4NP5A

Crystal structure of staphylococcal nuclease variant delta+phs v66a/i92n at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYNYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4np5A00
4NKLA 1STAA 1SYCA 5J39A 2OF1A 2F0LA 4HMJA 4IALA 2EY1A 3C1FA 3U9OA 3D6CA 4KJOA 4TRDA 4WRDA 4B9WA 1A3TA 5HGTA 5CV9A 3SK5A 2EYOA 2KHSA 2PW7A 4N9PA 2F0GA 1A3UA 1SNDA 5NUCA 5CGKA 3DMUA 1JOKA 1EY6A 1SNMA 4I65A 2EYLA 2F0IA 3ITPA 4K6DA 1F2YA 5CV4A 1TR5A 3H6MA 1TT2A 2SNSA 2F0FA 3OMGA 1SYFA 4KHVA 3SR1A 1A2TA 2LKVA 2PYKA 3BDLA 3NHHA 3P75A 5C4HA 4K5VA 3MXPA 3D4WA 5CV7A 5DEHA 4G57A 4NMZA 4QB4A 4ZUJA 3SHLA 4DU9A 4R8NA 5CC4A 5IGCA 2KQ3A 5DAUA 3R3OA 1JOOA 2WACA 4KD3A 5C5LA 3E5SA 3TP7A 3QB3A 4ODGA 2EY2A 3EVQA 3MHBA 2F0SA 5I6WA 3NUCA 2OXPA 5K5PA 2F0DA 1KABA 4ID6A 4NDXA 5E3FA 2EYHA 2EXZA 3HEJA 3SK4A 1STGA 3T16A 4NP5A 1EYCA 3TP6A 1STBA 4ME5A 1KDCA 1EY7A 1JOQA 3QOJA 5EKLA 2F0WA 3DHQA 2SOBA 4N9TA 2F3WA 3ERQA 2EY6A 4K2LA 4DGZA 5IODA 5J22A 1F2ZA 4K14A 1ENCA 2EYJA 4KY5A 1TQOA 5IGBA 4IZ8A 4KJNA 5M9OA 4F7XA 5CV6A 3NP8A 3OWFA 4K2KA 4RKLA 3NXWA 4ZUIA 5EKKA 3VA5A 1KDBA 5I9OA 1KDAA 5ISRA 2F0MA 2OEOA 1ENAA 2F0VA 4B9XA 5JOBA 2F0QA 4KD4A 4PMCA 1JORA 4J1MA 4DF7A 3OSOA 5CV8A 1EY0A 1EYAA 4PMBA 5CV5A 5E1FA 3MVVA 4EVOA 5KGUA 1EZ8A 1SYEA 3TP8A 2PZTA 2F0PA 2PZUA 4K5XA 3HZXA 5IGFA 1SNOA 2EYFA 3BDCA 5C4ZA 3OMCA 5IIFA 5I9PA 5JAVA 2F0TA 4S3SA 5J1ZA 4OL7A 5F2DA 3LX0A 3EROA 3NQTA 4KY7A 5HURA 2EY5A 2F0OA 1EYDA 2F0UA 3V2TA 2EYPA 5KYIA 3MZ5A 1EY5A 4H7BA 2F0JA 4QMGA 1EY9A 1U9RA 5IGEA 3D8GA 3P1HA 1SYBA 4K5WA 5KYLA 3SK8A 1STYA 5EGTA 2F0EA 1SNCA 1RKNA 1II3A 1NSNS 2PW5A 2PZWA 2SNMA 4K8IA 4KTAA 4MIUA 3SK6A 1EY8A 4KY6A 1SNPA 3EJIA 4EQPA 3MEHA 4YIJA 1STNA 1F2MA 1KAAA 4F8MA 1EQVA 1NUCA 5C3WA 4DFAA 4ZQ3A 5C5MA 5I6YA 2F0NA 3TMEA 5IGGA 1A2UA 2F3VA 2RDFA 3PMFA 4IUNA 4RKBA 2O4XA 5CR3A 3D4DA 5KRUA 1AEXA 3TP5A 5C3XA 3C1EA 4HMIA 1EY4A 2NUCA 3SXHA 1SYGA 1SNQA 2HQEA 5IGDA 4EQNA 5KIXA 1STHA 2QDBA 1A3VA 2PQEA 2F0KA 2M00A 2RKSA 4K8JA 3RUZA 2F0HA 4J6HA 3QOLA 5IOCA 3T13A 2RBMA 4KV6A 5C6AA 4WORA 3NK9A 4EQOA 2ENBA 2EYMA 4LAAA 5KEEA 3S9WA 4HTHA 4E6IA 4PNYA 1EZ6A 4QF4A 1IHZA 1SYDA
