3EBEA

Crystal structure of xenopus laevis replication initiation factor mcm10 internal domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
179
structure length
172
Chain Sequence
QYHVEKFSGLRIRKPRVSSSEMERKMNGRKLIRLAQLQNKIATEKLEEEDWVTFGVIVKKITPTFSIWRLNDLKDLDKYISLFLFGDVHKEHWKTDQGTVIGLLNANPMKPKEGTDEVCLSVDNPQKVLLMGDAVDLGTCKARKKNGDPCTQMVNLNDCEYCQYHVQAQYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein MCM10 homolog
publication title Structural basis for DNA binding by replication initiator mcm10.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Replication
total genus 43
structure length 172
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09329 zf-primase Primase zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ebeA00
4IPDA 1J5EQ 4JBKA 1PH4A 4A3GG 1XMQQ 4DR7L 1NMFA 2OWOA 5J3BA 3K7UC 4NXNQ 3H3VH 3PV0A 3CC7A 4QIWE 3STBC 3J80c 3G48A 4DK6C 5M3MH 4UP7A 5IWAL 1VS0A 4DUYL 1PA6A 4A3GH 3F2CA 2CKZB 2I5HA 2D62A 4QY7A 2UUCL 1S72A 2HQLA 3PO2G 2OTJA 1PYSB 5FJ8G 1HJPA 1OXUA 1X3GA 4JI5L 3G71A 2VY3A 3PF4A 3NEMA 3I7FA 4BY1G 1XPOA 1LYLA 4RG1A 5HY6A 1HZCA 4OWXB 1I94Q 1YVCA 3PIOA 1UE5A 4A3FG 3M3YH 2CWAA 1U0LA 2UUAL 3RLOA 4A3DG 4L5QA 1WCMG 2YTYA 5BR8Q 2AWNA 2ID0A 2MNAA 4UY8C 3GTLH 1I3QH 4RMFA 3M85A 1CKOA 1IYJB 3PO3G 1VQHA 4ALPA 1I50H 1XNQL 1Y1VH 3CQZH 4A3DH 4A76A 4KHZA 1MJCA 3U58A 1HNZQ 4NXML 1HNWQ 2NZHA 2Z6KA 4B3SL 4EX5A 2NVXH 4GN3B 1PYBA 2B63H 1BVSA 1N34L 1A8VA 3HOVH 4YCWA 5EAYA 4A4IA 5IP7H 1PH6A 4KHPQ 3UE0A 4JYAQ 2R93H 3GTOH 4DR2Q 4JI7Q 3GTQH 5GAEC 1M90C 4IPHA 2DGYA 2CWPA 2UUBL 4GNXB 1SE8A 4AQYQ 2VNUD 2K5NA 2VQFQ 4C3IH 4UP9A 1PFSA 2UU9Q 4GS3A 4BXXG 4YHHQ 2A1AA 1OXXK 1T9HA 3M9BA 4JI6L 2K5VA 1NTGA 3TEHB 2JJQA 1HH2P 1IBLL 1N33L 4BXXH 1VQ5A 5GROA 3I4MH 2LXJA 5JEAJ 3A5UA 2ZTCA 1TWFH 1QZHA 4Y52H 4A3JG 2KCMA 3K80C 4DV6Q 1MIUA 1Y14B 2HIXA 1KIXA 5LMUQ 4GKJQ 4DV2Q 4IJLA 4NPSA 1YITA 4P71A 3CC2A 4A3JH 4LFCQ 2E8GA 5FLMH 1EFWA 2ZTEA 1HZBA 3D0FA 2GN5A 4JCVE 4C3JH 3T1HL 1IBKL 1X65A 2VQEL 3M4OH 1NMGA 1D7QA 1OTCA 4XTCS 3S16H 2IY5B 3CMEA 3Q8DA 3BU2A 1QZGA 4DR4Q 4OO1I 4DR1Q 4LF6L 4LFAQ 1U5KA 1VQAA 4UPAA 2E2HH 4DPGA 4H02A 5AJ3L 1X9NA 2ZJRA 4POFA 2JA7H 4TQUS 4OO1G 3U50C 2I5LX 1PH3A 3ICEA 3UDXA 2F4VQ 1KAWA 4BA1I 4LF7Q 2VUMG 4A3LG 4DR6L 5C44H 5C0XJ 4IPGA 2K50A 3L0OA 1SFOH 3KF6B 1YHAA 4OONA 5ELNA 1OXTA 3IRBA 5JEAG 2IX1A 2VUMH 4PG3A 3KJOA 2QA4A 3HKZE 1Z47A 1XMOL 1YNXA 1X55A 1RIPA 5LMNQ 1P8LA 5GADC 4DV3L 3CMAA 3CCVA 2RHSB 3S2DH 3HOXG 2K14A 1K0RA 4A3CH 4UP8A 4BBSG 2EIFA 5JJIA 3OTOQ 1GD7A 2YTXA 3PUYA 2AWOA 1LUZA 1FJGL 4A93G 4LWCA 2B29A 2UXCL 3NBHB 1G6PA 2MFIA 4R4TA 4X64L 4DV0Q 3JAMc 2VL6A 1KRSA 1Q12A 4LUOA 3H3VI 2R92H 1C0AA 2ZM6L 1KHIA 3G4SA 4DK3C 1SR3A 4PZ6A 2YU9H 1S40A 4GN5A 1VQLA 1WFQA 4AH6A 4PZ7A 4DUZQ 4LF5L 3FHWA 1FL0A 1Q81C 4LW1A 2HT1A 1N32L 5C0XG 2UXBL 3PIPA 4X66L 1VQGA 3L2PA 4JG2A 1QVGA 2KCTA 3S1QH 2IHFA 4IPCA 4BBRG 2A8VA 2NVTH 4KI0A 1YHBA 3T1YL 2MO1A 3U4ZA 4LF9L 3UE1A 2Z6KC 4BBRH 3D31A 4NXMQ 2N78A 3HOZG 2E5LL 4JV5Q 2I5MX 2Q2IA 4JI8Q 4B3SQ 4APVA 1JB7A 3H0GG 2OTLA 3PO2H 1I5FA 5FJ8H 1HNXQ 1K3RA 2YV5A 3S17H 4JI4Q 2BA0A 3J7ZC 4BY1H 3KF6A 4K0KQ 1E3PA 2K75A 5M5YH 4HJ5A 4C2MH 2AKWB 1V1QA 5GAGC 3H0GH 1HZAA 4X62L 2R7DA 2MO0A 4A3FH 2UUBQ 5FLXc 4X65L 3KDFA 2XGTA 3TREA 1IBML 5JJLA 1YHQA 1VQCA 4B3RL 1WCMH 3BZCA 3PUWA 2JA9A 1VQBA 4OX9L 1VQFA 4OXPA 2HHHL 3F2BA 3CCEA 4FDBA 1IL2A 1CUKA 1J5EL 3PO3H 2CFMA 1GO3E 4PMWA 1IBLQ 4A3MG 3PF5A 2UXDQ 3E0EA 3UDGA 1XJVA 1CSPA 4NXNL 3PCOB 1XTDA 5HGQA 3S1MH 1PHJA 2FXQA 4DR5Q 4YCVA 1TWGH 1VQEA 1N36Q 4DV4Q 3J80i 4A3IG 3FKIG 3ER0A 1ASZA 4KLKA 4JBMA 5C4XG 1A62A 1C7YA 5IYBG 4MNOA 4P72A 2JA6G 3KFUA 2VS1A 4LF4Q 4LUZA 2K4KA 2LSSA 3HOYG 2GVBA 3GO5A 3CCSA 1I6HH 4DV7L 3KYHC 3BJUA 5IYBH 4A3EG 1GM5A 2JA6H 2B3GA 1J6QA 4QL5A 2VQEQ 2E2IH 3HOUG 1D8LA 3BZKA 1PVOA 1TXYA 1K8GA 2PI2E 2H5XA 1VQ6A 3PUXA 1YIJA 1QVCA 4LF6Q 2JA5G 2R7FA 1CSQA 1X6OA 1NE3A 5IP9G 4R4CA 5BR8L 1YJNA 1Q7YC 1V43A 1E24A 4ME3A 2WAQG 4AYBG 3DLLA 2K52A 1YEZA 2Y0SG 2YTVA 3MEFA 3RR5A 4IFDJ 2AHOB 1HNZL 4JBJA 4GOPC 1L2FA 3TQYA 4GKKQ 1KQSA 1W3SA 1AE3A 2AMCB 2OCEA 4DKAC 4LNQA 3AQQA 4DV5Q 3FP9A 3KLWA 1Q82C 3CAMA 1K9MC 1MKHA 1OXSC 2MQHA 3K7AH 4POGA 4IOAA 2ALYB 2V1CC 4DR2L 3E9HA 4L5TA 3CXCA 3AFPA 3A0JA 3RZDH 3KF8B 1JJ2A 4Y7NH 3J81c 1YZ6A 4GLAC 4AQYL 1PH8A 1HR0Q 3RLNA 1VQMA 1XNRL 4YY3Q 2VQFL 3K81C 1Y1WG 2BH8A 4YHHL 4R4IA 2EXDA 3CPWA 2RHQB 1Q46A 4MTNA 1IXRA 5ELOA 3CCQA 1FJGQ 3KJPA 3AYHB 4DV1L 1Y1WH 1SROA 1N9WA 4IOCA 4GOPA 1QVFA 4A3LH 4JI2Q 3CCUA 1CKNA 1E1TA 4J15A 1H95A 5C4JH 1Q1EA 2WB1G 3AFQA 3KDFB 4NB3A 2NVQH 2QEXA 4O0AA 1X3EA 5GQOA 2CCZA 2WFWA 4LUVA 4XIGS 3J7A5 1K83H 4DV6L 1PH5A 3M7NA 1VQOA 5IYDH 3G6EA 4DR3L 4GKJL 5K36G 5LMUL 5IYCG 4DR6Q 3U4VA 2ZJPA 2JEAI 4IFDG 1VQPA 3I4OA 1YJ9A 1XPUA 4X6AH 3ULJA 1W2BA 2PI2A 4LF8L 4DR7Q 2K5HA 4BY7G 2UXBQ 1WI5A 3CD6A 4X66Q 5IYCH 3OW2A 3HOXH 3DM3A 5C3EG 1B7YB 1BKBA 2Q2UA 4JI0L 4B3TL 3EIVA 1UWVA 5IWAQ 4DUYQ 4BBSH 4A3BG 2WAQE 4AYBE 1SMXA 2Y0SE 4DR4L 4QQBX 1B70B 4DR1L 2UUCQ 1JE5A 4A93H 2I0QA 1E22A 1SRUA 2NZOA 5C3EH 3T1YQ 4B3ML 1V9PA 4JI5Q 2R6GA 4A3BH 4DAMA 5C0XI 1VQNA 3VDYA 3L7ZC 2E5LQ 2JA8G 3TS0A 1UEBA 4O2DA 1A63A 4R1JA 4YCUA 2C35B 4DAYB 2UUAQ 1R9TH 1EQRA 1Q1BA 1Z9FA 3CW2C 3W5OA 5IYDG 3AEVA 4A3KG 3CCLA 3ULLA 1JJCB 1FGUA 1XNQQ 4B3RQ 5LMNL 4JI3L 2ES2A 3SGIA 1FVIA 1VQ4A 2N3SA 4OX9Q 1HZ9A 2HHHQ 3UDFA 2VW9A 4HJ9A 2ZJQA 2QGQA 5M3MG 2WB1E 3CCRA 1E7ZA 3OTOL 3A5ZB 1N34Q 1P16A 3HOZH 4JI1L 1EUJA 2LXKA 4P74A 4EQ5A 3EN2A 4OWTB 1KXLA 5GAHC 1TWCH 4DV0L 1JJGA 1Q8KA 2YYZA 3TRZA 3RZOH 3CF5A 2E2JH 1YBYA 3JAMi 3LGJA 2R7ZG 1EOVA 1RL2A 5H1SE 3S24A 3NELA 1YJWA 1E1OA 4HJAA 1Q86C 1M1KC 2F3IA 3A74A 3NENA 1GVPA 4IJHA 4R4OA 5LMNW 4JI6Q 4LFBL 3F2DA 3MXNB 4DUZL 4DV7Q 4R4QA 3S1RH 4GOPB 1XMQL 1N33Q 2R7ZH 1JT8A 1EWIA 1CKNB 1CKMA 3OYYA 1EIFA 4P73A 4WJ4A 3CCMA 2GVAA 1G51A 1TWHH 1Y1VG 4A3MH 1BBUA 4BA2I 1DGSA 3J81j 1K73C 2BH2A 2HIVA 1PH7A 4A75A 1X54A 2IX0A 2Q2TA 2EQSA 2B63G 4A3IH 3HOVG 3FKIH 1C9OA 5C4XH 3B6YA 3RNUA 5IP7G 4JV5L 1VQJA 4HIMA 3GTJH 2R93G 3T1HQ 1IBKQ 1I94L 4JI8L 3WWVA 3JC66 4AIMA 3GD7A 2JE6I 1HNXL 1VQ7A 5E7NA 1OXVA 1SN8A 3S2HH 3HOYH 3I2ZA 4JI4L 1QUQB 4K0KL 1JMCA 4A3EH 4HIDA 3HOUH 2A19A 1KRTA 3PUZA 5AJ3Q 2JQOA 1KL9A 1PV4A 4L5RC 1XNRQ 1AH9A 1O7IA 2KBNA 2JA5H 3HKZG 3I4MG 1HNWL 3I55A 5IP9H 1BBWA 2PQAB 3PUVA 2KHIA 3RLFA 4IO9A 4GLXA 1NBWA 4JBWA 2KENA 4DV1Q 2RF4A 3ZJYC 2UXDL 1A0IA 3GTMH 1PH1A 3TS2A 3I56A 5DLQE 3STBD 4KHPL 1K8AC 3ERSX 1L1OB 3HKSA 2NN6I 2OQ0A 3HOWG 3S1NH 4JYAL 1G291 3HFZB 4DR5L 1XMOQ 4JI7L 5JJKA 3K8AA 1PH2A 1N36L 3CCJA 5FLMG 4DV4L 3M4PA 4HIOA 4DR3Q 2NN6G 4DV3Q 4HIKA 1VCIA 4C3HH 2UU9L 3GTGH 3HOWH 4TVAB 4LF4L 3UDIA 4JOIC 4LF8Q 1SLJA 1KC8C 2UXCQ 4JI0Q 4JC0A 5IY0A 5IE8A 4B3TQ 1VQDA 4X64Q 4OWWB 2JA7G 2CQOA 1AE2A 2OQKA 4L5SA 1MJEA 2ZM6Q 3GTKH 4IFDI 5M5XH 1X56A 2IT1A 1KD1C 5C44G 4GNXC 1YI2A 4B3MQ 4DV2L 1VQKA 1UE1A 3KOJA 1UE6A 1VQIA 3H15A 4LFCL 1WYDA 3F1ZA 4LF5Q 3M4QA 4QGUA 1VQ8A 1EIYB 1S3OA 1N32Q 2JEBI 4JOIA 4YWMA 4GN4B 4GKKL 2L15A 2WP8J 3EBEA 1N8RC 5IT9c 3I4NG 3F8TA 4DV5L 4BY7H 2XTIA 1L1OC 1GKHA 3PGZA 3W1BA 3CPFA 2IHEA 1QUQA 3GDEA 4LFAL 1LTLA 1IZ6A 1UE7A 4HJ7A 2KHJA 4A3CG 2PNHA 5M3FG 4HJ8A 3RN5A 3I4NH 1HR0L 4LF9Q 4JI3Q 3CP0A 4YWKA 4YY3L 4QJFA 4GNXA 3J81i 2F4VL 1TWAH 1X3FA 2JK8A 2ZTDA 2F52A 2Q2HA 4MZ9A 1EQQA 1WOCA 4LF7L 3E9IA 2NVYH 5M3FH 2DUDA 1NJIC 1VQ9A 2N8NA 2PQAA 2R92G 2BA1A 2Z0SA 4YWLA 4JI1Q 3GTPH 2JA8H 4P75A 4WJ3M 2RCNA 3CC4A 3W1GA 4DNIA 2D0OA 5M5WH 1EYGA 4JI2L 1B8AA 1L0WA 4X62Q 4GLVB 3S15H 2ASBA 2ATWA 2D0PA 2PMZE 1L1OA 4X65Q 3RN2A 1IBMQ 1PH9A 4PZ8A 1LM0A 3S14H 1NY4A 3K0XA 1WJJA 2VZAA 1ASYA 3ULPA 2N49A 3PSIA 1HR0W 1XPRA 4A3KH 4LFBQ
chains in the Genus database with same CATH superfamily
5KGUA 1J5EQ 2EJFC 1GHKA 5FKAC 4UP7A 1PA6A 4A3GH 2CKZB 2UUCL 1J9OA 2HQLA 3PO2G 1PYSB 2RQXA 1U9RA 5FJ8G 3G71A 2VY3A 3I7FA 3DUZA 5IGFA 1HZCA 4EQOA 1A15A 3PIOA 2PCFB 4A3FG 3M3YH 4KJOA 4L5QA 1RHPA 1WCMG 2YTYA 4IALA 5FOBB 2ID0A 2A6EC 2PYKA 5COYA 3M85A 4A3KB 2L5TA 3Q22A 4A3DH 1MJCA 1D5XC 1TVXA 2NZHA 1ZXTA 3SXHA 2FJ2A 2Z6KA 4A3GB 1X3QA 4DFAA 3QO2A 1N34L 4B9XA 1BNZA 4YCWA 3MEHA 5EAYA 4KHPQ 3ITPA 3GTOH 4JI7Q 4DF7A 5GAEC 1B53A 1M90C 4IPHA 2VNUD 3T53B 2K5NA 5F2DA 4C3IH 4UP9A 2VQFQ 2UU9Q 4GS3A 5BN4A 1B3QA 4YHHQ 4JI6L 1V1PB 3M3YB 3T16A 1BR9A 2BDOA 1AW7A 1O7ZA 2A73B 2WACA 1QZHA 4A3JG 2NUCA 4A3DB 2HIXA 5LMUQ 2OEOA 1EZ6A 2E75C 5D65A 3D4RA 3MC0B 4NPSA 1U4RA 4B9WA 3CC2A 3W3AA 5ELCA 3ND8A 1HZBA 3M4OH 2SEBD 1X65A 1NMGA 5EQ0A 3KLRA 4XTCS 5J39A 3BU2A 4OO1I 4DR1Q 2EOTA 1CA6A 2IW3A 4LF6L 3GV3A 4DPGA 5C4ZA 4POFA 4TQUS 3BDCA 4HEDA 3U50C 4NW2A 2F4VQ 4RHRA 4LF7Q 4DR6L 1B3AA 2Q8IB 5C44H 3WDNA 4OO1H 1ZEQX 3L0OA 4OONA 1ET9A 1FNWA 2DY7A 2IX1A 2VUMH 2HDMA 2EYJA 1XMOL 4IUPA 1X55A 3E5SA 4DV3L 5JPNC 2A68C 3CMAA 3S2DH 1STEA 3TSSA 2LY7A 3PUYA 2AWOA 1EU4A 4ZYSA 4LUOA 3H3VI 1TS3A 4DN4M 4DK3C 2YU9H 1HUNA 4PZ7A 4OHJA 3HEJA 2MJ8A 4DUZQ 4J8QA 4DK1A 2PQEA 2VUMB 5C0XG 4X66L 2NB0A 1VQGA 3L2PA 1EY4A 3VYSA 2IHFA 4KI0A 5D3DA 1YHBA 5EKLA 3S2DB 3BG3A 2MO1A 2N55A 3C1FA 4G7OC 4RH6A 3UE1A 3R2IA 3KF8A 2I5MX 4APVA 3H0GG 4CGYB 3GV6A 1MBYA 4OEMB 4BBSB 1L0XB 4RGMA 4JI4Q 1DONA 2F0TA 1F2YA 3NWTA 4KKSA 4BY1H 1QCBD 3KF6A 2TMPA 5M5YH 4C2MH 2YU9B 4PNYA 1HZAA 1JWUD 5IGEA 1HQRD 5JAVA 2DNCA 2MPMA 5KRUA 2XGTA 1U4PA 5JJLA 1YHQA 3BZCA 2A68D 3FRPB 3EFXD 1VQBA 4ZKBB 5CV4A 1J5EL 4JK1C 3R2TA 4A3MG 3E0EA 1CSPA 2ZXOA 1XTDA 3KBGA 2OXPA 1PHJA 4LAAA 