1SN8A

Crystal structure of the s1 domain of rnase e from e. coli (pb derivative)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
ANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease E
publication title Structural characterization of the RNase E S1 domain and identification of its oligonucleotide-binding and dimerization interfaces.
pubmed doi rcsb
source organism Escherichia coli
total genus 17
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature ec 3.1.26.12: Ribonuclease E.
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sn8A00
2KHIA 3PF4A 1Q1BA 4BBSG 1OXXK 2E5LL 4JI5L 1UE6A 1HNWL 1Y1WH 3PUXA 4GLAC 4GN5A 1NE3A 1V1QA 4GLXA 2R93H 4A93H 3H0GH 1YVCA 1B8AA 1Z9FA 3CPFA 4HJAA 1KIXA 2Y0SE 2JA7G 2IX0A 2E2IH 2VUMG 4NXML 4BXXG 3FP9A 1XMOQ 2CKZB 1HZ9A 3OYYA 2ID0A 4L5TA 5M5WH 4DV1Q 3GTMH 1SRUA 2F3IA 2CWAA 3OTOQ 2ASBA 5IYDH 1HNZL 2ZTEA 4TQUS 1H95A 2ZM6Q 1HNXQ 1HJPA 1PFSA 2KENA 1WCMG 4X62Q 3ULLA 1PH2A 1KD1C 3UDXA 1XMOL 3PUVA 3RN5A 3K0XA 2Z0SA 1Y14B 2HIXA 2NN6I 3Q8DA 3UDIA 5M5XH 2B63G 1VQEA 3I7FA 1E24A 1L1OA 1GVPA 4JG2A 3G71A 4JI6Q 2IT1A 2RHSB 4L5QA 3RLOA 5FLMG 4DUYL 1PVOA 4JI7L 1AH9A 1YJNA 2AMCB 3I4NH 1TWAH 4A3JH 1P16A 4JI1Q 1D8LA 4DKAC 3RN2A 3M9BA 3RR5A 1BBUA 4B3MQ 3PSIA 4JC0A 4A3EH 2QGQA 4GS3A 5IWAQ 4O2DA 5M3MH 2ZJRA 1NJIC 2K50A 2JEAI 4JV5L 4DAYB 4A3IG 1E1TA 3U4ZA 3PUWA 1UEBA 4A3CH 4JI1L 4C3JH 2KHJA 4NB3A 4P75A 4LUZA 1Q8KA 1XNRL 1V43A 2R92G 4A3MG 1TWFH 2Q2UA 1K8AC 1IXRA 4R4CA 4XIGS 1OXSC 1L2FA 1LYLA 1EOVA 5IYCG 3MXNB 2NN6G 5IYBG 3I4MG 2GN5A 3IRBA 2N3SA 3NBHB 4P71A 4LFAQ 4YWMA 1Z47A 2YTVA 3HOXH 2VQFQ 3CMEA 4JYAL 3HOWG 1BVSA 4X64Q 3G48A 2BH2A 1S3OA 2JA5G 3AQQA 3JAMi 4A3MH 2DGYA 2FXQA 2N78A 4DV7L 3CMAA 2CQOA 3GTQH 4OONA 3I55A 2R7ZG 4PZ7A 1GD7A 4HJ8A 1E3PA 1W3SA 3D31A 4X6AH 4EX5A 1NTGA 3JAMc 3I4MH 2NVXH 2PNHA 3KJPA 4YCUA 3S15H 3AFQA 1Q82C 3GTGH 4LF9L 2K52A 3KOJA 2VQEL 1J5EQ 1ASZA 3CCEA 4HIKA 1K73C 4MNOA 3PV0A 1PA6A 1MJCA 2LXKA 4OWTB 4A75A 2R7ZH 1PH4A 1L1OB 4HIMA 4IOAA 4PMWA 3TS0A 3HOYG 4JI0Q 3GTLH 3M4OH 1E7ZA 2L15A 4DV5L 2Q2IA 1X65A 4JI2L 3KF6A 1JMCA 4PZ6A 4QQBX 4JBJA 3EIVA 5GROA 3FHWA 1C7YA 1T9HA 4LF8L 1VQAA 3CCMA 3ULPA 1EIFA 3D0FA 3GD7A 2UXDL 2UXCQ 1Q1EA 1GM5A 4KHPQ 1EIYB 1I5FA 4AYBG 4LFCQ 4QY7A 3GTKH 3GDEA 2F52A 5C0XI 3HOYH 3JC66 3K7UC 1EYGA 2Z6KA 2ZTDA 3HOZH 4LNQA 4K0KL 2UXBL 1YZ6A 1KL9A 2A8VA 2IY5B 3PO3H 5AJ3Q 3L2PA 1N36Q 1X55A 1XPUA 1C0AA 1OXTA 4UP7A 5JEAJ 4JI4Q 4POFA 2R7FA 1N9WA 2A19A 1Y1WG 1N8RC 2VS1A 2A1AA 4Y52H 3U4VA 3HKZE 1CKNA 2B29A 2E5LQ 4JI5Q 4BBRH 4JI3L 3W5OA 3CAMA 2R93G 1WJJA 3NEMA 1MIUA 2H5XA 2JA9A 1KQSA 3NELA 3E9IA 3AFPA 3H0GG 4YHHL 3J7ZC 4DV0L 3S1QH 2NVYH 3K81C 2I5MX 3HOUH 3UE1A 5IP7H 2YYZA 3RNUA 1R9TH 1YI2A 4LF4L 3F2CA 3K80C 1SE8A 2D62A 2VNUD 1NMGA 1QZGA 4NXMQ 1G51A 2K5HA 3CCUA 5IYDG 1WI5A 1QZHA 4DV2L 2N8NA 3PIPA 1X6OA 2K5VA 2I5LX 1HNZQ 4AYBE 3J81j 4DPGA 1K83H 1UE1A 2JJQA 4AQYL 2NZOA 4JOIA 2VY3A 2PMZE 1HR0Q 5LMNW 1PYBA 1IL2A 5E7NA 3I4NG 1VQNA 3KF6B 4GNXA 4A3JG 1L1OC 5LMUL 5C4XH 4DUYQ 4RG1A 4LF6L 5J3BA 2E2JH 4QIWE 1C9OA 4JI7Q 4A3EG 1VQGA 5JJIA 2WAQG 1Y1VH 4BY7G 3E9HA 5M3MG 1K0RA 3HOVH 1VQ6A 3T1YL 1HR0L 1YIJA 1GKHA 2PI2A 3W1GA 2UUCL 4UY8C 4NXNQ 4A3CG 1UE7A 4JV5Q 3M4QA 1BBWA 3J80i 1CUKA 4LF5L 5JEAG 1OXVA 2I5HA 3TS2A 3RZDH 3PF5A 1V9PA 4A3LH 1PHJA 1QUQA 3NENA 4QL5A 1LTLA 1XNRQ 3HKSA 1GO3E 3J80c 4A3GG 4GOPA 1IBML 4BY7H 3KF8B 2EIFA 4IPDA 4NXNL 2YTYA 4BY1G 2OWOA 1YEZA 1I6HH 2RHQB 4O0AA 2B3GA 4JI8L 3STBD 5ELOA 4IOCA 1FVIA 1X3GA 3A5ZB 1KRTA 4AIMA 4DK6C 1B70B 1QVCA 3HOXG 1CKNB 3M4PA 2XGTA 1YITA 4L5RC 4DV4L 3ER0A 3VDYA 1J6QA 3GTJH 3CQZH 3TRZA 4NPSA 3M85A 2ES2A 1XNQL 1JJCB 4A3DH 3S1MH 2HQLA 3AYHB 4JYAQ 5FLXc 3PGZA 1YHQA 1PYSB 1OTCA 3CCRA 4A3GH 1VQBA 4QJFA 4DV7Q 4BY1H 1NY4A 1UE5A 2R6GA 3U58A 1ASYA 4GKJL 4IJLA 1VQ8A 2MQHA 4MTNA 4YWLA 1IBKL 5JJLA 3CC4A 3CCJA 4LF9Q 4ME3A 2NZHA 1X56A 3KYHC 2VQEQ 4IPGA 4GN3B 1TWCH 2N49A 3M3YH 1FGUA 4IFDI 4DR6L 3KJOA 3I2ZA 3CPWA 2JQOA 1VQMA 2LXJA 1PH1A 4GNXB 1EWIA 4UP8A 4DAMA 4A76A 1D7QA 4X66L 2I0QA 3E0EA 4R4IA 4DV5Q 3UE0A 4JI2Q 1JT8A 1E1OA 2LSSA 2WP8J 2UU9L 4C3HH 4IJHA 3AEVA 3RZOH 1K3RA 4R4OA 1HH2P 1YNXA 5C0XJ 4LF8Q 2JA8H 1KHIA 4GKKL 2CWPA 5GADC 4DR5L 4HJ9A 4OWWB 2UXDQ 3HOZG 5GAHC 1K9MC 1SR3A 3ZJYC 5FJ8H 1U0LA 4B3TL 4DR7L 1QUQB 4BA1I 1M90C 3PO3G 3CC7A 2QEXA 4DV3L 3S1RH 4K0KQ 2UXBQ 2D0PA 3PUYA 4GOPB 3A74A 1O7IA 1W2BA 4A3BH 2GVBA 1VCIA 4X65Q 1X9NA 3J7A5 2V1CC 1CKMA 2JK8A 4DUZL 2OQKA 4IFDG 1YHBA 3KDFA 2E8GA 4EQ5A 4BBRG 1IYJB 1Q12A 2MFIA 3GO5A 5ELNA 4DR1L 1XPRA 4DR2L 4ALPA 3CC2A 1S40A 1SLJA 1S72A 4JI3Q 3CCSA 1VQOA 4X65L 4B3SL 3HOUG 5IP7G 4DV6L 1CKOA 1A62A 5HY6A 4AH6A 4UPAA 4YHHQ 4QGUA 3KLWA 4DV0Q 1YJWA 2MO0A 4DR4Q 3PIOA 2VW9A 1QVFA 3ULJA 3S16H 1N34Q 1LM0A 1MKHA 4LF4Q 3J81i 3STBC 3S1NH 3T1HL 5IT9c 4OX9L 1PH9A 1FL0A 2AWNA 4DNIA 4IPCA 1M1KC 4H02A 1FJGL 5M5YH 4IO9A 4DR3L 1NMFA 4OO1I 5C4JH 1U5KA 3K7AH 1VQDA 4DR4L 4DV2Q 5M3FG 3S17H 1A0IA 2VZAA 2Y0SG 4A3FH 5IE8A 1N34L 3CW2C 4KI0A 4HIOA 5GQOA 2QA4A 1I94L 2IHFA 2JA6G 2PI2E 4YY3L 3CF5A 5LMNL 4AQYQ 2F4VL 5IP9H 3HFZB 3S2DH 3H3VI 5C4XG 1PH8A 2K14A 5C0XG 4L5SA 4IPHA 1JB7A 5LMUQ 1TWHH 3ERSX 1Y1VG 4GNXC 1I50H 4GN4B 5M3FH 4LF6Q 3I56A 3HOVG 4YWKA 1UWVA 2GVAA 1X3EA 4C2MH 2HT1A 2JA6H 3T1YQ 3MEFA 1XMQL 1SFOH 1CSQA 2UUCQ 1N33L 2MNAA 4LF7L 4YCVA 4LUVA 3KFUA 4A4IA 1YJ9A 4GLVB 1VQFA 2R7DA 4A3KG 4LF5Q 4A3LG 4LFBL 2HHHQ 4OO1G 1VQ5A 1I3QH 1RIPA 5BR8L 1A63A 2BA1A 1EFWA 1PH7A 2ZTCA 2JEBI 1PH5A 5GAEC 2ALYB 1IBMQ 1TWGH 4MZ9A 4GOPC 1IBLL 2UUAL 1HNWQ 3KDFB 2K75A 1N32L 1VQHA 2OCEA 1SN8A 4C3IH 4JI8Q 4A3DG 2HHHL 4RMFA 1KRSA 1YBYA 4P72A 3SGIA 5C3EG 4P73A 3DLLA 2K5NA 2VL6A 4DV4Q 1VQCA 4A3KH 4BBSH 5JJKA 1XNQQ 1JJGA 1WFQA 4FDBA 5HGQA 3G4SA 1QVGA 3F2BA 3FKIG 1WYDA 3BJUA 1PH6A 2WFWA 1TXYA 4R4TA 1OXUA 2XTIA 2KBNA 4LW1A 3EBEA 3UDFA 4GKJQ 2JA7H 4XTCS 3TEHB 4DV1L 2VUMH 3H3VH 5C3EH 4BXXH 3OTOL 1IBKQ 3RLNA 3CCVA 5EAYA 4IFDJ 4LWCA 2ZM6L 3K8AA 1HNXL 2ZJQA 1X3FA 1HZCA 4JBWA 4X62L 2PQAA 3FKIH 2UUBQ 2C35B 3M7NA 4KLKA 1WCMH 2WAQE 2AKWB 4DR6Q 1JJ2A 4Y7NH 4DK3C 2B63H 4JI6L 1HR0W 3L7ZC 1IZ6A 4X66Q 3H15A 2ZJPA 1KAWA 3G6EA 5FLMH 2UUBL 1G291 1A8VA 2YU9H 1XJVA 2NVQH 2UU9Q 4B3ML 3PO2G 2JA8G 5IWAL 1Q46A 4HJ7A 4BA2I 4YCWA 3UDGA 5FJ8G 1HZBA 3PCOB 4GKKQ 1EQQA 3ICEA 2YTXA 3S2HH 3B6YA 4DR5Q 5H1SE 2RF4A 4A3IH 1XTDA 4B3TQ 3GTPH 4P74A 1EUJA 1VQ9A 4DR7Q 4A3BG 4J15A 4DV3Q 1P8LA 5IY0A 3L0OA 1Q81C 3PO2H 1K8GA 2R92H 3OW2A 3W1BA 1YHAA 2Q2TA 4APVA 2RCNA 3PUZA 1LUZA 3F1ZA 3I4OA 4DUZQ 3CCLA 2AWOA 1AE3A 3TREA 1NBWA 3EN2A 2VQFL 1PV4A 2YV5A 1VQLA 4LFAL 5IYCH 4POGA 3F2DA 5IYBH 4DR1Q 4DR2Q 2Z6KC 4X64L 3S24A 1VS0A 3HOWH 2WB1G 1XPOA 4B3SQ 1Q86C 2MO1A 4DV6Q 3A5UA 2JA5H 2K4KA 1VQPA 3U50C 4JBKA 2Q2HA 4PZ8A 1KC8C 3HKZG 4JCVE 4TVAB 2D0OA 1EQRA 3DM3A 3T1HQ 3A0JA 1RL2A 1AE2A 2OTLA 4OX9Q 1FJGQ 1CSPA 1KXLA 4DR3Q 1PH3A 2OQ0A 1SROA 3TQYA 4JBMA 5DLQE 4A3FG 3BU2A 1J5EL 5C44G 4B3RQ 2PQAB 4OXPA 4LUOA 3CCQA 2AHOB 1WOCA 1VQJA 1G6PA 3S14H 1I94Q 1E22A 2BH8A 5IP9G 2E2HH 3WWVA 2IHEA 4YY3Q 5LMNQ 3CD6A 4HIDA 2F4VQ 4R1JA 4UP9A 1X54A 4JI0L 2CFMA 4OWXB 2NVTH 4B3RL 3J81c 1VQKA 2ATWA 4WJ3M 5C44H 1VQ7A 1MJEA 2KCMA 2EXDA 2OTJA 2UXCL 4JOIC 1XMQQ 3BZKA 3GTOH 4KHPL 2WB1E 2JE6I 3F8TA 4R4QA 1N33Q 2BA0A 4LFCL 2CCZA 4LF7Q 4WJ4A 3BZCA 4LFBQ 1DGSA 4PG3A 3RLFA 5GAGC 1SMXA 1JE5A 3CXCA 2DUDA 4KHZA 5AJ3L 2IX1A 2EQSA 1B7YB 3LGJA 5BR8Q 4HJ5A 1Q7YC 2HIVA 1N36L 1VQIA 4A93G 5K36G 1HZAA 3CP0A 2KCTA 1L0WA 4JI4L 1IBLQ 1VQ4A 2UUAQ 1BKBA 1N32Q
chains in the Genus database with same CATH superfamily
2KHIA 4JI5L 2VB3X 3GTJB 4DXGA 4A3DB 3S1MB 1V1QA 5FO8B 4GZYC 4BY1B 3CPFA 3FKIB 2Z1CA 4HJAA 4DK0A 2VUMG 4ZQ3A 3FP9A 2KECA 1EY4A 4JVZA 4M1UB 1WVLA 3GTMH 2NUCA 1SXTA 1E2ZA 1EY9A 1PFSA 3TP5A 4X62Q 1WCMG 1TWCB 4O42A 4CDFC 3UDXA 3PUVA 4RFBA 2HIXA 3UDIA 4ABNA 2HQEA 2F0FA 1EQTA 1TS4A 4DUYL 2A73B 1YJNA 2AMCB 1SEBD 1TWAH 3NK9A 4JI1Q 3Q23A 3M9BA 1JQYD 4A3EH 4O2DA 3T53B 4EQNA 2ZJRA 1NJIC 2JEAI 4JV5L 4I65A 2L12A 3QR8A 3M4YA 2RVLA 1JC7A 5CR3A 5CV7A 3QIAA 4P75A 2Q8RE 3D6CA 4IUVA 4A3MG 2K32A 4IUQA 2Q2UA 3ERQA 1K8AC 4XIGS 4N9PA 5C4HA 1NAPA 5EGTA 1LYLA 1EOVA 1RTOA 1SAPA 1PMRA 4XDXA 3JAML 2CH4A 2YTVA 3CMEA 3HOWG 3FDTA 3BDOA 3G48A 3QOLA 3AQQA 5ELBA 1S4ZA 3VYRA 2F0MA 2XRQD 1A6XA 1MI2A 2PZTA 4PZ7A 1GD7A 3S1NB 2HUGA 3HKZB 1NTGA 1X3PA 2PNHA 3KJPA 1HQMC 1JWUD 4DGZA 2K52A 2VQEL 3UI2A 1J5EQ 3BYTB 2CHBD 4LAAA 1GUNA 5D3DA 3A7AB 4A75A 4RKBA 4IOAA 3A55A 2EYPA 5EPKA 2DN8A 3M4OH 4FNFA 1BNZA 4DN4M 3K6OA 3FHWA 2EYLA 1C7YA 4H7BA 1Q3LA 1LTTD 1STHA 5CORA 3ULPA 1SFOB 1EIFA 2PMZB 3D0FA 2UXCQ 3DMUA 2HCIA 4PNYA 4OHJA 1AZQA 2F52A 2OF1A 3HOYH 3K7UC 2D9UA 3HOZH 1LT6D 1CA5A 1H9MA 1YZ6A 3PO3H 2WACA 1X55A 3BYYB 1OXTA 4H0LC 4UP7A 3KF8A 5DNFA 4POFA 4Y52H 3U4VA 1CKNA 2B29A 3G6JB 4JI5Q 1A3VA 1Y8PB 3OMGA 4BBRH 4BBSB 3OW7A 3AFPA 4YHHL 2L9HA 3S1QH 2NVYH 1I4XA 3K81C 2I5MX 3UE1A 1R9TH 1FNVA 1YI2A 3F2CA 3K80C 3AMUA 1LT3D 3P75A 2MHVA 3T16A 2ICIA 1PFBA 4X3KA 5KIXA 2N8NA 3ND9A 1FD7D 1STEA 4OIKA 2VY3A 1HR0Q 1BR9A 2K6AA 1PYBA 1Y69U 1CT1D 4X3UA 5E7NA 2B63B 2BE5C 1KDBA 1CA6A 1NNXA 3BDCA 4DUYQ 4LF6L 2E2JH 2F0PA 4A3EG 5JJIA 1ET9A 3TP6A 1K0RA 1VQ6A 1O7YA 1LTSD 2TSSA 1S5ED 4JV5Q 3M4QA 1BBWA 3J80i 3K5MA 3C46A 3S2HB 1L0YB 4NP5A 4C56C 1EU3A 1JWSD 3KUPA 3HKSA 1GO3E 3J80c 4BY7H 2EIFA 1I6HH 1F2MA 2RHQB 2WKCA 5ELOA 1FVIA 1B70B 4RGNA 4L5RC 1J6QA 2NWGA 3CQZH 3GTJH 3TRZA 4A3DH 1D1IA 3S1MH 4KY5A 5FLXc 3FPPA 