1TR5A

Room temperature structure of staphylococcal nuclease variant truncated delta+phs i92e
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title X-ray and thermodynamic studies of staphylococcal nuclease variants I92E and I92K: insights into polarity of the protein interior
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 37
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2004-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1tr5A00
2EYHA 1SYDA 2F0MA 3D6CA 1EY0A 3C1FA 4WRDA 1JOQA 4RKBA 3SK8A 2EY5A 4H7BA 4K6DA 2F0OA 5IGFA 3MZ5A 5C3WA 1STYA 5EGTA 5C5MA 2PYKA 2F0PA 2F0FA 1RKNA 5C5LA 5KGUA 1EZ6A 4DFAA 4K5VA 5CV8A 2LKVA 4QF4A 1A3UA 3D8GA 3C1EA 4N9PA 4KJOA 4DU9A 2OF1A 4ZUJA 1SNOA 1SYGA 4LAAA 3NP8A 5IGBA 3NXWA 4N9TA 1NSNS 4B9XA 5KYIA 4K14A 2HQEA 2RKSA 3ITPA 4K5WA 4ZQ3A 5DEHA 4E6IA 4KHVA 4QMGA 5E1FA 1NUCA 2EXZA 2F0TA 5JAVA 3TP5A 4IUNA 3EVQA 5CV6A 4YIJA 5HURA 2EYLA 3LX0A 5K5PA 4HTHA 1KAAA 4NKLA 2F0EA 3EJIA 1U9RA 3NUCA 3T16A 3V2TA 2F0NA 3SK4A 3NQTA 2PQEA 4IALA 2RBMA 2KHSA 1EY7A 3D4WA 2OEOA 3QOLA 1AEXA 3MEHA 2F3VA 3S9WA 3SXHA 1SYEA 5I6YA 5CV5A 5I6WA 2EY1A 1F2MA 4HMJA 1TT2A 2F0VA 2F0HA 3H6MA 4KV6A 1JORA 1A2UA 5IIFA 3QOJA 1KABA 3SK5A 4I65A 2PZWA 3QB3A 1SYCA 4KY5A 1EYDA 1SNCA 5CV7A 1SYFA 5NUCA 5C4HA 5EKKA 1EY8A 4KY7A 4PMBA 5E3FA 1EY4A 4ZUIA 2F0JA 4K2LA 1F2ZA 4PNYA 5CR3A 2M00A 4ODGA 3EROA 1ENCA 1STAA 5C3XA 2PW7A 3R3OA 2OXPA 4NDXA 3DHQA 1A3VA 1JOKA 1KDBA 3OWFA 4J1MA 1STGA 3SR1A 3U9OA 1A3TA 2WACA 5J22A 3P1HA 5KRUA 4K8JA 4K8IA 3OMCA 4S3SA 1STNA 4R8NA 1IHZA 4NP5A 5DAUA 3OMGA 4KTAA 2F0UA 1II3A 3T13A 3RUZA 1EQVA 1STBA 5CV9A 5J39A 1KDAA 2SNSA 1KDCA 4IZ8A 4DF7A 5I9PA 3TMEA 4K2KA 5EKLA 5KIXA 1TR5A 4NMZA 3SHLA 2EYFA 3P75A 1SNMA 2O4XA 3ERQA 1ENAA 1SNQA 3PMFA 4F8MA 3BDLA 5IGEA 1EY5A 5M9OA 2PW5A 2SOBA 5CV4A 3E5SA 3HEJA 3MHBA 4G57A 2PZTA 2F0QA 4EQNA 2RDFA 4EQOA 3SK6A 4B9WA 3VA5A 2EY6A 1STHA 5F2DA 5CC4A 4KD4A 5ISRA 2EYPA 5C6AA 2EYOA 3MVVA 4ME5A 4DGZA 5IGCA 5IODA 5IGDA 4KD3A 4PMCA 1F2YA 5IOCA 4OL7A 1TQOA 5CGKA 2ENBA 1SYBA 3NHHA 4EQPA 2EYMA 2EYJA 1EZ8A 3BDCA 1SNPA 4K5XA 4F7XA 5KEEA 5JOBA 2SNMA 2F0IA 3TP8A 4QB4A 3DMUA 5HGTA 3D4DA 4WORA 2F0SA 2EY2A 1EYAA 2QDBA 2KQ3A 3OSOA 1A2TA 1EYCA 4HMIA 4MIUA 4RKLA 5J1ZA 1EY9A 2F0KA 3NK9A 5KYLA 3HZXA 4KJNA 3TP7A 4EVOA 2F0LA 3TP6A 2F0DA 5C4ZA 1EY6A 2F0WA 1SNDA 2F0GA 1JOOA 2F3WA 2NUCA 2PZUA 3MXPA 4ID6A 4KY6A 5I9OA 5IGGA 4J6HA 4TRDA
chains in the Genus database with same CATH superfamily
4GNXB 1U4RA 3VR5A 5C4XH 1WYDA 2JA7G 2XGTA 3MZ5A 1YNND 4RAUC 2R7DA 4IURA 1X6OA 3D8GA 4N9PA 4A3JH 5IP7G 3NXWA 5LL6S 4N9TA 4UDUC 1VQ6A 5C4JH 4ZQ3A 5LMUL 2R7FA 3I72A 4CDCC 4RHSA 4Y52H 4BY7H 4YIJA 2EYLA 3V2TA 4GKKQ 1I3QB 4IALA 3D4WA 5FLMH 5JPNC 1V1PB 4LF6L 1O78A 4GKJL 1V1OA 2UU9L 5IIFA 4DV6L 1KABA 1B8AA 4LF8L 3S15H 1BCPD 1K83H 1HA5A 3DXJC 3RNUA 3FHWA 2YTYA 1EY4A 1F9RA 4DR4L 1EWHA 1IL8A 4NXNL 1BOSA 4RH6A 4GS3A 1I5FA 3GO5A 3P20A 5IT9L 1A3VA 3KBGA 3FRPB 3CXCA 4RCNA 2WP8J 3SE0A 3S1NB 1CFMA 1JB3A 2CH4W 4C2MH 5C0XG 2UUAQ 3CU7A 3SGIA 3F2CA 2A6ED 2PO4A 3CRLC 1GHJA 2VQFQ 5JPMC 1LT5D 4A3GG 3CMAA 4J8QA 3NBHA 3TEHB 4HSPA 2NVXB 1ZXTA 4AQYQ 1AN8A 1JJCB 1O7ZA 3FKIH 4QQBX 5A2QE 2D5DA 3K59A 2B8GA 2ID0A 1JT8A 4LF9Q 4LF4L 4KD3A 5IOCA 4QIWB 1WTOA 3EN2A 4I7ZC 1T9HA 3AFPA 4DNRB 1I6HB 3PO3H 4YY3Q 1I4HA 1IYVA 1JQYD 3HOUB 1YHBA 2B3GA 4QJFA 1EY9A 3DLLA 5KYLA 4RCOA 5T1IA 4O1NA 4ID6A 1Y1WH 3IRBA 3GTMB 3SK8A 4K6DA 1K8GA 4RHRA 2AUJD 1X56A 3CQZB 1STYA 3GTQH 1FYCA 4KK7A 4DUYL 3NTKA 5IT9E 2LKVA 3K7UC 4H02A 3HOUG 5C3EG 4DPGA 4BXXG 1SYGA 2DNCA 1QG7A 3H91A 2Z6KC 2RKSA 3PUYA 3HFZB 1VF5C 4JI1Q 1PH2A 3GQBA 1YNXA 3Q0AA 4X3TA 3TP5A 4DV5L 5C4JB 4CDEC 2NN6I 4FXGC 1SSOA 3QOLA 2KHSA 4IO9A 2D0OA 1AEXA 2UXDL 1IKLA 3I3CA 3ERSX 2I5HA 5I6WA 2EJFC 1XNQQ 2O2LD 5COYA 1ONLA 2YTXA 1G51A 3QB3A 3GTLH 3CCRA 1EY8A 4PMBA 2K5HA 1E2VA 3RMHA 5I4DA 3KJOA 2MPMA 3A7AB 1O80A 3R3OA 4JI0L 3E9IA 1K83B 2NZOA 3CCEA 4DV0Q 4HJAA 3T1HL 1EIFA 4ZK9B 1K0SA 2D62A 1OO9B 3EIVA 4LFCQ 4DR2Q 3T13A 1JC7A 5CV9A 1B9NA 1LT4D 5FLMG 3G48A 3ICEA 1PMRA 1TY2A 2ICEC 5KIXA 4JI4Q 4L8JA 1IYUA 1GD7A 3PMFA 1JWMD 1G91A 5IGEA 1G2TA 3E5SA 4UAIA 1HUNA 1WD0A 2RDFA 1ZYRC 1KQSA 3A74A 4P72A 1KTKA 4JG2A 1Q8KA 2EYOA 1L0XB 3KF6A 4JC0A 1J5EQ 3FKIB 1F2YA 3OTOQ 4LUVA 4XQNA 3NHHA 2X6GA 2EYMA 2DJFC 1PYSB 4K5XA 1PTOC 4DN4M 2A1AA 1GUOA 1KAWA 1PFNA 4OWXB 1N33Q 5FK9C 1N32Q 3PO3B 1LYLA 1RIPA 2OQ0A 1AW7A 1SNDA 2M2LA 3AFQA 1IBMQ 2NYZD 2A6HC 2CKZB 2QA4A 1JOQA 4R9WA 1OXXK 4BBRH 1X32A 5EGTA 3NPPA 1XMOL 1Y1WB 1JJGA 3I90A 4DK6C 1F9PA 2P5ZX 3PGZA 3C2PA 5G3LF 3HP3A 2HD3A 4LAAA 2ZM6Q 4ME3A 3VYTA 1SE8A 2FHTA 4IUPA 1C9OA 4A3EB 4GLVB 4LNQA 1VQHA 3PO3G 2VQEQ 4ZLTF 3V05A 4OX9L 4LF5Q 4F88A 4RFBA 2QKIC 1L0YB 4HIOA 2KUMA 5K5PA 3NUCA 3BZDB 1QOHA 2WINB 3L7ZC 2PQEA 5AJ3L 1MSGA 2OEOA 1K3RA 3PO2H 1Y1WG 3S2DH 1AH9A 1FR3A 4JVZA 3B6YA 2MUYA 4DAVA 1B3AA 2UXCQ 1N8RC 2XWJB 1FNVA 3MXNA 1VQLA 2L55A 2CCZA 1JMCA 4A3EG 4Z9CB 1VQJA 2DNEA 1SDFA 2B2YC 1VQIA 3OOCA 1STAA 4R4CA 3GTLB 3S1RH 1PRTB 3RN2A 4DUZL 4NXML 3MC0B 4S3SA 3I4MH 3Q8DA 3K81C 1HUMA 3A5ZB 4K6LA 3RUZA 3AB9A 1SLJA 1H9JA 1GVPA 4OXPA 1B50A 5JEAH 3TMEA 2EDGA 2BE5D 1TR5A 4NMZA 3SHLA 5FLXc 4DR7L 1WD1A 3BDLA 4JI7L 3HEJA 1EEID 1S72A 5M5WH 1A63A 3IFDA 3NTIA 1VQNA 3HGBA 4HSVA 4G7HC 1VQ5A 4IPGA 4GOPB 2JXMB 3C3LA 3M4PA 2EYJA 3V96A 5JOBA 2R3ZA 1ILPA 1MD2D 3SVMA 1I4GA 3LWEA 3ND8A 1A15A 2N88A 1HQRD 2EY2A 2QDBA 2CWAA 4FP5D 1LTLA 4EQ5A 5IYDG 4A3IH 1BBUA 1Y69U 1Q90A 1Y1VH 4R1JA 1D5XC 5JJLA 1XMQL 1ZYRD 1TIID 2EY5A 1A8VA 4CJ0B 4ZCKA 1CSPA 2Z4HA 5CV8A 3E9HA 3J80c 4DU9A 4IOCA 2ZT9C 1PTOD 4C1NI 1GUTA 4AYBE 4B3SQ 1WTHA 2K4KA 1LLRD 1NUCA 3G4SA 4IUNA 1HTPA 2E2IH 4MHEA 4BBSH 4HTHA 1YVCA 1U9RA 3T16A 2F0NA 4JBWA 2RBMA 1EY7A 3S9WA 1STEA 3SXHA 2A6HD 4JI8L 2IY5B 2Z6KA 4DAYB 1S40A 1EU4A 3PO2B 2X6LA 3S2DB 3KBXA 4HEDA 4PZ8A 2QW7A 1PHJA 1OTCA 4DA2A 3CRKC 2HIXA 4XIGS 5EKKA 2K50A 2D9UA 3IKJA 1E3PA 1QZHA 4DV1Q 1HNWQ 1YITA 3EROA 1TXYA 5ELBA 1WTXA 4U673 1KL9A 1MSHA 5K36H 3OWFA 4J1MA 5ELDA 1I4PA 1EFID 3J81c 2NZ1D 3DWPA 5JJIA 2F0UA 2IWHA 4A3DH 2Z0SA 1SMXA 1HZ9A 1QUQA 2K52A 4GKKL 3W1GA 1CT1D 3I4MB 3I2ZA 4OHJA 2IHEA 5EPLA 3MHBA 4DV3Q 4RMFA 3HOXH 2JQOA 1UUPA 1ICWA 1ENFA 4GN3B 1KHIA 4B3MQ 2KENA 3T51B 5M5WB 1H9KA 1FD7D 2B63H 4M8AA 1CHQD 2C9OA 1KD1C 2R93G 3I4MG 2DGYA 1U4MA 4O42A 2UUAL 1IBKQ 3ULLA 5I2XA 5JEAG 4L63B 3PIP3 2BOSA 2F0KA 2BDOA 2VQFL 1RTOA 4A3IB 3BVGA 5IGGA 4AQYL 2H4OA 3L3OC 1SMYC 1AFPA 1VMCA 1JCKB 1Y1VB 5C5MA 2OQKA 2AHOB 4O2DA 2VY3A 2FINB 4LF9L 2N3SA 1N9WA 1CKMA 2ZTEA 2UUCQ 1VQAA 1BVSA 2VUMH 3S14H 1KRSA 1N34L 5DEHA 4UP8A 3PUXA 1EYGA 2AWOA 4YY3L 4A3IG 1EQTA 3K5MA 4KLKA 4O0AA 2V4DA 1VF7A 2IX3A 2PNHA 4FF4A 1E2ZA 5EQ0A 1Y1VG 2XWBB 1MGSA 3NBHB 4MN3A 2OTJA 2F3VA 2QCPX 2E2IB 4BBSB 2RVLA 2F0VA 4DK3C 1WTWA 1SFOH 1BCPC 3E0EA 3QOJA 1UE6A 1VQEA 1LT6D 2E2HH 3NENA 2F3IA 1M8AA 4JOIA 3N52A 4AH6A 4XYQA 1ENCA 5C3XA 2OXPA 3R2TA 3UDGA 3DHQA 1UNSA 1JOKA 1VQ8A 5DM63 2B2UA 3GTGH 4JI1L 4BBSG 3HOVH 4R4IA 1YBYA 1D6EC 4ZKBB 1QJOA 4X66Q 2GVAA 4DV4Q 3D3RA 2B2YA 3A56A 4A3GH 1TVXA 3P75A 1X3GA 2NZHA 1EUJA 4A3DB 2KECA 4X65Q 1XNQL 2JA5G 2F52A 4FXDA 3ZYYX 5CBAE 1GHKA 4KI0A 1DOLA 2ZXRA 1VQ9A 2ZJQA 1PH9A 3HOWG 4ME5A 1CQFA 1PFMA 1Q7YC 3HOXB 2XRSD 1QVGA 4ALPA 5K36G 3NWTA 4JYAQ 4DV0L 1X3PA 4LFCL 4A3DG 2K14A 4DR2L 4WORA 1CKNA 4LUOA 2AMCB 2J4XA 1DXMA 2ZJPA 5J3BA 2F0LA 4JI4L 3WWVA 3PV0A 1CA5A 1I4QA 3A8JE 1HJPA 2N49A 3VR3A 2WFWA 3JC66 3STBD 3DUZA 3HOXG 4HCSA 4OEMB 3QO2A 4RGMA 4C3IH 2LY7A 2PYKA 4IUVA 4ZRZA 4BA2I 5C3EH 4XT1B 2FMCA 4R4OA 4DR5Q 4XQQA 1EQRA 1Z9FA 4F87A 3C1EA 1J5EL 2OF1A 1QVCA 1SROA 4UP7A 3OTOL 1PH7A 1ZEQX 2C35B 1Q1EA 5M3MH 3DM3A 1B9MA 2WKCA 3URYA 2JJQA 4QMGA 2K5NA 2RSNA 3BDOA 2EXZA 2YYZA 4JPBW 3PUZA 2JP1A 4PZ6A 3S14B 1JE5A 2VUMB 2KVMA 4OWWB 4P74A 1N33L 2E5LQ 4IFDJ 1LTAD 4HJ5A 3IAYA 1HPCA 4C1NK 5FO7B 1N32L 2E2DC 2NTSA 3F1ZA 4CKCA 2HHHL 1IBML 4CHTB 3CCJA 1SMYD 3ER0A 3PSIA 4XDXA 2L0CA 1YEZA 1OXVA 1EOVA 2LSSA 4LMQD 3UE1A 5D14A 3KF6B 5IP9G 1IZ6A 4CKEA 1SFOB 2E75C 2VUMG 2JN4A 2NWGA 1UAPA 4LUZA 5GADC 2ZM6L 1HRJA 2E2HB 4RWSC 2UXBQ 2FMMA 4I7AA 1STGA 3JAME 2UUBQ 3CC2A 1A3TA 2HUGA 1H95A 2VQEL 3OMCA 3D31A 4LF5L 4EX5A 1HNZQ 4GLAC 4LFAQ 1GO3E 1SXTA 2QF7A 1JWUD 3GTGB 1VQFA 3NBIA 2FFKB 3HOVB 3I73A 1ENAA 4G7ZC 4A3GB 3CCVA 1ET6A 2BA1A 1RJTA 2UXCL 2NVTH 2KHJA 4CKBA 3KLSA 1VQGA 3R8BA 1VDZA 1EIGA 5F2DA 1OXSC 3GTJH 1IKMA 1I6VC 4EGVA 1PH5A 5IODA 1D8LA 4IFDH 1HQMC 1YNJD 2R61A 1K28A 4QIWE 4MNOA 4QY7A 1FNWA 3BDCA 3X3MA 1MI2A 1O7YA 2MFIA 1X3EA 4X62Q 2G9DA 3HOVG 1E0BA 5LMNQ 1HTLD 2KJXA 5LMNW 1EFWA 1B1ZA 