1TWFH

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twfH00
1LYLA 3RZOH 2NZHA 4C2MH 2LXJA 1N34Q 1MJEA 1CKMA 1LUZA 1C9OA 1N32L 1EFWA 1VQ9A 4Y7NH 5C0XG 5HGQA 3CPFA 3OW2A 1KAWA 1HNXL 1UE7A 3S16H 1VQ8A 1VQ7A 1Q81C 3K80C 1X6OA 4QY7A 5M3FH 4DUZL 4A3MH 4DAYB 2K4KA 5GQOA 1KHIA 4HJAA 2OTJA 1B7YB 1M90C 1X9NA 4A3MG 4A3JH 1Y1VH 2Q2UA 3S1QH 1HNXQ 5IYBH 4YHHL 1WCMH 1YEZA 1PH1A 1VQHA 1VQLA 3PUZA 4LF9L 2N3SA 4IFDI 4B3SL 1L2FA 4JBWA 3CMAA 2YU9H 2VS1A 3GO5A 4DUZQ 1NBWA 1NJIC 4NXML 2R92G 2A1AA 1YVCA 3A5ZB 4JI6L 2FXQA 3EN2A 5LMNQ 4DV0Q 4LNQA 2R7DA 3PUYA 5LMUQ 4BY1H 4YHHQ 1MJCA 4WJ4A 1Q82C 5IP7G 4GKKL 1S40A 2F4VQ 4B3SQ 2XGTA 4DNIA 5M5WH 5GAGC 4IO9A 3LGJA 4AIMA 3S14H 4OX9Q 1AH9A 3HOXH 3H15A 3L7ZC 3JAMi 1FL0A 2UU9L 3CCSA 4LF5L 3FHWA 1IZ6A 1DGSA 3A0JA 4IFDG 1J5EL 1LM0A 2CQOA 3PSIA 2BH8A 3CCLA 4BBRH 4GKKQ 1PH7A 4A3EH 4O2DA 1VQNA 4BY7H 4JCVE 3PUXA 4J15A 1YHAA 3UDFA 1PFSA 1GD7A 1SN8A 1N36Q 5FJ8G 2IY5B 4A3KH 2UU9Q 4LF5Q 1E3PA 1TWFH 3HKZG 2ZM6L 2JA8H 4BY7G 4DR4Q 4Y52H 1Z9FA 3PIOA 1VQMA 4X65L 4A3KG 1Q1EA 1X65A 2Z6KC 2ZTCA 3CF5A 1MIUA 2D0OA 1B70B 1TXYA 5C3EG 4DV4Q 4MZ9A 3W1GA 2UUBL 4R4IA 3HOUH 4IPHA 3J80i 3GTJH 1VQDA 1XPUA 1LTLA 2MO1A 1U0LA 4X65Q 1G6PA 2H5XA 2IX0A 4A76A 4UY8C 1RL2A 2VQFL 4GOPA 1SR3A 3HFZB 2B3GA 3CCUA 1K3RA 4GOPB 2A19A 1K0RA 3KF8B 4XIGS 3F2BA 4HIMA 1Q86C 3HOWH 4YWKA 4PMWA 1EQQA 4JI3L 2DUDA 4IJLA 3HKSA 3HOWG 2Z0SA 2Q2TA 3U50C 1KXLA 4LF8Q 4KHPL 2CWAA 2IHEA 1EQRA 3I4MH 5FLMH 4QQBX 1PH3A 2JA6G 3S2HH 5JEAJ 4L5RC 4WJ3M 4DK6C 4JV5Q 4IOCA 3GD7A 3DLLA 5BR8L 2RF4A 2Y0SG 4HIOA 2MQHA 4X66Q 1X55A 3ULPA 2JJQA 1WJJA 1PYSB 1SMXA 4UP9A 2R93G 3SGIA 4HIDA 3MXNB 1OTCA 3HOVH 4RMFA 2WAQG 4KHZA 3J80c 3STBC 1HR0L 2JA5G 1VS0A 5BR8Q 4DR6L 4YWMA 3CCVA 4DV3L 4JC0A 2E5LL 3CCQA 4RG1A 1IXRA 4LF6L 2LSSA 2N49A 5IE8A 1QVFA 4DV7L 1IBLL 2R7FA 1KC8C 1KRSA 4PZ7A 2QGQA 1TWCH 3T1HL 2N78A 1FJGL 1VQKA 1YBYA 2CWPA 2C35B 3OTOL 4UPAA 4DR2L 3I4OA 4DV3Q 2E5LQ 1CKNA 4DPGA 1WFQA 1X3GA 1VQ6A 2D0PA 1C0AA 4K0KL 1CKNB 1A8VA 1IBLQ 1P16A 2WAQE 3G48A 5C0XI 4JI2Q 2JA7H 4DKAC 4LUVA 5AJ3Q 4L5QA 1I94L 5IY0A 5C44G 2JA7G 5JEAG 2F52A 1HJPA 2VZAA 4DUYL 3AQQA 3PO2H 2UUAQ 2BH2A 2OQ0A 3L2PA 4LF4L 3I4NG 1Y1WH 4DR3L 4K0KQ 1VQPA 4YCVA 5J3BA 2UXCL 1QVCA 4AQYL 4LF7L 1I94Q 3GTKH 2AWOA 3RR5A 1EYGA 4APVA 4DUYQ 1UE5A 2GN5A 2UXBQ 2WB1E 2AMCB 3U4VA 4HJ9A 4DR5L 4R4CA 1V9PA 4LFCQ 4EQ5A 2ASBA 1HNWQ 2F3IA 2N8NA 4P73A 4LFBL 4GLAC 2Z6KA 3S2DH 2MO0A 3BJUA 4JI0Q 4A3GG 2KCMA 1JMCA 1OXTA 3CC7A 3S1MH 3PIPA 1D8LA 1UE6A 2ZTDA 4L5TA 2E2HH 1N32Q 2Q2HA 4DR5Q 4A4IA 4B3RL 4R4TA 1EOVA 1EWIA 4OXPA 5IP9H 2R92H 4X64L 4JI0L 3HOZG 4A3LG 2PI2E 2NVTH 4QL5A 2K5NA 2L15A 1KIXA 3G4SA 1GVPA 5IP9G 4BBSG 4LW1A 1I6HH 4O0AA 3BZCA 5M3MG 4GS3A 4YCWA 3CCMA 5C4XG 1AE2A 5IP7H 1QUQA 1SFOH 1PH8A 3GTLH 1CUKA 1A63A 4LFAL 4NXNL 4JI4L 3KJOA 4C3IH 2ATWA 1QUQB 4LF9Q 3H0GG 4X64Q 1HNZL 5IYCG 1HZBA 4NXMQ 3S17H 4POGA 2VL6A 1E7ZA 4JI6Q 1U5KA 4P75A 1FVIA 3I2ZA 4JI5L 1K83H 3VDYA 4JI4Q 3CC2A 4NXNQ 1Q46A 2K50A 3GTOH 4JBKA 4YCUA 4QJFA 5ELOA 5FJ8H 1HNZQ 3UE1A 1G291 1MKHA 3IRBA 1PHJA 4GKJL 5JJKA 3EBEA 4A3DG 2JQOA 2YTVA 4NPSA 4DR1L 2D62A 3M4OH 1Z47A 1YHQA 1J5EQ 3I7FA 5LMNW 2CCZA 5C3EH 5IYDH 1B8AA 2OQKA 2ZJQA 4AYBG 5GROA 1PV4A 1JE5A 2KBNA 3PUVA 4IPCA 1AE3A 1IBKL 1I3QH 3H3VI 2OCEA 5IYDG 4GNXC 1KL9A 3M4QA 2ZM6Q 1QVGA 3BU2A 2AKWB 4A3BG 2I5MX 2RCNA 4C3JH 4P71A 1SROA 1YJ9A 4LUOA 2MNAA 3JAMc 3F2DA 2UUBQ 4UP8A 2K5VA 4HJ5A 1K8GA 2NZOA 1T9HA 4A3IG 1VQ5A 1Y14B 2OTLA 4BXXH 3T1YL 2JA6H 2E2JH 1VQIA 4AYBE 4A3FH 1SLJA 3J7ZC 2VQFQ 1S72A 1VQOA 4BXXG 3STBD 4GN3B 2KCTA 3CXCA 3I55A 4POFA 4A3FG 3NEMA 4X62L 3RLNA 4DV1L 1K8AC 4C3HH 4OWTB 1BKBA 4JI3Q 2R93H 2ALYB 3JC66 1EIFA 1XNQL 3E9HA 4JYAL 4KHPQ 2JA5H 3KFUA 3TQYA 1R9TH 1PA6A 2K5HA 5JJIA 3HOYG 1GKHA 4QGUA 2HHHL 3K8AA 4TQUS 2QEXA 4JI8L 4LWCA 4DV6L 5E7NA 1XTDA 3M9BA 2YTYA 3PUWA 1JJ2A 1J6QA 1XNQQ 4JYAQ 3FKIG 2VNUD 3TEHB 1VQFA 2NN6I 3PF4A 2HHHQ 1VCIA 3M4PA 4JG2A 1HR0Q 2B63G 1E1OA 5FLXc 1K9MC 2HQLA 4DR6Q 1PH6A 4HJ8A 2ZJRA 1BBUA 2HT1A 4DV6Q 2GVBA 3CC4A 1JT8A 4DV2L 4A93H 2WB1G 4LF6Q 3G71A 4P72A 2JEBI 5EAYA 3U4ZA 1E22A 2EQSA 3NBHB 1NMGA 5C44H 4DV7Q 1XPOA 2NVXH 2K52A 3GTPH 2PNHA 4A93G 2VUMG 2QA4A 1YZ6A 3T1HQ 2DGYA 1FJGQ 3CD6A 2CFMA 3OTOQ 4DR2Q 1PH9A 3F1ZA 3I4NH 1PVOA 3CCJA 1I5FA 4DV2Q 2NN6G 2I0QA 3PO3G 1XMOL 1ASYA 2HIVA 4EX5A 1JJGA 5JJLA 1H95A 1S3OA 4PZ8A 3UE0A 2BA0A 2XTIA 3RZDH 3GTGH 3W5OA 3M7NA 4IPGA 4R4QA 3AYHB 4JOIC 4MNOA 2VW9A 2B29A 3CCEA 2E8GA 4FDBA 4GOPC 1XJVA 3I56A 2BA1A 4GLXA 1BBWA 3CQZH 1KD1C 4LF4Q 4A3GH 1NMFA 3M85A 4DR3Q 2R7ZG 1X3EA 1WI5A 3KLWA 2UXCQ 3J81j 4AQYQ 2RHQB 1YI2A 4LF7Q 4JBMA 3ZJYC 4KI0A 1N34L 1WYDA 1L0WA 3W1BA 2VY3A 4OWWB 3HOZH 4A3LH 2CKZB 1P8LA 4GNXA 1V43A 3F8TA 1YITA 4YY3L 2JK8A 1X54A 4GLVB 4OONA 4GNXB 2ID0A 2KENA 4BBSH 5M3MH 4LFBQ 5C4XH 3K7UC 2WP8J 1YIJA 1Q7YC 4YWLA 4IFDJ 2EXDA 3DM3A 1QZGA 2ZTEA 3CP0A 1O7IA 1VQ4A 1E24A 3H0GH 1Q12A 1L1OC 2PMZE 3PV0A 5IYCH 3FP9A 4B3RQ 4YY3Q 1SE8A 1VQAA 2JA9A 5GADC 1OXUA 1OXSC 3A5UA 1QZHA 3KF6A 2NVQH 3PF5A 4DV0L 5LMNL 1FGUA 3KF6B 5M3FG 3UDGA 4B3ML 5LMUL 4LFAQ 1G51A 3S24A 4L5SA 2F4VL 3ERSX 4A3JG 1Y1VG 2A8VA 3ULJA 5IYBG 1VQGA 1WCMG 5M5XH 4A3DH 2NVYH 3J81i 3S1NH 2AHOB 4OX9L 2KHIA 2OWOA 4A75A 4JBJA 4XTCS 1JB7A 4B3MQ 3AEVA 4JI5Q 3RLOA 3OYYA 4GN5A 4BY1G 4IPDA 2E2IH 1NE3A 3RN5A 2R6GA 3S1RH 1N9WA 1N36L 4GKJQ 2IHFA 4BA1I 5K36G 4JI1L 1CSQA 1Q8KA 4DR4L 4A3BH 1HZ9A 4KLKA 1A0IA 3HOXG 4DR1Q 3L0OA 3UDIA 2ES2A 3S15H 1XMQL 5M5YH 1PYBA 1GM5A 3D0FA 2IT1A 2UUCL 3CW2C 3E9IA 4BBRG 4DV4L 1IBKQ 1PH4A 1XNRL 3KYHC 3NENA 2PQAA 3D31A 4R1JA 4JI1Q 5DLQE 3CAMA 4A3EG 4A3IH 5GAEC 3H3VH 4OO1I 3CCRA 4A3CH 2PQAB 4GN4B 3AFQA 3U58A 1PH2A 1YJNA 4IOAA 1XMQQ 2LXKA 3TREA 5H1SE 1C7YA 2JA8G 1NY4A 2PI2A 5ELNA 3J81c 2UUCQ 4DR7L 4A3CG 1RIPA 1X3FA 2GVAA 1M1KC 2UXDL 1XNRQ 2I5HA 3Q8DA 2ZJPA 2KHJA 3RLFA 5IWAL 3CPWA 1YJWA 1N8RC 3HOUG 1TWAH 2YV5A 3GDEA 3TS0A 4JOIA 1XPRA 3T1YQ 4B3TL 3HOYH 4LF8L 3TS2A 4DR7Q 1UWVA 4OO1G 4LUZA 3B6YA 4HJ7A 2UXDQ 2WFWA 4JV5L 1EUJA 3A74A 4MTNA 3HKZE 2RHSB 4ME3A 4OWXB 1N33L 2Q2IA 4X66L 4X62Q 4DV1Q 5IWAQ 3PCOB 3FKIH 1IL2A 3PGZA 4DAMA 2IX1A 4B3TQ 3NELA 4P74A 1K73C 1HZAA 2YYZA 4UP7A 2B63H 1KRTA 3E0EA 1Q1BA 4TVAB 1D7QA 2I5LX 2HIXA 5C4JH 2VQEL 3I4MG 5FLMG 5HY6A 4JI8Q 3UDXA 1N33Q 3MEFA 5GAHC 3J7A5 3WWVA 1OXVA 1ASZA 1OXXK 3ICEA 3GTQH 3KJPA 1NTGA 3M3YH 2V1CC 3PO3H 3AFPA 5IT9c 1PH5A 1L1OA 1TWGH 2VUMH 3F2CA 4R4OA 1A62A 3K81C 1VQCA 1L1OB 2YTXA 2AWNA 1CSPA 4DV5L 1X56A 2K14A 2VQEQ 3G6EA 3KDFA 4ALPA 3HOVG 1VQEA 5C0XJ 4BA2I 4H02A 3RNUA 2EIFA 3KDFB 3CMEA 3GTMH 1SRUA 3ULLA 1WOCA 3BZKA 2MFIA 1TWHH 1HZCA 1EIYB 1YHBA 4AH6A 4JI2L 5AJ3L 1VQJA 4JI7L 4DV5Q 2Y0SE 2JEAI 2UUAL 2R7ZH 1I50H 1HR0W 1V1QA 4IJHA 4PZ6A 3K7AH 1XMOQ 1IBML 4NB3A 4X6AH 1IYJB 2JE6I 3ER0A 3KOJA 4JI7Q 4QIWE 1HH2P 1UEBA 3TRZA 1GO3E 3K0XA 2UXBL 4DK3C 4LFCL 1UE1A 4PG3A 1W2BA 1E1TA 1VQBA 1HNWL 1JJCB 1BVSA 3RN2A 2K75A 3PO2G 1W3SA 1YNXA 1IBMQ 3EIVA 4HIKA 1CKOA 1Y1WG 1KQSA
chains in the Genus database with same CATH superfamily
4IUVA 2LXJA 3GP7A 1EFWA 2Z1CA 5DEHA 5C0XG 5HGQA 1HNXL 2IW3A 1UE7A 3S16H 4EGVA 4DAYA 1JWMD 1Q81C 2Q8IB 1DOMA 4DUZL 2CHBD 5M3FH 4DAYB 2K4KA 1PFMA 1B7YB 1WTHA 2NWGA 4PV1C 2SOBA 1U4RA 1B50A 1Y1VH 1HRJA 1HNXQ 4YHHL 1WCMH 4LF9L 4B3SL 3MC0B 1E0BA 3CMAA 1TWAB 2VS1A 2YU9H 4DUZQ 2R92G 1EU4A 2QEJC 4NDXA 2EY5A 1NR2A 5JJZA 3T4AC 5LMNQ 5LMUQ 1LTTD 4YHHQ 3IFDA 4WJ4A 5IP7G 1S40A 4B3SQ 5K36H 4DNIA 4ILWA 5GAGC 1DM0B 3LGJA 4AIMA 3HOXH 3H15A 3TZDA 1AN8A 1FL0A 3E5SA 3JAMi 1K28A 2F0DA 3A0JA 1PTOC 3P1HA 2WB1B 3QOLA 4HSVA 4J15A 4WRDA 4YIJA 1TWGB 1SN8A 2IY5B 2F0TA 2JA8H 4Y52H 1Z9FA 2Z6KC 4K2LA 5ELCA 1LTGD 1CK1A 4DV4Q 4K8JA 3W1GA 2UUBL 2A6EC 1GUNA 3HOUH 1K3BC 3J80i 1TS2A 2B2YC 1XPUA 4RH6A 2MO1A 1G6PA 2H1EA 3OHXC 4EVOA 4A76A 1RL2A 4GOPA 4G7ZC 3KF8A 3K7AB 5JPNC 4GOPB 2F0HA 3KF8B 1Q86C 2F0SA 3D4RA 5FOBB 3P20A 4IJLA 4XT1B 2Z0SA 3PO2B 1KXLA 3IAYA 2F3WA 1WTWA 4ZUJA 1PH3A 4MIUA 5JEAJ 3OOCA 3NWTA 4DK6C 2RF4A 1BOSA 3FEWX 4C2MB 3MXNA 1JQYD 5CYUA 1SMXA 2R93G 3MXNB 1OTCA 1IL8A 3EFXD 2A74C 2K04A 4LF6L 2D5DA 4A3JB 1IBLL 1HXYD 3J7YW 1FJGL 1VQKA 3OIPA 2X6GA 4CKBA 3E6ZX 1HQMC 4DPGA 2HCCA 4K0KL 1IBLQ 2JA7H 5CV4A 2WAQE 3G48A 1SBBB 1IHZA 1IYVA 1EQTA 2Z8LA 4IURA 5JAVA 1HJPA 3S14B 2BH2A 3I4NG 1Y1WH 4K0KQ 1VQPA 3IL8A 5LHY1 1PTOB 2O2LD 4BBRB 4AQYL 4LF7L 5LL6S 1UE5A 5KYIA 2WB1E 4LFCQ 2ASBA 2Z6KA 3CRLC 4E6IA 1GUGA 2KCMA 2IJ0A 1OXTA 1WTXA 3S1MH 5EPJA 1D8LA 1I4RA 1EEFD 2B2YA 1EYDA 3NBIA 2QW7A 4A4IA 4B3RL 1EOVA 3EJIA 1EWIA 4OXPA 2DNCA 4A3LG 1AW7A 2EYOA 2K5NA 5FLXL 1GVPA 1EL0A 4GS3A 2FFKB 1PTOD 3GTLH 1A63A 4C3IH 1SYEA 1HNZL 4KN4C 3S17H 1JOOA 1KAAA 3S9WA 2EZVA 3I4MB 5I4DA 3Q24A 3I2ZA 3VYTA 5IT9E 4QJFA 5ELOA 1HNZQ 2A6ED 3C2PA 3IRBA 5JJKA 4CDDC 2YTVA 2CW0C 3M4OH 1Z47A 2K1BA 3NTIA 1YHQA 3MTSA 5G3LD 2CCZA 5C3EH 4UHVA 4AYBG 1UUPA 2KBNA 1RODA 3H3VI 1I3QH 1ICFB 2OCEA 3KLRA 5HURA 1Q90A 4RCOA 4GNXC 1KL9A 3BU2A 2I5MX 4ZKCB 4RA8A 1XX8A 4ABNA 4P71A 3I8ZA 2R61A 3H3VC 3HRZC 3BVGA 2K5VA 3TP8A 2NZOA 4A3IG 2OTLA 4L63B 1GJXA 2JA6H 2E2JH 3X3NA 5CMDA 1SE2A 1SLJA 4UDUC 3J7ZC 2VQFQ 4BXXG 2KCTA 2JSOA 4KTAA 4C3HH 4OWTB 1BKBA 4ULLA 1EIFA 2HHHL 4QGUA 2EYLA 3FPPA 2YTYA 1DD2A 3QG1A 3PUWA 1JJ2A 1M4VA 3H94A 2XN9C 3TEHB 2HHHQ 3J7AF 1VCIA 3M4PA 5FO8B 5FLXc 1K9MC 4K5WA 4HJ8A 2GVBA 3CC4A 3NBHA 3TDQA 1A3TA 2JEBI 5EAYA 4DV7Q 3PO3G 3NBHB 1STAA 