2KHSA 3OOCA 1VQEA 1ASZA 3J80i 1TS4A 2A6HC 3I3CA 1SXTA 1PRTB 5IT9E 2JA6G 3KFUA 1QOHA 2Z1CA 3HOYG 2KVMA 4BY1B 3BJUA 5IYBH 1PZJD 4C2MB 1J6QA 3HOUG 1PVOA 1D8LA 4R9WA 2VB3X 2H5XA 1VDZA 1CSQA 1X6OA 2EY6A 4RCOA 5IP9G 1H9SB 2J0TD 1Q7YC 2XRQD 3QOJA 1E24A 4ME3A 4IFDJ 3DLLA 2Y0SG 3S1RB 2AHOB 5A35A 1T5XD 5JOBA 2B2VA 3TQYA 3BDOA 4JPBW 2OCEA 2EY1A 1AEXA 1Q82C 3MAQA 4U673 2F0LA 5G3LF 2V1CC 2EY2A 1JJ2A 3KF8B 3IFDA 1IHZA 1YZ6A 4GLAC 3J81c 4KY6A 3RLNA 1VQMA 1XNRL 2VQFL 3GTJB 4YHHL 4R4IA 2EXDA 2RSNA 5CGKA 1IXRA 3NQIA 3AYHB 1Y1WH 4X3SA 1N9WA 1E1TA 5C4JH 2EYMA 1GUTA 1HUMA 2PZUA 2MHVA 3J7A5 1WD1A 1K83H 3M7NA 2A6HD 4NDXA 1JOOA 2L55A 5LMUL 1VQPA 1YJ9A 1ICFB 3E0JA 4X6AH 1W2BA 3KK7A 2A5HA 1SJED 1ONLA 5IYCH 3OW7A 2IWHA 1B7YB 1CFMA 1SSOA 5IWAQ 4A3BG 1HPCA 1B70B 4DR1L 1JE5A 1G6ZA 5C3EH 3T1YQ 1D1IA 1ET6A 1Y1WB 1UEBA 2F0IA 3I90A 1A63A 4BWGB 1IYVA 4V190 1K83B 4CBVA 1Q1BA 1Z9FA 1K0SA 3CW2C 2WB1B 4A3KG 3ULLA 3AMUA 1XNQQ 4B3RQ 3WOFA 1HZ9A 4RHSA 2HHHQ 4OX9Q 1PXUA 2QDLA 5CV9A 5CR3A 2BOSA 1IKLA 1EUJA 4JI1L 2BCOA 2Z4HA 4CJ1B 5C3EB 1KXLA 4N9PA 1ESFA 1Q8KA 1SE4A 3SEBA 1EOVA 5H1SE 3S24A 1Q86C 1E1OA 2RCFA 4HJAA 4IJHA 3NENA 1GVPA 4R4OA 3VA7A 4L8JA 4DUZL 2R7ZH 1JT8A 1EWIA 2F3WA 3OYYA 3BVGA 1PRTF 4WJ4A 3A8KE 3S15B 1EYCA 1TWHH 3K5OA 1BBUA 4BA2I 3S14B 1SYEA 1BUVT 2HIVA 3ND9A 4A75A 2M9VA 2F3VA 4M1UB 4A3IH 4HIMA 3URYA 5M3MB 3S2HH 5E7NA 3P7JA 4JI4L 1C8CA 1EY0A 3D6CA 4C3IG 1BOSA 2A19A 3PUZA 1T5EA 1NR2A 1IL8A 1KL9A 1PV4A 3C3LA 2R7ZB 1AH9A 1JB3A 1O7IA 3NP8A 5KIXA 1EQVA 1EY5A 3W2DA 3JAME 3PUVA 1WTQA 4GZYC 1KLGD 1FR3A 3GTMH 1M8AA 2KOLA 3HKSA 1L1OB 4JYAL 3H91A 1E2VA 2F0MA 2E76C 1Y1VB 1PH2A 3M4PA 4DXFA 2NN6G 4HIKA 4C3HH 1C48A 4JOIC 3SVMA 5IODA 2B63B 1SLJA 3VYRA 4G7ZC 1KC8C 4FF2A 3GTQB 1GHJA 1XWEA 4B3TQ 4OWWB 1BXTA 2B2UC 2OQKA 3V2TA 4IFDI 5M5XH 1KD1C 1LTRD 1F2LA 5C44G 4GNXC 4DV2L 1CZWA 1UE1A 3V96A 4CJ2C 4K5VA 3GTMB 1N32Q 2JEBI 4J1MA 2J7ZA 5E4WC 5K36H 3TBIB 1Z6HA 5EJWA 1TT2A 3F8TA 1RKNA 2QEJC 3HZXA 3CPFA 3GDEA 4X3KA 3RN5A 5M3FG 2KCCA 3I4NH 1PFNA 1WD0A 3CP0A 4PMBA 2JK8A 2PMZB 4HTHA 2EZVA 5EKKA 2NVYH 1VQ9A 2LS01 2N8NA 3IKJA 2PQAA 3MHBA 4P75A 5M5XB 2EVBA 1H9KA 5M5WH 1MSGA 3DHQA 4X62Q 3CHBD 2D0PA 2K01A 1YNNC 4I65A 4DAVA 2K28A 3A54A 3E3XA 1NY4A 1WJJA 2VZAA 3PSIA 2B8FA 1LTAD 3QOLA 4IPDA 3VR3A 1XMQQ 1NMFA 2XVSA 3K7UC 1MD2D 2AQ2B 2AQ3B 2LKVA 3PV0A 4QIWE 2K04A 4M8AA 3J80c 1EOTA 5EGTA 5IWAL 3I4NB 2HCIA 3NPPA 3R8BA 2D62A 2K7VA 3TP6A 1OXUA 2NVYB 3NEMA 5FO8B 1XPOA 4BY1G 5CV7A 1I94Q 1UE5A 5IT9L 5M5WB 1I4GA 1U0LA 2LFNA 3RLOA 2B2YA 2N88A 2AWNA 3GTLH 3TP8A 1I3QH 1CKOA 4RA8A 5CV5A 5LL6X 1QJOA 4XQJA 1XNQL 1A2UA 4NXML 1I4QA 4MN3A 2F0HA 1B4OA 4IUNA 4EX5A 4GN3B 1PYBA 2NVTB 3HOVH 1A8VA 2DNEA 3LX0A 3M4YA 3K58A 3UE0A 2R93H 1DM0B 4DR2Q 2KCNA 5IGGA 5C5LA 3OWEB 1YNND 2UUBL 5I2YA 4BXXG 1T9HA 3M9BA 5JVG3 2TSSA 1NTGA 2QILA 2JJQA 1HH2P 1IBLL 1VQ5A 5GROA 2LXJA 5JEAJ 3A5UA 1I3QB 2ZTCA 2EPBA 2DN8A 2O5JC 5DAUA 2KCMA 4DV6Q 1VMCA 1YITA 4P71A 1JCKB 2ENBA 4LFCQ 1G8ZD 5FLMH 4OGQC 2ZTEA 3S1MB 5I4DA 1KAAA 1D7QA 2G5DA 1NUCA 5T1IA 2PZWA 5I9OA 3VYTA 3Q8DA 3CMEA 2F0OA 1Y8NB 4G57A 1U5KA 1I6VC 4UPAA 4H02A 2ZJRA 4ID6A 1EQTA 1KAWA 2K50A 3DEOA 1PDQA 1QB5D 2QA4A 3Q6SA 3V05A 1Z47A 2XRSD 1YNXA 2F0SA 1RIPA 5LMNQ 1ZKOA 3CCVA 1E0BA 1RODA 2F0JA 2JN4A 2YTXA 1V1PA 4FF4A 2B29A 3NBHB 2L0CA 3J7YW 2CH4W 4IZ8A 1KRSA 2J4XA 2R92H 5M9OA 1KTKA 1QNUA 5CBAE 5IGCA 1DOMA 1VQLA 1SYDA 1U4MA 3FHWA 3IL8A 1N32L 3QJYA 2RDFA 2UXBL 3NBIA 2A74C 1M4VA 1QVGA 1EY8A 3S1QH 4KMUC 4R8NA 1SYBA 5I6WA 4BBRH 2ZXPA 2N78A 2E5LL 4JV5Q 2QDBA 4B3SQ 4R8IA 1I5FA 1JOKA 1F9RA 2R92B 2MP1A 4A93B 2XWBB 4N8FA 1E3PA 1UUPA 4HJ5A 2CVRA 2XWJB 4X62L 1H9JA 1RTNA 4XXEA 1PTOC 5FLXc 1II3A 4KKTA 4Z9CB 2JA9A 1FNVA 3F2BA 1WTPA 4PMWA 3S1QB 3PF5A 1ESRA 2ZT9C 3JAML 1W6KA 4ZRZA 4YCVA 4BBRB 4A3IG 2JYOA 4KLKA 4UAIA 4K5WA 4DNRB 4LF4Q 1I6HH 3CCSA 2SNMA 3P1HA 1GM5A 2NYZD 2VQEQ 3P20A 1TWCB 1TXYA 3X3MA 2PI2E 1VQ6A 1YIJA 1EL0A 2R7FA 1NE3A 2I46A 4R4CA 2WAQG 4AYBG 2K52A 1YEZA 2YTVA 1HXYD 1JICA 4V0BA 2EXZA 1PFBA 4GOPC 1KQSA 1AE3A 4WJWA 1STAA 4DKAC 4KD3A 4LNQA 5C3XA 3HS0C 1K9MC 1MKHA 2G9DA 2MQHA 3K7AH 4C3HG 4IOAA 4DR2L 3CXCA 3AFPA 1PTOD 1I6HB 1WTHA 3U9SA 1KLUD 2K1BA 5KYIA 3K81C 4EQNA 2IPKD 2BH8A 1JC7A 2AUKA 3EROA 3RUZA 3CPWA 2RHQB 3CCQA 4NMZA 1FJGQ 3KJPA 3OPOA 4DV1L 2B2WC 3AB9A 1S5BD 3L3OC 1QVFA 4A3LH 2F0VA 1H95A 1F2ZA 3AFQA 4NB3A 1X3EA 3OIQA 4KKUA 4N9TA 5GQOA 3SE0A 4DV6L 2EYLA 5JEAH 4DR3L 2KECA 2JXMB 5K36G 4OIJA 3U4VA 2ZJPA 4IFDG 1TU2B 1SDFA 1EWHA 2B2TC 4LF8L 4K8JA 3LWEA 3K7AB 4FXDA 3OW2A 3HOXH 4K6LA 2EJGC 4JI0L 3EIVA 1UWVA 4BBSH 1LT4D 1TY0A 2Y0SE 4QQBX 5E3FA 1G91A 2F4IA 2NZOA 1WTOA 4B3ML 4JI5Q 1SYCA 1H9SA 1B1ZA 1VQNA 3VDYA 1Q3LA 3TS0A 1G2SA 3NTKA 1GJXA 3I73A 1GUSA 3LWUA 4R1JA 2QCPX 4DAYB 1EQRA 2A69C 5A2QE 3W5OA 3GQBA 3CCLA 1A6XA 1JR0D 4H0LC 1JJCB 1LACA 3T51B 5LMNL 1VQ4A 1DCZA 1FVIA 2DY8A 3HOXB 1DOLA 4K14A 1F9PA 3UDFA 1D2BA 1EY7A 5C6AA 1W6JA 4BY7B 2NTSA 2LXKA 1JJGA 2YYZA 1TQOA 1YBYA 4L63B 2F0EA 2F3IA 5LMNW 4LFBL 3F2DA 3MXNB 4DV7Q 3S1RH 3GTPB 3PIP3 1N33Q 2Z6BA 5JPMC 3FVQA 4P73A 5BN5A 1WVLA 4RGTA 1PFMA 5KNDA 1G51A 3J81j 1K73C 1HQMC 1X54A 2WIIB 3EJIA 4Q5VA 3HOVG 3FKIH 4DGZA 1C9OA 3RNUA 4JV5L 1VQJA 4F7XA 3GTJH 2R93G 3T1HQ 1IBKQ 3FPUB 1VQ7A 1SN8A 4UDUC 1QUQB 3NE5B 1EY9A 3BYYB 2A69D 5ISRA 4CDEC 5AJ3Q 1WTWA 4H13C 1LT6D 5C5MA 2JA5H 2KQ3A 1XXGA 1BBWA 4IO9A 1NBWA 4F88A 4K6DA 4KY7A 1ILQA 3ZJYC 5DNFA 3LNNA 1PH1A 3TS2A 4KHPL 3STBD 1K8AC 3SK6A 3HOWG 3HFZB 1G291 4JI7L 5CV8A 5JJKA 3CQZB 3CCJA 5FLMG 3FKIB 3T4AC 1VCIA 2UU9L 4OL7A 1STYA 4LF4L 3UDIA 1JOQA 3PMFA 1GUWA 2UXCQ 2DJGC 5IY0A 1VQDA 4X64Q 3D4DA 1CHQD 2JA5B 1X56A 4ZUJA 1YI2A 1VQKA 1CHPD 1RD9D 5KYLA 4LF5Q 4K5XA 1F77A 4YWMA 4GN4B 3K5LA 5EPJA 2WP8J 3EQLC 3K0YA 4RKBA 2XTIA 1STHA 3W1BA 1IZ6A 1UE7A 5EBDA 4HAEA 2PNHA 4LF9Q 4JI3Q 3HP3A 4YWKA 2FMMA 2F4VL 3G7LA 4TSSA 1EQQA 1PZID 4LF7L 1NJIC 4HCSA 1TKWB 2R92G 2Z0SA 3TP7A 4WJ3M 4KJNA 4DNIA 2E2HB 4ZLTF 4GLVB 3S15H 2ASBA 1SNQA 1L1OA 4X65Q 3VR4A 1IBMQ 1Q8IA 4QIWB 3S14H 3ULPA 2N49A 2KEEA 4JBKA 4A3GG 2OWOA 5J3BA 4S3SA 1LT3D 3MVVA 4FNFA 3CC7A 2FFKB 4RFBA 4DK6C 5M3MH 2KEDA 1EEID 4KN4C 4NKLA 4QY7A 1SYFA 5D3IB 3G6JB 1ML0D 1HJPA 1X3GA 4JI5L 3PF4A 1CZGA 2F0FA 1DJRD 1Y69U 1LYLA 4RG1A 1X32A 3J81E 4OWXB 3NTHA 2CWAA 3DWPA 1ZYRD 4A3DG 2D2CC 2Z4IA 5BR8Q 2MNAA 4OELB 1RJTA 4ALPA 1I50H 1Y1VH 4A76A 1HNWQ 3U58A 3RD4A 1NCVA 4CKBA 2NVXH 1I4RA 2B63H 4A4IA 1E2WA 3GTQH 2V4DA 3VR2A 1X3PA 2GA4B 4AQYQ 1SE8A 3K57A 3DMUA 1PFSA 2A1AA 1OXXK 1XYIA 4FP5D 4DA2A 5G3LD 1G2TA 1VMPA 1N33L 3HRZC 1TY2A 4Y52H 1I50B 3K80C 1WCMB 4GKJQ 1B44D 2HDLA 4IJLA 4IUVA 2NVXB 4A3JH 3KUPA 2HD3A 2E8GA 3H3VC 2Q8TA 1EFWA 3NUCA 3TMEA 4EGVA 2GN5A 3T1HL 2G9HD 2E74C 1IBKL 3F2UA 2PPBC 2H1EA 5CV6A 1U4LA 1QZGA 4LFAQ 1VQAA 4RAUC 5JVH3 1YNJC 5AJ3L 3MXUA 2HCCA 4DK0A 4OO1G 1B9MA 1LV9A 1PTOH 1I4XA 1I4HA 2VUMG 4A3LG 3I70A 3QR8A 5ELNA 1OXTA 2KJXA 3IRBA 5JEAG 1KDCA 3KJOA 3HKZE 3K5NA 4LJZC 4CDFC 1L0YB 1VF7A 4K2KA 4A3JB 1STNA 5GADC 4YIJA 3HOXG 5A2QL 4EVOA 4ZQ3A 1K0RA 4A3CH 4UP8A 4BBSG 5JJIA 1HFGA 3WOEA 2UXCL 1HFNA 2MFIA 3SK4A 3H6MA 4X64L 4C1NI 2VL6A 1UNSA 5BN3A 1PTOB 3G4SA 4PZ6A 1EY6A 1NAPA 1AZQA 4AH6A 3BYTB 4LF5L 1FL0A 3S9WA 1Q81C 4LW1A 5EBCA 1ENAA 3PIPA 3BVZA 3BZDB 2KCTA 4FF3A 2NVTH 4IPCA 2A8VA 5C0XH 2RBMA 3E6ZX 4JVZA 1TS2A 3T1YL 1YNJD 4X3UA 2NTTA 5I2XA 3U4ZA 4LF9L 1FNUA 3C46A 5J22A 5C3WA 4CHTB 1HNXQ 2YV5A 2RA4A 4MHEA 3J7ZC 5DEHA 4K0KQ 2K75A 2ICIA 1RF2D 1V1QA 1EFID 3H0GH 3D8GA 2FMCA 2OT2A 5IGDA 4X65L 3KDFA 3TREA 1IBML 4DU9A 1VQCA 3T56B 2F0UA 4B3RL 1SAPA 3PUWA 2K05A 4OX9L 4OXPA 2HHHL 3CCEA 4FDBA 2R61A 3PO3H 2CFMA 1GO3E 4XT3B 4BS9A 1BCPC 5HGQA 1D5ZC 3S1MH 3NBHA 3MFYA 2FXQA 3IFTA 1N36Q 4DV4Q 4ZCKA 3FKIG 3ER0A 1S5DD 3DXJC 5FO7B 5CMDA 4JBMA 1A62A 5IYBG 2SDFA 3K6OA 1EWCA 4LUZA 1BBXC 2B2VC 2LSSA 2GVBA 2WV6D 4F87A 2JA6H 1AN8A 2K5WA 3FEWX 4K2LA 5E1FA 3H0GB 2B39A 1GOZA 3BZKA 3ONAB 1VF5C 4KHVA 5KEEA 2LMCB 4LF6Q 3BVMA 2JA5G 2L9HA 5BR8L 1V43A 3PO3B 1Y8OB 1FYCA 3A8IE 3KBXA 3Q23A 4JBJA 5E4XA 1L2FA 3D6WA 4GKKQ 1W3SA 1DXMA 2WKDA 2AMCB 1O78A 1RDPD 3AQQA 3FP9A 3KLWA 2BDNA 3N6RA 5CC4A 2ALYB 3T13A 3E9HA 4L5TA 3SHLA 1LTGD 3RZDH 1PH8A 3J80E 4AQYL 3J7AV 4YY3Q 1Y1WG 2JA6B 5FO9B 1D5MC 1Q46A 1EIHA 2RDHA 1KNEA 1SROA 3HOUB 1BCPD 4JI2Q 3CCUA 4J15A 3K59A 1Q1EA 2WB1G 3KDFB 2NVQH 1KABA 2CCZA 2WFWA 2Z8LA 4LUVA 4HR7B 1S5CD 4DNTB 1AZPA 1KDAA 1MSHA 2I07B 4GKJL 2VXWA 5IYCG 2K6AA 1XPUA 4O42A 4DR7Q 1HTPA 2K5HA 1PTOF 3CD6A 4X66Q 2WINB 3DM3A 5C3EG 1BKBA 2Q2UA 4B3TL 3RZDB 4DUYQ 2WAQE 3QIAA 4AYBE 3OIPA 4A93H 3CRKC 2I0QA 1E22A 1SRUA 2L11A 1EYAA 4A3BH 4DAMA 3CRLC 4ILWA 5TSSA 2MGSA 3MA2B 1DYQA 3QB3A 3NWSA 2C35B 2NVQB 2E2DC 1SMYC 2UUAQ 1QILA 1HTLD 3L9AX 3J81L 3M7GA 3A56A 1FGUA 1PYWD 1R4PB 1EYDA 3SGIA 3VYUA 4PV1C 2IL8A 2ZJQA 2QGQA 5M3MG 2O2LD 1P16A 4O1NA 4X3TA 3HOZH 3VR5A 1IKMA 2F03A 3EN2A 1TWCH 4A3BB 3TRZA 4QUFA 3JAMi 4G7HC 2R7ZG 1RL2A 1SE3A 2CHBD 2ZXRA 4LK1C 4HSPA 2PW5A 3MFGA 2IX3A 3A7AB 1XMQL 1EIFA 4WRDA 2EY5A 1F9QA 3CCMA 1Y1VG 4KD4A 2CH4A 1ENFA 1DGSA 1QE6A 5ELFA 1PH7A 2IX0A 2Q2TA 2B63G 3AU7A 1CQVA 5T1GA 5C4XH 3HOZB 1I94L 3WWVA 1K8OA 1SEBD 4AIMA 3GD7A 2JE6I 1HNXL 2NBFA 2NZ1D 1SMYD 2M2LA 4K0KL 1JMCA 4A3EH 4DAYA 1KRTA 1BQQT 2JQOA 4C56C 3A55A 5J1ZA 1XNRQ 2K03A 2KBNA 3I55A 4HSVA 5IOCA 3RLFA 3H09A 1LLRD 2CQAA 1A0IA 1UEAB 4RCNA 3ERSX 2NN6I 2OQ0A 2EDGA 1OO9B 2PW7A 1N36L 4DV4L 5C4XB 4KN7C 1CA5A 2IJ0A 2M00A 2NN6H 5DM73 4A3EB 3MXNA 3GTOB 