1BBXC

Non-specific protein-dna interactions in the sso7d-dna complex, nmr, 1 structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
63
structure length
63
Chain Sequence
b'ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*TP*AP*GP*CP*GP*CP*GP*CP*TP*AP*G)-3')
publication title Architecture of Nonspecific Protein-DNA Interactions in the Sso7D-DNA Complex
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
total genus 4
structure length 63
sequence length 63
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bbxC00
4IUUA 4ZKCB 1MSHA 3R93A 1J8IA 1EOTA 2KECA 1EL0A 2HCIA 2EPBA 2MGSA 2HDMA 1PFMA 1ESRA 1EIGA 1AP0A 1JICA 2EOTA 1HRJA 1O7YA 2RSOA 2FJ2A 3TZDA 1WTVA 2FINB 3I3CA 1WD1A 2R3ZA 4X3SA 1NR4A 3G7LA 3KUPA 5EPLA 2Q8TA 5E4WC 5EKIA 1U4PA 1ZXTA 2HUGA 4MHEA 2KEEA 3SVMA 1RJTA 1AZPA 5CBEE 2FHTA 2X69A 4OIKA 1B4OA 4RAUC 1KNAA 1M8AA 3I8ZA 4MN3A 2MJ8A 1KNEA 4CJ2C 4ZK9B 1IKMA 1HA6A 2RVLA 1X32A 1TVXA 4ZAIA 1GUWA 2BDNA 4HEDA 4O42A 5EPJA 3GV6A 3GV3A 1LV9A 2B2VC 3I90A 1F9QA 1X3PA 2L12A 3N52A 1B3AA 1NCVA 5D14A 2KUMA 1ILQA 4LMQD 4XT1B 2NYZD 4R9WA 3QO2A 2K28A 1NAPA 4U68A 1X3QA 1QE6A 2B2VA 2JYOA 2XIWA 2N55A 4QUFA 2RA4A 1G2SA 3FDTA 3ONAB 2KEDA 2DY8A 2L11A 2MP1A 1G6ZA 2B2WC 3H91A 2N88A 5T1GA 3P7JA 4CJ1B 2M2LA 5EPKA 3DEPA 1WTRA 1IL8A 3HP3A 5CORA 1SDFA 1ILPA 1RHPA 1HFGA 5AFWA 1EIHA 1B53A 2B2WA 3MWYW 4RA8A 3Q6SA 1QG7A 1VMPA 2KOLA 2IL8A 1HUMA 1WTPA 1RODA 1O80A 2L4NA 4ZLTF 4ZKBB 5COYA 1DZ1A 5CBAE 1PFNA 1WTOA 1XYIA 4QUCA 1RTOA 1F2LA 3IL8A 1MI2A 1BO0A 1DOLA 2EE1A 3I91A 5DNFA 4XDXA 3DM1A 4NW2A 3DEOA 3FPUB 5T1IA 2B2UC 2B2TC 2K1BA 2VXWA 1CA6A 2NWGA 2HDLA 2FMMA 1C8CA 2KVMA 1DONA 2K01A 4IURA 2X6LA 1BBXC 1ICWA 1U4RA 4X3KA 1WTWA 1WTQA 1QNKA 4HCSA 2B2TA 1U4MA 2K04A 2K03A 4R8IA 1Q3LA 5EQ0A 4IUTA 3MTSA 4UAIA 2CVRA 3UI2A 5JJZA 1WTXA 1SAPA 1F9PA 2B2YC 1G91A 3LWEA 5CMDA 1DOKA 1XX8A 2D9UA 1HFNA 1HHVA 4X3UA 1EQTA 1PDQA 2SDFA 3F2UA 4HSVA 1PFBA 1DOMA 1A15A 2L1BA 5E4XA 1F9SA 2B2YA 5EJWA 1G2TA 1CA5A 2DY7A 2JP1A 1SSOA 3KBXA 2HCCA 1NR2A 1IKLA 1B2TA 1J9OA 1MSGA 1U4LA 2X6GA 3D6WA 4RWSC 1RTNA 1JE4A 1S4ZA 3TN2A 3IFDA 4HAEA 1ML0D 2L9HA 1BNZA 2MPMA 4CJ0B 1PLFA 1O7ZA 2NZ1D 4IUVA 2K05A 2B2UA 1VMCA 2FFKB 2J7ZA 4IUPA 4IUQA 2RSNA 1WD0A 1E0BA 1F9RA 1CM9A 1WVLA 2H1EA 1MGSA 1BF4A 1B50A 4X3TA 4DN4M 1AZQA 4XT3B 5D65A 4OIJA 2Q8RE 1HUNA
chains in the Genus database with same CATH superfamily
1TR5A 4QF4A 1J8IA 3Q8DA 4K5WA 3QOLA 3T53B 4Z9CB 2AHOB 1M4VA 1PYWD 2FJ2A 4C3HH 4TKOB 2ATWA 2I5HA 3I3CA 2Q8IB 3G6JB 3G48A 4NDXA 1KAAA 3S17B 3K81C 2O4XA 3J7AV 3KLSA 1C4QA 1SJED 2B8FA 1Y1VG 4LUZA 1BCPD 1VQGA 1PRTF 1HA5A 3PO3G 1D7QA 1TVXA 1GVPA 5EPJA 4MTKA 3CRLC 5C3EG 2ENBA 3VYRA 1B3AA 4TRDA 2NYZD 2K28A 2KHIA 4ME5A 1B9MA 5T1GA 1BQQT 4CJ1B 4DV7L 2F0IA 3RR5A 2F0OA 1RHPA 2NZHA 3Q6SA 1JJ2A 3S1QB 3J7A5 3CKIB 2VQFQ 1K3BC 1N34Q 5JEAJ 5COYA 1ESFA 4DAPA 2ZM6L 2QCPX 1WTOA 4C3IB 3AB9A 1D1IA 2B8GA 1IBMQ 4HJ7A 1E22A 3S14B 1PMRA 4BBSB 5T1IA 3OMCA 2JSOA 4QL5A 3ND9A 3TSSA 2HQLA 2R7ZG 3BZDB 5M5WH 2WAQG 3STBC 1U4RA 1SNDA 3UE1A 4BS9A 4UAIA 5JVH3 1HZ9A 4V190 3F1ZA 1HHVA 5IT9c 1NNXA 2UXBL 4JI1Q 4L5RC 1PH6A 1VQ9A 3OHXC 4K5VA 1Y1WH 3OWFA 1G2TA 3Q23A 1BR9A 3BU2A 4M1UB 5FOBB 5LL6S 2X6GA 3S16H 3D8GA 2JA6G 4K0KL 2NB0A 3R3OA 1N36Q 2WKDA 4NP5A 3BDOA 2JA8B 1E0BA 1BF4A 2NN6H 4IFDJ 1UEBA 2EY1A 4G7OC 1EYGA 2Y0SE 5D65A 1CKNB 2PQAB 4KLKA 5M9OA 4RHSA 2KECA 1EL0A 2HCIA 1SFOB 3BS1A 5KNBA 1CKMA 1VQNA 2RSOA 1YJNA 1WCMH 5IGBA 1LYLA 4L63B 4QMGA 3T51B 4R4CA 1U4PA 5I9PA 1ZXTA 3IAYA 2FHTA 1YJWA 4KY6A 2MJ8A 4GN4B 1I4XA 2F0QA 3M7NA 2RVLA 4ZAIA 4JI4Q 2Y0SG 3IRBA 1JJGA 3W1BA 5C0XJ 1B7YB 4JI3Q 3NTIA 4IPHA 3SK5A 2F52A 1VQMA 1NCVA 4A3MB 4O1NA 1VQ7A 5IP7G 3H09A 5FJ8G 4IOAA 2DY8A 5C4XB 4H02A 3P7JA 3J80L 4IZ8A 4Q0FA 3DEPA 1VQBA 1EYAA 1SDFA 2G9DA 4PV1C 1LM0A 2LS01 3E6ZX 3H0GB 1G291 2K6AA 1XPOA 4N8FA 1FNWA 1B8AA 2MO1A 3AU7A 3HOYH 3RZOB 1QCBD 1RTOA 3C2PA 1PA6A 2NVYH 5DNFA 4ZQ3A 3NUCA 4M8AA 2B2TC 3GTPH 1R9TB 2XN9C 1WYDA 2KVMA 1GKHA 4OO1I 1WTQA 1E2WA 2WKCA 4WJWA 4DV0L 3UI2A 4LF5Q 2VQEL 3X3NA 3D3RA 3HOVH 4B9WA 4A3EG 3CXCA 2MHVA 4MNOA 3RLOA 3QG1A 5IYCG 4DAMA 2IW3A 4WJ3M 3I7FA 5E4XA 3FP9A 1JB7A 4BY1B 2E74C 1B1ZA 1KHIA 1ZYRC 2JP1A 4K6LA 2YU9B 2PNRC 3I4NH 3PIO3 4HIDA 3MXPA 2LY7A 4HAEA 3EIVA 3ULPA 1SN8A 2MQHA 1GUNA 2JA7G 2GVBA 3K58A 4RGMA 4LAAA 2Z8LA 1Q12A 4BXXH 5FLMH 2R92H 1SNMA 4DNRB 5CYUA 4ZRZA 4C56C 4DAYB 1SYCA 3STBD 3EFXD 4NXMQ 4A3IB 1AH9A 1Y69U 1PFMA 4F87A 1II3A 3F2CA 2JA5B 2F0HA 3B6YA 3MHBA 3W5OA 3HOZH 4C2MB 2FINB 2K14A 5M5YB 3CW2C 1S5FD 4EVOA 3SXHA 2KEEA 3UDFA 3E0JA 3PUWA 4RAUC 2AUKA 4BBRH 3OSOA 1YBYA 4LFAQ 1IXRA 4YY3Q 5JVG3 3PGZA 4RCNA 1TKWB 2ZTCA 1LV9A 2WIIB 5EAYA 3S17H 2K5DA 2ICIA 2BOSA 3AFPA 4FP5D 1NAPA 4A3GB 2B2VA 2E75C 4CDEC 2F0UA 1H9RA 5GAEC 4A3CG 2PNHA 5JOBA 2PO4A 1L1OA 5CORA 4XYOA 5A2QL 1S5BD 1B53A 3SK6A 1SMYD 3CD6A 4N9TA 3SGIA 1A6XA 2RDHA 3NQTA 4P73A 1D2BA 4I7ZC 2XWJB 4QUCA 4LFBL 3IL8A 2IJ0A 1DOLA 2E2DC 2PW7A 1FL0A 3TP5A 4OONA 3FPUB 3VYTA 3CC7A 2ICEC 1XNQL 3GD7A 4R1JA 5ELOA 4GKKQ 1KAWA 3A5UA 1ICFB 3L2PA 4H0LC 3PIPA 1H9JA 2HHHQ 2K03A 3PF4A 4BA2I 2BH2A 4KY7A 3S14H 4BBSH 3QJYA 5KEEA 1DOMA 4EQOA 3PCOB 2L15A 4B3SQ 2GA4B 1YNJD 4JI7L 3MFGA 2O5JC 3KBXA 1EEID 1SSOA 2HCCA 1Y8OB 1NMGA 3NQIA 1XTCD 3MFYA 2D5DA 3D6WA 5EBCA 3VDYA 2A5HA 4B9XA 1ET9A 2R6GA 3TZUA 2B29A 3RNUA 2FFKB 4WFN3 2A69D 3FVQA 3PUVA 2ASBA 1M90C 1Y1VB 2K52A 2NTTA 4JV5Q 5IYDG 4IUUA 1X3FA 1HNZQ 3LWUA 1DM0B 2F0VA 5JEAG 2EPBA 3GTGB 4I7AA 1QZHA 2IHFA 5IODA 2JA8H 3TZDA 2EZVA 5M3MG 3J80i 2R3ZA 3DHQA 4X3SA 3S2HB 3VYSA 4A3FG 4JI8Q 5JJLA 3VR2A 4OX9Q 5KNCA 4C3HB 2IPKD 4X66Q 1OXXK 2CQOA 1QB5D 4O42A 4DF7A 3K7UC 3NTHA 4POFA 5D3DA 4DV3L 1IBLQ 1EWHA 2PPBC 3L3OC 1H9MA 1HTPA 2QKIC 2QF7A 4CDDC 2OT2A 2JEAI 2R7ZB 2P5ZX 2B2WC 1E3PA 4P75A 1TWHB 2EY2A 3KJOA 1GHJA 4P71A 2A1AA 4Y7NB 4JI0L 1XPUA 4AQYQ 4QY7A 1FNUA 1K8OA 4A3MH 3TP8A 1TS4A 4G7HC 4IFDG 5IT9L 4DPGA 4KD3A 1F2LA 4A3KG 5C4XH 1JORA 1EEFD 4NPSA 4P72A 4DR5Q 4KTAA 1CUKA 4A93B 2B2UC 4UP9A 1TWFB 4GNXB 4OEMB 5EQ0A 3MTSA 1AE2A 3H94A 4KN7C 1PZKD 3LWEA 5HURA 2O2LD 4ZUJA 4MZ9A 2CWAA 4DR6Q 3NENA 1HNWL 2R93G 3HOUG 1R9TH 1RCVD 2WB1E 4JI6L 3TP7A 1I4PA 4L6TB 4JOIA 1HH2P 1CQVA 5C0XG 3MXNB 4FF3A 5FO7B 2XRQD 3E9IA 1Y1WB 3K5MA 5A2QE 3JAMi 3RN5A 1IYJB 4BY1H 1CFMA 2YU9H 1E2ZA 3A8JE 2N49A 1FR3A 3URYA 3KOJA 2Y0SB 4DV4Q 1Z6HA 5M3FB 4TVAB 1L0WA 4LUOA 2BDOA 2XSCA 2EOTA 3TS0A 1WJJA 1GUSA 1X65A 3W3AA 1GUOA 4GLVB 2LMCB 3BVZA 2R61A 1GOZA 2GVAA 2EYMA 1CHQD 4AYBG 2JA5H 1HZCA 1O7LA 2ZTDA 4C2MH 1MD2D 4A4IA 5M5YH 3GP7A 2F0SA 2OQ0A 4LF8L 2K5VA 5JJKA 3HZXA 1HNXL 4C3JG 5IGGA 1O7IA 4RKLA 4LJZC 3CU7A 3EBEA 2EVBA 1ZEQX 1PH7A 3T1HQ 1JWMD 2UUAL 4AH6A 3M4QA 5GAGC 5ELNA 5IGEA 1PHJA 4OXPA 4X62L 4O2DA 2IL8A 4RCOA 2Z9HA 1D5ZC 2FMCA 2ZTEA 4ZLTF 4A3GH 1E1OA 3J7AF 2VL6A 4KI0A 2LXJA 4S3SA 2QEJC 1XJVA 3K6OA 1CA6A 2A19A 2BE5D 4EX5A 4JVZA 3HOYB 2D62A 3H6MA 1Q46A 1YHBA 5DM63 1SE8A 4NKLA 5D3IB 4JYAQ 2NVYB 5LMNL 1IBKQ 3JAMc 4DR7Q 2DNEA 2F0KA 5LMUL 4GN3B 2F3WA 2OTLA 5E1FA 5BN4A 4B3ML 3NPPA 2KCNA 1QUQA 1K83H 3W2DA 2IHEA 2F0MA 1L0YB 1I5FA 5LL6X 4H13C 3A7LA 5C4JB 2KENA 2AUJD 3KLRA 2VUMB 2MPMA 2Z4IA 1HR0W 2BCOA 4BY7G 1UAPA 2B2UA 4IUQA 5IGCA 2EYOA 3HOXG 3GTJB 2LSSA 5I4DA 1IBKL 4DR3L 2F0DA 3SE0A 3CMEA 5IT9E 1PH3A 4KHVA 3SK4A 5FO8B 3S15H 1TY0A 1B9NA 2YYZA 2HQEA 1DGSA 5GAHC 4KHPQ 1EQRA 2A74C 4GOPA 2I46A 5K36G 2MFIA 3CCEA 3SDZA 1SYGA 1EIGA 4DR4Q 2MO0A 5I6WA 1I50B 2R92B 1N33L 1I4GA 2Z1CA 1Y1VH 4YWLA 4ILWA 5L37A 1LTSD 3MEHA 3J7YW 1PH4A 1G51A 4PZ6A 3GDEA 5C3EH 1BCPB 3I70A 4A3BG 1VQ8A 3GTGH 3HOZB 1KNAA 4IPDA 4HJAA 4K5XA 3MAQA 1LT6D 4C1NI 4ALPA 3BVMA 2BDNA 4LF4L 1Q1EA 5IWAQ 4JG2A 5FKAC 4IUNA 1ENAA 4A3DB 3ICEA 3S2HH 4BBRB 2K5HA 4UP8A 1OXSC 2RKSA 5DLQE 1LT4D 1AE3A 3KLWA 2MP1A 4KD4A 5E3FA 3NP8A 5H1SE 1UWVA 4PQXA 3P20A 3HP3A 1KQSA 1QJOA 1E1TA 3KJPA 4HR7B 1QG7A 2KOLA 1STGA 3KDFB 1DZ1A 1EOVA 5BR8Q 1XYIA 4LWCA 3ULJA 1E2VA 3CCJA 2R7ZH 3TP6A 4HCEA 1TWHH 2CH4A 2DUDA 4Y7NH 1KDAA 3BZKA 2WAQE 3R2IA 3EJIA 3HS0C 4RGOS 1PTOC 1U4MA 2EYHA 1KD1C 2C35B 2KCCA 2QDBA 3FKIB 4KV6A 2CVRA 1M1KC 1SAPA 1F9PA 3SHLA 1D5XC 2UU9Q 2Z4HA 4A93H 2NBFA 1PDQA 1LTLA 4FO2A 1PFBA 4B3RQ 1A15A 3OWEB 1TWFH 3K5LA 2B2YA 3DXJC 2JA6H 2DY7A 1VS0A 3S2DB 5C44B 1YJ9A 4WORA 1JE4A 1XNRQ 4YIJA 2JXMB 3DWPA 4JW0A 1BBUA 1RF2D 1NE3A 2F0JA 2AWOA 2XGTA 1FJGQ 2N78A 1MGSA 5AJ3Q 5ELFA 3H3VC 1SBBB 3LGJA 2C9OA 3KF6A 4IQZA 2IT1A 4LNQA 2VQFL 1N34L 5GQOA 4C1NK 2HDMA 3TREA 1PV4A 3BZCA 2DGYA 5IE8A 4NXNQ 2K5QA 1IBML 3PF5A 1SE2A 1MJCA 4JBKA 1JT8A 1EY8A 1Q86C 1NJIC 