1TWFH

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twfH00
4C3HH 2JA6G 1E1TA 3FHWA 1Y1VH 4JI4Q 1A63A 3PO2G 2AWNA 1YZ6A 2VQEQ 1IBLQ 3CCVA 4GKJQ 1YEZA 1N32Q 1VQKA 5E7NA 1VQLA 4LUVA 1HZCA 4EX5A 5IWAQ 4DV1L 1MJCA 1VQ9A 4A3CG 4OWWB 4JCVE 4DAMA 4DNIA 3AQQA 4IPGA 1D7QA 3PO3G 4DR7L 1NMGA 3J81j 4DV0L 1KD1C 5GAHC 1PFSA 1VQJA 5JEAG 4IOAA 5LMNL 1SN8A 4A3EH 1TWHH 4LFBL 4IPCA 4DR3Q 2R7ZH 3U4VA 4JI1Q 1HNWL 1IBML 3DM3A 4YWKA 1YBYA 3HOXH 2UU9Q 3KF6A 2A19A 4B3RL 4QQBX 2WFWA 4LFAQ 1GVPA 1J6QA 2GN5A 3NBHB 4JI8L 4KLKA 4AH6A 2JA9A 2KHJA 5IP9H 4YY3L 1VQ5A 2NZHA 3K81C 2R93G 2UXCL 1E24A 2VQFL 2JA7G 2R6GA 4KHPQ 1Q1EA 2MQHA 3OTOQ 3TRZA 4A3GG 5JJLA 3TS2A 3BZKA 3W1GA 5LMUL 1UE1A 2OTJA 3AFPA 1ASYA 1QVFA 4XTCS 4A3MH 2K5HA 1PH9A 3CW2C 4GN3B 3BZCA 2KHIA 3PUYA 3J7ZC 4JYAL 1KAWA 1YJWA 2B29A 2LXKA 4KI0A 4L5QA 4JI6L 4L5SA 2HT1A 1XNRL 1VS0A 1N33L 1BVSA 3I55A 1RIPA 2Z6KA 1EIFA 2NVTH 2IT1A 3E9HA 2ZM6L 3IRBA 4GN4B 1WYDA 1I3QH 2VW9A 3NENA 4PZ7A 5FJ8G 2R92G 2JA6H 1XPOA 3PO2H 1FL0A 3OYYA 2JE6I 4A3DG 4YCWA 2B3GA 3KFUA 2BH8A 1E1OA 3CC7A 3LGJA 1UE7A 1RL2A 1WOCA 1EUJA 3KOJA 4A3CH 3PUXA 2HIVA 1IYJB 1IBKL 3M4OH 4DV5Q 1L1OC 1P8LA 1Q46A 5GROA 4GS3A 1M90C 1GKHA 3GDEA 3T1HQ 1Q86C 1VQ8A 1SLJA 4DR1L 2QA4A 3RZOH 1Q8KA 1I5FA 3D31A 4LNQA 1B8AA 4X65Q 4A3LH 5IP7G 3S24A 1P16A 1Y14B 2NVQH 4JI2Q 4GNXC 1AE3A 1KRTA 5AJ3Q 4JV5Q 3CXCA 1N34L 1DGSA 4LUZA 1X56A 1XTDA 4PZ8A 3TREA 3G71A 4LF8L 5C0XG 2R93H 2K5VA 1WCMG 3NEMA 2JA7H 1IXRA 3M9BA 2ZJRA 3PIPA 3I4NG 1SROA 1KC8C 4JBJA 4A3GH 3CCMA 1UWVA 3A74A 3G6EA 3CF5A 4DUYQ 1HR0W 4LF4L 1V1QA 4X62L 3S1QH 1OXSC 1HR0Q 1L1OB 4OWXB 1GO3E 1YI2A 4GLAC 4GN5A 1XPRA 2WAQG 3S17H 2V1CC 4POGA 2D0OA 2UUCL 3HOUG 4XIGS 2E5LL 5EAYA 3JAMi 2N3SA 1KXLA 1BKBA 4DPGA 4GNXB 2JK8A 2ALYB 3H0GG 5HGQA 1WJJA 2VUMG 1U0LA 1G291 2RF4A 2JJQA 4LW1A 3L2PA 5FJ8H 2JA5G 2NZOA 3F2CA 4HJ5A 4JBMA 2IX1A 2MO0A 1HNXQ 3F2BA 1Y1WG 5IYCG 2VNUD 4B3SQ 3CD6A 2AKWB 1I94L 2Q2TA 3CPFA 3MEFA 4DV0Q 2UUBQ 4B3TQ 3F1ZA 5LMNQ 2CQOA 4K0KL 1N8RC 4DV4Q 1NY4A 1EFWA 1FJGL 4DR4Q 4IFDI 4LFBQ 4GOPC 1JT8A 2DGYA 1HNWQ 1IBMQ 2PMZE 3KJPA 1Q82C 3VDYA 1UEBA 1QZHA 3GTMH 4WJ3M 1KRSA 1HZBA 4DR2Q 1CSQA 2UXDL 4P75A 1YJNA 4NXNQ 5JJKA 4DR5Q 1G6PA 4HIMA 1X55A 3PUZA 2VS1A 4IJHA 4UP7A 3UE0A 5IP7H 5C4XG 2CFMA 3AYHB 1VQ4A 2UXBQ 4LF5Q 3STBC 1ASZA 2YTYA 4MZ9A 4HJ9A 4R4QA 4LF6Q 5C3EG 4DR6L 2K5NA 3ZJYC 1YHBA 2E2IH 5LMUQ 1B70B 4YCVA 1TWAH 1WCMH 5M5WH 5FLXc 4A75A 3UE1A 4YHHL 4DV7L 3I4NH 1JJGA 5IE8A 1XPUA 3A5ZB 1XMOL 2I5LX 1K0RA 3AFQA 3J81c 4GOPB 1VQHA 3GTOH 1AE2A 2KCTA 4C3JH 4JBKA 3OW2A 3W1BA 1XNQL 2VL6A 4LWCA 2VZAA 4R1JA 3PGZA 3TS0A 3CPWA 2ZM6Q 3HOUH 1KHIA 4A3LG 4NXML 1NTGA 4PZ6A 3GD7A 5C0XJ 3UDIA 3H0GH 4JI5L 3GTPH 4B3MQ 2VUMH 2AHOB 2JA5H 4P72A 4OO1G 2MO1A 1EQRA 1S3OA 4X64Q 2VY3A 1VQ6A 2CKZB 4LF9Q 3CCRA 5IYBG 1Y1WH 3HOYG 5IYCH 4DUZQ 3CCJA 4AQYL 3PF5A 2E2HH 1IBKQ 1E7ZA 3TEHB 4POFA 5BR8Q 1FGUA 1A0IA 3G48A 4Y52H 3CCEA 4DV2Q 1X3EA 4MNOA 1H95A 4YWLA 4DR1Q 3RLFA 3I7FA 4R4TA 5JJIA 1MIUA 2K14A 5M5YH 1Z9FA 3HKSA 2YTVA 1HNZL 1X3FA 3L0OA 3S2DH 4JI4L 2K75A 2VQEL 1IBLL 4LFCL 4JI7L 4GKJL 2HHHL 1PH6A 1N32L 1TWGH 3ULLA 1PH1A 1BBUA 2K50A 1PH2A 2K4KA 5C4XH 4HJ7A 2A1AA 3T1YL 3PV0A 4QJFA 4FDBA 4GLXA 1FVIA 1NE3A 1HZAA 5C3EH 3RLNA 2A8VA 4DV6Q 5IT9c 1K73C 4Y7NH 1G51A 1YITA 4O0AA 3K7UC 1EWIA 1JMCA 4A3FG 1EIYB 3ER0A 4IJLA 4BY7G 3H3VH 4DR3L 2LSSA 2UUCQ 1OXUA 4JI1L 5HY6A 1XMQQ 3HOWG 3GTLH 5C4JH 5K36G 1K8AC 3F8TA 5GQOA 5GAEC 4DAYB 4GNXA 1LTLA 4HJ8A 3BU2A 2D0PA 2R7FA 4P74A 2UU9L 4A3BG 5IY0A 4JI0Q 3KF6B 3WWVA 4BXXG 4TVAB 4HIOA 3FKIG 1X65A 3M4QA 1YNXA 1IZ6A 3J80i 3ICEA 3PUVA 1N36Q 3CCUA 1VQOA 1PH7A 1W2BA 3W5OA 3GO5A 3U4ZA 3NELA 3OTOL 4BY1G 5M3FG 3KYHC 4UPAA 2DUDA 4DV3L 1I94Q 2ES2A 4X66Q 2UUAQ 3UDFA 3UDGA 5IYBH 4YCUA 3HOYH 3Q8DA 4R4CA 4IOCA 3CC4A 4EQ5A 1SE8A 4HIDA 3AEVA 3B6YA 3I4OA 3H15A 3KDFB 3A5UA 4AIMA 2IHEA 4IPHA 1TWCH 1M1KC 3HFZB 1CSPA 2PQAB 1QVCA 2XGTA 4QL5A 1UE6A 2K52A 1K3RA 4HIKA 4A3JG 2UXDQ 2ZTCA 1VQFA 1JB7A 3S16H 2FXQA 2KBNA 2PNHA 4LUOA 4A93G 1YHAA 2QEXA 2GVBA 4DR6Q 1T9HA 1NJIC 1I6HH 4A3IG 3RR5A 3S14H 3PCOB 2MNAA 2Q2IA 2ZTDA 5M3MG 3CP0A 4DV1Q 1PA6A 1VQAA 4QIWE 2OTLA 1IL2A 3KLWA 2AWOA 4DR7Q 3FP9A 2OCEA 1V9PA 3JC66 5LMNW 4GOPA 2F4VL 1Q1BA 2NN6G 4DV5L 5ELOA 5M5XH 1CUKA 1K83H 4ALPA 1LM0A 4A3FH 1XNQQ 4IO9A 1CKNB 2R7DA 1WFQA 3RN2A 3T1HL 3U58A 1O7IA 1J5EL 1OXTA 1PYSB 4C3IH 3HOWH 3I4MH 4BY7H 1C0AA 2KCMA 1VQ7A 3PUWA 4X65L 1QVGA 4B3RQ 4JI2L 3CMAA 4A3BH 2Y0SE 4JI8Q 3UDXA 5AJ3L 1PH5A 4LF7L 4OX9L 4JV5L 4YY3Q 4JOIC 1L2FA 4BXXH 1VQCA 3PF4A 1AH9A 3FKIH 2UXCQ 4KHZA 2MFIA 2VQFQ 1U5KA 1JE5A 3HOZG 2BH2A 4MTNA 1X54A 4AQYQ 4QGUA 5M3FH 1B7YB 4DUYL 1VQMA 2YYZA 5H1SE 4BY1H 5GADC 2WB1E 3J81i 4IFDG 1I50H 5J3BA 5FLMG 1HR0L 1K9MC 1YIJA 4JYAQ 1V43A 2HIXA 4JI6Q 2IHFA 1VQBA 1XNRQ 1N33Q 4WJ4A 2EIFA 4GKKL 1LUZA 1HNZQ 4AYBE 1NMFA 1PV4A 1QUQB 2QGQA 3PIOA 4A3JH 2OQ0A 4JI7Q 4LFCQ 4JC0A 1VQPA 2HHHQ 4JI3L 1S72A 1A62A 4A76A 1N9WA 2CCZA 2WP8J 2EXDA 3RNUA 3T1YQ 1HNXL 4A93H 2LXJA 4H02A 1E3PA 1VQDA 4B3SL 2I5MX 4A3IH 1QZGA 2CWPA 1VQGA 4OO1I 1NBWA 2HQLA 2RCNA 5M3MH 2ATWA 1R9TH 2UUBL 3TQYA 3ULJA 3S1RH 4B3TL 1YVCA 2NVXH 1Q81C 1JJCB 2ASBA 2JEAI 3F2DA 4DV4L 4DR4L 1PH8A 1OXXK 4P73A 2ID0A 3U50C 3EBEA 2ZJPA 1GD7A 3ERSX 4R4OA 4UY8C 3E9IA 4DR2L 4NXNL 4DR5L 1OXVA 1C9OA 4APVA 3M7NA 3KF8B 3RN5A 1E22A 1K8GA 1LYLA 2Z0SA 3K0XA 4O2DA 1X6OA 4PMWA 2UXBL 4LF5L 1N34Q 4LF6L 4LF8Q 1SFOH 1VQIA 4DV3Q 4C2MH 3I2ZA 1Z47A 5IWAL 3HOZH 4A3KG 3CAMA 3E0EA 4LF4Q 1CKMA 4L5TA 4R4IA 1L1OA 2PI2A 4X62Q 4DKAC 2Q2UA 3KDFA 3CCSA 5FLMH 1VCIA 2EQSA 1HJPA 2YU9H 1Q12A 2PQAA 3CCQA 3CCLA 1L0WA 3I4MG 2E5LQ 3K8AA 2D62A 3GTKH 3HOVG 3M85A 5C44G 2Z6KC 4L5RC 2YTXA 2YV5A 4IPDA 2F3IA 4BA1I 4LFAL 1SR3A 4BBSG 4B3ML 2I0QA 4OXPA 1TXYA 2N8NA 1PHJA 4X6AH 4OONA 3D0FA 3PSIA 4DK3C 1GM5A 4KHPL 3A0JA 4GLVB 4X64L 4IFDJ 3L7ZC 3GTJH 2JA8G 4LF9L 1KL9A 2ZJQA 1S40A 1PH3A 4NPSA 2BA1A 3K7AH 2KENA 3MXNB 4DUZL 5IYDG 5C0XI 2F4VQ 3PO3H 5BR8L 2C35B 1CKNA 3S2HH 1MKHA 4K0KQ 4DV2L 1FJGQ 1J5EQ 2B63G 2NVYH 4BBRG 3S1MH 2PI2E 3GTGH 4HJAA 1EOVA 1Y1VG 3SGIA 4TQUS 4P71A 2OQKA 1PVOA 1TWFH 4LF7Q 3S15H 4OX9Q 3J7A5 4RG1A 1X3GA 2N78A 2E8GA 1EYGA 3J80c 3STBD 5JEAJ 4A4IA 4DV6L 4PG3A 2E2JH 1HZ9A 3RZDH 4YHHQ 1XJVA 4DV7Q 1Q7YC 4OWTB 4A3KH 1MJEA 1JJ2A 4A3EG 2BA0A 4DK6C 1XMOQ 4ME3A 1SRUA 2R7ZG 2Y0SG 2GVAA 3EN2A 1YHQA 3CQZH 1XMQL 2AMCB 3S1NH 2NN6I 4GKKQ 3DLLA 4NB3A 3HOXG 2JEBI 1A8VA 1QUQA 2I5HA 3K80C 4UP9A 3ULPA 4NXMQ 4JOIA 4JI0L 1OTCA 3HOVH 1PH4A 5IP9G 5C44H 1CKOA 2H5XA 2WB1G 3JAMc 4JI3Q 4JI5Q 2L15A 2WAQE 1HH2P 5DLQE 3RLOA 3M4PA 2R92H 4BA2I 1N36L 4JG2A 1SMXA 4YWMA 3CMEA 4BBSH 4A3DH 1WI5A 3EIVA 2CWAA 1VQNA 5GAGC 1YJ9A 4JBWA 2XTIA 1BBWA 1VQEA 4X66L 2JQOA 4A3MG 3HKZG 2UUAL 2JA8H 1KIXA 4AYBG 4UP8A 2IY5B 1C7YA 2OWOA 3GTQH 3CC2A 3BJUA 1UE5A 2IX0A 5IYDH 2N49A 4J15A 2Q2HA 4QY7A 3I56A 1D8LA 4RMFA 5ELNA 1X9NA 3M3YH 1W3SA 2RHQB 2ZTEA 2F52A 1EQQA 4BBRH 1KQSA 3G4SA 2B63H 3H3VI 3HKZE 3KJOA 1PYBA 2RHSB
chains in the Genus database with same CATH superfamily
5ELEA 2AWNA 5I6YA 3CCVA 3TMEA 4V0BA 1N32Q 3ND9A 2PNRC 3OWFA 2F4IA 5E7NA 1VQKA 4LUVA 1HZCA 2FFKB 1GUNA 1DOKA 3AQQA 4IPGA 4KD4A 3VYTA 1B3QA 4U673 4DV0L 3L9AX 3HOZB 2AQ3B 1SN8A 2EYHA 5J22A 4A3EH 5E1FA 3U4VA 3J80E 2YU9B 3DM3A 4WRDA 2UU9Q 2A19A 2XRQD 5IP9H 2UXCL 4KHPQ 2VQFL 4DK1A 3MXNA 1A3TA 3BG3A 2OF1A 3T4AC 2X6GA 2PYKA 2K5HA 1U4MA 4JYAL 1CK1A 3QR8A 2B29A 2JYOA 4L5SA 4HSVA 1BVSA 1RIPA 2L12A 2Z6KA 1EIFA 4OIJA 5FO8B 2IT1A 3E9HA 2ZM6L 2R92G 3OYYA 3QWNA 2XRSD 1I4RA 2BH8A 3LGJA 4B9XA 1RL2A 1HFGA 2NBFA 4ME5A 1EUJA 3PUXA 3R2IA 1JC7A 1GUSA 3RZDB 1YNND 4RAUC 5JEAH 3SK8A 1K8OA 1Q8KA 1I5FA 1EQTA 4X65Q 3O13A 1P16A 1Y14B 1KRTA 4CHTB 2RKSA 2KEDA 2NUCA 1X56A 4Q5VA 1CQFA 1SROA 4IUPA 1TQOA 2F0GA 4NMZA 3TZUA 2B8GA 2F1MA 1YI2A 5BN4A 3GTQB 1HRJA 2V1CC 2D0OA 5CC4A 1CTMA 4K14A 4XIGS 4MN3A 1GXDC 2B2TA 2N3SA 2JK8A 3H0GG 1FD7D 1HTLD 1U0LA 1G291 2RF4A 2JJQA 2Z6BA 1Y8OB 2B2VC 2B2YA 2F0SA 2NZOA 4C3HB 1HXYD 1Y1VB 5DEHA 3ERQA 2M00A 3F2BA 5FO7B 4B3SQ 2F3WA 1FR3A 4RWSC 5CR3A 2Q2TA 4KTAA 4DV0Q 1TU2B 5IODA 2EJGC 2A73B 4K0KL 1N8RC 3BYYB 1FJGL 4DR4Q 4DU9A 3GTMH 3VDYA 1QNUA 3RD4A 5T1IA 4WJ3M 1KRSA 4RHSA 4NXNQ 5JVH3 2A6ED 1D5ZC 1EOTA 2MHVA 5CV6A 3UE0A 3D4WA 2SEBD 5JPMC 4LF5Q 4HJ9A 4R4QA 3AU7A 3ONAB 1JCKB 1YHBA 3ZYYX 5KRUA 1IKMA 2J0TD 1B3AA 3C3LA 3GTOH 3J81c 4GOPB 1ENCA 2EVBA 2QCPX 4JBKA 1XNQL 2VL6A 1KTKA 2VZAA 3PGZA 3NP8A 2ZM6Q 2OT2A 1SYCA 1SMYC 3I8ZA 4NXML 2NVTB 2A74C 3AMUA 5AFWA 3GD7A 3UDIA 3SHLA 2QW7A 1I3QB 4B3MQ 2VUMH 3V05A 3X3MA 3PO2B 1PTOF 2VY3A 4H44C 4LF9Q 4FXKC 1Y1WH 5IYCH 1EIHA 2E2HH 3TEHB 1LTGD 2FHTA 3EFXD 4Y52H 4KJOA 4EQOA 3CCEA 1H95A 1D1KA 3M4OB 4YWLA 3RLFA 3K5LA 1CT1D 1IW7C 2I07B 2K14A 2KOLA 5JJIA 3HKSA 1HNZL 3S1MB 3S2DH 4JI7L 1IBLL 3KBGA 4GKJL 2NVQB 5E4XA 2K50A 3S15B 3NWSA 1M4VA 4I65A 4FDBA 3FDTA 1DOLA 1NE3A 2WACA 1MSGA 2A8VA 4DV6Q 3DUZA 1K28A 2RA4A 1G51A 4Y7NH 2JA7B 3K7UC 4K2LA 2B2UC 3ER0A 4BY7G 2K7VA 3HOWG 1H9SB 2EJFC 1XMQQ 1HA6A 2L9HA 1LTLA 1A2UA 4A3BG 4RGMA 3DWQA 4CJ2C 4ODGA 4BXXG 4HIOA 3FKIG 1X65A 3M4QA 1YNXA 1IZ6A 3ICEA 1ESRA 1QILA 1PH7A 1N36Q 5CV9A 1F2YA 3NELA 3OTOL 4ZAIA 4R9WA 4ZUJA 2F0EA 4X66Q 2SOBA 1TT2A 1SE8A 3I4OA 3NTIA 1EU3A 4C3JG 3BVZA 4RGTA 1G2TA 4IPHA 1TS2A 1KAAA 2B2VA 3A54A 3M3YB 2ZTCA 2RDHA 3GP7A 2KBNA 2L1BA 4KD3A 2BOSA 4A93G 2AQ1B 2RQXA 4CJ1B 1T9HA 4HTHA 5F2DA 