4NP5A

Crystal structure of staphylococcal nuclease variant delta+phs v66a/i92n at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYNYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4np5A00
3R3OA 1SNOA 2F0SA 3D4WA 4K8IA 3LX0A 4G57A 4B9WA 4KJOA 4F8MA 1EY5A 2F0IA 5IIFA 5IGCA 1SYBA 4K5VA 3NP8A 3MXPA 5IOCA 4WORA 2EYPA 3SK5A 3C1EA 3P1HA 4HMIA 3TP7A 5CV8A 1EZ6A 2F0FA 1SYCA 4TRDA 3SK8A 2PYKA 2F0UA 1EY7A 2EYHA 1A3VA 1KDAA 2EY5A 5C3WA 2RBMA 1EYCA 3EROA 4NP5A 4DF7A 2NUCA 5IGFA 3DHQA 3MVVA 4KD3A 4KD4A 1F2YA 4KY6A 4LAAA 1TQOA 2M00A 4EVOA 2PQEA 5C5MA 1SNDA 1STBA 3HZXA 4KY7A 3MHBA 2EYJA 4DFAA 2KQ3A 3D4DA 2PZUA 4QMGA 1EYAA 5KGUA 5J22A 2EY1A 3NUCA 3V2TA 4N9TA 5HGTA 5K5PA 1TT2A 1EZ8A 2F0QA 1SNCA 1JOKA 2PZTA 2PZWA 1SYEA 5I6WA 1A2UA 4QF4A 2F0GA 5KYIA 1F2ZA 3TP6A 4K5XA 5DAUA 4KJNA 1EQVA 1F2MA 1STGA 3PMFA 4E6IA 1A3TA 2PW5A 5HURA 1JORA 3C1FA 4K14A 1NUCA 5E3FA 2EXZA 3P75A 2O4XA 2PW7A 5IODA 3BDCA 5CV9A 2F0TA 5DEHA 4YIJA 4PNYA 4S3SA 4ODGA 5E1FA 2F0WA 2OXPA 5M9OA 3NHHA 4IZ8A 1AEXA 5CV5A 3SK4A 5CGKA 1SYFA 1NSNS 4MIUA 2OF1A 5JOBA 4ZUIA 5CV6A 4J6HA 4ID6A 1STNA 5IGDA 4PMBA 1RKNA 3RUZA 2SNSA 4DU9A 3TMEA 1KAAA 5KYLA 3TP5A 2SNMA 1A2TA 3EVQA 3QOLA 2HQEA 2F0EA 4KHVA 2F0KA 5C5LA 3T13A 5C3XA 4F7XA 2EYOA 2F0JA 1ENCA 1EY8A 1SNPA 1U9RA 3HEJA 3QOJA 5J1ZA 2LKVA 2EYMA 3D8GA 2EYLA 1ENAA 2OEOA 4K2LA 5EKLA 4HMJA 3SR1A 3E5SA 4R8NA 4KY5A 4RKLA 1JOQA 3BDLA 4WRDA 4NDXA 4I65A 3S9WA 2RDFA 1SYDA 4K2KA 5I6YA 4PMCA 1EY9A 5I9PA 2EY6A 1SYGA 4RKBA 4ZQ3A 1STHA 2EYFA 3D6CA 3ITPA 5CV7A 2F3VA 5EKKA 3OMGA 2EY2A 3VA5A 3QB3A 5I9OA 2WACA 4K5WA 1EY4A 4HTHA 1EYDA 4NKLA 4IALA 3H6MA 4ME5A 3U9OA 1STYA 2F0VA 3NXWA 2QDBA 2F0NA 4N9PA 1EY6A 3NK9A 4ZUJA 5EGTA 4IUNA 5IGBA 3ERQA 3TP8A 5ISRA 5CR3A 4J1MA 4K8JA 5KEEA 2F0DA 1STAA 1KDBA 4DGZA 5CV4A 2SOBA 1IHZA 1A3UA 2F0HA 2F0MA 4NMZA 5C6AA 5IGGA 4EQOA 5KIXA 4EQNA 4K6DA 5NUCA 2F3WA 5C4ZA 4KV6A 4OL7A 5C4HA 3NQTA 3SXHA 3EJIA 3SK6A 3OMCA 3OWFA 3SHLA 2F0OA 1JOOA 1KDCA 3MZ5A 4KTAA 2RKSA 5CC4A 5IGEA 1SNMA 4EQPA 2F0PA 3T16A 5KRUA 3OSOA 4B9XA 3DMUA 5F2DA 4H7BA 1TR5A 1SNQA 5J39A 3MEHA 1EY0A 2ENBA 2F0LA 4QB4A 1II3A 1KABA 2KHSA 5JAVA
chains in the Genus database with same CATH superfamily
5ELBA 2N3SA 3R3OA 4X64Q 4AIMA 2D5DA 4LMQD 4F8MA 2P5ZX 1J9OA 1DONA 1STEA 1JR0D 1VQEA 2HD3A 5T1IA 3M3YB 3RZOB 2CWPA 1V9PA 1O7YA 3J81E 4EQ5A 2IPKD 1LTID 2R7FA 4ULLA 4KY7A 3K7AH 1NMFA 5CYUA 1A2UA 2F0GA 1I6VC 1TWGH 3PV0A 3FRPB 2D0OA 1H9SA 2HDMA 2ZT9C 4K5XA 1F2MA 1JB7A 4KN7C 1QB5D 2PW7A 2QEXA 4JI0L 2K5DA 4S3SA 3NTHA 4YIJA 4ABNA 2F0WA 4C3HH 4DV0Q 4JV5Q 4GKKQ 1H9JA 3I8ZA 3PUVA 1BCPB 1X32A 1J5EL 4QY7A 5C0XJ 2J7ZA 3S1NH 4A3DG 1X3QA 2Q8TA 3RMHA 3RUZA 4C3JH 4JI3L 3TP5A 4LF6L 2ZXPA 3CQZB 2HQEA 5C5LA 1U9RA 2LKVA 2H5XA 2OEOA 4IUTA 2I5HA 3ND9A 1SSOA 2AQ1B 1WTHA 5GAHC 4BBRG 2VY3A 3OIQA 3ER0A 3HKZE 3I56A 2ZM6L 3SE0A 2JA5H 4ME5A 4DR4L 2IX1A 2F0VA 2L12A 1KRSA 3PO2B 3KF8B 3RD4A 1JQYD 3TP8A 1TS3A 4DXGA 1ILQA 1M8AA 3NQIA 4A3CG 3BDOA 3PUZA 1MSHA 1C0AA 2EPBA 1H95A 4JYAL 3MFGA 4BBRB 1F2LA 3F2UA 4TSSA 3A56A 4LF7Q 2JA7B 3M85A 3HKZG 4C1NI 1SJHD 1VQCA 2EOTA 1DCZA 1PH7A 4F88A 3CXCA 4K5VA 2E8GA 1YBYA 3S24A 2CKZB 3HKSA 3I4NG 1BBWA 1G8ZD 2F0FA 3SK8A 4GNXA 4PZ7A 3K5OA 4HIKA 3L9AX 1GUGA 2R93H 4IFDG 2FINB 3J7ZC 2VQFQ 2JA6H 4X3KA 3RNUA 1YJNA 1TWHB 3HZXA 2MFIA 4DXFA 1FJGL 4OWTB 5KGUA 2F4IA 1H9RA 2AHOB 2A74C 3HKZB 3M7NA 4DR1L 2CW0D 3S15H 1EIGA 4J15A 1LTLA 1TKWB 3ULLA 5KNDA 3BDCA 4GOPC 1XPRA 1S72A 3QIAA 2E76C 1NCVA 2QW7A 4U68A 3KYHC 3VYTA 4FF4A 3HOVB 3PUXA 2Z6BA 5CV6A 1B3QA 4J6HA 1BDOA 3KDFA 4C56C 1RD9D 5M3FG 1LT5D 1VQLA 3I91A 1K8GA 1PH9A 3QOLA 4OEMB 1A8VA 5ELNA 2K50A 3IL8A 3J7YW 4DR3Q 1E3PA 1W6KA 1BO0A 3E5SA 1PXUA 1GUOA 1NY4A 5JJKA 3PO3G 2G5DA 4NPSA 5AJ3Q 4CKEA 3CC4A 1HFNA 1CSQA 2B2VA 3S2DH 1EU3A 2ICEC 2VB3X 3I7FA 1EIYB 3S2HH 5C4XH 2QF7A 5M3FB 1PH2A 2ASBA 1NR4A 3Q22A 4EQOA 3HFZB 5KIXA 4IO9A 3I2ZA 4UHVA 3MC0B 4HAEA 4A3IG 1I6HH 2UXCL 1I4RA 4KTAA 3PO3B 5FLMG 2XN9C 2NVYH 2KHSA 3I70A 1QNUA 1D5MC 3T53B 1KRTA 4RGOS 3E0JA 1IBLL 1VF7A 2CQAA 5FK9C 4DR5Q 4MTNA 2Z4IA 5CV8A 5E7NA 2Z9HA 4OHJA 2KCTA 1XNRL 4UDUC 2LMCB 1QZHA 3KLWA 4IFDI 1Q7YC 3GTMB 1NMGA 2PQAA 4OONA 3K7UC 2B63G 1Q81C 2ZJPA 5ISRA 2CH4A 4A3FG 3D4RA 1S40A 1YEZA 2Z1CA 4QF4A 1G6ZA 4FVMA 2EZVA 2L9HA 1K83H 5LL6S 2XWBB 3I4LA 4HCEA 4DK3C 2MPMA 2J4XA 3A8JE 5IODA 5EJWA 1UAPA 1YZ6A 5IYDG 2N88A 1U5KA 2NB0A 2GN5A 4JI4Q 2ZTDA 5D3DA 5M5WB 2OF1A 3X3MA 2HIXA 3RZDH 1E1OA 3TS0A 1F9QA 1PH3A 1WTRA 2R7ZG 4A4IA 2B63B 3TBIB 4A3FB 1YHBA 2ZJRA 2WKDA 4HMJA 4JBMA 4CDEC 1VQAA 1AFPA 4X66Q 1E2VA 4JG2A 4XT3B 3T4AC 1HQMC 1CZGA 1SYDA 1VS0A 4K2KA 4R4TA 2I46A 5I9PA 1WYDA 2F3VA 2EY2A 3CCMA 3S1RH 5IP7H 1C8CA 1SE2A 4UP8A 4AH6A 2C5CA 2E2IH 2QDLA 1B44D 1PTOH 4NB3A 3PF5A 2KHJA 1STYA 2NN6I 4AYBE 1PYWD 2IJ0A 3S17H 3L2PA 1XJVA 4DNTB 2OQKA 1TWCB 4IUNA 4CJ2C 5BN3A 5CR3A 2R7ZB 4KHPQ 3R93A 5EPJA 2WKCA 4DV7Q 1PFMA 3GTLH 4A3KH 2VQEQ 3H3VI 5IGEA 1SNMA 4OGQC 1LM0A 4H7BA 4LFCL 2B2UC 2KENA 5KNCA 5IP9G 4BBSH 4LUOA 1F9RA 1SNOA 1MJEA 1NNXA 5K36G 4AYBG 4IUQA 4JI6L 3JAML 3W1GA 1LTSD 1CA5A 3ZYYX 3G4SA 1EU4A 4H02A 1LTRD 4GOPB 3A74A 4C2MB 2IW3A 4IPHA 3KLSA 1NJIC 1UE6A 1C48A 1STBA 1Y8NB 1EWIA 4DFAA 4XIGS 1VF5C 3EN2A 1D1IA 3GTKB 3AB9A 3G71A 3U50C 2RCNA 2Q8RE 3HOUG 3QR8A 4MTKA 4BY1H 1O7IA 2A68C 4AYBB 3T1HL 4ZKCB 2I5LX 1JORA 3HGBA 1EWHA 2F0TA 5CV9A 1SE3A 1KXLA 1ICFB 3CPWA 2BE5D 1N32L 1AEXA 4JI2L 5CGKA 3UDGA 2NTSA 2K7VA 4ZUIA 2UUBQ 1LT3D 5IGDA 5JEAG 1Z6HA 3S14H 2EJMA 2SNMA 2YTVA 4L8JA 1VQ6A 1CM9A 1PZJD 5LMNW 3QOJA 1HNZQ 3OTOL 4DPGA 2BCOA 1XMOQ 2RCFA 2B29A 1I4GA 3O13A 1ESFA 1XNQL 1Y1WG 4UY8C 2ID0A 4XQQA 1HQRD 3BVZA 4ZQ3A 1Y8OB 1HH2P 5IE8A 1RTOA 1IXRA 1IYJB 2MHVA 2HHHQ 4A3GH 1D8LA 1ZYRD 3NXWA 4XQNA 2JXMB 5C4JB 2HCIA 1F9SA 4IFDH 1YNJC 1PA6A 1V1PA 1VQIA 1P16A 2TSSA 3KJPA 4JI8Q 1FYCA 1MJCA 3IAYA 4LF8L 1ONLA 4LFBL 1VQ9A 1RCVD 4TVAB 3GTJB 1L0YB 5CC4A 5IYBH 4X64L 3OSOA 1PHJA 1G2SA 3QJYA 2VZAA 1XTDA 3TN2A 4R4CA 1D5XC 3W5OA 3M4OH 5FO8B 3HRZC 1YHAA 4OO1G 3BYTB 5IYCH 2O5IC 4L5RC 2Y0SG 2FXQA 4KKTA 1CT1D 3LX0A 3T1YQ 2NYZD 1MBYA 2ICIA 1PTOC 1M4VA 1H9MA 1SMYC 3GP7A 1HZCA 4HR7B 2B2YC 2A69C 1JWUD 1KAWA 2RF4A 3A7AB 2E2JB 3FKIG 1CUKA 2RBMA 1SFOH 2I5MX 3A0JA 3K80C 1R9TB 4DK6C 2FHTA 3H0GG 1PV4A 1IW7C 2YTXA 3D4DA 1TT2A 1UEBA 2AQ2B 1G6PA 3E9HA 2G9HD 4DV0L 1I94Q 4JV5L 4BA1I 4GKKL 2NN6H 4K0KQ 2CHBD 3I73A 4B08A 2UU9Q 4FF1A 3FP9A 2UUCQ 3GTGB 1X6OA 4IPGA 5C3EH 1D6EC 1S5BD 1WJJA 1NSNS 2A6HD 3FKIB 2BH2A 3I72A 2Z4HA 1DXMA 2MUYA 4IQZA 3FPPA 4DU9A 5C44H 4X3SA 3H3VH 1EFID 1QZGA 3S15B 1PFSA 3FHWA 3H0GB 2F0EA 3OOCA 1SNPA 3STBC 1BCPD 3JAMi 3K5MA 1CKMA 4WRDA 4XQJA 3I4MG 1WTWA 1Y1VG 2JA9A 2UXDQ 1R4QB 1SRUA 1V1OA 4RGTA 1E22A 1FNWA 2N55A 4IFDJ 2C35B 3MFYA 2JK8A 1EYDA 3VYSA 3UE1A 2DJGC 5I2YA 2LFNA 5EBCA 4DV4Q 2NZ1D 1GUWA 1BBXC 2KCMA 3Q0AA 1KHIA 4DR2Q 1PRTF 4LF7L 3L3OC 3I3CA 3I4MB 3OWFA 3SDZA 1Y1VB 4FO2A 5A2QL 1VDZA 1Q82C 3S2HB 5F2DA 2JA8G 2H4OA 1HZ9A 3CPFA 4Y52H 1VQFA 4MN3A 2YU9B 4FF2A 4OO1I 3HOXH 3HOWH 3D4WA 4L5QA 4R4QA 4DV1Q 2E2HB 4FDBA 5DM63 3M9BA 2ATWA 2N78A 2KOLA 1PZKD 1RHPA 4RCNA 1VQ4A 2VQFL 4JVZA 2AQ3B 4HEDA 1NAPA 3BVMA 4G4KA 3NPPA 2NVYB 3KUPA 3S1MB 2A19A 1FNUA 2A8VA 1VQPA 1AH9A 1TQOA 1CKNA 4UAIA 3SEBA 5M5XB 4A3MH 4FF3A 2OTJA 1VQBA 3K81C 3MHBA 1AN8A 1SDFA 2JA8B 3BZDB 1EZ8A 2F0QA 4HJ8A 2JSOA 4ALPA 1ET6A 4X65Q 2D9UA 3A54A 4PMWA 4LUZA 1I3QH 1SXTA 1NUCA 1SAPA 1QG7A 2QA4A 4Y7NB 3MA2B 5E1FA 1GJXA 3NHHA 1QUQB 3SK4A 1B8AA 1YNXA 1KC8C 5BN4A 3LNNA 3KF6A 2B2WC 5IWAQ 3K0YA 5M3MH 4B3RQ 1PYSB 3MXGA 2K5VA 5GROA 4DR3L 1IKMA 2E2DC 1NTGA 4R4IA 4PZ6A 3KOJA 3DM3A 1U4RA 4DV6Q 1EY8A 5AJ3L 3VA7A 3KLRA 4HIOA 1IBMQ 2RDGA 1JOQA 1UNSA 3S9WA 4ZCKA 3RZDB 3CD6A 4A3LH 3UDFA 2NVTH 1JE4A 3ITPA 3JC66 5HGQA 1E0BA 3H91A 1CQVA 2JP1A 3S1QB 1EY4A 1I50B 4P71A 5D14A 3H6MA 3PO2G 1X3PA 4KLKA 4FXDA 4A3BG 3H94A 1K0SA 1HJPA 1DGSA 5EQ0A 1HTLD 1KDBA 2F0MA 4RH6A 4HCSA 3J7AF 5BN5A 1I4XA 4XT1B 1CA6A 1WCMG 2AKWB 1YITA 2EE1A 1PTOB 5G3LF 3CCLA 3HOUH 2K14A 1HR0W 1A15A 3CCRA 3HOZB 3S17B 4DKAC 3I4OA 1WD1A 4B9XA 3K57A 1PTOF 3CRLC 1TR5A 2JA7G 4QUFA 1EY0A 2ENBA 4KKSA 1B4OA 4DR5L 5IT9c 1N33Q 4HIDA 2MO1A 4DR7Q 2XTIA 3MEFA 2IY5B 3JAMc 4A3BB 3GTLB 5JEAH 2F0IA 4RFBA 4HIMA 5IOCA 2EJGC 4P2CB 4A93G 1EUJA 1Q12A 1SYCA 5FJ8G 1K9MC 4RMFA 3KJOA 1WCMB 4A3JG 4DNRB 1PFNA 1Y1WH 2R6GA 5I2XA 3G6EA 1B2TA 1UUPA 4RHRA 1KLUD 1SLJA 1WOCA 2NZOA 4BXXH 3FPUB 1YNNC 1XMQQ 3NWSA 1BVSA 4M8AA 3I55A 1X54A 1GM5A 4JI4L 3F8TA 3IRBA 3A8KE 2L55A 3MXNB 3EIVA 4ZYSA 3K6OA 1QVGA 1XWEA 4A93B 3Q24A 3HOVG 3U9SA 1EL0A 4MIUA 4ID6A 