5M3FH 2X69A 4OIKA 5IY0A 1M8AA 1T9HA 2NN6I 4HJ8A 2BH8A 1HA6A 1UE7A 5IIFA 1KIXA 5IP7H 3FHWA 1C9OA 2UUBQ 2B2VC 3I90A 5FJ8H 1SRUA 3PUZA 4A3KB 4Y52H 4JI1L 1VQKA 4XIGS 3EROA 4FXDA 1L1OC 1SMYC 4QUFA 3ND8A 5I2XA 1G6ZA 4YCUA 3UDIA 1JQYD 3MXGA 1S5ED 4A3JG 4POGA 4JBWA 2ZJQA 1HFGA 1EIHA 3NK9A 1N36L 3AYHB 3J81j 4FDBA 1V43A 3I4LA 2R93B 3M4PA 1EY5A 1GUGA 2Q2HA 1HJPA 1KL9A 4UPAA 1EIYB 2PZUA 1VQHA 1CTMA 2ALYB 1SYEA 3U58A 2EYFA 3DEOA 1MIUA 3U4VA 4DV1Q 1GUTA 1LTBD 1R4QB 2K01A 2K50A 1TY2A 3T16A 1R4PB 1YNJC 2PMZE 5IYCH 1AN8A 5JPMC 3OTOQ 3SEBA 3HFZB 4KHZA 1V1PA 4N9PA 3AFQA 1X54A 3SK8A 4JI4L 2WB1B 2A69C 1AW7A 2DJGC 4JI3L 5C6AA 2JA7H 4HIMA 1XMOQ 2AMCB 4IPCA 2L5TA 4RWSC 4AIMA 3E5SA 2IWHA 1PRTC 4CBVA 1JR0D 4QJFA 1WCMG 1EYCA 4IUPA 3E3XA 4X65Q 3PMFA 1I4HA 1KTKA 4RH6A 3MC0B 2E5LQ 4OIJA 3RLNA 1EY6A 2EYLA 2QA4A 1K28A 5C4JH 1EWCA 1SR3A 1HPCA 4N8X1 5C4HA 2UXDQ 1PTOD 3DUZA 2VUMH 1D1KA 1ESRA 2TMPA 3KK7A 2E2HB 1V9PA 3GTJH 3T1YQ 2YTVA 3GTLH 3PO2G 4DNTB 2E76C 5EKIA 2NVXH 2HUGA 3A56A 5CV4A 2EXZA 4DUYQ 5EGTA 3DWAA 4MN3A 1KNEA 3K59A 4U673 1I50H 3G4SA 4LF5L 2AQ1B 1V1OA 2IX1A 4LFCQ 3VA7A 1U5KA 1H95A 3NE5B 4IJHA 1JMCA 4LMQD 5A35A 1QVCA 2JYOA 2L11A 2MUYA 1JJCB 2AQ3B 2PZWA 1JOQA 1IL8A 4OO1G 5CC4A 1ILPA 1B3QA 3NTKA 1L1OB 3OYYA 3JAML 4A3DH 1YNNC 4A3LH 1QZGA 2F4VQ 1IZ6A 1QNUA 3Q0AA 5CBAE 3D0FA 4OWWB 1SMXA 4EQ5A 1GJXA 3HOVG 1BO0A 3CPWA 5KIXA 2B63B 4DV6Q 1ET6A 1QVFA 4NXML 1MBYA 1FYCA 3I4MG 2QW7A 3A74A 1FNVA 2H5XA 5C4ZA 2E2IB 3CCRA 1WTXA 1JOOA 2PYKA 1L0XB 3M9BA 4JOIC 3DLLA 1OO9B 4X64Q 2AWNA 2CCZA 1G91A 3CCVA 4K2KA 3D4RA 1QOHA 2L1BA 3EVQA 5JJIA 3F8TA 5FLMG 4DR2Q 2A8VA 4YHHQ 4LFAL 4YY3L 4CDCC 1EZ8A 1YHAA 4WJ4A 2WP8J 3FKIH 2EYPA 2RBMA 2IX0A 2A6ED 4CJ0B 4DV5Q 2RCFA 1K83B 1Q81C 4IUVA 1WD0A 3CC2A 3Q22A 3PIP3 1D5MC 5JEAH 4A3BB 3S2DH 5CGKA 4XT3B 5C44H 1HR0Q 5IYBH 2NVQH 3K0YA 1OTCA 3R93A 5M3MH 3S1MB 1UUPA 3S1RB 2TSSA 1TIID 3NBHB 1SYFA 3QOJA 1S40A 3S15B 4GKJQ 1IYVA 3KF8A 3WOEA 2K33A 1TS2A 1EY4A 2HD3A 3J80E 1MKHA 1Z7TA 2Q8TA 5E4WC 4GKKL 4F8MA 1BCPF 3A55A 4OWTB 5CV6A 4K6DA 1TWCB 2HHHL 1GD7A 1OXVA 2EIFA 5E7NA 1PRTD 3KLSX 3PO3B 1F2YA 3GV6A 3OMGA 1PZID 1X3PA 2DN8A 2V1CC 5C3EB 5EKKA 1ILQA 5IP9G 2J4XA 4B3SL 3A5ZB 2HT1A 2F0PA 3HKZE 3H91A 1A3UA 1VQDA 1WTRA 3TEHB 3M85A 3TMEA 3PUXA 4IFDH 3G6EA 5AFWA 2JN4A 1S72A 4A3KH 2K32A 1LTAD 4HIKA 1WTPA 1ASYA 4ZUIA 2BE5C 5IOCA 1RODA 4C3IG 1TT2A 2JA9A 3MEFA 1VCIA 4JV5L 1J5EQ 4BBSG 3I55A 4QIWE 1X3EA 1HNZL 3DM1A 3R8BA 1K3RA 1QILA 3X3MA 2VXWA 2HDLA 4DKAC 1ICWA 4X3KA 1A63A 3HKZG 2WAQB 1EWIA 2R93H 4IN3A 3VYUA 1G8ZD 2L0CA 5CMDA 1XX8A 4JI8L 5C0XH 3LX0A 4OX9L 1XMQQ 1IYUA 4UHVA 4X66L 5ELEA 1IKLA 1B2TA 1YNND 4KY5A 4I65A 1IBLL 1S4ZA 4DNIA 3I72A 2JA6B 4LF7Q 1PTOH 2VS1A 1YZ6A 2K05A 4RG1A 3UDXA 3JAME 4APVA 1WVLA 2KA7A 3MVVA 4DN4M 4GOPC 4ODGA 3V96A 4AQYL 3C46A 1MSHA 3FMCA 5BN5A 1GXDC 2LFNA 4HN7A 3OOCA 3DWQA 2D0PA 4EQNA 3D4DA 5KNDA 1PVOA 1HRJA 4DR5L 4HIOA 5JPNC 1ASZA 4CHTB 4JI5Q 1HZAA 1K0RA 4A3JB 2UXCQ 3SVMA 4UY8C 1XWEA 4AYBE 1B4OA 1IKMA 4CJ2C 3E0EA 4ZK9B 1H9SA 3H3VH 3CF5A 3MZ5A 2E2HH 4C3JH 3CCSA 4DR6L 3PUYA 5CV7A 3GTQB 2KUMA 3CPFA 3RLFA 2I5LX 1NUCA 1EU4A 1AP0A 1W3SA 2F3IA 4DUZQ 4GNXA 2QGQA 4BA1I 1TWAB 3OPOA 4LK1C 1K73C 1Z47A 1VQIA 2A68C 3H0GG 1I94Q 3W1GA 1N8RC 3MWYW 1U9RA 4FXKC 1NTGA 2ZT9C 4LF6Q 4CKBA 3CHBD 1H9KA 3M4YA 1CT1D 1LT3D 4JPBW 1KLUD 3I91A 4L8JA 2WINB 4XDXA 4DV4L 4QGUA 1LACA 1A3TA 1JWSD 1DJRD 2LXKA 2ZXRA 4B3TQ 2K04A 2K4KA 4PZ7A 4JCVE 4RKBA 1Q3LA 5FLXc 3NEMA 4DK6C 2B2YC 1LT5D 1HFNA 5TSSA 1J6QA 2PMZB 2B63H 4RGNA 3NBIA 1Q1BA 3FRPB 4BY1G 4A3EB 1SYBA 4J6HA 3V05A 1F9SA 2VW9A 1YEZA 5EJWA 1PH9A 4BY7H 4P2CB 4DK3C 1B70B 1U4LA 2EJFC 2E2IH 5I2YA 3A0JA 2UUCQ 3F2DA 1BDOA 2A6HC 3C1FA 5ISRA 1EQVA 2D0OA 2JA7B 1AEXA 3K7AB 3T1HL 5K36H 1JCKB 2R7DA 2SOBA 3OIQA 1N32Q 1EZ6A 4P74A 3K0XA 3V2TA 3NXWA 3U50C 2XWBB 4A3IG 3VR6A 2JA5G 1T5XD 4GOPB 1XPRA 4FF2A 5EBDA 2KCTA 3S24A 3MA2B 4A3BH 2ZJPA 1ENCA 5EPLA 3NSWA 1SE4A 2F0FA 3WWVA 3VR5A 5CV9A 3S1MH 5C3WA 4JYAL 1FVIA 3S1RH 1UE1A 4HSPA 5GADC 4DR7L 2CHBD 4O0AA 5C5MA 1VQEA 2K5NA 3GTLB 1P16A 3KFUA 4KMUC 2NVXB 1LTTD 4KK7A 4CKCA 4DV2Q 5D14A 3M7GA 4A3GG 1YITA 2GN5A 2QILA 1I3QB 5C3XA 2F1MA 1VQPA 3ONAB 2E8GA 2KEDA 3OIPA 1TWGH 1TWCH 1PH5A 3CCLA 1PYBA 2N88A 3ZYYX 1SNPA 4ABNA 4DR1Q 3CQZB 3DMUA 3PO3H 3GTKB 3GO5A 1KDBA 5GROA 1F2ZA 4TSSA 1EIFA 2N8NA 2JQOA 1I4QA 4GLAC 2PZTA 1HQMC 3J81i 1SEBD 1D6EC 4KHPL 4RHRA 4IURA 3BG3A 4DR4L 1TS3A 5ELCA 4A75A 1LLRD 5DEHA 2Z6KA 5JJZA 2A73B 4HTHA 3AMUA 1EQTA 1X3GA 2SDFA 2PI2A 4HSVA 3OW7A 3RUZA 4CGYB 5K5PA 4RGTA 2Q2IA 2ES2A 2A68D 1CK1A 1GO3E 2OCEA 2YV5A 3LNNA 1J9OA 5IWAL 1MSGA 1BXTA 4DV7Q 3D31A 1RDPD 4GZYC 2B3GA 2V4DA 1BNZA 1NMFA 1PLFA 1VDZA 5JAVA 1O7ZA 2Z0SA 2J7ZA 2VY3A 2RSNA 4PZ8A 2CQAA 3BVGA 1SNCA 2ZM6Q 3ITPA 3S1NH 1DD2A 1HUNA 2EY5A 1NSNS 5KYIA 3KF6B 4QB4A 1X6OA 3GTMB 2MGSA 1VQ6A 3HOWG 5HGTA 3FEWX 5BR8L 1JOKA 1A62A 2F0GA 2F0WA 4TQUS 2NVQB 1WD1A 2NVTB 5M3MB 4Q5VA 3EN2A 3A54A 4C3HG 1AZPA 2UXBQ 3KDFA 3S9WA 4A3FB 1ENFA 3U9SA 5IGDA 1UNSA 2RQXA 4KKTA 2A6HD 4HEDA 2WFWA 2UU9L 2EXDA 4GLXA 3N52A 4B3RL 4IALA 3RMHA 5C5LA 2DJFC 4K0KQ 4XT1B 4A3JH 2VNUD 1WOCA 3J81c 3HGBA 1X3QA 1QE6A 1WFQA 4KKSA 2PCFB 4ZYSA 1RD9D 2OF1A 3CAMA 5KGUA 3HKZB 5J39A 4IPGA 1XNRL 2YTXA 1Q8KA 3ULLA 2R7FA 1TQOA 4RA8A 4MIUA 3GTQH 2EQSA 1HUMA 1FJGL 3A8KE 2L55A 1I4RA 3CMAA 5AJ3L 1I6VC 1PFNA 1V1QA 4ULLA 4A93G 1LABA 1TWAH 3K57A 3GQBA 2LKVA 1LO5D 4QIWB 1TU2B 2X6LA 4EGVA 2KQ3A 3CC4A 2OEOA 1Q7YC 4NXNL 2AQ2B 5CR3A 1UEAB 5G3LF 1G6PA 1PXUA 3HG9A 2E2JH 1SROA 4G7ZC 2ID0A 4R4TA 2EDGA 2A6EC 2SEBD 3HOUB 1V1PB 1BKBA 2KJXA 5ELDA 4DAVA 5EKLA 5F2DA 4QCLA 5J1ZA 2UUBL 1Y1WG 1W2BA 3TN2A 2FXQA 1C48A 2L9HA 2WACA 3P1HA 1XTDA 2RCNA 2KCMA 4A3EH 4FF1A 1VMCA 1KXLA 1ZKOA 2N3SA 2BA1A 1CKNA 2PQAA 3I2ZA 3O13A 2ZXPA 1AZQA 1A0IA 2J0TD 4JK1C 3UDGA 4JI2Q 1PTOB 5LMNW 5M3FG 2NN6G 1IHZA 2F4IA 3G71A 1F2MA 3PO2H 4JBMA 1Y8PB 3K7AH 1WTVA 4DV0Q 2Z6BA 1A2UA 3KBGA 1CKOA 4LUVA 3BYYB 2VQEQ 1XXGA 4DV1L 2HIVA 5CBEE 1YIJA 3AQQA 4FF4A 5J3BA 1X32A 4MTNA 4AYBB 4H44C 3WDNA 4YCWA 1LTRD 1CZWA 3ER0A 4IO9A 2L12A 3I4OA 4JI2L 3OTOL 2NZOA 3HKSA 1F77A 4U68A 4OO1H 3BJUA 1PH1A 1STNA 2VB2X 4C3JB 4J15A 1XMOL 2M2LA 2AKWB 3E9HA 1HXYD 2OXPA 4A76A 5FLXL 4J1MA 1VMPA 2G5DA 4X65L 1JC7A 1K8AC 3VR4A 1I3QH 4UP7A 2E5LL 3PIOA 3I4MH 1VQFA 4DGZA 3I56A 2RHSB 2UXDL 1I6HB 4NW2A 3CQZH 5I9OA 4A3CH 1SYDA 3GTKH 3HOYG 1MHWC 4YWKA 2CW0C 3BDLA 3R2TA 1EUJA 1C8CA 1X9NA 1RKNA 1DONA 2IX3A 4R4OA 5I6YA 3CCUA 5FO9B 3M4OH 4R8IA 1SE3A 2RDFA 4FNFA 4DFAA 4IJLA 3T1YL 1KLGD 2PW5A 5LHY1 1SXTA 2PI2E 3L7ZC 4J8QA 4DU9A 4DUYL 5IGFA 1OXTA 2F03A 4XTCS 3UE0A 1CA5A 3M3YH 3MXUA 1VF5C 2H4OA 1PH8A 2O5IC 1IL2A 1NR2A 3IFTA 4LFCL 3HRZC 2QEXA 1RTNA 2I0QA 2VUMG 3IFDA 3I4NG 4BY7B 2JK8A 1EU3A 2RF4A 2K7VA 2H1EA 4R8NA 3VA5A 2JJQA 4X3TA 1VQCA 4DAYA 3HOXB 4LFBQ 2HIXA 1JE5A 4EQPA 4OELB 3QIAA 1OXUA 1LTGD 3JC66 2Q2TA 2F4VL 4BXXG 2NUCA 1XNQQ 2R92G 1SNQA 3QWNA 1JICA 1W6KA 2NTSA 3QB3A 4DA2A 2CWPA 1O7YA 3CP0A 1B44D 4DV6L 3H15A 3KF8B 1EY7A 3TQYA 1FGBD 3KUPA 4MHEA 4YCVA 5IYDH 3HOZG 1RJTA 5ELBA 3GTMH 1DCZA 1X56A 1STHA 3EQLC 1FGUA 2QDLA 1PRTB 3CRKC 4JI7Q 3TS2A 1HCZA 5IP9H 4A3DG 4X64L 2MNAA 2G9HD 3GV3A 4A3LG 1F9QA 2KHJA 4BBRG 2NVTH 1VQLA 4GNXC 1U0LA 2BA0A 2JE6I 1GM5A 4DR2L 4YHHL 2N55A 4A3FH 3S1QH 3FDTA 1SNOA 4OL7A 4OGQC 2F0EA 1BBWA 5M5XB 4C3IH 2CH4W 4NB3A 4DV5L 5FK9C 1CHPD 3Q24A 1TWGB 1QWYA 1L2FA 3RZDB 1O80A 3A7AB 4ZKBB 4X6AH 1CI3M 1BOSA 4F7XA 1HR0L 5NUCA 2C5CA 4KN4C 4XQJA 2M9VA 5DAUA 3K5NA 2F3VA 1LUZA 3F2BA 1VQOA 4LF9Q 2XNAC 3L0OA 4OHJA 4GKJL 3RN2A 3PSIA 2B2TA 3FKIG 1P8LA 4DXFA 1EYDA 3U4ZA 3CCMA 4JBJA 1O78A 4IFDI 2RHQB 4XQQA 3DM3A 1PYSB 4DV3Q 4X3UA 1HTLD 2F0NA 4NMZA 3J7ZC 3GTOB 1STBA 2F0LA 3NBHA 5C44G 2JEBI 2ZXOA 4PMCA 1KRSA 5IYBG 2I5MX 4ZCKA 3HOWB 1UE6A 3L9AX 4PMBA 4JI0Q 1WTHA 2Q2UA 4OWXB 5BN3A 3NHHA 1ZYRD 1UE5A 4LF9L 5FLXE 3RD4A 1S5DD 3QR8A 1SFOH 3HOUH 4L5QA 1FD7D 3NWSA 4FYDA 1N9WA 2CW0D 4PG3A 2XVSA 4LW1A 5KYLA 1NBWA 1V8QA 2WV6D 1E24A 2D2CC 5C0XI 1CSPA 3BDCA 2XRSD 3S1NB 5CV5A 4UDUC 1J5EL 3TBIB 3HEJA 3J81L 2EYJA 1NR4A 3G7LA 2OQKA 2M00A 5CV8A 2JA8G 1HNWQ 4KJOA 2ZJRA 1RIPA 3IKJA 4JI6Q 3I8ZA 1Y14B 1GUWA 1CQFA 1H9SB 1YNXA 4L5SA 1STEA 1XMQL 4R9WA 4WRDA 3QO2A 2K5WA 3H0GH 4R4QA 1PZJD 1G2SA 1VQ4A 1SLJA 2EJGC 1K8GA 5DM73 3RZOH 1EQQA 4XXEA 3TRZA 4KJNA 4PMWA 5G3LD 3PV0A 3K5OA 4LF7L 5M5WB 3TDQA 1IW7C 4FXGC 1VF7A 4GS3A 1BVSA 3H3VI 2KHSA 2K75A 1QVGA 1S3OA 2EJMA 1SJHD 2EE1A 4G57A 4A3MG 4IOCA 4CDFC 2K1BA 3SR1A 1A8VA 1PFSA 2NWGA 5C4XG 3J80c 1Z9FA 2Z6KC 1BUVT 4L5TA 1WTWA 3ZJYC 1QNKA 