I;  3L2P A;  1PV4 A;  2M9V A;  1NAP A;  2AHO B;  4K0K Q;  4N8F A;  2CKZ B;  4KMU C;  2O2L D;  1ET9 A;  5IYC H;  5ELC A;  1EQQ A;  3RLO A;  2OQ0 A;  4NPS A;  2E2H B;  4JBM A;  4KK7 A;  1VQ4 A;  2BE5 C;  4K8J A;  1GVP A;  3A55 A;  2DGY A;  4A3B G;  4Y52 H;  5J39 A;  1NNX A;  1QZG A;  5EPK A;  1QNU A;  1E22 A;  4QUC A;  2OEO A;  1F2L A;  3OMG A;  5HGT A;  1Y8N B;  4NB3 A;  1HPC A;  2A68 D;  2QW7 A;  4DR6 Q;  3T1H Q;  1YHQ A;  2F0V A;  2UUC Q;  4FF2 A;  4JBW A;  1OO9 B;  4XQN A;  3BDL A;  5GRO A;  1BKB A;  4DV1 Q;  4N9P A;  2NVY B;  2E2H H;  1SN8 A;  1EY7 A;  2RSO A;  3JAM L;  1HR0 L;  1PFN A;  3CME A;  4L5T A;  2VQF L;  4OO1 G;  1ROD A;  1NBW A;  4P2C B;  5EPL A;  1MJC A;  2Y0S E;  1EZ6 A;  3CQZ B;  1XMQ Q;  1KAB A;  5JJL A;  4K6D A;  3FKI B;  3P75 A;  1C9O A;  3FDT A;  1PH8 A;  1Y1V B;  4JCV E;  5IIF A;  2JA5 B;  2ZTC A;  3QO2 A;  3AEV A;  4WOR A;  2F3W A;  3CRL C;  3J7A 5;  1CQF A;  1UE5 A;  4WFN 3;  2K5N A;  4JI3 L;  2UU9 L;  2XSC A;  3WWV A;  3HZX A;  1FGU A;  1T5E A;  1T9H A;  4K2K A;  2KBN A;  4FF3 A;  3I4N B;  2F0E A;  2GVA A;  4JI6 Q;  3F2D A;  2NVY H;  3A54 A;  3AFP A;  4L5S A;  1G51 A;  2CW0 D;  4FXG C;  1EWC A;  2Z1C A;  1CI3 M;  2HDM A;  1FGB D;  3E0J A;  2EYP A;  1F77 A;  4P73 A;  3TRZ A;  3CQZ H;  3KJP A;  3FKI H;  2BCO A;  3HG9 A;  1Y1V H;  3U9S A;  4RCO A;  2JA5 H;  2A6H C;  3I4L A;  3F1Z A;  5T1G A;  1JE5 A;  2AUK A;  2AWN A;  2NBF A;  4IUR A;  3MTS A;  2DNC A;  2IW3 A;  2X6L A;  1BXT A;  5FLM H;  4DK3 C;  3VA7 A;  1YNJ D;  3UDG A;  4RAU C;  2EIF A;  2D2C C;  2NZH A;  2Z8L A;  2ALY B;  1D6E C;  5J22 A;  1SMX A;  1K8A C;  3I4N H;  2RQX A;  1GUG A;  1IBL Q;  1UE1 A;  2BH8 A;  2TSS A;  2WP8 J;  2F3V A;  3J80 L;  1OXX K;  3OIP A;  1BCP F;  3OTO L;  4FO2 A;  2CVR A;  2F52 A;  2RF4 A;  3CCM A;  4BY1 B;  4AYB B;  4OEM B;  3HOU G;  1Q1B A;  3J81 c;  5C44 G;  1VQ7 A;  3E9I A;  1UE7 A;  5CV4 A;  1MSG A;  2EZV A;  4DR5 L;  1AE3 A;  1LT6 D;  4JI8 Q;  4HIM A;  5M9O A;  3WOF A;  1R4Q B;  1AW7 A;  1LYL A;  5FO7 B;  1WTR A;  3J7Y W;  2WII B;  4J8Q A;  4B08 A;  2KCN A;  1FJG L;  1N34 Q;  1ESF A;  5KGU A;  3MEF A;  3HOZ B;  1EYG A;  1Q1E A;  2UXC Q;  2DJF C;  5CV8 A;  3K6O A;  5LMN L;  4ZKB B;  4BY1 H;  1HTP A;  1AFP A;  3C1F A;  4JW0 A;  2L4N A;  1PZI D;  2E76 C;  3LNN A;  2Q8R E;  1D5Z C;  1PZJ D;  3X3M A;  3L3O C;  2JXM B;  4B9X A;  4FF1 A;  4PG3 A;  3HOV B;  1PTO C;  2JA7 G;  4PMW A;  3BDC A;  2PNH A;  2RDG A;  4A3K B;  3UDF A;  3PUV A;  2UUB Q;  1TWG B;  4DV4 L;  2E74 C;  2EJF C;  2L0C A;  4B3T L;  1H9M A;  1U0L A;  2A69 D;  5COR A;  1YNX A;  3HOZ H;  5CYU A;  3W5O A;  1A2T A;  3VYS A;  2OTJ A;  3MXP A;  1MKH A;  2EYL A;  4U68 A;  2XN9 C;  4LUO A;  1PH5 A;  4IJH A;  2R92 B;  3SVM A;  4DV7 L;  2B3G A;  1DYQ A;  4B3M L;  4HTH A;  4ULL A;  4DV0 L;  4ZLT F;  2K50 A;  1H9S A;  1V43 A;  4OEL B;  4LF8 L;  2KHS A;  1FR3 A;  3K7A B;  4JI1 Q;  3GTK B;  4DUZ Q;  1STB A;  1QUQ B;  4GKJ L;  2GVB A;  4R4C A;  1LM0 A;  5C0X I;  4Q5V A;  5IT9 L;  4A3K H;  2PQA B;  4BBS B;  2HCC A;  1TWG H;  1LTB D;  1PMR A;  2EY6 A;  2F0M A;  3QJY A;  3TN2 A;  2J7Z A;  1NSN S;  1LO5 D;  2JA9 A;  4I7Z C;  3S15 B;  1CKN B;  2ENB A;  2IX1 A;  5ELO A;  4XQQ A;  4QY7 A;  1VQ5 A;  2A73 B;  3F2U A;  1BNZ A;  4H13 C;  2R61 A;  1VQA A;  2R92 H;  4X65 Q;  2VUM G;  1S5E D;  3D31 A;  2N3S A;  5D14 A;  1KTK A;  1V9P A;  2CCZ A;  3K7A H;  3LX0 A;  3GTK H;  5EPJ A;  1QUQ A;  1X55 A;  1EY9 A;  4Z9C B;  1KDA A;  3PIO A;  2PQA A;  1J5E Q;  1K8M A;  4BBS H;  3DWQ A;  2F0G A;  2ZXR A;  1A3T A;  2Z9H A;  2HQE A;  1XPO A;  3J7Z C;  1GHJ A;  4IPH A;  4AH6 A;  1MI2 A;  5KYL A;  1Q82 C;  1SYE A;  3M7N A;  3S15 H;  5CV5 A;  3W2D A;  1B2T A;  2CQA A;  5JJZ A;  3G4S A;  4N8X 1;  3RUZ A;  1PXU A;  1EIG A;  4YHH L;  4HED A;  2IT1 A;  3CCU A;  4YY3 L;  1TXY A;  1SE2 A;  1UEA B;  4A3M G;  3KDF A;  2GN5 A;  4UY8 C;  4QCL A;  3I7F A;  1KL9 A;  4CKE A;  2L12 A;  3CCS A;  1U4L A;  2JSO A;  2N55 A;  1YNN C;  2N78 A;  2Z6K C;  1XXG A;  1EQT A;  1L1O A;  3OYY A;  1O7I A;  3OWE B;  4FXD A;  3EVQ A;  3I8Z A;  1SFO B;  4UHV A;  2JN4 A;  3ER0 A;  4KY6 A;  2B29 A;  1LT4 D;  2KEE A;  4DGZ A;  3AMU A;  2XTI A;  2B39 A;  4X66 Q;  