4NP5A

Crystal structure of staphylococcal nuclease variant delta+phs v66a/i92n at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYNYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4np5A00
3QB3A 4QB4A 4PMCA 3SXHA 4G57A 3SK8A 3MXPA 2O4XA 3MZ5A 3HEJA 2EY6A 3MHBA 2F0NA 1EZ6A 2F0EA 1STNA 5M9OA 3D8GA 5CC4A 1RKNA 5I6YA 3D4WA 1EY7A 3P1HA 4NP5A 4HTHA 4KHVA 4B9XA 1EY4A 2OEOA 4WORA 5E3FA 4OL7A 2F0FA 3P75A 2F0MA 1SYCA 4KY7A 5EKKA 4DGZA 5C5LA 3RUZA 2F0PA 4F8MA 4N9PA 5IGFA 5KIXA 2EXZA 1EY6A 1JOOA 3BDCA 1U9RA 4EQOA 2F3WA 1JOKA 4K5WA 2OXPA 4PNYA 4IUNA 4ZUIA 5ISRA 4R8NA 5CV9A 5KYIA 1A2UA 3SK6A 1A2TA 1TQOA 4K5XA 2F0GA 4N9TA 3E5SA 1ENCA 2F0JA 1IHZA 2F0HA 3NHHA 3NXWA 1EY9A 1EZ8A 1TT2A 2EYJA 3D6CA 3MVVA 4K14A 1F2YA 1SNOA 5EGTA 3BDLA 2F3VA 4S3SA 3SR1A 5C4HA 3D4DA 4HMJA 5C4ZA 1SNPA 5CV4A 2F0DA 4KJOA 4I65A 1SYEA 2PZTA 2PZUA 2NUCA 5CGKA 1A3TA 2M00A 5E1FA 3OWFA 2RBMA 5CV7A 4ZQ3A 3H6MA 4K2KA 5CV6A 4J1MA 4ZUJA 3TP6A 1ENAA 5IGCA 4DFAA 1F2MA 3R3OA 1EY0A 5C5MA 3SK4A 3V2TA 4EQNA 5KEEA 1AEXA 4KTAA 4KV6A 4RKBA 5IGDA 4DF7A 5C6AA 1II3A 1STBA 2PQEA 4YIJA 2F0OA 4RKLA 3EVQA 3OMCA 3HZXA 2WACA 5HGTA 3U9OA 5J22A 1TR5A 2RDFA 3NUCA 3VA5A 1NUCA 4PMBA 4K5VA 2F0TA 4K8JA 3EJIA 2EYPA 5C3XA 4WRDA 4K6DA 5CV5A 1KAAA 3TP8A 4EQPA 4B9WA 5IIFA 5JAVA 2EY5A 2EY2A 4KY6A 5JOBA 1KDBA 1EYCA 4KJNA 3T16A 4ID6A 2KHSA 3QOJA 1STGA 2KQ3A 2F0WA 2QDBA 1F2ZA 4IALA 4NMZA 3ITPA 5DEHA 5F2DA 4J6HA 1KDAA 4DU9A 5KGUA 4K2LA 2EYLA 1EY8A 4TRDA 4E6IA 1SYBA 4NKLA 5DAUA 5C3WA 3C1FA 3DHQA 3DMUA 3NQTA 3EROA 3SK5A 2SNMA 2F0UA 3TMEA 3C1EA 2F0LA 4H7BA 4MIUA 5K5PA 1STAA 2RKSA 1STHA 4HMIA 3T13A 5IGBA 5CR3A 3LX0A 2F0QA 3ERQA 1A3VA 1SNMA 2PYKA 5EKLA 3TP7A 5HURA 5IGEA 4ODGA 4IZ8A 1STYA 4ME5A 1KABA 1SYGA 3NP8A 1SYFA 2OF1A 1NSNS 3OMGA 3NK9A 5J1ZA 5IOCA 5NUCA 2F0SA 5IODA 1SNCA 1SNDA 2PW7A 1EY5A 4QF4A 4EVOA 5KYLA 5KRUA 3QOLA 4F7XA 1EYAA 1A3UA 5I9OA 3S9WA 1KDCA 1EYDA 4K8IA 2PZWA 5I9PA 1JORA 2SOBA 5J39A 4LAAA 2F0KA 3TP5A 2ENBA 5CV8A 2EY1A 2F0IA 1SNQA 1SYDA 3PMFA 4KD3A 4NDXA 5I6WA 4QMGA 1JOQA 1EQVA 2EYOA 2SNSA 2LKVA 3OSOA 2EYHA 2EYFA 5IGGA 2F0VA 4KD4A 3SHLA 4KY5A 2HQEA 3MEHA 2PW5A 2EYMA
chains in the Genus database with same CATH superfamily
2MHVA 4WJWA 4C3HH 2HCCA 4PMWA 4RCNA 5TSSA 4BXXH 3VYRA 1X32A 3FPPA 5FJ8G 2CWAA 5KNDA 4J15A 1GUTA 5I6YA 4PG3A 2QGQA 5EKKA 1GUGA 1SYCA 3HOVB 1GJXA 3BVGA 5ELNA 1LLRD 3HOYB 2GVAA 5KIXA 1JOOA 2VQFQ 2OTLA 4JCVE 1I3QB 2E2IH 3CCUA 2YU9B 1G291 5CV9A 1RIPA 2Z6KA 3MWYW 3STBC 1I4QA 3OWEB 4OIKA 1A15A 2ZJRA 1R9TH 1SFOB 2L11A 4O42A 3IAYA 4TQUS 2VY3A 4WJ4A 1RF2D 1VQIA 1O7LA 2F0DA 2HHHL 4A3LG 2D0OA 4BY7B 3RZOH 4DV7L 1QCBD 5IGCA 1QUQA 1VF5C 2YYZA 2G9HD 1EY0A 5M5WB 4DKAC 4DF7A 3CC7A 1STBA 4GOPB 3GTLB 4JPBW 1AH9A 3PF4A 2WKDA 1PMRA 1I94Q 2JQOA 3MXUA 4DV5L 1X9NA 1KC8C 1HNWQ 2H1EA 4K6DA 5M3MB 2QCPX 4R4QA 2L4NA 4PZ8A 2K28A 5DM73 1TKWB 4PZ6A 3A5UA 3S24A 1PRTB 2EZVA 2CH4W 1MJEA 2BE5D 1C48A 1LT3D 3C1FA 1OXVA 2JA6G 3RMHA 5CR3A 2B2WA 1MSGA 4DR1L 1YHQA 3BZDB 1SYGA 3OMGA 5IOCA 4V190 2Q2IA 2HDMA 3M3YH 1Q8KA 4K8IA 1K73C 2GVBA 3GV3A 4LAAA 4AQYL 2F0IA 1T9HA 1SNQA 4C1NI 5I2YA 2A74C 2EYOA 4WJ3M 3MXNB 1O7ZA 4R4IA 1O7IA 4MTNA 1PTOB 4M1UB 4IFDI 2K04A 4X62L 2WB1E 1FNVA 1WCMH 3KLSX 2LMCB 4G57A 3MZ5A 3KLWA 5FLXc 1STNA 1H9RA 3D8GA 3K58A 1YEZA 3P1HA 3EQLC 2UXCL 4YCVA 1JJCB 4AYBE 4CKCA 4DGZA 4F8MA 1PA6A 3PGZA 1LT5D 4IO9A 1VQ5A 2K14A 3PUZA 3K81C 1PFBA 2A6ED 2Z9HA 3D3RA 4RCOA 4XQNA 1V1PB 4LW1A 3BS1A 4IUVA 4RGTA 5EJWA 1KL9A 2F0GA 1PZJD 2F0JA 4APVA 1YI2A 4IOAA 1OXXK 2ZJPA 3PIOA 3CHBD 4KJOA 4A76A 1Z47A 4I65A 2EIFA 1HR0W 2EE1A 1UEBA 3PIPA 4A93G 1AEXA 4A3GG 4JBJA 1TWFH 4HEDA 2XRSD 2HT1A 1UE5A 4DV2L 3HZXA 2VB3X 1E7ZA 4XT3B 2E75C 3U9OA 1BR9A 3BZKA 2B2UC 3AMUA 2NWGA 4ABNA 1XTCD 4A3KG 2AUKA 3L0OA 1M1KC 3I4MH 4H13C 2EY5A 3K0XA 3NPPA 1EYCA 2B63B 2AQ3B 3S1QB 1U4RA 4YCWA 4LF9L 2A6HC 2F3IA 1LT4D 4BY1G 3T1YL 4QIWB 3BDOA 3N52A 2H5XA 3DMUA 1RODA 4DR5Q 4A3CH 4IURA 3MEFA 4HMIA 2E2JB 3ERQA 4L5SA 5M3FG 5HURA 2A68C 1STYA 4C2MB 4EGVA 1TS3A 1X3PA 3CC4A 1SNCA 2A73B 2Z6BA 5BR8Q 5KYLA 5IT9L 4JI5L 1N32Q 5IT9E 1TWAH 2VUMB 2JA8G 3CKIB 2JYOA 3FPUB 4XYOA 1CA6A 4RWSC 3K6OA 1HFNA 3M85A 2SNSA 2K52A 4H44C 3CU7A 1X3FA 3KF6A 4Q5VA 2QDLA 1BCPC 2VQEQ 2PW5A 1Y8OB 1XJVA 1NAPA 1EIGA 2CVRA 3PUVA 1KNEA 1F2LA 3T4AC 5IYCG 3VR6A 1IBLL 1Y1VB 4YY3Q 4A3GH 3K5OA 4DR3Q 2ZXRA 4POFA 1HHVA 4DUYL 1DZ1A 2NB0A 3RD4A 2IWHA 1GM5A 1PDQA 4C3JG 4A3DB 5IGFA 3I3CA 3G6JB 2EXZA 1B3QA 1DD2A 3I90A 5LMNQ 1K0RA 1FL0A 2XIWA 2JE6I 1M90C 1CKNA 3TQYA 4XQJA 3GD7A 2Z4IA 1ENCA 1IBKQ 3TRZA 4B3TQ 4A3JH 1SNOA 4RMFA 1NNXA 3GTQH 1IKLA 5E7NA 1X3QA 1XNQL 1CQFA 4EQ5A 1DONA 2RDGA 1KHIA 4LFBQ 5IYBH 1EUJA 1F2MA 1BUVT 2PQAA 2CH4A 4GN4B 2Q2HA 2K03A 4I7ZC 5K36G 4RKLA 1WTOA 2A5HA 1B53A 2WACA 4LF4L 1E24A 2DNEA 5J22A 1Q46A 1D7QA 3HP3A 3UDXA 3D4RA 2PNHA 3V96A 3OTOL 3PO3G 1LYLA 4WRDA 5CV5A 2XRQD 3HKZB 1IBMQ 3DM1A 1N8RC 2QEXA 1B2TA 2RSNA 5DEHA 5IWAQ 1E1OA 4CGYB 4A75A 2ES2A 1JC7A 2OQ0A 2CKZB 4JYAL 1NBWA 2V1CC 4A3BG 4H7BA 3GTJH 3EFXD 1E2VA 4JI2Q 2OF1A 4LFCQ 5JPNC 3DLLA 1Y69U 1HH2P 2K75A 3HRZC 4R8IA 5JEAG 4JBMA 2Z4HA 1YVCA 1YZ6A 2C35B 2E74C 1DJRD 3CCRA 1XPRA 1L0WA 1CSPA 1AN8A 3X3NA 2LKVA 4DK3C 3NSWA 4QIWE 3VDYA 5IGGA 1MGSA 2N3SA 4LF5L 3MEHA 4B3SL 4QB4A 3CXCA 5JJKA 3H3VI 2O5IC 3Q8DA 1CZGA 2L9HA 3HEJA 2EJGC 3SDZA 4C3IH 2B3GA 3MHBA 2F1MA 4FYDA 2JA6B 5K36H 3G48A 4WORA 2ZM6Q 2BOSA 1PRTF 2MPMA 3GQBA 4O2DA 5C4XH 1SBBB 2SDFA 3UE1A 1WTVA 3I4NH 1VQGA 2ZT9C 2F3WA 4KHPQ 2OXPA 2MO1A 3CCEA 4B3MQ 1OXUA 2OQKA 3M4YA 2IW3A 4OO1H 1YHBA 3E5SA 1G2TA 3VA7A 2L55A 1HR0L 2VW9A 1E0BA 5GQOA 1T5XD 4P72A 4XTCS 1TWHH 3HKSA 3AU7A 4X64Q 2Q8IB 4YHHQ 3PUXA 4ZUJA 3TP6A 3GTPH 4DFAA 5C5MA 5FO8B 1KIXA 1PZID 1V1OA 4L8JA 1II3A 4LF8L 3SE0A 3U50C 1PTOF 1C4QA 1SMXA 1TR5A 2RDFA 4DV6L 3WOEA 4ZRZA 3FEWX 2UUCL 1DM0B 2WAQG 1YNXA 2IX0A 1SSOA 3MFGA 4KJNA 3S1MB 3E9IA 1U4PA 2Q2TA 2K5WA 1VDZA 2KQ3A 5CBAE 1LTID 1I6VC 2I5MX 3R2TA 5C0XJ 2A1AA 4TRDA 1XMOQ 1SYBA 5C3WA 2L15A 3NTHA 1ASZA 4A3IH 3ND8A 4TKOB 3TMEA 5EPJA 2RCNA 1STHA 2R7ZH 3A55A 2LXJA 1Z6HA 3U9SA 3VR4A 4A93B 1WI5A 3C2PA 4A3GB 3NK9A 4QCLA 4PV1C 4DAYA 1WTQA 1PFSA 4GKJQ 1IW7D 2IT1A 5C0XI 3ZJYC 3HKZE 3H15A 3E0JA 1JMCA 4DV3Q 4A3KB 1LTBD 1SYDA 1AZPA 4QGUA 3AYHB 1YNND 5HGQA 4IQZA 2D0PA 2EYHA 4CDDC 5FK9C 2NVQB 2QF7A 4DAPA 3I72A 4BY1B 3F1ZA 2ZTEA 4LF6L 1MBYA 2Y0SG 3E3XA 1K83B 4IPDA 2RSOA 2NN6G 3M9BA 3QG1A 3JC66 4HR7B 1PV4A 3PV0A 4LF7L 4OWWB 2F0MA 5M3FB 2ID0A 1VQOA 3AB9A 1P16A 1B9NA 3BDCA 4K5WA 4A3EG 1PVOA 1KQSA 1A2UA 3JAMc 1YJNA 3SK6A 1A2TA 2EJMA 3FKIG 4CHTB 1AP0A 2VXWA 3S1RH 3C3LA 5JJLA 1HRJA 1EY9A 5EGTA 2JA8B 4FNFA 5C4HA 4RGNA 4DNIA 4DV4Q 1H9JA 3DWQA 4BBSG 1ZKOA 5CV4A 3TSSA 4HSVA 1PH9A 3RLNA 1CSQA 3OWFA 2RBMA 4QJFA 5M5XH 4FF3A 3EA6A 3BVZA 1DOMA 4JI6L 5IGDA 1FGBD 2E2HB 5D3IB 1AE3A 3OMCA 1YNJC 3I8ZA 3ULLA 1MD2D 2XGTA 3NUCA 4LWCA 1HNZL 1P8LA 1I50H 4C3JB 1HTLD 1LACA 5KNCA 5DM63 3HOZG 4A3FG 2R93B 3CCVA 1HQMC 2MNAA 5DLQE 5IE8A 1V1QA 1B8AA 4HJ9A 1K3RA 4LK1C 4DXGA 1N33L 4C3HG 4G7OC 2I07B 3K7AH 5G3LF 4CKBA 1RDPD 4BXXG 1CI3M 4FO2A 4CDEC 1HPCA 1G6PA 2F0UA 4YWLA 1A62A 1STAA 3LWUA 2D62A 3S14H 3M4OB 1YBYA 2Q2UA 5D3DA 5CYUA 5IGEA 2UUAQ 3OHXC 4RG1A 1KABA 5G3LD 1L2FA 1SYFA 4LFAL 2AQ2B 5C44G 4JW0A 3CCLA 1EYAA 1BF4A 1XNRQ 3S9WA 2IY5B 1FR3A 1E22A 4HJAA 2F4IA 2K5QA 2Z0SA 2JJQA 1SR3A 3MTSA 3ONAB 4GLVB 2FJ2A 4GZYC 1PYBA 3FRPB 2NVYB 3L7ZC 4KD3A 2OT2A 2DGYA 3PO3B 1XPUA 4JBWA 4P74A 2F0VA 1J5EL 2AMCB 3KYHC 3WWVA 3ICEA 4K0KQ 1ZXTA 2BH2A 4Y7NH 2B2YA 2R61A 4DR4L 2F0NA 1RKNA 4NXNL 4A3BB 3CPFA 1J9OA 3P75A 3CF5A 4U68A 1K8MA 3CP0A 1K9MC 2E76C 3A8JE 1JT8A 1PH5A 3NBHB 4IUNA 2M9VA 3KF8A 4JI0L 2I5HA 4PQXA 2NVXH 1K28A 3D6CA 1L1OC 4S3SA 1NMFA 4ME3A 2UUBQ 1EQRA 1N34L 1SYEA 3DEPA 1A3TA 1WFQA 4JV5L 4MN3A 4OWTB 1D1IA 1TWCB 3PUYA 4JI8Q 2R92H 4KTAA 2GA4B 1GHKA 1YHAA 5T1IA 2PQEA 1BKBA 4LUVA 5C44H 2ICEC 5A35A 3A7LA 3J81i 1NUCA 1CA5A 2F0TA 4Y52H 3A7AB 3HGBA 3BYTB 1B9MA 1XX8A 2N55A 2UXBQ 5EQ0A 2A8VA 4QQBX 1WCMG 3LWEA 5J3BA 1HA5A 4K2LA 1QILA 4JBKA 1S5BD 3M4PA 2JA5H 2O5JC 1ICFB 4A4IA 3GTKH 2A69C 2HIVA 4FXKC 5ELBA 3ULPA 4A3MG 3GTMH 2L5TA 1ML0D 5M5YB 4NXMQ 1A3VA 3M7NA 3K5NA 1RD9D 1WJJA 4L6TB 4X6AH 4JI3L 4MHEA 1E2ZA 3CCJA 3O13A 1E3PA 1SDFA 1FYCA 4KKSA 4QF4A 1RHPA 1U5KA 3G7LA 1EEFD 4BA1I 1A3UA 1EEID 1KDCA 2AQ1B 2K5DA 1QZGA 2WP8J 4IUQA 4JI1Q 1OXTA 1VCIA 1BDOA 4QMGA 1FJGQ 1SE3A 2EPBA 2WAQB 2EYFA 3KDFB 4KD4A 4GS3A 3VR2A 4F88A 4J6HA 2F4VQ 2NBFA 4KN4C 2PO4A 1I6HH 5BN4A 1ET9A 4C1NK 5JPMC 4IFDJ 1JB3A 4QL5A 2ZXPA 3ND9A 1EZ6A 2F0EA 1CKOA 2TSSA 4CKEA 