5GAEC 4A3JB 1HCZA 1NBWA 2XSCA 4X66L 1B7YB 4RHSA 2DUDA 4V190 2VW9A 2CWAA 2WP8J 1SJED 3NELA 1EY9A 1NR2A 3GO5A 4DA2A 3VA5A 4PZ8A 3QB3A 3A55A 3DLLA 4NKLA 4IALA 2K75A 4DN4M 4KHPL 3GD7A 3K8AA 2WAQE 2F0NA 4DV7L 1QWYA 4N8X1 2VQEL 2SOBA 1A3UA 5C6AA 2L1BA 4K6DA 3WOEA 1V43A 1N8RC 1DD2A 1T5XD 3EJIA 3D3RA 3HOYH 3GTOB 1SR3A 1C7YA 3EBEA 2HUGA 3QG1A 5IY0A 1TWAH 4FXKC 3AFQA 5JEAJ 3MEHA 3BU2A 2CCZA 1BOSA 4DV2Q 4CKCA 1EOVA 5LMUQ 3CHBD 3NENA 2WAQG 1FNVA 3IFDA 3OPOA 4NXMQ 4KJOA 2FFKB 5M5YB 1SYBA 3AFPA 3MXPA 2R92G 4XYOA 1L1OA 4B3SL 4HN7A 4GNXC 2VUMH 4BY7H 4H0LC 3U58A 3Q23A 1I4HA 1EQRA 3GTPH 4A3EH 3OWEB 5EBDA 2EYJA 2KQ3A 3CP0A 1SBBB 3Q6SA 1KTKA 3HS0C 5HGTA 1FR3A 3CF5A 1Q90A 1HTPA 1K28A 1SNCA 1JOKA 3SVMA 2K4KA 5I6WA 5ELFA 3K59A 2LS01 4ME3A 5DAUA 1IBKQ 1TY2A 4IUVA 2WAQB 1XPOA 3CAMA 2UUBL 1AW7A 1SN8A 5JJZA 2OT2A 2NVXB 3URYA 1MI2A 2R92B 4C3IH 1O7LA 2K6AA 2PPBC 1LABA 4QL5A 3H09A 1HNZL 2PNHA 3GV3A 4DAVA 3PGZA 4RA8A 3G7LA 1XMOL 3BYYB 1CHPD 4LF9Q 1WD0A 1ASZA 5JPMC 2K33A 4YY3Q 1CI3M 3GDEA 2F0KA 3VYRA 3MAQA 3G48A 1ENCA 1UE5A 1JB3A 2EYMA 1HHVA 3S16H 3EFXD 1MIUA 4RKLA 2IL8A 2RDFA 2HHHL 2UUAQ 4PMCA 5E4XA 5CORA 3RN5A 5FLXL 2Q2TA 1VQ7A 5C0XG 2KJXA 3MXUA 5CV7A 3M3YH 3RZOH 5I9OA 2B2UA 2JN4A 1GO3E 5BR8Q 1U4LA 3CKIB 2B2VC 4JI8L 2EVBA 2Z6KA 3RLNA 1BNZA 1PZID 1KLGD 4BS9A 2IHFA 2LXJA 2WIIB 5I4DA 4IOAA 5KEEA 1IHZA 4JOIA 3ULPA 3NBHA 1PLFA 3CW2C 4LJZC 2BDOA 4LFAQ 4A76A 2G9DA 5C4HA 5ELOA 2LSSA 3VR4A 3NQTA 4G7HC 1U0LA 3SHLA 2F4VQ 4NXNQ 2N8NA 4DV5Q 1DYQA 4KN4C 3T1YL 3U4ZA 1SNQA 2NTTA 2HCCA 1LTAD 1KABA 3DWAA 5C5MA 4DUYQ 3DUZA 3FDTA 4P75A 4OWXB 5IIFA 2PI2A 3G6JB 2CQOA 4YWKA 4WORA 2A6EC 3ULJA 1SE8A 1ASYA 3KFUA 1TWFB 2NVQH 3GQBA 2PNRC 1VQMA 1H9SB 4CDFC 4V0BA 2EY5A 4XXEA 1PYBA 2O2LD 2K32A 5EPLA 1GUTA 5IGFA 3DHQA 1I94L 4KD3A 3T51B 1X3EA 4X62Q 1ZXTA 2XGTA 4K0KL 4QMGA 2QILA 4DUZQ 4YHHQ 2UU9L 3NUCA 2UUCL 5D65A 5DLQE 3DEOA 1PRTC 5ELEA 3GTQH 5JJLA 1OXSC 3PIP3 4A3DH 5IT9L 1RF2D 1MSGA 4H13C 1A3TA 4RWSC 2PCFB 2NWGA 1BF4A 1XPUA 2GVBA 4OXPA 3LGJA 1HNXQ 1SYFA 4POGA 4O0AA 3E9IA 5JPNC 5E4WC 4YCWA 1E24A 2Z0SA 4BBRH 2K03A 3F2BA 3T13A 2UXDL 4C3HG 5JVG3 4LF5Q 1L2FA 4IJHA 2DJFC 2K5WA 3KLSX 1HR0Q 4DK1A 1PVOA 1ZEQX 2RHSB 4HJ5A 4R8IA 4MZ9A 4RG1A 1SYGA 4C3JG 2EYFA 3K7AB 5EKKA 4DV4L 4A3CH 4OIKA 4HTHA 4I7AA 1WTOA 2MO0A 2K01A 1IL2A 2VNUD 1TWGB 2HDLA 1TWHH 1Q8IA 1A63A 3ERQA 2KUMA 3V05A 3ZJYC 4DR2L 1FVIA 1CFMA 5IGGA 3A5UA 3NEMA 2B8GA 1N34Q 4C3HB 1QE6A 1X3FA 4I7ZC 1RDPD 2JA5G 1RTNA 1HNWQ 4LWCA 4L63B 2FMCA 1QILA 2F3WA 3S1NB 2B2TA 3E0EA 3FMCA 1IYVA 2RKSA 3KF8A 1AZPA 4C3JB 4GNXB 4DV1L 3I4NH 3J7AV 3CCJA 1VQDA 3ONAB 5JVH3 1ENFA 2K1BA 4QQBX 4DR6Q 4IURA 5IGCA 1K3RA 1QVCA 1BUVT 2AUJD 2EYPA 4CDDC 4IN3A 4APVA 4YWLA 3TQYA 3TS2A 1I4QA 2F0UA 1HA5A 1KQSA 1A3VA 3BZKA 3AYHB 2JA5B 5C3WA 2L0CA 3F2CA 3CCSA 3AU7A 1D5ZC 2WV6D 4X65L 1Q1EA 1KL9A 3UDXA 1PH8A 3VR6A 5TSSA 2K28A 4AQYQ 3MXNA 1DJRD 4N9TA 4JW0A 1XXGA 2ES2A 2PZWA 3AQQA 3KDFB 2A68D 1F2ZA 3TP6A 2R93G 2JA6G 5M3FH 5E3FA 5IWAL 4B3RL 3A7LA 2IHEA 1I5FA 5CV5A 2OWOA 3M7GA 4DV6L 3KBXA 1IBML 1K8OA 1YVCA 3PO3H 1RJTA 1A2TA 1CK1A 1S5FD 4OX9Q 4UPAA 3SR1A 4KY5A 4GZYC 2UXBQ 3PCOB 3GV6A 2A5HA 2MNAA 2R93B 1N36Q 1HZAA 1TU2B 2JA6B 1DOMA 3CMEA 2WB1E 3BVGA 4L5SA 4A3IH 2HT1A 1YNJD 3D0FA 1EY6A 3GTMH 1YJWA 2EIFA 1BBUA 4HJ7A 5GQOA 4X3UA 5FLMH 1J8IA 4KMUC 2H1EA 2V4DA 2F0HA 1B9MA 3PIO3 4LW1A 3K5LA 4KV6A 3OW2A 2L11A 3P20A 3SXHA 1AE2A 5C4XG 1Z47A 2F0OA 1N33L 1DOKA 4DR7L 4EQPA 3DMUA 1FD7D 5M5WH 3CCQA 1UWVA 4DAPA 5KYIA 1TS5A 1PTOD 1K73C 2PQAB 1SMYD 2MQHA 2A69D 1A6XA 4YCVA 1PH4A 1PRTB 4WJWA 3NBIA 2B63H 3P1HA 3TP7A 5IT9E 3BZCA 4CJ0B 4A3FH 1AP0A 2JEAI 1KDAA 3NWTA 1T9HA 3JAME 1EYCA 1OXXK 4NP5A 1HRJA 5EPKA 1EQQA 3S2DB 1IW7D 1JE5A 1XMQL 2IT1A 3IFTA 5C4XB 5FKAC 4JBWA 5IYDH 1YJ9A 1Z7TA 1LV9A 1EFWA 1JT8A 1M1KC 3V96A 2WB1B 2RQXA 3RN2A 1TWCH 5KNBA 1I6HB 4RAUC 4JI7Q 4GKJQ 3CMAA 2R7ZH 5DEHA 2BDNA 3NTKA 1EOTA 1S4ZA 3WDNA 4CGYB 5FOBB 5FO9B 5LL6X 1STNA 3TMEA 1EQTA 4JBKA 3STBD 1VQHA 2K5NA 4KHVA 5L37A 2EYOA 2F0JA 3E3XA 3HEJA 1MKHA 4ZRZA 4KKUA 2BH8A 2DY7A 5FLXc 4TKOB 4FNFA 4ZLTF 3NSWA 3OMGA 2E5LQ 2WACA 4B3MQ 2JQOA 2SEBD 4LNQA 4N8FA 1TS2A 4C2MH 2QKIC 3RLOA 2XIWA 1K83B 1UE1A 4BWGB 4GLAC 3GTKH 5IP7G 5IP9H 3LWUA 3F1ZA 4WJ3M 2E75C 1LUZA 3K5NA 5C4ZA 1QCBD 1DM0B 2KCNA 4DV2L 3HOZG 4DAMA 5K36H 1GD7A 3A8IE 1H9KA 1KDCA 1JC7A 5LHY1 1GUSA 2X6GA 5LMUL 3J80c 1VQJA 4JK1C 4NXML 1QJOA 1IYUA 1HXYD 2KEEA 5EAYA 1U4MA 2F0LA 2Q2UA 4A3KG 2F0SA 2B39A 2SDFA 2VL6A 2F3IA 4CDCC 1R4PB 1JMCA 3M4PA 1QVFA 3NP8A 3MTSA 5GADC 4HMIA 3NTIA 1PH1A 1OXTA 4RGNA 3S1RB 3CC2A 4JI5Q 1CHQD 3H3VC 2E2IB 2DY8A 2ZJQA 4BBSG 1W3SA 1JJGA 2NUCA 4B3TQ 1VQGA 4XTCS 1Z9FA 1BCPF 1IBKL 1U4PA 1SMXA 1VMCA 2PZUA 4IOCA 3AMUA 4J8QA 3PIPA 1SYEA 2K5HA 5C4JH 2QGQA 2NVQB 1DOLA 4A3KB 1KNAA 1BXTA 1B1ZA 3LWEA 4GOPA 2EXZA 2CW0C 1VQOA 1Y8PB 3WWVA 4LF9L 2L15A 4YY3L 4M1UB 3T56B 4BBSB 3GTQB 3GTJH 1VQKA 3SGIA 5LMNQ 1WVLA 4A3DB 1RKNA 4BY1G 4FXGC 1KAAA 3DEPA 2UUAL 1C4QA 4R4OA 5CMDA 4GN4B 5JJIA 4K2LA 1MGSA 1T5EA 2KBNA 3BS1A 2OTLA 1V1PB 5BR8L 3C2PA 1MD2D 3UI2A 1LT6D 4RKBA 1STHA 2JJQA 2EJFC 4IUPA 2E2JH 4LF4Q 3A5ZB 2N49A 1O7ZA 4JI1Q 2JYOA 1R9TH 3L7ZC 4ZUJA 3HP3A 1M90C 4BY1B 4LFAL 4U673 2O5JC 1G91A 1GHKA 1STAA 3C3LA 3UDIA 4NXNL 2F4VL 1ILPA 4DV5L 2CH4W 1TS4A 2E74C 2LXKA 4A3GG 2HQLA 4OO1H 3R2TA 3VDYA 1BKBA 2ZXOA 3GTGH 4IPCA 1ET9A 3S14B 4DUYL 3OIPA 4DV3Q 3F2DA 3CC7A 4R9WA 3EA6A 5ELCA 2RVLA 4QJFA 5A2QE 1II3A 3FKIH 1YIJA 1X55A 3Q8DA 2R61A 5HY6A 4HSPA 5IYBG 3J81c 4DNIA 3H0GH 1JWMD 1Q3LA 1E1TA 2D2CC 2X69A 4X62L 2EXDA 4GN5A 2EYHA 3I4NB 3TDQA 1B70B 2J0TD 4DUZL 4YHHL 4A3GB 5IYCG 1PFBA 2NBFA 2RSOA 4DAYB 1SNDA 2EQSA 3NE5B 1D7QA 1YNND 1KNEA 2EY1A 4H44C 5ELDA 5K5PA 1RODA 1JJCB 2PZTA 2Q2IA 1N9WA 4TQUS 1HUMA 1TY0A 1HNXL 1E2ZA 1EQVA 4OELB 4E6IA 1V8QA 2PW5A 3W3AA 1PMRA 3N6RA 2O4XA 1ESRA 1TXYA 3ND8A 4Q0FA 4ODGA 4NW2A 1IL8A 3CU7A 2YTYA 1EYGA 3M4OB 2AWOA 2BA1A 4GN3B 4LF5L 3I4MH 2QEJC 3K58A 2NN6G 1Q86C 4JI0Q 1Y1VH 4O1NA 4G7OC 1A62A 1HR0L 1J5EQ 2DNCA 3EVQA 3TREA 1LO5D 4F7XA 4O2DA 5J1ZA 5C3EG 3BG3A 3E6ZX 5EKLA 2YU9H 4R8NA 2D62A 3BDLA 4JI3Q 4LF6Q 1SFOB 2E2HH 1LTBD 1S5ED 1FL0A 3CCEA 5C44G 2I07B 2Z8LA 2DGYA 1FGBD 4RCOA 1S3OA 1F9PA 3S1MH 2XNAC 1GXDC 5H1SE 1N34L 5T1GA 3CCUA 1W2BA 4EX5A 5M5XH 1AE3A 1HNWL 3K0XA 2CVRA 1WI5A 3N52A 4GS3A 2ZM6Q 4J1MA 4DR4Q 2JA8H 3PIOA 4L5TA 1PDQA 5C3EB 4EQNA 3QO2A 5A35A 1PH5A 1S5CD 4A3IB 1PH6A 5DNFA 1JOOA 3MZ5A 4Y7NH 1Q46A 5C44B 4R1JA 4DR6L 2DNEA 1WTXA 4P73A 4QCLA 3PF4A 4QB4A 3UE0A 1WFQA 4JYAQ 5JAVA 4EGVA 3RLFA 1AZQA 1CKNB 1Y69U 2IX3A 4K8IA 4G57A 2HIVA 2K05A 2Q8IB 3ICEA 2RA4A 4CJ1B 4QUCA 1L1OC 3DM1A 1LYLA 2XWJB 4UP7A 1EWCA 2MP1A 4QGUA 3AEVA 4AQYL 4DF7A 3OW7A 3J81j 3HOXG 3HOWG 3MVVA 5CBAE 1VMPA 4LAAA 4EVOA 1IKLA 1SEBD 4YWMA 2AWNA 4DK0A 3S1QH 1EYAA 1I50H 3J80L 1Q8KA 3KF6B 1O78A 3X3NA 3R8BA 4KJNA 1FJGQ 2F1MA 5HURA 1JICA 4ZKBB 3CQZH 4K14A 5EKIA 3P75A 4A3MG 1WTPA 3DWPA 4IZ8A 2IX0A 4DR1Q 1A0IA 2LY7A 2JE6I 2BE5C 1X9NA 4OX9L 3HG9A 2RHQB 3VR2A 3HOXB 3HOWB 3TEHB 2SNSA 1BQQT 5D3IB 3HOZH 1V1QA 5KYLA 1CTMA 2UXBL 1K3BC 1N36L 4L6TB 1HPCA 2XVSA 3PO2H 2AMCB 1QUQA 1OTCA 3VR5A 4NDXA 5M3MG 1VQ5A 4A3BH 3KK7A 1S5DD 1HUNA 1D2BA 2EY6A 5AFWA 2MGSA 1VQ8A 4A3MB 3B6YA 1WCMH 3MWYW 2Z6KC 1K0RA 3NK9A 4HJAA 4QIWE 1ZYRC 1OXVA 5EGTA 4MHEA 1I3QB 4A3LG 1Q1BA 4K8JA 4PG3A 2ZTCA 3C46A 2JA7H 3L0OA 4JOIC 5GAGC 2FJ2A 3DWQA 2A1AA 1ZKOA 3ERSX 1KD1C 1SE4A 2EDGA 2GVAA 2PO4A 3TZDA 3D31A 5M3MB 3OMCA 1LTGD 2MJ8A 1DZ1A 5C0XI 2F0PA 3T16A 4B3SQ 4A93H 2WINB 5KRUA 2XRQD 1CSPA 3U4VA 5J39A 5FJ8H 2UXCQ 4JCVE 3RR5A 1CKOA 3CRKC 1WTQA 5FO7B 4A3JH 1VQNA 3PQIA 2A6ED 1TVXA 4B9WA 1EY5A 2B2YA 2XRSD 3D6WA 2NVTB 3C1EA 4X3TA 2ALYB 4O42A 3OYYA 1EZ6A 2VB2X 4PV1C 1IZ6A 2PYKA 1RIPA 3PSIA 1O80A 1IBLQ 3EROA 4ZAIA 1LACA 2BOSA 1XYIA 4KY6A 1F2YA 2B8FA 2M00A 2PQEA 3WOFA 1PRTD 1XNRQ 5J22A 3HOVH 3V2TA 1JJ2A 5J3BA 2F03A 4JI7L 4GKJL 1B3AA 1EIHA 2DN8A 3TRZA 1STGA 3OHXC 3PMFA 4OIJA 3HOUB 3M4QA 4QIWB 4PNYA 3J81L 2OXPA 4YCUA 1L0WA 2JEBI 3VYUA 2K5QA 4BXXG 4IPDA 1MHWC 4XDXA 3GTOH 2Y0SE 3W1BA 2A6HC 2OCEA 2WFWA 2VXWA 3TZUA 4JBJA 2K04A 3BJUA 1J6QA 3PUYA 2EYLA 3TSSA 1X3GA 2E5LL 2KCCA 1BCPC 4B3ML 4I65A 4HJ9A 1JCKB 1TIID 5M5YH 1EEID 5I6YA 4CBVA 4Q5VA 1LLRD 2Q2HA 1YHQA 4IUUA 1Y1WB 4ZK9B 1P8LA 4CHTB 5FLXE 1ML0D 3J80i 1B9NA 1EEFD 5IGBA 4F87A 2CFMA 2NZHA 1HA6A 4P72A 4FYDA 4HSVA 2IWHA 4WFN3 4GLVB 3FVQA 3EQLC 4OL7A 3R2IA 2F52A 2B2TC 1L1OB 2KEDA 2NVXH 2R92H 1B50A 1LT4D 4MNOA 1QOHA 2ZTEA 3FEWX 1E7ZA 4RGMA 1XTCD 3SK6A 4PQXA 1G291 1RL2A 1GVPA 4BA2I 2YYZA 4GLXA 2D0PA 4JI5L 3P7JA 3IKJA 1C9OA 3HOYG 2RSNA 3J80E 4LFCQ 1OXUA 4XYQA 2Y0SB 4K6LA 1ICWA 4B3TL 2GA4B 3SK5A 4C1NK 2KA7A 4TRDA 4DAYA 1GOZA 2PMZE 4ILWA 4JPBW 1EY7A 2AUKA 1KIXA 1D1KA 4KI0A 2ZXRA 1K8AC 4JI6Q 1F77A 1VCIA 4KD4A 5DM73 1I4PA 5G3LD 2X6LA 1K8MA 4IJLA 2R3ZA 3I90A 3CCVA 4POFA 1WTVA 1X56A 2PI2E 2WB1G 2B3GA 3W2DA 2V1CC 1BR9A 2VS1A 1B53A 2KVMA 4LK1C 2VUMG 4BY7G 3H15A 3HOYB 1X65A 3C1FA 1XX8A 1G2TA 2L5TA 1YI2A 2FMMA 4A3EG 5LMNL 1E2WA 5M9OA 4A75A 1TWAB 2A73B 2L4NA 2M2LA 3DXJC 2B2WA 5JOBA 2C9OA 3T1HQ 4Z9CB 4PMBA 5COYA 1CQFA 1N32Q 4JI2Q 1SROA 4FP5D 5C0XH 4OWWB 3KBGA 1JWSD 5C3XA 4C3IG 2TMPA 3D8GA 1ENAA 3PUWA 2BA0A 1OO9B 4LF4L 2VUMB 4BY7B 1UEAB 4LUVA 1UE7A 1CZWA 3OTOQ 4JI1L 3GTPB 3NBHB 1QNKA 3D6CA 4A3EB 1EIFA 1TWFH 1GUNA 4CKBA 4K5WA 1XNQQ 2KHIA 3U9OA 1GHJA 2R7DA 1FGUA 2PMZB 1LTTD 2QDBA 4X6AH 4N9PA 4P74A 1GKHA 4KK7A 5CBEE 2F0DA 4DGZA 5CV4A 4NMZA 4WJ4A 4C3IB 4DV3L 1HZBA 3VR3A 5NUCA 2KECA 2YV5A 3J81i 3M4YA 1W6JA 2OQ0A 2QCPX 2M9VA 4LF8Q 1Y14B 1G51A 2RDHA 4LFBQ 3QWNA 3J7A5 1L0XB 4UP9A 2K52A 4G7ZC 1HFGA 1NE3A 4KHZA 4JC0A 2I0QA 3S16B