3UI2 A;  1EYD A;  4XYO A;  2N49 A;  2Y0S G;  3NTH A;  3GTQ B;  1Y14 B;  2DNE A;  5CBE E;  4L5R C;  2Z0S A;  3GTL B;  1QNK A;  4IUN A;  4X6A H;  1JOK A;  1VQ8 A;  5E4W C;  2HDL A;  5EQ0 A;  4AYB E;  2A6E D;  3KJO A;  1SNP A;  2WFW A;  4DF7 A;  4XDX A;  1XMO Q;  2J0T D;  3HOV H;  2YTY A;  2UXD L;  5EJW A;  3LWU A;  3NSW A;  5IP9 H;  3A7L A;  1SFO H;  1CKO A;  1DOK A;  3TP5 A;  2JP1 A;  3DM3 A;  1NR2 A;  2EDG A;  4WJ3 M;  4G4K A;  2B2W A;  1IL2 A;  1V1P A;  4RG1 A;  3CCR A;  3GTP B;  1LAB A;  1Q8K A;  5JVH 3;  4LFB Q;  1SBB B;  3DEP A;  3GTQ H;  1YVC A;  4BBR B;  4BY7 G;  2C9O A;  5NUC A;  1BBU A;  1JOQ A;  4DV3 Q;  5FOB B;  1UNS A;  3GTL H;  4KHV A;  5AFW A;  2VB2 X;  1W3S A;  2K04 A;  5D65 A;  1EY8 A;  2ZXO A;  4RMF A;  1HRJ A;  5ELE A;  1WCM B;  5IP7 G;  3JAM i;  3D6C A;  5IGG A;  2SEB D;  3PUZ A;  4B3S Q;  5C5M A;  2KJX A;  3Q24 A;  4G7Z C;  3OWF A;  2MFI A;  3MXN A;  3GTP H;  4DV6 Q;  4LAA A;  1XNQ L;  1EY6 A;  2VS1 A;  4RH6 A;  4BBR H;  2D0P A;  4PQX A;  3J7A V;  1ET6 A;  1SDF A;  4ALP A;  4A3J B;  3TEH B;  5C4Z A;  2F0H A;  3F2C A;  1IBM L;  1J8I A;  4KN4 C;  3KBG A;  3TZU A;  4IZ8 A;  1V8Q A;  1PFB A;  4P72 A;  3L7Z C;  1WCM H;  3VR6 A;  5IYC G;  1Q3L A;  3QOJ A;  5M5X B;  1YHB A;  2A19 A;  2QDB A;  1KNE A;  1N33 L;  1EEI D;  2O4X A;  2MUY A;  2B2Y A;  4BS9 A;  3IFT A;  1HFN A;  4C56 C;  3CP0 A;  3KF6 B;  2PCF B;  1VQD A;  5IWA Q;  2R7Z B;  1TWH B;  1HCZ A;  3PIP A;  2NVX B;  2PNR C;  1LTA D;  2LY7 A;  4DV2 Q;  4NDX A;  4CJ0 B;  1ASZ A;  5C4X B;  4DUY Q;  4A3J H;  2RA4 A;  3S1Q B;  3MC0 B;  3S2H B;  2UUA L;  2WKC A;  1J6Q A;  5JAV A;  3J80 E;  1U4M A;  4YCV A;  4IJL A;  1STG A;  4UDU C;  2LXJ A;  4KKU A;  2NVT B;  2EYF A;  2EXD A;  2Z4I A;  5M5X H;  3KLS A;  1IBK L;  1E2V A;  1MIU A;  1BCP D;  4JV5 L;  4RKB A;  2O5I C;  4E6I A;  3VR2 A;  2VQE L;  2R7Z H;  1TWH H;  2NVX H;  2MP1 A;  2EE1 A;  4FP5 D;  3FP9 A;  1E2W A;  1A8V A;  1NMG A;  3M9B A;  4A3L H;  3ITP A;  5C4X H;  4TQU S;  1S5D D;  2F0F A;  3S1Q H;  2NN6 H;  3E5S A;  4J15 A;  4YWK A;  3T16 A;  1HNZ L;  3S2H H;  3E3X A;  1Z9F A;  2YYZ A;  1R9T B;  4LFC L;  4DR4 Q;  2V1C C;  3CD6 A;  4IUU A;  5T1I A;  4B3R L;  2PZT A;  3QG1 A;  4JI7 L;  4NXM L;  2NVT H;  1MHW C;  4H7B A;  3OW2 A;  3VA5 A;  2EYM A;  4JI4 Q;  3NBH A;  1PH7 A;  2F0I A;  4DAM A;  3HOW G;  2B2V C;  4OIJ A;  4FF4 A;  2HQL A;  2WIN B;  4NP5 A;  1IL8 A;  1CHP D;  5JPN C;  1VQN A;  1LT5 D;  3SR1 A;  3CCE A;  3FKI G;  2WAQ B;  1Y1V G;  4BWG B;  2JA5 G;  3KF8 B;  2F4V Q;  4OX9 L;  2ICI A;  1R9T H;  1C0A A;  2H1E A;  4RHR A;  3EFX D;  5L37 A;  3AYH B;  2XNA C;  4XYQ A;  3BS1 A;  2M2L A;  3V2T A;  2Q2I A;  3Q22 A;  5I2X A;  5CR3 A;  4LF6 L;  5F2D A;  3I4N G;  1GUO A;  2I5M X;  1J9O A;  2B8G A;  2Z4H A;  4BA2 I;  3BU2 A;  1XWE A;  4I7A A;  1AN8 A;  5C0X J;  1WTV A;  4JYA Q;  2I0Q A;  2UU9 Q;  5E7N A;  3KOJ A;  2NTT A;  1F9S A;  2Q2T A;  5IT9 E;  3MFY A;  4JI5 Q;  3D4D A;  3KF8 A;  2JA6 B;  1ZYR C;  1SE3 A;  1I94 L;  2EXZ A;  1EQR A;  3PSI A;  1YHA A;  1EEF D;  4PZ7 A;  4KTA A;  5M3M B;  2VZA A;  2YV5 A;  3FVQ A;  1ENF A;  5BN3 A;  2Q2U A;  2PMZ E;  1JMC A;  1SXT A;  1AZQ A;  3WDN A;  5CV6 A;  4EQO A;  4CDC C;  2BDN A;  1BBW A;  5TSS A;  4C3H B;  4DR3 Q;  4KLK A;  4GN4 B;  2KVM A;  3I4M G;  1Q7Y C;  1PRT C;  2KA7 A;  1Q81 C;  3FHW A;  1SNC A;  2QF7 A;  4IPG A;  1I6V C;  4L63 B;  1O7L A;  3ULP A;  2OTL A;  1W6K A;  4BY1 G;  4AYB G;  4R8I A;  1VS0 A;  4C2M B;  5JVG 3;  1I4G A;  1H9K A;  3GP7 A;  4OGQ C;  4JI0 Q;  2ZTD A;  2B2T C;  3AU7 A;  2HHH Q;  2VY3 A;  1WJJ A;  4KY5 A;  1T5X D;  1EFW A;  3WOE A;  1K8G A;  3M7G A;  2JA6 H;  1Y69 U;  2H5X A;  2YTV A;  4OXP A;  1U9R A;  1QWY A;  1E7Z A;  3PV0 A;  2F0U A;  3DWA A;  1WVL A;  1Q12 A;  1PVO A;  1S4Z A;  5M3M H;  1O7Z A;  1KDC A;  4A3I B;  5BN5 A;  1CM9 A;  3BVG A;  3HOY G;  1I50 B;  4IQZ A;  5JEA G;  4IUV A;  2D62 A;  3D0F A;  3HOZ G;  5M5Y B;  1I6H B;  4C3H H;  3K59 A;  1KDB A;  3CC4 A;  1U5K A;  1SMY D;  1N32 L;  4HSV A;  3CMA A;  1EYC A;  1SRO A;  1GM5 A;  1QIL A;  1NR4 A;  2R7D A;  3BJU A;  2N8N A;  4LFA L;  4C2M H;  2K33 A;  2F1M A;  2K32 A;  5HUR A;  4JPB W;  3HGB A;  1LV9 A;  4KKS A;  3J80 