1NJIC 4L63B 2IJ0A 1LT4D 5M3MG 4QIWE 2OTLA 4FF3A 4X3SA 1F9SA 2E2IB 2AWOA 1V9PA 2F4VL 5LMNW 1PRTB 1HTPA 1O7YA 1WTWA 1XNQQ 1QG7A 4ALPA 4A3FH 2L5TA 3D8GA 3T1HL 1J5EL 1XX8A 3J81L 3NQTA 1EY7A 2Y0SE 1SE3A 1KDBA 3UDXA 4C1NI 1PH5A 4OX9L 4JV5L 3NWTA 1L2FA 3PF4A 4KHZA 3GTPB 2BE5D 1PMRA 4QGUA 5M3FH 4QUFA 2YYZA 2Q8TA 2EYMA 4G7OC 1KLUD 4JI6Q 1FGBD 1N33Q 1CA5A 4WJ4A 1I4XA 4GKKL 1HNZQ 1I4PA 4AYBE 4DGZA 1QUQB 2P5ZX 4JI7Q 2PPBC 4JC0A 4CGYB 1S72A 4A76A 2EXDA 2LXJA 4PQXA 2QILA 2PW7A 1VQGA 1RKNA 2F0HA 1R9TH 3S1RH 2NVXH 3F2DA 4DV4L 1KNAA 4TSSA 1ILQA 2ID0A 4BWGB 3NK9A 1ET6A 3ERSX 4R4OA 2C5CA 1SYEA 1SYGA 4DR5L 1OXVA 4APVA 3TZDA 2FINB 3KF8B 3RN5A 2EE1A 1E22A 1NAPA 1EWHA 1JWMD 3K0XA 3H94A 4IALA 4IURA 3R93A 2EJMA 1MHWC 4RKBA 4XQQA 5IWAL 3HOZH 1L0YB 2B2UA 5CBAE 3N6RA 2PI2A 2Q2UA 3HOYB 3OMCA 1U9RA 2QDBA 1IYUA 1HJPA 2YU9H 1Q12A 3QB3A 1L0WA 1QE6A 2E5LQ 3K8AA 3J7AV 3HOVG 1TWCB 5C44G 4YIJA 5G3LD 4F88A 2YTXA 2YV5A 4IPDA 4BA1I 2B39A 4BBSG 4J1MA 1STEA 3P7JA 3WOEA 1GM5A 1EY5A 4IFDJ 3L7ZC 1KL9A 4HR7B 1I6HB 2BA1A 3K7AH 5J1ZA 3MXNB 4DUZL 3S14B 2G5DA 5C0XI 2F4VQ 3PO3H 2BDOA 1CKNA 1II3A 4EQNA 1J5EQ 4BBRG 1G91A 2Z4HA 3GTGH 1RTOA 1EOVA 4C3IB 1MSHA 1CQVA 4OX9Q 3GQBA 3MEHA 3J7A5 4ULLA 1TS4A 1PTOC 3OMGA 2N78A 2FMMA 3J80c 2RSNA 4PV1C 5JEAJ 5JPNC 1BOSA 3MXUA 1EYAA 3X3NA 1HZ9A 2B2WC 2E76C 1DCZA 3OOCA 4CKBA 5KYIA 3RZDH 1MJEA 4A3EG 4BY1B 3N52A 2R61A 2Y0SG 3T56B 5JAVA 2F0IA 2AMCB 1HUNA 4N9TA 4GKKQ 1RF2D 2HDLA 1RHPA 3SR1A 2N55A 2I5HA 5KGUA 4UP9A 1SE2A 4JI0L 5IP9G 1CKOA 2H5XA 3JAMc 4PMBA 2WAQE 3M4PA 1SMXA 4DA2A 4A3DH 1WI5A 4AYBG 4UP8A 1NR4A 1C7YA 3C2PA 3GTQH 3CC2A 3BJUA 2RSOA 2PMZB 4J15A 1BDOA 5EGTA 1HQMC 1X9NA 2R3ZA 1KQSA 2MJ8A 3HKZE 3KJOA 4F7XA 4C3HH 3FHWA 1Y1VH 5A2QL 2VQEQ 4XT1B 5FO9B 1YEZA 5KIXA 2JSOA 1PFNA 1YNJD 3A56A 5E4WC 5IWAQ 4DV1L 4JCVE 1NNXA 4C2MB 3FPUB 1TR5A 1S5FD 5GAHC 1KD1C 5JEAG 1EIGA 3TDQA 1H9SA 3WDNA 5ELFA 5LHY1 4JI1Q 5IT9L 1HNWL 3C1FA 4G7HC 4LK1C 2WFWA 3GTKB 4BS9A 1WTQA 2TSSA 2GN5A 4YY3L 1JOKA 2F0VA 4WFN3 2A68D 3TS2A 5LMUL 1QVFA 2E75C 4RHRA 3D6CA 4N8X1 5ELDA 1XXGA 1YJWA 1KLGD 2LXKA 1B50A 5M9OA 2HT1A 1VS0A 1PZKD 5CV8A 2NVTH 3C1EA 2NVYB 1I3QH 3BS1A 2RDGA 1YNJC 2AUJD 3VR2A 3PO2H 2NYZD 1SSOA 4EQPA 1FYCA 2KEEA 1E1OA 2K6AA 1GHKA 1WOCA 5IGCA 1MD2D 4A3CH 1IYJB 3J80L 3M4OH 1F9RA 4DV5Q 1U4RA 4GS3A 1UAPA 3SVMA 1GKHA 3GDEA 1VQ8A 1SLJA 4DR1L 3CQZB 3TSSA 2PZTA 1WTVA 2NVQH 1SYDA 4JI2Q 4GNXC 1EEFD 3SEBA 3CXCA 4G7ZC 4LUZA 1N34L 3G71A 4LF8L 1HQRD 2JA7H 3JAML 3PIPA 3FMCA 1KC8C 1STHA 4LF4L 4DNRB 1BQQT 1V1QA 1SNMA 5D65A 1HR0Q 2CHBD 1UUPA 4GN5A 1UEAB 1XPRA 2BCOA 2WAQG 4POGA 2I46A 2PZUA 1XYIA 2UUCL 3I70A 3NSWA 1RCVD 2A69C 1DONA 1KXLA 5CBEE 2VUMG 3OPOA 4LW1A 4KV6A 3L2PA 3F2CA 1S4ZA 3IAYA 1K0SA 1G8ZD 1Y1WG 5IYCG 1Q8IA 3DMUA 2VNUD 4ILWA 1I94L 3CPFA 2UUBQ 4B3TQ 3F1ZA 1EY9A 3EQLC 1PZID 4XYQA 1VF7A 2CQOA 2Z8LA 1JT8A 2KUMA 1NUCA 3NE5B 1R9TB 4X3TA 2DGYA 1HNWQ 3U9OA 1Q82C 1HZBA 4DR2Q 1SDFA 2UXDL 3NBHA 1CZGA 3L3OC 4HIMA 3HOXB 5IP7H 5C3WA 1SNOA 1LV9A 2CFMA 2YTYA 3QIAA 4LF6Q 4DR6L 2K5NA 5HURA 2E2IH 2XSCA 3KLRA 5LMUQ 5C0XH 4RA8A 1B70B 1WCMH 5IGBA 5KYLA 2A6HD 2JP1A 3UE1A 4YHHL 1S5CD 2NB0A 1K0RA 3U9SA 2F0JA 4ZQ3A 3W1BA 3IFDA 3TS0A 1PTOH 4A3LG 3QOLA 1AZQA 4JI5L 3GTPH 2AHOB 4OEMB 1Z6HA 2JA6B 2D5DA 4P72A 2L0CA 2F0QA 1EQRA 1S3OA 4O42A 4X64Q 4IUNA 2CKZB 3BDCA 1K3BC 1MBYA 4AQYL 2CQAA 2F0OA 2K04A 1C4QA 3T13A 5BR8Q 2HQEA 3K7AB 2Q8IB 2XVSA 1A0IA 1M8AA 2J4XA 4C1NK 3PO3B 2ENBA 4MNOA 2HUGA 4DAVA 4DR1Q 1RODA 1MGSA 1E0BA 1Z9FA 3L0OA 4JI4L 2K75A 3GTGB 1BXTA 2X69A 1SE4A 3ULLA 2Z4IA 3Q0AA 3PV0A 1FNVA 3IKJA 1U4PA 1JB3A 5FKAC 3RLNA 1B2TA 2R93B 3H91A 1SNCA 3VR5A 1YITA 4O0AA 1NSNS 4K5XA 2KCCA 4RCOA 4A3GB 4A3FG 3S1QB 1NCVA 3VR3A 1PFBA 3BVMA 4DR3L 2UUCQ 4FYDA 1K8AC 4TRDA 1EYCA 4GNXA 4P74A 5IY0A 5FLXE 3KF6B 1I4GA 3PUVA 1W2BA 4JPBW 3W5OA 5IIFA 3U4ZA 1Y8PB 1O7LA 5M3FG 4OO1H 1I94Q 2DUDA 4ZRZA 4A3DB 3SK4A 3UDFA 3UDGA 1EY4A 1X3PA 5IYBH 3Q8DA 3HOYH 4IOCA 4RKLA 1V8QA 4EQ5A 2KA7A 3EJIA 5COYA 1DM0B 1F77A 3H15A 1LTID 2IHEA 5LL6S 1AFPA 1TWCH 3F2UA 1M1KC 1CSPA 2O4XA 4QL5A 5EPKA 1K3RA 2UXDQ 2IL8A 1ONLA 2FXQA 4LUOA 2XNAC 2GVBA 5A35A 4DR6Q 5EKIA 2EZVA 1I6HH 1SYFA 3RR5A 3S14H 3PCOB 2MNAA 2FMCA 1ZYRD 3EROA 1B1ZA 2NTSA 2XN9C 1WTRA 1ENFA 1TWAB 1YNNC 5M5WB 1Q1BA 3I4NB 3KLSX 1LM0A 1XPUA 5J39A 1CKNB 3RN2A 4QMGA 4C3IH 3I4MH 2CH4W 5K36H 1QVGA 3T53B 5AJ3L 4JOIC 3WOFA 2UXCQ 2VQFQ 2MFIA 1D5MC 1U5KA 3HOZG 2JA5B 1T5XD 1CZWA 1H9MA 1X54A 4F8MA 5C4ZA 4AQYQ 1WD0A 3PMFA 4DUYL 1VQMA 5H1SE 4BY1H 3E0JA 3J81i 1K9MC 4JYAQ 3FEWX 1V43A 2IHFA 1VQBA 2D9UA 5CV5A 3SK5A 3SK6A 4IUVA 2EIFA 4CDCC 4CDDC 1NMFA 3DWAA 4PNYA 2QGQA 1BCPD 3CRKC 5M5YB 3R3OA 1A62A 2CCZA 1HNXL 1NR2A 5C4XB 2HCIA 5D14A 2LS01 3NBIA 2HQLA 2RCNA 3LNNA 2ATWA 5C3EB 2EY2A 3MWYW 1ML0D 4ZUIA 3CU7A 2F0TA 2NN6H 4KKSA 1PH8A 4DAYA 3U50C 4U68A 3EBEA 4O1NA 4UY8C 1ZXTA 4FP5D 4QCLA 2NTTA 5ELCA 2K33A 5C4JB 2A6EC 4CJ0B 1IL8A 1C9OA 5G3LF 2OEOA 3T16A 1K8GA 2Z0SA 1S5DD 2UXBL 5KNBA 4K6DA 2WINB 1L0XB 1LTRD 1VQIA 1B4OA 4C2MH 3I2ZA 2F03A 1BNZA 3HG9A 3E3XA 1CKMA 4L5TA 2QEJC 4DKAC 3KDFA 5FLMH 1VCIA 2EQSA 3FRPB 2PQAA 2SNSA 2D62A 3GTKH 4ZKCB 1BCPC 1SNQA 2F3IA 4UHVA 2I0QA 4ABNA 1PHJA 4X6AH 4OONA 3PSIA 4OGQC 3A0JA 2ZJQA 1S40A 1PH3A 3DEPA 1H9JA 2HDMA 3QOJA 2ZT9C 3VYSA 2C35B 3P20A 1TY0A 3S2HH 1MKHA 4K0KQ 4DV2L 1FJGQ 2NVYH 5M5XB 3MXGA 4XXEA 4C3HG 1Y1VG 3SGIA 4TQUS 1SXTA 4I7ZC 4HMIA 1ICFB 1EYGA 1ESFA 3STBD 3V2TA 3MZ5A 2H4OA 1QWYA 3BVGA 4R8IA 3S9WA 1A3UA 3MAQA 5TSSA 1Q7YC 1XJVA 2LMCB 2EY5A 2H1EA 1WCMB 4ME3A 3URYA 1I50B 5EQ0A 3CQZH 4R8NA 3OSOA 4KHVA 3DLLA 1UNSA 1A8VA 4DK0A 4NXMQ 4JOIA 2EOTA 1PH4A 5ELBA 1IYVA 1PTOB 2R92H 3RLOA 1V1OA 4A3JB 4BA2I 1ZKOA 3CMEA 4KY7A 4FO2A 3DEOA 2RBMA 5GAGC 2DNEA 2HCCA 1VQEA 2UUAL 2QKIC 4FVMA 4A3IB 1F2MA 2IX0A 3HRZC 4RGNA 5IYDH 3IFTA 1E2ZA 1TIID 3I56A 1D8LA 4JK1C 3VR4A 1EQQA 3H3VI 3D4DA 2RHSB 3M85A 3H3VC 3TP5A 5HGTA 3PO2G 1IBLQ 4GKJQ 1PZJD 1ET9A 3NTKA 3M7GA 2PQEA 4A3CG 4KK7A 4DAMA 4DNIA 1D7QA 4IN3A 1SFOB 1JORA 1G6ZA 4DR7L 1NMGA 3J81j 4ZCKA 1PFSA 1VQJA 1EY0A 1JOQA 4IOAA 5LMNL 3BDLA 4LFBL 2R7ZH 4N8FA 1WTXA 3HOXH 1YBYA 4B3RL 4QQBX 3KF6A 1ILPA 1DZ1A 2O2LD 3NBHB 4JI8L 4AH6A 4KLKA 2NZHA 3K5OA 3K81C 1E24A 2BE5C 2JA7G 2R6GA 1Q1EA 2MQHA 3OTOQ 5JJLA 1TY2A 3BZKA 1UE1A 2OTJA 3AFPA 1ASYA 1PH9A 4XQNA 5EPLA 4GN3B 3CW2C 1LACA 2KHIA 3J7ZC 1KAWA 2MP1A 1XNRL 1PRTD 2NZ1D 1KDCA 4NW2A 4GN4B 1WYDA 5CORA 3NENA 4PZ7A 4ZLTF 2K1BA 2JA6H 1B53A 2E2DC 1XPOA 1TWFB 1FL0A 2B3GA 2LFNA 1CFMA 3GV6A 1O78A 2EYJA 1UE7A 1LT6D 1D1IA 1FNWA 2HIVA 3K58A 1IBKL 1L1OC 4A3KB 1P8LA 5DAUA 5GROA 4MTKA 3T1HQ 2FJ2A 1Q86C 3D31A 4XQJA 2D2CC 1B8AA 5EPJA 4H7BA 5IP7G 1D5XC 3I4MB 1EU4A 3A7AB 5I6WA 3CKIB 4JV5Q 5IGGA 2CW0D 1DGSA 4PZ8A 1Y8NB 5C0XG 3A8KE 2R93H 2K5VA 1WCMG 3NEMA 1JE4A 4A3GH 1UWVA 1I4HA 1HR0W 3S1QH 2G9DA 4X62L 1OXSC 2JA8B 4M1UB 4OWXB 5C4HA 1CA6A 3K57A 1Q90A 5EAYA 2DN8A 2DY8A 3JAMi 4DPGA 1LT5D 2ALYB 3LX0A 4GNXB 2B63B 5HGQA 1WJJA 4DN4M 5KNCA 2EYPA 5FJ8H 4XT3B 4G4KA 5T1GA 2JXMB 2IX1A 1TS3A 3CRLC 4RFBA 4I7AA 3CD6A 4IUUA 1STGA 2AKWB 3RMHA 4H0LC 1F2ZA 3MEFA 3W3AA 3TP6A 5LMNQ 2SDFA 1C48A 2XIWA 4DV4Q 4LFBQ 4IFDI 5CYUA 5KEEA 2PMZE 3K59A 1TWHB 3R8BA 2AUKA 1YJNA 3KBXA 1G6PA 4DR5Q 2MGSA 1CI3M 3MA2B 3PUZA 2VS1A 1VQ4A 3ZJYC 2WB1B 1D6EC 4LMQD 4YCVA 1TWAH 4KY6A 5M5WH 5FLXc 4A75A 1O80A 4DV7L 3I91A 3I4NH 5IE8A 1XMOL 2I5LX 1AP0A 4A3MB 3HKZB 1AE2A 2WV6D 4C3JH 2C9OA 3CPWA 4F87A 1JWSD 3HOUH 4Q0FA 5C5LA 5CV7A 1NTGA 1D2BA 2JA5H 3MFGA 4HCSA 4OO1G 1VQ6A 3DWPA 3T51B 2GA4B 5IYBG 3G6JB 3HOYG 4DUZQ 2K28A 3DM1A 3PF5A 1IBKQ 1E7ZA 1AEXA 4KMUC 1FGUA 4OIKA 1IKLA 3G48A 3OWEB 2L4NA 3I7FA 4R4TA 3S2HB 1MIUA 5M5YH 3E6ZX 3RZOB 1X3FA 3SDZA 1PH6A 1N32L 1ICWA 1PH1A 1BBUA 1PH2A 2K4KA 5C4XH 4HJ7A 2A1AA 5C3EH 1HZAA 1HHVA 2EYLA 4UDUC 4Z9CB 2F0WA 3HEJA 2OXPA 3TBIB 3H3VH 4C3IG 1OXUA 2EY6A 5C4JH 3S17B 3F8TA 5GAEC 5K36G 4DAYB 3E5SA 3NQIA 2D0PA 2R7FA 1BBXC 2UU9L 4JI0Q 4HEDA 3WWVA 2G9HD 2AQ2B 4QUCA 4TVAB 1STBA 2PW5A 3CCUA 2A68C 1VQOA 1JR0D 2R92B 2EDGA 4P2CB 2B2WA 3KYHC 4BY1G 3BYTB 4UPAA 4DV3L 2ES2A 5LL6X 2LKVA 4YCUA 4R4CA 3CC4A 1TVXA 4V190 1QB5D 4ZK9B 1HUMA 3KDFB 4AIMA 1FNUA 2CH4A 2L55A 4G57A 2PQAB 1QVCA 2XGTA 1UE6A 1B9MA 2K52A 4N9PA 4HIKA 4EVOA 4KJNA 1JB7A 4JW0A 3S16H 2PNHA 1LTSD 1WTPA 4H13C 1YHAA 1RJTA 2PCFB 2Q2IA 2ZTDA 4DV1Q 1VQAA 3HS0C 1WD1A 1RDPD 3FP9A 3OW7A 1V1PA 4OHJA 2NN6G 5ELOA 4DXGA 5M5XH 1J9OA 2Z9HA 3A7LA 4J6HA 5FLXL 4IO9A 2R7DA 3U58A 2Q8RE 2RVLA 1OXTA 1PYSB 5IGFA 1C0AA 1VQ7A 3PUWA 4NP5A 2R7ZB 4X65L 4WJWA 2KQ3A 5IT9E 2EYOA 2VB3X 3CMAA 1BCPF 1J8IA 1A3VA 1DXMA 2K5WA 4LF7L 4YY3Q 1CM9A 1AH9A 3H0GB 4LJZC 4TKOB 1JE5A 2BH2A 4MTNA 1B7YB 5GADC 1I50H 5FLMG 1YIJA 3MHBA 1QNKA 3PIP3 1MI2A 2CVRA 4K2KA 1OO9B 1Q3LA 5I9OA 1E2VA 4A3JH 2OQ0A 2XWJB 4GZYC 3AB9A 5DM73 1VQPA 1RD9D 4JI3L 4CDEC 1N9WA 2WP8J 4X3UA 1CHQD 1JICA 1TWGB 4H02A 1VQDA 4B3SL 1HCZA 4A3IH 1QZGA 2CWPA 1X32A 4FF4A 1EL0A 1YVCA 3Q22A 2ASBA 4S3SA 2JEAI 1H9RA 4DR4L 1OXXK 4P73A 2ZJPA 1GD7A 3GTLB 4NXNL 3M7NA 1STYA 1LYLA 4O2DA 3VYRA 4LF5L 1N34Q 3D6WA 4LF8Q 1SFOH 4DV3Q 2A6HC 1W6KA 4LF4Q 3JAME 4IFDH 1F9QA 3CCLA 2KCNA 5FOBB 3J7YW 3NUCA 4DNTB 4LFAL 4B3ML 1QCBD 1TXYA 4DK3C 3VA7A 1GOZA 4LF9L 3V96A 5IYDG 2K5QA 5E3FA 1BCPB 1K83B 2PI2E 2ZXRA 3S1NB 4BY7B 4FXDA 2OQKA 1F2LA 3HOWB 1PVOA 1TWFH 4LF7Q 3TP8A 2RDFA 1X3GA 4A3BB 3KK7A 1KABA 3G7LA 3FKIB 1QOHA 1LT3D 