3EBEA

Crystal structure of xenopus laevis replication initiation factor mcm10 internal domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
179
structure length
172
Chain Sequence
QYHVEKFSGLRIRKPRVSSSEMERKMNGRKLIRLAQLQNKIATEKLEEEDWVTFGVIVKKITPTFSIWRLNDLKDLDKYISLFLFGDVHKEHWKTDQGTVIGLLNANPMKPKEGTDEVCLSVDNPQKVLLMGDAVDLGTCKARKKNGDPCTQMVNLNDCEYCQYHVQAQYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords Protein MCM10 homolog
publication title Structural basis for DNA binding by replication initiator mcm10.
pubmed doi rcsb
source organism Xenopus laevis
total genus 43
structure length 172
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09329 zf-primase Primase zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ebeA00
4NXNL 1AH9A 1SN8A 2UXBL 4GNXB 2ZJRA 1SMXA 3J7ZC 3VDYA 1N34Q 1KL9A 3BJUA 3G48A 4HJ7A 1K0RA 4HIKA 4TQUS 2VW9A 3S1NH 3M4OH 1X65A 3WWVA 3DLLA 2E2IH 4B3SL 4YCWA 3NENA 1Y1WH 1Q7YC 4A3KG 3HOWG 1A62A 5JEAG 1QVCA 3CCRA 1NJIC 5C44H 1BBWA 2UUCL 4WJ3M 1PH8A 4OO1I 2K5NA 2OQ0A 4A3GH 1UE6A 1EOVA 4DKAC 3H15A 3FHWA 4DR5Q 4R4IA 3UDIA 2VUMG 2VQFQ 3F2DA 3M7NA 1EIYB 3A5UA 1OXXK 2A1AA 2VL6A 4DR1L 4A3EG 3CCSA 2MO1A 4A3CG 4LWCA 2KCTA 4C3IH 2IX1A 3HOVG 2HT1A 1Y1VG 1S40A 1IXRA 1Q46A 3CD6A 1Y14B 4ME3A 4DUZL 1WYDA 1N33Q 1U0LA 4B3RL 1LTLA 2YTXA 2UXCQ 4DUYL 3K80C 1GKHA 4LFAQ 4GNXA 1VQCA 5M3FG 2I5HA 5IY0A 4LNQA 1FJGL 1RIPA 3RLFA 4UP8A 3L0OA 4A93G 2PQAA 5ELOA 2IX0A 3F1ZA 3ZJYC 2B63H 3J80i 1NMFA 1Q8KA 4X66Q 1IBLQ 1OXVA 1QVGA 1JMCA 1NY4A 2JK8A 4B3MQ 4K0KQ 1NBWA 2KBNA 1Q1BA 2MQHA 3BZCA 3KDFB 1XNQL 1TWHH 3GTKH 1XMQL 2GVAA 5JJKA 1C7YA 4DAMA 1HR0L 4YHHL 3KF8B 1KD1C 5IWAQ 4A76A 1IBML 1I50H 2OCEA 4QIWE 4R4QA 5GAGC 2ASBA 4BBRG 3STBD 2F4VL 3HOWH 4DV7Q 2NZHA 2A19A 3PCOB 4YWKA 1CKNA 4X65L 3SGIA 1Z9FA 1N32L 2VUMH 1VQEA 1BKBA 3J7A5 3HOUG 3CW2C 1PV4A 4QQBX 2JA9A 4A3EH 4EQ5A 2NN6G 2BA1A 2B3GA 2F3IA 5HY6A 4O0AA 1VQLA 2UUCQ 3F8TA 3HOVH 4QY7A 4JV5Q 1N34L 1IZ6A 4OWXB 4RMFA 3S1RH 1Y1VH 2QGQA 4LW1A 2VZAA 3J81c 1J5EQ 5C4JH 4LFBQ 1BBUA 3BZKA 3W1BA 4DV0Q 1M1KC 1XNRQ 4JI2Q 5C0XG 1MKHA 1XPUA 3PSIA 2MNAA 2QEXA 1PH3A 2C35B 3TRZA 2EXDA 2Q2HA 3K81C 5M3FH 3HOXG 1A8VA 1K8GA 3G6EA 4C3JH 1C9OA 3CPFA 4PG3A 2VS1A 4POFA 4DR5L 2MFIA 2VQFL 1VQ9A 3GTLH 3S2HH 1VQBA 4GS3A 3S24A 1FVIA 1CUKA 3PGZA 3H3VH 1ASYA 2ZTCA 1D7QA 1H95A 2VY3A 2R93G 4JI4Q 1JJCB 2PI2E 3NBHB 5IYCG 3PUYA 3UE1A 5C3EH 1YJWA 4LF6Q 3PUVA 2BH2A 4QJFA 2JJQA 1N33L 2K52A 3EIVA 3CCVA 3E9HA 4JI7Q 3L2PA 1QVFA 3RZOH 4KHPQ 2UXCL 3B6YA 4KLKA 4AQYQ 4DK3C 1Z47A 4LFAL 4BBSG 1VQMA 4BBRH 1PH9A 4DR7Q 1XMOQ 1QUQB 3I56A 4YWLA 1I6HH 3AFPA 2Q2UA 1Q1EA 4KI0A 3AQQA 4BXXG 4YWMA 4P75A 2AKWB 1MJCA 3HOUH 3FP9A 4X66L 1P8LA 1IBLL 4JYAQ 3UDFA 3A0JA 3CPWA 3T1YQ 2OTLA 5C4XG 3STBC 3T1HQ 1M90C 4B3ML 4K0KL 1PFSA 1HZBA 5EAYA 2GN5A 1WCMG 2IT1A 2R6GA 2YYZA 1IBKQ 3CAMA 2OWOA 2ZJPA 3GTOH 4BA2I 1L1OA 3F2CA 3CF5A 1YITA 4LF7Q 3J81j 1N9WA 4P73A 1GD7A 4R4OA 5IWAL 4GKJQ 1GVPA 4A3LG 3PIPA 2K5HA 2D0OA 4DV7L 4J15A 3HOXH 2JA8H 3HKZG 1B8AA 1L1OC 3KF6B 5GADC 4C2MH 4JCVE 3PUWA 4DV6Q 4L5SA 4OWWB 3Q8DA 4Y7NH 3CC2A 1K3RA 2Z0SA 3KLWA 2EIFA 2HIVA 2HHHQ 2KCMA 5JJIA 3EBEA 2AHOB 4IPGA 4HJ9A 1TXYA 2R93H 4JV5L 3GO5A 1J5EL 4DV4Q 2WAQE 5IYCH 4LFBL 1NTGA 3ULPA 4DV0L 1XNRL 3MEFA 1L2FA 2FXQA 5DLQE 3KJOA 1PHJA 1VQHA 4JI2L 2R7ZG 3RZDH 4EX5A 2F52A 1YHBA 4H02A 4LFCQ 2UU9Q 4BBSH 3U50C 4LUVA 2E8GA 3E0EA 1K83H 1ASZA 1SLJA 1SRUA 1V9PA 4GN5A 5GROA 4HIOA 4PMWA 4DR2Q 1SFOH 3CCLA 4BXXH 1HJPA 4QGUA 1KXLA 3I55A 4JI0Q 2WB1G 4IFDG 4LUOA 1VQPA 2YU9H 3M4PA 4GLXA 5C4XH 4YY3Q 3OW2A 4JI4L 4BY1G 1PH5A 3S15H 3CCJA 1RL2A 2JA6G 4LF9Q 3HOZG 1WCMH 2YTYA 1D8LA 5JEAJ 4LF6L 1V1QA 2JE6I 1KHIA 3GDEA 3RNUA 1X3FA 4UPAA 4POGA 4GNXC 4KHPL 1U5KA 1VQ5A 4JI7L 4L5RC 1UE5A 2CQOA 1EUJA 4AQYL 4AYBG 1VQGA 1PH6A 4A3LH 5GAEC 2K50A 4DR7L 1SROA 1TWCH 1X6OA 3D31A 3JC66 4OWTB 2CKZB 4FDBA 1XMOL 3UDXA 5IE8A 1YZ6A 1E24A 5C3EG 1BVSA 2RHQB 1O7IA 4BY7G 1E7ZA 2UUBQ 2BA0A 1X56A 2BH8A 3S2DH 1JJ2A 4JYAL 3T1YL 1I5FA 4C3HH 3J80c 1OXUA 3T1HL 4PZ7A 1OTCA 4OO1G 3OYYA 4KHZA 4X64Q 2PI2A 2WFWA 2IHEA 1L0WA 4UP7A 1A0IA 3ER0A 1YI2A 1IBKL 1W2BA 1HNWQ 4LF7L 2EQSA 1VQFA 3KFUA 2GVBA 3NELA 2Q2TA 2R7ZH 1WJJA 3RLOA 4A3MG 1EIFA 4GKJL 3AFQA 4L5TA 3GD7A 4IJLA 5LMUQ 4HIMA 3ICEA 1G6PA 3HFZB 3CC7A 4JI3Q 2UUAQ 4JI6Q 3M9BA 4GLAC 2RHSB 4DV6L 1VS0A 2Q2IA 1R9TH 2YV5A 3DM3A 2ZTDA 4GOPB 2HHHL 2OTJA 3GTPH 4TVAB 1N36Q 4P74A 2N3SA 3PV0A 1JJGA 2JA8G 4BY1H 3KDFA 4DPGA 1LYLA 2JA6H 1VQ7A 3S1MH 4DV4L 3HOZH 1XPOA 1SE8A 5JJLA 2RF4A 5J3BA 1KC8C 4PZ6A 1VQKA 5K36G 1CSPA 1HH2P 1YVCA 4HJAA 3JAMi 5LMNW 4LFCL 1X55A 1XTDA 2R7DA 2AWOA 4IPCA 3UE0A 1YIJA 2UU9L 2N49A 4GKKQ 4B3TQ 3CC4A 4DR2L 2NVYH 3MXNB 1E22A 5E7NA 4BY7H 4JI0L 5BR8Q 3ERSX 4DV5Q 3K0XA 4IPDA 3HOYG 2JEBI 4JOIA 5M3MG 5ELNA 4NXMQ 4AH6A 4YY3L 1LUZA 2K4KA 1E1OA 1UE1A 3ULLA 3PF5A 4LF9L 2JEAI 3GTJH 4A4IA 3M85A 3CCMA 4OONA 4JOIC 2I5MX 1KQSA 3U4VA 3NEMA 4A3MH 2KHJA 3U58A 2JQOA 2CWPA 1B7YB 2XTIA 2ES2A 1E3PA 1GM5A 1KIXA 3CP0A 1X9NA 1HZCA 2Z6KA 4DR6Q 3OTOQ 4JI5Q 4WJ4A 2Y0SG 4DNIA 2YTVA 5IP9G 5IT9c 1I94Q 1IYJB 2UUBL 1VQOA 4A3BG 4L5QA 1JT8A 2N78A 1UEBA 4DR4Q 1CKMA 3E9IA 2ATWA 4X64L 3TQYA 3H0GG 1T9HA 4DV1Q 1A63A 1KRSA 2ID0A 1VQ4A 5AJ3Q 1HNWL 4P71A 1XPRA 5M5XH 1PYBA 3TS2A 1QZHA 4MTNA 1YJNA 5LMUL 1VQ8A 3GTMH 3KYHC 5FLXc 3GTGH 1QUQA 1G291 5LMNQ 1J6QA 4HIDA 4JI3L 4AYBE 2UUAL 4GN4B 4JI6L 3H3VI 4JBKA 3S17H 1EQRA 3TEHB 4MNOA 1N8RC 1JE5A 1SR3A 1Q82C 2I5LX 3UDGA 4NB3A 1VCIA 2NVXH 3HOYH 5M3MH 4Y52H 1CSQA 1N36L 4DV2Q 1YNXA 4JBWA 5IP7G 3I4MG 3I4NG 2PQAB 4DR3Q 3ULJA 2MO0A 3FKIH 5FJ8H 1E1TA 1NE3A 3BU2A 1PA6A 1FGUA 4HJ8A 3IRBA 4DV3Q 3KJPA 4DAYB 1VQNA 4JI8Q 3CCQA 3AYHB 1HNXQ 4GKKL 2K5VA 1HZAA 2LXKA 3KF6A 3RN5A 3RLNA 2K14A 4A3IG 4B3TL 1X54A 1IL2A 1JB7A 5IP9H 5GAHC 1WI5A 2NN6I 3I4OA 1VQJA 5BR8L 3G4SA 4DV5L 3AEVA 4IOAA 4IJHA 2AWNA 2PMZE 2JA5G 4A3BH 1EYGA 3PO2G 1PH1A 1I3QH 4NXML 1CKNB 2E2HH 1Q12A 2E5LQ 1PYSB 3H0GH 4GLVB 1PH2A 2NVQH 2LSSA 1OXSC 5C0XI 1W3SA 4A3FG 5IYBG 3CMAA 1PH7A 4OXPA 4R1JA 1VQ6A 3PF4A 3KOJA 2CCZA 4LF8Q 1AE2A 1EFWA 2E2JH 4BA1I 3PUXA 4IFDJ 1K8AC 2N8NA 1HNZQ 4LF5Q 4JBMA 2OQKA 2VQEQ 3OTOL 4JI5L 4DR6L 5M5WH 2B29A 1EWIA 4P72A 1I94L 4OX9Q 3RR5A 2AMCB 4LF4Q 2DGYA 2V1CC 2WP8J 1WOCA 4NPSA 2CWAA 4JI1Q 4GN3B 2ZM6Q 2UXDQ 2WAQG 4DR4L 2RCNA 3I7FA 5IP7H 5H1SE 4X62Q 4DV1L 3TS0A 3I4NH 3I4MH 1VQIA 5AJ3L 4ALPA 4NXNQ 1VQDA 2HIXA 2JA7G 5M5YH 2NVTH 2UXBQ 1VQAA 3GTQH 3CXCA 1PH4A 3M4QA 4A3KH 3A5ZB 3J81i 1X3EA 3I2ZA 1K73C 1YJ9A 1X3GA 4A3JG 4YCUA 3F2BA 3CCEA 5FLMG 3U4ZA 1FL0A 2L15A 1HR0W 4APVA 5LMNL 4JG2A 4A3IH 4B3SQ 3HKSA 1Q81C 4IPHA 2R92G 3A74A 1TWFH 4A3DG 4LUZA 3K8AA 5GQOA 2Y0SE 3TREA 1V43A 4O2DA 4DK6C 2JA5H 4QL5A 3PO2H 1KAWA 5IYDG 4DV2L 3S14H 1GO3E 1KRTA 1G51A 3M3YH 1TWAH 3K7UC 2NZOA 3L7ZC 4DR1Q 4DR3L 3PO3G 3EN2A 2K75A 2D0PA 3HKZE 4A3FH 5IYBH 2ZTEA 2HQLA 4R4CA 1OXTA 4R4TA 4UP9A 1YHAA 3G71A 4DV3L 4YCVA 3CCUA 4JC0A 4JI8L 3LGJA 2XGTA 2H5XA 5C0XJ 1HNXL 4A93H 3FKIG 5FJ8G 3JAMc 1L1OB 2KHIA 4DUZQ 1XJVA 4B3RQ 1NMGA 2D62A 3RN2A 1Y1WG 4DUYQ 2LXJA 3S16H 2CFMA 5C44G 1LM0A 4GOPA 1DGSA 4RG1A 2IHFA 4A3GG 3W5OA 4XTCS 1FJGQ 1MIUA 4A3CH 4IO9A 2IY5B 4JBJA 1AE3A 2I0QA 2E5LL 1P16A 1PVOA 1C0AA 1B70B 3W1GA 1CKOA 3K7AH 4AIMA 1S72A 4GOPC 2VNUD 2JA7H 3PUZA 2A8VA 2KENA 2R7FA 1S3OA 1Q86C 2WB1E 1WFQA 4A3JH 4LF8L 1UWVA 4IOCA 1XNQQ 5FLMH 3S1QH 1TWGH 2Z6KC 1XMQQ 1YBYA 2DUDA 3D0FA 1K9MC 1YEZA 1QZGA 1HR0Q 4YHHQ 1UE7A 2ZJQA 1HNZL 4XIGS 1HZ9A 3CMEA 4LF5L 2VQEL 4A3DH 4IFDI 2R92H 4MZ9A 2PNHA 4HJ5A 1IBMQ 4OX9L 2F4VQ 4LF4L 3CQZH 5HGQA 4A75A 2QA4A 2UXDL 1EQQA 1MJEA 4JI1L 4UY8C 2ZM6L 4X6AH 4X65Q 1N32Q 1YHQA 2ALYB 5IYDH 4X62L 2B63G 3PO3H 3PIOA 4PZ8A
chains in the Genus database with same CATH superfamily
4NXNL 4RGNA 1AH9A 1LTRD 4FNFA 4GNXB 2ZJRA 3BJUA 4A3BB 1MHWC 3A56A 3TP8A 3M4OH 2WACA 2E2HB 5J22A 2E2IH 2KCCA 4YCWA 1HA5A 1Y1WH 1J9OA 1A62A 1QVCA 1ENCA 1I4HA 1UE6A 1CA6A 2EYPA 2F3VA 3FHWA 4DR5Q 3A5UA 2PZUA 3PMFA 4A3EG 1ENAA 3CCSA 1Q90A 1SNQA 1DYQA 2TMPA 2IX1A 2Q8RE 3HOVG 1IXRA 3CD6A 1G2TA 4DUZL 1U4MA 1N33Q 3I4MB 1YNJD 2RKSA 2YTXA 1GKHA 1RIPA 1RTOA 4UP8A 1HUMA 2A68C 4X66Q 1KTKA 2KBNA 2MQHA 3KDFB 1XMQL 3SR1A 3PO2B 5JJKA 4CBVA 1HR0L 1KD1C 4FXKC 2CH4A 2F4VL 5GAGC 3HOWH 4BBRG 3ZYYX 1Y8PB 1B50A 2EJMA 4DV7Q 2RA4A 3LWEA 5DAUA 4J6HA 4X65L 1N32L 1V8QA 3HOUG 1STHA 4QQBX 4EQ5A 2NN6G 1H9KA 3R8BA 1LT5D 1VQLA 1IZ6A 1SDFA 2QGQA 3A8JE 4RCOA 1HRJA 5C4JH 3W1BA 1M1KC 2B2YC 3TRZA 3CPFA 2CHBD 5M9OA 3IL8A 4A3JB 2MFIA 2VQFL 1VQ9A 1VQBA 4GS3A 4FP5D 1BXTA 2KUMA 1ASYA 1KNAA 2HDMA 1D7QA 4JI4Q 5KYIA 4ZKCB 3CQZB 1B9MA 1DOKA 4K8JA 3UE1A 1LTTD 4LF6Q 3NXWA 4Q5VA 3CCVA 2B39A 3BZDB 3E9HA 3KK7A 3R93A 4BBSG 4CJ1B 4DK3C 4LFAL 3IFTA 1VQMA 1KABA 1V1OA 1I6HH 1Q1EA 1D5XC 1Y8OB 4KI0A 4ZK9B 1DCZA 3IKJA 4MIUA 1MJCA 1A3UA 3S1NB 1IBLL 4MHEA 4G7OC 3FEWX 3STBC 2B8FA 1M90C 4B3ML 3DWAA 5C44B 1S5DD 1SYCA 1TIID 1WCMG 2YYZA 4BA2I 3CAMA 2OWOA 4A3CG 1YITA 4K8IA 1GD7A 4R4OA 1GVPA 5KNDA 3LNNA 1BCPC 2JA8H 3KF6B 5C3WA 4C2MH 3IFDA 2DNCA 1PRTB 2HHHQ 2D9UA 5JJIA 3EBEA 3OIQA 2RVLA 3X3MA 3GO5A 1QILA 4DV4Q 2WAQE 2Z9HA 5IYCH 3ULPA 2OXPA 1XNRL 4JI2L 2RQXA 2F52A 5EKKA 2UU9Q 1AP0A 2J7ZA 3QG1A 4LUVA 1PTOB 5GROA 4ILWA 4DXGA 1SFOH 3CCLA 4BXXH 1HJPA 1TWHB 3GTKB 2N88A 4JI0Q 2WB1G 3TN2A 2KVMA 1SMYD 3NWTA 4YY3Q 1QB5D 3S15H 1EWCA 2JSOA 4KY5A 5JEAJ 4POGA 2VUMB 4KHPL 3NP8A 2F0SA 4FYDA 3L9AX 2G9DA 1VQGA 1JWUD 1X6OA 2KOLA 3QB3A 3JC66 4OWTB 3VA5A 1DXMA 4FDBA 