1BBXC

Non-specific protein-dna interactions in the sso7d-dna complex, nmr, 1 structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
63
structure length
63
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of Nonspecific Protein-DNA Interactions in the Sso7D-DNA Complex
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*CP*TP*AP*GP*CP*GP*CP*GP*CP*TP*AP*G)-3')
total genus 4
structure length 63
sequence length 63
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bbxC00
2FHTA 5CBAE 1HFGA 2FJ2A 5EJWA 3I90A 2MGSA 1X3QA 2K03A 3GV3A 1MI2A 2X69A 1NAPA 1BO0A 4X3TA 2K28A 3D6WA 2FFKB 4RAUC 1HFNA 2RA4A 1F2LA 1C8CA 5CMDA 3MTSA 2MP1A 1RHPA 1Q3LA 1MSGA 1EIHA 1HRJA 3N52A 3TN2A 4ZLTF 1WTWA 1O80A 4IUVA 1AP0A 1WTQA 2M2LA 2B2UA 5COYA 4HCSA 1NCVA 2D9UA 1WTVA 5T1GA 2L12A 1G2SA 3FPUB 2KUMA 1HUMA 2VXWA 1ILQA 1RJTA 4O42A 5CORA 1PDQA 1U4MA 4RA8A 1ICWA 1B3AA 3MWYW 4LMQD 2R3ZA 4XDXA 1BF4A 5EQ0A 1PFBA 2X6GA 4IUPA 1NR2A 1SAPA 1IKLA 1WD1A 2IL8A 1BBXC 2K1BA 1ESRA 1U4PA 2B2WA 3ONAB 2HCCA 1XX8A 1EIGA 1VMCA 3P7JA 1O7YA 2EPBA 5EPJA 1EOTA 1B2TA 2DY8A 5EPLA 2MPMA 2SDFA 1QE6A 4CJ1B 1M8AA 1ML0D 2HDLA 2KECA 4HEDA 2B2YA 5D14A 4ZAIA 2FINB 2K01A 2RVLA 3KBXA 4X3UA 5D65A 5EKIA 1G6ZA 1HHVA 1A15A 1EL0A 3IL8A 4RWSC 2N88A 2Q8TA 3I91A 1B53A 1EQTA 2KEEA 4DN4M 4ZK9B 3SVMA 5E4XA 4X3KA 3DEPA 1WVLA 5EPKA 1WD0A 2N55A 3F2UA 2B2WC 4R8IA 2RSNA 3KUPA 2B2VC 4QUFA 1BNZA 1G91A 1DOMA 2B2UC 1B4OA 1E0BA 1X3PA 2EOTA 3G7LA 3R93A 1DZ1A 1J9OA 2EE1A 3Q6SA 2MJ8A 2XIWA 2JYOA 4UAIA 4IUQA 1JE4A 4XT3B 1IKMA 3LWEA 1PLFA 2L9HA 2KOLA 2X6LA 1TVXA 2B2TA 2NWGA 1F9PA 1RODA 1AZPA 1ILPA 1DOLA 3DM1A 1WTXA 1LV9A 1J8IA 1HUNA 1KNEA 2DY7A 1AZQA 1QNKA 3GV6A 4X3SA 4QUCA 5JJZA 3H91A 1MSHA 1SSOA 3I3CA 1GUWA 1IL8A 3IFDA 1O7ZA 2HDMA 1WTOA 1G2TA 2Q8RE 3I8ZA 4U68A 2L1BA 1CM9A 1MGSA 1ZXTA 3FDTA 4HSVA 2JP1A 1XYIA 1WTPA 3DEOA 1CA6A 2L4NA 1S4ZA 5DNFA 4IUUA 2J7ZA 1U4RA 2CVRA 1VMPA 1RTOA 1U4LA 1B50A 1DONA 1CA5A 4NW2A 5AFWA 1HA6A 3UI2A 2FMMA 2K04A 4R9WA 4CJ2C 1DOKA 1F9RA 1PFNA 2NZ1D 1F9QA 2H1EA 2HUGA 2KVMA 4HAEA 4MHEA 4MN3A 1RTNA 3TZDA 4ZKCB 1JICA 1KNAA 2KEDA 1WTRA 1QG7A 5CBEE 2L11A 1SDFA 2B2YC 2B2VA 2BDNA 2K05A 2RSOA 4IUTA 2HCIA 3HP3A 1PFMA 2NYZD 1NR4A 4ZKBB 3QO2A 1X32A 2B2TC 4IURA 4XT1B 4OIJA 5T1IA 4OIKA 5E4WC 4CJ0B 1F9SA
chains in the Genus database with same CATH superfamily
5DLQE 2BA0A 3NPPA 3I4OA 2K5QA 2DNEA 4HMIA 1NAPA 3V2TA 3X3MA 4EQNA 4O2DA 4DUZQ 4FXGC 4JI0L 1W3SA 1NMGA 1K9MC 4R4OA 1WTQA 4BY1B 5M5WB 1A62A 2B2UA 1C48A 5BN4A 1DYQA 4WFN3 4IOCA 2UXCQ 1N9WA 2CQOA 3OW2A 4JVZA 5EBCA 3GTQH 4XDXA 3EROA 1PFBA 3FKIG 4U673 3S2DB 5E3FA 3BJUA 2QDLA 2XWJB 2R92H 1PXUA 1O78A 4OL7A 1Y1WG 1K0SA 2A73B 1HR0L 2HIXA 4UP9A 3CHBD 2QGQA 3HOUH 3CP0A 1RIPA 3A7AB 4X3UA 1HNXQ 1CT1D 1YNJD 1XNQL 3M7NA 2E2DC 1FNWA 1LM0A 4IPCA 4XTCS 2ID0A 4IOAA 1UE7A 3I70A 4KN7C 4Y7NB 3J7A5 1STEA 4PMWA 1EUJA 5DEHA 1EY4A 4EGVA 1MJCA 2XIWA 3S2HH 1LLRD 2F0QA 2XRSD 4M8AA 4MTNA 4YCUA 5DAUA 4C3HB 1I5FA 3C46A 3S24A 1L0WA 1IZ6A 4F7XA 5I2XA 1AZQA 2ZJPA 1QNKA 2BH8A 3H3VH 2F0KA 2PNRC 4A3IB 1TWFB 5CV6A 1AEXA 3A74A 3FKIH 1Y69U 5BN3A 1A0IA 1GUWA 2UUCL 5CYUA 2R6GA 4DF7A 5K36G 1BCPB 4ZQ3A 1IBKQ 1O7LA 1EU3A 3I56A 1WTPA 2VQFQ 1I4RA 2KQ3A 3C1FA 3DEOA 3SK5A 4EVOA 2R93G 4IUUA 2MFIA 2Z8LA 3UI2A 3OW7A 1MJEA 2RHSB 1TS4A 2NZ1D 2CH4W 5KRUA 4P71A 1HH2P 2CCZA 2N78A 1K83H 1B1ZA 1VQMA 3RN2A 3PO3G 1PV4A 1NTGA 5GQOA 1VF5C 2TSSA 2ALYB 1Y1VH 3FP9A 1HFGA 4LF8Q 3NQTA 2NTSA 4JC0A 1LT3D 2Z9HA 1L0YB 3NE5B 1FNUA 1VQPA 3S1RB 3NENA 1A3UA 4P73A 1YJ9A 3N52A 5M3MB 5IYBG 3A56A 5COYA 1PH2A 4BXXG 2KUMA 2NVYB 2RBMA 4RA8A 4A3EB 4KD4A 5EQ0A 3NHHA 3OMCA 3K58A 4K6LA 4YCVA 1WD1A 5IWAL 2HT1A 4KHPQ 3K7AB 1U4PA 3S1MB 3HKZG 1STBA 1XX8A 2N8NA 5CV7A 1B2TA 1R9TH 2HQLA 4WJ3M 5LMUQ 4A3CH 4A3DB 2B2YA 2E2JB 1ICFB 4J15A 4DK3C 1H9JA 5IIFA 3CD6A 2JA5H 3HS0C 1YVCA 2OTJA 1IBLL 1WD0A 3GTJH 3M4QA 4R4IA 2VS1A 2RSNA 2B2VC 4C1NK 4X65L 1N8RC 3SEBA 3KLWA 4PZ7A 1K83B 2AWOA 3I72A 3Q6SA 4B3MQ 1JE4A 1UE5A 2A74C 4FNFA 4R8NA 1TVXA 4LFBQ 1RODA 2RDHA 1W6KA 3KK7A 1KRTA 5ELCA 4X62L 5JJKA 5M5XH 4HTHA 5C3EG 4NDXA 1TWCH 1KXLA 1QVCA 4ID6A 4HJAA 1AE2A 4L5QA 1SNQA 4C3JH 1KABA 1DD2A 1L1OC 1PZID 3X3NA 1X65A 2KA7A 2FMCA 1R4PB 3HOYH 4C3IB 1EY0A 3MFGA 1TS3A 3EN2A 4A3GB 3R3OA 1XMQQ 1ET9A 4A3EH 3GD7A 4C3HG 1QWYA 3DLLA 2K04A 2E5LQ 1NSNS 1U9RA 2E2IH 2JA7G 3G6EA 4UP7A 5ELEA 1YJNA 5C4XB 1RCVD 2RSOA 2WAQG 3HOZH 4OO1I 1ENCA 4NXMQ 5E4WC 3HOWG 1K3RA 1WFQA 4JPBW 2A6ED 4Y52H 3E5SA 3FKIB 4KKSA 4BS9A 2UXCL 4X66Q 1SNMA 2RDGA 1EIHA 5JOBA 3KF8A 1EWIA 5CV8A 4BY1H 4DR4L 3MXNB 1IW7D 2L55A 3T1YL 1VQ4A 3JAMc 4B3ML 2F3WA 4A3MB 1RF2D 1ICWA 1X54A 4IFDJ 3UDXA 2BE5C 2CW0D 4GS3A 3I4MG 3RUZA 4HJ5A 1S72A 4RGMA 2OTLA 1V1QA 4CDDC 3VDYA 2K1BA 3NBIA 3CPWA 1X9NA 4JK1C 1I3QH 5KIXA 3FVQA 1TWCB 3GTMH 3D4WA 4IFDH 2LXKA 4CDFC 3S17H 4LW1A 4A3MG 1KD1C 1Q86C 1Z6HA 1QUQA 5EKIA 1HHVA 2ES2A 2ZXRA 2AQ3B 3A7LA 2KHJA 3G48A 2KEEA 3DMUA 1UNSA 2UU9L 1ENFA 4A3BB 3A55A 3F1ZA 4QJFA 2JK8A 2PI2A 1STAA 4UY8C 1GOZA 5M5WH 4HIDA 2B2UC 4B3RL 1X3PA 2EYFA 1JJGA 4HCEA 2MJ8A 4MNOA 2JYOA 4IJHA 4R4TA 2EYHA 1TWAH 2WIIB 5IYBH 1EYDA 1ONLA 4F88A 3QR8A 2O5IC 2JEBI 3I4NH 4ME3A 1PH5A 1MSHA 5FO8B 3HZXA 1VQ5A 1EIFA 2A1AA 3UDFA 2A68C 2IHEA 1ZXTA 4HSVA 4DV3L 3D31A 3TP7A 1CA6A 5DNFA 1PA6A 4DV7L 4X64Q 1G51A 1RTOA 4IPDA 1C0AA 2F0FA 4N9TA 4ZCKA 4A3LH 1PTOF 4IQZA 3TZDA 4MN3A 1H9SB 3KDFB 1SRUA 1HNWL 1SR3A 3OOCA 3U58A 5G3LF 1BXTA 3TP5A 3HOZG 4A3JG 1F9SA 2FHTA 3J7AF 1TWFH 2B3GA 4L5RC 2YU9H 4GNXB 4I7ZC 2A6HD 1PH1A 2X69A 4FXDA 2JA7H 4ZUIA 4KD3A 4RAUC 2RA4A 3K5OA 1EYCA 2HD3A 1MSGA 3GTJB 3H0GG 1I4GA 4ZLTF 5C0XH 2F0MA 5JAVA 2L12A 1EQQA 5C44H 4APVA 3S15H 1Q82C 2F4VQ 2X6GA 1CKMA 1NR2A 5I6YA 5AJ3L 2LMCB 5FO7B 3MXPA 2CH4A 2ZJQA 3HKZB 3ONAB 4GOPC 3MXUA 4DNTB 1S5BD 2K5DA 2M00A 4CJ1B 1M8AA 1XTCD 2QEXA 5JPMC 4A3EG 1K8MA 4PNYA 3G4SA 1EQRA 1JT8A 2N88A 1KAWA 1Q1EA 1YITA 3J80c 2Z6KA 2I5HA 4IZ8A 1NY4A 2PMZE 2A5HA 3OWEB 3K7AH 3BVMA 3M7GA 4TRDA 5IT9E 1T5EA 1NJIC 1CKNB 4CDCC 2IY5B 4YHHQ 1IHZA 4DPGA 5IYCG 4G7OC 3BYTB 4A3LG 2B2TA 3CCEA 2C5CA 4LK1C 5FKAC 2TMPA 1RL2A 1FVIA 5JJZA 4LF5L 3S1MH 2K50A 2IWHA 4G57A 2Z1CA 2IHFA 3UE1A 4WORA 4P74A 3TS0A 4OXPA 3W1BA 1NUCA 4QF4A 3T4AC 3U9OA 2DJGC 4ZYSA 4RG1A 4LUVA 2OCEA 4OX9L 2KCNA 1F9QA 4BBRG 2ZXOA 2KVMA 2I07B 3CF5A 3CAMA 1FL0A 4QL5A 1CFMA 4ZRZA 1PFMA 4C3JB 3HOWH 2SOBA 1SYDA 2B63B 4AIMA 3CKIB 5C44G 4OO1H 3BZCA 2ZM6Q 4GN5A 2Q2HA 5KYLA 5CV4A 4AQYL 3TN2A 1B9NA 4LUZA 1EEFD 1LTGD 4OWXB 1TR5A 2E2JH 1RKNA 4NPSA 2XSCA 5CR3A 2EXZA 5T1GA 1CHQD 1GM5A 1HJPA 4KK7A 1KQSA 1HZ9A 3MWYW 3TREA 3CQZH 5EKLA 4IUPA 2GVBA 1AH9A 1Y1VG 1C7YA 1JOKA 3SGIA 3M3YH 4NP5A 4K5XA 1I94L 4JV5L 1I3QB 4BY1G 1VMCA 1YEZA 4MTKA 1DXMA 2EPBA 4P2CB 3GTMB 4B3RQ 5IODA 2J4XA 2KECA 4DAYA 4ZAIA 2K01A 4XYOA 5IE8A 4O1NA 2E5LL 2UU9Q 2VQEL 2A69C 4DV5L 3F2CA 2F0GA 3PUZA 1B53A 3KF6B 5E4XA 3BDLA 4QIWE 1PMRA 1WCMG 2CHBD 2ENBA 4WJWA 5I2YA 5FJ8H 1J9OA 1I6HB 1PVOA 4FVMA 1HR0W 2Q8IB 4PV1C 2ZXPA 4N8FA 1IXRA 1QJOA 1ENAA 2KOLA 4H02A 3HOVB 5FLXc 1ZYRD 1WTXA 2R93B 3FEWX 1KNEA 1G6PA 1LABA 5M3FH 3PIO3 2EY5A 5IP7G 3I2ZA 1V43A 2H4OA 4L5SA 2R7DA 3ULLA 4XQNA 3W2DA 1SEBD 3RZDH 4A3BH 2WB1B 4TKOB 4DR3Q 2L1BA 3NTKA 1OXUA 2L4NA 3CCSA 4JI2L 1X6OA 4HJ9A 2O5JC 1Q12A 1VQKA 4IO9A 1CA5A 1B50A 3HOXH 3BZDB 1IW7C 1F9RA 2AUKA 4DV4L 2OWOA 3RR5A 1Q81C 4XQJA 4ZKCB 2CW0C 2BE5D 2L11A 2F0LA 2KBNA 4DXFA 3A8KE 3PF4A 4IUTA 2HCIA 2UXDQ 3GTPB 3I4NB 5I4DA 5EBDA 5M3FG 1Y14B 1XMQL 1U0LA 1IBML 1N33Q 2JA8B 4FF3A 1EQVA 3EFXD 4A3CG 1Q3LA 4L8JA 2VL6A 3ZYYX 3CXCA 3ND8A 3LX0A 3D0FA 2SEBD 2RCFA 4OX9Q 2K4KA 1LTID 3DUZA 5F2DA 5FLMG 5CORA 3HEJA 4POGA 3H94A 3OTOL 2BOSA 3HOVH 1KDCA 3I73A 4JBKA 1D2BA 1LTRD 3D4DA 2IW3A 3P7JA 3CCJA 4DK1A 3HOUG 3UE0A 4LWCA 3OPOA 4LFCQ 3E9HA 1VQBA 2E2HB 5C0XJ 5IGEA 1QILA 1SFOB 3NSWA 3BS1A 1EQTA 2NTTA 5KGUA 4LFCL 2VQFL 3K7UC 2L5TA 3W1GA 4F87A 1BOSA 4UAIA 4H7BA 4QMGA 5FLXL 4BY7H 4ILWA 3EIVA 2EJGC 4JW0A 2N49A 4KHVA 4DFAA 1E1TA 4QGUA 1Y1WH 3PO3B 3VR2A 1E24A 2Q2IA 4DAMA 3ITPA 4JI6Q 2F4IA 1WTOA 1TWGB 3I8ZA 1E2WA 1B7YB 3FDTA 1YHBA 4UP8A 5KNDA 1TS2A 2KHIA 1DONA 2YTYA 3IFTA 4LF8L 2Z6KC 1HNXL 2UUBQ 3LWUA 5H1SE 1PH7A 1O7IA 4MHEA 1CHPD 2LFNA 1STYA 2R92G 3K5NA 1T9HA 2JA9A 1K8OA 2F1MA 3G6JB 3HP3A 2G9DA 3E0EA 4QQBX 4GKJL 2B2TC 5T1IA 2L0CA 1LO5D 3T16A 4FDBA 1GHJA 1VQ6A 2XWBB 2FJ2A 3H15A 4A3KG 4ALPA 4PMBA 3RZDB 5FLXE 1C8CA 2A19A 2A69D 4DR5L 5IGBA 3UDIA 4GZYC 2VQEQ 2I5LX 3TEHB 2M2LA 5JEAJ 4KY6A 2KJXA 4EQOA 1JJCB 4YWKA 3HKZE 3PIP3 1L2FA 3M85A 2IX0A 5GADC 4JI4Q 3FHWA 3VR3A 2F0JA 