3CCRA 4I7ZC 4A3GH 3HEJA 1EY8A 1Q90A 4QJFA 2L0CA 4QUFA 4BY1H 2KUMA 1NY4A 2B8GA 1ASYA 4KY6A 1K3BC 3L9AX 2MQHA 2OEOA 1JCKB 5E4WC 4ME3A 5IIFA 2QF7A 2VQEQ 1DONA 1GUSA 2E74C 1TWCH 2QEJC 3KLRA 1FGUA 4IFDI 1F9RA 2E2HB 3CPWA 2JQOA 4GNXB 2DNEA 1EWIA 4UP8A 3D8GA 4R4IA 2K33A 3SVMA 3T51B 1IKLA 2F3WA 4IJHA 1HHVA 1K3RA 3GTOB 2A6EC 2CWPA 1LTAD 4OWWB 3HOZG 1VMCA 5EKLA 5IT9E 3ZJYC 3NXWA 1U0LA 2B2TC 4BA1I 1M90C 3PO3G 1D6EC 2QEXA 2E76C 1WTWA 1B44D 1WTPA 1T5XD 2M9VA 5J39A 1RDPD 3NTKA 4IZ8A 4YIJA 2E8GA 4EQ5A 1IYUA 1IYJB 1Q12A 4BBRG 5ELNA 5JPNC 1SLJA 4CBVA 2F0GA 3CCSA 5JOBA 3DEOA 2R93B 4RWSC 1ICWA 4YHHQ 4DR4Q 2LKVA 4CGYB 2VW9A 1QVFA 3FEWX 3S1NH 1PZKD 2N55A 4K2LA 5IT9c 1FL0A 5CV9A 1TY2A 4IO9A 1MSHA 1CZGA 5TSSA 1A0IA 1G2SA 5IE8A 4KI0A 4HIOA 5GQOA 1I94L 2IHFA 1R4PB 3CF5A 3R2IA 3H3VI 5DEHA 1JB7A 3ERSX 4GNXC 1U4LA 4A3JB 4BS9A 4LF6Q 2IL8A 1XX8A 1SYGA 5M3MB 3MEFA 1XMQL 1SFOH 2XSCA 1N33L 4YCVA 2Z6BA 4LFBL 4A3KG 4OO1G 1VQ5A 1A63A 1RIPA 5I9PA 5BR8L 2BA1A 2ZTCA 1PH5A 3C2PA 5K36H 1IYVA 4MZ9A 1QNKA 5EPLA 1E0BA 4A3DG 4RMFA 2QKIC 4BBSH 2K5NA 2VL6A 2F0LA 3NPPA 3Q22A 4UAIA 3NQTA 4A3MB 4XQJA 3FKIG 1PH6A 2SNMA 1TXYA 1SNMA 4LW1A 4KJOA 4XTCS 3TEHB 4IUTA 4BXXH 5C3EH 3GTGB 3CCVA 4Q5VA 1JORA 4LWCA 2G5DA 2ZM6L 2ZJQA 1X3FA 1HZCA 1PYWD 4JBWA 1PTOB 3RMHA 2C35B 3VA7A 1A3TA 1AW7A 2KEEA 2SOBA 1JJ2A 1HFGA 2B63H 4JI6L 3GTLB 3L7ZC 1BO0A 4HN7A 3T56B 4DNTB 2ZJPA 2RSOA 3TP8A 5IWAL 1Q46A 3M7GA 3PCOB 4J1MA 1EQQA 1F9QA 1SYDA 2YTXA 3D6WA 3S2HH 1S5BD 3W2DA 5J1ZA 1EUJA 1ESFA 4CJ2C 4FXKC 2CH4W 1Q81C 2EYOA 3W1BA 4RHRA 4APVA 2RCNA 2QILA 1LUZA 3CCLA 3I4OA 3VR3A 3TREA 3EN2A 2VQFL 4LFAL 3F2DA 5IYBH 1DOKA 4X64L 4PMCA 1VS0A 2K4KA 4PMBA 2B2VC 1VQPA 4JBKA 3HKZG 4DFAA 3V2TA 4TVAB 4KHVA 3J7AV 3KLSX 5KEEA 1RL2A 3DHQA 1CSPA 3EQLC 4JBMA 5DLQE 2IJ0A 2WV6D 3BU2A 2PQAB 4OXPA 3BG3A 1L0XB 4HR7B 1T5EA 1WOCA 1VQJA 1G6PA 1VDZA 1I94Q 2E2HH 1PTOC 3BDLA 4B3RL 3MVVA 4TSSA 5C4XB 3O13A 2ATWA 3GP7A 1I3QB 1Y1VB 3MWYW 2JXMB 1ILQA 1BQQT 1CTMA 1K8OA 5KYIA 1XMQQ 3GTOH 4KHPL 2WB1E 2KA7A 2BA0A 4LFCL 1N33Q 4DAYA 4LFBQ 3X3MA 5FO7B 3CHBD 1DGSA 1X3QA 1SMXA 1DM0B 2AQ1B 2DUDA 4ODGA 1EYCA 3VYSA 3SEBA 2PW7A 4R8NA 5BR8Q 4A93G 5K36G 2HIVA 3MXGA 1ET6A 1FYCA 3A56A 4KKTA 2RCFA 1VQ4A 1Q1BA 4BBSG 2E5LL 1UE6A 4FXGC 1I4PA 1TS5A 3BZDB 1NE3A 4KJNA 2R93H 5DAUA 1OO9B 3EJIA 1Z9FA 1EOTA 2CW0C 2IX0A 3KK7A 1SJED 4KY7A 1XMOQ 4BXXG 1HZ9A 3OYYA 5I2XA 5M5WH 4QCLA 2F3IA 2ASBA 1EWCA 1EY6A 5IYDH 4TQUS 2X6GA 1H95A 2F03A 2ZM6Q 1HJPA 3T13A 2Z0SA 1Y14B 2NN6I 1DOLA 3NQIA 1RHPA 2B2YA 3Q8DA 2B63G 1L1OA 3NTIA 3HS0C 1GVPA 1U9RA 2F0TA 4JI6Q 3PQIA 2XVSA 1AH9A 4JI7L 2F0UA 1PRTB 1KDAA 2F1MA 3H94A 3PMFA 4A3JH 2HDLA 2LY7A 4DKAC 3GTPB 1BBUA 4P2CB 1SNQA 3RZOB 1YNJC 5IWAQ 1LACA 2JA8B 5M3MH 2K50A 1E1TA 1QNUA 1AN8A 4A3CH 4JI1L 4KN7C 4HCSA 2RDGA 4LUZA 1Q8KA 1V43A 4A3BB 5IGGA 1HPCA 2A68D 2WINB 4WJWA 1RCVD 1PFMA 3MXNB 5IYBG 2GN5A 3NBHB 4P71A 1S5DD 2VQFQ 4LFAQ 1Z47A 3K5OA 4J6HA 4X64Q 4RHSA 2AQ2B 4A3MH 4XT3B 3QJYA 1HTPA 2CQOA 1SYCA 4OONA 5CMDA 4DAVA 3I55A 3S16B 4HJ8A 1W3SA 3VR6A 3S14B 4R8IA 5M5YB 2EE1A 2BE5D 1SYEA 3SHLA 1ZYRC 3AFQA 1Q82C 3GTGH 2N88A 1D5XC 2B39A 3S17B 3CCEA 1K73C 4XQNA 4A3FB 1LTBD 1PTOH 5C44B 4IALA 1V1PB 1TS2A 1PA6A 2XWBB 2LXKA 1PH4A 3P1HA 4CDDC 2L55A 4PMWA 3TS0A 2G9HD 3GTLH 1E7ZA 2DJFC 1TWHB 1X65A 1JMCA 1NR2A 1U4MA 5GROA 3HP3A 1PRTC 1F9SA 2NTSA 3CCMA 3V96A 1GM5A 4KHPQ 4LFCQ 5C0XI 5IT9L 4K0KL 1B53A 1KLGD 4Q0FA 5CBEE 2VB2X 4OL7A 4C3IB 1CK1A 1N8RC 2VS1A 2A1AA 2F0DA 2E5LQ 5T1GA 4JI3L 2R93G 1Y8OB 4M8AA 2KHSA 2H5XA 3E3XA 1KQSA 3NELA 3E9IA 3ND8A 4G7HC 3J7AF 4RH6A 3RNUA 3H09A 1SE8A 3HZXA 5KNBA 1K0SA 1QZGA 4IUUA 5ELDA 5IYDG 3KLSA 1STGA 1QZHA 4DV2L 3PIPA 3J81j 1K83H 1I4QA 4CKBA 1UE1A 2JJQA 1Z7TA 4AQYL 3OPOA 4KKUA 1V1OA 2KQ3A 5LMNW 4C1NK 2ZXOA 1VQNA 3KF6B 4A3JG 5C4XH 2A69D 4XYOA 4JI7Q 1VQGA 1Y1VH 3E9HA 5M3MG 2EJFC 1QILA 1HR0L 4OIJA 1YIJA 1GKHA 2PI2A 2K5DA 4K6DA 4A3CG 1UE7A 5EKKA 4ZAIA 4F7XA 1OXVA 5A2QE 4DK1A 1O80A 1PZJD 1PHJA 1KTKA 2RDFA 4ZYSA 2BCOA 2H4OA 4HMJA 2YTYA 1SMYD 4JI8L 3A5ZB 4RGOS 1YITA 1EZ8A 2K01A 3M4PA 3MXUA 5BN5A 5JJLA 4RA8A 3I4MB 1XNQL 2ES2A 5CYUA 4FVMA 1PYSB 1B9MA 1C48A 4O1NA 3DM1A 1IW7C 4CKEA 1EFID 1FNWA 4EGVA 2R6GA 1UE5A 2R7ZB 4GKJL 1GUGA 4IJLA 1KDCA 2N49A 1G2TA 1IHZA 2J7ZA 2J0TD 2B2UA 3I2ZA 2C5CA 1BBXC 5E3FA 5C6AA 2NVTB 2I0QA 2JSOA 3D4RA 3UE0A 4QB4A 3VA5A 1PXUA 4FF1A 3L3OC 3Q6SA 3RZOH 2TMPA 2JA8H 1KHIA 1R4QB 2MP1A 5F2DA 4HJ9A 1CM9A 2KJXA 5GAHC 1SR3A 5LL6X 5FJ8H 4DR7L 1QUQB 1G91A 1M8AA 4AYBB 3CC7A 4K0KQ 2D0PA 3VYTA 4XQQA 4GOPB 3A74A 4A3BH 3SXHA 4X65Q 1WTVA 1X9NA 2JK8A 4MN3A 4DUZL 1J9OA 2OQKA 4IFDG 1GHKA 3KDFA 4QIWB 4DR2L 1Y1WB 1S40A 4HSPA 1S72A 4JI3Q 1GUWA 1B9NA 2DY7A 4A93B 1A62A 5HY6A 4AH6A 3H0GB 5E1FA 5AFWA 3S16H 1MKHA 3STBC 5HGTA 2O5JC 1PH9A 2AWNA 4DNIA 1FJGL 1DCZA 5M5YH 4HEDA 3RD4A 3Q24A 4DR4L 1CZWA 4DV2Q 2Z4HA 3S17H 1TY0A 4NKLA 5JPMC 4A3FH 3CW2C 2JA6G 5CGKA 4YY3L 1TQOA 4AQYQ 2F4VL 1ENCA 3HFZB 5NUCA 5C4XG 2K14A 4L5SA 4FF3A 1CQVA 1STYA 1TWHH 1Y1VG 3EFXD 3I4NB 3J80E 3TMEA 2OXPA 2EVBA 2F0QA 1HA6A 2ZT9C 1X3EA 1LTID 1CSQA 2MNAA 3KFUA 4GLVB 1VQFA 2R7DA 2O5IC 4C3JB 5FLXE 3VR4A 2EDGA 4ZUIA 2XIWA 1TWFB 3F2UA 3N52A 1RD9D 1IBLL 4GOPC 2EY5A 2K75A 2FMCA 1W6KA 1SN8A 4C3IH 4JI8Q 1DXMA 4JK1C 4P72A 3HOXB 3RUZA 4A3KH 1XNQQ 2EOTA 1WFQA 2ICEC 4FDBA 4OO1H 5HGQA 2LS01 1QVGA 3A8JE 4ZRZA 2F0WA 4R4TA 3TSSA 1STBA 2KBNA 2DY8A 3UDFA 4F87A 4GKJQ 3OTOL 3RLNA 2NTTA 5EAYA 4K8IA 4CJ0B 3WOFA 3FKIH 2UUBQ 1MBYA 2DJGC 5KRUA 4XT1B 3M7NA 4RCOA 1B3QA 2WAQE 4S3SA 4DNRB 2SEBD 4ILWA 4F88A 5BN3A 3G6EA 1XJVA 5I2YA 2F0JA 4H44C 1X32A 2AUJD 2JA8G 1RF2D 1LT4D 4ZCKA 3URYA 4HJ7A 4BA2I 3UDGA 5FJ8G 1HZBA 2RF4A 3GTKB 4DR7Q 1VQ9A 2F0OA 4A3BG 1CQFA 1P8LA 5IY0A 2F0NA 2K28A 3OW2A 2NB0A 4DUZQ 1AE3A 1FGBD 1NBWA 1VQLA 2YV5A 4POGA 1WTQA 4DR2Q 1N32Q 3S24A 5ELEA 1VF7A 2MO1A 2IPKD 2FINB 5FO9B 1SE4A 2D5DA 2D0OA 3DM3A 2OTLA 1AE2A 3R93A 2E2DC 1EY5A 1FJGQ 4MHEA 3TQYA 2LMCB 2DNCA 3J81L 4A3FG 1ICFB 5C44G 2L4NA 2KEDA 1A3UA 1E22A 5ELCA 3E0JA 4YY3Q 4HAEA 2F4VQ 2XRSD 1X54A 3EROA 4UDUC 4OWXB 4JI0L 2NVTH 4LJZC 1BCPD 1IKMA 4WJ3M 3HOVB 2KCMA 3ZYYX 3VR2A 2EXDA 3A8KE 3BZKA 2O4XA 4R4QA 4WJ4A 2Z4IA 4B08A 3RLFA 5GAGC 1JOQA 3CXCA 4IUNA 5AJ3L 2IX1A 3LGJA 4DXFA 1Q7YC 1VQIA 2QW7A 4C3IG 3CP0A 2KCTA 4JI4L 1IBLQ 2PYKA 1BKBA 1TR5A 1OXXK 1Y1WH 4GLAC 4FP5D 2BOSA 1QCBD 2MPMA 1F2LA 4GLXA 4A93H 3H0GH 1YVCA 1B8AA 3CKIB 1F9PA 2Y0SE 2EZVA 4R9WA 2CKZB 2RBMA 2ID0A 4L5TA 1SRUA 2ZXRA 3OTOQ 1HNZL 1DJRD 2ZTEA 3ULLA 5A35A 1PH2A 1XMOL 3M3YB 3RN5A 1LTGD 3TP7A 1VQEA 3G71A 2IT1A 4KMUC 4L5QA 1QG7A 3RLOA 1PVOA 3I4NH 1P16A 1D8LA 4B9WA 5IGEA 3RR5A 4MIUA 3QWNA 4JC0A 4GS3A 1UEAB 1ILPA 1DZ1A 1SYFA 3U4ZA 1I6VC 4C3JH 1WD1A 4NB3A 2K5WA 3FPUB 1NUCA 1TWFH 5ELFA 2AUKA 1YNND 2RSNA 2NN6G 3I4MG 3IRBA 3MFGA 3HOXH 5C5LA 4YWMA 1Z6HA 1K28A 3DWQA 1BCPF 1BVSA 5EPJA 2BH2A 1FR3A 4U68A 1F2YA 3JAMi 3SR1A 2FXQA 1HTLD 5I9OA 3C1EA 3CMAA 2R7ZG 3BVZA 3MEHA 4J8QA 1SE3A 4EX5A 3JAMc 4YCUA 5KGUA 5D3IB 3K7AB 3BS1A 5IGDA 4LF9L 1JICA 3KOJA 1ASZA 2L5TA 1MJCA 3SK6A 4OWTB 3OHXC 1GUOA 3K58A 4JI0Q 1XXGA 2L15A 4LMQD 4JI2L 4PZ6A 5COYA 4QQBX 5G3LD 4JBJA 4C2MB 1T9HA 2LFNA 2JA6B 1VQAA 4PQXA 4K5XA 4G4KA 3GD7A 1Q1EA 3I72A 1EIYB 2B2TA 1I5FA 3EVQA 4AYBG 3GTKH 2MJ8A 3ONAB 1Y8NB 4L6TB 1EYGA 2K03A 4LNQA 2UXBL 2PZUA 5AJ3Q 4KKSA 2EYHA 3MHBA 3NUCA 1C0AA 4JI4Q 1SJHD 1N9WA 2A19A 1Y1WG 1B3AA 3J7YW 3GTMB 3NEMA 3H0GG 3J7ZC 4RAUC 2A74C 5IP7H 2WKDA 2VNUD 1JB3A 1NMGA 2JA7B 4DF7A 1G51A 2K5HA 3CCUA 1X6OA 2B2WC 2K5VA 1HNZQ 4ZLTF 5IOCA 4DPGA 5HURA 3H6MA 1WTXA 2EXZA 5EKIA 4EQPA 4Y7NB 1B50A 3I4NG 4GNXA 3K59A 1C9OA 4PV1C 2NVQB 4ZKBB 3HOVH 3J80L 4ZK9B 1XWEA 1TIID 1EY0A 3BVGA 4IN3A 4NXNQ 5I4DA 3LWUA 4C3JG 1CUKA 4A3IB 2XWJB 1LV9A 3PF5A 1V9PA 4A3LH 1QOHA 2EY1A 3NENA 5FLXL 1IBML 2R92B 3KF8B 4IPDA 1HNWL 2OWOA 1S5CD 1YEZA 4O0AA 2B3GA 3STBD 1X3GA 3HOXG 1WTOA 1QVCA 1CKNB 2F0SA 2XGTA 4DV4L 3ER0A 3VDYA 5CBAE 1JJCB 5KNDA 3AYHB 1YHQA 2RA4A 2K04A 5G3LF 5EBDA 3PIP3 5KYLA 1SNPA 1VQBA 1EEID 2JA5B 2FFKB 3U58A 1F77A 4CKCA 3C3LA 1I4HA 1VQ8A 2F4IA 4MTNA 3GV6A 5I6YA 1IBKL 3CC4A 3P7JA 2XNAC 4LF9Q 2NZHA 3H3VC 4OGQC 1X56A 4WRDA 4Z9CB 2X6LA 3M3YH 2IX3A 4EVOA 3KJOA 1I4RA 2K7VA 2LXJA 4DAMA 4A76A 4X66L 4ZKCB 3E0EA 4IQZA 3SK8A 3HOYB 4JI2Q 3W3AA 2LSSA 2WP8J 2UU9L 3T4AC 3AEVA 4K14A 1HXYD 3A54A 4DR5L 1K9MC 3LNNA 3E6ZX 4HTHA 1AFPA 1RTNA 3LWEA 4DV3L 2UXBQ 2FJ2A 1W2BA 2GVBA 3S1QB 2V1CC 1SBBB 4FF2A 3R2TA 1C4QA 1EL0A 2MFIA 3GO5A 3MXPA 4DR1L 1XPRA 4ALPA 2EYFA 2K05A 4X65L 3MZ5A 5IP7G 4HMIA 2B2VA 1HUMA 2QDBA 4UPAA 4QGUA 3PIOA 3ULJA 3GV3A 1N34Q 2M00A 3J81i 2E2IB 4IFDH 4OX9L 4H02A 4OELB 3GQBA 1NMFA 1U5KA 3K7AH 1VQDA 2Q8TA 5M3FG 2VZAA 2E2JB 3IKJA 2PI2E 5LMNL 5FKAC 5M5XB 2KCNA 5IP9H 1PH8A 4IPHA 2K5QA 1GUTA 4IUPA 3HOVG 3MTSA 2B8FA 4YWKA 1UWVA 2GVAA 5E4XA 1LLRD 4KK7A 4C2MH 1JWMD 2A6ED 2WAQB 2JA6H 4BY7B 2M2LA 1MSGA 1ESRA 3QG1A 2EYMA 5CV6A 1II3A 3DWAA 4A4IA 1YJ9A 4A3LG 2HHHQ 3CQZB 1I3QH 2BDOA 5DM63 2JEBI 3MA2B 1EYDA 5GAEC 4A3GB 2ALYB 3MC0B 5T1IA 1IBMQ 1HNWQ 2UUAL 3OIPA 1VQHA 2OCEA 3VR5A 3K5LA 3MAQA 4DV4Q 1I4GA 4P73A 3DLLA 1VQCA 5JJKA 5JVH3 1CI3M 3G4SA 3F2BA 2B2WA 1E2VA 4ZUJA 5IGCA 3S9WA 3GTQB 2XTIA 4B9XA 5JAVA 2JA7H 4DV1L 2NVXB 1ZXTA 4RCNA 3S15B 3H3VH 1IBKQ 4IFDJ 1HNXL 2PQAA 3A8IE 1D1KA 3FMCA 4KLKA 2JN4A 4KTAA 4RGMA 5L37A 1GHJA 4QF4A 4Y7NH 4DK3C 1GJXA 1HR0W 1IZ6A 4X66Q 3H15A 4JW0A 3WDNA 5FLMH 2UUBL 1G291 1A8VA 3N6RA 2NVQH 2UU9Q 4B3ML 