1BBXC

Non-specific protein-dna interactions in the sso7d-dna complex, nmr, 1 structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
63
structure length
63
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*CP*TP*AP*GP*CP*GP*CP*GP*CP*TP*AP*G)-3')
publication title Architecture of Nonspecific Protein-DNA Interactions in the Sso7D-DNA Complex
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 4
structure length 63
sequence length 63
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bbxC00
1LV9A 2J7ZA 3I91A 2KVMA 3TZDA 1NR4A 2K28A 2N88A 1C8CA 1PFNA 5EPLA 1NAPA 1AP0A 1RTNA 2KECA 1AZPA 5COYA 1HHVA 2KEDA 4X3KA 2RVLA 1WD0A 1A15A 2D9UA 3N52A 4NW2A 2DY8A 4CJ1B 3D6WA 3TN2A 4QUFA 1F9QA 3Q6SA 4X3SA 1F9RA 2MJ8A 1B2TA 1XYIA 2SDFA 3I3CA 4O42A 4RA8A 2KOLA 4ZAIA 4OIJA 1QNKA 5EJWA 1RJTA 2VXWA 5EPJA 2K05A 5E4WC 1MSHA 4ZKCB 1ESRA 1NCVA 5D14A 1M8AA 1DONA 1HFNA 4HEDA 2HCIA 4UAIA 2KEEA 1BO0A 4RWSC 3IL8A 2EE1A 1Q3LA 1G2TA 1DOLA 1HFGA 1RODA 3ONAB 2H1EA 2HCCA 5CBAE 2RSNA 5T1IA 1PDQA 5JJZA 4X3TA 1J8IA 1O7YA 1RHPA 1RTOA 2X6GA 3DM1A 4CJ2C 2R3ZA 1WD1A 2HDMA 1DZ1A 4IUVA 2B2TC 4QUCA 3MTSA 1ILPA 2Q8TA 4CJ0B 5CBEE 1JE4A 1G91A 1JICA 1PLFA 1ZXTA 1ILQA 1KNEA 1KNAA 2FFKB 2FINB 2HUGA 1IL8A 1U4MA 2K01A 1WTXA 4ZKBB 3GV6A 4RAUC 1WTWA 1G6ZA 2BDNA 2B2TA 1X3PA 1WTQA 1G2SA 2CVRA 1DOMA 1EIGA 1U4LA 4XT1B 4HAEA 5CORA 1F9PA 1NR2A 1VMPA 2HDLA 2L12A 1IKLA 1E0BA 5D65A 1ICWA 1O7ZA 1PFBA 2L11A 3F2UA 4X3UA 2IL8A 2K1BA 2NZ1D 2RSOA 5T1GA 1AZQA 2K03A 3I8ZA 1SSOA 5E4XA 3H91A 3KUPA 5EPKA 1WTVA 2B2YC 1HUMA 2RA4A 2B2WC 3UI2A 1WVLA 1J9OA 1QE6A 5AFWA 2B2VC 4IURA 4R8IA 2XIWA 4IUQA 4MHEA 4OIKA 2MPMA 1X3QA 2FMMA 2L4NA 3DEOA 4IUTA 3KBXA 4R9WA 5DNFA 1EIHA 1CA6A 3R93A 1O80A 2DY7A 5EQ0A 4U68A 1B3AA 2B2YA 2K04A 2MP1A 2B2WA 3MWYW 4MN3A 5EKIA 1EL0A 1XX8A 2L1BA 3FPUB 2B2VA 2NWGA 3QO2A 2JP1A 1BNZA 1CM9A 1DOKA 4XDXA 1S4ZA 2JYOA 4DN4M 1BF4A 1HRJA 2FJ2A 1IKMA 3G7LA 3GV3A 2Q8RE 1U4RA 2M2LA 2KUMA 2EPBA 1SAPA 1HA6A 2MGSA 3SVMA 1EOTA 2B2UC 2EOTA 3HP3A 1B53A 4HCSA 1QG7A 2X69A 3I90A 4XT3B 4LMQD 3LWEA 1F2LA 5CMDA 1ML0D 1SDFA 1WTPA 1U4PA 1VMCA 1MSGA 1GUWA 4IUUA 1TVXA 1WTOA 1HUNA 1MGSA 1BBXC 4ZK9B 2B2UA 1WTRA 1PFMA 1X32A 1MI2A 2N55A 3FDTA 3IFDA 3P7JA 2L9HA 3DEPA 4HSVA 1F9SA 1B50A 4ZLTF 4IUPA 2FHTA 2X6LA 1B4OA 1EQTA 2NYZD 1CA5A
chains in the Genus database with same CATH superfamily
2E76C 4GKKL 2EYOA 3TZDA 3FKIG 4MZ9A 5M5XB 5EAYA 1EWCA 1YITA 1SYEA 1ZYRD 5M3MG 1TWHB 1O7IA 1EYCA 2Z9HA 3DMUA 1FR3A 1L2FA 3GTLB 1A15A 4JV5Q 3J80i 2E2HH 2L15A 4DV2Q 4IO9A 2PI2A 3H0GG 4DV4Q 2XWJB 1LTRD 2KOLA 1OXVA 3I72A 4OIJA 5DLQE 1RJTA 4A93G 1UWVA 1FGUA 4UP7A 2PMZB 4UAIA 1O78A 4BY1H 2LKVA 2AMCB 4OWWB 1IBKL 1S5BD 4C2MH 3BDOA 2PW7A 1GHKA 5EGTA 1YZ6A 1IBLL 2ASBA 1I4HA 4DUZL 2D62A 2F1MA 1U4MA 2GVBA 4ZKBB 5LL6X 3PIPA 4RAUC 4LF4Q 1SYFA 1QCBD 1EIGA 1K8AC 5M5YH 1PFBA 5E1FA 4A3FB 2E2JB 3GTPB 1WYDA 1VQ7A 3GTMB 2NUCA 1A6XA 4IUQA 4FF1A 3S14H 1Y1VB 1N34Q 3R93A 3KFUA 1JJGA 3S2DB 2MP1A 3HFZB 4XIGS 3A5UA 1BNZA 1CT1D 2YU9H 3MXGA 1IKMA 3C1EA 1CI3M 5CV5A 1SYGA 2IJ0A 4OL7A 1TT2A 1SMYD 2K5WA 4ZYSA 1LT5D 1Q90A 3MFYA 3HOUB 3ERQA 1J5EQ 4LAAA 1CKMA 2CFMA 5ISRA 4KMUC 1VQIA 2MQHA 4A3DB 2FXQA 2B63G 2M9VA 3K7AB 4ZK9B 1EYGA 4DAMA 2AKWB 2CWPA 3P7JA 1JORA 2PNHA 3H09A 3CCMA 1EIFA 2F0QA 3G4SA 1QNUA 1AW7A 5CV6A 4R4QA 4DNTB 2F0VA 4DXGA 3F1ZA 3I91A 3D4WA 3QB3A 3S1RB 1FD7D 3G71A 3E0EA 4JI7L 4BBSG 1GO3E 2EY6A 1PZKD 4C3JB 1D2BA 3TP8A 1FJGL 1EY0A 3OW2A 4NPSA 2EZVA 3WOFA 4XQQA 4JW0A 1PRTD 3S2HB 1BCPD 4F87A 2MUYA 2EJMA 3S9WA 3BZCA 3VR2A 3J81c 2QGQA 3QWNA 1M8AA 4GOPA 5M9OA 2WB1E 1Z47A 3PF5A 3J7AF 1PTOF 3MXNB 1JB3A 2OQKA 5HGQA 3HOXB 1GUNA 5HY6A 3PO3G 2G9HD 3CP0A 4P74A 1EY9A 3FEWX 5EBCA 3WOEA 4NXMQ 1M1KC 1WTWA 1Q1BA 2BDNA 4J1MA 1P16A 3UDFA 4ODGA 5FLMH 2RSOA 4BWGB 2EYPA 1YJ9A 3IRBA 2RA4A 4B3RL 2B2WC 5EBDA 1DGSA 1JWSD 3I70A 2BH2A 1Q8IA 1LTAD 3BDCA 3MEFA 1RF2D 4EX5A 3QG1A 3E9HA 4LWCA 1XXGA 3U9OA 1N33Q 4CGYB 5KRUA 1AH9A 2VW9A 3KF6B 4C1NI 2KCNA 5I9PA 1CTMA 1A2UA 2BOSA 2XNAC 3HOYG 1TY0A 2I07B 3HEJA 2PPBC 2EVBA 4L5TA 3HP3A 4LFCL 4J15A 3T1YQ 1HZBA 4A3CG 3T1HL 4XYQA 3TS2A 1OXUA 5IT9L 4X6AH 4HJ9A 1MSGA 4IUUA 4N8X1 4QJFA 2R7ZB 5C3EB 1OO9B 2VZAA 3MVVA 4HJ8A 4HIMA 1UAPA 3UE1A 1XMQL 4DV5L 5HGTA 2ES2A 4C3IB 2NVXB 2GN5A 3U50C 1I50H 3UE0A 2K32A 1PH7A 3ITPA 1S72A 3L7ZC 1CQFA 5COYA 4Y7NB 4B3SQ 1Q7YC 5I6YA 1PYBA 4K0KL 2IHEA 4FDBA 3TN2A 1V8QA 4FNFA 3NE5B 4GN3B 2ENBA 1F9RA 2ZM6L 2JA7G 3I3CA 5K5PA 1RL2A 3DXJC 1NCVA 4JVZA 1G291 3NBHA 2BDOA 5M5XH 1YHAA 3HOZB 2OEOA 3FMCA 2I5HA 1TWHH 1RODA 4V190 2ZTDA 3GTLH 2EJGC 2ID0A 3AMUA 4DR4Q 2B2TC 2UUCQ 1HTPA 2KHIA 1SNDA 3TP6A 2CQAA 1K83B 1ZKOA 1EYDA 5CBEE 4YY3L 2F0GA 4DV7Q 4L5SA 4PZ8A 2N3SA 3Q8DA 3V96A 3CXCA 2Z6KA 3ZYYX 4X65L 1OTCA 1R9TH 1DOMA 4KJNA 1WTOA 2RDGA 5LMNQ 1E0BA 1ICWA 4RGNA 5IT9E 1SXTA 2NN6G 2BE5C 3H91A 4BA2I 2B2YC 3HZXA 1YJWA 5IYCG 4EGVA 2AQ3B 3T51B 1VQ6A 2XIWA 2A68D 1PHJA 4G7HC 2F0UA 2UU9L 3CF5A 4DKAC 5JPMC 3A56A 4EQ5A 5IYDH 1JT8A 2TSSA 5ELCA 2B2VA 1Q12A 2WP8J 3P75A 1N9WA 3JC66 1AN8A 1Y14B 2XRQD 5ELBA 3CHBD 4A3FH 2E2JH 3GTPH 4A3DG 1G6PA 4QB4A 5FO8B 3S17B 3GTMH 1Q86C 4L5QA 2PNRC 1F77A 1W3SA 1D1KA 1Y1VH 2WB1B 1L0XB 1B53A 1IHZA 2A73B 4LMQD 3S2DH 4ZUIA 3ZJYC 5LL6S 2ATWA 2OXPA 3Q22A 1JOKA 3TMEA 2MO1A 1HR0Q 4JI0Q 2L0CA 1V1QA 1PZJD 3KDFA 4XQNA 3HOWB 4ME3A 1CKNA 4UPAA 3GTKB 3HOUH 4HTHA 1AP0A 3NQTA 4JI3L 3PUXA 3WDNA 2NZOA 5FJ8G 2Z0SA 3K7AH 4JI8L 4OWXB 3NBIA 2E74C 3A55A 4R4IA 3A54A 1PH8A 3KJOA 2B29A 4ILWA 1QNKA 1KDBA 1X55A 5CYUA 1MSHA 1Q81C 2K52A 3M4OH 2VY3A 1QUQA 3M4YA 3S1RH 3W5OA 3OYYA 4C3JH 3ONAB 2ZJQA 1J8IA 4GLVB 4OXPA 4DR3Q 3TZUA 4YIJA 4IUVA 4P71A 3S2HH 4DR1Q 2BH8A 4CJ0B 3TSSA 5G3LD 4OWTB 4C2MB 1ILQA 2FFKB 2JA9A 1B8AA 1HNXL 4IFDH 5IOCA 1M90C 1BUVT 2A19A 4GN4B 4XT1B 2Y0SE 1KRTA 4K0KQ 2NBFA 3HOXH 4RH6A 1HH2P 3BZKA 1SROA 1C4QA 5BN4A 1YEZA 2KBNA 4R8IA 2E5LQ 4RFBA 1WJJA 1SJED 4WRDA 1C0AA 4K14A 3ULPA 4KKSA 2NWGA 1P8LA 2NTTA 1S4ZA 1E1OA 1HQRD 1JWMD 2FJ2A 1T9HA 2JA5B 3NEMA 3K0YA 1D5ZC 2JQOA 4A3JG 2PZUA 2A6EC 2NTSA 1X6OA 4K2KA 4CDCC 4UP8A 4C3IG 2JK8A 3FP9A 1KDAA 2RF4A 2KA7A 3I4MH 2F0WA 2M00A 3UDXA 1PH2A 3PO2B 2PMZE 4JI2Q 2EY5A 1ENCA 4TRDA 4LUVA 2CWAA 2A74C 4KD3A 1B50A 3PCOB 4ZLTF 4H0LC 3HKZG 1GJXA 2QKIC 2WKDA 1GKHA 4AH6A 2J7ZA 3VYRA 4GZYC 4JOIA 4QF4A 4JV5L 1H9KA 4DV2L 4PZ7A 4DV4L 3GTJB 1SYBA 2R7ZH 2D9UA 4NW2A 1RDPD 4DAYA 5C3EH 4WFN3 4C56C 2VUMB 3QOLA 4LUZA 3Q6SA 1TR5A 2K4KA 3W1BA 3STBD 1SE2A 4A3KG 1YNJC 1SMXA 5EPJA 2NVXH 4IPCA 3AQQA 1VQHA 2D5DA 4HIDA 1NUCA 1FNVA 5C5MA 1STGA 3NTIA 1LACA 5KGUA 5ELDA 1QOHA 4Y7NH 2F4IA 1H9SB 1EIHA 4X3TA 1RHPA 3DM1A 3KLRA 4CJ2C 1XMOQ 1HPCA 5IGGA 4JI5L 2P5ZX 4OO1G 3KYHC 4LF4L 4P72A 4PMWA 3TBIB 1X65A 1KD1C 2Q8TA 2H4OA 1G91A 1HNZQ 2DNCA 5IGDA 1V1PB 1CSQA 1VQNA 1LTBD 3AEVA 4JI3Q 3GV6A 3R2IA 1PYWD 3SHLA 2D2CC 1GUSA 3HOZH 2GA4B 4A3EB 2Q2TA 2QDBA 3K5LA 3CAMA 1WCMB 3RN2A 3H15A 3P1HA 1PVOA 3G6EA 3BJUA 1K83H 4IURA 1X3GA 2GVAA 1U5KA 2L4NA 1RKNA 2FMCA 2IX1A 5JEAH 1OXSC 2EIFA 3K81C 2ZJPA 1DXMA 1QILA 2WB1G 1B9MA 1N8RC 1PH4A 2JP1A 1TU2B 4K6DA 4GNXA 1PRTF 1BCPF 1ICFB 1KLUD 5I9OA 5C0XG 1KDCA 2JA6H 3TEHB 1J5EL 1BOSA 2OTJA 1HA6A 4B3TQ 1ESFA 4A3IG 1TWGB 3CRKC 1PMRA 2IWHA 4A4IA 1PH1A 2R92B 4HSPA 1F2LA 2K5VA 1WTPA 1U4PA 1YBYA 1B7YB 4K8IA 2IX3A 5CV7A 2KCTA 3S17H 1EWIA 4F7XA 1MI2A 1VQAA 2E2IB 2JA8B 2X6LA 1L1OC 3BYYB 4MIUA 1LV9A 5BN5A 4GS3A 4DV0Q 3H3VI 1C48A 2K28A 4LUOA 2Y0SB 1EQVA 1GUGA 1H95A 3TRZA 1SN8A 5J1ZA 3RUZA 3HG9A 4MTNA 2F3VA 1IBML 4RHSA 4GOPC 2G5DA 5KNBA 2RKSA 2Q8IB 3T4AC 1L0WA 4BY1G 2F3WA 2LXKA 3GQBA 4L63B 4JBWA 3HOWH 2NVYB 2EYJA 2E8GA 4DNIA 3GTKH 2KEEA 3L2PA 4LF8L 4NP5A 4Z9CB 1DOLA 4ZCKA 2O5JC 3TS0A 1E3PA 3A0JA 4NXML 5GROA 1D8LA 1WD1A 4PMCA 4A3BB 3HRZC 2V4DA 3NHHA 1KXLA 4DUYQ 3MEHA 1B2TA 2N49A 3GTGB 1TWFB 3K6OA 1AE2A 5D3DA 4DFAA 4KLKA 5T1GA 1NNXA 1R9TB 1Y8OB 4DK1A 2QDLA 3E3XA 2F4VQ 1PRTC 4IJHA 1BCPC 2BA0A 3HOVH 1QE6A 4S3SA 4G7ZC 1ZEQX 2NN6I 1N33L 5I6WA 1GXDC 2Z8LA 4M8AA 3JAMc 2PQAB 4BY7B 4FXGC 1DYQA 4X64Q 3D6CA 1EL0A 4JI5Q 3PMFA 1CM9A 4YWMA 3TP5A 3DWQA 3HKSA 4LJZC 1B1ZA 3T1YL 1PXUA 1SAPA 1I4PA 1KAWA 2SOBA 2N8NA 3R2TA 3I4OA 2NB0A 2X69A 5KNDA 4LF6L 3AU7A 4HR7B 1KL9A 1WI5A 3W2DA 2K5DA 2RBMA 1MGSA 4DV6Q 2JA5H 2N55A 4HSVA 1K8OA 1SNPA 4IUPA 3U58A 5CV9A 3SDZA 4B3SL 4GN5A 3OWFA 1SNMA 5D3IB 3K5OA 4JBMA 1J6QA 3MXUA 1XTDA 4OEMB 4A3GB 1BKBA 1JCKB 1ENFA 3PO2H 2NVTB 3CMEA 1SRUA 3K57A 3I7FA 4KY5A 4XYOA 2EYLA 1ENAA 3F8TA 4H02A 1X3EA 1QJOA 4CHTB 5JJIA 1V1OA 2F03A 5EJWA 1HNWQ 3CQZB 3QIAA 5IYBH 4IOCA 1I4XA 1QZGA 