1BBXC

Non-specific protein-dna interactions in the sso7d-dna complex, nmr, 1 structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
63
structure length
63
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*TP*AP*GP*CP*GP*CP*GP*CP*TP*AP*G)-3')
publication title Architecture of Nonspecific Protein-DNA Interactions in the Sso7D-DNA Complex
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
total genus 4
structure length 63
sequence length 63
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bbxC00
1QG7A 1DOLA 1PFMA 2BDNA 4LMQD 4HAEA 2X69A 3D6WA 1ICWA 2HUGA 5AFWA 3HP3A 2NWGA 5EPJA 1WTRA 2FMMA 2HCCA 1SSOA 1MGSA 1AZPA 2L9HA 4X3KA 1ML0D 1MSGA 1TVXA 1G2TA 1EIGA 5E4WC 4U68A 1RODA 5DNFA 1VMPA 5EQ0A 2K05A 4ZKCB 1JICA 1CM9A 4IUUA 1U4MA 3P7JA 1QE6A 3MTSA 3R93A 2H1EA 1NR4A 3I3CA 5CBEE 3FDTA 4ZKBB 2FFKB 4R8IA 1WTQA 4IUPA 1PDQA 4RA8A 1WTPA 2KUMA 2L12A 5CBAE 4QUFA 4XT1B 5EPKA 1F9QA 1RTOA 1B50A 1MSHA 4X3SA 3I90A 2B2YA 2K03A 3TZDA 3UI2A 2IL8A 1M8AA 2EOTA 1J8IA 4HSVA 1HFNA 1NCVA 1MI2A 2KEEA 2Q8TA 2B2UA 1F9SA 5D14A 3I91A 1RJTA 4RAUC 2Q8RE 2N88A 5JJZA 1EIHA 2B2VA 1CA6A 1G2SA 5D65A 3QO2A 2D9UA 3TN2A 5EPLA 3SVMA 1NAPA 1X3QA 4XT3B 5CMDA 1WVLA 1DZ1A 1HHVA 2B2WA 4XDXA 3Q6SA 2FJ2A 2L1BA 1EOTA 4CJ1B 4IUVA 2B2TA 1F2LA 2KVMA 2K04A 3GV3A 3I8ZA 4OIJA 1SDFA 2R3ZA 1WTXA 1J9OA 1U4LA 2EE1A 1PFNA 2JYOA 2K01A 1F9RA 2NYZD 4OIKA 1E0BA 5COYA 1Q3LA 3DEOA 3IFDA 5CORA 1IKMA 3KBXA 1U4PA 1HUMA 4NW2A 2EPBA 1WTVA 1S4ZA 1RHPA 1DOKA 1C8CA 1PLFA 2KEDA 3N52A 2CVRA 4O42A 2RVLA 1B2TA 1CA5A 4X3TA 2DY7A 4X3UA 2MP1A 1KNAA 1U4RA 4ZLTF 2J7ZA 1X32A 1B53A 4HCSA 2MPMA 2XIWA 5EJWA 2X6LA 1WTOA 1DOMA 1JE4A 1ESRA 1G91A 4MHEA 1WD0A 1B3AA 3DEPA 3ONAB 1SAPA 1BBXC 1IKLA 2M2LA 1DONA 1EL0A 1RTNA 1EQTA 2DY8A 1ZXTA 1F9PA 1WD1A 4CJ2C 3IL8A 1O80A 1HRJA 1KNEA 1LV9A 1NR2A 4IUTA 2K28A 5T1GA 1XYIA 1HFGA 5E4XA 1HA6A 2VXWA 3F2UA 5T1IA 4R9WA 1O7YA 2HDLA 3KUPA 1VMCA 1O7ZA 2NZ1D 3H91A 1AP0A 3LWEA 1ILPA 2RA4A 2B2YC 1G6ZA 3GV6A 2N55A 4DN4M 1HUNA 2L11A 4ZAIA 1AZQA 2FINB 1WTWA 1ILQA 2B2UC 2K1BA 1QNKA 1IL8A 2RSOA 3DM1A 1A15A 4MN3A 1GUWA 1BF4A 2KECA 1B4OA 2HDMA 2B2VC 2KOLA 2MJ8A 3FPUB 4RWSC 1X3PA 2X6GA 4IURA 4QUCA 1BO0A 2RSNA 4ZK9B 2FHTA 4CJ0B 2JP1A 5EKIA 3G7LA 3MWYW 1XX8A 4UAIA 2B2WC 1PFBA 2SDFA 1BNZA 4IUQA 2MGSA 2B2TC 4HEDA 2L4NA 2HCIA
chains in the Genus database with same CATH superfamily
3CHBD 5EPJA 3R8BA 2PQAA 2XNAC 4K8IA 3RLFA 1E2ZA 4A3BG 1RDPD 5DNFA 1PV4A 2O5IC 1XTDA 3NENA 2N49A 1VQEA 3H94A 3V05A 2H1EA 1N33Q 4DR3Q 2P5ZX 4R8IA 1PRTB 3K5NA 3H0GG 3GTOH 1VQ4A 5ELNA 1K83H 3NWTA 1Z7TA 5EPKA 3TQYA 1QUQB 1HFNA 1VQMA 2B63H 3E3XA 4E6IA 1XMOQ 2K33A 1EIHA 2F0EA 3CCVA 4A3MH 1CA6A 1E7ZA 5CGKA 1CFMA 1BBWA 3PO3H 1WVLA 2B2WA 2BA1A 2F0HA 1HXYD 2WV6D 1K3RA 4X64Q 1SDFA 2IX1A 1RCVD 1VQ8A 4FVMA 4B3RQ 2JYOA 1FJGQ 1Q3LA 4KHPL 5LL6S 4IJLA 2EYFA 1V9PA 4GN3B 3M7NA 3T13A 1S4ZA 1R9TH 1Q7YC 2PI2A 1PLFA 4ME5A 3PIP3 1TWFH 4O42A 2NN6G 2BCOA 3N6RA 4YCUA 5HGTA 3NBHB 4ZLTF 1CI3M 2L0CA 3NQTA 2H4OA 1DOMA 4MHEA 2KHIA 1S5FD 2ZTEA 3DEPA 4IN3A 4LJZC 3CCQA 5TSSA 5IT9c 1YJNA 2E74C 2NZHA 4A3LH 1LTTD 1MJEA 1VQHA 1X65A 3K7UC 3RZDH 1KHIA 4X65L 5ELFA 4FXGC 4A75A 1O7IA 3K8AA 1W2BA 2K5HA 1PZID 2N8NA 1HZ9A 2F0SA 3AU7A 1EYGA 1G6ZA 1I4PA 4JI0Q 3K0XA 2Z1CA 3GTOB 4DV7Q 5KNCA 1K83B 2KECA 2HDMA 2L5TA 4JK1C 2YU9B 3V2TA 2FHTA 2JP1A 1Y69U 2K7VA 1TS4A 3ERSX 1ENAA 2K5DA 3I4OA 1Q90A 2YV5A 4EQ5A 1R4PB 2B2TC 4A3CG 5GAGC 1GUTA 4A3MB 2NTTA 3MFYA 1N33L 1PZJD 1WTRA 1Q8IA 3PO3B 1MGSA 1WJJA 4B3SQ 3HOZH 2IX3A 4S3SA 5M3FG 4DV4Q 3RUZA 4A3EB 3AEVA 1EY9A 4DR2Q 4NPSA 1F77A 1R9TB 1JMCA 3NE5B 2A73B 1TWFB 3PQIA 3KLSX 3W5OA 3SXHA 4DAPA 4DNIA 5FOBB 4L8JA 1NUCA 4J1MA 4AYBG 1STGA 1RJTA 1FJGL 4L5TA 2LMCB 3KF6A 1AN8A 2D9UA 3RZDB 1A2TA 1EOTA 3HOVH 3HKZE 5COYA 3I4LA 4B08A 4QF4A 4KJOA 4G7HC 4HN7A 2PZUA 4R8NA 4B9XA 2JA5H 2EJMA 4DK3C 1FYCA 3MA2B 1JB3A 2PQAB 5JJIA 4GLVB 4DV6Q 2J7ZA 4HCSA 3E9HA 4HMJA 2R7DA 1E1TA 3BZCA 3I70A 3MEFA 4JI0L 1F2YA 2SNSA 2A6HD 1EOVA 1HFGA 4G4KA 2R7ZH 4QQBX 3HOZB 1JWUD 5T1IA 1KAAA 1SNMA 4KMUC 3QOJA 3QR8A 1RL2A 1JJGA 1UEAB 1FNWA 2ALYB 4GNXA 1TR5A 2L11A 2PMZE 5FO8B 5KIXA 1AZQA 3MAQA 2RSOA 1QNKA 2RCFA 3I2ZA 1Q12A 4MN3A 3FPUB 3URYA 3BJUA 1NBWA 4GN5A 2A5HA 4IOCA 1EEFD 2IWHA 1IBKQ 4B3SL 5M3MH 3R2IA 1BVSA 4R1JA 2EYHA 1HTLD 2BDNA 4YWMA 4V190 3DWPA 2MNAA 4DR2L 4IUNA 5KYIA 1XNQQ 2TSSA 3A5UA 3STBC 3T16A 3GO5A 3HOVB 4HJAA 1SN8A 4P71A 4BY7G 5AJ3Q 4M8AA 1EYDA 1JB7A 4DU9A 2KHSA 2Y0SG 5DLQE 1NR4A 5CBEE 4JI7Q 3BDLA 5IYCG 2F1MA 2C35B 1KD1C 3HOWH 2BE5C 3MXGA 5NUCA 1K8MA 5CV9A 1K9MC 1GUNA 1I4XA 1E2WA 1O7LA 2EXZA 1SE2A 1EIFA 4X3SA 3TMEA 1SYDA 1TIID 4ID6A 1PH6A 1Q8KA 4F87A 1F9SA 2I5HA 1SYEA 1HR0Q 2N88A 4N9PA 2B2VA 5BR8L 1Y14B 3LX0A 4K5VA 4K0KQ 1VQLA 4XT3B 2KCMA 2O4XA 1PA6A 3GTPH 2R7ZB 2LSSA 3KFUA 4C3JG 3PUZA 2EY2A 4DV6L 2NZOA 3IFDA 1HUMA 4TQUS 4PMCA 5KNDA 2CQOA 2ZXRA 1STYA 4RGNA 5D3DA 1EQVA 4HIMA 2EQSA 3H3VC 5M3MB 4TRDA 1VQ9A 4UDUC 1VQAA 1K0SA 4A3IG 4CDEC 2QF7A 4ILWA 3S14B 1EQTA 4UHVA 2UXCQ 1NR2A 4JI5Q 5EAYA 4LF7Q 3ZYYX 2ICEC 3W1BA 4IFDH 2QKIC 1EFWA 2RDHA 1IBKL 4K6LA 1K73C 3MVVA 5J3BA 1C4QA 1E22A 1EY8A 1G51A 3D6CA 2K1BA 5KRUA 3HOWB 4OXPA 3KF6B 5C0XI 3CPWA 3F2BA 4N9TA 2JA6G 3PIO3 3V96A 4DXGA 4A3FH 2A69C 3A55A 4KV6A 4QIWE 4IUQA 2MGSA 5AJ3L 2E2IH 1LTGD 3CRKC 1TKWB 4A76A 3I4MG 2NVYH 2O5JC 2DNCA 4G7ZC 3J80L 1EWCA 3FPPA 1S5DD 2HCCA 2OTLA 3GTPB 4BWGB 1E3PA 2JQOA 4IJHA 1CHQD 3KDFA 5IIFA 2D2CC 1M90C 3MTSA 5FKAC 2LKVA 4J6HA 1AW7A 1Y1VH 2FFKB 3ULLA 4DAYA 5ELCA 1LTID 2K14A 3K6OA 1YNJC 1ASYA 1BQQT 1D5MC 2UUAL 5G3LD 4K0KL 1KXLA 1KRSA 1NMGA 2Z6KA 2K03A 3UI2A 4GOPA 1WI5A 3X3MA 4IPDA 4NDXA 4LFCQ 1NCVA 1C48A 2EIFA 2N78A 2F0TA 4JI8L 4GNXB 3OW2A 1WTHA 4HJ7A 3TN2A 2A8VA 1TY2A 3KLRA 1LT3D 3RN5A 5IOCA 5LMUQ 4CJ1B 3CC7A 3FMCA 4LF6Q 4BBRH 1D1IA 1AH9A 1PH1A 1EWHA 4NW2A 1L0YB 5C4XH 4L63B 4TSSA 1CQFA 3WOEA 3CXCA 3Q0AA 2UXCL 1G291 1LACA 4JI5L 1RF2D 1N34Q 4N8X1 4A3FB 1OTCA 2IY5B 2XRSD 3KLWA 3F2CA 5C3EG 3HOUH 1BCPC 4C1NI 3GTLH 5GROA 3HOYG 3IL8A 1Q82C 1KNEA 3A8IE 2UUCQ 2YTVA 2EY1A 2LS01 3P1HA 1X6OA 5E4XA 1LM0A 2CW0C 2ASBA 4A93G 3LWEA 2RA4A 1GUGA 1Y1VB 4JV5Q 4FYDA 4KY5A 5FJ8G 1ILQA 2K4KA 1IHZA 1LABA 1W6KA 2EYPA 1A3TA 2X6GA 3NXWA 1WFQA 2LFNA 2F0MA 5BN5A 4BS9A 4BXXG 4OO1H 4OELB 5IP7H 2FXQA 4LMQD 2EYLA 2B39A 2ZT9C 4Y7NH 4NMZA 3FKIH 3STBD 1JR0D 1B3QA 5IYBG 3HZXA 1D2BA 1MSGA 2E8GA 1TVXA 3H09A 1FD7D 1NY4A 4BBRB 3U9SA 4IUUA 3L2PA 2ZXPA 4OGQC 1XPUA 4LFCL 4ZKBB 1X3EA 5C4XB 2PW7A 3OOCA 1GOZA 1KDBA 2L12A 3J80E 1N32Q 1HA5A 2R7FA 4CGYB 2XGTA 5E3FA 1XPOA 3I90A 4CKBA 2KCNA 5LMUL 4HSVA 5JPMC 4C3HH 4LF6L 1H9MA 2SEBD 1MI2A 3VYSA 3HOUB 4AIMA 2AUJD 4APVA 1XNRQ 1A63A 1L1OC 3GTLB 4CDCC 5J22A 5C4ZA 2F4IA 1ZYRD 1YHAA 4MIUA 4HIKA 2BDOA 2D5DA 3K80C 4DV5L 1YI2A 4RHRA 4OONA 3CCSA 1N34L 2K01A 4GN4B 2WIIB 3NTHA 1IKMA 1A3VA 1XPRA 3RNUA 2UUCL 1YIJA 4JG2A 3WOFA 2C9OA 2UXBL 2K5QA 3KDFB 3U58A 1VQDA 1DD2A 1KQSA 3ITPA 1TWCH 1JWMD 5CYUA 2RDFA 1VQOA 2OQKA 3TP5A 4Y7NB 1HCZA 1M1KC 4DAYB 1MIUA 5IP9G 1VQCA 5T1GA 1XJVA 1BOSA 1K8OA 1HA6A 2VXWA 4GOPB 2LY7A 2UUBQ 3RZOH 3WWVA 1EUJA 2ZJRA 3BVMA 1IL8A 3BDCA 1NMFA 3GD7A 2F0IA 4JVZA 2I07B 4A3GH 3BG3A 4LUOA 4UAIA 2A69D 2KHJA 1X3GA 4DV3Q 4C3HB 4PZ7A 1SMYC 1QG7A 2E75C 5JVG3 1XMQL 4RCNA 2HUGA 2I5LX 3HP3A 1YBYA 1CTMA 2NWGA 4P72A 4X3KA 1TWHH 1BCPF 2XN9C 3M3YB 1O78A 1JORA 1VMPA 2F0FA 2Z4HA 2WAQE 1K28A 4PG3A 1U4MA 2G5DA 1HQRD 3I3CA 1FNUA 4BY1H 1OXSC 4A4IA 1XNRL 5DAUA 4DUZQ 1F2MA 2VB2X 5C0XG 3MFGA 2O2LD 4DK6C 2OTJA 3KBGA 3EN2A 2E2HH 1QVGA 5M5XH 3PO2H 4LFBQ 2B2YA 2WKDA 1HH2P 4JBMA 3S2DH 1TWCB 1N36Q 3I91A 2WAQG 1A8VA 1STHA 1H9JA 1BKBA 4H44C 3SR1A 3RN2A 1IYJB 3MHBA 3SDZA 1WYDA 4ZUIA 4A3EG 2WB1E 2GVBA 2EE1A 1LO5D 3RZOB 4PNYA 1KDAA 3J80i 4BBSH 5CORA 4EQOA 4KKSA 2OT2A 1NJIC 2EPBA 1TU2B 3W3AA 3SK6A 1RHPA 1STAA 3N52A 3OYYA 4WJ3M 2DY7A 4A3GB 2HIXA 1EY0A 5EJWA 5I4DA 3C1FA 2WB1G 1EL0A 2DY8A 2D0PA 1BCPD 2BH8A 1LV9A 1IW7D 1H9RA 3TDQA 1FNVA 1TWHB 1VF7A 1VQPA 1I4HA 1V1PB 2CW0D 4PMWA 1ASZA 3QIAA 2NZ1D 4NKLA 5GADC 1AP0A 4DV3L 2JA7H 4BY1B 4ZAIA 4DPGA 2UU9Q 2RCNA 5GAHC 3A54A 3G48A 4A3BH 1X56A 4R4OA 1UEBA 3SK4A 3OTOQ 5IWAQ 3J81j 3D3RA 1B4OA 3ULJA 1PH9A 2E2HB 5M5XB 3PO2B 5C44G 3T56B 1YNXA 1K3BC 1H95A 1PH7A 3R3OA 3D8GA 3A8JE 1BNZA 1G6PA 3P75A 3S2DB 3P7JA 1EFID 1ICWA 4K6DA 3VR2A 1JT8A 3OIQA 2AWOA 4DUZL 1VQIA 4U68A 2B3GA 3A7AB 1N9WA 4BBSB 1KTKA 1GUSA 1HNXQ 4MTNA 3I72A 1N36L 3M4YA 5CV6A 3QJYA 2CWAA 3OIPA 2GN5A 5FO7B 5ELOA 2JK8A 2B63B 3L0OA 1F9QA 2IT1A 4CDFC 4TVAB 3BZKA 2DN8A 4DR3L 1J8IA 1CSPA 4LWCA 