3PO2G 4X3TA 2Z9HA 1TKWB 1QJOA 4DR5Q 1ONLA 4OEMB 4A3IH 3DXJC 3GTPH 4P74A 1HFNA 4L8JA 4J15A 4DV3Q 2SDFA 1SNCA 1KAAA 4K6LA 1K8GA 2R92H 3I91A 1YHAA 3TN2A 4RKLA 5EBCA 1E2WA 4V190 3F1ZA 2HDMA 2AWOA 3LX0A 1XYIA 2NYZD 1PV4A 1FNUA 5C3XA 5IODA 5IYCH 4DR1Q 2Z6KC 1BUVT 1TS3A 3OSOA 3SE0A 1Q86C 3A5UA 2JA5H 3HOUB 3G7LA 2MUYA 2O2LD 3IFDA 4ME5A 4PZ8A 4JCVE 1EQRA 1RJTA 1AZPA 2L1BA 4OX9Q 1KXLA 1PH3A 2OQ0A 1SROA 3I73A 1ENFA 1STAA 2Y0SB 3S14H 5IP9G 2EJGC 5LMNQ 3CD6A 4HIDA 4V0BA 2F0IA 1H9RA 3E5SA 2SNSA 1VQKA 4G7OC 1JOOA 5C44H 1SYBA 1VQ7A 5JVG3 2OTJA 4H13C 4JOIC 1HA5A 3F8TA 2K1BA 3CRKC 3CU7A 2CCZA 1U4RA 4PG3A 3RZDB 3MFYA 4KD4A 1UUPA 4KHZA 3IL8A 1N36L 4K2KA 1HZAA 1L0WA 3I70A 2A68C 3X3NA 2UUAQ 3PF4A 3MXNA 2PZWA 4G57A 3PUXA 3NBHA 4GN5A 5C3EB 1WTRA 2HD3A 3ITPA 2G9DA 1F2ZA 2H1EA 2RDHA 4N8FA 2I07B 1D5MC 5C3WA 1NCVA 1KIXA 2JA7G 2E2IH 4NXML 3SK5A 4DV1Q 2CWAA 1SNDA 2IW3A 1J8IA 4I7AA 1HNXQ 4U673 1O78A 2KENA 1PTOD 2I46A 2CQAA 2PCFB 1KD1C 1V1PA 3K0XA 2KVMA 5M5XH 1M4VA 2RQXA 1NR4A 3I7FA 1E24A 2EYJA 4JG2A 2RHSB 5FLMG 1G8ZD 1DYQA 5J22A 3RN2A 1SDFA 4C3HB 4B3MQ 3PSIA 2QGQA 1NSNS 3A7LA 1O7ZA 4DAYB 4A3IG 4KV6A 3PUWA 4CJ1B 1UEBA 4N8X1 2KHJA 5JEAH 3S1RB 1XNRL 2R92G 4N9TA 1IXRA 4R4CA 1S5FD 1OXSC 1L2FA 2A6HC 3I90A 4QUCA 4FYDA 2BDNA 5IYCG 1V8QA 2PO4A 3IAYA 3FRPB 2N3SA 3P20A 4JYAL 1O7LA 1EIHA 1S3OA 2JA5G 2ZXPA 2DGYA 1D2BA 2N78A 2CW0D 1LTRD 4DV7L 2WB1B 3GTQH 2PW5A 1E3PA 4HCEA 3D31A 4X6AH 2E75C 2NN6H 3I4MH 3NSWA 2NVXH 5C4JB 3S15H 3I4LA 4HIKA 4MNOA 3PV0A 4FF4A 1CHPD 1TT2A 3H91A 2R7ZH 1L1OB 3S2DB 3NWTA 4HIMA 3D4WA 3VYUA 3HOYG 4DV5L 1BF4A 2Q2IA 1VF5C 3KF6A 1I50B 1PLFA 5DM73 5M3FB 4MTKA 1MHWC 1YNJD 2A69C 3EIVA 1H9KA 2A5HA 3OOCA 4LF8L 4UHVA 1A2TA 2UXDL 1ZKOA 5K5PA 1AP0A 4L63B 3AB9A 4QY7A 3GDEA 3JC66 2Z6KA 2ZTDA 1WTHA 1KL9A 2A8VA 2IY5B 1BOSA 1EIGA 3L2PA 1N36Q 1G6ZA 1B1ZA 1PTOF 1AEXA 1XPUA 1TWGB 5JEAJ 1SNOA 4TKOB 2R7FA 3NHHA 1KLUD 1SMYC 3HKZE 2F0KA 4C1NI 3W5OA 3CAMA 5M5WB 1WJJA 1MIUA 2JA9A 4K8JA 5D65A 4DV0L 3HOUH 2YYZA 4LF4L 3AU7A 1H9SB 4CHTB 2D62A 1ZYRD 4NXMQ 3BVMA 2VUMB 1WI5A 1BDOA 5M9OA 2FMMA 3Q0AA 2I5LX 2CVRA 4AYBE 5BN4A 3V05A 1RODA 1WCMB 2NZOA 4JOIA 1CHQD 3TDQA 2PMZE 1EZ6A 2B2YC 1IL2A 3EA6A 3NBIA 2Q8IB 1L1OC 4F8MA 5LMUL 5C0XH 4RG1A 5J3BA 4QIWE 1PRTD 2YU9B 1KNEA 1MGSA 2WAQG 4BY7G 3U9OA 3T1YL 3W1GA 2UUCL 4UY8C 2EPBA 2AQ3B 4LF5L 1STNA 5JEAG 1TVXA 2I5HA 4X3SA 3TS2A 3RZDH 1QUQA 4QL5A 1LTLA 1XNRQ 4A3GG 4IURA 3QOJA 3PO2B 4GOPA 1MD2D 4BY1G 4NXNL 1HCZA 3TZDA 4IOCA 4DK6C 3JAME 1KRTA 4AIMA 3D4DA 3U9SA 4BWGB 4NPSA 3M85A 3KBXA 5A2QL 2HQLA 4JYAQ 3PGZA 5D14A 3HOWB 1OTCA 1ZEQX 4DV7Q 2F0VA 1H9JA 2D2CC 3SDZA 3I3CA 4YWLA 3K0YA 3CCJA 3NWSA 2IWHA 2HCCA 3KYHC 4IPGA 4GN3B 3OIQA 2EY2A 3QB3A 5EJWA 3I8ZA 4FXDA 4G7ZC 1A2UA 4DR6L 2J4XA 1VQMA 2PPBC 1PH1A 4ID6A 1XTCD 1WD0A 3CRLC 1D7QA 3C1FA 5FK9C 4DV5Q 1JT8A 1E1OA 1UAPA 5I6WA 1LABA 4C3HH 1EQVA 4R4OA 1HH2P 1YNXA 5C0XJ 4LF8Q 4GKKL 1QB5D 5GADC 2UXDQ 1HUNA 1C8CA 4WORA 4B3TL 2F0EA 3S1RH 4RGTA 3PUYA 4E6IA 1O7IA 5LHY1 2PNRC 1VCIA 1U4PA 2QDLA 2L11A 1D5ZC 3J7A5 3NP8A 1CKMA 1YHBA 2R61A 1QWYA 3CC2A 1IW7D 1VQOA 1PRTF 4B3SL 3HOUG 1DD2A 4DV6L 1CKOA 3K57A 4DV0Q 3KLWA 1YJWA 2MO0A 2RKSA 1K83B 1EYAA 5FOBB 1LM0A 4LF4Q 3T1HL 3D3RA 4IPCA 1M1KC 4DR3L 4OO1I 5C4JH 4FO2A 3OWFA 2KCCA 2NBFA 2Y0SG 1N34L 2EY6A 4TRDA 5CV5A 1DOMA 4K5VA 2QA4A 2OT2A 4NW2A 1HQRD 1GOZA 1PZID 3S2DH 1B4OA 5C0XG 3KBGA 1BCPB 3OWEB 5LMUQ 1I50H 1TWAB 4GN4B 5M3FH 1PDQA 3DEPA 3I56A 5KNCA 4QMGA 5JJZA 2HT1A 4A3EB 4ULLA 3T1YQ 2UUCQ 1LO5D 4LF7L 4LUVA 4LF5Q 1KNAA 5CV4A 1IL8A 1BXTA 1EY7A 1EFWA 2FHTA 1PH7A 4WFN3 3K5NA 1TWGH 3KDFB 3PIO3 1N32L 1UNSA 2ENBA 2KOLA 2HHHL 1KRSA 1YBYA 3HRZC 5LL6S 3SGIA 3SK4A 5C3EG 1JJGA 1Q8IA 3NTHA 5C4ZA 4LK1C 1QE6A 2C9OA 1EWHA 2JYOA 1WYDA 2P5ZX 4KN4C 2EJMA 3BJUA 1K8MA 1VMPA 5CC4A 2WFWA 1OXUA 1EU4A 1SE2A 3EBEA 5IGFA 2VUMH 5IGBA 4NDXA 4DU9A 4K5WA 3K8AA 2GA4B 4X62L 2PQEA 1WCMH 2AKWB 4DR6Q 1EEFD 2B2UC 3M4OB 2WIIB 3QO2A 1KAWA 4C3HG 2YU9H 1JR0D 1BCPC 3WOEA 3TBIB 3TZUA 4YCWA 4NMZA 4GKKQ 3ICEA 2V4DA 3B6YA 5H1SE 5C5MA 1XTDA 3HOZB 5EQ0A 4B3TQ 3R3OA 3HGBA 4KD3A 4CDCC 3PO3B 3L0OA 3PO2H 4CDEC 2VXWA 2Q2TA 3PUZA 4EQOA 1H9SA 1LT5D 4BBRB 3J81E 4XXEA 5ISRA 1A15A 3HOWH 2WB1G 2NVYB 1XPOA 4B3SQ 4DV6Q 4XYQA 5CV8A 3U50C 2Q2HA 1R9TB 1JOKA 3FVQA 1KC8C 1TU2B 1KABA 4HSVA 3T1HQ 1CFMA 3A0JA 2MGSA 3HG9A 3NE5B 4DR3Q 2QCPX 2R3ZA 4B3RQ 1J5EL 1GXDC 1RKNA 4JPBW 4LUOA 3CCQA 2AHOB 1PFNA 1HRJA 2BH8A 2XN9C 3WWVA 2IHEA 4R1JA 4UP9A 2CFMA 4DAPA 3OMCA 3J81c 2F3VA 2NZ1D 1ENAA 1ML0D 1JE4A 1MJEA 2Z8LA 2A6HD 1W6JA 2UXCL 2JE6I 1SSOA 2F0HA 2JP1A 2X69A 4LF7Q 1B2TA 3DWPA 3IFTA 3BZCA 1JE5A 4A3KB 3DUZA 2EQSA 1B7YB 4HJ5A 1I6HB 4DA2A 3R8BA 1YNNC
chains in the Genus database with same CATH topology
2KHIA 3PF4A 1Q1BA 4BBSG 1OXXK 2E5LL 4JI5L 1UE6A 1HNWL 1Y1WH 3PUXA 4GLAC 4GN5A 1NE3A 1V1QA 4GLXA 2R93H 4A93H 3H0GH 1YVCA 1B8AA 1Z9FA 3CPFA 4HJAA 1KIXA 2Y0SE 2JA7G 2IX0A 2E2IH 2VUMG 4NXML 4BXXG 3FP9A 1XMOQ 2CKZB 1HZ9A 3OYYA 2ID0A 4L5TA 5M5WH 4DV1Q 3GTMH 1SRUA 2F3IA 2CWAA 3OTOQ 2ASBA 5IYDH 1HNZL 2ZTEA 4TQUS 1H95A 2ZM6Q 1HNXQ 1HJPA 1PFSA 2KENA 1WCMG 4X62Q 3ULLA 1PH2A 1KD1C 3UDXA 1XMOL 3PUVA 3RN5A 3K0XA 2Z0SA 1Y14B 2HIXA 2NN6I 3Q8DA 3UDIA 5M5XH 2B63G 1VQEA 3I7FA 1E24A 1L1OA 1GVPA 4JG2A 3G71A 4JI6Q 2IT1A 2RHSB 4L5QA 3RLOA 5FLMG 4DUYL 1PVOA 4JI7L 1AH9A 1YJNA 2AMCB 3I4NH 1TWAH 4A3JH 1P16A 4JI1Q 1D8LA 4DKAC 3RN2A 3M9BA 3RR5A 1BBUA 4B3MQ 3PSIA 4JC0A 4A3EH 2QGQA 4GS3A 5IWAQ 4O2DA 5M3MH 2ZJRA 1NJIC 2K50A 2JEAI 4JV5L 4DAYB 4A3IG 1E1TA 3U4ZA 3PUWA 1UEBA 4A3CH 4JI1L 4C3JH 2KHJA 4NB3A 4P75A 4LUZA 1Q8KA 1XNRL 1V43A 2R92G 4A3MG 1TWFH 2Q2UA 1K8AC 1IXRA 4R4CA 4XIGS 1OXSC 1L2FA 1LYLA 1EOVA 5IYCG 3MXNB 2NN6G 5IYBG 3I4MG 2GN5A 3IRBA 2N3SA 3NBHB 4P71A 4LFAQ 4YWMA 1Z47A 2YTVA 3HOXH 2VQFQ 3CMEA 4JYAL 3HOWG 1BVSA 4X64Q 3G48A 2BH2A 1S3OA 2JA5G 3AQQA 3JAMi 4A3MH 2DGYA 2FXQA 2N78A 4DV7L 3CMAA 2CQOA 3GTQH 4OONA 3I55A 2R7ZG 4PZ7A 1GD7A 4HJ8A 1E3PA 1W3SA 3D31A 4X6AH 4EX5A 1NTGA 3JAMc 3I4MH 2NVXH 2PNHA 3KJPA 4YCUA 3S15H 3AFQA 1Q82C 3GTGH 4LF9L 2K52A 3KOJA 2VQEL 1J5EQ 1ASZA 3CCEA 4HIKA 1K73C 4MNOA 3PV0A 1PA6A 1MJCA 2LXKA 4OWTB 4A75A 2R7ZH 1PH4A 1L1OB 4HIMA 4IOAA 4PMWA 3TS0A 3HOYG 4JI0Q 3GTLH 3M4OH 1E7ZA 2L15A 4DV5L 2Q2IA 1X65A 4JI2L 3KF6A 1JMCA 4PZ6A 4QQBX 4JBJA 3EIVA 5GROA 3FHWA 1C7YA 1T9HA 4LF8L 1VQAA 3CCMA 3ULPA 1EIFA 3D0FA 3GD7A 2UXDL 2UXCQ 1Q1EA 1GM5A 4KHPQ 1EIYB 1I5FA 4AYBG 4LFCQ 4QY7A 3GTKH 3GDEA 2F52A 5C0XI 3HOYH 3JC66 3K7UC 1EYGA 2Z6KA 2ZTDA 3HOZH 4LNQA 4K0KL 2UXBL 1YZ6A 1KL9A 2A8VA 2IY5B 3PO3H 5AJ3Q 3L2PA 1N36Q 1X55A 1XPUA 1C0AA 1OXTA 4UP7A 5JEAJ 4JI4Q 4POFA 2R7FA 1N9WA 2A19A 1Y1WG 1N8RC 2VS1A 2A1AA 4Y52H 3U4VA 3HKZE 1CKNA 2B29A 2E5LQ 4JI5Q 4BBRH 4JI3L 3W5OA 3CAMA 2R93G 1WJJA 3NEMA 1MIUA 2H5XA 2JA9A 1KQSA 3NELA 3E9IA 3AFPA 3H0GG 4YHHL 3J7ZC 4DV0L 3S1QH 2NVYH 3K81C 2I5MX 3HOUH 3UE1A 5IP7H 2YYZA 3RNUA 1R9TH 1YI2A 4LF4L 3F2CA 3K80C 1SE8A 2D62A 2VNUD 1NMGA 1QZGA 4NXMQ 1G51A 2K5HA 3CCUA 5IYDG 1WI5A 1QZHA 4DV2L 2N8NA 3PIPA 1X6OA 2K5VA 2I5LX 1HNZQ 4AYBE 3J81j 4DPGA 1K83H 1UE1A 2JJQA 4AQYL 2NZOA 4JOIA 2VY3A 2PMZE 1HR0Q 5LMNW 1PYBA 1IL2A 5E7NA 3I4NG 1VQNA 3KF6B 4GNXA 4A3JG 1L1OC 5LMUL 5C4XH 4DUYQ 4RG1A 4LF6L 5J3BA 2E2JH 4QIWE 1C9OA 4JI7Q 4A3EG 1VQGA 5JJIA 2WAQG 1Y1VH 4BY7G 3E9HA 5M3MG 1K0RA 3HOVH 1VQ6A 3T1YL 1HR0L 1YIJA 1GKHA 2PI2A 3W1GA 2UUCL 4UY8C 4NXNQ 4A3CG 1UE7A 4JV5Q 3M4QA 1BBWA 3J80i 1CUKA 4LF5L 5JEAG 1OXVA 2I5HA 3TS2A 3RZDH 3PF5A 1V9PA 4A3LH 1PHJA 1QUQA 3NENA 4QL5A 1LTLA 1XNRQ 3HKSA 1GO3E 3J80c 4A3GG 4GOPA 1IBML 4BY7H 3KF8B 2EIFA 4IPDA 4NXNL 2YTYA 4BY1G 2OWOA 1YEZA 1I6HH 2RHQB 4O0AA 2B3GA 4JI8L 3STBD 5ELOA 4IOCA 1FVIA 1X3GA 3A5ZB 1KRTA 4AIMA 4DK6C 1B70B 1QVCA 3HOXG 1CKNB 3M4PA 2XGTA 1YITA 4L5RC 4DV4L 3ER0A 3VDYA 1J6QA 3GTJH 3CQZH 3TRZA 4NPSA 3M85A 2ES2A 1XNQL 1JJCB 4A3DH 3S1MH 2HQLA 3AYHB 4JYAQ 5FLXc 3PGZA 1YHQA 1PYSB 1OTCA 3CCRA 4A3GH 1VQBA 4QJFA 4DV7Q 4BY1H 1NY4A 1UE5A 2R6GA 3U58A 1ASYA 4GKJL 4IJLA 1VQ8A 2MQHA 4MTNA 4YWLA 1IBKL 5JJLA 3CC4A 3CCJA 4LF9Q 4ME3A 2NZHA 1X56A 3KYHC 2VQEQ 4IPGA 4GN3B 1TWCH 2N49A 3M3YH 1FGUA 4IFDI 4DR6L 3KJOA 3I2ZA 3CPWA 2JQOA 1VQMA 2LXJA 1PH1A 4GNXB 1EWIA 4UP8A 4DAMA 4A76A 1D7QA 4X66L 2I0QA 3E0EA 4R4IA 4DV5Q 3UE0A 4JI2Q 1JT8A 1E1OA 2LSSA 2WP8J 2UU9L 4C3HH 4IJHA 3AEVA 3RZOH 1K3RA 4R4OA 1HH2P 1YNXA 5C0XJ 4LF8Q 2JA8H 1KHIA 4GKKL 2CWPA 5GADC 4DR5L 4HJ9A 4OWWB 2UXDQ 3HOZG 5GAHC 1K9MC 1SR3A 3ZJYC 5FJ8H 1U0LA 4B3TL 4DR7L 1QUQB 4BA1I 1M90C 3PO3G 3CC7A 2QEXA 4DV3L 3S1RH 4K0KQ 2UXBQ 2D0PA 3PUYA 4GOPB 3A74A 1O7IA 1W2BA 4A3BH 2GVBA 1VCIA 4X65Q 1X9NA 3J7A5 2V1CC 1CKMA 2JK8A 4DUZL 2OQKA 4IFDG 1YHBA 3KDFA 2E8GA 4EQ5A 4BBRG 1IYJB 1Q12A 2MFIA 3GO5A 5ELNA 4DR1L 1XPRA 4DR2L 4ALPA 3CC2A 1S40A 1SLJA 1S72A 4JI3Q 3CCSA 1VQOA 4X65L 4B3SL 3HOUG 5IP7G 4DV6L 1CKOA 1A62A 5HY6A 4AH6A 4UPAA 4YHHQ 4QGUA 3KLWA 4DV0Q 1YJWA 2MO0A 4DR4Q 3PIOA 2VW9A 1QVFA 3ULJA 3S16H 1N34Q 1LM0A 1MKHA 4LF4Q 3J81i 3STBC 3S1NH 3T1HL 5IT9c 4OX9L 1PH9A 1FL0A 2AWNA 4DNIA 4IPCA 1M1KC 4H02A 1FJGL 5M5YH 4IO9A 4DR3L 1NMFA 4OO1I 5C4JH 1U5KA 3K7AH 1VQDA 4DR4L 4DV2Q 5M3FG 3S17H 1A0IA 2VZAA 2Y0SG 4A3FH 5IE8A 1N34L 3CW2C 4KI0A 4HIOA 5GQOA 2QA4A 1I94L 2IHFA 2JA6G 2PI2E 4YY3L 3CF5A 5LMNL 4AQYQ 2F4VL 5IP9H 3HFZB 3S2DH 3H3VI 5C4XG 1PH8A 2K14A 5C0XG 4L5SA 4IPHA 1JB7A 5LMUQ 1TWHH 3ERSX 1Y1VG 4GNXC 1I50H 4GN4B 5M3FH 4LF6Q 3I56A 3HOVG 4YWKA 1UWVA 2GVAA 1X3EA 4C2MH 2HT1A 