c;  4LF7 L;  3A8K E;  3NBI A;  5EKI A;  5LMN Q;  1SJH D;  3PO2 B;  4LUV A;  1YIJ A;  1XJV A;  1GUS A;  4A3I H;  5C3W A;  4A3K G;  2NB0 A;  1HUM A;  1I50 H;  3NEM A;  5HY6 A;  5G3L F;  1SNM A;  4KHP Q;  5M5Y H;  4QQB X;  5GAH C;  1I6H H;  4ME5 A;  2LS0 1;  4KV6 A;  4KJN A;  1OXV A;  1PH1 A;  2E2I B;  4DR7 Q;  1PYB A;  3M85 A;  2R92 G;  4X64 Q;  3CU7 A;  2F0J A;  2R3Z A;  4MZ9 A;  2JA8 B;  1KHI A;  4ME3 A;  5CV7 A;  2YTX A;  2TMP A;  1C48 A;  3BDO A;  3J81 j;  4Y7N B;  1N36 L;  4TKO B;  1PH9 A;  2ASB A;  3PO2 H;  4KD3 A;  5BN4 A;  1IYJ B;  5M5W B;  1X3Q A;  1VQC A;  1E1T A;  5C5L A;  5ELD A;  4OO1 I;  1CFM A;  4A93 B;  3ONA B;  2EYJ A;  1EY5 A;  1G6P A;  1LUZ A;  1TS2 A;  1TWC B;  1ONL A;  4IAL A;  5BR8 L;  2IPK D;  5ELF A;  1HZA A;  2E2I H;  3I2Z A;  1HZB A;  3NTI A;  3SK8 A;  1GHK A;  1HZ9 A;  4PZ8 A;  2JA8 H;  4CJ1 B;  3S17 B;  4A3L G;  3Q0A A;  3NEL A;  4Y7N H;  1STY A;  2WAQ E;  1D1I A;  4C3I B;  4JVZ A;  1VQP A;  1SYG A;  3IKJ A;  5M5W H;  2JK8 A;  4OHJ A;  2ES2 A;  1G8Z D;  1VDZ A;  1JJ2 A;  1PYS B;  2BE5 D;  2PZW A;  4L8J A;  4DR1 Q;  3OIQ A;  4A93 H;  4EVO A;  4JI2 L;  1AH9 A;  3K5N A;  3LWE A;  4XIG S;  1CK1 A;  5KIX A;  4IUQ A;  5LMU L;  3B6Y A;  1TWC H;  3T53 B;  1LTG D;  5IT9 c;  3FEW X;  1HNX L;  4LF9 Q;  2ID0 A;  1HZC A;  3GV3 A;  4ZCK A;  2PI2 E;  2K5Q A;  1G6Z A;  3A5Z B;  3URY A;  3S17 H;  1TWF B;  1HXY D;  3HOV G;  5IYB H;  4C3I H;  5H1S E;  4NXN L;  3OPO A;  3RD4 A;  5C3E G;  4UAI A;  5FKA C;  1RJT A;  2K75 A;  2IX0 A;  3N52 A;  5IP9 G;  1ASY A;  2MJ8 A;  1HNW Q;  4EX5 A;  1HUN A;  2X69 A;  3G6E A;  3A8I E;  2K01 A;  1HJP A;  3K0X A;  3S1N B;  4ZKC B;  2E75 C;  4DNT B;  4RGM A;  1RKN A;  3KYH C;  1VQG A;  3TP6 A;  2Z6B A;  1QOH A;  1ILQ A;  3PGZ A;  4K0K L;  3M4Q A;  3PIO 3;  1SE8 A;  3RZD B;  4R4T A;  4CJ2 C;  2IHF A;  3W3A A;  5KNB A;  1TWF H;  2BH2 A;  3A8J E;  3S9W A;  1E1O A;  3CF5 A;  2EY1 A;  1II3 A;  3TS2 A;  4JOI C;  1VF5 C;  2M00 A;  2JQO A;  1EIH A;  5I4D A;  1GO3 E;  1U4P A;  1EQV A;  3DLL A;  1H9S B;  3EA6 A;  2ICE C;  4MN3 A;  1VMC A;  3VYU A;  2NZO A;  3S1N H;  4F8M A;  1H95 A;  4X3U A;  3CCL A;  3A0J A;  3Q23 A;  2K6A A;  2NYZ D;  3ZJY C;  4BBR G;  3BZD B;  1S5C D;  2PQE A;  3D6W A;  4DXG A;  4A3B B;  3H3V H;  1O80 A;  1FD7 D;  2A6H D;  4DR6 L;  3RZD H;  4ZRZ A;  3T1H L;  5AJ3 Q;  3I91 A;  2UUC L;  1X3F A;  1B3Q A;  4K2L A;  3U4V A;  3UE0 A;  3G6J B;  1E24 A;  4DV1 L;  4K14 A;  2Q2H A;  2HIX A;  2X6G A;  1WTQ A;  2VB3 X;  2LSS A;  4X3T A;  3A5U A;  4LF4 Q;  2R93 B;  1SYB A;  3R8B A;  5JJI A;  1XMQ L;  2CHB D;  1XTC D;  4BXX H;  4ABN A;  1KLG D;  2ZM6 Q;  4A3B H;  3S1M B;  4A3J G;  1IZ6 A;  4CKC A;  2K5V A;  5IOC A;  1U4R A;  2B2U A;  2G9D A;  3H94 A;  4DV5 Q;  1TKW B;  1PZK D;  3P20 A;  1HA6 A;  2QA4 A;  2QEJ C;  4JI6 L;  4HMJ A;  1YJ9 A;  5IE8 A;  1K73 C;  2XWJ B;  5CBA E;  3MZ5 A;  3KDF B;  3ERS X;  3I3C A;  3TDQ A;  1N9W A;  2R93 H;  4NMZ A;  2D9U A;  1L1O B;  1S3O A;  4LUZ A;  1BR9 A;  3J81 L;  3NHH A;  3PUW A;  1XNR Q;  3NUC A;  1A0I A;  4X62 Q;  2QDL A;  1HH2 P;  1JT8 A;  1C8C A;  4OWW B;  3S1M H;  5C4X G;  2CFM A;  2NN6 G;  3CCJ A;  1N8R C;  3PF4 A;  1PTO D;  3CCV A;  4HJ9 A;  2OWO A;  1DOL A;  1D2B A;  3MVV A;  1ESR A;  4ODG A;  1WOC A;  1FVI A;  1JCK B;  5LHY 1;  1IBL L;  1DON A;  1IW7 C;  3H0G G;  1EL0 A;  3K5M A;  1BQQ T;  4MTK A;  4HSP A;  4LNQ A;  1HA5 A;  1KNA A;  3GD7 A;  3Q8D A;  4GNX A;  4IOA A;  3CHB D;  2I5H A;  3PQI A;  4A3C H;  1LTR D;  4JI8 L;  4ZUJ A;  2VXW A;  2ZJR A;  4DR2 Q;  1DD2 A;  1B1Z A;  1VQO A;  1V1P B;  3U9O A;  4LJZ C;  2UXB Q;  1EIF A;  2DUD A;  4XXE A;  3QB3 A;  3U4Z A;  1N34 L;  4DN4 M;  3Q6S A;  5GQO A;  1SJE D;  4YIJ A;  5JEA J;  3PIP 3;  3EJI A;  3H09 A;  4BA1 I;  2KEC A;  2UXC L;  4FNF A;  4A3D B;  1JJG A;  3AB9 A;  1X65 A;  5DM7 3;  2EVB A;  1PRT F;  4LFC Q;  4GZY C;  1YZ6 A;  2QKI C;  4B3R Q;  1MBY A;  3HRZ C;  1STE A;  3HFZ B;  3NXW A;  4IFD G;  4MIU A;  2WAQ G;  4LW1 A;  3TRE A;  3MXN B;  3DWP A;  3I70 A;  5EKK A;  3MA2 B;  4OL7 A;  2UUB L;  4FDB A;  4ZQ3 A;  3T1Y Q;  1GUN A;  4DAY A;  1STN A;  5FLX L;  5C3X A;  2F3I A;  5G3L D;  4IFD I;  2XVS A;  3NE5 B;  5IGE A;  4QL5 A;  