2KEEA 3J7AF 5A35A 4H0LC 3EJIA 2NN6H 2XVSA 4BA1I 1YVCA 4AYBE 3QO2A 1AE3A 3A0JA 3GTJH 3OPOA 3Q23A 2EZVA 4GKKQ 1I6HH 2FJ2A 1CZGA 2B2TA 4HTHA 4NP5A 4JYAQ 3NWSA 2FMCA 1XMOL 2Q2IA 2EY6A 2VZAA 1CKOA 2EJFC 3M7GA 2JA7B 2EVBA 2EYMA 2PCFB 4A3BB 4EX5A 1N8RC 2F0NA 4DXFA 1AFPA 4OEMB 4X64L 1LYLA 2ZTDA 2ZTCA 4B3RL 1U4RA 1OXXK 1LUZA 4XYOA 1B53A 5CV7A 1TXYA 5HGQA 4FO2A 1UWVA 2CKZB 4QL5A 2IW3A 3DXJC 2UU9L 4IPGA 4LNQA 5GAEC 3OTOL 3NPPA 5IWAL 5EBCA 1I50H 3F2UA 4R9WA 4H7BA 2DUDA 5C5LA 3AB9A 5IT9L 4WFN3 3HEJA 5IGDA 3SGIA 1A15A 1BF4A 4MNOA 1ENCA 4OWXB 3J81L 4C2MH 1YJ9A 3CCJA 4JBWA 3VA5A 5HY6A 4DV7L 3PIPA 2IHEA 4HAEA 3TSSA 5IGGA 3D6WA 1J5EQ 1HNXL 3GTJB 4A3JH 2HT1A 1PH8A 5E4WC 4GZYC 1C0AA 3DM3A 5F2DA 1KIXA 4B3TQ 1ET6A 3RR5A 5IY0A 1CM9A 2F0DA 5FK9C 1EU4A 3HOWG 1CKMA 3NEMA 4FF3A 3J7A5 1WTQA 4M1UB 2NTSA 2Y0SE 1PVOA 2RBMA 4OX9Q 2CH4W 4DF7A 1M4VA 1RTOA 1UNSA 1B50A 4DV4L 4LFAQ 3U9OA 3EROA 4LAAA 1EZ6A 3GTMH 4JYAL 3S1NH 1SROA 4GKJQ 5JJZA 2RF4A 4JBJA 1NNXA 2KA7A 1I4RA 3E0JA 3C3LA 5EPLA 3TS2A 1WCMG 1I50B 4KKUA 2ID0A 1UE6A 2JA5B 3CQZH 3PV0A 1SMXA 4I7ZC 1B9MA 3AFPA 4HJ9A 2CFMA 1E0BA 1VQBA 1EZ8A 2VS1A 1EIYB 1SNCA 4Q5VA 4BA2I 4X3TA 4C2MB 1W6JA 4F7XA 5M5YH 1CZWA 1ENFA 2Z9HA 3PUXA 2K6AA 2MPMA 3D4RA 2LXJA 4TKOB 1MBYA 2B29A 5C0XJ 4OL7A 4DV0Q 1HTPA 1HRJA 5IGCA 4KTAA 4A3JB 5C4JH 3MXNA 5DM63 1EYAA 3KUPA 5ELBA 1KAWA 4Y52H 4UPAA 2KCCA 2MUYA 1I3QH 3HGBA 1FGUA 1GXDC 2AWNA 1EU3A 2B2UC 4A3KG 1B8AA 4A3FG 2MJ8A 2OXPA 4LF9Q 4IURA 4ZK9B 1XX8A 3J7YW 5BN4A 1EQRA 5IT9E 4B3TL 4QJFA 3GTMB 5IYCH 3S1NB 2L4NA 1V43A 4DR6Q 4L6TB 4F88A 1Y1WG 1SR3A 1CKNA 4GLAC 1GUOA 3BYYB 3NELA 4EGVA 4KN7C 2FMMA 2F52A 3J81E 1AZPA 5IYDH 1TS2A 3Q24A 3O13A 3HKZB 5FLMG 4OX9L 3CQZB 3TP8A 1PHJA 4DNRB 4AQYQ 2AQ2B 4LFAL 1SE4A 3R93A 5A2QL 4ALPA 1XNQL 3VA7A 1WTPA 4GKJL 3A7LA 4QUFA 4DV1Q 3PGZA 1ET9A 1QWYA 5M5YB 3TP7A 1IYUA 5L37A 3U50C 4JI7L 2KENA 5C5MA 1HR0W 2ENBA 1XTCD 3UDXA 3CCUA 2K32A 3CPFA 1G2SA 1B70B 3DWAA 3M4QA 4RGMA 1ESFA 5CMDA 2PW5A 2AQ3B 3M4OH 1Z9FA 4KY7A 5C4JB 4A3IH 3EIVA 3H15A 3KJOA 1VS0A 1I6VC 1WTOA 1HR0L 1QJOA 1PH4A 1I3QB 3KBXA 2PMZB 2RQXA 1PYSB 2MFIA 1PZKD 4FNFA 4DR5Q 2A68C 2KQ3A 3L3OC 4DV0L 1MD2D 5JPNC 2XIWA 2X6LA 4YHHQ 1CQVA 4DR1Q 2E5LQ 1RTNA 1JOKA 4IQZA 1Y8NB 1WD1A 3IKJA 4KLKA 1LT5D 3RLOA 3I4NG 4EQNA 2JA9A 1HNWQ 4EQPA 1VCIA 2F3VA 4ABNA 1I94Q 4LF9L 2XSCA 1O7YA 3LGJA 2G9DA 5EKLA 3H91A 4C3IH 3I4MH 4YY3Q 2I5MX 5K36G 1U0LA 2B8FA 4LF7L 5CR3A 3NBIA 1D6EC 4N8FA 2E2IB 2VQEQ 3E9IA 3I73A 3H3VH 4LF4Q 4X66Q 5JJKA 5IP7G 2DJFC 2NVYB 3SK5A 1H9SA 2VUMH 1LT6D 3JAML 2H5XA 3D4DA 1IBLQ 2PZWA 4FXKC 1SFOH 5GQOA 1JQYD 4HR7B 1BBUA 2F0KA 2I0QA 3M4OB 4Z9CB 4A3IB 4JI2Q 3D4WA 1IZ6A 4YCVA 5EQ0A 1KLUD 4ZKCB 1IYVA 3S15H 3UDGA 1GHJA 3EBEA 4RA8A 2PO4A 2TMPA 1SYCA 1PRTC 1EY7A 2F4VQ 3SE0A 1SLJA 2R93G 2JA8H 3TEHB 4C3HG 4DR4Q 1VQNA 3HOXH 2QA4A 3MXNB 1M8AA 4OHJA 4JC0A 5A2QE 4RAUC 3J81i 3OWFA 3PUVA 1TT2A 3HKSA 2UXDQ 3PIOA 4DR5L 1X3QA 2V4DA 3Q6SA 4X6AH 4Q0FA 1V1OA 4HCEA 1B44D 2K04A 4RMFA 2VQFQ 5C4HA 5EGTA 2F3WA 3IAYA 2NYZD 4C3IB 4DA2A 1B9NA 2R92G 3I4MB 4PZ8A 4AH6A 4DGZA 4YHHL 1Z6HA 2BE5D 4X62Q 5LMNQ 3S1QH 5CV5A 2CQAA 4L5QA 4DR1L 2E5LL 1V1PA 1YJWA 1DOKA 3LNNA 1DM0B 2NB0A 4ODGA 1CKNB 4NXMQ 4CHTB 4A3DH 3MXUA 1KNAA 2GA4B 1HNWL 4NB3A 1L0XB 4QIWB 1I94L 2VUMB 3JC66 3HRZC 5FJ8H 1WD0A 1IKLA 2M2LA 1UE5A 2EY5A 1SFOB 3KK7A 1TS3A 5JEAG 1GO3E 4RFBA 2K28A 4LF5Q 5M5WH 4BXXH 1SE8A 2VQEL 3KJPA 2HIVA 4YCWA 4X66L 1STEA 5J1ZA 1L1OA 3S15B 2NVTH 5H1SE 1BUVT 1NE3A 2FINB 4JW0A 5HURA 5JVH3 1WTWA 1GUWA 2VB3X 4WRDA 1VDZA 3EQLC 4HIDA 2OWOA 2KOLA 2MO0A 4QGUA 4QMGA 2JA8B 1X3FA 1BDOA 1BO0A 2A1AA 2V1CC 1EQQA 3KF8A 1ONLA 2MO1A 3G7LA 3HOXB 4JV5L 4JI2L 1JJ2A 2VW9A 3FKIB 2HCIA 3MZ5A 3CMAA 4L5SA 2NVQH 1JE5A 2QDBA 1OXVA 1PFMA 3PF5A 1QZHA 3A5ZB 1T9HA 2RHQB 4XQNA 5KNBA 4OWTB 2RHSB 5CC4A 2L9HA 2HHHQ 2F4VL 3K5OA 1EIGA 4RKBA 1D1KA 4U673 5DM73 1VF5C 4BY1G 4DR4L 3JAME 3F8TA 5IGFA 1QE6A 2QDLA 3S1QB 1JCKB 3ER0A 3FDTA 3A74A 1L0WA 5LHY1 3GTKH 3QB3A 5FLXL 3GTQH 1XWEA 3OMCA 2UXDL 4A3DB 3SEBA 4B3MQ 3QG1A 2VQFL 2RKSA 1GM5A 1FGBD 1G8ZD 5D14A 1FVIA 1S5BD 1N32L 3BVGA 5IGBA 5LMNL 4X62L 4PQXA 4HSPA 3QOLA 1NAPA 4XDXA 1I4QA 4FDBA 5M5WB 1SNOA 2L1BA 3K81C 4ZQ3A 4NXML 4P73A 4OIJA 1DYQA 2JJQA 3BYTB 3P20A 3GP7A 1F9RA 1H9SB 1YNJD 1PTOC 2NVTB 3CU7A 5JOBA 4DK0A 4RKLA 3X3NA 4JI6Q 2B63G 3CD6A 1PH2A 3TBIB 2F3IA 3K57A 2A68D 2IHFA 3GTGH 2ZJQA 4A3MG 1A6XA 4HJ5A 4LF5L 1PRTF 1X32A 3PO3G 4IOAA 2SNMA 3CMEA 3EA6A 1G91A 4KI0A 2M00A 1BCPB 4IFDI 3ONAB 1SAPA 3G71A 1RKNA 1SNDA 1W3SA 4CKEA 3CRLC 3OHXC 3EVQA 4R4CA 3M85A 1IL2A 4IUTA 2ICIA 1YITA 2JA7G 3U4VA 1VQFA 2KBNA 1VQGA 2F0JA 4IZ8A 4PV1C 3K0YA 3GTKB 2Q8IB 4G57A 3GTQB 5IGEA 4A3LG 2UUBL 4RH6A 3IFTA 2HHHL 2B2WC 4O0AA 4RGTA 4UP7A 4LW1A 3K58A 4J8QA 2YU9H 5C0XH 5I2YA 4MTKA 2F0QA 5J39A 3K5LA 2IJ0A 4ZUJA 1ZKOA 2YTYA 1EEID 4B3ML 1A0IA 1KABA 4QY7A 5ISRA 1X54A 3BZDB 2XWBB 1DGSA 2K5VA 2D0OA 3MXPA 2KCTA 4IUPA 1PDQA 3K5MA 1HJPA 5D3IB 1F2ZA 1PRTD 4A3EH 3GTGB 4HMIA 3H0GH 3UDIA 3L9AX 2R6GA 3VR4A 1AEXA 1MKHA 5DEHA 4RCOA 4RGOS 3TZDA 3M4PA 2WACA 3ND8A 1TY0A 1L1OB 3HOZG 4B9WA 2YYZA 3BS1A 4V0BA 3FEWX 4KD3A 2AMCB 2VL6A 1S5ED 5FLXE 2L15A 3G4SA 4JI6L 4LFBL 2NUCA 3W2DA 1DZ1A 2PI2E 3JAMi 4K5XA 3NHHA 2K52A 3PSIA 3KF8B 1HNZQ 4GS3A 4QB4A 3E5SA 2I46A 2PNRC 2Q2HA 3J81c 2ES2A 3AFQA 2DGYA 1PTOH 2QILA 3H3VI 4FF4A 2JEAI 3ERQA 1SYGA 2CVRA 2NBFA 1VQ7A 3BVZA 4DV2Q 4R4TA 2XWJB 4POGA 4X3UA 2ZJPA 4QCLA 2WFWA 4EVOA 2LXKA 3HOVG 3S1RH 4KK7A 3DMUA 4KHZA 1J6QA 3MEHA 5C44H 4FXDA 5KEEA 2JA5G 4JPBW 2RDGA 2AKWB 3S16H 1QZGA 2WAQB 2HDLA 4CBVA 1VMCA 4IO9A 2JE6I 3PCOB 1E24A 3NSWA 1K8AC 1TQOA 4OO1I 4POFA 3B6YA 1PTOF 4RWSC 3R2TA 3H0GB 4ZYSA 1SBBB 5IODA 2K5NA 1KRTA 4CJ0B 4O2DA 3S2HH 3C1EA 3NP8A 3NUCA 2BA0A 3H6MA 2SDFA 2R7ZG 1QVCA 1CSQA 2F0WA 2QGQA 1NTGA 2Z0SA 4HJ8A 1EYCA 1QOHA 3I55A 4A3JG 1QNUA 1D5ZC 1S3OA 1SXTA 2XRQD 4A3CH 1CT1D 2JXMB 3C2PA 3QWNA 1ML0D 2WB1B 2L55A 4OWWB 5C6AA 3TS0A 5JEAJ 3D31A 1MHWC 4CKCA 5M3MG 3W1GA 5M3FH 3S17H 2E76C 4YWKA 1PTOB 3KOJA 4XTCS 3UE0A 1KL9A 5E7NA 5BR8Q 2DNEA 3NQIA 1SMYD 1B7YB 3OMGA 4H02A 2IL8A 2XTIA 1UAPA 1OXTA 1SEBD 2Q8TA 3S1RB 1HNZL 5ELDA 1I6HB 1EY4A 1SNPA 1STBA 3CC4A 5C44B 5D65A 2F0VA 4PZ6A 1Q46A 3HKZG 4GNXC 4XQJA 5KYLA 2J4XA 3S16B 1Q86C 3E6ZX 3VR6A 4DV2L 3TRZA 2VNUD 1CHPD 1U4LA 1PFNA 2SOBA 1PTOD 1PXUA 2AUKA 4GKKL 1Y8OB 3DLLA 1CK1A 2PQEA 1WTVA 1C8CA 1HQMC 3NTKA 5FO9B 2HQLA 3PMFA 3S2HB 1HPCA 2YTXA 2E2JH 4KD4A 1SE3A 2Q2UA 2IPKD 4C56C 3VYRA 3G6EA 1GD7A 3Q22A 2ATWA 1DONA 3VYTA 4LUVA 2ZM6Q 1YNNC 3HFZB 1IBMQ 2F0LA 1OO9B 3DWQA 3S14H 4XQQA 1WOCA 1SJED 4LK1C 2PYKA 3GV6A 5M3FB 3S17B 1HZCA 3TREA 1E2VA 4DKAC 4NXNQ 2K75A 2GVAA 2B2VC 2WKCA 3VDYA 1T5EA 3J80c 4WJWA 3MWYW 1PFBA 4PMBA 1STNA 3FHWA 4DR7Q 1VQJA 3T1HQ 4IFDG 1RD9D 2PZTA 3BDOA 3VR3A 4L5RC 1Q1BA 2X69A 1LTAD 4RG1A 4XXEA 4AYBB 5IYDG 2PPBC 1QVFA 3UDFA 1LTBD 1MJCA 1HZAA 1I4GA 1LTSD 1RODA 1ZYRC 2NVXH 2UUAQ 3D0FA 2K05A 3MC0B 2CCZA 3E0EA 1JICA 1KDCA 4I7AA 4DAVA 4K14A 4IALA 5EKKA 2C5CA 4BY7H 2MQHA 1A3UA 1J5EL 4JI3Q 1FR3A 1WCMH 2A74C 3RMHA 4JI4Q 5BN3A 4XT1B 4JI8Q 4KY6A 2A6EC 2HD3A 1ICFB 1MSHA 2E2JB 3CCEA 3T53B 4IPCA 2EOTA 1QCBD 4DAMA 1YHBA 3I56A 2B2UA 3CF5A 2K50A 2OQ0A 5G3LF 1S40A 2A19A 4UP9A 2VY3A 1Y1VG 1YEZA 1HHVA 2F0UA 1TS5A 2DJGC 4WJ4A 1LLRD 4R4IA 1DXMA 3CW2C 2KVMA 3I8ZA 5ELEA 3FRPB 2R3ZA 3AYHB 3PUWA 1UE7A 1S5CD 4WORA 4C3JH 3DEOA 3G6JB 4K5WA 1SYFA 2R61A 4I65A 3LWUA 3F2DA 2MHVA 2ZM6L 4LF8Q 1B2TA 3JAMc 1CA5A 1IBML 1QILA 2MP1A 4UP8A 2OF1A 2J0TD 1ESRA 5K5PA 1B3AA 3DUZA 4DK1A 3CCRA 4A3KH 4BBRG 1I5FA 5I6YA 3ZJYC 2F03A 4IPHA 2BOSA 2CH4A 2JEBI 3NK9A 4CJ2C 1O80A 3NTIA 4NXNL 3A8KE 2WINB 5C4XG 3SK8A 1QB5D 4C3IG 2NVXB 1SRUA 4ZCKA 2OEOA 1O7ZA 2Z6KC 4BY7B 1Y1WH 4GOPC 1A62A 2N55A 3PF4A 4DR7L 3T1HL 1LTLA 2Y0SB 2ZXOA 1WCMB 4JBKA 3DM1A 3HOUG 5CV8A 4DFAA 5FLMH 5C3WA 4MZ9A 4F8MA 1X55A 2OCEA 1KC8C 1PMRA 4QUCA 2K5WA 5IE8A 2VUMG 1GVPA 3CAMA 2JA6H 1KLGD 3IRBA 1ZEQX 2EXDA 2QCPX 3FVQA 1C7YA 3KYHC 4JI3L 5I9OA 5LL6X 1GKHA 2EJGC 3CKIB 4J15A 3T51B 2JN4A 4JI4L 2F0GA 2IX0A 1JOQA 2Z6BA 5I9PA 3T4AC 4DR6L 4FF1A 4C3JB 1D5XC 1Y8PB 1YHQA 3WDNA 3I7FA 1DJRD 2JA8G 1OXUA 2KUMA 4OO1G 5CBAE 1HZBA 3HOXG 5I6WA 3OSOA 2NN6I 2AQ1B 4H13C 1LT4D 1EY5A 4YWLA 4AQYL 3FKIG 4P2CB 4DV5Q 4YIJA 4A3KB 4KKTA 2D62A 1AE2A 1SYBA 4DV1L 4LUZA 2QW7A 1BR9A 2HQEA 2F0OA 4KN4C 3ICEA 4IUVA 4LF8L 1B1ZA 2KJXA 3GV3A 1IW7C 1WTXA 1J9OA 4OIKA 2UXBQ 1SJHD 4ZRZA 1Y1WB 1Q1EA 3I4NH 4RHSA 3UE1A 2BH2A 4A3DG 3M9BA 1K8GA 2KEDA 1V1QA 3Q8DA 4JOIC 3L7ZC 1UE1A 1TWGH 5I2XA 3A56A 5K36H 1Z47A 5CV4A 2JA6B 3K59A 1NSNS 4CDDC 3TZUA 5C3EH 1ZXTA 1YNND 1TWAH 2Z4IA 3CCMA 3HOYH 3T1YQ 4FP5D 4JI1Q 1SNQA 5M9OA 4JOIA 5JAVA 1QUQA 1UUPA 1L2FA 3OW7A 1ILPA 2CHBD 5FLXc 4A93H 1JOOA 4DN4M 1EY6A 2Q2TA 3CCLA 1YZ6A 5C3XA 3OWEB 2G9HD 4DUYQ 1X9NA 1VQ5A 1XMQQ 1GJXA 1VQ6A 2EDGA 2RSNA 5JJLA 3F1ZA 3GDEA 1CUKA 1U5KA 3VYUA 4YY3L 2CWPA 2AHOB 3RLNA 1U9RA 4HEDA 1DOLA 3GQBA 1P8LA 2R93H 3BU2A 4XIGS 2PNHA 4P75A 4ULLA 5AFWA 1K0RA 3EFXD 4LF4L 3AMUA 1SSOA 1G2TA 1E1OA 3NBHA 1D7QA 2JSOA 1EWIA 5IYBH 1IBLL 4FF2A 3S24A 3FP9A 1D8LA 1PYWD 4A3GG 1P16A 3M3YH 1IXRA 1H9KA 3I4NB 3K7AH 4KJNA 4JCVE 1PYBA 1V8QA 4R4QA 2R92H 1TWGB 3SHLA 2M9VA 2A6ED 4K2KA 3HG9A 3CC2A 4K2LA 3PUYA 3S1MH 1JC7A 2EYJA 2Q8RE 1S72A 4C1NK 5C3EB 4P74A 2E2DC 1TWAB 1BXTA 1PH3A 3SVMA 4G7OC 1PH5A 1RIPA 3KLSA 3HOYB 1LTRD 3J7AV 4IFDJ 3AQQA 2N3SA 1F2LA 3ND9A 1A2UA 2B8GA 4UY8C 5LMNW 3PO2G 5JEAH 4A93B 1DCZA 1U4PA 3RD4A 2Z8LA 3C46A 4O1NA 2RVLA 4KHVA 1FL0A 5EBDA 5E1FA 4DNTB 3T1YL 1T5XD 4JI1L 4XYQA 1VQKA 3ULPA 1JE4A 4KHPQ 3VR5A 4HIOA 1PFSA 1BBXC 2R93B 1F9PA 2WP8J 4BBSG 3HS0C 3TP6A 2A6HC 1XXGA 1XYIA 4DUYL 3DHQA 3CP0A 5IP9H 4ME3A 3U4ZA 3J7ZC 2B2YC 5KGUA 3K7AB 1Q81C 1HUNA 1R4QB 2EYOA 2QEJC 1JJCB 2F0PA 4X65Q 1C9OA 1JWSD 1X3PA 1GHKA 1II3A 4K8JA 2R92B 2NVQB 5EKIA 4GLXA 2QEXA 3S9WA 3S1MB