4A4IA 4DV6L 3D4RA 4PG3A 2K01A 4YHHQ 2HD3A 4ZYSA 4OWTB 4A3KH 1JJ2A 2BA0A 4NDXA 4DK6C 1SRUA 2F0DA 2R7ZG 2GVAA 3EN2A 1XMQL 4NB3A 3A8IE 3HOXG 5JVG3 4C3JB 3ULPA 1SMYD 2BDNA 3HOUB 3DHQA 4JI3Q 3BZDB 5DLQE 5EKKA 1HH2P 2QF7A 2MUYA 4JI5Q 1N36L 4K8IA 4YWMA 1LLRD 4JBWA 2XTIA 1BBWA 1ENAA 4A93B 4X66L 2JQOA 2JA8H 1KIXA 4J8QA 5M3MB 1IHZA 2K05A 5IGDA 2Q2HA 1HPCA 4QY7A 2V4DA 4RMFA 5ELNA 2K32A 5EJWA 2RHQB 2ZTEA 2B63H 4B9WA 1JWUD 3G4SA 5KNDA 1IW7D 1PYBA 2JA6G 1E1TA 4JI4Q 1A63A 1H9KA 1YZ6A 1A15A 2X6LA 4HCEA 2IPKD 3PQIA 1TS5A 1ZYRC 1VQLA 4EX5A 1VQ9A 1MJCA 4OWWB 3PO3G 2TMPA 3RUZA 2K5DA 1S5BD 1TWHH 4IPCA 4DR3Q 1PRTF 2DNCA 1IBML 1GUTA 4CKCA 4YWKA 4LFAQ 1GVPA 1J6QA 1VQ5A 4UAIA 2JA9A 2KHJA 3VR6A 2R93G 3HGBA 4CDFC 3K5NA 3TRZA 4A3GG 1HFNA 1LABA 3W1GA 3GTJB 2QDLA 4XTCS 1EFID 4A3MH 3BZCA 3PUYA 1O7ZA 4L5QA 4KI0A 5EKLA 4JI6L 3I3CA 4JVZA 2LY7A 3I55A 1N33L 4FF1A 3NXWA 4PMCA 1BO0A 3IRBA 4QB4A 2VW9A 5FJ8G 3HZXA 4OELB 5DM63 2JE6I 1JOOA 1SNPA 4A3DG 4YCWA 3S16B 1W6JA 1LTAD 3EVQA 4C56C 4DXFA 3KFUA 1KDAA 3CC7A 1DJRD 1QJOA 3KOJA 5C3XA 5CMDA 5EBDA 1TKWB 5L37A 2DJFC 5CGKA 2E2JB 2ICIA 3FPPA 1Q46A 1M90C 1GUOA 3RZOH 2QA4A 4LNQA 5I2XA 4A3LH 2M2LA 3S24A 4K8JA 1AE3A 2A5HA 1X3QA 3HOVB 5AJ3Q 5C44B 2Z1CA 1XTDA 3TREA 1HA5A 2KHSA 2F3VA 4BBSB 1IXRA 3M9BA 2ZJRA 3I4NG 2VB2X 4JBJA 3CCMA 3A74A 3G6EA 3CF5A 4DUYQ 1L1OB 1GO3E 4GLAC 3S17H 1WTHA 4WORA 3HOUG 2E5LL 2MPMA 1RTNA 1BKBA 4DAPA 1A6XA 4BBRB 3H6MA 3GV3A 2JA5G 2DJGC 4JBMA 4HJ5A 4QIWB 1GUGA 2MO0A 1HNXQ 1DD2A 3H09A 2EXZA 3NTHA 1LTBD 4MHEA 5D3IB 3K5MA 1NY4A 1EFWA 2ZXOA 1EZ8A 4GOPC 1IBMQ 4A3EB 3KJPA 1QZHA 1UEBA 1PLFA 2Y0SB 4NKLA 1CSQA 5JJKA 4P75A 1STNA 1X55A 4IJHA 4UP7A 5C4XG 3AYHB 2UXBQ 3STBC 1ASZA 1LO5D 4MZ9A 3VA5A 3P1HA 4FNFA 4RGOS 5C3EG 2IWHA 1PFMA 2F0PA 2VXWA 4E6IA 3BDOA 1JJGA 2EPBA 3A5ZB 1ZEQX 3AFQA 4RCNA 1EY8A 1VQHA 3D3RA 1SEBD 1V1PB 1A2TA 1KNEA 1SNDA 2KCTA 3ITPA 1PXUA 5JOBA 5NUCA 4AYBB 4ZKBB 3OW2A 4LWCA 4R1JA 4IZ8A 1EY6A 3MXPA 1KHIA 1AN8A 1VF5C 2K03A 3QO2A 4PZ6A 5C0XJ 2ICEC 2IX3A 3H0GH 4K5VA 4K6LA 3I90A 2MO1A 1AZPA 1T5EA 3CCRA 1U4LA 3VYUA 3Q24A 2L11A 4K5WA 3CCJA 4IUQA 2B8FA 2M9VA 4POFA 1I4QA 4DF7A 2EY1A 5IGEA 3LWUA 4DV2Q 1X3EA 3QJYA 3A8JE 5I2YA 2YTVA 5JJZA 4M8AA 2VQEL 4LFCL 4LAAA 2HHHL 1TWGH 4KN4C 4IQZA 3ND8A 1PTOD 3T1YL 2IW3A 3W2DA 4QJFA 4GLXA 1FVIA 2F0KA 5IT9c 1K73C 1LTTD 1EWIA 1JMCA 3I73A 1WTOA 1EIYB 4IJLA 2LSSA 4JI1L 1EWCA 5HY6A 1XWEA 3GTLH 4CBVA 2PZWA 4HJ8A 3BU2A 4OL7A 4KKTA 2ZXPA 1B44D 1F9PA 3J80i 3J81E 3GO5A 2WKDA 4EGVA 2UUAQ 4HIDA 3AEVA 3TP7A 3B6YA 1PRTC 4HN7A 4FF2A 3LWEA 2EYFA 3A5UA 3K0YA 3HFZB 4A3JG 3GTMB 1VQFA 2N88A 2QEXA 2O5JC 4A3IG 3CP0A 1PA6A 1IL2A 3DXJC 3KLWA 4DR7Q 3JC66 2OCEA 4GOPA 3MFYA 4KKUA 1WVLA 1JQYD 1G2SA 4DV5L 3CHBD 1CUKA 1K83H 5FK9C 5K5PA 3GTOB 1WFQA 3S1NH 4BY7H 1O7IA 4B08A 4HMJA 3HOWH 2KCMA 2WAQB 3TN2A 4B3RQ 3P75A 1VDZA 4JI2L 4A3BH 3C46A 1GUWA 4JI8Q 3K6OA 2CW0C 4BXXH 1VQCA 4L6TB 3FKIH 2VUMB 1AW7A 2WB1E 4IFDG 5J3BA 3Q6SA 1Y1WB 1HR0L 1STAA 4DFAA 2F0LA 2E2HB 2HIXA 1EYDA 1BUVT 4KY5A 3IL8A 1XNRQ 1CHPD 1LUZA 3NHHA 4XDXA 5C5MA 1PV4A 3PIOA 4LFCQ 3R2TA 4HSPA 2HHHQ 3S2DB 3RNUA 3T1YQ 2WKCA 1SJHD 4A93H 2PO4A 1PYWD 1EZ6A 1E3PA 1Z7TA 2I5MX 4OO1I 1NBWA 2KECA 5M3MH 2UUBL 3KUPA 3TQYA 3ULJA 4B3TL 2F0NA 4Y7NB 1Q81C 1JJCB 4MIUA 3M4YA 4FXGC 1SYBA 5I4DA 3E9IA 4DR2L 1DOMA 2SNMA 3MTSA 4L8JA 1SJED 2RCFA 3HP3A 4PMWA 1X6OA 3EA6A 4LF6L 3NPPA 3Q23A 2F0UA 5ISRA 1Z47A 3MC0B 4A3KG 4X3KA 3CAMA 4KN7C 3E0EA 3OIQA 4R4IA 1L1OA 4X62Q 5BN3A 1E2WA 3CCSA 3SE0A 3I72A 1R4QB 1VMPA 3OIPA 3CCQA 3I4MG 3J7AF 2J7ZA 3I4LA 4IUTA 1XTCD 2Z6KC 4L5RC 2A69D 1GJXA 3OHXC 1SR3A 4RH6A 5D3DA 4OXPA 1C8CA 2N8NA 5C6AA 3D0FA 3PIO3 4KHPL 4GLVB 4X64L 3GTJH 2JA8G 2F0MA 4NPSA 2KENA 1SBBB 5BR8L 2KJXA 5CV4A 1K8MA 1SAPA 2B63G 3S1MH 4CKEA 1BF4A 4A3FB 3QG1A 1VMCA 4HJAA 2NWGA 5EBCA 4P71A 1EEID 2E74C 1DYQA 3S15H 4RG1A 2E8GA 3MVVA 5A2QE 3KLSA 4XYOA 3UI2A 2E2JH 1Y69U 4DV7Q 1B9NA 4QF4A 5M3FB 1XMOQ 1BR9A 1GHJA 3SXHA 1YHQA 1R4PB 4HAEA 2NN6I 4ID6A 5DNFA 2JEBI 1QUQA 2KVMA 3K80C 1OTCA 3HOVH 5IOCA 5C44H 2WB1G 2B2TC 2L15A 5I9PA 4JG2A 4BBSH 3EIVA 2CWAA 1VQNA 2WIIB 2DY7A 2B2YC 1EQVA 1YJ9A 2JN4A 3A55A 4A3MG 3HKZG 2IY5B 2OWOA 1UE5A 2O5IC 2N49A 3FVQA 1S5ED 3S1RB 2NVXB 1I6VC 5BN5A 3M3YH 1PDQA 2XWBB 2F0FA 1W3SA 2F52A 4BBRH 3KF8A 5GQOA
chains in the Genus database with same CATH topology
4C3HH 2JA6G 1E1TA 3FHWA 1Y1VH 4JI4Q 1A63A 3PO2G 2AWNA 1YZ6A 2VQEQ 1IBLQ 3CCVA 4GKJQ 1YEZA 1N32Q 1VQKA 5E7NA 1VQLA 4LUVA 1HZCA 4EX5A 5IWAQ 4DV1L 1MJCA 1VQ9A 4A3CG 4OWWB 4JCVE 4DAMA 4DNIA 3AQQA 4IPGA 1D7QA 3PO3G 4DR7L 1NMGA 3J81j 4DV0L 1KD1C 5GAHC 1PFSA 1VQJA 5JEAG 4IOAA 5LMNL 1SN8A 4A3EH 1TWHH 4LFBL 4IPCA 4DR3Q 2R7ZH 3U4VA 4JI1Q 1HNWL 1IBML 3DM3A 4YWKA 1YBYA 3HOXH 2UU9Q 3KF6A 2A19A 4B3RL 4QQBX 2WFWA 4LFAQ 1GVPA 1J6QA 2GN5A 3NBHB 4JI8L 4KLKA 4AH6A 2JA9A 2KHJA 5IP9H 4YY3L 1VQ5A 2NZHA 3K81C 2R93G 2UXCL 1E24A 2VQFL 2JA7G 2R6GA 4KHPQ 1Q1EA 2MQHA 3OTOQ 3TRZA 4A3GG 5JJLA 3TS2A 3BZKA 3W1GA 5LMUL 1UE1A 2OTJA 3AFPA 1ASYA 1QVFA 4XTCS 4A3MH 2K5HA 1PH9A 3CW2C 4GN3B 3BZCA 2KHIA 3PUYA 3J7ZC 4JYAL 1KAWA 1YJWA 2B29A 2LXKA 4KI0A 4L5QA 4JI6L 4L5SA 2HT1A 1XNRL 1VS0A 1N33L 1BVSA 3I55A 1RIPA 2Z6KA 1EIFA 2NVTH 2IT1A 3E9HA 2ZM6L 3IRBA 4GN4B 1WYDA 1I3QH 2VW9A 3NENA 4PZ7A 5FJ8G 2R92G 2JA6H 1XPOA 3PO2H 1FL0A 3OYYA 2JE6I 4A3DG 4YCWA 2B3GA 3KFUA 2BH8A 1E1OA 3CC7A 3LGJA 1UE7A 1RL2A 1WOCA 1EUJA 3KOJA 4A3CH 3PUXA 2HIVA 1IYJB 1IBKL 3M4OH 4DV5Q 1L1OC 1P8LA 1Q46A 5GROA 4GS3A 1M90C 1GKHA 3GDEA 3T1HQ 1Q86C 1VQ8A 1SLJA 4DR1L 2QA4A 3RZOH 1Q8KA 1I5FA 3D31A 4LNQA 1B8AA 4X65Q 4A3LH 5IP7G 3S24A 1P16A 1Y14B 2NVQH 4JI2Q 4GNXC 1AE3A 1KRTA 5AJ3Q 4JV5Q 3CXCA 1N34L 1DGSA 4LUZA 1X56A 1XTDA 4PZ8A 3TREA 3G71A 4LF8L 5C0XG 2R93H 2K5VA 1WCMG 3NEMA 2JA7H 1IXRA 3M9BA 2ZJRA 3PIPA 3I4NG 1SROA 1KC8C 4JBJA 4A3GH 3CCMA 1UWVA 3A74A 3G6EA 3CF5A 4DUYQ 1HR0W 4LF4L 1V1QA 4X62L 3S1QH 1OXSC 1HR0Q 1L1OB 4OWXB 1GO3E 1YI2A 4GLAC 4GN5A 1XPRA 2WAQG 3S17H 2V1CC 4POGA 2D0OA 2UUCL 3HOUG 4XIGS 2E5LL 5EAYA 3JAMi 2N3SA 1KXLA 1BKBA 4DPGA 4GNXB 2JK8A 2ALYB 3H0GG 5HGQA 1WJJA 2VUMG 1U0LA 1G291 2RF4A 2JJQA 4LW1A 3L2PA 5FJ8H 2JA5G 2NZOA 3F2CA 4HJ5A 4JBMA 2IX1A 2MO0A 1HNXQ 3F2BA 1Y1WG 5IYCG 2VNUD 4B3SQ 3CD6A 2AKWB 1I94L 2Q2TA 3CPFA 3MEFA 4DV0Q 2UUBQ 4B3TQ 3F1ZA 5LMNQ 2CQOA 4K0KL 1N8RC 4DV4Q 1NY4A 1EFWA 1FJGL 4DR4Q 4IFDI 4LFBQ 4GOPC 1JT8A 2DGYA 1HNWQ 1IBMQ 2PMZE 3KJPA 1Q82C 3VDYA 1UEBA 1QZHA 3GTMH 4WJ3M 1KRSA 1HZBA 4DR2Q 1CSQA 2UXDL 4P75A 1YJNA 4NXNQ 5JJKA 4DR5Q 1G6PA 4HIMA 1X55A 3PUZA 2VS1A 4IJHA 4UP7A 3UE0A 5IP7H 5C4XG 2CFMA 3AYHB 1VQ4A 2UXBQ 4LF5Q 3STBC 1ASZA 2YTYA 4MZ9A 4HJ9A 4R4QA 4LF6Q 5C3EG 4DR6L 2K5NA 3ZJYC 1YHBA 2E2IH 5LMUQ 1B70B 4YCVA 1TWAH 1WCMH 5M5WH 5FLXc 4A75A 3UE1A 4YHHL 4DV7L 3I4NH 1JJGA 5IE8A 1XPUA 3A5ZB 1XMOL 2I5LX 1K0RA 3AFQA 3J81c 4GOPB 1VQHA 3GTOH 1AE2A 2KCTA 4C3JH 4JBKA 3OW2A 3W1BA 1XNQL 2VL6A 4LWCA 2VZAA 4R1JA 3PGZA 3TS0A 3CPWA 2ZM6Q 3HOUH 1KHIA 4A3LG 4NXML 1NTGA 4PZ6A 3GD7A 5C0XJ 3UDIA 3H0GH 4JI5L 3GTPH 4B3MQ 2VUMH 2AHOB 2JA5H 4P72A 4OO1G 2MO1A 1EQRA 1S3OA 4X64Q 2VY3A 1VQ6A 2CKZB 4LF9Q 3CCRA 5IYBG 1Y1WH 3HOYG 5IYCH 4DUZQ 3CCJA 4AQYL 3PF5A 2E2HH 1IBKQ 1E7ZA 3TEHB 4POFA 5BR8Q 1FGUA 1A0IA 3G48A 4Y52H 3CCEA 4DV2Q 1X3EA 4MNOA 1H95A 4YWLA 4DR1Q 3RLFA 3I7FA 4R4TA 5JJIA 1MIUA 2K14A 5M5YH 1Z9FA 3HKSA 2YTVA 1HNZL 1X3FA 3L0OA 3S2DH 4JI4L 2K75A 2VQEL 1IBLL 4LFCL 4JI7L 4GKJL 2HHHL 1PH6A 1N32L 1TWGH 3ULLA 1PH1A 1BBUA 2K50A 1PH2A 2K4KA 5C4XH 4HJ7A 2A1AA 3T1YL 3PV0A 4QJFA 4FDBA 4GLXA 1FVIA 1NE3A 1HZAA 5C3EH 3RLNA 2A8VA 4DV6Q 5IT9c 1K73C 4Y7NH 1G51A 1YITA 4O0AA 3K7UC 1EWIA 1JMCA 4A3FG 1EIYB 3ER0A 4IJLA 4BY7G 3H3VH 4DR3L 2LSSA 2UUCQ 1OXUA 4JI1L 5HY6A 1XMQQ 3HOWG 3GTLH 5C4JH 5K36G 1K8AC 3F8TA 5GQOA 5GAEC 4DAYB 4GNXA 1LTLA 4HJ8A 3BU2A 2D0PA 2R7FA 4P74A 2UU9L 4A3BG 5IY0A 4JI0Q 3KF6B 3WWVA 4BXXG 4TVAB 4HIOA 3FKIG 1X65A 3M4QA 1YNXA 1IZ6A 3J80i 3ICEA 3PUVA 1N36Q 3CCUA 1VQOA 1PH7A 1W2BA 3W5OA 3GO5A 3U4ZA 3NELA 3OTOL 4BY1G 5M3FG 3KYHC 4UPAA 2DUDA 4DV3L 1I94Q 2ES2A 4X66Q 2UUAQ 3UDFA 3UDGA 5IYBH 4YCUA 3HOYH 3Q8DA 4R4CA 4IOCA 3CC4A 4EQ5A 1SE8A 4HIDA 3AEVA 3B6YA 3I4OA 3H15A 3KDFB 3A5UA 4AIMA 2IHEA 4IPHA 1TWCH 1M1KC 3HFZB 1CSPA 2PQAB 1QVCA 2XGTA 4QL5A 1UE6A 2K52A 1K3RA 4HIKA 4A3JG 2UXDQ 2ZTCA 1VQFA 1JB7A 3S16H 2FXQA 2KBNA 2PNHA 4LUOA 4A93G 1YHAA 2QEXA 2GVBA 4DR6Q 1T9HA 1NJIC 1I6HH 4A3IG 3RR5A 3S14H 3PCOB 2MNAA 2Q2IA 2ZTDA 5M3MG 3CP0A 4DV1Q 1PA6A 1VQAA 4QIWE 2OTLA 1IL2A 3KLWA 2AWOA 4DR7Q 3FP9A 2OCEA 1V9PA 3JC66 5LMNW 4GOPA 2F4VL 1Q1BA 2NN6G 4DV5L 5ELOA 5M5XH 1CUKA 1K83H 4ALPA 1LM0A 4A3FH 1XNQQ 4IO9A 1CKNB 2R7DA 1WFQA 3RN2A 3T1HL 3U58A 1O7IA 1J5EL 1OXTA 1PYSB 4C3IH 3HOWH 3I4MH 4BY7H 1C0AA 2KCMA 1VQ7A 3PUWA 4X65L 1QVGA 4B3RQ 4JI2L 3CMAA 4A3BH 2Y0SE 4JI8Q 3UDXA 5AJ3L 1PH5A 4LF7L 4OX9L 4JV5L 4YY3Q 4JOIC 1L2FA 4BXXH 1VQCA 3PF4A 1AH9A 3FKIH 2UXCQ 4KHZA 2MFIA 2VQFQ 1U5KA 1JE5A 3HOZG 2BH2A 4MTNA 1X54A 4AQYQ 4QGUA 5M3FH 1B7YB 4DUYL 1VQMA 2YYZA 5H1SE 4BY1H 5GADC 2WB1E 3J81i 4IFDG 1I50H 5J3BA 5FLMG 1HR0L 1K9MC 1YIJA 4JYAQ 1V43A 2HIXA 4JI6Q 2IHFA 1VQBA 1XNRQ 1N33Q 4WJ4A 2EIFA 4GKKL 1LUZA 1HNZQ 4AYBE 1NMFA 1PV4A 1QUQB 2QGQA 3PIOA 4A3JH 2OQ0A 4JI7Q 4LFCQ 4JC0A 1VQPA 2HHHQ 4JI3L 1S72A 1A62A 4A76A 1N9WA 2CCZA 2WP8J 2EXDA 3RNUA 3T1YQ 1HNXL 4A93H 2LXJA 4H02A 1E3PA 1VQDA 4B3SL 2I5MX 4A3IH 1QZGA 2CWPA 1VQGA 4OO1I 1NBWA 