3TP8 A;  3PUY A;  1WTO A;  1VCI A;  4XT1 B;  4DK6 C;  1X9N A;  4POG A;  3JAM E;  4A3D H;  3QR8 A;  2E5L Q;  3EBE A;  4F88 A;  1ENC A;  2F0O A;  4DNI A;  4EQ5 A;  1NTG A;  2RSN A;  4AQY Q;  1Q8I A;  1X3E A;  1E3P A;  5K36 H;  2OXP A;  4JI1 L;  4IN3 A;  1E0B A;  3SEB A;  1CKM A;  3E0E A;  1YNN D;  1QB5 D;  4GLV B;  4DUZ L;  2EPB A;  3EQL C;  2JA6 G;  2HIV A;  4S3S A;  4NKL A;  5D3I B;  2CQO A;  1UUP A;  1X32 A;  1QVG A;  4WJW A;  4AIM A;  3SDZ A;  5M3M G;  4A4I A;  1LAC A;  1KRS A;  1OXS C;  2QIL A;  1TR5 A;  3FPP A;  2OF1 A;  2AQ2 B;  2F0Q A;  5DM6 3;  1CSP A;  4UP7 A;  4C3H G;  2FXQ A;  4CDF C;  1PFM A;  1LTL A;  4C1N K;  1DJR D;  1BO0 A;  1IKM A;  2ZJQ A;  1CZG A;  1Q46 A;  4X65 L;  4QIW B;  4EGV A;  3I55 A;  1VQK A;  1PHJ A;  3GTO B;  5C6A A;  2Q8I B;  3R2T A;  2PW5 A;  3STB C;  2FHT A;  4C1N I;  1TS3 A;  3RNU A;  2LKV A;  4KI0 A;  1ILP A;  4HIO A;  1F9R A;  5EKL A;  4K5W A;  1J5E L;  5C0X H;  4LF5 Q;  3S1R B;  4A3I G;  3BVZ A;  3U50 C;  5M3F B;  2JYO A;  2E2D C;  3RN2 A;  1GUT A;  1SNO A;  4DA2 A;  3BYT B;  4MHE A;  3IFD A;  1D1K A;  4R9W A;  1X3G A;  1SRU A;  3L9A X;  3H3V C;  4RGN A;  4DK1 A;  4FYD A;  1HFG A;  4OON A;  1BBX C;  3V96 A;  3NBH B;  3NQT A;  3PF5 A;  3GTO H;  1JWU D;  2PZU A;  3RLN A;  4IO9 A;  1A2U A;  4DAP A;  5CV9 A;  1I4H A;  1B70 B;  2LXK A;  3TBI B;  1C7Y A;  3RMH A;  2MO0 A;  3S1R H;  3PO2 G;  2QGQ A;  1VQL A;  2JEA I;  4X66 L;  4V0B A;  2RHS B;  1X6O A;  2L9H A;  3J7A F;  5M3F H;  3TP7 A;  4QGU A;  5KNC A;  4YCW A;  4QB4 A;  5KEE A;  4LWC A;  4LF7 Q;  4TRD A;  3S24 A;  3CC2 A;  2WKD A;  4DFA A;  2C35 B;  3DXJ C;  5DLQ E;  4DNR B;  3H6M A;  3GTG B;  4IOC A;  2A5H A;  4HJ5 A;  5C4H A;  1XMO L;  1VQB A;  1I3Q B;  4ZUI A;  4GS3 A;  2JA8 G;  3I56 A;  3K5L A;  4GN3 B;  1LLR D;  3M4P A;  3RLF A;  5I9O A;  3X3N A;  4RWS C;  1JOR A;  4CKB A;  1RL2 A;  3VYT A;  1SNQ A;  4UPA A;  1W6J A;  5C4J B;  1HR0 Q;  4LFB L;  3S14 B;  4A93 G;  2VQF Q;  2Q8T A;  3UDX A;  2SDF A;  5FLM G;  3U58 A;  4DU9 A;  3UE1 A;  3BVM A;  4DV3 L;  4HJA A;  1WTW A;  1K28 A;  4DK0 A;  3GTG H;  2J4X A;  2EY2 A;  4JC0 A;  1I3Q H;  1B8A A;  4JI3 Q;  5ELB A;  2HT1 A;  1QG7 A;  4BY7 B;  1ZXT A;  1VF7 A;  4C3I G;  3ULL A;  2I46 A;  5IGB A;  4B3S L;  1SSO A;  1I4R A;  2B63 B;  2FMC A;  3E6Z X;  4A3G B;  4GLX A;  2KOL A;  5IYD H;  1I4Q A;  3TQY A;  5IY0 A;  1L1O C;  4C3J B;  2F0K A;  1CTM A;  3D4W A;  3JAM c;  5C4J H;  3ICE A;  4DV6 L;  3S14 H;  1PTO F;  1WTP A;  3K8A A;  4MNO A;  4RCN A;  1HTL D;  3SHL A;  1G2S A;  2F0N A;  1H9J A;  3TZD A;  3QOL A;  1B3A A;  2A68 C;  4DAV A;  2K1B A;  1Y1W B;  2MO1 A;  1WD0 A;  4HN7 A;  3S2D B;  4BY7 H;  3HS0 C;  1XYI A;  5IOD A;  1VQE A;  2B63 H;  5DNF A;  3J81 i;  4A3G H;  3I90 A;  3H91 A;  2EY5 A;  1KIX A;  5EGT A;  4C3J H;  1JB7 A;  1RTO A;  3K80 C;  4F87 A;  4O1N A;  1L0W A;  4P74 A;  3OTO Q;  1OXT A;  1MSH A;  2AKW B;  1TVX A;  5IWA L;  1A3V A;  2KCT A;  3PO3 B;  4ILW A;  1K83 B;  2IL8 A;  1L0Y B;  2B2W C;  2G9H D;  1DGS A;  2B8F A;  2IJ0 A;  4DUY L;  4DR5 Q;  4QUF A;  1R4P B;  3PCO B;  1NCV A;  4YWM A;  2RCN A;  3R3O A;  5A2Q L;  3MWY W;  1GKH A;  2A8V A;  1Y1W H;  1XPR A;  1KD1 C;  1SYD A;  1I4P A;  3S2D H;  1HQR D;  1IYV A;  3G7L A;  3CPF A;  2IY5 B;  1FJG Q;  5JOB A;  1JJC B;  1FNW A;  2V4D A;  2R7F A;  3GQB A;  4TSS A;  4WRD A;  3OW7 A;  3GO5 A;  4MTN A;  2CW0 C;  3M3Y B;  1TS5 A;  2L11 A;  3GDE A;  4PMB A;  4B9W A;  1E2Z A;  4M1U B;  1CA6 A;  3PO3 H;  2EJG C;  4G57 A;  3RR5 A;  1K83 H;  1TY0 A;  1CZW A;  4BXX G;  2D5D A;  5I9P A;  2P5Z X;  3KUP A;  1NJI C;  1ZYR D;  2MGS A;  1PH3 A;  4DR4 L;  1YNJ C;  3M4O B;  1B9N A;  1NMF A;  1B4O A;  2ZXP A;  1BF4 A;  3PUX A;  4DV4 Q;  4B3T Q;  4JI4 L;  2FIN B;  1VQ6 A;  4CBV A;  1SAP A;  2K5H A;  2KHI A;  1F2M A;  3M3Y H;  4A3E B;  1PRT D;  3ND9 A;  4UP9 A;  1EOV A;  2R93 G;  2Z6K A;  4UP8 A;  4BBS G;  1GUW A;  3VYR A;  3CCQ A;  2B2Y C;  4IFD J;  4K5V A;  1IYU A;  3W1B A;  4DV7 Q;  3I73 A;  3MXG A;  1SYF A;  4B3M Q;  5FLX E;  3K81 C;  3HOW B;  2F4V L;  4DV0 Q;  2L55 A;  1LT3 D;  4LF8 Q;  1EU4 A;  4A3F B;  5FJ8 H;  2CWP A;  3M4O H;  4GKJ Q;  4PV1 C;  2E8G A;  2HCI A;  2KUM A;  5CMD A;  4GLA