1VQ7A 1HA6A 4KHPQ 2BDNA 5D3IB 4APVA 2TMPA 2B2WA 3MXNB 2F0MA 2E76C 1SEBD 3CW2C 2I5LX 3H94A 5KGUA 4K5VA 5E4XA 1PVOA 1M1KC 4ZUJA 1V1QA 3I4LA 1SNOA 2KEEA 5BN4A 5FLXL 4C3IB 2K03A 1PRTF 1BNZA 1NSNS 2R92H 5C3EB 3TS2A 5FOBB 3RD4A 4X6AH 2WAQE 1TU2B 4DV7Q 4JBJA 1GXDC 4RG1A 4YCUA 3HG9A 3MFYA 3UDIA 3AYHB 5M3MB 3U50C 2JEBI 2GN5A 1T5EA 1U4PA 5LHY1 4ABNA 4LFBQ 2RSOA 3CCMA 1Y8NB 5ELNA 2Q8RE 4JI6Q 5EAYA 4A3EH 2B2TC 3SK5A 4C3IG 4ZKCB 1SYCA 2A19A 1DYQA 4IUUA 2Y0SE 4POGA 3DWAA 3CC7A 4KY7A 4A3LH 3BYYB 4PNYA 2ES2A 4ODGA 5M3MG 2AWNA 4NDXA 1EIHA 5CBEE 4LF7Q 2CH4A 1Q3LA 5J22A 4R8NA 3OMGA 1II3A 1EQVA 1STBA 2BE5C 2IHFA 2F1MA 2SNSA 3J80L 4C56C 3GDEA 3VR6A 5IWAQ 3BYTB 5M9OA 5JJZA 4A93H 1GM5A 2RCNA 5FLXE 1XJVA 4CJ2C 4B9WA 3U4VA 2L11A 1NBWA 5ISRA 4HJ7A 2EYPA 1Q1BA 2Q8IB 3PIO3 2K75A 2NVTB 4DV1L 1HNWL 3J7ZC 4OGQC 2RDHA 4TQUS 3TS0A 4EQPA 3ULPA 3GTJB 1N36Q 3BZCA 5ELOA 3A54A 2EXDA 5IYDH 2K32A 4K0KQ 4HR7B 1E1TA 2KHIA 3RLOA 4R8IA 2ALYB 1EYAA 4RKLA 4HMIA 1ASZA 3VR2A 1IYJB 4GN5A 1DJRD 4X64Q 1G8ZD 3U9SA 1QCBD 5E4WC 3SDZA 2F0WA 2XNAC 4HJ8A 1L1OC 3J81L 1JWSD 2XVSA 4DV3L 2F0OA 3VYRA 1R9TH 2K01A 1DOKA 1HZBA 4IFDG 4QF4A 1XXGA 1O7LA 4B3ML 4KJOA 4H44C 2JSOA 4CDDC 1W6JA 3K5LA 5ELCA 2HQEA 4K5WA 3JAMi 3FMCA 5FJ8H 2HDLA 4ILWA 4ULLA 2HCCA 1XPOA 1IBKL 2R92B 1QUQB 2B2VC 1K9MC 3TDQA 2I0QA 1NE3A 4IUTA 1CM9A 4DAMA 4CGYB 4WFN3 3E0JA 2A73B 4JV5Q 1WTQA 3K7AH 2NTTA 4NW2A 3HKZE 1X65A 2PZWA 1V1PA 2MGSA 4H0LC 5KNDA 2JA8H 1JICA 2ZTDA 5IYCH 2UUCL 1GUNA 3K5NA 2R92G 1QWYA 5C0XI 1OXTA 1HCZA 2L1BA 5L37A 1Z47A 4B08A 3I4NH 5KRUA 4JOIC 4Q5VA 1LTID 2O5IC 3KDFA 2RQXA 4R4QA 5J39A 1Y8OB 1HNXQ 4IZ8A 1MJCA 5EKLA 3W1BA 2B2UC 3J81E 2KOLA 2A74C 1O7IA 4F8MA 1QE6A 3K5OA 1EY5A 2RDGA 3HS0C 1EWCA 4LK1C 5E7NA 2EIFA 3GTKH 4EQNA 1VMPA 1SBBB 4A3LG 1U4LA 4A93B 3P7JA 3A55A 1XTCD 4BWGB 1TS2A 2VW9A 4GLXA 4DNTB 4QCLA 5IYBH 1U5KA 2H5XA 1NMFA 4ZYSA 2R93H 2OWOA 1EZ8A 4IJHA 1KNAA 1NCVA 4DR4Q 1E7ZA 1LACA 2PQAB 5HGTA 2K5VA 1HH2P 3OSOA 4X66L 2R7ZH 1WTRA 2XN9C 4DV4L 4HIKA 2VNUD 2K6AA 2GVBA 3HZXA 2EOTA 1CI3M 1FL0A 3BJUA 3W5OA 1NTGA 4A93G 4KY6A 3PIOA 1NJIC 2DY8A 4X65L 3UDXA 3CCSA 1VQBA 1WI5A 1X54A 1S5FD 3DEOA 3I7FA 3H3VI 3VR4A 4CJ1B 1E1OA 3I91A 1PFSA 1HZAA 1M4VA 1R9TB 4YCVA 5D65A 3CCLA 1X55A 4JBKA 1PYBA 3MA2B 4K14A 2K05A 1H9SB 3RN5A 4JYAL 1B3QA 4MTKA 2AQ1B 2KBNA 2QGQA 4NKLA 1D2BA 2Q2IA 1NMGA 1IBLQ 1V43A 3MEHA 2I07B 1SYEA 3MEFA 5EPKA 3ND9A 5I6YA 1Z6HA 1JORA 2F0HA 1K8MA 3I56A 1BQQT 3R2IA 3BU2A 1S5ED 2ASBA 1VS0A 1WTVA 4LW1A 2DJGC 4DR5L 4IJLA 1F2ZA 3J7YW 3BS1A 3K7AB 2XRQD 2A8VA 1YIJA 3TQYA 5FJ8G 2JA8B 4JI5Q 3PQIA 2WKDA 2CWPA 2WACA 2RF4A 2B2TA 1CKNB 1RODA 1BCPF 4RGNA 2MJ8A 2E5LL 5DLQE 1QVFA 4KKTA 3I4NB 1HZCA 2DN8A 1VQKA 2PMZE 2JA6H 2LXKA 2K1BA 2JA5H 1K3BC 3PCOB 2G5DA 2CQAA 4G57A 3HOWH 3I55A 4A76A 2F0QA 2JA8G 4EQOA 4N8X1 2JE6I 3PF4A 1PRTD 1STHA 5IYCG 1FJGQ 5IGCA 3GTKB 1SE2A 2MP1A 2ZJRA 3K58A 1JB7A 2F03A 3I4NG 2UXBL 1D1KA 2UUBL 1IXRA 3J80i 4AYBB 2R93B 4LFAL 2KQ3A 1EYCA 1CSQA 1WFQA 3OPOA 2IPKD 1LV9A 3VYUA 4KJNA 3TP7A 4EVOA 4OIJA 3STBC 4XTCS 5ELEA 2R7ZB 1JJ2A 4UPAA 1EY0A 3C1FA 2NN6H 1QNKA 2N8NA 5IYBG 1SE3A 2B2WC 4AYBG 4HCEA 3TZUA 3S17H 3WDNA 4MZ9A 2JEAI 4BY1G 5KYIA 3ITPA 1YI2A 1DCZA 1S4ZA 4X62L 1L1OA 1PH6A 5LMNL 4JW0A 1RF2D 2R7ZG 4FNFA 2TSSA 4KMUC 1BDOA 1KAAA 4YWKA 2F0EA 1AE3A 1H9MA 3SK4A 2Z6BA 3J81i 2RHQB 4KHPL 3QJYA 2EPBA 1SN8A 4HMJA 3H6MA 1D1IA 4KV6A 5C44H 2A68D 4HAEA 5IP9H 2GA4B 3AQQA 1I94Q 1QB5D 1NNXA 2YTVA 1VQCA 2B2VA 3SEBA 4K2LA 5C0XJ 5CR3A 1TWGH 2PW7A 4QUCA 2PPBC 5I2YA 4DV7L 4A3CH 4P73A 1K73C 3A8KE 2K04A 2IX0A 3RLNA 3KLWA 4A3FG 2K33A 1HR0Q 2PI2E 5I9PA 4PV1C 1HR0W 3K0XA 4IUQA 1PZJD 3ERQA 2IX1A 4LFBL 3I4OA 1B4OA 1XTDA 1UWVA 1W6KA 2NVYH 4JCVE 4Q0FA 5IY0A 4DNIA 4JI6L 2JA6B 1NAPA 2BA0A 5IE8A 3A5UA 4ZAIA 2JA5B 2VXWA 5EBDA 1YNJC 3J7AV 3HOWB 3E6ZX 1I4RA 4OL7A 1SE4A 4LWCA 5DM73 4UP9A 1CKOA 1XWEA 3N6RA 4FXKC 3CPFA 1SJED 3DEPA 1AZQA 4LF7L 1HXYD 4GN4B 1EQQA 4QL5A 2OT2A 1TS4A 3MXGA 4OONA 3TBIB 1XPUA 3RR5A 2JA6G 1C0AA 3HKSA 5JVH3 5G3LD 1XYIA 2BCOA 4NPSA 3BG3A 5IWAL 1KXLA 4J6HA 1UE1A 1EOTA 4RKBA 1Q46A 2WB1E 1EIYB 2WV6D 5GQOA 1FGBD 1C4QA 1A3UA 4DK0A 3NP8A 4HIMA 3RZOH 3QR8A 4KN7C 1PZID 1N36L 1BCPB 3D0FA 1K8OA 2NB0A 5ELFA 4K0KL 4YCWA 3S17B 4GNXC 1TY0A 2K5QA 1QNUA 3H09A 5HURA 2G9HD 2XTIA 1D7QA 3LX0A 1IW7C 1VQOA 2KCTA 2X69A 2CFMA 4X64L 1KLUD 1KNEA 2NN6G 3M85A 1TT2A 1RTNA 3KF8A 1HFGA 4J15A 1W2BA 4I65A 4BA1I 5EKIA 5CV7A 3S16B 1S5DD 5C44B 3NE5B 1LTRD 3RZDH 2Q8TA 2AQ2B 4A3KH 2VL6A 4Y7NH 2Q2UA 4G4KA 1KDBA 4U68A 2DY7A 1A6XA 5FKAC 1TWGB 3P1HA 1F9QA 4UHVA 4DR1Q 1Y8PB 1IHZA 3T1YQ 4A4IA 1KDAA 3NQIA 3G6EA 3F2BA 2A69D 1IL2A 3NWSA 4OO1H 1BUVT 2EE1A 1SNMA 2O4XA 2Z8LA 4RGTA 5C44G 3F2UA 2SOBA 4JV5L 1TWHH 1BBXC 2LFNA 2VZAA 2NBFA 1X3FA 1TWCH 3MTSA 2RHSB 1G291 2NVYB 3GD7A 2FXQA 4PMCA 2MO0A 3TSSA 2O5JC 1RHPA 1SR3A 4A3CG 1YJ9A 2ZXOA 5A2QL 1GOZA 1A62A 4DR6Q 2N55A 2KCMA 1JE4A 3FEWX 1PH4A 3HOZH 1A2TA 3CD6A 1HNXL 2KEDA 2MQHA 5C4ZA 1T5XD 2F0GA 3TREA 3KK7A 2QEJC 3NTHA 2F4VQ 1BO0A 3AU7A 3MXUA 1TWAH 2EYHA 1SYDA 2EJGC 1NR4A 1XNRQ 1NR2A 1RCVD 4H7BA 3U4ZA 1ASYA 3G71A 3TN2A 3H3VC 4HN7A 4HJ9A 4RA8A 1PYWD 5IGBA 1E2WA 1J9OA 3KDFB 4P2CB 3RZOB 1Q81C 2VB2X 1MHWC 1F77A 4X3UA 1PTOF 1PXUA 3Q6SA 3EFXD 3AMUA 4B3TQ 4JBMA 2D2CC 4DKAC 4YHHQ 2L15A 2Z1CA 4DR3Q 2RCFA 1AZPA 3KUPA 4A3MH 3RZDB 1VCIA 1IW7D 2L9HA 1A0IA 4A3KB 1YHAA 4KTAA 4Y7NB 1N34Q 1LTGD 2KCNA 3KFUA 4QGUA 1VQDA 4DF7A 3PUVA 3PF5A 1V8QA 4TSSA 1IBLL 2EYFA 2YU9H 3FVQA 2Z4IA 2PI2A 4P75A 1C48A 3GTPH 1CUKA 4G7OC 3M4OH 5EPJA 5CC4A 3VA5A 2EY6A 4WJ4A 4B3SL 4WJ3M 4FDBA 1M90C 1TWHB 1DD2A 2JA9A 3S1MH 2IL8A 2B39A 1PH3A 5A35A 3H15A 4A3KG 1GUSA 1TQOA 4XXEA 5CGKA 1TWCB 4JI5L 1PTOH 5C4XB 1DOMA 2ZXPA 1AE2A 3IFTA 2IJ0A 5GROA 3DMUA 2WAQB 2L4NA 3M9BA 4IQZA 3T4AC 4L5SA 1PZKD 2XIWA 2FJ2A 4A3JB 2E74C 1BBWA 1LTSD 5JJKA 4OO1G 4FO2A 1EY6A 1JR0D 4TKOB 1JOOA 2EJMA 4NB3A 4C3JH 1TWFH 4PQXA 5I9OA 3M7NA 3HOZB 4JI2Q 2C5CA 4B3RQ 3I70A 4BY7B 3H0GH 5IGFA 3J7A5 1UE5A 4DV2Q 5C4XG 4XYOA 4YWMA 1TWAB 1KIXA 4DFAA 3GP7A 1FJGL 1P16A 1WVLA 1QILA 2WAQG 3D6WA 2Y0SB 2I46A 3JAMc 1EL0A 4A3JG 2L12A 2MO1A 5E1FA 1XX8A 3S15B 3S2HH 1OXUA 3HOZG 4L5RC 2ICIA 2E8GA 3I8ZA 4DXFA 3CHBD 5CYUA 1CA6A 4XT3B 4BY7G 2B29A 4IPHA 1SAPA 1Z7TA 1PV4A 5CV5A 3IL8A 3LWUA 2CHBD 3QG1A 4C2MB 2Y0SG 4X3KA 3KYHC 4FF1A 4GNXA 1FGUA 1SNCA 5C4HA 2HQLA 3BVMA 3Q23A 3MWYW 1WOCA 3J80E 2J7ZA 3A8IE 3U9OA 4JI3Q 5HGQA 1LM0A 4M1UB 3OIQA 2WIIB 3S1QH 4QUFA 4A3MB 4YWLA 2V1CC 2H1EA 5BR8Q 4DXGA 3CC4A 2K5WA 3CPWA 1SNQA 1D5ZC 1LUZA 2JK8A 1B2TA 1CQVA 1PRTC 1C7YA 3LNNA 2YV5A 3T53B 1F9SA 2YU9B 2HHHQ 3FPUB 1I94L 3DM1A 3FKIG 3CF5A 3GTPB 3M4OB 1SYBA 5JEAJ 4A3MG 1L1OB 3UE0A 5LMUQ 1BF4A 2VS1A 2DUDA 4F7XA 3S1MB 2SNMA 3G7LA 1BR9A 3GTQB 3VDYA 1E24A 1PFBA 4MIUA 2K5DA 1PTOB 3AEVA 2HT1A 1HR0L 3NK9A 1J6QA 4OIKA 1H9RA 1J8IA 4PMWA 4GOPC 4LF6Q 3MXPA 2NUCA 2PZUA 5IT9c 1RL2A 5KNBA 3FPPA 4GKJQ 4TRDA 2UU9Q 1B53A 4WRDA 4UY8C 4HIDA 4DV6Q 1E22A 1MBYA 1YZ6A 3VA7A 5C3WA 4LF8Q 5CORA 2A5HA 4C3JB 1TWFB 3M4YA 2SDFA 1EZ6A 3M4QA 3C46A 3HKZB 4N8FA 1B44D 4BY1H 1LABA 3H0GB 3OIPA 4CDFC 4NXNQ 2F4IA 1BXTA 1MJEA 4AIMA 2OCEA 2OTLA 2K28A 3BZKA 4KHVA 1CK1A 5FO8B 1FVIA 5GAGC 2PCFB 3QWNA 3M3YH 3GTOH 3NQTA 2EZVA 1WCMH 2EVBA 3S2HB 4C3JG 3ONAB 3L9AX 4A3BH 4L5TA 2A68C 3HKZG 4MTNA 5M3FH 3H0GG 4JK1C 1CTMA 2E2JH 4C3HH 3OHXC 1ESFA 2KA7A 1SYFA 1XPRA 1S5BD 1ILQA 4ZUIA 4LJZC 4LF4Q 1RDPD 2M00A 1G2SA 3UDFA 4POFA 4A3FH 1ZKOA 3UI2A 4K8JA 2IW3A 4NP5A 5DAUA 1KDCA 1Q82C 4K2KA 4OO1I 1LTTD 3HOYH 3S1QB 3KJPA 2CQOA 2HIVA 2PW5A 4A75A 3J81j 2CW0C 4IN3A 3CP0A 2PZTA 2NVQH 1R4PB 5LL6X 2ATWA 3ULJA 3OW2A 4DUYQ 2QEXA 1K0RA 4DGZA 1UEBA 1W3SA 1G6ZA 1PH8A 1B70B 1MKHA 2CVRA 2BH2A 2QDLA 1I4XA 3F8TA 2M9VA 4QB4A 4BBRB 5GAHC 4DR1L 3D4DA 1ET9A 4DV5Q 3T1YL 5M5YH 5EBCA 2AKWB 2R6GA 2BH8A 1QZGA 5KNCA 3E3XA 2RA4A 3TP6A 2F0DA 1I50H 2UXDQ 3KF8B 1Q12A 2F3WA 1D5MC 3FDTA 3GV3A 4FVMA 4KN4C 2HCIA 1ML0D 3Q22A 4IFDI 2LXJA 3G6JB 3GV6A 1DONA 4PZ7A 1KC8C 2F0PA 2F0FA 5H1SE 2VB3X 1TKWB 3F2DA 2Q2HA 4BBRG 5BN3A 4JI0Q 3Q24A 4GZYC 4B9XA 1HNZL 1HFNA 3T1HQ 3EBEA 4E6IA 1K8AC 3A7LA 3CAMA 4BY1B 4DR6L 4IPCA 1GKHA 5JAVA 2K7VA 3M7GA 2AQ3B 2MNAA 3S1RB 3R93A 1DM0B 5AFWA 2F4VL 1PLFA 1S3OA 2EY1A 3M3YB 1X3QA 3GTOB 3PO2G 1A2UA 5TSSA 2PMZB 1WCMB 1XNRL 4PG3A 3EQLC 1RD9D 2EQSA 3QIAA 4A3BB 4KY5A 1EYDA 5M3FB 1F2LA 5E3FA 2F0JA 3HRZC 3W3AA 4DK1A 2E2JB 1G6PA 4C3HB 1L0WA 1SJHD 4P71A 3MAQA 1EWIA 3J7AF 4KHZA 1EU3A 1S5CD 1SRUA 1L2FA 1LO5D 1GJXA 2A69C 4FF2A 3TZDA 3OYYA 1WCMG 1TS3A 4A3FB 3S16H 1PDQA 2Q2TA 2LMCB 4A3BG 2HDMA 1HHVA 1PA6A 5M3FG 4B3TL 1CHPD 4V190 3NELA 4C3HG 