3EBEA

Crystal structure of xenopus laevis replication initiation factor mcm10 internal domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
179
structure length
172
Chain Sequence
QYHVEKFSGLRIRKPRVSSSEMERKMNGRKLIRLAQLQNKIATEKLEEEDWVTFGVIVKKITPTFSIWRLNDLKDLDKYISLFLFGDVHKEHWKTDQGTVIGLLNANPMKPKEGTDEVCLSVDNPQKVLLMGDAVDLGTCKARKKNGDPCTQMVNLNDCEYCQYHVQAQYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein MCM10 homolog
publication title Structural basis for DNA binding by replication initiator mcm10.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Replication
total genus 43
structure length 172
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09329 zf-primase Primase zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ebeA00
1Q12A 5IYDG 4PZ7A 5J3BA 5BR8Q 4DV3L 4A4IA 2PMZE 4B3ML 2HHHQ 5M3FH 2NVQH 1Y1VG 2RHSB 3AYHB 3RNUA 1E7ZA 2H5XA 1CSPA 4YHHL 1GD7A 3KLWA 1Q46A 1PH6A 1GM5A 4DR7Q 1I50H 1X6OA 2JJQA 5M5YH 1C0AA 4B3RL 1QUQB 2KCTA 1S40A 1P16A 5DLQE 4L5RC 1YNXA 3PV0A 3OTOL 1XJVA 1IBKL 2UU9L 4JI4Q 3B6YA 3MXNB 2YV5A 1PH2A 1NJIC 2ZTDA 4LF4L 1VQNA 2HT1A 4K0KL 2JEAI 3M4QA 3UDIA 1N36Q 4GLVB 1KAWA 1GKHA 3L0OA 3Q8DA 1Y1WH 4JI1L 3S16H 4LFCL 3TS2A 3HOVH 5K36G 2E2JH 2IT1A 2E5LQ 2ZJQA 4DKAC 3ER0A 1LUZA 1V1QA 3D31A 4ME3A 1JMCA 4DR4L 5IY0A 1A8VA 2IY5B 1X3GA 1X54A 3HKZE 3K0XA 4HIMA 3F2CA 4GNXA 1IBMQ 2VNUD 5GROA 4UP7A 1T9HA 4DV6L 3KF8B 4LF7L 1UWVA 1JJ2A 4JI5L 3L2PA 2L15A 3RR5A 1VQEA 4UY8C 4DAMA 1PH7A 3PO3H 1X3EA 4NXNL 1SN8A 1EFWA 1EYGA 2R7ZG 1VQDA 4YCWA 4GLAC 4A3FH 2DUDA 3M4PA 1HR0W 3J7ZC 1K83H 1EWIA 3I7FA 3S1RH 1VQFA 1WJJA 1G291 4OXPA 2IX0A 3PUWA 4GNXB 4O2DA 4LUZA 1DGSA 1LM0A 2VL6A 4DR5Q 2B3GA 5ELOA 3PUVA 4KLKA 2OTJA 1AE3A 1QZGA 5H1SE 4JYAQ 4AYBE 3HOZG 4BXXH 1X3FA 1E1OA 2R93G 3H15A 3EIVA 4A75A 1QVCA 1FGUA 3KF6A 4JI8L 5C4XH 1VQOA 4DR6L 3NBHB 5C44G 3CCMA 4WJ4A 4R4CA 1VQ6A 4DV3Q 1OXUA 2KENA 1HNWL 5IP9G 4HIOA 2E2HH 2B29A 3HKSA 4YHHQ 3A5UA 1X9NA 1M90C 3PF4A 4JYAL 3CCUA 2PNHA 4JBWA 4OX9L 2R7DA 4HJ7A 3RZOH 4B3RQ 1X56A 4JI7L 4JI6L 3OTOQ 1IBKQ 4JBJA 2JA8H 1SLJA 3CXCA 4K0KQ 4AQYL 1XMOL 5IWAL 2QGQA 4GN3B 1ASZA 3KF6B 1TWCH 3M9BA 4IFDJ 4BBSH 4OWWB 3JAMi 4JI1Q 4LFCQ 4A3CH 1SRUA 4DR4Q 3KJPA 2Y0SE 3ULPA 4PMWA 1JJGA 4LFAQ 4NPSA 4DK3C 5IP9H 5IP7H 1SROA 1N36L 4MTNA 1HZAA 1WOCA 2E8GA 1N34L 3T1HL 1PV4A 3HFZB 5M5WH 4DV6Q 3I4NH 1L2FA 2PI2E 4LW1A 4YCVA 1HR0L 4A3EG 1YHBA 2EQSA 4LF7Q 2ZTCA 4JI5Q 1S3OA 2Q2TA 1YITA 3CF5A 1KHIA 2VQEL 1VQ8A 2VUMH 2IHFA 3CPFA 3EN2A 2JEBI 4R4IA 5GQOA 2VZAA 3PCOB 1IYJB 4NXNQ 5C4JH 3A0JA 2WB1G 3CAMA 4QIWE 2Z6KC 3K8AA 2QA4A 2YTXA 2CWPA 4HIKA 4JV5L 1IBLL 3UE1A 4WJ3M 5IYCG 1S72A 2Z0SA 4KHZA 3VDYA 1ASYA 1R9TH 3I4OA 3K80C 4RG1A 1JJCB 1N32L 3F1ZA 1VQGA 1B7YB 2GN5A 1I94L 4A3EH 1OXTA 4A76A 2PQAA 4A3MG 3JC66 1Q1EA 3KFUA 1TWGH 3CCRA 4BBRG 1EIFA 1W2BA 4IFDG 2NN6G 5GADC 3BU2A 4BY1G 1UE7A 1VQBA 4JCVE 4O0AA 3GTKH 3PO2H 3RN5A 2CKZB 4IOAA 4JI8Q 4JI2L 2HQLA 5E7NA 3F2BA 2VY3A 2B63G 4A3IG 1UEBA 3F8TA 2UXCQ 3HOYG 2KHJA 5ELNA 3CCQA 1J6QA 4IJHA 4DV4L 2K4KA 1CUKA 4IO9A 1Q1BA 3BZKA 4OONA 3U4ZA 1HZBA 1Z47A 1IXRA 3J81c 4OX9Q 3W1GA 1LTLA 2PQAB 5IE8A 3MEFA 1SFOH 1PA6A 4JI7Q 5AJ3L 3DLLA 2OWOA 4JI6Q 4AH6A 1K0RA 2UUAL 4BY7G 2BH2A 1MJCA 1Z9FA 2N8NA 4X66Q 1XTDA 1QVGA 4H02A 5C0XI 3AFPA 5IWAQ 4AQYQ 1XMOQ 1QVFA 4C2MH 1YZ6A 2I0QA 3HOWG 3U58A 1D8LA 2K14A 1I5FA 5JJKA 3RLOA 4OWTB 3I4MH 4JC0A 1VQHA 1PHJA 4B3TL 3KYHC 3TQYA 4P71A 2JA6G 1WCMG 2Q2IA 2JA9A 1E3PA 4YWKA 3T1HQ 1TWFH 3A5ZB 4BA1I 3TS0A 1N34Q 3S17H 4HJ8A 1HR0Q 2ZTEA 5IYDH 4DNIA 2Z6KA 3FKIG 2MO0A 4LFAL 4A3GG 1Y1VH 5FJ8G 3EBEA 2VQEQ 2D0OA 3GO5A 2YTYA 1C7YA 4B3SL 4NB3A 3GD7A 2QEXA 3L7ZC 3RLFA 4DV5Q 1XPRA 4GN4B 3W1BA 2F3IA 5HY6A 3M7NA 4QY7A 1VQ5A 4JV5Q 3STBC 1IBLQ 1EOVA 2CQOA 3M4OH 3I4NG 3K7UC 2UXBL 1U0LA 1WI5A 1D7QA 1VQJA 2F52A 1N32Q 1UE5A 4A3BG 3IRBA 3PSIA 1I94Q 3FKIH 4YY3L 2WFWA 4DV2L 1N33L 1KQSA 4POGA 2BA1A 4JI3L 4HIDA 3CMAA 1VQMA 1M1KC 1XNQL 2ZJPA 3U50C 1VQPA 3T1YL 3BJUA 1EQQA 3ULLA 3FHWA 3PUYA 4JI2Q 1TXYA 1MKHA 4DPGA 3K7AH 1PH8A 2Q2UA 5IT9c 4LWCA 1VS0A 1YI2A 3FP9A 3H3VH 4Y52H 2D0PA 1G51A 3G4SA 4R4TA 2NVXH 1Y14B 4XIGS 4DV4Q 1XNRL 2R7ZH 3NEMA 4DR1L 4LFBL 3TEHB 1KD1C 4A3BH 4QQBX 3TREA 4BA2I 5AJ3Q 2K50A 1J5EL 2UUAQ 1RL2A 2AHOB 2UXCL 1U5KA 4JOIC 1EQRA 2AWNA 1XPOA 4EX5A 3GDEA 3CC7A 1VQ4A 1H95A 3AEVA 4DR2L 1VQKA 2WB1E 4LUOA 1BVSA 5C3EG 3J80i 2ZM6L 4HJAA 3HOZH 1OXSC 2KHIA 3HKZG 5LMNW 4X66L 3GTPH 1NE3A 4R4OA 4B3TQ 2R93H 2VW9A 4L5QA 4X62Q 4DV7L 4LF8L 2WAQG 4GLXA 3G71A 5FLMG 2R7FA 5C44H 3RN2A 2MQHA 3STBD 5M3MG 2VQFL 1MIUA 4DUZL 3NENA 4P75A 1JB7A 4P73A 1CKNA 2F4VL 4B3SQ 4A3JG 3S2DH 2AMCB 4APVA 4IOCA 1FVIA 2DGYA 2K75A 2LSSA 1HH2P 1TWAH 1PYSB 3D0FA 3HOXG 5GAGC 1OXVA 1MJEA 5C0XJ 3GTLH 1K73C 2UXBQ 1NTGA 4NXMQ 4JG2A 4DV5L 1FJGL 4PZ8A 3UDGA 3CMEA 4JI0L 1BKBA 3KDFA 1YEZA 2N3SA 2IX1A 3A74A 4YY3Q 5M5XH 4DUYL 2UUBL 4DV2Q 1YBYA 1CKNB 1N33Q 1I3QH 1RIPA 4JI3Q 1VQIA 1CSQA 1KXLA 1XNQQ 5IYBG 1NY4A 4UPAA 3T1YQ 1VQLA 3F2DA 2UUCL 4A93G 3WWVA 2EIFA 2C35B 5FLXc 3I56A 4PZ6A 3JAMc 1XPUA 5JEAJ 4HJ5A 1OTCA 2HIXA 1XNRQ 4JOIA 3RLNA 2ATWA 3KDFB 4UP9A 4DR1Q 4LFBQ 4IPDA 1HNZL 4J15A 4A3KG 4PG3A 1X65A 2YYZA 3DM3A 2RHQB 5IYCH 1J5EQ 1YHQA 4Y7NH 1A0IA 5LMNL 3PF5A 3GTQH 4QL5A 4OO1I 4RMFA 1X55A 3H0GG 3KJOA 4TVAB 1P8LA 4XTCS 1KL9A 1SE8A 1K8GA 2ZJRA 4DR2Q 4MNOA 4A3MH 2Y0SG 4DR3L 2ZM6Q 5C0XG 4BBRH 1KC8C 2D62A 1NMFA 5M3FG 2K52A 4BY1H 4DV7Q 1HZCA 1LYLA 2CFMA 4LF8Q 4GOPA 1K9MC 4X6AH 1YJNA 4LNQA 4IFDI 4A3KH 2GVBA 3CCEA 4X64L 1BBWA 3CQZH 1FL0A 1UE6A 2B63H 4A3IH 4LF9L 2VQFQ 2I5MX 1XMQQ 4DUZQ 3HOYH 1IL2A 3ERSX 4KI0A 4X62L 3S2HH 2F4VQ 4AIMA 4GKKL 4DV0L 1SR3A 1I6HH 3G48A 3PIPA 3AQQA 1Y1WG 4YCUA 2ID0A 5LMUL 3HOVG 1K8AC 3OYYA 4BY7H 5JEAG 3S1MH 2JK8A 1QZHA 3SGIA 4GKJL 4GOPB 3HOWH 3CD6A 1FJGQ 3CC4A 2UXDL 2V1CC 2E2IH 3CCSA 4JI0Q 5JJIA 1BBUA 3E9IA 3J81j 2UUBQ 3CCLA 3KOJA 1VCIA 4DUYQ 2R92G 3M85A 2BA0A 3I55A 4NXML 2JA6H 1WCMH 3PO3G 1N8RC 1Q8KA 2BH8A 4L5TA 1Q82C 1VQ7A 2UUCQ 1UE1A 2RCNA 4A3FG 3GTMH 2FXQA 1V9PA 4A3GH 2HIVA 1NMGA 5FJ8H 2JA7G 4IPCA 4YWMA 4LF5L 2RF4A 2YTVA 1PYBA 4X65L 4OWXB 2JQOA 2VS1A 1KRTA 3I2ZA 2I5HA 2WAQE 2NVTH 3K81C 2R6GA 1Q81C 1HNZQ 2A1AA 3J7A5 2AKWB 1N9WA 1HNXQ 2NVYH 5HGQA 2I5LX 5LMNQ 1L1OA 3HOUG 4BXXG 2R92H 3S1NH 1E22A 2MO1A 4ALPA 2EXDA 2IHEA 2LXJA 4C3IH 4POFA 3H3VI 4KHPL 1A62A 2K5NA 1W3SA 4GN5A 3CP0A 2CCZA 5C4XG 3S1QH 3ZJYC 4MZ9A 4DR3Q 1TWHH 4FDBA 5EAYA 1PH3A 2JA7H 3LGJA 4IPHA 3ICEA 1EIYB 4A3LG 4LF6L 1SMXA 3S24A 2JA5G 5GAEC 4X64Q 1V43A 1Q7YC 1L1OB 4LF9Q 3HOUH 2JA8G 2CWAA 1YVCA 2KBNA 2PI2A 4YWLA 1O7IA 4GKKQ 4TQUS 3TRZA 1NBWA 4DV0Q 4A3DH 4C3JH 4BBSG 5LMUQ 4DV1L 2A8VA 4A3CG 1VQAA 1HJPA 1XMQL 1K3RA 4B3MQ 4P72A 4GKJQ 4GOPC 4QGUA 5IP7G 1B70B 1YJWA 4P74A 2OQ0A 4A3LH 2UXDQ 3UDFA 3BZCA 1WFQA 4GS3A 1PH5A 2JA5H 3G6EA 4R1JA 1YIJA 3U4VA 3GTGH 5C3EH 4DAYB 5BR8L 1Q86C 1E1TA 2K5HA 2UU9Q 2HHHL 3PGZA 2NZOA 4LF4Q 2VUMG 1A63A 1OXXK 4DR7L 1AH9A 3UDXA 3AFQA 3NELA 1VQ9A 5FLMH 2JE6I 4C3HH 4AYBG 1C9OA 5M3MH 4JI4L 2LXKA 2MFIA 4LF5Q 1PH1A 2ES2A 1GO3E 4A3JH 4X65Q 2OCEA 3J80c 1VQCA 4R4QA 4LUVA 3CCJA 2A19A 1E24A 3ULJA 2E5LL 3HOXH 5GAHC 4JBMA 4QJFA 2N49A 1G6PA 3CW2C 3UE0A 3J81i 2XTIA 3PUXA 1IBML 3CPWA 1PVOA 4KHPQ 3PO2G 1EUJA 3W5OA 2XGTA 1HNXL 1CKMA 4OO1G 1JT8A 1AE2A 3PIOA 3CCVA 4GNXC 3E9HA 4HJ9A 1IZ6A 1WYDA 4JBKA 2OTLA 4UP8A 1KIXA 5IYBH 3GTJH 1L0WA 3M3YH 1HZ9A 4A93H 4LF6Q 1L1OC 2N78A 4IJLA 3RZDH 2AWOA 2NZHA 1YJ9A 2K5VA 1PH9A 1PH4A 1YHAA 3CC2A 3OW2A 2Q2HA 4L5SA 3S15H 5JJLA 2YU9H 4IPGA 2MNAA 1GVPA 4DR5L 2KCMA 2NN6I 2WP8J 4EQ5A 4DR6Q 1KRSA 1QUQA 4DV1Q 2ASBA 2OQKA 1PFSA 1CKOA 2ALYB 3I4MG 3S14H 1B8AA 3H0GH 3PUZA 1HNWQ 3E0EA 2GVAA 3GTOH 1JE5A 4DK6C 4A3DG
chains in the Genus database with same CATH superfamily
5C4ZA 3GV3A 4PZ7A 4B3ML 1PTOC 2PMZE 5M3FH 3RNUA 2H5XA 1GM5A 1PH6A 3VR4A 1SNMA 1UNSA 3K5OA 1C0AA 4B3RL 2KCTA 1S40A 2JA8B 5DLQE 1YNXA 3OTOL 1XJVA 2UU9L 1K8OA 3MXNB 1WTQA 1NJIC 1I6HH 1GUGA 4K0KL 3UDIA 4ZK9B 5CV9A 3ERQA 5LL6X 3H6MA 4KN7C 1TR5A 3Q8DA 3S16H 4LFCL 1Z6HA 2IT1A 4DKAC 3HGBA 4DR4L 1Q3LA 4CKBA 2IY5B 1X3GA 1HA6A 2B2TC 2D2CC 2QEJC 1U4RA 4NMZA 2VNUD 3F2CA 4GNXA 5IGCA 5GROA 1IW7D 4DV6L 1PFBA 4JI5L 1F77A 3DXJC 3V96A 4DAMA 1X3EA 1SYBA 4NXNL 5FO9B 2R7ZG 3DWPA 4CKEA 2QDBA 4DGZA 1R9TB 4KKUA 3T56B 4G7ZC 1S5FD 4TKOB 4RGMA 1JOQA 4LUZA 4QUCA 2ICEC 4KLKA 1L0YB 1X3FA 5E4WC 2ZXOA 2WV6D 2EE1A 1QVCA 1JORA 1FGUA 2B2YC 4DR6L 4QUFA 3CCMA 3A8JE 1E2VA 3J81E 4DV3Q 1HNWL 5IP9G 2E2HH 1RCVD 1X9NA 1SFOB 3PF4A 1Q8IA 4JBWA 3A56A 4JI7L 2M2LA 4C1NI 4PQXA 4AQYL 2XWJB 4GN3B 1SE4A 1TWCH 3R93A 4BWGB 2VB3X 4OWWB 3JAMi 2F3VA 4A3CH 1PFNA 1B53A 1VMPA 2Y0SE 4PMWA 4OELB 4DK3C 1BO0A 5IP7H 1SROA 1SMYD 5IP9H 2TSSA 2IWHA 1N34L 1PV4A 4K6DA 5M9OA 1UUPA 3H94A 1YHBA 2EQSA 2ZTCA 1S3OA 2A74C 3CF5A 1S5CD 2VUMH 5GQOA 4R4IA 1IYJB 1CTMA 3A0JA 1SYEA 4OIKA 4QIWE 4HIKA 2YTXA 5EBCA 1IBLL 1ENFA 2JA6B 1SYFA 1MD2D 2A5HA 3TP5A 3VR6A 4RG1A 1N32L 3FKIB 2G5DA 4A3GB 2AUKA 2GN5A 3SEBA 4Q5VA 3S9WA 3SK4A 3EA6A 4BBRG 1TY0A 5C3XA 2F0UA 4NKLA 5IT9E 2NN6G 4RHRA 4JCVE 2XRSD 3GTKH 3RN5A 1ZYRD 2CKZB 2KJXA 3U9OA 3I8ZA 1PLFA 2KHJA 1EYDA 4IO9A 4A3BB 4DV4L 3NQIA 1Q1BA 4OONA 3U4ZA 4OX9Q 3J81c 3DLLA 1EL0A 1C48A 3LNNA 2VB2X 4N9PA 5KRUA 4V190 1MJCA 2N8NA 4BY7G 2AQ2B 4WJWA 3AFPA 5IWAQ 1QVFA 1PTOH 4L63B 1D8LA 3RLOA 4OWTB 3I4MH 1PHJA 1KNEA 4B3TL 3TQYA 5C44B 2Q2IA 4YWKA 4A3DH 4BA1I 4ZYSA 1HR0Q 4UDUC 4NW2A 4MHEA 2VQEQ 4ZLTF 1NSNS 5J22A 4Q0FA 1E0BA 3L7ZC 