2L9HA

Oligomeric structure of the chemokine ccl5/rantes from nmr, ms, and saxs data
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 5
publication title Oligomeric Structure of the Chemokine CCL5/RANTES from NMR, MS, and SAXS Data.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 11
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l9hA00
2L12A 1EOTA 5D65A 2DY8A 1IKLA 1PFMA 1AZQA 1KNEA 1DZ1A 1RTNA 1U4RA 1F9RA 1E0BA 1QNKA 2B2TC 2K03A 1RHPA 4HSVA 1J9OA 5CORA 4MHEA 2NZ1D 3TZDA 4NW2A 2L11A 4XDXA 1HHVA 1HRJA 1IKMA 1MSGA 2IL8A 1J8IA 1DONA 2MP1A 1TVXA 2L1BA 2N55A 3MWYW 2B2UA 4CJ2C 1VMPA 1B53A 1PLFA 2SDFA 2XIWA 1EIHA 1WTVA 1O7YA 3I90A 4HEDA 1Q3LA 1HA6A 2KECA 4OIJA 1F9QA 2D9UA 4LMQD 1U4LA 1AZPA 1LV9A 2HDLA 1ILQA 1HUMA 1G6ZA 1B4OA 1MSHA 1PDQA 1NR4A 1EL0A 2B2UC 1U4MA 1U4PA 4RA8A 4OIKA 4X3KA 2X69A 4HCSA 2EE1A 1SSOA 1SDFA 2NYZD 2RSOA 3H91A 5D14A 5T1IA 3ONAB 1MI2A 1DOLA 1XX8A 3FDTA 2L4NA 5E4WC 2BDNA 4IUQA 1NCVA 1EIGA 2L9HA 1ICWA 4DN4M 3R93A 2FHTA 1B2TA 3G7LA 2VXWA 4IURA 1QG7A 3I3CA 1AP0A 2HCCA 3MTSA 3KBXA 2K05A 1NAPA 2RSNA 3DM1A 1C8CA 3N52A 1IL8A 2DY7A 5EJWA 1WTPA 2RVLA 4ZKCB 3I91A 2FINB 1B3AA 1PFBA 5JJZA 4O42A 1G2SA 1ZXTA 4RWSC 1NR2A 3DEOA 1B50A 1G91A 3HP3A 1X3PA 1M8AA 1HUNA 3DEPA 1HFNA 4R8IA 2EOTA 1HFGA 1BBXC 1KNAA 2NWGA 4R9WA 3UI2A 3F2UA 5AFWA 2HCIA 1QE6A 2B2YA 3KUPA 4ZK9B 5EQ0A 3LWEA 2Q8TA 4ZLTF 1WD1A 2B2WA 2N88A 5EKIA 3D6WA 3P7JA 5EPKA 4U68A 5DNFA 1WVLA 1EQTA 2MGSA 2K28A 3IFDA 1O80A 2CVRA 1ESRA 4X3SA 1F9PA 2MPMA 2B2YC 5EPJA 1BF4A 1S4ZA 1WTXA 2B2WC 1A15A 1SAPA 2RA4A 3IL8A 5E4XA 5CBAE 1BNZA 2KUMA 1RTOA 1CM9A 4QUCA 2FFKB 1WTQA 2MJ8A 1WD0A 2R3ZA 3TN2A 4ZKBB 4X3UA 2JYOA 1MGSA 4CJ1B 1PFNA 1DOKA 2HUGA 2J7ZA 1WTOA 4XT1B 2H1EA 1DOMA 5CMDA 1JICA 1O7ZA 2B2VA 5EPLA 5T1GA 2X6LA 3QO2A 4CJ0B 1CA5A 1F9SA 1ML0D 2FMMA 2JP1A 2EPBA 4MN3A 1X3QA 1XYIA 2X6GA 4IUTA 2HDMA 2KOLA 1BO0A 2KEDA 2Q8RE 2B2VC 1GUWA 4UAIA 4XT3B 1ILPA 2KVMA 3GV6A 4RAUC 1X32A 2FJ2A 1JE4A 3FPUB 1WTRA 4IUUA 2M2LA 1G2TA 2K04A 2B2TA 2K1BA 1VMCA 4X3TA 4ZAIA 2K01A 3Q6SA 4IUVA 1WTWA 2KEEA 4IUPA 4HAEA 4QUFA 1RODA 3GV3A 1F2LA 5CBEE 3I8ZA 1RJTA 1CA6A 5COYA 3SVMA
chains in the Genus database with same CATH superfamily
2DY8A 5FK9C 2UUBL 2PZUA 2EJMA 3GO5A 4C3IB 3E5SA 1EYGA 1N34Q 1IBLL 4CJ2C 1PLFA 1UNSA 3ERSX 4HIDA 1CKNA 2N78A 4TSSA 5CV8A 4JBKA 3VA5A 1VQ8A 1YITA 1B4OA 4HMIA 1U4MA 3CCUA 2NYZD 1SDFA 2K50A 1CQVA 2VY3A 5G3LD 4JI1L 3S17H 1VQ4A 4JI4L 3MXNB 1IW7D 2WAQE 4KV6A 1FL0A 1YBYA 1GVPA 4KJOA 3D6CA 4B3RQ 3MTSA 5GQOA 3JAMc 4IFDH 3A5ZB 3G48A 5EJWA 4NXML 3HOUB 5C4ZA 1B3AA 1HZAA 3VDYA 1ZXTA 3P75A 5JJKA 1G91A 2PI2A 4C1NK 4DV2L 4CHTB 4LF8L 2PZWA 2PNHA 3S2HH 4X64L 3NTIA 2K33A 4PZ7A 1VQJA 2B2WA 2F0UA 1Y14B 3U58A 2N49A 5DNFA 2IJ0A 3K58A 2UU9Q 4OWXB 1O80A 1ESRA 2B63B 1F9PA 2EJGC 1DYQA 4C3JH 3CU7A 4DR5Q 1ONLA 4DV5Q 4DFAA 3M85A 3OW2A 1KQSA 4BXXG 4BA1I 2EY5A 4KD3A 3S15B 3I4NH 2QEXA 3KJPA 2WACA 1VQKA 1VDZA 4DR2Q 4OX9L 1W3SA 1L1OC 4DNRB 4DV0L 1K3BC 2Q8RE 3EVQA 4Y7NB 3EQLC 2VQEL 5I6YA 3F1ZA 3K5MA 1EOVA 2ZJRA 1Q86C 1EY9A 4C3HH 5JEAG 1T5EA 3M3YB 4RHSA 4A3EG 1SNOA 4ZRZA 2F0OA 1RJTA 5M9OA 2HQEA 2OQKA 1U4RA 4PMCA 3OMCA 2K5QA 1PH3A 5KNCA 1RHPA 1YIJA 5EAYA 4LWCA 3PIP3 1XMOL 1A0IA 2L1BA 2R92H 5ELCA 3M9BA 3BG3A 1I3QB 4A93H 1PZKD 5C0XI 4OIJA 1E1OA 2NUCA 4ODGA 1PTOB 3Q8DA 4IALA 1XTCD 4A3DH 2B2UC 3EFXD 4OONA 5CGKA 1IYVA 5IGDA 1VQNA 2EQSA 4L63B 1PZJD 3D4WA 3WDNA 4GKJQ 3JAMi 3PV0A 1XNRQ 1CT1D 1TS4A 4QY7A 3T1HQ 3BDOA 4CBVA 4L6TB 4BY7B 1Z47A 3ER0A 2L15A 3HEJA 1LYLA 1NAPA 1JC7A 1GOZA 2EXZA 5ELNA 2M00A 4B3SL 4JI6Q 1B50A 4JI3Q 2QW7A 3AEVA 3KDFB 1XPRA 1X3PA 1HUNA 4IFDJ 4K5XA 3IAYA 2EXDA 5C44B 4JYAL 2KHJA 4QQBX 1T5XD 3D6WA 1V1PA 1Q7YC 1G51A 2K28A 1GUGA 1GM5A 2Z6KC 3FEWX 3SK6A 3BVGA 2UUAL 1MD2D 1A15A 3CCVA 5C4XB 1RTOA 1OXSC 1QUQB 1JR0D 3QG1A 3K5NA 1PMRA 3HKZE 1UAPA 2MJ8A 3OPOA 1WTQA 3ULLA 1EU4A 1PYWD 4LF4L 2JXMB 1H9JA 4R4QA 3STBC 1LT3D 3GTGH 1XTDA 4L5QA 5FJ8H 2K5WA 3ND8A 2JA7H 2V1CC 4JV5Q 1LT4D 3QOJA 2VL6A 4PZ8A 1HPCA 3KF6B 3WOFA 2Q2HA 1PH7A 1SMYC 1D6EC 2OTJA 2KA7A 1I6VC 4K8JA 4B3ML 1PTOF 3W1BA 1BCPC 2K5DA 4C1NI 3RUZA 4KHVA 1PRTC 4K8IA 1SFOB 1C7YA 2XSCA 4C3IG 3I4OA 3I8ZA 4JVZA 5CV5A 1IYUA 3EROA 1AZQA 4X65L 4AIMA 1LTSD 2Z1CA 2DNEA 1IBKQ 3LGJA 1WTHA 3PUVA 4P73A 4A3CG 1Q81C 1HHVA 1HNWL 4CDDC 5JJIA 1TWHB 3TEHB 3V2TA 1EY4A 4WRDA 3I2ZA 2BA0A 1IYJB 1DJRD 3DM3A 1F9QA 2EYPA 4LMQD 4TQUS 5BN4A 2EYJA 2XTIA 1XWEA 3NXWA 1EL0A 2DJGC 1A3VA 1PYSB 2L0CA 1YJ9A 3STBD 2XRQD 3CAMA 2K52A 3HOUG 3L9AX 4LF7Q 1UE1A 1SMYD 1UUPA 3I72A 1JWSD 2RVLA 4XXEA 4A3LG 2KCMA 1Q12A 1BCPD 3Q24A 5KGUA 1I4HA 3NTHA 1PRTD 3A8JE 3HP3A 4JBMA 1ZYRC 1EEID 2YU9B 5J22A 4GOPB 4A3IB 1EYAA 1K28A 3TS0A 1XMQQ 2XWBB 1QZHA 4NXNQ 2R93H 3W5OA 3M4OH 4EQOA 1TWFB 4X3SA 5IT9c 4OO1H 4C3HG 3ZJYC 5LMUQ 4FF1A 1FJGL 3EN2A 5D3IB 2R7ZH 1SBBB 1E24A 1LACA 1MIUA 4Z9CB 2EYOA 1JCKB 2QKIC 4HIKA 2Q2TA 2EY6A 2O2LD 1S5FD 2PCFB 2EYFA 4JG2A 1C4QA 3I73A 2EZVA 3UE0A 4DV1L 1HNZL 5M5XB 1EQVA 2R92G 3NTKA 4DR7Q 2ALYB 4DUYL 5CC4A 3BS1A 1Y1VH 2I46A 3VR2A 1PHJA 4UAIA 2AUKA 1HTPA 3H6MA 3QIAA 1MJCA 3FPUB 1FNWA 1JWUD 4MIUA 3CQZB 2JE6I 4O2DA 2K1BA 3GTOB 1TWAB 2IWHA 2EYHA 4HAEA 1CA6A 1TY0A 3CCSA 3PUWA 1ZYRD 2F0QA 3S2DB 1O7IA 3E6ZX 3KLSX 3GTMH 4S3SA 4BBSH 2F0DA 4A3BH 3TZDA 4HCEA 1S5CD 2C35B 2OWOA 1I5FA 4HJ5A 1PRTB 3HOXH 4RG1A 5K36H 3MHBA 4P72A 4DAVA 1Q8KA 1XJVA 1VQEA 2K7VA 2JEAI 2X69A 1CKMA 2Y0SG 1KLUD 2PO4A 3T1YQ 3K80C 4IOAA 5IWAQ 2E74C 2VUMH 2WINB 4ALPA 1WCMB 2L9HA 4TRDA 4DN4M 3R93A 5LL6X 4KN7C 2N8NA 2BDOA 4BY1B 1CFMA 1QUQA 1VQ9A 1K8OA 3CRLC 2O5IC 1SYFA 1A3UA 1B8AA 2OEOA 5JJZA 5C44G 3I4MB 1QVGA 1EWHA 1HJPA 4FXGC 3D4RA 3GP7A 1I6HH 1YNND 1STGA 2JA7G 2EYMA 1XNQL 1Q1BA 4R9WA 3UI2A 3DWAA 2XWJB 1IBMQ 2CW0C 2NVXH 3J80L 1LM0A 3S16B 5C4XG 1HNXQ 2PPBC 1OXUA 3NPPA 3S1QH 1NUCA 2UXBQ 2XN9C 4DR3Q 3AU7A 4DR6L 5JPNC 2A19A 1K8AC 3FVQA 1DD2A 1CM9A 4G7ZC 5EKLA 4XYQA 1CSQA 3PSIA 1VQ5A 2BOSA 4UP9A 2F4IA 3U9OA 4A3JB 1A2TA 1Z6HA 1DOKA 2XGTA 1L1OA 4DPGA 1TS5A 3NSWA 5IYCG 4EQ5A 3HOVB 1GO3E 4LFBQ 5T1GA 2ZM6Q 5KYIA 2PNRC 4KI0A 3R8BA 1BCPF 1EYDA 4OXPA 1PRTF 4XQQA 2Y0SE 1TY2A 3A55A 2VZAA 4JOIC 2LFNA 4YIJA 1WFQA 3H15A 1EIYB 1VMCA 3GTQH 1VQIA 1R4QB 3RZDH 1VF5C 3QR8A 4B3TL 3CCMA 1ASZA 2MUYA 5C6AA 1NY4A 1RTNA 1VQ7A 2K03A 1I94L 1X55A 2SEBD 2NZ1D 1ENAA 3LWUA 2K5VA 4XDXA 3J7ZC 2RBMA 2UUCQ 4XIGS 1DONA 2G9HD 4AQYQ 2B2UA 1LTGD 3PUXA 2F0WA 1CZWA 4MZ9A 3RD4A 2HQLA 4HIOA 4JBJA 1U4LA 2IHEA 3UDXA 3KLSA 3TP8A 3KBGA 1D5XC 4RA8A 1LTID 1KLGD 3H91A 5J3BA 3D0FA 3F2DA 2CWPA 3CD6A 1EY0A 3NHHA 1BKBA 5M5WB 4FXDA 4UHVA 2BDNA 4IUQA 3PCOB 2A69C 1E7ZA 1L2FA 2C5CA 3WOEA 2D62A 3L3OC 4JI8L 4KTAA 1N32L 4DGZA 1OXTA 4K5WA 1HTLD 4ZKCB 2NVYH 4NDXA 4A3IG 4GLVB 3MAQA 4YY3L 3M7GA 2UUBQ 1PZID 4QIWB 3BYTB 4XYOA 3J7A5 1AN8A 1B44D 5FLXL 4A3FH 3EJIA 5JEAH 3K7AH 4RMFA 1M90C 2Z6KA 4A3EH 5LMNQ 2ZXOA 1QE6A 5EQ0A 4G57A 1Y1VG 1VQFA 2EJFC 3ND9A 4FDBA 4UP8A 1YHBA 3E0JA 1HR0Q 1STAA 2ID0A 1F2ZA 3IFDA 1MHWC 4ZYSA 2K75A 3H0GB 4NPSA 3C1EA 2MPMA 2ENBA 1U5KA 1R9TH 4ILWA 2KHIA 5IGFA 2N3SA 1SYBA 1X6OA 5FLMG 3ICEA 1VQAA 4JI4Q 5C5MA 2IY5B 4HJ8A 5FLXE 4PNYA 1ENFA 1Z9FA 3HOZB 1X3EA 1W6KA 1YNJC 2SNMA 5FOBB 2RCNA 5TSSA 4CJ0B 4NXMQ 1ML0D 5C3XA 4QGUA 2A69D 2Q8IB 4UPAA 4IFDI 1H9KA 2OXPA 3HOXG 4FF2A 1EY7A 4MNOA 1JOQA 4G7OC 1X56A 4C56C 4DV2Q 4X6AH 1B9MA 1ILPA 4IJHA 5A2QE 2KVMA 4PG3A 3SDZA 3JC66 3KK7A 2CQOA 4L5TA 3HRZC 3J81j 4F87A 2YV5A 4J6HA 4J8QA 2NZHA 5COYA 3GTLH 1X9NA 5KNBA 3FMCA 2UXDL 5KRUA 2YTXA 2ZTCA 5C4JH 1Q8IA 1FD7D 1Q90A 4DV4L 2A6HD 2IL8A 5JVG3 5E1FA 3RMHA 3GTJH 3RLOA 1V1PB 1Y1WB 1LV9A 1G6ZA 1S5BD 2F3IA 1JJCB 2VB3X 5IOCA 3T16A 4OIKA 4X3KA 1PA6A 2E2HB 4IN3A 1Z7TA 4OX9Q 3ONAB 3CKIB 2F0HA 1YNJD 1KDBA 5M3MH 1JJ2A 1ASYA 1DCZA 1UE5A 3I4MG 2A1AA 4I65A 1QILA 1A63A 3N52A 1T9HA 4JI2Q 2WV6D 1M1KC 3PO2B 1EY5A 3A7AB 1EY6A 5IODA 2PMZB 3V96A 4P75A 3W1GA 2F52A 2Z4HA 3TP5A 3DLLA 2GVAA 5IYBG 1SYEA 1N8RC 5FO8B 2I5HA 2HCIA 1D8LA 4R4IA 3J81c 4C3IH 1WD1A 1H9RA 5NUCA 2HHHL 4DV3Q 4DA2A 3BVZA 3BDLA 4WJ4A 3HOWB 4HN7A 4R8NA 1XPOA 5BR8L 5AJ3Q 3OHXC 4A3JG 1FYCA 4OL7A 5JEAJ 3HG9A 5EBCA 4A3CH 2XNAC 2QA4A 4RGMA 1YJWA 4OWTB 3HOVG 3TRZA 3FKIB 1CI3M 3TN2A 4POFA 1D7QA 3TP6A 4CJ1B 3TSSA 4J1MA 4IPCA 4GNXC 3R2IA 2E8GA 2HD3A 1N36L 5E7NA 2BH2A 2X6GA 1OTCA 3CCJA 2QDLA 3LX0A 3HOUH 5IYDG 4LUOA 1KXLA 4QUFA 3PUYA 1EWCA 4A3LH 1PVOA 2Q2UA 1EOTA 1STEA 3SK5A 4M8AA 3CXCA 1H9SB 2ZT9C 4RGTA 2AHOB 3U9SA 1JOOA 3CF5A 3PF5A 1MSGA 2B63H 3GTKB 1C9OA 2DNCA 1EIHA 5GADC 4I7AA 4LFCL 4LF4Q 4IUNA 1H95A 4X62L 