4HCSA 1Q90A 2F0TA 4XYQA 4B08A 3K80C 1Q8IA 4JI5L 3S16B 4K14A 1EY0A 1DOKA 2D9UA 3D6CA 1VQ5A 2UXCL 1I6HH 4HMJA 3CCQA 1JWUD 4V0BA 4LF8Q 2YTYA 1HZBA 4K8IA 2WB1G 1HNXQ 4BWGB 1YHQA 3C1EA 3MXNA 4ID6A 2E2JB 1BCPC 2SNSA 5HY6A 2OTJA 4JC0A 1Q82C 2UUAQ 1Y8NB 3N6RA 4K8JA 4PNYA 4X62Q 2NZ1D 4DUZL 3C3LA 2CKZB 1W6JA 5HGQA 1F9RA 4A3IH 3PQIA 1WCMB 2CFMA 1CSQA 4DK0A 1X55A 1TS5A 2Q8RE 1I94L 1DYQA 1PTOF 4HJ9A 4ZKCB 1HQRD 4RFBA 1EOTA 3EA6A 3U9OA 1KC8C 4LF6L 1QUQB 1YI2A 3T13A 4QQBX 5LMNQ 4H7BA 2IY5B 1EFID 1A2TA 3HOXH 1GHKA 1C0AA 5LMUQ 3OW2A 3PO2B 3T4AC 1WI5A 4B3MQ 1EY9A 1K9MC 4YWMA 4B3TL 2PQEA 2B39A 2RDGA 3ERQA 1PH2A 1ONLA 3D4WA 1K8MA 1LTID 4F88A 5KRUA 2XIWA 1A3VA 3WOFA 2RA4A 1VQAA 4DR3Q 3I73A 5EPKA 2UUCL 3K8AA 3GTPB 1CZGA 4FVMA 3T56B 1D8LA 2B2WA 1T5EA 2VZAA 2L4NA 2XTIA 4HMIA 4DK1A 1N33Q 3A8IE 4GN5A 2B63G 1MI2A 1N32L 3HOVB 2SNMA 4K2LA 4ME3A 1JB3A 5M5XH 3BYTB 1KABA 1TXYA 2EY6A 3J81E 2FMMA 2OWOA 1STAA 3NELA 1BBXC 1MJEA 3I4MB 3RZDH 3I4NB 1E7ZA 1VQJA 1DXMA 1S5CD 2I07B 4IUTA 4LF4Q 4G4KA 1AFPA 3FPPA 2VB3X 1STYA 3KYHC 3F2UA 4DXGA 1EFWA 3M4OB 1KDCA 1K0SA 2KBNA 4RMFA 4DV2L 1IW7D 4KKUA 1RL2A 3ERSX 1KRTA 1ML0D 1YVCA 2DNCA 4HJ5A 3M3YB 3P75A 3GTOH 1C7YA 3VR3A 5J22A 3AEVA 4CKEA 4XQNA 1CM9A 1B50A 4DR1L 4E6IA 4R4IA 3HOWH 1NY4A 3NWTA
chains in the Genus database with same CATH topology
1TR5A 4QF4A 1J8IA 4K5WA 3QOLA 3T53B 4Z9CB 1M4VA 1PYWD 2FJ2A 4TKOB 3I3CA 2Q8IB 3G6JB 4NDXA 1KAAA 3S17B 2O4XA 3J7AV 3KLSA 1C4QA 1SJED 2B8FA 1BCPD 1PRTF 1HA5A 1TVXA 5EPJA 3CRLC 2ENBA 3VYRA 1B3AA 4TRDA 2NYZD 2K28A 4ME5A 1B9MA 5T1GA 1BQQT 4CJ1B 2F0IA 2F0OA 1RHPA 3Q6SA 3S1QB 3CKIB 5JEAJ 5COYA 1ESFA 4DAPA 1WTOA 2QCPX 4C3IB 3AB9A 1D1IA 2B8GA 3S14B 1PMRA 4BBSB 5T1IA 3OMCA 2JSOA 3ND9A 3TSSA 3BZDB 1U4RA 1SNDA 4BS9A 4UAIA 5JVH3 4V190 1HHVA 3OHXC 4K5VA 3OWFA 1G2TA 3Q23A 1BR9A 5FOBB 4M1UB 5LL6S 2X6GA 3D8GA 2NB0A 3R3OA 2WKDA 4NP5A 3BDOA 2JA8B 1E0BA 1BF4A 2NN6H 4IFDJ 2EY1A 4G7OC 5D65A 5M9OA 4RHSA 2KECA 1EL0A 2HCIA 1SFOB 3BS1A 5KNBA 2RSOA 5IGBA 4L63B 4QMGA 3T51B 1U4PA 5I9PA 1ZXTA 3IAYA 2FHTA 4KY6A 2MJ8A 1I4XA 2F0QA 3M7NA 2RVLA 4ZAIA 5C0XJ 3NTIA 3SK5A 1NCVA 4A3MB 4O1NA 3H09A 2DY8A 5C4XB 3P7JA 3J80L 4IZ8A 4Q0FA 3DEPA 1EYAA 1SDFA 2G9DA 4PV1C 2LS01 3E6ZX 3H0GB 1G291 2K6AA 1FNWA 3AU7A 3RZOB 1QCBD 1RTOA 3C2PA 5DNFA 4ZQ3A 3NUCA 4M8AA 2B2TC 1R9TB 2XN9C 2KVMA 4OO1I 1WTQA 1E2WA 2WKCA 4WJWA 3UI2A 3X3NA 3D3RA 4B9WA 2MHVA 3QG1A 2IW3A 5E4XA 4BY1B 2E74C 1B1ZA 1ZYRC 2JP1A 4K6LA 2YU9B 2PNRC 3PIO3 3MXPA 2LY7A 4HAEA 1GUNA 3K58A 4RGMA 4LAAA 2Z8LA 1Q12A 1SNMA 4DNRB 5CYUA 4ZRZA 4C56C 1SYCA 3EFXD 4A3IB 1Y69U 1PFMA 4F87A 1II3A 2JA5B 2F0HA 3MHBA 4C2MB 2FINB 5M5YB 1S5FD 4EVOA 3SXHA 2KEEA 3E0JA 3PUWA 4RAUC 2AUKA 3OSOA 5JVG3 4RCNA 1TKWB 1LV9A 2WIIB 2K5DA 2ICIA 2BOSA 4FP5D 1NAPA 4A3GB 2B2VA 2E75C 2F0UA 1H9RA 5JOBA 2PO4A 5CORA 4XYOA 5A2QL 1S5BD 1B53A 3SK6A 1SMYD 4N9TA 1A6XA 2RDHA 3NQTA 1D2BA 4I7ZC 2XWJB 4QUCA 3IL8A 2IJ0A 1DOLA 2E2DC 2PW7A 3TP5A 3FPUB 3VYTA 2ICEC 3GD7A 4H0LC 1H9JA 2K03A 4BA2I 4KY7A 3QJYA 5KEEA 1DOMA 4EQOA 2GA4B 1YNJD 3MFGA 2O5JC 3KBXA 1EEID 1SSOA 2HCCA 1Y8OB 3NQIA 1XTCD 2D5DA 3MFYA 3D6WA 5EBCA 2A5HA 4B9XA 1ET9A 2R6GA 3TZUA 2FFKB 4WFN3 2A69D 3FVQA 3PUVA 1Y1VB 2NTTA 4IUUA 3LWUA 1DM0B 2F0VA 5JEAG 2EPBA 3GTGB 5IODA 3TZDA 2EZVA 2R3ZA 3DHQA 4X3SA 3S2HB 3VYSA 3VR2A 5KNCA 4C3HB 2IPKD 1OXXK 1QB5D 4O42A 4DF7A 3NTHA 5D3DA 1EWHA 2PPBC 3L3OC 1H9MA 1HTPA 2QKIC 2QF7A 2JEAI 2OT2A 2R7ZB 2B2WC 1TWHB 2EY2A 1GHJA 4Y7NB 1FNUA 1K8OA 3TP8A 1TS4A 4G7HC 4IFDG 5IT9L 4KD3A 1F2LA 1JORA 1EEFD 4KTAA 4A93B 2B2UC 1TWFB 5EQ0A 3MTSA 3H94A 4KN7C 1PZKD 3LWEA 5HURA 2O2LD 4ZUJA 1RCVD 3TP7A 1I4PA 4L6TB 1CQVA 5C0XG 4FF3A 5FO7B 2XRQD 1Y1WB 3K5MA 5A2QE 1CFMA 1E2ZA 3A8JE 1FR3A 3URYA 2Y0SB 1Z6HA 5M3FB 2BDOA 2XSCA 2EOTA 1GUSA 3W3AA 1GUOA 2LMCB 3BVZA 2R61A 1GOZA 2EYMA 1CHQD 1O7LA 1MD2D 3GP7A 2F0SA 3HZXA 4C3JG 5IGGA 4RKLA 4LJZC 3CU7A 2EVBA 1ZEQX 1JWMD 5IGEA 2IL8A 4RCOA 1D5ZC 2FMCA 4ZLTF 3J7AF 4KI0A 4S3SA 2QEJC 3K6OA 1CA6A 2BE5D 3HOYB 2D62A 3H6MA 5DM63 4NKLA 5D3IB 2NVYB 2DNEA 2F0KA 2F3WA 5E1FA 5BN4A 3NPPA 2KCNA 3W2DA 2F0MA 1L0YB 5LL6X 4H13C 3A7LA 5C4JB 2AUJD 3KLRA 2VUMB 2MPMA 2Z4IA 2BCOA 1UAPA 2B2UA 4IUQA 5IGCA 2EYOA 3GTJB 5I4DA 2F0DA 3SE0A 5IT9E 4KHVA 3SK4A 5FO8B 1TY0A 1B9NA 2YYZA 2HQEA 2A74C 5K36G 2I46A 3SDZA 1SYGA 1EIGA 5I6WA 1I50B 2R92B 1I4GA 2Z1CA 4ILWA 1LTSD 3MEHA 3J7YW 1BCPB 3I70A 3HOZB 1KNAA 4K5XA 3MAQA 1LT6D 4C1NI 3BVMA 2BDNA 1Q1EA 5FKAC 4IUNA 1ENAA 4A3DB 4BBRB 1OXSC 2RKSA 1LT4D 2MP1A 4KD4A 5E3FA 3NP8A 4PQXA 3P20A 3HP3A 1QJOA 4HR7B 1QG7A 2KOLA 1STGA 1DZ1A 1XYIA 1E2VA 3TP6A 4HCEA 1KDAA 3R2IA 3EJIA 3HS0C 4RGOS 1PTOC 1U4MA 2EYHA 2KCCA 2QDBA 3FKIB 4KV6A 2CVRA 1SAPA 1F9PA 3SHLA 1D5XC 2Z4HA 2NBFA 1PDQA 4FO2A 1PFBA 1A15A 3OWEB 3K5LA 2B2YA 3DXJC 2DY7A 3S2DB 5C44B 4WORA 1JE4A 4YIJA 2JXMB 3DWPA 1RF2D 2F0JA 2AWOA 1MGSA 5ELFA 3H3VC 1SBBB 2C9OA 4IQZA 2IT1A 4C1NK 2HDMA 2K5QA 1SE2A 1EY8A 2X69A 4OIKA 1M8AA 2NN6I 1HA6A 5IIFA 2B2VC 3I90A 3PUZA 4A3KB 4XIGS 3EROA 4FXDA 1SMYC 4QUFA 3ND8A 5I2XA 1G6ZA 1JQYD 3MXGA 1S5ED 4JBWA 1HFGA 1EIHA 3NK9A 1V43A 3I4LA 2R93B 1EY5A 1GUGA 2PZUA 1CTMA 1SYEA 2EYFA 3DEOA 1GUTA 1LTBD 1R4QB 2K01A 1TY2A 3T16A 1R4PB 1YNJC 1AN8A 5JPMC 3SEBA 4KHZA 1V1PA 4N9PA 3SK8A 2WB1B 2A69C 1AW7A 5C6AA 4RWSC 2L5TA 3E5SA 2IWHA 1PRTC 4CBVA 1JR0D 1EYCA 4IUPA 3PMFA 1I4HA 1KTKA 4RH6A 3MC0B 4OIJA 1EY6A 2EYLA 1EWCA 5C4HA 1HPCA 1PTOD 3DUZA 1D1KA 1ESRA 2TMPA 3KK7A 2E2HB 4DNTB 2E76C 5EKIA 2HUGA 3A56A 5CV4A 2EXZA 5EGTA 3DWAA 4MN3A 1KNEA 3K59A 4U673 2AQ1B 1V1OA 2IX1A 3VA7A 3NE5B 4LMQD 5A35A 2JYOA 2L11A 2MUYA 2AQ3B 2PZWA 1JOQA 1IL8A 4OO1G 5CC4A 1ILPA 3NTKA 3JAML 1YNNC 1QNUA 3Q0AA 5CBAE 1GJXA 1BO0A 5KIXA 2B63B 1ET6A 1MBYA 1FYCA 1FNVA 5C4ZA 2E2IB 1WTXA 1JOOA 2PYKA 1L0XB 1G91A 1OO9B 2AWNA 4K2KA 3D4RA 1QOHA 2L1BA 3EVQA 1EZ8A 2WP8J 2EYPA 2RBMA 2IX0A 2A6ED 4CJ0B 1K83B 4IUVA 1WD0A 3Q22A 3PIP3 1D5MC 5JEAH 4A3BB 5CGKA 4XT3B 3K0YA 3R93A 3S1MB 1UUPA 3S1RB 2TSSA 1TIID 3QOJA 1SYFA 3S15B 1IYVA 3KF8A 3WOEA 2K33A 1TS2A 1EY4A 3J80E 1Z7TA 2Q8TA 5E4WC 4F8MA 1BCPF 3A55A 5CV6A 4K6DA 1TWCB 1OXVA 1PRTD 3KLSX 3PO3B 1F2YA 3GV6A 3OMGA 1PZID 1X3PA 2DN8A 5C3EB 5EKKA 1ILQA 2J4XA 2F0PA 3H91A 1A3UA 1WTRA 3M85A 3TMEA 3PUXA 4IFDH 5AFWA 2K32A 1LTAD 1WTPA 4ZUIA 2BE5C 5IOCA 1RODA 4C3IG 1TT2A 1VCIA 3DM1A 3R8BA 1QILA 3X3MA 2VXWA 2HDLA 1ICWA 4X3KA 2WAQB 4IN3A 3VYUA 1G8ZD 2L0CA 5CMDA 1XX8A 5C0XH 3LX0A 1IYUA 5ELEA 1IKLA 1B2TA 1YNND 4KY5A 4I65A 1S4ZA 3I72A 2JA6B 1PTOH 2K05A 3JAME 1WVLA 2KA7A 3MVVA 4DN4M 4ODGA 3V96A 3C46A 1MSHA 3FMCA 5BN5A 1GXDC 2LFNA 4HN7A 3OOCA 3DWQA 4EQNA 3D4DA 5KNDA 1HRJA 5JPNC 4CHTB 4A3JB 3SVMA 1XWEA 1B4OA 1IKMA 4CJ2C 4ZK9B 1H9SA 3MZ5A 3PUYA 5CV7A 3GTQB 2KUMA 3RLFA 1NUCA 1EU4A 1AP0A 4BA1I 1TWAB 3OPOA 4LK1C 1Z47A 2A68C 3MWYW 1U9RA 4FXKC 2ZT9C 4CKBA 3CHBD 1H9KA 3M4YA 1CT1D 1LT3D 1KLUD 3I91A 4L8JA 2WINB 4XDXA 1LACA 1A3TA 1JWSD 1DJRD 2ZXRA 2K04A 4RKBA 1Q3LA 2B2YC 1LT5D 1HFNA 5TSSA 2PMZB 4RGNA 3NBIA 1Q1BA 3FRPB 4A3EB 1SYBA 4J6HA 3V05A 1F9SA 5EJWA 4P2CB 1U4LA 2EJFC 5I2YA 1BDOA 2A6HC 3C1FA 5ISRA 1EQVA 2JA7B 1AEXA 3K7AB 5K36H 1JCKB 2SOBA 3OIQA 1EZ6A 3V2TA 3NXWA 2XWBB 3VR6A 1T5XD 4FF2A 5EBDA 3MA2B 1ENCA 5EPLA 3NSWA 1SE4A 2F0FA 3VR5A 5CV9A 5C3WA 4HSPA 2CHBD 5C5MA 3GTLB 4KMUC 2NVXB 1LTTD 4KK7A 4CKCA 5D14A 3M7GA 2QILA 1I3QB 5C3XA 2F1MA 3ONAB 2KEDA 3OIPA 2N88A 3ZYYX 1SNPA 4ABNA 3CQZB 3DMUA 3GTKB 3GO5A 1KDBA 1F2ZA 4TSSA 1I4QA 2PZTA 1HQMC 1SEBD 1D6EC 4RHRA 4IURA 3BG3A 1TS3A 5ELCA 1LLRD 5DEHA 5JJZA 2A73B 4HTHA 3AMUA 1EQTA 2SDFA 4HSVA 3OW7A 3RUZA 4CGYB 5K5PA 4RGTA 2A68D 1CK1A 1J9OA 3LNNA 1MSGA 1BXTA 3D31A 1RDPD 4GZYC 2V4DA 1BNZA 1PLFA 1VDZA 5JAVA 1O7ZA 2J7ZA 2RSNA 2CQAA 3BVGA 1SNCA 3ITPA 1DD2A 1HUNA 2EY5A 1NSNS 5KYIA 4QB4A 3GTMB 2MGSA 5HGTA 3FEWX 1JOKA 2F0GA 2F0WA 4TQUS 2NVQB 1WD1A 2NVTB 5M3MB 4Q5VA 3A54A 4C3HG 1AZPA 3S9WA 4A3FB 1ENFA 3U9SA 5IGDA 1UNSA 2RQXA 4KKTA 2A6HD 4HEDA 3N52A 4IALA 3RMHA 5C5LA 4XT1B 2VNUD 3HGBA 1X3QA 1QE6A 4KKSA 2PCFB 4ZYSA 1RD9D 2OF1A 5KGUA 5J39A 3HKZB 1TQOA 4RA8A 4MIUA 1HUMA 3A8KE 2L55A 1I4RA 1I6VC 1PFNA 4ULLA 1LABA 3K57A 3GQBA 2LKVA 1LO5D 4QIWB 1TU2B 2X6LA 4EGVA 2KQ3A 2OEOA 2AQ2B 5CR3A 1UEAB 5G3LF 1PXUA 3HG9A 4G7ZC 2ID0A 2EDGA 2A6EC 2SEBD 3HOUB 1V1PB 2KJXA 5ELDA 4DAVA 5EKLA 5F2DA 4QCLA 5J1ZA 3TN2A 1C48A 2L9HA 2WACA 3P1HA 4FF1A 1VMCA 1ZKOA 2BA1A 3O13A 2ZXPA 1AZQA 2J0TD 4JK1C 1PTOB 2NN6G 1IHZA 2F4IA 1F2MA 1Y8PB 1WTVA 1A2UA 3KBGA 3BYYB 1XXGA 5CBEE 4FF4A 1X32A 4AYBB 4H44C 3WDNA 1LTRD 1CZWA 2L12A 1F77A 4U68A 4OO1H 1STNA 2VB2X 4C3JB 2M2LA 1HXYD 2OXPA 