chains in the Genus database with same CATH topology
3CHBD 5EPJA 3R8BA 2XNAC 4K8IA 3RLFA 1E2ZA 1RDPD 5DNFA 2O5IC 3V05A 3H94A 2H1EA 4R8IA 1PRTB 3K5NA 3NWTA 1Z7TA 5EPKA 1HFNA 4E6IA 2K33A 1EIHA 2F0EA 1CA6A 5CGKA 1CFMA 1WVLA 2B2WA 2BA1A 2F0HA 1HXYD 2WV6D 1SDFA 2IX1A 1RCVD 4FVMA 2JYOA 1Q3LA 5LL6S 2EYFA 3M7NA 3T13A 1S4ZA 1PLFA 4ME5A 3PIP3 4O42A 2NN6G 2BCOA 3N6RA 5HGTA 4ZLTF 1CI3M 2L0CA 3NQTA 2H4OA 1DOMA 4MHEA 1S5FD 4IN3A 3DEPA 4LJZC 5TSSA 2E74C 1LTTD 5ELFA 4FXGC 1PZID 2F0SA 3AU7A 1G6ZA 1I4PA 2Z1CA 3GTOB 5KNCA 1K83B 2KECA 2HDMA 2L5TA 4JK1C 2YU9B 3V2TA 2FHTA 2JP1A 1Y69U 2K7VA 1TS4A 1ENAA 2K5DA 1Q90A 1R4PB 2B2TC 1GUTA 4A3MB 2NTTA 3MFYA 1PZJD 1WTRA 1Q8IA 3PO3B 1MGSA 2IX3A 4S3SA 4A3EB 3RUZA 1EY9A 1F77A 1R9TB 3NE5B 2A73B 1TWFB 3KLSX 3SXHA 4DAPA 5FOBB 4L8JA 1NUCA 4J1MA 1STGA 1RJTA 2LMCB 1AN8A 2D9UA 3RZDB 1A2TA 1EOTA 5COYA 4B08A 3I4LA 4QF4A 4KJOA 4G7HC 4HN7A 2PZUA 4R8NA 4B9XA 2EJMA 1FYCA 3MA2B 1JB3A 2J7ZA 4HCSA 4HMJA 3I70A 1F2YA 2SNSA 2A6HD 1HFGA 4G4KA 3HOZB 1JWUD 5T1IA 1KAAA 1SNMA 4KMUC 3QOJA 1UEAB 1FNWA 1TR5A 5KIXA 2L11A 5FO8B 1AZQA 3MAQA 2RSOA 1QNKA 1Q12A 4MN3A 3FPUB 3URYA 2A5HA 1EEFD 2IWHA 3R2IA 2EYHA 1HTLD 2BDNA 4V190 3DWPA 4IUNA 5KYIA 2TSSA 3T16A 3GO5A 3HOVB 4M8AA 1EYDA 4DU9A 2KHSA 1NR4A 5CBEE 3BDLA 2F1MA 2BE5C 3MXGA 5NUCA 1K8MA 5CV9A 1GUNA 1I4XA 1E2WA 1O7LA 2EXZA 1SE2A 4X3SA 3TMEA 1SYDA 1TIID 4ID6A 4F87A 1F9SA 1SYEA 2N88A 4N9PA 2B2VA 4K5VA 3LX0A 4XT3B 2O4XA 2R7ZB 4C3JG 3PUZA 2EY2A 3IFDA 1HUMA 4TQUS 4PMCA 5KNDA 2ZXRA 1STYA 4RGNA 5D3DA 1EQVA 3H3VC 5M3MB 4TRDA 4UDUC 2QF7A 4ILWA 3S14B 1EQTA 1NR2A 3ZYYX 2ICEC 4IFDH 2QKIC 2RDHA 4K6LA 3MVVA 1C4QA 1EY8A 3D6CA 2K1BA 5KRUA 3HOWB 5C0XI 4N9TA 3PIO3 3V96A 4DXGA 2A69C 3A55A 4KV6A 4IUQA 2MGSA 1LTGD 3CRKC 1TKWB 2O5JC 2DNCA 4G7ZC 3J80L 1EWCA 3FPPA 1S5DD 2HCCA 3GTPB 4BWGB 1CHQD 5IIFA 2D2CC 3MTSA 5FKAC 2LKVA 4J6HA 1AW7A 2FFKB 4DAYA 5ELCA 1LTID 3K6OA 1YNJC 1BQQT 1D5MC 5G3LD 2K03A 3UI2A 3X3MA 4NDXA 1NCVA 1C48A 2F0TA 3TN2A 1TY2A 3KLRA 1LT3D 5IOCA 4CJ1B 3FMCA 1D1IA 1EWHA 4NW2A 1L0YB 4L63B 3WOEA 4TSSA 1CQFA 3Q0AA 1G291 1LACA 1RF2D 4A3FB 2XRSD 1BCPC 4C1NI 3IL8A 1KNEA 3A8IE 2EY1A 2LS01 3P1HA 5E4XA 2CW0C 3LWEA 2RA4A 1GUGA 1Y1VB 4FYDA 4KY5A 1ILQA 1IHZA 1LABA 1W6KA 2EYPA 1A3TA 2X6GA 3NXWA 2LFNA 2F0MA 5BN5A 4BS9A 4OO1H 4LMQD 2EYLA 2B39A 2ZT9C 4NMZA 1JR0D 3HZXA 1D2BA 1MSGA 1TVXA 3H09A 1FD7D 4BBRB 3U9SA 4IUUA 2ZXPA 4OGQC 4ZKBB 5C4XB 2PW7A 3OOCA 1GOZA 1KDBA 2L12A 3J80E 1HA5A 4CGYB 5E3FA 3I90A 4CKBA 2KCNA 4HSVA 5JPMC 1H9MA 2SEBD 1MI2A 3VYSA 3HOUB 2AUJD 3GTLB 5J22A 5C4ZA 2F4IA 1ZYRD 4MIUA 2BDOA 2D5DA 4RHRA 2K01A 2WIIB 3NTHA 1IKMA 1A3VA 3WOFA 2C9OA 2K5QA 1DD2A 3ITPA 1JWMD 5CYUA 2RDFA 3TP5A 4Y7NB 1HCZA 5T1GA 1K8OA 1BOSA 1HA6A 2VXWA 2LY7A 3BVMA 1IL8A 3BDCA 3GD7A 2F0IA 2I07B 3BG3A 4UAIA 2A69D 4C3HB 1SMYC 1QG7A 2E75C 5JVG3 4RCNA 2HUGA 3HP3A 2NWGA 1CTMA 4X3KA 1BCPF 2XN9C 3M3YB 1O78A 1JORA 1VMPA 2F0FA 2Z4HA 1U4MA 1HQRD 3I3CA 1FNUA 1OXSC 5DAUA 1F2MA 2VB2X 5C0XG 3MFGA 2O2LD 3KBGA 2B2YA 2WKDA 1TWCB 3I91A 1STHA 1H9JA 4H44C 3SR1A 3MHBA 3SDZA 4ZUIA 2EE1A 1LO5D 3RZOB 4PNYA 1KDAA 5CORA 4EQOA 4KKSA 2OT2A 2EPBA 1TU2B 3W3AA 3SK6A 1RHPA 1STAA 3N52A 2DY7A 4A3GB 1EY0A 5EJWA 5I4DA 3C1FA 1EL0A 2DY8A 1BCPD 1LV9A 1IW7D 1H9RA 3TDQA 1FNVA 1TWHB 1VF7A 1I4HA 1V1PB 2CW0D 4PMWA 3QIAA 2NZ1D 4NKLA 1AP0A 4BY1B 4ZAIA 3A54A 3SK4A 3D3RA 1B4OA 2E2HB 5M5XB 3PO2B 3T56B 3R3OA 3D8GA 3A8JE 1BNZA 3P75A 3S2DB 3P7JA 1EFID 1ICWA 4K6DA 3VR2A 3OIQA 2AWOA 4U68A 3A7AB 4BBSB 1KTKA 1GUSA 3I72A 3M4YA 5CV6A 3QJYA 3OIPA 5FO7B 2B63B 1F9QA 2IT1A 2DN8A 1J8IA 3J7AF 2KEEA 5A35A 4H0LC 3EJIA 2NN6H 2XVSA 4BA1I 3QO2A 3OPOA 3Q23A 2EZVA 2FJ2A 1CZGA 2B2TA 4HTHA 4NP5A 3NWSA 2FMCA 2EY6A 2EJFC 3M7GA 2JA7B 2EVBA 2EYMA 2PCFB 4A3BB 2F0NA 4DXFA 1AFPA 1U4RA 1OXXK 4XYOA 1B53A 5CV7A 4FO2A 2IW3A 3DXJC 3NPPA 5EBCA 3F2UA 4R9WA 4H7BA 5C5LA 3AB9A 5IT9L 4WFN3 3HEJA 5IGDA 1A15A 1BF4A 1ENCA 3J81L 4JBWA 3VA5A 4HAEA 3TSSA 5IGGA 3D6WA 3GTJB 5E4WC 4GZYC 5F2DA 1ET6A 1CM9A 2F0DA 5FK9C 1EU4A 4FF3A 1WTQA 4M1UB 2NTSA 2RBMA 4DF7A 1M4VA 1RTOA 1UNSA 1B50A 3U9OA 3EROA 4LAAA 1EZ6A 5JJZA 2KA7A 1I4RA 3E0JA 3C3LA 5EPLA 1I50B 4KKUA 2ID0A 2JA5B 4I7ZC 3PV0A 1B9MA 1E0BA 1EZ8A 1SNCA 4Q5VA 4BA2I 4X3TA 4C2MB 1W6JA 4F7XA 1CZWA 1ENFA 3PUXA 2K6AA 2MPMA 3D4RA 4TKOB 1MBYA 5C0XJ 4OL7A 1HRJA 1HTPA 5IGCA 4KTAA 4A3JB 3MXNA 5DM63 1EYAA 3KUPA 5ELBA 2KCCA 2MUYA 3HGBA 1GXDC 2AWNA 1EU3A 2B2UC 2MJ8A 2OXPA 4IURA 4ZK9B 1XX8A 3J7YW 5BN4A 5IT9E 3GTMB 3S1NB 2L4NA 1V43A 4L6TB 4F88A 3BYYB 1GUOA 4EGVA 4KN7C 2FMMA 3J81E 1AZPA 1TS2A 3Q24A 3O13A 3HKZB 3CQZB 3TP8A 4DNRB 2AQ2B 1SE4A 3R93A 5A2QL 3VA7A 1WTPA 3A7LA 4QUFA 1ET9A 1QWYA 5M5YB 3TP7A 1IYUA 5C5MA 2ENBA 1XTCD 2K32A 1G2SA 3DWAA 4RGMA 1ESFA 5CMDA 2PW5A 2AQ3B 4KY7A 5C4JB 1I6VC 1WTOA 1QJOA 1I3QB 3KBXA 2PMZB 2RQXA 1PZKD 4FNFA 2A68C 2KQ3A 3L3OC 1MD2D 5JPNC 2XIWA 2X6LA 1CQVA 1RTNA 1JOKA 4IQZA 1Y8NB 1WD1A 3IKJA 1LT5D 4EQNA 4EQPA 1VCIA 2F3VA 4ABNA 2XSCA 1O7YA 2G9DA 5EKLA 3H91A 5K36G 2B8FA 5CR3A 3NBIA 1D6EC 2E2IB 3I73A 2NVYB 3SK5A 1H9SA 1LT6D 3JAML 3D4DA 2PZWA 4FXKC 1JQYD 4HR7B 2F0KA 3M4OB 4Z9CB 4A3IB 3D4WA 5EQ0A 1KLUD 4ZKCB 1IYVA 1GHJA 4RA8A 2PO4A 2TMPA 1SYCA 1PRTC 1EY7A 3SE0A 4C3HG 4OHJA 1M8AA 5A2QE 4RAUC 3OWFA 3PUVA 1TT2A 1X3QA 2V4DA 3Q6SA 4Q0FA 1V1OA 4HCEA 1B44D 2K04A 5C4HA 5EGTA 2F3WA 3IAYA 2NYZD 4C3IB 4DA2A 1B9NA 3I4MB 4DGZA 1Z6HA 2BE5D 5CV5A 2CQAA 1V1PA 1DOKA 3LNNA 1DM0B 2NB0A 4ODGA 4CHTB 3MXUA 1KNAA 2GA4B 1L0XB 4QIWB 2VUMB 3HRZC 1WD0A 1IKLA 2M2LA 2EY5A 1SFOB 3KK7A 1TS3A 5JEAG 4RFBA 2K28A 1STEA 5J1ZA 3S15B 1BUVT 2FINB 5HURA 5JVH3 1WTWA 1GUWA 2VB3X 4WRDA 1VDZA 3EQLC 2KOLA 2JA8B 4QMGA 1BDOA 1BO0A 3KF8A 1ONLA 3G7LA 3HOXB 3FKIB 2HCIA 3MZ5A 2QDBA 1OXVA 1PFMA 4XQNA 5KNBA 5CC4A 2L9HA 3K5OA 1EIGA 4RKBA 1D1KA 4U673 5DM73 1VF5C 3JAME 5IGFA 1QE6A 3S1QB 1JCKB 3FDTA 5LHY1 3QB3A 5FLXL 1XWEA 3OMCA 4A3DB 3SEBA 3QG1A 2RKSA 1FGBD 1G8ZD 5D14A 1S5BD 3BVGA 5IGBA 4PQXA 4HSPA 3QOLA 1NAPA 4XDXA 1I4QA 5M5WB 1SNOA 2L1BA 4ZQ3A 4OIJA 1DYQA 3BYTB 3P20A 3GP7A 1F9RA 1H9SB 1YNJD 1PTOC 2NVTB 3CU7A 5JOBA 4DK0A 4RKLA 3X3NA 3TBIB 3K57A 2A68D 1A6XA 1PRTF 1X32A 2SNMA 1G91A 3EA6A 4KI0A 2M00A 1BCPB 4IFDI 3ONAB 1SAPA 1RKNA 1SNDA 4CKEA 3CRLC 3OHXC 3EVQA 3M85A 4IUTA 2ICIA 2F0JA 4IZ8A 4PV1C 3K0YA 3GTKB 2Q8IB 4G57A 3GTQB 5IGEA 4RH6A 3IFTA 2B2WC 4RGTA 3K58A 4J8QA 5C0XH 5I2YA 2F0QA 5J39A 3K5LA 2IJ0A 4ZUJA 1ZKOA 1EEID 1KABA 5ISRA 3BZDB 2XWBB 3MXPA 4IUPA 1PDQA 3K5MA 5D3IB 1F2ZA 1PRTD 3GTGB 4HMIA 3L9AX 2R6GA 3VR4A 1AEXA 5DEHA 4RCOA 4RGOS 3TZDA 2WACA 3ND8A 1TY0A 4B9WA 2YYZA 3BS1A 4V0BA 3FEWX 4KD3A 5FLXE 1S5ED 2NUCA 3W2DA 1DZ1A 4K5XA 3NHHA 4QB4A 3E5SA 2I46A 2PNRC 1PTOH 2QILA 4FF4A 2JEAI 3ERQA 1SYGA 2CVRA 2NBFA 3BVZA 2XWJB 4X3UA 4QCLA 4EVOA 4KK7A 3DMUA 4KHZA 3MEHA 4FXDA 5KEEA 2RDGA 2WAQB 2HDLA 4CBVA 1VMCA 2JE6I 3NSWA 1TQOA 4OO1I 1PTOF 4RWSC 3R2TA 4ZYSA 3H0GB 5IODA 1SBBB 4CJ0B 3C1EA 3NP8A 3NUCA 2BA0A 3H6MA 2SDFA 2F0WA 1EYCA 1QOHA 1QNUA 1D5ZC 1SXTA 2XRQD 1CT1D 2JXMB 3C2PA 3QWNA 1ML0D 2WB1B 2L55A 5C6AA 5JEAJ 3D31A 4CKCA 2E76C 1PTOB 4XTCS 2DNEA 3NQIA 1SMYD 3OMGA 2IL8A 1UAPA 1OXTA 1SEBD 2Q8TA 3S1RB 5ELDA 1I6HB 1EY4A 1SNPA 1STBA 5C44B 5D65A 2F0VA 4XQJA 5KYLA 2J4XA 3S16B 3E6ZX 3VR6A 2VNUD 1CHPD 1U4LA 1PFNA 2SOBA 1PTOD 1PXUA 2AUKA 1Y8OB 