2M9VA 1X3GA 4A3FG 4K0KQ 1J6QA 3D31A 4RFBA 1GHJA 3S15H 2A68D 4KHPL 4DR1L 3AYHB 2A8VA 1YHAA 4DR4Q 1Y8OB 5CV4A 1A2UA 2L5TA 4YHHQ 4CKBA 2A5HA 4RGOS 1LTTD 4ZUJA 4Y7NH 3NELA 1P8LA 2ZXPA 4A4IA 3TBIB 1R4PB 1HZCA 4RKLA 4LFAQ 2A73B 3M7NA 1QOHA 3M3YH 4X65Q 1XXGA 2MHVA 3J81i 1B7YB 3VA7A 5JVH3 4R1JA 3OYYA 1N33Q 2EOTA 3E3XA 1WI5A 1HNWQ 4FP5D 5I9OA 2RDGA 3LWEA 2Q8TA 5EPKA 4U68A 2PYKA 4F8MA 5KNDA 2PI2E 2K5NA 1I3QH 4KD4A 4DV7Q 5EBDA 2JQOA 2NTTA 1PTOH 3HOZG 3CP0A 2I0QA 3NWTA 2NN6I 2FFKB 2CH4A 5M3FB 4HR7B 1DGSA 4ZKBB 1ESFA 4IO9A 5FO7B 1DXMA 2H1EA 3DWQA 5HGQA 5LHY1 4GS3A 1JICA 1O7ZA 4LF5Q 4BY7H 1XYIA 4MN3A 3CCRA 4JOIA 2F0SA 2C9OA 3K6OA 1TS3A 4RAUC 2UU9L 1SNDA 1WTRA 1X65A 5G3LF 2RCFA 2K04A 2K14A 1BQQT 4IOCA 1RD9D 5CBAE 4GNXB 2IW3A 3NUCA 5M3MG 4DR5L 5C44H 2PW5A 4K6LA 4QIWE 2B2TC 4DV5L 1I50B 2Z0SA 4HSPA 1Y1WG 1FJGQ 1QCBD 3CCLA 1STBA 4BBRB 4OO1I 1V9PA 2JSOA 1HH2P 3PGZA 5C4XH 1PFSA 5I9PA 3GDEA 3GTPB 4DUZL 1V1QA 1LTLA 2KECA 1OXXK 1GD7A 4A3KB 1PH2A 3HS0C 5HGTA 3NBIA 1TWGB 4KKSA 4BWGB 2P5ZX 1NNXA 4O0AA 2VQFQ 5I4DA 3D8GA 2L4NA 1KTKA 3AB9A 2WB1B 1D1KA 4ME5A 1L1OB 4DK1A 3JAML 3J80c 5IYCH 2RQXA 1PH6A 3E0EA 3NBHA 3U50C 3KBXA 4RGNA 1PH5A 1WTPA 1DM0B 3LNNA 4A3MB 1SFOH 2VS1A 4K2KA 3T4AC 3FRPB 2KHSA 4GLAC 2UXCQ 4ZK9B 4J15A 5EKIA 4X66Q 3JAME 3C3LA 1GHKA 1CSPA 4GKJL 1WVLA 1TWHH 4AYBB 1EQTA 2JA5B 1XNRL 3FKIG 3BZDB 2RDFA 3T1HL 1BF4A 1Q1EA 3PF4A 1NBWA 4ID6A 3SK4A 4P74A 2K4KA 4DAPA 4JI7Q 3C2PA 3HFZB 2JA6B 2R3ZA 4CKEA 1ET6A 2MQHA 1OO9B 1SNPA 5KIXA 1H9SA 4CKCA 4Q5VA 1W6JA 3B6YA 5ELOA 1V43A 4A3GB 3PIPA 2AQ2B 4JI6L 4JI3L 2B63G 5J1ZA 1JB7A 3PIO3 1X3QA 4R4CA 3RNUA 2D5DA 1B3QA 2CQAA 5C3EB 4C2MB 1VQHA 1K8GA 1HZ9A 1VQDA 2D0OA 1XNQQ 1L0YB 2NVTB 2B3GA 1K0SA 2DUDA 4L5RC 2B8FA 4HJAA 4IUPA 2R7DA 2YU9H 4A3IH 2JK8A 4GN3B 5H1SE 3P20A 4KKUA 2PMZE 2G9DA 1J5EQ 3MEHA 2I07B 3MXGA 1TWFH 2R7FA 4ZCKA 2GN5A 4LW1A 1WTVA 3AMUA 4JV5L 3S14B 2D9UA 1O78A 5HY6A 2ES2A 3MVVA 2Z4IA 4HJ7A 2IX1A 3J80i 5FLMH 1YNNC 2E5LQ 1MI2A 3ULJA 1QB5D 1H9MA 1S40A 2ZXRA 5M5XH 4HIMA 4Y52H 2Z9HA 4LF6Q 1F2MA 1NCVA 4DV6L 1B2TA 1HZBA 3S1NB 1K83B 5IP9G 1F2YA 1IBKL 3DM1A 1KDCA 1VQMA 1EUJA 1BCPB 1S5DD 3CQZH 3I91A 3VYTA 3GTOH 1TWAH 3FP9A 3HZXA 2BCOA 1I94Q 2WAQB 3VR5A 5DAUA 3S2DH 3GD7A 4BY7G 3IFTA 1BBXC 3S24A 1VQLA 3J7AV 3RLFA 2N88A 3HGBA 1JWMD 4H13C 1SRUA 4PMBA 4XTCS 5M3FG 1SNCA 2KCTA 5EPJA 2NB0A 2EYLA 2FMCA 4LF7L 4GNXA 5GROA 3SR1A 4QUCA 4RCNA 5D3DA 1C0AA 4IZ8A 1WJJA 1PFNA 2L55A 3OMGA 2K6AA 4JI8Q 1WCMH 1G8ZD 2O5JC 2R61A 2FXQA 2Z6BA 2QILA 1AH9A 3HOYB 3KFUA 4BY1H 1QNUA 4IUTA 2HDMA 5I2XA 2G5DA 4YCUA 4OHJA 3NQTA 2B2VC 1XMQL 1GUWA 2LKVA 2ATWA 4NXNL 1TQOA 1JE4A 3I4MH 1D1IA 1EZ6A 1KDAA 2KCCA 4I7ZC 1V1OA 1KAWA 1C48A 2K01A 4IUVA 2KEEA 5CBEE 3GV3A 4JI5Q 3BDCA 5K5PA 4BBRG 4ABNA 2LSSA 1NE3A 1EY8A 3S16H 4HSVA 2RDHA 3VR3A 1RDPD 2OTLA 5IYBH 1JE5A 4CDCC 1SMXA 3OTOQ 3VYSA 4A3KG 5C0XG 3CMAA 1LTAD 2E2JB 2OQ0A 2SDFA 3NENA 4LF9Q 1NMGA 1YZ6A 2F0GA 1TIID 3E9HA 5KEEA 1SEBD 4DR7L 1EQQA 1KL9A 2HDLA 3PO3B 2DGYA 4GKKQ 1FGBD 4A3JH 4RHRA 1NR4A 2NVQB 2F0EA 2F3WA 3M4YA 1JMCA 5IIFA 1BUVT 1OXVA 3S1RB 3HOVH 5DM73 1DOLA 2JA8B 2ZJQA 2MO0A 1EU3A 1I4PA 3NQIA 5F2DA 5BN5A 4Q0FA 3A8IE 3H3VH 1SYGA 1QG7A 4A3MG 1G6PA 2HCCA 4WFN3 2JN4A 3UDFA 5I6WA 4YCVA 1LT6D 3K0YA 1F77A 1X3FA 3MC0B 5I2YA 5IP7H 1LO5D 2UXDQ 1HQMC 2HT1A 1K0RA 1KABA 5ELFA 5IYDH 3MEFA 4AYBG 2JA5G 1HFGA 1EIFA 4JI0Q 1MBYA 3E9IA 4F7XA 3L2PA 4DK3C 3T1YL 2RF4A 1A6XA 5IWAL 4MTNA 2KJXA 1IXRA 3UDIA 1E3PA 5ELEA 2DN8A 3KF8A 2A74C 4YWKA 2LY7A 1B9NA 3M4PA 4FVMA 2CCZA 4A3GG 1A8VA 3A7LA 4BA2I 2SOBA 1WD0A 4LUVA 2B8GA 1VQOA 2D0PA 3S1MB 1S3OA 4EQPA 5M5WH 4QB4A 5BN3A 5CMDA 1IBLQ 5C3EG 3A56A 2VB2X 5DEHA 1CK1A 2EY1A 5IT9E 1KC8C 1SN8A 3QJYA 3RZOB 2A6HC 4IPHA 1IBML 3HKZB 1QWYA 2V4DA 4BS9A 2YTVA 1HNXL 2PQEA 4GLXA 1STHA 3VR6A 4JI1Q 4YWMA 2UXBL 5A2QL 1EFID 1VQPA 2B2TA 4N9TA 4HMJA 5IE8A 3VYUA 3D4DA 1TWCB 2HHHQ 1EQRA 1O7LA 3RR5A 1SXTA 2K32A 3T13A 4B9WA 1KNEA 3CCQA 1TU2B 2IT1A 4FF4A 1SYCA 2L11A 3H0GH 2QEJC 1J8IA 4LFBL 2N55A 4PMWA 1K3RA 4LF8Q 4X64Q 4FNFA 1NMFA 2QCPX 3TMEA 1STYA 3HOZH 1VQ6A 2KCNA 1EEFD 1SE4A 4DK0A 2HIVA 1TT2A 3L0OA 1GUSA 1UE7A 2E76C 1VQGA 5FKAC 2DY7A 1BBUA 3J7YW 1PH4A 2FINB 2UUCL 1NJIC 4AQYL 4RWSC 1WCMG 2PQAA 2E2IB 1EWIA 1M8AA 3CRKC 3Q22A 3TREA 1HFNA 4GN4B 2MFIA 1GUTA 1K8MA 1KNAA 4BY1G 4DV0Q 2QGQA 4LFCQ 5ELDA 3MA2B 4N9PA 2VQEQ 1ENCA 1KRSA 4K6DA 4NB3A 3WWVA 3G4SA 2F0KA 2B2YC 2IHFA 1WTXA 1Y1WH 3OWFA 2RA4A 3A0JA 5C5LA 1B70B 2MO1A 3W2DA 2E2HH 1PTOC 3ZYYX 3HOYG 4YWLA 1PH8A 1VQBA 1RL2A 1MGSA 1N9WA 2HUGA 2J7ZA 4U673 1WTOA 3QWNA 4H0LC 1YEZA 1W2BA 3S17B 3Q23A 1XMOQ 2F4VL 1E2WA 1D5ZC 4G7HC 1F9SA 3A8KE 5LMNL 1RCVD 1BO0A 3PO2H 1SROA 2F0VA 1HR0L 4IUUA 3NBHB 3TDQA 1YI2A 2KENA 5KYLA 1K73C 1RODA 4NP5A 4DKAC 3RLNA 3KJOA 1RIPA 2A68C 5JAVA 2L12A 2LMCB 1PFMA 2LXJA 4KN4C 3S2HB 1QNKA 4GN5A 1J9OA 4MHEA 3HOWH 3OOCA 1L0XB 1HRJA 3PO3G 5IP7G 1UWVA 5IGGA 1FR3A 3A54A 4B3SQ 3G6EA 1HA6A 1AE3A 3OWEB 2JA8G 4C3JB 3FKIH 1JQYD 3QB3A 1U4PA 1PTOD 4JYAQ 4DAYA 3N6RA 3J7AF 2AWOA 1ICFB 3I4NB 1NSNS 1ICWA 2SNSA 1QZGA 2FHTA 2ICIA 2UUAQ 1AP0A 1VCIA 2RSNA 5JOBA 4PZ6A 5GAGC 3I7FA 1PV4A 1YJNA 1CKOA 2AUJD 3SGIA 4C3HB 1ZEQX 1Y8PB 1LTBD 2XVSA 4ZLTF 1I4XA 1VF7A 2E2DC 2LXKA 2ZTEA 1AEXA 3TS2A 4DUZQ 3GTKH 4B3MQ 1E22A 3I55A 2R6GA 3TZUA 3OW7A 2R92B 1S4ZA 3IL8A 1JORA 3NK9A 1L0WA 4M1UB 2WP8J 3OIQA 1N34L 4A93B 1GUOA 3MXUA 3UDGA 4DF7A 4JI2L 4K2LA 3GQBA 2H5XA 2F0PA 4A3DB 2F0JA 4QL5A 3HKZG 3H0GG 2B2VA 3CC2A 3SEBA 3QO2A 2Q2IA 2EVBA 4DXFA 1LTRD 3VR4A 4DK6C 4DV3L 3MFGA 2IPKD 5IP9H 1EYCA 1BBWA 3CC7A 5AJ3L 1Y69U 4B3RL 4OELB 2F1MA 2WFWA 2AMCB 3SVMA 1HXYD 4V0BA 1DZ1A 1I4GA 3ERQA 4LK1C 4GOPC 5CORA 2Y0SB 1CQFA 3SK8A 3AFPA 4WJ3M 2ZTDA 1VQCA 2CH4W 2RHQB 1STNA 4FO2A 4IQZA 1VMPA 1NTGA 2RKSA 2HIXA 2XIWA 5DM63 1O7YA 3G71A 3KLRA 1GXDC 2BA1A 4H44C 4ULLA 4ZQ3A 1ET9A 5M3FH 1ILQA 1HUMA 1PDQA 5T1IA 1D5MC 4B08A 2EIFA 1XX8A 3C46A 3Q0AA 3GTGB 4AH6A 3BU2A 2O4XA 1E2VA 3K8AA 4A76A 3CC4A 2JA7B 4QJFA 4IURA 1U9RA 1C8CA 2K05A 1D2BA 1IL8A 4DR2L 2F0LA 1PYBA 1KIXA 1AW7A 1B1ZA 3BVMA 2AQ3B 1SJHD 1TXYA 1G2SA 4H7BA 3DEOA 3KLWA 4OWWB 4IPDA 1UEBA 4DV1Q 1HNZQ 1JJGA 3DEPA 2ASBA 3J81L 3X3NA 2IX0A 4DUYQ 4K0KL 3F2UA 4WJWA 5AFWA 1I50H 3V05A 2CKZB 1SR3A 1K9MC 3PO2G 3AFQA 5EKKA 2EDGA 2F0TA 4BBRH 4UDUC 1KD1C 2PW7A 1SLJA 4KY6A 3L7ZC 4DR4L 3GTPH 4E6IA 4YHHL 2OF1A 3R3OA 1BNZA 3S9WA 1LLRD 3DXJC 4A3KH 5C0XH 3ULPA 2KQ3A 1II3A 1TWGH 4DV6Q 4LFAL 3MXNA 3J81E 4CDEC 1IZ6A 3NEMA 3K0XA 3TQYA 5IY0A 4APVA 4XT1B 3HOWG 2QDBA 1DOMA 1X54A 4EGVA 5EGTA 3A74A 2F03A 4HTHA 1N33L 4IFDG 1SYDA 1GJXA 2VW9A 4WORA 3K7UC 4A3MH 5HURA 2D2CC 3NP8A 4DV7L 2NN6H 1F2LA 4KHZA 3M4QA 3MZ5A 2GVBA 3KOJA 1E0BA 4KKTA 5GAHC 2F0MA 4EQNA 1Q46A 1A62A 2JA5H 3D3RA 4C3JG 2XRSD 2WKCA 4XQNA 5CR3A 4LF5L 4NMZA 3MWYW 1B53A 2R93B 2RHSB 3I90A 4HEDA 3M4OB 4TVAB 4IJLA 2JA6H 1UEAB 1MSHA 3KF8B 3I4NG 1SSOA 2J0TD 2R7ZB 5IGEA 2NZOA 4A3GH 4MTKA 3VYRA 1CHQD 3FDTA 3AQQA 1I4RA 1JT8A 1EIGA 4RKBA 1BVSA 4DR6Q 1Y8NB 3H3VC 5C3EH 4C2MH 4KY5A 2MNAA 2H4OA 4CDFC 5J39A 1Y1VB 1PH9A 1UE6A 3MXPA 1MKHA 3R2TA 4KK7A 2NVTH 1PFBA 2OCEA 4O42A 2I5LX 1U0LA 2IX3A 5CYUA 4N8X1 5C3WA 1G291 1I4QA 3IKJA 1HA5A 2NBFA 4CGYB 3NWSA 1TS2A 2NWGA 4R4OA 5FLXc 5JPMC 3K59A 2B2YA 3KUPA 3A5UA 3CMEA 2BH8A 3GTMB 4BBSB 3K5OA 3PQIA 2VQFL 5IGCA 4A93G 2AQ1B 5LL6S 4A3BB 5DLQE 3BJUA 1EFWA 2QF7A 2E75C 3FPPA 2ICEC 4A3DG 4KJNA 3S14H 4B3TQ 2B2WC 1JOKA 3IRBA 3F2CA 3HOXB 4V190 4H02A 4OEMB 3UE1A 2WIIB 2F0IA 4JCVE 3I56A 2TMPA 4KLKA 5EPLA 3H3VI 2VUMB 3F8TA 3S1NH 1K83H 4FXKC 4QCLA 5C0XJ 4POGA 2AKWB 2JP1A 1S72A 2KOLA 1BOSA 2UXCL 4X66L 3KDFA 3GV6A 3RN5A 1YVCA 1G2TA 3H94A 3MFYA 1PH1A 1SE8A 5JJLA 1XPUA 4OGQC 4JI7L 4EX5A 5D65A 3SHLA 1IKLA 1I6HB 2PZTA 4QMGA 4DU9A 2PQAB 2TSSA 1N32Q 4NW2A 2NVXB 2F0FA 1TR5A 3X3MA 4YY3Q 1QVCA 3FHWA 1QVFA 3S1QB 5A35A 4P2CB 4DAMA 2A6EC 3DUZA 3EIVA 3G6JB 2F3VA 5FJ8G 4L8JA 4HCSA 4O1NA 2RSOA 5D14A 2JA9A 3U4VA 2F0NA 1Q82C 3KF6A 5LMUL 1BDOA 3HOYH 4JPBW 1KAAA 4IPGA 2OT2A 1PXUA 3CCEA 1J5EL 4LUZA 4GZYC 4K5VA 3C1FA 3H09A 4A75A 1HCZA 1RF2D 2CFMA 5FO9B 1CKNB 3BZCA 1NR2A 4G4KA 5ISRA 1ZKOA 2WB1G 4LJZC 4YCWA 3RZDB 3GTQB 1SNMA 4R8IA 3PIOA 4L5SA 4UP7A 3J80E 2B39A 3T53B 1A3TA 2E5LL 1E2ZA 2AWNA 3I4LA 3OSOA 3P7JA 3PMFA 2Z8LA 2E2JH 2K5HA 3P1HA 4LF6L 3BYYB 3DMUA 3BZKA 1SAPA 2NN6G 3PO3H 2KUMA 4P71A 2NVQH 1SE3A 2BE5C 5CV7A 1WOCA 3SXHA 2A6ED 3CHBD 3S1RH 4XQJA 4FF3A 2JYOA 3OIPA 5C4HA 2JA8H 4R4TA 3DWPA 1QJOA 3URYA 1M4VA 1RKNA 3F2BA 1BXTA 4DV4Q 1AE2A 3U4ZA 2CW0D 4K14A 1CA5A 5CV9A 3QOLA 4N8FA 2FMMA 2EPBA 4DAYB 4JBWA 4UY8C 3K81C 5IT9L 1S5ED 2JA6G 1GUNA 4XT3B 1JB3A 1VS0A 2WKDA 2NVYB 4GOPA 2M2LA 5GAEC 1WYDA 4HJ9A 1LUZA 3ITPA 1CUKA 3KYHC 4ZAIA 3Q6SA 4DNIA 1CHPD 4JK1C 2I5MX 3T56B 4ZUIA 4DNTB 1F9RA 4A3FB 2ZJPA 4JC0A 4BXXH 2R93G 3K7AB 2CHBD 2CWAA 4A3EB 3I70A 4OO1G 4KY7A 2MP1A 1TVXA 5ELBA 4FYDA 2R7ZG 4EVOA 2WB1E 3EA6A 1Q3LA 4DXGA 1R9TB 3CPFA 1AZPA 1YNXA 2BE5D 2F4VQ 1KRTA 4DR3L 1GKHA 3S1MH 2NTSA 1IKMA 2EE1A 1IHZA 3DHQA 5E4WC 2JJQA 5BR8Q 3RZOH 2KBNA 4JI5L 2LS01 3CW2C 3G7LA 3EBEA 2VXWA 2YTYA 1KHIA 3I3CA 1HQRD 3NE5B 2ZM6L 5L37A 4KMUC 5IGBA 3OTOL 4AYBE 1CTMA 1MJEA 3RN2A 4LF9L 1P16A 1TWCH 3K57A 1FNUA 1LT5D 3SE0A 4BBSG 4JW0A 1N36Q 1YHQA 4A3BG 3TP7A 4GKKL 3GTLB 1FGUA 2JEBI 4TKOB 2EY2A 2GA4B 5M5YB 3HKSA 5C4JB 3PUZA 1E1TA 2MGSA 5K36G 2CVRA 4B9XA 1LABA 2WAQG 3W3AA 2VNUD 4RH6A 5E4XA 1SJED 2B29A 4PV1C 3GTJB 1IL2A 2VUMG 4QF4A 1EZ8A 4RCOA 4X3UA 3T51B 4F88A 1TKWB 5M5YH 1IW7C 2X6LA 3K5LA 5E3FA 5CV6A 5LMNW 1SNQA 5M3MB 4JI0L 4X62Q 1HR0W 3O13A 2KEDA 4ME3A 4LAAA 4LNQA 1X32A 1CZGA 2FJ2A 4PQXA 1AFPA 4KHPQ 4DR1Q 1BR9A 1SE2A 2E2IH 4X3TA 1WTWA 1FNVA 1FVIA 2DJFC 4NKLA 3CPWA 2J4XA 2YYZA 1V8QA
