2L9HA

Oligomeric structure of the chemokine ccl5/rantes from nmr, ms, and saxs data
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oligomeric Structure of the Chemokine CCL5/RANTES from NMR, MS, and SAXS Data.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords C-C motif chemokine 5
total genus 11
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l9hA00
5EJWA 3HP3A 2VXWA 2X69A 1WD0A 1VMPA 4IURA 2EOTA 3QO2A 1RHPA 2HCCA 2FHTA 2B2TC 3ONAB 1BNZA 1EIGA 5COYA 2K1BA 3KBXA 1JE4A 1WTVA 1Q3LA 1NAPA 2FJ2A 3I90A 1IKMA 1U4PA 2MGSA 1WTQA 2MP1A 3GV6A 4CJ0B 2EPBA 4RA8A 1A15A 2IL8A 5EPLA 3H91A 2M2LA 2X6LA 1F9QA 2B2TA 3I3CA 4MN3A 4OIJA 1WTRA 1DOLA 2KVMA 1RTOA 2R3ZA 4ZKBB 1B2TA 5CMDA 1XYIA 4MHEA 4IUUA 2K04A 1HA6A 2N55A 2D9UA 3IL8A 1LV9A 2B2VC 3I91A 4CJ1B 1AZPA 2JYOA 2NYZD 5CORA 1WD1A 2FFKB 5DNFA 1VMCA 1HUMA 1IKLA 2KECA 4OIKA 4X3KA 1ILPA 1F2LA 3DM1A 4ZAIA 2K03A 1WVLA 2L12A 3MTSA 3R93A 2HCIA 1KNEA 2HDLA 1RJTA 1PFBA 1ZXTA 5T1IA 4HSVA 1BBXC 1G2SA 4X3UA 4XT3B 4ZK9B 3KUPA 5EPKA 2HDMA 3P7JA 2B2VA 4UAIA 3UI2A 1G6ZA 1PLFA 4R9WA 5CBEE 2H1EA 2NWGA 4QUCA 1HRJA 3G7LA 1TVXA 1KNAA 2XIWA 4ZLTF 1MSGA 1ESRA 4HAEA 4ZKCB 1AP0A 3TN2A 1EL0A 1XX8A 1CA6A 2JP1A 5T1GA 3SVMA 2FINB 2L9HA 1CA5A 2KUMA 3FPUB 4DN4M 2SDFA 1BF4A 3I8ZA 2B2WA 1CM9A 4IUPA 4LMQD 1WTPA 4RWSC 5D65A 4R8IA 4CJ2C 1X3PA 1AZQA 1GUWA 1MSHA 1MGSA 1ML0D 4IUQA 2CVRA 2RSNA 2RA4A 2EE1A 2B2YC 5E4WC 4QUFA 5JJZA 3MWYW 1ICWA 1QNKA 2L4NA 1ILQA 1MI2A 1QE6A 2BDNA 2RVLA 2B2WC 2NZ1D 4U68A 1X3QA 5EQ0A 1HHVA 1HUNA 2Q8RE 1RTNA 3IFDA 2L1BA 4NW2A 2MJ8A 4X3TA 1WTOA 4RAUC 1QG7A 1DONA 5E4XA 1X32A 1G91A 2B2YA 1E0BA 1EQTA 1PDQA 4IUTA 1B53A 1O7ZA 1DOMA 2N88A 1EIHA 1B3AA 1BO0A 1HFNA 1SAPA 1IL8A 1EOTA 4XDXA 3N52A 1HFGA 5EKIA 3TZDA 2B2UA 5D14A 3DEPA 2DY7A 1JICA 1O7YA 2KEEA 1F9PA 2X6GA 3F2UA 2KEDA 2K28A 2K01A 5EPJA 4IUVA 4XT1B 2MPMA 3D6WA 2FMMA 5AFWA 1SSOA 3DEOA 2HUGA 4HCSA 1B50A 3LWEA 5CBAE 1SDFA 1NR2A 1G2TA 1J9OA 1U4LA 1NCVA 2Q8TA 1NR4A 2K05A 1F9SA 1O80A 4X3SA 1B4OA 1DZ1A 3Q6SA 1WTXA 2J7ZA 2KOLA 1J8IA 1RODA 2B2UC 2RSOA 3FDTA 1F9RA 1PFMA 3GV3A 1C8CA 4O42A 1WTWA 1DOKA 2DY8A 1PFNA 2L11A 4HEDA 1S4ZA 1U4RA 1M8AA 1U4MA
chains in the Genus database with same CATH superfamily
1CT1D 4LUVA 1KABA 3HGBA 4L5SA 3DHQA 1BXTA 2K6AA 1N8RC 5K36H 3QO2A 1FYCA 3S2DH 3CPWA 1EWIA 2EIFA 4DAYB 4DUZQ 1STHA 3L2PA 4GN4B 1NMGA 1XMOQ 1YI2A 3BVZA 3H0GG 1ZKOA 2K14A 1UUPA 1I50B 5IT9c 2MUYA 1PYBA 3HEJA 1IW7C 3LX0A 2AUKA 3TEHB 2XGTA 4JI6Q 4WJ3M 4JV5Q 2E76C 4OIKA 4AYBB 2PW7A 3KK7A 2VQFQ 1H9RA 3D4WA 1E1OA 1L0XB 1HNWL 3MEFA 3QOLA 4GN5A 4S3SA 3DWAA 5C44H 1EL0A 3TN2A 3WDNA 1XMOL 1CKMA 1O78A 4DKAC 3U9OA 4QY7A 1FGUA 4IFDG 1EYDA 1Z6HA 4Y7NB 2JA8B 1X3PA 4DNRB 4IUQA 3ITPA 2EYLA 5D3IB 2SNMA 4V190 3S1MH 5JJIA 2QEXA 2PI2A 4H0LC 3C2PA 1I5FA 3PO2G 2PI2E 3BDCA 3TREA 1O7IA 1WTOA 5D3DA 5CV5A 2B2YA 2F0UA 3HOYG 4B3SL 4A3MB 4LUZA 2PQAA 1KXLA 1EY7A 5IOCA 4CDFC 2LS01 2KEEA 1QVGA 2AUJD 3UDIA 4HCSA 3ND9A 1BOSA 1SEBD 2ZM6L 4JBWA 1STAA 1O80A 3LNNA 2EQSA 3S17H 1R4QB 4JI4Q 4O42A 4ZCKA 3GTJH 3TRZA 1UWVA 1S4ZA 4H7BA 1JCKB 1M8AA 1KLUD 2F0MA 2E8GA 4YHHL 4DV0Q 3M4OB 4P2CB 2F0FA 1S3OA 4FF4A 2JA5B 4OHJA 1AE3A 2QILA 1QUQB 2B2TC 4A3GH 1UE1A 5A35A 1VQHA 1IZ6A 5I6YA 2MGSA 4LF7L 2NZHA 5ISRA 2TMPA 4MTNA 1YZ6A 1L2FA 2OTLA 1Q8KA 1DOLA 2F1MA 3EVQA 4ZKBB 4KTAA 2F0NA 4KD4A 3I4NG 2F0IA 1BBWA 1M1KC 4JOIC 1K9MC 3I91A 2PQAB 1RL2A 2JYOA 4N9TA 2IX1A 3NP8A 2WAQE 5EGTA 1F2LA 4ZAIA 5J3BA 1JMCA 3VDYA 4DNIA 4X64L 5BN3A 1U5KA 2BOSA 5EPKA 3PUXA 3S16H 4XTCS 2HHHQ 2RDHA 1GD7A 3RNUA 4OL7A 2EZVA 3OIPA 3BU2A 1Y8NB 3K81C 1FVIA 3GTQH 4OEMB 1Y8OB 5C0XG 1WFQA 2K32A 2JA7G 3TP5A 3A7AB 1UEAB 4APVA 1YNJD 3TSSA 4KV6A 1HR0W 3GTMB 1II3A 3PO3H 4H13C 2PO4A 5C5LA 4DV0L 1QE6A 2SOBA 4HR7B 3PGZA 3OPOA 4PV1C 2AQ1B 2IWHA 1EIFA 4H02A 2L5TA 2EJMA 4IUTA 1C4QA 1TXYA 2KQ3A 1KHIA 1N9WA 4PQXA 3H3VH 1EOTA 3R2IA 2VZAA 4NXMQ 4G7ZC 4Z9CB 4PMBA 1K83H 4CKCA 3NBHA 1PRTD 3TDQA 1NR4A 3GTQB 1SYBA 3FKIB 5CC4A 3CQZB 2JSOA 2F0LA 3L0OA 4A3BG 1SROA 4YY3L 2NUCA 1BUVT 2EYMA 1IBLQ 4DV1Q 3T1YQ 1XMQL 3MZ5A 3BDLA 4YCUA 5KYIA 4BY1B 2K1BA 1WTHA 2Z0SA 1IYJB 3KBGA 1U4PA 1YITA 4AIMA 1B8AA 1BCPF 1LTRD 2NTTA 3E5SA 4A3EH 4JW0A 4NXML 3I3CA 3H94A 1PZKD 4GS3A 2RF4A 3U4ZA 2VQFL 2JA8G 1B2TA 4R4OA 3NQIA 4DV5Q 2EXZA 3AYHB 1IBMQ 3AEVA 2NN6I 3CC4A 1A63A 1J6QA 2MFIA 2B2VC 3H3VI 3LGJA 5JEAH 2JA5G 2B29A 3PSIA 1IYVA 5DNFA 2KECA 2K03A 1NE3A 1T5EA 3ULPA 4OONA 1A3UA 3V2TA 3TBIB 4DV3L 3AMUA 1MJCA 2RBMA 4WORA 1D6EC 5CGKA 4DPGA 3BS1A 2UXBL 5JJKA 4A3EG 4DR4L 4R4IA 2KA7A 2OF1A 4DV2Q 5FOBB 1B1ZA 1XNRQ 1I6HH 3D0FA 3K8AA 5IP9H 1N36L 4IUPA 2L15A 5D65A 4DR2L 2RKSA 1AZQA 1IXRA 1MSHA 3QIAA 3K7AB 2EE1A 1ASZA 5BN5A 5E3FA 4AYBE 2EY5A 4HMIA 4ZUJA 5M5WB 2F03A 3E9HA 1X9NA 1ZYRC 1NUCA 3S1NH 2KHSA 5M3FB 2LSSA 2PNRC 5DM63 1QG7A 4QGUA 4UP7A 3I2ZA 1HNXQ 3HOUB 4GKJL 3CW2C 1STEA 2UXBQ 1GHKA 1HFGA 1A8VA 2B2UA 1JICA 1O7YA 4JI6L 2K33A 5AFWA 4FDBA 5KNDA 1SDFA 4U673 2QA4A 1IBML 5M3MH 1HR0Q 1XTDA 3T4AC 2FXQA 1JWMD 4F7XA 4B9XA 4OWXB 3PCOB 1VQ7A 2F0WA 2R93G 1A2UA 2DNCA 3PO3G 3CRKC 1EY6A 5M5WH 1S5BD 2JA6G 3G71A 3A7LA 4F87A 5JPMC 4DU9A 2C9OA 1B9NA 5C3EB 1EY9A 2MP1A 1QJOA 2EY1A 2R6GA 1R9TH 2NVYB 3HOZG 3GTLB 2B8GA 4R8NA 1WTRA 1Q86C 3PUZA 2K75A 4TRDA 1SXTA 1HR0L 4A3LH 2K04A 3EQLC 1Q81C 1TIID 3F8TA 2KHIA 2RCNA 3J7AV 3K0YA 1SFOB 3K5MA 1K83B 1HUMA 2KBNA 2IJ0A 1K0RA 1WVLA 4NXNL 1LTAD 2F0KA 1KL9A 3Q8DA 1PH4A 2G5DA 4I65A 5IIFA 3I4NH 1EYCA 1G2SA 2NZOA 1AH9A 1EU3A 4BA2I 4KN7C 2JK8A 1X3EA 1JB7A 5FLXc 3G7LA 1IBKL 5NUCA 2R7ZH 1ESRA 5G3LD 2WB1G 3CPFA 3S16B 3TZUA 2NVXB 4BY7G 1QWYA 4A93G 4IO9A 5M5XH 4A3GG 5FO9B 4X62L 3NXWA 2JA6B 3A8IE 2B2YC 1VQ4A 1ICWA 1QNKA 4QMGA 2D0OA 5I9PA 4IQZA 2N78A 4C3HH 2KENA 3VA5A 2QGQA 3G4SA 2B2WC 3KDFA 2L1BA 1MHWC 4RAUC 2IX3A 3J7ZC 3CXCA 1Q7YC 3K59A 4LF6Q 1PDQA 3EA6A 4A3FH 3AU7A 3I4NB 4XDXA 2BE5D 3W5OA 1GVPA 5FJ8H 2PZTA 5D14A 1MIUA 5IGEA 3I70A 1HZAA 1PRTF 2R92G 1LABA 2NTSA 4B3TQ 1CKOA 1LTSD 1U4LA 3RLNA 3HOYH 1V43A 4DR3L 4DV1L 4DV4L 4KY7A 2C35B 1B9MA 4DFAA 4P72A 3FDTA 2I0QA 1SE2A 2HHHL 2VQEL 5GADC 3RZOH 5KGUA 2A6HD 3H09A 1I94Q 2ICEC 1KLGD 1XWEA 1CKNB 1Y1WB 3T56B 1AE2A 4J6HA 4OWWB 1XPRA 1TS4A 5DM73 1Q3LA 4DUZL 3J80E 2K4KA 3HOXG 4GOPB 1HNWQ 1UEBA 2QF7A 2WFWA 4FYDA 3VR2A 3W2DA 5IY0A 1QILA 1F9QA 4C2MH 4Y7NH 2A6HC 2GVAA 4DR5Q 1D5ZC 5IODA 4A3IB 3S1QB 3GO5A 4JK1C 1XNQQ 1XXGA 1Q1BA 3AFQA 3H0GB 5KNBA 1W6JA 3VA7A 3PO2B 1H9JA 4LF9L 4JYAL 1MJEA 3MTSA 5J22A 5CV8A 1O7LA 1JOOA 3MXUA 1KNAA 2JE6I 3SK4A 3JC66 1L1OC 1XX8A 1CA6A 1EY4A 1QOHA 1LTBD 2L9HA 4DR3Q 4DN4M 3S17B 3E6ZX 2XRSD 3NUCA 4LMQD 1S5CD 5IYBG 4N8X1 5K36G 4A75A 3HZXA 2F4IA 1LYLA 1R9TB 1BDOA 1FNUA 4ZYSA 3HOZH 3GDEA 5I2XA 2N3SA 2VNUD 1X3QA 4DR6L 4HIDA 1K8GA 3TP8A 4X65L 4O1NA 2CQAA 1V9PA 1ESFA 4LFBL 1KC8C 1EOVA 4L8JA 2I46A 3KFUA 1DOMA 3RLFA 3RZDH 4DV4Q 1NTGA 2A6EC 1DCZA 3OWEB 4JPBW 4O0AA 1IL8A 3Q24A 1CHPD 1VQIA 4FXDA 2CFMA 1DZ1A 1CZWA 2F0HA 3CP0A 3HOVH 1VQEA 2D62A 1MBYA 3BJUA 1XNQL 3A56A 3MAQA 2NVXH 4I7AA 2YU9H 5ELNA 1ENFA 1HQMC 1K8AC 4DR7Q 2Q2UA 1PH8A 1KDBA 2BDOA 1I4GA 1HNZQ 1X54A 1HH2P 3MFGA 1Y1WH 2AWOA 1W6KA 3CD6A 2H5XA 3BYTB 1FNVA 1TY2A 1YNJC 1ET9A 2XNAC 1NBWA 3CCEA 1IKMA 5M5YH 2XRQD 3Q0AA 1CSPA 1SRUA 4ODGA 2Q2TA 3D6CA 3ER0A 1A15A 1C9OA 2TSSA 3H3VC 1A62A 4B3RL 1DD2A 1PVOA 3M3YB 3FP9A 1LT4D 3J81L 4UPAA 1XTCD 4HSPA 3I4MG 4JI3Q 1D5XC 4C56C 2B8FA 4A76A 1UE7A 2Z6KA 3F2CA 3NQTA 2C5CA 3DM1A 3FVQA 1YIJA 1I3QB 5KEEA 4R4CA 3PUYA 1HQRD 1I50H 1LACA 4HSVA 4XT3B 3BG3A 3HKSA 1LTLA 3MA2B 4R9WA 3RMHA 2EYOA 1HRJA 1EFID 2F0VA 1SE4A 5IWAQ 4LFAQ 2O4XA 2OTJA 2R61A 3E0JA 4PNYA 1DXMA 2K5VA 3SXHA 4DAPA 1SNPA 4ZKCB 3PIO3 4KHZA 2LFNA 2KUMA 1EZ6A 1EIYB 3KLRA 3FKIG 3VR6A 1TR5A 2P5ZX 3KF6B 2E2IH 2CVRA 5JPNC 3J80c 1TY0A 2CW0D 5JJZA 1V8QA 5IGBA 5ELEA 2R93H 3S2HB 1RF2D 1AW7A 2BDNA 3A5ZB 5KRUA 4U68A 2K5HA 5AJ3L 4BY1H 3EN2A 3G6JB 4HCEA 4DV7L 5E4XA 1CSQA 1YHBA 4NMZA 2OXPA 2VUMG 4LNQA 2VW9A 2O5JC 2NN6H 1PFSA 3TP7A 1G6PA 2R92B 1VQCA 3G6EA 4B3RQ 4L6TB 2K28A 1BCPB 3TQYA 3LWUA 1KDCA 2I5MX 4UDUC 1YHAA 3FHWA 5CBAE 5IT9L 1ENCA 1H9SA 4B3MQ 3NTIA 3MHBA 4A3KH 3SK8A 1CK1A 3CAMA 5JJLA 2UU9Q 4DK6C 1PFMA 4M8AA 2OCEA 4HMJA 5EBDA 1QNUA 2VL6A 1U4MA 1SYCA 3MEHA 2PZWA 4YY3Q 1HXYD 5I2YA 4JI0Q 4JI7Q 2F0TA 4Q0FA 1VQKA 4IURA 1KRSA 1Q12A 1EIGA 3STBC 3ZJYC 2PCFB 5FLXE 4A3DH 1J5EQ 1TWAH 2HQEA 3NE5B 1VQLA 3M85A 3PIPA 4KMUC 2RDGA 3VR5A 5KIXA 3NTHA 5JVG3 2DN8A 2KVMA 1SLJA 5C3XA 4HIMA 3V96A 3NPPA 4A93B 2EYJA 4AYBG 1Y1VG 4DR2Q 2FFKB 1K3RA 1EYAA 2ZTEA 4OGQC 2NB0A 3M9BA 