3NTIA 2CQOA 1AE2A 4N8X1 3I4LA 2ZM6Q 3GTKH 4C3IB 1STBA 2A6ED 2RVLA 2KA7A 3KOJA 1VQIA 1AFPA 4LFCL 4FXKC 5FLXE 5JJZA 4JOIA 1J8IA 4EQPA 4ABNA 2EYFA 3EBEA 4GKKL 2SNSA 1N8RC 3C2PA 5IT9c 3I4NG 4BY7H 5ELBA 3PGZA 2IHEA 1QUQA 4DAPA 5EPKA 1BDOA 1LTLA 2B2UA 4HMIA 4A3CG 3MXGA 1LTTD 4YY3L 4GNXA 2NWGA 2CW0C 1TWAH 1X3FA 2ZTDA 3M4OB 2F52A 1B50A 3E9IA 5M3FH 5CYUA 5KNBA 2AUJD 3OMGA 4JI1Q 3GTPH 1A3TA 3GTKB 2JA8H 3CC4A 1FGBD 2D0OA 1EYGA 4JI2L 1B8AA 1L0WA 4IUUA 5DM63 4HCEA 1PH9A 1QWYA 1ILPA 4PZ8A 3K0XA 1ASYA 5C44B 1JORA 5IYDH 1XPRA 3D4WA 1PH4A 4DR7L 1BF4A 3SK8A 4NXNQ 3H3VH 2F0QA 2L12A 3STBC 2B2YC 3FDTA 3OSOA 3G48A 1K3BC 1VS0A 4DUYL 4ZAIA 3F2CA 2I5HA 4ZK9B 3MWYW 5ELDA 1TWAB 1S72A 2OTJA 5M3FB 2JA8B 2H4OA 5HY6A 1YVCA 3A7LA 3MTSA 4KK7A 1JWMD 2UUAL 5KNCA 4ME5A 4WORA 4UY8C 4RMFA 4IUTA 1IYJB 4Q0FA 4KY5A 3PO3G 1VQHA 3CQZH 1O7LA 4KHZA 1HNZQ 1BO0A 4HN7A 2CW0D 3NSWA 4B3SL 3FMCA 1BVSA 3CU7A 1CK1A 5I9PA 5IP7H 1PH6A 3BDLA 3TN2A 4JYAQ 1FD7D 2EYOA 2DGYA 2CWPA 3OHXC 4GNXB 1GUGA 2F0PA 4RKLA 2K5VA 3TEHB 5L37A 2Z9HA 4K8IA 4DXGA 5M5YB 3J80L 4BXXH 4U68A 3I4MH 1A2TA 1JQYD 1TWFH 1HCZA 1MIUA 5EPLA 1Y14B 3TDQA 1KIXA 4RGOS 4DV2Q 2F0DA 4I7ZC 3N52A 4JCVE 2JSOA 3D0FA 4C3JH 4PMCA 2VQEL 1OTCA 1LO5D 3X3NA 4XT1B 3S16H 1LT5D 4IURA 4DR4Q 2IY5B 3H94A 2E2HH 4QF4A 3NQTA 1X9NA 2JA7H 4TKOB 2I5LX 1PH3A 3ICEA 3UDXA 2P5ZX 2XN9C 3HKZB 4BA1I 3I4MB 5C0XJ 4IPGA 1SFOH 3KF6B 1F9SA 1TWFB 1YHAA 3K5MA 5IGBA 1SBBB 4JW0A 1O80A 1ZYRC 1ENCA 4I7AA 4PG3A 1WTVA 1UAPA 1SE2A 1A3VA 3R93A 3KLSA 1P8LA 5K5PA 3SR1A 4C3JB 2RHSB 2X69A 1SYGA 2K14A 4H7BA 1DD2A 2EIFA 3I72A 3S16B 3OTOQ 1NNXA 2ICEC 1GD7A 4MIUA 3O13A 1LUZA 1FJGL 4A93G 1KNAA 4J6HA 4LWCA 2KUMA 2QKIC 4R4TA 4DV0Q 3JAMc 2JA7B 1Q12A 1C0AA 1CM9A 2C5CA 1KHIA 2ZM6L 1SR3A 4XQNA 1S40A 4GN5A 1WFQA 2O4XA 1SFOB 1XTCD 4L6TB 2MUYA 2HT1A 2C9OA 1LTID 5C4JB 2K5DA 2F0GA 1BCPB 4JG2A 5D14A 4BBRG 1SNMA 4ULLA 1IYUA 2Z6KC 3D31A 4NXMQ 3HOZG 3ERQA 1HA5A 2Q2IA 5EKIA 4JI8Q 1JB7A 2OTLA 2VB2X 3PO2H 1C4QA 3TZUA 2F0KA 2R3ZA 5FJ8H 1F2MA 1K3RA 2EJMA 3S17H 1D1KA 5AFWA 2BA0A 1HRJA 4QUCA 2AKWB 5GAGC 2R7DA 3TZDA 1R4QB 2MO0A 4A3FH 2UUBQ 2EE1A 3EVQA 1WCMH 3HG9A 3PQIA 1QG7A 3EA6A 4XQQA 1VQFA 1IL2A 3A8JE 1CUKA 1IBLQ 2UXDQ 3UDGA 1XJVA 3MXPA 1E2ZA 3PCOB 4NXNL 4CKEA 1DZ1A 4DR5Q 1TWGH 1G6PA 5C4XG 5LHY1 1C7YA 1Y8PB 4MNOA 2EYHA 2F0NA 3DEPA 3NHHA 4P72A 2VS1A 4QB4A 3PO2B 4IN3A 2K4KA 4H44C 3S17B 3GO5A 3DWQA 4XYOA 3PIO3 3Q24A 3KYHC 4DV7L 1WTRA 4A3EG 4CJ0B 1MI2A 2B3GA 4QL5A 2E2IH 1Q90A 4A3FB 4G4KA 1K8GA 4B08A 3PUXA 1QVCA 1K28A 1CI3M 2DJFC 1YJNA 4UHVA 1V8QA 3MEFA 3RR5A 1QNKA 1HNZL 2K5QA 4XDXA 3I8ZA 1TWHB 1TWGB 1O7YA 2B8GA 4DV5Q 3J7AF 3CAMA 2JP1A 1OXSC 5FLXL 4POGA 3D3RA 2OF1A 2QF7A 3OMCA 3RMHA 3A0JA 1HR0Q 4Y7NH 4A3IB 3QG1A 1PRTC 1SNOA 3DM1A 2F1MA 2E2IB 3S2HB 4KV6A 4MTNA 5ELOA 1PMRA 4IOCA 4GOPA 1CKNA 1PZKD 2QEXA 4O0AA 4XIGS 4WFN3 3BS1A 1VQOA 1A3UA 3G6EA 1PH5A 1HHVA 1ICWA 2HQEA 4DR6Q 2JEAI 2WAQB 4AYBB 1H9MA 3I4OA 3ULJA 2FHTA 2PI2A 1SNDA 4BY7G 4TRDA 2UXBQ 1WI5A 3GP7A 4XYQA 5IIFA 1B2TA 3IAYA 4IFDH 5FK9C 4MTKA 1DOKA 2B2WA 4Y7NB 1NR4A 1SMXA 4DR4L 2UUCQ 4C3HB 1V9PA 1BCPF 2R6GA 5C0XI 3L7ZC 1S4ZA 2XSCA 2E5LQ 1RCVD 2JA8G 4O2DA 2RSOA 4FYDA 2B2TA 4YCUA 4IUQA 2RDGA 1R9TH 1SNCA 2D5DA 5IYDG 3AEVA 3I91A 2D9UA 4FVMA 3OWFA 1PRTD 4JI3L 2ES2A 4CDCC 2N3SA 3NK9A 4IQZA 4FXGC 4FO2A 3SDZA 2VW9A 4HJ9A 3ZYYX 1MGSA 1B9NA 2WB1E 3CCRA 1E7ZA 3OTOL 3A5ZB 1N34Q 3MZ5A 3SK5A 4P74A 4EQ5A 1D6EC 2O5IC 4OWTB 5GAHC 4DV0L 2BE5C 2WKCA 3RZOH 1V1OA 3CF5A 2E2JH 3LGJA 5ELEA 4QMGA 3FPPA 3C1EA 1YJWA 3NELA 1M1KC 1PLFA 3A74A 4JI6Q 5NUCA 1GUOA 4R4QA 4GOPB 1R9TB 1CKNB 1CKMA 2X6GA 4LMQD 2GVAA 1GUNA 4ZKCB 4A3MH 2Q8RE 3NXWA 1I4PA 1K8MA 2BH2A 4RGNA 2L1BA 3HGBA 4PQXA 2EQSA 3KLSX 2QW7A 3B6YA 1S5ED 5IP7G 3R3OA 4JI8L 3JC66 1IW7C 1OXVA 1TR5A 3I2ZA 3HOYH 3RZOB 2E2JB 4HIDA 4C1NK 1AP0A 3HOUH 2XNAC 1SNPA 4P2CB 1LABA 4L5RC 4FF1A 3HKZG 4HMJA 1KDBA 3I4MG 1HNWL 5C4HA 5IP9H 2HUGA 2PQAB 4GLXA 2KHIA 4JBWA 4E6IA 2KENA 4DV1Q 4A3MB 1CQFA 2RF4A 4QCLA 2UXDL 1Z7TA 3I56A 5DLQE 3GTLB 3S1NH 4OIKA 1LTSD 2BE5D 2K33A 4DR5L 1XMOQ 5I6YA 3K8AA 1S5FD 4HIOA 1NSNS 4DR3Q 1XX8A 4DV3Q 1EIGA 4C3JG 2PO4A 3GTGH 3HOWH 4TVAB 1JE4A 4LF8Q 2X6LA 3Q0AA 3HOYB 3HOVB 1RTOA 2PZTA 1EU3A 2R93B 1LTBD 4JI0Q 2L4NA 4JC0A 5HURA 3DWAA 2K32A 5IE8A 2JA7G 1JWSD 4ODGA 4L5SA 1MJEA 3TP5A 4NP5A 2IT1A 3U9OA 2PNRC 3QWNA 4B3MQ 1WTXA 3VR6A 1H9RA 1UE6A 2Y0SB 3H15A 1WYDA 3F1ZA 3M4QA 4QGUA 1VQ8A 1EIYB 1S3OA 3S1NB 4RWSC 2EYPA 1IW7D 1GXDC 2F0WA 2L15A 4ZUIA 2AQ1B 1EEFD 4DV5L 3CKIB 1CTMA 1L1OC 1GKHA 2RKSA 1MHWC 4LFAL 3GTGB 3UI2A 4HJ7A 3HOWB 2KHJA 4HJ8A 1HR0L 2XIWA 1SJHD 4CKCA 4QJFA 3J81i 1TS5A 4MZ9A 2Q2HA 1WOCA 4F8MA 1TIID 3P75A 2DUDA 4CDDC 2BA1A 4YWLA 5CORA 2RCNA 3W1GA 3VA5A 5HGTA 1EZ8A 2ATWA 2PMZE 4KTAA 3RN2A 1STGA 2SOBA 1LM0A 5CBEE 5LL6S 1HA6A 1HR0W 2FINB 1CT1D 4A3KH 4LFBQ
chains in the Genus database with same CATH topology
4IPDA 1J5EQ 4JBKA 1PH4A 4A3GG 1XMQQ 4DR7L 1NMFA 2OWOA 5J3BA 3K7UC 4NXNQ 3H3VH 3PV0A 3CC7A 4QIWE 3STBC 3J80c 3G48A 4DK6C 5M3MH 4UP7A 5IWAL 1VS0A 4DUYL 1PA6A 4A3GH 3F2CA 2CKZB 2I5HA 2D62A 4QY7A 2UUCL 1S72A 2HQLA 3PO2G 2OTJA 1PYSB 5FJ8G 1HJPA 1OXUA 1X3GA 4JI5L 3G71A 2VY3A 3PF4A 3NEMA 3I7FA 4BY1G 1XPOA 1LYLA 4RG1A 5HY6A 1HZCA 4OWXB 1I94Q 1YVCA 3PIOA 1UE5A 4A3FG 3M3YH 2CWAA 1U0LA 2UUAL 3RLOA 4A3DG 4L5QA 1WCMG 2YTYA 5BR8Q 2AWNA 2ID0A 2MNAA 4UY8C 3GTLH 1I3QH 4RMFA 3M85A 1CKOA 1IYJB 3PO3G 1VQHA 4ALPA 1I50H 1XNQL 1Y1VH 3CQZH 4A3DH 4A76A 4KHZA 1MJCA 3U58A 1HNZQ 4NXML 1HNWQ 2NZHA 2Z6KA 4B3SL 4EX5A 2NVXH 4GN3B 1PYBA 2B63H 1BVSA 1N34L 1A8VA 3HOVH 4YCWA 5EAYA 4A4IA 5IP7H 1PH6A 4KHPQ 3UE0A 4JYAQ 2R93H 3GTOH 4DR2Q 4JI7Q 3GTQH 5GAEC 1M90C 4IPHA 2DGYA 2CWPA 2UUBL 4GNXB 1SE8A 4AQYQ 2VNUD 2K5NA 2VQFQ 4C3IH 4UP9A 1PFSA 2UU9Q 4GS3A 4BXXG 4YHHQ 2A1AA 1OXXK 1T9HA 3M9BA 4JI6L 2K5VA 1NTGA 3TEHB 2JJQA 1HH2P 1IBLL 1N33L 4BXXH 1VQ5A 5GROA 3I4MH 2LXJA 5JEAJ 3A5UA 2ZTCA 1TWFH 1QZHA 4Y52H 4A3JG 2KCMA 3K80C 4DV6Q 1MIUA 1Y14B 2HIXA 1KIXA 5LMUQ 4GKJQ 4DV2Q 4IJLA 4NPSA 1YITA 4P71A 3CC2A 4A3JH 4LFCQ 2E8GA 5FLMH 1EFWA 2ZTEA 1HZBA 3D0FA 2GN5A 4JCVE 4C3JH 3T1HL 1IBKL 1X65A 2VQEL 3M4OH 1NMGA 1D7QA 1OTCA 4XTCS 3S16H 2IY5B 3CMEA 3Q8DA 3BU2A 1QZGA 4DR4Q 4OO1I 4DR1Q 4LF6L 4LFAQ 1U5KA 1VQAA 4UPAA 2E2HH 4DPGA 4H02A 5AJ3L 1X9NA 2ZJRA 4POFA 2JA7H 4TQUS 4OO1G 3U50C 2I5LX 1PH3A 3ICEA 3UDXA 2F4VQ 1KAWA 4BA1I 4LF7Q 2VUMG 4A3LG 4DR6L 5C44H 5C0XJ 4IPGA 2K50A 3L0OA 1SFOH 3KF6B 1YHAA 4OONA 5ELNA 1OXTA 3IRBA 5JEAG 2IX1A 2VUMH 4PG3A 3KJOA 2QA4A 3HKZE 1Z47A 1XMOL 1YNXA 1X55A 1RIPA 5LMNQ 1P8LA 5GADC 4DV3L 3CMAA 3CCVA 2RHSB 3S2DH 3HOXG 2K14A 1K0RA 4A3CH 4UP8A 4BBSG 2EIFA 5JJIA 3OTOQ 1GD7A 2YTXA 3PUYA 2AWOA 1LUZA 1FJGL 4A93G 4LWCA 2B29A 2UXCL 3NBHB 1G6PA 2MFIA 4R4TA 4X64L 4DV0Q 3JAMc 2VL6A 1KRSA 1Q12A 4LUOA 3H3VI 2R92H 1C0AA 2ZM6L 1KHIA 3G4SA 4DK3C 1SR3A 4PZ6A 2YU9H 1S40A 4GN5A 1VQLA 1WFQA 4AH6A 4PZ7A 4DUZQ 4LF5L 3FHWA 1FL0A 1Q81C 4LW1A 2HT1A 1N32L 5C0XG 2UXBL 3PIPA 4X66L 1VQGA 3L2PA 4JG2A 1QVGA 2KCTA 3S1QH 2IHFA 4IPCA 4BBRG 2A8VA 2NVTH 4KI0A 1YHBA 3T1YL 2MO1A 3U4ZA 4LF9L 3UE1A 2Z6KC 4BBRH 3D31A 4NXMQ 2N78A 3HOZG 2E5LL 4JV5Q 2I5MX 2Q2IA 4JI8Q 4B3SQ 4APVA 1JB7A 3H0GG 2OTLA 3PO2H 1I5FA 5FJ8H 1HNXQ 1K3RA 2YV5A 3S17H 4JI4Q 2BA0A 3J7ZC 4BY1H 3KF6A 4K0KQ 1E3PA 2K75A 5M5YH 4HJ5A 4C2MH 2AKWB 1V1QA 5GAGC 3H0GH 1HZAA 4X62L 2R7DA 2MO0A 4A3FH 2UUBQ 5FLXc 4X65L 3KDFA 2XGTA 3TREA 1IBML 5JJLA 1YHQA 1VQCA 4B3RL 1WCMH 3BZCA 3PUWA 2JA9A 1VQBA 4OX9L 1VQFA 4OXPA 2HHHL 3F2BA 3CCEA 4FDBA 1IL2A 1CUKA 1J5EL 3PO3H 2CFMA 1GO3E 4PMWA 1IBLQ 4A3MG 3PF5A 2UXDQ 3E0EA 3UDGA 1XJVA 1CSPA 4NXNL 3PCOB 1XTDA 5HGQA 3S1MH 1PHJA 2FXQA 4DR5Q 4YCVA 1TWGH 1VQEA 1N36Q 4DV4Q 3J80i 4A3IG 3FKIG 3ER0A 1ASZA 4KLKA 4JBMA 5C4XG 1A62A 1C7YA 5IYBG 4MNOA 4P72A 2JA6G 3KFUA 2VS1A 4LF4Q 4LUZA 2K4KA 2LSSA 3HOYG 2GVBA 3GO5A 3CCSA 1I6HH 4DV7L 3KYHC 3BJUA 5IYBH 4A3EG 1GM5A 2JA6H 2B3GA 1J6QA 4QL5A 2VQEQ 2E2IH 3HOUG 1D8LA 3BZKA 1PVOA 1TXYA 1K8GA 2PI2E 2H5XA 1VQ6A 3PUXA 1YIJA 1QVCA 4LF6Q 2JA5G 2R7FA 1CSQA 1X6OA 1NE3A 5IP9G 4R4CA 5BR8L 1YJNA 1Q7YC 1V43A 1E24A 4ME3A 2WAQG 4AYBG 3DLLA 2K52A 1YEZA 2Y0SG 2YTVA 3MEFA 3RR5A 4IFDJ 2AHOB 1HNZL 4JBJA 4GOPC 1L2FA 3TQYA 4GKKQ 1KQSA 1W3SA 1AE3A 2AMCB 2OCEA 4DKAC 4LNQA 3AQQA 4DV5Q 3FP9A 3KLWA 1Q82C 3CAMA 1K9MC 1MKHA 1OXSC 2MQHA 3K7AH 4POGA 4IOAA 2ALYB 2V1CC 4DR2L 3E9HA 4L5TA 3CXCA 3AFPA 3A0JA 3RZDH 3KF8B 1JJ2A 4Y7NH 3J81c 1YZ6A 4GLAC 4AQYL 1PH8A 1HR0Q 3RLNA 1VQMA 1XNRL 4YY3Q 2VQFL 3K81C 1Y1WG 2BH8A 4YHHL 4R4IA 2EXDA 3CPWA 2RHQB 1Q46A 4MTNA 1IXRA 5ELOA 3CCQA 1FJGQ 3KJPA 3AYHB 4DV1L 1Y1WH 1SROA 1N9WA 4IOCA 4GOPA 1QVFA 4A3LH 4JI2Q 3CCUA 1CKNA 1E1TA 4J15A 1H95A 5C4JH 1Q1EA 2WB1G 3AFQA 3KDFB 4NB3A 2NVQH 2QEXA 4O0AA 1X3EA 5GQOA 2CCZA 2WFWA 4LUVA 4XIGS 3J7A5 1K83H 4DV6L 1PH5A 3M7NA 1VQOA 5IYDH 3G6EA 4DR3L 4GKJL 5K36G 5LMUL 5IYCG 4DR6Q 3U4VA 2ZJPA 2JEAI 4IFDG 1VQPA 3I4OA 1YJ9A 1XPUA 4X6AH 3ULJA 1W2BA 2PI2A 4LF8L 4DR7Q 2K5HA 4BY7G 2UXBQ 1WI5A 3CD6A 4X66Q 5IYCH 3OW2A 3HOXH 3DM3A 5C3EG 1B7YB 1BKBA 2Q2UA 4JI0L 4B3TL 3EIVA 1UWVA 5IWAQ 4DUYQ 4BBSH 4A3BG 2WAQE 4AYBE 1SMXA 2Y0SE 4DR4L 4QQBX 1B70B 4DR1L 2UUCQ 1JE5A 4A93H 2I0QA 1E22A 1SRUA 2NZOA 5C3EH 3T1YQ 4B3ML 1V9PA 4JI5Q 2R6GA 4A3BH 4DAMA 5C0XI 1VQNA 3VDYA 3L7ZC 2E5LQ 2JA8G 3TS0A 1UEBA 4O2DA 1A63A 4R1JA 4YCUA 2C35B 4DAYB 2UUAQ 1R9TH 1EQRA 1Q1BA 1Z9FA 3CW2C 3W5OA 5IYDG 3AEVA 4A3KG 3CCLA 3ULLA 1JJCB 1FGUA 1XNQQ 4B3RQ 5LMNL 4JI3L 2ES2A 3SGIA 