1SN8A

Crystal structure of the s1 domain of rnase e from e. coli (pb derivative)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
ANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the RNase E S1 domain and identification of its oligonucleotide-binding and dimerization interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease E
total genus 17
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature ec 3.1.26.12: Ribonuclease E.
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sn8A00
5C3EG 3D31A 3KF6A 5C4XH 1XMOQ 3CC7A 2R6GA 4DPGA 4QGUA 1A8VA 1RIPA 4DV6Q 1N33L 5HGQA 3U4VA 2E5LL 1HZ9A 3BJUA 2I5MX 5LMUL 4P72A 2R92G 5M5XH 3PGZA 3HOVG 4GN3B 4HJ9A 4HJAA 3HOVH 1UWVA 1HZCA 1KRTA 4EX5A 1XNRL 4X6AH 3RZDH 1UEBA 4YY3Q 4DR7L 4A93G 1Q7YC 1HR0L 1N36Q 2JA8G 5FLMG 4DV2L 1MKHA 2K5HA 5IYDG 5ELNA 1EQRA 1B7YB 3H0GG 3S2HH 1DGSA 2CFMA 2MNAA 1PH9A 1KC8C 3BU2A 3GO5A 1K9MC 2ATWA 4JBKA 4JI7Q 1KXLA 1S3OA 1X3FA 1GD7A 4DKAC 2UXCL 1YIJA 1JB7A 3GTKH 3GDEA 4JCVE 5GAEC 3S2DH 1PH1A 3B6YA 3RZOH 1N33Q 4JYAQ 1PVOA 2JE6I 1QVGA 4LFCL 1D8LA 2B29A 2H5XA 1XPRA 4X64Q 1X9NA 3HOZH 1PYBA 1YZ6A 3AFQA 2IX1A 1N34L 1VQKA 4DK3C 4Y7NH 2K50A 4GOPC 4MZ9A 2YV5A 4LUOA 1PYSB 4HIMA 3J7A5 1NY4A 2A19A 4XTCS 4DV5Q 2FXQA 3FKIG 5C44G 3ULPA 2HHHQ 4HJ5A 1HR0Q 3PUWA 2Z6KA 3UDFA 4A3EG 1O7IA 4TVAB 1FVIA 2CKZB 3PUYA 4LF5L 3CP0A 1HZBA 3K81C 3PCOB 4P71A 1Y14B 3KJPA 1D7QA 4OWWB 3F2BA 1IBKQ 4DV3Q 3J80i 5C3EH 4C3IH 1U0LA 3NELA 2Q2HA 2QGQA 3HOZG 4X65Q 4JV5L 2I5HA 3E9IA 1N34Q 5IT9c 1G291 2PI2A 2R7FA 2JA9A 5K36G 3J81i 2JK8A 4R4IA 2D62A 2VS1A 2Z6KC 3KYHC 4LF6L 3IRBA 1AE3A 1IZ6A 4A3KG 1K8GA 4BXXH 3UDXA 4R1JA 5IWAQ 5GROA 4IFDI 1C0AA 1AH9A 1Q8KA 4JI6Q 1KIXA 4GS3A 4HJ7A 2BH2A 4B3SL 4LF7Q 3M7NA 2E5LQ 4IJLA 2BA0A 5DLQE 1R9TH 3OYYA 2I0QA 4DUYL 3HKSA 2WAQG 5JEAJ 1JE5A 2Y0SG 2QA4A 4DR3Q 2WAQE 1GM5A 2JA6H 4JI5L 2MO1A 4QY7A 4JI3Q 4DUZQ 4GLAC 2PMZE 4JI3L 4A75A 2VL6A 1NMGA 3M4PA 3RN2A 4NXNQ 3M85A 1E22A 3I7FA 4JI0Q 4X62Q 1CUKA 4HIKA 1I5FA 2PNHA 4A3KH 2NVYH 5JEAG 5C0XG 1YVCA 4JI8Q 2ZM6L 5IYBG 4IPGA 5HY6A 4AH6A 3KJOA 2ZM6Q 1XMQQ 2L15A 4JOIC 4JI1L 2UUCQ 4K0KL 2K5NA 2UXBL 4GNXA 5LMNL 2K4KA 3RR5A 1JJGA 4DR1L 2EQSA 2IX0A 1MIUA 2XGTA 4C3HH 4A76A 1Q81C 4DR6Q 1A62A 1I3QH 1XNQQ 4AYBE 5FJ8G 2CQOA 5AJ3Q 4LFBQ 1LYLA 3WWVA 1VQ9A 1HJPA 3CCQA 2B63H 3GTPH 1CSQA 4DR3L 2BA1A 1U5KA 1BKBA 4OWTB 4IPDA 2NN6I 4BY1G 3BZCA 2WP8J 4AQYQ 4LNQA 1NE3A 4IPCA 1S40A 1NTGA 4LF5Q 4POGA 1E3PA 3W1GA 3I56A 3S24A 3I2ZA 2E2JH 1XNQL 2UXDQ 1P8LA 2PQAB 3HOYH 3CD6A 4A3MH 4DV4L 1E24A 4JBWA 5FLMH 4YWKA 4BXXG 1J5EQ 3STBC 1OXXK 1WFQA 3NEMA 3ZJYC 2E2HH 2JA7H 5IP7H 4BBSG 3K0XA 1I94L 1WCMH 3PO2G 2NZHA 2F4VQ 3KDFB 4JI1Q 2Y0SE 2CWAA 1KL9A 4P75A 3FP9A 4H02A 2JEAI 4A3DH 2ID0A 2IHFA 2JQOA 3F2DA 1V9PA 5C0XJ 4NXNL 3TS2A 1VQPA 4A3GH 2AHOB 2JA5H 1X54A 4LUVA 5IP9G 4JI0L 2UXCQ 2GVBA 4A4IA 3OW2A 2NVQH 4PZ6A 4KI0A 2AKWB 1UE6A 4POFA 3S16H 4JI5Q 4NXMQ 5C44H 3DM3A 4OONA 5M3FG 1Z47A 2EIFA 1EIYB 3A74A 1CKOA 1AE2A 4HIOA 1VQNA 4L5RC 4DNIA 3D0FA 1JMCA 1JT8A 1G6PA 3PUVA 2YTVA 4DV1L 3VDYA 1M1KC 1YHBA 1TWAH 4UP8A 3HKZG 4AIMA 1PH3A 2R93H 3U4ZA 3EN2A 4YCWA 3PO2H 1EWIA 5M3MG 3PF5A 4LF9Q 4LF6Q 4GOPB 1CKMA 1WOCA 2V1CC 1MJEA 3I4MH 1KHIA 1PA6A 1K73C 5IWAL 3M9BA 1SE8A 4KHPQ 1VS0A 2WB1G 5LMNQ 1E7ZA 4DK6C 1P16A 2UU9Q 3HOXH 1L1OB 1VQFA 3JC66 4LF9L 1J5EL 4DAMA 4YWMA 4A3JG 4GLVB 1N32Q 3CW2C 1X65A 4HJ8A 3CMAA 2ZTCA 2I5LX 2AWOA 5JJKA 2JA7G 3NENA 1WJJA 4AQYL 4DUZL 2VUMG 2K52A 3I55A 1YBYA 1EOVA 1VQAA 4DV1Q 1X3GA 3S15H 4OXPA 1GVPA 3UE0A 1A0IA 3E9HA 4R4TA 4B3ML 3RN5A 3TEHB 4UP9A 2HIVA 5AJ3L 1YHAA 1Q1BA 5H1SE 3FHWA 2RHQB 1VQOA 4NXML 5M5WH 1YJNA 2RF4A 4L5QA 1M90C 3CPWA 1VQHA 1PH5A 1HNWL 1XNRQ 1BBUA 5GQOA 4JI6L 1SR3A 3I4MG 3UE1A 1Q1EA 3CC2A 5JJLA 3A5UA 4MTNA 3W5OA 4C2MH 2ALYB 4A3FG 1PHJA 4A3LG 2A1AA 2KCTA 4IPHA 4IO9A 4DR4L 4IOAA 4RG1A 4JV5Q 1PV4A 3F1ZA 4P74A 1Y1VH 4OWXB 1VQJA 1X3EA 2LXKA 4B3MQ 1FGUA 3PO3G 4YY3L 4DR7Q 2OTJA 1WI5A 4YHHL 3K80C 2VNUD 2VQFQ 2VY3A 4O2DA 1VQEA 4J15A 3CCEA 2OWOA 3PF4A 1N8RC 1VQ8A 2KBNA 1LTLA 1B70B 1K83H 3GTGH 4GNXC 4A93H 2JEBI 2YTYA 4A3FH 2ASBA 1SN8A 1QZHA 3U50C 2R92H 1VCIA 2WFWA 1VQ5A 2YU9H 5M3FH 1XTDA 4LF4L 1PH4A 3A5ZB 4BBRG 2Q2UA 1H95A 4R4QA 4A3BH 3CQZH 2PI2E 1Q46A 3PUXA 5J3BA 3G4SA 1PH8A 2HT1A 1I50H 5FLXc 3H3VH 3PUZA 3FKIH 4KHZA 4KHPL 3LGJA 4A3CG 1L0WA 1KD1C 1IBLL 4A3CH 3ULJA 1IBMQ 1CSPA 4A3DG 3I4NH 1I6HH 4ME3A 2Q2TA 1OXTA 4EQ5A 4R4CA 4L5SA 3GTMH 2JJQA 3KF8B 4JI8L 3L2PA 1EQQA 1YITA 4DR2Q 1IBKL 4B3TQ 3PV0A 4BA1I 4A3GG 1KAWA 2IY5B 2RHSB 3KF6B 2VQFL 4UP7A 5BR8L 1OXSC 2F3IA 2KENA 3CMEA 1XPUA 5ELOA 4UY8C 4A3BG 4DR6L 4IFDJ 1X56A 2OQ0A 3EIVA 4PMWA 1TWFH 3DLLA 1MJCA 3JAMc 2R7DA 4LF8L 3OTOL 1FL0A 3U58A 3MEFA 1VQMA 1PH6A 1XMQL 3S1RH 3CAMA 3TQYA 1OTCA 3M4OH 4DUYQ 1VQLA 2VUMH 3I4NG 4DV6L 3S1NH 3HOUH 1LUZA 2F52A 1VQGA 4JI4L 1UE7A 1KRSA 5IP7G 3TRZA 5FJ8H 5IY0A 1TWHH 5M3MH 2E8GA 1IBML 3CCVA 2MO0A 1V1QA 4OO1I 3L0OA 3H3VI 4JBJA 2ZTEA 4R4OA 1J6QA 3ICEA 3UDIA 4A3IH 3KDFA 4GNXB 4LF4Q 1OXVA 4YWLA 5BR8Q 2HIXA 3UDGA 4BY1H 1JJ2A 4A3LH 2N49A 2OQKA 3KFUA 3RNUA 3NBHB 3F8TA 4QQBX 3HFZB 4L5TA 4QL5A 2ZJQA 3S14H 1EUJA 1VQBA 1QVFA 1TXYA 2VQEL 5C4XG 3CPFA 4GN5A 3TS0A 2LSSA 3HOWG 4B3RQ 2DGYA 4PZ8A 1WYDA 2Q2IA 2R93G 2B63G 4GKJQ 3A0JA 1Y1WH 4X66Q 1GO3E 3K8AA 3KLWA 4LFCQ 2UUCL 4K0KQ 3JAMi 1UE5A 3GTOH 2UXBQ 3S17H 3HOXG 2IHEA 1K3RA 2YYZA 3SGIA 5M5YH 4JBMA 4YCUA 1VQIA 3J80c 2VW9A 4DV3L 2N8NA 3G71A 2VZAA 4GKKL 2D0PA 4HIDA 3GTLH 3J81j 4QIWE 2RCNA 2YTXA 4DV7L 2N3SA 1HNWQ 1HNZL 4DV7Q 2ZTDA 5IYDH 2ES2A 2JA8H 1K8AC 1FJGL 1HH2P 1L1OA 2N78A 1Y1VG 2UUAL 1BBWA 4PZ7A 3I4OA 3T1YQ 1JJCB 3G48A 4JC0A 2UU9L 2LXJA 1S72A 3L7ZC 4GN4B 4O0AA 3BZKA 5IYCH 3CCUA 3GTJH 4DV0L 2OTLA 4YCVA 2E2IH 1Y1WG 1N36L 4DR4Q 1YEZA 2KHIA 1HNZQ 3K7AH 4NB3A 2K75A 3AFPA 3E0EA 4KLKA 3TREA 4IFDG 4GKJL 4OO1G 4Y52H 5JJIA 1HZAA 3HKZE 2R7ZH 2A8VA 1EIFA 4JI4Q 3MXNB 3G6EA 3PIPA 1IYJB 5EAYA 2AWNA 4LFAQ 1W3SA 4A3IG 1XMOL 4JI7L 4LWCA 4A3JH 2UUBQ 2NVXH 1V43A 2WB1E 4X65L 4GOPA 1ASZA 4JI2Q 1W2BA 3CCLA 3ULLA 1WCMG 3J7ZC 1HNXQ 4JYAL 4DV2Q 4WJ3M 1EYGA 4DAYB 4RMFA 1K0RA 4BY7G 2UUAQ 2CWPA 1G51A 3RLOA 5IE8A 3F2CA 4DR5L 1SROA 2KHJA 4OX9L 2NVTH 3KOJA 1NJIC 1LM0A 3HOWH 3RLNA 3STBD 5LMNW 1OXUA 2AMCB 1VQ4A 1SFOH 2NZOA 4P73A 2D0OA 2HHHL 5GAHC 4ALPA 2QEXA 3CCSA 1L1OC 4LFBL 2UUBL 1I94Q 3S1QH 4LUZA 2ZJPA 3RLFA 5GADC 4X64L 4LFAL 5E7NA 5GAGC 1C7YA 4FDBA 1Z9FA 3H0GH 2B3GA 1SMXA 5LMUQ 4A3MG 2UXDL 2MFIA 3AYHB 2VQEQ 1XJVA 2C35B 4X62L 2PQAA 1VQ6A 4BA2I 4PG3A 1Q82C 3M3YH 4BY7H 2F4VL 1X55A 1VQDA 1GKHA 1PFSA 1SLJA 5IYCG 3J81c 4QJFA 4AYBG 2BH8A 2NN6G 3M4QA 3PO3H 3PIOA 1QVCA 4JOIA 3OTOQ 3CC4A 1L2FA 3PSIA 1T9HA 1VQCA 4YHHQ 1A63A 2DUDA 3CCJA 1IXRA 1E1TA 2JA5G 3ERSX 1KQSA 1IBLQ 1YJ9A 3H15A 3ER0A 4APVA 1ASYA 3Q8DA 3CXCA 1HNXL 1Q86C 4UPAA 2ZJRA 3K7UC 2K5VA 4DR2L 4WJ4A 4BBRH 1XPOA 1Q12A 1PH2A 2CCZA 1E1OA 1SRUA 1C9OA 5IYBH 1YJWA 3W1BA 4LW1A 1N9WA 2IT1A 3AQQA 2MQHA 4X66L 3EBEA 2GVAA 1IL2A 3HOUG 3S1MH 1NBWA 2K14A 3CF5A 1YHQA 1VQ7A 4B3RL 4LF8Q 4DR1Q 2JA6G 2Z0SA 4DV0Q 4DV4Q 4JG2A 4GLXA 5C0XI 3CCRA 2R7ZG 4NPSA 5IP9H 5C4JH 4XIGS 4B3TL 1NMFA 2OCEA 1EFWA 4TQUS 1QUQB 3T1YL 4MNOA 3T1HQ 2HQLA 1CKNA 1X6OA 2GN5A 2EXDA 1FJGQ 4OX9Q 4IOCA 3T1HL 3AEVA 4DR5Q 4IJHA 1TWGH 1B8AA 4B3SQ 4LF7L 4C3JH 1RL2A 3CCMA 1PH7A 1BVSA 2KCMA 4BBSH 1N32L 1TWCH 1HR0W 3HOYG 4DV5L 4GKKQ 2XTIA 1QZGA 4JI2L 3GTQH 1QUQA 1UE1A 4A3EH 1CKNB 1YI2A 1YNXA 3GD7A
chains in the Genus database with same CATH superfamily
4NP5A 3IFTA 5C4XH 1TS4A 2R6GA 4QGUA 2XNAC 4DV6Q 5M5XH 4IFDH 2PPBC 4CKEA 2KJXA 1XNRL 3DM1A 3PMFA 1HR0L 3SXHA 3H0GG 5ELCA 3BU2A 3GO5A 1D5MC 4JBKA 4JI7Q 4FF1A 3S9WA 4CKBA 4K2KA 2BDNA 3GDEA 4JCVE 1PH1A 4JYAQ 1N33Q 1QVGA 1D1KA 1YZ6A 3JAME 4H44C 2DJGC 1N34L 1H9KA 2K50A 4MZ9A 4DV5Q 3FKIG 2HHHQ 1UAPA 4KKTA 5M3FB 1O7IA 4K6LA 1TWGB 2RCFA 4MHEA 4DV3Q 1PRTD 2JA5B 1XWEA 1ZYRD 4C3IH 1U0LA 3NELA 1V8QA 1AP0A 2QGQA 1C8CA 3HOZG 5FK9C 4JV5L 1L0XB 1N34Q 1FR3A 5IT9c 3IFDA 2JK8A 4KD3A 4R4IA 2KHSA 3KYHC 1JE4A 2WIIB 3IRBA 4LF6L 4BXXH 4R1JA 2V4DA 3MXGA 5IWAQ 4IFDI 1C0AA 1AH9A 2N55A 4IUVA 4LF7Q 4G7ZC 2ICEC 1CA5A 3P75A 1CFMA 3HKSA 3OWFA 1FNVA 4O1NA 4U673 5CR3A 3IL8A 1A2TA 4KY5A 4QUFA 1IW7D 4RKBA 3VA5A 2PZUA 4JI3Q 4DN4M 2VL6A 1SNCA 1BXTA 5J1ZA 2HQEA 5TSSA 4X62Q 1I5FA 2ZM6L 3DUZA 2EDGA 1SNPA 5IYBG 5C3EB 1I4XA 2EQSA 3MVVA 4C3HH 1SDFA 4CDEC 2CQOA 1PYWD 4C1NI 3WWVA 3MXPA 1VQ9A 1BKBA 4OWTB 4BY1G 4CGYB 3BZCA 2WP8J 4AQYQ 1S40A 1NTGA 4UHVA 3J81L 1E3PA 3S24A 1KDBA 1P8LA 2PQAB 3HOYH 4BXXG 4YWKA 1K0SA 1VMPA 3STBC 3S1QB 3NEMA 2DNEA 5IP7H 1ICWA 1RHPA 4QUCA 3PIP3 2WB1B 1X3PA 1FYCA 2Y0SE 3FP9A 4H02A 2RQXA 4PMBA 4XQJA 3MHBA 3F2DA 1V9PA 2K5QA 5F2DA 2AHOB 4LUVA 1E2ZA 2GVBA 3HGBA 5G3LF 4A4IA 2N88A 4PZ6A 4NDXA 1UE6A 5M3FG 3TSSA 1EIYB 4BY1B 2VUMB 3E5SA 4DNRB 1E2VA 1SE4A 4Y7NB 3L3OC 5CORA 1TWAH 4K2LA 3EN2A 3PO2H 1EWIA 3PF5A 3K7AB 1MSHA 4GOPB 4LF6Q 1WOCA 4WJWA 2BDOA 2F0HA 3M9BA 5C5MA 4KHPQ 1ESRA 3ERQA 3EFXD 1P16A 4B08A 1FD7D 2F0GA 2FFKB 1VQFA 2QF7A 4DAMA 4P2CB 3I70A 3CMAA 2ZTCA 2I5LX 3NENA 2DN8A 2L9HA 4DUZL 2VUMG 2K52A 3AMUA 3I55A 1U4RA 4DV1Q 5K5PA 1A0IA 1QJOA 3RN5A 1PLFA 3TEHB 4UP9A 3FHWA 2IL8A 4L8JA 1YJNA 4L5QA 1M90C 1PH5A 4NW2A 1SR3A 1A3TA 5EBDA 3UE1A 1BNZA 3CC2A 5JJLA 1G6ZA 4TSSA 3KLSX 3A5UA 3K58A 4MTNA 5EKIA 3W5OA 3HOXB 4A3FG 4DAVA 1SNOA 1HA5A 2KCTA 4IOAA 2XIWA 3VYSA 4U68A 1VQJA 1KLUD 4N9TA 2LXKA 1IHZA 2B2WC 2EYHA 