1U0LA 1LTBD 2I5MX 4YHHL 1P8LA 1XMOQ 2JA7H 3SK6A 3HOYB 4R4TA 4KD4A 4DR3L 1LT3D 3PUWA 5C6AA 1YNNC 3MVVA 1VQ4A 5IGDA 4BS9A 1EEFD 5M5XH 2NVQB 2ENBA 3OWEB 5DNFA 3U58A 3VYSA 5CMDA 1Y14B 5IP7H 1CZWA 5KEEA 5EJWA 3X3NA 3CCQA 1KLGD 3CCUA 4OX9Q 3L2PA 4TVAB 1ESRA 2F0SA 3A0JA 5J1ZA 3WOFA 5AJ3Q 2Z9HA 3HOYG 2PQAA 5M5YB 2QILA 2IT1A 2CW0D 1CZGA 3D6CA 1I50B 4KKUA 3S24A 1UE7A 5BN5A 1B7YB 1RKNA 5C5LA 1VQPA 3OW7A 2ZTCA 2MHVA 2XSCA 4RGOS 4GOPA 3FP9A 3K0YA 3KLRA 4NXMQ 4DUZQ 2D0PA 1WJJA 1I3QH 3CKIB 4FYDA 2F0TA 3EVQA 5CV6A 1KRTA 5C0XH 2KCCA 3EJIA 3CMEA 1DZ1A 3TRZA 1H9SA 2A6EC 1MIUA 3K6OA 3T56B 4DR7Q 4V0BA 1YJNA 1BKBA 3ZJYC 1F2MA 4JI7Q 4H13C 4JI2L 4B3RL 1R4QB 3K57A 4OELB 1TS5A 4L6TB 2PNRC 5NUCA 4DV2L 2SEBD 3S1NH 1YJWA 1ICFB 3WOEA 2JYOA 1X9NA 1Q8IA 4L5QA 2LS01 2AUKA 1WTPA 3SR1A 4CBVA 4K8IA 1STNA 1V9PA 2L5TA 3EA6A 5HY6A 3L0OA 3K8AA 3K80C 2NVXH 4X3SA 2B63B 3JAML 1UEAB 4IOAA 5CV4A 1XMQQ 4XQJA 4DAYA 1FNUA 1GUGA 3KOJA 2B8FA 5D3DA 2J0TD 1NY4A 3MFGA 1I6HH 2WB1B 3NSWA 3W2DA 5GAEC 1PH1A 3NEMA 4WJWA 2JA7B 4FF3A 3HOUH 4BXXH 1DGSA 3H3VH 1SNPA 1AP0A 3D4RA 4IPDA 3KLSX 1C8CA 4JI3L 2F0IA 2N78A 3RLFA 3TP8A 5M5XB 2B63G 3BVZA 5FO9B 4DAPA 3PIPA 1VQMA 4OWTB 3LGJA 3GTMH 1GUWA 1YHQA 5BR8L 5T1GA 1Q86C 5JVG3 4KKSA 4JI8Q 3CQZH 3DWQA 2WB1G 3O13A
chains in the Genus database with same CATH topology
1U4RA 3VR5A 3MZ5A 1YNND 4RAUC 4IURA 3D8GA 4N9PA 3NXWA 5LL6S 4N9TA 4UDUC 4ZQ3A 3I72A 4RHSA 4YIJA 2EYLA 3V2TA 1I3QB 4IALA 3D4WA 5JPNC 1V1PB 1O78A 1V1OA 5IIFA 1KABA 1BCPD 1HA5A 3DXJC 1EY4A 1F9RA 1EWHA 1IL8A 1BOSA 4RH6A 3GO5A 3P20A 5IT9L 1A3VA 3KBGA 3FRPB 4RCNA 2WP8J 3SE0A 3S1NB 1CFMA 1JB3A 5C0XG 3CU7A 2A6ED 2PO4A 3CRLC 1GHJA 5JPMC 1LT5D 4J8QA 3NBHA 4HSPA 2NVXB 1ZXTA 1AN8A 1O7ZA 5A2QE 2D5DA 3K59A 2B8GA 2ID0A 4KD3A 5IOCA 4QIWB 1WTOA 4I7ZC 4DNRB 1I6HB 1I4HA 1IYVA 1JQYD 3HOUB 1EY9A 5KYLA 4RCOA 5T1IA 4O1NA 4ID6A 3GTMB 3SK8A 4K6DA 4RHRA 2AUJD 3CQZB 1STYA 1FYCA 4KK7A 3NTKA 5IT9E 2LKVA 1SYGA 2DNCA 1QG7A 3H91A 2RKSA 3PUYA 1VF5C 3GQBA 3Q0AA 4X3TA 3TP5A 5C4JB 2NN6I 4FXGC 1SSOA 3QOLA 2KHSA 1AEXA 1IKLA 3I3CA 5I6WA 2EJFC 2O2LD 5COYA 1ONLA 3QB3A 1EY8A 4PMBA 1E2VA 3RMHA 5I4DA 2MPMA 3A7AB 1O80A 3R3OA 1K83B 4ZK9B 2D62A 1OO9B 3T13A 1JC7A 5CV9A 1B9NA 1LT4D 1PMRA 1TY2A 2ICEC 5KIXA 4L8JA 1IYUA 1G91A 3PMFA 1JWMD 5IGEA 1G2TA 3E5SA 4UAIA 1HUNA 1WD0A 2RDFA 1ZYRC 1KTKA 2EYOA 1L0XB 3FKIB 1F2YA 4XQNA 3NHHA 2X6GA 2EYMA 4K5XA 1PTOC 4DN4M 1GUOA 1PFNA 5FK9C 3PO3B 1AW7A 1SNDA 2M2LA 2NYZD 2A6HC 1JOQA 4R9WA 1OXXK 1X32A 5EGTA 3NPPA 1Y1WB 3I90A 1F9PA 3C2PA 5G3LF 3HP3A 4LAAA 3VYTA 2FHTA 4IUPA 4A3EB 4ZLTF 3V05A 4F88A 4RFBA 2QKIC 1L0YB 2KUMA 5K5PA 3NUCA 3BZDB 1QOHA 2WINB 3L7ZC 2PQEA 1MSGA 2OEOA 1FR3A 4DAVA 2MUYA 1B3AA 2XWJB 1FNVA 3MXNA 2L55A 4Z9CB 2DNEA 1SDFA 2B2YC 3OOCA 1STAA 3GTLB 1PRTB 3MC0B 4S3SA 1HUMA 4K6LA 3RUZA 3AB9A 1H9JA 1B50A 5JEAH 3TMEA 2EDGA 2BE5D 1TR5A 4NMZA 3SHLA 1WD1A 3BDLA 3HEJA 1EEID 3IFDA 3NTIA 3HGBA 4HSVA 4G7HC 2JXMB 3C3LA 2EYJA 3V96A 5JOBA 2R3ZA 1ILPA 1MD2D 3SVMA 1I4GA 3LWEA 3ND8A 1A15A 2N88A 1HQRD 2EY2A 2QDBA 4FP5D 1Y69U 1Q90A 1D5XC 1ZYRD 1TIID 2EY5A 4CJ0B 2Z4HA 5CV8A 4DU9A 2ZT9C 1PTOD 4C1NI 1GUTA 1LLRD 1NUCA 4IUNA 1HTPA 4MHEA 4HTHA 1U9RA 3T16A 2F0NA 4JBWA 2RBMA 1EY7A 3S9WA 1STEA 3SXHA 2A6HD 1EU4A 3PO2B 2X6LA 3S2DB 3KBXA 4HEDA 4DA2A 3CRKC 4XIGS 5EKKA 2D9UA 3IKJA 3EROA 5ELBA 1WTXA 4U673 1MSHA 5K36H 3OWFA 4J1MA 5ELDA 1I4PA 1EFID 2NZ1D 3DWPA 2F0UA 2IWHA 1CT1D 3I4MB 4OHJA 5EPLA 3MHBA 1UUPA 1ICWA 1ENFA 3T51B 5M5WB 1H9KA 1FD7D 4M8AA 1CHQD 2C9OA 1U4MA 4O42A 5I2XA 5JEAG 4L63B 3PIP3 2BOSA 2F0KA 2BDOA 1RTOA 4A3IB 5IGGA 3BVGA 2H4OA 3L3OC 1SMYC 1AFPA 1VMCA 1JCKB 1Y1VB 5C5MA 2FINB 5DEHA 3PUXA 2AWOA 1EQTA 3K5MA 2V4DA 1VF7A 2IX3A 4FF4A 1E2ZA 5EQ0A 2XWBB 1MGSA 4MN3A 2E2IB 2F3VA 2QCPX 4BBSB 2RVLA 2F0VA 1WTWA 1BCPC 3QOJA 1LT6D 1M8AA 3N52A 4XYQA 1ENCA 5C3XA 2OXPA 3R2TA 3DHQA 1UNSA 1JOKA 5DM63 2B2UA 1D6EC 4ZKBB 1QJOA 3D3RA 2B2YA 3A56A 1TVXA 3P75A 4A3DB 2KECA 4FXDA 3ZYYX 5CBAE 1GHKA 4KI0A 1DOLA 2ZXRA 4ME5A 1CQFA 1PFMA 3HOXB 2XRSD 5K36G 3NWTA 1X3PA 4WORA 2J4XA 1DXMA 2F0LA 3PV0A 1CA5A 1I4QA 3A8JE 3VR3A 3DUZA 4HCSA 3QO2A 4RGMA 2LY7A 2PYKA 4IUVA 4ZRZA 4BA2I 4XT1B 2FMCA 4XQQA 4F87A 3C1EA 2OF1A 1ZEQX 1Q1EA 1B9MA 2WKCA 3URYA 4QMGA 2RSNA 3BDOA 2EXZA 2YYZA 2VUMB 3PUZA 2JP1A 3S14B 2KVMA 4IFDJ 1LTAD 3IAYA 1HPCA 4C1NK 5FO7B 2E2DC 2NTSA 4CKCA 4CHTB 1SMYD 4XDXA 2L0CA 1OXVA 4LMQD 5D14A 4CKEA 1SFOB 2E75C 2NWGA 1UAPA 1HRJA 2E2HB 4RWSC 2FMMA 3JAME 1STGA 1A3TA 2HUGA 3OMCA 3D31A 1SXTA 2QF7A 1JWUD 3GTGB 3NBIA 2FFKB 3HOVB 3I73A 1ENAA 4G7ZC 4A3GB 1ET6A 2BA1A 1RJTA 4CKBA 3KLSA 3R8BA 1VDZA 1EIGA 5F2DA 1OXSC 1IKMA 1I6VC 4EGVA 5IODA 4IFDH 1HQMC 1YNJD 2R61A 1FNWA 3BDCA 3X3MA 1MI2A 1O7YA 2G9DA 1E0BA 1HTLD 2KJXA 1B1ZA 1HA6A 2BDNA 5D3IB 2TMPA 2B2WA 2F0MA 2E76C 1SEBD 3H94A 5KGUA 4K5VA 5E4XA 4ZUJA 3I4LA 1SNOA 2KEEA 5BN4A 5FLXL 4C3IB 2K03A 1PRTF 1BNZA 1NSNS 5C3EB 5FOBB 3RD4A 1TU2B 1GXDC 3HG9A 3MFYA 5M3MB 2JEBI 1T5EA 1U4PA 5LHY1 4ABNA 2RSOA 1Y8NB 2Q8RE 2B2TC 3SK5A 4C3IG 4ZKCB 1SYCA 4IUUA 1DYQA 3DWAA 4KY7A 3BYYB 4PNYA 4ODGA 2AWNA 4NDXA 1EIHA 5CBEE 1Q3LA 5J22A 4R8NA 3OMGA 1II3A 1EQVA 1STBA 2BE5C 2F1MA 2SNSA 3J80L 4C56C 3VR6A 3BYTB 5M9OA 5JJZA 5FLXE 4CJ2C 4B9WA 2L11A 5ISRA 2EYPA 1Q1BA 2Q8IB 3PIO3 2NVTB 4OGQC 2RDHA 4TQUS 4EQPA 3GTJB 3A54A 2K32A 4HR7B 4R8IA 1EYAA 4RKLA 4HMIA 3VR2A 1DJRD 1G8ZD 3U9SA 1QCBD 5E4WC 3SDZA 2F0WA 2XNAC 3J81L 1JWSD 2XVSA 2F0OA 3VYRA 2K01A 1DOKA 4IFDG 4QF4A 1XXGA 1O7LA 4KJOA 4H44C 2JSOA 1W6JA 3K5LA 5ELCA 2HQEA 4K5WA 3FMCA 2HDLA 4ILWA 4ULLA 2HCCA 2R92B 2B2VC 3TDQA 4IUTA 1CM9A 4CGYB 4WFN3 3E0JA 2A73B 1WTQA 2NTTA 4NW2A 2PZWA 1V1PA 2MGSA 4H0LC 5KNDA 1JICA 1GUNA 3K5NA 1QWYA 5C0XI 1OXTA 1HCZA 2L1BA 1Z47A 4B08A 5KRUA 4Q5VA 1LTID 2O5IC 2RQXA 5J39A 1Y8OB 4IZ8A 5EKLA 3J81E 2B2UC 2KOLA 2A74C 4F8MA 1QE6A 3K5OA 1EY5A 2RDGA 3HS0C 1EWCA 4LK1C 4EQNA 1VMPA 1SBBB 1U4LA 4A93B 3P7JA 3A55A 1XTCD 4BWGB 1TS2A 4DNTB 4QCLA 4ZYSA 1EZ8A 1KNAA 1NCVA 1LACA 5HGTA 3OSOA 1WTRA 2XN9C 2VNUD 2K6AA 3HZXA 2EOTA 1CI3M 4KY6A 2DY8A 1S5FD 3DEOA 3VR4A 4CJ1B 3I91A 1M4VA 1R9TB 5D65A 3MA2B 4K14A 2K05A 1H9SB 2AQ1B 4NKLA 1D2BA 1V43A 3MEHA 2I07B 1SYEA 5EPKA 5I6YA 3ND9A 1Z6HA 1JORA 2F0HA 1K8MA 1BQQT 3R2IA 1S5ED 1WTVA 1F2ZA 3J7YW 3BS1A 3K7AB 2XRQD 2JA8B 2WKDA 2WACA 2B2TA 1RODA 1BCPF 4RGNA 2MJ8A 4KKTA 3I4NB 2DN8A 2K1BA 2CQAA 4G57A 2F0QA 4EQOA 2JE6I 1PRTD 1STHA 5IGCA 3GTKB 1SE2A 2MP1A 3K58A 2F03A 1D1KA 4AYBB 2R93B 2KQ3A 1EYCA 3OPOA 2IPKD 1LV9A 3VYUA 4KJNA 3TP7A 4EVOA 4OIJA 4XTCS 5ELEA 2R7ZB 1EY0A 3C1FA 2NN6H 1QNKA 1SE3A 2B2WC 4HCEA 3TZUA 3WDNA 2JEAI 5KYIA 3ITPA 1DCZA 1S4ZA 1RF2D 4FNFA 2TSSA 4KMUC 1BDOA 1KAAA 2F0EA 1H9MA 3SK4A 3QJYA 2EPBA 4HMJA 3H6MA 1D1IA 4KV6A 2A68D 4HAEA 2GA4B 1QB5D 2B2VA 3SEBA 4K2LA 5C0XJ 5CR3A 2PW7A 4QUCA 2PPBC 5I2YA 3A8KE 2K04A 2IX0A 2K33A 5I9PA 4PV1C 4IUQA 1PZJD 3ERQA 2IX1A 1B4OA 1W6KA 4Q0FA 2JA6B 1NAPA 2BA0A 4ZAIA 2JA5B 2VXWA 5EBDA 1YNJC 3J7AV 3HOWB 3E6ZX 1I4RA 4OL7A 1SE4A 5DM73 1XWEA 3N6RA 4FXKC 1SJED 3DEPA 1AZQA 1HXYD 2OT2A 1TS4A 3MXGA 3TBIB 5JVH3 5G3LD 1XYIA 2BCOA 3BG3A 4J6HA 1EOTA 4RKBA 2WV6D 1FGBD 1C4QA 1A3UA 4DK0A 3NP8A 4KN7C 1PZID 1K8OA 1BCPB 2NB0A 5ELFA 3S17B 1TY0A 2K5QA 1QNUA 3H09A 5HURA 2G9HD 3LX0A 1IW7C 2X69A 1KLUD 1KNEA 2NN6G 3M85A 1TT2A 1RTNA 3KF8A 1HFGA 4I65A 4BA1I 5EKIA 5CV7A 3S16B 1S5DD 5C44B 3NE5B 1LTRD 2Q8TA 2AQ2B 4G4KA 1KDBA 4U68A 2DY7A 1A6XA 5FKAC 1TWGB 3P1HA 1F9QA 1Y8PB 1IHZA 1KDAA 3NQIA 2A69D 3NWSA 4OO1H 1BUVT 2EE1A 1SNMA 2O4XA 2Z8LA 4RGTA 3F2UA 2SOBA 1BBXC 2LFNA 2NBFA 3MTSA 1G291 2NVYB 3GD7A 4PMCA 3TSSA 2O5JC 1RHPA 2ZXOA 5A2QL 1GOZA 2N55A 1JE4A 3FEWX 1A2TA 2KEDA 5C4ZA 1T5XD 2F0GA 3KK7A 2QEJC 3NTHA 1BO0A 3AU7A 3MXUA 2EYHA 1SYDA 2EJGC 1NR4A 1NR2A 1RCVD 4H7BA 3TN2A 3H3VC 4HN7A 4RA8A 1PYWD 5IGBA 1E2WA 1J9OA 4P2CB 3RZOB 2VB2X 1F77A 4X3UA 1PTOF 1PXUA 3Q6SA 3EFXD 3AMUA 2D2CC 2Z1CA 1AZPA 3KUPA 3RZDB 1VCIA 1IW7D 2L9HA 4A3KB 4KTAA 4Y7NB 1LTGD 2KCNA 4DF7A 3PUVA 1V8QA 4TSSA 2EYFA 3FVQA 2Z4IA 1C48A 4G7OC 5EPJA 5CC4A 3VA5A 2EY6A 1TWHB 1DD2A 2IL8A 2B39A 5A35A 1GUSA 1TQOA 4XXEA 5CGKA 1TWCB 1PTOH 5C4XB 1DOMA 2ZXPA 3IFTA 2IJ0A 3DMUA 2WAQB 2L4NA 4IQZA 3T4AC 1PZKD 2XIWA 2FJ2A 4A3JB 2E74C 1LTSD 4OO1G 4FO2A 1EY6A 1JR0D 4TKOB 1JOOA 2EJMA 3M7NA 5I9OA 4PQXA 3HOZB 2C5CA 3I70A 4BY7B 5IGFA 4XYOA 1TWAB 4DFAA 3GP7A 1WVLA 1QILA 3D6WA 2Y0SB 2I46A 1EL0A 2L12A 5E1FA 1XX8A 3S15B 1OXUA 2ICIA 3I8ZA 4DXFA 3CHBD 5CYUA 1CA6A 4XT3B 1SAPA 1Z7TA 5CV5A 3IL8A 3LWUA 2CHBD 3QG1A 4C2MB 4X3KA 4FF1A 1SNCA 5C4HA 3Q23A 3BVMA 3MWYW 3J80E 2J7ZA 3A8IE 3U9OA 4M1UB 3OIQA 2WIIB 4QUFA 4A3MB 2H1EA 