1L1OA

Structure of the human replication protein a (rpa) trimerization core
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
DMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Replication protein A 14 kDa subunit
publication title Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 115
sequence length 115
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1l1oA00
4GN3B 1GM5A 4DR2Q 4JBWA 1EQRA 1SN8A 3S24A 3CF5A 1XNQQ 2HT1A 3HKZE 3RNUA 4JI7Q 3CXCA 2HQLA 2VS1A 3T1YL 1I6HH 3KJOA 5DLQE 4POGA 4DV5L 3RN2A 1CSQA 3K0XA 1KQSA 4JV5Q 4GKJQ 1FL0A 2Z6KA 1RL2A 1J5EQ 2VUMG 4IJHA 4YHHQ 4BXXH 4LUOA 2RHQB 2K52A 1YJNA 2UUBQ 1N32L 4A3LH 2OWOA 4GNXB 1L1OA 5GAGC 5M3MG 4JI0L 3PF4A 1VS0A 1N34L 1Y1WH 4PG3A 3SGIA 4GOPB 1Y1VH 1VQ8A 3PSIA 4PZ8A 4UPAA 2I0QA 1HJPA 1O7IA 1K8AC 4B3TQ 1NJIC 1YI2A 2JA7H 4JI2Q 4LF8Q 2BA0A 3PUXA 1ASYA 5C3EG 2R7FA 1JB7A 1TWAH 3BZKA 4PMWA 4AIMA 4QQBX 2R7ZG 4LUZA 5AJ3Q 1XPRA 4R4QA 2I5HA 4DUZL 2JE6I 3HOZG 4GLXA 1XPUA 3HOYH 3S14H 2K50A 2NVYH 3ULLA 1I3QH 1EOVA 5LMUL 4DV7Q 1GD7A 4HIOA 2CFMA 1ASZA 3H15A 3CC4A 3F2DA 4R4OA 3RLNA 3GO5A 4WJ3M 1VQ4A 3NEMA 3G4SA 4LW1A 4KLKA 3U4VA 5IY0A 2VZAA 2AWOA 4LUVA 3EBEA 2YTXA 4P73A 3CCSA 2VQFL 1VQ7A 4JI6Q 2BH2A 1PYBA 3CCJA 1Q12A 3GTLH 2IHEA 2A19A 5BR8Q 3GTOH 1IBLQ 3TEHB 4DR2L 4A3FH 5GROA 3PV0A 4HJAA 3CPFA 4JI7L 1YHAA 2WFWA 4X62Q 1EQQA 5JJIA 4LF9Q 4IPCA 4LF7Q 3UE1A 4JI4Q 3OTOQ 3M4QA 1PA6A 4UP8A 2ASBA 2Y0SE 3NENA 4JV5L 2QGQA 1PH8A 1HNWQ 3W1GA 4IFDG 2F52A 2UU9Q 1WCMG 2NN6I 1I5FA 4GN4B 3STBD 4IOCA 1GO3E 4R4IA 3I4NG 2KBNA 2IY5B 4GNXA 3MEFA 1S40A 2UUBL 3FP9A 4AQYQ 1QVFA 3S2DH 3S15H 1JMCA 4GOPA 4LF6Q 1OXSC 3HKSA 3J7ZC 5M3FH 1VQ5A 2GVAA 2B3GA 1V9PA 4JC0A 2MNAA 1VQBA 3TREA 2HHHQ 1PFSA 3ULPA 5IP9G 1IBKQ 1XMQQ 4JI2L 2ZM6Q 4LF8L 2RHSB 4JOIC 1PVOA 2NZHA 1GVPA 4JCVE 4JI8Q 5LMNQ 1YJ9A 3CD6A 4EX5A 2LXKA 4AYBE 2VW9A 4ALPA 4HJ9A 1PH4A 1VQGA 1CKMA 4C2MH 5FLXc 3B6YA 1HR0W 3D0FA 4TVAB 3CCQA 3T1YQ 1L0WA 3H0GG 2JA6G 4A3IG 2ZTCA 4P71A 1AE2A 1TWHH 4B3SQ 3AEVA 3RN5A 2E5LQ 1A63A 3ERSX 3S17H 1WJJA 5BR8L 2YTVA 1IBLL 1MIUA 3PO2H 3CPWA 3RZOH 2WP8J 1SRUA 3K8AA 2ZJRA 2CQOA 4A3CH 3K80C 1VQOA 2V1CC 5C0XG 2B63G 5JJLA 4LF7L 2A8VA 4APVA 4JI4L 2ATWA 3OTOL 2IX1A 3HOUH 4MZ9A 3I7FA 4H02A 1M1KC 2GN5A 4LFCQ 1HNWL 1HNZQ 1D7QA 4HIDA 5J3BA 2UU9L 3G71A 1KD1C 1I94Q 2JK8A 3FKIH 2NVQH 1UE6A 3E9IA 4XTCS 2OQKA 1UE5A 3Q8DA 4A93G 3EIVA 4NPSA 4LF6L 4NXML 3F8TA 3KLWA 2QA4A 2HHHL 4BA2I 1X3GA 3J80i 2R6GA 2EQSA 1XMQL 2WB1G 5IYBH 1IBKL 1Q1EA 5IE8A 2ZM6L 2JEBI 1MJEA 1VQKA 3J80c 1P16A 4LF4L 2UXCL 4JI5Q 5M3MH 1PYSB 4P75A 4JI8L 5FJ8G 4WJ4A 4OONA 3GDEA 3M4PA 5LMNL 1KXLA 3KOJA 3KYHC 2VQFQ 3AFPA 3GD7A 1K0RA 1VQDA 2AWNA 3JC66 3F2BA 1KL9A 3RZDH 1DGSA 2JA5G 1S3OA 4A3KG 2ALYB 3T1HQ 4OWXB 4IPGA 2CKZB 1MJCA 3WWVA 1CUKA 2IHFA 4FDBA 2KHIA 2PQAB 2L15A 4O0AA 5C3EH 2OTLA 3PO3G 4B3SL 2R7ZH 2E5LL 5GAHC 1OTCA 1SFOH 3TQYA 1IYJB 5EAYA 1YNXA 3HOXH 5GQOA 1EYGA 3I4OA 1X3EA 4BY7H 4JI3L 5IYDG 2WAQG 2JA9A 1YITA 5E7NA 1LM0A 3BZCA 2FXQA 1Q8KA 4L5SA 2GVBA 1FGUA 1M90C 4X66Q 4LFCL 1YHQA 1W2BA 3S16H 1HNZL 3PCOB 1Q1BA 1X54A 3I4MG 4JYAQ 4UP9A 1YZ6A 4O2DA 3KJPA 4DV6Q 3KFUA 1I94L 1D8LA 2EXDA 4DPGA 1BVSA 3M9BA 4JBJA 4A3JG 1EFWA 5GAEC 4HJ5A 1T9HA 2R7DA 2MQHA 4R4TA 5C44G 1MKHA 1EIYB 4BBSG 3E0EA 3KDFB 1Y14B 1HZCA 4J15A 1Q82C 1HR0Q 3I4NH 4DK6C 1YHBA 4RG1A 1C9OA 1E1OA 1VQIA 4QGUA 1X6OA 1QZGA 3PIPA 4JI5L 3BJUA 5M5WH 2E2JH 3U50C 1PH2A 2LXJA 4LFAQ 4C3JH 1XJVA 2R93G 3NELA 4R1JA 4A4IA 5IP9H 2IT1A 1VQNA 2CWPA 2R92G 2PI2E 2OTJA 1TXYA 5H1SE 3T1HL 2K5HA 2Z0SA 2PQAA 1AH9A 5IP7G 3HKZG 4JOIA 4JBKA 4UP7A 2D0PA 4A3BG 4BY1H 4BXXG 4A3GH 2XTIA 4GLVB 1UWVA 2E2IH 1KAWA 4A3LG 5HY6A 5ELNA 1CSPA 2YTYA 5IWAQ 4DV0L 4OWWB 2NVXH 1K83H 1XTDA 1Y1VG 4ME3A 3U58A 3H0GH 1U5KA 2JA6H 1H95A 1YVCA 4NXMQ 1VQJA 1N33L 4OO1I 2K75A 3TRZA 1L2FA 1OXXK 2PNHA 1NMFA 1XMOQ 1G51A 1A8VA 2MO1A 4DV3Q 3GTJH 1PH9A 1PH1A 3GTGH 4X66L 3A74A 3G6EA 3M3YH 3W1BA 4A3DG 1E3PA 1VQCA 2N49A 3J81i 1Q86C 2E2HH 4JYAL 4LF4Q 4DV6L 4X64Q 4OX9Q 2UXCQ 1QZHA 4IOAA 3VDYA 3L7ZC 4POFA 3J81c 2HIVA 3L2PA 2VL6A 2CCZA 3PUYA 3HOWG 3K7AH 1X3FA 3KDFA 5M5YH 1HNXL 5FLMG 1SE8A 4HJ8A 2MFIA 3PF5A 1VQ9A 3UDGA 1HR0L 4HJ7A 1N8RC 2E8GA 3RLFA 3UE0A 2JJQA 1G6PA 1E7ZA 1YIJA 2F4VQ 3ER0A 4A93H 4LFAL 1C0AA 4DV4Q 1JJGA 5M5XH 1K73C 3LGJA 1XPOA 1CKOA 1VQAA 4DKAC 1PV4A 4JI3Q 4JBMA 5JEAG 5GADC 1QVCA 2JA8G 2KCMA 3FHWA 3UDFA 3UDXA 4IFDJ 1OXVA 4L5QA 3K7UC 1EWIA 4R4CA 1HZAA 5FJ8H 1X55A 3AFQA 2LSSA 3F1ZA 1JT8A 3HFZB 1BBWA 1VQFA 1EIFA 4MTNA 1SMXA 1PH6A 3S1MH 4GOPC 1QVGA 4A3EG 1V1QA 1Z9FA 4DK3C 5HGQA 2Y0SG 1A0IA 1SR3A 3PUZA 4DAYB 5IWAL 2Q2HA 3CCMA 1R9TH 3AQQA 2Q2UA 4DR7Q 2UUCQ 2UXBQ 4HIKA 3PO3H 2ID0A 1LUZA 2RF4A 4DUYQ 1IZ6A 1XMOL 2NZOA 4PZ7A 2VUMH 3M7NA 4DV3L 4NXNQ 2BA1A 1NY4A 3GTKH 4C3IH 5IYDH 2XGTA 3RR5A 4OX9L 4X64L 4DR6L 3HOVG 1VQ6A 1AE3A 2YU9H 4B3ML 1FJGQ 2K5NA 1Q46A 1CKNB 3M4OH 3S2HH 2DUDA 4AYBG 4IJLA 2BH8A 4A76A 1N36L 1IXRA 3I4MH 1B8AA 1WOCA 4QIWE 3ICEA 1OXTA 2YV5A 2HIXA 4TQUS 3JAMc 2I5MX 3IRBA 2F4VL 2N78A 4YCVA 3I2ZA 4DV4L 1YBYA 4GLAC 5C0XJ 4BBSH 4IO9A 3HOZH 2UXDQ 3MXNB 4BBRG 4DV0Q 3W5OA 2ZJPA 3AYHB 4LFBQ 2ZJQA 3NBHB 1I50H 4OWTB 4LF5Q 4A3MG 1B7YB 4YCUA 1GKHA 3HOUG 3RLOA 1N33Q 2JEAI 3EN2A 2AKWB 2R93H 1B70B 1JE5A 2I5LX 5C4XG 1KHIA 3FKIG 1TWGH 2AHOB 3DM3A 3E9HA 2JQOA 3CCUA 1KC8C 2R92H 3S1QH 3CCLA 4DNIA 2EIFA 1PH3A 4DR7L 5IP7H 1KIXA 2UUCL 1X9NA 5IYBG 4A3BH 1HNXQ 4B3RQ 4DUYL 2VY3A 1YJWA 4Y7NH 5IYCG 4X6AH 3GTQH 2KENA 4P72A 4NXNL 2ES2A 1WCMH 3I55A 1UE7A 4DV2Q 2RCNA 3PUWA 4DR4Q 1WI5A 3CMEA 1W3SA 1VQEA 4OXPA 1NMGA 1YEZA 1J6QA 2Q2IA 1WFQA 1E22A 1RIPA 4AH6A 2H5XA 1CKNA 4QJFA 4XIGS 2KHJA 4EQ5A 1FJGL 4KI0A 3CW2C 4A3DH 3OYYA 2Z6KC 4L5RC 1HZBA 4JI1Q 2QEXA 3STBC 4DR5Q 4DR3Q 1V43A 3HOXG 5ELOA 3U4ZA 3L0OA 4DR1Q 1L1OC 3HOWH 3DLLA 1A62A 4KHZA 4BY7G 2C35B 4GKKQ 5FLMH 4KHPQ 2UXDL 1KRTA 4YY3Q 1VQHA 2NN6G 1Y1WG 1OXUA 3KF8B 3KF6B 3ULJA 1S72A 1XNRL 4LFBL 3CAMA 2DGYA 4LF5L 3UDIA 4A3IH 2JA7G 1SROA 3TS0A 2IX0A 4X65Q 4P74A 3CP0A 1NTGA 2K5VA 4OO1G 3PUVA 4IPDA 4BA1I 1XNQL 3A5ZB 3S1RH 4RMFA 1E1TA 4K0KQ 1Q81C 4IPHA 2AMCB 1G291 4Y52H 1N9WA 2JA8H 4DR6Q 3J81j 3CCEA 2KCTA 4L5TA 4JG2A 3TS2A 2VNUD 4PZ6A 2B63H 4IFDI 4DV1Q 1EUJA 4GKJL 2D62A 1IBMQ 1J5EL 4B3MQ 3HOYG 2N8NA 1TWFH 1UE1A 2PI2A 3K81C 4YHHL 3CCVA 1PH5A 4B3RL 1LTLA 4LNQA 3I56A 1FVIA 2VQEQ 1N36Q 4A3EH 4DV2L 4C3HH 1TWCH 4DR4L 2WB1E 2UUAQ 3S1NH 4B3TL 3H3VH 1QUQB 2A1AA 4A3FG 4YWLA 3A5UA 1BBUA 3CCRA 1JJCB 2K4KA 1VCIA 4GN5A 2NVTH 2PMZE 4JI1L 2OQ0A 1HH2P 4BY1G 4A3GG 5AJ3L 3HOVH 4DR5L 4DR3L 4GNXC 5C4JH 1X65A 4LWCA 4DR1L 4NB3A 5IT9c 1VQLA 1K8GA 4GKKL 3BU2A 4DV7L 2UXBL 4HIMA 2JA5H 4KHPL 4YY3L 4A3KH 1PHJA 3KF6A 3CC7A 1PH7A 5M3FG 4DV5Q 4QY7A 1HZ9A 4YWKA 2WAQE 1VQMA 3CC2A 2YYZA 4X65L 1U0LA 4DAMA 1K9MC 3A0JA 1LYLA 4A75A 1IL2A 3J7A5 1N32Q 2F3IA 1X56A 1JJ2A 4JI0Q 1L1OB 4BBRH 5C0XI 1N34Q 4K0KL 2N3SA 3PGZA 2ZTEA 4X62L 4LF9L 1E24A 1KRSA 4YCWA 3CMAA 4A3MH 4DV1L 1VQPA 4GS3A 2B29A 1IBML 3G48A 2Q2TA 5C4XH 3JAMi 2VQEL 1SLJA 2D0OA 4AQYL 1C7YA 2OCEA 3H3VI 3M85A 1WYDA 1P8LA 3PIOA 2UUAL 4JI6L 4DUZQ 2K14A 4QL5A 3F2CA 4A3JH 3GTPH 1K3RA 5JEAJ 5JJKA 1QUQA 4MNOA 5K36G 5C44H 3PO2G 2MO0A 1NBWA 5LMUQ 2CWAA 1BKBA 3ZJYC 5IYCH 4YWMA 1Q7YC 4A3CG 5LMNW 1XNRQ 3CQZH 4UY8C 1NE3A 3GTMH 3D31A 1UEBA 1Z47A 2ZTDA 3OW2A
chains in the Genus database with same CATH superfamily
4GN3B 1SN8A 2EYOA 3S24A 2Z4IA 2VS1A 1GXDC 5DEHA 4POGA 4JV5Q 1FL0A 2VUMG 1RHPA 2QDBA 1EY4A 5KNCA 2RHQB 2K52A 1YJNA 3H91A 1HHVA 2UUBQ 2E2IB 4A3LH 4GNXB 2K5QA 4JI0L 3PF4A 2NN6H 4PG3A 2NVXB 3DHQA 4PZ8A 4UPAA 2I0QA 1O7IA 3HG9A 2E76C 5EQ0A 5DM73 1YI2A 1NJIC 1KNEA 2BA0A 1PFBA 3GTGB 4PQXA 1ESRA 1JB7A 1TWAH 3U9OA 5LHY1 1F2ZA 1MBYA 1ICWA 2EDGA 4ZAIA 4DUZL 3AMUA 4L8JA 1XPUA 3HOYH 2K50A 4P2CB 3C2PA 1B1ZA 1H9RA 1I3QH 1ASZA 2UXBQ 3NXWA 2F0UA 3M7GA 5IY0A 2VZAA 5E3FA 4CJ2C 3CCSA 3J7A5 3CRLC 2N88A 3GTOH 1PTOB 3S1NB 3HS0C 2J7ZA 4DR2L 2PCFB 5GROA 4LK1C 3BS1A 4DNRB 4HJAA 5D14A 1YHAA 1DONA 2WFWA 4LF9Q 1O7LA 3M4QA 3UI2A 1PDQA 3NENA 2QGQA 1IW7C 2SOBA 4EQPA 3RMHA 3G6JB 2F52A 3I4NG 1WCMG 3STBD 3S1MB 2PMZB 2JA5B 1EY5A 3S15H 1A2UA 1M4VA 4GOPA 1OXSC 3HKSA 5L37A 1R9TB 1VQ5A 1V9PA 2X6LA 4DK0A 1XMQQ 3JAME 1GUWA 2A6HD 4F88A 2ZM6Q 4TRDA 4JOIC 2WKCA 5LMNQ 2L1BA 1H9KA 3Q23A 3QOJA 4AYBE 1PH4A 4C2MH 5NUCA 3B6YA 3A54A 2F0JA 3TBIB 3K57A 3QR8A 1CT1D 1DD2A 3H0GG 4KTAA 2JA6G 4A3IG 3K5OA 4P71A 1JOKA 5EKIA 3T51B 3RN5A 1A63A 3GTPB 4RKLA 4A3JB 5BR8L 2PQEA 2YTVA 1IBLL 5C44B 3PO2H 1SRUA 3K8AA 3P1HA 2V1CC 4K5XA 3S9WA 5ELCA 4APVA 5FLXL 4JI4L 1K8OA 4RWSC 3I7FA 1M1KC 2GN5A 1D7QA 4C3HG 1KD1C 2PZWA 1UE5A 3Q8DA 3SE0A 1ET6A 4A93G 4NPSA 3KLWA 1PYWD 3J80i 4G4KA 3K59A 1IBKL 2B2UA 2WB1G 5IYBH 1Q1EA 5IE8A 3SXHA 2K03A 4J8QA 1P16A 5CMDA 4JI8L 3M4PA 4IN3A 3KOJA 3J7YW 1RCVD 2VQFQ 1Y1VB 3I70A 3AFPA 3GD7A 1K0RA 3JC66 1KL9A 3I73A 1DGSA 4ZK9B 3T13A 2LY7A 2ALYB 4IPGA 1EWHA 1PLFA 4FDBA 2IHFA 1LT6D 2DJFC 4B3SL 2R7ZH 2D2CC 2E5LL 3TQYA 1IYJB 5EAYA 3J80L 2XVSA 3MTSA 1EYGA 4ZUIA 3S14B 2JA9A 4FP5D 5E7NA 4F87A 5EPKA 2FXQA 3ONAB 2QF7A 4E6IA 4DN4M 4L5SA 1STEA 1C8CA 4GZYC 4LFCL 4FYDA 3QWNA 1U4LA 3PCOB 1Q1BA 5IGDA 4JYAQ 2K32A 1YZ6A 4WJWA 3KJPA 1I94L 1BVSA 1RODA 3NSWA 4JBJA 4N8X1 2JA8B 2BDNA 1Y69U 5GAEC 2RDHA 1T9HA 4R4TA 1MKHA 4FVMA 4BBSG 3FVQA 4IFDH 3BG3A 4NKLA 1HR0Q 1YHBA 1E1OA 1MD2D 4JI5L 5EBCA 5M5WH 5A35A 2Q8TA 1PH2A 4U673 1XJVA 3DWQA 2CVRA 1B9NA 1PFNA 1V1PA 