2PW7A 4YHHL 2VY3A 1VQEA 4J15A 4ZCKA 5IGDA 3CCEA 3PF4A 1N8RC 1VQ8A 1LTLA 1W6KA 3HOUB 2KCNA 2JEBI 3K0YA 2R92H 1SN8A 4K5VA 1DOKA 2FMMA 2RBMA 5EKLA 2Q2UA 1PH8A 2CW0D 3G4SA 4KHPL 4FXDA 3T51B 1L0WA 2F0UA 4DK0A 4A3CH 1IBMQ 1CSPA 1G91A 1BO0A 4ME3A 4EQ5A 4XDXA 1SE3A 3TDQA 2IW3A 1ZXTA 4B3TQ 3PV0A 1KAWA 3VR3A 4WFN3 2RHSB 4J8QA 4RH6A 4L6TB 5I2XA 4UY8C 5KIXA 1ZEQX 4IFDJ 1EY8A 2M2LA 5A2QL 1SJED 4PMWA 1MJCA 3JAMc 3OTOL 2E2IB 1GUNA 3MEFA 1VQMA 1XMQL 3S1RH 2B63B 4XYOA 3M4OH 2KOLA 3Q23A 2OXPA 3NSWA 1VQGA 1UE7A 3CU7A 3CRKC 3CHBD 1IKMA 1A3UA 2MO0A 2G5DA 4QIWB 3H3VI 4JBJA 1J6QA 3ICEA 3UDIA 1G2SA 3C46A 1SAPA 1RTOA 5C0XH 3UDGA 1HTPA 2N49A 1TU2B 3KFUA 2RA4A 3NBHB 1D1IA 3RNUA 3F8TA 2WINB 4L5TA 2ZJQA 2F0DA 4C3JG 2LY7A 3DEPA 1KTKA 4B3RQ 3FKIB 1TQOA 4CBVA 2Q2IA 2R93G 1ILPA 1BCPC 4X66Q 3MA2B 3K8AA 3GTOH 2DNCA 3S17H 3HOXG 1X32A 1PTOH 3GTKB 4JBMA 1VQIA 4HMIA 2Z4HA 2NZ1D 4ODGA 2VZAA 3G71A 3HOYB 4HIDA 2J0TD 5D14A 2N3SA 1HNZL 2TSSA 4DV7Q 1VMCA 1EOTA 3KUPA 1L1OA 2QCPX 4JC0A 4XT1B 4PMCA 4KHVA 1K28A 3J81E 1YEZA 2KHIA 4GKJL 1GJXA 5JJIA 4BBRB 2RVLA 2R93B 3HKZE 3A8JE 3MWYW 3OPOA 4JI4Q 3MXNB 4ULLA 5CBEE 1DM0B 4PQXA 2F0WA 2NVXH 1ASZA 2B2UC 1TS5A 3J7ZC 1HNXQ 2J4XA 4JVZA 3TP8A 4A93B 4RMFA 1EYAA 5FKAC 2UUAQ 5IE8A 4DXFA 3CRLC 2NVTH 1LM0A 3ITPA 2PCFB 3K59A 4P73A 2HHHL 2QEXA 3DEOA 1L1OC 4DXGA 3NTHA 1SNMA 4I65A 4X64L 1SXTA 3SK6A 1SYDA 5GAGC 1RODA 1C7YA 4FDBA 1Q90A 2B3GA 1SMXA 5LMUQ 1B53A 2MFIA 3AYHB 2VQEQ 1XJVA 2C35B 5M5WB 2PQAA 4BA2I 1DZ1A 2XWBB 2F4VL 5IYCG 4HJ7A 4EQNA 2NN6G 3M4QA 1NUCA 4A3EB 3PO3H 4WRDA 2X69A 1F2MA 3CC4A 1L2FA 3PSIA 1CHQD 2E75C 2K05A 1I6HB 3ERSX 1KQSA 3H15A 3E6ZX 4APVA 1WD0A 1HNXL 3CXCA 5FO8B 5E3FA 3E0JA 1S5DD 1HPCA 3K7UC 2K5VA 2K6AA 2WAQB 4DR2L 1SRUA 1GHKA 3W1BA 5EQ0A 4YIJA 3AQQA 1FNWA 3RZDB 3FVQA 1WTWA 3EBEA 3HOVB 3CF5A 2RKSA 2F0PA 2EYOA 2X6LA 3CCRA 4NPSA 4MNOA 2ZT9C 2HQLA 2GN5A 2EXDA 1XYIA 3MTSA 3AEVA 4Q0FA 2L11A 2EY6A 3AU7A 4LF7L 2KCMA 4DV5L 1EEFD 4QCLA 1EYDA 5I2YA 4A3EH 4P72A 5JAVA 3CC7A 5CV6A 4OO1H 1N33L 5HGQA 3U4VA 2E5LL 4A3BB 2I5MX 5LMUL 2R92G 3PGZA 2TMPA 2DY8A 3HOVG 3HOVH 3NTIA 1HZCA 5G3LD 3SHLA 4X6AH 4A93G 4BY7B 5ELNA 4K5WA 1EQRA 2C9OA 2XWJB 2O5IC 3S2HH 2JXMB 1S5FD 2ATWA 3NE5B 4KTAA 1KXLA 1S3OA 5D65A 2NTTA 4DFAA 4DKAC 1YIJA 1PDQA 3I8ZA 1EIGA 1JB7A 3M4OB 2Z4IA 5GAEC 3S2DH 1HRJA 3RZOH 1PVOA 2JE6I 1HFNA 4M8AA 3HOZH 1I6VC 4X64Q 1PYBA 3AFQA 5JOBA 2IX1A 2WACA 1RJTA 1VQKA 2L0CA 5C4XB 1YNND 1H9SA 4LUOA 4HIMA 1QNUA 1NY4A 2A19A 3ULPA 5C44G 5BN4A 1MHWC 3NXWA 3I3CA 4HJ5A 1HR0Q 4AYBB 4A3EG 2Q8TA 3UDFA 3DMUA 3S16B 1NNXA 1WVLA 4C56C 1HZBA 1K83B 2B8FA 1Y14B 5BN3A 3F2BA 2Q2HA 5IT9L 3E9IA 2R7FA 4N9PA 5JVG3 2EOTA 3G6JB 4A3KG 1AE3A 1IZ6A 2AUJD 1WTPA 5GROA 1KNAA 2K28A 4JI6Q 1WD1A 4B3SL 5EBCA 4IJLA 1R9TH 1SNQA 1JWUD 3VA7A 3OYYA 3NWSA 4DUYL 1PZJD 2Y0SG 5T1GA 2QA4A 4DR3Q 1ZKOA 4JI5L 2BOSA 1D5ZC 1EWHA 3FMCA 2PMZE 4GLAC 1A3VA 3UI2A 1NMGA 1AZQA 1SYFA 4LK1C 2NVXB 1CUKA 4ZQ3A 2NVYH 1YVCA 1XMQQ 2M9VA 4H13C 4JOIC 2K5WA 1B3AA 4A3KB 2PZWA 4DR1L 2B8GA 1F2LA 4A76A 4DR6Q 1A62A 1I3QH 3BVMA 4AYBE 2R92B 1GUGA 5FJ8G 2KCCA 4RAUC 3S1RB 2B63H 4DR3L 4IPDA 2NN6I 1B3QA 3GP7A 5I9PA 5KGUA 1B50A 1NE3A 3H0GB 4POGA 1BQQT 2UXDQ 3W1GA 4MN3A 3I56A 4ZK9B 4JBWA 1OXXK 1WFQA 2E2HH 3P7JA 1HUMA 1I3QB 2EXZA 3K0XA 4XQNA 1I94L 2FHTA 2CHBD 3KDFB 1KL9A 1TS2A 2JEAI 4A3DH 1HHVA 1JR0D 5ELFA 4GZYC 5C0XJ 4NXNL 3HG9A 5IP9G 5ISRA 3OW2A 4KI0A 2AKWB 4NXMQ 5C44H 3A54A 4OONA 2EIFA 3D6CA 3NBIA 1CKOA 5IGBA 4L5RC 1G6PA 1M1KC 4DV1L 2D5DA 3QO2A 2JA6B 3HKZG 4AIMA 3SDZA 1Y69U 1BCPF 4OGQC 3MC0B 1AW7A 2YU9B 5EGTA 3I4MH 1K73C 4ME5A 1SE8A 3OMGA 1E7ZA 4DK6C 1EY6A 3GTOB 5J39A 4RHSA 1RD9D 1L1OB 4QF4A 1ET6A 3JC66 3OSOA 4G7OC 2F3VA 4IUUA 1PMRA 4XT3B 3WDNA 1EY0A 2JSOA 3HOWB 3CW2C 1N32Q 1OO9B 1X65A 3TP6A 4HJ8A 1S4ZA 2AWOA 5JJKA 1WJJA 2EPBA 2Q8IB 4FP5D 2O5JC 1X3GA 1EEID 3NQTA 2XSCA 2NBFA 2B2WA 2HIVA 4KN4C 1YHAA 1Q1BA 5H1SE 1VQOA 4KKSA 1HNWL 3C1FA 4XYQA 4OL7A 2F0TA 4JI6L 4C2MH 2ALYB 1T5EA 1EFID 3NTKA 1PHJA 2H4OA 1PV4A 5ELDA 3OW7A 4B3MQ 3W2DA 3PO3G 1PTOD 1SYCA 5IODA 2IPKD 1TWFB 4B9WA 1F9RA 3P20A 4YY3L 5FLXL 4DR7Q 2PNRC 4CJ1B 1F9SA 1PFMA 5EPJA 2NVTB 2L12A 3H91A 1ONLA 1B70B 1SE2A 4GNXC 4A93H 1EWCA 1L0YB 1PTOC 1VCIA 3R3OA 4LF4L 3SVMA 3I4NB 1F77A 5AFWA 3CQZH 2PI2E 4L63B 1GOZA 1Z6HA 5J3BA 2HT1A 1LLRD 3D4DA 1DJRD 3FKIH 4A3IB 3LGJA 5JPNC 1KD1C 3QJYA 2D2CC 4A3DG 1KDAA 1I6HH 4R4CA 1SYBA 3GTMH 2JJQA 2NN6H 4KK7A 3SE0A 3L2PA 3S15B 1ILQA 3PO3B 2L4NA 3KF6B 2VQFL 4CHTB 2NTSA 2F3IA 4DR6L 1X56A 3EIVA 2HCIA 1B9MA 3PQIA 4OEMB 2R7DA 1R9TB 1FL0A 3I91A 1STGA 1OTCA 2VUMH 3I4NG 1JOOA 1LTRD 3HOUH 1GHJA 2F52A 1X3QA 1B9NA 5IP7G 2AQ1B 3TRZA 5FJ8H 4HAEA 3CCVA 3ND9A 3J7YW 1CZGA 5CV5A 2D9UA 1GUOA 3F2UA 4GNXB 4YWLA 5BR8Q 2HIXA 1IYVA 2H1EA 1JJ2A 2OQKA 1PFNA 4QQBX 4QL5A 2QW7A 2VQEL 2LMCB 3M3YB 5C4XG 1CQVA 2DGYA 4PZ8A 2G9DA 4GKJQ 1HUNA 1Y1WH 1GO3E 1QWYA 2IHEA 2YYZA 5LL6S 4A3FB 3SGIA 4FYDA 3J80c 4DV3L 2R3ZA 1TR5A 4KD4A 1PZKD 2ZXRA 4QIWE 4DV7L 2YTXA 4F88A 2A68C 3P1HA 3BDLA 4H7BA 2VB2X 2ES2A 2JA8H 1K8AC 2N78A 2KEEA 2UUAL 1BBWA 5COYA 1JJCB 3G48A 2LXJA 1PTOB 2I46A 4GN4B 3BZKA 4RFBA 2X6GA 2OTLA 1N36L 4DR4Q 4C2MB 1QG7A 3AFPA 3E0EA 4Y52H 2A73B 3NK9A 4IALA 2A8VA 1EIFA 1PFBA 3W3AA 1NR4A 3G6EA 3T56B 1IYJB 4A3IG 4N8X1 1XMOL 4LWCA 3L9AX 2UUBQ 4M1UB 5KNBA 4WORA 5M3MB 1GUWA 3JAML 3ULLA 1WCMG 4WJ3M 4C1NK 1J8IA 1E2WA 1FNUA 4OX9L 2SNMA 1NJIC 1EQTA 3STBD 2F03A 4FO2A 1STEA 1JICA 2HD3A 2UUBL 1A15A 3RLFA 1XX8A 4HR7B 3A56A 3C3LA 1CTMA 1Z9FA 4G7HC 2EYJA 4C3HG 1MI2A 4X62L 4BY7H 4PG3A 2NVYB 1SLJA 4JOIA 3OTOQ 3HEJA 1LTTD 2L5TA 3K5MA 2EYLA 3OIQA 2DUDA 1IXRA 4PV1C 1YJ9A 1ASYA 3ER0A 1A2UA 4HN7A 3TP7A 4HSPA 2F0JA 4KKUA 2ZJRA 1LTAD 3D3RA 2CCZA 1E1OA 1C9OA 1H9JA 3V2TA 1N9WA 2EJGC 1EL0A 2MQHA 1TIID 1NBWA 1YHQA 4B3RL 2Z6BA 4LF8Q 2PZTA 4DV4Q 3J7AV 4JG2A 5C0XI 2R7ZG 5IP9H 5C4JH 1QUQB 3T1YL 1CKNA 1FJGQ 4OX9Q 3T1HL 1BCPB 1LT3D 1TWGH 1B8AA 3CCMA 1PH7A 4BBSH 3KK7A 4GKKQ 2KVMA 1QUQA 3LWUA 1UE1A 3QR8A 1CKNB 2B2VC 1YNXA 1STNA 3KF6A 3NWTA 1XMOQ 3HZXA 1A8VA 1RIPA 4KMUC 3BJUA 2XN9C 1MBYA 3X3MA 4HJ9A 2E2HB 1KRTA 1EU3A 3RZDH 4YY3Q 4Q5VA 4DR7L 1Q7YC 4ZRZA 2K5HA 5IYDG 4EVOA 2E76C 1KNEA 2CFMA 2EE1A 1F9PA 2MNAA 1PH9A 3AB9A 1KC8C 3HP3A 3R2TA 1LT5D 1TS3A 1NAPA 2UXCL 1TT2A 4IZ8A 4RA8A 3I4MB 1LACA 3B6YA 1I4PA 4FXGC 2QILA 2NWGA 1D8LA 2H5XA 1JWMD 2B2YC 3VR2A 4DK3C 4GOPC 3OOCA 5D3IB 1PYSB 2F3WA 3J7A5 3KLSA 4XTCS 1U4LA 1I4HA 1JOKA 3PUWA 3T16A 4F8MA 4TVAB 1FVIA 2BE5C 2CKZB 3S2DB 4LF5L 2EY2A 3K81C 3PCOB 4P71A 1D7QA 1ESFA 1HFGA 3RD4A 1IBKQ 2F0EA 3J80i 2JYOA 5IGCA 2J7ZA 4RGMA 1BR9A 2OF1A 4XXEA 3S2HB 5K36G 1G291 1TY2A 2A6EC 2FJ2A 3BG3A 1TWHB 2D62A 2VS1A 3NQIA 1K8GA 5ELBA 1Q8KA 3N6RA 4GS3A 2BH2A 3T53B 1Y1WB 1MD2D 3NHHA 3KBGA 5JEAJ 1JE5A 2WAQE 4IQZA 3NPPA 1A6XA 3MFGA 5KNDA 1F2ZA 4DUZQ 2Z1CA 3VR4A 3R2IA 3BS1A 4FVMA 3M4PA 3RN2A 4K8JA 4NXNQ 4B9XA 1E22A 3I7FA 5KEEA 3BZDB 4JI0Q 3H6MA 3MXUA 4E6IA 4HIKA 2SDFA 1PXUA 1H9MA 2C5CA 1BCPD 2MP1A 5JEAG 4JI8Q 5C0XG 5JEAH 4IPGA 4AH6A 2UUCQ 4K0KL 2K5NA 2UXBL 4GNXA 1JJGA 3RR5A 1YNJD 1BDOA 2IX0A 3GTLB 1XNQQ 3BDCA 3E3XA 1ENCA 4C3JB 5IGGA 5AJ3Q 5T1IA 1PRTB 3DWPA 1CSQA 3BYYB 2IX3A 1AZPA 2BA1A 1U5KA 1O7ZA 1Y8PB 1S5CD 3KLRA 4LF5Q 1LTID 5K36H 1KAAA 5A35A 1XNQL 3FPPA 2PW5A 3I2ZA 3RZOB 4DGZA 3A7LA 3CD6A 4DV4L 1E24A 5IGEA 5FLMH 4DAPA 5BN5A 3ZJYC 5CV4A 1EY4A 2JA7H 5A2QE 5E4XA 1I4GA 1WCMH 3OWEB 3I72A 3K5NA 2CWAA 4RHRA 4P75A 4C3IG 2ID0A 2IHFA 2JQOA 4RGTA 2AQ3B 5KNCA 4FF3A 3LNNA 1VQPA 2JA5H 3NBHA 2UXCQ 5FOBB 2WKDA 5L37A 1DYQA 3TN2A 4FXKC 2MPMA 3DM3A 1PTOF 1Z47A 3A74A 3WOFA 1AE2A 1JCKB 1VQNA 2HCCA 4DNIA 3D0FA 2F0NA 3PUVA 2YTVA 1CZWA 3H94A 4UP8A 5C6AA 3J80E 1PH3A 3G7LA 4HCEA 4YCWA 3VYTA 5CV8A 3DWQA 2V1CC 4OIKA 1KHIA 5IWAL 5I6YA 1II3A 2B2YA 1E0BA 2UU9Q 4FF2A 5LHY1 4RGNA 2HDLA 1CM9A 2K04A 1J5EL 4JW0A 4YWMA 4A3JG 4GLVB 1EY7A 3EA6A 4AQYL 1C4QA 3S15H 1EOVA 1PRTF 1VQAA 1H9RA 4OXPA 3UE0A 3E9HA 4C3HB 3LWEA 3SR1A 1CA6A 3R8BA 1EQVA 5M5WH 4IURA 3CPWA 1VQHA 2QDLA 2JA8B 5KRUA 1XNRQ 5GQOA 2SNSA 1Q1EA 4RCOA 1DCZA 4A3LG 4IPHA 4IO9A 3GTGB 2E2DC 4DR4L 4RG1A 4JV5Q 2Z9HA 4P74A 1Y1VH 2A74C 2CW0C 1LABA 1EZ8A 1X3EA 1YNJC 2EJMA 1FGUA 3TZDA 1EIHA 2OTJA 1WTRA 1QB5D 2VNUD 3QWNA 4K6DA 4O2DA 1TVXA 1SMYC 4IUPA 1TY0A 4KN7C 1K83H 4XQQA 4TRDA 2WFWA 1VQ5A 5M3FH 3A5ZB 1H95A 3ND8A 1Y8NB 3PUXA 5JPMC 1SBBB 2SEBD 4H0LC 3PUZA 4KHZA 3N52A 4C3IB 4K5XA 3HOZB 3S14B 3I4NH 1JB3A 4L5SA 4JI8L 1EQQA 4DR2Q 3S1NB 3CKIB 2B2TA 2KECA 2IY5B 1BUVT 2F0KA 4LMQD 5BR8L 2E2JB 3CMEA 4ABNA 1XPUA 5ELOA 4A3BG 5EJWA 1TWFH 1LTGD 1WTXA 3U58A 4R9WA 1PH6A 3ZYYX 2KQ3A 3CAMA 3TQYA 3A8KE 3MEHA 1U9RA 3GV3A 5CV7A 4DV6L 3BDOA 4JI4L 1AN8A 3GQBA 5IY0A 5M3MH 5EKKA 1RDPD 1WTVA 1WTOA 1STAA 1V1QA 4OO1I 3L0OA 4FF4A 2ZTEA 3QOJA 4A3IH 3KDFA 2XVSA 4LF4Q 2NYZD 3QB3A 5M5YB 1TWCB 3D6WA 4V0BA 3HFZB 3S14H 1EUJA 4OELB 2VXWA 1VQBA 2K1BA 2L1BA 1TXYA 2RDFA 2KA7A 1RKNA 2Z8LA 1XXGA 3TS0A 2LSSA 1WYDA 2NUCA 3A0JA 3T4AC 2AQ2B 3D8GA 3HRZC 3KLWA 3JAMi 1UE5A 3GTJB 1UUPA 3S1MB 1K3RA 1EYCA 5M5YH 4YCUA 3ONAB 5IIFA 2N8NA 2PMZB 2CVRA 4X3KA 1SJHD 4ZUIA 3J81j 1SFOB 1Q3LA 5IYDH 2MJ8A 1IYUA 2OEOA 2B2UA 1Y1VG 1VDZA 3Q6SA 3BYTB 2UU9L 3L7ZC 4FNFA 4O0AA 4S3SA 3GTJH 4YCVA 2E2IH 1Y1WG 4V190 1HNZQ 3K7AH 3QIAA 2K75A 4KLKA 4NB3A 3TREA 1HZAA 1B2TA 3HS0C 2F1MA 4RGOS 3K5OA 3OMCA 3PIPA 4LFAQ 1LT4D 4JI7L 1W3SA 1JOQA 4A3JH 2WB1E 4X65L 1W2BA 4JYAL 4DV2Q 4MTKA 1EZ6A 1G51A 3U9OA 3F2CA 1SROA 3KOJA 