4I65A 2PCFB 4DR4L 2UUCL 2PQEA 4AYBE 3GTJH 1G2TA 4AQYQ 5I2YA 3J7YW 4DV7L 2QEXA 3M4OB 4U673 2EJFC 5JVH3 2Z6KC 3E5SA 1D1IA 1AFPA 1DZ1A 3A5ZB 4QUCA 4B9WA 4HCEA 2VUMH 1WCMG 4WJ3M 1DM0B 5C4XB 4ZQ3A 2R7FA 4XTCS 1JICA 5LMNL 5EKIA 1JR0D 5NUCA 4LW1A 5FLMG 2Z4HA 1NMGA 1IBMQ 4OHJA 2HDLA 3J81i 3NSWA 4OX9Q 3IFTA 3T16A 3LGJA 2NZ1D 2K03A 3I8ZA 1D7QA 1W6JA 5E4XA 3MZ5A 1CFMA 5GAGC 5ELFA 2F0KA 3UI2A 5AFWA 2B2VC 5C4HA 4DGZA 4DK6C 4LF8Q 2O5IC 1F2YA 1EY5A 1O80A 3KF6A 2WAQB 3NQIA 4A3EH 4K5XA 1GD7A 1RCVD 4KI0A 2HIVA 2I0QA 4ZUJA 1SYDA 1WCMH 3OIPA 4YWKA 3BZDB 4AIMA 3T53B 3E0JA 3D4DA 2VB2X 2Q8RE 1G8ZD 4QMGA 3OMGA 2EPBA 2MGSA 4FO2A 3EA6A 2JA8G 1VQCA 3SXHA 3W1GA 1FNWA 2Q2IA 1IW7D 4RG1A 1HR0L 4JI0L 1L1OB 2Y0SG 1GUWA 3VDYA 1HUNA 5G3LF 2WINB 3I4MB 3CKIB 2FHTA 5KNCA 5JVG3 2A68C 3K5MA 1N36Q 4ALPA 3ERSX 1YJNA 1TWGH 4NDXA 1Q46A 2QEJC 2R92H 4PMBA 4CDFC 1VQ4A 1IXRA 3N52A 1WTHA 1G51A 1LT4D 1LTID 2E2IH 1B70B 2LY7A 2JA8H 2QF7A 3C46A 5GQOA 4BA1I 4LF6Q 4DR3L 5D14A 2A69D 1TS2A 4CKCA 4JI6L 1V9PA 1KTKA 1Q3LA 4DR1L 3M85A 1SE8A 1V43A 4PZ6A 1PDQA 1VQ9A 2F3IA 2R3ZA 1N32Q 5BN3A 3PUYA 1LLRD 1PTOC 5IGEA 3KLWA 4DR6Q 1SJHD 2F0DA 1RIPA 2HQEA 1K8MA 4OO1I 4WJ4A 1CZGA 2NVYH 4KY7A 2F0HA 3PUWA 1G6ZA 4EVOA 3DUZA 2K75A 4KKTA 4FF4A 3RD4A 4C3HH 1BCPB 3AFPA 1F9PA 5I2XA 1B9NA 2E5LL 2VQFQ 4HMJA 4GKJQ 2F0FA 4A3BH 1GHJA 1E1TA 2RDHA 1GVPA 1EZ6A 1Y8NB 4ID6A 5IYDG 1IZ6A 2BCOA 1TY2A 4A3FG 3GTGH 3E9IA 2MNAA 1TWFH 1QVGA 5IP9H 2KCMA 3PIO3 4UP9A 1EUJA 4JI4Q 4QGUA 2L1BA 1DOKA 1Y1VG 3K8AA 3PF4A 1BBUA 2O4XA 4HJ5A 5M3FB 3CC4A 1BR9A 3TDQA 1S5ED 4QCLA 5C0XI 1Q82C 2RHQB 4JI2L 2HD3A 2JA6B 1NSNS 4BY7H 3VYTA 4AYBB 1EWHA 1RD9D 3LWEA 5DM73 3S1QB 4ULLA 5JAVA 1UEBA 2F0LA 4FP5D 4IN3A 2MFIA 4POFA 4DR2Q 2B2UA 4JOIC 3I55A 1MIUA 1PFMA 2ZTEA 1VQPA 1PA6A 3HOUG 3DEPA 4K5WA 4KV6A 4M1UB 5BR8Q 4DAVA 1IYVA 1K9MC 2D0OA 1UEAB 1QB5D 1XTCD 3MHBA 3NBHB 1H9RA 4RKLA 2ICIA 2ZXRA 1MJCA 5ELOA 3D6WA 2E75C 3M4QA 1A3TA 1II3A 4K8JA 2CW0C 4RA8A 4ZAIA 1FYCA 2AUKA 2XVSA 4C3JG 5TSSA 1XMOL 2DN8A 2KENA 5CC4A 4HJ7A 3OPOA 5C44B 4LF7Q 4A3GH 4A3MB 1NY4A 2MO0A 3RLOA 3EIVA 4BXXH 1HFGA 2CHBD 1E2WA 1HNZL 4B3MQ 2ZJRA 2NVTH 1O7YA 2KHJA 1EU3A 1XWEA 4IFDG 4YWLA 1EFID 4B08A 3OHXC 1T5XD 2CH4A 2IPKD 3PQIA 3HOXG 3CQZH 2K01A 2TMPA 3L3OC 5FLXL 1X3PA 4RCOA 1VS0A 1I94Q 2EYHA 3K0XA 5LMUQ 2K1BA 3RZOB 4F88A 1LUZA 1TS4A 1VF5C 2CH4W 3VYUA 5C4XH 5DM63 3GO5A 1UNSA 5C0XJ 3CCEA 4PNYA 4GNXC 4JI6Q 3CCUA 2OWOA 4OIKA 1IL2A 3HOVB 1PH6A 4TSSA 2V1CC 1S40A 4N9PA 3VR6A 2A6HC 3OSOA 3RR5A 1T5EA 4B3TL 5K36H 4HN7A 2LFNA 1LT3D 3I4MG 3OW7A 2UXCQ 3S1NB 3I4NB 3RLFA 4KJOA 3SVMA 3KDFB 3I90A 4BBRH 1Z7TA 1A3VA 3K58A 4GLXA 5CMDA 1ML0D 1Y69U 1JC7A 2BE5D 1JMCA 1TVXA 3NWTA 3FKIB 1WTRA 3BU2A 3CCLA 4DV0L 3H3VC 2XSCA 1HCZA 2L9HA 4Q5VA 5M3MB 1VQJA 1B4OA 2K6AA 3SK8A 1CHQD 1CA5A 3BVMA 3J7AV 1SEBD 1TIID 2R7ZG 1EFWA 2HT1A 3BS1A 5C3EG 3X3NA 1NR4A 5FLXE 1BBWA 4OGQC 3JAML 3V2TA 1CQVA 4A93B 5JPNC 3I4LA 3FVQA 2RHSB 2F0TA 1XNRQ 1STAA 5IT9c 1KAAA 2K05A 5E4WC 1JOQA 2KCCA 1HFNA 1EEFD 4CKEA 1H9SA 1W6KA 2D0PA 1S5CD 5CGKA 3IL8A 1PTOB 2G9DA 3K7UC 4YCUA 4DUYL 1K8GA 2JE6I 3ER0A 1X3FA 4Y52H 3NUCA 1VF7A 1K28A 1ILPA 3R8BA 3I2ZA 3HOZG 1HZ9A 1YHQA 3FHWA 1PLFA 2FINB 3LX0A 4KY6A 3PV0A 1VQEA 1YNNC 1WTQA 3EJIA 2F4VL 4EQOA 2CVRA 4GLAC 1K3BC 2RCNA 1O7ZA 3F2UA 1TQOA 3RZDB 1GUTA 2IL8A 1Y1WH 1BXTA 1UE5A 1EQQA 4V0BA 1VQ5A 2OTLA 5JEAG 4DR5Q 1J9OA 3BVZA 4X64L 2R7DA 3I73A 2MPMA 2ZXOA 1SNQA 3D0FA 4JI1Q 5E7NA 2PI2E 3VR5A 1SFOB 5A2QL 2K04A 4ZRZA 5IGFA 1X9NA 2JA6G 4J6HA 1A62A 4AYBG 2R93B 3QO2A 5F2DA 5ELNA 2YYZA 1ZYRC 1WOCA 2LXJA 1I4RA 5J22A 3PIOA 3KK7A 1PH9A 2A8VA 4I7AA 3D4RA 3KLSX 2QILA 4DV6L 4P73A 4DR7Q 4XT3B 1BQQT 1GUOA 2Z1CA 1HZAA 3G48A 2UUBQ 4JBJA 3SE0A 2ZT9C 3OMCA 3J81L 4DAYB 2B39A 2XN9C 4X66Q 1X32A 4A3LH 4EQPA 1JJCB 2IW3A 1F9SA 5FO9B 2DUDA 5M3FH 1B44D 4BBSB 3F2DA 2HQLA 4A76A 2PYKA 2XGTA 5A35A 5IWAL 3B6YA 2K5QA 1JB7A 2AUJD 1RTNA 1EY4A 3S1QH 2SNSA 1Z9FA 2KECA 1ASZA 4X3KA 4KN7C 1WD0A 3I56A 1HNWL 3HOWG 3K59A 2EXZA 1F9QA 1HA5A 3KF8B 4DPGA 3M7GA 3RMHA 4AQYL 2OF1A 3OTOQ 3CCJA 1ESRA 4NKLA 3S16B 3PO3B 1JOOA 2AWNA 2F0SA 1BO0A 1TS5A 2VQEL 2NVQB 3CU7A 4LFAQ 4RGTA 4G4KA 3FRPB 1RTOA 3OWEB 5AJ3Q 2WAQE 3RNUA 1PH5A 1JWUD 2SNMA 4QIWB 3U4VA 4OX9L 2RQXA 3ULLA 2B3GA 5C44H 1VQDA 3T13A 2XWBB 1SMYC 4E6IA 5CORA 4A3MH 3HOVG 1VMPA 5D65A 2L12A 2L5TA 1YVCA 3J7ZC 3U9SA 4X3UA 4GNXB 1AZQA 3MAQA 1C9OA 1SSOA 3J81E 4C3HB 3KUPA 1YNJD 2OQ0A 1HUMA 1KQSA 4LFBQ 2XRSD 2F0JA 2PQAA 5EKLA 1TWAB 2K33A 1E22A 2FMMA 3DWPA 2IX0A 3KBXA 1CA6A 3I4NG 4R4TA 1Q1EA 1B3AA 1E24A 2F0IA 2KJXA 3HOYB 3D8GA 5KEEA 1A8VA 1S5DD 2JYOA 3O13A 4DN4M 3RZOH 1HJPA 2JN4A 2K50A 2WIIB 3M3YH 1STNA 1PFSA 2H5XA 4HCSA 2MHVA 2JA5G 3J80c 3DHQA 3KJPA 3DM3A 1MD2D 1M4VA 1GOZA 3CPFA 1N36L 3JAMi 4O0AA 4OELB 2Z4IA 1D6EC 4KD4A 3DWAA 2I5MX 3CW2C 3HS0C 3SEBA 4UHVA 3I4NH 3S1NH 2PW5A 2I5LX 3PO2G 1TWCB 4LF5Q 2RCFA 1STYA 5EPLA 1NAPA 2JA7B 3UDGA 1NBWA 1U0LA 2RDFA 4RGOS 5ELEA 1HHVA 1HXYD 4DV3Q 2UXDQ 3A8JE 2RVLA 4UY8C 5IYBG 4KHZA 3FKIH 4DK0A 4YHHQ 3G6JB 4X62Q 5M3MH 4B9XA 1C7YA 3Q23A 4JK1C 2EYMA 4ZKCB 2HIXA 2AQ1B 2Q2UA 1N32L 2DJGC 3H0GH 4RWSC 2VUMG 1IW7C 1VQKA 4DR6L 3LNNA 5IODA 3HKZE 2H1EA 2HCCA 4A93H 1QVFA 1SE3A 2X6GA 3VA7A 3SK4A 5IWAQ 4IFDI 1KNEA 4FXDA 2VQFL 1WTXA 2ZXPA 4FYDA 2JJQA 4GKJL 4RGMA 3MXNA 2SEBD 1PTOH 4K5VA 5C6AA 3GD7A 4DV1Q 1A2TA 3D3RA 1OXXK 3VYSA 2F0EA 1YI2A 2R93G 5EPKA 4KHPQ 1K3RA 3LWUA 3ND8A 2PZWA 4A3EG 4NXNQ 1CHPD 4JI4L 2VQEQ 4K2LA 1LTGD 2A69C 4XQJA 5HURA 4IUNA 4TKOB 2XTIA 1H9MA 1VQ8A 5JJLA 3RZDH 3EFXD 2DJFC 1BF4A 3RLNA 2UUAQ 1LYLA 1PYSB 4TVAB 5LHY1 3G7LA 2HHHQ 1I3QB 2AWOA 3A74A 2B2UC 3C3LA 1L1OA 1VQFA 3QR8A 4DR2L 3M4PA 2UXBQ 3T56B 1SFOH 1XNQL 5CV4A 5BR8L 1MHWC 2R93H 5GADC 1TKWB 3AFQA 4JPBW 3CPWA 3BVGA 3IKJA 4BBRB 2L55A 3F2CA 1XPUA 4JYAQ 3VA5A 3FDTA 5C3XA 2R92G 5C4JB 4IPGA 2B63H 1S5FD 4FF3A 3L0OA 2KVMA 3EVQA 1PFNA 3KLSA 4RCNA 1SNOA 3A7LA 4GKKQ 2DY8A 4H13C 4IFDJ 1CKOA 4X3SA 2MJ8A 4JCVE 4O42A 4LF7L 4BBSH 4G57A 4MTKA 4G7OC 1MJEA 4B3ML 1SR3A 1PV4A 1DONA 4HEDA 1I6HH 3TQYA 5I4DA 4IZ8A 1EY7A 3TREA 4H7BA 5CBAE 4GOPB 2C35B 3K80C 3GTQB 1KLGD 4P2CB 1X54A 1IBKQ 1JE4A 2EQSA 4C3HG 1PH3A 3PUZA 1I94L 5JJKA 1ZXTA 5E3FA 5LMUL 3S16H 3PO3H 1STHA 3NP8A 4A3BG 1IBLQ 2LSSA 2NVQH 1LTSD 3NTKA 2YV5A 1G2SA 4HAEA 3GP7A 3SK5A 1IKLA 4DUZQ 1X56A 2AQ2B 5KYLA 5H1SE 3SK6A 3ND9A 1KC8C 1JE5A 1JJ2A 5IP9G 4C1NK 1XPOA 1Y1WB 2CKZB 1D5XC 2C5CA 1K73C 1MKHA 1QVCA 2WFWA 5IE8A 1A63A 4R9WA 3ICEA 4KTAA 2YTXA 4H44C 3MWYW 1D5MC 4I7ZC 5DEHA 2N78A 1EQRA 2O2LD 4DU9A 2VB3X 3NK9A 4IJLA 4A3JB 2UXCL 1PRTB 4L8JA 2BA1A 3FPPA 4BY7G 3GV3A 2DNEA 1KABA 3K5NA 1VQMA 1HQMC 5IP7G 1TWAH 4L5RC 1JQYD 2QA4A 3VR4A 1F2MA 1VQGA 5M5WH 3KBGA 3HOYH 3AYHB 3HKZB 4IOAA 1NE3A 4WJWA 5J3BA 1VMCA 1YIJA 4DAPA 1S3OA 3MFGA 2R61A 1ASYA 1AEXA 1QZHA 1HZCA 4A3CH 3S15B 4DXFA 3IFDA 2PO4A 4IPDA 4QY7A 1SLJA 3EROA 3A8IE 2VL6A 1C8CA 1UE6A 3BYTB 1XNRL 3H3VH 4KK7A 3NXWA 4A3KB 1FL0A 1AZPA 4O2DA 1YHBA 2B8FA 3RN5A 5C4ZA 2JSOA 5IP7H 1U9RA 2F0OA 4DA2A 4JI7Q 1XYIA 3CCVA 1SE4A 1EY6A 2AHOB 4A3GG 4BXXG 2VXWA 1IYJB 1XNQQ 3NTHA 1FJGQ 1TWCH 1I4GA 3PGZA 4R1JA 4HJAA 2JA7H 3NWSA 3GTOB 4JC0A 1LT6D 2RSNA 5JJZA 2J0TD 3S1MB 2ALYB 1I6VC 2JEBI 2Z6BA 5JEAJ 4FF2A 1FVIA 4KKUA 2HUGA 1IL8A 4HIOA 2C9OA 1HTLD 3EQLC 1LO5D 1EZ8A 2VS1A 5C4XG 4DR5L 1A0IA 2E2DC 1EU4A 4NB3A 3UDIA 3U4ZA 3PSIA 1VQOA 4A75A 3BDLA 4CBVA 1H9JA 1TS3A 5GAHC 4JI1L 1WTVA 4KHVA 1Y8PB 2ZTCA 5J39A 2EY2A 4EQNA 3KOJA 4PG3A 4JG2A 2NN6H 4MHEA 3OIQA 4R8NA 4B3RQ 1F2ZA 5K36G 5IYCH 2B2WA 2EDGA 4ME5A 1XX8A 2R6GA 5LMNW 3F2BA 2VNUD 2OT2A 1PTOD 1DCZA 1QWYA 1FGBD 4FVMA 4A3IB 1VDZA 3CCQA 4DR7L 3A8KE 4BBRG 4KN4C 2WAQG 2WKCA 4YCWA 2KUMA 4IPHA 2UUBL 3V05A 3N6RA 1EOTA 4A3DH 3CCRA 2EOTA 4R4OA 3M3YB 3STBC 1SYCA 1R4PB 4X66L 1EYAA 1LTLA 1SDFA 4BS9A 4PV1C 5KYIA 4QL5A 4LFCQ 4RHRA 2E2HB 3T1HQ 4HIKA 2IHFA 2NYZD 1L0YB 1ET6A 1I3QH 3QJYA 4APVA 1KRSA 2N88A 3SR1A 4BY1B 4QIWE 3Q24A 1XMQQ 4DV5Q 2CCZA 5JOBA 1CKNB 1XJVA 4DNRB 2LS01 3OTOL 1PZID 4CJ1B 4LNQA 3WWVA 2YTYA 4QUFA 3NELA 2IT1A 5C4JH 4LFAL 4QQBX 2CQOA 5EKKA 1HR0W 4LK1C 3DLLA 3P20A 3PUVA 5FJ8H 3D31A 3CC2A 3IAYA 1IYUA 2HCIA 2DGYA 3EBEA 5AJ3L 2ZM6Q 1VQBA 5IGCA 1YNXA 1EEID 5M5YB 3J80L 3PIP3 1QUQB 3H0GB 1EY8A 3E6ZX 3MTSA 1SNCA 5IIFA 1SBBB 2F0PA 2A5HA 2F52A 1Y1WG 3S14B 2OCEA 4LF9L 1O7LA 2B2TA 2QCPX 1E2ZA 3AB9A 4YY3Q 4LFBL 3NPPA 1NR2A 1KIXA 2L11A 1I4QA 3GTQH 2CW0D 5DAUA 4X65Q 2YU9B 3MA2B 2LMCB 3M9BA 4P75A 3EN2A 1CSPA 1V1PA 3BG3A 2ICEC 4RMFA 1X3QA 5DNFA 2DY7A 3Q0AA 5KIXA 1K0SA 2B2YA 4MN3A 3CMAA 2NZHA 1ET9A 3FPUB 3CCSA 2A1AA 1NJIC 1HRJA 2UU9Q 4R4CA 5GAEC 1Z6HA 1EOVA 4F8MA 4J8QA 2M2LA 2EY1A 3S24A 5FK9C 1ONLA 1GM5A 1QG7A 4A3LG 3M7NA 1LABA 1XPRA 4POGA 5M3FG 4HMIA 1FNUA 3X3MA 5L37A 4A3JH 2B8GA 2K5NA 4IALA 3J80E 1BBXC 4C3IH 4LF5L 4UDUC 3JAME 4K6LA 4YCVA 5C5LA 3W3AA 3CD6A 4DV3L 5IY0A 2UXDL 3J7A5 4YHHL 1K0RA 3L9AX 3URYA 2B63B 1CK1A 1CZWA 2A6HD 4X62L 3J81j 1Q8KA 3OOCA 1LM0A 3KF8A 2KEDA 3ULJA 2J4XA 4N9TA 3S15H 2PZTA 3TP7A 2Q2HA 1VCIA 3H94A 2SDFA 5CV8A 2KHSA 1BVSA 3CRLC 4JI8Q 2EYFA 2K5HA 3A7AB 5FO7B 1CUKA 1W2BA 2EE1A 4A3KH 2IY5B 1N34L 1MBYA 5T1IA 1I6HB 4WORA 1R4QB 2HDMA 5C3WA 1A3UA 1EIYB 3HGBA 5C44G 4CDEC 3C2PA 3C1FA 5FKAC 1DD2A 4A3MG 2K14A 2YTVA 1OXTA 1KNAA 4DV1L 2JXMB 2EXDA 2A6ED 4OO1H 1VQLA 5FOBB 2WV6D 4CDDC 1KHIA 1STBA 4KHPL 3GTOH 1U4LA 4CKBA 4NXNL 1STEA 4DF7A 2K7VA 1HNXQ 2QW7A 3S1MH 3QOJA 1AE3A 1UE1A 1E7ZA 4JBKA 1DJRD 5A2QE 4RKBA 1WFQA 1WVLA 3NENA 4O1NA 4MNOA 1E2VA 2JEAI 4IUTA 4NMZA 3DEOA 1TXYA 2I46A 5EQ0A 2UUAL 4U68A 1I5FA 4XXEA 2HHHL 3R3OA 4PQXA 2F0NA 1UUPA 3MC0B 4XDXA 1B3QA 3MXPA 1NTGA 5FLXc 2UXBL 4OONA 1U4RA 5IGBA 3H6MA 1YNND 4LF9Q 4IQZA 1I50B 4TQUS 5C0XH 5CR3A 3CC7A 4JYAL 2KQ3A 2WACA 4ABNA 1LTTD 2F0MA 5M5WB 3GDEA 4Q0FA 4L6TB 4A3IH 4N8FA 1UE7A 3SGIA 1NMFA 4DK3C 1EQTA 3VR3A 1BDOA 4FXKC
