1SN8A

Crystal structure of the s1 domain of rnase e from e. coli (pb derivative)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
b'ANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease E
publication title Structural characterization of the RNase E S1 domain and identification of its oligonucleotide-binding and dimerization interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 17
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature ec 3.1.26.12: Ribonuclease E.
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sn8A00
4ME3A 4WJ3M 2GN5A 1X56A 3CCMA 3GTPH 1VS0A 1VQ9A 3MXNB 5J3BA 1C7YA 4OWTB 1QUQB 5C3EH 3S1RH 4C2MH 4JV5L 4JOIA 3K0XA 1HZBA 3KF8B 3ZJYC 5FLMH 3G4SA 4L5TA 4A93G 4X6AH 4DR7L 4IJLA 1CSQA 3GD7A 4LF4L 1X3GA 1I5FA 1VQ5A 3S2DH 4LFBL 2ID0A 4B3SQ 1L2FA 3ULJA 3F8TA 1A62A 1D7QA 1U0LA 2YTVA 4DR6L 2R93H 1A8VA 2VUMH 1I3QH 2AWNA 4IOCA 1BKBA 4DK3C 4X66Q 3DM3A 1Y1VH 3CCRA 4L5SA 3HOUG 2JA7G 3JC66 5C4JH 2ZM6Q 4PZ8A 5GADC 1GM5A 3PO2G 4YWLA 2B29A 4NB3A 4GNXC 4YWKA 4JI6Q 1TWHH 4AQYL 2MNAA 3NBHB 2N8NA 4BY1H 2Q2UA 4JYAQ 4TVAB 4UP7A 2E8GA 1HNWL 1P16A 3HOWG 4PG3A 1LM0A 1NMGA 4UPAA 4A93H 2UUCQ 4A3LG 4R1JA 2R7DA 3UE0A 1QVGA 3HKSA 1GD7A 2N49A 2YYZA 1L0WA 1ASZA 1VQPA 3ER0A 4OX9Q 1E22A 4A3MG 2D0OA 1HNZL 3AEVA 3MEFA 5FJ8H 4DV1Q 3KDFA 2K52A 4PMWA 1V43A 1SFOH 3KJPA 1Y1WH 2MQHA 3PUWA 3JAMc 1PHJA 3HOUH 2JA7H 3I56A 4GOPC 1N32L 2KBNA 2PI2E 3STBD 1Q7YC 3PO2H 5GROA 5JEAJ 2NZHA 5DLQE 4DUZQ 4DR4Q 3CMEA 4YY3L 2VS1A 4LFCL 4DV6L 3I4MH 5BR8L 3NEMA 2UXDQ 1KXLA 4X64Q 3H0GG 1OXUA 1KIXA 1GO3E 1OXVA 4R4IA 4YWMA 4IFDG 4RMFA 4A3LH 1CUKA 5E7NA 1C9OA 1NTGA 1CSPA 4PZ6A 3M4QA 3CCUA 4UP9A 1N9WA 1VQLA 1N34L 1HR0L 1Q46A 3HOYG 4A3MH 1N33Q 1IBLL 2K4KA 2YV5A 4DV7L 4AYBE 1NY4A 4HJ5A 4JI3Q 2ATWA 2KCMA 4EX5A 4APVA 3F2BA 4A3DH 3BU2A 1PFSA 3G71A 2ZTEA 2LXJA 4A3FG 1PH5A 1X54A 4NXMQ 3CCVA 4NXNL 1OXXK 4XIGS 1JJ2A 1DGSA 3TEHB 1G51A 3D0FA 1QUQA 1YHAA 3KLWA 2CFMA 3TQYA 1KRSA 1YJ9A 5ELNA 1JB7A 1FJGL 3H0GH 4LW1A 3UE1A 4HJ7A 4GLVB 4JBKA 1VQGA 1XPOA 4X62Q 1NBWA 5M3FH 2HHHL 4LF6L 2IHFA 1XNQL 1EQRA 3BJUA 2I5LX 4UP8A 2F52A 3Q8DA 5C44G 4LF5L 4LFAL 1XNRL 3HOYH 3PCOB 5LMUQ 3I4OA 2NVTH 4B3RL 2WAQE 2NVQH 2VQEQ 1B70B 1WI5A 2K14A 3PIOA 3UDGA 1IBKQ 3F1ZA 3FKIG 3F2CA 4DK6C 4GKKQ 1WOCA 4DV4Q 1QZGA 1D8LA 3KDFB 3J80c 1E1TA 4HIDA 4JBMA 2VNUD 4JC0A 2Q2TA 4GS3A 2WB1E 2ZJRA 3LGJA 2F4VL 1YBYA 3RNUA 2L15A 1FVIA 4JI0L 1QVFA 4IPHA 1E24A 1PYSB 1TWFH 4R4OA 3F2DA 2IHEA 3GTQH 1VQEA 3PV0A 3W5OA 1JE5A 4FDBA 1VQ7A 2K5VA 3GDEA 4LWCA 1VQJA 3ULPA 1N36L 2R92H 3JAMi 1W3SA 2JQOA 3T1HQ 4JI4L 1TXYA 1VQDA 4XTCS 1HJPA 5C44H 2EXDA 2PNHA 3S1MH 2A8VA 4KHPL 1KC8C 2V1CC 1VQKA 1NMFA 3G48A 3GTKH 3UDXA 3H3VI 3CPFA 1TWCH 2JK8A 3ULLA 4LF9Q 2R7ZG 2AWOA 3FKIH 4PZ7A 2JA5G 1OXSC 2H5XA 2UXCL 1VQOA 4R4CA 3U58A 4JI5Q 4QQBX 1T9HA 3J81j 5C0XI 1HZCA 1VCIA 4A3IH 2Y0SG 3T1YQ 2ES2A 4MZ9A 1MJCA 2PMZE 4KLKA 2BH8A 2R7FA 2RF4A 2Z0SA 1E1OA 4DUYL 1PA6A 1EFWA 1WFQA 4K0KQ 4BBSG 5IYBH 3UDFA 4Y7NH 1A0IA 1YZ6A 1I94Q 3S1NH 1KHIA 4JI7Q 4JI1L 4DV2L 2CWAA 4OO1I 4GNXB 5EAYA 2VQFQ 4DR5Q 2NVYH 1L1OA 1M1KC 5C4XG 2EIFA 1XTDA 1SE8A 1K83H 1EWIA 4JG2A 2R7ZH 4JBWA 2C35B 2KENA 4J15A 2E5LQ 2JA5H 2UUBQ 2VY3A 3J81c 1I50H 1YNXA 1VQBA 2K50A 4LF8L 1FGUA 1SLJA 4C3IH 1XMOQ 2BH2A 1XMQL 4AIMA 4GN5A 1CKMA 3K8AA 4YCVA 4X65L 4JBJA 4HIKA 1PH8A 4A75A 3KYHC 2OTJA 3EIVA 3M4OH 4HIMA 5FLXc 1IL2A 1HNXQ 1XPUA 4GN4B 5M5WH 2YU9H 3CF5A 3VDYA 2JA8G 3A74A 4BBSH 2BA1A 4GOPB 4YHHQ 4JI8Q 2KCTA 4IFDJ 5IP7G 4LF4Q 2UUCL 3J80i 1Z9FA 1BVSA 1AE2A 5IYCG 2QEXA 5C4XH 3M85A 4A3EG 1YJWA 2KHIA 3FP9A 3CC4A 1X6OA 4JYAL 2MO0A 3PO3G 1LYLA 3GTGH 4O0AA 4OWXB 3U4VA 4DV1L 5IWAL 4UY8C 5M5XH 1X9NA 5IY0A 5IT9c 2ZTDA 4QJFA 3CMAA 3L7ZC 1GKHA 4IPDA 4LUOA 4DAYB 4DR1Q 1PH7A 4L5RC 4KHZA 4A3GG 2MFIA 4AQYQ 3I55A 3L2PA 5IYDG 4DUZL 4DR4L 2UXDL 5JJIA 3I7FA 2JA8H 4X64L 2A1AA 1YITA 2XTIA 4KI0A 1IZ6A 5IP7H 3HOWH 1HZAA 1YIJA 1J5EQ 1I6HH 2IT1A 2UXBL 2Z6KC 1HNZQ 1VQ8A 4LF7Q 4JI2Q 3I4NG 3CC7A 1LTLA 1XPRA 4A3KG 1UEBA 1L1OB 1KAWA 2NVXH 1N33L 2PQAA 3S16H 1GVPA 1SRUA 1VQAA 4JI3L 1S72A 3PO3H 4GKJQ 3PF5A 1HZ9A 4OWWB 3RN5A 3OTOL 3CD6A 5K36G 1HH2P 1EOVA 1QVCA 2I5HA 5AJ3L 1PV4A 4YY3Q 2RHSB 5BR8Q 1WYDA 1S3OA 4DV5L 2IX0A 4BBRG 3E9HA 5M5YH 2ZTCA 4P74A 2ZJQA 2K5HA 2ZJPA 2HT1A 1V1QA 4P73A 3W1GA 4GNXA 1V9PA 3PUXA 4GN3B 1IBMQ 1B8AA 3J81i 2I0QA 3K81C 4QGUA 5C0XG 3I4NH 3E0EA 4B3TQ 1Q1BA 3WWVA 1RL2A 4A3KH 2RHQB 3S15H 1AE3A 5M3MG 1X55A 2AHOB 4DV3Q 2CKZB 1B7YB 1OXTA 5GAHC 2VQEL 3RLOA 1IBKL 4A3BG 2RCNA 2KHJA 1KRTA 4GKKL 3RN2A 2VW9A 4DV4L 4NXNQ 1SR3A 4A3FH 5GQOA 3TRZA 2UU9L 4R4QA 1YVCA 5H1SE 2E2JH 4OO1G 1Z47A 2OTLA 1O7IA 1TWGH 3IRBA 3OYYA 3G6EA 2OWOA 4BBRH 1R9TH 1FL0A 2JEBI 4GOPA 2HHHQ 2WP8J 5GAEC 4BA2I 1KL9A 4DR2L 3PGZA 3CW2C 4C3JH 1VQ6A 4GLAC 2OCEA 3KOJA 4YCUA 3T1HL 1BBUA 1SROA 4LFAQ 1XNRQ 1SMXA 3FHWA 4R4TA 3K7AH 2UUAL 3TS2A 5M3MH 4AYBG 1NJIC 3UDIA 3CC2A 2Q2HA 4DV0Q 1K3RA 1K8GA 2E2HH 2JEAI 4A3BH 1UE5A 2PQAB 4DKAC 4QY7A 1X3EA 4BY7G 3CAMA 1EQQA 4JCVE 3PUYA 3RLFA 4BA1I 3GTJH 3HOVG 3HKZG 4LUVA 5LMNL 1UE6A 1U5KA 3S2HH 4DR3Q 2N78A 2WFWA 3K80C 3DLLA 3PSIA 4K0KL 1UWVA 1X65A 1QZHA 1YHQA 3M3YH 3S1QH 4LUZA 1VQNA 2VZAA 5HGQA 1I94L 4JI7L 1YI2A 3HFZB 4KHPQ 3A5ZB 1X3FA 4DAMA 3B6YA 4B3MQ 4IPCA 4P71A 1AH9A 2WAQG 4B3SL 2R93G 3ERSX 1NE3A 4BY7H 1VQFA 1Y14B 4NPSA 2LXKA 3BZCA 3GO5A 2UUBL 3GTOH 1IYJB 3EBEA 1S40A 1XMOL 5HY6A 4X66L 3HOVH 1RIPA 1Q8KA 2WB1G 3M9BA 3ICEA 3L0OA 2D62A 4DUYQ 2ZM6L 1EYGA 1E3PA 2B3GA 3U4ZA 4L5QA 4BY1G 4A76A 1YHBA 4JI6L 2N3SA 4DNIA 1HNXL 3J7A5 2PI2A 4JV5Q 3GTMH 1K9MC 2AKWB 3HOXG 4JI1Q 1HR0W 4QL5A 4DV2Q 1E7ZA 4DPGA 4HIOA 1IXRA 4YHHL 1MJEA 1VQ4A 4JI8L 4DR7Q 2HIXA 2CCZA 3J7ZC 4LFBQ 3I2ZA 3RR5A 3S24A 2CWPA 3KFUA 4WJ4A 5ELOA 4LNQA 5FJ8G 4OX9L 1PVOA 3AFPA 4BXXG 4DR6Q 3M4PA 4AH6A 2IX1A 2HQLA 1Y1WG 1OTCA 4LF8Q 1P8LA 1K8AC 1XMQQ 2NN6I 4QIWE 2QGQA 2DUDA 4X65Q 3CCSA 1EIFA 2K75A 1YEZA 3CP0A 4DR1L 3S14H 1WCMG 1LUZA 4YCWA 3I4MG 5JJLA 2F3IA 4IO9A 3CCJA 4RG1A 2OQ0A 3STBC 2NZOA 1HNWQ 3CPWA 1UE7A 1VQIA 3HOXH 1PH4A 3M7NA 2ALYB 4Y52H 3EN2A 4EQ5A 1PH6A 3KF6A 3NELA 1PH3A 1J5EL 1BBWA 5IYCH 1UE1A 4P75A 4LF7L 4JI2L 5C0XJ 4A3EH 3D31A 2VL6A 2B63G 4MTNA 4BXXH 5IWAQ 3RZDH 3HOZG 4A3DG 4GKJL 1JJGA 1CKNA 4IPGA 3AQQA 3W1BA 1EIYB 1ASYA 1MIUA 1N32Q 3CQZH 2D0PA 4GLXA 1VQCA 4NXML 1WCMH 4A3GH 1SN8A 3PUVA 4DV6Q 4LFCQ 4HJ9A 3S17H 3A5UA 5IYDH 4MNOA 1G291 2E2IH 1YJNA 1Q12A 2BA0A 1VQHA 5M3FG 1KD1C 4A3CG 2GVBA 1WJJA 2JJQA 4OONA 4X62L 2UXBQ 1K73C 1IBML 4A3JG 1K0RA 2ASBA 3CCLA 1N34Q 1HR0Q 2I5MX 2OQKA 3CCEA 5JJKA 1JT8A 1IBLQ 4B3TL 1G6PA 4DV7Q 3PF4A 1Q1EA 2B63H 5LMNW 5LMUL 3BZKA 1XJVA 4DV3L 3HOZH 3K7UC 4IJHA 4P72A 3OTOQ 2K5NA 2R6GA 1M90C 5GAGC 2JA9A 2GVAA 1N8RC 3E9IA 3SGIA 5AJ3Q 2IY5B 4ALPA 3HKZE 4POFA 5JEAG 2Y0SE 2CQOA 4JOIC 3KJOA 2EQSA 4DV5Q 1C0AA 1EUJA 4IOAA 4A4IA 4C3HH 1FJGQ 1L1OC 3AFQA 2XGTA 4HJAA 4LF6Q 4A3CH 1PYBA 2R92G 3H3VH 3TS0A 1W2BA 1XNQQ 3TREA 3AYHB 4A3JH 1CKOA 4LF5Q 5IE8A 3CCQA 3KF6B 1VQMA 2JA6G 3H15A 2MO1A 2HIVA 4B3RQ 1J6QA 2QA4A 4O2DA 1JJCB 5IP9G 4IFDI 4DV0L 2A19A 4TQUS 4LF9L 2Z6KA 3GTLH 2UU9Q 1CKNB 3PUZA 2Q2IA 2FXQA 4A3IG 4JI5L 2F4VQ 4HJ8A 1A63A 4JI0Q 4DR3L 3T1YL 2YTYA 1Q81C 1TWAH 5IYBG 5C3EG 4DR2Q 3PIPA 1MKHA 3A0JA 4POGA 3OW2A 1N36Q 5FLMG 3U50C 4JI4Q 2NN6G 1Q86C 2AMCB 2UUAQ 4H02A 3NENA 2VQFL 4DR5L 2JA6H 1PH1A 4B3ML 2YTXA 5IP9H 1Q82C 2VUMG 4OXPA 1PH9A 2DGYA 3RLNA 2LSSA 2UXCQ 2JE6I 1H95A 1KQSA 1JMCA 1Y1VG 2E5LL 3RZOH 1PH2A 5LMNQ 3CXCA
chains in the Genus database with same CATH superfamily
3C2PA 4U673 1DCZA 1C7YA 4OWTB 1M4VA 1RHPA 4C1NI 4QF4A 4N8X1 3K0XA 5FLMH 4DR7L 4IJLA 1TQOA 2NN6H 1C4QA 1TS4A 1L0XB 2JA8B 3NTKA 1D7QA 2YTVA 4DR6L 2R93H 2B2VC 2AWNA 4K6LA 3P7JA 1Y1VH 2WKCA 3HOUG 4FF1A 4RKLA 5C4JH 1KNEA 1BF4A 3PO3B 4K2KA 2B29A 4NB3A 2K5QA 1SYCA 2Z9HA 1JCKB 4V190 3NBHB 2Q2UA 4JYAQ 1JOQA 4TVAB 2E8GA 3HOWG 1QVGA 5IT9L 5M5YB 2O5IC 4A3MG 1IYUA 3UI2A 3MEFA 3KDFA 4PMWA 2EJFC 1V43A 1SNCA 2NTTA 2BE5D 4DF7A 3L9AX 4DNRB 1N32L 2KBNA 4CGYB 5C5LA 5DLQE 4YY3L 5CMDA 1DJRD 4QIWB 1GO3E 4RGNA 4R4IA 1DD2A 4DU9A 4PZ6A 3T56B 3M4QA 5G3LD 4UP9A 1IKLA 1N34L 3K5OA 1Q46A 4HJ5A 1GHKA 1FNUA 4CDCC 1GUTA 3BU2A 1PFSA 1PH5A 1SYEA 1XYIA 4NXNL 1EYDA 1HHVA 3HS0C 1JB3A 5E4WC 1QUQA 3TQYA 1KRSA 1HFNA 1WTPA 3UE1A 4GLVB 2XWBB 4C3JG 1NBWA 4X62Q 5M3FH 2EPBA 4F7XA 3VR2A 1EEFD 1XNRL 1U4LA 3D4WA 5LMUQ 3I4OA 1IBKQ 3PIOA 2XN9C 2EJMA 2OF1A 4GKKQ 4DV4Q 1D8LA 1EIGA 3J80c 1E1TA 4JBMA 2E2DC 3K59A 1EQTA 4FF4A 5A2QL 3GTQH 3GTOB 3CHBD 1GOZA 4FVMA 3KBXA 2G9DA 1RODA 1AZQA 1D1IA 2EY5A 2K5VA 1F9SA 2Y0SB 1VQJA 4LWCA 4ILWA 2JQOA 3FEWX 1Y8NB 1Q8IA 2MHVA 1IW7D 3CRKC 3R2TA 1B3QA 1OXSC 4KD3A 4R4CA 3U58A 1O7ZA 1T9HA 1HZCA 4BS9A 1SDFA 4F87A 3URYA 1MSHA 1B50A 4MZ9A 2PMZE 1PRTF 2BH8A 4DUYL 1E1OA 4KHVA 4BBSG 2A69D 3BVMA 4JI7Q 4JI1L 5EAYA 2D2CC 1M1KC 3HOXB 1STBA 1I4XA 4JG2A 2N55A 1BCPF 2R7ZH 4J15A 1I50H 2K50A 3C1EA 1STGA 3CXCA 5IODA 1CA6A 4AIMA 4GN5A 1LTSD 4HIKA 1PH8A 3MA2B 3EIVA 4HIMA 4OHJA 2F03A 2YU9H 3VYUA 2BA1A 2DY7A 4YHHQ 1HTPA 3TN2A 1PZID 3LNNA 4DFAA 2UUCL 3T51B 5J39A 2J7ZA 1I4RA 5CORA 2QEXA 3Q0AA 2E2IB 4A3EG 4WJWA 2K32A 1X6OA 1LYLA 1X9NA 1I4PA 4FP5D 2ZTDA 2JYOA 1IYVA 3CMAA 3L7ZC 1LACA 5CYUA 3R2IA 3L2PA 5JJIA 3I7FA 4PV1C 2JA8H 4FF3A 1EY5A 4I7ZC 1HZAA 1S5CD 1H9SA 5FO8B 5C5MA 1BOSA 1BO0A 2Z6KC 1JQYD 1VQ8A 3I4NG 3DM1A 1XPRA 1L1OB 5FKAC 1EY7A 4QUFA 3PO3H 1JICA 1U4PA 4HR7B 4FF2A 1EQVA 1CZGA 1JOKA 