2JA6H 3T1YQ 3MEFA 1XMQL 1SFOH 1CSQA 2UUCQ 1N33L 2MNAA 4LF7L 4YCVA 4LUVA 3KFUA 4A4IA 1YJ9A 4GLVB 1VQFA 2R7DA 4A3KG 4LF5Q 4A3LG 4LFBL 2HHHQ 4OO1G 1VQ5A 1I3QH 1RIPA 5BR8L 1A63A 2BA1A 1EFWA 1PH7A 2ZTCA 2JEBI 1PH5A 5GAEC 2ALYB 1IBMQ 1TWGH 4MZ9A 4GOPC 1IBLL 2UUAL 1HNWQ 3KDFB 2K75A 1N32L 1VQHA 2OCEA 1SN8A 4C3IH 4JI8Q 4A3DG 2HHHL 4RMFA 1KRSA 1YBYA 4P72A 3SGIA 5C3EG 4P73A 3DLLA 2K5NA 2VL6A 4DV4Q 1VQCA 4A3KH 4BBSH 5JJKA 1XNQQ 1JJGA 1WFQA 4FDBA 5HGQA 3G4SA 1QVGA 3F2BA 3FKIG 1WYDA 3BJUA 1PH6A 2WFWA 1TXYA 4R4TA 1OXUA 2XTIA 2KBNA 4LW1A 3EBEA 3UDFA 4GKJQ 2JA7H 4XTCS 3TEHB 4DV1L 2VUMH 3H3VH 5C3EH 4BXXH 3OTOL 1IBKQ 3RLNA 3CCVA 5EAYA 4IFDJ 4LWCA 2ZM6L 3K8AA 1HNXL 2ZJQA 1X3FA 1HZCA 4JBWA 4X62L 2PQAA 3FKIH 2UUBQ 2C35B 3M7NA 4KLKA 1WCMH 2WAQE 2AKWB 4DR6Q 1JJ2A 4Y7NH 4DK3C 2B63H 4JI6L 1HR0W 3L7ZC 1IZ6A 4X66Q 3H15A 2ZJPA 1KAWA 3G6EA 5FLMH 2UUBL 1G291 1A8VA 2YU9H 1XJVA 2NVQH 2UU9Q 4B3ML 3PO2G 2JA8G 5IWAL 1Q46A 4HJ7A 4BA2I 4YCWA 3UDGA 5FJ8G 1HZBA 3PCOB 4GKKQ 1EQQA 3ICEA 2YTXA 3S2HH 3B6YA 4DR5Q 5H1SE 2RF4A 4A3IH 1XTDA 4B3TQ 3GTPH 4P74A 1EUJA 1VQ9A 4DR7Q 4A3BG 4J15A 4DV3Q 1P8LA 5IY0A 3L0OA 1Q81C 3PO2H 1K8GA 2R92H 3OW2A 3W1BA 1YHAA 2Q2TA 4APVA 2RCNA 3PUZA 1LUZA 3F1ZA 3I4OA 4DUZQ 3CCLA 2AWOA 1AE3A 3TREA 1NBWA 3EN2A 2VQFL 1PV4A 2YV5A 1VQLA 4LFAL 5IYCH 4POGA 3F2DA 5IYBH 4DR1Q 4DR2Q 2Z6KC 4X64L 3S24A 1VS0A 3HOWH 2WB1G 1XPOA 4B3SQ 1Q86C 2MO1A 4DV6Q 3A5UA 2JA5H 2K4KA 1VQPA 3U50C 4JBKA 2Q2HA 4PZ8A 1KC8C 3HKZG 4JCVE 4TVAB 2D0OA 1EQRA 3DM3A 3T1HQ 3A0JA 1RL2A 1AE2A 2OTLA 4OX9Q 1FJGQ 1CSPA 1KXLA 4DR3Q 1PH3A 2OQ0A 1SROA 3TQYA 4JBMA 5DLQE 4A3FG 3BU2A 1J5EL 5C44G 4B3RQ 2PQAB 4OXPA 4LUOA 3CCQA 2AHOB 1WOCA 1VQJA 1G6PA 3S14H 1I94Q 1E22A 2BH8A 5IP9G 2E2HH 3WWVA 2IHEA 4YY3Q 5LMNQ 3CD6A 4HIDA 2F4VQ 4R1JA 4UP9A 1X54A 4JI0L 2CFMA 4OWXB 2NVTH 4B3RL 3J81c 1VQKA 2ATWA 4WJ3M 5C44H 1VQ7A 1MJEA 2KCMA 2EXDA 2OTJA 2UXCL 4JOIC 1XMQQ 3BZKA 3GTOH 4KHPL 2WB1E 2JE6I 3F8TA 4R4QA 1N33Q 2BA0A 4LFCL 2CCZA 4LF7Q 4WJ4A 3BZCA 4LFBQ 1DGSA 4PG3A 3RLFA 5GAGC 1SMXA 1JE5A 3CXCA 2DUDA 4KHZA 5AJ3L 2IX1A 2EQSA 1B7YB 3LGJA 5BR8Q 4HJ5A 1Q7YC 2HIVA 1N36L 1VQIA 4A93G 5K36G 1HZAA 3CP0A 2KCTA 1L0WA 4JI4L 1IBLQ 1VQ4A 2UUAQ 1BKBA 1N32Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHI A;  3PF4 A;  1Q1B A;  4BBS G;  1OXX K;  2E5L L;  4JI5 L;  1UE6 A;  1HNW L;  1Y1W H;  3PUX A;  4GLA C;  4GN5 A;  1NE3 A;  1V1Q A;  4GLX A;  2R93 H;  4A93 H;  3H0G H;  1YVC A;  1B8A A;  1Z9F A;  3CPF A;  4HJA A;  1KIX A;  2Y0S E;  2JA7 G;  2IX0 A;  2E2I H;  2VUM G;  4NXM L;  4BXX G;  3FP9 A;  1XMO Q;  2CKZ B;  1HZ9 A;  3OYY A;  2ID0 A;  4L5T A;  5M5W H;  4DV1 Q;  3GTM H;  1SRU A;  2F3I A;  2CWA A;  3OTO Q;  2ASB A;  5IYD H;  1HNZ L;  2ZTE A;  4TQU S;  1H95 A;  2ZM6 Q;  1HNX Q;  1HJP A;  1PFS A;  2KEN A;  1WCM G;  4X62 Q;  3ULL A;  1PH2 A;  1KD1 C;  3UDX A;  1XMO L;  3PUV A;  3RN5 A;  3K0X A;  2Z0S A;  1Y14 B;  2HIX A;  2NN6 I;  3Q8D A;  3UDI A;  5M5X H;  2B63 G;  1VQE A;  3I7F A;  1E24 A;  1L1O A;  1GVP A;  4JG2 A;  3G71 A;  4JI6 Q;  2IT1 A;  2RHS B;  4L5Q A;  3RLO A;  5FLM G;  4DUY L;  1PVO A;  4JI7 L;  1AH9 A;  1YJN A;  2AMC B;  3I4N H;  1TWA H;  4A3J H;  1P16 A;  4JI1 Q;  1D8L A;  4DKA C;  3RN2 A;  3M9B A;  3RR5 A;  1BBU A;  4B3M Q;  3PSI A;  4JC0 A;  4A3E H;  2QGQ A;  4GS3 A;  5IWA Q;  4O2D A;  5M3M H;  2ZJR A;  1NJI C;  2K50 A;  2JEA I;  4JV5 L;  4DAY B;  4A3I G;  1E1T A;  3U4Z A;  3PUW A;  1UEB A;  4A3C H;  4JI1 L;  4C3J H;  2KHJ A;  4NB3 A;  4P75 A;  4LUZ A;  1Q8K A;  1XNR L;  1V43 A;  2R92 G;  4A3M G;  1TWF H;  2Q2U A;  1K8A C;  1IXR A;  4R4C A;  4XIG S;  1OXS C;  1L2F A;  1LYL A;  1EOV A;  5IYC G;  3MXN B;  2NN6 G;  5IYB G;  3I4M G;  2GN5 A;  3IRB A;  2N3S A;  3NBH B;  4P71 A;  4LFA Q;  4YWM A;  1Z47 A;  2YTV A;  3HOX H;  2VQF Q;  3CME A;  4JYA L;  3HOW G;  1BVS A;  4X64 Q;  3G48 A;  2BH2 A;  1S3O A;  2JA5 G;  3AQQ A;  3JAM i;  4A3M H;  2DGY A;  2FXQ A;  2N78 A;  4DV7 L;  3CMA A;  2CQO A;  3GTQ H;  4OON A;  3I55 A;  2R7Z G;  4PZ7 A;  1GD7 A;  4HJ8 A;  1E3P A;  1W3S A;  3D31 A;  4X6A H;  4EX5 A;  1NTG A;  3JAM c;  3I4M H;  2NVX H;  2PNH A;  3KJP A;  4YCU A;  3S15 H;  3AFQ A;  1Q82 C;  3GTG H;  4LF9 L;  2K52 A;  3KOJ A;  2VQE L;  1J5E Q;  1ASZ A;  3CCE A;  4HIK A;  1K73 C;  4MNO A;  3PV0 A;  1PA6 A;  1MJC A;  2LXK A;  4OWT B;  4A75 A;  2R7Z H;  1PH4 A;  1L1O B;  4HIM A;  4IOA A;  4PMW A;  3TS0 A;  3HOY G;  4JI0 Q;  3GTL H;  3M4O H;  1E7Z A;  2L15 A;  4DV5 L;  2Q2I A;  1X65 A;  4JI2 L;  3KF6 A;  1JMC A;  4PZ6 A;  4QQB X;  4JBJ A;  3EIV A;  5GRO A;  3FHW A;  1C7Y A;  1T9H A;  4LF8 L;  1VQA A;  3CCM A;  3ULP A;  1EIF A;  3D0F A;  3GD7 A;  2UXD L;  2UXC Q;  1Q1E A;  1GM5 A;  4KHP Q;  1EIY B;  1I5F A;  4AYB G;  4LFC Q;  4QY7 A;  3GTK H;  3GDE A;  2F52 A;  5C0X I;  3HOY H;  3JC6 6;  3K7U C;  1EYG A;  2Z6K A;  2ZTD A;  3HOZ H;  4LNQ A;  4K0K L;  2UXB L;  1YZ6 A;  1KL9 A;  2A8V A;  2IY5 B;  3PO3 H;  5AJ3 Q;  3L2P A;  1N36 Q;  1X55 A;  1XPU A;  1C0A A;  1OXT A;  4UP7 A;  5JEA J;  4JI4 Q;  4POF A;  2R7F A;  1N9W A;  2A19 A;  1Y1W G;  1N8R C;  2VS1 A;  2A1A A;  4Y52 H;  3U4V A;  3HKZ E;  1CKN A;  2B29 A;  2E5L Q;  4JI5 Q;  4BBR H;  4JI3 L;  3W5O A;  3CAM A;  2R93 G;  1WJJ A;  3NEM A;  1MIU A;  2H5X A;  2JA9 A;  1KQS A;  3NEL A;  3E9I A;  3AFP A;  3H0G G;  4YHH L;  3J7Z C;  4DV0 L;  3S1Q H;  2NVY H;  3K81 C;  2I5M X;  3HOU H;  3UE1 A;  5IP7 H;  2YYZ A;  3RNU A;  1R9T H;  1YI2 A;  4LF4 L;  3F2C A;  3K80 C;  1SE8 A;  2D62 A;  2VNU D;  1NMG A;  1QZG A;  4NXM Q;  1G51 A;  2K5H A;  3CCU A;  5IYD G;  1WI5 A;  1QZH A;  4DV2 L;  2N8N A;  3PIP A;  1X6O A;  2K5V A;  2I5L X;  1HNZ Q;  4AYB E;  3J81 j;  4DPG A;  1K83 H;  1UE1 A;  2JJQ A;  4AQY L;  2NZO A;  4JOI A;  2VY3 A;  2PMZ E;  1HR0 Q;  5LMN W;  1PYB A;  1IL2 A;  5E7N A;  3I4N G;  1VQN A;  3KF6 B;  4GNX A;  4A3J G;  1L1O C;  5LMU L;  5C4X H;  4DUY Q;  4RG1 A;  4LF6 L;  5J3B A;  2E2J H;  4QIW E;  1C9O A;  4JI7 Q;  4A3E G;  1VQG A;  5JJI A;  2WAQ G;  1Y1V H;  4BY7 G;  3E9H A;  5M3M G;  1K0R A;  3HOV H;  1VQ6 A;  3T1Y L;  1HR0 L;  1YIJ A;  1GKH A;  2PI2 A;  3W1G A;  2UUC L;  4UY8 C;  4NXN Q;  4A3C G;  1UE7 A;  4JV5 Q;  3M4Q A;  1BBW A;  3J80 i;  1CUK A;  4LF5 L;  5JEA G;  1OXV A;  2I5H A;  3TS2 A;  3RZD H;  3PF5 A;  1V9P A;  4A3L H;  1PHJ A;  1QUQ A;  3NEN A;  4QL5 A;  1LTL A;  1XNR Q;  3HKS A;  1GO3 E;  3J80 c;  4A3G G;  4GOP A;  1IBM L;  4BY7 H;  3KF8 B;  2EIF A;  4IPD A;  4NXN L;  2YTY A;  4BY1 G;  2OWO A;  1YEZ A;  1I6H H;  2RHQ B;  4O0A A;  2B3G A;  4JI8 L;  3STB D;  5ELO A;  4IOC A;  1FVI A;  1X3G A;  3A5Z B;  1KRT A;  4AIM A;  4DK6 C;  1B70 B;  1QVC A;  3HOX G;  1CKN B;  3M4P A;  2XGT A;  1YIT A;  4L5R C;  4DV4 L;  3ER0 A;  3VDY A;  1J6Q A;  3GTJ H;  3CQZ H;  3TRZ A;  4NPS A;  3M85 A;  2ES2 A;  1XNQ L;  1JJC B;  4A3D H;  3S1M H;  2HQL A;  3AYH B;  4JYA Q;  5FLX c;  3PGZ A;  1YHQ A;  1PYS B;  1OTC A;  3CCR A;  4A3G H;  1VQB A;  4QJF A;  4DV7 Q;  4BY1 H;  1NY4 A;  1UE5 A;  2R6G A;  3U58 A;  1ASY A;  4GKJ L;  4IJL A;  1VQ8 A;  2MQH A;  4MTN A;  4YWL A;  1IBK L;  5JJL A;  3CC4 A;  3CCJ A;  4LF9 Q;  4ME3 A;  2NZH A;  1X56 A;  3KYH C;  2VQE Q;  4IPG A;  4GN3 B;  1TWC H;  2N49 A;  3M3Y H;  1FGU A;  4IFD I;  4DR6 L;  3KJO A;  3I2Z A;  3CPW A;  2JQO A;  1VQM A;  2LXJ A;  1PH1 A;  4GNX B;  1EWI A;  4UP8 A;  4DAM A;  4A76 A;  1D7Q A;  4X66 L;  2I0Q A;  3E0E A;  4R4I A;  4DV5 Q;  3UE0 A;  4JI2 Q;  1JT8 A;  1E1O A;  2LSS A;  2WP8 J;  2UU9 L;  4C3H H;  4IJH A;  3AEV A;  3RZO H;  1K3R A;  4R4O A;  1HH2 P;  1YNX A;  5C0X J;  4LF8 Q;  2JA8 H;  1KHI A;  4GKK L;  2CWP A;  5GAD C;  4DR5 L;  4HJ9 A;  4OWW B;  2UXD Q;  3HOZ G;  5GAH C;  1K9M C;  1SR3 A;  3ZJY C;  5FJ8 H;  1U0L A;  4B3T L;  4DR7 L;  1QUQ B;  4BA1 I;  1M90 C;  3PO3 G;  3CC7 A;  2QEX A;  4DV3 L;  3S1R H;  4K0K Q;  2UXB Q;  2D0P A;  3PUY A;  4GOP B;  3A74 A;  1O7I A;  1W2B A;  4A3B H;  2GVB A;  1VCI A;  4X65 Q;  1X9N A;  3J7A 5;  2V1C C;  1CKM A;  2JK8 A;  4DUZ L;  2OQK A;  4IFD G;  1YHB A;  3KDF A;  2E8G A;  4EQ5 A;  4BBR G;  1IYJ B;  1Q12 A;  2MFI A;  3GO5 A;  5ELN A;  4DR1 L;  1XPR A;  4DR2 L;  4ALP A;  3CC2 A;  1S40 A;  1SLJ A;  1S72 A;  4JI3 Q;  3CCS A;  1VQO A;  4X65 L;  4B3S L;  3HOU G;  5IP7 G;  4DV6 L;  1CKO A;  1A62 A;  5HY6 A;  4AH6 A;  4UPA A;  4YHH Q;  4QGU A;  3KLW A;  4DV0 Q;  1YJW A;  2MO0 A;  4DR4 Q;  3PIO A;  2VW9 A;  1QVF A;  3ULJ A;  3S16 H;  1N34 Q;  1LM0 A;  1MKH A;  4LF4 Q;  3J81 i;  3STB C;  3S1N H;  3T1H L;  5IT9 c;  4OX9 L;  1PH9 A;  1FL0 A;  2AWN A;  4DNI A;  4IPC A;  1M1K C;  4H02 A;  1FJG L;  5M5Y H;  4IO9 A;  4DR3 L;  1NMF A;  4OO1 I;  5C4J H;  1U5K A;  3K7A H;  1VQD A;  4DR4 L;  4DV2 Q;  5M3F G;  3S17 H;  1A0I A;  2VZA A;  2Y0S G;  4A3F H;  5IE8 A;  1N34 L;  3CW2 C;  4KI0 A;  4HIO A;  5GQO A;  2QA4 A;  1I94 L;  2IHF A;  2JA6 G;  2PI2 E;  4YY3 L;  3CF5 A;  5LMN L;  4AQY Q;  2F4V L;  5IP9 H;  3HFZ B;  3S2D H;  3H3V I;  5C4X G;  1PH8 A;  2K14 A;  5C0X G;  4L5S A;  4IPH A;  1JB7 A;  5LMU Q;  1TWH H;  3ERS X;  1Y1V G;  4GNX C;  1I50 H;  4GN4 B;  5M3F H;  4LF6 Q;  3I56 A;  3HOV G;  4YWK A;  1UWV A;  2GVA A;  1X3E A;  4C2M H;  2HT1 A;  2JA6 H;  3T1Y Q;  3MEF A;  1XMQ L;  1SFO H;  1CSQ A;  2UUC Q;  1N33 L;  2MNA A;  4LF7 L;  4YCV A;  4LUV A;  3KFU A;  4A4I A;  1YJ9 A;  