chains in the Genus database with same CATH topology
2DY8A 5FK9C 2PZUA 2EJMA 3GO5A 4C3IB 3E5SA 4CJ2C 1PLFA 1UNSA 4TSSA 5CV8A 3VA5A 1B4OA 4HMIA 1U4MA 2NYZD 1SDFA 1CQVA 5G3LD 1IW7D 4KV6A 4KJOA 3D6CA 3MTSA 4IFDH 5EJWA 3HOUB 5C4ZA 1B3AA 1ZXTA 3P75A 1G91A 4C1NK 4CHTB 2PZWA 3NTIA 2K33A 2B2WA 2F0UA 5DNFA 2IJ0A 3K58A 1O80A 1ESRA 2B63B 1F9PA 2EJGC 1DYQA 3CU7A 1ONLA 4DFAA 3M85A 4BA1I 2EY5A 4KD3A 3S15B 2WACA 1VDZA 4DNRB 2Q8RE 3EVQA 4Y7NB 3EQLC 5I6YA 3K5MA 1EY9A 5JEAG 1T5EA 3M3YB 4RHSA 1SNOA 4ZRZA 2F0OA 1RJTA 5M9OA 2HQEA 1U4RA 4PMCA 3OMCA 2K5QA 5KNCA 1RHPA 3PIP3 2L1BA 5ELCA 3BG3A 1I3QB 1PZKD 5C0XI 4OIJA 4ODGA 2NUCA 1PTOB 4IALA 1XTCD 2B2UC 3EFXD 5CGKA 1IYVA 5IGDA 4L63B 1PZJD 3D4WA 3WDNA 3PV0A 1CT1D 1TS4A 3BDOA 4CBVA 4L6TB 4BY7B 1Z47A 3HEJA 1NAPA 1JC7A 1GOZA 2EXZA 2M00A 1B50A 1X3PA 1HUNA 4IFDJ 4K5XA 3IAYA 5C44B 1T5XD 3D6WA 1V1PA 2K28A 1GUGA 3FEWX 3SK6A 3BVGA 1MD2D 1A15A 5C4XB 1RTOA 1OXSC 1JR0D 3QG1A 3K5NA 1PMRA 1WTQA 1UAPA 2MJ8A 3OPOA 1EU4A 1PYWD 2JXMB 1H9JA 1LT3D 2K5WA 3ND8A 1LT4D 3QOJA 1HPCA 3WOFA 1SMYC 1D6EC 2KA7A 1I6VC 4K8JA 1PTOF 1BCPC 2K5DA 4C1NI 3RUZA 4KHVA 1PRTC 4K8IA 1SFOB 2XSCA 4C3IG 3I8ZA 5CV5A 1IYUA 3EROA 1AZQA 1LTSD 2Z1CA 2DNEA 3PUVA 1HHVA 1TWHB 3V2TA 1EY4A 4WRDA 2BA0A 1DJRD 1F9QA 2EYPA 4LMQD 4TQUS 5BN4A 2EYJA 3NXWA 1XWEA 1EL0A 1A3VA 2L0CA 2XRQD 3L9AX 1SMYD 1UUPA 3I72A 1JWSD 2RVLA 4XXEA 1Q12A 1BCPD 3Q24A 5KGUA 1I4HA 3NTHA 1PRTD 3A8JE 3HP3A 1ZYRC 1EEID 2YU9B 5J22A 4A3IB 1EYAA 2XWBB 4EQOA 1TWFB 4X3SA 4OO1H 4C3HG 4FF1A 5D3IB 1SBBB 1LACA 4Z9CB 2EYOA 1JCKB 2QKIC 2EY6A 2O2LD 1S5FD 2PCFB 2EYFA 1C4QA 3I73A 2EZVA 5M5XB 1EQVA 3NTKA 5CC4A 3BS1A 2I46A 3VR2A 4UAIA 2AUKA 1HTPA 3H6MA 3QIAA 3FPUB 1FNWA 1JWUD 4MIUA 3CQZB 2JE6I 2K1BA 3GTOB 1TWAB 2IWHA 2EYHA 4HAEA 1CA6A 1TY0A 3PUWA 1ZYRD 2F0QA 3S2DB 3E6ZX 3KLSX 4S3SA 2F0DA 3TZDA 4HCEA 1S5CD 1PRTB 5K36H 3MHBA 4DAVA 2K7VA 2JEAI 2X69A 1KLUD 2PO4A 2E74C 2WINB 1WCMB 4TRDA 4DN4M 2L9HA 3R93A 5LL6X 4KN7C 2BDOA 4BY1B 1CFMA 1K8OA 3CRLC 2O5IC 1SYFA 1A3UA 2OEOA 3I4MB 1EWHA 4FXGC 3D4RA 3GP7A 1YNND 1STGA 2EYMA 1Q1BA 4R9WA 3UI2A 3DWAA 2XWJB 2CW0C 3J80L 3S16B 2PPBC 1OXUA 3NPPA 1NUCA 2XN9C 3AU7A 5JPNC 3FVQA 1DD2A 1CM9A 4G7ZC 5EKLA 4XYQA 2BOSA 2F4IA 3U9OA 4A3JB 1A2TA 1Z6HA 1DOKA 1TS5A 3NSWA 3HOVB 5T1GA 5KYIA 2PNRC 4KI0A 3R8BA 1BCPF 1EYDA 1PRTF 4XQQA 1TY2A 3A55A 2LFNA 4YIJA 1VMCA 1R4QB 1VF5C 2MUYA 5C6AA 1RTNA 2K03A 2SEBD 2NZ1D 1ENAA 3LWUA 4XDXA 2RBMA 4XIGS 1DONA 2G9HD 2B2UA 1LTGD 3PUXA 2F0WA 1CZWA 3RD4A 1U4LA 3KLSA 3TP8A 3KBGA 1D5XC 4RA8A 1LTID 1KLGD 3H91A 1EY0A 3NHHA 5M5WB 4FXDA 2BDNA 4IUQA 2A69C 2C5CA 3WOEA 2D62A 3L3OC 4KTAA 4DGZA 1OXTA 4K5WA 1HTLD 4ZKCB 4NDXA 3MAQA 3M7GA 1PZID 4QIWB 3BYTB 4XYOA 1AN8A 1B44D 5FLXL 3EJIA 5JEAH 2ZXOA 1QE6A 5EQ0A 4G57A 3ND9A 2EJFC 3E0JA 1STAA 2ID0A 1F2ZA 3IFDA 4ZYSA 3H0GB 3C1EA 2MPMA 2ENBA 4ILWA 5IGFA 1SYBA 5C5MA 5FLXE 4PNYA 1ENFA 3HOZB 1YNJC 1W6KA 2SNMA 5FOBB 5TSSA 4CJ0B 1ML0D 5C3XA 2A69D 2Q8IB 4IFDI 1H9KA 2OXPA 4FF2A 1EY7A 1JOQA 4G7OC 4C56C 1B9MA 1ILPA 5A2QE 2KVMA 3SDZA 2J4XA 3KK7A 3HRZC 4F87A 4J6HA 4J8QA 5COYA 5KNBA 3FMCA 5KRUA 1Q8IA 1FD7D 1Q90A 2A6HD 2IL8A 5JVG3 5E1FA 3RMHA 1V1PB 1Y1WB 1LV9A 1G6ZA 1S5BD 5IOCA 2VB3X 3T16A 4OIKA 4X3KA 2E2HB 4IN3A 1Z7TA 3ONAB 3CKIB 2F0HA 1YNJD 1KDBA 1DCZA 4I65A 1QILA 3N52A 2WV6D 3PO2B 1EY5A 3A7AB 1EY6A 5IODA 2PMZB 3V96A 2Z4HA 3TP5A 1SYEA 5FO8B 2HCIA 1WD1A 1H9RA 5NUCA 4DA2A 3BVZA 3BDLA 3HOWB 4HN7A 4R8NA 3OHXC 1FYCA 4OL7A 5JEAJ 3HG9A 5EBCA 2XNAC 4RGMA 3FKIB 1CI3M 3TN2A 3TP6A 4CJ1B 3TSSA 4J1MA 3R2IA 2X6GA 3LX0A 4QUFA 3PUYA 1EWCA 1EOTA 1STEA 3SK5A 4M8AA 1H9SB 2ZT9C 4RGTA 3U9SA 1JOOA 1MSGA 3GTKB 2DNCA 1EIHA 4IUNA 2M9VA 3D31A 4RFBA 1GHJA 2A68D 1Y8OB 5CV4A 1A2UA 2L5TA 4CKBA 2A5HA 4RGOS 1LTTD 4ZUJA 2ZXPA 3TBIB 1R4PB 4RKLA 2A73B 3M7NA 1QOHA 1XXGA 2MHVA 3VA7A 5JVH3 2EOTA 4FP5D 5I9OA 2RDGA 3LWEA 2Q8TA 5EPKA 4U68A 2PYKA 4F8MA 5KNDA 4KD4A 5EBDA 2NTTA 1PTOH 3NWTA 2NN6I 2FFKB 5M3FB 4HR7B 4ZKBB 1ESFA 5FO7B 1DXMA 2H1EA 3DWQA 5LHY1 1JICA 1O7ZA 1XYIA 4MN3A 2F0SA 2C9OA 3K6OA 1TS3A 4RAUC 1SNDA 1WTRA 5G3LF 2K04A 1BQQT 1RD9D 5CBAE 2IW3A 3NUCA 2PW5A 4K6LA 2B2TC 1I50B 4HSPA 1QCBD 1STBA 4BBRB 4OO1I 2JSOA 5I9PA 3GTPB 2KECA 1OXXK 4A3KB 3HS0C 5HGTA 3NBIA 1TWGB 4KKSA 4BWGB 5I4DA 3D8GA 2L4NA 1KTKA 3AB9A 2WB1B 1D1KA 4ME5A 4DK1A 3JAML 2RQXA 3NBHA 3KBXA 4RGNA 1WTPA 1DM0B 3LNNA 4A3MB 4K2KA 3T4AC 3FRPB 2KHSA 4ZK9B 3JAME 5EKIA 3C3LA 1GHKA 1WVLA 4AYBB 1EQTA 2JA5B 3BZDB 2RDFA 1BF4A 1Q1EA 4ID6A 3SK4A 4DAPA 3C2PA 2JA6B 2R3ZA 4CKEA 1ET6A 1OO9B 1SNPA 5KIXA 1H9SA 4CKCA 4Q5VA 1W6JA 1V43A 4A3GB 2AQ2B 5J1ZA 3PIO3 1X3QA 2D5DA 2CQAA 5C3EB 4C2MB 1L0YB 2NVTB 2B8FA 4IUPA 3P20A 4KKUA 2G9DA 3MEHA 2I07B 3MXGA 3AMUA 1WTVA 3S14B 2D9UA 1O78A 3MVVA 2Z4IA 2IX1A 1YNNC 1MI2A 1QB5D 1H9MA 2ZXRA 1F2MA 1NCVA 1B2TA 3S1NB 1K83B 1F2YA 3DM1A 1KDCA 1BCPB 1S5DD 3I91A 3VYTA 3HZXA 2BCOA 2WAQB 3VR5A 5DAUA 3GD7A 3IFTA 1BBXC 3J7AV 3RLFA 2N88A 3HGBA 1JWMD 4H13C 4PMBA 4XTCS 1SNCA 5EPJA 2NB0A 2EYLA 2FMCA 3SR1A 4QUCA 4RCNA 5D3DA 4IZ8A 1PFNA 2L55A 3OMGA 2K6AA 1G8ZD 2O5JC 2R61A 2QILA 3HOYB 1QNUA 4IUTA 2HDMA 5I2XA 4OHJA 3NQTA 2B2VC 1GUWA 2LKVA 1TQOA 1JE4A 1D1IA 1EZ6A 1KDAA 2KCCA 4I7ZC 1V1OA 1C48A 2K01A 4IUVA 2KEEA 5CBEE 3GV3A 3BDCA 5K5PA 4ABNA 1EY8A 4HSVA 2RDHA 3VR3A 1RDPD 3VYSA 5C0XG 1LTAD 2E2JB 2SDFA 2F0GA 1TIID 5KEEA 1SEBD 2HDLA 3PO3B 1FGBD 4RHRA 1NR4A 2NVQB 2F0EA 2F3WA 3M4YA 5IIFA 1BUVT 1OXVA 3S1RB 5DM73 1DOLA 2JA8B 5F2DA 1EU3A 1I4PA 3NQIA 5BN5A 4Q0FA 3A8IE 1SYGA 1QG7A 2HCCA 4WFN3 5I6WA 1LT6D 3K0YA 1F77A 3MC0B 5I2YA 1LO5D 1HQMC 1KABA 5ELFA 1HFGA 1MBYA 4F7XA 1A6XA 2KJXA 5ELEA 2DN8A 3KF8A 2A74C 2LY7A 1B9NA 4FVMA 3A7LA 4BA2I 2SOBA 1WD0A 2B8GA 3S1MB 4EQPA 4QB4A 5BN3A 5CMDA 3A56A 2VB2X 5DEHA 1CK1A 2EY1A 5IT9E 3RZOB 3QJYA 2A6HC 3HKZB 1QWYA 2V4DA 4BS9A 2PQEA 1STHA 3VR6A 5A2QL 1EFID 2B2TA 4N9TA 4HMJA 3VYUA 3D4DA 1TWCB 1O7LA 1SXTA 2K32A 3T13A 4B9WA 1KNEA 1TU2B 2IT1A 4FF4A 1SYCA 2L11A 2QEJC 1J8IA 2N55A 4PMWA 2QCPX 4FNFA 3TMEA 1STYA 2KCNA 1EEFD 1SE4A 4DK0A 1TT2A 1GUSA 2E76C 5FKAC 2DY7A 3J7YW 2FINB 4RWSC 2E2IB 1M8AA 3CRKC 3Q22A 1HFNA 1GUTA 1K8MA 1KNAA 5ELDA 3MA2B 4N9PA 1ENCA 4K6DA 2F0KA 2B2YC 1WTXA 3OWFA 2RA4A 5C5LA 3W2DA 1PTOC 3ZYYX 1MGSA 2HUGA 2J7ZA 4U673 1WTOA 3QWNA 4H0LC 3S17B 3Q23A 1E2WA 1D5ZC 4G7HC 1F9SA 3A8KE 1RCVD 1BO0A 2F0VA 4IUUA 3TDQA 5KYLA 1RODA 4NP5A 2A68C 5JAVA 2L12A 2LMCB 1PFMA 4KN4C 3S2HB 1QNKA 1J9OA 4MHEA 3OOCA 1L0XB 1HRJA 5IGGA 1FR3A 3A54A 1HA6A 3OWEB 4C3JB 1JQYD 3QB3A 1U4PA 1PTOD 4DAYA 3N6RA 3J7AF 2AWOA 3I4NB 1NSNS 1ICWA 2SNSA 2FHTA 2ICIA 1AP0A 1VCIA 2RSNA 5JOBA 2AUJD 4C3HB 1ZEQX 1Y8PB 1LTBD 2XVSA 4ZLTF 1I4XA 1VF7A 2E2DC 1AEXA 2R6GA 3TZUA 3OW7A 2R92B 1S4ZA 3IL8A 1JORA 3NK9A 4M1UB 2WP8J 3OIQA 4A93B 1GUOA 3MXUA 4DF7A 4K2LA 3GQBA 2F0PA 4A3DB 2F0JA 2B2VA 3SEBA 3QO2A 2EVBA 4DXFA 1LTRD 3VR4A 3MFGA 2IPKD 1EYCA 1Y69U 2F1MA 3SVMA 1HXYD 4V0BA 1DZ1A 1I4GA 3ERQA 4LK1C 5CORA 2Y0SB 1CQFA 3SK8A 1STNA 4FO2A 4IQZA 1VMPA 2RKSA 5DM63 2XIWA 1O7YA 3KLRA 1GXDC 2BA1A 4H44C 4ULLA 4ZQ3A 1ET9A 1ILQA 1HUMA 1PDQA 5T1IA 1D5MC 4B08A 1XX8A 3C46A 3Q0AA 3GTGB 2O4XA 1E2VA 2JA7B 4IURA 1U9RA 1C8CA 2K05A 1D2BA 1IL8A 2F0LA 1AW7A 1B1ZA 3BVMA 2AQ3B 1SJHD 1G2SA 4H7BA 3DEOA 3DEPA 3J81L 3X3NA 2IX0A 3F2UA 4WJWA 5AFWA 3V05A 5EKKA 2EDGA 2F0TA 4UDUC 2PW7A 4KY6A 3L7ZC 4E6IA 2OF1A 3R3OA 1BNZA 3S9WA 1LLRD 3DXJC 5C0XH 2KQ3A 1II3A 3MXNA 3J81E 4XT1B 