chains in the Genus database with same CATH topology
2E76C 2EYOA 3TZDA 5M5XB 1EWCA 1SYEA 1ZYRD 1TWHB 1EYCA 3DMUA 1FR3A 3GTLB 1A15A 2XWJB 1LTRD 2KOLA 1OXVA 3I72A 4OIJA 1RJTA 2PMZB 4UAIA 1O78A 2LKVA 1S5BD 3BDOA 2PW7A 1GHKA 5EGTA 1I4HA 2D62A 2F1MA 1U4MA 4ZKBB 5LL6X 4RAUC 1SYFA 1QCBD 1EIGA 1PFBA 5E1FA 4A3FB 2E2JB 3GTPB 3GTMB 2NUCA 1A6XA 4IUQA 4FF1A 1Y1VB 3R93A 3S2DB 2MP1A 4XIGS 1BNZA 1CT1D 3MXGA 1IKMA 3C1EA 1CI3M 5CV5A 1SYGA 2IJ0A 4OL7A 1TT2A 1SMYD 2K5WA 4ZYSA 1LT5D 1Q90A 3MFYA 3HOUB 3ERQA 4LAAA 5ISRA 4KMUC 4A3DB 2M9VA 3K7AB 4ZK9B 3P7JA 1JORA 3H09A 2F0QA 1QNUA 1AW7A 5CV6A 4DNTB 2F0VA 4DXGA 3I91A 3D4WA 3QB3A 3S1RB 1FD7D 2EY6A 4C3JB 1PZKD 1D2BA 3TP8A 1EY0A 2EZVA 3WOFA 4XQQA 1PRTD 3S2HB 1BCPD 4F87A 2MUYA 2EJMA 3S9WA 3VR2A 3QWNA 1M8AA 5M9OA 1Z47A 3J7AF 1PTOF 1JB3A 3HOXB 1GUNA 2G9HD 1EY9A 3FEWX 5EBCA 3WOEA 1WTWA 1Q1BA 2BDNA 4J1MA 4ODGA 2RSOA 4BWGB 2EYPA 2RA4A 2B2WC 5EBDA 1JWSD 3I70A 1Q8IA 1LTAD 3BDCA 1RF2D 3QG1A 1XXGA 3U9OA 4CGYB 5KRUA 4C1NI 2KCNA 5I9PA 1CTMA 1A2UA 2BOSA 2XNAC 1TY0A 2I07B 3HEJA 2PPBC 2EVBA 3HP3A 4XYQA 1OXUA 5IT9L 1MSGA 4IUUA 2R7ZB 5C3EB 1OO9B 3MVVA 1UAPA 5HGTA 4C3IB 2NVXB 2K32A 3ITPA 3L7ZC 1CQFA 5COYA 4Y7NB 5I6YA 3TN2A 1V8QA 3NE5B 4FNFA 2ENBA 1F9RA 3I3CA 5K5PA 3DXJC 1NCVA 1G291 3NBHA 2BDOA 3HOZB 2OEOA 3FMCA 1RODA 4V190 2EJGC 2ID0A 3AMUA 2B2TC 1HTPA 1SNDA 3TP6A 2CQAA 1K83B 1ZKOA 1EYDA 5CBEE 2F0GA 3V96A 3ZYYX 1DOMA 4KJNA 1WTOA 2RDGA 1E0BA 1ICWA 4RGNA 5IT9E 1SXTA 2NN6G 2BE5C 3H91A 4BA2I 2B2YC 3HZXA 4EGVA 2AQ3B 3T51B 2XIWA 2A68D 4G7HC 2F0UA 5JPMC 3A56A 2TSSA 5ELCA 2B2VA 1Q12A 2WP8J 3P75A 1AN8A 2XRQD 5ELBA 3CHBD 4QB4A 5FO8B 3S17B 2PNRC 1F77A 1D1KA 2WB1B 1L0XB 1B53A 1IHZA 2A73B 4LMQD 4ZUIA 5LL6S 2OXPA 3Q22A 1JOKA 3TMEA 2L0CA 4XQNA 1PZJD 3HOWB 3GTKB 4HTHA 1AP0A 3NQTA 3PUXA 3WDNA 3NBIA 2E74C 3A55A 3A54A 4ILWA 1QNKA 1KDBA 5CYUA 1MSHA 3M4YA 3ONAB 1J8IA 3TZUA 4YIJA 4IUVA 4CJ0B 3TSSA 5G3LD 4C2MB 1ILQA 2FFKB 4IFDH 5IOCA 1BUVT 4XT1B 2NBFA 4RH6A 1C4QA 5BN4A 4R8IA 4RFBA 1SJED 4WRDA 4K14A 4KKSA 2NWGA 2NTTA 1S4ZA 1HQRD 1JWMD 2FJ2A 2JA5B 3K0YA 1D5ZC 2PZUA 2A6EC 2NTSA 4K2KA 4C3IG 1KDAA 2KA7A 2F0WA 2M00A 3PO2B 2EY5A 1ENCA 4TRDA 2A74C 4KD3A 1B50A 4ZLTF 4H0LC 1GJXA 2QKIC 2WKDA 2J7ZA 3VYRA 4GZYC 4QF4A 1H9KA 3GTJB 1SYBA 2D9UA 4NW2A 1RDPD 4DAYA 4WFN3 4C56C 2VUMB 3QOLA 3Q6SA 1TR5A 1SE2A 1YNJC 5EPJA 2D5DA 1NUCA 1FNVA 5C5MA 1STGA 3NTIA 1LACA 5KGUA 5ELDA 1QOHA 2F4IA 1H9SB 1EIHA 4X3TA 1RHPA 3DM1A 3KLRA 4CJ2C 1HPCA 5IGGA 4OO1G 4PMWA 3TBIB 2Q8TA 2H4OA 1G91A 2DNCA 5IGDA 1V1PB 1LTBD 3GV6A 3R2IA 1PYWD 3SHLA 2D2CC 1GUSA 2GA4B 4A3EB 2QDBA 3K5LA 1WCMB 3P1HA 4IURA 2L4NA 1RKNA 2FMCA 2IX1A 5JEAH 1OXSC 1DXMA 1QILA 1B9MA 2JP1A 1TU2B 4K6DA 1PRTF 1BCPF 1KLUD 5I9OA 5C0XG 1KDCA 1BOSA 1HA6A 1ESFA 1TWGB 3CRKC 1PMRA 2IWHA 2R92B 4HSPA 1F2LA 1WTPA 1U4PA 4K8IA 2IX3A 5CV7A 4F7XA 1MI2A 2E2IB 2JA8B 2X6LA 3BYYB 4MIUA 1LV9A 5BN5A 1C48A 2K28A 2Y0SB 1EQVA 1GUGA 5J1ZA 3RUZA 3HG9A 2F3VA 4RHSA 5KNBA 2RKSA 2Q8IB 3T4AC 2F3WA 3GQBA 4L63B 4JBWA 2NVYB 2EYJA 2KEEA 4NP5A 4Z9CB 1DOLA 2O5JC 1WD1A 4PMCA 4A3BB 3HRZC 2V4DA 3NHHA 3MEHA 1B2TA 3GTGB 1TWFB 3K6OA 5D3DA 4DFAA 5T1GA 1R9TB 1Y8OB 4DK1A 1PRTC 1BCPC 2BA0A 1QE6A 4S3SA 4G7ZC 1ZEQX 2NN6I 5I6WA 1GXDC 2Z8LA 4M8AA 4BY7B 4FXGC 1DYQA 3D6CA 1EL0A 3PMFA 1CM9A 3TP5A 3DWQA 4LJZC 1B1ZA 1PXUA 1SAPA 1I4PA 2SOBA 3R2TA 2NB0A 2X69A 5KNDA 3AU7A 4HR7B 3W2DA 2K5DA 2RBMA 1MGSA 2N55A 4HSVA 1K8OA 1SNPA 4IUPA 5CV9A 3SDZA 3OWFA 1SNMA 5D3IB 3K5OA 3MXUA 4A3GB 1JCKB 1ENFA 2NVTB 3K57A 4KY5A 4XYOA 2EYLA 1ENAA 1QJOA 4CHTB 1V1OA 2F03A 5EJWA 3CQZB 3QIAA 1I4XA 4I65A 2PCFB 2PQEA 1G2TA 5I2YA 3J7YW 3M4OB 4U673 2EJFC 5JVH3 3E5SA 1AFPA 1D1IA 1DZ1A 4QUCA 4B9WA 4HCEA 1DM0B 5C4XB 4ZQ3A 4XTCS 1JICA 5EKIA 1JR0D 5NUCA 2Z4HA 4OHJA 2HDLA 3NSWA 3IFTA 3T16A 2NZ1D 2K03A 3I8ZA 1W6JA 5E4XA 3MZ5A 1CFMA 5ELFA 2F0KA 3UI2A 5AFWA 2B2VC 5C4HA 4DGZA 2O5IC 1F2YA 1EY5A 1O80A 2WAQB 3NQIA 4K5XA 1RCVD 4KI0A 4ZUJA 1SYDA 3OIPA 3BZDB 3T53B 3E0JA 3D4DA 2VB2X 2Q8RE 1G8ZD 4QMGA 3OMGA 2EPBA 2MGSA 4FO2A 3EA6A 3SXHA 1FNWA 1IW7D 1GUWA 1HUNA 5G3LF 2WINB 3I4MB 3CKIB 2FHTA 5KNCA 5JVG3 2A68C 3K5MA 4NDXA 2QEJC 4PMBA 3N52A 1LT4D 1LTID 2LY7A 2QF7A 3C46A 4BA1I 5D14A 2A69D 1TS2A 4CKCA 1KTKA 1Q3LA 3M85A 1V43A 1PDQA 2R3ZA 5BN3A 3PUYA 1LLRD 1PTOC 5IGEA 1SJHD 2F0DA 2HQEA 1K8MA 4OO1I 1CZGA 4KY7A 2F0HA 3PUWA 1G6ZA 4EVOA 3DUZA 4KKTA 4FF4A 3RD4A 1BCPB 5I2XA 1F9PA 1B9NA 4HMJA 2F0FA 1GHJA 2RDHA 1EZ6A 1Y8NB 4ID6A 2BCOA 1TY2A 3PIO3 2L1BA 1DOKA 2O4XA 5M3FB 1BR9A 3TDQA 1S5ED 4QCLA 5C0XI 2JA6B 1NSNS 3VYTA 4AYBB 1EWHA 1RD9D 3LWEA 5DM73 3S1QB 4ULLA 5JAVA 2F0LA 4FP5D 4IN3A 2B2UA 1PFMA 3DEPA 4K5WA 4KV6A 4M1UB 4DAVA 1IYVA 1UEAB 1QB5D 1XTCD 3MHBA 1H9RA 4RKLA 2ICIA 2ZXRA 3D6WA 2E75C 1A3TA 1II3A 4K8JA 2CW0C 4RA8A 4ZAIA 1FYCA 2AUKA 2XVSA 4C3JG 5TSSA 2DN8A 5CC4A 3OPOA 5C44B 4A3MB 1HFGA 2CHBD 1E2WA 1O7YA 1EU3A 1XWEA 4IFDG 1EFID 4B08A 3OHXC 1T5XD 2IPKD 2K01A 2TMPA 3L3OC 5FLXL 1X3PA 4RCOA 2EYHA 2K1BA 3RZOB 4F88A 1VF5C 1TS4A 3VYUA 5DM63 3GO5A 1UNSA 5C0XJ 4PNYA 4OIKA 3HOVB 4TSSA 4N9PA 3VR6A 2A6HC 3OSOA 1T5EA 5K36H 4HN7A 2LFNA 1LT3D 3OW7A 3S1NB 3I4NB 3RLFA 4KJOA 3SVMA 3I90A 1Z7TA 1A3VA 3K58A 5CMDA 1ML0D 1Y69U 1JC7A 2BE5D 1TVXA 3NWTA 3FKIB 1WTRA 3H3VC 2XSCA 1HCZA 2L9HA 4Q5VA 5M3MB 1B4OA 2K6AA 3SK8A 1CHQD 1CA5A 3BVMA 3J7AV 1SEBD 1TIID 3BS1A 3X3NA 1NR4A 5FLXE 4OGQC 3JAML 3V2TA 1CQVA 4A93B 5JPNC 3I4LA 3FVQA 2F0TA 1STAA 1KAAA 2K05A 5E4WC 1JOQA 2KCCA 1HFNA 1EEFD 4CKEA 1H9SA 1W6KA 5CGKA 1S5CD 3IL8A 1PTOB 2G9DA 2JE6I 3NUCA 1VF7A 1ILPA 3R8BA 1PLFA 2FINB 3LX0A 4KY6A 3PV0A 1YNNC 1WTQA 3EJIA 4EQOA 2CVRA 1O7ZA 3F2UA 1TQOA 3RZDB 1GUTA 2IL8A 1BXTA 4V0BA 5JEAG 1J9OA 3BVZA 3I73A 2MPMA 2ZXOA 1SNQA 3VR5A 1SFOB 5A2QL 2K04A 4ZRZA 5IGFA 4J6HA 2R93B 3QO2A 5F2DA 2YYZA 1ZYRC 1I4RA 5J22A 3KK7A 3D4RA 3KLSX 2QILA 4XT3B 1BQQT 1GUOA 2Z1CA 3SE0A 2ZT9C 3OMCA 3J81L 2B39A 2XN9C 1X32A 4EQPA 2IW3A 1F9SA 5FO9B 1B44D 4BBSB 2PYKA 5A35A 2K5QA 2AUJD 1RTNA 1EY4A 2SNSA 2KECA 4X3KA 4KN7C 1WD0A 3K59A 2EXZA 1F9QA 1HA5A 3M7GA 3RMHA 2OF1A 4NKLA 1ESRA 3S16B 3PO3B 1JOOA 2AWNA 2F0SA 1BO0A 1TS5A 2NVQB 3CU7A 4RGTA 4G4KA 3FRPB 1RTOA 3OWEB 1JWUD 2SNMA 4QIWB 2RQXA 3T13A 2XWBB 1SMYC 4E6IA 5CORA 1VMPA 5D65A 2L12A 2L5TA 3U9SA 4X3UA 1AZQA 3MAQA 1SSOA 3J81E 4C3HB 3KUPA 1YNJD 1HUMA 2XRSD 2F0JA 5EKLA 1TWAB 2K33A 2FMMA 3DWPA 2IX0A 3KBXA 1CA6A 1Q1EA 1B3AA 2KJXA 2F0IA 3HOYB 3D8GA 5KEEA 1S5DD 2JYOA 3O13A 4DN4M 2WIIB 1STNA 4HCSA 2MHVA 3DHQA 1MD2D 1M4VA 1GOZA 2Z4IA 1D6EC 4KD4A 3DWAA 3HS0C 3SEBA 2PW5A 1TWCB 1STYA 5EPLA 1NAPA 2JA7B 2RDFA 4RGOS 5ELEA 1HHVA 1HXYD 3A8JE 2RVLA 4KHZA 4DK0A 3G6JB 4B9XA 3Q23A 4JK1C 2EYMA 4ZKCB 2AQ1B 4RWSC 1IW7C 3LNNA 5IODA 2H1EA 2HCCA 1SE3A 2X6GA 3VA7A 3SK4A 4IFDI 1KNEA 4FXDA 1WTXA 2ZXPA 4FYDA 4RGMA 3MXNA 2SEBD 1PTOH 4K5VA 5C6AA 3GD7A 1A2TA 3D3RA 1OXXK 3VYSA 2F0EA 5EPKA 3LWUA 3ND8A 2PZWA 1CHPD 4K2LA 1LTGD 2A69C 4XQJA 5HURA 4IUNA 4TKOB 1H9MA 3EFXD 1BF4A 5LHY1 3G7LA 1I3QB 2AWOA 2B2UC 3C3LA 3T56B 5CV4A 1TKWB 3BVGA 3IKJA 4BBRB 2L55A 3VA5A 3FDTA 5C3XA 5C4JB 1S5FD 4FF3A 2KVMA 3EVQA 1PFNA 3KLSA 4RCNA 1SNOA 3A7LA 2DY8A 4H13C 4IFDJ 4X3SA 2MJ8A 4O42A 4G57A 4G7OC 1DONA 4HEDA 5I4DA 4IZ8A 1EY7A 4H7BA 5CBAE 3GTQB 1KLGD 4P2CB 1JE4A 4C3HG 3PUZA 1ZXTA 5E3FA 1STHA 3NP8A 1LTSD 3NTKA 1G2SA 4HAEA 