4GLV B;  1VQF A;  2R7D A;  4A3K G;  4LF5 Q;  4A3L G;  4LFB L;  2HHH Q;  4OO1 G;  1VQ5 A;  1I3Q H;  1RIP A;  5BR8 L;  1A63 A;  2BA1 A;  1EFW A;  1PH7 A;  2ZTC A;  2JEB I;  1PH5 A;  5GAE C;  2ALY B;  1IBM Q;  1TWG H;  4MZ9 A;  4GOP C;  1IBL L;  2UUA L;  1HNW Q;  3KDF B;  2K75 A;  1N32 L;  1VQH A;  2OCE A;  1SN8 A;  4C3I H;  4JI8 Q;  4A3D G;  2HHH L;  4RMF A;  1KRS A;  1YBY A;  4P72 A;  3SGI A;  5C3E G;  4P73 A;  3DLL A;  2K5N A;  2VL6 A;  4DV4 Q;  1VQC A;  4A3K H;  4BBS H;  5JJK A;  1XNQ Q;  1JJG A;  1WFQ A;  4FDB A;  5HGQ A;  3G4S A;  1QVG A;  3F2B A;  3FKI G;  1WYD A;  3BJU A;  1PH6 A;  2WFW A;  1TXY A;  4R4T A;  1OXU A;  2XTI A;  2KBN A;  4LW1 A;  3EBE A;  3UDF A;  4GKJ Q;  2JA7 H;  4XTC S;  3TEH B;  4DV1 L;  2VUM H;  3H3V H;  5C3E H;  4BXX H;  3OTO L;  1IBK Q;  3RLN A;  3CCV A;  5EAY A;  4IFD J;  4LWC A;  2ZM6 L;  3K8A A;  1HNX L;  2ZJQ A;  1X3F A;  1HZC A;  4JBW A;  4X62 L;  2PQA A;  3FKI H;  2UUB Q;  2C35 B;  3M7N A;  4KLK A;  1WCM H;  2WAQ E;  2AKW B;  4DR6 Q;  1JJ2 A;  4Y7N H;  4DK3 C;  2B63 H;  4JI6 L;  1HR0 W;  3L7Z C;  1IZ6 A;  4X66 Q;  3H15 A;  2ZJP A;  1KAW A;  3G6E A;  5FLM H;  2UUB L;  1G29 1;  1A8V A;  2YU9 H;  1XJV A;  2NVQ H;  2UU9 Q;  4B3M L;  3PO2 G;  2JA8 G;  5IWA L;  1Q46 A;  4HJ7 A;  4BA2 I;  4YCW A;  3UDG A;  5FJ8 G;  1HZB A;  3PCO B;  4GKK Q;  1EQQ A;  3ICE A;  2YTX A;  3S2H H;  3B6Y A;  4DR5 Q;  5H1S E;  2RF4 A;  4A3I H;  1XTD A;  4B3T Q;  3GTP H;  4P74 A;  1EUJ A;  1VQ9 A;  4DR7 Q;  4A3B G;  4J15 A;  4DV3 Q;  1P8L A;  5IY0 A;  3L0O A;  1Q81 C;  3PO2 H;  1K8G A;  2R92 H;  3OW2 A;  3W1B A;  1YHA A;  2Q2T A;  4APV A;  2RCN A;  3PUZ A;  1LUZ A;  3F1Z A;  3I4O A;  4DUZ Q;  3CCL A;  2AWO A;  1AE3 A;  3TRE A;  1NBW A;  3EN2 A;  2VQF L;  1PV4 A;  2YV5 A;  1VQL A;  4LFA L;  5IYC H;  4POG A;  3F2D A;  5IYB H;  4DR1 Q;  4DR2 Q;  2Z6K C;  4X64 L;  3S24 A;  1VS0 A;  3HOW H;  2WB1 G;  1XPO A;  4B3S Q;  1Q86 C;  2MO1 A;  4DV6 Q;  3A5U A;  2JA5 H;  2K4K A;  1VQP A;  3U50 C;  4JBK A;  2Q2H A;  4PZ8 A;  1KC8 C;  3HKZ G;  4JCV E;  4TVA B;  2D0O A;  1EQR A;  3DM3 A;  3T1H Q;  3A0J A;  1RL2 A;  1AE2 A;  2OTL A;  4OX9 Q;  1FJG Q;  1CSP A;  1KXL A;  4DR3 Q;  1PH3 A;  2OQ0 A;  1SRO A;  3TQY A;  4JBM A;  5DLQ E;  4A3F G;  3BU2 A;  1J5E L;  5C44 G;  4B3R Q;  2PQA B;  4OXP A;  4LUO A;  3CCQ A;  2AHO B;  1WOC A;  1VQJ A;  1G6P A;  3S14 H;  1I94 Q;  1E22 A;  2BH8 A;  5IP9 G;  2E2H H;  3WWV A;  2IHE A;  4YY3 Q;  5LMN Q;  3CD6 A;  4HID A;  2F4V Q;  4R1J A;  4UP9 A;  1X54 A;  4JI0 L;  2CFM A;  4OWX B;  2NVT H;  4B3R L;  3J81 c;  1VQK A;  2ATW A;  4WJ3 M;  5C44 H;  1VQ7 A;  1MJE A;  2KCM A;  2EXD A;  2OTJ A;  2UXC L;  4JOI C;  1XMQ Q;  3BZK A;  3GTO H;  4KHP L;  2WB1 E;  2JE6 I;  3F8T A;  4R4Q A;  1N33 Q;  2BA0 A;  4LFC L;  2CCZ A;  4LF7 Q;  4WJ4 A;  3BZC A;  4LFB Q;  1DGS A;  4PG3 A;  3RLF A;  5GAG C;  1SMX A;  1JE5 A;  3CXC A;  2DUD A;  4KHZ A;  5AJ3 L;  2IX1 A;  2EQS A;  1B7Y B;  3LGJ A;  5BR8 Q;  4HJ5 A;  1Q7Y C;  2HIV A;  1N36 L;  1VQI A;  4A93 G;  5K36 G;  1HZA A;  3CP0 A;  2KCT A;  1L0W A;  4JI4 L;  1IBL Q;  1VQ4 A;  2UUA Q;  1BKB A;  1N32 Q; 
#chains in the Genus database with same CATH topology
 2KHI A;  4JI5 L;  2VB3 X;  3GTJ B;  4DXG A;  4A3D B;  3S1M B;  1V1Q A;  5FO8 B;  4GZY C;  4BY1 B;  3CPF A;  3FKI B;  2Z1C A;  4HJA A;  4DK0 A;  2VUM G;  4ZQ3 A;  3FP9 A;  2KEC A;  1EY4 A;  4JVZ A;  4M1U B;  1WVL A;  3GTM H;  2NUC A;  1SXT A;  1E2Z A;  1EY9 A;  1PFS A;  3TP5 A;  4X62 Q;  1WCM G;  1TWC B;  4O42 A;  4CDF C;  3UDX A;  3PUV A;  4RFB A;  2HIX A;  3UDI A;  4ABN A;  2HQE A;  2F0F A;  1EQT A;  1TS4 A;  4DUY L;  2A73 B;  1YJN A;  2AMC B;  1SEB D;  1TWA H;  3NK9 A;  4JI1 Q;  3Q23 A;  3M9B A;  1JQY D;  4A3E H;  4O2D A;  3T53 B;  4EQN A;  2ZJR A;  1NJI C;  2JEA I;  4JV5 L;  4I65 A;  2L12 A;  3QR8 A;  3M4Y A;  2RVL A;  1JC7 A;  5CR3 A;  5CV7 A;  3QIA A;  4P75 A;  2Q8R E;  3D6C A;  4IUV A;  4A3M G;  2K32 A;  4IUQ A;  2Q2U A;  3ERQ A;  1K8A C;  4XIG S;  4N9P A;  5C4H A;  1NAP A;  5EGT A;  1LYL A;  1EOV A;  1RTO A;  1SAP A;  1PMR A;  4XDX A;  3JAM L;  2CH4 A;  2YTV A;  3CME A;  3HOW G;  3FDT A;  3BDO A;  3G48 A;  3QOL A;  3AQQ A;  5ELB A;  1S4Z A;  3VYR A;  2F0M A;  2XRQ D;  1A6X A;  1MI2 A;  2PZT A;  4PZ7 A;  1GD7 A;  3S1N B;  2HUG A;  3HKZ B;  1NTG A;  1X3P A;  2PNH A;  3KJP A;  1HQM C;  1JWU D;  4DGZ A;  2K52 A;  2VQE L;  3UI2 A;  1J5E Q;  3BYT B;  2CHB D;  4LAA A;  1GUN A;  5D3D A;  3A7A B;  4A75 A;  4RKB A;  4IOA A;  3A55 A;  2EYP A;  5EPK A;  2DN8 A;  3M4O H;  4FNF A;  1BNZ A;  4DN4 M;  3K6O A;  3FHW A;  2EYL A;  1C7Y A;  4H7B A;  1Q3L A;  1LTT D;  1STH A;  5COR A;  3ULP A;  1SFO B;  1EIF A;  2PMZ B;  3D0F A;  2UXC Q;  3DMU A;  2HCI A;  4PNY A;  4OHJ A;  1AZQ A;  2F52 A;  2OF1 A;  3HOY H;  3K7U C;  2D9U A;  3HOZ H;  1LT6 D;  1CA5 A;  1H9M A;  1YZ6 A;  3PO3 H;  2WAC A;  1X55 A;  3BYY B;  1OXT A;  4H0L C;  4UP7 A;  3KF8 A;  5DNF A;  4POF A;  4Y52 H;  3U4V A;  1CKN A;  2B29 A;  3G6J B;  4JI5 Q;  1A3V A;  1Y8P B;  3OMG A;  4BBR H;  4BBS B;  3OW7 A;  3AFP A;  4YHH L;  2L9H A;  3S1Q H;  2NVY H;  1I4X A;  3K81 C;  2I5M X;  3UE1 A;  1R9T H;  1FNV A;  1YI2 A;  3F2C A;  3K80 C;  3AMU A;  1LT3 D;  3P75 A;  2MHV A;  3T16 A;  2ICI A;  1PFB A;  4X3K A;  5KIX A;  2N8N A;  3ND9 A;  1FD7 D;  1STE A;  4OIK A;  2VY3 A;  1HR0 Q;  1BR9 A;  2K6A A;  1PYB A;  1Y69 U;  1CT1 D;  4X3U A;  5E7N A;  2B63 B;  2BE5 C;  1KDB A;  1CA6 A;  1NNX A;  3BDC A;  4DUY Q;  4LF6 L;  2E2J H;  2F0P A;  4A3E G;  5JJI A;  1ET9 A;  3TP6 A;  1K0R A;  1VQ6 A;  1O7Y A;  1LTS D;  2TSS A;  1S5E D;  4JV5 Q;  3M4Q A;  1BBW A;  3J80 i;  3K5M A;  3C46 A;  3S2H B;  1L0Y B;  4NP5 A;  4C56 C;  1EU3 A;  1JWS D;  3KUP A;  3HKS A;  1GO3 E;  3J80 c;  4BY7 H;  2EIF A;  1I6H H;  1F2M A;  2RHQ B;  2WKC A;  5ELO A;  1FVI A;  1B70 B;  4RGN A;  4L5R C;  1J6Q A;  2NWG A;  3CQZ H;  3GTJ H;  3TRZ A;  4A3D H;  1D1I A;  3S1M H;  4KY5 A;  5FLX c;  3FPP A;  3CCR A;  4I7Z C;  4A3G H;  3HEJ A;  1EY8 A;  1Q90 A;  4QJF A;  2L0C A;  4QUF A;  4BY1 H;  2KUM A;  1NY4 A;  2B8G A;  1ASY A;  4KY6 A;  1K3B C;  3L9A X;  2MQH A;  2OEO A;  1JCK B;  5E4W C;  4ME3 A;  5IIF A;  2QF7 A;  2VQE Q;  1DON A;  1GUS A;  2E74 C;  1TWC H;  2QEJ C;  3KLR A;  1FGU A;  4IFD I;  1F9R A;  2E2H B;  3CPW A;  2JQO A;  4GNX B;  2DNE A;  1EWI A;  4UP8 A;  3D8G A;  4R4I A;  2K33 A;  3SVM A;  3T51 B;  1IKL A;  2F3W A;  4IJH A;  1HHV A;  1K3R A;  3GTO B;  2A6E C;  2CWP A;  1LTA D;  4OWW B;  3HOZ G;  1VMC A;  5EKL A;  5IT9 E;  3ZJY C;  3NXW A;  1U0L A;  2B2T C;  4BA1 I;  1M90 C;  3PO3 G;  1D6E C;  2QEX A;  2E76 C;  1WTW A;  1B44 D;  1WTP A;  1T5X D;  2M9V A;  5J39 A;  1RDP D;  3NTK A;  4IZ8 A;  4YIJ A;  2E8G A;  4EQ5 A;  1IYU A;  1IYJ B;  1Q12 A;  4BBR G;  5ELN A;  5JPN C;  1SLJ A;  4CBV A;  2F0G A;  3CCS A;  5JOB A;  3DEO A;  2R93 B;  4RWS C;  1ICW A;  4YHH Q;  4DR4 Q;  2LKV A;  4CGY B;  2VW9 A;  1QVF A;  3FEW X;  3S1N H;  1PZK D;  2N55 A;  4K2L A;  5IT9 c;  1FL0 A;  5CV9 A;  1TY2 A;  4IO9 A;  1MSH A;  1CZG A;  5TSS A;  1A0I A;  1G2S A;  5IE8 A;  4KI0 A;  4HIO A;  5GQO A;  1I94 L;  2IHF A;  1R4P B;  3CF5 A;  3R2I A;  3H3V I;  5DEH A;  1JB7 A;  3ERS X;  4GNX C;  1U4L A;  4A3J B;  4BS9 A;  4LF6 Q;  2IL8 A;  1XX8 A;  1SYG A;  5M3M B;  3MEF A;  1XMQ L;  1SFO H;  2XSC A;  1N33 L;  4YCV A;  2Z6B A;  4LFB L;  4A3K G;  4OO1 G;  1VQ5 A;  1A63 A;  1RIP A;  5I9P A;  5BR8 L;  2BA1 A;  2ZTC A;  1PH5 A;  3C2P A;  5K36 H;  1IYV A;  4MZ9 A;  1QNK A;  5EPL A;  1E0B A;  4A3D G;  4RMF A;  2QKI C;  4BBS H;  2K5N A;  2VL6 A;  2F0L A;  3NPP A;  3Q22 A;  4UAI A;  3NQT A;  4A3M B;  4XQJ A;  3FKI G;  1PH6 A;  2SNM A;  1TXY A;  1SNM A;  4LW1 A;  4KJO A;  4XTC S;  3TEH B;  4IUT A;  4BXX H;  5C3E H;  3GTG B;  3CCV A;  4Q5V A;  1JOR A;  4LWC A;  2G5D A;  2ZM6 L;  2ZJQ A;  1X3F A;  1HZC A;  1PYW D;  4JBW A;  1PTO B;  3RMH A;  2C35 B;  3VA7 A;  1A3T A;  1AW7 A;  2KEE A;  2SOB A;  1JJ2 A;  1HFG A;  2B63 H;  4JI6 L;  3GTL B;  3L7Z C;  1BO0 A;  4HN7 A;  3T56 B;  4DNT B;  2ZJP A;  2RSO A;  3TP8 A;  5IWA L;  1Q46 A;  3M7G A;  3PCO B;  4J1M A;  1EQQ A;  1F9Q A;  1SYD A;  2YTX A;  3D6W A;  3S2H H;  1S5B D;  3W2D A;  5J1Z A;  1EUJ A;  1ESF A;  4CJ2 C;  4FXK C;  2CH4 W;  1Q81 C;  2EYO A;  3W1B A;  4RHR A;  4APV A;  2RCN A;  2QIL A;  1LUZ A;  3CCL A;  3I4O A;  3VR3 A;  3TRE A;  3EN2 A;  2VQF L;  4LFA L;  3F2D A;  5IYB H;  1DOK A;  4X64 L;  4PMC A;  1VS0 A;  2K4K A;  4PMB A;  2B2V C;  1VQP A;  4JBK A;  3HKZ G;  4DFA A;  3V2T A;  4TVA B;  4KHV A;  3J7A V;  3KLS X;  5KEE A;  1RL2 A;  3DHQ A;  1CSP A;  3EQL C;  4JBM A;  5DLQ E;  2IJ0 A;  2WV6 D;  3BU2 A;  2PQA B;  4OXP A;  3BG3 A;  1L0X B;  4HR7 B;  1T5E A;  1WOC A;  1VQJ A;  1G6P A;  1VDZ A;  1I94 Q;  2E2H H;  1PTO C;  3BDL A;  4B3R L;  3MVV A;  4TSS A;  5C4X B;  3O13 A;  2ATW A;  3GP7 A;  1I3Q B;  1Y1V B;  3MWY W;  2JXM B;  1ILQ A;  1BQQ T;  1CTM A;  1K8O A;  5KYI A;  1XMQ Q;  3GTO H;  4KHP L;  2WB1 E;  2KA7 A;  2BA0 A;  4LFC L;  1N33 Q;  4DAY A;  4LFB Q;  3X3M A;  5FO7 B;  3CHB D;  1DGS A;  1X3Q A;  1SMX A;  1DM0 B;  2AQ1 B;  2DUD A;  4ODG A;  1EYC A;  3VYS A;  3SEB A;  2PW7 A;  4R8N A;  5BR8 Q;  4A93 G;  5K36 G;  2HIV A;  3MXG A;  1ET6 A;  1FYC A;  3A56 A;  4KKT A;  2RCF A;  1VQ4 