2QDBA 1DOMA 4EGVA 5EGTA 2F03A 4HTHA 4IFDG 1SYDA 1GJXA 4WORA 5HURA 2D2CC 3NP8A 2NN6H 1F2LA 4KHZA 3MZ5A 1E0BA 4KKTA 2F0MA 4EQNA 3D3RA 4C3JG 2XRSD 2WKCA 4XQNA 5CR3A 4NMZA 3MWYW 1B53A 2R93B 3I90A 4HEDA 3M4OB 1UEAB 1MSHA 1SSOA 2J0TD 2R7ZB 5IGEA 3VYRA 1CHQD 3FDTA 1I4RA 1EIGA 4RKBA 1Y8NB 3H3VC 4KY5A 2H4OA 5J39A 1Y1VB 3MXPA 3R2TA 4KK7A 1PFBA 4O42A 2IX3A 5CYUA 5C3WA 1G291 1I4QA 3IKJA 1HA5A 2NBFA 4CGYB 3NWSA 1TS2A 2NWGA 5JPMC 3K59A 2B2YA 3KUPA 3GTMB 4BBSB 3K5OA 5IGCA 2AQ1B 5LL6S 4A3BB 2QF7A 2E75C 3FPPA 2ICEC 4KJNA 2B2WC 1JOKA 3HOXB 4V190 2WIIB 2F0IA 2TMPA 5EPLA 2VUMB 4QCLA 4FXKC 5C0XJ 2JP1A 2KOLA 1BOSA 3GV6A 1G2TA 3H94A 3MFYA 4OGQC 5D65A 3SHLA 1IKLA 1I6HB 2PZTA 4QMGA 4DU9A 2TSSA 4NW2A 2NVXB 2F0FA 1TR5A 3X3MA 3S1QB 5A35A 4P2CB 2A6EC 3DUZA 3G6JB 2F3VA 4L8JA 4HCSA 4O1NA 2RSOA 5D14A 2F0NA 1BDOA 1KAAA 2OT2A 1PXUA 4GZYC 4K5VA 3C1FA 3H09A 1HCZA 1RF2D 5FO9B 1NR2A 4G4KA 5ISRA 1ZKOA 4LJZC 3GTQB 3RZDB 1SNMA 4R8IA 3J80E 2B39A 3T53B 1A3TA 1E2ZA 2AWNA 3I4LA 3OSOA 3P7JA 3PMFA 2Z8LA 3P1HA 3BYYB 3DMUA 1SAPA 2NN6G 2KUMA 1SE3A 2BE5C 5CV7A 3SXHA 2A6ED 3CHBD 4XQJA 4FF3A 2JYOA 3OIPA 5C4HA 3URYA 3DWPA 1QJOA 1M4VA 1RKNA 1BXTA 2CW0D 4K14A 1CA5A 5CV9A 3QOLA 2FMMA 2EPBA 4JBWA 5IT9L 1S5ED 1GUNA 4XT3B 1JB3A 2WKDA 2NVYB 2M2LA 3ITPA 4ZAIA 3Q6SA 1CHPD 4JK1C 3T56B 4ZUIA 4DNTB 1F9RA 4A3FB 3K7AB 2CHBD 4A3EB 3I70A 4OO1G 4KY7A 2MP1A 1TVXA 5ELBA 4FYDA 4EVOA 3EA6A 1Q3LA 4DXGA 1R9TB 1AZPA 2BE5D 2NTSA 1IKMA 2EE1A 1IHZA 3DHQA 5E4WC 2LS01 3G7LA 2VXWA 3I3CA 1HQRD 3NE5B 4KMUC 5IGBA 1CTMA 3K57A 1FNUA 1LT5D 3SE0A 3TP7A 3GTLB 2JEBI 4TKOB 2EY2A 2GA4B 5M5YB 5C4JB 3PUZA 2MGSA 5K36G 2CVRA 4B9XA 1LABA 3W3AA 2VNUD 4RH6A 5E4XA 1SJED 4PV1C 3GTJB 4QF4A 1EZ8A 4RCOA 4X3UA 4F88A 3T51B 1TKWB 1IW7C 2X6LA 3K5LA 5E3FA 5CV6A 1SNQA 5M3MB 3O13A 2KEDA 4LAAA 1X32A 1CZGA 2FJ2A 4PQXA 1AFPA 1BR9A 1SE2A 4X3TA 1WTWA 1FNVA 4NKLA 5JJZA 2YYZA 1V8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L12 A;  1EOT A;  5D65 A;  2DY8 A;  1IKL A;  1PFM A;  1AZQ A;  1KNE A;  1DZ1 A;  1RTN A;  1U4R A;  1F9R A;  1E0B A;  1QNK A;  2B2T C;  2K03 A;  1RHP A;  4HSV A;  1J9O A;  5COR A;  4MHE A;  2NZ1 D;  3TZD A;  4NW2 A;  2L11 A;  4XDX A;  1HHV A;  1HRJ A;  1IKM A;  1MSG A;  2IL8 A;  1J8I A;  1DON A;  2MP1 A;  1TVX A;  2L1B A;  2N55 A;  3MWY W;  2B2U A;  4CJ2 C;  1VMP A;  1B53 A;  1PLF A;  2SDF A;  2XIW A;  1EIH A;  1WTV A;  1O7Y A;  3I90 A;  4HED A;  1Q3L A;  1HA6 A;  2KEC A;  4OIJ A;  1F9Q A;  2D9U A;  4LMQ D;  1U4L A;  1AZP A;  1LV9 A;  2HDL A;  1ILQ A;  1HUM A;  1G6Z A;  1B4O A;  1MSH A;  1PDQ A;  1NR4 A;  1EL0 A;  2B2U C;  1U4M A;  1U4P A;  4RA8 A;  4OIK A;  4X3K A;  2X69 A;  4HCS A;  2EE1 A;  1SSO A;  1SDF A;  2NYZ D;  2RSO A;  3H91 A;  5D14 A;  5T1I A;  3ONA B;  1MI2 A;  1DOL A;  1XX8 A;  3FDT A;  2L4N A;  5E4W C;  2BDN A;  4IUQ A;  1NCV A;  1EIG A;  2L9H A;  1ICW A;  4DN4 M;  3R93 A;  2FHT A;  1B2T A;  3G7L A;  2VXW A;  4IUR A;  1QG7 A;  3I3C A;  1AP0 A;  2HCC A;  3MTS A;  3KBX A;  2K05 A;  1NAP A;  2RSN A;  3DM1 A;  1C8C A;  3N52 A;  1IL8 A;  2DY7 A;  5EJW A;  1WTP A;  2RVL A;  4ZKC B;  3I91 A;  2FIN B;  1B3A A;  1PFB A;  5JJZ A;  4O42 A;  1G2S A;  1ZXT A;  4RWS C;  1NR2 A;  3DEO A;  1B50 A;  1G91 A;  3HP3 A;  1X3P A;  1M8A A;  1HUN A;  3DEP A;  1HFN A;  4R8I A;  2EOT A;  1HFG A;  1BBX C;  1KNA A;  2NWG A;  4R9W A;  3UI2 A;  3F2U A;  5AFW A;  2HCI A;  1QE6 A;  2B2Y A;  3KUP A;  4ZK9 B;  5EQ0 A;  3LWE A;  2Q8T A;  4ZLT F;  1WD1 A;  2B2W A;  2N88 A;  5EKI A;  3D6W A;  3P7J A;  5EPK A;  4U68 A;  5DNF A;  1WVL A;  1EQT A;  2MGS A;  2K28 A;  3IFD A;  1O80 A;  2CVR A;  1ESR A;  4X3S A;  1F9P A;  2MPM A;  2B2Y C;  5EPJ A;  1BF4 A;  1S4Z A;  1WTX A;  2B2W C;  1A15 A;  1SAP A;  2RA4 A;  3IL8 A;  5E4X A;  5CBA E;  1BNZ A;  2KUM A;  1RTO A;  1CM9 A;  4QUC A;  2FFK B;  1WTQ A;  2MJ8 A;  1WD0 A;  2R3Z A;  3TN2 A;  4ZKB B;  4X3U A;  2JYO A;  1MGS A;  4CJ1 B;  1PFN A;  1DOK A;  2HUG A;  2J7Z A;  1WTO A;  4XT1 B;  2H1E A;  1DOM A;  5CMD A;  1JIC A;  1O7Z A;  2B2V A;  5EPL A;  5T1G A;  2X6L A;  3QO2 A;  4CJ0 B;  1CA5 A;  1F9S A;  1ML0 D;  2FMM A;  2JP1 A;  2EPB A;  4MN3 A;  1X3Q A;  1XYI A;  2X6G A;  4IUT A;  2HDM A;  2KOL A;  1BO0 A;  2KED A;  2Q8R E;  2B2V C;  1GUW A;  4UAI A;  4XT3 B;  1ILP A;  2KVM A;  3GV6 A;  4RAU C;  1X32 A;  2FJ2 A;  1JE4 A;  3FPU B;  1WTR A;  4IUU A;  2M2L A;  1G2T A;  2K04 A;  2B2T A;  2K1B A;  1VMC A;  4X3T A;  4ZAI A;  2K01 A;  3Q6S A;  4IUV A;  1WTW A;  2KEE A;  4IUP A;  4HAE A;  4QUF A;  1ROD A;  3GV3 A;  1F2L A;  5CBE E;  3I8Z A;  1RJT A;  1CA6 A;  5COY A;  3SVM A; 
#chains in the Genus database with same CATH topology
 2DY8 A;  5FK9 C;  2UUB L;  2PZU A;  2EJM A;  3GO5 A;  4C3I B;  3E5S A;  1EYG A;  1N34 Q;  1IBL L;  4CJ2 C;  1PLF A;  1UNS A;  3ERS X;  4HID A;  1CKN A;  2N78 A;  4TSS A;  5CV8 A;  4JBK A;  3VA5 A;  1VQ8 A;  1YIT A;  1B4O A;  4HMI A;  1U4M A;  3CCU A;  2NYZ D;  1SDF A;  2K50 A;  1CQV A;  2VY3 A;  5G3L D;  4JI1 L;  3S17 H;  1VQ4 A;  4JI4 L;  3MXN B;  1IW7 D;  2WAQ E;  4KV6 A;  1FL0 A;  1YBY A;  1GVP A;  4KJO A;  3D6C A;  4B3R Q;  3MTS A;  5GQO A;  3JAM c;  4IFD H;  3A5Z B;  3G48 A;  5EJW A;  4NXM L;  3HOU B;  5C4Z A;  1B3A A;  1HZA A;  3VDY A;  1ZXT A;  3P75 A;  5JJK A;  1G91 A;  2PI2 A;  4C1N K;  4DV2 L;  4CHT B;  4LF8 L;  2PZW A;  2PNH A;  3S2H H;  4X64 L;  3NTI A;  2K33 A;  4PZ7 A;  1VQJ A;  2B2W A;  2F0U A;  1Y14 B;  3U58 A;  2N49 A;  5DNF A;  2IJ0 A;  3K58 A;  2UU9 Q;  4OWX B;  1O80 A;  1ESR A;  2B63 B;  1F9P A;  2EJG C;  1DYQ A;  4C3J H;  3CU7 A;  4DR5 Q;  1ONL A;  4DV5 Q;  4DFA A;  3M85 A;  3OW2 A;  1KQS A;  4BXX G;  4BA1 I;  2EY5 A;  4KD3 A;  3S15 B;  3I4N H;  2QEX A;  3KJP A;  2WAC A;  1VQK A;  1VDZ A;  4DR2 Q;  4OX9 L;  1W3S A;  1L1O C;  4DNR B;  4DV0 L;  1K3B C;  2Q8R E;  3EVQ A;  4Y7N B;  3EQL C;  2VQE L;  5I6Y A;  3F1Z A;  3K5M A;  1EOV A;  2ZJR A;  1Q86 C;  1EY9 A;  4C3H H;  5JEA G;  1T5E A;  3M3Y B;  4RHS A;  4A3E G;  1SNO A;  4ZRZ A;  2F0O A;  1RJT A;  5M9O A;  2HQE A;  2OQK A;  1U4R A;  4PMC A;  3OMC A;  2K5Q A;  1PH3 A;  5KNC A;  1RHP A;  1YIJ A;  5EAY A;  4LWC A;  3PIP 3;  1XMO L;  1A0I A;  2L1B A;  2R92 H;  5ELC A;  3M9B A;  3BG3 A;  1I3Q B;  4A93 H;  1PZK D;  5C0X I;  4OIJ A;  1E1O A;  2NUC A;  4ODG A;  1PTO B;  3Q8D A;  4IAL A;  1XTC D;  4A3D H;  2B2U C;  3EFX D;  4OON A;  5CGK A;  1IYV A;  5IGD A;  1VQN A;  2EQS A;  4L63 B;  1PZJ D;  3D4W A;  3WDN A;  4GKJ Q;  3JAM i;  3PV0 A;  1XNR Q;  1CT1 D;  1TS4 A;  4QY7 A;  3T1H Q;  3BDO A;  4CBV A;  4L6T B;  4BY7 B;  1Z47 A;  3ER0 A;  2L15 A;  3HEJ A;  1LYL A;  1NAP A;  1JC7 A;  1GOZ A;  2EXZ A;  5ELN A;  2M00 A;  4B3S L;  4JI6 Q;  1B50 A;  4JI3 Q;  2QW7 A;  3AEV A;  3KDF B;  1XPR A;  1X3P A;  1HUN A;  4IFD J;  4K5X A;  3IAY A;  2EXD A;  5C44 B;  4JYA L;  2KHJ A;  4QQB X;  1T5X D;  3D6W A;  1V1P A;  1Q7Y C;  1G51 A;  2K28 A;  1GUG A;  1GM5 A;  2Z6K C;  3FEW X;  3SK6 A;  3BVG A;  2UUA L;  1MD2 D;  1A15 A;  3CCV A;  5C4X B;  1RTO A;  1OXS C;  1QUQ B;  1JR0 D;  3QG1 A;  3K5N A;  1PMR A;  3HKZ E;  1UAP A;  2MJ8 A;  3OPO A;  1WTQ A;  3ULL A;  1EU4 A;  1PYW D;  4LF4 L;  2JXM B;  1H9J A;  4R4Q A;  3STB C;  1LT3 D;  3GTG H;  1XTD A;  4L5Q A;  5FJ8 H;  2K5W A;  3ND8 A;  2JA7 H;  2V1C C;  4JV5 Q;  1LT4 D;  3QOJ A;  2VL6 A;  4PZ8 A;  1HPC A;  3KF6 B;  3WOF A;  2Q2H A;  1PH7 A;  1SMY C;  1D6E C;  2OTJ A;  2KA7 A;  1I6V C;  4K8J A;  4B3M L;  1PTO F;  3W1B A;  1BCP C;  2K5D A;  4C1N I;  3RUZ A;  4KHV A;  1PRT C;  4K8I A;  1SFO B;  1C7Y A;  2XSC A;  4C3I G;  3I4O A;  3I8Z A;  4JVZ A;  5CV5 A;  1IYU A;  3ERO A;  1AZQ A;  4X65 L;  4AIM A;  1LTS D;  2Z1C A;  2DNE A;  1IBK Q;  3LGJ A;  1WTH A;  3PUV A;  4P73 A;  4A3C G;  1Q81 C;  1HHV A;  1HNW L;  4CDD C;  5JJI A;  1TWH B;  3TEH B;  3V2T A;  1EY4 A;  4WRD A;  3I2Z A;  2BA0 A;  1IYJ B;  1DJR D;  3DM3 A;  1F9Q A;  2EYP A;  4LMQ D;  4TQU S;  5BN4 A;  2EYJ A;  2XTI A;  1XWE A;  3NXW A;  1EL0 A;  2DJG C;  1A3V A;  1PYS B;  2L0C A;  1YJ9 A;  3STB D;  2XRQ D;  3CAM A;  2K52 A;  3HOU G;  3L9A X;  4LF7 Q;  1UE1 A;  1SMY D;  1UUP A;  3I72 A;  1JWS D;  2RVL A;  4XXE A;  4A3L G;  2KCM A;  1Q12 A;  1BCP D;  3Q24 A;  5KGU A;  1I4H A;  3NTH A;  1PRT D;  3A8J E;  3HP3 A;  4JBM A;  1ZYR C;  1EEI D;  2YU9 B;  5J22 A;  4GOP B;  4A3I B;  1EYA A;  1K28 A;  3TS0 A;  1XMQ Q;  2XWB B;  1QZH A;  4NXN Q;  2R93 H;  3W5O A;  3M4O H;  4EQO A;  1TWF B;  