5FLXL 4J1MA 1VMPA 1JC7A 3VR4A 4DGZA 1I6HB 4NW2A 5I9OA 1SYDA 2CW0C 3BDLA 3R2TA 1C8CA 1DONA 1RKNA 2IX3A 5I6YA 5FO9B 4R8IA 1SE3A 2RDFA 4FNFA 4DFAA 1KLGD 2PW5A 5LHY1 1SXTA 3L7ZC 4J8QA 4DU9A 5IGFA 1OXTA 2F03A 4XTCS 1CA5A 3MXUA 1VF5C 2H4OA 2O5IC 1NR2A 3IFTA 3HRZC 1RTNA 3IFDA 4BY7B 1EU3A 2K7VA 2H1EA 4R8NA 3VA5A 4X3TA 3HOXB 4DAYA 4EQPA 3QIAA 1OXUA 1LTGD 2NUCA 1SNQA 3QWNA 1JICA 1W6KA 2NTSA 3QB3A 4DA2A 1O7YA 1B44D 1EY7A 1FGBD 3KUPA 4MHEA 1RJTA 5ELBA 1DCZA 1STHA 3EQLC 1PRTB 3CRKC 1HCZA 2G9HD 3GV3A 1F9QA 2BA0A 2JE6I 2N55A 3FDTA 1SNOA 4OL7A 4OGQC 2F0EA 5M5XB 5FK9C 1CHPD 3Q24A 1TWGB 1QWYA 3RZDB 1O80A 3A7AB 4ZKBB 1CI3M 1BOSA 4F7XA 5NUCA 2C5CA 4KN4C 4XQJA 2M9VA 5DAUA 3K5NA 2F3VA 2XNAC 4OHJA 2B2TA 4DXFA 1EYDA 1O78A 4IFDI 4XQQA 4X3UA 1HTLD 2F0NA 4NMZA 3GTOB 1STBA 2F0LA 3NBHA 2JEBI 2ZXOA 4PMCA 3HOWB 3L9AX 4PMBA 5BN3A 3NHHA 1ZYRD 5FLXE 3RD4A 1S5DD 1FD7D 3NWSA 4FYDA 2CW0D 2XVSA 5KYLA 2WV6D 1V8QA 2D2CC 5C0XI 3BDCA 2XRSD 3S1NB 5CV5A 4UDUC 3TBIB 3HEJA 3J81L 2EYJA 1NR4A 3G7LA 5CV8A 2M00A 4KJOA 3IKJA 3I8ZA 1GUWA 1CQFA 1H9SB 1STEA 4R9WA 4WRDA 3QO2A 2K5WA 1PZJD 1G2SA 2EJGC 5DM73 4XXEA 4KJNA 4PMWA 5G3LD 3PV0A 3K5OA 5M5WB 3TDQA 1IW7C 4FXGC 1VF7A 2KHSA 2EJMA 1SJHD 2EE1A 4G57A 2K1BA 3SR1A 2NWGA 1BUVT 1WTWA 1QNKA 4HCSA 1Q90A 2F0TA 4XYQA 4B08A 1Q8IA 3S16B 4K14A 1EY0A 1DOKA 2D9UA 3D6CA 4HMJA 1JWUD 4V0BA 4K8IA 4BWGB 3C1EA 3MXNA 4ID6A 2E2JB 1BCPC 2SNSA 1Y8NB 3N6RA 4K8JA 4PNYA 2NZ1D 3C3LA 1W6JA 1F9RA 1WCMB 4DK0A 1TS5A 2Q8RE 1DYQA 1PTOF 4ZKCB 1HQRD 4RFBA 1EOTA 3EA6A 3U9OA 3T13A 4H7BA 1EFID 1A2TA 1GHKA 3PO2B 3T4AC 1EY9A 2PQEA 2B39A 2RDGA 3ERQA 1ONLA 3D4WA 1K8MA 1LTID 4F88A 5KRUA 2XIWA 1A3VA 3WOFA 2RA4A 3I73A 5EPKA 3GTPB 1CZGA 4FVMA 3T56B 2B2WA 1T5EA 2L4NA 4HMIA 4DK1A 3A8IE 1MI2A 3HOVB 2SNMA 4K2LA 1JB3A 3BYTB 1KABA 2EY6A 3J81E 2FMMA 1STAA 1BBXC 3I4MB 3I4NB 1DXMA 1S5CD 2I07B 4IUTA 1AFPA 4G4KA 3FPPA 2VB3X 1STYA 3F2UA 4DXGA 3M4OB 1KDCA 1IW7D 4KKUA 1ML0D 2DNCA 3M3YB 3P75A 3VR3A 5J22A 4CKEA 4XQNA 1CM9A 1B50A 4E6IA 3NWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUU A;  4ZKC B;  1MSH A;  3R93 A;  1J8I A;  1EOT A;  2KEC A;  1EL0 A;  2HCI A;  2EPB A;  2MGS A;  2HDM A;  1PFM A;  1ESR A;  1EIG A;  1AP0 A;  1JIC A;  2EOT A;  1HRJ A;  1O7Y A;  2RSO A;  2FJ2 A;  3TZD A;  1WTV A;  2FIN B;  3I3C A;  1WD1 A;  2R3Z A;  4X3S A;  1NR4 A;  3G7L A;  3KUP A;  5EPL A;  2Q8T A;  5E4W C;  5EKI A;  1U4P A;  1ZXT A;  2HUG A;  4MHE A;  2KEE A;  3SVM A;  1RJT A;  1AZP A;  5CBE E;  2FHT A;  2X69 A;  4OIK A;  1B4O A;  4RAU C;  1KNA A;  1M8A A;  3I8Z A;  4MN3 A;  2MJ8 A;  1KNE A;  4CJ2 C;  4ZK9 B;  1IKM A;  1HA6 A;  2RVL A;  1X32 A;  1TVX A;  4ZAI A;  1GUW A;  2BDN A;  4HED A;  4O42 A;  5EPJ A;  3GV6 A;  3GV3 A;  1LV9 A;  2B2V C;  3I90 A;  1F9Q A;  1X3P A;  2L12 A;  3N52 A;  1B3A A;  1NCV A;  5D14 A;  2KUM A;  1ILQ A;  4LMQ D;  4XT1 B;  2NYZ D;  4R9W A;  3QO2 A;  2K28 A;  1NAP A;  4U68 A;  1X3Q A;  1QE6 A;  2B2V A;  2JYO A;  2XIW A;  2N55 A;  4QUF A;  2RA4 A;  1G2S A;  3FDT A;  3ONA B;  2KED A;  2DY8 A;  2L11 A;  2MP1 A;  1G6Z A;  2B2W C;  3H91 A;  2N88 A;  5T1G A;  3P7J A;  4CJ1 B;  2M2L A;  5EPK A;  3DEP A;  1WTR A;  1IL8 A;  3HP3 A;  5COR A;  1SDF A;  1ILP A;  1RHP A;  1HFG A;  5AFW A;  1EIH A;  1B53 A;  2B2W A;  3MWY W;  4RA8 A;  3Q6S A;  1QG7 A;  1VMP A;  2KOL A;  2IL8 A;  1HUM A;  1WTP A;  1ROD A;  1O80 A;  2L4N A;  4ZLT F;  4ZKB B;  5COY A;  1DZ1 A;  5CBA E;  1PFN A;  1WTO A;  1XYI A;  4QUC A;  1RTO A;  1F2L A;  3IL8 A;  1MI2 A;  1BO0 A;  1DOL A;  2EE1 A;  3I91 A;  5DNF A;  4XDX A;  3DM1 A;  4NW2 A;  3DEO A;  3FPU B;  5T1I A;  2B2U C;  2B2T C;  2K1B A;  2VXW A;  1CA6 A;  2NWG A;  2HDL A;  2FMM A;  1C8C A;  2KVM A;  1DON A;  2K01 A;  4IUR A;  2X6L A;  1BBX C;  1ICW A;  1U4R A;  4X3K A;  1WTW A;  1WTQ A;  1QNK A;  4HCS A;  2B2T A;  1U4M A;  2K04 A;  2K03 A;  4R8I A;  1Q3L A;  5EQ0 A;  4IUT A;  3MTS A;  4UAI A;  2CVR A;  3UI2 A;  5JJZ A;  1WTX A;  1SAP A;  1F9P A;  2B2Y C;  1G91 A;  3LWE A;  5CMD A;  1DOK A;  1XX8 A;  2D9U A;  1HFN A;  1HHV A;  4X3U A;  1EQT A;  1PDQ A;  2SDF A;  3F2U A;  4HSV A;  1PFB A;  1DOM A;  1A15 A;  2L1B A;  5E4X A;  1F9S A;  2B2Y A;  5EJW A;  1G2T A;  1CA5 A;  2DY7 A;  2JP1 A;  1SSO A;  3KBX A;  2HCC A;  1NR2 A;  1IKL A;  1B2T A;  1J9O A;  1MSG A;  1U4L A;  2X6G A;  3D6W A;  4RWS C;  1RTN A;  1JE4 A;  1S4Z A;  3TN2 A;  3IFD A;  4HAE A;  1ML0 D;  2L9H A;  1BNZ A;  2MPM A;  4CJ0 B;  1PLF A;  1O7Z A;  2NZ1 D;  4IUV A;  2K05 A;  2B2U A;  1VMC A;  2FFK B;  2J7Z A;  4IUP A;  4IUQ A;  2RSN A;  1WD0 A;  1E0B A;  1F9R A;  1CM9 A;  1WVL A;  2H1E A;  1MGS A;  1BF4 A;  1B50 A;  4X3T A;  4DN4 M;  1AZQ A;  4XT3 B;  5D65 A;  4OIJ A;  2Q8R E;  1HUN A; 
#chains in the Genus database with same CATH topology
 1TR5 A;  4QF4 A;  1J8I A;  3Q8D A;  4K5W A;  3QOL A;  3T53 B;  4Z9C B;  2AHO B;  1M4V A;  1PYW D;  2FJ2 A;  4C3H H;  4TKO B;  2ATW A;  2I5H A;  3I3C A;  2Q8I B;  3G6J B;  3G48 A;  4NDX A;  1KAA A;  3S17 B;  3K81 C;  2O4X A;  3J7A V;  3KLS A;  1C4Q A;  1SJE D;  2B8F A;  1Y1V G;  4LUZ A;  1BCP D;  1VQG A;  1PRT F;  1HA5 A;  3PO3 G;  1D7Q A;  1TVX A;  1GVP A;  5EPJ A;  4MTK A;  3CRL C;  5C3E G;  2ENB A;  3VYR A;  1B3A A;  4TRD A;  2NYZ D;  2K28 A;  2KHI A;  4ME5 A;  1B9M A;  5T1G A;  1BQQ T;  4CJ1 B;  4DV7 L;  2F0I A;  3RR5 A;  2F0O A;  1RHP A;  2NZH A;  3Q6S A;  1JJ2 A;  3S1Q B;  3J7A 5;  3CKI B;  2VQF Q;  1K3B C;  1N34 Q;  5JEA J;  5COY A;  1ESF A;  4DAP A;  2ZM6 L;  2QCP X;  1WTO A;  4C3I B;  3AB9 A;  1D1I A;  2B8G A;  1IBM Q;  4HJ7 A;  1E22 A;  3S14 B;  1PMR A;  4BBS B;  5T1I A;  3OMC A;  2JSO A;  4QL5 A;  3ND9 A;  3TSS A;  2HQL A;  2R7Z G;  3BZD B;  5M5W H;  2WAQ G;  3STB C;  1U4R A;  1SND A;  3UE1 A;  4BS9 A;  4UAI A;  5JVH 3;  1HZ9 A;  4V19 0;  3F1Z A;  1HHV A;  5IT9 c;  1NNX A;  2UXB L;  4JI1 Q;  4L5R C;  1PH6 A;  1VQ9 A;  3OHX C;  4K5V A;  1Y1W H;  3OWF A;  1G2T A;  3Q23 A;  1BR9 A;  3BU2 A;  4M1U B;  5FOB B;  5LL6 S;  2X6G A;  3S16 H;  3D8G A;  2JA6 G;  4K0K L;  2NB0 A;  3R3O A;  1N36 Q;  2WKD A;  4NP5 A;  3BDO A;  2JA8 B;  1E0B A;  1BF4 A;  2NN6 H;  4IFD J;  1UEB A;  2EY1 A;  4G7O C;  1EYG A;  2Y0S E;  5D65 A;  1CKN B;  2PQA B;  4KLK A;  5M9O A;  4RHS A;  2KEC A;  1EL0 A;  2HCI A;  1SFO B;  3BS1 A;  5KNB A;  1CKM A;  1VQN A;  2RSO A;  1YJN A;  1WCM H;  5IGB A;  1LYL A;  4L63 B;  4QMG A;  3T51 B;  4R4C A;  1U4P A;  5I9P A;  1ZXT A;  3IAY A;  2FHT A;  1YJW A;  4KY6 A;  2MJ8 A;  4GN4 B;  1I4X A;  2F0Q A;  3M7N A;  2RVL A;  4ZAI A;  4JI4 Q;  2Y0S G;  3IRB A;  1JJG A;  3W1B A;  5C0X J;  1B7Y B;  4JI3 Q;  3NTI A;  4IPH A;  3SK5 A;  2F52 A;  1VQM A;  1NCV A;  4A3M B;  4O1N A;  1VQ7 A;  5IP7 G;  3H09 A;  5FJ8 G;  4IOA A;  2DY8 A;  5C4X B;  4H02 A;  3P7J A;  3J80 L;  4IZ8 A;  4Q0F A;  3DEP A;  1VQB A;  1EYA A;  1SDF A;  2G9D A;  4PV1 C;  1LM0 A;  2LS0 1;  3E6Z X;  3H0G B;  1G29 1;  2K6A A;  1XPO A;  4N8F A;  1FNW A;  1B8A A;  2MO1 A;  3AU7 A;  3HOY H;  3RZO B;  1QCB D;  1RTO A;  3C2P A;  1PA6 A;  2NVY H;  5DNF A;  4ZQ3 A;  3NUC A;  4M8A A;  2B2T C;  3GTP H;  1R9T B;  2XN9 C;  1WYD A;  2KVM A;  1GKH A;  4OO1 I;  1WTQ A;  1E2W A;  2WKC A;  4WJW A;  4DV0 L;  3UI2 A;  4LF5 Q;  2VQE L;  3X3N A;  3D3R A;  3HOV H;  4B9W A;  4A3E G;  3CXC A;  2MHV A;  4MNO A;  3RLO A;  3QG1 A;  5IYC G;  4DAM A;  2IW3 A;  4WJ3 M;  3I7F A;  5E4X A;  3FP9 A;  1JB7 A;  4BY1 B;  2E74 C;  1B1Z A;  1KHI A;  1ZYR C;  2JP1 A;  4K6L A;  2YU9 B;  2PNR C;  3I4N H;  3PIO 3;  4HID A;  3MXP A;  2LY7 A;  4HAE A;  3EIV A;  3ULP A;  1SN8 A;  2MQH A;  1GUN A;  2JA7 G;  2GVB A;  3K58 A;  4RGM A;  4LAA A;  2Z8L A;  1Q12 A;  4BXX H;  5FLM H;  2R92 H;  1SNM A;  4DNR B;  5CYU A;  4ZRZ A;  4C56 C;  4DAY B;  1SYC A;  3STB D;  3EFX D;  4NXM Q;  4A3I B;  1AH9 A;  1Y69 U;  1PFM A;  4F87 A;  1II3 A;  3F2C A;  2JA5 B;  2F0H A;  3B6Y A;  3MHB A;  3W5O A;  3HOZ H;  4C2M B;  2FIN B;  2K14 A;  5M5Y B;  3CW2 C;  1S5F D;  4EVO A;  3SXH A;  2KEE A;  3UDF A;  3E0J A;  3PUW A;  4RAU C;  2AUK A;  4BBR H;  3OSO A;  1YBY A;  4LFA Q;  1IXR A;  4YY3 Q;  5JVG 3;  3PGZ A;  4RCN A;  1TKW B;  2ZTC A;  1LV9 A;  2WII B;  5EAY A;  3S17 H;  2K5D A;  2ICI A;  2BOS A;  3AFP A;  4FP5 D;  1NAP A;  4A3G B;  2B2V A;  2E75 C;  4CDE C;  2F0U A;  1H9R A;  5GAE C;  4A3C G;  2PNH A;  5JOB A;  2PO4 A;  1L1O A;  5COR A;  4XYO A;  5A2Q L;  1S5B D;  1B53 A;  3SK6 A;  1SMY D;  3CD6 A;  4N9T A;  3SGI A;  1A6X A;  2RDH A;  