3GP7A 3SK5A 1IKLA 2AQ2B 5KYLA 3SK6A 3ND9A 4C1NK 1Y1WB 1D5XC 2C5CA 4R9WA 4KTAA 4H44C 3MWYW 1D5MC 4I7ZC 5DEHA 2O2LD 4DU9A 2VB3X 3NK9A 4A3JB 1PRTB 4L8JA 2BA1A 3FPPA 3GV3A 2DNEA 1KABA 3K5NA 1HQMC 1JQYD 3VR4A 1F2MA 3KBGA 3HKZB 4WJWA 1VMCA 4DAPA 3MFGA 2R61A 1AEXA 3S15B 4DXFA 3IFDA 2PO4A 3EROA 3A8IE 1C8CA 3BYTB 4KK7A 3NXWA 4A3KB 1AZPA 2B8FA 5C4ZA 2JSOA 1U9RA 2F0OA 4DA2A 1XYIA 1SE4A 1EY6A 2VXWA 3NTHA 1I4GA 3NWSA 3GTOB 1LT6D 2RSNA 5JJZA 2J0TD 3S1MB 1I6VC 2JEBI 5JEAJ 4FF2A 4KKUA 2HUGA 1IL8A 2C9OA 1HTLD 3EQLC 1LO5D 1EZ8A 2E2DC 1EU4A 3BDLA 4CBVA 1H9JA 1TS3A 1WTVA 4KHVA 1Y8PB 5J39A 2EY2A 4EQNA 2NN6H 4MHEA 3OIQA 4R8NA 1F2ZA 5K36G 2B2WA 2EDGA 4ME5A 1XX8A 2R6GA 2VNUD 2OT2A 1PTOD 1DCZA 1QWYA 1FGBD 4FVMA 4A3IB 1VDZA 3A8KE 4KN4C 2WKCA 2KUMA 3V05A 3N6RA 1EOTA 2EOTA 3M3YB 1SYCA 1R4PB 1EYAA 1SDFA 4BS9A 4PV1C 5KYIA 4RHRA 2E2HB 2NYZD 1L0YB 1ET6A 3QJYA 2N88A 3SR1A 4BY1B 3Q24A 5JOBA 4DNRB 2LS01 1PZID 4CJ1B 4QUFA 2IT1A 5EKKA 4LK1C 3P20A 3PUVA 3D31A 3IAYA 1IYUA 2HCIA 5IGCA 1EEID 5M5YB 3J80L 3PIP3 3H0GB 1EY8A 3E6ZX 3MTSA 1SNCA 5IIFA 1SBBB 2F0PA 2A5HA 3S14B 1O7LA 2B2TA 2QCPX 1E2ZA 3AB9A 3NPPA 1NR2A 2L11A 1I4QA 2CW0D 5DAUA 2YU9B 3MA2B 2LMCB 1V1PA 3BG3A 2ICEC 1X3QA 5DNFA 2DY7A 3Q0AA 5KIXA 2B2YA 4MN3A 1ET9A 3FPUB 1HRJA 1Z6HA 4F8MA 4J8QA 2M2LA 2EY1A 5FK9C 1ONLA 1QG7A 3M7NA 1LABA 4HMIA 1FNUA 3X3MA 2B8GA 4IALA 3J80E 1BBXC 4UDUC 3JAME 4K6LA 5C5LA 3W3AA 3L9AX 3URYA 2B63B 1CK1A 1CZWA 2A6HD 3OOCA 3KF8A 2KEDA 2J4XA 4N9TA 2PZTA 3TP7A 1VCIA 3H94A 2SDFA 5CV8A 2KHSA 3CRLC 2EYFA 3A7AB 5FO7B 2EE1A 1MBYA 5T1IA 1I6HB 4WORA 1R4QB 2HDMA 5C3WA 1A3UA 3HGBA 3C2PA 3C1FA 5FKAC 1DD2A 1OXTA 1KNAA 2JXMB 2A6ED 4OO1H 5FOBB 2WV6D 1STBA 1U4LA 4CKBA 1STEA 4DF7A 2K7VA 3QOJA 1DJRD 5A2QE 4RKBA 1WVLA 4O1NA 1E2VA 2JEAI 4IUTA 4NMZA 3DEOA 2I46A 5EQ0A 4U68A 4XXEA 3R3OA 4PQXA 2F0NA 1UUPA 3MC0B 4XDXA 3MXPA 1U4RA 5IGBA 3H6MA 1YNND 4IQZA 1I50B 4TQUS 5C0XH 5CR3A 2KQ3A 2WACA 4ABNA 1LTTD 2F0MA 5M5WB 4Q0FA 4L6TB 1EQTA 3VR3A 1BDOA 4FXKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LV9 A;  2J7Z A;  3I91 A;  2KVM A;  3TZD A;  1NR4 A;  2K28 A;  2N88 A;  1C8C A;  1PFN A;  5EPL A;  1NAP A;  1AP0 A;  1RTN A;  2KEC A;  1AZP A;  5COY A;  1HHV A;  2KED A;  4X3K A;  2RVL A;  1WD0 A;  1A15 A;  2D9U A;  3N52 A;  4NW2 A;  2DY8 A;  4CJ1 B;  3D6W A;  3TN2 A;  4QUF A;  1F9Q A;  3Q6S A;  4X3S A;  1F9R A;  2MJ8 A;  1B2T A;  1XYI A;  2SDF A;  3I3C A;  4O42 A;  4RA8 A;  2KOL A;  4ZAI A;  4OIJ A;  1QNK A;  5EJW A;  1RJT A;  2VXW A;  5EPJ A;  2K05 A;  5E4W C;  1MSH A;  4ZKC B;  1ESR A;  1NCV A;  5D14 A;  1M8A A;  1DON A;  1HFN A;  4HED A;  2HCI A;  4UAI A;  2KEE A;  1BO0 A;  4RWS C;  3IL8 A;  2EE1 A;  1Q3L A;  1G2T A;  1DOL A;  1HFG A;  1ROD A;  3ONA B;  2H1E A;  2HCC A;  5CBA E;  2RSN A;  5T1I A;  1PDQ A;  5JJZ A;  4X3T A;  1J8I A;  1O7Y A;  1RHP A;  1RTO A;  2X6G A;  3DM1 A;  4CJ2 C;  2R3Z A;  1WD1 A;  2HDM A;  1DZ1 A;  4IUV A;  2B2T C;  4QUC A;  3MTS A;  1ILP A;  2Q8T A;  4CJ0 B;  5CBE E;  1JE4 A;  1G91 A;  1JIC A;  1PLF A;  1ZXT A;  1ILQ A;  1KNE A;  1KNA A;  2FFK B;  2FIN B;  2HUG A;  1IL8 A;  1U4M A;  2K01 A;  1WTX A;  4ZKB B;  3GV6 A;  4RAU C;  1WTW A;  1G6Z A;  2BDN A;  2B2T A;  1X3P A;  1WTQ A;  1G2S A;  2CVR A;  1DOM A;  1EIG A;  1U4L A;  4XT1 B;  4HAE A;  5COR A;  1F9P A;  1NR2 A;  1VMP A;  2HDL A;  2L12 A;  1IKL A;  1E0B A;  5D65 A;  1ICW A;  1O7Z A;  1PFB A;  2L11 A;  3F2U A;  4X3U A;  2IL8 A;  2K1B A;  2NZ1 D;  2RSO A;  5T1G A;  1AZQ A;  2K03 A;  3I8Z A;  1SSO A;  5E4X A;  3H91 A;  3KUP A;  5EPK A;  1WTV A;  2B2Y C;  1HUM A;  2RA4 A;  2B2W C;  3UI2 A;  1WVL A;  1J9O A;  1QE6 A;  5AFW A;  2B2V C;  4IUR A;  4R8I A;  2XIW A;  4IUQ A;  4MHE A;  4OIK A;  2MPM A;  1X3Q A;  2FMM A;  2L4N A;  3DEO A;  4IUT A;  3KBX A;  4R9W A;  5DNF A;  1EIH A;  1CA6 A;  3R93 A;  1O80 A;  2DY7 A;  5EQ0 A;  4U68 A;  1B3A A;  2B2Y A;  2K04 A;  2MP1 A;  2B2W A;  3MWY W;  4MN3 A;  5EKI A;  1EL0 A;  1XX8 A;  2L1B A;  3FPU B;  2B2V A;  2NWG A;  3QO2 A;  2JP1 A;  1BNZ A;  1CM9 A;  1DOK A;  4XDX A;  1S4Z A;  2JYO A;  4DN4 M;  1BF4 A;  1HRJ A;  2FJ2 A;  1IKM A;  3G7L A;  3GV3 A;  2Q8R E;  1U4R A;  2M2L A;  2KUM A;  2EPB A;  1SAP A;  1HA6 A;  2MGS A;  3SVM A;  1EOT A;  2B2U C;  2EOT A;  3HP3 A;  1B53 A;  4HCS A;  1QG7 A;  2X69 A;  3I90 A;  4XT3 B;  4LMQ D;  3LWE A;  1F2L A;  5CMD A;  1ML0 D;  1SDF A;  1WTP A;  1U4P A;  1VMC A;  1MSG A;  1GUW A;  4IUU A;  1TVX A;  1WTO A;  1HUN A;  1MGS A;  1BBX C;  4ZK9 B;  2B2U A;  1WTR A;  1PFM A;  1X32 A;  1MI2 A;  2N55 A;  3FDT A;  3IFD A;  3P7J A;  2L9H A;  3DEP A;  4HSV A;  1F9S A;  1B50 A;  4ZLT F;  4IUP A;  2FHT A;  2X6L A;  1B4O A;  1EQT A;  2NYZ D;  1CA5 A; 
#chains in the Genus database with same CATH topology
 2E76 C;  4GKK L;  2EYO A;  3TZD A;  3FKI G;  4MZ9 A;  5M5X B;  5EAY A;  1EWC A;  1YIT A;  1SYE A;  1ZYR D;  5M3M G;  1TWH B;  1O7I A;  1EYC A;  2Z9H A;  3DMU A;  1FR3 A;  1L2F A;  3GTL B;  1A15 A;  4JV5 Q;  3J80 i;  2E2H H;  2L15 A;  4DV2 Q;  4IO9 A;  2PI2 A;  3H0G G;  4DV4 Q;  2XWJ B;  1LTR D;  2KOL A;  1OXV A;  3I72 A;  4OIJ A;  5DLQ E;  1RJT A;  4A93 G;  1UWV A;  1FGU A;  4UP7 A;  2PMZ B;  4UAI A;  1O78 A;  4BY1 H;  2LKV A;  2AMC B;  4OWW B;  1IBK L;  1S5B D;  4C2M H;  3BDO A;  2PW7 A;  1GHK A;  5EGT A;  1YZ6 A;  1IBL L;  2ASB A;  1I4H A;  4DUZ L;  2D62 A;  2F1M A;  1U4M A;  2GVB A;  4ZKB B;  5LL6 X;  3PIP A;  4RAU C;  4LF4 Q;  1SYF A;  1QCB D;  1EIG A;  1K8A C;  5M5Y H;  1PFB A;  5E1F A;  4A3F B;  2E2J B;  3GTP B;  1WYD A;  1VQ7 A;  3GTM B;  2NUC A;  1A6X A;  4IUQ A;  4FF1 A;  3S14 H;  1Y1V B;  1N34 Q;  3R93 A;  3KFU A;  1JJG A;  3S2D B;  2MP1 A;  3HFZ B;  4XIG S;  3A5U A;  1BNZ A;  1CT1 D;  2YU9 H;  3MXG A;  1IKM A;  3C1E A;  1CI3 M;  5CV5 A;  1SYG A;  2IJ0 A;  4OL7 A;  1TT2 A;  1SMY D;  2K5W A;  4ZYS A;  1LT5 D;  1Q90 A;  3MFY A;  3HOU B;  3ERQ A;  1J5E Q;  4LAA A;  1CKM A;  2CFM A;  5ISR A;  4KMU C;  1VQI A;  2MQH A;  4A3D B;  2FXQ A;  2B63 G;  2M9V A;  3K7A B;  4ZK9 B;  1EYG A;  4DAM A;  2AKW B;  2CWP A;  3P7J A;  1JOR A;  2PNH A;  3H09 A;  3CCM A;  1EIF A;  2F0Q A;  3G4S A;  1QNU A;  1AW7 A;  5CV6 A;  4R4Q A;  4DNT B;  2F0V A;  4DXG A;  3F1Z A;  3I91 A;  3D4W A;  3QB3 A;  3S1R B;  1FD7 D;  3G71 A;  3E0E A;  4JI7 L;  4BBS G;  1GO3 E;  2EY6 A;  1PZK D;  4C3J B;  1D2B A;  3TP8 A;  1FJG L;  1EY0 A;  3OW2 A;  4NPS A;  2EZV A;  3WOF A;  4XQQ A;  4JW0 A;  1PRT D;  3S2H B;  1BCP D;  4F87 A;  2MUY A;  2EJM A;  3S9W A;  3BZC A;  3VR2 A;  3J81 c;  2QGQ A;  3QWN A;  1M8A A;  4GOP A;  5M9O A;  2WB1 E;  1Z47 A;  3PF5 A;  3J7A F;  1PTO F;  3MXN B;  1JB3 A;  2OQK A;  5HGQ A;  3HOX B;  1GUN A;  5HY6 A;  3PO3 G;  2G9H D;  3CP0 A;  4P74 A;  1EY9 A;  3FEW X;  5EBC A;  3WOE A;  4NXM Q;  1M1K C;  1WTW A;  1Q1B A;  2BDN A;  4J1M A;  1P16 A;  3UDF A;  4ODG A;  5FLM H;  2RSO A;  4BWG B;  2EYP A;  1YJ9 A;  3IRB A;  2RA4 A;  4B3R L;  2B2W C;  5EBD A;  1DGS A;  1JWS D;  3I70 A;  2BH2 A;  1Q8I A;  1LTA D;  3BDC A;  3MEF A;  1RF2 D;  4EX5 A;  3QG1 A;  3E9H A;  4LWC A;  1XXG A;  3U9O A;  1N33 Q;  4CGY B;  5KRU A;  1AH9 A;  2VW9 A;  3KF6 B;  4C1N I;  2KCN A;  5I9P A;  1CTM A;  1A2U A;  2BOS A;  2XNA C;  3HOY G;  1TY0 A;  2I07 B;  3HEJ A;  2PPB C;  2EVB A;  4L5T A;  3HP3 A;  4LFC L;  4J15 A;  3T1Y Q;  1HZB A;  4A3C G;  3T1H L;  4XYQ A;  3TS2 A;  1OXU A;  5IT9 L;  4X6A H;  4HJ9 A;  1MSG A;  4IUU A;  4N8X 1;  4QJF A;  2R7Z B;  5C3E B;  1OO9 B;  2VZA A;  3MVV A;  4HJ8 A;  4HIM A;  1UAP A;  3UE1 A;  1XMQ L;  4DV5 L;  5HGT A;  2ES2 A;  4C3I B;  2NVX B;  2GN5 A;  3U50 C;  1I50 H;  3UE0 A;  2K32 A;  1PH7 A;  3ITP A;  1S72 A;  3L7Z C;  1CQF A;  5COY A;  4Y7N B;  4B3S Q;  1Q7Y C;  5I6Y A;  1PYB A;  4K0K L;  2IHE A;  4FDB A;  3TN2 A;  1V8Q A;  4FNF A;  3NE5 B;  4GN3 B;  2ENB A;  1F9R A;  2ZM6 L;  2JA7 G;  3I3C A;  5K5P A;  1RL2 A;  3DXJ C;  1NCV A;  4JVZ A;  1G29 1;  3NBH A;  2BDO A;  5M5X H;  1YHA A;  3HOZ B;  2OEO A;  3FMC A;  2I5H A;  1TWH H;  1ROD A;  4V19 0;  2ZTD A;  3GTL H;  2EJG C;  2ID0 A;  3AMU A;  4DR4 Q;  2B2T C;  2UUC Q;  1HTP A;  2KHI A;  1SND A;  3TP6 A;  2CQA A;  1K83 B;  1ZKO A;  1EYD A;  5CBE E;  4YY3 L;  2F0G A;  4DV7 Q;  4L5S A;  4PZ8 A;  2N3S A;  3Q8D A;  3V96 A;  3CXC A;  2Z6K A;  3ZYY X;  4X65 L;  1OTC A;  1R9T H;  1DOM A;  4KJN A;  1WTO A;  2RDG A;  5LMN Q;  1E0B A;  1ICW A;  4RGN A;  5IT9 E;  1SXT A;  2NN6 G;  2BE5 C;  3H91 A;  4BA2 I;  2B2Y C;  3HZX