3NELA 4K2KA 4R1JA 4TSSA 1YNNC 3KBGA 3LNNA 2R92G 2OTJA 1TXYA 2K5HA 2QCPX 1DOMA 2OEOA 2NVTB 4L63B 4JBKA 4RFBA 4KV6A 2XTIA 1UWVA 2E2IH 3E6ZX 4A3LG 1BXTA 4K6LA 5HY6A 5ELNA 2YTYA 4KKSA 3M4YA 1EIGA 2HDLA 4OWWB 4DV0L 4R8IA 2NVXH 4AYBB 2E75C 4OO1I 1TWHB 3AU7A 1L2FA 1OXXK 2RBMA 5C3WA 2MO1A 5J1ZA 4N9TA 4DV3Q 3GTGH 4X66L 3A74A 3G6EA 1VQCA 2N49A 2R3ZA 4LF4Q 2UXCQ 2DY7A 2K5WA 2FFKB 2CCZA 2B2TA 3HOWG 1GUSA 3HOUB 3ITPA 1X3FA 2OF1A 1SE8A 4HJ8A 2MFIA 4WRDA 5F2DA 1FGBD 3VYSA 3FKIB 4HMJA 1IW7D 4IUNA 1YIJA 1MHWC 2G5DA 2MUYA 1S5BD 4DV4Q 1RKNA 5CORA 5ELEA 1CKOA 1F9RA 5K36H 1GUOA 3V05A 3KK7A 1QVCA 2IPKD 2KCMA 1OXVA 3NTKA 1X55A 3AFQA 1JT8A 3HFZB 4IUUA 2C5CA 3DEPA 1SMXA 1PH6A 3S1MH 4GOPC 5G3LD 2PW7A 1AEXA 1SR3A 5IWAL 1CI3M 3CCMA 3IFTA 1R9TH 1ENFA 5J39A 4V190 1LUZA 2PPBC 2BDOA 1IZ6A 1XMOL 2NZOA 5I4DA 2VB3X 2RA4A 1EYAA 1NY4A 2KHSA 2QILA 3RR5A 1STNA 4OX9L 3VR2A 4HSVA 1JOOA 1FJGQ 2NTSA 4C1NI 1Q46A 4RH6A 1FR3A 1IXRA 1G6ZA 3H09A 1SSOA 3ICEA 3A8IE 2I5MX 3IRBA 5CV8A 3I2ZA 4C56C 1HTLD 3VR4A 4IO9A 2A74C 3W5OA 3PQIA 2AQ1B 1I50H 1GKHA 1WTWA 3RLOA 1N33Q 1AP0A 3LWEA 1D1IA 3TN2A 4J6HA 1T5EA 5E1FA 2AHOB 3FMCA 2JQOA 2EYHA 2MP1A 4DAYA 5JAVA 1G8ZD 2E74C 4DNIA 1TVXA 1E2VA 4F8MA 4DR7L 5IP7H 2B2YC 1X9NA 5IYBG 5C3XA 4BY1B 4A3GB 2VY3A 1YJWA 4Y7NH 2EY2A 2KENA 2ES2A 4FNFA 3I55A 4FF3A 2O5IC 2RCNA 5CBEE 1WI5A 2KCCA 2QKIC 1WD1A 1WFQA 5M3FB 1OO9B 1FYCA 4QJFA 4LMQD 2KHJA 3MZ5A 3TZDA 1DZ1A 4DR5Q 4DR3Q 4HCSA 4DAPA 4DR1Q 2G9DA 1L1OC 1WTPA 2VXWA 5FLMH 3MXNA 1VQHA 3NBHA 3KF6B 1IL8A 4LFBL 2NUCA 5T1GA 3UDIA 2JA7G 4X65Q 4P74A 2K5VA 2M00A 2JP1A 4BA1I 4RMFA 4FO2A 4K0KQ 2K01A 4IPHA 3EA6A 3RZOB 4ZRZA 5JEAH 2JA8H 4DR6Q 3TS2A 4JG2A 1YNND 3MXGA 4NP5A 2B63H 4IFDI 4KJNA 1EUJA 3LX0A 2BOSA 1DJRD 2N8NA 2PI2A 5BN5A 4B3RL 1LTLA 3RD4A 3I56A 1FVIA 3H6MA 1II3A 4CKBA 3RUZA 4DR4L 1BDOA 3H3VH 1LACA 1KDBA 1QUQB 4CBVA 4A3FG 5COYA 4CJ0B 1BBUA 1JJCB 2K4KA 1BF4A 2NVTH 1KLUD 3ND8A 4OIJA 5M3MB 1HH2P 4KY7A 2DN8A 4GNXC 5C4JH 1LTID 1G2SA 4MHEA 1K8GA 4GKKL 3HEJA 3S2HB 2UXBL 2JN4A 1K3BC 3KF8A 1SE4A 1MSHA 3I8ZA 1YNJD 4QY7A 4CDCC 1PZJD 1VQMA 1KTKA 1WTOA 4K5WA 3A0JA 1LYLA 4RGNA 5M9OA 2RQXA 4UDUC 4LF9L 1KRSA 1QG7A 3FPUB 3DXJC 4DU9A 5E4WC 1STAA 4CDFC 5IODA 4O1NA 4XXEA 2VQEL 3E0JA 1PTOC 1WYDA 1P8LA 2UUAL 2F3WA 2IJ0A 3F2CA 4G57A 4XT1B 5A2QE 4MNOA 5K36G 5LL6S 1ZYRC 2MO0A 1L0XB 2SEBD 5LMUQ 2ZT9C 4A3CG 5LMNW 1EL0A 2RVLA 3SR1A 4G7HC 2ICEC 1D5XC 2ZTDA 3UDGA 1DYQA 1B3AA 4C3JB 1GM5A 1TS3A 4JBWA 1EQRA 1XNQQ 3RNUA 4JI7Q 3CXCA 1HA6A 2WKDA 5DLQE 4DV5L 1CSQA 1JORA 3T53B 1J5EQ 4ZYSA 4BXXH 1GUGA 2WACA 1L0YB 1QWYA 1FNUA 2A73B 2F0IA 1HFNA 4GOPB 1VQ8A 4X3TA 4IURA 1ENCA 4JI2Q 1ZEQX 2LKVA 3OWEB 5IIFA 1KNAA 2IX3A 3PUXA 1I4PA 2R7FA 5JVG3 3C3LA 5D3DA 2E2HB 4RGMA 4IUTA 3WOEA 4AIMA 1ESFA 4N8FA 4R4QA 5AJ3Q 5I9PA 1XPRA 3QOLA 3K7AB 2PO4A 4EVOA 5M5YB 4DV7Q 1GD7A 2CFMA 3H15A 4WJ3M 1VQ4A 1EZ8A 1ZXTA 3G4SA 4LW1A 2A6HC 1DM0B 3U4VA 5IGGA 2AWOA 4P73A 4QMGA 2VQFL 1KLGD 1PYBA 1X32A 2H1EA 5LL6X 1VMPA 4ZKCB 1HUNA 5JJIA 3L9AX 3UE1A 2F0WA 1A2TA 2Y0SE 1XXGA 1HNWQ 3SK6A 2UU9Q 4ID6A 4GN4B 5JVH3 1S40A 4H13C 4RAUC 5EGTA 1DCZA 1QVFA 3NP8A 3S2DH 4A3KB 1JMCA 3C1EA 1E0BA 4JI6Q 3J7ZC 5M3FH 2B3GA 2MNAA 2HHHQ 3TREA 1PFSA 1HTPA 3ULPA 1SAPA 5IP9G 4H0LC 4LF8L 1EWCA 1PVOA 2NZHA 1GVPA 1AW7A 5KEEA 4UHVA 2LXKA 1PRTC 4ALPA 4HJ9A 5FLXc 1HR0W 2NB0A 1CQFA 4TVAB 1XWEA 3CCQA 1B4OA 2DNCA 3I4MB 1G91A 1CFMA 4EQNA 2ZTCA 3QIAA 1SNDA 2DJGC 4MIUA 3KBXA 1PZID 2F4IA 3RZOH 2ZJRA 1R4QB 4HMIA 4QF4A 3K80C 1VQOA 2B63G 4LF7L 2A8VA 2A69D 2NTTA 2K1BA 3NQIA 4X3UA 3OTOL 1F2LA 4K5VA 4MZ9A 2L11A 1SBBB 5J3BA 4ZUJA 3ZYYX 2F0GA 1UE6A 2G9HD 2OQKA 4LF6L 2XRSD 1W6JA 3KLSX 2QA4A 4N9PA 1AZQA 4DF7A 4BA2I 1WTVA 1X3GA 2PZTA 4A3BB 2FMMA 2EZVA 3D4DA 1JICA 1MJEA 3J80c 5ELDA 3GTQB 4LF4L 2UXCL 5M3MH 5FJ8G 4OONA 3GV6A 3KYHC 2H4OA 1RDPD 5I2XA 1EY9A 1V1PB 5ISRA 3F2BA 1TR5A 1S3OA 1KAAA 4YIJA 5C4HA 4A3DB 5C3EH 1IKLA 4O0AA 2L15A 2OTLA 3PO3G 4CKCA 3DWAA 3HOXH 3QJYA 1PTOD 5CV6A 1ICFB 2WAQG 5IYDG 3NWTA 1NAPA 2EYMA 1ZYRD 3OW7A 3D4WA 2QEJC 2GVBA 1M90C 1O7YA 1S5ED 1YHQA 1HNZL 4OO1H 1X54A 1UUPA 4UP9A 1TS2A 2JSOA 4DPGA 1STGA 1MI2A 3VYRA 2EXZA 1EFWA 5CC4A 4HJ5A 2R7DA 3NE5B 1BR9A 1T5XD 2F0NA 1EIYB 4OGQC 1I4XA 4J15A 4HR7B 4RG1A 1C9OA 4Z9CB 1X6OA 3PIPA 2Y0SB 1TWCB 3QB3A 4LFAQ 4C3JH 3P7JA 2B2VC 2R93G 1CTMA 4RA8A 5KYIA 4A4IA 2IT1A 2L9HA 1SNCA 2PI2E 4R9WA 3T1HL 1LABA 2VB2X 5FKAC 3MC0B 2Z0SA 2PQAA 4BWGB 3HKZG 3SHLA 4UP7A 4BXXG 4XQJA 2F0LA 1KAWA 2A68D 3CU7A 1CSPA 1B50A 4KD3A 1XTDA 2X6GA 1U5KA 2X69A 4NXMQ 1N33L 1VQJA 3SK5A 3EROA 1K0SA 3TRZA 1JQYD 4I7ZC 2PNHA 1NMFA 2EY5A 3OSOA 1G51A 3Q0AA 1PH9A 1KDAA 3W1BA 3J81i 2E2HH 1EEID 4DV6L 4X64Q 4IOAA 1ZKOA 3L7ZC 4POFA 3L2PA 5C0XH 3J80E 2VL6A 1UNSA 3PUYA 3DUZA 1HQRD 3K7AH 3MFGA 4HN7A 4A3MB 3KDFA 5M5YH 3WOFA 2RDGA 4HJ7A 5C4XB 2NVQB 1G6PA 3ER0A 4RGTA 5CYUA 1JJGA 3T4AC 4QCLA 1K73C 1VQAA 2V4DA 4JBMA 3J81L 3FHWA 3UDFA 4IFDJ 4R8NA 4L5QA 3GTKH 1HZAA 1VQFA 1B44D 3F2UA 1EQVA 4MTNA 1QVGA 2F0SA 3VA5A 4A3EG 1PRTD 1Z9FA 4DK3C 3PUZA 4DAYB 4DA2A 2XRQD 5FO8B 3HP3A 3NTIA 4X3KA 2RF4A 4DUYQ 4PZ7A 1SFOB 5I6YA 4NXNQ 4KD4A 4QIWB 3TMEA 4KMUC 4BY7B 3K5NA 4C3IH 4LAAA 1LTAD 4DR6L 2N55A 3HOVG 1Y1WB 1VQ6A 2YU9H 1SNQA 2K5NA 3ERQA 4RGOS 3EVQA 2DUDA 1KABA 2BH8A 4A76A 3I4MH 3DEOA 3DMUA 1WOCA 4FF1A 3KUPA 2I46A 2F4VL 3IFDA 1YBYA 4GLAC 1C4QA 1PRTB 2UXDQ 3HOZH 3MXNB 4BBRG 2NVYB 2ZJPA 4NMZA 3AYHB 3NBHB 1CA6A 2B39A 4YCUA 2AUKA 5KGUA 5C5MA 4KY6A 1PXUA 2AKWB 1B70B 1JE5A 2I5LX 1KHIA 3MXPA 2E2DC 1KC8C 3E9HA 3A7AB 2EIFA 4CDEC 1JWSD 1D2BA 2UUCL 4A3BH 1HNXQ 2XWJB 5IYCG 3GTQH 4DV2Q 1UE7A 4KJOA 3BVZA 3C1FA 4K14A 1HCZA 2R61A 3VR5A 4FXGC 4Q5VA 2H5XA 3NTHA 4NDXA 3CW2C 4A3DH 3OYYA 1HZBA 1H9JA 2QEXA 1X3QA 1V43A 3HOXG 5ELOA 3L0OA 3DLLA 1A62A 4EGVA 1H9SA 2NN6G 3KF8B 2MGSA 3ULJA 4ILWA 1C48A 1JWUD 4I65A 2DGYA 4LF5L 2KEEA 1SROA 2KCNA 4KKUA 1NR4A 4OO1G 1XNQL 3A5ZB 3IKJA 1E1TA 2O4XA 1QE6A 2AMCB 1G291 1N9WA 1BBXC 3CCEA 2KCTA 3OPOA 4B9WA 4DV1Q 3AB9A 2EVBA 1J5EL 3HOYG 1LTTD 3K81C 5IGCA 1YNJC 1DOLA 5CV4A 4LNQA 3QG1A 5FO9B 2EJGC 1TWCH 2B8FA 3MEHA 1TKWB 2WB1E 4BS9A 3S1NH 1PTOH 1CQVA 2VUMB 2M2LA 1V8QA 4JI1L 2OQ0A 1D1KA 5AJ3L 3OMCA 1X65A 1UAPA 4LWCA 3M4OB 1SYBA 3BU2A 4DV7L 3RZDB 1IYUA 4HIMA 2JA5H 4KHPL 4YY3L 1TY2A 2FINB 1HZ9A 1CHPD 4YWKA 5IGFA 1K9MC 1U0LA 4A75A 2F3IA 4JI0Q 5C0XI 3PGZA 4YCWA 3BYTB 5IT9L 4HAEA 4A3MH 4GS3A 4K8JA 1IBML 3G48A 2Q2TA 3WDNA 4DXGA 5C4XH 2SNMA 2NWGA 3S16B 1EEFD 1WTXA 5DM63 2OCEA 4JI6L 4DUZQ 3GTPH 4A3JH 5JEAJ 5C44H 3PO2G 1NBWA 1BKBA 1Q7YC 4YWMA 5C4ZA 3I4NB 1WCMB 1XNRQ 1NE3A 4JW0A 1UEBA 5TSSA 1STHA 4DR2Q 2WINB 3LWUA 1JWMD 3J7AF 4DK1A 3KJOA 4IZ8A 3RN2A 3K0XA 2B2UC 1KQSA 1CHQD 4GKJQ 2Z6KA 4YHHQ 1NR2A 2XSCA 4C3IG 2C9OA 3V96A 1N32L 2OWOA 5GAGC 1VS0A 1N34L 1Y1WH 1K83B 1Y1VH 3PSIA 3H0GB 4KY5A 2JA6B 2IW3A 4A3IB 4HEDA 3W3AA 1A6XA 1ASYA 3M3YB 2JYOA 4K2LA 1J9OA 2Z1CA 4QQBX 2R7ZG 4LUZA 1QCBD 3BDLA 3S14H 3HOZG 1TWFB 2NVYH 3ULLA 1EOVA 1Q90A 3CC4A 4HIOA 4R4OA 4C3HB 2F3VA 2BH2A 1VQ7A 2YTXA 1QB5D 1Q12A 3D6WA 2IHEA 5BR8Q 4A93B 1IBLQ 5CV5A 3TEHB 4DAVA 5M5XB 2K28A 1ONLA 3PV0A 2WB1B 4X62Q 4IPCA 4JI4Q 3GQBA 4UP8A 2ASBA 4JV5L 4IFDG 2IY5B 1I5FA 1E2WA 4IOCA 4R4IA 3MEFA 2UUBL 3FP9A 4AQYQ 3N6RA 3EQLC 2GVAA 4JC0A 1VQBA 1HXYD 2CH4A 3URYA 1IBKQ 3O13A 2A69C 2RHSB 4JCVE 4JI8Q 2HCIA 1YJ9A 1MSGA 3CD6A 4EX5A 2LS01 2XWBB 3BZDB 4O42A 3T1YQ 1L0WA 5EKLA 3TP7A 1TWHH 4B3SQ 3AEVA 2E5LQ 2Z8LA 3ERSX 1WJJA 4DFAA 1MIUA 1NCVA 2WP8J 1WVLA 4BBSB 2CQOA 1BCPF 3SDZA 2B2TC 1SMYD 4RCOA 4C1NK 5JJLA 2ZXPA 2IX1A 3HOUH 3HRZC 1EFID 2F0OA 1V1OA 2LFNA 1HPCA 4H02A 4LFCQ 1GUTA 3PIP3 4J1MA 1I94Q 3FKIH 1TWGB 3E9IA 4XTCS 2R92B 4NXML 3F8TA 1WTQA 1GHKA 2R6GA 2L12A 1DXMA 2EQSA 1XMQL 2ZM6L 2JEBI 2MJ8A 4LJZC 3QO2A 2KUMA 1GJXA 4JI5Q 4P75A 2NYZD 3GDEA 5LMNL 3SVMA 1SJHD 1U4RA 1VQDA 1S5FD 3RZDH 2JA5G 2DY8A 1SNOA 1CZWA 2CKZB 4CJ1B 1CUKA 1TWAB 2PQAB 5I6WA 1OTCA 1YNXA 3CRKC 3I4OA 1MGSA 3HOWB 1X3EA 1I3QB 1WD0A 1YITA 2KQ3A 3BZCA 1Y8PB 1Q8KA 5K5PA 3DM1A 2DNEA 1H9MA 2K04A 4X66Q 1W2BA 3S16H 5JOBA 4O2DA 5EPLA 3S1RB 1D8LA 3M9BA 2A68C 3NUCA 4A3JG 5C44G 1F2YA 3KDFB 3VR6A 1QNKA 1Y14B 1Q82C 2XNAC 3I4NH 1WTHA 3FPPA 4DK6C 1O78A 1AFPA 1VF7A 5EJWA 1BQQT 5FOBB 5I2YA 4QGUA 4RCNA 1Q8IA 3BJUA 3ND9A 1QOHA 3S15B 3U50C 3FRPB 2EPBA 2KVMA 1TY0A 1VQNA 3TP6A 1F9SA 5H1SE 3EJIA 1PFMA 1AH9A 5IP7G 4JOIA 4BY1H 4A3GH 2HD3A 2PYKA 2F0DA 4B08A 1F9PA 3R93A 2KOLA 3MVVA 5IWAQ 4HSPA 1K83H 1Y1VG 1FD7D 3H0GH 2JA6H 1YVCA 1XMOQ 1A8VA 4L6TB 1PH1A 5HGTA 1CA5A 3M3YH 1STBA 1Q86C 4JYAL 4OX9Q 1QZHA 1BNZA 3J81c 2HIVA 2IWHA 1R4PB 1HNXL 1A3VA 5FLMG 2F1MA 3PF5A 4XYQA 3I3CA 1I6VC 3Q22A 1HR0L 4TKOB 1N8RC 1RTNA 4MN3A 2E8GA 2JJQA 1E7ZA 4A93H 1C0AA 5M5XH 3LGJA 4FF4A 5BN4A 4JI3Q 1G2TA 5JEAG 5GADC 2JA8G 4H44C 1HUMA 2QW7A 3K7UC 1CZGA 4Q0FA 5KNDA 2F0KA 3F1ZA 2LSSA 3HZXA 2CW0D 3NBIA 3K5MA 1SNPA 2RSOA 1EIFA 1V1QA 2Q2HA 1X3PA 3AQQA 1ENAA 4DR7Q 2L5TA 1I6HB 4OEMB 3BVGA 5EBDA 3TSSA 3M7NA 4DV3L 2BA1A 1IYVA 2M9VA 2XGTA 1LT4D 2KEDA 4RHRA 1LV9A 1AE3A 2JA7B 2GA4B 3S2HH 4AYBG 5J22A 1BCPB 3X3NA 4HTHA 5JJZA 2ZXOA 1I4GA 3CKIB 4QIWE 2HIXA 3JAMc 2N78A 1Q3LA 4YCVA 4DV4L 1B2TA 2JXMB 5C0XJ 4BBSH 1QNUA 1NNXA 2BE5C 1H9SB 4LFBQ 4OWTB 3MWYW 2A6EC 3HOUG 3OIQA 1CM9A 3GTLB 1B3QA 2IL8A 4KN7C 3FKIG 5AFWA 4OELB 1TWGH 3DM3A 3CCUA 4A3FB 2R92H 3CCLA 2K05A 1SE2A 4FXKC 4KN4C 1PH3A 2I07B 3MHBA 3TP5A 2FMCA 4PNYA 3J81E 4B3RQ 4X6AH 5FLXE 4DR4Q 3CMEA 4OIKA 