chains in the Genus database with same CATH topology
5ELBA 3R3OA 2D5DA 4LMQD 4F8MA 1J9OA 1DONA 1STEA 1JR0D 3M3YB 5T1IA 3RZOB 1O7YA 3J81E 2IPKD 1LTID 4ULLA 4KY7A 5CYUA 1A2UA 2F0GA 1I6VC 3PV0A 3FRPB 1H9SA 2HDMA 2ZT9C 4K5XA 1F2MA 4KN7C 1QB5D 2PW7A 2K5DA 4S3SA 3NTHA 4YIJA 4ABNA 2F0WA 1H9JA 3I8ZA 3PUVA 1BCPB 1X32A 5C0XJ 2J7ZA 1X3QA 2Q8TA 3RMHA 3RUZA 3TP5A 2ZXPA 3CQZB 2HQEA 5C5LA 1U9RA 2LKVA 2OEOA 4IUTA 3ND9A 1SSOA 2AQ1B 3OIQA 3SE0A 4ME5A 2IX1A 2F0VA 2L12A 3PO2B 3RD4A 1JQYD 3TP8A 1TS3A 4DXGA 1ILQA 1M8AA 3NQIA 3BDOA 3PUZA 1MSHA 2EPBA 3MFGA 4BBRB 1F2LA 3F2UA 4TSSA 3A56A 2JA7B 3M85A 4C1NI 1SJHD 2EOTA 1DCZA 4F88A 4K5VA 2F0FA 1G8ZD 3SK8A 3K5OA 3L9AX 1GUGA 4IFDG 2FINB 4X3KA 1TWHB 3HZXA 4DXFA 5KGUA 2F4IA 1H9RA 2A74C 3HKZB 3M7NA 2CW0D 1EIGA 1TKWB 5KNDA 3BDCA 3QIAA 2E76C 1NCVA 4U68A 3VYTA 4FF4A 3HOVB 3PUXA 5CV6A 4J6HA 1BDOA 4C56C 1RD9D 1LT5D 3I91A 3QOLA 3IL8A 3J7YW 1W6KA 1BO0A 3E5SA 1PXUA 1GUOA 4CKEA 1HFNA 2B2VA 1EU3A 2ICEC 2VB3X 2QF7A 5M3FB 1NR4A 3Q22A 4EQOA 5KIXA 3MC0B 4HAEA 1I4RA 4KTAA 3PO3B 2XN9C 2KHSA 3I70A 1QNUA 1D5MC 3T53B 4RGOS 3E0JA 1VF7A 2CQAA 5FK9C 2Z4IA 5CV8A 4OHJA 4UDUC 2LMCB 4IFDI 3GTMB 5ISRA 3D4RA 2Z1CA 4QF4A 1G6ZA 4FVMA 2EZVA 2L9HA 5LL6S 2XWBB 3I4LA 4HCEA 2MPMA 2J4XA 3A8JE 5IODA 5EJWA 1UAPA 2N88A 2NB0A 5D3DA 5M5WB 2OF1A 3X3MA 1F9QA 1WTRA 2B63B 3TBIB 4A3FB 2WKDA 4HMJA 1AFPA 1E2VA 4XT3B 3T4AC 1HQMC 1CZGA 1SYDA 4K2KA 2I46A 5I9PA 2F3VA 2EY2A 1C8CA 1SE2A 2C5CA 1B44D 1PTOH 1STYA 2NN6I 1PYWD 2IJ0A 4DNTB 1TWCB 4IUNA 4CJ2C 5BN3A 5CR3A 2R7ZB 3R93A 5EPJA 2WKCA 1PFMA 5IGEA 1SNMA 4OGQC 4H7BA 2B2UC 5KNCA 1F9RA 1SNOA 5K36G 4IUQA 3JAML 1LTSD 1CA5A 3ZYYX 1EU4A 1LTRD 4C2MB 2IW3A 3KLSA 1C48A 1STBA 1Y8NB 4DFAA 4XIGS 1VF5C 1D1IA 3GTKB 3AB9A 2Q8RE 2A68C 4AYBB 4ZKCB 1JORA 1EWHA 3HGBA 2F0TA 5CV9A 1SE3A 2BE5D 1AEXA 5CGKA 2NTSA 2K7VA 4ZUIA 1LT3D 5IGDA 5JEAG 1Z6HA 2EJMA 2SNMA 4L8JA 1CM9A 1PZJD 3QOJA 2BCOA 1I4GA 3O13A 1ESFA 2ID0A 4XQQA 1HQRD 3BVZA 4ZQ3A 1Y8OB 1RTOA 2MHVA 1ZYRD 3NXWA 4XQNA 2JXMB 5C4JB 2HCIA 1F9SA 4IFDH 1YNJC 1V1PA 2TSSA 3IAYA 1FYCA 1ONLA 1RCVD 3GTJB 1L0YB 5CC4A 3OSOA 1G2SA 3QJYA 3TN2A 1D5XC 5FO8B 3HRZC 4OO1G 3BYTB 2O5IC 4KKTA 1CT1D 3LX0A 2NYZD 1MBYA 2ICIA 1PTOC 1M4VA 1H9MA 1SMYC 3GP7A 4HR7B 2B2YC 2A69C 1JWUD 3A7AB 2E2JB 2RBMA 1R9TB 2FHTA 1IW7C 3D4DA 1TT2A 2AQ2B 2G9HD 4BA1I 2NN6H 2CHBD 3I73A 4B08A 4FF1A 3GTGB 1D6EC 1S5BD 1NSNS 2A6HD 3FKIB 3I72A 2Z4HA 1DXMA 2MUYA 4IQZA 3FPPA 4DU9A 4X3SA 3S15B 1EFID 3H0GB 2F0EA 3OOCA 1SNPA 1BCPD 3K5MA 4WRDA 4XQJA 1WTWA 1R4QB 4RGTA 1V1OA 1FNWA 2N55A 4IFDJ 3MFYA 3VYSA 1EYDA 5I2YA 2LFNA 5EBCA 2NZ1D 1GUWA 1BBXC 3Q0AA 1PRTF 3L3OC 3I3CA 3I4MB 3OWFA 3SDZA 1Y1VB 4FO2A 5A2QL 1VDZA 3S2HB 5F2DA 2H4OA 4MN3A 2YU9B 4OO1I 4FF2A 3D4WA 2E2HB 5DM63 2KOLA 1PZKD 1RHPA 4RCNA 2AQ3B 4HEDA 1NAPA 3BVMA 4G4KA 3NPPA 2NVYB 3KUPA 3S1MB 1FNUA 1TQOA 4UAIA 5M5XB 3SEBA 4FF3A 3MHBA 1AN8A 1SDFA 2JA8B 3BZDB 1EZ8A 2F0QA 2JSOA 1ET6A 2D9UA 3A54A 4PMWA 1SXTA 1NUCA 1SAPA 1QG7A 4Y7NB 3MA2B 5E1FA 1GJXA 3NHHA 3SK4A 5BN4A 3LNNA 2B2WC 3K0YA 3MXGA 1IKMA 2E2DC 1U4RA 1EY8A 3VA7A 3KLRA 2RDGA 1JOQA 1UNSA 3S9WA 3RZDB 1JE4A 3ITPA 1E0BA 3H91A 1CQVA 2JP1A 3S1QB 1EY4A 1I50B 5D14A 3H6MA 1X3PA 4FXDA 3H94A 5EQ0A 1HTLD 1KDBA 2F0MA 4RH6A 4HCSA 3J7AF 5BN5A 1I4XA 4XT1B 1CA6A 2EE1A 1PTOB 5G3LF 1A15A 3HOZB 3S17B 1WD1A 4B9XA 3K57A 1PTOF 3CRLC 1TR5A 4QUFA 1EY0A 2ENBA 4KKSA 1B4OA 4A3BB 3GTLB 5JEAH 2F0IA 4RFBA 5IOCA 2EJGC 4P2CB 1Q12A 1SYCA 1WCMB 4DNRB 1PFNA 2R6GA 5I2XA 1B2TA 1UUPA 4RHRA 1KLUD 3FPUB 1YNNC 3NWSA 4M8AA 3A8KE 2L55A 4ZYSA 3K6OA 1XWEA 4A93B 3Q24A 3U9SA 1EL0A 4MIUA 4ID6A 4A3JB 1HCZA 2XSCA 4RHSA 4V190 2WP8J 1SJED 1EY9A 1NR2A 3GO5A 4DA2A 3VA5A 3QB3A 3A55A 4NKLA 4IALA 4DN4M 3GD7A 2F0NA 1QWYA 2SOBA 1A3UA 5C6AA 2L1BA 4K6DA 3WOEA 1V43A 1DD2A 1T5XD 3EJIA 3D3RA 3GTOB 2HUGA 3QG1A 4FXKC 5JEAJ 3MEHA 1BOSA 4CKCA 3CHBD 1FNVA 3IFDA 3OPOA 4KJOA 2FFKB 5M5YB 1SYBA 3MXPA 4XYOA 4HN7A 4H0LC 3Q23A 1I4HA 3OWEB 5EBDA 2EYJA 2KQ3A 1SBBB 3Q6SA 1KTKA 3HS0C 5HGTA 1FR3A 1Q90A 1HTPA 1SNCA 1JOKA 3SVMA 5I6WA 5ELFA 3K59A 2LS01 5DAUA 1TY2A 4IUVA 2WAQB 1AW7A 5JJZA 2OT2A 2NVXB 3URYA 1MI2A 2R92B 1O7LA 2K6AA 2PPBC 1LABA 3H09A 4DAVA 3GV3A 4RA8A 3G7LA 3BYYB 1CHPD 1WD0A 5JPMC 2K33A 1CI3M 3VYRA 2F0KA 3MAQA 1ENCA 1JB3A 2EYMA 1HHVA 3EFXD 4RKLA 2IL8A 2RDFA 4PMCA 5E4XA 5CORA 5FLXL 5C0XG 2KJXA 3MXUA 5CV7A 5I9OA 2B2UA 1U4LA 3CKIB 2B2VC 2EVBA 1BNZA 1PZID 1KLGD 4BS9A 2WIIB 5I4DA 5KEEA 1IHZA 3NBHA 1PLFA 4LJZC 2BDOA 2G9DA 5C4HA 3VR4A 3NQTA 4G7HC 3SHLA 1DYQA 4KN4C 1SNQA 2NTTA 2HCCA 1LTAD 5C5MA 1KABA 3DWAA 3DUZA 3FDTA 5IIFA 3G6JB 4WORA 2A6EC 1TWFB 3GQBA 2PNRC 1H9SB 4V0BA 2EY5A 4XXEA 2O2LD 2K32A 5EPLA 1GUTA 5IGFA 3DHQA 4KD3A 3T51B 1ZXTA 4QMGA 2QILA 3NUCA 5D65A 3DEOA 1PRTC 5ELEA 1OXSC 3PIP3 5IT9L 1RF2D 1MSGA 4H13C 1A3TA 4RWSC 2PCFB 2NWGA 1BF4A 1SYFA 5JPNC 5E4WC 2K03A 3T13A 4C3HG 5JVG3 2K5WA 3KLSX 4DK1A 1ZEQX 4R8IA 1SYGA 4C3JG 2EYFA 3K7AB 5EKKA 4OIKA 4HTHA 1WTOA 2K01A 2VNUD 1TWGB 2HDLA 1Q8IA 3ERQA 2KUMA 3V05A 1CFMA 5IGGA 2B8GA 4C3HB 1QE6A 4I7ZC 1RDPD 1RTNA 4L63B 2FMCA 1QILA 2F3WA 3S1NB 2B2TA 3FMCA 1IYVA 2RKSA 3KF8A 1AZPA 4C3JB 3J7AV 3ONAB 5JVH3 1ENFA 2K1BA 4IURA 5IGCA 1BUVT 2AUJD 2EYPA 4IN3A 1I4QA 2F0UA 1HA5A 1A3VA 2JA5B 5C3WA 2L0CA 3AU7A 1D5ZC 2WV6D 1Q1EA 3VR6A 5TSSA 2K28A 3MXNA 1DJRD 4N9TA 1XXGA 2PZWA 2A68D 1F2ZA 3TP6A 5E3FA 3A7LA 5CV5A 3M7GA 3KBXA 1K8OA 1RJTA 1A2TA 1CK1A 1S5FD 3SR1A 4KY5A 4GZYC 3GV6A 2A5HA 2R93B 1TU2B 2JA6B 1DOMA 3BVGA 1YNJD 1EY6A 4X3UA 1J8IA 4KMUC 2H1EA 2V4DA 2F0HA 1B9MA 3PIO3 3K5LA 4KV6A 2L11A 3P20A 3SXHA 1Z47A 2F0OA 1DOKA 4EQPA 3DMUA 1FD7D 4DAPA 5KYIA 1TS5A 1PTOD 1SMYD 2A69D 1A6XA 1PRTB 4WJWA 3NBIA 3P1HA 3TP7A 5IT9E 4CJ0B 1AP0A 2JEAI 1KDAA 3NWTA 3JAME 1EYCA 1OXXK 4NP5A 1HRJA 5EPKA 3S2DB 1IW7D 2IT1A 3IFTA 5C4XB 5FKAC 4JBWA 1Z7TA 1LV9A 3V96A 2WB1B 2RQXA 5KNBA 1I6HB 4RAUC 5DEHA 2BDNA 3NTKA 1EOTA 1S4ZA 3WDNA 4CGYB 5FOBB 5FO9B 5LL6X 1STNA 3TMEA 1EQTA 4KHVA 2EYOA 2F0JA 3HEJA 4ZRZA 4KKUA 2DY7A 4TKOB 4FNFA 4ZLTF 3NSWA 3OMGA 2WACA 2SEBD 1TS2A 2QKIC 2XIWA 1K83B 4BWGB 3LWUA 2E75C 3K5NA 5C4ZA 1QCBD 1DM0B 2KCNA 5K36H 3A8IE 1H9KA 1KDCA 1JC7A 5LHY1 1GUSA 2X6GA 4JK1C 1QJOA 1IYUA 1HXYD 2KEEA 1U4MA 2F0LA 2F0SA 2B39A 2SDFA 1R4PB 3NP8A 3MTSA 4HMIA 3NTIA 1OXTA 4RGNA 3S1RB 1CHQD 3H3VC 2E2IB 2DY8A 2NUCA 4XTCS 1BCPF 1U4PA 1VMCA 2PZUA 3AMUA 4J8QA 1SYEA 2NVQB 1DOLA 4A3KB 1KNAA 1BXTA 1B1ZA 3LWEA 2EXZA 2CW0C 1Y8PB 4M1UB 3T56B 4BBSB 3GTQB 1WVLA 4A3DB 1RKNA 4FXGC 1KAAA 3DEPA 1C4QA 5CMDA 4K2LA 1MGSA 1T5EA 3BS1A 1V1PB 3C2PA 1MD2D 3UI2A 4RKBA 1LT6D 1STHA 2EJFC 4IUPA 1O7ZA 2JYOA 3L7ZC 4ZUJA 3HP3A 4BY1B 4U673 2O5JC 1G91A 1GHKA 1STAA 3C3LA 1ILPA 1TS4A 2E74C 4OO1H 3R2TA 2ZXOA 3S14B 1ET9A 3OIPA 4R9WA 3EA6A 5ELCA 2RVLA 5A2QE 1II3A 2R61A 4HSPA 1JWMD 1Q3LA 2D2CC 2X69A 2EYHA 3I4NB 3TDQA 2J0TD 4A3GB 1PFBA 2NBFA 2RSOA 1SNDA 3NE5B 1YNND 1KNEA 2EY1A 4H44C 5ELDA 5K5PA 1RODA 2PZTA 4TQUS 1HUMA 1TY0A 1E2ZA 1EQVA 4E6IA 1V8QA 2PW5A 3W3AA 1PMRA 3N6RA 2O4XA 1ESRA 3ND8A 4Q0FA 4ODGA 4NW2A 1IL8A 3CU7A 3M4OB 2AWOA 2BA1A 2QEJC 3K58A 2NN6G 4O1NA 4G7OC 2DNCA 3EVQA 1LO5D 4F7XA 5J1ZA 3BG3A 3E6ZX 5EKLA 4R8NA 2D62A 3BDLA 1SFOB 1LTBD 1S5ED 2I07B 2Z8LA 1FGBD 4RCOA 1F9PA 2XNAC 1GXDC 5T1GA 2CVRA 3N52A 4J1MA 1PDQA 5C3EB 4EQNA 3QO2A 5A35A 1S5CD 4A3IB 5DNFA 1JOOA 3MZ5A 5C44B 2DNEA 1WTXA 4QCLA 4QB4A 5JAVA 4EGVA 3RLFA 1AZQA 1Y69U 2IX3A 4K8IA 4G57A 2K05A 2Q8IB 2RA4A 4CJ1B 4QUCA 3DM1A 2XWJB 1EWCA 2MP1A 4DF7A 3OW7A 3MVVA 5CBAE 1VMPA 