1WTVA 1CK1A 2PQEA 1C8CA 1HQMC 3NTKA 5FO9B 3PMFA 3S2HB 1HPCA 4KD4A 1SE3A 2IPKD 4C56C 3VYRA 3Q22A 1DONA 3VYTA 1YNNC 2F0LA 1OO9B 3DWQA 4XQQA 1SJED 4LK1C 2PYKA 3GV6A 5M3FB 3S17B 1E2VA 2B2VC 2WKCA 1T5EA 4WJWA 3MWYW 1PFBA 4PMBA 1STNA 4IFDG 1RD9D 2PZTA 3BDOA 3VR3A 1Q1BA 2X69A 1LTAD 4AYBB 4XXEA 2PPBC 1LTBD 1I4GA 1LTSD 1RODA 1ZYRC 2K05A 3MC0B 1JICA 1KDCA 4DAVA 4K14A 4IALA 5EKKA 2C5CA 1A3UA 1FR3A 2A74C 3RMHA 5BN3A 4XT1B 4KY6A 2A6EC 2E2JB 1MSHA 3T53B 2EOTA 1QCBD 2B2UA 5G3LF 1HHVA 2F0UA 1TS5A 1LLRD 1DXMA 5ELEA 2KVMA 3I8ZA 3FRPB 2R3ZA 3PUWA 1S5CD 4WORA 3DEOA 3G6JB 4K5WA 1SYFA 2R61A 4I65A 3LWUA 2MHVA 1B2TA 1CA5A 1QILA 2MP1A 2OF1A 2J0TD 1ESRA 5K5PA 1B3AA 3DUZA 4DK1A 5I6YA 2F03A 2BOSA 2JEBI 3NK9A 4CJ2C 1O80A 3NTIA 3A8KE 2WINB 3SK8A 1QB5D 4C3IG 2NVXB 2OEOA 1O7ZA 4BY7B 2N55A 2Y0SB 2ZXOA 1WCMB 3DM1A 5CV8A 4DFAA 5C3WA 4F8MA 1PMRA 4QUCA 2K5WA 1KLGD 1ZEQX 2QCPX 3FVQA 5I9OA 5LL6X 2EJGC 3CKIB 3T51B 2F0GA 2IX0A 1JOQA 5I9PA 3T4AC 4FF1A 4C3JB 1D5XC 1Y8PB 3WDNA 1DJRD 1OXUA 2KUMA 4OO1G 5CBAE 5I6WA 3OSOA 2NN6I 2AQ1B 4H13C 1LT4D 1EY5A 4P2CB 4YIJA 4A3KB 4KKTA 2D62A 1SYBA 1BR9A 2HQEA 2F0OA 4KN4C 4IUVA 1B1ZA 2KJXA 3GV3A 1IW7C 1WTXA 1J9OA 4OIKA 1SJHD 4ZRZA 1Y1WB 1Q1EA 4RHSA 2KEDA 3L7ZC 5I2XA 3A56A 5K36H 1Z47A 5CV4A 2JA6B 3K59A 1NSNS 3TZUA 1ZXTA 1YNND 2Z4IA 4FP5D 1SNQA 5M9OA 5JAVA 1UUPA 3OW7A 1ILPA 2CHBD 1JOOA 4DN4M 1EY6A 5C3XA 3OWEB 2G9HD 1GJXA 2EDGA 2RSNA 3VYUA 1U9RA 4HEDA 1DOLA 3GQBA 4XIGS 4ULLA 5AFWA 3EFXD 3AMUA 1SSOA 1G2TA 3NBHA 2JSOA 4FF2A 1PYWD 3I4NB 1H9KA 4KJNA 1V8QA 1TWGB 3SHLA 2M9VA 2A6ED 4K2KA 3HG9A 4K2LA 3PUYA 1JC7A 2EYJA 2Q8RE 4C1NK 5C3EB 2E2DC 1TWAB 1BXTA 3SVMA 4G7OC 3KLSA 3HOYB 1LTRD 3J7AV 4IFDJ 1F2LA 3ND9A 1A2UA 2B8GA 5JEAH 4A93B 1DCZA 1U4PA 3RD4A 2Z8LA 3C46A 4O1NA 2RVLA 4KHVA 5EBDA 5E1FA 4DNTB 1T5XD 4XYQA 1JE4A 3VR5A 1BBXC 2R93B 1F9PA 2WP8J 3HS0C 3TP6A 2A6HC 1XXGA 1XYIA 3DHQA 2B2YC 5KGUA 3K7AB 1HUNA 1R4QB 2EYOA 2QEJC 2F0PA 1JWSD 1X3PA 1GHKA 1II3A 4K8JA 2R92B 2NVQB 5EKIA 3S9WA 3S1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QG7 A;  1DOL A;  1PFM A;  2BDN A;  4LMQ D;  4HAE A;  2X69 A;  3D6W A;  1ICW A;  2HUG A;  5AFW A;  3HP3 A;  2NWG A;  5EPJ A;  1WTR A;  2FMM A;  2HCC A;  1SSO A;  1MGS A;  1AZP A;  2L9H A;  4X3K A;  1ML0 D;  1MSG A;  1TVX A;  1G2T A;  1EIG A;  5E4W C;  4U68 A;  1ROD A;  5DNF A;  1VMP A;  5EQ0 A;  2K05 A;  4ZKC B;  1JIC A;  1CM9 A;  4IUU A;  1U4M A;  3P7J A;  1QE6 A;  3MTS A;  3R93 A;  2H1E A;  1NR4 A;  3I3C A;  5CBE E;  3FDT A;  4ZKB B;  2FFK B;  4R8I A;  1WTQ A;  4IUP A;  1PDQ A;  4RA8 A;  1WTP A;  2KUM A;  2L12 A;  5CBA E;  4QUF A;  4XT1 B;  5EPK A;  1F9Q A;  1RTO A;  1B50 A;  1MSH A;  4X3S A;  3I90 A;  2B2Y A;  2K03 A;  3TZD A;  3UI2 A;  2IL8 A;  1M8A A;  2EOT A;  1J8I A;  4HSV A;  1HFN A;  1NCV A;  1MI2 A;  2KEE A;  2Q8T A;  2B2U A;  1F9S A;  5D14 A;  3I91 A;  1RJT A;  4RAU C;  2Q8R E;  2N88 A;  5JJZ A;  1EIH A;  2B2V A;  1CA6 A;  1G2S A;  5D65 A;  3QO2 A;  2D9U A;  3TN2 A;  5EPL A;  3SVM A;  1NAP A;  1X3Q A;  4XT3 B;  5CMD A;  1WVL A;  1DZ1 A;  1HHV A;  2B2W A;  4XDX A;  3Q6S A;  2FJ2 A;  2L1B A;  1EOT A;  4CJ1 B;  4IUV A;  2B2T A;  1F2L A;  2KVM A;  2K04 A;  3GV3 A;  3I8Z A;  4OIJ A;  1SDF A;  2R3Z A;  1WTX A;  1J9O A;  1U4L A;  2EE1 A;  1PFN A;  2JYO A;  2K01 A;  1F9R A;  2NYZ D;  4OIK A;  1E0B A;  5COY A;  1Q3L A;  3DEO A;  3IFD A;  5COR A;  1IKM A;  3KBX A;  1U4P A;  1HUM A;  4NW2 A;  2EPB A;  1WTV A;  1S4Z A;  1RHP A;  1DOK A;  1C8C A;  1PLF A;  2KED A;  3N52 A;  2CVR A;  4O42 A;  2RVL A;  1B2T A;  1CA5 A;  4X3T A;  2DY7 A;  4X3U A;  2MP1 A;  1KNA A;  1U4R A;  4ZLT F;  2J7Z A;  1X32 A;  1B53 A;  4HCS A;  2MPM A;  2XIW A;  5EJW A;  2X6L A;  1WTO A;  1DOM A;  1JE4 A;  1ESR A;  1G91 A;  4MHE A;  1WD0 A;  1B3A A;  3DEP A;  3ONA B;  1SAP A;  1BBX C;  1IKL A;  2M2L A;  1DON A;  1EL0 A;  1RTN A;  1EQT A;  2DY8 A;  1ZXT A;  1F9P A;  1WD1 A;  4CJ2 C;  3IL8 A;  1O80 A;  1HRJ A;  1KNE A;  1LV9 A;  1NR2 A;  4IUT A;  2K28 A;  5T1G A;  1XYI A;  1HFG A;  5E4X A;  1HA6 A;  2VXW A;  3F2U A;  5T1I A;  4R9W A;  1O7Y A;  2HDL A;  3KUP A;  1VMC A;  1O7Z A;  2NZ1 D;  3H91 A;  1AP0 A;  3LWE A;  1ILP A;  2RA4 A;  2B2Y C;  1G6Z A;  3GV6 A;  2N55 A;  4DN4 M;  1HUN A;  2L11 A;  4ZAI A;  1AZQ A;  2FIN B;  1WTW A;  1ILQ A;  2B2U C;  2K1B A;  1QNK A;  1IL8 A;  2RSO A;  3DM1 A;  1A15 A;  4MN3 A;  1GUW A;  1BF4 A;  2KEC A;  1B4O A;  2HDM A;  2B2V C;  2KOL A;  2MJ8 A;  3FPU B;  4RWS C;  1X3P A;  2X6G A;  4IUR A;  4QUC A;  1BO0 A;  2RSN A;  4ZK9 B;  2FHT A;  4CJ0 B;  2JP1 A;  5EKI A;  3G7L A;  3MWY W;  1XX8 A;  4UAI A;  2B2W C;  1PFB A;  2SDF A;  1BNZ A;  4IUQ A;  2MGS A;  2B2T C;  4HED A;  2L4N A;  2HCI A; 
#chains in the Genus database with same CATH topology
 3CHB D;  5EPJ A;  3R8B A;  2PQA A;  2XNA C;  4K8I A;  3RLF A;  1E2Z A;  4A3B G;  1RDP D;  5DNF A;  1PV4 A;  2O5I C;  1XTD A;  3NEN A;  2N49 A;  1VQE A;  3H94 A;  3V05 A;  2H1E A;  1N33 Q;  4DR3 Q;  2P5Z X;  4R8I A;  1PRT B;  3K5N A;  3H0G G;  3GTO H;  1VQ4 A;  5ELN A;  1K83 H;  3NWT A;  1Z7T A;  5EPK A;  3TQY A;  1QUQ B;  1HFN A;  1VQM A;  2B63 H;  3E3X A;  4E6I A;  1XMO Q;  2K33 A;  1EIH A;  2F0E A;  3CCV A;  4A3M H;  1CA6 A;  1E7Z A;  5CGK A;  1CFM A;  1BBW A;  3PO3 H;  1WVL A;  2B2W A;  2BA1 A;  2F0H A;  1HXY D;  2WV6 D;  1K3R A;  4X64 Q;  1SDF A;  2IX1 A;  1RCV D;  1VQ8 A;  4FVM A;  4B3R Q;  2JYO A;  1FJG Q;  1Q3L A;  4KHP L;  5LL6 S;  4IJL A;  2EYF A;  1V9P A;  4GN3 B;  3M7N A;  3T13 A;  1S4Z A;  1R9T H;  1Q7Y C;  2PI2 A;  1PLF A;  4ME5 A;  3PIP 3;  1TWF H;  4O42 A;  2NN6 G;  2BCO A;  3N6R A;  4YCU A;  5HGT A;  3NBH B;  4ZLT F;  1CI3 M;  2L0C A;  3NQT A;  2H4O A;  1DOM A;  4MHE A;  2KHI A;  1S5F D;  2ZTE A;  3DEP A;  4IN3 A;  4LJZ C;  3CCQ A;  5TSS A;  5IT9 c;  1YJN A;  2E74 C;  2NZH A;  4A3L H;  1LTT D;  1MJE A;  1VQH A;  1X65 A;  3K7U C;  3RZD H;  1KHI A;  4X65 L;  5ELF A;  4FXG C;  4A75 A;  1O7I A;  3K8A A;  1W2B A;  2K5H A;  1PZI D;  2N8N A;  1HZ9 A;  2F0S A;  3AU7 A;  1EYG A;  1G6Z A;  1I4P A;  4JI0 Q;  3K0X A;  2Z1C A;  3GTO B;  4DV7 Q;  5KNC A;  1K83 B;  2KEC A;  2HDM A;  2L5T A;  4JK1 C;  2YU9 B;  3V2T A;  2FHT A;  2JP1 A;  1Y69 U;  2K7V A;  1TS4 A;  3ERS X;  1ENA A;  2K5D A;  3I4O A;  1Q90 A;  2YV5 A;  4EQ5 A;  1R4P B;  2B2T C;  4A3C G;  5GAG C;  1GUT A;  4A3M B;  2NTT A;  3MFY A;  1N33 L;  1PZJ D;  1WTR A;  1Q8I A;  3PO3 B;  1MGS A;  1WJJ A;  4B3S Q;  3HOZ H;  2IX3 A;  4S3S A;  5M3F G;  4DV4 Q;  3RUZ A;  4A3E B;  3AEV A;  1EY9 A;  4DR2 Q;  4NPS A;  1F77 A;  1R9T B;  1JMC A;  3NE5 B;  2A73 B;  1TWF B;  3PQI A;  3KLS X;  3W5O A;  3SXH A;  4DAP A;  4DNI A;  5FOB B;  4L8J A;  1NUC A;  4J1M A;  4AYB G;  1STG A;  1RJT A;  1FJG L;  4L5T A;  2LMC B;  3KF6 A;  1AN8 A;  2D9U A;  3RZD B;  1A2T A;  1EOT A;  3HOV H;  3HKZ E;  5COY A;  3I4L A;  4B08 A;  4QF4 A;  4KJO A;  4G7H C;  4HN7 A;  2PZU A;  4R8N A;  4B9X A;  2JA5 H;  2EJM A;  4DK3 C;  1FYC A;  3MA2 B;  1JB3 A;  2PQA B;  5JJI A;  4GLV B;  4DV6 Q;  2J7Z A;  4HCS A;  3E9H A;  4HMJ A;  2R7D A;  1E1T A;  3BZC A;  3I70 A;  3MEF A;  4JI0 L;  1F2Y A;  2SNS A;  2A6H D;  1EOV A;  1HFG A;  4G4K A;  2R7Z H;  4QQB X;  3HOZ B;  1JWU D;  5T1I A;  1KAA A;  1SNM A;  4KMU C;  3QOJ A;  3QR8 A;  1RL2 A;  1JJG A;  1UEA B;  1FNW A;  2ALY B;  4GNX A;  1TR5 A;  2L11 A;  2PMZ E;  5FO8 B;  5KIX A;  1AZQ A;  3MAQ A;  2RSO A;  1QNK A;  2RCF A;  3I2Z A;  1Q12 A;  4MN3 A;  3FPU B;  3URY A;  3BJU A;  1NBW A;  4GN5 A;  2A5H A;  4IOC A;  1EEF D;  2IWH A;  1IBK Q;  4B3S L;  5M3M H;  3R2I A;  1BVS A;  4R1J A;  2EYH A;  1HTL D;  2BDN A;  4YWM A;  4V19 0;  3DWP A;  2MNA A;  4DR2 L;  4IUN A;  5KYI A;  1XNQ Q;  2TSS A;  3A5U A;  3STB C;  3T16 A;  3GO5 A;  3HOV B;  4HJA A;  1SN8 A;  4P71 A;  4BY7 G;  5AJ3 Q;  4M8A A;  1EYD A;  1JB7 A;  4DU9 A;  2KHS A;  2Y0S G;  5DLQ E;  1NR4 A;  5CBE E;  4JI7 Q;  3BDL A;  5IYC G;  2F1M A;  2C35 B;  1KD1 C;  3HOW H;  2BE5 C;  3MXG A;  5NUC A;  1K8M A;  5CV9 A;  1K9M C;  1GUN A;  1I4X A;  1E2W A;  1O7L A;  2EXZ A;  1SE2 A;  1EIF A;  4X3S A;  3TME A;  1SYD A;  1TII D;  4ID6 A;  1PH6 A;  1Q8K A;  4F87 A;  1F9S A;  2I5H A;  1SYE A;  1HR0 Q;  2N88 A;  4N9P A;  2B2V A;  5BR8 L;  1Y14 B;  3LX0 A;  4K5V A;  4K0K Q;  1VQL A;  4XT3 B;  2KCM A;  2O4X A;  1PA6 A;  3GTP H;  2R7Z B;  2LSS A;  3KFU A;  4C3J G;  3PUZ A;  2EY2 A;  4DV6 L;  2NZO A;  3IFD A;  1HUM A;  4TQU S;  4PMC A;  5KND A;  2CQO A;  