3HOWH 1I50B 3M7GA 4UAIA 1VQ4A 1OXUA 2NZOA 3DHQA 1CT1D 4BWGB 5JJZA 5GAHC 4ALPA 4LFBL 4LUZA 2B2VA 5GADC 3J80L 1HQRD 5E7NA 4G57A 1AFPA 2HUGA 3H0GH 3A7AB 2UXDL 2PQEA 1V1PB 2B39A 1X55A 2PO4A 1GKHA 1PFSA 3J81c 2DY7A 4EQPA 3PIOA 1QVCA 4IUQA 4X3UA 2CH4A 1T9HA 1VQCA 3QOLA 2FMCA 1A63A 1E1TA 4KV6A 2R61A 2JA5G 3X3NA 4UPAA 4WJ4A 4BBRH 5HURA 1Q12A 1FGBD 5M9OA 5IYBH 2IT1A 2F0SA 2K01A 1DOLA 5JVH3 4X66L 3TMEA 2F0MA 3DWAA 1CQFA 2GVAA 3HOUG 2K14A 4DR1Q 3K6OA 1SYGA 2DJFC 2JA6G 3HKZB 2Z0SA 4DV0Q 4GLXA 1SSOA 3D4RA 4EQOA 1QOHA 1NMFA 1RTNA 2OCEA 1EFWA 4TQUS 3T1HQ 1X6OA 2A6ED 5C4ZA 1HXYD 1O78A 2QDBA 1Y1VB 4CDFC 2WKCA 1STHA 4C3JH 1RL2A 1Q8IA 2F4IA 1BVSA 2RSOA 3K5LA 1N32L 1TWCH 1HR0W 3HOYG 2XTIA 4JI2L 5C5LA 4IUTA 2ICIA 1B44D 4HTHA 1YI2A 4CJ2C 3I4MG 5C3EG 3D31A 1HTLD 1DOMA 4DPGA 3RUZA 4G4KA 1HZ9A 1SEBD 2G9HD 1R4QB 2LKVA 4GN3B 4HJAA 3DXJC 2F0LA 1UWVA 5J22A 4CJ0B 4EX5A 1UEBA 1GUTA 2A6HD 1N36Q 2JA8G 5FLMG 4DV2L 1MKHA 5EPLA 5C4HA 2F0OA 1B7YB 1EY9A 1DGSA 4KJNA 1C48A 2FINB 2IJ0A 1K9MC 3A55A 1ML0D 1X3FA 1GD7A 4UDUC 5CGKA 4JK1C 2ENBA 4RKLA 1U4PA 3GTKH 2CQAA 1K8OA 3H3VC 4LFCL 2B29A 1VF5C 1XPRA 1NSNS 1X9NA 2K32A 4Z9CB 2GA4B 2EYPA 4OHJA 4Y7NH 2YV5A 4PNYA 1D5XC 2FXQA 1DXMA 3O13A 1QNKA 4DA2A 5IOCA 3EVQA 2MGSA 2Z6KA 1V1OA 3PUYA 3CP0A 3KJPA 4X3TA 4OWWB 5C3EH 1JWSD 3I90A 4A3DB 4X65Q 5KYLA 5IGFA 5NUCA 2I5HA 1TKWB 2PI2A 1V1PA 2JA9A 3J81i 2Q8RE 1RF2D 2Z6KC 3I73A 5DAUA 1F2YA 3UDXA 1DD2A 1KIXA 3M7NA 5E4WC 4QB4A 2E5LQ 5DLQE 2BA0A 2XRQD 3FPUB 2I0QA 2BCOA 4KY6A 2WAQG 2JA6H 5I4DA 1GM5A 5CYUA 4I7AA 2MO1A 4QY7A 1QILA 1S5BD 4JI3L 4A75A 4CDCC 1GXDC 4NKLA 4K8IA 5FLXE 3M85A 4DK1A 2PNHA 4A3KH 1KLGD 1G2TA 4HEDA 5HY6A 3KJOA 2ZM6Q 2L15A 4JI1L 3FRPB 5LMNL 2K4KA 3NUCA 4ZYSA 2XGTA 1MIUA 5EPKA 1Q81C 1J9OA 4LFBQ 1LYLA 3T13A 1HJPA 3CCQA 3GTPH 1EU4A 1VF7A 4LNQA 5I9OA 4IPCA 4N8FA 3TZUA 4F7XA 2E2JH 3V05A 2EY5A 1O7YA 2A69C 4A3MH 1K8MA 1J5EQ 3QG1A 4ZUJA 3S17B 4BBSG 4HSVA 3PO2G 2NZHA 2F4VQ 2QKIC 4JI1Q 1G8ZD 2AUKA 2RDGA 3SEBA 3OHXC 2K03A 3TS2A 4A3GH 1X54A 3Q24A 3EROA 5FO7B 4JI0L 1WTHA 3TP5A 2NVQH 4POFA 3S16H 4JI5Q 2JA7B 4LJZC 5ELEA 2F0FA 3TBIB 2F0QA 4HIOA 5DM73 1JMCA 1JT8A 3VDYA 1YHBA 1AEXA 2B2TC 1Y8OB 2R93H 3U4ZA 3OIPA 5M3MG 2K7VA 4LF9Q 1CI3M 3A8IE 1WCMB 1CKMA 4ZKCB 1MJEA 4DU9A 1PA6A 4BBSB 4K14A 4DAYA 1VS0A 2WB1G 5LMNQ 3VYUA 4QMGA 3HOXH 3EQLC 2LS01 4DNTB 3URYA 1JORA 4LF9L 2PYKA 1IKLA 1EY5A 1GUSA 2JA7G 5IT9E 3C2PA 1YBYA 1GVPA 1B1ZA 1R4PB 1D2BA 4R4TA 3MXNA 4B3ML 5AJ3L 4NXML 2RHQB 2A68D 1SNDA 2RF4A 4R8IA 1BBUA 4KJOA 3KBXA 4CKCA 1YNNC 1M8AA 2A1AA 4J6HA 3RMHA 2L55A 4X3SA 3F1ZA 4OWXB 2KEDA 2EY1A 1MGSA 1IL8A 2EYFA 1WI5A 3K80C 2VQFQ 1TWAB 1XTCD 2OWOA 1RCVD 2RSNA 2KBNA 3M4YA 2F0VA 3FDTA 4O42A 3Q0AA 5LL6X 3VYRA 3GTGH 5C44B 2YTYA 4A3FH 2ASBA 1QZHA 3U50C 2JP1A 2YU9H 1XTDA 5M5XB 1PH4A 4BBRG 3IAYA 2EJFC 2A6HC 4R4QA 4A3BH 3PO2B 1Q46A 5C3XA 1BBXC 3H3VH 1I50H 5FLXc 2SOBA 4A3CG 1LT6D 1IBLL 3ULJA 4MIUA 5D3DA 2VB3X 2Q2TA 5E1FA 1OXTA 1IW7C 3KF8B 1YITA 1IBKL 4BA1I 4A3GG 1O80A 3FEWX 1HQMC 4UP7A 5CC4A 3V96A 5DM63 1OXSC 3BVGA 2KENA 5I6WA 5C4JB 2OQ0A 3DLLA 4LF8L 4EGVA 2Y0SB 1HA6A 1KDCA 1QCBD 4DUYQ 3D4WA 1VQLA 3U9SA 3S1NH 1LUZA 2F0IA 1BF4A 4HCSA 1KRSA 1Z7TA 1TWHH 1DONA 2E8GA 4ZAIA 1IBML 1PRTC 1ICFB 4RCNA 4R4OA 1D6EC 1F9QA 4CDDC 1OXVA 4BY1H 3BVZA 4A3LH 1UNSA 3WOEA 3PIO3 4I7ZC 1SMYD 4IUNA 1QVFA 3I4LA 3LX0A 3CPFA 4GN5A 2ZXOA 3HOWG 3R93A 2IWHA 1H9SB 3MFYA 2R7ZB 1NR2A 2B63G 3CQZB 3GTQB 2LFNA 5DNFA 4LFCQ 2UUCL 4ZLTF 4K0KQ 2UXBQ 2A5HA 4ILWA 1M4VA 2E74C 3VR6A 4HMJA 2VW9A 5C3WA 4GKKL 3VR5A 2D0PA 3GTLH 4ID6A 2EYMA 2RCNA 2K5DA 2HDMA 1HNWQ 4J1MA 1SYEA 2K33A 2P5ZX 1U4MA 2ZTDA 5KYIA 1FJGL 1HH2P 4PZ7A 3T1YQ 3I4OA 1STYA 1S72A 2EVBA 1PZID 5IYCH 3CCUA 4DV0L 5CV9A 1CK1A 3C1EA 1ENFA 4IFDG 4OO1G 5DEHA 2R7ZH 3SK8A 2MUYA 1JC7A 5EAYA 2AWNA 4TKOB 5HGTA 1MSGA 1T5XD 5CMDA 1V43A 4GOPA 1W6JA 3GTMB 1I4QA 4JI2Q 3CCLA 2BE5D 1LV9A 1EYGA 4DAYB 1K0RA 4BY7G 4NMZA 2CWPA 3RLOA 4A3GB 4DR5L 1B4OA 2KHJA 1QE6A 2MHVA 2CH4W 1ENAA 4KY7A 3RLNA 4LAAA 1KABA 5LMNW 2AMCB 1SFOH 1ZYRC 2D0OA 2ZXPA 3CCSA 1I4RA 1LO5D 1BOSA 1I94Q 3S1QH 1WTQA 2ZJPA 4LFAL 2I07B 4A3MG 2OT2A 1CHPD 4R8NA 1JQYD 1VQ6A 3SK5A 1Q82C 3M3YH 1VQDA 2M00A 4QJFA 4AYBG 2BH8A 3IKJA 3K57A 1K3BC 3MAQA 4IN3A 4BS9A 2A69D 4YHHQ 1HCZA 3CCJA 4DF7A 1LTSD 3Q22A 1IBLQ 2JN4A 3Q8DA 1Q86C 1XPOA 1PH2A 2NB0A 3EJIA 2WV6D 1YJWA 4LW1A 2KUMA 3GTPB 1ET9A 1UEAB 2XRSD 3MZ5A 2O2LD 2RDHA 4F87A 1IL2A 3S1MH 4A3MB 1VQ7A 4RWSC 2O4XA 1LTBD 1S5ED 3SK4A 3NP8A 4XIGS 4B3TL 1STBA 4IOCA 4DR5Q 3H09A 4IJHA 1O7LA 4B3SQ 3J7AF 5FO9B 5CBAE 1NCVA 2EZVA 3KF8A 3GV6A 4JPBW 1QZGA 4OIJA 3GTQH 2NVQB 4ZKBB 4A3JB 2QEJC 3GD7A
chains in the Genus database with same CATH topology
5C3EG 3D31A 3KF6A 5C4XH 1XMOQ 3CC7A 2R6GA 4DPGA 4QGUA 1A8VA 1RIPA 4DV6Q 1N33L 5HGQA 3U4VA 2E5LL 1HZ9A 3BJUA 2I5MX 5LMUL 4P72A 2R92G 5M5XH 3PGZA 3HOVG 4GN3B 4HJ9A 4HJAA 3HOVH 1UWVA 1HZCA 1KRTA 4EX5A 1XNRL 4X6AH 3RZDH 1UEBA 4YY3Q 4DR7L 4A93G 1Q7YC 1HR0L 1N36Q 2JA8G 5FLMG 4DV2L 1MKHA 2K5HA 5IYDG 5ELNA 1EQRA 1B7YB 3H0GG 3S2HH 1DGSA 2CFMA 2MNAA 1PH9A 1KC8C 3BU2A 3GO5A 1K9MC 2ATWA 4JBKA 4JI7Q 1KXLA 1S3OA 1X3FA 1GD7A 4DKAC 2UXCL 1YIJA 1JB7A 3GTKH 3GDEA 4JCVE 5GAEC 3S2DH 1PH1A 3B6YA 3RZOH 1N33Q 4JYAQ 1PVOA 2JE6I 1QVGA 4LFCL 1D8LA 2B29A 2H5XA 1XPRA 4X64Q 1X9NA 3HOZH 1PYBA 1YZ6A 3AFQA 2IX1A 1N34L 1VQKA 4DK3C 4Y7NH 2K50A 4GOPC 4MZ9A 2YV5A 4LUOA 1PYSB 4HIMA 3J7A5 1NY4A 2A19A 4XTCS 4DV5Q 2FXQA 3FKIG 5C44G 3ULPA 2HHHQ 4HJ5A 1HR0Q 3PUWA 2Z6KA 3UDFA 4A3EG 1O7IA 4TVAB 1FVIA 2CKZB 3PUYA 4LF5L 3CP0A 1HZBA 3K81C 3PCOB 4P71A 1Y14B 3KJPA 1D7QA 4OWWB 3F2BA 1IBKQ 4DV3Q 3J80i 5C3EH 4C3IH 1U0LA 3NELA 2Q2HA 2QGQA 3HOZG 4X65Q 4JV5L 2I5HA 3E9IA 1N34Q 5IT9c 1G291 2PI2A 2R7FA 2JA9A 5K36G 3J81i 2JK8A 4R4IA 2D62A 2VS1A 2Z6KC 3KYHC 4LF6L 3IRBA 1AE3A 1IZ6A 4A3KG 1K8GA 4BXXH 3UDXA 4R1JA 5IWAQ 5GROA 4IFDI 1C0AA 1AH9A 1Q8KA 4JI6Q 1KIXA 4GS3A 4HJ7A 2BH2A 4B3SL 4LF7Q 3M7NA 2E5LQ 4IJLA 2BA0A 5DLQE 1R9TH 3OYYA 2I0QA 4DUYL 3HKSA 2WAQG 5JEAJ 1JE5A 2Y0SG 2QA4A 4DR3Q 2WAQE 1GM5A 2JA6H 4JI5L 2MO1A 4QY7A 4JI3Q 4DUZQ 4GLAC 2PMZE 4JI3L 4A75A 2VL6A 1NMGA 3M4PA 3RN2A 4NXNQ 3M85A 1E22A 3I7FA 4JI0Q 4X62Q 1CUKA 4HIKA 1I5FA 2PNHA 4A3KH 2NVYH 5JEAG 5C0XG 1YVCA 4JI8Q 2ZM6L 5IYBG 4IPGA 5HY6A 4AH6A 3KJOA 2ZM6Q 1XMQQ 2L15A 4JOIC 4JI1L 2UUCQ 4K0KL 2K5NA 2UXBL 4GNXA 5LMNL 2K4KA 3RR5A 1JJGA 4DR1L 2EQSA 2IX0A 1MIUA 2XGTA 4C3HH 4A76A 1Q81C 4DR6Q 1A62A 1I3QH 1XNQQ 4AYBE 5FJ8G 2CQOA 5AJ3Q 4LFBQ 1LYLA 3WWVA 1VQ9A 1HJPA 3CCQA 2B63H 3GTPH 1CSQA 4DR3L 2BA1A 1U5KA 1BKBA 4OWTB 4IPDA 2NN6I 4BY1G 3BZCA 2WP8J 4AQYQ 4LNQA 1NE3A 4IPCA 1S40A 1NTGA 4LF5Q 4POGA 1E3PA 3W1GA 3I56A 3S24A 3I2ZA 2E2JH 1XNQL 2UXDQ 1P8LA 2PQAB 3HOYH 3CD6A 4A3MH 4DV4L 1E24A 4JBWA 5FLMH 4YWKA 4BXXG 1J5EQ 3STBC 1OXXK 1WFQA 3NEMA 3ZJYC 2E2HH 2JA7H 5IP7H 4BBSG 3K0XA 1I94L 1WCMH 3PO2G 2NZHA 2F4VQ 3KDFB 4JI1Q 2Y0SE 2CWAA 1KL9A 4P75A 3FP9A 4H02A 2JEAI 4A3DH 2ID0A 2IHFA 2JQOA 3F2DA 1V9PA 5C0XJ 4NXNL 3TS2A 1VQPA 4A3GH 2AHOB 2JA5H 1X54A 4LUVA 5IP9G 4JI0L 2UXCQ 2GVBA 4A4IA 3OW2A 2NVQH 4PZ6A 4KI0A 2AKWB 1UE6A 4POFA 3S16H 4JI5Q 4NXMQ 5C44H 3DM3A 4OONA 5M3FG 1Z47A 2EIFA 1EIYB 3A74A 1CKOA 1AE2A 4HIOA 1VQNA 4L5RC 4DNIA 3D0FA 1JMCA 1JT8A 1G6PA 3PUVA 2YTVA 4DV1L 3VDYA 1M1KC 1YHBA 1TWAH 4UP8A 3HKZG 4AIMA 1PH3A 2R93H 3U4ZA 3EN2A 4YCWA 3PO2H 1EWIA 5M3MG 3PF5A 4LF9Q 4LF6Q 4GOPB 1CKMA 1WOCA 2V1CC 1MJEA 3I4MH 1KHIA 1PA6A 1K73C 5IWAL 3M9BA 1SE8A 4KHPQ 1VS0A 2WB1G 5LMNQ 1E7ZA 4DK6C 1P16A 2UU9Q 3HOXH 1L1OB 1VQFA 3JC66 4LF9L 1J5EL 4DAMA 4YWMA 4A3JG 4GLVB 1N32Q 3CW2C 1X65A 4HJ8A 3CMAA 2ZTCA 2I5LX 2AWOA 5JJKA 2JA7G 3NENA 1WJJA 4AQYL 4DUZL 2VUMG 2K52A 3I55A 1YBYA 1EOVA 1VQAA 4DV1Q 1X3GA 3S15H 4OXPA 1GVPA 3UE0A 1A0IA 3E9HA 4R4TA 4B3ML 3RN5A 3TEHB 4UP9A 2HIVA 5AJ3L 1YHAA 1Q1BA 5H1SE 3FHWA 2RHQB 1VQOA 4NXML 5M5WH 1YJNA 2RF4A 4L5QA 1M90C 3CPWA 1VQHA 1PH5A 1HNWL 1XNRQ 1BBUA 5GQOA 4JI6L 1SR3A 3I4MG 3UE1A 1Q1EA 3CC2A 5JJLA 3A5UA 4MTNA 3W5OA 4C2MH 2ALYB 4A3FG 1PHJA 4A3LG 2A1AA 2KCTA 4IPHA 4IO9A 4DR4L 4IOAA 4RG1A 4JV5Q 1PV4A 3F1ZA 4P74A 1Y1VH 4OWXB 1VQJA 1X3EA 2LXKA 4B3MQ 1FGUA 3PO3G 4YY3L 4DR7Q 2OTJA 1WI5A 4YHHL 3K80C 2VNUD 2VQFQ 2VY3A 4O2DA 1VQEA 4J15A 3CCEA 2OWOA 3PF4A 1N8RC 1VQ8A 2KBNA 1LTLA 1B70B 1K83H 3GTGH 4GNXC 4A93H 2JEBI 2YTYA 4A3FH 2ASBA 1SN8A 1QZHA 3U50C 2R92H 1VCIA 2WFWA 1VQ5A 2YU9H 5M3FH 1XTDA 4LF4L 1PH4A 3A5ZB 4BBRG 2Q2UA 1H95A 4R4QA 4A3BH 3CQZH 2PI2E 1Q46A 3PUXA 5J3BA 3G4SA 1PH8A 2HT1A 1I50H 5FLXc 3H3VH 3PUZA 3FKIH 4KHZA 4KHPL 3LGJA 4A3CG 1L0WA 1KD1C 1IBLL 4A3CH 3ULJA 1IBMQ 1CSPA 4A3DG 3I4NH 1I6HH 4ME3A 2Q2TA 1OXTA 4EQ5A 4R4CA 4L5SA 3GTMH 2JJQA 3KF8B 4JI8L 3L2PA 1EQQA 1YITA 4DR2Q 1IBKL 4B3TQ 3PV0A 4BA1I 4A3GG 1KAWA 2IY5B 2RHSB 3KF6B 2VQFL 4UP7A 5BR8L 1OXSC 2F3IA 2KENA 3CMEA 1XPUA 5ELOA 4UY8C 4A3BG 4DR6L 4IFDJ 1X56A 2OQ0A 3EIVA 4PMWA 1TWFH 3DLLA 1MJCA 3JAMc 2R7DA 4LF8L 3OTOL 1FL0A 3U58A 3MEFA 1VQMA 1PH6A 1XMQL 3S1RH 3CAMA 3TQYA 1OTCA 3M4OH 4DUYQ 1VQLA 2VUMH 3I4NG 4DV6L 3S1NH 3HOUH 1LUZA 2F52A 1VQGA 4JI4L 1UE7A 1KRSA 5IP7G 3TRZA 5FJ8H 5IY0A 1TWHH 5M3MH 2E8GA 1IBML 3CCVA 2MO0A 1V1QA 4OO1I 3L0OA 3H3VI 4JBJA 2ZTEA 4R4OA 1J6QA 3ICEA 3UDIA 4A3IH 3KDFA 4GNXB 4LF4Q 1OXVA 4YWLA 5BR8Q 2HIXA 3UDGA 4BY1H 1JJ2A 4A3LH 2N49A 2OQKA 3KFUA 3RNUA 3NBHB 3F8TA 4QQBX 3HFZB 4L5TA 4QL5A 2ZJQA 3S14H 1EUJA 1VQBA 1QVFA 1TXYA 2VQEL 5C4XG 3CPFA 4GN5A 3TS0A 2LSSA 3HOWG 4B3RQ 2DGYA 4PZ8A 1WYDA 