3RNUA 1BCPF 4HAEA 4AH6A 3PO2G 3CCQA 3RLOA 2E5LL 5E3FA 3HOWG 2OCEA 2HD3A 1TY0A 3HOUH 3S16H 3I4MG 1R4PB 5EPLA 1IKMA 2YTVA 1BVSA 1BCPD 3EBEA 4MNOA 1B1ZA 1I50B 1M4VA 3NXWA 1N9WA 5LL6S 5BN3A 1SNPA 3I73A 1A8VA 1BOSA 4GN3B 1KLGD 1TS5A 4A3CG 3TZDA 2M00A 1I4PA 4DK6C 5CV7A 4C56C 2HHHQ 4A3MH 1Q81C 2K05A 3G6EA 2X6LA 1D5MC 3R3OA 1VQEA 2Y0SB 3RR5A 3Q24A 4DV7Q 5FO9B 3S2DB 2F0OA 3PUWA 4DXFA 3BU2A 1EQQA 4X3TA 1BBXC 3A56A 1S5FD 2PI2E 2K6AA 1N36L 3CC2A 4DV5Q 1QE6A 1CFMA 3DWPA 3S15H 3CAMA 2VS1A 3TP8A 4EQPA 4A3EB 5JOBA 3T56B 1C0AA 3GDEA 3FKIB 4GNXC 2KHSA 3OW2A 1AE2A 1STGA 2Z8LA 4EQNA 1F2ZA 5I2XA 4U673 2B2VA 2EYLA 2NVTH 2JA7H 4BBSB 2R6GA 4DAMA 3SK5A 4BBRG 4TVAB 3PO2H 4X3KA 3LNNA 1W3SA 5D14A 2RKSA 2B8FA 3F8TA 3LX0A 2HCIA 2JXMB 3NEMA 2I5LX 1E2WA 2KUMA 3HOWH 1QVGA 4MTKA 1VQKA 4DR1Q 1IZ6A 1QJOA 1NSNS 1KAWA 1STEA 1TXYA 4GOPA 1MI2A 1D1KA 2AWNA 4R4OA 1RL2A 4A3JG 1L1OB 1K8GA 3HOZB 4A3FB 1JOQA 5IY0A 5EBDA 3S1NB 3KBGA 1B4OA 3OSOA 4KI0A 4AQYQ 1PHJA 1KNAA 4KY5A 4C3HB 3J7AV 3SXHA 5IYBG 3RZDH 2PNRC 1CKMA 2D5DA 3MXPA 4X62Q 4IN3A 4G4KA 5CMDA 1GOZA 2K01A 2G5DA 2UU9L 1VQ4A 3D4WA 4HTHA 4KY7A 4P2CB 1QZHA 2B2TA 2AKWB 2UXCQ 3T51B 3A0JA 2R3ZA 4JOIC 2E2IB 1U9RA 1LO5D 1LTAD 4EQOA 4ZCKA 2KJXA 4P71A 1Q3LA 1QG7A 5ELFA 3HS0C 2V4DA 3J7YW 2IPKD 3GTGH 1B44D 1TQOA 1R9TB 3BZCA 3P7JA 2K5HA 3E9HA 1F2YA 2MQHA 3K7UC 5C4ZA 1AW7A 1VQ7A 4HIDA 1VQJA 3D6WA 3MXNA 3S2HH 1HNXL 3RZOB 5E1FA 4BBRH 5CV6A 1NTGA 1VQ6A 1HZBA 4X66L 1S4ZA 4RKBA 3DWAA 3I56A 3GTMB 3EVQA 4FXDA 2JA9A 1HJPA 4DV2Q 3U4ZA 1EU4A 1Z7TA 5CORA 5D65A 2LS01 2N88A 2BCOA 2VZAA 1VMCA 5IP9H 2D2CC 2M2LA 1V1PA 1Q8IA 3T16A 4JK1C 4ID6A 4B3RL 1SMYD 3IKJA 4ZKCB 1Y14B 1EYGA 1QNUA 4LF9Q 4C3IG 3T1YQ 4LUOA 1WD1A 2A6EC 2SNMA 1DOLA 1W2BA 1CHQD 1SNMA 1VQMA 1UE1A 5C4XG 5C3EH 1Y1WH 3I4NG 4JI7L 4CBVA 3M3YB 3W1GA 1O80A 3HOXG 4OO1G 2KHIA 3S16B 1IYVA 4KK7A 4O0AA 4JI5Q 1FD7D 4JC0A 4UP7A 1TIID 1D8LA 1JB7A 3I70A 2ZTCA 3Q6SA 3T1HL 1K8AC 1WCMB 3NWTA 4IJHA 2JK8A 3CCSA 1SROA 4ZLTF 4A3MB 1IBLQ 4B9XA 4KHVA 4X65L 1HZ9A 4OL7A 1JORA 1UNSA 2H4OA 5C5LA 1IL2A 2IX3A 2XVSA 4DUYQ 3RN2A 1WTHA 1EU3A 4AYBG 3TDQA 5T1GA 1XTDA 2ZTDA 5ISRA 2Z6KC 4R8NA 4IFDH 2NN6I 3CQZH 1I4RA 3I4OA 4GNXB 4RGOS 2UXDL 2HQLA 1VMPA 5IYDH 3J80i 4A3IG 4KN7C 5CGKA 1TU2B 2R7ZG 2CCZA 5CBEE 1Q12A 1EIFA 3H6MA 4K2KA 3RLFA 3S17H 1XNQQ 3T53B 3OYYA 4XT1B 1TWFB 4I7AA 3PO2B 3ERSX 3A8IE 5GAGC 3CD6A 2BDNA 5FKAC 3HOWB 3HOXH 4LF4Q 1PRTD 4K5VA 4RH6A 3I4MB 2L1BA 2BDOA 3DUZA 4UP9A 1NCVA 1F9PA 3R2IA 4KY6A 4WFN3 1FNUA 1KDBA 1SE2A 3OTOQ 3G4SA 1X56A 3GTOH 4OXPA 2KECA 2BA0A 1DYQA 3Q23A 2BA1A 1LUZA 5KGUA 2JN4A 2RCFA 3VYUA 4QUCA 2KBNA 4JYAQ 1H9SB 2B2WC 1SN8A 2J0TD 2PYKA 4H0LC 4GN5A 1VQAA 3CRLC 3K57A 5J1ZA 2FMCA 2LSSA 2JEAI 5IODA 1SNDA 2K7VA 2PW7A 4EVOA 1TWGH 4G7HC 1CQVA 1EIYB 1PTOD 3QOLA 4HN7A 4V0BA 4JI4L 1TWAB 4L5RC 3LGJA 4OX9L 2B8GA 5FOBB 5FLMH 2NTTA 1VQLA 2Q8RE 1ESFA 5CV8A 2EY1A 2LY7A 3I7FA 2KCTA 3KK7A 2KEEA 3A5ZB 4PMCA 4LF5Q 2NZOA 5EAYA 4FF1A 3J7AF 4B3SQ 4B08A 1SLJA 2EY6A 3UI2A 4DN4M 4BBRB 1MKHA 1F77A 3SGIA 4DAVA 4UAIA 3A54A 2F0FA 3PIO3 3HOVH 1CK1A 1YIJA 3HOYH 4CJ1B 4UP8A 1NMGA 5FLXL 1LTTD 1I3QH 1Y8PB 5FLXE 3PIP3 1OXSC 2YU9H 2PMZB 4X3UA 4K5XA 3OPOA 3WDNA 1IHZA 5HGTA 4A3JB 1SFOH 1ASYA 3GTQB 4HMJA 2CW0D 1RJTA 1HR0Q 4BY7H 1XMQL 3SK4A 1KTKA 4DNTB 5C6AA 5M5WH 3L2PA 4LMQD 4DR6L 3GTLH 4LF8Q 1QNKA 1C7YA 4KMUC 2B2UA 5E4XA 4DV6Q 2EYPA 1SAPA 3UDIA 2WIIB 5IIFA 2EVBA 1I4HA 2UUCQ 2EY2A 3K5LA 3ER0A 3IFDA 4IALA 1TS2A 4NMZA 3ITPA 4GKKL 1BQQT 4FF4A 3PCOB 4LUZA 4OGQC 4ULLA 3STBD 1ONLA 3GTJB 3SVMA 4DV0L 3T13A 4DR7L 4Z9CB 2WV6D 1JCKB 2R7DA 4DUZL 1U0LA 5L37A 4DR2L 5AJ3L 2AWOA 3GP7A 1X54A 4R4TA 2B39A 3I91A 3VR5A 1H9SA 2RDHA 2PZWA 3CPWA 2F0KA 3PMFA 1EOTA 1Q1EA 2XN9C 3Q0AA 1GUWA 1HQRD 1PFNA 1PFMA 3A74A 4RHRA 2HQEA 3J81c 1B50A 1QUQB 1PTOH 3F2UA 2IL8A 3GO5A 1PYSB 3SK8A 4UPAA 2R92G 4C3IB 4LF6Q 1RTOA 2KENA 5M9OA 3TS0A 3HFZB 2VQFL 2F0PA 4N9PA 2N8NA 5C4XB 2KCCA 4LF7Q 3KJPA 3I4NB 4PZ7A 1WTXA 5COYA 5E4WC 2IHFA 3HOXB 3H3VH 1YJ9A 3TBIB 5LMNW 2VUMG 2JSOA 5IGBA 3V05A 3AQQA 3G71A 3D4DA 2AUJD 3FP9A 2JA5G 1J8IA 4ZK9B 1TWHB 2B29A 2PZUA 1DCZA 1D5XC 1Q90A 1LV9A 3GTPB 1IW7C 1X3EA 1HXYD 1VQFA 1IYUA 3V2TA 1Y1VG 2KVMA 3NWSA 1I94L 3F2DA 4JI6Q 1YNNC 5C0XG 3SEBA 1GVPA 3HG9A 5C4JH 1HNWL 3FDTA 3OIPA 1GUOA 1J6QA 4A3DG 4PMBA 1SJHD 2KOLA 2PMZE 2QW7A 1HNZQ 3DM3A 4MZ9A 2K50A 4AYBB 1EL0A 1KAAA 3FMCA 1FNWA 3PQIA 3K80C 2B63H 1Z9FA 2QDBA 5F2DA 1N33Q 1BO0A 2WKCA 4NKLA 5DAUA 3TN2A 4A3IB 2RHSB 3I4LA 1E1TA 2R7ZB 2YTXA 4DPGA 4OONA 4XQQA 1UE7A 4NB3A 3TP7A 1V43A 1PH3A 2E2JH 3HOUG 1M8AA 4C2MH 2R7FA 1JE5A 1JR0D 1CT1D 5NUCA 3UDFA 3PF5A 1JWMD 1S72A 4OHJA 4LFAQ 2HIXA 1QB5D 5I9PA 5LHY1 2VUMH 5I6WA 3W3AA 1JICA 3MA2B 3I2ZA 1EOVA 3HKZG 2K33A 4R1JA 3VYSA 4DA2A 4L5TA 1G8ZD 2LFNA 1J5EQ 4NW2A 2F52A 1Y1VH 4DR4Q 2E8GA 1EY4A 2A6HD 5C0XH 1MHWC 1EWIA 1HA6A 4NXNQ 3RUZA 1LM0A 3NBIA 4A3DH 1UE6A 1VF7A 3DXJC 4JVZA 1HCZA 2MO0A 3S1RB 2LXKA 2A68D 4HJ8A 4BS9A 1AZQA 4JI0Q 5IP7H 1QVFA 3BDLA 3SR1A 3BG3A 2QILA 2JA7G 1ENFA 1ZYRC 4OWXB 5JVH3 3OOCA 1HUNA 4L5QA 1CZWA 5EPKA 1SE8A 3VYTA 2C5CA 5M5XB 1PZKD 1N34Q 2ICIA 3IRBA 4FDBA 5LMUL 3KOJA 3KJOA 4KV6A 3F2BA 4JV5Q 2EQSA 3QIAA 5FJ8H 1VQBA 2MUYA 4XIGS 3B6YA 2QEJC 2CFMA 2JEBI 2OTJA 4HIOA 1V8QA 3EJIA 1PYWD 3F2CA 3KF6B 3WOFA 5JAVA 1TS4A 3NBHA 3UDGA 2PI2A 4J8QA 1D2BA 2N49A 3K7AB 3UE0A 1B7YB 4E6IA 4DR5L 3NE5B 3K5MA 2JP1A 2FFKB 2IJ0A 4F87A 1PLFA 2EOTA 4A3LH 3S14B 4MIUA 1G91A 1KRTA 4QY7A 3TREA 1C8CA 5ELEA 4ME5A 1S3OA 5BR8L 4FVMA 1N32L 4JI3Q 2F0SA 1CKNB 1UWVA 1GHJA 2SEBD 2DUDA 1L0XB 1FGUA 1I4GA 2K5VA 3NTIA 1S40A 2ENBA 1ILQA 2ALYB 2VQEL 1VQHA 1F9RA 2EJFC 1WTRA 3SHLA 3VR3A 2IHEA 2CHBD 4OO1I 3R8BA 2PQAB 4YY3L 4Y7NB 4KKUA 4CJ2C 4TSSA 4DR3L 2MP1A 4OELB 1L0YB 5EBCA 1LABA 5A2QL 4KLKA 1O78A 5A2QE 5JEAJ 1IL8A 3E0EA 3TZUA 1OTCA 2ATWA 2JA6H 1HFGA 2I46A 1MJCA 2D9UA 3L3OC 3BJUA 5LMNL 1BNZA 2E5LQ 1JWSD 4IUPA 5LMUQ 1GXDC 1EY6A 2EDGA 2Q8TA 2RQXA 3A8KE 5C4JB 4ZUIA 5IP9G 5KYIA 1IBKL 3KFUA 1AFPA 2NVXB 4B3TL 1G51A 1XYIA 5KNBA 2QKIC 3NHHA 2EYJA 1TT2A 3MVVA 4RA8A 2XTIA 1A6XA 1W6KA 1PH1A 2PZTA 3CCMA 2IX1A 4LFBL 1EWCA 3KDFA 3JAML 3JAME 2X6GA 2KCMA 5C3EG 1Y1WG 2DY7A 2R92B 2QA4A 3P20A 2OWOA 5JVG3 3H0GG 1K3BC 5C44B 3H09A 2BE5C 2K4KA 4X3SA 1LTLA 2WAQE 4ZKBB 1D6EC 1DOKA 3VA5A 2CWPA 3QJYA 1SEBD 1IBML 4B9WA 1N36Q 1ESRA 4IJLA 4RGMA 3PSIA 5IWAL 1LTSD 3S1MH 1WYDA 3J7A5 2VNUD 1FVIA 3NTKA 4DU9A 1W6JA 2PPBC 1EY8A 1EFWA 2JA5B 3GTKB 3DHQA 5K5PA 2F0LA 4JI2L 4EX5A 1V9PA 4LFCL 1TVXA 1JJ2A 3I55A 4A93H 3J80c 3DEOA 1SXTA 1RCVD 4IOCA 4IFDG 3J81L 5GADC 1MIUA 2CQOA 4HCSA 3FVQA 4F7XA 4K6LA 1CUKA 1KRSA 3J81E 1K0SA 5IYDG 2R93G 2FINB 1BXTA 1U4LA 2YTYA 3CW2C 4A3KH 4P75A 2Y0SE 3MXGA 2NVQH 2Z1CA 1C9OA 1I6HB 3W5OA 4BY1H 1I5FA 2B2YC 2O4XA 4HSPA 2ZM6L 1K83H 1EY7A 3H0GH 4NP5A 3Q22A 2XWJB 1VS0A 2OEOA 2VL6A 1S5DD 1RTNA 2UU9Q 5M3FH 4GLAC 1WD0A 3HOUB 4KHPL 2HDLA 3H91A 4B3ML 1IYJB 4POGA 4FF2A 3IFTA 4GLXA 4FXGC 4N9TA 1PXUA 4K14A 1EZ8A 3TEHB 2JA8H 1L1OA 5AFWA 4X64L 3KUPA 4YHHL 1HTPA 2L12A 3NQIA 2WB1G 2J7ZA 3KLSA 4XYQA 1GUNA 4ZQ3A 2N78A 1CM9A 1VQCA 1VQPA 2PCFB 1HNXQ 4CDFC 1HZAA 4DAYB 5IYCH 2BH8A 4OEMB 4YIJA 2E2HH 4X66Q 1X6OA 1YJWA 1ICWA 4UY8C 1S5ED 5FLMG 4C3JH 4DV1L 1H9KA 3S15B 2G9DA 5JJZA 5C3XA 2R93H 2NYZD 1DXMA 1G6ZA 4IPGA 5BN5A 2L0CA 4IUUA 4XDXA 4DK1A 1PH7A 1S5CD 1XMOL 1T5EA 1KDAA 4IPCA 4B3RQ 2NVTB 2JA7B 2RHQB 1I4XA 2KHJA 4Q0FA 3W2DA 3C1EA 1WTPA 1LT6D 4KHZA 1K8OA 3M4OH 3HOVG 4ODGA 3CMEA 3HOYG 3TS2A 1WTWA 4GKJL 4DNRB 1U4MA 2NZHA 4JI7Q 5I9OA 4HIMA 1NR4A 1R4QB 4DV3L 3OW7A 2K5NA 1PH6A 1ILPA 1KXLA 3U58A 3D0FA 1BBUA 1UUPA 3R93A 2XNAC 4KKTA 4NDXA 2NVYH 1EQVA 1SRUA 3QO2A 4G7ZC 3PO3H 4R4CA 1F9QA 1YNJD 4BY7G 2DJGC 2MFIA 3KBXA 3QB3A 3BYYB 5H1SE 2O2LD 3RZDB 3C46A 4ZYSA 1H9MA 3T1HQ 4BA2I 5ELCA 1PH2A 1VQDA 2P5ZX 1NJIC 1B70B 2RVLA 4A3BH 2KCNA 2NZ1D 2KEDA 5GROA 3K8AA 1SMYC 4YWMA 4X65Q 2VB2X 2ZXOA 1JOKA 5M3MG 4XXEA 3IL8A 3GTGB 5I4DA 4DV4L 5JEAH 2F0HA 4LNQA 1Y8NB 2F3VA 4IPHA 4DV1Q 2K1BA 2RA4A 3OIQA 2ZJQA 2UXDQ 3S2HB 1BCPB 2NUCA 2C9OA 4OIJA 4J1MA 1ENAA 3AEVA 1CHPD 1UEAB 5KEEA 1TWCH 1NE3A 3J7ZC 3CMAA 4ZAIA 1ZEQX 1G2SA 2EXDA 1GKHA 2F03A 1EWHA 2J4XA 4IUTA 4FP5D 2WFWA 1SE4A 4P73A 1JWUD 4K8JA 4JG2A 1Q7YC 5JJIA 1Q1BA 3D31A 3NELA 3QWNA 3QOJA 4GNXA 2F0WA 1B3AA 2B2VC 3AFQA 1QOHA 3U4VA 1VQNA 1LTGD 3NQTA 3EN2A 2UUAL 2YV5A 4UDUC 1KD1C 5DNFA 5EKLA 5EKIA 5M5YH 1A0IA 3EIVA 1JQYD 5C3EB 4IZ8A 1Y1WB 1EIHA 1GD7A 3NP8A 2GN5A 3AFPA 1XXGA 1XNRL 3H0GB 4HJ5A 3KF8B 5FO7B 1PH8A 1EFID 4GOPC 3MC0B 1X3GA 2K32A 2AHOB 5KRUA 5M3MH 1H95A 4O1NA 4ILWA 1SJED 5GAHC 5J39A 3TP5A 4JI4Q 1QVCA 2DN8A 3FHWA 2CQAA 4OX9Q 2E2DC 1IXRA 1X55A 2TMPA 4HIKA 1F9SA 3RN5A 4K0KL 2A19A 1JE4A 2EYMA 5IT9c 3M4QA 5LL6X 2NTSA 1PRTC 4AIMA 2I0QA 1XWEA 3L9AX 2WINB 5CC4A 2DY8A 3KLRA 1CTMA 1D5ZC 2B2TC 1YITA 4RHSA 1PH4A 4NPSA 4N8FA 5ELOA 1NR2A 4JOIA 4CDCC 5GAEC 4L63B 1Q86C 2MJ8A 2X69A 2A69D 4PNYA 1MSHA 1VQ8A 3CQZB 2ASBA 4R9WA 2B63G 3H94A 2HUGA 4YCUA 1HUMA 4HJ7A 4UHVA 1A63A 2UUBL 1KLUD 1Q82C 1TY2A 4RFBA 3M7GA 1OO9B 1EQTA 4RAUC 3K0YA 4HCEA 3S17B 1PTOC 4JI8L 2FMMA 5HY6A 4DK0A 4H02A 1XMQQ 2NN6H 3S2DH 4YWKA 2KA7A 1O7YA 1WOCA 4DR6Q 4M8AA 3X3MA 2FXQA 1DGSA 5ELDA 4CJ0B 1ZYRD 2DJFC 2UXBL 3K59A 4A3EH 1XPOA 3MAQA 3GTOB 3J81j 3H3VC 4ALPA 1BBWA 3ULJA 3FKIH 1NY4A 1QWYA 4LJZC 3J80L 3J80E 4GKKQ 4BBSH 1LTRD 3EROA 2WB1B 4NXML 2XWBB 1HZCA 3URYA 4BWGB 3JAMi 2F0QA 3CRKC 4DV0Q 1GO3E 1ET6A 3BVMA 3W1BA 1WVLA 4DR7Q 1JJGA 3MFYA 4DUZQ 2RF4A 3N6RA 4DR2Q 1TWGB 2CW0C 5AJ3Q 1EY5A 4JI1L 1VQ9A 1EYDA 1X65A 3NENA 3QR8A 1UAPA 2SOBA 4QUFA 5IP7G 1FJGL 3S1QH 2DNCA 2FHTA 3HOZH 3E6ZX 4A3FH 2MGSA 2F4VL 4N8X1 3S1NH 3ZYYX 1GUSA 2XSCA 3GV6A