2ZXR A;  1STY A;  4RGN A;  5D3D A;  1EQV A;  4HIM A;  2EQS A;  3H3V C;  5M3M B;  4TRD A;  1VQ9 A;  4UDU C;  1VQA A;  1K0S A;  4A3I G;  4CDE C;  2QF7 A;  4ILW A;  3S14 B;  1EQT A;  4UHV A;  2UXC Q;  1NR2 A;  4JI5 Q;  5EAY A;  4LF7 Q;  3ZYY X;  2ICE C;  3W1B A;  4IFD H;  2QKI C;  1EFW A;  2RDH A;  1IBK L;  4K6L A;  1K73 C;  3MVV A;  5J3B A;  1C4Q A;  1E22 A;  1EY8 A;  1G51 A;  3D6C A;  2K1B A;  5KRU A;  3HOW B;  4OXP A;  3KF6 B;  5C0X I;  3CPW A;  3F2B A;  4N9T A;  2JA6 G;  3PIO 3;  3V96 A;  4DXG A;  4A3F H;  2A69 C;  3A55 A;  4KV6 A;  4QIW E;  4IUQ A;  2MGS A;  5AJ3 L;  2E2I H;  1LTG D;  3CRK C;  1TKW B;  4A76 A;  3I4M G;  2NVY H;  2O5J C;  2DNC A;  4G7Z C;  3J80 L;  1EWC A;  3FPP A;  1S5D D;  2HCC A;  2OTL A;  3GTP B;  4BWG B;  1E3P A;  2JQO A;  4IJH A;  1CHQ D;  3KDF A;  5IIF A;  2D2C C;  1M90 C;  3MTS A;  5FKA C;  2LKV A;  4J6H A;  1AW7 A;  1Y1V H;  2FFK B;  3ULL A;  4DAY A;  5ELC A;  1LTI D;  2K14 A;  3K6O A;  1YNJ C;  1ASY A;  1BQQ T;  1D5M C;  2UUA L;  5G3L D;  4K0K L;  1KXL A;  1KRS A;  1NMG A;  2Z6K A;  2K03 A;  3UI2 A;  4GOP A;  1WI5 A;  3X3M A;  4IPD A;  4NDX A;  4LFC Q;  1NCV A;  1C48 A;  2EIF A;  2N78 A;  2F0T A;  4JI8 L;  4GNX B;  3OW2 A;  1WTH A;  4HJ7 A;  3TN2 A;  2A8V A;  1TY2 A;  3KLR A;  1LT3 D;  3RN5 A;  5IOC A;  5LMU Q;  4CJ1 B;  3CC7 A;  3FMC A;  4LF6 Q;  4BBR H;  1D1I A;  1AH9 A;  1PH1 A;  1EWH A;  4NW2 A;  1L0Y B;  5C4X H;  4L63 B;  4TSS A;  1CQF A;  3WOE A;  3CXC A;  3Q0A A;  2UXC L;  1G29 1;  1LAC A;  4JI5 L;  1RF2 D;  1N34 Q;  4N8X 1;  4A3F B;  1OTC A;  2IY5 B;  2XRS D;  3KLW A;  3F2C A;  5C3E G;  3HOU H;  1BCP C;  4C1N I;  3GTL H;  5GRO A;  3HOY G;  3IL8 A;  1Q82 C;  1KNE A;  3A8I E;  2UUC Q;  2YTV A;  2EY1 A;  2LS0 1;  3P1H A;  1X6O A;  5E4X A;  1LM0 A;  2CW0 C;  2ASB A;  4A93 G;  3LWE A;  2RA4 A;  1GUG A;  1Y1V B;  4JV5 Q;  4FYD A;  4KY5 A;  5FJ8 G;  1ILQ A;  2K4K A;  1IHZ A;  1LAB A;  1W6K A;  2EYP A;  1A3T A;  2X6G A;  3NXW A;  1WFQ A;  2LFN A;  2F0M A;  5BN5 A;  4BS9 A;  4BXX G;  4OO1 H;  4OEL B;  5IP7 H;  2FXQ A;  4LMQ D;  2EYL A;  2B39 A;  2ZT9 C;  4Y7N H;  4NMZ A;  3FKI H;  3STB D;  1JR0 D;  1B3Q A;  5IYB G;  3HZX A;  1D2B A;  1MSG A;  2E8G A;  1TVX A;  3H09 A;  1FD7 D;  1NY4 A;  4BBR B;  3U9S A;  4IUU A;  3L2P A;  2ZXP A;  4OGQ C;  1XPU A;  4LFC L;  4ZKB B;  1X3E A;  5C4X B;  2PW7 A;  3OOC A;  1GOZ A;  1KDB A;  2L12 A;  3J80 E;  1N32 Q;  1HA5 A;  2R7F A;  4CGY B;  2XGT A;  5E3F A;  1XPO A;  3I90 A;  4CKB A;  2KCN A;  5LMU L;  4HSV A;  5JPM C;  4C3H H;  4LF6 L;  1H9M A;  2SEB D;  1MI2 A;  3VYS A;  3HOU B;  4AIM A;  2AUJ D;  4APV A;  1XNR Q;  1A63 A;  1L1O C;  3GTL B;  4CDC C;  5J22 A;  5C4Z A;  2F4I A;  1ZYR D;  1YHA A;  4MIU A;  4HIK A;  2BDO A;  2D5D A;  3K80 C;  4DV5 L;  1YI2 A;  4RHR A;  4OON A;  3CCS A;  1N34 L;  2K01 A;  4GN4 B;  2WII B;  3NTH A;  1IKM A;  1A3V A;  1XPR A;  3RNU A;  2UUC L;  1YIJ A;  4JG2 A;  3WOF A;  2C9O A;  2UXB L;  2K5Q A;  3KDF B;  3U58 A;  1VQD A;  1DD2 A;  1KQS A;  3ITP A;  1TWC H;  1JWM D;  5CYU A;  2RDF A;  1VQO A;  2OQK A;  3TP5 A;  4Y7N B;  1HCZ A;  1M1K C;  4DAY B;  1MIU A;  5IP9 G;  1VQC A;  5T1G A;  1XJV A;  1BOS A;  1K8O A;  1HA6 A;  2VXW A;  4GOP B;  2LY7 A;  2UUB Q;  3RZO H;  3WWV A;  1EUJ A;  2ZJR A;  3BVM A;  1IL8 A;  3BDC A;  1NMF A;  3GD7 A;  2F0I A;  4JVZ A;  2I07 B;  4A3G H;  3BG3 A;  4LUO A;  4UAI A;  2A69 D;  2KHJ A;  1X3G A;  4DV3 Q;  4C3H B;  4PZ7 A;  1SMY C;  1QG7 A;  2E75 C;  5JVG 3;  1XMQ L;  4RCN A;  2HUG A;  2I5L X;  3HP3 A;  1YBY A;  1CTM A;  2NWG A;  4P72 A;  4X3K A;  1TWH H;  1BCP F;  2XN9 C;  3M3Y B;  1O78 A;  1JOR A;  1VMP A;  2F0F A;  2Z4H A;  2WAQ E;  1K28 A;  4PG3 A;  1U4M A;  2G5D A;  1HQR D;  3I3C A;  1FNU A;  4BY1 H;  1OXS C;  4A4I A;  1XNR L;  5DAU A;  4DUZ Q;  1F2M A;  2VB2 X;  5C0X G;  3MFG A;  2O2L D;  4DK6 C;  2OTJ A;  3KBG A;  3EN2 A;  2E2H H;  1QVG A;  5M5X H;  3PO2 H;  4LFB Q;  2B2Y A;  2WKD A;  1HH2 P;  4JBM A;  3S2D H;  1TWC B;  1N36 Q;  3I91 A;  2WAQ G;  1A8V A;  1STH A;  1H9J A;  1BKB A;  4H44 C;  3SR1 A;  3RN2 A;  1IYJ B;  3MHB A;  3SDZ A;  1WYD A;  4ZUI A;  4A3E G;  2WB1 E;  2GVB A;  2EE1 A;  1LO5 D;  3RZO B;  4PNY A;  1KDA A;  3J80 i;  4BBS H;  5COR A;  4EQO A;  4KKS A;  2OT2 A;  1NJI C;  2EPB A;  1TU2 B;  3W3A A;  3SK6 A;  1RHP A;  1STA A;  3N52 A;  3OYY A;  4WJ3 M;  2DY7 A;  4A3G B;  2HIX A;  1EY0 A;  5EJW A;  5I4D A;  3C1F A;  2WB1 G;  1EL0 A;  2DY8 A;  2D0P A;  1BCP D;  2BH8 A;  1LV9 A;  1IW7 D;  1H9R A;  3TDQ A;  1FNV A;  1TWH B;  1VF7 A;  1VQP A;  1I4H A;  1V1P B;  2CW0 D;  4PMW A;  1ASZ A;  3QIA A;  2NZ1 D;  4NKL A;  5GAD C;  1AP0 A;  4DV3 L;  2JA7 H;  4BY1 B;  4ZAI A;  4DPG A;  2UU9 Q;  2RCN A;  5GAH C;  3A54 A;  3G48 A;  4A3B H;  1X56 A;  4R4O A;  1UEB A;  3SK4 A;  3OTO Q;  5IWA Q;  3J81 j;  3D3R A;  1B4O A;  3ULJ A;  1PH9 A;  2E2H B;  5M5X B;  3PO2 B;  5C44 G;  3T56 B;  1YNX A;  1K3B C;  1H95 A;  1PH7 A;  3R3O A;  3D8G A;  3A8J E;  1BNZ A;  1G6P A;  3P75 A;  3S2D B;  3P7J A;  1EFI D;  1ICW A;  4K6D A;  3VR2 A;  1JT8 A;  3OIQ A;  2AWO A;  4DUZ L;  1VQI A;  4U68 A;  2B3G A;  3A7A B;  1N9W A;  4BBS B;  1KTK A;  1GUS A;  1HNX Q;  4MTN A;  3I72 A;  1N36 L;  3M4Y A;  5CV6 A;  3QJY A;  2CWA A;  3OIP A;  2GN5 A;  5FO7 B;  5ELO A;  2JK8 A;  2B63 B;  3L0O A;  1F9Q A;  2IT1 A;  4CDF C;  4TVA B;  3BZK A;  2DN8 A;  4DR3 L;  1J8I A;  1CSP A;  4LWC A;  2KEE A;  3J7A F;  5A35 A;  4H0L C;  3EJI A;  2NN6 H;  2XVS A;  4BA1 I;  1YVC A;  4AYB E;  3QO2 A;  1AE3 A;  3A0J A;  3GTJ H;  3OPO A;  3Q23 A;  2EZV A;  4GKK Q;  1I6H H;  2FJ2 A;  1CZG A;  2B2T A;  4HTH A;  4NP5 A;  4JYA Q;  3NWS A;  2FMC A;  1XMO L;  2Q2I A;  2EY6 A;  2VZA A;  1CKO A;  2EJF C;  3M7G A;  2JA7 B;  2EVB A;  2EYM A;  2PCF B;  4A3B B;  4EX5 A;  1N8R C;  2F0N A;  4DXF A;  1AFP A;  4OEM B;  4X64 L;  1LYL A;  2ZTD A;  2ZTC A;  4B3R L;  1U4R A;  1OXX K;  1LUZ A;  4XYO A;  1B53 A;  5CV7 A;  1TXY A;  5HGQ A;  4FO2 A;  1UWV A;  2CKZ B;  4QL5 A;  2IW3 A;  3DXJ C;  2UU9 L;  4IPG A;  4LNQ A;  5GAE C;  3OTO L;  3NPP A;  5IWA L;  5EBC A;  1I50 H;  3F2U A;  4R9W A;  4H7B A;  2DUD A;  5C5L A;  3AB9 A;  5IT9 L;  4WFN 3;  3HEJ A;  5IGD A;  3SGI A;  1A15 A;  1BF4 A;  4MNO A;  1ENC A;  4OWX B;  3J81 L;  4C2M H;  1YJ9 A;  3CCJ A;  4JBW A;  3VA5 A;  5HY6 A;  4DV7 L;  3PIP A;  2IHE A;  4HAE A;  3TSS A;  5IGG A;  3D6W A;  1J5E Q;  1HNX L;  3GTJ B;  4A3J H;  2HT1 A;  1PH8 A;  5E4W C;  4GZY C;  1C0A A;  3DM3 A;  5F2D A;  1KIX A;  4B3T Q;  1ET6 A;  3RR5 A;  5IY0 A;  1CM9 A;  2F0D A;  5FK9 C;  1EU4 A;  3HOW G;  1CKM A;  3NEM A;  4FF3 A;  3J7A 5;  1WTQ A;  4M1U B;  2NTS A;  2Y0S E;  1PVO A;  2RBM A;  4OX9 Q;  2CH4 W;  4DF7 A;  1M4V A;  1RTO A;  1UNS A;  1B50 A;  4DV4 L;  4LFA Q;  3U9O A;  3ERO A;  4LAA A;  1EZ6 A;  3GTM H;  4JYA L;  3S1N H;  1SRO A;  4GKJ Q;  5JJZ A;  2RF4 A;  4JBJ A;  1NNX A;  2KA7 A;  1I4R A;  3E0J A;  3C3L A;  5EPL A;  3TS2 A;  1WCM G;  1I50 B;  4KKU A;  2ID0 A;  1UE6 A;  2JA5 B;  3CQZ H;  3PV0 A;  1SMX A;  4I7Z C;  1B9M A;  3AFP A;  4HJ9 A;  2CFM A;  1E0B A;  1VQB A;  1EZ8 A;  2VS1 A;  1EIY B;  1SNC A;  4Q5V A;  4BA2 I;  4X3T A;  4C2M B;  1W6J A;  4F7X A;  5M5Y H;  1CZW A;  1ENF A;  2Z9H A;  3PUX A;  2K6A A;  2MPM A;  3D4R A;  2LXJ A;  4TKO B;  1MBY A;  2B29 A;  5C0X J;  4OL7 A;  4DV0 Q;  1HTP A;  1HRJ A;  5IGC A;  4KTA A;  4A3J B;  5C4J H;  3MXN A;  5DM6 3;  1EYA A;  3KUP A;  5ELB A;  1KAW A;  4Y52 H;  4UPA A;  2KCC A;  2MUY A;  1I3Q H;  3HGB A;  1FGU A;  1GXD C;  2AWN A;  1EU3 A;  2B2U C;  4A3K G;  1B8A A;  4A3F G;  2MJ8 A;  2OXP A;  4LF9 Q;  4IUR A;  4ZK9 B;  1XX8 A;  3J7Y W;  5BN4 A;  1EQR A;  5IT9 E;  4B3T L;  4QJF A;  3GTM B;  5IYC H;  3S1N B;  2L4N A;  1V43 A;  4DR6 Q;  4L6T B;  4F88 A;  1Y1W G;  1SR3 A;  1CKN A;  4GLA C;  1GUO A;  3BYY B;  3NEL A;  4EGV A;  4KN7 C;  2FMM A;  2F52 A;  3J81 E;  1AZP A;  5IYD H;  1TS2 A;  3Q24 A;  3O13 A;  3HKZ B;  5FLM G;  4OX9 L;  3CQZ B;  3TP8 A;  1PHJ A;  4DNR B;  4AQY Q;  2AQ2 B;  4LFA L;  1SE4 A;  3R93 A;  5A2Q L;  4ALP A;  1XNQ L;  3VA7 A;  1WTP A;  4GKJ L;  3A7L A;  4QUF A;  4DV1 Q;  3PGZ A;  1ET9 A;  1QWY A;  5M5Y B;  3TP7 A;  1IYU A;  5L37 A;  3U50 C;  4JI7 L;  2KEN A;  5C5M A;  1HR0 W;  2ENB A;  1XTC D;  3UDX A;  3CCU A;  2K32 A;  3CPF A;  1G2S A;  1B70 B;  3DWA A;  3M4Q A;  4RGM A;  1ESF A;  5CMD A;  2PW5 A;  2AQ3 B;  3M4O H;  1Z9F A;  4KY7 A;  5C4J B;  4A3I H;  3EIV