3RNUA 4X66L 1TQOA 1A2UA 1X55A 4QY7A 1BBXC 3CCUA 1Y1WB 4FO2A 4BA1I 1O7YA 1TIID 1CI3M 2NN6G 1PTOB 3VYUA 5IYDH 2SDFA 2F0OA 1HPCA 3N6RA 1VQFA 4K6DA 1B3QA 4RHSA 3QOJA 4KY7A 1GJXA 1FGBD 1ASYA 2V4DA 4JI8Q 1B70B 4Q5VA 1S5FD 5CGKA 4TQUS 2F0UA 1QUQB 2CQAA 1VS0A 2K5NA 1G91A 3AQQA 2EJMA 1I50H 1VQIA 1B4OA 2AHOB 2AWNA 3PCOB 4CBVA 1HR0Q 3ICEA 3GTOB 4A3FB 4JYAQ 4XT3B 3PMFA 1K0RA 5IGDA 5GAGC 1I4HA 2Z6BA 3VR6A 5A2QE 4A3DH 5IYDG 3Q8DA 3NQIA 1M1KC 1LV9A 1SYFA 2YV5A 3HOYG 1EYGA 2F0TA 2PCFB 2RKSA 1UUPA 1YNXA 2VY3A 4BWGB 2JA5B 3IFDA 4C3JG 1O7ZA 3IAYA 1JMCA 1HZBA 4AQYQ 1JWUD 1PTOC 1D5ZC 2IX3A 1JOOA 3HOXB 3BVGA 2PYKA 4JOIA 2JXMB 1VCIA 4DAVA 1X3EA 2AQ2B 4S3SA 5BR8L 3JAME 3BVZA 1JWMD 2K05A 1PH9A 2EXDA 5K36H 1Y1VB 5LMNL 1R9TB 4LF6L 4LF9Q 5LMUL 5CBAE 1LYLA 5IT9c 4GKJQ 1X56A 2UUAL 3DM3A 3M9BA 4XXEA 4JYAL 3KLSX 1MHWC 2OQ0A 5CMDA 4GNXC 2JA8G 1BCPD 4K8JA 2PI2E 5M3MG 3MHBA 3L2PA 1HRJA 5NUCA 4B3SL 4B9XA 4I7AA 4AYBE 5LMNW 5ELOA 1GO3E 1NCVA 2RF4A 1SJHD 2WKCA 2EY2A 4JI8L 1ILQA 4A3FH 4A3KH 4LF5Q 3NELA 1UWVA 4LMQD 3J81E 1J5EQ 1AN8A 2Y0SB 2Z4HA 1K8AC 1I4QA 1UEBA 3HG9A 3GO5A 5I6WA 4DAPA 2F4VL 2HIVA 4DV1L 4JI6L 1PZKD 4K2LA 4MZ9A 1TWGH 3PUVA 3CPFA 2UXDL 5EGTA 1EL0A 4H44C 2IT1A 1SLJA 2ICEC 2WB1G 4X3KA 1JB3A 3NTIA 2CFMA 4K14A 1BBWA 5FO9B 3BYYB 2GVAA 1GUSA 2CWAA 2KENA 5ELBA 5C4HA 5C4XH 1P8LA 3HGBA 2X6LA 1SJED 2NWGA 1AZPA 1F9PA 2QA4A 4RFBA 1SMXA 2DY7A 4O0AA 4DR3L 3J81i 1LTBD 4X3SA 1IBKL 2E2HH 4UDUC 3VR5A 5FK9C 4DKAC 1NE3A 4DV7Q 3RZOH 2Q8RE 3HOZB 2XGTA 1I6VC 2K7VA 2F3VA 1SYBA 3O13A 4RCNA 5KNBA 2UUBL 1TY0A 5LHY1 1SFOH 3D4RA 2OT2A 1KLGD 3GTLH 2EY6A 4CGYB 4BY7B 4NW2A 5AFWA 2JA8H 1SNPA 2LSSA 3B6YA 1JQYD 1MBYA 3OSOA 1E3PA 3M4YA 4JI3L 3E3XA 3EBEA 4HN7A 5C3WA 5L37A 1VQJA 1DGSA 4ODGA 3T13A 1UE1A 3P1HA 3AYHB 1X32A 4EQ5A 3S16H 3LNNA 1N34L 4WRDA 5M5XB 2K14A 3I90A 2R7ZG 1JCKB 3U50C 4DV2L 3KF6A 3OMGA 2A68D 5A2QL 1X3GA 2ZT9C 4X3TA 1N32Q 1VQ8A 4YIJA 1SNCA 3KYHC 2EZVA 4DV3Q 2EVBA 1PH4A 4FYDA 5C4XG 1Q8IA 1CSQA 4IUVA 1XTDA 4DAYB 5CV9A 4HCSA 5LMNQ 4OHJA 4KN4C 1EZ6A 1HUMA 5C44B 1PDQA 1U4MA 5BR8Q 2R3ZA 4JI5Q 3S1NB 1KAAA 5GROA 5E1FA 3SXHA 4JI4L 4JI7Q 3STBD 3BG3A 2B2WA 3PV0A 1Y8PB 1EIGA 2PMZB 3ZJYC 2ZM6L 4I65A 3T1YQ 2HDLA 2LXJA 3SK4A 4DV0L 4LJZC 3CRKC 1QOHA 1XNRQ 1Y8OB 3CCRA 3AFQA 3GTLB 2AKWB 2KCCA 2EYMA 1PRTF 1SNDA 1W2BA 3M4OH 1BCPF 4R8IA 1BNZA 3ND9A 5C4JH 3R93A 1F2YA 5JVH3 1IKMA 2V1CC 5IP9G 1ASZA 1A63A 1PTOH 5C0XG 3NK9A 1J8IA 4JI1L 4DV6Q 4HJ8A 2K52A 1VQEA 1VQCA 1R4QB 3S16B 3K6OA 4QUCA 4DU9A 1EY7A 2PW5A 3F2DA 4DR1L 3K81C 2QDBA 3MXGA 4G7ZC 1EWCA 4OWTB 1JC7A 1STNA 5JEAH 3DWAA 4N9PA 1MGSA 4CKCA 1RD9D 1BKBA 1XYIA 2EQSA 4WJ4A 4LFAL 2E75C 1Z7TA 3HFZB 4ABNA 3S14B 2JA7B 2F0NA 2MQHA 4JBJA 4MIUA 1MIUA 2JEAI 4KHZA 2VUMG 2WINB 1WJJA 1IYUA 2R7ZH 1E1OA 1TU2B 1X3FA 2PZWA 3R8BA 3DWPA 2VZAA 1XPOA 2ICIA 2XRQD 1KNAA 3T56B 4RCOA 1CKNA 3S15B 3CU7A 1L0XB 4ZUJA 1D5XC 3NUCA 3Q0AA 4ZKBB 3QO2A 4CKBA 1G291 4X65Q 1FR3A 3A5ZB 2C35B 3F2BA 1D8LA 1S5CD 1X3QA 3AMUA 1STGA 1CZGA 5M5YB 5LL6X 4OONA 3K5MA 2NN6H 3D6WA 3H0GB 3WWVA 1O80A 5TSSA 5IOCA 1HQRD 2RQXA 3NP8A 1HTLD 1OXVA 2UXBL 3QWNA 2F0PA 2NN6I 4C3IH 3FPUB 4A3JB 3OIPA 3CRLC 5J22A 2JA6H 4E6IA 3DWQA 4KY5A 2B39A 3I4LA 1FGUA 2OF1A 3TQYA 1PH8A 4TVAB 3Q24A 1IKLA 1VF7A 5HGTA 1QZHA 4KHPL 3CC2A 2IX1A 5IP7H 3SR1A 2PZTA 1SXTA 4BBRH 2VB2X 2R61A 3KLSA 4A93G 1LTLA 3GDEA 4KV6A 3KLRA 1E2VA 4HMJA 4IPGA 4IFDG 1A15A 2F0WA 1SBBB 1BCPC 3IL8A 4JI5L 2NZHA 2RDFA 3GTKB 4J6HA 3I91A 1E2ZA 3VYSA 2WV6D 4DNRB 2PO4A 1PTOD 4GNXA 1WCMH 1KDAA 2I0QA 1VQGA 2B2WC 1QVGA 1DOMA 1NMFA 1VQAA 5C6AA 2EOTA 1DZ1A 3M3YB 4FF1A 1HCZA 4LF4L 4IUQA 3KDFA 1PLFA 3A54A 4CHTB 1H9SA 2DJFC 4PMCA 3OYYA 3GP7A 2PZUA 1JOQA 1OXXK 1SMYD 4JBWA 3H91A 5C3EB 3I3CA 2Z0SA 5HY6A 2HDMA 1VQ7A 3S9WA 1A2TA 4JI3Q 4CDEC 4JCVE 3J81c 4A3BG 1CM9A 3S1QH 1PRTC 2EDGA 3T51B 2WFWA 1SE4A 5C5LA 1EY8A 2JE6I 4A4IA 4H0LC 1H9KA 4TSSA 3FPPA 1PYBA 2FMMA 4BBSG 1GUGA 4R9WA 4FP5D 4CJ2C 1S5DD 4V190 4IN3A 3RMHA 1WTRA 4K5VA 3OTOQ 2B2YC 3IRBA 3MZ5A 4LNQA 3GTGH 3L3OC 5ELNA 2B63H 5KYIA 4LF7Q 1DM0B 4J8QA 1CSPA 5FLMH 1HTPA 5EJWA 2MGSA 4IUNA 1UAPA 3PIOA 1MI2A 1N33L 5JJIA 1IBMQ 3I4MB 4RMFA 4HIKA 5DM63 2WACA 2VUMB 1XNQQ 1EZ8A 3AB9A 5C4ZA 5IGFA 1B8AA 1G2SA 2K5HA 1PRTB 1RJTA 3SK8A 4X64L 2E76C 1BF4A 1CQFA 2PPBC 3S2DH 1VQDA 3S1NH 4DV4Q 2FXQA 3GTPH 1V1OA 3C1EA 2IL8A 4K5WA 5M3FB 4JBMA 4GKKQ 2K33A 2F3IA 4JG2A 1ZYRC 4FXKC 1NBWA 2D62A 4HIOA 4DV1Q 4NXNQ 3VYRA 2NVXH 3MXNA 5M9OA 1QE6A 5JJLA 4PZ6A 3KF8B 4NB3A 5KEEA 1J5EL 1BR9A 1DJRD 4ZK9B 3DEPA 3S1RH 1YIJA 1PH3A 2N55A 3CCQA 5G3LD 4X6AH 2OQKA 2Y0SG 1F2MA 2E8GA 1E0BA 4DR2L 4JI1Q 3SK6A 1JB7A 4KKTA 5HGQA 4BY7G 3GTQB 2UUAQ 5IY0A 1LT6D 1HNZQ 1XJVA 4DR7Q 1E22A 3HOUB 4B9WA 5D3DA 3NWSA 3CMAA 4DR6L 1GVPA 5JPNC 3PO2B 3I4MH 3PO2G 1FD7D 5IGGA 1AW7A 4DV5Q 1K28A 2NUCA 3A5UA 4GOPA 3T1HQ 1QB5D 1G8ZD 3R2TA 2QCPX 1VQ9A 4RKLA 3VR4A 3TSSA 4FF4A 1C4QA 3I55A 3NXWA 3A8JE 3J81L 3TP8A 3VA7A 4GLAC 2KEDA 2AMCB 4YHHL 4IJLA 1Q8KA 4F8MA 4OIJA 1SYCA 1J6QA 1EYAA 1N36Q 1FNVA 3KBGA 2E74C 2WB1E 2B29A 4Q0FA 5CC4A 1KIXA 3DXJC 3J7ZC 1SE8A 5IWAQ 1TXYA 1N34Q 1MKHA 1A8VA 3PGZA 4DV6L 1QZGA 3VA5A 4B08A 4QIWB 1SYGA 1ZEQX 2SNSA 2VXWA 3CW2C 3VYTA 3AFPA 1H9RA 1Q1BA 4K8IA 4PQXA 1YI2A 5C5MA 4R4CA 1H95A 4RHRA 3J7AV 4LF9L 1A6XA 4LF6Q 4RGNA 1IYVA 4GLXA 5C3EH 2LS01 1P16A 2HCCA 3MVVA 3S2HB 1LTSD 2VB3X 3NWTA 1EWHA 1S5ED 1VDZA 4DV0Q 3E6ZX 4BBSH 2EJFC 3KBXA 1XPRA 1SN8A 4A3GH 2GA4B 1KLUD 3SVMA 4C2MH 5J1ZA 4JI7L 1WI5A 3JAMi 2BH2A 1JWSD 1YZ6A 5IGCA 5C0XI 5GAEC 3KUPA 2OXPA 1LUZA 1F77A 1RDPD 2QF7A 1HNWQ 2DNCA 3HOXG 1Y8NB 3CQZB 4LAAA 1MD2D 4EX5A 5JVG3 2MO0A 1U5KA 3HOVG 1N32L 3RLOA 4UPAA 2D0OA 3KFUA 2P5ZX 1BBUA 1LT4D 4YWMA 2LKVA 1XWEA 2IJ0A 4KMUC 1S4ZA 3AEVA 3I7FA 1STHA 4QCLA 1U4RA 4A3MH 1VMPA 1WOCA 1U4LA 4OGQC 1HXYD 1KRSA 4KJNA 1D1KA 3H3VC 2R7ZB 1OO9B 1PFNA 3URYA 5AJ3Q 3E0JA 4DK0A 1EY6A 1UEAB 4DGZA 4K0KL 4A3JH 3MEHA 2QEJC 2B2VA 2NVXB 2L15A 1SMYC 1L1OB 1D1IA 2C9OA 2NYZD 4XT1B 4A3GG 2B63G 4X62Q 4L63B 2K75A 2DGYA 4LFBL 1II3A 1GUTA 2FFKB 2B8FA 4R1JA 1XMOL 4A93B 3H0GH 4M1UB 3L7ZC 5LL6S 3M4PA 3S1QB 3BU2A 4YCWA 3Q23A 3OHXC 2B8GA 2NVYH 4DUYL 1TWAB 2JN4A 3J80E 1B3AA 3MA2B 1GUNA 1IL2A 2DN8A 2E2IB 1W6JA 4DUZL 1PYWD 4JI0Q 3EJIA 1XMOQ 4GN4B 3PO3H 2NVQB 1GKHA 2EYPA 4DR2Q 1EOTA 3BZKA 5D3IB 1ET6A 5FJ8G 3C2PA 1K8GA 1YNND 2D5DA 1WYDA 3KOJA 2NBFA 3J7YW 1Q90A 3AU7A 3CCVA 3SDZA 1VQNA 1PZJD 2VW9A 2O2LD 4B3TL 4RH6A 3QJYA 1PH6A 1V1PA 4QUFA 1I4PA 4BXXH 4PZ8A 4C3IG 4NXML 4A3FG 4LUOA 5IYCH 1DCZA 1T5XD 1EY5A 1QNUA 3DM1A 3OIQA 1LT5D 1M4VA 2LY7A 4P75A 3HRZC 4NKLA 2YU9B 5HURA 2ASBA 1VQHA 3KJOA 1BVSA 2A6HC 1EEID 1YHQA 2JP1A 4BBSB 4GLVB 3W3AA 1BQQT 4YWLA 3TBIB 2HQEA 2JQOA 2CVRA 5DM73 5BN5A 1I4XA 3E9IA 3L0OA 3HKSA 2VUMH 1SNOA 3FMCA 3MEFA 2F0DA 2XNAC 4HAEA 1L1OA 1QG7A 1SDFA 2NVQH 1OXTA 4A3KB 2BDNA 3H09A 2ZTEA 1NR4A 4IURA 1JORA 2EYOA 4OIKA 3TZUA 2O4XA 3J80L 3T1HL 3QOLA 1A3TA 4KLKA 4DR5Q 1V8QA 3TS2A 2QKIC 1ESFA 1TS5A 1F2LA 1TWHB 1AP0A 3UDGA 1XPUA 4DR7L 1WTVA 1KC8C 2PNHA 4C1NI 2F03A 2H5XA 4L5TA 5KNCA 4EQPA 4V0BA 4G4KA 2NVTB 4UHVA 1YBYA 2D0PA 4LF4Q 1BUVT 2DY8A 1HQMC 5EPLA 5GAHC 3JAML 3S17B 1N36L 4HEDA 2F0VA 5A35A 3J80i 3RLNA 1OTCA 4RWSC 2NZOA 1KTKA 4JI2Q 3PO2H 3NEMA 4GN3B 2Q2UA 4GKKL 1WVLA 3RZOB 2Q2TA 4A75A 1KDBA 2F52A 2QW7A 1QVFA 3G7LA 4ULLA 1HZCA 2EE1A 5K5PA 2J0TD 4OWWB 5IT9L 1K73C 5ISRA 1ILPA 3A0JA 3GV6A 1IBLQ 4HR7B 1CUKA 4KTAA 1JE5A 2RCNA 4C56C 3TMEA 2XN9C 1G2TA 3PSIA 4Y7NH 4NMZA 4U68A 4DA2A 4CKEA 4BA2I 1SE2A 5ELDA 1S40A 3EQLC 1CKOA 4A76A 4KI0A 1YJWA 5C4JB 1HNZL 2YTVA 1IYJB 4Z9CB 2F0IA 5J3BA 4FF2A 3CC7A 4G7HC 2XVSA 1WTHA 3LGJA 4C3HH 1Z9FA 1AFPA 4P72A 2JJQA 3P75A 1GUOA 1I50B 3F8TA 3PQIA 1I6HH 2R7FA 2MUYA 3BDCA 1EIYB 3STBC 2WAQB 3HOWB 4J1MA 3ER0A 4CJ0B 2WKDA 3U9SA 2AUJD 3QIAA 4IPHA 2EY1A 3IKJA 1TY2A 2K5WA 1D7QA 4POFA 1HZAA 1BO0A 3WDNA 2PQAB 2WAQE 1HFNA 3C3LA 3MTSA 3H3VI 3NBHB 3V05A 3U4ZA 3SHLA 3A8IE 2QILA 5M3MH 1WTWA 4GOPB 1SROA 2RHQB 2D9UA 2EYLA 1H9MA 4KKUA 2MNAA 3G71A 4O42A 3T53B 1GD7A 3QG1A 4DR1Q 1LTTD 4DV2Q 4AYBG 1LACA 2JA6G 4C2MB 1GHKA 1PHJA 4XYQA 1TT2A 1SAPA 2AQ1B 1YHAA 2G5DA 3I4NG 4JOIC 1ESRA 2MHVA 3PUWA 3FRPB 4A93H 5EPJA 3TDQA 1VQOA 2MPMA 2ZTDA 3KJPA 4LF7L 4DR6Q 1EOVA 2D2CC 2FINB 5D14A 4B3TQ 2RVLA 1D6EC 2ZTCA 5D65A 4AH6A 3K0XA 3NBHA 4OEMB 4DK6C 2I5MX 3NTHA 2PQAA 2Q8TA 2UUCQ 5FOBB 1Z47A 1D5MC 2EYJA 5I9PA 3RN5A 1HA5A 3L9AX 1WCMB 3PUYA 1BDOA 3F2UA 3ULPA 1OXSC 1QCBD 3CMEA 4HJ7A 3BDOA 1FJGQ 2L9HA 3WOEA 5EKKA 1EY9A 1EFID 1PFSA 3EVQA 1PYSB 2R93H 4YY3Q 4A3DG 3CC4A 4N8X1 2KCTA 2R92B 2K5VA 1UE6A 4DUYQ 4A3IG 3D6CA 3PIPA 5M5YH 2N3SA 4IFDI 5C3XA 4NXNL 2DUDA 3P20A 1YNNC 3K80C 2JA5G 3J81j 1YNJC 2HHHL 4ME5A 3Q22A 4PG3A 4RGOS 4HIMA 3SE0A 2GN5A 1A3VA 4R4QA 3ERQA 4RKBA 2WP8J 4K2KA 2J7ZA 3HOYB 3QB3A 2SNMA 3D3RA 5I9OA 2KHSA 4QB4A 2NB0A 1I94Q 4JV5Q 1HA6A 3GQBA 3CCLA 3W5OA 3K57A 3M4OB 2NVTH 1E7ZA 3H6MA 2H1EA 2HUGA 3TRZA 1JICA 5E7NA 2HHHQ 4K0KQ 2ATWA 4AYBB 1TKWB 2JA6B 4LFAQ 1KL9A 1NNXA 5JEAG 2PQEA 3ULJA 2BA1A 1B9MA 4A3IH 2K03A 1EU4A 3GV3A 1CK1A 1PRTD 2K28A 1FJGL 4DXGA 2MP1A 3PUXA 1RHPA 4IALA 5IP9H 1FYCA 4B3SQ 3RD4A 3K8AA 3V96A 2CKZB 3GTOH 4L6TB 5CV5A 5ELFA 3S14H 2Z4IA 2YYZA 3TP6A 4XIGS 1V9PA 1Q7YC 1SYEA 1SE3A 4DNIA 2K6AA 1XNRL 3JC66 2JSOA 1TWHH 2PW7A 1ML0D 2F0EA 1JJ2A 3DHQA 1G6ZA 2OEOA 1GXDC 2IPKD 3WOFA 1CQVA 2Y0SE 3RLFA 1CTMA 4DN4M 2M9VA 5EAYA 5EPKA 4DR4Q 4XQQA 1S3OA 2KCMA 1JR0D 3K5LA 2EIFA 1AE3A 2YTXA 3MAQA 3LWEA 3EA6A 3D8GA 2ZJRA 1DOLA 2K32A 1HUNA 3MFYA 4KJOA 3K0YA 3R2IA 4HSPA 2F0HA 3K59A 3U4VA 1CZWA 5J39A 1B44D 1SSOA 4OO1G 3PF5A 1IL8A 3GTGB 2CWPA 1XXGA 2G9HD 4BBRB 2A6EC 2BCOA 1C9OA 4H13C 3ERSX 2I46A 2MO1A 3GTKH 1LTAD 2A8VA 1M90C 2UXBQ 1EFWA 1DOKA 1K3BC 3MC0B 4YY3L 1Q46A 1RTNA 2XTIA 2F0SA 1KHIA 5CBEE 3OWFA 1VQLA 4OELB 4RGTA 3CCMA 1ZKOA 1V1PB 1F2ZA 2VNUD 2BDOA