2Q2IA 2R93G 2B63G 4GKJQ 3A0JA 1Y1WH 4X66Q 1GO3E 3K8AA 3KLWA 4LFCQ 2UUCL 4K0KQ 3JAMi 1UE5A 3GTOH 2UXBQ 3S17H 3HOXG 2IHEA 1K3RA 2YYZA 3SGIA 5M5YH 4JBMA 4YCUA 1VQIA 3J80c 2VW9A 4DV3L 2N8NA 3G71A 2VZAA 4GKKL 2D0PA 4HIDA 3GTLH 3J81j 4QIWE 2RCNA 2YTXA 4DV7L 2N3SA 1HNWQ 1HNZL 4DV7Q 2ZTDA 5IYDH 2ES2A 2JA8H 1K8AC 1FJGL 1HH2P 1L1OA 2N78A 1Y1VG 2UUAL 1BBWA 4PZ7A 3I4OA 3T1YQ 1JJCB 3G48A 4JC0A 2UU9L 2LXJA 1S72A 3L7ZC 4GN4B 4O0AA 3BZKA 5IYCH 3CCUA 3GTJH 4DV0L 2OTLA 4YCVA 2E2IH 1Y1WG 1N36L 4DR4Q 1YEZA 2KHIA 1HNZQ 3K7AH 4NB3A 2K75A 3AFPA 3E0EA 4KLKA 3TREA 4IFDG 4GKJL 4OO1G 4Y52H 5JJIA 1HZAA 3HKZE 2R7ZH 2A8VA 1EIFA 4JI4Q 3MXNB 3G6EA 3PIPA 1IYJB 5EAYA 2AWNA 4LFAQ 1W3SA 4A3IG 1XMOL 4JI7L 4LWCA 4A3JH 2UUBQ 2NVXH 1V43A 2WB1E 4X65L 4GOPA 1ASZA 4JI2Q 1W2BA 3CCLA 3ULLA 1WCMG 3J7ZC 1HNXQ 4JYAL 4DV2Q 4WJ3M 1EYGA 4DAYB 4RMFA 1K0RA 4BY7G 2UUAQ 2CWPA 1G51A 3RLOA 5IE8A 3F2CA 4DR5L 1SROA 2KHJA 4OX9L 2NVTH 3KOJA 1NJIC 1LM0A 3HOWH 3RLNA 3STBD 5LMNW 1OXUA 2AMCB 1VQ4A 1SFOH 2NZOA 4P73A 2D0OA 2HHHL 5GAHC 4ALPA 2QEXA 3CCSA 1L1OC 4LFBL 2UUBL 1I94Q 3S1QH 4LUZA 2ZJPA 3RLFA 5GADC 4X64L 4LFAL 5E7NA 5GAGC 1C7YA 4FDBA 1Z9FA 3H0GH 2B3GA 1SMXA 5LMUQ 4A3MG 2UXDL 2MFIA 3AYHB 2VQEQ 1XJVA 2C35B 4X62L 2PQAA 1VQ6A 4BA2I 4PG3A 1Q82C 3M3YH 4BY7H 2F4VL 1X55A 1VQDA 1GKHA 1PFSA 1SLJA 5IYCG 3J81c 4QJFA 4AYBG 2BH8A 2NN6G 3M4QA 3PO3H 3PIOA 1QVCA 4JOIA 3OTOQ 3CC4A 1L2FA 3PSIA 1T9HA 1VQCA 4YHHQ 1A63A 2DUDA 3CCJA 1IXRA 1E1TA 2JA5G 3ERSX 1KQSA 1IBLQ 1YJ9A 3H15A 3ER0A 4APVA 1ASYA 3Q8DA 3CXCA 1HNXL 1Q86C 4UPAA 2ZJRA 3K7UC 2K5VA 4DR2L 4WJ4A 4BBRH 1XPOA 1Q12A 1PH2A 2CCZA 1E1OA 1SRUA 1C9OA 5IYBH 1YJWA 3W1BA 4LW1A 1N9WA 2IT1A 3AQQA 2MQHA 4X66L 3EBEA 2GVAA 1IL2A 3HOUG 3S1MH 1NBWA 2K14A 3CF5A 1YHQA 1VQ7A 4B3RL 4LF8Q 4DR1Q 2JA6G 2Z0SA 4DV0Q 4DV4Q 4JG2A 4GLXA 5C0XI 3CCRA 2R7ZG 4NPSA 5IP9H 5C4JH 4XIGS 4B3TL 1NMFA 2OCEA 1EFWA 4TQUS 1QUQB 3T1YL 4MNOA 3T1HQ 2HQLA 1CKNA 1X6OA 2GN5A 2EXDA 1FJGQ 4OX9Q 4IOCA 3T1HL 3AEVA 4DR5Q 4IJHA 1TWGH 1B8AA 4B3SQ 4LF7L 4C3JH 1RL2A 3CCMA 1PH7A 1BVSA 2KCMA 4BBSH 1N32L 1TWCH 1HR0W 3HOYG 4DV5L 4GKKQ 2XTIA 1QZGA 4JI2L 3GTQH 1QUQA 1UE1A 4A3EH 1CKNB 1YI2A 1YNXA 3GD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E G;  3D31 A;  3KF6 A;  5C4X H;  1XMO Q;  3CC7 A;  2R6G A;  4DPG A;  4QGU A;  1A8V A;  1RIP A;  4DV6 Q;  1N33 L;  5HGQ A;  3U4V A;  2E5L L;  1HZ9 A;  3BJU A;  2I5M X;  5LMU L;  4P72 A;  2R92 G;  5M5X H;  3PGZ A;  3HOV G;  4GN3 B;  4HJ9 A;  4HJA A;  3HOV H;  1UWV A;  1HZC A;  1KRT A;  4EX5 A;  1XNR L;  4X6A H;  3RZD H;  1UEB A;  4YY3 Q;  4DR7 L;  4A93 G;  1Q7Y C;  1HR0 L;  1N36 Q;  2JA8 G;  5FLM G;  4DV2 L;  1MKH A;  2K5H A;  5IYD G;  5ELN A;  1EQR A;  1B7Y B;  3H0G G;  3S2H H;  1DGS A;  2CFM A;  2MNA A;  1PH9 A;  1KC8 C;  3BU2 A;  3GO5 A;  1K9M C;  2ATW A;  4JBK A;  4JI7 Q;  1KXL A;  1S3O A;  1X3F A;  1GD7 A;  4DKA C;  2UXC L;  1YIJ A;  1JB7 A;  3GTK H;  3GDE A;  4JCV E;  5GAE C;  3S2D H;  1PH1 A;  3B6Y A;  3RZO H;  1N33 Q;  4JYA Q;  1PVO A;  2JE6 I;  1QVG A;  4LFC L;  1D8L A;  2B29 A;  2H5X A;  1XPR A;  4X64 Q;  1X9N A;  3HOZ H;  1PYB A;  1YZ6 A;  3AFQ A;  2IX1 A;  1N34 L;  1VQK A;  4DK3 C;  4Y7N H;  2K50 A;  4GOP C;  4MZ9 A;  2YV5 A;  4LUO A;  1PYS B;  4HIM A;  3J7A 5;  1NY4 A;  2A19 A;  4XTC S;  4DV5 Q;  2FXQ A;  3FKI G;  5C44 G;  3ULP A;  2HHH Q;  4HJ5 A;  1HR0 Q;  3PUW A;  2Z6K A;  3UDF A;  4A3E G;  1O7I A;  4TVA B;  1FVI A;  2CKZ B;  3PUY A;  4LF5 L;  3CP0 A;  1HZB A;  3K81 C;  3PCO B;  4P71 A;  1Y14 B;  3KJP A;  1D7Q A;  4OWW B;  3F2B A;  1IBK Q;  4DV3 Q;  3J80 i;  5C3E H;  4C3I H;  1U0L A;  3NEL A;  2Q2H A;  2QGQ A;  3HOZ G;  4X65 Q;  4JV5 L;  2I5H A;  3E9I A;  1N34 Q;  5IT9 c;  1G29 1;  2PI2 A;  2R7F A;  2JA9 A;  5K36 G;  3J81 i;  2JK8 A;  4R4I A;  2D62 A;  2VS1 A;  2Z6K C;  3KYH C;  4LF6 L;  3IRB A;  1AE3 A;  1IZ6 A;  4A3K G;  1K8G A;  4BXX H;  3UDX A;  4R1J A;  5IWA Q;  5GRO A;  4IFD I;  1C0A A;  1AH9 A;  1Q8K A;  4JI6 Q;  1KIX A;  4GS3 A;  4HJ7 A;  2BH2 A;  4B3S L;  4LF7 Q;  3M7N A;  2E5L Q;  4IJL A;  2BA0 A;  5DLQ E;  1R9T H;  3OYY A;  2I0Q A;  4DUY L;  3HKS A;  2WAQ G;  5JEA J;  1JE5 A;  2Y0S G;  2QA4 A;  4DR3 Q;  2WAQ E;  1GM5 A;  2JA6 H;  4JI5 L;  2MO1 A;  4QY7 A;  4JI3 Q;  4DUZ Q;  4GLA C;  2PMZ E;  4JI3 L;  4A75 A;  2VL6 A;  1NMG A;  3M4P A;  3RN2 A;  4NXN Q;  3M85 A;  1E22 A;  3I7F A;  4JI0 Q;  4X62 Q;  1CUK A;  4HIK A;  1I5F A;  2PNH A;  4A3K H;  2NVY H;  5JEA G;  5C0X G;  1YVC A;  4JI8 Q;  2ZM6 L;  5IYB G;  4IPG A;  5HY6 A;  4AH6 A;  3KJO A;  2ZM6 Q;  1XMQ Q;  2L15 A;  4JOI C;  4JI1 L;  2UUC Q;  4K0K L;  2K5N A;  2UXB L;  4GNX A;  5LMN L;  2K4K A;  3RR5 A;  1JJG A;  4DR1 L;  2EQS A;  2IX0 A;  1MIU A;  2XGT A;  4C3H H;  4A76 A;  1Q81 C;  4DR6 Q;  1A62 A;  1I3Q H;  1XNQ Q;  4AYB E;  5FJ8 G;  2CQO A;  5AJ3 Q;  4LFB Q;  1LYL A;  3WWV A;  1VQ9 A;  1HJP A;  3CCQ A;  2B63 H;  3GTP H;  1CSQ A;  4DR3 L;  2BA1 A;  1U5K A;  1BKB A;  4OWT B;  4IPD A;  2NN6 I;  4BY1 G;  3BZC A;  2WP8 J;  4AQY Q;  4LNQ A;  1NE3 A;  4IPC A;  1S40 A;  1NTG A;  4LF5 Q;  4POG A;  1E3P A;  3W1G A;  3I56 A;  3S24 A;  3I2Z A;  2E2J H;  1XNQ L;  2UXD Q;  1P8L A;  2PQA B;  3HOY H;  3CD6 A;  4A3M H;  4DV4 L;  1E24 A;  4JBW A;  5FLM H;  4YWK A;  4BXX G;  1J5E Q;  3STB C;  1OXX K;  1WFQ A;  3NEM A;  3ZJY C;  2E2H H;  2JA7 H;  5IP7 H;  4BBS G;  3K0X A;  1I94 L;  1WCM H;  3PO2 G;  2NZH A;  2F4V Q;  3KDF B;  4JI1 Q;  2Y0S E;  2CWA A;  1KL9 A;  4P75 A;  3FP9 A;  4H02 A;  2JEA I;  4A3D H;  2ID0 A;  2IHF A;  2JQO A;  3F2D A;  1V9P A;  5C0X J;  4NXN L;  3TS2 A;  1VQP A;  4A3G H;  2AHO B;  2JA5 H;  1X54 A;  4LUV A;  5IP9 G;  4JI0 L;  2UXC Q;  2GVB A;  4A4I A;  3OW2 A;  2NVQ H;  4PZ6 A;  4KI0 A;  2AKW B;  1UE6 A;  4POF A;  3S16 H;  4JI5 Q;  4NXM Q;  5C44 H;  3DM3 A;  4OON A;  5M3F G;  1Z47 A;  2EIF A;  1EIY B;  3A74 A;  1CKO A;  1AE2 A;  4HIO A;  1VQN A;  4L5R C;  4DNI A;  3D0F A;  1JMC A;  1JT8 A;  1G6P A;  3PUV A;  2YTV A;  4DV1 L;  3VDY A;  1M1K C;  1YHB A;  1TWA H;  4UP8 A;  3HKZ G;  4AIM A;  1PH3 A;  2R93 H;  3U4Z A;  3EN2 A;  4YCW A;  3PO2 H;  1EWI A;  5M3M G;  3PF5 A;  4LF9 Q;  4LF6 Q;  4GOP B;  1CKM A;  1WOC A;  2V1C C;  1MJE A;  3I4M H;  1KHI A;  1PA6 A;  1K73 C;  5IWA L;  3M9B A;  1SE8 A;  4KHP Q;  1VS0 A;  2WB1 G;  5LMN Q;  1E7Z A;  4DK6 C;  1P16 A;  2UU9 Q;  3HOX H;  1L1O B;  1VQF A;  3JC6 6;  4LF9 L;  1J5E L;  4DAM A;  4YWM A;  4A3J G;  4GLV B;  1N32 Q;  3CW2 C;  1X65 A;  4HJ8 A;  3CMA A;  2ZTC A;  2I5L X;  2AWO A;  5JJK A;  2JA7 G;  3NEN A;  1WJJ A;  4AQY L;  4DUZ L;  2VUM G;  2K52 A;  3I55 A;  1YBY A;  1EOV A;  1VQA A;  4DV1 Q;  1X3G A;  3S15 H;  4OXP A;  1GVP A;  3UE0 A;  1A0I A;  3E9H A;  4R4T A;  4B3M L;  3RN5 A;  3TEH B;  4UP9 A;  2HIV A;  5AJ3 L;  1YHA A;  1Q1B A;  5H1S E;  3FHW A;  2RHQ B;  1VQO A;  4NXM L;  5M5W H;  1YJN A;  2RF4 A;  4L5Q A;  1M90 C;  3CPW A;  1VQH A;  1PH5 A;  1HNW L;  1XNR Q;  1BBU A;  5GQO A;  4JI6 L;  1SR3 A;  3I4M G;  3UE1 A;  1Q1E A;  3CC2 A;  5JJL A;  3A5U A;  4MTN A;  3W5O A;  4C2M H;  2ALY B;  4A3F G;  1PHJ A;  4A3L G;  2A1A A;  2KCT A;  4IPH A;  4IO9 A;  4DR4 L;  4IOA A;  4RG1 A;  4JV5 Q;  1PV4 A;  3F1Z A;  4P74 A;  1Y1V H;  4OWX B;  1VQJ A;  1X3E A;  2LXK A;  4B3M Q;  1FGU A;  3PO3 G;  4YY3 L;  4DR7 Q;  2OTJ A;  1WI5 A;  4YHH L;  3K80 C;  2VNU D;  2VQF Q;  2VY3 A;  4O2D A;  1VQE A;  4J15 A;  3CCE A;  2OWO A;  3PF4 A;  1N8R C;  1VQ8 A;  2KBN A;  1LTL A;  1B70 B;  1K83 H;  3GTG H;  4GNX C;  4A93 H;  2JEB I;  2YTY A;  4A3F H;  2ASB A;  1SN8 A;  1QZH A;  3U50 C;  2R92 H;  1VCI A;  2WFW A;  1VQ5 A;  2YU9 H;  5M3F H;  1XTD A;  4LF4 L;  1PH4 A;  3A5Z B;  4BBR G;  2Q2U A;  1H95 A;  4R4Q A;  4A3B H;  3CQZ H;  2PI2 E;  1Q46 A;  3PUX A;  5J3B A;  3G4S A;  1PH8 A;  2HT1 A;  1I50 H;  5FLX c;  3H3V H;  3PUZ A;  3FKI H;  4KHZ A;  4KHP L;  3LGJ A;  4A3C G;  1L0W A;  1KD1 C;  1IBL L;  4A3C H;  3ULJ A;  1IBM Q;  1CSP A;  4A3D G;  3I4N H;  1I6H H;  4ME3 A;  2Q2T A;  1OXT A;  4EQ5 A;  4R4C A;  4L5S A;  3GTM H;  2JJQ A;  3KF8 B;  4JI8 L;  3L2P A;  1EQQ A;  1YIT A;  4DR2 Q;  1IBK L;  4B3T Q;  3PV0 A;  4BA1 I;  4A3G G;  1KAW A;  2IY5 B;  2RHS B;  3KF6 B;  2VQF L;  4UP7 A;  5BR8 L;  1OXS C;  2F3I A;  2KEN A;  3CME A;  1XPU A;  5ELO A;  4UY8 C;  4A3B G;  4DR6 L;  4IFD J;  1X56 A;  2OQ0 A;  3EIV A;  4PMW A;  1TWF H;  3DLL A;  1MJC A;  3JAM c;  2R7D A;  4LF8 L;  3OTO L;  1FL0 A;  3U58 A;  3MEF A;  1VQM A;  1PH6 A;  1XMQ L;  3S1R H;  3CAM A;  3TQY A;  1OTC A;  3M4O H;  4DUY Q;  1VQL A;  2VUM H;  3I4N G;  4DV6 L;  3S1N H;  3HOU H;  1LUZ A;  2F52 A;  1VQG A;  4JI4 L;  1UE7 A;  1KRS A;  5IP7 G;  3TRZ A;  5FJ8 H;  5IY0 A;  1TWH H;  5M3M H;  2E8G A;  1IBM L;  3CCV A;  2MO0 A;  1V1Q A;  4OO1 I;  3L0O A;  3H3V I;  4JBJ A;  2ZTE A;  4R4O A;  1J6Q A;  3ICE A;  3UDI A;  4A3I H;  3KDF A;  4GNX B;  4LF4 Q;  1OXV A;  4YWL A;  5BR8 Q;  2HIX A;  3UDG A;  4BY1 H;  1JJ2 A;  4A3L H;  2N49 A;  2OQK A;  3KFU A;  3RNU A;  3NBH B;  3F8T A;  4QQB X;  3HFZ B;  4L5T A;  4QL5 A;  2ZJQ A;  3S14 H;  1EUJ A;  1VQB A;  1QVF A;  1TXY A;  2VQE L;  5C4X G;  3CPF A;  4GN5 A;  3TS0 A;  2LSS A;  3HOW G;  4B3R Q;  2DGY A;  4PZ8 A;  1WYD A;  2Q2I A;  2R93 G;  2B63 G;  4GKJ Q;  3A0J A;  1Y1W H;  4X66 Q;  1GO3 E;  3K8A A;  3KLW A;  4LFC Q;  2UUC L;  