4DXGA 2K5WA 1SNQA 1D5ZC 1B2TA 1CQVA 1PRTC 3LNNA 3T53B 1F9SA 2YU9B 3FPUB 3DM1A 3GTPB 3M4OB 1SYBA 5JEAJ 1BF4A 4F7XA 3S1MB 2SNMA 3G7LA 1BR9A 3GTQB 1PFBA 4MIUA 2K5DA 1PTOB 3NK9A 4OIKA 1H9RA 1J8IA 4PMWA 3MXPA 2NUCA 2PZUA 5KNBA 3FPPA 4TRDA 1B53A 4WRDA 1MBYA 3VA7A 5C3WA 5CORA 2A5HA 4C3JB 1TWFB 3M4YA 2SDFA 1EZ6A 3C46A 3HKZB 1B44D 1LABA 3H0GB 3OIPA 2F4IA 1BXTA 2K28A 4KHVA 1CK1A 5FO8B 2PCFB 3QWNA 3NQTA 2EZVA 2EVBA 3S2HB 4C3JG 3ONAB 3L9AX 2A68C 4JK1C 1CTMA 3OHXC 1ESFA 2KA7A 1SYFA 1S5BD 1ILQA 4ZUIA 4LJZC 1RDPD 2M00A 1G2SA 1ZKOA 3UI2A 4K8JA 2IW3A 4NP5A 5DAUA 1KDCA 4K2KA 4OO1I 1LTTD 3S1QB 2PW5A 2CW0C 4IN3A 2PZTA 1R4PB 5LL6X 4DGZA 1G6ZA 2CVRA 1I4XA 2M9VA 4QB4A 4BBRB 3D4DA 1ET9A 5EBCA 2R6GA 5KNCA 2RA4A 3TP6A 2F0DA 1Q12A 2F3WA 1D5MC 3FDTA 3GV3A 4FVMA 4KN4C 2HCIA 1ML0D 3Q22A 4IFDI 3G6JB 3GV6A 1DONA 2F0PA 2F0FA 2VB3X 1TKWB 5BN3A 3Q24A 4GZYC 4B9XA 1HFNA 4E6IA 4BY1B 3A7LA 5JAVA 2K7VA 3M7GA 2AQ3B 3S1RB 3R93A 1DM0B 5AFWA 1PLFA 2EY1A 3M3YB 1X3QA 3GTOB 1A2UA 5TSSA 2PMZB 1WCMB 3EQLC 1RD9D 3QIAA 4A3BB 4KY5A 1EYDA 5M3FB 1F2LA 5E3FA 2F0JA 3HRZC 3W3AA 4DK1A 2E2JB 4C3HB 1SJHD 3MAQA 3J7AF 4KHZA 1EU3A 1S5CD 1LO5D 1GJXA 2A69C 4FF2A 3TZDA 1TS3A 4A3FB 1PDQA 2LMCB 2HDMA 1HHVA 1CHPD 4V190 4C3HG 1LTBD 3SK6A 3HOYB 4KD4A 1LT3D 3PUWA 5C6AA 1YNNC 3MVVA 5IGDA 4BS9A 1EEFD 2NVQB 2ENBA 3OWEB 5DNFA 3VYSA 5CMDA 1CZWA 5KEEA 5EJWA 3X3NA 1KLGD 1ESRA 2F0SA 5J1ZA 3WOFA 5M5YB 2QILA 2IT1A 2CW0D 1CZGA 3D6CA 1I50B 4KKUA 5BN5A 1RKNA 5C5LA 3OW7A 2MHVA 2XSCA 4RGOS 3K0YA 3KLRA 3CKIB 4FYDA 2F0TA 3EVQA 5CV6A 5C0XH 2KCCA 3EJIA 1DZ1A 1H9SA 2A6EC 3K6OA 3T56B 4V0BA 1F2MA 4H13C 1R4QB 3K57A 1TS5A 4L6TB 2PNRC 5NUCA 2SEBD 3WOEA 2JYOA 1Q8IA 2LS01 2AUKA 1WTPA 3SR1A 4CBVA 4K8IA 1STNA 2L5TA 3EA6A 4X3SA 2B63B 3JAML 1UEAB 5CV4A 4XQJA 4DAYA 1FNUA 1GUGA 5D3DA 2B8FA 2J0TD 3MFGA 2WB1B 3NSWA 3W2DA 4WJWA 2JA7B 4FF3A 1SNPA 1AP0A 3D4RA 3KLSX 1C8CA 2F0IA 3TP8A 3RLFA 5M5XB 3BVZA 5FO9B 4DAPA 1GUWA 5T1GA 5JVG3 4KKSA 3DWQA 3O13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYH A;  1SYD A;  2F0M A;  3D6C A;  1EY0 A;  3C1F A;  4WRD A;  1JOQ A;  4RKB A;  3SK8 A;  2EY5 A;  4H7B A;  4K6D A;  2F0O A;  5IGF A;  3MZ5 A;  5C3W A;  1STY A;  5EGT A;  5C5M A;  2PYK A;  2F0P A;  2F0F A;  1RKN A;  5C5L A;  5KGU A;  1EZ6 A;  4DFA A;  4K5V A;  5CV8 A;  2LKV A;  4QF4 A;  1A3U A;  3D8G A;  3C1E A;  4N9P A;  4KJO A;  4DU9 A;  2OF1 A;  4ZUJ A;  1SNO A;  1SYG A;  4LAA A;  3NP8 A;  5IGB A;  3NXW A;  4N9T A;  1NSN S;  4B9X A;  5KYI A;  4K14 A;  2HQE A;  2RKS A;  3ITP A;  4K5W A;  4ZQ3 A;  5DEH A;  4E6I A;  4KHV A;  4QMG A;  5E1F A;  1NUC A;  2EXZ A;  2F0T A;  5JAV A;  3TP5 A;  4IUN A;  3EVQ A;  5CV6 A;  4YIJ A;  5HUR A;  2EYL A;  3LX0 A;  5K5P A;  4HTH A;  1KAA A;  4NKL A;  2F0E A;  3EJI A;  1U9R A;  3NUC A;  3T16 A;  3V2T A;  2F0N A;  3SK4 A;  3NQT A;  2PQE A;  4IAL A;  2RBM A;  2KHS A;  1EY7 A;  3D4W A;  2OEO A;  3QOL A;  1AEX A;  3MEH A;  2F3V A;  3S9W A;  3SXH A;  1SYE A;  5I6Y A;  5CV5 A;  5I6W A;  2EY1 A;  1F2M A;  4HMJ A;  1TT2 A;  2F0V A;  2F0H A;  3H6M A;  4KV6 A;  1JOR A;  1A2U A;  5IIF A;  3QOJ A;  1KAB A;  3SK5 A;  4I65 A;  2PZW A;  3QB3 A;  1SYC A;  4KY5 A;  1EYD A;  1SNC A;  5CV7 A;  1SYF A;  5NUC A;  5C4H A;  5EKK A;  1EY8 A;  4KY7 A;  4PMB A;  5E3F A;  1EY4 A;  4ZUI A;  2F0J A;  4K2L A;  1F2Z A;  4PNY A;  5CR3 A;  2M00 A;  4ODG A;  3ERO A;  1ENC A;  1STA A;  5C3X A;  2PW7 A;  3R3O A;  2OXP A;  4NDX A;  3DHQ A;  1A3V A;  1JOK A;  1KDB A;  3OWF A;  4J1M A;  1STG A;  3SR1 A;  3U9O A;  1A3T A;  2WAC A;  5J22 A;  3P1H A;  5KRU A;  4K8J A;  4K8I A;  3OMC A;  4S3S A;  1STN A;  4R8N A;  1IHZ A;  4NP5 A;  5DAU A;  3OMG A;  4KTA A;  2F0U A;  1II3 A;  3T13 A;  3RUZ A;  1EQV A;  1STB A;  5CV9 A;  5J39 A;  1KDA A;  2SNS A;  1KDC A;  4IZ8 A;  4DF7 A;  5I9P A;  3TME A;  4K2K A;  5EKL A;  5KIX A;  1TR5 A;  4NMZ A;  3SHL A;  2EYF A;  3P75 A;  1SNM A;  2O4X A;  3ERQ A;  1ENA A;  1SNQ A;  3PMF A;  4F8M A;  3BDL A;  5IGE A;  1EY5 A;  5M9O A;  2PW5 A;  2SOB A;  5CV4 A;  3E5S A;  3HEJ A;  3MHB A;  4G57 A;  2PZT A;  2F0Q A;  4EQN A;  2RDF A;  4EQO A;  3SK6 A;  4B9W A;  3VA5 A;  2EY6 A;  1STH A;  5F2D A;  5CC4 A;  4KD4 A;  5ISR A;  2EYP A;  5C6A A;  2EYO A;  3MVV A;  4ME5 A;  4DGZ A;  5IGC A;  5IOD A;  5IGD A;  4KD3 A;  4PMC A;  1F2Y A;  5IOC A;  4OL7 A;  1TQO A;  5CGK A;  2ENB A;  1SYB A;  3NHH A;  4EQP A;  2EYM A;  2EYJ A;  1EZ8 A;  3BDC A;  1SNP A;  4K5X A;  4F7X A;  5KEE A;  5JOB A;  2SNM A;  2F0I A;  3TP8 A;  4QB4 A;  3DMU A;  5HGT A;  3D4D A;  4WOR A;  2F0S A;  2EY2 A;  1EYA A;  2QDB A;  2KQ3 A;  3OSO A;  1A2T A;  1EYC A;  4HMI A;  4MIU A;  4RKL A;  5J1Z A;  1EY9 A;  2F0K A;  3NK9 A;  5KYL A;  3HZX A;  4KJN A;  3TP7 A;  4EVO A;  2F0L A;  3TP6 A;  2F0D A;  5C4Z A;  1EY6 A;  2F0W A;  1SND A;  2F0G A;  1JOO A;  2F3W A;  2NUC A;  2PZU A;  3MXP A;  4ID6 A;  4KY6 A;  5I9O A;  5IGG A;  4J6H A;  4TRD A; 
#chains in the Genus database with same CATH topology
 4GNX B;  1U4R A;  3VR5 A;  5C4X H;  1WYD A;  2JA7 G;  2XGT A;  3MZ5 A;  1YNN D;  4RAU C;  2R7D A;  4IUR A;  1X6O A;  3D8G A;  4N9P A;  4A3J H;  5IP7 G;  3NXW A;  5LL6 S;  4N9T A;  4UDU C;  1VQ6 A;  5C4J H;  4ZQ3 A;  5LMU L;  2R7F A;  3I72 A;  4CDC C;  4RHS A;  4Y52 H;  4BY7 H;  4YIJ A;  2EYL A;  3V2T A;  4GKK Q;  1I3Q B;  4IAL A;  3D4W A;  5FLM H;  5JPN C;  1V1P B;  4LF6 L;  1O78 A;  4GKJ L;  1V1O A;  2UU9 L;  5IIF A;  4DV6 L;  1KAB A;  1B8A A;  4LF8 L;  3S15 H;  1BCP D;  1K83 H;  1HA5 A;  3DXJ C;  3RNU A;  3FHW A;  2YTY A;  1EY4 A;  1F9R A;  4DR4 L;  1EWH A;  1IL8 A;  4NXN L;  1BOS A;  4RH6 A;  4GS3 A;  1I5F A;  3GO5 A;  3P20 A;  5IT9 L;  1A3V A;  3KBG A;  3FRP B;  3CXC A;  4RCN A;  2WP8 J;  3SE0 A;  3S1N B;  1CFM A;  1JB3 A;  2CH4 W;  4C2M H;  5C0X G;  2UUA Q;  3CU7 A;  3SGI A;  3F2C A;  2A6E D;  2PO4 A;  3CRL C;  1GHJ A;  2VQF Q;  5JPM C;  1LT5 D;  4A3G G;  3CMA A;  4J8Q A;  3NBH A;  3TEH B;  4HSP A;  2NVX B;  1ZXT A;  4AQY Q;  1AN8 A;  1JJC B;  1O7Z A;  3FKI H;  4QQB X;  5A2Q E;  2D5D A;  3K59 A;  2B8G A;  2ID0 A;  1JT8 A;  4LF9 Q;  4LF4 L;  4KD3 A;  5IOC A;  4QIW B;  1WTO A;  3EN2 A;  4I7Z C;  1T9H A;  3AFP A;  4DNR B;  1I6H B;  3PO3 H;  4YY3 Q;  1I4H A;  1IYV A;  1JQY D;  3HOU B;  1YHB A;  2B3G A;  4QJF A;  1EY9 A;  3DLL A;  5KYL A;  4RCO A;  5T1I A;  4O1N A;  4ID6 A;  1Y1W H;  3IRB A;  3GTM B;  3SK8 A;  4K6D A;  1K8G A;  4RHR A;  2AUJ D;  1X56 A;  3CQZ B;  1STY A;  3GTQ H;  1FYC A;  4KK7 A;  4DUY L;  3NTK A;  5IT9 E;  2LKV A;  3K7U C;  4H02 A;  3HOU G;  5C3E G;  4DPG A;  4BXX G;  1SYG A;  2DNC A;  1QG7 A;  3H91 A;  2Z6K C;  2RKS A;  3PUY A;  3HFZ B;  1VF5 C;  4JI1 Q;  1PH2 A;  3GQB A;  1YNX A;  3Q0A A;  4X3T A;  3TP5 A;  4DV5 L;  5C4J B;  4CDE C;  2NN6 I;  4FXG C;  1SSO A;  3QOL A;  2KHS A;  4IO9 A;  2D0O A;  1AEX A;  2UXD L;  1IKL A;  3I3C A;  3ERS X;  2I5H A;  5I6W A;  2EJF C;  1XNQ Q;  2O2L D;  5COY A;  1ONL A;  2YTX A;  1G51 A;  3QB3 A;  3GTL H;  3CCR A;  1EY8 A;  4PMB A;  2K5H A;  1E2V A;  3RMH A;  5I4D A;  3KJO A;  2MPM A;  3A7A B;  1O80 A;  3R3O A;  4JI0 L;  3E9I A;  1K83 B;  2NZO A;  3CCE A;  4DV0 Q;  4HJA A;  3T1H L;  1EIF A;  4ZK9 B;  1K0S A;  2D62 A;  1OO9 B;  3EIV A;  4LFC Q;  4DR2 Q;  3T13 A;  1JC7 A;  5CV9 A;  1B9N A;  1LT4 D;  5FLM G;  3G48 A;  3ICE A;  1PMR A;  1TY2 A;  2ICE C;  5KIX A;  4JI4 Q;  4L8J A;  1IYU A;  1GD7 A;  3PMF A;  1JWM D;  1G91 A;  5IGE A;  1G2T A;  3E5S A;  4UAI A;  1HUN A;  1WD0 A;  2RDF A;  1ZYR C;  1KQS A;  3A74 A;  4P72 A;  1KTK A;  4JG2 A;  1Q8K A;  2EYO A;  1L0X B;  3KF6 A;  4JC0 A;  1J5E Q;  3FKI B;  1F2Y A;  3OTO Q;  4LUV A;  4XQN A;  3NHH A;  2X6G A;  2EYM A;  2DJF C;  1PYS B;  4K5X A;  1PTO C;  4DN4 M;  2A1A A;  1GUO A;  1KAW A;  1PFN A;  4OWX B;  1N33 Q;  5FK9 C;  1N32 Q;  3PO3 B;  1LYL A;  1RIP A;  2OQ0 A;  1AW7 A;  1SND A;  2M2L A;  3AFQ A;  1IBM Q;  2NYZ D;  2A6H C;  2CKZ B;  2QA4 A;  1JOQ A;  4R9W A;  1OXX K;  4BBR H;  1X32 A;  5EGT A;  3NPP A;  1XMO L;  1Y1W B;  1JJG A;  3I90 A;  4DK6 C;  1F9P A;  2P5Z X;  3PGZ A;  3C2P A;  5G3L F;  3HP3 A;  2HD3 A;  4LAA A;  2ZM6 Q;  4ME3 A;  3VYT A;  1SE8 A;  2FHT A;  4IUP A;  1C9O A;  4A3E B;  4GLV B;  4LNQ A;  1VQH A;  3PO3 G;  2VQE Q;  4ZLT F;  3V05 A;  4OX9 L;  4LF5 Q;  4F88 A;  4RFB A;  2QKI C;  1L0Y B;  4HIO A;  2KUM A;  5K5P A;  3NUC A;  3BZD B;  1QOH A;  2WIN B;  3L7Z C;  2PQE A;  5AJ3 L;  1MSG A;  2OEO A;  1K3R A;  3PO2 H;  1Y1W G;  3S2D H;  1AH9 A;  1FR3 A;  4JVZ A;  3B6Y A;  2MUY