1VQEA 1D5MC 1NMGA 2Q2IA 1B53A 4OL7A 1EY0A 1RIPA 3MXUA 1FJGL 1CKNA 2Z6BA 1GHJA 2LMCB 1RF2D 1IKMA 4NW2A 4L5RC 1TS5A 3U4ZA 3HOWH 4GKKQ 1ML0D 1KRTA 1M8AA 1OXUA 1HA5A 1D5ZC 2EJFC 2RDFA 1XNRL 1UEAB 4B9XA 3MAQA 4IUVA 3CP0A 3PUVA 4IPDA 3S17B 3S1RH 3E5SA 3DWPA 1Q81C 2O5JC 4Y52H 1A15A 2VNUD 4MTKA 2CHBD 4GKJL 4B3MQ 5IOCA 4IALA 4YHHL 1PH5A 2VQEQ 1N36Q 3G7LA 4KK7A 3SK8A 2UUAQ 4X3SA 2F0HA 4H7BA 4YWLA 1RJTA 1TU2B 1AN8A 3TZUA 1VCIA 2MPMA 4GN5A 4PMBA 1QJOA 4BY1G 4A3GG 4DR5L 4DR3L 5EKKA 4DR1L 4NB3A 5IT9c 1JR0D 4HCEA 2K5DA 4A3KH 3CC7A 1PH7A 5M3FG 4DV5Q 1JB3A 3U9SA 2WAQE 2PZUA 3BYYB 4X65L 1B9MA 3OWFA 1X56A 4K0KL 2N3SA 2ZTEA 4X62L 1I50B 3CMAA 3FDTA 3A8JE 1SNMA 1VQPA 2B29A 3BVMA 5G3LF 3JAMi 1A3TA 4AQYL 1C7YA 4G7ZC 3PIOA 5JJKA 2K14A 3MFYA 4QL5A 1K3RA 5DAUA 3TP8A 3OMGA 2B2YA 2CWAA 2CH4W 5KIXA 3X3MA 4Y7NB 3A55A 3Q24A 2XN9C 4UY8C 2EJMA 5BN3A 1Z47A 2E2JB 3OW2A 4S3SA 2HT1A 2Q8RE 3CF5A 3HKZE 5EPJA 2HQLA 3JAML 3K5LA 3T1YL 1I6HH 5HURA 4U68A 3R2TA 1RL2A 2Q8IB 1GOZA 4IJHA 4XQNA 4LUOA 1GUNA 3IL8A 4ZQ3A 2KECA 1L1OA 5M3MG 3VA7A 3P20A 2HDMA 1VMCA 3SGIA 4CKEA 4QB4A 4B3TQ 1HJPA 1K8AC 2BE5D 2JA7H 1U9RA 4LF8Q 2A6ED 3TDQA 3GTJB 5C3EG 1EU4A 4RHSA 3BZKA 1SE3A 4PMWA 2B63B 2I5HA 1FNVA 2JE6I 2SDFA 4GLXA 1NUCA 2MHVA 4DGZA 5LMUL 2ZXRA 3F2DA 3RLNA 3GO5A 5IT9E 3I4LA 1EU3A 1SJED 3NEMA 4KLKA 5FO7B 4LUVA 3EBEA 3NHHA 1KDCA 3CCJA 3GTLH 2A19A 1SEBD 4A3FH 1IHZA 3CPFA 4JI7L 2EY1A 1EQQA 4LF7Q 1E2ZA 3OTOQ 1PA6A 2F0QA 4KHVA 1PH8A 3W1GA 1EIHA 2AQ3B 5C4JB 1LTRD 2NN6I 2OT2A 3IAYA 1GO3E 2KBNA 4GNXA 3D4RA 1S5DD 3R3OA 1XYIA 5KNBA 3EFXD 1LTBD 3VYTA 4C3JG 4LF6Q 3H94A 2P5ZX 1TQOA 1EYCA 1SMYC 4JI2L 3GP7A 3PO3B 2Z4HA 3BDOA 1Y8OB 2WAQB 4ME5A 1LT5D 2VW9A 1VQGA 1CKMA 3D0FA 2KJXA 1Z7TA 2F0MA 1I4QA 2B2WA 1AE2A 3D3RA 2K6AA 3S17H 1K28A 3PMFA 3CPWA 1CK1A 4A3CH 1DOKA 4IUQA 3C46A 5C0XG 2ATWA 4UAIA 1HNWL 1HNZQ 4HIDA 2R93B 1STYA 2O2LD 1XTCD 2UU9L 3G71A 4ZKBB 2JK8A 2NVQH 3S1QB 5C5LA 3V2TA 2HCCA 3EIVA 5FK9C 3K58A 2HHHL 3HKZB 5IGBA 2RKSA 1VQKA 4WJ4A 1PYSB 3KLSA 1KXLA 4ULLA 4RKBA 2K33A 4CGYB 2AWNA 3P75A 4A3KG 1SYFA 3A56A 3T1HQ 1ILQA 1EY8A 3NQTA 4OWXB 4FF2A 3WWVA 1EY7A 1MJCA 2KHIA 5JPMC 2EY6A 5GAHC 1SFOH 5GQOA 4BY7H 4JI3L 5T1IA 1LM0A 3R8BA 3NK9A 3SEBA 1O7ZA 2F03A 2EOTA 3T16A 3OOCA 1FGUA 2PW5A 4OHJA 1BUVT 3I4MG 4I7AA 2F0VA 4DV6Q 3OIPA 3KFUA 3A8KE 1O80A 2EXDA 5C6AA 2MQHA 3E0EA 1J8IA 3BDCA 1HZCA 1HRJA 4K8IA 1VQIA 1QZGA 4A3EB 3S2DB 2E2JH 2LXJA 2QDLA 1S4ZA 5IP9H 2CWPA 4KKTA 4CHTB 4QUFA 3I90A 3HGBA 5DNFA 2D0PA 4A3BG 4FXDA 3HOVB 4GLVB 1WTRA 2F0PA 3I91A 4ME3A 3U58A 2K7VA 1PZKD 1H95A 2K75A 1BCPC 1S5CD 3K0YA 1TS4A 3GTJH 1I4RA 5ELFA 4A3DG 1E3PA 2CW0C 4BBRB 3VDYA 5D3IB 5CGKA 2L0CA 1JE4A 4PMCA 4DXFA 3E3XA 1SYDA 1U4PA 1VQ9A 3RLFA 2WIIB 1LTGD 3UE0A 3D8GA 2F4VQ 3CHBD 4LFAL 3NPPA 1VDZA 4F7XA 4M1UB 1XPOA 1Z6HA 4DKAC 1PV4A 2WV6D 3UDXA 2BCOA 3CQZB 5FJ8H 1EWIA 1Y8NB 2FJ2A 4R4CA 3GTMB 4WORA 1BBWA 2EYPA 1ILPA 2CQAA 2OXPA 5HGQA 2Y0SG 1A0IA 5C3EB 2Q2UA 3NWSA 2F0FA 2UUCQ 4CDDC 4HIKA 1AZPA 3PO3H 2ID0A 5CV9A 3W2DA 2VUMH 3HOXB 5KYLA 5IYDH 4QUCA 4X64L 2SNSA 3GV3A 2EYLA 4B3ML 4XQQA 3M4OH 1CKNB 1PMRA 1TT2A 2B2WC 4IJLA 1N36L 3J7AV 4XYOA 5ELBA 1B8AA 2EYJA 4JPBW 1VF5C 1OXTA 2YV5A 4TQUS 2KA7A 2NBFA 1JOQA 1BO0A 2FHTA 2HQEA 1F9QA 2J4XA 1NSNS 3HOYB 2B8GA 4DV0Q 5CBAE 2ZJQA 1SYCA 4EQOA 1SXTA 1B7YB 4A3MG 4LF5Q 2ICIA 2JEAI 5E4XA 3EN2A 3FEWX 5JPNC 2R93H 5C4XG 1A3UA 3GTOB 2B2VA 3S1QH 5I9OA 1FNWA 1KIXA 1EYDA 4DUYL 1PTOF 3OHXC 4P72A 4NXNL 1WCMH 3PUWA 1W3SA 4OXPA 1YEZA 1J6QA 4ZLTF 3N52A 1E22A 4AH6A 4EQ5A 4XIGS 1U4MA 4KI0A 2Z6KC 4JI1Q 2EE1A 3STBC 4XDXA 1EOTA 3A7LA 4KHZA 4BY7G 2C35B 4DNTB 4C2MB 4JVZA 4KHPQ 2UXDL 4YY3Q 3VR3A 4ZCKA 5IGEA 1Y1WG 1S72A 3CAMA 4WFN3 1LLRD 5CV7A 2PNRC 4A3IH 1SDFA 3TS0A 2IX0A 1NTGA 2HUGA 5A2QL 3PO2B 3PIO3 4IUPA 3R2IA 2AQ2B 2NZ1D 3J81j 4L5TA 1QILA 5CR3A 1SYGA 4PZ6A 3GTKB 2D62A 1IBMQ 3I72A 1SYEA 1TWFH 1UE1A 4PV1C 3CCVA 1EY6A 4A3EH 4DV2L 4C3HH 5D65A 1RD9D 3MA2B 2F0TA 3VYUA 2TSSA 1BOSA 1F2MA 4B3TL 2A1AA 1F77A 2TMPA 3D6CA 3A5UA 3CCRA 2AUJD 1LO5D 1BCPD 4C3IB 1LTSD 2PMZE 1ET9A 2L4NA 3L3OC 3Q6SA 3SK4A 3HOVH 4IQZA 1W6KA 2EYFA 2YU9B 1VQLA 2A5HA 1HFGA 4V0BA 2L55A 3T56B 4K6DA 1D6EC 1TIID 1EQTA 1PHJA 1EZ6A 3KLRA 3KF6A 3CC2A 2J0TD 2YYZA 1HQMC 2D9UA 2R7ZB 4DAMA 1IL2A 1N32Q 2Z9HA 1JJ2A 3HOZB 5KRUA 1L1OB 4BBRH 1N34Q 1E24A 4XT3B 4ABNA 4G7OC 4DV1L 2F0EA 1XX8A 2RCFA 2RSNA 2XIWA 1PRTF 1SLJA 2D0OA 3H3VI 3M85A 3H3VC 1RTOA 1QUQA 2D5DA 1LT3D 1I4HA 4JK1C 3ZJYC 5IYCH 1JC7A 1JCKB 2ENBA 3CQZH 3GTMH 3D31A 3K6OA 4ODGA 5M5WB 1K8MA 4M8AA
chains in the Genus database with same CATH topology
4GN3B 1GM5A 4DR2Q 4JBWA 1EQRA 1SN8A 3S24A 3CF5A 1XNQQ 2HT1A 3HKZE 3RNUA 4JI7Q 3CXCA 2HQLA 2VS1A 3T1YL 1I6HH 3KJOA 5DLQE 4POGA 4DV5L 3RN2A 1CSQA 3K0XA 1KQSA 4JV5Q 4GKJQ 1FL0A 2Z6KA 1RL2A 1J5EQ 2VUMG 4IJHA 4YHHQ 4BXXH 4LUOA 2RHQB 2K52A 1YJNA 2UUBQ 1N32L 4A3LH 2OWOA 4GNXB 1L1OA 5GAGC 5M3MG 4JI0L 3PF4A 1VS0A 1N34L 1Y1WH 4PG3A 3SGIA 4GOPB 1Y1VH 1VQ8A 3PSIA 4PZ8A 4UPAA 2I0QA 1HJPA 1O7IA 1K8AC 4B3TQ 1NJIC 1YI2A 2JA7H 4JI2Q 4LF8Q 2BA0A 3PUXA 1ASYA 5C3EG 2R7FA 1JB7A 1TWAH 3BZKA 4PMWA 4AIMA 4QQBX 2R7ZG 4LUZA 5AJ3Q 1XPRA 4R4QA 2I5HA 4DUZL 2JE6I 3HOZG 4GLXA 1XPUA 3HOYH 3S14H 2K50A 2NVYH 3ULLA 1I3QH 1EOVA 5LMUL 4DV7Q 1GD7A 4HIOA 2CFMA 1ASZA 3H15A 3CC4A 3F2DA 4R4OA 3RLNA 3GO5A 4WJ3M 1VQ4A 3NEMA 3G4SA 4LW1A 4KLKA 3U4VA 5IY0A 2VZAA 2AWOA 4LUVA 3EBEA 2YTXA 4P73A 3CCSA 2VQFL 1VQ7A 4JI6Q 2BH2A 1PYBA 3CCJA 1Q12A 3GTLH 2IHEA 2A19A 5BR8Q 3GTOH 1IBLQ 3TEHB 4DR2L 4A3FH 5GROA 3PV0A 4HJAA 3CPFA 4JI7L 1YHAA 2WFWA 4X62Q 1EQQA 5JJIA 4LF9Q 4IPCA 4LF7Q 3UE1A 4JI4Q 3OTOQ 3M4QA 1PA6A 4UP8A 2ASBA 2Y0SE 3NENA 4JV5L 2QGQA 1PH8A 1HNWQ 3W1GA 4IFDG 2F52A 2UU9Q 1WCMG 2NN6I 1I5FA 4GN4B 3STBD 4IOCA 1GO3E 4R4IA 3I4NG 2KBNA 2IY5B 4GNXA 3MEFA 1S40A 2UUBL 3FP9A 4AQYQ 1QVFA 3S2DH 3S15H 1JMCA 4GOPA 4LF6Q 1OXSC 3HKSA 3J7ZC 5M3FH 1VQ5A 2GVAA 2B3GA 1V9PA 4JC0A 2MNAA 1VQBA 3TREA 2HHHQ 1PFSA 3ULPA 5IP9G 1IBKQ 1XMQQ 4JI2L 2ZM6Q 4LF8L 2RHSB 4JOIC 1PVOA 2NZHA 1GVPA 4JCVE 4JI8Q 5LMNQ 1YJ9A 3CD6A 4EX5A 2LXKA 4AYBE 2VW9A 4ALPA 4HJ9A 1PH4A 1VQGA 1CKMA 4C2MH 5FLXc 3B6YA 1HR0W 3D0FA 4TVAB 3CCQA 3T1YQ 1L0WA 3H0GG 2JA6G 4A3IG 2ZTCA 4P71A 1AE2A 1TWHH 4B3SQ 3AEVA 3RN5A 2E5LQ 1A63A 3ERSX 3S17H 1WJJA 5BR8L 2YTVA 1IBLL 1MIUA 3PO2H 3CPWA 3RZOH 2WP8J 1SRUA 3K8AA 2ZJRA 2CQOA 4A3CH 3K80C 1VQOA 2V1CC 5C0XG 2B63G 5JJLA 4LF7L 2A8VA 4APVA 4JI4L 2ATWA 3OTOL 2IX1A 3HOUH 4MZ9A 3I7FA 4H02A 1M1KC 2GN5A 4LFCQ 1HNWL 1HNZQ 1D7QA 4HIDA 5J3BA 2UU9L 3G71A 1KD1C 1I94Q 2JK8A 3FKIH 2NVQH 1UE6A 3E9IA 4XTCS 2OQKA 1UE5A 3Q8DA 4A93G 3EIVA 4NPSA 4LF6L 4NXML 3F8TA 3KLWA 2QA4A 2HHHL 4BA2I 1X3GA 3J80i 2R6GA 2EQSA 1XMQL 2WB1G 5IYBH 1IBKL 1Q1EA 5IE8A 2ZM6L 2JEBI 1MJEA 1VQKA 3J80c 1P16A 4LF4L 2UXCL 4JI5Q 5M3MH 1PYSB 4P75A 4JI8L 5FJ8G 4WJ4A 4OONA 3GDEA 3M4PA 5LMNL 1KXLA 3KOJA 3KYHC 2VQFQ 3AFPA 3GD7A 1K0RA 1VQDA 2AWNA 3JC66 3F2BA 1KL9A 3RZDH 1DGSA 2JA5G 1S3OA 4A3KG 2ALYB 3T1HQ 4OWXB 4IPGA 2CKZB 1MJCA 3WWVA 1CUKA 2IHFA 4FDBA 2KHIA 2PQAB 2L15A 4O0AA 5C3EH 2OTLA 3PO3G 4B3SL 2R7ZH 2E5LL 5GAHC 1OTCA 1SFOH 3TQYA 1IYJB 5EAYA 1YNXA 3HOXH 5GQOA 1EYGA 3I4OA 1X3EA 4BY7H 4JI3L 5IYDG 2WAQG 2JA9A 1YITA 5E7NA 1LM0A 3BZCA 2FXQA 1Q8KA 4L5SA 2GVBA 1FGUA 1M90C 4X66Q 4LFCL 1YHQA 1W2BA 3S16H 1HNZL 3PCOB 1Q1BA 1X54A 3I4MG 4JYAQ 4UP9A 1YZ6A 4O2DA 3KJPA 4DV6Q 3KFUA 1I94L 1D8LA 2EXDA 4DPGA 1BVSA 3M9BA 4JBJA 4A3JG 1EFWA 5GAEC 4HJ5A 1T9HA 2R7DA 2MQHA 4R4TA 5C44G 1MKHA 1EIYB 4BBSG 3E0EA 3KDFB 1Y14B 1HZCA 4J15A 1Q82C 1HR0Q 3I4NH 4DK6C 1YHBA 4RG1A 1C9OA 1E1OA 1VQIA 4QGUA 1X6OA 1QZGA 3PIPA 4JI5L 3BJUA 5M5WH 2E2JH 3U50C 1PH2A 2LXJA 4LFAQ 4C3JH 1XJVA 2R93G 3NELA 4R1JA 4A4IA 5IP9H 2IT1A 1VQNA 2CWPA 2R92G 2PI2E 2OTJA 1TXYA 5H1SE 3T1HL 2K5HA 2Z0SA 2PQAA 1AH9A 5IP7G 3HKZG 4JOIA 4JBKA 4UP7A 2D0PA 4A3BG 4BY1H 4BXXG 4A3GH 2XTIA 4GLVB 1UWVA 2E2IH 1KAWA 4A3LG 5HY6A 5ELNA 1CSPA 2YTYA 5IWAQ 4DV0L 4OWWB 2NVXH 1K83H 1XTDA 1Y1VG 4ME3A 3U58A 3H0GH 1U5KA 2JA6H 1H95A 1YVCA 4NXMQ 1VQJA 1N33L 4OO1I 2K75A 3TRZA 1L2FA 1OXXK 2PNHA 1NMFA 1XMOQ 1G51A 1A8VA 2MO1A 4DV3Q 3GTJH 1PH9A 1PH1A 3GTGH 4X66L 3A74A 3G6EA 3M3YH 3W1BA 4A3DG 1E3PA 1VQCA 2N49A 3J81i 1Q86C 2E2HH 4JYAL 4LF4Q 4DV6L 4X64Q 4OX9Q 2UXCQ 1QZHA 4IOAA 3VDYA 3L7ZC 4POFA 3J81c 2HIVA 3L2PA 2VL6A 2CCZA 3PUYA 3HOWG 3K7AH 1X3FA 3KDFA 5M5YH 1HNXL 5FLMG 1SE8A 4HJ8A 2MFIA 3PF5A 1VQ9A 3UDGA 1HR0L 4HJ7A 1N8RC 2E8GA 3RLFA 3UE0A 2JJQA 1G6PA 1E7ZA 1YIJA 2F4VQ 3ER0A 4A93H 4LFAL 1C0AA 4DV4Q 1JJGA 5M5XH 1K73C 3LGJA 1XPOA 1CKOA 1VQAA 4DKAC 1PV4A 4JI3Q 4JBMA 5JEAG 5GADC 1QVCA 2JA8G 2KCMA 3FHWA 3UDFA 3UDXA 4IFDJ 1OXVA 4L5QA 3K7UC 1EWIA 4R4CA 1HZAA 5FJ8H 1X55A 3AFQA 2LSSA 3F1ZA 1JT8A 3HFZB 1BBWA 1VQFA 1EIFA 4MTNA 1SMXA 1PH6A 3S1MH 4GOPC 1QVGA 4A3EG 1V1QA 1Z9FA 4DK3C 5HGQA 2Y0SG 1A0IA 1SR3A 3PUZA 4DAYB 5IWAL 2Q2HA 3CCMA 1R9TH 3AQQA 2Q2UA 4DR7Q 2UUCQ 2UXBQ 4HIKA 3PO3H 2ID0A 1LUZA 2RF4A 4DUYQ 1IZ6A 1XMOL 2NZOA 4PZ7A 2VUMH 3M7NA 4DV3L 4NXNQ 2BA1A 1NY4A 3GTKH 4C3IH 5IYDH 2XGTA 3RR5A 4OX9L 4X64L 4DR6L 3HOVG 1VQ6A 1AE3A 2YU9H 4B3ML 1FJGQ 2K5NA 1Q46A 1CKNB 3M4OH 3S2HH 2DUDA 4AYBG 4IJLA 2BH8A 4A76A 1N36L 1IXRA 3I4MH 1B8AA 1WOCA 4QIWE 3ICEA 1OXTA 2YV5A 2HIXA 4TQUS 3JAMc 2I5MX 3IRBA 2F4VL 2N78A 4YCVA 3I2ZA 4DV4L 1YBYA 4GLAC 5C0XJ 4BBSH 4IO9A 3HOZH 2UXDQ 3MXNB 4BBRG 4DV0Q 3W5OA 2ZJPA 3AYHB 4LFBQ 2ZJQA 3NBHB 1I50H 4OWTB 4LF5Q 4A3MG 1B7YB 4YCUA 