3W1GA 5BR8L 4J15A 3U50C 4ILWA 4ABNA 3M4PA 1TS5A 4DXFA 2H1EA 2VB2X 4DV2L 4A3JB 4DR4Q 2V1CC 1K73C 1HNXL 1LT6D 2Z8LA 5ELDA 2BA0A 4FF1A 4XYQA 1TWHH 3BYYB 1LTGD 4MIUA 2B2WA 4BBRB 2AQ2B 4CDCC 2WV6D 3C1EA 3HOWG 3P20A 4PG3A 3DWQA 4K0KL 4N8FA 1T9HA 4A3BH 4JG2A 3OW7A 4RGNA 3RD4A 5IYDG 2GN5A 4CDEC 3D3RA 1A6XA 2EY6A 2A68C 2JA9A 2KJXA 1YNND 2AMCB 5C4ZA 5LMNL 1H95A 2N8NA 5JOBA 1G91A 1PV4A 3KYHC 2N88A 2O2LD 2NVYH 1YBYA 1IHZA 2GA4B 3NWSA 2IHFA 2ZJRA 1HA5A 5EPJA 4YCWA 4J8QA 1PH2A 1KAAA 3RN2A 4JBJA 1NR2A 1ICFB 4X3SA 3U9SA 3M7NA 2RSOA 2K7VA 1C8CA 1SMXA 2R92H 3ZYYX 3S9WA 4BY7H 4GKJQ 3RN5A 2ENBA 2E5LQ 3I73A 4C3IH 2ALYB 1YNXA 5A2QL 4JI4L 2HQLA 4IPGA 1WTVA 1B7YB 2ID0A 4JI1Q 1ASYA 4RA8A 5EKLA 1ENAA 3HOUG 2IL8A 2F0PA 1E1TA 1PTOH 4OIJA 3QR8A 4ZUIA 4GNXA 1TWFB 2VS1A 4JVZA 1LLRD 4K0KQ 2WKDA 4AQYL 2LKVA 4DUYQ 4LF7Q 2F0GA 4CJ1B 4X3KA 1LUZA 1N33L 1JE5A 4IZ8A 1HJPA 3EROA 3GTKH 1AFPA 1LTTD 2CWPA 4A3EB 1L0WA 3R93A 2F0EA 4IOCA 4TVAB 2UXDQ 3MVVA 3M4QA 4CBVA 5C4HA 2RHQB 1GUGA 1K8MA 2HD3A 1Z9FA 1CZGA 2JEAI 1Q1EA 1WI5A 2JN4A 3HKZB 4DAMA 2F3VA 2EY2A 3K5OA 4X66Q 5T1GA 1VQNA 1K3BC 3SVMA 3ND8A 1I6HB 1WCMH 3HKZE 5AJ3Q 4QB4A 4FF2A 2KCNA 1CKNA 1V1PA 3TS0A 4R8IA 1Y1VB 3OOCA 1GUWA 1YJ9A 3J80i 3HOXB 3T1HQ 2G9HD 5E4WC 3CCSA 2SEBD 5FK9C 4A3BB 1LT3D 4E6IA 2JXMB 4KY5A 2RVLA 5EQ0A 1ET6A 1Y1WG 4F8MA 1E7ZA 1IBKQ 3GTOB 4J1MA 3VR3A 3ULJA 2QDBA 1VQ6A 3GTKB 1Q90A 2HIVA 3JAME 1K0SA 3L3OC 1LTID 2J4XA 5FO7B 3N52A 5C5MA 4IPDA 1PH7A 4R4TA 4RGOS 4B3TL 1EWCA 1G2TA 3LWEA 5IT9E 2Z1CA 3K5LA 4DAVA 4UP9A 5M3FH 1NCVA 5HGTA 1V1QA 5GROA 1HTLD 1N34L 5CV6A 3OSOA 5GAEC 3PO2H 4K2LA 3KF8A 1X6OA 1F9RA 1SYDA 1BKBA 1JJCB 2F0JA 3A74A 1WTWA 2VQEQ 2A6ED 3EJIA 3FPPA 5H1SE 2VXWA 4KI0A 2F0SA 1TKWB 1VS0A 2AKWB 5FKAC 4WFN3 1NAPA 2FJ2A 1Y69U 1W2BA 3SK6A 3OTOL 4AQYQ 1M90C 2XSCA 2VUMB 2Z6KC 4BS9A 1FNWA 1WCMG 2LXJA 3Q22A 2K50A 4KHVA 5IGGA 1F2YA 4KD3A 4KLKA 4RH6A 1ZEQX 5CMDA 1QUQA 4LFAL 1N32Q 2NBFA 3HOWH 1I94L 3HOZB 1TQOA 2UXDL 1XPOA 2K5NA 3A54A 4GKKQ 1XJVA 5IP9G 4PZ6A 1S40A 2IX0A 1EEID 3OW2A 2F0DA 3H6MA 5C3EH 4LF9Q 2BCOA 5F2DA 1Q8IA 3CCJA 4CKEA 4K5XA 3UDGA 2ASBA 2E2JB 2HCIA 3I7FA 4PMWA 3OMGA 4P73A 2GVBA 1ZXTA 2VB3X 4YHHQ 5IP7H 3AFPA 5C3EG 4LUOA 3S1RH 2K5WA 1FD7D 2A69D 2H4OA 4YWLA 4C1NI 3J7YW 2UU9L 4JCVE 1MSGA 4HAEA 1OXVA 2A5HA 3L9AX 5C0XI 3HFZB 4KHPL 2BH2A 1I4RA 4ME5A 1SMYC 1QVCA 3HOUH 1YNNC 5IYCH 4POFA 3S24A 3PF5A 4NXNQ 3HOXH 2UUBQ 2RA4A 1TT2A 3CHBD 1BCPC 2IPKD 1C0AA 3O13A 4XIGS 2L4NA 4JBKA 3NEMA 3EBEA 4G7HC 2NZ1D 1HUNA 1N36Q 4RCOA 4IPHA 3GTOH 4K5WA 4NW2A 1DONA 3MXGA 3TMEA 3CCRA 1PH9A 4X64Q 1JC7A 2XVSA 3CCMA 5DEHA 4JC0A 1SAPA 1PA6A 1X56A 5IGCA 1F9PA 1M4VA 4X62Q 5M3FG 2M00A 2UUAQ 1L1OA 1G291 5BR8Q 1EY5A 3V05A 3HOYB 4GN3B 1PH1A 1F9SA 1B4OA 2E2HB 1WTXA 4ZQ3A 3GV3A 1SYGA 2OQKA 5HURA 2OWOA 3M3YH 1K28A 2DY8A 4HEDA 3GTGB 1STNA 1OXSC 4RGMA 4IJLA 2RCFA 1U0LA 3DUZA 1VMPA 3D8GA 2Q2IA 1VQFA 1RHPA 5IYCG 3AQQA 2OEOA 4QIWE 3KF6A 1GUOA 3L7ZC 4C3IB 1CI3M 5DAUA 4CGYB 2F52A 1GO3E 2Q2HA 1EYGA 1KDAA 4A3MG 4C2MB 1A2TA 5IGDA 5GAHC 2YTYA 5I9OA 1VQAA 3SE0A 2ZJQA 3GTJB 2E2IB 1C7YA 2CCZA 3Q23A 4DR7L 1V1OA 2DJGC 4R1JA 3IL8A 3M4OH 1NY4A 1SJED 4G7OC 3SR1A 4P75A 1CQFA 4G57A 4KK7A 4JI2Q 1SE8A 3P75A 4EQ5A 4HJ5A 1RJTA 1CQVA 1RCVD 3S1RB 3SGIA 4LF4Q 4UAIA 4XXEA 5CBEE 1D2BA 1I6VC 4DR5L 4ZLTF 5KYLA 1SR3A 3BZCA 3DXJC 4KN4C 2R7DA 2A19A 2FINB 4B08A 5JEAG 1PRTB 4Y52H 2SDFA 4K2KA 1ZYRD 4DV3Q 4KJOA 1CM9A 4A3FB 1PXUA 5IGFA 3R3OA 1ML0D 3I56A 3BVGA 4JI1L 4GLXA 1UE6A 3JAMc 4DK0A 1Y8PB 4C3IG 1LM0A 4MZ9A 4LFCQ 4DV7Q 2MJ8A 4V0BA 2E74C 3T13A 4QJFA 4TSSA 1B70B 1STYA 4OXPA 3ULLA 5M5XB 1B53A 3GQBA 1EQQA 4A3FG 4AH6A 3TZDA 5EKIA 4A3KG 3DEPA 1SBBB 4MNOA 1W3SA 4CDDC 3CC7A 1P16A 2MPMA 4A3DB 2FMMA 2UUCL 3VYRA 3CF5A 3WOFA 4B3ML 3S15H 1VQBA 1NSNS 4RGTA 1GM5A 5C3WA 1S5FD 3HOVG 2J7ZA 2KOLA 4HJ9A 3OWFA 1Y14B 4NPSA 2ZJPA 4WJ4A 2YU9B 1PFNA 1NNXA 2F3WA 3S2DB 3CRLC 5DLQE 3K80C 4DK1A 3J81i 3J7AF 1CUKA 2X69A 1PH3A 4RHSA 4IPCA 1JB3A 4YIJA 2FHTA 5HGQA 4C3JB 5IYDH 2R7ZG 4A3JH 2CKZB 4DGZA 4C3JG 5FLXL 3DMUA 5GQOA 1WTQA 4CJ0B 1TS3A 3AB9A 3FKIH 2CWAA 4OO1G 1HFNA 5M9OA 2KCTA 2B63H 3NWTA 4LFBQ 2JQOA 5TSSA 4IFDJ 2DGYA 4QF4A 1FJGL 1XPUA 3URYA 5LL6X 1X55A 1H9MA 3S15B 2DNEA 4JI7L 2I5HA 5J1ZA 3MXNB 2I5LX 4A3CH 4LF8Q 5CV9A 4I7ZC 2G9DA 3PIOA 2PPBC 1VQDA 1J5EL 3H0GH 4XQNA 2D5DA 4QL5A 1PLFA 4XQQA 2ZXOA 4OO1H 4KKTA 3R2TA 4DV6Q 1S5ED 5ELBA 4A3IG 4GLAC 1AP0A 5CV7A 1DM0B 3J81c 5M3MB 1VQMA 1VQ5A 3K7UC 4A3MH 1PTOD 4RWSC 4DF7A 3S14H 1G8ZD 1DYQA 1UNSA 3NBIA 3WWVA 2SNSA 4QUFA 3UDFA 2AQ3B 1VQOA 4KKSA 2WINB 3S2HH 1TS2A 2UXCL 3IFDA 5I6WA 4H44C 1KD1C 3QOJA 1F77A 3CMEA 1T5XD 3FRPB 2YTVA 3B6YA 5CV4A 3OIQA 1TWCH 5ELCA 4JV5L 1TWFH 3PUWA 3KDFB 3K57A 4XT1B 4BBSG 3K7AH 1QB5D 2QEJC 1IYUA 1L1OB 1IBLL 5M5YB 3MXPA 2PMZE 4OO1I 4NB3A 4OX9Q 2OT2A 5LMNQ 1DOKA 3RLOA 1BQQT 3JAML 4JI5L 2EYPA 2RDFA 3PQIA 4HIKA 3OMCA 1K8OA 1JWSD 1NJIC 5E7NA 1H9KA 2RQXA 4X6AH 3QJYA 1YEZA 1V1PB 3KBXA 4DV5L 4CHTB 4DA2A 3GV6A 1MD2D 1SYFA 1AN8A 3DWPA 5CYUA 4UP8A 5KNCA 2EPBA 4K8JA 4POGA 3JAMi 3W1BA 1EQVA 3HG9A 4FF3A 1CTMA 2EXDA 2PZUA 4IUUA 2WB1B 2K5DA 4NP5A 4KHPQ 3K5NA 1EUJA 4A93H 2FMCA 3F1ZA 4GOPA 4A3CG 4DUYL 1SNCA 1SNQA 1VMCA 2Y0SE 3T1HL 3D4DA 4P74A 1PZID 2EVBA 1RIPA 1JQYD 1TU2B 4XQJA 4X3UA 4HTHA 1E22A 2D0PA 3KUPA 3P7JA 4KKUA 3PO3B 2B63G 3KOJA 2N49A 1E2ZA 1LO5D 1S72A 1BBUA 2Q8IB 3T53B 3W3AA 1X3GA 4EQPA 3KF8B 1PH5A 5CR3A 4IOAA 5EAYA 3H15A 2WAQB 1VQPA 1TWHB 1BF4A 5A2QE 2E75C 3SEBA 2PW5A 1STBA 4A3JG 1H9SB 1EFWA 3CMAA 1JT8A 3QG1A 5IWAL 1MGSA 1RKNA 1SE3A 2D2CC 4GNXC 2CH4W 1RD9D 4IN3A 1JR0D 2L55A 1R4PB 2LXKA 3QWNA 4IUNA 5LMUQ 3MWYW 4K14A 1EQRA 5C4JB 1SFOH 2WIIB 3X3NA 2QW7A 4X3TA 2PNHA 4X66L 3WOEA 1HTPA 1O7ZA 4QIWB 3PUVA 5EBCA 3DLLA 2DY7A 3F2UA 1BR9A 2X6GA 4L5QA 4QQBX 4Q5VA 4BXXG 3PMFA 1UAPA 4JBMA 1ONLA 2OQ0A 3OTOQ 2Y0SG 3S1QH 4ME3A 1L0YB 1TWAB 3Q6SA 5FLMG 4LK1C 4DAYA 2M9VA 4L63B 3NK9A 1KRTA 1F2MA 2A1AA 3NSWA 3J81E 1YVCA 2Z9HA 4WJWA 5C0XH 2JA7H 3CCVA 2KCMA 1PHJA 3J81j 2F0QA 4EX5A 1UE5A 2Z4HA 4K8IA 1D7QA 1A0IA 4HN7A 4X65Q 4TKOB 1KAWA 5COYA 3R8BA 5EKKA 2JEBI 1JE4A 3A0JA 2YTXA 2A73B 1YJNA 2EDGA 4EQNA 3IFTA 5G3LF 4LF4L 3TS2A 4IFDH 4MN3A 1PTOB 4LW1A 4MHEA 2MQHA 5IP7G 3CU7A 4HJ8A 1GUNA 4DK3C 1P8LA 1TWCB 1VQJA 4HJAA 4GKKL 2A68D 4MTKA 1JJGA 1IKLA 3RZOB 4OWTB 1EU4A 1KNEA 2HDLA 1HNZL 5T1IA 3J80L 1D5MC 3BZKA 3FEWX 1SYEA 4ZK9B 3RZDB 2E2DC 1PTOC 2HT1A 3VYUA 2EJGC 4IJHA 3CC2A 1Q46A 1I4HA 2R7FA 1N32L 1OO9B 2B3GA 4A3LG 3TP6A 3C1FA 4RHRA 2JP1A 1QZHA 1PH6A 4P71A 3KLSA 1GJXA 3A8KE 3I8ZA 1WOCA 4FVMA 3GTGH 4UHVA 1OXUA 2ATWA 3J7A5 3ICEA 4DR1L 1AEXA 4UY8C 5C4JH 4NDXA 1ILQA 3NTKA 2E2HH 2VY3A 2A74C 4B3SQ 5GAGC 1E0BA 2MHVA 4BBRH 4C1NK 5HY6A 1GKHA 4BBRG 4QCLA 2QKIC 4BY7B 3P1HA 1GOZA 1N33Q 2LY7A 3E3XA 4IUVA 3D6WA 4RKBA 1KTKA 3DEOA 1VQ9A 1J9OA 4RMFA 4FO2A 2AWNA 2ZM6Q 3T51B 1YJWA 1B3QA 1F2ZA 4BA1I 1Z7TA 2IT1A 4BBSH 2L11A 4JYAQ 1SJHD 2PYKA 2Z4IA 3MFYA 3GTLH 4EQOA 1JORA 3GD7A 1E24A 3CKIB 1D1IA 3A5UA 2EOTA 5FO8B 5IYBH 2HCCA 4C3HG 3PF4A 3ONAB 3A8JE 1JOQA 2CQOA 4JI2L 1WYDA 3VYTA 4PMCA 1OXXK 2A8VA 2NVQH 3S14B 3I90A 4F88A 5C4XG 3K0XA 1SNOA 2MNAA 3PV0A 1A3VA 4FXKC 1TWGH 2Y0SB 2E5LL 5EPLA 2JA7B 1GUSA 1VDZA 2UXCQ 4M1UB 3UE1A 3SDZA 2BH8A 2J0TD 1HA6A 2ZXPA 2K5QA 2NYZD 1D1KA 1WD1A 2ZXRA 4A3GB 4DNTB 1PRTC 1EZ8A 2CW0C 1I4XA 3KJPA 2HDMA 3ERQA 1G6ZA 3UI2A 2JA5H 2NWGA 4IALA 4LFCL 1VQGA 1TVXA 2XIWA 4OX9L 1VF5C 3PIP3 1BCPD 4RG1A 3S1NB 3HRZC 4DR1Q 2XTIA 1FGBD 3D4RA 3IRBA 3FPUB 1D8LA 1E2WA 5ELOA 3I55A 2PMZB 2A69C 3NELA 3RUZA 2RSNA 3EFXD 4K6DA 4A3DG 1STGA 2KHJA 4A3KB 1HHVA 3BZDB 4R4QA 4EGVA 1I3QH 4C3JH 2CHBD 3IAYA 2V4DA 4KJNA 2WAQG 2WKCA 4TQUS 1SNMA 5L37A 2KEDA 1HZ9A 3SK5A 2MO0A 2B63B 1KIXA 3HS0C 3STBD 1SSOA 1NMFA 1B50A 3UDXA 1QZGA 4JI3L 5BN4A 2K05A 2R93B 4PZ7A 3NENA 4JI8Q 1J8IA 1RODA 3N6RA 5JVH3 1HZCA 2NN6G 4HIOA 1GHJA 3CCQA 3M7GA 1HZBA 5EJWA 1Q82C 5E1FA 4B9WA 1BNZA 4RCNA 2L0CA 4LF8L 1E2VA 4K5VA 2EJFC 2UUAL 4LF5Q 5LMUL 3D31A 1EY0A 1TWGB 4GOPC 2IHEA 1JOKA 3BVMA 4FP5D 4G4KA 3H91A 1U9RA 3U58A 2X6LA 3GTPH 3VR4A 2B2TA 2ZTCA 2R3ZA 3K58A 1XYIA 3IKJA 4CKBA 1XNRL 2N55A 3VYSA 2D9UA 4ALPA 1GXDC 3UE0A 5LHY1 1KQSA 4L5TA 5CORA 2WP8J 5IE8A 1FR3A 2Z6BA 3NBHB 3CQZH 1QVFA 2L12A 1DJRD 3M4YA 4GNXB 3C3LA 1PFBA 1SNDA 2MO1A 3X3MA 1EWHA 3MC0B 4JOIA 3BDOA 4YWKA 4BBSB 2ZT9C 2E2JH 3HOWB 1JWUD 3F2DA 1OXTA 4DXGA 2IW3A 1FL0A 4DV6L 3ERSX 3MXNA 4LAAA 2JA8H 1YHQA 2NVTB 4CJ2C 5J39A 4OELB 3GTPB 3I4OA 2JA6H 5C4XB 1BVSA 1EY8A 3QB3A 4RFBA 1CFMA 3T16A 4HJ7A 2XWBB 4C3HB 4JI0L 3CCUA 1MI2A 1I4PA 2KCCA 2QCPX 4BWGB 1RTNA 3G48A 3C46A 2UUBL 4ZRZA 1RDPD 3I72A 4WRDA 5M3MG 4YCVA 1EIHA 1BO0A 3EIVA 2EYFA 1I4QA 2XWJB 1G51A 2F0OA 3E0EA 4A4IA 1PTOF 2I07B 2Q8TA 5FLMH 2F4VQ 1S5DD 5K5PA 3F2BA 2JJQA 3E9IA 1JJ2A 3DM3A 4JI5Q 4QUCA 3A55A 1WJJA 2YV5A 3HP3A 1GUTA 1WD0A 1N34Q 1LT5D 1X65A 1SMYD 4A3IH 3GTMH 3I4LA 4GLVB 3OYYA 2UUCQ 2HIXA 5LL6S 1QCBD 3OHXC 3FMCA 5C6AA 2WB1E 2AHOB 2QDLA 1X3FA 1HCZA 2BE5C 2M2LA 4FNFA 2IY5B 1RTOA 1A3TA 2XN9C 1E3PA 5C44G 2F4VL 3GP7A 1Z47A 2ICIA 1WCMB 1LV9A 2WACA 4ULLA 1AZPA 1C48A 1PYSB 2O5IC 1ILPA 2ZTDA 1Y1VH 1SN8A 5LMNW 4XYOA 2EYHA 2ES2A 4RKLA 2RHSB 2BA1A 1BBXC 3I4MH 2K52A 1IL2A 2B2VA 1VQ8A 3S1MB 1HPCA 4DR6Q 2F3IA 3U4VA 1MKHA 1B44D 5C44B 4LF6L 4LJZC 2DUDA 1CA5A 3T1YL 1XMQQ 4ID6A 4KY6A 1WTPA 3KJOA 2LMCB 4NKLA 4N9PA 5C4XH 4LWCA 2PQEA 3KLSX 4YWMA 1IW7D 2NVQB 1PZJD 4IFDI 2Q8RE 5ELFA 4GZYC 3HKZG 4EVOA 5JAVA 3RR5A 1FJGQ 2NVTH 1VF7A 1X32A 4O2DA 1EQTA 2DJFC 4JI8L 1OTCA 1B3AA 2B39A 4K6LA 3KLWA 3I4MB 1PMRA 2YYZA 1PYWD 2K01A 2CH4A 5C0XJ 2R7ZB 2HUGA 3NHHA 3CCLA 3HOVB 2VUMH 1VCIA 5FJ8G 1EEFD 2B2UC 1DGSA 4BY1G 3K6OA 1CHQD 5JEAJ 4BXXH 4L5RC 3SHLA 5I4DA 4PZ8A 1U4RA 4LF5L 4FXGC
