1TWFH

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twfH00
1T9HA 2AWNA 1Q81C 1YNXA 1Y1VG 4JBKA 4DR3L 1YIJA 4DR2L 4JV5Q 4ME3A 4DV3Q 1EYGA 1IBKQ 1I3QH 3GTMH 1N34L 5M3MH 2OTLA 5IWAL 2I5LX 3M4QA 4DUYQ 3L2PA 3CCQA 2F4VQ 4DR4Q 3GTKH 1K9MC 1I94L 4LF5Q 3FP9A 1BBWA 2ZTCA 2RF4A 4HIOA 4DR5L 1R9TH 4B3MQ 4GOPA 4A3MH 3PUWA 1A62A 1HJPA 4RMFA 4DR6L 3GTGH 3PUVA 2RHQB 4A3MG 3CMEA 5FJ8H 1C0AA 4R1JA 1X56A 4OONA 2K5NA 1ASYA 2UUCQ 3BU2A 2Z6KA 3TS0A 1E1TA 3CC4A 2BH2A 3RN5A 1FL0A 1N33L 5IWAQ 3RN2A 1X6OA 3F8TA 1IBKL 1N32Q 3AQQA 3GTOH 1YEZA 2Q2HA 4BY1G 1YZ6A 1PHJA 4DR2Q 2BA0A 1QZHA 4JOIA 4GN3B 1FJGL 1NMFA 3L0OA 4YCWA 2HIVA 3BJUA 4DR5Q 2H5XA 4JI3Q 4LF4L 3SGIA 4IPGA 1VQBA 3RLFA 4DUZL 2YU9H 4LF5L 4DR4L 2B3GA 2ZTEA 4YHHQ 4IOCA 3VDYA 4DUYL 3CQZH 4L5SA 3DM3A 2E2IH 1N36Q 3CW2C 5GQOA 3H0GG 1VCIA 1L1OC 1EIFA 1UWVA 1HNZL 4DR7Q 3G4SA 1PYBA 2JEBI 4B3RQ 2N78A 4YY3Q 5C44G 2E2JH 1HR0W 1EFWA 4GKJL 3F2DA 2DGYA 2B29A 4R4TA 4JI7Q 5ELNA 4A3BH 1QUQA 3PV0A 4A3LG 1A0IA 3UDFA 4LFAL 4A76A 4WJ3M 3HOZH 2YTXA 4JI0Q 4JI3L 1BKBA 3J7ZC 4B3RL 4WJ4A 2JA5G 4GKJQ 1HNZQ 4DV2Q 2MO0A 2F3IA 2Z6KC 2JA5H 1GVPA 4YCVA 3CXCA 1Q86C 1BVSA 2R93H 2KENA 4PZ6A 3CCRA 4A75A 3OW2A 2WP8J 1PH7A 4IPDA 3S16H 4GN5A 1WOCA 3GTQH 1VQPA 4LUVA 1Y1WG 1SN8A 1Q1BA 1UE7A 2QGQA 3F2BA 1K8AC 4A3DH 3S2DH 2ID0A 4A3EH 4KLKA 1Y1WH 4IJHA 2PQAB 3HOUH 5M3FG 3RR5A 5M5XH 4GN4B 1LTLA 1WJJA 2UXCQ 2NZOA 1XMOL 1JMCA 2JA6H 2NVTH 1VQKA 3I4MH 2XTIA 2JJQA 1HNWL 1X3FA 2K5VA 1OXUA 2CQOA 4GLAC 4HJ5A 4HJ7A 2F4VL 2ALYB 3AFPA 2JE6I 4JI4L 2JA9A 2JEAI 2CWPA 3GDEA 1L1OA 3STBD 2K75A 4POFA 2PQAA 5M3MG 5IYDG 4PMWA 2Z0SA 1VQ9A 2PMZE 4TVAB 1HZBA 1V9PA 2K52A 3MXNB 5GROA 1KHIA 3CCMA 4DV3L 1YJ9A 3EN2A 1VQMA 3FKIG 4DK3C 3K7UC 3BZKA 2HT1A 3I7FA 3L7ZC 3PIOA 3GTLH 1XJVA 5K36G 4K0KQ 1SR3A 3ERSX 3HKSA 4QIWE 1A8VA 4DV7Q 3S1NH 4HIMA 2KCTA 4OWXB 2GN5A 5GADC 4R4CA 2OQKA 2JK8A 1TXYA 5BR8L 4AH6A 2ES2A 1LUZA 2D0PA 5C4JH 4OX9L 4A3CG 3WWVA 4IFDG 4LFBQ 1TWGH 4OWTB 4DV4L 1UEBA 4YWKA 5GAHC 4JBMA 1YHQA 2Y0SE 1IBLL 3TEHB 4A3JG 3KJPA 1VQ4A 3S14H 1V1QA 4YHHL 4A3JH 5HGQA 1Q7YC 4DV7L 1XNRQ 1AE3A 3HKZG 2QA4A 1X65A 1KRSA 5FLMG 3HFZB 1CKNA 5LMNW 1NY4A 4R4IA 1KIXA 4X66L 4MZ9A 1OTCA 2A19A 4GOPB 3H3VH 1TWAH 1E24A 2OTJA 2IX0A 2XGTA 4JI5L 4DKAC 1KC8C 2ASBA 4R4OA 3HOVH 3I56A 4JYAL 5M5WH 2R92G 4HJ9A 2E5LQ 1HR0L 4BBSH 3U4ZA 3D0FA 3PF4A 2GVBA 3ULJA 4O0AA 4IOAA 1IBLQ 3M4OH 3PCOB 4DV6Q 4NB3A 1HZCA 3E9IA 3PF5A 1L2FA 3GTJH 3E9HA 4X62L 4ALPA 1WYDA 3H3VI 3D31A 4A3IH 4JI2L 3PO3G 3PIPA 2MO1A 2VNUD 3LGJA 1PH5A 2WFWA 3J80c 3PO3H 4OO1G 1QVFA 1HNWQ 3CCLA 2VL6A 2JQOA 3U4VA 2WAQG 4Y7NH 2VQFQ 1U5KA 2NVXH 4A93G 1S72A 1SFOH 1Z9FA 3HOYH 3S15H 4DAYB 2YTVA 1HNXQ 1EWIA 4K0KL 1D8LA 2NVYH 2HHHL 4UP7A 4PZ7A 4JCVE 4IFDI 1CKNB 3S1MH 2IT1A 4JYAQ 1MIUA 2K4KA 1NTGA 3EIVA 2CWAA 4JI6Q 1KAWA 2JA8H 2E2HH 4LF8Q 1Q46A 1P16A 4BBRG 1VQLA 3TREA 4A3FH 5C4XG 2UUBQ 3GD7A 3A0JA 1GD7A 1TWCH 4A3FG 1SE8A 2HHHQ 4BY7G 1CSPA 4DR1Q 1YJNA 4X62Q 1U0LA 4DR7L 2E8GA 3MEFA 1I50H 1KD1C 1EQRA 3A74A 4TQUS 3CC7A 1VQOA 4KI0A 2NVQH 2LXJA 1XPOA 1N36L 3STBC 2ZM6Q 1CUKA 4UPAA 4A3EG 2N49A 3NELA 4X64Q 2PNHA 1BBUA 2ZTDA 5IYCG 5M3FH 2A8VA 2EIFA 4X65L 5LMNQ 3M7NA 4AYBG 4YY3L 1JB7A 5IYCH 3GO5A 1XTDA 1K0RA 1YBYA 3KYHC 4P73A 3HKZE 4KHZA 3KF6A 3OYYA 4P71A 4APVA 1PH3A 1SLJA 2VS1A 3PUYA 2B63G 4B3SQ 1N8RC 1GKHA 3AFQA 1PVOA 2VUMH 1SMXA 3HOWG 4KHPL 2B63H 4QJFA 4LWCA 1NMGA 4JI0L 3KOJA 3U58A 4EQ5A 2VUMG 2IHEA 3HOWH 3FKIH 2C35B 1VQNA 1GM5A 1X3GA 1PV4A 4POGA 4DR6Q 1WI5A 1JT8A 4YCUA 1JJGA 3CCVA 1UE5A 1X54A 2AMCB 1N32L 1XMQQ 4DR1L 1VQAA 2VZAA 4UP8A 1JJCB 1KL9A 5LMNL 3UDGA 2UUCL 2UUBL 1XNRL 1HZ9A 1Y14B 4JI4Q 4DAMA 4HIKA 1IBML 1PYSB 4MTNA 3J80i 3GTPH 2DUDA 3AYHB 3EBEA 2CKZB 3TQYA 2HIXA 3HOXH 4L5QA 3CAMA 3PO2H 3S2HH 4DV5L 2UUAQ 1VQHA 1VQ5A 5JEAG 1HNXL 1Q1EA 2UU9Q 1D7QA 1VQGA 4GS3A 5HY6A 3KF8B 1WCMH 1M90C 4OX9Q 5C0XI 3G71A 3KFUA 4JG2A 5M5YH 5IYBG 1YVCA 1CKOA 1PA6A 1B8AA 2R6GA 3G6EA 1W2BA 1M1KC 4A3BG 2YV5A 3CF5A 1E1OA 1RIPA 2VY3A 3PSIA 1XMQL 5JJLA 1FVIA 5JEAJ 3RLNA 1IXRA 2HQLA 3CPWA 4GKKL 3RZDH 4BA1I 1I6HH 3CD6A 1YITA 4BBSG 4JI1Q 4JC0A 5GAGC 5C0XJ 1K8GA 1VQ8A 2OWOA 3NEMA 4DV0L 1IBMQ 4LF7Q 4JI8Q 1G291 3M4PA 3ER0A 4NXNQ 1RL2A 4BBRH 1G51A 5LMUQ 2ZJRA 4YWMA 4XTCS 3PUXA 4A3GH 2VQEL 2PI2A 1Q12A 1QUQB 1K73C 4A3DG 2I0QA 2R7DA 1VQ6A 4A93H 4GOPC 4YWLA 4MNOA 2BA1A 5C0XG 5IT9c 2A1AA 1HR0Q 4X65Q 1TWFH 4DV0Q 1EQQA 4LF7L 4LF4Q 1NE3A 2K50A 2JA6G 1QVCA 4J15A 3I4OA 2ZM6L 2VQEQ 2KHIA 5IE8A 3A5ZB 4L5RC 1V43A 2GVAA 3UE0A 3BZCA 1YJWA 4BA2I 4X66Q 2Q2TA 3KLWA 1PH1A 1VQJA 3I55A 3H0GH 5IP7G 4NXNL 5LMUL 2EQSA 3W1BA 5AJ3L 3J81j 4C3JH 4A4IA 1FGUA 4XIGS 4QL5A 3NENA 4A3KH 3TS2A 3T1HL 4JI1L 1XNQQ 4LUZA 5EAYA 5IY0A 4HIDA 4UP9A 4LF9L 4GNXC 4A3LH 2AWOA 3K81C 4X6AH 2V1CC 1X3EA 3JAMi 1VQIA 2D0OA 3HOZG 4P75A 2EXDA 3S17H 4QY7A 1J6QA 4EX5A 3J81c 1P8LA 2VQFL 3M85A 4GLXA 1QVGA 1QZGA 2BH8A 1OXSC 1N34Q 5BR8Q 1A63A 1Q8KA 4DNIA 4JI6L 3PUZA 2ZJQA 1N33Q 4DR3Q 4IO9A 4AQYL 3NBHB 2I5HA 5AJ3Q 2QEXA 3JAMc 2ZJPA 1LM0A 4R4QA 3ZJYC 1C7YA 2IHFA 4AIMA 4DV5Q 2UUAL 1YI2A 1PH8A 3PO2G 1VQCA 4HJ8A 4GLVB 4PZ8A 2IX1A 3HOUG 4O2DA 1E3PA 2CFMA 3OTOL 1Q82C 4B3ML 3T1HQ 1PH9A 2ATWA 1Y1VH 1I94Q 1S3OA 3CP0A 4C3IH 1H95A 4DV1L 1OXXK 1IZ6A 1YHBA 2WB1E 3S24A 4C3HH 4JI5Q 4H02A 1O7IA 4IPHA 5J3BA 2KBNA 3RLOA 3A5UA 5E7NA 3J81i 4NXML 1I5FA 1NBWA 1UE6A 4DV6L 2R92H 1IYJB 3U50C 3M3YH 2MNAA 3KF6B 1EUJA 1KRTA 3W5OA 1N9WA 1TWHH 1EIYB 4JI8L 2OCEA 3ICEA 4KHPQ 5FJ8G 3HOXG 2E5LL 4LW1A 4JOIC 3CCEA 4P74A 3RNUA 4HJAA 4B3SL 2UXDL 4NPSA 1MJCA 3DLLA 2NN6I 4QQBX 4A3IG 4JV5L 2MQHA 1W3SA 2Q2IA 2VW9A 1VQEA 3CPFA 3AEVA 1GO3E 5C3EG 2F52A 2YTYA 3KDFA 1K3RA 1WCMG 3I2ZA 1IL2A 4LFBL 4FDBA 3F2CA 1S40A 5JJKA 4DV1Q 4DK6C 4L5TA 5IYBH 1VQDA 3T1YL 4LF6Q 4A3CH 1MKHA 4OO1I 4LF8L 2K14A 2AHOB 1UE1A 3UDXA 3OTOQ 2RCNA 2R7ZH 4LFAQ 4OXPA 5DLQE 1E7ZA 2WAQE 2UXDQ 4LUOA 4JBWA 2R7ZG 5GAEC 1X9NA 3RZOH 2LXKA 1E22A 1XPUA 4JI7L 1YHAA 3JC66 2LSSA 4B3TQ 3FHWA 4IJLA 1WFQA 2JA8G 3S1RH 4LF9Q 5FLMH 2NZHA 1LYLA 1B7YB 4QGUA 3Q8DA 1VQFA 5C4XH 4LFCQ 2R7FA 2KHJA 2NN6G 4AYBE 3S1QH 4BY7H 1MJEA 2UXBL 1PH4A 1JE5A 4BY1H 4GNXB 4A3GG 4JBJA 3K8AA 5JJIA 1HH2P 2JA7H 1C9OA 3CC2A 3HOVG 3I4NG 3ULLA 1XMOQ 1FJGQ 2JA7G 1PFSA 3I4NH 5IYDH 2YYZA 2UXCL 1AH9A 1L1OB 2AKWB 1JJ2A 1X55A 1XNQL 1ASZA 4UY8C 3H15A 2N3SA 2IY5B 2R93G 2RHSB 4AQYQ 2CCZA 1CKMA 4JI2Q 3KJOA 1K83H 1KQSA 1CSQA 4PG3A 4Y52H 4LFCL 3CCJA 5IP9H 5IP7H 4IFDJ 5C44H 5IP9G 2WB1G 1VS0A 3ULPA 2L15A 5ELOA 1G6PA 3IRBA 2D62A 1SRUA 3K80C 4A3KG 1PH6A 4C2MH 4B3TL 3CCUA 4LNQA 3HOYG 3UE1A 1EOVA 2FXQA 3G48A 5H1SE 3TRZA 3KDFB 1OXVA 2I5MX 1L0WA 3PGZA 2Q2UA 2Y0SG 3I4MG 2UXBQ 3B6YA 1SROA 3CCSA 3K7AH 1Z47A 4P72A 4BXXH 1KXLA 2MFIA 3UDIA 3E0EA 4NXMQ 3K0XA 4DV4Q 1AE2A 4BXXG 4OWWB 4DV2L 1PH2A 3F1ZA 1OXTA 1J5EQ 4IPCA 4DPGA 2K5HA 3M9BA 1NJIC 1HZAA 2N8NA 4X64L 1B70B 3J7A5 2PI2E 4GNXA 2KCMA 5FLXc 4RG1A 1VQ7A 4GKKQ 3W1GA 3CMAA 1XPRA 1DGSA 2UU9L 4DUZQ 2OQ0A 3T1YQ 4LF6L 1J5EL 5C3EH
chains in the Genus database with same CATH superfamily
1F9RA 2CH4W 2XWJB 1Q81C 1YIJA 4JV5Q 1EYGA 2RDFA 1EY9A 1N34L 2K32A 2OTLA 1DOKA 3CCQA 3WDNA 4GZYC 2IX3A 5KYLA 2A6ED 1TIID 3FP9A 1R9TH 2RF4A 1HJPA 3HRZC 5D3IB 4Z9CB 2JYOA 3I3CA 2AUKA 5CGKA 3CMEA 1Y8PB 3OIPA 2K5NA 2BH2A 3RN5A 3MHBA 2ZT9C 1X6OA 3K7AB 1N32Q 4N9PA 3GTOH 2Q2HA 4BY1G 4K8JA 2KCNA 3HS0C 5IGDA 5E4WC 3BJUA 1Q90A 1VQBA 4LF5L 4EVOA 2B3GA 2F0NA 1K8OA 2SEBD 3BDCA 4IUQA 1F2ZA 5FK9C 1UWVA 4HR7B 3BDLA 1PYBA 3HP3A 2N78A 1Z6HA 1W6KA 3T56B 1EFWA 2PCFB 3OHXC 5ELNA 4XT1B 5LL6X 1GJXA 4K2LA 3UDFA 5ELBA 4WJ3M 4Q0FA 3HOZH 4KY6A 4WFN3 1EEID 4WJ4A 1EIGA 4GKJQ 1SEBD 2IJ0A 1AEXA 2MO0A 2F3IA 2Z6KC 1GVPA 4IURA 3OW2A 2N88A 5D14A 4GN5A 1UE7A 4A3EH 4KLKA 3TZDA 4IJHA 2VB2X 2EDGA 5M3FG 1DZ1A 2JA6H 1O7YA 2ENBA 1VQKA 1KDCA 2XTIA 5IYDH 2CQOA 4HJ5A 1FR3A 3U9OA 3AFPA 4C3HG 4JI4L 2JA9A 1BCPD 4PNYA 3STBD 2B2VC 2K75A 2PQAA 1PTOD 3K7UC 1SJHD 3PIOA 3S1NB 4HIMA 1ML0D 3SHLA 2KCTA 3Q22A 4OWXB 4TSSA 5EGTA 3VR6A 5GADC 3NK9A 3P75A 3J7YW 3PO3B 4B9WA 3VR4A 4KHVA 2D0PA 2QKIC 4A3CG 4RGNA 1RJTA 1B1ZA 1UEBA 1SMYD 4A3JG 3PIP3 1JCKB 1V1QA 1Q7YC 1XNRQ 2G5DA 2R61A 1EU3A 1VF7A 1CKNA 3D6CA 4X66L 1R4PB 1TWCB 2Z9HA 4XDXA 1RF2D 2OTJA 1CK1A 2EY1A 2XGTA 4JI5L 3HOVH 4JYAL 3FPPA 4HJ9A 1HR0L 2QF7A 3U4ZA 1WD0A 3ULJA 1U4LA 1HZCA 4PV1C 4RAUC 3H3VI 3PO3G 1Y8NB 2VNUD 1JWSD 1HNWQ 2VQFQ 4HMJA 1CZWA 2OXPA 4ZYSA 3S15H 3X3NA 4DAYB 2JA7B 4H44C 2DNEA 1SYBA 1WTWA 4QUCA 4UP7A 4JYAQ 3U9SA 3NQTA 3EIVA 2CWAA 2JA8H 2E2HH 1ENAA 1LLRD 3ND9A 3BYTB 5C4XG 2UUBQ 3R8BA 1GD7A 2HHHQ 4BY7G 3TP5A 5IOCA 1HTLD 1I50H 4TQUS 1U9RA 5KRUA 1LT5D 3RUZA 1IYVA 1GXDC 4KTAA 3D4RA 5C0XH 1N36L 4QCLA 4UPAA 3NELA 4FF4A 1MHWC 2BDNA 1BBUA 5IYCG 5M3FH 1HQRD 1R9TB 1IHZA 1H9JA 1XTDA 3KF6A 1HA6A 2FMCA 2VS1A 2R92B 1HTPA 3AFQA 4EQ5A 2VUMG 3CRKC 3MC0B 1QILA 2KCCA 1AW7A 1E2WA 1WI5A 4DA2A 4E6IA 4YCUA 4ME5A 1JJGA 1X54A 2AMCB 1I50B 1G2SA 2NYZD 2J0TD 4A3BB 2QEJC 2O5IC 3UDGA 4JI4Q 2A6HC 1KNAA 1WTXA 4KN4C 2R7ZB 1E0BA 1SE3A 3AYHB 3EBEA 3TQYA 4CDCC 3HOXH 1LT6D 1HNXL 4DAVA 2UU9Q 1K3BC 4I7AA 4CBVA 4OX9Q 4N8FA 3G71A 3KFUA 4JG2A 5M5YH 1WTVA 2KVMA 3NE5B 4V0BA 2YV5A 3MXUA 1E1OA 2WACA 1ET6A 1HA5A 5I4DA 3OIQA 2A73B 2OWOA 1K8GA 1LACA 4KY7A 4OGQC 1EZ6A 1EY8A 2BCOA 1STBA 4NXNQ 5EKIA 3FDTA 3TN2A 3A56A 5D65A 2K1BA 1TS2A 1H9RA 3NHHA 1K73C 3A8JE 4C2MB 2R7DA 4YWLA 2BA1A 3PMFA 3EQLC 1NUCA 