2I5HA 5M3MB 4FNFA 5AJ3L 3TDQA 4YY3Q 1PV4A 5I2YA 1JE4A 1WYDA 1K28A 3GTLB 3P1HA 3E9HA 5M5YH 1O80A 2K5HA 1PRTC 2KA7A 5FO9B 4S3SA 2PNRC 4GNXA 3C3LA 1HPCA 1KLGD 1S5ED 4GN3B 4TRDA 2I0QA 3K81C 1HQRD 5EJWA 2PZWA 2A6EC 2RHQB 1AE3A 1LO5D 2CKZB 4A3BG 3P20A 1STYA 4NXNQ 1BCPC 5K36H 1STAA 1ZYRC 5GQOA 3TRZA 3VYTA 4R4QA 1YVCA 2RVLA 5H1SE 1Z47A 1PYWD 2OWOA 3RZOB 2WP8J 5GAEC 4ID6A 4ZYSA 2X6GA 3PGZA 4WFN3 1G8ZD 2NBFA 4GLAC 2OCEA 4YCUA 1QJOA 2R3ZA 3T1HL 3TP8A 1SROA 1XNRQ 2O2LD 1CHQD 5C3XA 2FMCA 3DMUA 3CC2A 2Q2HA 4DV0Q 1DM0B 2WIIB 1K8GA 1D5ZC 3V05A 1ONLA 4BY7G 1G2TA 4QY7A 3CAMA 1X32A 3V96A 4JCVE 4HEDA 3RLFA 3HKZG 1TU2B 2WAQB 5KNDA 3J81E 2VUMB 4RGOS 2HCCA 3A8JE 4QMGA 4K0KL 2EYLA 3MXPA 5HGQA 1GUWA 3SE0A 1YI2A 4BY1B 2RQXA 3BDLA 1VQFA 3GTOH 4NPSA 2LXKA 2EOTA 2DNCA 3GO5A 4ZKCB 3EBEA 1LTRD 4PQXA 4DUYQ 2ZM6L 4IUNA 4IZ8A 4N8FA 1W6JA 4ZCKA 4C1NK 5IGDA 1Y1WB 2RCFA 4QCLA 3HOUB 4DNIA 1ENCA 5KNCA 1MD2D 4JI1Q 1HR0W 4QL5A 3Q22A 1IXRA 1FD7D 2K05A 1VQ4A 4K8IA 3I4MB 1ILQA 1E2WA 3J7ZC 3S24A 3AMUA 4OX9L 4AH6A 3NE5B 3VYSA 5IIFA 2TMPA 1QOHA 4QIWE 3X3MA 3CCSA 2F0GA 2PQEA 2F0EA 4DR1L 3SVMA 3VR5A 1LUZA 4RGTA 4RG1A 2OQ0A 1EYAA 3HOXH 3EN2A 1F2LA 2BDNA 3NUCA 4IN3A 3BVGA 3ND9A 3BS1A 5IYCH 1JWMD 1II3A 1BQQT 3CKIB 5ELEA 2NUCA 1DOLA 2D0PA 4GLXA 4KK7A 4U68A 1EY9A 1A6XA 3PUVA 1SYFA 4LFCQ 5JVG3 3A5UA 2ZXOA 4MNOA 1G291 4TSSA 2E2IH 1YJNA 1VQHA 2AUKA 1SYGA 1WJJA 5IGFA 4A3JG 3I90A 1K0RA 1JT8A 3NTIA 3KBGA 1D1KA 1IBLQ 1Q1EA 2FMMA 1XJVA 2E76C 1CI3M 4DV3L 3K7UC 4CDFC 1PTOD 2JA9A 2GVAA 3DWAA 5AJ3Q 3NPPA 3GTKB 4POFA 2RSNA 1CZWA 5JEAG 1MGSA 2Y0SE 1TWCB 2EQSA 1C0AA 2F3VA 1FJGQ 3A56A 3H3VC 4XDXA 3CU7A 4LF6Q 1PYBA 3SR1A 2R92G 3TS0A 2MGSA 1W2BA 3TREA 5IE8A 3CCQA 3KF6B 1ZXTA 5EKIA 1J6QA 4HCEA 4TQUS 2FHTA 3GTLH 1CKNB 3PUZA 1AZPA 4OIJA 4KD4A 4IUVA 4HJ8A 4OO1H 2A68D 3T1YL 1AN8A 1Q81C 5IYBG 5C3EG 3OIQA 1MKHA 3A0JA 5DAUA 1Q86C 2AMCB 5M5WB 4NDXA 4BBSB 1A2UA 4CDDC 1SNDA 1PH1A 4B3ML 1S5FD 4O1NA 1Q82C 3H94A 1H95A 2LSSA 2EYMA 1JMCA 3RZOH 1EY0A 4ME3A 2GN5A 1X56A 3GTGB 1K0SA 1VS0A 3MEHA 5J3BA 1E2ZA 5JPNC 4IALA 4JV5L 4A93G 3KF8B 4L5TA 3NQTA 5D65A 4LF4L 1X3GA 2CHBD 4LFBL 2ID0A 4RHRA 3DEOA 3F8TA 3W2DA 1A62A 1U0LA 1A8VA 2VUMH 1BBXC 5EPLA 4B08A 1BKBA 4IOCA 3CCRA 5CBEE 2NVXB 1NAPA 2ZM6Q 4R8NA 5I9PA 1GM5A 4YWKA 4H44C 2Q8IB 4K5VA 4BY1H 2N8NA 1HNWL 4UP7A 2F0WA 3NBIA 4K2LA 4A3LG 1NMGA 2Z6BA 3UE0A 3TZDA 4ODGA 3HKSA 3K57A 4OX9Q 3KLSX 1HNZL 4ZUIA 2PZUA 4LMQD 1PRTB 2PYKA 4DV1Q 1F9PA 2D9UA 1Y1WH 1X3PA 5FO7B 3HOUH 3P75A 1TY2A 2EY6A 3STBD 3A55A 3CMEA 3I4MH 4DV6L 3I70A 4Q0FA 4WORA 1B44D 3A7AB 5DNFA 2E2JB 4KMUC 1BCPB 4RMFA 5EKKA 2M9VA 1NTGA 2SEBD 3RUZA 3R93A 3CCUA 1KABA 3HOYG 4A3MH 1N33Q 4DV7L 1NY4A 1G91A 4A3FG 3U9SA 3CCVA 2CW0C 1DGSA 1JC7A 2F0SA 4A3BB 3TZUA 3D0FA 4K5XA 1A2TA 1YNNC 1JB7A 4CBVA 4HJ7A 4JBKA 1VQGA 4LAAA 2IHFA 2X6LA 1EQRA 2QF7A 4UP8A 5C44G 3Q8DA 4LF5L 3S1QB 1V8QA 5CV8A 2WACA 4B3RL 2WAQE 1CQFA 3D6WA 1WI5A 2K14A 1QZGA 3K5NA 4F88A 4HIDA 4XQQA 1ICWA 2AQ3B 1YBYA 2F4VL 2XRQD 5COYA 4BY7B 2B8GA 1FVIA 3J7AF 1QVFA 3F2DA 1TWFH 3PV0A 3W5OA 4JW0A 4HN7A 1NCVA 3HKZB 3F2UA 3BG3A 1N36L 3WOFA 3SK8A 1W3SA 2F0PA 1YNJC 4JI4L 1BUVT 1TXYA 1VQDA 2QILA 1KC8C 2V1CC 1B1ZA 3GTKH 1TWCH 3ULLA 4R8IA 2AWOA 4PZ7A 1VQOA 4QQBX 4C3IG 3ND8A 5C0XI 3T13A 3T1YQ 5BN3A 1F77A 2Z0SA 1PA6A 1ZEQX 2F0MA 1I94Q 1IKMA 2CWAA 3J7AV 3A7LA 2FJ2A 2NVYH 1L1OA 4G4KA 4XYQA 1SE8A 3EA6A 2A6HD 1EWIA 4CJ0B 4KN4C 5E1FA 1F9QA 2UUBQ 3J81c 1SLJA 1XMOQ 2BH2A 1XMQL 1DOKA 2IW3A 3K8AA 5EBCA 3TP6A 3JAME 4CKEA 3KYHC 3I72A 1G2SA 4I65A 1XPUA 5M5WH 3CQZB 4BBSH 3A74A 2P5ZX 4GOPB 4A3GB 5IP7G 4LF4Q 5EQ0A 3J80i 1V1PB 2NZ1D 3NHHA 3C46A 2KHIA 1I6VC 3KK7A 3GTGH 4O0AA 4OWXB 3U4VA 2AQ2B 5IWAL 3OOCA 3T4AC 4CDEC 4J8QA 5TSSA 1PH7A 4KHZA 5ELFA 1SMYD 2MFIA 4OELB 5IYDG 5IGEA 4DUZL 4DR4L 2UXDL 5EGTA 4X64L 1YITA 2LY7A 1MSGA 2K04A 1RKNA 1IZ6A 3H91A 1JORA 4KKTA 1HNZQ 2K5DA 4JI2Q 1F2ZA 1UEBA 1A3UA 3K6OA 1KAWA 2NVXH 1SRUA 4JI3L 4GKJQ 4ZK9B 4DNTB 4A3JB 1NUCA 5C6AA 4CKBA 1D5XC 5LHY1 1J9OA 2DY8A 1HA6A 1PZJD 1TIID 2B2VA 2A5HA 4DV5L 2H1EA 2ZJPA 1V1QA 5J22A 5KIXA 2G9HD 5C0XG 3I4NH 4B9XA 3E0EA 1Q1BA 1SE3A 1RL2A 3QG1A 2AHOB 4KY7A 2K03A 1ENAA 5GAHC 2VQEL 1T5EA 3N52A 2UU9L 4HAEA 4AYBB 2E2JH 1HFGA 2OTLA 2ZXPA 3OYYA 1EZ6A 2HDLA 4DGZA 1X3QA 3G6EA 1FL0A 2JEBI 1SJED 3FVQA 2EYFA 1ET9A 1STHA 5C3EB 5G3LF 3S1RB 4C2MB 3TS2A 4G7ZC 1B9MA 1ZYRD 1B3AA 2HUGA 2JEAI 3D3RA 1K3RA 5ELBA 4A3BH 1TS2A 2E75C 3MFGA 1S5BD 4X3UA 1EQQA 3SK6A 5ELCA 4BA1I 2CVRA 3HOVG 2GA4B 1WTOA 1UE6A 1U5KA 2N78A 4OL7A 3I91A 2WFWA 1CHPD 1EOTA 3GP7A 1X65A 3S1QH 3Q23A 4LUZA 5K5PA 1VQNA 2WB1B 1LT3D 1HTLD 1TWHB 5I9OA 3A5ZB 4J6HA 4KY6A 4P71A 1AH9A 3QOLA 4A93B 1NR4A 2R93G 3ERSX 1EY4A 1NE3A 4BY7H 1Y14B 3I8ZA 1HQMC 1RIPA 3M9BA 1EYGA 1V1OA 5IT9E 2B3GA 3QJYA 1UNSA 4L5QA 1SFOB 1ILPA 1KDBA 1HNXL 1O78A 4HIOA 1E7ZA 3I73A 4DPGA 1MJEA 4JI8L 1ZKOA 3LWUA 1FYCA 3E3XA 4H7BA 4HMJA 4DR7Q 3I2ZA 2CWPA 4WJ4A 1XX8A 1BR9A 5C4HA 4G7HC 3AFPA 2XRSD 3M4PA 4DR6Q 5EPKA 3DEPA 1CTMA 4BWGB 4MIUA 1XMQQ 1K8AC 1TS5A 2OEOA 2IWHA 1DZ1A 4PNYA 4HTHA 3CP0A 2XSCA 2B2UC 4A3DB 1WCMG 2JP1A 4RCNA 2F3IA 3CCJA 5D3IB 1FNVA 4EQ5A 1KDAA 3KF6A 1F2YA 3D4RA 2RDFA 1J5EL 4LF7L 2WV6D 2OXPA 2MP1A 3D31A 3O13A 2F0NA 5EKLA 4MTNA 2B63G 5IWAQ 4HSPA 1CKNA 3W1BA 1EIYB 1N32Q 3CQZH 3SXHA 4DXFA 2NVTB 4NXML 1W6KA 4A3GH 1SN8A 4NP5A 3K5LA 4HJ9A 4EGVA 4C3HG 1Q12A 2BA0A 2K33A 4L6TB 5M3FG 4A3CG 2B2TC 2JJQA 1K73C 1IBML 5HURA 2ASBA 3CCLA 1N34Q 2OQKA 3CCEA 1B4OA 1ICFB 4B3TL 5CR3A 2EE1A 3VA5A 3G7LA 5A2QE 1GUNA 3AU7A 5IGGA 2R6GA 5C44B 2R61A 3E9IA 2IY5B 3HKZE 1LTAD 5I2XA 2ZT9C 4DV5Q 1EUJA 4IOAA 3U9OA 3G6JB 1LT4D 4L63B 4HJAA 4A3IB 3H3VH 2VB3X 3Q6SA 4A3JH 3J80L 1CKOA 1JWUD 1EZ8A 4RCOA 4Y7NB 2MO1A 4FYDA 2HIVA 3MC0B 1Y8OB 3S1NB 3FMCA 4O2DA 4IFDI 5IP9G 4DXGA 2Q8RE 4LF9L 2Z6KA 2UU9Q 1O7YA 3Q24A 1IW7C 2FXQA 3FRPB 1K83B 4JI5L 1GUOA 5JEAH 2QCPX 4K6DA 4DR3L 5BN4A 2F0TA 2Z4HA 2YTYA 4C3IB 5JOBA 3PIPA 2F0HA 4POGA 3U50C 1UAPA 2A69C 1PLFA 3ZYYX 3NENA 3OPOA 2VQFL 4DR5L 4XXEA 3TP5A 2DGYA 4KKSA 2JE6I 1KQSA 3IKJA 2HQEA 2ATWA 1SE4A 4WJ3M 5ISRA 3MXNB 1A15A 1KNAA 1QUQB 1I4HA 2CH4W 4XT1B 2QKIC 3T16A 5C3EH 2KQ3A 3S1RH 4C2MH 5E4XA 3ZJYC 1HZBA 2RSOA 2XWJB 2MJ8A 1CSQA 1QNUA 2JN4A 1VQ5A 1H9KA 4RH6A 3OSOA 3HOWB 3SDZA 4G57A 1I6HB 4ZUJA 5JVH3 3H6MA 3DM3A 1HRJA 1KAAA 2L4NA 2JA7G 3JC66 5CV4A 3MWYW 3SEBA 3QWNA 4A3MB 3S16B 3PO2G 4YWLA 3RD4A 3BZDB 1TWHH 4I7AA 1WTHA 5CV9A 1P16A 4HMIA 4A93H 2UUCQ 4R1JA 2R7DA 5FK9C 1CT1D 1GD7A 2YYZA 1K8OA 4IURA 1VQPA 3ER0A 4CJ1B 2D0OA 1I4QA 2K5WA 5FJ8H 1SFOH 3KJPA 2MQHA 3PUWA 3JAMc 3S15B 3I56A 2KCCA 4GOPC 1STEA 1SAPA 1EU4A 2PI2E 5GROA 5JEAJ 2NZHA 2VS1A 1KXLA 5BR8L 3NEMA 1XWEA 3H0GG 1DYQA 1OXUA 1KIXA 2KECA 2TSSA 4YWMA 4IFDG 1CUKA 4A3LH 5E7NA 1CSPA 1GUGA 3CRLC 1TWFB 1N9WA 4EQNA 1HR0L 1ET6A 2K4KA 5LL6S 4AYBE 4C3JB 2KCMA 3F2BA 4A3DH 3D4DA 3G71A 2ZTEA 2I46A 1R4PB 2LS01 3K7AB 4NXMQ 1NR2A 2L9HA 1OXXK 2F0FA 1JJ2A 2SDFA 3TEHB 1LLRD 5NUCA 2CFMA 4NW2A 2SOBA 3GTJB 1EY6A 2HHHL 3PIO3 1XNQL 4TKOB 2I5LX 1RDPD 1AFPA 2XVSA 4LFAL 3M3YB 3FDTA 3NTHA 3HOYH 2NVTH 1TS3A 3UDGA 2ICIA 2CW0D 3F1ZA 3FKIG 4DK6C 2K6AA 1WOCA 2NVYB 1Q90A 1D5MC 4JC0A 2Q2TA 1LABA 2PCFB 2WB1E 4GS3A 3RNUA 1H9RA 1H9JA 4JI0L 3NBHA 4IPHA 1PYSB 2BCOA 3HOVB 4YIJA 4FDBA 1VQ7A 2BDOA 4P2CB 3GDEA 3ULPA 1V1PA 3MFYA 3EFXD 3TMEA 3T1HQ 4KV6A 2DN8A 5C44H 1HJPA 2EXDA 1DXMA 3GTMB 4KHPL 3WOEA 1PFBA 1VQKA 1NMFA 1QNKA 3IL8A 1NNXA 2JK8A 4LF9Q 2JA5G 2KHSA 3TSSA 2UXCL 1PTOF 4JI5Q 2F0KA 1VCIA 4A3IH 2Y0SG 2ES2A 1STNA 5IGCA 2NTSA 1LT6D 3SHLA 3IAYA 2R7FA 4K0KQ 2JXMB 1WFQA 5IOCA 4GZYC 3I4LA 4Y7NH 4DA2A 3S14B 1YZ6A 3MZ5A 3S1NH 4ZRZA 4DV2L 1A3TA 4OO1I 4GNXB 2VQFQ 2EYHA 4DR5Q 5C4XG 2EIFA 1XTDA 1WTRA 1K83H 1CFMA 2KENA 2NB0A 5FLXL 1HCZA 2K28A 5E3FA 1VQBA 4LF8L 1FGUA 4C3IH 4A3EB 1QB5D 1VDZA 1SEBD 1CKMA 3RZDB 4A75A 2M00A 2OTJA 1GUSA 1SNOA 3DUZA 2Q8TA 4GN4B 5KNBA 2EY2A 3GQBA 2K7VA 5FOBB 1WCMB 3S17B 1WD1A 1Z9FA 1BVSA 1AE2A 5IYCG 1EYCA 4RHSA 3M85A 1YJWA 3TP7A 3FP9A 3L3OC 2MO0A 3ITPA 2LFNA 3NWTA 5IY0A 2CQAA 5IT9c 3I4NB 4QJFA 3QIAA 4LUOA 4IPDA 4L8JA 4DAYB 4DR1Q 2B63B 4X3SA 4JVZA 4L5RC 2EXZA 3I55A 1L0YB 5KYIA 1B53A 3VR6A 2A1AA 4OGQC 2EZVA 2XTIA 5IP7H 2HDMA 3GV6A 3HOWH 4C3HB 1I6HH 2UXBL 5I6WA 1K3BC 1DONA 2B2YC 3CC7A 1LTLA 3HGBA 3V2TA 4A3KG 3S16H 1GVPA 1VQAA 1S72A 3PF5A 3MHBA 4OWWB 1HH2P 2L55A 4H0LC 4KTAA 1PTOC 4RFBA 4KJNA 2RHSB 5BR8Q 2IX0A 4BBRG 2ZTCA 4P74A 1WTXA 1EU3A 4P73A 1V9PA 3PUXA 4J1MA 3M4YA 3J81i 3KUPA 4QGUA 3PMFA 4K8JA 3WWVA 3S15H 1LTBD 3OIPA 5M3MG 1X55A 1SYDA 4DV3Q 1OXTA 2X69A 1IBKL 2RCNA 4FO2A 1WTWA 4GKKL 3RN2A 2VW9A 4DV4L 1T5XD 4OO1G 1O7IA 4IUTA 1WD0A 4LJZC 2N88A 2HHHQ 2A68C 4BA2I 4DR2L 4C3JH 1LTID 1CM9A 3KOJA 3X3NA 4RA8A 1BBUA 4LFAQ 1Q3LA 1SMXA 1XTCD 3FHWA 4R4TA 3K7AH 1GXDC 5CV6A 2KJXA 2E74C 3NWSA 2PQAB 1X3EA 3S2DB 4NMZA 3GTJH 1BNZA 4LUVA 5LMNL 1FNWA 1EL0A 1I3QB 3DLLA 3PSIA 1QZHA 1YHQA 3M3YH 2CH4A 1H9MA 4JI7L 1GJXA 3A8KE 1WTQA 2H4OA 3HFZB 4KHPQ 1X3FA 4DAMA 3B6YA 4B3MQ 4IPCA 5IGBA 4RGMA 2WAQG 1FR3A 5C4ZA 4B3SL 1K8MA 2B8FA 2DJFC 2K1BA 3BZCA 1IYJB 2A74C 3MXGA 1S40A 2O4XA 3HOVH 5HY6A 4X66L 2EJGC 1IHZA 2D62A 4BY1G 4A76A 4JI6L 2N3SA 2JA7B 3J7A5 4JV5Q 3GTMH 1TVXA 1HA5A 1K9MC 3PO2B 4DV2Q 4YHHL 2HIXA 3A8IE 1F2MA 4LFBQ 2NYZD 3KFUA 5KEEA 2F0JA 4NKLA 4LNQA 5J1ZA 1PVOA 4BXXG 2IX1A 2MPMA 1DOMA 2HQLA 1Y1WG 1OTCA 4ABNA 1P8LA 4LF8Q 2NN6I 2QGQA 2DUDA 2F3WA 1YEZA 3S14H 2BOSA 3I4MG 5JJLA 1ENFA 