C;  2HD3 A;  3AQQ A;  1TS4 A;  3HEJ A;  1PDQ A;  3SK4 A;  3SE0 A;  1DM0 B;  2FJ2 A;  3FMC A;  4A3E H;  1BCP B;  3NQI A;  1DOM A;  5JJK A;  1EWH A;  3N6R A;  4JYA L;  1RDP D;  2RBM A;  1KLU D;  3CPW A;  3DUZ A;  1KAW A;  4A3C G;  4JI5 L;  1D8L A;  4HIK A;  5LMN W;  4GKK L;  1QVF A;  3TME A;  2DY8 A;  3HKZ B;  1C4Q A;  3HOW H;  1EYA A;  5I2Y A;  4A3F H;  3W1G A;  2CH4 A;  5LL6 S;  4JG2 A;  2KQ3 A;  1S5B D;  1QE6 A;  3D3R A;  4A76 A;  3VR4 A;  2WV6 D;  1TQO A;  4EQP A;  3UDI A;  4PZ6 A;  3DMU A;  1K3R A;  1X3P A;  3BG3 A;  2A69 C;  4X3S A;  2EYH A;  1UE6 A;  1TT2 A;  2WB1 B;  5J3B A;  4DR3 L;  5IGD A;  2VL6 A;  3T13 A;  2K4K A;  4GOP B;  1AZP A;  1B44 D;  2K5W A;  3F2B A;  2K14 A;  4JK1 C;  4HID A;  1JWM D;  4YHH Q;  4JI0 L;  1FYC A;  2HHH L;  4YY3 Q;  4YWL A;  4L5Q A;  2F0T A;  3EIV A;  4HCE A;  1HQM C;  3I4M B;  1TWA B;  2VNU D;  3OSO A;  4K5X A;  2EJM A;  4KHZ A;  2NVQ B;  2A74 C;  2IWH A;  3BZC A;  3NWS A;  1AE2 A;  1YI2 A;  1EY0 A;  1G29 1;  1IHZ A;  3OMC A;  5EBD A;  4HMI A;  4KY7 A;  3OHX C;  4LK1 C;  2K05 A;  2L5T A;  2XWB B;  3QWN A;  2AQ3 B;  1RCV D;  4G7O C;  1QJO A;  3HOX B;  1VQJ A;  4GOP A;  2K03 A;  4A3D G;  1P8L A;  2NWG A;  2A1A A;  3HOY B;  3NWT A;  1AEX A;  1WD1 A;  3PMF A;  1A3U A;  1OXU A;  3IL8 A;  3KK7 A;  3I4M H;  5K36 G;  3MEH A;  1TWA H;  3KFU A;  1B9M A;  1JOO A;  2F0W A;  2NVQ H;  2UXD Q;  5EBC A;  4KD4 A;  1PH6 A;  4XT3 B;  4CHT B;  1EU3 A;  4KHP L;  1K0S A;  2OCE A;  2ZJP A;  3HOX H;  1Z6H A;  3IRB A;  1I4X A;  1WCM G;  2NZ1 D;  4DR7 L;  1XX8 A;  1IKL A;  3VDY A;  2EYO A;  3HOY H;  2MHV A;  3O13 A;  3NTK A;  1VQI A;  3EN2 A;  5JEA H;  4X64 L;  1KAA A;  2E2J B;  3C2P A;  4QJF A;  1V1Q A;  4IPC A;  5HGQ A;  3K57 A;  2YU9 B;  2I5L X;  5GAD C;  2F0L A;  1Z47 A;  1BUV T;  2CWA A;  2L15 A;  3CXC A;  5C0X G;  2EQS A;  3D4R A;  4KKT A;  3DM1 A;  4HR7 B;  5ISR A;  3CRK C;  4OWX B;  4FVM A;  4ZAI A;  3S16 B;  3HKS A;  1JQY D;  1XNQ Q;  1FNU A;  2XGT A;  1WI5 A;  5ELN A;  3SGI A;  3K5O A;  1NY4 A;  4O2D A;  1B53 A;  3MFG A;  1DXM A;  5FLX c;  2A6E C;  5FK9 C;  1IBM Q;  3I72 A;  2MQH A;  2E2J H;  2I07 B;  1CSQ A;  2ZTE A;  1WTX A;  1K9M C;  3RN5 A;  4ZK9 B;  4QF4 A;  2KEN A;  4GNX B;  2R7Z G;  2YU9 H;  2B2V A;  4IUP A;  3NP8 A;  3K58 A;  1ZEQ X;  5CGK A;  4A75 A;  4IPD A;  4R4Q A;  4R8N A;  1N33 Q;  3FRP B;  4DR1 L;  4OO1 H;  5M3F G;  3S16 H;  2QEX A;  3SXH A;  2NUC A;  1A63 A;  4P71 A;  1GD7 A;  1S72 A;  3T56 B;  5I6Y A;  4LF9 L;  5D3D A;  2NN6 I;  3KLW A;  2C5C A;  1H9R A;  1M4V A;  1Q90 A;  3ERQ A;  3IAY A;  1YJW A;  1PLF A;  2ATW A;  2UUA Q;  1KQS A;  1CKN A;  1PFS A;  1NE3 A;  3M4Y A;  5K5P A;  1UAP A;  3HKZ E;  1F2Y A;  1HNW L;  2LFN A;  1PRT B;  3G71 A;  3TSS A;  1Y8O B;  1PH4 A;  1IBK Q;  1RIP A;  4L6T B;  3T4A C;  2KHJ A;  3K0Y A;  4J1M A;  3T51 B;  4JV5 Q;  1QVC A;  3BYY B;  1STH A;  3HOU B;  2VQE Q;  5C44 B;  5A2Q E;  1JC7 A;  1JWS D;  5C3E B;  2WB1 E;  4K6L A;  1CT1 D;  2K28 A;  3CAM A;  4KJO A;  4DAY B;  4P75 A;  2RVL A;  2AWO A;  2GA4 B;  3KLS X;  2RHQ B;  1YEZ A;  1PYW D;  1HNZ Q;  2FMM A;  2SNS A;  1ZKO A; 
#chains in the Genus database with same CATH homology
 1EOT A;  1ML0 D;  1SYC A;  1MD2 D;  3D8G A;  3R93 A;  2EOT A;  2H4O A;  2RDF A;  4OIK A;  3CKI B;  2K5D A;  4ZYS A;  2XRS D;  5KND A;  4F7X A;  2B2T A;  3R2I A;  1Y8P B;  2PW7 A;  1L0X B;  1D5X C;  4U67 3;  2IX3 A;  1JE4 A;  1DCZ A;  1CA5 A;  2KCC A;  2JA7 B;  2BDO A;  3FPU B;  3A7A B;  1SND A;  1Z7T A;  1QCB D;  4O42 A;  5E3F A;  2F0D A;  1DZ1 A;  5FO8 B;  3V05 A;  2R6G A;  1JB3 A;  1RTN A;  3GTM B;  1BCP C;  4IUT A;  4HCS A;  1IW7 D;  5FO9 B;  4C3J G;  2PMZ B;  1SE4 A;  4EQN A;  3HP3 A;  3OOC A;  5E4X A;  2FFK B;  1CHQ D;  5LL6 X;  3VR5 A;  1K8O A;  5CC4 A;  3MHB A;  5DAU A;  2F03 A;  1MGS A;  4RHS A;  1ENA A;  2N88 A;  2BOS A;  3MXU A;  1F9Q A;  4DXF A;  4H44 C;  3NK9 A;  4RGT A;  1EY4 A;  2VUM B;  3DEO A;  3GTJ B;  2BA1 A;  3C46 A;  3RZO B;  1RD9 D;  3GV6 A;  2JEB I;  1CQV A;  2PPB C;  2DY7 A;  4Q0F A;  4G7H C;  1GXD C;  4K8I A;  1AP0 A;  3NPP A;  5KYI A;  2L1B A;  2LMC B;  4PMC A;  5J1Z A;  1M8A A;  2OT2 A;  4A3M B;  4H0L C;  3H0G B;  4HAE A;  2F0S A;  3DHQ A;  