chains in the Genus database with same CATH topology
1CT1D 1KABA 3HGBA 3DHQA 1BXTA 2K6AA 5K36H 3QO2A 1FYCA 1STHA 3BVZA 1ZKOA 1UUPA 1I50B 2MUYA 3HEJA 1IW7C 3LX0A 2AUKA 2E76C 4OIKA 4AYBB 2PW7A 3KK7A 1H9RA 3D4WA 1L0XB 3QOLA 4S3SA 3DWAA 1EL0A 3TN2A 3WDNA 1O78A 3U9OA 4IFDG 1EYDA 1Z6HA 4Y7NB 2JA8B 1X3PA 4DNRB 4IUQA 3ITPA 2EYLA 5D3IB 2SNMA 4V190 4H0LC 3C2PA 3BDCA 1WTOA 5D3DA 5CV5A 2B2YA 2F0UA 4A3MB 1EY7A 5IOCA 2LS01 2KEEA 2AUJD 4HCSA 3ND9A 1BOSA 1SEBD 4JBWA 1STAA 1O80A 3LNNA 1R4QB 4O42A 1S4ZA 4H7BA 1JCKB 1M8AA 1KLUD 2F0MA 3M4OB 2F0FA 4P2CB 4FF4A 2JA5B 4OHJA 2QILA 2B2TC 5A35A 5I6YA 2MGSA 5ISRA 2TMPA 1DOLA 2F1MA 3EVQA 4ZKBB 4KTAA 2F0NA 4KD4A 2F0IA 3I91A 2JYOA 4N9TA 2IX1A 3NP8A 5EGTA 1F2LA 4ZAIA 5BN3A 2BOSA 5EPKA 3PUXA 4XTCS 2RDHA 4OL7A 2EZVA 3OIPA 1Y8NB 1Y8OB 5C0XG 2K32A 3TP5A 3A7AB 1UEAB 1YNJD 3TSSA 4KV6A 3GTMB 1II3A 4H13C 2PO4A 5C5LA 1QE6A 2SOBA 4HR7B 3OPOA 4PV1C 2AQ1B 2IWHA 2L5TA 2EJMA 4IUTA 1C4QA 2KQ3A 4PQXA 1EOTA 3R2IA 4G7ZC 4Z9CB 4PMBA 4CKCA 3NBHA 1PRTD 3TDQA 1NR4A 3GTQB 1SYBA 3FKIB 5CC4A 3CQZB 2JSOA 2F0LA 2NUCA 1BUVT 2EYMA 3MZ5A 3BDLA 5KYIA 4BY1B 2K1BA 3KBGA 1U4PA 1BCPF 1LTRD 2NTTA 3E5SA 3I3CA 3H94A 1PZKD 1B2TA 3NQIA 2EXZA 2NN6I 2B2VC 5JEAH 1IYVA 5DNFA 2KECA 2K03A 1T5EA 1A3UA 3V2TA 3TBIB 3AMUA 2RBMA 4WORA 1D6EC 5CGKA 3BS1A 2KA7A 2OF1A 5FOBB 1B1ZA 4IUPA 5D65A 2RKSA 1AZQA 1MSHA 3QIAA 3K7AB 2EE1A 5BN5A 5E3FA 2EY5A 4HMIA 4ZUJA 5M5WB 2F03A 1ZYRC 1NUCA 2KHSA 5M3FB 2PNRC 5DM63 1QG7A 3HOUB 1STEA 1GHKA 1HFGA 2B2UA 1JICA 1O7YA 2K33A 5AFWA 5KNDA 4U673 1SDFA 3T4AC 1JWMD 4F7XA 4B9XA 2F0WA 1A2UA 2DNCA 3CRKC 1EY6A 1S5BD 3A7LA 4F87A 5JPMC 4DU9A 2C9OA 1B9NA 5C3EB 1EY9A 2MP1A 1QJOA 2EY1A 2R6GA 2NVYB 3GTLB 2B8GA 4R8NA 1WTRA 3PUZA 4TRDA 1SXTA 2K04A 3EQLC 1TIID 3J7AV 3K0YA 1SFOB 3K5MA 1K83B 1HUMA 2IJ0A 1WVLA 1LTAD 2F0KA 4I65A 5IIFA 1EYCA 1G2SA 1EU3A 4BA2I 4KN7C 3G7LA 5NUCA 1ESRA 5G3LD 3S16B 3TZUA 2NVXB 1QWYA 5FO9B 2JA6B 3NXWA 3A8IE 2B2YC 5I9PA 1ICWA 1QNKA 4QMGA 4IQZA 3VA5A 2B2WC 2L1BA 4RAUC 2IX3A 3K59A 1PDQA 3EA6A 3AU7A 3I4NB 4XDXA 2BE5D 5IGEA 2PZTA 5D14A 3I70A 1PRTF 1LABA 2NTSA 1LTSD 1U4LA 1V43A 4KY7A 1B9MA 4DFAA 3FDTA 1SE2A 5KGUA 2A6HD 3H09A 2ICEC 1KLGD 1XWEA 1Y1WB 3T56B 4J6HA 1TS4A 5DM73 1Q3LA 3J80E 2QF7A 4FYDA 3VR2A 3W2DA 1QILA 1F9QA 2A6HC 1D5ZC 5IODA 4A3IB 3S1QB 3GO5A 4JK1C 1XXGA 1Q1BA 3H0GB 5KNBA 1W6JA 3VA7A 3PO2B 1H9JA 3MTSA 5J22A 5CV8A 1O7LA 1JOOA 3MXUA 1KNAA 2JE6I 3SK4A 1XX8A 1CA6A 1EY4A 1QOHA 1LTBD 2L9HA 4DN4M 3S17B 3E6ZX 2XRSD 3NUCA 4LMQD 1S5CD 5K36G 3HZXA 2F4IA 1R9TB 1BDOA 1FNUA 4ZYSA 5I2XA 2VNUD 1X3QA 3TP8A 4O1NA 2CQAA 1ESFA 4L8JA 2I46A 1DOMA 3RLFA 3OWEB 2A6EC 1DCZA 1IL8A 3Q24A 1CHPD 4FXDA 1DZ1A 1CZWA 2F0HA 2D62A 1MBYA 3A56A 3MAQA 1ENFA 1HQMC 1KDBA 2BDOA 1I4GA 3MFGA 2AWOA 1W6KA 3BYTB 1FNVA 1TY2A 1YNJC 1ET9A 2XNAC 1IKMA 2XRQD 3Q0AA 4ODGA 3D6CA 1A15A 2TSSA 3H3VC 1DD2A 3M3YB 1LT4D 3J81L 1XTCD 4HSPA 1D5XC 4C56C 2B8FA 3NQTA 2C5CA 3DM1A 3FVQA 1I3QB 5KEEA 3PUYA 1HQRD 1LACA 4HSVA 4XT3B 3BG3A 3MA2B 4R9WA 3RMHA 2EYOA 1HRJA 1EFID 2F0VA 1SE4A 2O4XA 2R61A 3E0JA 4PNYA 1DXMA 3PIO3 3SXHA 4DAPA 1SNPA 4ZKCB 4KHZA 2LFNA 2KUMA 1EZ6A 3KLRA 3VR6A 1TR5A 2CVRA 5JPNC 1TY0A 2CW0D 5JJZA 1V8QA 5IGBA 5ELEA 3S2HB 1RF2D 1AW7A 2BDNA 5KRUA 4U68A 3G6JB 4HCEA 5E4XA 4NMZA 2OXPA 2O5JC 2NN6H 3TP7A 2R92B 4L6TB 2K28A 1BCPB 1KDCA 3LWUA 4UDUC 5CBAE 5IT9L 1ENCA 1H9SA 3NTIA 3MHBA 3SK8A 1CK1A 1PFMA 4M8AA 4HMJA 5EBDA 1QNUA 1U4MA 1SYCA 3MEHA 2PZWA 1HXYD 5I2YA 2F0TA 4Q0FA 4IURA 1Q12A 1EIGA 2PCFB 5FLXE 2HQEA 3NE5B 3M85A 4KMUC 2RDGA 3VR5A 5KIXA 3NTHA 5JVG3 2DN8A 2KVMA 5C3XA 3V96A 3NPPA 4A93B 2EYJA 2FFKB 1EYAA 4OGQC 2NB0A 4ILWA 4ABNA 1TS5A 4DXFA 2H1EA 2VB2X 4A3JB 1LT6D 2Z8LA 5ELDA 2BA0A 4FF1A 4XYQA 3BYYB 1LTGD 4MIUA 2B2WA 4BBRB 2AQ2B 2WV6D 3C1EA 3P20A 3DWQA 3OW7A 4RGNA 3RD4A 3D3RA 1A6XA 2EY6A 2A68C 2KJXA 1YNND 5C4ZA 1G91A 5JOBA 2N88A 2O2LD 1IHZA 2GA4B 3NWSA 1HA5A 5EPJA 4J8QA 1KAAA 1NR2A 4X3SA 3U9SA 3M7NA 2RSOA 2K7VA 1C8CA 3ZYYX 3S9WA 2ENBA 3I73A 5A2QL 1WTVA 2ID0A 4RA8A 5EKLA 1ENAA 2IL8A 2F0PA 1PTOH 4OIJA 4ZUIA 1TWFB 1LLRD 2WKDA 2LKVA 2F0GA 4CJ1B 4X3KA 4IZ8A 3EROA 1AFPA 1LTTD 4A3EB 3R93A 2F0EA 3MVVA 4CBVA 5C4HA 1GUGA 1K8MA 1CZGA 2JEAI 1Q1EA 3HKZB 2F3VA 2EY2A 3K5OA 5T1GA 3SVMA 3ND8A 1I6HB 4QB4A 4FF2A 2KCNA 1V1PA 4R8IA 1Y1VB 3OOCA 1GUWA 3HOXB 2G9HD 5E4WC 2SEBD 5FK9C 4A3BB 1LT3D 4E6IA 2JXMB 4KY5A 2RVLA 5EQ0A 1ET6A 4F8MA 3GTOB 4J1MA 3VR3A 2QDBA 3GTKB 1Q90A 3JAME 3L3OC 1LTID 2J4XA 5FO7B 3N52A 5C5MA 4RGOS 1EWCA 1G2TA 3LWEA 5IT9E 2Z1CA 3K5LA 4DAVA 1NCVA 5HGTA 1HTLD 5CV6A 3OSOA 4K2LA 3KF8A 1F9RA 1SYDA 2F0JA 1WTWA 2A6ED 3EJIA 3FPPA 2VXWA 4KI0A 2F0SA 1TKWB 5FKAC 4WFN3 1NAPA 2FJ2A 1Y69U 3SK6A 2XSCA 2VUMB 4BS9A 1FNWA 3Q22A 4KHVA 5IGGA 1F2YA 4KD3A 4RH6A 1ZEQX 5CMDA 2NBFA 3HOZB 1TQOA 3A54A 2IX0A 1EEID 2F0DA 3H6MA 2BCOA 5F2DA 1Q8IA 4CKEA 4K5XA 2E2JB 2HCIA 4PMWA 3OMGA 2VB3X 1ZXTA 2K5WA 1FD7D 2A69D 2H4OA 4C1NI 3J7YW 1MSGA 4HAEA 1OXVA 2A5HA 3L9AX 5C0XI 1I4RA 4ME5A 1SMYC 1YNNC 2RA4A 1TT2A 3CHBD 1BCPC 2IPKD 3O13A 4XIGS 2L4NA 1HUNA 4G7HC 2NZ1D 4RCOA 4K5WA 4NW2A 1DONA 3MXGA 3TMEA 1JC7A 2XVSA 5DEHA 1SAPA 5IGCA 1F9PA 1M4VA 2M00A 1G291 1EY5A 3V05A 3HOYB 1F9SA 1B4OA 2E2HB 1WTXA 4ZQ3A 3GV3A 1SYGA 5HURA 2DY8A 4HEDA 3GTGB 1STNA 1OXSC 4RGMA 3DUZA 1VMPA 3D8GA 1RHPA 2OEOA 1GUOA 3L7ZC 4C3IB 1CI3M 5DAUA 4CGYB 1KDAA 4C2MB 1A2TA 5IGDA 5I9OA 3GTJB 3SE0A 2E2IB 3Q23A 1V1OA 3IL8A 1SJED 4G7OC 3SR1A 1CQFA 4G57A 4KK7A 3P75A 1RJTA 1CQVA 1RCVD 3S1RB 4UAIA 4XXEA 5CBEE 1D2BA 1I6VC 4ZLTF 5KYLA 3DXJC 4KN4C 5JEAG 2FINB 4B08A 1PRTB 2SDFA 4K2KA 1ZYRD 4KJOA 1CM9A 4A3FB 1PXUA 5IGFA 3R3OA 1ML0D 3BVGA 4DK0A 1Y8PB 4C3IG 2MJ8A 4V0BA 2E74C 3T13A 4TSSA 1STYA 5M5XB 1B53A 3GQBA 3TZDA 5EKIA 3DEPA 1SBBB 2MPMA 4A3DB 2FMMA 3VYRA 3WOFA 1NSNS 4RGTA 5C3WA 1S5FD 2J7ZA 2KOLA 3OWFA 2YU9B 1PFNA 2F3WA 3S2DB 3CRLC 4DK1A 3J7AF 2X69A 4RHSA 1JB3A 4YIJA 2FHTA 4C3JB 4DGZA 4C3JG 5FLXL 3DMUA 1WTQA 4CJ0B 1TS3A 3AB9A 4OO1G 1HFNA 5M9OA 3NWTA 5TSSA 4IFDJ 4QF4A 3URYA 5LL6X 1H9MA 3S15B 2DNEA 5J1ZA 5CV9A 4I7ZC 2G9DA 2PPBC 4XQNA 2D5DA 1PLFA 4XQQA 2ZXOA 4OO1H 4KKTA 3R2TA 1S5ED 5ELBA 1AP0A 5CV7A 1DM0B 5M3MB 1PTOD 4RWSC 4DF7A 1G8ZD 1DYQA 1UNSA 3NBIA 2SNSA 4QUFA 2AQ3B 4KKSA 2WINB 1TS2A 3IFDA 5I6WA 4H44C 3QOJA 1F77A 1T5XD 3FRPB 5CV4A 3OIQA 5ELCA 3PUWA 3K57A 4XT1B 1QB5D 2QEJC 1IYUA 5M5YB 3MXPA 4OO1I 2OT2A 1DOKA 1BQQT 3JAML 2EYPA 2RDFA 3OMCA 1K8OA 1JWSD 1H9KA 2RQXA 3QJYA 1V1PB 3KBXA 4CHTB 4DA2A 3GV6A 1MD2D 1SYFA 1AN8A 3DWPA 5CYUA 5KNCA 2EPBA 4K8JA 1EQVA 3HG9A 4FF3A 1CTMA 2PZUA 4IUUA 2WB1B 2K5DA 4NP5A 3K5NA 2FMCA 1SNCA 1SNQA 1VMCA 3D4DA 1PZID 2EVBA 1JQYD 1TU2B 4XQJA 4X3UA 4HTHA 3KUPA 3P7JA 4KKUA 3PO3B 1E2ZA 1LO5D 2Q8IB 4EQPA 3T53B 3W3AA 5CR3A 2WAQB 1TWHB 1BF4A 5A2QE 2E75C 3SEBA 2PW5A 1STBA 1H9SB 3QG1A 1MGSA 1RKNA 1SE3A 2D2CC 1RD9D 4IN3A 1JR0D 2L55A 1R4PB 3QWNA 4IUNA 3MWYW 4K14A 5C4JB 2WIIB 3X3NA 4X3TA 3WOEA 1HTPA 1O7ZA 4QIWB 3PUVA 5EBCA 2DY7A 3F2UA 1BR9A 2X6GA 4Q5VA 3PMFA 1UAPA 1ONLA 1L0YB 1TWAB 3Q6SA 4LK1C 4DAYA 2M9VA 4L63B 3NK9A 1F2MA 3NSWA 3J81E 4WJWA 5C0XH 2F0QA 2Z4HA 4K8IA 4HN7A 4TKOB 5COYA 3R8BA 5EKKA 2JEBI 1JE4A 2A73B 2EDGA 4EQNA 3IFTA 5G3LF 4IFDH 4MN3A 1PTOB 4MHEA 3CU7A 1GUNA 1TWCB 2A68D 1IKLA 3RZOB 1EU4A 1KNEA 2HDLA 5T1IA 3J80L 1D5MC 3FEWX 1SYEA 4ZK9B 3RZDB 2E2DC 1PTOC 3VYUA 2EJGC 1I4HA 1OO9B 3TP6A 3C1FA 4RHRA 2JP1A 3KLSA 1GJXA 3A8KE 3I8ZA 