2L9HA

Oligomeric structure of the chemokine ccl5/rantes from nmr, ms, and saxs data
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords C-C motif chemokine 5
publication title Oligomeric Structure of the Chemokine CCL5/RANTES from NMR, MS, and SAXS Data.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l9hA00
1B50A 2B2VC 5EKIA 1RHPA 1U4LA 3I3CA 2EE1A 1PLFA 1JE4A 2DY8A 3KBXA 3P7JA 2FINB 1F9PA 3TZDA 1MSHA 1RJTA 2B2YC 2MP1A 1B53A 4IUTA 4IUQA 5CBEE 4CJ0B 4MN3A 3I90A 4HSVA 4IUVA 2JYOA 1DOMA 2L4NA 2H1EA 2KUMA 2XIWA 3D6WA 3KUPA 1IKLA 4OIKA 1WTOA 2N88A 2K1BA 4HEDA 1DONA 1F2LA 2HDMA 2L11A 5EJWA 4ZK9B 1SDFA 1JICA 3TN2A 3GV6A 3DEPA 1CM9A 2B2WC 4DN4M 2EOTA 2NWGA 4ZLTF 1WTRA 1NR2A 1BO0A 3LWEA 2HUGA 3Q6SA 5CMDA 1QG7A 1B3AA 1EIGA 1HFGA 1S4ZA 2K03A 2KVMA 3MWYW 1ILQA 1X3QA 2EPBA 1EIHA 1F9RA 2MJ8A 1G2TA 1QNKA 2N55A 1G2SA 1ZXTA 2B2TC 1CA5A 1TVXA 2RSNA 5E4XA 2NYZD 2B2UA 5CBAE 2L9HA 2KECA 4IURA 2L12A 4RA8A 2KOLA 1ESRA 2HCIA 3R93A 1WTPA 1LV9A 2X69A 3SVMA 1WTQA 4IUUA 3F2UA 1G6ZA 1A15A 1WTXA 5T1GA 5E4WC 1EL0A 1WD0A 1O7YA 3QO2A 2JP1A 4NW2A 5COYA 1BBXC 1NCVA 1U4PA 3UI2A 4LMQD 1X32A 2J7ZA 3ONAB 1HUMA 1QE6A 2R3ZA 3N52A 5D65A 4QUFA 2M2LA 4UAIA 2MGSA 1MSGA 2HCCA 1MGSA 1RTNA 2FHTA 4ZKBB 4X3UA 4U68A 2D9UA 5JJZA 2RSOA 2VXWA 1HRJA 2NZ1D 3HP3A 4XDXA 4XT3B 1VMCA 4ZAIA 1F9SA 2FMMA 3I8ZA 3IFDA 5EPLA 1HHVA 2DY7A 1F9QA 4HCSA 4X3TA 4CJ2C 1O80A 4HAEA 1X3PA 4XT1B 2B2VA 2HDLA 4R8IA 1DOLA 1IL8A 1XYIA 1AZPA 1HA6A 4R9WA 1NR4A 3DEOA 2KEDA 2K05A 4O42A 4RWSC 5EPJA 2L1BA 1AZQA 1AP0A 1J8IA 2CVRA 2IL8A 2B2YA 4IUPA 3IL8A 3DM1A 4QUCA 2Q8TA 1O7ZA 5EPKA 2BDNA 2FJ2A 4CJ1B 1SSOA 5D14A 1Q3LA 1CA6A 1PFNA 3FDTA 4X3KA 1U4MA 3I91A 1ILPA 1EQTA 1PDQA 1WTVA 4X3SA 1DOKA 4MHEA 1HUNA 1PFMA 5DNFA 2KEEA 1U4RA 1M8AA 1WTWA 1SAPA 5AFWA 1PFBA 2B2WA 2MPMA 2Q8RE 3FPUB 3GV3A 5EQ0A 5T1IA 1DZ1A 2K04A 1NAPA 1IKMA 1E0BA 4RAUC 1VMPA 1HFNA 4OIJA 3MTSA 1G91A 1RTOA 1BNZA 1WD1A 3H91A 2X6LA 1B4OA 1ICWA 2FFKB 1EOTA 1C8CA 2B2TA 2K28A 5CORA 1MI2A 2K01A 2RA4A 1BF4A 1KNEA 2B2UC 1KNAA 2RVLA 1RODA 1GUWA 2SDFA 3G7LA 4ZKCB 1ML0D 1B2TA 2X6GA 1WVLA 1J9OA 1XX8A
chains in the Genus database with same CATH superfamily
1B50A 2EYLA 4A3KB 3OW7A 3PSIA 3FEWX 3S2DB 1HR0W 2OEOA 5CBEE 4IFDI 5C4ZA 4APVA 3KUPA 1KLGD 2R6GA 3H94A 1WTOA 2F0LA 2IJ0A 1DGSA 1QZHA 1SBBB 5A35A 5C3XA 1Y1WH 4YCWA 4ZLTF 2I5LX 4FF4A 4R4IA 2HUGA 2KVMA 4C3HG 4HIOA 4JI5Q 2F0UA 1IBKQ 3K59A 3J81E 3S1RB 2F0FA 4FXDA 4DV7L 1GUSA 1JMCA 3NTIA 4DK6C 3MFGA 1A8VA 4KK7A 4I7AA 4KLKA 2K50A 1WTQA 4DV0L 3TP7A 3CC4A 3J81j 3CAMA 1MBYA 4O1NA 3F2BA 1X32A 3QB3A 1VQ6A 3J7YW 1JOKA 1IBLQ 1YJ9A 4A3DH 3OWFA 5C4HA 3PO2G 1HXYD 3HOYH 1VQEA 1YEZA 2CW0C 2NZOA 2KCTA 5IWAQ 5GADC 1EWCA 2NZ1D 1KC8C 3FKIG 1BKBA 3WWVA 1EFWA 1CI3M 4HCSA 3WDNA 4I65A 2WP8J 3KF6B 5I2YA 2YU9H 2HDLA 1DOLA 4LFBL 4DR3L 4FO2A 1QJOA 3HOXG 3GTMH 2DJFC 1VQPA 4M1UB 1SYGA 5D14A 4BY7B 2VNUD 1RCVD 3FDTA 3D3RA 3SE0A 5JAVA 5KNDA 1SJHD 5DNFA 4LK1C 3I56A 1M8AA 1QUQB 1TY0A 2PW5A 5T1IA 1CT1D 5D3DA 4EQ5A 5K36G 1TWAH 4CGYB 4UHVA 1TS4A 4C3JB 3M4OB 5KNCA 3RN5A 2R92B 4B3RL 3BZCA 4A3FH 3MEFA 3GTLB 5CV4A 1UWVA 3Q0AA 1ENAA 1I3QH 1XX8A 5GAHC 2IHEA 1L1OA 3QOJA 2DY8A 3VR3A 2FINB 1SYFA 1BR9A 2NVQH 1PVOA 1Y14B 1XMQL 2QEJC 2D0PA 2WIIB 3BS1A 4A3GG 4DV7Q 4ODGA 2EYJA 2CH4W 3J7AV 2L11A 4KY6A 3OYYA 3NBIA 4DV0Q 2AHOB 4RH6A 3S1MB 3MWYW 2GA4B 4KN4C 4K6DA 4LNQA 1OO9B 5C3EH 2MJ8A 2VUMB 1KLUD 4JI6L 1SNOA 3RZDH 3TZUA 1A3VA 3G6JB 3F2DA 2NYZD 3RUZA 1IZ6A 4QF4A 2L12A 3A54A 4A3JB 2KOLA 1ESRA 3D4WA 4RGNA 3CRKC 4R8NA 5CV9A 3X3MA 2R7DA 1V8QA 1GD7A 4HMJA 2R7ZB 4QUFA 2Q2UA 1WOCA 4L8JA 3KJPA 1UNSA 1R9TB 4LFBQ 2E2JB 4DR3Q 1QZGA 4ILWA 2UXDQ 3JAMi 4QMGA 1JJGA 1IYVA 3NP8A 3KOJA 3CCMA 4YWLA 5IGFA 1PFSA 1JC7A 1UAPA 5J39A 4WJ4A 3KLRA 1QNUA 2Q2TA 3EBEA 4Q0FA 4L5TA 1LTAD 4CHTB 2B63H 4DK1A 5JPNC 1BBUA 3TP5A 3ZJYC 2R92G 4GN5A 4XQJA 5LMNL 1Q3LA 5JPMC 3I91A 4PMBA 1F2MA 1NE3A 3VR4A 3H0GB 3U4VA 1PFMA 1Q1BA 2HIXA 1WTWA 1E0BA 5FJ8H 3GD7A 5AJ3L 1EEID 3S15H 1EQQA 5HURA 4LF4L 2HD3A 2F0MA 2QGQA 5ELDA 1XMQQ 2E2IB 5CORA 2CHBD 4GNXA 3NTHA 1WCMH 5IOCA 1GUWA 2VS1A 3HZXA 2BCOA 2YTXA 5KRUA 1B8AA 2A8VA 1GJXA 4LUOA 4YWKA 2JSOA 5LMUL 3TMEA 1TWHH 4DR5L 1X55A 2NN6I 5I9PA 2VUMG 4YCUA 1MSHA 1B53A 2RF4A 1JWMD 5GAGC 4JI6Q 4PZ6A 1E7ZA 2H1EA 3D6WA 2SEBD 1IKLA 3T53B 3CCEA 4HR7B 1WTRA 1E3PA 2R7ZG 1N33L 2K5HA 5F2DA 4QCLA 3D31A 1EY9A 4C3HH 3J7ZC 4DR6L 1F9RA 2QA4A 2OTJA 2PPBC 1EQRA 3S2HB 4DXGA 4IUNA 2EZVA 4GNXB 1KRSA 5E4XA 2F52A 3S16B 1VQNA 3CCSA 1JR0D 1FGUA 3LWUA 4R4QA 1CK1A 1WTPA 1LV9A 3SVMA 1LTBD 1MHWC 1YNND 1V1OA 4XXEA 2Z9HA 1CSPA 4XIGS 1EEFD 2J7ZA 1QE6A 4RCOA 3NK9A 4UP8A 1Y1VG 1PHJA 4HIKA 2VY3A 1MGSA 5JVH3 4H13C 3PO2H 4U68A 4Z9CB 2BDOA 3C3LA 4K5VA 3BDOA 5LMNQ 4DK3C 1STNA 2QF7A 1AE3A 1PTOB 3HRZC 5FKAC 1CKNA 2G9HD 1TS2A 2I46A 3FKIH 1B9NA 2LY7A 2WAQE 2RDGA 1PV4A 4KD3A 5FO7B 1Y1WB 2Z4HA 1SE8A 4O42A 5AJ3Q 1J8IA 1YNJC 3DWPA 2K5WA 5FK9C 3UE1A 1UE6A 3KJOA 3DM3A 3HOXH 1N32Q 5EPKA 3S1QH 1XTDA 1EYCA 3FPPA 2PQAA 1QVCA 3QG1A 1GUGA 3D8GA 1TS3A 2YV5A 1D7QA 3ERSX 2KEEA 4PG3A 3WOFA 2AQ2B 1LABA 2DN8A 4B3SL 3HOVB 3OW2A 5LMUQ 2F0NA 3OOCA 5GROA 4RFBA 5C44G 4X62L 4DR5Q 1XPUA 5K36H 4L5SA 1EY6A 1XPRA 2JK8A 1EOTA 3A8JE 1U9RA 2IT1A 4B3TL 3EQLC 1CKNB 1D1KA 2HQEA 2RVLA 4PMWA 1ML0D 1HQMC 4EQOA 3HEJA 3F2CA 1E24A 4UPAA 1RHPA 3H6MA 1Z6HA 3GQBA 1C48A 4DR6Q 4IUTA 4R1JA 4DV3L 3S1RH 2L4NA 5M9OA 4A3GH 2PQAB 1PRTF 4G57A 1CFMA 3GTMB 4WRDA 1TS5A 3CC7A 1CM9A 3NQIA 3G48A 3MXNA 4DR2L 1VQ8A 1EIGA 3IRBA 4GZYC 1U0LA 1XMOQ 2RDHA 1K28A 1XXGA 4GNXC 2IX0A 1K83H 3CCRA 4U673 2I5HA 4K8JA 1ENCA 1ZYRD 1PH4A 3VA7A 2PMZE 3BZKA 3K8AA 2A69C 5C6AA 1PH8A 3MVVA 1FD7D 3BDLA 4NW2A 2F0DA 1VQ7A 4C1NI 4LF7Q 2SNSA 4DAMA 1YBYA 3BVGA 4OX9L 1I3QB 3I7FA 4N9TA 3IFTA 4RHSA 1B3QA 2RQXA 1D6EC 1JWUD 2NVQB 3Q22A 5KGUA 1PTOC 5ELOA 1EY4A 3A56A 1SROA 1JB3A 2J0TD 2VQFL 3HOVG 3EFXD 2AWNA 3NQTA 4CJ2C 4B3SQ 4AYBB 1A2UA 3MHBA 3VR2A 4X62Q 4XYQA 3JC66 2MUYA 3GTJH 4QUCA 2Z8LA 5C3EB 4QL5A 2TMPA 3HKZE 2JA8G 2R92H 3K5OA 1SSOA 4B3TQ 1JWSD 4C3IB 4YCVA 5M3FB 3TS0A 1MJEA 3D0FA 1OXTA 2R93G 3PUVA 1GUNA 1K73C 2UXBL 3H91A 2X6LA 1H9SB 4DV3Q 4ZUIA 3PQIA 4NP5A 2CW0D 3NWTA 4JVZA 2B29A 4JPBW 4RKBA 1BDOA 5FLXE 1VS0A 4DUYQ 5A2QL 1B2TA 1Q90A 1K9MC 4B9XA 4DR2Q 1HA5A 3I3CA 3SXHA 5IODA 1M1KC 4DR7Q 3P7JA 5BR8L 4K6LA 3BG3A 3TZDA 1OXXK 2VUMH 5I9OA 1KQSA 1H9MA 1IYUA 3OHXC 2N88A 2K1BA 1BXTA 3HOUB 3CU7A 5EJWA 2UUCQ 1VQFA 3GV6A 1SMYD 5IGBA 3M7NA 1Q1EA 2YYZA 4LUZA 1K8OA 3PO3G 3ULLA 3V96A 5CMDA 1PA6A 3GTOH 2R7ZH 2ENBA 1X3QA 1GUTA 2K7VA 2EYFA 1I6HB 3SK5A 1HPCA 4OX9Q 2E2JH 2A73B 5M3MB 1TVXA 1FJGQ 3S15B 3UDIA 2KECA 2K5NA 1GM5A 4LF9L 4GKKQ 1X65A 2E2HH 2WAQG 5E4WC 1EL0A 2VB2X 1OTCA 5IGDA 4AYBG 2Z1CA 3AQQA 3FRPB 4X66L 4CDEC 5G3LD 5KIXA 1Y1VH 3AEVA 1RTNA 2FHTA 3J81L 2A68C 1AN8A 3KLSA 2EYPA 1S5ED 1Z47A 4CKCA 3KDFA 4HN7A 2WB1E 4C3IG 2ES2A 3D6CA 1RD9D 2PW7A 5M3FG 2ZTCA 2HIVA 1SE3A 3A7AB 1HA6A 4R9WA 3DEOA 2NB0A 2CQAA 2UXBQ 3UDXA 5FO8B 1I5FA 2QILA 1XTCD 2K6AA 4C3HB 3HKZB 5DM73 2E2IH 4NXNL 2KENA 3L9AX 3NPPA 3PF4A 1I4PA 4A3IG 1SMXA 2IWHA 2BH8A 4OO1G 3PGZA 3E3XA 1YJNA 4JI2L 3F8TA 2F0WA 1O7LA 5C44H 1K3RA 4BBSB 3NTKA 5BR8Q 3KBGA 5M5WH 1EFID 2M9VA 3HOUG 1JQYD 2RA4A 4RHRA 3IKJA 4AH6A 5BN3A 3CCLA 3PO2B 2SOBA 2DUDA 4F8MA 3I73A 4IJLA 2JN4A 5A2QE 1PLFA 3FKIB 2QKIC 4B08A 3GTKH 3SHLA 5JEAG 5M3MG 1RIPA 3I90A 3BYYB 3CCQA 1AFPA 1XYIA 3S16H 2KCCA 4QIWB 3DEPA 3R2TA 2PNHA 3S1QB 1X9NA 1NR2A 3R2IA 3A8KE 4LUVA 1HFGA 1S4ZA 4HJ7A 1FNWA 4X66Q 5M5XB 2AQ3B 3ICEA 3ER0A 1QNKA 4A3MB 2BH2A 4QJFA 2HQLA 2EJFC 4J15A 1T5XD 1PTOH 2PCFB 4DGZA 4Y7NH 1TXYA 1A0IA 3E9IA 1HQRD 1BQQT 1CQVA 2R3ZA 4JI0L 5D65A 1D5MC 4XQQA 2K5VA 4DV5L 2DGYA 1EOVA 3HKZG 2BE5D 2K75A 1ESFA 3IAYA 4NXNQ 4HJAA 4M8AA 4XDXA 1I4XA 2CWAA 4JCVE 1RF2D 4B3ML 4A3GB 4Q5VA 3G71A 3S17H 3HOVH 5IYBH 1UE5A 3OIQA 5C4XG 4JI2Q 5DLQE 2Q2IA 4BBSG 3BJUA 4RWSC 1Z9FA 1II3A 2PQEA 2ATWA 2OWOA 2ZXOA 3M4QA 2L5TA 1J5EL 3J80c 2JA8H 3GTQH 1K0SA 2JA5G 4JI7L 1GOZA 1K83B 4HIDA 3BU2A 2EYMA 2KHJA 1VQDA 2AKWB 3VYTA 1Q81C 2KA7A 2R93H 4LF5L 4DR4Q 1X3EA 4GLAC 1EWHA 3J7AF 2RHSB 1KD1C 4YHHL 4A3CG 4OL7A 2K28A 4C1NK 3TP6A 4CDCC 3EIVA 5HY6A 1H9KA 3RR5A 4WFN3 1WYDA 4K8IA 4YY3L 1YI2A 5C0XI 1NUCA 2JEBI 5CV8A 1KL9A 3GDEA 1QVFA 3H3VH 1F9PA 3MC0B 2N8NA 4A3MG 2ICEC 4IUVA 4IOCA 4QB4A 2LFNA 4WORA 4ZK9B 3GTJB 3D4DA 4H44C 1JOOA 2PNRC 3PO3H 2A6ED 3CMEA 2ZJRA 1B3AA 2K03A 1S40A 4JG2A 2OT2A 5CV6A 3DWAA 4JI0Q 4LF6L 2EYOA 2PO4A 1S5BD 3J81i 3VYSA 2AMCB 5TSSA 1VQ9A 4DV5Q 3RLNA 1CA5A 3K0XA 4V0BA 