4LAAA 4EVOA 1IKLA 1SEBD 2AWNA 4DK0A 1EYAA 3J80L 1O78A 3X3NA 3R8BA 4KJNA 2F1MA 5HURA 1JICA 4ZKBB 4K14A 5EKIA 3P75A 1WTPA 3DWPA 4IZ8A 2IX0A 2LY7A 2JE6I 2BE5C 3HG9A 3VR2A 3HOXB 3HOWB 2SNSA 1BQQT 5D3IB 5KYLA 1CTMA 4L6TB 1HPCA 2XVSA 3VR5A 4NDXA 3KK7A 1S5DD 1HUNA 1D2BA 2EY6A 5AFWA 2MGSA 4A3MB 3MWYW 3NK9A 5EGTA 1ZYRC 1OXVA 4MHEA 1I3QB 1Q1BA 4K8JA 3C46A 2FJ2A 3DWQA 1ZKOA 1SE4A 2EDGA 2PO4A 3TZDA 3D31A 5M3MB 3OMCA 1LTGD 2MJ8A 1DZ1A 5C0XI 2F0PA 3T16A 2WINB 5KRUA 2XRQD 5J39A 3CRKC 1WTQA 5FO7B 2A6ED 1TVXA 4B9WA 1EY5A 2B2YA 2XRSD 3D6WA 2NVTB 3C1EA 4X3TA 4O42A 1EZ6A 2VB2X 4PV1C 2PYKA 1O80A 3EROA 4ZAIA 1LACA 2BOSA 1XYIA 4KY6A 1F2YA 2B8FA 2M00A 2PQEA 3WOFA 1PRTD 5J22A 3V2TA 2F03A 1B3AA 1EIHA 2DN8A 1STGA 3OHXC 3PMFA 4OIJA 3HOUB 4QIWB 4PNYA 3J81L 2OXPA 2JEBI 3VYUA 2K5QA 4XDXA 2A6HC 2VXWA 3TZUA 2K04A 3PUYA 2EYLA 3TSSA 2KCCA 1BCPC 4I65A 1JCKB 1TIID 1EEID 5I6YA 4CBVA 4Q5VA 1LLRD 1Y1WB 4IUUA 4ZK9B 4CHTB 5FLXE 1ML0D 1B9NA 1EEFD 5IGBA 4F87A 1HA6A 4FYDA 4HSVA 2IWHA 4WFN3 3FVQA 3EQLC 4OL7A 3R2IA 2B2TC 2KEDA 1B50A 1LT4D 1QOHA 3FEWX 4RGMA 1XTCD 3SK6A 4PQXA 1G291 4BA2I 2YYZA 3P7JA 3IKJA 2RSNA 3J80E 1OXUA 4XYQA 2Y0SB 4K6LA 1ICWA 2GA4B 3SK5A 4C1NK 2KA7A 4TRDA 4DAYA 1GOZA 4ILWA 1EY7A 2AUKA 1D1KA 4KI0A 2ZXRA 1F77A 1VCIA 4KD4A 5DM73 1I4PA 5G3LD 2X6LA 1K8MA 2R3ZA 3I90A 1WTVA 3W2DA 1BR9A 1B53A 2KVMA 4LK1C 3HOYB 3C1FA 1XX8A 1G2TA 2L5TA 2FMMA 1E2WA 5M9OA 1TWAB 2A73B 2L4NA 2M2LA 3DXJC 2B2WA 5JOBA 2C9OA 4Z9CB 4PMBA 5COYA 1CQFA 5C0XH 4FP5D 3KBGA 1JWSD 5C3XA 4C3IG 2TMPA 3D8GA 1ENAA 3PUWA 2BA0A 1OO9B 2VUMB 4BY7B 1UEAB 1CZWA 3GTPB 1QNKA 3D6CA 4A3EB 1GUNA 4CKBA 4K5WA 3U9OA 1GHJA 2PMZB 1LTTD 2QDBA 4N9PA 4KK7A 5CBEE 2F0DA 4DGZA 5CV4A 4NMZA 4C3IB 3VR3A 5NUCA 2KECA 3M4YA 1W6JA 2QCPX 2M9VA 2RDHA 3QWNA 1L0XB 4G7ZC 1HFGA 4KHZA 3S16B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R3O A;  1SNO A;  2F0S A;  3D4W A;  4K8I A;  3LX0 A;  4G57 A;  4B9W A;  4KJO A;  4F8M A;  1EY5 A;  2F0I A;  5IIF A;  5IGC A;  1SYB A;  4K5V A;  3NP8 A;  3MXP A;  5IOC A;  4WOR A;  2EYP A;  3SK5 A;  3C1E A;  3P1H A;  4HMI A;  3TP7 A;  5CV8 A;  1EZ6 A;  2F0F A;  1SYC A;  4TRD A;  3SK8 A;  2PYK A;  2F0U A;  1EY7 A;  2EYH A;  1A3V A;  1KDA A;  2EY5 A;  5C3W A;  2RBM A;  1EYC A;  3ERO A;  4NP5 A;  4DF7 A;  2NUC A;  5IGF A;  3DHQ A;  3MVV A;  4KD3 A;  4KD4 A;  1F2Y A;  4KY6 A;  4LAA A;  1TQO A;  2M00 A;  4EVO A;  2PQE A;  5C5M A;  1SND A;  1STB A;  3HZX A;  4KY7 A;  3MHB A;  2EYJ A;  4DFA A;  2KQ3 A;  3D4D A;  2PZU A;  4QMG A;  1EYA A;  5KGU A;  5J22 A;  2EY1 A;  3NUC A;  3V2T A;  4N9T A;  5HGT A;  5K5P A;  1TT2 A;  1EZ8 A;  2F0Q A;  1SNC A;  1JOK A;  2PZT A;  2PZW A;  1SYE A;  5I6W A;  1A2U A;  4QF4 A;  2F0G A;  5KYI A;  1F2Z A;  3TP6 A;  4K5X A;  5DAU A;  4KJN A;  1EQV A;  1F2M A;  1STG A;  3PMF A;  4E6I A;  1A3T A;  2PW5 A;  5HUR A;  1JOR A;  3C1F A;  4K14 A;  1NUC A;  5E3F A;  2EXZ A;  3P75 A;  2O4X A;  2PW7 A;  5IOD A;  3BDC A;  5CV9 A;  2F0T A;  5DEH A;  4YIJ A;  4PNY A;  4S3S A;  4ODG A;  5E1F A;  2F0W A;  2OXP A;  5M9O A;  3NHH A;  4IZ8 A;  1AEX A;  5CV5 A;  3SK4 A;  5CGK A;  1SYF A;  1NSN S;  4MIU A;  2OF1 A;  5JOB A;  4ZUI A;  5CV6 A;  4J6H A;  4ID6 A;  1STN A;  5IGD A;  4PMB A;  1RKN A;  3RUZ A;  2SNS A;  4DU9 A;  3TME A;  1KAA A;  5KYL A;  3TP5 A;  2SNM A;  1A2T A;  3EVQ A;  3QOL A;  2HQE A;  2F0E A;  4KHV A;  2F0K A;  5C5L A;  3T13 A;  5C3X A;  4F7X A;  2EYO A;  2F0J A;  1ENC A;  1EY8 A;  1SNP A;  1U9R A;  3HEJ A;  3QOJ A;  5J1Z A;  2LKV A;  2EYM A;  3D8G A;  2EYL A;  1ENA A;  2OEO A;  4K2L A;  5EKL A;  4HMJ A;  3SR1 A;  3E5S A;  4R8N A;  4KY5 A;  4RKL A;  1JOQ A;  3BDL A;  4WRD A;  4NDX A;  4I65 A;  3S9W A;  2RDF A;  1SYD A;  4K2K A;  5I6Y A;  4PMC A;  1EY9 A;  5I9P A;  2EY6 A;  1SYG A;  4RKB A;  4ZQ3 A;  1STH A;  2EYF A;  3D6C A;  3ITP A;  5CV7 A;  2F3V A;  5EKK A;  3OMG A;  2EY2 A;  3VA5 A;  3QB3 A;  5I9O A;  2WAC A;  4K5W A;  1EY4 A;  4HTH A;  1EYD A;  4NKL A;  4IAL A;  3H6M A;  4ME5 A;  3U9O A;  1STY A;  2F0V A;  3NXW A;  2QDB A;  2F0N A;  4N9P A;  1EY6 A;  3NK9 A;  4ZUJ A;  5EGT A;  4IUN A;  5IGB A;  3ERQ A;  3TP8 A;  5ISR A;  5CR3 A;  4J1M A;  4K8J A;  5KEE A;  2F0D A;  1STA A;  1KDB A;  4DGZ A;  5CV4 A;  2SOB A;  1IHZ A;  1A3U A;  2F0H A;  2F0M A;  4NMZ A;  5C6A A;  5IGG A;  4EQO A;  5KIX A;  4EQN A;  4K6D A;  5NUC A;  2F3W A;  5C4Z A;  4KV6 A;  4OL7 A;  5C4H A;  3NQT A;  3SXH A;  3EJI A;  3SK6 A;  3OMC A;  3OWF A;  3SHL A;  2F0O A;  1JOO A;  1KDC A;  3MZ5 A;  4KTA A;  2RKS A;  5CC4 A;  5IGE A;  1SNM A;  4EQP A;  2F0P A;  3T16 A;  5KRU A;  3OSO A;  4B9X A;  3DMU A;  5F2D A;  4H7B A;  1TR5 A;  1SNQ A;  5J39 A;  3MEH A;  1EY0 A;  2ENB A;  2F0L A;  4QB4 A;  1II3 A;  1KAB A;  2KHS A;  5JAV A; 
#chains in the Genus database with same CATH topology
 5ELB A;  2N3S A;  3R3O A;  4X64 Q;  4AIM A;  2D5D A;  4LMQ D;  4F8M A;  2P5Z X;  1J9O A;  1DON A;  1STE A;  1JR0 D;  1VQE A;  2HD3 A;  5T1I A;  3M3Y B;  3RZO B;  2CWP A;  1V9P A;  1O7Y A;  3J81 E;  4EQ5 A;  2IPK D;  1LTI D;  2R7F A;  4ULL A;  4KY7 A;  3K7A H;  1NMF A;  5CYU A;  1A2U A;  2F0G A;  1I6V C;  1TWG H;  3PV0 A;  3FRP B;  2D0O A;  1H9S A;  2HDM A;  2ZT9 C;  4K5X A;  1F2M A;  1JB7 A;  4KN7 C;  1QB5 D;  2PW7 A;  2QEX A;  4JI0 L;  2K5D A;  4S3S A;  3NTH A;  4YIJ A;  4ABN A;  2F0W A;  4C3H H;  4DV0 Q;  4JV5 Q;  4GKK Q;  1H9J A;  3I8Z A;  3PUV A;  1BCP B;  1X32 A;  1J5E L;  4QY7 A;  5C0X J;  2J7Z A;  3S1N H;  4A3D G;  1X3Q A;  2Q8T A;  3RMH A;  3RUZ A;  4C3J H;  4JI3 L;  3TP5 A;  4LF6 L;  2ZXP A;  3CQZ B;  2HQE A;  5C5L A;  1U9R A;  2LKV A;  2H5X A;  2OEO A;  4IUT A;  2I5H A;  3ND9 A;  1SSO A;  2AQ1 B;  1WTH A;  5GAH C;  4BBR G;  2VY3 A;  3OIQ A;  3ER0 A;  3HKZ E;  3I56 A;  2ZM6 L;  3SE0 A;  2JA5 H;  4ME5 A;  4DR4 L;  2IX1 A;  2F0V A;  2L12 A;  1KRS A;  3PO2 B;  3KF8 B;  3RD4 A;  1JQY D;  3TP8 A;  1TS3 A;  4DXG A;  1ILQ A;  1M8A A;  3NQI A;  4A3C G;  3BDO A;  3PUZ A;  1MSH A;  1C0A A;  2EPB A;  1H95 A;  4JYA L;  3MFG A;  4BBR B;  1F2L A;  3F2U A;  4TSS A;  3A56 A;  4LF7 Q;  2JA7 B;  3M85 A;  3HKZ G;  4C1N I;  1SJH D;  1VQC A;  2EOT A;  1DCZ A;  1PH7 A;  4F88 A;  3CXC A;  4K5V A;  2E8G A;  1YBY A;  3S24 A;  2CKZ B;  3HKS A;  3I4N G;  1BBW A;  1G8Z D;  2F0F A;  3SK8 A;  4GNX A;  4PZ7 A;  3K5O A;  4HIK A;  3L9A X;  1GUG A;  2R93 H;  4IFD G;  2FIN B;  3J7Z C;  2VQF Q;  2JA6 H;  4X3K A;  3RNU A;  1YJN A;  1TWH B;  3HZX A;  2MFI A;  4DXF A;  1FJG L;  4OWT B;  5KGU A;  2F4I A;  1H9R A;  2AHO B;  2A74 C;  3HKZ B;  3M7N A;  4DR1 L;  2CW0 D;  3S15 H;  1EIG A;  4J15 A;  1LTL A;  1TKW B;  3ULL A;  5KND A;  3BDC A;  4GOP C;  1XPR A;  1S72 A;  3QIA A;  2E76 C;  1NCV A;  2QW7 A;  4U68 A;  3KYH C;  3VYT A;  4FF4 A;  3HOV B;  3PUX A;  2Z6B A;  5CV6 A;  1B3Q A;  4J6H A;  1BDO A;  3KDF A;  4C56 C;  1RD9 D;  5M3F G;  1LT5 D;  1VQL A;  3I91 A;  1K8G A;  1PH9 A;  3QOL A;  4OEM B;  1A8V A;  5ELN A;  2K50 A;  3IL8 A;  3J7Y W;  4DR3 Q;  1E3P A;  1W6K A;  1BO0 A;  3E5S A;  1PXU A;  1GUO A;  1NY4 A;  5JJK A;  3PO3 G;  2G5D A;  4NPS A;  5AJ3 Q;  4CKE A;  3CC4 A;  1HFN A;  1CSQ A;  2B2V A;  3S2D H;  1EU3 A;  2ICE C;  2VB3 X;  3I7F A;  1EIY B;  3S2H H;  5C4X H;  2QF7 A;  5M3F B;  1PH2 A;  2ASB A;  1NR4 A;  3Q22 A;  4EQO A;  3HFZ B;  5KIX A;  4IO9 A;  3I2Z A;  4UHV A;  3MC0 B;  4HAE A;  4A3I G;  1I6H H;  2UXC L;  1I4R A;  4KTA A;  3PO3 B;  5FLM G;  2XN9 C;  2NVY H;  2KHS A;  3I70 A;  1QNU A;  1D5M C;  3T53 B;  1KRT A;  4RGO S;  3E0J A;  1IBL L;  1VF7 A;  2CQA A;  5FK9 C;  4DR5 Q;  4MTN A;  2Z4I A;  5CV8 A;  5E7N A;  2Z9H A;  4OHJ A;  2KCT A;  1XNR L;  4UDU C;  2LMC B;  1QZH A;  3KLW A;  4IFD I;  1Q7Y C;  3GTM B;  1NMG A;  2PQA A;  4OON A;  3K7U C;  2B63 G;  1Q81 C;  2ZJP A;  5ISR A;  2CH4 A;  4A3F G;  3D4R A;  1S40 A;  1YEZ A;  2Z1C A;  4QF4 A;  1G6Z A;  4FVM A;  2EZV A;  2L9H A;  1K83 H;  5LL6 S;  2XWB B;  3I4L A;  4HCE A;  4DK3 C;  2MPM A;  2J4X A;  3A8J E;  5IOD A;  5EJW A;  1UAP A;  1YZ6 A;  5IYD G;  2N88 A;  1U5K A;  2NB0 A;  2GN5 A;  4JI4 Q;  2ZTD A;  5D3D A;  5M5W B;  2OF1 A;  3X3M A;  2HIX A;  3RZD H;  1E1O A;  3TS0 A;  1F9Q A;  1PH3 A;  1WTR A;  2R7Z G;  4A4I A;  2B63 B;  3TBI B;  4A3F B;  1YHB A;  2ZJR A;  2WKD A;  4HMJ A;  4JBM A;  4CDE C;  1VQA A;  1AFP A;  4X66 Q;  1E2V A;  4JG2 A;  4XT3 B;  3T4A C;  1HQM C;  1CZG A;  1SYD A;  1VS0 A;  4K2K A;  4R4T A;  2I46 A;  5I9P A;  1WYD A;  2F3V A;  2EY2 A;  3CCM A;  3S1R H;  5IP7 