3NQT A;  4P73 A;  1D2B A;  4I7Z C;  2XWJ B;  4QUC A;  4LFB L;  3IL8 A;  2IJ0 A;  1DOL A;  2E2D C;  2PW7 A;  1FL0 A;  3TP5 A;  4OON A;  3FPU B;  3VYT A;  3CC7 A;  2ICE C;  1XNQ L;  3GD7 A;  4R1J A;  5ELO A;  4GKK Q;  1KAW A;  3A5U A;  1ICF B;  3L2P A;  4H0L C;  3PIP A;  1H9J A;  2HHH Q;  2K03 A;  3PF4 A;  4BA2 I;  2BH2 A;  4KY7 A;  3S14 H;  4BBS H;  3QJY A;  5KEE A;  1DOM A;  4EQO A;  3PCO B;  2L15 A;  4B3S Q;  2GA4 B;  1YNJ D;  4JI7 L;  3MFG A;  2O5J C;  3KBX A;  1EEI D;  1SSO A;  2HCC A;  1Y8O B;  1NMG A;  3NQI A;  1XTC D;  3MFY A;  2D5D A;  3D6W A;  5EBC A;  3VDY A;  2A5H A;  4B9X A;  1ET9 A;  2R6G A;  3TZU A;  2B29 A;  3RNU A;  2FFK B;  4WFN 3;  2A69 D;  3FVQ A;  3PUV A;  2ASB A;  1M90 C;  1Y1V B;  2K52 A;  2NTT A;  4JV5 Q;  5IYD G;  4IUU A;  1X3F A;  1HNZ Q;  3LWU A;  1DM0 B;  2F0V A;  5JEA G;  2EPB A;  3GTG B;  4I7A A;  1QZH A;  2IHF A;  5IOD A;  2JA8 H;  3TZD A;  2EZV A;  5M3M G;  3J80 i;  2R3Z A;  3DHQ A;  4X3S A;  3S2H B;  3VYS A;  4A3F G;  4JI8 Q;  5JJL A;  3VR2 A;  4OX9 Q;  5KNC A;  4C3H B;  2IPK D;  4X66 Q;  1OXX K;  2CQO A;  1QB5 D;  4O42 A;  4DF7 A;  3K7U C;  3NTH A;  4POF A;  5D3D A;  4DV3 L;  1IBL Q;  1EWH A;  2PPB C;  3L3O C;  1H9M A;  1HTP A;  2QKI C;  2QF7 A;  4CDD C;  2OT2 A;  2JEA I;  2R7Z B;  2P5Z X;  2B2W C;  1E3P A;  4P75 A;  1TWH B;  2EY2 A;  3KJO A;  1GHJ A;  4P71 A;  2A1A A;  4Y7N B;  4JI0 L;  1XPU A;  4AQY Q;  4QY7 A;  1FNU A;  1K8O A;  4A3M H;  3TP8 A;  1TS4 A;  4G7H C;  4IFD G;  5IT9 L;  4DPG A;  4KD3 A;  1F2L A;  4A3K G;  5C4X H;  1JOR A;  1EEF D;  4NPS A;  4P72 A;  4DR5 Q;  4KTA A;  1CUK A;  4A93 B;  2B2U C;  4UP9 A;  1TWF B;  4GNX B;  4OEM B;  5EQ0 A;  3MTS A;  1AE2 A;  3H94 A;  4KN7 C;  1PZK D;  3LWE A;  5HUR A;  2O2L D;  4ZUJ A;  4MZ9 A;  2CWA A;  4DR6 Q;  3NEN A;  1HNW L;  2R93 G;  3HOU G;  1R9T H;  1RCV D;  2WB1 E;  4JI6 L;  3TP7 A;  1I4P A;  4L6T B;  4JOI A;  1HH2 P;  1CQV A;  5C0X G;  3MXN B;  4FF3 A;  5FO7 B;  2XRQ D;  3E9I A;  1Y1W B;  3K5M A;  5A2Q E;  3JAM i;  3RN5 A;  1IYJ B;  4BY1 H;  1CFM A;  2YU9 H;  1E2Z A;  3A8J E;  2N49 A;  1FR3 A;  3URY A;  3KOJ A;  2Y0S B;  4DV4 Q;  1Z6H A;  5M3F B;  4TVA B;  1L0W A;  4LUO A;  2BDO A;  2XSC A;  2EOT A;  3TS0 A;  1WJJ A;  1GUS A;  1X65 A;  3W3A A;  1GUO A;  4GLV B;  2LMC B;  3BVZ A;  2R61 A;  1GOZ A;  2GVA A;  2EYM A;  1CHQ D;  4AYB G;  2JA5 H;  1HZC A;  1O7L A;  2ZTD A;  4C2M H;  1MD2 D;  4A4I A;  5M5Y H;  3GP7 A;  2F0S A;  2OQ0 A;  4LF8 L;  2K5V A;  5JJK A;  3HZX A;  1HNX L;  4C3J G;  5IGG A;  1O7I A;  4RKL A;  4LJZ C;  3CU7 A;  3EBE A;  2EVB A;  1ZEQ X;  1PH7 A;  3T1H Q;  1JWM D;  2UUA L;  4AH6 A;  3M4Q A;  5GAG C;  5ELN A;  5IGE A;  1PHJ A;  4OXP A;  4X62 L;  4O2D A;  2IL8 A;  4RCO A;  2Z9H A;  1D5Z C;  2FMC A;  2ZTE A;  4ZLT F;  4A3G H;  1E1O A;  3J7A F;  2VL6 A;  4KI0 A;  2LXJ A;  4S3S A;  2QEJ C;  1XJV A;  3K6O A;  1CA6 A;  2A19 A;  2BE5 D;  4EX5 A;  4JVZ A;  3HOY B;  2D62 A;  3H6M A;  1Q46 A;  1YHB A;  5DM6 3;  1SE8 A;  4NKL A;  5D3I B;  4JYA Q;  2NVY B;  5LMN L;  1IBK Q;  3JAM c;  4DR7 Q;  2DNE A;  2F0K A;  5LMU L;  4GN3 B;  2F3W A;  2OTL A;  5E1F A;  5BN4 A;  4B3M L;  3NPP A;  2KCN A;  1QUQ A;  1K83 H;  3W2D A;  2IHE A;  2F0M A;  1L0Y B;  1I5F A;  5LL6 X;  4H13 C;  3A7L A;  5C4J B;  2KEN A;  2AUJ D;  3KLR A;  2VUM B;  2MPM A;  2Z4I A;  1HR0 W;  2BCO A;  4BY7 G;  1UAP A;  2B2U A;  4IUQ A;  5IGC A;  2EYO A;  3HOX G;  3GTJ B;  2LSS A;  5I4D A;  1IBK L;  4DR3 L;  2F0D A;  3SE0 A;  3CME A;  5IT9 E;  1PH3 A;  4KHV A;  3SK4 A;  5FO8 B;  3S15 H;  1TY0 A;  1B9N A;  2YYZ A;  2HQE A;  1DGS A;  5GAH C;  4KHP Q;  1EQR A;  2A74 C;  4GOP A;  2I46 A;  5K36 G;  2MFI A;  3CCE A;  3SDZ A;  1SYG A;  1EIG A;  4DR4 Q;  2MO0 A;  5I6W A;  1I50 B;  2R92 B;  1N33 L;  1I4G A;  2Z1C A;  1Y1V H;  4YWL A;  4ILW A;  5L37 A;  1LTS D;  3MEH A;  3J7Y W;  1PH4 A;  1G51 A;  4PZ6 A;  3GDE A;  5C3E H;  1BCP B;  3I70 A;  4A3B G;  1VQ8 A;  3GTG H;  3HOZ B;  1KNA A;  4IPD A;  4HJA A;  4K5X A;  3MAQ A;  1LT6 D;  4C1N I;  4ALP A;  3BVM A;  2BDN A;  4LF4 L;  1Q1E A;  5IWA Q;  4JG2 A;  5FKA C;  4IUN A;  1ENA A;  4A3D B;  3ICE A;  3S2H H;  4BBR B;  2K5H A;  4UP8 A;  1OXS C;  2RKS A;  5DLQ E;  1LT4 D;  1AE3 A;  3KLW A;  2MP1 A;  4KD4 A;  5E3F A;  3NP8 A;  5H1S E;  1UWV A;  4PQX A;  3P20 A;  3HP3 A;  1KQS A;  1QJO A;  1E1T A;  3KJP A;  4HR7 B;  1QG7 A;  2KOL A;  1STG A;  3KDF B;  1DZ1 A;  1EOV A;  5BR8 Q;  1XYI A;  4LWC A;  3ULJ A;  1E2V A;  3CCJ A;  2R7Z H;  3TP6 A;  4HCE A;  1TWH H;  2CH4 A;  2DUD A;  4Y7N H;  1KDA A;  3BZK A;  2WAQ E;  3R2I A;  3EJI A;  3HS0 C;  4RGO S;  1PTO C;  1U4M A;  2EYH A;  1KD1 C;  2C35 B;  2KCC A;  2QDB A;  3FKI B;  4KV6 A;  2CVR A;  1M1K C;  1SAP A;  1F9P A;  3SHL A;  1D5X C;  2UU9 Q;  2Z4H A;  4A93 H;  2NBF A;  1PDQ A;  1LTL A;  4FO2 A;  1PFB A;  4B3R Q;  1A15 A;  3OWE B;  1TWF H;  3K5L A;  2B2Y A;  3DXJ C;  2JA6 H;  2DY7 A;  1VS0 A;  3S2D B;  5C44 B;  1YJ9 A;  4WOR A;  1JE4 A;  1XNR Q;  4YIJ A;  2JXM B;  3DWP A;  4JW0 A;  1BBU A;  1RF2 D;  1NE3 A;  2F0J A;  2AWO A;  2XGT A;  1FJG Q;  2N78 A;  1MGS A;  5AJ3 Q;  5ELF A;  3H3V C;  1SBB B;  3LGJ A;  2C9O A;  3KF6 A;  4IQZ A;  2IT1 A;  4LNQ A;  2VQF L;  1N34 L;  5GQO A;  4C1N K;  2HDM A;  3TRE A;  1PV4 A;  3BZC A;  2DGY A;  5IE8 A;  4NXN Q;  2K5Q A;  1IBM L;  3PF5 A;  1SE2 A;  1MJC A;  4JBK A;  1JT8 A;  1EY8 A;  1Q86 C;  1NJI C;  5M3F H;  2X69 A;  4OIK A;  5IY0 A;  1M8A A;  1T9H A;  2NN6 I;  4HJ8 A;  2BH8 A;  1HA6 A;  1UE7 A;  5IIF A;  1KIX A;  5IP7 H;  3FHW A;  1C9O A;  2UUB Q;  2B2V C;  3I90 A;  5FJ8 H;  1SRU A;  3PUZ A;  4A3K B;  4Y52 H;  4JI1 L;  1VQK A;  4XIG S;  3ERO A;  4FXD A;  1L1O C;  1SMY C;  4QUF A;  3ND8 A;  5I2X A;  1G6Z A;  4YCU A;  3UDI A;  1JQY D;  3MXG A;  1S5E D;  4A3J G;  4POG A;  4JBW A;  2ZJQ A;  1HFG A;  1EIH A;  3NK9 A;  1N36 L;  3AYH B;  3J81 j;  4FDB A;  1V43 A;  3I4L A;  2R93 B;  3M4P A;  1EY5 A;  1GUG A;  2Q2H A;  1HJP A;  1KL9 A;  4UPA A;  1EIY B;  2PZU A;  1VQH A;  1CTM A;  2ALY B;  1SYE A;  3U58 A;  2EYF A;  3DEO A;  1MIU A;  3U4V A;  4DV1 Q;  1GUT A;  1LTB D;  1R4Q B;  2K01 A;  2K50 A;  1TY2 A;  3T16 A;  1R4P B;  1YNJ C;  2PMZ E;  5IYC H;  1AN8 A;  5JPM C;  3OTO Q;  3SEB A;  3HFZ B;  4KHZ A;  1V1P A;  4N9P A;  3AFQ A;  1X54 A;  3SK8 A;  4JI4 L;  2WB1 B;  2A69 C;  1AW7 A;  2DJG C;  4JI3 L;  5C6A A;  2JA7 H;  4HIM A;  1XMO Q;  2AMC B;  4IPC A;  2L5T A;  4RWS C;  4AIM A;  3E5S A;  2IWH A;  1PRT C;  4CBV A;  1JR0 D;  4QJF A;  1WCM G;  1EYC A;  4IUP A;  3E3X A;  4X65 Q;  3PMF A;  1I4H A;  1KTK A;  4RH6 A;  3MC0 B;  2E5L Q;  4OIJ A;  3RLN A;  1EY6 A;  2EYL A;  2QA4 A;  1K28 A;  5C4J H;  1EWC A;  1SR3 A;  1HPC A;  4N8X 1;  5C4H A;  2UXD Q;  1PTO D;  3DUZ A;  2VUM H;  1D1K A;  1ESR A;  2TMP A;  3KK7 A;  2E2H B;  1V9P A;  3GTJ H;  3T1Y Q;  2YTV A;  3GTL H;  3PO2 G;  4DNT B;  2E76 C;  5EKI A;  2NVX H;  2HUG A;  3A56 A;  5CV4 A;  2EXZ A;  4DUY Q;  5EGT A;  3DWA A;  4MN3 A;  1KNE A;  3K59 A;  4U67 3;  1I50 H;  3G4S A;  4LF5 L;  2AQ1 B;  1V1O A;  2IX1 A;  4LFC Q;  3VA7 A;  1U5K A;  1H95 A;  3NE5 B;  4IJH A;  1JMC A;  4LMQ D;  5A35 A;  1QVC A;  2JYO A;  2L11 A;  2MUY A;  1JJC B;  2AQ3 B;  2PZW A;  1JOQ A;  1IL8 A;  4OO1 G;  5CC4 A;  1ILP A;  1B3Q A;  3NTK A;  1L1O B;  3OYY A;  3JAM L;  4A3D H;  1YNN C;  4A3L H;  1QZG A;  2F4V Q;  1IZ6 A;  1QNU A;  3Q0A A;  5CBA E;  3D0F A;  4OWW B;  1SMX A;  4EQ5 A;  1GJX A;  3HOV G;  1BO0 A;  3CPW A;  5KIX A;  2B63 B;  4DV6 Q;  1ET6 A;  1QVF A;  4NXM L;  1MBY A;  1FYC A;  3I4M G;  2QW7 A;  3A74 A;  1FNV A;  2H5X A;  5C4Z A;  2E2I B;  3CCR A;  1WTX A;  1JOO A;  2PYK A;  1L0X B;  3M9B A;  4JOI C;  3DLL A;  1OO9 B;  4X64 Q;  2AWN A;  2CCZ A;  1G91 A;  3CCV A;  4K2K A;  3D4R A;  1QOH A;  2L1B A;  3EVQ A;  5JJI A;  3F8T A;  5FLM G;  4DR2 Q;  2A8V A;  4YHH Q;  4LFA L;  4YY3 L;  4CDC C;  1EZ8 A;  1YHA A;  4WJ4 A;  2WP8 J;  3FKI H;  2EYP A;  2RBM A;  2IX0 A;  2A6E D;  4CJ0 B;  4DV5 Q;  2RCF A;  1K83 B;  1Q81 C;  4IUV A;  1WD0 A;  3CC2 A;  3Q22 A;  3PIP 3;  1D5M C;  5JEA H;  4A3B B;  3S2D H;  5CGK A;  4XT3 B;  5C44 H;  1HR0 Q;  5IYB H;  2NVQ H;  3K0Y A;  1OTC A;  3R93 A;  5M3M H;  3S1M B;  1UUP A;  3S1R B;  2TSS A;  1TII D;  3NBH B;  1SYF A;  3QOJ A;  1S40 A;  3S15 B;  4GKJ Q;  1IYV A;  3KF8 A;  3WOE A;  2K33 A;  1TS2 A;  1EY4 A;  2HD3 A;  3J80 E;  1MKH A;  1Z7T A;  2Q8T A;  5E4W C;  4GKK L;  4F8M A;  1BCP F;  3A55 A;  