2QDLA 1PRTB 2EXDA 3OMGA 4J8QA 4CBVA 2M00A 2WB1G 4IFDG 4MZ9A 1QWYA 5DEHA 3OMCA 4B3MQ 4UDUC 3QO2A 1BBXC 1VQAA 4JW0A 1U4PA 1GO3E 4JI4L 5C5MA 3KK7A 3HFZB 1SE4A 4LAAA 1E2WA 2KQ3A 1BCPD 4TRDA 1PZKD 2F0EA 3K81C 4OEMB 2GN5A 1NBWA 1FYCA 4JI7Q 2ICIA 4C3IH 2FMMA 2B8GA 2VQEL 4JK1C 1RKNA 2VB3X 5M3FH 2ALYB 2EY5A 1VQJA 4A75A 3RNUA 4MIUA 4LF5Q 1M4VA 4DNIA 1LT3D 1L1OB 2F0QA 3GTOB 3HGBA 2LXJA 2Z0SA 3CD6A 4NMZA 4MTKA 4YHHQ 5C5LA 2NUCA 2VZAA 1PZID 4NPSA 4DNTB 2EJMA 2A74C 4X3KA 1ILPA 1S5DD 3CQZH 1LACA 1HUNA 3CCUA 4YY3Q 1SAPA 4A3IH 2C9OA 4POGA 1PH2A 1NAPA 4OO1H 1PH5A 1NSNS 2E2HB 1VMPA 4TQUS 2RDFA 5IYCG 4OIJA 1SFOH 1HFNA 2V4DA 1F2YA 5J22A 5E7NA 4FP5D 2SNMA 1YVCA 1W3SA 1Y1VB 4X64L 4FVMA 2NBFA 1NMGA 3HOUH 1OXSC 1KAAA 4B3RQ 2EY1A 1Z7TA 4ULLA 2K5QA 2IPKD 2UXCL 1PXUA 2LSSA 2Y0SE 3KBXA 1SYCA 3VR6A 2EDGA 2MNAA 2F03A 4IUQA 1I6HH 5FO9B 5JEAH 2ZJPA 5M3MH 5EPJA 1RL2A 1UE7A 3MAQA 3OSOA 2D62A 3U50C 1JICA 1C4QA 4LFCL 4TVAB 3LNNA 1SNPA 4J1MA 1XNRL 2IHFA 1QG7A 5DM63 3C1FA 1ILQA 3LX0A 4CKEA 1STYA 2ZTDA 3L3OC 1FNUA 3A55A 5EKKA 4GKJL 1G2SA 1K0RA 5IP7G 5C44B 1PRTC 2L9HA 5M5WB 4RA8A 4RKLA 2CQOA 3SR1A 4L63B 2X69A 2NZHA 3M7GA 4DAYA 3K5MA 5EBCA 1T5EA 1O7YA 2VQEQ 1S72A 2EVBA 3KFUA 4XQNA 3OPOA 4MTNA 4LFAL 3MA2B 3V05A 1V43A 3U58A 1EZ8A 2O4XA 4NB3A 1STGA 4DKAC 3GTKB 2XRSD 4DFAA 1V9PA 3EJIA 1E2ZA 2H4OA 4PNYA 3B6YA 4H02A 2H5XA 5G3LF 1KHIA 4LW1A 3P1HA 4V190 5EAYA 4R8IA 5C4XH 4JBMA 4JC0A 4DNRB 4BBSH 3U4ZA 1L1OC 2L1BA 1D5XC 4PQXA 2IL8A 5ELBA 4DAVA 3DM1A 3G4SA 3T1HL 1O7ZA 2OQKA 3DUZA 1ICFB 2D2CC 1LYLA 4X64Q 2PI2E 1SYEA 4KJNA 4DAYB 1T9HA 1Q7YC 3DXJC 1EQVA 2JA5H 2ZM6L 1E1TA 1EYAA 1IBML 2NVXH 1KXLA 1EY0A 2B2WA 4KJOA 4RG1A 4IN3A 1VF7A 2K04A 4OWWB 5J1ZA 2J4XA 2IW3A 2UXCQ 4CKBA 1GHKA 4Y7NB 4TSSA 2EYHA 2LKVA 2EJGC 1C8CA 1OXVA 5IT9E 1TWGB 4A3CH 4JOIA 3TP8A 3I4MG 4LF4Q 4KI0A 4LFCQ 2JQOA 2ZTEA 3W1GA 1EU4A 1XNRQ 4MNOA 5JEAJ 1MKHA 5M5XH 3S17B 4A3MH 4GKJQ 4DAPA 2HDMA 2F0SA 3CC2A 2B39A 5FLXL 2JA8B 2E74C 4GLVB 4F88A 3GTQB 2RHQB 2K32A 1YHQA 2I5MX 4Y52H 1STEA 3NELA 3HOWB 1L0WA 4LFAQ 3JAMc 4XYOA 3S9WA 1L2FA 1DM0B 1VF5C 4FF1A 1N33Q 3RN2A 2R93B 1VDZA 5CBAE 2A6HD 1EWIA 1EY8A 2A5HA 4JBJA 1HNWL 2PI2A 3EA6A 4IFDH 2RBMA 2WV6D 2KHSA 3GO5A 1TT2A 2C35B 1DCZA 4HIMA 4AQYL 4I7ZC 2I0QA 2MGSA 3AB9A 2L55A 3KLSX 4X3UA 2ID0A 3N6RA 5JOBA 4QQBX 1HRJA 3EVQA 3VYRA 1H9RA 1DYQA 3L7ZC 2ZM6Q 4DV4L 3RLFA 3T4AC 1IBMQ 1A3UA 5CC4A 1AW7A 2KBNA 4ABNA 3PO3B 2K05A 4OELB 3MXGA 5IP9G 4IUPA 3R8BA 3IL8A 5BN5A 1SNQA 3RZOH 1Q82C 2O5JC 1AP0A 5IGGA 3KLWA 2Y0SG 1HTLD 2PZWA 2JA7G 3MXNB 2F0GA 3D4RA 2WAQB 3M3YH 3RD4A 3NSWA 5IYCH 1ZEQX 1NNXA 1WFQA 3K5NA 2Z4IA 1JCKB 4IPHA 3L0OA 3CHBD 2SDFA 4JI1L 2X6GA 1TWFB 3GP7A 2NTSA 4OONA 3J80E 1K8GA 1Q46A 2PZTA 3NBHA 1KDCA 3HOWG 4WJWA 2B3GA 4QY7A 4AIMA 4EX5A 2MHVA 3TBIB 4JV5L 4EGVA 1DONA 4R4TA 1JB7A 2CH4A 5I4DA 1HNWQ 2JA6G 3I4LA 1LTSD 1V1PA 1HZBA 2B2WC 1K3BC 5IE8A 3CQZB 3I4OA 4KKUA 3URYA 1PYBA 1Q8KA 1M90C 3I4NG 1FGBD 4A3IB 4AQYQ 2OTLA 2QEXA 4FF3A 4GOPA 4OO1I 4A3LG 1K8MA 1N36L 4JOIC 1SFOB 4IFDJ 5IP7H 2B2UA 1G8ZD 4P72A 2RKSA 2VL6A 1GXDC 3S14B 2MO0A 1G6ZA 4DF7A 3NBHB 4DV4Q 1ASZA 3L2PA 1TWCB 1SJED 3A7LA 2UU9L 1F77A 4DUZL 4RGOS 3H3VC 3K80C 3Q24A 1GKHA 1V1PB 1QVGA 1D1IA 3I70A 1C0AA 4DV1L 2L0CA 2PMZB 4GOPB 2E8GA 3AFQA 4BWGB 3QJYA 1BCPF 1Y8NB 2BOSA 4L6TB 2VQFQ 4A3FG 1CKMA 2E76C 3SDZA 2XVSA 4C56C 5H1SE 5ELFA 3C2PA 1YNNC 2JXMB 1JOQA 5EBDA 1X54A 2BA0A 1Q86C 1U4RA 3DLLA 1PFBA 4JI1Q 1E22A 5C4JH 4PV1C 4KY5A 2Z6KA 4IOAA 1KDAA 4R4OA 2IX1A 1BNZA 1IHZA 1HCZA 1R4PB 3PUYA 1D8LA 2F3VA 3OWEB 1PH3A 2NVYB 3FMCA 1ET9A 2C5CA 1HNZL 1EY5A 4LJZC 1ZKOA 4NXML 3GTGH 3I4MH 1LT6D 3E6ZX 4DPGA 2CWPA 5D3IB 1XNQL 3TSSA 1JE4A 5LL6X 2D0OA 1E1OA 2EQSA 3P75A 4BXXG 5C4XB 1DOMA 4RMFA 5CV7A 1IW7C 1N36Q 3TN2A 3J7A5 1PZJD 1GHJA 3PF5A 5IIFA 3KDFB 2OXPA 3H09A 2NVXB 2JA5B 1SLJA 4GN4B 3CMAA 2UU9Q 4DUZQ 3ERQA 1EIHA 1G2TA 3CP0A 3UE0A 4BBRG 3I72A 3ZYYX 2F0OA 1VQHA 1B70B 4IURA 2RCNA 1ASYA 1I6VC 1DD2A 1Q12A 3HOZG 1I4HA 1PMRA 3VDYA 3I2ZA 3CKIB 4DV1Q 4BY1B 2DNEA 1ONLA 1HUMA 3W2DA 1HTPA 4LF9Q 3UDFA 3CF5A 2YTVA 4OWTB 1TQOA 3FVQA 2Z6BA 5JJZA 4YIJA 2KCMA 2LMCB 1VQ4A 3W5OA 1TU2B 4C2MB 3IFDA 4B9WA 1O80A 1TY2A 1KRTA 1KIXA 1EYDA 4GOPC 1A63A 2E75C 1LUZA 2JA9A 1VCIA 1WCMG 2F0JA 1ZYRC 5IP9H 2AWOA 2Q8TA 1SE2A 1PH6A 1TWGH 1J6QA 1TKWB 2WKCA 1HNZQ 4NXMQ 1LTID 1OXUA 3K6OA 1NY4A 3M4PA 2AQ1B 2G9DA 4R4CA 1STHA 2WB1B 1PH7A 1XNQQ 2EY2A 2JA7H 5IGEA 5E3FA 4IZ8A 1C9OA 1MI2A 3ULPA 3CRLC 2K5DA 3G7LA 4FYDA 2IY5B 4A3BG 3KF6A 4X65L 3T16A 4EQPA 3HOWH 1PYWD 1NTGA 3SEBA 1RJTA 2MP1A 1Y69U 2JYOA 2KJXA 5M5YH 5L37A 4HEDA 1UUPA 3SK4A 1TR5A 2NTTA 1SDFA 1F2ZA 1RDPD 1QUQA 2JA6H 3RZOB 5J3BA 2F1MA 4HJ9A 4K5XA 4BY1G 1WTHA 2QDBA 2Z6KC 1SYBA 3LGJA 1AH9A 3E0JA 2HT1A 1CHPD 4G7HC 3I4NH 4PZ7A 1B44D 4K2LA 1ET6A 4A3LH 4KHPL 5JJLA 1BVSA 3M3YB 2EXZA 3CPFA 4F7XA 2VW9A 4DA2A 4KTAA 1YNJD 2HCIA 4DV6L 1VQ5A 5I2XA 4HSPA 5LMNW 4IUUA 3F2UA 2E5LL 3W1BA 3NHHA 2DNCA 2NVTB 5KYLA 2UXDL 5FLXc 1SXTA 2N78A 5ELEA 3I55A 3K57A 4ZQ3A 4CDFC 3SK6A 4OGQC 3HKSA 4JI3L 2D9UA 3JAME 1SMYC 2JJQA 5I6WA 5DAUA 4QGUA 1A2TA 3HP3A 4ZAIA 3V2TA 4A3KG 1YITA 1UEBA 2WINB 2MO1A 5K5PA 4HAEA 1X3PA 3DWQA 1CQFA 1CZWA 1L0YB 1XWEA 2OCEA 4KV6A 3TRZA 3K0YA 3AFPA 1HJPA 1HR0L 1ENFA 2CVRA 2B2YA 1NJIC 2FJ2A 1EZ6A 1CA6A 1X3GA 5FLMG 1WTVA 4DK0A 3NWSA 1J5EQ 5AFWA 1TWFH 4X65Q 3PMFA 3Q8DA 4IPCA 4S3SA 1MJCA 3MZ5A 1G51A 2V1CC 1ICWA 2FFKB 1SYDA 2WACA 2B2TA 1YZ6A 4FF2A 2A1AA 3STBC 1VQOA 4E6IA 4IO9A 3A0JA 4N9PA 2QCPX 1W6JA 1N34L 2CKZB 4K0KL 2A69D 4K2KA 2EE1A 2F3IA 4H7BA 1SRUA 4LWCA 3A74A 2XNAC 4GN3B 4A3EB 2HHHL 4G7ZC 1LT5D 3QWNA 4DR1L 4BS9A 4PZ8A 4POFA 1GUOA 1JJ2A 4HSVA 2K33A 4KHPQ 5KEEA 1P8LA 4BXXH 5KNBA 1F2LA 3PIO3 4UP7A 3EROA 5IT9L 4DV6Q 3S14H 1I94L 4DN4M 2E5LQ 4NDXA 2EOTA 2N49A 2XRQD 1BUVT 2JE6I 4RGTA 2UUBL 2I07B 1TWCH 1KABA 1PTOD 1TIID 5KYIA 4A93B 2EPBA 5C4JB 5C0XG 4BY7G 3PUWA 2G5DA 2MQHA 1HNXL 3ITPA 2E2DC 4N8FA 4BBRH 2FXQA 4JI3Q 2KHIA 4LF6Q 3PV0A 4KHVA 3O13A 3BZDB 4JBWA 4K5WA 3SGIA 3HOZH 4P2CB 2ZT9C 1N9WA 3NUCA 3W3AA 3GTGB 1AE2A 2ZJQA 1NCVA 3K7AB 1SR3A 3I4MB 4C3JG 3E9HA 2UUAL 5LL6S 3N52A 1Q8IA 1SNMA 3K58A 4UAIA 4ME5A 1A62A 4WJ3M 3NE5B 1HR0Q 1EY7A 4OHJA 2OF1A 2PZUA 4JI4Q 1S5FD 5CR3A 1VMCA 3I8ZA 2DY7A 5GQOA 2K4KA 2O5IC 1N32L 1AZPA 2B2VA 1IL8A 1SEBD 3F1ZA 2NVYH 2BDNA 3TREA 4J6HA 4IPGA 3TDQA 1PDQA 4X3SA 5E1FA 4MHEA 1H95A 4PMCA 3C1EA 1N34Q 3FPUB 3TEHB 1LT4D 5HGQA 4K0KQ 4RAUC 1IYJB 1VQIA 4A3EG 1BCPB 3UDGA 1JE5A 2BE5C 1RTOA 3PIOA 4A3JG 1WD1A 2HHHQ 4DR1Q 2B8FA 4OXPA 1PH1A 3U9OA 2CCZA 3E5SA 3S24A 1I4GA 2XSCA 1CSQA 3M4YA 1KNAA 4GLXA 1RODA 3NXWA 3SK8A 5JJKA 1I94Q 1Y8PB 4DV2L 4A3BH 3J81c 2UUBQ 3KF8A 5EKIA 4LF8L 1LLRD 3GTPH 4OWXB 4A93G 1LTTD 2B2YC 2BA1A 2K52A 3PUXA 3M85A 3K5LA 4CJ0B 4MN3A 1HNXQ 1JT8A 2XIWA 4OIKA 5JVG3 3CW2C 1I50B 2F0TA 1H9JA 2A68D 4CDDC 1STAA 1XMOL 2NWGA 4L5QA 4L5RC 5FOBB 2R61A 4BY1H 3J80L 3K7UC 2UUAQ 1W2BA 4IPDA 2GVBA 2XGTA 2Y0SB 3PIP3 2B2TC 1HZCA 2RSNA 2JA7B 3H0GG 5HGTA 1I4RA 4LF7L 3R93A 1HZ9A 3AU7A 3FHWA 4AYBE 2XWJB 4HJ5A 2IX3A 1NMFA 3KF8B 4C2MH 4ALPA 4NKLA 2O2LD 3UI2A 1EIYB 3S1NH 2L15A 4RCNA 3T51B 4BA2I 1YIJA 1FNVA 4EQNA 2WKDA 1O7IA 2HCCA 4KMUC 2F0KA 1IW7D 1EIFA 1S3OA 4O0AA 5M5YB 2A6EC 3CCVA 3CXCA 3E0EA 4A3KH 5EPLA 2NN6G 1HHVA 3S2DH 3VA5A 3FP9A 2JA6B 2XWBB 4P71A 4XT1B 2ZXPA 4A3DB 1NR4A 4BA1I 1CHQD 2PYKA 3HOYB 1CUKA 3I4NB 4CJ1B 1Y8OB 4FXGC 3HS0C 4KD4A 1EQTA 2F0PA 1DXMA 3H3VI 1DOKA 5IYDG 5FLMH 3T1HQ 4H0LC 5EQ0A 2MPMA 1DZ1A 4DV2Q 2YU9B 3NEMA 1IKMA 5C3WA 4LF8Q 1V1QA 1IL2A 4IJHA 1BCPC 3BYTB 5IY0A 4DUYL 2F4VL 2GVAA 1JORA 2EY6A 1E2VA 1JJCB 4IQZA 2F0IA 3OIPA 1L0XB 3MEHA 1PYSB 3QR8A 2JEAI 4P75A 4DR7L 1PH9A 3PIPA 1J9OA 3CCJA 3VR5A 3ULJA 4DXFA 2B2VC 2MFIA 1U4LA 1TWAB 3ND9A 4FNFA 3OTOL 4IALA 5ISRA 1LTGD 5I6YA 2UUCL 4DU9A 2TSSA 1WTXA 2KUMA 4KKSA 1B1ZA 2F4IA 3M9BA 1YJWA 4A3FB 3BDCA 1WI5A 1WJJA 2FMCA 2XN9C 1K8AC 5IGCA 1D5ZC 1Y1WG 2Q2HA 2ZXRA 1UEAB 3T1YL 3Q6SA 4ID6A 1VQGA 2NVTH 1D2BA 2F0VA 1FJGL 3T13A 4KY7A 4HTHA 1H9SA 2YTYA 2LS01 2N55A 2AUKA 1HZAA 4BY7H 5C0XH 1UE1A 4GKKL 1BOSA 3ND8A 1YNXA 1C7YA 4GS3A 4A4IA 3DMUA 5IYBG 4O2DA 1B9MA 4UY8C 2CFMA 1A15A 5T1GA 2K14A 1LO5D 5COYA 2D5DA 3A5UA 4ME3A 1LM0A 1P16A 1SNDA 4LMQD 2DJGC 4HMIA 5GAEC 4C3JH 3M4OH 2M2LA 4A3DG 1MIUA 1O78A 1MSGA 3RZDB 3HOYG 3HG9A 3VYUA 3P20A 1CKOA 1FVIA 3GTLH 2RSOA 2VXWA 2RCFA 1F9SA 4JYAL 1AEXA 4ZRZA 5ELCA 4EVOA 1YHBA 1VQBA 4G7OC 4JI8L 1F9QA 5EGTA 2QW7A 1AZQA 2XTIA 4X6AH 1EYGA 3QIAA 2F4VQ 2OQ0A 1I4QA 1G291 1R4QB 1VQMA 2ASBA 3QOLA 3H15A 1QB5D 1DJRD 3S1MH 4BBRB 2EIFA 3A5ZB 1QILA 4JBKA 2Q8RE 3AMUA 3GV3A 4HCEA 3HOZB 4TKOB 2KCNA 4N8X1 1FR3A 1W6KA 2R7FA 4HJ8A 4A3EH 2WFWA 4RGMA 3OTOQ 2B63B 1G91A 1U5KA 3R3OA 3EN2A 3CPWA 4UP9A 4A3JH 4ZUJA 1A3TA 4QIWE 3U9SA 1YHAA 3TQYA 4A76A 1MD2D 3J80i 3BVMA 3T1YQ 1WVLA 1R9TH 3WOEA 1QOHA 1LTLA 3RLOA 3G6EA 1KDBA 3C46A 4A93H 1LTRD 2F0HA 1EUJA 1WCMB 5EKLA 3AYHB 1VQLA 5CGKA 4JV5Q 1X3FA 3PUZA 3TS2A 1BO0A 3LWEA 4ZCKA 4FXKC 1X6OA 3RMHA 3K7AH 5C0XJ 1TWHB 5CYUA 5LHY1 4K14A 5C3EG 1SN8A 2Q8IB 1ZXTA 5NUCA 4P73A 1S5CD 3H0GH 1FL0A 3STBD 1CZGA 4KHZA 3NENA 1N8RC 1PTOF 4JYAQ 3X3NA 3T56B 5IT9c 1WD0A 2JP1A 4JI8Q 3ONAB 4JI5L 1IBKL 1CTMA 1KAWA 1X56A 4A3BB 1GVPA 3GTPB 4ZKBB 1BBWA 3DHQA 2N3SA 3MFYA 5BN4A 4XT3B 4KN7C 1VQKA 2NN6H 4X3TA 4P74A 2AUJD 1SNCA 4G4KA 5ELNA 1XPOA 1IBLL 2KEDA 3KYHC 2B63G 2A6HC 2P5ZX 3PCOB 1QCBD 2A19A 5CV5A 4KKTA 5IWAL 1STBA 1PFNA 3JAML 1U4MA 4FDBA 1B7YB 4ZYSA 5JJIA 4DR4L 5IYDH 1G6PA 3S2HH 5FJ8G 2LXKA 1HH2P 4F87A 3MTSA 4YWMA 3A8IE 1IXRA 1VQCA 1KTKA 1B4OA 3BVZA 3S1NB 1XJVA 3HOXB 3Q23A 4XTCS 1I50H 2K01A 1BF4A 1KNEA 2B2UC 2F3WA 1PRTD 4ZKCB 1A6XA 3MXPA 1EU3A 3MXUA