chains in the Genus database with same CATH topology
2MHVA 4WJWA 2HCCA 4PMWA 4RCNA 5TSSA 3VYRA 1X32A 3FPPA 5KNDA 5I6YA 1GUTA 5EKKA 1GUGA 1SYCA 3HOVB 1GJXA 3BVGA 1LLRD 3HOYB 5KIXA 1JOOA 1I3QB 2YU9B 1G291 5CV9A 3MWYW 1I4QA 3OWEB 4OIKA 1A15A 1SFOB 2L11A 4O42A 3IAYA 4TQUS 1RF2D 2F0DA 1O7LA 4BY7B 1QCBD 5IGCA 1VF5C 2YYZA 2G9HD 1EY0A 5M5WB 4DF7A 1STBA 3GTLB 2WKDA 1PMRA 3MXUA 2H1EA 4K6DA 5M3MB 2QCPX 2L4NA 2K28A 5DM73 1TKWB 1PRTB 2EZVA 2BE5D 1C48A 1LT3D 3C1FA 1OXVA 3RMHA 5CR3A 2B2WA 1MSGA 3BZDB 1SYGA 3OMGA 5IOCA 4V190 2HDMA 4K8IA 3GV3A 4LAAA 2F0IA 5I2YA 1SNQA 4C1NI 2A74C 2EYOA 1O7ZA 1PTOB 4M1UB 4IFDI 2K04A 1FNVA 3KLSX 2LMCB 4G57A 3MZ5A 1STNA 1H9RA 3D8GA 3K58A 3P1HA 3EQLC 4CKCA 4DGZA 4F8MA 1LT5D 3PUZA 1PFBA 2A6ED 3D3RA 4RCOA 4XQNA 1V1PB 3BS1A 4IUVA 4RGTA 5EJWA 2F0GA 1PZJD 2F0JA 1OXXK 3CHBD 4KJOA 1Z47A 4I65A 2EE1A 1AEXA 4HEDA 2XRSD 3HZXA 2VB3X 3U9OA 4XT3B 2E75C 1BR9A 2B2UC 3AMUA 2NWGA 4ABNA 1XTCD 2AUKA 4H13C 2EY5A 3NPPA 1EYCA 2B63B 2AQ3B 3S1QB 1U4RA 2A6HC 1LT4D 4QIWB 3BDOA 3N52A 3DMUA 1RODA 4IURA 4HMIA 2E2JB 3ERQA 5HURA 2A68C 1STYA 4C2MB 4EGVA 1TS3A 1X3PA 1SNCA 2A73B 5KYLA 5IT9L 5IT9E 2VUMB 3CKIB 2JYOA 3FPUB 4XYOA 1CA6A 4RWSC 3K6OA 1HFNA 3M85A 2SNSA 4H44C 3CU7A 4Q5VA 1BCPC 2PW5A 1Y8OB 1NAPA 1EIGA 2CVRA 3PUVA 1KNEA 1F2LA 3T4AC 3VR6A 1Y1VB 3K5OA 2ZXRA 1HHVA 1DZ1A 2NB0A 3RD4A 2IWHA 1PDQA 4C3JG 4A3DB 5IGFA 3I3CA 3G6JB 2EXZA 1DD2A 3I90A 2XIWA 2JE6I 4XQJA 3GD7A 2Z4IA 1ENCA 1SNOA 1IKLA 1X3QA 1CQFA 1DONA 2RDGA 1F2MA 1BUVT 2K03A 4I7ZC 5K36G 4RKLA 1WTOA 2A5HA 1B53A 2WACA 2DNEA 5J22A 3HP3A 3D4RA 3V96A 4WRDA 5CV5A 2XRQD 3HKZB 3DM1A 1B2TA 2RSNA 5DEHA 4CGYB 1JC7A 4H7BA 3EFXD 1E2VA 2OF1A 5JPNC 1Y69U 3HRZC 4R8IA 5JEAG 2Z4HA 2E74C 1DJRD 1AN8A 3X3NA 2LKVA 3NSWA 5IGGA 1MGSA 3MEHA 4QB4A 2O5IC 1CZGA 2L9HA 3HEJA 2EJGC 3SDZA 3MHBA 2F1MA 4FYDA 2JA6B 5K36H 4WORA 2BOSA 1PRTF 2MPMA 3GQBA 1SBBB 2SDFA 1WTVA 2ZT9C 2F3WA 2OXPA 1OXUA 3M4YA 2IW3A 4OO1H 3E5SA 1G2TA 3VA7A 2L55A 1E0BA 1T5XD 4XTCS 3AU7A 2Q8IB 3PUXA 4ZUJA 3TP6A 4DFAA 5C5MA 5FO8B 1PZID 1V1OA 4L8JA 1II3A 3SE0A 1PTOF 1C4QA 1TR5A 2RDFA 3WOEA 4ZRZA 3FEWX 1DM0B 2IX0A 1SSOA 3MFGA 4KJNA 3S1MB 1U4PA 2K5WA 1VDZA 2KQ3A 5CBAE 1LTID 1I6VC 3R2TA 5C0XJ 4TRDA 1SYBA 5C3WA 3NTHA 3ND8A 4TKOB 3TMEA 5EPJA 1STHA 3A55A 1Z6HA 3U9SA 3VR4A 4A93B 3C2PA 4A3GB 3NK9A 4QCLA 4PV1C 4DAYA 1WTQA 1IW7D 2IT1A 5C0XI 3E0JA 4A3KB 1LTBD 1SYDA 1AZPA 1YNND 4IQZA 2EYHA 5FK9C 2NVQB 2QF7A 4DAPA 3I72A 4BY1B 1MBYA 1K83B 2RSOA 2NN6G 3QG1A 4HR7B 3PV0A 2F0MA 5M3FB 2ID0A 3AB9A 1B9NA 3BDCA 4K5WA 1A2UA 3SK6A 1A2TA 2EJMA 4CHTB 1AP0A 2VXWA 3C3LA 1HRJA 1EY9A 5EGTA 2JA8B 4FNFA 5C4HA 4RGNA 1H9JA 3DWQA 1ZKOA 5CV4A 3TSSA 4HSVA 3OWFA 2RBMA 4FF3A 3EA6A 3BVZA 1DOMA 5IGDA 1FGBD 2E2HB 5D3IB 3OMCA 1YNJC 3I8ZA 1MD2D 3NUCA 4C3JB 1HTLD 1LACA 5KNCA 5DM63 2R93B 1HQMC 4LK1C 4DXGA 4C3HG 4G7OC 2I07B 5G3LF 4CKBA 1RDPD 1CI3M 4FO2A 1HPCA 2F0UA 1STAA 3LWUA 2D62A 3M4OB 5D3DA 5CYUA 5IGEA 3OHXC 1KABA 5G3LD 1SYFA 2AQ2B 1EYAA 1BF4A 3S9WA 1FR3A 2F4IA 2K5QA 3MTSA 3ONAB 2FJ2A 4GZYC 3FRPB 2NVYB 3L7ZC 4KD3A 2OT2A 3PO3B 4JBWA 2F0VA 1ZXTA 2B2YA 2R61A 2F0NA 1RKNA 4A3BB 1J9OA 3P75A 4U68A 1K8MA 2E76C 3A8JE 4IUNA 2M9VA 3KF8A 4PQXA 3D6CA 4S3SA 1SYEA 3DEPA 1A3TA 4MN3A 1D1IA 1TWCB 3PUYA 4KTAA 2GA4B 1GHKA 5T1IA 2PQEA 2ICEC 5A35A 3A7LA 1NUCA 1CA5A 2F0TA 3A7AB 3HGBA 3BYTB 1B9MA 1XX8A 2N55A 5EQ0A 3LWEA 1HA5A 4K2LA 1QILA 1S5BD 2O5JC 2A69C 4FXKC 5ELBA 2L5TA 1ML0D 5M5YB 1A3VA 3M7NA 3K5NA 1RD9D 4L6TB 4MHEA 1E2ZA 3O13A 1SDFA 1FYCA 4KKSA 4QF4A 1RHPA 3G7LA 1EEFD 4BA1I 1A3UA 1EEID 1KDCA 2AQ1B 2K5DA 2WP8J 4IUQA 1OXTA 1VCIA 1BDOA 4QMGA 1SE3A 2EPBA 2WAQB 2EYFA 4KD4A 3VR2A 4F88A 4J6HA 2NBFA 4KN4C 2PO4A 5BN4A 1ET9A 4C1NK 5JPMC 4IFDJ 1JB3A 2ZXPA 1EZ6A 2F0EA 3ND9A 2TSSA 4CKEA 1BCPF 4HAEA 5E3FA 1TY0A 1R4PB 5EPLA 1IKMA 1BCPD 1B1ZA 1I50B 1M4VA 3NXWA 5LL6S 5BN3A 1SNPA 3I73A 1BOSA 1KLGD 1TS5A 3TZDA 2M00A 1I4PA 5CV7A 4C56C 2K05A 2X6LA 1D5MC 3R3OA 2Y0SB 3Q24A 5FO9B 3S2DB 2F0OA 3PUWA 4DXFA 1BBXC 4X3TA 3A56A 1S5FD 2K6AA 1QE6A 1CFMA 3DWPA 3TP8A 4A3EB 4EQPA 5JOBA 3T56B 3FKIB 2KHSA 1STGA 4EQNA 2Z8LA 4U673 1F2ZA 5I2XA 2B2VA 2EYLA 4BBSB 2R6GA 3SK5A 4X3KA 3LNNA 5D14A 2RKSA 2B8FA 3LX0A 2HCIA 2JXMB 1E2WA 2KUMA 1QJOA 1NSNS 1STEA 1MI2A 1D1KA 2AWNA 3HOZB 4A3FB 1JOQA 5EBDA 3S1NB 3KBGA 1B4OA 3OSOA 4KI0A 1KNAA 4KY5A 4C3HB 3J7AV 3SXHA 2PNRC 2D5DA 3MXPA 4IN3A 4G4KA 5CMDA 1GOZA 2K01A 3D4WA 4HTHA 4KY7A 4P2CB 2B2TA 3T51B 2R3ZA 2E2IB 1U9RA 1LO5D 1LTAD 4EQOA 2KJXA 1Q3LA 1QG7A 5ELFA 3HS0C 2V4DA 3J7YW 2IPKD 1B44D 1TQOA 1R9TB 3P7JA 1F2YA 5C4ZA 1AW7A 3D6WA 3MXNA 3RZOB 5E1FA 5CV6A 1S4ZA 4RKBA 3DWAA 3GTMB 3EVQA 4FXDA 1EU4A 1Z7TA 5CORA 5D65A 2LS01 2N88A 2BCOA 1VMCA 2D2CC 2M2LA 1V1PA 1Q8IA 3T16A 4JK1C 4ID6A 1SMYD 3IKJA 4ZKCB 1QNUA 4C3IG 1WD1A 2A6EC 2SNMA 1DOLA 1CHQD 1SNMA 4CBVA 3M3YB 1O80A 4OO1G 3S16B 1IYVA 4KK7A 1FD7D 1TIID 3I70A 3Q6SA 1WCMB 3NWTA 4ZLTF 4A3MB 4B9XA 4KHVA 4OL7A 1JORA 1UNSA 2H4OA 5C5LA 2IX3A 2XVSA 1EU3A 3TDQA 5T1GA 5ISRA 4R8NA 4IFDH 2NN6I 1I4RA 4RGOS 1VMPA 4KN7C 5CGKA 1TU2B 5CBEE 1Q12A 3H6MA 4K2KA 3RLFA 3T53B 4XT1B 1TWFB 3PO2B 3A8IE 2BDNA 5FKAC 3HOWB 1PRTD 4K5VA 4RH6A 3I4MB 2L1BA 2BDOA 3DUZA 1NCVA 1F9PA 3R2IA 4KY6A 4WFN3 1FNUA 1KDBA 1SE2A 2KECA 2BA0A 1DYQA 3Q23A 2BA1A 5KGUA 3VYUA 4QUCA 1H9SB 2B2WC 2J0TD 2PYKA 4H0LC 3CRLC 3K57A 5J1ZA 2FMCA 2JEAI 5IODA 1SNDA 2K7VA 2PW7A 4EVOA 4G7HC 1CQVA 1PTOD 3QOLA 4HN7A 4V0BA 1TWAB 2B8GA 5FOBB 2NTTA 2Q8RE 1ESFA 5CV8A 2EY1A 2LY7A 3KK7A 2KEEA 4PMCA 4FF1A 3J7AF 4B08A 2EY6A 3UI2A 4DN4M 4BBRB 1F77A 4DAVA 4UAIA 3A54A 2F0FA 3PIO3 1CK1A 4CJ1B 5FLXL 1LTTD 1Y8PB 5FLXE 3PIP3 1OXSC 2PMZB 4X3UA 4K5XA 3OPOA 3WDNA 1IHZA 5HGTA 4A3JB 3GTQB 4HMJA 2CW0D 1RJTA 3SK4A 1KTKA 4DNTB 5C6AA 4LMQD 1QNKA 4KMUC 2B2UA 5E4XA 2EYPA 1SAPA 2WIIB 5IIFA 2EVBA 1I4HA 2EY2A 3K5LA 3IFDA 4IALA 1TS2A 4NMZA 3ITPA 1BQQT 4FF4A 4OGQC 4ULLA 1ONLA 3GTJB 3SVMA 3T13A 4Z9CB 2WV6D 1JCKB 2AWOA 3GP7A 2B39A 3I91A 3VR5A 1H9SA 2RDHA 2PZWA 2F0KA 3PMFA 1EOTA 1Q1EA 2XN9C 3Q0AA 1GUWA 1HQRD 1PFNA 1PFMA 4RHRA 2HQEA 1B50A 1PTOH 3F2UA 2IL8A 3GO5A 3SK8A 4C3IB 1RTOA 5M9OA 2F0PA 4N9PA 5C4XB 2KCCA 3I4NB 1WTXA 5COYA 5E4WC 3HOXB 3TBIB 2JSOA 5IGBA 3V05A 3D4DA 2AUJD 1J8IA 4ZK9B 1TWHB 2PZUA 1DCZA 1D5XC 1Q90A 1LV9A 3GTPB 1IW7C 1HXYD 1IYUA 3V2TA 2KVMA 3NWSA 1YNNC 5C0XG 3SEBA 3HG9A 3FDTA 3OIPA 1GUOA 4PMBA 1SJHD 2KOLA 4AYBB 1EL0A 1KAAA 3FMCA 1FNWA 2QDBA 5F2DA 1BO0A 2WKCA 4NKLA 5DAUA 3TN2A 4A3IB 3I4LA 2R7ZB 4XQQA 3TP7A 1V43A 1M8AA 1JR0D 1CT1D 5NUCA 1JWMD 4OHJA 1QB5D 5I9PA 5LHY1 5I6WA 3W3AA 1JICA 3MA2B 2K33A 3VYSA 4DA2A 1G8ZD 2LFNA 4NW2A 1EY4A 2A6HD 5C0XH 1HA6A 3RUZA 3NBIA 1VF7A 3DXJC 1HCZA 3S1RB 2A68D 4BS9A 1AZQA 3BDLA 3SR1A 3BG3A 2QILA 1ENFA 1ZYRC 5JVH3 3OOCA 1HUNA 1CZWA 5EPKA 3VYTA 2C5CA 5M5XB 1PZKD 2ICIA 4KV6A 3QIAA 2MUYA 4XIGS 2QEJC 2JEBI 1V8QA 3EJIA 1PYWD 3WOFA 5JAVA 1TS4A 3NBHA 4J8QA 1D2BA 3K7AB 4E6IA 3NE5B 3K5MA 2JP1A 2FFKB 2IJ0A 4F87A 1PLFA 2EOTA 3S14B 4MIUA 1G91A 1C8CA 5ELEA 4ME5A 4FVMA 2F0SA 1GHJA 2SEBD 1L0XB 1I4GA 3NTIA 2ENBA 1ILQA 1F9RA 2EJFC 1WTRA 3SHLA 3VR3A 2CHBD 4OO1I 3R8BA 4Y7NB 4KKUA 4CJ2C 4TSSA 2MP1A 1L0YB 5EBCA 1LABA 5A2QL 1O78A 5A2QE 5JEAJ 1IL8A 3TZUA 1HFGA 2I46A 2D9UA 3L3OC 1BNZA 1JWSD 4IUPA 1GXDC 1EY6A 2EDGA 2Q8TA 2RQXA 3A8KE 5C4JB 4ZUIA 5KYIA 1AFPA 2NVXB 1XYIA 5KNBA 2QKIC 3NHHA 2EYJA 1TT2A 3MVVA 4RA8A 1A6XA 1W6KA 2PZTA 2IX1A 1EWCA 3JAML 3JAME 2X6GA 2DY7A 2R92B 3P20A 5JVG3 5C44B 3H09A 2BE5C 4X3SA 4ZKBB 1D6EC 1DOKA 3VA5A 3QJYA 