2K1BA 4XT3B 4DV5Q 2F0WA 2F3IA 5HY6A 3M7NA 1G91A 3FMCA 3GTLB 3PQIA 2CQOA 3M4OH 3OHXC 1D7QA 3CU7A 1UE5A 2H1EA 2X6GA 1GUNA 3IRBA 1I94Q 4XQNA 3K6OA 2Q8IB 1KQSA 4JI3L 3CMAA 3T1YL 3BJUA 4JI2Q 4EVOA 5IT9c 4LWCA 3FP9A 1MGSA 5BN5A 1EY7A 2N88A 4R4TA 4XIGS 3TEHB 4QQBX 2K50A 1FR3A 1STNA 3GDEA 3CC7A 2C9OA 2JXMB 2F03A 1KLUD 2Q8TA 1VQKA 4ILWA 4UAIA 1IL8A 2YU9B 5C3EG 3J80i 2J7ZA 4HJAA 1JWMD 1KDAA 2F0GA 1XX8A 1NE3A 1DD2A 1IYUA 2VW9A 4X62Q 4DV7L 4LF8L 1R4QB 5DEHA 2B63B 4QCLA 2R7FA 1DONA 3RN2A 2HDMA 3BDLA 1W6JA 2VQFL 1MIUA 4FXGC 5CMDA 1CKNA 4B3SQ 1FVIA 4RKLA 2DGYA 3L9AX 1ICWA 3VA7A 4XXEA 1HH2P 1TWAH 1K3BC 1I4XA 4JG2A 4DV5L 3NTKA 1C8CA 1CI3M 1II3A 1SJED 1AW7A 4YY3Q 1EY8A 2EY1A 2EYLA 1XNQQ 5IYBG 1NY4A 4UPAA 2NWGA 3F2DA 1PYWD 4A93G 1V1OA 1HUNA 4PZ6A 5JEAJ 1R4PB 4G57A 4HJ5A 2HIXA 1XNRQ 4JOIA 5CYUA 4DR1Q 4UP9A 4IPDA 1HNZL 4A3KG 4PG3A 1NAPA 3GTQH 5JVH3 4QL5A 1H9JA 1X55A 3EFXD 4RKBA 1P8LA 1F9QA 2K33A 3IKJA 1STGA 4DR2Q 4MNOA 4A3MH 2Y0SG 4DR3L 5FLXL 2ZM6Q 2O2LD 4KD4A 2GA4B 4BY1H 4RCNA 2B2WC 4GOPA 4G7HC 4H0LC 4A3KH 2L9HA 4DFAA 4CDDC 4DUZQ 1IL2A 2F0LA 3ERSX 1DCZA 4X62L 4C3JB 2PW5A 4DV0L 4YCUA 1WTXA 5JEAG 3S1MH 1KABA 2JK8A 1EEFD 3OMCA 3A8KE 2E2HB 1ET9A 1ESRA 1PTOF 2JA5B 3HOWH 2UXDL 2V1CC 4HTHA 2E2IH 3NTHA 4JI0Q 1FD7D 2M9VA 4P2CB 1BBUA 4WRDA 2UUBQ 1CM9A 1RJTA 4J1MA 4DUYQ 1ZEQX 1NCVA 5JPMC 4C3HB 1Q82C 1BF4A 3J7YW 2PPBC 4A3FG 2Z6BA 2FXQA 2HIVA 5FJ8H 2JA7G 4DK1A 4X65L 4OWXB 2D9UA 2VS1A 1KRTA 3OMGA 2R6GA 3HP3A 1JC7A 4JK1C 2KECA 1L1OA 1E22A 4ALPA 5KYIA 4K6LA 1TS3A 2XIWA 5C4XG 3D6CA 4FYDA 4MZ9A 1TWHH 5DNFA 2CVRA 2JA7H 1SDFA 2AUJD 5JJZA 4ODGA 3ICEA 3EVQA 4A3LG 1SMXA 3S15B 5GAEC 2O5IC 4LF9Q 4DAYA 2JA8G 2CWAA 2EVBA 2K5DA 1PZKD 1A2UA 3TZUA 3QO2A 4DF7A 1O7IA 4GKKQ 3D4DA 5LMUQ 4DV1L 1HJPA 2ICIA 4QGUA 3MAQA 4A3LH 4H44C 3UDFA 1HQMC 3TMEA 2L55A 3A55A 2CH4A 4JW0A 3U4VA 3GTGH 2NVQB 2SOBA 5BR8L 1Q86C 5A2QL 4LF4Q 1OXXK 4DR7L 4X3UA 1VQ9A 3J7AV 5FLMH 1BNZA 4B9XA 4AYBG 3A54A 2O5JC 2MFIA 3VR2A 1PH1A 1GO3E 1Y1WB 2OCEA 1VQCA 4R4QA 2A6ED 3CCJA 3MHBA 1JOKA 1K8MA 5ELCA 5BN4A 3ULJA 2E5LL 3HOXH 1BDOA 1ZXTA 2N49A 3UE0A 3J81i 3PUXA 5IOCA 1JB3A 4KHPQ 2L4NA 4GNXC 1D6EC 1S5DD 1KIXA 5D14A 1HZ9A 2RKSA 1ML0D 4IJLA 3RZDH 1PH4A 3R2IA 4F8MA 1HCZA 4IPGA 1A3TA 2KCMA 2IX3A 1QNKA 2B2VA 2ALYB 2I07B 3S14H 5E3FA 3MXNA 3H0GH 3PUZA 1NR2A 4X3TA 3E0EA 5FO7B 4DK6C 2XSCA 4TSSA 5IYDG 5J3BA 1JR0D 4HN7A 1QG7A 1HQRD 1Y1VG 2RHSB 3AYHB 1GD7A 3KLWA 5C6AA 1I50H 1X6OA 2JJQA 5DAUA 4L5RC 3PV0A 1IBKL 3LX0A 3DM1A 1STEA 4LF4L 2ZTDA 4QF4A 1VQNA 2RCFA 1N36Q 4BBSB 4GLVB 3SDZA 2EYFA 4JPBW 3TS2A 3HOVH 2E2JH 1F9RA 3G7LA 1LUZA 5IY0A 1X54A 3KUPA 1PMRA 5M5WB 5CV5A 2DJFC 1IBMQ 2LMCB 4UP7A 3KF8B 4LF7L 1A6XA 2RSOA 1SN8A 1EFWA 1VQDA 4YCWA 4DNRB 3J7ZC 1K83H 3RD4A 1EWIA 1LABA 4KN4C 3S1RH 3KBGA 3PUWA 5EBDA 1TIID 1LM0A 2VL6A 5CORA 1UEAB 2FFKB 4DR5Q 2OTJA 3K59A 3PO2B 2WB1B 4ULLA 2R93G 2F3WA 3EIVA 4R8IA 1Y69U 4JI8L 3GTQB 3NXWA 3I4LA 3MVVA 5C44G 3F2UA 4R4CA 1OXUA 2K5QA 2NTTA 3HKSA 4RAUC 4JYAL 2F0HA 2F0QA 2PNHA 2F0SA 3CCUA 1ZYRC 2R7DA 4B3RQ 2PQEA 2A73B 3R2TA 4JI6L 3OTOQ 2K04A 1SLJA 3W2DA 4K0KQ 1ASZA 2FJ2A 3KF6B 4FF3A 3QG1A 1CA5A 4JVZA 4LFCQ 1CQVA 1EQVA 1D1IA 4DR4Q 3KJPA 2ZXPA 4MIUA 1N36L 3AU7A 4WFN3 3HFZB 4DV6Q 3I4NH 1M8AA 4YCVA 4A3EG 4JI5Q 3NE5B 4CDEC 2NZ1D 1KHIA 4IUNA 3HOWB 3EN2A 1EU3A 1ZKOA 2E2IB 4NXNQ 1H9MA 5C4JH 1GUWA 2QA4A 3K8AA 2KHSA 4JV5L 2DN8A 3UE1A 4WJ3M 5IYCG 1S72A 1I4PA 1X3PA 3URYA 4KHZA 2NUCA 1ASYA 1B7YB 4A3EH 4RH6A 2EJMA 1Q1EA 4M8AA 1K28A 3KFUA 1D5ZC 1EIFA 1BBXC 1W2BA 2MHVA 1ESFA 1TS4A 2EXZA 3K7AB 4RGTA 1HRJA 3F2BA 2VY3A 2B63G 2LY7A 3W3AA 5TSSA 2NVXB 1UEBA 1LTTD 1LT4D 2UXCQ 2EDGA 1GJXA 3BZKA 1HZBA 1Z47A 3WOEA 3K57A 3MEFA 4JI7Q 5AJ3L 1MSHA 1SNCA 3MEHA 4O1NA 2PZWA 1BCPF 1Z9FA 1WTRA 4AQYQ 5C0XI 1E2ZA 4C2MH 2I0QA 4MN3A 3HOZB 2K14A 1AZPA 1I5FA 1PRTB 1VQHA 1EU4A 3KYHC 4P71A 5EQ0A 1WCMG 3K5MA 1E3PA 1N34Q 3NBIA 2F0DA 1HPCA 3NTIA 4DNIA 2Z6KA 3S2DB 5I6YA 3BVMA 2YTYA 3IFDA 1C7YA 2PNRC 2F1MA 3GD7A 1PDQA 3IFTA 4GN4B 1LO5D 3W1BA 1VQ5A 1IBLQ 1U4PA 1EOVA 2A6HD 2WAQB 1U4MA 1VF7A 3K7UC 4OHJA 2EZVA 1U0LA 2F52A 2HD3A 3KLSX 1CA6A 1N32Q 5M5XB 3M7GA 2WFWA 1N33L 2AQ3B 4POGA 1VQMA 5FLXE 3BDCA 2ZJPA 3HOXB 2F0IA 4DXGA 3M4YA 3FHWA 5I4DA 1RTNA 3PUYA 1MKHA 5KIXA 3VA5A 4DPGA 2Q2UA 4ABNA 4Y52H 1VF5C 1TKWB 4DV4Q 2FHTA 2F0OA 2R7ZH 4RA8A 1J8IA 1EYAA 5EPKA 4IUPA 4C3JG 1J5EL 1RL2A 2AHOB 3T4AC 2UXCL 1U5KA 4JOIC 2A69C 1XPOA 2KEEA 4ZRZA 2CW0D 2QKIC 2NYZD 3NWSA 2WB1E 1BVSA 3P20A 2C5CA 2KHIA 5LMNW 3GTPH 2EY6A 4B3TQ 4GLXA 4CKCA 5DM63 3G71A 2XWBB 3G6JB 4A3IB 4YIJA 3HOYB 4C3HG 1X3QA 3S14B 5M3MG 3PMFA 1LLRD 1EY4A 3N52A 4P73A 4IOCA 3BDOA 2LSSA 2G9DA 4ZCKA 1DXMA 1AP0A 5C0XJ 3OWEB 2QF7A 2K32A 1TVXA 4PZ8A 3UDGA 1BKBA 1YEZA 5C3WA 1RKNA 4F88A 3FPUB 4FNFA 3NK9A 1I3QH 4JI3Q 1F2LA 4KJOA 1CSQA 2EYHA 1KXLA 3T1YQ 3DMUA 2UUCL 1LV9A 2RDGA 3GV6A 4HR7B 5FLXc 3I56A 1OTCA 2J4XA 4HMIA 3RLNA 4CDFC 4J15A 3DM3A 3S1NB 1YHQA 4Y7NH 5LMNL 3TP8A 1LT6D 3PF5A 4E6IA 1GXDC 4C3IB 1D2BA 4OO1I 1V8QA 1K8GA 4PMCA 2ZJRA 2F0JA 3S1RB 3K5NA 1G2SA 5C0XG 4BBRH 1KC8C 1V1PB 2D62A 1GUSA 2F0NA 1XWEA 2NN6H 4DV7Q 1HZCA 5A2QE 4LF8Q 1Y8PB 2K6AA 4IFDI 4KKTA 3HOUB 3CCEA 1BBWA 3CQZH 1UE6A 2VQFQ 3VYSA 1XMQQ 3S2HH 3I91A 3SK5A 1SR3A 3G48A 3PIPA 1Y1WG 1AEXA 2EPBA 4BY7H 5IGBA 3SGIA 2RVLA 2F0VA 3D8GA 4IUUA 3U9SA 2HDLA 1STAA 4IN3A 1STHA 5JJIA 1JICA 3E9IA 3J81j 2KCNA 3HZXA 3T53B 1A3UA 2R92G 3PO3G 1N8RC 1D5MC 2BH8A 2E2DC 3SXHA 2MUYA 1GUOA 4KD3A 1TY2A 1EZ8A 3I70A 4B9WA 4A3JB 2JN4A 3NPPA 4YWMA 5KGUA 4DAPA 2MP1A 2K5WA 2WAQE 2NVTH 3K81C 1Q81C 5D65A 1HNZQ 2A1AA 3J7A5 2AKWB 1N9WA 2NVYH 4F87A 5HGQA 3BS1A 2I5LX 4DNTB 4BXXG 2R92H 2EY2A 5C4JB 1WTOA 4KTAA 2EXDA 3SK8A 3VR5A 2LXJA 5C5LA 3H3VI 1BOSA 1A62A 2K5NA 4KJNA 3ITPA 2Q8RE 3S1QH 4DR3Q 1RTOA 5EAYA 2Z4IA 4CJ2C 4FXDA 1MBYA 1EIYB 5I9PA 1V43A 5IGEA 1U4LA 3MA2B 5FKAC 2KBNA 1AFPA 4TQUS 1DYQA 4DV0Q 2DNEA 1RODA 2L11A 3LWUA 4BBSG 1B44D 1XMQL 1K3RA 5BN3A 2SNMA 1EWHA 1YNJC 2OQ0A 2UXDQ 1WTWA 5IGDA 3D4WA 5FOBB 4R1JA 4CHTB 5M3FB 1YIJA 5C3EH 2HHHL 3RUZA 4TRDA 4C2MB 5ELBA 3C1EA 3UDXA 1O7LA 3SR1A 3AFQA 5CV7A 2JE6I 2RDFA 3A7AB 1SYDA 1I6HB 4JI4L 2LXKA 2EJFC 1YNND 3O13A 4X65Q 3S16B 3V2TA 4FF1A 3R8BA 3Q22A 1VDZA 2ZT9C 1EIGA 3CW2C 2XTIA 2IJ0A 3E6ZX 1WD1A 2SDFA 1EUJA 3W5OA 3PO2G 4XQJA 3QIAA 1CKMA 4OO1G 2F0TA 1JT8A 3PIOA 3E9HA 4LJZC 1QWYA 2OTLA 2F0KA 4UP8A 5IYBH 3GTJH 4IUVA 3M3YH 5LL6S 4A93H 1BCPC 1FNWA 1F2ZA 2PO4A 1MSGA 1YHAA 2QILA 3VR3A 3CC2A 4L5SA 1T5XD 2EYMA 1GVPA 2WP8J 4EQ5A 4ID6A 4DV1Q 3TN2A 5C5MA 3Q6SA 1SEBD 5IGFA 3BVGA 1ICFB 1Q12A 5BR8Q 4A4IA 4OEMB 2ZXRA 1EIHA 1CSPA 4YHHL 4DR7Q 1Q46A 3EQLC 3KLSA 1QUQB 4UHVA 3QJYA 5K5PA 1H9SB 3KF8A 1J9OA 3NUCA 4HSPA 2YV5A 1PH2A 4R9WA 1TWCB 1KNAA 2HT1A 3M4QA 1QOHA 1KAWA 1HUMA 1GKHA 2E76C 2F0EA 4LAAA 4JI1L 5K36G 2E5LQ 5JEAH 3ER0A 1V1QA 3D31A 1JMCA 2OF1A 1D5XC 4FVMA 3K0XA 3P7JA 1AN8A 5EJWA 1EEID 5FO8B 1T5EA 2VUMB 1UWVA 1JJ2A 2Z4HA 3L2PA 3SK6A 5JAVA 4GZYC 1VQEA 4UY8C 1S4ZA 1EYGA 4GLAC 4A3FH 3M4PA 1XTCD 1D1KA 1VQFA 4O2DA 3BZDB 3HG9A 1SSOA 4RGOS 1AE3A 3E0JA 5H1SE 4KV6A 3SE0A 3HOZG 3MWYW 3GTKB 1E1OA 4A75A 3KF6A 3D4RA 5C4XH 3NBHB 3WDNA 3NHHA 3FDTA 4WJ4A 5ELFA 2L1BA 1VQ6A 1FNUA 1RF2D 4CBVA 4HIOA 3A5UA 1M90C 4DN4M 3RZOH 4HJ7A 1X56A 4BBRB 1LACA 1IBKQ 1B3AA 3BG3A 4JBJA 4I7AA 2JA8H 4HMJA 3MZ5A 1PTOB 1H9RA 3CXCA 4HEDA 1XMOL 2QGQA 3M9BA 2K03A 3CQZB 3T16A 3I4MB 3KBXA 2WKCA 1Z7TA 3T13A 3ULPA 1JJGA 4LFAQ 1G6ZA 4A3DB 4MTNA 1HZAA 1MHWC 3J7AF 3T1HL 1SJHD 1U9RA 4K5WA 4LF7Q 4HSVA 2Q2TA 1VQ8A 4N8X1 1LTGD 3CAMA 1ENCA 2Z6KC 2CWPA 3M4OB 1F9SA 1CFMA 2Z0SA 3VDYA 1R9TH 2LFNA 3I4OA 1PXUA 1I4HA 1IW7C 1JJCB 4I7ZC 4A76A 3JC66 1SYGA 2A6HC 2B8FA 1LT3D 2OT2A 4HCEA 3BU2A 1VQBA 4O0AA 5C4HA 4JI8Q 1E2WA 4NDXA 1I6VC 1PRTD 4OIJA 5IGGA 4A3IG 1BXTA 3F8TA 3HOYG 2BDNA 5ELNA 4IJHA 2K4KA 1CUKA 4JYAQ 3S1QB 3W1GA 1LTLA 2PQAB 5IE8A 1BR9A 1SFOH 2KQ3A 3E3XA 4DAVA 4JI6Q 4AH6A 1K0RA 2DY7A 2UUAL 4K2LA 2BH2A 4X66Q 1M4VA 3DEPA 1QVGA 1YZ6A 3P75A 4L6TB 4JC0A 2F0MA 3ND8A 3H09A 1VMCA 2JA6G 2JA9A 1TWFH 3A5ZB 3TS0A 1O7YA 2ZTEA 3BYTB 5IYDH 3FKIG 2MO0A 2NTSA 1TU2B 4LFAL 1Y1VH 3DEOA 3EBEA 4A3GG 2D0OA 2NB0A 3GO5A 5DM73 4NB3A 2QEXA 3I90A 3RLFA 1XPRA 1TWAB 5C3EB 3KK7A 4QY7A 4JV5Q 1QJOA 3OPOA 1SMYC 2UXBL 3VYUA 1WI5A 1JCKB 1GHJA 4A3BG 4KMUC 3PSIA 2RDHA 3FKIH 4DV2L 1IYVA 2BA1A 5HGTA 1M1KC 1KDCA 3U50C 1VQPA 2KCCA 1EQQA 1G8ZD 2EYJA 1PH8A 1VS0A 2A68D 2HCIA 3OOCA 1EYCA 3G4SA 1Y14B 2L5TA 2R61A 4LFBL 4A3BH 3TREA 4BA2I 4O42A 2B2WA 5AJ3Q 3QB3A 1Y8OB 4IURA 5CGKA 1EQRA 4EX5A 4A93B 1AZQA 4A3MB 1O7ZA 1H95A 5KNBA 3AEVA 4R8NA 4LUOA 3BVZA 4BY1B 4X66L 4R4OA 2R93H 4K8IA 4A3KB 2XN9C 3I72A 5ELDA 1GHKA 5C44H 2MQHA 3STBD 4EQNA 5KNCA 1SNDA 2BE5D 2F4VL 4A3JG 3QWNA 4APVA 3S1MB 1WVLA 2IW3A 1KLGD 5CR3A 3D0FA 3SVMA 1OXVA 3OSOA 4K2KA 1QCBD 1MJEA 3AB9A 3GTLH 1NUCA 4NXMQ 1FJGL 4DXFA 5EGTA 1EZ6A 2N3SA 4K5VA 1YBYA 1N33Q 1RIPA 4BS9A 1OO9B 1S5ED 3FPPA 1VQLA 1STYA 3WWVA 4ZUIA 4J6HA 2N55A 1XPUA 1PFMA 1V1PA 2ATWA 1X32A 3KDFB 2YYZA 4LK1C 1DM0B 2RHQB 5IYCH 3OIPA 1J5EQ 4QMGA 2SNSA 1MI2A 2MJ8A 5KYLA 4EGVA 4K14A 1SE8A 1TWHB 3AMUA 2JA7B 4X3SA 1WTVA 1EY6A 1UAPA 3JAML 1NMFA 5M3FG 2K52A 3NQTA 1LYLA 2CFMA 5IIFA 1K9MC 4LNQA 2AQ1B 4X64L 1ET6A 1FL0A 4C1NK 5COYA 2B63H 1SYCA 1JWUD 3VYRA 4KI0A 3CRKC 5C4XB 4KY5A 1CK1A 2ID0A 5F2DA 4FXKC 4RWSC 2CQAA 4GKJL 3CKIB 2E75C 4CDCC 3RZOB 3CC4A 3GTGB 1F9PA 3HKZB 1XXGA 2PW7A 2X69A 3CCLA 3KOJA 1HTPA 3M85A 5CV6A 2BA0A 3I55A 4NXML 1WCMH 