chains in the Genus database with same CATH topology
2BA0A 3NPPA 2K5QA 2DNEA 4HMIA 1NAPA 3V2TA 3X3MA 4EQNA 4FXGC 1WTQA 4BY1B 5M5WB 2B2UA 1C48A 5BN4A 1DYQA 4WFN3 5EBCA 4XDXA 3EROA 1PFBA 4U673 3S2DB 5E3FA 2XWJB 1PXUA 1O78A 4OL7A 2A73B 3CHBD 3A7AB 4X3UA 1CT1D 1YNJD 3M7NA 2E2DC 1FNWA 4XTCS 2ID0A 3I70A 4KN7C 4Y7NB 1STEA 4PMWA 5DEHA 1EY4A 4EGVA 2XIWA 1LLRD 2F0QA 2XRSD 4M8AA 5DAUA 4C3HB 3C46A 4F7XA 5I2XA 1AZQA 1QNKA 2F0KA 2PNRC 4A3IB 1TWFB 5CV6A 1AEXA 1Y69U 5BN3A 1GUWA 5CYUA 2R6GA 4DF7A 5K36G 1BCPB 4ZQ3A 1O7LA 1EU3A 1WTPA 1I4RA 2KQ3A 3C1FA 3DEOA 3SK5A 4EVOA 4IUUA 2Z8LA 3UI2A 3OW7A 1TS4A 2NZ1D 5KRUA 1B1ZA 1VF5C 2TSSA 1HFGA 3NQTA 2NTSA 1LT3D 1L0YB 3NE5B 1FNUA 3S1RB 1A3UA 3N52A 5M3MB 3A56A 5COYA 2KUMA 2NVYB 2RBMA 4RA8A 4A3EB 4KD4A 5EQ0A 3NHHA 3OMCA 3K58A 4K6LA 1WD1A 3K7AB 1U4PA 3S1MB 1STBA 1XX8A 5CV7A 1B2TA 4A3DB 2B2YA 2E2JB 1H9JA 5IIFA 3HS0C 1WD0A 2RSNA 2B2VC 4C1NK 3SEBA 1K83B 2AWOA 3I72A 3Q6SA 1JE4A 2A74C 4FNFA 4R8NA 1TVXA 1RODA 2RDHA 1W6KA 3KK7A 5ELCA 4HTHA 4NDXA 4ID6A 1SNQA 1KABA 1DD2A 1PZID 3X3NA 2KA7A 2FMCA 1R4PB 4C3IB 1EY0A 3MFGA 1TS3A 4A3GB 3R3OA 1ET9A 3GD7A 4C3HG 1QWYA 2K04A 1U9RA 1NSNS 5ELEA 5C4XB 1RCVD 2RSOA 4OO1I 1ENCA 5E4WC 2A6ED 3E5SA 3FKIB 4KKSA 4BS9A 1SNMA 2RDGA 1EIHA 5JOBA 3KF8A 5CV8A 1IW7D 2L55A 2F3WA 4A3MB 1RF2D 1ICWA 4IFDJ 2BE5C 2CW0D 3RUZA 4RGMA 2K1BA 3NBIA 4JK1C 5KIXA 3FVQA 1TWCB 3D4WA 4IFDH 1Z6HA 5EKIA 1HHVA 2ZXRA 2AQ3B 3A7LA 2KEEA 3DMUA 1UNSA 1ENFA 4A3BB 3A55A 1STAA 1GOZA 2B2UC 1X3PA 2EYFA 4HCEA 2MJ8A 2JYOA 2EYHA 2WIIB 1EYDA 1ONLA 4F88A 2O5IC 2JEBI 1MSHA 5FO8B 3HZXA 2A68C 1ZXTA 4HSVA 3D31A 3TP7A 1CA6A 5DNFA 1RTOA 2F0FA 4N9TA 1PTOF 4IQZA 3TZDA 4MN3A 1H9SB 3OOCA 5G3LF 1BXTA 3TP5A 1F9SA 2FHTA 3J7AF 4I7ZC 2A6HD 2X69A 4FXDA 4ZUIA 4KD3A 4RAUC 2RA4A 3K5OA 1EYCA 1MSGA 3GTJB 1I4GA 4ZLTF 5C0XH 2F0MA 5JAVA 2L12A 2X6GA 1NR2A 5I6YA 2LMCB 5FO7B 3MXPA 3HKZB 3ONAB 3MXUA 4DNTB 1S5BD 2K5DA 2M00A 4CJ1B 1M8AA 1XTCD 5JPMC 1K8MA 4PNYA 2N88A 1Q1EA 4IZ8A 2A5HA 3OWEB 3BVMA 3M7GA 4TRDA 5IT9E 1T5EA 1IHZA 4G7OC 3BYTB 2B2TA 2C5CA 4LK1C 5FKAC 2TMPA 5JJZA 2IWHA 4G57A 2Z1CA 4WORA 1NUCA 4QF4A 3T4AC 4ZYSA 3U9OA 2KCNA 1F9QA 2ZXOA 2KVMA 2I07B 1CFMA 4ZRZA 1PFMA 4C3JB 2SOBA 1SYDA 2B63B 3CKIB 4OO1H 5KYLA 5CV4A 3TN2A 1B9NA 1EEFD 1LTGD 1TR5A 1RKNA 2XSCA 5CR3A 2EXZA 5T1GA 1CHQD 4KK7A 3MWYW 5EKLA 4IUPA 1JOKA 4NP5A 4K5XA 1I3QB 1VMCA 1DXMA 2EPBA 4P2CB 3GTMB 5IODA 2J4XA 2KECA 4DAYA 4ZAIA 2K01A 4XYOA 4O1NA 2A69C 2F0GA 3PUZA 1B53A 5E4XA 3BDLA 1PMRA 2CHBD 2ENBA 4WJWA 5I2YA 1J9OA 1I6HB 4FVMA 2Q8IB 4PV1C 2ZXPA 1QJOA 1ENAA 2KOLA 3HOVB 1ZYRD 1WTXA 2R93B 3FEWX 1KNEA 1LABA 3PIO3 2EY5A 1V43A 2H4OA 4XQNA 3W2DA 1SEBD 2WB1B 4TKOB 2L1BA 3NTKA 1OXUA 2L4NA 2O5JC 1Q12A 1B50A 1CA5A 3BZDB 1IW7C 1F9RA 2AUKA 4XQJA 4ZKCB 2CW0C 2BE5D 2L11A 2F0LA 4DXFA 3A8KE 4IUTA 2HCIA 3GTPB 3I4NB 5I4DA 5EBDA 2JA8B 4FF3A 1EQVA 3EFXD 1Q3LA 4L8JA 3ZYYX 3ND8A 3LX0A 2SEBD 1LTID 3DUZA 5F2DA 5CORA 3HEJA 3H94A 2BOSA 1KDCA 3I73A 1D2BA 1LTRD 3D4DA 2IW3A 3P7JA 4DK1A 3OPOA 2E2HB 5C0XJ 5IGEA 1QILA 1SFOB 3NSWA 3BS1A 1EQTA 2NTTA 5KGUA 2L5TA 4F87A 1BOSA 4UAIA 4H7BA 4QMGA 5FLXL 4ILWA 2EJGC 4KHVA 4DFAA 3PO3B 3VR2A 3ITPA 2F4IA 1WTOA 1TWGB 3I8ZA 1E2WA 3FDTA 5KNDA 1TS2A 1DONA 3IFTA 3LWUA 4MHEA 1CHPD 2LFNA 1STYA 3K5NA 1K8OA 2F1MA 3G6JB 3HP3A 2G9DA 2B2TC 5T1IA 2L0CA 1LO5D 3T16A 1GHJA 2XWBB 2FJ2A 4PMBA 3RZDB 5FLXE 1C8CA 2A69D 5IGBA 4GZYC 2M2LA 5JEAJ 4KY6A 2KJXA 4EQOA 3PIP3 3M85A 2IX0A 3VR3A 2F0JA 1BBXC 1TQOA 1A2UA 1Y1WB 4FO2A 4BA1I 1O7YA 1TIID 1CI3M 2NN6G 1PTOB 3VYUA 2SDFA 2F0OA 1HPCA 3N6RA 4K6DA 4RHSA 3QOJA 4KY7A 1GJXA 1FGBD 2V4DA 4Q5VA 1S5FD 5CGKA 4TQUS 2F0UA 2CQAA 1G91A 2EJMA 1B4OA 4CBVA 2AWNA 3GTOB 4A3FB 4XT3B 3PMFA 5IGDA 1I4HA 3VR6A 5A2QE 3NQIA 1LV9A 1SYFA 2F0TA 2PCFB 2RKSA 1UUPA 4BWGB 2JA5B 3IFDA 4C3JG 1O7ZA 3IAYA 1JWUD 1PTOC 1D5ZC 2IX3A 1JOOA 3HOXB 3BVGA 2PYKA 2JXMB 1VCIA 4DAVA 2AQ2B 4S3SA 3JAME 3BVZA 1JWMD 2K05A 5K36H 1Y1VB 1R9TB 5CBAE 4XXEA 3KLSX 5CMDA 1BCPD 4K8JA 3MHBA 1HRJA 5NUCA 4B9XA 1NCVA 1SJHD 2WKCA 2EY2A 1ILQA 4LMQD 3J81E 1AN8A 2Y0SB 2Z4HA 1I4QA 3HG9A 3GO5A 5I6WA 4DAPA 1PZKD 4K2LA 3PUVA 5EGTA 1EL0A 4H44C 2IT1A 2ICEC 4X3KA 1JB3A 3NTIA 4K14A 5FO9B 3BYYB 1GUSA 5ELBA 5C4HA 3HGBA 2X6LA 1SJED 2NWGA 1AZPA 1F9PA 4RFBA 2DY7A 1LTBD 4X3SA 4UDUC 3VR5A 5FK9C 2Q8RE 3HOZB 1I6VC 2K7VA 2F3VA 1SYBA 3O13A 4RCNA 5KNBA 1TY0A 5LHY1 3D4RA 2OT2A 1KLGD 2EY6A 4CGYB 4BY7B 4NW2A 5AFWA 1SNPA 1JQYD 1MBYA 3OSOA 3M4YA 5C3WA 4HN7A 4ODGA 3T13A 3P1HA 1X32A 3LNNA 4WRDA 5M5XB 3I90A 1JCKB 3OMGA 2A68D 5A2QL 2ZT9C 4X3TA 4YIJA 1SNCA 2EZVA 2EVBA 4FYDA 1Q8IA 4IUVA 5CV9A 4HCSA 4OHJA 4KN4C 1EZ6A 1HUMA 5C44B 1PDQA 1U4MA 2R3ZA 3S1NB 1KAAA 5E1FA 3SXHA 3BG3A 2B2WA 3PV0A 1Y8PB 1EIGA 2PMZB 4I65A 2HDLA 3SK4A 4LJZC 3CRKC 1QOHA 1Y8OB 3GTLB 2KCCA 2EYMA 1PRTF 1SNDA 1BCPF 4R8IA 1BNZA 3ND9A 3R93A 1F2YA 5JVH3 1IKMA 1PTOH 5C0XG 3NK9A 1J8IA 1R4QB 3S16B 3K6OA 4QUCA 4DU9A 1EY7A 2PW5A 2QDBA 3MXGA 4G7ZC 1EWCA 1JC7A 1STNA 5JEAH 3DWAA 4N9PA 1MGSA 4CKCA 1RD9D 1XYIA 2E75C 1Z7TA 4ABNA 3S14B 2JA7B 2F0NA 4MIUA 2JEAI 4KHZA 2WINB 1IYUA 1TU2B 2PZWA 3R8BA 3DWPA 2ICIA 2XRQD 1KNAA 3T56B 4RCOA 3S15B 3CU7A 1L0XB 4ZUJA 1D5XC 3NUCA 3Q0AA 4ZKBB 3QO2A 4CKBA 1G291 1FR3A 1S5CD 1X3QA 3AMUA 1STGA 1CZGA 5M5YB 5LL6X 3K5MA 2NN6H 3D6WA 3H0GB 1O80A 5TSSA 5IOCA 1HQRD 2RQXA 3NP8A 1HTLD 1OXVA 3QWNA 2F0PA 2NN6I 3FPUB 4A3JB 3OIPA 3CRLC 5J22A 4E6IA 3DWQA 4KY5A 2B39A 3I4LA 2OF1A 3Q24A 1IKLA 1VF7A 5HGTA 2IX1A 3SR1A 2PZTA 1SXTA 2VB2X 2R61A 3KLSA 4KV6A 3KLRA 1E2VA 4HMJA 4IFDG 1A15A 2F0WA 1SBBB 1BCPC 3IL8A 2RDFA 3GTKB 4J6HA 3I91A 1E2ZA 3VYSA 2WV6D 4DNRB 2PO4A 1PTOD 1KDAA 2B2WC 1DOMA 5C6AA 1DZ1A 2EOTA 3M3YB 4FF1A 1HCZA 4IUQA 1PLFA 3A54A 4CHTB 1H9SA 4PMCA 3GP7A 2PZUA 1JOQA 1OXXK 1SMYD 4JBWA 3H91A 5C3EB 3I3CA 2HDMA 3S9WA 1A2TA 1CM9A 1PRTC 2EDGA 3T51B 1SE4A 5C5LA 1EY8A 2JE6I 4H0LC 1H9KA 4TSSA 3FPPA 2FMMA 1GUGA 4R9WA 4FP5D 4CJ2C 1S5DD 4V190 4IN3A 3RMHA 1WTRA 4K5VA 2B2YC 3MZ5A 3L3OC 5KYIA 1DM0B 4J8QA 1HTPA 5EJWA 2MGSA 4IUNA 1UAPA 1MI2A 3I4MB 5DM63 2WACA 2VUMB 1EZ8A 3AB9A 5C4ZA 5IGFA 1G2SA 1PRTB 1RJTA 3SK8A 2E76C 1BF4A 1CQFA 2PPBC 1V1OA 3C1EA 2IL8A 4K5WA 5M3FB 2K33A 1ZYRC 4FXKC 2D62A 3VYRA 3MXNA 5M9OA 1QE6A 5KEEA 1BR9A 1DJRD 4ZK9B 3DEPA 2N55A 5G3LD 1F2MA 1E0BA 3SK6A 4KKTA 3GTQB 1LT6D 3HOUB 4B9WA 5D3DA 3NWSA 5JPNC 3PO2B 1FD7D 5IGGA 1AW7A 2NUCA 1QB5D 1G8ZD 3R2TA 2QCPX 4RKLA 3VR4A 3TSSA 4FF4A 1C4QA 3NXWA 3A8JE 3J81L 3TP8A 3VA7A 2KEDA 4F8MA 4OIJA 1SYCA 1EYAA 1FNVA 3KBGA 2E74C 4Q0FA 5CC4A 3DXJC 3VA5A 4B08A 4QIWB 1SYGA 1ZEQX 2SNSA 2VXWA 3VYTA 1H9RA 1Q1BA 4K8IA 4PQXA 5C5MA 4RHRA 3J7AV 1A6XA 4RGNA 1IYVA 2LS01 2HCCA 3MVVA 3S2HB 1LTSD 2VB3X 3NWTA 1EWHA 1S5ED 1VDZA 3E6ZX 2EJFC 3KBXA 2GA4B 1KLUD 3SVMA 5J1ZA 1JWSD 5IGCA 5C0XI 3KUPA 2OXPA 1F77A 1RDPD 2QF7A 2DNCA 1Y8NB 3CQZB 4LAAA 1MD2D 5JVG3 1LT4D 2LKVA 1XWEA 2IJ0A 4KMUC 1S4ZA 1STHA 4QCLA 1U4RA 1VMPA 1U4LA 4OGQC 1HXYD 4KJNA 1D1KA 3H3VC 2R7ZB 1OO9B 1PFNA 3URYA 3E0JA 4DK0A 1EY6A 1UEAB 4DGZA 3MEHA 2QEJC 2B2VA 2NVXB 1SMYC 1D1IA 2C9OA 2NYZD 4XT1B 4L63B 1II3A 1GUTA 2FFKB 2B8FA 4A93B 4M1UB 3L7ZC 5LL6S 3S1QB 3Q23A 3OHXC 2B8GA 1TWAB 3J80E 1B3AA 3MA2B 1GUNA 2DN8A 2E2IB 1W6JA 1PYWD 3EJIA 2NVQB 2EYPA 1EOTA 5D3IB 1ET6A 3C2PA 1YNND 2D5DA 2NBFA 3J7YW 1Q90A 3AU7A 3SDZA 1PZJD 2O2LD 4RH6A 