1BXTA 3STBC 1HNWQ 3CPWA 1UE7A 1PH4A 3HEJA 4Y52H 4CHTB 1CQVA 3K58A 3NELA 1EWCA 1PH3A 1BBWA 3H0GB 1UE1A 4P75A 5C0XJ 1AEXA 4A3EH 2VL6A 3RZDH 1JJGA 3HOZG 2EYOA 4C56C 1ASYA 1MIUA 3PQIA 1VQCA 2NVQB 1E0BA 4WRDA 4DK0A 1WCMH 5M9OA 5I4DA 4DV6Q 4RAUC 3S17H 2IJ0A 1RF2D 2RDGA 3MTSA 1KD1C 1VMCA 1SYBA 2GVBA 4OONA 2UXBQ 1EWHA 1RCVD 2PO4A 4OIKA 4G7OC 5JJKA 2C9OA 5DM73 1G6PA 4DV7Q 4Q5VA 2B63H 2R92B 4HSVA 3BZKA 2F0DA 1SSOA 4P72A 3HG9A 4IJHA 5KRUA 2K5NA 4CKCA 3S1MB 5GAGC 1N8RC 2AQ1B 3SGIA 1SNQA 4ALPA 5DM63 3MXNA 2CQOA 4JOIC 1PRTD 2RBMA 3FKIB 4A4IA 4KN7C 5F2DA 4C3HH 2SNSA 2XGTA 3K5MA 4CJ2C 4A3CH 3NK9A 2A6ED 2RKSA 3AYHB 1R4QB 4LF5Q 4Z9CB 2JA6G 3H15A 1TY0A 4B3RQ 1BCPD 3I3CA 4DV0L 2L12A 1HUMA 4M1UB 4QB4A 2F4VQ 2B2WC 4UDUC 2JA5B 4XQJA 4X3KA 1TWAH 4UHVA 4DR2Q 2J4XA 3OW2A 1N36Q 3A54A 4KJOA 5FLMG 2QEJC 3M4OB 4JI4Q 2NN6G 2IPKD 1OO9B 4H02A 5JJZA 2DJGC 2YTXA 3HP3A 5IP9H 1QG7A 4OXPA 3E0JA 2V4DA 4HCSA 5C4XB 2A6HC 1Y1VG 1EEID 2E5LL 3OW7A 1KLUD 5LMNQ 1PH2A 1QE6A 2PZTA 3NQIA 3CCMA 3GTPH 1VQ9A 2Z4IA 4X3TA 5JPMC 5M5XB 1FGBD 5EPJA 3DHQA 4JOIA 1QCBD 3G4SA 4X6AH 2KCNA 4K5WA 3J81L 2ENBA 3GD7A 2JSOA 1I5FA 4EVOA 3S2DH 5C3WA 4B3SQ 1L2FA 3ULJA 2KUMA 4IQZA 1I3QH 2B39A 4K14A 4DK3C 4X66Q 4L5SA 2IX3A 3BYYB 3HZXA 2XIWA 4PZ8A 4PMCA 5GADC 1U4MA 4GNXC 4JI6Q 2K01A 3M7GA 4AQYL 2BE5C 2MNAA 2C5CA 1SMYC 1PDQA 2B2WA 2I07B 1D2BA 4PG3A 1LM0A 4UPAA 1Z7TA 1JOOA 1PTOB 4ULLA 2N49A 1L0WA 1ASZA 1E22A 2SNMA 3AEVA 2K52A 1LTTD 1PHJA 4A3KB 2JA7H 4M8AA 4F8MA 3HOYB 2KEDA 1WTVA 1Q7YC 3PO2H 4DUZQ 4DR4Q 2UXDQ 4LFCL 4A3FB 4X64Q 1OXVA 4UAIA 4QUCA 2VB2X 3SK4A 1UUPA 1TWGB 1C9OA 4BBRB 1R9TB 1F9RA 1VQLA 3EROA 1IBLL 2YV5A 4JI3Q 4EX5A 4APVA 3E6ZX 2M2LA 2LXJA 1C48A 1X54A 4H13C 2RA4A 5ELDA 2EYJA 4XIGS 2E2HB 1G51A 1Y69U 3KLWA 1YHAA 1YJ9A 1FJGL 5ELNA 3H0GH 4LW1A 3WDNA 3KF8A 4IFDH 1EFID 1XPOA 2B2UA 4LF6L 3S2HB 3HRZC 4MHEA 3BJUA 1RTNA 2F52A 3PCOB 2NVQH 2VQEQ 2F0UA 1B70B 2G5DA 3MXUA 3F2CA 1VMPA 3KDFB 2VNUD 5A35A 1O7LA 2ZJRA 3LGJA 2LMCB 3AB9A 2L15A 1TKWB 1E24A 4R4OA 2IHEA 1VQEA 4ZLTF 3DXJC 4XQNA 1JE5A 1AW7A 1SE2A 2R92H 1NSNS 3JAMi 2F0LA 3S1MH 4XTCS 2PNHA 2A8VA 1CK1A 1PXUA 2B2TA 3G48A 1SBBB 3T53B 3EQLC 3UDXA 3H3VI 3CPFA 2R7ZG 4FXKC 3FKIH 2H5XA 4DAYA 2F0OA 3K0YA 3J81j 5KGUA 2F0VA 1MJCA 4KLKA 2RF4A 4JK1C 5I6YA 1EFWA 3GV3A 5IYBH 3UDFA 2L5TA 1A0IA 3BVZA 4DN4M 1KHIA 1TR5A 4B9WA 3DWQA 1GHJA 4ZQ3A 1PFNA 2QDLA 1ESFA 2HD3A 4JBWA 3S9WA 2C35B 2JA5H 2E5LQ 3FPPA 2VY3A 1YNXA 1A3VA 2WKDA 4FXGC 1QILA 1C8CA 4YCVA 4X65L 2A73B 4JBJA 3D6CA 2WINB 2XNAC 1IL8A 3M4OH 2F1MA 1IL2A 5FLXc 1HNXQ 4RKBA 3CF5A 3VDYA 2JA8G 5LL6X 3LX0A 3NSWA 4JI8Q 2KCTA 4IFDJ 4MTKA 1LTGD 5C4XH 5CBAE 3CC4A 3BYTB 3PO3G 4DAPA 4UY8C 4DV1L 5M5XH 1GKHA 4KKUA 3QB3A 3HOZB 4A3GG 4AQYQ 2O5JC 1VF5C 2F0IA 3R3OA 4KI0A 1KDCA 3D8GA 1LT5D 1YIJA 1J5EQ 2IT1A 3R8BA 4LF7Q 1U4RA 2EVBA 1Z6HA 1N33L 2DNEA 1JWSD 2PQAA 1HZ9A 1HUNA 3RN5A 3OTOL 3CD6A 5K36G 3QOJA 3KLRA 1EOVA 5DEHA 1QVCA 2F4IA 3J80E 1S3OA 3DWPA 1PTOH 2ZJQA 1RJTA 2KEEA 2HT1A 1EY8A 3VYRA 3W1GA 4DAVA 4N9PA 4IUPA 1B8AA 3OWEB 4XYOA 1IBMQ 4B3TQ 1ESRA 4A3KH 2J0TD 2PW7A 1B7YB 3RLOA 1M8AA 4DK1A 2KHJA 1KRTA 1SJHD 2JA6B 2QDBA 1SR3A 3QO2A 1LV9A 4A3FH 1YNND 1RTOA 1TWGH 2LKVA 3FPUB 3IRBA 2KOLA 4BBRH 1R9TH 4GOPA 3N6RA 1KL9A 1VQ6A 3CW2C 3MAQA 1CA5A 1H9SB 3IFTA 1I4GA 3BDOA 2UUAL 4N9TA 4AYBG 5M3MH 3UDIA 1NJIC 3OMCA 4EQOA 2E2HH 5BN5A 1UE5A 4DKAC 5CC4A 5KYLA 2Z1CA 3PUYA 1MBYA 3S2HH 2R93B 4DR3Q 2KVMA 1QWYA 3K80C 5T1IA 1Y1VB 1UWVA 5C4JB 2FFKB 1YNJD 2VZAA 1WVLA 1I94L 1MHWC 4ME5A 4PMBA 3W3AA 5L37A 1MI2A 4XT3B 3LWEA 5CV5A 5D14A 5EBDA 2EY1A 2UUBL 1VF7A 1XMOL 1Q8KA 2WB1G 3ICEA 3L0OA 3MVVA 1E3PA 2AUJD 3U4ZA 1YHBA 2PI2A 2L0CA 2AKWB 3HOXG 4JYAL 1TT2A 2IL8A 2PMZB 3C1FA 2RDHA 4ZAIA 2CCZA 3RR5A 4V0BA 1BDOA 3ERQA 5ELOA 5FJ8G 3EJIA 5T1GA 4X65Q 1KTKA 1PZKD 3QR8A 1EIFA 2K75A 2F0QA 3KLSA 4YCWA 4IO9A 2NZOA 1VQIA 3M7NA 2ALYB 5CV7A 2MUYA 1PH6A 3JAML 2NWGA 4JI2L 5JAVA 3J7YW 1HXYD 5M3FB 2L11A 4BXXH 4A3DG 1G6ZA 3BDCA 4GKJL 4FXDA 4IPGA 3AQQA 1JR0D 4KY5A 4RWSC 1AP0A 1UEAB 3OWFA 4EQPA 1D6EC 2PW5A 2EYPA 1SNPA 1E2VA 5IYDH 1B9NA 3GTQB 4X62L 1S4ZA 1HR0Q 2I5MX 4MN3A 1TWAB 4R9WA 3VA7A 3PF4A 3TBIB 5LMNW 5LMUL 3HOZH 1SNMA 4E6IA 3OTOQ 1M90C 4IUUA 2ICEC 1XXGA 3IFDA 1PFMA 2EDGA 3H09A 3KJOA 2D5DA 3E5SA 3RMHA 1L1OC 3AFQA 4LK1C 4IUQA 3GTPB 1XNQQ 2OT2A 2VXWA 3OMGA 3VR4A 4ZKBB 1VQMA 5C0XH 1J8IA 2L1BA 2QA4A 1U9RA 1JJCB 2A19A 1Y8PB 3PIP3 1PMRA 2B2YA 2Q2IA 4A3IG 5CGKA 5HGTA 2R7ZB 4OEMB 1RD9D 1A63A 4JI0Q 3SK5A 3EVQA 1I50B 3VR3A 1SXTA 2QW7A 5D3DA 1ML0D 1B2TA 5FLXE 1S5DD 2HCIA 2UUAQ 2PPBC 2YU9B 3NP8A 2FINB 2Z8LA 2JA6H 3NXWA 1EIHA 4JPBW 3ONAB 2VUMG 1PH9A 3RLNA 3OHXC 2UXCQ 2ZXRA 4O42A 5AFWA
chains in the Genus database with same CATH topology
4ME3A 4WJ3M 2GN5A 1X56A 3CCMA 3GTPH 1VS0A 1VQ9A 3MXNB 5J3BA 1C7YA 4OWTB 1QUQB 5C3EH 3S1RH 4C2MH 4JV5L 4JOIA 3K0XA 1HZBA 3KF8B 3ZJYC 5FLMH 3G4SA 4L5TA 4A93G 4X6AH 4DR7L 4IJLA 1CSQA 3GD7A 4LF4L 1X3GA 1I5FA 1VQ5A 3S2DH 4LFBL 2ID0A 4B3SQ 1L2FA 3ULJA 3F8TA 1A62A 1D7QA 1U0LA 2YTVA 4DR6L 2R93H 1A8VA 2VUMH 1I3QH 2AWNA 4IOCA 1BKBA 4DK3C 4X66Q 3DM3A 1Y1VH 3CCRA 4L5SA 3HOUG 2JA7G 3JC66 5C4JH 2ZM6Q 4PZ8A 5GADC 1GM5A 3PO2G 4YWLA 2B29A 4NB3A 4GNXC 4YWKA 4JI6Q 1TWHH 4AQYL 2MNAA 3NBHB 2N8NA 4BY1H 2Q2UA 4JYAQ 4TVAB 4UP7A 2E8GA 1HNWL 1P16A 3HOWG 4PG3A 1LM0A 1NMGA 4UPAA 4A93H 2UUCQ 4A3LG 4R1JA 2R7DA 3UE0A 1QVGA 3HKSA 1GD7A 2N49A 2YYZA 1L0WA 1ASZA 1VQPA 3ER0A 4OX9Q 1E22A 4A3MG 2D0OA 1HNZL 3AEVA 3MEFA 5FJ8H 4DV1Q 3KDFA 2K52A 4PMWA 1V43A 1SFOH 3KJPA 1Y1WH 2MQHA 3PUWA 3JAMc 1PHJA 3HOUH 2JA7H 3I56A 4GOPC 1N32L 2KBNA 2PI2E 3STBD 1Q7YC 3PO2H 5GROA 5JEAJ 2NZHA 5DLQE 4DUZQ 4DR4Q 3CMEA 4YY3L 2VS1A 4LFCL 4DV6L 3I4MH 5BR8L 3NEMA 2UXDQ 1KXLA 4X64Q 3H0GG 1OXUA 1KIXA 1GO3E 1OXVA 4R4IA 4YWMA 4IFDG 4RMFA 4A3LH 1CUKA 5E7NA 1C9OA 1NTGA 1CSPA 4PZ6A 3M4QA 3CCUA 4UP9A 1N9WA 1VQLA 1N34L 1HR0L 1Q46A 3HOYG 4A3MH 1N33Q 1IBLL 2K4KA 2YV5A 4DV7L 4AYBE 1NY4A 4HJ5A 4JI3Q 2ATWA 2KCMA 4EX5A 4APVA 3F2BA 4A3DH 3BU2A 1PFSA 3G71A 2ZTEA 2LXJA 4A3FG 1PH5A 1X54A 4NXMQ 3CCVA 4NXNL 1OXXK 4XIGS 1JJ2A 1DGSA 3TEHB 1G51A 3D0FA 1QUQA 1YHAA 3KLWA 2CFMA 3TQYA 1KRSA 1YJ9A 5ELNA 1JB7A 1FJGL 3H0GH 4LW1A 3UE1A 4HJ7A 4GLVB 4JBKA 1VQGA 1XPOA 4X62Q 1NBWA 5M3FH 2HHHL 4LF6L 2IHFA 1XNQL 1EQRA 3BJUA 2I5LX 4UP8A 2F52A 3Q8DA 5C44G 4LF5L 4LFAL 1XNRL 3HOYH 3PCOB 5LMUQ 3I4OA 2NVTH 4B3RL 2WAQE 2NVQH 2VQEQ 1B70B 1WI5A 2K14A 3PIOA 3UDGA 1IBKQ 3F1ZA 3FKIG 3F2CA 4DK6C 4GKKQ 1WOCA 4DV4Q 1QZGA 1D8LA 3KDFB 3J80c 1E1TA 4HIDA 4JBMA 2VNUD 4JC0A 2Q2TA 4GS3A 2WB1E 2ZJRA 3LGJA 2F4VL 1YBYA 3RNUA 2L15A 1FVIA 4JI0L 1QVFA 4IPHA 1E24A 1PYSB 1TWFH 4R4OA 3F2DA 2IHEA 3GTQH 1VQEA 3PV0A 3W5OA 1JE5A 4FDBA 1VQ7A 2K5VA 3GDEA 4LWCA 1VQJA 3ULPA 1N36L 2R92H 3JAMi 1W3SA 2JQOA 3T1HQ 4JI4L 1TXYA 1VQDA 4XTCS 1HJPA 5C44H 2EXDA 2PNHA 3S1MH 2A8VA 4KHPL 1KC8C 2V1CC 1VQKA 1NMFA 3G48A 3GTKH 3UDXA 3H3VI 3CPFA 1TWCH 2JK8A 3ULLA 4LF9Q 2R7ZG 2AWOA 3FKIH 4PZ7A 2JA5G 1OXSC 2H5XA 2UXCL 1VQOA 4R4CA 3U58A 4JI5Q 4QQBX 1T9HA 3J81j 5C0XI 1HZCA 1VCIA 4A3IH 2Y0SG 3T1YQ 2ES2A 4MZ9A 1MJCA 2PMZE 4KLKA 2BH8A 2R7FA 2RF4A 2Z0SA 1E1OA 4DUYL 1PA6A 1EFWA 1WFQA 4K0KQ 4BBSG 5IYBH 3UDFA 4Y7NH 1A0IA 1YZ6A 1I94Q 3S1NH 1KHIA 4JI7Q 4JI1L 4DV2L 2CWAA 4OO1I 4GNXB 5EAYA 2VQFQ 4DR5Q 2NVYH 1L1OA 1M1KC 5C4XG 2EIFA 1XTDA 1SE8A 1K83H 1EWIA 4JG2A 2R7ZH 4JBWA 2C35B 2KENA 4J15A 2E5LQ 2JA5H 2UUBQ 2VY3A 3J81c 1I50H 1YNXA 1VQBA 2K50A 4LF8L 1FGUA 1SLJA 4C3IH 1XMOQ 2BH2A 1XMQL 4AIMA 4GN5A 1CKMA 3K8AA 4YCVA 4X65L 4JBJA 4HIKA 1PH8A 4A75A 3KYHC 2OTJA 3EIVA 3M4OH 4HIMA 5FLXc 1IL2A 1HNXQ 1XPUA 4GN4B 5M5WH 2YU9H 3CF5A 3VDYA 2JA8G 3A74A 4BBSH 2BA1A 4GOPB 4YHHQ 4JI8Q 2KCTA 4IFDJ 5IP7G 4LF4Q 2UUCL 3J80i 1Z9FA 1BVSA 1AE2A 5IYCG 2QEXA 5C4XH 3M85A 4A3EG 1YJWA 2KHIA 3FP9A 3CC4A 1X6OA 4JYAL 2MO0A 3PO3G 1LYLA 3GTGH 4O0AA 4OWXB 3U4VA 4DV1L 5IWAL 4UY8C 5M5XH 1X9NA 5IY0A 5IT9c 2ZTDA 4QJFA 3CMAA 3L7ZC 1GKHA 4IPDA 4LUOA 4DAYB 4DR1Q 1PH7A 4L5RC 4KHZA 4A3GG 2MFIA 4AQYQ 3I55A 3L2PA 5IYDG 4DUZL 4DR4L 2UXDL 5JJIA 3I7FA 2JA8H 4X64L 2A1AA 1YITA 2XTIA 4KI0A 1IZ6A 5IP7H 3HOWH 1HZAA 1YIJA 1J5EQ 1I6HH 2IT1A 2UXBL 2Z6KC 1HNZQ 1VQ8A 4LF7Q 4JI2Q 3I4NG 3CC7A 1LTLA 1XPRA 4A3KG 1UEBA 1L1OB 1KAWA 2NVXH 1N33L 2PQAA 3S16H 1GVPA 1SRUA 1VQAA 4JI3L 1S72A 3PO3H 4GKJQ 3PF5A 1HZ9A 4OWWB 3RN5A 3OTOL 3CD6A 5K36G 1HH2P 1EOVA 1QVCA 2I5HA 5AJ3L 1PV4A 4YY3Q 2RHSB 5BR8Q 1WYDA 1S3OA 4DV5L 2IX0A 4BBRG 3E9HA 5M5YH 2ZTCA 4P74A 2ZJQA 2K5HA 2ZJPA 2HT1A 1V1QA 4P73A 3W1GA 4GNXA 1V9PA 3PUXA 4GN3B 1IBMQ 1B8AA 3J81i 2I0QA 3K81C 4QGUA 5C0XG 3I4NH 3E0EA 4B3TQ 1Q1BA 3WWVA 1RL2A 4A3KH 2RHQB 3S15H 1AE3A 5M3MG 1X55A 2AHOB 4DV3Q 2CKZB 1B7YB 1OXTA 5GAHC 2VQEL 3RLOA 1IBKL 4A3BG 2RCNA 2KHJA 1KRTA 4GKKL 3RN2A 2VW9A 4DV4L 4NXNQ 1SR3A 4A3FH 5GQOA 3TRZA 2UU9L 4R4QA 1YVCA 5H1SE 2E2JH 4OO1G 1Z47A 2OTLA 1O7IA 1TWGH 3IRBA 3OYYA 3G6EA 2OWOA 4BBRH 1R9TH 1FL0A 2JEBI 4GOPA 2HHHQ 2WP8J 5GAEC 4BA2I 1KL9A 4DR2L 3PGZA 3CW2C 4C3JH 1VQ6A 4GLAC 2OCEA 3KOJA 4YCUA 3T1HL 1BBUA 1SROA 4LFAQ 1XNRQ 1SMXA 3FHWA 4R4TA 3K7AH 2UUAL 3TS2A 5M3MH 4AYBG 1NJIC 3UDIA 3CC2A 2Q2HA 4DV0Q 1K3RA 1K8GA 2E2HH 2JEAI 4A3BH 1UE5A 2PQAB 4DKAC 4QY7A 1X3EA 4BY7G 3CAMA 1EQQA 4JCVE 3PUYA 3RLFA 4BA1I 3GTJH 3HOVG 3HKZG 4LUVA 5LMNL 1UE6A 1U5KA 3S2HH 4DR3Q 2N78A 2WFWA 3K80C 3DLLA 3PSIA 4K0KL 1UWVA 1X65A 1QZHA 1YHQA 3M3YH 3S1QH 4LUZA 1VQNA 2VZAA 5HGQA 1I94L 4JI7L 1YI2A 3HFZB 4KHPQ 3A5ZB 1X3FA 4DAMA 3B6YA 