1SEBD 4B9WA 1ESRA 4RGMA 1LTSD 2VNUD 3NTKA 4DU9A 1W6JA 2PPBC 1EY8A 2JA5B 3GTKB 3DHQA 5K5PA 2F0LA 1TVXA 3DEOA 1SXTA 1RCVD 4IFDG 3J81L 4HCSA 3FVQA 4F7XA 4K6LA 3J81E 2FINB 1BXTA 1U4LA 3MXGA 2Z1CA 1I6HB 2B2YC 2O4XA 4HSPA 1EY7A 4NP5A 3Q22A 2XWJB 2OEOA 1S5DD 1RTNA 1WD0A 3HOUB 2HDLA 3H91A 4FF2A 3IFTA 4FXGC 4N9TA 1PXUA 4K14A 1EZ8A 5AFWA 3KUPA 1HTPA 2L12A 3NQIA 3KLSA 2J7ZA 4XYQA 1GUNA 4ZQ3A 1CM9A 2PCFB 4YIJA 1ICWA 1S5ED 1H9KA 3S15B 2G9DA 5JJZA 5C3XA 2NYZD 1DXMA 1G6ZA 5BN5A 2L0CA 4IUUA 4XDXA 4DK1A 1S5CD 1T5EA 1KDAA 2NVTB 2JA7B 1I4XA 4Q0FA 3W2DA 3C1EA 1WTPA 1LT6D 4KHZA 1K8OA 4ODGA 1WTWA 4DNRB 1U4MA 5I9OA 1NR4A 1R4QB 3OW7A 1ILPA 1UUPA 3R93A 2XNAC 4KKTA 4NDXA 1EQVA 3QO2A 4G7ZC 1F9QA 1YNJD 3KBXA 3QB3A 3BYYB 3RZDB 2O2LD 3C46A 4ZYSA 1H9MA 4BA2I 5ELCA 2RVLA 2KCNA 2NZ1D 2KEDA 1SMYC 2VB2X 2ZXOA 1JOKA 4XXEA 3IL8A 3GTGB 5I4DA 5JEAH 2F0HA 1Y8NB 2F3VA 2K1BA 2RA4A 3OIQA 3S2HB 1BCPB 2NUCA 2C9OA 4OIJA 4J1MA 1ENAA 1CHPD 1UEAB 5KEEA 4ZAIA 1ZEQX 1G2SA 2F03A 1EWHA 2J4XA 4IUTA 4FP5D 1SE4A 1JWUD 4K8JA 1Q1BA 3D31A 3QWNA 3QOJA 2F0WA 1B3AA 2B2VC 1QOHA 1LTGD 3NQTA 4UDUC 5DNFA 5EKLA 5EKIA 1JQYD 5C3EB 4IZ8A 1Y1WB 1EIHA 3NP8A 1XXGA 3H0GB 5FO7B 1EFID 3MC0B 2K32A 5KRUA 4O1NA 4ILWA 1SJED 5J39A 3TP5A 2DN8A 2CQAA 2E2DC 2TMPA 1F9SA 1JE4A 2EYMA 5LL6X 2NTSA 1PRTC 1XWEA 3L9AX 2WINB 5CC4A 2DY8A 3KLRA 1CTMA 1D5ZC 2B2TC 4RHSA 1NR2A 4L63B 2MJ8A 2X69A 2A69D 4PNYA 1MSHA 3CQZB 4R9WA 3H94A 2HUGA 1HUMA 1KLUD 1TY2A 4RFBA 3M7GA 1OO9B 1EQTA 4RAUC 3K0YA 4HCEA 3S17B 1PTOC 2FMMA 4DK0A 2NN6H 2KA7A 1O7YA 4M8AA 3X3MA 5ELDA 4CJ0B 1ZYRD 3K59A 3MAQA 3GTOB 3H3VC 1QWYA 4LJZC 3J80L 3J80E 1LTRD 3EROA 2WB1B 2XWBB 3URYA 4BWGB 2F0QA 3CRKC 1ET6A 3BVMA 1WVLA 3MFYA 3N6RA 1TWGB 2CW0C 1EY5A 1EYDA 1UAPA 2SOBA 4QUFA 2DNCA 2FHTA 3E6ZX 2MGSA 3ZYYX 1GUSA 2XSCA 3GV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QB3 A;  4QB4 A;  4PMC A;  3SXH A;  4G57 A;  3SK8 A;  3MXP A;  2O4X A;  3MZ5 A;  3HEJ A;  2EY6 A;  3MHB A;  2F0N A;  1EZ6 A;  2F0E A;  1STN A;  5M9O A;  3D8G A;  5CC4 A;  1RKN A;  5I6Y A;  3D4W A;  1EY7 A;  3P1H A;  4NP5 A;  4HTH A;  4KHV A;  4B9X A;  1EY4 A;  2OEO A;  4WOR A;  5E3F A;  4OL7 A;  2F0F A;  3P75 A;  2F0M A;  1SYC A;  4KY7 A;  5EKK A;  4DGZ A;  5C5L A;  3RUZ A;  2F0P A;  4F8M A;  4N9P A;  5IGF A;  5KIX A;  2EXZ A;  1EY6 A;  1JOO A;  3BDC A;  1U9R A;  4EQO A;  2F3W A;  1JOK A;  4K5W A;  2OXP A;  4PNY A;  4IUN A;  4ZUI A;  5ISR A;  4R8N A;  5CV9 A;  5KYI A;  1A2U A;  3SK6 A;  1A2T A;  1TQO A;  4K5X A;  2F0G A;  4N9T A;  3E5S A;  1ENC A;  2F0J A;  1IHZ A;  2F0H A;  3NHH A;  3NXW A;  1EY9 A;  1EZ8 A;  1TT2 A;  2EYJ A;  3D6C A;  3MVV A;  4K14 A;  1F2Y A;  1SNO A;  5EGT A;  3BDL A;  2F3V A;  4S3S A;  3SR1 A;  5C4H A;  3D4D A;  4HMJ A;  5C4Z A;  1SNP A;  5CV4 A;  2F0D A;  4KJO A;  4I65 A;  1SYE A;  2PZT A;  2PZU A;  2NUC A;  5CGK A;  1A3T A;  2M00 A;  5E1F A;  3OWF A;  2RBM A;  5CV7 A;  4ZQ3 A;  3H6M A;  4K2K A;  5CV6 A;  4J1M A;  4ZUJ A;  3TP6 A;  1ENA A;  5IGC A;  4DFA A;  1F2M A;  3R3O A;  1EY0 A;  5C5M A;  3SK4 A;  3V2T A;  4EQN A;  5KEE A;  1AEX A;  4KTA A;  4KV6 A;  4RKB A;  5IGD A;  4DF7 A;  5C6A A;  1II3 A;  1STB A;  2PQE A;  4YIJ A;  2F0O A;  4RKL A;  3EVQ A;  3OMC A;  3HZX A;  2WAC A;  5HGT A;  3U9O A;  5J22 A;  1TR5 A;  2RDF A;  3NUC A;  3VA5 A;  1NUC A;  4PMB A;  4K5V A;  2F0T A;  4K8J A;  3EJI A;  2EYP A;  5C3X A;  4WRD A;  4K6D A;  5CV5 A;  1KAA A;  3TP8 A;  4EQP A;  4B9W A;  5IIF A;  5JAV A;  2EY5 A;  2EY2 A;  4KY6 A;  5JOB A;  1KDB A;  1EYC A;  4KJN A;  3T16 A;  4ID6 A;  2KHS A;  3QOJ A;  1STG A;  2KQ3 A;  2F0W A;  2QDB A;  1F2Z A;  4IAL A;  4NMZ A;  3ITP A;  5DEH A;  5F2D A;  4J6H A;  1KDA A;  4DU9 A;  5KGU A;  4K2L A;  2EYL A;  1EY8 A;  4TRD A;  4E6I A;  1SYB A;  4NKL A;  5DAU A;  5C3W A;  3C1F A;  3DHQ A;  3DMU A;  3NQT A;  3ERO A;  3SK5 A;  2SNM A;  2F0U A;  3TME A;  3C1E A;  2F0L A;  4H7B A;  4MIU A;  5K5P A;  1STA A;  2RKS A;  1STH A;  4HMI A;  3T13 A;  5IGB A;  5CR3 A;  3LX0 A;  2F0Q A;  3ERQ A;  1A3V A;  1SNM A;  2PYK A;  5EKL A;  3TP7 A;  5HUR A;  5IGE A;  4ODG A;  4IZ8 A;  1STY A;  4ME5 A;  1KAB A;  1SYG A;  3NP8 A;  1SYF A;  2OF1 A;  1NSN S;  3OMG A;  3NK9 A;  5J1Z A;  5IOC A;  5NUC A;  2F0S A;  5IOD A;  1SNC A;  1SND A;  2PW7 A;  1EY5 A;  4QF4 A;  4EVO A;  5KYL A;  5KRU A;  3QOL A;  4F7X A;  1EYA A;  1A3U A;  5I9O A;  3S9W A;  1KDC A;  1EYD A;  4K8I A;  2PZW A;  5I9P A;  1JOR A;  2SOB A;  5J39 A;  4LAA A;  2F0K A;  3TP5 A;  2ENB A;  5CV8 A;  2EY1 A;  2F0I A;  1SNQ A;  1SYD A;  3PMF A;  4KD3 A;  4NDX A;  5I6W A;  4QMG A;  1JOQ A;  1EQV A;  2EYO A;  2SNS A;  2LKV A;  3OSO A;  2EYH A;  2EYF A;  5IGG A;  2F0V A;  4KD4 A;  3SHL A;  4KY5 A;  2HQE A;  3MEH A;  2PW5 A;  2EYM A; 
#chains in the Genus database with same CATH topology
 2MHV A;  4WJW A;  4C3H H;  2HCC A;  4PMW A;  4RCN A;  5TSS A;  4BXX H;  3VYR A;  1X32 A;  3FPP A;  5FJ8 G;  2CWA A;  5KND A;  4J15 A;  1GUT A;  5I6Y A;  4PG3 A;  2QGQ A;  5EKK A;  1GUG A;  1SYC A;  3HOV B;  1GJX A;  3BVG A;  5ELN A;  1LLR D;  3HOY B;  2GVA A;  5KIX A;  1JOO A;  2VQF Q;  2OTL A;  4JCV E;  1I3Q B;  2E2I H;  3CCU A;  2YU9 B;  1G29 1;  5CV9 A;  1RIP A;  2Z6K A;  3MWY W;  3STB C;  1I4Q A;  3OWE B;  4OIK A;  1A15 A;  2ZJR A;  1R9T H;  1SFO B;  2L11 A;  4O42 A;  3IAY A;  4TQU S;  2VY3 A;  4WJ4 A;  1RF2 D;  1VQI A;  1O7L A;  2F0D A;  2HHH L;  4A3L G;  2D0O A;  4BY7 B;  3RZO H;  4DV7 L;  1QCB D;  5IGC A;  1QUQ A;  1VF5 C;  2YYZ A;  2G9H D;  1EY0 A;  5M5W B;  4DKA C;  4DF7 A;  3CC7 A;  1STB A;  4GOP B;  3GTL B;  4JPB W;  1AH9 A;  3PF4 A;  2WKD A;  1PMR A;  1I94 Q;  2JQO A;  3MXU A;  4DV5 L;  1X9N A;  1KC8 C;  1HNW Q;  2H1E A;  4K6D A;  5M3M B;  2QCP X;  4R4Q A;  2L4N A;  4PZ8 A;  2K28 A;  5DM7 3;  1TKW B;  4PZ6 A;  3A5U A;  3S24 A;  1PRT B;  2EZV A;  2CH4 W;  1MJE A;  2BE5 D;  1C48 A;  1LT3 D;  3C1F A;  1OXV A;  2JA6 G;  3RMH A;  5CR3 A;  2B2W A;  1MSG A;  4DR1 L;  1YHQ A;  3BZD B;  1SYG A;  3OMG A;  5IOC A;  4V19 0;  2Q2I A;  2HDM A;  3M3Y H;  1Q8K A;  4K8I A;  1K73 C;  2GVB A;  3GV3 A;  4LAA A;  4AQY L;  2F0I A;  1T9H A;  1SNQ A;  4C1N I;  5I2Y A;  2A74 C;  2EYO A;  4WJ3 M;  3MXN B;  1O7Z A;  4R4I A;  1O7I A;  4MTN A;  1PTO B;  4M1U B;  4IFD I;  2K04 A;  4X62 L;  2WB1 E;  1FNV A;  1WCM H;  3KLS X;  2LMC B;  4G57 A;  3MZ5 A;  3KLW A;  5FLX c;  1STN A;  1H9R A;  3D8G A;  3K58 A;  1YEZ A;  3P1H A;  3EQL C;  2UXC L;  4YCV A;  1JJC B;  4AYB E;  4CKC A;  4DGZ A;  4F8M A;  1PA6 A;  3PGZ A;  1LT5 D;  4IO9 A;  1VQ5 A;  2K14 A;  3PUZ A;  3K81 C;  1PFB A;  2A6E D;  2Z9H A;  3D3R A;  4RCO A;  4XQN A;  1V1P B;  4LW1 A;  3BS1 A;  4IUV A;  4RGT A;  5EJW A;  1KL9 A;  2F0G A;  1PZJ D;  2F0J A;  4APV A;  1YI2 A;  4IOA A;  1OXX K;  2ZJP A;  3PIO A;  3CHB D;  4KJO A;  4A76 A;  1Z47 A;  4I65 A;  2EIF A;  1HR0 W;  2EE1 A;  1UEB A;  3PIP A;  4A93 G;  1AEX A;  4A3G G;  4JBJ A;  1TWF H;  4HED A;  2XRS D;  2HT1 A;  1UE5 A;  4DV2 L;  3HZX A;  2VB3 X;  1E7Z A;  4XT3 B;  2E75 C;  3U9O A;  1BR9 A;  3BZK A;  2B2U C;  3AMU A;  2NWG A;  4ABN A;  1XTC D;  4A3K G;  2AUK A;  3L0O A;  1M1K C;  3I4M H;  4H13 C;  2EY5 A;  3K0X A;  3NPP A;  1EYC A;  2B63 B;  2AQ3 B;  3S1Q B;  1U4R A;  4YCW A;  4LF9 L;  2A6H C;  2F3I A;  1LT4 D;  4BY1 G;  3T1Y L;  4QIW B;  3BDO A;  3N52 A;  2H5X A;  3DMU A;  1ROD A;  4DR5 Q;  4A3C H;  4IUR A;  3MEF A;  4HMI A;  2E2J B;  3ERQ A;  4L5S A;  5M3F G;  5HUR A;  2A68 C;  1STY A;  4C2M B;  4EGV A;  1TS3 A;  1X3P A;  3CC4 A;  1SNC A;  2A73 B;  2Z6B A;  5BR8 Q;  5KYL A;  5IT9 L;  4JI5 L;  1N32 Q;  5IT9 E;  1TWA H;  2VUM B;  2JA8 G;  3CKI B;  2JYO A;  3FPU B;  4XYO A;  1CA6 A;  4RWS C;  3K6O A;  1HFN A;  3M85 A;  2SNS A;  2K52 A;  4H44 C;  3CU7 A;  1X3F A;  3KF6 A;  4Q5V A;  2QDL A;  1BCP C;  2VQE Q;  2PW5 A;  1Y8O B;  1XJV A;  1NAP A;  1EIG A;  2CVR A;  3PUV A;  1KNE A;  1F2L A;  3T4A C;  5IYC G;  3VR6 A;  1IBL L;  1Y1V B;  4YY3 Q;  4A3G H;  3K5O A;  4DR3 Q;  2ZXR A;  4POF A;  1HHV A;  4DUY L;  1DZ1 A;  2NB0 A;  3RD4 A;  2IWH A;  1GM5 A;  1PDQ A;  4C3J G;  4A3D B;  5IGF A;  3I3C A;  3G6J B;  2EXZ A;  1B3Q A;  1DD2 A;  3I90 A;  5LMN Q;  1K0R A;  1FL0 A;  2XIW A;  2JE6 I;  1M90 C;  1CKN A;  3TQY A;  4XQJ A;  3GD7 A;  2Z4I A;  1ENC A;  1IBK Q;  3TRZ A;  4B3T Q;  4A3J H;  1SNO A;  4RMF A;  1NNX A;  3GTQ H;  1IKL A;  5E7N A;  1X3Q A;  1XNQ L;  1CQF A;  4EQ5 A;  1DON A;  2RDG A;  1KHI A;  4LFB Q;  5IYB H;  1EUJ A;  1F2M A;  1BUV T;  2PQA A;  2CH4 A;  4GN4 B;  2Q2H A;  2K03 A;  4I7Z C;  5K36 G;  4RKL A;  1WTO A;  2A5H A;  1B53 A;  2WAC A;  4LF4 L;  1E24 A;  2DNE A;  5J22 A;  1Q46 A;  1D7Q A;  3HP3 A;  3UDX A;  3D4R A;  2PNH A;  3V96 A;  3OTO L;  3PO3 G;  1LYL A;  4WRD A;  5CV5 A;  2XRQ D;  3HKZ B;  1IBM Q;  3DM1 A;  1N8R C;  2QEX A;  1B2T A;  2RSN A;  5DEH A;  5IWA Q;  1E1O A;  4CGY B;  4A75 A;  2ES2 A;  1JC7 A;  2OQ0 A;  2CKZ B;  4JYA L;  1NBW A;  2V1C C;  4A3B G;  4H7B A;  3GTJ H;  3EFX D;  1E2V A;  4JI2 Q;  2OF1 A;  4LFC Q;  5JPN C;  3DLL A;  1Y69 U;  1HH2 P;  2K75 A;  3HRZ C;  4R8I A;  5JEA G;  4JBM A;  2Z4H A;  1YVC A;  1YZ6 A;  2C35 B;  2E74 C;  1DJR D;  3CCR A;  1XPR A;  1L0W A;  1CSP A;  1AN8 A;  3X3N A;  2LKV A;  4DK3 C;  3NSW A;  4QIW E;  3VDY A;  5IGG A;  1MGS A;  2N3S A;  4LF5 L;  3MEH A;  4B3S L;  4QB4 A;  3CXC A;  5JJK A;  3H3V I;  2O5I C;  3Q8D A;  1CZG A;  2L9H A;  3HEJ A;  2EJG C;  3SDZ A;  4C3I H;  2B3G A;  3MHB A;  2F1M A;  4FYD A;  2JA6 B;  5K36 H;  3G48 A;  4WOR A;  2ZM6 Q;  2BOS A;  1PRT F;  2MPM A;  3GQB A;  4O2D A;  5C4X H;  1SBB B;  2SDF A;  3UE1 A;  1WTV A;  3I4N H;  1VQG A;  2ZT9 C;  2F3W A;  4KHP Q;  2OXP A;  2MO1 A;  3CCE A;  4B3M Q;  1OXU A;  2OQK A;  3M4Y A;  2IW3 A;  4OO1 H;  1YHB A;  3E5S A;  1G2T A;  3VA7 A;  2L55 A;  1HR0 L;  2VW9 A;  1E0B A;  5GQO A;  1T5X D;  4P72 A;  4XTC S;  1TWH H;  3HKS A;  3AU7 A;  4X64 Q;  2Q8I B;  4YHH Q;  3PUX A;  4ZUJ A;  3TP6 A;  3GTP H;  4DFA A;  5C5M A;  5FO8 B;  1KIX A;  1PZI D;  1V1O A;  4L8J A;  1II3 A;  4LF8 L;  3SE0 A;  3U50 C;  1PTO F;  1C4Q A;  1SMX A;  1TR5 A;  2RDF A;  4DV6 L;  3WOE A;  4ZRZ A;  3FEW X;  2UUC L;  1DM0 B;  2WAQ G;  1YNX A;  2IX0 A;  1SSO A;  3MFG A;  4KJN A;  3S1M B;  3E9I A;  1U4P A;  2Q2T A;  2K5W A;  1VDZ A;  2KQ3 A;  5CBA E;  1LTI D;  1I6V C;  2I5M X;  3R2T A;  5C0X J;  2A1A A;  4TRD A;  1XMO Q;  1SYB A;  5C3W A;  2L15 A;  3NTH A;  1ASZ A;  4A3I H;  3ND8 A;  4TKO B;  3TME A;  5EPJ A;  2RCN A;  1STH A;  2R7Z H;  3A55 A;  2LXJ A;  1Z6H A;  3U9S A;  3VR4 A;  4A93 B;  1WI5 A;  3C2P A;  4A3G B;  3NK9 A;  4QCL A;  4PV1 C;  4DAY A;  1WTQ A;  1PFS A;  4GKJ Q;  1IW7 D;  2IT1 A;  5C0X I;  3ZJY C;  3HKZ E;  3H15 A;  3E0J A;  1JMC A;  4DV3 Q;  4A3K B;  1LTB D;  1SYD A;  1AZP A;  4QGU A;  3AYH B;  1YNN D;  5HGQ A;  4IQZ A;  2D0P A;  2EYH A;  4CDD C;  5FK9 C;  2NVQ B;  2QF7 A;  4DAP A;  3I72 A;  4BY1 B;  3F1Z A;  2ZTE A;  4LF6 L;  1MBY A;  2Y0S G;  3E3X A;  1K83 B;  4IPD A;  2RSO A;  2NN6 G;  3M9B A;  3QG1 A;  3JC6 6;  4HR7 B;  1PV4 A;  3PV0 A;  4LF7 L;  4OWW B;  2F0M A;  5M3F B;  2ID0 A;  1VQO A;  3AB9 A;  1P16 A;  1B9N A;  3BDC A;  4K5W A;  4A3E G;  1PVO A;  1KQS A;  1A2U A;  3JAM c;  1YJN A;  3SK6 A;  1A2T A;  2EJM A;  3FKI G;  4CHT B;  1AP0 A;  2VXW A;  3S1R H;  3C3L A;  5JJL A;  1HRJ A;  1EY9 A;  5EGT A;  2JA8 B;  4FNF A;  5C4H A;  4RGN A;  4DNI A;  4DV4 Q;  1H9J A;  3DWQ A;  4BBS G;  1ZKO A;  5CV4 A;  3TSS A;  4HSV A;  1PH9 A;  3RLN A;  1CSQ A;  3OWF A;  2RBM A;  4QJF A;  5M5X H;  4FF3 A;  3EA6 A;  3BVZ A;  1DOM A;  4JI6 L;  5IGD A;  1FGB D;  2E2H B;  5D3I B;  1AE3 A;  3OMC A;  1YNJ C;  3I8Z A;  3ULL A;  1MD2 D;  2XGT A;  3NUC A;  4LWC A;  1HNZ L;  1P8L A;  1I50 H;  4C3J B;  1HTL D;  1LAC A;  5KNC A;  5DM6 3;  3HOZ G;  4A3F G;  2R93 B;  3CCV A;  1HQM C;  2MNA A;  5DLQ E;  5IE8 A;  1V1Q A;  1B8A A;  4HJ9 A;  1K3R A;  4LK1 C;  4DXG A;  1N33 L;  4C3H G;  4G7O C;  2I07 B;  3K7A H;  5G3L F;  4CKB A;  1RDP D;  4BXX G;  1CI3 M;  4FO2 A;  4CDE C;  1HPC A;  1G6P A;  2F0U A;  4YWL A;  1A62 A;  1STA A;  3LWU A;  2D62 A;  3S14 H;  3M4O B;  1YBY A;  2Q2U A;  5D3D A;  5CYU A;  5IGE A;  2UUA Q;  3OHX C;  4RG1 A;  1KAB A;  5G3L D;  1L2F A;  1SYF A;  4LFA L;  2AQ2 B;  5C44 G;  4JW0 A;  3CCL A;  1EYA A;  1BF4 A;  1XNR Q;  3S9W A;  2IY5 B;  1FR3 A;  1E22 A;  4HJA A;  2F4I A;  2K5Q A;  2Z0S A;  2JJQ A;  1SR3 A;  3MTS A;  3ONA B;  4GLV B;  2FJ2 A;  4GZY C;  1PYB A;  3FRP B;  2NVY B;  3L7Z C;  4KD3 A;  2OT2 A;  2DGY A;  3PO3 B;  1XPU A;  4JBW A;  4P74 A;  2F0V A;  1J5E L;  2AMC B;  3KYH C;  3WWV A;  3ICE A;  4K0K Q;  1ZXT A;  2BH2 A;  4Y7N H;  2B2Y A;  2R61 A;  4DR4 L;  2F0N A;  1RKN A;  4NXN L;  4A3B B;  3CPF A;  1J9O A;  3P75 A;  3CF5 A;  4U68 A;  1K8M A;  3CP0 A;  1K9M C;  2E76 C;  3A8J E;  1JT8 A;  1PH5 A;  3NBH B;  4IUN A;  2M9V A;  3KF8 A;  4JI0 L;  2I5H A;  4PQX A;  2NVX H;  1K28 A;  3D6C A;  1L1O C;  4S3S A;  1NMF A;  4ME3 A;  2UUB Q;  1EQR A;  1N34 L;  1SYE A;  3DEP A;  1A3T A;  1WFQ A;  4JV5 L;  4MN3 A;  4OWT B;  1D1I A;  1TWC B;  3PUY A;  4JI8 Q;  2R92 H;  4KTA A;  2GA4 B;  1GHK A;  1YHA A;  5T1I A;  2PQE A;  1BKB A;  4LUV A;  5C44 H;  2ICE C;  5A35 A;  3A7L A;  3J81 i;  1NUC A;  1CA5 A;  2F0T A;  4Y52 H;  3A7A B;  3HGB A;  3BYT B;  1B9M A;  1XX8 A;  2N55 A;  2UXB Q;  5EQ0 A;  2A8V A;  4QQB X;  1WCM G;  3LWE A;  5J3B A;  1HA5 A;  4K2L A;  1QIL A;  4JBK A;  1S5B D;  3M4P A;  2JA5 H;  2O5J C;  1ICF B;  4A4I A;  3GTK H;  2A69 C;  2HIV A;  4FXK C;  5ELB A;  3ULP A;  4A3M G;  3GTM H;  2L5T A;  1ML0 D;  5M5Y B;  4NXM Q;  1A3V A;  3M7N A;  3K5N A;  1RD9 D;  1WJJ A;  4L6T B;  4X6A H;  4JI3 L;  4MHE A;  1E2Z A;  3CCJ A;  3O13 A;  1E3P A;  1SDF A;  1FYC A;  4KKS A;  4QF4 A;  1RHP A;  1U5K A;  3G7L A;  1EEF D;  4BA1 I;  1A3U A;  1EEI D;  1KDC A;  2AQ1 B;  2K5D A;  1QZG A;  2WP8 J;  4IUQ A;  4JI1 Q;  1OXT A;  1VCI A;  1BDO A;  4QMG A;  1FJG Q;  1SE3 A;  2EPB A;  2WAQ B;  2EYF A;  3KDF B;  4KD4 A;  4GS3 A;  3VR2 A;  4F88 A;  4J6H A;  2F4V Q;  2NBF A;  4KN4 C;  2PO4 A;  1I6H H;  5BN4 A;  1ET9 A;  4C1N K;  5JPM C;  4IFD J;  1JB3 A;  4QL5 A;  2ZXP A;  3ND9 A;  1EZ6 A;  2F0E A;  1CKO A;  2TSS A;  4CKE A;  3RNU A;  1BCP F;  4HAE A;  4AH6 A;  3PO2 G;  3CCQ A;  3RLO A;  2E5L L;  5E3F A;  3HOW G;  2OCE A;  2HD3 A;  1TY0 A;  3HOU H;  3S16 H;  3I4M G;  1R4P B;  5EPL A;  1IKM A;  2YTV A;  1BVS A;  1BCP D;  3EBE A;  4MNO A;  1B1Z A;  1I50 B;  1M4V A;  3NXW A;  1N9W A;  5LL6 S;  5BN3 A;  1SNP A;  3I73 A;  1A8V A;  1BOS A;  4GN3 B;  1KLG D;  1TS5 A;  4A3C G;  3TZD A;  2M00 A;  1I4P A;  4DK6 C;  5CV7 A;  4C56 C;  2HHH Q;  4A3M H;  1Q81 C;  2K05 A;  3G6E A;  2X6L A;  1D5M C;  3R3O A;  1VQE A;  2Y0S B;  3RR5 A;  3Q24 A;  4DV7 Q;  5FO9 B;  3S2D B;  2F0O A;  3PUW A;  4DXF A;  3BU2 A;  1EQQ A;  4X3T A;  1BBX C;  3A56 A;  1S5F D;  2PI2 E;  2K6A A;  1N36 L;  3CC2 A;  4DV5 Q;  1QE6 A;  1CFM A;  3DWP A;  3S15 H;  3CAM A;  2VS1 A;  3TP8 A;  4EQP A;  4A3E B;  5JOB A;  3T56 B;  1C0A A;  3GDE A;  3FKI B;  4GNX C;  2KHS A;  3OW2 A;  1AE2 A;  1STG A;  2Z8L A;  4EQN A;  1F2Z A;  5I2X A;  4U67 3;  2B2V A;  2EYL A;  2NVT H;  2JA7 H;  4BBS B;  2R6G A;  4DAM A;  3SK5 A;  4BBR G;  4TVA B;  3PO2 H;  4X3K A;  3LNN A;  1W3S A;  5D14 A;  2RKS A;  2B8F A;  3F8T A;  3LX0 A;  2HCI A;  2JXM B;  3NEM A;  2I5L X;  1E2W A;  2KUM A;  3HOW H;  1QVG A;  4MTK A;  1VQK A;  4DR1 Q;  1IZ6 A;  1QJO A;  1NSN S;  1KAW A;  1STE A;  1TXY A;  4GOP A;  1MI2 A;  1D1K A;  2AWN A;  4R4O A;  1RL2 A;  4A3J G;  1L1O B;  1K8G A;  3HOZ B;  4A3F B;  1JOQ A;  5IY0 A;  5EBD A;  3S1N B;  3KBG A;  1B4O A;  3OSO A;  4KI0 A;  4AQY Q;  1PHJ A;  1KNA A;  4KY5 A;  4C3H B;  3J7A V;  3SXH A;  5IYB G;  3RZD H;  2PNR C;  1CKM A;  2D5D A;  3MXP A;  4X62 Q;  4IN3 A;  4G4K A;  5CMD A;  1GOZ A;  2K01 A;  2G5D A;  2UU9 L;  1VQ4 A;  3D4W A;  4HTH A;  4KY7 A;  4P2C B;  1QZH A;  2B2T A;  2AKW B;  2UXC Q;  3T51 B;  3A0J A;  2R3Z A;  4JOI C;  2E2I B;  1U9R A;  1LO5 D;  1LTA D;  4EQO A;  4ZCK A;  2KJX A;  4P71 A;  1Q3L A;  1QG7 A;  5ELF A;  3HS0 C;  2V4D A;  3J7Y W;  2IPK D;  3GTG H;  1B44 D;  1TQO A;  1R9T B;  3BZC A;  3P7J A;  2K5H A;  3E9H A;  1F2Y A;  2MQH A;  3K7U C;  5C4Z A;  1AW7 A;  1VQ7 A;  4HID A;  1VQJ A;  3D6W A;  3MXN A;  3S2H H;  1HNX L;  3RZO B;  5E1F A;  4BBR H;  5CV6 A;  1NTG A;  1VQ6 A;  1HZB A;  4X66 L;  1S4Z A;  4RKB A;  3DWA A;  3I56 A;  3GTM B;  3EVQ A;  4FXD A;  2JA9 A;  1HJP A;  4DV2 Q;  3U4Z A;  1EU4 A;  1Z7T A;  5COR A;  5D65 A;  2LS0 1;  2N88 A;  2BCO A;  2VZA A;  1VMC A;  5IP9 H;  2D2C C;  2M2L A;  1V1P A;  1Q8I A;  3T16 A;  4JK1 C;  4ID6 A;  4B3R L;  1SMY D;  3IKJ A;  4ZKC B;  1Y14 B;  1EYG A;  1QNU A;  4LF9 Q;  4C3I G;  3T1Y Q;  4LUO A;  1WD1 A;  2A6E C;  2SNM A;  1DOL A;  1W2B A;  1CHQ D;  1SNM A;  1VQM A;  1UE1 A;  5C4X G;  5C3E H;  1Y1W H;  3I4N G;  4JI7 L;  4CBV A;  3M3Y B;  3W1G A;  1O80 A;  3HOX G;  