H;  1C8C A;  1SE2 A;  4UP8 A;  4AH6 A;  2C5C A;  2E2I H;  2QDL A;  1B44 D;  1PTO H;  4NB3 A;  3PF5 A;  2KHJ A;  1STY A;  2NN6 I;  4AYB E;  1PYW D;  2IJ0 A;  3S17 H;  3L2P A;  1XJV A;  4DNT B;  2OQK A;  1TWC B;  4IUN A;  4CJ2 C;  5BN3 A;  5CR3 A;  2R7Z B;  4KHP Q;  3R93 A;  5EPJ A;  2WKC A;  4DV7 Q;  1PFM A;  3GTL H;  4A3K H;  2VQE Q;  3H3V I;  5IGE A;  1SNM A;  4OGQ C;  1LM0 A;  4H7B A;  4LFC L;  2B2U C;  2KEN A;  5KNC A;  5IP9 G;  4BBS H;  4LUO A;  1F9R A;  1SNO A;  1MJE A;  1NNX A;  5K36 G;  4AYB G;  4IUQ A;  4JI6 L;  3JAM L;  3W1G A;  1LTS D;  1CA5 A;  3ZYY X;  3G4S A;  1EU4 A;  4H02 A;  1LTR D;  4GOP B;  3A74 A;  4C2M B;  2IW3 A;  4IPH A;  3KLS A;  1NJI C;  1UE6 A;  1C48 A;  1STB A;  1Y8N B;  1EWI A;  4DFA A;  4XIG S;  1VF5 C;  3EN2 A;  1D1I A;  3GTK B;  3AB9 A;  3G71 A;  3U50 C;  2RCN A;  2Q8R E;  3HOU G;  3QR8 A;  4MTK A;  4BY1 H;  1O7I A;  2A68 C;  4AYB B;  3T1H L;  4ZKC B;  2I5L X;  1JOR A;  3HGB A;  1EWH A;  2F0T A;  5CV9 A;  1SE3 A;  1KXL A;  1ICF B;  3CPW A;  2BE5 D;  1N32 L;  1AEX A;  4JI2 L;  5CGK A;  3UDG A;  2NTS A;  2K7V A;  4ZUI A;  2UUB Q;  1LT3 D;  5IGD A;  5JEA G;  1Z6H A;  3S14 H;  2EJM A;  2SNM A;  2YTV A;  4L8J A;  1VQ6 A;  1CM9 A;  1PZJ D;  5LMN W;  3QOJ A;  1HNZ Q;  3OTO L;  4DPG A;  2BCO A;  1XMO Q;  2RCF A;  2B29 A;  1I4G A;  3O13 A;  1ESF A;  1XNQ L;  1Y1W G;  4UY8 C;  2ID0 A;  4XQQ A;  1HQR D;  3BVZ A;  4ZQ3 A;  1Y8O B;  1HH2 P;  5IE8 A;  1RTO A;  1IXR A;  1IYJ B;  2MHV A;  2HHH Q;  4A3G H;  1D8L A;  1ZYR D;  3NXW A;  4XQN A;  2JXM B;  5C4J B;  2HCI A;  1F9S A;  4IFD H;  1YNJ C;  1PA6 A;  1V1P A;  1VQI A;  1P16 A;  2TSS A;  3KJP A;  4JI8 Q;  1FYC A;  1MJC A;  3IAY A;  4LF8 L;  1ONL A;  4LFB L;  1VQ9 A;  1RCV D;  4TVA B;  3GTJ B;  1L0Y B;  5CC4 A;  5IYB H;  4X64 L;  3OSO A;  1PHJ A;  1G2S A;  3QJY A;  2VZA A;  1XTD A;  3TN2 A;  4R4C A;  1D5X C;  3W5O A;  3M4O H;  5FO8 B;  3HRZ C;  1YHA A;  4OO1 G;  3BYT B;  5IYC H;  2O5I C;  4L5R C;  2Y0S G;  2FXQ A;  4KKT A;  1CT1 D;  3LX0 A;  3T1Y Q;  2NYZ D;  1MBY A;  2ICI A;  1PTO C;  1M4V A;  1H9M A;  1SMY C;  3GP7 A;  1HZC A;  4HR7 B;  2B2Y C;  2A69 C;  1JWU D;  1KAW A;  2RF4 A;  3A7A B;  2E2J B;  3FKI G;  1CUK A;  2RBM A;  1SFO H;  2I5M X;  3A0J A;  3K80 C;  1R9T B;  4DK6 C;  2FHT A;  3H0G G;  1PV4 A;  1IW7 C;  2YTX A;  3D4D A;  1TT2 A;  1UEB A;  2AQ2 B;  1G6P A;  3E9H A;  2G9H D;  4DV0 L;  1I94 Q;  4JV5 L;  4BA1 I;  4GKK L;  2NN6 H;  4K0K Q;  2CHB D;  3I73 A;  4B08 A;  2UU9 Q;  4FF1 A;  3FP9 A;  2UUC Q;  3GTG B;  1X6O A;  4IPG A;  5C3E H;  1D6E C;  1S5B D;  1WJJ A;  1NSN S;  2A6H D;  3FKI B;  2BH2 A;  3I72 A;  2Z4H A;  1DXM A;  2MUY A;  4IQZ A;  3FPP A;  4DU9 A;  5C44 H;  4X3S A;  3H3V H;  1EFI D;  1QZG A;  3S15 B;  1PFS A;  3FHW A;  3H0G B;  2F0E A;  3OOC A;  1SNP A;  3STB C;  1BCP D;  3JAM i;  3K5M A;  1CKM A;  4WRD A;  4XQJ A;  3I4M G;  1WTW A;  1Y1V G;  2JA9 A;  2UXD Q;  1R4Q B;  1SRU A;  1V1O A;  4RGT A;  1E22 A;  1FNW A;  2N55 A;  4IFD J;  2C35 B;  3MFY A;  2JK8 A;  1EYD A;  3VYS A;  3UE1 A;  2DJG C;  5I2Y A;  2LFN A;  5EBC A;  4DV4 Q;  2NZ1 D;  1GUW A;  1BBX C;  2KCM A;  3Q0A A;  1KHI A;  4DR2 Q;  1PRT F;  4LF7 L;  3L3O C;  3I3C A;  3I4M B;  3OWF A;  3SDZ A;  1Y1V B;  4FO2 A;  5A2Q L;  1VDZ A;  1Q82 C;  3S2H B;  5F2D A;  2JA8 G;  2H4O A;  1HZ9 A;  3CPF A;  4Y52 H;  1VQF A;  4MN3 A;  2YU9 B;  4FF2 A;  4OO1 I;  3HOX H;  3HOW H;  3D4W A;  4L5Q A;  4R4Q A;  4DV1 Q;  2E2H B;  4FDB A;  5DM6 3;  3M9B A;  2ATW A;  2N78 A;  2KOL A;  1PZK D;  1RHP A;  4RCN A;  1VQ4 A;  2VQF L;  4JVZ A;  2AQ3 B;  4HED A;  1NAP A;  3BVM A;  4G4K A;  3NPP A;  2NVY B;  3KUP A;  3S1M B;  2A19 A;  1FNU A;  2A8V A;  1VQP A;  1AH9 A;  1TQO A;  1CKN A;  4UAI A;  3SEB A;  5M5X B;  4A3M H;  4FF3 A;  2OTJ A;  1VQB A;  3K81 C;  3MHB A;  1AN8 A;  1SDF A;  2JA8 B;  3BZD B;  1EZ8 A;  2F0Q A;  4HJ8 A;  2JSO A;  4ALP A;  1ET6 A;  4X65 Q;  2D9U A;  3A54 A;  4PMW A;  4LUZ A;  1I3Q H;  1SXT A;  1NUC A;  1SAP A;  1QG7 A;  2QA4 A;  4Y7N B;  3MA2 B;  5E1F A;  1GJX A;  3NHH A;  1QUQ B;  3SK4 A;  1B8A A;  1YNX A;  1KC8 C;  5BN4 A;  3LNN A;  3KF6 A;  2B2W C;  5IWA Q;  3K0Y A;  5M3M H;  4B3R Q;  1PYS B;  3MXG A;  2K5V A;  5GRO A;  4DR3 L;  1IKM A;  2E2D C;  1NTG A;  4R4I A;  4PZ6 A;  3KOJ A;  3DM3 A;  1U4R A;  4DV6 Q;  1EY8 A;  5AJ3 L;  3VA7 A;  3KLR A;  4HIO A;  1IBM Q;  2RDG A;  1JOQ A;  1UNS A;  3S9W A;  4ZCK A;  3RZD B;  3CD6 A;  4A3L H;  3UDF A;  2NVT H;  1JE4 A;  3ITP A;  3JC6 6;  5HGQ A;  1E0B A;  3H91 A;  1CQV A;  2JP1 A;  3S1Q B;  1EY4 A;  1I50 B;  4P71 A;  5D14 A;  3H6M A;  3PO2 G;  1X3P A;  4KLK A;  4FXD A;  4A3B G;  3H94 A;  1K0S A;  1HJP A;  1DGS A;  5EQ0 A;  1HTL D;  1KDB A;  2F0M A;  4RH6 A;  4HCS A;  3J7A F;  5BN5 A;  1I4X A;  4XT1 B;  1CA6 A;  1WCM G;  2AKW B;  1YIT A;  2EE1 A;  1PTO B;  5G3L F;  3CCL A;  3HOU H;  2K14 A;  1HR0 W;  1A15 A;  3CCR A;  3HOZ B;  3S17 B;  4DKA C;  3I4O A;  1WD1 A;  4B9X A;  3K57 A;  1PTO F;  3CRL C;  1TR5 A;  2JA7 G;  4QUF A;  1EY0 A;  2ENB A;  4KKS A;  1B4O A;  4DR5 L;  5IT9 c;  1N33 Q;  4HID A;  2MO1 A;  4DR7 Q;  2XTI A;  3MEF A;  2IY5 B;  3JAM c;  4A3B B;  3GTL B;  5JEA H;  2F0I A;  4RFB A;  4HIM A;  5IOC A;  2EJG C;  4P2C B;  4A93 G;  1EUJ A;  1Q12 A;  1SYC A;  5FJ8 G;  1K9M C;  4RMF A;  3KJO A;  1WCM B;  4A3J G;  4DNR B;  1PFN A;  1Y1W H;  2R6G A;  5I2X A;  3G6E A;  1B2T A;  1UUP A;  4RHR A;  1KLU D;  1SLJ A;  1WOC A;  2NZO A;  4BXX H;  3FPU B;  1YNN C;  1XMQ Q;  3NWS A;  1BVS A;  4M8A A;  3I55 A;  1X54 A;  1GM5 A;  4JI4 L;  3F8T A;  3IRB A;  3A8K E;  2L55 A;  3MXN B;  3EIV A;  4ZYS A;  3K6O A;  1QVG A;  1XWE A;  4A93 B;  3Q24 A;  3HOV G;  3U9S A;  1EL0 A;  4MIU A;  4ID6 A;  5GAE C;  4A3J B;  1HCZ A;  1NBW A;  2XSC A;  4X66 L;  1B7Y B;  4RHS A;  2DUD A;  4V19 0;  2VW9 A;  2CWA A;  2WP8 J;  1SJE D;  3NEL A;  1EY9 A;  1NR2 A;  3GO5 A;  4DA2 A;  3VA5 A;  4PZ8 A;  3QB3 A;  3A55 A;  3DLL A;  4NKL A;  4IAL A;  2K75 A;  4DN4 M;  4KHP L;  3GD7 A;  3K8A A;  2WAQ E;  2F0N A;  4DV7 L;  1QWY A;  4N8X 1;  2VQE L;  2SOB A;  1A3U A;  5C6A A;  2L1B A;  4K6D A;  3WOE A;  1V43 A;  1N8R C;  1DD2 A;  1T5X D;  3EJI A;  3D3R A;  3HOY H;  3GTO B;  1SR3 A;  1C7Y A;  3EBE A;  2HUG A;  3QG1 A;  5IY0 A;  1TWA H;  4FXK C;  3AFQ A;  5JEA J;  3MEH A;  3BU2 A;  2CCZ A;  1BOS A;  4DV2 Q;  4CKC A;  1EOV A;  5LMU Q;  3CHB D;  3NEN A;  2WAQ G;  1FNV A;  3IFD A;  3OPO A;  4NXM Q;  4KJO A;  2FFK B;  5M5Y B;  1SYB A;  3AFP A;  3MXP A;  2R92 G;  4XYO A;  1L1O A;  4B3S L;  4HN7 A;  4GNX C;  2VUM H;  4BY7 H;  4H0L C;  3U58 A;  3Q23 A;  1I4H A;  1EQR A;  3GTP H;  4A3E H;  3OWE B;  5EBD A;  2EYJ A;  2KQ3 A;  3CP0 A;  1SBB B;  3Q6S A;  1KTK A;  3HS0 C;  5HGT A;  1FR3 A;  3CF5 A;  1Q90 A;  1HTP A;  1K28 A;  1SNC A;  1JOK A;  3SVM A;  2K4K A;  5I6W A;  5ELF A;  3K59 A;  2LS0 1;  4ME3 A;  5DAU A;  1IBK Q;  1TY2 A;  4IUV A;  2WAQ B;  1XPO A;  3CAM A;  2UUB L;  1AW7 A;  1SN8 A;  5JJZ A;  2OT2 A;  2NVX B;  3URY A;  1MI2 A;  2R92 B;  4C3I H;  1O7L A;  2K6A A;  2PPB C;  1LAB A;  4QL5 A;  3H09 A;  1HNZ L;  2PNH A;  3GV3 A;  4DAV A;  3PGZ A;  4RA8 A;  3G7L A;  1XMO L;  3BYY B;  1CHP D;  4LF9 Q;  1WD0 A;  1ASZ A;  5JPM C;  2K33 A;  4YY3 Q;  1CI3 M;  3GDE A;  2F0K A;  3VYR A;  3MAQ A;  3G48 A;  1ENC A;  1UE5 A;  1JB3 A;  2EYM A;  1HHV A;  3S16 H;  3EFX D;  1MIU A;  4RKL A;  2IL8 A;  2RDF A;  2HHH L;  2UUA Q;  4PMC A;  5E4X A;  5COR A;  3RN5 A;  5FLX L;  2Q2T A;  1VQ7 A;  5C0X G;  2KJX A;  3MXU A;  5CV7 A;  3M3Y H;  3RZO H;  5I9O A;  2B2U A;  2JN4 A;  1GO3 E;  5BR8 Q;  1U4L A;  3CKI B;  2B2V C;  4JI8 L;  2EVB A;  2Z6K A;  3RLN A;  1BNZ A;  1PZI D;  1KLG D;  4BS9 A;  2IHF A;  2LXJ A;  2WII B;  5I4D A;  4IOA A;  5KEE A;  1IHZ A;  4JOI A;  3ULP A;  3NBH A;  1PLF A;  3CW2 C;  4LJZ C;  2BDO A;  4LFA Q;  4A76 A;  2G9D A;  5C4H A;  5ELO A;  2LSS A;  3VR4 A;  3NQT A;  4G7H C;  1U0L A;  3SHL A;  2F4V Q;  4NXN Q;  2N8N A;  4DV5 Q;  1DYQ A;  4KN4 C;  3T1Y L;  3U4Z A;  1SNQ A;  2NTT A;  2HCC A;  1LTA D;  1KAB A;  3DWA A;  5C5M A;  4DUY Q;  3DUZ A;  3FDT A;  4P75 A;  4OWX B;  5IIF A;  2PI2 A;  3G6J B;  2CQO A;  4YWK A;  4WOR A;  2A6E C;  3ULJ A;  1SE8 A;  1ASY A;  3KFU A;  1TWF B;  2NVQ H;  3GQB A;  2PNR C;  1VQM A;  1H9S B;  4CDF C;  4V0B A;  2EY5 A;  4XXE A;  1PYB A;  2O2L D;  2K32 A;  5EPL A;  1GUT A;  5IGF A;  3DHQ A;  1I94 L;  4KD3 A;  3T51 B;  1X3E A;  4X62 Q;  1ZXT A;  2XGT A;  