chains in the Genus database with same CATH topology
1B50A 2EYLA 4A3KB 3OW7A 3FEWX 3S2DB 2OEOA 5CBEE 4IFDI 5C4ZA 3KUPA 1KLGD 2R6GA 3H94A 1WTOA 2F0LA 2IJ0A 1SBBB 5A35A 5C3XA 4ZLTF 4FF4A 2HUGA 2KVMA 4C3HG 2F0UA 3K59A 3J81E 3S1RB 2F0FA 4FXDA 1GUSA 3NTIA 3MFGA 4KK7A 1WTQA 3TP7A 1MBYA 4O1NA 1X32A 3QB3A 3J7YW 1JOKA 3OWFA 5C4HA 1HXYD 2CW0C 1EWCA 2NZ1D 1CI3M 4HCSA 3WDNA 4I65A 2WP8J 5I2YA 2HDLA 1DOLA 4FO2A 1QJOA 4M1UB 1SYGA 5D14A 4BY7B 2VNUD 1RCVD 3FDTA 3D3RA 3SE0A 5JAVA 5KNDA 1SJHD 5DNFA 4LK1C 1M8AA 1TY0A 2PW5A 5T1IA 1CT1D 5D3DA 5K36G 4CGYB 1TS4A 4C3JB 3M4OB 5KNCA 2R92B 3GTLB 5CV4A 3Q0AA 1ENAA 1XX8A 3QOJA 2DY8A 3VR3A 2FINB 1SYFA 1BR9A 2QEJC 2WIIB 3BS1A 4ODGA 2EYJA 3J7AV 2L11A 4KY6A 3NBIA 4RH6A 3S1MB 3MWYW 2GA4B 4KN4C 4K6DA 1OO9B 2MJ8A 2VUMB 1KLUD 1SNOA 3TZUA 1A3VA 3G6JB 2NYZD 3RUZA 4QF4A 2L12A 3A54A 4A3JB 2KOLA 1ESRA 3D4WA 4RGNA 3CRKC 4R8NA 5CV9A 3X3MA 1V8QA 4HMJA 2R7ZB 4QUFA 4L8JA 1R9TB 1UNSA 2E2JB 4ILWA 4QMGA 1IYVA 3NP8A 5IGFA 1JC7A 1UAPA 5J39A 3KLRA 1QNUA 4Q0FA 1LTAD 4CHTB 4DK1A 5JPNC 3TP5A 4XQJA 1Q3LA 5JPMC 3I91A 4PMBA 1F2MA 3VR4A 3H0GB 1PFMA 1Q1BA 1WTWA 1E0BA 3GD7A 1EEID 5HURA 2F0MA 5ELDA 2E2IB 5CORA 2CHBD 3NTHA 5IOCA 1GUWA 3HZXA 2BCOA 5KRUA 1GJXA 2JSOA 3TMEA 2NN6I 5I9PA 1MSHA 1B53A 1JWMD 2H1EA 3D6WA 2SEBD 1IKLA 3T53B 4HR7B 1WTRA 5F2DA 4QCLA 3D31A 1EY9A 1F9RA 2PPBC 3S2HB 4DXGA 4IUNA 2EZVA 3S16B 5E4XA 1JR0D 3LWUA 1CK1A 1WTPA 1LV9A 3SVMA 1LTBD 1YNND 1V1OA 4XXEA 4XIGS 1EEFD 2J7ZA 1QE6A 4RCOA 3NK9A 1MGSA 5JVH3 4H13C 4U68A 4Z9CB 2BDOA 3C3LA 4K5VA 3BDOA 1STNA 2QF7A 1PTOB 3HRZC 5FKAC 2G9HD 1TS2A 2I46A 1B9NA 2LY7A 2RDGA 4KD3A 5FO7B 1Y1WB 2Z4HA 4O42A 1J8IA 1YNJC 3DWPA 2K5WA 5FK9C 5EPKA 1EYCA 3FPPA 3QG1A 1GUGA 3D8GA 1TS3A 2KEEA 3WOFA 2AQ2B 1LABA 2DN8A 3HOVB 2F0NA 3OOCA 4RFBA 5K36H 1EY6A 1EOTA 3A8JE 1U9RA 2IT1A 3EQLC 1D1KA 2HQEA 2RVLA 4PMWA 1ML0D 1HQMC 4EQOA 3HEJA 1RHPA 3H6MA 1Z6HA 3GQBA 1C48A 4IUTA 2L4NA 5M9OA 1PRTF 4G57A 1CFMA 3GTMB 4WRDA 1TS5A 1CM9A 3NQIA 3MXNA 1EIGA 4GZYC 2RDHA 1XXGA 2IX0A 4U673 4K8JA 1ENCA 1ZYRD 3VA7A 5C6AA 2A69C 3MVVA 1FD7D 3BDLA 4NW2A 2F0DA 4C1NI 2SNSA 3BVGA 1I3QB 4N9TA 3IFTA 4RHSA 2RQXA 1D6EC 1JWUD 2NVQB 3Q22A 5KGUA 1PTOC 1EY4A 3A56A 1JB3A 2J0TD 3EFXD 2AWNA 3NQTA 4CJ2C 4AYBB 1A2UA 3MHBA 3VR2A 4XYQA 2MUYA 4QUCA 2Z8LA 5C3EB 2TMPA 3K5OA 1SSOA 1JWSD 4C3IB 5M3FB 1OXTA 3PUVA 1GUNA 3H91A 2X6LA 1H9SB 4ZUIA 4NP5A 2CW0D 3NWTA 4RKBA 1BDOA 5FLXE 5A2QL 1B2TA 1Q90A 4B9XA 1HA5A 3I3CA 3SXHA 5IODA 3P7JA 4K6LA 3BG3A 3TZDA 1OXXK 5I9OA 1H9MA 1IYUA 3OHXC 2N88A 2K1BA 1BXTA 3HOUB 3CU7A 5EJWA 3GV6A 1SMYD 5IGBA 3M7NA 1Q1EA 2YYZA 1K8OA 3V96A 5CMDA 2ENBA 1X3QA 1GUTA 2K7VA 2EYFA 1I6HB 3SK5A 1HPCA 2A73B 5M3MB 1TVXA 3S15B 2KECA 5E4WC 1EL0A 2VB2X 5IGDA 2Z1CA 3FRPB 5G3LD 5KIXA 1RTNA 2FHTA 3J81L 2A68C 1AN8A 3KLSA 2EYPA 1S5ED 1Z47A 4CKCA 4HN7A 4C3IG 3D6CA 1RD9D 2PW7A 1SE3A 3A7AB 1HA6A 4R9WA 3DEOA 2NB0A 2CQAA 5FO8B 4C3HB 2QILA 1XTCD 2K6AA 3HKZB 5DM73 3L9AX 3NPPA 1I4PA 2IWHA 4OO1G 2F0WA 1O7LA 4BBSB 3NTKA 3KBGA 1EFID 2M9VA 1JQYD 2RA4A 4RHRA 3IKJA 5BN3A 3PO2B 2SOBA 4F8MA 3I73A 5A2QE 1PLFA 3FKIB 2QKIC 4B08A 3SHLA 5JEAG 3I90A 3BYYB 1AFPA 1XYIA 2KCCA 4QIWB 3DEPA 3R2TA 3S1QB 1NR2A 3R2IA 3A8KE 1HFGA 1S4ZA 1FNWA 5M5XB 2AQ3B 1QNKA 4A3MB 2EJFC 1T5XD 1PTOH 2PCFB 4DGZA 1HQRD 1BQQT 1CQVA 2R3ZA 5D65A 1D5MC 4XQQA 2BE5D 1ESFA 3IAYA 4M8AA 4XDXA 1I4XA 1RF2D 4A3GB 4Q5VA 3OIQA 4RWSC 2PQEA 1II3A 2ZXOA 2L5TA 1GOZA 1K83B 2EYMA 3VYTA 2KA7A 1EWHA 3J7AF 4OL7A 2K28A 4C1NK 3TP6A 1H9KA 4WFN3 4K8IA 5C0XI 1NUCA 2JEBI 5CV8A 1F9PA 3MC0B 2ICEC 4IUVA 4QB4A 2LFNA 4WORA 4ZK9B 3GTJB 3D4DA 4H44C 1JOOA 2PNRC 2A6ED 1B3AA 2K03A 2OT2A 5CV6A 3DWAA 2EYOA 2PO4A 1S5BD 3VYSA 5TSSA 1CA5A 4V0BA 1PRTB 3OMGA 4J8QA 4CBVA 2M00A 4IFDG 1QWYA 5DEHA 3OMCA 4UDUC 3QO2A 1BBXC 1U4PA 5C5MA 3KK7A 1SE4A 4LAAA 1E2WA 2KQ3A 1BCPD 4TRDA 1PZKD 2F0EA 1FYCA 2ICIA 2FMMA 2B8GA 4JK1C 1RKNA 2VB3X 2EY5A 4MIUA 1M4VA 1LT3D 2F0QA 3GTOB 3HGBA 4NMZA 5C5LA 2NUCA 1PZID 4DNTB 2EJMA 2A74C 4X3KA 1ILPA 1S5DD 1LACA 1HUNA 1SAPA 2C9OA 1NAPA 4OO1H 1NSNS 2E2HB 1VMPA 4TQUS 2RDFA 1HFNA 4OIJA 2V4DA 1F2YA 5J22A 4FP5D 2SNMA 1Y1VB 4FVMA 2NBFA 1OXSC 1KAAA 2EY1A 1Z7TA 4ULLA 2K5QA 2IPKD 1PXUA 3KBXA 1SYCA 3VR6A 2EDGA 2F03A 4IUQA 5FO9B 5JEAH 5EPJA 3MAQA 3OSOA 2D62A 1JICA 1C4QA 3LNNA 1SNPA 4J1MA 1QG7A 5DM63 3C1FA 1ILQA 3LX0A 4CKEA 1STYA 3L3OC 1FNUA 3A55A 5EKKA 1G2SA 5C44B 1PRTC 2L9HA 5M5WB 4RA8A 4RKLA 3SR1A 4L63B 2X69A 3M7GA 4DAYA 3K5MA 5EBCA 1T5EA 1O7YA 2EVBA 4XQNA 3OPOA 3MA2B 3V05A 1V43A 1EZ8A 2O4XA 1STGA 3GTKB 2XRSD 4DFAA 3EJIA 1E2ZA 2H4OA 4PNYA 5G3LF 3P1HA 4V190 4R8IA 4DNRB 2L1BA 4PQXA 1D5XC 2IL8A 5ELBA 4DAVA 3DM1A 1O7ZA 3DUZA 2D2CC 4KJNA 1SYEA 3DXJC 1EQVA 1EYAA 1EY0A 2B2WA 4KJOA 4IN3A 1VF7A 2K04A 5J1ZA 2J4XA 2IW3A 4CKBA 1GHKA 4Y7NB 4TSSA 2EYHA 2LKVA 2EJGC 1C8CA 1OXVA 5IT9E 1TWGB 3TP8A 4KI0A 1EU4A 5JEAJ 3S17B 4DAPA 2HDMA 2F0SA 2B39A 5FLXL 2JA8B 2E74C 4F88A 3GTQB 2K32A 1STEA 3HOWB 4XYOA 3S9WA 1DM0B 1VF5C 4FF1A 2R93B 1VDZA 5CBAE 2A6HD 1EY8A 2A5HA 3EA6A 4IFDH 2RBMA 2WV6D 2KHSA 3GO5A 1TT2A 1DCZA 4I7ZC 2MGSA 3AB9A 2L55A 3KLSX 4X3UA 2ID0A 3N6RA 5JOBA 1HRJA 3EVQA 3VYRA 1H9RA 1DYQA 3L7ZC 3RLFA 3T4AC 1A3UA 5CC4A 1AW7A 4ABNA 3PO3B 2K05A 3MXGA 4IUPA 3R8BA 3IL8A 5BN5A 1SNQA 2O5JC 1AP0A 5IGGA 1HTLD 2PZWA 2F0GA 3D4RA 2WAQB 3RD4A 3NSWA 1ZEQX 3K5NA 2Z4IA 1JCKB 3CHBD 2SDFA 3J80E 2X6GA 1TWFB 3GP7A 2NTSA 2PZTA 3NBHA 1KDCA 4WJWA 2MHVA 3TBIB 4EGVA 1DONA 5I4DA 3I4LA 1LTSD 1V1PA 2B2WC 3CQZB 4KKUA 3URYA 1FGBD 4A3IB 4FF3A 4OO1I 1K8MA 1SFOB 4IFDJ 2B2UA 1G8ZD 2RKSA 1GXDC 3S14B 1G6ZA 4DF7A 1TWCB 1SJED 3A7LA 1F77A 4RGOS 3H3VC 3Q24A 1V1PB 1D1IA 3I70A 2L0CA 2PMZB 4BWGB 3QJYA 1BCPF 1Y8NB 2BOSA 4L6TB 2E76C 3SDZA 2XVSA 4C56C 5ELFA 3C2PA 1YNNC 2JXMB 1JOQA 5EBDA 2BA0A 1U4RA 1PFBA 4PV1C 4KY5A 1KDAA 2IX1A 1BNZA 1IHZA 1HCZA 1R4PB 3PUYA 3OWEB 2F3VA 2NVYB 3FMCA 1ET9A 2C5CA 1EY5A 4LJZC 1ZKOA 1LT6D 3E6ZX 5D3IB 3TSSA 1JE4A 5LL6X 3P75A 5C4XB 1DOMA 5CV7A 1IW7C 3TN2A 1PZJD 1GHJA 5IIFA 2OXPA 3H09A 2NVXB 2JA5B 3ERQA 1EIHA 1G2TA 3I72A 3ZYYX 2F0OA 4IURA 1I6VC 1DD2A 1Q12A 1I4HA 1PMRA 3CKIB 4BY1B 2DNEA 1ONLA 1HUMA 3W2DA 1HTPA 1TQOA 3FVQA 5JJZA 4YIJA 2LMCB 1TU2B 4C2MB 3IFDA 4B9WA 1O80A 1TY2A 1EYDA 2E75C 1VCIA 2F0JA 1ZYRC 2AWOA 2Q8TA 1SE2A 1TKWB 2WKCA 1LTID 1OXUA 3K6OA 2AQ1B 2G9DA 1STHA 2WB1B 2EY2A 5IGEA 5E3FA 4IZ8A 1MI2A 3CRLC 2K5DA 3G7LA 4FYDA 3T16A 4EQPA 1PYWD 3SEBA 1RJTA 2MP1A 1Y69U 2JYOA 2KJXA 4HEDA 1UUPA 3SK4A 1TR5A 2NTTA 1SDFA 1F2ZA 1RDPD 3RZOB 2F1MA 4K5XA 2QDBA 1SYBA 3E0JA 1CHPD 4G7HC 1B44D 4K2LA 1ET6A 3M3YB 2EXZA 4F7XA 4DA2A 4KTAA 1YNJD 2HCIA 5I2XA 4HSPA 4IUUA 3F2UA 3NHHA 2DNCA 2NVTB 5KYLA 1SXTA 5ELEA 3K57A 4ZQ3A 3SK6A 4OGQC 2D9UA 3JAME 1SMYC 5I6WA 5DAUA 1A2TA 3HP3A 4ZAIA 3V2TA 2WINB 5K5PA 4HAEA 1X3PA 3DWQA 1CQFA 1CZWA 1L0YB 1XWEA 4KV6A 3K0YA 1ENFA 2CVRA 2B2YA 2FJ2A 1EZ6A 1CA6A 1WTVA 4DK0A 3NWSA 5AFWA 3PMFA 4S3SA 3MZ5A 1ICWA 2FFKB 1SYDA 2WACA 2B2TA 4FF2A 4E6IA 4N9PA 2QCPX 1W6JA 2A69D 4K2KA 2EE1A 4H7BA 2XNAC 4A3EB 4G7ZC 1LT5D 3QWNA 4BS9A 1GUOA 4HSVA 2K33A 5KEEA 5KNBA 1F2LA 3PIO3 3EROA 5IT9L 4DN4M 4NDXA 2EOTA 2XRQD 1BUVT 2JE6I 4RGTA 2I07B 1KABA 1PTOD 1TIID 5KYIA 4A93B 2EPBA 5C4JB 5C0XG 3PUWA 3ITPA 2E2DC 3PV0A 4KHVA 3O13A 3BZDB 4JBWA 4K5WA 4P2CB 2ZT9C 3NUCA 3W3AA 3GTGB 1NCVA 3K7AB 3I4MB 4C3JG 5LL6S 3N52A 1Q8IA 1SNMA 3K58A 4UAIA 4ME5A 3NE5B 1EY7A 4OHJA 2OF1A 2PZUA 1S5FD 5CR3A 1VMCA 3I8ZA 2DY7A 