4X3S A;  5IT9 c;  4OO1 H;  4C3H G;  3ZJY C;  5LMU Q;  4FF1 A;  1FJG L;  3EN2 A;  5D3I B;  2R7Z H;  1SBB B;  1E24 A;  1LAC A;  1MIU A;  4Z9C B;  2EYO A;  1JCK B;  2QKI C;  4HIK A;  2Q2T A;  2EY6 A;  2O2L D;  1S5F D;  2PCF B;  2EYF A;  4JG2 A;  1C4Q A;  3I73 A;  2EZV A;  3UE0 A;  4DV1 L;  1HNZ L;  5M5X B;  1EQV A;  2R92 G;  3NTK A;  4DR7 Q;  2ALY B;  4DUY L;  5CC4 A;  3BS1 A;  1Y1V H;  2I46 A;  3VR2 A;  1PHJ A;  4UAI A;  2AUK A;  1HTP A;  3H6M A;  3QIA A;  1MJC A;  3FPU B;  1FNW A;  1JWU D;  4MIU A;  3CQZ B;  2JE6 I;  4O2D A;  2K1B A;  3GTO B;  1TWA B;  2IWH A;  2EYH A;  4HAE A;  1CA6 A;  1TY0 A;  3CCS A;  3PUW A;  1ZYR D;  2F0Q A;  3S2D B;  1O7I A;  3E6Z X;  3KLS X;  3GTM H;  4S3S A;  4BBS H;  2F0D A;  4A3B H;  3TZD A;  4HCE A;  1S5C D;  2C35 B;  2OWO A;  1I5F A;  4HJ5 A;  1PRT B;  3HOX H;  4RG1 A;  5K36 H;  3MHB A;  4P72 A;  4DAV A;  1Q8K A;  1XJV A;  1VQE A;  2K7V A;  2JEA I;  2X69 A;  1CKM A;  2Y0S G;  1KLU D;  2PO4 A;  3T1Y Q;  3K80 C;  4IOA A;  5IWA Q;  2E74 C;  2VUM H;  2WIN B;  4ALP A;  1WCM B;  2L9H A;  4TRD A;  4DN4 M;  3R93 A;  5LL6 X;  4KN7 C;  2N8N A;  2BDO A;  4BY1 B;  1CFM A;  1QUQ A;  1VQ9 A;  1K8O A;  3CRL C;  2O5I C;  1SYF A;  1A3U A;  1B8A A;  2OEO A;  5JJZ A;  5C44 G;  3I4M B;  1QVG A;  1EWH A;  1HJP A;  4FXG C;  3D4R A;  3GP7 A;  1I6H H;  1YNN D;  1STG A;  2JA7 G;  2EYM A;  1XNQ L;  1Q1B A;  4R9W A;  3UI2 A;  3DWA A;  2XWJ B;  1IBM Q;  2CW0 C;  2NVX H;  3J80 L;  1LM0 A;  3S16 B;  5C4X G;  1HNX Q;  2PPB C;  1OXU A;  3NPP A;  3S1Q H;  1NUC A;  2UXB Q;  2XN9 C;  4DR3 Q;  3AU7 A;  4DR6 L;  5JPN C;  2A19 A;  1K8A C;  3FVQ A;  1DD2 A;  1CM9 A;  4G7Z C;  5EKL A;  4XYQ A;  1CSQ A;  3PSI A;  1VQ5 A;  2BOS A;  4UP9 A;  2F4I A;  3U9O A;  4A3J B;  1A2T A;  1Z6H A;  1DOK A;  2XGT A;  1L1O A;  4DPG A;  1TS5 A;  3NSW A;  5IYC G;  4EQ5 A;  3HOV B;  1GO3 E;  4LFB Q;  5T1G A;  2ZM6 Q;  5KYI A;  2PNR C;  4KI0 A;  3R8B A;  1BCP F;  1EYD A;  4OXP A;  1PRT F;  4XQQ A;  2Y0S E;  1TY2 A;  3A55 A;  2VZA A;  4JOI C;  2LFN A;  4YIJ A;  1WFQ A;  3H15 A;  1EIY B;  1VMC A;  3GTQ H;  1VQI A;  1R4Q B;  3RZD H;  1VF5 C;  3QR8 A;  4B3T L;  3CCM A;  1ASZ A;  2MUY A;  5C6A A;  1NY4 A;  1RTN A;  1VQ7 A;  2K03 A;  1I94 L;  1X55 A;  2SEB D;  2NZ1 D;  1ENA A;  3LWU A;  2K5V A;  4XDX A;  3J7Z C;  2RBM A;  2UUC Q;  4XIG S;  1DON A;  2G9H D;  4AQY Q;  2B2U A;  1LTG D;  3PUX A;  2F0W A;  1CZW A;  4MZ9 A;  3RD4 A;  2HQL A;  4HIO A;  4JBJ A;  1U4L A;  2IHE A;  3UDX A;  3KLS A;  3TP8 A;  3KBG A;  1D5X C;  4RA8 A;  1LTI D;  1KLG D;  3H91 A;  5J3B A;  3D0F A;  3F2D A;  2CWP A;  3CD6 A;  1EY0 A;  3NHH A;  1BKB A;  5M5W B;  4FXD A;  4UHV A;  2BDN A;  4IUQ A;  3PCO B;  2A69 C;  1E7Z A;  1L2F A;  2C5C A;  3WOE A;  2D62 A;  3L3O C;  4JI8 L;  4KTA A;  1N32 L;  4DGZ A;  1OXT A;  4K5W A;  1HTL D;  4ZKC B;  2NVY H;  4NDX A;  4A3I G;  4GLV B;  3MAQ A;  4YY3 L;  3M7G A;  2UUB Q;  1PZI D;  4QIW B;  3BYT B;  4XYO A;  3J7A 5;  1AN8 A;  1B44 D;  5FLX L;  4A3F H;  3EJI A;  5JEA H;  3K7A H;  4RMF A;  1M90 C;  2Z6K A;  4A3E H;  5LMN Q;  2ZXO A;  1QE6 A;  5EQ0 A;  4G57 A;  1Y1V G;  1VQF A;  2EJF C;  3ND9 A;  4FDB A;  4UP8 A;  1YHB A;  3E0J A;  1HR0 Q;  1STA A;  2ID0 A;  1F2Z A;  3IFD A;  1MHW C;  4ZYS A;  2K75 A;  3H0G B;  4NPS A;  3C1E A;  2MPM A;  2ENB A;  1U5K A;  1R9T H;  4ILW A;  2KHI A;  5IGF A;  2N3S A;  1SYB A;  1X6O A;  5FLM G;  3ICE A;  1VQA A;  4JI4 Q;  5C5M A;  2IY5 B;  4HJ8 A;  5FLX E;  4PNY A;  1ENF A;  1Z9F A;  3HOZ B;  1X3E A;  1W6K A;  1YNJ C;  2SNM A;  5FOB B;  2RCN A;  5TSS A;  4CJ0 B;  4NXM Q;  1ML0 D;  5C3X A;  4QGU A;  2A69 D;  2Q8I B;  4UPA A;  4IFD I;  1H9K A;  2OXP A;  3HOX G;  4FF2 A;  1EY7 A;  4MNO A;  1JOQ A;  4G7O C;  1X56 A;  4C56 C;  4DV2 Q;  4X6A H;  1B9M A;  1ILP A;  4IJH A;  5A2Q E;  2KVM A;  4PG3 A;  3SDZ A;  3JC6 6;  3KK7 A;  2CQO A;  4L5T A;  3HRZ C;  3J81 j;  4F87 A;  2YV5 A;  4J6H A;  4J8Q A;  2NZH A;  5COY A;  3GTL H;  1X9N A;  5KNB A;  3FMC A;  2UXD L;  5KRU A;  2YTX A;  2ZTC A;  5C4J H;  1Q8I A;  1FD7 D;  1Q90 A;  4DV4 L;  2A6H D;  2IL8 A;  5JVG 3;  5E1F A;  3RMH A;  3GTJ H;  3RLO A;  1V1P B;  1Y1W B;  1LV9 A;  1G6Z A;  1S5B D;  2F3I A;  1JJC B;  2VB3 X;  5IOC A;  3T16 A;  4OIK A;  4X3K A;  1PA6 A;  2E2H B;  4IN3 A;  1Z7T A;  4OX9 Q;  3ONA B;  3CKI B;  2F0H A;  1YNJ D;  1KDB A;  5M3M H;  1JJ2 A;  1ASY A;  1DCZ A;  1UE5 A;  3I4M G;  2A1A A;  4I65 A;  1QIL A;  1A63 A;  3N52 A;  1T9H A;  4JI2 Q;  2WV6 D;  1M1K C;  3PO2 B;  1EY5 A;  3A7A B;  1EY6 A;  5IOD A;  2PMZ B;  3V96 A;  4P75 A;  3W1G A;  2F52 A;  2Z4H A;  3TP5 A;  3DLL A;  2GVA A;  5IYB G;  1SYE A;  1N8R C;  5FO8 B;  2I5H A;  2HCI A;  1D8L A;  4R4I A;  3J81 c;  4C3I H;  1WD1 A;  1H9R A;  5NUC A;  2HHH L;  4DV3 Q;  4DA2 A;  3BVZ A;  3BDL A;  4WJ4 A;  3HOW B;  4HN7 A;  4R8N A;  1XPO A;  5BR8 L;  5AJ3 Q;  3OHX C;  4A3J G;  1FYC A;  4OL7 A;  5JEA J;  3HG9 A;  5EBC A;  4A3C H;  2XNA C;  2QA4 A;  4RGM A;  1YJW A;  4OWT B;  3HOV G;  3TRZ A;  3FKI B;  1CI3 M;  3TN2 A;  4POF A;  1D7Q A;  3TP6 A;  4CJ1 B;  3TSS A;  4J1M A;  4IPC A;  4GNX C;  3R2I A;  2E8G A;  2HD3 A;  1N36 L;  5E7N A;  2BH2 A;  2X6G A;  1OTC A;  3CCJ A;  2QDL A;  3LX0 A;  3HOU H;  5IYD G;  4LUO A;  1KXL A;  4QUF A;  3PUY A;  1EWC A;  4A3L H;  1PVO A;  2Q2U A;  1EOT A;  1STE A;  3SK5 A;  4M8A A;  3CXC A;  1H9S B;  2ZT9 C;  4RGT A;  2AHO B;  3U9S A;  1JOO A;  3CF5 A;  3PF5 A;  1MSG A;  2B63 H;  3GTK B;  1C9O A;  2DNC A;  1EIH A;  5GAD C;  4I7A A;  4LFC L;  4LF4 Q;  4IUN A;  1H95 A;  4X62 L;  2M9V A;  1X3G A;  4A3F G;  4K0K Q;  1J6Q A;  3D31 A;  4RFB A;  1GHJ A;  3S15 H;  2A68 D;  4KHP L;  4DR1 L;  3AYH B;  2A8V A;  1YHA A;  4DR4 Q;  1Y8O B;  5CV4 A;  1A2U A;  2L5T A;  4YHH Q;  4CKB A;  2A5H A;  4RGO S;  1LTT D;  4ZUJ A;  4Y7N H;  3NEL A;  1P8L A;  2ZXP A;  4A4I A;  3TBI B;  1R4P B;  1HZC A;  4RKL A;  4LFA Q;  2A73 B;  3M7N A;  1QOH A;  3M3Y H;  4X65 Q;  1XXG A;  2MHV A;  3J81 i;  1B7Y B;  3VA7 A;  5JVH 3;  4R1J A;  3OYY A;  1N33 Q;  2EOT A;  3E3X A;  1WI5 A;  1HNW Q;  4FP5 D;  5I9O A;  2RDG A;  3LWE A;  2Q8T A;  5EPK A;  4U68 A;  2PYK A;  4F8M A;  5KND A;  2PI2 E;  2K5N A;  1I3Q H;  4KD4 A;  4DV7 Q;  5EBD A;  2JQO A;  2NTT A;  1PTO H;  3HOZ G;  3CP0 A;  2I0Q A;  3NWT A;  2NN6 I;  2FFK B;  2CH4 A;  5M3F B;  4HR7 B;  1DGS A;  4ZKB B;  1ESF A;  4IO9 A;  5FO7 B;  1DXM A;  2H1E A;  3DWQ A;  5HGQ A;  5LHY 1;  4GS3 A;  1JIC A;  1O7Z A;  4LF5 Q;  4BY7 H;  1XYI A;  4MN3 A;  3CCR A;  4JOI A;  2F0S A;  2C9O A;  3K6O A;  1TS3 A;  4RAU C;  2UU9 L;  1SND A;  1WTR A;  1X65 A;  5G3L F;  2RCF A;  2K04 A;  2K14 A;  1BQQ T;  4IOC A;  1RD9 D;  5CBA E;  4GNX B;  2IW3 A;  3NUC A;  5M3M G;  4DR5 L;  5C44 H;  2PW5 A;  4K6L A;  4QIW E;  2B2T C;  4DV5 L;  1I50 B;  2Z0S A;  4HSP A;  1Y1W G;  1FJG Q;  1QCB D;  3CCL A;  1STB A;  4BBR B;  4OO1 I;  1V9P A;  2JSO A;  1HH2 P;  3PGZ A;  5C4X H;  1PFS A;  5I9P A;  3GDE A;  3GTP B;  4DUZ L;  1V1Q A;  1LTL A;  2KEC A;  1OXX K;  1GD7 A;  4A3K B;  1PH2 A;  3HS0 C;  5HGT A;  3NBI A;  1TWG B;  4KKS A;  4BWG B;  2P5Z X;  1NNX A;  4O0A A;  2VQF Q;  5I4D A;  3D8G A;  2L4N A;  1KTK A;  3AB9 A;  2WB1 B;  1D1K A;  4ME5 A;  1L1O B;  4DK1 A;  3JAM L;  3J80 c;  5IYC H;  2RQX A;  1PH6 A;  3E0E A;  3NBH A;  3U50 C;  3KBX A;  4RGN A;  1PH5 A;  1WTP A;  1DM0 B;  3LNN A;  4A3M B;  1SFO H;  2VS1 A;  4K2K A;  3T4A C;  3FRP B;  2KHS A;  4GLA C;  2UXC Q;  4ZK9 B;  4J15 A;  5EKI A;  4X66 Q;  3JAM E;  3C3L A;  1GHK A;  1CSP A;  4GKJ L;  1WVL A;  1TWH H;  4AYB B;  1EQT A;  2JA5 B;  1XNR L;  3FKI G;  3BZD B;  2RDF A;  3T1H L;  1BF4 A;  1Q1E A;  3PF4 A;  1NBW A;  4ID6 A;  3SK4 A;  4P74 A;  2K4K A;  4DAP A;  4JI7 Q;  3C2P A;  3HFZ B;  2JA6 B;  2R3Z A;  4CKE A;  1ET6 A;  2MQH A;  1OO9 B;  1SNP A;  5KIX A;  1H9S A;  4CKC A;  4Q5V A;  1W6J A;  3B6Y A;  5ELO A;  1V43 A;  4A3G B;  3PIP A;  2AQ2 B;  4JI6 L;  4JI3 L;  2B63 G;  5J1Z A;  1JB7 A;  3PIO 3;  1X3Q A;  4R4C A;  3RNU A;  2D5D A;  1B3Q A;  2CQA A;  5C3E B;  4C2M B;  1VQH A;  1K8G A;  1HZ9 A;  1VQD A;  2D0O A;  1XNQ Q;  1L0Y B;  2NVT B;  2B3G A;  1K0S A;  2DUD A;  4L5R C;  2B8F A;  4HJA A;  4IUP A;  2R7D A;  2YU9 H;  4A3I H;  2JK8 A;  4GN3 B;  5H1S E;  3P20 A;  4KKU A;  2PMZ E;  2G9D A;  1J5E Q;  3MEH A;  2I07 B;  3MXG A;  1TWF H;  2R7F A;  4ZCK A;  2GN5 A;  4LW1 A;  1WTV A;  3AMU A;  4JV5 L;  3S14 B;  2D9U A;  1O78 A;  