A;  1Q1B A;  4BBS G;  2E5L L;  1UE6 A;  4FXG C;  1I4P A;  1TS5 A;  3BZD B;  1NE3 A;  4KJN A;  2R93 H;  5DAU A;  1OO9 B;  3EJI A;  1Z9F A;  1EOT A;  2CW0 C;  2IX0 A;  3KK7 A;  1SJE D;  4KY7 A;  1XMO Q;  4BXX G;  1HZ9 A;  3OYY A;  5I2X A;  5M5W H;  4QCL A;  2F3I A;  2ASB A;  1EWC A;  1EY6 A;  5IYD H;  4TQU S;  2X6G A;  1H95 A;  2F03 A;  2ZM6 Q;  1HJP A;  3T13 A;  2Z0S A;  1Y14 B;  2NN6 I;  1DOL A;  3NQI A;  1RHP A;  2B2Y A;  3Q8D A;  2B63 G;  1L1O A;  3NTI A;  3HS0 C;  1GVP A;  1U9R A;  2F0T A;  4JI6 Q;  3PQI A;  2XVS A;  1AH9 A;  4JI7 L;  2F0U A;  1PRT B;  1KDA A;  2F1M A;  3H94 A;  3PMF A;  4A3J H;  2HDL A;  2LY7 A;  4DKA C;  3GTP B;  1BBU A;  4P2C B;  1SNQ A;  3RZO B;  1YNJ C;  5IWA Q;  1LAC A;  2JA8 B;  5M3M H;  2K50 A;  1E1T A;  1QNU A;  1AN8 A;  4A3C H;  4JI1 L;  4KN7 C;  4HCS A;  2RDG A;  4LUZ A;  1Q8K A;  1V43 A;  4A3B B;  5IGG A;  1HPC A;  2A68 D;  2WIN B;  4WJW A;  1RCV D;  1PFM A;  3MXN B;  5IYB G;  2GN5 A;  3NBH B;  4P71 A;  1S5D D;  2VQF Q;  4LFA Q;  1Z47 A;  3K5O A;  4J6H A;  4X64 Q;  4RHS A;  2AQ2 B;  4A3M H;  4XT3 B;  3QJY A;  1HTP A;  2CQO A;  1SYC A;  4OON A;  5CMD A;  4DAV A;  3I55 A;  3S16 B;  4HJ8 A;  1W3S A;  3VR6 A;  3S14 B;  4R8I A;  5M5Y B;  2EE1 A;  2BE5 D;  1SYE A;  3SHL A;  1ZYR C;  3AFQ A;  1Q82 C;  3GTG H;  2N88 A;  1D5X C;  2B39 A;  3S17 B;  3CCE A;  1K73 C;  4XQN A;  4A3F B;  1LTB D;  1PTO H;  5C44 B;  4IAL A;  1V1P B;  1TS2 A;  1PA6 A;  2XWB B;  2LXK A;  1PH4 A;  3P1H A;  4CDD C;  2L55 A;  4PMW A;  3TS0 A;  2G9H D;  3GTL H;  1E7Z A;  2DJF C;  1TWH B;  1X65 A;  1JMC A;  1NR2 A;  1U4M A;  5GRO A;  3HP3 A;  1PRT C;  1F9S A;  2NTS A;  3CCM A;  3V96 A;  1GM5 A;  4KHP Q;  4LFC Q;  5C0X I;  5IT9 L;  4K0K L;  1B53 A;  1KLG D;  4Q0F A;  5CBE E;  2VB2 X;  4OL7 A;  4C3I B;  1CK1 A;  1N8R C;  2VS1 A;  2A1A A;  2F0D A;  2E5L Q;  5T1G A;  4JI3 L;  2R93 G;  1Y8O B;  4M8A A;  2KHS A;  2H5X A;  3E3X A;  1KQS A;  3NEL A;  3E9I A;  3ND8 A;  4G7H C;  3J7A F;  4RH6 A;  3RNU A;  3H09 A;  1SE8 A;  3HZX A;  5KNB A;  1K0S A;  1QZG A;  4IUU A;  5ELD A;  5IYD G;  3KLS A;  1STG A;  1QZH A;  4DV2 L;  3PIP A;  3J81 j;  1K83 H;  1I4Q A;  4CKB A;  1UE1 A;  2JJQ A;  1Z7T A;  4AQY L;  3OPO A;  4KKU A;  1V1O A;  2KQ3 A;  5LMN W;  4C1N K;  2ZXO A;  1VQN A;  3KF6 B;  4A3J G;  5C4X H;  2A69 D;  4XYO A;  4JI7 Q;  1VQG A;  1Y1V H;  3E9H A;  5M3M G;  2EJF C;  1QIL A;  1HR0 L;  4OIJ A;  1YIJ A;  1GKH A;  2PI2 A;  2K5D A;  4K6D A;  4A3C G;  1UE7 A;  5EKK A;  4ZAI A;  4F7X A;  1OXV A;  5A2Q E;  4DK1 A;  1O80 A;  1PZJ D;  1PHJ A;  1KTK A;  2RDF A;  4ZYS A;  2BCO A;  2H4O A;  4HMJ A;  2YTY A;  1SMY D;  4JI8 L;  3A5Z B;  4RGO S;  1YIT A;  1EZ8 A;  2K01 A;  3M4P A;  3MXU A;  5BN5 A;  5JJL A;  4RA8 A;  3I4M B;  1XNQ L;  2ES2 A;  5CYU A;  4FVM A;  1PYS B;  1B9M A;  1C48 A;  4O1N A;  3DM1 A;  1IW7 C;  4CKE A;  1EFI D;  1FNW A;  4EGV A;  2R6G A;  1UE5 A;  2R7Z B;  4GKJ L;  1GUG A;  4IJL A;  1KDC A;  2N49 A;  1G2T A;  1IHZ A;  2J7Z A;  2J0T D;  2B2U A;  3I2Z A;  2C5C A;  1BBX C;  5E3F A;  5C6A A;  2NVT B;  2I0Q A;  2JSO A;  3D4R A;  3UE0 A;  4QB4 A;  3VA5 A;  1PXU A;  4FF1 A;  3L3O C;  3Q6S A;  3RZO H;  2TMP A;  2JA8 H;  1KHI A;  1R4Q B;  2MP1 A;  5F2D A;  4HJ9 A;  1CM9 A;  2KJX A;  5GAH C;  1SR3 A;  5LL6 X;  5FJ8 H;  4DR7 L;  1QUQ B;  1G91 A;  1M8A A;  4AYB B;  3CC7 A;  4K0K Q;  2D0P A;  3VYT A;  4XQQ A;  4GOP B;  3A74 A;  4A3B H;  3SXH A;  4X65 Q;  1WTV A;  1X9N A;  2JK8 A;  4MN3 A;  4DUZ L;  1J9O A;  2OQK A;  4IFD G;  1GHK A;  3KDF A;  4QIW B;  4DR2 L;  1Y1W B;  1S40 A;  4HSP A;  1S72 A;  4JI3 Q;  1GUW A;  1B9N A;  2DY7 A;  4A93 B;  1A62 A;  5HY6 A;  4AH6 A;  3H0G B;  5E1F A;  5AFW A;  3S16 H;  1MKH A;  3STB C;  5HGT A;  2O5J C;  1PH9 A;  2AWN A;  4DNI A;  1FJG L;  1DCZ A;  5M5Y H;  4HED A;  3RD4 A;  3Q24 A;  4DR4 L;  1CZW A;  4DV2 Q;  2Z4H A;  3S17 H;  1TY0 A;  4NKL A;  5JPM C;  4A3F H;  3CW2 C;  2JA6 G;  5CGK A;  4YY3 L;  1TQO A;  4AQY Q;  2F4V L;  1ENC A;  3HFZ B;  5NUC A;  5C4X G;  2K14 A;  4L5S A;  4FF3 A;  1CQV A;  1STY A;  1TWH H;  1Y1V G;  3EFX D;  3I4N B;  3J80 E;  3TME A;  2OXP A;  2EVB A;  2F0Q A;  1HA6 A;  2ZT9 C;  1X3E A;  1LTI D;  1CSQ A;  2MNA A;  3KFU A;  4GLV B;  1VQF A;  2R7D A;  2O5I C;  4C3J B;  5FLX E;  3VR4 A;  2EDG A;  4ZUI A;  2XIW A;  1TWF B;  3F2U A;  3N52 A;  1RD9 D;  1IBL L;  4GOP C;  2EY5 A;  2K75 A;  2FMC A;  1W6K A;  1SN8 A;  4C3I H;  4JI8 Q;  1DXM A;  4JK1 C;  4P72 A;  3HOX B;  3RUZ A;  4A3K H;  1XNQ Q;  2EOT A;  1WFQ A;  2ICE C;  4FDB A;  4OO1 H;  5HGQ A;  2LS0 1;  1QVG A;  3A8J E;  4ZRZ A;  2F0W A;  4R4T A;  3TSS A;  1STB A;  2KBN A;  2DY8 A;  3UDF A;  4F87 A;  4GKJ Q;  3OTO L;  3RLN A;  2NTT A;  5EAY A;  4K8I A;  4CJ0 B;  3WOF A;  3FKI H;  2UUB Q;  1MBY A;  2DJG C;  5KRU A;  4XT1 B;  3M7N A;  4RCO A;  1B3Q A;  2WAQ E;  4S3S A;  4DNR B;  2SEB D;  4ILW A;  4F88 A;  5BN3 A;  3G6E A;  1XJV A;  5I2Y A;  2F0J A;  4H44 C;  1X32 A;  2AUJ D;  2JA8 G;  1RF2 D;  1LT4 D;  4ZCK A;  3URY A;  4HJ7 A;  4BA2 I;  3UDG A;  5FJ8 G;  1HZB A;  2RF4 A;  3GTK B;  4DR7 Q;  1VQ9 A;  2F0O A;  4A3B G;  1CQF A;  1P8L A;  5IY0 A;  2F0N A;  2K28 A;  3OW2 A;  2NB0 A;  4DUZ Q;  1AE3 A;  1FGB D;  1NBW A;  1VQL A;  2YV5 A;  4POG A;  1WTQ A;  4DR2 Q;  1N32 Q;  3S24 A;  5ELE A;  1VF7 A;  2MO1 A;  2IPK D;  2FIN B;  5FO9 B;  1SE4 A;  2D5D A;  2D0O A;  3DM3 A;  2OTL A;  1AE2 A;  3R93 A;  2E2D C;  1EY5 A;  1FJG Q;  4MHE A;  3TQY A;  2LMC B;  2DNC A;  3J81 L;  4A3F G;  1ICF B;  5C44 G;  2L4N A;  2KED A;  1A3U A;  1E22 A;  5ELC A;  3E0J A;  4YY3 Q;  4HAE A;  2F4V Q;  2XRS D;  1X54 A;  3ERO A;  4UDU C;  4OWX B;  4JI0 L;  2NVT H;  4LJZ C;  1BCP D;  1IKM A;  4WJ3 M;  3HOV B;  2KCM A;  3ZYY X;  3VR2 A;  2EXD A;  3A8K E;  3BZK A;  2O4X A;  4R4Q A;  4WJ4 A;  2Z4I A;  4B08 A;  3RLF A;  5GAG C;  1JOQ A;  3CXC A;  4IUN A;  5AJ3 L;  2IX1 A;  3LGJ A;  4DXF A;  1Q7Y C;  1VQI A;  2QW7 A;  4C3I G;  3CP0 A;  2KCT A;  4JI4 L;  1IBL Q;  2PYK A;  1BKB A;  1TR5 A;  1OXX K;  1Y1W H;  4GLA C;  4FP5 D;  2BOS A;  1QCB D;  2MPM A;  1F2L A;  4GLX A;  4A93 H;  3H0G H;  1YVC A;  1B8A A;  3CKI B;  1F9P A;  2Y0S E;  2EZV A;  4R9W A;  2CKZ B;  2RBM A;  2ID0 A;  4L5T A;  1SRU A;  2ZXR A;  3OTO Q;  1HNZ L;  1DJR D;  2ZTE A;  3ULL A;  5A35 A;  1PH2 A;  1XMO L;  3M3Y B;  3RN5 A;  1LTG D;  3TP7 A;  1VQE A;  3G71 A;  2IT1 A;  4KMU C;  4L5Q A;  1QG7 A;  3RLO A;  1PVO A;  3I4N H;  1P16 A;  1D8L A;  4B9W A;  5IGE A;  3RR5 A;  4MIU A;  3QWN A;  4JC0 A;  4GS3 A;  1UEA B;  1ILP A;  1DZ1 A;  1SYF A;  3U4Z A;  1I6V C;  4C3J H;  1WD1 A;  4NB3 A;  2K5W A;  3FPU B;  1NUC A;  1TWF H;  5ELF A;  2AUK A;  1YNN D;  2RSN A;  2NN6 G;  3I4M G;  3IRB A;  3MFG A;  3HOX H;  5C5L A;  4YWM A;  1Z6H A;  1K28 A;  3DWQ A;  1BCP F;  1BVS A;  5EPJ A;  2BH2 A;  1FR3 A;  4U68 A;  1F2Y A;  3JAM i;  3SR1 A;  2FXQ A;  1HTL D;  5I9O A;  3C1E A;  3CMA A;  2R7Z G;  3BVZ A;  3MEH A;  4J8Q A;  1SE3 A;  4EX5 A;  3JAM c;  4YCU A;  5KGU A;  5D3I B;  3K7A B;  3BS1 A;  5IGD A;  4LF9 L;  1JIC A;  3KOJ A;  1ASZ A;  2L5T A;  1MJC A;  3SK6 A;  4OWT B;  3OHX C;  1GUO A;  3K58 A;  4JI0 Q;  1XXG A;  2L15 A;  4LMQ D;  4JI2 L;  4PZ6 A;  5COY A;  4QQB X;  5G3L D;  4JBJ A;  4C2M B;  1T9H A;  2LFN A;  2JA6 B;  1VQA A;  4PQX A;  4K5X A;  4G4K A;  3GD7 A;  1Q1E A;  3I72 A;  1EIY B;  2B2T A;  1I5F A;  3EVQ A;  4AYB G;  3GTK H;  2MJ8 A;  3ONA B;  1Y8N B;  4L6T B;  1EYG A;  2K03 A;  4LNQ A;  2UXB L;  2PZU A;  5AJ3 Q;  4KKS A;  2EYH A;  3MHB A;  3NUC A;  1C0A A;  4JI4 Q;  1SJH D;  1N9W A;  2A19 A;  1Y1W G;  1B3A A;  3J7Y W;  3GTM B;  3NEM A;  3H0G G;  3J7Z C;  4RAU C;  2A74 C;  5IP7 H;  2WKD A;  2VNU D;  1JB3 A;  1NMG A;  2JA7 B;  4DF7 A;  1G51 A;  2K5H A;  3CCU A;  1X6O A;  2B2W C;  2K5V A;  1HNZ Q;  4ZLT F;  5IOC A;  4DPG A;  5HUR A;  3H6M A;  1WTX A;  2EXZ A;  5EKI A;  4EQP A;  4Y7N B;  1B50 A;  3I4N G;  4GNX A;  3K59 A;  1C9O A;  4PV1 C;  2NVQ B;  4ZKB B;  3HOV H;  3J80 L;  4ZK9 B;  1XWE A;  1TII D;  1EY0 A;  3BVG A;  4IN3 A;  4NXN Q;  5I4D A;  3LWU A;  4C3J G;  1CUK A;  4A3I B;  2XWJ B;  1LV9 A;  3PF5 A;  1V9P A;  4A3L H;  1QOH A;  2EY1 A;  3NEN A;  5FLX L;  1IBM L;  2R92 B;  3KF8 B;  4IPD A;  1HNW L;  2OWO A;  1S5C D;  1YEZ A;  4O0A A;  2B3G A;  3STB D;  1X3G A;  3HOX G;  1WTO A;  1QVC A;  1CKN B;  2F0S A;  2XGT A;  4DV4 L;  3ER0 A;  3VDY A;  5CBA E;  1JJC B;  5KND A;  3AYH B;  1YHQ A;  2RA4 A;  2K04 A;  5G3L F;  5EBD A;  3PIP 3;  5KYL A;  1SNP A;  1VQB A;  1EEI D;  2JA5 B;  2FFK B;  3U58 A;  1F77 A;  4CKC A;  3C3L A;  1I4H A;  1VQ8 A;  2F4I A;  4MTN A;  3GV6 A;  5I6Y A;  1IBK L;  3CC4 A;  3P7J A;  2XNA C;  4LF9 Q;  2NZH A;  3H3V C;  4OGQ C;  1X56 A;  4WRD A;  4Z9C B;  2X6L A;  3M3Y H;  2IX3 A;  4EVO A;  3KJO A;  1I4R A;  2K7V A;  2LXJ A;  4DAM A;  4A76 A;  4X66 L;  4ZKC B;  3E0E A;  4IQZ A;  3SK8 A;  3HOY B;  4JI2 Q;  3W3A A;  2LSS A;  2WP8 J;  2UU9 L;  3T4A C;  3AEV A;  4K14 A;  1HXY D;  3A54 A;  4DR5 L;  1K9M C;  3LNN A;  3E6Z X;  4HTH A;  1AFP A;  1RTN A;  3LWE A;  4DV3 L;  2UXB Q;  2FJ2 A;  1W2B A;  2GVB A;  3S1Q B;  2V1C C;  1SBB B;  4FF2 A;  3R2T A;  1C4Q A;  1EL0 A;  2MFI A;  3GO5 A;  3MXP A;  4DR1 L;  1XPR A;  4ALP A;  2EYF A;  2K05 A;  4X65 L;  3MZ5 A;  5IP7 G;  4HMI A;  2B2V A;  