1BF4A 5JEAH 2K52A 2GA4B 3CD6A 1YZ6A 1I4HA 2CFMA 4N8FA 3OTOQ 1PVOA 3F1ZA 1DOLA 5CC4A 1I5FA 3J81L 1ASYA 2HIVA 1RJTA 1JJGA 5JJLA 2FJ2A 4B9XA 1FYCA 4PZ8A 1SAPA 3P75A 2B8GA 3NTHA 4IUUA 4TKOB 2ENBA 3VR2A 1JORA 3TRZA 4FDBA 2BA1A 3T53B 2OEOA 1JICA 1NMFA 4WFN3 3M85A 2B39A 3KLWA 4QF4A 3TMEA 1WTPA 1WTOA 4JBMA 4B9WA 1N34L 3VR5A 4B08A 2VY3A 4OWWB 2CKZB 4GNXA 3ND9A 3F8TA 2JK8A 4KMUC 4GNXB 2ID0A 2KENA 4LFBQ 2WP8J 1YIJA 2B2WC 4BS9A 3DM3A 2NB0A 1VQ4A 1LV9A 4A3IB 2QKIC 2PMZE 3VA5A 2OXPA 1WTQA 1SE8A 3J80L 5GADC 1QZHA 1YNJC 3FPUB 4X3UA 2DNEA 1FGUA 1RDPD 1EY0A 2CW0D 3OIQA 1QB5D 3S24A 2EYPA 1D5XC 3ERSX 4FXGC 5M5XH 1EOTA 4OX9L 1ESFA 1RCVD 1SNCA 2KHIA 5DM73 2F0VA 3QOJA 3K5MA 4A75A 2OWOA 2JA5B 1G6ZA 1JB7A 3AEVA 1RKNA 2XIWA 3NXWA 3MA2B 3OYYA 4GN5A 4BY1G 2EY6A 1I6VC 2E2IH 5KIXA 4I7AA 1SYDA 4OIKA 2IHFA 4JI1L 5CORA 1Q8KA 5ELFA 4DR4L 4DR1Q 5KNCA 2ES2A 1GM5A 2F0FA 2IT1A 2F0MA 1LTID 3E9IA 1PH4A 1WD0A 3KYHC 4JI1Q 5C44B 2NVXB 1E2ZA 4A3CH 3AFQA 4NKLA 4IOAA 1YJNA 3NUCA 1C7YA 3J81c 4DR7L 3MXGA 1NSNS 3AMUA 1LTAD 3HGBA 1M1KC 3C3LA 2L9HA 2RDHA 3SK8A 1PZID 5IWAL 1N8RC 3RZDB 1TWAH 2YV5A 1LLRD 3TS0A 4DR7Q 3B6YA 2O4XA 4ZLTF 2V4DA 1B9MA 3A74A 4MTNA 1WVLA 2Q2IA 5IWAQ 3PCOB 3MFGA 1KRTA 3TN2A 3E0EA 1K8OA 4TVAB 2HIXA 2VQEL 4JI8Q 5M3MB 1ZEQX 5GAHC 2B2WA 1OXXK 4ZCKA 1R4PB 1PH5A 1TWGH 1FNVA 3H0GB 3KBGA 2ICEC 3R3OA 1KABA 1CSPA 2A68C 4DV5L 2VQEQ 3HOVG 4BA2I 2NVQB 2EIFA 3ULLA 2F3VA 3BZKA 2PO4A 1EIYB 1S5FD 4HCSA 3A55A 4DV5Q 4JI7L 2L55A 2WKCA 4A3DB 1TS5A 2IL8A 4FXDA 4DK0A 1HR0W 3K7AH 1CFMA 4KY5A 1XMOQ 4NB3A 2XNAC 5D3DA 1IYJB 3ER0A 3KOJA 4EQNA 4JI7Q 1HH2P 1HTLD 2UXBL 3VR4A 5IODA 1HNWL 4Z9CB 1JJCB 4RAUC 1BVSA 4RGOS 4A3BB 3A7AB 1W3SA 2NUCA 4QB4A 3S15B 1YNJD 3TSSA 4KY6A 1KQSA 1LYLA 2Z4IA 2SNSA 4C2MH 1MJEA 1CKMA 1LUZA 1C9OA 3PMFA 3OW2A 3CPFA 1KAWA 1A15A 2KUMA 5TSSA 1VF5C 3K80C 4QY7A 1O7LA 5GQOA 4HJAA 4Q5VA 4A3MG 4A3JH 3L3OC 1YEZA 1RF2D 1VQHA 1L2FA 4JBWA 2IWHA 3QB3A 3GO5A 1NJIC 2SEBD 3DM1A 2OT2A 2A1AA 3A5ZB 3BG3A 4XYQA 2FXQA 4DV0Q 4JI6L 1S4ZA 2RDFA 1VDZA 1EY5A 2IPKD 2R7DA 3PUYA 1MJCA 3H91A 2LFNA 2XGTA 3FKIB 4IZ8A 1WTVA 3QJYA 3S14H 1JOKA 4ZYSA 3CCSA 1PTOF 3EROA 2NTTA 4LF5L 1IZ6A 1DGSA 5C4JB 2CQOA 3A8KE 1X3PA 1PTOH 4BBRH 4X3TA 1PH7A 1SYBA 2EOTA 4O2DA 1VQNA 3PUXA 3UDFA 2Z6BA 5FJ8G 4LF5Q 2BOSA 3T51B 3PIOA 3C1FA 5DAUA 4K2KA 3QIAA 4A3KG 1X65A 4FXKC 2ZTCA 1KLGD 3CF5A 1DCZA 3URYA 1LTLA 2G9DA 1U0LA 4L8JA 5G3LF 4OO1H 1LT4D 3BVMA 2H5XA 1SR3A 2R7ZB 5BN4A 1EYCA 1K0RA 4HIMA 3F2BA 3F2UA 1EQQA 4JI3L 1I4XA 1KNEA 3VYSA 1EY8A 2Q2TA 1EQRA 3I4MH 5FLMH 4QQBX 2BE5C 2A68D 2MJ8A 2XVSA 4L5RC 2EJGC 4JV5Q 4WJ3M 4IOCA 2MHVA 1F9PA 4HIOA 2MQHA 1X55A 3RZOB 2JJQA 1GUWA 1PYSB 4IUTA 4UP9A 2WAQG 1CHQD 2N55A 3R93A 4K8IA 4A3MB 2HDLA 3CCVA 4WORA 3CCQA 1IXRA 2DY7A 3S1QB 1ZXTA 1KC8C 4TRDA 2QGQA 2C9OA 4V190 3T1HL 3QR8A 1STBA 2CWPA 4DR2L 4UPAA 3MXUA 4DF7A 1II3A 3EVQA 1CKNA 2JP1A 2PPBC 2QCPX 1X3GA 3BYTB 1VQ6A 2D0PA 1HTPA 1PFNA 1CKNB 3UI2A 5C0XI 1U4LA 4JI2Q 4DKAC 3GV3A 3LX0A 1AZPA 4L5QA 3VA7A 2UUAQ 4LF4L 5BN3A 4YCVA 5J3BA 1PZKD 4FYDA 1GHJA 4NP5A 4KK7A 4A3EB 1QE6A 2AWOA 3RR5A 1JCKB 3NP8A 5A2QL 2AMCB 2EXZA 4F8MA 4DR5L 4A3KB 1TWFB 3BDCA 1G2SA 4H7BA 4JI0Q 4A3GG 1JMCA 4PNYA 3CC7A 2HD3A 1UE6A 1K8MA 2F0EA 2Q2HA 4DR5Q 4R4TA 3GTJB 3PQIA 1CM9A 1Y69U 3HOZG 2L1BA 1CA6A 2L4NA 1TIID 5D3IB 3G4SA 5IP9G 4BBSG 3NTKA 2J0TD 4O0AA 4XDXA 3BZCA 5C4XG 4X3SA 1AE2A 2E76C 1QUQA 5IT9L 4NXNL 4JI4L 2ATWA 1QUQB 4LF9Q 5IYCG 1HZBA 4POGA 3BYYB 4QUCA 4MHEA 2RSOA 1STGA 3S2HB 4JI4Q 4NXNQ 1EY4A 2K33A 5I9PA 2CH4A 4GKJL 2O5JC 3BZDB 2K6AA 4QIWB 2D62A 2PW7A 4CKCA 5LMNW 1DZ1A 1B8AA 2N88A 1PV4A 4IPCA 5IYDG 1AZQA 4O42A 4RHSA 3M4QA 1TWCB 5KNBA 3MAQA 3E3XA 4FNFA 2F0JA 2BE5D 1LT6D 4FF1A 2UUBQ 1VQ5A 4BXXH 3H09A 1PXUA 3T1YL 4H0LC 4ZKBB 1B4OA 5JVG3 2QDBA 3HG9A 4GN3B 3I55A 5CV6A 4POFA 4A3FG 1TU2B 2WINB 3NEMA 5I2YA 4DV1L 1KLUD 2K5WA 3GTKB 4HAEA 2ALYB 3DWPA 5D65A 2JA5H 1PA6A 4HSPA 3HOYG 3K8AA 4TQUS 2QEXA 3OWEB 2KCCA 4DXGA 4DV6L 3M9BA 3A56A 2NYZD 2E2HB 1PMRA 1VQFA 2NN6I 3PF4A 4JG2A 2EJMA 2B63G 2R92B 4N9PA 2ZJRA 4DV6Q 5C3WA 1I6HB 3NQTA 3VR3A 4LF6Q 1PDQA 1S5CD 5C44H 2NVXH 3MWYW 2PNHA 2VUMG 2QA4A 1FJGQ 3WOEA 1SJHD 1R4QB 2NN6G 1PFBA 4EX5A 4L6TB 1K83B 2K01A 3CU7A 4DGZA 3GTOB 3RZDH 3W5OA 2A73B 4IPGA 2RVLA 1BBWA 1KD1C 1WI5A 3K6OA 2K5DA 2F0GA 4AQYQ 4LF7Q 1GOZA 3ZJYC 1WYDA 1L0WA 1CT1D 2Q8RE 2A5HA 4RGMA 1E2VA 1P8LA 2RSNA 1V43A 1NUCA 1D2BA 3W2DA 5M3MH 3K7UC 1Q7YC 2EXDA 4IALA 1Q8IA 3H0GH 1L1OC 2F1MA 3N52A 4B3RQ 2PNRC 3RD4A 1OXUA 2NVQH 3PF5A 4A3FB 1BNZA 5M3FG 5JVH3 4KD3A 3HZXA 3SHLA 1S5BD 3DWAA 2F4VL 4ID6A 1Y1VG 3VR6A 4A3DH 1WCMG 2R93B 3HOYB 2KVMA 5IGDA 5COYA 1QNKA 1STHA 4IQZA 3RLOA 2F4IA 3D6CA 2AUKA 4IPDA 4N8X1 1Y8PB 2R6GA 1SNDA 1N36L 5K36G 4BA1I 4DN4M 3PIP3 4A3BH 1HZ9A 3HOXG 3CKIB 2XRSD 3L0OA 3S15H 1UAPA 1O7ZA 1XMQL 3D0FA 2ZXPA 1XNRL 2PQAA 3D31A 5DLQE 1F77A 2EE1A 2PQAB 1PH2A 3U58A 1XMQQ 2LXKA 2JA8G 5M9OA 3I4NB 1JC7A 1NY4A 2PI2A 3NK9A 1A6XA 2GVAA 1BXTA 4K5VA 2EVBA 2UXDL 1XNRQ 2F0WA 3I72A 1B44D 2ZJPA 1ZKOA 3MVVA 3RLFA 1YJWA 3HOUG 1C0AA 4B3TL 4LF8L 4RKLA 3ZYYX 4LUZA 5JOBA 5ISRA 2UXDQ 1EUJA 2PZWA 3V96A 1MSHA 2RHSB 4ME3A 4OWXB 1N33L 4X66L 3FKIH 4XQQA 2MP1A 4B3TQ 4P74A 1HZAA 2YYZA 5CV5A 4JPBW 4DAPA 4IUQA 5C4JH 1SYFA 1N33Q 1ZYRC 1OXVA 1ASZA 3ICEA 1X32A 1NTGA 3I70A 2V1CC 5IGCA 1L1OA 1A62A 3MZ5A 3T13A 1L1OB 4XQNA 4ALPA 1HHVA 1XYIA 1VQEA 5C0XJ 1BCPC 1PRTC 4CJ2C 3KUPA 4ZAIA 3D6WA 1WOCA 1D1KA 2G9HD 2MFIA 1A2TA 3FVQA 4IN3A 4CKEA 1FGBD 5AJ3L 1UNSA 5CR3A 2A6HC 2NVYB 2JEAI 3S1NB 1VF7A 5DNFA 1K0SA 2R7ZH 1V1QA 5CV7A 5IGBA 4AYBB 1IBML 3JAML 5KYLA 1H9KA 5J22A 1J8IA 2F0PA 1CQFA 1UEBA 4PG3A 1HUMA 1YNXA 1IBMQ 4HIKA 1Y1WG 5M5YB 3TP6A 3RZOH 1ENFA 1U9RA 1N34Q 5T1IA 5KGUA 1N32L 1VQ9A 2PYKA 3D4DA 1X3QA 1VQ7A 1QNUA 5IIFA 4A3MH 3R2IA 4XQJA 2KA7A 1M90C 1UEAB 4J8QA 4U68A 3S1QH 2LKVA 5IYBH 1PH1A 1VQLA 1F2ZA 3PUZA 2N3SA 4IFDI 4R8IA 4NXML 1NBWA 4OELB 1YVCA 5EQ0A 4LNQA 1MHWC 3RMHA 1GUOA 4IO9A 4C3IG 4OX9Q 4TSSA 5FLXE 2E2DC 2XWJB 4IFDG 1J5EL 1LM0A 3CCLA 2J7ZA 4A3EH 3I3CA 3PO3B 4JCVE 5EKLA 2FINB 1YHAA 3DEOA 5EGTA 4A3KH 4BY7G 1E3PA 1TWFH 3HKZG 2ZM6L 4DR4Q 2F0LA 2B2VC 1MIUA 2D0OA 1B70B 1PRTB 1TXYA 5C3EG 1SE4A 1TWHB 4R4IA 4IPHA 3TZUA 3GTJH 1VQDA 4FO2A 4R9WA 1NCVA 1LT3D 1D5MC 4UY8C 5KRUA 1I50B 2KCNA 4X3KA 2D9UA 3Q22A 1K3RA 2A19A 1ZYRD 4XIGS 4CDEC 5EPLA 1W6JA 4PMWA 2DUDA 3HKSA 3HOWG 4CHTB 1CHPD 2I46A 3TBIB 4KHPL 2CWAA 4KV6A 4HMIA 1V1OA 2JA6G 4JVZA 3S2HH 1JR0D 3K58A 2HDMA 2LS01 5BR8L 2Y0SG 1BCPD 1PRTD 2QF7A 3ULPA 2EY2A 4C3HG 1JB3A 3GQBA 3SGIA 4Y7NB 3I73A 4KHZA 1EQVA 3STBC 4DNRB 3J80c 2E74C 1HR0L 2A6HD 2K05A 4OIJA 3KLSX 5BR8Q 4DR6L 1RTNA 2E75C 4YWMA 3PIO3 1M8AA 1TS3A 1CA5A 4DV3L 4RGNA 4RG1A 1QVFA 2KEDA 1STYA 2R7FA 1KRSA 4PZ7A 1TWCH 3LWEA 3M4YA 2C35B 3GV6A 5I6WA 1EY9A 2HCIA 4DFAA 1DJRD 4DV3Q 1WFQA 4BY1B 3TS2A 1A8VA 1P16A 1ILPA 4LUVA 1I94L 5ELBA 5IY0A 5M5WB 5JEAG 2F52A 3PO2H 4DUYL 3AQQA 4JW0A 2OQ0A 2EYJA 4DR3L 4UAIA 1EFID 2UXCL 2K7VA 1QVCA 3OSOA 5KNDA 1I94Q 3GTKH 5C0XH 4BY7B 4APVA 4DUYQ 4ZQ3A 2GN5A 2UXBQ 4U673 3U4VA 4FF3A 1HNWQ 1V9PA 4RCNA 3J81E 4GLAC 2M00A 2B2VA 2MO0A 3BJUA 1Y8OB 1S5DD 2ZTDA 3CHBD 2RA4A 2E2HH 1NR4A 5IP9H 2R92H 1D6EC 2B2UC 4X64L 1QCBD 2CVRA 3C1EA 3IKJA 3NE5B 2FMMA 4LW1A 1I6HH 2MUYA 4YCWA 3CCMA 1YNNC 5IP7H 1PH8A 1CUKA 1FR3A 4LFAL 3K0YA 3HOWB 4X64Q 2VL6A 4JI6Q 2Y0SB 1FVIA 4JI5L 5LL6X 1PLFA 1K83H 3VDYA 3GTOH 4YCUA 3NSWA 3UE1A 1G291 1MKHA 4QUFA 4RGTA 5C5LA 5NUCA 2JQOA 2KJXA 1B3AA 3HOVB 4DNTB 4OL7A 5IYDH 5GROA 1AE3A 1IBKL 4J6HA 1KTKA 1B53A 1QVGA 1C48A 1DOKA 1CZWA 2L11A 1I4QA 5C4ZA 1SROA 1YJ9A 4LUOA 4FP5D 1BDOA 3OW7A 3F2DA 4C3JG 5FK9C 2K5QA 1K8GA 2H4OA 1T9HA 3A7LA 4A3FH 4WJWA 4M1UB 1S72A 1EWCA 3STBD 1WD1A 2G5DA 1IW7C 1HA5A 4X62L 3RLNA 2C5CA 2F0NA 4JI3Q 2R93H 1SMYC 4RHRA 1XNQL 1J9OA 3E9HA 2D2CC 2B2TC 3A8IE 4N9TA 1SE3A 3KFUA 5JJIA 5CGKA 4RKBA 1GKHA 5E3FA 3BVZA 2ZXOA 3M7GA 1TKWB 2NBFA 3K5LA 3S2DB 4LWCA 5E7NA 2AUJD 1XNQQ 1J6QA 3DHQA 5IGEA 1W6KA 2J4XA 2QILA 2B2UA 2WACA 4KN7C 1QJOA 2NVTB 1PH6A 2EPBA 2HT1A 1JT8A 4DV2L 2WB1G 3G71A 1L0XB 4P72A 1SFOB 3U4ZA 1E22A 1LTRD 1NMGA 2F0KA 4A93G 1EZ6A 2DGYA 3T1HQ 1B2TA 4DR2Q 4C1NK 3I4NH 4G7HC 1LTSD 2WKDA 4DV2Q 2I0QA 2VB3X 1KDAA 3Q23A 2A69C 2MGSA 3ITPA 3QWNA 1O80A 1S3OA 5ELEA 2BA0A 2XTIA 2JYOA 4FVMA 4MNOA 3CCEA 2B29A 2CQAA 1XJVA 4GOPC 3I56A 5J39A 4GLXA 4LF4Q 3K5OA 1FNUA 1X3EA 4CJ0B 2RHQB 2DN8A 1YNND 1BO0A 4KY7A 3W1BA 2AQ3B 3K57A 2JN4A 2CH4W 4A3LH 4F88A 4YY3L 1X54A 1QOHA 4C3JB 4YWLA 4IFDJ 1QZGA 3J7AV 2ZTEA 3CP0A 1O7IA 1E24A 3PV0A 4OHJA 3FP9A 3Q0AA 4YY3Q 1TY0A 5FKAC 4PQXA 3A5UA 1OXSC 3KF6A 5LMNL 2EY1A 3KF6B 3A8JE 4CDCC 5LMUL 5A35A 1G51A 2TSSA 3RUZA 4A3JG 2A8VA 2F0OA 3ULJA 1VQGA 2NVYH 2B2TA 3J81i 2AHOB 3S1NH 2WAQB 2F0UA 4JBJA 1R9TB 3ERQA 3W3AA 1IKLA 1Z6HA 3K59A 1N9WA 4GKJQ 1T5XD 5ELDA 3DMUA 4KLKA 2SNMA 5E4XA 3UDIA 5M5YH 3CW2C 1XXGA 1AP0A 1AFPA 4BBRG 4A93B 2SDFA 1TQOA 2XRQD 1DYQA 1IW7D 4DV4L 4A3IH 3NENA 4R1JA 2F03A 4OO1I 5GAEC 3H3VH 3GTPB 4KKSA 1FNWA 3CCRA 2L5TA 1SMYD 1LT5D 1TVXA 1C8CA 1T5EA 3TREA 5H1SE 2XWBB 1X3FA 4EQPA 3WOFA 1ONLA 3Q8DA 1EWHA 3SVMA 4DAVA 3SEBA 1XPRA 3GTGB 3T1YQ 3EQLC 4QCLA 4OO1G 4F7XA 4HJ7A 4HTHA 3CQZB 1LACA 2WFWA 4A3GB 4G7OC 2BDNA 2K28A 4ME5A 4DV1Q 3OWFA 3ONAB 1O7YA 4DAMA 2IX1A 1K73C 4UP7A 1Q3LA 3HOZB 1Q1BA 2EDGA 1D7QA 2I5LX 1U4MA 1MGSA 4QMGA 3I4MG 4BBSB 5FLMG 3UDXA 3J7A5 