4OWT B;  5CV6 A;  4K6D A;  1TWC B;  2HHH L;  1GD7 A;  1OXV A;  2EIF A;  5E7N A;  1PRT D;  3KLS X;  3PO3 B;  1F2Y A;  3GV6 A;  3OMG A;  1PZI D;  1X3P A;  2DN8 A;  2V1C C;  5C3E B;  5EKK A;  1ILQ A;  5IP9 G;  2J4X A;  4B3S L;  3A5Z B;  2HT1 A;  2F0P A;  3HKZ E;  3H91 A;  1A3U A;  1VQD A;  1WTR A;  3TEH B;  3M85 A;  3TME A;  3PUX A;  4IFD H;  3G6E A;  5AFW A;  2JN4 A;  1S72 A;  4A3K H;  2K32 A;  1LTA D;  4HIK A;  1WTP A;  1ASY A;  4ZUI A;  2BE5 C;  5IOC A;  1ROD A;  4C3I G;  1TT2 A;  2JA9 A;  3MEF A;  1VCI A;  4JV5 L;  1J5E Q;  4BBS G;  3I55 A;  4QIW E;  1X3E A;  1HNZ L;  3DM1 A;  3R8B A;  1K3R A;  1QIL A;  3X3M A;  2VXW A;  2HDL A;  4DKA C;  1ICW A;  4X3K A;  1A63 A;  3HKZ G;  2WAQ B;  1EWI A;  2R93 H;  4IN3 A;  3VYU A;  1G8Z D;  2L0C A;  5CMD A;  1XX8 A;  4JI8 L;  5C0X H;  3LX0 A;  4OX9 L;  1XMQ Q;  1IYU A;  4UHV A;  4X66 L;  5ELE A;  1IKL A;  1B2T A;  1YNN D;  4KY5 A;  4I65 A;  1IBL L;  1S4Z A;  4DNI A;  3I72 A;  2JA6 B;  4LF7 Q;  1PTO H;  2VS1 A;  1YZ6 A;  2K05 A;  4RG1 A;  3UDX A;  3JAM E;  4APV A;  1WVL A;  2KA7 A;  3MVV A;  4DN4 M;  4GOP C;  4ODG A;  3V96 A;  4AQY L;  3C46 A;  1MSH A;  3FMC A;  5BN5 A;  1GXD C;  2LFN A;  4HN7 A;  3OOC A;  3DWQ A;  2D0P A;  4EQN A;  3D4D A;  5KND A;  1PVO A;  1HRJ A;  4DR5 L;  4HIO A;  5JPN C;  1ASZ A;  4CHT B;  4JI5 Q;  1HZA A;  1K0R A;  4A3J B;  2UXC Q;  3SVM A;  4UY8 C;  1XWE A;  4AYB E;  1B4O A;  1IKM A;  4CJ2 C;  3E0E A;  4ZK9 B;  1H9S A;  3H3V H;  3CF5 A;  3MZ5 A;  2E2H H;  4C3J H;  3CCS A;  4DR6 L;  3PUY A;  5CV7 A;  3GTQ B;  2KUM A;  3CPF A;  3RLF A;  2I5L X;  1NUC A;  1EU4 A;  1AP0 A;  1W3S A;  2F3I A;  4DUZ Q;  4GNX A;  2QGQ A;  4BA1 I;  1TWA B;  3OPO A;  4LK1 C;  1K73 C;  1Z47 A;  1VQI A;  2A68 C;  3H0G G;  1I94 Q;  3W1G A;  1N8R C;  3MWY W;  1U9R A;  4FXK C;  1NTG A;  2ZT9 C;  4LF6 Q;  4CKB A;  3CHB D;  1H9K A;  3M4Y A;  1CT1 D;  1LT3 D;  4JPB W;  1KLU D;  3I91 A;  4L8J A;  2WIN B;  4XDX A;  4DV4 L;  4QGU A;  1LAC A;  1A3T A;  1JWS D;  1DJR D;  2LXK A;  2ZXR A;  4B3T Q;  2K04 A;  2K4K A;  4PZ7 A;  4JCV E;  4RKB A;  1Q3L A;  5FLX c;  3NEM A;  4DK6 C;  2B2Y C;  1LT5 D;  1HFN A;  5TSS A;  1J6Q A;  2PMZ B;  2B63 H;  4RGN A;  3NBI A;  1Q1B A;  3FRP B;  4BY1 G;  4A3E B;  1SYB A;  4J6H A;  3V05 A;  1F9S A;  2VW9 A;  1YEZ A;  5EJW A;  1PH9 A;  4BY7 H;  4P2C B;  4DK3 C;  1B70 B;  1U4L A;  2EJF C;  2E2I H;  5I2Y A;  3A0J A;  2UUC Q;  3F2D A;  1BDO A;  2A6H C;  3C1F A;  5ISR A;  1EQV A;  2D0O A;  2JA7 B;  1AEX A;  3K7A B;  3T1H L;  5K36 H;  1JCK B;  2R7D A;  2SOB A;  3OIQ A;  1N32 Q;  1EZ6 A;  4P74 A;  3K0X A;  3V2T A;  3NXW A;  3U50 C;  2XWB B;  4A3I G;  3VR6 A;  2JA5 G;  1T5X D;  4GOP B;  1XPR A;  4FF2 A;  5EBD A;  2KCT A;  3S24 A;  3MA2 B;  4A3B H;  2ZJP A;  1ENC A;  5EPL A;  3NSW A;  1SE4 A;  2F0F A;  3WWV A;  3VR5 A;  5CV9 A;  3S1M H;  5C3W A;  4JYA L;  1FVI A;  3S1R H;  1UE1 A;  4HSP A;  5GAD C;  4DR7 L;  2CHB D;  4O0A A;  5C5M A;  1VQE A;  2K5N A;  3GTL B;  1P16 A;  3KFU A;  4KMU C;  2NVX B;  1LTT D;  4KK7 A;  4CKC A;  4DV2 Q;  5D14 A;  3M7G A;  4A3G G;  1YIT A;  2GN5 A;  2QIL A;  1I3Q B;  5C3X A;  2F1M A;  1VQP A;  3ONA B;  2E8G A;  2KED A;  3OIP A;  1TWG H;  1TWC H;  1PH5 A;  3CCL A;  1PYB A;  2N88 A;  3ZYY X;  1SNP A;  4ABN A;  4DR1 Q;  3CQZ B;  3DMU A;  3PO3 H;  3GTK B;  3GO5 A;  1KDB A;  5GRO A;  1F2Z A;  4TSS A;  1EIF A;  2N8N A;  2JQO A;  1I4Q A;  4GLA C;  2PZT A;  1HQM C;  3J81 i;  1SEB D;  1D6E C;  4KHP L;  4RHR A;  4IUR A;  3BG3 A;  4DR4 L;  1TS3 A;  5ELC A;  4A75 A;  1LLR D;  5DEH A;  2Z6K A;  5JJZ A;  2A73 B;  4HTH A;  3AMU A;  1EQT A;  1X3G A;  2SDF A;  2PI2 A;  4HSV A;  3OW7 A;  3RUZ A;  4CGY B;  5K5P A;  4RGT A;  2Q2I A;  2ES2 A;  2A68 D;  1CK1 A;  1GO3 E;  2OCE A;  2YV5 A;  3LNN A;  1J9O A;  5IWA L;  1MSG A;  1BXT A;  4DV7 Q;  3D31 A;  1RDP D;  4GZY C;  2B3G A;  2V4D A;  1BNZ A;  1NMF A;  1PLF A;  1VDZ A;  5JAV A;  1O7Z A;  2Z0S A;  2J7Z A;  2VY3 A;  2RSN A;  4PZ8 A;  2CQA A;  3BVG A;  1SNC A;  2ZM6 Q;  3ITP A;  3S1N H;  1DD2 A;  1HUN A;  2EY5 A;  1NSN S;  5KYI A;  3KF6 B;  4QB4 A;  1X6O A;  3GTM B;  2MGS A;  1VQ6 A;  3HOW G;  5HGT A;  3FEW X;  5BR8 L;  1JOK A;  1A62 A;  2F0G A;  2F0W A;  4TQU S;  2NVQ B;  1WD1 A;  2NVT B;  5M3M B;  4Q5V A;  3EN2 A;  3A54 A;  4C3H G;  1AZP A;  2UXB Q;  3KDF A;  3S9W A;  4A3F B;  1ENF A;  3U9S A;  5IGD A;  1UNS A;  2RQX A;  4KKT A;  2A6H D;  4HED A;  2WFW A;  2UU9 L;  2EXD A;  4GLX A;  3N52 A;  4B3R L;  4IAL A;  3RMH A;  5C5L A;  2DJF C;  4K0K Q;  4XT1 B;  4A3J H;  2VNU D;  1WOC A;  3J81 c;  3HGB A;  1X3Q A;  1QE6 A;  1WFQ A;  4KKS A;  2PCF B;  4ZYS A;  1RD9 D;  2OF1 A;  3CAM A;  5KGU A;  3HKZ B;  5J39 A;  4IPG A;  1XNR L;  2YTX A;  1Q8K A;  3ULL A;  2R7F A;  1TQO A;  4RA8 A;  4MIU A;  3GTQ H;  2EQS A;  1HUM A;  1FJG L;  3A8K E;  2L55 A;  1I4R A;  3CMA A;  5AJ3 L;  1I6V C;  1PFN A;  1V1Q A;  4ULL A;  4A93 G;  1LAB A;  1TWA H;  3K57 A;  3GQB A;  2LKV A;  1LO5 D;  4QIW B;  1TU2 B;  2X6L A;  4EGV A;  2KQ3 A;  3CC4 A;  2OEO A;  1Q7Y C;  4NXN L;  2AQ2 B;  5CR3 A;  1UEA B;  5G3L F;  1G6P A;  1PXU A;  3HG9 A;  2E2J H;  1SRO A;  4G7Z C;  2ID0 A;  4R4T A;  2EDG A;  2A6E C;  2SEB D;  3HOU B;  1V1P B;  1BKB A;  2KJX A;  5ELD A;  4DAV A;  5EKL A;  5F2D A;  4QCL A;  5J1Z A;  2UUB L;  1Y1W G;  1W2B A;  3TN2 A;  2FXQ A;  1C48 A;  2L9H A;  2WAC A;  3P1H A;  1XTD A;  2RCN A;  2KCM A;  4A3E H;  4FF1 A;  1VMC A;  1KXL A;  1ZKO A;  2N3S A;  2BA1 A;  1CKN A;  2PQA A;  3I2Z A;  3O13 A;  2ZXP A;  1AZQ A;  1A0I A;  2J0T D;  4JK1 C;  3UDG A;  4JI2 Q;  1PTO B;  5LMN W;  5M3F G;  2NN6 G;  1IHZ A;  2F4I A;  3G71 A;  1F2M A;  3PO2 H;  4JBM A;  1Y8P B;  3K7A H;  1WTV A;  4DV0 Q;  2Z6B A;  1A2U A;  3KBG A;  1CKO A;  4LUV A;  3BYY B;  2VQE Q;  1XXG A;  4DV1 L;  2HIV A;  5CBE E;  1YIJ A;  3AQQ A;  4FF4 A;  5J3B A;  1X32 A;  4MTN A;  4AYB B;  4H44 C;  3WDN A;  4YCW A;  1LTR D;  1CZW A;  3ER0 A;  4IO9 A;  2L12 A;  3I4O A;  4JI2 L;  3OTO L;  2NZO A;  3HKS A;  1F77 A;  4U68 A;  4OO1 H;  3BJU A;  1PH1 A;  1STN A;  2VB2 X;  4C3J B;  4J15 A;  1XMO L;  2M2L A;  2AKW B;  3E9H A;  1HXY D;  2OXP A;  4A76 A;  5FLX L;  4J1M A;  1VMP A;  2G5D A;  4X65 L;  1JC7 A;  1K8A C;  3VR4 A;  1I3Q H;  4UP7 A;  2E5L L;  3PIO A;  3I4M H;  1VQF A;  4DGZ A;  3I56 A;  2RHS B;  2UXD L;  1I6H B;  4NW2 A;  3CQZ H;  5I9O A;  4A3C H;  1SYD A;  3GTK H;  3HOY G;  1MHW C;  4YWK A;  2CW0 C;  3BDL A;  3R2T A;  1EUJ A;  1C8C A;  1X9N A;  1RKN A;  1DON A;  2IX3 A;  4R4O A;  5I6Y A;  3CCU A;  5FO9 B;  3M4O H;  4R8I A;  1SE3 A;  2RDF A;  4FNF A;  4DFA A;  4IJL A;  3T1Y L;  1KLG D;  2PW5 A;  5LHY 1;  1SXT A;  2PI2 E;  3L7Z C;  4J8Q A;  4DU9 A;  4DUY L;  5IGF A;  1OXT A;  2F03 A;  4XTC S;  3UE0 A;  1CA5 A;  3M3Y H;  3MXU A;  1VF5 C;  2H4O A;  1PH8 A;  2O5I C;  1IL2 A;  1NR2 A;  3IFT A;  4LFC L;  3HRZ C;  2QEX A;  1RTN A;  2I0Q A;  2VUM G;  3IFD A;  3I4N G;  4BY7 B;  2JK8 A;  1EU3 A;  2RF4 A;  2K7V A;  2H1E A;  4R8N A;  3VA5 A;  2JJQ A;  4X3T A;  1VQC A;  4DAY A;  3HOX B;  4LFB Q;  2HIX A;  1JE5 A;  4EQP A;  4OEL B;  3QIA A;  1OXU A;  1LTG D;  3JC6 6;  2Q2T A;  2F4V L;  4BXX G;  2NUC A;  1XNQ Q;  2R92 G;  1SNQ A;  3QWN A;  1JIC A;  1W6K A;  2NTS A;  3QB3 A;  4DA2 A;  2CWP A;  1O7Y A;  3CP0 A;  1B44 D;  4DV6 L;  3H15 A;  3KF8 B;  1EY7 A;  3TQY A;  1FGB D;  3KUP A;  4MHE A;  4YCV A;  5IYD H;  3HOZ G;  1RJT A;  5ELB A;  3GTM H;  1DCZ A;  1X56 A;  1STH A;  3EQL C;  1FGU A;  2QDL A;  1PRT B;  3CRK C;  4JI7 Q;  3TS2 A;  1HCZ A;  5IP9 H;  4A3D G;  4X64 L;  2MNA A;  2G9H D;  3GV3 A;  4A3L G;  1F9Q A;  2KHJ A;  4BBR G;  2NVT H;  1VQL A;  4GNX C;  1U0L A;  2BA0 A;  2JE6 I;  1GM5 A;  4DR2 L;  4YHH L;  2N55 A;  4A3F H;  3S1Q H;  3FDT A;  1SNO A;  4OL7 A;  4OGQ C;  2F0E A;  1BBW A;  5M5X B;  4C3I H;  2CH4 W;  4NB3 A;  4DV5 L;  5FK9 C;  1CHP D;  3Q24 A;  1TWG B;  1QWY A;  1L2F A;  3RZD B;  1O80 A;  3A7A B;  4ZKB B;  4X6A H;  1CI3 M;  1BOS A;  4F7X A;  1HR0 L;  5NUC A;  2C5C A;  4KN4 C;  4XQJ A;  2M9V A;  5DAU A;  3K5N A;  2F3V A;  1LUZ A;  3F2B A;  1VQO A;  4LF9 Q;  2XNA C;  3L0O A;  4OHJ A;  4GKJ L;  3RN2 A;  3PSI A;  2B2T A;  3FKI G;  1P8L A;  4DXF A;  1EYD A;  3U4Z A;  3CCM A;  4JBJ A;  1O78 A;  4IFD I;  2RHQ B;  4XQQ A;  3DM3 A;  1PYS B;  4DV3 Q;  4X3U A;  1HTL D;  2F0N A;  4NMZ A;  3J7Z C;  3GTO B;  1STB A;  2F0L A;  3NBH A;  5C44 G;  2JEB I;  2ZXO A;  4PMC A;  1KRS A;  5IYB