4B3MQ 4IPCA 4P71A 1AH9A 2WAQG 4B3SL 2R93G 3ERSX 1NE3A 4BY7H 1VQFA 1Y14B 4NPSA 2LXKA 3BZCA 3GO5A 2UUBL 3GTOH 1IYJB 3EBEA 1S40A 1XMOL 5HY6A 4X66L 3HOVH 1RIPA 1Q8KA 2WB1G 3M9BA 3ICEA 3L0OA 2D62A 4DUYQ 2ZM6L 1EYGA 1E3PA 2B3GA 3U4ZA 4L5QA 4BY1G 4A76A 1YHBA 4JI6L 2N3SA 4DNIA 1HNXL 3J7A5 2PI2A 4JV5Q 3GTMH 1K9MC 2AKWB 3HOXG 4JI1Q 1HR0W 4QL5A 4DV2Q 1E7ZA 4DPGA 4HIOA 1IXRA 4YHHL 1MJEA 1VQ4A 4JI8L 4DR7Q 2HIXA 2CCZA 3J7ZC 4LFBQ 3I2ZA 3RR5A 3S24A 2CWPA 3KFUA 4WJ4A 5ELOA 4LNQA 5FJ8G 4OX9L 1PVOA 3AFPA 4BXXG 4DR6Q 3M4PA 4AH6A 2IX1A 2HQLA 1Y1WG 1OTCA 4LF8Q 1P8LA 1K8AC 1XMQQ 2NN6I 4QIWE 2QGQA 2DUDA 4X65Q 3CCSA 1EIFA 2K75A 1YEZA 3CP0A 4DR1L 3S14H 1WCMG 1LUZA 4YCWA 3I4MG 5JJLA 2F3IA 4IO9A 3CCJA 4RG1A 2OQ0A 3STBC 2NZOA 1HNWQ 3CPWA 1UE7A 1VQIA 3HOXH 1PH4A 3M7NA 2ALYB 4Y52H 3EN2A 4EQ5A 1PH6A 3KF6A 3NELA 1PH3A 1J5EL 1BBWA 5IYCH 1UE1A 4P75A 4LF7L 4JI2L 5C0XJ 4A3EH 3D31A 2VL6A 2B63G 4MTNA 4BXXH 5IWAQ 3RZDH 3HOZG 4A3DG 4GKJL 1JJGA 1CKNA 4IPGA 3AQQA 3W1BA 1EIYB 1ASYA 1MIUA 1N32Q 3CQZH 2D0PA 4GLXA 1VQCA 4NXML 1WCMH 4A3GH 1SN8A 3PUVA 4DV6Q 4LFCQ 4HJ9A 3S17H 3A5UA 5IYDH 4MNOA 1G291 2E2IH 1YJNA 1Q12A 2BA0A 1VQHA 5M3FG 1KD1C 4A3CG 2GVBA 1WJJA 2JJQA 4OONA 4X62L 2UXBQ 1K73C 1IBML 4A3JG 1K0RA 2ASBA 3CCLA 1N34Q 1HR0Q 2I5MX 2OQKA 3CCEA 5JJKA 1JT8A 1IBLQ 4B3TL 1G6PA 4DV7Q 3PF4A 1Q1EA 2B63H 5LMNW 5LMUL 3BZKA 1XJVA 4DV3L 3HOZH 3K7UC 4IJHA 4P72A 3OTOQ 2K5NA 2R6GA 1M90C 5GAGC 2JA9A 2GVAA 1N8RC 3E9IA 3SGIA 5AJ3Q 2IY5B 4ALPA 3HKZE 4POFA 5JEAG 2Y0SE 2CQOA 4JOIC 3KJOA 2EQSA 4DV5Q 1C0AA 1EUJA 4IOAA 4A4IA 4C3HH 1FJGQ 1L1OC 3AFQA 2XGTA 4HJAA 4LF6Q 4A3CH 1PYBA 2R92G 3H3VH 3TS0A 1W2BA 1XNQQ 3TREA 3AYHB 4A3JH 1CKOA 4LF5Q 5IE8A 3CCQA 3KF6B 1VQMA 2JA6G 3H15A 2MO1A 2HIVA 4B3RQ 1J6QA 2QA4A 4O2DA 1JJCB 5IP9G 4IFDI 4DV0L 2A19A 4TQUS 4LF9L 2Z6KA 3GTLH 2UU9Q 1CKNB 3PUZA 2Q2IA 2FXQA 4A3IG 4JI5L 2F4VQ 4HJ8A 1A63A 4JI0Q 4DR3L 3T1YL 2YTYA 1Q81C 1TWAH 5IYBG 5C3EG 4DR2Q 3PIPA 1MKHA 3A0JA 4POGA 3OW2A 1N36Q 5FLMG 3U50C 4JI4Q 2NN6G 1Q86C 2AMCB 2UUAQ 4H02A 3NENA 2VQFL 4DR5L 2JA6H 1PH1A 4B3ML 2YTXA 5IP9H 1Q82C 2VUMG 4OXPA 1PH9A 2DGYA 3RLNA 2LSSA 2UXCQ 2JE6I 1H95A 1KQSA 1JMCA 1Y1VG 2E5LL 3RZOH 1PH2A 5LMNQ 3CXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME3 A;  4WJ3 M;  2GN5 A;  1X56 A;  3CCM A;  3GTP H;  1VS0 A;  1VQ9 A;  3MXN B;  5J3B A;  1C7Y A;  4OWT B;  1QUQ B;  5C3E H;  3S1R H;  4C2M H;  4JV5 L;  4JOI A;  3K0X A;  1HZB A;  3KF8 B;  3ZJY C;  5FLM H;  3G4S A;  4L5T A;  4A93 G;  4X6A H;  4DR7 L;  4IJL A;  1CSQ A;  3GD7 A;  4LF4 L;  1X3G A;  1I5F A;  1VQ5 A;  3S2D H;  4LFB L;  2ID0 A;  4B3S Q;  1L2F A;  3ULJ A;  3F8T A;  1A62 A;  1D7Q A;  1U0L A;  2YTV A;  4DR6 L;  2R93 H;  1A8V A;  2VUM H;  1I3Q H;  2AWN A;  4IOC A;  1BKB A;  4DK3 C;  4X66 Q;  3DM3 A;  1Y1V H;  3CCR A;  4L5S A;  3HOU G;  2JA7 G;  3JC6 6;  5C4J H;  2ZM6 Q;  4PZ8 A;  5GAD C;  1GM5 A;  3PO2 G;  4YWL A;  2B29 A;  4NB3 A;  4GNX C;  4YWK A;  4JI6 Q;  1TWH H;  4AQY L;  2MNA A;  3NBH B;  2N8N A;  4BY1 H;  2Q2U A;  4JYA Q;  4TVA B;  4UP7 A;  2E8G A;  1HNW L;  1P16 A;  3HOW G;  4PG3 A;  1LM0 A;  1NMG A;  4UPA A;  4A93 H;  2UUC Q;  4A3L G;  4R1J A;  2R7D A;  3UE0 A;  1QVG A;  3HKS A;  1GD7 A;  2N49 A;  2YYZ A;  1L0W A;  1ASZ A;  1VQP A;  3ER0 A;  4OX9 Q;  1E22 A;  4A3M G;  2D0O A;  1HNZ L;  3AEV A;  3MEF A;  5FJ8 H;  4DV1 Q;  3KDF A;  2K52 A;  4PMW A;  1V43 A;  1SFO H;  3KJP A;  1Y1W H;  2MQH A;  3PUW A;  3JAM c;  1PHJ A;  3HOU H;  2JA7 H;  3I56 A;  4GOP C;  1N32 L;  2KBN A;  2PI2 E;  3STB D;  1Q7Y C;  3PO2 H;  5GRO A;  5JEA J;  2NZH A;  5DLQ E;  4DUZ Q;  4DR4 Q;  3CME A;  4YY3 L;  2VS1 A;  4LFC L;  4DV6 L;  3I4M H;  5BR8 L;  3NEM A;  2UXD Q;  1KXL A;  4X64 Q;  3H0G G;  1OXU A;  1KIX A;  1GO3 E;  1OXV A;  4R4I A;  4YWM A;  4IFD G;  4RMF A;  4A3L H;  1CUK A;  5E7N A;  1C9O A;  1NTG A;  1CSP A;  4PZ6 A;  3M4Q A;  3CCU A;  4UP9 A;  1N9W A;  1VQL A;  1N34 L;  1HR0 L;  1Q46 A;  3HOY G;  4A3M H;  1N33 Q;  1IBL L;  2K4K A;  2YV5 A;  4DV7 L;  4AYB E;  1NY4 A;  4HJ5 A;  4JI3 Q;  2ATW A;  2KCM A;  4EX5 A;  4APV A;  3F2B A;  4A3D H;  3BU2 A;  1PFS A;  3G71 A;  2ZTE A;  2LXJ A;  4A3F G;  1PH5 A;  1X54 A;  4NXM Q;  3CCV A;  4NXN L;  1OXX K;  4XIG S;  1JJ2 A;  1DGS A;  3TEH B;  1G51 A;  3D0F A;  1QUQ A;  1YHA A;  3KLW A;  2CFM A;  3TQY A;  1KRS A;  1YJ9 A;  5ELN A;  1JB7 A;  1FJG L;  3H0G H;  4LW1 A;  3UE1 A;  4HJ7 A;  4GLV B;  4JBK A;  1VQG A;  1XPO A;  4X62 Q;  1NBW A;  5M3F H;  2HHH L;  4LF6 L;  2IHF A;  1XNQ L;  1EQR A;  3BJU A;  2I5L X;  4UP8 A;  2F52 A;  3Q8D A;  5C44 G;  4LF5 L;  4LFA L;  1XNR L;  3HOY H;  3PCO B;  5LMU Q;  3I4O A;  2NVT H;  4B3R L;  2WAQ E;  2NVQ H;  2VQE Q;  1B70 B;  1WI5 A;  2K14 A;  3PIO A;  3UDG A;  1IBK Q;  3F1Z A;  3FKI G;  3F2C A;  4DK6 C;  4GKK Q;  1WOC A;  4DV4 Q;  1QZG A;  1D8L A;  3KDF B;  3J80 c;  1E1T A;  4HID A;  4JBM A;  2VNU D;  4JC0 A;  2Q2T A;  4GS3 A;  2WB1 E;  2ZJR A;  3LGJ A;  2F4V L;  1YBY A;  3RNU A;  2L15 A;  1FVI A;  4JI0 L;  1QVF A;  4IPH A;  1E24 A;  1PYS B;  1TWF H;  4R4O A;  3F2D A;  2IHE A;  3GTQ H;  1VQE A;  3PV0 A;  3W5O A;  1JE5 A;  4FDB A;  1VQ7 A;  2K5V A;  3GDE A;  4LWC A;  1VQJ A;  3ULP A;  1N36 L;  2R92 H;  3JAM i;  1W3S A;  2JQO A;  3T1H Q;  4JI4 L;  1TXY A;  1VQD A;  4XTC S;  1HJP A;  5C44 H;  2EXD A;  2PNH A;  3S1M H;  2A8V A;  4KHP L;  1KC8 C;  2V1C C;  1VQK A;  1NMF A;  3G48 A;  3GTK H;  3UDX A;  3H3V I;  3CPF A;  1TWC H;  2JK8 A;  3ULL A;  4LF9 Q;  2R7Z G;  2AWO A;  3FKI H;  4PZ7 A;  2JA5 G;  1OXS C;  2H5X A;  2UXC L;  1VQO A;  4R4C A;  3U58 A;  4JI5 Q;  4QQB X;  1T9H A;  3J81 j;  5C0X I;  1HZC A;  1VCI A;  4A3I H;  2Y0S G;  3T1Y Q;  2ES2 A;  4MZ9 A;  1MJC A;  2PMZ E;  4KLK A;  2BH8 A;  2R7F A;  2RF4 A;  2Z0S A;  1E1O A;  4DUY L;  1PA6 A;  1EFW A;  1WFQ A;  4K0K Q;  4BBS G;  5IYB H;  3UDF A;  4Y7N H;  1A0I A;  1YZ6 A;  1I94 Q;  3S1N H;  1KHI A;  4JI7 Q;  4JI1 L;  4DV2 L;  2CWA A;  4OO1 I;  4GNX B;  5EAY A;  2VQF Q;  4DR5 Q;  2NVY H;  1L1O A;  1M1K C;  5C4X G;  2EIF A;  1XTD A;  1SE8 A;  1K83 H;  1EWI A;  4JG2 A;  2R7Z H;  4JBW A;  2C35 B;  2KEN A;  4J15 A;  2E5L Q;  2JA5 H;  2UUB Q;  2VY3 A;  3J81 c;  1I50 H;  1YNX A;  1VQB A;  2K50 A;  4LF8 L;  1FGU A;  1SLJ A;  4C3I H;  1XMO Q;  2BH2 A;  1XMQ L;  4AIM A;  4GN5 A;  1CKM A;  3K8A A;  4YCV A;  4X65 L;  4JBJ A;  4HIK A;  1PH8 A;  4A75 A;  3KYH C;  2OTJ A;  3EIV A;  3M4O H;  4HIM A;  5FLX c;  1IL2 A;  1HNX Q;  1XPU A;  4GN4 B;  5M5W H;  2YU9 H;  3CF5 A;  3VDY A;  2JA8 G;  3A74 A;  4BBS H;  2BA1 A;  4GOP B;  4YHH Q;  4JI8 Q;  2KCT A;  4IFD J;  5IP7 G;  4LF4 Q;  2UUC L;  3J80 i;  1Z9F A;  1BVS A;  1AE2 A;  5IYC G;  2QEX A;  5C4X H;  3M85 A;  4A3E G;  1YJW A;  2KHI A;  3FP9 A;  3CC4 A;  1X6O A;  4JYA L;  2MO0 A;  3PO3 G;  1LYL A;  3GTG H;  4O0A A;  4OWX B;  3U4V A;  4DV1 L;  5IWA L;  4UY8 C;  5M5X H;  1X9N A;  5IY0 A;  5IT9 c;  2ZTD A;  4QJF A;  3CMA A;  3L7Z C;  1GKH A;  4IPD A;  4LUO A;  4DAY B;  4DR1 Q;  1PH7 A;  4L5R C;  4KHZ A;  4A3G G;  2MFI A;  4AQY Q;  3I55 A;  3L2P A;  5IYD G;  4DUZ L;  4DR4 L;  2UXD L;  5JJI A;  3I7F A;  2JA8 H;  4X64 L;  2A1A A;  1YIT A;  2XTI A;  4KI0 A;  1IZ6 A;  5IP7 H;  3HOW H;  1HZA A;  1YIJ A;  1J5E Q;  1I6H H;  2IT1 A;  2UXB L;  2Z6K C;  1HNZ Q;  1VQ8 A;  4LF7 Q;  4JI2 Q;  3I4N G;  3CC7 A;  1LTL A;  1XPR A;  4A3K G;  1UEB A;  1L1O B;  1KAW A;  2NVX H;  1N33 L;  2PQA A;  3S16 H;  1GVP A;  1SRU A;  1VQA A;  4JI3 L;  1S72 A;  3PO3 H;  4GKJ Q;  3PF5 A;  1HZ9 A;  4OWW B;  3RN5 A;  3OTO L;  3CD6 A;  5K36 G;  1HH2 P;  1EOV A;  1QVC A;  2I5H A;  5AJ3 L;  1PV4 A;  4YY3 Q;  2RHS B;  5BR8 Q;  1WYD A;  1S3O A;  4DV5 L;  2IX0 A;  4BBR G;  3E9H A;  5M5Y H;  2ZTC A;  4P74 A;  2ZJQ A;  2K5H A;  2ZJP A;  2HT1 A;  1V1Q A;  4P73 A;  3W1G A;  4GNX A;  1V9P A;  3PUX A;  4GN3 B;  1IBM Q;  1B8A A;  3J81 i;  2I0Q A;  3K81 C;  4QGU A;  5C0X G;  3I4N H;  3E0E A;  4B3T Q;  1Q1B A;  3WWV A;  1RL2 A;  4A3K H;  2RHQ B;  3S15 H;  1AE3 A;  5M3M G;  1X55 A;  2AHO B;  4DV3 Q;  2CKZ B;  1B7Y B;  1OXT A;  5GAH C;  2VQE L;  3RLO A;  1IBK L;  4A3B G;  2RCN A;  2KHJ A;  1KRT A;  4GKK L;  3RN2 A;  2VW9 A;  4DV4 L;  4NXN Q;  1SR3 A;  4A3F H;  5GQO A;  3TRZ A;  2UU9 L;  4R4Q A;  1YVC A;  5H1S E;  2E2J H;  4OO1 G;  1Z47 A;  2OTL A;  1O7I A;  1TWG H;  3IRB A;  3OYY A;  3G6E A;  2OWO A;  4BBR H;  1R9T H;  1FL0 A;  2JEB I;  4GOP A;  2HHH Q;  2WP8 J;  5GAE C;  4BA2 I;  1KL9 A;  4DR2 L;  3PGZ A;  3CW2 C;  4C3J H;  1VQ6 A;  4GLA C;  2OCE A;  3KOJ A;  4YCU A;  3T1H L;  1BBU A;  1SRO A;  4LFA Q;  1XNR Q;  1SMX A;  3FHW A;  4R4T A;  3K7A H;  2UUA L;  3TS2 A;  5M3M H;  4AYB G;  1NJI C;  3UDI A;  3CC2 A;  2Q2H A;  4DV0 Q;  1K3R A;  1K8G A;  2E2H H;  2JEA I;  4A3B H;  1UE5 A;  2PQA B;  4DKA C;  4QY7 A;  1X3E A;  4BY7 G;  3CAM A;  1EQQ A;  4JCV E;  3PUY A;  3RLF A;  4BA1 I;  3GTJ H;  3HOV G;  3HKZ G;  4LUV A;  5LMN L;  1UE6 A;  1U5K A;  3S2H H;  4DR3 Q;  2N78 A;  2WFW A;  3K80 C;  3DLL A;  3PSI A;  4K0K L;  1UWV A;  1X65 A;  1QZH A;  1YHQ A;  3M3Y H;  3S1Q H;  4LUZ A;  1VQN A;  2VZA A;  5HGQ A;  1I94 L;  4JI7 L;  1YI2 A;  3HFZ B;  4KHP Q;  3A5Z B;  1X3F A;  4DAM A;  3B6Y A;  4B3M Q;  4IPC A;  4P71 A;  1AH9 A;  2WAQ G;  4B3S L;  2R93 G;  3ERS X;  1NE3 A;  4BY7 H;  1VQF A;  1Y14 B;  4NPS A;  2LXK A;  