4K0K Q;  3JAM i;  1UE5 A;  3GTO H;  2UXB Q;  3S17 H;  3HOX G;  2IHE A;  1K3R A;  2YYZ A;  3SGI A;  5M5Y H;  4JBM A;  4YCU A;  1VQI A;  3J80 c;  2VW9 A;  4DV3 L;  2N8N A;  3G71 A;  2VZA A;  4GKK L;  2D0P A;  4HID A;  3GTL H;  3J81 j;  4QIW E;  2RCN A;  2YTX A;  4DV7 L;  2N3S A;  1HNW Q;  1HNZ L;  4DV7 Q;  2ZTD A;  5IYD H;  2ES2 A;  2JA8 H;  1K8A C;  1FJG L;  1HH2 P;  1L1O A;  2N78 A;  1Y1V G;  2UUA L;  1BBW A;  4PZ7 A;  3I4O A;  3T1Y Q;  1JJC B;  3G48 A;  4JC0 A;  2UU9 L;  2LXJ A;  1S72 A;  3L7Z C;  4GN4 B;  4O0A A;  3BZK A;  5IYC H;  3CCU A;  3GTJ H;  4DV0 L;  2OTL A;  4YCV A;  2E2I H;  1Y1W G;  1N36 L;  4DR4 Q;  1YEZ A;  2KHI A;  1HNZ Q;  3K7A H;  4NB3 A;  2K75 A;  3AFP A;  3E0E A;  4KLK A;  3TRE A;  4IFD G;  4GKJ L;  4OO1 G;  4Y52 H;  5JJI A;  1HZA A;  3HKZ E;  2R7Z H;  2A8V A;  1EIF A;  4JI4 Q;  3MXN B;  3G6E A;  3PIP A;  1IYJ B;  5EAY A;  2AWN A;  4LFA Q;  1W3S A;  4A3I G;  1XMO L;  4JI7 L;  4LWC A;  4A3J H;  2UUB Q;  2NVX H;  1V43 A;  2WB1 E;  4X65 L;  4GOP A;  1ASZ A;  4JI2 Q;  1W2B A;  3CCL A;  3ULL A;  1WCM G;  3J7Z C;  1HNX Q;  4JYA L;  4DV2 Q;  4WJ3 M;  1EYG A;  4DAY B;  4RMF A;  1K0R A;  4BY7 G;  2UUA Q;  2CWP A;  1G51 A;  3RLO A;  5IE8 A;  3F2C A;  4DR5 L;  1SRO A;  2KHJ A;  4OX9 L;  2NVT H;  3KOJ A;  1NJI C;  1LM0 A;  3HOW H;  3RLN A;  3STB D;  5LMN W;  1OXU A;  2AMC B;  1VQ4 A;  1SFO H;  2NZO A;  4P73 A;  2D0O A;  2HHH L;  5GAH C;  4ALP A;  2QEX A;  3CCS A;  1L1O C;  4LFB L;  2UUB L;  1I94 Q;  3S1Q H;  4LUZ A;  2ZJP A;  3RLF A;  5GAD C;  4X64 L;  4LFA L;  5E7N A;  5GAG C;  1C7Y A;  4FDB A;  1Z9F A;  3H0G H;  2B3G A;  1SMX A;  5LMU Q;  4A3M G;  2UXD L;  2MFI A;  3AYH B;  2VQE Q;  1XJV A;  2C35 B;  4X62 L;  2PQA A;  1VQ6 A;  4BA2 I;  4PG3 A;  1Q82 C;  3M3Y H;  4BY7 H;  2F4V L;  1X55 A;  1VQD A;  1GKH A;  1PFS A;  1SLJ A;  5IYC G;  3J81 c;  4QJF A;  4AYB G;  2BH8 A;  2NN6 G;  3M4Q A;  3PO3 H;  3PIO A;  1QVC A;  4JOI A;  3OTO Q;  3CC4 A;  1L2F A;  3PSI A;  1T9H A;  1VQC A;  4YHH Q;  1A63 A;  2DUD A;  3CCJ A;  1IXR A;  1E1T A;  2JA5 G;  3ERS X;  1KQS A;  1IBL Q;  1YJ9 A;  3H15 A;  3ER0 A;  4APV A;  1ASY A;  3Q8D A;  3CXC A;  1HNX L;  1Q86 C;  4UPA A;  2ZJR A;  3K7U C;  2K5V A;  4DR2 L;  4WJ4 A;  4BBR H;  1XPO A;  1Q12 A;  1PH2 A;  2CCZ A;  1E1O A;  1SRU A;  1C9O A;  5IYB H;  1YJW A;  3W1B A;  4LW1 A;  1N9W A;  2IT1 A;  3AQQ A;  2MQH A;  4X66 L;  3EBE A;  2GVA A;  1IL2 A;  3HOU G;  3S1M H;  1NBW A;  2K14 A;  3CF5 A;  1YHQ A;  1VQ7 A;  4B3R L;  4LF8 Q;  4DR1 Q;  2JA6 G;  2Z0S A;  4DV0 Q;  4DV4 Q;  4JG2 A;  4GLX A;  5C0X I;  3CCR A;  2R7Z G;  4NPS A;  5IP9 H;  5C4J H;  4XIG S;  4B3T L;  1NMF A;  2OCE A;  1EFW A;  4TQU S;  1QUQ B;  3T1Y L;  4MNO A;  3T1H Q;  2HQL A;  1CKN A;  1X6O A;  2GN5 A;  2EXD A;  1FJG Q;  4OX9 Q;  4IOC A;  3T1H L;  3AEV A;  4DR5 Q;  4IJH A;  1TWG H;  1B8A A;  4B3S Q;  4LF7 L;  4C3J H;  1RL2 A;  3CCM A;  1PH7 A;  1BVS A;  2KCM A;  4BBS H;  1N32 L;  1TWC H;  1HR0 W;  3HOY G;  4DV5 L;  4GKK Q;  2XTI A;  1QZG A;  4JI2 L;  3GTQ H;  1QUQ A;  1UE1 A;  4A3E H;  1CKN B;  1YI2 A;  1YNX A;  3GD7 A; 
#chains in the Genus database with same CATH topology
 4NP5 A;  3IFT A;  5C4X H;  1TS4 A;  2R6G A;  4QGU A;  2XNA C;  4DV6 Q;  5M5X H;  4IFD H;  2PPB C;  4CKE A;  2KJX A;  1XNR L;  3DM1 A;  3PMF A;  1HR0 L;  3SXH A;  3H0G G;  5ELC A;  3BU2 A;  3GO5 A;  1D5M C;  4JBK A;  4JI7 Q;  4FF1 A;  3S9W A;  4CKB A;  4K2K A;  2BDN A;  3GDE A;  4JCV E;  1PH1 A;  4JYA Q;  1N33 Q;  1QVG A;  1D1K A;  1YZ6 A;  3JAM E;  4H44 C;  2DJG C;  1N34 L;  1H9K A;  2K50 A;  4MZ9 A;  4DV5 Q;  3FKI G;  2HHH Q;  1UAP A;  4KKT A;  5M3F B;  1O7I A;  4K6L A;  1TWG B;  2RCF A;  4MHE A;  4DV3 Q;  1PRT D;  2JA5 B;  1XWE A;  1ZYR D;  4C3I H;  1U0L A;  3NEL A;  1V8Q A;  1AP0 A;  2QGQ A;  1C8C A;  3HOZ G;  5FK9 C;  4JV5 L;  1L0X B;  1N34 Q;  1FR3 A;  5IT9 c;  3IFD A;  2JK8 A;  4KD3 A;  4R4I A;  2KHS A;  3KYH C;  1JE4 A;  2WII B;  3IRB A;  4LF6 L;  4BXX H;  4R1J A;  2V4D A;  3MXG A;  5IWA Q;  4IFD I;  1C0A A;  1AH9 A;  2N55 A;  4IUV A;  4LF7 Q;  4G7Z C;  2ICE C;  1CA5 A;  3P75 A;  1CFM A;  3HKS A;  3OWF A;  1FNV A;  4O1N A;  4U67 3;  5CR3 A;  3IL8 A;  1A2T A;  4KY5 A;  4QUF A;  1IW7 D;  4RKB A;  3VA5 A;  2PZU A;  4JI3 Q;  4DN4 M;  2VL6 A;  1SNC A;  1BXT A;  5J1Z A;  2HQE A;  5TSS A;  4X62 Q;  1I5F A;  2ZM6 L;  3DUZ A;  2EDG A;  1SNP A;  5IYB G;  5C3E B;  1I4X A;  2EQS A;  3MVV A;  4C3H H;  1SDF A;  4CDE C;  2CQO A;  1PYW D;  4C1N I;  3WWV A;  3MXP A;  1VQ9 A;  1BKB A;  4OWT B;  4BY1 G;  4CGY B;  3BZC A;  2WP8 J;  4AQY Q;  1S40 A;  1NTG A;  4UHV A;  3J81 L;  1E3P A;  3S24 A;  1KDB A;  1P8L A;  2PQA B;  3HOY H;  4BXX G;  4YWK A;  1K0S A;  1VMP A;  3STB C;  3S1Q B;  3NEM A;  2DNE A;  5IP7 H;  1ICW A;  1RHP A;  4QUC A;  3PIP 3;  2WB1 B;  1X3P A;  1FYC A;  2Y0S E;  3FP9 A;  4H02 A;  2RQX A;  4PMB A;  4XQJ A;  3MHB A;  3F2D A;  1V9P A;  2K5Q A;  5F2D A;  2AHO B;  4LUV A;  1E2Z A;  2GVB A;  3HGB A;  5G3L F;  4A4I A;  2N88 A;  4PZ6 A;  4NDX A;  1UE6 A;  5M3F G;  3TSS A;  1EIY B;  4BY1 B;  2VUM B;  3E5S A;  4DNR B;  1E2V A;  1SE4 A;  4Y7N B;  3L3O C;  5COR A;  1TWA H;  4K2L A;  3EN2 A;  3PO2 H;  1EWI A;  3PF5 A;  3K7A B;  1MSH A;  4GOP B;  4LF6 Q;  1WOC A;  4WJW A;  2BDO A;  2F0H A;  3M9B A;  5C5M A;  4KHP Q;  1ESR A;  3ERQ A;  3EFX D;  1P16 A;  4B08 A;  1FD7 D;  2F0G A;  2FFK B;  1VQF A;  2QF7 A;  4DAM A;  4P2C B;  3I70 A;  3CMA A;  2ZTC A;  2I5L X;  3NEN A;  2DN8 A;  2L9H A;  4DUZ L;  2VUM G;  2K52 A;  3AMU A;  3I55 A;  1U4R A;  4DV1 Q;  5K5P A;  1A0I A;  1QJO A;  3RN5 A;  1PLF A;  3TEH B;  4UP9 A;  3FHW A;  2IL8 A;  4L8J A;  1YJN A;  4L5Q A;  1M90 C;  1PH5 A;  4NW2 A;  1SR3 A;  1A3T A;  5EBD A;  3UE1 A;  1BNZ A;  3CC2 A;  5JJL A;  1G6Z A;  4TSS A;  3KLS X;  3A5U A;  3K58 A;  4MTN A;  5EKI A;  3W5O A;  3HOX B;  4A3F G;  4DAV A;  1SNO A;  1HA5 A;  2KCT A;  4IOA A;  2XIW A;  3VYS A;  4U68 A;  1VQJ A;  1KLU D;  4N9T A;  2LXK A;  1IHZ A;  2B2W C;  2EYH A;  2PW7 A;  4YHH L;  2VY3 A;  1VQE A;  4J15 A;  4ZCK A;  5IGD A;  3CCE A;  3PF4 A;  1N8R C;  1VQ8 A;  1LTL A;  1W6K A;  3HOU B;  2KCN A;  2JEB I;  3K0Y A;  2R92 H;  1SN8 A;  4K5V A;  1DOK A;  2FMM A;  2RBM A;  5EKL A;  2Q2U A;  1PH8 A;  2CW0 D;  3G4S A;  4KHP L;  4FXD A;  3T51 B;  1L0W A;  2F0U A;  4DK0 A;  4A3C H;  1IBM Q;  1CSP A;  1G91 A;  1BO0 A;  4ME3 A;  4EQ5 A;  4XDX A;  1SE3 A;  3TDQ A;  2IW3 A;  1ZXT A;  4B3T Q;  3PV0 A;  1KAW A;  3VR3 A;  4WFN 3;  2RHS B;  4J8Q A;  4RH6 A;  4L6T B;  5I2X A;  4UY8 C;  5KIX A;  1ZEQ X;  4IFD J;  1EY8 A;  2M2L A;  5A2Q L;  1SJE D;  4PMW A;  1MJC A;  3JAM c;  3OTO L;  2E2I B;  1GUN A;  3MEF A;  1VQM A;  1XMQ L;  3S1R H;  2B63 B;  4XYO A;  3M4O H;  2KOL A;  3Q23 A;  2OXP A;  3NSW A;  1VQG A;  1UE7 A;  3CU7 A;  3CRK C;  3CHB D;  1IKM A;  1A3U A;  2MO0 A;  2G5D A;  4QIW B;  3H3V I;  4JBJ A;  1J6Q A;  3ICE A;  3UDI A;  1G2S A;  3C46 A;  1SAP A;  1RTO A;  5C0X H;  3UDG A;  1HTP A;  2N49 A;  1TU2 B;  3KFU A;  2RA4 A;  3NBH B;  1D1I A;  3RNU A;  3F8T A;  2WIN B;  4L5T A;  2ZJQ A;  2F0D A;  4C3J G;  2LY7 A;  3DEP A;  1KTK A;  4B3R Q;  3FKI B;  1TQO A;  4CBV A;  2Q2I A;  2R93 G;  1ILP A;  1BCP C;  4X66 Q;  3MA2 B;  3K8A A;  3GTO H;  2DNC A;  3S17 H;  3HOX G;  1X32 A;  1PTO H;  3GTK B;  4JBM A;  1VQI A;  4HMI A;  2Z4H A;  2NZ1 D;  4ODG A;  2VZA A;  3G71 A;  3HOY B;  4HID A;  2J0T D;  5D14 A;  2N3S A;  1HNZ L;  2TSS A;  4DV7 Q;  1VMC A;  1EOT A;  3KUP A;  1L1O A;  2QCP X;  4JC0 A;  4XT1 B;  4PMC A;  4KHV A;  1K28 A;  3J81 E;  1YEZ A;  2KHI A;  4GKJ L;  1GJX A;  5JJI A;  4BBR B;  2RVL A;  2R93 B;  3HKZ E;  3A8J E;  3MWY W;  3OPO A;  4JI4 Q;  3MXN B;  4ULL A;  5CBE E;  1DM0 B;  4PQX A;  2F0W A;  2NVX H;  1ASZ A;  2B2U C;  1TS5 A;  3J7Z C;  1HNX Q;  2J4X A;  4JVZ A;  3TP8 A;  4A93 B;  4RMF A;  1EYA A;  5FKA C;  2UUA Q;  5IE8 A;  4DXF A;  3CRL C;  2NVT H;  1LM0 A;  3ITP A;  2PCF B;  3K59 A;  4P73 A;  2HHH L;  2QEX A;  3DEO A;  1L1O C;  4DXG A;  3NTH A;  1SNM A;  4I65 A;  4X64 L;  1SXT A;  3SK6 A;  1SYD A;  5GAG C;  1ROD A;  1C7Y A;  4FDB A;  1Q90 A;  2B3G A;  1SMX A;  5LMU Q;  1B53 A;  2MFI A;  3AYH B;  2VQE Q;  1XJV A;  2C35 B;  5M5W B;  2PQA A;  4BA2 I;  1DZ1 A;  2XWB B;  2F4V L;  5IYC G;  4HJ7 A;  4EQN A;  2NN6 G;  3M4Q A;  1NUC A;  4A3E B;  3PO3 H;  4WRD A;  2X69 A;  1F2M A;  3CC4 A;  1L2F A;  3PSI A;  1CHQ D;  2E75 C;  2K05 A;  1I6H B;  3ERS X;  1KQS A;  3H15 A;  3E6Z X;  4APV A;  1WD0 A;  1HNX L;  3CXC A;  5FO8 B;  5E3F A;  3E0J A;  1S5D D;  1HPC A;  3K7U C;  2K5V A;  2K6A A;  2WAQ B;  4DR2 L;  1SRU A;  1GHK A;  3W1B A;  5EQ0 A;  4YIJ A;  3AQQ A;  1FNW A;  3RZD B;  3FVQ A;  1WTW A;  3EBE A;  3HOV B;  3CF5 A;  2RKS A;  2F0P A;  2EYO A;  2X6L A;  3CCR A;  4NPS A;  4MNO A;  2ZT9 C;  2HQL A;  2GN5 A;  2EXD A;  1XYI A;  3MTS A;  3AEV A;  4Q0F A;  2L11 A;  2EY6 A;  3AU7 A;  4LF7 L;  2KCM A;  4DV5 L;  1EEF D;  4QCL A;  1EYD A;  5I2Y A;  4A3E H;  4P72 A;  5JAV A;  3CC7 A;  5CV6 A;  4OO1 H;  1N33 L;  5HGQ A;  3U4V A;  2E5L L;  4A3B B;  2I5M X;  5LMU L;  2R92 G;  3PGZ A;  2TMP A;  2DY8 A;  3HOV G;  3HOV H;  3NTI A;  1HZC A;  5G3L D;  3SHL A;  4X6A H;  4A93 G;  4BY7 B;  5ELN A;  4K5W A;  1EQR A;  2C9O A;  2XWJ B;  2O5I C;  3S2H H;  2JXM