3QJYA 1V1PA 4QUFA 1I4PA 4C3IG 1DCZA 1T5XD 1EY5A 1QNUA 3DM1A 3OIQA 1LT5D 1M4VA 2LY7A 3HRZC 4NKLA 2YU9B 5HURA 2A6HC 1EEID 2JP1A 4BBSB 3W3AA 1BQQT 3TBIB 2HQEA 2CVRA 5DM73 5BN5A 1I4XA 1SNOA 3FMCA 2F0DA 2XNAC 4HAEA 1QG7A 1SDFA 1OXTA 4A3KB 2BDNA 3H09A 1NR4A 4IURA 1JORA 2EYOA 4OIKA 3TZUA 2O4XA 3J80L 3QOLA 1A3TA 1V8QA 2QKIC 1ESFA 1TS5A 1F2LA 1TWHB 1AP0A 1WTVA 4C1NI 2F03A 5KNCA 4EQPA 4V0BA 4G4KA 2NVTB 1BUVT 2DY8A 1HQMC 5EPLA 3JAML 3S17B 4HEDA 2F0VA 5A35A 4RWSC 1KTKA 1WVLA 3RZOB 1KDBA 3G7LA 4ULLA 2EE1A 5K5PA 2J0TD 5IT9L 5ISRA 1ILPA 3GV6A 4HR7B 4KTAA 4C56C 3TMEA 2XN9C 1G2TA 4NMZA 4U68A 4DA2A 4CKEA 4BA2I 1SE2A 5ELDA 3EQLC 4KI0A 5C4JB 4Z9CB 2F0IA 4FF2A 4G7HC 2XVSA 1AFPA 3P75A 1GUOA 1I50B 2MUYA 3BDCA 2WAQB 3HOWB 4J1MA 4CJ0B 2WKDA 3U9SA 2AUJD 3QIAA 2EY1A 3IKJA 1TY2A 2K5WA 1BO0A 3WDNA 1HFNA 3C3LA 3MTSA 3V05A 3SHLA 3A8IE 2QILA 1WTWA 2D9UA 2EYLA 1H9MA 4KKUA 4O42A 3T53B 3QG1A 1LTTD 1LACA 4C2MB 1GHKA 4XYQA 1TT2A 1SAPA 2AQ1B 1ESRA 2MHVA 3PUWA 3FRPB 5EPJA 3TDQA 2MPMA 5D14A 2D2CC 2FINB 2RVLA 1D6EC 5D65A 3NBHA 3NTHA 2Q8TA 5FOBB 1Z47A 1D5MC 2EYJA 5I9PA 1HA5A 3L9AX 1WCMB 3PUYA 1BDOA 3F2UA 1OXSC 1QCBD 3BDOA 2L9HA 3WOEA 5EKKA 1EY9A 1EFID 3EVQA 2R92B 3D6CA 4IFDI 5C3XA 3P20A 1YNNC 1YNJC 4ME5A 3Q22A 4RGOS 3SE0A 1A3VA 3ERQA 4RKBA 2WP8J 4K2KA 2J7ZA 3HOYB 3QB3A 2SNMA 3D3RA 5I9OA 2KHSA 4QB4A 2NB0A 1HA6A 3GQBA 3K57A 3M4OB 3H6MA 2H1EA 2HUGA 1JICA 4AYBB 1TKWB 2JA6B 5JEAG 2PQEA 2BA1A 1B9MA 2K03A 1EU4A 3GV3A 1CK1A 1PRTD 2K28A 4DXGA 2MP1A 3PUXA 1RHPA 4IALA 1FYCA 3RD4A 3V96A 4L6TB 5CV5A 5ELFA 2Z4IA 2YYZA 3TP6A 4XIGS 1SYEA 1SE3A 2K6AA 2JSOA 2PW7A 1ML0D 2F0EA 3DHQA 1G6ZA 2OEOA 1GXDC 2IPKD 3WOFA 1CQVA 3RLFA 1CTMA 4DN4M 2M9VA 5EPKA 4XQQA 1JR0D 3K5LA 3MAQA 3LWEA 3EA6A 3D8GA 1DOLA 2K32A 1HUNA 3MFYA 4KJOA 3K0YA 3R2IA 4HSPA 2F0HA 3K59A 1CZWA 5J39A 1B44D 1SSOA 4OO1G 1IL8A 3GTGB 1XXGA 2G9HD 4BBRB 2A6EC 2BCOA 4H13C 2I46A 1LTAD 1DOKA 3MC0B 1RTNA 2F0SA 5CBEE 3OWFA 4RGTA 1ZKOA 1V1PB 1F2ZA 2VNUD 2BDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHT A;  5CBA E;  1HFG A;  2FJ2 A;  5EJW A;  3I90 A;  2MGS A;  1X3Q A;  2K03 A;  3GV3 A;  1MI2 A;  2X69 A;  1NAP A;  1BO0 A;  4X3T A;  2K28 A;  3D6W A;  2FFK B;  4RAU C;  1HFN A;  2RA4 A;  1F2L A;  1C8C A;  5CMD A;  3MTS A;  2MP1 A;  1RHP A;  1Q3L A;  1MSG A;  1EIH A;  1HRJ A;  3N52 A;  3TN2 A;  4ZLT F;  1WTW A;  1O80 A;  4IUV A;  1AP0 A;  1WTQ A;  2M2L A;  2B2U A;  5COY A;  4HCS A;  1NCV A;  2D9U A;  1WTV A;  5T1G A;  2L12 A;  1G2S A;  3FPU B;  2KUM A;  1HUM A;  2VXW A;  1ILQ A;  1RJT A;  4O42 A;  5COR A;  1PDQ A;  1U4M A;  4RA8 A;  1ICW A;  1B3A A;  3MWY W;  4LMQ D;  2R3Z A;  4XDX A;  1BF4 A;  5EQ0 A;  1PFB A;  2X6G A;  4IUP A;  1NR2 A;  1SAP A;  1IKL A;  1WD1 A;  2IL8 A;  1BBX C;  2K1B A;  1ESR A;  1U4P A;  2B2W A;  3ONA B;  2HCC A;  1XX8 A;  1EIG A;  1VMC A;  3P7J A;  1O7Y A;  2EPB A;  5EPJ A;  1EOT A;  1B2T A;  2DY8 A;  5EPL A;  2MPM A;  2SDF A;  1QE6 A;  4CJ1 B;  1M8A A;  1ML0 D;  2HDL A;  2KEC A;  4HED A;  2B2Y A;  5D14 A;  4ZAI A;  2FIN B;  2K01 A;  2RVL A;  3KBX A;  4X3U A;  5D65 A;  5EKI A;  1G6Z A;  1HHV A;  1A15 A;  1EL0 A;  3IL8 A;  4RWS C;  2N88 A;  2Q8T A;  3I91 A;  1B53 A;  1EQT A;  2KEE A;  4DN4 M;  4ZK9 B;  3SVM A;  5E4X A;  4X3K A;  3DEP A;  1WVL A;  5EPK A;  1WD0 A;  2N55 A;  3F2U A;  2B2W C;  4R8I A;  2RSN A;  3KUP A;  2B2V C;  4QUF A;  1BNZ A;  1G91 A;  1DOM A;  2B2U C;  1B4O A;  1E0B A;  1X3P A;  2EOT A;  3G7L A;  3R93 A;  1DZ1 A;  1J9O A;  2EE1 A;  3Q6S A;  2MJ8 A;  2XIW A;  2JYO A;  4UAI A;  4IUQ A;  1JE4 A;  4XT3 B;  1IKM A;  3LWE A;  1PLF A;  2L9H A;  2KOL A;  2X6L A;  1TVX A;  2B2T A;  2NWG A;  1F9P A;  1ROD A;  1AZP A;  1ILP A;  1DOL A;  3DM1 A;  1WTX A;  1LV9 A;  1J8I A;  1HUN A;  1KNE A;  2DY7 A;  1AZQ A;  1QNK A;  3GV6 A;  4X3S A;  4QUC A;  5JJZ A;  3H91 A;  1MSH A;  1SSO A;  3I3C A;  1GUW A;  1IL8 A;  3IFD A;  1O7Z A;  2HDM A;  1WTO A;  1G2T A;  2Q8R E;  3I8Z A;  4U68 A;  2L1B A;  1CM9 A;  1MGS A;  1ZXT A;  3FDT A;  4HSV A;  2JP1 A;  1XYI A;  1WTP A;  3DEO A;  1CA6 A;  2L4N A;  1S4Z A;  5DNF A;  4IUU A;  2J7Z A;  1U4R A;  2CVR A;  1VMP A;  1RTO A;  1U4L A;  1B50 A;  1DON A;  1CA5 A;  4NW2 A;  5AFW A;  1HA6 A;  3UI2 A;  2FMM A;  2K04 A;  4R9W A;  4CJ2 C;  1DOK A;  1F9R A;  1PFN A;  2NZ1 D;  1F9Q A;  2H1E A;  2HUG A;  2KVM A;  4HAE A;  4MHE A;  4MN3 A;  1RTN A;  3TZD A;  4ZKC B;  1JIC A;  1KNA A;  2KED A;  1WTR A;  1QG7 A;  5CBE E;  2L11 A;  1SDF A;  2B2Y C;  2B2V A;  2BDN A;  2K05 A;  2RSO A;  4IUT A;  2HCI A;  3HP3 A;  1PFM A;  2NYZ D;  1NR4 A;  4ZKB B;  3QO2 A;  1X32 A;  2B2T C;  4IUR A;  4XT1 B;  4OIJ A;  5T1I A;  4OIK A;  5E4W C;  4CJ0 B;  1F9S A; 
#chains in the Genus database with same CATH topology
 5DLQ E;  2BA0 A;  3NPP A;  3I4O A;  2K5Q A;  2DNE A;  4HMI A;  1NAP A;  3V2T A;  3X3M A;  4EQN A;  4O2D A;  4DUZ Q;  4FXG C;  4JI0 L;  1W3S A;  1NMG A;  1K9M C;  4R4O A;  1WTQ A;  4BY1 B;  5M5W B;  1A62 A;  2B2U A;  1C48 A;  5BN4 A;  1DYQ A;  4WFN 3;  4IOC A;  2UXC Q;  1N9W A;  2CQO A;  3OW2 A;  4JVZ A;  5EBC A;  3GTQ H;  4XDX A;  3ERO A;  1PFB A;  3FKI G;  4U67 3;  3S2D B;  5E3F A;  3BJU A;  2QDL A;  2XWJ B;  2R92 H;  1PXU A;  1O78 A;  4OL7 A;  1Y1W G;  1K0S A;  2A73 B;  1HR0 L;  2HIX A;  4UP9 A;  3CHB D;  2QGQ A;  3HOU H;  3CP0 A;  1RIP A;  3A7A B;  4X3U A;  1HNX Q;  1CT1 D;  1YNJ D;  1XNQ L;  3M7N A;  2E2D C;  1FNW A;  1LM0 A;  4IPC A;  4XTC S;  2ID0 A;  4IOA A;  1UE7 A;  3I70 A;  4KN7 C;  4Y7N B;  3J7A 5;  1STE A;  4PMW A;  1EUJ A;  5DEH A;  1EY4 A;  4EGV A;  1MJC A;  2XIW A;  3S2H H;  1LLR D;  2F0Q A;  2XRS D;  4M8A A;  4MTN A;  4YCU A;  5DAU A;  4C3H B;  1I5F A;  3C46 A;  3S24 A;  1L0W A;  1IZ6 A;  4F7X A;  5I2X A;  1AZQ A;  2ZJP A;  1QNK A;  2BH8 A;  3H3V H;  2F0K A;  2PNR C;  4A3I B;  1TWF B;  5CV6 A;  1AEX A;  3A74 A;  3FKI H;  1Y69 U;  5BN3 A;  1A0I A;  1GUW A;  2UUC L;  5CYU A;  2R6G A;  4DF7 A;  5K36 G;  1BCP B;  4ZQ3 A;  1IBK Q;  1O7L A;  1EU3 A;  3I56 A;  1WTP A;  2VQF Q;  1I4R A;  2KQ3 A;  3C1F A;  3DEO A;  3SK5 A;  4EVO A;  2R93 G;  4IUU A;  2MFI A;  2Z8L A;  3UI2 A;  3OW7 A;  1MJE A;  2RHS B;  1TS4 A;  2NZ1 D;  2CH4 W;  5KRU A;  4P71 A;  1HH2 P;  2CCZ A;  2N78 A;  1K83 H;  1B1Z A;  1VQM A;  3RN2 A;  3PO3 G;  1PV4 A;  1NTG A;  5GQO A;  1VF5 C;  2TSS A;  2ALY B;  1Y1V H;  3FP9 A;  1HFG A;  4LF8 Q;  3NQT A;  2NTS A;  4JC0 A;  1LT3 D;  2Z9H A;  1L0Y B;  3NE5 B;  1FNU A;  1VQP A;  3S1R B;  3NEN A;  1A3U A;  4P73 A;  1YJ9 A;  3N52 A;  5M3M B;  5IYB G;  3A56 A;  5COY A;  1PH2 A;  4BXX G;  2KUM A;  2NVY B;  2RBM A;  4RA8 A;  4A3E B;  4KD4 A;  5EQ0 A;  3NHH A;  3OMC A;  3K58 A;  4K6L A;  4YCV A;  1WD1 A;  5IWA L;  2HT1 A;  4KHP Q;  3K7A B;  1U4P A;  3S1M B;  3HKZ G;  1STB A;  1XX8 A;  2N8N A;  5CV7 A;  1B2T A;  1R9T H;  2HQL A;  4WJ3 M;  5LMU Q;  4A3C H;  4A3D B;  2B2Y A;  2E2J B;  1ICF B;  4J15 A;  4DK3 C;  1H9J A;  5IIF A;  3CD6 A;  2JA5 H;  3HS0 C;  1YVC A;  2OTJ A;  1IBL L;  1WD0 A;  3GTJ H;  3M4Q A;  4R4I A;  2VS1 A;  2RSN A;  2B2V C;  4C1N K;  4X65 L;  1N8R C;  3SEB A;  3KLW A;  4PZ7 A;  1K83 B;  2AWO A;  3I72 A;  3Q6S A;  4B3M Q;  1JE4 A;  1UE5 A;  2A74 C;  4FNF A;  4R8N A;  1TVX A;  4LFB Q;  1ROD A;  2RDH A;  1W6K A;  3KK7 A;  1KRT A;  5ELC A;  4X62 L;  5JJK A;  5M5X H;  4HTH A;  5C3E G;  4NDX A;  1TWC H;  1KXL A;  1QVC A;  4ID6 A;  4HJA A;  1AE2 A;  4L5Q A;  1SNQ A;  4C3J H;  1KAB A;  1DD2 A;  1L1O C;  1PZI D;  3X3N A;  1X65 A;  2KA7 A;  2FMC A;  1R4P B;  3HOY H;  4C3I B;  1EY0 A;  3MFG A;  1TS3 A;  3EN2 A;  4A3G B;  3R3O A;  1XMQ Q;  1ET9 A;  4A3E H;  3GD7 A;  4C3H G;  1QWY A;  3DLL A;  2K04 A;  2E5L Q;  1NSN S;  1U9R A;  2E2I H;  2JA7 G;  3G6E A;  4UP7 A;  5ELE A;  1YJN A;  5C4X B;  1RCV D;  2RSO A;  2WAQ G;  3HOZ H;  4OO1 I;  1ENC A;  4NXM Q;  5E4W C;  3HOW G;  1K3R A;  1WFQ A;  4JPB W;  2A6E D;  4Y52 H;  3E5S A;  3FKI B;  4KKS A;  4BS9 A;  2UXC L;  4X66 Q;  1SNM A;  2RDG A;  1EIH A;  5JOB A;  3KF8 A;  1EWI A;  5CV8 A;  4BY1 H;  4DR4 L;  3MXN B;  1IW7 D;  2L55 A;  3T1Y L;  1VQ4 A;  3JAM c;  4B3M L;  2F3W A;  4A3M B;  1RF2 D;  1ICW A;  1X54 A;  4IFD J;  3UDX A;  2BE5 C;  2CW0 D;  4GS3 A;  3I4M G;  3RUZ A;  4HJ5 A;  1S72 A;  4RGM A;  2OTL A;  1V1Q A;  4CDD C;  3VDY A;  2K1B A;  3NBI A;  3CPW A;  1X9N A;  4JK1 C;  1I3Q H;  5KIX A;  3FVQ A;  1TWC B;  3GTM H;  3D4W A;  4IFD H;  2LXK A;  4CDF C;  3S17 H;  4LW1 A;  4A3M G;  1KD1 C;  1Q86 