1FVIA 1VQ4A 2N3SA 4OX9Q 1HZ9A 2HHHQ 3UDFA 2VW9A 4HJ9A 2ZJQA 2QGQA 5M3MG 2WB1E 3CCRA 1E7ZA 3OTOL 3A5ZB 1N34Q 1P16A 3HOZH 4JI1L 1EUJA 2LXKA 4P74A 4EQ5A 3EN2A 4OWTB 1KXLA 5GAHC 1TWCH 4DV0L 1JJGA 1Q8KA 2YYZA 3TRZA 3RZOH 3CF5A 2E2JH 1YBYA 3JAMi 3LGJA 2R7ZG 1EOVA 1RL2A 5H1SE 3S24A 3NELA 1YJWA 1E1OA 4HJAA 1Q86C 1M1KC 2F3IA 3A74A 3NENA 1GVPA 4IJHA 4R4OA 5LMNW 4JI6Q 4LFBL 3F2DA 3MXNB 4DUZL 4DV7Q 4R4QA 3S1RH 4GOPB 1XMQL 1N33Q 2R7ZH 1JT8A 1EWIA 1CKNB 1CKMA 3OYYA 1EIFA 4P73A 4WJ4A 3CCMA 2GVAA 1G51A 1TWHH 1Y1VG 4A3MH 1BBUA 4BA2I 1DGSA 3J81j 1K73C 2BH2A 2HIVA 1PH7A 4A75A 1X54A 2IX0A 2Q2TA 2EQSA 2B63G 4A3IH 3HOVG 3FKIH 1C9OA 5C4XH 3B6YA 3RNUA 5IP7G 4JV5L 1VQJA 4HIMA 3GTJH 2R93G 3T1HQ 1IBKQ 1I94L 4JI8L 3WWVA 3JC66 4AIMA 3GD7A 2JE6I 1HNXL 1VQ7A 5E7NA 1OXVA 1SN8A 3S2HH 3HOYH 3I2ZA 4JI4L 1QUQB 4K0KL 1JMCA 4A3EH 4HIDA 3HOUH 2A19A 1KRTA 3PUZA 5AJ3Q 2JQOA 1KL9A 1PV4A 4L5RC 1XNRQ 1AH9A 1O7IA 2KBNA 2JA5H 3HKZG 3I4MG 1HNWL 3I55A 5IP9H 1BBWA 2PQAB 3PUVA 2KHIA 3RLFA 4IO9A 4GLXA 1NBWA 4JBWA 2KENA 4DV1Q 2RF4A 3ZJYC 2UXDL 1A0IA 3GTMH 1PH1A 3TS2A 3I56A 5DLQE 3STBD 4KHPL 1K8AC 3ERSX 1L1OB 3HKSA 2NN6I 2OQ0A 3HOWG 3S1NH 4JYAL 1G291 3HFZB 4DR5L 1XMOQ 4JI7L 5JJKA 3K8AA 1PH2A 1N36L 3CCJA 5FLMG 4DV4L 3M4PA 4HIOA 4DR3Q 2NN6G 4DV3Q 4HIKA 1VCIA 4C3HH 2UU9L 3GTGH 3HOWH 4TVAB 4LF4L 3UDIA 4JOIC 4LF8Q 1SLJA 1KC8C 2UXCQ 4JI0Q 4JC0A 5IY0A 5IE8A 4B3TQ 1VQDA 4X64Q 4OWWB 2JA7G 2CQOA 1AE2A 2OQKA 4L5SA 1MJEA 2ZM6Q 3GTKH 4IFDI 5M5XH 1X56A 2IT1A 1KD1C 5C44G 4GNXC 1YI2A 4B3MQ 4DV2L 1VQKA 1UE1A 3KOJA 1UE6A 1VQIA 3H15A 4LFCL 1WYDA 3F1ZA 4LF5Q 3M4QA 4QGUA 1VQ8A 1EIYB 1S3OA 1N32Q 2JEBI 4JOIA 4YWMA 4GN4B 4GKKL 2L15A 2WP8J 3EBEA 1N8RC 5IT9c 3I4NG 3F8TA 4DV5L 4BY7H 2XTIA 1L1OC 1GKHA 3PGZA 3W1BA 3CPFA 2IHEA 1QUQA 3GDEA 4LFAL 1LTLA 1IZ6A 1UE7A 4HJ7A 2KHJA 4A3CG 2PNHA 5M3FG 4HJ8A 3RN5A 3I4NH 1HR0L 4LF9Q 4JI3Q 3CP0A 4YWKA 4YY3L 4QJFA 4GNXA 3J81i 2F4VL 1TWAH 1X3FA 2JK8A 2ZTDA 2F52A 2Q2HA 4MZ9A 1EQQA 1WOCA 4LF7L 3E9IA 2NVYH 5M3FH 2DUDA 1NJIC 1VQ9A 2N8NA 2PQAA 2R92G 2BA1A 2Z0SA 4YWLA 4JI1Q 3GTPH 2JA8H 4P75A 4WJ3M 2RCNA 3CC4A 3W1GA 4DNIA 2D0OA 5M5WH 1EYGA 4JI2L 1B8AA 1L0WA 4X62Q 4GLVB 3S15H 2ASBA 2ATWA 2D0PA 2PMZE 1L1OA 4X65Q 3RN2A 1IBMQ 1PH9A 4PZ8A 1LM0A 3S14H 1NY4A 3K0XA 1WJJA 2VZAA 1ASYA 3ULPA 2N49A 3PSIA 1HR0W 1XPRA 4A3KH 4LFBQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPD A;  1J5E Q;  4JBK A;  1PH4 A;  4A3G G;  1XMQ Q;  4DR7 L;  1NMF A;  2OWO A;  5J3B A;  3K7U C;  4NXN Q;  3H3V H;  3PV0 A;  3CC7 A;  4QIW E;  3STB C;  3J80 c;  3G48 A;  4DK6 C;  5M3M H;  4UP7 A;  5IWA L;  1VS0 A;  4DUY L;  1PA6 A;  4A3G H;  3F2C A;  2CKZ B;  2I5H A;  2D62 A;  4QY7 A;  2UUC L;  1S72 A;  2HQL A;  3PO2 G;  2OTJ A;  1PYS B;  5FJ8 G;  1HJP A;  1OXU A;  1X3G A;  4JI5 L;  3G71 A;  2VY3 A;  3PF4 A;  3NEM A;  3I7F A;  4BY1 G;  1XPO A;  1LYL A;  4RG1 A;  5HY6 A;  1HZC A;  4OWX B;  1I94 Q;  1YVC A;  3PIO A;  1UE5 A;  4A3F G;  3M3Y H;  2CWA A;  1U0L A;  2UUA L;  3RLO A;  4A3D G;  4L5Q A;  1WCM G;  2YTY A;  5BR8 Q;  2AWN A;  2ID0 A;  2MNA A;  4UY8 C;  3GTL H;  1I3Q H;  4RMF A;  3M85 A;  1CKO A;  1IYJ B;  3PO3 G;  1VQH A;  4ALP A;  1I50 H;  1XNQ L;  1Y1V H;  3CQZ H;  4A3D H;  4A76 A;  4KHZ A;  1MJC A;  3U58 A;  1HNZ Q;  4NXM L;  1HNW Q;  2NZH A;  2Z6K A;  4B3S L;  4EX5 A;  2NVX H;  4GN3 B;  1PYB A;  2B63 H;  1BVS A;  1N34 L;  1A8V A;  3HOV H;  4YCW A;  5EAY A;  4A4I A;  5IP7 H;  1PH6 A;  4KHP Q;  3UE0 A;  4JYA Q;  2R93 H;  3GTO H;  4DR2 Q;  4JI7 Q;  3GTQ H;  5GAE C;  1M90 C;  4IPH A;  2DGY A;  2CWP A;  2UUB L;  4GNX B;  1SE8 A;  4AQY Q;  2VNU D;  2K5N A;  2VQF Q;  4C3I H;  4UP9 A;  1PFS A;  2UU9 Q;  4GS3 A;  4BXX G;  4YHH Q;  2A1A A;  1OXX K;  1T9H A;  3M9B A;  4JI6 L;  2K5V A;  1NTG A;  3TEH B;  2JJQ A;  1HH2 P;  1IBL L;  1N33 L;  4BXX H;  1VQ5 A;  5GRO A;  3I4M H;  2LXJ A;  5JEA J;  3A5U A;  2ZTC A;  1TWF H;  1QZH A;  4Y52 H;  4A3J G;  2KCM A;  3K80 C;  4DV6 Q;  1MIU A;  1Y14 B;  2HIX A;  1KIX A;  5LMU Q;  4GKJ Q;  4DV2 Q;  4IJL A;  4NPS A;  1YIT A;  4P71 A;  3CC2 A;  4A3J H;  4LFC Q;  2E8G A;  5FLM H;  1EFW A;  2ZTE A;  1HZB A;  3D0F A;  2GN5 A;  4JCV E;  4C3J H;  3T1H L;  1IBK L;  1X65 A;  2VQE L;  3M4O H;  1NMG A;  1D7Q A;  1OTC A;  4XTC S;  3S16 H;  2IY5 B;  3CME A;  3Q8D A;  3BU2 A;  1QZG A;  4DR4 Q;  4OO1 I;  4DR1 Q;  4LF6 L;  4LFA Q;  1U5K A;  1VQA A;  4UPA A;  2E2H H;  4DPG A;  4H02 A;  5AJ3 L;  1X9N A;  2ZJR A;  4POF A;  2JA7 H;  4TQU S;  4OO1 G;  3U50 C;  2I5L X;  1PH3 A;  3ICE A;  3UDX A;  2F4V Q;  1KAW A;  4BA1 I;  4LF7 Q;  2VUM G;  4A3L G;  4DR6 L;  5C44 H;  5C0X J;  4IPG A;  2K50 A;  3L0O A;  1SFO H;  3KF6 B;  1YHA A;  4OON A;  5ELN A;  1OXT A;  3IRB A;  5JEA G;  2IX1 A;  2VUM H;  4PG3 A;  3KJO A;  2QA4 A;  3HKZ E;  1Z47 A;  1XMO L;  1YNX A;  1X55 A;  1RIP A;  5LMN Q;  1P8L A;  5GAD C;  4DV3 L;  3CMA A;  3CCV A;  2RHS B;  3S2D H;  3HOX G;  2K14 A;  1K0R A;  4A3C H;  4UP8 A;  4BBS G;  2EIF A;  5JJI A;  3OTO Q;  1GD7 A;  2YTX A;  3PUY A;  2AWO A;  1LUZ A;  1FJG L;  4A93 G;  4LWC A;  2B29 A;  2UXC L;  3NBH B;  1G6P A;  2MFI A;  4R4T A;  4X64 L;  4DV0 Q;  3JAM c;  2VL6 A;  1KRS A;  1Q12 A;  4LUO A;  3H3V I;  2R92 H;  1C0A A;  2ZM6 L;  1KHI A;  3G4S A;  4DK3 C;  1SR3 A;  4PZ6 A;  2YU9 H;  1S40 A;  4GN5 A;  1VQL A;  1WFQ A;  4AH6 A;  4PZ7 A;  4DUZ Q;  4LF5 L;  3FHW A;  1FL0 A;  1Q81 C;  4LW1 A;  2HT1 A;  1N32 L;  5C0X G;  2UXB L;  3PIP A;  4X66 L;  1VQG A;  3L2P A;  4JG2 A;  1QVG A;  2KCT A;  3S1Q H;  2IHF A;  4IPC A;  4BBR G;  2A8V A;  2NVT H;  4KI0 A;  1YHB A;  3T1Y L;  2MO1 A;  3U4Z A;  4LF9 L;  3UE1 A;  2Z6K C;  4BBR H;  3D31 A;  4NXM Q;  2N78 A;  3HOZ G;  2E5L L;  4JV5 Q;  2I5M X;  2Q2I A;  4JI8 Q;  4B3S Q;  4APV A;  1JB7 A;  3H0G G;  2OTL A;  3PO2 H;  1I5F A;  5FJ8 H;  1HNX Q;  1K3R A;  2YV5 A;  3S17 H;  4JI4 Q;  2BA0 A;  3J7Z C;  4BY1 H;  3KF6 A;  4K0K Q;  1E3P A;  2K75 A;  5M5Y H;  4HJ5 A;  4C2M H;  2AKW B;  1V1Q A;  5GAG C;  3H0G H;  1HZA A;  4X62 L;  2R7D A;  2MO0 A;  4A3F H;  2UUB Q;  5FLX c;  4X65 L;  3KDF A;  2XGT A;  3TRE A;  1IBM L;  5JJL A;  1YHQ A;  1VQC A;  4B3R L;  1WCM H;  3BZC A;  3PUW A;  2JA9 A;  1VQB A;  4OX9 L;  1VQF A;  4OXP A;  2HHH L;  3F2B A;  3CCE A;  4FDB A;  1IL2 A;  1CUK A;  1J5E L;  3PO3 H;  2CFM A;  1GO3 E;  4PMW A;  1IBL Q;  4A3M G;  3PF5 A;  2UXD Q;  3E0E A;  3UDG A;  1XJV A;  1CSP A;  4NXN L;  3PCO B;  1XTD A;  5HGQ A;  3S1M H;  1PHJ A;  2FXQ A;  4DR5 Q;  4YCV A;  1TWG H;  1VQE A;  1N36 Q;  4DV4 Q;  3J80 i;  4A3I G;  3FKI G;  3ER0 A;  1ASZ A;  4KLK A;  4JBM A;  5C4X G;  1A62 A;  1C7Y A;  5IYB G;  4MNO A;  4P72 A;  2JA6 G;  3KFU A;  2VS1 A;  4LF4 Q;  4LUZ A;  2K4K A;  2LSS A;  3HOY G;  2GVB A;  3GO5 A;  3CCS A;  1I6H H;  4DV7 L;  3KYH C;  3BJU A;  5IYB H;  4A3E G;  1GM5 A;  2JA6 H;  2B3G A;  1J6Q A;  4QL5 A;  2VQE Q;  2E2I H;  3HOU G;  1D8L A;  3BZK A;  1PVO A;  1TXY A;  1K8G A;  2PI2 E;  2H5X A;  1VQ6 A;  3PUX A;  1YIJ A;  1QVC A;  4LF6 Q;  2JA5 G;  2R7F A;  1CSQ A;  1X6O A;  1NE3 A;  5IP9 G;  4R4C A;  5BR8 L;  1YJN A;  1Q7Y C;  1V43 A;  1E24 A;  4ME3 A;  2WAQ G;  4AYB G;  3DLL A;  2K52 A;  1YEZ A;  2Y0S G;  2YTV A;  3MEF A;  3RR5 A;  4IFD J;  2AHO B;  1HNZ L;  4JBJ A;  4GOP C;  1L2F A;  3TQY A;  4GKK Q;  1KQS A;  1W3S A;  1AE3 A;  2AMC B;  2OCE A;  4DKA C;  4LNQ A;  3AQQ A;  4DV5 Q;  3FP9 A;  3KLW A;  1Q82 C;  3CAM A;  1K9M C;  1MKH A;  1OXS C;  2MQH A;  3K7A H;  4POG A;  4IOA A;  2ALY B;  2V1C C;  4DR2 L;  3E9H A;  4L5T A;  3CXC A;  3AFP A;  3A0J A;  3RZD H;  3KF8 B;  1JJ2 A;  4Y7N H;  3J81 c;  1YZ6 A;  4GLA C;  4AQY L;  1PH8 A;  1HR0 Q;  3RLN A;  1VQM A;  1XNR L;  4YY3 Q;  2VQF L;  3K81 C;  1Y1W G;  2BH8 A;  4YHH L;  4R4I A;  2EXD A;  3CPW A;  2RHQ B;  1Q46 A;  4MTN A;  1IXR A;  5ELO A;  3CCQ A;  1FJG Q;  3KJP A;  3AYH B;  4DV1 L;  1Y1W H;  1SRO A;  1N9W A;  4IOC A;  4GOP A;  1QVF A;  4A3L H;  4JI2 Q;  3CCU A;  1CKN A;  1E1T A;  4J15 A;  1H95 A;  5C4J H;  1Q1E A;  2WB1 G;  3AFQ A;  3KDF B;  4NB3 A;  2NVQ H;  2QEX A;  4O0A A;  1X3E A;  5GQO A;  2CCZ A;  2WFW A;  4LUV A;  4XIG S;  3J7A 5;  1K83 H;  4DV6 L;  1PH5 A;  3M7N A;  1VQO A;  5IYD H;  3G6E A;  4DR3 L;  4GKJ L;  5K36 G;  5LMU L;  5IYC G;  4DR6 Q;  3U4V A;  2ZJP A;  2JEA I;  4IFD G;  1VQP A;  3I4O A;  1YJ9 A;  1XPU A;  4X6A H;  3ULJ A;  1W2B A;  2PI2 A;  4LF8 L;  4DR7 Q;  2K5H A;  4BY7 G;  2UXB Q;  1WI5 A;  3CD6 A;  4X66 Q;  5IYC H;  3OW2 A;  3HOX H;  3DM3 A;  5C3E G;  1B7Y B;  1BKB A;  2Q2U A;  4JI0 L;  4B3T L;  3EIV A;  1UWV A;  5IWA Q;  4DUY Q;  4BBS H;  4A3B G;  2WAQ E;  4AYB E;  1SMX A;  2Y0S E;  4DR4 L;  4QQB X;  1B70 B;  4DR1 L;  2UUC Q;  1JE5 A;  4A93 H;  2I0Q A;  1E22 A;  1SRU A;  2NZO A;  5C3E H;  3T1Y Q;  4B3M L;  1V9P A;  4JI5 Q;  2R6G A;  4A3B H;  4DAM A;  5C0X I;  1VQN A;  3VDY A;  3L7Z C;  2E5L Q;  2JA8 G;  3TS0 A;  1UEB A;  4O2D A;  1A63 A;  4R1J A;  4YCU A;  2C35 B;  4DAY B;  2UUA Q;  1R9T H;  1EQR A;  1Q1B A;  1Z9F A;  3CW2 C;  3W5O A;  5IYD G;  3AEV A;  4A3K G;  3CCL A;  3ULL A;  1JJC B;  1FGU A;  1XNQ Q;  4B3R Q;  5LMN L;  4JI3 L;  2ES2 A;  3SGI A;  1FVI A;  1VQ4 A;  2N3S A;  4OX9 Q;  1HZ9 A;  2HHH Q;  3UDF A;  2VW9 A;  4HJ9 A;  2ZJQ A;  2QGQ A;  5M3M G;  2WB1 E;  3CCR A;  1E7Z A;  3OTO L;  3A5Z B;  1N34 Q;  1P16 A;  3HOZ H;  4JI1 L;  1EUJ A;  2LXK A;  4P74 