3UDXA 5IE8A 1YZ6A 4OIKA 1BVSA 5KIXA 1O7IA 1Y1VB 2K7VA 2BA0A 2HQEA 3K59A 2NUCA 1I5FA 4XYQA 4LMQD 4C3HH 4X64Q 2PO4A 2BE5D 4ZLTF 4QMGA 1GJXA 1EY0A 4C3JB 5IGBA 1HNWQ 1VQFA 4X3KA 3NELA 3ND8A 1WJJA 3RLOA 5ELEA 3AFQA 4L5TA 3GD7A 4IJLA 1Y8NB 4JI6Q 4AYBB 2KEEA 2YV5A 1EY6A 3DM3A 2OTJA 3GTPH 4IUQA 4TVAB 4CDCC 3RZOB 2B2TA 4P74A 4XDXA 2JA8G 3DHQA 5IT9E 4BY1H 3KDFA 1VQ7A 2SOBA 3TSSA 3HOZH 4ZUJA 5JJLA 3DUZA 1B9NA 1KC8C 5K36G 5I6YA 2LS01 5LMNW 4LFCL 1GHJA 5HURA 1PDQA 1FNWA 3FPPA 1L0YB 4HSPA 1LACA 2JN4A 1F2MA 3K0XA 2PMZB 4JOIA 1LUZA 1BQQT 4JPBW 5IGFA 5C4ZA 2JEAI 1FR3A 3HOXB 3T4AC 1G8ZD 4A4IA 3M85A 2Z1CA 2I5MX 3FMCA 2VB2X 4Y7NB 3U58A 1B7YB 1GM5A 1EY7A 4H7BA 1HZCA 4JI5Q 1ZYRD 5IP9G 1HFNA 1IYJB 4HSVA 1D2BA 2EJGC 4CDDC 2J0TD 4DR4Q 3RZDB 5EPJA 2JYOA 3TQYA 4CHTB 1TY2A 1LT3D 1A63A 2ID0A 4DGZA 1CHPD 1SYBA 1G91A 1XPRA 4X3TA 5M5XH 4XQQA 1PYBA 3TP6A 1YJNA 2L11A 4R8NA 1CM9A 2OF1A 4KK7A 4JBKA 3S17H 1EQRA 4MNOA 1JE5A 4XYOA 2I5LX 4NKLA 2NVXH 1VCIA 3QWNA 3DMUA 1CSQA 2MPMA 2SNMA 3I4NG 4KV6A 2PQAB 3Q22A 3ULJA 3FKIH 4E6IA 2ZXRA 2QW7A 3HKZB 1U4PA 3C1EA 3W2DA 3BU2A 1S5CD 4DV3Q 2F0WA 5CGKA 1XTCD 2A6EC 3KF6A 3RLNA 1J8IA 4WJWA 4RCNA 3AEVA 2B2UA 4DV5L 3J7AV 4IOAA 4IJHA 3Q24A 1STAA 5IGDA 1LTAD 1I3QH 1RTNA 3PIO3 3GQBA 4B9XA 3H0GH 4GLVB 1PH2A 2EY2A 3I73A 2F0PA 4A3FG 4KKTA 3TZDA 1EEID 4FO2A 1BF4A 4R1JA 2NBFA 1VQ6A 4LF8Q 1AE2A 3E6ZX 1LTID 2VB3X 2BOSA 4BA1I 4IFDJ 2N8NA 4ME5A 1HNZQ 2OQKA 2VQEQ 4DR6L 5I9OA 2JA6B 1EWIA 2JP1A 2F0VA 4OX9Q 1WOCA 4NPSA 3JAME 4JI1Q 5J39A 2ZM6Q 2WAQG 3NSWA 1WTXA 1CHQD 4N9TA 2RCNA 5H1SE 5AJ3L 4ALPA 1BUVT 3AMUA 2HIXA 2NVTH 2NVYB 3M4QA 4A3KH 3A5ZB 1X3EA 1X3GA 4BY7B 4YCUA 1F9RA 5CV6A 3U4ZA 5LMNL 5T1GA 2KECA 3V96A 4A3IH 4MN3A 1Q81C 1TWFH 2F0UA 3SK6A 3K8AA 4OGQC 3TREA 1V43A 2FMMA 2P5ZX 4CJ2C 2E75C 2O2LD 1GO3E 1KRTA 3M3YH 3S14H 3L7ZC 3TDQA 1EIGA 2D0PA 2ZTEA 3FDTA 1YHAA 4NP5A 1U9RA 3G71A 3K5MA 2JA7B 1GHKA 5G3LF 3MXPA 5ELCA 2H5XA 1SYEA 4A93H 3FKIG 3N6RA 4WORA 4IURA 3RN2A 3QO2A 1PXUA 4DUYQ 2F0LA 2LXJA 3A8KE 3S16H 2EYMA 2K28A 4A3GG 3J80L 4TRDA 3A7LA 3BDOA 3GTGB 3W1GA 4GOPC 2VNUD 2JA7H 3PUZA 1S3OA 1BNZA 1XNQQ 3HGBA 2ZJQA 4HMIA 3CMEA 4LF5L 4A3DH 2PNHA 3V2TA 3MTSA 5HGQA 2NTSA 2UXDL 1PTOD 3CKIB 3NWSA 1YHQA 2XN9C 4X62L 2HDLA 3AU7A 3PO3H 2O4XA 3GP7A 3VDYA 1N34Q 3G48A 4HJ7A 1K0RA 2VW9A 1K0SA 3VA7A 3NENA 1KNEA 2FFKB 4A3KG 1Q7YC 1K28A 3CCRA 2EOTA 1NJIC 1BBWA 1WTWA 2OQ0A 3I90A 3OSOA 3ITPA 1NR4A 2C5CA 1OXXK 2A1AA 4DR1L 1EYAA 4LWCA 2KCTA 3N52A 3KLSX 4C3IH 5M5WB 2WIIB 2EYOA 3NQIA 1STNA 3C46A 4DFAA 5E3FA 5C6AA 5IT9L 3PIP3 3J81E 5M3FG 3GTQB 2I5HA 4LNQA 2ENBA 1FJGL 4EVOA 3L0OA 4A93G 2PQAA 4KY7A 5ELOA 1JWMD 2B63H 1F9PA 5DM73 2O5JC 1OXVA 3WOEA 1HTPA 2N55A 2JK8A 2F4IA 5DNFA 4K0KQ 5EBCA 1Q1BA 3BZCA 3I91A 4K5WA 2JA5B 1C7YA 1ET6A 3KF8B 4X3UA 2EJFC 1TWAB 1G6ZA 2G9HD 4A76A 1IBML 1I50H 4QIWE 2BDNA 3D6CA 4S3SA 5EPLA 1KDCA 5C4HA 4ZQ3A 2F1MA 3QJYA 3SGIA 1SJHD 3R2TA 3ND9A 4A3EH 2FMCA 3DWQA 2BA1A 4KKSA 1F9SA 5HY6A 4O0AA 1SYFA 3HOVH 4JV5Q 5J1ZA 4RMFA 1VMCA 3P20A 3S1RH 4LJZC 4LFBQ 4DV0Q 1HTLD 1D5MC 4Q0FA 2MNAA 1JOKA 1T5XD 2C35B 2EXDA 3K81C 2DN8A 1K8GA 3OMCA 4POFA 5IOCA 3S24A 1TWGB 1LTGD 1FVIA 1TQOA 4XQNA 1CUKA 4RKBA 5CV8A 2EE1A 3OPOA 2A6HD 4KN4C 1SMYC 2L1BA 2R92B 2R93G 3RUZA 3SK8A 4EQPA 2K1BA 3PUYA 2BH2A 2K52A 3EIVA 1E2WA 3HRZC 3L2PA 1QVFA 2A73B 2UXCL 1AFPA 4C3IG 4KLKA 2JXMB 1DZ1A 4BBRH 4DR7Q 5IGEA 2Q2UA 3AQQA 2F0QA 4YWMA 4P75A 2AKWB 2PQEA 3HOUH 3M4OB 3Q0AA 2E2IB 3A0JA 3T1YQ 5C4XG 2NN6H 1STEA 1Y1WB 2BE5C 1DOLA 2R6GA 1S5ED 3F2CA 1JCKB 3BVGA 3H6MA 4RH6A 5IWAL 2DNEA 2EXZA 4OEMB 1WTQA 4GKJQ 4HCSA 1JB3A 2K5HA 2KEDA 4JCVE 1RJTA 3Q8DA 1VF5C 2Z0SA 2HIVA 4HJ9A 4UDUC 3RD4A 4X3SA 1MGSA 1TS4A 1J5EL 2KA7A 2HD3A 3JAML 2R7ZG 4HEDA 1STGA 5D3IB 4BBSH 2RSNA 4L63B 1LTBD 2XWJB 3E0EA 4ZKBB 1ASZA 4GN5A 1PFNA 3F2UA 1KXLA 3I55A 2DY7A 4LUOA 3NQTA 2YU9H 2XNAC 2B8GA 3I8ZA 1PH5A 1SE2A 3HOWB 3CCJA 1RL2A 1TY0A 1WCMH 2M2LA 2YTYA 4A3CH 1V1QA 3GDEA 1KHIA 3RNUA 4GNXC 2LFNA 1VQ5A 4JI7L 1A2TA 2CQOA 3T53B 1EUJA 4AQYL 1FGBD 2K50A 1XMOL 1TWCH 1E24A 1ZYRC 2J4XA 2RHQB 1E7ZA 1M4VA 5C4JB 3EROA 3NBIA 5I6WA 3S2DH 4JYAL 4EGVA 3E3XA 1IHZA 3T1HL 4OO1G 2K5QA 3OYYA 4KHZA 1YNNC 1BBXC 1L0WA 1IBKL 3W3AA 4LF7L 1JOQA 1ONLA 4RHRA 2Q2TA 4A3MG 4RFBA 1EZ6A 5A35A 5LMUQ 1G6PA 1F9QA 2IWHA 2DJFC 3MZ5A 5DEHA 2PCFB 3M9BA 4DV6L 1PMRA 1Z7TA 2Q2IA 1H9SB 2FINB 4FF3A 1KDAA 4BS9A 1N36Q 5D65A 1AN8A 3FVQA 1S5BD 3MA2B 1LYLA 1I6HB 1MSGA 1SE8A 1H9JA 2F0GA 3KF8A 1QE6A 4H0LC 2B2TC 1HH2P 4HJAA 3URYA 2EDGA 1YIJA 2R7DA 2F3WA 2ICIA 2AWOA 4DXFA 5BN5A 3CC4A 1CZWA 2Z6BA 4DR2L 4FF1A 3MXNB 1E22A 2K01A 5FLXE 3ERSX 4J1MA 3HOYG 1BR9A 2K05A 4XT3B 5M3MG 4NXMQ 2K4KA 4HTHA 1RCVD 2A69D 4LF9L 2X6GA 2JA8B 4C1NK 4PNYA 4C2MB 3KUPA 4JOIC 3V05A 3U4VA 4ABNA 1II3A 2KHJA 2E74C 3D4DA 1ILPA 2CWPA 1IW7D 2L0CA 2ES2A 1A3VA 3CP0A 2Z6KA 4WJ4A 1RD9D 2Y0SG 3OW7A 2YTVA 1NNXA 3WDNA 1I94Q 2V4DA 5FOBB 1PZKD 2UUBL 1VQOA 4A3BG 4L5QA 2N78A 5LL6S 3E9IA 2PPBC 1T9HA 1RODA 3J81L 1TKWB 1JICA 1SFOB 5K36H 2QILA 1PZID 4MTNA 3GTMH 1DOMA 4HIDA 1MD2D 4JI3L 4AYBE 2UUAL 3S15B 1X3PA 2IX3A 2ZXPA 1H9RA 2M00A 3J80E 2L12A 1N8RC 2EPBA 4DK1A 4Y52H 4F87A 4K5XA 1YNXA 3I4MG 4DR3Q 3A7AB 1CT1D 1E1TA 1FGUA 1VDZA 3IRBA 2K6AA 2F0KA 4DAYB 1S4ZA 1EU4A 1G2SA 3CCQA 3AYHB 4C3HB 4V190 1JWSD 1BDOA 1F2YA 1HZAA 1QNUA 2K5VA 3RN5A 3BDCA 1JC7A 1QWYA 3EJIA 4B3TL 5ELDA 1IL2A 1JB7A 1GUGA 5IP9H 3I4OA 2NN6I 4CDEC 5BR8L 4M8AA 1B44D 2PMZE 3TP5A 1OO9B 3PO2G 1CKNB 1IYVA 1WTVA 1PYSB 2X69A 2NVQH 5ELFA 2LSSA 1PRTC 1W3SA 2B2UC 3VYRA 3KOJA 2E2JH 3NK9A 3GTPB 1EFID 4J8QA 2DY8A 4BY1B 4JBMA 1O7ZA 3OTOL 4IZ8A 2B29A 4P72A 3HOZB 1VF7A 2AMCB 4LF4Q 5EQ0A 2R3ZA 2WP8J 1UEAB 1PTOC 3K0YA 4DV1L 3I4NH 3TS0A 3AB9A 1VQIA 2CW0C 5BN3A 4NXNQ 1VQDA 5M5YH 5F2DA 3CXCA 2H4OA 5JEAH 3K58A 2MGSA 1YJ9A 4A3JG 1FD7D 3CCEA 3L3OC 5FLMG 1WTPA 4APVA 1HA6A 4DAVA 4CJ0B 2Z8LA 3HKSA 4IPHA 3HZXA 1CFMA 4LUZA 4QB4A 4DK6C 1AEXA 3IAYA 2B2YA 5IYDG 4DV2L 3K7UC 4L8JA 4A3FH 3HKZE 4R4TA 3S9WA 5LL6X 4YCVA 4JI8L 2XGTA 3DM1A 5CV5A 5C0XJ 1HNXL 3I70A 4DUZQ 1XXGA 1L1OB 1EY9A 4G7HC 1I6VC 1NMGA 2D5DA 2D62A 3EFXD 4DN4M 3H3VC 1H9SA 5C44G 3U9SA 4JVZA 1WTRA 4XTCS 1MIUA 5NUCA 5M5XB 2IY5B 2I0QA 2E5LL 1PVOA 1B70B 3K7AH 1B3QA 2X6LA 2R7FA 5ISRA 3S17B 4JK1C 1M8AA 4IOCA 3S1QH 4C56C 2NVXB 1JOOA 3D0FA 3TP7A 1XMQQ 1QZGA 3VYSA 1HR0Q 1UE7A 2HCCA 3MXNA 3FKIB 1CZGA 2F4VQ 4A75A 5AFWA 4MTKA 4X65Q 1N32Q 1PYWD 1SJED 2WV6D 3DEOA 1AW7A 3PIOA 4PZ8A 2I46A 1IL8A 1SN8A 2UXBL 2RDFA 1SMXA 1MBYA 2RBMA 3SE0A 3J7ZC 1D1KA 1KL9A 4O1NA 5JPMC 1A6XA 4HIKA 1I3QB 5E4XA 3DLLA 4B3SL 1LLRD 3H0GB 1B4OA 2CQAA 5KEEA 5JEAG 4IQZA 4B08A 4WJ3M 2RSOA 2K5NA 4A3GH 4G7ZC 4DU9A 1EOVA 4DKAC 3H15A 1WD0A 3OOCA 4R4IA 3UDIA 2VUMG 2VQFQ 4OL7A 5EJWA 5KNBA 5I2YA 2MO1A 2A6HC 4HAEA 1QCBD 1FNUA 3I3CA 2IPKD 2HT1A 1Y1VG 1I4RA 2WKDA 1Q46A 1WYDA 4P2CB 1U0LA 4B3RL 4DNTB 4C1NI 1LABA 4F88A 3T16A 4LFAQ 1DONA 2NVTB 4A3KB 4DK0A 4C3JG 5JOBA 2IX0A 3ZJYC 1WD1A 1ICWA 1NMFA 1Q8KA 3NPPA 1IBLQ 1JMCA 4A3IB 5C3XA 5LHY1 1TWFB 4B3MQ 1L0XB 2OEOA 4DAYA 1I4GA 5FLXL 1DD2A 1ZXTA 4YHHL 3S14B 3M3YB 1WVLA 2OCEA 4R4QA 2ASBA 3STBD 2L55A 1Z6HA 1C48A 2A19A 3PCOB 5FO8B 1CKNA 1Z9FA 1BOSA 2FHTA 2NB0A 3LX0A 1VQEA 3J7A5 1BCPF 4IALA 4YIJA 3CW2C 4A93B 1PV4A 3LWUA 2F3IA 2UUCQ 3S16B 2M9VA 4QY7A 5FK9C 5FO7B 4LW1A 2VZAA 1BBUA 2D2CC 4EQOA 2TSSA 1XNRQ 4RGTA 4JI2Q 1H9MA 3T56B 4IN3A 5C0XG 1XPUA 2IJ0A 3PSIA 2QEXA 4PV1C 5EKLA 3VR3A 5M3FH 4ID6A 1A8VA 3HOXG 3G6EA 4DR5L 3GTLH 1TS3A 4KD4A 3S2HH 1YNJC 1X32A 2B2VC 2XIWA 3PGZA 4U68A 5CV9A 4QCLA 2VY3A 1H95A 1RF2D 5G3LD 4A3DB 4H44C 2B2WA 4DA2A 1JJCB 5C5MA 4K5VA 1RDPD 1YJWA 3C3LA 5C3EH 1ZEQX 1N33L 4KHPQ 1ENFA 3PO3B 1SNPA 5CC4A 1Z47A 1PH9A 4RHSA 3I56A 4YWLA 3AFPA 5CV7A 5EBDA 1XWEA 1QOHA 1IYUA 4X66L 3UDFA 3CPWA 4N8FA 1PFSA 1HZBA 4IUVA 2IT1A 1Y69U 5IODA 5HGTA 3GTOH 4IUUA 2PW7A 1L1OA 4HR7B 3J81j 1N9WA 1AZQA 5TSSA 4K2LA 4A3LG 3PIPA 2D0OA 5CBAE 4DV7L 5EGTA 4J15A 4C3IB 2NYZD 4RGMA 3HKZG 5GADC 2EYLA 1ESRA 1GXDC 4L5SA 4OWWB 3CC2A 2EIFA 2KCMA 1QJOA 3VYTA 3D6WA 4IPGA 5JVG3 5E4WC 4RA8A 5FO9B 2R93H 1GUNA 3BVZA 1NTGA 1GOZA 3MEFA 5DLQE 1PHJA 1DJRD 1VQHA 3VR6A 2B63B 4EX5A 1YHBA 4LFCQ 3U50C 3K57A 1K83H 1SRUA 4HIOA 1K8OA 2AQ3B 4R9WA 5K5PA 3UI2A 4QGUA 4LAAA 4IFDG 1VQPA 4QF4A 4FF2A 3M4PA 4GLXA 5C4XH 3OW2A 4JI4L 1I50B 2G5DA 1KAAA 2A69C 2JA6G 2XRQD 2Z4IA 1D8LA 4LF6L 3D4WA 2JE6I 4RWSC 5CMDA 1X3FA 2XSCA 4UPAA 4KY6A 4XQJA 1U5KA 3CRKC 4L5RC 4CKBA 4A3EB 3NTKA 1IW7C 5GAEC 1SROA 3D31A 2CKZB 4O42A 4K6LA 2IL8A 3E5SA 3HOVB 1O80A 5C3EG 3S1RB 4BY7G 4I7AA 2BH8A 1S5FD 4G4KA 1JJ2A 4K2KA 3J80c 2E76C 1OXUA 1RHPA 5KRUA 2PI2A 4ZRZA 1UUPA 2WFWA 2ICEC 2IHEA 2OT2A 4KN7C 1A0IA 1HPCA 2EQSA 4XT1B 2GVBA 2R7ZH 4HIMA 3ICEA 3MFYA 3HFZB 3CC7A 1KLGD 1NSNS 2EY1A 2RHSB 1VS0A 3OMGA 2EYHA 2ZTDA 2HHHL 2F03A 2K03A 1JJGA 4BBRB 4DPGA 3S1MH 4DV4L 5J3BA 1B1ZA 3I72A 1VQKA 1CSPA 3HOUB 3ERQA 3EA6A 3KBXA 4IPCA 1XTDA 2UU9L 3UE0A 1TVXA 1EOTA 4PMCA 1EIHA 4JI0L 2SEBD 4DV5Q 4QUFA 1NCVA 4YY3L 2MJ8A 2A6ED 4KD3A 4OO1H 1E1OA 1UE1A 3SXHA 3ULLA 3PF5A 3GTJH 4OONA 1KQSA 5EKIA 3NEMA 4A3MH 1EYCA 2XTIA 2R61A 3MXGA 1QNKA 2QF7A 1KIXA 5A2QL 3TMEA 4DR6Q 4IUPA 4DNIA 5IT9c 3E0JA 1DM0B 1JT8A 1LT6D 1CKMA 1RKNA 1Q3LA 4X64L 4BBSB 5AJ3Q 1I4XA 2WKCA 1HNWL 4P71A 1T5EA 2EY6A 3ONAB 2KQ3A 3Q23A 1QZHA 1EYDA 3KYHC 4CKCA 2YU9B 5LMNQ 1G291 2F0FA 2EVBA 4JI6L 4GN4B 4BWGB 2A74C 4FXGC 1EEFD 3TEHB 1WCMB 2Y0SB 1SR3A 2LKVA 4NB3A 3CU7A 3HOYH 5M3MH 1PLFA 4JBWA 5IP7G 