4C3IB 1Y1VB 1GOZA 2BE5D 2JA6G 4XXEA 4J15A 1BQQT 3D4DA 3I4OA 1EFID 4ZKBB 2XWBB 1H9KA 5I2YA 1YJWA 4BA2I 1I4QA 3H0GH 4NXNL 2EQSA 3W1BA 2L11A 5IIFA 5AJ3L 4RHRA 4DK1A 1G91A 3D3RA 1FGUA 4QL5A 4A3KH 3T1HL 1EEFD 1O78A 1Y69U 2A5HA 2B2UA 1S5ED 2ZXPA 2Q8IB 1HRJA 2AWOA 4X6AH 1E2VA 5EBDA 2L0CA 1K8MA 2D0OA 4DAPA 1J6QA 2MHVA 3M85A 4GLXA 5I6WA 1SDFA 1N34Q 3FVQA 1N33Q 1CTMA 5AJ3Q 2QEXA 3OMGA 3JAMc 4H0LC 2IHFA 4AIMA 3PO2B 5C5MA 3HOXB 3P7JA 1U4PA 5E3FA 3GTLB 1VQCA 1SNMA 4PZ8A 2Z8LA 1BCPC 1Q82C 1CA6A 4RGTA 1IZ6A 1PTOB 1VF5C 3S24A 1LT4D 3RLOA 5JPMC 4NXML 1KDBA 5IGFA 1PFBA 2WIIB 1WTOA 3M3YH 4CJ0B 4DFAA 4NW2A 3MEHA 1TWHH 2VUMB 1Q3LA 3HOXG 3G6JB 4JOIC 4HJAA 3TBIB 1MJCA 4P2CB 4N9TA 1K83B 3K5LA 2MQHA 2VW9A 5C3EG 5C44B 1WCMG 4FDBA 2VXWA 5T1IA 1S40A 3V96A 3T1YL 1GUWA 4A3CH 1MKHA 1UE1A 4OIJA 5CR3A 3OTOQ 3BG3A 4OXPA 4I65A 1D5ZC 4L8JA 2RSNA 4BBSB 4JBWA 5GAEC 1X9NA 2A6EC 1ZKOA 2JA8G 3S1RH 1EWHA 4ABNA 2KHJA 4A3KB 2Q8RE 5KNDA 3VA7A 1PH4A 3K8AA 3MWYW 3I4NG 2OT2A 1XMOQ 1FJGQ 2LFNA 2JA7G 2DNCA 1AH9A 2F0VA 4FYDA 3OMCA 2B8FA 1DOMA 1O80A 3H15A 2F0KA 3J80E 1AN8A 3AU7A 1ESFA 4Y52H 1Z7TA 3CCJA 2F0JA 4J1MA 5IP9G 4I7ZC 3ULPA 1EYAA 1K0SA 3K80C 4RGOS 4C1NI 1EOVA 2FXQA 3Q6SA 1OXVA 2I5MX 2Q2UA 1SROA 3K7AH 2JN4A 4P72A 3CRLC 4BXXH 2MFIA 3UDIA 3TDQA 1SFOB 4BXXG 3DUZA 3T13A 2HD3A 4DPGA 1A6XA 4C3JB 5K36H 2F0UA 2KCMA 3HOWB 4RG1A 2V4DA 4A3DB 2WKCA 4RH6A 4GKKQ 4WJWA 1DGSA 1CZGA 1CI3M 1T9HA 2AWNA 4RCOA 3WOEA 3KBGA 1Y1VG 4JBKA 1SXTA 3GTMH 1I3QH 1CFMA 2IPKD 1MSGA 4V190 2KJXA 2Z4HA 4LF5Q 4IUNA 4FXGC 1BBWA 2ZTCA 5HGTA 1SNPA 4DR6L 3GTGH 1M4VA 3PUVA 3ONAB 5FLXL 5M9OA 1RHPA 4M1UB 4ZKCB 5DEHA 4OONA 4WORA 1ASYA 2Z6KA 1E1TA 3NTIA 1FL0A 1N33L 5IWAQ 3F8TA 1IBKL 3TSSA 1JICA 2EYJA 1PMRA 4DR2Q 4JOIA 5KNBA 1J9OA 1NMFA 3L0OA 5C3EB 4JI3Q 1QWYA 4IOCA 4BY7B 4L5SA 4RCNA 2A6HD 5GQOA 1VCIA 2L5TA 4ZUJA 4KN7C 4KKUA 1EIFA 4DR7Q 1SNQA 3PV0A 2RVLA 3MA2B 3Q0AA 1F2MA 4KMUC 4A76A 5C5LA 4FVMA 4OIKA 3NP8A 4F8MA 3GTKB 3P20A 5CBEE 1BKBA 4PQXA 2JA5G 4OELB 3D6WA 3VYSA 4QIWB 2R93H 4PZ6A 3CCRA 1PH7A 1Q8IA 2WP8J 3DWAA 1A2TA 1LTAD 3S16H 2F0FA 2P5ZX 3V2TA 2E76C 1Y1WG 1SN8A 2QGQA 4A3DH 4IUPA 2ID0A 3K5MA 4J8QA 2KEDA 2PQAB 3RR5A 1HFGA 1LTLA 1WJJA 2MUYA 2MGSA 3I4MH 2JJQA 1X3FA 1WTQA 4HJ7A 4QB4A 1L1OA 2B2YA 1VQ9A 1T5XD 2PMZE 4TVAB 1HZBA 3MXNB 5GROA 1KHIA 3W2DA 3GV3A 1VQMA 4IZ8A 1I4XA 2HT1A 5K36G 2AQ3B 4K0KQ 3ZYYX 1SR3A 4QIWE 3HKSA 3SEBA 1A8VA 3S1NH 1U4RA 1CQVA 4R4CA 5BR8L 5ELDA 4ZLTF 4IUVA 4QUFA 4LFBQ 1TWGH 4OWTB 1A3UA 4DV4L 2B2WC 4IFDH 4YWKA 1D5MC 3N52A 2KEEA 1VQ4A 2QILA 2DJFC 2DY8A 4JPBW 1GUSA 2A69D 2EXZA 5CV9A 1AE3A 3HKZG 3LWEA 4PMCA 1M8AA 3ITPA 1EY6A 1KIXA 2IL8A 5J39A 4MZ9A 2EY6A 3I4LA 1WTHA 3MXGA 5HURA 1E24A 2IX0A 1KC8C 2ASBA 4R4OA 3PQIA 3D0FA 3NTHA 4FXKC 5DAUA 1QCBD 1IBLQ 4KD3A 3M4OH 3PCOB 4DV6Q 2F0LA 1L2FA 3H0GB 4ALPA 1WYDA 3D31A 4A3IH 2NUCA 3EJIA 2EOTA 3VR5A 4G7OC 1HUNA 3PIPA 4RKBA 2B2TA 2MO1A 3NUCA 3LGJA 3J80c 1C4QA 2WAQG 4XT3B 3WOFA 5FOBB 2NVXH 1G6ZA 1Y1WB 1S72A 2NTTA 4DN4M 3BVMA 5C4HA 1Z9FA 3HOYH 3VYRA 4OEMB 2YTVA 1EWIA 3I91A 4IFDI 4R9WA 5M3MB 2QDBA 1I3QB 1PZJD 2WINB 4JI6Q 4CKCA 4LF8Q 1S5DD 3BS1A 1QB5D 1TKWB 3GD7A 4DR1Q 4DR7L 2NVTB 1U0LA 3PIO3 2NVQH 1GHKA 4XQJA 5CV7A 3STBC 3E6ZX 4A3EG 1FNWA 1SMYC 1V1PB 1B9MA 2PNHA 5KIXA 1DCZA 4X65L 2ICEC 1JB7A 4YY3L 5EPKA 1D2BA 3GO5A 1BDOA 2WKDA 4KHZA 1KLGD 2F0MA 1PZID 2B63G 4B3SQ 1XX8A 2KUMA 1TWHB 1SMXA 4XQNA 2VUMH 2B63H 4UDUC 4KHPL 1NMGA 5C4XB 4F7XA 3KOJA 1D6EC 3U58A 2IHEA 1NCVA 1TS5A 3FKIH 3ND8A 2C35B 1VQNA 1GUNA 1GM5A 3SK8A 1CQFA 4POGA 4DR6Q 3CCVA 1UE5A 5A2QE 1B4OA 4DR1L 1KL9A 5LMNL 2UUCL 2XN9C 1DJRD 1B3QA 1FNVA 1JQYD 2RQXA 4MTNA 5CYUA 2CKZB 3PO2H 3EVQA 1SBBB 1QOHA 4GS3A 4C1NK 4KKSA 4K8IA 4ODGA 1EOTA 1PA6A 2R6GA 1W2BA 4CDDC 1SYFA 1PZKD 1XMQL 1FVIA 3SXHA 3RLNA 5JEAJ 1LTGD 2DJGC 4QMGA 5I9OA 1ICFB 2HCIA 4ULLA 4BBSG 4K6LA 5GAGC 1HHVA 1FD7D 2K04A 4DV0L 1IBMQ 4LF7Q 4JI8Q 2AQ2B 3Q24A 3JAML 2GA4B 3S9WA 3I72A 5EBCA 1VDZA 4YWMA 1V1OA 3PUXA 1QUQB 2NVYB 1JWUD 4AYBB 2F0OA 3NWSA 4GOPC 4MNOA 5IT9c 2A1AA 2K33A 1UUPA 4LF4Q 2E74C 2QW7A 2ZM6L 2EYLA 2GVAA 3UE0A 2LY7A 2Q2TA 3KLWA 2LKVA 1V1PA 4ZCKA 1F9QA 4CGYB 1VMPA 2Y0SB 4XIGS 4FF3A 1L0YB 2EJGC 3RD4A 4UP9A 4GNXC 3LX0A 3SK6A 5IGGA 2FJ2A 3S17H 2YU9B 3GTMB 4QY7A 3J81c 1B53A 1P8LA 1QZGA 3IFDA 4XQQA 2F1MA 2ZJQA 3A8IE 4AQYL 2K5QA 1EIHA 1HCZA 1C7YA 4DV5Q 3DXJC 2UUAL 3FEWX 5CV6A 5T1GA 2K5DA 3GTJB 1NSNS 3E3XA 5C3WA 3HOUG 1PRTC 3T1HQ 4DNTB 1RTOA 5G3LF 1TWFB 3CP0A 4FNFA 4G7ZC 4DV1L 1OXXK 3FKIB 1KABA 2NWGA 2WB1E 1II3A 4C3HH 4IPHA 3Q23A 1EY4A 5E7NA 3J81i 4HSPA 2R92H 2B39A 1IYJB 2MNAA 1EUJA 2F0EA 1AP0A 4X3UA 1N9WA 1ET9A 5FJ8G 4LW1A 3CCEA 1I4PA 3RNUA 3DLLA 2BOSA 1LTTD 1W3SA 1VQEA 3CPFA 1AZQA 3AEVA 3KDFA 3FRPB 4LFBL 1TU2B 5DNFA 5JJKA 4DV1Q 5IYBH 4L5TA 1LTBD 1VQDA 1ILQA 2K14A 1GUTA 5AFWA 2RCNA 2R7ZH 2N55A 4LFAQ 1E7ZA 2UXDQ 3UI2A 2NZ1D 1SJED 5EQ0A 3D4WA 1E22A 2QDLA 4HCEA 4JI7L 2X6LA 1YHAA 5FO8B 1XPUA 3TZUA 4B3TQ 2RKSA 2NZHA 3A8KE 1CHQD 2D9UA 2F0WA 5EKLA 1AZPA 4JBJA 4L63B 2JA7H 3CC2A 3S15B 3HOVG 2F3VA 3I4NH 3I4MB 2UXCL 1L1OB 4UY8C 1BUVT 1I4RA 1JOKA 5JAVA 2IY5B 2R93G 3CKIB 5A2QL 2C9OA 4JI2Q 4CDEC 4LFCL 5IP9H 3I90A 4FF2A 2EYHA 3CU7A 5EPLA 1G6PA 3OPOA 5ELOA 5BN4A 3IRBA 4A3KG 4L6TB 2RSOA 4C2MH 3T16A 4LNQA 3HOYG 3UE1A 5CORA 2PZWA 5H1SE 3AB9A 3I4MG 1KTKA 3M4YA 1LO5D 3MFGA 1PLFA 4EQOA 2CW0C 4KY5A 1A3TA 4Q5VA 2B2TC 3DM1A 4OWWB 1PH2A 1OXTA 1J5EQ 4IPCA 2K5HA 4DAYA 3M9BA 1A3VA 2N8NA 3KLSA 3DEPA 1VMCA 2A69C 5FLXc 3OWFA 1EY5A 2ICIA 2UU9L 4DUZQ 3T1YQ 5ELCA 4G57A 1J5EL 3T53B 1H9MA 1RTNA 1YNXA 4LK1C 4DR3L 2EJFC 3IKJA 1O7LA 5COYA 4ME3A 4DV3Q 1IBKQ 1QNKA 3EFXD 1WTPA 2I5LX 4DUYQ 1XTCD 2F4VQ 1I94L 2IWHA 4DNRB 1OO9B 1TVXA 3K0YA 3DWQA 3PUWA 1A62A 4N8X1 4RMFA 3KBXA 4DU9A 2IW3A 2RHQB 4A3MG 2MP1A 1PRTF 4R1JA 1X56A 2KOLA 1HUMA 2UUCQ 3TS0A 2M9VA 3RN2A 3AQQA 1YZ6A 2EVBA 3QJYA 1PHJA 1DD2A 1QZHA 5L37A 3NTKA 4GN3B 1HFNA 4RWSC 5KYIA 1DONA 4DR5Q 2H5XA 3DHQA 3RLFA 4DUZL 2YU9H 4DR4L 2ZTEA 3VDYA 1IKLA 3CQZH 3DM3A 1N36Q 4JW0A 5J1ZA 3H0GG 3DWPA 4BBRB 1L1OC 1HNZL 3M7GA 4DF7A 3KLRA 4B9XA 1SAPA 2JEBI 4B3RQ 4YY3Q 5C44G 3L9AX 3ERQA 1HR0W 4GKJL 3F2DA 2DGYA 2B29A 4JI7Q 4A3BH 4OHJA 3SK5A 1C48A 3URYA 3QG1A 4LFAL 2PMZB 3VA5A 2YTXA 4JI0Q 2F3WA 3J7ZC 3KF8A 4DV2Q 2PQEA 2JA5H 3J7AV 4YCVA 1BVSA 4ZRZA 4A75A 2L12A 1F77A 1PYWD 2EE1A 2XNAC 1BF4A 5M5YB 5TSSA 1BXTA 4LUVA 1VQPA 1Q1BA 1Y1WH 2CH4A 1F2LA 3HOUH 4F87A 4GN4B 2UXCQ 2NZOA 1XMOL 2F0TA 3H91A 1LTID 1TS3A 2K5VA 2F4VL 1F2YA 1JWMD 1TR5A 3H94A 3GDEA 1BO0A 2BE5C 1X32A 2Z0SA 3C1EA 2F0QA 2K52A 3FMCA 4DV3L 3CCMA 1YJ9A 1JE4A 4NDXA 1D1IA 4DK3C 3BZKA 3L7ZC 3R2IA 3AMUA 4DXGA 3ERSX 4A93B 1TWAB 2G9HD 2VB3X 4EGVA 5ELEA 1QG7A 2GN5A 4HCSA 2CHBD 1CA5A 4R8NA 1LUZA 5C4JH 1EQVA 4OX9L 3GV6A 3WWVA 1EWCA 2JXMB 3W3AA 5D3DA 1TWGB 1S4ZA 4FXDA 3SE0A 1EZ8A 4RGMA 1JOOA 2Y0SE 1YHQA 3L3OC 3TEHB 1ZXTA 1LT3D 3KJPA 4YHHL 4A3JH 1X65A 5FLMG 1BCPF 1E2ZA 4R4IA 5CMDA 4XYQA 1V8QA 2FMMA 1OTCA 3LNNA 2JP1A 3NBIA 5CV5A 1TWAH 3SVMA 3H3VH 4DKAC 2NB0A 5M5WH 2R92G 2E5LQ 4BBSH 1PRTD 4MN3A 3PF4A 2OEOA 4O0AA 4KD4A 3GTGB 4NB3A 1MI2A 3K59A 4JK1C 3MFYA 4IUUA 1KLUD 3V05A 5KEEA 5M3FB 2B63B 1PH5A 2RDGA 3CCLA 1CM9A 2VL6A 3U4VA 4A93G 2R3ZA 1MGSA 1SFOH 4X3KA 4TKOB 1STNA 2LMCB 1HNXQ 1IW7C 2K01A 3S17B 2HHHL 1CKNB 2HDLA 2K4KA 1SYGA 1NTGA 1TQOA 2F0HA 2EJMA 1B9NA 1VQLA 2E2IB 2Z4IA 1STHA 4A3FH 3KUPA 5F2DA 1TWCH 4QF4A 2SDFA 1SE8A 1RCVD 4A3FG 1B3AA 4X62Q 2E8GA 3MEFA 5BN5A 1KD1C 1VQOA 3TP6A 2OF1A 2ZM6Q 3O13A 3QOJA 2N49A 1I6VC 4X64Q 2A8VA 3JAME 2EIFA 5LMNQ 4AYBG 4CHTB 3KYHC 1IW7D 3OYYA 1PH3A 3PUYA 1GKHA 4RA8A 2J4XA 1PVOA 3HOWG 2Q8TA 5IGBA 4QJFA 4LWCA 4JI0L 4BY1B 3T51B 5KGUA 1X3GA 1PV4A 4RHSA 2KA7A 4CKEA 2O2LD 3MAQA 2FINB 3K6OA 3J80L 2K28A 3BVZA 1XMQQ 3IL8A 1EY0A 1NR4A 1VQAA 2UUBL 1JJCB 1XNRL 1HZ9A 4HIKA 1PYSB 5FO7B 3J80i 2QCPX 2E75C 1STEA 4X3TA 1IKMA 1VQ5A 2F0SA 2NBFA 4KKTA 1Q1EA 1D7QA 2AUJD 5HY6A 3KF8B 1WCMH 3H6MA 1M90C 5C0XI 5KNCA 1I4GA 1CKOA 4Y7NB 1SE4A 1QJOA 1B8AA 3G6EA 3GTOB 1RIPA 2VY3A 3PSIA 3I4NB 5JJLA 5IGEA 5JOBA 1IXRA 4GKKL 1PXUA 3NPPA 4BA1I 1I6HH 1YITA 4JI1Q 1VQ8A 2DN8A 3S14B 3D8GA 4BWGB 4R8IA 1XWEA 2AQ1B 3ER0A 2CQAA 1QE6A 1G51A 2NN6H 2VQEL 2PI2A 1Q12A 3J81L 4OO1H 2I0QA 5IODA 4A93H 2ZXOA 5C6AA 1D1KA 5C0XG 3RMHA 4X65Q 1TWFH 4DV0Q 1EQQA 4LF7L 1NE3A 1QVCA 1STGA 1ZYRD 2PYKA 5J22A 2F0PA 2KHIA 5IE8A 3A5ZB 2VQEQ 3BZCA 2B2YC 4ID6A 1VQJA 3R2TA 3I55A 5LMUL 2HQEA 3J81j 4A4IA 4H13C 3EROA 3TS2A 4JI1L 1R4QB 5C4JB 4LUZA 4HN7A 1G8ZD 5EAYA 4HIDA 1A2UA 3K81C 5IT9L 2V1CC 5JPNC 3HOZG 2K5WA 5IGCA 4EX5A 2KHSA 2VQFL 1QVGA 3S1MB 1OXSC 5BR8Q 1A63A 1Q8KA 3PUZA 4DR3Q 4IO9A 1EU4A 3NBHB 2ZJPA 1LM0A 4ILWA 4R4QA 1B2TA 4U68A 3S2HB 1YI2A 3NBHA 1PH8A 3PO2G 4HJ8A 4GLVB 2B2UC 5JEAH 2CFMA 3OTOL 4B3ML 1Y1VH 5E4XA 3OSOA 1FGBD 1JOQA 2FFKB 4K5WA 5E1FA 3GTQB 3TP7A 3G7LA 2KBNA 1SSOA 1SE2A 4LJZC 2PZTA 1NBWA 1UE6A 3U50C 1YNJD 2FHTA 3W5OA 2OCEA 3ICEA 2E5LL 3K5OA 4KJNA 2UXDL 4P74A 4QQBX 4JV5L 3HOYB 1GO3E 1PFNA 1ICWA 3BZDB 3I2ZA 3F2CA 1EY7A 1Y8OB 2M00A 4DK6C 1LV9A 4LF6Q 4CDFC 4OO1I 2SNMA 4LF8L 3I70A 2MPMA 3UDXA 2PPBC 3C46A 5DLQE 2WAQE 3K5NA 5ELFA 3LWUA 1GHJA 2X69A 4LUOA 3M4OB 3JC66 4KK7A 2HCCA 3FHWA 4IJLA 1WFQA 4LF9Q 1JB3A 1AFPA 1LYLA 1B7YB 1JR0D 1VQFA 4C3JG 2R7FA 1CT1D 4BY7H 4K5XA 1MJEA 2UXBL 1PRTB 1JE5A 4BY1H 5JJIA 1HH2P 1C9OA 1BR9A 3HEJA 1WD1A 1GUGA 1PFSA 2L1BA 