1BOS A;  3P7J A;  4RKL A;  3SK6 A;  1HHV A;  4XQJ A;  2B2U C;  1O7Y A;  2RKS A;  2Y0S B;  4NW2 A;  2O5J C;  2RDH A;  1JR0 D;  2SNM A;  4RGO S;  1O78 A;  3KBX A;  5E1F A;  5IGF A;  4N9T A;  1GJX A;  1TII D;  1G91 A;  1JIC A;  1GOZ A;  1RF2 D;  1VMP A;  2PO4 A;  5A35 A;  4I65 A;  2QCP X;  5COY A;  2XRQ D;  3P1H A;  4PNY A;  3VR3 A;  2HUG A;  1PTO B;  4J6H A;  2SOB A;  1A15 A;  1STA A;  1D5M C;  4KN7 C;  3KLR A;  2PYK A;  3ZYY X;  4XTC S;  4ID6 A;  4LMQ D;  2NTS A;  2DN8 A;  1SMY C;  3A56 A;  1LTI D;  3QIA A;  5JPM C;  1TU2 B;  4QMG A;  2ZT9 C;  1F2Z A;  1RHP A;  5DEH A;  5KRU A;  1G2T A;  1PTO H;  1TY2 A;  4X3K A;  4IFD H;  2JE6 I;  3C3L A;  1EZ8 A;  4RA8 A;  1B50 A;  2F4I A;  1A6X A;  2WAC A;  2BA0 A;  2XIW A;  2K7V A;  3J81 E;  1BDO A;  2MPM A;  2AUJ D;  5I6W A;  1V1O A;  3ERO A;  4V19 0;  1FNV A;  1S5F D;  1SEB D;  5IGC A;  2F0P A;  2AQ1 B;  1NUC A;  2KED A;  1F9P A;  4RFB A;  3C1E A;  1LTS D;  4M8A A;  3SK5 A;  3ND8 A;  4FXK C;  3MAQ A;  1LTT D;  1EFI D;  4CGY B;  1ICW A;  2M9V A;  1NAP A;  4KMU C;  2O2L D;  1ET9 A;  5ELC A;  2E2H B;  4KK7 A;  2BE5 C;  4K8J A;  3A55 A;  5J39 A;  5EPK A;  1QNU A;  4QUC A;  2OEO A;  1F2L A;  3OMG A;  5HGT A;  1Y8N B;  1HPC A;  2A68 D;  2F0V A;  4FF2 A;  4JBW A;  1OO9 B;  4XQN A;  3BDL A;  4N9P A;  2NVY B;  1EY7 A;  2RSO A;  3JAM L;  1PFN A;  4OO1 G;  1ROD A;  4P2C B;  5EPL A;  1EZ6 A;  3CQZ B;  1KAB A;  4K6D A;  3FKI B;  3P75 A;  3FDT A;  1Y1V B;  5IIF A;  2JA5 B;  3QO2 A;  4WOR A;  2F3W A;  3CRL C;  1CQF A;  4WFN 3;  2XSC A;  3HZX A;  1T5E A;  4K2K A;  4FF3 A;  3I4N B;  2F0E A;  3A54 A;  2Z1C A;  2CW0 D;  1EWC A;  4FXG C;  1CI3 M;  2HDM A;  1FGB D;  3E0J A;  2EYP A;  1F77 A;  2BCO A;  3HG9 A;  3U9S A;  4RCO A;  2A6H C;  3I4L A;  5T1G A;  2AUK A;  2AWN A;  2NBF A;  4IUR A;  3MTS A;  2DNC A;  2IW3 A;  2X6L A;  1BXT A;  3VA7 A;  1YNJ D;  4RAU C;  2D2C C;  2Z8L A;  1D6E C;  5J22 A;  2RQX A;  1GUG A;  2TSS A;  2WP8 J;  2F3V A;  3J80 L;  1OXX K;  3OIP A;  1BCP F;  4FO2 A;  2CVR A;  4BY1 B;  4AYB B;  1Q1B A;  5CV4 A;  1MSG A;  2EZV A;  1LT6 D;  5M9O A;  3WOF A;  1R4Q B;  1AW7 A;  5FO7 B;  1WTR A;  3J7Y W;  2WII B;  4J8Q A;  4B08 A;  2KCN A;  1ESF A;  5KGU A;  3HOZ B;  1Q1E A;  5CV8 A;  3K6O A;  4ZKB B;  1HTP A;  1AFP A;  3C1F A;  2L4N A;  1PZI D;  2E76 C;  3LNN A;  2Q8R E;  1D5Z C;  1PZJ D;  3X3M A;  3L3O C;  2JXM B;  4B9X A;  4FF1 A;  1PTO C;  4PMW A;  3BDC A;  2RDG A;  4A3K B;  3PUV A;  1TWG B;  2E74 C;  2EJF C;  2L0C A;  1H9M A;  2A69 D;  5COR A;  5CYU A;  1A2T A;  3VYS A;  3MXP A;  2EYL A;  4U68 A;  2XN9 C;  2R92 B;  3SVM A;  1DYQ A;  4HTH A;  4ULL A;  4ZLT F;  1H9S A;  1V43 A;  2KHS A;  1FR3 A;  3K7A B;  3GTK B;  1STB A;  4Q5V A;  5C0X I;  5IT9 L;  4BBS B;  2HCC A;  1LTB D;  1PMR A;  2EY6 A;  2F0M A;  3QJY A;  3TN2 A;  2J7Z A;  1NSN S;  1LO5 D;  4I7Z C;  3S15 B;  2ENB A;  2IX1 A;  4XQQ A;  2A73 B;  3F2U A;  1BNZ A;  4H13 C;  2R61 A;  1S5E D;  3D31 A;  5D14 A;  1KTK A;  3LX0 A;  5EPJ A;  1EY9 A;  4Z9C B;  1KDA A;  1K8M A;  3DWQ A;  2F0G A;  2ZXR A;  1A3T A;  2HQE A;  1GHJ A;  1MI2 A;  5KYL A;  1SYE A;  3M7N A;  5CV5 A;  3W2D A;  1B2T A;  2CQA A;  5JJZ A;  3RUZ A;  1PXU A;  1EIG A;  4HED A;  2IT1 A;  1SE2 A;  1UEA B;  4QCL A;  4CKE A;  2L12 A;  3HOV B;  1U4L A;  2JSO A;  2N55 A;  1YNN C;  1XXG A;  1EQT A;  3OWE B;  4FXD A;  3EVQ A;  3I8Z A;  1SFO B;  4KY6 A;  1LT4 D;  2KEE A;  4DGZ A;  3AMU A;  2B39 A;  3UI2 A;  1EYD A;  4XYO A;  3NTH A;  3GTQ B;  2DNE A;  5CBE E;  3GTL B;  1QNK A;  4IUN A;  1JOK A;  5E4W C;  2HDL A;  5EQ0 A;  2A6E D;  1SNP A;  4DF7 A;  4XDX A;  2J0T D;  5EJW A;  3LWU A;  3NSW A;  3A7L A;  1DOK A;  3TP5 A;  2JP1 A;  1NR2 A;  2EDG A;  4G4K A;  2B2W A;  1V1P A;  3GTP B;  1LAB A;  5JVH 3;  1SBB B;  3DEP A;  4BBR B;  2C9O A;  5NUC A;  1JOQ A;  5FOB B;  1UNS A;  4KHV A;  5AFW A;  2VB2 X;  2K04 A;  5D65 A;  1EY8 A;  2ZXO A;  1HRJ A;  5ELE A;  1WCM B;  3D6C A;  5IGG A;  2SEB D;  3PUZ A;  5C5M A;  2KJX A;  3Q24 A;  4G7Z C;  3OWF A;  3MXN A;  4LAA A;  1EY6 A;  4RH6 A;  4PQX A;  3J7A V;  1ET6 A;  1SDF A;  4A3J B;  5C4Z A;  2F0H A;  1J8I A;  4KN4 C;  3KBG A;  3TZU A;  4IZ8 A;  1V8Q A;  1PFB A;  3L7Z C;  3VR6 A;  1Q3L