2HQLA 2RCNA 5M3MH 2ATWA 1R9TH 2UUBL 3TQYA 3ULJA 3S1RH 4B3TL 1YVCA 2NVXH 1Q81C 1JJCB 2ASBA 2JEAI 3F2DA 4DV4L 4DR4L 1PH8A 1OXXK 4P73A 2ID0A 3U50C 3EBEA 2ZJPA 1GD7A 3ERSX 4R4OA 4UY8C 3E9IA 4DR2L 4NXNL 4DR5L 1OXVA 1C9OA 4APVA 3M7NA 3KF8B 3RN5A 1E22A 1K8GA 1LYLA 2Z0SA 3K0XA 4O2DA 1X6OA 4PMWA 2UXBL 4LF5L 1N34Q 4LF6L 4LF8Q 1SFOH 1VQIA 4DV3Q 4C2MH 3I2ZA 1Z47A 5IWAL 3HOZH 4A3KG 3CAMA 3E0EA 4LF4Q 1CKMA 4L5TA 4R4IA 1L1OA 2PI2A 4X62Q 4DKAC 2Q2UA 3KDFA 3CCSA 5FLMH 1VCIA 2EQSA 1HJPA 2YU9H 1Q12A 2PQAA 3CCQA 3CCLA 1L0WA 3I4MG 2E5LQ 3K8AA 2D62A 3GTKH 3HOVG 3M85A 5C44G 2Z6KC 4L5RC 2YTXA 2YV5A 4IPDA 2F3IA 4BA1I 4LFAL 1SR3A 4BBSG 4B3ML 2I0QA 4OXPA 1TXYA 2N8NA 1PHJA 4X6AH 4OONA 3D0FA 3PSIA 4DK3C 1GM5A 4KHPL 3A0JA 4GLVB 4X64L 4IFDJ 3L7ZC 3GTJH 2JA8G 4LF9L 1KL9A 2ZJQA 1S40A 1PH3A 4NPSA 2BA1A 3K7AH 2KENA 3MXNB 4DUZL 5IYDG 5C0XI 2F4VQ 3PO3H 5BR8L 2C35B 1CKNA 3S2HH 1MKHA 4K0KQ 4DV2L 1FJGQ 1J5EQ 2B63G 2NVYH 4BBRG 3S1MH 2PI2E 3GTGH 4HJAA 1EOVA 1Y1VG 3SGIA 4TQUS 4P71A 2OQKA 1PVOA 1TWFH 4LF7Q 3S15H 4OX9Q 3J7A5 4RG1A 1X3GA 2N78A 2E8GA 1EYGA 3J80c 3STBD 5JEAJ 4A4IA 4DV6L 4PG3A 2E2JH 1HZ9A 3RZDH 4YHHQ 1XJVA 4DV7Q 1Q7YC 4OWTB 4A3KH 1MJEA 1JJ2A 4A3EG 2BA0A 4DK6C 1XMOQ 4ME3A 1SRUA 2R7ZG 2Y0SG 2GVAA 3EN2A 1YHQA 3CQZH 1XMQL 2AMCB 3S1NH 2NN6I 4GKKQ 3DLLA 4NB3A 3HOXG 2JEBI 1A8VA 1QUQA 2I5HA 3K80C 4UP9A 3ULPA 4NXMQ 4JOIA 4JI0L 1OTCA 3HOVH 1PH4A 5IP9G 5C44H 1CKOA 2H5XA 2WB1G 3JAMc 4JI3Q 4JI5Q 2L15A 2WAQE 1HH2P 5DLQE 3RLOA 3M4PA 2R92H 4BA2I 1N36L 4JG2A 1SMXA 4YWMA 3CMEA 4BBSH 4A3DH 1WI5A 3EIVA 2CWAA 1VQNA 5GAGC 1YJ9A 4JBWA 2XTIA 1BBWA 1VQEA 4X66L 2JQOA 4A3MG 3HKZG 2UUAL 2JA8H 1KIXA 4AYBG 4UP8A 2IY5B 1C7YA 2OWOA 3GTQH 3CC2A 3BJUA 1UE5A 2IX0A 5IYDH 2N49A 4J15A 2Q2HA 4QY7A 3I56A 1D8LA 4RMFA 5ELNA 1X9NA 3M3YH 1W3SA 2RHQB 2ZTEA 2F52A 1EQQA 4BBRH 1KQSA 3G4SA 2B63H 3H3VI 3HKZE 3KJOA 1PYBA 2RHSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3H H;  2JA6 G;  1E1T A;  3FHW A;  1Y1V H;  4JI4 Q;  1A63 A;  3PO2 G;  2AWN A;  1YZ6 A;  2VQE Q;  1IBL Q;  3CCV A;  4GKJ Q;  1YEZ A;  1N32 Q;  1VQK A;  5E7N A;  1VQL A;  4LUV A;  1HZC A;  4EX5 A;  5IWA Q;  4DV1 L;  1MJC A;  1VQ9 A;  4A3C G;  4OWW B;  4JCV E;  4DAM A;  4DNI A;  3AQQ A;  4IPG A;  1D7Q A;  3PO3 G;  4DR7 L;  1NMG A;  3J81 j;  4DV0 L;  1KD1 C;  5GAH C;  1PFS A;  1VQJ A;  5JEA G;  4IOA A;  5LMN L;  1SN8 A;  4A3E H;  1TWH H;  4LFB L;  4IPC A;  4DR3 Q;  2R7Z H;  3U4V A;  4JI1 Q;  1HNW L;  1IBM L;  3DM3 A;  4YWK A;  1YBY A;  3HOX H;  2UU9 Q;  3KF6 A;  2A19 A;  4B3R L;  4QQB X;  2WFW A;  4LFA Q;  1GVP A;  1J6Q A;  2GN5 A;  3NBH B;  4JI8 L;  4KLK A;  4AH6 A;  2JA9 A;  2KHJ A;  5IP9 H;  4YY3 L;  1VQ5 A;  2NZH A;  3K81 C;  2R93 G;  2UXC L;  1E24 A;  2VQF L;  2JA7 G;  2R6G A;  4KHP Q;  1Q1E A;  2MQH A;  3OTO Q;  3TRZ A;  4A3G G;  5JJL A;  3TS2 A;  3BZK A;  3W1G A;  5LMU L;  1UE1 A;  2OTJ A;  3AFP A;  1ASY A;  1QVF A;  4XTC S;  4A3M H;  2K5H A;  1PH9 A;  3CW2 C;  4GN3 B;  3BZC A;  2KHI A;  3PUY A;  3J7Z C;  4JYA L;  1KAW A;  1YJW A;  2B29 A;  2LXK A;  4KI0 A;  4L5Q A;  4JI6 L;  4L5S A;  2HT1 A;  1XNR L;  1VS0 A;  1N33 L;  1BVS A;  3I55 A;  1RIP A;  2Z6K A;  1EIF A;  2NVT H;  2IT1 A;  3E9H A;  2ZM6 L;  3IRB A;  4GN4 B;  1WYD A;  1I3Q H;  2VW9 A;  3NEN A;  4PZ7 A;  5FJ8 G;  2R92 G;  2JA6 H;  1XPO A;  3PO2 H;  1FL0 A;  3OYY A;  2JE6 I;  4A3D G;  4YCW A;  2B3G A;  3KFU A;  2BH8 A;  1E1O A;  3CC7 A;  3LGJ A;  1UE7 A;  1RL2 A;  1WOC A;  1EUJ A;  3KOJ A;  4A3C H;  3PUX A;  2HIV A;  1IYJ B;  1IBK L;  3M4O H;  4DV5 Q;  1L1O C;  1P8L A;  1Q46 A;  5GRO A;  4GS3 A;  1M90 C;  1GKH A;  3GDE A;  3T1H Q;  1Q86 C;  1VQ8 A;  1SLJ A;  4DR1 L;  2QA4 A;  3RZO H;  1Q8K A;  1I5F A;  3D31 A;  4LNQ A;  1B8A A;  4X65 Q;  4A3L H;  5IP7 G;  3S24 A;  1P16 A;  1Y14 B;  2NVQ H;  4JI2 Q;  4GNX C;  1AE3 A;  1KRT A;  5AJ3 Q;  4JV5 Q;  3CXC A;  1N34 L;  1DGS A;  4LUZ A;  1X56 A;  1XTD A;  4PZ8 A;  3TRE A;  3G71 A;  4LF8 L;  5C0X G;  2R93 H;  2K5V A;  1WCM G;  3NEM A;  2JA7 H;  1IXR A;  3M9B A;  2ZJR A;  3PIP A;  3I4N G;  1SRO A;  1KC8 C;  4JBJ A;  4A3G H;  3CCM A;  1UWV A;  3A74 A;  3G6E A;  3CF5 A;  4DUY Q;  1HR0 W;  4LF4 L;  1V1Q A;  4X62 L;  3S1Q H;  1OXS C;  1HR0 Q;  1L1O B;  4OWX B;  1GO3 E;  1YI2 A;  4GLA C;  4GN5 A;  1XPR A;  2WAQ G;  3S17 H;  2V1C C;  4POG A;  2D0O A;  2UUC L;  3HOU G;  4XIG S;  2E5L L;  5EAY A;  3JAM i;  2N3S A;  1KXL A;  1BKB A;  4DPG A;  4GNX B;  2JK8 A;  2ALY B;  3H0G G;  5HGQ A;  1WJJ A;  2VUM G;  1U0L A;  1G29 1;  2RF4 A;  2JJQ A;  4LW1 A;  3L2P A;  5FJ8 H;  2JA5 G;  2NZO A;  3F2C A;  4HJ5 A;  4JBM A;  2IX1 A;  2MO0 A;  1HNX Q;  3F2B A;  1Y1W G;  5IYC G;  2VNU D;  4B3S Q;  3CD6 A;  2AKW B;  1I94 L;  2Q2T A;  3CPF A;  3MEF A;  4DV0 Q;  2UUB Q;  4B3T Q;  3F1Z A;  5LMN Q;  2CQO A;  4K0K L;  1N8R C;  4DV4 Q;  1NY4 A;  1EFW A;  1FJG L;  4DR4 Q;  4IFD I;  4LFB Q;  4GOP C;  1JT8 A;  2DGY A;  1HNW Q;  1IBM Q;  2PMZ E;  3KJP A;  1Q82 C;  3VDY A;  1UEB A;  1QZH A;  3GTM H;  4WJ3 M;  1KRS A;  1HZB A;  4DR2 Q;  1CSQ A;  2UXD L;  4P75 A;  1YJN A;  4NXN Q;  5JJK A;  4DR5 Q;  1G6P A;  4HIM A;  1X55 A;  3PUZ A;  2VS1 A;  4IJH A;  4UP7 A;  3UE0 A;  5IP7 H;  5C4X G;  2CFM A;  3AYH B;  1VQ4 A;  2UXB Q;  4LF5 Q;  3STB C;  1ASZ A;  2YTY A;  4MZ9 A;  4HJ9 A;  4R4Q A;  4LF6 Q;  5C3E G;  4DR6 L;  2K5N A;  3ZJY C;  1YHB A;  2E2I H;  5LMU Q;  1B70 B;  4YCV A;  1TWA H;  1WCM H;  5M5W H;  5FLX c;  4A75 A;  3UE1 A;  4YHH L;  4DV7 L;  3I4N H;  1JJG A;  5IE8 A;  1XPU A;  3A5Z B;  1XMO L;  2I5L X;  1K0R A;  3AFQ A;  3J81 c;  4GOP B;  1VQH A;  3GTO H;  1AE2 A;  2KCT A;  4C3J H;  4JBK A;  3OW2 A;  3W1B A;  1XNQ L;  2VL6 A;  4LWC A;  2VZA A;  4R1J A;  3PGZ A;  3TS0 A;  3CPW A;  2ZM6 Q;  3HOU H;  1KHI A;  4A3L G;  4NXM L;  1NTG A;  4PZ6 A;  3GD7 A;  5C0X J;  3UDI A;  3H0G H;  4JI5 L;  3GTP H;  4B3M Q;  2VUM H;  2AHO B;  2JA5 H;  4P72 A;  4OO1 G;  2MO1 A;  1EQR A;  1S3O A;  4X64 Q;  2VY3 A;  1VQ6 A;  2CKZ B;  4LF9 Q;  3CCR A;  5IYB G;  1Y1W H;  3HOY G;  5IYC H;  4DUZ Q;  3CCJ A;  4AQY L;  3PF5 A;  2E2H H;  1IBK Q;  1E7Z A;  3TEH B;  4POF A;  5BR8 Q;  1FGU A;  1A0I A;  3G48 A;  4Y52 H;  3CCE A;  4DV2 Q;  1X3E A;  4MNO A;  1H95 A;  4YWL A;  4DR1 Q;  3RLF A;  3I7F A;  4R4T A;  5JJI A;  1MIU A;  2K14 A;  5M5Y H;  1Z9F A;  3HKS A;  2YTV A;  1HNZ L;  1X3F A;  3L0O A;  3S2D H;  4JI4 L;  2K75 A;  2VQE L;  1IBL L;  4LFC L;  4JI7 L;  4GKJ L;  2HHH L;  1PH6 A;  1N32 L;  1TWG H;  3ULL A;  1PH1 A;  1BBU A;  2K50 A;  1PH2 A;  2K4K A;  5C4X H;  4HJ7 A;  2A1A A;  3T1Y L;  3PV0 A;  4QJF A;  4FDB A;  4GLX A;  1FVI A;  1NE3 A;  1HZA A;  5C3E H;  3RLN A;  2A8V A;  4DV6 Q;  5IT9 c;  1K73 C;  4Y7N H;  1G51 A;  1YIT A;  4O0A A;  3K7U C;  1EWI A;  1JMC A;  4A3F G;  1EIY B;  3ER0 A;  4IJL A;  4BY7 G;  3H3V H;  4DR3 L;  2LSS A;  2UUC Q;  1OXU A;  4JI1 L;  5HY6 A;  1XMQ Q;  3HOW G;  3GTL H;  5C4J H;  5K36 G;  1K8A C;  3F8T A;  5GQO A;  5GAE C;  4DAY B;  4GNX A;  1LTL A;  4HJ8 A;  3BU2 A;  2D0P A;  2R7F A;  4P74 A;  2UU9 L;  4A3B G;  5IY0 A;  4JI0 Q;  3KF6 B;  3WWV A;  4BXX G;  4TVA B;  4HIO A;  3FKI G;  1X65 A;  3M4Q A;  1YNX A;  1IZ6 A;  3J80 i;  3ICE A;  3PUV A;  1N36 Q;  3CCU A;  1VQO A;  1PH7 A;  1W2B A;  3W5O A;  3GO5 A;  3U4Z A;  3NEL A;  3OTO L;  4BY1 G;  5M3F G;  3KYH C;  4UPA A;  2DUD A;  4DV3 L;  1I94 Q;  2ES2 A;  4X66 Q;  2UUA Q;  3UDF A;  3UDG A;  5IYB H;  4YCU A;  3HOY H;  3Q8D A;  4R4C A;  4IOC A;  3CC4 A;  4EQ5 A;  1SE8 A;  4HID A;  3AEV A;  3B6Y A;  3I4O A;  3H15 A;  3KDF B;  3A5U A;  4AIM A;  2IHE A;  4IPH A;  1TWC H;  1M1K C;  3HFZ B;  1CSP A;  2PQA B;  1QVC A;  2XGT A;  4QL5 A;  1UE6 A;  2K52 A;  1K3R A;  4HIK A;  4A3J G;  2UXD Q;  2ZTC A;  1VQF A;  1JB7 A;  3S16 H;  2FXQ A;  2KBN A;  2PNH A;  4LUO A;  4A93 G;  1YHA A;  2QEX A;  2GVB A;  4DR6 Q;  1T9H A;  1NJI C;  1I6H H;  4A3I G;  3RR5 A;  3S14 H;  3PCO B;  2MNA A;  2Q2I A;  2ZTD A;  5M3M G;  3CP0 A;  4DV1 Q;  1PA6 A;  1VQA A;  4QIW E;  2OTL A;  1IL2 A;  3KLW A;  2AWO A;  4DR7 Q;  3FP9 A;  2OCE A;  1V9P A;  3JC6 6;  5LMN W;  4GOP A;  2F4V L;  1Q1B A;  2NN6 G;  4DV5 L;  5ELO A;  5M5X H;  1CUK A;  1K83 H;  4ALP A;  1LM0 A;  4A3F H;  1XNQ Q;  4IO9 A;  1CKN B;  2R7D A;  1WFQ A;  3RN2 A;  3T1H L;  3U58 A;  1O7I A;  1J5E L;  1OXT A;  1PYS B;  4C3I H;  3HOW H;  3I4M H;  4BY7 H;  1C0A A;  2KCM A;  1VQ7 A;  3PUW A;  4X65 L;  1QVG A;  4B3R Q;  4JI2 L;  3CMA A;  4A3B H;  2Y0S E;  4JI8 Q;  3UDX A;  5AJ3 L;  1PH5 A;  4LF7 L;  4OX9 L;  4JV5 L;  4YY3 Q;  4JOI C;  1L2F A;  4BXX H;  1VQC A;  3PF4 A;  1AH9 A;  3FKI H;  2UXC Q;  4KHZ A;  2MFI A;  2VQF Q;  1U5K A;  1JE5 A;  3HOZ G;  2BH2 A;  4MTN A;  1X54 A;  4AQY Q;  4QGU A;  5M3F H;  1B7Y B;  4DUY L;  1VQM A;  2YYZ A;  5H1S E;  4BY1 H;  5GAD C;  2WB1 E;  3J81 i;  4IFD G;  1I50 H;  5J3B A;  5FLM G;  1HR0 L;  1K9M C;  1YIJ A;  4JYA Q;  1V43 A;  2HIX A;  4JI6 Q;  2IHF A;  1VQB A;  1XNR Q;  1N33 Q;  4WJ4 A;  2EIF A;  4GKK L;  1LUZ A;  1HNZ Q;  4AYB E;  1NMF A;  1PV4 A;  1QUQ B;  2QGQ A;  3PIO A;  4A3J H;  2OQ0 A;  4JI7 Q;  4LFC Q;  4JC0 A;  1VQP A;  2HHH Q;  4JI3 L;  1S72 A;  1A62 A;  4A76 A;  1N9W A;  2CCZ A;  2WP8 J;  2EXD A;  3RNU A;  3T1Y Q;  1HNX L;  4A93 H;  2LXJ A;  4H02 A;  1E3P