A;  1YJW A;  5IYC G;  4EGV A;  2AQ3 B;  3T51 B;  1VQ6 A;  2XIW A;  2A68 D;  1PHJ A;  4G7H C;  2F0U A;  2UU9 L;  3CF5 A;  4DKA C;  5JPM C;  3A56 A;  4EQ5 A;  5IYD H;  1JT8 A;  2TSS A;  5ELC A;  2B2V A;  1Q12 A;  2WP8 J;  3P75 A;  1N9W A;  3JC6 6;  1AN8 A;  1Y14 B;  2XRQ D;  5ELB A;  3CHB D;  4A3F H;  2E2J H;  3GTP H;  4A3D G;  1G6P A;  4QB4 A;  5FO8 B;  3S17 B;  3GTM H;  1Q86 C;  4L5Q A;  2PNR C;  1F77 A;  1W3S A;  1D1K A;  1Y1V H;  2WB1 B;  1L0X B;  1B53 A;  1IHZ A;  2A73 B;  4LMQ D;  3S2D H;  4ZUI A;  3ZJY C;  5LL6 S;  2ATW A;  2OXP A;  3Q22 A;  1JOK A;  3TME A;  2MO1 A;  1HR0 Q;  4JI0 Q;  2L0C A;  1V1Q A;  1PZJ D;  3KDF A;  4XQN A;  3HOW B;  4ME3 A;  1CKN A;  4UPA A;  3GTK B;  3HOU H;  4HTH A;  1AP0 A;  3NQT A;  4JI3 L;  3PUX A;  3WDN A;  2NZO A;  5FJ8 G;  2Z0S A;  3K7A H;  4JI8 L;  4OWX B;  3NBI A;  2E74 C;  3A55 A;  4R4I A;  3A54 A;  1PH8 A;  3KJO A;  2B29 A;  4ILW A;  1QNK A;  1KDB A;  1X55 A;  5CYU A;  1MSH A;  1Q81 C;  2K52 A;  3M4O H;  2VY3 A;  1QUQ A;  3M4Y A;  3S1R H;  3W5O A;  3OYY A;  4C3J H;  3ONA B;  2ZJQ A;  1J8I A;  4GLV B;  4OXP A;  4DR3 Q;  3TZU A;  4YIJ A;  4IUV A;  4P71 A;  3S2H H;  4DR1 Q;  2BH8 A;  4CJ0 B;  3TSS A;  5G3L D;  4OWT B;  4C2M B;  1ILQ A;  2FFK B;  2JA9 A;  1B8A A;  1HNX L;  4IFD H;  5IOC A;  1M90 C;  1BUV T;  2A19 A;  4GN4 B;  4XT1 B;  2Y0S E;  1KRT A;  4K0K Q;  2NBF A;  3HOX H;  4RH6 A;  1HH2 P;  3BZK A;  1SRO A;  1C4Q A;  5BN4 A;  1YEZ A;  2KBN A;  4R8I A;  2E5L Q;  4RFB A;  1WJJ A;  1SJE D;  4WRD A;  1C0A A;  4K14 A;  3ULP A;  4KKS A;  2NWG A;  1P8L A;  2NTT A;  1S4Z A;  1E1O A;  1HQR D;  1JWM D;  2FJ2 A;  1T9H A;  2JA5 B;  3NEM A;  3K0Y A;  1D5Z C;  2JQO A;  4A3J G;  2PZU A;  2A6E C;  2NTS A;  1X6O A;  4K2K A;  4CDC C;  4UP8 A;  4C3I G;  2JK8 A;  3FP9 A;  1KDA A;  2RF4 A;  2KA7 A;  3I4M H;  2F0W A;  2M00 A;  3UDX A;  1PH2 A;  3PO2 B;  2PMZ E;  4JI2 Q;  2EY5 A;  1ENC A;  4TRD A;  4LUV A;  2CWA A;  2A74 C;  4KD3 A;  1B50 A;  3PCO B;  4ZLT F;  4H0L C;  3HKZ G;  1GJX A;  2QKI C;  2WKD A;  1GKH A;  4AH6 A;  2J7Z A;  3VYR A;  4GZY C;  4JOI A;  4QF4 A;  4JV5 L;  1H9K A;  4DV2 L;  4PZ7 A;  4DV4 L;  3GTJ B;  1SYB A;  2R7Z H;  2D9U A;  4NW2 A;  1RDP D;  4DAY A;  5C3E H;  4WFN 3;  4C56 C;  2VUM B;  3QOL A;  4LUZ A;  3Q6S A;  1TR5 A;  2K4K A;  3W1B A;  3STB D;  1SE2 A;  4A3K G;  1YNJ C;  1SMX A;  5EPJ A;  2NVX H;  4IPC A;  3AQQ A;  1VQH A;  2D5D A;  4HID A;  1NUC A;  1FNV A;  5C5M A;  1STG A;  3NTI A;  1LAC A;  5KGU A;  5ELD A;  1QOH A;  4Y7N H;  2F4I A;  1H9S B;  1EIH A;  4X3T A;  1RHP A;  3DM1 A;  3KLR A;  4CJ2 C;  1XMO Q;  1HPC A;  5IGG A;  4JI5 L;  2P5Z X;  4OO1 G;  3KYH C;  4LF4 L;  4P72 A;  4PMW A;  3TBI B;  1X65 A;  1KD1 C;  2Q8T A;  2H4O A;  1G91 A;  1HNZ Q;  2DNC A;  5IGD A;  1V1P B;  1CSQ A;  1VQN A;  1LTB D;  3AEV A;  4JI3 Q;  3GV6 A;  3R2I A;  1PYW D;  3SHL A;  2D2C C;  1GUS A;  3HOZ H;  2GA4 B;  4A3E B;  2Q2T A;  2QDB A;  3K5L A;  3CAM A;  1WCM B;  3RN2 A;  3H15 A;  3P1H A;  1PVO A;  3G6E A;  3BJU A;  1K83 H;  4IUR A;  1X3G A;  2GVA A;  1U5K A;  2L4N A;  1RKN A;  2FMC A;  2IX1 A;  5JEA H;  1OXS C;  2EIF A;  3K81 C;  2ZJP A;  1DXM A;  1QIL A;  2WB1 G;  1B9M A;  1N8R C;  1PH4 A;  2JP1 A;  1TU2 B;  4K6D A;  4GNX A;  1PRT F;  1BCP F;  1ICF B;  1KLU D;  5I9O A;  5C0X G;  1KDC A;  2JA6 H;  3TEH B;  1J5E L;  1BOS A;  2OTJ A;  1HA6 A;  4B3T Q;  1ESF A;  4A3I G;  1TWG B;  3CRK C;  1PMR A;  2IWH A;  4A4I A;  1PH1 A;  2R92 B;  4HSP A;  1F2L A;  2K5V A;  1WTP A;  1U4P A;  1YBY A;  1B7Y B;  4K8I A;  2IX3 A;  5CV7 A;  2KCT A;  3S17 H;  1EWI A;  4F7X A;  1MI2 A;  1VQA A;  2E2I B;  2JA8 B;  2X6L A;  1L1O C;  3BYY B;  4MIU A;  1LV9 A;  5BN5 A;  4GS3 A;  4DV0 Q;  3H3V I;  1C48 A;  2K28 A;  4LUO A;  2Y0S B;  1EQV A;  1GUG A;  1H95 A;  3TRZ A;  1SN8 A;  5J1Z A;  3RUZ A;  3HG9 A;  4MTN A;  2F3V A;  1IBM L;  4RHS A;  4GOP C;  2G5D A;  5KNB A;  2RKS A;  2Q8I B;  3T4A C;  1L0W A;  4BY1 G;  2F3W A;  2LXK A;  3GQB A;  4L63 B;  4JBW A;  3HOW H;  2NVY B;  2EYJ A;  2E8G A;  4DNI A;  3GTK H;  2KEE A;  3L2P A;  4LF8 L;  4NP5 A;  4Z9C B;  1DOL A;  4ZCK A;  2O5J C;  3TS0 A;  1E3P A;  3A0J A;  4NXM L;  5GRO A;  1D8L A;  1WD1 A;  4PMC A;  4A3B B;  3HRZ C;  2V4D A;  3NHH A;  1KXL A;  4DUY Q;  3MEH A;  1B2T A;  2N49 A;  3GTG B;  1TWF B;  3K6O A;  1AE2 A;  5D3D A;  4DFA A;  4KLK A;  5T1G A;  1NNX A;  1R9T B;  1Y8O B;  4DK1 A;  2QDL A;  3E3X A;  2F4V Q;  1PRT C;  4IJH A;  1BCP C;  2BA0 A;  3HOV H;  1QE6 A;  4S3S A;  4G7Z C;  1ZEQ X;  2NN6 I;  1N33 L;  5I6W A;  1GXD C;  2Z8L A;  4M8A A;  3JAM c;  2PQA B;  4BY7 B;  4FXG C;  1DYQ A;  4X64 Q;  3D6C A;  1EL0 A;  4JI5 Q;  3PMF A;  1CM9 A;  4YWM A;  3TP5 A;  3DWQ A;  3HKS A;  4LJZ C;  1B1Z A;  3T1Y L;  1PXU A;  1SAP A;  1I4P A;  1KAW A;  2SOB A;  2N8N A;  3R2T A;  3I4O A;  2NB0 A;  2X69 A;  5KND A;  4LF6 L;  3AU7 A;  4HR7 B;  1KL9 A;  1WI5 A;  3W2D A;  2K5D A;  2RBM A;  1MGS A;  4DV6 Q;  2JA5 H;  2N55 A;  4HSV A;  1K8O A;  1SNP A;  4IUP A;  3U58 A;  5CV9 A;  3SDZ A;  4B3S L;  4GN5 A;  3OWF A;  1SNM A;  5D3I B;  3K5O A;  4JBM A;  1J6Q A;  3MXU A;  1XTD A;  4OEM B;  4A3G B;  1BKB A;  1JCK B;  1ENF A;  3PO2 H;  2NVT B;  3CME A;  1SRU A;  3K57 A;  3I7F A;  4KY5 A;  4XYO A;  2EYL A;  1ENA A;  3F8T A;  4H02 A;  1X3E A;  1QJO A;  4CHT B;  5JJI A;  1V1O A;  2F03 A;  5EJW A;  1HNW Q;  3CQZ B;  3QIA A;  5IYB H;  4IOC A;  1I4X A;  1QZG A;  4I65 A;  2PCF B;  4DR4 L;  2UUC L;  2PQE A;  4AYB E;  3GTJ H;  1G2T A;  4AQY Q;  5I2Y A;  3J7Y W;  4DV7 L;  2QEX A;  3M4O B;  4U67 3;  2EJF C;  5JVH 3;  2Z6K C;  3E5S A;  1D1I A;  1AFP A;  1DZ1 A;  3A5Z B;  4QUC A;  4B9W A;  4HCE A;  2VUM H;  1WCM G;  4WJ3 M;  1DM0 B;  5C4X B;  4ZQ3 A;  2R7F A;  4XTC S;  1JIC A;  5LMN L;  5EKI A;  1JR0 D;  5NUC A;  4LW1 A;  5FLM G;  2Z4H A;  1NMG A;  1IBM Q;  4OHJ A;  2HDL A;  3J81 i;  3NSW A;  4OX9 Q;  3IFT A;  3T16 A;  3LGJ A;  2NZ1 D;  2K03 A;  3I8Z A;  1D7Q A;  1W6J A;  5E4X A;  3MZ5 A;  1CFM A;  5GAG C;  5ELF A;  2F0K A;  3UI2 A;  5AFW A;  2B2V C;  5C4H A;  4DGZ A;  4DK6 C;  4LF8 Q;  2O5I C;  1F2Y A;  1EY5 A;  1O80 A;  3KF6 A;  2WAQ B;  3NQI A;  4A3E H;  4K5X A;  1GD7 A;  1RCV D;  4KI0 A;  2HIV A;  2I0Q A;  4ZUJ A;  1SYD A;  1WCM H;  3OIP A;  4YWK A;  3BZD B;  4AIM A;  3T53 B;  3E0J A;  3D4D A;  2VB2 X;  2Q8R E;  1G8Z D;  4QMG A;  3OMG A;  2EPB A;  2MGS A;  4FO2 A;  3EA6 A;  2JA8 G;  1VQC A;  3SXH A;  3W1G A;  1FNW A;  2Q2I A;  1IW7 D;  4RG1 A;  1HR0 L;  4JI0 L;  1L1O B;  2Y0S G;  1GUW A;  3VDY A;  1HUN A;  5G3L F;  2WIN B;  3I4M B;  3CKI B;  2FHT A;  5KNC A;  5JVG 3;  2A68 C;  3K5M A;  1N36 Q;  4ALP A;  3ERS X;  1YJN A;  1TWG H;  4NDX A;  1Q46 A;  2QEJ C;  2R92 H;  4PMB A;  4CDF C;  1VQ4 A;  1IXR A;  3N52 A;  1WTH A;  1G51 A;  1LT4 D;  1LTI D;  2E2I H;  1B70 B;  2LY7 A;  2JA8 H;  2QF7 A;  3C46 A;  5GQO A;  4BA1 I;  4LF6 Q;  4DR3 L;  5D14 A;  2A69 D;  1TS2 A;  4CKC A;  4JI6 L;  1V9P A;  1KTK A;  1Q3L A;  4DR1 L;  3M85 A;  1SE8 A;  1V43 A;  4PZ6 A;  1PDQ A;  1VQ9 A;  2F3I A;  2R3Z A;  1N32 Q;  5BN3 A;  3PUY A;  1LLR D;  1PTO C;  5IGE A;  3KLW A;  4DR6 Q;  1SJH D;  2F0D A;  1RIP A;  2HQE A;  1K8M A;  4OO1 I;  4WJ4 A;  1CZG A;  2NVY H;  4KY7 A;  2F0H A;  3PUW A;  1G6Z A;  4EVO A;  3DUZ A;  2K75 A;  4KKT A;  4FF4 A;  3RD4 A;  4C3H H;  1BCP B;  3AFP A;  1F9P A;  5I2X A;  1B9N A;  2E5L L;  2VQF Q;  4HMJ A;  4GKJ Q;  2F0F A;  4A3B H;  1GHJ A;  1E1T A;  2RDH A;  1GVP A;  1EZ6 A;  1Y8N B;  4ID6 A;  5IYD G;  1IZ6 A;  2BCO A;  1TY2 A;  4A3F G;  3GTG H;  3E9I A;  2MNA A;  1TWF H;  1QVG A;  5IP9 H;  2KCM A;  3PIO 3;  4UP9 A;  1EUJ A;  4JI4 Q;  4QGU A;  2L1B A;  1DOK A;  1Y1V G;  3K8A A;  3PF4 A;  1BBU A;  2O4X A;  4HJ5 A;  5M3F B;  3CC4 A;  1BR9 A;  3TDQ A;  1S5E D;  4QCL A;  5C0X I;  1Q82 C;  2RHQ B;  4JI2 L;  2HD3 A;  2JA6 B;  1NSN S;  4BY7 H;  3VYT A;  4AYB B;  1EWH A;  1RD9 D;  3LWE A;  5DM7 3;  3S1Q B;  4ULL A;  5JAV A;  1UEB A;  2F0L A;  4FP5 D;  4IN3 A;  2MFI A;  4POF A;  4DR2 Q;  2B2U A;  4JOI C;  3I55 A;  1MIU A;  1PFM A;  2ZTE A;  1VQP A;  1PA6 A;  3HOU G;  3DEP A;  4K5W A;  4KV6 A;  4M1U B;  5BR8 Q;  4DAV A;  1IYV A;  1K9M C;  2D0O A;  1UEA B;  1QB5 D;  1XTC D;  3MHB A;  3NBH B;  1H9R A;  4RKL A;  2ICI A;  2ZXR A;  1MJC A;  5ELO A;  3D6W A;  2E75 C;  3M4Q A;  1A3T A;  1II3 A;  4K8J A;  2CW0 C;  4RA8 A;  4ZAI A;  1FYC A;  2AUK A;  2XVS A;  4C3J G;  5TSS A;  1XMO L;  2DN8 A;  