5HY6 A;  2ES2 A;  3MVV A;  2Z4I A;  4HJ7 A;  2IX1 A;  3J80 i;  5FLM H;  1YNN C;  2E5L Q;  1MI2 A;  3ULJ A;  1QB5 D;  1H9M A;  1S40 A;  2ZXR A;  5M5X H;  4HIM A;  4Y52 H;  2Z9H A;  4LF6 Q;  1F2M A;  1NCV A;  4DV6 L;  1B2T A;  1HZB A;  3S1N B;  1K83 B;  5IP9 G;  1F2Y A;  1IBK L;  3DM1 A;  1KDC A;  1VQM A;  1EUJ A;  1BCP B;  1S5D D;  3CQZ H;  3I91 A;  3VYT A;  3GTO H;  1TWA H;  3FP9 A;  3HZX A;  2BCO A;  1I94 Q;  2WAQ B;  3VR5 A;  5DAU A;  3S2D H;  3GD7 A;  4BY7 G;  3IFT A;  1BBX C;  3S24 A;  1VQL A;  3J7A V;  3RLF A;  2N88 A;  3HGB A;  1JWM D;  4H13 C;  1SRU A;  4PMB A;  4XTC S;  5M3F G;  1SNC A;  2KCT A;  5EPJ A;  2NB0 A;  2EYL A;  2FMC A;  4LF7 L;  4GNX A;  5GRO A;  3SR1 A;  4QUC A;  4RCN A;  5D3D A;  1C0A A;  4IZ8 A;  1WJJ A;  1PFN A;  2L55 A;  3OMG A;  2K6A A;  4JI8 Q;  1WCM H;  1G8Z D;  2O5J C;  2R61 A;  2FXQ A;  2Z6B A;  2QIL A;  1AH9 A;  3HOY B;  3KFU A;  4BY1 H;  1QNU A;  4IUT A;  2HDM A;  5I2X A;  2G5D A;  4YCU A;  4OHJ A;  3NQT A;  2B2V C;  1XMQ L;  1GUW A;  2LKV A;  2ATW A;  4NXN L;  1TQO A;  1JE4 A;  3I4M H;  1D1I A;  1EZ6 A;  1KDA A;  2KCC A;  4I7Z C;  1V1O A;  1KAW A;  1C48 A;  2K01 A;  4IUV A;  2KEE A;  5CBE E;  3GV3 A;  4JI5 Q;  3BDC A;  5K5P A;  4BBR G;  4ABN A;  2LSS A;  1NE3 A;  1EY8 A;  3S16 H;  4HSV A;  2RDH A;  3VR3 A;  1RDP D;  2OTL A;  5IYB H;  1JE5 A;  4CDC C;  1SMX A;  3OTO Q;  3VYS A;  4A3K G;  5C0X G;  3CMA A;  1LTA D;  2E2J B;  2OQ0 A;  2SDF A;  3NEN A;  4LF9 Q;  1NMG A;  1YZ6 A;  2F0G A;  1TII D;  3E9H A;  5KEE A;  1SEB D;  4DR7 L;  1EQQ A;  1KL9 A;  2HDL A;  3PO3 B;  2DGY A;  4GKK Q;  1FGB D;  4A3J H;  4RHR A;  1NR4 A;  2NVQ B;  2F0E A;  2F3W A;  3M4Y A;  1JMC A;  5IIF A;  1BUV T;  1OXV A;  3S1R B;  3HOV H;  5DM7 3;  1DOL A;  2JA8 B;  2ZJQ A;  2MO0 A;  1EU3 A;  1I4P A;  3NQI A;  5F2D A;  5BN5 A;  4Q0F A;  3A8I E;  3H3V H;  1SYG A;  1QG7 A;  4A3M G;  1G6P A;  2HCC A;  4WFN 3;  2JN4 A;  3UDF A;  5I6W A;  4YCV A;  1LT6 D;  3K0Y A;  1F77 A;  1X3F A;  3MC0 B;  5I2Y A;  5IP7 H;  1LO5 D;  2UXD Q;  1HQM C;  2HT1 A;  1K0R A;  1KAB A;  5ELF A;  5IYD H;  3MEF A;  4AYB G;  2JA5 G;  1HFG A;  1EIF A;  4JI0 Q;  1MBY A;  3E9I A;  4F7X A;  3L2P A;  4DK3 C;  3T1Y L;  2RF4 A;  1A6X A;  5IWA L;  4MTN A;  2KJX A;  1IXR A;  3UDI A;  1E3P A;  5ELE A;  2DN8 A;  3KF8 A;  2A74 C;  4YWK A;  2LY7 A;  1B9N A;  3M4P A;  4FVM A;  2CCZ A;  4A3G G;  1A8V A;  3A7L A;  4BA2 I;  2SOB A;  1WD0 A;  4LUV A;  2B8G A;  1VQO A;  2D0P A;  3S1M B;  1S3O A;  4EQP A;  5M5W H;  4QB4 A;  5BN3 A;  5CMD A;  1IBL Q;  5C3E G;  3A56 A;  2VB2 X;  5DEH A;  1CK1 A;  2EY1 A;  5IT9 E;  1KC8 C;  1SN8 A;  3QJY A;  3RZO B;  2A6H C;  4IPH A;  1IBM L;  3HKZ B;  1QWY A;  2V4D A;  4BS9 A;  2YTV A;  1HNX L;  2PQE A;  4GLX A;  1STH A;  3VR6 A;  4JI1 Q;  4YWM A;  2UXB L;  5A2Q L;  1EFI D;  1VQP A;  2B2T A;  4N9T A;  4HMJ A;  5IE8 A;  3VYU A;  3D4D A;  1TWC B;  2HHH Q;  1EQR A;  1O7L A;  3RR5 A;  1SXT A;  2K32 A;  3T13 A;  4B9W A;  1KNE A;  3CCQ A;  1TU2 B;  2IT1 A;  4FF4 A;  1SYC A;  2L11 A;  3H0G H;  2QEJ C;  1J8I A;  4LFB L;  2N55 A;  4PMW A;  1K3R A;  4LF8 Q;  4X64 Q;  4FNF A;  1NMF A;  2QCP X;  3TME A;  1STY A;  3HOZ H;  1VQ6 A;  2KCN A;  1EEF D;  1SE4 A;  4DK0 A;  2HIV A;  1TT2 A;  3L0O A;  1GUS A;  1UE7 A;  2E76 C;  1VQG A;  5FKA C;  2DY7 A;  1BBU A;  3J7Y W;  1PH4 A;  2FIN B;  2UUC L;  1NJI C;  4AQY L;  4RWS C;  1WCM G;  2PQA A;  2E2I B;  1EWI A;  1M8A A;  3CRK C;  3Q22 A;  3TRE A;  1HFN A;  4GN4 B;  2MFI A;  1GUT A;  1K8M A;  1KNA A;  4BY1 G;  4DV0 Q;  2QGQ A;  4LFC Q;  5ELD A;  3MA2 B;  4N9P A;  2VQE Q;  1ENC A;  1KRS A;  4K6D A;  4NB3 A;  3WWV A;  3G4S A;  2F0K A;  2B2Y C;  2IHF A;  1WTX A;  1Y1W H;  3OWF A;  2RA4 A;  3A0J A;  5C5L A;  1B70 B;  2MO1 A;  3W2D A;  2E2H H;  1PTO C;  3ZYY X;  3HOY G;  4YWL A;  1PH8 A;  1VQB A;  1RL2 A;  1MGS A;  1N9W A;  2HUG A;  2J7Z A;  4U67 3;  1WTO A;  3QWN A;  4H0L C;  1YEZ A;  1W2B A;  3S17 B;  3Q23 A;  1XMO Q;  2F4V L;  1E2W A;  1D5Z C;  4G7H C;  1F9S A;  3A8K E;  5LMN L;  1RCV D;  1BO0 A;  3PO2 H;  1SRO A;  2F0V A;  1HR0 L;  4IUU A;  3NBH B;  3TDQ A;  1YI2 A;  2KEN A;  5KYL A;  1K73 C;  1ROD A;  4NP5 A;  4DKA C;  3RLN A;  3KJO A;  1RIP A;  2A68 C;  5JAV A;  2L12 A;  2LMC B;  1PFM A;  2LXJ A;  4KN4 C;  3S2H B;  1QNK A;  4GN5 A;  1J9O A;  4MHE A;  3HOW H;  3OOC A;  1L0X B;  1HRJ A;  3PO3 G;  5IP7 G;  1UWV A;  5IGG A;  1FR3 A;  3A54 A;  4B3S Q;  3G6E A;  1HA6 A;  1AE3 A;  3OWE B;  2JA8 G;  4C3J B;  3FKI H;  1JQY D;  3QB3 A;  1U4P A;  1PTO D;  4JYA Q;  4DAY A;  3N6R A;  3J7A F;  2AWO A;  1ICF B;  3I4N B;  1NSN S;  1ICW A;  2SNS A;  1QZG A;  2FHT A;  2ICI A;  2UUA Q;  1AP0 A;  1VCI A;  2RSN A;  5JOB A;  4PZ6 A;  5GAG C;  3I7F A;  1PV4 A;  1YJN A;  1CKO A;  2AUJ D;  3SGI A;  4C3H B;  1ZEQ X;  1Y8P B;  1LTB D;  2XVS A;  4ZLT F;  1I4X A;  1VF7 A;  2E2D C;  2LXK A;  2ZTE A;  1AEX A;  3TS2 A;  4DUZ Q;  3GTK H;  4B3M Q;  1E22 A;  3I55 A;  2R6G A;  3TZU A;  3OW7 A;  2R92 B;  1S4Z A;  3IL8 A;  1JOR A;  3NK9 A;  1L0W A;  4M1U B;  2WP8 J;  3OIQ A;  1N34 L;  4A93 B;  1GUO A;  3MXU A;  3UDG A;  4DF7 A;  4JI2 L;  4K2L A;  3GQB A;  2H5X A;  2F0P A;  4A3D B;  2F0J A;  4QL5 A;  3HKZ G;  3H0G G;  2B2V A;  3CC2 A;  3SEB A;  3QO2 A;  2Q2I A;  2EVB A;  4DXF A;  1LTR D;  3VR4 A;  4DK6 C;  4DV3 L;  3MFG A;  2IPK D;  5IP9 H;  1EYC A;  1BBW A;  3CC7 A;  5AJ3 L;  1Y69 U;  4B3R L;  4OEL B;  2F1M A;  2WFW A;  2AMC B;  3SVM A;  1HXY D;  4V0B A;  1DZ1 A;  1I4G A;  3ERQ A;  4LK1 C;  4GOP C;  5COR A;  2Y0S B;  1CQF A;  3SK8 A;  3AFP A;  4WJ3 M;  2ZTD A;  1VQC A;  2CH4 W;  2RHQ B;  1STN A;  4FO2 A;  4IQZ A;  1VMP A;  1NTG A;  2RKS A;  2HIX A;  2XIW A;  5DM6 3;  1O7Y A;  3G71 A;  3KLR A;  1GXD C;  2BA1 A;  4H44 C;  4ULL A;  4ZQ3 A;  1ET9 A;  5M3F H;  1ILQ A;  1HUM A;  1PDQ A;  5T1I A;  1D5M C;  4B08 A;  2EIF A;  1XX8 A;  3C46 A;  3Q0A A;  3GTG B;  4AH6 A;  3BU2 A;  2O4X A;  1E2V A;  3K8A A;  4A76 A;  3CC4 A;  2JA7 B;  4QJF A;  4IUR A;  1U9R A;  1C8C A;  2K05 A;  1D2B A;  1IL8 A;  4DR2 L;  2F0L A;  1PYB A;  1KIX A;  1AW7 A;  1B1Z A;  3BVM A;  2AQ3 B;  1SJH D;  1TXY A;  1G2S A;  4H7B A;  3DEO A;  3KLW A;  4OWW B;  4IPD A;  1UEB A;  4DV1 Q;  1HNZ Q;  1JJG A;  3DEP A;  2ASB A;  3J81 L;  3X3N A;  2IX0 A;  4DUY Q;  4K0K L;  3F2U A;  4WJW A;  5AFW A;  1I50 H;  3V05 A;  2CKZ B;  1SR3 A;  1K9M C;  3PO2 G;  3AFQ A;  5EKK A;  2EDG A;  2F0T A;  4BBR H;  4UDU C;  1KD1 C;  2PW7 A;  1SLJ A;  4KY6 A;  3L7Z C;  4DR4 L;  3GTP H;  4E6I A;  4YHH L;  2OF1 A;  3R3O A;  1BNZ A;  3S9W A;  1LLR D;  3DXJ C;  4A3K H;  5C0X H;  3ULP A;  2KQ3 A;  1II3 A;  1TWG H;  4DV6 Q;  4LFA L;  3MXN A;  3J81 E;  4CDE C;  1IZ6 A;  3NEM A;  3K0X A;  3TQY A;  5IY0 A;  4APV A;  4XT1 B;  3HOW G;  2QDB A;  1DOM A;  1X54 A;  4EGV A;  5EGT A;  3A74 A;  2F03 A;  4HTH A;  1N33 L;  4IFD G;  1SYD A;  1GJX A;  2VW9 A;  4WOR A;  3K7U C;  4A3M H;  5HUR A;  2D2C C;  3NP8 A;  4DV7 L;  2NN6 H;  1F2L A;  4KHZ A;  3M4Q A;  3MZ5 A;  2GVB A;  3KOJ A;  1E0B A;  4KKT A;  5GAH C;  2F0M A;  4EQN A;  1Q46 A;  1A62 A;  2JA5 H;  3D3R A;  4C3J G;  2XRS D;  2WKC A;  4XQN A;  5CR3 A;  4LF5 L;  4NMZ A;  3MWY W;  1B53 A;  2R93 B;  2RHS B;  3I90 A;  4HED A;  3M4O B;  4TVA B;  4IJL A;  2JA6 H;  1UEA B;  1MSH A;  3KF8 B;  3I4N G;  1SSO A;  2J0T D;  2R7Z B;  5IGE A;  2NZO A;  4A3G H;  4MTK A;  3VYR A;  1CHQ D;  3FDT A;  3AQQ A;  1I4R A;  1JT8 A;  1EIG A;  4RKB A;  1BVS A;  4DR6 Q;  1Y8N B;  3H3V C;  5C3E H;  4C2M H;  4KY5 A;  2MNA A;  2H4O A;  4CDF C;  5J39 A;  1Y1V B;  1PH9 A;  1UE6 A;  3MXP A;  1MKH A;  3R2T A;  4KK7 A;  2NVT H;  1PFB A;  2OCE A;  4O42 A;  2I5L X;  1U0L A;  2IX3 A;  5CYU A;  4N8X 1;  5C3W A;  1G29 1;  1I4Q A;  3IKJ A;  1HA5 A;  2NBF A;  4CGY B;  3NWS A;  1TS2 A;  2NWG A;  4R4O A;  5FLX c;  5JPM C;  3K59 A;  2B2Y A;  3KUP A;  3A5U A;  3CME A;  2BH8 A;  3GTM B;  4BBS B;  3K5O A;  3PQI A;  2VQF L;  5IGC A;  4A93 G;  2AQ1 B;  5LL6 S;  4A3B B;  5DLQ E;  3BJU A;  1EFW A;  2QF7 A;  2E75 C;  3FPP A;  2ICE C;  4A3D G;  4KJN A;  3S14 H;  4B3T Q;  2B2W C;  1JOK A;  3IRB A;  3F2C A;  3HOX B;  4V19 0;  4H02 A;  4OEM B;  3UE1 A;  2WII B;  2F0I A;  4JCV E;  3I56 A;  2TMP A;  4KLK A;  5EPL A;  3H3V I;  2VUM B;  3F8T A;  3S1N H;  1K83 H;  4FXK C;  4QCL A;  5C0X J;  4POG A;  2AKW B;  2JP1 A;  1S72 A;  2KOL A;  1BOS A;  2UXC L;  4X66 L;  3KDF A;  3GV6 A;  3RN5 A;  1YVC