1GKHA 3HOUG 3RLOA 1N33Q 2JEAI 3EN2A 2AKWB 2R93H 1B70B 1JE5A 2I5LX 5C4XG 1KHIA 3FKIG 1TWGH 2AHOB 3DM3A 3E9HA 2JQOA 3CCUA 1KC8C 2R92H 3S1QH 3CCLA 4DNIA 2EIFA 1PH3A 4DR7L 5IP7H 1KIXA 2UUCL 1X9NA 5IYBG 4A3BH 1HNXQ 4B3RQ 4DUYL 2VY3A 1YJWA 4Y7NH 5IYCG 4X6AH 3GTQH 2KENA 4P72A 4NXNL 2ES2A 1WCMH 3I55A 1UE7A 4DV2Q 2RCNA 3PUWA 4DR4Q 1WI5A 3CMEA 1W3SA 1VQEA 4OXPA 1NMGA 1YEZA 1J6QA 2Q2IA 1WFQA 1E22A 1RIPA 4AH6A 2H5XA 1CKNA 4QJFA 4XIGS 2KHJA 4EQ5A 1FJGL 4KI0A 3CW2C 4A3DH 3OYYA 2Z6KC 4L5RC 1HZBA 4JI1Q 2QEXA 3STBC 4DR5Q 4DR3Q 1V43A 3HOXG 5ELOA 3U4ZA 3L0OA 4DR1Q 1L1OC 3HOWH 3DLLA 1A62A 4KHZA 4BY7G 2C35B 4GKKQ 5FLMH 4KHPQ 2UXDL 1KRTA 4YY3Q 1VQHA 2NN6G 1Y1WG 1OXUA 3KF8B 3KF6B 3ULJA 1S72A 1XNRL 4LFBL 3CAMA 2DGYA 4LF5L 3UDIA 4A3IH 2JA7G 1SROA 3TS0A 2IX0A 4X65Q 4P74A 3CP0A 1NTGA 2K5VA 4OO1G 3PUVA 4IPDA 4BA1I 1XNQL 3A5ZB 3S1RH 4RMFA 1E1TA 4K0KQ 1Q81C 4IPHA 2AMCB 1G291 4Y52H 1N9WA 2JA8H 4DR6Q 3J81j 3CCEA 2KCTA 4L5TA 4JG2A 3TS2A 2VNUD 4PZ6A 2B63H 4IFDI 4DV1Q 1EUJA 4GKJL 2D62A 1IBMQ 1J5EL 4B3MQ 3HOYG 2N8NA 1TWFH 1UE1A 2PI2A 3K81C 4YHHL 3CCVA 1PH5A 4B3RL 1LTLA 4LNQA 3I56A 1FVIA 2VQEQ 1N36Q 4A3EH 4DV2L 4C3HH 1TWCH 4DR4L 2WB1E 2UUAQ 3S1NH 4B3TL 3H3VH 1QUQB 2A1AA 4A3FG 4YWLA 3A5UA 1BBUA 3CCRA 1JJCB 2K4KA 1VCIA 4GN5A 2NVTH 2PMZE 4JI1L 2OQ0A 1HH2P 4BY1G 4A3GG 5AJ3L 3HOVH 4DR5L 4DR3L 4GNXC 5C4JH 1X65A 4LWCA 4DR1L 4NB3A 5IT9c 1VQLA 1K8GA 4GKKL 3BU2A 4DV7L 2UXBL 4HIMA 2JA5H 4KHPL 4YY3L 4A3KH 1PHJA 3KF6A 3CC7A 1PH7A 5M3FG 4DV5Q 4QY7A 1HZ9A 4YWKA 2WAQE 1VQMA 3CC2A 2YYZA 4X65L 1U0LA 4DAMA 1K9MC 3A0JA 1LYLA 4A75A 1IL2A 3J7A5 1N32Q 2F3IA 1X56A 1JJ2A 4JI0Q 1L1OB 4BBRH 5C0XI 1N34Q 4K0KL 2N3SA 3PGZA 2ZTEA 4X62L 4LF9L 1E24A 1KRSA 4YCWA 3CMAA 4A3MH 4DV1L 1VQPA 4GS3A 2B29A 1IBML 3G48A 2Q2TA 5C4XH 3JAMi 2VQEL 1SLJA 2D0OA 4AQYL 1C7YA 2OCEA 3H3VI 3M85A 1WYDA 1P8LA 3PIOA 2UUAL 4JI6L 4DUZQ 2K14A 4QL5A 3F2CA 4A3JH 3GTPH 1K3RA 5JEAJ 5JJKA 1QUQA 4MNOA 5K36G 5C44H 3PO2G 2MO0A 1NBWA 5LMUQ 2CWAA 1BKBA 3ZJYC 5IYCH 4YWMA 1Q7YC 4A3CG 5LMNW 1XNRQ 3CQZH 4UY8C 1NE3A 3GTMH 3D31A 1UEBA 1Z47A 2ZTDA 3OW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GN3 B;  1GM5 A;  4DR2 Q;  4JBW A;  1EQR A;  1SN8 A;  3S24 A;  3CF5 A;  1XNQ Q;  2HT1 A;  3HKZ E;  3RNU A;  4JI7 Q;  3CXC A;  2HQL A;  2VS1 A;  3T1Y L;  1I6H H;  3KJO A;  5DLQ E;  4POG A;  4DV5 L;  3RN2 A;  1CSQ A;  3K0X A;  1KQS A;  4JV5 Q;  4GKJ Q;  1FL0 A;  2Z6K A;  1RL2 A;  1J5E Q;  2VUM G;  4IJH A;  4YHH Q;  4BXX H;  4LUO A;  2RHQ B;  2K52 A;  1YJN A;  2UUB Q;  1N32 L;  4A3L H;  2OWO A;  4GNX B;  1L1O A;  5GAG C;  5M3M G;  4JI0 L;  3PF4 A;  1VS0 A;  1N34 L;  1Y1W H;  4PG3 A;  3SGI A;  4GOP B;  1Y1V H;  1VQ8 A;  3PSI A;  4PZ8 A;  4UPA A;  2I0Q A;  1HJP A;  1O7I A;  1K8A C;  4B3T Q;  1NJI C;  1YI2 A;  2JA7 H;  4JI2 Q;  4LF8 Q;  2BA0 A;  3PUX A;  1ASY A;  5C3E G;  2R7F A;  1JB7 A;  1TWA H;  3BZK A;  4PMW A;  4AIM A;  4QQB X;  2R7Z G;  4LUZ A;  5AJ3 Q;  1XPR A;  4R4Q A;  2I5H A;  4DUZ L;  2JE6 I;  3HOZ G;  4GLX A;  1XPU A;  3HOY H;  3S14 H;  2K50 A;  2NVY H;  3ULL A;  1I3Q H;  1EOV A;  5LMU L;  4DV7 Q;  1GD7 A;  4HIO A;  2CFM A;  1ASZ A;  3H15 A;  3CC4 A;  3F2D A;  4R4O A;  3RLN A;  3GO5 A;  4WJ3 M;  1VQ4 A;  3NEM A;  3G4S A;  4LW1 A;  4KLK A;  3U4V A;  5IY0 A;  2VZA A;  2AWO A;  4LUV A;  3EBE A;  2YTX A;  4P73 A;  3CCS A;  2VQF L;  1VQ7 A;  4JI6 Q;  2BH2 A;  1PYB A;  3CCJ A;  1Q12 A;  3GTL H;  2IHE A;  2A19 A;  5BR8 Q;  3GTO H;  1IBL Q;  3TEH B;  4DR2 L;  4A3F H;  5GRO A;  3PV0 A;  4HJA A;  3CPF A;  4JI7 L;  1YHA A;  2WFW A;  4X62 Q;  1EQQ A;  5JJI A;  4LF9 Q;  4IPC A;  4LF7 Q;  3UE1 A;  4JI4 Q;  3OTO Q;  3M4Q A;  1PA6 A;  4UP8 A;  2ASB A;  2Y0S E;  3NEN A;  4JV5 L;  2QGQ A;  1PH8 A;  1HNW Q;  3W1G A;  4IFD G;  2F52 A;  2UU9 Q;  1WCM G;  2NN6 I;  1I5F A;  4GN4 B;  3STB D;  4IOC A;  1GO3 E;  4R4I A;  3I4N G;  2KBN A;  2IY5 B;  4GNX A;  3MEF A;  1S40 A;  2UUB L;  3FP9 A;  4AQY Q;  1QVF A;  3S2D H;  3S15 H;  1JMC A;  4GOP A;  4LF6 Q;  1OXS C;  3HKS A;  3J7Z C;  5M3F H;  1VQ5 A;  2GVA A;  2B3G A;  1V9P A;  4JC0 A;  2MNA A;  1VQB A;  3TRE A;  2HHH Q;  1PFS A;  3ULP A;  5IP9 G;  1IBK Q;  1XMQ Q;  4JI2 L;  2ZM6 Q;  4LF8 L;  2RHS B;  4JOI C;  1PVO A;  2NZH A;  1GVP A;  4JCV E;  4JI8 Q;  5LMN Q;  1YJ9 A;  3CD6 A;  4EX5 A;  2LXK A;  4AYB E;  2VW9 A;  4ALP A;  4HJ9 A;  1PH4 A;  1VQG A;  1CKM A;  4C2M H;  5FLX c;  3B6Y A;  1HR0 W;  3D0F A;  4TVA B;  3CCQ A;  3T1Y Q;  1L0W A;  3H0G G;  2JA6 G;  4A3I G;  2ZTC A;  4P71 A;  1AE2 A;  1TWH H;  4B3S Q;  3AEV A;  3RN5 A;  2E5L Q;  1A63 A;  3ERS X;  3S17 H;  1WJJ A;  5BR8 L;  2YTV A;  1IBL L;  1MIU A;  3PO2 H;  3CPW A;  3RZO H;  2WP8 J;  1SRU A;  3K8A A;  2ZJR A;  2CQO A;  4A3C H;  3K80 C;  1VQO A;  2V1C C;  5C0X G;  2B63 G;  5JJL A;  4LF7 L;  2A8V A;  4APV A;  4JI4 L;  2ATW A;  3OTO L;  2IX1 A;  3HOU H;  4MZ9 A;  3I7F A;  4H02 A;  1M1K C;  2GN5 A;  4LFC Q;  1HNW L;  1HNZ Q;  1D7Q A;  4HID A;  5J3B A;  2UU9 L;  3G71 A;  1KD1 C;  1I94 Q;  2JK8 A;  3FKI H;  2NVQ H;  1UE6 A;  3E9I A;  4XTC S;  2OQK A;  1UE5 A;  3Q8D A;  4A93 G;  3EIV A;  4NPS A;  4LF6 L;  4NXM L;  3F8T A;  3KLW A;  2QA4 A;  2HHH L;  4BA2 I;  1X3G A;  3J80 i;  2R6G A;  2EQS A;  1XMQ L;  2WB1 G;  5IYB H;  1IBK L;  1Q1E A;  5IE8 A;  2ZM6 L;  2JEB I;  1MJE A;  1VQK A;  3J80 c;  1P16 A;  4LF4 L;  2UXC L;  4JI5 Q;  5M3M H;  1PYS B;  4P75 A;  4JI8 L;  5FJ8 G;  4WJ4 A;  4OON A;  3GDE A;  3M4P A;  5LMN L;  1KXL A;  3KOJ A;  3KYH C;  2VQF Q;  3AFP A;  3GD7 A;  1K0R A;  1VQD A;  2AWN A;  3JC6 6;  3F2B A;  1KL9 A;  3RZD H;  1DGS A;  2JA5 G;  1S3O A;  4A3K G;  2ALY B;  3T1H Q;  4OWX B;  4IPG A;  2CKZ B;  1MJC A;  3WWV A;  1CUK A;  2IHF A;  4FDB A;  2KHI A;  2PQA B;  2L15 A;  4O0A A;  5C3E H;  2OTL A;  3PO3 G;  4B3S L;  2R7Z H;  2E5L L;  5GAH C;  1OTC A;  1SFO H;  3TQY A;  1IYJ B;  5EAY A;  1YNX A;  3HOX H;  5GQO A;  1EYG A;  3I4O A;  1X3E A;  4BY7 H;  4JI3 L;  5IYD G;  2WAQ G;  2JA9 A;  1YIT A;  5E7N A;  1LM0 A;  3BZC A;  2FXQ A;  1Q8K A;  4L5S A;  2GVB A;  1FGU A;  1M90 C;  4X66 Q;  4LFC L;  1YHQ A;  1W2B A;  3S16 H;  1HNZ L;  3PCO B;  1Q1B A;  1X54 A;  3I4M G;  4JYA Q;  4UP9 A;  1YZ6 A;  4O2D A;  3KJP A;  4DV6 Q;  3KFU A;  1I94 L;  1D8L A;  2EXD A;  4DPG A;  1BVS A;  3M9B A;  4JBJ A;  4A3J G;  1EFW A;  5GAE C;  4HJ5 A;  1T9H A;  2R7D A;  2MQH A;  4R4T A;  5C44 G;  1MKH A;  1EIY B;  4BBS G;  3E0E A;  3KDF B;  1Y14 B;  1HZC A;  4J15 A;  1Q82 C;  1HR0 Q;  3I4N H;  4DK6 C;  1YHB A;  4RG1 A;  1C9O A;  1E1O A;  1VQI A;  4QGU A;  1X6O A;  1QZG A;  3PIP A;  4JI5 L;  3BJU A;  5M5W H;  2E2J H;  3U50 C;  1PH2 A;  2LXJ A;  4LFA Q;  4C3J H;  1XJV A;  2R93 G;  3NEL A;  4R1J A;  4A4I A;  5IP9 H;  2IT1 A;  1VQN A;  2CWP A;  2R92 G;  2PI2 E;  2OTJ A;  1TXY A;  5H1S E;  3T1H L;  2K5H A;  2Z0S A;  2PQA A;  1AH9 A;  5IP7 G;  3HKZ G;  4JOI A;  4JBK A;  4UP7 A;  2D0P A;  4A3B G;  4BY1 H;  4BXX G;  4A3G H;  2XTI A;  4GLV B;  1UWV A;  2E2I H;  1KAW A;  4A3L G;  5HY6 A;  5ELN A;  1CSP A;  2YTY A;  5IWA Q;  4DV0 L;  4OWW B;  2NVX H;  1K83 H;  1XTD A;  1Y1V G;  4ME3 A;  3U58 A;  3H0G H;  1U5K A;  2JA6 H;  1H95 A;  1YVC A;  4NXM Q;  1VQJ A;  1N33 L;  4OO1 I;  2K75 A;  3TRZ A;  1L2F A;  1OXX K;  2PNH A;  1NMF A;  1XMO Q;  1G51 A;  1A8V A;  2MO1 A;  4DV3 Q;  3GTJ H;  1PH9 A;  1PH1 A;  3GTG H;  4X66 L;  3A74 A;  3G6E A;  3M3Y H;  3W1B A;  4A3D G;  1E3P A;  1VQC A;  2N49 A;  3J81 i;  1Q86 C;  2E2H H;  4JYA L;  4LF4 Q;  4DV6 L;  4X64 Q;  4OX9 Q;  2UXC Q;  1QZH A;  4IOA A;  3VDY A;  3L7Z C;  4POF A;  3J81 c;  2HIV A;  3L2P A;  2VL6 A;  2CCZ A;  3PUY A;  3HOW G;  3K7A H;  1X3F A;  3KDF A;  5M5Y H;  1HNX L;  5FLM G;  1SE8 A;  4HJ8 A;  2MFI A;  3PF5 A;  1VQ9 A;  3UDG A;  1HR0 L;  4HJ7 A;  1N8R C;  2E8G A;  3RLF A;  3UE0 A;  2JJQ A;  1G6P A;  1E7Z A;  1YIJ A;  2F4V Q;  3ER0 A;  4A93 H;  4LFA L;  1C0A A;  4DV4 Q;  1JJG A;  5M5X H;  1K73 C;  3LGJ A;  1XPO A;  1CKO A;  1VQA A;  4DKA C;  1PV4 A;  4JI3 Q;  4JBM A;  5JEA G;  5GAD C;  1QVC A;  2JA8 G;  2KCM A;  3FHW A;  3UDF A;  3UDX A;  4IFD J;  1OXV A;  4L5Q A;  3K7U C;  1EWI A;  4R4C A;  1HZA A;  5FJ8 H;  1X55 A;  3AFQ A;  2LSS A;  3F1Z A;  1JT8 A;  3HFZ B;  1BBW A;  1VQF A;  1EIF A;  4MTN A;  1SMX A;  1PH6 A;  3S1M H;  4GOP C;  1QVG A;  4A3E G;  1V1Q A;  1Z9F A;  4DK3 C;  5HGQ A;  2Y0S G;  1A0I A;  1SR3 A;  3PUZ A;  4DAY B;  5IWA L;  2Q2H A;  3CCM A;  1R9T H;  3AQQ A;  2Q2U A;  4DR7 Q;  2UUC Q;  2UXB Q;  4HIK A;  3PO3 H;  2ID0 A;  1LUZ A;  2RF4 A;  4DUY Q;  1IZ6 A;  1XMO L;  2NZO A;  4PZ7 A;  2VUM H;  3M7N A;  4DV3 L;  4NXN Q;  2BA1 A;  1NY4 A;  3GTK H;  4C3I H;  5IYD H;  2XGT A;  3RR5 A;  4OX9 L;  4X64 L;  4DR6 L;  3HOV G;  1VQ6 A;  1AE3 A;  2YU9 H;  4B3M L;  1FJG Q;  2K5N A;  1Q46 A;  1CKN B;  3M4O H;  3S2H H;  2DUD A;  4AYB G;  4IJL A;  2BH8 A;  4A76 A;  1N36 L;  1IXR A;  3I4M H;  1B8A A;  1WOC A;  4QIW E;  3ICE A;  1OXT A;  2YV5 A;  2HIX A;  4TQU S;  3JAM c;  2I5M X;  3IRB A;  2F4V L;  2N78 A;  4YCV A;  3I2Z A;  4DV4 L;  1YBY A;  4GLA C;  5C0X J;  4BBS H;  4IO9 A;  3HOZ H;  2UXD Q;  3MXN B;  4BBR G;  4DV0 Q;  3W5O A;  2ZJP A;  3AYH B;  4LFB Q;  2ZJQ A;  3NBH B;  1I50 H;  4OWT B;  4LF5 Q;  4A3M G;  1B7Y B;  4YCU A;  1GKH A;  3HOU G;  3RLO A;  1N33 Q;  2JEA I;  3EN2 A;  