A;  1VQD A;  4B3S L;  2I5M X;  4A3I H;  1QZG A;  2CWP A;  1VQG A;  4OO1 I;  1NBW A;  2HQL A;  2RCN A;  5M3M H;  2ATW A;  1R9T H;  2UUB L;  3TQY A;  3ULJ A;  3S1R H;  4B3T L;  1YVC A;  2NVX H;  1Q81 C;  1JJC B;  2ASB A;  2JEA I;  3F2D A;  4DV4 L;  4DR4 L;  1PH8 A;  1OXX K;  4P73 A;  2ID0 A;  3U50 C;  3EBE A;  2ZJP A;  1GD7 A;  3ERS X;  4R4O A;  4UY8 C;  3E9I A;  4DR2 L;  4NXN L;  4DR5 L;  1OXV A;  1C9O A;  4APV A;  3M7N A;  3KF8 B;  3RN5 A;  1E22 A;  1K8G A;  1LYL A;  2Z0S A;  3K0X A;  4O2D A;  1X6O A;  4PMW A;  2UXB L;  4LF5 L;  1N34 Q;  4LF6 L;  4LF8 Q;  1SFO H;  1VQI A;  4DV3 Q;  4C2M H;  3I2Z A;  1Z47 A;  5IWA L;  3HOZ H;  4A3K G;  3CAM A;  3E0E A;  4LF4 Q;  1CKM A;  4L5T A;  4R4I A;  1L1O A;  2PI2 A;  4X62 Q;  4DKA C;  2Q2U A;  3KDF A;  3CCS A;  5FLM H;  1VCI A;  2EQS A;  1HJP A;  2YU9 H;  1Q12 A;  2PQA A;  3CCQ A;  3CCL A;  1L0W A;  3I4M G;  2E5L Q;  3K8A A;  2D62 A;  3GTK H;  3HOV G;  3M85 A;  5C44 G;  2Z6K C;  4L5R C;  2YTX A;  2YV5 A;  4IPD A;  2F3I A;  4BA1 I;  4LFA L;  1SR3 A;  4BBS G;  4B3M L;  2I0Q A;  4OXP A;  1TXY A;  2N8N A;  1PHJ A;  4X6A H;  4OON A;  3D0F A;  3PSI A;  4DK3 C;  1GM5 A;  4KHP L;  3A0J A;  4GLV B;  4X64 L;  4IFD J;  3L7Z C;  3GTJ H;  2JA8 G;  4LF9 L;  1KL9 A;  2ZJQ A;  1S40 A;  1PH3 A;  4NPS A;  2BA1 A;  3K7A H;  2KEN A;  3MXN B;  4DUZ L;  5IYD G;  5C0X I;  2F4V Q;  3PO3 H;  5BR8 L;  2C35 B;  1CKN A;  3S2H H;  1MKH A;  4K0K Q;  4DV2 L;  1FJG Q;  1J5E Q;  2B63 G;  2NVY H;  4BBR G;  3S1M H;  2PI2 E;  3GTG H;  4HJA A;  1EOV A;  1Y1V G;  3SGI A;  4TQU S;  4P71 A;  2OQK A;  1PVO A;  1TWF H;  4LF7 Q;  3S15 H;  4OX9 Q;  3J7A 5;  4RG1 A;  1X3G A;  2N78 A;  2E8G A;  1EYG A;  3J80 c;  3STB D;  5JEA J;  4A4I A;  4DV6 L;  4PG3 A;  2E2J H;  1HZ9 A;  3RZD H;  4YHH Q;  1XJV A;  4DV7 Q;  1Q7Y C;  4OWT B;  4A3K H;  1MJE A;  1JJ2 A;  4A3E G;  2BA0 A;  4DK6 C;  1XMO Q;  4ME3 A;  1SRU A;  2R7Z G;  2Y0S G;  2GVA A;  3EN2 A;  1YHQ A;  3CQZ H;  1XMQ L;  2AMC B;  3S1N H;  2NN6 I;  4GKK Q;  3DLL A;  4NB3 A;  3HOX G;  2JEB I;  1A8V A;  1QUQ A;  2I5H A;  3K80 C;  4UP9 A;  3ULP A;  4NXM Q;  4JOI A;  4JI0 L;  1OTC A;  3HOV H;  1PH4 A;  5IP9 G;  5C44 H;  1CKO A;  2H5X A;  2WB1 G;  3JAM c;  4JI3 Q;  4JI5 Q;  2L15 A;  2WAQ E;  1HH2 P;  5DLQ E;  3RLO A;  3M4P A;  2R92 H;  4BA2 I;  1N36 L;  4JG2 A;  1SMX A;  4YWM A;  3CME A;  4BBS H;  4A3D H;  1WI5 A;  3EIV A;  2CWA A;  1VQN A;  5GAG C;  1YJ9 A;  4JBW A;  2XTI A;  1BBW A;  1VQE A;  4X66 L;  2JQO A;  4A3M G;  3HKZ G;  2UUA L;  2JA8 H;  1KIX A;  4AYB G;  4UP8 A;  2IY5 B;  1C7Y A;  2OWO A;  3GTQ H;  3CC2 A;  3BJU A;  1UE5 A;  2IX0 A;  5IYD H;  2N49 A;  4J15 A;  2Q2H A;  4QY7 A;  3I56 A;  1D8L A;  4RMF A;  5ELN A;  1X9N A;  3M3Y H;  1W3S A;  2RHQ B;  2ZTE A;  2F52 A;  1EQQ A;  4BBR H;  1KQS A;  3G4S A;  2B63 H;  3H3V I;  3HKZ E;  3KJO A;  1PYB A;  2RHS B; 
#chains in the Genus database with same CATH topology
 5ELE A;  2AWN A;  5I6Y A;  3CCV A;  3TME A;  4V0B A;  1N32 Q;  3ND9 A;  2PNR C;  3OWF A;  2F4I A;  5E7N A;  1VQK A;  4LUV A;  1HZC A;  2FFK B;  1GUN A;  1DOK A;  3AQQ A;  4IPG A;  4KD4 A;  3VYT A;  1B3Q A;  4U67 3;  4DV0 L;  3L9A X;  3HOZ B;  2AQ3 B;  1SN8 A;  2EYH A;  5J22 A;  4A3E H;  5E1F A;  3U4V A;  3J80 E;  2YU9 B;  3DM3 A;  4WRD A;  2UU9 Q;  2A19 A;  2XRQ D;  5IP9 H;  2UXC L;  4KHP Q;  2VQF L;  4DK1 A;  3MXN A;  1A3T A;  3BG3 A;  2OF1 A;  3T4A C;  2X6G A;  2PYK A;  2K5H A;  1U4M A;  4JYA L;  1CK1 A;  3QR8 A;  2B29 A;  2JYO A;  4L5S A;  4HSV A;  1BVS A;  1RIP A;  2L12 A;  2Z6K A;  1EIF A;  4OIJ A;  5FO8 B;  2IT1 A;  3E9H A;  2ZM6 L;  2R92 G;  3OYY A;  3QWN A;  2XRS D;  1I4R A;  2BH8 A;  3LGJ A;  4B9X A;  1RL2 A;  1HFG A;  2NBF A;  4ME5 A;  1EUJ A;  3PUX A;  3R2I A;  1JC7 A;  1GUS A;  3RZD B;  1YNN D;  4RAU C;  5JEA H;  3SK8 A;  1K8O A;  1Q8K A;  1I5F A;  1EQT A;  4X65 Q;  3O13 A;  1P16 A;  1Y14 B;  1KRT A;  4CHT B;  2RKS A;  2KED A;  2NUC A;  1X56 A;  4Q5V A;  1CQF A;  1SRO A;  4IUP A;  1TQO A;  2F0G A;  4NMZ A;  3TZU A;  2B8G A;  2F1M A;  1YI2 A;  5BN4 A;  3GTQ B;  1HRJ A;  2V1C C;  2D0O A;  5CC4 A;  1CTM A;  4K14 A;  4XIG S;  4MN3 A;  1GXD C;  2B2T A;  2N3S A;  2JK8 A;  3H0G G;  1FD7 D;  1HTL D;  1U0L A;  1G29 1;  2RF4 A;  2JJQ A;  2Z6B A;  1Y8O B;  2B2V C;  2B2Y A;  2F0S A;  2NZO A;  4C3H B;  1HXY D;  1Y1V B;  5DEH A;  3ERQ A;  2M00 A;  3F2B A;  5FO7 B;  4B3S Q;  2F3W A;  1FR3 A;  4RWS C;  5CR3 A;  2Q2T A;  4KTA A;  4DV0 Q;  1TU2 B;  5IOD A;  2EJG C;  2A73 B;  4K0K L;  1N8R C;  3BYY B;  1FJG L;  4DR4 Q;  4DU9 A;  3GTM H;  3VDY A;  1QNU A;  3RD4 A;  5T1I A;  4WJ3 M;  1KRS A;  4RHS A;  4NXN Q;  5JVH 3;  2A6E D;  1D5Z C;  1EOT A;  2MHV A;  5CV6 A;  3UE0 A;  3D4W A;  2SEB D;  5JPM C;  4LF5 Q;  4HJ9 A;  4R4Q A;  3AU7 A;  3ONA B;  1JCK B;  1YHB A;  3ZYY X;  5KRU A;  1IKM A;  2J0T D;  1B3A A;  3C3L A;  3GTO H;  3J81 c;  4GOP B;  1ENC A;  2EVB A;  2QCP X;  4JBK A;  1XNQ L;  2VL6 A;  1KTK A;  2VZA A;  3PGZ A;  3NP8 A;  2ZM6 Q;  2OT2 A;  1SYC A;  1SMY C;  3I8Z A;  4NXM L;  2NVT B;  2A74 C;  3AMU A;  5AFW A;  3GD7 A;  3UDI A;  3SHL A;  2QW7 A;  1I3Q B;  4B3M Q;  2VUM H;  3V05 A;  3X3M A;  3PO2 B;  1PTO F;  2VY3 A;  4H44 C;  4LF9 Q;  4FXK C;  1Y1W H;  5IYC H;  1EIH A;  2E2H H;  3TEH B;  1LTG D;  2FHT A;  3EFX D;  4Y52 H;  4KJO A;  4EQO A;  3CCE A;  1H95 A;  1D1K A;  3M4O B;  4YWL A;  3RLF A;  3K5L A;  1CT1 D;  1IW7 C;  2I07 B;  2K14 A;  2KOL A;  5JJI A;  3HKS A;  1HNZ L;  3S1M B;  3S2D H;  4JI7 L;  1IBL L;  3KBG A;  4GKJ L;  2NVQ B;  5E4X A;  2K50 A;  3S15 B;  3NWS A;  1M4V A;  4I65 A;  4FDB A;  3FDT A;  1DOL A;  1NE3 A;  2WAC A;  1MSG A;  2A8V A;  4DV6 Q;  3DUZ A;  1K28 A;  2RA4 A;  1G51 A;  4Y7N H;  2JA7 B;  3K7U C;  4K2L A;  2B2U C;  3ER0 A;  4BY7 G;  2K7V A;  3HOW G;  1H9S B;  2EJF C;  1XMQ Q;  1HA6 A;  2L9H A;  1LTL A;  1A2U A;  4A3B G;  4RGM A;  3DWQ A;  4CJ2 C;  4ODG A;  4BXX G;  4HIO A;  3FKI G;  1X65 A;  3M4Q A;  1YNX A;  1IZ6 A;  3ICE A;  1ESR A;  1QIL A;  1PH7 A;  1N36 Q;  5CV9 A;  1F2Y A;  3NEL A;  3OTO L;  4ZAI A;  4R9W A;  4ZUJ A;  2F0E A;  4X66 Q;  2SOB A;  1TT2 A;  1SE8 A;  3I4O A;  3NTI A;  1EU3 A;  4C3J G;  3BVZ A;  4RGT A;  1G2T A;  4IPH A;  1TS2 A;  1KAA A;  2B2V A;  3A54 A;  3M3Y B;  2ZTC A;  2RDH A;  3GP7 A;  2KBN A;  2L1B A;  4KD3 A;  2BOS A;  4A93 G;  2AQ1 B;  2RQX A;  4CJ1 B;  1T9H A;  4HTH A;  5F2D A;  1NJI C;  4L63 B;  2IJ0 A;  1LT4 D;  5M3M G;  4QIW E;  2OTL A;  4FF3 A;  4X3S A;  1F9S A;  2E2I B;  2AWO A;  1V9P A;  2F4V L;  5LMN W;  1PRT B;  1HTP A;  1O7Y A;  1WTW A;  1XNQ Q;  1QG7 A;  4ALP A;  4A3F H;  2L5T A;  3D8G A;  3T1H L;  1J5E L;  1XX8 A;  3J81 L;  3NQT A;  1EY7 A;  2Y0S E;  1SE3 A;  1KDB A;  3UDX A;  4C1N I;  1PH5 A;  4OX9 L;  4JV5 L;  3NWT A;  1L2F A;  3PF4 A;  4KHZ A;  3GTP B;  2BE5 D;  1PMR A;  4QGU A;  5M3F H;  4QUF A;  2YYZ A;  2Q8T A;  2EYM A;  4G7O C;  1KLU D;  4JI6 Q;  1FGB D;  1N33 Q;  1CA5 A;  4WJ4 A;  1I4X A;  4GKK L;  1HNZ Q;  1I4P A;  4AYB E;  4DGZ A;  1QUQ B;  2P5Z X;  4JI7 Q;  2PPB C;  4JC0 A;  4CGY B;  1S72 A;  4A76 A;  2EXD A;  2LXJ A;  4PQX A;  2QIL A;  2PW7 A;  1VQG A;  1RKN A;  2F0H A;  1R9T H;  3S1R H;  2NVX H;  3F2D A;  4DV4 L;  1KNA A;  4TSS A;  1ILQ A;  2ID0 A;  4BWG B;  3NK9 A;  1ET6 A;  3ERS X;  4R4O A;  2C5C A;  1SYE A;  1SYG A;  4DR5 L;  1OXV A;  4APV A;  3TZD A;  2FIN B;  3KF8 B;  3RN5 A;  2EE1 A;  1E22 A;  1NAP A;  1EWH A;  1JWM D;  3K0X A;  3H94 A;  4IAL A;  4IUR A;  3R93 A;  2EJM A;  1MHW C;  4RKB A;  4XQQ A;  5IWA L;  3HOZ H;  1L0Y B;  2B2U A;  5CBA E;  3N6R A;  2PI2 A;  2Q2U A;  3HOY B;  3OMC A;  1U9R A;  2QDB A;  1IYU A;  1HJP A;  2YU9 H;  1Q12 A;  3QB3 A;  1L0W A;  1QE6 A;  2E5L Q;  3K8A A;  3J7A V;  3HOV G;  1TWC B;  5C44 G;  4YIJ A;  5G3L D;  4F88 A;  2YTX A;  2YV5 A;  4IPD A;  4BA1 I;  2B39 A;  4BBS G;  4J1M A;  1STE A;  3P7J A;  3WOE A;  1GM5 A;  1EY5 A;  4IFD J;  3L7Z C;  1KL9 A;  4HR7 B;  1I6H B;  2BA1 A;  3K7A H;  5J1Z A;  3MXN B;  4DUZ L;  3S14 B;  2G5D A;  5C0X I;  2F4V Q;  3PO3 H;  2BDO A;  1CKN A;  1II3 A;  4EQN A;  1J5E Q;  4BBR G;  1G91 A;  2Z4H A;  3GTG H;  1RTO A;  1EOV A;  4C3I B;  1MSH A;  1CQV A;  4OX9 Q;  3GQB A;  3MEH A;  3J7A 5;  4ULL A;  1TS4 A;  1PTO C;  3OMG A;  2N78 A;  2FMM A;  3J80 c;  2RSN A;  4PV1 C;  5JEA J;  5JPN C;  1BOS A;  3MXU A;  1EYA A;  3X3N A;  1HZ9 A;  2B2W C;  2E76 C;  1DCZ A;  3OOC A;  4CKB A;  5KYI A;  3RZD H;  1MJE A;  4A3E G;  4BY1 B;  3N52 A;  2R61 A;  2Y0S G;  3T56 B;  5JAV A;  2F0I A;  2AMC B;  1HUN A;  4N9T A;  4GKK Q;  1RF2 D;  2HDL A;  1RHP A;  3SR1 A;  2N55 A;  2I5H A;  5KGU A;  4UP9 A;  1SE2 A;  4JI0 L;  5IP9 G;  1CKO A;  2H5X A;  3JAM c;  4PMB A;  2WAQ E;  3M4P A;  1SMX A;  4DA2 A;  4A3D H;  1WI5 A;  4AYB G;  4UP8 A;  1NR4 A;  1C7Y A;  3C2P A;  3GTQ H;  3CC2 A;  3BJU A;  2RSO A;  2PMZ B;  4J15 A;  1BDO A;  5EGT A;  1HQM C;  1X9N A;  2R3Z A;  1KQS A;  2MJ8 A;  3HKZ E;  3KJO A;  4F7X A;  4C3H H;  3FHW A;  1Y1V H;  5A2Q L;  2VQE Q;  4XT1 B;  5FO9 B;  1YEZ A;  5KIX A;  2JSO A;  1PFN A;  1YNJ D;  3A56 A;  5E4W C;  5IWA Q;  4DV1 L;  4JCV E;  1NNX A;  4C2M B;  3FPU B;  1TR5 A;  1S5F D;  5GAH C;  1KD1 C;  5JEA G;  1EIG A;  3TDQ A;  1H9S A;  3WDN A;  