3DEPA 1TWCB 5CBEE 1PA6A 5ELBA 4HJ8A 1WTOA 2A5HA 1V1PB 1VQNA 3S2DB 3SDZA 2LXKA 1AZPA 2K14A 1SE4A 4FXDA 2AUKA 5GAHC 3G4SA 2AWNA 4QUCA 2JA5G 4A3BH 1EYGA 1PH1A 2E2HH 3QR8A 1SNCA 4HCEA 1OXSC 5IYBG 4OXPA 3FRPB 2WB1B 3HG9A 4ZCKA 3VR5A 1B53A 1K8AC 1A2UA 2RDHA 4LF5Q 4JI5L 3QOJA 1HQRD 1SSOA 2QDBA 4EQNA 3OHXC 2DGYA 2UXDQ 1EU3A 4DR4L 1LO5D 2ZXOA 3I7FA 3I4MH 4X62Q 1XX8A 2FJ2A 1LT4D 1ML0D 4WRDA 1VMPA 4G57A 1PH4A 5JAVA 3KLSA 3R3OA 2L15A 1W6JA 4JG2A 4RKLA 1EL0A 2R92G 3A74A 2PYKA 3EQLC 1FNVA 3TZUA 4O2DA 4IUNA 3J7AF 4QL5A 3PO2H 1MI2A 1KAWA 3CRLC 1G51A 4FVMA 1HXYD 2HUGA 3TBIB 2NZOA 4DR1Q 2K75A 1CK1A 1OXTA 4UP9A 4DV3L 3KBGA 1ICFB 1BCPB 1FYCA 3NTIA 2PNRC 3JAMc 5DM63 1XJVA 3H91A 1Y1WG 1EZ8A 1E2ZA 1A15A 2CFMA 1LM0A 4RG1A 2K5WA 1FJGQ 4JBJA 3GTMB 1P16A 5KNCA 2E2DC 4AIMA 1F2LA 3MC0B 2KJXA 2NWGA 2WINB 2F0OA 1Q86C 4N9PA 4A3JH 4LF8L 5FLMH 4RGOS 2DUDA 3D4RA 1HUNA 5KGUA 1HNZL 4XIGS 4IUTA 2VQEL 4DAPA 2F0IA 4HJ5A 2F0HA 1IBMQ 4OX9L 3CQZH 1CQFA 2QA4A 1MJEA 4JI1L 4UY8C 2ZM6L 4X6AH 1SYDA 2ALYB 5IYDH 3NHHA 3G7LA 1GUTA 1SNDA 4V0BA 4TQUS 3NE5B 3S1NH 1X65A 3WOFA 3WWVA 2KCNA 2LMCB 4I7ZC 3PQIA 2NVQB 1SE3A 3HOWG 2HCIA 5C44H 2UUCL 3BS1A 1PH8A 4OO1I 2EY5A 5L37A 2H1EA 2E2JB 3F2DA 3M7NA 1EIYB 2VL6A 4KHVA 2GA4B 3O13A 5I4DA 1D6EC 3VYUA 1HFGA 1B3AA 1S40A 1Y14B 4ME3A 4CKEA 3DWPA 3I4NB 1LTLA 2UXCQ 1U4LA 4ZAIA 4DUYL 3K80C 1C8CA 4GNXA 1GUWA 1VQCA 5M5YB 2F0MA 3HEJA 5IY0A 3RLFA 3EVQA 4ODGA 3F1ZA 2ZT9C 3J80i 4F7XA 1QVGA 1NY4A 1ZKOA 2MUYA 1PTOH 4ZUIA 1NBWA 2F0EA 1V1PA 2PW5A 1XNQL 1TWHH 3GTKH 2SNSA 3D3RA 2GVAA 1I4PA 4DAMA 5T1IA 1ILQA 3H94A 5IWAQ 4A3FB 1R4QB 2EYJA 2NZHA 3QOLA 4YWKA 2VUMH 5IIFA 1BKBA 5BN4A 2JA9A 3GV3A 3MAQA 2B3GA 3P1HA 3F8TA 1N34L 4OWXB 2K5DA 5I9PA 2MHVA 1Y1VH 4XXEA 3J81c 1J5EQ 3BZKA 3SVMA 2WAQB 4LK1C 2XVSA 1MKHA 3K7AB 2BCOA 1PH3A 3BG3A 2Q2HA 3VR4A 2AQ2B 4C3JH 1C9OA 4PG3A 2VS1A 4NW2A 2NTTA 3S1QB 3U9OA 1SBBB 3H3VH 5JJZA 2L9HA 2ZTCA 1EY5A 2XWBB 1B2TA 2PI2E 5CV4A 2F0JA 3NBHB 5IYCG 3PUVA 1LTSD 4QJFA 2JJQA 3P7JA 5FKAC 4JI7Q 1EQVA 2B2WC 3RZOH 3B6YA 3K5OA 4AQYQ 1UNSA 1XMOQ 1QUQB 2A68D 4BXXG 1TR5A 1EQTA 3FP9A 3DXJC 1P8LA 4U673 3HP3A 4JYAQ 2OTLA 3FPUB 3T1HQ 4OELB 4K0KL 2C9OA 1A3TA 3T13A 5EAYA 2GN5A 4A3GB 1IBKQ 2ZJPA 3MFGA 3CF5A 4LF7Q 5C0XH 4P73A 4UAIA 5CR3A 2PZWA 3R2IA 1PFBA 3HOXH 1B8AA 1L1OC 1YNND 1R4PB 4DV6Q 3PUWA 2I07B 4Y7NH 1K3RA 2RDGA 2QEJC 3KLWA 3X3NA 1STYA 2AHOB 3NUCA 4C3HG 1TXYA 4JV5L 4L6TB 5JPNC 3G6JB 3SEBA 4H13C 1PFMA 3BVMA 4LFBL 1WTHA 3M7GA 4DV0L 1L2FA 2FXQA 3KJOA 1IKLA 1NR2A 3RZDH 4H02A 3MXUA 5A2QE 2E8GA 1SLJA 1V9PA 4PMWA 4DR2Q 3OIPA 1SAPA 3OWEB 4JW0A 1JR0D 4NMZA 4KKUA 3BYYB 4BY1G 4LF9Q 3HOZG 2O5IC 4K14A 1CQVA 2QKIC 3BDLA 1W6KA 5IGGA 1UE5A 2DJGC 4AYBG 2KHSA 2Z4HA 1PH6A 4A3LH 1HHVA 4DR7L 4B9WA 4FF4A 2QDLA 2VXWA 2UUBQ 1X56A 1R9TB 3T1YL 4GZYC 2K32A 1OTCA 4PZ7A 3SK4A 1SNMA 4TSSA 5M3FB 4UP7A 3ER0A 1YI2A 2PZTA 4Z9CB 1EY8A 1W2BA 1I4QA 3KFUA 3GTLB 3S2HB 1GUSA 1EIFA 4GKJL 3K5LA 1BCPD 4JI3Q 1EWHA 2UUAQ 4GLAC 1R9TH 5C3EB 4IFDH 5KYLA 4GOPB 3NTHA 1TT2A 2N3SA 1HCZA 3PV0A 2JA6H 1ESFA 2Q8TA 1JQYD 1XPOA 2RF4A 5D14A 4PZ6A 1SYGA 1YVCA 1X3QA 4F8MA 3JAMi 1X55A 4KJNA 2N49A 4GKKQ 1Q8IA 4B3TQ 5CORA 2NVYH 3A55A 5E7NA 2L5TA 4OHJA 3GTOB 4BY7H 5BR8Q 4IPDA 2JEBI 4K6DA 3H09A 5ELNA 4AH6A 2F0NA 5D3DA 1CI3M 4GKKL 2CVRA 4HN7A 3SK5A 3CCMA 1HQMC 1KLUD 4I65A 1F77A 1PRTF 4N8X1 2JQOA 1E3PA 3A8IE 2R93B 1E2VA 3SHLA 1X9NA 1PRTD 2AUJD 3CHBD 3OTOQ 4ULLA 1D5ZC 4CDFC 2IW3A 1UEBA 2ATWA 4DV1Q 3H0GG 1KRSA 3NBHA 1VQ4A 4UHVA 1PTOF 1K83B 1JORA 3MEHA 3P75A 2BDOA 4RAUC 4KJOA 4PQXA 4OIJA 1O7LA 1E0BA 3TS2A 5LMUL 1VQ8A 1JE4A 5FLXc 3K5NA 1QUQA 3GTGH 1J6QA 5C4XB 3H3VI 1STBA 2CW0D 1UAPA 1Q82C 3UDGA 4R8IA 3RMHA 1MSHA 1N36L 1D1IA 4DV2Q 3C2PA 2L4NA 5IGCA 2MO0A 5FJ8H 4PMBA 1NE3A 1TS2A 4DF7A 3KJPA 2NZ1D 3OWFA 4HMJA 4JI8Q 1HNXQ 4A3IG 1X54A 1LV9A 3D8GA 2K33A 1WI5A 1QG7A 1VQJA 3KLRA 4NXML 1SXTA 2R7ZB 4TKOB 1Q12A 2E5LQ 1CTMA 5C0XI 3CMAA 1PH7A 3PF4A 2F0DA 3M4YA 2CCZA 5EPKA 1EFWA 3GV6A 3PUXA 3MHBA 3C1FA 5I2XA 1NAPA 1KDBA 5M5WH 1I94L 3S1MB 3RR5A 1EY4A 3MWYW 2V1CC 1PZJD 2CWAA 2Q8IB 4GN3B 3MVVA 2AQ1B 5CYUA 5IP7H 1IKMA 1SEBD 2JA7G 2UXBQ 1VQAA 3GTQH 1K73C 3J81i 1C4QA 3I2ZA 4M1UB 3VR2A 3F2BA 1U4RA 1K3BC 3BYTB 1FL0A 1HR0W 4B3SQ 4A3DG 4KMUC 3GTJB 5GQOA 3T51B 2Y0SE 2CH4W 4KTAA 2JA5H 4A3MB 2EZVA 1TWAH 4DR3L 2LY7A 3PO3G 3EN2A 1F2ZA 3K6OA 5IYBH 2HQLA 4R4CA 2B2VA 2K04A 2MP1A 3CCUA 4JC0A 1O7YA 3LGJA 4ZYSA 5FJ8G 3A54A 2KHIA 4B3RQ 2EYFA 2SDFA 4WFN3 4GOPA 1DGSA 2IHFA 1BO0A 3W5OA 4IO9A 1SNOA 1AE3A 3I4LA 1C0AA 1ET9A 1S72A 1CKOA 2F0TA 5COYA 2A8VA 2KENA 5E1FA 4DNRB 2WB1E 1WFQA 1TU2B 1UWVA 1TWGH 2Z6KC 4NDXA 1YBYA 1K8MA 1O78A 5M3MB 1XYIA 1YEZA 1K9MC 3HOYB 4YHHQ 2XRSD 1HZ9A 4IFDI 1TS5A 3HS0C 4MZ9A 2RCFA 2R92H 4CGYB 5JVH3 4LF4L 1GUOA 4QIWB 3Q6SA 1EQQA 3J7YW 2QCPX 5C5LA 1CA5A 3QIAA 2B63G 1NUCA
chains in the Genus database with same CATH topology
4NXNL 1AH9A 1SN8A 2UXBL 4GNXB 2ZJRA 1SMXA 3J7ZC 3VDYA 1N34Q 1KL9A 3BJUA 3G48A 4HJ7A 1K0RA 4HIKA 4TQUS 2VW9A 3S1NH 3M4OH 1X65A 3WWVA 3DLLA 2E2IH 4B3SL 4YCWA 3NENA 1Y1WH 1Q7YC 4A3KG 3HOWG 1A62A 5JEAG 1QVCA 3CCRA 1NJIC 5C44H 1BBWA 2UUCL 4WJ3M 1PH8A 4OO1I 2K5NA 2OQ0A 4A3GH 1UE6A 1EOVA 4DKAC 3H15A 3FHWA 4DR5Q 4R4IA 3UDIA 2VUMG 2VQFQ 3F2DA 3M7NA 1EIYB 3A5UA 1OXXK 2A1AA 2VL6A 4DR1L 4A3EG 3CCSA 2MO1A 4A3CG 4LWCA 2KCTA 4C3IH 2IX1A 3HOVG 2HT1A 1Y1VG 1S40A 1IXRA 1Q46A 3CD6A 1Y14B 4ME3A 4DUZL 1WYDA 1N33Q 1U0LA 4B3RL 1LTLA 2YTXA 2UXCQ 4DUYL 3K80C 1GKHA 4LFAQ 4GNXA 1VQCA 5M3FG 2I5HA 5IY0A 4LNQA 1FJGL 1RIPA 3RLFA 4UP8A 3L0OA 4A93G 2PQAA 5ELOA 2IX0A 3F1ZA 3ZJYC 2B63H 3J80i 1NMFA 1Q8KA 4X66Q 1IBLQ 1OXVA 1QVGA 1JMCA 1NY4A 2JK8A 4B3MQ 4K0KQ 1NBWA 2KBNA 1Q1BA 2MQHA 3BZCA 3KDFB 1XNQL 1TWHH 3GTKH 1XMQL 2GVAA 5JJKA 1C7YA 4DAMA 1HR0L 4YHHL 3KF8B 1KD1C 5IWAQ 4A76A 1IBML 1I50H 2OCEA 4QIWE 4R4QA 5GAGC 2ASBA 4BBRG 3STBD 2F4VL 3HOWH 4DV7Q 2NZHA 2A19A 3PCOB 4YWKA 1CKNA 4X65L 3SGIA 1Z9FA 1N32L 2VUMH 1VQEA 1BKBA 3J7A5 3HOUG 3CW2C 1PV4A 4QQBX 2JA9A 4A3EH 4EQ5A 2NN6G 2BA1A 2B3GA 2F3IA 5HY6A 4O0AA 1VQLA 2UUCQ 3F8TA 3HOVH 4QY7A 4JV5Q 1N34L 1IZ6A 4OWXB 4RMFA 3S1RH 1Y1VH 2QGQA 4LW1A 2VZAA 3J81c 1J5EQ 5C4JH 4LFBQ 1BBUA 3BZKA 3W1BA 4DV0Q 1M1KC 1XNRQ 4JI2Q 5C0XG 1MKHA 1XPUA 3PSIA 2MNAA 2QEXA 1PH3A 2C35B 3TRZA 2EXDA 2Q2HA 3K81C 5M3FH 3HOXG 1A8VA 1K8GA 3G6EA 4C3JH 1C9OA 3CPFA 4PG3A 2VS1A 4POFA 4DR5L 2MFIA 2VQFL 1VQ9A 3GTLH 3S2HH 1VQBA 4GS3A 3S24A 1FVIA 1CUKA 3PGZA 3H3VH 1ASYA 2ZTCA 1D7QA 1H95A 2VY3A 2R93G 4JI4Q 1JJCB 2PI2E 3NBHB 5IYCG 3PUYA 3UE1A 5C3EH 1YJWA 4LF6Q 3PUVA 2BH2A 4QJFA 2JJQA 1N33L 2K52A 3EIVA 3CCVA 3E9HA 4JI7Q 3L2PA 1QVFA 3RZOH 4KHPQ 2UXCL 3B6YA 4KLKA 4AQYQ 4DK3C 1Z47A 4LFAL 4BBSG 1VQMA 4BBRH 1PH9A 4DR7Q 1XMOQ 1QUQB 3I56A 4YWLA 1I6HH 3AFPA 2Q2UA 1Q1EA 4KI0A 3AQQA 4BXXG 4YWMA 4P75A 2AKWB 1MJCA 3HOUH 3FP9A 4X66L 1P8LA 1IBLL 4JYAQ 3UDFA 3A0JA 3CPWA 3T1YQ 2OTLA 5C4XG 3STBC 3T1HQ 1M90C 4B3ML 4K0KL 1PFSA 1HZBA 5EAYA 2GN5A 1WCMG 2IT1A 2R6GA 2YYZA 1IBKQ 3CAMA 2OWOA 2ZJPA 3GTOH 4BA2I 1L1OA 3F2CA 3CF5A 1YITA 4LF7Q 3J81j 1N9WA 4P73A 1GD7A 4R4OA 5IWAL 4GKJQ 1GVPA 4A3LG 3PIPA 2K5HA 2D0OA 4DV7L 4J15A 3HOXH 2JA8H 3HKZG 1B8AA 1L1OC 3KF6B 5GADC 4C2MH 4JCVE 3PUWA 4DV6Q 4L5SA 4OWWB 3Q8DA 4Y7NH 3CC2A 1K3RA 2Z0SA 3KLWA 2EIFA 2HIVA 2HHHQ 2KCMA 5JJIA 3EBEA 2AHOB 4IPGA 4HJ9A 1TXYA 2R93H 4JV5L 3GO5A 1J5EL 4DV4Q 2WAQE 5IYCH 4LFBL 1NTGA 3ULPA 4DV0L 1XNRL 3MEFA 1L2FA 2FXQA 5DLQE 3KJOA 1PHJA 1VQHA 4JI2L 2R7ZG 3RZDH 4EX5A 2F52A 1YHBA 4H02A 4LFCQ 2UU9Q 4BBSH 3U50C 4LUVA 2E8GA 3E0EA 1K83H 1ASZA 1SLJA 1SRUA 1V9PA 4GN5A 5GROA 4HIOA 4PMWA 4DR2Q 1SFOH 3CCLA 4BXXH 1HJPA 4QGUA 1KXLA 3I55A 4JI0Q 2WB1G 4IFDG 4LUOA 1VQPA 2YU9H 3M4PA 4GLXA 5C4XH 4YY3Q 3OW2A 4JI4L 4BY1G 1PH5A 3S15H 3CCJA 1RL2A 2JA6G 4LF9Q 3HOZG 1WCMH 2YTYA 1D8LA 5JEAJ 4LF6L 1V1QA 2JE6I 1KHIA 3GDEA 3RNUA 1X3FA 4UPAA 4POGA 4GNXC 4KHPL 1U5KA 1VQ5A 4JI7L 4L5RC 1UE5A 2CQOA 1EUJA 4AQYL 4AYBG 1VQGA 1PH6A 4A3LH 5GAEC 2K50A 4DR7L 1SROA 1TWCH 1X6OA 3D31A 3JC66 4OWTB 2CKZB 4FDBA 1XMOL 3UDXA 5IE8A 1YZ6A 1E24A 5C3EG 1BVSA 2RHQB 1O7IA 4BY7G 1E7ZA 2UUBQ 2BA0A 1X56A 2BH8A 3S2DH 1JJ2A 4JYAL 3T1YL 1I5FA 4C3HH 3J80c 1OXUA 3T1HL 4PZ7A 1OTCA 4OO1G 3OYYA 4KHZA 4X64Q 2PI2A 2WFWA 2IHEA 1L0WA 4UP7A 1A0IA 3ER0A 1YI2A 1IBKL 1W2BA 1HNWQ 4LF7L 2EQSA 1VQFA 3KFUA 2GVBA 3NELA 2Q2TA 2R7ZH 1WJJA 3RLOA 4A3MG 1EIFA 4GKJL 3AFQA 4L5TA 3GD7A 4IJLA 5LMUQ 4HIMA 3ICEA 1G6PA 3HFZB 3CC7A 4JI3Q 2UUAQ 4JI6Q 3M9BA 4GLAC 2RHSB 4DV6L 1VS0A 2Q2IA 1R9TH 2YV5A 3DM3A 2ZTDA 4GOPB 2HHHL 2OTJA 3GTPH 4TVAB 1N36Q 4P74A 2N3SA 3PV0A 1JJGA 2JA8G 4BY1H 3KDFA 4DPGA 1LYLA 2JA6H 1VQ7A 3S1MH 4DV4L 3HOZH 1XPOA 1SE8A 5JJLA 2RF4A 5J3BA 1KC8C 4PZ6A 1VQKA 5K36G 1CSPA 1HH2P 1YVCA 4HJAA 3JAMi 5LMNW 4LFCL 1X55A 1XTDA 2R7DA 2AWOA 4IPCA 3UE0A 1YIJA 2UU9L 2N49A 4GKKQ 4B3TQ 3CC4A 4DR2L 2NVYH 3MXNB 1E22A 5E7NA 4BY7H 4JI0L 5BR8Q 3ERSX 4DV5Q 3K0XA 4IPDA 3HOYG 2JEBI 4JOIA 5M3MG 5ELNA 4NXMQ 4AH6A 4YY3L 1LUZA 2K4KA 1E1OA 1UE1A 3ULLA 3PF5A 4LF9L 2JEAI 3GTJH 4A4IA 3M85A 3CCMA 4OONA 4JOIC 2I5MX 1KQSA 3U4VA 3NEMA 4A3MH 2KHJA 3U58A 2JQOA 2CWPA 1B7YB 2XTIA 2ES2A 1E3PA 1GM5A 1KIXA 3CP0A 1X9NA 1HZCA 2Z6KA 4DR6Q 3OTOQ 4JI5Q 4WJ4A 2Y0SG 4DNIA 2YTVA 5IP9G 5IT9c 1I94Q 1IYJB 2UUBL 1VQOA 4A3BG 4L5QA 1JT8A 2N78A 1UEBA 4DR4Q 1CKMA 3E9IA 2ATWA 4X64L 3TQYA 3H0GG 1T9HA 4DV1Q 1A63A 1KRSA 2ID0A 1VQ4A 5AJ3Q 1HNWL 4P71A 1XPRA 5M5XH 1PYBA 3TS2A 1QZHA 4MTNA 1YJNA 5LMUL 1VQ8A 3GTMH 3KYHC 5FLXc 3GTGH 