4K0K L;  4QMG A;  2QIL A;  4DUZ Q;  4YHH Q;  2UU9 L;  3NUC A;  2UUC L;  5D65 A;  5DLQ E;  3DEO A;  1PRT C;  5ELE A;  3GTQ H;  5JJL A;  1OXS C;  3PIP 3;  4A3D H;  5IT9 L;  1RF2 D;  1MSG A;  4H13 C;  1A3T A;  4RWS C;  2PCF B;  2NWG A;  1BF4 A;  1XPU A;  2GVB A;  4OXP A;  3LGJ A;  1HNX Q;  1SYF A;  4POG A;  4O0A A;  3E9I A;  5JPN C;  5E4W C;  4YCW A;  1E24 A;  2Z0S A;  4BBR H;  2K03 A;  3F2B A;  3T13 A;  2UXD L;  4C3H G;  5JVG 3;  4LF5 Q;  1L2F A;  4IJH A;  2DJF C;  2K5W A;  3KLS X;  1HR0 Q;  4DK1 A;  1PVO A;  1ZEQ X;  2RHS B;  4HJ5 A;  4R8I A;  4MZ9 A;  4RG1 A;  1SYG A;  4C3J G;  2EYF A;  3K7A B;  5EKK A;  4DV4 L;  4A3C H;  4OIK A;  4HTH A;  4I7A A;  1WTO A;  2MO0 A;  2K01 A;  1IL2 A;  2VNU D;  1TWG B;  2HDL A;  1TWH H;  1Q8I A;  1A63 A;  3ERQ A;  2KUM A;  3V05 A;  3ZJY C;  4DR2 L;  1FVI A;  1CFM A;  5IGG A;  3A5U A;  3NEM A;  2B8G A;  1N34 Q;  4C3H B;  1QE6 A;  1X3F A;  4I7Z C;  1RDP D;  2JA5 G;  1RTN A;  1HNW Q;  4LWC A;  4L63 B;  2FMC A;  1QIL A;  2F3W A;  3S1N B;  2B2T A;  3E0E A;  3FMC A;  1IYV A;  2RKS A;  3KF8 A;  1AZP A;  4C3J B;  4GNX B;  4DV1 L;  3I4N H;  3J7A V;  3CCJ A;  1VQD A;  3ONA B;  5JVH 3;  1ENF A;  2K1B A;  4QQB X;  4DR6 Q;  4IUR A;  5IGC A;  1K3R A;  1QVC A;  1BUV T;  2AUJ D;  2EYP A;  4CDD C;  4IN3 A;  4APV A;  4YWL A;  3TQY A;  3TS2 A;  1I4Q A;  2F0U A;  1HA5 A;  1KQS A;  1A3V A;  3BZK A;  3AYH B;  2JA5 B;  5C3W A;  2L0C A;  3F2C A;  3CCS A;  3AU7 A;  1D5Z C;  2WV6 D;  4X65 L;  1Q1E A;  1KL9 A;  3UDX A;  1PH8 A;  3VR6 A;  5TSS A;  2K28 A;  4AQY Q;  3MXN A;  1DJR D;  4N9T A;  4JW0 A;  1XXG A;  2ES2 A;  2PZW A;  3AQQ A;  3KDF B;  2A68 D;  1F2Z A;  3TP6 A;  2R93 G;  2JA6 G;  5M3F H;  5E3F A;  5IWA L;  4B3R L;  3A7L A;  2IHE A;  1I5F A;  5CV5 A;  2OWO A;  3M7G A;  4DV6 L;  3KBX A;  1IBM L;  1K8O A;  1YVC A;  3PO3 H;  1RJT A;  1A2T A;  1CK1 A;  1S5F D;  4OX9 Q;  4UPA A;  3SR1 A;  4KY5 A;  4GZY C;  2UXB Q;  3PCO B;  3GV6 A;  2A5H A;  2MNA A;  2R93 B;  1N36 Q;  1HZA A;  1TU2 B;  2JA6 B;  1DOM A;  3CME A;  2WB1 E;  3BVG A;  4L5S A;  4A3I H;  2HT1 A;  1YNJ D;  3D0F A;  1EY6 A;  3GTM H;  1YJW A;  2EIF A;  1BBU A;  4HJ7 A;  5GQO A;  4X3U A;  5FLM H;  1J8I A;  4KMU C;  2H1E A;  2V4D A;  2F0H A;  1B9M A;  3PIO 3;  4LW1 A;  3K5L A;  4KV6 A;  3OW2 A;  2L11 A;  3P20 A;  3SXH A;  1AE2 A;  5C4X G;  1Z47 A;  2F0O A;  1N33 L;  1DOK A;  4DR7 L;  4EQP A;  3DMU A;  1FD7 D;  5M5W H;  3CCQ A;  1UWV A;  4DAP A;  5KYI A;  1TS5 A;  1PTO D;  1K73 C;  2PQA B;  1SMY D;  2MQH A;  2A69 D;  1A6X A;  4YCV A;  1PH4 A;  1PRT B;  4WJW A;  3NBI A;  2B63 H;  3P1H A;  3TP7 A;  5IT9 E;  3BZC A;  4CJ0 B;  4A3F H;  1AP0 A;  2JEA I;  1KDA A;  3NWT A;  1T9H A;  3JAM E;  1EYC A;  1OXX K;  4NP5 A;  1HRJ A;  5EPK A;  1EQQ A;  3S2D B;  1IW7 D;  1JE5 A;  1XMQ L;  2IT1 A;  3IFT A;  5C4X B;  5FKA C;  4JBW A;  5IYD H;  1YJ9 A;  1Z7T A;  1LV9 A;  1EFW A;  1JT8 A;  1M1K C;  3V96 A;  2WB1 B;  2RQX A;  3RN2 A;  1TWC H;  5KNB A;  1I6H B;  4RAU C;  4JI7 Q;  4GKJ Q;  3CMA A;  2R7Z H;  5DEH A;  2BDN A;  3NTK A;  1EOT A;  1S4Z A;  3WDN A;  4CGY B;  5FOB B;  5FO9 B;  5LL6 X;  1STN A;  3TME A;  1EQT A;  4JBK A;  3STB D;  1VQH A;  2K5N A;  4KHV A;  5L37 A;  2EYO A;  2F0J A;  3E3X A;  3HEJ A;  1MKH A;  4ZRZ A;  4KKU A;  2BH8 A;  2DY7 A;  5FLX c;  4TKO B;  4FNF A;  4ZLT F;  3NSW A;  3OMG A;  2E5L Q;  2WAC A;  4B3M Q;  2JQO A;  2SEB D;  4LNQ A;  4N8F A;  1TS2 A;  4C2M H;  2QKI C;  3RLO A;  2XIW A;  1K83 B;  1UE1 A;  4BWG B;  4GLA C;  3GTK H;  5IP7 G;  5IP9 H;  3LWU A;  3F1Z A;  4WJ3 M;  2E75 C;  1LUZ A;  3K5N A;  5C4Z A;  1QCB D;  1DM0 B;  2KCN A;  4DV2 L;  3HOZ G;  4DAM A;  5K36 H;  1GD7 A;  3A8I E;  1H9K A;  1KDC A;  1JC7 A;  5LHY 1;  1GUS A;  2X6G A;  5LMU L;  3J80 c;  1VQJ A;  4JK1 C;  4NXM L;  1QJO A;  1IYU A;  1HXY D;  2KEE A;  5EAY A;  1U4M A;  2F0L A;  2Q2U A;  4A3K G;  2F0S A;  2B39 A;  2SDF A;  2VL6 A;  2F3I A;  4CDC C;  1R4P B;  1JMC A;  3M4P A;  1QVF A;  3NP8 A;  3MTS A;  5GAD C;  4HMI A;  3NTI A;  1PH1 A;  1OXT A;  4RGN A;  3S1R B;  3CC2 A;  4JI5 Q;  1CHQ D;  3H3V C;  2E2I B;  2DY8 A;  2ZJQ A;  4BBS G;  1W3S A;  1JJG A;  2NUC A;  4B3T Q;  1VQG A;  4XTC S;  1Z9F A;  1BCP F;  1IBK L;  1U4P A;  1SMX A;  1VMC A;  2PZU A;  4IOC A;  3AMU A;  4J8Q A;  3PIP A;  1SYE A;  2K5H A;  5C4J H;  2QGQ A;  2NVQ B;  1DOL A;  4A3K B;  1KNA A;  1BXT A;  1B1Z A;  3LWE A;  4GOP A;  2EXZ A;  2CW0 C;  1VQO A;  1Y8P B;  3WWV A;  4LF9 L;  2L15 A;  4YY3 L;  4M1U B;  3T56 B;  4BBS B;  3GTQ B;  3GTJ H;  1VQK A;  3SGI A;  5LMN Q;  1WVL A;  4A3D B;  1RKN A;  4BY1 G;  4FXG C;  1KAA A;  3DEP A;  2UUA L;  1C4Q A;  4R4O A;  5CMD A;  4GN4 B;  5JJI A;  4K2L A;  1MGS A;  1T5E A;  2KBN A;  3BS1 A;  2OTL A;  1V1P B;  5BR8 L;  3C2P A;  1MD2 D;  3UI2 A;  1LT6 D;  4RKB A;  1STH A;  2JJQ A;  2EJF C;  4IUP A;  2E2J H;  4LF4 Q;  3A5Z B;  2N49 A;  1O7Z A;  4JI1 Q;  2JYO A;  1R9T H;  3L7Z C;  4ZUJ A;  3HP3 A;  1M90 C;  4BY1 B;  4LFA L;  4U67 3;  2O5J C;  1G91 A;  1GHK A;  1STA A;  3C3L A;  3UDI A;  4NXN L;  2F4V L;  1ILP A;  4DV5 L;  2CH4 W;  1TS4 A;  2E74 C;  2LXK A;  4A3G G;  2HQL A;  4OO1 H;  3R2T A;  3VDY A;  1BKB A;  2ZXO A;  3GTG H;  4IPC A;  1ET9 A;  3S14 B;  4DUY L;  3OIP A;  4DV3 Q;  3F2D A;  3CC7 A;  4R9W A;  3EA6 A;  5ELC A;  2RVL A;  4QJF A;  5A2Q E;  1II3 A;  3FKI H;  1YIJ A;  1X55 A;  3Q8D A;  2R61 A;  5HY6 A;  4HSP A;  5IYB G;  3J81 c;  4DNI A;  3H0G H;  1JWM D;  1Q3L A;  1E1T A;  2D2C C;  2X69 A;  4X62 L;  2EXD A;  4GN5 A;  2EYH A;  3I4N B;  3TDQ A;  1B70 B;  2J0T D;  4DUZ L;  4YHH L;  4A3G B;  5IYC G;  1PFB A;  2NBF A;  2RSO A;  4DAY B;  1SND A;  2EQS A;  3NE5 B;  1D7Q A;  1YNN D;  1KNE A;  2EY1 A;  4H44 C;  5ELD A;  5K5P A;  1ROD A;  1JJC B;  2PZT A;  2Q2I A;  1N9W A;  4TQU S;  1HUM A;  1TY0 A;  1HNX L;  1E2Z A;  1EQV A;  4OEL B;  4E6I A;  1V8Q A;  2PW5 A;  3W3A A;  1PMR A;  3N6R A;  2O4X A;  1ESR A;  1TXY A;  3ND8 A;  4Q0F A;  4ODG A;  4NW2 A;  1IL8 A;  3CU7 A;  2YTY A;  1EYG A;  3M4O B;  2AWO A;  2BA1 A;  4GN3 B;  4LF5 L;  3I4M H;  2QEJ C;  3K58 A;  2NN6 G;  1Q86 C;  4JI0 Q;  1Y1V H;  4O1N A;  4G7O C;  1A62 A;  1HR0 L;  1J5E Q;  2DNC A;  3EVQ A;  3TRE A;  1LO5 D;  4F7X A;  4O2D A;  5J1Z A;  5C3E G;  3BG3 A;  3E6Z X;  5EKL A;  2YU9 H;  4R8N A;  2D62 A;  3BDL A;  4JI3 Q;  4LF6 Q;  1SFO B;  2E2H H;  1LTB D;  1S5E D;  1FL0 A;  3CCE A;  5C44 G;  2I07 B;  2Z8L A;  2DGY A;  1FGB D;  4RCO A;  1S3O A;  1F9P A;  3S1M H;  2XNA C;  1GXD C;  5H1S E;  1N34 L;  5T1G A;  3CCU A;  1W2B A;  4EX5 A;  5M5X H;  1AE3 A;  1HNW L;  3K0X A;  2CVR A;  1WI5 A;  3N52 A;  4GS3 A;  2ZM6 Q;  4J1M A;  4DR4 Q;  2JA8 H;  3PIO A;  4L5T A;  1PDQ A;  5C3E B;  4EQN A;  3QO2 A;  5A35 A;  1PH5 A;  1S5C D;  4A3I B;  1PH6 A;  5DNF A;  1JOO A;  3MZ5 A;  4Y7N H;  1Q46 A;  5C44 B;  4R1J A;  4DR6 L;  2DNE A;  1WTX A;  4P73 A;  4QCL A;  3PF4 A;  4QB4 A;  3UE0 A;  1WFQ A;  4JYA Q;  5JAV A;  4EGV A;  3RLF A;  1AZQ A;  1CKN B;  1Y69 U;  2IX3 A;  4K8I A;  4G57 A;  2HIV A;  2K05 A;  2Q8I B;  3ICE A;  2RA4 A;  4CJ1 B;  4QUC A;  1L1O C;  3DM1 A;  1LYL A;  2XWJ B;  4UP7 A;  1EWC A;  2MP1 A;  4QGU A;  3AEV A;  4AQY L;  4DF7 A;  3OW7 A;  3J81 j;  3HOX G;  3HOW G;  3MVV A;  5CBA E;  1VMP A;  4LAA A;  4EVO A;  1IKL A;  1SEB D;  4YWM A;  2AWN A;  4DK0 A;  3S1Q H;  1EYA A;  1I50 H;  3J80 L;  1Q8K A;  3KF6 B;  1O78 A;  3X3N A;  3R8B A;  4KJN A;  1FJG Q;  2F1M A;  5HUR A;  1JIC A;  4ZKB B;  3CQZ H;  4K14 A;  5EKI A;  3P75 A;  4A3M G;  1WTP A;  3DWP A;  4IZ8 A;  2IX0 A;  4DR1 Q;  1A0I A;  2LY7 A;  2JE6 I;  2BE5 C;  1X9N A;  4OX9 L;  3HG9 A;  2RHQ B;  3VR2 A;  3HOX B;  3HOW B;  3TEH B;  2SNS A;  1BQQ T;  5D3I B;  3HOZ H;  1V1Q A;  5KYL A;  1CTM A;  2UXB L;  1K3B C;  1N36 L;  4L6T B;  1HPC A;  2XVS A;  3PO2 H;  2AMC B;  1QUQ A;  1OTC A;  3VR5 A;  4NDX A;  5M3M G;  1VQ5 A;  4A3B H;  3KK7 A;  1S5D D;  1HUN A;  1D2B A;  2EY6 A;  5AFW A;  2MGS A;  1VQ8 A;  4A3M B;  3B6Y A;  1WCM H;  3MWY W;  2Z6K C;  1K0R A;  3NK9 A;  4HJA A;  4QIW E;  1ZYR C;  1OXV A;  5EGT A;  4MHE A;  1I3Q B;  4A3L G;  1Q1B A;  4K8J A;  4PG3 A;  2ZTC A;  3C46 A;  2JA7 H;  3L0O A;  4JOI C;  5GAG C;  2FJ2 A;  3DWQ A;  2A1A A;  1ZKO A;  3ERS X;  1KD1 C;  1SE4 A;  2EDG A;  2GVA A;  2PO4 A;  3TZD A;  3D31 A;  5M3M B;  3OMC A;  1LTG D;  2MJ8 A;  1DZ1 A;  5C0X I;  2F0P A;  3T16 A;  4B3S Q;  4A93 H;  2WIN B;  5KRU A;  2XRQ D;  1CSP A;  3U4V A;  5J39 A;  5FJ8 