3BZC A;  3GO5 A;  2UUB L;  3GTO H;  1IYJ B;  3EBE A;  1S40 A;  1XMO L;  5HY6 A;  4X66 L;  3HOV H;  1RIP A;  1Q8K A;  2WB1 G;  3M9B A;  3ICE A;  3L0O A;  2D62 A;  4DUY Q;  2ZM6 L;  1EYG A;  1E3P A;  2B3G A;  3U4Z A;  4L5Q A;  4BY1 G;  4A76 A;  1YHB A;  4JI6 L;  2N3S A;  4DNI A;  1HNX L;  3J7A 5;  2PI2 A;  4JV5 Q;  3GTM H;  1K9M C;  2AKW B;  3HOX G;  4JI1 Q;  1HR0 W;  4QL5 A;  4DV2 Q;  1E7Z A;  4DPG A;  4HIO A;  1IXR A;  4YHH L;  1MJE A;  1VQ4 A;  4JI8 L;  4DR7 Q;  2HIX A;  2CCZ A;  3J7Z C;  4LFB Q;  3I2Z A;  3RR5 A;  3S24 A;  2CWP A;  3KFU A;  4WJ4 A;  5ELO A;  4LNQ A;  5FJ8 G;  4OX9 L;  1PVO A;  3AFP A;  4BXX G;  4DR6 Q;  3M4P A;  4AH6 A;  2IX1 A;  2HQL A;  1Y1W G;  1OTC A;  4LF8 Q;  1P8L A;  1K8A C;  1XMQ Q;  2NN6 I;  4QIW E;  2QGQ A;  2DUD A;  4X65 Q;  3CCS A;  1EIF A;  2K75 A;  1YEZ A;  3CP0 A;  4DR1 L;  3S14 H;  1WCM G;  1LUZ A;  4YCW A;  3I4M G;  5JJL A;  2F3I A;  4IO9 A;  3CCJ A;  4RG1 A;  2OQ0 A;  3STB C;  2NZO A;  1HNW Q;  3CPW A;  1UE7 A;  1VQI A;  3HOX H;  1PH4 A;  3M7N A;  2ALY B;  4Y52 H;  3EN2 A;  4EQ5 A;  1PH6 A;  3KF6 A;  3NEL A;  1PH3 A;  1J5E L;  1BBW A;  5IYC H;  1UE1 A;  4P75 A;  4LF7 L;  4JI2 L;  5C0X J;  4A3E H;  3D31 A;  2VL6 A;  2B63 G;  4MTN A;  4BXX H;  5IWA Q;  3RZD H;  3HOZ G;  4A3D G;  4GKJ L;  1JJG A;  1CKN A;  4IPG A;  3AQQ A;  3W1B A;  1EIY B;  1ASY A;  1MIU A;  1N32 Q;  3CQZ H;  2D0P A;  4GLX A;  1VQC A;  4NXM L;  1WCM H;  4A3G H;  1SN8 A;  3PUV A;  4DV6 Q;  4LFC Q;  4HJ9 A;  3S17 H;  3A5U A;  5IYD H;  4MNO A;  1G29 1;  2E2I H;  1YJN A;  1Q12 A;  2BA0 A;  1VQH A;  5M3F G;  1KD1 C;  4A3C G;  2GVB A;  1WJJ A;  2JJQ A;  4OON A;  4X62 L;  2UXB Q;  1K73 C;  1IBM L;  4A3J G;  1K0R A;  2ASB A;  3CCL A;  1N34 Q;  1HR0 Q;  2I5M X;  2OQK A;  3CCE A;  5JJK A;  1JT8 A;  1IBL Q;  4B3T L;  1G6P A;  4DV7 Q;  3PF4 A;  1Q1E A;  2B63 H;  5LMN W;  5LMU L;  3BZK A;  1XJV A;  4DV3 L;  3HOZ H;  3K7U C;  4IJH A;  4P72 A;  3OTO Q;  2K5N A;  2R6G A;  1M90 C;  5GAG C;  2JA9 A;  2GVA A;  1N8R C;  3E9I A;  3SGI A;  5AJ3 Q;  2IY5 B;  4ALP A;  3HKZ E;  4POF A;  5JEA G;  2Y0S E;  2CQO A;  4JOI C;  3KJO A;  2EQS A;  4DV5 Q;  1C0A A;  1EUJ A;  4IOA A;  4A4I A;  4C3H H;  1FJG Q;  1L1O C;  3AFQ A;  2XGT A;  4HJA A;  4LF6 Q;  4A3C H;  1PYB A;  2R92 G;  3H3V H;  3TS0 A;  1W2B A;  1XNQ Q;  3TRE A;  3AYH B;  4A3J H;  1CKO A;  4LF5 Q;  5IE8 A;  3CCQ A;  3KF6 B;  1VQM A;  2JA6 G;  3H15 A;  2MO1 A;  2HIV A;  4B3R Q;  1J6Q A;  2QA4 A;  4O2D A;  1JJC B;  5IP9 G;  4IFD I;  4DV0 L;  2A19 A;  4TQU S;  4LF9 L;  2Z6K A;  3GTL H;  2UU9 Q;  1CKN B;  3PUZ A;  2Q2I A;  2FXQ A;  4A3I G;  4JI5 L;  2F4V Q;  4HJ8 A;  1A63 A;  4JI0 Q;  4DR3 L;  3T1Y L;  2YTY A;  1Q81 C;  1TWA H;  5IYB G;  5C3E G;  4DR2 Q;  3PIP A;  1MKH A;  3A0J A;  4POG A;  3OW2 A;  1N36 Q;  5FLM G;  3U50 C;  4JI4 Q;  2NN6 G;  1Q86 C;  2AMC B;  2UUA Q;  4H02 A;  3NEN A;  2VQF L;  4DR5 L;  2JA6 H;  1PH1 A;  4B3M L;  2YTX A;  5IP9 H;  1Q82 C;  2VUM G;  4OXP A;  1PH9 A;  2DGY A;  3RLN A;  2LSS A;  2UXC Q;  2JE6 I;  1H95 A;  1KQS A;  1JMC A;  1Y1V G;  2E5L L;  3RZO H;  1PH2 A;  5LMN Q;  3CXC A; 
#chains in the Genus database with same CATH topology
 3C2P A;  4U67 3;  1DCZ A;  1C7Y A;  4OWT B;  1M4V A;  1RHP A;  4C1N I;  4QF4 A;  4N8X 1;  3K0X A;  5FLM H;  4DR7 L;  4IJL A;  1TQO A;  2NN6 H;  1C4Q A;  1TS4 A;  1L0X B;  2JA8 B;  3NTK A;  1D7Q A;  2YTV A;  4DR6 L;  2R93 H;  2B2V C;  2AWN A;  4K6L A;  3P7J A;  1Y1V H;  2WKC A;  3HOU G;  4FF1 A;  4RKL A;  5C4J H;  1KNE A;  1BF4 A;  3PO3 B;  4K2K A;  2B29 A;  4NB3 A;  2K5Q A;  1SYC A;  2Z9H A;  1JCK B;  4V19 0;  3NBH B;  2Q2U A;  4JYA Q;  1JOQ A;  4TVA B;  2E8G A;  3HOW G;  1QVG A;  5IT9 L;  5M5Y B;  2O5I C;  4A3M G;  1IYU A;  3UI2 A;  3MEF A;  3KDF A;  4PMW A;  2EJF C;  1V43 A;  1SNC A;  2NTT A;  2BE5 D;  4DF7 A;  3L9A X;  4DNR B;  1N32 L;  2KBN A;  4CGY B;  5C5L A;  5DLQ E;  4YY3 L;  5CMD A;  1DJR D;  4QIW B;  1GO3 E;  4RGN A;  4R4I A;  1DD2 A;  4DU9 A;  4PZ6 A;  3T56 B;  3M4Q A;  5G3L D;  4UP9 A;  1IKL A;  1N34 L;  3K5O A;  1Q46 A;  4HJ5 A;  1GHK A;  1FNU A;  4CDC C;  1GUT A;  3BU2 A;  1PFS A;  1PH5 A;  1SYE A;  1XYI A;  4NXN L;  1EYD A;  1HHV A;  3HS0 C;  1JB3 A;  5E4W C;  1QUQ A;  3TQY A;  1KRS A;  1HFN A;  1WTP A;  3UE1 A;  4GLV B;  2XWB B;  4C3J G;  1NBW A;  4X62 Q;  5M3F H;  2EPB A;  4F7X A;  3VR2 A;  1EEF D;  1XNR L;  1U4L A;  3D4W A;  5LMU Q;  3I4O A;  1IBK Q;  3PIO A;  2XN9 C;  2EJM A;  2OF1 A;  4GKK Q;  4DV4 Q;  1D8L A;  1EIG A;  3J80 c;  1E1T A;  4JBM A;  2E2D C;  3K59 A;  1EQT A;  4FF4 A;  5A2Q L;  3GTQ H;  3GTO B;  3CHB D;  1GOZ A;  4FVM A;  3KBX A;  2G9D A;  1ROD A;  1AZQ A;  1D1I A;  2EY5 A;  2K5V A;  1F9S A;  2Y0S B;  1VQJ A;  4LWC A;  4ILW A;  2JQO A;  3FEW X;  1Y8N B;  1Q8I A;  2MHV A;  1IW7 D;  3CRK C;  3R2T A;  1B3Q A;  1OXS C;  4KD3 A;  4R4C A;  3U58 A;  1O7Z A;  1T9H A;  1HZC A;  4BS9 A;  1SDF A;  4F87 A;  3URY A;  1MSH A;  1B50 A;  4MZ9 A;  2PMZ E;  1PRT F;  2BH8 A;  4DUY L;  1E1O A;  4KHV A;  4BBS G;  2A69 D;  3BVM A;  4JI7 Q;  4JI1 L;  5EAY A;  2D2C C;  1M1K C;  3HOX B;  1STB A;  1I4X A;  4JG2 A;  2N55 A;  1BCP F;  2R7Z H;  4J15 A;  1I50 H;  2K50 A;  3C1E A;  1STG A;  3CXC A;  5IOD A;  1CA6 A;  4AIM A;  4GN5 A;  1LTS D;  4HIK A;  1PH8 A;  3MA2 B;  3EIV A;  4HIM A;  4OHJ A;  2F03 A;  2YU9 H;  3VYU A;  2BA1 A;  2DY7 A;  4YHH Q;  1HTP A;  3TN2 A;  1PZI D;  3LNN A;  4DFA A;  2UUC L;  3T51 B;  5J39 A;  2J7Z A;  1I4R A;  5COR A;  2QEX A;  3Q0A A;  2E2I B;  4A3E G;  4WJW A;  2K32 A;  1X6O A;  1LYL A;  1X9N A;  1I4P A;  4FP5 D;  2ZTD A;  2JYO A;  1IYV A;  3CMA A;  3L7Z C;  1LAC A;  5CYU A;  3R2I A;  3L2P A;  5JJI A;  3I7F A;  4PV1 C;  2JA8 H;  4FF3 A;  1EY5 A;  4I7Z C;  1HZA A;  1S5C D;  1H9S A;  5FO8 B;  5C5M A;  1BOS A;  1BO0 A;  2Z6K C;  1JQY D;  1VQ8 A;  3I4N G;  3DM1 A;  1XPR A;  1L1O B;  5FKA C;  1EY7 A;  4QUF A;  3PO3 H;  1JIC A;  1U4P A;  4HR7 B;  4FF2 A;  1EQV A;  1CZG A;  1JOK A;  2I5H A;  5M3M B;  4FNF A;  5AJ3 L;  3TDQ A;  4YY3 Q;  1PV4 A;  5I2Y A;  1JE4 A;  1WYD A;  1K28 A;  3GTL B;  3P1H A;  3E9H A;  5M5Y H;  1O80 A;  2K5H A;  1PRT C;  2KA7 A;  5FO9 B;  4S3S A;  2PNR C;  4GNX A;  3C3L A;  1HPC A;  1KLG D;  1S5E D;  4GN3 B;  4TRD A;  2I0Q A;  3K81 C;  1HQR D;  5EJW A;  2PZW A;  2A6E C;  2RHQ B;  1AE3 A;  1LO5 D;  2CKZ B;  4A3B G;  3P20 A;  1STY A;  4NXN Q;  1BCP C;  5K36 H;  1STA A;  1ZYR C;  5GQO A;  3TRZ A;  3VYT A;  4R4Q A;  1YVC A;  2RVL A;  5H1S E;  1Z47 A;  1PYW D;  2OWO A;  3RZO B;  2WP8 J;  5GAE C;  4ID6 A;  4ZYS A;  2X6G A;  3PGZ A;  4WFN 3;  1G8Z D;  2NBF A;  4GLA C;  2OCE A;  4YCU A;  1QJO A;  2R3Z A;  3T1H L;  3TP8 A;  1SRO A;  1XNR Q;  2O2L D;  1CHQ D;  5C3X A;  2FMC A;  3DMU A;  3CC2 A;  2Q2H A;  4DV0 Q;  1DM0 B;  2WII B;  1K8G A;  1D5Z C;  3V05 A;  1ONL A;  4BY7 G;  1G2T A;  4QY7 A;  3CAM A;  1X32 A;  3V96 A;  4JCV E;  4HED A;  3RLF A;  3HKZ G;  1TU2 B;  2WAQ B;  5KND A;  3J81 E;  2VUM B;  4RGO S;  2HCC A;  3A8J E;  4QMG A;  4K0K L;  2EYL A;  3MXP A;  5HGQ A;  1GUW A;  3SE0 A;  1YI2 A;  4BY1 B;  2RQX A;  3BDL A;  1VQF A;  3GTO H;  4NPS A;  2LXK A;  2EOT A;  2DNC A;  3GO5 A;  4ZKC B;  3EBE A;  1LTR D;  4PQX A;  4DUY Q;  2ZM6 L;  4IUN A;  4IZ8 A;  4N8F A;  1W6J A;  4ZCK A;  4C1N K;  5IGD A;  1Y1W B;  2RCF A;  4QCL A;  3HOU B;  4DNI A;  1ENC A;  5KNC A;  1MD2 D;  4JI1 Q;  1HR0 W;  4QL5 A;  3Q22 A;  1IXR A;  1FD7 D;  2K05 A;  1VQ4 A;  4K8I A;  3I4M B;  1ILQ A;  1E2W A;  3J7Z C;  3S24 A;  3AMU A;  4OX9 L;  4AH6 A;  3NE5 B;  3VYS A;  5IIF A;  2TMP A;  1QOH A;  4QIW E;  3X3M A;  3CCS A;  2F0G A;  2PQE A;  2F0E A;  4DR1 L;  3SVM A;  3VR5 A;  1LUZ A;  4RGT A;  4RG1 A;  2OQ0 A;  1EYA A;  3HOX H;  3EN2 A;  1F2L A;  2BDN A;  3NUC A;  4IN3 A;  3BVG A;  3ND9 A;  3BS1 A;  5IYC H;  1JWM D;  1II3 A;  1BQQ T;  3CKI B;  5ELE A;  2NUC A;  1DOL A;  2D0P A;  4GLX A;  4KK7 A;  4U68 A;  1EY9 A;  1A6X A;  3PUV A;  1SYF A;  4LFC Q;  5JVG 3;  3A5U A;  2ZXO A;  4MNO A;  1G29 1;  4TSS A;  2E2I H;  1YJN A;  1VQH A;  2AUK A;  1SYG A;  1WJJ A;  5IGF A;  4A3J G;  3I90 A;  1K0R A;  1JT8 A;  3NTI A;  3KBG A;  1D1K A;  1IBL Q;  1Q1E A;  2FMM A;  1XJV A;  2E76 C;  1CI3 M;  4DV3 L;  3K7U C;  4CDF C;  1PTO D;  2JA9 A;  2GVA A;  3DWA A;  5AJ3 Q;  3NPP A;  3GTK B;  4POF A;  2RSN A;  1CZW A;  5JEA G;  1MGS A;  2Y0S E;  1TWC B;  2EQS A;  1C0A A;  2F3V A;  1FJG Q;  3A56 A;  3H3V C;  4XDX A;  3CU7 A;  4LF6 Q;  1PYB A;  3SR1 A;  2R92 G;  3TS0 A;  2MGS A;  1W2B A;  3TRE A;  5IE8 A;  3CCQ A;  3KF6 B;  1ZXT A;  5EKI A;  1J6Q A;  4HCE A;  4TQU S;  2FHT A;  3GTL H;  1CKN B;  3PUZ A;  1AZP A;  4OIJ A;  4KD4 A;  4IUV A;  4HJ8 A;  4OO1 H;  2A68 D;  3T1Y L;  1AN8 A;  1Q81 C;  5IYB G;  5C3E G;  3OIQ A;  1MKH A;  3A0J A;  5DAU A;  1Q86 C;  2AMC B;  5M5W B;  4NDX A;  4BBS B;  1A2U A;  4CDD C;  1SND A;  1PH1 A;  4B3M L;  1S5F D;  4O1N A;  1Q82 C;  3H94 A;  1H95 A;  2LSS A;  2EYM A;  1JMC A;  3RZO H;  1EY0 A;  4ME3 A;  2GN5 A;  1X56 A;  3GTG B;  1K0S A;  1VS0 A;  3MEH A;  5J3B A;  1E2Z A;  5JPN C;  4IAL A;  4JV5 L;  4A93 G;  3KF8 B;  4L5T A;  3NQT A;  5D65 A;  4LF4 L;  1X3G A;  2CHB D;  4LFB L;  2ID0 A;  4RHR A;  3DEO A;  3F8T A;  3W2D A;  1A62 A;  1U0L A;  1A8V A;  2VUM H;  1BBX C;  5EPL A;  4B08 A;  