4FVMA 1OXUA 1AEXA 4NDXA 1ILQA 3NTKA 2A74C 1E0BA 2MHVA 4C1NK 4QCLA 2QKIC 4BY7B 3P1HA 1GOZA 2LY7A 4IUVA 3D6WA 4RKBA 1KTKA 3DEOA 1J9OA 4FO2A 2AWNA 3T51B 1F2ZA 4BA1I 1Z7TA 2IT1A 2L11A 1SJHD 2PYKA 2Z4IA 3MFYA 4EQOA 1JORA 3GD7A 3CKIB 1D1IA 2EOTA 5FO8B 2HCCA 4C3HG 3ONAB 3A8JE 1JOQA 3VYTA 4PMCA 1OXXK 3S14B 3I90A 4F88A 1SNOA 3PV0A 1A3VA 4FXKC 2Y0SB 5EPLA 2JA7B 1GUSA 1VDZA 4M1UB 3SDZA 2J0TD 1HA6A 2ZXPA 2K5QA 2NYZD 1D1KA 1WD1A 2ZXRA 4A3GB 4DNTB 1PRTC 1EZ8A 2CW0C 1I4XA 2HDMA 3ERQA 1G6ZA 3UI2A 2NWGA 4IALA 1TVXA 2XIWA 1VF5C 3PIP3 1BCPD 3S1NB 3HRZC 1FGBD 3D4RA 3FPUB 1E2WA 2PMZB 2A69C 3RUZA 2RSNA 3EFXD 4K6DA 1STGA 4A3KB 1HHVA 3BZDB 4EGVA 2CHBD 3IAYA 2V4DA 4KJNA 2WKCA 4TQUS 1SNMA 2KEDA 3SK5A 2B63B 3HS0C 1SSOA 1B50A 5BN4A 2K05A 2R93B 1J8IA 1RODA 3N6RA 5JVH3 2NN6G 1GHJA 3M7GA 5EJWA 5E1FA 4B9WA 1BNZA 4RCNA 2L0CA 1E2VA 4K5VA 2EJFC 3D31A 1EY0A 1TWGB 1JOKA 3BVMA 4FP5D 3H91A 1U9RA 4G4KA 2X6LA 3VR4A 2B2TA 2R3ZA 3K58A 1XYIA 3IKJA 4CKBA 2N55A 3VYSA 2D9UA 1GXDC 5LHY1 5CORA 2WP8J 1FR3A 2L12A 1DJRD 3M4YA 3C3LA 1PFBA 1SNDA 3X3MA 1EWHA 3MC0B 3BDOA 4BBSB 2ZT9C 3HOWB 1JWUD 1OXTA 4DXGA 2IW3A 3MXNA 4LAAA 2NVTB 4CJ2C 5J39A 3GTPB 5C4XB 1EY8A 3QB3A 4RFBA 1CFMA 3T16A 2XWBB 4C3HB 1MI2A 1I4PA 2KCCA 2QCPX 4BWGB 1RTNA 3C46A 4ZRZA 1RDPD 3I72A 4WRDA 1EIHA 1BO0A 2EYFA 1I4QA 2XWJB 2F0OA 1PTOF 2I07B 2Q8TA 1S5DD 5K5PA 4QUCA 3A55A 3HP3A 1GUTA 1WD0A 1LT5D 1SMYD 3I4LA 5LL6S 1QCBD 3OHXC 3FMCA 5C6AA 1HCZA 2BE5C 2M2LA 4FNFA 1RTOA 1A3TA 2XN9C 3GP7A 1Z47A 2ICIA 1WCMB 1LV9A 2WACA 4ULLA 1AZPA 1C48A 2O5IC 1ILPA 4XYOA 2EYHA 4RKLA 2BA1A 1BBXC 2B2VA 3S1MB 1HPCA 1B44D 5C44B 4LJZC 1CA5A 4ID6A 4KY6A 1WTPA 2LMCB 4NKLA 4N9PA 2PQEA 3KLSX 1IW7D 2NVQB 1PZJD 4IFDI 2Q8RE 5ELFA 4GZYC 4EVOA 5JAVA 1VF7A 1X32A 1EQTA 3I4MB 1B3AA 2B39A 4K6LA 1PMRA 2YYZA 1PYWD 2K01A 5C0XJ 2R7ZB 2HUGA 3NHHA 3HOVB 1VCIA 1EEFD 2B2UC 3K6OA 1CHQD 5JEAJ 3SHLA 5I4DA 1U4RA 4FXGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJW A;  3HP3 A;  2VXW A;  2X69 A;  1WD0 A;  1VMP A;  4IUR A;  2EOT A;  3QO2 A;  1RHP A;  2HCC A;  2FHT A;  2B2T C;  3ONA B;  1BNZ A;  1EIG A;  5COY A;  2K1B A;  3KBX A;  1JE4 A;  1WTV A;  1Q3L A;  1NAP A;  2FJ2 A;  3I90 A;  1IKM A;  1U4P A;  2MGS A;  1WTQ A;  2MP1 A;  3GV6 A;  4CJ0 B;  2EPB A;  4RA8 A;  1A15 A;  2IL8 A;  5EPL A;  3H91 A;  2M2L A;  2X6L A;  1F9Q A;  2B2T A;  3I3C A;  4MN3 A;  4OIJ A;  1WTR A;  1DOL A;  2KVM A;  1RTO A;  2R3Z A;  4ZKB B;  1B2T A;  5CMD A;  1XYI A;  4MHE A;  4IUU A;  2K04 A;  1HA6 A;  2N55 A;  2D9U A;  3IL8 A;  1LV9 A;  2B2V C;  3I91 A;  4CJ1 B;  1AZP A;  2JYO A;  2NYZ D;  5COR A;  1WD1 A;  2FFK B;  5DNF A;  1VMC A;  1HUM A;  1IKL A;  2KEC A;  4OIK A;  4X3K A;  1ILP A;  1F2L A;  3DM1 A;  4ZAI A;  2K03 A;  1WVL A;  2L12 A;  3MTS A;  3R93 A;  2HCI A;  1KNE A;  2HDL A;  1RJT A;  1PFB A;  1ZXT A;  5T1I A;  4HSV A;  1BBX C;  1G2S A;  4X3U A;  4XT3 B;  4ZK9 B;  3KUP A;  5EPK A;  2HDM A;  3P7J A;  2B2V A;  4UAI A;  3UI2 A;  1G6Z A;  1PLF A;  4R9W A;  5CBE E;  2H1E A;  2NWG A;  4QUC A;  1HRJ A;  3G7L A;  1TVX A;  1KNA A;  2XIW A;  4ZLT F;  1MSG A;  1ESR A;  4HAE A;  4ZKC B;  1AP0 A;  3TN2 A;  1EL0 A;  1XX8 A;  1CA6 A;  2JP1 A;  5T1G A;  3SVM A;  2FIN B;  2L9H A;  1CA5 A;  2KUM A;  3FPU B;  4DN4 M;  2SDF A;  1BF4 A;  3I8Z A;  2B2W A;  1CM9 A;  4IUP A;  4LMQ D;  1WTP A;  4RWS C;  5D65 A;  4R8I A;  4CJ2 C;  1X3P A;  1AZQ A;  1GUW A;  1MSH A;  1MGS A;  1ML0 D;  4IUQ A;  2CVR A;  2RSN A;  2RA4 A;  2EE1 A;  2B2Y C;  5E4W C;  4QUF A;  5JJZ A;  3MWY W;  1ICW A;  1QNK A;  2L4N A;  1ILQ A;  1MI2 A;  1QE6 A;  2BDN A;  2RVL A;  2B2W C;  2NZ1 D;  4U68 A;  1X3Q A;  5EQ0 A;  1HHV A;  1HUN A;  2Q8R E;  1RTN A;  3IFD A;  2L1B A;  4NW2 A;  2MJ8 A;  4X3T A;  1WTO A;  4RAU C;  1QG7 A;  1DON A;  5E4X A;  1X32 A;  1G91 A;  2B2Y A;  1E0B A;  1EQT A;  1PDQ A;  4IUT A;  1B53 A;  1O7Z A;  1DOM A;  2N88 A;  1EIH A;  1B3A A;  1BO0 A;  1HFN A;  1SAP A;  1IL8 A;  1EOT A;  4XDX A;  3N52 A;  1HFG A;  5EKI A;  3TZD A;  2B2U A;  5D14 A;  3DEP A;  2DY7 A;  1JIC A;  1O7Y A;  2KEE A;  1F9P A;  2X6G A;  3F2U A;  2KED A;  2K28 A;  2K01 A;  5EPJ A;  4IUV A;  4XT1 B;  2MPM A;  3D6W A;  2FMM A;  5AFW A;  1SSO A;  3DEO A;  2HUG A;  4HCS A;  1B50 A;  3LWE A;  5CBA E;  1SDF A;  1NR2 A;  1G2T A;  1J9O A;  1U4L A;  1NCV A;  2Q8T A;  1NR4 A;  2K05 A;  1F9S A;  1O80 A;  4X3S A;  1B4O A;  1DZ1 A;  3Q6S A;  1WTX A;  2J7Z A;  2KOL A;  1J8I A;  1ROD A;  2B2U C;  2RSO A;  3FDT A;  1F9R A;  1PFM A;  3GV3 A;  1C8C A;  4O42 A;  1WTW A;  1DOK A;  2DY8 A;  1PFN A;  2L11 A;  4HED A;  1S4Z A;  1U4R A;  1M8A A;  1U4M A; 
#chains in the Genus database with same CATH topology
 1CT1 D;  4LUV A;  1KAB A;  3HGB A;  4L5S A;  3DHQ A;  1BXT A;  2K6A A;  1N8R C;  5K36 H;  3QO2 A;  1FYC A;  3S2D H;  3CPW A;  1EWI A;  2EIF A;  4DAY B;  4DUZ Q;  1STH A;  3L2P A;  4GN4 B;  1NMG A;  1XMO Q;  1YI2 A;  3BVZ A;  3H0G G;  1ZKO A;  2K14 A;  1UUP A;  1I50 B;  5IT9 c;  2MUY A;  1PYB A;  3HEJ A;  1IW7 C;  3LX0 A;  2AUK A;  3TEH B;  2XGT A;  4JI6 Q;  4WJ3 M;  4JV5 Q;  2E76 C;  4OIK A;  4AYB B;  2PW7 A;  3KK7 A;  2VQF Q;  1H9R A;  3D4W A;  1E1O A;  1L0X B;  1HNW L;  3MEF A;  3QOL A;  4GN5 A;  4S3S A;  3DWA A;  5C44 H;  1EL0 A;  3TN2 A;  3WDN A;  1XMO L;  1CKM A;  1O78 A;  4DKA C;  3U9O A;  4QY7 A;  1FGU A;  4IFD G;  1EYD A;  1Z6H A;  4Y7N B;  2JA8 B;  1X3P A;  4DNR B;  4IUQ A;  3ITP A;  2EYL A;  5D3I B;  2SNM A;  4V19 0;  3S1M H;  5JJI A;  2QEX A;  2PI2 A;  4H0L C;  3C2P A;  1I5F A;  3PO2 G;  2PI2 E;  3BDC A;  3TRE A;  1O7I A;  1WTO A;  5D3D A;  5CV5 A;  2B2Y A;  2F0U A;  3HOY G;  4B3S L;  4A3M B;  4LUZ A;  2PQA A;  1KXL A;  1EY7 A;  5IOC A;  4CDF C;  2LS0 1;  2KEE A;  1QVG A;  2AUJ D;  3UDI A;  4HCS A;  3ND9 A;  1BOS A;  1SEB D;  2ZM6 L;  4JBW A;  1STA A;  1O80 A;  3LNN A;  2EQS A;  3S17 H;  1R4Q B;  4JI4 Q;  4O42 A;  4ZCK A;  3GTJ H;  3TRZ A;  1UWV A;  1S4Z A;  4H7B A;  1JCK B;  1M8A A;  1KLU D;  2F0M A;  2E8G A;  4YHH L;  4DV0 Q;  3M4O B;  4P2C B;  2F0F A;  1S3O A;  4FF4 A;  2JA5 B;  4OHJ A;  1AE3 A;  2QIL A;  1QUQ B;  2B2T C;  4A3G H;  1UE1 A;  5A35 A;  1VQH A;  1IZ6 A;  5I6Y A;  2MGS A;  4LF7 L;  2NZH A;  5ISR A;  2TMP A;  4MTN A;  1YZ6 A;  1L2F A;  2OTL A;  1Q8K A;  1DOL A;  2F1M A;  3EVQ A;  4ZKB B;  4KTA A;  2F0N A;  4KD4 A;  3I4N G;  2F0I A;  1BBW A;  1M1K C;  4JOI C;  1K9M C;  3I91 A;  2PQA B;  1RL2 A;  2JYO A;  4N9T A;  2IX1 A;  3NP8 A;  2WAQ E;  5EGT A;  1F2L A;  4ZAI A;  5J3B A;  1JMC A;  3VDY A;  4DNI A;  4X64 L;  5BN3 A;  1U5K A;  2BOS A;  5EPK A;  3PUX A;  3S16 H;  4XTC S;  2HHH Q;  2RDH A;  1GD7 A;  3RNU A;  4OL7 A;  2EZV A;  3OIP A;  3BU2 A;  1Y8N B;  3K81 C;  1FVI A;  3GTQ H;  4OEM B;  1Y8O B;  5C0X G;  1WFQ A;  2K32 A;  2JA7 G;  3TP5 A;  3A7A B;  1UEA B;  4APV A;  1YNJ D;  3TSS A;  4KV6 A;  1HR0 W;  3GTM B;  1II3 A;  3PO3 H;  4H13 C;  2PO4 A;  5C5L A;  4DV0 L;  1QE6 A;  2SOB A;  4HR7 B;  3PGZ A;  3OPO A;  4PV1 C;  2AQ1 B;  2IWH A;  1EIF A;  4H02 A;  2L5T A;  2EJM A;  4IUT A;  1C4Q A;  1TXY A;  2KQ3 A;  1KHI A;  1N9W A;  4PQX A;  3H3V H;  1EOT A;  3R2I A;  2VZA A;  4NXM Q;  4G7Z C;  4Z9C B;  4PMB A;  1K83 H;  4CKC A;  3NBH A;  1PRT D;  3TDQ A;  1NR4 A;  3GTQ B;  1SYB A;  3FKI B;  5CC4 A;  3CQZ B;  2JSO A;  2F0L A;  3L0O A;  4A3B G;  1SRO A;  4YY3 L;  2NUC A;  1BUV T;  2EYM A;  1IBL Q;  4DV1 Q;  3T1Y Q;  1XMQ L;  3MZ5 A;  3BDL A;  4YCU A;  5KYI A;  4BY1 B;  2K1B A;  1WTH A;  2Z0S A;  1IYJ B;  3KBG A;  1U4P A;  1YIT A;  4AIM A;  1B8A A;  1BCP F;  1LTR D;  2NTT A;  3E5S A;  4A3E H;  4JW0 A;  4NXM L;  3I3C A;  3H94 A;  1PZK D;  4GS3 A;  2RF4 A;  3U4Z A;  2VQF L;  2JA8 G;  1B2T A;  4R4O A;  3NQI A;  4DV5 Q;  2EXZ A;  3AYH B;  1IBM Q;  3AEV A;  2NN6 I;  3CC4 A;  1A63 A;  1J6Q A;  2MFI A;  2B2V C;  3H3V I;  3LGJ A;  5JEA H;  2JA5 G;  2B29 A;  3PSI A;  1IYV A;  5DNF A;  2KEC A;  2K03 A;  1NE3 A;  1T5E A;  3ULP A;  4OON A;  1A3U A;  3V2T A;  3TBI B;  4DV3 L;  3AMU A;  1MJC A;  2RBM A;  4WOR A;  1D6E C;  5CGK A;  4DPG A;  3BS1 A;  2UXB L;  5JJK A;  4A3E G;  4DR4 L;  4R4I A;  2KA7 A;  2OF1 A;  4DV2 Q;  5FOB B;  1B1Z A;  1XNR Q;  1I6H H;  3D0F A;  3K8A A;  5IP9 H;  1N36 L;  4IUP A;  2L15 A;  5D65 A;  4DR2 L;  2RKS A;  1AZQ A;  1IXR A;  1MSH A;  3QIA A;  3K7A B;  2EE1 A;  1ASZ A;  5BN5 A;  5E3F A;  4AYB E;  2EY5 A;  4HMI A;  4ZUJ A;  5M5W B;  2F03 A;  3E9H A;  1X9N A;  1ZYR C;  1NUC A;  3S1N H;  