A;  4EQ5 A;  3EN2 A;  4OWT B;  1KXL A;  5GAH C;  1TWC H;  4DV0 L;  1JJG A;  1Q8K A;  2YYZ A;  3TRZ A;  3RZO H;  3CF5 A;  2E2J H;  1YBY A;  3JAM i;  3LGJ A;  2R7Z G;  1EOV A;  1RL2 A;  5H1S E;  3S24 A;  3NEL A;  1YJW A;  1E1O A;  4HJA A;  1Q86 C;  1M1K C;  2F3I A;  3A74 A;  3NEN A;  1GVP A;  4IJH A;  4R4O A;  5LMN W;  4JI6 Q;  4LFB L;  3F2D A;  3MXN B;  4DUZ L;  4DV7 Q;  4R4Q A;  3S1R H;  4GOP B;  1XMQ L;  1N33 Q;  2R7Z H;  1JT8 A;  1EWI A;  1CKN B;  1CKM A;  3OYY A;  1EIF A;  4P73 A;  4WJ4 A;  3CCM A;  2GVA A;  1G51 A;  1TWH H;  1Y1V G;  4A3M H;  1BBU A;  4BA2 I;  1DGS A;  3J81 j;  1K73 C;  2BH2 A;  2HIV A;  1PH7 A;  4A75 A;  1X54 A;  2IX0 A;  2Q2T A;  2EQS A;  2B63 G;  4A3I H;  3HOV G;  3FKI H;  1C9O A;  5C4X H;  3B6Y A;  3RNU A;  5IP7 G;  4JV5 L;  1VQJ A;  4HIM A;  3GTJ H;  2R93 G;  3T1H Q;  1IBK Q;  1I94 L;  4JI8 L;  3WWV A;  3JC6 6;  4AIM A;  3GD7 A;  2JE6 I;  1HNX L;  1VQ7 A;  5E7N A;  1OXV A;  1SN8 A;  3S2H H;  3HOY H;  3I2Z A;  4JI4 L;  1QUQ B;  4K0K L;  1JMC A;  4A3E H;  4HID A;  3HOU H;  2A19 A;  1KRT A;  3PUZ A;  5AJ3 Q;  2JQO A;  1KL9 A;  1PV4 A;  4L5R C;  1XNR Q;  1AH9 A;  1O7I A;  2KBN A;  2JA5 H;  3HKZ G;  3I4M G;  1HNW L;  3I55 A;  5IP9 H;  1BBW A;  2PQA B;  3PUV A;  2KHI A;  3RLF A;  4IO9 A;  4GLX A;  1NBW A;  4JBW A;  2KEN A;  4DV1 Q;  2RF4 A;  3ZJY C;  2UXD L;  1A0I A;  3GTM H;  1PH1 A;  3TS2 A;  3I56 A;  5DLQ E;  3STB D;  4KHP L;  1K8A C;  3ERS X;  1L1O B;  3HKS A;  2NN6 I;  2OQ0 A;  3HOW G;  3S1N H;  4JYA L;  1G29 1;  3HFZ B;  4DR5 L;  1XMO Q;  4JI7 L;  5JJK A;  3K8A A;  1PH2 A;  1N36 L;  3CCJ A;  5FLM G;  4DV4 L;  3M4P A;  4HIO A;  4DR3 Q;  2NN6 G;  4DV3 Q;  4HIK A;  1VCI A;  4C3H H;  2UU9 L;  3GTG H;  3HOW H;  4TVA B;  4LF4 L;  3UDI A;  4JOI C;  4LF8 Q;  1SLJ A;  1KC8 C;  2UXC Q;  4JI0 Q;  4JC0 A;  5IY0 A;  5IE8 A;  4B3T Q;  1VQD A;  4X64 Q;  4OWW B;  2JA7 G;  2CQO A;  1AE2 A;  2OQK A;  4L5S A;  1MJE A;  2ZM6 Q;  3GTK H;  4IFD I;  5M5X H;  1X56 A;  2IT1 A;  1KD1 C;  5C44 G;  4GNX C;  1YI2 A;  4B3M Q;  4DV2 L;  1VQK A;  1UE1 A;  3KOJ A;  1UE6 A;  1VQI A;  3H15 A;  4LFC L;  1WYD A;  3F1Z A;  4LF5 Q;  3M4Q A;  4QGU A;  1VQ8 A;  1EIY B;  1S3O A;  1N32 Q;  2JEB I;  4JOI A;  4YWM A;  4GN4 B;  4GKK L;  2L15 A;  2WP8 J;  3EBE A;  1N8R C;  5IT9 c;  3I4N G;  3F8T A;  4DV5 L;  4BY7 H;  2XTI A;  1L1O C;  1GKH A;  3PGZ A;  3W1B A;  3CPF A;  2IHE A;  1QUQ A;  3GDE A;  4LFA L;  1LTL A;  1IZ6 A;  1UE7 A;  4HJ7 A;  2KHJ A;  4A3C G;  2PNH A;  5M3F G;  4HJ8 A;  3RN5 A;  3I4N H;  1HR0 L;  4LF9 Q;  4JI3 Q;  3CP0 A;  4YWK A;  4YY3 L;  4QJF A;  4GNX A;  3J81 i;  2F4V L;  1TWA H;  1X3F A;  2JK8 A;  2ZTD A;  2F52 A;  2Q2H A;  4MZ9 A;  1EQQ A;  1WOC A;  4LF7 L;  3E9I A;  2NVY H;  5M3F H;  2DUD A;  1NJI C;  1VQ9 A;  2N8N A;  2PQA A;  2R92 G;  2BA1 A;  2Z0S A;  4YWL A;  4JI1 Q;  3GTP H;  2JA8 H;  4P75 A;  4WJ3 M;  2RCN A;  3CC4 A;  3W1G A;  4DNI A;  2D0O A;  5M5W H;  1EYG A;  4JI2 L;  1B8A A;  1L0W A;  4X62 Q;  4GLV B;  3S15 H;  2ASB A;  2ATW A;  2D0P A;  2PMZ E;  1L1O A;  4X65 Q;  3RN2 A;  1IBM Q;  1PH9 A;  4PZ8 A;  1LM0 A;  3S14 H;  1NY4 A;  3K0X A;  1WJJ A;  2VZA A;  1ASY A;  3ULP A;  2N49 A;  3PSI A;  1HR0 W;  1XPR A;  4A3K H;  4LFB Q; 
#chains in the Genus database with same CATH topology
 5KGU A;  1J5E Q;  2EJF C;  1GHK A;  5FKA C;  4UP7 A;  1PA6 A;  4A3G H;  2CKZ B;  2UUC L;  1J9O A;  2HQL A;  3PO2 G;  1PYS B;  2RQX A;  1U9R A;  5FJ8 G;  3G71 A;  2VY3 A;  3I7F A;  3DUZ A;  5IGF A;  1HZC A;  4EQO A;  1A15 A;  3PIO A;  2PCF B;  4A3F G;  3M3Y H;  4KJO A;  4L5Q A;  1RHP A;  1WCM G;  2YTY A;  4IAL A;  5FOB B;  2ID0 A;  2A6E C;  2PYK A;  5COY A;  3M85 A;  4A3K B;  2L5T A;  3Q22 A;  4A3D H;  1MJC A;  1D5X C;  1TVX A;  2NZH A;  1ZXT A;  3SXH A;  2FJ2 A;  2Z6K A;  4A3G B;  1X3Q A;  4DFA A;  3QO2 A;  1N34 L;  4B9X A;  1BNZ A;  4YCW A;  3MEH A;  5EAY A;  4KHP Q;  3ITP A;  3GTO H;  4JI7 Q;  4DF7 A;  5GAE C;  1B53 A;  1M90 C;  4IPH A;  2VNU D;  3T53 B;  2K5N A;  5F2D A;  4C3I H;  4UP9 A;  2VQF Q;  2UU9 Q;  4GS3 A;  5BN4 A;  1B3Q A;  4YHH Q;  4JI6 L;  1V1P B;  3M3Y B;  3T16 A;  1BR9 A;  2BDO A;  1AW7 A;  1O7Z A;  2A73 B;  2WAC A;  1QZH A;  4A3J G;  2NUC A;  4A3D B;  2HIX A;  5LMU Q;  2OEO A;  1EZ6 A;  2E75 C;  5D65 A;  3D4R A;  3MC0 B;  4NPS A;  1U4R A;  4B9W A;  3CC2 A;  3W3A A;  5ELC A;  3ND8 A;  1HZB A;  3M4O H;  2SEB D;  1X65 A;  1NMG A;  5EQ0 A;  3KLR A;  4XTC S;  5J39 A;  3BU2 A;  4OO1 I;  4DR1 Q;  2EOT A;  1CA6 A;  2IW3 A;  4LF6 L;  3GV3 A;  4DPG A;  5C4Z A;  4POF A;  4TQU S;  3BDC A;  4HED A;  3U50 C;  4NW2 A;  2F4V Q;  4RHR A;  4LF7 Q;  4DR6 L;  1B3A A;  2Q8I B;  5C44 H;  3WDN A;  4OO1 H;  1ZEQ X;  3L0O A;  4OON A;  1ET9 A;  1FNW A;  2DY7 A;  2IX1 A;  2VUM H;  2HDM A;  2EYJ A;  1XMO L;  4IUP A;  1X55 A;  3E5S A;  4DV3 L;  5JPN C;  2A68 C;  3CMA A;  3S2D H;  1STE A;  3TSS A;  2LY7 A;  3PUY A;  2AWO A;  1EU4 A;  4ZYS A;  4LUO A;  3H3V I;  1TS3 A;  4DN4 M;  4DK3 C;  2YU9 H;  1HUN A;  4PZ7 A;  4OHJ A;  3HEJ A;  2MJ8 A;  4DUZ Q;  4J8Q A;  4DK1 A;  2PQE A;  2VUM B;  5C0X G;  4X66 L;  2NB0 A;  1VQG A;  3L2P A;  1EY4 A;  3VYS A;  2IHF A;  4KI0 A;  5D3D A;  1YHB A;  5EKL A;  3S2D B;  3BG3 A;  2MO1 A;  2N55 A;  3C1F A;  4G7O C;  4RH6 A;  3UE1 A;  3R2I A;  3KF8 A;  2I5M X;  4APV A;  3H0G G;  4CGY B;  3GV6 A;  1MBY A;  4OEM B;  4BBS B;  1L0X B;  4RGM A;  4JI4 Q;  1DON A;  2F0T A;  1F2Y A;  3NWT A;  4KKS A;  4BY1 H;  1QCB D;  3KF6 A;  2TMP A;  5M5Y H;  4C2M H;  2YU9 B;  4PNY A;  1HZA A;  1JWU D;  5IGE A;  1HQR D;  5JAV A;  2DNC A;  2MPM A;  5KRU A;  2XGT A;  1U4P A;  5JJL A;  1YHQ A;  3BZC A;  2A68 D;  3FRP B;  3EFX D;  1VQB A;  4ZKB B;  5CV4 A;  1J5E L;  4JK1 C;  3R2T A;  4A3M G;  3E0E A;  1CSP A;  2ZXO A;  1XTD A;  3KBG A;  2OXP A;  1PHJ A;  4LAA A;  2KHS A;  3OOC A;  1VQE A;  1ASZ A;  3J80 i;  1TS4 A;  2A6H C;  3I3C A;  1SXT A;  1PRT B;  5IT9 E;  2JA6 G;  3KFU A;  1QOH A;  2Z1C A;  3HOY G;  2KVM A;  4BY1 B;  3BJU A;  5IYB H;  1PZJ D;  4C2M B;  1J6Q A;  3HOU G;  1PVO A;  1D8L A;  4R9W A;  2VB3 X;  2H5X A;  1VDZ A;  1CSQ A;  1X6O A;  2EY6 A;  4RCO A;  5IP9 G;  1H9S B;  2J0T D;  1Q7Y C;  2XRQ D;  3QOJ A;  1E24 A;  4ME3 A;  4IFD J;  3DLL A;  2Y0S G;  3S1R B;  2AHO B;  5A35 A;  1T5X D;  5JOB A;  2B2V A;  3TQY A;  3BDO A;  4JPB W;  2OCE A;  2EY1 A;  1AEX A;  1Q82 C;  3MAQ A;  4U67 3;  2F0L A;  5G3L F;  2V1C C;  2EY2 A;  1JJ2 A;  3KF8 B;  3IFD A;  1IHZ A;  1YZ6 A;  4GLA C;  3J81 c;  4KY6 A;  3RLN A;  1VQM A;  1XNR L;  2VQF L;  3GTJ B;  4YHH L;  4R4I A;  2EXD A;  2RSN A;  5CGK A;  1IXR A;  3NQI A;  3AYH B;  1Y1W H;  4X3S A;  1N9W A;  1E1T A;  5C4J H;  2EYM A;  1GUT A;  1HUM A;  2PZU A;  2MHV A;  3J7A 5;  1WD1 A;  1K83 H;  3M7N A;  2A6H D;  4NDX A;  1JOO A;  2L55 A;  5LMU L;  1VQP A;  1YJ9 A;  1ICF B;  3E0J A;  4X6A H;  1W2B A;  3KK7 A;  2A5H A;  1SJE D;  1ONL A;  5IYC H;  3OW7 A;  2IWH A;  1B7Y B;  1CFM A;  1SSO A;  5IWA Q;  4A3B G;  1HPC A;  1B70 B;  4DR1 L;  1JE5 A;  1G6Z A;  5C3E H;  3T1Y Q;  1D1I A;  1ET6 A;  1Y1W B;  1UEB A;  2F0I A;  3I90 A;  1A63 A;  4BWG B;  1IYV A;  4V19 0;  1K83 B;  4CBV A;  1Q1B A;  1Z9F A;  1K0S A;  3CW2 C;  2WB1 B;  4A3K G;  3ULL A;  3AMU A;  1XNQ Q;  4B3R Q;  3WOF A;  1HZ9 A;  4RHS A;  2HHH Q;  4OX9 Q;  1PXU A;  2QDL A;  5CV9 A;  5CR3 A;  2BOS A;  1IKL A;  1EUJ A;  4JI1 L;  2BCO A;  2Z4H A;  4CJ1 B;  5C3E B;  1KXL A;  4N9P A;  1ESF A;  1Q8K A;  1SE4 A;  3SEB A;  1EOV A;  5H1S E;  3S24 A;  1Q86 C;  1E1O A;  2RCF A;  4HJA A;  4IJH A;  3NEN A;  1GVP A;  4R4O A;  3VA7 A;  4L8J A;  4DUZ L;  2R7Z H;  1JT8 A;  1EWI A;  2F3W A;  3OYY A;  3BVG A;  1PRT F;  4WJ4 A;  3A8K E;  3S15 B;  1EYC A;  1TWH H;  3K5O A;  1BBU A;  4BA2 I;  3S14 B;  1SYE A;  1BUV T;  2HIV A;  3ND9 A;  4A75 A;  2M9V A;  2F3V A;  4M1U B;  4A3I H;  4HIM A;  3URY A;  5M3M B;  3S2H H;  5E7N A;  3P7J A;  4JI4 L;  1C8C A;  1EY0 A;  3D6C A;  4C3I G;  1BOS A;  2A19 A;  3PUZ A;  1T5E A;  1NR2 A;  1IL8 A;  1KL9 A;  1PV4 A;  3C3L A;  2R7Z B;  1AH9 A;  1JB3 A;  1O7I A;  3NP8 A;  5KIX A;  1EQV A;  1EY5 A;  3W2D A;  3JAM E;  3PUV A;  1WTQ A;  4GZY C;  1KLG D;  1FR3 A;  3GTM H;  1M8A A;  2KOL A;  3HKS A;  1L1O B;  4JYA L;  3H91 A;  1E2V A;  2F0M A;  2E76 C;  1Y1V B;  1PH2 A;  3M4P A;  4DXF A;  2NN6 G;  4HIK A;  4C3H H;  1C48 A;  4JOI C;  3SVM A;  5IOD A;  2B63 B;  1SLJ A;  3VYR A;  4G7Z C;  1KC8 C;  4FF2 A;  3GTQ B;  1GHJ A;  1XWE A;  4B3T Q;  4OWW B;  1BXT A;  2B2U C;  2OQK A;  3V2T A;  4IFD I;  5M5X H;  1KD1 C;  1LTR D;  1F2L A;  5C44 G;  4GNX C;  4DV2 L;  1CZW A;  1UE1 A;  3V96 A;  4CJ2 C;  4K5V A;  3GTM B;  1N32 Q;  2JEB I;  4J1M A;  2J7Z A;  5E4W C;  5K36 H;  3TBI B;  1Z6H A;  5EJW A;  1TT2 A;  3F8T A;  1RKN A;  2QEJ C;  3HZX A;  3CPF A;  3GDE A;  4X3K A;  3RN5 A;  5M3F G;  2KCC A;  3I4N H;  1PFN A;  1WD0 A;  3CP0 A;  4PMB A;  2JK8 A;  2PMZ B;  4HTH A;  2EZV A;  5EKK A;  2NVY H;  1VQ9 A;  2LS0 1;  2N8N A;  3IKJ A;  2PQA A;  3MHB A;  4P75 A;  5M5X B;  2EVB A;  1H9K A;  5M5W H;  1MSG A;  3DHQ A;  4X62 Q;  3CHB D;  2D0P A;  2K01 A;  1YNN C;  4I65 A;  4DAV A;  2K28 A;  3A54 A;  3E3X A;  1NY4 A;  1WJJ A;  2VZA A;  3PSI A;  2B8F A;  1LTA D;  3QOL A;  4IPD A;  3VR3 A;  1XMQ Q;  1NMF A;  2XVS A;  3K7U C;  1MD2 D;  2AQ2 B;  2AQ3 B;  2LKV A;  3PV0 