2O5IC 1AZPA 2B2VA 1IL8A 1SEBD 2BDNA 4J6HA 3TDQA 1PDQA 4X3SA 5E1FA 4MHEA 4PMCA 3C1EA 3FPUB 1LT4D 4RAUC 1BCPB 2BE5C 1RTOA 1WD1A 2B8FA 3U9OA 3E5SA 1I4GA 2XSCA 3M4YA 1KNAA 1RODA 3NXWA 3SK8A 1Y8PB 3KF8A 5EKIA 1LLRD 1LTTD 2B2YC 2BA1A 3PUXA 3K5LA 3M85A 4CJ0B 4MN3A 2XIWA 4OIKA 5JVG3 1I50B 2F0TA 1H9JA 2A68D 1STAA 2NWGA 5FOBB 2R61A 3J80L 2Y0SB 3PIP3 2B2TC 2RSNA 2JA7B 5HGTA 1I4RA 3R93A 3AU7A 2XWJB 2IX3A 4NKLA 2O2LD 3UI2A 4RCNA 3T51B 4BA2I 1FNVA 4EQNA 2WKDA 2HCCA 4KMUC 2F0KA 1IW7D 5M5YB 2A6EC 5EPLA 2NN6G 1HHVA 3VA5A 2JA6B 2XWBB 4XT1B 2ZXPA 4A3DB 1NR4A 4BA1I 1CHQD 2PYKA 3HOYB 3I4NB 4CJ1B 1Y8OB 4FXGC 3HS0C 4KD4A 1EQTA 2F0PA 1DXMA 1DOKA 4H0LC 5EQ0A 2MPMA 1DZ1A 2YU9B 1IKMA 5C3WA 1BCPC 3BYTB 1JORA 2EY6A 1E2VA 4IQZA 2F0IA 3OIPA 1L0XB 3MEHA 2JEAI 1J9OA 3VR5A 4DXFA 2B2VC 1U4LA 1TWAB 3ND9A 4FNFA 4IALA 5ISRA 1LTGD 5I6YA 4DU9A 2TSSA 1WTXA 2KUMA 4KKSA 1B1ZA 2F4IA 4A3FB 3BDCA 2FMCA 2XN9C 5IGCA 1D5ZC 2ZXRA 1UEAB 3Q6SA 4ID6A 1D2BA 2F0VA 3T13A 4KY7A 4HTHA 1H9SA 2LS01 2N55A 2AUKA 5C0XH 1BOSA 3ND8A 3DMUA 1B9MA 1A15A 5T1GA 1LO5D 5COYA 2D5DA 1SNDA 4LMQD 4HMIA 2M2LA 1O78A 1MSGA 3RZDB 3HG9A 3VYUA 3P20A 2RSOA 2VXWA 1F9SA 1AEXA 4ZRZA 5ELCA 4EVOA 4G7OC 1F9QA 5EGTA 1AZQA 3QIAA 1I4QA 1G291 1R4QB 3QOLA 1QB5D 1DJRD 4BBRB 1QILA 2Q8RE 3AMUA 3GV3A 4HCEA 3HOZB 4TKOB 2KCNA 1FR3A 1W6KA 4RGMA 1G91A 2B63B 3R3OA 4ZUJA 1A3TA 3U9SA 1MD2D 3BVMA 1WVLA 3WOEA 1QOHA 1KDBA 3C46A 1LTRD 2F0HA 1WCMB 5EKLA 5CGKA 3PUZA 1BO0A 3LWEA 4FXKC 3RMHA 5C0XJ 1TWHB 5CYUA 5LHY1 4K14A 2Q8IB 1ZXTA 5NUCA 1S5CD 1CZGA 4KHZA 1PTOF 3X3NA 3T56B 1WD0A 2JP1A 3ONAB 1CTMA 4A3BB 3GTPB 4ZKBB 3DHQA 3MFYA 5BN4A 4XT3B 4KN7C 2NN6H 4X3TA 2AUJD 1SNCA 4G4KA 2KEDA 2A6HC 1QCBD 5CV5A 4KKTA 1STBA 1PFNA 3JAML 1U4MA 4ZYSA 4F87A 3MTSA 3A8IE 1KTKA 1B4OA 3BVZA 3S1NB 3HOXB 3Q23A 4XTCS 2K01A 1BF4A 1KNEA 2B2UC 2F3WA 1PRTD 4ZKCB 1A6XA 3MXPA 1EU3A 3MXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B50 A;  2B2V C;  5EKI A;  1RHP A;  1U4L A;  3I3C A;  2EE1 A;  1PLF A;  1JE4 A;  2DY8 A;  3KBX A;  3P7J A;  2FIN B;  1F9P A;  3TZD A;  1MSH A;  1RJT A;  2B2Y C;  2MP1 A;  1B53 A;  4IUT A;  4IUQ A;  5CBE E;  4CJ0 B;  4MN3 A;  3I90 A;  4HSV A;  4IUV A;  2JYO A;  1DOM A;  2L4N A;  2H1E A;  2KUM A;  2XIW A;  3D6W A;  3KUP A;  1IKL A;  4OIK A;  1WTO A;  2N88 A;  2K1B A;  4HED A;  1DON A;  1F2L A;  2HDM A;  2L11 A;  5EJW A;  4ZK9 B;  1SDF A;  1JIC A;  3TN2 A;  3GV6 A;  3DEP A;  1CM9 A;  2B2W C;  4DN4 M;  2EOT A;  2NWG A;  4ZLT F;  1WTR A;  1NR2 A;  1BO0 A;  3LWE A;  2HUG A;  3Q6S A;  5CMD A;  1QG7 A;  1B3A A;  1EIG A;  1HFG A;  1S4Z A;  2K03 A;  2KVM A;  3MWY W;  1ILQ A;  1X3Q A;  2EPB A;  1EIH A;  1F9R A;  2MJ8 A;  1G2T A;  1QNK A;  2N55 A;  1G2S A;  1ZXT A;  2B2T C;  1CA5 A;  1TVX A;  2RSN A;  5E4X A;  2NYZ D;  2B2U A;  5CBA E;  2L9H A;  2KEC A;  4IUR A;  2L12 A;  4RA8 A;  2KOL A;  1ESR A;  2HCI A;  3R93 A;  1WTP A;  1LV9 A;  2X69 A;  3SVM A;  1WTQ A;  4IUU A;  3F2U A;  1G6Z A;  1A15 A;  1WTX A;  5T1G A;  5E4W C;  1EL0 A;  1WD0 A;  1O7Y A;  3QO2 A;  2JP1 A;  4NW2 A;  5COY A;  1BBX C;  1NCV A;  1U4P A;  3UI2 A;  4LMQ D;  1X32 A;  2J7Z A;  3ONA B;  1HUM A;  1QE6 A;  2R3Z A;  3N52 A;  5D65 A;  4QUF A;  2M2L A;  4UAI A;  2MGS A;  1MSG A;  2HCC A;  1MGS A;  1RTN A;  2FHT A;  4ZKB B;  4X3U A;  4U68 A;  2D9U A;  5JJZ A;  2RSO A;  2VXW A;  1HRJ A;  2NZ1 D;  3HP3 A;  4XDX A;  4XT3 B;  1VMC A;  4ZAI A;  1F9S A;  2FMM A;  3I8Z A;  3IFD A;  5EPL A;  1HHV A;  2DY7 A;  1F9Q A;  4HCS A;  4X3T A;  4CJ2 C;  1O80 A;  4HAE A;  1X3P A;  4XT1 B;  2B2V A;  2HDL A;  4R8I A;  1DOL A;  1IL8 A;  1XYI A;  1AZP A;  1HA6 A;  4R9W A;  1NR4 A;  3DEO A;  2KED A;  2K05 A;  4O42 A;  4RWS C;  5EPJ A;  2L1B A;  1AZQ A;  1AP0 A;  1J8I A;  2CVR A;  2IL8 A;  2B2Y A;  4IUP A;  3IL8 A;  3DM1 A;  4QUC A;  2Q8T A;  1O7Z A;  5EPK A;  2BDN A;  2FJ2 A;  4CJ1 B;  1SSO A;  5D14 A;  1Q3L A;  1CA6 A;  1PFN A;  3FDT A;  4X3K A;  1U4M A;  3I91 A;  1ILP A;  1EQT A;  1PDQ A;  1WTV A;  4X3S A;  1DOK A;  4MHE A;  1HUN A;  1PFM A;  5DNF A;  2KEE A;  1U4R A;  1M8A A;  1WTW A;  1SAP A;  5AFW A;  1PFB A;  2B2W A;  2MPM A;  2Q8R E;  3FPU B;  3GV3 A;  5EQ0 A;  5T1I A;  1DZ1 A;  2K04 A;  1NAP A;  1IKM A;  1E0B A;  4RAU C;  1VMP A;  1HFN A;  4OIJ A;  3MTS A;  1G91 A;  1RTO A;  1BNZ A;  1WD1 A;  3H91 A;  2X6L A;  1B4O A;  1ICW A;  2FFK B;  1EOT A;  1C8C A;  2B2T A;  2K28 A;  5COR A;  1MI2 A;  2K01 A;  2RA4 A;  1BF4 A;  1KNE A;  2B2U C;  1KNA A;  2RVL A;  1ROD A;  1GUW A;  2SDF A;  3G7L A;  4ZKC B;  1ML0 D;  1B2T A;  2X6G A;  1WVL A;  1J9O A;  1XX8 A; 
#chains in the Genus database with same CATH topology
 1B50 A;  2EYL A;  4A3K B;  3OW7 A;  3PSI A;  3FEW X;  3S2D B;  1HR0 W;  2OEO A;  5CBE E;  4IFD I;  5C4Z A;  4APV A;  3KUP A;  1KLG D;  2R6G A;  3H94 A;  1WTO A;  2F0L A;  2IJ0 A;  1DGS A;  1QZH A;  1SBB B;  5A35 A;  5C3X A;  1Y1W H;  4YCW A;  4ZLT F;  2I5L X;  4FF4 A;  4R4I A;  2HUG A;  2KVM A;  4C3H G;  4HIO A;  4JI5 Q;  2F0U A;  1IBK Q;  3K59 A;  3J81 E;  3S1R B;  2F0F A;  4FXD A;  4DV7 L;  1GUS A;  1JMC A;  3NTI A;  4DK6 C;  3MFG A;  1A8V A;  4KK7 A;  4I7A A;  4KLK A;  2K50 A;  1WTQ A;  4DV0 L;  3TP7 A;  3CC4 A;  3J81 j;  3CAM A;  1MBY A;  4O1N A;  3F2B A;  1X32 A;  3QB3 A;  1VQ6 A;  3J7Y W;  1JOK A;  1IBL Q;  1YJ9 A;  4A3D H;  3OWF A;  5C4H A;  3PO2 G;  1HXY D;  3HOY H;  1VQE A;  1YEZ A;  2CW0 C;  2NZO A;  2KCT A;  5IWA Q;  5GAD C;  1EWC A;  2NZ1 D;  1KC8 C;  3FKI G;  1BKB A;  3WWV A;  1EFW A;  1CI3 M;  4HCS A;  3WDN A;  4I65 A;  2WP8 J;  3KF6 B;  5I2Y A;  2YU9 H;  2HDL A;  1DOL A;  4LFB L;  4DR3 L;  4FO2 A;  1QJO A;  3HOX G;  3GTM H;  2DJF C;  1VQP A;  4M1U B;  1SYG A;  5D14 A;  4BY7 B;  2VNU D;  1RCV D;  3FDT A;  3D3R A;  3SE0 A;  5JAV A;  5KND A;  1SJH D;  5DNF A;  4LK1 C;  3I56 A;  1M8A A;  1QUQ B;  1TY0 A;  2PW5 A;  5T1I A;  1CT1 D;  5D3D A;  4EQ5 A;  5K36 G;  1TWA H;  4CGY B;  4UHV A;  1TS4 A;  4C3J B;  3M4O B;  5KNC A;  3RN5 A;  2R92 B;  4B3R L;  3BZC A;  4A3F H;  3MEF A;  3GTL B;  5CV4 A;  1UWV A;  3Q0A A;  1ENA A;  1I3Q H;  1XX8 A;  5GAH C;  2IHE A;  1L1O A;  3QOJ A;  2DY8 A;  3VR3 A;  2FIN B;  1SYF A;  1BR9 A;  2NVQ H;  1PVO A;  1Y14 B;  1XMQ L;  2QEJ C;  2D0P A;  2WII B;  3BS1 A;  4A3G G;  4DV7 Q;  4ODG A;  2EYJ A;  2CH4 W;  3J7A V;  2L11 A;  4KY6 A;  3OYY A;  3NBI A;  4DV0 Q;  2AHO B;  4RH6 A;  3S1M B;  3MWY W;  2GA4 B;  4KN4 C;  4K6D A;  4LNQ A;  1OO9 B;  5C3E H;  2MJ8 A;  2VUM B;  1KLU D;  4JI6 L;  1SNO A;  3RZD H;  3TZU A;  1A3V A;  3G6J B;  3F2D A;  2NYZ D;  3RUZ A;  1IZ6 A;  4QF4 A;  2L12 A;  3A54 A;  4A3J B;  2KOL A;  1ESR A;  3D4W A;  4RGN A;  3CRK C;  4R8N A;  5CV9 A;  3X3M A;  2R7D A;  1V8Q A;  1GD7 A;  4HMJ A;  2R7Z B;  4QUF A;  2Q2U A;  1WOC A;  4L8J A;  3KJP A;  1UNS A;  1R9T B;  4LFB Q;  2E2J B;  4DR3 Q;  1QZG A;  4ILW A;  2UXD Q;  3JAM i;  4QMG A;  1JJG A;  1IYV A;  3NP8 A;  3KOJ A;  3CCM A;  4YWL A;  5IGF A;  1PFS A;  1JC7 A;  1UAP A;  5J39 A;  4WJ4 A;  3KLR A;  1QNU A;  2Q2T A;  3EBE A;  4Q0F A;  4L5T A;  1LTA D;  4CHT B;  2B63 H;  4DK1 A;  5JPN C;  1BBU A;  3TP5 A;  3ZJY C;  2R92 G;  4GN5 A;  4XQJ A;  5LMN L;  1Q3L A;  5JPM C;  3I91 A;  4PMB A;  1F2M A;  1NE3 A;  3VR4 A;  3H0G B;  3U4V A;  1PFM A;  1Q1B A;  2HIX A;  1WTW A;  1E0B A;  5FJ8 H;  3GD7 A;  5AJ3 L;  1EEI D;  3S15 H;  1EQQ A;  5HUR A;  4LF4 L;  2HD3 A;  2F0M A;  2QGQ A;  5ELD A;  1XMQ Q;  2E2I B;  5COR A;  2CHB D;  4GNX A;  3NTH A;  1WCM H;  5IOC A;  1GUW A;  2VS1 A;  3HZX A;  2BCO A;  2YTX A;  5KRU A;  1B8A A;  2A8V A;  1GJX A;  4LUO A;  4YWK A;  2JSO A;  5LMU L;  3TME A;  1TWH H;  4DR5 L;  1X55 A;  2NN6 I;  5I9P A;  2VUM G;  4YCU A;  1MSH A;  1B53 A;  2RF4 A;  1JWM D;  5GAG C;  4JI6 Q;  4PZ6 A;  1E7Z A;  2H1E A;  3D6W A;  2SEB D;  1IKL A;  3T53 B;  3CCE A;  4HR7 B;  1WTR A;  1E3P A;  2R7Z G;  1N33 L;  2K5H A;  5F2D A;  4QCL A;  3D31 A;  1EY9 A;  4C3H H;  3J7Z C;  4DR6 L;  1F9R A;  2QA4 A;  2OTJ A;  2PPB C;  1EQR A;  3S2H B;  4DXG A;  4IUN A;  2EZV A;  4GNX B;  1KRS A;  5E4X A;  2F52 A;  3S16 B;  1VQN A;  3CCS A;  1JR0 D;  1FGU A;  3LWU A;  4R4Q A;  1CK1 A;  1WTP A;  1LV9 A;  3SVM A;  1LTB D;  1MHW C;  1YNN D;  1V1O A;  4XXE A;  2Z9H A;  1CSP A;  4XIG S;  1EEF D;  2J7Z A;  1QE6 A;  4RCO A;  3NK9 A;  4UP8 A;  1Y1V G;  1PHJ A;  4HIK A;  2VY3 A;  1MGS A;  5JVH 3;  4H13 C;  3PO2 H;  4U68 A;  4Z9C B;  2BDO A;  3C3L A;  4K5V A;  3BDO A;  5LMN Q;  