A;  4DAV A;  1B3A A;  2UXC Q;  1N8R C;  2XWJ B;  1FNV A;  3MXN A;  1VQL A;  2L55 A;  2CCZ A;  1JMC A;  4A3E G;  4Z9C B;  1VQJ A;  2DNE A;  1SDF A;  2B2Y C;  1VQI A;  3OOC A;  1STA A;  4R4C A;  3GTL B;  3S1R H;  1PRT B;  3RN2 A;  4DUZ L;  4NXM L;  3MC0 B;  4S3S A;  3I4M H;  3Q8D A;  3K81 C;  1HUM A;  3A5Z B;  4K6L A;  3RUZ A;  3AB9 A;  1SLJ A;  1H9J A;  1GVP A;  4OXP A;  1B50 A;  5JEA H;  3TME A;  2EDG A;  2BE5 D;  1TR5 A;  4NMZ A;  3SHL A;  5FLX c;  4DR7 L;  1WD1 A;  3BDL A;  4JI7 L;  3HEJ A;  1EEI D;  1S72 A;  5M5W H;  1A63 A;  3IFD A;  3NTI A;  1VQN A;  3HGB A;  4HSV A;  4G7H C;  1VQ5 A;  4IPG A;  4GOP B;  2JXM B;  3C3L A;  3M4P A;  2EYJ A;  3V96 A;  5JOB A;  2R3Z A;  1ILP A;  1MD2 D;  3SVM A;  1I4G A;  3LWE A;  3ND8 A;  1A15 A;  2N88 A;  1HQR D;  2EY2 A;  2QDB A;  2CWA A;  4FP5 D;  1LTL A;  4EQ5 A;  5IYD G;  4A3I H;  1BBU A;  1Y69 U;  1Q90 A;  1Y1V H;  4R1J A;  1D5X C;  5JJL A;  1XMQ L;  1ZYR D;  1TII D;  2EY5 A;  1A8V A;  4CJ0 B;  4ZCK A;  1CSP A;  2Z4H A;  5CV8 A;  3E9H A;  3J80 c;  4DU9 A;  4IOC A;  2ZT9 C;  1PTO D;  4C1N I;  1GUT A;  4AYB E;  4B3S Q;  1WTH A;  2K4K A;  1LLR D;  1NUC A;  3G4S A;  4IUN A;  1HTP A;  2E2I H;  4MHE A;  4BBS H;  4HTH A;  1YVC A;  1U9R A;  3T16 A;  2F0N A;  4JBW A;  2RBM A;  1EY7 A;  3S9W A;  1STE A;  3SXH A;  2A6H D;  4JI8 L;  2IY5 B;  2Z6K A;  4DAY B;  1S40 A;  1EU4 A;  3PO2 B;  2X6L A;  3S2D B;  3KBX A;  4HED A;  4PZ8 A;  2QW7 A;  1PHJ A;  1OTC A;  4DA2 A;  3CRK C;  2HIX A;  4XIG S;  5EKK A;  2K50 A;  2D9U A;  3IKJ A;  1E3P A;  1QZH A;  4DV1 Q;  1HNW Q;  1YIT A;  3ERO A;  1TXY A;  5ELB A;  1WTX A;  4U67 3;  1KL9 A;  1MSH A;  5K36 H;  3OWF A;  4J1M A;  5ELD A;  1I4P A;  1EFI D;  3J81 c;  2NZ1 D;  3DWP A;  5JJI A;  2F0U A;  2IWH A;  4A3D H;  2Z0S A;  1SMX A;  1HZ9 A;  1QUQ A;  2K52 A;  4GKK L;  3W1G A;  1CT1 D;  3I4M B;  3I2Z A;  4OHJ A;  2IHE A;  5EPL A;  3MHB A;  4DV3 Q;  4RMF A;  3HOX H;  2JQO A;  1UUP A;  1ICW A;  1ENF A;  4GN3 B;  1KHI A;  4B3M Q;  2KEN A;  3T51 B;  5M5W B;  1H9K A;  1FD7 D;  2B63 H;  4M8A A;  1CHQ D;  2C9O A;  1KD1 C;  2R93 G;  3I4M G;  2DGY A;  1U4M A;  4O42 A;  2UUA L;  1IBK Q;  3ULL A;  5I2X A;  5JEA G;  4L63 B;  3PIP 3;  2BOS A;  2F0K A;  2BDO A;  2VQF L;  1RTO A;  4A3I B;  3BVG A;  5IGG A;  4AQY L;  2H4O A;  3L3O C;  1SMY C;  1AFP A;  1VMC A;  1JCK B;  1Y1V B;  5C5M A;  2OQK A;  2AHO B;  4O2D A;  2VY3 A;  2FIN B;  4LF9 L;  2N3S A;  1N9W A;  1CKM A;  2ZTE A;  2UUC Q;  1VQA A;  1BVS A;  2VUM H;  3S14 H;  1KRS A;  1N34 L;  5DEH A;  4UP8 A;  3PUX A;  1EYG A;  2AWO A;  4YY3 L;  4A3I G;  1EQT A;  3K5M A;  4KLK A;  4O0A A;  2V4D A;  1VF7 A;  2IX3 A;  2PNH A;  4FF4 A;  1E2Z A;  5EQ0 A;  1Y1V G;  2XWB B;  1MGS A;  3NBH B;  4MN3 A;  2OTJ A;  2F3V A;  2QCP X;  2E2I B;  4BBS B;  2RVL A;  2F0V A;  4DK3 C;  1WTW A;  1SFO H;  1BCP C;  3E0E A;  3QOJ A;  1UE6 A;  1VQE A;  1LT6 D;  2E2H H;  3NEN A;  2F3I A;  1M8A A;  4JOI A;  3N52 A;  4AH6 A;  4XYQ A;  1ENC A;  5C3X A;  2OXP A;  3R2T A;  3UDG A;  3DHQ A;  1UNS A;  1JOK A;  1VQ8 A;  5DM6 3;  2B2U A;  3GTG H;  4JI1 L;  4BBS G;  3HOV H;  4R4I A;  1YBY A;  1D6E C;  4ZKB B;  1QJO A;  4X66 Q;  2GVA A;  4DV4 Q;  3D3R A;  2B2Y A;  3A56 A;  4A3G H;  1TVX A;  3P75 A;  1X3G A;  2NZH A;  1EUJ A;  4A3D B;  2KEC A;  4X65 Q;  1XNQ L;  2JA5 G;  2F52 A;  4FXD A;  3ZYY X;  5CBA E;  1GHK A;  4KI0 A;  1DOL A;  2ZXR A;  1VQ9 A;  2ZJQ A;  1PH9 A;  3HOW G;  4ME5 A;  1CQF A;  1PFM A;  1Q7Y C;  3HOX B;  2XRS D;  1QVG A;  4ALP A;  5K36 G;  3NWT A;  4JYA Q;  4DV0 L;  1X3P A;  4LFC L;  4A3D G;  2K14 A;  4DR2 L;  4WOR A;  1CKN A;  4LUO A;  2AMC B;  2J4X A;  1DXM A;  2ZJP A;  5J3B A;  2F0L A;  4JI4 L;  3WWV A;  3PV0 A;  1CA5 A;  1I4Q A;  3A8J E;  1HJP A;  2N49 A;  3VR3 A;  2WFW A;  3JC6 6;  3STB D;  3DUZ A;  3HOX G;  4HCS A;  4OEM B;  3QO2 A;  4RGM A;  4C3I H;  2LY7 A;  2PYK A;  4IUV A;  4ZRZ A;  4BA2 I;  5C3E H;  4XT1 B;  2FMC A;  4R4O A;  4DR5 Q;  4XQQ A;  1EQR A;  1Z9F A;  4F87 A;  3C1E A;  1J5E L;  2OF1 A;  1QVC A;  1SRO A;  4UP7 A;  3OTO L;  1PH7 A;  1ZEQ X;  2C35 B;  1Q1E A;  5M3M H;  3DM3 A;  1B9M A;  2WKC A;  3URY A;  2JJQ A;  4QMG A;  2K5N A;  2RSN A;  3BDO A;  2EXZ A;  2YYZ A;  4JPB W;  3PUZ A;  2JP1 A;  4PZ6 A;  3S14 B;  1JE5 A;  2VUM B;  2KVM A;  4OWW B;  4P74 A;  1N33 L;  2E5L Q;  4IFD J;  1LTA D;  4HJ5 A;  3IAY A;  1HPC A;  4C1N K;  5FO7 B;  1N32 L;  2E2D C;  2NTS A;  3F1Z A;  4CKC A;  2HHH L;  1IBM L;  4CHT B;  3CCJ A;  1SMY D;  3ER0 A;  3PSI A;  4XDX A;  2L0C A;  1YEZ A;  1OXV A;  1EOV A;  2LSS A;  4LMQ D;  3UE1 A;  5D14 A;  3KF6 B;  5IP9 G;  1IZ6 A;  4CKE A;  1SFO B;  2E75 C;  2VUM G;  2JN4 A;  2NWG A;  1UAP A;  4LUZ A;  5GAD C;  2ZM6 L;  1HRJ A;  2E2H B;  4RWS C;  2UXB Q;  2FMM A;  4I7A A;  1STG A;  3JAM E;  2UUB Q;  3CC2 A;  1A3T A;  2HUG A;  1H95 A;  2VQE L;  3OMC A;  3D31 A;  4LF5 L;  4EX5 A;  1HNZ Q;  4GLA C;  4LFA Q;  1GO3 E;  1SXT A;  2QF7 A;  1JWU D;  3GTG B;  1VQF A;  3NBI A;  2FFK B;  3HOV B;  3I73 A;  1ENA A;  4G7Z C;  4A3G B;  3CCV A;  1ET6 A;  2BA1 A;  1RJT A;  2UXC L;  2NVT H;  2KHJ A;  4CKB A;  3KLS A;  1VQG A;  3R8B A;  1VDZ A;  1EIG A;  5F2D A;  1OXS C;  3GTJ H;  1IKM A;  1I6V C;  4EGV A;  1PH5 A;  5IOD A;  1D8L A;  4IFD H;  1HQM C;  1YNJ D;  2R61 A;  1K28 A;  4QIW E;  4MNO A;  4QY7 A;  1FNW A;  3BDC A;  3X3M A;  1MI2 A;  1O7Y A;  2MFI A;  1X3E A;  4X62 Q;  2G9D A;  3HOV G;  1E0B A;  5LMN Q;  1HTL D;  2KJX A;  5LMN W;  1EFW A;  1B1Z A;  1VQ7 A;  1HA6 A;  4KHP Q;  2BDN A;  5D3I B;  4APV A;  2TMP A;  2B2W A;  3MXN B;  2F0M A;  2E76 C;  1SEB D;  3CW2 C;  2I5L X;  3H94 A;  5KGU A;  4K5V A;  5E4X A;  1PVO A;  1M1K C;  4ZUJ A;  1V1Q A;  3I4L A;  1SNO A;  2KEE A;  5BN4 A;  5FLX L;  4C3I B;  2K03 A;  1PRT F;  1BNZ A;  1NSN S;  2R92 H;  5C3E B;  3TS2 A;  5FOB B;  3RD4 A;  4X6A H;  2WAQ E;  1TU2 B;  4DV7 Q;  4JBJ A;  1GXD C;  4RG1 A;  4YCU A;  3HG9 A;  3MFY A;  3UDI A;  3AYH B;  5M3M B;  3U50 C;  2JEB I;  2GN5 A;  1T5E A;  1U4P A;  5LHY 1;  4ABN A;  4LFB Q;  2RSO A;  3CCM A;  1Y8N B;  5ELN A;  2Q8R E;  4JI6 Q;  5EAY A;  4A3E H;  2B2T C;  3SK5 A;  4C3I G;  4ZKC B;  1SYC A;  2A19 A;  1DYQ A;  4IUU A;  2Y0S E;  4POG A;  3DWA A;  3CC7 A;  4KY7 A;  4A3L H;  3BYY B;  4PNY A;  2ES2 A;  4ODG A;  5M3M G;  2AWN A;  4NDX A;  1EIH A;  5CBE E;  4LF7 Q;  2CH4 A;  1Q3L A;  5J22 A;  4R8N A;  3OMG A;  1II3 A;  1EQV A;  1STB A;  2BE5 C;  2IHF A;  2F1M A;  2SNS A;  3J80 L;  4C56 C;  3GDE A;  3VR6 A;  5IWA Q;  3BYT B;  5M9O A;  5JJZ A;  4A93 H;  1GM5 A;  2RCN A;  5FLX E;  1XJV A;  4CJ2 C;  4B9W A;  3U4V A;  2L11 A;  1NBW A;  5ISR A;  4HJ7 A;  2EYP A;  1Q1B A;  2Q8I B;  3PIO 3;  2K75 A;  2NVT B;  4DV1 L;  1HNW L;  3J7Z C;  4OGQ C;  2RDH A;  4TQU S;  3TS0 A;  4EQP A;  3ULP A;  3GTJ B;  1N36 Q;  3BZC A;  5ELO A;  3A54 A;  2EXD A;  5IYD H;  2K32 A;  4K0K Q;  4HR7 B;  1E1T A;  2KHI A;  3RLO A;  4R8I A;  2ALY B;  1EYA A;  4RKL A;  4HMI A;  1ASZ A;  3VR2 A;  1IYJ B;  4GN5 A;  1DJR D;  4X64 Q;  1G8Z D;  3U9S A;  1QCB D;  5E4W C;  3SDZ A;  2F0W A;  2XNA C;  4HJ8 A;  1L1O C;  3J81 L;  1JWS D;  2XVS A;  4DV3 L;  2F0O A;  3VYR A;  1R9T H;  2K01 A;  1DOK A;  1HZB A;  4IFD G;  4QF4 A;  1XXG A;  1O7L A;  4B3M L;  4KJO A;  4H44 C;  2JSO A;  4CDD C;  1W6J A;  3K5L A;  5ELC A;  2HQE A;  4K5W A;  3JAM i;  3FMC A;  5FJ8 H;  2HDL A;  4ILW A;  4ULL A;  2HCC A;  1XPO A;  1IBK L;  2R92 B;  1QUQ B;  2B2V C;  1K9M C;  3TDQ A;  2I0Q A;  1NE3 A;  4IUT A;  1CM9 A;  4DAM A;  4CGY B;  4WFN 3;  3E0J A;  2A73 B;  4JV5 Q;  1WTQ A;  3K7A H;  2NTT A;  4NW2 A;  3HKZ E;  1X65 A;  2PZW A;  1V1P A;  2MGS A;  4H0L C;  5KND A;  2JA8 H;  1JIC A;  2ZTD A;  5IYC H;  2UUC L;  1GUN A;  3K5N A;  2R92 G;  1QWY A;  5C0X I;  1OXT A;  1HCZ A;  2L1B A;  5L37 A;  1Z47 A;  4B08 A;  3I4N H;  5KRU A;  4JOI C;  4Q5V A;  1LTI D;  2O5I C;  3KDF A;  2RQX A;  4R4Q A;  5J39 A;  1Y8O B;  1HNX Q;  4IZ8 A;  1MJC A;  5EKL A;  3W1B A;  2B2U C;  3J81 E;  2KOL A;  2A74 C;  1O7I A;  4F8M A;  1QE6 A;  3K5O A;  1EY5 A;  2RDG A;  3HS0 C;  1EWC A;  4LK1 C;  5E7N A;  2EIF A;  3GTK H;  4EQN A;  1VMP A;  1SBB B;  4A3L G;  1U4L A;  4A93 B;  3P7J A;  3A55 A;  1XTC D;  4BWG B;  1TS2 A;  2VW9 A;  4GLX A;  4DNT B;  4QCL A;  5IYB H;  1U5K A;  2H5X A;  1NMF A;  4ZYS A;  2R93 H;  2OWO A;  1EZ8 A;  4IJH A;  1KNA A;  1NCV A;  4DR4 Q;  1E7Z A;  1LAC A;  2PQA B;  5HGT A;  2K5V A;  1HH2 P;  3OSO A;  4X66 L;  2R7Z H;  1WTR A;  2XN9 C;  