1BKB A;  4IOC A;  3CCR A;  5CBE E;  2NVX B;  1NAP A;  2ZM6 Q;  4R8N A;  5I9P A;  1GM5 A;  4YWK A;  4H44 C;  2Q8I B;  4K5V A;  4BY1 H;  2N8N A;  1HNW L;  4UP7 A;  2F0W A;  3NBI A;  4K2L A;  4A3L G;  1NMG A;  2Z6B A;  3UE0 A;  3TZD A;  4ODG A;  3HKS A;  3K57 A;  4OX9 Q;  3KLS X;  1HNZ L;  4ZUI A;  2PZU A;  4LMQ D;  1PRT B;  2PYK A;  4DV1 Q;  1F9P A;  2D9U A;  1Y1W H;  1X3P A;  5FO7 B;  3HOU H;  3P75 A;  1TY2 A;  2EY6 A;  3STB D;  3A55 A;  3CME A;  3I4M H;  4DV6 L;  3I70 A;  4Q0F A;  4WOR A;  1B44 D;  3A7A B;  5DNF A;  2E2J B;  4KMU C;  1BCP B;  4RMF A;  5EKK A;  2M9V A;  1NTG A;  2SEB D;  3RUZ A;  3R93 A;  3CCU A;  1KAB A;  3HOY G;  4A3M H;  1N33 Q;  4DV7 L;  1NY4 A;  1G91 A;  4A3F G;  3U9S A;  3CCV A;  2CW0 C;  1DGS A;  1JC7 A;  2F0S A;  4A3B B;  3TZU A;  3D0F A;  4K5X A;  1A2T A;  1YNN C;  1JB7 A;  4CBV A;  4HJ7 A;  4JBK A;  1VQG A;  4LAA A;  2IHF A;  2X6L A;  1EQR A;  2QF7 A;  4UP8 A;  5C44 G;  3Q8D A;  4LF5 L;  3S1Q B;  1V8Q A;  5CV8 A;  2WAC A;  4B3R L;  2WAQ E;  1CQF A;  3D6W A;  1WI5 A;  2K14 A;  1QZG A;  3K5N A;  4F88 A;  4HID A;  4XQQ A;  1ICW A;  2AQ3 B;  1YBY A;  2F4V L;  2XRQ D;  5COY A;  4BY7 B;  2B8G A;  1FVI A;  3J7A F;  1QVF A;  3F2D A;  1TWF H;  3PV0 A;  3W5O A;  4JW0 A;  4HN7 A;  1NCV A;  3HKZ B;  3F2U A;  3BG3 A;  1N36 L;  3WOF A;  3SK8 A;  1W3S A;  2F0P A;  1YNJ C;  4JI4 L;  1BUV T;  1TXY A;  1VQD A;  2QIL A;  1KC8 C;  2V1C C;  1B1Z A;  3GTK H;  1TWC H;  3ULL A;  4R8I A;  2AWO A;  4PZ7 A;  1VQO A;  4QQB X;  4C3I G;  3ND8 A;  5C0X I;  3T13 A;  3T1Y Q;  5BN3 A;  1F77 A;  2Z0S A;  1PA6 A;  1ZEQ X;  2F0M A;  1I94 Q;  1IKM A;  2CWA A;  3J7A V;  3A7L A;  2FJ2 A;  2NVY H;  1L1O A;  4G4K A;  4XYQ A;  1SE8 A;  3EA6 A;  2A6H D;  1EWI A;  4CJ0 B;  4KN4 C;  5E1F A;  1F9Q A;  2UUB Q;  3J81 c;  1SLJ A;  1XMO Q;  2BH2 A;  1XMQ L;  1DOK A;  2IW3 A;  3K8A A;  5EBC A;  3TP6 A;  3JAM E;  4CKE A;  3KYH C;  3I72 A;  1G2S A;  4I65 A;  1XPU A;  5M5W H;  3CQZ B;  4BBS H;  3A74 A;  2P5Z X;  4GOP B;  4A3G B;  5IP7 G;  4LF4 Q;  5EQ0 A;  3J80 i;  1V1P B;  2NZ1 D;  3NHH A;  3C46 A;  2KHI A;  1I6V C;  3KK7 A;  3GTG H;  4O0A A;  4OWX B;  3U4V A;  2AQ2 B;  5IWA L;  3OOC A;  3T4A C;  4CDE C;  4J8Q A;  5TSS A;  1PH7 A;  4KHZ A;  5ELF A;  1SMY D;  2MFI A;  4OEL B;  5IYD G;  5IGE A;  4DUZ L;  4DR4 L;  2UXD L;  5EGT A;  4X64 L;  1YIT A;  2LY7 A;  1MSG A;  2K04 A;  1RKN A;  1IZ6 A;  3H91 A;  1JOR A;  4KKT A;  1HNZ Q;  2K5D A;  4JI2 Q;  1F2Z A;  1UEB A;  1A3U A;  3K6O A;  1KAW A;  2NVX H;  1SRU A;  4JI3 L;  4GKJ Q;  4ZK9 B;  4DNT B;  4A3J B;  1NUC A;  5C6A A;  4CKB A;  1D5X C;  5LHY 1;  1J9O A;  2DY8 A;  1HA6 A;  1PZJ D;  1TII D;  2B2V A;  2A5H A;  4DV5 L;  2H1E A;  2ZJP A;  1V1Q A;  5J22 A;  5KIX A;  2G9H D;  5C0X G;  3I4N H;  4B9X A;  3E0E A;  1Q1B A;  1SE3 A;  1RL2 A;  3QG1 A;  2AHO B;  4KY7 A;  2K03 A;  1ENA A;  5GAH C;  2VQE L;  1T5E A;  3N52 A;  2UU9 L;  4HAE A;  4AYB B;  2E2J H;  1HFG A;  2OTL A;  2ZXP A;  3OYY A;  1EZ6 A;  2HDL A;  4DGZ A;  1X3Q A;  3G6E A;  1FL0 A;  2JEB I;  1SJE D;  3FVQ A;  2EYF A;  1ET9 A;  1STH A;  5C3E B;  5G3L F;  3S1R B;  4C2M B;  3TS2 A;  4G7Z C;  1B9M A;  1ZYR D;  1B3A A;  2HUG A;  2JEA I;  3D3R A;  1K3R A;  5ELB A;  4A3B H;  1TS2 A;  2E75 C;  3MFG A;  1S5B D;  4X3U A;  1EQQ A;  3SK6 A;  5ELC A;  4BA1 I;  2CVR A;  3HOV G;  2GA4 B;  1WTO A;  1UE6 A;  1U5K A;  2N78 A;  4OL7 A;  3I91 A;  2WFW A;  1CHP D;  1EOT A;  3GP7 A;  1X65 A;  3S1Q H;  3Q23 A;  4LUZ A;  5K5P A;  1VQN A;  2WB1 B;  1LT3 D;  1HTL D;  1TWH B;  5I9O A;  3A5Z B;  4J6H A;  4KY6 A;  4P71 A;  1AH9 A;  3QOL A;  4A93 B;  1NR4 A;  2R93 G;  3ERS X;  1EY4 A;  1NE3 A;  4BY7 H;  1Y14 B;  3I8Z A;  1HQM C;  1RIP A;  3M9B A;  1EYG A;  1V1O A;  5IT9 E;  2B3G A;  3QJY A;  1UNS A;  4L5Q A;  1SFO B;  1ILP A;  1KDB A;  1HNX L;  1O78 A;  4HIO A;  1E7Z A;  3I73 A;  4DPG A;  1MJE A;  4JI8 L;  1ZKO A;  3LWU A;  1FYC A;  3E3X A;  4H7B A;  4HMJ A;  4DR7 Q;  3I2Z A;  2CWP A;  4WJ4 A;  1XX8 A;  1BR9 A;  5C4H A;  4G7H C;  3AFP A;  2XRS D;  3M4P A;  4DR6 Q;  5EPK A;  3DEP A;  1CTM A;  4BWG B;  4MIU A;  1XMQ Q;  1K8A C;  1TS5 A;  2OEO A;  2IWH A;  1DZ1 A;  4PNY A;  4HTH A;  3CP0 A;  2XSC A;  2B2U C;  4A3D B;  1WCM G;  2JP1 A;  4RCN A;  2F3I A;  3CCJ A;  5D3I B;  1FNV A;  4EQ5 A;  1KDA A;  3KF6 A;  1F2Y A;  3D4R A;  2RDF A;  1J5E L;  4LF7 L;  2WV6 D;  2OXP A;  2MP1 A;  3D31 A;  3O13 A;  2F0N A;  5EKL A;  4MTN A;  2B63 G;  5IWA Q;  4HSP A;  1CKN A;  3W1B A;  1EIY B;  1N32 Q;  3CQZ H;  3SXH A;  4DXF A;  2NVT B;  4NXM L;  1W6K A;  4A3G H;  1SN8 A;  4NP5 A;  3K5L A;  4HJ9 A;  4EGV A;  4C3H G;  1Q12 A;  2BA0 A;  2K33 A;  4L6T B;  5M3F G;  4A3C G;  2B2T C;  2JJQ A;  1K73 C;  1IBM L;  5HUR A;  2ASB A;  3CCL A;  1N34 Q;  2OQK A;  3CCE A;  1B4O A;  1ICF B;  4B3T L;  5CR3 A;  2EE1 A;  3VA5 A;  3G7L A;  5A2Q E;  1GUN A;  3AU7 A;  5IGG A;  2R6G A;  5C44 B;  2R61 A;  3E9I A;  2IY5 B;  3HKZ E;  1LTA D;  5I2X A;  2ZT9 C;  4DV5 Q;  1EUJ A;  4IOA A;  3U9O A;  3G6J B;  1LT4 D;  4L63 B;  4HJA A;  4A3I B;  3H3V H;  2VB3 X;  3Q6S A;  4A3J H;  3J80 L;  1CKO A;  1JWU D;  1EZ8 A;  4RCO A;  4Y7N B;  2MO1 A;  4FYD A;  2HIV A;  3MC0 B;  1Y8O B;  3S1N B;  3FMC A;  4O2D A;  4IFD I;  5IP9 G;  4DXG A;  2Q8R E;  4LF9 L;  2Z6K A;  2UU9 Q;  1O7Y A;  3Q24 A;  1IW7 C;  2FXQ A;  3FRP B;  1K83 B;  4JI5 L;  1GUO A;  5JEA H;  2QCP X;  4K6D A;  4DR3 L;  5BN4 A;  2F0T A;  2Z4H A;  2YTY A;  4C3I B;  5JOB A;  3PIP A;  2F0H A;  4POG A;  3U50 C;  1UAP A;  2A69 C;  1PLF A;  3ZYY X;  3NEN A;  3OPO A;  2VQF L;  4DR5 L;  4XXE A;  3TP5 A;  2DGY A;  4KKS A;  2JE6 I;  1KQS A;  3IKJ A;  2HQE A;  2ATW A;  1SE4 A;  4WJ3 M;  5ISR A;  3MXN B;  1A15 A;  1KNA A;  1QUQ B;  1I4H A;  2CH4 W;  4XT1 B;  2QKI C;  3T16 A;  5C3E H;  2KQ3 A;  3S1R H;  4C2M H;  5E4X A;  3ZJY C;  1HZB A;  2RSO A;  2XWJ B;  2MJ8 A;  1CSQ A;  1QNU A;  2JN4 A;  1VQ5 A;  1H9K A;  4RH6 A;  3OSO A;  3HOW B;  3SDZ A;  4G57 A;  1I6H B;  4ZUJ A;  5JVH 3;  3H6M A;  3DM3 A;  1HRJ A;  1KAA A;  2L4N A;  2JA7 G;  3JC6 6;  5CV4 A;  3MWY W;  3SEB A;  3QWN A;  4A3M B;  3S16 B;  3PO2 G;  4YWL A;  3RD4 A;  3BZD B;  1TWH H;  4I7A A;  1WTH A;  5CV9 A;  1P16 A;  4HMI A;  4A93 H;  2UUC Q;  4R1J A;  2R7D A;  5FK9 C;  1CT1 D;  1GD7 A;  2YYZ A;  1K8O A;  4IUR A;  1VQP A;  3ER0 A;  4CJ1 B;  2D0O A;  1I4Q A;  2K5W A;  5FJ8 H;  1SFO H;  3KJP A;  2MQH A;  3PUW A;  3JAM c;  3S15 B;  3I56 A;  2KCC A;  4GOP C;  1STE A;  1SAP A;  1EU4 A;  2PI2 E;  5GRO A;  5JEA J;  2NZH A;  2VS1 A;  1KXL A;  5BR8 L;  3NEM A;  1XWE A;  3H0G G;  1DYQ A;  1OXU A;  1KIX A;  2KEC A;  2TSS A;  4YWM A;  4IFD G;  1CUK A;  4A3L H;  5E7N A;  1CSP A;  1GUG A;  3CRL C;  1TWF B;  1N9W A;  4EQN A;  1HR0 L;  1ET6 A;  2K4K A;  5LL6 S;  4AYB E;  4C3J B;  2KCM A;  3F2B A;  4A3D H;  3D4D A;  3G71 A;  2ZTE A;  2I46 A;  1R4P B;  2LS0 1;  3K7A B;  4NXM Q;  1NR2 A;  2L9H A;  1OXX K;  2F0F A;  1JJ2 A;  2SDF A;  3TEH B;  1LLR D;  5NUC A;  2CFM A;  4NW2 A;  2SOB A;  3GTJ B;  1EY6 A;  2HHH L;  3PIO 3;  1XNQ L;  4TKO B;  2I5L X;  1RDP D;  1AFP A;  2XVS A;  4LFA L;  3M3Y B;  3FDT A;  3NTH A;  3HOY H;  2NVT H;  1TS3 A;  3UDG A;  2ICI A;  2CW0 D;  3F1Z A;  3FKI G;  4DK6 C;  2K6A A;  1WOC A;  2NVY B;  1Q90 A;  1D5M C;  4JC0 A;  2Q2T A;  1LAB A;  2PCF B;  2WB1 E;  4GS3 A;  3RNU A;  1H9R A;  1H9J A;  4JI0 L;  3NBH A;  4IPH A;  1PYS B;  2BCO A;  3HOV B;  4YIJ A;  4FDB A;  1VQ7 A;  2BDO A;  4P2C B;  3GDE A;  3ULP A;  1V1P A;  3MFY A;  3EFX D;  3TME A;  3T1H Q;  4KV6 A;  2DN8 A;  5C44 H;  1HJP A;  2EXD A;  1DXM A;  3GTM B;  4KHP L;  3WOE A;  1PFB A;  1VQK A;  1NMF A;  1QNK A;  3IL8 A;  1NNX A;  2JK8 A;  4LF9 Q;  2JA5 G;  2KHS A;  3TSS A;  2UXC L;  1PTO F;  4JI5 Q;  2F0K A;  1VCI A;  4A3I H;  2Y0S G;  2ES2 A;  1STN A;  5IGC A;  2NTS A;  1LT6 D;  3SHL A;  3IAY A;  2R7F A;  4K0K Q;  2JXM B;  1WFQ A;  5IOC A;  4GZY C;  3I4L A;  4Y7N H;  4DA2 A;  3S14 B;  1YZ6 A;  3MZ5 A;  3S1N H;  4ZRZ A;  4DV2 L;  1A3T A;  4OO1 I;  4GNX B;  2VQF Q;  2EYH A;  4DR5 Q;  5C4X G;  2EIF A;  1XTD A;  1WTR A;  1K83 H;  1CFM A;  2KEN A;  2NB0 A;  5FLX L;  1HCZ A;  2K28 A;  5E3F A;  1VQB A;  4LF8 L;  1FGU A;  4C3I H;  4A3E B;  1QB5 D;  1VDZ A;  1SEB D;  1CKM A;  3RZD B;  4A75 A;  2M00 A;  2OTJ A;  1GUS A;  1SNO A;  3DUZ A;  2Q8T A;  4GN4 B;  5KNB A;  2EY2 A;  3GQB A;  2K7V A;  5FOB B;  1WCM B;  3S17 B;  1WD1 A;  1Z9F A;  1BVS A;  1AE2 A;  5IYC G;  1EYC A;  4RHS A;  3M85 A;  1YJW A;  3TP7 A;  3FP9 A;  3L3O C;  2MO0 A;  3ITP A;  2LFN A;  3NWT A;  5IY0 A;  2CQA A;  5IT9 c;  3I4N B;  4QJF A;  3QIA A;  4LUO A;  4IPD A;  4L8J A;  4DAY B;  4DR1 Q;  2B63 B;  4X3S A;  4JVZ A;  4L5R C;  2EXZ A;  3I55 A;  1L0Y B;  5KYI A;  1B53 A;  3VR6 A;  2A1A A;  4OGQ C;  2EZV A;  2XTI A;  5IP7 H;  2HDM A;  3GV6 A;  3HOW H;  4C3H B;  1I6H H;  2UXB L;  5I6W A;  1K3B C;  1DON A;  2B2Y C;  3CC7 A;  1LTL A;  3HGB A;  3V2T A;  4A3K G;  3S16 H;  1GVP A;  1VQA A;  1S72 A;  3PF5 A;  3MHB A;  4OWW B;  1HH2 P;  2L55 A;  4H0L C;  4KTA A;  1PTO C;  4RFB A;  4KJN A;  2RHS B;  5BR8 Q;  2IX0 A;  4BBR G;  2ZTC A;  4P74 A;  1WTX A;  1EU3 A;  4P73 A;  1V9P A;  3PUX A;  4J1M A;  3M4Y A;  3J81 i;  3KUP A;  4QGU A;  3PMF A;  4K8J A;  3WWV A;  3S15 H;  1LTB D;  3OIP A;  