A;  1G2T A;  3H94 A;  3MFY A;  1PH1 A;  1SE8 A;  5JJL A;  1XPU A;  4OGQ C;  4JI7 L;  4EX5 A;  5D65 A;  3SHL A;  1IKL A;  1I6H B;  2PZT A;  4QMG A;  4DU9 A;  2PQA B;  2TSS A;  1N32 Q;  4NW2 A;  2NVX B;  2F0F A;  1TR5 A;  3X3M A;  4YY3 Q;  1QVC A;  3FHW A;  1QVF A;  3S1Q B;  5A35 A;  4P2C B;  4DAM A;  2A6E C;  3DUZ A;  3EIV A;  3G6J B;  2F3V A;  5FJ8 G;  4L8J A;  4HCS A;  4O1N A;  2RSO A;  5D14 A;  2JA9 A;  3U4V A;  2F0N A;  1Q82 C;  3KF6 A;  5LMU L;  1BDO A;  3HOY H;  4JPB W;  1KAA A;  4IPG A;  2OT2 A;  1PXU A;  3CCE A;  1J5E L;  4LUZ A;  4GZY C;  4K5V A;  3C1F A;  3H09 A;  4A75 A;  1HCZ A;  1RF2 D;  2CFM A;  5FO9 B;  1CKN B;  3BZC A;  1NR2 A;  4G4K A;  5ISR A;  1ZKO A;  2WB1 G;  4LJZ C;  4YCW A;  3RZD B;  3GTQ B;  1SNM A;  4R8I A;  3PIO A;  4L5S A;  4UP7 A;  3J80 E;  2B39 A;  3T53 B;  1A3T A;  2E5L L;  1E2Z A;  2AWN A;  3I4L A;  3OSO A;  3P7J A;  3PMF A;  2Z8L A;  2E2J H;  2K5H A;  3P1H A;  4LF6 L;  3BYY B;  3DMU A;  3BZK A;  1SAP A;  2NN6 G;  3PO3 H;  2KUM A;  4P71 A;  2NVQ H;  1SE3 A;  2BE5 C;  5CV7 A;  1WOC A;  3SXH A;  2A6E D;  3CHB D;  3S1R H;  4XQJ A;  4FF3 A;  2JYO A;  3OIP A;  5C4H A;  2JA8 H;  4R4T A;  3DWP A;  1QJO A;  3URY A;  1M4V A;  1RKN A;  3F2B A;  1BXT A;  4DV4 Q;  1AE2 A;  3U4Z A;  2CW0 D;  4K14 A;  1CA5 A;  5CV9 A;  3QOL A;  4N8F A;  2FMM A;  2EPB A;  4DAY B;  4JBW A;  4UY8 C;  3K81 C;  5IT9 L;  1S5E D;  2JA6 G;  1GUN A;  4XT3 B;  1JB3 A;  1VS0 A;  2WKD A;  2NVY B;  4GOP A;  2M2L A;  5GAE C;  1WYD A;  4HJ9 A;  1LUZ A;  3ITP A;  1CUK A;  3KYH C;  4ZAI A;  3Q6S A;  4DNI A;  1CHP D;  4JK1 C;  2I5M X;  3T56 B;  4ZUI A;  4DNT B;  1F9R A;  4A3F B;  2ZJP A;  4JC0 A;  4BXX H;  2R93 G;  3K7A B;  2CHB D;  2CWA A;  4A3E B;  3I70 A;  4OO1 G;  4KY7 A;  2MP1 A;  1TVX A;  5ELB A;  4FYD A;  2R7Z G;  4EVO A;  2WB1 E;  3EA6 A;  1Q3L A;  4DXG A;  1R9T B;  3CPF A;  1AZP A;  1YNX A;  2BE5 D;  2F4V Q;  1KRT A;  4DR3 L;  1GKH A;  3S1M H;  2NTS A;  1IKM A;  2EE1 A;  1IHZ A;  3DHQ A;  5E4W C;  2JJQ A;  5BR8 Q;  3RZO H;  2KBN A;  4JI5 L;  2LS0 1;  3CW2 C;  3G7L A;  3EBE A;  2VXW A;  2YTY A;  1KHI A;  3I3C A;  1HQR D;  3NE5 B;  2ZM6 L;  5L37 A;  4KMU C;  5IGB A;  3OTO L;  4AYB E;  1CTM A;  1MJE A;  3RN2 A;  4LF9 L;  1P16 A;  1TWC H;  3K57 A;  1FNU A;  1LT5 D;  3SE0 A;  4BBS G;  4JW0 A;  1N36 Q;  1YHQ A;  4A3B G;  3TP7 A;  4GKK L;  3GTL B;  1FGU A;  2JEB I;  4TKO B;  2EY2 A;  2GA4 B;  5M5Y B;  3HKS A;  5C4J B;  3PUZ A;  1E1T A;  2MGS A;  5K36 G;  2CVR A;  4B9X A;  1LAB A;  2WAQ G;  3W3A A;  2VNU D;  4RH6 A;  5E4X A;  1SJE D;  2B29 A;  4PV1 C;  3GTJ B;  1IL2 A;  2VUM G;  4QF4 A;  1EZ8 A;  4RCO A;  4X3U A;  3T51 B;  4F88 A;  1TKW B;  5M5Y H;  1IW7 C;  2X6L A;  3K5L A;  5E3F A;  5CV6 A;  5LMN W;  1SNQ A;  5M3M B;  4JI0 L;  4X62 Q;  1HR0 W;  3O13 A;  2KED A;  4ME3 A;  4LAA A;  4LNQ A;  1X32 A;  1CZG A;  2FJ2 A;  4PQX A;  1AFP A;  4KHP Q;  4DR1 Q;  1BR9 A;  1SE2 A;  2E2I H;  4X3T A;  1WTW A;  1FNV A;  1FVI A;  2DJF C;  4NKL A;  3CPW A;  2J4X A;  2YYZ A;  1V8Q A; 
#chains in the Genus database with same CATH homology
 2DY8 A;  5FK9 C;  2PZU A;  2EJM A;  3GO5 A;  4C3I B;  3E5S A;  4CJ2 C;  1PLF A;  1UNS A;  4TSS A;  5CV8 A;  3VA5 A;  1B4O A;  4HMI A;  1U4M A;  2NYZ D;  1SDF A;  1CQV A;  5G3L D;  1IW7 D;  4KV6 A;  4KJO A;  3D6C A;  3MTS A;  4IFD H;  5EJW A;  3HOU B;  5C4Z A;  1B3A A;  1ZXT A;  3P75 A;  1G91 A;  4C1N K;  4CHT B;  2PZW A;  3NTI A;  2K33 A;  2B2W A;  2F0U A;  5DNF A;  2IJ0 A;  3K58 A;  1O80 A;  1ESR A;  2B63 B;  1F9P A;  2EJG C;  1DYQ A;  3CU7 A;  1ONL A;  4DFA A;  3M85 A;  4BA1 I;  2EY5 A;  4KD3 A;  3S15 B;  2WAC A;  1VDZ A;  4DNR B;  2Q8R E;  3EVQ A;  4Y7N B;  3EQL C;  5I6Y A;  3K5M A;  1EY9 A;  5JEA G;  1T5E A;  3M3Y B;  4RHS A;  1SNO A;  4ZRZ A;  2F0O A;  1RJT A;  5M9O A;  2HQE A;  1U4R A;  4PMC A;  3OMC A;  2K5Q A;  5KNC A;  1RHP A;  3PIP 3;  2L1B A;  5ELC A;  3BG3 A;  1I3Q B;  1PZK D;  5C0X I;  4OIJ A;  4ODG A;  2NUC A;  1PTO B;  4IAL A;  1XTC D;  2B2U C;  3EFX D;  5CGK A;  1IYV A;  5IGD A;  4L63 B;  1PZJ D;  3D4W A;  3WDN A;  3PV0 A;  1CT1 D;  1TS4 A;  3BDO A;  4CBV A;  4L6T B;  4BY7 B;  1Z47 A;  3HEJ A;  1NAP A;  1JC7 A;  1GOZ A;  2EXZ A;  2M00 A;  1B50 A;  1X3P A;  1HUN A;  4IFD J;  4K5X A;  3IAY A;  5C44 B;  1T5X D;  3D6W A;  1V1P A;  2K28 A;  1GUG A;  3FEW X;  3SK6 A;  3BVG A;  1MD2 D;  1A15 A;  5C4X B;  1RTO A;  1OXS C;  1JR0 D;  3QG1 A;  3K5N A;  1PMR A;  1WTQ A;  1UAP A;  2MJ8 A;  3OPO A;  1EU4 A;  1PYW D;  2JXM B;  1H9J A;  1LT3 D;  2K5W A;  3ND8 A;  1LT4 D;  3QOJ A;  1HPC A;  3WOF A;  1SMY C;  1D6E C;  2KA7 A;  1I6V C;  4K8J A;  1PTO F;  1BCP C;  2K5D A;  4C1N I;  3RUZ A;  4KHV A;  1PRT C;  4K8I A;  1SFO B;  2XSC A;  4C3I G;  3I8Z A;  5CV5 A;  1IYU A;  3ERO A;  1AZQ A;  1LTS D;  2Z1C A;  2DNE A;  3PUV A;  1HHV A;  1TWH B;  3V2T A;  1EY4 A;  4WRD A;  2BA0 A;  1DJR D;  1F9Q A;  2EYP A;  4LMQ D;  4TQU S;  5BN4 A;  2EYJ A;  3NXW A;  1XWE A;  1EL0 A;  1A3V A;  2L0C A;  2XRQ D;  3L9A X;  1SMY D;  1UUP A;  3I72 A;  1JWS D;  2RVL A;  4XXE A;  1Q12 A;  1BCP D;  3Q24 A;  5KGU A;  1I4H A;  3NTH A;  1PRT D;  3A8J E;  3HP3 A;  1ZYR C;  1EEI D;  2YU9 B;  5J22 A;  4A3I B;  1EYA A;  2XWB B;  4EQO A;  1TWF B;  4X3S A;  4OO1 H;  4C3H G;  4FF1 A;  5D3I B;  1SBB B;  1LAC A;  4Z9C B;  2EYO A;  1JCK B;  2QKI C;  2EY6 A;  2O2L D;  1S5F D;  2PCF B;  2EYF A;  1C4Q A;  3I73 A;  2EZV A;  5M5X B;  1EQV A;  3NTK A;  5CC4 A;  3BS1 A;  2I46 A;  3VR2 A;  4UAI A;  2AUK A;  1HTP A;  3H6M A;  3QIA A;  3FPU B;  1FNW A;  1JWU D;  4MIU A;  3CQZ B;  2JE6 I;  2K1B A;  3GTO B;  1TWA B;  2IWH A;  2EYH A;  4HAE A;  1CA6 A;  1TY0 A;  3PUW A;  1ZYR D;  2F0Q A;  3S2D B;  3E6Z X;  3KLS X;  4S3S A;  2F0D A;  3TZD A;  4HCE A;  1S5C D;  1PRT B;  5K36 H;  3MHB A;  4DAV A;  2K7V A;  2JEA I;  2X69 A;  1KLU D;  2PO4 A;  2E74 C;  2WIN B;  1WCM B;  4TRD A;  4DN4 M;  2L9H A;  3R93 A;  5LL6 X;  4KN7 C;  2BDO A;  4BY1 B;  1CFM A;  1K8O A;  3CRL C;  2O5I C;  1SYF A;  1A3U A;  2OEO A;  3I4M B;  1EWH A;  4FXG C;  3D4R A;  3GP7 A;  1YNN D;  1STG A;  2EYM A;  1Q1B A;  4R9W A;  3UI2 A;  3DWA A;  2XWJ B;  2CW0 C;  3J80 L;  3S16 B;  2PPB C;  1OXU A;  3NPP A;  1NUC A;  2XN9 C;  3AU7 A;  5JPN C;  3FVQ A;  1DD2 A;  1CM9 A;  4G7Z C;  5EKL A;  4XYQ A;  2BOS A;  2F4I A;  3U9O A;  4A3J B;  1A2T A;  1Z6H A;  1DOK A;  1TS5 A;  3NSW A;  3HOV B;  5T1G A;  5KYI A;  2PNR C;  4KI0 A;  3R8B A;  1BCP F;  1EYD A;  1PRT F;  4XQQ A;  1TY2 A;  3A55 A;  2LFN A;  4YIJ A;  1VMC A;  1R4Q B;  1VF5 C;  2MUY A;  5C6A A;  1RTN A;  2K03 A;  2SEB D;  2NZ1 D;  1ENA A;  3LWU A;  4XDX A;  2RBM A;  4XIG S;  1DON A;  2G9H D;  2B2U A;  1LTG D;  3PUX A;  2F0W A;  1CZW A;  3RD4 A;  1U4L A;  3KLS A;  3TP8 A;  3KBG A;  1D5X C;  4RA8 A;  1LTI D;  1KLG D;  3H91 A;  1EY0 A;  3NHH A;  5M5W B;  4FXD A;  2BDN A;  4IUQ A;  2A69 C;  2C5C A;  3WOE A;  2D62 A;  3L3O C;  4KTA A;  4DGZ A;  1OXT A;  4K5W A;  1HTL D;  4ZKC B;  4NDX A;  3MAQ A;  3M7G A;  1PZI D;  4QIW B;  3BYT B;  4XYO A;  1AN8 A;  1B44 D;  5FLX L;  3EJI A;  5JEA H;  2ZXO A;  1QE6 A;  5EQ0 A;  4G57 A;  3ND9 A;  2EJF C;  3E0J A;  1STA A;  2ID0 A;  1F2Z A;  3IFD A;  4ZYS A;  3H0G B;  3C1E A;  2MPM A;  2ENB A;  4ILW A;  5IGF A;  1SYB A;  5C5M A;  5FLX E;  4PNY A;  1ENF A;  3HOZ B;  1YNJ C;  1W6K A;  2SNM A;  5FOB B;  5TSS A;  4CJ0 B;  1ML0 D;  5C3X A;  2A69 D;  2Q8I B;  4IFD I;  1H9K A;  2OXP A;  4FF2 A;  1EY7 A;  1JOQ A;  4G7O C;  4C56 C;  1B9M A;  1ILP A;  5A2Q E;  2KVM A;  3SDZ A;  2J4X A;  3KK7 A;  3HRZ C;  4F87 A;  4J6H A;  4J8Q A;  5COY A;  5KNB A;  3FMC A;  5KRU A;  1Q8I A;  1FD7 D;  1Q90 A;  2A6H D;  2IL8 A;  5JVG 3;  5E1F A;  3RMH A;  1V1P B;  1Y1W B;  1LV9 A;  1G6Z A;  1S5B D;  5IOC A;  2VB3 X;  3T16 A;  4OIK A;  4X3K A;  2E2H B;  4IN3 A;  1Z7T A;  3ONA B;  3CKI B;  2F0H A;  1YNJ D;  1KDB A;  1DCZ A;  4I65 A;  1QIL A;  3N52 A;  2WV6 D;  3PO2 B;  1EY5 A;  3A7A B;  1EY6 A;  5IOD A;  2PMZ B;  3V96 A;  2Z4H A;  3TP5 A;  1SYE A;  5FO8 B;  2HCI A;  1WD1 A;  1H9R A;  5NUC A;  4DA2 A;  3BVZ A;  3BDL A;  3HOW B;  4HN7 A;  4R8N A;  3OHX C;  1FYC A;  4OL7 A;  5JEA J;  3HG9 A;  5EBC A;  2XNA C;  4RGM A;  3FKI B;  1CI3 M;  3TN2 A;  3TP6 A;  4CJ1 B;  3TSS A;  4J1M A;  3R2I A;  2X6G A;  3LX0 A;  4QUF A;  3PUY A;  1EWC A;  1EOT A;  1STE A;  3SK5 A;  4M8A A;  1H9S B;  2ZT9 C;  4RGT A;  3U9S A;  1JOO A;  1MSG