A;  4QIW E;  2K04 A;  4M8A A;  3J80 c;  1EOT A;  5EGT A;  5IWA L;  3I4N B;  2HCI A;  3NPP A;  3R8B A;  2D62 A;  2K7V A;  3TP6 A;  1OXU A;  2NVY B;  3NEM A;  5FO8 B;  1XPO A;  4BY1 G;  5CV7 A;  1I94 Q;  1UE5 A;  5IT9 L;  5M5W B;  1I4G A;  1U0L A;  2LFN A;  3RLO A;  2B2Y A;  2N88 A;  2AWN A;  3GTL H;  3TP8 A;  1I3Q H;  1CKO A;  4RA8 A;  5CV5 A;  5LL6 X;  1QJO A;  4XQJ A;  1XNQ L;  1A2U A;  4NXM L;  1I4Q A;  4MN3 A;  2F0H A;  1B4O A;  4IUN A;  4EX5 A;  4GN3 B;  1PYB A;  2NVT B;  3HOV H;  1A8V A;  2DNE A;  3LX0 A;  3M4Y A;  3K58 A;  3UE0 A;  2R93 H;  1DM0 B;  4DR2 Q;  2KCN A;  5IGG A;  5C5L A;  3OWE B;  1YNN D;  2UUB L;  5I2Y A;  4BXX G;  1T9H A;  3M9B A;  5JVG 3;  2TSS A;  1NTG A;  2QIL A;  2JJQ A;  1HH2 P;  1IBL L;  1VQ5 A;  5GRO A;  2LXJ A;  5JEA J;  3A5U A;  1I3Q B;  2ZTC A;  2EPB A;  2DN8 A;  2O5J C;  5DAU A;  2KCM A;  4DV6 Q;  1VMC A;  1YIT A;  4P71 A;  1JCK B;  2ENB A;  4LFC Q;  1G8Z D;  5FLM H;  4OGQ C;  2ZTE A;  3S1M B;  5I4D A;  1KAA A;  1D7Q A;  2G5D A;  1NUC A;  5T1I A;  2PZW A;  5I9O A;  3VYT A;  3Q8D A;  3CME A;  2F0O A;  1Y8N B;  4G57 A;  1U5K A;  1I6V C;  4UPA A;  4H02 A;  2ZJR A;  4ID6 A;  1EQT A;  1KAW A;  2K50 A;  3DEO A;  1PDQ A;  1QB5 D;  2QA4 A;  3Q6S A;  3V05 A;  1Z47 A;  2XRS D;  1YNX A;  2F0S A;  1RIP A;  5LMN Q;  1ZKO A;  3CCV A;  1E0B A;  1ROD A;  2F0J A;  2JN4 A;  2YTX A;  1V1P A;  4FF4 A;  2B29 A;  3NBH B;  2L0C A;  3J7Y W;  2CH4 W;  4IZ8 A;  1KRS A;  2J4X A;  2R92 H;  5M9O A;  1KTK A;  1QNU A;  5CBA E;  5IGC A;  1DOM A;  1VQL A;  1SYD A;  1U4M A;  3FHW A;  3IL8 A;  1N32 L;  3QJY A;  2RDF A;  2UXB L;  3NBI A;  2A74 C;  1M4V A;  1QVG A;  1EY8 A;  3S1Q H;  4KMU C;  4R8N A;  1SYB A;  5I6W A;  4BBR H;  2ZXP A;  2N78 A;  2E5L L;  4JV5 Q;  2QDB A;  4B3S Q;  4R8I A;  1I5F A;  1JOK A;  1F9R A;  2R92 B;  2MP1 A;  4A93 B;  2XWB B;  4N8F A;  1E3P A;  1UUP A;  4HJ5 A;  2CVR A;  2XWJ B;  4X62 L;  1H9J A;  1RTN A;  4XXE A;  1PTO C;  5FLX c;  1II3 A;  4KKT A;  4Z9C B;  2JA9 A;  1FNV A;  3F2B A;  1WTP A;  4PMW A;  3S1Q B;  3PF5 A;  1ESR A;  2ZT9 C;  3JAM L;  1W6K A;  4ZRZ A;  4YCV A;  4BBR B;  4A3I G;  2JYO A;  4KLK A;  4UAI A;  4K5W A;  4DNR B;  4LF4 Q;  1I6H H;  3CCS A;  2SNM A;  3P1H A;  1GM5 A;  2NYZ D;  2VQE Q;  3P20 A;  1TWC B;  1TXY A;  3X3M A;  2PI2 E;  1VQ6 A;  1YIJ A;  1EL0 A;  2R7F A;  1NE3 A;  2I46 A;  4R4C A;  2WAQ G;  4AYB G;  2K52 A;  1YEZ A;  2YTV A;  1HXY D;  1JIC A;  4V0B A;  2EXZ A;  1PFB A;  4GOP C;  1KQS A;  1AE3 A;  4WJW A;  1STA A;  4DKA C;  4KD3 A;  4LNQ A;  5C3X A;  3HS0 C;  1K9M C;  1MKH A;  2G9D A;  2MQH A;  3K7A H;  4C3H G;  4IOA A;  4DR2 L;  3CXC A;  3AFP A;  1PTO D;  1I6H B;  1WTH A;  3U9S A;  1KLU D;  2K1B A;  5KYI A;  3K81 C;  4EQN A;  2IPK D;  2BH8 A;  1JC7 A;  2AUK A;  3ERO A;  3RUZ A;  3CPW A;  2RHQ B;  3CCQ A;  4NMZ A;  1FJG Q;  3KJP A;  3OPO A;  4DV1 L;  2B2W C;  3AB9 A;  1S5B D;  3L3O C;  1QVF A;  4A3L H;  2F0V A;  1H95 A;  1F2Z A;  3AFQ A;  4NB3 A;  1X3E A;  3OIQ A;  4KKU A;  4N9T A;  5GQO A;  3SE0 A;  4DV6 L;  2EYL A;  5JEA H;  4DR3 L;  2KEC A;  2JXM B;  5K36 G;  4OIJ A;  3U4V A;  2ZJP A;  4IFD G;  1TU2 B;  1SDF A;  1EWH A;  2B2T C;  4LF8 L;  4K8J A;  3LWE A;  3K7A B;  4FXD A;  3OW2 A;  3HOX H;  4K6L A;  2EJG C;  4JI0 L;  3EIV A;  1UWV A;  4BBS H;  1LT4 D;  1TY0 A;  2Y0S E;  4QQB X;  5E3F A;  1G91 A;  2F4I A;  2NZO A;  1WTO A;  4B3M L;  4JI5 Q;  1SYC A;  1H9S A;  1B1Z A;  1VQN A;  3VDY A;  1Q3L A;  3TS0 A;  1G2S A;  3NTK A;  1GJX A;  3I73 A;  1GUS A;  3LWU A;  4R1J A;  2QCP X;  4DAY B;  1EQR A;  2A69 C;  5A2Q E;  3W5O A;  3GQB A;  3CCL A;  1A6X A;  1JR0 D;  4H0L C;  1JJC B;  1LAC A;  3T51 B;  5LMN L;  1VQ4 A;  1DCZ A;  1FVI A;  2DY8 A;  3HOX B;  1DOL A;  4K14 A;  1F9P A;  3UDF A;  1D2B A;  1EY7 A;  5C6A A;  1W6J A;  4BY7 B;  2NTS A;  2LXK A;  1JJG A;  2YYZ A;  1TQO A;  1YBY A;  4L63 B;  2F0E A;  2F3I A;  5LMN W;  4LFB L;  3F2D A;  3MXN B;  4DV7 Q;  3S1R H;  3GTP B;  3PIP 3;  1N33 Q;  2Z6B A;  5JPM C;  3FVQ A;  4P73 A;  5BN5 A;  1WVL A;  4RGT A;  1PFM A;  5KND A;  1G51 A;  3J81 j;  1K73 C;  1HQM C;  1X54 A;  2WII B;  3EJI A;  4Q5V A;  3HOV G;  3FKI H;  4DGZ A;  1C9O A;  3RNU A;  4JV5 L;  1VQJ A;  4F7X A;  3GTJ H;  2R93 G;  3T1H Q;  1IBK Q;  3FPU B;  1VQ7 A;  1SN8 A;  4UDU C;  1QUQ B;  3NE5 B;  1EY9 A;  3BYY B;  2A69 D;  5ISR A;  4CDE C;  5AJ3 Q;  1WTW A;  4H13 C;  1LT6 D;  5C5M A;  2JA5 H;  2KQ3 A;  1XXG A;  1BBW A;  4IO9 A;  1NBW A;  4F88 A;  4K6D A;  4KY7 A;  1ILQ A;  3ZJY C;  5DNF A;  3LNN A;  1PH1 A;  3TS2 A;  4KHP L;  3STB D;  1K8A C;  3SK6 A;  3HOW G;  3HFZ B;  1G29 1;  4JI7 L;  5CV8 A;  5JJK A;  3CQZ B;  3CCJ A;  5FLM G;  3FKI B;  3T4A C;  1VCI A;  2UU9 L;  4OL7 A;  1STY A;  4LF4 L;  3UDI A;  1JOQ A;  3PMF A;  1GUW A;  2UXC Q;  2DJG C;  5IY0 A;  1VQD A;  4X64 Q;  3D4D A;  1CHQ D;  2JA5 B;  1X56 A;  4ZUJ A;  1YI2 A;  1VQK A;  1CHP D;  1RD9 D;  5KYL A;  4LF5 Q;  4K5X A;  1F77 A;  4YWM A;  4GN4 B;  3K5L A;  5EPJ A;  2WP8 J;  3EQL C;  3K0Y A;  4RKB A;  2XTI A;  1STH A;  3W1B A;  1IZ6 A;  1UE7 A;  5EBD A;  4HAE A;  2PNH A;  4LF9 Q;  4JI3 Q;  3HP3 A;  4YWK A;  2FMM A;  2F4V L;  3G7L A;  4TSS A;  1EQQ A;  1PZI D;  4LF7 L;  1NJI C;  4HCS A;  1TKW B;  2R92 G;  2Z0S A;  3TP7 A;  4WJ3 M;  4KJN A;  4DNI A;  2E2H B;  4ZLT F;  4GLV B;  3S15 H;  2ASB A;  1SNQ A;  1L1O A;  4X65 Q;  3VR4 A;  1IBM Q;  1Q8I A;  4QIW B;  3S14 H;  3ULP A;  2N49 A;  2KEE A;  4JBK A;  4A3G G;  2OWO A;  5J3B A;  4S3S A;  1LT3 D;  3MVV A;  4FNF A;  3CC7 A;  2FFK B;  4RFB A;  4DK6 C;  5M3M H;  2KED A;  1EEI D;  4KN4 C;  4NKL A;  4QY7 A;  1SYF A;  5D3I B;  3G6J B;  1ML0 D;  1HJP A;  1X3G A;  4JI5 L;  3PF4 A;  1CZG A;  2F0F A;  1DJR D;  1Y69 U;  1LYL A;  4RG1 A;  1X32 A;  3J81 E;  4OWX B;  3NTH A;  2CWA A;  3DWP A;  1ZYR D;  4A3D G;  2D2C C;  2Z4I A;  5BR8 Q;  2MNA A;  4OEL B;  1RJT A;  4ALP A;  1I50 H;  1Y1V H;  4A76 A;  1HNW Q;  3U58 A;  3RD4 A;  1NCV A;  4CKB A;  2NVX H;  1I4R A;  2B63 H;  4A4I A;  1E2W A;  3GTQ H;  2V4D A;  3VR2 A;  1X3P A;  2GA4 B;  4AQY Q;  1SE8 A;  3K57 A;  3DMU A;  1PFS A;  2A1A A;  1OXX K;  1XYI A;  4FP5 D;  4DA2 A;  5G3L D;  1G2T A;  1VMP A;  1N33 L;  3HRZ C;  1TY2 A;  4Y52 H;  1I50 B;  3K80 C;  1WCM B;  4GKJ Q;  1B44 D;  2HDL A;  4IJL A;  4IUV A;  2NVX B;  4A3J H;  3KUP A;  2HD3 A;  2E8G A;  3H3V C;  2Q8T A;  1EFW A;  3NUC A;  3TME A;  4EGV A;  2GN5 A;  3T1H L;  2G9H D;  2E74 C;  1IBK L;  3F2U A;  2PPB C;  2H1E A;  5CV6 A;  1U4L A;  1QZG A;  4LFA Q;  1VQA A;  4RAU C;  5JVH 3;  1YNJ C;  5AJ3 L;  3MXU A;  2HCC A;  4DK0 A;  4OO1 G;  1B9M A;  1LV9 A;  1PTO H;  1I4X A;  1I4H A;  2VUM G;  4A3L G;  3I70 A;  3QR8 A;  5ELN A;  1OXT A;  2KJX A;  3IRB A;  5JEA G;  1KDC A;  3KJO A;  3HKZ E;  3K5N A;  4LJZ C;  4CDF C;  1L0Y B;  1VF7 A;  4K2K A;  4A3J B;  1STN A;  5GAD C;  4YIJ A;  3HOX G;  5A2Q L;  4EVO A;  4ZQ3 A;  1K0R A;  4A3C H;  4UP8 A;  4BBS G;  5JJI A;  1HFG A;  3WOE A;  2UXC L;  1HFN A;  2MFI A;  3SK4 A;  3H6M A;  4X64 L;  4C1N I;  2VL6 A;  1UNS A;  5BN3 A;  1PTO B;  3G4S A;  4PZ6 A;  1EY6 A;  1NAP A;  1AZQ A;  4AH6 A;  3BYT B;  4LF5 L;  1FL0 A;  3S9W A;  1Q81 C;  4LW1 A;  5EBC A;  1ENA A;  3PIP A;  3BVZ A;  3BZD B;  2KCT A;  4FF3 A;  2NVT H;  4IPC A;  2A8V A;  5C0X H;  2RBM A;  3E6Z X;  4JVZ A;  1TS2 A;  3T1Y L;  1YNJ D;  4X3U A;  2NTT A;  5I2X A;  3U4Z A;  4LF9 L;  1FNU A;  3C46 A;  5J22 A;  5C3W A;  4CHT B;  1HNX Q;  2YV5 A;  2RA4 A;  4MHE A;  3J7Z C;  5DEH A;  4K0K Q;  2K75 A;  2ICI A;  1RF2 D;  1V1Q A;  1EFI D;  3H0G H;  3D8G A;  2FMC A;  2OT2 A;  5IGD A;  4X65 L;  3KDF A;  3TRE A;  1IBM L;  4DU9 A;  1VQC A;  3T56 B;  2F0U A;  4B3R L;  1SAP A;  3PUW A;  2K05 A;  4OX9 L;  4OXP A;  2HHH L;  3CCE A;  4FDB A;  2R61 A;  3PO3 H;  2CFM A;  1GO3 E;  4XT3 B;  4BS9 A;  1BCP C;  5HGQ A;  1D5Z C;  3S1M H;  3NBH A;  3MFY A;  2FXQ A;  3IFT A;  1N36 Q;  4DV4 Q;  4ZCK A;  3FKI G;  3ER0 A;  1S5D D;  3DXJ C;  5FO7 B;  5CMD A;  4JBM A;  1A62 A;  5IYB G;  2SDF A;  3K6O A;  1EWC A;  4LUZ A;  1BBX C;  2B2V C;  2LSS A;  2GVB A;  2WV6 D;  4F87 A;  2JA6 H;  1AN8 A;  2K5W A;  3FEW X;  4K2L A;  5E1F A;  3H0G B;  2B39 A;  1GOZ A;  3BZK A;  3ONA B;  1VF5 C;  4KHV A;  5KEE A;  2LMC B;  4LF6 Q;  3BVM A;  2JA5 G;  2L9H A;  5BR8 L;  1V43 A;  3PO3 B;  1Y8O B;  1FYC A;  3A8I E;  3KBX A;  3Q23 A;  4JBJ A;  5E4X A;  1L2F A;  3D6W A;  4GKK Q;  1W3S A;  1DXM A;  2WKD A;  2AMC B;  1O78 A;  1RDP D;  3AQQ A;  3FP9 A;  3KLW A;  2BDN A;  3N6R A;  5CC4 A;  2ALY B;  3T13 A;  3E9H A;  4L5T A;  3SHL A;  1LTG D;  3RZD H;  1PH8 A;  3J80 E;  4AQY L;  3J7A V;  4YY3 Q;  1Y1W G;  2JA6 B;  5FO9 B;  1D5M C;  1Q46 A;  1EIH A;  2RDH A;  1KNE A;  1SRO A;  3HOU B;  1BCP D;  4JI2 Q;  3CCU A;  4J15 A;  3K59 A;  1Q1E A;  2WB1 G;  3KDF B;  2NVQ H;  1KAB A;  2CCZ A;  2WFW A;  2Z8L A;  4LUV A;  4HR7 B;  1S5C D;  4DNT B;  1AZP A;  1KDA A;  1MSH A;  2I07 B;  4GKJ L;  2VXW A;  5IYC G;  2K6A A;  1XPU A;  4O42 A;  4DR7 Q;  1HTP A;  2K5H A;  1PTO F;  3CD6 A;  4X66 Q;  2WIN B;  3DM3 A;  5C3E G;  1BKB A;  2Q2U A;  4B3T L;  3RZD B;  4DUY Q;  2WAQ E;  3QIA A;  4AYB E;  3OIP A;  4A93 H;  3CRK C;  2I0Q A;  1E22 A;  1SRU A;  2L11 A;  1EYA A;  4A3B H;  4DAM A;  3CRL C;  4ILW A;  5TSS A;  2MGS A;  3MA2 B;  1DYQ A;  3QB3 A;  3NWS A;  2C35 