1QUQA 1G291 5LMNQ 1J6QA 4HIDA 4JI3L 4AYBE 2UUAL 4GN4B 4JI6L 3H3VI 4JBKA 3S17H 1EQRA 3TEHB 4MNOA 1N8RC 1JE5A 1SR3A 1Q82C 2I5LX 3UDGA 4NB3A 1VCIA 2NVXH 3HOYH 5M3MH 4Y52H 1CSQA 1N36L 4DV2Q 1YNXA 4JBWA 5IP7G 3I4MG 3I4NG 2PQAB 4DR3Q 3ULJA 2MO0A 3FKIH 5FJ8H 1E1TA 1NE3A 3BU2A 1PA6A 1FGUA 4HJ8A 3IRBA 4DV3Q 3KJPA 4DAYB 1VQNA 4JI8Q 3CCQA 3AYHB 1HNXQ 4GKKL 2K5VA 1HZAA 2LXKA 3KF6A 3RN5A 3RLNA 2K14A 4A3IG 4B3TL 1X54A 1IL2A 1JB7A 5IP9H 5GAHC 1WI5A 2NN6I 3I4OA 1VQJA 5BR8L 3G4SA 4DV5L 3AEVA 4IOAA 4IJHA 2AWNA 2PMZE 2JA5G 4A3BH 1EYGA 3PO2G 1PH1A 1I3QH 4NXML 1CKNB 2E2HH 1Q12A 2E5LQ 1PYSB 3H0GH 4GLVB 1PH2A 2NVQH 2LSSA 1OXSC 5C0XI 1W3SA 4A3FG 5IYBG 3CMAA 1PH7A 4OXPA 4R1JA 1VQ6A 3PF4A 3KOJA 2CCZA 4LF8Q 1AE2A 1EFWA 2E2JH 4BA1I 3PUXA 4IFDJ 1K8AC 2N8NA 1HNZQ 4LF5Q 4JBMA 2OQKA 2VQEQ 3OTOL 4JI5L 4DR6L 5M5WH 2B29A 1EWIA 4P72A 1I94L 4OX9Q 3RR5A 2AMCB 4LF4Q 2DGYA 2V1CC 2WP8J 1WOCA 4NPSA 2CWAA 4JI1Q 4GN3B 2ZM6Q 2UXDQ 2WAQG 4DR4L 2RCNA 3I7FA 5IP7H 5H1SE 4X62Q 4DV1L 3TS0A 3I4NH 3I4MH 1VQIA 5AJ3L 4ALPA 4NXNQ 1VQDA 2HIXA 2JA7G 5M5YH 2NVTH 2UXBQ 1VQAA 3GTQH 3CXCA 1PH4A 3M4QA 4A3KH 3A5ZB 3J81i 1X3EA 3I2ZA 1K73C 1YJ9A 1X3GA 4A3JG 4YCUA 3F2BA 3CCEA 5FLMG 3U4ZA 1FL0A 2L15A 1HR0W 4APVA 5LMNL 4JG2A 4A3IH 4B3SQ 3HKSA 1Q81C 4IPHA 2R92G 3A74A 1TWFH 4A3DG 4LUZA 3K8AA 5GQOA 2Y0SE 3TREA 1V43A 4O2DA 4DK6C 2JA5H 4QL5A 3PO2H 1KAWA 5IYDG 4DV2L 3S14H 1GO3E 1KRTA 1G51A 3M3YH 1TWAH 3K7UC 2NZOA 3L7ZC 4DR1Q 4DR3L 3PO3G 3EN2A 2K75A 2D0PA 3HKZE 4A3FH 5IYBH 2ZTEA 2HQLA 4R4CA 1OXTA 4R4TA 4UP9A 1YHAA 3G71A 4DV3L 4YCVA 3CCUA 4JC0A 4JI8L 3LGJA 2XGTA 2H5XA 5C0XJ 1HNXL 4A93H 3FKIG 5FJ8G 3JAMc 1L1OB 2KHIA 4DUZQ 1XJVA 4B3RQ 1NMGA 2D62A 3RN2A 1Y1WG 4DUYQ 2LXJA 3S16H 2CFMA 5C44G 1LM0A 4GOPA 1DGSA 4RG1A 2IHFA 4A3GG 3W5OA 4XTCS 1FJGQ 1MIUA 4A3CH 4IO9A 2IY5B 4JBJA 1AE3A 2I0QA 2E5LL 1P16A 1PVOA 1C0AA 1B70B 3W1GA 1CKOA 3K7AH 4AIMA 1S72A 4GOPC 2VNUD 2JA7H 3PUZA 2A8VA 2KENA 2R7FA 1S3OA 1Q86C 2WB1E 1WFQA 4A3JH 4LF8L 1UWVA 4IOCA 1XNQQ 5FLMH 3S1QH 1TWGH 2Z6KC 1XMQQ 1YBYA 2DUDA 3D0FA 1K9MC 1YEZA 1QZGA 1HR0Q 4YHHQ 1UE7A 2ZJQA 1HNZL 4XIGS 1HZ9A 3CMEA 4LF5L 2VQEL 4A3DH 4IFDI 2R92H 4MZ9A 2PNHA 4HJ5A 1IBMQ 4OX9L 2F4VQ 4LF4L 3CQZH 5HGQA 4A75A 2QA4A 2UXDL 1EQQA 1MJEA 4JI1L 4UY8C 2ZM6L 4X6AH 4X65Q 1N32Q 1YHQA 2ALYB 5IYDH 4X62L 2B63G 3PO3H 3PIOA 4PZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN L;  1AH9 A;  1SN8 A;  2UXB L;  4GNX B;  2ZJR A;  1SMX A;  3J7Z C;  3VDY A;  1N34 Q;  1KL9 A;  3BJU A;  3G48 A;  4HJ7 A;  1K0R A;  4HIK A;  4TQU S;  2VW9 A;  3S1N H;  3M4O H;  1X65 A;  3WWV A;  3DLL A;  2E2I H;  4B3S L;  4YCW A;  3NEN A;  1Y1W H;  1Q7Y C;  4A3K G;  3HOW G;  1A62 A;  5JEA G;  1QVC A;  3CCR A;  1NJI C;  5C44 H;  1BBW A;  2UUC L;  4WJ3 M;  1PH8 A;  4OO1 I;  2K5N A;  2OQ0 A;  4A3G H;  1UE6 A;  1EOV A;  4DKA C;  3H15 A;  3FHW A;  4DR5 Q;  4R4I A;  3UDI A;  2VUM G;  2VQF Q;  3F2D A;  3M7N A;  1EIY B;  3A5U A;  1OXX K;  2A1A A;  2VL6 A;  4DR1 L;  4A3E G;  3CCS A;  2MO1 A;  4A3C G;  4LWC A;  2KCT A;  4C3I H;  2IX1 A;  3HOV G;  2HT1 A;  1Y1V G;  1S40 A;  1IXR A;  1Q46 A;  3CD6 A;  1Y14 B;  4ME3 A;  4DUZ L;  1WYD A;  1N33 Q;  1U0L A;  4B3R L;  1LTL A;  2YTX A;  2UXC Q;  4DUY L;  3K80 C;  1GKH A;  4LFA Q;  4GNX A;  1VQC A;  5M3F G;  2I5H A;  5IY0 A;  4LNQ A;  1FJG L;  1RIP A;  3RLF A;  4UP8 A;  3L0O A;  4A93 G;  2PQA A;  5ELO A;  2IX0 A;  3F1Z A;  3ZJY C;  2B63 H;  3J80 i;  1NMF A;  1Q8K A;  4X66 Q;  1IBL Q;  1OXV A;  1QVG A;  1JMC A;  1NY4 A;  2JK8 A;  4B3M Q;  4K0K Q;  1NBW A;  2KBN A;  1Q1B A;  2MQH A;  3BZC A;  3KDF B;  1XNQ L;  1TWH H;  3GTK H;  1XMQ L;  2GVA A;  5JJK A;  1C7Y A;  4DAM A;  1HR0 L;  4YHH L;  3KF8 B;  1KD1 C;  5IWA Q;  4A76 A;  1IBM L;  1I50 H;  2OCE A;  4QIW E;  4R4Q A;  5GAG C;  2ASB A;  4BBR G;  3STB D;  2F4V L;  3HOW H;  4DV7 Q;  2NZH A;  2A19 A;  3PCO B;  4YWK A;  1CKN A;  4X65 L;  3SGI A;  1Z9F A;  1N32 L;  2VUM H;  1VQE A;  1BKB A;  3J7A 5;  3HOU G;  3CW2 C;  1PV4 A;  4QQB X;  2JA9 A;  4A3E H;  4EQ5 A;  2NN6 G;  2BA1 A;  2B3G A;  2F3I A;  5HY6 A;  4O0A A;  1VQL A;  2UUC Q;  3F8T A;  3HOV H;  4QY7 A;  4JV5 Q;  1N34 L;  1IZ6 A;  4OWX B;  4RMF A;  3S1R H;  1Y1V H;  2QGQ A;  4LW1 A;  2VZA A;  3J81 c;  1J5E Q;  5C4J H;  4LFB Q;  1BBU A;  3BZK A;  3W1B A;  4DV0 Q;  1M1K C;  1XNR Q;  4JI2 Q;  5C0X G;  1MKH A;  1XPU A;  3PSI A;  2MNA A;  2QEX A;  1PH3 A;  2C35 B;  3TRZ A;  2EXD A;  2Q2H A;  3K81 C;  5M3F H;  3HOX G;  1A8V A;  1K8G A;  3G6E A;  4C3J H;  1C9O A;  3CPF A;  4PG3 A;  2VS1 A;  4POF A;  4DR5 L;  2MFI A;  2VQF L;  1VQ9 A;  3GTL H;  3S2H H;  1VQB A;  4GS3 A;  3S24 A;  1FVI A;  1CUK A;  3PGZ A;  3H3V H;  1ASY A;  2ZTC A;  1D7Q A;  1H95 A;  2VY3 A;  2R93 G;  4JI4 Q;  1JJC B;  2PI2 E;  3NBH B;  5IYC G;  3PUY A;  3UE1 A;  5C3E H;  1YJW A;  4LF6 Q;  3PUV A;  2BH2 A;  4QJF A;  2JJQ A;  1N33 L;  2K52 A;  3EIV A;  3CCV A;  3E9H A;  4JI7 Q;  3L2P A;  1QVF A;  3RZO H;  4KHP Q;  2UXC L;  3B6Y A;  4KLK A;  4AQY Q;  4DK3 C;  1Z47 A;  4LFA L;  4BBS G;  1VQM A;  4BBR H;  1PH9 A;  4DR7 Q;  1XMO Q;  1QUQ B;  3I56 A;  4YWL A;  1I6H H;  3AFP A;  2Q2U A;  1Q1E A;  4KI0 A;  3AQQ A;  4BXX G;  4YWM A;  4P75 A;  2AKW B;  1MJC A;  3HOU H;  3FP9 A;  4X66 L;  1P8L A;  1IBL L;  4JYA Q;  3UDF A;  3A0J A;  3CPW A;  3T1Y Q;  2OTL A;  5C4X G;  3STB C;  3T1H Q;  1M90 C;  4B3M L;  4K0K L;  1PFS A;  1HZB A;  5EAY A;  2GN5 A;  1WCM G;  2IT1 A;  2R6G A;  2YYZ A;  1IBK Q;  3CAM A;  2OWO A;  2ZJP A;  3GTO H;  4BA2 I;  1L1O A;  3F2C A;  3CF5 A;  1YIT A;  4LF7 Q;  3J81 j;  1N9W A;  4P73 A;  1GD7 A;  4R4O A;  5IWA L;  4GKJ Q;  1GVP A;  4A3L G;  3PIP A;  2K5H A;  2D0O A;  4DV7 L;  4J15 A;  3HOX H;  2JA8 H;  3HKZ G;  1B8A A;  1L1O C;  3KF6 B;  5GAD C;  4C2M H;  4JCV E;  3PUW A;  4DV6 Q;  4L5S A;  4OWW B;  3Q8D A;  4Y7N H;  3CC2 A;  1K3R A;  2Z0S A;  3KLW A;  2EIF A;  2HIV A;  2HHH Q;  2KCM A;  5JJI A;  3EBE A;  2AHO B;  4IPG A;  4HJ9 A;  1TXY A;  2R93 H;  4JV5 L;  3GO5 A;  1J5E L;  4DV4 Q;  2WAQ E;  5IYC H;  4LFB L;  1NTG A;  3ULP A;  4DV0 L;  1XNR L;  3MEF A;  1L2F A;  2FXQ A;  5DLQ E;  3KJO A;  1PHJ A;  1VQH A;  4JI2 L;  2R7Z G;  3RZD H;  4EX5 A;  2F52 A;  1YHB A;  4H02 A;  4LFC Q;  2UU9 Q;  4BBS H;  3U50 C;  4LUV A;  2E8G A;  3E0E A;  1K83 H;  1ASZ A;  1SLJ A;  1SRU A;  1V9P A;  4GN5 A;  5GRO A;  4HIO A;  4PMW A;  4DR2 Q;  1SFO H;  3CCL A;  4BXX H;  1HJP A;  4QGU A;  1KXL A;  3I55 A;  4JI0 Q;  2WB1 G;  4IFD G;  4LUO A;  1VQP A;  2YU9 H;  3M4P A;  4GLX A;  5C4X H;  4YY3 Q;  3OW2 A;  4JI4 L;  4BY1 G;  1PH5 A;  3S15 H;  3CCJ A;  1RL2 A;  2JA6 G;  4LF9 Q;  3HOZ G;  1WCM H;  2YTY A;  1D8L A;  5JEA J;  4LF6 L;  1V1Q A;  2JE6 I;  1KHI A;  3GDE A;  3RNU A;  1X3F A;  4UPA A;  4POG A;  4GNX C;  4KHP L;  1U5K A;  1VQ5 A;  4JI7 L;  4L5R C;  1UE5 A;  2CQO A;  1EUJ A;  4AQY L;  4AYB G;  1VQG A;  1PH6 A;  4A3L H;  5GAE C;  2K50 A;  4DR7 L;  1SRO A;  1TWC H;  1X6O A;  3D31 A;  3JC6 6;  4OWT B;  2CKZ B;  4FDB A;  1XMO L;  3UDX A;  5IE8 A;  1YZ6 A;  1E24 A;  5C3E G;  1BVS A;  2RHQ B;  1O7I A;  4BY7 G;  1E7Z A;  2UUB Q;  2BA0 A;  1X56 A;  2BH8 A;  3S2D H;  1JJ2 A;  4JYA L;  3T1Y L;  1I5F A;  4C3H H;  3J80 c;  1OXU A;  3T1H L;  4PZ7 A;  1OTC A;  4OO1 G;  3OYY A;  4KHZ A;  4X64 Q;  2PI2 A;  2WFW A;  2IHE A;  1L0W A;  4UP7 A;  1A0I A;  3ER0 A;  1YI2 A;  1IBK L;  1W2B A;  1HNW Q;  4LF7 L;  2EQS A;  1VQF A;  3KFU A;  2GVB A;  3NEL A;  2Q2T A;  2R7Z H;  1WJJ A;  3RLO A;  4A3M G;  1EIF A;  4GKJ L;  3AFQ A;  4L5T A;  3GD7 A;  4IJL A;  5LMU Q;  4HIM A;  3ICE A;  1G6P A;  3HFZ B;  3CC7 A;  4JI3 Q;  2UUA Q;  4JI6 Q;  3M9B A;  4GLA C;  2RHS B;  4DV6 L;  1VS0 A;  2Q2I A;  1R9T H;  2YV5 A;  3DM3 A;  2ZTD A;  4GOP B;  2HHH L;  2OTJ A;  3GTP H;  4TVA B;  1N36 Q;  4P74 A;  2N3S A;  3PV0 A;  1JJG A;  2JA8 G;  4BY1 H;  3KDF A;  4DPG A;  1LYL A;  2JA6 H;  1VQ7 A;  3S1M H;  4DV4 L;  3HOZ H;  1XPO A;  1SE8 A;  5JJL A;  2RF4 A;  5J3B A;  1KC8 C;  4PZ6 A;  1VQK A;  5K36 G;  1CSP A;  1HH2 P;  1YVC A;  4HJA A;  3JAM i;  5LMN W;  4LFC L;  1X55 A;  1XTD A;  2R7D A;  2AWO A;  4IPC A;  3UE0 A;  1YIJ A;  2UU9 L;  2N49 A;  4GKK Q;  4B3T Q;  3CC4 A;  4DR2 L;  2NVY H;  3MXN B;  1E22 A;  5E7N A;  4BY7 H;  4JI0 L;  5BR8 Q;  3ERS X;  4DV5 Q;  3K0X A;  4IPD A;  3HOY G;  2JEB I;  4JOI A;  5M3M G;  5ELN A;  4NXM Q;  4AH6 A;  4YY3 L;  1LUZ A;  2K4K A;  1E1O A;  1UE1 A;  3ULL A;  3PF5 A;  4LF9 L;  2JEA I;  3GTJ H;  4A4I A;  3M85 A;  3CCM A;  4OON A;  4JOI C;  2I5M X;  1KQS A;  3U4V A;  3NEM A;  4A3M H;  2KHJ A;  3U58 A;  2JQO A;  2CWP A;  1B7Y B;  2XTI A;  2ES2 A;  1E3P A;  1GM5 A;  1KIX A;  3CP0 A;  1X9N A;  1HZC A;  2Z6K A;  4DR6 Q;  3OTO Q;  4JI5 Q;  4WJ4 A;  2Y0S G;  4DNI A;  2YTV A;  5IP9 G;  5IT9 c;  1I94 Q;  1IYJ B;  2UUB L;  1VQO A;  4A3B G;  4L5Q A;  1JT8 A;  2N78 A;  1UEB A;  4DR4 Q;  1CKM A;  3E9I A;  2ATW A;  4X64 L;  3TQY A;  3H0G G;  1T9H A;  4DV1 Q;  1A63 A;  1KRS A;  2ID0 A;  1VQ4 A;  5AJ3 Q;  1HNW L;  4P71 A;  1XPR A;  5M5X H;  1PYB A;  3TS2 A;  1QZH A;  4MTN A;  1YJN A;  5LMU L;  1VQ8 A;  3GTM H;  3KYH C;  5FLX c;  3GTG H;  1QUQ A;  1G29 1;  5LMN Q;  1J6Q A;  4HID A;  4JI3 L;  4AYB E;  2UUA L;  4GN4 B;  4JI6 L;  3H3V I;  4JBK A;  3S17 H;  1EQR A;  3TEH B;  4MNO A;  1N8R C;  1JE5 A;  1SR3 A;  1Q82 C;  2I5L X;  3UDG A;  4NB3 A;  1VCI A;  