2AKW B;  2R93 H;  1B70 B;  1JE5 A;  2I5L X;  5C4X G;  1KHI A;  3FKI G;  1TWG H;  2AHO B;  3DM3 A;  3E9H A;  2JQO A;  3CCU A;  1KC8 C;  2R92 H;  3S1Q H;  3CCL A;  4DNI A;  2EIF A;  1PH3 A;  4DR7 L;  5IP7 H;  1KIX A;  2UUC L;  1X9N A;  5IYB G;  4A3B H;  1HNX Q;  4B3R Q;  4DUY L;  2VY3 A;  1YJW A;  4Y7N H;  5IYC G;  4X6A H;  3GTQ H;  2KEN A;  4P72 A;  4NXN L;  2ES2 A;  1WCM H;  3I55 A;  1UE7 A;  4DV2 Q;  2RCN A;  3PUW A;  4DR4 Q;  1WI5 A;  3CME A;  1W3S A;  1VQE A;  4OXP A;  1NMG A;  1YEZ A;  1J6Q A;  2Q2I A;  1WFQ A;  1E22 A;  1RIP A;  4AH6 A;  2H5X A;  1CKN A;  4QJF A;  4XIG S;  2KHJ A;  4EQ5 A;  1FJG L;  4KI0 A;  3CW2 C;  4A3D H;  3OYY A;  2Z6K C;  4L5R C;  1HZB A;  4JI1 Q;  2QEX A;  3STB C;  4DR5 Q;  4DR3 Q;  1V43 A;  3HOX G;  5ELO A;  3U4Z A;  3L0O A;  4DR1 Q;  1L1O C;  3HOW H;  3DLL A;  1A62 A;  4KHZ A;  4BY7 G;  2C35 B;  4GKK Q;  5FLM H;  4KHP Q;  2UXD L;  1KRT A;  4YY3 Q;  1VQH A;  2NN6 G;  1Y1W G;  1OXU A;  3KF8 B;  3KF6 B;  3ULJ A;  1S72 A;  1XNR L;  4LFB L;  3CAM A;  2DGY A;  4LF5 L;  3UDI A;  4A3I H;  2JA7 G;  1SRO A;  3TS0 A;  2IX0 A;  4X65 Q;  4P74 A;  3CP0 A;  1NTG A;  2K5V A;  4OO1 G;  3PUV A;  4IPD A;  4BA1 I;  1XNQ L;  3A5Z B;  3S1R H;  4RMF A;  1E1T A;  4K0K Q;  1Q81 C;  4IPH A;  2AMC B;  1G29 1;  4Y52 H;  1N9W A;  2JA8 H;  4DR6 Q;  3J81 j;  3CCE A;  2KCT A;  4L5T A;  4JG2 A;  3TS2 A;  2VNU D;  4PZ6 A;  2B63 H;  4IFD I;  4DV1 Q;  1EUJ A;  4GKJ L;  2D62 A;  1IBM Q;  1J5E L;  4B3M Q;  3HOY G;  2N8N A;  1TWF H;  1UE1 A;  2PI2 A;  3K81 C;  4YHH L;  3CCV A;  1PH5 A;  4B3R L;  1LTL A;  4LNQ A;  3I56 A;  1FVI A;  2VQE Q;  1N36 Q;  4A3E H;  4DV2 L;  4C3H H;  1TWC H;  4DR4 L;  2WB1 E;  2UUA Q;  3S1N H;  4B3T L;  3H3V H;  1QUQ B;  2A1A A;  4A3F G;  4YWL A;  3A5U A;  1BBU A;  3CCR A;  1JJC B;  2K4K A;  1VCI A;  4GN5 A;  2NVT H;  2PMZ E;  4JI1 L;  2OQ0 A;  1HH2 P;  4BY1 G;  4A3G G;  5AJ3 L;  3HOV H;  4DR5 L;  4DR3 L;  4GNX C;  5C4J H;  1X65 A;  4LWC A;  4DR1 L;  4NB3 A;  5IT9 c;  1VQL A;  1K8G A;  4GKK L;  3BU2 A;  4DV7 L;  2UXB L;  4HIM A;  2JA5 H;  4KHP L;  4YY3 L;  4A3K H;  1PHJ A;  3KF6 A;  3CC7 A;  1PH7 A;  5M3F G;  4DV5 Q;  4QY7 A;  1HZ9 A;  4YWK A;  2WAQ E;  1VQM A;  3CC2 A;  2YYZ A;  4X65 L;  1U0L A;  4DAM A;  1K9M C;  3A0J A;  1LYL A;  4A75 A;  1IL2 A;  3J7A 5;  1N32 Q;  2F3I A;  1X56 A;  1JJ2 A;  4JI0 Q;  1L1O B;  4BBR H;  5C0X I;  1N34 Q;  4K0K L;  2N3S A;  3PGZ A;  2ZTE A;  4X62 L;  4LF9 L;  1E24 A;  1KRS A;  4YCW A;  3CMA A;  4A3M H;  4DV1 L;  1VQP A;  4GS3 A;  2B29 A;  1IBM L;  3G48 A;  2Q2T A;  5C4X H;  3JAM i;  2VQE L;  1SLJ A;  2D0O A;  4AQY L;  1C7Y A;  2OCE A;  3H3V I;  3M85 A;  1WYD A;  1P8L A;  3PIO A;  2UUA L;  4JI6 L;  4DUZ Q;  2K14 A;  4QL5 A;  3F2C A;  4A3J H;  3GTP H;  1K3R A;  5JEA J;  5JJK A;  1QUQ A;  4MNO A;  5K36 G;  5C44 H;  3PO2 G;  2MO0 A;  1NBW A;  5LMU Q;  2CWA A;  1BKB A;  3ZJY C;  5IYC H;  4YWM A;  1Q7Y C;  4A3C G;  5LMN W;  1XNR Q;  3CQZ H;  4UY8 C;  1NE3 A;  3GTM H;  3D31 A;  1UEB A;  1Z47 A;  2ZTD A;  3OW2 A; 
#chains in the Genus database with same CATH topology
 4GN3 B;  1SN8 A;  2EYO A;  3S24 A;  2Z4I A;  2VS1 A;  1GXD C;  5DEH A;  4POG A;  4JV5 Q;  1FL0 A;  2VUM G;  1RHP A;  2QDB A;  1EY4 A;  5KNC A;  2RHQ B;  2K52 A;  1YJN A;  3H91 A;  1HHV A;  2UUB Q;  2E2I B;  4A3L H;  4GNX B;  2K5Q A;  4JI0 L;  3PF4 A;  2NN6 H;  4PG3 A;  2NVX B;  3DHQ A;  4PZ8 A;  4UPA A;  2I0Q A;  1O7I A;  3HG9 A;  2E76 C;  5EQ0 A;  5DM7 3;  1YI2 A;  1NJI C;  1KNE A;  2BA0 A;  1PFB A;  3GTG B;  4PQX A;  1ESR A;  1JB7 A;  1TWA H;  3U9O A;  5LHY 1;  1F2Z A;  1MBY A;  1ICW A;  2EDG A;  4ZAI A;  4DUZ L;  3AMU A;  4L8J A;  1XPU A;  3HOY H;  2K50 A;  4P2C B;  3C2P A;  1B1Z A;  1H9R A;  1I3Q H;  1ASZ A;  2UXB Q;  3NXW A;  2F0U A;  3M7G A;  5IY0 A;  2VZA A;  5E3F A;  4CJ2 C;  3CCS A;  3J7A 5;  3CRL C;  2N88 A;  3GTO H;  1PTO B;  3S1N B;  3HS0 C;  2J7Z A;  4DR2 L;  2PCF B;  5GRO A;  4LK1 C;  3BS1 A;  4DNR B;  4HJA A;  5D14 A;  1YHA A;  1DON A;  2WFW A;  4LF9 Q;  1O7L A;  3M4Q A;  3UI2 A;  1PDQ A;  3NEN A;  2QGQ A;  1IW7 C;  2SOB A;  4EQP A;  3RMH A;  3G6J B;  2F52 A;  3I4N G;  1WCM G;  3STB D;  3S1M B;  2PMZ B;  2JA5 B;  1EY5 A;  3S15 H;  1A2U A;  1M4V A;  4GOP A;  1OXS C;  3HKS A;  5L37 A;  1R9T B;  1VQ5 A;  1V9P A;  2X6L A;  4DK0 A;  1XMQ Q;  3JAM E;  1GUW A;  2A6H D;  4F88 A;  2ZM6 Q;  4TRD A;  4JOI C;  2WKC A;  5LMN Q;  2L1B A;  1H9K A;  3Q23 A;  3QOJ A;  4AYB E;  1PH4 A;  4C2M H;  5NUC A;  3B6Y A;  3A54 A;  2F0J A;  3TBI B;  3K57 A;  3QR8 A;  1CT1 D;  1DD2 A;  3H0G G;  4KTA A;  2JA6 G;  4A3I G;  3K5O A;  4P71 A;  1JOK A;  5EKI A;  3T51 B;  3RN5 A;  1A63 A;  3GTP B;  4RKL A;  4A3J B;  5BR8 L;  2PQE A;  2YTV A;  1IBL L;  5C44 B;  3PO2 H;  1SRU A;  3K8A A;  3P1H A;  2V1C C;  4K5X A;  3S9W A;  5ELC A;  4APV A;  5FLX L;  4JI4 L;  1K8O A;  4RWS C;  3I7F A;  1M1K C;  2GN5 A;  1D7Q A;  4C3H G;  1KD1 C;  2PZW A;  1UE5 A;  3Q8D A;  3SE0 A;  1ET6 A;  4A93 G;  4NPS A;  3KLW A;  1PYW D;  3J80 i;  4G4K A;  3K59 A;  1IBK L;  2B2U A;  2WB1 G;  5IYB H;  1Q1E A;  5IE8 A;  3SXH A;  2K03 A;  4J8Q A;  1P16 A;  5CMD A;  4JI8 L;  3M4P A;  4IN3 A;  3KOJ A;  3J7Y W;  1RCV D;  2VQF Q;  1Y1V B;  3I70 A;  3AFP A;  3GD7 A;  1K0R A;  3JC6 6;  1KL9 A;  3I73 A;  1DGS A;  4ZK9 B;  3T13 A;  2LY7 A;  2ALY B;  4IPG A;  1EWH A;  1PLF A;  4FDB A;  2IHF A;  1LT6 D;  2DJF C;  4B3S L;  2R7Z H;  2D2C C;  2E5L L;  3TQY A;  1IYJ B;  5EAY A;  3J80 L;  2XVS A;  3MTS A;  1EYG A;  4ZUI A;  3S14 B;  2JA9 A;  4FP5 D;  5E7N A;  4F87 A;  5EPK A;  2FXQ A;  3ONA B;  2QF7 A;  4E6I A;  4DN4 M;  4L5S A;  1STE A;  1C8C A;  4GZY C;  4LFC L;  4FYD A;  3QWN A;  1U4L A;  3PCO B;  1Q1B A;  5IGD A;  4JYA Q;  2K32 A;  1YZ6 A;  4WJW A;  3KJP A;  1I94 L;  1BVS A;  1ROD A;  3NSW A;  4JBJ A;  4N8X 1;  2JA8 B;  2BDN A;  1Y69 U;  5GAE C;  2RDH A;  1T9H A;  4R4T A;  1MKH A;  4FVM A;  4BBS G;  3FVQ A;  4IFD H;  3BG3 A;  4NKL A;  1HR0 Q;  1YHB A;  1E1O A;  1MD2 D;  4JI5 L;  5EBC A;  5M5W H;  5A35 A;  2Q8T A;  1PH2 A;  4U67 3;  1XJV A;  3DWQ A;  2CVR A;  1B9N A;  1PFN A;  1V1P A;  3NEL A;  4K2K A;  4R1J A;  4TSS A;  1YNN C;  3KBG A;  3LNN A;  2R92 G;  2OTJ A;  1TXY A;  2K5H A;  2QCP X;  1DOM A;  2OEO A;  2NVT B;  4L63 B;  4JBK A;  4RFB A;  4KV6 A;  2XTI A;  1UWV A;  2E2I H;  3E6Z X;  4A3L G;  1BXT A;  4K6L A;  5HY6 A;  5ELN A;  2YTY A;  4KKS A;  3M4Y A;  1EIG A;  2HDL A;  4OWW B;  4DV0 L;  4R8I A;  2NVX H;  4AYB B;  2E75 C;  4OO1 I;  1TWH B;  3AU7 A;  1L2F A;  1OXX K;  2RBM A;  5C3W A;  2MO1 A;  5J1Z A;  4N9T A;  4DV3 Q;  3GTG H;  4X66 L;  3A74 A;  3G6E A;  1VQC A;  2N49 A;  2R3Z A;  4LF4 Q;  2UXC Q;  2DY7 A;  2K5W A;  2FFK B;  2CCZ A;  2B2T A;  3HOW G;  1GUS A;  3HOU B;  3ITP A;  1X3F A;  2OF1 A;  1SE8 A;  4HJ8 A;  2MFI A;  4WRD A;  5F2D A;  1FGB D;  3VYS A;  3FKI B;  4HMJ A;  1IW7 D;  4IUN A;  1YIJ A;  1MHW C;  2G5D A;  2MUY A;  1S5B D;  4DV4 Q;  1RKN A;  5COR A;  5ELE A;  1CKO A;  1F9R A;  5K36 H;  1GUO A;  3V05 A;  3KK7 A;  1QVC A;  2IPK D;  2KCM A;  1OXV A;  3NTK A;  1X55 A;  3AFQ A;  1JT8 A;  3HFZ B;  4IUU A;  2C5C A;  3DEP A;  1SMX A;  1PH6 A;  3S1M H;  4GOP C;  5G3L D;  2PW7 A;  1AEX A;  1SR3 A;  5IWA L;  1CI3 M;  3CCM A;  3IFT A;  1R9T H;  1ENF A;  5J39 A;  4V19 0;  1LUZ A;  2PPB C;  2BDO A;  1IZ6 A;  1XMO L;  2NZO A;  5I4D A;  2VB3 X;  2RA4 A;  1EYA A;  1NY4 A;  2KHS A;  2QIL A;  3RR5 A;  1STN A;  4OX9 L;  3VR2 A;  4HSV A;  1JOO A;  1FJG Q;  2NTS A;  4C1N I;  1Q46 A;  4RH6 A;  1FR3 A;  1IXR A;  1G6Z A;  3H09 A;  1SSO A;  3ICE A;  3A8I E;  2I5M X;  3IRB A;  5CV8 A;  3I2Z A;  4C56 C;  1HTL D;  3VR4 A;  4IO9 A;  2A74 C;  3W5O A;  3PQI A;  2AQ1 B;  1I50 H;  1GKH A;  1WTW A;  3RLO A;  1N33 Q;  1AP0 A;  3LWE A;  1D1I A;  3TN2 A;  4J6H A;  1T5E A;  5E1F A;  2AHO B;  3FMC A;  2JQO A;  2EYH A;  2MP1 A;  4DAY A;  5JAV A;  1G8Z D;  2E74 C;  4DNI A;  1TVX A;  1E2V A;  4F8M A;  4DR7 L;  5IP7 H;  2B2Y C;  1X9N A;  5IYB G;  5C3X A;  4BY1 B;  4A3G B;  2VY3 A;  1YJW A;  4Y7N H;  2EY2 A;  2KEN A;  2ES2 A;  4FNF A;  3I55 A;  4FF3 A;  2O5I C;  2RCN A;  5CBE E;  1WI5 A;  2KCC A;  2QKI C;  1WD1 A;  1WFQ A;  5M3F B;  1OO9 B;  1FYC A;  4QJF A;  4LMQ D;  2KHJ A;  3MZ5 A;  3TZD A;  1DZ1 A;  4DR5 Q;  4DR3 Q;  4HCS A;  4DAP A;  4DR1 Q;  2G9D A;  1L1O C;  1WTP A;  2VXW A;  5FLM H;  3MXN A;  1VQH A;  3NBH A;  3KF6 B;  1IL8 A;  4LFB L;  2NUC A;  5T1G A;  3UDI A;  2JA7 G;  4X65 Q;  4P74 A;  2K5V A;  2M00 A;  2JP1 A;  4BA1 I;  4RMF A;  4FO2 A;  4K0K Q;  2K01 A;  4IPH A;  3EA6 A;  3RZO B;  4ZRZ A;  5JEA H;  2JA8 H;  4DR6 Q;  3TS2 A;  4JG2 A;  1YNN D;  3MXG A;  4NP5 A;  2B63 H;  4IFD I;  4KJN A;  1EUJ A;  3LX0 A;  2BOS A;  1DJR D;  2N8N A;  2PI2 A;  5BN5 A;  4B3R L;  1LTL A;  3RD4 A;  3I56 A;  1FVI A;  3H6M A;  1II3 A;  4CKB A;  3RUZ A;  4DR4 L;  1BDO A;  3H3V H;  1LAC A;  1KDB A;  1QUQ B;  4CBV A;  4A3F G;  5COY A;  4CJ0 B;  1BBU A;  1JJC B;  2K4K A;  1BF4 A;  2NVT H;  1KLU D;  3ND8 A;  4OIJ A;  5M3M B;  1HH2 P;  4KY7 A;  2DN8 A;  4GNX C;  5C4J H;  1LTI D;  1G2S A;  4MHE A;  1K8G A;  4GKK L;  3HEJ A;  3S2H B;  2UXB L;  2JN4 A;  1K3B C;  3KF8 A;  1SE4 A;  1MSH A;  3I8Z A;  1YNJ D;  4QY7 A;  4CDC C;  1PZJ D;  1VQM A;  1KTK A;  1WTO A;  