C;  1Z6H A;  1QUQ A;  5EKI A;  1HHV A;  2ES2 A;  2ZXR A;  2AQ3 B;  3A7L A;  2KHJ A;  3G48 A;  2KEE A;  3DMU A;  1UNS A;  2UU9 L;  1ENF A;  4A3B B;  3A55 A;  3F1Z A;  4QJF A;  2JK8 A;  2PI2 A;  1STA A;  4UY8 C;  1GOZ A;  5M5W H;  4HID A;  2B2U C;  4B3R L;  1X3P A;  2EYF A;  1JJG A;  4HCE A;  2MJ8 A;  4MNO A;  2JYO A;  4IJH A;  4R4T A;  2EYH A;  1TWA H;  2WII B;  5IYB H;  1EYD A;  1ONL A;  4F88 A;  3QR8 A;  2O5I C;  2JEB I;  3I4N H;  4ME3 A;  1PH5 A;  1MSH A;  5FO8 B;  3HZX A;  1VQ5 A;  1EIF A;  2A1A A;  3UDF A;  2A68 C;  2IHE A;  1ZXT A;  4HSV A;  4DV3 L;  3D31 A;  3TP7 A;  1CA6 A;  5DNF A;  1PA6 A;  4DV7 L;  4X64 Q;  1G51 A;  1RTO A;  4IPD A;  1C0A A;  2F0F A;  4N9T A;  4ZCK A;  4A3L H;  1PTO F;  4IQZ A;  3TZD A;  4MN3 A;  1H9S B;  3KDF B;  1SRU A;  1HNW L;  1SR3 A;  3OOC A;  3U58 A;  5G3L F;  1BXT A;  3TP5 A;  3HOZ G;  4A3J G;  1F9S A;  2FHT A;  3J7A F;  1TWF H;  2B3G A;  4L5R C;  2YU9 H;  4GNX B;  4I7Z C;  2A6H D;  1PH1 A;  2X69 A;  4FXD A;  2JA7 H;  4ZUI A;  4KD3 A;  4RAU C;  2RA4 A;  3K5O A;  1EYC A;  2HD3 A;  1MSG A;  3GTJ B;  3H0G G;  1I4G A;  4ZLT F;  5C0X H;  2F0M A;  5JAV A;  2L12 A;  1EQQ A;  5C44 H;  4APV A;  3S15 H;  1Q82 C;  2F4V Q;  2X6G A;  1CKM A;  1NR2 A;  5I6Y A;  5AJ3 L;  2LMC B;  5FO7 B;  3MXP A;  2CH4 A;  2ZJQ A;  3HKZ B;  3ONA B;  4GOP C;  3MXU A;  4DNT B;  1S5B D;  2K5D A;  2M00 A;  4CJ1 B;  1M8A A;  1XTC D;  2QEX A;  5JPM C;  4A3E G;  1K8M A;  4PNY A;  3G4S A;  1EQR A;  1JT8 A;  2N88 A;  1KAW A;  1Q1E A;  1YIT A;  3J80 c;  2Z6K A;  2I5H A;  4IZ8 A;  1NY4 A;  2PMZ E;  2A5H A;  3OWE B;  3K7A H;  3BVM A;  3M7G A;  4TRD A;  5IT9 E;  1T5E A;  1NJI C;  1CKN B;  4CDC C;  2IY5 B;  4YHH Q;  1IHZ A;  4DPG A;  5IYC G;  4G7O C;  3BYT B;  4A3L G;  2B2T A;  3CCE A;  2C5C A;  4LK1 C;  5FKA C;  2TMP A;  1RL2 A;  1FVI A;  5JJZ A;  4LF5 L;  3S1M H;  2K50 A;  2IWH A;  4G57 A;  2Z1C A;  2IHF A;  3UE1 A;  4WOR A;  4P74 A;  3TS0 A;  4OXP A;  3W1B A;  1NUC A;  4QF4 A;  3T4A C;  3U9O A;  2DJG C;  4ZYS A;  4RG1 A;  4LUV A;  2OCE A;  4OX9 L;  2KCN A;  1F9Q A;  4BBR G;  2ZXO A;  2KVM A;  2I07 B;  3CF5 A;  3CAM A;  1FL0 A;  4QL5 A;  1CFM A;  4ZRZ A;  1PFM A;  4C3J B;  3HOW H;  2SOB A;  1SYD A;  2B63 B;  4AIM A;  3CKI B;  5C44 G;  4OO1 H;  3BZC A;  2ZM6 Q;  4GN5 A;  2Q2H A;  5KYL A;  5CV4 A;  4AQY L;  3TN2 A;  1B9N A;  4LUZ A;  1EEF D;  1LTG D;  4OWX B;  1TR5 A;  2E2J H;  1RKN A;  4NPS A;  2XSC A;  5CR3 A;  2EXZ A;  5T1G A;  1CHQ D;  1GM5 A;  1HJP A;  4KK7 A;  1KQS A;  1HZ9 A;  3MWY W;  3TRE A;  3CQZ H;  5EKL A;  4IUP A;  2GVB A;  1AH9 A;  1Y1V G;  1C7Y A;  1JOK A;  3SGI A;  3M3Y H;  4NP5 A;  4K5X A;  1I94 L;  4JV5 L;  1I3Q B;  4BY1 G;  1VMC A;  1YEZ A;  4MTK A;  1DXM A;  2EPB A;  4P2C B;  3GTM B;  4B3R Q;  5IOD A;  2J4X A;  2KEC A;  4DAY A;  4ZAI A;  2K01 A;  4XYO A;  5IE8 A;  4O1N A;  2E5L L;  2UU9 Q;  2VQE L;  2A69 C;  4DV5 L;  3F2C A;  2F0G A;  3PUZ A;  1B53 A;  3KF6 B;  5E4X A;  3BDL A;  4QIW E;  1PMR A;  1WCM G;  2CHB D;  2ENB A;  4WJW A;  5I2Y A;  5FJ8 H;  1J9O A;  1I6H B;  1PVO A;  4FVM A;  1HR0 W;  2Q8I B;  4PV1 C;  2ZXP A;  4N8F A;  1IXR A;  1QJO A;  1ENA A;  2KOL A;  4H02 A;  3HOV B;  5FLX c;  1ZYR D;  1WTX A;  2R93 B;  3FEW X;  1KNE A;  1G6P A;  1LAB A;  5M3F H;  3PIO 3;  2EY5 A;  5IP7 G;  3I2Z A;  1V43 A;  2H4O A;  4L5S A;  2R7D A;  3ULL A;  4XQN A;  3W2D A;  1SEB D;  3RZD H;  4A3B H;  2WB1 B;  4TKO B;  4DR3 Q;  2L1B A;  3NTK A;  1OXU A;  2L4N A;  3CCS A;  4JI2 L;  1X6O A;  4HJ9 A;  2O5J C;  1Q12 A;  1VQK A;  4IO9 A;  1CA5 A;  1B50 A;  3HOX H;  3BZD B;  1IW7 C;  1F9R A;  2AUK A;  4DV4 L;  2OWO A;  3RR5 A;  1Q81 C;  4XQJ A;  4ZKC B;  2CW0 C;  2BE5 D;  2L11 A;  2F0L A;  2KBN A;  4DXF A;  3A8K E;  3PF4 A;  4IUT A;  2HCI A;  2UXD Q;  3GTP B;  3I4N B;  5I4D A;  5EBD A;  5M3F G;  1Y14 B;  1XMQ L;  1U0L A;  1IBM L;  1N33 Q;  2JA8 B;  4FF3 A;  1EQV A;  3EFX D;  4A3C G;  1Q3L A;  4L8J A;  2VL6 A;  3ZYY X;  3CXC A;  3ND8 A;  3LX0 A;  3D0F A;  2SEB D;  2RCF A;  4OX9 Q;  2K4K A;  1LTI D;  3DUZ A;  5F2D A;  5FLM G;  5COR A;  3HEJ A;  4POG A;  3H94 A;  3OTO L;  2BOS A;  3HOV H;  1KDC A;  3I73 A;  4JBK A;  1D2B A;  1LTR D;  3D4D A;  2IW3 A;  3P7J A;  3CCJ A;  4DK1 A;  3HOU G;  3UE0 A;  4LWC A;  3OPO A;  4LFC Q;  3E9H A;  1VQB A;  2E2H B;  5C0X J;  5IGE A;  1QIL A;  1SFO B;  3NSW A;  3BS1 A;  1EQT A;  2NTT A;  5KGU A;  4LFC L;  2VQF L;  3K7U C;  2L5T A;  3W1G A;  4F87 A;  1BOS A;  4UAI A;  4H7B A;  4QMG A;  5FLX L;  4BY7 H;  4ILW A;  3EIV A;  2EJG C;  4JW0 A;  2N49 A;  4KHV A;  4DFA A;  1E1T A;  4QGU A;  1Y1W H;  3PO3 B;  3VR2 A;  1E24 A;  2Q2I A;  4DAM A;  3ITP A;  4JI6 Q;  2F4I A;  1WTO A;  1TWG B;  3I8Z A;  1E2W A;  1B7Y B;  3FDT A;  1YHB A;  4UP8 A;  5KND A;  1TS2 A;  2KHI A;  1DON A;  2YTY A;  3IFT A;  4LF8 L;  2Z6K C;  1HNX L;  2UUB Q;  3LWU A;  5H1S E;  1PH7 A;  1O7I A;  4MHE A;  1CHP D;  2LFN A;  1STY A;  2R92 G;  3K5N A;  1T9H A;  2JA9 A;  1K8O A;  2F1M A;  3G6J B;  3HP3 A;  2G9D A;  3E0E A;  4QQB X;  4GKJ L;  2B2T C;  5T1I A;  2L0C A;  1LO5 D;  3T16 A;  4FDB A;  1GHJ A;  1VQ6 A;  2XWB B;  2FJ2 A;  3H15 A;  4A3K G;  4ALP A;  4PMB A;  3RZD B;  5FLX E;  1C8C A;  2A19 A;  2A69 D;  4DR5 L;  5IGB A;  3UDI A;  4GZY C;  2VQE Q;  2I5L X;  3TEH B;  2M2L A;  5JEA J;  4KY6 A;  2KJX A;  4EQO A;  1JJC B;  4YWK A;  3HKZ E;  3PIP 3;  1L2F A;  3M85 A;  2IX0 A;  5GAD C;  4JI4 Q;  3FHW A;  3VR3 A;  2F0J A;  3RNU A;  4X66 L;  1TQO A;  1A2U A;  1X55 A;  4QY7 A;  1BBX C;  3CCU A;  1Y1W B;  4FO2 A;  4BA1 I;  1O7Y A;  1TII D;  1CI3 M;  2NN6 G;  1PTO B;  3VYU A;  5IYD H;  2SDF A;  2F0O A;  1HPC A;  3N6R A;  1VQF A;  4K6D A;  1B3Q A;  4RHS A;  3QOJ A;  4KY7 A;  1GJX A;  1FGB D;  1ASY A;  2V4D A;  4JI8 Q;  1B70 B;  4Q5V A;  1S5F D;  5CGK A;  4TQU S;  2F0U A;  1QUQ B;  2CQA A;  1VS0 A;  2K5N A;  1G91 A;  3AQQ A;  2EJM A;  1I50 H;  1VQI A;  1B4O A;  2AHO B;  2AWN A;  3PCO B;  4CBV A;  1HR0 Q;  3ICE A;  3GTO B;  4A3F B;  4JYA Q;  4XT3 B;  3PMF A;  1K0R A;  5IGD A;  5GAG C;  1I4H A;  2Z6B A;  3VR6 A;  5A2Q E;  4A3D H;  5IYD G;  3Q8D A;  3NQI A;  1M1K C;  1LV9 A;  1SYF A;  2YV5 A;  3HOY G;  1EYG A;  2F0T A;  2PCF B;  2RKS A;  1UUP A;  1YNX A;  2VY3 A;  4BWG B;  2JA5 B;  3IFD A;  4C3J G;  1O7Z A;  3IAY A;  1JMC A;  1HZB A;  4AQY Q;  1JWU D;  1PTO C;  1D5Z C;  2IX3 A;  1JOO A;  3HOX B;  3BVG A;  2PYK A;  4JOI A;  2JXM B;  1VCI A;  4DAV A;  1X3E A;  2AQ2 B;  4S3S A;  5BR8 L;  3JAM E;  3BVZ A;  1JWM D;  2K05 A;  1PH9 A;  2EXD A;  5K36 H;  1Y1V B;  5LMN L;  1R9T B;  4LF6 L;  4LF9 Q;  5LMU L;  5CBA E;  1LYL A;  5IT9 c;  4GKJ Q;  1X56 A;  2UUA L;  3DM3 A;  3M9B A;  4XXE A;  4JYA L;  3KLS X;  1MHW C;  2OQ0 A;  5CMD A;  4GNX C;  2JA8 G;  1BCP D;  4K8J A;  2PI2 E;  5M3M G;  3MHB A;  3L2P A;  1HRJ A;  5NUC A;  4B3S L;  4B9X A;  4I7A A;  4AYB E;  5LMN W;  5ELO A;  1GO3 E;  1NCV A;  2RF4 A;  1SJH D;  2WKC A;  2EY2 A;  4JI8 L;  1ILQ A;  4A3F H;  4A3K H;  4LF5 Q;  3NEL A;  1UWV A;  4LMQ D;  3J81 E;  1J5E Q;  1AN8 A;  2Y0S B;  2Z4H A;  1K8A C;  1I4Q A;  1UEB A;  3HG9 A;  3GO5 A;  5I6W A;  4DAP A;  2F4V L;  2HIV A;  4DV1 L;  4JI6 L;  1PZK D;  4K2L A;  4MZ9 A;  1TWG H;  3PUV A;  3CPF A;  2UXD L;  5EGT A;  1EL0 A;  4H44 C;  2IT1 A;  1SLJ A;  2ICE C;  2WB1 G;  4X3K A;  1JB3 A;  3NTI A;  2CFM A;  4K14 A;  1BBW A;  5FO9 B;  3BYY B;  2GVA A;  1GUS A;  2CWA A;  2KEN A;  5ELB A;  5C4H A;  5C4X H;  1P8L A;  3HGB A;  2X6L A;  1SJE D;  2NWG A;  1AZP A;  1F9P A;  2QA4 A;  4RFB A;  1SMX A;  2DY7 A;  4O0A A;  4DR3 L;  3J81 i;  1LTB D;  4X3S A;  1IBK L;  2E2H H;  4UDU C;  3VR5 A;  5FK9 C;  4DKA C;  1NE3 A;  4DV7 Q;  3RZO H;  2Q8R E;  3HOZ B;  2XGT A;  1I6V C;  2K7V A;  2F3V A;  1SYB A;  3O13 A;  4RCN A;  5KNB A;  2UUB L;  1TY0 A;  5LHY 1;  1SFO H;  3D4R A;  2OT2 A;  1KLG D;  3GTL H;  2EY6 A;  4CGY B;  4BY7 B;  4NW2 A;  5AFW A;  2JA8 H;  1SNP A;  2LSS A;  3B6Y A;  1JQY D;  1MBY A;  3OSO A;  1E3P A;  3M4Y A;  4JI3 L;  3E3X A;  3EBE A;  4HN7 A;  5C3W A;  5L37 A;  1VQJ A;  1DGS A;  4ODG A;  3T13 A;  1UE1 A;  3P1H A;  3AYH B;  1X32 A;  4EQ5 A;  3S16 H;  3LNN A;  1N34 L;  4WRD A;  5M5X B;  2K14 A;  3I90 A;  2R7Z G;  1JCK B;  3U50 C;  4DV2 L;  3KF6 A;  3OMG A;  2A68 D;  5A2Q L;  1X3G A;  2ZT9 C;  4X3T A;  1N32 Q;  1VQ8 A;  4YIJ A;  1SNC A;  3KYH C;  2EZV A;  4DV3 Q;  2EVB A;  1PH4 A;  4FYD A;  5C4X G;  1Q8I A;  1CSQ A;  4IUV A;  1XTD A;  4DAY