3MEFA 5C4XB 3KJPA 4O1NA 3PO3H 2A69D 5IOCA 5IT9c 4R4OA 1VQCA 1OO9B 5EPKA 4M8AA 1Y8NB 2K14A 5T1GA 1BCPF 1PRTF 3KDFA 3G6EA 4H02A 4C56C 3KDFB 3CMEA 2L0CA 1TWHH 1YHBA 3A54A 4AH6A 1VQJA 5D14A 3SDZA 1I50H 4KJNA 4P2CB 4K5XA 4C1NI 4PZ6A 3R8BA 1A3VA 4QIWE 5JPMC 3S1RB 3K0XA 3FMCA 4DK3C 4LFCL 1WTRA 3NPPA 2K75A 3C46A 3EIVA 1IYUA 1CKOA 4EQOA 1JOQA 2NZHA 4J1MA 4CGYB 4Y7NH 2F0IA 3SR1A 1V1PA 1VQ8A 3D4WA 1MI2A 4PMBA 1V1PB 2M9VA 1X6OA 3D3RA 4NW2A 2ZXRA 3MEHA 1KHIA 2OTJA 5KEEA 5I9OA 1X9NA 1TY2A 5E1FA 5IGFA 2Q2UA 1EYAA 5A2QE 2NZ1D 3LNNA 2KOLA 2EYHA 4ZK9B 4ODGA 3EN2A 1S5ED 4BY1H 5BN5A 1Q82C 4GKKL 3R2TA 2F4VQ 5M5WH 3HEJA 1QILA 2PZTA 1AH9A 4IFDH 2B63B 3L7ZC 5EBCA 2UU9L 3FHWA 5FO9B 4LJZC 3ND8A 3PSIA 2BH8A 4GKKQ 3GTQB 3M3YB 4BY7H 2KECA 3HS0C 4G4KA 2VUMB 1PFSA 1GD7A 1N36Q 2UU9Q 3SK4A 1VQMA 4X65L 5CV9A 3K5NA 1Q1EA 3X3MA 3GTMB 4DXFA 4MZ9A 3V2TA 2RCFA 4X65Q 2LMCB 2HUGA 2IX0A 2PMZB 2VQFL 3HFZB 2B3GA 1RTOA 3NQIA 3CCUA 2RKSA 3HOWH 4YWKA 1EZ8A 3OMGA 3U50C 4I7ZC 4LF8Q 2IHEA 3AB9A 2Z4HA 5EBDA 3V05A 3GD7A 3DLLA 2KQ3A 4X66Q 2MPMA 3SK6A 4BWGB 1WJJA 1RHPA 1ICWA 4PMCA 1GHKA 1BUVT 4HIDA 3HOVH 4RMFA 3S16B 1F2LA 5C6AA 2JA5G 1BQQT 2VXWA 1VS0A 5IGGA 2BDOA 5M3FB 1BR9A 2RBMA 2E5LL 4JC0A 1AEXA 2LSSA 2N49A 5IE8A 4Q0FA 3QO2A 4DV7L 3CRKC 1Y1VB 4RWSC 1WCMB 2WV6D 2N78A 1YBYA 3OTOL 2YU9B 3I4OA 2E5LQ 1NNXA 3E0JA 1CQVA 1EY7A 1RD9D 5E4WC 4CBVA 5AJ3Q 5C44G 2JA7G 1EIGA 1ET6A 2VZAA 3HOXB 3L2PA 4HR7B 1B3QA 3BDOA 3NWSA 4XT3B 4RFBA 4KKUA 2PQEA 1EYGA 2RDGA 1A2UA 2TMPA 4HJ9A 4R4CA 3G7LA 4EQ5A 2JA8B 2F3IA 2N8NA 4P73A 4LFBL 1H9RA 3S2DH 4FF2A 4GZYC 2PZUA 5EJWA 3PIPA 3NHHA 1QWYA 4L5TA 1I4PA 2AQ1B 2OF1A 1N32Q 3HOUB 1U4PA 2F0QA 4LMQD 2BCOA 2PI2E 2NVTH 4QL5A 5FO7B 2L15A 1KIXA 4OGQC 4HN7A 3H6MA 5M3MG 1ESRA 1SFOH 1IKMA 3N6RA 3BS1A 3KJOA 1G91A 1ML0D 3H0GG 2L12A 1C4QA 1HPCA 4NXMQ 5K5PA 1E7ZA 1U5KA 1SNQA 1PZJD 4KHVA 1SYGA 2DJGC 4P75A 4MTKA 3I91A 3Q6SA 3U9SA 2K32A 2QDLA 3CC2A 1Q46A 2K50A 1SXTA 2LY7A 4JBKA 5FJ8H 3LWUA 1LO5D 1MSGA 1PHJA 1F2YA 2K03A 1DXMA 3EBEA 4A3DG 1TS4A 4NPSA 4DR1L 1I4GA 1D5ZC 1Z7TA 2RQXA 3BDLA 3I7FA 1J5EQ 2OQKA 2ZJQA 1JE5A 2IX3A 3PUVA 2P5ZX 1BCPB 3MFYA 1SNMA 2B8FA 2DJFC 3KLSA 1ENCA 2ZM6Q 3VYRA 4FF4A 2AKWB 4A3BG 1V8QA 2RCNA 4C3JH 4ZRZA 1PYWD 2MNAA 3JAMc 5I6YA 4UP8A 3I90A 1CZGA 1MD2D 4MN3A 2JA7B 4HJ5A 4CJ1B 4F87A 1CTMA 1Y14B 3KBXA 1SNOA 3FDTA 1B9NA 1VQIA 4H44C 3DXJC 4AYBE 2O5IC 1VQOA 4XXEA 3CXCA 1Y1WB 1HCZA 2NTSA 1K8AC 1KDCA 3VYUA 3JC66 1EIHA 4JYAL 4H13C 2JXMB 3TP5A 4KHPQ 2Z9HA 3TQYA 1R9TH 2K5HA 2ZT9C 1STNA 4JI8L 3U9OA 1ENAA 1XTDA 4G57A 3S1MB 4JYAQ 2VNUD 3FKIG 2FHTA 1EEID 2I07B 1HR0Q 1E1OA 1EU3A 2HQLA 4DR6Q 1TR5A 1BBUA 4NMZA 5CBEE 4A93H 3IFTA 1HA6A 1SYCA 3GTLB 1XPOA 4KKTA 1ILQA 1XTCD 2EQSA 3GTPH 4C3IB 1TT2A 2R3ZA 2FMCA 1PH9A 3CCJA 3S17B 1SJED 5C4HA 1QG7A 2HQEA 1XMOL 4DK1A 4HEDA 3MXPA 1HUNA 1H95A 5CV8A 1KDBA 3UE0A 1H9JA 3GTGH 3M7NA 4R4QA 3HKZB 3AYHB 4JOIC 2VW9A 4KJOA 2E8GA 5C5MA 1XWEA 1SNPA 3CQZH 4A3GH 4JK1C 4DR3Q 2R7ZG 1G2TA 2PCFB 3M4OB 3D8GA 2UXCQ 3J81j 2EJFC 5C3EB 1YI2A 1LTBD 4KI0A 1I3QB 3HOZH 1STEA 1YITA 1G8ZD 4GLVB 4OONA 3HP3A 4BBSH 2X6LA 5C4XH 4XYOA 3JAME 3OPOA 3KK7A 5I2XA 5AFWA 1GUTA 1SSOA 4IUPA 1Q12A 4ZUIA 5IYCH 3DWQA 4I65A 1VQAA 2JA9A 2JA6B 2E2JB 4OEMB 4DV0L 3DEPA 3UDGA 4B3ML 1F9RA 1KNAA 1F2MA 4LFAQ 4L5SA 4R8NA 4C3HB 1JWSD 2X69A 5IYBG 3SXHA 3J80E 4XTCS 2AQ2B 1FD7D 4B3MQ 3I4LA 4JI5Q 5J1ZA 1ET9A 2Q8TA 1CI3M 1NE3A 1GXDC 1JWUD 3RN5A 3S1RH 2WIIB 1CSQA 4CDFC 4V0BA 1A0IA 2EYFA 4LK1C 4HMJA 1PYBA 1NAPA 1BBXC 2UUCL 2ICIA 5C3XA 3O13A 1IBKQ 3TP7A 4A3EG 3CAMA 4GN4B 3WDNA 1SEBD 3T56B 2UUCQ 5ELNA 4A3CG 1E2WA 5EKIA 1RIPA 4S3SA 1VMPA 5HGTA 2I5HA 4LAAA 2KHJA 3CPWA 3SE0A 5F2DA 3GDEA 4JOIA 1VMCA 3HOYH 3P7JA 1UWVA 3T16A 4JV5L 1F9SA 2DY8A 3HKZE 4K14A 4X62Q 1B1ZA 4KD4A 1IL2A 3PGZA 1GUSA 5CBAE 5L37A 4DA2A 3NELA 1A3UA 1HQRD 3DUZA 2B63H 1LABA 1DONA 3AU7A 1HFNA 4IUNA 3EA6A 5HY6A 1H9SA 1EY6A 3SK5A 3WWVA 3GTQH 3M3YH 1H9SB 1O78A 3AFPA 4DU9A 2VUMH 3F2CA 3G6JB 3K81C 3OMCA 2YTXA 2AWNA 1L0YB 3L9AX 1X56A 5DM63 2NN6H 1H9MA 3RNUA 3GTMH 1MBYA 1SRUA 2XSCA 1HFGA 2PW5A 1HZCA 2KEEA 4JI2L 1SDFA 2Y0SE 5M5XB 4K6LA 2EYMA 2UUAL 3FRPB 4IJHA 2VB2X 3MHBA 2M2LA 4X6AH 1JE4A 2JE6I 2E2IB 1D1IA 2KHSA 1F9QA 1GO3E 1UE1A 1W2BA 1E1TA 1VQBA 3PO2G 3RN2A 4K6DA 4HCEA 5EKKA 4JI0L
chains in the Genus database with same CATH topology
1LYLA 3RZOH 2NZHA 4C2MH 2LXJA 1N34Q 1MJEA 1CKMA 1LUZA 1C9OA 1N32L 1EFWA 1VQ9A 4Y7NH 5C0XG 5HGQA 3CPFA 3OW2A 1KAWA 1HNXL 1UE7A 3S16H 1VQ8A 1VQ7A 1Q81C 3K80C 1X6OA 4QY7A 5M3FH 4DUZL 4A3MH 4DAYB 2K4KA 5GQOA 1KHIA 4HJAA 2OTJA 1B7YB 1M90C 1X9NA 4A3MG 4A3JH 1Y1VH 2Q2UA 3S1QH 1HNXQ 5IYBH 4YHHL 1WCMH 1YEZA 1PH1A 1VQHA 1VQLA 3PUZA 4LF9L 2N3SA 4IFDI 4B3SL 1L2FA 4JBWA 3CMAA 2YU9H 2VS1A 3GO5A 4DUZQ 1NBWA 1NJIC 4NXML 2R92G 2A1AA 1YVCA 3A5ZB 4JI6L 2FXQA 3EN2A 5LMNQ 4DV0Q 4LNQA 2R7DA 3PUYA 5LMUQ 4BY1H 4YHHQ 1MJCA 4WJ4A 1Q82C 5IP7G 4GKKL 1S40A 2F4VQ 4B3SQ 2XGTA 4DNIA 5M5WH 5GAGC 4IO9A 3LGJA 4AIMA 3S14H 4OX9Q 1AH9A 3HOXH 3H15A 3L7ZC 3JAMi 1FL0A 2UU9L 3CCSA 4LF5L 3FHWA 1IZ6A 1DGSA 3A0JA 4IFDG 1J5EL 1LM0A 2CQOA 3PSIA 2BH8A 3CCLA 4BBRH 4GKKQ 1PH7A 4A3EH 4O2DA 1VQNA 4BY7H 4JCVE 3PUXA 4J15A 1YHAA 3UDFA 1PFSA 1GD7A 1SN8A 1N36Q 5FJ8G 2IY5B 4A3KH 2UU9Q 4LF5Q 1E3PA 1TWFH 3HKZG 2ZM6L 2JA8H 4BY7G 4DR4Q 4Y52H 1Z9FA 3PIOA 1VQMA 4X65L 4A3KG 1Q1EA 1X65A 2Z6KC 2ZTCA 3CF5A 1MIUA 2D0OA 1B70B 1TXYA 5C3EG 4DV4Q 4MZ9A 3W1GA 2UUBL 4R4IA 3HOUH 4IPHA 3J80i 3GTJH 1VQDA 1XPUA 1LTLA 2MO1A 1U0LA 4X65Q 1G6PA 2H5XA 2IX0A 4A76A 4UY8C 1RL2A 2VQFL 4GOPA 1SR3A 3HFZB 2B3GA 3CCUA 1K3RA 4GOPB 2A19A 1K0RA 3KF8B 4XIGS 3F2BA 4HIMA 1Q86C 3HOWH 4YWKA 4PMWA 1EQQA 4JI3L 2DUDA 4IJLA 3HKSA 3HOWG 2Z0SA 2Q2TA 3U50C 1KXLA 4LF8Q 4KHPL 2CWAA 2IHEA 1EQRA 3I4MH 5FLMH 4QQBX 1PH3A 2JA6G 3S2HH 5JEAJ 4L5RC 4WJ3M 4DK6C 4JV5Q 4IOCA 3GD7A 3DLLA 5BR8L 2RF4A 2Y0SG 4HIOA 2MQHA 4X66Q 1X55A 3ULPA 2JJQA 1WJJA 1PYSB 1SMXA 4UP9A 2R93G 3SGIA 4HIDA 3MXNB 1OTCA 3HOVH 4RMFA 2WAQG 4KHZA 3J80c 3STBC 1HR0L 2JA5G 1VS0A 5BR8Q 4DR6L 4YWMA 3CCVA 4DV3L 4JC0A 2E5LL 3CCQA 4RG1A 1IXRA 4LF6L 2LSSA 2N49A 5IE8A 1QVFA 4DV7L 1IBLL 2R7FA 1KC8C 1KRSA 4PZ7A 2QGQA 1TWCH 3T1HL 2N78A 1FJGL 1VQKA 1YBYA 2CWPA 2C35B 3OTOL 4UPAA 4DR2L 3I4OA 4DV3Q 2E5LQ 1CKNA 4DPGA 1WFQA 1X3GA 1VQ6A 2D0PA 1C0AA 4K0KL 1CKNB 1A8VA 1IBLQ 1P16A 2WAQE 3G48A 5C0XI 4JI2Q 2JA7H 4DKAC 4LUVA 5AJ3Q 4L5QA 1I94L 5IY0A 5C44G 2JA7G 5JEAG 2F52A 1HJPA 2VZAA 4DUYL 3AQQA 3PO2H 2UUAQ 2BH2A 2OQ0A 3L2PA 4LF4L 3I4NG 1Y1WH 4DR3L 4K0KQ 1VQPA 4YCVA 5J3BA 2UXCL 1QVCA 4AQYL 4LF7L 1I94Q 3GTKH 2AWOA 3RR5A 1EYGA 4APVA 4DUYQ 1UE5A 2GN5A 2UXBQ 2WB1E 2AMCB 3U4VA 4HJ9A 4DR5L 4R4CA 1V9PA 4LFCQ 4EQ5A 2ASBA 1HNWQ 2F3IA 2N8NA 4P73A 4LFBL 4GLAC 2Z6KA 3S2DH 2MO0A 3BJUA 4JI0Q 4A3GG 2KCMA 1JMCA 1OXTA 3CC7A 3S1MH 3PIPA 1D8LA 1UE6A 2ZTDA 4L5TA 2E2HH 1N32Q 2Q2HA 4DR5Q 4A4IA 4B3RL 4R4TA 1EOVA 1EWIA 4OXPA 5IP9H 2R92H 4X64L 4JI0L 3HOZG 4A3LG 2PI2E 2NVTH 4QL5A 2K5NA 2L15A 1KIXA 3G4SA 1GVPA 5IP9G 4BBSG 4LW1A 1I6HH 4O0AA 3BZCA 5M3MG 4GS3A 4YCWA 3CCMA 5C4XG 1AE2A 5IP7H 1QUQA 1SFOH 1PH8A 3GTLH 1CUKA 1A63A 4LFAL 4NXNL 4JI4L 3KJOA 4C3IH 2ATWA 1QUQB 4LF9Q 3H0GG 4X64Q 1HNZL 5IYCG 1HZBA 4NXMQ 3S17H 4POGA 2VL6A 1E7ZA 4JI6Q 1U5KA 4P75A 1FVIA 3I2ZA 4JI5L 1K83H 3VDYA 4JI4Q 3CC2A 4NXNQ 1Q46A 2K50A 3GTOH 4JBKA 4YCUA 4QJFA 5ELOA 5FJ8H 1HNZQ 3UE1A 1G291 1MKHA 3IRBA 1PHJA 4GKJL 5JJKA 3EBEA 4A3DG 2JQOA 2YTVA 4NPSA 4DR1L 2D62A 3M4OH 1Z47A 1YHQA 1J5EQ 3I7FA 5LMNW 2CCZA 5C3EH 5IYDH 1B8AA 2OQKA 2ZJQA 4AYBG 5GROA 1PV4A 1JE5A 2KBNA 3PUVA 4IPCA 1AE3A 1IBKL 1I3QH 3H3VI 2OCEA 5IYDG 4GNXC 1KL9A 3M4QA 2ZM6Q 1QVGA 3BU2A 2AKWB 4A3BG 2I5MX 2RCNA 4C3JH 4P71A 1SROA 1YJ9A 4LUOA 2MNAA 3JAMc 3F2DA 2UUBQ 4UP8A 2K5VA 4HJ5A 1K8GA 2NZOA 1T9HA 4A3IG 1VQ5A 1Y14B 2OTLA 4BXXH 3T1YL 2JA6H 2E2JH 1VQIA 4AYBE 4A3FH 1SLJA 3J7ZC 2VQFQ 1S72A 1VQOA 4BXXG 3STBD 4GN3B 2KCTA 3CXCA 3I55A 4POFA 4A3FG 3NEMA 4X62L 3RLNA 4DV1L 1K8AC 4C3HH 4OWTB 1BKBA 4JI3Q 2R93H 2ALYB 3JC66 1EIFA 1XNQL 3E9HA 4JYAL 4KHPQ 2JA5H 3KFUA 3TQYA 1R9TH 1PA6A 2K5HA 5JJIA 3HOYG 1GKHA 4QGUA 2HHHL 3K8AA 4TQUS 2QEXA 4JI8L 4LWCA 4DV6L 5E7NA 1XTDA 3M9BA 2YTYA 3PUWA 1JJ2A 1J6QA 1XNQQ 4JYAQ 3FKIG 2VNUD 3TEHB 1VQFA 2NN6I 3PF4A 2HHHQ 1VCIA 3M4PA 4JG2A 1HR0Q 2B63G 1E1OA 5FLXc 1K9MC 2HQLA 4DR6Q 1PH6A 4HJ8A 2ZJRA 1BBUA 2HT1A 4DV6Q 2GVBA 3CC4A 1JT8A 4DV2L 4A93H 2WB1G 4LF6Q 3G71A 4P72A 2JEBI 5EAYA 3U4ZA 1E22A 2EQSA 3NBHB 1NMGA 5C44H 4DV7Q 1XPOA 2NVXH 2K52A 3GTPH 2PNHA 4A93G 2VUMG 2QA4A 1YZ6A 3T1HQ 2DGYA 1FJGQ 3CD6A 2CFMA 3OTOQ 4DR2Q 1PH9A 3F1ZA 3I4NH 1PVOA 3CCJA 1I5FA 4DV2Q 2NN6G 2I0QA 3PO3G 1XMOL 1ASYA 2HIVA 4EX5A 1JJGA 5JJLA 1H95A 1S3OA 4PZ8A 3UE0A 2BA0A 2XTIA 3RZDH 3GTGH 3W5OA 3M7NA 4IPGA 4R4QA 3AYHB 4JOIC 4MNOA 2VW9A 2B29A 3CCEA 2E8GA 4FDBA 4GOPC 1XJVA 3I56A 2BA1A 4GLXA 1BBWA 3CQZH 1KD1C 4LF4Q 4A3GH 1NMFA 3M85A 4DR3Q 2R7ZG 1X3EA 1WI5A 3KLWA 2UXCQ 3J81j 4AQYQ 2RHQB 1YI2A 4LF7Q 4JBMA 3ZJYC 4KI0A 1N34L 1WYDA 1L0WA 3W1BA 2VY3A 4OWWB 3HOZH 4A3LH 2CKZB 1P8LA 4GNXA 1V43A 3F8TA 1YITA 4YY3L 2JK8A 1X54A 4GLVB 4OONA 4GNXB 2ID0A 2KENA 4BBSH 5M3MH 4LFBQ 5C4XH 3K7UC 2WP8J 1YIJA 1Q7YC 4YWLA 4IFDJ 2EXDA 3DM3A 1QZGA 2ZTEA 3CP0A 1O7IA 1VQ4A 1E24A 3H0GH 1Q12A 1L1OC 2PMZE 3PV0A 5IYCH 3FP9A 4B3RQ 4YY3Q 1SE8A 1VQAA 2JA9A 5GADC 1OXUA 1OXSC 3A5UA 1QZHA 3KF6A 2NVQH 3PF5A 4DV0L 5LMNL 1FGUA 3KF6B 5M3FG 3UDGA 