5ELF A;  5LHY 1;  4JI1 Q;  5IT9 L;  1HNW L;  3C1F A;  4G7H C;  4LK1 C;  2WFW A;  3GTK B;  4BS9 A;  1WTQ A;  2TSS A;  2GN5 A;  4YY3 L;  1JOK A;  2F0V A;  4WFN 3;  2A68 D;  3TS2 A;  5LMU L;  1QVF A;  2E75 C;  4RHR A;  3D6C A;  4N8X 1;  5ELD A;  1XXG A;  1YJW A;  1KLG D;  2LXK A;  1B50 A;  5M9O A;  2HT1 A;  1VS0 A;  1PZK D;  5CV8 A;  2NVT H;  3C1E A;  2NVY B;  1I3Q H;  3BS1 A;  2RDG A;  1YNJ C;  2AUJ D;  3VR2 A;  3PO2 H;  2NYZ D;  1SSO A;  4EQP A;  1FYC A;  2KEE A;  1E1O A;  2K6A A;  1GHK A;  1WOC A;  5IGC A;  1MD2 D;  4A3C H;  1IYJ B;  3J80 L;  3M4O H;  1F9R A;  4DV5 Q;  1U4R A;  4GS3 A;  1UAP A;  3SVM A;  1GKH A;  3GDE A;  1VQ8 A;  1SLJ A;  4DR1 L;  3CQZ B;  3TSS A;  2PZT A;  1WTV A;  2NVQ H;  1SYD A;  4JI2 Q;  4GNX C;  1EEF D;  3SEB A;  3CXC A;  4G7Z C;  4LUZ A;  1N34 L;  3G71 A;  4LF8 L;  1HQR D;  2JA7 H;  3JAM L;  3PIP A;  3FMC A;  1KC8 C;  1STH A;  4LF4 L;  4DNR B;  1BQQ T;  1V1Q A;  1SNM A;  5D65 A;  1HR0 Q;  2CHB D;  1UUP A;  4GN5 A;  1UEA B;  1XPR A;  2BCO A;  2WAQ G;  4POG A;  2I46 A;  2PZU A;  1XYI A;  2UUC L;  3I70 A;  3NSW A;  1RCV D;  2A69 C;  1DON A;  1KXL A;  5CBE E;  2VUM G;  3OPO A;  4LW1 A;  4KV6 A;  3L2P A;  3F2C A;  1S4Z A;  3IAY A;  1K0S A;  1G8Z D;  1Y1W G;  5IYC G;  1Q8I A;  3DMU A;  2VNU D;  4ILW A;  1I94 L;  3CPF A;  2UUB Q;  4B3T Q;  3F1Z A;  1EY9 A;  3EQL C;  1PZI D;  4XYQ A;  1VF7 A;  2CQO A;  2Z8L A;  1JT8 A;  2KUM A;  1NUC A;  3NE5 B;  1R9T B;  4X3T A;  2DGY A;  1HNW Q;  3U9O A;  1Q82 C;  1HZB A;  4DR2 Q;  1SDF A;  2UXD L;  3NBH A;  1CZG A;  3L3O C;  4HIM A;  3HOX B;  5IP7 H;  5C3W A;  1SNO A;  1LV9 A;  2CFM A;  2YTY A;  3QIA A;  4LF6 Q;  4DR6 L;  2K5N A;  5HUR A;  2E2I H;  2XSC A;  3KLR A;  5LMU Q;  5C0X H;  4RA8 A;  1B70 B;  1WCM H;  5IGB A;  5KYL A;  2A6H D;  2JP1 A;  3UE1 A;  4YHH L;  1S5C D;  2NB0 A;  1K0R A;  3U9S A;  2F0J A;  4ZQ3 A;  3W1B A;  3IFD A;  3TS0 A;  1PTO H;  4A3L G;  3QOL A;  1AZQ A;  4JI5 L;  3GTP H;  2AHO B;  4OEM B;  1Z6H A;  2JA6 B;  2D5D A;  4P72 A;  2L0C A;  2F0Q A;  1EQR A;  1S3O A;  4O42 A;  4X64 Q;  4IUN A;  2CKZ B;  3BDC A;  1K3B C;  1MBY A;  4AQY L;  2CQA A;  2F0O A;  2K04 A;  1C4Q A;  3T13 A;  5BR8 Q;  2HQE A;  3K7A B;  2Q8I B;  2XVS A;  1A0I A;  1M8A A;  2J4X A;  4C1N K;  3PO3 B;  2ENB A;  4MNO A;  2HUG A;  4DAV A;  4DR1 Q;  1ROD A;  1MGS A;  1E0B A;  1Z9F A;  3L0O A;  4JI4 L;  2K75 A;  3GTG B;  1BXT A;  2X69 A;  1SE4 A;  3ULL A;  2Z4I A;  3Q0A A;  3PV0 A;  1FNV A;  3IKJ A;  1U4P A;  1JB3 A;  5FKA C;  3RLN A;  1B2T A;  2R93 B;  3H91 A;  1SNC A;  3VR5 A;  1YIT A;  4O0A A;  1NSN S;  4K5X A;  2KCC A;  4RCO A;  4A3G B;  4A3F G;  3S1Q B;  1NCV A;  3VR3 A;  1PFB A;  3BVM A;  4DR3 L;  2UUC Q;  4FYD A;  1K8A C;  4TRD A;  1EYC A;  4GNX A;  4P74 A;  5IY0 A;  5FLX E;  3KF6 B;  1I4G A;  3PUV A;  1W2B A;  4JPB W;  3W5O A;  5IIF A;  3U4Z A;  1Y8P B;  1O7L A;  5M3F G;  4OO1 H;  1I94 Q;  2DUD A;  4ZRZ A;  4A3D B;  3SK4 A;  3UDF A;  3UDG A;  1EY4 A;  1X3P A;  5IYB H;  3Q8D A;  3HOY H;  4IOC A;  4RKL A;  1V8Q A;  4EQ5 A;  2KA7 A;  3EJI A;  5COY A;  1DM0 B;  1F77 A;  3H15 A;  1LTI D;  2IHE A;  5LL6 S;  1AFP A;  1TWC H;  3F2U A;  1M1K C;  1CSP A;  2O4X A;  4QL5 A;  5EPK A;  1K3R A;  2UXD Q;  2IL8 A;  1ONL A;  2FXQ A;  4LUO A;  2XNA C;  2GVB A;  5A35 A;  4DR6 Q;  5EKI A;  2EZV A;  1I6H H;  1SYF A;  3RR5 A;  3S14 H;  3PCO B;  2MNA A;  2FMC A;  1ZYR D;  3ERO A;  1B1Z A;  2NTS A;  2XN9 C;  1WTR A;  1ENF A;  1TWA B;  1YNN C;  5M5W B;  1Q1B A;  3I4N B;  3KLS X;  1LM0 A;  1XPU A;  5J39 A;  1CKN B;  3RN2 A;  4QMG A;  4C3I H;  3I4M H;  2CH4 W;  5K36 H;  1QVG A;  3T53 B;  5AJ3 L;  4JOI C;  3WOF A;  2UXC Q;  2VQF Q;  2MFI A;  1D5M C;  1U5K A;  3HOZ G;  2JA5 B;  1T5X D;  1CZW A;  1H9M A;  1X54 A;  4F8M A;  5C4Z A;  4AQY Q;  1WD0 A;  3PMF A;  4DUY L;  1VQM A;  5H1S E;  4BY1 H;  3E0J A;  3J81 i;  1K9M C;  4JYA Q;  3FEW X;  1V43 A;  2IHF A;  1VQB A;  2D9U A;  5CV5 A;  3SK5 A;  3SK6 A;  4IUV A;  2EIF A;  4CDC C;  4CDD C;  1NMF A;  3DWA A;  4PNY A;  2QGQ A;  1BCP D;  3CRK C;  5M5Y B;  3R3O A;  1A62 A;  2CCZ A;  1HNX L;  1NR2 A;  5C4X B;  2HCI A;  5D14 A;  2LS0 1;  3NBI A;  2HQL A;  2RCN A;  3LNN A;  2ATW A;  5C3E B;  2EY2 A;  3MWY W;  1ML0 D;  4ZUI A;  3CU7 A;  2F0T A;  2NN6 H;  4KKS A;  1PH8 A;  4DAY A;  3U50 C;  4U68 A;  3EBE A;  4O1N A;  4UY8 C;  1ZXT A;  4FP5 D;  4QCL A;  2NTT A;  5ELC A;  2K33 A;  5C4J B;  2A6E C;  4CJ0 B;  1IL8 A;  1C9O A;  5G3L F;  2OEO A;  3T16 A;  1K8G A;  2Z0S A;  1S5D D;  2UXB L;  5KNB A;  4K6D A;  2WIN B;  1L0X B;  1LTR D;  1VQI A;  1B4O A;  4C2M H;  3I2Z A;  2F03 A;  1BNZ A;  3HG9 A;  3E3X A;  1CKM A;  4L5T A;  2QEJ C;  4DKA C;  3KDF A;  5FLM H;  1VCI A;  2EQS A;  3FRP B;  2PQA A;  2SNS A;  2D62 A;  3GTK H;  4ZKC B;  1BCP C;  1SNQ A;  2F3I A;  4UHV A;  2I0Q A;  4ABN A;  1PHJ A;  4X6A H;  4OON A;  3PSI A;  4OGQ C;  3A0J A;  2ZJQ A;  1S40 A;  1PH3 A;  3DEP A;  1H9J A;  2HDM A;  3QOJ A;  2ZT9 C;  3VYS A;  2C35 B;  3P20 A;  1TY0 A;  3S2H H;  1MKH A;  4K0K Q;  4DV2 L;  1FJG Q;  2NVY H;  5M5X B;  3MXG A;  4XXE A;  4C3H G;  1Y1V G;  3SGI A;  4TQU S;  1SXT A;  4I7Z C;  4HMI A;  1ICF B;  1EYG A;  1ESF A;  3STB D;  3V2T A;  3MZ5 A;  2H4O A;  1QWY A;  3BVG A;  4R8I A;  3S9W A;  1A3U A;  3MAQ A;  5TSS A;  1Q7Y C;  1XJV A;  2LMC B;  2EY5 A;  2H1E A;  1WCM B;  4ME3 A;  3URY A;  1I50 B;  5EQ0 A;  3CQZ H;  4R8N A;  3OSO A;  4KHV A;  3DLL A;  1UNS A;  1A8V A;  4DK0 A;  4NXM Q;  4JOI A;  2EOT A;  1PH4 A;  5ELB A;  1IYV A;  1PTO B;  2R92 H;  3RLO A;  1V1O A;  4A3J B;  4BA2 I;  1ZKO A;  3CME A;  4KY7 A;  4FO2 A;  3DEO A;  2RBM A;  5GAG C;  2DNE A;  2HCC A;  1VQE A;  2UUA L;  2QKI C;  4FVM A;  4A3I B;  1F2M A;  2IX0 A;  3HRZ C;  4RGN A;  5IYD H;  3IFT A;  1E2Z A;  1TII D;  3I56 A;  1D8L A;  4JK1 C;  3VR4 A;  1EQQ A;  3H3V I;  3D4D A;  2RHS B;  3M85 A;  3H3V C;  3TP5 A;  5HGT A;  3PO2 G;  1IBL Q;  4GKJ Q;  1PZJ D;  1ET9 A;  3NTK A;  3M7G A;  2PQE A;  4A3C G;  4KK7 A;  4DAM A;  4DNI A;  1D7Q A;  4IN3 A;  1SFO B;  1JOR A;  1G6Z A;  4DR7 L;  1NMG A;  3J81 j;  4ZCK A;  1PFS A;  1VQJ A;  1EY0 A;  1JOQ A;  4IOA A;  5LMN L;  3BDL A;  4LFB L;  2R7Z H;  4N8F A;  1WTX A;  3HOX H;  1YBY A;  4B3R L;  4QQB X;  3KF6 A;  1ILP A;  1DZ1 A;  2O2L D;  3NBH B;  4JI8 L;  4AH6 A;  4KLK A;  2NZH A;  3K5O A;  3K81 C;  1E24 A;  2BE5 C;  2JA7 G;  2R6G A;  1Q1E A;  2MQH A;  3OTO Q;  5JJL A;  1TY2 A;  3BZK A;  1UE1 A;  2OTJ A;  3AFP A;  1ASY A;  1PH9 A;  4XQN A;  5EPL A;  4GN3 B;  3CW2 C;  1LAC A;  2KHI A;  3J7Z C;  1KAW A;  2MP1 A;  1XNR L;  1PRT D;  2NZ1 D;  1KDC A;  4NW2 A;  4GN4 B;  1WYD A;  5COR A;  3NEN A;  4PZ7 A;  4ZLT F;  2K1B A;  2JA6 H;  1B53 A;  2E2D C;  1XPO A;  1TWF B;  1FL0 A;  2B3G A;  2LFN A;  1CFM A;  3GV6 A;  1O78 A;  2EYJ A;  1UE7 A;  1LT6 D;  1D1I A;  1FNW A;  2HIV A;  3K58 A;  1IBK L;  1L1O C;  4A3K B;  1P8L A;  5DAU A;  5GRO A;  4MTK A;  3T1H Q;  2FJ2 A;  1Q86 C;  3D31 A;  4XQJ A;  2D2C C;  1B8A A;  5EPJ A;  4H7B A;  5IP7 G;  1D5X C;  3I4M B;  1EU4 A;  3A7A B;  5I6W A;  3CKI B;  4JV5 Q;  5IGG A;  2CW0 D;  1DGS A;  4PZ8 A;  1Y8N B;  5C0X G;  3A8K E;  2R93 H;  2K5V A;  1WCM G;  3NEM A;  1JE4 A;  4A3G H;  1UWV A;  1I4H A;  1HR0 W;  3S1Q H;  2G9D A;  4X62 L;  1OXS C;  2JA8 B;  4M1U B;  4OWX B;  5C4H A;  1CA6 A;  3K57 A;  1Q90 A;  5EAY A;  2DN8 A;  2DY8 A;  3JAM i;  4DPG A;  1LT5 D;  2ALY B;  3LX0 A;  4GNX B;  2B63 B;  5HGQ A;  1WJJ A;  4DN4 M;  5KNC A;  2EYP A;  5FJ8 H;  4XT3 B;  4G4K A;  5T1G A;  2JXM B;  2IX1 A;  1TS3 A;  3CRL C;  4RFB A;  4I7A A;  3CD6 A;  4IUU A;  1STG A;  2AKW B;  3RMH A;  4H0L C;  1F2Z A;  3MEF A;  3W3A A;  3TP6 A;  5LMN Q;  2SDF A;  1C48 A;  2XIW A;  4DV4 Q;  4LFB Q;  4IFD I;  5CYU A;  5KEE A;  2PMZ E;  3K59 A;  1TWH B;  3R8B A;  2AUK A;  1YJN A;  3KBX A;  1G6P A;  4DR5 Q;  2MGS A;  1CI3 M;  3MA2 B;  3PUZ A;  2VS1 A;  1VQ4 A;  3ZJY C;  2WB1 B;  1D6E C;  4LMQ D;  4YCV A;  1TWA H;  4KY6 A;  5M5W H;  5FLX c;  4A75 A;  1O80 A;  4DV7 L;  3I91 A;  3I4N H;  5IE8 A;  1XMO L;  2I5L X;  1AP0 A;  4A3M B;  3HKZ B;  1AE2 A;  2WV6 D;  4C3J H;  2C9O A;  3CPW A;  4F87 A;  1JWS D;  3HOU H;  4Q0F A;  5C5L A;  5CV7 A;  1NTG A;  1D2B A;  2JA5 H;  3MFG A;  4HCS A;  4OO1 G;  1VQ6 A;  3DWP A;  3T51 B;  2GA4 B;  5IYB G;  3G6J B;  3HOY G;  4DUZ Q;  2K28 A;  3DM1 A;  3PF5 A;  1IBK Q;  1E7Z A;  1AEX A;  4KMU C;  1FGU A;  4OIK A;  1IKL A;  3G48 A;  3OWE B;  2L4N A;  3I7F A;  4R4T A;  3S2H B;  1MIU A;  5M5Y H;  3E6Z X;  3RZO B;  1X3F A;  3SDZ A;  1PH6 A;  1N32 L;  1ICW A;  1PH1 A;  1BBU A;  1PH2 A;  2K4K A;  5C4X H;  4HJ7 A;  2A1A A;  5C3E H;  1HZA A;  1HHV A;  2EYL A;  4UDU C;  4Z9C B;  2F0W A;  3HEJ A;  2OXP A;  3TBI B;  3H3V H;  4C3I G;  1OXU A;  2EY6 A;  5C4J H;  3S17 B;  3F8T A;  5GAE C;  5K36 G;  4DAY B;  3E5S A;  3NQI A;  2D0P A;  2R7F A;  1BBX C;  2UU9 L;  4JI0 Q;  4HED A;  3WWV A;  2G9H D;  2AQ2 B;  4QUC A;  4TVA B;  1STB A;  2PW5 A;  3CCU A;  2A68 C;  1VQO A;  1JR0 D;  2R92 B;  2EDG A;  4P2C B;  2B2W A;  3KYH C;  4BY1 G;  3BYT B;  4UPA A;  4DV3 L;  2ES2 A;  5LL6 X;  2LKV A;  4YCU A;  4R4C A;  3CC4 A;  1TVX A;  4V19 0;  1QB5 D;  4ZK9 B;  1HUM A;  3KDF B;  4AIM A;  1FNU A;  2CH4 A;  2L55 