B;  1S5F D;  2ATW A;  3NE5 B;  4KTA A;  1KXL A;  1S3O A;  5D65 A;  2NTT A;  4DFA A;  4DKA C;  1YIJ A;  1PDQ A;  3I8Z A;  1EIG A;  1JB7 A;  3M4O B;  2Z4I A;  5GAE C;  3S2D H;  1HRJ A;  3RZO H;  1PVO A;  2JE6 I;  1HFN A;  4M8A A;  3HOZ H;  1I6V C;  4X64 Q;  1PYB A;  3AFQ A;  5JOB A;  2IX1 A;  2WAC A;  1RJT A;  1VQK A;  2L0C A;  5C4X B;  1YNN D;  1H9S A;  4LUO A;  4HIM A;  1QNU A;  1NY4 A;  2A19 A;  3ULP A;  5C44 G;  5BN4 A;  1MHW C;  3NXW A;  3I3C A;  4HJ5 A;  1HR0 Q;  4AYB B;  4A3E G;  2Q8T A;  3UDF A;  3DMU A;  3S16 B;  1NNX A;  1WVL A;  4C56 C;  1HZB A;  1K83 B;  2B8F A;  1Y14 B;  5BN3 A;  3F2B A;  2Q2H A;  5IT9 L;  3E9I A;  2R7F A;  4N9P A;  5JVG 3;  2EOT A;  3G6J B;  4A3K G;  1AE3 A;  1IZ6 A;  2AUJ D;  1WTP A;  5GRO A;  1KNA A;  2K28 A;  4JI6 Q;  1WD1 A;  4B3S L;  5EBC A;  4IJL A;  1R9T H;  1SNQ A;  1JWU D;  3VA7 A;  3OYY A;  3NWS A;  4DUY L;  1PZJ D;  2Y0S G;  5T1G A;  2QA4 A;  4DR3 Q;  1ZKO A;  4JI5 L;  2BOS A;  1D5Z C;  1EWH A;  3FMC A;  2PMZ E;  4GLA C;  1A3V A;  3UI2 A;  1NMG A;  1AZQ A;  1SYF A;  4LK1 C;  2NVX B;  1CUK A;  4ZQ3 A;  2NVY H;  1YVC A;  1XMQ Q;  2M9V A;  4H13 C;  4JOI C;  2K5W A;  1B3A A;  4A3K B;  2PZW A;  4DR1 L;  2B8G A;  1F2L A;  4A76 A;  4DR6 Q;  1A62 A;  1I3Q H;  3BVM A;  4AYB E;  2R92 B;  1GUG A;  5FJ8 G;  2KCC A;  4RAU C;  3S1R B;  2B63 H;  4DR3 L;  4IPD A;  2NN6 I;  1B3Q A;  3GP7 A;  5I9P A;  5KGU A;  1B50 A;  1NE3 A;  3H0G B;  4POG A;  1BQQ T;  2UXD Q;  3W1G A;  4MN3 A;  3I56 A;  4ZK9 B;  4JBW A;  1OXX K;  1WFQ A;  2E2H H;  3P7J A;  1HUM A;  1I3Q B;  2EXZ A;  3K0X A;  4XQN A;  1I94 L;  2FHT A;  2CHB D;  3KDF B;  1KL9 A;  1TS2 A;  2JEA I;  4A3D H;  1HHV A;  1JR0 D;  5ELF A;  4GZY C;  5C0X J;  4NXN L;  3HG9 A;  5IP9 G;  5ISR A;  3OW2 A;  4KI0 A;  2AKW B;  4NXM Q;  5C44 H;  3A54 A;  4OON A;  2EIF A;  3D6C A;  3NBI A;  1CKO A;  5IGB A;  4L5R C;  1G6P A;  1M1K C;  4DV1 L;  2D5D A;  3QO2 A;  2JA6 B;  3HKZ G;  4AIM A;  3SDZ A;  1Y69 U;  1BCP F;  4OGQ C;  3MC0 B;  1AW7 A;  2YU9 B;  5EGT A;  3I4M H;  1K73 C;  4ME5 A;  1SE8 A;  3OMG A;  1E7Z A;  4DK6 C;  1EY6 A;  3GTO B;  5J39 A;  4RHS A;  1RD9 D;  1L1O B;  4QF4 A;  1ET6 A;  3JC6 6;  3OSO A;  4G7O C;  2F3V A;  4IUU A;  1PMR A;  4XT3 B;  3WDN A;  1EY0 A;  2JSO A;  3HOW B;  3CW2 C;  1N32 Q;  1OO9 B;  1X65 A;  3TP6 A;  4HJ8 A;  1S4Z A;  2AWO A;  5JJK A;  1WJJ A;  2EPB A;  2Q8I B;  4FP5 D;  2O5J C;  1X3G A;  1EEI D;  3NQT A;  2XSC A;  2NBF A;  2B2W A;  2HIV A;  4KN4 C;  1YHA A;  1Q1B A;  5H1S E;  1VQO A;  4KKS A;  1HNW L;  3C1F A;  4XYQ A;  4OL7 A;  2F0T A;  4JI6 L;  4C2M H;  2ALY B;  1T5E A;  1EFI D;  3NTK A;  1PHJ A;  2H4O A;  1PV4 A;  5ELD A;  3OW7 A;  4B3M Q;  3W2D A;  3PO3 G;  1PTO D;  1SYC A;  5IOD A;  2IPK D;  1TWF B;  4B9W A;  1F9R A;  3P20 A;  4YY3 L;  5FLX L;  4DR7 Q;  2PNR C;  4CJ1 B;  1F9S A;  1PFM A;  5EPJ A;  2NVT B;  2L12 A;  3H91 A;  1ONL A;  1B70 B;  1SE2 A;  4GNX C;  4A93 H;  1EWC A;  1L0Y B;  1PTO C;  1VCI A;  3R3O A;  4LF4 L;  3SVM A;  3I4N B;  1F77 A;  5AFW A;  3CQZ H;  2PI2 E;  4L63 B;  1GOZ A;  1Z6H A;  5J3B A;  2HT1 A;  1LLR D;  3D4D A;  1DJR D;  3FKI H;  4A3I B;  3LGJ A;  5JPN C;  1KD1 C;  3QJY A;  2D2C C;  4A3D G;  1KDA A;  1I6H H;  4R4C A;  1SYB A;  3GTM H;  2JJQ A;  2NN6 H;  4KK7 A;  3SE0 A;  3L2P A;  3S15 B;  1ILQ A;  3PO3 B;  2L4N A;  3KF6 B;  2VQF L;  4CHT B;  2NTS A;  2F3I A;  4DR6 L;  1X56 A;  3EIV A;  2HCI A;  1B9M A;  3PQI A;  4OEM B;  2R7D A;  1R9T B;  1FL0 A;  3I91 A;  1STG A;  1OTC A;  2VUM H;  3I4N G;  1JOO A;  1LTR D;  3HOU H;  1GHJ A;  2F52 A;  1X3Q A;  1B9N A;  5IP7 G;  2AQ1 B;  3TRZ A;  5FJ8 H;  4HAE A;  3CCV A;  3ND9 A;  3J7Y W;  1CZG A;  5CV5 A;  2D9U A;  1GUO A;  3F2U A;  4GNX B;  4YWL A;  5BR8 Q;  2HIX A;  1IYV A;  2H1E A;  1JJ2 A;  2OQK A;  1PFN A;  4QQB X;  4QL5 A;  2QW7 A;  2VQE L;  2LMC B;  3M3Y B;  5C4X G;  1CQV A;  2DGY A;  4PZ8 A;  2G9D A;  4GKJ Q;  1HUN A;  1Y1W H;  1GO3 E;  1QWY A;  2IHE A;  2YYZ A;  5LL6 S;  4A3F B;  3SGI A;  4FYD A;  3J80 c;  4DV3 L;  2R3Z A;  1TR5 A;  4KD4 A;  1PZK D;  2ZXR A;  4QIW E;  4DV7 L;  2YTX A;  4F88 A;  2A68 C;  3P1H A;  3BDL A;  4H7B A;  2VB2 X;  2ES2 A;  2JA8 H;  1K8A C;  2N78 A;  2KEE A;  2UUA L;  1BBW A;  5COY A;  1JJC B;  3G48 A;  2LXJ A;  1PTO B;  2I46 A;  4GN4 B;  3BZK A;  4RFB A;  2X6G A;  2OTL A;  1N36 L;  4DR4 Q;  4C2M B;  1QG7 A;  3AFP A;  3E0E A;  4Y52 H;  2A73 B;  3NK9 A;  4IAL A;  2A8V A;  1EIF A;  1PFB A;  3W3A A;  1NR4 A;  3G6E A;  3T56 B;  1IYJ B;  4A3I G;  4N8X 1;  1XMO L;  4LWC A;  3L9A X;  2UUB Q;  4M1U B;  5KNB A;  4WOR A;  5M3M B;  1GUW A;  3JAM L;  3ULL A;  1WCM G;  4WJ3 M;  4C1N K;  1J8I A;  1E2W A;  1FNU A;  4OX9 L;  2SNM A;  1NJI C;  1EQT A;  3STB D;  2F03 A;  4FO2 A;  1STE A;  1JIC A;  2HD3 A;  2UUB L;  1A15 A;  3RLF A;  1XX8 A;  4HR7 B;  3A56 A;  3C3L A;  1CTM A;  1Z9F A;  4G7H C;  2EYJ A;  4C3H G;  1MI2 A;  4X62 L;  4BY7 H;  4PG3 A;  2NVY B;  1SLJ A;  4JOI A;  3OTO Q;  3HEJ A;  1LTT D;  2L5T A;  3K5M A;  2EYL A;  3OIQ A;  2DUD A;  1IXR A;  4PV1 C;  1YJ9 A;  1ASY A;  3ER0 A;  1A2U A;  4HN7 A;  3TP7 A;  4HSP A;  2F0J A;  4KKU A;  2ZJR A;  1LTA D;  3D3R A;  2CCZ A;  1E1O A;  1C9O A;  1H9J A;  3V2T A;  1N9W A;  2EJG C;  1EL0 A;  2MQH A;  1TII D;  1NBW A;  1YHQ A;  4B3R L;  2Z6B A;  4LF8 Q;  2PZT A;  4DV4 Q;  3J7A V;  4JG2 A;  5C0X I;  2R7Z G;  5IP9 H;  5C4J H;  1QUQ B;  3T1Y L;  1CKN A;  1FJG Q;  4OX9 Q;  3T1H L;  1BCP B;  1LT3 D;  1TWG H;  1B8A A;  3CCM A;  1PH7 A;  4BBS H;  3KK7 A;  4GKK Q;  2KVM A;  1QUQ A;  3LWU A;  1UE1 A;  3QR8 A;  1CKN B;  2B2V C;  1YNX A;  1STN A;  3KF6 A;  3NWT A;  1XMO Q;  3HZX A;  1A8V A;  1RIP A;  4KMU C;  3BJU A;  2XN9 C;  1MBY A;  3X3M A;  4HJ9 A;  2E2H B;  1KRT A;  1EU3 A;  3RZD H;  4YY3 Q;  4Q5V A;  4DR7 L;  1Q7Y C;  4ZRZ A;  2K5H A;  5IYD G;  4EVO A;  2E76 C;  1KNE A;  2CFM A;  2EE1 A;  1F9P A;  2MNA A;  1PH9 A;  3AB9 A;  1KC8 C;  3HP3 A;  3R2T A;  1LT5 D;  1TS3 A;  1NAP A;  2UXC L;  1TT2 A;  4IZ8 A;  4RA8 A;  3I4M B;  1LAC A;  3B6Y A;  1I4P A;  4FXG C;  2QIL A;  2NWG A;  1D8L A;  2H5X A;  1JWM D;  2B2Y C;  3VR2 A;  4DK3 C;  4GOP C;  3OOC A;  5D3I B;  1PYS B;  2F3W A;  3J7A 5;  3KLS A;  4XTC S;  1U4L A;  1I4H A;  1JOK A;  3PUW A;  3T16 A;  4F8M A;  4TVA B;  1FVI A;  2BE5 C;  2CKZ B;  3S2D B;  4LF5 L;  2EY2 A;  3K81 C;  3PCO B;  4P71 A;  1D7Q A;  1ESF A;  1HFG A;  3RD4 A;  1IBK Q;  2F0E A;  3J80 i;  2JYO A;  5IGC A;  2J7Z A;  4RGM A;  1BR9 A;  2OF1 A;  4XXE A;  3S2H B;  5K36 G;  1G29 1;  1TY2 A;  2A6E C;  2FJ2 A;  3BG3 A;  1TWH B;  2D62 A;  2VS1 A;  3NQI A;  1K8G A;  5ELB A;  1Q8K A;  3N6R A;  4GS3 A;  2BH2 A;  3T53 B;  1Y1W B;  1MD2 D;  3NHH A;  3KBG A;  5JEA J;  1JE5 A;  2WAQ E;  4IQZ A;  3NPP A;  1A6X A;  3MFG A;  5KND A;  1F2Z A;  4DUZ Q;  2Z1C A;  3VR4 A;  3R2I A;  3BS1 A;  4FVM A;  3M4P A;  3RN2 A;  4K8J A;  4NXN Q;  4B9X A;  1E22 A;  3I7F A;  5KEE A;  3BZD B;  4JI0 Q;  3H6M A;  3MXU A;  4E6I A;  4HIK A;  2SDF A;  1PXU A;  1H9M A;  2C5C A;  1BCP D;  2MP1 A;  5JEA G;  4JI8 Q;  5C0X G;  5JEA H;  4IPG A;  4AH6 A;  2UUC Q;  4K0K L;  2K5N A;  2UXB L;  4GNX A;  1JJG A;  3RR5 A;  1YNJ D;  1BDO A;  2IX0 A;  3GTL B;  1XNQ Q;  3BDC A;  3E3X A;  1ENC A;  4C3J B;  5IGG A;  5AJ3 Q;  5T1I A;  1PRT B;  3DWP A;  1CSQ A;  3BYY B;  2IX3 A;  1AZP A;  2BA1 A;  1U5K A;  1O7Z A;  1Y8P B;  1S5C D;  3KLR A;  4LF5 Q;  1LTI D;  5K36 H;  1KAA A;  5A35 A;  1XNQ L;  3FPP A;  2PW5 A;  3I2Z A;  3RZO B;  4DGZ A;  3A7L A;  3CD6 A;  4DV4 L;  1E24 A;  5IGE A;  5FLM H;  4DAP A;  5BN5 A;  3ZJY C;  5CV4 A;  1EY4 A;  2JA7 H;  5A2Q E;  5E4X A;  1I4G A;  1WCM H;  3OWE B;  3I72 A;  3K5N A;  2CWA A;  4RHR A;  4P75 A;  4C3I G;  2ID0 A;  2IHF A;  2JQO A;  4RGT A;  2AQ3 B;  5KNC A;  4FF3 A;  3LNN A;  1VQP A;  2JA5 H;  3NBH A;  2UXC Q;  5FOB B;  2WKD A;  5L37 A;  1DYQ A;  3TN2 A;  4FXK C;  2MPM A;  3DM3 A;  1PTO F;  1Z47 A;  3A74 A;  3WOF A;  1AE2 A;  1JCK B;  1VQN A;  2HCC A;  4DNI A;  3D0F A;  2F0N A;  3PUV A;  2YTV A;  1CZW A;  3H94 A;  4UP8 A;  5C6A A;  3J80 E;  1PH3 A;  3G7L A;  4HCE A;  4YCW A;  3VYT A;  5CV8 A;  3DWQ A;  2V1C C;  4OIK A;  1KHI A;  5IWA L;  5I6Y A;  1II3 A;  2B2Y A;  1E0B A;  2UU9 Q;  4FF2 A;  5LHY 1;  4RGN A;  2HDL A;  1CM9 A;  2K04 A;  1J5E L;  4JW0 A;  4YWM A;  4A3J G;  4GLV B;  1EY7 A;  3EA6 A;  4AQY L;  1C4Q A;  3S15 H;  1EOV A;  1PRT F;  1VQA A;  1H9R A;  4OXP A;  3UE0 A;  3E9H A;  4C3H B;  3LWE A;  3SR1 A;  1CA6 A;  3R8B A;  1EQV A;  5M5W H;  4IUR A;  3CPW A;  1VQH A;  2QDL A;  2JA8 B;  5KRU A;  1XNR Q;  5GQO A;  2SNS A;  1Q1E A;  4RCO A;  1DCZ A;  4A3L G;  4IPH A;  4IO9 A;  3GTG B;  2E2D C;  4DR4 L;  4RG1 A;  4JV5 Q;  2Z9H A;  4P74 A;  1Y1V H;  2A74 C;  2CW0 C;  1LAB A;  1EZ8 A;  1X3E A;  1YNJ C;  2EJM A;  1FGU A;  3TZD A;  1EIH A;  2OTJ A;  1WTR A;  1QB5 D;  2VNU D;  3QWN A;  4K6D A;  4O2D A;  1TVX A;  1SMY C;  4IUP A;  1TY0 A;  4KN7 C;  1K83 H;  4XQQ A;  4TRD A;  2WFW A;  1VQ5 A;  5M3F H;  3A5Z B;  1H95 A;  3ND8 A;  1Y8N B;  3PUX A;  5JPM C;  1SBB B;  2SEB D;  4H0L C;  3PUZ A;  4KHZ A;  3N52 A;  4C3I B;  4K5X A;  3HOZ B;  3S14 B;  3I4N H;  1JB3 A;  4L5S A;  4JI8 L;  1EQQ A;  4DR2 Q;  3S1N B;  3CKI B;  2B2T A;  2KEC A;  2IY5 B;  1BUV T;  2F0K A;  4LMQ D;  5BR8 L;  2E2J