1HUM A;  2QDB A;  4UPA A;  4QGU A;  3PIO A;  3ULJ A;  3GV3 A;  1N34 Q;  2M00 A;  3J81 i;  2E2I B;  4IFD H;  4OX9 L;  4H02 A;  4OEL B;  3GQB A;  1NMF A;  1U5K A;  3K7A H;  1VQD A;  2Q8T A;  5M3F G;  2VZA A;  2E2J B;  3IKJ A;  2PI2 E;  5LMN L;  5FKA C;  5M5X B;  2KCN A;  5IP9 H;  1PH8 A;  4IPH A;  2K5Q A;  1GUT A;  4IUP A;  3HOV G;  3MTS A;  2B8F A;  4YWK A;  1UWV A;  2GVA A;  5E4X A;  1LLR D;  4KK7 A;  4C2M H;  1JWM D;  2A6E D;  2WAQ B;  2JA6 H;  4BY7 B;  2M2L A;  1MSG A;  1ESR A;  3QG1 A;  2EYM A;  5CV6 A;  1II3 A;  3DWA A;  4A4I A;  1YJ9 A;  4A3L G;  2HHH Q;  3CQZ B;  1I3Q H;  2BDO A;  5DM6 3;  2JEB I;  3MA2 B;  1EYD A;  5GAE C;  4A3G B;  2ALY B;  3MC0 B;  5T1I A;  1IBM Q;  1HNW Q;  2UUA L;  3OIP A;  1VQH A;  2OCE A;  3VR5 A;  3K5L A;  3MAQ A;  4DV4 Q;  1I4G A;  4P73 A;  3DLL A;  1VQC A;  5JJK A;  5JVH 3;  1CI3 M;  3G4S A;  3F2B A;  2B2W A;  1E2V A;  4ZUJ A;  5IGC A;  3S9W A;  3GTQ B;  2XTI A;  4B9X A;  5JAV A;  2JA7 H;  4DV1 L;  2NVX B;  1ZXT A;  4RCN A;  3S15 B;  3H3V H;  1IBK Q;  4IFD J;  1HNX L;  2PQA A;  3A8I E;  1D1K A;  3FMC A;  4KLK A;  2JN4 A;  4KTA A;  4RGM A;  5L37 A;  1GHJ A;  4QF4 A;  4Y7N H;  4DK3 C;  1GJX A;  1HR0 W;  1IZ6 A;  4X66 Q;  3H15 A;  4JW0 A;  3WDN A;  5FLM H;  2UUB L;  1G29 1;  1A8V A;  3N6R A;  2NVQ H;  2UU9 Q;  4B3M L;  3PO2 G;  4X3T A;  2Z9H A;  1TKW B;  1QJO A;  4DR5 Q;  1ONL A;  4OEM B;  4A3I H;  3DXJ C;  3GTP H;  4P74 A;  1HFN A;  4L8J A;  4J15 A;  4DV3 Q;  2SDF A;  1SNC A;  1KAA A;  4K6L A;  1K8G A;  2R92 H;  3I91 A;  1YHA A;  3TN2 A;  4RKL A;  5EBC A;  1E2W A;  4V19 0;  3F1Z A;  2HDM A;  2AWO A;  3LX0 A;  1XYI A;  2NYZ D;  1PV4 A;  1FNU A;  5C3X A;  5IOD A;  5IYC H;  4DR1 Q;  2Z6K C;  1BUV T;  1TS3 A;  3OSO A;  3SE0 A;  1Q86 C;  3A5U A;  2JA5 H;  3HOU B;  3G7L A;  2MUY A;  2O2L D;  3IFD A;  4ME5 A;  4PZ8 A;  4JCV E;  1EQR A;  1RJT A;  1AZP A;  2L1B A;  4OX9 Q;  1KXL A;  1PH3 A;  2OQ0 A;  1SRO A;  3I73 A;  1ENF A;  1STA A;  2Y0S B;  3S14 H;  5IP9 G;  2EJG C;  5LMN Q;  3CD6 A;  4HID A;  4V0B A;  2F0I A;  1H9R A;  3E5S A;  2SNS A;  1VQK A;  4G7O C;  1JOO A;  5C44 H;  1SYB A;  1VQ7 A;  5JVG 3;  2OTJ A;  4H13 C;  4JOI C;  1HA5 A;  3F8T A;  2K1B A;  3CRK C;  3CU7 A;  2CCZ A;  1U4R A;  4PG3 A;  3RZD B;  3MFY A;  4KD4 A;  1UUP A;  4KHZ A;  3IL8 A;  1N36 L;  4K2K A;  1HZA A;  1L0W A;  3I70 A;  2A68 C;  3X3N A;  2UUA Q;  3PF4 A;  3MXN A;  2PZW A;  4G57 A;  3PUX A;  3NBH A;  4GN5 A;  5C3E B;  1WTR A;  2HD3 A;  3ITP A;  2G9D A;  1F2Z A;  2H1E A;  2RDH A;  4N8F A;  2I07 B;  1D5M C;  5C3W A;  1NCV A;  1KIX A;  2JA7 G;  2E2I H;  4NXM L;  3SK5 A;  4DV1 Q;  2CWA A;  1SND A;  2IW3 A;  1J8I A;  4I7A A;  1HNX Q;  4U67 3;  1O78 A;  2KEN A;  1PTO D;  2I46 A;  2CQA A;  2PCF B;  1KD1 C;  1V1P A;  3K0X A;  2KVM A;  5M5X H;  1M4V A;  2RQX A;  1NR4 A;  3I7F A;  1E24 A;  2EYJ A;  4JG2 A;  2RHS B;  5FLM G;  1G8Z D;  1DYQ A;  5J22 A;  3RN2 A;  1SDF A;  4C3H B;  4B3M Q;  3PSI A;  2QGQ A;  1NSN S;  3A7L A;  1O7Z A;  4DAY B;  4A3I G;  4KV6 A;  3PUW A;  4CJ1 B;  1UEB A;  4N8X 1;  2KHJ A;  5JEA H;  3S1R B;  1XNR L;  2R92 G;  4N9T A;  1IXR A;  4R4C A;  1S5F D;  1OXS C;  1L2F A;  2A6H C;  3I90 A;  4QUC A;  4FYD A;  2BDN A;  5IYC G;  1V8Q A;  2PO4 A;  3IAY A;  3FRP B;  2N3S A;  3P20 A;  4JYA L;  1O7L A;  1EIH A;  1S3O A;  2JA5 G;  2ZXP A;  2DGY A;  1D2B A;  2N78 A;  2CW0 D;  1LTR D;  4DV7 L;  2WB1 B;  3GTQ H;  2PW5 A;  1E3P A;  4HCE A;  3D31 A;  4X6A H;  2E75 C;  2NN6 H;  3I4M H;  3NSW A;  2NVX H;  5C4J B;  3S15 H;  3I4L A;  4HIK A;  4MNO A;  3PV0 A;  4FF4 A;  1CHP D;  1TT2 A;  3H91 A;  2R7Z H;  1L1O B;  3S2D B;  3NWT A;  4HIM A;  3D4W A;  3VYU A;  3HOY G;  4DV5 L;  1BF4 A;  2Q2I A;  1VF5 C;  3KF6 A;  1I50 B;  1PLF A;  5DM7 3;  5M3F B;  4MTK A;  1MHW C;  1YNJ D;  2A69 C;  3EIV A;  1H9K A;  2A5H A;  3OOC A;  4LF8 L;  4UHV A;  1A2T A;  2UXD L;  1ZKO A;  5K5P A;  1AP0 A;  4L63 B;  3AB9 A;  4QY7 A;  3GDE A;  3JC6 6;  2Z6K A;  2ZTD A;  1WTH A;  1KL9 A;  2A8V A;  2IY5 B;  1BOS A;  1EIG A;  3L2P A;  1N36 Q;  1G6Z A;  1B1Z A;  1PTO F;  1AEX A;  1XPU A;  1TWG B;  5JEA J;  1SNO A;  4TKO B;  2R7F A;  3NHH A;  1KLU D;  1SMY C;  3HKZ E;  2F0K A;  4C1N I;  3W5O A;  3CAM A;  5M5W B;  1WJJ A;  1MIU A;  2JA9 A;  4K8J A;  5D65 A;  4DV0 L;  3HOU H;  2YYZ A;  4LF4 L;  3AU7 A;  1H9S B;  4CHT B;  2D62 A;  1ZYR D;  4NXM Q;  3BVM A;  2VUM B;  1WI5 A;  1BDO A;  5M9O A;  2FMM A;  3Q0A A;  2I5L X;  2CVR A;  4AYB E;  5BN4 A;  3V05 A;  1ROD A;  1WCM B;  2NZO A;  4JOI A;  1CHQ D;  3TDQ A;  2PMZ E;  1EZ6 A;  2B2Y C;  1IL2 A;  3EA6 A;  3NBI A;  2Q8I B;  1L1O C;  4F8M A;  5LMU L;  5C0X H;  4RG1 A;  5J3B A;  4QIW E;  1PRT D;  2YU9 B;  1KNE A;  1MGS A;  2WAQ G;  4BY7 G;  3U9O A;  3T1Y L;  3W1G A;  2UUC L;  4UY8 C;  2EPB A;  2AQ3 B;  4LF5 L;  1STN A;  5JEA G;  1TVX A;  2I5H A;  4X3S A;  3TS2 A;  3RZD H;  1QUQ A;  4QL5 A;  1LTL A;  1XNR Q;  4A3G G;  4IUR A;  3QOJ A;  3PO2 B;  4GOP A;  1MD2 D;  4BY1 G;  4NXN L;  1HCZ A;  3TZD A;  4IOC A;  4DK6 C;  3JAM E;  1KRT A;  4AIM A;  3D4D A;  3U9S A;  4BWG B;  4NPS A;  3M85 A;  3KBX A;  5A2Q L;  2HQL A;  4JYA Q;  3PGZ A;  5D14 A;  3HOW B;  1OTC A;  1ZEQ X;  4DV7 Q;  2F0V A;  1H9J A;  2D2C C;  3SDZ A;  3I3C A;  4YWL A;  3K0Y A;  3CCJ A;  3NWS A;  2IWH A;  2HCC A;  3KYH C;  4IPG A;  4GN3 B;  3OIQ A;  2EY2 A;  3QB3 A;  5EJW A;  3I8Z A;  4FXD A;  4G7Z C;  1A2U A;  4DR6 L;  2J4X A;  1VQM A;  2PPB C;  1PH1 A;  4ID6 A;  1XTC D;  1WD0 A;  3CRL C;  1D7Q A;  3C1F A;  5FK9 C;  4DV5 Q;  1JT8 A;  1E1O A;  1UAP A;  5I6W A;  1LAB A;  4C3H H;  1EQV A;  4R4O A;  1HH2 P;  1YNX A;  5C0X J;  4LF8 Q;  4GKK L;  1QB5 D;  5GAD C;  2UXD Q;  1HUN A;  1C8C A;  4WOR A;  4B3T L;  2F0E A;  3S1R H;  4RGT A;  3PUY A;  4E6I A;  1O7I A;  5LHY 1;  2PNR C;  1VCI A;  1U4P A;  2QDL A;  2L11 A;  1D5Z C;  3J7A 5;  3NP8 A;  1CKM A;  1YHB A;  2R61 A;  1QWY A;  3CC2 A;  1IW7 D;  1VQO A;  1PRT F;  4B3S L;  3HOU G;  1DD2 A;  4DV6 L;  1CKO A;  3K57 A;  4DV0 Q;  3KLW A;  1YJW A;  2MO0 A;  2RKS A;  1K83 B;  1EYA A;  5FOB B;  1LM0 A;  4LF4 Q;  3T1H L;  3D3R A;  4IPC A;  1M1K C;  4DR3 L;  4OO1 I;  5C4J H;  4FO2 A;  3OWF A;  2KCC A;  2NBF A;  2Y0S G;  1N34 L;  2EY6 A;  4TRD A;  5CV5 A;  1DOM A;  4K5V A;  2QA4 A;  2OT2 A;  4NW2 A;  1HQR D;  1GOZ A;  1PZI D;  3S2D H;  1B4O A;  5C0X G;  3KBG A;  1BCP B;  3OWE B;  5LMU Q;  1I50 H;  1TWA B;  4GN4 B;  5M3F H;  1PDQ A;  3DEP A;  3I56 A;  5KNC A;  4QMG A;  5JJZ A;  2HT1 A;  4A3E B;  4ULL A;  3T1Y Q;  2UUC Q;  1LO5 D;  4LF7 L;  4LUV A;  4LF5 Q;  1KNA A;  5CV4 A;  1IL8 A;  1BXT A;  1EY7 A;  1EFW A;  2FHT A;  1PH7 A;  4WFN 3;  3K5N A;  1TWG H;  3KDF B;  3PIO 3;  1N32 L;  1UNS A;  2ENB A;  2KOL A;  2HHH L;  1KRS A;  1YBY A;  3HRZ C;  5LL6 S;  3SGI A;  3SK4 A;  5C3E G;  1JJG A;  1Q8I A;  3NTH A;  5C4Z A;  4LK1 C;  1QE6 A;  2C9O A;  1EWH A;  2JYO A;  1WYD A;  2P5Z X;  4KN4 C;  2EJM A;  3BJU A;  1K8M A;  1VMP A;  5CC4 A;  2WFW A;  1OXU A;  1EU4 A;  1SE2 A;  3EBE A;  5IGF A;  2VUM H;  5IGB A;  4NDX A;  4DU9 A;  4K5W A;  3K8A A;  2GA4 B;  4X62 L;  2PQE A;  1WCM H;  2AKW B;  4DR6 Q;  1EEF D;  2B2U C;  3M4O B;  2WII B;  3QO2 A;  1KAW A;  4C3H G;  2YU9 H;  1JR0 D;  1BCP C;  3WOE A;  3TBI B;  3TZU A;  4YCW A;  4NMZ A;  4GKK Q;  3ICE A;  2V4D A;  3B6Y A;  5H1S E;  5C5M A;  1XTD A;  3HOZ B;  5EQ0 A;  4B3T Q;  3R3O A;  3HGB A;  4KD3 A;  4CDC C;  3PO3 B;  3L0O A;  3PO2 H;  4CDE C;  2VXW A;  2Q2T A;  3PUZ A;  4EQO A;  1H9S A;  1LT5 D;  4BBR B;  3J81 E;  4XXE A;  5ISR A;  1A15 A;  3HOW H;  2WB1 G;  2NVY B;  1XPO A;  4B3S Q;  4DV6 Q;  4XYQ A;  5CV8 A;  3U50 C;  2Q2H A;  1R9T B;  1JOK A;  3FVQ A;  1KC8 C;  1TU2 B;  1KAB A;  4HSV A;  3T1H Q;  1CFM A;  3A0J A;  2MGS A;  3HG9 A;  3NE5 B;  4DR3 Q;  2QCP X;  2R3Z A;  4B3R Q;  1J5E L;  1GXD C;  1RKN A;  4JPB W;  4LUO A;  3CCQ A;  2AHO B;  1PFN A;  1HRJ A;  2BH8 A;  2XN9 C;  3WWV A;  2IHE A;  4R1J A;  4UP9 A;  2CFM A;  4DAP A;  3OMC A;  3J81 c;  2F3V A;  2NZ1 D;  1ENA A;  1ML0 D;  1JE4 A;  1MJE A;  2Z8L A;  2A6H D;  1W6J A;  2UXC L;  2JE6 I;  1SSO A;  2F0H A;  2JP1 A;  2X69 A;  4LF7 Q;  1B2T A;  3DWP A;  3IFT A;  3BZC A;  1JE5 A;  4A3K B;  3DUZ A;  2EQS A;  1B7Y B;  4HJ5 A;  1I6H B;  4DA2 A;  3R8B A;  1YNN C; 
#chains in the Genus database with same CATH homology