B;  5CV9 A;  4HCS A;  5LMN Q;  4OHJ A;  4KN4 C;  1EZ6 A;  1HUM A;  5C44 B;  1PDQ A;  1U4M A;  5BR8 Q;  2R3Z A;  4JI5 Q;  3S1N B;  1KAA A;  5GRO A;  5E1F A;  3SXH A;  4JI4 L;  4JI7 Q;  3STB D;  3BG3 A;  2B2W A;  3PV0 A;  1Y8P B;  1EIG A;  2PMZ B;  3ZJY C;  2ZM6 L;  4I65 A;  3T1Y Q;  2HDL A;  2LXJ A;  3SK4 A;  4DV0 L;  4LJZ C;  3CRK C;  1QOH A;  1XNR Q;  1Y8O B;  3CCR A;  3AFQ A;  3GTL B;  2AKW B;  2KCC A;  2EYM A;  1PRT F;  1SND A;  1W2B A;  3M4O H;  1BCP F;  4R8I A;  1BNZ A;  3ND9 A;  5C4J H;  3R93 A;  1F2Y A;  5JVH 3;  1IKM A;  2V1C C;  5IP9 G;  1ASZ A;  1A63 A;  1PTO H;  5C0X G;  3NK9 A;  1J8I A;  4JI1 L;  4DV6 Q;  4HJ8 A;  2K52 A;  1VQE A;  1VQC A;  1R4Q B;  3S16 B;  3K6O A;  4QUC A;  4DU9 A;  1EY7 A;  2PW5 A;  3F2D A;  4DR1 L;  3K81 C;  2QDB A;  3MXG A;  4G7Z C;  1EWC A;  4OWT B;  1JC7 A;  1STN A;  5JEA H;  3DWA A;  4N9P A;  1MGS A;  4CKC A;  1RD9 D;  1BKB A;  1XYI A;  2EQS A;  4WJ4 A;  4LFA L;  2E75 C;  1Z7T A;  3HFZ B;  4ABN A;  3S14 B;  2JA7 B;  2F0N A;  2MQH A;  4JBJ A;  4MIU A;  1MIU A;  2JEA I;  4KHZ A;  2VUM G;  2WIN B;  1WJJ A;  1IYU A;  2R7Z H;  1E1O A;  1TU2 B;  1X3F A;  2PZW A;  3R8B A;  3DWP A;  2VZA A;  1XPO A;  2ICI A;  2XRQ D;  1KNA A;  3T56 B;  4RCO A;  1CKN A;  3S15 B;  3CU7 A;  1L0X B;  4ZUJ A;  1D5X C;  3NUC A;  3Q0A A;  4ZKB B;  3QO2 A;  4CKB A;  1G29 1;  4X65 Q;  1FR3 A;  3A5Z B;  2C35 B;  3F2B A;  1D8L A;  1S5C D;  1X3Q A;  3AMU A;  1STG A;  1CZG A;  5M5Y B;  5LL6 X;  4OON A;  3K5M A;  2NN6 H;  3D6W A;  3H0G B;  3WWV A;  1O80 A;  5TSS A;  5IOC A;  1HQR D;  2RQX A;  3NP8 A;  1HTL D;  1OXV A;  2UXB L;  3QWN A;  2F0P A;  2NN6 I;  4C3I H;  3FPU B;  4A3J B;  3OIP A;  3CRL C;  5J22 A;  2JA6 H;  4E6I A;  3DWQ A;  4KY5 A;  2B39 A;  3I4L A;  1FGU A;  2OF1 A;  3TQY A;  1PH8 A;  4TVA B;  3Q24 A;  1IKL A;  1VF7 A;  5HGT A;  1QZH A;  4KHP L;  3CC2 A;  2IX1 A;  5IP7 H;  3SR1 A;  2PZT A;  1SXT A;  4BBR H;  2VB2 X;  2R61 A;  3KLS A;  4A93 G;  1LTL A;  3GDE A;  4KV6 A;  3KLR A;  1E2V A;  4HMJ A;  4IPG A;  4IFD G;  1A15 A;  2F0W A;  1SBB B;  1BCP C;  3IL8 A;  4JI5 L;  2NZH A;  2RDF A;  3GTK B;  4J6H A;  3I91 A;  1E2Z A;  3VYS A;  2WV6 D;  4DNR B;  2PO4 A;  1PTO D;  4GNX A;  1WCM H;  1KDA A;  2I0Q A;  1VQG A;  2B2W C;  1QVG A;  1DOM A;  1NMF A;  1VQA A;  5C6A A;  2EOT A;  1DZ1 A;  3M3Y B;  4FF1 A;  1HCZ A;  4LF4 L;  4IUQ A;  3KDF A;  1PLF A;  3A54 A;  4CHT B;  1H9S A;  2DJF C;  4PMC A;  3OYY A;  3GP7 A;  2PZU A;  1JOQ A;  1OXX K;  1SMY D;  4JBW A;  3H91 A;  5C3E B;  3I3C A;  2Z0S A;  5HY6 A;  2HDM A;  1VQ7 A;  3S9W A;  1A2T A;  4JI3 Q;  4CDE C;  4JCV E;  3J81 c;  4A3B G;  1CM9 A;  3S1Q H;  1PRT C;  2EDG A;  3T51 B;  2WFW A;  1SE4 A;  5C5L A;  1EY8 A;  2JE6 I;  4A4I A;  4H0L C;  1H9K A;  4TSS A;  3FPP A;  1PYB A;  2FMM A;  4BBS G;  1GUG A;  4R9W A;  4FP5 D;  4CJ2 C;  1S5D D;  4V19 0;  4IN3 A;  3RMH A;  1WTR A;  4K5V A;  3OTO Q;  2B2Y C;  3IRB A;  3MZ5 A;  4LNQ A;  3GTG H;  3L3O C;  5ELN A;  2B63 H;  5KYI A;  4LF7 Q;  1DM0 B;  4J8Q A;  1CSP A;  5FLM H;  1HTP A;  5EJW A;  2MGS A;  4IUN A;  1UAP A;  3PIO A;  1MI2 A;  1N33 L;  5JJI A;  1IBM Q;  3I4M B;  4RMF A;  4HIK A;  5DM6 3;  2WAC A;  2VUM B;  1XNQ Q;  1EZ8 A;  3AB9 A;  5C4Z A;  5IGF A;  1B8A A;  1G2S A;  2K5H A;  1PRT B;  1RJT A;  3SK8 A;  4X64 L;  2E76 C;  1BF4 A;  1CQF A;  2PPB C;  3S2D H;  1VQD A;  3S1N H;  4DV4 Q;  2FXQ A;  3GTP H;  1V1O A;  3C1E A;  2IL8 A;  4K5W A;  5M3F B;  4JBM A;  4GKK Q;  2K33 A;  2F3I A;  4JG2 A;  1ZYR C;  4FXK C;  1NBW A;  2D62 A;  4HIO A;  4DV1 Q;  4NXN Q;  3VYR A;  2NVX H;  3MXN A;  5M9O A;  1QE6 A;  5JJL A;  4PZ6 A;  3KF8 B;  4NB3 A;  5KEE A;  1J5E L;  1BR9 A;  1DJR D;  4ZK9 B;  3DEP A;  3S1R H;  1YIJ A;  1PH3 A;  2N55 A;  3CCQ A;  5G3L D;  4X6A H;  2OQK A;  2Y0S G;  1F2M A;  2E8G A;  1E0B A;  4DR2 L;  4JI1 Q;  3SK6 A;  1JB7 A;  4KKT A;  5HGQ A;  4BY7 G;  3GTQ B;  2UUA Q;  5IY0 A;  1LT6 D;  1HNZ Q;  1XJV A;  4DR7 Q;  1E22 A;  3HOU B;  4B9W A;  5D3D A;  3NWS A;  3CMA A;  4DR6 L;  1GVP A;  5JPN C;  3PO2 B;  3I4M H;  3PO2 G;  1FD7 D;  5IGG A;  1AW7 A;  4DV5 Q;  1K28 A;  2NUC A;  3A5U A;  4GOP A;  3T1H Q;  1QB5 D;  1G8Z D;  3R2T A;  2QCP X;  1VQ9 A;  4RKL A;  3VR4 A;  3TSS A;  4FF4 A;  1C4Q A;  3I55 A;  3NXW A;  3A8J E;  3J81 L;  3TP8 A;  3VA7 A;  4GLA C;  2KED A;  2AMC B;  4YHH L;  4IJL A;  1Q8K A;  4F8M A;  4OIJ A;  1SYC A;  1J6Q A;  1EYA A;  1N36 Q;  1FNV A;  3KBG A;  2E74 C;  2WB1 E;  2B29 A;  4Q0F A;  5CC4 A;  1KIX A;  3DXJ C;  3J7Z C;  1SE8 A;  5IWA Q;  1TXY A;  1N34 Q;  1MKH A;  1A8V A;  3PGZ A;  4DV6 L;  1QZG A;  3VA5 A;  4B08 A;  4QIW B;  1SYG A;  1ZEQ X;  2SNS A;  2VXW A;  3CW2 C;  3VYT A;  3AFP A;  1H9R A;  1Q1B A;  4K8I A;  4PQX A;  1YI2 A;  5C5M A;  4R4C A;  1H95 A;  4RHR A;  3J7A V;  4LF9 L;  1A6X A;  4LF6 Q;  4RGN A;  1IYV A;  4GLX A;  5C3E H;  2LS0 1;  1P16 A;  2HCC A;  3MVV A;  3S2H B;  1LTS D;  2VB3 X;  3NWT A;  1EWH A;  1S5E D;  1VDZ A;  4DV0 Q;  3E6Z X;  4BBS H;  2EJF C;  3KBX A;  1XPR A;  1SN8 A;  4A3G H;  2GA4 B;  1KLU D;  3SVM A;  4C2M H;  5J1Z A;  4JI7 L;  1WI5 A;  3JAM i;  2BH2 A;  1JWS D;  1YZ6 A;  5IGC A;  5C0X I;  5GAE C;  3KUP A;  2OXP A;  1LUZ A;  1F77 A;  1RDP D;  2QF7 A;  1HNW Q;  2DNC A;  3HOX G;  1Y8N B;  3CQZ B;  4LAA A;  1MD2 D;  4EX5 A;  5JVG 3;  2MO0 A;  1U5K A;  3HOV G;  1N32 L;  3RLO A;  4UPA A;  2D0O A;  3KFU A;  2P5Z X;  1BBU A;  1LT4 D;  4YWM A;  2LKV A;  1XWE A;  2IJ0 A;  4KMU C;  1S4Z A;  3AEV A;  3I7F A;  1STH A;  4QCL A;  1U4R A;  4A3M H;  1VMP A;  1WOC A;  1U4L A;  4OGQ C;  1HXY D;  1KRS A;  4KJN A;  1D1K A;  3H3V C;  2R7Z B;  1OO9 B;  1PFN A;  3URY A;  5AJ3 Q;  3E0J A;  4DK0 A;  1EY6 A;  1UEA B;  4DGZ A;  4K0K L;  4A3J H;  3MEH A;  2QEJ C;  2B2V A;  2NVX B;  2L15 A;  1SMY C;  1L1O B;  1D1I A;  2C9O A;  2NYZ D;  4XT1 B;  4A3G G;  2B63 G;  4X62 Q;  4L63 B;  2K75 A;  2DGY A;  4LFB L;  1II3 A;  1GUT A;  2FFK B;  2B8F A;  4R1J A;  1XMO L;  4A93 B;  3H0G H;  4M1U B;  3L7Z C;  5LL6 S;  3M4P A;  3S1Q B;  3BU2 A;  4YCW A;  3Q23 A;  3OHX C;  2B8G A;  2NVY H;  4DUY L;  1TWA B;  2JN4 A;  3J80 E;  1B3A A;  3MA2 B;  1GUN A;  1IL2 A;  2DN8 A;  2E2I B;  1W6J A;  4DUZ L;  1PYW D;  4JI0 Q;  3EJI A;  1XMO Q;  4GN4 B;  3PO3 H;  2NVQ B;  1GKH A;  2EYP A;  4DR2 Q;  1EOT A;  3BZK A;  5D3I B;  1ET6 A;  5FJ8 G;  3C2P A;  1K8G A;  1YNN D;  2D5D A;  1WYD A;  3KOJ A;  2NBF A;  3J7Y W;  1Q90 A;  3AU7 A;  3CCV A;  3SDZ A;  1VQN A;  1PZJ D;  2VW9 A;  2O2L D;  4B3T L;  4RH6 A;  3QJY A;  1PH6 A;  1V1P A;  4QUF A;  1I4P A;  4BXX H;  4PZ8 A;  4C3I G;  4NXM L;  4A3F G;  4LUO A;  5IYC H;  1DCZ A;  1T5X D;  1EY5 A;  1QNU A;  3DM1 A;  3OIQ A;  1LT5 D;  1M4V A;  2LY7 A;  4P75 A;  3HRZ C;  4NKL A;  2YU9 B;  5HUR A;  2ASB A;  1VQH A;  3KJO A;  1BVS A;  2A6H C;  1EEI D;  1YHQ A;  2JP1 A;  4BBS B;  4GLV B;  3W3A A;  1BQQ T;  4YWL A;  3TBI B;  2HQE A;  2JQO A;  2CVR A;  5DM7 3;  5BN5 A;  1I4X A;  3E9I A;  3L0O A;  3HKS A;  2VUM H;  1SNO A;  3FMC A;  3MEF A;  2F0D A;  2XNA C;  4HAE A;  1L1O A;  1QG7 A;  1SDF A;  2NVQ H;  1OXT A;  4A3K B;  2BDN A;  3H09 A;  2ZTE A;  1NR4 A;  4IUR A;  1JOR A;  2EYO A;  4OIK A;  3TZU A;  2O4X A;  3J80 L;  3T1H L;  3QOL A;  1A3T A;  4KLK A;  4DR5 Q;  1V8Q A;  3TS2 A;  2QKI C;  1ESF A;  1TS5 A;  1F2L A;  1TWH B;  1AP0 A;  3UDG A;  1XPU A;  4DR7 L;  1WTV A;  1KC8 C;  2PNH A;  4C1N I;  2F03 A;  2H5X A;  4L5T A;  5KNC A;  4EQP A;  4V0B A;  4G4K A;  2NVT B;  4UHV A;  1YBY A;  2D0P A;  4LF4 Q;  1BUV T;  2DY8 A;  1HQM C;  5EPL A;  5GAH C;  3JAM L;  3S17 B;  1N36 L;  4HED A;  2F0V A;  5A35 A;  3J80 i;  3RLN A;  1OTC A;  4RWS C;  2NZO A;  1KTK A;  4JI2 Q;  3PO2 H;  3NEM A;  4GN3 B;  2Q2U A;  4GKK L;  1WVL A;  3RZO B;  2Q2T A;  4A75 A;  1KDB A;  2F52 A;  2QW7 A;  1QVF A;  3G7L A;  4ULL A;  1HZC A;  2EE1 A;  5K5P A;  2J0T D;  4OWW B;  5IT9 L;  1K73 C;  5ISR A;  1ILP A;  3A0J A;  3GV6 A;  1IBL Q;  4HR7 B;  1CUK A;  4KTA A;  1JE5 A;  2RCN A;  4C56 C;  3TME A;  2XN9 C;  1G2T A;  3PSI A;  4Y7N H;  4NMZ A;  4U68 A;  4DA2 A;  4CKE A;  4BA2 I;  1SE2 A;  5ELD A;  1S40 A;  3EQL C;  1CKO A;  4A76 A;  4KI0 A;  1YJW A;  5C4J B;  1HNZ L;  2YTV A;  1IYJ B;  4Z9C B;  2F0I A;  5J3B A;  4FF2 A;  3CC7 A;  4G7H C;  2XVS A;  1WTH A;  3LGJ A;  4C3H H;  1Z9F A;  1AFP A;  4P72 A;  2JJQ A;  3P75 A;  1GUO A;  1I50 B;  3F8T A;  3PQI A;  1I6H H;  2R7F A;  2MUY A;  3BDC A;  1EIY B;  3STB C;  2WAQ B;  3HOW B;  4J1M A;  3ER0 A;  4CJ0 B;  2WKD A;  3U9S A;  2AUJ D;  3QIA A;  4IPH A;  2EY1 A;  3IKJ A;  1TY2 A;  2K5W A;  1D7Q A;  4POF A;  1HZA A;  1BO0 A;  3WDN A;  2PQA B;  2WAQ E;  1HFN A;  3C3L A;  3MTS A;  3H3V I;  3NBH B;  3V05 A;  3U4Z A;  3SHL A;  3A8I E;  2QIL A;  5M3M H;  1WTW A;  4GOP B;  1SRO A;  2RHQ B;  2D9U A;  2EYL A;  1H9M A;  4KKU A;  2MNA A;  3G71 A;  4O42 A;  3T53 B;  1GD7 A;  3QG1 A;  4DR1 Q;  1LTT D;  4DV2 Q;  4AYB G;  1LAC A;  2JA6 G;  4C2M B;  1GHK A;  1PHJ A;  4XYQ A;  1TT2 A;  1SAP A;  2AQ1 B;  1YHA A;  2G5D A;  3I4N G;  4JOI C;  1ESR A;  2MHV A;  3PUW A;  3FRP B;  4A93 H;  5EPJ A;  3TDQ A;  1VQO A;  2MPM A;  2ZTD A;  3KJP A;  4LF7 L;  4DR6 Q;  1EOV A;  2D2C C;  2FIN B;  5D14 A;  4B3T Q;  2RVL A;  1D6E C;  2ZTC A;  5D65 A;  4AH6 A;  3K0X A;  3NBH A;  4OEM B;  4DK6 C;  2I5M X;  3NTH A;  2PQA A;  2Q8T A;  2UUC Q;  5FOB B;  1Z47 A;  1D5M C;  2EYJ A;  5I9P A;  3RN5 A;  1HA5 A;  3L9A X;  1WCM B;  3PUY A;  1BDO A;  3F2U A;  3ULP A;  1OXS C;  1QCB D;  3CME A;  4HJ7 A;  3BDO A;  1FJG Q;  2L9H A;  3WOE A;  5EKK A;  1EY9 A;  1EFI D;  1PFS A;  3EVQ A;  1PYS B;  2R93 H;  4YY3 Q;  4A3D G;  3CC4 A;  4N8X 1;  2KCT A;  2R92 B;  2K5V A;  1UE6 A;  4DUY Q;  4A3I G;  3D6C A;  3PIP A;  5M5Y H;  2N3S A;  4IFD I;  5C3X A;  4NXN L;  2DUD A;  3P20 A;  1YNN C;  3K80 C;  2JA5 G;  3J81 j;  1YNJ C;  2HHH L;  4ME5 A;  3Q22 A;  4PG3 A;  4RGO S;  4HIM A;  3SE0 A;  2GN5 A;  1A3V A;  4R4Q A;  3ERQ A;  4RKB A;  2WP8 J;  4K2K A;  2J7Z A;  3HOY B;  3QB3 A;  2SNM A;  3D3R A;  5I9O A;  2KHS A;  4QB4 A;  2NB0 A;  1I94 Q;  4JV5 Q;  1HA6 A;  3GQB A;  3CCL A;  3W5O A;  3K57 A;  3M4O B;  2NVT H;  1E7Z A;  3H6M A;  2H1E A;  2HUG A;  3TRZ A;  1JIC A;  5E7N A;  2HHH Q;  4K0K Q;  2ATW A;  4AYB B;  1TKW B;  2JA6 B;  4LFA Q;  1KL9 A;  1NNX A;  5JEA G;  2PQE A;  3ULJ A;  2BA1 A;  1B9M A;  4A3I H;  2K03 A;  1EU4 A;  3GV3 A;  1CK1 A;  1PRT D;  2K28 A;  1FJG L;  4DXG A;  2MP1 A;  3PUX A;  1RHP A;  4IAL A;  5IP9 H;  1FYC A;  4B3S Q;  3RD4 A;  3K8A A;  3V96 A;  2CKZ B;  3GTO H;  4L6T B;  5CV5 A;  5ELF A;  3S14 H;  2Z4I A;  2YYZ A;  3TP6 A;  4XIG S;  1V9P A;  1Q7Y C;  1SYE A;  1SE3 A;  4DNI A;  2K6A A;  1XNR L;  3JC6 6;  2JSO A;  1TWH H;  2PW7 A;  1ML0 D;  2F0E A;  1JJ2 A;  3DHQ A;  1G6Z A;  2OEO A;  1GXD C;  2IPK D;  3WOF A;  1CQV A;  2Y0S E;  3RLF A;  1CTM A;  4DN4 M;  2M9V A;  5EAY A;  5EPK A;  4DR4 Q;  4XQQ A;  1S3O A;  2KCM A;  1JR0 D;  3K5L A;  2EIF A;  1AE3 A;  2YTX A;  3MAQ A;  3LWE A;  3EA6 A;  3D8G A;  2ZJR A;  1DOL A;  2K32 A;  1HUN A;  3MFY A;  4KJO A;  3K0Y A;  3R2I A;  4HSP A;  2F0H A;  3K59 A;  3U4V A;  1CZW A;  5J39 A;  1B44 D;  1SSO A;  4OO1 G;  3PF5 A;  1IL8 A;  3GTG B;  2CWP A;  1XXG A;  2G9H D;  4BBR B;  2A6E C;  2BCO A;  1C9O A;  4H13 C;  3ERS X;  2I46 A;  2MO1 A;  3GTK H;  1LTA D;  2A8V A;  1M90 C;  2UXB Q;  1EFW A;  1DOK A;  1K3B C;  3MC0 B;  4YY3 L;  1Q46 A;  1RTN A;  2XTI A;  2F0S A;  1KHI A;  5CBE E;  3OWF A;  1VQL A;  4OEL B;  4RGT A;  3CCM A;  1ZKO A;  1V1P B;  1F2Z A;  2VNU D;  2BDO A; 
#chains in the Genus database with same CATH homology
 2BA0 A;  3NPP A;  2K5Q A;  2DNE A;  4HMI A;  1NAP A;  3V2T A;  3X3M A;  4EQN A;  4FXG C;  1WTQ A;  4BY1 B;  5M5W B;  2B2U A;  1C48 A;  5BN4 A;  1DYQ A;  4WFN 3;  5EBC A;  4XDX A;  3ERO A;  1PFB A;  4U67 3;  3S2D B;  5E3F A;  2XWJ B;  1PXU A;  1O78 A;  4OL7 A;  2A73 B;  3CHB D;  3A7A B;  4X3U A;  1CT1 D;  1YNJ D;  3M7N A;  2E2D C;  1FNW A;  4XTC S;  2ID0 A;  3I70 A;  4KN7 C;  4Y7N B;  1STE A;  4PMW A;  5DEH A;  1EY4 A;  4EGV A;  2XIW A;  1LLR D;  2F0Q A;  2XRS D;  4M8A A;  5DAU A;  4C3H B;  3C46 A;  4F7X A;  5I2X A;  1AZQ A;  1QNK A;  2F0K A;  2PNR C;  4A3I B;  1TWF B;  5CV6 A;  1AEX A;  1Y69 U;  5BN3 A;  1GUW A;  5CYU A;  2R6G A;  4DF7 A;  5K36 G;  1BCP B;  4ZQ3 A;  1O7L A;  1EU3 A;  1WTP A;  1I4R A;  2KQ3 A;  3C1F A;  3DEO A;  3SK5 A;  4EVO A;  4IUU A;  2Z8L A;  3UI2 A;  3OW7 A;  1TS4 A;  2NZ1 D;  5KRU A;  1B1Z A;  1VF5 C;  2TSS A;  1HFG A;  3NQT A;  2NTS A;  1LT3 D;  1L0Y B;  3NE5 B;  1FNU A;  3S1R B;  1A3U A;  3N52 A;  5M3M B;  3A56 A;  5COY A;  2KUM A;  2NVY B;  2RBM A;  4RA8 A;  4A3E B;  4KD4 A;  5EQ0 A;  3NHH A;  3OMC A;  3K58 A;  4K6L A;  1WD1 A;  3K7A B;  1U4P A;  3S1M B;  1STB A;  1XX8 A;  5CV7 A;  1B2T A;  4A3D B;  2B2Y A;  2E2J B;  1H9J A;  5IIF A;  3HS0 C;  1WD0 A;  2RSN A;  2B2V C;  4C1N K;  3SEB A;  1K83 B;  2AWO A;  3I72 A;  3Q6S A;  1JE4 A;  2A74 C;  4FNF A;  4R8N A;  1TVX A;  1ROD A;  2RDH A;  1W6K A;  3KK7 A;  5ELC A;  4HTH A;  4NDX A;  4ID6 A;  1SNQ A;  1KAB A;  1DD2 A;  1PZI D;  3X3N A;  2KA7 A;  2FMC A;  1R4P B;  4C3I B;  1EY0 A;  3MFG A;  1TS3 A;  4A3G B;  3R3O A;  1ET9 A;  3GD7 A;  4C3H G;  1QWY A;  2K04 A;  1U9R A;  1NSN S;  5ELE A;  5C4X B;  1RCV D;  2RSO A;  4OO1 I;  1ENC A;  5E4W C;  2A6E D;  3E5S A;  3FKI B;  4KKS A;  4BS9 A;  1SNM A;  2RDG A;  1EIH A;  5JOB A;  3KF8 A;  5CV8 A;  1IW7 D;  2L55 A;  2F3W A;  4A3M B;  1RF2 D;  1ICW A;  4IFD J;  2BE5 C;  2CW0 D;  3RUZ A;  4RGM A;  2K1B A;  3NBI A;  4JK1 C;  5KIX A;  3FVQ A;  1TWC B;  3D4W A;  4IFD H;  1Z6H A;  5EKI A;  1HHV A;  2ZXR A;  2AQ3 B;  3A7L A;  2KEE A;  3DMU A;  1UNS A;  1ENF A;  4A3B B;  3A55 A;  1STA A;  1GOZ A;  2B2U C;  1X3P A;  2EYF A;  4HCE A;  2MJ8 A;  2JYO A;  2EYH A;  2WII B;  1EYD A;  1ONL A;  4F88 A;  2O5I C;  2JEB I;  1MSH A;  5FO8 B;  3HZX A;  2A68 C;  1ZXT A;  4HSV A;  3D31 A;  3TP7 A;  1CA6 A;  5DNF A;  1RTO A;  2F0F A;  4N9T A;  1PTO F;  4IQZ A;  3TZD A;  4MN3 A;  1H9S B;  3OOC A;  5G3L F;  1BXT A;  3TP5 A;  1F9S A;  2FHT A;  3J7A F;  4I7Z C;  2A6H D;  2X69 A;  4FXD A;  4ZUI A;  4KD3 A;  4RAU C;  2RA4 A;  3K5O A;  1EYC A;  1MSG A;  3GTJ B;  1I4G A;  4ZLT F;  5C0X H;  2F0M A;  5JAV A;  2L12 A;  2X6G A;  1NR2 A;  5I6Y A;  2LMC B;  5FO7 B;  3MXP A;  3HKZ B;  3ONA B;  3MXU A;  4DNT B;  1S5B D;  2K5D A;  2M00 A;  4CJ1 B;  1M8A A;  1XTC D;  5JPM C;  1K8M A;  4PNY A;  2N88 A;  1Q1E A;  4IZ8 A;  2A5H A;  3OWE B;  3BVM A;  3M7G A;  4TRD A;  5IT9 E;  1T5E A;  1IHZ A;  4G7O C;  3BYT B;  2B2T A;  2C5C A;  4LK1 C;  5FKA C;  2TMP A;  5JJZ A;  2IWH A;  4G57 A;  2Z1C A;  4WOR A;  1NUC A;  4QF4 A;  3T4A C;  4ZYS A;  3U9O A;  2KCN A;  1F9Q A;  2ZXO A;  2KVM A;  2I07 B;  1CFM A;  4ZRZ A;  1PFM A;  4C3J B;  2SOB A;  1SYD A;  2B63 B;  3CKI B;  4OO1 H;  5KYL A;  5CV4 A;  3TN2 A;  1B9N A;  1EEF D;  1LTG D;  1TR5 A;  1RKN A;  2XSC A;  5CR3 A;  2EXZ A;  5T1G A;  1CHQ D;  4KK7 A;  3MWY W;  5EKL A;  4IUP A;  1JOK A;  4NP5 A;  4K5X A;  1I3Q B;  1VMC A;  1DXM A;  2EPB A;  4P2C B;  3GTM B;  5IOD A;  2J4X A;  2KEC A;  4DAY A;  4ZAI A;  2K01 A;  4XYO A;  4O1N A;  2A69 C;  2F0G A;  3PUZ A;  1B53 A;  5E4X A;  3BDL A;  1PMR A;  2CHB D;  2ENB A;  4WJW A;  5I2Y A;  1J9O A;  1I6H B;  4FVM A;  2Q8I B;  4PV1 C;  2ZXP A;  1QJO A;  1ENA A;  2KOL A;  3HOV B;  1ZYR D;  1WTX A;  2R93 B;  3FEW X;  1KNE A;  1LAB A;  3PIO 3;  2EY5 A;  1V43 A;  2H4O A;  4XQN A;  3W2D A;  1SEB D;  2WB1 B;  4TKO B;  2L1B A;  3NTK A;  1OXU A;  2L4N A;  2O5J C;  1Q12 A;  1B50 A;  1CA5 A;  3BZD B;  1IW7 C;  1F9R A;  2AUK A;  4XQJ A;  4ZKC B;  2CW0 C;  2BE5 D;  2L11 A;  2F0L A;  4DXF A;  3A8K E;  4IUT A;  2HCI A;  3GTP B;  3I4N B;  5I4D A;  5EBD A;  2JA8 B;  4FF3 A;  1EQV A;  3EFX D;  1Q3L A;  4L8J A;  3ZYY X;  3ND8 A;  3LX0 A;  2SEB D;  1LTI D;  3DUZ A;  5F2D A;  5COR A;  3HEJ A;  3H94 A;  2BOS A;  1KDC A;  3I73 A;  1D2B A;  1LTR D;  3D4D A;  2IW3 A;  3P7J A;  4DK1 A;  3OPO A;  2E2H B;  5C0X J;  5IGE A;  1QIL A;  1SFO B;  3NSW A;  3BS1 A;  1EQT A;  2NTT A;  5KGU A;  2L5T A;  4F87 A;  1BOS A;  4UAI A;  4H7B A;  4QMG A;  5FLX L;  4ILW A;  2EJG C;  4KHV A;  4DFA A;  3PO3 B;  3VR2 A;  3ITP A;  2F4I A;  1WTO A;  1TWG B;  3I8Z A;  1E2W A;  3FDT A;  5KND A;  1TS2 A;  1DON A;  3IFT A;  3LWU A;  4MHE A;  1CHP D;  2LFN A;  1STY A;  3K5N A;  1K8O A;  2F1M A;  3G6J B;  3HP3 A;  2G9D A;  2B2T C;  5T1I A;  2L0C A;  1LO5 D;  3T16 A;  1GHJ A;  2XWB B;  2FJ2 A;  4PMB A;  3RZD B;  5FLX E;  1C8C A;  2A69 D;  5IGB A;  4GZY C;  2M2L A;  5JEA J;  4KY6 A;  2KJX A;  4EQO A;  3PIP 3;  3M85 A;  2IX0 A;  3VR3 A;  2F0J A;  1BBX C;  1TQO A;  1A2U A;  1Y1W B;  4FO2 A;  4BA1 I;  1O7Y A;  1TII D;  1CI3 M;  2NN6 G;  1PTO B;  3VYU A;  2SDF A;  2F0O A;  1HPC A;  3N6R A;  4K6D A;  4RHS A;  3QOJ A;  4KY7 A;  1GJX A;  1FGB D;  2V4D A;  4Q5V A;  1S5F