4OO1 G;  2KHI A;  3S16 B;  1IYV A;  4KK7 A;  4O0A A;  4JI5 Q;  1FD7 D;  4JC0 A;  4UP7 A;  1TII D;  1D8L A;  1JB7 A;  3I70 A;  2ZTC A;  3Q6S A;  3T1H L;  1K8A C;  1WCM B;  3NWT A;  4IJH A;  2JK8 A;  3CCS A;  1SRO A;  4ZLT F;  4A3M B;  1IBL Q;  4B9X A;  4KHV A;  4X65 L;  1HZ9 A;  4OL7 A;  1JOR A;  1UNS A;  2H4O A;  5C5L A;  1IL2 A;  2IX3 A;  2XVS A;  4DUY Q;  3RN2 A;  1WTH A;  1EU3 A;  4AYB G;  3TDQ A;  5T1G A;  1XTD A;  2ZTD A;  5ISR A;  2Z6K C;  4R8N A;  4IFD H;  2NN6 I;  3CQZ H;  1I4R A;  3I4O A;  4GNX B;  4RGO S;  2UXD L;  2HQL A;  1VMP A;  5IYD H;  3J80 i;  4A3I G;  4KN7 C;  5CGK A;  1TU2 B;  2R7Z G;  2CCZ A;  5CBE E;  1Q12 A;  1EIF A;  3H6M A;  4K2K A;  3RLF A;  3S17 H;  1XNQ Q;  3T53 B;  3OYY A;  4XT1 B;  1TWF B;  4I7A A;  3PO2 B;  3ERS X;  3A8I E;  5GAG C;  3CD6 A;  2BDN A;  5FKA C;  3HOW B;  3HOX H;  4LF4 Q;  1PRT D;  4K5V A;  4RH6 A;  3I4M B;  2L1B A;  2BDO A;  3DUZ A;  4UP9 A;  1NCV A;  1F9P A;  3R2I A;  4KY6 A;  4WFN 3;  1FNU A;  1KDB A;  1SE2 A;  3OTO Q;  3G4S A;  1X56 A;  3GTO H;  4OXP A;  2KEC A;  2BA0 A;  1DYQ A;  3Q23 A;  2BA1 A;  1LUZ A;  5KGU A;  2JN4 A;  2RCF A;  3VYU A;  4QUC A;  2KBN A;  4JYA Q;  1H9S B;  2B2W C;  1SN8 A;  2J0T D;  2PYK A;  4H0L C;  4GN5 A;  1VQA A;  3CRL C;  3K57 A;  5J1Z A;  2FMC A;  2LSS A;  2JEA I;  5IOD A;  1SND A;  2K7V A;  2PW7 A;  4EVO A;  1TWG H;  4G7H C;  1CQV A;  1EIY B;  1PTO D;  3QOL A;  4HN7 A;  4V0B A;  4JI4 L;  1TWA B;  4L5R C;  3LGJ A;  4OX9 L;  2B8G A;  5FOB B;  5FLM H;  2NTT A;  1VQL A;  2Q8R E;  1ESF A;  5CV8 A;  2EY1 A;  2LY7 A;  3I7F A;  2KCT A;  3KK7 A;  2KEE A;  3A5Z B;  4PMC A;  4LF5 Q;  2NZO A;  5EAY A;  4FF1 A;  3J7A F;  4B3S Q;  4B08 A;  1SLJ A;  2EY6 A;  3UI2 A;  4DN4 M;  4BBR B;  1MKH A;  1F77 A;  3SGI A;  4DAV A;  4UAI A;  3A54 A;  2F0F A;  3PIO 3;  3HOV H;  1CK1 A;  1YIJ A;  3HOY H;  4CJ1 B;  4UP8 A;  1NMG A;  5FLX L;  1LTT D;  1I3Q H;  1Y8P B;  5FLX E;  3PIP 3;  1OXS C;  2YU9 H;  2PMZ B;  4X3U A;  4K5X A;  3OPO A;  3WDN A;  1IHZ A;  5HGT A;  4A3J B;  1SFO H;  1ASY A;  3GTQ B;  4HMJ A;  2CW0 D;  1RJT A;  1HR0 Q;  4BY7 H;  1XMQ L;  3SK4 A;  1KTK A;  4DNT B;  5C6A A;  5M5W H;  3L2P A;  4LMQ D;  4DR6 L;  3GTL H;  4LF8 Q;  1QNK A;  1C7Y A;  4KMU C;  2B2U A;  5E4X A;  4DV6 Q;  2EYP A;  1SAP A;  3UDI A;  2WII B;  5IIF A;  2EVB A;  1I4H A;  2UUC Q;  2EY2 A;  3K5L A;  3ER0 A;  3IFD A;  4IAL A;  1TS2 A;  4NMZ A;  3ITP A;  4GKK L;  1BQQ T;  4FF4 A;  3PCO B;  4LUZ A;  4OGQ C;  4ULL A;  3STB D;  1ONL A;  3GTJ B;  3SVM A;  4DV0 L;  3T13 A;  4DR7 L;  4Z9C B;  2WV6 D;  1JCK B;  2R7D A;  4DUZ L;  1U0L A;  5L37 A;  4DR2 L;  5AJ3 L;  2AWO A;  3GP7 A;  1X54 A;  4R4T A;  2B39 A;  3I91 A;  3VR5 A;  1H9S A;  2RDH A;  2PZW A;  3CPW A;  2F0K A;  3PMF A;  1EOT A;  1Q1E A;  2XN9 C;  3Q0A A;  1GUW A;  1HQR D;  1PFN A;  1PFM A;  3A74 A;  4RHR A;  2HQE A;  3J81 c;  1B50 A;  1QUQ B;  1PTO H;  3F2U A;  2IL8 A;  3GO5 A;  1PYS B;  3SK8 A;  4UPA A;  2R92 G;  4C3I B;  4LF6 Q;  1RTO A;  2KEN A;  5M9O A;  3TS0 A;  3HFZ B;  2VQF L;  2F0P A;  4N9P A;  2N8N A;  5C4X B;  2KCC A;  4LF7 Q;  3KJP A;  3I4N B;  4PZ7 A;  1WTX A;  5COY A;  5E4W C;  2IHF A;  3HOX B;  3H3V H;  1YJ9 A;  3TBI B;  5LMN W;  2VUM G;  2JSO A;  5IGB A;  3V05 A;  3AQQ A;  3G71 A;  3D4D A;  2AUJ D;  3FP9 A;  2JA5 G;  1J8I A;  4ZK9 B;  1TWH B;  2B29 A;  2PZU A;  1DCZ A;  1D5X C;  1Q90 A;  1LV9 A;  3GTP B;  1IW7 C;  1X3E A;  1HXY D;  1VQF A;  1IYU A;  3V2T A;  1Y1V G;  2KVM A;  3NWS A;  1I94 L;  3F2D A;  4JI6 Q;  1YNN C;  5C0X G;  3SEB A;  1GVP A;  3HG9 A;  5C4J H;  1HNW L;  3FDT A;  3OIP A;  1GUO A;  1J6Q A;  4A3D G;  4PMB A;  1SJH D;  2KOL A;  2PMZ E;  2QW7 A;  1HNZ Q;  3DM3 A;  4MZ9 A;  2K50 A;  4AYB B;  1EL0 A;  1KAA A;  3FMC A;  1FNW A;  3PQI A;  3K80 C;  2B63 H;  1Z9F A;  2QDB A;  5F2D A;  1N33 Q;  1BO0 A;  2WKC A;  4NKL A;  5DAU A;  3TN2 A;  4A3I B;  2RHS B;  3I4L A;  1E1T A;  2R7Z B;  2YTX A;  4DPG A;  4OON A;  4XQQ A;  1UE7 A;  4NB3 A;  3TP7 A;  1V43 A;  1PH3 A;  2E2J H;  3HOU G;  1M8A A;  4C2M H;  2R7F A;  1JE5 A;  1JR0 D;  1CT1 D;  5NUC A;  3UDF A;  3PF5 A;  1JWM D;  1S72 A;  4OHJ A;  4LFA Q;  2HIX A;  1QB5 D;  5I9P A;  5LHY 1;  2VUM H;  5I6W A;  3W3A A;  1JIC A;  3MA2 B;  3I2Z A;  1EOV A;  3HKZ G;  2K33 A;  4R1J A;  3VYS A;  4DA2 A;  4L5T A;  1G8Z D;  2LFN A;  1J5E Q;  4NW2 A;  2F52 A;  1Y1V H;  4DR4 Q;  2E8G A;  1EY4 A;  2A6H D;  5C0X H;  1MHW C;  1EWI A;  1HA6 A;  4NXN Q;  3RUZ A;  1LM0 A;  3NBI A;  4A3D H;  1UE6 A;  1VF7 A;  3DXJ C;  4JVZ A;  1HCZ A;  2MO0 A;  3S1R B;  2LXK A;  2A68 D;  4HJ8 A;  4BS9 A;  1AZQ A;  4JI0 Q;  5IP7 H;  1QVF A;  3BDL A;  3SR1 A;  3BG3 A;  2QIL A;  2JA7 G;  1ENF A;  1ZYR C;  4OWX B;  5JVH 3;  3OOC A;  1HUN A;  4L5Q A;  1CZW A;  5EPK A;  1SE8 A;  3VYT A;  2C5C A;  5M5X B;  1PZK D;  1N34 Q;  2ICI A;  3IRB A;  4FDB A;  5LMU L;  3KOJ A;  3KJO A;  4KV6 A;  3F2B A;  4JV5 Q;  2EQS A;  3QIA A;  5FJ8 H;  1VQB A;  2MUY A;  4XIG S;  3B6Y A;  2QEJ C;  2CFM A;  2JEB I;  2OTJ A;  4HIO A;  1V8Q A;  3EJI A;  1PYW D;  3F2C A;  3KF6 B;  3WOF A;  5JAV A;  1TS4 A;  3NBH A;  3UDG A;  2PI2 A;  4J8Q A;  1D2B A;  2N49 A;  3K7A B;  3UE0 A;  1B7Y B;  4E6I A;  4DR5 L;  3NE5 B;  3K5M A;  2JP1 A;  2FFK B;  2IJ0 A;  4F87 A;  1PLF A;  2EOT A;  4A3L H;  3S14 B;  4MIU A;  1G91 A;  1KRT A;  4QY7 A;  3TRE A;  1C8C A;  5ELE A;  4ME5 A;  1S3O A;  5BR8 L;  4FVM A;  1N32 L;  4JI3 Q;  2F0S A;  1CKN B;  1UWV A;  1GHJ A;  2SEB D;  2DUD A;  1L0X B;  1FGU A;  1I4G A;  2K5V A;  3NTI A;  1S40 A;  2ENB A;  1ILQ A;  2ALY B;  2VQE L;  1VQH A;  1F9R A;  2EJF C;  1WTR A;  3SHL A;  3VR3 A;  2IHE A;  2CHB D;  4OO1 I;  3R8B A;  2PQA B;  4YY3 L;  4Y7N B;  4KKU A;  4CJ2 C;  4TSS A;  4DR3 L;  2MP1 A;  4OEL B;  1L0Y B;  5EBC A;  1LAB A;  5A2Q L;  4KLK A;  1O78 A;  5A2Q E;  5JEA J;  1IL8 A;  3E0E A;  3TZU A;  1OTC A;  2ATW A;  2JA6 H;  1HFG A;  2I46 A;  1MJC A;  2D9U A;  3L3O C;  3BJU A;  5LMN L;  1BNZ A;  2E5L Q;  1JWS D;  4IUP A;  5LMU Q;  1GXD C;  1EY6 A;  2EDG A;  2Q8T A;  2RQX A;  3A8K E;  5C4J B;  4ZUI A;  5IP9 G;  5KYI A;  1IBK L;  3KFU A;  1AFP A;  2NVX B;  4B3T L;  1G51 A;  1XYI A;  5KNB A;  2QKI C;  3NHH A;  2EYJ A;  1TT2 A;  3MVV A;  4RA8 A;  2XTI A;  1A6X A;  1W6K A;  1PH1 A;  2PZT A;  3CCM A;  2IX1 A;  4LFB L;  1EWC A;  3KDF A;  3JAM L;  3JAM E;  2X6G A;  2KCM A;  5C3E G;  1Y1W G;  2DY7 A;  2R92 B;  2QA4 A;  3P20 A;  2OWO A;  5JVG 3;  3H0G G;  1K3B C;  5C44 B;  3H09 A;  2BE5 C;  2K4K A;  4X3S A;  1LTL A;  2WAQ E;  4ZKB B;  1D6E C;  1DOK A;  3VA5 A;  2CWP A;  3QJY A;  1SEB D;  1IBM L;  4B9W A;  1N36 Q;  1ESR A;  4IJL A;  4RGM A;  3PSI A;  5IWA L;  1LTS D;  3S1M H;  1WYD A;  3J7A 5;  2VNU D;  1FVI A;  3NTK A;  4DU9 A;  1W6J A;  2PPB C;  1EY8 A;  1EFW A;  2JA5 B;  3GTK B;  3DHQ A;  5K5P A;  2F0L A;  4JI2 L;  4EX5 A;  1V9P A;  4LFC L;  1TVX A;  1JJ2 A;  3I55 A;  4A93 H;  3J80 c;  3DEO A;  1SXT A;  1RCV D;  4IOC A;  4IFD G;  3J81 L;  5GAD C;  1MIU A;  2CQO A;  4HCS A;  3FVQ A;  4F7X A;  4K6L A;  1CUK A;  1KRS A;  3J81 E;  1K0S A;  5IYD G;  2R93 G;  2FIN B;  1BXT A;  1U4L A;  2YTY A;  3CW2 C;  4A3K H;  4P75 A;  2Y0S E;  3MXG A;  2NVQ H;  2Z1C A;  1C9O A;  1I6H B;  3W5O A;  4BY1 H;  1I5F A;  2B2Y C;  2O4X A;  4HSP A;  2ZM6 L;  1K83 H;  1EY7 A;  3H0G H;  4NP5 A;  3Q22 A;  2XWJ B;  1VS0 A;  2OEO A;  2VL6 A;  1S5D D;  1RTN A;  2UU9 Q;  5M3F H;  4GLA C;  1WD0 A;  3HOU B;  4KHP L;  2HDL A;  3H91 A;  4B3M L;  1IYJ B;  4POG A;  4FF2 A;  3IFT A;  4GLX A;  4FXG C;  4N9T A;  1PXU A;  4K14 A;  1EZ8 A;  3TEH B;  2JA8 H;  1L1O A;  5AFW A;  4X64 L;  3KUP A;  4YHH L;  1HTP A;  2L12 A;  3NQI A;  2WB1 G;  2J7Z A;  3KLS A;  4XYQ A;  1GUN A;  4ZQ3 A;  2N78 A;  1CM9 A;  1VQC A;  1VQP A;  2PCF B;  1HNX Q;  4CDF C;  1HZA A;  4DAY B;  5IYC H;  2BH8 A;  4OEM B;  4YIJ A;  2E2H H;  4X66 Q;  1X6O A;  1YJW A;  1ICW A;  4UY8 C;  1S5E D;  5FLM G;  4C3J H;  4DV1 L;  1H9K A;  3S15 B;  2G9D A;  5JJZ A;  5C3X A;  2R93 H;  2NYZ D;  1DXM A;  1G6Z A;  4IPG A;  5BN5 A;  2L0C A;  4IUU A;  4XDX A;  4DK1 A;  1PH7 A;  1S5C D;  1XMO L;  1T5E A;  1KDA A;  4IPC A;  4B3R Q;  2NVT B;  2JA7 B;  2RHQ B;  1I4X A;  2KHJ A;  4Q0F A;  3W2D A;  3C1E A;  1WTP A;  1LT6 D;  4KHZ A;  1K8O A;  3M4O H;  3HOV G;  4ODG A;  3CME A;  3HOY G;  3TS2 A;  1WTW A;  4GKJ L;  4DNR B;  1U4M A;  2NZH A;  4JI7 Q;  5I9O A;  4HIM A;  1NR4 A;  1R4Q B;  4DV3 L;  3OW7 A;  2K5N A;  