3H09A 2YYZA 3F2UA 2AKWB 2O4XA 3RZDB 1X55A 1PFMA 1ASZA 1RKNA 2K05A 4AQYQ 2CCZA 1K83H 4O42A 1KQSA 4PG3A 4U673 5IP7H 4IFDJ 1YNJC 4A3GB 2L15A 5FKAC 3H3VC 1EYCA 3CCUA 3X3MA 3KDFB 2WV6D 3QIAA 2Y0SG 3EA6A 3B6YA 4O1NA 1J8IA 1KXLA 3E0EA 1HXYD 3K0XA 3E5SA 4DV4Q 1AE2A 2G9DA 4DV2L 3F1ZA 1MBYA 1HZAA 3J7A5 1B70B 2PI2E 2JA8B 3QOLA 4XYOA 3W1GA 4ZK9B 3CMAA 2EZVA 5M5XB 3HOUB 4LAAA 3TP8A 4HEDA 4OL7A 5C3EH 5CC4A 4DR2L 1HQMC 2L55A 5M3MH 1DYQA 5IWAL 3M4QA 2DY7A 2LS01 3L2PA 4F88A 4M8AA 3GTKH 1K9MC 4DR4Q 4DR5L 4HIOA 4B3MQ 4GOPA 4A3MH 3VR2A 2KECA 2Z6BA 4UAIA 1RODA 5FJ8H 1C0AA 2SNSA 2B2WA 2PW5A 1BCPB 3BU2A 4DK0A 1ZYRC 3OOCA 3CC4A 3DMUA 2B8GA 1YEZA 2F4IA 2BA0A 2EY2A 1XXGA 2R93B 5BN3A 1FJGL 4YCWA 2HIVA 4LF4L 4TRDA 3S16B 3SGIA 4IPGA 5EJWA 4YHHQ 1BBXC 4DUYL 2PW7A 2O5JC 1BNZA 2E2IH 2EYFA 2ZXRA 3CW2C 1FNUA 3HG9A 5I9PA 2X6GA 3GTPB 3I8ZA 1ONLA 3G4SA 2E2JH 1D5XC 2TSSA 1KDAA 3A55A 4R4TA 4A3IB 1QUQA 5DM63 3VYTA 3QWNA 1A0IA 1MSHA 4A3LG 4WRDA 2RA4A 4JI3L 4B3RL 4CJ1B 1ZEQX 2RCFA 1HNZQ 3C1FA 3CXCA 1Q86C 1PTOF 3K57A 2KENA 4IPDA 1NAPA 4A3JB 1WOCA 3GTQH 3QO2A 3R93A 3F2BA 1K8AC 3S2DH 3HGBA 5M5XH 2JA6B 4PMBA 1JMCA 2NVTH 1I4HA 4C3IG 1HNWL 5LHY1 1OXUA 4GLAC 2JEAI 1ESRA 2ALYB 2JE6I 4H7BA 3VR3A 2CWPA 5M3MG 4POFA 5IYDG 5M5WB 3NSWA 4PMWA 1V9PA 1H9SB 3P1HA 2L9HA 4A3FB 3EN2A 1S5CD 3FKIG 4UHVA 3I7FA 3GTLH 1XJVA 1HPCA 2CVRA 3S1RB 1EL0A 4DV7Q 5I2XA 3SR1A 3MTSA 2XRSD 2Z1CA 1A15A 2JK8A 1TXYA 2OQKA 4AH6A 4HAEA 1TY2A 2ES2A 1KNEA 1BOSA 1SYDA 2NVXB 4IFDG 4JVZA 2E2DC 5GAHC 2J7ZA 4JBMA 2I07B 1IBLL 1UAPA 1TY0A 3S14H 5HGQA 5FLXE 4DV7L 2QA4A 4A3EB 1KRSA 3HFZB 3A54A 2EYOA 5LMNW 1NY4A 3A7LA 4C56C 2A19A 4GOPB 1T5EA 1B50A 3I73A 5K5PA 1JORA 1X3PA 3I56A 1SNOA 3QR8A 2A74C 2GVBA 4IOAA 1G2TA 4ZQ3A 3E9IA 3PF5A 3GTJH 3E9HA 4X62L 4JI2L 2XIWA 2C5CA 4K6DA 4NKLA 4OO1G 2WFWA 2WAQB 3PO3H 1QVFA 2SOBA 2JQOA 4Y7NH 1U5KA 3S2DB 4K0KL 1D8LA 2E2JB 2NVYH 4PZ7A 1LTSD 4JCVE 5I6YA 3S1MH 2IT1A 1MIUA 2E2HB 2RDHA 1KAWA 1Q46A 1P16A 2EPBA 4BBRG 3TREA 3E0JA 2A68C 3A0JA 5G3LD 5JVG3 4S3SA 1CSPA 1YJNA 1SNDA 3OWEB 1EQRA 3A74A 3CC7A 3MXNA 3MXPA 4KI0A 2LXJA 1XPOA 1CUKA 2ZTDA 2XRQD 3M7NA 3NQIA 1KAAA 5IYCH 1W6JA 1K0RA 1YBYA 1WVLA 4P73A 3HKZE 2JA5B 1MD2D 4P71A 4APVA 4CJ2C 1SLJA 1UEAB 1N8RC 2BDOA 2JSOA 5C3XA 1PTOC 3KLSX 1FYCA 1ILPA 3HOWH 4FP5D 4RKLA 3A7AB 1JT8A 1IYUA 1N32L 5CV8A 1UNSA 2VZAA 4MTKA 4UP8A 2K6AA 1F9SA 1Y14B 4DAMA 5EKKA 5LL6S 1IBML 1STYA 1H9SA 3GTPH 2DUDA 4HSVA 3GQBA 2HIXA 2WB1B 4L5QA 4J6HA 3CAMA 3S2HH 5JVH3 4DV5L 2UUAQ 2PZUA 1VQHA 5JEAG 1VQGA 3T4AC 4G4KA 1WCMB 1K28A 4DGZA 5IYBG 1YVCA 4MIUA 3NWTA 3QB3A 4ZAIA 3C2PA 1M1KC 4A3BG 3CF5A 3CPWA 2HQLA 3J7AF 3RZDH 3CD6A 4JC0A 5C0XJ 3NEMA 4RFBA 1G291 3M4PA 2F0DA 1RL2A 4BBRH 1NNXA 2KQ3A 4LMQD 2ZJRA 5LMUQ 1C8CA 4XTCS 4A3GH 1GUOA 1EQTA 4K2KA 2F0IA 4K14A 3NXWA 4A3DG 5A35A 1ENFA 1VQ6A 2L4NA 1JC7A 4B08A 1HR0Q 2K03A 3HOVB 2EY5A 1DXMA 2K50A 3RZOB 3KK7A 4KJOA 4L5RC 1V43A 3TMEA 3VYUA 3IAYA 1YNNC 2H4OA 4X66Q 4CKBA 1PH1A 2XSCA 5IP7G 4C3JH 1XYIA 3NENA 1XNQQ 1X3QA 1DM0B 3FPUB 5IY0A 4LF9L 4A3LH 1NR2A 3HKZB 1X3EA 2CW0D 4EQPA 5FO9B 1TS4A 3JAMi 1VQIA 4P75A 2EXDA 2MJ8A 2BH8A 2TMPA 4DNIA 4JI6L 3OW7A 2I5HA 1PDQA 3ZJYC 3BYYB 4NMZA 3HOZB 5CV4A 2IX1A 5C4ZA 4X3SA 4O2DA 1E3PA 2ATWA 4IQZA 1PH9A 3MVVA 4G7HC 1I94Q 1S3OA 4C3IH 3HZXA 1H95A 4KV6A 1YHBA 4JI5Q 4H02A 1O7IA 2EYPA 1S5BD 5J3BA 3A5UA 1S5FD 2I46A 1LABA 1I5FA 2PO4A 1QNUA 4DV6L 3MZ5A 4NP5A 3M3YB 2HUGA 2NTSA 4YIJA 3KF6B 1KRTA 1EIYB 5IT9E 4JI8L 4BS9A 4KHPQ 4B3SL 1EYDA 3CHBD 4NPSA 2NN6I 2K7VA 4A3IG 1RDPD 1IL8A 4EQNA 4FO2A 2Q2IA 4IALA 3C3LA 2F52A 2YTYA 1K3RA 1IL2A 1TT2A 1F9PA 2NVQB 1WTRA 1L0XB 1U4MA 2AHOB 2D2CC 4IN3A 3R3OA 2A68D 4MHEA 2F0GA 2R7ZG 3SK4A 3RZOH 2LXKA 2LSSA 4A3MB 5FLMH 4QGUA 3Q8DA 2D5DA 1DOLA 3BDOA 5C4XH 4LFCQ 2NN6G 4AYBE 3S1QH 4K5VA 1LTRD 4C3HB 4GNXB 2XVSA 4A3GG 3K58A 4IUTA 3SDZA 3ULLA 3IFTA 2H1EA 3DEOA 2RBMA 5EPJA 2HDMA 1JJ2A 2F03A 1I6HB 1XNQL 3N6RA 1SYCA 2N3SA 1CHPD 2RHSB 1CKMA 5JJZA 5NUCA 4DXFA 3KJOA 1CSQA 3GP7A 5C44H 2B2VA 2WB1G 1VS0A 4FF1A 3BVGA 2PNRC 2D62A 1SRUA 3J81E 1PH6A 4B3TL 1O7ZA 3G48A 3TRZA 1B44D 2UXBQ 1L0WA 3S1QB 3PGZA 1RD9D 3CCSA 4ZUIA 1Z47A 1PTOH 4NXMQ 5DM73 1STAA 4HTHA 1NJIC 4X64L 5ISRA 5CBAE 1ENCA 4GNXA 2M2LA 1VQ7A 3CQZB 4HMIA 1XPRA 1YNND 2OQ0A 1SNCA 4LF6L 1SYEA 2EYMA
chains in the Genus database with same CATH topology
1T9HA 2AWNA 1Q81C 1YNXA 1Y1VG 4JBKA 4DR3L 1YIJA 4DR2L 4JV5Q 4ME3A 4DV3Q 1EYGA 1IBKQ 1I3QH 3GTMH 1N34L 5M3MH 2OTLA 5IWAL 2I5LX 3M4QA 4DUYQ 3L2PA 3CCQA 2F4VQ 4DR4Q 3GTKH 1K9MC 1I94L 4LF5Q 3FP9A 1BBWA 2ZTCA 2RF4A 4HIOA 4DR5L 1R9TH 4B3MQ 4GOPA 4A3MH 3PUWA 1A62A 1HJPA 4RMFA 4DR6L 3GTGH 3PUVA 2RHQB 4A3MG 3CMEA 5FJ8H 1C0AA 4R1JA 1X56A 4OONA 2K5NA 1ASYA 2UUCQ 3BU2A 2Z6KA 3TS0A 1E1TA 3CC4A 2BH2A 3RN5A 1FL0A 1N33L 5IWAQ 3RN2A 1X6OA 3F8TA 1IBKL 1N32Q 3AQQA 3GTOH 1YEZA 2Q2HA 4BY1G 1YZ6A 1PHJA 4DR2Q 2BA0A 1QZHA 4JOIA 4GN3B 1FJGL 1NMFA 3L0OA 4YCWA 2HIVA 3BJUA 4DR5Q 2H5XA 4JI3Q 4LF4L 3SGIA 4IPGA 1VQBA 3RLFA 4DUZL 2YU9H 4LF5L 4DR4L 2B3GA 2ZTEA 4YHHQ 4IOCA 3VDYA 4DUYL 3CQZH 4L5SA 3DM3A 2E2IH 1N36Q 3CW2C 5GQOA 3H0GG 1VCIA 1L1OC 1EIFA 1UWVA 1HNZL 4DR7Q 3G4SA 1PYBA 2JEBI 4B3RQ 2N78A 4YY3Q 5C44G 2E2JH 1HR0W 1EFWA 4GKJL 3F2DA 2DGYA 2B29A 4R4TA 4JI7Q 5ELNA 4A3BH 1QUQA 3PV0A 4A3LG 1A0IA 3UDFA 4LFAL 4A76A 4WJ3M 3HOZH 2YTXA 4JI0Q 4JI3L 1BKBA 3J7ZC 4B3RL 4WJ4A 2JA5G 4GKJQ 1HNZQ 4DV2Q 2MO0A 2F3IA 2Z6KC 2JA5H 1GVPA 4YCVA 3CXCA 1Q86C 1BVSA 2R93H 2KENA 4PZ6A 3CCRA 4A75A 3OW2A 2WP8J 1PH7A 4IPDA 3S16H 4GN5A 1WOCA 3GTQH 1VQPA 4LUVA 1Y1WG 1SN8A 1Q1BA 1UE7A 2QGQA 3F2BA 1K8AC 4A3DH 3S2DH 2ID0A 4A3EH 4KLKA 1Y1WH 4IJHA 2PQAB 3HOUH 5M3FG 3RR5A 5M5XH 4GN4B 1LTLA 1WJJA 2UXCQ 2NZOA 1XMOL 1JMCA 2JA6H 2NVTH 1VQKA 3I4MH 2XTIA 2JJQA 1HNWL 1X3FA 2K5VA 1OXUA 2CQOA 4GLAC 4HJ5A 4HJ7A 2F4VL 2ALYB 3AFPA 2JE6I 4JI4L 2JA9A 2JEAI 2CWPA 3GDEA 1L1OA 3STBD 2K75A 4POFA 2PQAA 5M3MG 5IYDG 4PMWA 2Z0SA 1VQ9A 2PMZE 4TVAB 1HZBA 1V9PA 2K52A 3MXNB 5GROA 1KHIA 3CCMA 4DV3L 1YJ9A 3EN2A 1VQMA 3FKIG 4DK3C 3K7UC 3BZKA 2HT1A 3I7FA 3L7ZC 3PIOA 3GTLH 1XJVA 5K36G 4K0KQ 1SR3A 3ERSX 3HKSA 4QIWE 1A8VA 4DV7Q 3S1NH 4HIMA 2KCTA 4OWXB 2GN5A 5GADC 4R4CA 2OQKA 2JK8A 1TXYA 5BR8L 4AH6A 2ES2A 1LUZA 2D0PA 5C4JH 4OX9L 4A3CG 3WWVA 4IFDG 4LFBQ 1TWGH 4OWTB 4DV4L 1UEBA 4YWKA 5GAHC 4JBMA 1YHQA 2Y0SE 1IBLL 3TEHB 4A3JG 3KJPA 1VQ4A 3S14H 1V1QA 4YHHL 4A3JH 5HGQA 1Q7YC 4DV7L 1XNRQ 1AE3A 3HKZG 2QA4A 1X65A 1KRSA 5FLMG 3HFZB 1CKNA 5LMNW 1NY4A 4R4IA 1KIXA 4X66L 4MZ9A 1OTCA 2A19A 4GOPB 3H3VH 1TWAH 1E24A 2OTJA 2IX0A 2XGTA 4JI5L 4DKAC 1KC8C 2ASBA 4R4OA 3HOVH 3I56A 4JYAL 5M5WH 2R92G 4HJ9A 2E5LQ 1HR0L 4BBSH 3U4ZA 3D0FA 3PF4A 2GVBA 3ULJA 4O0AA 4IOAA 1IBLQ 3M4OH 3PCOB 4DV6Q 4NB3A 1HZCA 3E9IA 3PF5A 1L2FA 3GTJH 3E9HA 4X62L 4ALPA 1WYDA 3H3VI 3D31A 4A3IH 4JI2L 3PO3G 3PIPA 2MO1A 2VNUD 3LGJA 1PH5A 2WFWA 3J80c 3PO3H 4OO1G 1QVFA 1HNWQ 3CCLA 2VL6A 2JQOA 3U4VA 2WAQG 4Y7NH 2VQFQ 1U5KA 2NVXH 4A93G 1S72A 1SFOH 1Z9FA 3HOYH 3S15H 4DAYB 2YTVA 1HNXQ 1EWIA 4K0KL 1D8LA 2NVYH 2HHHL 4UP7A 4PZ7A 4JCVE 4IFDI 1CKNB 3S1MH 2IT1A 4JYAQ 1MIUA 2K4KA 1NTGA 3EIVA 2CWAA 4JI6Q 1KAWA 2JA8H 2E2HH 4LF8Q 1Q46A 1P16A 4BBRG 1VQLA 3TREA 4A3FH 5C4XG 2UUBQ 3GD7A 3A0JA 1GD7A 1TWCH 4A3FG 1SE8A 2HHHQ 4BY7G 1CSPA 4DR1Q 1YJNA 4X62Q 1U0LA 4DR7L 2E8GA 3MEFA 1I50H 1KD1C 1EQRA 3A74A 4TQUS 3CC7A 1VQOA 4KI0A 2NVQH 2LXJA 1XPOA 1N36L 3STBC 2ZM6Q 1CUKA 4UPAA 4A3EG 2N49A 3NELA 4X64Q 2PNHA 1BBUA 2ZTDA 5IYCG 5M3FH 2A8VA 2EIFA 4X65L 5LMNQ 3M7NA 4AYBG 4YY3L 1JB7A 5IYCH 3GO5A 1XTDA 1K0RA 1YBYA 3KYHC 4P73A 3HKZE 4KHZA 3KF6A 3OYYA 4P71A 4APVA 1PH3A 1SLJA 2VS1A 3PUYA 2B63G 4B3SQ 1N8RC 1GKHA 3AFQA 1PVOA 2VUMH 1SMXA 3HOWG 4KHPL 2B63H 4QJFA 4LWCA 1NMGA 4JI0L 3KOJA 3U58A 4EQ5A 2VUMG 2IHEA 3HOWH 3FKIH 2C35B 1VQNA 1GM5A 1X3GA 1PV4A 4POGA 4DR6Q 1WI5A 1JT8A 4YCUA 1JJGA 3CCVA 1UE5A 1X54A 2AMCB 1N32L 1XMQQ 4DR1L 1VQAA 2VZAA 4UP8A 1JJCB 1KL9A 5LMNL 3UDGA 2UUCL 2UUBL 1XNRL 1HZ9A 1Y14B 4JI4Q 4DAMA 4HIKA 1IBML 1PYSB 4MTNA 3J80i 3GTPH 2DUDA 3AYHB 3EBEA 2CKZB 3TQYA 2HIXA 3HOXH 4L5QA 3CAMA 3PO2H 3S2HH 4DV5L 2UUAQ 1VQHA 1VQ5A 5JEAG 1HNXL 1Q1EA 2UU9Q 1D7QA 1VQGA 4GS3A 5HY6A 3KF8B 1WCMH 1M90C 4OX9Q 5C0XI 3G71A 3KFUA 4JG2A 5M5YH 5IYBG 1YVCA 1CKOA 1PA6A 1B8AA 2R6GA 3G6EA 1W2BA 1M1KC 4A3BG 2YV5A 3CF5A 1E1OA 1RIPA 2VY3A 3PSIA 1XMQL 5JJLA 1FVIA 5JEAJ 3RLNA 1IXRA 2HQLA 3CPWA 4GKKL 3RZDH 4BA1I 1I6HH 3CD6A 1YITA 4BBSG 4JI1Q 4JC0A 5GAGC 5C0XJ 1K8GA 1VQ8A 2OWOA 3NEMA 4DV0L 1IBMQ 4LF7Q 4JI8Q 1G291 3M4PA 3ER0A 4NXNQ 1RL2A 4BBRH 1G51A 5LMUQ 2ZJRA 4YWMA 4XTCS 3PUXA 4A3GH 2VQEL 2PI2A 1Q12A 1QUQB 1K73C 4A3DG 2I0QA 2R7DA 1VQ6A 4A93H 4GOPC 4YWLA 4MNOA 2BA1A 5C0XG 5IT9c 2A1AA 1HR0Q 4X65Q 1TWFH 4DV0Q 1EQQA 4LF7L 4LF4Q 1NE3A 2K50A 2JA6G 1QVCA 4J15A 3I4OA 2ZM6L 2VQEQ 2KHIA 5IE8A 3A5ZB 4L5RC 1V43A 2GVAA 3UE0A 3BZCA 1YJWA 4BA2I 4X66Q 2Q2TA 3KLWA 1PH1A 1VQJA 3I55A 3H0GH 5IP7G 4NXNL 5LMUL 2EQSA 3W1BA 5AJ3L 3J81j 4C3JH 4A4IA 1FGUA 4XIGS 4QL5A 3NENA 4A3KH 3TS2A 3T1HL 4JI1L 1XNQQ 4LUZA 5EAYA 5IY0A 4HIDA 4UP9A 4LF9L 4GNXC 4A3LH 2AWOA 3K81C 4X6AH 2V1CC 1X3EA 3JAMi 1VQIA 2D0OA 3HOZG 4P75A 2EXDA 3S17H 4QY7A 1J6QA 4EX5A 3J81c 1P8LA 2VQFL 3M85A 4GLXA 1QVGA 1QZGA 2BH8A 1OXSC 1N34Q 5BR8Q 1A63A 1Q8KA 4DNIA 4JI6L 3PUZA 2ZJQA 1N33Q 4DR3Q 4IO9A 4AQYL 3NBHB 2I5HA 5AJ3Q 2QEXA 3JAMc 2ZJPA 1LM0A 4R4QA 3ZJYC 1C7YA 2IHFA 4AIMA 4DV5Q 2UUAL 1YI2A 