2NVX H;  3HOY H;  5M3M H;  4Y52 H;  1CSQ A;  1N36 L;  4DV2 Q;  1YNX A;  4JBW A;  5IP7 G;  3I4M G;  3I4N G;  2PQA B;  4DR3 Q;  3ULJ A;  2MO0 A;  3FKI H;  5FJ8 H;  1E1T A;  1NE3 A;  3BU2 A;  1PA6 A;  1FGU A;  4HJ8 A;  3IRB A;  4DV3 Q;  3KJP A;  4DAY B;  1VQN A;  4JI8 Q;  3CCQ A;  3AYH B;  1HNX Q;  4GKK L;  2K5V A;  1HZA A;  2LXK A;  3KF6 A;  3RN5 A;  3RLN A;  2K14 A;  4A3I G;  4B3T L;  1X54 A;  1IL2 A;  1JB7 A;  5IP9 H;  5GAH C;  1WI5 A;  2NN6 I;  3I4O A;  1VQJ A;  5BR8 L;  3G4S A;  4DV5 L;  3AEV A;  4IOA A;  4IJH A;  2AWN A;  2PMZ E;  2JA5 G;  4A3B H;  1EYG A;  3PO2 G;  1PH1 A;  1I3Q H;  4NXM L;  1CKN B;  2E2H H;  1Q12 A;  2E5L Q;  1PYS B;  3H0G H;  4GLV B;  1PH2 A;  2NVQ H;  2LSS A;  1OXS C;  5C0X I;  1W3S A;  4A3F G;  5IYB G;  3CMA A;  1PH7 A;  4OXP A;  4R1J A;  1VQ6 A;  3PF4 A;  3KOJ A;  2CCZ A;  4LF8 Q;  1AE2 A;  1EFW A;  2E2J H;  4BA1 I;  3PUX A;  4IFD J;  1K8A C;  2N8N A;  1HNZ Q;  4LF5 Q;  4JBM A;  2OQK A;  2VQE Q;  3OTO L;  4JI5 L;  4DR6 L;  5M5W H;  2B29 A;  1EWI A;  4P72 A;  1I94 L;  4OX9 Q;  3RR5 A;  2AMC B;  4LF4 Q;  2DGY A;  2V1C C;  2WP8 J;  1WOC A;  4NPS A;  2CWA A;  4JI1 Q;  4GN3 B;  2ZM6 Q;  2UXD Q;  2WAQ G;  4DR4 L;  2RCN A;  3I7F A;  5IP7 H;  5H1S E;  4X62 Q;  4DV1 L;  3TS0 A;  3I4N H;  3I4M H;  1VQI A;  5AJ3 L;  4ALP A;  4NXN Q;  1VQD A;  2HIX A;  2JA7 G;  5M5Y H;  2NVT H;  2UXB Q;  1VQA A;  3GTQ H;  3CXC A;  1PH4 A;  3M4Q A;  4A3K H;  3A5Z B;  3J81 i;  1X3E A;  3I2Z A;  1K73 C;  1YJ9 A;  1X3G A;  4A3J G;  4YCU A;  3F2B A;  3CCE A;  5FLM G;  3U4Z A;  1FL0 A;  2L15 A;  1HR0 W;  4APV A;  5LMN L;  4JG2 A;  4A3I H;  4B3S Q;  3HKS A;  1Q81 C;  4IPH A;  2R92 G;  3A74 A;  1TWF H;  4A3D G;  4LUZ A;  3K8A A;  5GQO A;  2Y0S E;  3TRE A;  1V43 A;  4O2D A;  4DK6 C;  2JA5 H;  4QL5 A;  3PO2 H;  1KAW A;  5IYD G;  4DV2 L;  3S14 H;  1GO3 E;  1KRT A;  1G51 A;  3M3Y H;  1TWA H;  3K7U C;  2NZO A;  3L7Z C;  4DR1 Q;  4DR3 L;  3PO3 G;  3EN2 A;  2K75 A;  2D0P A;  3HKZ E;  4A3F H;  5IYB H;  2ZTE A;  2HQL A;  4R4C A;  1OXT A;  4R4T A;  4UP9 A;  1YHA A;  3G71 A;  4DV3 L;  4YCV A;  3CCU A;  4JC0 A;  4JI8 L;  3LGJ A;  2XGT A;  2H5X A;  5C0X J;  1HNX L;  4A93 H;  3FKI G;  5FJ8 G;  3JAM c;  1L1O B;  2KHI A;  4DUZ Q;  1XJV A;  4B3R Q;  1NMG A;  2D62 A;  3RN2 A;  1Y1W G;  4DUY Q;  2LXJ A;  3S16 H;  2CFM A;  5C44 G;  1LM0 A;  4GOP A;  1DGS A;  4RG1 A;  2IHF A;  4A3G G;  3W5O A;  4XTC S;  1FJG Q;  1MIU A;  4A3C H;  4IO9 A;  2IY5 B;  4JBJ A;  1AE3 A;  2I0Q A;  2E5L L;  1P16 A;  1PVO A;  1C0A A;  1B70 B;  3W1G A;  1CKO A;  3K7A H;  4AIM A;  1S72 A;  4GOP C;  2VNU D;  2JA7 H;  3PUZ A;  2A8V A;  2KEN A;  2R7F A;  1S3O A;  1Q86 C;  2WB1 E;  1WFQ A;  4A3J H;  4LF8 L;  1UWV A;  4IOC A;  1XNQ Q;  5FLM H;  3S1Q H;  1TWG H;  2Z6K C;  1XMQ Q;  1YBY A;  2DUD A;  3D0F A;  1K9M C;  1YEZ A;  1QZG A;  1HR0 Q;  4YHH Q;  1UE7 A;  2ZJQ A;  1HNZ L;  4XIG S;  1HZ9 A;  3CME A;  4LF5 L;  2VQE L;  4A3D H;  4IFD I;  2R92 H;  4MZ9 A;  2PNH A;  4HJ5 A;  1IBM Q;  4OX9 L;  2F4V Q;  4LF4 L;  3CQZ H;  5HGQ A;  4A75 A;  2QA4 A;  2UXD L;  1EQQ A;  1MJE A;  4JI1 L;  4UY8 C;  2ZM6 L;  4X6A H;  4X65 Q;  1N32 Q;  1YHQ A;  2ALY B;  5IYD H;  4X62 L;  2B63 G;  3PO3 H;  3PIO A;  4PZ8 A; 
#chains in the Genus database with same CATH topology
 4NXN L;  4RGN A;  1AH9 A;  1LTR D;  4FNF A;  4GNX B;  2ZJR A;  3BJU A;  4A3B B;  1MHW C;  3A56 A;  3TP8 A;  3M4O H;  2WAC A;  2E2H B;  5J22 A;  2E2I H;  2KCC A;  4YCW A;  1HA5 A;  1Y1W H;  1J9O A;  1A62 A;  1QVC A;  1ENC A;  1I4H A;  1UE6 A;  1CA6 A;  2EYP A;  2F3V A;  3FHW A;  4DR5 Q;  3A5U A;  2PZU A;  3PMF A;  4A3E G;  1ENA A;  3CCS A;  1Q90 A;  1SNQ A;  1DYQ A;  2TMP A;  2IX1 A;  2Q8R E;  3HOV G;  1IXR A;  3CD6 A;  1G2T A;  4DUZ L;  1U4M A;  1N33 Q;  3I4M B;  1YNJ D;  2RKS A;  2YTX A;  1GKH A;  1RIP A;  1RTO A;  4UP8 A;  1HUM A;  2A68 C;  4X66 Q;  1KTK A;  2KBN A;  2MQH A;  3KDF B;  1XMQ L;  3SR1 A;  3PO2 B;  5JJK A;  4CBV A;  1HR0 L;  1KD1 C;  4FXK C;  2CH4 A;  2F4V L;  5GAG C;  3HOW H;  4BBR G;  3ZYY X;  1Y8P B;  1B50 A;  2EJM A;  4DV7 Q;  2RA4 A;  3LWE A;  5DAU A;  4J6H A;  4X65 L;  1N32 L;  1V8Q A;  3HOU G;  1STH A;  4QQB X;  4EQ5 A;  2NN6 G;  1H9K A;  3R8B A;  1LT5 D;  1VQL A;  1IZ6 A;  1SDF A;  2QGQ A;  3A8J E;  4RCO A;  1HRJ A;  5C4J H;  3W1B A;  1M1K C;  2B2Y C;  3TRZ A;  3CPF A;  2CHB D;  5M9O A;  3IL8 A;  4A3J B;  2MFI A;  2VQF L;  1VQ9 A;  1VQB A;  4GS3 A;  4FP5 D;  1BXT A;  2KUM A;  1ASY A;  1KNA A;  2HDM A;  1D7Q A;  4JI4 Q;  5KYI A;  4ZKC B;  3CQZ B;  1B9M A;  1DOK A;  4K8J A;  3UE1 A;  1LTT D;  4LF6 Q;  3NXW A;  4Q5V A;  3CCV A;  2B39 A;  3BZD B;  3E9H A;  3KK7 A;  3R93 A;  4BBS G;  4CJ1 B;  4DK3 C;  4LFA L;  3IFT A;  1VQM A;  1KAB A;  1V1O A;  1I6H H;  1Q1E A;  1D5X C;  1Y8O B;  4KI0 A;  4ZK9 B;  1DCZ A;  3IKJ A;  4MIU A;  1MJC A;  1A3U A;  3S1N B;  1IBL L;  4MHE A;  4G7O C;  3FEW X;  3STB C;  2B8F A;  1M90 C;  4B3M L;  3DWA A;  5C44 B;  1S5D D;  1SYC A;  1TII D;  1WCM G;  2YYZ A;  4BA2 I;  3CAM A;  2OWO A;  4A3C G;  1YIT A;  4K8I A;  1GD7 A;  4R4O A;  1GVP A;  5KND A;  3LNN A;  1BCP C;  2JA8 H;  3KF6 B;  5C3W A;  4C2M H;  3IFD A;  2DNC A;  1PRT B;  2HHH Q;  2D9U A;  5JJI A;  3EBE A;  3OIQ A;  2RVL A;  3X3M A;  3GO5 A;  1QIL A;  4DV4 Q;  2WAQ E;  2Z9H A;  5IYC H;  3ULP A;  2OXP A;  1XNR L;  4JI2 L;  2RQX A;  2F52 A;  5EKK A;  2UU9 Q;  1AP0 A;  2J7Z A;  3QG1 A;  4LUV A;  1PTO B;  5GRO A;  4ILW A;  4DXG A;  1SFO H;  3CCL A;  4BXX H;  1HJP A;  1TWH B;  3GTK B;  2N88 A;  4JI0 Q;  2WB1 G;  3TN2 A;  2KVM A;  1SMY D;  3NWT A;  4YY3 Q;  1QB5 D;  3S15 H;  1EWC A;  2JSO A;  4KY5 A;  5JEA J;  4POG A;  2VUM B;  4KHP L;  3NP8 A;  2F0S A;  4FYD A;  3L9A X;  2G9D A;  1VQG A;  1JWU D;  1X6O A;  2KOL A;  3QB3 A;  3JC6 6;  4OWT B;  3VA5 A;  1DXM A;  4FDB A;  3UDX A;  5IE8 A;  1YZ6 A;  4OIK A;  1BVS A;  5KIX A;  1O7I A;  1Y1V B;  2K7V A;  2BA0 A;  2HQE A;  3K59 A;  2NUC A;  1I5F A;  4XYQ A;  4LMQ D;  4C3H H;  4X64 Q;  2PO4 A;  2BE5 D;  4ZLT F;  4QMG A;  1GJX A;  1EY0 A;  4C3J B;  5IGB A;  1HNW Q;  1VQF A;  4X3K A;  3NEL A;  3ND8 A;  1WJJ A;  3RLO A;  5ELE A;  3AFQ A;  4L5T A;  3GD7 A;  4IJL A;  1Y8N B;  4JI6 Q;  4AYB B;  2KEE A;  2YV5 A;  1EY6 A;  3DM3 A;  2OTJ A;  3GTP H;  4IUQ A;  4TVA B;  4CDC C;  3RZO B;  2B2T A;  4P74 A;  4XDX A;  2JA8 G;  3DHQ A;  5IT9 E;  4BY1 H;  3KDF A;  1VQ7 A;  2SOB A;  3TSS A;  3HOZ H;  4ZUJ A;  5JJL A;  3DUZ A;  1B9N A;  1KC8 C;  5K36 G;  5I6Y A;  2LS0 1;  5LMN W;  4LFC L;  1GHJ A;  5HUR A;  1PDQ A;  1FNW A;  3FPP A;  1L0Y B;  4HSP A;  1LAC A;  2JN4 A;  1F2M A;  3K0X A;  2PMZ B;  4JOI A;  1LUZ A;  1BQQ T;  4JPB W;  5IGF A;  5C4Z A;  2JEA I;  1FR3 A;  3HOX B;  3T4A C;  1G8Z D;  4A4I A;  3M85 A;  2Z1C A;  2I5M X;  3FMC A;  2VB2 X;  4Y7N B;  3U58 A;  1B7Y B;  1GM5 A;  1EY7 A;  4H7B A;  1HZC A;  4JI5 Q;  1ZYR D;  5IP9 G;  1HFN A;  1IYJ B;  4HSV A;  1D2B A;  2EJG C;  4CDD C;  2J0T D;  4DR4 Q;  3RZD B;  5EPJ A;  2JYO A;  3TQY A;  4CHT B;  1TY2 A;  1LT3 D;  1A63 A;  2ID0 A;  4DGZ A;  1CHP D;  1SYB A;  1G91 A;  1XPR A;  4X3T A;  5M5X H;  4XQQ A;  1PYB A;  3TP6 A;  1YJN A;  2L11 A;  4R8N A;  1CM9 A;  2OF1 A;  4KK7 A;  4JBK A;  3S17 H;  1EQR A;  4MNO A;  1JE5 A;  4XYO A;  2I5L X;  4NKL A;  2NVX H;  1VCI A;  3QWN A;  3DMU A;  1CSQ A;  2MPM A;  2SNM A;  3I4N G;  4KV6 A;  2PQA B;  3Q22 A;  3ULJ A;  3FKI H;  4E6I A;  2ZXR A;  2QW7 A;  3HKZ B;  1U4P A;  3C1E A;  3W2D A;  3BU2 A;  1S5C D;  4DV3 Q;  2F0W A;  5CGK A;  1XTC D;  2A6E C;  3KF6 A;  3RLN A;  1J8I A;  4WJW A;  4RCN A;  3AEV A;  2B2U A;  4DV5 L;  3J7A V;  4IOA A;  4IJH A;  3Q24 A;  1STA A;  5IGD A;  1LTA D;  1I3Q H;  1RTN A;  3PIO 3;  3GQB A;  4B9X A;  3H0G H;  4GLV B;  1PH2 A;  2EY2 A;  3I73 A;  2F0P A;  4A3F G;  4KKT A;  3TZD A;  1EEI D;  4FO2 A;  1BF4 A;  4R1J A;  2NBF A;  1VQ6 A;  4LF8 Q;  1AE2 A;  3E6Z X;  1LTI D;  2VB3 X;  2BOS A;  4BA1 I;  4IFD J;  2N8N A;  4ME5 A;  1HNZ Q;  2OQK A;  2VQE Q;  4DR6 L;  5I9O A;  2JA6 B;  1EWI A;  2JP1 A;  2F0V A;  4OX9 Q;  1WOC A;  4NPS A;  3JAM E;  4JI1 Q;  5J39 A;  2ZM6 Q;  2WAQ G;  3NSW A;  1WTX A;  1CHQ D;  4N9T A;  2RCN A;  5H1S E;  5AJ3 L;  4ALP A;  1BUV T;  3AMU A;  2HIX A;  2NVT H;  2NVY B;  3M4Q A;  4A3K H;  3A5Z B;  1X3E A;  1X3G A;  4BY7 B;  4YCU A;  1F9R A;  5CV6 A;  3U4Z A;  5LMN L;  5T1G A;  2KEC A;  3V96 A;  4A3I H;  4MN3 A;  1Q81 C;  1TWF H;  2F0U A;  3SK6 A;  3K8A A;  4OGQ C;  3TRE A;  1V43 A;  2FMM A;  2P5Z X;  4CJ2 C;  2E75 C;  2O2L D;  1GO3 E;  1KRT A;  3M3Y H;  3S14 H;  3L7Z C;  3TDQ A;  1EIG A;  2D0P A;  2ZTE A;  3FDT A;  1YHA A;  4NP5 A;  1U9R A;  3G71 A;  3K5M A;  2JA7 B;  1GHK A;  5G3L F;  3MXP A;  5ELC A;  2H5X A;  1SYE A;  4A93 H;  3FKI G;  3N6R A;  4WOR A;  4IUR A;  3RN2 A;  3QO2 A;  1PXU A;  4DUY Q;  2F0L A;  2LXJ A;  3A8K E;  3S16 H;  2EYM A;  2K28 A;  4A3G G;  3J80 L;  4TRD A;  3A7L A;  3BDO A;  3GTG B;  3W1G A;  4GOP C;  2VNU D;  2JA7 H;  3PUZ A;  1S3O A;  1BNZ A;  1XNQ Q;  3HGB A;  2ZJQ A;  4HMI A;  3CME A;  4LF5 L;  4A3D H;  2PNH A;  3V2T A;  3MTS A;  5HGQ A;  2NTS A;  2UXD L;  1PTO D;  3CKI B;  3NWS A;  1YHQ A;  2XN9 C;  4X62 L;  2HDL A;  3AU7 A;  3PO3 H;  2O4X A;  3GP7 A;  3VDY A;  1N34 Q;  3G48 A;  4HJ7 A;  1K0R A;  2VW9 A;  1K0S A;  3VA7 A;  3NEN A;  1KNE A;  2FFK B;  