A;  3QOJ A;  5M5X B;  2QDB A;  1KNE A;  1EEI D;  2O4X A;  2MUY A;  2B2Y A;  4BS9 A;  3IFT A;  1HFN A;  4C56 C;  2PCF B;  2R7Z B;  1TWH B;  1HCZ A;  2NVX B;  2PNR C;  1LTA D;  2LY7 A;  4NDX A;  4CJ0 B;  5C4X B;  2RA4 A;  3S1Q B;  3MC0 B;  3S2H B;  2WKC A;  5JAV A;  3J80 E;  1U4M A;  1STG A;  4UDU C;  4KKU A;  2NVT B;  2EYF A;  2Z4I A;  3KLS A;  1E2V A;  1BCP D;  4RKB A;  2O5I C;  4E6I A;  3VR2 A;  2MP1 A;  2EE1 A;  4FP5 D;  1E2W A;  3ITP A;  4TQU S;  1S5D D;  2F0F A;  2NN6 H;  3E5S A;  3T16 A;  2YYZ A;  1R9T B;  4IUU A;  5T1I A;  2PZT A;  3QG1 A;  4H7B A;  3VA5 A;  2EYM A;  3NBH A;  2F0I A;  2B2V C;  4OIJ A;  4FF4 A;  2WIN B;  4NP5 A;  1IL8 A;  1CHP D;  5JPN C;  1LT5 D;  3SR1 A;  2WAQ B;  4BWG B;  2ICI A;  2H1E A;  4RHR A;  3EFX D;  2XNA C;  4XYQ A;  3BS1 A;  2M2L A;  3V2T A;  3Q22 A;  5I2X A;  5CR3 A;  5F2D A;  1GUO A;  1J9O A;  2B8G A;  2Z4H A;  4BA2 I;  1XWE A;  1AN8 A;  5C0X J;  1WTV A;  2NTT A;  1F9S A;  5IT9 E;  3MFY A;  3D4D A;  3KF8 A;  2JA6 B;  1ZYR C;  1SE3 A;  2EXZ A;  1EEF D;  4KTA A;  5M3M B;  3FVQ A;  1ENF A;  5BN3 A;  1SXT A;  1AZQ A;  3WDN A;  5CV6 A;  4EQO A;  2BDN A;  5TSS A;  4C3H B;  2KVM A;  1PRT C;  2KA7 A;  1SNC A;  2QF7 A;  1I6V C;  4L63 B;  1O7L A;  1W6K A;  4R8I A;  4C2M B;  5JVG 3;  1I4G A;  1H9K A;  3GP7 A;  4OGQ C;  2B2T C;  3AU7 A;  4KY5 A;  1T5X D;  3WOE A;  3M7G A;  1Y69 U;  1U9R A;  1QWY A;  3PV0 A;  2F0U A;  3DWA A;  1WVL A;  1Q12 A;  1S4Z A;  1O7Z A;  1KDC A;  4A3I B;  5BN5 A;  1CM9 A;  3BVG A;  1I50 B;  4IQZ A;  5JEA G;  4IUV A;  2D62 A;  5M5Y B;  1I6H B;  3K59 A;  1KDB A;  1SMY D;  4HSV A;  1EYC A;  1QIL A;  1NR4 A;  2K33 A;  2F1M A;  2K32 A;  5HUR A;  3HGB A;  1LV9 A;  4KKS A;  3A8K E;  3NBI A;  5EKI A;  1SJH D;  3PO2 B;  1GUS A;  5C3W A;  2NB0 A;  1HUM A;  5G3L F;  1SNM A;  4ME5 A;  2LS0 1;  4KV6 A;  4KJN A;  1OXV A;  2E2I B;  3M85 A;  3CU7 A;  2F0J A;  2R3Z A;  2JA8 B;  5CV7 A;  2TMP A;  1C48 A;  3BDO A;  4Y7N B;  4TKO B;  4KD3 A;  5BN4 A;  5M5W B;  1X3Q A;  5C5L A;  5ELD A;  4OO1 I;  1CFM A;  4A93 B;  3ONA B;  2EYJ A;  1EY5 A;  1TS2 A;  1TWC B;  1ONL A;  4IAL A;  2IPK D;  5ELF A;  3NTI A;  3SK8 A;  1GHK A;  4CJ1 B;  3S17 B;  3Q0A A;  1STY A;  1D1I A;  4C3I B;  1SYG A;  3IKJ A;  4OHJ A;  1G8Z D;  1VDZ A;  2BE5 D;  2PZW A;  4L8J A;  3OIQ A;  4EVO A;  3K5N A;  3LWE A;  4XIG S;  1CK1 A;  5KIX A;  4IUQ A;  3T53 B;  1LTG D;  3FEW X;  2ID0 A;  3GV3 A;  2K5Q A;  1G6Z A;  3URY A;  1TWF B;  1HXY D;  3OPO A;  3RD4 A;  4UAI A;  5FKA C;  1RJT A;  2IX0 A;  3N52 A;  2MJ8 A;  1HUN A;  2X69 A;  3A8I E;  2K01 A;  3S1N B;  4ZKC B;  2E75 C;  4DNT B;  4RGM A;  1RKN A;  3TP6 A;  1QOH A;  1ILQ A;  3PIO 3;  3RZD B;  4CJ2 C;  3W3A A;  5KNB A;  3A8J E;  3S9W A;  2EY1 A;  1II3 A;  1VF5 C;  2M00 A;  1EIH A;  5I4D A;  1U4P A;  1EQV A;  1H9S B;  3EA6 A;  2ICE C;  4MN3 A;  1VMC A;  3VYU A;  4F8M A;  4X3U A;  3Q23 A;  2K6A A;  2NYZ D;  3BZD B;  1S5C D;  2PQE A;  3D6W A;  4DXG A;  4A3B B;  1O80 A;  1FD7 D;  2A6H D;  4ZRZ A;  3I91 A;  4K2L A;  3G6J B;  4K14 A;  2X6G A;  1WTQ A;  2VB3 X;  4X3T A;  2R93 B;  1SYB A;  3R8B A;  2CHB D;  1XTC D;  4ABN A;  1KLG D;  3S1M B;  4CKC A;  5IOC A;  1U4R A;  2B2U A;  2G9D A;  3H94 A;  1TKW B;  1PZK D;  3P20 A;  1HA6 A;  2QEJ C;  4HMJ A;  2XWJ B;  5CBA E;  3MZ5 A;  3I3C A;  3TDQ A;  4NMZ A;  2D9U A;  1BR9 A;  3J81 L;  3NHH A;  3PUW A;  3NUC A;  1C8C A;  2NN6 G;  1PTO D;  1DOL A;  1D2B A;  3MVV A;  1ESR A;  4ODG A;  1JCK B;  5LHY 1;  1DON A;  1IW7 C;  1EL0 A;  3K5M A;  1BQQ T;  4HSP A;  1HA5 A;  1KNA A;  3GD7 A;  3CHB D;  1LTR D;  4ZUJ A;  2VXW A;  1DD2 A;  1B1Z A;  1V1P B;  3U9O A;  4LJZ C;  4XXE A;  3QB3 A;  4DN4 M;  3Q6S A;  1SJE D;  4YIJ A;  5JEA J;  3PIP 3;  3EJI A;  3H09 A;  4BA1 I;  2KEC A;  4FNF A;  4A3D B;  3AB9 A;  5DM7 3;  2EVB A;  1PRT F;  4GZY C;  2QKI C;  1MBY A;  3HRZ C;  1STE A;  3NXW A;  4IFD G;  4MIU A;  3DWP A;  3I70 A;  5EKK A;  3MA2 B;  4OL7 A;  4ZQ3 A;  1GUN A;  4DAY A;  1STN A;  5FLX L;  5C3X A;  5G3L D;  4IFD I;  2XVS A;  3NE5 B;  5IGE A;  3TP8 A;  3PUY A;  1WTO A;  1VCI A;  4XT1 B;  3JAM E;  4F88 A;  1ENC A;  2F0O A;  2RSN A;  1Q8I A;  5K36 H;  2OXP A;  4IN3 A;  1E0B A;  3SEB A;  1YNN D;  