G;  2I5M X;  4ZCK A;  3HOW B;  1UE6 A;  3L9A X;  4PMB A;  4JI0 Q;  1WTH A;  2Q2U A;  4OWX B;  5BN3 A;  3NHH A;  1ZYR D;  1UE5 A;  4LF9 L;  5FLX E;  3RD4 A;  1S5D D;  3QR8 A;  1SFO H;  3HOU H;  4L5Q A;  1FD7 D;  3NWS A;  4FYD A;  1N9W A;  2CW0 D;  4PG3 A;  2XVS A;  4LW1 A;  5KYL A;  1NBW A;  1V8Q A;  2WV6 D;  1E24 A;  2D2C C;  5C0X I;  1CSP A;  3BDC A;  2XRS D;  3S1N B;  5CV5 A;  4UDU C;  1J5E L;  3TBI B;  3HEJ A;  3J81 L;  2EYJ A;  1NR4 A;  3G7L A;  2OQK A;  2M00 A;  5CV8 A;  2JA8 G;  1HNW Q;  4KJO A;  2ZJR A;  1RIP A;  3IKJ A;  4JI6 Q;  3I8Z A;  1Y14 B;  1GUW A;  1CQF A;  1H9S B;  1YNX A;  4L5S A;  1STE A;  1XMQ L;  4R9W A;  4WRD A;  3QO2 A;  2K5W A;  3H0G H;  4R4Q A;  1PZJ D;  1G2S A;  1VQ4 A;  1SLJ A;  2EJG C;  1K8G A;  5DM7 3;  3RZO H;  1EQQ A;  4XXE A;  3TRZ A;  4KJN A;  4PMW A;  5G3L D;  3PV0 A;  3K5O A;  4LF7 L;  5M5W B;  3TDQ A;  1IW7 C;  4FXG C;  1VF7 A;  4GS3 A;  1BVS A;  3H3V I;  2KHS A;  2K75 A;  1QVG A;  1S3O A;  2EJM A;  1SJH D;  2EE1 A;  4G57 A;  4A3M G;  4IOC A;  4CDF C;  2K1B A;  3SR1 A;  1A8V A;  1PFS A;  2NWG A;  5C4X G;  3J80 c;  1Z9F A;  2Z6K C;  1BUV T;  4L5T A;  1WTW A;  3ZJY C;  1QNK A;  4HCS A;  1Q90 A;  2F0T A;  4XYQ A;  4B08 A;  3K80 C;  1Q8I A;  4JI5 L;  3S16 B;  4K14 A;  1EY0 A;  1DOK A;  2D9U A;  3D6C A;  1VQ5 A;  2UXC L;  1I6H H;  4HMJ A;  3CCQ A;  1JWU D;  4V0B A;  4LF8 Q;  2YTY A;  1HZB A;  4K8I A;  2WB1 G;  1HNX Q;  4BWG B;  1YHQ A;  3C1E A;  3MXN A;  4ID6 A;  2E2J B;  1BCP C;  2SNS A;  5HY6 A;  2OTJ A;  4JC0 A;  1Q82 C;  2UUA Q;  1Y8N B;  3N6R A;  4K8J A;  4PNY A;  4X62 Q;  2NZ1 D;  4DUZ L;  3C3L A;  2CKZ B;  1W6J A;  5HGQ A;  1F9R A;  4A3I H;  3PQI A;  1WCM B;  2CFM A;  1CSQ A;  4DK0 A;  1X55 A;  1TS5 A;  2Q8R E;  1I94 L;  1DYQ A;  1PTO F;  4HJ9 A;  4ZKC B;  1HQR D;  4RFB A;  1EOT A;  3EA6 A;  3U9O A;  1KC8 C;  4LF6 L;  1QUQ B;  1YI2 A;  3T13 A;  4QQB X;  5LMN Q;  4H7B A;  2IY5 B;  1EFI D;  1A2T A;  3HOX H;  1GHK A;  1C0A A;  5LMU Q;  3OW2 A;  3PO2 B;  3T4A C;  1WI5 A;  4B3M Q;  1EY9 A;  1K9M C;  4YWM A;  4B3T L;  2PQE A;  2B39 A;  2RDG A;  3ERQ A;  1PH2 A;  1ONL A;  3D4W A;  1K8M A;  1LTI D;  4F88 A;  5KRU A;  2XIW A;  1A3V A;  3WOF A;  2RA4 A;  1VQA A;  4DR3 Q;  3I73 A;  5EPK A;  2UUC L;  3K8A A;  3GTP B;  1CZG A;  4FVM A;  3T56 B;  1D8L A;  2B2W A;  1T5E A;  2VZA A;  2L4N A;  2XTI A;  4HMI A;  4DK1 A;  1N33 Q;  3A8I E;  4GN5 A;  2B63 G;  1MI2 A;  1N32 L;  3HOV B;  2SNM A;  4K2L A;  4ME3 A;  1JB3 A;  5M5X H;  3BYT B;  1KAB A;  1TXY A;  2EY6 A;  3J81 E;  2FMM A;  2OWO A;  1STA A;  3NEL A;  1BBX C;  1MJE A;  3I4M B;  3RZD H;  3I4N B;  1E7Z A;  1VQJ A;  1DXM A;  1S5C D;  2I07 B;  4IUT A;  4LF4 Q;  4G4K A;  1AFP A;  3FPP A;  2VB3 X;  1STY A;  3KYH C;  3F2U A;  4DXG A;  1EFW A;  3M4O B;  1KDC A;  1K0S A;  2KBN A;  4RMF A;  4DV2 L;  1IW7 D;  4KKU A;  1RL2 A;  3ERS X;  1KRT A;  1ML0 D;  1YVC A;  2DNC A;  4HJ5 A;  3M3Y B;  3P75 A;  3GTO H;  1C7Y A;  3VR3 A;  5J22 A;  3AEV A;  4CKE A;  4XQN A;  1CM9 A;  1B50 A;  4DR1 L;  4E6I A;  4R4I A;  3HOW H;  1NY4 A;  3NWT A; 
#chains in the Genus database with same CATH homology
 1TR5 A;  4QF4 A;  1J8I A;  4K5W A;  3QOL A;  3T53 B;  4Z9C B;  1M4V A;  1PYW D;  2FJ2 A;  4TKO B;  3I3C A;  2Q8I B;  3G6J B;  4NDX A;  1KAA A;  3S17 B;  2O4X A;  3J7A V;  3KLS A;  1C4Q A;  1SJE D;  2B8F A;  1BCP D;  1PRT F;  1HA5 A;  1TVX A;  5EPJ A;  3CRL C;  2ENB A;  3VYR A;  1B3A A;  4TRD A;  2NYZ D;  2K28 A;  4ME5 A;  1B9M A;  5T1G A;  1BQQ T;  4CJ1 B;  2F0I A;  2F0O A;  1RHP A;  3Q6S A;  3S1Q B;  3CKI B;  5JEA J;  5COY A;  1ESF A;  4DAP A;  1WTO A;  2QCP X;  4C3I B;  3AB9 A;  1D1I A;  2B8G A;  3S14 B;  1PMR A;  4BBS B;  5T1I A;  3OMC A;  2JSO A;  3ND9 A;  3TSS A;  3BZD B;  1U4R A;  1SND A;  4BS9 A;  4UAI A;  5JVH 3;  4V19 0;  1HHV A;  3OHX C;  4K5V A;  3OWF A;  1G2T A;  3Q23 A;  1BR9 A;  5FOB B;  4M1U B;  5LL6 S;  2X6G A;  3D8G A;  2NB0 A;  3R3O A;  2WKD A;  4NP5 A;  3BDO A;  2JA8 B;  1E0B A;  1BF4 A;  2NN6 H;  4IFD J;  2EY1 A;  4G7O C;  5D65 A;  5M9O A;  4RHS A;  2KEC A;  1EL0 A;  2HCI A;  1SFO B;  3BS1 A;  5KNB A;  2RSO A;  5IGB A;  4L63 B;  4QMG A;  3T51 B;  1U4P A;  5I9P A;  1ZXT A;  3IAY A;  2FHT A;  4KY6 A;  2MJ8 A;  1I4X A;  2F0Q A;  3M7N A;  2RVL A;  4ZAI A;  5C0X J;  3NTI A;  3SK5 A;  1NCV A;  4A3M B;  4O1N A;  3H09 A;  2DY8 A;  5C4X B;  3P7J A;  3J80 L;  4IZ8 A;  4Q0F A;  3DEP A;  1EYA A;  1SDF A;  2G9D A;  4PV1 C;  2LS0 1;  3E6Z X;  3H0G B;  1G29 1;  2K6A A;  1FNW A;  3AU7 A;  3RZO B;  1QCB D;  1RTO A;  3C2P A;  5DNF A;  4ZQ3 A;  3NUC A;  4M8A A;  2B2T C;  1R9T B;  2XN9 C;  2KVM A;  4OO1 I;  1WTQ A;  1E2W A;  2WKC A;  4WJW A;  3UI2 A;  3X3N A;  3D3R A;  4B9W A;  2MHV A;  3QG1 A;  2IW3 A;  5E4X A;  4BY1 B;  2E74 C;  1B1Z A;  1ZYR C;  2JP1 A;  4K6L A;  2YU9 B;  2PNR C;  3PIO 3;  3MXP A;  2LY7 A;  4HAE A;  1GUN A;  3K58 A;  4RGM A;  4LAA A;  2Z8L A;  1Q12 A;  1SNM A;  4DNR B;  5CYU A;  4ZRZ A;  4C56 C;  1SYC A;  3EFX D;  4A3I B;  1Y69 U;  1PFM A;  4F87 A;  1II3 A;  2JA5 B;  2F0H A;  3MHB A;  4C2M B;  2FIN B;  5M5Y B;  1S5F D;  4EVO A;  3SXH A;  2KEE A;  3E0J A;  3PUW A;  4RAU C;  2AUK A;  3OSO A;  5JVG 3;  4RCN A;  1TKW B;  1LV9 A;  2WII B;  2K5D A;  2ICI A;  2BOS A;  4FP5 D;  1NAP A;  4A3G B;  2B2V A;  2E75 C;  2F0U A;  1H9R A;  5JOB A;  2PO4 A;  5COR A;  4XYO A;  5A2Q L;  1S5B D;  1B53 A;  3SK6 A;  1SMY D;  4N9T A;  1A6X A;  2RDH A;  3NQT A;  1D2B A;  4I7Z C;  2XWJ B;  4QUC A;  3IL8 A;  2IJ0 A;  1DOL A;  2E2D C;  2PW7 A;  3TP5 A;  3FPU B;  3VYT A;  2ICE C;  3GD7 A;  4H0L C;  1H9J A;  2K03 A;  4BA2 I;  4KY7 A;  3QJY A;  5KEE A;  1DOM A;  4EQO A;  2GA4 B;  1YNJ D;  3MFG A;  2O5J C;  3KBX A;  1EEI D;  1SSO A;  2HCC A;  1Y8O B;  3NQI A;  1XTC D;  2D5D A;  3MFY A;  3D6W A;  5EBC A;  2A5H A;  4B9X A;  1ET9 A;  2R6G A;  3TZU A;  2FFK B;  4WFN 3;  2A69 D;  3FVQ A;  3PUV A;  1Y1V B;  2NTT A;  4IUU A;  3LWU A;  1DM0 B;  2F0V A;  5JEA G;  2EPB A;  3GTG B;  5IOD A;  3TZD A;  2EZV A;  2R3Z A;  3DHQ A;  4X3S A;  3S2H B;  3VYS A;  3VR2 A;  5KNC A;  4C3H B;  2IPK D;  1OXX K;  1QB5 D;  4O42 A;  4DF7 A;  3NTH A;  5D3D A;  1EWH A;  2PPB C;  3L3O C;  1H9M A;  1HTP A;  2QKI C;  2QF7 A;  2JEA I;  2OT2 A;  2R7Z B;  2B2W C;  1TWH B;  2EY2 A;  1GHJ A;  4Y7N B;  1FNU A;  1K8O A;  3TP8 A;  1TS4 A;  4G7H C;  4IFD G;  5IT9 L;  4KD3 A;  1F2L A;  1JOR A;  1EEF D;  4KTA A;  4A93 B;  2B2U C;  1TWF B;  5EQ0 A;  3MTS A;  3H94 A;  4KN7 C;  1PZK D;  3LWE A;  5HUR A;  2O2L D;  4ZUJ A;  1RCV D;  3TP7 A;  1I4P A;  4L6T B;  1CQV A;  5C0X G;  4FF3 A;  5FO7 B;  2XRQ D;  1Y1W B;  3K5M A;  5A2Q E;  1CFM A;  1E2Z A;  3A8J E;  1FR3 A;  3URY A;  2Y0S B;  1Z6H A;  5M3F B;  2BDO A;  2XSC A;  2EOT A;  1GUS A;  3W3A A;  1GUO A;  2LMC B;  3BVZ A;  2R61 A;  1GOZ A;  2EYM A;  1CHQ D;  1O7L A;  1MD2 D;  3GP7 A;  2F0S A;  3HZX A;  4C3J G;  5IGG A;  4RKL A;  4LJZ C;  3CU7 A;  2EVB A;  1ZEQ X;  1JWM D;  5IGE A;  2IL8 A;  4RCO A;  1D5Z C;  2FMC A;  4ZLT F;  3J7A F;  4KI0 A;  4S3S A;  2QEJ C;  3K6O A;  1CA6 A;  2BE5 D;  3HOY B;  2D62 A;  3H6M A;  5DM6 3;  4NKL A;  5D3I B;  2NVY B;  2DNE A;  2F0K A;  2F3W A;  5E1F A;  5BN4 A;  3NPP A;  2KCN A;  3W2D A;  2F0M A;  1L0Y B;  5LL6 X;  4H13 C;  3A7L A;  5C4J B;  2AUJ D;  3KLR A;  2VUM B;  2MPM A;  2Z4I A;  2BCO A;  1UAP A;  2B2U A;  4IUQ A;  5IGC A;  2EYO A;  3GTJ B;  5I4D A;  2F0D A;  3SE0 A;  5IT9 E;  4KHV A;  3SK4 A;  5FO8 B;  1TY0 A;  1B9N A;  2YYZ A;  2HQE A;  2A74 C;  5K36 G;  2I46 A;  3SDZ A;  1SYG A;  1EIG A;  5I6W A;  1I50 B;  2R92 B;  1I4G A;  2Z1C A;  4ILW A;  1LTS D;  3MEH A;  3J7Y W;  1BCP B;  3I70 A;  3HOZ B;  1KNA A;  4K5X A;  3MAQ A;  1LT6 D;  4C1N I;  3BVM A;  2BDN A;  1Q1E A;  5FKA C;  4IUN A;  1ENA A;  4A3D B;  4BBR B;  1OXS C;  2RKS A;  1LT4 D;  2MP1 A;  4KD4 A;  5E3F A;  3NP8 A;  4PQX A;  3P20 A;  3HP3 A;  1QJO A;  4HR7 B;  1QG7 A;  2KOL A;  1STG A;  1DZ1 A;  1XYI A;  1E2V A;  3TP6 A;  4HCE A;  1KDA A;  3R2I A;  3EJI A;  3HS0 C;  4RGO S;  1PTO C;  1U4M A;  2EYH A;  2KCC A;  2QDB A;  3FKI B;  4KV6 A;  2CVR A;  1SAP A;  1F9P A;  3SHL A;  1D5X C;  2Z4H A;  2NBF A;  1PDQ A;  4FO2 A;  1PFB A;  1A15 A;  3OWE B;  3K5L A;  2B2Y A;  3DXJ C;  2DY7 A;  3S2D B;  5C44 B;  4WOR A;  1JE4 A;  4YIJ A;  2JXM B;  3DWP A;  1RF2 D;  2F0J A;  2AWO A;  1MGS A;  5ELF A;  3H3V C;  1SBB B;  2C9O A;  4IQZ A;  2IT1 A;  4C1N K;  2HDM A;  2K5Q A;  