1VQ7A 2UUCQ 3TZDA 2RCNA 3GTMH 1V9PA 5E1FA 5ELEA 1NMGA 4LF5L 2YTVA 3D6WA 2JQOA 1ONLA 4H7BA 2RA4A 4F7XA 5LMNQ 1YNNC 1CQFA 1STBA 2IHEA 4AYBB 4POFA 3MXGA 4GN5A 1RHPA 2CCZA 1B2TA 3ZJYC 1CHPD 2WINB 4HAEA 3DHQA 3LGJA 3P1HA 3IL8A 3RZDB 4LF6L 3NSWA 2JA5G 1Q7YC 1BCPB 2IL8A 2QW7A 1HHVA 4K8JA 1YVCA 2KEDA 1IKMA 3VYTA 4YWLA 3TRZA 4IQZA 4C3JH 2EY5A 2A8VA 3OIQA 4A3CG 1VQAA 3H0GB 3MXUA 4ZAIA 4J8QA 4GOPC 4FF4A 5IP7G 1B70B 2HCCA 4U68A 5J39A 3BZCA 1WFQA 2JA5H 1C4QA 3HEJA 2E74C 2NZOA 3PIP3 1I50B 1SXTA 2VUMG 1A63A 1AH9A 1SNOA 3NELA 4KY7A 4C3HH 5M3MH 1A2TA 1S5BD 3TDQA 2ES2A 1TWFB 1KAAA 3HOVB 4LUVA 2E2JB 2A19A 2JP1A 1Y1VB 4JBMA 4QJFA 1LTBD 1G6PA 1B3QA 5JPNC 1CZWA 3CPWA 1PVOA 3MXPA 4K5XA 3I3CA 5I6WA 1L0XB 1AE2A 3K5LA 4HJ9A 1IZ6A 3J80L 4JBKA 1K83B 1L1OC 2N78A 2LKVA 1LT5D 2AWOA 1YJ9A 3TP7A 3S15H 4V0BA 1JQYD 4NP5A 2Q2HA 2K01A 2QCPX 1WTPA 2J0TD 2G9HD 1QUQA 2EYOA 4B08A 2ASBA 1H9SA 2OQKA 5J1ZA 3I4MG 1B8AA 2GVAA 3GTOH 2OXPA 1JE5A 3MC0B 3FEWX 4A3DG 2PZTA 2IPKD 3DUZA 1DOLA 4DV3L 2KVMA 5C0XH 2DNCA 4N9TA 2HHHQ 1XYIA 2NVQH 1E7ZA 5I2YA 5M5YH 1FYCA 1P16A 1H9KA 3SHLA 5G3LD 4JI4Q 2R93B 2EOTA 3B6YA 1LTRD 3K58A 5D3DA 2JEAI 1DOMA 5JOBA 1GUTA 3OWFA 4ZQ3A 3L0OA 1Y1WH 3T51B 3GQBA 4LMQD 2ZJQA 4CJ0B 4RGNA 4ME3A 2B2UA 1A8VA 3HKZE 3C2PA 2O4XA 1K0SA 4HIMA 3I4NB 3X3NA 1T9HA 2Z9HA 2WACA 3EJIA 2L15A 3RR5A 2MGSA 1PH7A 3PO3H 2A6EC 1WTHA 5KNDA 4PV1C 1I4RA 2DUDA 1HR0W 3NBHA 3I7FA 1SNQA 1WJJA 1G291 4OXPA 2IX0A 3K0YA 4GNXB 4A3EB 3PIO3 1DGSA 5CBEE 2B3GA 5ELOA 1QB5D 3H3VC 3KLRA 3PUVA 1QZGA 3R3OA 1EY9A 1PTOD 4AYBE 3C3LA 4BXXH 1DZ1A 1HTLD 3H15A 1TQOA 5EPJA 1VQOA 3HRZC 2XRQD 1TT2A 5AFWA 3A7LA 2KENA 3QOJA 2B29A 4YHHQ 1Q90A 4OX9L 2B2VC 4PNYA 3Q0AA 4KK7A 1PRTC 5ISRA 1G2TA 4G7OC 4KHVA 5IWAL 4IUQA 4IFDJ 2B2TA 4BBSH 3DWQA 4JI1Q 1SRUA 4X3KA 4NPSA 2H4OA 4U673 1F2MA 1WOCA 3FVQA 4XYQA 2E8GA 5M5WH 5FK9C 1L2FA 2PI2E 4LW1A 1HR0L 2PYKA 1ILPA 4MTKA 1YITA 5L37A 2VQEL 2IHFA 3CPFA 2JEBI 2VZAA 3PCOB 1O78A 5JVG3 2EJGC 2WB1G 3I73A 2K05A 2XNAC 2KA7A 4XT1B 1WCMB 2MPMA 2M00A 2R3ZA 3K80C 3GTMB 3F1ZA 1VQGA 3IAYA 4OL7A 4DA2A 1I94L 1OXTA 2PQAA 4A3MG 2B2YA 1B50A 1TWGH 3CCRA 1JE4A 2A69D 4IFDG 1NNXA 5G3LF 3UI2A 5GADC 3GP7A 1UE7A 4BY1G 4IOAA 3PO2H 4JI2L 3ZYYX 2HQLA 5E7NA 5LHY1 1JWSD 3Q24A 4OO1H 4CGYB 2ENBA 4EQOA 2R7ZB 3BYYB 3CCQA 1J6QA 1EFID 3A8IE 1B1ZA 3Q23A 1HFGA 2F4IA 1IXRA 3WOFA 1PA6A 2OWOA 2A68C 4IFDH 1XTDA 1A15A 4H02A 1XMOQ 3HOWG 4L8JA 3U58A 2CH4W 3GTPB 5JJKA 2NBFA 1B9MA 2RQXA 1HFNA 1RD9D 1CHQD 1LTID 3J81L 3T1HQ 3S17H 4HJ8A 1SE3A 5FJ8G 2F0FA 2OEOA 1I4GA 4B3SL 4M1UB 5T1IA 5CV8A 4RHSA 3STBC 4CJ1B 1EY5A 2FMCA 2BE5C 2K28A 1VQJA 5K36H 5M3MB 4ZKBB 4IZ8A 3OW7A 1I3QB 4YY3L 4S3SA 3QR8A 4HIDA 3LWEA 4FP5D 1SNPA 1XNQL 3JAME 4Z9CB 3ULLA 2FINB 2X6LA 1TXYA 4H13C 3K7AH 1DOKA 1SE2A 3DWAA 1YI2A 3H3VH 2D0PA 1G51A 4KY6A 2NVXH 1XNRL 3NEMA 4DR1L 1KD1C 4Y7NB 4FF2A 2UUAQ 1IHZA 2AWNA 4PMBA 4DU9A 1EOTA 2L12A 1DJRD 1VQ4A 3RMHA 3E5SA 4DR2L 3FRPB 1ILQA 5IT9L 2XVSA 2ZM6L 3HOZH 1OXSC 3HKZG 1EWCA 4L5QA 2WAQG 5A35A 3D3RA 5FLMG 1RDPD 2PZUA 3S2HB 4DUZL 3NENA 3GTOB 4QB4A 5E4XA 4P75A 1JB7A 4G4KA 3S2DH 2AMCB 1NR4A 4BY7B 2K75A 1PYSB 1IKLA 1HXYD 5GAGC 3HOXG 2JYOA 2WKDA 1LTAD 2UXBQ 1K73C 5M5YB 1NTGA 1O80A 2LS01 3TP6A 1FNVA 4JI0L 3CMEA 3KDFA 5EKLA 2IX1A 1B9NA 4I65A 3A74A 2UUBL 5M5XH 1TS5A 4DUYL 2D5DA 4DV2Q 1CKNB 4ZUJA 4OGQC 1VQIA 2RBMA 5I2XA 2V4DA 3MFYA 1TS2A 4N8FA 1GOZA 2EIFA 2C35B 4IALA 4HCSA 3JAMc 2B8GA 2NVTB 1PZJD 1KDBA 1F2YA 2NVYB 4LFBQ 4C56C 1X65A 2R92B 4ME5A 1A0IA 3PO3B 1QNUA 4RMFA 4IUTA 3H0GG 5CBAE 3KJOA 4TVAB 1PZID 3NWTA 3CHBD 4XTCS 1KL9A 1KTKA 4DK0A 1I4QA 3CRLC 1YNJD 1QE6A 2Z1CA 2PMZB 1EQTA 4X6AH 1YJNA 1CZGA 2GVBA 4A3IH 4LF9L 3MFGA 2I5MX 3HOYH 2TMPA 2F4VQ 4AIMA 4GKKL 2CW0C 4RCOA 1A3VA 2K7VA 3AQQA 3N6RA 5D3IB 2JSOA 5LMUL 3HOVG 5EKKA 3MTSA 1K8AC 3OYYA 1QZHA 4ZKCB 1EY0A 3L3OC 4GOPB 1Y8NB 3CD6A 1FJGQ 3TBIB 5NUCA 3TSSA 1JOOA 2RSNA 3HS0C 3CCSA 3X3MA 1VCIA 2DJGC 2P5ZX 5IODA 2JA6H 3V05A 4C3IG 1Q8KA 4L5TA 4RFBA 1UE1A 3J80E 2EYPA 4A3GH 3H91A 5T1GA 4IPCA 2RF4A 1PYBA 1B4OA 2SEBD 3I2ZA 2I5HA 1BCPD 1BUVT 1HA5A 1HNXQ 3HOUG 3S1NH 2HQEA 2MO1A 4C3IH 4KHPL 1W3SA 1QILA 3CP0A 2B39A 5HURA 5EPLA 4FDBA 1PH3A 3GTJB 3M3YB 4XQQA 2PCFB 4IPHA 3S24A 2KUMA 1TWGB 2CHBD 2Z8LA 4X64Q 1L1OB 3HOUH 1SBBB 2PI2A 1NBWA 4WORA 2DY8A 2QDLA 2VXWA 5KEEA 4B3MQ 4P72A 4GKJQ 2F0PA 1YJWA 1ENAA 2BOSA 5CV4A 4P74A 2Y0SB 4EQPA 4GS3A 1PH5A 3G6EA 3I4NG 4DAYB 2FMMA 1E1TA 2K5HA 2UU9Q 3PGZA 2WIIB 2BDOA 1PRTF 1C9OA 1LTSD 4QIWB 4LF5Q 4XDXA 3C1FA 4A3JH 3J80c 3S17B 3C46A 1E24A 1SAPA 2BCOA 2KOLA 5GAHC 5EKIA 4FO2A 1IBML 2HUGA 4XYOA 2XGTA 2B2UC 1HNXL 3ND9A 3ONAB 3CCVA 3QOLA 5I9OA 1WYDA 3NP8A 4A3FB 1L0WA 4LF6Q 1FGBD 1PH9A 2NZHA 2K5VA 5JJLA 3OW2A 2YU9H 1CT1D 1BQQT 2I46A 2MNAA 4DR5L 2NN6I 4DR6Q 1KRSA 1PFSA 1CKOA 3EROA 1HNWQ 5CC4A 1WD0A 1W6KA 2L0CA 4KKSA
chains in the Genus database with same CATH topology
1Q12A 5IYDG 4PZ7A 5J3BA 5BR8Q 4DV3L 4A4IA 2PMZE 4B3ML 2HHHQ 5M3FH 2NVQH 1Y1VG 2RHSB 3AYHB 3RNUA 1E7ZA 2H5XA 1CSPA 4YHHL 1GD7A 3KLWA 1Q46A 1PH6A 1GM5A 4DR7Q 1I50H 1X6OA 2JJQA 5M5YH 1C0AA 4B3RL 1QUQB 2KCTA 1S40A 1P16A 5DLQE 4L5RC 1YNXA 3PV0A 3OTOL 1XJVA 1IBKL 2UU9L 4JI4Q 3B6YA 3MXNB 2YV5A 1PH2A 1NJIC 2ZTDA 4LF4L 1VQNA 2HT1A 4K0KL 2JEAI 3M4QA 3UDIA 1N36Q 4GLVB 1KAWA 1GKHA 3L0OA 3Q8DA 1Y1WH 4JI1L 3S16H 4LFCL 3TS2A 3HOVH 5K36G 2E2JH 2IT1A 2E5LQ 2ZJQA 4DKAC 3ER0A 1LUZA 1V1QA 3D31A 4ME3A 1JMCA 4DR4L 5IY0A 1A8VA 2IY5B 1X3GA 1X54A 3HKZE 3K0XA 4HIMA 3F2CA 4GNXA 1IBMQ 2VNUD 5GROA 4UP7A 1T9HA 4DV6L 3KF8B 4LF7L 1UWVA 1JJ2A 4JI5L 3L2PA 2L15A 3RR5A 1VQEA 4UY8C 4DAMA 1PH7A 3PO3H 1X3EA 4NXNL 1SN8A 1EFWA 1EYGA 2R7ZG 1VQDA 4YCWA 4GLAC 4A3FH 2DUDA 3M4PA 1HR0W 3J7ZC 1K83H 1EWIA 3I7FA 3S1RH 1VQFA 1WJJA 1G291 4OXPA 2IX0A 3PUWA 4GNXB 4O2DA 4LUZA 1DGSA 1LM0A 2VL6A 4DR5Q 2B3GA 5ELOA 3PUVA 4KLKA 2OTJA 1AE3A 1QZGA 5H1SE 4JYAQ 4AYBE 3HOZG 4BXXH 1X3FA 1E1OA 2R93G 3H15A 3EIVA 4A75A 1QVCA 1FGUA 3KF6A 4JI8L 5C4XH 1VQOA 4DR6L 3NBHB 5C44G 3CCMA 4WJ4A 4R4CA 1VQ6A 4DV3Q 1OXUA 2KENA 1HNWL 5IP9G 4HIOA 2E2HH 2B29A 3HKSA 4YHHQ 3A5UA 1X9NA 1M90C 3PF4A 4JYAL 3CCUA 2PNHA 4JBWA 4OX9L 2R7DA 4HJ7A 3RZOH 4B3RQ 1X56A 4JI7L 4JI6L 3OTOQ 1IBKQ 4JBJA 2JA8H 1SLJA 3CXCA 4K0KQ 4AQYL 1XMOL 5IWAL 2QGQA 4GN3B 1ASZA 3KF6B 1TWCH 3M9BA 4IFDJ 4BBSH 4OWWB 3JAMi 4JI1Q 4LFCQ 4A3CH 1SRUA 4DR4Q 3KJPA 2Y0SE 3ULPA 4PMWA 1JJGA 4LFAQ 4NPSA 4DK3C 5IP9H 5IP7H 1SROA 1N36L 4MTNA 1HZAA 1WOCA 2E8GA 1N34L 3T1HL 1PV4A 3HFZB 5M5WH 4DV6Q 3I4NH 1L2FA 2PI2E 4LW1A 4YCVA 1HR0L 4A3EG 1YHBA 2EQSA 4LF7Q 2ZTCA 4JI5Q 1S3OA 2Q2TA 1YITA 3CF5A 1KHIA 2VQEL 1VQ8A 2VUMH 2IHFA 3CPFA 3EN2A 2JEBI 4R4IA 5GQOA 2VZAA 3PCOB 1IYJB 4NXNQ 5C4JH 3A0JA 2WB1G 3CAMA 4QIWE 2Z6KC 3K8AA 2QA4A 2YTXA 2CWPA 4HIKA 4JV5L 1IBLL 3UE1A 4WJ3M 5IYCG 1S72A 2Z0SA 4KHZA 3VDYA 1ASYA 1R9TH 3I4OA 3K80C 4RG1A 1JJCB 1N32L 3F1ZA 1VQGA 1B7YB 2GN5A 1I94L 4A3EH 1OXTA 4A76A 2PQAA 4A3MG 3JC66 1Q1EA 3KFUA 1TWGH 3CCRA 4BBRG 1EIFA 1W2BA 4IFDG 2NN6G 5GADC 3BU2A 4BY1G 1UE7A 1VQBA 4JCVE 4O0AA 3GTKH 3PO2H 3RN5A 2CKZB 4IOAA 4JI8Q 4JI2L 2HQLA 5E7NA 3F2BA 2VY3A 2B63G 4A3IG 1UEBA 3F8TA 2UXCQ 3HOYG 2KHJA 5ELNA 3CCQA 1J6QA 4IJHA 4DV4L 2K4KA 1CUKA 4IO9A 1Q1BA 3BZKA 4OONA 3U4ZA 1HZBA 1Z47A 1IXRA 3J81c 4OX9Q 3W1GA 1LTLA 2PQAB 5IE8A 3MEFA 1SFOH 1PA6A 4JI7Q 5AJ3L 3DLLA 2OWOA 4JI6Q 4AH6A 1K0RA 2UUAL 4BY7G 2BH2A 1MJCA 1Z9FA 2N8NA 4X66Q 1XTDA 1QVGA 4H02A 5C0XI 3AFPA 5IWAQ 4AQYQ 1XMOQ 1QVFA 4C2MH 1YZ6A 2I0QA 3HOWG 3U58A 1D8LA 2K14A 1I5FA 5JJKA 3RLOA 4OWTB 3I4MH 4JC0A 1VQHA 1PHJA 4B3TL 3KYHC 3TQYA 4P71A 2JA6G 1WCMG 2Q2IA 2JA9A 1E3PA 4YWKA 3T1HQ 1TWFH 3A5ZB 4BA1I 3TS0A 1N34Q 3S17H 4HJ8A 1HR0Q 2ZTEA 5IYDH 4DNIA 2Z6KA 3FKIG 2MO0A 4LFAL 4A3GG 1Y1VH 5FJ8G 3EBEA 2VQEQ 2D0OA 3GO5A 2YTYA 1C7YA 4B3SL 4NB3A 3GD7A 2QEXA 3L7ZC 3RLFA 4DV5Q 1XPRA 4GN4B 3W1BA 2F3IA 5HY6A 3M7NA 4QY7A 1VQ5A 4JV5Q 3STBC 1IBLQ 1EOVA 2CQOA 3M4OH 3I4NG 3K7UC 2UXBL 1U0LA 1WI5A 1D7QA 1VQJA 2F52A 1N32Q 1UE5A 4A3BG 3IRBA 3PSIA 1I94Q 3FKIH 4YY3L 2WFWA 4DV2L 1N33L 1KQSA 4POGA 2BA1A 4JI3L 4HIDA 3CMAA 1VQMA 1M1KC 1XNQL 2ZJPA 3U50C 1VQPA 3T1YL 3BJUA 1EQQA 3ULLA 3FHWA 3PUYA 4JI2Q 1TXYA 1MKHA 4DPGA 3K7AH 1PH8A 2Q2UA 5IT9c 4LWCA 1VS0A 1YI2A 3FP9A 3H3VH 4Y52H 2D0PA 1G51A 3G4SA 4R4TA 2NVXH 1Y14B 4XIGS 4DV4Q 1XNRL 2R7ZH 3NEMA 4DR1L 4LFBL 3TEHB 1KD1C 4A3BH 4QQBX 3TREA 4BA2I 5AJ3Q 2K50A 1J5EL 2UUAQ 1RL2A 2AHOB 2UXCL 1U5KA 4JOIC 1EQRA 2AWNA 1XPOA 4EX5A 3GDEA 3CC7A 1VQ4A 1H95A 3AEVA 4DR2L 1VQKA 2WB1E 4LUOA 1BVSA 5C3EG 3J80i 2ZM6L 4HJAA 3HOZH 1OXSC 2KHIA 3HKZG 5LMNW 4X66L 3GTPH 1NE3A 4R4OA 4B3TQ 2R93H 2VW9A 4L5QA 4X62Q 4DV7L 4LF8L 2WAQG 4GLXA 3G71A 5FLMG 2R7FA 5C44H 3RN2A 2MQHA 3STBD 5M3MG 2VQFL 1MIUA 4DUZL 3NENA 4P75A 1JB7A 4P73A 1CKNA 2F4VL 4B3SQ 4A3JG 3S2DH 2AMCB 4APVA 4IOCA 1FVIA 2DGYA 2K75A 2LSSA 1HH2P 1TWAH 1PYSB 3D0FA 3HOXG 5GAGC 1OXVA 1MJEA 5C0XJ 3GTLH 1K73C 2UXBQ 1NTGA 4NXMQ 4JG2A 4DV5L 1FJGL 4PZ8A 3UDGA 3CMEA 4JI0L 1BKBA 3KDFA 1YEZA 2N3SA 2IX1A 3A74A 4YY3Q 5M5XH 4DUYL 2UUBL 4DV2Q 1YBYA 1CKNB 1N33Q 1I3QH 1RIPA 4JI3Q 1VQIA 1CSQA 1KXLA 1XNQQ 5IYBG 1NY4A 4UPAA 3T1YQ 1VQLA 3F2DA 2UUCL 4A93G 3WWVA 2EIFA 2C35B 5FLXc 3I56A 4PZ6A 3JAMc 1XPUA 5JEAJ 4HJ5A 1OTCA 2HIXA 1XNRQ 4JOIA 3RLNA 2ATWA 3KDFB 4UP9A 4DR1Q 4LFBQ 4IPDA 1HNZL 4J15A 4A3KG 4PG3A 1X65A 2YYZA 3DM3A 2RHQB 5IYCH 1J5EQ 1YHQA 4Y7NH 1A0IA 5LMNL 3PF5A 3GTQH 4QL5A 4OO1I 4RMFA 1X55A 3H0GG 3KJOA 4TVAB 1P8LA 4XTCS 1KL9A 1SE8A 1K8GA 2ZJRA 4DR2Q 4MNOA 