1QB5 D;  2EPB A;  3EQL C;  4S3S A;  4NKL A;  5D3I B;  1UUP A;  1X32 A;  4WJW A;  3SDZ A;  1LAC A;  1OXS C;  2QIL A;  1TR5 A;  2OF1 A;  3FPP A;  2AQ2 B;  2F0Q A;  5DM6 3;  4C3H G;  1PFM A;  4C1N K;  1DJR D;  1BO0 A;  1IKM A;  1CZG A;  4QIW B;  4EGV A;  3GTO B;  5C6A A;  2Q8I B;  2PW5 A;  3R2T A;  2FHT A;  4C1N I;  1TS3 A;  2LKV A;  4KI0 A;  1ILP A;  1F9R A;  5EKL A;  4K5W A;  5C0X H;  3S1R B;  3BVZ A;  5M3F B;  2JYO A;  2E2D C;  1GUT A;  1SNO A;  4DA2 A;  3BYT B;  4MHE A;  3IFD A;  1D1K A;  4R9W A;  3L9A X;  3H3V C;  4RGN A;  4DK1 A;  4FYD A;  1HFG A;  1BBX C;  3V96 A;  3NQT A;  1JWU D;  2PZU A;  1A2U A;  4DAP A;  5CV9 A;  1I4H A;  3TBI B;  3RMH A;  2JEA I;  4V0B A;  2L9H A;  3J7A F;  3TP7 A;  5KNC A;  4QB4 A;  5KEE A;  4TRD A;  2WKD A;  4DFA A;  3DXJ C;  4DNR B;  3H6M A;  3GTG B;  2A5H A;  5C4H A;  1I3Q B;  4ZUI A;  3K5L A;  1LLR D;  3RLF A;  5I9O A;  3X3N A;  4RWS C;  1JOR A;  4CKB A;  3VYT A;  1SNQ A;  1W6J A;  5C4J B;  3S14 B;  2Q8T A;  2SDF A;  4DU9 A;  3BVM A;  1WTW A;  4DK0 A;  2J4X A;  2EY2 A;  5ELB A;  1QG7 A;  4BY7 B;  1ZXT A;  1VF7 A;  4C3I G;  2I46 A;  5IGB A;  1SSO A;  1I4R A;  2B63 B;  2FMC A;  3E6Z X;  4A3G B;  2KOL A;  1I4Q A;  4C3J B;  2F0K A;  1CTM A;  3D4W A;  1PTO F;  1WTP A;  4RCN A;  1HTL D;  3SHL A;  1G2S A;  2F0N A;  1H9J A;  3TZD A;  3QOL A;  1B3A A;  2A68 C;  4DAV A;  2K1B A;  1Y1W B;  1WD0 A;  4HN7 A;  3S2D B;  3HS0 C;  1XYI A;  5IOD A;  5DNF A;  3I90 A;  3H91 A;  2EY5 A;  5EGT A;  1RTO A;  4F87 A;  4O1N A;  1OXT A;  1MSH A;  1TVX A;  1A3V A;  3PO3 B;  4ILW A;  1K83 B;  2IL8 A;  1L0Y B;  2B2W C;  2G9H D;  2B8F A;  2IJ0 A;  4QUF A;  1R4P B;  1NCV A;  3R3O A;  5A2Q L;  3MWY W;  1SYD A;  1I4P A;  1HQR D;  1IYV A;  3G7L A;  5JOB A;  1FNW A;  2V4D A;  3GQB A;  4TSS A;  4WRD A;  3OW7 A;  3GO5 A;  2CW0 C;  3M3Y B;  1TS5 A;  2L11 A;  4PMB A;  4B9W A;  1E2Z A;  4M1U B;  1CA6 A;  2EJG C;  4G57 A;  1TY0 A;  1CZW A;  2D5D A;  5I9P A;  3KUP A;  1ZYR D;  2MGS A;  1YNJ C;  3M4O B;  1B9N A;  1B4O A;  2ZXP A;  1BF4 A;  3PUX A;  2FIN B;  4CBV A;  1SAP A;  1F2M A;  4A3E B;  1PRT D;  3ND9 A;  1GUW A;  3VYR A;  2B2Y C;  4IFD J;  4K5V A;  1IYU A;  3I73 A;  3MXG A;  1SYF A;  5FLX E;  3HOW B;  2L55 A;  1LT3 D;  1EU4 A;  4A3F B;  4PV1 C;  2HCI A;  2KUM A;  5CMD A;  1TS4 A;  3HEJ A;  1PDQ A;  3SK4 A;  3SE0 A;  1DM0 B;  2FJ2 A;  3FMC A;  1BCP B;  3NQI A;  1DOM A;  1EWH A;  3N6R A;  1RDP D;  2RBM A;  1KLU D;  3DUZ A;  3TME A;  2DY8 A;  3HKZ B;  1C4Q A;  1EYA A;  5I2Y A;  5LL6 S;  2KQ3 A;  1S5B D;  1QE6 A;  3D3R A;  3VR4 A;  2WV6 D;  1TQO A;  4EQP A;  3DMU A;  1X3P A;  3BG3 A;  2A69 C;  4X3S A;  2EYH A;  1TT2 A;  2WB1 B;  5IGD A;  3T13 A;  1AZP A;  1B44 D;  2K5W A;  4JK1 C;  1JWM D;  1FYC A;  2F0T A;  4HCE A;  1HQM C;  3I4M B;  1TWA B;  2VNU D;  3OSO A;  4K5X A;  2EJM A;  4KHZ A;  2NVQ B;  2A74 C;  2IWH A;  3NWS A;  1EY0 A;  1G29 1;  1IHZ A;  3OMC A;  5EBD A;  4HMI A;  4KY7 A;  3OHX C;  4LK1 C;  2K05 A;  2L5T A;  2XWB B;  3QWN A;  2AQ3 B;  1RCV D;  4G7O C;  1QJO A;  3HOX B;  2K03 A;  2NWG A;  3HOY B;  3NWT A;  1AEX A;  1WD1 A;  3PMF A;  1A3U A;  1OXU A;  3IL8 A;  3KK7 A;  5K36 G;  3MEH A;  1B9M A;  1JOO A;  2F0W A;  5EBC A;  4KD4 A;  4XT3 B;  4CHT B;  1EU3 A;  1Z6H A;  1I4X A;  2NZ1 D;  1XX8 A;  1IKL A;  2EYO A;  2MHV A;  3O13 A;  3NTK A;  5JEA H;  1KAA A;  2E2J B;  3C2P A;  3K57 A;  2YU9 B;  2F0L A;  1Z47 A;  1BUV T;  5C0X G;  3D4R A;  4KKT A;  3DM1 A;  4HR7 B;  5ISR A;  3CRK C;  4FVM A;  4ZAI A;  3S16 B;  1JQY D;  1FNU A;  3K5O A;  1B53 A;  3MFG A;  1DXM A;  2A6E C;  5FK9 C;  3I72 A;  2I07 B;  1WTX A;  4ZK9 B;  4QF4 A;  2B2V A;  4IUP A;  3NP8 A;  3K58 A;  1ZEQ X;  5CGK A;  4R8N A;  3FRP B;  4OO1 H;  3SXH A;  2NUC A;  3T56 B;  5I6Y A;  5D3D A;  2NN6 I;  2C5C A;  1H9R A;  1M4V A;  1Q90 A;  3ERQ A;  3IAY A;  1PLF A;  3M4Y A;  5K5P A;  1UAP A;  1F2Y A;  2LFN A;  1PRT B;  3TSS A;  1Y8O B;  4L6T B;  3T4A C;  3K0Y A;  4J1M A;  3T51 B;  3BYY B;  1STH A;  3HOU B;  5C44 B;  5A2Q E;  1JC7 A;  1JWS D;  5C3E B;  4K6L A;  1CT1 D;  2K28 A;  4KJO A;  2RVL A;  2AWO A;  2GA4 B;  3KLS X;  1PYW D;  2FMM A;  2SNS A;  1ZKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...