1SE2 A;  1EY8 A;  2X69 A;  4OIK A;  1M8A A;  2NN6 I;  1HA6 A;  5IIF A;  2B2V C;  3I90 A;  3PUZ A;  4A3K B;  4XIG S;  3ERO A;  4FXD A;  1SMY C;  4QUF A;  3ND8 A;  5I2X A;  1G6Z A;  1JQY D;  3MXG A;  1S5E D;  4JBW A;  1HFG A;  1EIH A;  3NK9 A;  1V43 A;  3I4L A;  2R93 B;  1EY5 A;  1GUG A;  2PZU A;  1CTM A;  1SYE A;  2EYF A;  3DEO A;  1GUT A;  1LTB D;  1R4Q B;  2K01 A;  1TY2 A;  3T16 A;  1R4P B;  1YNJ C;  1AN8 A;  5JPM C;  3SEB A;  4KHZ A;  1V1P A;  4N9P A;  3SK8 A;  2WB1 B;  2A69 C;  1AW7 A;  5C6A A;  4RWS C;  2L5T A;  3E5S A;  2IWH A;  1PRT C;  4CBV A;  1JR0 D;  1EYC A;  4IUP A;  3PMF A;  1I4H A;  1KTK A;  4RH6 A;  3MC0 B;  4OIJ A;  1EY6 A;  2EYL A;  1EWC A;  5C4H A;  1HPC A;  1PTO D;  3DUZ A;  1D1K A;  1ESR A;  2TMP A;  3KK7 A;  2E2H B;  4DNT B;  2E76 C;  5EKI A;  2HUG A;  3A56 A;  5CV4 A;  2EXZ A;  5EGT A;  3DWA A;  4MN3 A;  1KNE A;  3K59 A;  4U67 3;  2AQ1 B;  1V1O A;  2IX1 A;  3VA7 A;  3NE5 B;  4LMQ D;  5A35 A;  2JYO A;  2L11 A;  2MUY A;  2AQ3 B;  2PZW A;  1JOQ A;  1IL8 A;  4OO1 G;  5CC4 A;  1ILP A;  3NTK A;  3JAM L;  1YNN C;  1QNU A;  3Q0A A;  5CBA E;  1GJX A;  1BO0 A;  5KIX A;  2B63 B;  1ET6 A;  1MBY A;  1FYC A;  1FNV A;  5C4Z A;  2E2I B;  1WTX A;  1JOO A;  2PYK A;  1L0X B;  1G91 A;  1OO9 B;  2AWN A;  4K2K A;  3D4R A;  1QOH A;  2L1B A;  3EVQ A;  1EZ8 A;  2WP8 J;  2EYP A;  2RBM A;  2IX0 A;  2A6E D;  4CJ0 B;  1K83 B;  4IUV A;  1WD0 A;  3Q22 A;  3PIP 3;  1D5M C;  5JEA H;  4A3B B;  5CGK A;  4XT3 B;  3K0Y A;  3R93 A;  3S1M B;  1UUP A;  3S1R B;  2TSS A;  1TII D;  3QOJ A;  1SYF A;  3S15 B;  1IYV A;  3KF8 A;  3WOE A;  2K33 A;  1TS2 A;  1EY4 A;  3J80 E;  1Z7T A;  2Q8T A;  5E4W C;  4F8M A;  1BCP F;  3A55 A;  5CV6 A;  4K6D A;  1TWC B;  1OXV A;  1PRT D;  3KLS X;  3PO3 B;  1F2Y A;  3GV6 A;  3OMG A;  1PZI D;  1X3P A;  2DN8 A;  5C3E B;  5EKK A;  1ILQ A;  2J4X A;  2F0P A;  3H91 A;  1A3U A;  1WTR A;  3M85 A;  3TME A;  3PUX A;  4IFD H;  5AFW A;  2K32 A;  1LTA D;  1WTP A;  4ZUI A;  2BE5 C;  5IOC A;  1ROD A;  4C3I G;  1TT2 A;  1VCI A;  3DM1 A;  3R8B A;  1QIL A;  3X3M A;  2VXW A;  2HDL A;  1ICW A;  4X3K A;  2WAQ B;  4IN3 A;  3VYU A;  1G8Z D;  2L0C A;  5CMD A;  1XX8 A;  5C0X H;  3LX0 A;  1IYU A;  5ELE A;  1IKL A;  1B2T A;  1YNN D;  4KY5 A;  4I65 A;  1S4Z A;  3I72 A;  2JA6 B;  1PTO H;  2K05 A;  3JAM E;  1WVL A;  2KA7 A;  3MVV A;  4DN4 M;  4ODG A;  3V96 A;  3C46 A;  1MSH A;  3FMC A;  5BN5 A;  1GXD C;  2LFN A;  4HN7 A;  3OOC A;  3DWQ A;  4EQN A;  3D4D A;  5KND A;  1HRJ A;  5JPN C;  4CHT B;  4A3J B;  3SVM A;  1XWE A;  1B4O A;  1IKM A;  4CJ2 C;  4ZK9 B;  1H9S A;  3MZ5 A;  3PUY A;  5CV7 A;  3GTQ B;  2KUM A;  3RLF A;  1NUC A;  1EU4 A;  1AP0 A;  4BA1 I;  1TWA B;  3OPO A;  4LK1 C;  1Z47 A;  2A68 C;  3MWY W;  1U9R A;  4FXK C;  2ZT9 C;  4CKB A;  3CHB D;  1H9K A;  3M4Y A;  1CT1 D;  1LT3 D;  1KLU D;  3I91 A;  4L8J A;  2WIN B;  4XDX A;  1LAC A;  1A3T A;  1JWS D;  1DJR D;  2ZXR A;  2K04 A;  4RKB A;  1Q3L A;  2B2Y C;  1LT5 D;  1HFN A;  5TSS A;  2PMZ B;  4RGN A;  3NBI A;  1Q1B A;  3FRP B;  4A3E B;  1SYB A;  4J6H A;  3V05 A;  1F9S A;  5EJW A;  4P2C B;  1U4L A;  2EJF C;  5I2Y A;  1BDO A;  2A6H C;  3C1F A;  5ISR A;  1EQV A;  2JA7 B;  1AEX A;  3K7A B;  5K36 H;  1JCK B;  2SOB A;  3OIQ A;  1EZ6 A;  3V2T A;  3NXW A;  2XWB B;  3VR6 A;  1T5X D;  4FF2 A;  5EBD A;  3MA2 B;  1ENC A;  5EPL A;  3NSW A;  1SE4 A;  2F0F A;  3VR5 A;  5CV9 A;  5C3W A;  4HSP A;  2CHB D;  5C5M A;  3GTL B;  4KMU C;  2NVX B;  1LTT D;  4KK7 A;  4CKC A;  5D14 A;  3M7G A;  2QIL A;  1I3Q B;  5C3X A;  2F1M A;  3ONA B;  2KED A;  3OIP A;  2N88 A;  3ZYY X;  1SNP A;  4ABN A;  3CQZ B;  3DMU A;  3GTK B;  3GO5 A;  1KDB A;  1F2Z A;  4TSS A;  1I4Q A;  2PZT A;  1HQM C;  1SEB D;  1D6E C;  4RHR A;  4IUR A;  3BG3 A;  1TS3 A;  5ELC A;  1LLR D;  5DEH A;  5JJZ A;  2A73 B;  4HTH A;  3AMU A;  1EQT A;  2SDF A;  4HSV A;  3OW7 A;  3RUZ A;  4CGY B;  5K5P A;  4RGT A;  2A68 D;  1CK1 A;  1J9O A;  3LNN A;  1MSG A;  1BXT A;  3D31 A;  1RDP D;  4GZY C;  2V4D A;  1BNZ A;  1PLF A;  1VDZ A;  5JAV A;  1O7Z A;  2J7Z A;  2RSN A;  2CQA A;  3BVG A;  1SNC A;  3ITP A;  1DD2 A;  1HUN A;  2EY5 A;  1NSN S;  5KYI A;  4QB4 A;  3GTM B;  2MGS A;  5HGT A;  3FEW X;  1JOK A;  2F0G A;  2F0W A;  4TQU S;  2NVQ B;  1WD1 A;  2NVT B;  5M3M B;  4Q5V A;  3A54 A;  4C3H G;  1AZP A;  3S9W A;  4A3F B;  1ENF A;  3U9S A;  5IGD A;  1UNS A;  2RQX A;  4KKT A;  2A6H D;  4HED A;  3N52 A;  4IAL A;  3RMH A;  5C5L A;  4XT1 B;  2VNU D;  3HGB A;  1X3Q A;  1QE6 A;  4KKS A;  2PCF B;  4ZYS A;  1RD9 D;  2OF1 A;  5KGU A;  5J39 A;  3HKZ B;  1TQO A;  4RA8 A;  4MIU A;  1HUM A;  3A8K E;  2L55 A;  1I4R A;  1I6V C;  1PFN A;  4ULL A;  1LAB A;  3K57 A;  3GQB A;  2LKV A;  1LO5 D;  4QIW B;  1TU2 B;  2X6L A;  4EGV A;  2KQ3 A;  2OEO A;  2AQ2 B;  5CR3 A;  1UEA B;  5G3L F;  1PXU A;  3HG9 A;  4G7Z C;  2ID0 A;  2EDG A;  2A6E C;  2SEB D;  3HOU B;  1V1P B;  2KJX A;  5ELD A;  4DAV A;  5EKL A;  5F2D A;  4QCL A;  5J1Z A;  3TN2 A;  1C48 A;  2L9H A;  2WAC A;  3P1H A;  4FF1 A;  1VMC A;  1ZKO A;  2BA1 A;  3O13 A;  2ZXP A;  1AZQ A;  2J0T D;  4JK1 C;  1PTO B;  2NN6 G;  1IHZ A;  2F4I A;  1F2M A;  1Y8P B;  1WTV A;  1A2U A;  3KBG A;  3BYY B;  1XXG A;  5CBE E;  4FF4 A;  1X32 A;  4AYB B;  4H44 C;  3WDN A;  1LTR D;  1CZW A;  2L12 A;  1F77 A;  4U68 A;  4OO1 H;  1STN A;  2VB2 X;  4C3J B;  2M2L A;  1HXY D;  2OXP A;  5FLX L;  4J1M A;  1VMP A;  1JC7 A;  3VR4 A;  4DGZ A;  1I6H B;  4NW2 A;  5I9O A;  1SYD A;  2CW0 C;  3BDL A;  3R2T A;  1C8C A;  1DON A;  1RKN A;  2IX3 A;  5I6Y A;  5FO9 B;  4R8I A;  1SE3 A;  2RDF A;  4FNF A;  4DFA A;  1KLG D;  2PW5 A;  5LHY 1;  1SXT A;  3L7Z C;  4J8Q A;  4DU9 A;  5IGF A;  1OXT A;  2F03 A;  4XTC S;  1CA5 A;  3MXU A;  1VF5 C;  2H4O A;  2O5I C;  1NR2 A;  3IFT A;  3HRZ C;  1RTN A;  3IFD A;  4BY7 B;  1EU3 A;  2K7V A;  2H1E A;  4R8N A;  3VA5 A;  4X3T A;  3HOX B;  4DAY A;  4EQP A;  3QIA A;  1OXU A;  1LTG D;  2NUC A;  1SNQ A;  3QWN A;  1JIC A;  1W6K A;  2NTS A;  3QB3 A;  4DA2 A;  1O7Y A;  1B44 D;  1EY7 A;  1FGB D;  3KUP A;  4MHE A;  1RJT A;  5ELB A;  1DCZ A;  1STH A;  3EQL C;  1PRT B;  3CRK C;  1HCZ A;  2G9H D;  3GV3 A;  1F9Q A;  2BA0 A;  2JE6 I;  2N55 A;  3FDT A;  1SNO A;  4OL7 A;  4OGQ C;  2F0E A;  5M5X B;  5FK9 C;  1CHP D;  3Q24 A;  1TWG B;  1QWY A;  3RZD B;  1O80 A;  3A7A B;  4ZKB B;  1CI3 M;  1BOS A;  4F7X A;  5NUC A;  2C5C A;  4KN4 C;  4XQJ A;  2M9V A;  5DAU A;  3K5N A;  2F3V A;  2XNA C;  4OHJ A;  2B2T A;  4DXF A;  1EYD A;  1O78 A;  4IFD I;  4XQQ A;  4X3U A;  1HTL D;  2F0N A;  4NMZ A;  3GTO B;  1STB A;  2F0L A;  3NBH A;  2JEB I;  2ZXO A;  4PMC A;  3HOW B;  3L9A X;  4PMB A;  5BN3 A;  3NHH A;  1ZYR D;  5FLX E;  3RD4 A;  1S5D D;  1FD7 D;  3NWS A;  4FYD A;  2CW0 D;  2XVS A;  5KYL A;  2WV6 D;  1V8Q A;  2D2C C;  5C0X I;  3BDC A;  2XRS D;  3S1N B;  5CV5 A;  4UDU C;  3TBI B;  3HEJ A;  3J81 L;  2EYJ A;  1NR4 A;  3G7L A;  5CV8 A;  2M00 A;  4KJO A;  3IKJ A;  3I8Z A;  1GUW A;  1CQF A;  1H9S B;  1STE A;  4R9W A;  4WRD A;  3QO2 A;  2K5W A;  1PZJ D;  1G2S A;  2EJG C;  5DM7 3;  4XXE A;  4KJN A;  4PMW A;  5G3L D;  3PV0 A;  3K5O A;  5M5W B;  3TDQ A;  1IW7 C;  4FXG C;  1VF7 A;  2KHS A;  2EJM A;  1SJH D;  2EE1 A;  4G57 A;  2K1B A;  3SR1 A;  2NWG A;  1BUV T;  1WTW A;  1QNK A;  4HCS A;  1Q90 A;  2F0T A;  4XYQ A;  4B08 A;  1Q8I A;  3S16 B;  4K14 A;  1EY0 A;  1DOK A;  2D9U A;  3D6C A;  4HMJ A;  1JWU D;  4V0B A;  4K8I A;  4BWG B;  3C1E A;  3MXN A;  4ID6 A;  2E2J B;  1BCP C;  2SNS A;  1Y8N B;  3N6R A;  4K8J A;  4PNY A;  2NZ1 D;  3C3L A;  1W6J A;  1F9R A;  1WCM B;  4DK0 A;  1TS5 A;  2Q8R E;  1DYQ A;  1PTO F;  4ZKC B;  1HQR D;  4RFB A;  1EOT A;  3EA6 A;  3U9O A;  3T13 A;  4H7B A;  1EFI D;  1A2T A;  1GHK A;  3PO2 B;  3T4A C;  1EY9 A;  2PQE A;  2B39 A;  2RDG A;  3ERQ A;  1ONL A;  3D4W A;  1K8M A;  1LTI D;  4F88 A;  5KRU A;  2XIW A;  1A3V A;  3WOF A;  2RA4 A;  3I73 A;  5EPK A;  3GTP B;  1CZG A;  4FVM A;  3T56 B;  2B2W A;  1T5E A;  2L4N A;  4HMI A;  4DK1 A;  3A8I E;  1MI2 A;  3HOV B;  2SNM A;  4K2L A;  1JB3 A;  3BYT B;  1KAB A;  2EY6 A;  3J81 E;  2FMM A;  1STA A;  1BBX C;  3I4M B;  3I4N B;  1DXM A;  1S5C D;  2I07 B;  4IUT A;  1AFP A;  4G4K A;  3FPP A;  2VB3 X;  1STY A;  3F2U A;  4DXG A;  3M4O B;  1KDC A;  1IW7 D;  4KKU A;  1ML0 D;  2DNC A;  3M3Y B;  3P75 A;  3VR3 A;  5J22 A;  4CKE A;  4XQN A;  1CM9 A;  1B50 A;  4E6I A;  3NWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...