A;  3H15 A;  3KJO A;  1VS0 A;  1I6V C;  1WTO A;  1HR0 L;  1QJO A;  1PH4 A;  1I3Q B;  3KBX A;  2PMZ B;  2RQX A;  1PYS B;  2MFI A;  1PZK D;  4FNF A;  4DR5 Q;  2A68 C;  2KQ3 A;  3L3O C;  4DV0 L;  1MD2 D;  5JPN C;  2XIW A;  2X6L A;  4YHH Q;  1CQV A;  4DR1 Q;  2E5L Q;  1RTN A;  1JOK A;  4IQZ A;  1Y8N B;  1WD1 A;  3IKJ A;  4KLK A;  1LT5 D;  3RLO A;  3I4N G;  4EQN A;  2JA9 A;  1HNW Q;  4EQP A;  1VCI A;  2F3V A;  4ABN A;  1I94 Q;  4LF9 L;  2XSC A;  1O7Y A;  3LGJ A;  2G9D A;  5EKL A;  3H91 A;  4C3I H;  3I4M H;  4YY3 Q;  2I5M X;  5K36 G;  1U0L A;  2B8F A;  4LF7 L;  5CR3 A;  3NBI A;  1D6E C;  4N8F A;  2E2I B;  2VQE Q;  3E9I A;  3I73 A;  3H3V H;  4LF4 Q;  4X66 Q;  5JJK A;  5IP7 G;  2DJF C;  2NVY B;  3SK5 A;  1H9S A;  2VUM H;  1LT6 D;  3JAM L;  2H5X A;  3D4D A;  1IBL Q;  2PZW A;  4FXK C;  1SFO H;  5GQO A;  1JQY D;  4HR7 B;  1BBU A;  2F0K A;  2I0Q A;  3M4O B;  4Z9C B;  4A3I B;  4JI2 Q;  3D4W A;  1IZ6 A;  4YCV A;  5EQ0 A;  1KLU D;  4ZKC B;  1IYV A;  3S15 H;  3UDG A;  1GHJ A;  3EBE A;  4RA8 A;  2PO4 A;  2TMP A;  1SYC A;  1PRT C;  1EY7 A;  2F4V Q;  3SE0 A;  1SLJ A;  2R93 G;  2JA8 H;  3TEH B;  4C3H G;  4DR4 Q;  1VQN A;  3HOX H;  2QA4 A;  3MXN B;  1M8A A;  4OHJ A;  4JC0 A;  5A2Q E;  4RAU C;  3J81 i;  3OWF A;  3PUV A;  1TT2 A;  3HKS A;  2UXD Q;  3PIO A;  4DR5 L;  1X3Q A;  2V4D A;  3Q6S A;  4X6A H;  4Q0F A;  1V1O A;  4HCE A;  1B44 D;  2K04 A;  4RMF A;  2VQF Q;  5C4H A;  5EGT A;  2F3W A;  3IAY A;  2NYZ D;  4C3I B;  4DA2 A;  1B9N A;  2R92 G;  3I4M B;  4PZ8 A;  4AH6 A;  4DGZ A;  4YHH L;  1Z6H A;  2BE5 D;  4X62 Q;  5LMN Q;  3S1Q H;  5CV5 A;  2CQA A;  4L5Q A;  4DR1 L;  2E5L L;  1V1P A;  1YJW A;  1DOK A;  3LNN A;  1DM0 B;  2NB0 A;  4ODG A;  1CKN B;  4NXM Q;  4CHT B;  4A3D H;  3MXU A;  1KNA A;  2GA4 B;  1HNW L;  4NB3 A;  1L0X B;  4QIW B;  1I94 L;  2VUM B;  3JC6 6;  3HRZ C;  5FJ8 H;  1WD0 A;  1IKL A;  2M2L A;  1UE5 A;  2EY5 A;  1SFO B;  3KK7 A;  1TS3 A;  5JEA G;  1GO3 E;  4RFB A;  2K28 A;  4LF5 Q;  5M5W H;  4BXX H;  1SE8 A;  2VQE L;  3KJP A;  2HIV A;  4YCW A;  4X66 L;  1STE A;  5J1Z A;  1L1O A;  3S15 B;  2NVT H;  5H1S E;  1BUV T;  1NE3 A;  2FIN B;  4JW0 A;  5HUR A;  5JVH 3;  1WTW A;  1GUW A;  2VB3 X;  4WRD A;  1VDZ A;  3EQL C;  4HID A;  2OWO A;  2KOL A;  2MO0 A;  4QGU A;  4QMG A;  2JA8 B;  1X3F A;  1BDO A;  1BO0 A;  2A1A A;  2V1C C;  1EQQ A;  3KF8 A;  1ONL A;  2MO1 A;  3G7L A;  3HOX B;  4JV5 L;  4JI2 L;  1JJ2 A;  2VW9 A;  3FKI B;  2HCI A;  3MZ5 A;  3CMA A;  4L5S A;  2NVQ H;  1JE5 A;  2QDB A;  1OXV A;  1PFM A;  3PF5 A;  1QZH A;  3A5Z B;  1T9H A;  2RHQ B;  4XQN A;  5KNB A;  4OWT B;  2RHS B;  5CC4 A;  2L9H A;  2HHH Q;  2F4V L;  3K5O A;  1EIG A;  4RKB A;  1D1K A;  4U67 3;  5DM7 3;  1VF5 C;  4BY1 G;  4DR4 L;  3JAM E;  3F8T A;  5IGF A;  1QE6 A;  2QDL A;  3S1Q B;  1JCK B;  3ER0 A;  3FDT A;  3A74 A;  1L0W A;  5LHY 1;  3GTK H;  3QB3 A;  5FLX L;  3GTQ H;  1XWE A;  3OMC A;  2UXD L;  4A3D B;  3SEB A;  4B3M Q;  3QG1 A;  2VQF L;  2RKS A;  1GM5 A;  1FGB D;  1G8Z D;  5D14 A;  1FVI A;  1S5B D;  1N32 L;  3BVG A;  5IGB A;  5LMN L;  4X62 L;  4PQX A;  4HSP A;  3QOL A;  1NAP A;  4XDX A;  1I4Q A;  4FDB A;  5M5W B;  1SNO A;  2L1B A;  3K81 C;  4ZQ3 A;  4NXM L;  4P73 A;  4OIJ A;  1DYQ A;  2JJQ A;  3BYT B;  3P20 A;  3GP7 A;  1F9R A;  1H9S B;  1YNJ D;  1PTO C;  2NVT B;  3CU7 A;  5JOB A;  4DK0 A;  4RKL A;  3X3N A;  4JI6 Q;  2B63 G;  3CD6 A;  1PH2 A;  3TBI B;  2F3I A;  3K57 A;  2A68 D;  2IHF A;  3GTG H;  2ZJQ A;  4A3M G;  1A6X A;  4HJ5 A;  4LF5 L;  1PRT F;  1X32 A;  3PO3 G;  4IOA A;  2SNM A;  3CME A;  3EA6 A;  1G91 A;  4KI0 A;  2M00 A;  1BCP B;  4IFD I;  3ONA B;  1SAP A;  3G71 A;  1RKN A;  1SND A;  1W3S A;  4CKE A;  3CRL C;  3OHX C;  3EVQ A;  4R4C A;  3M85 A;  1IL2 A;  4IUT A;  2ICI A;  1YIT A;  2JA7 G;  3U4V A;  1VQF A;  2KBN A;  1VQG A;  2F0J A;  4IZ8 A;  4PV1 C;  3K0Y A;  3GTK B;  2Q8I B;  4G57 A;  3GTQ B;  5IGE A;  4A3L G;  2UUB L;  4RH6 A;  3IFT A;  2HHH L;  2B2W C;  4O0A A;  4RGT A;  4UP7 A;  4LW1 A;  3K58 A;  4J8Q A;  2YU9 H;  5C0X H;  5I2Y A;  4MTK A;  2F0Q A;  5J39 A;  3K5L A;  2IJ0 A;  4ZUJ A;  1ZKO A;  2YTY A;  1EEI D;  4B3M L;  1A0I A;  1KAB A;  4QY7 A;  5ISR A;  1X54 A;  3BZD B;  2XWB B;  1DGS A;  2K5V A;  2D0O A;  3MXP A;  2KCT A;  4IUP A;  1PDQ A;  3K5M A;  1HJP A;  5D3I B;  1F2Z A;  1PRT D;  4A3E H;  3GTG B;  4HMI A;  3H0G H;  3UDI A;  3L9A X;  2R6G A;  3VR4 A;  1AEX A;  1MKH A;  5DEH A;  4RCO A;  4RGO S;  3TZD A;  3M4P A;  2WAC A;  3ND8 A;  1TY0 A;  1L1O B;  3HOZ G;  4B9W A;  2YYZ A;  3BS1 A;  4V0B A;  3FEW X;  4KD3 A;  2AMC B;  2VL6 A;  1S5E D;  5FLX E;  2L15 A;  3G4S A;  4JI6 L;  4LFB L;  2NUC A;  3W2D A;  1DZ1 A;  2PI2 E;  3JAM i;  4K5X A;  3NHH A;  2K52 A;  3PSI A;  3KF8 B;  1HNZ Q;  4GS3 A;  4QB4 A;  3E5S A;  2I46 A;  2PNR C;  2Q2H A;  3J81 c;  2ES2 A;  3AFQ A;  2DGY A;  1PTO H;  2QIL A;  3H3V I;  4FF4 A;  2JEA I;  3ERQ A;  1SYG A;  2CVR A;  2NBF A;  1VQ7 A;  3BVZ A;  4DV2 Q;  4R4T A;  2XWJ B;  4POG A;  4X3U A;  2ZJP A;  4QCL A;  2WFW A;  4EVO A;  2LXK A;  3HOV G;  3S1R H;  4KK7 A;  3DMU A;  4KHZ A;  1J6Q A;  3MEH A;  5C44 H;  4FXD A;  5KEE A;  2JA5 G;  4JPB W;  2RDG A;  2AKW B;  3S16 H;  1QZG A;  2WAQ B;  2HDL A;  4CBV A;  1VMC A;  4IO9 A;  2JE6 I;  3PCO B;  1E24 A;  3NSW A;  1K8A C;  1TQO A;  4OO1 I;  4POF A;  3B6Y A;  1PTO F;  4RWS C;  3R2T A;  3H0G B;  4ZYS A;  1SBB B;  5IOD A;  2K5N A;  1KRT A;  4CJ0 B;  4O2D A;  3S2H H;  3C1E A;  3NP8 A;  3NUC A;  2BA0 A;  3H6M A;  2SDF A;  2R7Z G;  1QVC A;  1CSQ A;  2F0W A;  2QGQ A;  1NTG A;  2Z0S A;  4HJ8 A;  1EYC A;  1QOH A;  3I55 A;  4A3J G;  1QNU A;  1D5Z C;  1S3O A;  1SXT A;  2XRQ D;  4A3C H;  1CT1 D;  2JXM B;  3C2P A;  3QWN A;  1ML0 D;  2WB1 B;  2L55 A;  4OWW B;  5C6A A;  3TS0 A;  5JEA J;  3D31 A;  1MHW C;  4CKC A;  5M3M G;  3W1G A;  5M3F H;  3S17 H;  2E76 C;  4YWK A;  1PTO B;  3KOJ A;  4XTC S;  3UE0 A;  1KL9 A;  5E7N A;  5BR8 Q;  2DNE A;  3NQI A;  1SMY D;  1B7Y B;  3OMG A;  4H02 A;  2IL8 A;  2XTI A;  1UAP A;  1OXT A;  1SEB D;  2Q8T A;  3S1R B;  1HNZ L;  5ELD A;  1I6H B;  1EY4 A;  1SNP A;  1STB A;  3CC4 A;  5C44 B;  5D65 A;  2F0V A;  4PZ6 A;  1Q46 A;  3HKZ G;  4GNX C;  4XQJ A;  5KYL A;  2J4X A;  3S16 B;  1Q86 C;  3E6Z X;  3VR6 A;  4DV2 L;  3TRZ A;  2VNU D;  1CHP D;  1U4L A;  1PFN A;  2SOB A;  1PTO D;  1PXU A;  2AUK A;  4GKK L;  1Y8O B;  3DLL A;  1CK1 A;  2PQE A;  1WTV A;  1C8C A;  1HQM C;  3NTK A;  5FO9 B;  2HQL A;  3PMF A;  3S2H B;  1HPC A;  2YTX A;  2E2J H;  4KD4 A;  1SE3 A;  2Q2U A;  2IPK D;  4C56 C;  3VYR A;  3G6E A;  1GD7 A;  3Q22 A;  2ATW A;  1DON A;  3VYT A;  4LUV A;  2ZM6 Q;  1YNN C;  3HFZ B;  1IBM Q;  2F0L A;  1OO9 B;  3DWQ A;  3S14 H;  4XQQ A;  1WOC A;  1SJE D;  4LK1 C;  2PYK A;  3GV6 A;  5M3F B;  3S17 B;  1HZC A;  3TRE A;  1E2V A;  4DKA C;  4NXN Q;  2K75 A;  2GVA A;  2B2V C;  2WKC A;  3VDY A;  1T5E A;  3J80 c;  4WJW A;  3MWY W;  1PFB A;  4PMB A;  1STN A;  3FHW A;  4DR7 Q;  1VQJ A;  3T1H Q;  4IFD G;  1RD9 D;  2PZT A;  3BDO A;  3VR3 A;  4L5R C;  1Q1B A;  2X69 A;  1LTA D;  4RG1 A;  4XXE A;  4AYB B;  5IYD G;  2PPB C;  1QVF A;  3UDF A;  1LTB D;  1MJC A;  1HZA A;  1I4G A;  1LTS D;  1ROD A;  1ZYR C;  2NVX H;  2UUA Q;  3D0F A;  2K05 A;  3MC0 B;  2CCZ A;  3E0E A;  1JIC A;  1KDC A;  4I7A A;  4DAV A;  4K14 A;  4IAL A;  5EKK A;  2C5C A;  4BY7 H;  2MQH A;  1A3U A;  1J5E L;  4JI3 Q;  1FR3 A;  1WCM H;  2A74 C;  3RMH A;  4JI4 Q;  5BN3 A;  4XT1 B;  4JI8 Q;  4KY6 A;  2A6E C;  2HD3 A;  1ICF B;  1MSH A;  2E2J B;  3CCE A;  3T53 B;  4IPC A;  2EOT A;  1QCB D;  4DAM A;  1YHB A;  3I56 A;  2B2U A;  3CF5 A;  2K50 A;  2OQ0 A;  5G3L F;  1S40 A;  2A19 A;  4UP9 A;  2VY3 A;  1Y1V G;  1YEZ A;  1HHV A;  2F0U A;  1TS5 A;  2DJG C;  4WJ4 A;  1LLR D;  4R4I A;  1DXM A;  3CW2 C;  2KVM A;  3I8Z A;  5ELE A;  3FRP B;  2R3Z A;  3AYH B;  3PUW A;  1UE7 A;  1S5C D;  4WOR A;  4C3J H;  3DEO A;  3G6J B;  4K5W A;  1SYF A;  2R61 A;  4I65 A;  3LWU A;  3F2D A;  2MHV A;  2ZM6 L;  4LF8 Q;  1B2T A;  3JAM c;  1CA5 A;  1IBM L;  1QIL A;  2MP1 A;  4UP8 A;  2OF1 A;  2J0T D;  1ESR A;  5K5P A;  1B3A A;  3DUZ A;  4DK1 A;  3CCR A;  4A3K H;  4BBR G;  1I5F A;  5I6Y A;  3ZJY C;  2F03 A;  4IPH A;  2BOS A;  2CH4 A;  2JEB I;  3NK9 A;  4CJ2 C;  1O80 A;  3NTI A;  4NXN L;  3A8K E;  2WIN B;  5C4X G;  3SK8 A;  1QB5 D;  4C3I G;  2NVX B;  1SRU A;  4ZCK A;  2OEO A;  1O7Z A;  2Z6K C;  4BY7 B;  1Y1W H;  4GOP C;  1A62 A;  2N55 A;  3PF4 A;  