2KEN A;  5CC4 A;  4HJ7 A;  3OPO A;  5C44 B;  4LF7 Q;  4A3G H;  4A3M B;  1NY4 A;  2MO0 A;  3RLO A;  3EIV A;  4BXX H;  1HFG A;  2CHB D;  1E2W A;  1HNZ L;  4B3M Q;  2ZJR A;  2NVT H;  1O7Y A;  2KHJ A;  1EU3 A;  1XWE A;  4IFD G;  4YWL A;  1EFI D;  4B08 A;  3OHX C;  1T5X D;  2CH4 A;  2IPK D;  3PQI A;  3HOX G;  3CQZ H;  2K01 A;  2TMP A;  3L3O C;  5FLX L;  1X3P A;  4RCO A;  1VS0 A;  1I94 Q;  2EYH A;  3K0X A;  5LMU Q;  2K1B A;  3RZO B;  4F88 A;  1LUZ A;  1TS4 A;  1VF5 C;  2CH4 W;  3VYU A;  5C4X H;  5DM6 3;  3GO5 A;  1UNS A;  5C0X J;  3CCE A;  4PNY A;  4GNX C;  4JI6 Q;  3CCU A;  2OWO A;  4OIK A;  1IL2 A;  3HOV B;  1PH6 A;  4TSS A;  2V1C C;  1S40 A;  4N9P A;  3VR6 A;  2A6H C;  3OSO A;  3RR5 A;  1T5E A;  4B3T L;  5K36 H;  4HN7 A;  2LFN A;  1LT3 D;  3I4M G;  3OW7 A;  2UXC Q;  3S1N B;  3I4N B;  3RLF A;  4KJO A;  3SVM A;  3KDF B;  3I90 A;  4BBR H;  1Z7T A;  1A3V A;  3K58 A;  4GLX A;  5CMD A;  1ML0 D;  1Y69 U;  1JC7 A;  2BE5 D;  1JMC A;  1TVX A;  3NWT A;  3FKI B;  1WTR A;  3BU2 A;  3CCL A;  4DV0 L;  3H3V C;  2XSC A;  1HCZ A;  2L9H A;  4Q5V A;  5M3M B;  1VQJ A;  1B4O A;  2K6A A;  3SK8 A;  1CHQ D;  1CA5 A;  3BVM A;  3J7A V;  1SEB D;  1TII D;  2R7Z G;  1EFW A;  2HT1 A;  3BS1 A;  5C3E G;  3X3N A;  1NR4 A;  5FLX E;  1BBW A;  4OGQ C;  3JAM L;  3V2T A;  1CQV A;  4A93 B;  5JPN C;  3I4L A;  3FVQ A;  2RHS B;  2F0T A;  1XNR Q;  1STA A;  5IT9 c;  1KAA A;  2K05 A;  5E4W C;  1JOQ A;  2KCC A;  1HFN A;  1EEF D;  4CKE A;  1H9S A;  1W6K A;  2D0P A;  1S5C D;  5CGK A;  3IL8 A;  1PTO B;  2G9D A;  3K7U C;  4YCU A;  4DUY L;  1K8G A;  2JE6 I;  3ER0 A;  1X3F A;  4Y52 H;  3NUC A;  1VF7 A;  1K28 A;  1ILP A;  3R8B A;  3I2Z A;  3HOZ G;  1HZ9 A;  1YHQ A;  3FHW A;  1PLF A;  2FIN B;  3LX0 A;  4KY6 A;  3PV0 A;  1VQE A;  1YNN C;  1WTQ A;  3EJI A;  2F4V L;  4EQO A;  2CVR A;  4GLA C;  1K3B C;  2RCN A;  1O7Z A;  3F2U A;  1TQO A;  3RZD B;  1GUT A;  2IL8 A;  1Y1W H;  1BXT A;  1UE5 A;  1EQQ A;  4V0B A;  1VQ5 A;  2OTL A;  5JEA G;  4DR5 Q;  1J9O A;  3BVZ A;  4X64 L;  2R7D A;  3I73 A;  2MPM A;  2ZXO A;  1SNQ A;  3D0F A;  4JI1 Q;  5E7N A;  2PI2 E;  3VR5 A;  1SFO B;  5A2Q L;  2K04 A;  4ZRZ A;  5IGF A;  1X9N A;  2JA6 G;  4J6H A;  1A62 A;  4AYB G;  2R93 B;  3QO2 A;  5F2D A;  5ELN A;  2YYZ A;  1ZYR C;  1WOC A;  2LXJ A;  1I4R A;  5J22 A;  3PIO A;  3KK7 A;  1PH9 A;  2A8V A;  4I7A A;  3D4R A;  3KLS X;  2QIL A;  4DV6 L;  4P73 A;  4DR7 Q;  4XT3 B;  1BQQ T;  1GUO A;  2Z1C A;  1HZA A;  3G48 A;  2UUB Q;  4JBJ A;  3SE0 A;  2ZT9 C;  3OMC A;  3J81 L;  4DAY B;  2B39 A;  2XN9 C;  4X66 Q;  1X32 A;  4A3L H;  4EQP A;  1JJC B;  2IW3 A;  1F9S A;  5FO9 B;  2DUD A;  5M3F H;  1B44 D;  4BBS B;  3F2D A;  2HQL A;  4A76 A;  2PYK A;  2XGT A;  5A35 A;  5IWA L;  3B6Y A;  2K5Q A;  1JB7 A;  2AUJ D;  1RTN A;  1EY4 A;  3S1Q H;  2SNS A;  1Z9F A;  2KEC A;  1ASZ A;  4X3K A;  4KN7 C;  1WD0 A;  3I56 A;  1HNW L;  3HOW G;  3K59 A;  2EXZ A;  1F9Q A;  1HA5 A;  3KF8 B;  4DPG A;  3M7G A;  3RMH A;  4AQY L;  2OF1 A;  3OTO Q;  3CCJ A;  1ESR A;  4NKL A;  3S16 B;  3PO3 B;  1JOO A;  2AWN A;  2F0S A;  1BO0 A;  1TS5 A;  2VQE L;  2NVQ B;  3CU7 A;  4LFA Q;  4RGT A;  4G4K A;  3FRP B;  1RTO A;  3OWE B;  5AJ3 Q;  2WAQ E;  3RNU A;  1PH5 A;  1JWU D;  2SNM A;  4QIW B;  3U4V A;  4OX9 L;  2RQX A;  3ULL A;  2B3G A;  5C44 H;  1VQD A;  3T13 A;  2XWB B;  1SMY C;  4E6I A;  5COR A;  4A3M H;  3HOV G;  1VMP A;  5D65 A;  2L12 A;  2L5T A;  1YVC A;  3J7Z C;  3U9S A;  4X3U A;  4GNX B;  1AZQ A;  3MAQ A;  1C9O A;  1SSO A;  3J81 E;  4C3H B;  3KUP A;  1YNJ D;  2OQ0 A;  1HUM A;  1KQS A;  4LFB Q;  2XRS D;  2F0J A;  2PQA A;  5EKL A;  1TWA B;  2K33 A;  1E22 A;  2FMM A;  3DWP A;  2IX0 A;  3KBX A;  1CA6 A;  3I4N G;  4R4T A;  1Q1E A;  1B3A A;  1E24 A;  2F0I A;  2KJX A;  3HOY B;  3D8G A;  5KEE A;  1A8V A;  1S5D D;  2JYO A;  3O13 A;  4DN4 M;  3RZO H;  1HJP A;  2JN4 A;  2K50 A;  2WII B;  3M3Y H;  1STN A;  1PFS A;  2H5X A;  4HCS A;  2MHV A;  2JA5 G;  3J80 c;  3DHQ A;  3KJP A;  3DM3 A;  1MD2 D;  1M4V A;  1GOZ A;  3CPF A;  1N36 L;  3JAM i;  4O0A A;  4OEL B;  2Z4I A;  1D6E C;  4KD4 A;  3DWA A;  2I5M X;  3CW2 C;  3HS0 C;  3SEB A;  4UHV A;  3I4N H;  3S1N H;  2PW5 A;  2I5L X;  3PO2 G;  1TWC B;  4LF5 Q;  2RCF A;  1STY A;  5EPL A;  1NAP A;  2JA7 B;  3UDG A;  1NBW A;  1U0L A;  2RDF A;  4RGO S;  5ELE A;  1HHV A;  1HXY D;  4DV3 Q;  2UXD Q;  3A8J E;  2RVL A;  4UY8 C;  5IYB G;  4KHZ A;  3FKI H;  4DK0 A;  4YHH Q;  3G6J B;  4X62 Q;  5M3M H;  4B9X A;  1C7Y A;  3Q23 A;  4JK1 C;  2EYM A;  4ZKC B;  2HIX A;  2AQ1 B;  2Q2U A;  1N32 L;  2DJG C;  3H0G H;  4RWS C;  2VUM G;  1IW7 C;  1VQK A;  4DR6 L;  3LNN A;  5IOD A;  3HKZ E;  2H1E A;  2HCC A;  4A93 H;  1QVF A;  1SE3 A;  2X6G A;  3VA7 A;  3SK4 A;  5IWA Q;  4IFD I;  1KNE A;  4FXD A;  2VQF L;  1WTX A;  2ZXP A;  4FYD A;  2JJQ A;  4GKJ L;  4RGM A;  3MXN A;  2SEB D;  1PTO H;  4K5V A;  5C6A A;  3GD7 A;  4DV1 Q;  1A2T A;  3D3R A;  1OXX K;  3VYS A;  2F0E A;  1YI2 A;  2R93 G;  5EPK A;  4KHP Q;  1K3R A;  3LWU A;  3ND8 A;  2PZW A;  4A3E G;  4NXN Q;  1CHP D;  4JI4 L;  2VQE Q;  4K2L A;  1LTG D;  2A69 C;  4XQJ A;  5HUR A;  4IUN A;  4TKO B;  2XTI A;  1H9M A;  1VQ8 A;  5JJL A;  3RZD H;  3EFX D;  2DJF C;  1BF4 A;  3RLN A;  2UUA Q;  1LYL A;  1PYS B;  4TVA B;  5LHY 1;  3G7L A;  2HHH Q;  1I3Q B;  2AWO A;  3A74 A;  2B2U C;  3C3L A;  1L1O A;  1VQF A;  3QR8 A;  4DR2 L;  3M4P A;  2UXB Q;  3T56 B;  1SFO H;  1XNQ L;  5CV4 A;  5BR8 L;  1MHW C;  2R93 H;  5GAD C;  1TKW B;  3AFQ A;  4JPB W;  3CPW A;  3BVG A;  3IKJ A;  4BBR B;  2L55 A;  3F2C A;  1XPU A;  4JYA Q;  3VA5 A;  3FDT A;  5C3X A;  2R92 G;  5C4J B;  4IPG A;  2B63 H;  1S5F D;  4FF3 A;  3L0O A;  2KVM A;  3EVQ A;  1PFN A;  3KLS A;  4RCN A;  1SNO A;  3A7L A;  4GKK Q;  2DY8 A;  4H13 C;  4IFD J;  1CKO A;  4X3S A;  2MJ8 A;  4JCV E;  4O42 A;  4LF7 L;  4BBS H;  4G57 A;  4MTK A;  4G7O C;  1MJE A;  4B3M L;  1SR3 A;  1PV4 A;  1DON A;  4HED A;  1I6H H;  3TQY A;  5I4D A;  4IZ8 A;  1EY7 A;  3TRE A;  4H7B A;  5CBA E;  4GOP B;  2C35 B;  3K80 C;  3GTQ B;  1KLG D;  4P2C B;  1X54 A;  1IBK Q;  1JE4 A;  2EQS A;  4C3H G;  1PH3 A;  3PUZ A;  1I94 L;  5JJK A;  1ZXT A;  5E3F A;  5LMU L;  3S16 H;  3PO3 H;  1STH A;  3NP8 A;  4A3B G;  1IBL Q;  2LSS A;  2NVQ H;  1LTS D;  3NTK A;  2YV5 A;  1G2S A;  4HAE A;  3GP7 A;  3SK5 A;  1IKL A;  4DUZ Q;  1X56 A;  2AQ2 B;  5KYL A;  5H1S E;  3SK6 A;  3ND9 A;  1KC8 C;  1JE5 A;  1JJ2 A;  5IP9 G;  4C1N K;  1XPO A;  1Y1W B;  2CKZ B;  1D5X C;  2C5C A;  1K73 C;  1MKH A;  1QVC A;  2WFW A;  5IE8 A;  1A63 A;  4R9W A;  3ICE A;  4KTA A;  2YTX A;  4H44 C;  3MWY W;  1D5M C;  4I7Z C;  5DEH A;  2N78 A;  1EQR A;  2O2L D;  4DU9 A;  2VB3 X;  3NK9 A;  4IJL A;  4A3J B;  2UXC L;  1PRT B;  4L8J A;  2BA1 A;  3FPP A;  4BY7 G;  3GV3 A;  2DNE A;  1KAB A;  3K5N A;  1VQM A;  1HQM C;  5IP7 G;  1TWA H;  4L5R C;  1JQY D;  2QA4 A;  3VR4 A;  1F2M A;  1VQG A;  5M5W H;  3KBG A;  3HOY H;  3AYH B;  3HKZ B;  4IOA A;  1NE3 A;  4WJW A;  5J3B A;  1VMC A;  1YIJ A;  4DAP A;  1S3O A;  3MFG A;  2R61 A;  1ASY A;  1AEX A;  1QZH A;  1HZC A;  4A3C H;  3S15 B;  4DXF A;  3IFD A;  2PO4 A;  4IPD A;  4QY7 A;  1SLJ A;  3ERO A;  3A8I E;  2VL6 A;  1C8C A;  1UE6 A;  3BYT B;  1XNR L;  3H3V H;  4KK7 A;  3NXW A;  4A3K B;  1FL0 A;  1AZP A;  4O2D A;  1YHB A;  2B8F A;  3RN5 A;  5C4Z A;  2JSO A;  5IP7 H;  1U9R A;  2F0O A;  4DA2 A;  4JI7 Q;  1XYI A;  3CCV A;  1SE4 A;  1EY6 A;  2AHO B;  4A3G G;  4BXX G;  2VXW A;  1IYJ B;  1XNQ Q;  3NTH A;  1FJG Q;  1TWC H;  1I4G A;  3PGZ A;  4R1J A;  4HJA A;  2JA7 H;  3NWS A;  3GTO B;  4JC0 A;  1LT6 D;  2RSN A;  5JJZ A;  2J0T D;  3S1M B;  2ALY B;  1I6V C;  2JEB I;  2Z6B A;  5JEA J;  4FF2 A;  1FVI A;  4KKU A;  2HUG A;  1IL8 A;  4HIO A;  2C9O A;  1HTL D;  3EQL C;  1LO5 D;  1EZ8 A;  2VS1 A;  5C4X G;  4DR5 L;  1A0I A;  2E2D C;  1EU4 A;  4NB3 A;  3UDI A;  3U4Z A;  3PSI A;  1VQO A;  4A75 A;  3BDL A;  4CBV A;  1H9J A;  1TS3 A;  5GAH C;  4JI1 L;  1WTV A;  4KHV A;  1Y8P B;  2ZTC A;  5J39 A;  2EY2 A;  4EQN A;  3KOJ A;  4PG3 A;  4JG2 A;  2NN6 H;  4MHE A;  3OIQ A;  4R8N A;  4B3R Q;  1F2Z A;  5K36 G;  5IYC H;  2B2W A;  2EDG A;  4ME5 A;  1XX8 A;  2R6G A;  5LMN W;  3F2B A;  2VNU D;  2OT2 A;  1PTO D;  1DCZ A;  1QWY A;  1FGB D;  4FVM A;  4A3I B;  1VDZ A;  3CCQ A;  4DR7 L;  3A8K E;  4BBR G;  4KN4 C;  2WAQ G;  2WKC A;  4YCW A;  2KUM A;  4IPH A;  2UUB L;  3V05 A;  3N6R A;  1EOT A;  4A3D H;  3CCR A;  2EOT A;  4R4O A;  