5M3M G;  1X55 A;  1SYD A;  4DV3 Q;  1OXT A;  2X69 A;  1IBK L;  2RCN A;  4FO2 A;  1WTW A;  4GKK L;  3RN2 A;  2VW9 A;  4DV4 L;  1T5X D;  4OO1 G;  1O7I A;  4IUT A;  1WD0 A;  4LJZ C;  2N88 A;  2HHH Q;  2A68 C;  4BA2 I;  4DR2 L;  4C3J H;  1LTI D;  1CM9 A;  3KOJ A;  3X3N A;  4RA8 A;  1BBU A;  4LFA Q;  1Q3L A;  1SMX A;  1XTC D;  3FHW A;  4R4T A;  3K7A H;  1GXD C;  5CV6 A;  2KJX A;  2E74 C;  3NWS A;  2PQA B;  1X3E A;  3S2D B;  4NMZ A;  3GTJ H;  1BNZ A;  4LUV A;  5LMN L;  1FNW A;  1EL0 A;  1I3Q B;  3DLL A;  3PSI A;  1QZH A;  1YHQ A;  3M3Y H;  2CH4 A;  1H9M A;  4JI7 L;  1GJX A;  3A8K E;  1WTQ A;  2H4O A;  3HFZ B;  4KHP Q;  1X3F A;  4DAM A;  3B6Y A;  4B3M Q;  4IPC A;  5IGB A;  4RGM A;  2WAQ G;  1FR3 A;  5C4Z A;  4B3S L;  1K8M A;  2B8F A;  2DJF C;  2K1B A;  3BZC A;  1IYJ B;  2A74 C;  3MXG A;  1S40 A;  2O4X A;  3HOV H;  5HY6 A;  4X66 L;  2EJG C;  1IHZ A;  2D62 A;  4BY1 G;  4A76 A;  4JI6 L;  2N3S A;  2JA7 B;  3J7A 5;  4JV5 Q;  3GTM H;  1TVX A;  1HA5 A;  1K9M C;  3PO2 B;  4DV2 Q;  4YHH L;  2HIX A;  3A8I E;  1F2M A;  4LFB Q;  2NYZ D;  3KFU A;  5KEE A;  2F0J A;  4NKL A;  4LNQ A;  5J1Z A;  1PVO A;  4BXX G;  2IX1 A;  2MPM A;  1DOM A;  2HQL A;  1Y1W G;  1OTC A;  4ABN A;  1P8L A;  4LF8 Q;  2NN6 I;  2QGQ A;  2DUD A;  2F3W A;  1YEZ A;  3S14 H;  2BOS A;  3I4M G;  5JJL A;  1ENF A;  1BXT A;  3STB C;  1HNW Q;  3CPW A;  1UE7 A;  1PH4 A;  3HEJ A;  4Y52 H;  4CHT B;  1CQV A;  3K58 A;  3NEL A;  1EWC A;  1PH3 A;  1BBW A;  3H0G B;  1UE1 A;  4P75 A;  5C0X J;  1AEX A;  4A3E H;  2VL6 A;  3RZD H;  1JJG A;  3HOZ G;  2EYO A;  4C56 C;  1ASY A;  1MIU A;  3PQI A;  1VQC A;  2NVQ B;  1E0B A;  4WRD A;  4DK0 A;  1WCM H;  5M9O A;  5I4D A;  4DV6 Q;  4RAU C;  3S17 H;  2IJ0 A;  1RF2 D;  2RDG A;  3MTS A;  1KD1 C;  1VMC A;  1SYB A;  2GVB A;  4OON A;  2UXB Q;  1EWH A;  1RCV D;  2PO4 A;  4OIK A;  4G7O C;  5JJK A;  2C9O A;  5DM7 3;  1G6P A;  4DV7 Q;  4Q5V A;  2B63 H;  2R92 B;  4HSV A;  3BZK A;  2F0D A;  1SSO A;  4P72 A;  3HG9 A;  4IJH A;  5KRU A;  2K5N A;  4CKC A;  3S1M B;  5GAG C;  1N8R C;  2AQ1 B;  3SGI A;  1SNQ A;  4ALP A;  5DM6 3;  3MXN A;  2CQO A;  4JOI C;  1PRT D;  2RBM A;  3FKI B;  4A4I A;  4KN7 C;  5F2D A;  4C3H H;  2SNS A;  2XGT A;  3K5M A;  4CJ2 C;  4A3C H;  3NK9 A;  2A6E D;  2RKS A;  3AYH B;  1R4Q B;  4LF5 Q;  4Z9C B;  2JA6 G;  3H15 A;  1TY0 A;  4B3R Q;  1BCP D;  3I3C A;  4DV0 L;  2L12 A;  1HUM A;  4M1U B;  4QB4 A;  2F4V Q;  2B2W C;  4UDU C;  2JA5 B;  4XQJ A;  4X3K A;  1TWA H;  4UHV A;  4DR2 Q;  2J4X A;  3OW2 A;  1N36 Q;  3A54 A;  4KJO A;  5FLM G;  2QEJ C;  3M4O B;  4JI4 Q;  2NN6 G;  2IPK D;  1OO9 B;  4H02 A;  5JJZ A;  2DJG C;  2YTX A;  3HP3 A;  5IP9 H;  1QG7 A;  4OXP A;  3E0J A;  2V4D A;  4HCS A;  5C4X B;  2A6H C;  1Y1V G;  1EEI D;  2E5L L;  3OW7 A;  1KLU D;  5LMN Q;  1PH2 A;  1QE6 A;  2PZT A;  3NQI A;  3CCM A;  3GTP H;  1VQ9 A;  2Z4I A;  4X3T A;  5JPM C;  5M5X B;  1FGB D;  5EPJ A;  3DHQ A;  4JOI A;  1QCB D;  3G4S A;  4X6A H;  2KCN A;  4K5W A;  3J81 L;  2ENB A;  3GD7 A;  2JSO A;  1I5F A;  4EVO A;  3S2D H;  5C3W A;  4B3S Q;  1L2F A;  3ULJ A;  2KUM A;  4IQZ A;  1I3Q H;  2B39 A;  4K14 A;  4DK3 C;  4X66 Q;  4L5S A;  2IX3 A;  3BYY B;  3HZX A;  2XIW A;  4PZ8 A;  4PMC A;  5GAD C;  1U4M A;  4GNX C;  4JI6 Q;  2K01 A;  3M7G A;  4AQY L;  2BE5 C;  2MNA A;  2C5C A;  1SMY C;  1PDQ A;  2B2W A;  2I07 B;  1D2B A;  4PG3 A;  1LM0 A;  4UPA A;  1Z7T A;  1JOO A;  1PTO B;  4ULL A;  2N49 A;  1L0W A;  1ASZ A;  1E22 A;  2SNM A;  3AEV A;  2K52 A;  1LTT D;  1PHJ A;  4A3K B;  2JA7 H;  4M8A A;  4F8M A;  3HOY B;  2KED A;  1WTV A;  1Q7Y C;  3PO2 H;  4DUZ Q;  4DR4 Q;  2UXD Q;  4LFC L;  4A3F B;  4X64 Q;  1OXV A;  4UAI A;  4QUC A;  2VB2 X;  3SK4 A;  1UUP A;  1TWG B;  1C9O A;  4BBR B;  1R9T B;  1F9R A;  1VQL A;  3ERO A;  1IBL L;  2YV5 A;  4JI3 Q;  4EX5 A;  4APV A;  3E6Z X;  2M2L A;  2LXJ A;  1C48 A;  1X54 A;  4H13 C;  2RA4 A;  5ELD A;  2EYJ A;  4XIG S;  2E2H B;  1G51 A;  1Y69 U;  3KLW A;  1YHA A;  1YJ9 A;  1FJG L;  5ELN A;  3H0G H;  4LW1 A;  3WDN A;  3KF8 A;  4IFD H;  1EFI D;  1XPO A;  2B2U A;  4LF6 L;  3S2H B;  3HRZ C;  4MHE A;  3BJU A;  1RTN A;  2F52 A;  3PCO B;  2NVQ H;  2VQE Q;  2F0U A;  1B70 B;  2G5D A;  3MXU A;  3F2C A;  1VMP A;  3KDF B;  2VNU D;  5A35 A;  1O7L A;  2ZJR A;  3LGJ A;  2LMC B;  3AB9 A;  2L15 A;  1TKW B;  1E24 A;  4R4O A;  2IHE A;  1VQE A;  4ZLT F;  3DXJ C;  4XQN A;  1JE5 A;  1AW7 A;  1SE2 A;  2R92 H;  1NSN S;  3JAM i;  2F0L A;  3S1M H;  4XTC S;  2PNH A;  2A8V A;  1CK1 A;  1PXU A;  2B2T A;  3G48 A;  1SBB B;  3T53 B;  3EQL C;  3UDX A;  3H3V I;  3CPF A;  2R7Z G;  4FXK C;  3FKI H;  2H5X A;  4DAY A;  2F0O A;  3K0Y A;  3J81 j;  5KGU A;  2F0V A;  1MJC A;  4KLK A;  2RF4 A;  4JK1 C;  5I6Y A;  1EFW A;  3GV3 A;  5IYB H;  3UDF A;  2L5T A;  1A0I A;  3BVZ A;  4DN4 M;  1KHI A;  1TR5 A;  4B9W A;  3DWQ A;  1GHJ A;  4ZQ3 A;  1PFN A;  2QDL A;  1ESF A;  2HD3 A;  4JBW A;  3S9W A;  2C35 B;  2JA5 H;  2E5L Q;  3FPP A;  2VY3 A;  1YNX A;  1A3V A;  2WKD A;  4FXG C;  1QIL A;  1C8C A;  4YCV A;  4X65 L;  2A73 B;  4JBJ A;  3D6C A;  2WIN B;  2XNA C;  1IL8 A;  3M4O H;  2F1M A;  1IL2 A;  5FLX c;  1HNX Q;  4RKB A;  3CF5 A;  3VDY A;  2JA8 G;  5LL6 X;  3LX0 A;  3NSW A;  4JI8 Q;  2KCT A;  4IFD J;  4MTK A;  1LTG D;  5C4X H;  5CBA E;  3CC4 A;  3BYT B;  3PO3 G;  4DAP A;  4UY8 C;  4DV1 L;  5M5X H;  1GKH A;  4KKU A;  3QB3 A;  3HOZ B;  4A3G G;  4AQY Q;  2O5J C;  1VF5 C;  2F0I A;  3R3O A;  4KI0 A;  1KDC A;  3D8G A;  1LT5 D;  1YIJ A;  1J5E Q;  2IT1 A;  3R8B A;  4LF7 Q;  1U4R A;  2EVB A;  1Z6H A;  1N33 L;  2DNE A;  1JWS D;  2PQA A;  1HZ9 A;  1HUN A;  3RN5 A;  3OTO L;  3CD6 A;  5K36 G;  3QOJ A;  3KLR A;  1EOV A;  5DEH A;  1QVC A;  2F4I A;  3J80 E;  1S3O A;  3DWP A;  1PTO H;  2ZJQ A;  1RJT A;  2KEE A;  2HT1 A;  1EY8 A;  3VYR A;  3W1G A;  4DAV A;  4N9P A;  4IUP A;  1B8A A;  3OWE B;  4XYO A;  1IBM Q;  4B3T Q;  1ESR A;  4A3K H;  2J0T D;  2PW7 A;  1B7Y B;  3RLO A;  1M8A A;  4DK1 A;  2KHJ A;  1KRT A;  1SJH D;  2JA6 B;  2QDB A;  1SR3 A;  3QO2 A;  1LV9 A;  4A3F H;  1YNN D;  1RTO A;  1TWG H;  2LKV A;  3FPU B;  3IRB A;  2KOL A;  4BBR H;  1R9T H;  4GOP A;  3N6R A;  1KL9 A;  1VQ6 A;  3CW2 C;  3MAQ A;  1CA5 A;  1H9S B;  3IFT A;  1I4G A;  3BDO A;  2UUA L;  4N9T A;  4AYB G;  5M3M H;  3UDI A;  1NJI C;  3OMC A;  4EQO A;  2E2H H;  5BN5 A;  1UE5 A;  4DKA C;  5CC4 A;  5KYL A;  2Z1C A;  3PUY A;  1MBY A;  3S2H H;  2R93 B;  4DR3 Q;  2KVM A;  1QWY A;  3K80 C;  5T1I A;  1Y1V B;  1UWV A;  5C4J B;  2FFK B;  1YNJ D;  2VZA A;  1WVL A;  1I94 L;  1MHW C;  4ME5 A;  4PMB A;  3W3A A;  5L37 A;  1MI2 A;  4XT3 B;  3LWE A;  5CV5 A;  5D14 A;  5EBD A;  2EY1 A;  2UUB L;  1VF7 A;  1XMO L;  1Q8K A;  2WB1 G;  3ICE A;  3L0O A;  3MVV A;  1E3P A;  2AUJ D;  3U4Z A;  1YHB A;  2PI2 A;  2L0C A;  2AKW B;  3HOX G;  4JYA L;  1TT2 A;  2IL8 A;  2PMZ B;  3C1F A;  2RDH A;  4ZAI A;  2CCZ A;  3RR5 A;  4V0B A;  1BDO A;  3ERQ A;  5ELO A;  5FJ8 G;  3EJI A;  5T1G A;  4X65 Q;  1KTK A;  1PZK D;  3QR8 A;  1EIF A;  2K75 A;  2F0Q A;  3KLS A;  4YCW A;  4IO9 A;  2NZO A;  1VQI A;  3M7N A;  2ALY B;  5CV7 A;  2MUY A;  1PH6 A;  3JAM L;  2NWG A;  4JI2 L;  5JAV A;  3J7Y W;  1HXY D;  5M3F B;  2L11 A;  4BXX H;  4A3D G;  1G6Z A;  3BDC A;  4GKJ L;  4FXD A;  4IPG A;  3AQQ A;  1JR0 D;  4KY5 A;  4RWS C;  1AP0 A;  1UEA B;  3OWF A;  4EQP A;  1D6E C;  2PW5 A;  2EYP A;  1SNP A;  1E2V A;  5IYD H;  1B9N A;  3GTQ B;  4X62 L;  1S4Z A;  1HR0 Q;  2I5M X;  4MN3 A;  1TWA B;  4R9W A;  3VA7 A;  3PF4 A;  3TBI B;  5LMN W;  5LMU L;  3HOZ H;  1SNM A;  4E6I A;  3OTO Q;  1M90 C;  4IUU A;  2ICE C;  1XXG A;  3IFD A;  1PFM A;  2EDG A;  3H09 A;  3KJO A;  2D5D A;  3E5S A;  3RMH A;  1L1O C;  3AFQ A;  4LK1 C;  4IUQ A;  3GTP B;  1XNQ Q;  2OT2 A;  2VXW A;  3OMG A;  3VR4 A;  4ZKB B;  1VQM A;  5C0X H;  1J8I A;  2L1B A;  2QA4 A;  1U9R A;  1JJC B;  2A19 A;  1Y8P B;  3PIP 3;  1PMR A;  2B2Y A;  2Q2I A;  4A3I G;  5CGK A;  5HGT A;  2R7Z B;  4OEM B;  1RD9 D;  1A63 A;  4JI0 Q;  3SK5 A;  3EVQ A;  1I50 B;  3VR3 A;  1SXT A;  2QW7 A;  5D3D A;  1ML0 D;  1B2T A;  5FLX E;  1S5D D;  2HCI A;  2UUA Q;  2PPB C;  2YU9 B;  3NP8 A;  2FIN B;  2Z8L A;  2JA6 H;  3NXW A;  1EIH A;  4JPB W;  3ONA B;  2VUM G;  1PH9 A;  3RLN A;  3OHX C;  2UXC Q;  2ZXR A;  4O42 A;  5AFW A; 
#chains in the Genus database with same CATH homology