4DK3 C;  1STN A;  2QF7 A;  1AE3 A;  1PTO B;  3HRZ C;  5FKA C;  1CKN A;  2G9H D;  1TS2 A;  2I46 A;  3FKI H;  1B9N A;  2LY7 A;  2WAQ E;  2RDG A;  1PV4 A;  4KD3 A;  5FO7 B;  1Y1W B;  2Z4H A;  1SE8 A;  4O42 A;  5AJ3 Q;  1J8I A;  1YNJ C;  3DWP A;  2K5W A;  5FK9 C;  3UE1 A;  1UE6 A;  3KJO A;  3DM3 A;  3HOX H;  1N32 Q;  5EPK A;  3S1Q H;  1XTD A;  1EYC A;  3FPP A;  2PQA A;  1QVC A;  3QG1 A;  1GUG A;  3D8G A;  1TS3 A;  2YV5 A;  1D7Q A;  3ERS X;  2KEE A;  4PG3 A;  3WOF A;  2AQ2 B;  1LAB A;  2DN8 A;  4B3S L;  3HOV B;  3OW2 A;  5LMU Q;  2F0N A;  3OOC A;  5GRO A;  4RFB A;  5C44 G;  4X62 L;  4DR5 Q;  1XPU A;  5K36 H;  4L5S A;  1EY6 A;  1XPR A;  2JK8 A;  1EOT A;  3A8J E;  1U9R A;  2IT1 A;  4B3T L;  3EQL C;  1CKN B;  1D1K A;  2HQE A;  2RVL A;  4PMW A;  1ML0 D;  1HQM C;  4EQO A;  3HEJ A;  3F2C A;  1E24 A;  4UPA A;  1RHP A;  3H6M A;  1Z6H A;  3GQB A;  1C48 A;  4DR6 Q;  4IUT A;  4R1J A;  4DV3 L;  3S1R H;  2L4N A;  5M9O A;  4A3G H;  2PQA B;  1PRT F;  4G57 A;  1CFM A;  3GTM B;  4WRD A;  1TS5 A;  3CC7 A;  1CM9 A;  3NQI A;  3G48 A;  3MXN A;  4DR2 L;  1VQ8 A;  1EIG A;  3IRB A;  4GZY C;  1U0L A;  1XMO Q;  2RDH A;  1K28 A;  1XXG A;  4GNX C;  2IX0 A;  1K83 H;  3CCR A;  4U67 3;  2I5H A;  4K8J A;  1ENC A;  1ZYR D;  1PH4 A;  3VA7 A;  2PMZ E;  3BZK A;  3K8A A;  2A69 C;  5C6A A;  1PH8 A;  3MVV A;  1FD7 D;  3BDL A;  4NW2 A;  2F0D A;  1VQ7 A;  4C1N I;  4LF7 Q;  2SNS A;  4DAM A;  1YBY A;  3BVG A;  4OX9 L;  1I3Q B;  3I7F A;  4N9T A;  3IFT A;  4RHS A;  1B3Q A;  2RQX A;  1D6E C;  1JWU D;  2NVQ B;  3Q22 A;  5KGU A;  1PTO C;  5ELO A;  1EY4 A;  3A56 A;  1SRO A;  1JB3 A;  2J0T D;  2VQF L;  3HOV G;  3EFX D;  2AWN A;  3NQT A;  4CJ2 C;  4B3S Q;  4AYB B;  1A2U A;  3MHB A;  3VR2 A;  4X62 Q;  4XYQ A;  3JC6 6;  2MUY A;  3GTJ H;  4QUC A;  2Z8L A;  5C3E B;  4QL5 A;  2TMP A;  3HKZ E;  2JA8 G;  2R92 H;  3K5O A;  1SSO A;  4B3T Q;  1JWS D;  4C3I B;  4YCV A;  5M3F B;  3TS0 A;  1MJE A;  3D0F A;  1OXT A;  2R93 G;  3PUV A;  1GUN A;  1K73 C;  2UXB L;  3H91 A;  2X6L A;  1H9S B;  4DV3 Q;  4ZUI A;  3PQI A;  4NP5 A;  2CW0 D;  3NWT A;  4JVZ A;  2B29 A;  4JPB W;  4RKB A;  1BDO A;  5FLX E;  1VS0 A;  4DUY Q;  5A2Q L;  1B2T A;  1Q90 A;  1K9M C;  4B9X A;  4DR2 Q;  1HA5 A;  3I3C A;  3SXH A;  5IOD A;  1M1K C;  4DR7 Q;  3P7J A;  5BR8 L;  4K6L A;  3BG3 A;  3TZD A;  1OXX K;  2VUM H;  5I9O A;  1KQS A;  1H9M A;  1IYU A;  3OHX C;  2N88 A;  2K1B A;  1BXT A;  3HOU B;  3CU7 A;  5EJW A;  2UUC Q;  1VQF A;  3GV6 A;  1SMY D;  5IGB A;  3M7N A;  1Q1E A;  2YYZ A;  4LUZ A;  1K8O A;  3PO3 G;  3ULL A;  3V96 A;  5CMD A;  1PA6 A;  3GTO H;  2R7Z H;  2ENB A;  1X3Q A;  1GUT A;  2K7V A;  2EYF A;  1I6H B;  3SK5 A;  1HPC A;  4OX9 Q;  2E2J H;  2A73 B;  5M3M B;  1TVX A;  1FJG Q;  3S15 B;  3UDI A;  2KEC A;  2K5N A;  1GM5 A;  4LF9 L;  4GKK Q;  1X65 A;  2E2H H;  2WAQ G;  5E4W C;  1EL0 A;  2VB2 X;  1OTC A;  5IGD A;  4AYB G;  2Z1C A;  3AQQ A;  3FRP B;  4X66 L;  4CDE C;  5G3L D;  5KIX A;  1Y1V H;  3AEV A;  1RTN A;  2FHT A;  3J81 L;  2A68 C;  1AN8 A;  3KLS A;  2EYP A;  1S5E D;  1Z47 A;  4CKC A;  3KDF A;  4HN7 A;  2WB1 E;  4C3I G;  2ES2 A;  3D6C A;  1RD9 D;  2PW7 A;  5M3F G;  2ZTC A;  2HIV A;  1SE3 A;  3A7A B;  1HA6 A;  4R9W A;  3DEO A;  2NB0 A;  2CQA A;  2UXB Q;  3UDX A;  5FO8 B;  1I5F A;  2QIL A;  1XTC D;  2K6A A;  4C3H B;  3HKZ B;  5DM7 3;  2E2I H;  4NXN L;  2KEN A;  3L9A X;  3NPP A;  3PF4 A;  1I4P A;  4A3I G;  1SMX A;  2IWH A;  2BH8 A;  4OO1 G;  3PGZ A;  3E3X A;  1YJN A;  4JI2 L;  3F8T A;  2F0W A;  1O7L A;  5C44 H;  1K3R A;  4BBS B;  3NTK A;  5BR8 Q;  3KBG A;  5M5W H;  1EFI D;  2M9V A;  3HOU G;  1JQY D;  2RA4 A;  4RHR A;  3IKJ A;  4AH6 A;  5BN3 A;  3CCL A;  3PO2 B;  2SOB A;  2DUD A;  4F8M A;  3I73 A;  4IJL A;  2JN4 A;  5A2Q E;  1PLF A;  3FKI B;  2QKI C;  4B08 A;  3GTK H;  3SHL A;  5JEA G;  5M3M G;  1RIP A;  3I90 A;  3BYY B;  3CCQ A;  1AFP A;  1XYI A;  3S16 H;  2KCC A;  4QIW B;  3DEP A;  3R2T A;  2PNH A;  3S1Q B;  1X9N A;  1NR2 A;  3R2I A;  3A8K E;  4LUV A;  1HFG A;  1S4Z A;  4HJ7 A;  1FNW A;  4X66 Q;  5M5X B;  2AQ3 B;  3ICE A;  3ER0 A;  1QNK A;  4A3M B;  2BH2 A;  4QJF A;  2HQL A;  2EJF C;  4J15 A;  1T5X D;  1PTO H;  2PCF B;  4DGZ A;  4Y7N H;  1TXY A;  1A0I A;  3E9I A;  1HQR D;  1BQQ T;  1CQV A;  2R3Z A;  4JI0 L;  5D65 A;  1D5M C;  4XQQ A;  2K5V A;  4DV5 L;  2DGY A;  1EOV A;  3HKZ G;  2BE5 D;  2K75 A;  1ESF A;  3IAY A;  4NXN Q;  4HJA A;  4M8A A;  4XDX A;  1I4X A;  2CWA A;  4JCV E;  1RF2 D;  4B3M L;  4A3G B;  4Q5V A;  3G71 A;  3S17 H;  3HOV H;  5IYB H;  1UE5 A;  3OIQ A;  5C4X G;  4JI2 Q;  5DLQ E;  2Q2I A;  4BBS G;  3BJU A;  4RWS C;  1Z9F A;  1II3 A;  2PQE A;  2ATW A;  2OWO A;  2ZXO A;  3M4Q A;  2L5T A;  1J5E L;  3J80 c;  2JA8 H;  3GTQ H;  1K0S A;  2JA5 G;  4JI7 L;  1GOZ A;  1K83 B;  4HID A;  3BU2 A;  2EYM A;  2KHJ A;  1VQD A;  2AKW B;  3VYT A;  1Q81 C;  2KA7 A;  2R93 H;  4LF5 L;  4DR4 Q;  1X3E A;  4GLA C;  1EWH A;  3J7A F;  2RHS B;  1KD1 C;  4YHH L;  4A3C G;  4OL7 A;  2K28 A;  4C1N K;  3TP6 A;  4CDC C;  3EIV A;  5HY6 A;  1H9K A;  3RR5 A;  4WFN 3;  1WYD A;  4K8I A;  4YY3 L;  1YI2 A;  5C0X I;  1NUC A;  2JEB I;  5CV8 A;  1KL9 A;  3GDE A;  1QVF A;  3H3V H;  1F9P A;  3MC0 B;  2N8N A;  4A3M G;  2ICE C;  4IUV A;  4IOC A;  4QB4 A;  2LFN A;  4WOR A;  4ZK9 B;  3GTJ B;  3D4D A;  4H44 C;  1JOO A;  2PNR C;  3PO3 H;  2A6E D;  3CME A;  2ZJR A;  1B3A A;  2K03 A;  1S40 A;  4JG2 A;  2OT2 A;  5CV6 A;  3DWA A;  4JI0 Q;  4LF6 L;  2EYO A;  2PO4 A;  1S5B D;  3J81 i;  3VYS A;  2AMC B;  5TSS A;  1VQ9 A;  4DV5 Q;  3RLN A;  1CA5 A;  3K0X A;  4V0B A;  2QDL A;  1PRT B;  2EXD A;  3OMG A;  4J8Q A;  4CBV A;  2M00 A;  2WB1 G;  4IFD G;  4MZ9 A;  1QWY A;  5DEH A;  3OMC A;  4B3M Q;  4UDU C;  3QO2 A;  1BBX C;  1VQA A;  4JW0 A;  1U4P A;  1GO3 E;  4JI4 L;  5C5M A;  3KK7 A;  3HFZ B;  1SE4 A;  4LAA A;  1E2W A;  2KQ3 A;  1BCP D;  4TRD A;  1PZK D;  2F0E A;  3K81 C;  4OEM B;  2GN5 A;  1NBW A;  1FYC A;  4JI7 Q;  2ICI A;  4C3I H;  2FMM A;  2B8G A;  2VQE L;  4JK1 C;  1RKN A;  2VB3 X;  5M3F H;  2ALY B;  2EY5 A;  1VQJ A;  4A75 A;  3RNU A;  4MIU A;  4LF5 Q;  1M4V A;  4DNI A;  1LT3 D;  1L1O B;  2F0Q A;  3GTO B;  3HGB A;  2LXJ A;  2Z0S A;  3CD6 A;  4NMZ A;  4MTK A;  4YHH Q;  5C5L A;  2NUC A;  2VZA A;  1PZI D;  4NPS A;  4DNT B;  2EJM A;  2A74 C;  4X3K A;  1ILP A;  1S5D D;  3CQZ H;  1LAC A;  1HUN A;  3CCU A;  4YY3 Q;  1SAP A;  4A3I H;  2C9O A;  4POG A;  1PH2 A;  1NAP A;  4OO1 H;  1PH5 A;  1NSN S;  2E2H B;  1VMP A;  4TQU S;  2RDF A;  5IYC G;  4OIJ A;  1SFO H;  1HFN A;  2V4D A;  1F2Y A;  5J22 A;  5E7N A;  4FP5 D;  2SNM A;  1YVC A;  1W3S A;  1Y1V B;  4X64 L;  4FVM A;  2NBF A;  1NMG A;  3HOU H;  1OXS C;  1KAA A;  4B3R Q;  2EY1 A;  1Z7T A;  4ULL A;  2K5Q A;  2IPK D;  2UXC L;  1PXU A;  2LSS A;  2Y0S E;  3KBX A;  1SYC A;  3VR6 A;  2EDG A;  2MNA A;  2F03 A;  4IUQ A;  1I6H H;  5FO9 B;  5JEA H;  2ZJP A;  5M3M H;  5EPJ A;  1RL2 A;  1UE7 A;  3MAQ A;  3OSO A;  2D62 A;  3U50 C;  1JIC A;  1C4Q A;  4LFC L;  4TVA B;  3LNN A;  1SNP A;  4J1M A;  1XNR L;  2IHF A;  1QG7 A;  5DM6 3;  3C1F A;  1ILQ A;  3LX0 A;  4CKE A;  1STY A;  2ZTD A;  3L3O C;  1FNU A;  3A55 A;  5EKK A;  4GKJ L;  1G2S A;  1K0R A;  5IP7 G;  5C44 B;  1PRT C;  2L9H A;  5M5W B;  4RA8 A;  4RKL A;  2CQO A;  3SR1 A;  4L63 B;  2X69 A;  2NZH A;  3M7G A;  4DAY A;  3K5M A;  5EBC A;  1T5E A;  1O7Y A;  2VQE Q;  1S72 A;  2EVB A;  3KFU A;  4XQN A;  3OPO A;  4MTN A;  4LFA L;  3MA2 B;  3V05 A;  1V43 A;  3U58 A;  1EZ8 A;  2O4X A;  4NB3 A;  1STG A;  4DKA C;  3GTK B;  2XRS D;  4DFA A;  1V9P A;  3EJI A;  1E2Z A;  2H4O A;  4PNY A;  3B6Y A;  4H02 A;  2H5X A;  5G3L F;  1KHI A;  4LW1 A;  3P1H A;  4V19 0;  5EAY A;  4R8I A;  5C4X H;  4JBM A;  4JC0 A;  4DNR B;  4BBS H;  3U4Z A;  1L1O C;  2L1B A;  1D5X C;  4PQX A;  2IL8 A;  5ELB A;  4DAV A;  3DM1 A;  3G4S A;  3T1H L;  1O7Z A;  2OQK A;  3DUZ A;  1ICF B;  2D2C C;  1LYL A;  4X64 Q;  2PI2 E;  1SYE A;  4KJN A;  4DAY B;  1T9H A;  1Q7Y C;  3DXJ C;  1EQV A;  2JA5 H;  2ZM6 L;  1E1T A;  1EYA A;  1IBM L;  2NVX H;  1KXL A;  1EY0 A;  2B2W A;  4KJO A;  4RG1 A;  4IN3 A;  1VF7 A;  2K04 A;  4OWW B;  5J1Z A;  2J4X A;  2IW3 A;  2UXC Q;  4CKB A;  1GHK A;  4Y7N B;  4TSS A;  2EYH A;  2LKV A;  2EJG C;  1C8C A;  1OXV A;  5IT9 E;  1TWG B;  4A3C H;  4JOI A;  3TP8 A;  3I4M G;  4LF4 Q;  4KI0 A;  4LFC Q;  2JQO A;  2ZTE A;  3W1G A;  1EU4 A;  1XNR Q;  4MNO A;  5JEA J;  1MKH