2KHS A;  5M3F B;  2LSS A;  2PNR C;  5DM6 3;  1QG7 A;  4QGU A;  4UP7 A;  3I2Z A;  1HNX Q;  3HOU B;  4GKJ L;  3CW2 C;  1STE A;  2UXB Q;  1GHK A;  1HFG A;  1A8V A;  2B2U A;  1JIC A;  1O7Y A;  4JI6 L;  2K33 A;  5AFW A;  4FDB A;  5KND A;  1SDF A;  4U67 3;  2QA4 A;  1IBM L;  5M3M H;  1HR0 Q;  1XTD A;  3T4A C;  2FXQ A;  1JWM D;  4F7X A;  4B9X A;  4OWX B;  3PCO B;  1VQ7 A;  2F0W A;  2R93 G;  1A2U A;  2DNC A;  3PO3 G;  3CRK C;  1EY6 A;  5M5W H;  1S5B D;  2JA6 G;  3G71 A;  3A7L A;  4F87 A;  5JPM C;  4DU9 A;  2C9O A;  1B9N A;  5C3E B;  1EY9 A;  2MP1 A;  1QJO A;  2EY1 A;  2R6G A;  1R9T H;  2NVY B;  3HOZ G;  3GTL B;  2B8G A;  4R8N A;  1WTR A;  1Q86 C;  3PUZ A;  2K75 A;  4TRD A;  1SXT A;  1HR0 L;  4A3L H;  2K04 A;  3EQL C;  1Q81 C;  1TII D;  3F8T A;  2KHI A;  2RCN A;  3J7A V;  3K0Y A;  1SFO B;  3K5M A;  1K83 B;  1HUM A;  2KBN A;  2IJ0 A;  1K0R A;  1WVL A;  4NXN L;  1LTA D;  2F0K A;  1KL9 A;  3Q8D A;  1PH4 A;  2G5D A;  4I65 A;  5IIF A;  3I4N H;  1EYC A;  1G2S A;  2NZO A;  1AH9 A;  1EU3 A;  4BA2 I;  4KN7 C;  2JK8 A;  1X3E A;  1JB7 A;  5FLX c;  3G7L A;  1IBK L;  5NUC A;  2R7Z H;  1ESR A;  5G3L D;  2WB1 G;  3CPF A;  3S16 B;  3TZU A;  2NVX B;  4BY7 G;  1QWY A;  4A93 G;  4IO9 A;  5M5X H;  4A3G G;  5FO9 B;  4X62 L;  3NXW A;  2JA6 B;  3A8I E;  2B2Y C;  1VQ4 A;  1ICW A;  1QNK A;  4QMG A;  2D0O A;  5I9P A;  4IQZ A;  2N78 A;  4C3H H;  2KEN A;  3VA5 A;  2QGQ A;  3G4S A;  2B2W C;  3KDF A;  2L1B A;  1MHW C;  4RAU C;  2IX3 A;  3J7Z C;  3CXC A;  1Q7Y C;  3K59 A;  4LF6 Q;  1PDQ A;  3EA6 A;  4A3F H;  3AU7 A;  3I4N B;  4XDX A;  2BE5 D;  3W5O A;  1GVP A;  5FJ8 H;  2PZT A;  5D14 A;  1MIU A;  5IGE A;  3I70 A;  1HZA A;  1PRT F;  2R92 G;  1LAB A;  2NTS A;  4B3T Q;  1CKO A;  1LTS D;  1U4L A;  3RLN A;  3HOY H;  1V43 A;  4DR3 L;  4DV1 L;  4DV4 L;  4KY7 A;  2C35 B;  1B9M A;  4DFA A;  4P72 A;  3FDT A;  2I0Q A;  1SE2 A;  2HHH L;  2VQE L;  5GAD C;  3RZO H;  5KGU A;  2A6H D;  3H09 A;  1I94 Q;  2ICE C;  1KLG D;  1XWE A;  1CKN B;  1Y1W B;  3T56 B;  1AE2 A;  4J6H A;  4OWW B;  1XPR A;  1TS4 A;  5DM7 3;  1Q3L A;  4DUZ L;  3J80 E;  2K4K A;  3HOX G;  4GOP B;  1HNW Q;  1UEB A;  2QF7 A;  2WFW A;  4FYD A;  3VR2 A;  3W2D A;  5IY0 A;  1QIL A;  1F9Q A;  4C2M H;  4Y7N H;  2A6H C;  2GVA A;  4DR5 Q;  1D5Z C;  5IOD A;  4A3I B;  3S1Q B;  3GO5 A;  4JK1 C;  1XNQ Q;  1XXG A;  1Q1B A;  3AFQ A;  3H0G B;  5KNB A;  1W6J A;  3VA7 A;  3PO2 B;  1H9J A;  4LF9 L;  4JYA L;  1MJE A;  3MTS A;  5J22 A;  5CV8 A;  1O7L A;  1JOO A;  3MXU A;  1KNA A;  2JE6 I;  3SK4 A;  3JC6 6;  1L1O C;  1XX8 A;  1CA6 A;  1EY4 A;  1QOH A;  1LTB D;  2L9H A;  4DR3 Q;  4DN4 M;  3S17 B;  3E6Z X;  2XRS D;  3NUC A;  4LMQ D;  1S5C D;  5IYB G;  4N8X 1;  5K36 G;  4A75 A;  3HZX A;  2F4I A;  1LYL A;  1R9T B;  1BDO A;  1FNU A;  4ZYS A;  3HOZ H;  3GDE A;  5I2X A;  2N3S A;  2VNU D;  1X3Q A;  4DR6 L;  4HID A;  1K8G A;  3TP8 A;  4X65 L;  4O1N A;  2CQA A;  1V9P A;  1ESF A;  4LFB L;  1KC8 C;  1EOV A;  4L8J A;  2I46 A;  3KFU A;  1DOM A;  3RLF A;  3RZD H;  4DV4 Q;  1NTG A;  2A6E C;  1DCZ A;  3OWE B;  4JPB W;  4O0A A;  1IL8 A;  3Q24 A;  1CHP D;  1VQI A;  4FXD A;  2CFM A;  1DZ1 A;  1CZW A;  2F0H A;  3CP0 A;  3HOV H;  1VQE A;  2D62 A;  1MBY A;  3BJU A;  1XNQ L;  3A56 A;  3MAQ A;  2NVX H;  4I7A A;  2YU9 H;  5ELN A;  1ENF A;  1HQM C;  1K8A C;  4DR7 Q;  2Q2U A;  1PH8 A;  1KDB A;  2BDO A;  1I4G A;  1HNZ Q;  1X54 A;  1HH2 P;  3MFG A;  1Y1W H;  2AWO A;  1W6K A;  3CD6 A;  2H5X A;  3BYT B;  1FNV A;  1TY2 A;  1YNJ C;  1ET9 A;  2XNA C;  1NBW A;  3CCE A;  1IKM A;  5M5Y H;  2XRQ D;  3Q0A A;  1CSP A;  1SRU A;  4ODG A;  2Q2T A;  3D6C A;  3ER0 A;  1A15 A;  1C9O A;  2TSS A;  3H3V C;  1A62 A;  4B3R L;  1DD2 A;  1PVO A;  3M3Y B;  3FP9 A;  1LT4 D;  3J81 L;  4UPA A;  1XTC D;  4HSP A;  3I4M G;  4JI3 Q;  1D5X C;  4C56 C;  2B8F A;  4A76 A;  1UE7 A;  2Z6K A;  3F2C A;  3NQT A;  2C5C A;  3DM1 A;  3FVQ A;  1YIJ A;  1I3Q B;  5KEE A;  4R4C A;  3PUY A;  1HQR D;  1I50 H;  1LAC A;  4HSV A;  4XT3 B;  3BG3 A;  3HKS A;  1LTL A;  3MA2 B;  4R9W A;  3RMH A;  2EYO A;  1HRJ A;  1EFI D;  2F0V A;  1SE4 A;  5IWA Q;  4LFA Q;  2O4X A;  2OTJ A;  2R61 A;  3E0J A;  4PNY A;  1DXM A;  2K5V A;  3SXH A;  4DAP A;  1SNP A;  4ZKC B;  3PIO 3;  4KHZ A;  2LFN A;  2KUM A;  1EZ6 A;  1EIY B;  3KLR A;  3FKI G;  3VR6 A;  1TR5 A;  2P5Z X;  3KF6 B;  2E2I H;  2CVR A;  5JPN C;  3J80 c;  1TY0 A;  2CW0 D;  5JJZ A;  1V8Q A;  5IGB A;  5ELE A;  2R93 H;  3S2H B;  1RF2 D;  1AW7 A;  2BDN A;  3A5Z B;  5KRU A;  4U68 A;  2K5H A;  5AJ3 L;  4BY1 H;  3EN2 A;  3G6J B;  4HCE A;  4DV7 L;  5E4X A;  1CSQ A;  1YHB A;  4NMZ A;  2OXP A;  2VUM G;  4LNQ A;  2VW9 A;  2O5J C;  2NN6 H;  1PFS A;  3TP7 A;  1G6P A;  2R92 B;  1VQC A;  3G6E A;  4B3R Q;  4L6T B;  2K28 A;  1BCP B;  3TQY A;  3LWU A;  1KDC A;  2I5M X;  4UDU C;  1YHA A;  3FHW A;  5CBA E;  5IT9 L;  1ENC A;  1H9S A;  4B3M Q;  3NTI A;  3MHB A;  4A3K H;  3SK8 A;  1CK1 A;  3CAM A;  5JJL A;  2UU9 Q;  4DK6 C;  1PFM A;  4M8A A;  2OCE A;  4HMJ A;  5EBD A;  1QNU A;  2VL6 A;  1U4M A;  1SYC A;  3MEH A;  2PZW A;  4YY3 Q;  1HXY D;  5I2Y A;  4JI0 Q;  4JI7 Q;  2F0T A;  4Q0F A;  1VQK A;  4IUR A;  1KRS A;  1Q12 A;  1EIG A;  3STB C;  3ZJY C;  2PCF B;  5FLX E;  4A3D H;  1J5E Q;  1TWA H;  2HQE A;  3NE5 B;  1VQL A;  3M85 A;  3PIP A;  4KMU C;  2RDG A;  3VR5 A;  5KIX A;  3NTH A;  5JVG 3;  2DN8 A;  2KVM A;  1SLJ A;  5C3X A;  4HIM A;  3V96 A;  3NPP A;  4A93 B;  2EYJ A;  4AYB G;  1Y1V G;  4DR2 Q;  2FFK B;  1K3R A;  1EYA A;  2ZTE A;  4OGQ C;  2NB0 A;  3M9B A;  3W1G A;  5BR8 L;  4J15 A;  3U50 C;  4ILW A;  4ABN A;  3M4P A;  1TS5 A;  4DXF A;  2H1E A;  2VB2 X;  4DV2 L;  4A3J B;  4DR4 Q;  2V1C C;  1K73 C;  1HNX L;  1LT6 D;  2Z8L A;  5ELD A;  2BA0 A;  4FF1 A;  4XYQ A;  1TWH H;  3BYY B;  1LTG D;  4MIU A;  2B2W A;  4BBR B;  2AQ2 B;  4CDC C;  2WV6 D;  3C1E A;  3HOW G;  3P20 A;  4PG3 A;  3DWQ A;  4K0K L;  4N8F A;  1T9H A;  4A3B H;  4JG2 A;  3OW7 A;  4RGN A;  3RD4 A;  5IYD G;  2GN5 A;  4CDE C;  3D3R A;  1A6X A;  2EY6 A;  2A68 C;  2JA9 A;  2KJX A;  1YNN D;  2AMC B;  5C4Z A;  5LMN L;  1H95 A;  2N8N A;  5JOB A;  1G91 A;  1PV4 A;  3KYH C;  2N88 A;  2O2L D;  2NVY H;  1YBY A;  1IHZ A;  2GA4 B;  3NWS A;  2IHF A;  2ZJR A;  1HA5 A;  5EPJ A;  4YCW A;  4J8Q A;  1PH2 A;  1KAA A;  3RN2 A;  4JBJ A;  1NR2 A;  1ICF B;  4X3S A;  3U9S A;  3M7N A;  2RSO A;  2K7V A;  1C8C A;  1SMX A;  2R92 H;  3ZYY X;  3S9W A;  4BY7 H;  4GKJ Q;  3RN5 A;  2ENB A;  2E5L Q;  3I73 A;  4C3I H;  2ALY B;  1YNX A;  5A2Q L;  4JI4 L;  2HQL A;  4IPG A;  1WTV A;  1B7Y B;  2ID0 A;  4JI1 Q;  1ASY A;  4RA8 A;  5EKL A;  1ENA A;  3HOU G;  2IL8 A;  2F0P A;  1E1T A;  1PTO H;  4OIJ A;  3QR8 A;  4ZUI A;  4GNX A;  1TWF B;  2VS1 A;  4JVZ A;  1LLR D;  4K0K Q;  2WKD A;  4AQY L;  2LKV A;  4DUY Q;  4LF7 Q;  2F0G A;  4CJ1 B;  4X3K A;  1LUZ A;  1N33 L;  1JE5 A;  4IZ8 A;  1HJP A;  3ERO A;  3GTK H;  1AFP A;  1LTT D;  2CWP A;  4A3E B;  1L0W A;  3R93 A;  2F0E A;  4IOC A;  4TVA B;  2UXD Q;  3MVV A;  3M4Q A;  4CBV A;  5C4H A;  2RHQ B;  1GUG A;  1K8M A;  2HD3 A;  1Z9F A;  1CZG A;  2JEA I;  1Q1E A;  1WI5 A;  2JN4 A;  3HKZ B;  4DAM A;  2F3V A;  2EY2 A;  3K5O A;  4X66 Q;  5T1G A;  1VQN A;  1K3B C;  3SVM A;  3ND8 A;  1I6H B;  1WCM H;  3HKZ E;  5AJ3 Q;  4QB4 A;  4FF2 A;  2KCN A;  1CKN A;  1V1P A;  3TS0 A;  4R8I A;  1Y1V B;  3OOC A;  1GUW A;  1YJ9 A;  3J80 i;  3HOX B;  3T1H Q;  2G9H D;  5E4W C;  3CCS A;  2SEB D;  5FK9 C;  4A3B B;  1LT3 D;  4E6I A;  2JXM B;  4KY5 A;  2RVL A;  5EQ0 A;  1ET6 A;  1Y1W G;  4F8M A;  1E7Z A;  1IBK Q;  3GTO B;  4J1M A;  3VR3 A;  3ULJ A;  2QDB A;  1VQ6 A;  3GTK B;  1Q90 A;  2HIV A;  3JAM E;  1K0S A;  3L3O C;  1LTI D;  2J4X A;  5FO7 B;  3N52 A;  5C5M A;  4IPD A;  1PH7 A;  4R4T A;  4RGO S;  4B3T L;  1EWC A;  1G2T A;  3LWE A;  5IT9 E;  2Z1C A;  3K5L A;  4DAV A;  4UP9 A;  5M3F H;  1NCV A;  5HGT A;  1V1Q A;  5GRO A;  1HTL D;  1N34 L;  5CV6 A;  3OSO A;  5GAE C;  3PO2 H;  4K2L A;  3KF8 A;  1X6O A;  1F9R A;  1SYD A;  1BKB A;  1JJC B;  2F0J A;  3A74 A;  1WTW A;  2VQE Q;  2A6E D;  3EJI A;  3FPP A;  5H1S E;  2VXW A;  4KI0 A;  2F0S A;  1TKW B;  1VS0 A;  2AKW B;  5FKA C;  4WFN 3;  1NAP A;  2FJ2 A;  1Y69 U;  1W2B A;  3SK6 A;  3OTO L;  4AQY Q;  1M90 C;  2XSC A;  2VUM B;  2Z6K C;  4BS9 A;  1FNW A;  1WCM G;  2LXJ A;  3Q22 A;  2K50 A;  4KHV A;  5IGG A;  1F2Y A;  4KD3 A;  4KLK A;  4RH6 A;  1ZEQ X;  5CMD A;  1QUQ A;  4LFA L;  1N32 