4DR7 L;  3T1H L;  1LTL A;  2Y0S B;  2ZXO A;  1WCM B;  4JBK A;  3DM1 A;  3HOU G;  5CV8 A;  4DFA A;  5FLM H;  5C3W A;  4MZ9 A;  4F8M A;  1X55 A;  2OCE A;  1KC8 C;  1PMR A;  4QUC A;  2K5W A;  5IE8 A;  2VUM G;  1GVP A;  3CAM A;  2JA6 H;  1KLG D;  3IRB A;  1ZEQ X;  2EXD A;  2QCP X;  3FVQ A;  1C7Y A;  3KYH C;  4JI3 L;  5I9O A;  5LL6 X;  1GKH A;  2EJG C;  3CKI B;  4J15 A;  3T51 B;  2JN4 A;  4JI4 L;  2F0G A;  2IX0 A;  1JOQ A;  2Z6B A;  5I9P A;  3T4A C;  4DR6 L;  4FF1 A;  4C3J B;  1D5X C;  1Y8P B;  1YHQ A;  3WDN A;  3I7F A;  1DJR D;  2JA8 G;  1OXU A;  2KUM A;  4OO1 G;  5CBA E;  1HZB A;  3HOX G;  5I6W A;  3OSO A;  2NN6 I;  2AQ1 B;  4H13 C;  1LT4 D;  1EY5 A;  4YWL A;  4AQY L;  3FKI G;  4P2C B;  4DV5 Q;  4YIJ A;  4A3K B;  4KKT A;  2D62 A;  1AE2 A;  1SYB A;  4DV1 L;  4LUZ A;  2QW7 A;  1BR9 A;  2HQE A;  2F0O A;  4KN4 C;  3ICE A;  4IUV A;  4LF8 L;  1B1Z A;  2KJX A;  3GV3 A;  1IW7 C;  1WTX A;  1J9O A;  4OIK A;  2UXB Q;  1SJH D;  4ZRZ A;  1Y1W B;  1Q1E A;  3I4N H;  4RHS A;  3UE1 A;  2BH2 A;  4A3D G;  3M9B A;  1K8G A;  2KED A;  1V1Q A;  3Q8D A;  4JOI C;  3L7Z C;  1UE1 A;  1TWG H;  5I2X A;  3A56 A;  5K36 H;  1Z47 A;  5CV4 A;  2JA6 B;  3K59 A;  1NSN S;  4CDD C;  3TZU A;  5C3E H;  1ZXT A;  1YNN D;  1TWA H;  2Z4I A;  3CCM A;  3HOY H;  3T1Y Q;  4FP5 D;  4JI1 Q;  1SNQ A;  5M9O A;  4JOI A;  5JAV A;  1QUQ A;  1UUP A;  1L2F A;  3OW7 A;  1ILP A;  2CHB D;  5FLX c;  4A93 H;  1JOO A;  4DN4 M;  1EY6 A;  2Q2T A;  3CCL A;  1YZ6 A;  5C3X A;  3OWE B;  2G9H D;  4DUY Q;  1X9N A;  1VQ5 A;  1XMQ Q;  1GJX A;  1VQ6 A;  2EDG A;  2RSN A;  5JJL A;  3F1Z A;  3GDE A;  1CUK A;  1U5K A;  3VYU A;  4YY3 L;  2CWP A;  2AHO B;  3RLN A;  1U9R A;  4HED A;  1DOL A;  3GQB A;  1P8L A;  2R93 H;  3BU2 A;  4XIG S;  2PNH A;  4P75 A;  4ULL A;  5AFW A;  1K0R A;  3EFX D;  4LF4 L;  3AMU A;  1SSO A;  1G2T A;  1E1O A;  3NBH A;  1D7Q A;  2JSO A;  1EWI A;  5IYB H;  1IBL L;  4FF2 A;  3S24 A;  3FP9 A;  1D8L A;  1PYW D;  4A3G G;  1P16 A;  3M3Y H;  1IXR A;  1H9K A;  3I4N B;  3K7A H;  4KJN A;  4JCV E;  1PYB A;  1V8Q A;  4R4Q A;  2R92 H;  1TWG B;  3SHL A;  2M9V A;  2A6E D;  4K2K A;  3HG9 A;  3CC2 A;  4K2L A;  3PUY A;  3S1M H;  1JC7 A;  2EYJ A;  2Q8R E;  1S72 A;  4C1N K;  5C3E B;  4P74 A;  2E2D C;  1TWA B;  1BXT A;  1PH3 A;  3SVM A;  4G7O C;  1PH5 A;  1RIP A;  3KLS A;  3HOY B;  1LTR D;  3J7A V;  4IFD J;  3AQQ A;  2N3S A;  1F2L A;  3ND9 A;  1A2U A;  2B8G A;  4UY8 C;  5LMN W;  3PO2 G;  5JEA H;  4A93 B;  1DCZ A;  1U4P A;  3RD4 A;  2Z8L A;  3C46 A;  4O1N A;  2RVL A;  4KHV A;  1FL0 A;  5EBD A;  5E1F A;  4DNT B;  3T1Y L;  1T5X D;  4JI1 L;  4XYQ A;  1VQK A;  3ULP A;  1JE4 A;  4KHP Q;  3VR5 A;  4HIO A;  1PFS A;  1BBX C;  2R93 B;  1F9P A;  2WP8 J;  4BBS G;  3HS0 C;  3TP6 A;  2A6H C;  1XXG A;  1XYI A;  4DUY L;  3DHQ A;  3CP0 A;  5IP9 H;  4ME3 A;  3U4Z A;  3J7Z C;  2B2Y C;  5KGU A;  3K7A B;  1Q81 C;  1HUN A;  1R4Q B;  2EYO A;  2QEJ C;  1JJC B;  2F0P A;  4X65 Q;  1C9O A;  1JWS D;  1X3P A;  1GHK A;  1II3 A;  4K8J A;  2R92 B;  2NVQ B;  5EKI A;  4GLX A;  2QEX A;  3S9W A;  3S1M B; 
#chains in the Genus database with same CATH homology
 3CHB D;  5EPJ A;  3R8B A;  2XNA C;  4K8I A;  3RLF A;  1E2Z A;  1RDP D;  5DNF A;  2O5I C;  3V05 A;  3H94 A;  2H1E A;  4R8I A;  1PRT B;  3K5N A;  3NWT A;  1Z7T A;  5EPK A;  1HFN A;  4E6I A;  2K33 A;  1EIH A;  2F0E A;  1CA6 A;  5CGK A;  1CFM A;  1WVL A;  2B2W A;  2BA1 A;  2F0H A;  1HXY D;  2WV6 D;  1SDF A;  2IX1 A;  1RCV D;  4FVM A;  2JYO A;  1Q3L A;  5LL6 S;  2EYF A;  3M7N A;  3T13 A;  1S4Z A;  1PLF A;  4ME5 A;  3PIP 3;  4O42 A;  2NN6 G;  2BCO A;  3N6R A;  5HGT A;  4ZLT F;  1CI3 M;  2L0C A;  3NQT A;  2H4O A;  1DOM A;  4MHE A;  1S5F D;  4IN3 A;  3DEP A;  4LJZ C;  5TSS A;  2E74 C;  1LTT D;  5ELF A;  4FXG C;  1PZI D;  2F0S A;  3AU7 A;  1G6Z A;  1I4P A;  2Z1C A;  3GTO B;  5KNC A;  1K83 B;  2KEC A;  2HDM A;  2L5T A;  4JK1 C;  2YU9 B;  3V2T A;  2FHT A;  2JP1 A;  1Y69 U;  2K7V A;  1TS4 A;  1ENA A;  2K5D A;  1Q90 A;  1R4P B;  2B2T C;  1GUT A;  4A3M B;  2NTT A;  3MFY A;  1PZJ D;  1WTR A;  1Q8I A;  3PO3 B;  1MGS A;  2IX3 A;  4S3S A;  4A3E B;  3RUZ A;  1EY9 A;  1F77 A;  1R9T B;  3NE5 B;  2A73 B;  1TWF B;  3KLS X;  3SXH A;  4DAP A;  5FOB B;  4L8J A;  1NUC A;  4J1M A;  1STG A;  1RJT A;  2LMC B;  1AN8 A;  2D9U A;  3RZD B;  1A2T A;  1EOT A;  5COY A;  4B08 A;  3I4L A;  4QF4 A;  4KJO A;  4G7H C;  4HN7 A;  2PZU A;  4R8N A;  4B9X A;  2EJM A;  1FYC A;  3MA2 B;  1JB3 A;  2J7Z A;  4HCS A;  4HMJ A;  3I70 A;  1F2Y A;  2SNS A;  2A6H D;  1HFG A;  4G4K A;  3HOZ B;  1JWU D;  5T1I A;  1KAA A;  1SNM A;  4KMU C;  3QOJ A;  1UEA B;  1FNW A;  1TR5 A;  5KIX A;  2L11 A;  5FO8 B;  1AZQ A;  3MAQ A;  2RSO A;  1QNK A;  1Q12 A;  4MN3 A;  3FPU B;  3URY A;  2A5H A;  1EEF D;  2IWH A;  3R2I A;  2EYH A;  1HTL D;  2BDN A;  4V19 0;  3DWP A;  4IUN A;  5KYI A;  2TSS A;  3T16 A;  3GO5 A;  3HOV B;  4M8A A;  1EYD A;  4DU9 A;  2KHS A;  1NR4 A;  5CBE E;  3BDL A;  2F1M A;  2BE5 C;  3MXG A;  5NUC A;  1K8M A;  5CV9 A;  1GUN A;  1I4X A;  1E2W A;  1O7L A;  2EXZ A;  1SE2 A;  4X3S A;  3TME A;  1SYD A;  1TII D;  4ID6 A;  4F87 A;  1F9S A;  1SYE A;  2N88 A;  4N9P A;  2B2V A;  4K5V A;  3LX0 A;  4XT3 B;  2O4X A;  2R7Z B;  4C3J G;  3PUZ A;  2EY2 A;  3IFD A;  1HUM A;  4TQU S;  4PMC A;  5KND A;  2ZXR A;  1STY A;  4RGN A;  5D3D A;  1EQV A;  3H3V C;  5M3M B;  4TRD A;  4UDU C;  2QF7 A;  4ILW A;  3S14 B;  1EQT A;  1NR2 A;  3ZYY X;  2ICE C;  4IFD H;  2QKI C;  2RDH A;  4K6L A;  3MVV A;  1C4Q A;  1EY8 A;  3D6C A;  2K1B A;  5KRU A;  3HOW B;  5C0X I;  4N9T A;  3PIO 3;  3V96 A;  4DXG A;  2A69 C;  3A55 A;  4KV6 A;  4IUQ A;  2MGS A;  1LTG D;  3CRK C;  1TKW B;  2O5J C;  2DNC A;  4G7Z C;  3J80 L;  1EWC A;  3FPP A;  1S5D D;  2HCC A;  3GTP B;  4BWG B;  1CHQ D;  5IIF A;  2D2C C;  3MTS A;  5FKA C;  2LKV A;  4J6H A;  1AW7 A;  2FFK B;  4DAY A;  5ELC A;  1LTI D;  3K6O A;  1YNJ C;  1BQQ T;  1D5M C;  5G3L D;  2K03 A;  3UI2 A;  3X3M A;  4NDX A;  1NCV A;  1C48 A;  2F0T A;  3TN2 A;  1TY2 A;  3KLR A;  1LT3 D;  5IOC A;  4CJ1 B;  3FMC A;  1D1I A;  1EWH A;  4NW2 A;  1L0Y B;  4L63 B;  3WOE A;  4TSS A;  1CQF A;  3Q0A A;  1G29 1;  1LAC A;  1RF2 D;  4A3F B;  2XRS D;  1BCP C;  4C1N I;  3IL8 A;  1KNE A;  3A8I E;  2EY1 A;  2LS0 1;  3P1H A;  5E4X A;  2CW0 C;  3LWE A;  2RA4 A;  1GUG A;  1Y1V B;  4FYD A;  4KY5 A;  1ILQ A;  1IHZ A;  1LAB A;  1W6K A;  2EYP A;  1A3T A;  2X6G A;  3NXW A;  2LFN A;  2F0M A;  5BN5 A;  4BS9 A;  4OO1 H;  4LMQ D;  2EYL A;  2B39 A;  2ZT9 C;  4NMZ A;  1JR0 D;  3HZX A;  1D2B A;  1MSG A;  1TVX A;  3H09 A;  1FD7 D;  4BBR B;  3U9S A;  4IUU A;  2ZXP A;  4OGQ C;  4ZKB B;  5C4X B;  2PW7 A;  3OOC A;  1GOZ A;  1KDB A;  2L12 A;  3J80 E;  1HA5 A;  4CGY B;  5E3F A;  3I90 A;  4CKB A;  2KCN A;  4HSV A;  5JPM C;  1H9M A;  2SEB D;  1MI2 A;  3VYS A;  3HOU B;  2AUJ D;  3GTL B;  5J22 A;  5C4Z A;  2F4I A;  1ZYR D;  4MIU A;  2BDO A;  2D5D A;  4RHR A;  2K01 A;  2WII B;  3NTH A;  1IKM A;  1A3V A;  3WOF A;  2C9O A;  2K5Q A;  1DD2 A;  3ITP A;  1JWM D;  5CYU A;  2RDF A;  3TP5 A;  4Y7N B;  1HCZ A;  5T1G A;  1K8O A;  1BOS A;  1HA6 A;  2VXW A;  2LY7 A;  3BVM A;  1IL8 A;  3BDC A;  3GD7 A;  2F0I A;  2I07 B;  3BG3 A;  4UAI A;  2A69 D;  4C3H B;  1SMY C;  1QG7 A;  2E75 C;  5JVG 3;  4RCN A;  2HUG A;  3HP3 A;  2NWG A;  1CTM A;  4X3K A;  1BCP F;  2XN9 C;  3M3Y B;  1O78 A;  1JOR A;  1VMP A;  2F0F A;  2Z4H A;  1U4M A;  1HQR D;  3I3C A;  1FNU A;  1OXS C;  5DAU A;  1F2M A;  2VB2 X;  5C0X G;  3MFG A;  2O2L D;  3KBG A;  2B2Y A;  2WKD A;  1TWC B;  3I91 A;  1STH A;  1H9J A;  4H44 C;  3SR1 A;  3MHB A;  3SDZ A;  4ZUI A;  2EE1 A;  1LO5 D;  3RZO B;  4PNY A;  1KDA A;  5COR A;  4EQO A;  4KKS A;  2OT2 A;  2EPB A;  1TU2 B;  3W3A A;  3SK6 A;  1RHP A;  1STA A;  3N52 A;  2DY7 A;  4A3G B;  1EY0 A;  5EJW A;  5I4D A;  3C1F A;  1EL0 A;  2DY8 A;  1BCP D;  1LV9 A;  1IW7 D;  1H9R A;  3TDQ A;  1FNV A;  1TWH B;  1VF7 A;  1I4H A;  1V1P B;  2CW0 D;  4PMW A;  3QIA A;  2NZ1 D;  4NKL A;  1AP0 A;  4BY1 B;  4ZAI A;  3A54 A;  3SK4 A;  3D3R A;  1B4O A;  2E2H B;  5M5X B;  3PO2 B;  3T56 B;  3R3O A;  3D8G A;  3A8J E;  1BNZ A;  3P75 A;  3S2D B;  3P7J A;  1EFI D;  1ICW A;  4K6D A;  3VR2 A;  3OIQ A;  2AWO A;  4U68 A;  3A7A B;  4BBS B;  1KTK A;  1GUS A;  3I72 A;  3M4Y A;  5CV6 A;  3QJY A;  3OIP A;  5FO7 B;  2B63 B;  1F9Q A;  2IT1 A;  2DN8 A;  1J8I A;  3J7A F;  2KEE A;  5A35 A;  4H0L C;  3EJI A;  2NN6 H;  