A;  5M5X H;  3S17 B;  4A3M H;  4GKJ Q;  4DAP A;  2HDM A;  2F0S A;  3CC2 A;  2B39 A;  5FLX L;  2JA8 B;  2E74 C;  4GLV B;  4F88 A;  3GTQ B;  2RHQ B;  2K32 A;  1YHQ A;  2I5M X;  4Y52 H;  1STE A;  3NEL A;  3HOW B;  1L0W A;  4LFA Q;  3JAM c;  4XYO A;  3S9W A;  1L2F A;  1DM0 B;  1VF5 C;  4FF1 A;  1N33 Q;  3RN2 A;  2R93 B;  1VDZ A;  5CBA E;  2A6H D;  1EWI A;  1EY8 A;  2A5H A;  4JBJ A;  1HNW L;  2PI2 A;  3EA6 A;  4IFD H;  2RBM A;  2WV6 D;  2KHS A;  3GO5 A;  1TT2 A;  2C35 B;  1DCZ A;  4HIM A;  4AQY L;  4I7Z C;  2I0Q A;  2MGS A;  3AB9 A;  2L55 A;  3KLS X;  4X3U A;  2ID0 A;  3N6R A;  5JOB A;  4QQB X;  1HRJ A;  3EVQ A;  3VYR A;  1H9R A;  1DYQ A;  3L7Z C;  2ZM6 Q;  4DV4 L;  3RLF A;  3T4A C;  1IBM Q;  1A3U A;  5CC4 A;  1AW7 A;  2KBN A;  4ABN A;  3PO3 B;  2K05 A;  4OEL B;  3MXG A;  5IP9 G;  4IUP A;  3R8B A;  3IL8 A;  5BN5 A;  1SNQ A;  3RZO H;  1Q82 C;  2O5J C;  1AP0 A;  5IGG A;  3KLW A;  2Y0S G;  1HTL D;  2PZW A;  2JA7 G;  3MXN B;  2F0G A;  3D4R A;  2WAQ B;  3M3Y H;  3RD4 A;  3NSW A;  5IYC H;  1ZEQ X;  1NNX A;  1WFQ A;  3K5N A;  2Z4I A;  1JCK B;  4IPH A;  3L0O A;  3CHB D;  2SDF A;  4JI1 L;  2X6G A;  1TWF B;  3GP7 A;  2NTS A;  4OON A;  3J80 E;  1K8G A;  1Q46 A;  2PZT A;  3NBH A;  1KDC A;  3HOW G;  4WJW A;  2B3G A;  4QY7 A;  4AIM A;  4EX5 A;  2MHV A;  3TBI B;  4JV5 L;  4EGV A;  1DON A;  4R4T A;  1JB7 A;  2CH4 A;  5I4D A;  1HNW Q;  2JA6 G;  3I4L A;  1LTS D;  1V1P A;  1HZB A;  2B2W C;  1K3B C;  5IE8 A;  3CQZ B;  3I4O A;  4KKU A;  3URY A;  1PYB A;  1Q8K A;  1M90 C;  3I4N G;  1FGB D;  4A3I B;  4AQY Q;  2OTL A;  2QEX A;  4FF3 A;  4GOP A;  4OO1 I;  4A3L G;  1K8M A;  1N36 L;  4JOI C;  1SFO B;  4IFD J;  5IP7 H;  2B2U A;  1G8Z D;  4P72 A;  2RKS A;  2VL6 A;  1GXD C;  3S14 B;  2MO0 A;  1G6Z A;  4DF7 A;  3NBH B;  4DV4 Q;  1ASZ A;  3L2P A;  1TWC B;  1SJE D;  3A7L A;  2UU9 L;  1F77 A;  4DUZ L;  4RGO S;  3H3V C;  3K80 C;  3Q24 A;  1GKH A;  1V1P B;  1QVG A;  1D1I A;  3I70 A;  1C0A A;  4DV1 L;  2L0C A;  2PMZ B;  4GOP B;  2E8G A;  3AFQ A;  4BWG B;  3QJY A;  1BCP F;  1Y8N B;  2BOS A;  4L6T B;  2VQF Q;  4A3F G;  1CKM A;  2E76 C;  3SDZ A;  2XVS A;  4C56 C;  5H1S E;  5ELF A;  3C2P A;  1YNN C;  2JXM B;  1JOQ A;  5EBD A;  1X54 A;  2BA0 A;  1Q86 C;  1U4R A;  3DLL A;  1PFB A;  4JI1 Q;  1E22 A;  5C4J H;  4PV1 C;  4KY5 A;  2Z6K A;  4IOA A;  1KDA A;  4R4O A;  2IX1 A;  1BNZ A;  1IHZ A;  1HCZ A;  1R4P B;  3PUY A;  1D8L A;  2F3V A;  3OWE B;  1PH3 A;  2NVY B;  3FMC A;  1ET9 A;  2C5C A;  1HNZ L;  1EY5 A;  4LJZ C;  1ZKO A;  4NXM L;  3GTG H;  3I4M H;  1LT6 D;  3E6Z X;  4DPG A;  2CWP A;  5D3I B;  1XNQ L;  3TSS A;  1JE4 A;  5LL6 X;  2D0O A;  1E1O A;  2EQS A;  3P75 A;  4BXX G;  5C4X B;  1DOM A;  4RMF A;  5CV7 A;  1IW7 C;  1N36 Q;  3TN2 A;  3J7A 5;  1PZJ D;  1GHJ A;  3PF5 A;  5IIF A;  3KDF B;  2OXP A;  3H09 A;  2NVX B;  2JA5 B;  1SLJ A;  4GN4 B;  3CMA A;  2UU9 Q;  4DUZ Q;  3ERQ A;  1EIH A;  1G2T A;  3CP0 A;  3UE0 A;  4BBR G;  3I72 A;  3ZYY X;  2F0O A;  1VQH A;  1B70 B;  4IUR A;  2RCN A;  1ASY A;  1I6V C;  1DD2 A;  1Q12 A;  3HOZ G;  1I4H A;  1PMR A;  3VDY A;  3I2Z A;  3CKI B;  4DV1 Q;  4BY1 B;  2DNE A;  1ONL A;  1HUM A;  3W2D A;  1HTP A;  4LF9 Q;  3UDF A;  3CF5 A;  2YTV A;  4OWT B;  1TQO A;  3FVQ A;  2Z6B A;  5JJZ A;  4YIJ A;  2KCM A;  2LMC B;  1VQ4 A;  3W5O A;  1TU2 B;  4C2M B;  3IFD A;  4B9W A;  1O80 A;  1TY2 A;  1KRT A;  1KIX A;  1EYD A;  4GOP C;  1A63 A;  2E75 C;  1LUZ A;  2JA9 A;  1VCI A;  1WCM G;  2F0J A;  1ZYR C;  5IP9 H;  2AWO A;  2Q8T A;  1SE2 A;  1PH6 A;  1TWG H;  1J6Q A;  1TKW B;  2WKC A;  1HNZ Q;  4NXM Q;  1LTI D;  1OXU A;  3K6O A;  1NY4 A;  3M4P A;  2AQ1 B;  2G9D A;  4R4C A;  1STH A;  2WB1 B;  1PH7 A;  1XNQ Q;  2EY2 A;  2JA7 H;  5IGE A;  5E3F A;  4IZ8 A;  1C9O A;  1MI2 A;  3ULP A;  3CRL C;  2K5D A;  3G7L A;  4FYD A;  2IY5 B;  4A3B G;  3KF6 A;  4X65 L;  3T16 A;  4EQP A;  3HOW H;  1PYW D;  1NTG A;  3SEB A;  1RJT A;  2MP1 A;  1Y69 U;  2JYO A;  2KJX A;  5M5Y H;  5L37 A;  4HED A;  1UUP A;  3SK4 A;  1TR5 A;  2NTT A;  1SDF A;  1F2Z A;  1RDP D;  1QUQ A;  2JA6 H;  3RZO B;  5J3B A;  2F1M A;  4HJ9 A;  4K5X A;  4BY1 G;  1WTH A;  2QDB A;  2Z6K C;  1SYB A;  3LGJ A;  1AH9 A;  3E0J A;  2HT1 A;  1CHP D;  4G7H C;  3I4N H;  4PZ7 A;  1B44 D;  4K2L A;  1ET6 A;  4A3L H;  4KHP L;  5JJL A;  1BVS A;  3M3Y B;  2EXZ A;  3CPF A;  4F7X A;  2VW9 A;  4DA2 A;  4KTA A;  1YNJ D;  2HCI A;  4DV6 L;  1VQ5 A;  5I2X A;  4HSP A;  5LMN W;  4IUU A;  3F2U A;  2E5L L;  3W1B A;  3NHH A;  2DNC A;  2NVT B;  5KYL A;  2UXD L;  5FLX c;  1SXT A;  2N78 A;  5ELE A;  3I55 A;  3K57 A;  4ZQ3 A;  4CDF C;  3SK6 A;  4OGQ C;  3HKS A;  4JI3 L;  2D9U A;  3JAM E;  1SMY C;  2JJQ A;  5I6W A;  5DAU A;  4QGU A;  1A2T A;  3HP3 A;  4ZAI A;  3V2T A;  4A3K G;  1YIT A;  1UEB A;  2WIN B;  2MO1 A;  5K5P A;  4HAE A;  1X3P A;  3DWQ A;  1CQF A;  1CZW A;  1L0Y B;  1XWE A;  2OCE A;  4KV6 A;  3TRZ A;  3K0Y A;  3AFP A;  1HJP A;  1HR0 L;  1ENF A;  2CVR A;  2B2Y A;  1NJI C;  2FJ2 A;  1EZ6 A;  1CA6 A;  1X3G A;  5FLM G;  1WTV A;  4DK0 A;  3NWS A;  1J5E Q;  5AFW A;  1TWF H;  4X65 Q;  3PMF A;  3Q8D A;  4IPC A;  4S3S A;  1MJC A;  3MZ5 A;  1G51 A;  2V1C C;  1ICW A;  2FFK B;  1SYD A;  2WAC A;  2B2T A;  1YZ6 A;  4FF2 A;  2A1A A;  3STB C;  1VQO A;  4E6I A;  4IO9 A;  3A0J A;  4N9P A;  2QCP X;  1W6J A;  1N34 L;  2CKZ B;  4K0K L;  2A69 D;  4K2K A;  2EE1 A;  2F3I A;  4H7B A;  1SRU A;  4LWC A;  3A74 A;  2XNA C;  4GN3 B;  4A3E B;  2HHH L;  4G7Z C;  1LT5 D;  3QWN A;  4DR1 L;  4BS9 A;  4PZ8 A;  4POF A;  1GUO A;  1JJ2 A;  4HSV A;  2K33 A;  4KHP Q;  5KEE A;  1P8L A;  4BXX H;  5KNB A;  1F2L A;  3PIO 3;  4UP7 A;  3ERO A;  5IT9 L;  4DV6 Q;  3S14 H;  1I94 L;  4DN4 M;  2E5L Q;  4NDX A;  2EOT A;  2N49 A;  2XRQ D;  1BUV T;  2JE6 I;  4RGT A;  2UUB L;  2I07 B;  1TWC H;  1KAB A;  1PTO D;  1TII D;  5KYI A;  4A93 B;  2EPB A;  5C4J B;  5C0X G;  4BY7 G;  3PUW A;  2G5D A;  2MQH A;  1HNX L;  3ITP A;  2E2D C;  4N8F A;  4BBR H;  2FXQ A;  4JI3 Q;  2KHI A;  4LF6 Q;  3PV0 A;  4KHV A;  3O13 A;  3BZD B;  4JBW A;  4K5W A;  3SGI A;  3HOZ H;  4P2C B;  2ZT9 C;  1N9W A;  3NUC A;  3W3A A;  3GTG B;  1AE2 A;  2ZJQ A;  1NCV A;  3K7A B;  1SR3 A;  3I4M B;  4C3J G;  3E9H A;  2UUA L;  5LL6 S;  3N52 A;  1Q8I A;  1SNM A;  3K58 A;  4UAI A;  4ME5 A;  1A62 A;  4WJ3 M;  3NE5 B;  1HR0 Q;  1EY7 A;  4OHJ A;  2OF1 A;  2PZU A;  4JI4 Q;  1S5F D;  5CR3 A;  1VMC A;  3I8Z A;  2DY7 A;  5GQO A;  2K4K A;  2O5I C;  1N32 L;  1AZP A;  2B2V A;  1IL8 A;  1SEB D;  3F1Z A;  2NVY H;  2BDN A;  3TRE A;  4J6H A;  4IPG A;  3TDQ A;  1PDQ A;  4X3S A;  5E1F A;  4MHE A;  1H95 A;  4PMC A;  3C1E A;  1N34 Q;  3FPU B;  3TEH B;  1LT4 D;  5HGQ A;  4K0K Q;  4RAU C;  1IYJ B;  1VQI A;  4A3E G;  1BCP B;  3UDG A;  1JE5 A;  2BE5 C;  1RTO A;  3PIO A;  4A3J G;  1WD1 A;  2HHH Q;  4DR1 Q;  2B8F A;  4OXP A;  1PH1 A;  3U9O A;  2CCZ A;  3E5S A;  3S24 A;  1I4G A;  2XSC A;  1CSQ A;  3M4Y A;  1KNA A;  4GLX A;  1ROD A;  3NXW A;  3SK8 A;  5JJK A;  1I94 Q;  1Y8P B;  4DV2 L;  4A3B H;  3J81 c;  2UUB Q;  3KF8 A;  5EKI A;  4LF8 L;  1LLR D;  3GTP H;  4OWX B;  4A93 G;  1LTT D;  2B2Y C;  2BA1 A;  2K52 A;  3PUX A;  3M85 A;  3K5L A;  4CJ0 B;  4MN3 A;  1HNX Q;  1JT8 A;  2XIW A;  4OIK A;  5JVG 3;  3CW2 C;  1I50 B;  2F0T A;  1H9J A;  2A68 D;  4CDD C;  1STA A;  1XMO L;  2NWG A;  4L5Q A;  4L5R C;  5FOB B;  2R61 A;  4BY1 H;  3J80 L;  3K7U C;  2UUA Q;  1W2B A;  4IPD A;  2GVB A;  2XGT A;  2Y0S B;  3PIP 3;  2B2T C;  1HZC A;  2RSN A;  2JA7 B;  3H0G G;  5HGT A;  1I4R A;  4LF7 L;  3R93 A;  1HZ9 A;  3AU7 A;  3FHW A;  4AYB E;  2XWJ B;  4HJ5 A;  2IX3 A;  1NMF A;  3KF8 B;  4C2M H;  4ALP A;  4NKL A;  2O2L D;  3UI2 A;  1EIY B;  3S1N H;  2L15 A;  4RCN A;  3T51 B;  4BA2 I;  1YIJ A;  1FNV A;  4EQN A;  2WKD A;  1O7I A;  2HCC A;  4KMU C;  2F0K A;  1IW7 D;  1EIF A;  1S3O A;  4O0A A;  5M5Y B;  2A6E C;  3CCV A;  3CXC A;  3E0E A;  4A3K H;  5EPL A;  2NN6 G;  1HHV A;  3S2D H;  3VA5 A;  3FP9 A;  2JA6 B;  2XWB B;  4P71 A;  4XT1 B;  2ZXP A;  4A3D B;  1NR4 A;  4BA1 I;  1CHQ D;  2PYK A;  3HOY B;  1CUK A;  3I4N B;  4CJ1 B;  1Y8O B;  4FXG C;  3HS0 C;  4KD4 A;  1EQT A;  2F0P A;  1DXM A;  3H3V I;  1DOK A;  5IYD G;  5FLM H;  3T1H Q;  4H0L C;  5EQ0 A;  2MPM A;  1DZ1 A;  4DV2 Q;  2YU9 B;  3NEM A;  1IKM A;  5C3W A;  4LF8 Q;  1V1Q A;  1IL2 A;  4IJH A;  1BCP C;  3BYT B;  5IY0 A;  4DUY L;  2F4V L;  2GVA A;  1JOR A;  2EY6 A;  1E2V A;  1JJC B;  