4DV4 L;  4HIK A;  2VNU D;  2K6A A;  2GVB A;  3HZX A;  2EOT A;  1CI3 M;  1FL0 A;  3BJU A;  3W5O A;  1NTG A;  4A93 G;  4KY6 A;  3PIO A;  1NJI C;  2DY8 A;  4X65 L;  3UDX A;  3CCS A;  1VQB A;  1WI5 A;  1X54 A;  1S5F D;  3DEO A;  3I7F A;  3H3V I;  3VR4 A;  4CJ1 B;  1E1O A;  3I91 A;  1PFS A;  1HZA A;  1M4V A;  1R9T B;  4YCV A;  5D65 A;  3CCL A;  1X55 A;  4JBK A;  1PYB A;  3MA2 B;  4K14 A;  2K05 A;  1H9S B;  3RN5 A;  4JYA L;  1B3Q A;  4MTK A;  2AQ1 B;  2KBN A;  2QGQ A;  4NKL A;  1D2B A;  2Q2I A;  1NMG A;  1IBL Q;  1V43 A;  3MEH A;  2I07 B;  1SYE A;  3MEF A;  5EPK A;  3ND9 A;  5I6Y A;  1Z6H A;  1JOR A;  2F0H A;  1K8M A;  3I56 A;  1BQQ T;  3R2I A;  3BU2 A;  1S5E D;  2ASB A;  1VS0 A;  1WTV A;  4LW1 A;  2DJG C;  4DR5 L;  4IJL A;  1F2Z A;  3J7Y W;  3BS1 A;  3K7A B;  2XRQ D;  2A8V A;  1YIJ A;  3TQY A;  5FJ8 G;  2JA8 B;  4JI5 Q;  3PQI A;  2WKD A;  2CWP A;  2WAC A;  2RF4 A;  2B2T A;  1CKN B;  1ROD A;  1BCP F;  4RGN A;  2MJ8 A;  2E5L L;  5DLQ E;  1QVF A;  4KKT A;  3I4N B;  1HZC A;  2DN8 A;  1VQK A;  2PMZ E;  2JA6 H;  2LXK A;  2K1B A;  2JA5 H;  1K3B C;  3PCO B;  2G5D A;  2CQA A;  4G57 A;  3HOW H;  3I55 A;  4A76 A;  2F0Q A;  2JA8 G;  4EQO A;  4N8X 1;  2JE6 I;  3PF4 A;  1PRT D;  1STH A;  5IYC G;  1FJG Q;  5IGC A;  3GTK B;  1SE2 A;  2MP1 A;  2ZJR A;  3K58 A;  1JB7 A;  2F03 A;  3I4N G;  2UXB L;  1D1K A;  2UUB L;  1IXR A;  3J80 i;  4AYB B;  2R93 B;  4LFA L;  2KQ3 A;  1EYC A;  1CSQ A;  1WFQ A;  3OPO A;  2IPK D;  1LV9 A;  3VYU A;  4KJN A;  3TP7 A;  4EVO A;  4OIJ A;  3STB C;  4XTC S;  5ELE A;  2R7Z B;  1JJ2 A;  4UPA A;  1EY0 A;  3C1F A;  2NN6 H;  1QNK A;  2N8N A;  5IYB G;  1SE3 A;  2B2W C;  4AYB G;  4HCE A;  3TZU A;  3S17 H;  3WDN A;  4MZ9 A;  2JEA I;  4BY1 G;  5KYI A;  3ITP A;  1YI2 A;  1DCZ A;  1S4Z A;  4X62 L;  1L1O A;  1PH6 A;  5LMN L;  4JW0 A;  1RF2 D;  2R7Z G;  4FNF A;  2TSS A;  4KMU C;  1BDO A;  1KAA A;  4YWK A;  2F0E A;  1AE3 A;  1H9M A;  3SK4 A;  2Z6B A;  3J81 i;  2RHQ B;  4KHP L;  3QJY A;  2EPB A;  1SN8 A;  4HMJ A;  3H6M A;  1D1I A;  4KV6 A;  5C44 H;  2A68 D;  4HAE A;  5IP9 H;  2GA4 B;  3AQQ A;  1I94 Q;  1QB5 D;  1NNX A;  2YTV A;  1VQC A;  2B2V A;  3SEB A;  4K2L A;  5C0X J;  5CR3 A;  1TWG H;  2PW7 A;  4QUC A;  2PPB C;  5I2Y A;  4DV7 L;  4A3C H;  4P73 A;  1K73 C;  3A8K E;  2K04 A;  2IX0 A;  3RLN A;  3KLW A;  4A3F G;  2K33 A;  1HR0 Q;  2PI2 E;  5I9P A;  4PV1 C;  1HR0 W;  3K0X A;  4IUQ A;  1PZJ D;  3ERQ A;  2IX1 A;  4LFB L;  3I4O A;  1B4O A;  1XTD A;  1UWV A;  1W6K A;  2NVY H;  4JCV E;  4Q0F A;  5IY0 A;  4DNI A;  4JI6 L;  2JA6 B;  1NAP A;  2BA0 A;  5IE8 A;  3A5U A;  4ZAI A;  2JA5 B;  2VXW A;  5EBD A;  1YNJ C;  3J7A V;  3HOW B;  3E6Z X;  1I4R A;  4OL7 A;  1SE4 A;  4LWC A;  5DM7 3;  4UP9 A;  1CKO A;  1XWE A;  3N6R A;  4FXK C;  3CPF A;  1SJE D;  3DEP A;  1AZQ A;  4LF7 L;  1HXY D;  4GN4 B;  1EQQ A;  4QL5 A;  2OT2 A;  1TS4 A;  3MXG A;  4OON A;  3TBI B;  1XPU A;  3RR5 A;  2JA6 G;  1C0A A;  3HKS A;  5JVH 3;  5G3L D;  1XYI A;  2BCO A;  4NPS A;  3BG3 A;  5IWA L;  1KXL A;  4J6H A;  1UE1 A;  1EOT A;  4RKB A;  1Q46 A;  2WB1 E;  1EIY B;  2WV6 D;  5GQO A;  1FGB D;  1C4Q A;  1A3U A;  4DK0 A;  3NP8 A;  4HIM A;  3RZO H;  3QR8 A;  4KN7 C;  1PZI D;  1N36 L;  1BCP B;  3D0F A;  1K8O A;  2NB0 A;  5ELF A;  4K0K L;  4YCW A;  3S17 B;  4GNX C;  1TY0 A;  2K5Q A;  1QNU A;  3H09 A;  5HUR A;  2G9H D;  2XTI A;  1D7Q A;  3LX0 A;  1IW7 C;  1VQO A;  2KCT A;  2X69 A;  2CFM A;  4X64 L;  1KLU D;  1KNE A;  2NN6 G;  3M85 A;  1TT2 A;  1RTN A;  3KF8 A;  1HFG A;  4J15 A;  1W2B A;  4I65 A;  4BA1 I;  5EKI A;  5CV7 A;  3S16 B;  1S5D D;  5C44 B;  3NE5 B;  1LTR D;  3RZD H;  2Q8T A;  2AQ2 B;  4A3K H;  2VL6 A;  4Y7N H;  2Q2U A;  4G4K A;  1KDB A;  4U68 A;  2DY7 A;  1A6X A;  5FKA C;  1TWG B;  3P1H A;  1F9Q A;  4UHV A;  4DR1 Q;  1Y8P B;  1IHZ A;  3T1Y Q;  4A4I A;  1KDA A;  3NQI A;  3G6E A;  3F2B A;  2A69 D;  1IL2 A;  3NWS A;  4OO1 H;  1BUV T;  2EE1 A;  1SNM A;  2O4X A;  2Z8L A;  4RGT A;  5C44 G;  3F2U A;  2SOB A;  4JV5 L;  1TWH H;  1BBX C;  2LFN A;  2VZA A;  2NBF A;  1X3F A;  1TWC H;  3MTS A;  2RHS B;  1G29 1;  2NVY B;  3GD7 A;  2FXQ A;  4PMC A;  2MO0 A;  3TSS A;  2O5J C;  1RHP A;  1SR3 A;  4A3C G;  1YJ9 A;  2ZXO A;  5A2Q L;  1GOZ A;  1A62 A;  4DR6 Q;  2N55 A;  2KCM A;  1JE4 A;  3FEW X;  1PH4 A;  3HOZ H;  1A2T A;  3CD6 A;  1HNX L;  2KED A;  2MQH A;  5C4Z A;  1T5X D;  2F0G A;  3TRE A;  3KK7 A;  2QEJ C;  3NTH A;  2F4V Q;  1BO0 A;  3AU7 A;  3MXU A;  1TWA H;  2EYH A;  1SYD A;  2EJG C;  1NR4 A;  1XNR Q;  1NR2 A;  1RCV D;  4H7B A;  3U4Z A;  1ASY A;  3G71 A;  3TN2 A;  3H3V C;  4HN7 A;  4HJ9 A;  4RA8 A;  1PYW D;  5IGB A;  1E2W A;  1J9O A;  3KDF B;  4P2C B;  3RZO B;  1Q81 C;  2VB2 X;  1MHW C;  1F77 A;  4X3U A;  1PTO F;  1PXU A;  3Q6S A;  3EFX D;  3AMU A;  4B3T Q;  4JBM A;  2D2C C;  4DKA C;  4YHH Q;  2L15 A;  2Z1C A;  4DR3 Q;  2RCF A;  1AZP A;  3KUP A;  4A3M H;  3RZD B;  1VCI A;  1IW7 D;  2L9H A;  1A0I A;  4A3K B;  1YHA A;  4KTA A;  4Y7N B;  1N34 Q;  1LTG D;  2KCN A;  3KFU A;  4QGU A;  1VQD A;  4DF7 A;  3PUV A;  3PF5 A;  1V8Q A;  4TSS A;  1IBL L;  2EYF A;  2YU9 H;  3FVQ A;  2Z4I A;  2PI2 A;  4P75 A;  1C48 A;  3GTP H;  1CUK A;  4G7O C;  3M4O H;  5EPJ A;  5CC4 A;  3VA5 A;  2EY6 A;  4WJ4 A;  4B3S L;  4WJ3 M;  4FDB A;  1M90 C;  1TWH B;  1DD2 A;  2JA9 A;  3S1M H;  2IL8 A;  2B39 A;  1PH3 A;  5A35 A;  3H15 A;  4A3K G;  1GUS A;  1TQO A;  4XXE A;  5CGK A;  1TWC B;  4JI5 L;  1PTO H;  5C4X B;  1DOM A;  2ZXP A;  1AE2 A;  3IFT A;  2IJ0 A;  5GRO A;  3DMU A;  2WAQ B;  2L4N A;  3M9B A;  4IQZ A;  3T4A C;  4L5S A;  1PZK D;  2XIW A;  2FJ2 A;  4A3J B;  2E74 C;  1BBW A;  1LTS D;  5JJK A;  4OO1 G;  4FO2 A;  1EY6 A;  1JR0 D;  4TKO B;  1JOO A;  2EJM A;  4NB3 A;  4C3J H;  1TWF H;  4PQX A;  5I9O A;  3M7N A;  3HOZ B;  4JI2 Q;  2C5C A;  4B3R Q;  3I70 A;  4BY7 B;  3H0G H;  5IGF A;  3J7A 5;  1UE5 A;  4DV2 Q;  5C4X G;  4XYO A;  4YWM A;  1TWA B;  1KIX A;  4DFA A;  3GP7 A;  1FJG L;  1P16 A;  1WVL A;  1QIL A;  2WAQ G;  3D6W A;  2Y0S B;  2I46 A;  3JAM c;  1EL0 A;  4A3J G;  2L12 A;  2MO1 A;  5E1F A;  1XX8 A;  3S15 B;  3S2H H;  1OXU A;  3HOZ G;  4L5R C;  2ICI A;  2E8G A;  3I8Z A;  4DXF A;  3CHB D;  5CYU A;  1CA6 A;  4XT3 B;  4BY7 G;  2B29 A;  4IPH A;  1SAP A;  1Z7T A;  1PV4 A;  5CV5 A;  3IL8 A;  3LWU A;  2CHB D;  3QG1 A;  4C2M B;  2Y0S G;  4X3K A;  3KYH C;  4FF1 A;  4GNX A;  1FGU A;  1SNC A;  5C4H A;  2HQL A;  3BVM A;  3Q23 A;  3MWY W;  1WOC A;  3J80 E;  2J7Z A;  3A8I E;  3U9O A;  4JI3 Q;  5HGQ A;  1LM0 A;  4M1U B;  3OIQ A;  2WII B;  3S1Q H;  4QUF A;  4A3M B;  4YWL A;  2V1C C;  2H1E A;  5BR8 Q;  4DXG A;  3CC4 A;  2K5W A;  3CPW A;  1SNQ A;  1D5Z C;  1LUZ A;  2JK8 A;  1B2T A;  1CQV A;  1PRT C;  1C7Y A;  3LNN A;  2YV5 A;  3T53 B;  1F9S A;  2YU9 B;  2HHH Q;  3FPU B;  1I94 L;  3DM1 A;  3FKI G;  3CF5 A;  3GTP B;  3M4O B;  1SYB A;  5JEA J;  4A3M G;  1L1O B;  3UE0 A;  5LMU Q;  1BF4 A;  2VS1 A;  2DUD A;  4F7X A;  3S1M B;  2SNM A;  3G7L A;  1BR9 A;  3GTQ B;  3VDY A;  1E24 A;  1PFB A;  4MIU A;  2K5D A;  1PTO B;  3AEV A;  2HT1 A;  1HR0 L;  3NK9 A;  1J6Q A;  4OIK A;  1H9R A;  1J8I A;  4PMW A;  4GOP C;  4LF6 Q;  3MXP A;  2NUC A;  2PZU A;  5IT9 c;  1RL2 A;  5KNB A;  3FPP A;  4GKJ Q;  4TRD A;  2UU9 Q;  1B53 A;  4WRD A;  4UY8 C;  4HID A;  4DV6 Q;  1E22 A;  1MBY A;  1YZ6 A;  3VA7 A;  5C3W A;  4LF8 Q;  5COR A;  2A5H A;  4C3J B;  1TWF B;  3M4Y A;  2SDF A;  1EZ6 A;  3M4Q A;  3C46 A;  3HKZ B;  4N8F A;  1B44 D;  4BY1 H;  1LAB A;  3H0G B;  3OIP A;  4CDF C;  4NXN Q;  2F4I A;  1BXT A;  1MJE A;  4AIM A;  2OCE A;  2OTL A;  2K28 A;  3BZK A;  4KHV A;  1CK1 A;  5FO8 B;  1FVI A;  5GAG C;  2PCF B;  3QWN A;  3M3Y H;  3GTO H;  3NQT A;  2EZV A;  1WCM H;  2EVB A;  3S2H B;  4C3J G;  3ONA B;  3L9A X;  4A3B H;  4L5T A;  2A68 C;  3HKZ G;  4MTN A;  5M3F H;  3H0G G;  4JK1 C;  1CTM A;  2E2J H;  4C3H H;  3OHX C;  1ESF A;  2KA7 A;  1SYF A;  1XPR A;  1S5B D;  1ILQ A;  4ZUI A;  4LJZ C;  4LF4 Q;  1RDP D;  2M00 A;  1G2S A;  3UDF A;  4POF A;  4A3F H;  1ZKO A;  3UI2 A;  4K8J A;  2IW3 A;  4NP5 A;  5DAU A;  1KDC A;  1Q82 C;  4K2K A;  4OO1 I;  1LTT D;  3HOY H;  3S1Q B;  3KJP A;  2CQO A;  2HIV A;  2PW5 A;  4A75 A;  3J81 j;  2CW0 C;  4IN3 A;  3CP0 A;  2PZT A;  2NVQ H;  1R4P B;  5LL6 X;  2ATW A;  3ULJ A;  3OW2 A;  4DUY Q;  2QEX A;  1K0R A;  4DGZ A;  1UEB A;  1W3S A;  1G6Z A;  1PH8 A;  1B70 B;  1MKH A;  2CVR A;  2BH2 A;  2QDL A;  1I4X A;  3F8T A;  2M9V A;  4QB4 A;  4BBR B;  5GAH C;  4DR1 L;  