4A3MH 2Y0SG 4DR3L 2ZM6Q 5C0XG 4BBRH 1KC8C 2D62A 1NMFA 5M3FG 2K52A 4BY1H 4DV7Q 1HZCA 1LYLA 2CFMA 4LF8Q 4GOPA 1K9MC 4X6AH 1YJNA 4LNQA 4IFDI 4A3KH 2GVBA 3CCEA 4X64L 1BBWA 3CQZH 1FL0A 1UE6A 2B63H 4A3IH 4LF9L 2VQFQ 2I5MX 1XMQQ 4DUZQ 3HOYH 1IL2A 3ERSX 4KI0A 4X62L 3S2HH 2F4VQ 4AIMA 4GKKL 4DV0L 1SR3A 1I6HH 3G48A 3PIPA 3AQQA 1Y1WG 4YCUA 2ID0A 5LMUL 3HOVG 1K8AC 3OYYA 4BY7H 5JEAG 3S1MH 2JK8A 1QZHA 3SGIA 4GKJL 4GOPB 3HOWH 3CD6A 1FJGQ 3CC4A 2UXDL 2V1CC 2E2IH 3CCSA 4JI0Q 5JJIA 1BBUA 3E9IA 3J81j 2UUBQ 3CCLA 3KOJA 1VCIA 4DUYQ 2R92G 3M85A 2BA0A 3I55A 4NXML 2JA6H 1WCMH 3PO3G 1N8RC 1Q8KA 2BH8A 4L5TA 1Q82C 1VQ7A 2UUCQ 1UE1A 2RCNA 4A3FG 3GTMH 2FXQA 1V9PA 4A3GH 2HIVA 1NMGA 5FJ8H 2JA7G 4IPCA 4YWMA 4LF5L 2RF4A 2YTVA 1PYBA 4X65L 4OWXB 2JQOA 2VS1A 1KRTA 3I2ZA 2I5HA 2WAQE 2NVTH 3K81C 2R6GA 1Q81C 1HNZQ 2A1AA 3J7A5 2AKWB 1N9WA 1HNXQ 2NVYH 5HGQA 2I5LX 5LMNQ 1L1OA 3HOUG 4BXXG 2R92H 3S1NH 1E22A 2MO1A 4ALPA 2EXDA 2IHEA 2LXJA 4C3IH 4POFA 3H3VI 4KHPL 1A62A 2K5NA 1W3SA 4GN5A 3CP0A 2CCZA 5C4XG 3S1QH 3ZJYC 4MZ9A 4DR3Q 1TWHH 4FDBA 5EAYA 1PH3A 2JA7H 3LGJA 4IPHA 3ICEA 1EIYB 4A3LG 4LF6L 1SMXA 3S24A 2JA5G 5GAEC 4X64Q 1V43A 1Q7YC 1L1OB 4LF9Q 3HOUH 2JA8G 2CWAA 1YVCA 2KBNA 2PI2A 4YWLA 1O7IA 4GKKQ 4TQUS 3TRZA 1NBWA 4DV0Q 4A3DH 4C3JH 4BBSG 5LMUQ 4DV1L 2A8VA 4A3CG 1VQAA 1HJPA 1XMQL 1K3RA 4B3MQ 4P72A 4GKJQ 4GOPC 4QGUA 5IP7G 1B70B 1YJWA 4P74A 2OQ0A 4A3LH 2UXDQ 3UDFA 3BZCA 1WFQA 4GS3A 1PH5A 2JA5H 3G6EA 4R1JA 1YIJA 3U4VA 3GTGH 5C3EH 4DAYB 5BR8L 1Q86C 1E1TA 2K5HA 2UU9Q 2HHHL 3PGZA 2NZOA 4LF4Q 2VUMG 1A63A 1OXXK 4DR7L 1AH9A 3UDXA 3AFQA 3NELA 1VQ9A 5FLMH 2JE6I 4C3HH 4AYBG 1C9OA 5M3MH 4JI4L 2LXKA 2MFIA 4LF5Q 1PH1A 2ES2A 1GO3E 4A3JH 4X65Q 2OCEA 3J80c 1VQCA 4R4QA 4LUVA 3CCJA 2A19A 1E24A 3ULJA 2E5LL 3HOXH 5GAHC 4JBMA 4QJFA 2N49A 1G6PA 3CW2C 3UE0A 3J81i 2XTIA 3PUXA 1IBML 3CPWA 1PVOA 4KHPQ 3PO2G 1EUJA 3W5OA 2XGTA 1HNXL 1CKMA 4OO1G 1JT8A 1AE2A 3PIOA 3CCVA 4GNXC 3E9HA 4HJ9A 1IZ6A 1WYDA 4JBKA 2OTLA 4UP8A 1KIXA 5IYBH 3GTJH 1L0WA 3M3YH 1HZ9A 4A93H 4LF6Q 1L1OC 2N78A 4IJLA 3RZDH 2AWOA 2NZHA 1YJ9A 2K5VA 1PH9A 1PH4A 1YHAA 3CC2A 3OW2A 2Q2HA 4L5SA 3S15H 5JJLA 2YU9H 4IPGA 2MNAA 1GVPA 4DR5L 2KCMA 2NN6I 2WP8J 4EQ5A 4DR6Q 1KRSA 1QUQA 4DV1Q 2ASBA 2OQKA 1PFSA 1CKOA 2ALYB 3I4MG 3S14H 1B8AA 3H0GH 3PUZA 1HNWQ 3E0EA 2GVAA 3GTOH 1JE5A 4DK6C 4A3DG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q12 A;  5IYD G;  4PZ7 A;  5J3B A;  5BR8 Q;  4DV3 L;  4A4I A;  2PMZ E;  4B3M L;  2HHH Q;  5M3F H;  2NVQ H;  1Y1V G;  2RHS B;  3AYH B;  3RNU A;  1E7Z A;  2H5X A;  1CSP A;  4YHH L;  1GD7 A;  3KLW A;  1Q46 A;  1PH6 A;  1GM5 A;  4DR7 Q;  1I50 H;  1X6O A;  2JJQ A;  5M5Y H;  1C0A A;  4B3R L;  1QUQ B;  2KCT A;  1S40 A;  1P16 A;  5DLQ E;  4L5R C;  1YNX A;  3PV0 A;  3OTO L;  1XJV A;  1IBK L;  2UU9 L;  4JI4 Q;  3B6Y A;  3MXN B;  2YV5 A;  1PH2 A;  1NJI C;  2ZTD A;  4LF4 L;  1VQN A;  2HT1 A;  4K0K L;  2JEA I;  3M4Q A;  3UDI A;  1N36 Q;  4GLV B;  1KAW A;  1GKH A;  3L0O A;  3Q8D A;  1Y1W H;  4JI1 L;  3S16 H;  4LFC L;  3TS2 A;  3HOV H;  5K36 G;  2E2J H;  2IT1 A;  2E5L Q;  2ZJQ A;  4DKA C;  3ER0 A;  1LUZ A;  1V1Q A;  3D31 A;  4ME3 A;  1JMC A;  4DR4 L;  5IY0 A;  1A8V A;  2IY5 B;  1X3G A;  1X54 A;  3HKZ E;  3K0X A;  4HIM A;  3F2C A;  4GNX A;  1IBM Q;  2VNU D;  5GRO A;  4UP7 A;  1T9H A;  4DV6 L;  3KF8 B;  4LF7 L;  1UWV A;  1JJ2 A;  4JI5 L;  3L2P A;  2L15 A;  3RR5 A;  1VQE A;  4UY8 C;  4DAM A;  1PH7 A;  3PO3 H;  1X3E A;  4NXN L;  1SN8 A;  1EFW A;  1EYG A;  2R7Z G;  1VQD A;  4YCW A;  4GLA C;  4A3F H;  2DUD A;  3M4P A;  1HR0 W;  3J7Z C;  1K83 H;  1EWI A;  3I7F A;  3S1R H;  1VQF A;  1WJJ A;  1G29 1;  4OXP A;  2IX0 A;  3PUW A;  4GNX B;  4O2D A;  4LUZ A;  1DGS A;  1LM0 A;  2VL6 A;  4DR5 Q;  2B3G A;  5ELO A;  3PUV A;  4KLK A;  2OTJ A;  1AE3 A;  1QZG A;  5H1S E;  4JYA Q;  4AYB E;  3HOZ G;  4BXX H;  1X3F A;  1E1O A;  2R93 G;  3H15 A;  3EIV A;  4A75 A;  1QVC A;  1FGU A;  3KF6 A;  4JI8 L;  5C4X H;  1VQO A;  4DR6 L;  3NBH B;  5C44 G;  3CCM A;  4WJ4 A;  4R4C A;  1VQ6 A;  4DV3 Q;  1OXU A;  2KEN A;  1HNW L;  5IP9 G;  4HIO A;  2E2H H;  2B29 A;  3HKS A;  4YHH Q;  3A5U A;  1X9N A;  1M90 C;  3PF4 A;  4JYA L;  3CCU A;  2PNH A;  4JBW A;  4OX9 L;  2R7D A;  4HJ7 A;  3RZO H;  4B3R Q;  1X56 A;  4JI7 L;  4JI6 L;  3OTO Q;  1IBK Q;  4JBJ A;  2JA8 H;  1SLJ A;  3CXC A;  4K0K Q;  4AQY L;  1XMO L;  5IWA L;  2QGQ A;  4GN3 B;  1ASZ A;  3KF6 B;  1TWC H;  3M9B A;  4IFD J;  4BBS H;  4OWW B;  3JAM i;  4JI1 Q;  4LFC Q;  4A3C H;  1SRU A;  4DR4 Q;  3KJP A;  2Y0S E;  3ULP A;  4PMW A;  1JJG A;  4LFA Q;  4NPS A;  4DK3 C;  5IP9 H;  5IP7 H;  1SRO A;  1N36 L;  4MTN A;  1HZA A;  1WOC A;  2E8G A;  1N34 L;  3T1H L;  1PV4 A;  3HFZ B;  5M5W H;  4DV6 Q;  3I4N H;  1L2F A;  2PI2 E;  4LW1 A;  4YCV A;  1HR0 L;  4A3E G;  1YHB A;  2EQS A;  4LF7 Q;  2ZTC A;  4JI5 Q;  1S3O A;  2Q2T A;  1YIT A;  3CF5 A;  1KHI A;  2VQE L;  1VQ8 A;  2VUM H;  2IHF A;  3CPF A;  3EN2 A;  2JEB I;  4R4I A;  5GQO A;  2VZA A;  3PCO B;  1IYJ B;  4NXN Q;  5C4J H;  3A0J A;  2WB1 G;  3CAM A;  4QIW E;  2Z6K C;  3K8A A;  2QA4 A;  2YTX A;  2CWP A;  4HIK A;  4JV5 L;  1IBL L;  3UE1 A;  4WJ3 M;  5IYC G;  1S72 A;  2Z0S A;  4KHZ A;  3VDY A;  1ASY A;  1R9T H;  3I4O A;  3K80 C;  4RG1 A;  1JJC B;  1N32 L;  3F1Z A;  1VQG A;  1B7Y B;  2GN5 A;  1I94 L;  4A3E H;  1OXT A;  4A76 A;  2PQA A;  4A3M G;  3JC6 6;  1Q1E A;  3KFU A;  1TWG H;  3CCR A;  4BBR G;  1EIF A;  1W2B A;  4IFD G;  2NN6 G;  5GAD C;  3BU2 A;  4BY1 G;  1UE7 A;  1VQB A;  4JCV E;  4O0A A;  3GTK H;  3PO2 H;  3RN5 A;  2CKZ B;  4IOA A;  4JI8 Q;  4JI2 L;  2HQL A;  5E7N A;  3F2B A;  2VY3 A;  2B63 G;  4A3I G;  1UEB A;  3F8T A;  2UXC Q;  3HOY G;  2KHJ A;  5ELN A;  3CCQ A;  1J6Q A;  4IJH A;  4DV4 L;  2K4K A;  1CUK A;  4IO9 A;  1Q1B A;  3BZK A;  4OON A;  3U4Z A;  1HZB A;  1Z47 A;  1IXR A;  3J81 c;  4OX9 Q;  3W1G A;  1LTL A;  2PQA B;  5IE8 A;  3MEF A;  1SFO H;  1PA6 A;  4JI7 Q;  5AJ3 L;  3DLL A;  2OWO A;  4JI6 Q;  4AH6 A;  1K0R A;  2UUA L;  4BY7 G;  2BH2 A;  1MJC A;  1Z9F A;  2N8N A;  4X66 Q;  1XTD A;  1QVG A;  4H02 A;  5C0X I;  3AFP A;  5IWA Q;  4AQY Q;  1XMO Q;  1QVF A;  4C2M H;  1YZ6 A;  2I0Q A;  3HOW G;  3U58 A;  1D8L A;  2K14 A;  1I5F A;  5JJK A;  3RLO A;  4OWT B;  3I4M H;  4JC0 A;  1VQH A;  1PHJ A;  4B3T L;  3KYH C;  3TQY A;  4P71 A;  2JA6 G;  1WCM G;  2Q2I A;  2JA9 A;  1E3P A;  4YWK A;  3T1H Q;  1TWF H;  3A5Z B;  4BA1 I;  3TS0 A;  1N34 Q;  3S17 H;  4HJ8 A;  1HR0 Q;  2ZTE A;  5IYD H;  4DNI A;  2Z6K A;  3FKI G;  2MO0 A;  4LFA L;  4A3G G;  1Y1V H;  5FJ8 G;  3EBE A;  2VQE Q;  2D0O A;  3GO5 A;  2YTY A;  1C7Y A;  4B3S L;  4NB3 A;  3GD7 A;  2QEX A;  3L7Z C;  3RLF A;  4DV5 Q;  1XPR A;  4GN4 B;  3W1B A;  2F3I A;  5HY6 A;  3M7N A;  4QY7 A;  1VQ5 A;  4JV5 Q;  3STB C;  1IBL Q;  1EOV A;  2CQO A;  3M4O H;  3I4N G;  3K7U C;  2UXB L;  1U0L A;  1WI5 A;  1D7Q A;  1VQJ A;  2F52 A;  1N32 Q;  1UE5 A;  4A3B G;  3IRB A;  3PSI A;  1I94 Q;  3FKI H;  4YY3 L;  2WFW A;  4DV2 L;  1N33 L;  1KQS A;  4POG A;  2BA1 A;  4JI3 L;  4HID A;  3CMA A;  1VQM A;  1M1K C;  1XNQ L;  2ZJP A;  3U50 C;  1VQP A;  3T1Y L;  3BJU A;  1EQQ A;  3ULL A;  3FHW A;  3PUY A;  4JI2 Q;  1TXY A;  1MKH A;  4DPG A;  3K7A H;  1PH8 A;  2Q2U A;  5IT9 c;  4LWC A;  1VS0 A;  1YI2 A;  3FP9 A;  3H3V H;  4Y52 H;  2D0P A;  1G51 A;  3G4S A;  4R4T A;  2NVX H;  1Y14 B;  4XIG S;  4DV4 Q;  1XNR L;  2R7Z H;  3NEM A;  4DR1 L;  4LFB L;  3TEH B;  1KD1 C;  4A3B H;  4QQB X;  3TRE A;  4BA2 I;  5AJ3 Q;  2K50 A;  1J5E L;  2UUA Q;  1RL2 A;  2AHO B;  2UXC L;  1U5K A;  4JOI C;  1EQR A;  2AWN A;  1XPO A;  4EX5 A;  3GDE A;  3CC7 A;  1VQ4 A;  1H95 A;  3AEV A;  4DR2 L;  1VQK A;  2WB1 E;  4LUO A;  1BVS A;  5C3E G;  3J80 i;  2ZM6 L;  4HJA A;  3HOZ H;  1OXS C;  2KHI A;  3HKZ G;  5LMN W;  4X66 L;  3GTP H;  1NE3 A;  4R4O A;  4B3T Q;  2R93 H;  2VW9 A;  4L5Q A;  4X62 Q;  4DV7 L;  4LF8 L;  2WAQ G;  4GLX A;  3G71 A;  5FLM G;  2R7F A;  5C44 H;  3RN2 A;  2MQH A;  3STB D;  5M3M G;  2VQF L;  1MIU A;  4DUZ L;  3NEN A;  4P75 A;  1JB7 A;  4P73 A;  1CKN A;  2F4V L;  4B3S Q;  4A3J G;  3S2D H;  2AMC B;  4APV A;  4IOC A;  1FVI A;  2DGY A;  2K75 A;  2LSS A;  1HH2 P;  1TWA H;  1PYS B;  3D0F A;  3HOX G;  5GAG C;  1OXV A;  1MJE A;  5C0X J;  3GTL H;  1K73 C;  2UXB Q;  1NTG A;  4NXM Q;  4JG2 A;  4DV5 L;  1FJG L;  4PZ8 A;  3UDG A;  3CME A;  4JI0 L;  1BKB A;  3KDF A;  1YEZ A;  2N3S A;  2IX1 A;  3A74 A;  4YY3 Q;  5M5X H;  4DUY L;  2UUB L;  4DV2 Q;  1YBY A;  1CKN B;  1N33 Q;  1I3Q H;  1RIP A;  4JI3 Q;  1VQI A;  1CSQ A;  1KXL A;  1XNQ Q;  5IYB G;  1NY4 A;  4UPA A;  3T1Y Q;  1VQL A;  3F2D A;  2UUC L;  4A93 G;  3WWV A;  2EIF A;  2C35 B;  5FLX c;  3I56 A;  4PZ6 A;  3JAM c;  1XPU A;  5JEA J;  4HJ5 A;  1OTC A;  2HIX A;  1XNR Q;  4JOI A;  3RLN A;  2ATW A;  3KDF B;  4UP9 A;  4DR1 Q;  4LFB Q;  4IPD A;  1HNZ L;  4J15 A;  4A3K G;  4PG3 A;  1X65 A;  2YYZ A;  3DM3 A;  2RHQ B;  5IYC H;  1J5E Q;  1YHQ A;  4Y7N H;  1A0I A;  5LMN L;  3PF5 A;  3GTQ H;  4QL5 A;  4OO1 I;  4RMF A;  1X55 A;  3H0G G;  3KJO A;  4TVA B;  1P8L A;  4XTC S;  1KL9 A;  1SE8 A;  1K8G A;  2ZJR A;  4DR2 Q;  4MNO A;  4A3M H;  2Y0S G;  4DR3 L;  2ZM6 Q;  5C0X G;  4BBR H;  1KC8 C;  2D62 A;  1NMF A;  5M3F G;  2K52 A;  4BY1 H;  4DV7 Q;  1HZC A;  1LYL A;  2CFM A;  4LF8 Q;  4GOP A;  1K9M C;  4X6A H;  1YJN A;  4LNQ A;  4IFD I;  4A3K