4A3K G;  1Q7Y C;  1K28 A;  3CCR A;  2EOT A;  1NJI C;  1BBW A;  1WTW A;  2OQ0 A;  3I90 A;  3OSO A;  3ITP A;  1NR4 A;  2C5C A;  1OXX K;  2A1A A;  4DR1 L;  1EYA A;  4LWC A;  2KCT A;  3N52 A;  3KLS X;  4C3I H;  5M5W B;  2WII B;  2EYO A;  3NQI A;  1STN A;  3C46 A;  4DFA A;  5E3F A;  5C6A A;  5IT9 L;  3PIP 3;  3J81 E;  5M3F G;  3GTQ B;  2I5H A;  4LNQ A;  2ENB A;  1FJG L;  4EVO A;  3L0O A;  4A93 G;  2PQA A;  4KY7 A;  5ELO A;  1JWM D;  2B63 H;  1F9P A;  5DM7 3;  2O5J C;  1OXV A;  3WOE A;  1HTP A;  2N55 A;  2JK8 A;  2F4I A;  5DNF A;  4K0K Q;  5EBC A;  1Q1B A;  3BZC A;  3I91 A;  4K5W A;  2JA5 B;  1C7Y A;  1ET6 A;  3KF8 B;  4X3U A;  2EJF C;  1TWA B;  1G6Z A;  2G9H D;  4A76 A;  1IBM L;  1I50 H;  4QIW E;  2BDN A;  3D6C A;  4S3S A;  5EPL A;  1KDC A;  5C4H A;  4ZQ3 A;  2F1M A;  3QJY A;  3SGI A;  1SJH D;  3R2T A;  3ND9 A;  4A3E H;  2FMC A;  3DWQ A;  2BA1 A;  4KKS A;  1F9S A;  5HY6 A;  4O0A A;  1SYF A;  3HOV H;  4JV5 Q;  5J1Z A;  4RMF A;  1VMC A;  3P20 A;  3S1R H;  4LJZ C;  4LFB Q;  4DV0 Q;  1HTL D;  1D5M C;  4Q0F A;  2MNA A;  1JOK A;  1T5X D;  2C35 B;  2EXD A;  3K81 C;  2DN8 A;  1K8G A;  3OMC A;  4POF A;  5IOC A;  3S24 A;  1TWG B;  1LTG D;  1FVI A;  1TQO A;  4XQN A;  1CUK A;  4RKB A;  5CV8 A;  2EE1 A;  3OPO A;  2A6H D;  4KN4 C;  1SMY C;  2L1B A;  2R92 B;  2R93 G;  3RUZ A;  3SK8 A;  4EQP A;  2K1B A;  3PUY A;  2BH2 A;  2K52 A;  3EIV A;  1E2W A;  3HRZ C;  3L2P A;  1QVF A;  2A73 B;  2UXC L;  1AFP A;  4C3I G;  4KLK A;  2JXM B;  1DZ1 A;  4BBR H;  4DR7 Q;  5IGE A;  2Q2U A;  3AQQ A;  2F0Q A;  4YWM A;  4P75 A;  2AKW B;  2PQE A;  3HOU H;  3M4O B;  3Q0A A;  2E2I B;  3A0J A;  3T1Y Q;  5C4X G;  2NN6 H;  1STE A;  1Y1W B;  2BE5 C;  1DOL A;  2R6G A;  1S5E D;  3F2C A;  1JCK B;  3BVG A;  3H6M A;  4RH6 A;  5IWA L;  2DNE A;  2EXZ A;  4OEM B;  1WTQ A;  4GKJ Q;  4HCS A;  1JB3 A;  2K5H A;  2KED A;  4JCV E;  1RJT A;  3Q8D A;  1VF5 C;  2Z0S A;  2HIV A;  4HJ9 A;  4UDU C;  3RD4 A;  4X3S A;  1MGS A;  1TS4 A;  1J5E L;  2KA7 A;  2HD3 A;  3JAM L;  2R7Z G;  4HED A;  1STG A;  5D3I B;  4BBS H;  2RSN A;  4L63 B;  1LTB D;  2XWJ B;  3E0E A;  4ZKB B;  1ASZ A;  4GN5 A;  1PFN A;  3F2U A;  1KXL A;  3I55 A;  2DY7 A;  4LUO A;  3NQT A;  2YU9 H;  2XNA C;  2B8G A;  3I8Z A;  1PH5 A;  1SE2 A;  3HOW B;  3CCJ A;  1RL2 A;  1TY0 A;  1WCM H;  2M2L A;  2YTY A;  4A3C H;  1V1Q A;  3GDE A;  1KHI A;  3RNU A;  4GNX C;  2LFN A;  1VQ5 A;  4JI7 L;  1A2T A;  2CQO A;  3T53 B;  1EUJ A;  4AQY L;  1FGB D;  2K50 A;  1XMO L;  1TWC H;  1E24 A;  1ZYR C;  2J4X A;  2RHQ B;  1E7Z A;  1M4V A;  5C4J B;  3ERO A;  3NBI A;  5I6W A;  3S2D H;  4JYA L;  4EGV A;  3E3X A;  1IHZ A;  3T1H L;  4OO1 G;  2K5Q A;  3OYY A;  4KHZ A;  1YNN C;  1BBX C;  1L0W A;  1IBK L;  3W3A A;  4LF7 L;  1JOQ A;  1ONL A;  4RHR A;  2Q2T A;  4A3M G;  4RFB A;  1EZ6 A;  5A35 A;  5LMU Q;  1G6P A;  1F9Q A;  2IWH A;  2DJF C;  3MZ5 A;  5DEH A;  2PCF B;  3M9B A;  4DV6 L;  1PMR A;  1Z7T A;  2Q2I A;  1H9S B;  2FIN B;  4FF3 A;  1KDA A;  4BS9 A;  1N36 Q;  5D65 A;  1AN8 A;  3FVQ A;  1S5B D;  3MA2 B;  1LYL A;  1I6H B;  1MSG A;  1SE8 A;  1H9J A;  2F0G A;  3KF8 A;  1QE6 A;  4H0L C;  2B2T C;  1HH2 P;  4HJA A;  3URY A;  2EDG A;  1YIJ A;  2R7D A;  2F3W A;  2ICI A;  2AWO A;  4DXF A;  5BN5 A;  3CC4 A;  1CZW A;  2Z6B A;  4DR2 L;  4FF1 A;  3MXN B;  1E22 A;  2K01 A;  5FLX E;  3ERS X;  4J1M A;  3HOY G;  1BR9 A;  2K05 A;  4XT3 B;  5M3M G;  4NXM Q;  2K4K A;  4HTH A;  1RCV D;  2A69 D;  4LF9 L;  2X6G A;  2JA8 B;  4C1N K;  4PNY A;  4C2M B;  3KUP A;  4JOI C;  3V05 A;  3U4V A;  4ABN A;  1II3 A;  2KHJ A;  2E74 C;  3D4D A;  1ILP A;  2CWP A;  1IW7 D;  2L0C A;  2ES2 A;  1A3V A;  3CP0 A;  2Z6K A;  4WJ4 A;  1RD9 D;  2Y0S G;  3OW7 A;  2YTV A;  1NNX A;  3WDN A;  1I94 Q;  2V4D A;  5FOB B;  1PZK D;  2UUB L;  1VQO A;  4A3B G;  4L5Q A;  2N78 A;  5LL6 S;  3E9I A;  2PPB C;  1T9H A;  1ROD A;  3J81 L;  1TKW B;  1JIC A;  1SFO B;  5K36 H;  2QIL A;  1PZI D;  4MTN A;  3GTM H;  1DOM A;  4HID A;  1MD2 D;  4JI3 L;  4AYB E;  2UUA L;  3S15 B;  1X3P A;  2IX3 A;  2ZXP A;  1H9R A;  2M00 A;  3J80 E;  2L12 A;  1N8R C;  2EPB A;  4DK1 A;  4Y52 H;  4F87 A;  4K5X A;  1YNX A;  3I4M G;  4DR3 Q;  3A7A B;  1CT1 D;  1E1T A;  1FGU A;  1VDZ A;  3IRB A;  2K6A A;  2F0K A;  4DAY B;  1S4Z A;  1EU4 A;  1G2S A;  3CCQ A;  3AYH B;  4C3H B;  4V19 0;  1JWS D;  1BDO A;  1F2Y A;  1HZA A;  1QNU A;  2K5V A;  3RN5 A;  3BDC A;  1JC7 A;  1QWY A;  3EJI A;  4B3T L;  5ELD A;  1IL2 A;  1JB7 A;  1GUG A;  5IP9 H;  3I4O A;  2NN6 I;  4CDE C;  5BR8 L;  4M8A A;  1B44 D;  2PMZ E;  3TP5 A;  1OO9 B;  3PO2 G;  1CKN B;  1IYV A;  1WTV A;  1PYS B;  2X69 A;  2NVQ H;  5ELF A;  2LSS A;  1PRT C;  1W3S A;  2B2U C;  3VYR A;  3KOJ A;  2E2J H;  3NK9 A;  3GTP B;  1EFI D;  4J8Q A;  2DY8 A;  4BY1 B;  4JBM A;  1O7Z A;  3OTO L;  4IZ8 A;  2B29 A;  4P72 A;  3HOZ B;  1VF7 A;  2AMC B;  4LF4 Q;  5EQ0 A;  2R3Z A;  2WP8 J;  1UEA B;  1PTO C;  3K0Y A;  4DV1 L;  3I4N H;  3TS0 A;  3AB9 A;  1VQI A;  2CW0 C;  5BN3 A;  4NXN Q;  1VQD A;  5M5Y H;  5F2D A;  3CXC A;  2H4O A;  5JEA H;  3K58 A;  2MGS A;  1YJ9 A;  4A3J G;  1FD7 D;  3CCE A;  3L3O C;  5FLM G;  1WTP A;  4APV A;  1HA6 A;  4DAV A;  4CJ0 B;  2Z8L A;  3HKS A;  4IPH A;  3HZX A;  1CFM A;  4LUZ A;  4QB4 A;  4DK6 C;  1AEX A;  3IAY A;  2B2Y A;  5IYD G;  4DV2 L;  3K7U C;  4L8J A;  4A3F H;  3HKZ E;  4R4T A;  3S9W A;  5LL6 X;  4YCV A;  4JI8 L;  2XGT A;  3DM1 A;  5CV5 A;  5C0X J;  1HNX L;  3I70 A;  4DUZ Q;  1XXG A;  1L1O B;  1EY9 A;  4G7H C;  1I6V C;  1NMG A;  2D5D A;  2D62 A;  3EFX D;  4DN4 M;  3H3V C;  1H9S A;  5C44 G;  3U9S A;  4JVZ A;  1WTR A;  4XTC S;  1MIU A;  5NUC A;  5M5X B;  2IY5 B;  2I0Q A;  2E5L L;  1PVO A;  1B70 B;  3K7A H;  1B3Q A;  2X6L A;  2R7F A;  5ISR A;  3S17 B;  4JK1 C;  1M8A A;  4IOC A;  3S1Q H;  4C56 C;  2NVX B;  1JOO A;  3D0F A;  3TP7 A;  1XMQ Q;  1QZG A;  3VYS A;  1HR0 Q;  1UE7 A;  2HCC A;  3MXN A;  3FKI B;  1CZG A;  2F4V Q;  4A75 A;  5AFW A;  4MTK A;  4X65 Q;  1N32 Q;  1PYW D;  1SJE D;  2WV6 D;  3DEO A;  1AW7 A;  3PIO A;  4PZ8 A;  2I46 A;  1IL8 A;  1SN8 A;  2UXB L;  2RDF A;  1SMX A;  1MBY A;  2RBM A;  3SE0 A;  3J7Z C;  1D1K A;  1KL9 A;  4O1N A;  5JPM C;  1A6X A;  4HIK A;  1I3Q B;  5E4X A;  3DLL A;  4B3S L;  1LLR D;  3H0G B;  1B4O A;  2CQA A;  5KEE A;  5JEA G;  4IQZ A;  4B08 A;  4WJ3 M;  2RSO A;  2K5N A;  4A3G H;  4G7Z C;  4DU9 A;  1EOV A;  4DKA C;  3H15 A;  1WD0 A;  3OOC A;  4R4I A;  3UDI A;  2VUM G;  2VQF Q;  4OL7 A;  5EJW A;  5KNB A;  5I2Y A;  2MO1 A;  2A6H C;  4HAE A;  1QCB D;  1FNU A;  3I3C A;  2IPK D;  2HT1 A;  1Y1V G;  1I4R A;  2WKD A;  1Q46 A;  1WYD A;  4P2C B;  1U0L A;  4B3R L;  4DNT B;  4C1N I;  1LAB A;  4F88 A;  3T16 A;  4LFA Q;  1DON A;  2NVT B;  4A3K B;  4DK0 A;  4C3J G;  5JOB A;  2IX0 A;  3ZJY C;  1WD1 A;  1ICW A;  1NMF A;  1Q8K A;  3NPP A;  1IBL Q;  1JMC A;  4A3I B;  5C3X A;  5LHY 1;  1TWF B;  4B3M Q;  1L0X B;  2OEO A;  4DAY A;  1I4G A;  5FLX L;  1DD2 A;  1ZXT A;  4YHH L;  3S14 B;  3M3Y B;  1WVL A;  2OCE A;  4R4Q A;  2ASB A;  3STB D;  2L55 A;  1Z6H A;  1C48 A;  2A19 A;  3PCO B;  5FO8 B;  1CKN A;  1Z9F A;  1BOS A;  2FHT A;  2NB0 A;  3LX0 A;  1VQE A;  3J7A 5;  1BCP F;  4IAL A;  4YIJ A;  3CW2 C;  4A93 B;  1PV4 A;  3LWU A;  2F3I A;  2UUC Q;  3S16 B;  2M9V A;  4QY7 A;  5FK9 C;  5FO7 B;  4LW1 A;  2VZA A;  1BBU A;  2D2C C;  4EQO A;  2TSS A;  1XNR Q;  4RGT A;  4JI2 Q;  1H9M A;  3T56 B;  4IN3 A;  5C0X G;  1XPU A;  2IJ0 A;  3PSI A;  2QEX A;  4PV1 C;  5EKL A;  3VR3 A;  5M3F H;  4ID6 A;  1A8V A;  3HOX G;  3G6E A;  4DR5 L;  3GTL H;  1TS3 A;  4KD4 A;  3S2H H;  1YNJ C;  1X32 A;  2B2V C;  2XIW A;  3PGZ A;  4U68 A;  5CV9 A;  4QCL A;  2VY3 A;  1H95 A;  1RF2 D;  5G3L D;  4A3D B;  4H44 C;  2B2W A;  4DA2 A;  1JJC B;  5C5M A;  4K5V A;  1RDP D;  1YJW A;  3C3L A;  5C3E H;  1ZEQ X;  1N33 L;  4KHP Q;  1ENF A;  3PO3 B;  1SNP A;  5CC4 A;  1Z47 A;  1PH9 A;  4RHS A;  3I56 A;  4YWL A;  3AFP A;  5CV7 A;  5EBD A;  1XWE A;  1QOH A;  1IYU A;  4X66 L;  3UDF A;  3CPW A;  4N8F A;  1PFS A;  1HZB A;  4IUV A;  2IT1 A;  1Y69 U;  5IOD A;  5HGT A;  3GTO H;  4IUU A;  2PW7 A;  1L1O A;  4HR7 B;  3J81 j;  1N9W A;  1AZQ A;  5TSS A;  4K2L A;  4A3L G;  3PIP A;  2D0O A;  5CBA E;  4DV7 L;  5EGT A;  4J15 A;  4C3I B;  2NYZ D;  4RGM A;  3HKZ G;  5GAD C;  2EYL A;  1ESR A;  1GXD C;  4L5S A;  4OWW B;  3CC2 A;  2EIF A;  2KCM A;  1QJO A;  3VYT A;  3D6W A;  4IPG A;  5JVG 3;  5E4W C;  4RA8 A;  5FO9 B;  2R93 H;  1GUN A;  3BVZ A;  1NTG A;  1GOZ A;  3MEF A;  5DLQ E;  1PHJ A;  1DJR D;  1VQH A;  3VR6 A;  2B63 B;  4EX5 A;  1YHB A;  4LFC Q;  3U50 C;  3K57 A;  1K83 H;  1SRU A;  4HIO A;  1K8O A;  2AQ3 B;  4R9W A;  5K5P A;  3UI2 A;  4QGU A;  4LAA A;  4IFD G;  1VQP A;  4QF4 A;  4FF2 A;  3M4P A;  4GLX A;  5C4X H;  3OW2 A;  4JI4 L;  1I50 B;  2G5D A;  1KAA A;  2A69 C;  2JA6 G;  2XRQ D;  2Z4I A;  1D8L A;  4LF6 L;  3D4W A;  2JE6 I;  4RWS C;  5CMD A;  1X3F A;  2XSC A;  4UPA A;  4KY6 A;  4XQJ A;  1U5K A;  3CRK C;  4L5R C;  4CKB A;  4A3E B;  3NTK A;  1IW7 C;  5GAE C;  1SRO A;  3D31 A;  2CKZ B;  4O42 A;  4K6L A;  2IL8 A;  3E5S A;  3HOV B;  1O80 A;  5C3E G;  3S1R B;  4BY7 G;  4I7A A;  2BH8 A;  1S5F D;  4G4K A;  1JJ2 A;  4K2K A;  3J80 c;  2E76 C;  1OXU A;  1RHP A;  5KRU A;  2PI2 A;  4ZRZ A;  1UUP A;  2WFW A;  2ICE C;  2IHE A;  2OT2 A;  4KN7 C;  1A0I A;  