B;  3CME A;  4ABN A;  1XPU A;  5ELO A;  4A3B G;  5EJW A;  1TWF H;  1LTG D;  1WTX A;  3U58 A;  4R9W A;  1PH6 A;  3ZYY X;  2KQ3 A;  3CAM A;  3TQY A;  3A8K E;  3MEH A;  1U9R A;  3GV3 A;  5CV7 A;  4DV6 L;  3BDO A;  4JI4 L;  1AN8 A;  3GQB A;  5IY0 A;  5M3M H;  5EKK A;  1RDP D;  1WTV A;  1WTO A;  1STA A;  1V1Q A;  4OO1 I;  3L0O A;  4FF4 A;  2ZTE A;  3QOJ A;  4A3I H;  3KDF A;  2XVS A;  4LF4 Q;  2NYZ D;  3QB3 A;  5M5Y B;  1TWC B;  3D6W A;  4V0B A;  3HFZ B;  3S14 H;  1EUJ A;  4OEL B;  2VXW A;  1VQB A;  2K1B A;  2L1B A;  1TXY A;  2RDF A;  2KA7 A;  1RKN A;  2Z8L A;  1XXG A;  3TS0 A;  2LSS A;  1WYD A;  2NUC A;  3A0J A;  3T4A C;  2AQ2 B;  3D8G A;  3HRZ C;  3KLW A;  3JAM i;  1UE5 A;  3GTJ B;  1UUP A;  3S1M B;  1K3R A;  1EYC A;  5M5Y H;  4YCU A;  3ONA B;  5IIF A;  2N8N A;  2PMZ B;  2CVR A;  4X3K A;  1SJH D;  4ZUI A;  3J81 j;  1SFO B;  1Q3L A;  5IYD H;  2MJ8 A;  1IYU A;  2OEO A;  2B2U A;  1Y1V G;  1VDZ A;  3Q6S A;  3BYT B;  2UU9 L;  3L7Z C;  4FNF A;  4O0A A;  4S3S A;  3GTJ H;  4YCV A;  2E2I H;  1Y1W G;  4V19 0;  1HNZ Q;  3K7A H;  3QIA A;  2K75 A;  4KLK A;  4NB3 A;  3TRE A;  1HZA A;  1B2T A;  3HS0 C;  2F1M A;  4RGO S;  3K5O A;  3OMC A;  3PIP A;  4LFA Q;  1LT4 D;  4JI7 L;  1W3S A;  1JOQ A;  4A3J H;  2WB1 E;  4X65 L;  1W2B A;  4JYA L;  4DV2 Q;  4MTK A;  1EZ6 A;  1G51 A;  3U9O A;  3F2C A;  1SRO A;  3KOJ A;  3HOW H;  1I50 B;  3M7G A;  4UAI A;  1VQ4 A;  1OXU A;  2NZO A;  3DHQ A;  1CT1 D;  4BWG B;  5JJZ A;  5GAH C;  4ALP A;  4LFB L;  4LUZ A;  2B2V A;  5GAD C;  3J80 L;  1HQR D;  5E7N A;  4G57 A;  1AFP A;  2HUG A;  3H0G H;  3A7A B;  2UXD L;  2PQE A;  1V1P B;  2B39 A;  1X55 A;  2PO4 A;  1GKH A;  1PFS A;  3J81 c;  2DY7 A;  4EQP A;  3PIO A;  1QVC A;  4IUQ A;  4X3U A;  2CH4 A;  1T9H A;  1VQC A;  3QOL A;  2FMC A;  1A63 A;  1E1T A;  4KV6 A;  2R61 A;  2JA5 G;  3X3N A;  4UPA A;  4WJ4 A;  4BBR H;  5HUR A;  1Q12 A;  1FGB D;  5M9O A;  5IYB H;  2IT1 A;  2F0S A;  2K01 A;  1DOL A;  5JVH 3;  4X66 L;  3TME A;  2F0M A;  3DWA A;  1CQF A;  2GVA A;  3HOU G;  2K14 A;  4DR1 Q;  3K6O A;  1SYG A;  2DJF C;  2JA6 G;  3HKZ B;  2Z0S A;  4DV0 Q;  4GLX A;  1SSO A;  3D4R A;  4EQO A;  1QOH A;  1NMF A;  1RTN A;  2OCE A;  1EFW A;  4TQU S;  3T1H Q;  1X6O A;  2A6E D;  5C4Z A;  1HXY D;  1O78 A;  2QDB A;  1Y1V B;  4CDF C;  2WKC A;  1STH A;  4C3J H;  1RL2 A;  1Q8I A;  2F4I A;  1BVS A;  2RSO A;  3K5L A;  1N32 L;  1TWC H;  1HR0 W;  3HOY G;  2XTI A;  4JI2 L;  5C5L A;  4IUT A;  2ICI A;  1B44 D;  4HTH A;  1YI2 A;  4CJ2 C;  3I4M G;  5C3E G;  3D31 A;  1HTL D;  1DOM A;  4DPG A;  3RUZ A;  4G4K A;  1HZ9 A;  1SEB D;  2G9H D;  1R4Q B;  2LKV A;  4GN3 B;  4HJA A;  3DXJ C;  2F0L A;  1UWV A;  5J22 A;  4CJ0 B;  4EX5 A;  1UEB A;  1GUT A;  2A6H D;  1N36 Q;  2JA8 G;  5FLM G;  4DV2 L;  1MKH A;  5EPL A;  5C4H A;  2F0O A;  1B7Y B;  1EY9 A;  1DGS A;  4KJN A;  1C48 A;  2FIN B;  2IJ0 A;  1K9M C;  3A55 A;  1ML0 D;  1X3F A;  1GD7 A;  4UDU C;  5CGK A;  4JK1 C;  2ENB A;  4RKL A;  1U4P A;  3GTK H;  2CQA A;  1K8O A;  3H3V C;  4LFC L;  2B29 A;  1VF5 C;  1XPR A;  1NSN S;  1X9N A;  2K32 A;  4Z9C B;  2GA4 B;  2EYP A;  4OHJ A;  4Y7N H;  2YV5 A;  4PNY A;  1D5X C;  2FXQ A;  1DXM A;  3O13 A;  1QNK A;  4DA2 A;  5IOC A;  3EVQ A;  2MGS A;  2Z6K A;  1V1O A;  3PUY A;  3CP0 A;  3KJP A;  4X3T A;  4OWW B;  5C3E H;  1JWS D;  3I90 A;  4A3D B;  4X65 Q;  5KYL A;  5IGF A;  5NUC A;  2I5H A;  1TKW B;  2PI2 A;  1V1P A;  2JA9 A;  3J81 i;  2Q8R E;  1RF2 D;  2Z6K C;  3I73 A;  5DAU A;  1F2Y A;  3UDX A;  1DD2 A;  1KIX A;  3M7N A;  5E4W C;  4QB4 A;  2E5L Q;  5DLQ E;  2BA0 A;  2XRQ D;  3FPU B;  2I0Q A;  2BCO A;  4KY6 A;  2WAQ G;  2JA6 H;  5I4D A;  1GM5 A;  5CYU A;  4I7A A;  2MO1 A;  4QY7 A;  1QIL A;  1S5B D;  4JI3 L;  4A75 A;  4CDC C;  1GXD C;  4NKL A;  4K8I A;  5FLX E;  3M85 A;  4DK1 A;  2PNH A;  4A3K H;  1KLG D;  1G2T A;  4HED A;  5HY6 A;  3KJO A;  2ZM6 Q;  2L15 A;  4JI1 L;  3FRP B;  5LMN L;  2K4K A;  3NUC A;  4ZYS A;  2XGT A;  1MIU A;  5EPK A;  1Q81 C;  1J9O A;  4LFB Q;  1LYL A;  3T13 A;  1HJP A;  3CCQ A;  3GTP H;  1EU4 A;  1VF7 A;  4LNQ A;  5I9O A;  4IPC A;  4N8F A;  3TZU A;  4F7X A;  2E2J H;  3V05 A;  2EY5 A;  1O7Y A;  2A69 C;  4A3M H;  1K8M A;  1J5E Q;  3QG1 A;  4ZUJ A;  3S17 B;  4BBS G;  4HSV A;  3PO2 G;  2NZH A;  2F4V Q;  2QKI C;  4JI1 Q;  1G8Z D;  2AUK A;  2RDG A;  3SEB A;  3OHX C;  2K03 A;  3TS2 A;  4A3G H;  1X54 A;  3Q24 A;  3ERO A;  5FO7 B;  4JI0 L;  1WTH A;  3TP5 A;  2NVQ H;  4POF A;  3S16 H;  4JI5 Q;  2JA7 B;  4LJZ C;  5ELE A;  2F0F A;  3TBI B;  2F0Q A;  4HIO A;  5DM7 3;  1JMC A;  1JT8 A;  3VDY A;  1YHB A;  1AEX A;  2B2T C;  1Y8O B;  2R93 H;  3U4Z A;  3OIP A;  5M3M G;  2K7V A;  4LF9 Q;  1CI3 M;  3A8I E;  1WCM B;  1CKM A;  4ZKC B;  1MJE A;  4DU9 A;  1PA6 A;  4BBS B;  4K14 A;  4DAY A;  1VS0 A;  2WB1 G;  5LMN Q;  3VYU A;  4QMG A;  3HOX H;  3EQL C;  2LS0 1;  4DNT B;  3URY A;  1JOR A;  4LF9 L;  2PYK A;  1IKL A;  1EY5 A;  1GUS A;  2JA7 G;  5IT9 E;  3C2P A;  1YBY A;  1GVP A;  1B1Z A;  1R4P B;  1D2B A;  4R4T A;  3MXN A;  4B3M L;  5AJ3 L;  4NXM L;  2RHQ B;  2A68 D;  1SND A;  2RF4 A;  4R8I A;  1BBU A;  4KJO A;  3KBX A;  4CKC A;  1YNN C;  1M8A A;  2A1A A;  4J6H A;  3RMH A;  2L55 A;  4X3S A;  3F1Z A;  4OWX B;  2KED A;  2EY1 A;  1MGS A;  1IL8 A;  2EYF A;  1WI5 A;  3K80 C;  2VQF Q;  1TWA B;  1XTC D;  2OWO A;  1RCV D;  2RSN A;  2KBN A;  3M4Y A;  2F0V A;  3FDT A;  4O42 A;  3Q0A A;  5LL6 X;  3VYR A;  3GTG H;  5C44 B;  2YTY A;  4A3F H;  2ASB A;  1QZH A;  3U50 C;  2JP1 A;  2YU9 H;  1XTD A;  5M5X B;  1PH4 A;  4BBR G;  3IAY A;  2EJF C;  2A6H C;  4R4Q A;  4A3B H;  3PO2 B;  1Q46 A;  5C3X A;  1BBX C;  3H3V H;  1I50 H;  5FLX c;  2SOB A;  4A3C G;  1LT6 D;  1IBL L;  3ULJ A;  4MIU A;  5D3D A;  2VB3 X;  2Q2T A;  5E1F A;  1OXT A;  1IW7 C;  3KF8 B;  1YIT A;  1IBK L;  4BA1 I;  4A3G G;  1O80 A;  3FEW X;  1HQM C;  4UP7 A;  5CC4 A;  3V96 A;  5DM6 3;  1OXS C;  3BVG A;  2KEN A;  5I6W A;  5C4J B;  2OQ0 A;  3DLL A;  4LF8 L;  4EGV A;  2Y0S B;  1HA6 A;  1KDC A;  1QCB D;  4DUY Q;  3D4W A;  1VQL A;  3U9S A;  3S1N H;  1LUZ A;  2F0I A;  1BF4 A;  4HCS A;  1KRS A;  1Z7T A;  1TWH H;  1DON A;  2E8G A;  4ZAI A;  1IBM L;  1PRT C;  1ICF B;  4RCN A;  4R4O A;  1D6E C;  1F9Q A;  4CDD C;  1OXV A;  4BY1 H;  3BVZ A;  4A3L H;  1UNS A;  3WOE A;  3PIO 3;  4I7Z C;  1SMY D;  4IUN A;  1QVF A;  3I4L A;  3LX0 A;  3CPF A;  4GN5 A;  2ZXO A;  3HOW G;  3R93 A;  2IWH A;  1H9S B;  3MFY A;  2R7Z B;  1NR2 A;  2B63 G;  3CQZ B;  3GTQ B;  2LFN A;  5DNF A;  4LFC Q;  2UUC L;  4ZLT F;  4K0K Q;  2UXB Q;  2A5H A;  4ILW A;  1M4V A;  2E74 C;  3VR6 A;  4HMJ A;  2VW9 A;  5C3W A;  4GKK L;  3VR5 A;  2D0P A;  3GTL H;  4ID6 A;  2EYM A;  2RCN A;  2K5D A;  2HDM A;  1HNW Q;  4J1M A;  1SYE A;  2K33 A;  2P5Z X;  1U4M A;  2ZTD A;  5KYI A;  1FJG L;  1HH2 P;  4PZ7 A;  3T1Y Q;  3I4O A;  1STY A;  1S72 A;  2EVB A;  1PZI D;  5IYC H;  3CCU A;  4DV0 L;  5CV9 A;  1CK1 A;  3C1E A;  1ENF A;  4IFD G;  4OO1 G;  5DEH A;  2R7Z H;  3SK8 A;  2MUY A;  1JC7 A;  5EAY A;  2AWN A;  4TKO B;  5HGT A;  1MSG A;  1T5X D;  5CMD A;  1V43 A;  4GOP A;  1W6J A;  3GTM B;  1I4Q A;  4JI2 Q;  3CCL A;  2BE5 D;  1LV9 A;  1EYG A;  4DAY B;  1K0R A;  4BY7 G;  4NMZ A;  2CWP A;  3RLO A;  4A3G B;  4DR5 L;  1B4O A;  2KHJ A;  1QE6 A;  2MHV A;  2CH4 W;  1ENA A;  4KY7 A;  3RLN A;  4LAA A;  1KAB A;  5LMN W;  2AMC B;  1SFO H;  1ZYR C;  2D0O A;  2ZXP A;  3CCS A;  1I4R A;  1LO5 D;  1BOS A;  1I94 Q;  3S1Q H;  1WTQ A;  2ZJP A;  4LFA L;  2I07 B;  4A3M G;  2OT2 A;  1CHP D;  4R8N A;  1JQY D;  1VQ6 A;  3SK5 A;  1Q82 C;  3M3Y H;  1VQD A;  2M00 A;  4QJF A;  4AYB G;  2BH8 A;  3IKJ A;  3K57 A;  1K3B C;  3MAQ A;  4IN3 A;  4BS9 A;  2A69 D;  4YHH Q;  1HCZ A;  3CCJ A;  4DF7 A;  1LTS D;  3Q22 A;  1IBL Q;  2JN4 A;  3Q8D A;  1Q86 C;  1XPO A;  1PH2 A;  2NB0 A;  3EJI A;  2WV6 D;  1YJW A;  4LW1 A;  2KUM A;  3GTP B;  1ET9 A;  1UEA B;  2XRS D;  3MZ5 A;  2O2L D;  2RDH A;  4F87 A;  1IL2 A;  3S1M H;  4A3M B;  1VQ7 A;  4RWS C;  2O4X A;  1LTB D;  1S5E D;  3SK4 A;  3NP8 A;  4XIG S;  4B3T L;  1STB A;  4IOC A;  4DR5 Q;  3H09 A;  4IJH A;  1O7L A;  4B3S Q;  3J7A F;  5FO9 B;  5CBA E;  1NCV A;  2EZV A;  3KF8 A;  3GV6 A;  4JPB W;  1QZG A;  4OIJ A;  3GTQ H;  2NVQ B;  4ZKB B;  4A3J B;  2QEJ C;  3GD7 A; 
#chains in the Genus database with same CATH homology