4K5W A;  3A0J A;  1LYL A;  4RGN A;  5M9O A;  2RQX A;  4UDU C;  4LF9 L;  1KRS A;  1QG7 A;  3FPU B;  3DXJ C;  4DU9 A;  5E4W C;  1STA A;  4CDF C;  5IOD A;  4O1N A;  4XXE A;  2VQE L;  3E0J A;  1PTO C;  1WYD A;  1P8L A;  2UUA L;  2F3W A;  2IJ0 A;  3F2C A;  4G57 A;  4XT1 B;  5A2Q E;  4MNO A;  5K36 G;  5LL6 S;  1ZYR C;  2MO0 A;  1L0X B;  2SEB D;  5LMU Q;  2ZT9 C;  4A3C G;  5LMN W;  1EL0 A;  2RVL A;  3SR1 A;  4G7H C;  2ICE C;  1D5X C;  2ZTD A;  3UDG A;  1DYQ A;  1B3A A;  4C3J B;  1GM5 A;  1TS3 A;  4JBW A;  1EQR A;  1XNQ Q;  3RNU A;  4JI7 Q;  3CXC A;  1HA6 A;  2WKD A;  5DLQ E;  4DV5 L;  1CSQ A;  1JOR A;  3T53 B;  1J5E Q;  4ZYS A;  4BXX H;  1GUG A;  2WAC A;  1L0Y B;  1QWY A;  1FNU A;  2A73 B;  2F0I A;  1HFN A;  4GOP B;  1VQ8 A;  4X3T A;  4IUR A;  1ENC A;  4JI2 Q;  1ZEQ X;  2LKV A;  3OWE B;  5IIF A;  1KNA A;  2IX3 A;  3PUX A;  1I4P A;  2R7F A;  5JVG 3;  3C3L A;  5D3D A;  2E2H B;  4RGM A;  4IUT A;  3WOE A;  4AIM A;  1ESF A;  4N8F A;  4R4Q A;  5AJ3 Q;  5I9P A;  1XPR A;  3QOL A;  3K7A B;  2PO4 A;  4EVO A;  5M5Y B;  4DV7 Q;  1GD7 A;  2CFM A;  3H15 A;  4WJ3 M;  1VQ4 A;  1EZ8 A;  1ZXT A;  3G4S A;  4LW1 A;  2A6H C;  1DM0 B;  3U4V A;  5IGG A;  2AWO A;  4P73 A;  4QMG A;  2VQF L;  1KLG D;  1PYB A;  1X32 A;  2H1E A;  5LL6 X;  1VMP A;  4ZKC B;  1HUN A;  5JJI A;  3L9A X;  3UE1 A;  2F0W A;  1A2T A;  2Y0S E;  1XXG A;  1HNW Q;  3SK6 A;  2UU9 Q;  4ID6 A;  4GN4 B;  5JVH 3;  1S40 A;  4H13 C;  4RAU C;  5EGT A;  1DCZ A;  1QVF A;  3NP8 A;  3S2D H;  4A3K B;  1JMC A;  3C1E A;  1E0B A;  4JI6 Q;  3J7Z C;  5M3F H;  2B3G A;  2MNA A;  2HHH Q;  3TRE A;  1PFS A;  1HTP A;  3ULP A;  1SAP A;  5IP9 G;  4H0L C;  4LF8 L;  1EWC A;  1PVO A;  2NZH A;  1GVP A;  1AW7 A;  5KEE A;  4UHV A;  2LXK A;  1PRT C;  4ALP A;  4HJ9 A;  5FLX c;  1HR0 W;  2NB0 A;  1CQF A;  4TVA B;  1XWE A;  3CCQ A;  1B4O A;  2DNC A;  3I4M B;  1G91 A;  1CFM A;  4EQN A;  2ZTC A;  3QIA A;  1SND A;  2DJG C;  4MIU A;  3KBX A;  1PZI D;  2F4I A;  3RZO H;  2ZJR A;  1R4Q B;  4HMI A;  4QF4 A;  3K80 C;  1VQO A;  2B63 G;  4LF7 L;  2A8V A;  2A69 D;  2NTT A;  2K1B A;  3NQI A;  4X3U A;  3OTO L;  1F2L A;  4K5V A;  4MZ9 A;  2L11 A;  1SBB B;  5J3B A;  4ZUJ A;  3ZYY X;  2F0G A;  1UE6 A;  2G9H D;  2OQK A;  4LF6 L;  2XRS D;  1W6J A;  3KLS X;  2QA4 A;  4N9P A;  1AZQ A;  4DF7 A;  4BA2 I;  1WTV A;  1X3G A;  2PZT A;  4A3B B;  2FMM A;  2EZV A;  3D4D A;  1JIC A;  1MJE A;  3J80 c;  5ELD A;  3GTQ B;  4LF4 L;  2UXC L;  5M3M H;  5FJ8 G;  4OON A;  3GV6 A;  3KYH C;  2H4O A;  1RDP D;  5I2X A;  1EY9 A;  1V1P B;  5ISR A;  3F2B A;  1TR5 A;  1S3O A;  1KAA A;  4YIJ A;  5C4H A;  4A3D B;  5C3E H;  1IKL A;  4O0A A;  2L15 A;  2OTL A;  3PO3 G;  4CKC A;  3DWA A;  3HOX H;  3QJY A;  1PTO D;  5CV6 A;  1ICF B;  2WAQ G;  5IYD G;  3NWT A;  1NAP A;  2EYM A;  1ZYR D;  3OW7 A;  3D4W A;  2QEJ C;  2GVB A;  1M90 C;  1O7Y A;  1S5E D;  1YHQ A;  1HNZ L;  4OO1 H;  1X54 A;  1UUP A;  4UP9 A;  1TS2 A;  2JSO A;  4DPG A;  1STG A;  1MI2 A;  3VYR A;  2EXZ A;  1EFW A;  5CC4 A;  4HJ5 A;  2R7D A;  3NE5 B;  1BR9 A;  1T5X D;  2F0N A;  1EIY B;  4OGQ C;  1I4X A;  4J15 A;  4HR7 B;  4RG1 A;  1C9O A;  4Z9C B;  1X6O A;  3PIP A;  2Y0S B;  1TWC B;  3QB3 A;  4LFA Q;  4C3J H;  3P7J A;  2B2V C;  2R93 G;  1CTM A;  4RA8 A;  5KYI A;  4A4I A;  2IT1 A;  2L9H A;  1SNC A;  2PI2 E;  4R9W A;  3T1H L;  1LAB A;  2VB2 X;  5FKA C;  3MC0 B;  2Z0S A;  2PQA A;  4BWG B;  3HKZ G;  3SHL A;  4UP7 A;  4BXX G;  4XQJ A;  2F0L A;  1KAW A;  2A68 D;  3CU7 A;  1CSP A;  1B50 A;  4KD3 A;  1XTD A;  2X6G A;  1U5K A;  2X69 A;  4NXM Q;  1N33 L;  1VQJ A;  3SK5 A;  3ERO A;  1K0S A;  3TRZ A;  1JQY D;  4I7Z C;  2PNH A;  1NMF A;  2EY5 A;  3OSO A;  1G51 A;  3Q0A A;  1PH9 A;  1KDA A;  3W1B A;  3J81 i;  2E2H H;  1EEI D;  4DV6 L;  4X64 Q;  4IOA A;  1ZKO A;  3L7Z C;  4POF A;  3L2P A;  5C0X H;  3J80 E;  2VL6 A;  1UNS A;  3PUY A;  3DUZ A;  1HQR D;  3K7A H;  3MFG A;  4HN7 A;  4A3M B;  3KDF A;  5M5Y H;  3WOF A;  2RDG A;  4HJ7 A;  5C4X B;  2NVQ B;  1G6P A;  3ER0 A;  4RGT A;  5CYU A;  1JJG A;  3T4A C;  4QCL A;  1K73 C;  1VQA A;  2V4D A;  4JBM A;  3J81 L;  3FHW A;  3UDF A;  4IFD J;  4R8N A;  4L5Q A;  3GTK H;  1HZA A;  1VQF A;  1B44 D;  3F2U A;  1EQV A;  4MTN A;  1QVG A;  2F0S A;  3VA5 A;  4A3E G;  1PRT D;  1Z9F A;  4DK3 C;  3PUZ A;  4DAY B;  4DA2 A;  2XRQ D;  5FO8 B;  3HP3 A;  3NTI A;  4X3K A;  2RF4 A;  4DUY Q;  4PZ7 A;  1SFO B;  5I6Y A;  4NXN Q;  4KD4 A;  4QIW B;  3TME A;  4KMU C;  4BY7 B;  3K5N A;  4C3I H;  4LAA A;  1LTA D;  4DR6 L;  2N55 A;  3HOV G;  1Y1W B;  1VQ6 A;  2YU9 H;  1SNQ A;  2K5N A;  3ERQ A;  4RGO S;  3EVQ A;  2DUD A;  1KAB A;  2BH8 A;  4A76 A;  3I4M H;  3DEO A;  3DMU A;  1WOC A;  4FF1 A;  3KUP A;  2I46 A;  2F4V L;  3IFD A;  1YBY A;  4GLA C;  1C4Q A;  1PRT B;  2UXD Q;  3HOZ H;  3MXN B;  4BBR G;  2NVY B;  2ZJP A;  4NMZ A;  3AYH B;  3NBH B;  1CA6 A;  2B39 A;  4YCU A;  2AUK A;  5KGU A;  5C5M A;  4KY6 A;  1PXU A;  2AKW B;  1B70 B;  1JE5 A;  2I5L X;  1KHI A;  3MXP A;  2E2D C;  1KC8 C;  3E9H A;  3A7A B;  2EIF A;  4CDE C;  1JWS D;  1D2B A;  2UUC L;  4A3B H;  1HNX Q;  2XWJ B;  5IYC G;  3GTQ H;  4DV2 Q;  1UE7 A;  4KJO A;  3BVZ A;  3C1F A;  4K14 A;  1HCZ A;  2R61 A;  3VR5 A;  4FXG C;  4Q5V A;  2H5X A;  3NTH A;  4NDX A;  3CW2 C;  4A3D H;  3OYY A;  1HZB A;  1H9J A;  2QEX A;  1X3Q A;  1V43 A;  3HOX G;  5ELO A;  3L0O A;  3DLL A;  1A62 A;  4EGV A;  1H9S A;  2NN6 G;  3KF8 B;  2MGS A;  3ULJ A;  4ILW A;  1C48 A;  1JWU D;  4I65 A;  2DGY A;  4LF5 L;  2KEE A;  1SRO A;  2KCN A;  4KKU A;  1NR4 A;  4OO1 G;  1XNQ L;  3A5Z B;  3IKJ A;  1E1T A;  2O4X A;  1QE6 A;  2AMC B;  1G29 1;  1N9W A;  1BBX C;  3CCE A;  2KCT A;  3OPO A;  4B9W A;  4DV1 Q;  3AB9 A;  2EVB A;  1J5E L;  3HOY G;  1LTT D;  3K81 C;  5IGC A;  1YNJ C;  1DOL A;  5CV4 A;  4LNQ A;  3QG1 A;  5FO9 B;  2EJG C;  1TWC H;  2B8F A;  3MEH A;  1TKW B;  2WB1 E;  4BS9 A;  3S1N H;  1PTO H;  1CQV A;  2VUM B;  2M2L A;  1V8Q A;  4JI1 L;  2OQ0 A;  1D1K A;  5AJ3 L;  3OMC A;  1X65 A;  1UAP A;  4LWC A;  3M4O B;  1SYB A;  3BU2 A;  4DV7 L;  3RZD B;  1IYU A;  4HIM A;  2JA5 H;  4KHP L;  4YY3 L;  1TY2 A;  2FIN B;  1HZ9 A;  1CHP D;  4YWK A;  5IGF A;  1K9M C;  1U0L A;  4A75 A;  2F3I A;  4JI0 Q;  5C0X I;  3PGZ A;  4YCW A;  3BYT B;  5IT9 L;  4HAE A;  4A3M H;  4GS3 A;  4K8J A;  1IBM L;  3G48 A;  2Q2T A;  3WDN A;  4DXG A;  5C4X H;  2SNM A;  2NWG A;  3S16 B;  1EEF D;  1WTX A;  5DM6 3;  2OCE A;  4JI6 L;  4DUZ Q;  3GTP H;  4A3J H;  5JEA J;  5C44 H;  3PO2 G;  1NBW A;  1BKB A;  1Q7Y C;  4YWM A;  5C4Z A;  3I4N B;  1WCM B;  1XNR Q;  1NE3 A;  4JW0 A;  1UEB A;  5TSS A;  1STH A;  4DR2 Q;  2WIN B;  3LWU A;  1JWM D;  3J7A F;  4DK1 A;  3KJO A;  4IZ8 A;  3RN2 A;  3K0X A;  2B2U C;  1KQS A;  1CHQ D;  4GKJ Q;  2Z6K A;  4YHH Q;  1NR2 A;  2XSC A;  4C3I G;  2C9O A;  3V96 A;  1N32 L;  2OWO A;  5GAG C;  1VS0 A;  1N34 L;  1Y1W H;  1K83 B;  1Y1V H;  3PSI A;  3H0G B;  4KY5 A;  2JA6 B;  2IW3 A;  4A3I B;  4HED A;  3W3A A;  1A6X A;  1ASY A;  3M3Y B;  2JYO A;  4K2L A;  1J9O A;  2Z1C A;  4QQB X;  2R7Z G;  4LUZ A;  1QCB D;  3BDL A;  3S14 H;  3HOZ G;  1TWF B;  2NVY H;  3ULL A;  1EOV A;  1Q90 A;  3CC4 A;  4HIO A;  4R4O A;  4C3H B;  2F3V A;  2BH2 A;  1VQ7 A;  2YTX A;  1QB5 D;  1Q12 A;  3D6W A;  2IHE A;  5BR8 Q;  4A93 B;  1IBL Q;  5CV5 A;  3TEH B;  4DAV A;  5M5X B;  2K28 A;  1ONL A;  3PV0 A;  2WB1 B;  4X62 Q;  4IPC A;  4JI4 Q;  3GQB A;  4UP8 A;  2ASB A;  4JV5 L;  4IFD G;  2IY5 B;  1I5F A;  1E2W A;  4IOC A;  4R4I A;  3MEF A;  2UUB L;  3FP9 A;  4AQY Q;  3N6R A;  3EQL C;  2GVA A;  4JC0 A;  1VQB A;  1HXY D;  2CH4 A;  3URY A;  1IBK Q;  3O13 A;  2A69 C;  2RHS B;  4JCV E;  4JI8 Q;  2HCI A;  1YJ9 A;  1MSG A;  3CD6 A;  4EX5 A;  2LS0 1;  2XWB B;  3BZD B;  4O42 A;  3T1Y Q;  1L0W A;  5EKL A;  3TP7 A;  1TWH H;  4B3S Q;  3AEV A;  2E5L Q;  2Z8L A;  3ERS X;  1WJJ A;  4DFA A;  1MIU A;  1NCV A;  2WP8 J;  1WVL A;  4BBS B;  2CQO A;  1BCP F;  3SDZ A;  2B2T C;  1SMY D;  4RCO A;  4C1N K;  5JJL A;  2ZXP A;  2IX1 A;  3HOU H;  3HRZ C;  1EFI D;  2F0O A;  1V1O A;  2LFN A;  1HPC A;  4H02 A;  4LFC Q;  1GUT A;  3PIP 3;  4J1M A;  1I94 Q;  3FKI H;  1TWG B;  3E9I A;  4XTC S;  2R92 B;  4NXM L;  3F8T A;  1WTQ A;  1GHK A;  2R6G A;  2L12 A;  1DXM A;  2EQS A;  1XMQ L;  2ZM6 L;  2JEB I;  2MJ8 A;  4LJZ C;  3QO2 A;  2KUM A;  1GJX A;  4JI5 Q;  4P75 A;  2NYZ D;  3GDE A;  5LMN L;  3SVM A;  1SJH D;  1U4R A;  1VQD A;  1S5F D;  3RZD H;  2JA5 G;  2DY8 A;  1SNO A;  1CZW A;  2CKZ B;  4CJ1 B;  1CUK A;  1TWA B;  2PQA B;  5I6W A;  1OTC A;  1YNX A;  3CRK C;  3I4O A;  1MGS A;  3HOW B;  1X3E A;  1I3Q B;  1WD0 A;  1YIT A;  2KQ3 A;  3BZC A;  1Y8P B;  1Q8K A;  5K5P A;  3DM1 A;  2DNE A;  1H9M A;  2K04 A;  4X66 Q;  1W2B A;  3S16 H;  5JOB A;  4O2D A;  5EPL A;  3S1R B;  1D8L A;  3M9B A;  2A68 C;  3NUC A;  4A3J G;  5C44 G;  1F2Y A;  3KDF B;  3VR6 A;  1QNK A;  1Y14 B;  1Q82 C;  2XNA C;  3I4N H;  1WTH A;  3FPP A;  4DK6 C;  1O78 A;  1AFP A;  1VF7 A;  5EJW A;  1BQQ T;  5FOB B;  5I2Y A;  4QGU A;  4RCN A;  1Q8I A;  3BJU A;  3ND9 A;  1QOH A;  3S15 B;  3U50 C;  3FRP B;  2EPB A;  2KVM A;  1TY0 A;  1VQN A;  3TP6 A;  1F9S A;  5H1S E;  3EJI A;  1PFM A;  1AH9 A;  5IP7 G;  4JOI A;  4BY1 H;  4A3G H;  2HD3 A;  2PYK A;  2F0D A;  4B08 A;  1F9P A;  3R93 A;  2KOL A;  