1HPC A;  2EQS A;  4XT1 B;  2GVB A;  2R7Z H;  4HIM A;  3ICE A;  3MFY A;  3HFZ B;  3CC7 A;  1KLG D;  1NSN S;  2EY1 A;  2RHS B;  1VS0 A;  3OMG A;  2EYH A;  2ZTD A;  2HHH L;  2F03 A;  2K03 A;  1JJG A;  4BBR B;  4DPG A;  3S1M H;  4DV4 L;  5J3B A;  1B1Z A;  3I72 A;  1VQK A;  1CSP A;  3HOU B;  3ERQ A;  3EA6 A;  3KBX A;  4IPC A;  1XTD A;  2UU9 L;  3UE0 A;  1TVX A;  1EOT A;  4PMC A;  1EIH A;  4JI0 L;  2SEB D;  4DV5 Q;  4QUF A;  1NCV A;  4YY3 L;  2MJ8 A;  2A6E D;  4KD3 A;  4OO1 H;  1E1O A;  1UE1 A;  3SXH A;  3ULL A;  3PF5 A;  3GTJ H;  4OON A;  1KQS A;  5EKI A;  3NEM A;  4A3M H;  1EYC A;  2XTI A;  2R61 A;  3MXG A;  1QNK A;  2QF7 A;  1KIX A;  5A2Q L;  3TME A;  4DR6 Q;  4IUP A;  4DNI A;  5IT9 c;  3E0J A;  1DM0 B;  1JT8 A;  1LT6 D;  1CKM A;  1RKN A;  1Q3L A;  4X64 L;  4BBS B;  5AJ3 Q;  1I4X A;  2WKC A;  1HNW L;  4P71 A;  1T5E A;  2EY6 A;  3ONA B;  2KQ3 A;  3Q23 A;  1QZH A;  1EYD A;  3KYH C;  4CKC A;  2YU9 B;  5LMN Q;  1G29 1;  2F0F A;  2EVB A;  4JI6 L;  4GN4 B;  4BWG B;  2A74 C;  4FXG C;  1EEF D;  3TEH B;  1WCM B;  2Y0S B;  1SR3 A;  2LKV A;  4NB3 A;  3CU7 A;  3HOY H;  5M3M H;  1PLF A;  4JBW A;  5IP7 G;  3DEP A;  1TWC B;  5CBE E;  1PA6 A;  5ELB A;  4HJ8 A;  1WTO A;  2A5H A;  1V1P B;  1VQN A;  3S2D B;  3SDZ A;  2LXK A;  1AZP A;  2K14 A;  1SE4 A;  4FXD A;  2AUK A;  5GAH C;  3G4S A;  2AWN A;  4QUC A;  2JA5 G;  4A3B H;  1EYG A;  1PH1 A;  2E2H H;  3QR8 A;  1SNC A;  4HCE A;  1OXS C;  5IYB G;  4OXP A;  3FRP B;  2WB1 B;  3HG9 A;  4ZCK A;  3VR5 A;  1B53 A;  1K8A C;  1A2U A;  2RDH A;  4LF5 Q;  4JI5 L;  3QOJ A;  1HQR D;  1SSO A;  2QDB A;  4EQN A;  3OHX C;  2DGY A;  2UXD Q;  1EU3 A;  4DR4 L;  1LO5 D;  2ZXO A;  3I7F A;  3I4M H;  4X62 Q;  1XX8 A;  2FJ2 A;  1LT4 D;  1ML0 D;  4WRD A;  1VMP A;  4G57 A;  1PH4 A;  5JAV A;  3KLS A;  3R3O A;  2L15 A;  1W6J A;  4JG2 A;  4RKL A;  1EL0 A;  2R92 G;  3A74 A;  2PYK A;  3EQL C;  1FNV A;  3TZU A;  4O2D A;  4IUN A;  3J7A F;  4QL5 A;  3PO2 H;  1MI2 A;  1KAW A;  3CRL C;  1G51 A;  4FVM A;  1HXY D;  2HUG A;  3TBI B;  2NZO A;  4DR1 Q;  2K75 A;  1CK1 A;  1OXT A;  4UP9 A;  4DV3 L;  3KBG A;  1ICF B;  1BCP B;  1FYC A;  3NTI A;  2PNR C;  3JAM c;  5DM6 3;  1XJV A;  3H91 A;  1Y1W G;  1EZ8 A;  1E2Z A;  1A15 A;  2CFM A;  1LM0 A;  4RG1 A;  2K5W A;  1FJG Q;  4JBJ A;  3GTM B;  1P16 A;  5KNC A;  2E2D C;  4AIM A;  1F2L A;  3MC0 B;  2KJX A;  2NWG A;  2WIN B;  2F0O A;  1Q86 C;  4N9P A;  4A3J H;  4LF8 L;  5FLM H;  4RGO S;  2DUD A;  3D4R A;  1HUN A;  5KGU A;  1HNZ L;  4XIG S;  4IUT A;  2VQE L;  4DAP A;  2F0I A;  4HJ5 A;  2F0H A;  1IBM Q;  4OX9 L;  3CQZ H;  1CQF A;  2QA4 A;  1MJE A;  4JI1 L;  4UY8 C;  2ZM6 L;  4X6A H;  1SYD A;  2ALY B;  5IYD H;  3NHH A;  3G7L A;  1GUT A;  1SND A;  4V0B A;  4TQU S;  3NE5 B;  3S1N H;  1X65 A;  3WOF A;  3WWV A;  2KCN A;  2LMC B;  4I7Z C;  3PQI A;  2NVQ B;  1SE3 A;  3HOW G;  2HCI A;  5C44 H;  2UUC L;  3BS1 A;  1PH8 A;  4OO1 I;  2EY5 A;  5L37 A;  2H1E A;  2E2J B;  3F2D A;  3M7N A;  1EIY B;  2VL6 A;  4KHV A;  2GA4 B;  3O13 A;  5I4D A;  1D6E C;  3VYU A;  1HFG A;  1B3A A;  1S40 A;  1Y14 B;  4ME3 A;  4CKE A;  3DWP A;  3I4N B;  1LTL A;  2UXC Q;  1U4L A;  4ZAI A;  4DUY L;  3K80 C;  1C8C A;  4GNX A;  1GUW A;  1VQC A;  5M5Y B;  2F0M A;  3HEJ A;  5IY0 A;  3RLF A;  3EVQ A;  4ODG A;  3F1Z A;  2ZT9 C;  3J80 i;  4F7X A;  1QVG A;  1NY4 A;  1ZKO A;  2MUY A;  1PTO H;  4ZUI A;  1NBW A;  2F0E A;  1V1P A;  2PW5 A;  1XNQ L;  1TWH H;  3GTK H;  2SNS A;  3D3R A;  2GVA A;  1I4P A;  4DAM A;  5T1I A;  1ILQ A;  3H94 A;  5IWA Q;  4A3F B;  1R4Q B;  2EYJ A;  2NZH A;  3QOL A;  4YWK A;  2VUM H;  5IIF A;  1BKB A;  5BN4 A;  2JA9 A;  3GV3 A;  3MAQ A;  2B3G A;  3P1H A;  3F8T A;  1N34 L;  4OWX B;  2K5D A;  5I9P A;  2MHV A;  1Y1V H;  4XXE A;  3J81 c;  1J5E Q;  3BZK A;  3SVM A;  2WAQ B;  4LK1 C;  2XVS A;  1MKH A;  3K7A B;  2BCO A;  1PH3 A;  3BG3 A;  2Q2H A;  3VR4 A;  2AQ2 B;  4C3J H;  1C9O A;  4PG3 A;  2VS1 A;  4NW2 A;  2NTT A;  3S1Q B;  3U9O A;  1SBB B;  3H3V H;  5JJZ A;  2L9H A;  2ZTC A;  1EY5 A;  2XWB B;  1B2T A;  2PI2 E;  5CV4 A;  2F0J A;  3NBH B;  5IYC G;  3PUV A;  1LTS D;  4QJF A;  2JJQ A;  3P7J A;  5FKA C;  4JI7 Q;  1EQV A;  2B2W C;  3RZO H;  3B6Y A;  3K5O A;  4AQY Q;  1UNS A;  1XMO Q;  1QUQ B;  2A68 D;  4BXX G;  1TR5 A;  1EQT A;  3FP9 A;  3DXJ C;  1P8L A;  4U67 3;  3HP3 A;  4JYA Q;  2OTL A;  3FPU B;  3T1H Q;  4OEL B;  4K0K L;  2C9O A;  1A3T A;  3T13 A;  5EAY A;  2GN5 A;  4A3G B;  1IBK Q;  2ZJP A;  3MFG A;  3CF5 A;  4LF7 Q;  5C0X H;  4P73 A;  4UAI A;  5CR3 A;  2PZW A;  3R2I A;  1PFB A;  3HOX H;  1B8A A;  1L1O C;  1YNN D;  1R4P B;  4DV6 Q;  3PUW A;  2I07 B;  4Y7N H;  1K3R A;  2RDG A;  2QEJ C;  3KLW A;  3X3N A;  1STY A;  2AHO B;  3NUC A;  4C3H G;  1TXY A;  4JV5 L;  4L6T B;  5JPN C;  3G6J B;  3SEB A;  4H13 C;  1PFM A;  3BVM A;  4LFB L;  1WTH A;  3M7G A;  4DV0 L;  1L2F A;  2FXQ A;  3KJO A;  1IKL A;  1NR2 A;  3RZD H;  4H02 A;  3MXU A;  5A2Q E;  2E8G A;  1SLJ A;  1V9P A;  4PMW A;  4DR2 Q;  3OIP A;  1SAP A;  3OWE B;  4JW0 A;  1JR0 D;  4NMZ A;  4KKU A;  3BYY B;  4BY1 G;  4LF9 Q;  3HOZ G;  2O5I C;  4K14 A;  1CQV A;  2QKI C;  3BDL A;  1W6K A;  5IGG A;  1UE5 A;  2DJG C;  4AYB G;  2KHS A;  2Z4H A;  1PH6 A;  4A3L H;  1HHV A;  4DR7 L;  4B9W A;  4FF4 A;  2QDL A;  2VXW A;  2UUB Q;  1X56 A;  1R9T B;  3T1Y L;  4GZY C;  2K32 A;  1OTC A;  4PZ7 A;  3SK4 A;  1SNM A;  4TSS A;  5M3F B;  4UP7 A;  3ER0 A;  1YI2 A;  2PZT A;  4Z9C B;  1EY8 A;  1W2B A;  1I4Q A;  3KFU A;  3GTL B;  3S2H B;  1GUS A;  1EIF A;  4GKJ L;  3K5L A;  1BCP D;  4JI3 Q;  1EWH A;  2UUA Q;  4GLA C;  1R9T H;  5C3E B;  4IFD H;  5KYL A;  4GOP B;  3NTH A;  1TT2 A;  2N3S A;  1HCZ A;  3PV0 A;  2JA6 H;  1ESF A;  2Q8T A;  1JQY D;  1XPO A;  2RF4 A;  5D14 A;  4PZ6 A;  1SYG A;  1YVC A;  1X3Q A;  4F8M A;  3JAM i;  1X55 A;  4KJN A;  2N49 A;  4GKK Q;  1Q8I A;  4B3T Q;  5COR A;  2NVY H;  3A55 A;  5E7N A;  2L5T A;  4OHJ A;  3GTO B;  4BY7 H;  5BR8 Q;  4IPD A;  2JEB I;  4K6D A;  3H09 A;  5ELN A;  4AH6 A;  2F0N A;  5D3D A;  1CI3 M;  4GKK L;  2CVR A;  4HN7 A;  3SK5 A;  3CCM A;  1HQM C;  1KLU D;  4I65 A;  1F77 A;  1PRT F;  4N8X 1;  2JQO A;  1E3P A;  3A8I E;  2R93 B;  1E2V A;  3SHL A;  1X9N A;  1PRT D;  2AUJ D;  3CHB D;  3OTO Q;  4ULL A;  1D5Z C;  4CDF C;  2IW3 A;  1UEB A;  2ATW A;  4DV1 Q;  3H0G G;  1KRS A;  3NBH A;  1VQ4 A;  4UHV A;  1PTO F;  1K83 B;  1JOR A;  3MEH A;  3P75 A;  2BDO A;  4RAU C;  4KJO A;  4PQX A;  4OIJ A;  1O7L A;  1E0B A;  3TS2 A;  5LMU L;  1VQ8 A;  1JE4 A;  5FLX c;  3K5N A;  1QUQ A;  3GTG H;  1J6Q A;  5C4X B;  3H3V I;  1STB A;  2CW0 D;  1UAP A;  1Q82 C;  3UDG A;  4R8I A;  3RMH A;  1MSH A;  1N36 L;  1D1I A;  4DV2 Q;  3C2P A;  2L4N A;  5IGC A;  2MO0 A;  5FJ8 H;  4PMB A;  1NE3 A;  1TS2 A;  4DF7 A;  3KJP A;  2NZ1 D;  3OWF A;  4HMJ A;  4JI8 Q;  1HNX Q;  4A3I G;  1X54 A;  1LV9 A;  3D8G A;  2K33 A;  1WI5 A;  1QG7 A;  1VQJ A;  3KLR A;  4NXM L;  1SXT A;  2R7Z B;  4TKO B;  1Q12 A;  2E5L Q;  1CTM A;  5C0X I;  3CMA A;  1PH7 A;  3PF4 A;  2F0D A;  3M4Y A;  2CCZ A;  5EPK A;  1EFW A;  3GV6 A;  3PUX A;  3MHB A;  3C1F A;  5I2X A;  1NAP A;  1KDB A;  5M5W H;  1I94 L;  3S1M B;  3RR5 A;  1EY4 A;  3MWY W;  2V1C C;  1PZJ D;  2CWA A;  2Q8I B;  4GN3 B;  3MVV A;  2AQ1 B;  5CYU A;  5IP7 H;  1IKM A;  1SEB D;  2JA7 G;  2UXB Q;  1VQA A;  3GTQ H;  1K73 C;  3J81 i;  1C4Q A;  3I2Z A;  4M1U B;  3VR2 A;  3F2B A;  1U4R A;  1K3B C;  3BYT B;  1FL0 A;  1HR0 W;  4B3S Q;  4A3D G;  4KMU C;  3GTJ B;  5GQO A;  3T51 B;  2Y0S E;  2CH4 W;  4KTA A;  2JA5 H;  4A3M B;  2EZV A;  1TWA H;  4DR3 L;  2LY7 A;  3PO3 G;  3EN2 A;  1F2Z A;  3K6O A;  5IYB H;  2HQL A;  4R4C A;  2B2V A;  2K04 A;  2MP1 A;  3CCU A;  4JC0 A;  1O7Y A;  3LGJ A;  4ZYS A;  5FJ8 G;  3A54 A;  2KHI A;  4B3R Q;  2EYF A;  2SDF A;  4WFN 3;  4GOP A;  1DGS A;  2IHF A;  1BO0 A;  3W5O A;  4IO9 A;  1SNO A;  1AE3 A;  3I4L A;  1C0A A;  1ET9 A;  1S72 A;  1CKO A;  2F0T A;  5COY A;  2A8V A;  2KEN A;  5E1F A;  4DNR B;  2WB1 E;  1WFQ A;  1TU2 B;  1UWV A;  1TWG H;  2Z6K C;  4NDX A;  1YBY A;  1K8M A;  1O78 A;  5M3M B;  1XYI A;  1YEZ A;  1K9M C;  3HOY B;  4YHH Q;  2XRS D;  1HZ9 A;  4IFD I;  1TS5 A;  3HS0 C;  4MZ9 A;  2RCF A;  2R92 H;  4CGY B;  5JVH 3;  4LF4 L;  1GUO A;  4QIW B;  3Q6S A;  1EQQ A;  3J7Y W;  2QCP X;  5C5L A;  1CA5 A;  3QIA A;  2B63 G;  1NUC A; 
#chains in the Genus database with same CATH homology