3D4D A;  1ET9 A;  4DV5 Q;  3T1Y L;  5M5Y H;  5EBC A;  2AKW B;  2R6G A;  2BH8 A;  1QZG A;  5KNC A;  3E3X A;  2RA4 A;  3TP6 A;  2F0D A;  1I50 H;  2UXD Q;  3KF8 B;  1Q12 A;  2F3W A;  1D5M C;  3FDT A;  3GV3 A;  4FVM A;  4KN4 C;  2HCI A;  1ML0 D;  3Q22 A;  4IFD I;  2LXJ A;  3G6J B;  3GV6 A;  1DON A;  4PZ7 A;  1KC8 C;  2F0P A;  2F0F A;  5H1S E;  2VB3 X;  1TKW B;  3F2D A;  2Q2H A;  4BBR G;  5BN3 A;  4JI0 Q;  3Q24 A;  4GZY C;  4B9X A;  1HNZ L;  1HFN A;  3T1H Q;  3EBE A;  4E6I A;  1K8A C;  3A7L A;  3CAM A;  4BY1 B;  4DR6 L;  4IPC A;  1GKH A;  5JAV A;  2K7V A;  3M7G A;  2AQ3 B;  2MNA A;  3S1R B;  3R93 A;  1DM0 B;  5AFW A;  2F4V L;  1PLF A;  1S3O A;  2EY1 A;  3M3Y B;  1X3Q A;  3GTO B;  3PO2 G;  1A2U A;  5TSS A;  2PMZ B;  1WCM B;  1XNR L;  4PG3 A;  3EQL C;  1RD9 D;  2EQS A;  3QIA A;  4A3B B;  4KY5 A;  1EYD A;  5M3F B;  1F2L A;  5E3F A;  2F0J A;  3HRZ C;  3W3A A;  4DK1 A;  2E2J B;  1G6P A;  4C3H B;  1L0W A;  1SJH D;  4P71 A;  3MAQ A;  1EWI A;  3J7A F;  4KHZ A;  1EU3 A;  1S5C D;  1SRU A;  1L2F A;  1LO5 D;  1GJX A;  2A69 C;  4FF2 A;  3TZD A;  3OYY A;  1WCM G;  1TS3 A;  4A3F B;  3S16 H;  1PDQ A;  2Q2T A;  2LMC B;  4A3B G;  2HDM A;  1HHV A;  1PA6 A;  5M3F G;  4B3T L;  1CHP D;  4V19 0;  3NEL A;  4C3H G;  1U0L A;  1LTB D;  2I5M X;  4YHH L;  1P8L A;  1XMO Q;  2JA7 H;  3SK6 A;  3HOY B;  4R4T A;  4KD4 A;  4DR3 L;  1LT3 D;  3PUW A;  5C6A A;  1YNN C;  3MVV A;  1VQ4 A;  5IGD A;  4BS9 A;  1EEF D;  5M5X H;  2NVQ B;  2ENB A;  3OWE B;  5DNF A;  3U58 A;  3VYS A;  5CMD A;  1Y14 B;  5IP7 H;  1CZW A;  5KEE A;  5EJW A;  3X3N A;  3CCQ A;  1KLG D;  3CCU A;  4OX9 Q;  3L2P A;  4TVA B;  1ESR A;  2F0S A;  3A0J A;  5J1Z A;  3WOF A;  5AJ3 Q;  2Z9H A;  3HOY G;  2PQA A;  5M5Y B;  2QIL A;  2IT1 A;  2CW0 D;  1CZG A;  3D6C A;  1I50 B;  4KKU A;  3S24 A;  1UE7 A;  5BN5 A;  1B7Y B;  1RKN A;  5C5L A;  1VQP A;  3OW7 A;  2ZTC A;  2MHV A;  2XSC A;  4RGO S;  4GOP A;  3FP9 A;  3K0Y A;  3KLR A;  4NXM Q;  4DUZ Q;  2D0P A;  1WJJ A;  1I3Q H;  3CKI B;  4FYD A;  2F0T A;  3EVQ A;  5CV6 A;  1KRT A;  5C0X H;  2KCC A;  3EJI A;  3CME A;  1DZ1 A;  3TRZ A;  1H9S A;  2A6E C;  1MIU A;  3K6O A;  3T56 B;  4DR7 Q;  4V0B A;  1YJN A;  1BKB A;  3ZJY C;  1F2M A;  4JI7 Q;  4H13 C;  4JI2 L;  4B3R L;  1R4Q B;  3K57 A;  4OEL B;  1TS5 A;  4L6T B;  2PNR C;  5NUC A;  4DV2 L;  2SEB D;  3S1N H;  1YJW A;  1ICF B;  3WOE A;  2JYO A;  1X9N A;  1Q8I A;  4L5Q A;  2LS0 1;  2AUK A;  1WTP A;  3SR1 A;  4CBV A;  4K8I A;  1STN A;  1V9P A;  2L5T A;  3EA6 A;  5HY6 A;  3L0O A;  3K8A A;  3K80 C;  2NVX H;  4X3S A;  2B63 B;  3JAM L;  1UEA B;  4IOA A;  5CV4 A;  1XMQ Q;  4XQJ A;  4DAY A;  1FNU A;  1GUG A;  3KOJ A;  2B8F A;  5D3D A;  2J0T D;  1NY4 A;  3MFG A;  1I6H H;  2WB1 B;  3NSW A;  3W2D A;  5GAE C;  1PH1 A;  3NEM A;  4WJW A;  2JA7 B;  4FF3 A;  3HOU H;  4BXX H;  1DGS A;  3H3V H;  1SNP A;  1AP0 A;  3D4R A;  4IPD A;  3KLS X;  1C8C A;  4JI3 L;  2F0I A;  2N78 A;  3RLF A;  3TP8 A;  5M5X B;  2B63 G;  3BVZ A;  5FO9 B;  4DAP A;  3PIP A;  1VQM A;  4OWT B;  3LGJ A;  3GTM H;  1GUW A;  1YHQ A;  5BR8 L;  5T1G A;  1Q86 C;  5JVG 3;  4KKS A;  4JI8 Q;  3CQZ H;  3DWQ A;  2WB1 G;  3O13 A; 
#chains in the Genus database with same CATH homology
 1U4R A;  3VR5 A;  3MZ5 A;  1YNN D;  4RAU C;  4IUR A;  3D8G A;  4N9P A;  3NXW A;  5LL6 S;  4N9T A;  4UDU C;  4ZQ3 A;  3I72 A;  4RHS A;  4YIJ A;  2EYL A;  3V2T A;  1I3Q B;  4IAL A;  3D4W A;  5JPN C;  1V1P B;  1O78 A;  1V1O A;  5IIF A;  1KAB A;  1BCP D;  1HA5 A;  3DXJ C;  1EY4 A;  1F9R A;  1EWH A;  1IL8 A;  1BOS A;  4RH6 A;  3GO5 A;  3P20 A;  5IT9 L;  1A3V A;  3KBG A;  3FRP B;  4RCN A;  2WP8 J;  3SE0 A;  3S1N B;  1CFM A;  1JB3 A;  5C0X G;  3CU7 A;  2A6E D;  2PO4 A;  3CRL C;  1GHJ A;  5JPM C;  1LT5 D;  4J8Q A;  3NBH A;  4HSP A;  2NVX B;  1ZXT A;  1AN8 A;  1O7Z A;  5A2Q E;  2D5D A;  3K59 A;  2B8G A;  2ID0 A;  4KD3 A;  5IOC A;  4QIW B;  1WTO A;  4I7Z C;  4DNR B;  1I6H B;  1I4H A;  1IYV A;  1JQY D;  3HOU B;  1EY9 A;  5KYL A;  4RCO A;  5T1I A;  4O1N A;  4ID6 A;  3GTM B;  3SK8 A;  4K6D A;  4RHR A;  2AUJ D;  3CQZ B;  1STY A;  1FYC A;  4KK7 A;  3NTK A;  5IT9 E;  2LKV A;  1SYG A;  2DNC A;  1QG7 A;  3H91 A;  2RKS A;  3PUY A;  1VF5 C;  3GQB A;  3Q0A A;  4X3T A;  3TP5 A;  5C4J B;  2NN6 I;  4FXG C;  1SSO A;  3QOL A;  2KHS A;  1AEX A;  1IKL A;  3I3C A;  5I6W A;  2EJF C;  2O2L D;  5COY A;  1ONL A;  3QB3 A;  1EY8 A;  4PMB A;  1E2V A;  3RMH A;  5I4D A;  2MPM A;  3A7A B;  1O80 A;  3R3O A;  1K83 B;  4ZK9 B;  2D62 A;  1OO9 B;  3T13 A;  1JC7 A;  5CV9 A;  1B9N A;  1LT4 D;  1PMR A;  1TY2 A;  2ICE C;  5KIX A;  4L8J A;  1IYU A;  1G91 A;  3PMF A;  1JWM D;  5IGE A;  1G2T A;  3E5S A;  4UAI A;  1HUN A;  1WD0 A;  2RDF A;  1ZYR C;  1KTK A;  2EYO A;  1L0X B;  3FKI B;  1F2Y A;  4XQN A;  3NHH A;  2X6G A;  2EYM A;  4K5X A;  1PTO C;  4DN4 M;  1GUO A;  1PFN A;  5FK9 C;  3PO3 B;  1AW7 A;  1SND A;  2M2L A;  2NYZ D;  2A6H C;  1JOQ A;  4R9W A;  1OXX K;  1X32 A;  5EGT A;  3NPP A;  1Y1W B;  3I90 A;  1F9P A;  3C2P A;  5G3L F;  3HP3 A;  4LAA A;  3VYT A;  2FHT A;  4IUP A;  4A3E B;  4ZLT F;  3V05 A;  4F88 A;  4RFB A;  2QKI C;  1L0Y B;  2KUM A;  5K5P A;  3NUC A;  3BZD B;  1QOH A;  2WIN B;  3L7Z C;  2PQE A;  1MSG A;  2OEO A;  1FR3 A;  4DAV A;  2MUY A;  1B3A A;  2XWJ B;  1FNV A;  3MXN A;  2L55 A;  4Z9C B;  2DNE A;  1SDF A;  2B2Y C;  3OOC A;  1STA A;  3GTL B;  1PRT B;  3MC0 B;  4S3S A;  1HUM A;  4K6L A;  3RUZ A;  3AB9 A;  1H9J A;  1B50 A;  5JEA H;  3TME A;  2EDG A;  2BE5 D;  1TR5 A;  4NMZ A;  3SHL A;  1WD1 A;  3BDL A;  3HEJ A;  1EEI D;  3IFD A;  3NTI A;  3HGB A;  4HSV A;  4G7H C;  2JXM B;  3C3L A;  2EYJ A;  3V96 A;  5JOB A;  2R3Z A;  1ILP A;  1MD2 D;  3SVM A;  1I4G A;  3LWE A;  3ND8 A;  1A15 A;  2N88 A;  1HQR D;  2EY2 A;  2QDB A;  4FP5 D;  1Y69 U;  1Q90 A;  1D5X C;  1ZYR D;  1TII D;  2EY5 A;  4CJ0 B;  2Z4H A;  5CV8 A;  4DU9 A;  2ZT9 C;  1PTO D;  4C1N I;  1GUT A;  1LLR D;  1NUC A;  4IUN A;  1HTP A;  4MHE A;  4HTH A;  1U9R A;  3T16 A;  2F0N A;  4JBW A;  2RBM A;  1EY7 A;  3S9W A;  1STE A;  3SXH A;  2A6H D;  1EU4 A;  3PO2 B;  2X6L A;  3S2D B;  3KBX A;  4HED A;  4DA2 A;  3CRK C;  4XIG S;  5EKK A;  2D9U A;  3IKJ A;  3ERO A;  5ELB A;  1WTX A;  4U67 3;  1MSH A;  5K36 H;  3OWF A;  4J1M A;  5ELD A;  1I4P A;  1EFI D;  2NZ1 D;  3DWP A;  2F0U A;  2IWH A;  1CT1 D;  3I4M B;  4OHJ A;  5EPL A;  3MHB A;  1UUP A;  1ICW A;  1ENF A;  3T51 B;  5M5W B;  1H9K A;  1FD7 D;  4M8A A;  1CHQ D;  2C9O A;  1U4M A;  4O42 A;  5I2X A;  5JEA G;  4L63 B;  3PIP 3;  2BOS A;  2F0K A;  2BDO A;  1RTO A;  4A3I B;  5IGG A;  3BVG A;  2H4O A;  3L3O C;  1SMY C;  1AFP A;  1VMC A;  1JCK B;  1Y1V B;  5C5M A;  2FIN B;  5DEH A;  3PUX A;  2AWO A;  1EQT A;  3K5M A;  2V4D A;  1VF7 A;  2IX3 A;  4FF4 A;  1E2Z A;  5EQ0 A;  2XWB B;  1MGS A;  4MN3 A;  2E2I B;  2F3V A;  2QCP X;  4BBS B;  2RVL A;  2F0V A;  1WTW A;  1BCP C;  3QOJ A;  1LT6 D;  1M8A A;  3N52 A;  4XYQ A;  1ENC A;  5C3X A;  2OXP A;  3R2T A;  3DHQ A;  1UNS A;  1JOK A;  5DM6 3;  2B2U A;  1D6E C;  4ZKB B;  1QJO A;  3D3R A;  2B2Y A;  3A56 A;  1TVX A;  3P75 A;  4A3D B;  2KEC A;  4FXD A;  3ZYY X;  5CBA E;  1GHK A;  4KI0 A;  1DOL A;  2ZXR A;  4ME5 A;  1CQF A;  1PFM A;  3HOX B;  2XRS D;  5K36 G;  3NWT A;  1X3P A;  4WOR A;  2J4X A;  1DXM A;  2F0L A;  3PV0 A;  1CA5 A;  1I4Q A;  3A8J E;  3VR3 A;  3DUZ A;  4HCS A;  3QO2 A;  4RGM A;  2LY7 A;  2PYK A;  4IUV A;  4ZRZ A;  4BA2 I;  4XT1 B;  2FMC A;  4XQQ A;  4F87 A;  3C1E A;  2OF1 A;  1ZEQ X;  1Q1E A;  1B9M A;  2WKC A;  3URY A;  4QMG A;  2RSN A;  3BDO A;  2EXZ A;  2YYZ A;  2VUM B;  3PUZ A;  2JP1 A;  3S14 B;  2KVM A;  4IFD J;  1LTA D;  3IAY A;  1HPC A;  4C1N K;  5FO7 B;  2E2D C;  2NTS A;  4CKC A;  4CHT B;  1SMY D;  4XDX A;  2L0C A;  1OXV A;  4LMQ D;  5D14 A;  4CKE A;  1SFO B;  2E75 C;  2NWG A;  1UAP A;  1HRJ A;  2E2H B;  4RWS C;  2FMM A;  3JAM E;  1STG A;  1A3T A;  2HUG A;  3OMC A;  3D31 A;  1SXT A;  2QF7 A;  1JWU D;  3GTG B;  3NBI A;  2FFK B;  3HOV B;  3I73 A;  1ENA A;  4G7Z C;  4A3G B;  1ET6 A;  2BA1 A;  1RJT A;  4CKB A;  3KLS A;  3R8B A;  1VDZ A;  1EIG A;  5F2D A;  1OXS C;  1IKM A;  1I6V C;  4EGV A;  5IOD A;  4IFD H;  1HQM C;  1YNJ D;  2R61 A;  1FNW A;  3BDC A;  3X3M A;  1MI2 A;  1O7Y A;  2G9D A;  1E0B A;  1HTL D;  2KJX A;  1B1Z A;  1HA6 A;  2BDN A;  5D3I B;  2TMP A;  2B2W A;  2F0M A;  2E76 C;  1SEB D;  3H94 A;  5KGU A;  4K5V A;  5E4X A;  4ZUJ A;  3I4L A;  1SNO A;  2KEE A;  5BN4 A;  5FLX L;  4C3I B;  2K03 A;  1PRT F;  