 2KHI A;  3PF4 A;  1Q1B A;  4BBS G;  1OXX K;  2E5L L;  4JI5 L;  1UE6 A;  1HNW L;  1Y1W H;  3PUX A;  4GLA C;  4GN5 A;  1NE3 A;  1V1Q A;  4GLX A;  2R93 H;  4A93 H;  3H0G H;  1YVC A;  1B8A A;  1Z9F A;  3CPF A;  4HJA A;  1KIX A;  2Y0S E;  2JA7 G;  2IX0 A;  2E2I H;  2VUM G;  4NXM L;  4BXX G;  3FP9 A;  1XMO Q;  2CKZ B;  1HZ9 A;  3OYY A;  2ID0 A;  4L5T A;  5M5W H;  4DV1 Q;  3GTM H;  1SRU A;  2F3I A;  2CWA A;  3OTO Q;  2ASB A;  5IYD H;  1HNZ L;  2ZTE A;  4TQU S;  1H95 A;  2ZM6 Q;  1HNX Q;  1HJP A;  1PFS A;  2KEN A;  1WCM G;  4X62 Q;  3ULL A;  1PH2 A;  1KD1 C;  3UDX A;  1XMO L;  3PUV A;  3RN5 A;  3K0X A;  2Z0S A;  1Y14 B;  2HIX A;  2NN6 I;  3Q8D A;  3UDI A;  5M5X H;  2B63 G;  1VQE A;  3I7F A;  1E24 A;  1L1O A;  1GVP A;  4JG2 A;  3G71 A;  4JI6 Q;  2IT1 A;  2RHS B;  4L5Q A;  3RLO A;  5FLM G;  4DUY L;  1PVO A;  4JI7 L;  1AH9 A;  1YJN A;  2AMC B;  3I4N H;  1TWA H;  4A3J H;  1P16 A;  4JI1 Q;  1D8L A;  4DKA C;  3RN2 A;  3M9B A;  3RR5 A;  1BBU A;  4B3M Q;  3PSI A;  4JC0 A;  4A3E H;  2QGQ A;  4GS3 A;  5IWA Q;  4O2D A;  5M3M H;  2ZJR A;  1NJI C;  2K50 A;  2JEA I;  4JV5 L;  4DAY B;  4A3I G;  1E1T A;  3U4Z A;  3PUW A;  1UEB A;  4A3C H;  4JI1 L;  4C3J H;  2KHJ A;  4NB3 A;  4P75 A;  4LUZ A;  1Q8K A;  1XNR L;  1V43 A;  2R92 G;  4A3M G;  1TWF H;  2Q2U A;  1K8A C;  1IXR A;  4R4C A;  4XIG S;  1OXS C;  1L2F A;  1LYL A;  1EOV A;  5IYC G;  3MXN B;  2NN6 G;  5IYB G;  3I4M G;  2GN5 A;  3IRB A;  2N3S A;  3NBH B;  4P71 A;  4LFA Q;  4YWM A;  1Z47 A;  2YTV A;  3HOX H;  2VQF Q;  3CME A;  4JYA L;  3HOW G;  1BVS A;  4X64 Q;  3G48 A;  2BH2 A;  1S3O A;  2JA5 G;  3AQQ A;  3JAM i;  4A3M H;  2DGY A;  2FXQ A;  2N78 A;  4DV7 L;  3CMA A;  2CQO A;  3GTQ H;  4OON A;  3I55 A;  2R7Z G;  4PZ7 A;  1GD7 A;  4HJ8 A;  1E3P A;  1W3S A;  3D31 A;  4X6A H;  4EX5 A;  1NTG A;  3JAM c;  3I4M H;  2NVX H;  2PNH A;  3KJP A;  4YCU A;  3S15 H;  3AFQ A;  1Q82 C;  3GTG H;  4LF9 L;  2K52 A;  3KOJ A;  2VQE L;  1J5E Q;  1ASZ A;  3CCE A;  4HIK A;  1K73 C;  4MNO A;  3PV0 A;  1PA6 A;  1MJC A;  2LXK A;  4OWT B;  4A75 A;  2R7Z H;  1PH4 A;  1L1O B;  4HIM A;  4IOA A;  4PMW A;  3TS0 A;  3HOY G;  4JI0 Q;  3GTL H;  3M4O H;  1E7Z A;  2L15 A;  4DV5 L;  2Q2I A;  1X65 A;  4JI2 L;  3KF6 A;  1JMC A;  4PZ6 A;  4QQB X;  4JBJ A;  3EIV A;  5GRO A;  3FHW A;  1C7Y A;  1T9H A;  4LF8 L;  1VQA A;  3CCM A;  3ULP A;  1EIF A;  3D0F A;  3GD7 A;  2UXD L;  2UXC Q;  1Q1E A;  1GM5 A;  4KHP Q;  1EIY B;  1I5F A;  4AYB G;  4LFC Q;  4QY7 A;  3GTK H;  3GDE A;  2F52 A;  5C0X I;  3HOY H;  3JC6 6;  3K7U C;  1EYG A;  2Z6K A;  2ZTD A;  3HOZ H;  4LNQ A;  4K0K L;  2UXB L;  1YZ6 A;  1KL9 A;  2A8V A;  2IY5 B;  3PO3 H;  5AJ3 Q;  3L2P A;  1N36 Q;  1X55 A;  1XPU A;  1C0A A;  1OXT A;  4UP7 A;  5JEA J;  4JI4 Q;  4POF A;  2R7F A;  1N9W A;  2A19 A;  1Y1W G;  1N8R C;  2VS1 A;  2A1A A;  4Y52 H;  3U4V A;  3HKZ E;  1CKN A;  2B29 A;  2E5L Q;  4JI5 Q;  4BBR H;  4JI3 L;  3W5O A;  3CAM A;  2R93 G;  1WJJ A;  3NEM A;  1MIU A;  2H5X A;  2JA9 A;  1KQS A;  3NEL A;  3E9I A;  3AFP A;  3H0G G;  4YHH L;  3J7Z C;  4DV0 L;  3S1Q H;  2NVY H;  3K81 C;  2I5M X;  3HOU H;  3UE1 A;  5IP7 H;  2YYZ A;  3RNU A;  1R9T H;  1YI2 A;  4LF4 L;  3F2C A;  3K80 C;  1SE8 A;  2D62 A;  2VNU D;  1NMG A;  1QZG A;  4NXM Q;  1G51 A;  2K5H A;  3CCU A;  5IYD G;  1WI5 A;  1QZH A;  4DV2 L;  2N8N A;  3PIP A;  1X6O A;  2K5V A;  2I5L X;  1HNZ Q;  4AYB E;  3J81 j;  4DPG A;  1K83 H;  1UE1 A;  2JJQ A;  4AQY L;  2NZO A;  4JOI A;  2VY3 A;  2PMZ E;  1HR0 Q;  5LMN W;  1PYB A;  1IL2 A;  5E7N A;  3I4N G;  1VQN A;  3KF6 B;  4GNX A;  4A3J G;  1L1O C;  5LMU L;  5C4X H;  4DUY Q;  4RG1 A;  4LF6 L;  5J3B A;  2E2J H;  4QIW E;  1C9O A;  4JI7 Q;  4A3E G;  1VQG A;  5JJI A;  2WAQ G;  1Y1V H;  4BY7 G;  3E9H A;  5M3M G;  1K0R A;  3HOV H;  1VQ6 A;  3T1Y L;  1HR0 L;  1YIJ A;  1GKH A;  2PI2 A;  3W1G A;  2UUC L;  4UY8 C;  4NXN Q;  4A3C G;  1UE7 A;  4JV5 Q;  3M4Q A;  1BBW A;  3J80 i;  1CUK A;  4LF5 L;  5JEA G;  1OXV A;  2I5H A;  3TS2 A;  3RZD H;  3PF5 A;  1V9P A;  4A3L H;  1PHJ A;  1QUQ A;  3NEN A;  4QL5 A;  1LTL A;  1XNR Q;  3HKS A;  1GO3 E;  3J80 c;  4A3G G;  4GOP A;  1IBM L;  4BY7 H;  3KF8 B;  2EIF A;  4IPD A;  4NXN L;  2YTY A;  4BY1 G;  2OWO A;  1YEZ A;  1I6H H;  2RHQ B;  4O0A A;  2B3G A;  4JI8 L;  3STB D;  5ELO A;  4IOC A;  1FVI A;  1X3G A;  3A5Z B;  1KRT A;  4AIM A;  4DK6 C;  1B70 B;  1QVC A;  3HOX G;  1CKN B;  3M4P A;  2XGT A;  1YIT A;  4L5R C;  4DV4 L;  3ER0 A;  3VDY A;  1J6Q A;  3GTJ H;  3CQZ H;  3TRZ A;  4NPS A;  3M85 A;  2ES2 A;  1XNQ L;  1JJC B;  4A3D H;  3S1M H;  2HQL A;  3AYH B;  4JYA Q;  5FLX c;  3PGZ A;  1YHQ A;  1PYS B;  1OTC A;  3CCR A;  4A3G H;  1VQB A;  4QJF A;  4DV7 Q;  4BY1 H;  1NY4 A;  1UE5 A;  2R6G A;  3U58 A;  1ASY A;  4GKJ L;  4IJL A;  1VQ8 A;  2MQH A;  4MTN A;  4YWL A;  1IBK L;  5JJL A;  3CC4 A;  3CCJ A;  4LF9 Q;  4ME3 A;  2NZH A;  1X56 A;  3KYH C;  2VQE Q;  4IPG A;  4GN3 B;  1TWC H;  2N49 A;  3M3Y H;  1FGU A;  4IFD I;  4DR6 L;  3KJO A;  3I2Z A;  3CPW A;  2JQO A;  1VQM A;  2LXJ A;  1PH1 A;  4GNX B;  1EWI A;  4UP8 A;  4DAM A;  4A76 A;  1D7Q A;  4X66 L;  2I0Q A;  3E0E A;  4R4I A;  4DV5 Q;  3UE0 A;  4JI2 Q;  1JT8 A;  1E1O A;  2LSS A;  2WP8 J;  2UU9 L;  4C3H H;  4IJH A;  3AEV A;  3RZO H;  1K3R A;  4R4O A;  1HH2 P;  1YNX A;  5C0X J;  4LF8 Q;  2JA8 H;  1KHI A;  4GKK L;  2CWP A;  5GAD C;  4DR5 L;  4HJ9 A;  4OWW B;  2UXD Q;  3HOZ G;  5GAH C;  1K9M C;  1SR3 A;  3ZJY C;  5FJ8 H;  1U0L A;  4B3T L;  4DR7 L;  1QUQ B;  4BA1 I;  1M90 C;  3PO3 G;  3CC7 A;  2QEX A;  4DV3 L;  3S1R H;  4K0K Q;  2UXB Q;  2D0P A;  3PUY A;  4GOP B;  3A74 A;  1O7I A;  1W2B A;  4A3B H;  2GVB A;  1VCI A;  4X65 Q;  1X9N A;  3J7A 5;  2V1C C;  1CKM A;  2JK8 A;  4DUZ L;  2OQK A;  4IFD G;  1YHB A;  3KDF A;  2E8G A;  4EQ5 A;  4BBR G;  1IYJ B;  1Q12 A;  2MFI A;  3GO5 A;  5ELN A;  4DR1 L;  1XPR A;  4DR2 L;  4ALP A;  3CC2 A;  1S40 A;  1SLJ A;  1S72 A;  4JI3 Q;  3CCS A;  1VQO A;  4X65 L;  4B3S L;  3HOU G;  5IP7 G;  4DV6 L;  1CKO A;  1A62 A;  5HY6 A;  4AH6 A;  4UPA A;  4YHH Q;  4QGU A;  3KLW A;  4DV0 Q;  1YJW A;  2MO0 A;  4DR4 Q;  3PIO A;  2VW9 A;  1QVF A;  3ULJ A;  3S16 H;  1N34 Q;  1LM0 A;  1MKH A;  4LF4 Q;  3J81 i;  3STB C;  3S1N H;  3T1H L;  5IT9 c;  4OX9 L;  1PH9 A;  1FL0 A;  2AWN A;  4DNI A;  4IPC A;  1M1K C;  4H02 A;  1FJG L;  5M5Y H;  4IO9 A;  4DR3 L;  1NMF A;  4OO1 I;  5C4J H;  1U5K A;  3K7A H;  1VQD A;  4DR4 L;  4DV2 Q;  5M3F G;  3S17 H;  1A0I A;  2VZA A;  2Y0S G;  4A3F H;  5IE8 A;  1N34 L;  3CW2 C;  4KI0 A;  4HIO A;  5GQO A;  2QA4 A;  1I94 L;  2IHF A;  2JA6 G;  2PI2 E;  4YY3 L;  3CF5 A;  5LMN L;  4AQY Q;  2F4V L;  5IP9 H;  3HFZ B;  3S2D H;  3H3V I;  5C4X G;  1PH8 A;  2K14 A;  5C0X G;  4L5S A;  4IPH A;  1JB7 A;  5LMU Q;  1TWH H;  3ERS X;  1Y1V G;  4GNX C;  1I50 H;  4GN4 B;  5M3F H;  4LF6 Q;  3I56 A;  3HOV G;  4YWK A;  1UWV A;  2GVA A;  1X3E A;  4C2M H;  2HT1 A;  2JA6 H;  3T1Y Q;  3MEF A;  1XMQ L;  1SFO H;  1CSQ A;  2UUC Q;  1N33 L;  2MNA A;  4LF7 L;  4YCV A;  4LUV A;  3KFU A;  4A4I A;  1YJ9 A;  4GLV B;  1VQF A;  2R7D A;  4A3K G;  4LF5 Q;  4A3L G;  4LFB L;  2HHH Q;  4OO1 G;  1VQ5 A;  1I3Q H;  1RIP A;  5BR8 L;  1A63 A;  2BA1 A;  1EFW A;  1PH7 A;  2ZTC A;  2JEB I;  1PH5 A;  5GAE C;  2ALY B;  1IBM Q;  1TWG H;  4MZ9 A;  4GOP C;  1IBL L;  2UUA L;  1HNW Q;  3KDF B;  2K75 A;  1N32 L;  1VQH A;  2OCE A;  1SN8 A;  4C3I H;  4JI8 Q;  4A3D G;  2HHH L;  4RMF A;  1KRS A;  1YBY A;  4P72 A;  3SGI A;  5C3E G;  4P73 A;  3DLL A;  2K5N A;  2VL6 A;  4DV4 Q;  1VQC A;  4A3K H;  4BBS H;  5JJK A;  1XNQ Q;  1JJG A;  1WFQ A;  4FDB A;  5HGQ A;  3G4S A;  1QVG A;  3F2B A;  3FKI G;  1WYD A;  3BJU A;  1PH6 A;  2WFW A;  1TXY A;  4R4T A;  1OXU A;  2XTI A;  2KBN A;  4LW1 A;  3EBE A;  3UDF A;  4GKJ Q;  2JA7 H;  4XTC S;  3TEH B;  4DV1 L;  2VUM H;  3H3V H;  5C3E H;  4BXX H;  3OTO L;  1IBK Q;  3RLN A;  3CCV A;  5EAY A;  4IFD J;  4LWC A;  2ZM6 L;  3K8A A;  1HNX L;  2ZJQ A;  1X3F A;  1HZC A;  4JBW A;  4X62 L;  2PQA A;  3FKI H;  2UUB Q;  2C35 B;  3M7N A;  4KLK A;  1WCM H;  2WAQ E;  2AKW B;  4DR6 Q;  1JJ2 A;  4Y7N H;  4DK3 C;  2B63 H;  4JI6 L;  1HR0 W;  3L7Z C;  1IZ6 A;  4X66 Q;  3H15 A;  2ZJP A;  1KAW A;  3G6E A;  5FLM H;  2UUB L;  1G29 1;  1A8V A;  2YU9 H;  1XJV A;  2NVQ H;  2UU9 Q;  4B3M L;  3PO2 G;  2JA8 G;  5IWA L;  1Q46 A;  4HJ7 A;  4BA2 I;  4YCW A;  3UDG A;  5FJ8 G;  1HZB A;  3PCO B;  4GKK Q;  1EQQ A;  3ICE A;  2YTX A;  3S2H H;  3B6Y A;  4DR5 Q;  5H1S E;  2RF4 A;  4A3I H;  1XTD A;  4B3T Q;  3GTP H;  4P74 A;  1EUJ A;  1VQ9 A;  4DR7 Q;  4A3B G;  4J15 A;  4DV3 Q;  1P8L A;  5IY0 A;  3L0O A;  1Q81 C;  3PO2 H;  1K8G A;  2R92 H;  3OW2 A;  3W1B A;  1YHA A;  2Q2T A;  4APV A;  2RCN A;  3PUZ A;  1LUZ A;  3F1Z A;  3I4O A;  4DUZ Q;  3CCL A;  2AWO A;  1AE3 A;  3TRE A;  1NBW A;  3EN2 A;  2VQF L;  1PV4 A;  2YV5 A;  1VQL A;  4LFA L;  5IYC H;  4POG A;  3F2D A;  5IYB H;  4DR1 Q;  4DR2 Q;  2Z6K C;  4X64 L;  3S24 A;  1VS0 A;  3HOW H;  2WB1 G;  1XPO A;  4B3S Q;  1Q86 C;  2MO1 A;  4DV6 Q;  3A5U A;  2JA5 H;  2K4K A;  1VQP A;  3U50 C;  4JBK A;  2Q2H A;  4PZ8 A;  1KC8 C;  3HKZ G;  4JCV E;  4TVA B;  2D0O A;  1EQR A;  3DM3 A;  3T1H Q;  3A0J A;  1RL2 A;  1AE2 A;  2OTL A;  4OX9 Q;  1FJG Q;  1CSP A;  1KXL A;  4DR3 Q;  1PH3 A;  2OQ0 A;  1SRO A;  3TQY A;  4JBM A;  5DLQ E;  4A3F G;  3BU2 A;  1J5E L;  5C44 G;  4B3R Q;  2PQA B;  4OXP A;  4LUO A;  3CCQ A;  2AHO B;  1WOC A;  1VQJ A;  1G6P A;  3S14 H;  1I94 Q;  1E22 A;  2BH8 A;  5IP9 G;  2E2H H;  3WWV A;  2IHE A;  4YY3 Q;  5LMN Q;  3CD6 A;  4HID A;  2F4V Q;  4R1J A;  4UP9 A;  1X54 A;  4JI0 L;  2CFM A;  4OWX B;  2NVT H;  4B3R L;  3J81 c;  1VQK A;  2ATW A;  4WJ3 M;  5C44 H;  1VQ7 A;  1MJE A;  2KCM A;  2EXD A;  2OTJ A;  2UXC L;  4JOI C;  1XMQ Q;  3BZK A;  3GTO H;  4KHP L;  2WB1 E;  2JE6 I;  3F8T A;  4R4Q A;  1N33 Q;  2BA0 A;  4LFC L;  2CCZ A;  4LF7 Q;  4WJ4 A;  3BZC A;  4LFB Q;  1DGS A;  4PG3 A;  3RLF A;  5GAG C;  1SMX A;  1JE5 A;  3CXC A;  2DUD A;  4KHZ A;  5AJ3 L;  2IX1 A;  2EQS A;  1B7Y B;  3LGJ A;  5BR8 Q;  4HJ5 A;  1Q7Y C;  2HIV A;  1N36 L;  1VQI A;  4A93 G;  5K36 G;  1HZA A;  3CP0 A;  2KCT A;  1L0W A;  4JI4 L;  1IBL Q;  1VQ4 A;  2UUA Q;  1BKB A;  1N32 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...