2XVS A;  4BA1 I;  3QO2 A;  3OPO A;  3Q23 A;  2EZV A;  2FJ2 A;  1CZG A;  2B2T A;  4HTH A;  4NP5 A;  3NWS A;  2FMC A;  2EY6 A;  2EJF C;  3M7G A;  2JA7 B;  2EVB A;  2EYM A;  2PCF B;  4A3B B;  2F0N A;  4DXF A;  1AFP A;  1U4R A;  1OXX K;  4XYO A;  1B53 A;  5CV7 A;  4FO2 A;  2IW3 A;  3DXJ C;  3NPP A;  5EBC A;  3F2U A;  4R9W A;  4H7B A;  5C5L A;  3AB9 A;  5IT9 L;  4WFN 3;  3HEJ A;  5IGD A;  1A15 A;  1BF4 A;  1ENC A;  3J81 L;  4JBW A;  3VA5 A;  4HAE A;  3TSS A;  5IGG A;  3D6W A;  3GTJ B;  5E4W C;  4GZY C;  5F2D A;  1ET6 A;  1CM9 A;  2F0D A;  5FK9 C;  1EU4 A;  4FF3 A;  1WTQ A;  4M1U B;  2NTS A;  2RBM A;  4DF7 A;  1M4V A;  1RTO A;  1UNS A;  1B50 A;  3U9O A;  3ERO A;  4LAA A;  1EZ6 A;  5JJZ A;  2KA7 A;  1I4R A;  3E0J A;  3C3L A;  5EPL A;  1I50 B;  4KKU A;  2ID0 A;  2JA5 B;  4I7Z C;  3PV0 A;  1B9M A;  1E0B A;  1EZ8 A;  1SNC A;  4Q5V A;  4BA2 I;  4X3T A;  4C2M B;  1W6J A;  4F7X A;  1CZW A;  1ENF A;  3PUX A;  2K6A A;  2MPM A;  3D4R A;  4TKO B;  1MBY A;  5C0X J;  4OL7 A;  1HRJ A;  1HTP A;  5IGC A;  4KTA A;  4A3J B;  3MXN A;  5DM6 3;  1EYA A;  3KUP A;  5ELB A;  2KCC A;  2MUY A;  3HGB A;  1GXD C;  2AWN A;  1EU3 A;  2B2U C;  2MJ8 A;  2OXP A;  4IUR A;  4ZK9 B;  1XX8 A;  3J7Y W;  5BN4 A;  5IT9 E;  3GTM B;  3S1N B;  2L4N A;  1V43 A;  4L6T B;  4F88 A;  3BYY B;  1GUO A;  4EGV A;  4KN7 C;  2FMM A;  3J81 E;  1AZP A;  1TS2 A;  3Q24 A;  3O13 A;  3HKZ B;  3CQZ B;  3TP8 A;  4DNR B;  2AQ2 B;  1SE4 A;  3R93 A;  5A2Q L;  3VA7 A;  1WTP A;  3A7L A;  4QUF A;  1ET9 A;  1QWY A;  5M5Y B;  3TP7 A;  1IYU A;  5C5M A;  2ENB A;  1XTC D;  2K32 A;  1G2S A;  3DWA A;  4RGM A;  1ESF A;  5CMD A;  2PW5 A;  2AQ3 B;  4KY7 A;  5C4J B;  1I6V C;  1WTO A;  1QJO A;  1I3Q B;  3KBX A;  2PMZ B;  2RQX A;  1PZK D;  4FNF A;  2A68 C;  2KQ3 A;  3L3O C;  1MD2 D;  5JPN C;  2XIW A;  2X6L A;  1CQV A;  1RTN A;  1JOK A;  4IQZ A;  1Y8N B;  1WD1 A;  3IKJ A;  1LT5 D;  4EQN A;  4EQP A;  1VCI A;  2F3V A;  4ABN A;  2XSC A;  1O7Y A;  2G9D A;  5EKL A;  3H91 A;  5K36 G;  2B8F A;  5CR3 A;  3NBI A;  1D6E C;  2E2I B;  3I73 A;  2NVY B;  3SK5 A;  1H9S A;  1LT6 D;  3JAM L;  3D4D A;  2PZW A;  4FXK C;  1JQY D;  4HR7 B;  2F0K A;  3M4O B;  4Z9C B;  4A3I B;  3D4W A;  5EQ0 A;  1KLU D;  4ZKC B;  1IYV A;  1GHJ A;  4RA8 A;  2PO4 A;  2TMP A;  1SYC A;  1PRT C;  1EY7 A;  3SE0 A;  4C3H G;  4OHJ A;  1M8A A;  5A2Q E;  4RAU C;  3OWF A;  3PUV A;  1TT2 A;  1X3Q A;  2V4D A;  3Q6S A;  4Q0F A;  1V1O A;  4HCE A;  1B44 D;  2K04 A;  5C4H A;  5EGT A;  2F3W A;  3IAY A;  2NYZ D;  4C3I B;  4DA2 A;  1B9N A;  3I4M B;  4DGZ A;  1Z6H A;  2BE5 D;  5CV5 A;  2CQA A;  1V1P A;  1DOK A;  3LNN A;  1DM0 B;  2NB0 A;  4ODG A;  4CHT B;  3MXU A;  1KNA A;  2GA4 B;  1L0X B;  4QIW B;  2VUM B;  3HRZ C;  1WD0 A;  1IKL A;  2M2L A;  2EY5 A;  1SFO B;  3KK7 A;  1TS3 A;  5JEA G;  4RFB A;  2K28 A;  1STE A;  5J1Z A;  3S15 B;  1BUV T;  2FIN B;  5HUR A;  5JVH 3;  1WTW A;  1GUW A;  2VB3 X;  4WRD A;  1VDZ A;  3EQL C;  2KOL A;  2JA8 B;  4QMG A;  1BDO A;  1BO0 A;  3KF8 A;  1ONL A;  3G7L A;  3HOX B;  3FKI B;  2HCI A;  3MZ5 A;  2QDB A;  1OXV A;  1PFM A;  4XQN A;  5KNB A;  5CC4 A;  2L9H A;  3K5O A;  1EIG A;  4RKB A;  1D1K A;  4U67 3;  5DM7 3;  1VF5 C;  3JAM E;  5IGF A;  1QE6 A;  3S1Q B;  1JCK B;  3FDT A;  5LHY 1;  3QB3 A;  5FLX L;  1XWE A;  3OMC A;  4A3D B;  3SEB A;  3QG1 A;  2RKS A;  1FGB D;  1G8Z D;  5D14 A;  1S5B D;  3BVG A;  5IGB A;  4PQX A;  4HSP A;  3QOL A;  1NAP A;  4XDX A;  1I4Q A;  5M5W B;  1SNO A;  2L1B A;  4ZQ3 A;  4OIJ A;  1DYQ A;  3BYT B;  3P20 A;  3GP7 A;  1F9R A;  1H9S B;  1YNJ D;  1PTO C;  2NVT B;  3CU7 A;  5JOB A;  4DK0 A;  4RKL A;  3X3N A;  3TBI B;  3K57 A;  2A68 D;  1A6X A;  1PRT F;  1X32 A;  2SNM A;  1G91 A;  3EA6 A;  4KI0 A;  2M00 A;  1BCP B;  4IFD I;  3ONA B;  1SAP A;  1RKN A;  1SND A;  4CKE A;  3CRL C;  3OHX C;  3EVQ A;  3M85 A;  4IUT A;  2ICI A;  2F0J A;  4IZ8 A;  4PV1 C;  3K0Y A;  3GTK B;  2Q8I B;  4G57 A;  3GTQ B;  5IGE A;  4RH6 A;  3IFT A;  2B2W C;  4RGT A;  3K58 A;  4J8Q A;  5C0X H;  5I2Y A;  2F0Q A;  5J39 A;  3K5L A;  2IJ0 A;  4ZUJ A;  1ZKO A;  1EEI D;  1KAB A;  5ISR A;  3BZD B;  2XWB B;  3MXP A;  4IUP A;  1PDQ A;  3K5M A;  5D3I B;  1F2Z A;  1PRT D;  3GTG B;  4HMI A;  3L9A X;  2R6G A;  3VR4 A;  1AEX A;  5DEH A;  4RCO A;  4RGO S;  3TZD A;  2WAC A;  3ND8 A;  1TY0 A;  4B9W A;  2YYZ A;  3BS1 A;  4V0B A;  3FEW X;  4KD3 A;  5FLX E;  1S5E D;  2NUC A;  3W2D A;  1DZ1 A;  4K5X A;  3NHH A;  4QB4 A;  3E5S A;  2I46 A;  2PNR C;  1PTO H;  2QIL A;  4FF4 A;  2JEA I;  3ERQ A;  1SYG A;  2CVR A;  2NBF A;  3BVZ A;  2XWJ B;  4X3U A;  4QCL A;  4EVO A;  4KK7 A;  3DMU A;  4KHZ A;  3MEH A;  4FXD A;  5KEE A;  2RDG A;  2WAQ B;  2HDL A;  4CBV A;  1VMC A;  2JE6 I;  3NSW A;  1TQO A;  4OO1 I;  1PTO F;  4RWS C;  3R2T A;  4ZYS A;  3H0G B;  5IOD A;  1SBB B;  4CJ0 B;  3C1E A;  3NP8 A;  3NUC A;  2BA0 A;  3H6M A;  2SDF A;  2F0W A;  1EYC A;  1QOH A;  1QNU A;  1D5Z C;  1SXT A;  2XRQ D;  1CT1 D;  2JXM B;  3C2P A;  3QWN A;  1ML0 D;  2WB1 B;  2L55 A;  5C6A A;  5JEA J;  3D31 A;  4CKC A;  2E76 C;  1PTO B;  4XTC S;  2DNE A;  3NQI A;  1SMY D;  3OMG A;  2IL8 A;  1UAP A;  1OXT A;  1SEB D;  2Q8T A;  3S1R B;  5ELD A;  1I6H B;  1EY4 A;  1SNP A;  1STB A;  5C44 B;  5D65 A;  2F0V A;  4XQJ A;  5KYL A;  2J4X A;  3S16 B;  3E6Z X;  3VR6 A;  2VNU D;  1CHP D;  1U4L A;  1PFN A;  2SOB A;  1PTO D;  1PXU A;  2AUK A;  1Y8O B;  1WTV A;  1CK1 A;  2PQE A;  1C8C A;  1HQM C;  3NTK A;  5FO9 B;  3PMF A;  3S2H B;  1HPC A;  4KD4 A;  1SE3 A;  2IPK D;  4C56 C;  3VYR A;  3Q22 A;  1DON A;  3VYT A;  1YNN C;  2F0L A;  1OO9 B;  3DWQ A;  4XQQ A;  1SJE D;  4LK1 C;  2PYK A;  3GV6 A;  5M3F B;  3S17 B;  1E2V A;  2B2V C;  2WKC A;  1T5E A;  4WJW A;  3MWY W;  1PFB A;  4PMB A;  1STN A;  4IFD G;  1RD9 D;  2PZT A;  3BDO A;  3VR3 A;  1Q1B A;  2X69 A;  1LTA D;  4AYB B;  4XXE A;  2PPB C;  1LTB D;  1I4G A;  1LTS D;  1ROD A;  1ZYR C;  2K05 A;  3MC0 B;  1JIC A;  1KDC A;  4DAV A;  4K14 A;  4IAL A;  5EKK A;  2C5C A;  1A3U A;  1FR3 A;  2A74 C;  3RMH A;  5BN3 A;  4XT1 B;  4KY6 A;  2A6E C;  2E2J B;  1MSH A;  3T53 B;  2EOT A;  1QCB D;  2B2U A;  5G3L F;  1HHV A;  2F0U A;  1TS5 A;  1LLR D;  1DXM A;  5ELE A;  2KVM A;  3I8Z A;  3FRP B;  2R3Z A;  3PUW A;  1S5C D;  4WOR A;  3DEO A;  3G6J B;  4K5W A;  1SYF A;  2R61 A;  4I65 A;  3LWU A;  2MHV A;  1B2T A;  1CA5 A;  1QIL A;  2MP1 A;  2OF1 A;  2J0T D;  1ESR A;  5K5P A;  1B3A A;  3DUZ A;  4DK1 A;  5I6Y A;  2F03 A;  2BOS A;  2JEB I;  3NK9 A;  4CJ2 C;  1O80 A;  3NTI A;  3A8K E;  2WIN B;  3SK8 A;  1QB5 D;  4C3I G;  2NVX B;  2OEO A;  1O7Z A;  4BY7 B;  2N55 A;  2Y0S B;  2ZXO A;  1WCM B;  3DM1 A;  5CV8 A;  4DFA A;  5C3W A;  4F8M A;  1PMR A;  4QUC A;  2K5W A;  1KLG D;  1ZEQ X;  2QCP X;  3FVQ A;  5I9O A;  5LL6 X;  2EJG C;  3CKI B;  3T51 B;  2F0G A;  2IX0 A;  1JOQ A;  5I9P A;  3T4A C;  4FF1 A;  4C3J B;  1D5X C;  1Y8P B;  3WDN A;  1DJR D;  1OXU A;  2KUM A;  4OO1 G;  5CBA E;  5I6W A;  3OSO A;  2NN6 I;  2AQ1 B;  4H13 C;  1LT4 D;  1EY5 A;  4P2C B;  4YIJ A;  4A3K B;  4KKT A;  2D62 A;  1SYB A;  1BR9 A;  2HQE A;  2F0O A;  4KN4 C;  4IUV A;  1B1Z A;  2KJX A;  3GV3 A;  1IW7 C;  1WTX A;  1J9O A;  4OIK A;  1SJH D;  4ZRZ A;  1Y1W B;  1Q1E A;  4RHS A;  2KED A;  3L7Z C;  5I2X A;  3A56 A;  5K36 H;  1Z47 A;  5CV4 A;  2JA6 B;  3K59 A;  1NSN S;  3TZU A;  1ZXT A;  1YNN D;  2Z4I A;  4FP5 D;  1SNQ A;  5M9O A;  5JAV A;  1UUP A;  3OW7 A;  1ILP A;  2CHB D;  1JOO A;  4DN4 M;  1EY6 A;  5C3X A;  3OWE B;  2G9H D;  1GJX A;  2EDG A;  2RSN A;  3VYU A;  1U9R A;  4HED A;  1DOL A;  3GQB A;  4XIG S;  4ULL A;  5AFW A;  3EFX D;  3AMU A;  1SSO A;  1G2T A;  3NBH A;  2JSO A;  4FF2 A;  1PYW D;  3I4N B;  1H9K A;  4KJN A;  1V8Q A;  1TWG B;  3SHL A;  2M9V A;  2A6E D;  4K2K A;  3HG9 A;  4K2L A;  3PUY A;  1JC7 A;  2EYJ A;  2Q8R E;  4C1N K;  5C3E B;  2E2D C;  1TWA B;  1BXT A;  3SVM A;  4G7O C;  3KLS A;  3HOY B;  1LTR D;  3J7A V;  4IFD J;  1F2L A;  3ND9 A;  1A2U A;  2B8G A;  5JEA H;  4A93 B;  1DCZ A;  1U4P A;  3RD4 A;  2Z8L A;  3C46 A;  4O1N A;  2RVL A;  4KHV A;  5EBD A;  5E1F A;  4DNT B;  1T5X D;  4XYQ A;  1JE4 A;  3VR5 A;  1BBX C;  2R93 B;  1F9P A;  2WP8 J;  3HS0 C;  3TP6 A;  2A6H C;  1XXG A;  1XYI A;  3DHQ A;  2B2Y C;  5KGU A;  3K7A B;  1HUN A;  1R4Q B;  2EYO A;  2QEJ C;  2F0P A;  1JWS D;  1X3P A;  1GHK A;  1II3 A;  4K8J A;  2R92 B;  2NVQ B;  5EKI A;  3S9W A;  3S1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...