H;  2GVB A;  3CCE A;  4X64 L;  1BBW A;  3CQZ H;  1FL0 A;  1UE6 A;  2B63 H;  4A3I H;  4LF9 L;  2VQF Q;  2I5M X;  1XMQ Q;  4DUZ Q;  3HOY H;  1IL2 A;  3ERS X;  4KI0 A;  4X62 L;  3S2H H;  2F4V Q;  4AIM A;  4GKK L;  4DV0 L;  1SR3 A;  1I6H H;  3G48 A;  3PIP A;  3AQQ A;  1Y1W G;  4YCU A;  2ID0 A;  5LMU L;  3HOV G;  1K8A C;  3OYY A;  4BY7 H;  5JEA G;  3S1M H;  2JK8 A;  1QZH A;  3SGI A;  4GKJ L;  4GOP B;  3HOW H;  3CD6 A;  1FJG Q;  3CC4 A;  2UXD L;  2V1C C;  2E2I H;  3CCS A;  4JI0 Q;  5JJI A;  1BBU A;  3E9I A;  3J81 j;  2UUB Q;  3CCL A;  3KOJ A;  1VCI A;  4DUY Q;  2R92 G;  3M85 A;  2BA0 A;  3I55 A;  4NXM L;  2JA6 H;  1WCM H;  3PO3 G;  1N8R C;  1Q8K A;  2BH8 A;  4L5T A;  1Q82 C;  1VQ7 A;  2UUC Q;  1UE1 A;  2RCN A;  4A3F G;  3GTM H;  2FXQ A;  1V9P A;  4A3G H;  2HIV A;  1NMG A;  5FJ8 H;  2JA7 G;  4IPC A;  4YWM A;  4LF5 L;  2RF4 A;  2YTV A;  1PYB A;  4X65 L;  4OWX B;  2JQO A;  2VS1 A;  1KRT A;  3I2Z A;  2I5H A;  2WAQ E;  2NVT H;  3K81 C;  2R6G A;  1Q81 C;  1HNZ Q;  2A1A A;  3J7A 5;  2AKW B;  1N9W A;  1HNX Q;  2NVY H;  5HGQ A;  2I5L X;  5LMN Q;  1L1O A;  3HOU G;  4BXX G;  2R92 H;  3S1N H;  1E22 A;  2MO1 A;  4ALP A;  2EXD A;  2IHE A;  2LXJ A;  4C3I H;  4POF A;  3H3V I;  4KHP L;  1A62 A;  2K5N A;  1W3S A;  4GN5 A;  3CP0 A;  2CCZ A;  5C4X G;  3S1Q H;  3ZJY C;  4MZ9 A;  4DR3 Q;  1TWH H;  4FDB A;  5EAY A;  1PH3 A;  2JA7 H;  3LGJ A;  4IPH A;  3ICE A;  1EIY B;  4A3L G;  4LF6 L;  1SMX A;  3S24 A;  2JA5 G;  5GAE C;  4X64 Q;  1V43 A;  1Q7Y C;  1L1O B;  4LF9 Q;  3HOU H;  2JA8 G;  2CWA A;  1YVC A;  2KBN A;  2PI2 A;  4YWL A;  1O7I A;  4GKK Q;  4TQU S;  3TRZ A;  1NBW A;  4DV0 Q;  4A3D H;  4C3J H;  4BBS G;  5LMU Q;  4DV1 L;  2A8V A;  4A3C G;  1VQA A;  1HJP A;  1XMQ L;  1K3R A;  4B3M Q;  4P72 A;  4GKJ Q;  4GOP C;  4QGU A;  5IP7 G;  1B70 B;  1YJW A;  4P74 A;  2OQ0 A;  4A3L H;  2UXD Q;  3UDF A;  3BZC A;  1WFQ A;  4GS3 A;  1PH5 A;  2JA5 H;  3G6E A;  4R1J A;  1YIJ A;  3U4V A;  3GTG H;  5C3E H;  4DAY B;  5BR8 L;  1Q86 C;  1E1T A;  2K5H A;  2UU9 Q;  2HHH L;  3PGZ A;  2NZO A;  4LF4 Q;  2VUM G;  1A63 A;  1OXX K;  4DR7 L;  1AH9 A;  3UDX A;  3AFQ A;  3NEL A;  1VQ9 A;  5FLM H;  2JE6 I;  4C3H H;  4AYB G;  1C9O A;  5M3M H;  4JI4 L;  2LXK A;  2MFI A;  4LF5 Q;  1PH1 A;  2ES2 A;  1GO3 E;  4A3J H;  4X65 Q;  2OCE A;  3J80 c;  1VQC A;  4R4Q A;  4LUV A;  3CCJ A;  2A19 A;  1E24 A;  3ULJ A;  2E5L L;  3HOX H;  5GAH C;  4JBM A;  4QJF A;  2N49 A;  1G6P A;  3CW2 C;  3UE0 A;  3J81 i;  2XTI A;  3PUX A;  1IBM L;  3CPW A;  1PVO A;  4KHP Q;  3PO2 G;  1EUJ A;  3W5O A;  2XGT A;  1HNX L;  1CKM A;  4OO1 G;  1JT8 A;  1AE2 A;  3PIO A;  3CCV A;  4GNX C;  3E9H A;  4HJ9 A;  1IZ6 A;  1WYD A;  4JBK A;  2OTL A;  4UP8 A;  1KIX A;  5IYB H;  3GTJ H;  1L0W A;  3M3Y H;  1HZ9 A;  4A93 H;  4LF6 Q;  1L1O C;  2N78 A;  4IJL A;  3RZD H;  2AWO A;  2NZH A;  1YJ9 A;  2K5V A;  1PH9 A;  1PH4 A;  1YHA A;  3CC2 A;  3OW2 A;  2Q2H A;  4L5S A;  3S15 H;  5JJL A;  2YU9 H;  4IPG A;  2MNA A;  1GVP A;  4DR5 L;  2KCM A;  2NN6 I;  2WP8 J;  4EQ5 A;  4DR6 Q;  1KRS A;  1QUQ A;  4DV1 Q;  2ASB A;  2OQK A;  1PFS A;  1CKO A;  2ALY B;  3I4M G;  3S14 H;  1B8A A;  3H0G H;  3PUZ A;  1HNW Q;  3E0E A;  2GVA A;  3GTO H;  1JE5 A;  4DK6 C;  4A3D G; 
#chains in the Genus database with same CATH topology
 5C4Z A;  3GV3 A;  4PZ7 A;  4B3M L;  1PTO C;  2PMZ E;  5M3F H;  3RNU A;  2H5X A;  1GM5 A;  1PH6 A;  3VR4 A;  1SNM A;  1UNS A;  3K5O A;  1C0A A;  4B3R L;  2KCT A;  1S40 A;  2JA8 B;  5DLQ E;  1YNX A;  3OTO L;  1XJV A;  2UU9 L;  1K8O A;  3MXN B;  1WTQ A;  1NJI C;  1I6H H;  1GUG A;  4K0K L;  3UDI A;  4ZK9 B;  5CV9 A;  3ERQ A;  5LL6 X;  3H6M A;  4KN7 C;  1TR5 A;  3Q8D A;  3S16 H;  4LFC L;  1Z6H A;  2IT1 A;  4DKA C;  3HGB A;  4DR4 L;  1Q3L A;  4CKB A;  2IY5 B;  1X3G A;  1HA6 A;  2B2T C;  2D2C C;  2QEJ C;  1U4R A;  4NMZ A;  2VNU D;  3F2C A;  4GNX A;  5IGC A;  5GRO A;  1IW7 D;  4DV6 L;  1PFB A;  4JI5 L;  1F77 A;  3DXJ C;  3V96 A;  4DAM A;  1X3E A;  1SYB A;  4NXN L;  5FO9 B;  2R7Z G;  3DWP A;  4CKE A;  2QDB A;  4DGZ A;  1R9T B;  4KKU A;  3T56 B;  4G7Z C;  1S5F D;  4TKO B;  4RGM A;  1JOQ A;  4LUZ A;  4QUC A;  2ICE C;  4KLK A;  1L0Y B;  1X3F A;  5E4W C;  2ZXO A;  2WV6 D;  2EE1 A;  1QVC A;  1JOR A;  1FGU A;  2B2Y C;  4DR6 L;  4QUF A;  3CCM A;  3A8J E;  1E2V A;  3J81 E;  4DV3 Q;  1HNW L;  5IP9 G;  2E2H H;  1RCV D;  1X9N A;  1SFO B;  3PF4 A;  1Q8I A;  4JBW A;  3A56 A;  4JI7 L;  2M2L A;  4C1N I;  4PQX A;  4AQY L;  2XWJ B;  4GN3 B;  1SE4 A;  1TWC H;  3R93 A;  4BWG B;  2VB3 X;  4OWW B;  3JAM i;  2F3V A;  4A3C H;  1PFN A;  1B53 A;  1VMP A;  2Y0S E;  4PMW A;  4OEL B;  4DK3 C;  1BO0 A;  5IP7 H;  1SRO A;  1SMY D;  5IP9 H;  2TSS A;  2IWH A;  1N34 L;  1PV4 A;  4K6D A;  5M9O A;  1UUP A;  3H94 A;  1YHB A;  2EQS A;  2ZTC A;  1S3O A;  2A74 C;  3CF5 A;  1S5C D;  2VUM H;  5GQO A;  4R4I A;  1IYJ B;  1CTM A;  3A0J A;  1SYE A;  4OIK A;  4QIW E;  4HIK A;  2YTX A;  5EBC A;  1IBL L;  1ENF A;  2JA6 B;  1SYF A;  1MD2 D;  2A5H A;  3TP5 A;  3VR6 A;  4RG1 A;  1N32 L;  3FKI B;  2G5D A;  4A3G B;  2AUK A;  2GN5 A;  3SEB A;  4Q5V A;  3S9W A;  3SK4 A;  3EA6 A;  4BBR G;  1TY0 A;  5C3X A;  2F0U A;  4NKL A;  5IT9 E;  2NN6 G;  4RHR A;  4JCV E;  2XRS D;  3GTK H;  3RN5 A;  1ZYR D;  2CKZ B;  2KJX A;  3U9O A;  3I8Z A;  1PLF A;  2KHJ A;  1EYD A;  4IO9 A;  4A3B B;  4DV4 L;  3NQI A;  1Q1B A;  4OON A;  3U4Z A;  4OX9 Q;  3J81 c;  3DLL A;  1EL0 A;  1C48 A;  3LNN A;  2VB2 X;  4N9P A;  5KRU A;  4V19 0;  1MJC A;  2N8N A;  4BY7 G;  2AQ2 B;  4WJW A;  3AFP A;  5IWA Q;  1QVF A;  1PTO H;  4L63 B;  1D8L A;  3RLO A;  4OWT B;  3I4M H;  1PHJ A;  1KNE A;  4B3T L;  3TQY A;  5C44 B;  2Q2I A;  4YWK A;  4A3D H;  4BA1 I;  4ZYS A;  1HR0 Q;  4UDU C;  4NW2 A;  4MHE A;  2VQE Q;  4ZLT F;  1NSN S;  5J22 A;  4Q0F A;  1E0B A;  3L7Z C;  2K1B A;  4XT3 B;  4DV5 Q;  2F0W A;  2F3I A;  5HY6 A;  3M7N A;  1G91 A;  3FMC A;  3GTL B;  3PQI A;  2CQO A;  3M4O H;  3OHX C;  1D7Q A;  3CU7 A;  1UE5 A;  2H1E A;  2X6G A;  1GUN A;  3IRB A;  1I94 Q;  4XQN A;  3K6O A;  2Q8I B;  1KQS A;  4JI3 L;  3CMA A;  3T1Y L;  3BJU A;  4JI2 Q;  4EVO A;  5IT9 c;  4LWC A;  3FP9 A;  1MGS A;  5BN5 A;  1EY7 A;  2N88 A;  4R4T A;  4XIG S;  3TEH B;  4QQB X;  2K50 A;  1FR3 A;  1STN A;  3GDE A;  3CC7 A;  2C9O A;  2JXM B;  2F03 A;  1KLU D;  2Q8T A;  1VQK A;  4ILW A;  4UAI A;  1IL8 A;  2YU9 B;  5C3E G;  3J80 i;  2J7Z A;  4HJA A;  1JWM D;  1KDA A;  2F0G A;  1XX8 A;  1NE3 A;  1DD2 A;  1IYU A;  2VW9 A;  4X62 Q;  4DV7 L;  4LF8 L;  1R4Q B;  5DEH A;  2B63 B;  4QCL A;  2R7F A;  1DON A;  3RN2 A;  2HDM A;  3BDL A;  1W6J A;  2VQF L;  1MIU A;  4FXG C;  5CMD A;  1CKN A;  4B3S Q;  1FVI A;  4RKL A;  2DGY A;  3L9A X;  1ICW A;  3VA7 A;  4XXE A;  1HH2 P;  1TWA H;  1K3B C;  1I4X A;  4JG2 A;  4DV5 L;  3NTK A;  1C8C A;  1CI3 M;  1II3 A;  1SJE D;  1AW7 A;  4YY3 Q;  1EY8 A;  2EY1 A;  2EYL A;  1XNQ Q;  5IYB G;  1NY4 A;  4UPA A;  2NWG A;  3F2D A;  1PYW D;  4A93 G;  1V1O A;  1HUN A;  4PZ6 A;  5JEA J;  1R4P B;  4G57 A;  4HJ5 A;  2HIX A;  1XNR Q;  4JOI A;  5CYU A;  4DR1 Q;  4UP9 A;  4IPD A;  1HNZ L;  4A3K G;  4PG3 A;  1NAP A;  3GTQ H;  5JVH 3;  4QL5 A;  1H9J A;  1X55 A;  3EFX D;  4RKB A;  1P8L A;  1F9Q A;  2K33 A;  3IKJ A;  1STG A;  4DR2 Q;  4MNO A;  4A3M H;  2Y0S G;  4DR3 L;  5FLX L;  2ZM6 Q;  2O2L D;  4KD4 A;  2GA4 B;  4BY1 H;  4RCN A;  2B2W C;  4GOP A;  4G7H C;  4H0L C;  4A3K H;  2L9H A;  4DFA A;  4CDD C;  4DUZ Q;  1IL2 A;  2F0L A;  3ERS X;  1DCZ A;  4X62 L;  4C3J B;  2PW5 A;  4DV0 L;  4YCU A;  1WTX A;  5JEA G;  3S1M H;  1KAB A;  2JK8 A;  1EEF D;  3OMC A;  3A8K E;  2E2H B;  1ET9 A;  1ESR A;  1PTO F;  2JA5 B;  3HOW H;  2UXD L;  2V1C C;  4HTH A;  2E2I H;  3NTH A;  4JI0 Q;  1FD7 D;  2M9V A;  4P2C B;  1BBU A;  4WRD A;  2UUB Q;  1CM9 A;  1RJT A;  4J1M A;  4DUY Q;  1ZEQ X;  1NCV A;  5JPM C;  4C3H B;  1Q82 C;  1BF4 A;  3J7Y W;  2PPB C;  4A3F G;  2Z6B A;  2FXQ A;  2HIV A;  5FJ8 H;  2JA7 G;  4DK1 A;  4X65 L;  4OWX B;  2D9U A;  2VS1 A;  1KRT A;  3OMG A;  2R6G A;  3HP3 A;  1JC7 A;  4JK1 C;  2KEC A;  1L1O A;  1E22 A;  4ALP A;  5KYI A;  4K6L A;  1TS3 A;  2XIW A;  5C4X G;  3D6C A;  4FYD A;  4MZ9 A;  1TWH H;  5DNF A;  2CVR A;  2JA7 H;  1SDF A;  2AUJ D;  5JJZ A;  4ODG A;  3ICE A;  3EVQ A;  4A3L G;  1SMX A;  3S15 B;  5GAE C;  2O5I C;  4LF9 Q;  4DAY A;  2JA8 G;  2CWA A;  2EVB A;  2K5D A;  1PZK D;  1A2U A;  3TZU A;  3QO2 A;  4DF7 A;  1O7I A;  4GKK Q;  3D4D A;  5LMU Q;  4DV1 L;  1HJP A;  2ICI A;  4QGU A;  3MAQ A;  4A3L H;  4H44 C;  3UDF A;  1HQM C;  3TME A;  2L55 A;  3A55 A;  2CH4 A;  4JW0 A;  3U4V A;  3GTG H;  2NVQ B;  2SOB A;  5BR8 L;  1Q86 C;  5A2Q L;  4LF4 Q;  1OXX K;  4DR7 L;  4X3U A;  1VQ9 A;  3J7A V;  5FLM H;  1BNZ A;  4B9X A;  4AYB G;  3A54 A;  2O5J C;  2MFI A;  3VR2 A;  1PH1 A;  1GO3 E;  1Y1W B;  2OCE A;  1VQC A;  4R4Q A;  2A6E D;  3CCJ A;  3MHB A;  1JOK A;  1K8M A;  5ELC A;  5BN4 A;  3ULJ A;  2E5L L;  3HOX H;  1BDO A;  1ZXT A;  2N49 A;  3UE0 A;  3J81 i;  3PUX A;  5IOC A;  1JB3 A;  4KHP Q;  2L4N A;  4GNX C;  1D6E C;  1S5D D;  1KIX A;  5D14 A;  1HZ9 A;  2RKS A;  1ML0 D;  4IJL A;  3RZD H;  1PH4 A;  3R2I A;  4F8M A;  1HCZ A;  4IPG A;  1A3T A;  2KCM A;  2IX3 A;  1QNK A;  2B2V A;  2ALY B;  2I07 B;  3S14 H;  5E3F A;  3MXN A;  3H0G H;  3PUZ A;  1NR2 A;  4X3T A;  3E0E A;  5FO7 B;  4DK6 