4B3ML 5LMUL 4LFAQ 1G51A 3S24A 4L5SA 2F4VL 3ERSX 4A3JG 1Y1VG 2A8VA 3ULJA 5IYBG 1VQGA 1WCMG 5M5XH 4A3DH 2NVYH 3J81i 3S1NH 2AHOB 4OX9L 2KHIA 2OWOA 4A75A 4JBJA 4XTCS 1JB7A 4B3MQ 3AEVA 4JI5Q 3RLOA 3OYYA 4GN5A 4BY1G 4IPDA 2E2IH 1NE3A 3RN5A 2R6GA 3S1RH 1N9WA 1N36L 4GKJQ 2IHFA 4BA1I 5K36G 4JI1L 1CSQA 1Q8KA 4DR4L 4A3BH 1HZ9A 4KLKA 1A0IA 3HOXG 4DR1Q 3L0OA 3UDIA 2ES2A 3S15H 1XMQL 5M5YH 1PYBA 1GM5A 3D0FA 2IT1A 2UUCL 3CW2C 3E9IA 4BBRG 4DV4L 1IBKQ 1PH4A 1XNRL 3KYHC 3NENA 2PQAA 3D31A 4R1JA 4JI1Q 5DLQE 3CAMA 4A3EG 4A3IH 5GAEC 3H3VH 4OO1I 3CCRA 4A3CH 2PQAB 4GN4B 3AFQA 3U58A 1PH2A 1YJNA 4IOAA 1XMQQ 2LXKA 3TREA 5H1SE 1C7YA 2JA8G 1NY4A 2PI2A 5ELNA 3J81c 2UUCQ 4DR7L 4A3CG 1RIPA 1X3FA 2GVAA 1M1KC 2UXDL 1XNRQ 2I5HA 3Q8DA 2ZJPA 2KHJA 3RLFA 5IWAL 3CPWA 1YJWA 1N8RC 3HOUG 1TWAH 2YV5A 3GDEA 3TS0A 4JOIA 1XPRA 3T1YQ 4B3TL 3HOYH 4LF8L 3TS2A 4DR7Q 1UWVA 4OO1G 4LUZA 3B6YA 4HJ7A 2UXDQ 2WFWA 4JV5L 1EUJA 3A74A 4MTNA 3HKZE 2RHSB 4ME3A 4OWXB 1N33L 2Q2IA 4X66L 4X62Q 4DV1Q 5IWAQ 3PCOB 3FKIH 1IL2A 3PGZA 4DAMA 2IX1A 4B3TQ 3NELA 4P74A 1K73C 1HZAA 2YYZA 4UP7A 2B63H 1KRTA 3E0EA 1Q1BA 4TVAB 1D7QA 2I5LX 2HIXA 5C4JH 2VQEL 3I4MG 5FLMG 5HY6A 4JI8Q 3UDXA 1N33Q 3MEFA 5GAHC 3J7A5 3WWVA 1OXVA 1ASZA 1OXXK 3ICEA 3GTQH 3KJPA 1NTGA 3M3YH 2V1CC 3PO3H 3AFPA 5IT9c 1PH5A 1L1OA 1TWGH 2VUMH 3F2CA 4R4OA 1A62A 3K81C 1VQCA 1L1OB 2YTXA 2AWNA 1CSPA 4DV5L 1X56A 2K14A 2VQEQ 3G6EA 3KDFA 4ALPA 3HOVG 1VQEA 5C0XJ 4BA2I 4H02A 3RNUA 2EIFA 3KDFB 3CMEA 3GTMH 1SRUA 3ULLA 1WOCA 3BZKA 2MFIA 1TWHH 1HZCA 1EIYB 1YHBA 4AH6A 4JI2L 5AJ3L 1VQJA 4JI7L 4DV5Q 2Y0SE 2JEAI 2UUAL 2R7ZH 1I50H 1HR0W 1V1QA 4IJHA 4PZ6A 3K7AH 1XMOQ 1IBML 4NB3A 4X6AH 1IYJB 2JE6I 3ER0A 3KOJA 4JI7Q 4QIWE 1HH2P 1UEBA 3TRZA 1GO3E 3K0XA 2UXBL 4DK3C 4LFCL 1UE1A 4PG3A 1W2BA 1E1TA 1VQBA 1HNWL 1JJCB 1BVSA 3RN2A 2K75A 3PO2G 1W3SA 1YNXA 1IBMQ 3EIVA 4HIKA 1CKOA 1Y1WG 1KQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LYL A;  3RZO H;  2NZH A;  4C2M H;  2LXJ A;  1N34 Q;  1MJE A;  1CKM A;  1LUZ A;  1C9O A;  1N32 L;  1EFW A;  1VQ9 A;  4Y7N H;  5C0X G;  5HGQ A;  3CPF A;  3OW2 A;  1KAW A;  1HNX L;  1UE7 A;  3S16 H;  1VQ8 A;  1VQ7 A;  1Q81 C;  3K80 C;  1X6O A;  4QY7 A;  5M3F H;  4DUZ L;  4A3M H;  4DAY B;  2K4K A;  5GQO A;  1KHI A;  4HJA A;  2OTJ A;  1B7Y B;  1M90 C;  1X9N A;  4A3M G;  4A3J H;  1Y1V H;  2Q2U A;  3S1Q H;  1HNX Q;  5IYB H;  4YHH L;  1WCM H;  1YEZ A;  1PH1 A;  1VQH A;  1VQL A;  3PUZ A;  4LF9 L;  2N3S A;  4IFD I;  4B3S L;  1L2F A;  4JBW A;  3CMA A;  2YU9 H;  2VS1 A;  3GO5 A;  4DUZ Q;  1NBW A;  1NJI C;  4NXM L;  2R92 G;  2A1A A;  1YVC A;  3A5Z B;  4JI6 L;  2FXQ A;  3EN2 A;  5LMN Q;  4DV0 Q;  4LNQ A;  2R7D A;  3PUY A;  5LMU Q;  4BY1 H;  4YHH Q;  1MJC A;  4WJ4 A;  1Q82 C;  5IP7 G;  4GKK L;  1S40 A;  2F4V Q;  4B3S Q;  2XGT A;  4DNI A;  5M5W H;  5GAG C;  4IO9 A;  3LGJ A;  4AIM A;  3S14 H;  4OX9 Q;  1AH9 A;  3HOX H;  3H15 A;  3L7Z C;  3JAM i;  1FL0 A;  2UU9 L;  3CCS A;  4LF5 L;  3FHW A;  1IZ6 A;  1DGS A;  3A0J A;  4IFD G;  1J5E L;  1LM0 A;  2CQO A;  3PSI A;  2BH8 A;  3CCL A;  4BBR H;  4GKK Q;  1PH7 A;  4A3E H;  4O2D A;  1VQN A;  4BY7 H;  4JCV E;  3PUX A;  4J15 A;  1YHA A;  3UDF A;  1PFS A;  1GD7 A;  1SN8 A;  1N36 Q;  5FJ8 G;  2IY5 B;  4A3K H;  2UU9 Q;  4LF5 Q;  1E3P A;  1TWF H;  3HKZ G;  2ZM6 L;  2JA8 H;  4BY7 G;  4DR4 Q;  4Y52 H;  1Z9F A;  3PIO A;  1VQM A;  4X65 L;  4A3K G;  1Q1E A;  1X65 A;  2Z6K C;  2ZTC A;  3CF5 A;  1MIU A;  2D0O A;  1B70 B;  1TXY A;  5C3E G;  4DV4 Q;  4MZ9 A;  3W1G A;  2UUB L;  4R4I A;  3HOU H;  4IPH A;  3J80 i;  3GTJ H;  1VQD A;  1XPU A;  1LTL A;  2MO1 A;  1U0L A;  4X65 Q;  1G6P A;  2H5X A;  2IX0 A;  4A76 A;  4UY8 C;  1RL2 A;  2VQF L;  4GOP A;  1SR3 A;  3HFZ B;  2B3G A;  3CCU A;  1K3R A;  4GOP B;  2A19 A;  1K0R A;  3KF8 B;  4XIG S;  3F2B A;  4HIM A;  1Q86 C;  3HOW H;  4YWK A;  4PMW A;  1EQQ A;  4JI3 L;  2DUD A;  4IJL A;  3HKS A;  3HOW G;  2Z0S A;  2Q2T A;  3U50 C;  1KXL A;  4LF8 Q;  4KHP L;  2CWA A;  2IHE A;  1EQR A;  3I4M H;  5FLM H;  4QQB X;  1PH3 A;  2JA6 G;  3S2H H;  5JEA J;  4L5R C;  4WJ3 M;  4DK6 C;  4JV5 Q;  4IOC A;  3GD7 A;  3DLL A;  5BR8 L;  2RF4 A;  2Y0S G;  4HIO A;  2MQH A;  4X66 Q;  1X55 A;  3ULP A;  2JJQ A;  1WJJ A;  1PYS B;  1SMX A;  4UP9 A;  2R93 G;  3SGI A;  4HID A;  3MXN B;  1OTC A;  3HOV H;  4RMF A;  2WAQ G;  4KHZ A;  3J80 c;  3STB C;  1HR0 L;  2JA5 G;  1VS0 A;  5BR8 Q;  4DR6 L;  4YWM A;  3CCV A;  4DV3 L;  4JC0 A;  2E5L L;  3CCQ A;  4RG1 A;  1IXR A;  4LF6 L;  2LSS A;  2N49 A;  5IE8 A;  1QVF A;  4DV7 L;  1IBL L;  2R7F A;  1KC8 C;  1KRS A;  4PZ7 A;  2QGQ A;  1TWC H;  3T1H L;  2N78 A;  1FJG L;  1VQK A;  1YBY A;  2CWP A;  2C35 B;  3OTO L;  4UPA A;  4DR2 L;  3I4O A;  4DV3 Q;  2E5L Q;  1CKN A;  4DPG A;  1WFQ A;  1X3G A;  1VQ6 A;  2D0P A;  1C0A A;  4K0K L;  1CKN B;  1A8V A;  1IBL Q;  1P16 A;  2WAQ E;  3G48 A;  5C0X I;  4JI2 Q;  2JA7 H;  4DKA C;  4LUV A;  5AJ3 Q;  4L5Q A;  1I94 L;  5IY0 A;  5C44 G;  2JA7 G;  5JEA G;  2F52 A;  1HJP A;  2VZA A;  4DUY L;  3AQQ A;  3PO2 H;  2UUA Q;  2BH2 A;  2OQ0 A;  3L2P A;  4LF4 L;  3I4N G;  1Y1W H;  4DR3 L;  4K0K Q;  1VQP A;  4YCV A;  5J3B A;  2UXC L;  1QVC A;  4AQY L;  4LF7 L;  1I94 Q;  3GTK H;  2AWO A;  3RR5 A;  1EYG A;  4APV A;  4DUY Q;  1UE5 A;  2GN5 A;  2UXB Q;  2WB1 E;  2AMC B;  3U4V A;  4HJ9 A;  4DR5 L;  4R4C A;  1V9P A;  4LFC Q;  4EQ5 A;  2ASB A;  1HNW Q;  2F3I A;  2N8N A;  4P73 A;  4LFB L;  4GLA C;  2Z6K A;  3S2D H;  2MO0 A;  3BJU A;  4JI0 Q;  4A3G G;  2KCM A;  1JMC A;  1OXT A;  3CC7 A;  3S1M H;  3PIP A;  1D8L A;  1UE6 A;  2ZTD A;  4L5T A;  2E2H H;  1N32 Q;  2Q2H A;  4DR5 Q;  4A4I A;  4B3R L;  4R4T A;  1EOV A;  1EWI A;  4OXP A;  5IP9 H;  2R92 H;  4X64 L;  4JI0 L;  3HOZ G;  4A3L G;  2PI2 E;  2NVT H;  4QL5 A;  2K5N A;  2L15 A;  1KIX A;  3G4S A;  1GVP A;  5IP9 G;  4BBS G;  4LW1 A;  1I6H H;  4O0A A;  3BZC A;  5M3M G;  4GS3 A;  4YCW A;  3CCM A;  5C4X G;  1AE2 A;  5IP7 H;  1QUQ A;  1SFO H;  1PH8 A;  3GTL H;  1CUK A;  1A63 A;  4LFA L;  4NXN L;  4JI4 L;  3KJO A;  4C3I H;  2ATW A;  1QUQ B;  4LF9 Q;  3H0G G;  4X64 Q;  1HNZ L;  5IYC G;  1HZB A;  4NXM Q;  3S17 H;  4POG A;  2VL6 A;  1E7Z A;  4JI6 Q;  1U5K A;  4P75 A;  1FVI A;  3I2Z A;  4JI5 L;  1K83 H;  3VDY A;  4JI4 Q;  3CC2 A;  4NXN Q;  1Q46 A;  2K50 A;  3GTO H;  4JBK A;  4YCU A;  4QJF A;  5ELO A;  5FJ8 H;  1HNZ Q;  3UE1 A;  1G29 1;  1MKH A;  3IRB A;  1PHJ A;  4GKJ L;  5JJK A;  3EBE A;  4A3D G;  2JQO A;  2YTV A;  4NPS A;  4DR1 L;  2D62 A;  3M4O H;  1Z47 A;  1YHQ A;  1J5E Q;  3I7F A;  5LMN W;  2CCZ A;  5C3E H;  5IYD H;  1B8A A;  2OQK A;  2ZJQ A;  4AYB G;  5GRO A;  1PV4 A;  1JE5 A;  2KBN A;  3PUV A;  4IPC A;  1AE3 A;  1IBK L;  1I3Q H;  3H3V I;  2OCE A;  5IYD G;  4GNX C;  1KL9 A;  3M4Q A;  2ZM6 Q;  1QVG A;  3BU2 A;  2AKW B;  4A3B G;  2I5M X;  2RCN A;  4C3J H;  4P71 A;  1SRO A;  1YJ9 A;  4LUO A;  2MNA A;  3JAM c;  3F2D A;  2UUB Q;  4UP8 A;  2K5V A;  4HJ5 A;  1K8G A;  2NZO A;  1T9H A;  4A3I G;  1VQ5 A;  1Y14 B;  2OTL A;  4BXX H;  3T1Y L;  2JA6 H;  2E2J H;  1VQI A;  4AYB E;  4A3F H;  1SLJ A;  3J7Z C;  2VQF Q;  1S72 A;  1VQO A;  4BXX G;  3STB D;  4GN3 B;  2KCT A;  3CXC A;  3I55 A;  4POF A;  4A3F G;  3NEM A;  4X62 L;  3RLN A;  4DV1 L;  1K8A C;  4C3H H;  4OWT B;  1BKB A;  4JI3 Q;  2R93 H;  2ALY B;  3JC6 6;  1EIF A;  1XNQ L;  3E9H A;  4JYA L;  4KHP Q;  2JA5 H;  3KFU A;  3TQY A;  1R9T H;  1PA6 A;  2K5H A;  5JJI A;  3HOY G;  1GKH A;  4QGU A;  2HHH L;  3K8A A;  4TQU S;  2QEX A;  4JI8 L;  4LWC A;  4DV6 L;  5E7N A;  1XTD A;  3M9B A;  2YTY A;  3PUW A;  1JJ2 A;  1J6Q A;  1XNQ Q;  4JYA Q;  3FKI G;  2VNU D;  3TEH B;  1VQF A;  2NN6 I;  3PF4 A;  2HHH Q;  1VCI A;  3M4P A;  4JG2 A;  1HR0 Q;  2B63 G;  1E1O A;  5FLX c;  1K9M C;  2HQL A;  4DR6 Q;  1PH6 A;  4HJ8 A;  2ZJR A;  1BBU A;  2HT1 A;  4DV6 Q;  2GVB A;  3CC4 A;  1JT8 A;  4DV2 L;  4A93 H;  2WB1 G;  4LF6 Q;  3G71 A;  4P72 A;  2JEB I;  5EAY A;  3U4Z A;  1E22 A;  2EQS A;  3NBH B;  1NMG A;  5C44 H;  4DV7 Q;  1XPO A;  2NVX H;  2K52 A;  3GTP H;  2PNH A;  4A93 G;  2VUM G;  2QA4 A;  1YZ6 A;  3T1H Q;  2DGY A;  1FJG Q;  3CD6 A;  2CFM A;  3OTO Q;  4DR2 Q;  1PH9 A;  3F1Z A;  3I4N H;  1PVO A;  3CCJ A;  1I5F A;  4DV2 Q;  2NN6 G;  2I0Q A;  3PO3 G;  1XMO L;  1ASY A;  2HIV A;  4EX5 A;  1JJG A;  5JJL A;  1H95 A;  1S3O A;  4PZ8 A;  3UE0 A;  2BA0 A;  2XTI A;  3RZD H;  3GTG H;  3W5O A;  3M7N A;  4IPG A;  4R4Q A;  3AYH B;  4JOI C;  4MNO A;  2VW9 A;  2B29 A;  3CCE A;  2E8G A;  4FDB A;  4GOP C;  1XJV A;  3I56 A;  2BA1 A;  4GLX A;  1BBW A;  3CQZ H;  1KD1 C;  4LF4 Q;  4A3G H;  1NMF A;  3M85 A;  4DR3 Q;  2R7Z G;  1X3E A;  1WI5 A;  3KLW A;  2UXC Q;  3J81 j;  4AQY Q;  2RHQ B;  1YI2 A;  4LF7 Q;  4JBM A;  3ZJY C;  4KI0 A;  1N34 L;  1WYD A;  1L0W A;  3W1B A;  2VY3 A;  4OWW B;  3HOZ H;  4A3L H;  2CKZ B;  1P8L A;  4GNX A;  1V43 A;  3F8T A;  1YIT A;  4YY3 L;  2JK8 A;  1X54 A;  4GLV B;  4OON A;  4GNX B;  2ID0 A;  2KEN A;  4BBS H;  5M3M H;  4LFB Q;  5C4X H;  3K7U C;  2WP8 J;  1YIJ A;  1Q7Y C;  4YWL A;  4IFD J;  2EXD A;  3DM3 A;  1QZG A;  2ZTE A;  3CP0 A;  1O7I A;  1VQ4 A;  1E24 A;  3H0G H;  1Q12 A;  1L1O C;  2PMZ E;  3PV0 A;  5IYC H;  3FP9 A;  4B3R Q;  4YY3 Q;  1SE8 A;  1VQA A;  2JA9 A;  5GAD C;  1OXU A;  1OXS C;  3A5U A;  1QZH