A;  4G57 A;  2PQA B;  1QVC A;  2XGT A;  1UE6 A;  1B9M A;  2K52 A;  4N9P A;  4HIK A;  4EVO A;  4KJN A;  1JB7 A;  4JW0 A;  3S16 H;  2PNH A;  1LTS D;  1WTP A;  4H13 C;  1YHA A;  1RJT A;  2PCF B;  2Q2I A;  2ZTD A;  4DV1 Q;  1VQA A;  3HS0 C;  1WD1 A;  1RDP D;  3FP9 A;  3OW7 A;  1V1P A;  4OHJ A;  2NN6 G;  5ELO A;  4DXG A;  5M5X H;  1J9O A;  2Z9H A;  3A7L A;  4J6H A;  5FLX L;  4IO9 A;  2R7D A;  3U58 A;  2Q8R E;  2RVL A;  1OXT A;  1PYS B;  5IGF A;  1C0A A;  1VQ7 A;  3PUW A;  4NP5 A;  2R7Z B;  4X65 L;  4WJW A;  2KQ3 A;  5IT9 E;  2EYO A;  2VB3 X;  3CMA A;  1BCP F;  1J8I A;  1A3V A;  1DXM A;  2K5W A;  4LF7 L;  4YY3 Q;  1CM9 A;  1AH9 A;  3H0G B;  4LJZ C;  4TKO B;  1JE5 A;  2BH2 A;  4MTN A;  1B7Y B;  5GAD C;  1I50 H;  5FLM G;  1YIJ A;  3MHB A;  1QNK A;  3PIP 3;  1MI2 A;  2CVR A;  4K2K A;  1OO9 B;  1Q3L A;  5I9O A;  1E2V A;  4A3J H;  2OQ0 A;  2XWJ B;  4GZY C;  3AB9 A;  5DM7 3;  1VQP A;  1RD9 D;  4JI3 L;  4CDE C;  1N9W A;  2WP8 J;  4X3U A;  1CHQ D;  1JIC A;  1TWG B;  4H02 A;  1VQD A;  4B3S L;  1HCZ A;  4A3I H;  1QZG A;  2CWP A;  1X32 A;  4FF4 A;  1EL0 A;  1YVC A;  3Q22 A;  2ASB A;  4S3S A;  2JEA I;  1H9R A;  4DR4 L;  1OXX K;  4P73 A;  2ZJP A;  1GD7 A;  3GTL B;  4NXN L;  3M7N A;  1STY A;  1LYL A;  4O2D A;  3VYR A;  4LF5 L;  1N34 Q;  3D6W A;  4LF8 Q;  1SFO H;  4DV3 Q;  2A6H C;  1W6K A;  4LF4 Q;  3JAM E;  4IFD H;  1F9Q A;  3CCL A;  2KCN A;  5FOB B;  3J7Y W;  3NUC A;  4DNT B;  4LFA L;  4B3M L;  1QCB D;  1TXY A;  4DK3 C;  3VA7 A;  1GOZ A;  4LF9 L;  3V96 A;  5IYD G;  2K5Q A;  5E3F A;  1BCP B;  1K83 B;  2PI2 E;  2ZXR A;  3S1N B;  4BY7 B;  4FXD A;  2OQK A;  1F2L A;  3HOW B;  1PVO A;  1TWF H;  4LF7 Q;  3TP8 A;  2RDF A;  1X3G A;  4A3B B;  3KK7 A;  1KAB A;  3G7L A;  3FKI B;  1QOH A;  1LT3 D;  4A4I A;  4DV6 L;  3D4R A;  4PG3 A;  2K01 A;  4YHH Q;  2HD3 A;  4ZYS A;  4OWT B;  4A3K H;  1JJ2 A;  2BA0 A;  4NDX A;  4DK6 C;  1SRU A;  2F0D A;  2R7Z G;  2GVA A;  3EN2 A;  1XMQ L;  4NB3 A;  3A8I E;  3HOX G;  5JVG 3;  4C3J B;  3ULP A;  1SMY D;  2BDN A;  3HOU B;  3DHQ A;  4JI3 Q;  3BZD B;  5DLQ E;  5EKK A;  1HH2 P;  2QF7 A;  2MUY A;  4JI5 Q;  1N36 L;  4K8I A;  4YWM A;  1LLR D;  4JBW A;  2XTI A;  1BBW A;  1ENA A;  4A93 B;  4X66 L;  2JQO A;  2JA8 H;  1KIX A;  4J8Q A;  5M3M B;  1IHZ A;  2K05 A;  5IGD A;  2Q2H A;  1HPC A;  4QY7 A;  2V4D A;  4RMF A;  5ELN A;  2K32 A;  5EJW A;  2RHQ B;  2ZTE A;  2B63 H;  4B9W A;  1JWU D;  3G4S A;  5KND A;  1IW7 D;  1PYB A;  2JA6 G;  1E1T A;  4JI4 Q;  1A63 A;  1H9K A;  1YZ6 A;  1A15 A;  2X6L A;  4HCE A;  2IPK D;  3PQI A;  1TS5 A;  1ZYR C;  1VQL A;  4EX5 A;  1VQ9 A;  1MJC A;  4OWW B;  3PO3 G;  2TMP A;  3RUZ A;  2K5D A;  1S5B D;  1TWH H;  4IPC A;  4DR3 Q;  1PRT F;  2DNC A;  1IBM L;  1GUT A;  4CKC A;  4YWK A;  4LFA Q;  1GVP A;  1J6Q A;  1VQ5 A;  4UAI A;  2JA9 A;  2KHJ A;  3VR6 A;  2R93 G;  3HGB A;  4CDF C;  3K5N A;  3TRZ A;  4A3G G;  1HFN A;  1LAB A;  3W1G A;  3GTJ B;  2QDL A;  4XTC S;  1EFI D;  4A3M H;  3BZC A;  3PUY A;  1O7Z A;  4L5Q A;  4KI0 A;  5EKL A;  4JI6 L;  3I3C A;  4JVZ A;  2LY7 A;  3I55 A;  1N33 L;  4FF1 A;  3NXW A;  4PMC A;  1BO0 A;  3IRB A;  4QB4 A;  2VW9 A;  5FJ8 G;  3HZX A;  4OEL B;  5DM6 3;  2JE6 I;  1JOO A;  1SNP A;  4A3D G;  4YCW A;  3S16 B;  1W6J A;  1LTA D;  3EVQ A;  4C56 C;  4DXF A;  3KFU A;  1KDA A;  3CC7 A;  1DJR D;  1QJO A;  3KOJ A;  5C3X A;  5CMD A;  5EBD A;  1TKW B;  5L37 A;  2DJF C;  5CGK A;  2E2J B;  2ICI A;  3FPP A;  1Q46 A;  1M90 C;  1GUO A;  3RZO H;  2QA4 A;  4LNQ A;  5I2X A;  4A3L H;  2M2L A;  3S24 A;  4K8J A;  1AE3 A;  2A5H A;  1X3Q A;  3HOV B;  5AJ3 Q;  5C44 B;  2Z1C A;  1XTD A;  3TRE A;  1HA5 A;  2KHS A;  2F3V A;  4BBS B;  1IXR A;  3M9B A;  2ZJR A;  3I4N G;  2VB2 X;  4JBJ A;  3CCM A;  3A74 A;  3G6E A;  3CF5 A;  4DUY Q;  1L1O B;  1GO3 E;  4GLA C;  3S17 H;  1WTH A;  4WOR A;  3HOU G;  2E5L L;  2MPM A;  1RTN A;  1BKB A;  4DAP A;  1A6X A;  4BBR B;  3H6M A;  3GV3 A;  2JA5 G;  2DJG C;  4JBM A;  4HJ5 A;  4QIW B;  1GUG A;  2MO0 A;  1HNX Q;  1DD2 A;  3H09 A;  2EXZ A;  3NTH A;  1LTB D;  4MHE A;  5D3I B;  3K5M A;  1NY4 A;  1EFW A;  2ZXO A;  1EZ8 A;  4GOP C;  1IBM Q;  4A3E B;  3KJP A;  1QZH A;  1UEB A;  1PLF A;  2Y0S B;  4NKL A;  1CSQ A;  5JJK A;  4P75 A;  1STN A;  1X55 A;  4IJH A;  4UP7 A;  5C4X G;  3AYH B;  2UXB Q;  3STB C;  1ASZ A;  1LO5 D;  4MZ9 A;  3VA5 A;  3P1H A;  4FNF A;  4RGO S;  5C3E G;  2IWH A;  1PFM A;  2F0P A;  2VXW A;  4E6I A;  3BDO A;  1JJG A;  2EPB A;  3A5Z B;  1ZEQ X;  3AFQ A;  4RCN A;  1EY8 A;  1VQH A;  3D3R A;  1SEB D;  1V1P B;  1A2T A;  1KNE A;  1SND A;  2KCT A;  3ITP A;  1PXU A;  5JOB A;  5NUC A;  4AYB B;  4ZKB B;  3OW2 A;  4LWC A;  4R1J A;  4IZ8 A;  1EY6 A;  3MXP A;  1KHI A;  1AN8 A;  1VF5 C;  2K03 A;  3QO2 A;  4PZ6 A;  5C0X J;  2ICE C;  2IX3 A;  3H0G H;  4K5V A;  4K6L A;  3I90 A;  2MO1 A;  1AZP A;  1T5E A;  3CCR A;  1U4L A;  3VYU A;  3Q24 A;  2L11 A;  4K5W A;  3CCJ A;  4IUQ A;  2B8F A;  2M9V A;  4POF A;  1I4Q A;  4DF7 A;  2EY1 A;  5IGE A;  3LWU A;  4DV2 Q;  1X3E A;  3QJY A;  3A8J E;  5I2Y A;  2YTV A;  5JJZ A;  4M8A A;  2VQE L;  4LFC L;  4LAA A;  2HHH L;  1TWG H;  4KN4 C;  4IQZ A;  3ND8 A;  1PTO D;  3T1Y L;  2IW3 A;  3W2D A;  4QJF A;  4GLX A;  1FVI A;  2F0K A;  5IT9 c;  1K73 C;  1LTT D;  1EWI A;  1JMC A;  3I73 A;  1WTO A;  1EIY B;  4IJL A;  2LSS A;  4JI1 L;  1EWC A;  5HY6 A;  1XWE A;  3GTL H;  4CBV A;  2PZW A;  4HJ8 A;  3BU2 A;  4OL7 A;  4KKT A;  2ZXP A;  1B44 D;  1F9P A;  3J80 i;  3J81 E;  3GO5 A;  2WKD A;  4EGV A;  2UUA Q;  4HID A;  3AEV A;  3TP7 A;  3B6Y A;  1PRT C;  4HN7 A;  4FF2 A;  3LWE A;  2EYF A;  3A5U A;  3K0Y A;  3HFZ B;  4A3J G;  3GTM B;  1VQF A;  2N88 A;  2QEX A;  2O5J C;  4A3I G;  3CP0 A;  1PA6 A;  1IL2 A;  3DXJ C;  3KLW A;  4DR7 Q;  3JC6 6;  2OCE A;  4GOP A;  3MFY A;  4KKU A;  1WVL A;  1JQY D;  1G2S A;  4DV5 L;  3CHB D;  1CUK A;  1K83 H;  5FK9 C;  5K5P A;  3GTO B;  1WFQ A;  3S1N H;  4BY7 H;  1O7I A;  4B08 A;  4HMJ A;  3HOW H;  2KCM A;  2WAQ B;  3TN2 A;  4B3R Q;  3P75 A;  1VDZ A;  4JI2 L;  4A3B H;  3C46 A;  1GUW A;  4JI8 Q;  3K6O A;  2CW0 C;  4BXX H;  1VQC A;  4L6T B;  3FKI H;  2VUM B;  1AW7 A;  2WB1 E;  4IFD G;  5J3B A;  3Q6S A;  1Y1W B;  1HR0 L;  1STA A;  4DFA A;  2F0L A;  2E2H B;  2HIX A;  1EYD A;  1BUV T;  4KY5 A;  3IL8 A;  1XNR Q;  1CHP D;  1LUZ A;  3NHH A;  4XDX A;  5C5M A;  1PV4 A;  3PIO A;  4LFC Q;  3R2T A;  4HSP A;  2HHH Q;  3S2D B;  3RNU A;  3T1Y Q;  2WKC A;  1SJH D;  4A93 H;  2PO4 A;  1PYW D;  1EZ6 A;  1E3P A;  1Z7T A;  2I5M X;  4OO1 I;  1NBW A;  2KEC A;  5M3M H;  2UUB L;  3KUP A;  3TQY A;  3ULJ A;  4B3T L;  2F0N A;  4Y7N B;  1Q81 C;  1JJC B;  4MIU A;  3M4Y A;  4FXG C;  1SYB A;  5I4D A;  3E9I A;  4DR2 L;  1DOM A;  2SNM A;  3MTS A;  4L8J A;  1SJE D;  2RCF A;  3HP3 A;  4PMW A;  1X6O A;  3EA6 A;  4LF6 L;  3NPP A;  3Q23 A;  2F0U A;  5ISR A;  1Z47 A;  3MC0 B;  4A3K G;  4X3K A;  3CAM A;  4KN7 C;  3E0E A;  3OIQ A;  4R4I A;  1L1O A;  4X62 Q;  5BN3 A;  1E2W A;  3CCS A;  3SE0 A;  3I72 A;  1R4Q B;  1VMP A;  3OIP A;  3CCQ A;  3I4M G;  3J7A F;  2J7Z A;  3I4L A;  4IUT A;  1XTC D;  2Z6K C;  4L5R C;  2A69 D;  1GJX A;  3OHX C;  1SR3 A;  4RH6 A;  5D3D A;  4OXP A;  1C8C A;  2N8N A;  5C6A A;  3D0F A;  3PIO 3;  4KHP L;  4GLV B;  4X64 L;  3GTJ H;  2JA8 G;  2F0M A;  4NPS A;  2KEN A;  1SBB B;  5BR8 L;  2KJX A;  5CV4 A;  1K8M A;  1SAP A;  2B63 G;  3S1M H;  4CKE A;  1BF4 A;  4A3F B;  3QG1 A;  1VMC A;  4HJA A;  2NWG A;  5EBC A;  4P71 A;  1EEI D;  2E74 C;  1DYQ A;  3S15 H;  4RG1 A;  2E8G A;  3MVV A;  5A2Q E;  3KLS A;  4XYO A;  3UI2 A;  2E2J H;  1Y69 U;  4DV7 Q;  1B9N A;  4QF4 A;  5M3F B;  1XMO Q;  1BR9 A;  1GHJ A;  3SXH A;  1YHQ A;  1R4P B;  4HAE A;  2NN6 I;  4ID6 A;  5DNF A;  2JEB I;  1QUQ A;  2KVM A;  3K80 C;  1OTC A;  3HOV H;  5IOC A;  5C44 H;  2WB1 G;  2B2T C;  2L15 A;  5I9P A;  4JG2 A;  4BBS H;  3EIV A;  2CWA A;  1VQN A;  2WII B;  2DY7 A;  2B2Y C;  1EQV A;  1YJ9 A;  2JN4 A;  3A55 A;  4A3M G;  3HKZ G;  2IY5 B;  2OWO A;  1UE5 A;  2O5I C;  2N49 A;  3FVQ A;  1S5E D;  3S1R B;  2NVX B;  1I6V C;  5BN5 A;  3M3Y H;  1PDQ A;  2XWB B;  2F0F A;  1W3S A;  2F52 A;  4BBR H;  3KF8 A;  5GQO A; 
#chains in the Genus database with same CATH homology