3MVV A;  5IWA Q;  4HSP A;  1K83 H;  1Y1V G;  1FD7 D;  3H0G H;  2JA6 H;  1YVC A;  1XMO Q;  1A8V A;  4L6T B;  1PH1 A;  5HGT A;  1CA5 A;  3M3Y H;  1STB A;  1Q86 C;  4JYA L;  4OX9 Q;  1QZH A;  1BNZ A;  3J81 c;  2HIV A;  2IWH A;  1R4P B;  1HNX L;  1A3V A;  5FLM G;  2F1M A;  3PF5 A;  4XYQ A;  3I3C A;  1I6V C;  3Q22 A;  1HR0 L;  4TKO B;  1N8R C;  1RTN A;  4MN3 A;  2E8G A;  2JJQ A;  1E7Z A;  4A93 H;  1C0A A;  5M5X H;  3LGJ A;  4FF4 A;  5BN4 A;  4JI3 Q;  1G2T A;  5JEA G;  5GAD C;  2JA8 G;  4H44 C;  1HUM A;  2QW7 A;  3K7U C;  1CZG A;  4Q0F A;  5KND A;  2F0K A;  3F1Z A;  2LSS A;  3HZX A;  2CW0 D;  3NBI A;  3K5M A;  1SNP A;  2RSO A;  1EIF A;  1V1Q A;  2Q2H A;  1X3P A;  3AQQ A;  1ENA A;  4DR7 Q;  2L5T A;  1I6H B;  4OEM B;  3BVG A;  5EBD A;  3TSS A;  3M7N A;  4DV3 L;  2BA1 A;  1IYV A;  2M9V A;  2XGT A;  1LT4 D;  2KED A;  4RHR A;  1LV9 A;  1AE3 A;  2JA7 B;  2GA4 B;  3S2H H;  4AYB G;  5J22 A;  1BCP B;  3X3N A;  4HTH A;  5JJZ A;  2ZXO A;  1I4G A;  3CKI B;  4QIW E;  2HIX A;  3JAM c;  2N78 A;  1Q3L A;  4YCV A;  4DV4 L;  1B2T A;  2JXM B;  5C0X J;  4BBS H;  1QNU A;  1NNX A;  2BE5 C;  1H9S B;  4LFB Q;  4OWT B;  3MWY W;  2A6E C;  3HOU G;  3OIQ A;  1CM9 A;  3GTL B;  1B3Q A;  2IL8 A;  4KN7 C;  3FKI G;  5AFW A;  4OEL B;  1TWG H;  3DM3 A;  3CCU A;  4A3F B;  2R92 H;  3CCL A;  2K05 A;  1SE2 A;  4FXK C;  4KN4 C;  1PH3 A;  2I07 B;  3MHB A;  3TP5 A;  2FMC A;  4PNY A;  3J81 E;  4B3R Q;  4X6A H;  5FLX E;  4DR4 Q;  3CME A;  4OIK A;  1VQE A;  1D5M C;  1NMG A;  2Q2I A;  1B53 A;  4OL7 A;  1EY0 A;  1RIP A;  3MXU A;  1FJG L;  1CKN A;  2Z6B A;  1GHJ A;  2LMC B;  1RF2 D;  1IKM A;  4NW2 A;  4L5R C;  1TS5 A;  3U4Z A;  3HOW H;  4GKK Q;  1ML0 D;  1KRT A;  1M8A A;  1OXU A;  1HA5 A;  1D5Z C;  2EJF C;  2RDF A;  1XNR L;  1UEA B;  4B9X A;  3MAQ A;  4IUV A;  3CP0 A;  3PUV A;  4IPD A;  3S17 B;  3S1R H;  3E5S A;  3DWP A;  1Q81 C;  2O5J C;  4Y52 H;  1A15 A;  2VNU D;  4MTK A;  2CHB D;  4GKJ L;  4B3M Q;  5IOC A;  4IAL A;  4YHH L;  1PH5 A;  2VQE Q;  1N36 Q;  3G7L A;  4KK7 A;  3SK8 A;  2UUA Q;  4X3S A;  2F0H A;  4H7B A;  4YWL A;  1RJT A;  1TU2 B;  1AN8 A;  3TZU A;  1VCI A;  2MPM A;  4GN5 A;  4PMB A;  1QJO A;  4BY1 G;  4A3G G;  4DR5 L;  4DR3 L;  5EKK A;  4DR1 L;  4NB3 A;  5IT9 c;  1JR0 D;  4HCE A;  2K5D A;  4A3K H;  3CC7 A;  1PH7 A;  5M3F G;  4DV5 Q;  1JB3 A;  3U9S A;  2WAQ E;  2PZU A;  3BYY B;  4X65 L;  1B9M A;  3OWF A;  1X56 A;  4K0K L;  2N3S A;  2ZTE A;  4X62 L;  1I50 B;  3CMA A;  3FDT A;  3A8J E;  1SNM A;  1VQP A;  2B29 A;  3BVM A;  5G3L F;  3JAM i;  1A3T A;  4AQY L;  1C7Y A;  4G7Z C;  3PIO A;  5JJK A;  2K14 A;  3MFY A;  4QL5 A;  1K3R A;  5DAU A;  3TP8 A;  3OMG A;  2B2Y A;  2CWA A;  2CH4 W;  5KIX A;  3X3M A;  4Y7N B;  3A55 A;  3Q24 A;  2XN9 C;  4UY8 C;  2EJM A;  5BN3 A;  1Z47 A;  2E2J B;  3OW2 A;  4S3S A;  2HT1 A;  2Q8R E;  3CF5 A;  3HKZ E;  5EPJ A;  2HQL A;  3JAM L;  3K5L A;  3T1Y L;  1I6H H;  5HUR A;  4U68 A;  3R2T A;  1RL2 A;  2Q8I B;  1GOZ A;  4IJH A;  4XQN A;  4LUO A;  1GUN A;  3IL8 A;  4ZQ3 A;  2KEC A;  1L1O A;  5M3M G;  3VA7 A;  3P20 A;  2HDM A;  1VMC A;  3SGI A;  4CKE A;  4QB4 A;  4B3T Q;  1HJP A;  1K8A C;  2BE5 D;  2JA7 H;  1U9R A;  4LF8 Q;  2A6E D;  3TDQ A;  3GTJ B;  5C3E G;  1EU4 A;  4RHS A;  3BZK A;  1SE3 A;  4PMW A;  2B63 B;  2I5H A;  1FNV A;  2JE6 I;  2SDF A;  4GLX A;  1NUC A;  2MHV A;  4DGZ A;  5LMU L;  2ZXR A;  3F2D A;  3RLN A;  3GO5 A;  5IT9 E;  3I4L A;  1EU3 A;  1SJE D;  3NEM A;  4KLK A;  5FO7 B;  4LUV A;  3EBE A;  3NHH A;  1KDC A;  3CCJ A;  3GTL H;  2A19 A;  1SEB D;  4A3F H;  1IHZ A;  3CPF A;  4JI7 L;  2EY1 A;  1EQQ A;  4LF7 Q;  1E2Z A;  3OTO Q;  1PA6 A;  2F0Q A;  4KHV A;  1PH8 A;  3W1G A;  1EIH A;  2AQ3 B;  5C4J B;  1LTR D;  2NN6 I;  2OT2 A;  3IAY A;  1GO3 E;  2KBN A;  4GNX A;  3D4R A;  1S5D D;  3R3O A;  1XYI A;  5KNB A;  3EFX D;  1LTB D;  3VYT A;  4C3J G;  4LF6 Q;  3H94 A;  2P5Z X;  1TQO A;  1EYC A;  1SMY C;  4JI2 L;  3GP7 A;  3PO3 B;  2Z4H A;  3BDO A;  1Y8O B;  2WAQ B;  4ME5 A;  1LT5 D;  2VW9 A;  1VQG A;  1CKM A;  3D0F A;  2KJX A;  1Z7T A;  2F0M A;  1I4Q A;  2B2W A;  1AE2 A;  3D3R A;  2K6A A;  3S17 H;  1K28 A;  3PMF A;  3CPW A;  1CK1 A;  4A3C H;  1DOK A;  4IUQ A;  3C46 A;  5C0X G;  2ATW A;  4UAI A;  1HNW L;  1HNZ Q;  4HID A;  2R93 B;  1STY A;  2O2L D;  1XTC D;  2UU9 L;  3G71 A;  4ZKB B;  2JK8 A;  2NVQ H;  3S1Q B;  5C5L A;  3V2T A;  2HCC A;  3EIV A;  5FK9 C;  3K58 A;  2HHH L;  3HKZ B;  5IGB A;  2RKS A;  1VQK A;  4WJ4 A;  1PYS B;  3KLS A;  1KXL A;  4ULL A;  4RKB A;  2K33 A;  4CGY B;  2AWN A;  3P75 A;  4A3K G;  1SYF A;  3A56 A;  3T1H Q;  1ILQ A;  1EY8 A;  3NQT A;  4OWX B;  4FF2 A;  3WWV A;  1EY7 A;  1MJC A;  2KHI A;  5JPM C;  2EY6 A;  5GAH C;  1SFO H;  5GQO A;  4BY7 H;  4JI3 L;  5T1I A;  1LM0 A;  3R8B A;  3NK9 A;  3SEB A;  1O7Z A;  2F03 A;  2EOT A;  3T16 A;  3OOC A;  1FGU A;  2PW5 A;  4OHJ A;  1BUV T;  3I4M G;  4I7A A;  2F0V A;  4DV6 Q;  3OIP A;  3KFU A;  3A8K E;  1O80 A;  2EXD A;  5C6A A;  2MQH A;  3E0E A;  1J8I A;  3BDC A;  1HZC A;  1HRJ A;  4K8I A;  1VQI A;  1QZG A;  4A3E B;  3S2D B;  2E2J H;  2LXJ A;  2QDL A;  1S4Z A;  5IP9 H;  2CWP A;  4KKT A;  4CHT B;  4QUF A;  3I90 A;  3HGB A;  5DNF A;  2D0P A;  4A3B G;  4FXD A;  3HOV B;  4GLV B;  1WTR A;  2F0P A;  3I91 A;  4ME3 A;  3U58 A;  2K7V A;  1PZK D;  1H95 A;  2K75 A;  1BCP C;  1S5C D;  3K0Y A;  1TS4 A;  3GTJ H;  1I4R A;  5ELF A;  4A3D G;  1E3P A;  2CW0 C;  4BBR B;  3VDY A;  5D3I B;  5CGK A;  2L0C A;  1JE4 A;  4PMC A;  4DXF A;  3E3X A;  1SYD A;  1U4P A;  1VQ9 A;  3RLF A;  2WII B;  1LTG D;  3UE0 A;  3D8G A;  2F4V Q;  3CHB D;  4LFA L;  3NPP A;  1VDZ A;  4F7X A;  4M1U B;  1XPO A;  1Z6H A;  4DKA C;  1PV4 A;  2WV6 D;  3UDX A;  2BCO A;  3CQZ B;  5FJ8 H;  1EWI A;  1Y8N B;  2FJ2 A;  4R4C A;  3GTM B;  4WOR A;  1BBW A;  2EYP A;  1ILP A;  2CQA A;  2OXP A;  5HGQ A;  2Y0S G;  1A0I A;  5C3E B;  2Q2U A;  3NWS A;  2F0F A;  2UUC Q;  4CDD C;  4HIK A;  1AZP A;  3PO3 H;  2ID0 A;  5CV9 A;  3W2D A;  2VUM H;  3HOX B;  5KYL A;  5IYD H;  4QUC A;  4X64 L;  2SNS A;  3GV3 A;  2EYL A;  4B3M L;  4XQQ A;  3M4O H;  1CKN B;  1PMR A;  1TT2 A;  2B2W C;  4IJL A;  1N36 L;  3J7A V;  4XYO A;  5ELB A;  1B8A A;  2EYJ A;  4JPB W;  1VF5 C;  1OXT A;  2YV5 A;  4TQU S;  2KA7 A;  2NBF A;  1JOQ A;  1BO0 A;  2FHT A;  2HQE A;  1F9Q A;  2J4X A;  1NSN S;  3HOY B;  2B8G A;  4DV0 Q;  5CBA E;  2ZJQ A;  1SYC A;  4EQO A;  1SXT A;  1B7Y B;  4A3M G;  4LF5 Q;  2ICI A;  2JEA I;  5E4X A;  3EN2 A;  3FEW X;  5JPN C;  2R93 H;  5C4X G;  1A3U A;  3GTO B;  2B2V A;  3S1Q H;  5I9O A;  1FNW A;  1KIX A;  1EYD A;  4DUY L;  1PTO F;  3OHX C;  4P72 A;  4NXN L;  1WCM H;  3PUW A;  1W3S A;  4OXP A;  1YEZ A;  1J6Q A;  4ZLT F;  3N52 A;  1E22 A;  4AH6 A;  4EQ5 A;  4XIG S;  1U4M A;  4KI0 A;  2Z6K C;  4JI1 Q;  2EE1 A;  3STB C;  4XDX A;  1EOT A;  3A7L A;  4KHZ A;  4BY7 G;  2C35 B;  4DNT B;  4C2M B;  4JVZ A;  4KHP Q;  2UXD L;  4YY3 Q;  3VR3 A;  4ZCK A;  5IGE A;  1Y1W G;  1S72 A;  3CAM A;  4WFN 3;  1LLR D;  5CV7 A;  2PNR C;  4A3I H;  1SDF A;  3TS0 A;  2IX0 A;  1NTG A;  2HUG A;  5A2Q L;  3PO2 B;  3PIO 3;  4IUP A;  3R2I A;  2AQ2 B;  2NZ1 D;  3J81 j;  4L5T A;  1QIL A;  5CR3 A;  1SYG A;  4PZ6 A;  3GTK B;  2D62 A;  1IBM Q;  3I72 A;  1SYE A;  1TWF H;  1UE1 A;  4PV1 C;  3CCV A;  1EY6 A;  4A3E H;  4DV2 L;  4C3H H;  5D65 A;  1RD9 D;  3MA2 B;  2F0T A;  3VYU A;  2TSS A;  1BOS A;  1F2M A;  4B3T L;  2A1A A;  1F77 A;  2TMP A;  3D6C A;  3A5U A;  3CCR A;  2AUJ D;  1LO5 D;  1BCP D;  4C3I B;  1LTS D;  2PMZ E;  1ET9 A;  2L4N A;  3L3O C;  3Q6S A;  3SK4 A;  3HOV H;  4IQZ A;  1W6K A;  2EYF A;  2YU9 B;  1VQL A;  2A5H A;  1HFG A;  4V0B A;  2L55 A;  3T56 B;  4K6D A;  1D6E C;  1TII D;  1EQT A;  1PHJ A;  1EZ6 A;  3KLR A;  3KF6 A;  3CC2 A;  2J0T D;  2YYZ A;  1HQM C;  2D9U A;  2R7Z B;  4DAM A;  1IL2 A;  1N32 Q;  2Z9H A;  1JJ2 A;  3HOZ B;  5KRU A;  1L1O B;  4BBR H;  1N34 Q;  1E24 A;  4XT3 B;  4ABN A;  4G7O C;  4DV1 L;  2F0E A;  1XX8 A;  2RCF A;  2RSN A;  2XIW A;  1PRT F;  1SLJ A;  2D0O A;  3H3V I;  3M85 A;  3H3V C;  1RTO A;  1QUQ A;  2D5D A;  1LT3 D;  1I4H A;  4JK1 C;  3ZJY C;  5IYC H;  1JC7 A;  1JCK B;  2ENB A;  3CQZ H;  3GTM H;  3D31 A;  3K6O A;  4ODG A;  5M5W B;  1K8M A;  4M8A A; 
#chains in the Genus database with same CATH homology