D;  5CGK A;  4TQU S;  2F0U A;  2CQA A;  1G91 A;  2EJM A;  1B4O A;  4CBV A;  2AWN A;  3GTO B;  4A3F B;  4XT3 B;  3PMF A;  5IGD A;  1I4H A;  3VR6 A;  5A2Q E;  3NQI A;  1LV9 A;  1SYF A;  2F0T A;  2PCF B;  2RKS A;  1UUP A;  4BWG B;  2JA5 B;  3IFD A;  4C3J G;  1O7Z A;  3IAY A;  1JWU D;  1PTO C;  1D5Z C;  2IX3 A;  1JOO A;  3HOX B;  3BVG A;  2PYK A;  2JXM B;  1VCI A;  4DAV A;  2AQ2 B;  4S3S A;  3JAM E;  3BVZ A;  1JWM D;  2K05 A;  5K36 H;  1Y1V B;  1R9T B;  5CBA E;  4XXE A;  3KLS X;  5CMD A;  1BCP D;  4K8J A;  3MHB A;  1HRJ A;  5NUC A;  4B9X A;  1NCV A;  1SJH D;  2WKC A;  2EY2 A;  1ILQ A;  4LMQ D;  3J81 E;  1AN8 A;  2Y0S B;  2Z4H A;  1I4Q A;  3HG9 A;  3GO5 A;  5I6W A;  4DAP A;  1PZK D;  4K2L A;  3PUV A;  5EGT A;  1EL0 A;  4H44 C;  2IT1 A;  2ICE C;  4X3K A;  1JB3 A;  3NTI A;  4K14 A;  5FO9 B;  3BYY B;  1GUS A;  5ELB A;  5C4H A;  3HGB A;  2X6L A;  1SJE D;  2NWG A;  1AZP A;  1F9P A;  4RFB A;  2DY7 A;  1LTB D;  4X3S A;  4UDU C;  3VR5 A;  5FK9 C;  2Q8R E;  3HOZ B;  1I6V C;  2K7V A;  2F3V A;  1SYB A;  3O13 A;  4RCN A;  5KNB A;  1TY0 A;  5LHY 1;  3D4R A;  2OT2 A;  1KLG D;  2EY6 A;  4CGY B;  4BY7 B;  4NW2 A;  5AFW A;  1SNP A;  1JQY D;  1MBY A;  3OSO A;  3M4Y A;  5C3W A;  4HN7 A;  4ODG A;  3T13 A;  3P1H A;  1X32 A;  3LNN A;  4WRD A;  5M5X B;  3I90 A;  1JCK B;  3OMG A;  2A68 D;  5A2Q L;  2ZT9 C;  4X3T A;  4YIJ A;  1SNC A;  2EZV A;  2EVB A;  4FYD A;  1Q8I A;  4IUV A;  5CV9 A;  4HCS A;  4OHJ A;  4KN4 C;  1EZ6 A;  1HUM A;  5C44 B;  1PDQ A;  1U4M A;  2R3Z A;  3S1N B;  1KAA A;  5E1F A;  3SXH A;  3BG3 A;  2B2W A;  3PV0 A;  1Y8P B;  1EIG A;  2PMZ B;  4I65 A;  2HDL A;  3SK4 A;  4LJZ C;  3CRK C;  1QOH A;  1Y8O B;  3GTL B;  2KCC A;  2EYM A;  1PRT F;  1SND A;  1BCP F;  4R8I A;  1BNZ A;  3ND9 A;  3R93 A;  1F2Y A;  5JVH 3;  1IKM A;  1PTO H;  5C0X G;  3NK9 A;  1J8I A;  1R4Q B;  3S16 B;  3K6O A;  4QUC A;  4DU9 A;  1EY7 A;  2PW5 A;  2QDB A;  3MXG A;  4G7Z C;  1EWC A;  1JC7 A;  1STN A;  5JEA H;  3DWA A;  4N9P A;  1MGS A;  4CKC A;  1RD9 D;  1XYI A;  2E75 C;  1Z7T A;  4ABN A;  3S14 B;  2JA7 B;  2F0N A;  4MIU A;  2JEA I;  4KHZ A;  2WIN B;  1IYU A;  1TU2 B;  2PZW A;  3R8B A;  3DWP A;  2ICI A;  2XRQ D;  1KNA A;  3T56 B;  4RCO A;  3S15 B;  3CU7 A;  1L0X B;  4ZUJ A;  1D5X C;  3NUC A;  3Q0A A;  4ZKB B;  3QO2 A;  4CKB A;  1G29 1;  1FR3 A;  1S5C D;  1X3Q A;  3AMU A;  1STG A;  1CZG A;  5M5Y B;  5LL6 X;  3K5M A;  2NN6 H;  3D6W A;  3H0G B;  1O80 A;  5TSS A;  5IOC A;  1HQR D;  2RQX A;  3NP8 A;  1HTL D;  1OXV A;  3QWN A;  2F0P A;  2NN6 I;  3FPU B;  4A3J B;  3OIP A;  3CRL C;  5J22 A;  4E6I A;  3DWQ A;  4KY5 A;  2B39 A;  3I4L A;  2OF1 A;  3Q24 A;  1IKL A;  1VF7 A;  5HGT A;  2IX1 A;  3SR1 A;  2PZT A;  1SXT A;  2VB2 X;  2R61 A;  3KLS A;  4KV6 A;  3KLR A;  1E2V A;  4HMJ A;  4IFD G;  1A15 A;  2F0W A;  1SBB B;  1BCP C;  3IL8 A;  2RDF A;  3GTK B;  4J6H A;  3I91 A;  1E2Z A;  3VYS A;  2WV6 D;  4DNR B;  2PO4 A;  1PTO D;  1KDA A;  2B2W C;  1DOM A;  5C6A A;  1DZ1 A;  2EOT A;  3M3Y B;  4FF1 A;  1HCZ A;  4IUQ A;  1PLF A;  3A54 A;  4CHT B;  1H9S A;  4PMC A;  3GP7 A;  2PZU A;  1JOQ A;  1OXX K;  1SMY D;  4JBW A;  3H91 A;  5C3E B;  3I3C A;  2HDM A;  3S9W A;  1A2T A;  1CM9 A;  1PRT C;  2EDG A;  3T51 B;  1SE4 A;  5C5L A;  1EY8 A;  2JE6 I;  4H0L C;  1H9K A;  4TSS A;  3FPP A;  2FMM A;  1GUG A;  4R9W A;  4FP5 D;  4CJ2 C;  1S5D D;  4V19 0;  4IN3 A;  3RMH A;  1WTR A;  4K5V A;  2B2Y C;  3MZ5 A;  3L3O C;  5KYI A;  1DM0 B;  4J8Q A;  1HTP A;  5EJW A;  2MGS A;  4IUN A;  1UAP A;  1MI2 A;  3I4M B;  5DM6 3;  2WAC A;  2VUM B;  1EZ8 A;  3AB9 A;  5C4Z A;  5IGF A;  1G2S A;  1PRT B;  1RJT A;  3SK8 A;  2E76 C;  1BF4 A;  1CQF A;  2PPB C;  1V1O A;  3C1E A;  2IL8 A;  4K5W A;  5M3F B;  2K33 A;  1ZYR C;  4FXK C;  2D62 A;  3VYR A;  3MXN A;  5M9O A;  1QE6 A;  5KEE A;  1BR9 A;  1DJR D;  4ZK9 B;  3DEP A;  2N55 A;  5G3L D;  1F2M A;  1E0B A;  3SK6 A;  4KKT A;  3GTQ B;  1LT6 D;  3HOU B;  4B9W A;  5D3D A;  3NWS A;  5JPN C;  3PO2 B;  1FD7 D;  5IGG A;  1AW7 A;  2NUC A;  1QB5 D;  1G8Z D;  3R2T A;  2QCP X;  4RKL A;  3VR4 A;  3TSS A;  4FF4 A;  1C4Q A;  3NXW A;  3A8J E;  3J81 L;  3TP8 A;  3VA7 A;  2KED A;  4F8M A;  4OIJ A;  1SYC A;  1EYA A;  1FNV A;  3KBG A;  2E74 C;  4Q0F A;  5CC4 A;  3DXJ C;  3VA5 A;  4B08 A;  4QIW B;  1SYG A;  1ZEQ X;  2SNS A;  2VXW A;  3VYT A;  1H9R A;  1Q1B A;  4K8I A;  4PQX A;  5C5M A;  4RHR A;  3J7A V;  1A6X A;  4RGN A;  1IYV A;  2LS0 1;  2HCC A;  3MVV A;  3S2H B;  1LTS D;  2VB3 X;  3NWT A;  1EWH A;  1S5E D;  1VDZ A;  3E6Z X;  2EJF C;  3KBX A;  2GA4 B;  1KLU D;  3SVM A;  5J1Z A;  1JWS D;  5IGC A;  5C0X I;  3KUP A;  2OXP A;  1F77 A;  1RDP D;  2QF7 A;  2DNC A;  1Y8N B;  3CQZ B;  4LAA A;  1MD2 D;  5JVG 3;  1LT4 D;  2LKV A;  1XWE A;  2IJ0 A;  4KMU C;  1S4Z A;  1STH A;  4QCL A;  1U4R A;  1VMP A;  1U4L A;  4OGQ C;  1HXY D;  4KJN A;  1D1K A;  3H3V C;  2R7Z B;  1OO9 B;  1PFN A;  3URY A;  3E0J A;  4DK0 A;  1EY6 A;  1UEA B;  4DGZ A;  3MEH A;  2QEJ C;  2B2V A;  2NVX B;  1SMY C;  1D1I A;  2C9O A;  2NYZ D;  4XT1 B;  4L63 B;  1II3 A;  1GUT A;  2FFK B;  2B8F A;  4A93 B;  4M1U B;  3L7Z C;  5LL6 S;  3S1Q B;  3Q23 A;  3OHX C;  2B8G A;  1TWA B;  3J80 E;  1B3A A;  3MA2 B;  1GUN A;  2DN8 A;  2E2I B;  1W6J A;  1PYW D;  3EJI A;  2NVQ B;  2EYP A;  1EOT A;  5D3I B;  1ET6 A;  3C2P A;  1YNN D;  2D5D A;  2NBF A;  3J7Y W;  1Q90 A;  3AU7 A;  3SDZ A;  1PZJ D;  2O2L D;  4RH6 A;  3QJY A;  1V1P A;  4QUF A;  1I4P A;  4C3I G;  1DCZ A;  1T5X D;  1EY5 A;  1QNU A;  3DM1 A;  3OIQ A;  1LT5 D;  1M4V A;  2LY7 A;  3HRZ C;  4NKL A;  2YU9 B;  5HUR A;  2A6H C;  1EEI D;  2JP1 A;  4BBS B;  3W3A A;  1BQQ T;  3TBI B;  2HQE A;  2CVR A;  5DM7 3;  5BN5 A;  1I4X A;  1SNO A;  3FMC A;  2F0D A;  2XNA C;  4HAE A;  1QG7 A;  1SDF A;  1OXT A;  4A3K B;  2BDN A;  3H09 A;  1NR4 A;  4IUR A;  1JOR A;  2EYO A;  4OIK A;  3TZU A;  2O4X A;  3J80 L;  3QOL A;  1A3T A;  1V8Q A;  2QKI C;  1ESF A;  1TS5 A;  1F2L A;  1TWH B;  1AP0 A;  1WTV A;  4C1N I;  2F03 A;  5KNC A;  4EQP A;  4V0B A;  4G4K A;  2NVT B;  1BUV T;  2DY8 A;  1HQM C;  5EPL A;  3JAM L;  3S17 B;  4HED A;  2F0V A;  5A35 A;  4RWS C;  1KTK A;  1WVL A;  3RZO B;  1KDB A;  3G7L A;  4ULL A;  2EE1 A;  5K5P A;  2J0T D;  5IT9 L;  5ISR A;  1ILP A;  3GV6 A;  4HR7 B;  4KTA A;  4C56 C;  3TME A;  2XN9 C;  1G2T A;  4NMZ A;  4U68 A;  4DA2 A;  4CKE A;  4BA2 I;  1SE2 A;  5ELD A;  3EQL C;  4KI0 A;  5C4J B;  4Z9C B;  2F0I A;  4FF2 A;  4G7H C;  2XVS A;  1AFP A;  3P75 A;  1GUO A;  1I50 B;  2MUY A;  3BDC A;  2WAQ B;  3HOW B;  4J1M A;  4CJ0 B;  2WKD A;  3U9S A;  2AUJ D;  3QIA A;  2EY1 A;  3IKJ A;  1TY2 A;  2K5W A;  1BO0 A;  3WDN A;  1HFN A;  3C3L A;  3MTS A;  3V05 A;  3SHL A;  3A8I E;  2QIL A;  1WTW A;  2D9U A;  2EYL A;  1H9M A;  4KKU A;  4O42 A;  3T53 B;  3QG1 A;  1LTT D;  1LAC A;  4C2M B;  1GHK A;  4XYQ A;  1TT2 A;  1SAP A;  2AQ1 B;  1ESR A;  2MHV A;  3PUW A;  3FRP B;  5EPJ A;  3TDQ A;  2MPM A;  5D14 A;  2D2C C;  2FIN B;  2RVL A;  1D6E C;  5D65 A;  3NBH A;  3NTH A;  2Q8T A;  5FOB B;  1Z47 A;  1D5M C;  2EYJ A;  5I9P A;  1HA5 A;  3L9A X;  1WCM B;  3PUY A;  1BDO A;  3F2U A;  1OXS C;  1QCB D;  3BDO A;  2L9H A;  3WOE A;  5EKK A;  1EY9 A;  1EFI D;  3EVQ A;  2R92 B;  3D6C A;  4IFD I;  5C3X A;  3P20 A;  1YNN C;  1YNJ C;  4ME5 A;  3Q22 A;  4RGO S;  3SE0 A;  1A3V A;  3ERQ A;  4RKB A;  2WP8 J;  4K2K A;  2J7Z A;  3HOY B;  3QB3 A;  2SNM A;  3D3R A;  5I9O A;  2KHS A;  4QB4 A;  2NB0 A;  1HA6 A;  3GQB A;  3K57 A;  3M4O B;  3H6M A;  2H1E A;  2HUG A;  1JIC A;  4AYB B;  1TKW B;  2JA6 B;  5JEA G;  2PQE A;  2BA1 A;  1B9M A;  2K03 A;  1EU4 A;  3GV3 A;  1CK1 A;  1PRT D;  2K28 A;  4DXG A;  2MP1 A;  3PUX A;  1RHP A;  4IAL A;  1FYC A;  3RD4 A;  3V96 A;  4L6T B;  5CV5 A;  5ELF A;  2Z4I A;  2YYZ A;  3TP6 A;  4XIG S;  1SYE A;  1SE3 A;  2K6A A;  2JSO A;  2PW7 A;  1ML0 D;  2F0E A;  3DHQ A;  1G6Z A;  2OEO A;  1GXD C;  2IPK D;  3WOF A;  1CQV A;  3RLF A;  1CTM A;  4DN4 M;  2M9V A;  5EPK A;  4XQQ A;  1JR0 D;  3K5L A;  3MAQ A;  3LWE A;  3EA6 A;  3D8G A;  1DOL A;  2K32 A;  1HUN A;  3MFY A;  4KJO A;  3K0Y A;  3R2I A;  4HSP A;  2F0H A;  3K59 A;  1CZW A;  5J39 A;  1B44 D;  1SSO A;  4OO1 G;  1IL8 A;  3GTG B;  1XXG A;  2G9H D;  4BBR B;  2A6E C;  2BCO A;  4H13 C;  2I46 A;  1LTA D;  1DOK A;  3MC0 B;  1RTN A;  2F0S A;  5CBE E;  3OWF A;  4RGT A;  1ZKO A;  1V1P B;  1F2Z A;  2VNU D;  2BDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...