1PH8A 3PO2G 1VQCA 4HJ8A 4GLVB 4PZ8A 2IX1A 3HOUG 4O2DA 1E3PA 2CFMA 3OTOL 1Q82C 4B3ML 3T1HQ 1PH9A 2ATWA 1Y1VH 1I94Q 1S3OA 3CP0A 4C3IH 1H95A 4DV1L 1OXXK 1IZ6A 1YHBA 2WB1E 3S24A 4C3HH 4JI5Q 4H02A 1O7IA 4IPHA 5J3BA 2KBNA 3RLOA 3A5UA 5E7NA 3J81i 4NXML 1I5FA 1NBWA 1UE6A 4DV6L 2R92H 1IYJB 3U50C 3M3YH 2MNAA 3KF6B 1EUJA 1KRTA 3W5OA 1N9WA 1TWHH 1EIYB 4JI8L 2OCEA 3ICEA 4KHPQ 5FJ8G 3HOXG 2E5LL 4LW1A 4JOIC 3CCEA 4P74A 3RNUA 4HJAA 4B3SL 2UXDL 4NPSA 1MJCA 3DLLA 2NN6I 4QQBX 4A3IG 4JV5L 2MQHA 1W3SA 2Q2IA 2VW9A 1VQEA 3CPFA 3AEVA 1GO3E 5C3EG 2F52A 2YTYA 3KDFA 1K3RA 1WCMG 3I2ZA 1IL2A 4LFBL 4FDBA 3F2CA 1S40A 5JJKA 4DV1Q 4DK6C 4L5TA 5IYBH 1VQDA 3T1YL 4LF6Q 4A3CH 1MKHA 4OO1I 4LF8L 2K14A 2AHOB 1UE1A 3UDXA 3OTOQ 2RCNA 2R7ZH 4LFAQ 4OXPA 5DLQE 1E7ZA 2WAQE 2UXDQ 4LUOA 4JBWA 2R7ZG 5GAEC 1X9NA 3RZOH 2LXKA 1E22A 1XPUA 4JI7L 1YHAA 3JC66 2LSSA 4B3TQ 3FHWA 4IJLA 1WFQA 2JA8G 3S1RH 4LF9Q 5FLMH 2NZHA 1LYLA 1B7YB 4QGUA 3Q8DA 1VQFA 5C4XH 4LFCQ 2R7FA 2KHJA 2NN6G 4AYBE 3S1QH 4BY7H 1MJEA 2UXBL 1PH4A 1JE5A 4BY1H 4GNXB 4A3GG 4JBJA 3K8AA 5JJIA 1HH2P 2JA7H 1C9OA 3CC2A 3HOVG 3I4NG 3ULLA 1XMOQ 1FJGQ 2JA7G 1PFSA 3I4NH 5IYDH 2YYZA 2UXCL 1AH9A 1L1OB 2AKWB 1JJ2A 1X55A 1XNQL 1ASZA 4UY8C 3H15A 2N3SA 2IY5B 2R93G 2RHSB 4AQYQ 2CCZA 1CKMA 4JI2Q 3KJOA 1K83H 1KQSA 1CSQA 4PG3A 4Y52H 4LFCL 3CCJA 5IP9H 5IP7H 4IFDJ 5C44H 5IP9G 2WB1G 1VS0A 3ULPA 2L15A 5ELOA 1G6PA 3IRBA 2D62A 1SRUA 3K80C 4A3KG 1PH6A 4C2MH 4B3TL 3CCUA 4LNQA 3HOYG 3UE1A 1EOVA 2FXQA 3G48A 5H1SE 3TRZA 3KDFB 1OXVA 2I5MX 1L0WA 3PGZA 2Q2UA 2Y0SG 3I4MG 2UXBQ 3B6YA 1SROA 3CCSA 3K7AH 1Z47A 4P72A 4BXXH 1KXLA 2MFIA 3UDIA 3E0EA 4NXMQ 3K0XA 4DV4Q 1AE2A 4BXXG 4OWWB 4DV2L 1PH2A 3F1ZA 1OXTA 1J5EQ 4IPCA 4DPGA 2K5HA 3M9BA 1NJIC 1HZAA 2N8NA 4X64L 1B70B 3J7A5 2PI2E 4GNXA 2KCMA 5FLXc 4RG1A 1VQ7A 4GKKQ 3W1GA 3CMAA 1XPRA 1DGSA 2UU9L 4DUZQ 2OQ0A 3T1YQ 4LF6L 1J5EL 5C3EH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T9H A;  2AWN A;  1Q81 C;  1YNX A;  1Y1V G;  4JBK A;  4DR3 L;  1YIJ A;  4DR2 L;  4JV5 Q;  4ME3 A;  4DV3 Q;  1EYG A;  1IBK Q;  1I3Q H;  3GTM H;  1N34 L;  5M3M H;  2OTL A;  5IWA L;  2I5L X;  3M4Q A;  4DUY Q;  3L2P A;  3CCQ A;  2F4V Q;  4DR4 Q;  3GTK H;  1K9M C;  1I94 L;  4LF5 Q;  3FP9 A;  1BBW A;  2ZTC A;  2RF4 A;  4HIO A;  4DR5 L;  1R9T H;  4B3M Q;  4GOP A;  4A3M H;  3PUW A;  1A62 A;  1HJP A;  4RMF A;  4DR6 L;  3GTG H;  3PUV A;  2RHQ B;  4A3M G;  3CME A;  5FJ8 H;  1C0A A;  4R1J A;  1X56 A;  4OON A;  2K5N A;  1ASY A;  2UUC Q;  3BU2 A;  2Z6K A;  3TS0 A;  1E1T A;  3CC4 A;  2BH2 A;  3RN5 A;  1FL0 A;  1N33 L;  5IWA Q;  3RN2 A;  1X6O A;  3F8T A;  1IBK L;  1N32 Q;  3AQQ A;  3GTO H;  1YEZ A;  2Q2H A;  4BY1 G;  1YZ6 A;  1PHJ A;  4DR2 Q;  2BA0 A;  1QZH A;  4JOI A;  4GN3 B;  1FJG L;  1NMF A;  3L0O A;  4YCW A;  2HIV A;  3BJU A;  4DR5 Q;  2H5X A;  4JI3 Q;  4LF4 L;  3SGI A;  4IPG A;  1VQB A;  3RLF A;  4DUZ L;  2YU9 H;  4LF5 L;  4DR4 L;  2B3G A;  2ZTE A;  4YHH Q;  4IOC A;  3VDY A;  4DUY L;  3CQZ H;  4L5S A;  3DM3 A;  2E2I H;  1N36 Q;  3CW2 C;  5GQO A;  3H0G G;  1VCI A;  1L1O C;  1EIF A;  1UWV A;  1HNZ L;  4DR7 Q;  3G4S A;  1PYB A;  2JEB I;  4B3R Q;  2N78 A;  4YY3 Q;  5C44 G;  2E2J H;  1HR0 W;  1EFW A;  4GKJ L;  3F2D A;  2DGY A;  2B29 A;  4R4T A;  4JI7 Q;  5ELN A;  4A3B H;  1QUQ A;  3PV0 A;  4A3L G;  1A0I A;  3UDF A;  4LFA L;  4A76 A;  4WJ3 M;  3HOZ H;  2YTX A;  4JI0 Q;  4JI3 L;  1BKB A;  3J7Z C;  4B3R L;  4WJ4 A;  2JA5 G;  4GKJ Q;  1HNZ Q;  4DV2 Q;  2MO0 A;  2F3I A;  2Z6K C;  2JA5 H;  1GVP A;  4YCV A;  3CXC A;  1Q86 C;  1BVS A;  2R93 H;  2KEN A;  4PZ6 A;  3CCR A;  4A75 A;  3OW2 A;  2WP8 J;  1PH7 A;  4IPD A;  3S16 H;  4GN5 A;  1WOC A;  3GTQ H;  1VQP A;  4LUV A;  1Y1W G;  1SN8 A;  1Q1B A;  1UE7 A;  2QGQ A;  3F2B A;  1K8A C;  4A3D H;  3S2D H;  2ID0 A;  4A3E H;  4KLK A;  1Y1W H;  4IJH A;  2PQA B;  3HOU H;  5M3F G;  3RR5 A;  5M5X H;  4GN4 B;  1LTL A;  1WJJ A;  2UXC Q;  2NZO A;  1XMO L;  1JMC A;  2JA6 H;  2NVT H;  1VQK A;  3I4M H;  2XTI A;  2JJQ A;  1HNW L;  1X3F A;  2K5V A;  1OXU A;  2CQO A;  4GLA C;  4HJ5 A;  4HJ7 A;  2F4V L;  2ALY B;  3AFP A;  2JE6 I;  4JI4 L;  2JA9 A;  2JEA I;  2CWP A;  3GDE A;  1L1O A;  3STB D;  2K75 A;  4POF A;  2PQA A;  5M3M G;  5IYD G;  4PMW A;  2Z0S A;  1VQ9 A;  2PMZ E;  4TVA B;  1HZB A;  1V9P A;  2K52 A;  3MXN B;  5GRO A;  1KHI A;  3CCM A;  4DV3 L;  1YJ9 A;  3EN2 A;  1VQM A;  3FKI G;  4DK3 C;  3K7U C;  3BZK A;  2HT1 A;  3I7F A;  3L7Z C;  3PIO A;  3GTL H;  1XJV A;  5K36 G;  4K0K Q;  1SR3 A;  3ERS X;  3HKS A;  4QIW E;  1A8V A;  4DV7 Q;  3S1N H;  4HIM A;  2KCT A;  4OWX B;  2GN5 A;  5GAD C;  4R4C A;  2OQK A;  2JK8 A;  1TXY A;  5BR8 L;  4AH6 A;  2ES2 A;  1LUZ A;  2D0P A;  5C4J H;  4OX9 L;  4A3C G;  3WWV A;  4IFD G;  4LFB Q;  1TWG H;  4OWT B;  4DV4 L;  1UEB A;  4YWK A;  5GAH C;  4JBM A;  1YHQ A;  2Y0S E;  1IBL L;  3TEH B;  4A3J G;  3KJP A;  1VQ4 A;  3S14 H;  1V1Q A;  4YHH L;  4A3J H;  5HGQ A;  1Q7Y C;  4DV7 L;  1XNR Q;  1AE3 A;  3HKZ G;  2QA4 A;  1X65 A;  1KRS A;  5FLM G;  3HFZ B;  1CKN A;  5LMN W;  1NY4 A;  4R4I A;  1KIX A;  4X66 L;  4MZ9 A;  1OTC A;  2A19 A;  4GOP B;  3H3V H;  1TWA H;  1E24 A;  2OTJ A;  2IX0 A;  2XGT A;  4JI5 L;  4DKA C;  1KC8 C;  2ASB A;  4R4O A;  3HOV H;  3I56 A;  4JYA L;  5M5W H;  2R92 G;  4HJ9 A;  2E5L Q;  1HR0 L;  4BBS H;  3U4Z A;  3D0F A;  3PF4 A;  2GVB A;  3ULJ A;  4O0A A;  4IOA A;  1IBL Q;  3M4O H;  3PCO B;  4DV6 Q;  4NB3 A;  1HZC A;  3E9I A;  3PF5 A;  1L2F A;  3GTJ H;  3E9H A;  4X62 L;  4ALP A;  1WYD A;  3H3V I;  3D31 A;  4A3I H;  4JI2 L;  3PO3 G;  3PIP A;  2MO1 A;  2VNU D;  3LGJ A;  1PH5 A;  2WFW A;  3J80 c;  3PO3 H;  4OO1 G;  1QVF A;  1HNW Q;  3CCL A;  2VL6 A;  2JQO A;  3U4V A;  2WAQ G;  4Y7N H;  2VQF Q;  1U5K A;  2NVX H;  4A93 G;  1S72 A;  1SFO H;  1Z9F A;  3HOY H;  3S15 H;  4DAY B;  2YTV A;  1HNX Q;  1EWI A;  4K0K L;  1D8L A;  2NVY H;  2HHH L;  4UP7 A;  4PZ7 A;  4JCV E;  4IFD I;  1CKN B;  3S1M H;  2IT1 A;  4JYA Q;  1MIU A;  2K4K A;  1NTG A;  3EIV A;  2CWA A;  4JI6 Q;  1KAW A;  2JA8 H;  2E2H H;  4LF8 Q;  1Q46 A;  1P16 A;  4BBR G;  1VQL A;  3TRE A;  4A3F H;  5C4X G;  2UUB Q;  3GD7 A;  3A0J A;  1GD7 A;  1TWC H;  4A3F G;  1SE8 A;  2HHH Q;  4BY7 G;  1CSP A;  4DR1 Q;  1YJN A;  4X62 Q;  1U0L A;  4DR7 L;  2E8G A;  3MEF A;  1I50 H;  1KD1 C;  1EQR A;  3A74 A;  4TQU S;  3CC7 A;  1VQO A;  4KI0 A;  2NVQ H;  2LXJ A;  1XPO A;  1N36 L;  3STB C;  2ZM6 Q;  1CUK A;  4UPA A;  4A3E G;  2N49 A;  3NEL A;  4X64 Q;  2PNH A;  1BBU A;  2ZTD A;  5IYC G;  5M3F H;  2A8V A;  2EIF A;  4X65 L;  5LMN Q;  3M7N A;  4AYB G;  4YY3 L;  1JB7 A;  5IYC H;  3GO5 A;  1XTD A;  1K0R A;  1YBY A;  3KYH C;  4P73 A;  3HKZ E;  4KHZ A;  3KF6 A;  3OYY A;  4P71 A;  4APV A;  1PH3 A;  1SLJ A;  2VS1 A;  3PUY A;  2B63 G;  4B3S Q;  1N8R C;  1GKH A;  3AFQ A;  1PVO A;  2VUM H;  1SMX A;  3HOW G;  4KHP L;  2B63 H;  4QJF A;  4LWC A;  1NMG A;  4JI0 L;  3KOJ A;  3U58 A;  4EQ5 A;  2VUM G;  2IHE A;  3HOW H;  3FKI H;  2C35 B;  1VQN A;  1GM5 A;  1X3G A;  1PV4 A;  4POG A;  4DR6 Q;  1WI5 A;  1JT8 A;  4YCU A;  1JJG A;  3CCV A;  1UE5 A;  1X54 A;  2AMC B;  1N32 L;  1XMQ Q;  4DR1 L;  1VQA A;  2VZA A;  4UP8 A;  1JJC B;  1KL9 A;  5LMN L;  3UDG A;  2UUC L;  2UUB L;  1XNR L;  1HZ9 A;  1Y14 B;  4JI4 Q;  4DAM A;  4HIK A;  1IBM L;  1PYS B;  4MTN A;  3J80 i;  3GTP H;  2DUD A;  3AYH B;  3EBE A;  2CKZ B;  3TQY A;  2HIX A;  3HOX H;  4L5Q A;  3CAM A;  3PO2 H;  3S2H H;  4DV5 L;  2UUA Q;  1VQH A;  1VQ5 A;  5JEA G;  1HNX L;  1Q1E A;  2UU9 Q;  1D7Q A;  1VQG A;  4GS3 A;  5HY6 A;  3KF8 B;  1WCM H;  1M90 C;  4OX9 Q;  5C0X I;  3G71 A;  3KFU A;  4JG2 A;  5M5Y H;  5IYB G;  1YVC A;  1CKO A;  1PA6 A;  1B8A A;  2R6G A;  3G6E A;  1W2B A;  1M1K C;  4A3B G;  2YV5 A;  3CF5 A;  1E1O A;  1RIP A;  2VY3 A;  3PSI A;  1XMQ L;  5JJL A;  1FVI A;  5JEA J;  3RLN A;  1IXR A;  2HQL A;  3CPW A;  4GKK L;  3RZD H;  4BA1 I;  1I6H H;  3CD6 A;  1YIT A;  4BBS G;  4JI1 Q;  4JC0 A;  5GAG C;  5C0X J;  1K8G A;  1VQ8 A;  2OWO A;  3NEM A;  4DV0 L;  1IBM Q;  4LF7 Q;  4JI8 Q;  1G29 1;  3M4P A;  3ER0 A;  4NXN Q;  1RL2 A;  4BBR H;  1G51 A;  5LMU Q;  2ZJR A;  4YWM A;  4XTC S;  3PUX A;  4A3G H;  2VQE L;  2PI2 A;  1Q12 A;  1QUQ B;  1K73 C;  4A3D G;  2I0Q A;  2R7D A;  1VQ6 A;  4A93 H;  4GOP C;  4YWL A;  4MNO A;  2BA1 A;  5C0X G;  5IT9 c;  2A1A A;  1HR0 Q;  4X65 Q;  1TWF H;  4DV0 Q;  1EQQ A;  4LF7 L;  4LF4 Q;  1NE3 A;  2K50 A;  2JA6 G;  1QVC A;  4J15 A;  3I4O A;  2ZM6 L;  2VQE Q;  2KHI A;  5IE8 A;  3A5Z B;  4L5R C;  1V43 A;  2GVA A;  3UE0 A;  3BZC A;  1YJW A;  4BA2 I;  4X66 Q;  2Q2T A;  3KLW A;  1PH1 A;  1VQJ A;  3I55 A;  3H0G H;  5IP7 G;  4NXN L;  5LMU L;  2EQS A;  3W1B A;  5AJ3 L;  3J81 j;  4C3J H;  4A4I A;  1FGU A;  4XIG S;  4QL5 A;  3NEN A;  4A3K H;  3TS2 A;  3T1H L;  4JI1 L;  1XNQ Q;  4LUZ A;  5EAY A;  5IY0 A;  4HID A;  4UP9 A;  4LF9 L;  4GNX C;  4A3L H;  2AWO A;  3K81 C;  4X6A H;  2V1C C;  1X3E A;  3JAM i;  1VQI A;  2D0O A;  3HOZ G;  4P75 A;  2EXD A;  3S17 H;  4QY7 A;  1J6Q A;  4EX5 A;  3J81 c;  1P8L A;  2VQF L;  3M85 A;  4GLX A;  1QVG A;  1QZG A;  2BH8 A;  1OXS C;  1N34 Q;  5BR8 Q;  1A63 A;  1Q8K A;  4DNI A;  4JI6 L;  3PUZ A;  2ZJQ A;  1N33 Q;  4DR3 Q;  4IO9 A;  4AQY L;  3NBH B;  2I5H A;  5AJ3 Q;  2QEX A;  3JAM c;  2ZJP