A;  3KF6 A;  2NVQ H;  3PF5 A;  4DV0 L;  5LMN L;  1FGU A;  3KF6 B;  5M3F G;  3UDG A;  4B3M L;  5LMU L;  4LFA Q;  1G51 A;  3S24 A;  4L5S A;  2F4V L;  3ERS X;  4A3J G;  1Y1V G;  2A8V A;  3ULJ A;  5IYB G;  1VQG A;  1WCM G;  5M5X H;  4A3D H;  2NVY H;  3J81 i;  3S1N H;  2AHO B;  4OX9 L;  2KHI A;  2OWO A;  4A75 A;  4JBJ A;  4XTC S;  1JB7 A;  4B3M Q;  3AEV A;  4JI5 Q;  3RLO A;  3OYY A;  4GN5 A;  4BY1 G;  4IPD A;  2E2I H;  1NE3 A;  3RN5 A;  2R6G A;  3S1R H;  1N9W A;  1N36 L;  4GKJ Q;  2IHF A;  4BA1 I;  5K36 G;  4JI1 L;  1CSQ A;  1Q8K A;  4DR4 L;  4A3B H;  1HZ9 A;  4KLK A;  1A0I A;  3HOX G;  4DR1 Q;  3L0O A;  3UDI A;  2ES2 A;  3S15 H;  1XMQ L;  5M5Y H;  1PYB A;  1GM5 A;  3D0F A;  2IT1 A;  2UUC L;  3CW2 C;  3E9I A;  4BBR G;  4DV4 L;  1IBK Q;  1PH4 A;  1XNR L;  3KYH C;  3NEN A;  2PQA A;  3D31 A;  4R1J A;  4JI1 Q;  5DLQ E;  3CAM A;  4A3E G;  4A3I H;  5GAE C;  3H3V H;  4OO1 I;  3CCR A;  4A3C H;  2PQA B;  4GN4 B;  3AFQ A;  3U58 A;  1PH2 A;  1YJN A;  4IOA A;  1XMQ Q;  2LXK A;  3TRE A;  5H1S E;  1C7Y A;  2JA8 G;  1NY4 A;  2PI2 A;  5ELN A;  3J81 c;  2UUC Q;  4DR7 L;  4A3C G;  1RIP A;  1X3F A;  2GVA A;  1M1K C;  2UXD L;  1XNR Q;  2I5H A;  3Q8D A;  2ZJP A;  2KHJ A;  3RLF A;  5IWA L;  3CPW A;  1YJW A;  1N8R C;  3HOU G;  1TWA H;  2YV5 A;  3GDE A;  3TS0 A;  4JOI A;  1XPR A;  3T1Y Q;  4B3T L;  3HOY H;  4LF8 L;  3TS2 A;  4DR7 Q;  1UWV A;  4OO1 G;  4LUZ A;  3B6Y A;  4HJ7 A;  2UXD Q;  2WFW A;  4JV5 L;  1EUJ A;  3A74 A;  4MTN A;  3HKZ E;  2RHS B;  4ME3 A;  4OWX B;  1N33 L;  2Q2I A;  4X66 L;  4X62 Q;  4DV1 Q;  5IWA Q;  3PCO B;  3FKI H;  1IL2 A;  3PGZ A;  4DAM A;  2IX1 A;  4B3T Q;  3NEL A;  4P74 A;  1K73 C;  1HZA A;  2YYZ A;  4UP7 A;  2B63 H;  1KRT A;  3E0E A;  1Q1B A;  4TVA B;  1D7Q A;  2I5L X;  2HIX A;  5C4J H;  2VQE L;  3I4M G;  5FLM G;  5HY6 A;  4JI8 Q;  3UDX A;  1N33 Q;  3MEF A;  5GAH C;  3J7A 5;  3WWV A;  1OXV A;  1ASZ A;  1OXX K;  3ICE A;  3GTQ H;  3KJP A;  1NTG A;  3M3Y H;  2V1C C;  3PO3 H;  3AFP A;  5IT9 c;  1PH5 A;  1L1O A;  1TWG H;  2VUM H;  3F2C A;  4R4O A;  1A62 A;  3K81 C;  1VQC A;  1L1O B;  2YTX A;  2AWN A;  1CSP A;  4DV5 L;  1X56 A;  2K14 A;  2VQE Q;  3G6E A;  3KDF A;  4ALP A;  3HOV G;  1VQE A;  5C0X J;  4BA2 I;  4H02 A;  3RNU A;  2EIF A;  3KDF B;  3CME A;  3GTM H;  1SRU A;  3ULL A;  1WOC A;  3BZK A;  2MFI A;  1TWH H;  1HZC A;  1EIY B;  1YHB A;  4AH6 A;  4JI2 L;  5AJ3 L;  1VQJ A;  4JI7 L;  4DV5 Q;  2Y0S E;  2JEA I;  2UUA L;  2R7Z H;  1I50 H;  1HR0 W;  1V1Q A;  4IJH A;  4PZ6 A;  3K7A H;  1XMO Q;  1IBM L;  4NB3 A;  4X6A H;  1IYJ B;  2JE6 I;  3ER0 A;  3KOJ A;  4JI7 Q;  4QIW E;  1HH2 P;  1UEB A;  3TRZ A;  1GO3 E;  3K0X A;  2UXB L;  4DK3 C;  4LFC L;  1UE1 A;  4PG3 A;  1W2B A;  1E1T A;  1VQB A;  1HNW L;  1JJC B;  1BVS A;  3RN2 A;  2K75 A;  3PO2 G;  1W3S A;  1YNX A;  1IBM Q;  3EIV A;  4HIK A;  1CKO A;  1Y1W G;  1KQS A; 
#chains in the Genus database with same CATH topology
 4IUV A;  2LXJ A;  3GP7 A;  1EFW A;  2Z1C A;  5DEH A;  5C0X G;  5HGQ A;  1HNX L;  2IW3 A;  1UE7 A;  3S16 H;  4EGV A;  4DAY A;  1JWM D;  1Q81 C;  2Q8I B;  1DOM A;  4DUZ L;  2CHB D;  5M3F H;  4DAY B;  2K4K A;  1PFM A;  1B7Y B;  1WTH A;  2NWG A;  4PV1 C;  2SOB A;  1U4R A;  1B50 A;  1Y1V H;  1HRJ A;  1HNX Q;  4YHH L;  1WCM H;  4LF9 L;  4B3S L;  3MC0 B;  1E0B A;  3CMA A;  1TWA B;  2VS1 A;  2YU9 H;  4DUZ Q;  2R92 G;  1EU4 A;  2QEJ C;  4NDX A;  2EY5 A;  1NR2 A;  5JJZ A;  3T4A C;  5LMN Q;  5LMU Q;  1LTT D;  4YHH Q;  3IFD A;  4WJ4 A;  5IP7 G;  1S40 A;  4B3S Q;  5K36 H;  4DNI A;  4ILW A;  5GAG C;  1DM0 B;  3LGJ A;  4AIM A;  3HOX H;  3H15 A;  3TZD A;  1AN8 A;  1FL0 A;  3E5S A;  3JAM i;  1K28 A;  2F0D A;  3A0J A;  1PTO C;  3P1H A;  2WB1 B;  3QOL A;  4HSV A;  4J15 A;  4WRD A;  4YIJ A;  1TWG B;  1SN8 A;  2IY5 B;  2F0T A;  2JA8 H;  4Y52 H;  1Z9F A;  2Z6K C;  4K2L A;  5ELC A;  1LTG D;  1CK1 A;  4DV4 Q;  4K8J A;  3W1G A;  2UUB L;  2A6E C;  1GUN A;  3HOU H;  1K3B C;  3J80 i;  1TS2 A;  2B2Y C;  1XPU A;  4RH6 A;  2MO1 A;  1G6P A;  2H1E A;  3OHX C;  4EVO A;  4A76 A;  1RL2 A;  4GOP A;  4G7Z C;  3KF8 A;  3K7A B;  5JPN C;  4GOP B;  2F0H A;  3KF8 B;  1Q86 C;  2F0S A;  3D4R A;  5FOB B;  3P20 A;  4IJL A;  4XT1 B;  2Z0S A;  3PO2 B;  1KXL A;  3IAY A;  2F3W A;  1WTW A;  4ZUJ A;  1PH3 A;  4MIU A;  5JEA J;  3OOC A;  3NWT A;  4DK6 C;  2RF4 A;  1BOS A;  3FEW X;  4C2M B;  3MXN A;  1JQY D;  5CYU A;  1SMX A;  2R93 G;  3MXN B;  1OTC A;  1IL8 A;  3EFX D;  2A74 C;  2K04 A;  4LF6 L;  2D5D A;  4A3J B;  1IBL L;  1HXY D;  3J7Y W;  1FJG L;  1VQK A;  3OIP A;  2X6G A;  4CKB A;  3E6Z X;  1HQM C;  4DPG A;  2HCC A;  4K0K L;  1IBL Q;  2JA7 H;  5CV4 A;  2WAQ E;  3G48 A;  1SBB B;  1IHZ A;  1IYV A;  1EQT A;  2Z8L A;  4IUR A;  5JAV A;  1HJP A;  3S14 B;  2BH2 A;  3I4N G;  1Y1W H;  4K0K Q;  1VQP A;  3IL8 A;  5LHY 1;  1PTO B;  2O2L D;  4BBR B;  4AQY L;  4LF7 L;  5LL6 S;  1UE5 A;  5KYI A;  2WB1 E;  4LFC Q;  2ASB A;  2Z6K A;  3CRL C;  4E6I A;  1GUG A;  2KCM A;  2IJ0 A;  1OXT A;  1WTX A;  3S1M H;  5EPJ A;  1D8L A;  1I4R A;  1EEF D;  2B2Y A;  1EYD A;  3NBI A;  2QW7 A;  4A4I A;  4B3R L;  1EOV A;  3EJI A;  1EWI A;  4OXP A;  2DNC A;  4A3L G;  1AW7 A;  2EYO A;  2K5N A;  5FLX L;  1GVP A;  1EL0 A;  4GS3 A;  2FFK B;  1PTO D;  3GTL H;  1A63 A;  4C3I H;  1SYE A;  1HNZ L;  4KN4 C;  3S17 H;  1JOO A;  1KAA A;  3S9W A;  2EZV A;  3I4M B;  5I4D A;  3Q24 A;  3I2Z A;  3VYT A;  5IT9 E;  4QJF A;  5ELO A;  1HNZ Q;  2A6E D;  3C2P A;  3IRB A;  5JJK A;  4CDD C;  2YTV A;  2CW0 C;  3M4O H;  1Z47 A;  2K1B A;  3NTI A;  1YHQ A;  3MTS A;  5G3L D;  2CCZ A;  5C3E H;  4UHV A;  4AYB G;  1UUP A;  2KBN A;  1ROD A;  3H3V I;  1I3Q H;  1ICF B;  2OCE A;  3KLR A;  5HUR A;  1Q90 A;  4RCO A;  4GNX C;  1KL9 A;  3BU2 A;  2I5M X;  4ZKC B;  4RA8 A;  1XX8 A;  4ABN A;  4P71 A;  3I8Z A;  2R61 A;  3H3V C;  3HRZ C;  3BVG A;  2K5V A;  3TP8 A;  2NZO A;  4A3I G;  2OTL A;  4L63 B;  1GJX A;  2JA6 H;  2E2J H;  3X3N A;  5CMD A;  1SE2 A;  1SLJ A;  4UDU C;  3J7Z C;  2VQF Q;  4BXX G;  2KCT A;  2JSO A;  4KTA A;  4C3H H;  4OWT B;  1BKB A;  4ULL A;  1EIF A;  2HHH L;  4QGU A;  2EYL A;  3FPP A;  2YTY A;  1DD2 A;  3QG1 A;  3PUW A;  1JJ2 A;  1M4V A;  3H94 A;  2XN9 C;  3TEH B;  2HHH Q;  3J7A F;  1VCI A;  3M4P A;  5FO8 B;  5FLX c;  1K9M C;  4K5W A;  4HJ8 A;  2GVB A;  3CC4 A;  3NBH A;  3TDQ A;  1A3T A;  2JEB I;  5EAY A;  4DV7 Q;  3PO3 G;  3NBH B;  1STA A;  1BF4 A;  5JEA H;  2K52 A;  2GA4 B;  3CD6 A;  1YZ6 A;  1I4H A;  2CFM A;  4N8F A;  3OTO Q;  1PVO A;  3F1Z A;  1DOL A;  5CC4 A;  1I5F A;  3J81 L;  1ASY A;  2HIV A;  1RJT A;  1JJG A;  5JJL A;  2FJ2 A;  4B9X A;  1FYC A;  4PZ8 A;  1SAP A;  3P75 A;  2B8G A;  3NTH A;  4IUU A;  4TKO B;  2ENB A;  3VR2 A;  1JOR A;  3TRZ A;  4FDB A;  2BA1 A;  3T53 B;  2OEO A;  1JIC A;  1NMF A;  4WFN 3;  3M85 A;  2B39 A;  3KLW A;  4QF4 A;  3TME A;  1WTP A;  1WTO A;  4JBM A;  4B9W A;  1N34 L;  3VR5 A;  4B08 A;  2VY3 A;  4OWW B;  2CKZ B;  4GNX A;  3ND9 A;  3F8T A;  2JK8 A;  4KMU C;  4GNX B;  2ID0 A;  2KEN A;  4LFB Q;  2WP8 J;  1YIJ A;  2B2W C;  4BS9 A;  3DM3 A;  2NB0 A;  1VQ4 A;  1LV9 A;  4A3I B;  2QKI C;  2PMZ E;  3VA5 A;  2OXP A;  1WTQ A;  1SE8 A;  3J80 L;  5GAD C;  1QZH A;  1YNJ C;  3FPU B;  4X3U A;  2DNE A;  1FGU A;  1RDP D;  1EY0 A;  2CW0 D;  3OIQ A;  1QB5 D;  3S24 A;  2EYP A;  1D5X C;  3ERS X;  4FXG C;  5M5X H;  1EOT A;  4OX9 L;  1ESF A;  1RCV D;  1SNC A;  2KHI A;  5DM7 3;  2F0V A;  3QOJ A;  3K5M A;  4A75 A;  2OWO A;  2JA5 B;  1G6Z A;  1JB7 A;  3AEV A;  1RKN A;  2XIW A;  3NXW A;  3MA2 B;  3OYY A;  4GN5 A;  4BY1 G;  2EY6 A;  1I6V C;  2E2I H;  5KIX A;  4I7A A;  1SYD A;  4OIK A;  2IHF A;  4JI1 L;  5COR A;  1Q8K A;  5ELF A;  4DR4 L;  4DR1 Q;  5KNC A;  2ES2 A;  1GM5 A;  2F0F A;  2IT1 A;  2F0M A;  1LTI D;  3E9I A;  1PH4 A;  1WD0 A;  3KYH C;  4JI1 Q;  5C44 B;  2NVX B;  1E2Z A;  4A3C H;  3AFQ A;  4NKL A;  4IOA A;  1YJN A;  3NUC A;  1C7Y A;  3J81 c;  4DR7 L;  3MXG A;  1NSN S;  3AMU A;  1LTA D;  3HGB A;  1M1K C;  3C3L A;  2L9H A;  2RDH A;  3SK8 A;  1PZI D;  5IWA L;  1N8R C;  3RZD B;  1TWA H;  2YV5 A;  1LLR D;  3TS0 A;  4DR7 Q;  3B6Y A;  2O4X A;  4ZLT F;  2V4D A;  1B9M A;  3A74 A;  4MTN A;  1WVL A;  2Q2I A;  5IWA Q;  3PCO B;  3MFG A;  1KRT A;  3TN2 A;  3E0E A;  1K8O A;  4TVA B;  2HIX A;  2VQE L;  4JI8 Q;  5M3M B;  1ZEQ X;  5GAH C;  2B2W A;  1OXX K;  4ZCK A;  1R4P B;  1PH5 A;  1TWG H;  1FNV A;  3H0G B;  3KBG A;  2ICE C;  3R3O A;  1KAB A;  1CSP A;  2A68 C;  4DV5 L;  2VQE Q;  3HOV G;  4BA2 I;  2NVQ B;  2EIF A;  3ULL A;  2F3V A;  3BZK A;  2PO4 A;  1EIY B;  1S5F D;  4HCS A;  3A55 A;  4DV5 Q;  4JI7 L;  2L55 A;  2WKC A;  4A3D B;  1TS5 A;  2IL8 A;  4FXD A;  4DK0 A;  1HR0 W;  3K7A H;  1CFM A;  4KY5 A;  1XMO Q;  4NB3 A;  2XNA C;  5D3D A;  1IYJ B;  3ER0 A;  3KOJ A;  4EQN A;  4JI7 Q;  1HH2 P;  1HTL D;  2UXB L;  3VR4 A;  5IOD A;  1HNW L;  4Z9C B;  1JJC B;  4RAU C;  1BVS A;  4RGO S;  4A3B B;  3A7A B;  1W3S A;  2NUC A;  4QB4 A;  3S15 B;  1YNJ D;  3TSS A;  4KY6 A;  1KQS A;  1LYL A;  2Z4I A;  2SNS A;  4C2M H;  1MJE A;  1CKM A;  1LUZ A;  1C9O A;  3PMF A;  3OW2 A;  3CPF A;  1KAW A;  1A15 A;  2KUM A;  5TSS A;  1VF5 C;  3K80 C;  4QY7 A;  1O7L A;  5GQO A;  4HJA A;  4Q5V A;  4A3M G;  4A3J H;  3L3O C;  