Q;  2NBF A;  3HOW H;  1I94 L;  3HOZ B;  1TQO A;  2UXD L;  1XPO A;  2K5N A;  3A54 A;  4GKK Q;  1XJV A;  5IP9 G;  4PZ6 A;  1S40 A;  2IX0 A;  1EEI D;  3OW2 A;  2F0D A;  3H6M A;  5C3E H;  4LF9 Q;  2BCO A;  5F2D A;  1Q8I A;  3CCJ A;  4CKE A;  4K5X A;  3UDG A;  2ASB A;  2E2J B;  2HCI A;  3I7F A;  4PMW A;  3OMG A;  4P73 A;  2GVB A;  1ZXT A;  2VB3 X;  4YHH Q;  5IP7 H;  3AFP A;  5C3E G;  4LUO A;  3S1R H;  2K5W A;  1FD7 D;  2A69 D;  2H4O A;  4YWL A;  4C1N I;  3J7Y W;  2UU9 L;  4JCV E;  1MSG A;  4HAE A;  1OXV A;  2A5H A;  3L9A X;  5C0X I;  3HFZ B;  4KHP L;  2BH2 A;  1I4R A;  4ME5 A;  1SMY C;  1QVC A;  3HOU H;  1YNN C;  5IYC H;  4POF A;  3S24 A;  3PF5 A;  4NXN Q;  3HOX H;  2UUB Q;  2RA4 A;  1TT2 A;  3CHB D;  1BCP C;  2IPK D;  1C0A A;  3O13 A;  4XIG S;  2L4N A;  4JBK A;  3NEM A;  3EBE A;  4G7H C;  2NZ1 D;  1HUN A;  1N36 Q;  4RCO A;  4IPH A;  3GTO H;  4K5W A;  4NW2 A;  1DON A;  3MXG A;  3TME A;  3CCR A;  1PH9 A;  4X64 Q;  1JC7 A;  2XVS A;  3CCM A;  5DEH A;  4JC0 A;  1SAP A;  1PA6 A;  1X56 A;  5IGC A;  1F9P A;  1M4V A;  4X62 Q;  5M3F G;  2M00 A;  2UUA Q;  1L1O A;  1G29 1;  5BR8 Q;  1EY5 A;  3V05 A;  3HOY B;  4GN3 B;  1PH1 A;  1F9S A;  1B4O A;  2E2H B;  1WTX A;  4ZQ3 A;  3GV3 A;  1SYG A;  2OQK A;  5HUR A;  2OWO A;  3M3Y H;  1K28 A;  2DY8 A;  4HED A;  3GTG B;  1STN A;  1OXS C;  4RGM A;  4IJL A;  2RCF A;  1U0L A;  3DUZ A;  1VMP A;  3D8G A;  2Q2I A;  1VQF A;  1RHP A;  5IYC G;  3AQQ A;  2OEO A;  4QIW E;  3KF6 A;  1GUO A;  3L7Z C;  4C3I B;  1CI3 M;  5DAU A;  4CGY B;  2F52 A;  1GO3 E;  2Q2H A;  1EYG A;  1KDA A;  4A3M G;  4C2M B;  1A2T A;  5IGD A;  5GAH C;  2YTY A;  5I9O A;  1VQA A;  3SE0 A;  2ZJQ A;  3GTJ B;  2E2I B;  1C7Y A;  2CCZ A;  3Q23 A;  4DR7 L;  1V1O A;  2DJG C;  4R1J A;  3IL8 A;  3M4O H;  1NY4 A;  1SJE D;  4G7O C;  3SR1 A;  4P75 A;  1CQF A;  4G57 A;  4KK7 A;  4JI2 Q;  1SE8 A;  3P75 A;  4EQ5 A;  4HJ5 A;  1RJT A;  1CQV A;  1RCV D;  3S1R B;  3SGI A;  4LF4 Q;  4UAI A;  4XXE A;  5CBE E;  1D2B A;  1I6V C;  4DR5 L;  4ZLT F;  5KYL A;  1SR3 A;  3BZC A;  3DXJ C;  4KN4 C;  2R7D A;  2A19 A;  2FIN B;  4B08 A;  5JEA G;  1PRT B;  4Y52 H;  2SDF A;  4K2K A;  1ZYR D;  4DV3 Q;  4KJO A;  1CM9 A;  4A3F B;  1PXU A;  5IGF A;  3R3O A;  1ML0 D;  3I56 A;  3BVG A;  4JI1 L;  4GLX A;  1UE6 A;  3JAM c;  4DK0 A;  1Y8P B;  4C3I G;  1LM0 A;  4MZ9 A;  4LFC Q;  4DV7 Q;  2MJ8 A;  4V0B A;  2E74 C;  3T13 A;  4QJF A;  4TSS A;  1B70 B;  1STY A;  4OXP A;  3ULL A;  5M5X B;  1B53 A;  3GQB A;  1EQQ A;  4A3F G;  4AH6 A;  3TZD A;  5EKI A;  4A3K G;  3DEP A;  1SBB B;  4MNO A;  1W3S A;  4CDD C;  3CC7 A;  1P16 A;  2MPM A;  4A3D B;  2FMM A;  2UUC L;  3VYR A;  3CF5 A;  3WOF A;  4B3M L;  3S15 H;  1VQB A;  1NSN S;  4RGT A;  1GM5 A;  5C3W A;  1S5F D;  3HOV G;  2J7Z A;  2KOL A;  4HJ9 A;  3OWF A;  1Y14 B;  4NPS A;  2ZJP A;  4WJ4 A;  2YU9 B;  1PFN A;  1NNX A;  2F3W A;  3S2D B;  3CRL C;  5DLQ E;  3K80 C;  4DK1 A;  3J81 i;  3J7A F;  1CUK A;  2X69 A;  1PH3 A;  4RHS A;  4IPC A;  1JB3 A;  4YIJ A;  2FHT A;  5HGQ A;  4C3J B;  5IYD H;  2R7Z G;  4A3J H;  2CKZ B;  4DGZ A;  4C3J G;  5FLX L;  3DMU A;  5GQO A;  1WTQ A;  4CJ0 B;  1TS3 A;  3AB9 A;  3FKI H;  2CWA A;  4OO1 G;  1HFN A;  5M9O A;  2KCT A;  2B63 H;  3NWT A;  4LFB Q;  2JQO A;  5TSS A;  4IFD J;  2DGY A;  4QF4 A;  1FJG L;  1XPU A;  3URY A;  5LL6 X;  1X55 A;  1H9M A;  3S15 B;  2DNE A;  4JI7 L;  2I5H A;  5J1Z A;  3MXN B;  2I5L X;  4A3C H;  4LF8 Q;  5CV9 A;  4I7Z C;  2G9D A;  3PIO A;  2PPB C;  1VQD A;  1J5E L;  3H0G H;  4XQN A;  2D5D A;  4QL5 A;  1PLF A;  4XQQ A;  2ZXO A;  4OO1 H;  4KKT A;  3R2T A;  4DV6 Q;  1S5E D;  5ELB A;  4A3I G;  4GLA C;  1AP0 A;  5CV7 A;  1DM0 B;  3J81 c;  5M3M B;  1VQM A;  1VQ5 A;  3K7U C;  4A3M H;  1PTO D;  4RWS C;  4DF7 A;  3S14 H;  1G8Z D;  1DYQ A;  1UNS A;  3NBI A;  3WWV A;  2SNS A;  4QUF A;  3UDF A;  2AQ3 B;  1VQO A;  4KKS A;  2WIN B;  3S2H H;  1TS2 A;  2UXC L;  3IFD A;  5I6W A;  4H44 C;  1KD1 C;  3QOJ A;  1F77 A;  3CME A;  1T5X D;  3FRP B;  2YTV A;  3B6Y A;  5CV4 A;  3OIQ A;  1TWC H;  5ELC A;  4JV5 L;  1TWF H;  3PUW A;  3KDF B;  3K57 A;  4XT1 B;  4BBS G;  3K7A H;  1QB5 D;  2QEJ C;  1IYU A;  1L1O B;  1IBL L;  5M5Y B;  3MXP A;  2PMZ E;  4OO1 I;  4NB3 A;  4OX9 Q;  2OT2 A;  5LMN Q;  1DOK A;  3RLO A;  1BQQ T;  3JAM L;  4JI5 L;  2EYP A;  2RDF A;  3PQI A;  4HIK A;  3OMC A;  1K8O A;  1JWS D;  1NJI C;  5E7N A;  1H9K A;  2RQX A;  4X6A H;  3QJY A;  1YEZ A;  1V1P B;  3KBX A;  4DV5 L;  4CHT B;  4DA2 A;  3GV6 A;  1MD2 D;  1SYF A;  1AN8 A;  3DWP A;  5CYU A;  4UP8 A;  5KNC A;  2EPB A;  4K8J A;  4POG A;  3JAM i;  3W1B A;  1EQV A;  3HG9 A;  4FF3 A;  1CTM A;  2EXD A;  2PZU A;  4IUU A;  2WB1 B;  2K5D A;  4NP5 A;  4KHP Q;  3K5N A;  1EUJ A;  4A93 H;  2FMC A;  3F1Z A;  4GOP A;  4A3C G;  4DUY L;  1SNC A;  1SNQ A;  1VMC A;  2Y0S E;  3T1H L;  3D4D A;  4P74 A;  1PZI D;  2EVB A;  1RIP A;  1JQY D;  1TU2 B;  4XQJ A;  4X3U A;  4HTH A;  1E22 A;  2D0P A;  3KUP A;  3P7J A;  4KKU A;  3PO3 B;  2B63 G;  3KOJ A;  2N49 A;  1E2Z A;  1LO5 D;  1S72 A;  1BBU A;  2Q8I B;  3T53 B;  3W3A A;  1X3G A;  4EQP A;  3KF8 B;  1PH5 A;  5CR3 A;  4IOA A;  5EAY A;  3H15 A;  2WAQ B;  1VQP A;  1TWH B;  1BF4 A;  5A2Q E;  2E75 C;  3SEB A;  2PW5 A;  1STB A;  4A3J G;  1H9S B;  1EFW A;  3CMA A;  1JT8 A;  3QG1 A;  5IWA L;  1MGS A;  1RKN A;  1SE3 A;  2D2C C;  4GNX C;  2CH4 W;  1RD9 D;  4IN3 A;  1JR0 D;  2L55 A;  1R4P B;  2LXK A;  3QWN A;  4IUN A;  5LMU Q;  3MWY W;  4K14 A;  1EQR A;  5C4J B;  1SFO H;  2WII B;  3X3N A;  2QW7 A;  4X3T A;  2PNH A;  4X66 L;  3WOE A;  1HTP A;  1O7Z A;  4QIW B;  3PUV A;  5EBC A;  3DLL A;  2DY7 A;  3F2U A;  1BR9 A;  2X6G A;  4L5Q A;  4QQB X;  4Q5V A;  4BXX G;  3PMF A;  1UAP A;  4JBM A;  1ONL A;  2OQ0 A;  3OTO Q;  2Y0S G;  3S1Q H;  4ME3 A;  1L0Y B;  1TWA B;  3Q6S A;  5FLM G;  4LK1 C;  4DAY A;  2M9V A;  4L63 B;  3NK9 A;  1KRT A;  1F2M A;  2A1A A;  3NSW A;  3J81 E;  1YVC A;  2Z9H A;  4WJW A;  5C0X H;  2JA7 H;  3CCV A;  2KCM A;  1PHJ A;  3J81 j;  2F0Q A;  4EX5 A;  1UE5 A;  2Z4H A;  4K8I A;  1D7Q A;  1A0I A;  4HN7 A;  4X65 Q;  4TKO B;  1KAW A;  5COY A;  3R8B A;  5EKK A;  2JEB I;  1JE4 A;  3A0J A;  2YTX A;  2A73 B;  1YJN A;  2EDG A;  4EQN A;  3IFT A;  5G3L F;  4LF4 L;  3TS2 A;  4IFD H;  4MN3 A;  1PTO B;  4LW1 A;  4MHE A;  2MQH A;  5IP7 G;  3CU7 A;  4HJ8 A;  1GUN A;  4DK3 C;  1P8L A;  1TWC B;  1VQJ A;  4HJA A;  4GKK L;  2A68 D;  4MTK A;  1JJG A;  1IKL A;  3RZO B;  4OWT B;  1EU4 A;  1KNE A;  2HDL A;  1HNZ L;  5T1I A;  3J80 L;  1D5M C;  3BZK A;  3FEW X;  1SYE A;  4ZK9 B;  3RZD B;  2E2D C;  1PTO C;  2HT1 A;  3VYU A;  2EJG C;  4IJH A;  3CC2 A;  1Q46 A;  1I4H A;  2R7F A;  1N32 L;  1OO9 B;  2B3G A;  4A3L G;  3TP6 A;  3C1F A;  4RHR A;  2JP1 A;  1QZH A;  1PH6 A;  4P71 A;  3KLS A;  1GJX A;  3A8K E;  3I8Z A;  1WOC A;  4FVM A;  3GTG H;  4UHV A;  1OXU A;  2ATW A;  3J7A 5;  3ICE A;  4DR1 L;  1AEX A;  4UY8 C;  5C4J H;  4NDX A;  1ILQ A;  3NTK A;  2E2H H;  2VY3 A;  2A74 C;  4B3S Q;  5GAG C;  1E0B A;  2MHV A;  4BBR H;  4C1N K;  5HY6 A;  1GKH A;  4BBR G;  4QCL A;  2QKI C;  4BY7 B;  3P1H A;  1GOZ A;  1N33 Q;  2LY7 A;  3E3X A;  4IUV A;  3D6W A;  4RKB A;  1KTK A;  3DEO A;  1VQ9 A;  1J9O A;  4RMF A;  4FO2 A;  2AWN A;  2ZM6 Q;  3T51 B;  1YJW A;  1B3Q A;  1F2Z A;  4BA1 I;  1Z7T A;  2IT1 A;  4BBS H;  2L11 A;  4JYA Q;  1SJH D;  2PYK A;  2Z4I A;  3MFY A;  3GTL H;  4EQO A;  1JOR A;  3GD7 A;  1E24 A;  3CKI B;  1D1I A;  3A5U A;  2EOT A;  5FO8 B;  5IYB H;  2HCC A;  4C3H G;  3PF4 A;  3ONA B;  3A8J E;  1JOQ A;  2CQO A;  4JI2 L;  1WYD A;  3VYT A;  4PMC A;  1OXX K;  2A8V A;  2NVQ H;  3S14 B;  3I90 A;  4F88 A;  5C4X G;  3K0X A;  1SNO A;  2MNA A;  3PV0 A;  1A3V A;  4FXK C;  1TWG H;  2Y0S B;  2E5L L;  5EPL A;  2JA7 B;  1GUS A;  1VDZ A;  2UXC Q;  4M1U B;  3UE1 A;  3SDZ A;  2BH8 A;  2J0T D;  1HA6 A;  2ZXP A;  2K5Q A;  2NYZ D;  1D1K A;  1WD1 A;  2ZXR A;  4A3G B;  4DNT B;  1PRT C;  1EZ8 A;  2CW0 C;  1I4X A;  3KJP A;  2HDM A;  3ERQ A;  1G6Z A;  3UI2 A;  2JA5 H;  2NWG A;  4IAL A;  4LFC L;  1VQG A;  1TVX A;  2XIW A;  4OX9 L;  1VF5 C;  3PIP 3;  1BCP D;  4RG1 A;  3S1N B;  3HRZ C;  4DR1 Q;  2XTI A;  1FGB D;  3D4R A;  3IRB A;  3FPU B;  1D8L A;  1E2W A;  5ELO A;  3I55 A;  2PMZ B;  2A69 C;  3NEL A;  3RUZ A;  2RSN A;  3EFX D;  4K6D A;  4A3D G;  1STG A;  2KHJ A;  4A3K B;  1HHV A;  3BZD B;  4R4Q A;  4EGV A;  1I3Q H;  4C3J H;  2CHB D;  3IAY A;  2V4D A;  4KJN A;  