 4NXN L;  1AH9 A;  1SN8 A;  2UXB L;  4GNX B;  2ZJR A;  1SMX A;  3J7Z C;  3VDY A;  1N34 Q;  1KL9 A;  3BJU A;  3G48 A;  4HJ7 A;  1K0R A;  4HIK A;  4TQU S;  2VW9 A;  3S1N H;  3M4O H;  1X65 A;  3WWV A;  3DLL A;  2E2I H;  4B3S L;  4YCW A;  3NEN A;  1Y1W H;  1Q7Y C;  4A3K G;  3HOW G;  1A62 A;  5JEA G;  1QVC A;  3CCR A;  1NJI C;  5C44 H;  1BBW A;  2UUC L;  4WJ3 M;  1PH8 A;  4OO1 I;  2K5N A;  2OQ0 A;  4A3G H;  1UE6 A;  1EOV A;  4DKA C;  3H15 A;  3FHW A;  4DR5 Q;  4R4I A;  3UDI A;  2VUM G;  2VQF Q;  3F2D A;  3M7N A;  1EIY B;  3A5U A;  1OXX K;  2A1A A;  2VL6 A;  4DR1 L;  4A3E G;  3CCS A;  2MO1 A;  4A3C G;  4LWC A;  2KCT A;  4C3I H;  2IX1 A;  3HOV G;  2HT1 A;  1Y1V G;  1S40 A;  1IXR A;  1Q46 A;  3CD6 A;  1Y14 B;  4ME3 A;  4DUZ L;  1WYD A;  1N33 Q;  1U0L A;  4B3R L;  1LTL A;  2YTX A;  2UXC Q;  4DUY L;  3K80 C;  1GKH A;  4LFA Q;  4GNX A;  1VQC A;  5M3F G;  2I5H A;  5IY0 A;  4LNQ A;  1FJG L;  1RIP A;  3RLF A;  4UP8 A;  3L0O A;  4A93 G;  2PQA A;  5ELO A;  2IX0 A;  3F1Z A;  3ZJY C;  2B63 H;  3J80 i;  1NMF A;  1Q8K A;  4X66 Q;  1IBL Q;  1OXV A;  1QVG A;  1JMC A;  1NY4 A;  2JK8 A;  4B3M Q;  4K0K Q;  1NBW A;  2KBN A;  1Q1B A;  2MQH A;  3BZC A;  3KDF B;  1XNQ L;  1TWH H;  3GTK H;  1XMQ L;  2GVA A;  5JJK A;  1C7Y A;  4DAM A;  1HR0 L;  4YHH L;  3KF8 B;  1KD1 C;  5IWA Q;  4A76 A;  1IBM L;  1I50 H;  2OCE A;  4QIW E;  4R4Q A;  5GAG C;  2ASB A;  4BBR G;  3STB D;  2F4V L;  3HOW H;  4DV7 Q;  2NZH A;  2A19 A;  3PCO B;  4YWK A;  1CKN A;  4X65 L;  3SGI A;  1Z9F A;  1N32 L;  2VUM H;  1VQE A;  1BKB A;  3J7A 5;  3HOU G;  3CW2 C;  1PV4 A;  4QQB X;  2JA9 A;  4A3E H;  4EQ5 A;  2NN6 G;  2BA1 A;  2B3G A;  2F3I A;  5HY6 A;  4O0A A;  1VQL A;  2UUC Q;  3F8T A;  3HOV H;  4QY7 A;  4JV5 Q;  1N34 L;  1IZ6 A;  4OWX B;  4RMF A;  3S1R H;  1Y1V H;  2QGQ A;  4LW1 A;  2VZA A;  3J81 c;  1J5E Q;  5C4J H;  4LFB Q;  1BBU A;  3BZK A;  3W1B A;  4DV0 Q;  1M1K C;  1XNR Q;  4JI2 Q;  5C0X G;  1MKH A;  1XPU A;  3PSI A;  2MNA A;  2QEX A;  1PH3 A;  2C35 B;  3TRZ A;  2EXD A;  2Q2H A;  3K81 C;  5M3F H;  3HOX G;  1A8V A;  1K8G A;  3G6E A;  4C3J H;  1C9O A;  3CPF A;  4PG3 A;  2VS1 A;  4POF A;  4DR5 L;  2MFI A;  2VQF L;  1VQ9 A;  3GTL H;  3S2H H;  1VQB A;  4GS3 A;  3S24 A;  1FVI A;  1CUK A;  3PGZ A;  3H3V H;  1ASY A;  2ZTC A;  1D7Q A;  1H95 A;  2VY3 A;  2R93 G;  4JI4 Q;  1JJC B;  2PI2 E;  3NBH B;  5IYC G;  3PUY A;  3UE1 A;  5C3E H;  1YJW A;  4LF6 Q;  3PUV A;  2BH2 A;  4QJF A;  2JJQ A;  1N33 L;  2K52 A;  3EIV A;  3CCV A;  3E9H A;  4JI7 Q;  3L2P A;  1QVF A;  3RZO H;  4KHP Q;  2UXC L;  3B6Y A;  4KLK A;  4AQY Q;  4DK3 C;  1Z47 A;  4LFA L;  4BBS G;  1VQM A;  4BBR H;  1PH9 A;  4DR7 Q;  1XMO Q;  1QUQ B;  3I56 A;  4YWL A;  1I6H H;  3AFP A;  2Q2U A;  1Q1E A;  4KI0 A;  3AQQ A;  4BXX G;  4YWM A;  4P75 A;  2AKW B;  1MJC A;  3HOU H;  3FP9 A;  4X66 L;  1P8L A;  1IBL L;  4JYA Q;  3UDF A;  3A0J A;  3CPW A;  3T1Y Q;  2OTL A;  5C4X G;  3STB C;  3T1H Q;  1M90 C;  4B3M L;  4K0K L;  1PFS A;  1HZB A;  5EAY A;  2GN5 A;  1WCM G;  2IT1 A;  2R6G A;  2YYZ A;  1IBK Q;  3CAM A;  2OWO A;  2ZJP A;  3GTO H;  4BA2 I;  1L1O A;  3F2C A;  3CF5 A;  1YIT A;  4LF7 Q;  3J81 j;  1N9W A;  4P73 A;  1GD7 A;  4R4O A;  5IWA L;  4GKJ Q;  1GVP A;  4A3L G;  3PIP A;  2K5H A;  2D0O A;  4DV7 L;  4J15 A;  3HOX H;  2JA8 H;  3HKZ G;  1B8A A;  1L1O C;  3KF6 B;  5GAD C;  4C2M H;  4JCV E;  3PUW A;  4DV6 Q;  4L5S A;  4OWW B;  3Q8D A;  4Y7N H;  3CC2 A;  1K3R A;  2Z0S A;  3KLW A;  2EIF A;  2HIV A;  2HHH Q;  2KCM A;  5JJI A;  3EBE A;  2AHO B;  4IPG A;  4HJ9 A;  1TXY A;  2R93 H;  4JV5 L;  3GO5 A;  1J5E L;  4DV4 Q;  2WAQ E;  5IYC H;  4LFB L;  1NTG A;  3ULP A;  4DV0 L;  1XNR L;  3MEF A;  1L2F A;  2FXQ A;  5DLQ E;  3KJO A;  1PHJ A;  1VQH A;  4JI2 L;  2R7Z G;  3RZD H;  4EX5 A;  2F52 A;  1YHB A;  4H02 A;  4LFC Q;  2UU9 Q;  4BBS H;  3U50 C;  4LUV A;  2E8G A;  3E0E A;  1K83 H;  1ASZ A;  1SLJ A;  1SRU A;  1V9P A;  4GN5 A;  5GRO A;  4HIO A;  4PMW A;  4DR2 Q;  1SFO H;  3CCL A;  4BXX H;  1HJP A;  4QGU A;  1KXL A;  3I55 A;  4JI0 Q;  2WB1 G;  4IFD G;  4LUO A;  1VQP A;  2YU9 H;  3M4P A;  4GLX A;  5C4X H;  4YY3 Q;  3OW2 A;  4JI4 L;  4BY1 G;  1PH5 A;  3S15 H;  3CCJ A;  1RL2 A;  2JA6 G;  4LF9 Q;  3HOZ G;  1WCM H;  2YTY A;  1D8L A;  5JEA J;  4LF6 L;  1V1Q A;  2JE6 I;  1KHI A;  3GDE A;  3RNU A;  1X3F A;  4UPA A;  4POG A;  4GNX C;  4KHP L;  1U5K A;  1VQ5 A;  4JI7 L;  4L5R C;  1UE5 A;  2CQO A;  1EUJ A;  4AQY L;  4AYB G;  1VQG A;  1PH6 A;  4A3L H;  5GAE C;  2K50 A;  4DR7 L;  1SRO A;  1TWC H;  1X6O A;  3D31 A;  3JC6 6;  4OWT B;  2CKZ B;  4FDB A;  1XMO L;  3UDX A;  5IE8 A;  1YZ6 A;  1E24 A;  5C3E G;  1BVS A;  2RHQ B;  1O7I A;  4BY7 G;  1E7Z A;  2UUB Q;  2BA0 A;  1X56 A;  2BH8 A;  3S2D H;  1JJ2 A;  4JYA L;  3T1Y L;  1I5F A;  4C3H H;  3J80 c;  1OXU A;  3T1H L;  4PZ7 A;  1OTC A;  4OO1 G;  3OYY A;  4KHZ A;  4X64 Q;  2PI2 A;  2WFW A;  2IHE A;  1L0W A;  4UP7 A;  1A0I A;  3ER0 A;  1YI2 A;  1IBK L;  1W2B A;  1HNW Q;  4LF7 L;  2EQS A;  1VQF A;  3KFU A;  2GVB A;  3NEL A;  2Q2T A;  2R7Z H;  1WJJ A;  3RLO A;  4A3M G;  1EIF A;  4GKJ L;  3AFQ A;  4L5T A;  3GD7 A;  4IJL A;  5LMU Q;  4HIM A;  3ICE A;  1G6P A;  3HFZ B;  3CC7 A;  4JI3 Q;  2UUA Q;  4JI6 Q;  3M9B A;  4GLA C;  2RHS B;  4DV6 L;  1VS0 A;  2Q2I A;  1R9T H;  2YV5 A;  3DM3 A;  2ZTD A;  4GOP B;  2HHH L;  2OTJ A;  3GTP H;  4TVA B;  1N36 Q;  4P74 A;  2N3S A;  3PV0 A;  1JJG A;  2JA8 G;  4BY1 H;  3KDF A;  4DPG A;  1LYL A;  2JA6 H;  1VQ7 A;  3S1M H;  4DV4 L;  3HOZ H;  1XPO A;  1SE8 A;  5JJL A;  2RF4 A;  5J3B A;  1KC8 C;  4PZ6 A;  1VQK A;  5K36 G;  1CSP A;  1HH2 P;  1YVC A;  4HJA A;  3JAM i;  5LMN W;  4LFC L;  1X55 A;  1XTD A;  2R7D A;  2AWO A;  4IPC A;  3UE0 A;  1YIJ A;  2UU9 L;  2N49 A;  4GKK Q;  4B3T Q;  3CC4 A;  4DR2 L;  2NVY H;  3MXN B;  1E22 A;  5E7N A;  4BY7 H;  4JI0 L;  5BR8 Q;  3ERS X;  4DV5 Q;  3K0X A;  4IPD A;  3HOY G;  2JEB I;  4JOI A;  5M3M G;  5ELN A;  4NXM Q;  4AH6 A;  4YY3 L;  1LUZ A;  2K4K A;  1E1O A;  1UE1 A;  3ULL A;  3PF5 A;  4LF9 L;  2JEA I;  3GTJ H;  4A4I A;  3M85 A;  3CCM A;  4OON A;  4JOI C;  2I5M X;  1KQS A;  3U4V A;  3NEM A;  4A3M H;  2KHJ A;  3U58 A;  2JQO A;  2CWP A;  1B7Y B;  2XTI A;  2ES2 A;  1E3P A;  1GM5 A;  1KIX A;  3CP0 A;  1X9N A;  1HZC A;  2Z6K A;  4DR6 Q;  3OTO Q;  4JI5 Q;  4WJ4 A;  2Y0S G;  4DNI A;  2YTV A;  5IP9 G;  5IT9 c;  1I94 Q;  1IYJ B;  2UUB L;  1VQO A;  4A3B G;  4L5Q A;  1JT8 A;  2N78 A;  1UEB A;  4DR4 Q;  1CKM A;  3E9I A;  2ATW A;  4X64 L;  3TQY A;  3H0G G;  1T9H A;  4DV1 Q;  1A63 A;  1KRS A;  2ID0 A;  1VQ4 A;  5AJ3 Q;  1HNW L;  4P71 A;  1XPR A;  5M5X H;  1PYB A;  3TS2 A;  1QZH A;  4MTN A;  1YJN A;  5LMU L;  1VQ8 A;  3GTM H;  3KYH C;  5FLX c;  3GTG H;  1QUQ A;  1G29 1;  5LMN Q;  1J6Q A;  4HID A;  4JI3 L;  4AYB E;  2UUA L;  4GN4 B;  4JI6 L;  3H3V I;  4JBK A;  3S17 H;  1EQR A;  3TEH B;  4MNO A;  1N8R C;  1JE5 A;  1SR3 A;  1Q82 C;  2I5L X;  3UDG A;  4NB3 A;  1VCI A;  2NVX H;  3HOY H;  5M3M H;  4Y52 H;  1CSQ A;  1N36 L;  4DV2 Q;  1YNX A;  4JBW A;  5IP7 G;  3I4M G;  3I4N G;  2PQA B;  4DR3 Q;  3ULJ A;  2MO0 A;  3FKI H;  5FJ8 H;  1E1T A;  1NE3 A;  3BU2 A;  1PA6 A;  1FGU A;  4HJ8 A;  3IRB A;  4DV3 Q;  3KJP A;  4DAY B;  1VQN A;  4JI8 Q;  3CCQ A;  3AYH B;  1HNX Q;  4GKK L;  2K5V A;  1HZA A;  2LXK A;  3KF6 A;  3RN5 A;  3RLN A;  2K14 A;  4A3I G;  4B3T L;  1X54 A;  1IL2 A;  1JB7 A;  5IP9 H;  5GAH C;  1WI5 A;  2NN6 I;  3I4O A;  1VQJ A;  5BR8 L;  3G4S A;  4DV5 L;  3AEV A;  4IOA A;  4IJH A;  2AWN A;  2PMZ E;  2JA5 G;  4A3B H;  1EYG A;  3PO2 G;  1PH1 A;  1I3Q H;  4NXM L;  1CKN B;  2E2H H;  1Q12 A;  2E5L Q;  1PYS B;  3H0G H;  4GLV B;  1PH2 A;  2NVQ H;  2LSS A;  1OXS C;  5C0X I;  1W3S A;  4A3F G;  5IYB G;  3CMA A;  1PH7 A;  4OXP A;  4R1J A;  1VQ6 A;  3PF4 A;  3KOJ A;  2CCZ A;  4LF8 Q;  1AE2 A;  1EFW A;  2E2J H;  4BA1 I;  3PUX A;  4IFD J;  1K8A C;  2N8N A;  1HNZ Q;  4LF5 Q;  4JBM A;  2OQK A;  2VQE Q;  3OTO L;  4JI5 L;  4DR6 L;  5M5W H;  2B29 A;  1EWI A;  4P72 A;  1I94 L;  4OX9 Q;  3RR5 A;  2AMC B;  4LF4 Q;  2DGY A;  2V1C C;  2WP8 J;  1WOC A;  4NPS A;  2CWA A;  4JI1 Q;  4GN3 B;  2ZM6 Q;  2UXD Q;  2WAQ G;  4DR4 L;  2RCN A;  3I7F A;  5IP7 H;  5H1S E;  4X62 Q;  4DV1 L;  3TS0 A;  3I4N H;  3I4M H;  1VQI A;  5AJ3 L;  4ALP A;  4NXN Q;  1VQD A;  2HIX A;  2JA7 G;  5M5Y H;  2NVT H;  2UXB Q;  1VQA A;  3GTQ H;  3CXC A;  1PH4 A;  3M4Q A;  4A3K H;  3A5Z B;  3J81 i;  1X3E A;  3I2Z A;  1K73 C;  1YJ9 A;  1X3G A;  4A3J G;  4YCU A;  3F2B A;  3CCE A;  5FLM G;  3U4Z A;  1FL0 A;  2L15 A;  1HR0 W;  4APV A;  5LMN L;  4JG2 A;  4A3I H;  4B3S Q;  3HKS A;  1Q81 C;  4IPH A;  2R92 G;  3A74 A;  1TWF H;  4A3D G;  4LUZ A;  3K8A A;  5GQO A;  2Y0S E;  3TRE A;  1V43 A;  4O2D A;  4DK6 C;  2JA5 H;  4QL5 A;  3PO2 H;  1KAW A;  5IYD G;  4DV2 L;  3S14 H;  1GO3 E;  1KRT A;  1G51 A;  3M3Y H;  1TWA H;  3K7U C;  2NZO A;  3L7Z C;  4DR1 Q;  4DR3 L;  3PO3 G;  3EN2 A;  2K75 A;  2D0P A;  3HKZ E;  4A3F H;  5IYB H;  2ZTE A;  2HQL A;  4R4C A;  1OXT A;  4R4T A;  4UP9 A;  1YHA A;  3G71 A;  4DV3 L;  4YCV A;  3CCU A;  4JC0 A;  4JI8 L;  3LGJ A;  2XGT A;  2H5X A;  5C0X J;  1HNX L;  4A93 H;  3FKI G;  5FJ8 G;  3JAM c;  1L1O B;  2KHI A;  4DUZ Q;  1XJV A;  4B3R Q;  1NMG A;  2D62 A;  3RN2 A;  1Y1W G;  4DUY Q;  2LXJ A;  3S16 H;  2CFM A;  5C44 G;  1LM0 A;  4GOP A;  1DGS A;  4RG1 A;  2IHF A;  4A3G G;  3W5O A;  4XTC S;  1FJG Q;  1MIU A;  4A3C H;  4IO9 A;  2IY5 B;  4JBJ A;  1AE3 A;  2I0Q A;  2E5L L;  1P16 A;  1PVO A;  1C0A A;  1B70 B;  3W1G A;  1CKO A;  3K7A H;  4AIM A;  1S72 A;  4GOP C;  2VNU D;  2JA7 H;  3PUZ A;  2A8V A;  2KEN A;  2R7F A;  1S3O A;  1Q86 C;  2WB1 E;  1WFQ A;  4A3J H;  4LF8 L;  1UWV A;  4IOC A;  1XNQ Q;  5FLM H;  3S1Q H;  1TWG H;  2Z6K C;  1XMQ Q;  1YBY A;  2DUD A;  3D0F A;  1K9M C;  1YEZ A;  1QZG A;  1HR0 Q;  4YHH Q;  1UE7 A;  2ZJQ A;  1HNZ L;  4XIG S;  1HZ9 A;  3CME A;  4LF5 L;  2VQE L;  4A3D H;  4IFD I;  2R92 H;  4MZ9 A;  2PNH A;  4HJ5 A;  1IBM Q;  4OX9 L;  2F4V Q;  4LF4 L;  3CQZ H;  5HGQ A;  4A75 A;  2QA4 A;  2UXD L;  1EQQ A;  1MJE A;  4JI1 L;  4UY8 C;  2ZM6 L;  4X6A H;  4X65 Q;  1N32 Q;  1YHQ A;  2ALY B;  5IYD H;  4X62 L;  2B63 G;  3PO3 H;  3PIO A;  4PZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...