3M3Y B;  3STB C;  1SYC A;  1R4P B;  4X66 L;  1EYA A;  1LTL A;  1SDF A;  4BS9 A;  4PV1 C;  5KYI A;  4QL5 A;  4LFC Q;  4RHR A;  2E2H B;  3T1H Q;  4HIK A;  2IHF A;  2NYZ D;  1L0Y B;  1ET6 A;  1I3Q H;  3QJY A;  4APV A;  1KRS A;  2N88 A;  3SR1 A;  4BY1 B;  4QIW E;  3Q24 A;  1XMQ Q;  4DV5 Q;  2CCZ A;  5JOB A;  1CKN B;  1XJV A;  4DNR B;  2LS0 1;  3OTO L;  1PZI D;  4CJ1 B;  4LNQ A;  3WWV A;  2YTY A;  4QUF A;  3NEL A;  2IT1 A;  5C4J H;  4LFA L;  4QQB X;  2CQO A;  5EKK A;  1HR0 W;  4LK1 C;  3DLL A;  3P20 A;  3PUV A;  5FJ8 H;  3D31 A;  3CC2 A;  3IAY A;  1IYU A;  2HCI A;  2DGY A;  3EBE A;  5AJ3 L;  2ZM6 Q;  1VQB A;  5IGC A;  1YNX A;  1EEI D;  5M5Y B;  3J80 L;  3PIP 3;  1QUQ B;  3H0G B;  1EY8 A;  3E6Z X;  3MTS A;  1SNC A;  5IIF A;  1SBB B;  2F0P A;  2A5H A;  2F52 A;  1Y1W G;  3S14 B;  2OCE A;  4LF9 L;  1O7L A;  2B2T A;  2QCP X;  1E2Z A;  3AB9 A;  4YY3 Q;  4LFB L;  3NPP A;  1NR2 A;  1KIX A;  2L11 A;  1I4Q A;  3GTQ H;  2CW0 D;  5DAU A;  4X65 Q;  2YU9 B;  3MA2 B;  2LMC B;  3M9B A;  4P75 A;  3EN2 A;  1CSP A;  1V1P A;  3BG3 A;  2ICE C;  4RMF A;  1X3Q A;  5DNF A;  2DY7 A;  3Q0A A;  5KIX A;  1K0S A;  2B2Y A;  4MN3 A;  3CMA A;  2NZH A;  1ET9 A;  3FPU B;  3CCS A;  2A1A A;  1NJI C;  1HRJ A;  2UU9 Q;  4R4C A;  5GAE C;  1Z6H A;  1EOV A;  4F8M A;  4J8Q A;  2M2L A;  2EY1 A;  3S24 A;  5FK9 C;  1ONL A;  1GM5 A;  1QG7 A;  4A3L G;  3M7N A;  1LAB A;  1XPR A;  4POG A;  5M3F G;  4HMI A;  1FNU A;  3X3M A;  5L37 A;  4A3J H;  2B8G A;  2K5N A;  4IAL A;  3J80 E;  1BBX C;  4C3I H;  4LF5 L;  4UDU C;  3JAM E;  4K6L A;  4YCV A;  5C5L A;  3W3A A;  3CD6 A;  4DV3 L;  5IY0 A;  2UXD L;  3J7A 5;  4YHH L;  1K0R A;  3L9A X;  3URY A;  2B63 B;  1CK1 A;  1CZW A;  2A6H D;  4X62 L;  3J81 j;  1Q8K A;  3OOC A;  1LM0 A;  3KF8 A;  2KED A;  3ULJ A;  2J4X A;  4N9T A;  3S15 H;  2PZT A;  3TP7 A;  2Q2H A;  1VCI A;  3H94 A;  2SDF A;  5CV8 A;  2KHS A;  1BVS A;  3CRL C;  4JI8 Q;  2EYF A;  2K5H A;  3A7A B;  5FO7 B;  1CUK A;  1W2B A;  2EE1 A;  4A3K H;  2IY5 B;  1N34 L;  1MBY A;  5T1I A;  1I6H B;  4WOR A;  1R4Q B;  2HDM A;  5C3W A;  1A3U A;  1EIY B;  3HGB A;  5C44 G;  4CDE C;  3C2P A;  3C1F A;  5FKA C;  1DD2 A;  4A3M G;  2K14 A;  2YTV A;  1OXT A;  1KNA A;  4DV1 L;  2JXM B;  2EXD A;  2A6E D;  4OO1 H;  1VQL A;  5FOB B;  2WV6 D;  4CDD C;  1KHI A;  1STB A;  4KHP L;  3GTO H;  1U4L A;  4CKB A;  4NXN L;  1STE A;  4DF7 A;  2K7V A;  1HNX Q;  2QW7 A;  3S1M H;  3QOJ A;  1AE3 A;  1UE1 A;  1E7Z A;  4JBK A;  1DJR D;  5A2Q E;  4RKB A;  1WFQ A;  1WVL A;  3NEN A;  4O1N A;  4MNO A;  1E2V A;  2JEA I;  4IUT A;  4NMZ A;  3DEO A;  1TXY A;  2I46 A;  5EQ0 A;  2UUA L;  4U68 A;  1I5F A;  4XXE A;  2HHH L;  3R3O A;  4PQX A;  2F0N A;  1UUP A;  3MC0 B;  4XDX A;  1B3Q A;  3MXP A;  1NTG A;  5FLX c;  2UXB L;  4OON A;  1U4R A;  5IGB A;  3H6M A;  1YNN D;  4LF9 Q;  4IQZ A;  1I50 B;  4TQU S;  5C0X H;  5CR3 A;  3CC7 A;  4JYA L;  2KQ3 A;  2WAC A;  4ABN A;  1LTT D;  2F0M A;  5M5W B;  3GDE A;  4Q0F A;  4L6T B;  4A3I H;  4N8F A;  1UE7 A;  3SGI A;  1NMF A;  4DK3 C;  1EQT A;  3VR3 A;  1BDO A;  4FXK C; 
#chains in the Genus database with same CATH homology
 2E76 C;  2EYO A;  3TZD A;  5M5X B;  1EWC A;  1SYE A;  1ZYR D;  1TWH B;  1EYC A;  3DMU A;  1FR3 A;  3GTL B;  1A15 A;  2XWJ B;  1LTR D;  2KOL A;  1OXV A;  3I72 A;  4OIJ A;  1RJT A;  2PMZ B;  4UAI A;  1O78 A;  2LKV A;  1S5B D;  3BDO A;  2PW7 A;  1GHK A;  5EGT A;  1I4H A;  2D62 A;  2F1M A;  1U4M A;  4ZKB B;  5LL6 X;  4RAU C;  1SYF A;  1QCB D;  1EIG A;  1PFB A;  5E1F A;  4A3F B;  2E2J B;  3GTP B;  3GTM B;  2NUC A;  1A6X A;  4IUQ A;  4FF1 A;  1Y1V B;  3R93 A;  3S2D B;  2MP1 A;  4XIG S;  1BNZ A;  1CT1 D;  3MXG A;  1IKM A;  3C1E A;  1CI3 M;  5CV5 A;  1SYG A;  2IJ0 A;  4OL7 A;  1TT2 A;  1SMY D;  2K5W A;  4ZYS A;  1LT5 D;  1Q90 A;  3MFY A;  3HOU B;  3ERQ A;  4LAA A;  5ISR A;  4KMU C;  4A3D B;  2M9V A;  3K7A B;  4ZK9 B;  3P7J A;  1JOR A;  3H09 A;  2F0Q A;  1QNU A;  1AW7 A;  5CV6 A;  4DNT B;  2F0V A;  4DXG A;  3I91 A;  3D4W A;  3QB3 A;  3S1R B;  1FD7 D;  2EY6 A;  4C3J B;  1PZK D;  1D2B A;  3TP8 A;  1EY0 A;  2EZV A;  3WOF A;  4XQQ A;  1PRT D;  3S2H B;  1BCP D;  4F87 A;  2MUY A;  2EJM A;  3S9W A;  3VR2 A;  3QWN A;  1M8A A;  5M9O A;  1Z47 A;  3J7A F;  1PTO F;  1JB3 A;  3HOX B;  1GUN A;  2G9H D;  1EY9 A;  3FEW X;  5EBC A;  3WOE A;  1WTW A;  1Q1B A;  2BDN A;  4J1M A;  4ODG A;  2RSO A;  4BWG B;  2EYP A;  2RA4 A;  2B2W C;  5EBD A;  1JWS D;  3I70 A;  1Q8I A;  1LTA D;  3BDC A;  1RF2 D;  3QG1 A;  1XXG A;  3U9O A;  4CGY B;  5KRU A;  4C1N I;  2KCN A;  5I9P A;  1CTM A;  1A2U A;  2BOS A;  2XNA C;  1TY0 A;  2I07 B;  3HEJ A;  2PPB C;  2EVB A;  3HP3 A;  4XYQ A;  1OXU A;  5IT9 L;  1MSG A;  4IUU A;  2R7Z B;  5C3E B;  1OO9 B;  3MVV A;  1UAP A;  5HGT A;  4C3I B;  2NVX B;  2K32 A;  3ITP A;  3L7Z C;  1CQF A;  5COY A;  4Y7N B;  5I6Y A;  3TN2 A;  1V8Q A;  3NE5 B;  4FNF A;  2ENB A;  1F9R A;  3I3C A;  5K5P A;  3DXJ C;  1NCV A;  1G29 1;  3NBH A;  2BDO A;  3HOZ B;  2OEO A;  3FMC A;  1ROD A;  4V19 0;  2EJG C;  2ID0 A;  3AMU A;  2B2T C;  1HTP A;  1SND A;  3TP6 A;  2CQA A;  1K83 B;  1ZKO A;  1EYD A;  5CBE E;  2F0G A;  3V96 A;  3ZYY X;  1DOM A;  4KJN A;  1WTO A;  2RDG A;  1E0B A;  1ICW A;  4RGN A;  5IT9 E;  1SXT A;  2NN6 G;  2BE5 C;  3H91 A;  4BA2 I;  2B2Y C;  3HZX A;  4EGV A;  2AQ3 B;  3T51 B;  2XIW A;  2A68 D;  4G7H C;  2F0U A;  5JPM C;  3A56 A;  2TSS A;  5ELC A;  2B2V A;  1Q12 A;  2WP8 J;  3P75 A;  1AN8 A;  2XRQ D;  5ELB A;  3CHB D;  4QB4 A;  5FO8 B;  3S17 B;  2PNR C;  1F77 A;  1D1K A;  2WB1 B;  1L0X B;  1B53 A;  1IHZ A;  2A73 B;  4LMQ D;  4ZUI A;  5LL6 S;  2OXP A;  3Q22 A;  1JOK A;  3TME A;  2L0C A;  4XQN A;  1PZJ D;  3HOW B;  3GTK B;  4HTH A;  1AP0 A;  3NQT A;  3PUX A;  3WDN A;  3NBI A;  2E74 C;  3A55 A;  3A54 A;  4ILW A;  1QNK A;  1KDB A;  5CYU A;  1MSH A;  3M4Y A;  3ONA B;  1J8I A;  3TZU A;  4YIJ A;  4IUV A;  4CJ0 B;  3TSS A;  5G3L D;  4C2M B;  1ILQ A;  2FFK B;  4IFD H;  5IOC A;  1BUV T;  4XT1 B;  2NBF A;  4RH6 A;  1C4Q A;  5BN4 A;  4R8I A;  4RFB A;  1SJE D;  4WRD A;  4K14 A;  4KKS A;  2NWG A;  2NTT A;  1S4Z A;  1HQR D;  1JWM D;  2FJ2 A;  2JA5 B;  3K0Y A;  1D5Z C;  2PZU A;  2A6E C;  2NTS A;  4K2K A;  4C3I G;  1KDA A;  2KA7 A;  2F0W A;  2M00 A;  3PO2 B;  2EY5 A;  1ENC A;  4TRD A;  2A74 C;  4KD3 A;  1B50 A;  4ZLT F;  4H0L C;  1GJX A;  2QKI C;  2WKD A;  2J7Z A;  3VYR A;  4GZY C;  4QF4 A;  1H9K A;  3GTJ B;  1SYB A;  2D9U A;  4NW2 A;  1RDP D;  4DAY A;  4WFN 3;  4C56 C;  2VUM B;  3QOL A;  3Q6S A;  1TR5 A;  1SE2 A;  1YNJ C;  5EPJ A;  2D5D A;  1NUC A;  1FNV A;  5C5M A;  1STG A;  3NTI A;  1LAC A;  5KGU A;  5ELD A;  1QOH A;  2F4I A;  1H9S B;  1EIH A;  4X3T A;  1RHP A;  3DM1 A;  3KLR A;  4CJ2 C;  1HPC A;  5IGG A;  4OO1 G;  4PMW A;  3TBI B;  2Q8T A;  2H4O A;  1G91 A;  2DNC A;  5IGD A;  1V1P B;  1LTB D;  3GV6 A;  3R2I A;  1PYW D;  3SHL A;  2D2C C;  1GUS A;  2GA4 B;  4A3E B;  2QDB A;  3K5L A;  1WCM B;  3P1H A;  4IUR A;  2L4N A;  1RKN A;  2FMC A;  2IX1 A;  5JEA H;  1OXS C;  1DXM A;  1QIL A;  1B9M A;  2JP1 A;  1TU2 B;  4K6D A;  1PRT F;  1BCP F;  1KLU D;  5I9O A;  5C0X G;  1KDC A;  1BOS A;  1HA6 A;  1ESF A;  1TWG B;  3CRK C;  1PMR A;  2IWH A;  2R92 B;  4HSP A;  1F2L A;  1WTP A;  1U4P A;  4K8I A;  2IX3 A;  5CV7 A;  4F7X A;  1MI2 A;  2E2I B;  2JA8 B;  2X6L A;  3BYY B;  4MIU A;  1LV9 A;  5BN5 A;  1C48 A;  2K28 A;  2Y0S B;  1EQV A;  1GUG A;  5J1Z A;  3RUZ A;  3HG9 A;  2F3V A;  4RHS A;  5KNB A;  2RKS A;  2Q8I B;  3T4A C;  2F3W A;  3GQB A;  4L63 B;  4JBW A;  2NVY B;  2EYJ A;  2KEE A;  4NP5 A;  4Z9C B;  1DOL A;  2O5J C;  1WD1 A;  4PMC A;  4A3B B;  3HRZ C;  2V4D A;  3NHH A;  3MEH A;  1B2T A;  3GTG B;  1TWF B;  3K6O A;  5D3D A;  4DFA A;  5T1G A;  1R9T B;  1Y8O B;  4DK1 A;  1PRT C;  1BCP C;  2BA0 A;  1QE6 A;  4S3S A;  4G7Z C;  1ZEQ X;  2NN6 I;  5I6W A;  1GXD C;  2Z8L A;  4M8A A;  4BY7 B;  4FXG C;  1DYQ A;  3D6C A;  1EL0 A;  3PMF A;  1CM9 A;  3TP5 A;  3DWQ A;  4LJZ C;  1B1Z A;  1PXU A;  1SAP A;  1I4P A;  2SOB A;  3R2T A;  2NB0 A;  2X69 A;  5KND A;  3AU7 A;  4HR7 B;  3W2D A;  2K5D A;  2RBM A;  1MGS A;  2N55 A;  4HSV A;  1K8O A;  1SNP A;  4IUP A;  5CV9 A;  3SDZ A;  3OWF A;  1SNM A;  5D3I B;  3K5O A;  3MXU A;  4A3G B;  1JCK B;  1ENF A;  2NVT B;  3K57 A;  4KY5 A;  4XYO A;  2EYL A;  1ENA A;  1QJO A;  4CHT B;  1V1O A;  2F03 A;  5EJW A;  3CQZ B;  3QIA A;  1I4X A;  4I65 A;  2PCF B;  2PQE A;  1G2T A;  5I2Y A;  3J7Y