 4C3H H;  2JA6 G;  1E1T A;  3FHW A;  1Y1V H;  4JI4 Q;  1A63 A;  3PO2 G;  2AWN A;  1YZ6 A;  2VQE Q;  1IBL Q;  3CCV A;  4GKJ Q;  1YEZ A;  1N32 Q;  1VQK A;  5E7N A;  1VQL A;  4LUV A;  1HZC A;  4EX5 A;  5IWA Q;  4DV1 L;  1MJC A;  1VQ9 A;  4A3C G;  4OWW B;  4JCV E;  4DAM A;  4DNI A;  3AQQ A;  4IPG A;  1D7Q A;  3PO3 G;  4DR7 L;  1NMG A;  3J81 j;  4DV0 L;  1KD1 C;  5GAH C;  1PFS A;  1VQJ A;  5JEA G;  4IOA A;  5LMN L;  1SN8 A;  4A3E H;  1TWH H;  4LFB L;  4IPC A;  4DR3 Q;  2R7Z H;  3U4V A;  4JI1 Q;  1HNW L;  1IBM L;  3DM3 A;  4YWK A;  1YBY A;  3HOX H;  2UU9 Q;  3KF6 A;  2A19 A;  4B3R L;  4QQB X;  2WFW A;  4LFA Q;  1GVP A;  1J6Q A;  2GN5 A;  3NBH B;  4JI8 L;  4KLK A;  4AH6 A;  2JA9 A;  2KHJ A;  5IP9 H;  4YY3 L;  1VQ5 A;  2NZH A;  3K81 C;  2R93 G;  2UXC L;  1E24 A;  2VQF L;  2JA7 G;  2R6G A;  4KHP Q;  1Q1E A;  2MQH A;  3OTO Q;  3TRZ A;  4A3G G;  5JJL A;  3TS2 A;  3BZK A;  3W1G A;  5LMU L;  1UE1 A;  2OTJ A;  3AFP A;  1ASY A;  1QVF A;  4XTC S;  4A3M H;  2K5H A;  1PH9 A;  3CW2 C;  4GN3 B;  3BZC A;  2KHI A;  3PUY A;  3J7Z C;  4JYA L;  1KAW A;  1YJW A;  2B29 A;  2LXK A;  4KI0 A;  4L5Q A;  4JI6 L;  4L5S A;  2HT1 A;  1XNR L;  1VS0 A;  1N33 L;  1BVS A;  3I55 A;  1RIP A;  2Z6K A;  1EIF A;  2NVT H;  2IT1 A;  3E9H A;  2ZM6 L;  3IRB A;  4GN4 B;  1WYD A;  1I3Q H;  2VW9 A;  3NEN A;  4PZ7 A;  5FJ8 G;  2R92 G;  2JA6 H;  1XPO A;  3PO2 H;  1FL0 A;  3OYY A;  2JE6 I;  4A3D G;  4YCW A;  2B3G A;  3KFU A;  2BH8 A;  1E1O A;  3CC7 A;  3LGJ A;  1UE7 A;  1RL2 A;  1WOC A;  1EUJ A;  3KOJ A;  4A3C H;  3PUX A;  2HIV A;  1IYJ B;  1IBK L;  3M4O H;  4DV5 Q;  1L1O C;  1P8L A;  1Q46 A;  5GRO A;  4GS3 A;  1M90 C;  1GKH A;  3GDE A;  3T1H Q;  1Q86 C;  1VQ8 A;  1SLJ A;  4DR1 L;  2QA4 A;  3RZO H;  1Q8K A;  1I5F A;  3D31 A;  4LNQ A;  1B8A A;  4X65 Q;  4A3L H;  5IP7 G;  3S24 A;  1P16 A;  1Y14 B;  2NVQ H;  4JI2 Q;  4GNX C;  1AE3 A;  1KRT A;  5AJ3 Q;  4JV5 Q;  3CXC A;  1N34 L;  1DGS A;  4LUZ A;  1X56 A;  1XTD A;  4PZ8 A;  3TRE A;  3G71 A;  4LF8 L;  5C0X G;  2R93 H;  2K5V A;  1WCM G;  3NEM A;  2JA7 H;  1IXR A;  3M9B A;  2ZJR A;  3PIP A;  3I4N G;  1SRO A;  1KC8 C;  4JBJ A;  4A3G H;  3CCM A;  1UWV A;  3A74 A;  3G6E A;  3CF5 A;  4DUY Q;  1HR0 W;  4LF4 L;  1V1Q A;  4X62 L;  3S1Q H;  1OXS C;  1HR0 Q;  1L1O B;  4OWX B;  1GO3 E;  1YI2 A;  4GLA C;  4GN5 A;  1XPR A;  2WAQ G;  3S17 H;  2V1C C;  4POG A;  2D0O A;  2UUC L;  3HOU G;  4XIG S;  2E5L L;  5EAY A;  3JAM i;  2N3S A;  1KXL A;  1BKB A;  4DPG A;  4GNX B;  2JK8 A;  2ALY B;  3H0G G;  5HGQ A;  1WJJ A;  2VUM G;  1U0L A;  1G29 1;  2RF4 A;  2JJQ A;  4LW1 A;  3L2P A;  5FJ8 H;  2JA5 G;  2NZO A;  3F2C A;  4HJ5 A;  4JBM A;  2IX1 A;  2MO0 A;  1HNX Q;  3F2B A;  1Y1W G;  5IYC G;  2VNU D;  4B3S Q;  3CD6 A;  2AKW B;  1I94 L;  2Q2T A;  3CPF A;  3MEF A;  4DV0 Q;  2UUB Q;  4B3T Q;  3F1Z A;  5LMN Q;  2CQO A;  4K0K L;  1N8R C;  4DV4 Q;  1NY4 A;  1EFW A;  1FJG L;  4DR4 Q;  4IFD I;  4LFB Q;  4GOP C;  1JT8 A;  2DGY A;  1HNW Q;  1IBM Q;  2PMZ E;  3KJP A;  1Q82 C;  3VDY A;  1UEB A;  1QZH A;  3GTM H;  4WJ3 M;  1KRS A;  1HZB A;  4DR2 Q;  1CSQ A;  2UXD L;  4P75 A;  1YJN A;  4NXN Q;  5JJK A;  4DR5 Q;  1G6P A;  4HIM A;  1X55 A;  3PUZ A;  2VS1 A;  4IJH A;  4UP7 A;  3UE0 A;  5IP7 H;  5C4X G;  2CFM A;  3AYH B;  1VQ4 A;  2UXB Q;  4LF5 Q;  3STB C;  1ASZ A;  2YTY A;  4MZ9 A;  4HJ9 A;  4R4Q A;  4LF6 Q;  5C3E G;  4DR6 L;  2K5N A;  3ZJY C;  1YHB A;  2E2I H;  5LMU Q;  1B70 B;  4YCV A;  1TWA H;  1WCM H;  5M5W H;  5FLX c;  4A75 A;  3UE1 A;  4YHH L;  4DV7 L;  3I4N H;  1JJG A;  5IE8 A;  1XPU A;  3A5Z B;  1XMO L;  2I5L X;  1K0R A;  3AFQ A;  3J81 c;  4GOP B;  1VQH A;  3GTO H;  1AE2 A;  2KCT A;  4C3J H;  4JBK A;  3OW2 A;  3W1B A;  1XNQ L;  2VL6 A;  4LWC A;  2VZA A;  4R1J A;  3PGZ A;  3TS0 A;  3CPW A;  2ZM6 Q;  3HOU H;  1KHI A;  4A3L G;  4NXM L;  1NTG A;  4PZ6 A;  3GD7 A;  5C0X J;  3UDI A;  3H0G H;  4JI5 L;  3GTP H;  4B3M Q;  2VUM H;  2AHO B;  2JA5 H;  4P72 A;  4OO1 G;  2MO1 A;  1EQR A;  1S3O A;  4X64 Q;  2VY3 A;  1VQ6 A;  2CKZ B;  4LF9 Q;  3CCR A;  5IYB G;  1Y1W H;  3HOY G;  5IYC H;  4DUZ Q;  3CCJ A;  4AQY L;  3PF5 A;  2E2H H;  1IBK Q;  1E7Z A;  3TEH B;  4POF A;  5BR8 Q;  1FGU A;  1A0I A;  3G48 A;  4Y52 H;  3CCE A;  4DV2 Q;  1X3E A;  4MNO A;  1H95 A;  4YWL A;  4DR1 Q;  3RLF A;  3I7F A;  4R4T A;  5JJI A;  1MIU A;  2K14 A;  5M5Y H;  1Z9F A;  3HKS A;  2YTV A;  1HNZ L;  1X3F A;  3L0O A;  3S2D H;  4JI4 L;  2K75 A;  2VQE L;  1IBL L;  4LFC L;  4JI7 L;  4GKJ L;  2HHH L;  1PH6 A;  1N32 L;  1TWG H;  3ULL A;  1PH1 A;  1BBU A;  2K50 A;  1PH2 A;  2K4K A;  5C4X H;  4HJ7 A;  2A1A A;  3T1Y L;  3PV0 A;  4QJF A;  4FDB A;  4GLX A;  1FVI A;  1NE3 A;  1HZA A;  5C3E H;  3RLN A;  2A8V A;  4DV6 Q;  5IT9 c;  1K73 C;  4Y7N H;  1G51 A;  1YIT A;  4O0A A;  3K7U C;  1EWI A;  1JMC A;  4A3F G;  1EIY B;  3ER0 A;  4IJL A;  4BY7 G;  3H3V H;  4DR3 L;  2LSS A;  2UUC Q;  1OXU A;  4JI1 L;  5HY6 A;  1XMQ Q;  3HOW G;  3GTL H;  5C4J H;  5K36 G;  1K8A C;  3F8T A;  5GQO A;  5GAE C;  4DAY B;  4GNX A;  1LTL A;  4HJ8 A;  3BU2 A;  2D0P A;  2R7F A;  4P74 A;  2UU9 L;  4A3B G;  5IY0 A;  4JI0 Q;  3KF6 B;  3WWV A;  4BXX G;  4TVA B;  4HIO A;  3FKI G;  1X65 A;  3M4Q A;  1YNX A;  1IZ6 A;  3J80 i;  3ICE A;  3PUV A;  1N36 Q;  3CCU A;  1VQO A;  1PH7 A;  1W2B A;  3W5O A;  3GO5 A;  3U4Z A;  3NEL A;  3OTO L;  4BY1 G;  5M3F G;  3KYH C;  4UPA A;  2DUD A;  4DV3 L;  1I94 Q;  2ES2 A;  4X66 Q;  2UUA Q;  3UDF A;  3UDG A;  5IYB H;  4YCU A;  3HOY H;  3Q8D A;  4R4C A;  4IOC A;  3CC4 A;  4EQ5 A;  1SE8 A;  4HID A;  3AEV A;  3B6Y A;  3I4O A;  3H15 A;  3KDF B;  3A5U A;  4AIM A;  2IHE A;  4IPH A;  1TWC H;  1M1K C;  3HFZ B;  1CSP A;  2PQA B;  1QVC A;  2XGT A;  4QL5 A;  1UE6 A;  2K52 A;  1K3R A;  4HIK A;  4A3J G;  2UXD Q;  2ZTC A;  1VQF A;  1JB7 A;  3S16 H;  2FXQ A;  2KBN A;  2PNH A;  4LUO A;  4A93 G;  1YHA A;  2QEX A;  2GVB A;  4DR6 Q;  1T9H A;  1NJI C;  1I6H H;  4A3I G;  3RR5 A;  3S14 H;  3PCO B;  2MNA A;  2Q2I A;  2ZTD A;  5M3M G;  3CP0 A;  4DV1 Q;  1PA6 A;  1VQA A;  4QIW E;  2OTL A;  1IL2 A;  3KLW A;  2AWO A;  4DR7 Q;  3FP9 A;  2OCE A;  1V9P A;  3JC6 6;  5LMN W;  4GOP A;  2F4V L;  1Q1B A;  2NN6 G;  4DV5 L;  5ELO A;  5M5X H;  1CUK A;  1K83 H;  4ALP A;  1LM0 A;  4A3F H;  1XNQ Q;  4IO9 A;  1CKN B;  2R7D A;  1WFQ A;  3RN2 A;  3T1H L;  3U58 A;  1O7I A;  1J5E L;  1OXT A;  1PYS B;  4C3I H;  3HOW H;  3I4M H;  4BY7 H;  1C0A A;  2KCM A;  1VQ7 A;  3PUW A;  4X65 L;  1QVG A;  4B3R Q;  4JI2 L;  3CMA A;  4A3B H;  2Y0S E;  4JI8 Q;  3UDX A;  5AJ3 L;  1PH5 A;  4LF7 L;  4OX9 L;  4JV5 L;  4YY3 Q;  4JOI C;  1L2F A;  4BXX H;  1VQC A;  3PF4 A;  1AH9 A;  3FKI H;  2UXC Q;  4KHZ A;  2MFI A;  2VQF Q;  1U5K A;  1JE5 A;  3HOZ G;  2BH2 A;  4MTN A;  1X54 A;  4AQY Q;  4QGU A;  5M3F H;  1B7Y B;  4DUY L;  1VQM A;  2YYZ A;  5H1S E;  4BY1 H;  5GAD C;  2WB1 E;  3J81 i;  4IFD G;  1I50 H;  5J3B A;  5FLM G;  1HR0 L;  1K9M C;  1YIJ A;  4JYA Q;  1V43 A;  2HIX A;  4JI6 Q;  2IHF A;  1VQB A;  1XNR Q;  1N33 Q;  4WJ4 A;  2EIF A;  4GKK L;  1LUZ A;  1HNZ Q;  4AYB E;  1NMF A;  1PV4 A;  1QUQ B;  2QGQ A;  3PIO A;  4A3J H;  2OQ0 A;  4JI7 Q;  4LFC Q;  4JC0 A;  1VQP A;  2HHH Q;  4JI3 L;  1S72 A;  1A62 A;  4A76 A;  1N9W A;  2CCZ A;  2WP8 J;  2EXD A;  3RNU A;  3T1Y Q;  1HNX L;  4A93 H;  2LXJ A;  4H02 A;  1E3P A;  1VQD A;  4B3S L;  2I5M X;  4A3I H;  1QZG A;  2CWP A;  1VQG A;  4OO1 I;  1NBW A;  2HQL A;  2RCN A;  5M3M H;  2ATW A;  1R9T H;  2UUB L;  3TQY A;  3ULJ A;  3S1R H;  4B3T L;  1YVC A;  2NVX H;  1Q81 C;  1JJC B;  2ASB A;  2JEA I;  3F2D A;  4DV4 L;  4DR4 L;  1PH8 A;  1OXX K;  4P73 A;  2ID0 A;  3U50 C;  3EBE A;  2ZJP A;  1GD7 A;  3ERS X;  4R4O A;  4UY8 C;  3E9I A;  4DR2 L;  4NXN L;  4DR5 L;  1OXV A;  1C9O A;  4APV A;  3M7N A;  3KF8 B;  3RN5 A;  1E22 A;  1K8G A;  1LYL A;  2Z0S A;  3K0X A;  4O2D A;  1X6O A;  4PMW A;  2UXB L;  4LF5 L;  1N34 Q;  4LF6 L;  4LF8 Q;  1SFO H;  1VQI A;  4DV3 Q;  4C2M H;  3I2Z A;  1Z47 A;  5IWA L;  3HOZ H;  4A3K G;  3CAM A;  3E0E A;  4LF4 Q;  1CKM A;  4L5T A;  4R4I A;  1L1O A;  2PI2 A;  4X62 Q;  4DKA C;  2Q2U A;  3KDF A;  3CCS A;  5FLM H;  1VCI A;  2EQS A;  1HJP A;  2YU9 H;  1Q12 A;  2PQA A;  3CCQ A;  3CCL A;  1L0W A;  3I4M G;  2E5L Q;  3K8A A;  2D62 A;  3GTK H;  3HOV G;  3M85 A;  5C44 G;  2Z6K C;  4L5R C;  2YTX A;  2YV5 A;  4IPD A;  2F3I A;  4BA1 I;  4LFA L;  1SR3 A;  4BBS G;  4B3M L;  2I0Q A;  4OXP A;  1TXY A;  2N8N A;  1PHJ A;  4X6A H;  4OON A;  3D0F A;  3PSI A;  4DK3 C;  1GM5 A;  4KHP L;  3A0J A;  4GLV B;  4X64 L;  4IFD J;  3L7Z C;  3GTJ H;  2JA8 G;  4LF9 L;  1KL9 A;  2ZJQ A;  1S40 A;  1PH3 A;  4NPS A;  2BA1 A;  3K7A H;  2KEN A;  3MXN B;  4DUZ L;  5IYD G;  5C0X I;  2F4V Q;  3PO3 H;  5BR8 L;  2C35 B;  1CKN A;  3S2H H;  1MKH A;  4K0K Q;  4DV2 L;  1FJG Q;  1J5E Q;  2B63 G;  2NVY H;  4BBR G;  3S1M H;  2PI2 E;  3GTG H;  4HJA A;  1EOV A;  1Y1V G;  3SGI A;  4TQU S;  4P71 A;  2OQK A;  1PVO A;  1TWF H;  4LF7 Q;  3S15 H;  4OX9 Q;  3J7A 5;  4RG1 A;  1X3G A;  2N78 A;  2E8G A;  1EYG A;  3J80 c;  3STB D;  5JEA J;  4A4I A;  4DV6 L;  4PG3 A;  2E2J H;  1HZ9 A;  3RZD H;  4YHH Q;  1XJV A;  4DV7 Q;  1Q7Y C;  4OWT B;  4A3K H;  1MJE A;  1JJ2 A;  4A3E G;  2BA0 A;  4DK6 C;  1XMO Q;  4ME3 A;  1SRU A;  2R7Z G;  2Y0S G;  2GVA A;  3EN2 A;  1YHQ A;  3CQZ H;  1XMQ L;  2AMC B;  3S1N H;  2NN6 I;  4GKK Q;  3DLL A;  4NB3 A;  3HOX G;  2JEB I;  1A8V A;  1QUQ A;  2I5H A;  3K80 C;  4UP9 A;  3ULP A;  4NXM Q;  4JOI A;  4JI0 L;  1OTC A;  3HOV H;  1PH4 A;  5IP9 G;  5C44 H;  1CKO A;  2H5X A;  2WB1 G;  3JAM c;  4JI3 Q;  4JI5 Q;  2L15 A;  2WAQ E;  1HH2 P;  5DLQ E;  3RLO A;  3M4P A;  2R92 H;  4BA2 I;  1N36 L;  4JG2 A;  1SMX A;  4YWM A;  3CME A;  4BBS H;  4A3D H;  1WI5 A;  3EIV A;  2CWA A;  1VQN A;  5GAG C;  1YJ9 A;  4JBW A;  2XTI A;  1BBW A;  1VQE A;  4X66 L;  2JQO A;  4A3M G;  3HKZ G;  2UUA L;  2JA8 H;  1KIX A;  4AYB G;  4UP8 A;  2IY5 B;  1C7Y A;  2OWO A;  3GTQ H;  3CC2 A;  3BJU A;  1UE5 A;  2IX0 A;  5IYD H;  2N49 A;  4J15 A;  2Q2H A;  4QY7 A;  3I56 A;  1D8L A;  4RMF A;  5ELN A;  1X9N A;  3M3Y H;  1W3S A;  2RHQ B;  2ZTE A;  2F52 A;  1EQQ A;  4BBR H;  1KQS A;  3G4S A;  2B63 H;  3H3V I;  3HKZ E;  3KJO A;  1PYB A;  2RHS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...