C;  2XSC A;  4TSS A;  5IYD G;  5J3B A;  1JR0 D;  4HN7 A;  1QG7 A;  1HQR D;  1Y1V G;  2RHS B;  3AYH B;  1GD7 A;  3KLW A;  5C6A A;  1I50 H;  1X6O A;  2JJQ A;  5DAU A;  4L5R C;  3PV0 A;  1IBK L;  3LX0 A;  3DM1 A;  1STE A;  4LF4 L;  2ZTD A;  4QF4 A;  1VQN A;  2RCF A;  1N36 Q;  4BBS B;  4GLV B;  3SDZ A;  2EYF A;  4JPB W;  3TS2 A;  3HOV H;  2E2J H;  1F9R A;  3G7L A;  1LUZ A;  5IY0 A;  1X54 A;  3KUP A;  1PMR A;  5M5W B;  5CV5 A;  2DJF C;  1IBM Q;  2LMC B;  4UP7 A;  3KF8 B;  4LF7 L;  1A6X A;  2RSO A;  1SN8 A;  1EFW A;  1VQD A;  4YCW A;  4DNR B;  3J7Z C;  1K83 H;  3RD4 A;  1EWI A;  1LAB A;  4KN4 C;  3S1R H;  3KBG A;  3PUW A;  5EBD A;  1TII D;  1LM0 A;  2VL6 A;  5COR A;  1UEA B;  2FFK B;  4DR5 Q;  2OTJ A;  3K59 A;  3PO2 B;  2WB1 B;  4ULL A;  2R93 G;  2F3W A;  3EIV A;  4R8I A;  1Y69 U;  4JI8 L;  3GTQ B;  3NXW A;  3I4L A;  3MVV A;  5C44 G;  3F2U A;  4R4C A;  1OXU A;  2K5Q A;  2NTT A;  3HKS A;  4RAU C;  4JYA L;  2F0H A;  2F0Q A;  2PNH A;  2F0S A;  3CCU A;  1ZYR C;  2R7D A;  4B3R Q;  2PQE A;  2A73 B;  3R2T A;  4JI6 L;  3OTO Q;  2K04 A;  1SLJ A;  3W2D A;  4K0K Q;  1ASZ A;  2FJ2 A;  3KF6 B;  4FF3 A;  3QG1 A;  1CA5 A;  4JVZ A;  4LFC Q;  1CQV A;  1EQV A;  1D1I A;  4DR4 Q;  3KJP A;  2ZXP A;  4MIU A;  1N36 L;  3AU7 A;  4WFN 3;  3HFZ B;  4DV6 Q;  3I4N H;  1M8A A;  4YCV A;  4A3E G;  4JI5 Q;  3NE5 B;  4CDE C;  2NZ1 D;  1KHI A;  4IUN A;  3HOW B;  3EN2 A;  1EU3 A;  1ZKO A;  2E2I B;  4NXN Q;  1H9M A;  5C4J H;  1GUW A;  2QA4 A;  3K8A A;  2KHS A;  4JV5 L;  2DN8 A;  3UE1 A;  4WJ3 M;  5IYC G;  1S72 A;  1I4P A;  1X3P A;  3URY A;  4KHZ A;  2NUC A;  1ASY A;  1B7Y B;  4A3E H;  4RH6 A;  2EJM A;  1Q1E A;  4M8A A;  1K28 A;  3KFU A;  1D5Z C;  1EIF A;  1BBX C;  1W2B A;  2MHV A;  1ESF A;  1TS4 A;  2EXZ A;  3K7A B;  4RGT A;  1HRJ A;  3F2B A;  2VY3 A;  2B63 G;  2LY7 A;  3W3A A;  5TSS A;  2NVX B;  1UEB A;  1LTT D;  1LT4 D;  2UXC Q;  2EDG A;  1GJX A;  3BZK A;  1HZB A;  1Z47 A;  3WOE A;  3K57 A;  3MEF A;  4JI7 Q;  5AJ3 L;  1MSH A;  1SNC A;  3MEH A;  4O1N A;  2PZW A;  1BCP F;  1Z9F A;  1WTR A;  4AQY Q;  5C0X I;  1E2Z A;  4C2M H;  2I0Q A;  4MN3 A;  3HOZ B;  2K14 A;  1AZP A;  1I5F A;  1PRT B;  1VQH A;  1EU4 A;  3KYH C;  4P71 A;  5EQ0 A;  1WCM G;  3K5M A;  1E3P A;  1N34 Q;  3NBI A;  2F0D A;  1HPC A;  3NTI A;  4DNI A;  2Z6K A;  3S2D B;  5I6Y A;  3BVM A;  2YTY A;  3IFD A;  1C7Y A;  2PNR C;  2F1M A;  3GD7 A;  1PDQ A;  3IFT A;  4GN4 B;  1LO5 D;  3W1B A;  1VQ5 A;  1IBL Q;  1U4P A;  1EOV A;  2A6H D;  2WAQ B;  1U4M A;  1VF7 A;  3K7U C;  4OHJ A;  2EZV A;  1U0L A;  2F52 A;  2HD3 A;  3KLS X;  1CA6 A;  1N32 Q;  5M5X B;  3M7G A;  2WFW A;  1N33 L;  2AQ3 B;  4POG A;  1VQM A;  5FLX E;  3BDC A;  2ZJP A;  3HOX B;  2F0I A;  4DXG A;  3M4Y A;  3FHW A;  5I4D A;  1RTN A;  3PUY A;  1MKH A;  5KIX A;  3VA5 A;  4DPG A;  2Q2U A;  4ABN A;  4Y52 H;  1VF5 C;  1TKW B;  4DV4 Q;  2FHT A;  2F0O A;  2R7Z H;  4RA8 A;  1J8I A;  1EYA A;  5EPK A;  4IUP A;  4C3J G;  1J5E L;  1RL2 A;  2AHO B;  3T4A C;  2UXC L;  1U5K A;  4JOI C;  2A69 C;  1XPO A;  2KEE A;  4ZRZ A;  2CW0 D;  2QKI C;  2NYZ D;  3NWS A;  2WB1 E;  1BVS A;  3P20 A;  2C5C A;  2KHI A;  5LMN W;  3GTP H;  2EY6 A;  4B3T Q;  4GLX A;  4CKC A;  5DM6 3;  3G71 A;  2XWB B;  3G6J B;  4A3I B;  4YIJ A;  3HOY B;  4C3H G;  1X3Q A;  3S14 B;  5M3M G;  3PMF A;  1LLR D;  1EY4 A;  3N52 A;  4P73 A;  4IOC A;  3BDO A;  2LSS A;  2G9D A;  4ZCK A;  1DXM A;  1AP0 A;  5C0X J;  3OWE B;  2QF7 A;  2K32 A;  1TVX A;  4PZ8 A;  3UDG A;  1BKB A;  1YEZ A;  5C3W A;  1RKN A;  4F88 A;  3FPU B;  4FNF A;  3NK9 A;  1I3Q H;  4JI3 Q;  1F2L A;  4KJO A;  1CSQ A;  2EYH A;  1KXL A;  3T1Y Q;  3DMU A;  2UUC L;  1LV9 A;  2RDG A;  3GV6 A;  4HR7 B;  5FLX c;  3I56 A;  1OTC A;  2J4X A;  4HMI A;  3RLN A;  4CDF C;  4J15 A;  3DM3 A;  3S1N B;  1YHQ A;  4Y7N H;  5LMN L;  3TP8 A;  1LT6 D;  3PF5 A;  4E6I A;  1GXD C;  4C3I B;  1D2B A;  4OO1 I;  1V8Q A;  1K8G A;  4PMC A;  2ZJR A;  2F0J A;  3S1R B;  3K5N A;  1G2S A;  5C0X G;  4BBR H;  1KC8 C;  1V1P B;  2D62 A;  1GUS A;  2F0N A;  1XWE A;  2NN6 H;  4DV7 Q;  1HZC A;  5A2Q E;  4LF8 Q;  1Y8P B;  2K6A A;  4IFD I;  4KKT A;  3HOU B;  3CCE A;  1BBW A;  3CQZ H;  1UE6 A;  2VQF Q;  3VYS A;  1XMQ Q;  3S2H H;  3I91 A;  3SK5 A;  1SR3 A;  3G48 A;  3PIP A;  1Y1W G;  1AEX A;  2EPB A;  4BY7 H;  5IGB A;  3SGI A;  2RVL A;  2F0V A;  3D8G A;  4IUU A;  3U9S A;  2HDL A;  1STA A;  4IN3 A;  1STH A;  5JJI A;  1JIC A;  3E9I A;  3J81 j;  2KCN A;  3HZX A;  3T53 B;  1A3U A;  2R92 G;  3PO3 G;  1N8R C;  1D5M C;  2BH8 A;  2E2D C;  3SXH A;  2MUY A;  1GUO A;  4KD3 A;  1TY2 A;  1EZ8 A;  3I70 A;  4B9W A;  4A3J B;  2JN4 A;  3NPP A;  4YWM A;  5KGU A;  4DAP A;  2MP1 A;  2K5W A;  2WAQ E;  2NVT H;  3K81 C;  1Q81 C;  5D65 A;  1HNZ Q;  2A1A A;  3J7A 5;  2AKW B;  1N9W A;  2NVY H;  4F87 A;  5HGQ A;  3BS1 A;  2I5L X;  4DNT B;  4BXX G;  2R92 H;  2EY2 A;  5C4J B;  1WTO A;  4KTA A;  2EXD A;  3SK8 A;  3VR5 A;  2LXJ A;  5C5L A;  3H3V I;  1BOS A;  1A62 A;  2K5N A;  4KJN A;  3ITP A;  2Q8R E;  3S1Q H;  4DR3 Q;  1RTO A;  5EAY A;  2Z4I A;  4CJ2 C;  4FXD A;  1MBY A;  1EIY B;  5I9P A;  1V43 A;  5IGE A;  1U4L A;  3MA2 B;  5FKA C;  2KBN A;  1AFP A;  4TQU S;  1DYQ A;  4DV0 Q;  2DNE A;  1ROD A;  2L11 A;  3LWU A;  4BBS G;  1B44 D;  1XMQ L;  1K3R A;  5BN3 A;  2SNM A;  1EWH A;  1YNJ C;  2OQ0 A;  2UXD Q;  1WTW A;  5IGD A;  3D4W A;  5FOB B;  4R1J A;  4CHT B;  5M3F B;  1YIJ A;  5C3E H;  2HHH L;  3RUZ A;  4TRD A;  4C2M B;  5ELB A;  3C1E A;  3UDX A;  1O7L A;  3SR1 A;  3AFQ A;  5CV7 A;  2JE6 I;  2RDF A;  3A7A B;  1SYD A;  1I6H B;  4JI4 L;  2LXK A;  2EJF C;  1YNN D;  3O13 A;  4X65 Q;  3S16 B;  3V2T A;  4FF1 A;  3R8B A;  3Q22 A;  1VDZ A;  2ZT9 C;  1EIG A;  3CW2 C;  2XTI A;  2IJ0 A;  3E6Z X;  1WD1 A;  2SDF A;  1EUJ A;  3W5O A;  3PO2 G;  4XQJ A;  3QIA A;  1CKM A;  4OO1 G;  2F0T A;  1JT8 A;  3PIO A;  3E9H A;  4LJZ C;  1QWY A;  2OTL A;  2F0K A;  4UP8 A;  5IYB H;  3GTJ H;  4IUV A;  3M3Y H;  5LL6 S;  4A93 H;  1BCP C;  1FNW A;  1F2Z A;  2PO4 A;  1MSG A;  1YHA A;  2QIL A;  3VR3 A;  3CC2 A;  4L5S A;  1T5X D;  2EYM A;  1GVP A;  2WP8 J;  4EQ5 A;  4ID6 A;  4DV1 Q;  3TN2 A;  5C5M A;  3Q6S A;  1SEB D;  5IGF A;  3BVG A;  1ICF B;  1Q12 A;  5BR8 Q;  4A4I A;  4OEM B;  2ZXR A;  1EIH A;  1CSP A;  4YHH L;  4DR7 Q;  1Q46 A;  3EQL C;  3KLS A;  1QUQ B;  4UHV A;  3QJY A;  5K5P A;  1H9S B;  3KF8 A;  1J9O A;  3NUC A;  4HSP A;  2YV5 A;  1PH2 A;  4R9W A;  1TWC B;  1KNA A;  2HT1 A;  3M4Q A;  1QOH A;  1KAW A;  1HUM A;  1GKH A;  2E76 C;  2F0E A;  4LAA A;  4JI1 L;  5K36 G;  2E5L Q;  5JEA H;  3ER0 A;  1V1Q A;  3D31 A;  1JMC A;  2OF1 A;  1D5X C;  4FVM A;  3K0X A;  3P7J A;  1AN8 A;  5EJW A;  1EEI D;  5FO8 B;  1T5E A;  2VUM B;  1UWV A;  1JJ2 A;  2Z4H A;  3L2P A;  3SK6 A;  5JAV A;  4GZY C;  1VQE A;  4UY8 C;  1S4Z A;  1EYG A;  4GLA C;  4A3F H;  3M4P A;  1XTC D;  1D1K A;  1VQF A;  4O2D A;  3BZD B;  3HG9 A;  1SSO A;  4RGO S;  1AE3 A;  3E0J A;  5H1S E;  4KV6 A;  3SE0 A;  3HOZ G;  3MWY W;  3GTK B;  1E1O A;  4A75 A;  3KF6 A;  3D4R A;  5C4X H;  3NBH B;  3WDN A;  3NHH A;  3FDT A;  4WJ4 A;  5ELF A;  2L1B A;  1VQ6 A;  1FNU A;  1RF2 D;  4CBV A;  4HIO A;  3A5U A;  1M90 C;  4DN4 M;  3RZO H;  4HJ7 A;  1X56 A;  4BBR B;  1LAC A;  1IBK Q;  1B3A A;  3BG3 A;  4JBJ A;  4I7A A;  2JA8 H;  4HMJ A;  3MZ5 A;  1PTO B;  1H9R A;  3CXC A;  4HED A;  1XMO L;  2QGQ A;  3M9B A;  2K03 A;  3CQZ B;  3T16 A;  3I4M B;  3KBX A;  2WKC A;  1Z7T A;  3T13 A;  3ULP A;  1JJG A;  4LFA Q;  1G6Z A;  4A3D B;  4MTN A;  1HZA A;  1MHW C;  3J7A F;  3T1H L;  1SJH D;  1U9R A;  4K5W A;  4LF7 Q;  4HSV A;  2Q2T A;  1VQ8 A;  4N8X 1;  1LTG D;  3CAM A;  1ENC A;  2Z6K C;  2CWP A;  3M4O B;  1F9S A;  1CFM A;  2Z0S A;  3VDY A;  1R9T H;  2LFN A;  3I4O A;  1PXU A;  1I4H A;  1IW7 C;  1JJC B;  4I7Z C;  4A76 A;  3JC6 6;  1SYG A;  2A6H C;  2B8F A;  1LT3 D;  2OT2 A;  4HCE A;  3BU2 A;  1VQB A;  4O0A A;  5C4H A;  4JI8 Q;  1E2W A;  4NDX A;  1I6V C;  1PRT D;  4OIJ A;  5IGG A;  4A3I G;  1BXT A;  3F8T A;  3HOY G;  2BDN A;  5ELN A;  4IJH A;  2K4K A;  1CUK A;  4JYA Q;  3S1Q B;  3W1G A;  1LTL A;  2PQA B;  5IE8 A;  1BR9 A;  1SFO H;  2KQ3 A;  3E3X A;  4DAV A;  4JI6 Q;  4AH6 A;  1K0R A;  2DY7 A;  2UUA L;  4K2L A;  2BH2 A;  4X66 Q;  1M4V A;  3DEP A;  1QVG A;  1YZ6 A;  3P75 A;  4L6T B;  4JC0 A;  2F0M A;  3ND8 A;  3H09 A;  1VMC A;  2JA6 G;  2JA9 A;  1TWF H;  3A5Z B;  3TS0 A;  1O7Y A;  2ZTE A;  3BYT B;  5IYD H;  3FKI G;  2MO0 A;  2NTS A;  1TU2 B;  4LFA L;  1Y1V H;  3DEO A;  3EBE A;  4A3G G;  2D0O A;  2NB0 A;  3GO5 A;  5DM7 3;  4NB3 A;  2QEX A;  3I90 A;  3RLF A;  1XPR A;  1TWA B;  5C3E B;  3KK7 A;  4QY7 A;  4JV5 Q;  1QJO A;  3OPO A;  1SMY C;  2UXB L;  3VYU A;  1WI5 A;  1JCK B;  1GHJ A;  4A3B G;  4KMU C;  3PSI A;  2RDH A;  3FKI H;  4DV2 L;  1IYV A;  2BA1 A;  5HGT A;  1M1K C;  1KDC A;  3U50 C;  1VQP A;  2KCC A;  1EQQ A;  1G8Z D;  2EYJ A;  1PH8 A;  1VS0 A;  2A68 D;  2HCI A;  3OOC A;  1EYC A;  3G4S A;  1Y14 B;  2L5T A;  2R61 A;  4LFB L;  4A3B H;  3TRE A;  4BA2 I;  4O42 A;  2B2W A;  5AJ3 Q;  3QB3 A;  1Y8O B;  4IUR A;  5CGK A;  1EQR A;  4EX5 A;  4A93 B;  1AZQ A;  4A3M B;  1O7Z A;  1H95 A;  5KNB A;  3AEV A;  4R8N A;  4LUO A;  3BVZ A;  4BY1 B;  4X66 L;  4R4O A;  2R93 H;  4K8I A;  4A3K B;  2XN9 C;  3I72 A;  5ELD A;  1GHK A;  5C44 H;  2MQH A;  3STB D;  