A;  1LM0 A;  4R4Q A;  3ZJY C;  1C7Y A;  2IHF A;  4AIM A;  4DV5 Q;  2UUA L;  1YI2 A;  1PH8 A;  3PO2 G;  1VQC A;  4HJ8 A;  4GLV B;  4PZ8 A;  2IX1 A;  3HOU G;  4O2D A;  1E3P A;  2CFM A;  3OTO L;  1Q82 C;  4B3M L;  3T1H Q;  1PH9 A;  2ATW A;  1Y1V H;  1I94 Q;  1S3O A;  3CP0 A;  4C3I H;  1H95 A;  4DV1 L;  1OXX K;  1IZ6 A;  1YHB A;  2WB1 E;  3S24 A;  4C3H H;  4JI5 Q;  4H02 A;  1O7I A;  4IPH A;  5J3B A;  2KBN A;  3RLO A;  3A5U A;  5E7N A;  3J81 i;  4NXM L;  1I5F A;  1NBW A;  1UE6 A;  4DV6 L;  2R92 H;  1IYJ B;  3U50 C;  3M3Y H;  2MNA A;  3KF6 B;  1EUJ A;  1KRT A;  3W5O A;  1N9W A;  1TWH H;  1EIY B;  4JI8 L;  2OCE A;  3ICE A;  4KHP Q;  5FJ8 G;  3HOX G;  2E5L L;  4LW1 A;  4JOI C;  3CCE A;  4P74 A;  3RNU A;  4HJA A;  4B3S L;  2UXD L;  4NPS A;  1MJC A;  3DLL A;  2NN6 I;  4QQB X;  4A3I G;  4JV5 L;  2MQH A;  1W3S A;  2Q2I A;  2VW9 A;  1VQE A;  3CPF A;  3AEV A;  1GO3 E;  5C3E G;  2F52 A;  2YTY A;  3KDF A;  1K3R A;  1WCM G;  3I2Z A;  1IL2 A;  4LFB L;  4FDB A;  3F2C A;  1S40 A;  5JJK A;  4DV1 Q;  4DK6 C;  4L5T A;  5IYB H;  1VQD A;  3T1Y L;  4LF6 Q;  4A3C H;  1MKH A;  4OO1 I;  4LF8 L;  2K14 A;  2AHO B;  1UE1 A;  3UDX A;  3OTO Q;  2RCN A;  2R7Z H;  4LFA Q;  4OXP A;  5DLQ E;  1E7Z A;  2WAQ E;  2UXD Q;  4LUO A;  4JBW A;  2R7Z G;  5GAE C;  1X9N A;  3RZO H;  2LXK A;  1E22 A;  1XPU A;  4JI7 L;  1YHA A;  3JC6 6;  2LSS A;  4B3T Q;  3FHW A;  4IJL A;  1WFQ A;  2JA8 G;  3S1R H;  4LF9 Q;  5FLM H;  2NZH A;  1LYL A;  1B7Y B;  4QGU A;  3Q8D A;  1VQF A;  5C4X H;  4LFC Q;  2R7F A;  2KHJ A;  2NN6 G;  4AYB E;  3S1Q H;  4BY7 H;  1MJE A;  2UXB L;  1PH4 A;  1JE5 A;  4BY1 H;  4GNX B;  4A3G G;  4JBJ A;  3K8A A;  5JJI A;  1HH2 P;  2JA7 H;  1C9O A;  3CC2 A;  3HOV G;  3I4N G;  3ULL A;  1XMO Q;  1FJG Q;  2JA7 G;  1PFS A;  3I4N H;  5IYD H;  2YYZ A;  2UXC L;  1AH9 A;  1L1O B;  2AKW B;  1JJ2 A;  1X55 A;  1XNQ L;  1ASZ A;  4UY8 C;  3H15 A;  2N3S A;  2IY5 B;  2R93 G;  2RHS B;  4AQY Q;  2CCZ A;  1CKM A;  4JI2 Q;  3KJO A;  1K83 H;  1KQS A;  1CSQ A;  4PG3 A;  4Y52 H;  4LFC L;  3CCJ A;  5IP9 H;  5IP7 H;  4IFD J;  5C44 H;  5IP9 G;  2WB1 G;  1VS0 A;  3ULP A;  2L15 A;  5ELO A;  1G6P A;  3IRB A;  2D62 A;  1SRU A;  3K80 C;  4A3K G;  1PH6 A;  4C2M H;  4B3T L;  3CCU A;  4LNQ A;  3HOY G;  3UE1 A;  1EOV A;  2FXQ A;  3G48 A;  5H1S E;  3TRZ A;  3KDF B;  1OXV A;  2I5M X;  1L0W A;  3PGZ A;  2Q2U A;  2Y0S G;  3I4M G;  2UXB Q;  3B6Y A;  1SRO A;  3CCS A;  3K7A H;  1Z47 A;  4P72 A;  4BXX H;  1KXL A;  2MFI A;  3UDI A;  3E0E A;  4NXM Q;  3K0X A;  4DV4 Q;  1AE2 A;  4BXX G;  4OWW B;  4DV2 L;  1PH2 A;  3F1Z A;  1OXT A;  1J5E Q;  4IPC A;  4DPG A;  2K5H A;  3M9B A;  1NJI C;  1HZA A;  2N8N A;  4X64 L;  1B70 B;  3J7A 5;  2PI2 E;  4GNX A;  2KCM A;  5FLX c;  4RG1 A;  1VQ7 A;  4GKK Q;  3W1G A;  3CMA A;  1XPR A;  1DGS A;  2UU9 L;  4DUZ Q;  2OQ0 A;  3T1Y Q;  4LF6 L;  1J5E L;  5C3E H; 
#chains in the Genus database with same CATH topology
 1F9R A;  2CH4 W;  2XWJ B;  1Q81 C;  1YIJ A;  4JV5 Q;  1EYG A;  2RDF A;  1EY9 A;  1N34 L;  2K32 A;  2OTL A;  1DOK A;  3CCQ A;  3WDN A;  4GZY C;  2IX3 A;  5KYL A;  2A6E D;  1TII D;  3FP9 A;  1R9T H;  2RF4 A;  1HJP A;  3HRZ C;  5D3I B;  4Z9C B;  2JYO A;  3I3C A;  2AUK A;  5CGK A;  3CME A;  1Y8P B;  3OIP A;  2K5N A;  2BH2 A;  3RN5 A;  3MHB A;  2ZT9 C;  1X6O A;  3K7A B;  1N32 Q;  4N9P A;  3GTO H;  2Q2H A;  4BY1 G;  4K8J A;  2KCN A;  3HS0 C;  5IGD A;  5E4W C;  3BJU A;  1Q90 A;  1VQB A;  4LF5 L;  4EVO A;  2B3G A;  2F0N A;  1K8O A;  2SEB D;  3BDC A;  4IUQ A;  1F2Z A;  5FK9 C;  1UWV A;  4HR7 B;  3BDL A;  1PYB A;  3HP3 A;  2N78 A;  1Z6H A;  1W6K A;  3T56 B;  1EFW A;  2PCF B;  3OHX C;  5ELN A;  4XT1 B;  5LL6 X;  1GJX A;  4K2L A;  3UDF A;  5ELB A;  4WJ3 M;  4Q0F A;  3HOZ H;  4KY6 A;  4WFN 3;  1EEI D;  4WJ4 A;  1EIG A;  4GKJ Q;  1SEB D;  2IJ0 A;  1AEX A;  2MO0 A;  2F3I A;  2Z6K C;  1GVP A;  4IUR A;  3OW2 A;  2N88 A;  5D14 A;  4GN5 A;  1UE7 A;  4A3E H;  4KLK A;  3TZD A;  4IJH A;  2VB2 X;  2EDG A;  5M3F G;  1DZ1 A;  2JA6 H;  1O7Y A;  2ENB A;  1VQK A;  1KDC A;  2XTI A;  5IYD H;  2CQO A;  4HJ5 A;  1FR3 A;  3U9O A;  3AFP A;  4C3H G;  4JI4 L;  2JA9 A;  1BCP D;  4PNY A;  3STB D;  2B2V C;  2K75 A;  2PQA A;  1PTO D;  3K7U C;  1SJH D;  3PIO A;  3S1N B;  4HIM A;  1ML0 D;  3SHL A;  2KCT A;  3Q22 A;  4OWX B;  4TSS A;  5EGT A;  3VR6 A;  5GAD C;  3NK9 A;  3P75 A;  3J7Y W;  3PO3 B;  4B9W A;  3VR4 A;  4KHV A;  2D0P A;  2QKI C;  4A3C G;  4RGN A;  1RJT A;  1B1Z A;  1UEB A;  1SMY D;  4A3J G;  3PIP 3;  1JCK B;  1V1Q A;  1Q7Y C;  1XNR Q;  2G5D A;  2R61 A;  1EU3 A;  1VF7 A;  1CKN A;  3D6C A;  4X66 L;  1R4P B;  1TWC B;  2Z9H A;  4XDX A;  1RF2 D;  2OTJ A;  1CK1 A;  2EY1 A;  2XGT A;  4JI5 L;  3HOV H;  4JYA L;  3FPP A;  4HJ9 A;  1HR0 L;  2QF7 A;  3U4Z A;  1WD0 A;  3ULJ A;  1U4L A;  1HZC A;  4PV1 C;  4RAU C;  3H3V I;  3PO3 G;  1Y8N B;  2VNU D;  1JWS D;  1HNW Q;  2VQF Q;  4HMJ A;  1CZW A;  2OXP A;  4ZYS A;  3S15 H;  3X3N A;  4DAY B;  2JA7 B;  4H44 C;  2DNE A;  1SYB A;  1WTW A;  4QUC A;  4UP7 A;  4JYA Q;  3U9S A;  3NQT A;  3EIV A;  2CWA A;  2JA8 H;  2E2H H;  1ENA A;  1LLR D;  3ND9 A;  3BYT B;  5C4X G;  2UUB Q;  3R8B A;  1GD7 A;  2HHH Q;  4BY7 G;  3TP5 A;  5IOC A;  1HTL D;  1I50 H;  4TQU S;  1U9R A;  5KRU A;  1LT5 D;  3RUZ A;  1IYV A;  1GXD C;  4KTA A;  3D4R A;  5C0X H;  1N36 L;  4QCL A;  4UPA A;  3NEL A;  4FF4 A;  1MHW C;  2BDN A;  1BBU A;  5IYC G;  5M3F H;  1HQR D;  1R9T B;  1IHZ A;  1H9J A;  1XTD A;  3KF6 A;  1HA6 A;  2FMC A;  2VS1 A;  2R92 B;  1HTP A;  3AFQ A;  4EQ5 A;  2VUM G;  3CRK C;  3MC0 B;  1QIL A;  2KCC A;  1AW7 A;  1E2W A;  1WI5 A;  4DA2 A;  4E6I A;  4YCU A;  4ME5 A;  1JJG A;  1X54 A;  2AMC B;  1I50 B;  1G2S A;  2NYZ D;  2J0T D;  4A3B B;  2QEJ C;  2O5I C;  3UDG A;  4JI4 Q;  2A6H C;  1KNA A;  1WTX A;  4KN4 C;  2R7Z B;  1E0B A;  1SE3 A;  3AYH B;  3EBE A;  3TQY A;  4CDC C;  3HOX H;  1LT6 D;  1HNX L;  4DAV A;  2UU9 Q;  1K3B C;  4I7A A;  4CBV A;  4OX9 Q;  4N8F A;  3G71 A;  3KFU A;  4JG2 A;  5M5Y H;  1WTV A;  2KVM A;  3NE5 B;  4V0B A;  2YV5 A;  3MXU A;  1E1O A;  2WAC A;  1ET6 A;  1HA5 A;  5I4D A;  3OIQ A;  2A73 B;  2OWO A;  1K8G A;  1LAC A;  4KY7 A;  4OGQ C;  1EZ6 A;  1EY8 A;  2BCO A;  1STB A;  4NXN Q;  5EKI A;  3FDT A;  3TN2 A;  3A56 A;  5D65 A;  2K1B A;  1TS2 A;  1H9R A;  3NHH A;  1K73 C;  3A8J E;  4C2M B;  2R7D A;  4YWL A;  2BA1 A;  3PMF A;  3EQL C;  1NUC A;  4C3I B;  1Y1V B;  1GOZ A;  2BE5 D;  2JA6 G;  4XXE A;  4J15 A;  1BQQ T;  3D4D A;  3I4O A;  1EFI D;  4ZKB B;  2XWB B;  1H9K A;  5I2Y A;  1YJW A;  4BA2 I;  1I4Q A;  3H0G H;  4NXN L;  2EQS A;  3W1B A;  2L11 A;  5IIF A;  5AJ3 L;  4RHR A;  4DK1 A;  1G91 A;  3D3R A;  1FGU A;  4QL5 A;  4A3K H;  3T1H L;  1EEF D;  1O78 A;  1Y69 U;  2A5H A;  2B2U A;  1S5E D;  2ZXP A;  2Q8I B;  1HRJ A;  2AWO A;  4X6A H;  1E2V A;  5EBD A;  2L0C A;  1K8M A;  2D0O A;  4DAP A;  1J6Q A;  2MHV A;  3M85 A;  4GLX A;  5I6W A;  1SDF A;  1N34 Q;  3FVQ A;  1N33 Q;  1CTM A;  5AJ3 Q;  2QEX A;  3OMG A;  3JAM c;  4H0L C;  2IHF A;  4AIM A;  3PO2 B;  5C5M A;  3HOX B;  3P7J A;  1U4P A;  5E3F A;  3GTL B;  1VQC A;  1SNM A;  4PZ8 A;  2Z8L A;  1BCP C;  1Q82 C;  1CA6 A;  4RGT A;  1IZ6 A;  1PTO B;  1VF5 C;  3S24 A;  1LT4 D;  3RLO A;  5JPM C;  4NXM L;  1KDB A;  5IGF A;  1PFB A;  2WII B;  1WTO A;  3M3Y H;  4CJ0 B;  4DFA A;  4NW2 A;  3MEH A;  1TWH H;  2VUM B;  1Q3L A;  3HOX G;  3G6J B;  4JOI C;  4HJA A;  3TBI B;  1MJC A;  4P2C B;  4N9T A;  1K83 B;  3K5L A;  2MQH A;  2VW9 A;  5C3E G;  5C44 B;  1WCM G;  4FDB A;  2VXW A;  5T1I A;  1S40 A;  3V96 A;  3T1Y L;  1GUW A;  4A3C H;  1MKH A;  1UE1 A;  4OIJ A;  5CR3 A;  3OTO Q;  3BG3 A;  4OXP A;  4I65 A;  1D5Z C;  4L8J A;  2RSN A;  4BBS B;  4JBW A;  5GAE C;  1X9N A;  2A6E C;  1ZKO A;  2JA8 G;  3S1R H;  1EWH A;  4ABN A;  2KHJ A;  4A3K B;  2Q8R E;  5KND A;  3VA7 A;  1PH4 A;  3K8A A;  3MWY W;  3I4N G;  2OT2 A;  1XMO Q;  1FJG Q;  2LFN A;  2JA7 G;  2DNC A;  1AH9 A;  2F0V A;  4FYD A;  3OMC A;  2B8F A;  1DOM A;  1O80 A;  3H15 A;  2F0K A;  3J80 E;  1AN8 A;  3AU7 A;  1ESF A;  4Y52 H;  1Z7T A;  3CCJ A;  2F0J A;  4J1M A;  5IP9 G;  4I7Z C;  3ULP A;  1EYA A;  1K0S A;  3K80 C;  4RGO S;  4C1N I;  1EOV A;  2FXQ A;  3Q6S A;  1OXV A;  2I5M X;  2Q2U A;  1SRO A;  3K7A H;  2JN4 A;  4P72 A;  3CRL C;  4BXX H;  2MFI A;  3UDI A;  3TDQ A;  1SFO B;  4BXX G;  3DUZ A;  3T13 A;  2HD3 A;  4DPG A;  1A6X A;  4C3J B;  5K36 H;  2F0U A;  2KCM A;  3HOW B;  4RG1 A;  2V4D A;  4A3D B;  2WKC A;  4RH6 A;  4GKK Q;  4WJW A;  1DGS A;  1CZG A;  1CI3 M;  1T9H A;  2AWN A;  4RCO A;  3WOE A;  3KBG A;  1Y1V G;  4JBK A;  1SXT A;  3GTM H;  1I3Q H;  1CFM A;  2IPK D;  1MSG A;  4V19 0;  2KJX A;  2Z4H A;  4LF5 Q;  4IUN A;  4FXG C;  1BBW A;  2ZTC A;  5HGT A;  1SNP A;  4DR6 L;  3GTG H;  1M4V A;  3PUV A;  3ONA B;  5FLX L;  5M9O A;  1RHP A;  4M1U B;  4ZKC B;  5DEH A;  4OON A;  4WOR A;  1ASY A;  2Z6K A;  1E1T A;  3NTI A;  1FL0 A;  1N33 L;  5IWA Q;  3F8T A;  1IBK L;  3TSS A;  1JIC A;  2EYJ A;  1PMR A;  4DR2 Q;  4JOI A;  5KNB A;  1J9O A;  1NMF A;  3L0O A;  5C3E B;  4JI3 Q;  1QWY A;  4IOC A;  4BY7 B;  4L5S A;  4RCN A;  2A6H D;  5GQO A;  1VCI A;  2L5T A;  4ZUJ A;  4KN7 C;  4KKU A;  1EIF A;  4DR7 Q;  1SNQ A;  3PV0 A;  2RVL A;  