 5C3E G;  3D31 A;  3KF6 A;  5C4X H;  1XMO Q;  3CC7 A;  2R6G A;  4DPG A;  4QGU A;  1A8V A;  1RIP A;  4DV6 Q;  1N33 L;  5HGQ A;  3U4V A;  2E5L L;  1HZ9 A;  3BJU A;  2I5M X;  5LMU L;  4P72 A;  2R92 G;  5M5X H;  3PGZ A;  3HOV G;  4GN3 B;  4HJ9 A;  4HJA A;  3HOV H;  1UWV A;  1HZC A;  1KRT A;  4EX5 A;  1XNR L;  4X6A H;  3RZD H;  1UEB A;  4YY3 Q;  4DR7 L;  4A93 G;  1Q7Y C;  1HR0 L;  1N36 Q;  2JA8 G;  5FLM G;  4DV2 L;  1MKH A;  2K5H A;  5IYD G;  5ELN A;  1EQR A;  1B7Y B;  3H0G G;  3S2H H;  1DGS A;  2CFM A;  2MNA A;  1PH9 A;  1KC8 C;  3BU2 A;  3GO5 A;  1K9M C;  2ATW A;  4JBK A;  4JI7 Q;  1KXL A;  1S3O A;  1X3F A;  1GD7 A;  4DKA C;  2UXC L;  1YIJ A;  1JB7 A;  3GTK H;  3GDE A;  4JCV E;  5GAE C;  3S2D H;  1PH1 A;  3B6Y A;  3RZO H;  1N33 Q;  4JYA Q;  1PVO A;  2JE6 I;  1QVG A;  4LFC L;  1D8L A;  2B29 A;  2H5X A;  1XPR A;  4X64 Q;  1X9N A;  3HOZ H;  1PYB A;  1YZ6 A;  3AFQ A;  2IX1 A;  1N34 L;  1VQK A;  4DK3 C;  4Y7N H;  2K50 A;  4GOP C;  4MZ9 A;  2YV5 A;  4LUO A;  1PYS B;  4HIM A;  3J7A 5;  1NY4 A;  2A19 A;  4XTC S;  4DV5 Q;  2FXQ A;  3FKI G;  5C44 G;  3ULP A;  2HHH Q;  4HJ5 A;  1HR0 Q;  3PUW A;  2Z6K A;  3UDF A;  4A3E G;  1O7I A;  4TVA B;  1FVI A;  2CKZ B;  3PUY A;  4LF5 L;  3CP0 A;  1HZB A;  3K81 C;  3PCO B;  4P71 A;  1Y14 B;  3KJP A;  1D7Q A;  4OWW B;  3F2B A;  1IBK Q;  4DV3 Q;  3J80 i;  5C3E H;  4C3I H;  1U0L A;  3NEL A;  2Q2H A;  2QGQ A;  3HOZ G;  4X65 Q;  4JV5 L;  2I5H A;  3E9I A;  1N34 Q;  5IT9 c;  1G29 1;  2PI2 A;  2R7F A;  2JA9 A;  5K36 G;  3J81 i;  2JK8 A;  4R4I A;  2D62 A;  2VS1 A;  2Z6K C;  3KYH C;  4LF6 L;  3IRB A;  1AE3 A;  1IZ6 A;  4A3K G;  1K8G A;  4BXX H;  3UDX A;  4R1J A;  5IWA Q;  5GRO A;  4IFD I;  1C0A A;  1AH9 A;  1Q8K A;  4JI6 Q;  1KIX A;  4GS3 A;  4HJ7 A;  2BH2 A;  4B3S L;  4LF7 Q;  3M7N A;  2E5L Q;  4IJL A;  2BA0 A;  5DLQ E;  1R9T H;  3OYY A;  2I0Q A;  4DUY L;  3HKS A;  2WAQ G;  5JEA J;  1JE5 A;  2Y0S G;  2QA4 A;  4DR3 Q;  2WAQ E;  1GM5 A;  2JA6 H;  4JI5 L;  2MO1 A;  4QY7 A;  4JI3 Q;  4DUZ Q;  4GLA C;  2PMZ E;  4JI3 L;  4A75 A;  2VL6 A;  1NMG A;  3M4P A;  3RN2 A;  4NXN Q;  3M85 A;  1E22 A;  3I7F A;  4JI0 Q;  4X62 Q;  1CUK A;  4HIK A;  1I5F A;  2PNH A;  4A3K H;  2NVY H;  5JEA G;  5C0X G;  1YVC A;  4JI8 Q;  2ZM6 L;  5IYB G;  4IPG A;  5HY6 A;  4AH6 A;  3KJO A;  2ZM6 Q;  1XMQ Q;  2L15 A;  4JOI C;  4JI1 L;  2UUC Q;  4K0K L;  2K5N A;  2UXB L;  4GNX A;  5LMN L;  2K4K A;  3RR5 A;  1JJG A;  4DR1 L;  2EQS A;  2IX0 A;  1MIU A;  2XGT A;  4C3H H;  4A76 A;  1Q81 C;  4DR6 Q;  1A62 A;  1I3Q H;  1XNQ Q;  4AYB E;  5FJ8 G;  2CQO A;  5AJ3 Q;  4LFB Q;  1LYL A;  3WWV A;  1VQ9 A;  1HJP A;  3CCQ A;  2B63 H;  3GTP H;  1CSQ A;  4DR3 L;  2BA1 A;  1U5K A;  1BKB A;  4OWT B;  4IPD A;  2NN6 I;  4BY1 G;  3BZC A;  2WP8 J;  4AQY Q;  4LNQ A;  1NE3 A;  4IPC A;  1S40 A;  1NTG A;  4LF5 Q;  4POG A;  1E3P A;  3W1G A;  3I56 A;  3S24 A;  3I2Z A;  2E2J H;  1XNQ L;  2UXD Q;  1P8L A;  2PQA B;  3HOY H;  3CD6 A;  4A3M H;  4DV4 L;  1E24 A;  4JBW A;  5FLM H;  4YWK A;  4BXX G;  1J5E Q;  3STB C;  1OXX K;  1WFQ A;  3NEM A;  3ZJY C;  2E2H H;  2JA7 H;  5IP7 H;  4BBS G;  3K0X A;  1I94 L;  1WCM H;  3PO2 G;  2NZH A;  2F4V Q;  3KDF B;  4JI1 Q;  2Y0S E;  2CWA A;  1KL9 A;  4P75 A;  3FP9 A;  4H02 A;  2JEA I;  4A3D H;  2ID0 A;  2IHF A;  2JQO A;  3F2D A;  1V9P A;  5C0X J;  4NXN L;  3TS2 A;  1VQP A;  4A3G H;  2AHO B;  2JA5 H;  1X54 A;  4LUV A;  5IP9 G;  4JI0 L;  2UXC Q;  2GVB A;  4A4I A;  3OW2 A;  2NVQ H;  4PZ6 A;  4KI0 A;  2AKW B;  1UE6 A;  4POF A;  3S16 H;  4JI5 Q;  4NXM Q;  5C44 H;  3DM3 A;  4OON A;  5M3F G;  1Z47 A;  2EIF A;  1EIY B;  3A74 A;  1CKO A;  1AE2 A;  4HIO A;  1VQN A;  4L5R C;  4DNI A;  3D0F A;  1JMC A;  1JT8 A;  1G6P A;  3PUV A;  2YTV A;  4DV1 L;  3VDY A;  1M1K C;  1YHB A;  1TWA H;  4UP8 A;  3HKZ G;  4AIM A;  1PH3 A;  2R93 H;  3U4Z A;  3EN2 A;  4YCW A;  3PO2 H;  1EWI A;  5M3M G;  3PF5 A;  4LF9 Q;  4LF6 Q;  4GOP B;  1CKM A;  1WOC A;  2V1C C;  1MJE A;  3I4M H;  1KHI A;  1PA6 A;  1K73 C;  5IWA L;  3M9B A;  1SE8 A;  4KHP Q;  1VS0 A;  2WB1 G;  5LMN Q;  1E7Z A;  4DK6 C;  1P16 A;  2UU9 Q;  3HOX H;  1L1O B;  1VQF A;  3JC6 6;  4LF9 L;  1J5E L;  4DAM A;  4YWM A;  4A3J G;  4GLV B;  1N32 Q;  3CW2 C;  1X65 A;  4HJ8 A;  3CMA A;  2ZTC A;  2I5L X;  2AWO A;  5JJK A;  2JA7 G;  3NEN A;  1WJJ A;  4AQY L;  4DUZ L;  2VUM G;  2K52 A;  3I55 A;  1YBY A;  1EOV A;  1VQA A;  4DV1 Q;  1X3G A;  3S15 H;  4OXP A;  1GVP A;  3UE0 A;  1A0I A;  3E9H A;  4R4T A;  4B3M L;  3RN5 A;  3TEH B;  4UP9 A;  2HIV A;  5AJ3 L;  1YHA A;  1Q1B A;  5H1S E;  3FHW A;  2RHQ B;  1VQO A;  4NXM L;  5M5W H;  1YJN A;  2RF4 A;  4L5Q A;  1M90 C;  3CPW A;  1VQH A;  1PH5 A;  1HNW L;  1XNR Q;  1BBU A;  5GQO A;  4JI6 L;  1SR3 A;  3I4M G;  3UE1 A;  1Q1E A;  3CC2 A;  5JJL A;  3A5U A;  4MTN A;  3W5O A;  4C2M H;  2ALY B;  4A3F G;  1PHJ A;  4A3L G;  2A1A A;  2KCT A;  4IPH A;  4IO9 A;  4DR4 L;  4IOA A;  4RG1 A;  4JV5 Q;  1PV4 A;  3F1Z A;  4P74 A;  1Y1V H;  4OWX B;  1VQJ A;  1X3E A;  2LXK A;  4B3M Q;  1FGU A;  3PO3 G;  4YY3 L;  4DR7 Q;  2OTJ A;  1WI5 A;  4YHH L;  3K80 C;  2VNU D;  2VQF Q;  2VY3 A;  4O2D A;  1VQE A;  4J15 A;  3CCE A;  2OWO A;  3PF4 A;  1N8R C;  1VQ8 A;  2KBN A;  1LTL A;  1B70 B;  1K83 H;  3GTG H;  4GNX C;  4A93 H;  2JEB I;  2YTY A;  4A3F H;  2ASB A;  1SN8 A;  1QZH A;  3U50 C;  2R92 H;  1VCI A;  2WFW A;  1VQ5 A;  2YU9 H;  5M3F H;  1XTD A;  4LF4 L;  1PH4 A;  3A5Z B;  4BBR G;  2Q2U A;  1H95 A;  4R4Q A;  4A3B H;  3CQZ H;  2PI2 E;  1Q46 A;  3PUX A;  5J3B A;  3G4S A;  1PH8 A;  2HT1 A;  1I50 H;  5FLX c;  3H3V H;  3PUZ A;  3FKI H;  4KHZ A;  4KHP L;  3LGJ A;  4A3C G;  1L0W A;  1KD1 C;  1IBL L;  4A3C H;  3ULJ A;  1IBM Q;  1CSP A;  4A3D G;  3I4N H;  1I6H H;  4ME3 A;  2Q2T A;  1OXT A;  4EQ5 A;  4R4C A;  4L5S A;  3GTM H;  2JJQ A;  3KF8 B;  4JI8 L;  3L2P A;  1EQQ A;  1YIT A;  4DR2 Q;  1IBK L;  4B3T Q;  3PV0 A;  4BA1 I;  4A3G G;  1KAW A;  2IY5 B;  2RHS B;  3KF6 B;  2VQF L;  4UP7 A;  5BR8 L;  1OXS C;  2F3I A;  2KEN A;  3CME A;  1XPU A;  5ELO A;  4UY8 C;  4A3B G;  4DR6 L;  4IFD J;  1X56 A;  2OQ0 A;  3EIV A;  4PMW A;  1TWF H;  3DLL A;  1MJC A;  3JAM c;  2R7D A;  4LF8 L;  3OTO L;  1FL0 A;  3U58 A;  3MEF A;  1VQM A;  1PH6 A;  1XMQ L;  3S1R H;  3CAM A;  3TQY A;  1OTC A;  3M4O H;  4DUY Q;  1VQL A;  2VUM H;  3I4N G;  4DV6 L;  3S1N H;  3HOU H;  1LUZ A;  2F52 A;  1VQG A;  4JI4 L;  1UE7 A;  1KRS A;  5IP7 G;  3TRZ A;  5FJ8 H;  5IY0 A;  1TWH H;  5M3M H;  2E8G A;  1IBM L;  3CCV A;  2MO0 A;  1V1Q A;  4OO1 I;  3L0O A;  3H3V I;  4JBJ A;  2ZTE A;  4R4O A;  1J6Q A;  3ICE A;  3UDI A;  4A3I H;  3KDF A;  4GNX B;  4LF4 Q;  1OXV A;  4YWL A;  5BR8 Q;  2HIX A;  3UDG A;  4BY1 H;  1JJ2 A;  4A3L H;  2N49 A;  2OQK A;  3KFU A;  3RNU A;  3NBH B;  3F8T A;  4QQB X;  3HFZ B;  4L5T A;  4QL5 A;  2ZJQ A;  3S14 H;  1EUJ A;  1VQB A;  1QVF A;  1TXY A;  2VQE L;  5C4X G;  3CPF A;  4GN5 A;  3TS0 A;  2LSS A;  3HOW G;  4B3R Q;  2DGY A;  4PZ8 A;  1WYD A;  2Q2I A;  2R93 G;  2B63 G;  4GKJ Q;  3A0J A;  1Y1W H;  4X66 Q;  1GO3 E;  3K8A A;  3KLW A;  4LFC Q;  2UUC L;  4K0K Q;  3JAM i;  1UE5 A;  3GTO H;  2UXB Q;  3S17 H;  3HOX G;  2IHE A;  1K3R A;  2YYZ A;  3SGI A;  5M5Y H;  4JBM A;  4YCU A;  1VQI A;  3J80 c;  2VW9 A;  4DV3 L;  2N8N A;  3G71 A;  2VZA A;  4GKK L;  2D0P A;  4HID A;  3GTL H;  3J81 j;  4QIW E;  2RCN A;  2YTX A;  4DV7 L;  2N3S A;  1HNW Q;  1HNZ L;  4DV7 Q;  2ZTD A;  5IYD H;  2ES2 A;  2JA8 H;  1K8A C;  1FJG L;  1HH2 P;  1L1O A;  2N78 A;  1Y1V G;  2UUA L;  1BBW A;  4PZ7 A;  3I4O A;  3T1Y Q;  1JJC B;  3G48 A;  4JC0 A;  2UU9 L;  2LXJ A;  1S72 A;  3L7Z C;  4GN4 B;  4O0A A;  3BZK A;  5IYC H;  3CCU A;  3GTJ H;  4DV0 L;  2OTL A;  4YCV A;  2E2I H;  1Y1W G;  1N36 L;  4DR4 Q;  1YEZ A;  2KHI A;  1HNZ Q;  3K7A H;  4NB3 A;  2K75 A;  3AFP A;  3E0E A;  4KLK A;  3TRE A;  4IFD G;  4GKJ L;  4OO1 G;  4Y52 H;  5JJI A;  1HZA A;  3HKZ E;  2R7Z H;  2A8V A;  1EIF A;  4JI4 Q;  3MXN B;  3G6E A;  3PIP A;  1IYJ B;  5EAY A;  2AWN A;  4LFA Q;  1W3S A;  4A3I G;  1XMO L;  4JI7 L;  4LWC A;  4A3J H;  2UUB Q;  2NVX H;  1V43 A;  2WB1 E;  4X65 L;  4GOP A;  1ASZ A;  4JI2 Q;  1W2B A;  3CCL A;  3ULL A;  1WCM G;  3J7Z C;  1HNX Q;  4JYA L;  4DV2 Q;  4WJ3 M;  1EYG A;  4DAY B;  4RMF A;  1K0R A;  4BY7 G;  2UUA Q;  2CWP A;  1G51 A;  3RLO A;  5IE8 A;  3F2C A;  4DR5 L;  1SRO A;  2KHJ A;  4OX9 L;  2NVT H;  3KOJ A;  1NJI C;  1LM0 A;  3HOW H;  3RLN A;  3STB D;  5LMN W;  1OXU A;  2AMC B;  1VQ4 A;  1SFO H;  2NZO A;  4P73 A;  2D0O A;  2HHH L;  5GAH C;  4ALP A;  2QEX A;  3CCS A;  1L1O C;  4LFB L;  2UUB L;  1I94 Q;  3S1Q H;  4LUZ A;  2ZJP A;  3RLF A;  5GAD C;  4X64 L;  4LFA L;  5E7N A;  5GAG C;  1C7Y A;  4FDB A;  1Z9F A;  3H0G H;  2B3G A;  1SMX A;  5LMU Q;  4A3M G;  2UXD L;  2MFI A;  3AYH B;  2VQE Q;  1XJV A;  2C35 B;  4X62 L;  2PQA A;  1VQ6 A;  4BA2 I;  4PG3 A;  1Q82 C;  3M3Y H;  4BY7 H;  2F4V L;  1X55 A;  1VQD A;  1GKH A;  1PFS A;  1SLJ A;  5IYC G;  3J81 c;  4QJF A;  4AYB G;  2BH8 A;  2NN6 G;  3M4Q A;  3PO3 H;  3PIO A;  1QVC A;  4JOI A;  3OTO Q;  3CC4 A;  1L2F A;  3PSI A;  1T9H A;  1VQC A;  4YHH Q;  1A63 A;  2DUD A;  3CCJ A;  1IXR A;  1E1T A;  2JA5 G;  3ERS X;  1KQS A;  1IBL Q;  1YJ9 A;  3H15 A;  3ER0 A;  4APV A;  1ASY A;  3Q8D A;  3CXC A;  1HNX L;  1Q86 C;  4UPA A;  2ZJR A;  3K7U C;  2K5V A;  4DR2 L;  4WJ4 A;  4BBR H;  1XPO A;  1Q12 A;  1PH2 A;  2CCZ A;  1E1O A;  1SRU A;  1C9O A;  5IYB H;  1YJW A;  3W1B A;  4LW1 A;  1N9W A;  2IT1 A;  3AQQ A;  2MQH A;  4X66 L;  3EBE A;  2GVA A;  1IL2 A;  3HOU G;  3S1M H;  1NBW A;  2K14 A;  3CF5 A;  1YHQ A;  1VQ7 A;  4B3R L;  4LF8 Q;  4DR1 Q;  2JA6 G;  2Z0S A;  4DV0 Q;  4DV4 Q;  4JG2 A;  4GLX A;  5C0X I;  3CCR A;  2R7Z G;  4NPS A;  5IP9 H;  5C4J H;  4XIG S;  4B3T L;  1NMF A;  2OCE A;  1EFW A;  4TQU S;  1QUQ B;  3T1Y L;  4MNO A;  3T1H Q;  2HQL A;  1CKN A;  1X6O A;  2GN5 A;  2EXD A;  1FJG Q;  4OX9 Q;  4IOC A;  3T1H L;  3AEV A;  4DR5 Q;  4IJH A;  1TWG H;  1B8A A;  4B3S Q;  4LF7 L;  4C3J H;  1RL2 A;  3CCM A;  1PH7 A;  1BVS A;  2KCM A;  4BBS H;  1N32 L;  1TWC H;  1HR0 W;  3HOY G;  4DV5 L;  4GKK Q;  2XTI A;  1QZG A;  4JI2 L;  3GTQ H;  1QUQ A;  1UE1 A;  4A3E H;  1CKN B;  1YI2 A;  1YNX A;  3GD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...