2WAQ G;  2WKC A;  4TQU S;  1SNM A;  5L37 A;  2KED A;  1HZ9 A;  3SK5 A;  2MO0 A;  2B63 B;  1KIX A;  3HS0 C;  3STB D;  1SSO A;  1NMF A;  1B50 A;  3UDX A;  1QZG A;  4JI3 L;  5BN4 A;  2K05 A;  2R93 B;  4PZ7 A;  3NEN A;  4JI8 Q;  1J8I A;  1ROD A;  3N6R A;  5JVH 3;  1HZC A;  2NN6 G;  4HIO A;  1GHJ A;  3CCQ A;  3M7G A;  1HZB A;  5EJW A;  1Q82 C;  5E1F A;  4B9W A;  1BNZ A;  4RCN A;  2L0C A;  4LF8 L;  1E2V A;  4K5V A;  2EJF C;  2UUA L;  4LF5 Q;  5LMU L;  3D31 A;  1EY0 A;  1TWG B;  4GOP C;  2IHE A;  1JOK A;  3BVM A;  4FP5 D;  4G4K A;  3H91 A;  1U9R A;  3U58 A;  2X6L A;  3GTP H;  3VR4 A;  2B2T A;  2ZTC A;  2R3Z A;  3K58 A;  1XYI A;  3IKJ A;  4CKB A;  1XNR L;  2N55 A;  3VYS A;  2D9U A;  4ALP A;  1GXD C;  3UE0 A;  5LHY 1;  1KQS A;  4L5T A;  5COR A;  2WP8 J;  5IE8 A;  1FR3 A;  2Z6B A;  3NBH B;  3CQZ H;  1QVF A;  2L12 A;  1DJR D;  3M4Y A;  4GNX B;  3C3L A;  1PFB A;  1SND A;  2MO1 A;  3X3M A;  1EWH A;  3MC0 B;  4JOI A;  3BDO A;  4YWK A;  4BBS B;  2ZT9 C;  2E2J H;  3HOW B;  1JWU D;  3F2D A;  1OXT A;  4DXG A;  2IW3 A;  1FL0 A;  4DV6 L;  3ERS X;  3MXN A;  4LAA A;  2JA8 H;  1YHQ A;  2NVT B;  4CJ2 C;  5J39 A;  4OEL B;  3GTP B;  3I4O A;  2JA6 H;  5C4X B;  1BVS A;  1EY8 A;  3QB3 A;  4RFB A;  1CFM A;  3T16 A;  4HJ7 A;  2XWB B;  4C3H B;  4JI0 L;  3CCU A;  1MI2 A;  1I4P A;  2KCC A;  2QCP X;  4BWG B;  1RTN A;  3G48 A;  3C46 A;  2UUB L;  4ZRZ A;  1RDP D;  3I72 A;  4WRD A;  5M3M G;  4YCV A;  1EIH A;  1BO0 A;  3EIV A;  2EYF A;  1I4Q A;  2XWJ B;  1G51 A;  2F0O A;  3E0E A;  4A4I A;  1PTO F;  2I07 B;  2Q8T A;  5FLM H;  2F4V Q;  1S5D D;  5K5P A;  3F2B A;  2JJQ A;  3E9I A;  1JJ2 A;  3DM3 A;  4JI5 Q;  4QUC A;  3A55 A;  1WJJ A;  2YV5 A;  3HP3 A;  1GUT A;  1WD0 A;  1N34 Q;  1LT5 D;  1X65 A;  1SMY D;  4A3I H;  3GTM H;  3I4L A;  4GLV B;  3OYY A;  2UUC Q;  2HIX A;  5LL6 S;  1QCB D;  3OHX C;  3FMC A;  5C6A A;  2WB1 E;  2AHO B;  2QDL A;  1X3F A;  1HCZ A;  2BE5 C;  2M2L A;  4FNF A;  2IY5 B;  1RTO A;  1A3T A;  2XN9 C;  1E3P A;  5C44 G;  2F4V L;  3GP7 A;  1Z47 A;  2ICI A;  1WCM B;  1LV9 A;  2WAC A;  4ULL A;  1AZP A;  1C48 A;  1PYS B;  2O5I C;  1ILP A;  2ZTD A;  1Y1V H;  1SN8 A;  5LMN W;  4XYO A;  2EYH A;  2ES2 A;  4RKL A;  2RHS B;  2BA1 A;  1BBX C;  3I4M H;  2K52 A;  1IL2 A;  2B2V A;  1VQ8 A;  3S1M B;  1HPC A;  4DR6 Q;  2F3I A;  3U4V A;  1MKH A;  1B44 D;  5C44 B;  4LF6 L;  4LJZ C;  2DUD A;  1CA5 A;  3T1Y L;  1XMQ Q;  4ID6 A;  4KY6 A;  1WTP A;  3KJO A;  2LMC B;  4NKL A;  4N9P A;  5C4X H;  4LWC A;  2PQE A;  3KLS X;  4YWM A;  1IW7 D;  2NVQ B;  1PZJ D;  4IFD I;  2Q8R E;  5ELF A;  4GZY C;  3HKZ G;  4EVO A;  5JAV A;  3RR5 A;  1FJG Q;  2NVT H;  1VF7 A;  1X32 A;  4O2D A;  1EQT A;  2DJF C;  4JI8 L;  1OTC A;  1B3A A;  2B39 A;  4K6L A;  3KLW A;  3I4M B;  1PMR A;  2YYZ A;  1PYW D;  2K01 A;  2CH4 A;  5C0X J;  2R7Z B;  2HUG A;  3NHH A;  3CCL A;  3HOV B;  2VUM H;  1VCI A;  5FJ8 G;  1EEF D;  2B2U C;  1DGS A;  4BY1 G;  3K6O A;  1CHQ D;  5JEA J;  4BXX H;  4L5R C;  3SHL A;  5I4D A;  4PZ8 A;  1U4R A;  4LF5 L;  4FXG C; 
#chains in the Genus database with same CATH homology
 1CT1 D;  1KAB A;  3HGB A;  3DHQ A;  1BXT A;  2K6A A;  5K36 H;  3QO2 A;  1FYC A;  1STH A;  3BVZ A;  1ZKO A;  1UUP A;  1I50 B;  2MUY A;  3HEJ A;  1IW7 C;  3LX0 A;  2AUK A;  2E76 C;  4OIK A;  4AYB B;  2PW7 A;  3KK7 A;  1H9R A;  3D4W A;  1L0X B;  3QOL A;  4S3S A;  3DWA A;  1EL0 A;  3TN2 A;  3WDN A;  1O78 A;  3U9O A;  4IFD G;  1EYD A;  1Z6H A;  4Y7N B;  2JA8 B;  1X3P A;  4DNR B;  4IUQ A;  3ITP A;  2EYL A;  5D3I B;  2SNM A;  4V19 0;  4H0L C;  3C2P A;  3BDC A;  1WTO A;  5D3D A;  5CV5 A;  2B2Y A;  2F0U A;  4A3M B;  1EY7 A;  5IOC A;  2LS0 1;  2KEE A;  2AUJ D;  4HCS A;  3ND9 A;  1BOS A;  1SEB D;  4JBW A;  1STA A;  1O80 A;  3LNN A;  1R4Q B;  4O42 A;  1S4Z A;  4H7B A;  1JCK B;  1M8A A;  1KLU D;  2F0M A;  3M4O B;  2F0F A;  4P2C B;  4FF4 A;  2JA5 B;  4OHJ A;  2QIL A;  2B2T C;  5A35 A;  5I6Y A;  2MGS A;  5ISR A;  2TMP A;  1DOL A;  2F1M A;  3EVQ A;  4ZKB B;  4KTA A;  2F0N A;  4KD4 A;  2F0I A;  3I91 A;  2JYO A;  4N9T A;  2IX1 A;  3NP8 A;  5EGT A;  1F2L A;  4ZAI A;  5BN3 A;  2BOS A;  5EPK A;  3PUX A;  4XTC S;  2RDH A;  4OL7 A;  2EZV A;  3OIP A;  1Y8N B;  1Y8O B;  5C0X G;  2K32 A;  3TP5 A;  3A7A B;  1UEA B;  1YNJ D;  3TSS A;  4KV6 A;  3GTM B;  1II3 A;  4H13 C;  2PO4 A;  5C5L A;  1QE6 A;  2SOB A;  4HR7 B;  3OPO A;  4PV1 C;  2AQ1 B;  2IWH A;  2L5T A;  2EJM A;  4IUT A;  1C4Q A;  2KQ3 A;  4PQX A;  1EOT A;  3R2I A;  4G7Z C;  4Z9C B;  4PMB A;  4CKC A;  3NBH A;  1PRT D;  3TDQ A;  1NR4 A;  3GTQ B;  1SYB A;  3FKI B;  5CC4 A;  3CQZ B;  2JSO A;  2F0L A;  2NUC A;  1BUV T;  2EYM A;  3MZ5 A;  3BDL A;  5KYI A;  4BY1 B;  2K1B A;  3KBG A;  1U4P A;  1BCP F;  1LTR D;  2NTT A;  3E5S A;  3I3C A;  3H94 A;  1PZK D;  1B2T A;  3NQI A;  2EXZ A;  2NN6 I;  2B2V C;  5JEA H;  1IYV A;  5DNF A;  2KEC A;  2K03 A;  1T5E A;  1A3U A;  3V2T A;  3TBI B;  3AMU A;  2RBM A;  4WOR A;  1D6E C;  5CGK A;  3BS1 A;  2KA7 A;  2OF1 A;  5FOB B;  1B1Z A;  4IUP A;  5D65 A;  2RKS A;  1AZQ A;  1MSH A;  3QIA A;  3K7A B;  2EE1 A;  5BN5 A;  5E3F A;  2EY5 A;  4HMI A;  4ZUJ A;  5M5W B;  2F03 A;  1ZYR C;  1NUC A;  2KHS A;  5M3F B;  2PNR C;  5DM6 3;  1QG7 A;  3HOU B;  1STE A;  1GHK A;  1HFG A;  2B2U A;  1JIC A;  1O7Y A;  2K33 A;  5AFW A;  5KND A;  4U67 3;  1SDF A;  3T4A C;  1JWM D;  4F7X A;  4B9X A;  2F0W A;  1A2U A;  2DNC A;  3CRK C;  1EY6 A;  1S5B D;  3A7L A;  4F87 A;  5JPM C;  4DU9 A;  2C9O A;  1B9N A;  5C3E B;  1EY9 A;  2MP1 A;  1QJO A;  2EY1 A;  2R6G A;  2NVY B;  3GTL B;  2B8G A;  4R8N A;  1WTR A;  3PUZ A;  4TRD A;  1SXT A;  2K04 A;  3EQL C;  1TII D;  3J7A V;  3K0Y A;  1SFO B;  3K5M A;  1K83 B;  1HUM A;  2IJ0 A;  1WVL A;  1LTA D;  2F0K A;  4I65 A;  5IIF A;  1EYC A;  1G2S A;  1EU3 A;  4BA2 I;  4KN7 C;  3G7L A;  5NUC A;  1ESR A;  5G3L D;  3S16 B;  3TZU A;  2NVX B;  1QWY A;  5FO9 B;  2JA6 B;  3NXW A;  3A8I E;  2B2Y C;  5I9P A;  1ICW A;  1QNK A;  4QMG A;  4IQZ A;  3VA5 A;  2B2W C;  2L1B A;  4RAU C;  2IX3 A;  3K59 A;  1PDQ A;  3EA6 A;  3AU7 A;  3I4N B;  4XDX A;  2BE5 D;  5IGE A;  2PZT A;  5D14 A;  3I70 A;  1PRT F;  1LAB A;  2NTS A;  1LTS D;  1U4L A;  1V43 A;  4KY7 A;  1B9M A;  4DFA A;  3FDT A;  1SE2 A;  5KGU A;  2A6H D;  3H09 A;  2ICE C;  1KLG D;  1XWE A;  1Y1W B;  3T56 B;  4J6H A;  1TS4 A;  5DM7 3;  1Q3L A;  3J80 E;  2QF7 A;  4FYD A;  3VR2 A;  3W2D A;  1QIL A;  1F9Q A;  2A6H C;  1D5Z C;  5IOD A;  4A3I B;  3S1Q B;  3GO5 A;  4JK1 C;  1XXG A;  1Q1B A;  3H0G B;  5KNB A;  1W6J A;  3VA7 A;  3PO2 B;  1H9J A;  3MTS A;  5J22 A;  5CV8 A;  1O7L A;  1JOO A;  3MXU A;  1KNA A;  2JE6 I;  3SK4 A;  1XX8 A;  1CA6 A;  1EY4 A;  1QOH A;  1LTB D;  2L9H A;  4DN4 M;  3S17 B;  3E6Z X;  2XRS D;  3NUC A;  4LMQ D;  1S5C D;  5K36 G;  3HZX A;  2F4I A;  1R9T B;  1BDO A;  1FNU A;  4ZYS A;  5I2X A;  2VNU D;  1X3Q A;  3TP8 A;  4O1N A;  2CQA A;  1ESF A;  4L8J A;  2I46 A;  1DOM A;  3RLF A;  3OWE B;  2A6E C;  1DCZ A;  1IL8 A;  3Q24 A;  1CHP D;  4FXD A;  1DZ1 A;  1CZW A;  2F0H A;  2D62 A;  1MBY A;  3A56 A;  3MAQ A;  1ENF A;  1HQM C;  1KDB A;  2BDO A;  1I4G A;  3MFG A;  2AWO A;  1W6K A;  3BYT B;  1FNV A;  1TY2 A;  1YNJ C;  1ET9 A;  2XNA C;  1IKM A;  2XRQ D;  3Q0A A;  4ODG A;  3D6C A;  1A15 A;  2TSS A;  3H3V C;  1DD2 A;  3M3Y B;  1LT4 D;  3J81 L;  1XTC D;  4HSP A;  1D5X C;  4C56 C;  2B8F A;  3NQT A;  2C5C A;  3DM1 A;  3FVQ A;  1I3Q B;  5KEE A;  3PUY A;  1HQR D;  1LAC A;  4HSV A;  4XT3 B;  3BG3 A;  3MA2 B;  4R9W A;  3RMH A;  2EYO A;  1HRJ A;  1EFI D;  2F0V A;  1SE4 A;  2O4X A;  2R61 A;  3E0J A;  4PNY A;  1DXM A;  3PIO 3;  3SXH A;  4DAP A;  1SNP A;  4ZKC B;  4KHZ A;  2LFN A;  2KUM A;  1EZ6 A;  3KLR A;  3VR6 A;  1TR5 A;  2CVR A;  5JPN C;  1TY0 A;  2CW0 D;  5JJZ A;  1V8Q A;  5IGB A;  5ELE A;  3S2H B;  1RF2 D;  1AW7 A;  2BDN A;  5KRU A;  4U68 A;  3G6J B;  4HCE A;  5E4X A;  4NMZ A;  2OXP A;  2O5J C;  2NN6 H;  3TP7 A;  2R92 B;  4L6T B;  2K28 A;  1BCP B;  1KDC A;  3LWU A;  4UDU C;  5CBA E;  5IT9 L;  1ENC A;  1H9S A;  3NTI A;  3MHB A;  3SK8 A;  1CK1 A;  1PFM A;  4M8A A;  4HMJ A;  5EBD A;  1QNU A;  1U4M A;  1SYC A;  3MEH A;  2PZW A;  1HXY D;  5I2Y A;  2F0T A;  4Q0F A;  4IUR A;  1Q12 A;  1EIG A;  2PCF B;  5FLX E;  2HQE A;  3NE5 B;  3M85 A;  4KMU C;  2RDG A;  3VR5 A;  5KIX A;  3NTH A;  5JVG 3;  2DN8 A;  2KVM A;  5C3X A;  3V96 A;  3NPP A;  4A93 B;  2EYJ A;  2FFK B;  1EYA A;  4OGQ C;  