4EQN A;  5KNC A;  1SND A;  2BE5 D;  2F4V L;  4A3J G;  3QWN A;  4APV A;  3S1M B;  1WVL A;  2IW3 A;  1KLG D;  5CR3 A;  3D0F A;  3SVM A;  1OXV A;  3OSO A;  4K2K A;  1QCB D;  1MJE A;  3AB9 A;  3GTL H;  1NUC A;  4NXM Q;  1FJG L;  4DXF A;  5EGT A;  1EZ6 A;  2N3S A;  4K5V A;  1YBY A;  1N33 Q;  1RIP A;  4BS9 A;  1OO9 B;  1S5E D;  3FPP A;  1VQL A;  1STY A;  3WWV A;  4ZUI A;  4J6H A;  2N55 A;  1XPU A;  1PFM A;  1V1P A;  2ATW A;  1X32 A;  3KDF B;  2YYZ A;  4LK1 C;  1DM0 B;  2RHQ B;  5IYC H;  3OIP A;  1J5E Q;  4QMG A;  2SNS A;  1MI2 A;  2MJ8 A;  5KYL A;  4EGV A;  4K14 A;  1SE8 A;  1TWH B;  3AMU A;  2JA7 B;  4X3S A;  1WTV A;  1EY6 A;  1UAP A;  3JAM L;  1NMF A;  5M3F G;  2K52 A;  3NQT A;  1LYL A;  2CFM A;  5IIF A;  1K9M C;  4LNQ A;  2AQ1 B;  4X64 L;  1ET6 A;  1FL0 A;  4C1N K;  5COY A;  2B63 H;  1SYC A;  1JWU D;  3VYR A;  4KI0 A;  3CRK C;  5C4X B;  4KY5 A;  1CK1 A;  2ID0 A;  5F2D A;  4FXK C;  4RWS C;  2CQA A;  4GKJ L;  3CKI B;  2E75 C;  4CDC C;  3RZO B;  3CC4 A;  3GTG B;  1F9P A;  3HKZ B;  1XXG A;  2PW7 A;  2X69 A;  3CCL A;  3KOJ A;  1HTP A;  3M85 A;  5CV6 A;  2BA0 A;  3I55 A;  4NXM L;  1WCM H;  1VQ7 A;  2UUC Q;  3TZD A;  2RCN A;  3GTM H;  1V9P A;  5E1F A;  5ELE A;  1NMG A;  4LF5 L;  2YTV A;  3D6W A;  2JQO A;  1ONL A;  4H7B A;  2RA4 A;  4F7X A;  5LMN Q;  1YNN C;  1CQF A;  1STB A;  2IHE A;  4AYB B;  4POF A;  3MXG A;  4GN5 A;  1RHP A;  2CCZ A;  1B2T A;  3ZJY C;  1CHP D;  2WIN B;  4HAE A;  3DHQ A;  3LGJ A;  3P1H A;  3IL8 A;  3RZD B;  4LF6 L;  3NSW A;  2JA5 G;  1Q7Y C;  1BCP B;  2IL8 A;  2QW7 A;  1HHV A;  4K8J A;  1YVC A;  2KED A;  1IKM A;  3VYT A;  4YWL A;  3TRZ A;  4IQZ A;  4C3J H;  2EY5 A;  2A8V A;  3OIQ A;  4A3C G;  1VQA A;  3H0G B;  3MXU A;  4ZAI A;  4J8Q A;  4GOP C;  4FF4 A;  5IP7 G;  1B70 B;  2HCC A;  4U68 A;  5J39 A;  3BZC A;  1WFQ A;  2JA5 H;  1C4Q A;  3HEJ A;  2E74 C;  2NZO A;  3PIP 3;  1I50 B;  1SXT A;  2VUM G;  1A63 A;  1AH9 A;  1SNO A;  3NEL A;  4KY7 A;  4C3H H;  5M3M H;  1A2T A;  1S5B D;  3TDQ A;  2ES2 A;  1TWF B;  1KAA A;  3HOV B;  4LUV A;  2E2J B;  2A19 A;  2JP1 A;  1Y1V B;  4JBM A;  4QJF A;  1LTB D;  1G6P A;  1B3Q A;  5JPN C;  1CZW A;  3CPW A;  1PVO A;  3MXP A;  4K5X A;  3I3C A;  5I6W A;  1L0X B;  1AE2 A;  3K5L A;  4HJ9 A;  1IZ6 A;  3J80 L;  4JBK A;  1K83 B;  1L1O C;  2N78 A;  2LKV A;  1LT5 D;  2AWO A;  1YJ9 A;  3TP7 A;  3S15 H;  4V0B A;  1JQY D;  4NP5 A;  2Q2H A;  2K01 A;  2QCP X;  1WTP A;  2J0T D;  2G9H D;  1QUQ A;  2EYO A;  4B08 A;  2ASB A;  1H9S A;  2OQK A;  5J1Z A;  3I4M G;  1B8A A;  2GVA A;  3GTO H;  2OXP A;  1JE5 A;  3MC0 B;  3FEW X;  4A3D G;  2PZT A;  2IPK D;  3DUZ A;  1DOL A;  4DV3 L;  2KVM A;  5C0X H;  2DNC A;  4N9T A;  2HHH Q;  1XYI A;  2NVQ H;  1E7Z A;  5I2Y A;  5M5Y H;  1FYC A;  1P16 A;  1H9K A;  3SHL A;  5G3L D;  4JI4 Q;  2R93 B;  2EOT A;  3B6Y A;  1LTR D;  3K58 A;  5D3D A;  2JEA I;  1DOM A;  5JOB A;  1GUT A;  3OWF A;  4ZQ3 A;  3L0O A;  1Y1W H;  3T51 B;  3GQB A;  4LMQ D;  2ZJQ A;  4CJ0 B;  4RGN A;  4ME3 A;  2B2U A;  1A8V A;  3HKZ E;  3C2P A;  2O4X A;  1K0S A;  4HIM A;  3I4N B;  3X3N A;  1T9H A;  2Z9H A;  2WAC A;  3EJI A;  2L15 A;  3RR5 A;  2MGS A;  1PH7 A;  3PO3 H;  2A6E C;  1WTH A;  5KND A;  4PV1 C;  1I4R A;  2DUD A;  1HR0 W;  3NBH A;  3I7F A;  1SNQ A;  1WJJ A;  1G29 1;  4OXP A;  2IX0 A;  3K0Y A;  4GNX B;  4A3E B;  3PIO 3;  1DGS A;  5CBE E;  2B3G A;  5ELO A;  1QB5 D;  3H3V C;  3KLR A;  3PUV A;  1QZG A;  3R3O A;  1EY9 A;  1PTO D;  4AYB E;  3C3L A;  4BXX H;  1DZ1 A;  1HTL D;  3H15 A;  1TQO A;  5EPJ A;  1VQO A;  3HRZ C;  2XRQ D;  1TT2 A;  5AFW A;  3A7L A;  2KEN A;  3QOJ A;  2B29 A;  4YHH Q;  1Q90 A;  4OX9 L;  2B2V C;  4PNY A;  3Q0A A;  4KK7 A;  1PRT C;  5ISR A;  1G2T A;  4G7O C;  4KHV A;  5IWA L;  4IUQ A;  4IFD J;  2B2T A;  4BBS H;  3DWQ A;  4JI1 Q;  1SRU A;  4X3K A;  4NPS A;  2H4O A;  4U67 3;  1F2M A;  1WOC A;  3FVQ A;  4XYQ A;  2E8G A;  5M5W H;  5FK9 C;  1L2F A;  2PI2 E;  4LW1 A;  1HR0 L;  2PYK A;  1ILP A;  4MTK A;  1YIT A;  5L37 A;  2VQE L;  2IHF A;  3CPF A;  2JEB I;  2VZA A;  3PCO B;  1O78 A;  5JVG 3;  2EJG C;  2WB1 G;  3I73 A;  2K05 A;  2XNA C;  2KA7 A;  4XT1 B;  1WCM B;  2MPM A;  2M00 A;  2R3Z A;  3K80 C;  3GTM B;  3F1Z A;  1VQG A;  3IAY A;  4OL7 A;  4DA2 A;  1I94 L;  1OXT A;  2PQA A;  4A3M G;  2B2Y A;  1B50 A;  1TWG H;  3CCR A;  1JE4 A;  2A69 D;  4IFD G;  1NNX A;  5G3L F;  3UI2 A;  5GAD C;  3GP7 A;  1UE7 A;  4BY1 G;  4IOA A;  3PO2 H;  4JI2 L;  3ZYY X;  2HQL A;  5E7N A;  5LHY 1;  1JWS D;  3Q24 A;  4OO1 H;  4CGY B;  2ENB A;  4EQO A;  2R7Z B;  3BYY B;  3CCQ A;  1J6Q A;  1EFI D;  3A8I E;  1B1Z A;  3Q23 A;  1HFG A;  2F4I A;  1IXR A;  3WOF A;  1PA6 A;  2OWO A;  2A68 C;  4IFD H;  1XTD A;  1A15 A;  4H02 A;  1XMO Q;  3HOW G;  4L8J A;  3U58 A;  2CH4 W;  3GTP B;  5JJK A;  2NBF A;  1B9M A;  2RQX A;  1HFN A;  1RD9 D;  1CHQ D;  1LTI D;  3J81 L;  3T1H Q;  3S17 H;  4HJ8 A;  1SE3 A;  5FJ8 G;  2F0F A;  2OEO A;  1I4G A;  4B3S L;  4M1U B;  5T1I A;  5CV8 A;  4RHS A;  3STB C;  4CJ1 B;  1EY5 A;  2FMC A;  2BE5 C;  2K28 A;  1VQJ A;  5K36 H;  5M3M B;  4ZKB B;  4IZ8 A;  3OW7 A;  1I3Q B;  4YY3 L;  4S3S A;  3QR8 A;  4HID A;  3LWE A;  4FP5 D;  1SNP A;  1XNQ L;  3JAM E;  4Z9C B;  3ULL A;  2FIN B;  2X6L A;  1TXY A;  4H13 C;  3K7A H;  1DOK A;  1SE2 A;  3DWA A;  1YI2 A;  3H3V H;  2D0P A;  1G51 A;  4KY6 A;  2NVX H;  1XNR L;  3NEM A;  4DR1 L;  1KD1 C;  4Y7N B;  4FF2 A;  2UUA Q;  1IHZ A;  2AWN A;  4PMB A;  4DU9 A;  1EOT A;  2L12 A;  1DJR D;  1VQ4 A;  3RMH A;  3E5S A;  4DR2 L;  3FRP B;  1ILQ A;  5IT9 L;  2XVS A;  2ZM6 L;  3HOZ H;  1OXS C;  3HKZ G;  1EWC A;  4L5Q A;  2WAQ G;  5A35 A;  3D3R A;  5FLM G;  1RDP D;  2PZU A;  3S2H B;  4DUZ L;  3NEN A;  3GTO B;  4QB4 A;  5E4X A;  4P75 A;  1JB7 A;  4G4K A;  3S2D H;  2AMC B;  1NR4 A;  4BY7 B;  2K75 A;  1PYS B;  1IKL A;  1HXY D;  5GAG C;  3HOX G;  2JYO A;  2WKD A;  1LTA D;  2UXB Q;  1K73 C;  5M5Y B;  1NTG A;  1O80 A;  2LS0 1;  3TP6 A;  1FNV A;  4JI0 L;  3CME A;  3KDF A;  5EKL A;  2IX1 A;  1B9N A;  4I65 A;  3A74 A;  2UUB L;  5M5X H;  1TS5 A;  4DUY L;  2D5D A;  4DV2 Q;  1CKN B;  4ZUJ A;  4OGQ C;  1VQI A;  2RBM A;  5I2X A;  2V4D A;  3MFY A;  1TS2 A;  4N8F A;  1GOZ A;  2EIF A;  2C35 B;  4IAL A;  4HCS A;  3JAM c;  2B8G A;  2NVT B;  1PZJ D;  1KDB A;  1F2Y A;  2NVY B;  4LFB Q;  4C56 C;  1X65 A;  2R92 B;  4ME5 A;  1A0I A;  3PO3 B;  1QNU A;  4RMF A;  4IUT A;  3H0G G;  5CBA E;  3KJO A;  4TVA B;  1PZI D;  3NWT A;  3CHB D;  4XTC S;  1KL9 A;  1KTK A;  4DK0 A;  1I4Q A;  3CRL C;  1YNJ D;  1QE6 A;  2Z1C A;  2PMZ B;  1EQT A;  4X6A H;  1YJN A;  1CZG A;  2GVB A;  4A3I H;  4LF9 L;  3MFG A;  2I5M X;  3HOY H;  2TMP A;  2F4V Q;  4AIM A;  4GKK L;  2CW0 C;  4RCO A;  1A3V A;  2K7V A;  3AQQ A;  3N6R A;  5D3I B;  2JSO A;  5LMU L;  3HOV G;  5EKK A;  3MTS A;  1K8A C;  3OYY A;  1QZH A;  4ZKC B;  1EY0 A;  3L3O C;  4GOP B;  1Y8N B;  3CD6 A;  1FJG Q;  3TBI B;  5NUC A;  3TSS A;  1JOO A;  2RSN A;  3HS0 C;  3CCS A;  3X3M A;  1VCI A;  2DJG C;  2P5Z X;  5IOD A;  2JA6 H;  3V05 A;  4C3I G;  1Q8K A;  4L5T A;  4RFB A;  1UE1 A;  3J80 E;  2EYP A;  4A3G H;  3H91 A;  5T1G A;  4IPC A;  2RF4 A;  1PYB A;  1B4O A;  2SEB D;  3I2Z A;  2I5H A;  1BCP D;  1BUV T;  1HA5 A;  1HNX Q;  3HOU G;  3S1N H;  2HQE A;  2MO1 A;  4C3I H;  4KHP L;  1W3S A;  1QIL A;  3CP0 A;  2B39 A;  5HUR A;  5EPL A;  4FDB A;  1PH3 A;  3GTJ B;  3M3Y B;  4XQQ A;  2PCF B;  4IPH A;  3S24 A;  2KUM A;  1TWG B;  2CHB D;  2Z8L A;  4X64 Q;  1L1O B;  3HOU H;  1SBB B;  2PI2 A;  1NBW A;  4WOR A;  2DY8 A;  2QDL A;  2VXW A;  5KEE A;  4B3M Q;  4P72 A;  4GKJ Q;  2F0P A;  1YJW A;  1ENA A;  2BOS A;  5CV4 A;  4P74 A;  2Y0S B;  4EQP A;  4GS3 A;  1PH5 A;  3G6E A;  3I4N G;  4DAY B;  2FMM A;  1E1T A;  2K5H A;  2UU9 Q;  3PGZ A;  2WII B;  2BDO A;  1PRT F;  1C9O A;  1LTS D;  4QIW B;  4LF5 Q;  4XDX A;  3C1F A;  4A3J H;  3J80 c;  3S17 B;  3C46 A;  1E24 A;  1SAP A;  2BCO A;  2KOL A;  5GAH C;  5EKI A;  4FO2 A;  1IBM L;  2HUG A;  4XYO A;  2XGT A;  2B2U C;  1HNX L;  3ND9 A;  3ONA B;  3CCV A;  3QOL A;  5I9O A;  1WYD A;  3NP8 A;  4A3F B;  1L0W A;  4LF6 Q;  1FGB D;  1PH9 A;  2NZH A;  2K5V A;  5JJL A;  3OW2 A;  2YU9 H;  1CT1 D;  1BQQ T;  2I46 A;  2MNA A;  4DR5 L;  2NN6 I;  4DR6 Q;  1KRS A;  1PFS A;  1CKO A;  3ERO A;  1HNW Q;  5CC4 A;  1WD0 A;  1W6K A;  2L0C A;  4KKS A; 
#chains in the Genus database with same CATH homology