3MA2 B;  3Q0A A;  1F2M A;  4KMU C;  4A76 A;  5C5L A;  4FVM A;  4OIK A;  3NP8 A;  4F8M A;  3GTK B;  3P20 A;  5CBE E;  1BKB A;  4PQX A;  2JA5 G;  4OEL B;  3D6W A;  3VYS A;  4QIW B;  2R93 H;  4PZ6 A;  3CCR A;  1PH7 A;  1Q8I A;  2WP8 J;  3DWA A;  1A2T A;  1LTA D;  3S16 H;  2F0F A;  2P5Z X;  3V2T A;  2E76 C;  1Y1W G;  1SN8 A;  2QGQ A;  4A3D H;  4IUP A;  2ID0 A;  3K5M A;  4J8Q A;  2KED A;  2PQA B;  3RR5 A;  1HFG A;  1LTL A;  1WJJ A;  2MUY A;  2MGS A;  3I4M H;  2JJQ A;  1X3F A;  1WTQ A;  4HJ7 A;  4QB4 A;  1L1O A;  2B2Y A;  1VQ9 A;  1T5X D;  2PMZ E;  4TVA B;  1HZB A;  3MXN B;  5GRO A;  1KHI A;  3W2D A;  3GV3 A;  1VQM A;  4IZ8 A;  1I4X A;  2HT1 A;  5K36 G;  2AQ3 B;  4K0K Q;  3ZYY X;  1SR3 A;  4QIW E;  3HKS A;  3SEB A;  1A8V A;  3S1N H;  1U4R A;  1CQV A;  4R4C A;  5BR8 L;  5ELD A;  4ZLT F;  4IUV A;  4QUF A;  4LFB Q;  1TWG H;  4OWT B;  1A3U A;  4DV4 L;  2B2W C;  4IFD H;  4YWK A;  1D5M C;  3N52 A;  2KEE A;  1VQ4 A;  2QIL A;  2DJF C;  2DY8 A;  4JPB W;  1GUS A;  2A69 D;  2EXZ A;  5CV9 A;  1AE3 A;  3HKZ G;  3LWE A;  4PMC A;  1M8A A;  3ITP A;  1EY6 A;  1KIX A;  2IL8 A;  5J39 A;  4MZ9 A;  2EY6 A;  3I4L A;  1WTH A;  3MXG A;  5HUR A;  1E24 A;  2IX0 A;  1KC8 C;  2ASB A;  4R4O A;  3PQI A;  3D0F A;  3NTH A;  4FXK C;  5DAU A;  1QCB D;  1IBL Q;  4KD3 A;  3M4O H;  3PCO B;  4DV6 Q;  2F0L A;  1L2F A;  3H0G B;  4ALP A;  1WYD A;  3D31 A;  4A3I H;  2NUC A;  3EJI A;  2EOT A;  3VR5 A;  4G7O C;  1HUN A;  3PIP A;  4RKB A;  2B2T A;  2MO1 A;  3NUC A;  3LGJ A;  3J80 c;  1C4Q A;  2WAQ G;  4XT3 B;  3WOF A;  5FOB B;  2NVX H;  1G6Z A;  1Y1W B;  1S72 A;  2NTT A;  4DN4 M;  3BVM A;  5C4H A;  1Z9F A;  3HOY H;  3VYR A;  4OEM B;  2YTV A;  1EWI A;  3I91 A;  4IFD I;  4R9W A;  5M3M B;  2QDB A;  1I3Q B;  1PZJ D;  2WIN B;  4JI6 Q;  4CKC A;  4LF8 Q;  1S5D D;  3BS1 A;  1QB5 D;  1TKW B;  3GD7 A;  4DR1 Q;  4DR7 L;  2NVT B;  1U0L A;  3PIO 3;  2NVQ H;  1GHK A;  4XQJ A;  5CV7 A;  3STB C;  3E6Z X;  4A3E G;  1FNW A;  1SMY C;  1V1P B;  1B9M A;  2PNH A;  5KIX A;  1DCZ A;  4X65 L;  2ICE C;  1JB7 A;  4YY3 L;  5EPK A;  1D2B A;  3GO5 A;  1BDO A;  2WKD A;  4KHZ A;  1KLG D;  2F0M A;  1PZI D;  2B63 G;  4B3S Q;  1XX8 A;  2KUM A;  1TWH B;  1SMX A;  4XQN A;  2VUM H;  2B63 H;  4UDU C;  4KHP L;  1NMG A;  5C4X B;  4F7X A;  3KOJ A;  1D6E C;  3U58 A;  2IHE A;  1NCV A;  1TS5 A;  3FKI H;  3ND8 A;  2C35 B;  1VQN A;  1GUN A;  1GM5 A;  3SK8 A;  1CQF A;  4POG A;  4DR6 Q;  3CCV A;  1UE5 A;  5A2Q E;  1B4O A;  4DR1 L;  1KL9 A;  5LMN L;  2UUC L;  2XN9 C;  1DJR D;  1B3Q A;  1FNV A;  1JQY D;  2RQX A;  4MTN A;  5CYU A;  2CKZ B;  3PO2 H;  3EVQ A;  1SBB B;  1QOH A;  4GS3 A;  4C1N K;  4KKS A;  4K8I A;  4ODG A;  1EOT A;  1PA6 A;  2R6G A;  1W2B A;  4CDD C;  1SYF A;  1PZK D;  1XMQ L;  1FVI A;  3SXH A;  3RLN A;  5JEA J;  1LTG D;  2DJG C;  4QMG A;  5I9O A;  1ICF B;  2HCI A;  4ULL A;  4BBS G;  4K6L A;  5GAG C;  1HHV A;  1FD7 D;  2K04 A;  4DV0 L;  1IBM Q;  4LF7 Q;  4JI8 Q;  2AQ2 B;  3Q24 A;  3JAM L;  2GA4 B;  3S9W A;  3I72 A;  5EBC A;  1VDZ A;  4YWM A;  1V1O A;  3PUX A;  1QUQ B;  2NVY B;  1JWU D;  4AYB B;  2F0O A;  3NWS A;  4GOP C;  4MNO A;  5IT9 c;  2A1A A;  2K33 A;  1UUP A;  4LF4 Q;  2E74 C;  2QW7 A;  2ZM6 L;  2EYL A;  2GVA A;  3UE0 A;  2LY7 A;  2Q2T A;  3KLW A;  2LKV A;  1V1P A;  4ZCK A;  1F9Q A;  4CGY B;  1VMP A;  2Y0S B;  4XIG S;  4FF3 A;  1L0Y B;  2EJG C;  3RD4 A;  4UP9 A;  4GNX C;  3LX0 A;  3SK6 A;  5IGG A;  2FJ2 A;  3S17 H;  2YU9 B;  3GTM B;  4QY7 A;  3J81 c;  1B53 A;  1P8L A;  1QZG A;  3IFD A;  4XQQ A;  2F1M A;  2ZJQ A;  3A8I E;  4AQY L;  2K5Q A;  1EIH A;  1HCZ A;  1C7Y A;  4DV5 Q;  3DXJ C;  2UUA L;  3FEW X;  5CV6 A;  5T1G A;  2K5D A;  3GTJ B;  1NSN S;  3E3X A;  5C3W A;  3HOU G;  1PRT C;  3T1H Q;  4DNT B;  1RTO A;  5G3L F;  1TWF B;  3CP0 A;  4FNF A;  4G7Z C;  4DV1 L;  1OXX K;  3FKI B;  1KAB A;  2NWG A;  2WB1 E;  1II3 A;  4C3H H;  4IPH A;  3Q23 A;  1EY4 A;  5E7N A;  3J81 i;  4HSP A;  2R92 H;  2B39 A;  1IYJ B;  2MNA A;  1EUJ A;  2F0E A;  1AP0 A;  4X3U A;  1N9W A;  1ET9 A;  5FJ8 G;  4LW1 A;  3CCE A;  1I4P A;  3RNU A;  3DLL A;  2BOS A;  1LTT D;  1W3S A;  1VQE A;  3CPF A;  1AZQ A;  3AEV A;  3KDF A;  3FRP B;  4LFB L;  1TU2 B;  5DNF A;  5JJK A;  4DV1 Q;  5IYB H;  4L5T A;  1LTB D;  1VQD A;  1ILQ A;  2K14 A;  1GUT A;  5AFW A;  2RCN A;  2R7Z H;  2N55 A;  4LFA Q;  1E7Z A;  2UXD Q;  3UI2 A;  2NZ1 D;  1SJE D;  5EQ0 A;  3D4W A;  1E22 A;  2QDL A;  4HCE A;  4JI7 L;  2X6L A;  1YHA A;  5FO8 B;  1XPU A;  3TZU A;  4B3T Q;  2RKS A;  2NZH A;  3A8K E;  1CHQ D;  2D9U A;  2F0W A;  5EKL A;  1AZP A;  4JBJ A;  4L63 B;  2JA7 H;  3CC2 A;  3S15 B;  3HOV G;  2F3V A;  3I4N H;  3I4M B;  2UXC L;  1L1O B;  4UY8 C;  1BUV T;  1I4R A;  1JOK A;  5JAV A;  2IY5 B;  2R93 G;  3CKI B;  5A2Q L;  2C9O A;  4JI2 Q;  4CDE C;  4LFC L;  5IP9 H;  3I90 A;  4FF2 A;  2EYH A;  3CU7 A;  5EPL A;  1G6P A;  3OPO A;  5ELO A;  5BN4 A;  3IRB A;  4A3K G;  4L6T B;  2RSO A;  4C2M H;  3T16 A;  4LNQ A;  3HOY G;  3UE1 A;  5COR A;  2PZW A;  5H1S E;  3AB9 A;  3I4M G;  1KTK A;  3M4Y A;  1LO5 D;  3MFG A;  1PLF A;  4EQO A;  2CW0 C;  4KY5 A;  1A3T A;  4Q5V A;  2B2T C;  3DM1 A;  4OWW B;  1PH2 A;  1OXT A;  1J5E Q;  4IPC A;  2K5H A;  4DAY A;  3M9B A;  1A3V A;  2N8N A;  3KLS A;  3DEP A;  1VMC A;  2A69 C;  5FLX c;  3OWF A;  1EY5 A;  2ICI A;  2UU9 L;  4DUZ Q;  3T1Y Q;  5ELC A;  4G57 A;  1J5E L;  3T53 B;  1H9M A;  1RTN A;  1YNX A;  4LK1 C;  4DR3 L;  2EJF C;  3IKJ A;  1O7L A;  5COY A;  4ME3 A;  4DV3 Q;  1IBK Q;  1QNK A;  3EFX D;  1WTP A;  2I5L X;  4DUY Q;  1XTC D;  2F4V Q;  1I94 L;  2IWH A;  4DNR B;  1OO9 B;  1TVX A;  3K0Y A;  3DWQ A;  3PUW A;  1A62 A;  4N8X 1;  4RMF A;  3KBX A;  4DU9 A;  2IW3 A;  2RHQ B;  4A3M G;  2MP1 A;  1PRT F;  4R1J A;  1X56 A;  2KOL A;  1HUM A;  2UUC Q;  3TS0 A;  2M9V A;  3RN2 A;  3AQQ A;  1YZ6 A;  2EVB A;  3QJY A;  1PHJ A;  1DD2 A;  1QZH A;  5L37 A;  3NTK A;  4GN3 B;  1HFN A;  4RWS C;  5KYI A;  1DON A;  4DR5 Q;  2H5X A;  3DHQ A;  3RLF A;  4DUZ L;  2YU9 H;  4DR4 L;  2ZTE A;  3VDY A;  1IKL A;  3CQZ H;  3DM3 A;  1N36 Q;  4JW0 A;  5J1Z A;  3H0G G;  3DWP A;  4BBR B;  1L1O C;  1HNZ L;  3M7G A;  4DF7 A;  3KLR A;  4B9X A;  1SAP A;  2JEB I;  4B3R Q;  4YY3 Q;  5C44 G;  3L9A X;  3ERQ A;  1HR0 W;  4GKJ L;  3F2D A;  2DGY A;  2B29 A;  4JI7 Q;  4A3B H;  4OHJ A;  3SK5 A;  1C48 A;  3URY A;  3QG1 A;  4LFA L;  2PMZ B;  3VA5 A;  2YTX A;  4JI0 Q;  2F3W A;  3J7Z C;  3KF8 A;  4DV2 Q;  2PQE A;  2JA5 H;  3J7A V;  4YCV A;  1BVS A;  4ZRZ A;  4A75 A;  2L12 A;  1F77 A;  1PYW D;  2EE1 A;  2XNA C;  1BF4 A;  5M5Y B;  5TSS A;  1BXT A;  4LUV A;  1VQP A;  1Q1B A;  1Y1W H;  2CH4 A;  1F2L A;  3HOU H;  4F87 A;  4GN4 B;  2UXC Q;  2NZO A;  1XMO L;  2F0T A;  3H91 A;  1LTI D;  1TS3 A;  2K5V A;  2F4V L;  1F2Y A;  1JWM D;  1TR5 A;  3H94 A;  3GDE A;  1BO0 A;  2BE5 C;  1X32 A;  2Z0S A;  3C1E A;  2F0Q A;  2K52 A;  3FMC A;  4DV3 L;  3CCM A;  1YJ9 A;  1JE4 A;  4NDX A;  1D1I A;  4DK3 C;  3BZK A;  3L7Z C;  3R2I A;  3AMU A;  4DXG A;  3ERS X;  4A93 B;  1TWA B;  2G9H D;  2VB3 X;  4EGV A;  5ELE A;  1QG7 A;  2GN5 A;  4HCS A;  2CHB D;  1CA5 A;  4R8N A;  1LUZ A;  5C4J H;  1EQV A;  4OX9 L;  3GV6 A;  3WWV A;  1EWC A;  2JXM B;  3W3A A;  5D3D A;  1TWG B;  1S4Z A;  4FXD A;  3SE0 A;  1EZ8 A;  4RGM A;  1JOO A;  2Y0S E;  1YHQ A;  3L3O C;  3TEH B;  1ZXT A;  1LT3 D;  3KJP A;  4YHH L;  4A3J H;  1X65 A;  5FLM G;  1BCP F;  1E2Z A;  4R4I A;  5CMD A;  4XYQ A;  1V8Q A;  2FMM A;  1OTC A;  3LNN A;  2JP1 A;  3NBI A;  5CV5 A;  1TWA H;  3SVM A;  3H3V H;  4DKA C;  2NB0 A;  5M5W H;  2R92 G;  2E5L Q;  4BBS H;  1PRT D;  4MN3 A;  3PF4 A;  2OEO A;  4O0A A;  4KD4 A;  3GTG B;  4NB3 A;  1MI2 A;  3K59 A;  4JK1 C;  3MFY A;  4IUU A;  1KLU D;  3V05 A;  5KEE A;  5M3F B;  2B63 B;  1PH5 A;  2RDG A;  3CCL A;  1CM9 A;  2VL6 A;  3U4V A;  4A93 G;  2R3Z A;  1MGS A;  1SFO H;  4X3K A;  4TKO B;  1STN A;  2LMC B;  1HNX Q;  1IW7 C;  2K01 A;  3S17 B;  2HHH L;  1CKN B;  2HDL A;  2K4K A;  1SYG A;  1NTG A;  1TQO A;  2F0H A;  2EJM A;  1B9N A;  1VQL A;  2E2I B;  2Z4I A;  1STH A;  4A3F H;  3KUP A;  5F2D A;  1TWC H;  4QF4 A;  2SDF A;  1SE8 A;  1RCV D;  4A3F G;  1B3A A;  4X62 Q;  2E8G A;  3MEF A;  5BN5 A;  1KD1 C;  1VQO A;  3TP6 A;  2OF1 A;  2ZM6 Q;  3O13 A;  3QOJ A;  2N49 A;  1I6V C;  4X64 Q;  2A8V A;  3JAM E;  2EIF A;  5LMN Q;  4AYB G;  4CHT B;  3KYH C;  1IW7 D;  3OYY A;  1PH3 A;  3PUY A;  1GKH A;  4RA8 A;  2J4X A;  1PVO A;  3HOW G;  2Q8T A;  5IGB A;  4QJF A;  4LWC A;  4JI0 L;  4BY1 B;  3T51 B;  5KGU A;  1X3G A;  1PV4 A;  4RHS A;  2KA7 A;  4CKE A;  2O2L D;  3MAQ A;  2FIN B;  3K6O A;  3J80 L;  2K28 A;  3BVZ A;  1XMQ Q;  3IL8 A;  1EY0 A;  1NR4 A;  1VQA A;  2UUB L;  1JJC B;  1XNR L;  1HZ9 A;  4HIK A;  1PYS B;  5FO7 B;  3J80 i;  2QCP X;  2E75 C;  1STE A;  4X3T A;  1IKM A;  1VQ5 A;  2F0S A;  2NBF A;  4KKT A;  1Q1E A;  1D7Q A;  2AUJ D;  5HY6 A;  3KF8 B;  1WCM H;  3H6M A;  1M90 C;  5C0X I;  5KNC A;  1I4G A;  1CKO A;  4Y7N B;  1SE4 A;  1QJO A;  1B8A A;  3G6E A;  3GTO B;  1RIP A;  2VY3 A;  3PSI A;  3I4N B;  5JJL A;  5IGE A;  5JOB A;  1IXR A;  4GKK L;  1PXU A;  3NPP A;  4BA1 I;  1I6H H;  1YIT A;  4JI1 Q;  1VQ8 A;  2DN8 A;  3S14 B;  3D8G A;  4BWG B;  4R8I A;  1XWE A;  2AQ1 B;  3ER0 