1BNZ A;  1NSN S;  5C3E B;  5FOB B;  3RD4 A;  1TU2 B;  1GXD C;  3HG9 A;  3MFY A;  5M3M B;  2JEB I;  1T5E A;  1U4P A;  5LHY 1;  4ABN A;  2RSO A;  1Y8N B;  2Q8R E;  2B2T C;  3SK5 A;  4C3I G;  4ZKC B;  1SYC A;  4IUU A;  1DYQ A;  3DWA A;  4KY7 A;  3BYY B;  4PNY A;  4ODG A;  2AWN A;  4NDX A;  1EIH A;  5CBE E;  1Q3L A;  5J22 A;  4R8N A;  3OMG A;  1II3 A;  1EQV A;  1STB A;  2BE5 C;  2F1M A;  2SNS A;  3J80 L;  4C56 C;  3VR6 A;  3BYT B;  5M9O A;  5JJZ A;  5FLX E;  4CJ2 C;  4B9W A;  2L11 A;  5ISR A;  2EYP A;  1Q1B A;  2Q8I B;  3PIO 3;  2NVT B;  4OGQ C;  2RDH A;  4TQU S;  4EQP A;  3GTJ B;  3A54 A;  2K32 A;  4HR7 B;  4R8I A;  1EYA A;  4RKL A;  4HMI A;  3VR2 A;  1DJR D;  1G8Z D;  3U9S A;  1QCB D;  5E4W C;  3SDZ A;  2F0W A;  2XNA C;  3J81 L;  1JWS D;  2XVS A;  2F0O A;  3VYR A;  2K01 A;  1DOK A;  4IFD G;  4QF4 A;  1XXG A;  1O7L A;  4KJO A;  4H44 C;  2JSO A;  1W6J A;  3K5L A;  5ELC A;  2HQE A;  4K5W A;  3FMC A;  2HDL A;  4ILW A;  4ULL A;  2HCC A;  2R92 B;  2B2V C;  3TDQ A;  4IUT A;  1CM9 A;  4CGY B;  4WFN 3;  3E0J A;  2A73 B;  1WTQ A;  2NTT A;  4NW2 A;  2PZW A;  1V1P A;  2MGS A;  4H0L C;  5KND A;  1JIC A;  1GUN A;  3K5N A;  1QWY A;  5C0X I;  1OXT A;  1HCZ A;  2L1B A;  1Z47 A;  4B08 A;  5KRU A;  4Q5V A;  1LTI D;  2O5I C;  2RQX A;  5J39 A;  1Y8O B;  4IZ8 A;  5EKL A;  3J81 E;  2B2U C;  2KOL A;  2A74 C;  4F8M A;  1QE6 A;  3K5O A;  1EY5 A;  2RDG A;  3HS0 C;  1EWC A;  4LK1 C;  4EQN A;  1VMP A;  1SBB B;  1U4L A;  4A93 B;  3P7J A;  3A55 A;  1XTC D;  4BWG B;  1TS2 A;  4DNT B;  4QCL A;  4ZYS A;  1EZ8 A;  1KNA A;  1NCV A;  1LAC A;  5HGT A;  3OSO A;  1WTR A;  2XN9 C;  2VNU D;  2K6A A;  3HZX A;  2EOT A;  1CI3 M;  4KY6 A;  2DY8 A;  1S5F D;  3DEO A;  3VR4 A;  4CJ1 B;  3I91 A;  1M4V A;  1R9T B;  5D65 A;  3MA2 B;  4K14 A;  2K05 A;  1H9S B;  2AQ1 B;  4NKL A;  1D2B A;  1V43 A;  3MEH A;  2I07 B;  1SYE A;  5EPK A;  5I6Y A;  3ND9 A;  1Z6H A;  1JOR A;  2F0H A;  1K8M A;  1BQQ T;  3R2I A;  1S5E D;  1WTV A;  1F2Z A;  3J7Y W;  3BS1 A;  3K7A B;  2XRQ D;  2JA8 B;  2WKD A;  2WAC A;  2B2T A;  1ROD A;  1BCP F;  4RGN A;  2MJ8 A;  4KKT A;  3I4N B;  2DN8 A;  2K1B A;  2CQA A;  4G57 A;  2F0Q A;  4EQO A;  2JE6 I;  1PRT D;  1STH A;  5IGC A;  3GTK B;  1SE2 A;  2MP1 A;  3K58 A;  2F03 A;  1D1K A;  4AYB B;  2R93 B;  2KQ3 A;  1EYC A;  3OPO A;  2IPK D;  1LV9 A;  3VYU A;  4KJN A;  3TP7 A;  4EVO A;  4OIJ A;  4XTC S;  5ELE A;  2R7Z B;  1EY0 A;  3C1F A;  2NN6 H;  1QNK A;  1SE3 A;  2B2W C;  4HCE A;  3TZU A;  3WDN A;  2JEA I;  5KYI A;  3ITP A;  1DCZ A;  1S4Z A;  1RF2 D;  4FNF A;  2TSS A;  4KMU C;  1BDO A;  1KAA A;  2F0E A;  1H9M A;  3SK4 A;  3QJY A;  2EPB A;  4HMJ A;  3H6M A;  1D1I A;  4KV6 A;  2A68 D;  4HAE A;  2GA4 B;  1QB5 D;  2B2V A;  3SEB A;  4K2L A;  5C0X J;  5CR3 A;  2PW7 A;  4QUC A;  2PPB C;  5I2Y A;  3A8K E;  2K04 A;  2IX0 A;  2K33 A;  5I9P A;  4PV1 C;  4IUQ A;  1PZJ D;  3ERQ A;  2IX1 A;  1B4O A;  1W6K A;  4Q0F A;  2JA6 B;  1NAP A;  2BA0 A;  4ZAI A;  2JA5 B;  2VXW A;  5EBD A;  1YNJ C;  3J7A V;  3HOW B;  3E6Z X;  1I4R A;  4OL7 A;  1SE4 A;  5DM7 3;  1XWE A;  3N6R A;  4FXK C;  1SJE D;  3DEP A;  1AZQ A;  1HXY D;  2OT2 A;  1TS4 A;  3MXG A;  3TBI B;  5JVH 3;  5G3L D;  1XYI A;  2BCO A;  3BG3 A;  4J6H A;  1EOT A;  4RKB A;  2WV6 D;  1FGB D;  1C4Q A;  1A3U A;  4DK0 A;  3NP8 A;  4KN7 C;  1PZI D;  1K8O A;  1BCP B;  2NB0 A;  5ELF A;  3S17 B;  1TY0 A;  2K5Q A;  1QNU A;  3H09 A;  5HUR A;  2G9H D;  3LX0 A;  1IW7 C;  2X69 A;  1KLU D;  1KNE A;  2NN6 G;  3M85 A;  1TT2 A;  1RTN A;  3KF8 A;  1HFG A;  4I65 A;  4BA1 I;  5EKI A;  5CV7 A;  3S16 B;  1S5D D;  5C44 B;  3NE5 B;  1LTR D;  2Q8T A;  2AQ2 B;  4G4K A;  1KDB A;  4U68 A;  2DY7 A;  1A6X A;  5FKA C;  1TWG B;  3P1H A;  1F9Q A;  1Y8P B;  1IHZ A;  1KDA A;  3NQI A;  2A69 D;  3NWS A;  4OO1 H;  1BUV T;  2EE1 A;  1SNM A;  2O4X A;  2Z8L A;  4RGT A;  3F2U A;  2SOB A;  1BBX C;  2LFN A;  2NBF A;  3MTS A;  1G29 1;  2NVY B;  3GD7 A;  4PMC A;  3TSS A;  2O5J C;  1RHP A;  2ZXO A;  5A2Q L;  1GOZ A;  2N55 A;  1JE4 A;  3FEW X;  1A2T A;  2KED A;  5C4Z A;  1T5X D;  2F0G A;  3KK7 A;  2QEJ C;  3NTH A;  1BO0 A;  3AU7 A;  3MXU A;  2EYH A;  1SYD A;  2EJG C;  1NR4 A;  1NR2 A;  1RCV D;  4H7B A;  3TN2 A;  3H3V C;  4HN7 A;  4RA8 A;  1PYW D;  5IGB A;  1E2W A;  1J9O A;  4P2C B;  3RZO B;  2VB2 X;  1F77 A;  4X3U A;  1PTO F;  1PXU A;  3Q6S A;  3EFX D;  3AMU A;  2D2C C;  2Z1C A;  1AZP A;  3KUP A;  3RZD B;  1VCI A;  1IW7 D;  2L9H A;  4A3K B;  4KTA A;  4Y7N B;  1LTG D;  2KCN A;  4DF7 A;  3PUV A;  1V8Q A;  4TSS A;  2EYF A;  3FVQ A;  2Z4I A;  1C48 A;  4G7O C;  5EPJ A;  5CC4 A;  3VA5 A;  2EY6 A;  1TWH B;  1DD2 A;  2IL8 A;  2B39 A;  5A35 A;  1GUS A;  1TQO A;  4XXE A;  5CGK A;  1TWC B;  1PTO H;  5C4X B;  1DOM A;  2ZXP A;  3IFT A;  2IJ0 A;  3DMU A;  2WAQ B;  2L4N A;  4IQZ A;  3T4A C;  1PZK D;  2XIW A;  2FJ2 A;  4A3J B;  2E74 C;  1LTS D;  4OO1 G;  4FO2 A;  1EY6 A;  1JR0 D;  4TKO B;  1JOO A;  2EJM A;  3M7N A;  5I9O A;  4PQX A;  3HOZ B;  2C5C A;  3I70 A;  4BY7 B;  5IGF A;  4XYO A;  1TWA B;  4DFA A;  3GP7 A;  1WVL A;  1QIL A;  3D6W A;  2Y0S B;  2I46 A;  1EL0 A;  2L12 A;  5E1F A;  1XX8 A;  3S15 B;  1OXU A;  2ICI A;  3I8Z A;  4DXF A;  3CHB D;  5CYU A;  1CA6 A;  4XT3 B;  1SAP A;  1Z7T A;  5CV5 A;  3IL8 A;  3LWU A;  2CHB D;  3QG1 A;  4C2M B;  4X3K A;  4FF1 A;  1SNC A;  5C4H A;  3Q23 A;  3BVM A;  3MWY W;  3J80 E;  2J7Z A;  3A8I E;  3U9O A;  4M1U B;  3OIQ A;  2WII B;  4QUF A;  4A3M B;  2H1E A;  4DXG A;  2K5W A;  1SNQ A;  1D5Z C;  1B2T A;  1CQV A;  1PRT C;  3LNN A;  3T53 B;  1F9S A;  2YU9 B;  3FPU B;  3DM1 A;  3GTP B;  3M4O B;  1SYB A;  5JEA J;  1BF4 A;  4F7X A;  3S1M B;  2SNM A;  3G7L A;  1BR9 A;  3GTQ B;  1PFB A;  4MIU A;  2K5D A;  1PTO B;  3NK9 A;  4OIK A;  1H9R A;  1J8I A;  4PMW A;  3MXP A;  2NUC A;  2PZU A;  5KNB A;  3FPP A;  4TRD A;  1B53 A;  4WRD A;  1MBY A;  3VA7 A;  5C3W A;  5COR A;  2A5H A;  4C3J B;  1TWF B;  3M4Y A;  2SDF A;  1EZ6 A;  3C46 A;  3HKZ B;  1B44 D;  1LAB A;  3H0G B;  3OIP A;  2F4I A;  1BXT A;  2K28 A;  4KHV A;  1CK1 A;  5FO8 B;  2PCF B;  3QWN A;  3NQT A;  2EZV A;  2EVB A;  3S2H B;  4C3J G;  3ONA B;  3L9A X;  2A68 C;  4JK1 C;  1CTM A;  3OHX C;  1ESF A;  2KA7 A;  1SYF A;  1S5B D;  1ILQ A;  4ZUI A;  4LJZ C;  1RDP D;  2M00 A;  1G2S A;  1ZKO A;  3UI2 A;  4K8J A;  2IW3 A;  4NP5 A;  5DAU A;  1KDC A;  4K2K A;  4OO1 I;  1LTT D;  3S1Q B;  2PW5 A;  2CW0 C;  4IN3 A;  2PZT A;  1R4P B;  5LL6 X;  4DGZ A;  1G6Z A;  2CVR A;  1I4X A;  2M9V A;  4QB4 A;  4BBR B;  3D4D A;  1ET9 A;  5EBC A;  2R6G A;  5KNC A;  2RA4 A;  3TP6 A;  2F0D A;  1Q12 A;  2F3W A;  1D5M C;  3FDT A;  3GV3 A;  4FVM A;  4KN4 C;  2HCI A;  1ML0 D;  3Q22 A;  4IFD I;  3G6J B;  3GV6 A;  1DON A;  2F0P A;  2F0F A;  2VB3 X;  1TKW B;  5BN3 A;  3Q24 A;  4GZY C;  4B9X A;  1HFN A;  4E6I A;  4BY1 B;  3A7L A;  5JAV A;  2K7V A;  3M7G A;  2AQ3 B;  3S1R B;  3R93 A;  1DM0 B;  5AFW A;  1PLF A;  2EY1 A;  3M3Y B;  1X3Q A;  3GTO B;  1A2U A;  5TSS A;  2PMZ B;  1WCM B;  3EQL C;  1RD9 D;  3QIA A;  4A3B B;  4KY5 A;  1EYD A;  5M3F B;  1F2L A;  5E3F A;  2F0J A;  3HRZ C;  3W3A A;  4DK1 A;  2E2J B;  4C3H B;  1SJH D;  3MAQ A;  3J7A F;  4KHZ A;  1EU3 A;  1S5C D;  1LO5 D;  1GJX A;  2A69 C;  4FF2 A;  3TZD A;  1TS3 A;  4A3F B;  1PDQ A;  2LMC B;  2HDM A;  1HHV A;  1CHP D;  4V19 0;  4C3H G;  1LTB D;  3SK6 A;  3HOY B;  4KD4 A;  1LT3 D;  3PUW A;  5C6A A;  1YNN C;  3MVV A;  5IGD A;  4BS9 A;  1EEF D;  2NVQ B;  2ENB A;  3OWE B;  5DNF A;  3VYS A;  5CMD A;  1CZW A;  5KEE A;  5EJW A;  3X3N A;  1KLG D;  1ESR A;  2F0S A;  5J1Z A;  3WOF A;  5M5Y B;  2QIL A;  2IT1 A;  2CW0 D;  1CZG A;  3D6C A;  1I50 B;  4KKU A;  5BN5 A;  1RKN A;  5C5L A;  3OW7 A;  2MHV A;  2XSC A;  4RGO S;  3K0Y A;  3KLR A;  3CKI B;  4FYD A;  2F0T A;  3EVQ A;  5CV6 A;  5C0X H;  2KCC A;  3EJI A;  1DZ1 A;  1H9S A;  2A6E C;  3K6O A;  3T56 B;  4V0B A;  1F2M A;  4H13 C;  1R4Q B;  3K57 A;  1TS5 A;  4L6T B;  2PNR C;  5NUC A;  2SEB D;  3WOE A;  2JYO A;  1Q8I A;  2LS0 1;  2AUK A;  1WTP A;  3SR1 A;  4CBV A;  4K8I A;  1STN A;  2L5T A;  3EA6 A;  4X3S A;  2B63 B;  3JAM L;  1UEA B;  5CV4 A;  4XQJ A;  4DAY A;  1FNU A;  1GUG A;  5D3D A;  2B8F A;  2J0T D;  3MFG A;  2WB1 B;  3NSW A;  3W2D A;  4WJW A;  2JA7 B;  4FF3 A;  1SNP A;  1AP0 A;  3D4R A;  3KLS X;  1C8C A;  2F0I A;  3TP8 A;  3RLF A;  5M5X B;  3BVZ A;  5FO9 B;  4DAP A;  1GUW A;  5T1G A;  5JVG 3;  4KKS A;  3DWQ A;  3O13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...