A;  3GTK B;  2DNC A;  1EIH A;  4IUN A;  2M9V A;  3D31 A;  4RFB A;  1GHJ A;  2A68 D;  1Y8O B;  5CV4 A;  1A2U A;  2L5T A;  4CKB A;  2A5H A;  4RGO S;  1LTT D;  4ZUJ A;  2ZXP A;  3TBI B;  1R4P B;  4RKL A;  2A73 B;  3M7N A;  1QOH A;  1XXG A;  2MHV A;  3VA7 A;  5JVH 3;  2EOT A;  4FP5 D;  5I9O A;  2RDG A;  3LWE A;  2Q8T A;  5EPK A;  4U68 A;  2PYK A;  4F8M A;  5KND A;  4KD4 A;  5EBD A;  2NTT A;  1PTO H;  3NWT A;  2NN6 I;  2FFK B;  5M3F B;  4HR7 B;  4ZKB B;  1ESF A;  5FO7 B;  1DXM A;  2H1E A;  3DWQ A;  5LHY 1;  1JIC A;  1O7Z A;  1XYI A;  4MN3 A;  2F0S A;  2C9O A;  3K6O A;  1TS3 A;  4RAU C;  1SND A;  1WTR A;  5G3L F;  2K04 A;  1BQQ T;  1RD9 D;  5CBA E;  2IW3 A;  3NUC A;  2PW5 A;  4K6L A;  2B2T C;  1I50 B;  4HSP A;  1QCB D;  1STB A;  4BBR B;  4OO1 I;  2JSO A;  5I9P A;  3GTP B;  2KEC A;  1OXX K;  4A3K B;  3HS0 C;  5HGT A;  3NBI A;  1TWG B;  4KKS A;  4BWG B;  5I4D A;  3D8G A;  2L4N A;  1KTK A;  3AB9 A;  2WB1 B;  1D1K A;  4ME5 A;  4DK1 A;  3JAM L;  2RQX A;  3NBH A;  3KBX A;  4RGN A;  1WTP A;  1DM0 B;  3LNN A;  4A3M B;  4K2K A;  3T4A C;  3FRP B;  2KHS A;  4ZK9 B;  3JAM E;  5EKI A;  3C3L A;  1GHK A;  1WVL A;  4AYB B;  1EQT A;  2JA5 B;  3BZD B;  2RDF A;  1BF4 A;  1Q1E A;  4ID6 A;  3SK4 A;  4DAP A;  3C2P A;  2JA6 B;  2R3Z A;  4CKE A;  1ET6 A;  1OO9 B;  1SNP A;  5KIX A;  1H9S A;  4CKC A;  4Q5V A;  1W6J A;  1V43 A;  4A3G B;  2AQ2 B;  5J1Z A;  3PIO 3;  1X3Q A;  2D5D A;  2CQA A;  5C3E B;  4C2M B;  1L0Y B;  2NVT B;  2B8F A;  4IUP A;  3P20 A;  4KKU A;  2G9D A;  3MEH A;  2I07 B;  3MXG A;  3AMU A;  1WTV A;  3S14 B;  2D9U A;  1O78 A;  3MVV A;  2Z4I A;  2IX1 A;  1YNN C;  1MI2 A;  1QB5 D;  1H9M A;  2ZXR A;  1F2M A;  1NCV A;  1B2T A;  3S1N B;  1K83 B;  1F2Y A;  3DM1 A;  1KDC A;  1BCP B;  1S5D D;  3I91 A;  3VYT A;  3HZX A;  2BCO A;  2WAQ B;  3VR5 A;  5DAU A;  3GD7 A;  3IFT A;  1BBX C;  3J7A V;  3RLF A;  2N88 A;  3HGB A;  1JWM D;  4H13 C;  4PMB A;  4XTC S;  1SNC A;  5EPJ A;  2NB0 A;  2EYL A;  2FMC A;  3SR1 A;  4QUC A;  4RCN A;  5D3D A;  4IZ8 A;  1PFN A;  2L55 A;  3OMG A;  2K6A A;  1G8Z D;  2O5J C;  2R61 A;  2QIL A;  3HOY B;  1QNU A;  4IUT A;  2HDM A;  5I2X A;  4OHJ A;  3NQT A;  2B2V C;  1GUW A;  2LKV A;  1TQO A;  1JE4 A;  1D1I A;  1EZ6 A;  1KDA A;  2KCC A;  4I7Z C;  1V1O A;  1C48 A;  2K01 A;  4IUV A;  2KEE A;  5CBE E;  3GV3 A;  3BDC A;  5K5P A;  4ABN A;  1EY8 A;  4HSV A;  2RDH A;  3VR3 A;  1RDP D;  3VYS A;  5C0X G;  1LTA D;  2E2J B;  2SDF A;  2F0G A;  1TII D;  5KEE A;  1SEB D;  2HDL A;  3PO3 B;  1FGB D;  4RHR A;  1NR4 A;  2NVQ B;  2F0E A;  2F3W A;  3M4Y A;  5IIF A;  1BUV T;  1OXV A;  3S1R B;  5DM7 3;  1DOL A;  2JA8 B;  5F2D A;  1EU3 A;  1I4P A;  3NQI A;  5BN5 A;  4Q0F A;  3A8I E;  1SYG A;  1QG7 A;  2HCC A;  4WFN 3;  5I6W A;  1LT6 D;  3K0Y A;  1F77 A;  3MC0 B;  5I2Y A;  1LO5 D;  1HQM C;  1KAB A;  5ELF A;  1HFG A;  1MBY A;  4F7X A;  1A6X A;  2KJX A;  5ELE A;  2DN8 A;  3KF8 A;  2A74 C;  2LY7 A;  1B9N A;  4FVM A;  3A7L A;  4BA2 I;  2SOB A;  1WD0 A;  2B8G A;  3S1M B;  4EQP A;  4QB4 A;  5BN3 A;  5CMD A;  3A56 A;  2VB2 X;  5DEH A;  1CK1 A;  2EY1 A;  5IT9 E;  3RZO B;  3QJY A;  2A6H C;  3HKZ B;  1QWY A;  2V4D A;  4BS9 A;  2PQE A;  1STH A;  3VR6 A;  5A2Q L;  1EFI D;  2B2T A;  4N9T A;  4HMJ A;  3VYU A;  3D4D A;  1TWC B;  1O7L A;  1SXT A;  2K32 A;  3T13 A;  4B9W A;  1KNE A;  1TU2 B;  2IT1 A;  4FF4 A;  1SYC A;  2L11 A;  2QEJ C;  1J8I A;  2N55 A;  4PMW A;  2QCP X;  4FNF A;  3TME A;  1STY A;  2KCN A;  1EEF D;  1SE4 A;  4DK0 A;  1TT2 A;  1GUS A;  2E76 C;  5FKA C;  2DY7 A;  3J7Y W;  2FIN B;  4RWS C;  2E2I B;  1M8A A;  3CRK C;  3Q22 A;  1HFN A;  1GUT A;  1K8M A;  1KNA A;  5ELD A;  3MA2 B;  4N9P A;  1ENC A;  4K6D A;  2F0K A;  2B2Y C;  1WTX A;  3OWF A;  2RA4 A;  5C5L A;  3W2D A;  1PTO C;  3ZYY X;  1MGS A;  2HUG A;  2J7Z A;  4U67 3;  1WTO A;  3QWN A;  4H0L C;  3S17 B;  3Q23 A;  1E2W A;  1D5Z C;  4G7H C;  1F9S A;  3A8K E;  1RCV D;  1BO0 A;  2F0V A;  4IUU A;  3TDQ A;  5KYL A;  1ROD A;  4NP5 A;  2A68 C;  5JAV A;  2L12 A;  2LMC B;  1PFM A;  4KN4 C;  3S2H B;  1QNK A;  1J9O A;  4MHE A;  3OOC A;  1L0X B;  1HRJ A;  5IGG A;  1FR3 A;  3A54 A;  1HA6 A;  3OWE B;  4C3J B;  1JQY D;  3QB3 A;  1U4P A;  1PTO D;  4DAY A;  3N6R A;  3J7A F;  2AWO A;  3I4N B;  1NSN S;  1ICW A;  2SNS A;  2FHT A;  2ICI A;  1AP0 A;  1VCI A;  2RSN A;  5JOB A;  2AUJ D;  4C3H B;  1ZEQ X;  1Y8P B;  1LTB D;  2XVS A;  4ZLT F;  1I4X A;  1VF7 A;  2E2D C;  1AEX A;  2R6G A;  3TZU A;  3OW7 A;  2R92 B;  1S4Z A;  3IL8 A;  1JOR A;  3NK9 A;  4M1U B;  2WP8 J;  3OIQ A;  4A93 B;  1GUO A;  3MXU A;  4DF7 A;  4K2L A;  3GQB A;  2F0P A;  4A3D B;  2F0J A;  2B2V A;  3SEB A;  3QO2 A;  2EVB A;  4DXF A;  1LTR D;  3VR4 A;  3MFG A;  2IPK D;  1EYC A;  1Y69 U;  2F1M A;  3SVM A;  1HXY D;  4V0B A;  1DZ1 A;  1I4G A;  3ERQ A;  4LK1 C;  5COR A;  2Y0S B;  1CQF A;  3SK8 A;  1STN A;  4FO2 A;  4IQZ A;  1VMP A;  2RKS A;  5DM6 3;  2XIW A;  1O7Y A;  3KLR A;  1GXD C;  2BA1 A;  4H44 C;  4ULL A;  4ZQ3 A;  1ET9 A;  1ILQ A;  1HUM A;  1PDQ A;  5T1I A;  1D5M C;  4B08 A;  1XX8 A;  3C46 A;  3Q0A A;  3GTG B;  2O4X A;  1E2V A;  2JA7 B;  4IUR A;  1U9R A;  1C8C A;  2K05 A;  1D2B A;  1IL8 A;  2F0L A;  1AW7 A;  1B1Z A;  3BVM A;  2AQ3 B;  1SJH D;  1G2S A;  4H7B A;  3DEO A;  3DEP A;  3J81 L;  3X3N A;  2IX0 A;  3F2U A;  4WJW A;  5AFW A;  3V05 A;  5EKK A;  2EDG A;  2F0T A;  4UDU C;  2PW7 A;  4KY6 A;  3L7Z C;  4E6I A;  2OF1 A;  3R3O A;  1BNZ A;  3S9W A;  1LLR D;  3DXJ C;  5C0X H;  2KQ3 A;  1II3 A;  3MXN A;  3J81 E;  4XT1 B;  2QDB A;  1DOM A;  4EGV A;  5EGT A;  2F03 A;  4HTH A;  4IFD G;  1SYD A;  1GJX A;  4WOR A;  5HUR A;  2D2C C;  3NP8 A;  2NN6 H;  1F2L A;  4KHZ A;  3MZ5 A;  1E0B A;  4KKT A;  2F0M A;  4EQN A;  3D3R A;  4C3J G;  2XRS D;  2WKC A;  4XQN A;  5CR3 A;  4NMZ A;  3MWY W;  1B53 A;  2R93 B;  3I90 A;  4HED A;  3M4O B;  1UEA B;  1MSH A;  1SSO A;  2J0T D;  2R7Z B;  5IGE A;  3VYR A;  1CHQ D;  3FDT A;  1I4R A;  1EIG A;  4RKB A;  1Y8N B;  3H3V C;  4KY5 A;  2H4O A;  5J39 A;  1Y1V B;  3MXP A;  3R2T A;  4KK7 A;  1PFB A;  4O42 A;  2IX3 A;  5CYU A;  5C3W A;  1G29 1;  1I4Q A;  3IKJ A;  1HA5 A;  2NBF A;  4CGY B;  3NWS A;  1TS2 A;  2NWG A;  5JPM C;  3K59 A;  2B2Y A;  3KUP A;  3GTM B;  4BBS B;  3K5O A;  5IGC A;  2AQ1 B;  5LL6 S;  4A3B B;  2QF7 A;  2E75 C;  3FPP A;  2ICE C;  4KJN A;  2B2W C;  1JOK A;  3HOX B;  4V19 0;  2WII B;  2F0I A;  2TMP A;  5EPL A;  2VUM B;  4QCL A;  4FXK C;  5C0X J;  2JP1 A;  2KOL A;  1BOS A;  3GV6 A;  1G2T A;  3H94 A;  3MFY A;  4OGQ C;  5D65 A;  3SHL A;  1IKL A;  1I6H B;  2PZT A;  4QMG A;  4DU9 A;  2TSS A;  4NW2 A;  2NVX B;  2F0F A;  1TR5 A;  3X3M A;  3S1Q B;  5A35 A;  4P2C B;  2A6E C;  3DUZ A;  3G6J B;  2F3V A;  4L8J A;  4HCS A;  4O1N A;  2RSO A;  5D14 A;  2F0N A;  1BDO A;  1KAA A;  2OT2 A;  1PXU A;  4GZY C;  4K5V A;  3C1F A;  3H09 A;  1HCZ A;  1RF2 D;  5FO9 B;  1NR2 A;  4G4K A;  5ISR A;  1ZKO A;  4LJZ C;  3GTQ B;  3RZD B;  1SNM A;  4R8I A;  3J80 E;  2B39 A;  3T53 B;  1A3T A;  1E2Z A;  2AWN A;  3I4L A;  3OSO A;  3P7J A;  3PMF A;  2Z8L A;  3P1H A;  3BYY B;  3DMU A;  1SAP A;  2NN6 G;  2KUM A;  1SE3 A;  2BE5 C;  5CV7 A;  3SXH A;  2A6E D;  3CHB D;  4XQJ A;  4FF3 A;  2JYO A;  3OIP A;  5C4H A;  3URY A;  3DWP A;  1QJO A;  1M4V A;  1RKN A;  1BXT A;  2CW0 D;  4K14 A;  1CA5 A;  5CV9 A;  3QOL A;  2FMM A;  2EPB A;  4JBW A;  5IT9 L;  1S5E D;  1GUN A;  4XT3 B;  1JB3 A;  2WKD A;  2NVY B;  2M2L A;  3ITP A;  4ZAI A;  3Q6S A;  1CHP D;  4JK1 C;  3T56 B;  4ZUI A;  4DNT B;  1F9R A;  4A3F B;  3K7A B;  2CHB D;  4A3E B;  3I70 A;  4OO1 G;  4KY7 A;  2MP1 A;  1TVX A;  5ELB A;  4FYD A;  4EVO A;  3EA6 A;  1Q3L A;  4DXG A;  1R9T B;  1AZP A;  2BE5 D;  2NTS A;  1IKM A;  2EE1 A;  1IHZ A;  3DHQ A;  5E4W C;  2LS0 1;  3G7L A;  2VXW A;  3I3C A;  1HQR D;  3NE5 B;  4KMU C;  5IGB A;  1CTM A;  3K57 A;  1FNU A;  1LT5 D;  3SE0 A;  3TP7 A;  3GTL B;  2JEB I;  4TKO B;  2EY2 A;  2GA4 B;  5M5Y B;  5C4J B;  3PUZ A;  2MGS A;  5K36 G;  2CVR A;  4B9X A;  1LAB A;  3W3A A;  2VNU D;  4RH6 A;  5E4X A;  1SJE D;  4PV1 C;  3GTJ B;  4QF4 A;  1EZ8 A;  4RCO A;  4X3U A;  4F88 A;  3T51 B;  1TKW B;  1IW7 C;  2X6L A;  3K5L A;  5E3F A;  5CV6 A;  1SNQ A;  5M3M B;  3O13 A;  2KED A;  4LAA A;  1X32 A;  1CZG A;  2FJ2 A;  4PQX A;  1AFP A;  1BR9 A;  1SE2 A;  4X3T A;  1WTW A;  1FNV A;  4NKL A;  5JJZ A;  2YYZ A;  1V8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...