H;  2UXC Q;  4JCV E;  3RR5 A;  1CKO A;  3CRK C;  1WTQ A;  5FO7 B;  4A3J H;  1VQN A;  3PQI A;  2A6E D;  1TVX A;  4B9W A;  1EY5 A;  2B2Y A;  2XRS D;  3D6W A;  2NVT B;  3C1E A;  4X3T A;  2ALY B;  4O42 A;  3OYY A;  1EZ6 A;  2VB2 X;  4PV1 C;  1IZ6 A;  2PYK A;  1RIP A;  3PSI A;  1O80 A;  1IBL Q;  3ERO A;  4ZAI A;  1LAC A;  2BOS A;  1XYI A;  4KY6 A;  1F2Y A;  2B8F A;  2M00 A;  2PQE A;  3WOF A;  1PRT D;  1XNR Q;  5J22 A;  3HOV H;  3V2T A;  1JJ2 A;  5J3B A;  2F03 A;  4JI7 L;  4GKJ L;  1B3A A;  1EIH A;  2DN8 A;  3TRZ A;  1STG A;  3OHX C;  3PMF A;  4OIJ A;  3HOU B;  3M4Q A;  4QIW B;  4PNY A;  3J81 L;  2OXP A;  4YCU A;  1L0W A;  2JEB I;  3VYU A;  2K5Q A;  4BXX G;  4IPD A;  1MHW C;  4XDX A;  3GTO H;  2Y0S E;  3W1B A;  2A6H C;  2OCE A;  2WFW A;  2VXW A;  3TZU A;  4JBJ A;  2K04 A;  3BJU A;  1J6Q A;  3PUY A;  2EYL A;  3TSS A;  1X3G A;  2E5L L;  2KCC A;  1BCP C;  4B3M L;  4I65 A;  4HJ9 A;  1JCK B;  1TII D;  5M5Y H;  1EEI D;  5I6Y A;  4CBV A;  4Q5V A;  1LLR D;  2Q2H A;  1YHQ A;  4IUU A;  1Y1W B;  4ZK9 B;  1P8L A;  4CHT B;  5FLX E;  1ML0 D;  3J80 i;  1B9N A;  1EEF D;  5IGB A;  4F87 A;  2CFM A;  2NZH A;  1HA6 A;  4P72 A;  4FYD A;  4HSV A;  2IWH A;  4WFN 3;  4GLV B;  3FVQ A;  3EQL C;  4OL7 A;  3R2I A;  2F52 A;  2B2T C;  1L1O B;  2KED A;  2NVX H;  2R92 H;  1B50 A;  1LT4 D;  4MNO A;  1QOH A;  2ZTE A;  3FEW X;  1E7Z A;  4RGM A;  1XTC D;  3SK6 A;  4PQX A;  1G29 1;  1RL2 A;  1GVP A;  4BA2 I;  2YYZ A;  4GLX A;  2D0P A;  4JI5 L;  3P7J A;  3IKJ A;  1C9O A;  3HOY G;  2RSN A;  3J80 E;  4LFC Q;  1OXU A;  4XYQ A;  2Y0S B;  4K6L A;  1ICW A;  4B3T L;  2GA4 B;  3SK5 A;  4C1N K;  2KA7 A;  4TRD A;  4DAY A;  1GOZ A;  2PMZ E;  4ILW A;  4JPB W;  1EY7 A;  2AUK A;  1KIX A;  1D1K A;  4KI0 A;  2ZXR A;  1K8A C;  4JI6 Q;  1F77 A;  1VCI A;  4KD4 A;  5DM7 3;  1I4P A;  5G3L D;  2X6L A;  1K8M A;  4IJL A;  2R3Z A;  3I90 A;  3CCV A;  4POF A;  1WTV A;  1X56 A;  2PI2 E;  2WB1 G;  2B3G A;  3W2D A;  2V1C C;  1BR9 A;  2VS1 A;  1B53 A;  2KVM A;  4LK1 C;  2VUM G;  4BY7 G;  3H15 A;  3HOY B;  1X65 A;  3C1F A;  1XX8 A;  1G2T A;  2L5T A;  1YI2 A;  2FMM A;  4A3E G;  5LMN L;  1E2W A;  5M9O A;  4A75 A;  1TWA B;  2A73 B;  2L4N A;  2M2L A;  3DXJ C;  2B2W A;  5JOB A;  2C9O A;  3T1H Q;  4Z9C B;  4PMB A;  5COY A;  1CQF A;  1N32 Q;  4JI2 Q;  1SRO A;  4FP5 D;  5C0X H;  4OWW B;  3KBG A;  1JWS D;  5C3X A;  4C3I G;  2TMP A;  3D8G A;  1ENA A;  3PUW A;  2BA0 A;  1OO9 B;  4LF4 L;  2VUM B;  4BY7 B;  1UEA B;  4LUV A;  1UE7 A;  1CZW A;  3OTO Q;  4JI1 L;  3GTP B;  3NBH B;  1QNK A;  3D6C A;  4A3E B;  1EIF A;  1TWF H;  1GUN A;  4CKB A;  4K5W A;  1XNQ Q;  2KHI A;  3U9O A;  1GHJ A;  2R7D A;  1FGU A;  2PMZ B;  1LTT D;  2QDB A;  4X6A H;  4N9P A;  4P74 A;  1GKH A;  4KK7 A;  5CBE E;  2F0D A;  4DGZ A;  5CV4 A;  4NMZ A;  4WJ4 A;  4C3I B;  4DV3 L;  1HZB A;  3VR3 A;  5NUC A;  2KEC A;  2YV5 A;  3J81 i;  3M4Y A;  1W6J A;  2OQ0 A;  2QCP X;  2M9V A;  4LF8 Q;  1Y14 B;  1G51 A;  2RDH A;  4LFB Q;  3QWN A;  3J7A 5;  1L0X B;  4UP9 A;  2K52 A;  4G7Z C;  1HFG A;  1NE3 A;  4KHZ A;  4JC0 A;  2I0Q A;  3S16 B; 
#chains in the Genus database with same CATH homology
 5ELB A;  3R3O A;  2D5D A;  4LMQ D;  4F8M A;  1J9O A;  1DON A;  1STE A;  1JR0 D;  3M3Y B;  5T1I A;  3RZO B;  1O7Y A;  3J81 E;  2IPK D;  1LTI D;  4ULL A;  4KY7 A;  5CYU A;  1A2U A;  2F0G A;  1I6V C;  3PV0 A;  3FRP B;  1H9S A;  2HDM A;  2ZT9 C;  4K5X A;  1F2M A;  4KN7 C;  1QB5 D;  2PW7 A;  2K5D A;  4S3S A;  3NTH A;  4YIJ A;  4ABN A;  2F0W A;  1H9J A;  3I8Z A;  3PUV A;  1BCP B;  1X32 A;  5C0X J;  2J7Z A;  1X3Q A;  2Q8T A;  3RMH A;  3RUZ A;  3TP5 A;  2ZXP A;  3CQZ B;  2HQE A;  5C5L A;  1U9R A;  2LKV A;  2OEO A;  4IUT A;  3ND9 A;  1SSO A;  2AQ1 B;  3OIQ A;  3SE0 A;  4ME5 A;  2IX1 A;  2F0V A;  2L12 A;  3PO2 B;  3RD4 A;  1JQY D;  3TP8 A;  1TS3 A;  4DXG A;  1ILQ A;  1M8A A;  3NQI A;  3BDO A;  3PUZ A;  1MSH A;  2EPB A;  3MFG A;  4BBR B;  1F2L A;  3F2U A;  4TSS A;  3A56 A;  2JA7 B;  3M85 A;  4C1N I;  1SJH D;  2EOT A;  1DCZ A;  4F88 A;  4K5V A;  2F0F A;  1G8Z D;  3SK8 A;  3K5O A;  3L9A X;  1GUG A;  4IFD G;  2FIN B;  4X3K A;  1TWH B;  3HZX A;  4DXF A;  5KGU A;  2F4I A;  1H9R A;  2A74 C;  3HKZ B;  3M7N A;  2CW0 D;  1EIG A;  1TKW B;  5KND A;  3BDC A;  3QIA A;  2E76 C;  1NCV A;  4U68 A;  3VYT A;  4FF4 A;  3HOV B;  3PUX A;  5CV6 A;  4J6H A;  1BDO A;  4C56 C;  1RD9 D;  1LT5 D;  3I91 A;  3QOL A;  3IL8 A;  3J7Y W;  1W6K A;  1BO0 A;  3E5S A;  1PXU A;  1GUO A;  4CKE A;  1HFN A;  2B2V A;  1EU3 A;  2ICE C;  2VB3 X;  2QF7 A;  5M3F B;  1NR4 A;  3Q22 A;  4EQO A;  5KIX A;  3MC0 B;  4HAE A;  1I4R A;  4KTA A;  3PO3 B;  2XN9 C;  2KHS A;  3I70 A;  1QNU A;  1D5M C;  3T53 B;  4RGO S;  3E0J A;  1VF7 A;  2CQA A;  5FK9 C;  2Z4I A;  5CV8 A;  4OHJ A;  4UDU C;  2LMC B;  4IFD I;  3GTM B;  5ISR A;  3D4R A;  2Z1C A;  4QF4 A;  1G6Z A;  4FVM A;  2EZV A;  2L9H A;  5LL6 S;  2XWB B;  3I4L A;  4HCE A;  2MPM A;  2J4X A;  3A8J E;  5IOD A;  5EJW A;  1UAP A;  2N88 A;  2NB0 A;  5D3D A;  5M5W B;  2OF1 A;  3X3M A;  1F9Q A;  1WTR A;  2B63 B;  3TBI B;  4A3F B;  2WKD A;  4HMJ A;  1AFP A;  1E2V A;  4XT3 B;  3T4A C;  1HQM C;  1CZG A;  1SYD A;  4K2K A;  2I46 A;  5I9P A;  2F3V A;  2EY2 A;  1C8C A;  1SE2 A;  2C5C A;  1B44 D;  1PTO H;  1STY A;  2NN6 I;  1PYW D;  2IJ0 A;  4DNT B;  1TWC B;  4IUN A;  4CJ2 C;  5BN3 A;  5CR3 A;  2R7Z B;  3R93 A;  5EPJ A;  2WKC A;  1PFM A;  5IGE A;  1SNM A;  4OGQ C;  4H7B A;  2B2U C;  5KNC A;  1F9R A;  1SNO A;  5K36 G;  4IUQ A;  3JAM L;  1LTS D;  1CA5 A;  3ZYY X;  1EU4 A;  1LTR D;  4C2M B;  2IW3 A;  3KLS A;  1C48 A;  1STB A;  1Y8N B;  4DFA A;  4XIG S;  1VF5 C;  1D1I A;  3GTK B;  3AB9 A;  2Q8R E;  2A68 C;  4AYB B;  4ZKC B;  1JOR A;  1EWH A;  3HGB A;  2F0T A;  5CV9 A;  1SE3 A;  2BE5 D;  1AEX A;  5CGK A;  2NTS A;  2K7V A;  4ZUI A;  1LT3 D;  5IGD A;  5JEA G;  1Z6H A;  2EJM A;  2SNM A;  4L8J A;  1CM9 A;  1PZJ D;  3QOJ A;  2BCO A;  1I4G A;  3O13 A;  1ESF A;  2ID0 A;  4XQQ A;  1HQR D;  3BVZ A;  4ZQ3 A;  1Y8O B;  1RTO A;  2MHV A;  1ZYR D;  3NXW A;  4XQN A;  2JXM B;  5C4J B;  2HCI A;  1F9S A;  4IFD H;  1YNJ C;  1V1P A;  2TSS A;  3IAY A;  1FYC A;  1ONL A;  1RCV D;  3GTJ B;  1L0Y B;  5CC4 A;  3OSO A;  1G2S A;  3QJY A;  3TN2 A;  1D5X C;  5FO8 B;  3HRZ C;  4OO1 G;  3BYT B;  2O5I C;  4KKT A;  1CT1 D;  3LX0 A;  2NYZ D;  1MBY A;  2ICI A;  1PTO C;  1M4V A;  1H9M A;  1SMY C;  3GP7 A;  4HR7 B;  2B2Y C;  2A69 C;  1JWU D;  3A7A B;  2E2J B;  2RBM A;  1R9T B;  2FHT A;  1IW7 C;  3D4D A;  1TT2 A;  2AQ2 B;  2G9H D;  4BA1 I;  2NN6 H;  2CHB D;  3I73 A;  4B08 A;  4FF1 A;  3GTG B;  1D6E C;  1S5B D;  1NSN S;  2A6H D;  3FKI B;  3I72 A;  2Z4H A;  1DXM A;  2MUY A;  4IQZ A;  3FPP A;  4DU9 A;  4X3S A;  3S15 B;  1EFI D;  3H0G B;  2F0E A;  3OOC A;  1SNP A;  1BCP D;  3K5M A;  4WRD A;  4XQJ A;  1WTW A;  1R4Q B;  4RGT A;  1V1O A;  1FNW A;  2N55 A;  4IFD J;  3MFY A;  3VYS A;  1EYD A;  5I2Y A;  2LFN A;  5EBC A;  2NZ1 D;  1GUW A;  1BBX C;  3Q0A A;  1PRT F;  3L3O C;  3I3C A;  3I4M B;  3OWF A;  3SDZ A;  1Y1V B;  4FO2 A;  5A2Q L;  1VDZ A;  3S2H B;  5F2D A;  2H4O A;  4MN3 A;  2YU9 B;  4OO1 I;  4FF2 A;  3D4W A;  2E2H B;  5DM6 3;  2KOL A;  1PZK D;  1RHP A;  4RCN A;  2AQ3 B;  4HED A;  1NAP A;  3BVM A;  4G4K A;  3NPP A;  2NVY B;  3KUP A;  3S1M B;  1FNU A;  1TQO A;  4UAI A;  5M5X B;  3SEB A;  4FF3 A;  3MHB A;  1AN8 A;  1SDF A;  2JA8 B;  3BZD B;  1EZ8 A;  2F0Q A;  2JSO A;  1ET6 A;  2D9U A;  3A54 A;  4PMW A;  1SXT A;  1NUC A;  1SAP A;  1QG7 A;  4Y7N B;  3MA2 B;  5E1F A;  1GJX A;  3NHH A;  3SK4 A;  5BN4 A;  3LNN A;  2B2W C;  3K0Y A;  3MXG A;  1IKM A;  2E2D C;  1U4R A;  1EY8 A;  3VA7 A;  3KLR A;  2RDG A;  1JOQ A;  1UNS A;  3S9W A;  3RZD B;  1JE4 A;  3ITP A;  1E0B A;  3H91 A;  1CQV A;  2JP1 A;  3S1Q B;  1EY4 A;  1I50 B;  5D14 A;  3H6M A;  1X3P A;  4FXD A;  3H94 A;  5EQ0 A;  1HTL D;  1KDB A;  2F0M A;  4RH6 A;  4HCS A;  3J7A F;  5BN5 A;  1I4X A;  4XT1 B;  1CA6 A;  2EE1 A;  1PTO B;  5G3L F;  1A15 A;  3HOZ B;  3S17 B;  1WD1 A;  4B9X A;  3K57 A;  1PTO F;  3CRL C;  1TR5 A;  4QUF A;  1EY0 A;  2ENB A;  4KKS A;  1B4O A;  4A3B B;  3GTL B;  5JEA H;  2F0I A;  4RFB A;  5IOC A;  2EJG C;  4P2C B;  1Q12 A;  1SYC A;  1WCM B;  4DNR B;  1PFN A;  2R6G A;  5I2X A;  1B2T A;  1UUP A;  4RHR A;  1KLU D;  3FPU B;  1YNN C;  3NWS A;  4M8A A;  3A8K E;  2L55 A;  4ZYS A;  3K6O A;  1XWE A;  4A93 B;  3Q24 A;  3U9S A;  1EL0 A;  4MIU A;  4ID6 A;  4A3J B;  1HCZ A;  2XSC A;  4RHS A;  4V19 0;  2WP8 J;  1SJE D;  1EY9 A;  1NR2 A;  3GO5 A;  4DA2 A;  3VA5 A;  3QB3 A;  3A55 A;  4NKL A;  4IAL A;  4DN4 M;  3GD7 A;  2F0N A;  1QWY A;  2SOB A;  1A3U A;  5C6A A;  2L1B A;  4K6D A;  3WOE A;  1V43 A;  1DD2 A;  1T5X D;  3EJI A;  3D3R A;  3GTO B;  2HUG A;  3QG1 A;  4FXK C;  5JEA J;  3MEH A;  1BOS A;  4CKC A;  3CHB D;  1FNV A;  3IFD A;  3OPO A;  4KJO A;  2FFK B;  5M5Y B;  1SYB A;  3MXP A;  4XYO A;  4HN7 A;  4H0L C;  3Q23 A;  1I4H A;  3OWE B;  5EBD A;  2EYJ A;  2KQ3 A;  1SBB B;  3Q6S A;  1KTK A;  3HS0 C;  5HGT A;  1FR3 A;  1Q90 A;  1HTP A;  1SNC A;  1JOK A;  3SVM A;  5I6W A;  5ELF A;  3K59 A;  2LS0 1;  5DAU A;  1TY2 A;  4IUV A;  2WAQ B;  1AW7 A;  5JJZ A;  2OT2 A;  2NVX B;  3URY A;  1MI2 A;  2R92 B;  1O7L A;  2K6A A;  2PPB C;  1LAB A;  3H09 A;  4DAV A;  3GV3 A;  4RA8 A;  3G7L A;  3BYY B;  1CHP D;  1WD0 A;  5JPM C;  2K33 A;  1CI3 M;  3VYR A;  2F0K A;  3MAQ A;  1ENC A;  1JB3 A;  2EYM A;  1HHV A;  3EFX D;  4RKL A;  2IL8 A;  2RDF A;  4PMC A;  5E4X A;  5COR A;  5FLX L;  5C0X G;  2KJX A;  3MXU A;  5CV7 A;  5I9O A;  2B2U A;  1U4L A;  3CKI B;  2B2V C;  2EVB A;  1BNZ A;  1PZI D;  1KLG D;  4BS9 A;  2WII B;  5I4D A;  5KEE A;  1IHZ A;  3NBH A;  1PLF A;  4LJZ C;  2BDO A;  2G9D A;  5C4H A;  3VR4 A;  3NQT A;  4G7H C;  3SHL A;  1DYQ A;  4KN4 C;  1SNQ A;  2NTT A;  2HCC A;  1LTA D;  5C5M A;  1KAB A;  3DWA A;  3DUZ A;  3FDT A;  5IIF A;  3G6J B;  4WOR A;  2A6E C;  1TWF B;  3GQB A;  2PNR C;  1H9S B;  4V0B A;  2EY5 A;  4XXE A;  2O2L D;  2K32 A;  5EPL A;  1GUT A;  5IGF A;  3DHQ A;  4KD3 A;  3T51 B;  1ZXT A;  4QMG A;  2QIL A;  3NUC A;  5D65 A;  3DEO A;  1PRT C;  5ELE A;  1OXS C;  3PIP 3;  5IT9 L;  1RF2 D;  1MSG A;  4H13 C;  1A3T A;  4RWS C;  2PCF B;  2NWG A;  1BF4 A;  1SYF A;  5JPN C;  5E4W C;  2K03 A;  3T13 A;  4C3H G;  5JVG 3;  2K5W A;  3KLS X;  4DK1 A;  1ZEQ X;  4R8I A;  1SYG A;  4C3J G;  2EYF A;  3K7A B;  5EKK A;  4OIK A;  4HTH A;  1WTO A;  2K01 A;  2VNU D;  1TWG B;  2HDL A;  1Q8I A;  3ERQ A;  2KUM A;  3V05 A;  1CFM A;  5IGG A;  2B8G A;  4C3H B;  1QE6 A;  4I7Z C;  1RDP D;  1RTN A;  4L63 B;  2FMC A;  1QIL A;  2F3W A;  3S1N B;  2B2T A;  3FMC A;  1IYV A;  2RKS A;  3KF8 A;  1AZP A;  4C3J B;  3J7A V;  3ONA B;  5JVH 3;  1ENF A;  2K1B A;  4IUR A;  5IGC A;  1BUV T;  2AUJ D;  2EYP A;  4IN3 A;  1I4Q A;  2F0U A;  1HA5 A;  1A3V A;  2JA5 B;  5C3W A;  2L0C A;  3AU7 A;  1D5Z C;  2WV6 D;  1Q1E A;  3VR6 A;  5TSS A;  2K28 A;  3MXN A;  1DJR D;  4N9T A;  1XXG A;  2PZW A;  2A68 D;  1F2Z A;  3TP6 A;  5E3F A;  3A7L A;  5CV5 A;  3M7G A;  3KBX A;  1K8O A;  1RJT A;  1A2T A;  1CK1 A;  1S5F D;  3SR1 A;  4KY5 A;  4GZY C;  3GV6 A;  2A5H A;  2R93 B;  1TU2 B;  2JA6 B;  1DOM A;  3BVG A;  1YNJ D;  1EY6 A;  4X3U A;  1J8I A;  4KMU C;  2H1E A;  2V4D A;  2F0H A;  1B9M A;  3PIO 3;  3K5L A;  4KV6 A;  2L11 A;  3P20 A;  3SXH A;  1Z47 A;  2F0O A;  1DOK A;  4EQP A;  3DMU A;  1FD7 D;  4DAP A;  5KYI A;  1TS5 A;  1PTO D;  1SMY D;  2A69 D;  1A6X A;  1PRT B;  4WJW A;  3NBI A;  3P1H A;  3TP7 A;  5IT9 E;  4CJ0 B;  1AP0 A;  2JEA I;  1KDA A;  3NWT A;  3JAM E;  1EYC A;  1OXX K;  4NP5 A;  1HRJ A;  5EPK A;  3S2D B;  1IW7 D;  2IT1 A;  3IFT A;  5C4X B;  5FKA C;  4JBW A;  1Z7T A;  1LV9 A;  3V96 A;  2WB1 B;  2RQX A;  5KNB A;  1I6H B;  4RAU C;  5DEH A;  2BDN A;  3NTK A;  1EOT A;  1S4Z A;  3WDN A;  4CGY B;  5FOB B;  5FO9 B;  5LL6 X;  1STN A;  3TME A;  1EQT A;  4KHV A;  2EYO A;  2F0J A;  3HEJ A;  4ZRZ A;  4KKU A;  2DY7 A;  4TKO B;  4FNF A;  4ZLT F;  3NSW A;  3OMG A;  2WAC A;  2SEB D;  1TS2 A;  2QKI C;  2XIW A;  1K83 B;  4BWG B;  3LWU A;  2E75 C;  3K5N A;  5C4Z A;  1QCB D;  1DM0 B;  2KCN A;  5K36 H;  3A8I E;  1H9K A;  1KDC A;  1JC7 A;  5LHY 1;  1GUS A;  2X6G A;  4JK1 C;  1QJO A;  1IYU A;  1HXY D;  2KEE A;  1U4M A;  2F0L A;  2F0S A;  2B39 A;  2SDF A;  1R4P B;  3NP8 A;  3MTS A;  4HMI A;  3NTI A;  1OXT A;  4RGN A;  3S1R B;  1CHQ D;  3H3V C;  2E2I B;  2DY8 A;  2NUC A;  4XTC S;  1BCP F;  1U4P A;  1VMC A;  2PZU A;  3AMU A;  4J8Q A;  1SYE A;  2NVQ B;  1DOL A;  4A3K B;  1KNA A;  1BXT A;  1B1Z A;  3LWE A;  2EXZ A;  2CW0 C;  1Y8P B;  4M1U B;  3T56 B;  4BBS B;  3GTQ B;  1WVL A;  4A3D B;  1RKN A;  4FXG C;  1KAA A;  3DEP A;  1C4Q A;  5CMD A;  4K2L A;  1MGS A;  1T5E A;  3BS1 A;  1V1P B;  3C2P A;  1MD2 D;  3UI2 A;  4RKB A;  1LT6 D;  1STH A;  2EJF C;  4IUP A;  1O7Z A;  2JYO A;  3L7Z C;  4ZUJ A;  3HP3 A;  4BY1 B;  4U67 3;  2O5J C;  1G91 A;  1GHK A;  1STA A;  3C3L A;  1ILP A;  1TS4 A;  2E74 C;  4OO1 H;  3R2T A;  2ZXO A;  3S14 B;  1ET9 A;  3OIP A;  4R9W A;  3EA6 A;  5ELC A;  2RVL A;  5A2Q E;  1II3 A;  2R61 A;  4HSP A;  1JWM D;  1Q3L A;  2D2C C;  2X69 A;  2EYH A;  3I4N B;  3TDQ A;  2J0T D;  4A3G B;  1PFB A;  2NBF A;  2RSO A;  1SND A;  3NE5 B;  1YNN D;  1KNE A;  2EY1 A;  4H44 C;  5ELD A;  5K5P A;  1ROD A;  2PZT A;  4TQU S;  1HUM A;  1TY0 A;  1E2Z A;  1EQV A;  4E6I A;  1V8Q A;  2PW5 A;  3W3A A;  1PMR A;  3N6R A;  2O4X A;  1ESR A;  3ND8 A;  4Q0F A;  4ODG A;  4NW2 A;  1IL8 A;  3CU7 A;  3M4O B;  2AWO A;  2BA1 A;  2QEJ C;  3K58 A;  2NN6 G;  4O1N A;  4G7O C;  2DNC A;  3EVQ A;  1LO5 D;  4F7X A;  5J1Z A;  3BG3 A;  3E6Z X;  5EKL A;  4R8N A;  2D62 A;  3BDL A;  1SFO B;  1LTB D;  1S5E D;  2I07 B;  2Z8L A;  1FGB D;  4RCO A;  1F9P A;  2XNA C;  1GXD C;  5T1G A;  2CVR A;  3N52 A;  4J1M A;  1PDQ A;  5C3E B;  4EQN A;  3QO2 A;  5A35 A;  1S5C D;  4A3I B;  5DNF A;  1JOO A;  3MZ5 A;  5C44 B;  2DNE A;  1WTX A;  4QCL A;  4QB4 A;  5JAV A;  4EGV A;  3RLF A;  1AZQ A;  1Y69 U;  2IX3 A;  4K8I A;  4G57 A;  2K05 A;  2Q8I B;  2RA4 A;  4CJ1 B;  4QUC A;  3DM1 A;  2XWJ B;  1EWC A;  2MP1 A;  4DF7 A;  3OW7 A;  3MVV A;  5CBA E;  1VMP A;  4LAA A;  4EVO A;  1IKL A;  1SEB D;  2AWN A;  4DK0 A;  1EYA A;  3J80 L;  1O78 A;  3X3N A;  3R8B A;  4KJN A;  2F1M A;  5HUR A;  1JIC A;  4ZKB B;  4K14 A;  5EKI A;  3P75 A;  1WTP A;  3DWP A;  4IZ8 A;  2IX0 A;  2LY7 A;  2JE6 I;  2BE5 C;  3HG9 A;  3VR2 A;  3HOX B;  3HOW B;  2SNS A;  1BQQ T;  5D3I B;  5KYL A;  1CTM A;  4L6T B;  1HPC A;  2XVS A;  3VR5 A;  4NDX A;  3KK7 A;  1S5D D;  1HUN A;  1D2B A;  2EY6 A;  5AFW A;  2MGS A;  4A3M B;  3MWY W;  3NK9 A;  5EGT A;  1ZYR C;  1OXV A;  4MHE A;  1I3Q B;  1Q1B A;  4K8J A;  3C46 A;  2FJ2 A;  3DWQ A;  1ZKO A;  1SE4 A;  2EDG A;  2PO4 A;  3TZD A;  3D31 A;  5M3M B;  3OMC A;  1LTG D;  2MJ8 A;  1DZ1 A;  5C0X I;  2F0P A;  3T16 A;  2WIN B;  5KRU A;  2XRQ D;  5J39 A;  3CRK C;  1WTQ A;  5FO7 B;  2A6E D;  1TVX A;  4B9W A;  1EY5 A;  2B2Y A;  2XRS D;  3D6W A;  2NVT B;  3C1E A;  4X3T A;  4O42 A;  1EZ6 A;  2VB2 X;  4PV1 C;  2PYK A;  1O80 A;  3ERO A;  4ZAI A;  1LAC A;  2BOS A;  1XYI A;  4KY6 A;  1F2Y A;  2B8F A;  2M00 A;  2PQE A;  3WOF A;  1PRT D;  5J22 A;  3V2T A;  2F03 A;  1B3A A;  1EIH A;  2DN8 A;  1STG A;  3OHX C;  3PMF A;  4OIJ A;  3HOU B;  4QIW B;  4PNY A;  3J81 L;  2OXP A;  2JEB I;  3VYU A;  2K5Q A;  4XDX A;  2A6H C;  2VXW A;  3TZU A;  2K04 A;  3PUY A;  2EYL A;  3TSS A;  2KCC A;  1BCP C;  4I65 A;  1JCK B;  1TII D;  1EEI D;  5I6Y A;  4CBV A;  4Q5V A;  1LLR D;  1Y1W B;  4IUU A;  4ZK9 B;  4CHT B;  5FLX E;  1ML0 D;  1B9N A;  1EEF D;  5IGB A;  4F87 A;  1HA6 A;  4FYD A;  4HSV A;  2IWH A;  4WFN 3;  3FVQ A;  3EQL C;  4OL7 A;  3R2I A;  2B2T C;  2KED A;  1B50 A;  1LT4 D;  1QOH A;  3FEW X;  4RGM A;  1XTC D;  3SK6 A;  4PQX A;  1G29 1;  4BA2 I;  2YYZ A;  3P7J A;  3IKJ A;  2RSN A;  3J80 E;  1OXU A;  4XYQ A;  2Y0S B;  4K6L A;  1ICW A;  2GA4 B;  3SK5 A;  4C1N K;  2KA7 A;  4TRD A;  4DAY A;  1GOZ A;  4ILW A;  1EY7 A;  2AUK A;  1D1K A;  4KI0 A;  2ZXR A;  1F77 A;  1VCI A;  4KD4 A;  5DM7 3;  1I4P A;  5G3L D;  2X6L A;  1K8M A;  2R3Z A;  3I90 A;  1WTV A;  3W2D A;  1BR9 A;  1B53 A;  2KVM A;  4LK1 C;  3HOY B;  3C1F A;  1XX8 A;  1G2T A;  2L5T A;  2FMM A;  1E2W A;  5M9O A;  1TWA B;  2A73 B;  2L4N A;  2M2L A;  3DXJ C;  2B2W A;  5JOB A;  2C9O A;  4Z9C B;  4PMB A;  5COY A;  1CQF A;  5C0X H;  4FP5 D;  3KBG A;  1JWS D;  5C3X A;  4C3I G;  2TMP A;  3D8G A;  1ENA A;  3PUW A;  2BA0 A;  1OO9 B;  2VUM B;  4BY7 B;  1UEA B;  1CZW A;  3GTP B;  1QNK A;  3D6C A;  4A3E B;  1GUN A;  4CKB A;  4K5W A;  3U9O A;  1GHJ A;  2PMZ B;  1LTT D;  2QDB A;  4N9P A;  4KK7 A;  5CBE E;  2F0D A;  4DGZ A;  5CV4 A;  4NMZ A;  4C3I B;  3VR3 A;  5NUC A;  2KEC A;  3M4Y A;  1W6J A;  2QCP X;  2M9V A;  2RDH A;  3QWN A;  1L0X B;  4G7Z C;  1HFG A;  4KHZ A;  3S16 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...