1YEZ A;  1RF2 D;  1VQH A;  1L2F A;  4JBW A;  2IWH A;  3QB3 A;  3GO5 A;  1NJI C;  2SEB D;  3DM1 A;  2OT2 A;  2A1A A;  3A5Z B;  3BG3 A;  4XYQ A;  2FXQ A;  4DV0 Q;  4JI6 L;  1S4Z A;  2RDF A;  1VDZ A;  1EY5 A;  2IPK D;  2R7D A;  3PUY A;  1MJC A;  3H91 A;  2LFN A;  2XGT A;  3FKI B;  4IZ8 A;  1WTV A;  3QJY A;  3S14 H;  1JOK A;  4ZYS A;  3CCS A;  1PTO F;  3ERO A;  2NTT A;  4LF5 L;  1IZ6 A;  1DGS A;  5C4J B;  2CQO A;  3A8K E;  1X3P A;  1PTO H;  4BBR H;  4X3T A;  1PH7 A;  1SYB A;  2EOT A;  4O2D A;  1VQN A;  3PUX A;  3UDF A;  2Z6B A;  5FJ8 G;  4LF5 Q;  2BOS A;  3T51 B;  3PIO A;  3C1F A;  5DAU A;  4K2K A;  3QIA A;  4A3K G;  1X65 A;  4FXK C;  2ZTC A;  1KLG D;  3CF5 A;  1DCZ A;  3URY A;  1LTL A;  2G9D A;  1U0L A;  4L8J A;  5G3L F;  4OO1 H;  1LT4 D;  3BVM A;  2H5X A;  1SR3 A;  2R7Z B;  5BN4 A;  1EYC A;  1K0R A;  4HIM A;  3F2B A;  3F2U A;  1EQQ A;  4JI3 L;  1I4X A;  1KNE A;  3VYS A;  1EY8 A;  2Q2T A;  1EQR A;  3I4M H;  5FLM H;  4QQB X;  2BE5 C;  2A68 D;  2MJ8 A;  2XVS A;  4L5R C;  2EJG C;  4JV5 Q;  4WJ3 M;  4IOC A;  2MHV A;  1F9P A;  4HIO A;  2MQH A;  1X55 A;  3RZO B;  2JJQ A;  1GUW A;  1PYS B;  4IUT A;  4UP9 A;  2WAQ G;  1CHQ D;  2N55 A;  3R93 A;  4K8I A;  4A3M B;  2HDL A;  3CCV A;  4WOR A;  3CCQ A;  1IXR A;  2DY7 A;  3S1Q B;  1ZXT A;  1KC8 C;  4TRD A;  2QGQ A;  2C9O A;  4V19 0;  3T1H L;  3QR8 A;  1STB A;  2CWP A;  4DR2 L;  4UPA A;  3MXU A;  4DF7 A;  1II3 A;  3EVQ A;  1CKN A;  2JP1 A;  2PPB C;  2QCP X;  1X3G A;  3BYT B;  1VQ6 A;  2D0P A;  1HTP A;  1PFN A;  1CKN B;  3UI2 A;  5C0X I;  1U4L A;  4JI2 Q;  4DKA C;  3GV3 A;  3LX0 A;  1AZP A;  4L5Q A;  3VA7 A;  2UUA Q;  4LF4 L;  5BN3 A;  4YCV A;  5J3B A;  1PZK D;  4FYD A;  1GHJ A;  4NP5 A;  4KK7 A;  4A3E B;  1QE6 A;  2AWO A;  3RR5 A;  1JCK B;  3NP8 A;  5A2Q L;  2AMC B;  2EXZ A;  4F8M A;  4DR5 L;  4A3K B;  1TWF B;  3BDC A;  1G2S A;  4H7B A;  4JI0 Q;  4A3G G;  1JMC A;  4PNY A;  3CC7 A;  2HD3 A;  1UE6 A;  1K8M A;  2F0E A;  2Q2H A;  4DR5 Q;  4R4T A;  3GTJ B;  3PQI A;  1CM9 A;  1Y69 U;  3HOZ G;  2L1B A;  1CA6 A;  2L4N A;  1TII D;  5D3I B;  3G4S A;  5IP9 G;  4BBS G;  3NTK A;  2J0T D;  4O0A A;  4XDX A;  3BZC A;  5C4X G;  4X3S A;  1AE2 A;  2E76 C;  1QUQ A;  5IT9 L;  4NXN L;  4JI4 L;  2ATW A;  1QUQ B;  4LF9 Q;  5IYC G;  1HZB A;  4POG A;  3BYY B;  4QUC A;  4MHE A;  2RSO A;  1STG A;  3S2H B;  4JI4 Q;  4NXN Q;  1EY4 A;  2K33 A;  5I9P A;  2CH4 A;  4GKJ L;  2O5J C;  3BZD B;  2K6A A;  4QIW B;  2D62 A;  2PW7 A;  4CKC A;  5LMN W;  1DZ1 A;  1B8A A;  2N88 A;  1PV4 A;  4IPC A;  5IYD G;  1AZQ A;  4O42 A;  4RHS A;  3M4Q A;  1TWC B;  5KNB A;  3MAQ A;  3E3X A;  4FNF A;  2F0J A;  2BE5 D;  1LT6 D;  4FF1 A;  2UUB Q;  1VQ5 A;  4BXX H;  3H09 A;  1PXU A;  3T1Y L;  4H0L C;  4ZKB B;  1B4O A;  5JVG 3;  2QDB A;  3HG9 A;  4GN3 B;  3I55 A;  5CV6 A;  4POF A;  4A3F G;  1TU2 B;  2WIN B;  3NEM A;  5I2Y A;  4DV1 L;  1KLU D;  2K5W A;  3GTK B;  4HAE A;  2ALY B;  3DWP A;  5D65 A;  2JA5 H;  1PA6 A;  4HSP A;  3HOY G;  3K8A A;  4TQU S;  2QEX A;  3OWE B;  2KCC A;  4DXG A;  4DV6 L;  3M9B A;  3A56 A;  2NYZ D;  2E2H B;  1PMR A;  1VQF A;  2NN6 I;  3PF4 A;  4JG2 A;  2EJM A;  2B63 G;  2R92 B;  4N9P A;  2ZJR A;  4DV6 Q;  5C3W A;  1I6H B;  3NQT A;  3VR3 A;  4LF6 Q;  1PDQ A;  1S5C D;  5C44 H;  2NVX H;  3MWY W;  2PNH A;  2VUM G;  2QA4 A;  1FJG Q;  3WOE A;  1SJH D;  1R4Q B;  2NN6 G;  1PFB A;  4EX5 A;  4L6T B;  1K83 B;  2K01 A;  3CU7 A;  4DGZ A;  3GTO B;  3RZD H;  3W5O A;  2A73 B;  4IPG A;  2RVL A;  1BBW A;  1KD1 C;  1WI5 A;  3K6O A;  2K5D A;  2F0G A;  4AQY Q;  4LF7 Q;  1GOZ A;  3ZJY C;  1WYD A;  1L0W A;  1CT1 D;  2Q8R E;  2A5H A;  4RGM A;  1E2V A;  1P8L A;  2RSN A;  1V43 A;  1NUC A;  1D2B A;  3W2D A;  5M3M H;  3K7U C;  1Q7Y C;  2EXD A;  4IAL A;  1Q8I A;  3H0G H;  1L1O C;  2F1M A;  3N52 A;  4B3R Q;  2PNR C;  3RD4 A;  1OXU A;  2NVQ H;  3PF5 A;  4A3F B;  1BNZ A;  5M3F G;  5JVH 3;  4KD3 A;  3HZX A;  3SHL A;  1S5B D;  3DWA A;  2F4V L;  4ID6 A;  1Y1V G;  3VR6 A;  4A3D H;  1WCM G;  2R93 B;  3HOY B;  2KVM A;  5IGD A;  5COY A;  1QNK A;  1STH A;  4IQZ A;  3RLO A;  2F4I A;  3D6C A;  2AUK A;  4IPD A;  4N8X 1;  1Y8P B;  2R6G A;  1SND A;  1N36 L;  5K36 G;  4BA1 I;  4DN4 M;  3PIP 3;  4A3B H;  1HZ9 A;  3HOX G;  3CKI B;  2XRS D;  3L0O A;  3S15 H;  1UAP A;  1O7Z A;  1XMQ L;  3D0F A;  2ZXP A;  1XNR L;  2PQA A;  3D31 A;  5DLQ E;  1F77 A;  2EE1 A;  2PQA B;  1PH2 A;  3U58 A;  1XMQ Q;  2LXK A;  2JA8 G;  5M9O A;  3I4N B;  1JC7 A;  1NY4 A;  2PI2 A;  3NK9 A;  1A6X A;  2GVA A;  1BXT A;  4K5V A;  2EVB A;  2UXD L;  1XNR Q;  2F0W A;  3I72 A;  1B44 D;  2ZJP A;  1ZKO A;  3MVV A;  3RLF A;  1YJW A;  3HOU G;  1C0A A;  4B3T L;  4LF8 L;  4RKL A;  3ZYY X;  4LUZ A;  5JOB A;  5ISR A;  2UXD Q;  1EUJ A;  2PZW A;  3V96 A;  1MSH A;  2RHS B;  4ME3 A;  4OWX B;  1N33 L;  4X66 L;  3FKI H;  4XQQ A;  2MP1 A;  4B3T Q;  4P74 A;  1HZA A;  2YYZ A;  5CV5 A;  4JPB W;  4DAP A;  4IUQ A;  5C4J H;  1SYF A;  1N33 Q;  1ZYR C;  1OXV A;  1ASZ A;  3ICE A;  1X32 A;  1NTG A;  3I70 A;  2V1C C;  5IGC A;  1L1O A;  1A62 A;  3MZ5 A;  3T13 A;  1L1O B;  4XQN A;  4ALP A;  1HHV A;  1XYI A;  1VQE A;  5C0X J;  1BCP C;  1PRT C;  4CJ2 C;  3KUP A;  4ZAI A;  3D6W A;  1WOC A;  1D1K A;  2G9H D;  2MFI A;  1A2T A;  3FVQ A;  4IN3 A;  4CKE A;  1FGB D;  5AJ3 L;  1UNS A;  5CR3 A;  2A6H C;  2NVY B;  2JEA I;  3S1N B;  1VF7 A;  5DNF A;  1K0S A;  2R7Z H;  1V1Q A;  5CV7 A;  5IGB A;  4AYB B;  1IBM L;  3JAM L;  5KYL A;  1H9K A;  5J22 A;  1J8I A;  2F0P A;  1CQF A;  1UEB A;  4PG3 A;  1HUM A;  1YNX A;  1IBM Q;  4HIK A;  1Y1W G;  5M5Y B;  3TP6 A;  3RZO H;  1ENF A;  1U9R A;  1N34 Q;  5T1I A;  5KGU A;  1N32 L;  1VQ9 A;  2PYK A;  3D4D A;  1X3Q A;  1VQ7 A;  1QNU A;  5IIF A;  4A3M H;  3R2I A;  4XQJ A;  2KA7 A;  1M90 C;  1UEA B;  4J8Q A;  4U68 A;  3S1Q H;  2LKV A;  5IYB H;  1PH1 A;  1VQL A;  1F2Z A;  3PUZ A;  2N3S A;  4IFD I;  4R8I A;  4NXM L;  1NBW A;  4OEL B;  1YVC A;  5EQ0 A;  4LNQ A;  1MHW C;  3RMH A;  1GUO A;  4IO9 A;  4C3I G;  4OX9 Q;  4TSS A;  5FLX E;  2E2D C;  2XWJ B;  4IFD G;  1J5E L;  1LM0 A;  3CCL A;  2J7Z A;  4A3E H;  3I3C A;  3PO3 B;  4JCV E;  5EKL A;  2FIN B;  1YHA A;  3DEO A;  5EGT A;  4A3K H;  4BY7 G;  1E3P A;  1TWF H;  3HKZ G;  2ZM6 L;  4DR4 Q;  2F0L A;  2B2V C;  1MIU A;  2D0O A;  1B70 B;  1PRT B;  1TXY A;  5C3E G;  1SE4 A;  1TWH B;  4R4I A;  4IPH A;  3TZU A;  3GTJ H;  1VQD A;  4FO2 A;  4R9W A;  1NCV A;  1LT3 D;  1D5M C;  4UY8 C;  5KRU A;  1I50 B;  2KCN A;  4X3K A;  2D9U A;  3Q22 A;  1K3R A;  2A19 A;  1ZYR D;  4XIG S;  4CDE C;  5EPL A;  1W6J A;  4PMW A;  2DUD A;  3HKS A;  3HOW G;  4CHT B;  1CHP D;  2I46 A;  3TBI B;  4KHP L;  2CWA A;  4KV6 A;  4HMI A;  1V1O A;  2JA6 G;  4JVZ A;  3S2H H;  1JR0 D;  3K58 A;  2HDM A;  2LS0 1;  5BR8 L;  2Y0S G;  1BCP D;  1PRT D;  2QF7 A;  3ULP A;  2EY2 A;  4C3H G;  1JB3 A;  3GQB A;  3SGI A;  4Y7N B;  3I73 A;  4KHZ A;  1EQV A;  3STB C;  4DNR B;  3J80 c;  2E74 C;  1HR0 L;  2A6H D;  2K05 A;  4OIJ A;  3KLS X;  5BR8 Q;  4DR6 L;  1RTN A;  2E75 C;  4YWM A;  3PIO 3;  1M8A A;  1TS3 A;  1CA5 A;  4DV3 L;  4RGN A;  4RG1 A;  1QVF A;  2KED A;  1STY A;  2R7F A;  1KRS A;  4PZ7 A;  1TWC H;  3LWE A;  3M4Y A;  2C35 B;  3GV6 A;  5I6W A;  1EY9 A;  2HCI A;  4DFA A;  1DJR D;  4DV3 Q;  1WFQ A;  4BY1 B;  3TS2 A;  1A8V A;  1P16 A;  1ILP A;  4LUV A;  1I94 L;  5ELB A;  5IY0 A;  5M5W B;  5JEA G;  2F52 A;  3PO2 H;  4DUY L;  3AQQ A;  4JW0 A;  2OQ0 A;  2EYJ A;  4DR3 L;  4UAI A;  1EFI D;  2UXC L;  2K7V A;  1QVC A;  3OSO A;  5KND A;  1I94 Q;  3GTK H;  5C0X H;  4BY7 B;  4APV A;  4DUY Q;  4ZQ3 A;  2GN5 A;  2UXB Q;  4U67 3;  3U4V A;  4FF3 A;  1HNW Q;  1V9P A;  4RCN A;  3J81 E;  4GLA C;  2M00 A;  2B2V A;  2MO0 A;  3BJU A;  1Y8O B;  1S5D D;  2ZTD A;  3CHB D;  2RA4 A;  2E2H H;  1NR4 A;  5IP9 H;  2R92 H;  1D6E C;  2B2U C;  4X64 L;  1QCB D;  2CVR A;  3C1E A;  3IKJ A;  3NE5 B;  2FMM A;  4LW1 A;  1I6H H;  2MUY A;  4YCW A;  3CCM A;  1YNN C;  5IP7 H;  1PH8 A;  1CUK A;  1FR3 A;  4LFA L;  3K0Y A;  3HOW B;  4X64 Q;  2VL6 A;  4JI6 Q;  2Y0S B;  1FVI A;  4JI5 L;  5LL6 X;  1PLF A;  1K83 H;  3VDY A;  3GTO H;  4YCU A;  3NSW A;  3UE1 A;  1G29 1;  1MKH A;  4QUF A;  4RGT A;  5C5L A;  5NUC A;  2JQO A;  2KJX A;  1B3A A;  3HOV B;  4DNT B;  4OL7 A;  5IYD H;  5GRO A;  1AE3 A;  1IBK L;  4J6H A;  1KTK A;  1B53 A;  1QVG A;  1C48 A;  1DOK A;  1CZW A;  2L11 A;  1I4Q A;  5C4Z A;  1SRO A;  1YJ9 A;  4LUO A;  4FP5 D;  1BDO A;  3OW7 A;  3F2D A;  4C3J G;  5FK9 C;  2K5Q A;  1K8G A;  2H4O A;  1T9H A;  3A7L A;  4A3F H;  4WJW A;  4M1U B;  1S72 A;  1EWC A;  3STB D;  1WD1 A;  2G5D A;  1IW7 C;  1HA5 A;  4X62 L;  3RLN A;  2C5C A;  2F0N A;  4JI3 Q;  2R93 H;  1SMY C;  4RHR A;  1XNQ L;  1J9O A;  3E9H A;  2D2C C;  2B2T C;  3A8I E;  4N9T A;  1SE3 A;  3KFU A;  5JJI A;  5CGK A;  4RKB A;  1GKH A;  5E3F A;  3BVZ A;  2ZXO A;  3M7G A;  1TKW B;  2NBF A;  3K5L A;  3S2D B;  4LWC A;  5E7N A;  2AUJ D;  1XNQ Q;  1J6Q A;  3DHQ A;  5IGE A;  1W6K A;  2J4X A;  2QIL A;  2B2U A;  2WAC A;  4KN7 C;  1QJO A;  2NVT B;  1PH6 A;  2EPB A;  2HT1 A;  1JT8 A;  4DV2 L;  2WB1 G;  3G71 A;  1L0X B;  4P72 A;  1SFO B;  3U4Z A;  1E22 A;  1LTR D;  1NMG A;  2F0K A;  4A93 G;  1EZ6 A;  2DGY A;  3T1H Q;  1B2T A;  4DR2 Q;  4C1N