2NB0 A;  4ILW A;  4ABN A;  1TS5 A;  4DXF A;  2H1E A;  2VB2 X;  4A3J B;  1LT6 D;  2Z8L A;  5ELD A;  2BA0 A;  4FF1 A;  4XYQ A;  3BYY B;  1LTG D;  4MIU A;  2B2W A;  4BBR B;  2AQ2 B;  2WV6 D;  3C1E A;  3P20 A;  3DWQ A;  3OW7 A;  4RGN A;  3RD4 A;  3D3R A;  1A6X A;  2EY6 A;  2A68 C;  2KJX A;  1YNN D;  5C4Z A;  1G91 A;  5JOB A;  2N88 A;  2O2L D;  1IHZ A;  2GA4 B;  3NWS A;  1HA5 A;  5EPJ A;  4J8Q A;  1KAA A;  1NR2 A;  4X3S A;  3U9S A;  3M7N A;  2RSO A;  2K7V A;  1C8C A;  3ZYY X;  3S9W A;  2ENB A;  3I73 A;  5A2Q L;  1WTV A;  2ID0 A;  4RA8 A;  5EKL A;  1ENA A;  2IL8 A;  2F0P A;  1PTO H;  4OIJ A;  4ZUI A;  1TWF B;  1LLR D;  2WKD A;  2LKV A;  2F0G A;  4CJ1 B;  4X3K A;  4IZ8 A;  3ERO A;  1AFP A;  1LTT D;  4A3E B;  3R93 A;  2F0E A;  3MVV A;  4CBV A;  5C4H A;  1GUG A;  1K8M A;  1CZG A;  2JEA I;  1Q1E A;  3HKZ B;  2F3V A;  2EY2 A;  3K5O A;  5T1G A;  3SVM A;  3ND8 A;  1I6H B;  4QB4 A;  4FF2 A;  2KCN A;  1V1P A;  4R8I A;  1Y1V B;  3OOC A;  1GUW A;  3HOX B;  2G9H D;  5E4W C;  2SEB D;  5FK9 C;  4A3B B;  1LT3 D;  4E6I A;  2JXM B;  4KY5 A;  2RVL A;  5EQ0 A;  1ET6 A;  4F8M A;  3GTO B;  4J1M A;  3VR3 A;  2QDB A;  3GTK B;  1Q90 A;  3JAM E;  3L3O C;  1LTI D;  2J4X A;  5FO7 B;  3N52 A;  5C5M A;  4RGO S;  1EWC A;  1G2T A;  3LWE A;  5IT9 E;  2Z1C A;  3K5L A;  4DAV A;  1NCV A;  5HGT A;  1HTL D;  5CV6 A;  3OSO A;  4K2L A;  3KF8 A;  1F9R A;  1SYD A;  2F0J A;  1WTW A;  2A6E D;  3EJI A;  3FPP A;  2VXW A;  4KI0 A;  2F0S A;  1TKW B;  5FKA C;  4WFN 3;  1NAP A;  2FJ2 A;  1Y69 U;  3SK6 A;  2XSC A;  2VUM B;  4BS9 A;  1FNW A;  3Q22 A;  4KHV A;  5IGG A;  1F2Y A;  4KD3 A;  4RH6 A;  1ZEQ X;  5CMD A;  2NBF A;  3HOZ B;  1TQO A;  3A54 A;  2IX0 A;  1EEI D;  2F0D A;  3H6M A;  2BCO A;  5F2D A;  1Q8I A;  4CKE A;  4K5X A;  2E2J B;  2HCI A;  4PMW A;  3OMG A;  2VB3 X;  1ZXT A;  2K5W A;  1FD7 D;  2A69 D;  2H4O A;  4C1N I;  3J7Y W;  1MSG A;  4HAE A;  1OXV A;  2A5H A;  3L9A X;  5C0X I;  1I4R A;  4ME5 A;  1SMY C;  1YNN C;  2RA4 A;  1TT2 A;  3CHB D;  1BCP C;  2IPK D;  3O13 A;  4XIG S;  2L4N A;  1HUN A;  4G7H C;  2NZ1 D;  4RCO A;  4K5W A;  4NW2 A;  1DON A;  3MXG A;  3TME A;  1JC7 A;  2XVS A;  5DEH A;  1SAP A;  5IGC A;  1F9P A;  1M4V A;  2M00 A;  1G29 1;  1EY5 A;  3V05 A;  3HOY B;  1F9S A;  1B4O A;  2E2H B;  1WTX A;  4ZQ3 A;  3GV3 A;  1SYG A;  5HUR A;  2DY8 A;  4HED A;  3GTG B;  1STN A;  1OXS C;  4RGM A;  3DUZ A;  1VMP A;  3D8G A;  1RHP A;  2OEO A;  1GUO A;  3L7Z C;  4C3I B;  1CI3 M;  5DAU A;  4CGY B;  1KDA A;  4C2M B;  1A2T A;  5IGD A;  5I9O A;  3GTJ B;  3SE0 A;  2E2I B;  3Q23 A;  1V1O A;  3IL8 A;  1SJE D;  4G7O C;  3SR1 A;  1CQF A;  4G57 A;  4KK7 A;  3P75 A;  1RJT A;  1CQV A;  1RCV D;  3S1R B;  4UAI A;  4XXE A;  5CBE E;  1D2B A;  1I6V C;  4ZLT F;  5KYL A;  3DXJ C;  4KN4 C;  5JEA G;  2FIN B;  4B08 A;  1PRT B;  2SDF A;  4K2K A;  1ZYR D;  4KJO A;  1CM9 A;  4A3F B;  1PXU A;  5IGF A;  3R3O A;  1ML0 D;  3BVG A;  4DK0 A;  1Y8P B;  4C3I G;  2MJ8 A;  4V0B A;  2E74 C;  3T13 A;  4TSS A;  1STY A;  5M5X B;  1B53 A;  3GQB A;  3TZD A;  5EKI A;  3DEP A;  1SBB B;  2MPM A;  4A3D B;  2FMM A;  3VYR A;  3WOF A;  1NSN S;  4RGT A;  5C3W A;  1S5F D;  2J7Z A;  2KOL A;  3OWF A;  2YU9 B;  1PFN A;  2F3W A;  3S2D B;  3CRL C;  4DK1 A;  3J7A F;  2X69 A;  4RHS A;  1JB3 A;  4YIJ A;  2FHT A;  4C3J B;  4DGZ A;  4C3J G;  5FLX L;  3DMU A;  1WTQ A;  4CJ0 B;  1TS3 A;  3AB9 A;  4OO1 G;  1HFN A;  5M9O A;  3NWT A;  5TSS A;  4IFD J;  4QF4 A;  3URY A;  5LL6 X;  1H9M A;  3S15 B;  2DNE A;  5J1Z A;  5CV9 A;  4I7Z C;  2G9D A;  2PPB C;  4XQN A;  2D5D A;  1PLF A;  4XQQ A;  2ZXO A;  4OO1 H;  4KKT A;  3R2T A;  1S5E D;  5ELB A;  1AP0 A;  5CV7 A;  1DM0 B;  5M3M B;  1PTO D;  4RWS C;  4DF7 A;  1G8Z D;  1DYQ A;  1UNS A;  3NBI A;  2SNS A;  4QUF A;  2AQ3 B;  4KKS A;  2WIN B;  1TS2 A;  3IFD A;  5I6W A;  4H44 C;  3QOJ A;  1F77 A;  1T5X D;  3FRP B;  5CV4 A;  3OIQ A;  5ELC A;  3PUW A;  3K57 A;  4XT1 B;  1QB5 D;  2QEJ C;  1IYU A;  5M5Y B;  3MXP A;  4OO1 I;  2OT2 A;  1DOK A;  1BQQ T;  3JAM L;  2EYP A;  2RDF A;  3OMC A;  1K8O A;  1JWS D;  1H9K A;  2RQX A;  3QJY A;  1V1P B;  3KBX A;  4CHT B;  4DA2 A;  3GV6 A;  1MD2 D;  1SYF A;  1AN8 A;  3DWP A;  5CYU A;  5KNC A;  2EPB A;  4K8J A;  1EQV A;  3HG9 A;  4FF3 A;  1CTM A;  2PZU A;  4IUU A;  2WB1 B;  2K5D A;  4NP5 A;  3K5N A;  2FMC A;  1SNC A;  1SNQ A;  1VMC A;  3D4D A;  1PZI D;  2EVB A;  1JQY D;  1TU2 B;  4XQJ A;  4X3U A;  4HTH A;  3KUP A;  3P7J A;  4KKU A;  3PO3 B;  1E2Z A;  1LO5 D;  2Q8I B;  4EQP A;  3T53 B;  3W3A A;  5CR3 A;  2WAQ B;  1TWH B;  1BF4 A;  5A2Q E;  2E75 C;  3SEB A;  2PW5 A;  1STB A;  1H9S B;  3QG1 A;  1MGS A;  1RKN A;  1SE3 A;  2D2C C;  1RD9 D;  4IN3 A;  1JR0 D;  2L55 A;  1R4P B;  3QWN A;  4IUN A;  3MWY W;  4K14 A;  5C4J B;  2WII B;  3X3N A;  4X3T A;  3WOE A;  1HTP A;  1O7Z A;  4QIW B;  3PUV A;  5EBC A;  2DY7 A;  3F2U A;  1BR9 A;  2X6G A;  4Q5V A;  3PMF A;  1UAP A;  1ONL A;  1L0Y B;  1TWA B;  3Q6S A;  4LK1 C;  4DAY A;  2M9V A;  4L63 B;  3NK9 A;  1F2M A;  3NSW A;  3J81 E;  4WJW A;  5C0X H;  2F0Q A;  2Z4H A;  4K8I A;  4HN7 A;  4TKO B;  5COY A;  3R8B A;  5EKK A;  2JEB I;  1JE4 A;  2A73 B;  2EDG A;  4EQN A;  3IFT A;  5G3L F;  4IFD H;  4MN3 A;  1PTO B;  4MHE A;  3CU7 A;  1GUN A;  1TWC B;  2A68 D;  1IKL A;  3RZO B;  1EU4 A;  1KNE A;  2HDL A;  5T1I A;  3J80 L;  1D5M C;  3FEW X;  1SYE A;  4ZK9 B;  3RZD B;  2E2D C;  1PTO C;  3VYU A;  2EJG C;  1I4H A;  1OO9 B;  3TP6 A;  3C1F A;  4RHR A;  2JP1 A;  3KLS A;  1GJX A;  3A8K E;  3I8Z A;  4FVM A;  1OXU A;  1AEX A;  4NDX A;  1ILQ A;  3NTK A;  2A74 C;  1E0B A;  2MHV A;  4C1N K;  4QCL A;  2QKI C;  4BY7 B;  3P1H A;  1GOZ A;  2LY7 A;  4IUV A;  3D6W A;  4RKB A;  1KTK A;  3DEO A;  1J9O A;  4FO2 A;  2AWN A;  3T51 B;  1F2Z A;  4BA1 I;  1Z7T A;  2IT1 A;  2L11 A;  1SJH D;  2PYK A;  2Z4I A;  3MFY A;  4EQO A;  1JOR A;  3GD7 A;  3CKI B;  1D1I A;  2EOT A;  5FO8 B;  2HCC A;  4C3H G;  3ONA B;  3A8J E;  1JOQ A;  3VYT A;  4PMC A;  1OXX K;  3S14 B;  3I90 A;  4F88 A;  1SNO A;  3PV0 A;  1A3V A;  4FXK C;  2Y0S B;  5EPL A;  2JA7 B;  1GUS A;  1VDZ A;  4M1U B;  3SDZ A;  2J0T D;  1HA6 A;  2ZXP A;  2K5Q A;  2NYZ D;  1D1K A;  1WD1 A;  2ZXR A;  4A3G B;  4DNT B;  1PRT C;  1EZ8 A;  2CW0 C;  1I4X A;  2HDM A;  3ERQ A;  1G6Z A;  3UI2 A;  2NWG A;  4IAL A;  1TVX A;  2XIW A;  1VF5 C;  3PIP 3;  1BCP D;  3S1N B;  3HRZ C;  1FGB D;  3D4R A;  3FPU B;  1E2W A;  2PMZ B;  2A69 C;  3RUZ A;  2RSN A;  3EFX D;  4K6D A;  1STG A;  4A3K B;  1HHV A;  3BZD B;  4EGV A;  2CHB D;  3IAY A;  2V4D A;  4KJN A;  2WKC A;  4TQU S;  1SNM A;  2KED A;  3SK5 A;  2B63 B;  3HS0 C;  1SSO A;  1B50 A;  5BN4 A;  2K05 A;  2R93 B;  1J8I A;  1ROD A;  3N6R A;  5JVH 3;  2NN6 G;  1GHJ A;  3M7G A;  5EJW A;  5E1F A;  4B9W A;  1BNZ A;  4RCN A;  2L0C A;  1E2V A;  4K5V A;  2EJF C;  3D31 A;  1EY0 A;  1TWG B;  1JOK A;  3BVM A;  4FP5 D;  3H91 A;  1U9R A;  4G4K A;  2X6L A;  3VR4 A;  2B2T A;  2R3Z A;  3K58 A;  1XYI A;  3IKJ A;  4CKB A;  2N55 A;  3VYS A;  2D9U A;  1GXD C;  5LHY 1;  5COR A;  2WP8 J;  1FR3 A;  2L12 A;  1DJR D;  3M4Y A;  3C3L A;  1PFB A;  1SND A;  3X3M A;  1EWH A;  3MC0 B;  3BDO A;  4BBS B;  2ZT9 C;  3HOW B;  1JWU D;  1OXT A;  4DXG A;  2IW3 A;  3MXN A;  4LAA A;  2NVT B;  4CJ2 C;  5J39 A;  3GTP B;  5C4X B;  1EY8 A;  3QB3 A;  4RFB A;  1CFM A;  3T16 A;  2XWB B;  4C3H B;  1MI2 A;  1I4P A;  2KCC A;  2QCP X;  4BWG B;  1RTN A;  3C46 A;  4ZRZ A;  1RDP D;  3I72 A;  4WRD A;  1EIH A;  1BO0 A;  2EYF A;  1I4Q A;  2XWJ B;  2F0O A;  1PTO F;  2I07 B;  2Q8T A;  1S5D D;  5K5P A;  4QUC A;  3A55 A;  3HP3 A;  1GUT A;  1WD0 A;  1LT5 D;  1SMY D;  3I4L A;  5LL6 S;  1QCB D;  3OHX C;  3FMC A;  5C6A A;  1HCZ A;  2BE5 C;  2M2L A;  4FNF A;  1RTO A;  1A3T A;  2XN9 C;  3GP7 A;  1Z47 A;  2ICI A;  1WCM B;  1LV9 A;  2WAC A;  4ULL A;  1AZP A;  1C48 A;  2O5I C;  1ILP A;  4XYO A;  2EYH A;  4RKL A;  2BA1 A;  1BBX C;  2B2V A;  3S1M B;  1HPC A;  1B44 D;  5C44 B;  4LJZ C;  1CA5 A;  4ID6 A;  4KY6 A;  1WTP A;  2LMC B;  4NKL A;  4N9P A;  2PQE A;  3KLS X;  1IW7 D;  2NVQ B;  1PZJ D;  4IFD I;  2Q8R E;  5ELF A;  4GZY C;  4EVO A;  5JAV A;  1VF7 A;  1X32 A;  1EQT A;  3I4M B;  1B3A A;  2B39 A;  4K6L A;  1PMR A;  2YYZ A;  1PYW D;  2K01 A;  5C0X J;  2R7Z B;  2HUG A;  3NHH A;  3HOV B;  1VCI A;  1EEF D;  2B2U C;  3K6O A;  1CHQ D;  5JEA J;  3SHL A;  5I4D A;  1U4R A;  4FXG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...