B;  2NVQ B;  2E2D C;  1SMY C;  2UUA Q;  1QIL A;  1HTL D;  3L9A X;  3J81 L;  3M7G A;  3A56 A;  1FGU A;  1PYW D;  1R4P B;  1EYD A;  3SGI A;  3VYU A;  4PV1 C;  2IL8 A;  2ZJQ A;  2QGQ A;  5M3M G;  2O2L D;  1P16 A;  4O1N A;  4X3T A;  3HOZ H;  3VR5 A;  1IKM A;  2F03 A;  3EN2 A;  1TWC H;  4A3B B;  3TRZ A;  4QUF A;  3JAM i;  4G7H C;  2R7Z G;  1RL2 A;  1SE3 A;  2CHB D;  2ZXR A;  4LK1 C;  4HSP A;  2PW5 A;  3MFG A;  2IX3 A;  3A7A B;  1XMQ L;  1EIF A;  4WRD A;  2EY5 A;  1F9Q A;  3CCM A;  1Y1V G;  4KD4 A;  2CH4 A;  1ENF A;  1DGS A;  1QE6 A;  5ELF A;  1PH7 A;  2IX0 A;  2Q2T A;  2B63 G;  3AU7 A;  1CQV A;  5T1G A;  5C4X H;  3HOZ B;  1I94 L;  3WWV A;  1K8O A;  1SEB D;  4AIM A;  3GD7 A;  2JE6 I;  1HNX L;  2NBF A;  2NZ1 D;  1SMY D;  2M2L A;  4K0K L;  1JMC A;  4A3E H;  4DAY A;  1KRT A;  1BQQ T;  2JQO A;  4C56 C;  3A55 A;  5J1Z A;  1XNR Q;  2K03 A;  2KBN A;  3I55 A;  4HSV A;  5IOC A;  3RLF A;  3H09 A;  1LLR D;  2CQA A;  1A0I A;  1UEA B;  4RCN A;  3ERS X;  2NN6 I;  2OQ0 A;  2EDG A;  1OO9 B;  2PW7 A;  1N36 L;  4DV4 L;  5C4X B;  4KN7 C;  1CA5 A;  2IJ0 A;  2M00 A;  2NN6 H;  5DM7 3;  4A3E B;  3MXN A;  3GTO B;  3NTI A;  2CQO A;  1AE2 A;  4N8X 1;  3I4L A;  2ZM6 Q;  3GTK H;  4C3I B;  1STB A;  2A6E D;  2RVL A;  2KA7 A;  3KOJ A;  1VQI A;  1AFP A;  4LFC L;  4FXK C;  5FLX E;  5JJZ A;  4JOI A;  1J8I A;  4EQP A;  4ABN A;  2EYF A;  3EBE A;  4GKK L;  2SNS A;  1N8R C;  3C2P A;  5IT9 c;  3I4N G;  4BY7 H;  5ELB A;  3PGZ A;  2IHE A;  1QUQ A;  4DAP A;  5EPK A;  1BDO A;  1LTL A;  2B2U A;  4HMI A;  4A3C G;  3MXG A;  1LTT D;  4YY3 L;  4GNX A;  2NWG A;  2CW0 C;  1TWA H;  1X3F A;  2ZTD A;  3M4O B;  2F52 A;  1B50 A;  3E9I A;  5M3F H;  5CYU A;  5KNB A;  2AUJ D;  3OMG A;  4JI1 Q;  3GTP H;  1A3T A;  3GTK B;  2JA8 H;  3CC4 A;  1FGB D;  2D0O A;  1EYG A;  4JI2 L;  1B8A A;  1L0W A;  4IUU A;  5DM6 3;  4HCE A;  1PH9 A;  1QWY A;  1ILP A;  4PZ8 A;  3K0X A;  1ASY A;  5C44 B;  1JOR A;  5IYD H;  1XPR A;  3D4W A;  1PH4 A;  4DR7 L;  1BF4 A;  3SK8 A;  4NXN Q;  3H3V H;  2F0Q A;  2L12 A;  3STB C;  2B2Y C;  3FDT A;  3OSO A;  3G48 A;  1K3B C;  1VS0 A;  4DUY L;  4ZAI A;  3F2C A;  2I5H A;  4ZK9 B;  3MWY W;  5ELD A;  1TWA B;  1S72 A;  2OTJ A;  5M3F B;  2JA8 B;  2H4O A;  5HY6 A;  1YVC A;  3A7L A;  3MTS A;  4KK7 A;  1JWM D;  2UUA L;  5KNC A;  4ME5 A;  4WOR A;  4UY8 C;  4RMF A;  4IUT A;  1IYJ B;  4Q0F A;  4KY5 A;  3PO3 G;  1VQH A;  3CQZ H;  1O7L A;  4KHZ A;  1HNZ Q;  1BO0 A;  4HN7 A;  2CW0 D;  3NSW A;  4B3S L;  3FMC A;  1BVS A;  3CU7 A;  1CK1 A;  5I9P A;  5IP7 H;  1PH6 A;  3BDL A;  3TN2 A;  4JYA Q;  1FD7 D;  2EYO A;  2DGY A;  2CWP A;  3OHX C;  4GNX B;  1GUG A;  2F0P A;  4RKL A;  2K5V A;  3TEH B;  5L37 A;  2Z9H A;  4K8I A;  4DXG A;  5M5Y B;  3J80 L;  4BXX H;  4U68 A;  3I4M H;  1A2T A;  1JQY D;  1TWF H;  1HCZ A;  1MIU A;  5EPL A;  1Y14 B;  3TDQ A;  1KIX A;  4RGO S;  4DV2 Q;  2F0D A;  4I7Z C;  3N52 A;  4JCV E;  2JSO A;  3D0F A;  4C3J H;  4PMC A;  2VQE L;  1OTC A;  1LO5 D;  3X3N A;  4XT1 B;  3S16 H;  1LT5 D;  4IUR A;  4DR4 Q;  2IY5 B;  3H94 A;  2E2H H;  4QF4 A;  3NQT A;  1X9N A;  2JA7 H;  4TKO B;  2I5L X;  1PH3 A;  3ICE A;  3UDX A;  2P5Z X;  2XN9 C;  3HKZ B;  4BA1 I;  3I4M B;  5C0X J;  4IPG A;  1SFO H;  3KF6 B;  1F9S A;  1TWF B;  1YHA A;  3K5M A;  5IGB A;  1SBB B;  4JW0 A;  1O80 A;  1ZYR C;  1ENC A;  4I7A A;  4PG3 A;  1WTV A;  1UAP A;  1SE2 A;  1A3V A;  3R93 A;  3KLS A;  1P8L A;  5K5P A;  3SR1 A;  4C3J B;  2RHS B;  2X69 A;  1SYG A;  2K14 A;  4H7B A;  1DD2 A;  2EIF A;  3I72 A;  3S16 B;  3OTO Q;  1NNX A;  2ICE C;  1GD7 A;  4MIU A;  3O13 A;  1LUZ A;  1FJG L;  4A93 G;  1KNA A;  4J6H A;  4LWC A;  2KUM A;  2QKI C;  4R4T A;  4DV0 Q;  3JAM c;  2JA7 B;  1Q12 A;  1C0A A;  1CM9 A;  2C5C A;  1KHI A;  2ZM6 L;  1SR3 A;  4XQN A;  1S40 A;  4GN5 A;  1WFQ A;  2O4X A;  1SFO B;  1XTC D;  4L6T B;  2MUY A;  2HT1 A;  2C9O A;  1LTI D;  5C4J B;  2K5D A;  2F0G A;  1BCP B;  4JG2 A;  5D14 A;  4BBR G;  1SNM A;  4ULL A;  1IYU A;  2Z6K C;  3D31 A;  4NXM Q;  3HOZ G;  3ERQ A;  1HA5 A;  2Q2I A;  5EKI A;  4JI8 Q;  1JB7 A;  2OTL A;  2VB2 X;  3PO2 H;  1C4Q A;  3TZU A;  2F0K A;  2R3Z A;  5FJ8 H;  1F2M A;  1K3R A;  2EJM A;  3S17 H;  1D1K A;  5AFW A;  2BA0 A;  1HRJ A;  4QUC A;  2AKW B;  5GAG C;  2R7D A;  3TZD A;  1R4Q B;  2MO0 A;  4A3F H;  2UUB Q;  2EE1 A;  3EVQ A;  1WCM H;  3HG9 A;  3PQI A;  1QG7 A;  3EA6 A;  4XQQ A;  1VQF A;  1IL2 A;  3A8J E;  1CUK A;  1IBL Q;  2UXD Q;  3UDG A;  1XJV A;  3MXP A;  1E2Z A;  3PCO B;  4NXN L;  4CKE A;  1DZ1 A;  4DR5 Q;  1TWG H;  1G6P A;  5C4X G;  5LHY 1;  1C7Y A;  1Y8P B;  4MNO A;  2EYH A;  2F0N A;  3DEP A;  3NHH A;  4P72 A;  2VS1 A;  4QB4 A;  3PO2 B;  4IN3 A;  2K4K A;  4H44 C;  3S17 B;  3GO5 A;  3DWQ A;  4XYO A;  3PIO 3;  3Q24 A;  3KYH C;  4DV7 L;  1WTR A;  4A3E G;  4CJ0 B;  1MI2 A;  2B3G A;  4QL5 A;  2E2I H;  1Q90 A;  4A3F B;  4G4K A;  1K8G A;  4B08 A;  3PUX A;  1QVC A;  1K28 A;  1CI3 M;  2DJF C;  1YJN A;  4UHV A;  1V8Q A;  3MEF A;  3RR5 A;  1QNK A;  1HNZ L;  2K5Q A;  4XDX A;  3I8Z A;  1TWH B;  1TWG B;  1O7Y A;  2B8G A;  4DV5 Q;  3J7A F;  3CAM A;  2JP1 A;  1OXS C;  5FLX L;  4POG A;  3D3R A;  2OF1 A;  2QF7 A;  3OMC A;  3RMH A;  3A0J A;  1HR0 Q;  4Y7N H;  4A3I B;  3QG1 A;  1PRT C;  1SNO A;  3DM1 A;  2F1M A;  2E2I B;  3S2H B;  4KV6 A;  4MTN A;  5ELO A;  1PMR A;  4IOC A;  4GOP A;  1CKN A;  1PZK D;  2QEX A;  4O0A A;  4XIG S;  4WFN 3;  3BS1 A;  1VQO A;  1A3U A;  3G6E A;  1PH5 A;  1HHV A;  1ICW A;  2HQE A;  4DR6 Q;  2JEA I;  2WAQ B;  4AYB B;  1H9M A;  3I4O A;  3ULJ A;  2FHT A;  2PI2 A;  1SND A;  4BY7 G;  4TRD A;  2UXB Q;  1WI5 A;  3GP7 A;  4XYQ A;  5IIF A;  1B2T A;  3IAY A;  4IFD H;  5FK9 C;  4MTK A;  1DOK A;  2B2W A;  4Y7N B;  1NR4 A;  1SMX A;  4DR4 L;  2UUC Q;  4C3H B;  1V9P A;  1BCP F;  2R6G A;  5C0X I;  3L7Z C;  1S4Z A;  2XSC A;  2E5L Q;  1RCV D;  2JA8 G;  4O2D A;  2RSO A;  4FYD A;  2B2T A;  4YCU A;  4IUQ A;  2RDG A;  1R9T H;  1SNC A;  2D5D A;  5IYD G;  3AEV A;  3I91 A;  2D9U A;  4FVM A;  3OWF A;  1PRT D;  4JI3 L;  2ES2 A;  4CDC C;  2N3S A;  3NK9 A;  4IQZ A;  4FXG C;  4FO2 A;  3SDZ A;  2VW9 A;  4HJ9 A;  3ZYY X;  1MGS A;  1B9N A;  2WB1 E;  3CCR A;  1E7Z A;  3OTO L;  3A5Z B;  1N34 Q;  3MZ5 A;  3SK5 A;  4P74 A;  4EQ5 A;  1D6E C;  2O5I C;  4OWT B;  5GAH C;  4DV0 L;  2BE5 C;  2WKC A;  3RZO H;  1V1O A;  3CF5 A;  2E2J H;  3LGJ A;  5ELE A;  4QMG A;  3FPP A;  3C1E A;  1YJW A;  3NEL A;  1M1K C;  1PLF A;  3A74 A;  4JI6 Q;  5NUC A;  1GUO A;  4R4Q A;  4GOP B;  1R9T B;  1CKN B;  1CKM A;  2X6G A;  4LMQ D;  2GVA A;  1GUN A;  4ZKC B;  4A3M H;  2Q8R E;  3NXW A;  1I4P A;  1K8M A;  2BH2 A;  4RGN A;  2L1B A;  3HGB A;  4PQX A;  2EQS A;  3KLS X;  2QW7 A;  3B6Y A;  1S5E D;  5IP7 G;  3R3O A;  4JI8 L;  3JC6 6;  1IW7 C;  1OXV A;  1TR5 A;  3I2Z A;  3HOY H;  3RZO B;  2E2J B;  4HID A;  4C1N K;  1AP0 A;  3HOU H;  2XNA C;  1SNP A;  4P2C B;  1LAB A;  4L5R C;  4FF1 A;  3HKZ G;  4HMJ A;  1KDB A;  3I4M G;  1HNW L;  5C4H A;  5IP9 H;  2HUG A;  2PQA B;  4GLX A;  2KHI A;  4JBW A;  4E6I A;  2KEN A;  4DV1 Q;  4A3M B;  1CQF A;  2RF4 A;  4QCL A;  2UXD L;  1Z7T A;  3I56 A;  5DLQ E;  3GTL B;  3S1N H;  4OIK A;  1LTS D;  2BE5 D;  2K33 A;  4DR5 L;  1XMO Q;  5I6Y A;  3K8A A;  1S5F D;  4HIO A;  1NSN S;  4DR3 Q;  1XX8 A;  4DV3 Q;  1EIG A;  4C3J G;  2PO4 A;  3GTG H;  3HOW H;  4TVA B;  1JE4 A;  4LF8 Q;  2X6L A;  3Q0A A;  3HOY B;  3HOV B;  1RTO A;  2PZT A;  1EU3 A;  2R93 B;  1LTB D;  4JI0 Q;  2L4N A;  4JC0 A;  5HUR A;  3DWA A;  2K32 A;  5IE8 A;  2JA7 G;  1JWS D;  4ODG A;  4L5S A;  1MJE A;  3TP5 A;  4NP5 A;  2IT1 A;  3U9O A;  2PNR C;  3QWN A;  4B3M Q;  1WTX A;  3VR6 A;  1H9R A;  1UE6 A;  2Y0S B;  3H15 A;  1WYD A;  3F1Z A;  3M4Q A;  4QGU A;  1VQ8 A;  1EIY B;  1S3O A;  3S1N B;  4RWS C;  2EYP A;  1IW7 D;  1GXD C;  2F0W A;  2L15 A;  4ZUI A;  2AQ1 B;  1EEF D;  4DV5 L;  3CKI B;  1CTM A;  1L1O C;  1GKH A;  2RKS A;  1MHW C;  4LFA L;  3GTG B;  3UI2 A;  4HJ7 A;  3HOW B;  2KHJ A;  4HJ8 A;  1HR0 L;  2XIW A;  1SJH D;  4CKC A;  4QJF A;  3J81 i;  1TS5 A;  4MZ9 A;  2Q2H A;  1WOC A;  4F8M A;  1TII D;  3P75 A;  2DUD A;  4CDD C;  2BA1 A;  4YWL A;  5COR A;  2RCN A;  3W1G A;  3VA5 A;  5HGT A;  1EZ8 A;  2ATW A;  2PMZ E;  4KTA A;  3RN2 A;  1STG A;  2SOB A;  1LM0 A;  5CBE E;  5LL6 S;  1HA6 A;  1HR0 W;  2FIN B;  1CT1 D;  4A3K H;  4LFB Q; 
#chains in the Genus database with same CATH homology