A;  2CQA A;  1QE6 A;  1G51 A;  2NN6 H;  2VQE L;  2PI2 A;  1Q12 A;  3J81 L;  4OO1 H;  2I0Q A;  5IOD A;  4A93 H;  2ZXO A;  5C6A A;  1D1K A;  5C0X G;  3RMH A;  4X65 Q;  1TWF H;  4DV0 Q;  1EQQ A;  4LF7 L;  1NE3 A;  1QVC A;  1STG A;  1ZYR D;  2PYK A;  5J22 A;  2F0P A;  2KHI A;  5IE8 A;  3A5Z B;  2VQE Q;  3BZC A;  2B2Y C;  4ID6 A;  1VQJ A;  3R2T A;  3I55 A;  5LMU L;  2HQE A;  3J81 j;  4A4I A;  4H13 C;  3ERO A;  3TS2 A;  4JI1 L;  1R4Q B;  5C4J B;  4LUZ A;  4HN7 A;  1G8Z D;  5EAY A;  4HID A;  1A2U A;  3K81 C;  5IT9 L;  2V1C C;  5JPN C;  3HOZ G;  2K5W A;  5IGC A;  4EX5 A;  2KHS A;  2VQF L;  1QVG A;  3S1M B;  1OXS C;  5BR8 Q;  1A63 A;  1Q8K A;  3PUZ A;  4DR3 Q;  4IO9 A;  1EU4 A;  3NBH B;  2ZJP A;  1LM0 A;  4ILW A;  4R4Q A;  1B2T A;  4U68 A;  3S2H B;  1YI2 A;  3NBH A;  1PH8 A;  3PO2 G;  4HJ8 A;  4GLV B;  2B2U C;  5JEA H;  2CFM A;  3OTO L;  4B3M L;  1Y1V H;  5E4X A;  3OSO A;  1FGB D;  1JOQ A;  2FFK B;  4K5W A;  5E1F A;  3GTQ B;  3TP7 A;  3G7L A;  2KBN A;  1SSO A;  1SE2 A;  4LJZ C;  2PZT A;  1NBW A;  1UE6 A;  3U50 C;  1YNJ D;  2FHT A;  3W5O A;  2OCE A;  3ICE A;  2E5L L;  3K5O A;  4KJN A;  2UXD L;  4P74 A;  4QQB X;  4JV5 L;  3HOY B;  1GO3 E;  1PFN A;  1ICW A;  3BZD B;  3I2Z A;  3F2C A;  1EY7 A;  1Y8O B;  2M00 A;  4DK6 C;  1LV9 A;  4LF6 Q;  4CDF C;  4OO1 I;  2SNM A;  4LF8 L;  3I70 A;  2MPM A;  3UDX A;  2PPB C;  3C46 A;  5DLQ E;  2WAQ E;  3K5N A;  5ELF A;  3LWU A;  1GHJ A;  2X69 A;  4LUO A;  3M4O B;  3JC6 6;  4KK7 A;  2HCC A;  3FHW A;  4IJL A;  1WFQ A;  4LF9 Q;  1JB3 A;  1AFP A;  1LYL A;  1B7Y B;  1JR0 D;  1VQF A;  4C3J G;  2R7F A;  1CT1 D;  4BY7 H;  4K5X A;  1MJE A;  2UXB L;  1PRT B;  1JE5 A;  4BY1 H;  5JJI A;  1HH2 P;  1C9O A;  1BR9 A;  3HEJ A;  1WD1 A;  1GUG A;  1PFS A;  2L1B A;  3H09 A;  2YYZ A;  3F2U A;  2AKW B;  2O4X A;  3RZD B;  1X55 A;  1PFM A;  1ASZ A;  1RKN A;  2K05 A;  4AQY Q;  2CCZ A;  1K83 H;  4O42 A;  1KQS A;  4PG3 A;  4U67 3;  5IP7 H;  4IFD J;  1YNJ C;  4A3G B;  2L15 A;  5FKA C;  3H3V C;  1EYC A;  3CCU A;  3X3M A;  3KDF B;  2WV6 D;  3QIA A;  2Y0S G;  3EA6 A;  3B6Y A;  4O1N A;  1J8I A;  1KXL A;  3E0E A;  1HXY D;  3K0X A;  3E5S A;  4DV4 Q;  1AE2 A;  2G9D A;  4DV2 L;  3F1Z A;  1MBY A;  1HZA A;  3J7A 5;  1B70 B;  2PI2 E;  2JA8 B;  3QOL A;  4XYO A;  3W1G A;  4ZK9 B;  3CMA A;  2EZV A;  5M5X B;  3HOU B;  4LAA A;  3TP8 A;  4HED A;  4OL7 A;  5C3E H;  5CC4 A;  4DR2 L;  1HQM C;  2L55 A;  5M3M H;  1DYQ A;  5IWA L;  3M4Q A;  2DY7 A;  2LS0 1;  3L2P A;  4F88 A;  4M8A A;  3GTK H;  1K9M C;  4DR4 Q;  4DR5 L;  4HIO A;  4B3M Q;  4GOP A;  4A3M H;  3VR2 A;  2KEC A;  2Z6B A;  4UAI A;  1ROD A;  5FJ8 H;  1C0A A;  2SNS A;  2B2W A;  2PW5 A;  1BCP B;  3BU2 A;  4DK0 A;  1ZYR C;  3OOC A;  3CC4 A;  3DMU A;  2B8G A;  1YEZ A;  2F4I A;  2BA0 A;  2EY2 A;  1XXG A;  2R93 B;  5BN3 A;  1FJG L;  4YCW A;  2HIV A;  4LF4 L;  4TRD A;  3S16 B;  3SGI A;  4IPG A;  5EJW A;  4YHH Q;  1BBX C;  4DUY L;  2PW7 A;  2O5J C;  1BNZ A;  2E2I H;  2EYF A;  2ZXR A;  3CW2 C;  1FNU A;  3HG9 A;  5I9P A;  2X6G A;  3GTP B;  3I8Z A;  1ONL A;  3G4S A;  2E2J H;  1D5X C;  2TSS A;  1KDA A;  3A55 A;  4R4T A;  4A3I B;  1QUQ A;  5DM6 3;  3VYT A;  3QWN A;  1A0I A;  1MSH A;  4A3L G;  4WRD A;  2RA4 A;  4JI3 L;  4B3R L;  4CJ1 B;  1ZEQ X;  2RCF A;  1HNZ Q;  3C1F A;  3CXC A;  1Q86 C;  1PTO F;  3K57 A;  2KEN A;  4IPD A;  1NAP A;  4A3J B;  1WOC A;  3GTQ H;  3QO2 A;  3R93 A;  3F2B A;  1K8A C;  3S2D H;  3HGB A;  5M5X H;  2JA6 B;  4PMB A;  1JMC A;  2NVT H;  1I4H A;  4C3I G;  1HNW L;  5LHY 1;  1OXU A;  4GLA C;  2JEA I;  1ESR A;  2ALY B;  2JE6 I;  4H7B A;  3VR3 A;  2CWP A;  5M3M G;  4POF A;  5IYD G;  5M5W B;  3NSW A;  4PMW A;  1V9P A;  1H9S B;  3P1H A;  2L9H A;  4A3F B;  3EN2 A;  1S5C D;  3FKI G;  4UHV A;  3I7F A;  3GTL H;  1XJV A;  1HPC A;  2CVR A;  3S1R B;  1EL0 A;  4DV7 Q;  5I2X A;  3SR1 A;  3MTS A;  2XRS D;  2Z1C A;  1A15 A;  2JK8 A;  1TXY A;  2OQK A;  4AH6 A;  4HAE A;  1TY2 A;  2ES2 A;  1KNE A;  1BOS A;  1SYD A;  2NVX B;  4IFD G;  4JVZ A;  2E2D C;  5GAH C;  2J7Z A;  4JBM A;  2I07 B;  1IBL L;  1UAP A;  1TY0 A;  3S14 H;  5HGQ A;  5FLX E;  4DV7 L;  2QA4 A;  4A3E B;  1KRS A;  3HFZ B;  3A54 A;  2EYO A;  5LMN W;  1NY4 A;  3A7L A;  4C56 C;  2A19 A;  4GOP B;  1T5E A;  1B50 A;  3I73 A;  5K5P A;  1JOR A;  1X3P A;  3I56 A;  1SNO A;  3QR8 A;  2A74 C;  2GVB A;  4IOA A;  1G2T A;  4ZQ3 A;  3E9I A;  3PF5 A;  3GTJ H;  3E9H A;  4X62 L;  4JI2 L;  2XIW A;  2C5C A;  4K6D A;  4NKL A;  4OO1 G;  2WFW A;  2WAQ B;  3PO3 H;  1QVF A;  2SOB A;  2JQO A;  4Y7N H;  1U5K A;  3S2D B;  4K0K L;  1D8L A;  2E2J B;  2NVY H;  4PZ7 A;  1LTS D;  4JCV E;  5I6Y A;  3S1M H;  2IT1 A;  1MIU A;  2E2H B;  2RDH A;  1KAW A;  1Q46 A;  1P16 A;  2EPB A;  4BBR G;  3TRE A;  3E0J A;  2A68 C;  3A0J A;  5G3L D;  5JVG 3;  4S3S A;  1CSP A;  1YJN A;  1SND A;  3OWE B;  1EQR A;  3A74 A;  3CC7 A;  3MXN A;  3MXP A;  4KI0 A;  2LXJ A;  1XPO A;  1CUK A;  2ZTD A;  2XRQ D;  3M7N A;  3NQI A;  1KAA A;  5IYC H;  1W6J A;  1K0R A;  1YBY A;  1WVL A;  4P73 A;  3HKZ E;  2JA5 B;  1MD2 D;  4P71 A;  4APV A;  4CJ2 C;  1SLJ A;  1UEA B;  1N8R C;  2BDO A;  2JSO A;  5C3X A;  1PTO C;  3KLS X;  1FYC A;  1ILP A;  3HOW H;  4FP5 D;  4RKL A;  3A7A B;  1JT8 A;  1IYU A;  1N32 L;  5CV8 A;  1UNS A;  2VZA A;  4MTK A;  4UP8 A;  2K6A A;  1F9S A;  1Y14 B;  4DAM A;  5EKK A;  5LL6 S;  1IBM L;  1STY A;  1H9S A;  3GTP H;  2DUD A;  4HSV A;  3GQB A;  2HIX A;  2WB1 B;  4L5Q A;  4J6H A;  3CAM A;  3S2H H;  5JVH 3;  4DV5 L;  2UUA Q;  2PZU A;  1VQH A;  5JEA G;  1VQG A;  3T4A C;  4G4K A;  1WCM B;  1K28 A;  4DGZ A;  5IYB G;  1YVC A;  4MIU A;  3NWT A;  3QB3 A;  4ZAI A;  3C2P A;  1M1K C;  4A3B G;  3CF5 A;  3CPW A;  2HQL A;  3J7A F;  3RZD H;  3CD6 A;  4JC0 A;  5C0X J;  3NEM A;  4RFB A;  1G29 1;  3M4P A;  2F0D A;  1RL2 A;  4BBR H;  1NNX A;  2KQ3 A;  4LMQ D;  2ZJR A;  5LMU Q;  1C8C A;  4XTC S;  4A3G H;  1GUO A;  1EQT A;  4K2K A;  2F0I A;  4K14 A;  3NXW A;  4A3D G;  5A35 A;  1ENF A;  1VQ6 A;  2L4N A;  1JC7 A;  4B08 A;  1HR0 Q;  2K03 A;  3HOV B;  2EY5 A;  1DXM A;  2K50 A;  3RZO B;  3KK7 A;  4KJO A;  4L5R C;  1V43 A;  3TME A;  3VYU A;  3IAY A;  1YNN C;  2H4O A;  4X66 Q;  4CKB A;  1PH1 A;  2XSC A;  5IP7 G;  4C3J H;  1XYI A;  3NEN A;  1XNQ Q;  1X3Q A;  1DM0 B;  3FPU B;  5IY0 A;  4LF9 L;  4A3L H;  1NR2 A;  3HKZ B;  1X3E A;  2CW0 D;  4EQP A;  5FO9 B;  1TS4 A;  3JAM i;  1VQI A;  4P75 A;  2EXD A;  2MJ8 A;  2BH8 A;  2TMP A;  4DNI A;  4JI6 L;  3OW7 A;  2I5H A;  1PDQ A;  3ZJY C;  3BYY B;  4NMZ A;  3HOZ B;  5CV4 A;  2IX1 A;  5C4Z A;  4X3S A;  4O2D A;  1E3P A;  2ATW A;  4IQZ A;  1PH9 A;  3MVV A;  4G7H C;  1I94 Q;  1S3O A;  4C3I H;  3HZX A;  1H95 A;  4KV6 A;  1YHB A;  4JI5 Q;  4H02 A;  1O7I A;  2EYP A;  1S5B D;  5J3B A;  3A5U A;  1S5F D;  2I46 A;  1LAB A;  1I5F A;  2PO4 A;  1QNU A;  4DV6 L;  3MZ5 A;  4NP5 A;  3M3Y B;  2HUG A;  2NTS A;  4YIJ A;  3KF6 B;  1KRT A;  1EIY B;  5IT9 E;  4JI8 L;  4BS9 A;  4KHP Q;  4B3S L;  1EYD A;  3CHB D;  4NPS A;  2NN6 I;  2K7V A;  4A3I G;  1RDP D;  1IL8 A;  4EQN A;  4FO2 A;  2Q2I A;  4IAL A;  3C3L A;  2F52 A;  2YTY A;  1K3R A;  1IL2 A;  1TT2 A;  1F9P A;  2NVQ B;  1WTR A;  1L0X B;  1U4M A;  2AHO B;  2D2C C;  4IN3 A;  3R3O A;  2A68 D;  4MHE A;  2F0G A;  2R7Z G;  3SK4 A;  3RZO H;  2LXK A;  2LSS A;  4A3M B;  5FLM H;  4QGU A;  3Q8D A;  2D5D A;  1DOL A;  3BDO A;  5C4X H;  4LFC Q;  2NN6 G;  4AYB E;  3S1Q H;  4K5V A;  1LTR D;  4C3H B;  4GNX B;  2XVS A;  4A3G G;  3K58 A;  4IUT A;  3SDZ A;  3ULL A;  3IFT A;  2H1E A;  3DEO A;  2RBM A;  5EPJ A;  2HDM A;  1JJ2 A;  2F03 A;  1I6H B;  1XNQ L;  3N6R A;  1SYC A;  2N3S A;  1CHP D;  2RHS B;  1CKM A;  5JJZ A;  5NUC A;  4DXF A;  3KJO A;  1CSQ A;  3GP7 A;  5C44 H;  2B2V A;  2WB1 G;  1VS0 A;  4FF1 A;  3BVG A;  2PNR C;  2D62 A;  1SRU A;  3J81 E;  1PH6 A;  4B3T L;  1O7Z A;  3G48 A;  3TRZ A;  1B44 D;  2UXB Q;  1L0W A;  3S1Q B;  3PGZ A;  1RD9 D;  3CCS A;  4ZUI A;  1Z47 A;  1PTO H;  4NXM Q;  5DM7 3;  1STA A;  4HTH A;  1NJI C;  4X64 L;  5ISR A;  5CBA E;  1ENC A;  4GNX A;  2M2L A;  1VQ7 A;  3CQZ B;  4HMI A;  1XPR A;  1YNN D;  2OQ0 A;  1SNC A;  4LF6 L;  1SYE A;  2EYM A; 
#chains in the Genus database with same CATH homology
 1T9H A;  2AWN A;  1Q81 C;  1YNX A;  1Y1V G;  4JBK A;  4DR3 L;  1YIJ A;  4DR2 L;  4JV5 Q;  4ME3 A;  4DV3 Q;  1EYG A;  1IBK Q;  1I3Q H;  3GTM H;  1N34 L;  5M3M H;  2OTL A;  5IWA L;  2I5L X;  3M4Q A;  4DUY Q;  3L2P A;  3CCQ A;  2F4V Q;  4DR4 Q;  3GTK H;  1K9M C;  1I94 L;  4LF5 Q;  3FP9 A;  1BBW A;  2ZTC A;  2RF4 A;  4HIO A;  4DR5 L;  1R9T H;  4B3M Q;  4GOP A;  4A3M H;  3PUW A;  1A62 A;  1HJP A;  4RMF A;  4DR6 L;  3GTG H;  3PUV A;  2RHQ B;  4A3M G;  3CME A;  5FJ8 H;  1C0A A;  4R1J A;  1X56 A;  4OON A;  2K5N A;  1ASY A;  2UUC Q;  3BU2 A;  2Z6K A;  3TS0 A;  1E1T A;  3CC4 A;  2BH2 A;  3RN5 A;  1FL0 A;  1N33 L;  5IWA Q;  3RN2 A;  1X6O A;  3F8T A;  1IBK L;  1N32 Q;  3AQQ A;  3GTO H;  1YEZ A;  2Q2H A;  4BY1 G;  1YZ6 A;  1PHJ A;  4DR2 Q;  2BA0 A;  1QZH A;  4JOI A;  4GN3 B;  1FJG L;  1NMF A;  3L0O A;  4YCW A;  2HIV A;  3BJU A;  4DR5 Q;  2H5X A;  4JI3 Q;  4LF4 L;  3SGI A;  4IPG A;  1VQB A;  3RLF A;  4DUZ L;  2YU9 H;  4LF5 L;  4DR4 L;  2B3G A;  2ZTE A;  4YHH Q;  4IOC A;  3VDY A;  4DUY L;  3CQZ H;  4L5S A;  3DM3 A;  2E2I H;  1N36 Q;  3CW2 C;  5GQO A;  3H0G G;  1VCI A;  1L1O C;  1EIF A;  1UWV A;  1HNZ L;  4DR7 Q;  3G4S A;  1PYB A;  2JEB I;  4B3R Q;  2N78 A;  4YY3 Q;  5C44 G;  2E2J H;  1HR0 W;  1EFW A;  4GKJ L;  3F2D A;  2DGY A;  2B29 A;  4R4T A;  4JI7 Q;  5ELN A;  4A3B H;  1QUQ A;  3PV0 A;  4A3L G;  1A0I A;  3UDF A;  4LFA L;  4A76 A;  4WJ3 M;  3HOZ H;  2YTX A;  4JI0 Q;  4JI3 L;  1BKB A;  3J7Z C;  4B3R L;  4WJ4 A;  2JA5 G;  4GKJ Q;  1HNZ Q;  4DV2 Q;  2MO0 A;  2F3I A;  2Z6K C;  2JA5 H;  1GVP A;  4YCV A;  3CXC A;  1Q86 C;  1BVS A;  2R93 H;  2KEN A;  4PZ6 A;  3CCR A;  4A75 A;  3OW2 A;  2WP8 J;  1PH7 A;  4IPD A;  3S16 H;  4GN5 A;  1WOC A;  3GTQ H;  1VQP A;  4LUV A;  1Y1W G;  1SN8 A;  1Q1B A;  1UE7 A;  2QGQ A;  3F2B A;  1K8A C;  4A3D H;  3S2D H;  2ID0 A;  4A3E H;  4KLK A;  1Y1W H;  4IJH A;  2PQA B;  3HOU H;  5M3F G;  3RR5 A;  5M5X H;  4GN4 B;  1LTL A;  1WJJ A;  2UXC Q;  2NZO A;  1XMO L;  1JMC A;  2JA6 H;  2NVT H;  1VQK A;  3I4M H;  2XTI A;  2JJQ A;  1HNW L;  1X3F A;  2K5V A;  1OXU A;  2CQO A;  4GLA C;  4HJ5 A;  4HJ7 A;  2F4V L;  2ALY B;  3AFP A;  2JE6 I;  4JI4 L;  2JA9 A;  2JEA I;  2CWP A;  3GDE A;  1L1O A;  3STB D;  2K75 A;  4POF A;  2PQA A;  5M3M G;  5IYD G;  4PMW A;  2Z0S A;  1VQ9 A;  2PMZ E;  4TVA B;  1HZB A;  1V9P A;  2K52 A;  3MXN B;  5GRO A;  1KHI A;  3CCM A;  4DV3 L;  1YJ9 A;  3EN2 A;  1VQM A;  3FKI G;  4DK3 C;  3K7U C;  3BZK A;  2HT1 A;  3I7F A;  3L7Z C;  3PIO A;  3GTL H;  1XJV A;  5K36 G;  4K0K Q;  1SR3 A;  3ERS X;  3HKS A;  4QIW E;  1A8V A;  4DV7 Q;  3S1N H;  4HIM A;  2KCT A;  4OWX B;  2GN5 A;  5GAD C;  4R4C A;  2OQK A;  2JK8 A;  1TXY A;  5BR8 L;  4AH6 A;  2ES2 A;  1LUZ A;  2D0P A;  5C4J H;  4OX9 L;  4A3C G;  3WWV A;  4IFD G;  4LFB Q;  1TWG H;  4OWT B;  4DV4 L;  1UEB A;  4YWK A;  5GAH C;  4JBM A;  1YHQ A;  2Y0S E;  1IBL L;  3TEH B;  4A3J G;  3KJP A;  1VQ4 A;  3S14 H;  1V1Q A;  4YHH L;  4A3J H;  5HGQ A;  1Q7Y C;  4DV7 L;  1XNR Q;  1AE3 A;  3HKZ G;  2QA4 A;  1X65 A;  1KRS A;  5FLM G;  3HFZ B;  1CKN A;  5LMN W;  1NY4 A;  4R4I A;  1KIX A;  4X66 L;  4MZ9 A;  1OTC A;  2A19 A;  4GOP B;  3H3V H;  1TWA H;  1E24 A;  2OTJ A;  2IX0 A;  2XGT A;  4JI5 L;  4DKA C;  1KC8 C;  2ASB A;  4R4O A;  3HOV H;  3I56 A;  4JYA L;  5M5W H;  2R92 G;  4HJ9 A;  2E5L Q;  1HR0 L;  4BBS H;  3U4Z A;  3D0F A;  3PF4 A;  2GVB A;  3ULJ A;  4O0A A;  4IOA A;  1IBL Q;  3M4O H;  3PCO B;  4DV6 Q;  4NB3 A;  1HZC A;  3E9I A;  3PF5 A;  1L2F A;  3GTJ H;  3E9H A;  4X62 L;  4ALP A;  1WYD A;  3H3V I;  3D31 A;  4A3I H;  4JI2 L;  3PO3 G;  3PIP A;  2MO1 A;  2VNU D;  3LGJ A;  1PH5 A;  2WFW A;  3J80 c;  3PO3 H;  4OO1 G;  1QVF A;  1HNW Q;  3CCL A;  2VL6 A;  2JQO A;  3U4V A;  2WAQ G;  4Y7N H;  2VQF Q;  1U5K A;  2NVX H;  4A93 G;  1S72 A;  1SFO H;  1Z9F A;  3HOY H;  3S15 H;  4DAY B;  2YTV A;  1HNX Q;  1EWI A;  4K0K L;  1D8L A;  2NVY H;  2HHH L;  4UP7 A;  4PZ7 A;  4JCV E;  4IFD I;  1CKN B;  3S1M H;  2IT1 A;  4JYA Q;  1MIU A;  2K4K A;  1NTG A;  3EIV A;  2CWA A;  4JI6 Q;  1KAW A;  2JA8 H;  2E2H H;  4LF8 Q;  1Q46 A;  1P16 A;  4BBR G;  1VQL A;  3TRE A;  4A3F H;  5C4X G;  2UUB Q;  3GD7 A;  3A0J A;  1GD7 A;  1TWC H;  4A3F G;  1SE8 A;  2HHH Q;  4BY7 G;  1CSP A;  4DR1 Q;  1YJN A;  4X62 Q;  1U0L A;  4DR7 L;  2E8G A;  3MEF A;  1I50 H;  1KD1 C;  1EQR A;  3A74 A;  4TQU S;  3CC7 A;  1VQO A;  4KI0 A;  2NVQ H;  2LXJ A;  1XPO A;  1N36 L;  3STB C;  2ZM6 Q;  1CUK A;  4UPA A;  4A3E G;  2N49 A;  3NEL A;  4X64 Q;  2PNH A;  1BBU A;  2ZTD A;  5IYC G;  5M3F H;  2A8V A;  2EIF A;  4X65 L;  5LMN Q;  3M7N A;  4AYB G;  4YY3 L;  1JB7 A;  5IYC H;  3GO5 A;  1XTD A;  1K0R A;  1YBY A;  3KYH C;  4P73 A;  3HKZ E;  4KHZ A;  3KF6 A;  3OYY A;  4P71 A;  4APV A;  1PH3 A;  1SLJ A;  2VS1 A;  3PUY A;  2B63 G;  4B3S Q;  1N8R C;  1GKH A;  3AFQ A;  1PVO A;  2VUM H;  1SMX A;  3HOW G;  4KHP L;  2B63 H;  4QJF A;  4LWC A;  1NMG A;  4JI0 L;  3KOJ A;  3U58 A;  4EQ5 A;  2VUM G;  2IHE A;  3HOW H;  3FKI H;  2C35 B;  1VQN A;  1GM5 A;  1X3G A;  1PV4 A;  4POG A;  4DR6 Q;  1WI5 A;  1JT8 A;  4YCU A;  1JJG A;  3CCV A;  1UE5 A;  1X54 A;  2AMC B;  1N32 L;  1XMQ Q;  4DR1 L;  1VQA A;  2VZA A;  4UP8 A;  1JJC B;  1KL9 A;  5LMN L;  3UDG A;  2UUC L;  2UUB L;  1XNR L;  1HZ9 A;  1Y14 B;  4JI4 Q;  4DAM A;  4HIK A;  1IBM L;  1PYS B;  4MTN A;  3J80 i;  3GTP H;  2DUD A;  3AYH B;  3EBE A;  2CKZ B;  3TQY A;  2HIX A;  3HOX H;  4L5Q A;  3CAM A;  3PO2 H;  3S2H H;  4DV5 L;  2UUA Q;  1VQH A;  1VQ5 A;  5JEA G;  1HNX L;  1Q1E A;  2UU9 Q;  1D7Q A;  1VQG A;  4GS3 A;  5HY6 A;  3KF8 B;  1WCM H;  1M90 C;  4OX9 Q;  5C0X I;  3G71 A;  3KFU A;  4JG2 A;  5M5Y H;  5IYB G;  1YVC A;  1CKO A;  1PA6 A;  1B8A A;  2R6G A;  3G6E A;  1W2B A;  1M1K C;  4A3B G;  2YV5 A;  3CF5 A;  1E1O A;  1RIP A;  2VY3 A;  3PSI A;  1XMQ L;  5JJL A;  1FVI A;  5JEA J;  3RLN A;  1IXR A;  2HQL A;  3CPW A;  4GKK L;  3RZD H;  4BA1 I;  1I6H H;  3CD6 A;  1YIT A;  4BBS G;  4JI1 Q;  4JC0 A;  5GAG C;  5C0X J;  1K8G A;  1VQ8 A;  2OWO A;  3NEM A;  4DV0 L;  1IBM Q;  4LF7 Q;  4JI8 Q;  1G29 1;  3M4P A;  3ER0 A;  4NXN Q;  1RL2 A;  4BBR H;  1G51 A;  5LMU Q;  2ZJR A;  4YWM A;  4XTC S;  3PUX A;  4A3G H;  2VQE L;  2PI2 A;  1Q12 A;  1QUQ B;  1K73 C;  4A3D G;  2I0Q A;  2R7D A;  1VQ6 A;  4A93 H;  4GOP C;  4YWL A;  4MNO A;  2BA1 A;  5C0X G;  5IT9 c;  2A1A A;  1HR0 Q;  4X65 Q;  1TWF H;  4DV0 Q;  1EQQ A;  4LF7 L;  4LF4 Q;  1NE3 A;  2K50 A;  2JA6 G;  1QVC A;  4J15 A;  3I4O A;  2ZM6 L;  2VQE Q;  2KHI A;  5IE8 A;  3A5Z B;  4L5R C;  1V43 A;  2GVA A;  3UE0 A;  3BZC A;  1YJW A;  4BA2 I;  4X66 Q;  2Q2T A;  3KLW A;  1PH1 A;  1VQJ A;  3I55 A;  3H0G H;  5IP7 G;  4NXN L;  5LMU L;  2EQS A;  3W1B A;  5AJ3 L;  3J81 j;  4C3J H;  4A4I A;  1FGU A;  4XIG S;  4QL5 A;  3NEN A;  4A3K H;  3TS2 A;  3T1H L;  4JI1 L;  1XNQ Q;  4LUZ A;  5EAY A;  5IY0 A;  4HID A;  4UP9 A;  4LF9 L;  4GNX C;  4A3L H;  2AWO A;  3K81 C;  4X6A H;  2V1C C;  1X3E A;  3JAM i;  1VQI A;  2D0O A;  3HOZ G;  4P75 A;  2EXD A;  3S17 H;  4QY7 A;  1J6Q A;  4EX5 A;  3J81 c;  1P8L A;  2VQF L;  3M85 A;  4GLX A;  1QVG A;  1QZG A;  2BH8 A;  1OXS C;  1N34 Q;  5BR8 Q;  1A63 A;  1Q8K A;  4DNI A;  4JI6 L;  3PUZ A;  2ZJQ A;  1N33 Q;  4DR3 Q;  4IO9 A;  4AQY L;  3NBH B;  2I5H A;  5AJ3 Q;  2QEX A;  3JAM c;  2ZJP A;  1LM0 A;  4R4Q A;  3ZJY C;  1C7Y A;  2IHF A;  4AIM A;  4DV5 Q;  2UUA L;  1YI2 A;  1PH8 A;  3PO2 G;  1VQC A;  4HJ8 A;  4GLV B;  4PZ8 A;  2IX1 A;  3HOU G;  4O2D A;  1E3P A;  2CFM A;  3OTO L;  1Q82 C;  4B3M L;  3T1H Q;  1PH9 A;  2ATW A;  1Y1V H;  1I94 Q;  1S3O A;  3CP0 A;  4C3I H;  1H95 A;  4DV1 L;  1OXX K;  1IZ6 A;  1YHB A;  2WB1 E;  3S24 A;  4C3H H;  4JI5 Q;  4H02 A;  1O7I A;  4IPH A;  5J3B A;  2KBN A;  3RLO A;  3A5U A;  5E7N A;  3J81 i;  4NXM L;  1I5F A;  1NBW A;  1UE6 A;  4DV6 L;  2R92 H;  1IYJ B;  3U50 C;  3M3Y H;  2MNA A;  3KF6 B;  1EUJ A;  1KRT A;  3W5O A;  1N9W A;  1TWH H;  1EIY B;  4JI8 L;  2OCE A;  3ICE A;  4KHP Q;  5FJ8 G;  3HOX G;  2E5L L;  4LW1 A;  4JOI C;  3CCE A;  4P74 A;  3RNU A;  4HJA A;  4B3S L;  2UXD L;  4NPS A;  1MJC A;  3DLL A;  2NN6 I;  4QQB X;  4A3I G;  4JV5 L;  2MQH A;  1W3S A;  2Q2I A;  2VW9 A;  1VQE A;  3CPF A;  3AEV A;  1GO3 E;  5C3E G;  2F52 A;  2YTY A;  3KDF A;  1K3R A;  1WCM G;  3I2Z A;  1IL2 A;  4LFB L;  4FDB A;  3F2C A;  1S40 A;  5JJK A;  4DV1 Q;  4DK6 C;  4L5T A;  5IYB H;  1VQD A;  3T1Y L;  4LF6 Q;  4A3C H;  1MKH A;  4OO1 I;  4LF8 L;  2K14 A;  2AHO B;  1UE1 A;  3UDX A;  3OTO Q;  2RCN A;  2R7Z H;  4LFA Q;  4OXP A;  5DLQ E;  1E7Z A;  2WAQ E;  2UXD Q;  4LUO A;  4JBW A;  2R7Z G;  5GAE C;  1X9N A;  3RZO H;  2LXK A;  1E22 A;  1XPU A;  4JI7 L;  1YHA A;  3JC6 6;  2LSS A;  4B3T Q;  3FHW A;  4IJL A;  1WFQ A;  2JA8 G;  3S1R H;  4LF9 Q;  5FLM H;  2NZH A;  1LYL A;  1B7Y B;  4QGU A;  3Q8D A;  1VQF A;  5C4X H;  4LFC Q;  2R7F A;  2KHJ A;  2NN6 G;  4AYB E;  3S1Q H;  4BY7 H;  1MJE A;  2UXB L;  1PH4 A;  1JE5 A;  4BY1 H;  4GNX B;  4A3G G;  4JBJ A;  3K8A A;  5JJI A;  1HH2 P;  2JA7 H;  1C9O A;  3CC2 A;  3HOV G;  3I4N G;  3ULL A;  1XMO Q;  1FJG Q;  2JA7 G;  1PFS A;  3I4N H;  5IYD H;  2YYZ A;  2UXC L;  1AH9 A;  1L1O B;  2AKW B;  1JJ2 A;  1X55 A;  1XNQ L;  1ASZ A;  4UY8 C;  3H15 A;  2N3S A;  2IY5 B;  2R93 G;  2RHS B;  4AQY Q;  2CCZ A;  1CKM A;  4JI2 Q;  3KJO A;  1K83 H;  1KQS A;  1CSQ A;  4PG3 A;  4Y52 H;  4LFC L;  3CCJ A;  5IP9 H;  5IP7 H;  4IFD J;  5C44 H;  5IP9 G;  2WB1 G;  1VS0 A;  3ULP A;  2L15 A;  5ELO A;  1G6P A;  3IRB A;  2D62 A;  1SRU A;  3K80 C;  4A3K G;  1PH6 A;  4C2M H;  4B3T L;  3CCU A;  4LNQ A;  3HOY G;  3UE1 A;  1EOV A;  2FXQ A;  3G48 A;  5H1S E;  3TRZ A;  3KDF B;  1OXV A;  2I5M X;  1L0W A;  3PGZ A;  2Q2U A;  2Y0S G;  3I4M G;  2UXB Q;  3B6Y A;  1SRO A;  3CCS A;  3K7A H;  1Z47 A;  4P72 A;  4BXX H;  1KXL A;  2MFI A;  3UDI A;  3E0E A;  4NXM Q;  3K0X A;  4DV4 Q;  1AE2 A;  4BXX G;  4OWW B;  4DV2 L;  1PH2 A;  3F1Z A;  1OXT A;  1J5E Q;  4IPC A;  4DPG A;  2K5H A;  3M9B A;  1NJI C;  1HZA A;  2N8N A;  4X64 L;  1B70 B;  3J7A 5;  2PI2 E;  4GNX A;  2KCM A;  5FLX c;  4RG1 A;  1VQ7 A;  4GKK Q;  3W1G A;  3CMA A;  1XPR A;  1DGS A;  2UU9 L;  4DUZ Q;  2OQ0 A;  3T1Y Q;  4LF6 L;  1J5E L;  5C3E H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...