 1Q12 A;  5IYD G;  4PZ7 A;  5J3B A;  5BR8 Q;  4DV3 L;  4A4I A;  2PMZ E;  4B3M L;  2HHH Q;  5M3F H;  2NVQ H;  1Y1V G;  2RHS B;  3AYH B;  3RNU A;  1E7Z A;  2H5X A;  1CSP A;  4YHH L;  1GD7 A;  3KLW A;  1Q46 A;  1PH6 A;  1GM5 A;  4DR7 Q;  1I50 H;  1X6O A;  2JJQ A;  5M5Y H;  1C0A A;  4B3R L;  1QUQ B;  2KCT A;  1S40 A;  1P16 A;  5DLQ E;  4L5R C;  1YNX A;  3PV0 A;  3OTO L;  1XJV A;  1IBK L;  2UU9 L;  4JI4 Q;  3B6Y A;  3MXN B;  2YV5 A;  1PH2 A;  1NJI C;  2ZTD A;  4LF4 L;  1VQN A;  2HT1 A;  4K0K L;  2JEA I;  3M4Q A;  3UDI A;  1N36 Q;  4GLV B;  1KAW A;  1GKH A;  3L0O A;  3Q8D A;  1Y1W H;  4JI1 L;  3S16 H;  4LFC L;  3TS2 A;  3HOV H;  5K36 G;  2E2J H;  2IT1 A;  2E5L Q;  2ZJQ A;  4DKA C;  3ER0 A;  1LUZ A;  1V1Q A;  3D31 A;  4ME3 A;  1JMC A;  4DR4 L;  5IY0 A;  1A8V A;  2IY5 B;  1X3G A;  1X54 A;  3HKZ E;  3K0X A;  4HIM A;  3F2C A;  4GNX A;  1IBM Q;  2VNU D;  5GRO A;  4UP7 A;  1T9H A;  4DV6 L;  3KF8 B;  4LF7 L;  1UWV A;  1JJ2 A;  4JI5 L;  3L2P A;  2L15 A;  3RR5 A;  1VQE A;  4UY8 C;  4DAM A;  1PH7 A;  3PO3 H;  1X3E A;  4NXN L;  1SN8 A;  1EFW A;  1EYG A;  2R7Z G;  1VQD A;  4YCW A;  4GLA C;  4A3F H;  2DUD A;  3M4P A;  1HR0 W;  3J7Z C;  1K83 H;  1EWI A;  3I7F A;  3S1R H;  1VQF A;  1WJJ A;  1G29 1;  4OXP A;  2IX0 A;  3PUW A;  4GNX B;  4O2D A;  4LUZ A;  1DGS A;  1LM0 A;  2VL6 A;  4DR5 Q;  2B3G A;  5ELO A;  3PUV A;  4KLK A;  2OTJ A;  1AE3 A;  1QZG A;  5H1S E;  4JYA Q;  4AYB E;  3HOZ G;  4BXX H;  1X3F A;  1E1O A;  2R93 G;  3H15 A;  3EIV A;  4A75 A;  1QVC A;  1FGU A;  3KF6 A;  4JI8 L;  5C4X H;  1VQO A;  4DR6 L;  3NBH B;  5C44 G;  3CCM A;  4WJ4 A;  4R4C A;  1VQ6 A;  4DV3 Q;  1OXU A;  2KEN A;  1HNW L;  5IP9 G;  4HIO A;  2E2H H;  2B29 A;  3HKS A;  4YHH Q;  3A5U A;  1X9N A;  1M90 C;  3PF4 A;  4JYA L;  3CCU A;  2PNH A;  4JBW A;  4OX9 L;  2R7D A;  4HJ7 A;  3RZO H;  4B3R Q;  1X56 A;  4JI7 L;  4JI6 L;  3OTO Q;  1IBK Q;  4JBJ A;  2JA8 H;  1SLJ A;  3CXC A;  4K0K Q;  4AQY L;  1XMO L;  5IWA L;  2QGQ A;  4GN3 B;  1ASZ A;  3KF6 B;  1TWC H;  3M9B A;  4IFD J;  4BBS H;  4OWW B;  3JAM i;  4JI1 Q;  4LFC Q;  4A3C H;  1SRU A;  4DR4 Q;  3KJP A;  2Y0S E;  3ULP A;  4PMW A;  1JJG A;  4LFA Q;  4NPS A;  4DK3 C;  5IP9 H;  5IP7 H;  1SRO A;  1N36 L;  4MTN A;  1HZA A;  1WOC A;  2E8G A;  1N34 L;  3T1H L;  1PV4 A;  3HFZ B;  5M5W H;  4DV6 Q;  3I4N H;  1L2F A;  2PI2 E;  4LW1 A;  4YCV A;  1HR0 L;  4A3E G;  1YHB A;  2EQS A;  4LF7 Q;  2ZTC A;  4JI5 Q;  1S3O A;  2Q2T A;  1YIT A;  3CF5 A;  1KHI A;  2VQE L;  1VQ8 A;  2VUM H;  2IHF A;  3CPF A;  3EN2 A;  2JEB I;  4R4I A;  5GQO A;  2VZA A;  3PCO B;  1IYJ B;  4NXN Q;  5C4J H;  3A0J A;  2WB1 G;  3CAM A;  4QIW E;  2Z6K C;  3K8A A;  2QA4 A;  2YTX A;  2CWP A;  4HIK A;  4JV5 L;  1IBL L;  3UE1 A;  4WJ3 M;  5IYC G;  1S72 A;  2Z0S A;  4KHZ A;  3VDY A;  1ASY A;  1R9T H;  3I4O A;  3K80 C;  4RG1 A;  1JJC B;  1N32 L;  3F1Z A;  1VQG A;  1B7Y B;  2GN5 A;  1I94 L;  4A3E H;  1OXT A;  4A76 A;  2PQA A;  4A3M G;  3JC6 6;  1Q1E A;  3KFU A;  1TWG H;  3CCR A;  4BBR G;  1EIF A;  1W2B A;  4IFD G;  2NN6 G;  5GAD C;  3BU2 A;  4BY1 G;  1UE7 A;  1VQB A;  4JCV E;  4O0A A;  3GTK H;  3PO2 H;  3RN5 A;  2CKZ B;  4IOA A;  4JI8 Q;  4JI2 L;  2HQL A;  5E7N A;  3F2B A;  2VY3 A;  2B63 G;  4A3I G;  1UEB A;  3F8T A;  2UXC Q;  3HOY G;  2KHJ A;  5ELN A;  3CCQ A;  1J6Q A;  4IJH A;  4DV4 L;  2K4K A;  1CUK A;  4IO9 A;  1Q1B A;  3BZK A;  4OON A;  3U4Z A;  1HZB A;  1Z47 A;  1IXR A;  3J81 c;  4OX9 Q;  3W1G A;  1LTL A;  2PQA B;  5IE8 A;  3MEF A;  1SFO H;  1PA6 A;  4JI7 Q;  5AJ3 L;  3DLL A;  2OWO A;  4JI6 Q;  4AH6 A;  1K0R A;  2UUA L;  4BY7 G;  2BH2 A;  1MJC A;  1Z9F A;  2N8N A;  4X66 Q;  1XTD A;  1QVG A;  4H02 A;  5C0X I;  3AFP A;  5IWA Q;  4AQY Q;  1XMO Q;  1QVF A;  4C2M H;  1YZ6 A;  2I0Q A;  3HOW G;  3U58 A;  1D8L A;  2K14 A;  1I5F A;  5JJK A;  3RLO A;  4OWT B;  3I4M H;  4JC0 A;  1VQH A;  1PHJ A;  4B3T L;  3KYH C;  3TQY A;  4P71 A;  2JA6 G;  1WCM G;  2Q2I A;  2JA9 A;  1E3P A;  4YWK A;  3T1H Q;  1TWF H;  3A5Z B;  4BA1 I;  3TS0 A;  1N34 Q;  3S17 H;  4HJ8 A;  1HR0 Q;  2ZTE A;  5IYD H;  4DNI A;  2Z6K A;  3FKI G;  2MO0 A;  4LFA L;  4A3G G;  1Y1V H;  5FJ8 G;  3EBE A;  2VQE Q;  2D0O A;  3GO5 A;  2YTY A;  1C7Y A;  4B3S L;  4NB3 A;  3GD7 A;  2QEX A;  3L7Z C;  3RLF A;  4DV5 Q;  1XPR A;  4GN4 B;  3W1B A;  2F3I A;  5HY6 A;  3M7N A;  4QY7 A;  1VQ5 A;  4JV5 Q;  3STB C;  1IBL Q;  1EOV A;  2CQO A;  3M4O H;  3I4N G;  3K7U C;  2UXB L;  1U0L A;  1WI5 A;  1D7Q A;  1VQJ A;  2F52 A;  1N32 Q;  1UE5 A;  4A3B G;  3IRB A;  3PSI A;  1I94 Q;  3FKI H;  4YY3 L;  2WFW A;  4DV2 L;  1N33 L;  1KQS A;  4POG A;  2BA1 A;  4JI3 L;  4HID A;  3CMA A;  1VQM A;  1M1K C;  1XNQ L;  2ZJP A;  3U50 C;  1VQP A;  3T1Y L;  3BJU A;  1EQQ A;  3ULL A;  3FHW A;  3PUY A;  4JI2 Q;  1TXY A;  1MKH A;  4DPG A;  3K7A H;  1PH8 A;  2Q2U A;  5IT9 c;  4LWC A;  1VS0 A;  1YI2 A;  3FP9 A;  3H3V H;  4Y52 H;  2D0P A;  1G51 A;  3G4S A;  4R4T A;  2NVX H;  1Y14 B;  4XIG S;  4DV4 Q;  1XNR L;  2R7Z H;  3NEM A;  4DR1 L;  4LFB L;  3TEH B;  1KD1 C;  4A3B H;  4QQB X;  3TRE A;  4BA2 I;  5AJ3 Q;  2K50 A;  1J5E L;  2UUA Q;  1RL2 A;  2AHO B;  2UXC L;  1U5K A;  4JOI C;  1EQR A;  2AWN A;  1XPO A;  4EX5 A;  3GDE A;  3CC7 A;  1VQ4 A;  1H95 A;  3AEV A;  4DR2 L;  1VQK A;  2WB1 E;  4LUO A;  1BVS A;  5C3E G;  3J80 i;  2ZM6 L;  4HJA A;  3HOZ H;  1OXS C;  2KHI A;  3HKZ G;  5LMN W;  4X66 L;  3GTP H;  1NE3 A;  4R4O A;  4B3T Q;  2R93 H;  2VW9 A;  4L5Q A;  4X62 Q;  4DV7 L;  4LF8 L;  2WAQ G;  4GLX A;  3G71 A;  5FLM G;  2R7F A;  5C44 H;  3RN2 A;  2MQH A;  3STB D;  5M3M G;  2VQF L;  1MIU A;  4DUZ L;  3NEN A;  4P75 A;  1JB7 A;  4P73 A;  1CKN A;  2F4V L;  4B3S Q;  4A3J G;  3S2D H;  2AMC B;  4APV A;  4IOC A;  1FVI A;  2DGY A;  2K75 A;  2LSS A;  1HH2 P;  1TWA H;  1PYS B;  3D0F A;  3HOX G;  5GAG C;  1OXV A;  1MJE A;  5C0X J;  3GTL H;  1K73 C;  2UXB Q;  1NTG A;  4NXM Q;  4JG2 A;  4DV5 L;  1FJG L;  4PZ8 A;  3UDG A;  3CME A;  4JI0 L;  1BKB A;  3KDF A;  1YEZ A;  2N3S A;  2IX1 A;  3A74 A;  4YY3 Q;  5M5X H;  4DUY L;  2UUB L;  4DV2 Q;  1YBY A;  1CKN B;  1N33 Q;  1I3Q H;  1RIP A;  4JI3 Q;  1VQI A;  1CSQ A;  1KXL A;  1XNQ Q;  5IYB G;  1NY4 A;  4UPA A;  3T1Y Q;  1VQL A;  3F2D A;  2UUC L;  4A93 G;  3WWV A;  2EIF A;  2C35 B;  5FLX c;  3I56 A;  4PZ6 A;  3JAM c;  1XPU A;  5JEA J;  4HJ5 A;  1OTC A;  2HIX A;  1XNR Q;  4JOI A;  3RLN A;  2ATW A;  3KDF B;  4UP9 A;  4DR1 Q;  4LFB Q;  4IPD A;  1HNZ L;  4J15 A;  4A3K G;  4PG3 A;  1X65 A;  2YYZ A;  3DM3 A;  2RHQ B;  5IYC H;  1J5E Q;  1YHQ A;  4Y7N H;  1A0I A;  5LMN L;  3PF5 A;  3GTQ H;  4QL5 A;  4OO1 I;  4RMF A;  1X55 A;  3H0G G;  3KJO A;  4TVA B;  1P8L A;  4XTC S;  1KL9 A;  1SE8 A;  1K8G A;  2ZJR A;  4DR2 Q;  4MNO A;  4A3M H;  2Y0S G;  4DR3 L;  2ZM6 Q;  5C0X G;  4BBR H;  1KC8 C;  2D62 A;  1NMF A;  5M3F G;  2K52 A;  4BY1 H;  4DV7 Q;  1HZC A;  1LYL A;  2CFM A;  4LF8 Q;  4GOP A;  1K9M C;  4X6A H;  1YJN A;  4LNQ A;  4IFD I;  4A3K H;  2GVB A;  3CCE A;  4X64 L;  1BBW A;  3CQZ H;  1FL0 A;  1UE6 A;  2B63 H;  4A3I H;  4LF9 L;  2VQF Q;  2I5M X;  1XMQ Q;  4DUZ Q;  3HOY H;  1IL2 A;  3ERS X;  4KI0 A;  4X62 L;  3S2H H;  2F4V Q;  4AIM A;  4GKK L;  4DV0 L;  1SR3 A;  1I6H H;  3G48 A;  3PIP A;  3AQQ A;  1Y1W G;  4YCU A;  2ID0 A;  5LMU L;  3HOV G;  1K8A C;  3OYY A;  4BY7 H;  5JEA G;  3S1M H;  2JK8 A;  1QZH A;  3SGI A;  4GKJ L;  4GOP B;  3HOW H;  3CD6 A;  1FJG Q;  3CC4 A;  2UXD L;  2V1C C;  2E2I H;  3CCS A;  4JI0 Q;  5JJI A;  1BBU A;  3E9I A;  3J81 j;  2UUB Q;  3CCL A;  3KOJ A;  1VCI A;  4DUY Q;  2R92 G;  3M85 A;  2BA0 A;  3I55 A;  4NXM L;  2JA6 H;  1WCM H;  3PO3 G;  1N8R C;  1Q8K A;  2BH8 A;  4L5T A;  1Q82 C;  1VQ7 A;  2UUC Q;  1UE1 A;  2RCN A;  4A3F G;  3GTM H;  2FXQ A;  1V9P A;  4A3G H;  2HIV A;  1NMG A;  5FJ8 H;  2JA7 G;  4IPC A;  4YWM A;  4LF5 L;  2RF4 A;  2YTV A;  1PYB A;  4X65 L;  4OWX B;  2JQO A;  2VS1 A;  1KRT A;  3I2Z A;  2I5H A;  2WAQ E;  2NVT H;  3K81 C;  2R6G A;  1Q81 C;  1HNZ Q;  2A1A A;  3J7A 5;  2AKW B;  1N9W A;  1HNX Q;  2NVY H;  5HGQ A;  2I5L X;  5LMN Q;  1L1O A;  3HOU G;  4BXX G;  2R92 H;  3S1N H;  1E22 A;  2MO1 A;  4ALP A;  2EXD A;  2IHE A;  2LXJ A;  4C3I H;  4POF A;  3H3V I;  4KHP L;  1A62 A;  2K5N A;  1W3S A;  4GN5 A;  3CP0 A;  2CCZ A;  5C4X G;  3S1Q H;  3ZJY C;  4MZ9 A;  4DR3 Q;  1TWH H;  4FDB A;  5EAY A;  1PH3 A;  2JA7 H;  3LGJ A;  4IPH A;  3ICE A;  1EIY B;  4A3L G;  4LF6 L;  1SMX A;  3S24 A;  2JA5 G;  5GAE C;  4X64 Q;  1V43 A;  1Q7Y C;  1L1O B;  4LF9 Q;  3HOU H;  2JA8 G;  2CWA A;  1YVC A;  2KBN A;  2PI2 A;  4YWL A;  1O7I A;  4GKK Q;  4TQU S;  3TRZ A;  1NBW A;  4DV0 Q;  4A3D H;  4C3J H;  4BBS G;  5LMU Q;  4DV1 L;  2A8V A;  4A3C G;  1VQA A;  1HJP A;  1XMQ L;  1K3R A;  4B3M Q;  4P72 A;  4GKJ Q;  4GOP C;  4QGU A;  5IP7 G;  1B70 B;  1YJW A;  4P74 A;  2OQ0 A;  4A3L H;  2UXD Q;  3UDF A;  3BZC A;  1WFQ A;  4GS3 A;  1PH5 A;  2JA5 H;  3G6E A;  4R1J A;  1YIJ A;  3U4V A;  3GTG H;  5C3E H;  4DAY B;  5BR8 L;  1Q86 C;  1E1T A;  2K5H A;  2UU9 Q;  2HHH L;  3PGZ A;  2NZO A;  4LF4 Q;  2VUM G;  1A63 A;  1OXX K;  4DR7 L;  1AH9 A;  3UDX A;  3AFQ A;  3NEL A;  1VQ9 A;  5FLM H;  2JE6 I;  4C3H H;  4AYB G;  1C9O A;  5M3M H;  4JI4 L;  2LXK A;  2MFI A;  4LF5 Q;  1PH1 A;  2ES2 A;  1GO3 E;  4A3J H;  4X65 Q;  2OCE A;  3J80 c;  1VQC A;  4R4Q A;  4LUV A;  3CCJ A;  2A19 A;  1E24 A;  3ULJ A;  2E5L L;  3HOX H;  5GAH C;  4JBM A;  4QJF A;  2N49 A;  1G6P A;  3CW2 C;  3UE0 A;  3J81 i;  2XTI A;  3PUX A;  1IBM L;  3CPW A;  1PVO A;  4KHP Q;  3PO2 G;  1EUJ A;  3W5O A;  2XGT A;  1HNX L;  1CKM A;  4OO1 G;  1JT8 A;  1AE2 A;  3PIO A;  3CCV A;  4GNX C;  3E9H A;  4HJ9 A;  1IZ6 A;  1WYD A;  4JBK A;  2OTL A;  4UP8 A;  1KIX A;  5IYB H;  3GTJ H;  1L0W A;  3M3Y H;  1HZ9 A;  4A93 H;  4LF6 Q;  1L1O C;  2N78 A;  4IJL A;  3RZD H;  2AWO A;  2NZH A;  1YJ9 A;  2K5V A;  1PH9 A;  1PH4 A;  1YHA A;  3CC2 A;  3OW2 A;  2Q2H A;  4L5S A;  3S15 H;  5JJL A;  2YU9 H;  4IPG A;  2MNA A;  1GVP A;  4DR5 L;  2KCM A;  2NN6 I;  2WP8 J;  4EQ5 A;  4DR6 Q;  1KRS A;  1QUQ A;  4DV1 Q;  2ASB A;  2OQK A;  1PFS A;  1CKO A;  2ALY B;  3I4M G;  3S14 H;  1B8A A;  3H0G H;  3PUZ A;  1HNW Q;  3E0E A;  2GVA A;  3GTO H;  1JE5 A;  4DK6 C;  4A3D G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...