 4ME3 A;  4WJ3 M;  2GN5 A;  1X56 A;  3CCM A;  3GTP H;  1VS0 A;  1VQ9 A;  3MXN B;  5J3B A;  1C7Y A;  4OWT B;  1QUQ B;  5C3E H;  3S1R H;  4C2M H;  4JV5 L;  4JOI A;  3K0X A;  1HZB A;  3KF8 B;  3ZJY C;  5FLM H;  3G4S A;  4L5T A;  4A93 G;  4X6A H;  4DR7 L;  4IJL A;  1CSQ A;  3GD7 A;  4LF4 L;  1X3G A;  1I5F A;  1VQ5 A;  3S2D H;  4LFB L;  2ID0 A;  4B3S Q;  1L2F A;  3ULJ A;  3F8T A;  1A62 A;  1D7Q A;  1U0L A;  2YTV A;  4DR6 L;  2R93 H;  1A8V A;  2VUM H;  1I3Q H;  2AWN A;  4IOC A;  1BKB A;  4DK3 C;  4X66 Q;  3DM3 A;  1Y1V H;  3CCR A;  4L5S A;  3HOU G;  2JA7 G;  3JC6 6;  5C4J H;  2ZM6 Q;  4PZ8 A;  5GAD C;  1GM5 A;  3PO2 G;  4YWL A;  2B29 A;  4NB3 A;  4GNX C;  4YWK A;  4JI6 Q;  1TWH H;  4AQY L;  2MNA A;  3NBH B;  2N8N A;  4BY1 H;  2Q2U A;  4JYA Q;  4TVA B;  4UP7 A;  2E8G A;  1HNW L;  1P16 A;  3HOW G;  4PG3 A;  1LM0 A;  1NMG A;  4UPA A;  4A93 H;  2UUC Q;  4A3L G;  4R1J A;  2R7D A;  3UE0 A;  1QVG A;  3HKS A;  1GD7 A;  2N49 A;  2YYZ A;  1L0W A;  1ASZ A;  1VQP A;  3ER0 A;  4OX9 Q;  1E22 A;  4A3M G;  2D0O A;  1HNZ L;  3AEV A;  3MEF A;  5FJ8 H;  4DV1 Q;  3KDF A;  2K52 A;  4PMW A;  1V43 A;  1SFO H;  3KJP A;  1Y1W H;  2MQH A;  3PUW A;  3JAM c;  1PHJ A;  3HOU H;  2JA7 H;  3I56 A;  4GOP C;  1N32 L;  2KBN A;  2PI2 E;  3STB D;  1Q7Y C;  3PO2 H;  5GRO A;  5JEA J;  2NZH A;  5DLQ E;  4DUZ Q;  4DR4 Q;  3CME A;  4YY3 L;  2VS1 A;  4LFC L;  4DV6 L;  3I4M H;  5BR8 L;  3NEM A;  2UXD Q;  1KXL A;  4X64 Q;  3H0G G;  1OXU A;  1KIX A;  1GO3 E;  1OXV A;  4R4I A;  4YWM A;  4IFD G;  4RMF A;  4A3L H;  1CUK A;  5E7N A;  1C9O A;  1NTG A;  1CSP A;  4PZ6 A;  3M4Q A;  3CCU A;  4UP9 A;  1N9W A;  1VQL A;  1N34 L;  1HR0 L;  1Q46 A;  3HOY G;  4A3M H;  1N33 Q;  1IBL L;  2K4K A;  2YV5 A;  4DV7 L;  4AYB E;  1NY4 A;  4HJ5 A;  4JI3 Q;  2ATW A;  2KCM A;  4EX5 A;  4APV A;  3F2B A;  4A3D H;  3BU2 A;  1PFS A;  3G71 A;  2ZTE A;  2LXJ A;  4A3F G;  1PH5 A;  1X54 A;  4NXM Q;  3CCV A;  4NXN L;  1OXX K;  4XIG S;  1JJ2 A;  1DGS A;  3TEH B;  1G51 A;  3D0F A;  1QUQ A;  1YHA A;  3KLW A;  2CFM A;  3TQY A;  1KRS A;  1YJ9 A;  5ELN A;  1JB7 A;  1FJG L;  3H0G H;  4LW1 A;  3UE1 A;  4HJ7 A;  4GLV B;  4JBK A;  1VQG A;  1XPO A;  4X62 Q;  1NBW A;  5M3F H;  2HHH L;  4LF6 L;  2IHF A;  1XNQ L;  1EQR A;  3BJU A;  2I5L X;  4UP8 A;  2F52 A;  3Q8D A;  5C44 G;  4LF5 L;  4LFA L;  1XNR L;  3HOY H;  3PCO B;  5LMU Q;  3I4O A;  2NVT H;  4B3R L;  2WAQ E;  2NVQ H;  2VQE Q;  1B70 B;  1WI5 A;  2K14 A;  3PIO A;  3UDG A;  1IBK Q;  3F1Z A;  3FKI G;  3F2C A;  4DK6 C;  4GKK Q;  1WOC A;  4DV4 Q;  1QZG A;  1D8L A;  3KDF B;  3J80 c;  1E1T A;  4HID A;  4JBM A;  2VNU D;  4JC0 A;  2Q2T A;  4GS3 A;  2WB1 E;  2ZJR A;  3LGJ A;  2F4V L;  1YBY A;  3RNU A;  2L15 A;  1FVI A;  4JI0 L;  1QVF A;  4IPH A;  1E24 A;  1PYS B;  1TWF H;  4R4O A;  3F2D A;  2IHE A;  3GTQ H;  1VQE A;  3PV0 A;  3W5O A;  1JE5 A;  4FDB A;  1VQ7 A;  2K5V A;  3GDE A;  4LWC A;  1VQJ A;  3ULP A;  1N36 L;  2R92 H;  3JAM i;  1W3S A;  2JQO A;  3T1H Q;  4JI4 L;  1TXY A;  1VQD A;  4XTC S;  1HJP A;  5C44 H;  2EXD A;  2PNH A;  3S1M H;  2A8V A;  4KHP L;  1KC8 C;  2V1C C;  1VQK A;  1NMF A;  3G48 A;  3GTK H;  3UDX A;  3H3V I;  3CPF A;  1TWC H;  2JK8 A;  3ULL A;  4LF9 Q;  2R7Z G;  2AWO A;  3FKI H;  4PZ7 A;  2JA5 G;  1OXS C;  2H5X A;  2UXC L;  1VQO A;  4R4C A;  3U58 A;  4JI5 Q;  4QQB X;  1T9H A;  3J81 j;  5C0X I;  1HZC A;  1VCI A;  4A3I H;  2Y0S G;  3T1Y Q;  2ES2 A;  4MZ9 A;  1MJC A;  2PMZ E;  4KLK A;  2BH8 A;  2R7F A;  2RF4 A;  2Z0S A;  1E1O A;  4DUY L;  1PA6 A;  1EFW A;  1WFQ A;  4K0K Q;  4BBS G;  5IYB H;  3UDF A;  4Y7N H;  1A0I A;  1YZ6 A;  1I94 Q;  3S1N H;  1KHI A;  4JI7 Q;  4JI1 L;  4DV2 L;  2CWA A;  4OO1 I;  4GNX B;  5EAY A;  2VQF Q;  4DR5 Q;  2NVY H;  1L1O A;  1M1K C;  5C4X G;  2EIF A;  1XTD A;  1SE8 A;  1K83 H;  1EWI A;  4JG2 A;  2R7Z H;  4JBW A;  2C35 B;  2KEN A;  4J15 A;  2E5L Q;  2JA5 H;  2UUB Q;  2VY3 A;  3J81 c;  1I50 H;  1YNX A;  1VQB A;  2K50 A;  4LF8 L;  1FGU A;  1SLJ A;  4C3I H;  1XMO Q;  2BH2 A;  1XMQ L;  4AIM A;  4GN5 A;  1CKM A;  3K8A A;  4YCV A;  4X65 L;  4JBJ A;  4HIK A;  1PH8 A;  4A75 A;  3KYH C;  2OTJ A;  3EIV A;  3M4O H;  4HIM A;  5FLX c;  1IL2 A;  1HNX Q;  1XPU A;  4GN4 B;  5M5W H;  2YU9 H;  3CF5 A;  3VDY A;  2JA8 G;  3A74 A;  4BBS H;  2BA1 A;  4GOP B;  4YHH Q;  4JI8 Q;  2KCT A;  4IFD J;  5IP7 G;  4LF4 Q;  2UUC L;  3J80 i;  1Z9F A;  1BVS A;  1AE2 A;  5IYC G;  2QEX A;  5C4X H;  3M85 A;  4A3E G;  1YJW A;  2KHI A;  3FP9 A;  3CC4 A;  1X6O A;  4JYA L;  2MO0 A;  3PO3 G;  1LYL A;  3GTG H;  4O0A A;  4OWX B;  3U4V A;  4DV1 L;  5IWA L;  4UY8 C;  5M5X H;  1X9N A;  5IY0 A;  5IT9 c;  2ZTD A;  4QJF A;  3CMA A;  3L7Z C;  1GKH A;  4IPD A;  4LUO A;  4DAY B;  4DR1 Q;  1PH7 A;  4L5R C;  4KHZ A;  4A3G G;  2MFI A;  4AQY Q;  3I55 A;  3L2P A;  5IYD G;  4DUZ L;  4DR4 L;  2UXD L;  5JJI A;  3I7F A;  2JA8 H;  4X64 L;  2A1A A;  1YIT A;  2XTI A;  4KI0 A;  1IZ6 A;  5IP7 H;  3HOW H;  1HZA A;  1YIJ A;  1J5E Q;  1I6H H;  2IT1 A;  2UXB L;  2Z6K C;  1HNZ Q;  1VQ8 A;  4LF7 Q;  4JI2 Q;  3I4N G;  3CC7 A;  1LTL A;  1XPR A;  4A3K G;  1UEB A;  1L1O B;  1KAW A;  2NVX H;  1N33 L;  2PQA A;  3S16 H;  1GVP A;  1SRU A;  1VQA A;  4JI3 L;  1S72 A;  3PO3 H;  4GKJ Q;  3PF5 A;  1HZ9 A;  4OWW B;  3RN5 A;  3OTO L;  3CD6 A;  5K36 G;  1HH2 P;  1EOV A;  1QVC A;  2I5H A;  5AJ3 L;  1PV4 A;  4YY3 Q;  2RHS B;  5BR8 Q;  1WYD A;  1S3O A;  4DV5 L;  2IX0 A;  4BBR G;  3E9H A;  5M5Y H;  2ZTC A;  4P74 A;  2ZJQ A;  2K5H A;  2ZJP A;  2HT1 A;  1V1Q A;  4P73 A;  3W1G A;  4GNX A;  1V9P A;  3PUX A;  4GN3 B;  1IBM Q;  1B8A A;  3J81 i;  2I0Q A;  3K81 C;  4QGU A;  5C0X G;  3I4N H;  3E0E A;  4B3T Q;  1Q1B A;  3WWV A;  1RL2 A;  4A3K H;  2RHQ B;  3S15 H;  1AE3 A;  5M3M G;  1X55 A;  2AHO B;  4DV3 Q;  2CKZ B;  1B7Y B;  1OXT A;  5GAH C;  2VQE L;  3RLO A;  1IBK L;  4A3B G;  2RCN A;  2KHJ A;  1KRT A;  4GKK L;  3RN2 A;  2VW9 A;  4DV4 L;  4NXN Q;  1SR3 A;  4A3F H;  5GQO A;  3TRZ A;  2UU9 L;  4R4Q A;  1YVC A;  5H1S E;  2E2J H;  4OO1 G;  1Z47 A;  2OTL A;  1O7I A;  1TWG H;  3IRB A;  3OYY A;  3G6E A;  2OWO A;  4BBR H;  1R9T H;  1FL0 A;  2JEB I;  4GOP A;  2HHH Q;  2WP8 J;  5GAE C;  4BA2 I;  1KL9 A;  4DR2 L;  3PGZ A;  3CW2 C;  4C3J H;  1VQ6 A;  4GLA C;  2OCE A;  3KOJ A;  4YCU A;  3T1H L;  1BBU A;  1SRO A;  4LFA Q;  1XNR Q;  1SMX A;  3FHW A;  4R4T A;  3K7A H;  2UUA L;  3TS2 A;  5M3M H;  4AYB G;  1NJI C;  3UDI A;  3CC2 A;  2Q2H A;  4DV0 Q;  1K3R A;  1K8G A;  2E2H H;  2JEA I;  4A3B H;  1UE5 A;  2PQA B;  4DKA C;  4QY7 A;  1X3E A;  4BY7 G;  3CAM A;  1EQQ A;  4JCV E;  3PUY A;  3RLF A;  4BA1 I;  3GTJ H;  3HOV G;  3HKZ G;  4LUV A;  5LMN L;  1UE6 A;  1U5K A;  3S2H H;  4DR3 Q;  2N78 A;  2WFW A;  3K80 C;  3DLL A;  3PSI A;  4K0K L;  1UWV A;  1X65 A;  1QZH A;  1YHQ A;  3M3Y H;  3S1Q H;  4LUZ A;  1VQN A;  2VZA A;  5HGQ A;  1I94 L;  4JI7 L;  1YI2 A;  3HFZ B;  4KHP Q;  3A5Z B;  1X3F A;  4DAM A;  3B6Y A;  4B3M Q;  4IPC A;  4P71 A;  1AH9 A;  2WAQ G;  4B3S L;  2R93 G;  3ERS X;  1NE3 A;  4BY7 H;  1VQF A;  1Y14 B;  4NPS A;  2LXK A;  3BZC A;  3GO5 A;  2UUB L;  3GTO H;  1IYJ B;  3EBE A;  1S40 A;  1XMO L;  5HY6 A;  4X66 L;  3HOV H;  1RIP A;  1Q8K A;  2WB1 G;  3M9B A;  3ICE A;  3L0O A;  2D62 A;  4DUY Q;  2ZM6 L;  1EYG A;  1E3P A;  2B3G A;  3U4Z A;  4L5Q A;  4BY1 G;  4A76 A;  1YHB A;  4JI6 L;  2N3S A;  4DNI A;  1HNX L;  3J7A 5;  2PI2 A;  4JV5 Q;  3GTM H;  1K9M C;  2AKW B;  3HOX G;  4JI1 Q;  1HR0 W;  4QL5 A;  4DV2 Q;  1E7Z A;  4DPG A;  4HIO A;  1IXR A;  4YHH L;  1MJE A;  1VQ4 A;  4JI8 L;  4DR7 Q;  2HIX A;  2CCZ A;  3J7Z C;  4LFB Q;  3I2Z A;  3RR5 A;  3S24 A;  2CWP A;  3KFU A;  4WJ4 A;  5ELO A;  4LNQ A;  5FJ8 G;  4OX9 L;  1PVO A;  3AFP A;  4BXX G;  4DR6 Q;  3M4P A;  4AH6 A;  2IX1 A;  2HQL A;  1Y1W G;  1OTC A;  4LF8 Q;  1P8L A;  1K8A C;  1XMQ Q;  2NN6 I;  4QIW E;  2QGQ A;  2DUD A;  4X65 Q;  3CCS A;  1EIF A;  2K75 A;  1YEZ A;  3CP0 A;  4DR1 L;  3S14 H;  1WCM G;  1LUZ A;  4YCW A;  3I4M G;  5JJL A;  2F3I A;  4IO9 A;  3CCJ A;  4RG1 A;  2OQ0 A;  3STB C;  2NZO A;  1HNW Q;  3CPW A;  1UE7 A;  1VQI A;  3HOX H;  1PH4 A;  3M7N A;  2ALY B;  4Y52 H;  3EN2 A;  4EQ5 A;  1PH6 A;  3KF6 A;  3NEL A;  1PH3 A;  1J5E L;  1BBW A;  5IYC H;  1UE1 A;  4P75 A;  4LF7 L;  4JI2 L;  5C0X J;  4A3E H;  3D31 A;  2VL6 A;  2B63 G;  4MTN A;  4BXX H;  5IWA Q;  3RZD H;  3HOZ G;  4A3D G;  4GKJ L;  1JJG A;  1CKN A;  4IPG A;  3AQQ A;  3W1B A;  1EIY B;  1ASY A;  1MIU A;  1N32 Q;  3CQZ H;  2D0P A;  4GLX A;  1VQC A;  4NXM L;  1WCM H;  4A3G H;  1SN8 A;  3PUV A;  4DV6 Q;  4LFC Q;  4HJ9 A;  3S17 H;  3A5U A;  5IYD H;  4MNO A;  1G29 1;  2E2I H;  1YJN A;  1Q12 A;  2BA0 A;  1VQH A;  5M3F G;  1KD1 C;  4A3C G;  2GVB A;  1WJJ A;  2JJQ A;  4OON A;  4X62 L;  2UXB Q;  1K73 C;  1IBM L;  4A3J G;  1K0R A;  2ASB A;  3CCL A;  1N34 Q;  1HR0 Q;  2I5M X;  2OQK A;  3CCE A;  5JJK A;  1JT8 A;  1IBL Q;  4B3T L;  1G6P A;  4DV7 Q;  3PF4 A;  1Q1E A;  2B63 H;  5LMN W;  5LMU L;  3BZK A;  1XJV A;  4DV3 L;  3HOZ H;  3K7U C;  4IJH A;  4P72 A;  3OTO Q;  2K5N A;  2R6G A;  1M90 C;  5GAG C;  2JA9 A;  2GVA A;  1N8R C;  3E9I A;  3SGI A;  5AJ3 Q;  2IY5 B;  4ALP A;  3HKZ E;  4POF A;  5JEA G;  2Y0S E;  2CQO A;  4JOI C;  3KJO A;  2EQS A;  4DV5 Q;  1C0A A;  1EUJ A;  4IOA A;  4A4I A;  4C3H H;  1FJG Q;  1L1O C;  3AFQ A;  2XGT A;  4HJA A;  4LF6 Q;  4A3C H;  1PYB A;  2R92 G;  3H3V H;  3TS0 A;  1W2B A;  1XNQ Q;  3TRE A;  3AYH B;  4A3J H;  1CKO A;  4LF5 Q;  5IE8 A;  3CCQ A;  3KF6 B;  1VQM A;  2JA6 G;  3H15 A;  2MO1 A;  2HIV A;  4B3R Q;  1J6Q A;  2QA4 A;  4O2D A;  1JJC B;  5IP9 G;  4IFD I;  4DV0 L;  2A19 A;  4TQU S;  4LF9 L;  2Z6K A;  3GTL H;  2UU9 Q;  1CKN B;  3PUZ A;  2Q2I A;  2FXQ A;  4A3I G;  4JI5 L;  2F4V Q;  4HJ8 A;  1A63 A;  4JI0 Q;  4DR3 L;  3T1Y L;  2YTY A;  1Q81 C;  1TWA H;  5IYB G;  5C3E G;  4DR2 Q;  3PIP A;  1MKH A;  3A0J A;  4POG A;  3OW2 A;  1N36 Q;  5FLM G;  3U50 C;  4JI4 Q;  2NN6 G;  1Q86 C;  2AMC B;  2UUA Q;  4H02 A;  3NEN A;  2VQF L;  4DR5 L;  2JA6 H;  1PH1 A;  4B3M L;  2YTX A;  5IP9 H;  1Q82 C;  2VUM G;  4OXP A;  1PH9 A;  2DGY A;  3RLN A;  2LSS A;  2UXC Q;  2JE6 I;  1H95 A;  1KQS A;  1JMC A;  1Y1V G;  2E5L L;  3RZO H;  1PH2 A;  5LMN Q;  3CXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...