4IQZ A;  2F0I A;  3OIP A;  1L0X B;  3MEH A;  1PYS B;  3QR8 A;  2JEA I;  4P75 A;  4DR7 L;  1PH9 A;  3PIP A;  1J9O A;  3CCJ A;  3VR5 A;  3ULJ A;  4DXF A;  2B2V C;  2MFI A;  1U4L A;  1TWA B;  3ND9 A;  4FNF A;  3OTO L;  4IAL A;  5ISR A;  1LTG D;  5I6Y A;  2UUC L;  4DU9 A;  2TSS A;  1WTX A;  2KUM A;  4KKS A;  1B1Z A;  2F4I A;  3M9B A;  1YJW A;  4A3F B;  3BDC A;  1WI5 A;  1WJJ A;  2FMC A;  2XN9 C;  1K8A C;  5IGC A;  1D5Z C;  1Y1W G;  2Q2H A;  2ZXR A;  1UEA B;  3T1Y L;  3Q6S A;  4ID6 A;  1VQG A;  2NVT H;  1D2B A;  2F0V A;  1FJG L;  3T13 A;  4KY7 A;  4HTH A;  1H9S A;  2YTY A;  2LS0 1;  2N55 A;  2AUK A;  1HZA A;  4BY7 H;  5C0X H;  1UE1 A;  4GKK L;  1BOS A;  3ND8 A;  1YNX A;  1C7Y A;  4GS3 A;  4A4I A;  3DMU A;  5IYB G;  4O2D A;  1B9M A;  4UY8 C;  2CFM A;  1A15 A;  5T1G A;  2K14 A;  1LO5 D;  5COY A;  2D5D A;  3A5U A;  4ME3 A;  1LM0 A;  1P16 A;  1SND A;  4LMQ D;  2DJG C;  4HMI A;  5GAE C;  4C3J H;  3M4O H;  2M2L A;  4A3D G;  1MIU A;  1O78 A;  1MSG A;  3RZD B;  3HOY G;  3HG9 A;  3VYU A;  3P20 A;  1CKO A;  1FVI A;  3GTL H;  2RSO A;  2VXW A;  2RCF A;  1F9S A;  4JYA L;  1AEX A;  4ZRZ A;  5ELC A;  4EVO A;  1YHB A;  1VQB A;  4G7O C;  4JI8 L;  1F9Q A;  5EGT A;  2QW7 A;  1AZQ A;  2XTI A;  4X6A H;  1EYG A;  3QIA A;  2F4V Q;  2OQ0 A;  1I4Q A;  1G29 1;  1R4Q B;  1VQM A;  2ASB A;  3QOL A;  3H15 A;  1QB5 D;  1DJR D;  3S1M H;  4BBR B;  2EIF A;  3A5Z B;  1QIL A;  4JBK A;  2Q8R E;  3AMU A;  3GV3 A;  4HCE A;  3HOZ B;  4TKO B;  2KCN A;  4N8X 1;  1FR3 A;  1W6K A;  2R7F A;  4HJ8 A;  4A3E H;  2WFW A;  4RGM A;  3OTO Q;  2B63 B;  1G91 A;  1U5K A;  3R3O A;  3EN2 A;  3CPW A;  4UP9 A;  4A3J H;  4ZUJ A;  1A3T A;  4QIW E;  3U9S A;  1YHA A;  3TQY A;  4A76 A;  1MD2 D;  3J80 i;  3BVM A;  3T1Y Q;  1WVL A;  1R9T H;  3WOE A;  1QOH A;  1LTL A;  3RLO A;  3G6E A;  1KDB A;  3C46 A;  4A93 H;  1LTR D;  2F0H A;  1EUJ A;  1WCM B;  5EKL A;  3AYH B;  1VQL A;  5CGK A;  4JV5 Q;  1X3F A;  3PUZ A;  3TS2 A;  1BO0 A;  3LWE A;  4ZCK A;  4FXK C;  1X6O A;  3RMH A;  3K7A H;  5C0X J;  1TWH B;  5CYU A;  5LHY 1;  4K14 A;  5C3E G;  1SN8 A;  2Q8I B;  1ZXT A;  5NUC A;  4P73 A;  1S5C D;  3H0G H;  1FL0 A;  3STB D;  1CZG A;  4KHZ A;  3NEN A;  1N8R C;  1PTO F;  4JYA Q;  3X3N A;  3T56 B;  5IT9 c;  1WD0 A;  2JP1 A;  4JI8 Q;  3ONA B;  4JI5 L;  1IBK L;  1CTM A;  1KAW A;  1X56 A;  4A3B B;  1GVP A;  3GTP B;  4ZKB B;  1BBW A;  3DHQ A;  2N3S A;  3MFY A;  5BN4 A;  4XT3 B;  4KN7 C;  1VQK A;  2NN6 H;  4X3T A;  4P74 A;  2AUJ D;  1SNC A;  4G4K A;  5ELN A;  1XPO A;  1IBL L;  2KED A;  3KYH C;  2B63 G;  2A6H C;  2P5Z X;  3PCO B;  1QCB D;  2A19 A;  5CV5 A;  4KKT A;  5IWA L;  1STB A;  1PFN A;  3JAM L;  1U4M A;  4FDB A;  1B7Y B;  4ZYS A;  5JJI A;  4DR4 L;  5IYD H;  1G6P A;  3S2H H;  5FJ8 G;  2LXK A;  1HH2 P;  4F87 A;  3MTS A;  4YWM A;  3A8I E;  1IXR A;  1VQC A;  1KTK A;  1B4O A;  3BVZ A;  3S1N B;  1XJV A;  3HOX B;  3Q23 A;  4XTC S;  1I50 H;  2K01 A;  1BF4 A;  1KNE A;  2B2U C;  2F3W A;  1PRT D;  4ZKC B;  1A6X A;  3MXP A;  1EU3 A;  3MXU A; 
#chains in the Genus database with same CATH homology
 1B50 A;  2EYL A;  4A3K B;  3OW7 A;  3FEW X;  3S2D B;  2OEO A;  5CBE E;  4IFD I;  5C4Z A;  3KUP A;  1KLG D;  2R6G A;  3H94 A;  1WTO A;  2F0L A;  2IJ0 A;  1SBB B;  5A35 A;  5C3X A;  4ZLT F;  4FF4 A;  2HUG A;  2KVM A;  4C3H G;  2F0U A;  3K59 A;  3J81 E;  3S1R B;  2F0F A;  4FXD A;  1GUS A;  3NTI A;  3MFG A;  4KK7 A;  1WTQ A;  3TP7 A;  1MBY A;  4O1N A;  1X32 A;  3QB3 A;  3J7Y W;  1JOK A;  3OWF A;  5C4H A;  1HXY D;  2CW0 C;  1EWC A;  2NZ1 D;  1CI3 M;  4HCS A;  3WDN A;  4I65 A;  2WP8 J;  5I2Y A;  2HDL A;  1DOL A;  4FO2 A;  1QJO A;  4M1U B;  1SYG A;  5D14 A;  4BY7 B;  2VNU D;  1RCV D;  3FDT A;  3D3R A;  3SE0 A;  5JAV A;  5KND A;  1SJH D;  5DNF A;  4LK1 C;  1M8A A;  1TY0 A;  2PW5 A;  5T1I A;  1CT1 D;  5D3D A;  5K36 G;  4CGY B;  1TS4 A;  4C3J B;  3M4O B;  5KNC A;  2R92 B;  3GTL B;  5CV4 A;  3Q0A A;  1ENA A;  1XX8 A;  3QOJ A;  2DY8 A;  3VR3 A;  2FIN B;  1SYF A;  1BR9 A;  2QEJ C;  2WII B;  3BS1 A;  4ODG A;  2EYJ A;  3J7A V;  2L11 A;  4KY6 A;  3NBI A;  4RH6 A;  3S1M B;  3MWY W;  2GA4 B;  4KN4 C;  4K6D A;  1OO9 B;  2MJ8 A;  2VUM B;  1KLU D;  1SNO A;  3TZU A;  1A3V A;  3G6J B;  2NYZ D;  3RUZ A;  4QF4 A;  2L12 A;  3A54 A;  4A3J B;  2KOL A;  1ESR A;  3D4W A;  4RGN A;  3CRK C;  4R8N A;  5CV9 A;  3X3M A;  1V8Q A;  4HMJ A;  2R7Z B;  4QUF A;  4L8J A;  1R9T B;  1UNS A;  2E2J B;  4ILW A;  4QMG A;  1IYV A;  3NP8 A;  5IGF A;  1JC7 A;  1UAP A;  5J39 A;  3KLR A;  1QNU A;  4Q0F A;  1LTA D;  4CHT B;  4DK1 A;  5JPN C;  3TP5 A;  4XQJ A;  1Q3L A;  5JPM C;  3I91 A;  4PMB A;  1F2M A;  3VR4 A;  3H0G B;  1PFM A;  1Q1B A;  1WTW A;  1E0B A;  3GD7 A;  1EEI D;  5HUR A;  2F0M A;  5ELD A;  2E2I B;  5COR A;  2CHB D;  3NTH A;  5IOC A;  1GUW A;  3HZX A;  2BCO A;  5KRU A;  1GJX A;  2JSO A;  3TME A;  2NN6 I;  5I9P A;  1MSH A;  1B53 A;  1JWM D;  2H1E A;  3D6W A;  2SEB D;  1IKL A;  3T53 B;  4HR7 B;  1WTR A;  5F2D A;  4QCL A;  3D31 A;  1EY9 A;  1F9R A;  2PPB C;  3S2H B;  4DXG A;  4IUN A;  2EZV A;  3S16 B;  5E4X A;  1JR0 D;  3LWU A;  1CK1 A;  1WTP A;  1LV9 A;  3SVM A;  1LTB D;  1YNN D;  1V1O A;  4XXE A;  4XIG S;  1EEF D;  2J7Z A;  1QE6 A;  4RCO A;  3NK9 A;  1MGS A;  5JVH 3;  4H13 C;  4U68 A;  4Z9C B;  2BDO A;  3C3L A;  4K5V A;  3BDO A;  1STN A;  2QF7 A;  1PTO B;  3HRZ C;  5FKA C;  2G9H D;  1TS2 A;  2I46 A;  1B9N A;  2LY7 A;  2RDG A;  4KD3 A;  5FO7 B;  1Y1W B;  2Z4H A;  4O42 A;  1J8I A;  1YNJ C;  3DWP A;  2K5W A;  5FK9 C;  5EPK A;  1EYC A;  3FPP A;  3QG1 A;  1GUG A;  3D8G A;  1TS3 A;  2KEE A;  3WOF A;  2AQ2 B;  1LAB A;  2DN8 A;  3HOV B;  2F0N A;  3OOC A;  4RFB A;  5K36 H;  1EY6 A;  1EOT A;  3A8J E;  1U9R A;  2IT1 A;  3EQL C;  1D1K A;  2HQE A;  2RVL A;  4PMW A;  1ML0 D;  1HQM C;  4EQO A;  3HEJ A;  1RHP A;  3H6M A;  1Z6H A;  3GQB A;  1C48 A;  4IUT A;  2L4N A;  5M9O A;  1PRT F;  4G57 A;  1CFM A;  3GTM B;  4WRD A;  1TS5 A;  1CM9 A;  3NQI A;  3MXN A;  1EIG A;  4GZY C;  2RDH A;  1XXG A;  2IX0 A;  4U67 3;  4K8J A;  1ENC A;  1ZYR D;  3VA7 A;  5C6A A;  2A69 C;  3MVV A;  1FD7 D;  3BDL A;  4NW2 A;  2F0D A;  4C1N I;  2SNS A;  3BVG A;  1I3Q B;  4N9T A;  3IFT A;  4RHS A;  2RQX A;  1D6E C;  1JWU D;  2NVQ B;  3Q22 A;  5KGU A;  1PTO C;  1EY4 A;  3A56 A;  1JB3 A;  2J0T D;  3EFX D;  2AWN A;  3NQT A;  4CJ2 C;  4AYB B;  1A2U A;  3MHB A;  3VR2 A;  4XYQ A;  2MUY A;  4QUC A;  2Z8L A;  5C3E B;  2TMP A;  3K5O A;  1SSO A;  1JWS D;  4C3I B;  5M3F B;  1OXT A;  3PUV A;  1GUN A;  3H91 A;  2X6L A;  1H9S B;  4ZUI A;  4NP5 A;  2CW0 D;  3NWT A;  4RKB A;  1BDO A;  5FLX E;  5A2Q L;  1B2T A;  1Q90 A;  4B9X A;  1HA5 A;  3I3C A;  3SXH A;  5IOD A;  3P7J A;  4K6L A;  3BG3 A;  3TZD A;  1OXX K;  5I9O A;  1H9M A;  1IYU A;  3OHX C;  2N88 A;  2K1B A;  1BXT A;  3HOU B;  3CU7 A;  5EJW A;  3GV6 A;  1SMY D;  5IGB A;  3M7N A;  1Q1E A;  2YYZ A;  1K8O A;  3V96 A;  5CMD A;  2ENB A;  1X3Q A;  1GUT A;  2K7V A;  2EYF A;  1I6H B;  3SK5 A;  1HPC A;  2A73 B;  5M3M B;  1TVX A;  3S15 B;  2KEC A;  5E4W C;  1EL0 A;  2VB2 X;  5IGD A;  2Z1C A;  3FRP B;  5G3L D;  5KIX A;  1RTN A;  2FHT A;  3J81 L;  2A68 C;  1AN8 A;  3KLS A;  2EYP A;  1S5E D;  1Z47 A;  4CKC A;  4HN7 A;  4C3I G;  3D6C A;  1RD9 D;  2PW7 A;  1SE3 A;  3A7A B;  1HA6 A;  4R9W A;  3DEO A;  2NB0 A;  2CQA A;  5FO8 B;  4C3H B;  2QIL A;  1XTC D;  2K6A A;  3HKZ B;  5DM7 3;  3L9A X;  3NPP A;  1I4P A;  2IWH A;  4OO1 G;  2F0W A;  1O7L A;  4BBS B;  3NTK A;  3KBG A;  1EFI D;  2M9V A;  1JQY D;  2RA4 A;  4RHR A;  3IKJ A;  5BN3 A;  3PO2 B;  2SOB A;  4F8M A;  3I73 A;  5A2Q E;  1PLF A;  3FKI B;  2QKI C;  4B08 A;  3SHL A;  5JEA G;  3I90 A;  3BYY B;  1AFP A;  1XYI A;  2KCC A;  4QIW B;  3DEP A;  3R2T A;  3S1Q B;  1NR2 A;  3R2I A;  3A8K E;  1HFG A;  1S4Z A;  1FNW A;  5M5X B;  2AQ3 B;  1QNK A;  4A3M B;  2EJF C;  1T5X D;  1PTO H;  2PCF B;  4DGZ A;  1HQR D;  1BQQ T;  1CQV A;  2R3Z A;  5D65 A;  1D5M C;  4XQQ A;  2BE5 D;  1ESF A;  3IAY A;  4M8A A;  4XDX A;  1I4X A;  1RF2 D;  4A3G B;  4Q5V A;  3OIQ A;  4RWS C;  2PQE A;  1II3 A;  2ZXO A;  2L5T A;  1GOZ A;  1K83 B;  2EYM A;  3VYT A;  2KA7 A;  1EWH A;  3J7A F;  4OL7 A;  2K28 A;  4C1N K;  3TP6 A;  1H9K A;  4WFN 3;  4K8I A;  5C0X I;  1NUC A;  2JEB I;  5CV8 A;  1F9P A;  3MC0 B;  2ICE C;  4IUV A;  4QB4 A;  2LFN A;  4WOR A;  4ZK9 B;  3GTJ B;  3D4D A;  4H44 C;  1JOO A;  2PNR C;  2A6E D;  1B3A A;  2K03 A;  