1PH6 A;  1ILP A;  1KXL A;  3U58 A;  3D0F A;  1BBU A;  1UUP A;  3R93 A;  2XNA C;  4KKT A;  4NDX A;  2NVY H;  1EQV A;  1SRU A;  3QO2 A;  4G7Z C;  3PO3 H;  4R4C A;  1F9Q A;  1YNJ D;  4BY7 G;  2DJG C;  2MFI A;  3KBX A;  3QB3 A;  3BYY B;  5H1S E;  2O2L D;  3RZD B;  3C46 A;  4ZYS A;  1H9M A;  3T1H Q;  4BA2 I;  5ELC A;  1PH2 A;  1VQD A;  2P5Z X;  1NJI C;  1B70 B;  2RVL A;  4A3B H;  2KCN A;  2NZ1 D;  2KED A;  5GRO A;  3K8A A;  1SMY C;  4YWM A;  4X65 Q;  2VB2 X;  2ZXO A;  1JOK A;  5M3M G;  4XXE A;  3IL8 A;  3GTG B;  5I4D A;  4DV4 L;  5JEA H;  2F0H A;  4LNQ A;  1Y8N B;  2F3V A;  4IPH A;  4DV1 Q;  2K1B A;  2RA4 A;  3OIQ A;  2ZJQ A;  2UXD Q;  3S2H B;  1BCP B;  2NUC A;  2C9O A;  4OIJ A;  4J1M A;  1ENA A;  3AEV A;  1CHP D;  1UEA B;  5KEE A;  1TWC H;  1NE3 A;  3J7Z C;  3CMA A;  4ZAI A;  1ZEQ X;  1G2S A;  2EXD A;  1GKH A;  2F03 A;  1EWH A;  2J4X A;  4IUT A;  4FP5 D;  2WFW A;  1SE4 A;  4P73 A;  1JWU D;  4K8J A;  4JG2 A;  1Q7Y C;  5JJI A;  1Q1B A;  3D31 A;  3NEL A;  3QWN A;  3QOJ A;  4GNX A;  2F0W A;  1B3A A;  2B2V C;  3AFQ A;  1QOH A;  3U4V A;  1VQN A;  1LTG D;  3NQT A;  3EN2 A;  2UUA L;  2YV5 A;  4UDU C;  1KD1 C;  5DNF A;  5EKL A;  5EKI A;  5M5Y H;  1A0I A;  3EIV A;  1JQY D;  5C3E B;  4IZ8 A;  1Y1W B;  1EIH A;  1GD7 A;  3NP8 A;  2GN5 A;  3AFP A;  1XXG A;  1XNR L;  3H0G B;  4HJ5 A;  3KF8 B;  5FO7 B;  1PH8 A;  1EFI D;  4GOP C;  3MC0 B;  1X3G A;  2K32 A;  2AHO B;  5KRU A;  5M3M H;  1H95 A;  4O1N A;  4ILW A;  1SJE D;  5GAH C;  5J39 A;  3TP5 A;  4JI4 Q;  1QVC A;  2DN8 A;  3FHW A;  2CQA A;  4OX9 Q;  2E2D C;  1IXR A;  1X55 A;  2TMP A;  4HIK A;  1F9S A;  3RN5 A;  4K0K L;  2A19 A;  1JE4 A;  2EYM A;  5IT9 c;  3M4Q A;  5LL6 X;  2NTS A;  1PRT C;  4AIM A;  2I0Q A;  1XWE A;  3L9A X;  2WIN B;  5CC4 A;  2DY8 A;  3KLR A;  1CTM A;  1D5Z C;  2B2T C;  1YIT A;  4RHS A;  1PH4 A;  4NPS A;  4N8F A;  5ELO A;  1NR2 A;  4JOI A;  4CDC C;  5GAE C;  4L63 B;  1Q86 C;  2MJ8 A;  2X69 A;  2A69 D;  4PNY A;  1MSH A;  1VQ8 A;  3CQZ B;  2ASB A;  4R9W A;  2B63 G;  3H94 A;  2HUG A;  4YCU A;  1HUM A;  4HJ7 A;  4UHV A;  1A63 A;  2UUB L;  1KLU D;  1Q82 C;  1TY2 A;  4RFB A;  3M7G A;  1OO9 B;  1EQT A;  4RAU C;  3K0Y A;  4HCE A;  3S17 B;  1PTO C;  4JI8 L;  2FMM A;  5HY6 A;  4DK0 A;  4H02 A;  1XMQ Q;  2NN6 H;  3S2D H;  4YWK A;  2KA7 A;  1O7Y A;  1WOC A;  4DR6 Q;  4M8A A;  3X3M A;  2FXQ A;  1DGS A;  5ELD A;  4CJ0 B;  1ZYR D;  2DJF C;  2UXB L;  3K59 A;  4A3E H;  1XPO A;  3MAQ A;  3GTO B;  3J81 j;  3H3V C;  4ALP A;  1BBW A;  3ULJ A;  3FKI H;  1NY4 A;  1QWY A;  4LJZ C;  3J80 L;  3J80 E;  4GKK Q;  4BBS H;  1LTR D;  3ERO A;  2WB1 B;  4NXM L;  2XWB B;  1HZC A;  3URY A;  4BWG B;  3JAM i;  2F0Q A;  3CRK C;  4DV0 Q;  1GO3 E;  1ET6 A;  3BVM A;  3W1B A;  1WVL A;  4DR7 Q;  1JJG A;  3MFY A;  4DUZ Q;  2RF4 A;  3N6R A;  4DR2 Q;  1TWG B;  2CW0 C;  5AJ3 Q;  1EY5 A;  4JI1 L;  1VQ9 A;  1EYD A;  1X65 A;  3NEN A;  3QR8 A;  1UAP A;  2SOB A;  4QUF A;  5IP7 G;  1FJG L;  3S1Q H;  2DNC A;  2FHT A;  3HOZ H;  3E6Z X;  4A3F H;  2MGS A;  2F4V L;  4N8X 1;  3S1N H;  3ZYY X;  1GUS A;  2XSC A;  3GV6 A; 
#chains in the Genus database with same CATH homology
 2MHV A;  4WJW A;  2HCC A;  4PMW A;  4RCN A;  5TSS A;  3VYR A;  1X32 A;  3FPP A;  5KND A;  5I6Y A;  1GUT A;  5EKK A;  1GUG A;  1SYC A;  3HOV B;  1GJX A;  3BVG A;  1LLR D;  3HOY B;  5KIX A;  1JOO A;  1I3Q B;  2YU9 B;  1G29 1;  5CV9 A;  3MWY W;  1I4Q A;  3OWE B;  4OIK A;  1A15 A;  1SFO B;  2L11 A;  4O42 A;  3IAY A;  4TQU S;  1RF2 D;  2F0D A;  1O7L A;  4BY7 B;  1QCB D;  5IGC A;  1VF5 C;  2YYZ A;  2G9H D;  1EY0 A;  5M5W B;  4DF7 A;  1STB A;  3GTL B;  2WKD A;  1PMR A;  3MXU A;  2H1E A;  4K6D A;  5M3M B;  2QCP X;  2L4N A;  2K28 A;  5DM7 3;  1TKW B;  1PRT B;  2EZV A;  2BE5 D;  1C48 A;  1LT3 D;  3C1F A;  1OXV A;  3RMH A;  5CR3 A;  2B2W A;  1MSG A;  3BZD B;  1SYG A;  3OMG A;  5IOC A;  4V19 0;  2HDM A;  4K8I A;  3GV3 A;  4LAA A;  2F0I A;  5I2Y A;  1SNQ A;  4C1N I;  2A74 C;  2EYO A;  1O7Z A;  1PTO B;  4M1U B;  4IFD I;  2K04 A;  1FNV A;  3KLS X;  2LMC B;  4G57 A;  3MZ5 A;  1STN A;  1H9R A;  3D8G A;  3K58 A;  3P1H A;  3EQL C;  4CKC A;  4DGZ A;  4F8M A;  1LT5 D;  3PUZ A;  1PFB A;  2A6E D;  3D3R A;  4RCO A;  4XQN A;  1V1P B;  3BS1 A;  4IUV A;  4RGT A;  5EJW A;  2F0G A;  1PZJ D;  2F0J A;  1OXX K;  3CHB D;  4KJO A;  1Z47 A;  4I65 A;  2EE1 A;  1AEX A;  4HED A;  2XRS D;  3HZX A;  2VB3 X;  3U9O A;  4XT3 B;  2E75 C;  1BR9 A;  2B2U C;  3AMU A;  2NWG A;  4ABN A;  1XTC D;  2AUK A;  4H13 C;  2EY5 A;  3NPP A;  1EYC A;  2B63 B;  2AQ3 B;  3S1Q B;  1U4R A;  2A6H C;  1LT4 D;  4QIW B;  3BDO A;  3N52 A;  3DMU A;  1ROD A;  4IUR A;  4HMI A;  2E2J B;  3ERQ A;  5HUR A;  2A68 C;  1STY A;  4C2M B;  4EGV A;  1TS3 A;  1X3P A;  1SNC A;  2A73 B;  5KYL A;  5IT9 L;  5IT9 E;  2VUM B;  3CKI B;  2JYO A;  3FPU B;  4XYO A;  1CA6 A;  4RWS C;  3K6O A;  1HFN A;  3M85 A;  2SNS A;  4H44 C;  3CU7 A;  4Q5V A;  1BCP C;  2PW5 A;  1Y8O B;  1NAP A;  1EIG A;  2CVR A;  3PUV A;  1KNE A;  1F2L A;  3T4A C;  3VR6 A;  1Y1V B;  3K5O A;  2ZXR A;  1HHV A;  1DZ1 A;  2NB0 A;  3RD4 A;  2IWH A;  1PDQ A;  4C3J G;  4A3D B;  5IGF A;  3I3C A;  3G6J B;  2EXZ A;  1DD2 A;  3I90 A;  2XIW A;  2JE6 I;  4XQJ A;  3GD7 A;  2Z4I A;  1ENC A;  1SNO A;  1IKL A;  1X3Q A;  1CQF A;  1DON A;  2RDG A;  1F2M A;  1BUV T;  2K03 A;  4I7Z C;  5K36 G;  4RKL A;  1WTO A;  2A5H A;  1B53 A;  2WAC A;  2DNE A;  5J22 A;  3HP3 A;  3D4R A;  3V96 A;  4WRD A;  5CV5 A;  2XRQ D;  3HKZ B;  3DM1 A;  1B2T A;  2RSN A;  5DEH A;  4CGY B;  1JC7 A;  4H7B A;  3EFX D;  1E2V A;  2OF1 A;  5JPN C;  1Y69 U;  3HRZ C;  4R8I A;  5JEA G;  2Z4H A;  2E74 C;  1DJR D;  1AN8 A;  3X3N A;  2LKV A;  3NSW A;  5IGG A;  1MGS A;  3MEH A;  4QB4 A;  2O5I C;  1CZG A;  2L9H A;  3HEJ A;  2EJG C;  3SDZ A;  3MHB A;  2F1M A;  4FYD A;  2JA6 B;  5K36 H;  4WOR A;  2BOS A;  1PRT F;  2MPM A;  3GQB A;  1SBB B;  2SDF A;  1WTV A;  2ZT9 C;  2F3W A;  2OXP A;  1OXU A;  3M4Y A;  2IW3 A;  4OO1 H;  3E5S A;  1G2T A;  3VA7 A;  2L55 A;  1E0B A;  1T5X D;  4XTC S;  3AU7 A;  2Q8I B;  3PUX A;  4ZUJ A;  3TP6 A;  4DFA A;  5C5M A;  5FO8 B;  1PZI D;  1V1O A;  4L8J A;  1II3 A;  3SE0 A;  1PTO F;  1C4Q A;  1TR5 A;  2RDF A;  3WOE A;  4ZRZ A;  3FEW X;  1DM0 B;  2IX0 A;  1SSO A;  3MFG A;  4KJN A;  3S1M B;  1U4P A;  2K5W A;  1VDZ A;  2KQ3 A;  5CBA E;  1LTI D;  1I6V C;  3R2T A;  5C0X J;  4TRD A;  1SYB A;  5C3W A;  3NTH A;  3ND8 A;  4TKO B;  3TME A;  5EPJ A;  1STH A;  3A55 A;  1Z6H A;  3U9S A;  3VR4 A;  4A93 B;  3C2P A;  4A3G B;  3NK9 A;  4QCL A;  4PV1 C;  4DAY A;  1WTQ A;  1IW7 D;  2IT1 A;  5C0X I;  3E0J A;  4A3K B;  1LTB D;  1SYD A;  1AZP A;  1YNN D;  4IQZ A;  2EYH A;  5FK9 C;  2NVQ B;  2QF7 A;  4DAP A;  3I72 A;  4BY1 B;  1MBY A;  1K83 B;  2RSO A;  2NN6 G;  3QG1 A;  4HR7 B;  3PV0 A;  2F0M A;  5M3F B;  2ID0 A;  3AB9 A;  1B9N A;  3BDC A;  4K5W A;  1A2U A;  3SK6 A;  1A2T A;  2EJM A;  4CHT B;  1AP0 A;  2VXW A;  3C3L A;  1HRJ A;  1EY9 A;  5EGT A;  2JA8 B;  4FNF A;  5C4H A;  4RGN A;  1H9J A;  3DWQ A;  1ZKO A;  5CV4 A;  3TSS A;  4HSV A;  3OWF A;  2RBM A;  4FF3 A;  3EA6 A;  3BVZ A;  1DOM A;  5IGD A;  1FGB D;  2E2H B;  5D3I B;  3OMC A;  1YNJ C;  3I8Z A;  1MD2 D;  3NUC A;  4C3J B;  1HTL D;  1LAC A;  5KNC A;  5DM6 3;  2R93 B;  1HQM C;  4LK1 C;  4DXG A;  4C3H G;  4G7O C;  2I07 B;  5G3L F;  4CKB A;  1RDP D;  1CI3 M;  4FO2 A;  1HPC A;  2F0U A;  1STA A;  3LWU A;  2D62 A;  3M4O B;  5D3D A;  5CYU A;  5IGE A;  3OHX C;  1KAB A;  5G3L D;  1SYF A;  2AQ2 B;  1EYA A;  1BF4 A;  3S9W A;  1FR3 A;  2F4I A;  2K5Q A;  3MTS A;  3ONA B;  2FJ2 A;  4GZY C;  3FRP B;  2NVY B;  3L7Z C;  4KD3 A;  2OT2 A;  3PO3 B;  4JBW A;  2F0V A;  1ZXT A;  2B2Y A;  2R61 A;  2F0N A;  1RKN A;  4A3B B;  1J9O A;  3P75 A;  4U68 A;  1K8M A;  2E76 C;  3A8J E;  4IUN A;  2M9V A;  3KF8 A;  4PQX A;  3D6C A;  4S3S A;  1SYE A;  3DEP A;  1A3T A;  4MN3 A;  1D1I A;  1TWC B;  3PUY A;  4KTA A;  2GA4 B;  1GHK A;  5T1I A;  2PQE A;  2ICE C;  5A35 A;  3A7L A;  1NUC A;  1CA5 A;  2F0T A;  3A7A B;  3HGB A;  3BYT B;  1B9M A;  1XX8 A;  2N55 A;  5EQ0 A;  3LWE A;  1HA5 A;  4K2L A;  1QIL A;  1S5B D;  2O5J C;  2A69 C;  4FXK C;  5ELB A;  2L5T A;  1ML0 D;  5M5Y B;  1A3V A;  3M7N A;  3K5N A;  1RD9 D;  4L6T B;  4MHE A;  1E2Z A;  3O13 A;  1SDF A;  1FYC A;  4KKS A;  4QF4 A;  1RHP A;  3G7L A;  1EEF D;  4BA1 I;  1A3U A;  1EEI D;  1KDC A;  2AQ1 B;  2K5D A;  2WP8 J;  4IUQ A;  1OXT A;  1VCI A;  1BDO A;  4QMG