K;  3I4N H;  4G7H C;  1LTS D;  2WKD A;  4DV2 Q;  2I0Q A;  2VB3 X;  1KDA A;  3Q23 A;  2A69 C;  2MGS A;  3ITP A;  3QWN A;  1O80 A;  1S3O A;  5ELE A;  2BA0 A;  2XTI A;  2JYO A;  4FVM A;  4MNO A;  3CCE A;  2B29 A;  2CQA A;  1XJV A;  4GOP C;  3I56 A;  5J39 A;  4GLX A;  4LF4 Q;  3K5O A;  1FNU A;  1X3E A;  4CJ0 B;  2RHQ B;  2DN8 A;  1YNN D;  1BO0 A;  4KY7 A;  3W1B A;  2AQ3 B;  3K57 A;  2JN4 A;  2CH4 W;  4A3L H;  4F88 A;  4YY3 L;  1X54 A;  1QOH A;  4C3J B;  4YWL A;  4IFD J;  1QZG A;  3J7A V;  2ZTE A;  3CP0 A;  1O7I A;  1E24 A;  3PV0 A;  4OHJ A;  3FP9 A;  3Q0A A;  4YY3 Q;  1TY0 A;  5FKA C;  4PQX A;  3A5U A;  1OXS C;  3KF6 A;  5LMN L;  2EY1 A;  3KF6 B;  3A8J E;  4CDC C;  5LMU L;  5A35 A;  1G51 A;  2TSS A;  3RUZ A;  4A3J G;  2A8V A;  2F0O A;  3ULJ A;  1VQG A;  2NVY H;  2B2T A;  3J81 i;  2AHO B;  3S1N H;  2WAQ B;  2F0U A;  4JBJ A;  1R9T B;  3ERQ A;  3W3A A;  1IKL A;  1Z6H A;  3K59 A;  1N9W A;  4GKJ Q;  1T5X D;  5ELD A;  3DMU A;  4KLK A;  2SNM A;  5E4X A;  3UDI A;  5M5Y H;  3CW2 C;  1XXG A;  1AP0 A;  1AFP A;  4BBR G;  4A93 B;  2SDF A;  1TQO A;  2XRQ D;  1DYQ A;  1IW7 D;  4DV4 L;  4A3I H;  3NEN A;  4R1J A;  2F03 A;  4OO1 I;  5GAE C;  3H3V H;  3GTP B;  4KKS A;  1FNW A;  3CCR A;  2L5T A;  1SMY D;  1LT5 D;  1TVX A;  1C8C A;  1T5E A;  3TRE A;  5H1S E;  2XWB B;  1X3F A;  4EQP A;  3WOF A;  1ONL A;  3Q8D A;  1EWH A;  3SVM A;  4DAV A;  3SEB A;  1XPR A;  3GTG B;  3T1Y Q;  3EQL C;  4QCL A;  4OO1 G;  4F7X A;  4HJ7 A;  4HTH A;  3CQZ B;  1LAC A;  2WFW A;  4A3G B;  4G7O C;  2BDN A;  2K28 A;  4ME5 A;  4DV1 Q;  3OWF A;  3ONA B;  1O7Y A;  4DAM A;  2IX1 A;  1K73 C;  4UP7 A;  1Q3L A;  3HOZ B;  1Q1B A;  2EDG A;  1D7Q A;  2I5L X;  1U4M A;  1MGS A;  4QMG A;  3I4M G;  4BBS B;  5FLM G;  3UDX A;  3J7A 5;  3MEF A;  5C4X B;  3KJP A;  4O1N A;  3PO3 H;  2A69 D;  5IOC A;  5IT9 c;  4R4O A;  1VQC A;  1OO9 B;  5EPK A;  4M8A A;  1Y8N B;  2K14 A;  5T1G A;  1BCP F;  1PRT F;  3KDF A;  3G6E A;  4H02 A;  4C56 C;  3KDF B;  3CME A;  2L0C A;  1TWH H;  1YHB A;  3A54 A;  4AH6 A;  1VQJ A;  5D14 A;  3SDZ A;  1I50 H;  4KJN A;  4P2C B;  4K5X A;  4C1N I;  4PZ6 A;  3R8B A;  1A3V A;  4QIW E;  5JPM C;  3S1R B;  3K0X A;  3FMC A;  4DK3 C;  4LFC L;  1WTR A;  3NPP A;  2K75 A;  3C46 A;  3EIV A;  1IYU A;  1CKO A;  4EQO A;  1JOQ A;  2NZH A;  4J1M A;  4CGY B;  4Y7N H;  2F0I A;  3SR1 A;  1V1P A;  1VQ8 A;  3D4W A;  1MI2 A;  4PMB A;  1V1P B;  2M9V A;  1X6O A;  3D3R A;  4NW2 A;  2ZXR A;  3MEH A;  1KHI A;  2OTJ A;  5KEE A;  5I9O A;  1X9N A;  1TY2 A;  5E1F A;  5IGF A;  2Q2U A;  1EYA A;  5A2Q E;  2NZ1 D;  3LNN A;  2KOL A;  2EYH A;  4ZK9 B;  4ODG A;  3EN2 A;  1S5E D;  4BY1 H;  5BN5 A;  1Q82 C;  4GKK L;  3R2T A;  2F4V Q;  5M5W H;  3HEJ A;  1QIL A;  2PZT A;  1AH9 A;  4IFD H;  2B63 B;  3L7Z C;  5EBC A;  2UU9 L;  3FHW A;  5FO9 B;  4LJZ C;  3ND8 A;  3PSI A;  2BH8 A;  4GKK Q;  3GTQ B;  3M3Y B;  4BY7 H;  2KEC A;  3HS0 C;  4G4K A;  2VUM B;  1PFS A;  1GD7 A;  1N36 Q;  2UU9 Q;  3SK4 A;  1VQM A;  4X65 L;  5CV9 A;  3K5N A;  1Q1E A;  3X3M A;  3GTM B;  4DXF A;  4MZ9 A;  3V2T A;  2RCF A;  4X65 Q;  2LMC B;  2HUG A;  2IX0 A;  2PMZ B;  2VQF L;  3HFZ B;  2B3G A;  1RTO A;  3NQI A;  3CCU A;  2RKS A;  3HOW H;  4YWK A;  1EZ8 A;  3OMG A;  3U50 C;  4I7Z C;  4LF8 Q;  2IHE A;  3AB9 A;  2Z4H A;  5EBD A;  3V05 A;  3GD7 A;  3DLL A;  2KQ3 A;  4X66 Q;  2MPM A;  3SK6 A;  4BWG B;  1WJJ A;  1RHP A;  1ICW A;  4PMC A;  1GHK A;  1BUV T;  4HID A;  3HOV H;  4RMF A;  3S16 B;  1F2L A;  5C6A A;  2JA5 G;  1BQQ T;  2VXW A;  1VS0 A;  5IGG A;  2BDO A;  5M3F B;  1BR9 A;  2RBM A;  2E5L L;  4JC0 A;  1AEX A;  2LSS A;  2N49 A;  5IE8 A;  4Q0F A;  3QO2 A;  4DV7 L;  3CRK C;  1Y1V B;  4RWS C;  1WCM B;  2WV6 D;  2N78 A;  1YBY A;  3OTO L;  2YU9 B;  3I4O A;  2E5L Q;  1NNX A;  3E0J A;  1CQV A;  1EY7 A;  1RD9 D;  5E4W C;  4CBV A;  5AJ3 Q;  5C44 G;  2JA7 G;  1EIG A;  1ET6 A;  2VZA A;  3HOX B;  3L2P A;  4HR7 B;  1B3Q A;  3BDO A;  3NWS A;  4XT3 B;  4RFB A;  4KKU A;  2PQE A;  1EYG A;  2RDG A;  1A2U A;  2TMP A;  4HJ9 A;  4R4C A;  3G7L A;  4EQ5 A;  2JA8 B;  2F3I A;  2N8N A;  4P73 A;  4LFB L;  1H9R A;  3S2D H;  4FF2 A;  4GZY C;  2PZU A;  5EJW A;  3PIP A;  3NHH A;  1QWY A;  4L5T A;  1I4P A;  2AQ1 B;  2OF1 A;  1N32 Q;  3HOU B;  1U4P A;  2F0Q A;  4LMQ D;  2BCO A;  2PI2 E;  2NVT H;  4QL5 A;  5FO7 B;  2L15 A;  1KIX A;  4OGQ C;  4HN7 A;  3H6M A;  5M3M G;  1ESR A;  1SFO H;  1IKM A;  3N6R A;  3BS1 A;  3KJO A;  1G91 A;  1ML0 D;  3H0G G;  2L12 A;  1C4Q A;  1HPC A;  4NXM Q;  5K5P A;  1E7Z A;  1U5K A;  1SNQ A;  1PZJ D;  4KHV A;  1SYG A;  2DJG C;  4P75 A;  4MTK A;  3I91 A;  3Q6S A;  3U9S A;  2K32 A;  2QDL A;  3CC2 A;  1Q46 A;  2K50 A;  1SXT A;  2LY7 A;  4JBK A;  5FJ8 H;  3LWU A;  1LO5 D;  1MSG A;  1PHJ A;  1F2Y A;  2K03 A;  1DXM A;  3EBE A;  4A3D G;  1TS4 A;  4NPS A;  4DR1 L;  1I4G A;  1D5Z C;  1Z7T A;  2RQX A;  3BDL A;  3I7F A;  1J5E Q;  2OQK A;  2ZJQ A;  1JE5 A;  2IX3 A;  3PUV A;  2P5Z X;  1BCP B;  3MFY A;  1SNM A;  2B8F A;  2DJF C;  3KLS A;  1ENC A;  2ZM6 Q;  3VYR A;  4FF4 A;  2AKW B;  4A3B G;  1V8Q A;  2RCN A;  4C3J H;  4ZRZ A;  1PYW D;  2MNA A;  3JAM c;  5I6Y A;  4UP8 A;  3I90 A;  1CZG A;  1MD2 D;  4MN3 A;  2JA7 B;  4HJ5 A;  4CJ1 B;  4F87 A;  1CTM A;  1Y14 B;  3KBX A;  1SNO A;  3FDT A;  1B9N A;  1VQI A;  4H44 C;  3DXJ C;  4AYB E;  2O5I C;  1VQO A;  4XXE A;  3CXC A;  1Y1W B;  1HCZ A;  2NTS A;  1K8A C;  1KDC A;  3VYU A;  3JC6 6;  1EIH A;  4JYA L;  4H13 C;  2JXM B;  3TP5 A;  4KHP Q;  2Z9H A;  3TQY A;  1R9T H;  2K5H A;  2ZT9 C;  1STN A;  4JI8 L;  3U9O A;  1ENA A;  1XTD A;  4G57 A;  3S1M B;  4JYA Q;  2VNU D;  3FKI G;  2FHT A;  1EEI D;  2I07 B;  1HR0 Q;  1E1O A;  1EU3 A;  2HQL A;  4DR6 Q;  1TR5 A;  1BBU A;  4NMZ A;  5CBE E;  4A93 H;  3IFT A;  1HA6 A;  1SYC A;  3GTL B;  1XPO A;  4KKT A;  1ILQ A;  1XTC D;  2EQS A;  3GTP H;  4C3I B;  1TT2 A;  2R3Z A;  2FMC A;  1PH9 A;  3CCJ A;  3S17 B;  1SJE D;  5C4H A;  1QG7 A;  2HQE A;  1XMO L;  4DK1 A;  4HED A;  3MXP A;  1HUN A;  1H95 A;  5CV8 A;  1KDB A;  3UE0 A;  1H9J A;  3GTG H;  3M7N A;  4R4Q A;  3HKZ B;  3AYH B;  4JOI C;  2VW9 A;  4KJO A;  2E8G A;  5C5M A;  1XWE A;  1SNP A;  3CQZ H;  4A3G H;  4JK1 C;  4DR3 Q;  2R7Z G;  1G2T A;  2PCF B;  3M4O B;  3D8G A;  2UXC Q;  3J81 j;  2EJF C;  5C3E B;  1YI2 A;  1LTB D;  4KI0 A;  1I3Q B;  3HOZ H;  1STE A;  1YIT A;  1G8Z D;  4GLV B;  4OON A;  3HP3 A;  4BBS H;  2X6L A;  5C4X H;  4XYO A;  3JAM E;  3OPO A;  3KK7 A;  5I2X A;  5AFW A;  1GUT A;  1SSO A;  4IUP A;  1Q12 A;  4ZUI A;  5IYC H;  3DWQ A;  4I65 A;  1VQA A;  2JA9 A;  2JA6 B;  2E2J B;  4OEM B;  4DV0 L;  3DEP A;  3UDG A;  4B3M L;  1F9R A;  1KNA A;  1F2M A;  4LFA Q;  4L5S A;  4R8N A;  4C3H B;  1JWS D;  2X69 A;  5IYB G;  3SXH A;  3J80 E;  4XTC S;  2AQ2 B;  1FD7 D;  4B3M Q;  3I4L A;  4JI5 Q;  5J1Z A;  1ET9 A;  2Q8T A;  1CI3 M;  1NE3 A;  1GXD C;  1JWU D;  3RN5 A;  3S1R H;  2WII B;  1CSQ A;  4CDF C;  4V0B A;  1A0I A;  2EYF A;  4LK1 C;  4HMJ A;  1PYB A;  1NAP A;  1BBX C;  2UUC L;  2ICI A;  5C3X A;  3O13 A;  1IBK Q;  3TP7 A;  4A3E G;  3CAM A;  4GN4 B;  3WDN A;  1SEB D;  3T56 B;  2UUC Q;  5ELN A;  4A3C G;  1E2W A;  5EKI A;  1RIP A;  4S3S A;  1VMP A;  5HGT A;  2I5H A;  4LAA A;  2KHJ A;  3CPW A;  3SE0 A;  5F2D A;  3GDE A;  4JOI A;  1VMC A;  3HOY H;  3P7J A;  1UWV A;  3T16 A;  4JV5 L;  1F9S A;  2DY8 A;  3HKZ E;  4K14 A;  4X62 Q;  1B1Z A;  4KD4 A;  1IL2 A;  3PGZ A;  1GUS A;  5CBA E;  5L37 A;  4DA2 A;  3NEL A;  1A3U A;  1HQR D;  3DUZ A;  2B63 H;  1LAB A;  1DON A;  3AU7 A;  1HFN A;  4IUN A;  3EA6 A;  5HY6 A;  1H9S A;  1EY6 A;  3SK5 A;  3WWV A;  3GTQ H;  3M3Y H;  1H9S B;  1O78 A;  3AFP A;  4DU9 A;  2VUM H;  3F2C A;  3G6J B;  3K81 C;  3OMC A;  2YTX A;  2AWN A;  1L0Y B;  3L9A X;  1X56 A;  5DM6 3;  2NN6 H;  1H9M A;  3RNU A;  3GTM H;  1MBY A;  1SRU A;  2XSC A;  1HFG A;  2PW5 A;  1HZC A;  2KEE A;  4JI2 L;  1SDF A;  2Y0S E;  5M5X B;  4K6L A;  2EYM A;  2UUA L;  3FRP B;  4IJH A;  2VB2 X;  3MHB A;  2M2L A;  4X6A H;  1JE4 A;  2JE6 I;  2E2I B;  1D1I A;  2KHS A;  1F9Q A;  1GO3 E;  1UE1 A;  1W2B A;  1E1T A;  1VQB A;  3PO2 G;  3RN2 A;  4K6D A;  4HCE A;  5EKK A;  4JI0 L; 
#chains in the Genus database with same CATH homology