2OT2 A;  5CV6 A;  3DWA A;  2EYO A;  2PO4 A;  1S5B D;  3VYS A;  5TSS A;  1CA5 A;  4V0B A;  1PRT B;  3OMG A;  4J8Q A;  4CBV A;  2M00 A;  4IFD G;  1QWY A;  5DEH A;  3OMC A;  4UDU C;  3QO2 A;  1BBX C;  1U4P A;  5C5M A;  3KK7 A;  1SE4 A;  4LAA A;  1E2W A;  2KQ3 A;  1BCP D;  4TRD A;  1PZK D;  2F0E A;  1FYC A;  2ICI A;  2FMM A;  2B8G A;  4JK1 C;  1RKN A;  2VB3 X;  2EY5 A;  4MIU A;  1M4V A;  1LT3 D;  2F0Q A;  3GTO B;  3HGB A;  4NMZ A;  5C5L A;  2NUC A;  1PZI D;  4DNT B;  2EJM A;  2A74 C;  4X3K A;  1ILP A;  1S5D D;  1LAC A;  1HUN A;  1SAP A;  2C9O A;  1NAP A;  4OO1 H;  1NSN S;  2E2H B;  1VMP A;  4TQU S;  2RDF A;  1HFN A;  4OIJ A;  2V4D A;  1F2Y A;  5J22 A;  4FP5 D;  2SNM A;  1Y1V B;  4FVM A;  2NBF A;  1OXS C;  1KAA A;  2EY1 A;  1Z7T A;  4ULL A;  2K5Q A;  2IPK D;  1PXU A;  3KBX A;  1SYC A;  3VR6 A;  2EDG A;  2F03 A;  4IUQ A;  5FO9 B;  5JEA H;  5EPJ A;  3MAQ A;  3OSO A;  2D62 A;  1JIC A;  1C4Q A;  3LNN A;  1SNP A;  4J1M A;  1QG7 A;  5DM6 3;  3C1F A;  1ILQ A;  3LX0 A;  4CKE A;  1STY A;  3L3O C;  1FNU A;  3A55 A;  5EKK A;  1G2S A;  5C44 B;  1PRT C;  2L9H A;  5M5W B;  4RA8 A;  4RKL A;  3SR1 A;  4L63 B;  2X69 A;  3M7G A;  4DAY A;  3K5M A;  5EBC A;  1T5E A;  1O7Y A;  2EVB A;  4XQN A;  3OPO A;  3MA2 B;  3V05 A;  1V43 A;  1EZ8 A;  2O4X A;  1STG A;  3GTK B;  2XRS D;  4DFA A;  3EJI A;  1E2Z A;  2H4O A;  4PNY A;  5G3L F;  3P1H A;  4V19 0;  4R8I A;  4DNR B;  2L1B A;  4PQX A;  1D5X C;  2IL8 A;  5ELB A;  4DAV A;  3DM1 A;  1O7Z A;  3DUZ A;  2D2C C;  4KJN A;  1SYE A;  3DXJ C;  1EQV A;  1EYA A;  1EY0 A;  2B2W A;  4KJO A;  4IN3 A;  1VF7 A;  2K04 A;  5J1Z A;  2J4X A;  2IW3 A;  4CKB A;  1GHK A;  4Y7N B;  4TSS A;  2EYH A;  2LKV A;  2EJG C;  1C8C A;  1OXV A;  5IT9 E;  1TWG B;  3TP8 A;  4KI0 A;  1EU4 A;  5JEA J;  3S17 B;  4DAP A;  2HDM A;  2F0S A;  2B39 A;  5FLX L;  2JA8 B;  2E74 C;  4F88 A;  3GTQ B;  2K32 A;  1STE A;  3HOW B;  4XYO A;  3S9W A;  1DM0 B;  1VF5 C;  4FF1 A;  2R93 B;  1VDZ A;  5CBA E;  2A6H D;  1EY8 A;  2A5H A;  3EA6 A;  4IFD H;  2RBM A;  2WV6 D;  2KHS A;  3GO5 A;  1TT2 A;  1DCZ A;  4I7Z C;  2MGS A;  3AB9 A;  2L55 A;  3KLS X;  4X3U A;  2ID0 A;  3N6R A;  5JOB A;  1HRJ A;  3EVQ A;  3VYR A;  1H9R A;  1DYQ A;  3L7Z C;  3RLF A;  3T4A C;  1A3U A;  5CC4 A;  1AW7 A;  4ABN A;  3PO3 B;  2K05 A;  3MXG A;  4IUP A;  3R8B A;  3IL8 A;  5BN5 A;  1SNQ A;  2O5J C;  1AP0 A;  5IGG A;  1HTL D;  2PZW A;  2F0G A;  3D4R A;  2WAQ B;  3RD4 A;  3NSW A;  1ZEQ X;  3K5N A;  2Z4I A;  1JCK B;  3CHB D;  2SDF A;  3J80 E;  2X6G A;  1TWF B;  3GP7 A;  2NTS A;  2PZT A;  3NBH A;  1KDC A;  4WJW A;  2MHV A;  3TBI B;  4EGV A;  1DON A;  5I4D A;  3I4L A;  1LTS D;  1V1P A;  2B2W C;  3CQZ B;  4KKU A;  3URY A;  1FGB D;  4A3I B;  4FF3 A;  4OO1 I;  1K8M A;  1SFO B;  4IFD J;  2B2U A;  1G8Z D;  2RKS A;  1GXD C;  3S14 B;  1G6Z A;  4DF7 A;  1TWC B;  1SJE D;  3A7L A;  1F77 A;  4RGO S;  3H3V C;  3Q24 A;  1V1P B;  1D1I A;  3I70 A;  2L0C A;  2PMZ B;  4BWG B;  3QJY A;  1BCP F;  1Y8N B;  2BOS A;  4L6T B;  2E76 C;  3SDZ A;  2XVS A;  4C56 C;  5ELF A;  3C2P A;  1YNN C;  2JXM B;  1JOQ A;  5EBD A;  2BA0 A;  1U4R A;  1PFB A;  4PV1 C;  4KY5 A;  1KDA A;  2IX1 A;  1BNZ A;  1IHZ A;  1HCZ A;  1R4P B;  3PUY A;  3OWE B;  2F3V A;  2NVY B;  3FMC A;  1ET9 A;  2C5C A;  1EY5 A;  4LJZ C;  1ZKO A;  1LT6 D;  3E6Z X;  5D3I B;  3TSS A;  1JE4 A;  5LL6 X;  3P75 A;  5C4X B;  1DOM A;  5CV7 A;  1IW7 C;  3TN2 A;  1PZJ D;  1GHJ A;  5IIF A;  2OXP A;  3H09 A;  2NVX B;  2JA5 B;  3ERQ A;  1EIH A;  1G2T A;  3I72 A;  3ZYY X;  2F0O A;  4IUR A;  1I6V C;  1DD2 A;  1Q12 A;  1I4H A;  1PMR A;  3CKI B;  4BY1 B;  2DNE A;  1ONL A;  1HUM A;  3W2D A;  1HTP A;  1TQO A;  3FVQ A;  5JJZ A;  4YIJ A;  2LMC B;  1TU2 B;  4C2M B;  3IFD A;  4B9W A;  1O80 A;  1TY2 A;  1EYD A;  2E75 C;  1VCI A;  2F0J A;  1ZYR C;  2AWO A;  2Q8T A;  1SE2 A;  1TKW B;  2WKC A;  1LTI D;  1OXU A;  3K6O A;  2AQ1 B;  2G9D A;  1STH A;  2WB1 B;  2EY2 A;  5IGE A;  5E3F A;  4IZ8 A;  1MI2 A;  3CRL C;  2K5D A;  3G7L A;  4FYD A;  3T16 A;  4EQP A;  1PYW D;  3SEB A;  1RJT A;  2MP1 A;  1Y69 U;  2JYO A;  2KJX A;  4HED A;  1UUP A;  3SK4 A;  1TR5 A;  2NTT A;  1SDF A;  1F2Z A;  1RDP D;  3RZO B;  2F1M A;  4K5X A;  2QDB A;  1SYB A;  3E0J A;  1CHP D;  4G7H C;  1B44 D;  4K2L A;  1ET6 A;  3M3Y B;  2EXZ A;  4F7X A;  4DA2 A;  4KTA A;  1YNJ D;  2HCI A;  5I2X A;  4HSP A;  4IUU A;  3F2U A;  3NHH A;  2DNC A;  2NVT B;  5KYL A;  1SXT A;  5ELE A;  3K57 A;  4ZQ3 A;  3SK6 A;  4OGQ C;  2D9U A;  3JAM E;  1SMY C;  5I6W A;  5DAU A;  1A2T A;  3HP3 A;  4ZAI A;  3V2T A;  2WIN B;  5K5P A;  4HAE A;  1X3P A;  3DWQ A;  1CQF A;  1CZW A;  1L0Y B;  1XWE A;  4KV6 A;  3K0Y A;  1ENF A;  2CVR A;  2B2Y A;  2FJ2 A;  1EZ6 A;  1CA6 A;  1WTV A;  4DK0 A;  3NWS A;  5AFW A;  3PMF A;  4S3S A;  3MZ5 A;  1ICW A;  2FFK B;  1SYD A;  2WAC A;  2B2T A;  4FF2 A;  4E6I A;  4N9P A;  2QCP X;  1W6J A;  2A69 D;  4K2K A;  2EE1 A;  4H7B A;  2XNA C;  4A3E B;  4G7Z C;  1LT5 D;  3QWN A;  4BS9 A;  1GUO A;  4HSV A;  2K33 A;  5KEE A;  5KNB A;  1F2L A;  3PIO 3;  3ERO A;  5IT9 L;  4DN4 M;  4NDX A;  2EOT A;  2XRQ D;  1BUV T;  2JE6 I;  4RGT A;  2I07 B;  1KAB A;  1PTO D;  1TII D;  5KYI A;  4A93 B;  2EPB A;  5C4J B;  5C0X G;  3PUW A;  3ITP A;  2E2D C;  3PV0 A;  4KHV A;  3O13 A;  3BZD B;  4JBW A;  4K5W A;  4P2C B;  2ZT9 C;  3NUC A;  3W3A A;  3GTG B;  1NCV A;  3K7A B;  3I4M B;  4C3J G;  5LL6 S;  3N52 A;  1Q8I A;  1SNM A;  3K58 A;  4UAI A;  4ME5 A;  3NE5 B;  1EY7 A;  4OHJ A;  2OF1 A;  2PZU A;  1S5F D;  5CR3 A;  1VMC A;  3I8Z A;  2DY7 A;  2O5I C;  1AZP A;  2B2V A;  1IL8 A;  1SEB D;  2BDN A;  4J6H A;  3TDQ A;  1PDQ A;  4X3S A;  5E1F A;  4MHE A;  4PMC A;  3C1E A;  3FPU B;  1LT4 D;  4RAU C;  1BCP B;  2BE5 C;  1RTO A;  1WD1 A;  2B8F A;  3U9O A;  3E5S A;  1I4G A;  2XSC A;  3M4Y A;  1KNA A;  1ROD A;  3NXW A;  3SK8 A;  1Y8P B;  3KF8 A;  5EKI A;  1LLR D;  1LTT D;  2B2Y C;  2BA1 A;  3PUX A;  3K5L A;  3M85 A;  4CJ0 B;  4MN3 A;  2XIW A;  4OIK A;  5JVG 3;  1I50 B;  2F0T A;  1H9J A;  2A68 D;  1STA A;  2NWG A;  5FOB B;  2R61 A;  3J80 L;  2Y0S B;  3PIP 3;  2B2T C;  2RSN A;  2JA7 B;  5HGT A;  1I4R A;  3R93 A;  3AU7 A;  2XWJ B;  2IX3 A;  4NKL A;  2O2L D;  3UI2 A;  4RCN A;  3T51 B;  4BA2 I;  1FNV A;  4EQN A;  2WKD A;  2HCC A;  4KMU C;  2F0K A;  1IW7 D;  5M5Y B;  2A6E C;  5EPL A;  2NN6 G;  1HHV A;  3VA5 A;  2JA6 B;  2XWB B;  4XT1 B;  2ZXP A;  4A3D B;  1NR4 A;  4BA1 I;  1CHQ D;  2PYK A;  3HOY B;  3I4N B;  4CJ1 B;  1Y8O B;  4FXG C;  3HS0 C;  4KD4 A;  1EQT A;  2F0P A;  1DXM A;  1DOK A;  4H0L C;  5EQ0 A;  2MPM A;  1DZ1 A;  2YU9 B;  1IKM A;  5C3W A;  1BCP C;  3BYT B;  1JOR A;  2EY6 A;  1E2V A;  4IQZ A;  2F0I A;  3OIP A;  1L0X B;  3MEH A;  2JEA I;  1J9O A;  3VR5 A;  4DXF A;  2B2V C;  1U4L A;  1TWA B;  3ND9 A;  4FNF A;  4IAL A;  5ISR A;  1LTG D;  5I6Y A;  4DU9 A;  2TSS A;  1WTX A;  2KUM A;  4KKS A;  1B1Z A;  2F4I A;  4A3F B;  3BDC A;  2FMC A;  2XN9 C;  5IGC A;  1D5Z C;  2ZXR A;  1UEA B;  3Q6S A;  4ID6 A;  1D2B A;  2F0V A;  3T13 A;  4KY7 A;  4HTH A;  1H9S A;  2LS0 1;  2N55 A;  2AUK A;  5C0X H;  1BOS A;  3ND8 A;  3DMU A;  1B9M A;  1A15 A;  5T1G A;  1LO5 D;  5COY A;  2D5D A;  1SND A;  4LMQ D;  4HMI A;  2M2L A;  1O78 A;  1MSG A;  3RZD B;  3HG9 A;  3VYU A;  3P20 A;  2RSO A;  2VXW A;  1F9S A;  1AEX A;  4ZRZ A;  5ELC A;  4EVO A;  4G7O C;  1F9Q A;  5EGT A;  1AZQ A;  3QIA A;  1I4Q A;  1G29 1;  1R4Q B;  3QOL A;  1QB5 D;  1DJR D;  4BBR B;  1QIL A;  2Q8R E;  3AMU A;  3GV3 A;  4HCE A;  3HOZ B;  4TKO B;  2KCN A;  1FR3 A;  1W6K A;  4RGM A;  1G91 A;  2B63 B;  3R3O A;  4ZUJ A;  1A3T A;  3U9S A;  1MD2 D;  3BVM A;  1WVL A;  3WOE A;  1QOH A;  1KDB A;  3C46 A;  1LTR D;  2F0H A;  1WCM B;  5EKL A;  5CGK A;  3PUZ A;  1BO0 A;  3LWE A;  4FXK C;  3RMH A;  5C0X J;  1TWH B;  5CYU A;  5LHY 1;  4K14 A;  2Q8I B;  1ZXT A;  5NUC A;  1S5C D;  1CZG A;  4KHZ A;  1PTO F;  3X3N A;  3T56 B;  1WD0 A;  2JP1 A;  3ONA B;  1CTM A;  4A3B B;  3GTP B;  4ZKB B;  3DHQ A;  3MFY A;  5BN4 A;  4XT3 B;  4KN7 C;  2NN6 H;  4X3T A;  2AUJ D;  1SNC A;  4G4K A;  2KED A;  2A6H C;  1QCB D;  5CV5 A;  4KKT A;  1STB A;  1PFN A;  3JAM L;  1U4M A;  4ZYS A;  4F87 A;  3MTS A;  3A8I E;  1KTK A;  1B4O A;  3BVZ A;  3S1N B;  3HOX B;  3Q23 A;  4XTC S;  2K01 A;  1BF4 A;  1KNE A;  2B2U C;  2F3W A;  1PRT D;  4ZKC B;  1A6X A;  3MXP A;  1EU3 A;  3MXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...