 4IPD A;  1J5E Q;  4JBK A;  1PH4 A;  4A3G G;  1XMQ Q;  4DR7 L;  1NMF A;  2OWO A;  5J3B A;  3K7U C;  4NXN Q;  3H3V H;  3PV0 A;  3CC7 A;  4QIW E;  3STB C;  3J80 c;  3G48 A;  4DK6 C;  5M3M H;  4UP7 A;  5IWA L;  1VS0 A;  4DUY L;  1PA6 A;  4A3G H;  3F2C A;  2CKZ B;  2I5H A;  2D62 A;  4QY7 A;  2UUC L;  1S72 A;  2HQL A;  3PO2 G;  2OTJ A;  1PYS B;  5FJ8 G;  1HJP A;  1OXU A;  1X3G A;  4JI5 L;  3G71 A;  2VY3 A;  3PF4 A;  3NEM A;  3I7F A;  4BY1 G;  1XPO A;  1LYL A;  4RG1 A;  5HY6 A;  1HZC A;  4OWX B;  1I94 Q;  1YVC A;  3PIO A;  1UE5 A;  4A3F G;  3M3Y H;  2CWA A;  1U0L A;  2UUA L;  3RLO A;  4A3D G;  4L5Q A;  1WCM G;  2YTY A;  5BR8 Q;  2AWN A;  2ID0 A;  2MNA A;  4UY8 C;  3GTL H;  1I3Q H;  4RMF A;  3M85 A;  1CKO A;  1IYJ B;  3PO3 G;  1VQH A;  4ALP A;  1I50 H;  1XNQ L;  1Y1V H;  3CQZ H;  4A3D H;  4A76 A;  4KHZ A;  1MJC A;  3U58 A;  1HNZ Q;  4NXM L;  1HNW Q;  2NZH A;  2Z6K A;  4B3S L;  4EX5 A;  2NVX H;  4GN3 B;  1PYB A;  2B63 H;  1BVS A;  1N34 L;  1A8V A;  3HOV H;  4YCW A;  5EAY A;  4A4I A;  5IP7 H;  1PH6 A;  4KHP Q;  3UE0 A;  4JYA Q;  2R93 H;  3GTO H;  4DR2 Q;  4JI7 Q;  3GTQ H;  5GAE C;  1M90 C;  4IPH A;  2DGY A;  2CWP A;  2UUB L;  4GNX B;  1SE8 A;  4AQY Q;  2VNU D;  2K5N A;  2VQF Q;  4C3I H;  4UP9 A;  1PFS A;  2UU9 Q;  4GS3 A;  4BXX G;  4YHH Q;  2A1A A;  1OXX K;  1T9H A;  3M9B A;  4JI6 L;  2K5V A;  1NTG A;  3TEH B;  2JJQ A;  1HH2 P;  1IBL L;  1N33 L;  4BXX H;  1VQ5 A;  5GRO A;  3I4M H;  2LXJ A;  5JEA J;  3A5U A;  2ZTC A;  1TWF H;  1QZH A;  4Y52 H;  4A3J G;  2KCM A;  3K80 C;  4DV6 Q;  1MIU A;  1Y14 B;  2HIX A;  1KIX A;  5LMU Q;  4GKJ Q;  4DV2 Q;  4IJL A;  4NPS A;  1YIT A;  4P71 A;  3CC2 A;  4A3J H;  4LFC Q;  2E8G A;  5FLM H;  1EFW A;  2ZTE A;  1HZB A;  3D0F A;  2GN5 A;  4JCV E;  4C3J H;  3T1H L;  1IBK L;  1X65 A;  2VQE L;  3M4O H;  1NMG A;  1D7Q A;  1OTC A;  4XTC S;  3S16 H;  2IY5 B;  3CME A;  3Q8D A;  3BU2 A;  1QZG A;  4DR4 Q;  4OO1 I;  4DR1 Q;  4LF6 L;  4LFA Q;  1U5K A;  1VQA A;  4UPA A;  2E2H H;  4DPG A;  4H02 A;  5AJ3 L;  1X9N A;  2ZJR A;  4POF A;  2JA7 H;  4TQU S;  4OO1 G;  3U50 C;  2I5L X;  1PH3 A;  3ICE A;  3UDX A;  2F4V Q;  1KAW A;  4BA1 I;  4LF7 Q;  2VUM G;  4A3L G;  4DR6 L;  5C44 H;  5C0X J;  4IPG A;  2K50 A;  3L0O A;  1SFO H;  3KF6 B;  1YHA A;  4OON A;  5ELN A;  1OXT A;  3IRB A;  5JEA G;  2IX1 A;  2VUM H;  4PG3 A;  3KJO A;  2QA4 A;  3HKZ E;  1Z47 A;  1XMO L;  1YNX A;  1X55 A;  1RIP A;  5LMN Q;  1P8L A;  5GAD C;  4DV3 L;  3CMA A;  3CCV A;  2RHS B;  3S2D H;  3HOX G;  2K14 A;  1K0R A;  4A3C H;  4UP8 A;  4BBS G;  2EIF A;  5JJI A;  3OTO Q;  1GD7 A;  2YTX A;  3PUY A;  2AWO A;  1LUZ A;  1FJG L;  4A93 G;  4LWC A;  2B29 A;  2UXC L;  3NBH B;  1G6P A;  2MFI A;  4R4T A;  4X64 L;  4DV0 Q;  3JAM c;  2VL6 A;  1KRS A;  1Q12 A;  4LUO A;  3H3V I;  2R92 H;  1C0A A;  2ZM6 L;  1KHI A;  3G4S A;  4DK3 C;  1SR3 A;  4PZ6 A;  2YU9 H;  1S40 A;  4GN5 A;  1VQL A;  1WFQ A;  4AH6 A;  4PZ7 A;  4DUZ Q;  4LF5 L;  3FHW A;  1FL0 A;  1Q81 C;  4LW1 A;  2HT1 A;  1N32 L;  5C0X G;  2UXB L;  3PIP A;  4X66 L;  1VQG A;  3L2P A;  4JG2 A;  1QVG A;  2KCT A;  3S1Q H;  2IHF A;  4IPC A;  4BBR G;  2A8V A;  2NVT H;  4KI0 A;  1YHB A;  3T1Y L;  2MO1 A;  3U4Z A;  4LF9 L;  3UE1 A;  2Z6K C;  4BBR H;  3D31 A;  4NXM Q;  2N78 A;  3HOZ G;  2E5L L;  4JV5 Q;  2I5M X;  2Q2I A;  4JI8 Q;  4B3S Q;  4APV A;  1JB7 A;  3H0G G;  2OTL A;  3PO2 H;  1I5F A;  5FJ8 H;  1HNX Q;  1K3R A;  2YV5 A;  3S17 H;  4JI4 Q;  2BA0 A;  3J7Z C;  4BY1 H;  3KF6 A;  4K0K Q;  1E3P A;  2K75 A;  5M5Y H;  4HJ5 A;  4C2M H;  2AKW B;  1V1Q A;  5GAG C;  3H0G H;  1HZA A;  4X62 L;  2R7D A;  2MO0 A;  4A3F H;  2UUB Q;  5FLX c;  4X65 L;  3KDF A;  2XGT A;  3TRE A;  1IBM L;  5JJL A;  1YHQ A;  1VQC A;  4B3R L;  1WCM H;  3BZC A;  3PUW A;  2JA9 A;  1VQB A;  4OX9 L;  1VQF A;  4OXP A;  2HHH L;  3F2B A;  3CCE A;  4FDB A;  1IL2 A;  1CUK A;  1J5E L;  3PO3 H;  2CFM A;  1GO3 E;  4PMW A;  1IBL Q;  4A3M G;  3PF5 A;  2UXD Q;  3E0E A;  3UDG A;  1XJV A;  1CSP A;  4NXN L;  3PCO B;  1XTD A;  5HGQ A;  3S1M H;  1PHJ A;  2FXQ A;  4DR5 Q;  4YCV A;  1TWG H;  1VQE A;  1N36 Q;  4DV4 Q;  3J80 i;  4A3I G;  3FKI G;  3ER0 A;  1ASZ A;  4KLK A;  4JBM A;  5C4X G;  1A62 A;  1C7Y A;  5IYB G;  4MNO A;  4P72 A;  2JA6 G;  3KFU A;  2VS1 A;  4LF4 Q;  4LUZ A;  2K4K A;  2LSS A;  3HOY G;  2GVB A;  3GO5 A;  3CCS A;  1I6H H;  4DV7 L;  3KYH C;  3BJU A;  5IYB H;  4A3E G;  1GM5 A;  2JA6 H;  2B3G A;  1J6Q A;  4QL5 A;  2VQE Q;  2E2I H;  3HOU G;  1D8L A;  3BZK A;  1PVO A;  1TXY A;  1K8G A;  2PI2 E;  2H5X A;  1VQ6 A;  3PUX A;  1YIJ A;  1QVC A;  4LF6 Q;  2JA5 G;  2R7F A;  1CSQ A;  1X6O A;  1NE3 A;  5IP9 G;  4R4C A;  5BR8 L;  1YJN A;  1Q7Y C;  1V43 A;  1E24 A;  4ME3 A;  2WAQ G;  4AYB G;  3DLL A;  2K52 A;  1YEZ A;  2Y0S G;  2YTV A;  3MEF A;  3RR5 A;  4IFD J;  2AHO B;  1HNZ L;  4JBJ A;  4GOP C;  1L2F A;  3TQY A;  4GKK Q;  1KQS A;  1W3S A;  1AE3 A;  2AMC B;  2OCE A;  4DKA C;  4LNQ A;  3AQQ A;  4DV5 Q;  3FP9 A;  3KLW A;  1Q82 C;  3CAM A;  1K9M C;  1MKH A;  1OXS C;  2MQH A;  3K7A H;  4POG A;  4IOA A;  2ALY B;  2V1C C;  4DR2 L;  3E9H A;  4L5T A;  3CXC A;  3AFP A;  3A0J A;  3RZD H;  3KF8 B;  1JJ2 A;  4Y7N H;  3J81 c;  1YZ6 A;  4GLA C;  4AQY L;  1PH8 A;  1HR0 Q;  3RLN A;  1VQM A;  1XNR L;  4YY3 Q;  2VQF L;  3K81 C;  1Y1W G;  2BH8 A;  4YHH L;  4R4I A;  2EXD A;  3CPW A;  2RHQ B;  1Q46 A;  4MTN A;  1IXR A;  5ELO A;  3CCQ A;  1FJG Q;  3KJP A;  3AYH B;  4DV1 L;  1Y1W H;  1SRO A;  1N9W A;  4IOC A;  4GOP A;  1QVF A;  4A3L H;  4JI2 Q;  3CCU A;  1CKN A;  1E1T A;  4J15 A;  1H95 A;  5C4J H;  1Q1E A;  2WB1 G;  3AFQ A;  3KDF B;  4NB3 A;  2NVQ H;  2QEX A;  4O0A A;  1X3E A;  5GQO A;  2CCZ A;  2WFW A;  4LUV A;  4XIG S;  3J7A 5;  1K83 H;  4DV6 L;  1PH5 A;  3M7N A;  1VQO A;  5IYD H;  3G6E A;  4DR3 L;  4GKJ L;  5K36 G;  5LMU L;  5IYC G;  4DR6 Q;  3U4V A;  2ZJP A;  2JEA I;  4IFD G;  1VQP A;  3I4O A;  1YJ9 A;  1XPU A;  4X6A H;  3ULJ A;  1W2B A;  2PI2 A;  4LF8 L;  4DR7 Q;  2K5H A;  4BY7 G;  2UXB Q;  1WI5 A;  3CD6 A;  4X66 Q;  5IYC H;  3OW2 A;  3HOX H;  3DM3 A;  5C3E G;  1B7Y B;  1BKB A;  2Q2U A;  4JI0 L;  4B3T L;  3EIV A;  1UWV A;  5IWA Q;  4DUY Q;  4BBS H;  4A3B G;  2WAQ E;  4AYB E;  1SMX A;  2Y0S E;  4DR4 L;  4QQB X;  1B70 B;  4DR1 L;  2UUC Q;  1JE5 A;  4A93 H;  2I0Q A;  1E22 A;  1SRU A;  2NZO A;  5C3E H;  3T1Y Q;  4B3M L;  1V9P A;  4JI5 Q;  2R6G A;  4A3B H;  4DAM A;  5C0X I;  1VQN A;  3VDY A;  3L7Z C;  2E5L Q;  2JA8 G;  3TS0 A;  1UEB A;  4O2D A;  1A63 A;  4R1J A;  4YCU A;  2C35 B;  4DAY B;  2UUA Q;  1R9T H;  1EQR A;  1Q1B A;  1Z9F A;  3CW2 C;  3W5O A;  5IYD G;  3AEV A;  4A3K G;  3CCL A;  3ULL A;  1JJC B;  1FGU A;  1XNQ Q;  4B3R Q;  5LMN L;  4JI3 L;  2ES2 A;  3SGI A;  1FVI A;  1VQ4 A;  2N3S A;  4OX9 Q;  1HZ9 A;  2HHH Q;  3UDF A;  2VW9 A;  4HJ9 A;  2ZJQ A;  2QGQ A;  5M3M G;  2WB1 E;  3CCR A;  1E7Z A;  3OTO L;  3A5Z B;  1N34 Q;  1P16 A;  3HOZ H;  4JI1 L;  1EUJ A;  2LXK A;  4P74 A;  4EQ5 A;  3EN2 A;  4OWT B;  1KXL A;  5GAH C;  1TWC H;  4DV0 L;  1JJG A;  1Q8K A;  2YYZ A;  3TRZ A;  3RZO H;  3CF5 A;  2E2J H;  1YBY A;  3JAM i;  3LGJ A;  2R7Z G;  1EOV A;  1RL2 A;  5H1S E;  3S24 A;  3NEL A;  1YJW A;  1E1O A;  4HJA A;  1Q86 C;  1M1K C;  2F3I A;  3A74 A;  3NEN A;  1GVP A;  4IJH A;  4R4O A;  5LMN W;  4JI6 Q;  4LFB L;  3F2D A;  3MXN B;  4DUZ L;  4DV7 Q;  4R4Q A;  3S1R H;  4GOP B;  1XMQ L;  1N33 Q;  2R7Z H;  1JT8 A;  1EWI A;  1CKN B;  1CKM A;  3OYY A;  1EIF A;  4P73 A;  4WJ4 A;  3CCM A;  2GVA A;  1G51 A;  1TWH H;  1Y1V G;  4A3M H;  1BBU A;  4BA2 I;  1DGS A;  3J81 j;  1K73 C;  2BH2 A;  2HIV A;  1PH7 A;  4A75 A;  1X54 A;  2IX0 A;  2Q2T A;  2EQS A;  2B63 G;  4A3I H;  3HOV G;  3FKI H;  1C9O A;  5C4X H;  3B6Y A;  3RNU A;  5IP7 G;  4JV5 L;  1VQJ A;  4HIM A;  3GTJ H;  2R93 G;  3T1H Q;  1IBK Q;  1I94 L;  4JI8 L;  3WWV A;  3JC6 6;  4AIM A;  3GD7 A;  2JE6 I;  1HNX L;  1VQ7 A;  5E7N A;  1OXV A;  1SN8 A;  3S2H H;  3HOY H;  3I2Z A;  4JI4 L;  1QUQ B;  4K0K L;  1JMC A;  4A3E H;  4HID A;  3HOU H;  2A19 A;  1KRT A;  3PUZ A;  5AJ3 Q;  2JQO A;  1KL9 A;  1PV4 A;  4L5R C;  1XNR Q;  1AH9 A;  1O7I A;  2KBN A;  2JA5 H;  3HKZ G;  3I4M G;  1HNW L;  3I55 A;  5IP9 H;  1BBW A;  2PQA B;  3PUV A;  2KHI A;  3RLF A;  4IO9 A;  4GLX A;  1NBW A;  4JBW A;  2KEN A;  4DV1 Q;  2RF4 A;  3ZJY C;  2UXD L;  1A0I A;  3GTM H;  1PH1 A;  3TS2 A;  3I56 A;  5DLQ E;  3STB D;  4KHP L;  1K8A C;  3ERS X;  1L1O B;  3HKS A;  2NN6 I;  2OQ0 A;  3HOW G;  3S1N H;  4JYA L;  1G29 1;  3HFZ B;  4DR5 L;  1XMO Q;  4JI7 L;  5JJK A;  3K8A A;  1PH2 A;  1N36 L;  3CCJ A;  5FLM G;  4DV4 L;  3M4P A;  4HIO A;  4DR3 Q;  2NN6 G;  4DV3 Q;  4HIK A;  1VCI A;  4C3H H;  2UU9 L;  3GTG H;  3HOW H;  4TVA B;  4LF4 L;  3UDI A;  4JOI C;  4LF8 Q;  1SLJ A;  1KC8 C;  2UXC Q;  4JI0 Q;  4JC0 A;  5IY0 A;  5IE8 A;  4B3T Q;  1VQD A;  4X64 Q;  4OWW B;  2JA7 G;  2CQO A;  1AE2 A;  2OQK A;  4L5S A;  1MJE A;  2ZM6 Q;  3GTK H;  4IFD I;  5M5X H;  1X56 A;  2IT1 A;  1KD1 C;  5C44 G;  4GNX C;  1YI2 A;  4B3M Q;  4DV2 L;  1VQK A;  1UE1 A;  3KOJ A;  1UE6 A;  1VQI A;  3H15 A;  4LFC L;  1WYD A;  3F1Z A;  4LF5 Q;  3M4Q A;  4QGU A;  1VQ8 A;  1EIY B;  1S3O A;  1N32 Q;  2JEB I;  4JOI A;  4YWM A;  4GN4 B;  4GKK L;  2L15 A;  2WP8 J;  3EBE A;  1N8R C;  5IT9 c;  3I4N G;  3F8T A;  4DV5 L;  4BY7 H;  2XTI A;  1L1O C;  1GKH A;  3PGZ A;  3W1B A;  3CPF A;  2IHE A;  1QUQ A;  3GDE A;  4LFA L;  1LTL A;  1IZ6 A;  1UE7 A;  4HJ7 A;  2KHJ A;  4A3C G;  2PNH A;  5M3F G;  4HJ8 A;  3RN5 A;  3I4N H;  1HR0 L;  4LF9 Q;  4JI3 Q;  3CP0 A;  4YWK A;  4YY3 L;  4QJF A;  4GNX A;  3J81 i;  2F4V L;  1TWA H;  1X3F A;  2JK8 A;  2ZTD A;  2F52 A;  2Q2H A;  4MZ9 A;  1EQQ A;  1WOC A;  4LF7 L;  3E9I A;  2NVY H;  5M3F H;  2DUD A;  1NJI C;  1VQ9 A;  2N8N A;  2PQA A;  2R92 G;  2BA1 A;  2Z0S A;  4YWL A;  4JI1 Q;  3GTP H;  2JA8 H;  4P75 A;  4WJ3 M;  2RCN A;  3CC4 A;  3W1G A;  4DNI A;  2D0O A;  5M5W H;  1EYG A;  4JI2 L;  1B8A A;  1L0W A;  4X62 Q;  4GLV B;  3S15 H;  2ASB A;  2ATW A;  2D0P A;  2PMZ E;  1L1O A;  4X65 Q;  3RN2 A;  1IBM Q;  1PH9 A;  4PZ8 A;  1LM0 A;  3S14 H;  1NY4 A;  3K0X A;  1WJJ A;  2VZA A;  1ASY A;  3ULP A;  2N49 A;  3PSI A;  1HR0 W;  1XPR A;  4A3K H;  4LFB Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...