A;  1SE3 A;  2EPB A;  2WAQ B;  2EYF A;  4KD4 A;  3VR2 A;  4F88 A;  4J6H A;  2NBF A;  4KN4 C;  2PO4 A;  5BN4 A;  1ET9 A;  4C1N K;  5JPM C;  4IFD J;  1JB3 A;  2ZXP A;  1EZ6 A;  2F0E A;  3ND9 A;  2TSS A;  4CKE A;  1BCP F;  4HAE A;  5E3F A;  1TY0 A;  1R4P B;  5EPL A;  1IKM A;  1BCP D;  1B1Z A;  1I50 B;  1M4V A;  3NXW A;  5LL6 S;  5BN3 A;  1SNP A;  3I73 A;  1BOS A;  1KLG D;  1TS5 A;  3TZD A;  2M00 A;  1I4P A;  5CV7 A;  4C56 C;  2K05 A;  2X6L A;  1D5M C;  3R3O A;  2Y0S B;  3Q24 A;  5FO9 B;  3S2D B;  2F0O A;  3PUW A;  4DXF A;  1BBX C;  4X3T A;  3A56 A;  1S5F D;  2K6A A;  1QE6 A;  1CFM A;  3DWP A;  3TP8 A;  4A3E B;  4EQP A;  5JOB A;  3T56 B;  3FKI B;  2KHS A;  1STG A;  4EQN A;  2Z8L A;  4U67 3;  1F2Z A;  5I2X A;  2B2V A;  2EYL A;  4BBS B;  2R6G A;  3SK5 A;  4X3K A;  3LNN A;  5D14 A;  2RKS A;  2B8F A;  3LX0 A;  2HCI A;  2JXM B;  1E2W A;  2KUM A;  1QJO A;  1NSN S;  1STE A;  1MI2 A;  1D1K A;  2AWN A;  3HOZ B;  4A3F B;  1JOQ A;  5EBD A;  3S1N B;  3KBG A;  1B4O A;  3OSO A;  4KI0 A;  1KNA A;  4KY5 A;  4C3H B;  3J7A V;  3SXH A;  2PNR C;  2D5D A;  3MXP A;  4IN3 A;  4G4K A;  5CMD A;  1GOZ A;  2K01 A;  3D4W A;  4HTH A;  4KY7 A;  4P2C B;  2B2T A;  3T51 B;  2R3Z A;  2E2I B;  1U9R A;  1LO5 D;  1LTA D;  4EQO A;  2KJX A;  1Q3L A;  1QG7 A;  5ELF A;  3HS0 C;  2V4D A;  3J7Y W;  2IPK D;  1B44 D;  1TQO A;  1R9T B;  3P7J A;  1F2Y A;  5C4Z A;  1AW7 A;  3D6W A;  3MXN A;  3RZO B;  5E1F A;  5CV6 A;  1S4Z A;  4RKB A;  3DWA A;  3GTM B;  3EVQ A;  4FXD A;  1EU4 A;  1Z7T A;  5COR A;  5D65 A;  2LS0 1;  2N88 A;  2BCO A;  1VMC A;  2D2C C;  2M2L A;  1V1P A;  1Q8I A;  3T16 A;  4JK1 C;  4ID6 A;  1SMY D;  3IKJ A;  4ZKC B;  1QNU A;  4C3I G;  1WD1 A;  2A6E C;  2SNM A;  1DOL A;  1CHQ D;  1SNM A;  4CBV A;  3M3Y B;  1O80 A;  4OO1 G;  3S16 B;  1IYV A;  4KK7 A;  1FD7 D;  1TII D;  3I70 A;  3Q6S A;  1WCM B;  3NWT A;  4ZLT F;  4A3M B;  4B9X A;  4KHV A;  4OL7 A;  1JOR A;  1UNS A;  2H4O A;  5C5L A;  2IX3 A;  2XVS A;  1EU3 A;  3TDQ A;  5T1G A;  5ISR A;  4R8N A;  4IFD H;  2NN6 I;  1I4R A;  4RGO S;  1VMP A;  4KN7 C;  5CGK A;  1TU2 B;  5CBE E;  1Q12 A;  3H6M A;  4K2K A;  3RLF A;  3T53 B;  4XT1 B;  1TWF B;  3PO2 B;  3A8I E;  2BDN A;  5FKA C;  3HOW B;  1PRT D;  4K5V A;  4RH6 A;  3I4M B;  2L1B A;  2BDO A;  3DUZ A;  1NCV A;  1F9P A;  3R2I A;  4KY6 A;  4WFN 3;  1FNU A;  1KDB A;  1SE2 A;  2KEC A;  2BA0 A;  1DYQ A;  3Q23 A;  2BA1 A;  5KGU A;  3VYU A;  4QUC A;  1H9S B;  2B2W C;  2J0T D;  2PYK A;  4H0L C;  3CRL C;  3K57 A;  5J1Z A;  2FMC A;  2JEA I;  5IOD A;  1SND A;  2K7V A;  2PW7 A;  4EVO A;  4G7H C;  1CQV A;  1PTO D;  3QOL A;  4HN7 A;  4V0B A;  1TWA B;  2B8G A;  5FOB B;  2NTT A;  2Q8R E;  1ESF A;  5CV8 A;  2EY1 A;  2LY7 A;  3KK7 A;  2KEE A;  4PMC A;  4FF1 A;  3J7A F;  4B08 A;  2EY6 A;  3UI2 A;  4DN4 M;  4BBR B;  1F77 A;  4DAV A;  4UAI A;  3A54 A;  2F0F A;  3PIO 3;  1CK1 A;  4CJ1 B;  5FLX L;  1LTT D;  1Y8P B;  5FLX E;  3PIP 3;  1OXS C;  2PMZ B;  4X3U A;  4K5X A;  3OPO A;  3WDN A;  1IHZ A;  5HGT A;  4A3J B;  3GTQ B;  4HMJ A;  2CW0 D;  1RJT A;  3SK4 A;  1KTK A;  4DNT B;  5C6A A;  4LMQ D;  1QNK A;  4KMU C;  2B2U A;  5E4X A;  2EYP A;  1SAP A;  2WII B;  5IIF A;  2EVB A;  1I4H A;  2EY2 A;  3K5L A;  3IFD A;  4IAL A;  1TS2 A;  4NMZ A;  3ITP A;  1BQQ T;  4FF4 A;  4OGQ C;  4ULL A;  1ONL A;  3GTJ B;  3SVM A;  3T13 A;  4Z9C B;  2WV6 D;  1JCK B;  2AWO A;  3GP7 A;  2B39 A;  3I91 A;  3VR5 A;  1H9S A;  2RDH A;  2PZW A;  2F0K A;  3PMF A;  1EOT A;  1Q1E A;  2XN9 C;  3Q0A A;  1GUW A;  1HQR D;  1PFN A;  1PFM A;  4RHR A;  2HQE A;  1B50 A;  1PTO H;  3F2U A;  2IL8 A;  3GO5 A;  3SK8 A;  4C3I B;  1RTO A;  5M9O A;  2F0P A;  4N9P A;  5C4X B;  2KCC A;  3I4N B;  1WTX A;  5COY A;  5E4W C;  3HOX B;  3TBI B;  2JSO A;  5IGB A;  3V05 A;  3D4D A;  2AUJ D;  1J8I A;  4ZK9 B;  1TWH B;  2PZU A;  1DCZ A;  1D5X C;  1Q90 A;  1LV9 A;  3GTP B;  1IW7 C;  1HXY D;  1IYU A;  3V2T A;  2KVM A;  3NWS A;  1YNN C;  5C0X G;  3SEB A;  3HG9 A;  3FDT A;  3OIP A;  1GUO A;  4PMB A;  1SJH D;  2KOL A;  4AYB B;  1EL0 A;  1KAA A;  3FMC A;  1FNW A;  2QDB A;  5F2D A;  1BO0 A;  2WKC A;  4NKL A;  5DAU A;  3TN2 A;  4A3I B;  3I4L A;  2R7Z B;  4XQQ A;  3TP7 A;  1V43 A;  1M8A A;  1JR0 D;  1CT1 D;  5NUC A;  1JWM D;  4OHJ A;  1QB5 D;  5I9P A;  5LHY 1;  5I6W A;  3W3A A;  1JIC A;  3MA2 B;  2K33 A;  3VYS A;  4DA2 A;  1G8Z D;  2LFN A;  4NW2 A;  1EY4 A;  2A6H D;  5C0X H;  1HA6 A;  3RUZ A;  3NBI A;  1VF7 A;  3DXJ C;  1HCZ A;  3S1R B;  2A68 D;  4BS9 A;  1AZQ A;  3BDL A;  3SR1 A;  3BG3 A;  2QIL A;  1ENF A;  1ZYR C;  5JVH 3;  3OOC A;  1HUN A;  1CZW A;  5EPK A;  3VYT A;  2C5C A;  5M5X B;  1PZK D;  2ICI A;  4KV6 A;  3QIA A;  2MUY A;  4XIG S;  2QEJ C;  2JEB I;  1V8Q A;  3EJI A;  1PYW D;  3WOF A;  5JAV A;  1TS4 A;  3NBH A;  4J8Q A;  1D2B A;  3K7A B;  4E6I A;  3NE5 B;  3K5M A;  2JP1 A;  2FFK B;  2IJ0 A;  4F87 A;  1PLF A;  2EOT A;  3S14 B;  4MIU A;  1G91 A;  1C8C A;  5ELE A;  4ME5 A;  4FVM A;  2F0S A;  1GHJ A;  2SEB D;  1L0X B;  1I4G A;  3NTI A;  2ENB A;  1ILQ A;  1F9R A;  2EJF C;  1WTR A;  3SHL A;  3VR3 A;  2CHB D;  4OO1 I;  3R8B A;  4Y7N B;  4KKU A;  4CJ2 C;  4TSS A;  2MP1 A;  1L0Y B;  5EBC A;  1LAB A;  5A2Q L;  1O78 A;  5A2Q E;  5JEA J;  1IL8 A;  3TZU A;  1HFG A;  2I46 A;  2D9U A;  3L3O C;  1BNZ A;  1JWS D;  4IUP A;  1GXD C;  1EY6 A;  2EDG A;  2Q8T A;  2RQX A;  3A8K E;  5C4J B;  4ZUI A;  5KYI A;  1AFP A;  2NVX B;  1XYI A;  5KNB A;  2QKI C;  3NHH A;  2EYJ A;  1TT2 A;  3MVV A;  4RA8 A;  1A6X A;  1W6K A;  2PZT A;  2IX1 A;  1EWC A;  3JAM L;  3JAM E;  2X6G A;  2DY7 A;  2R92 B;  3P20 A;  5JVG 3;  5C44 B;  3H09 A;  2BE5 C;  4X3S A;  4ZKB B;  1D6E C;  1DOK A;  3VA5 A;  3QJY A;  1SEB D;  4B9W A;  1ESR A;  4RGM A;  1LTS D;  2VNU D;  3NTK A;  4DU9 A;  1W6J A;  2PPB C;  1EY8 A;  2JA5 B;  3GTK B;  3DHQ A;  5K5P A;  2F0L A;  1TVX A;  3DEO A;  1SXT A;  1RCV D;  4IFD G;  3J81 L;  4HCS A;  3FVQ A;  4F7X A;  4K6L A;  3J81 E;  2FIN B;  1BXT A;  1U4L A;  3MXG A;  2Z1C A;  1I6H B;  2B2Y C;  2O4X A;  4HSP A;  1EY7 A;  4NP5 A;  3Q22 A;  2XWJ B;  2OEO A;  1S5D D;  1RTN A;  1WD0 A;  3HOU B;  2HDL A;  3H91 A;  4FF2 A;  3IFT A;  4FXG C;  4N9T A;  1PXU A;  4K14 A;  1EZ8 A;  5AFW A;  3KUP A;  1HTP A;  2L12 A;  3NQI A;  3KLS A;  2J7Z A;  4XYQ A;  1GUN A;  4ZQ3 A;  1CM9 A;  2PCF B;  4YIJ A;  1ICW A;  1S5E D;  1H9K A;  3S15 B;  2G9D A;  5JJZ A;  5C3X A;  2NYZ D;  1DXM A;  1G6Z A;  5BN5 A;  2L0C A;  4IUU A;  4XDX A;  4DK1 A;  1S5C D;  1T5E A;  1KDA A;  2NVT B;  2JA7 B;  1I4X A;  4Q0F A;  3W2D A;  3C1E A;  1WTP A;  1LT6 D;  4KHZ A;  1K8O A;  4ODG A;  1WTW A;  4DNR B;  1U4M A;  5I9O A;  1NR4 A;  1R4Q B;  3OW7 A;  1ILP A;  1UUP A;  3R93 A;  2XNA C;  4KKT A;  4NDX A;  1EQV A;  3QO2 A;  4G7Z C;  1F9Q A;  1YNJ D;  3KBX A;  3QB3 A;  3BYY B;  3RZD B;  2O2L D;  3C46 A;  4ZYS A;  1H9M A;  4BA2 I;  5ELC A;  2RVL A;  2KCN A;  2NZ1 D;  2KED A;  1SMY C;  2VB2 X;  2ZXO A;  1JOK A;  4XXE A;  3IL8 A;  3GTG B;  5I4D A;  5JEA H;  2F0H A;  1Y8N B;  2F3V A;  2K1B A;  2RA4 A;  3OIQ A;  3S2H B;  1BCP B;  2NUC A;  2C9O A;  4OIJ A;  4J1M A;  1ENA A;  1CHP D;  1UEA B;  5KEE A;  4ZAI A;  1ZEQ X;  1G2S A;  2F03 A;  1EWH A;  2J4X A;  4IUT A;  4FP5 D;  1SE4 A;  1JWU D;  4K8J A;  1Q1B A;  3D31 A;  3QWN A;  3QOJ A;  2F0W A;  1B3A A;  2B2V C;  1QOH A;  1LTG D;  3NQT A;  4UDU C;  5DNF A;  5EKL A;  5EKI A;  1JQY D;  5C3E B;  4IZ8 A;  1Y1W B;  1EIH A;  3NP8 A;  1XXG A;  3H0G B;  5FO7 B;  1EFI D;  3MC0 B;  2K32 A;  5KRU A;  4O1N A;  4ILW A;  1SJE D;  5J39 A;  3TP5 A;  2DN8 A;  2CQA A;  2E2D C;  2TMP A;  1F9S A;  1JE4 A;  2EYM A;  5LL6 X;  2NTS A;  1PRT C;  1XWE A;  3L9A X;  2WIN B;  5CC4 A;  2DY8 A;  3KLR A;  1CTM A;  1D5Z C;  2B2T C;  4RHS A;  1NR2 A;  4L63 B;  2MJ8 A;  2X69 A;  2A69 D;  4PNY A;  1MSH A;  3CQZ B;  4R9W A;  3H94 A;  2HUG A;  1HUM A;  1KLU D;  1TY2 A;  4RFB A;  3M7G A;  1OO9 B;  1EQT A;  4RAU C;  3K0Y A;  4HCE A;  3S17 B;  1PTO C;  2FMM A;  4DK0 A;  2NN6 H;  2KA7 A;  1O7Y A;  4M8A A;  3X3M A;  5ELD A;  4CJ0 B;  1ZYR D;  3K59 A;  3MAQ A;  3GTO B;  3H3V C;  1QWY A;  4LJZ C;  3J80 L;  3J80 E;  1LTR D;  3ERO A;  2WB1 B;  2XWB B;  3URY A;  4BWG B;  2F0Q A;  3CRK C;  1ET6 A;  3BVM A;  1WVL A;  3MFY A;  3N6R A;  1TWG B;  2CW0 C;  1EY5 A;  1EYD A;  1UAP A;  2SOB A;  4QUF A;  2DNC A;  2FHT A;  3E6Z X;  2MGS A;  3ZYY X;  1GUS A;  2XSC A;  3GV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...