 4GN3 B;  1GM5 A;  4DR2 Q;  4JBW A;  1EQR A;  1SN8 A;  3S24 A;  3CF5 A;  1XNQ Q;  2HT1 A;  3HKZ E;  3RNU A;  4JI7 Q;  3CXC A;  2HQL A;  2VS1 A;  3T1Y L;  1I6H H;  3KJO A;  5DLQ E;  4POG A;  4DV5 L;  3RN2 A;  1CSQ A;  3K0X A;  1KQS A;  4JV5 Q;  4GKJ Q;  1FL0 A;  2Z6K A;  1RL2 A;  1J5E Q;  2VUM G;  4IJH A;  4YHH Q;  4BXX H;  4LUO A;  2RHQ B;  2K52 A;  1YJN A;  2UUB Q;  1N32 L;  4A3L H;  2OWO A;  4GNX B;  1L1O A;  5GAG C;  5M3M G;  4JI0 L;  3PF4 A;  1VS0 A;  1N34 L;  1Y1W H;  4PG3 A;  3SGI A;  4GOP B;  1Y1V H;  1VQ8 A;  3PSI A;  4PZ8 A;  4UPA A;  2I0Q A;  1HJP A;  1O7I A;  1K8A C;  4B3T Q;  1NJI C;  1YI2 A;  2JA7 H;  4JI2 Q;  4LF8 Q;  2BA0 A;  3PUX A;  1ASY A;  5C3E G;  2R7F A;  1JB7 A;  1TWA H;  3BZK A;  4PMW A;  4AIM A;  4QQB X;  2R7Z G;  4LUZ A;  5AJ3 Q;  1XPR A;  4R4Q A;  2I5H A;  4DUZ L;  2JE6 I;  3HOZ G;  4GLX A;  1XPU A;  3HOY H;  3S14 H;  2K50 A;  2NVY H;  3ULL A;  1I3Q H;  1EOV A;  5LMU L;  4DV7 Q;  1GD7 A;  4HIO A;  2CFM A;  1ASZ A;  3H15 A;  3CC4 A;  3F2D A;  4R4O A;  3RLN A;  3GO5 A;  4WJ3 M;  1VQ4 A;  3NEM A;  3G4S A;  4LW1 A;  4KLK A;  3U4V A;  5IY0 A;  2VZA A;  2AWO A;  4LUV A;  3EBE A;  2YTX A;  4P73 A;  3CCS A;  2VQF L;  1VQ7 A;  4JI6 Q;  2BH2 A;  1PYB A;  3CCJ A;  1Q12 A;  3GTL H;  2IHE A;  2A19 A;  5BR8 Q;  3GTO H;  1IBL Q;  3TEH B;  4DR2 L;  4A3F H;  5GRO A;  3PV0 A;  4HJA A;  3CPF A;  4JI7 L;  1YHA A;  2WFW A;  4X62 Q;  1EQQ A;  5JJI A;  4LF9 Q;  4IPC A;  4LF7 Q;  3UE1 A;  4JI4 Q;  3OTO Q;  3M4Q A;  1PA6 A;  4UP8 A;  2ASB A;  2Y0S E;  3NEN A;  4JV5 L;  2QGQ A;  1PH8 A;  1HNW Q;  3W1G A;  4IFD G;  2F52 A;  2UU9 Q;  1WCM G;  2NN6 I;  1I5F A;  4GN4 B;  3STB D;  4IOC A;  1GO3 E;  4R4I A;  3I4N G;  2KBN A;  2IY5 B;  4GNX A;  3MEF A;  1S40 A;  2UUB L;  3FP9 A;  4AQY Q;  1QVF A;  3S2D H;  3S15 H;  1JMC A;  4GOP A;  4LF6 Q;  1OXS C;  3HKS A;  3J7Z C;  5M3F H;  1VQ5 A;  2GVA A;  2B3G A;  1V9P A;  4JC0 A;  2MNA A;  1VQB A;  3TRE A;  2HHH Q;  1PFS A;  3ULP A;  5IP9 G;  1IBK Q;  1XMQ Q;  4JI2 L;  2ZM6 Q;  4LF8 L;  2RHS B;  4JOI C;  1PVO A;  2NZH A;  1GVP A;  4JCV E;  4JI8 Q;  5LMN Q;  1YJ9 A;  3CD6 A;  4EX5 A;  2LXK A;  4AYB E;  2VW9 A;  4ALP A;  4HJ9 A;  1PH4 A;  1VQG A;  1CKM A;  4C2M H;  5FLX c;  3B6Y A;  1HR0 W;  3D0F A;  4TVA B;  3CCQ A;  3T1Y Q;  1L0W A;  3H0G G;  2JA6 G;  4A3I G;  2ZTC A;  4P71 A;  1AE2 A;  1TWH H;  4B3S Q;  3AEV A;  3RN5 A;  2E5L Q;  1A63 A;  3ERS X;  3S17 H;  1WJJ A;  5BR8 L;  2YTV A;  1IBL L;  1MIU A;  3PO2 H;  3CPW A;  3RZO H;  2WP8 J;  1SRU A;  3K8A A;  2ZJR A;  2CQO A;  4A3C H;  3K80 C;  1VQO A;  2V1C C;  5C0X G;  2B63 G;  5JJL A;  4LF7 L;  2A8V A;  4APV A;  4JI4 L;  2ATW A;  3OTO L;  2IX1 A;  3HOU H;  4MZ9 A;  3I7F A;  4H02 A;  1M1K C;  2GN5 A;  4LFC Q;  1HNW L;  1HNZ Q;  1D7Q A;  4HID A;  5J3B A;  2UU9 L;  3G71 A;  1KD1 C;  1I94 Q;  2JK8 A;  3FKI H;  2NVQ H;  1UE6 A;  3E9I A;  4XTC S;  2OQK A;  1UE5 A;  3Q8D A;  4A93 G;  3EIV A;  4NPS A;  4LF6 L;  4NXM L;  3F8T A;  3KLW A;  2QA4 A;  2HHH L;  4BA2 I;  1X3G A;  3J80 i;  2R6G A;  2EQS A;  1XMQ L;  2WB1 G;  5IYB H;  1IBK L;  1Q1E A;  5IE8 A;  2ZM6 L;  2JEB I;  1MJE A;  1VQK A;  3J80 c;  1P16 A;  4LF4 L;  2UXC L;  4JI5 Q;  5M3M H;  1PYS B;  4P75 A;  4JI8 L;  5FJ8 G;  4WJ4 A;  4OON A;  3GDE A;  3M4P A;  5LMN L;  1KXL A;  3KOJ A;  3KYH C;  2VQF Q;  3AFP A;  3GD7 A;  1K0R A;  1VQD A;  2AWN A;  3JC6 6;  3F2B A;  1KL9 A;  3RZD H;  1DGS A;  2JA5 G;  1S3O A;  4A3K G;  2ALY B;  3T1H Q;  4OWX B;  4IPG A;  2CKZ B;  1MJC A;  3WWV A;  1CUK A;  2IHF A;  4FDB A;  2KHI A;  2PQA B;  2L15 A;  4O0A A;  5C3E H;  2OTL A;  3PO3 G;  4B3S L;  2R7Z H;  2E5L L;  5GAH C;  1OTC A;  1SFO H;  3TQY A;  1IYJ B;  5EAY A;  1YNX A;  3HOX H;  5GQO A;  1EYG A;  3I4O A;  1X3E A;  4BY7 H;  4JI3 L;  5IYD G;  2WAQ G;  2JA9 A;  1YIT A;  5E7N A;  1LM0 A;  3BZC A;  2FXQ A;  1Q8K A;  4L5S A;  2GVB A;  1FGU A;  1M90 C;  4X66 Q;  4LFC L;  1YHQ A;  1W2B A;  3S16 H;  1HNZ L;  3PCO B;  1Q1B A;  1X54 A;  3I4M G;  4JYA Q;  4UP9 A;  1YZ6 A;  4O2D A;  3KJP A;  4DV6 Q;  3KFU A;  1I94 L;  1D8L A;  2EXD A;  4DPG A;  1BVS A;  3M9B A;  4JBJ A;  4A3J G;  1EFW A;  5GAE C;  4HJ5 A;  1T9H A;  2R7D A;  2MQH A;  4R4T A;  5C44 G;  1MKH A;  1EIY B;  4BBS G;  3E0E A;  3KDF B;  1Y14 B;  1HZC A;  4J15 A;  1Q82 C;  1HR0 Q;  3I4N H;  4DK6 C;  1YHB A;  4RG1 A;  1C9O A;  1E1O A;  1VQI A;  4QGU A;  1X6O A;  1QZG A;  3PIP A;  4JI5 L;  3BJU A;  5M5W H;  2E2J H;  3U50 C;  1PH2 A;  2LXJ A;  4LFA Q;  4C3J H;  1XJV A;  2R93 G;  3NEL A;  4R1J A;  4A4I A;  5IP9 H;  2IT1 A;  1VQN A;  2CWP A;  2R92 G;  2PI2 E;  2OTJ A;  1TXY A;  5H1S E;  3T1H L;  2K5H A;  2Z0S A;  2PQA A;  1AH9 A;  5IP7 G;  3HKZ G;  4JOI A;  4JBK A;  4UP7 A;  2D0P A;  4A3B G;  4BY1 H;  4BXX G;  4A3G H;  2XTI A;  4GLV B;  1UWV A;  2E2I H;  1KAW A;  4A3L G;  5HY6 A;  5ELN A;  1CSP A;  2YTY A;  5IWA Q;  4DV0 L;  4OWW B;  2NVX H;  1K83 H;  1XTD A;  1Y1V G;  4ME3 A;  3U58 A;  3H0G H;  1U5K A;  2JA6 H;  1H95 A;  1YVC A;  4NXM Q;  1VQJ A;  1N33 L;  4OO1 I;  2K75 A;  3TRZ A;  1L2F A;  1OXX K;  2PNH A;  1NMF A;  1XMO Q;  1G51 A;  1A8V A;  2MO1 A;  4DV3 Q;  3GTJ H;  1PH9 A;  1PH1 A;  3GTG H;  4X66 L;  3A74 A;  3G6E A;  3M3Y H;  3W1B A;  4A3D G;  1E3P A;  1VQC A;  2N49 A;  3J81 i;  1Q86 C;  2E2H H;  4JYA L;  4LF4 Q;  4DV6 L;  4X64 Q;  4OX9 Q;  2UXC Q;  1QZH A;  4IOA A;  3VDY A;  3L7Z C;  4POF A;  3J81 c;  2HIV A;  3L2P A;  2VL6 A;  2CCZ A;  3PUY A;  3HOW G;  3K7A H;  1X3F A;  3KDF A;  5M5Y H;  1HNX L;  5FLM G;  1SE8 A;  4HJ8 A;  2MFI A;  3PF5 A;  1VQ9 A;  3UDG A;  1HR0 L;  4HJ7 A;  1N8R C;  2E8G A;  3RLF A;  3UE0 A;  2JJQ A;  1G6P A;  1E7Z A;  1YIJ A;  2F4V Q;  3ER0 A;  4A93 H;  4LFA L;  1C0A A;  4DV4 Q;  1JJG A;  5M5X H;  1K73 C;  3LGJ A;  1XPO A;  1CKO A;  1VQA A;  4DKA C;  1PV4 A;  4JI3 Q;  4JBM A;  5JEA G;  5GAD C;  1QVC A;  2JA8 G;  2KCM A;  3FHW A;  3UDF A;  3UDX A;  4IFD J;  1OXV A;  4L5Q A;  3K7U C;  1EWI A;  4R4C A;  1HZA A;  5FJ8 H;  1X55 A;  3AFQ A;  2LSS A;  3F1Z A;  1JT8 A;  3HFZ B;  1BBW A;  1VQF A;  1EIF A;  4MTN A;  1SMX A;  1PH6 A;  3S1M H;  4GOP C;  1QVG A;  4A3E G;  1V1Q A;  1Z9F A;  4DK3 C;  5HGQ A;  2Y0S G;  1A0I A;  1SR3 A;  3PUZ A;  4DAY B;  5IWA L;  2Q2H A;  3CCM A;  1R9T H;  3AQQ A;  2Q2U A;  4DR7 Q;  2UUC Q;  2UXB Q;  4HIK A;  3PO3 H;  2ID0 A;  1LUZ A;  2RF4 A;  4DUY Q;  1IZ6 A;  1XMO L;  2NZO A;  4PZ7 A;  2VUM H;  3M7N A;  4DV3 L;  4NXN Q;  2BA1 A;  1NY4 A;  3GTK H;  4C3I H;  5IYD H;  2XGT A;  3RR5 A;  4OX9 L;  4X64 L;  4DR6 L;  3HOV G;  1VQ6 A;  1AE3 A;  2YU9 H;  4B3M L;  1FJG Q;  2K5N A;  1Q46 A;  1CKN B;  3M4O H;  3S2H H;  2DUD A;  4AYB G;  4IJL A;  2BH8 A;  4A76 A;  1N36 L;  1IXR A;  3I4M H;  1B8A A;  1WOC A;  4QIW E;  3ICE A;  1OXT A;  2YV5 A;  2HIX A;  4TQU S;  3JAM c;  2I5M X;  3IRB A;  2F4V L;  2N78 A;  4YCV A;  3I2Z A;  4DV4 L;  1YBY A;  4GLA C;  5C0X J;  4BBS H;  4IO9 A;  3HOZ H;  2UXD Q;  3MXN B;  4BBR G;  4DV0 Q;  3W5O A;  2ZJP A;  3AYH B;  4LFB Q;  2ZJQ A;  3NBH B;  1I50 H;  4OWT B;  4LF5 Q;  4A3M G;  1B7Y B;  4YCU A;  1GKH A;  3HOU G;  3RLO A;  1N33 Q;  2JEA I;  3EN2 A;  2AKW B;  2R93 H;  1B70 B;  1JE5 A;  2I5L X;  5C4X G;  1KHI A;  3FKI G;  1TWG H;  2AHO B;  3DM3 A;  3E9H A;  2JQO A;  3CCU A;  1KC8 C;  2R92 H;  3S1Q H;  3CCL A;  4DNI A;  2EIF A;  1PH3 A;  4DR7 L;  5IP7 H;  1KIX A;  2UUC L;  1X9N A;  5IYB G;  4A3B H;  1HNX Q;  4B3R Q;  4DUY L;  2VY3 A;  1YJW A;  4Y7N H;  5IYC G;  4X6A H;  3GTQ H;  2KEN A;  4P72 A;  4NXN L;  2ES2 A;  1WCM H;  3I55 A;  1UE7 A;  4DV2 Q;  2RCN A;  3PUW A;  4DR4 Q;  1WI5 A;  3CME A;  1W3S A;  1VQE A;  4OXP A;  1NMG A;  1YEZ A;  1J6Q A;  2Q2I A;  1WFQ A;  1E22 A;  1RIP A;  4AH6 A;  2H5X A;  1CKN A;  4QJF A;  4XIG S;  2KHJ A;  4EQ5 A;  1FJG L;  4KI0 A;  3CW2 C;  4A3D H;  3OYY A;  2Z6K C;  4L5R C;  1HZB A;  4JI1 Q;  2QEX A;  3STB C;  4DR5 Q;  4DR3 Q;  1V43 A;  3HOX G;  5ELO A;  3U4Z A;  3L0O A;  4DR1 Q;  1L1O C;  3HOW H;  3DLL A;  1A62 A;  4KHZ A;  4BY7 G;  2C35 B;  4GKK Q;  5FLM H;  4KHP Q;  2UXD L;  1KRT A;  4YY3 Q;  1VQH A;  2NN6 G;  1Y1W G;  1OXU A;  3KF8 B;  3KF6 B;  3ULJ A;  1S72 A;  1XNR L;  4LFB L;  3CAM A;  2DGY A;  4LF5 L;  3UDI A;  4A3I H;  2JA7 G;  1SRO A;  3TS0 A;  2IX0 A;  4X65 Q;  4P74 A;  3CP0 A;  1NTG A;  2K5V A;  4OO1 G;  3PUV A;  4IPD A;  4BA1 I;  1XNQ L;  3A5Z B;  3S1R H;  4RMF A;  1E1T A;  4K0K Q;  1Q81 C;  4IPH A;  2AMC B;  1G29 1;  4Y52 H;  1N9W A;  2JA8 H;  4DR6 Q;  3J81 j;  3CCE A;  2KCT A;  4L5T A;  4JG2 A;  3TS2 A;  2VNU D;  4PZ6 A;  2B63 H;  4IFD I;  4DV1 Q;  1EUJ A;  4GKJ L;  2D62 A;  1IBM Q;  1J5E L;  4B3M Q;  3HOY G;  2N8N A;  1TWF H;  1UE1 A;  2PI2 A;  3K81 C;  4YHH L;  3CCV A;  1PH5 A;  4B3R L;  1LTL A;  4LNQ A;  3I56 A;  1FVI A;  2VQE Q;  1N36 Q;  4A3E H;  4DV2 L;  4C3H H;  1TWC H;  4DR4 L;  2WB1 E;  2UUA Q;  3S1N H;  4B3T L;  3H3V H;  1QUQ B;  2A1A A;  4A3F G;  4YWL A;  3A5U A;  1BBU A;  3CCR A;  1JJC B;  2K4K A;  1VCI A;  4GN5 A;  2NVT H;  2PMZ E;  4JI1 L;  2OQ0 A;  1HH2 P;  4BY1 G;  4A3G G;  5AJ3 L;  3HOV H;  4DR5 L;  4DR3 L;  4GNX C;  5C4J H;  1X65 A;  4LWC A;  4DR1 L;  4NB3 A;  5IT9 c;  1VQL A;  1K8G A;  4GKK L;  3BU2 A;  4DV7 L;  2UXB L;  4HIM A;  2JA5 H;  4KHP L;  4YY3 L;  4A3K H;  1PHJ A;  3KF6 A;  3CC7 A;  1PH7 A;  5M3F G;  4DV5 Q;  4QY7 A;  1HZ9 A;  4YWK A;  2WAQ E;  1VQM A;  3CC2 A;  2YYZ A;  4X65 L;  1U0L A;  4DAM A;  1K9M C;  3A0J A;  1LYL A;  4A75 A;  1IL2 A;  3J7A 5;  1N32 Q;  2F3I A;  1X56 A;  1JJ2 A;  4JI0 Q;  1L1O B;  4BBR H;  5C0X I;  1N34 Q;  4K0K L;  2N3S A;  3PGZ A;  2ZTE A;  4X62 L;  4LF9 L;  1E24 A;  1KRS A;  4YCW A;  3CMA A;  4A3M H;  4DV1 L;  1VQP A;  4GS3 A;  2B29 A;  1IBM L;  3G48 A;  2Q2T A;  5C4X H;  3JAM i;  2VQE L;  1SLJ A;  2D0O A;  4AQY L;  1C7Y A;  2OCE A;  3H3V I;  3M85 A;  1WYD A;  1P8L A;  3PIO A;  2UUA L;  4JI6 L;  4DUZ Q;  2K14 A;  4QL5 A;  3F2C A;  4A3J H;  3GTP H;  1K3R A;  5JEA J;  5JJK A;  1QUQ A;  4MNO A;  5K36 G;  5C44 H;  3PO2 G;  2MO0 A;  1NBW A;  5LMU Q;  2CWA A;  1BKB A;  3ZJY C;  5IYC H;  4YWM A;  1Q7Y C;  4A3C G;  5LMN W;  1XNR Q;  3CQZ H;  4UY8 C;  1NE3 A;  3GTM H;  3D31 A;  1UEB A;  1Z47 A;  2ZTD A;  3OW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...