W;  3M4O B;  4U67 3;  2EJF C;  5JVH 3;  3E5S A;  1AFP A;  1D1I A;  1DZ1 A;  4QUC A;  4B9W A;  4HCE A;  1DM0 B;  5C4X B;  4ZQ3 A;  4XTC S;  1JIC A;  5EKI A;  1JR0 D;  5NUC A;  2Z4H A;  4OHJ A;  2HDL A;  3NSW A;  3IFT A;  3T16 A;  2NZ1 D;  2K03 A;  3I8Z A;  1W6J A;  5E4X A;  3MZ5 A;  1CFM A;  5ELF A;  2F0K A;  3UI2 A;  5AFW A;  2B2V C;  5C4H A;  4DGZ A;  2O5I C;  1F2Y A;  1EY5 A;  1O80 A;  2WAQ B;  3NQI A;  4K5X A;  1RCV D;  4KI0 A;  4ZUJ A;  1SYD A;  3OIP A;  3BZD B;  3T53 B;  3E0J A;  3D4D A;  2VB2 X;  2Q8R E;  1G8Z D;  4QMG A;  3OMG A;  2EPB A;  2MGS A;  4FO2 A;  3EA6 A;  3SXH A;  1FNW A;  1IW7 D;  1GUW A;  1HUN A;  5G3L F;  2WIN B;  3I4M B;  3CKI B;  2FHT A;  5KNC A;  5JVG 3;  2A68 C;  3K5M A;  4NDX A;  2QEJ C;  4PMB A;  3N52 A;  1LT4 D;  1LTI D;  2LY7 A;  2QF7 A;  3C46 A;  4BA1 I;  5D14 A;  2A69 D;  1TS2 A;  4CKC A;  1KTK A;  1Q3L A;  3M85 A;  1V43 A;  1PDQ A;  2R3Z A;  5BN3 A;  3PUY A;  1LLR D;  1PTO C;  5IGE A;  1SJH D;  2F0D A;  2HQE A;  1K8M A;  4OO1 I;  1CZG A;  4KY7 A;  2F0H A;  3PUW A;  1G6Z A;  4EVO A;  3DUZ A;  4KKT A;  4FF4 A;  3RD4 A;  1BCP B;  5I2X A;  1F9P A;  1B9N A;  4HMJ A;  2F0F A;  1GHJ A;  2RDH A;  1EZ6 A;  1Y8N B;  4ID6 A;  2BCO A;  1TY2 A;  3PIO 3;  2L1B A;  1DOK A;  2O4X A;  5M3F B;  1BR9 A;  3TDQ A;  1S5E D;  4QCL A;  5C0X I;  2JA6 B;  1NSN S;  3VYT A;  4AYB B;  1EWH A;  1RD9 D;  3LWE A;  5DM7 3;  3S1Q B;  4ULL A;  5JAV A;  2F0L A;  4FP5 D;  4IN3 A;  2B2U A;  1PFM A;  3DEP A;  4K5W A;  4KV6 A;  4M1U B;  4DAV A;  1IYV A;  1UEA B;  1QB5 D;  1XTC D;  3MHB A;  1H9R A;  4RKL A;  2ICI A;  2ZXR A;  3D6W A;  2E75 C;  1A3T A;  1II3 A;  4K8J A;  2CW0 C;  4RA8 A;  4ZAI A;  1FYC A;  2AUK A;  2XVS A;  4C3J G;  5TSS A;  2DN8 A;  5CC4 A;  3OPO A;  5C44 B;  4A3M B;  1HFG A;  2CHB D;  1E2W A;  1O7Y A;  1EU3 A;  1XWE A;  4IFD G;  1EFI D;  4B08 A;  3OHX C;  1T5X D;  2IPK D;  2K01 A;  2TMP A;  3L3O C;  5FLX L;  1X3P A;  4RCO A;  2EYH A;  2K1B A;  3RZO B;  4F88 A;  1VF5 C;  1TS4 A;  3VYU A;  5DM6 3;  3GO5 A;  1UNS A;  5C0X J;  4PNY A;  4OIK A;  3HOV B;  4TSS A;  4N9P A;  3VR6 A;  2A6H C;  3OSO A;  1T5E A;  5K36 H;  4HN7 A;  2LFN A;  1LT3 D;  3OW7 A;  3S1N B;  3I4N B;  3RLF A;  4KJO A;  3SVM A;  3I90 A;  1Z7T A;  1A3V A;  3K58 A;  5CMD A;  1ML0 D;  1Y69 U;  1JC7 A;  2BE5 D;  1TVX A;  3NWT A;  3FKI B;  1WTR A;  3H3V C;  2XSC A;  1HCZ A;  2L9H A;  4Q5V A;  5M3M B;  1B4O A;  2K6A A;  3SK8 A;  1CHQ D;  1CA5 A;  3BVM A;  3J7A V;  1SEB D;  1TII D;  3BS1 A;  3X3N A;  1NR4 A;  5FLX E;  4OGQ C;  3JAM L;  3V2T A;  1CQV A;  4A93 B;  5JPN C;  3I4L A;  3FVQ A;  2F0T A;  1STA A;  1KAA A;  2K05 A;  5E4W C;  1JOQ A;  2KCC A;  1HFN A;  1EEF D;  4CKE A;  1H9S A;  1W6K A;  5CGK A;  1S5C D;  3IL8 A;  1PTO B;  2G9D A;  2JE6 I;  3NUC A;  1VF7 A;  1ILP A;  3R8B A;  1PLF A;  2FIN B;  3LX0 A;  4KY6 A;  3PV0 A;  1YNN C;  1WTQ A;  3EJI A;  4EQO A;  2CVR A;  1O7Z A;  3F2U A;  1TQO A;  3RZD B;  1GUT A;  2IL8 A;  1BXT A;  4V0B A;  5JEA G;  1J9O A;  3BVZ A;  3I73 A;  2MPM A;  2ZXO A;  1SNQ A;  3VR5 A;  1SFO B;  5A2Q L;  2K04 A;  4ZRZ A;  5IGF A;  4J6H A;  2R93 B;  3QO2 A;  5F2D A;  2YYZ A;  1ZYR C;  1I4R A;  5J22 A;  3KK7 A;  3D4R A;  3KLS X;  2QIL A;  4XT3 B;  1BQQ T;  1GUO A;  2Z1C A;  3SE0 A;  2ZT9 C;  3OMC A;  3J81 L;  2B39 A;  2XN9 C;  1X32 A;  4EQP A;  2IW3 A;  1F9S A;  5FO9 B;  1B44 D;  4BBS B;  2PYK A;  5A35 A;  2K5Q A;  2AUJ D;  1RTN A;  1EY4 A;  2SNS A;  2KEC A;  4X3K A;  4KN7 C;  1WD0 A;  3K59 A;  2EXZ A;  1F9Q A;  1HA5 A;  3M7G A;  3RMH A;  2OF1 A;  4NKL A;  1ESR A;  3S16 B;  3PO3 B;  1JOO A;  2AWN A;  2F0S A;  1BO0 A;  1TS5 A;  2NVQ B;  3CU7 A;  4RGT A;  4G4K A;  3FRP B;  1RTO A;  3OWE B;  1JWU D;  2SNM A;  4QIW B;  2RQX A;  3T13 A;  2XWB B;  1SMY C;  4E6I A;  5COR A;  1VMP A;  5D65 A;  2L12 A;  2L5T A;  3U9S A;  4X3U A;  1AZQ A;  3MAQ A;  1SSO A;  3J81 E;  4C3H B;  3KUP A;  1YNJ D;  1HUM A;  2XRS D;  2F0J A;  5EKL A;  1TWA B;  2K33 A;  2FMM A;  3DWP A;  2IX0 A;  3KBX A;  1CA6 A;  1Q1E A;  1B3A A;  2KJX A;  2F0I A;  3HOY B;  3D8G A;  5KEE A;  1S5D D;  2JYO A;  3O13 A;  4DN4 M;  2WII B;  1STN A;  4HCS A;  2MHV A;  3DHQ A;  1MD2 D;  1M4V A;  1GOZ A;  2Z4I A;  1D6E C;  4KD4 A;  3DWA A;  3HS0 C;  3SEB A;  2PW5 A;  1TWC B;  1STY A;  5EPL A;  1NAP A;  2JA7 B;  2RDF A;  4RGO S;  5ELE A;  1HHV A;  1HXY D;  3A8J E;  2RVL A;  4KHZ A;  4DK0 A;  3G6J B;  4B9X A;  3Q23 A;  4JK1 C;  2EYM A;  4ZKC B;  2AQ1 B;  4RWS C;  1IW7 C;  3LNN A;  5IOD A;  2H1E A;  2HCC A;  1SE3 A;  2X6G A;  3VA7 A;  3SK4 A;  4IFD I;  1KNE A;  4FXD A;  1WTX A;  2ZXP A;  4FYD A;  4RGM A;  3MXN A;  2SEB D;  1PTO H;  4K5V A;  5C6A A;  3GD7 A;  1A2T A;  3D3R A;  1OXX K;  3VYS A;  2F0E A;  5EPK A;  3LWU A;  3ND8 A;  2PZW A;  1CHP D;  4K2L A;  1LTG D;  2A69 C;  4XQJ A;  5HUR A;  4IUN A;  4TKO B;  1H9M A;  3EFX D;  1BF4 A;  5LHY 1;  3G7L A;  1I3Q B;  2AWO A;  2B2U C;  3C3L A;  3T56 B;  5CV4 A;  1TKW B;  3BVG A;  3IKJ A;  4BBR B;  2L55 A;  3VA5 A;  3FDT A;  5C3X A;  5C4J B;  1S5F D;  4FF3 A;  2KVM A;  3EVQ A;  1PFN A;  3KLS A;  4RCN A;  1SNO A;  3A7L A;  2DY8 A;  4H13 C;  4IFD J;  4X3S A;  2MJ8 A;  4O42 A;  4G57 A;  4G7O C;  1DON A;  4HED A;  5I4D A;  4IZ8 A;  1EY7 A;  4H7B A;  5CBA E;  3GTQ B;  1KLG D;  4P2C B;  1JE4 A;  4C3H G;  3PUZ A;  1ZXT A;  5E3F A;  1STH A;  3NP8 A;  1LTS D;  3NTK A;  1G2S A;  4HAE A;  3GP7 A;  3SK5 A;  1IKL A;  2AQ2 B;  5KYL A;  3SK6 A;  3ND9 A;  4C1N K;  1Y1W B;  1D5X C;  2C5C A;  4R9W A;  4KTA A;  4H44 C;  3MWY W;  1D5M C;  4I7Z C;  5DEH A;  2O2L D;  4DU9 A;  2VB3 X;  3NK9 A;  4A3J B;  1PRT B;  4L8J A;  2BA1 A;  3FPP A;  3GV3 A;  2DNE A;  1KAB A;  3K5N A;  1HQM C;  1JQY D;  3VR4 A;  1F2M A;  3KBG A;  3HKZ B;  4WJW A;  1VMC A;  4DAP A;  3MFG A;  2R61 A;  1AEX A;  3S15 B;  4DXF A;  3IFD A;  2PO4 A;  3ERO A;  3A8I E;  1C8C A;  3BYT B;  4KK7 A;  3NXW A;  4A3K B;  1AZP A;  2B8F A;  5C4Z A;  2JSO A;  1U9R A;  2F0O A;  4DA2 A;  1XYI A;  1SE4 A;  1EY6 A;  2VXW A;  3NTH A;  1I4G A;  3NWS A;  3GTO B;  1LT6 D;  2RSN A;  5JJZ A;  2J0T D;  3S1M B;  1I6V C;  2JEB I;  5JEA J;  4FF2 A;  4KKU A;  2HUG A;  1IL8 A;  2C9O A;  1HTL D;  3EQL C;  1LO5 D;  1EZ8 A;  2E2D C;  1EU4 A;  3BDL A;  4CBV A;  1H9J A;  1TS3 A;  1WTV A;  4KHV A;  1Y8P B;  5J39 A;  2EY2 A;  4EQN A;  2NN6 H;  4MHE A;  3OIQ A;  4R8N A;  1F2Z A;  5K36 G;  2B2W A;  2EDG A;  4ME5 A;  1XX8 A;  2R6G A;  2VNU D;  2OT2 A;  1PTO D;  1DCZ A;  1QWY A;  1FGB D;  4FVM A;  4A3I B;  1VDZ A;  3A8K E;  4KN4 C;  2WKC A;  2KUM A;  3V05 A;  3N6R A;  1EOT A;  2EOT A;  3M3Y B;  1SYC A;  1R4P B;  1EYA A;  1SDF A;  4BS9 A;  4PV1 C;  5KYI A;  4RHR A;  2E2H B;  2NYZ D;  1L0Y B;  1ET6 A;  3QJY A;  2N88 A;  3SR1 A;  4BY1 B;  3Q24 A;  5JOB A;  4DNR B;  2LS0 1;  1PZI D;  4CJ1 B;  4QUF A;  2IT1 A;  5EKK A;  4LK1 C;  3P20 A;  3PUV A;  3D31 A;  3IAY A;  1IYU A;  2HCI A;  5IGC A;  1EEI D;  5M5Y B;  3J80 L;  3PIP 3;  3H0G B;  1EY8 A;  3E6Z X;  3MTS A;  1SNC A;  5IIF A;  1SBB B;  2F0P A;  2A5H A;  3S14 B;  1O7L A;  2B2T A;  2QCP X;  1E2Z A;  3AB9 A;  3NPP A;  1NR2 A;  2L11 A;  1I4Q A;  2CW0 D;  5DAU A;  2YU9 B;  3MA2 B;  2LMC B;  1V1P A;  3BG3 A;  2ICE C;  1X3Q A;  5DNF A;  2DY7 A;  3Q0A A;  5KIX A;  2B2Y A;  4MN3 A;  1ET9 A;  3FPU B;  1HRJ A;  1Z6H A;  4F8M A;  4J8Q A;  2M2L A;  2EY1 A;  5FK9 C;  1ONL A;  1QG7 A;  3M7N A;  1LAB A;  4HMI A;  1FNU A;  3X3M A;  2B8G A;  4IAL A;  3J80 E;  1BBX C;  4UDU C;  3JAM E;  4K6L A;  5C5L A;  3W3A A;  3L9A X;  3URY A;  2B63 B;  1CK1 A;  1CZW A;  2A6H D;  3OOC A;  3KF8 A;  2KED A;  2J4X A;  4N9T A;  2PZT A;  3TP7 A;  1VCI A;  3H94 A;  2SDF A;  5CV8 A;  2KHS A;  3CRL C;  2EYF A;  3A7A B;  5FO7 B;  2EE1 A;  1MBY A;  5T1I A;  1I6H B;  4WOR A;  1R4Q B;  2HDM A;  5C3W A;  1A3U A;  3HGB A;  3C2P A;  3C1F A;  5FKA C;  1DD2 A;  1OXT A;  1KNA A;  2JXM B;  2A6E D;  4OO1 H;  5FOB B;  2WV6 D;  1STB A;  1U4L A;  4CKB A;  1STE A;  4DF7 A;  2K7V A;  3QOJ A;  1DJR D;  5A2Q E;  4RKB A;  1WVL A;  4O1N A;  1E2V A;  2JEA I;  4IUT A;  4NMZ A;  3DEO A;  2I46 A;  5EQ0 A;  4U68 A;  4XXE A;  3R3O A;  4PQX A;  2F0N A;  1UUP A;  3MC0 B;  4XDX A;  3MXP A;  1U4R A;  5IGB A;  3H6M A;  1YNN D;  4IQZ A;  1I50 B;  4TQU S;  5C0X H;  5CR3 A;  2KQ3 A;  2WAC A;  4ABN A;  1LTT D;  2F0M A;  5M5W B;  4Q0F A;  4L6T B;  1EQT A;  3VR3 A;  1BDO A;  4FXK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...