 1LYL A;  3RZO H;  2NZH A;  4C2M H;  2LXJ A;  1N34 Q;  1MJE A;  1CKM A;  1LUZ A;  1C9O A;  1N32 L;  1EFW A;  1VQ9 A;  4Y7N H;  5C0X G;  5HGQ A;  3CPF A;  3OW2 A;  1KAW A;  1HNX L;  1UE7 A;  3S16 H;  1VQ8 A;  1VQ7 A;  1Q81 C;  3K80 C;  1X6O A;  4QY7 A;  5M3F H;  4DUZ L;  4A3M H;  4DAY B;  2K4K A;  5GQO A;  1KHI A;  4HJA A;  2OTJ A;  1B7Y B;  1M90 C;  1X9N A;  4A3M G;  4A3J H;  1Y1V H;  2Q2U A;  3S1Q H;  1HNX Q;  5IYB H;  4YHH L;  1WCM H;  1YEZ A;  1PH1 A;  1VQH A;  1VQL A;  3PUZ A;  4LF9 L;  2N3S A;  4IFD I;  4B3S L;  1L2F A;  4JBW A;  3CMA A;  2YU9 H;  2VS1 A;  3GO5 A;  4DUZ Q;  1NBW A;  1NJI C;  4NXM L;  2R92 G;  2A1A A;  1YVC A;  3A5Z B;  4JI6 L;  2FXQ A;  3EN2 A;  5LMN Q;  4DV0 Q;  4LNQ A;  2R7D A;  3PUY A;  5LMU Q;  4BY1 H;  4YHH Q;  1MJC A;  4WJ4 A;  1Q82 C;  5IP7 G;  4GKK L;  1S40 A;  2F4V Q;  4B3S Q;  2XGT A;  4DNI A;  5M5W H;  5GAG C;  4IO9 A;  3LGJ A;  4AIM A;  3S14 H;  4OX9 Q;  1AH9 A;  3HOX H;  3H15 A;  3L7Z C;  3JAM i;  1FL0 A;  2UU9 L;  3CCS A;  4LF5 L;  3FHW A;  1IZ6 A;  1DGS A;  3A0J A;  4IFD G;  1J5E L;  1LM0 A;  2CQO A;  3PSI A;  2BH8 A;  3CCL A;  4BBR H;  4GKK Q;  1PH7 A;  4A3E H;  4O2D A;  1VQN A;  4BY7 H;  4JCV E;  3PUX A;  4J15 A;  1YHA A;  3UDF A;  1PFS A;  1GD7 A;  1SN8 A;  1N36 Q;  5FJ8 G;  2IY5 B;  4A3K H;  2UU9 Q;  4LF5 Q;  1E3P A;  1TWF H;  3HKZ G;  2ZM6 L;  2JA8 H;  4BY7 G;  4DR4 Q;  4Y52 H;  1Z9F A;  3PIO A;  1VQM A;  4X65 L;  4A3K G;  1Q1E A;  1X65 A;  2Z6K C;  2ZTC A;  3CF5 A;  1MIU A;  2D0O A;  1B70 B;  1TXY A;  5C3E G;  4DV4 Q;  4MZ9 A;  3W1G A;  2UUB L;  4R4I A;  3HOU H;  4IPH A;  3J80 i;  3GTJ H;  1VQD A;  1XPU A;  1LTL A;  2MO1 A;  1U0L A;  4X65 Q;  1G6P A;  2H5X A;  2IX0 A;  4A76 A;  4UY8 C;  1RL2 A;  2VQF L;  4GOP A;  1SR3 A;  3HFZ B;  2B3G A;  3CCU A;  1K3R A;  4GOP B;  2A19 A;  1K0R A;  3KF8 B;  4XIG S;  3F2B A;  4HIM A;  1Q86 C;  3HOW H;  4YWK A;  4PMW A;  1EQQ A;  4JI3 L;  2DUD A;  4IJL A;  3HKS A;  3HOW G;  2Z0S A;  2Q2T A;  3U50 C;  1KXL A;  4LF8 Q;  4KHP L;  2CWA A;  2IHE A;  1EQR A;  3I4M H;  5FLM H;  4QQB X;  1PH3 A;  2JA6 G;  3S2H H;  5JEA J;  4L5R C;  4WJ3 M;  4DK6 C;  4JV5 Q;  4IOC A;  3GD7 A;  3DLL A;  5BR8 L;  2RF4 A;  2Y0S G;  4HIO A;  2MQH A;  4X66 Q;  1X55 A;  3ULP A;  2JJQ A;  1WJJ A;  1PYS B;  1SMX A;  4UP9 A;  2R93 G;  3SGI A;  4HID A;  3MXN B;  1OTC A;  3HOV H;  4RMF A;  2WAQ G;  4KHZ A;  3J80 c;  3STB C;  1HR0 L;  2JA5 G;  1VS0 A;  5BR8 Q;  4DR6 L;  4YWM A;  3CCV A;  4DV3 L;  4JC0 A;  2E5L L;  3CCQ A;  4RG1 A;  1IXR A;  4LF6 L;  2LSS A;  2N49 A;  5IE8 A;  1QVF A;  4DV7 L;  1IBL L;  2R7F A;  1KC8 C;  1KRS A;  4PZ7 A;  2QGQ A;  1TWC H;  3T1H L;  2N78 A;  1FJG L;  1VQK A;  1YBY A;  2CWP A;  2C35 B;  3OTO L;  4UPA A;  4DR2 L;  3I4O A;  4DV3 Q;  2E5L Q;  1CKN A;  4DPG A;  1WFQ A;  1X3G A;  1VQ6 A;  2D0P A;  1C0A A;  4K0K L;  1CKN B;  1A8V A;  1IBL Q;  1P16 A;  2WAQ E;  3G48 A;  5C0X I;  4JI2 Q;  2JA7 H;  4DKA C;  4LUV A;  5AJ3 Q;  4L5Q A;  1I94 L;  5IY0 A;  5C44 G;  2JA7 G;  5JEA G;  2F52 A;  1HJP A;  2VZA A;  4DUY L;  3AQQ A;  3PO2 H;  2UUA Q;  2BH2 A;  2OQ0 A;  3L2P A;  4LF4 L;  3I4N G;  1Y1W H;  4DR3 L;  4K0K Q;  1VQP A;  4YCV A;  5J3B A;  2UXC L;  1QVC A;  4AQY L;  4LF7 L;  1I94 Q;  3GTK H;  2AWO A;  3RR5 A;  1EYG A;  4APV A;  4DUY Q;  1UE5 A;  2GN5 A;  2UXB Q;  2WB1 E;  2AMC B;  3U4V A;  4HJ9 A;  4DR5 L;  4R4C A;  1V9P A;  4LFC Q;  4EQ5 A;  2ASB A;  1HNW Q;  2F3I A;  2N8N A;  4P73 A;  4LFB L;  4GLA C;  2Z6K A;  3S2D H;  2MO0 A;  3BJU A;  4JI0 Q;  4A3G G;  2KCM A;  1JMC A;  1OXT A;  3CC7 A;  3S1M H;  3PIP A;  1D8L A;  1UE6 A;  2ZTD A;  4L5T A;  2E2H H;  1N32 Q;  2Q2H A;  4DR5 Q;  4A4I A;  4B3R L;  4R4T A;  1EOV A;  1EWI A;  4OXP A;  5IP9 H;  2R92 H;  4X64 L;  4JI0 L;  3HOZ G;  4A3L G;  2PI2 E;  2NVT H;  4QL5 A;  2K5N A;  2L15 A;  1KIX A;  3G4S A;  1GVP A;  5IP9 G;  4BBS G;  4LW1 A;  1I6H H;  4O0A A;  3BZC A;  5M3M G;  4GS3 A;  4YCW A;  3CCM A;  5C4X G;  1AE2 A;  5IP7 H;  1QUQ A;  1SFO H;  1PH8 A;  3GTL H;  1CUK A;  1A63 A;  4LFA L;  4NXN L;  4JI4 L;  3KJO A;  4C3I H;  2ATW A;  1QUQ B;  4LF9 Q;  3H0G G;  4X64 Q;  1HNZ L;  5IYC G;  1HZB A;  4NXM Q;  3S17 H;  4POG A;  2VL6 A;  1E7Z A;  4JI6 Q;  1U5K A;  4P75 A;  1FVI A;  3I2Z A;  4JI5 L;  1K83 H;  3VDY A;  4JI4 Q;  3CC2 A;  4NXN Q;  1Q46 A;  2K50 A;  3GTO H;  4JBK A;  4YCU A;  4QJF A;  5ELO A;  5FJ8 H;  1HNZ Q;  3UE1 A;  1G29 1;  1MKH A;  3IRB A;  1PHJ A;  4GKJ L;  5JJK A;  3EBE A;  4A3D G;  2JQO A;  2YTV A;  4NPS A;  4DR1 L;  2D62 A;  3M4O H;  1Z47 A;  1YHQ A;  1J5E Q;  3I7F A;  5LMN W;  2CCZ A;  5C3E H;  5IYD H;  1B8A A;  2OQK A;  2ZJQ A;  4AYB G;  5GRO A;  1PV4 A;  1JE5 A;  2KBN A;  3PUV A;  4IPC A;  1AE3 A;  1IBK L;  1I3Q H;  3H3V I;  2OCE A;  5IYD G;  4GNX C;  1KL9 A;  3M4Q A;  2ZM6 Q;  1QVG A;  3BU2 A;  2AKW B;  4A3B G;  2I5M X;  2RCN A;  4C3J H;  4P71 A;  1SRO A;  1YJ9 A;  4LUO A;  2MNA A;  3JAM c;  3F2D A;  2UUB Q;  4UP8 A;  2K5V A;  4HJ5 A;  1K8G A;  2NZO A;  1T9H A;  4A3I G;  1VQ5 A;  1Y14 B;  2OTL A;  4BXX H;  3T1Y L;  2JA6 H;  2E2J H;  1VQI A;  4AYB E;  4A3F H;  1SLJ A;  3J7Z C;  2VQF Q;  1S72 A;  1VQO A;  4BXX G;  3STB D;  4GN3 B;  2KCT A;  3CXC A;  3I55 A;  4POF A;  4A3F G;  3NEM A;  4X62 L;  3RLN A;  4DV1 L;  1K8A C;  4C3H H;  4OWT B;  1BKB A;  4JI3 Q;  2R93 H;  2ALY B;  3JC6 6;  1EIF A;  1XNQ L;  3E9H A;  4JYA L;  4KHP Q;  2JA5 H;  3KFU A;  3TQY A;  1R9T H;  1PA6 A;  2K5H A;  5JJI A;  3HOY G;  1GKH A;  4QGU A;  2HHH L;  3K8A A;  4TQU S;  2QEX A;  4JI8 L;  4LWC A;  4DV6 L;  5E7N A;  1XTD A;  3M9B A;  2YTY A;  3PUW A;  1JJ2 A;  1J6Q A;  1XNQ Q;  4JYA Q;  3FKI G;  2VNU D;  3TEH B;  1VQF A;  2NN6 I;  3PF4 A;  2HHH Q;  1VCI A;  3M4P A;  4JG2 A;  1HR0 Q;  2B63 G;  1E1O A;  5FLX c;  1K9M C;  2HQL A;  4DR6 Q;  1PH6 A;  4HJ8 A;  2ZJR A;  1BBU A;  2HT1 A;  4DV6 Q;  2GVB A;  3CC4 A;  1JT8 A;  4DV2 L;  4A93 H;  2WB1 G;  4LF6 Q;  3G71 A;  4P72 A;  2JEB I;  5EAY A;  3U4Z A;  1E22 A;  2EQS A;  3NBH B;  1NMG A;  5C44 H;  4DV7 Q;  1XPO A;  2NVX H;  2K52 A;  3GTP H;  2PNH A;  4A93 G;  2VUM G;  2QA4 A;  1YZ6 A;  3T1H Q;  2DGY A;  1FJG Q;  3CD6 A;  2CFM A;  3OTO Q;  4DR2 Q;  1PH9 A;  3F1Z A;  3I4N H;  1PVO A;  3CCJ A;  1I5F A;  4DV2 Q;  2NN6 G;  2I0Q A;  3PO3 G;  1XMO L;  1ASY A;  2HIV A;  4EX5 A;  1JJG A;  5JJL A;  1H95 A;  1S3O A;  4PZ8 A;  3UE0 A;  2BA0 A;  2XTI A;  3RZD H;  3GTG H;  3W5O A;  3M7N A;  4IPG A;  4R4Q A;  3AYH B;  4JOI C;  4MNO A;  2VW9 A;  2B29 A;  3CCE A;  2E8G A;  4FDB A;  4GOP C;  1XJV A;  3I56 A;  2BA1 A;  4GLX A;  1BBW A;  3CQZ H;  1KD1 C;  4LF4 Q;  4A3G H;  1NMF A;  3M85 A;  4DR3 Q;  2R7Z G;  1X3E A;  1WI5 A;  3KLW A;  2UXC Q;  3J81 j;  4AQY Q;  2RHQ B;  1YI2 A;  4LF7 Q;  4JBM A;  3ZJY C;  4KI0 A;  1N34 L;  1WYD A;  1L0W A;  3W1B A;  2VY3 A;  4OWW B;  3HOZ H;  4A3L H;  2CKZ B;  1P8L A;  4GNX A;  1V43 A;  3F8T A;  1YIT A;  4YY3 L;  2JK8 A;  1X54 A;  4GLV B;  4OON A;  4GNX B;  2ID0 A;  2KEN A;  4BBS H;  5M3M H;  4LFB Q;  5C4X H;  3K7U C;  2WP8 J;  1YIJ A;  1Q7Y C;  4YWL A;  4IFD J;  2EXD A;  3DM3 A;  1QZG A;  2ZTE A;  3CP0 A;  1O7I A;  1VQ4 A;  1E24 A;  3H0G H;  1Q12 A;  1L1O C;  2PMZ E;  3PV0 A;  5IYC H;  3FP9 A;  4B3R Q;  4YY3 Q;  1SE8 A;  1VQA A;  2JA9 A;  5GAD C;  1OXU A;  1OXS C;  3A5U A;  1QZH A;  3KF6 A;  2NVQ H;  3PF5 A;  4DV0 L;  5LMN L;  1FGU A;  3KF6 B;  5M3F G;  3UDG A;  4B3M L;  5LMU L;  4LFA Q;  1G51 A;  3S24 A;  4L5S A;  2F4V L;  3ERS X;  4A3J G;  1Y1V G;  2A8V A;  3ULJ A;  5IYB G;  1VQG A;  1WCM G;  5M5X H;  4A3D H;  2NVY H;  3J81 i;  3S1N H;  2AHO B;  4OX9 L;  2KHI A;  2OWO A;  4A75 A;  4JBJ A;  4XTC S;  1JB7 A;  4B3M Q;  3AEV A;  4JI5 Q;  3RLO A;  3OYY A;  4GN5 A;  4BY1 G;  4IPD A;  2E2I H;  1NE3 A;  3RN5 A;  2R6G A;  3S1R H;  1N9W A;  1N36 L;  4GKJ Q;  2IHF A;  4BA1 I;  5K36 G;  4JI1 L;  1CSQ A;  1Q8K A;  4DR4 L;  4A3B H;  1HZ9 A;  4KLK A;  1A0I A;  3HOX G;  4DR1 Q;  3L0O A;  3UDI A;  2ES2 A;  3S15 H;  1XMQ L;  5M5Y H;  1PYB A;  1GM5 A;  3D0F A;  2IT1 A;  2UUC L;  3CW2 C;  3E9I A;  4BBR G;  4DV4 L;  1IBK Q;  1PH4 A;  1XNR L;  3KYH C;  3NEN A;  2PQA A;  3D31 A;  4R1J A;  4JI1 Q;  5DLQ E;  3CAM A;  4A3E G;  4A3I H;  5GAE C;  3H3V H;  4OO1 I;  3CCR A;  4A3C H;  2PQA B;  4GN4 B;  3AFQ A;  3U58 A;  1PH2 A;  1YJN A;  4IOA A;  1XMQ Q;  2LXK A;  3TRE A;  5H1S E;  1C7Y A;  2JA8 G;  1NY4 A;  2PI2 A;  5ELN A;  3J81 c;  2UUC Q;  4DR7 L;  4A3C G;  1RIP A;  1X3F A;  2GVA A;  1M1K C;  2UXD L;  1XNR Q;  2I5H A;  3Q8D A;  2ZJP A;  2KHJ A;  3RLF A;  5IWA L;  3CPW A;  1YJW A;  1N8R C;  3HOU G;  1TWA H;  2YV5 A;  3GDE A;  3TS0 A;  4JOI A;  1XPR A;  3T1Y Q;  4B3T L;  3HOY H;  4LF8 L;  3TS2 A;  4DR7 Q;  1UWV A;  4OO1 G;  4LUZ A;  3B6Y A;  4HJ7 A;  2UXD Q;  2WFW A;  4JV5 L;  1EUJ A;  3A74 A;  4MTN A;  3HKZ E;  2RHS B;  4ME3 A;  4OWX B;  1N33 L;  2Q2I A;  4X66 L;  4X62 Q;  4DV1 Q;  5IWA Q;  3PCO B;  3FKI H;  1IL2 A;  3PGZ A;  4DAM A;  2IX1 A;  4B3T Q;  3NEL A;  4P74 A;  1K73 C;  1HZA A;  2YYZ A;  4UP7 A;  2B63 H;  1KRT A;  3E0E A;  1Q1B A;  4TVA B;  1D7Q A;  2I5L X;  2HIX A;  5C4J H;  2VQE L;  3I4M G;  5FLM G;  5HY6 A;  4JI8 Q;  3UDX A;  1N33 Q;  3MEF A;  5GAH C;  3J7A 5;  3WWV A;  1OXV A;  1ASZ A;  1OXX K;  3ICE A;  3GTQ H;  3KJP A;  1NTG A;  3M3Y H;  2V1C C;  3PO3 H;  3AFP A;  5IT9 c;  1PH5 A;  1L1O A;  1TWG H;  2VUM H;  3F2C A;  4R4O A;  1A62 A;  3K81 C;  1VQC A;  1L1O B;  2YTX A;  2AWN A;  1CSP A;  4DV5 L;  1X56 A;  2K14 A;  2VQE Q;  3G6E A;  3KDF A;  4ALP A;  3HOV G;  1VQE A;  5C0X J;  4BA2 I;  4H02 A;  3RNU A;  2EIF A;  3KDF B;  3CME A;  3GTM H;  1SRU A;  3ULL A;  1WOC A;  3BZK A;  2MFI A;  1TWH H;  1HZC A;  1EIY B;  1YHB A;  4AH6 A;  4JI2 L;  5AJ3 L;  1VQJ A;  4JI7 L;  4DV5 Q;  2Y0S E;  2JEA I;  2UUA L;  2R7Z H;  1I50 H;  1HR0 W;  1V1Q A;  4IJH A;  4PZ6 A;  3K7A H;  1XMO Q;  1IBM L;  4NB3 A;  4X6A H;  1IYJ B;  2JE6 I;  3ER0 A;  3KOJ A;  4JI7 Q;  4QIW E;  1HH2 P;  1UEB A;  3TRZ A;  1GO3 E;  3K0X A;  2UXB L;  4DK3 C;  4LFC L;  1UE1 A;  4PG3 A;  1W2B A;  1E1T A;  1VQB A;  1HNW L;  1JJC B;  1BVS A;  3RN2 A;  2K75 A;  3PO2 G;  1W3S A;  1YNX A;  1IBM Q;  3EIV A;  4HIK A;  1CKO A;  1Y1W G;  1KQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...