chains in the Genus database with same CATH superfamily
4X3SA 1DZ1A 2ZTDA 1N36L 2NN6G 1X3QA 3PF5A 3NBHA 5CV9A 2A6EC 2F0GA 4DAMA 2QDLA 2EJFC 4JBWA 4KLKA 4TVAB 3SEBA 4OO1H 1Q1BA 1Y1VH 1XPRA 2DJGC 3SR1A 2SNSA 4L6TB 4LF8Q 4LFBL 3P75A 4C3JH 3SHLA 3HOYG 2B2VC 3GTOH 3GQBA 3GTKH 4JI5Q 3UDXA 4IFDJ 1IW7C 1D5ZC 1EWCA 1WTVA 1NCVA 2LFNA 4WJWA 3WOFA 3FHWA 4X66Q 3PO3B 3WOEA 1TU2B 1JICA 4BY1H 1QUQB 4IURA 2AUKA 2VQEQ 5EKLA 2AHOB 1BO0A 3DEPA 4N9TA 1IXRA 3F1ZA 4A3MB 1K0RA 2A69D 3GV3A 3J81j 1WCMB 3CCMA 3M4YA 2PPBC 3S16H 4PMBA 1L1OB 1UE1A 4A3IG 2JA5G 1JE5A 1X3PA 3OMCA 2V4DA 4BBSH 1RD9D 2N78A 2KCTA 2EY5A 4RGTA 3EFXD 4DUYQ 4C1NI 4U673 2WP8J 2UXBL 1U9RA 1EFID 1BCPC 1SNCA 2N8NA 4EQPA 1X3GA 3IFTA 3IKJA 3OW2A 1NNXA 3H0GB 4HIDA 2QF7A 1PFMA 2F0NA 2F3VA 4QUFA 4OIJA 2R92H 5C3XA 3VYUA 2FJ2A 5M3MH 1N34L 1SXTA 2G9DA 2Q8TA 3PO2B 2N3SA 4CDEC 1QVCA 2R3ZA 3MWYW 4JBKA 4LF8L 2X69A 4XYOA 4KV6A 1HA5A 2EQSA 3MXNA 4KI0A 4JI5L 4LAAA 1PH6A 2ASBA 4PNYA 1JB3A 3E9IA 3S17B 1SYCA 4LW1A 5BR8Q 5M5XH 5D3DA 2Z6KA 4X66L 3FP9A 3SK5A 4FVMA 1UAPA 2NVXB 4MNOA 5CGKA 5D65A 1SNMA 3ITPA 1XX8A 3J80i 3H6MA 2VQEL 1XPOA 2ZM6Q 2PYKA 2EPBA 2EZVA 2X6LA 5CV7A 1KD1C 1H9KA 5IGCA 2VUMH 4A3BH 1GD7A 1GHKA 1O7IA 1CK1A 1N32Q 4CHTB 1I4GA 3RN5A 1SN8A 1I4PA 2A6ED 1D1KA 3O13A 4CKBA 5FKAC 3F2CA 1ZEQX 5KRUA 3D31A 1PYWD 1PH5A 3G7LA 1U4MA 2UUBQ 1EY7A 1K3BC 5K36H 3I56A 1Q86C 3CF5A 5D14A 4CKCA 3HOWH 1IW7D 1YNNC 4XT3B 4DGZA 3KFUA 5CV6A 1K9MC 1NR4A 1SE2A 3H91A 1IL2A 3HOZB 4ZUIA 2SEBD 3GTMH 4DUYL 1LT4D 1JORA 2V1CC 4P2CB 2N49A 2BCOA 1K73C 5CV8A 4ZYSA 2K32A 4FO2A 3STBC 5KNCA 3MVVA 3CCQA 1LTAD 1SE4A 2EJMA 4UP8A 2F0PA 3HG9A 3HRZC 4KKSA 2A19A 1TWHH 1Q8KA 3ULLA 2IY5B 5C44H 4BBSG 2EJGC 2DN8A 4OELB 2JEAI 1QWYA 3RZOB 1Z7TA 4KN7C 1M8AA 4A76A 1HZAA 2JSOA 4Y52H 1K8MA 2K28A 4I7AA 5FLMG 2B63G 1O7LA 1S5FD 2JA7B 1F2MA 1Y1WB 4BA1I 3HOXH 4DFAA 5BR8L 4IQZA 1NE3A 4CBVA 1TY0A 1R4PB 2BH2A 3EBEA 1BVSA 1TWAH 1BCPD 1YVCA 4K0KQ 2R92G 1I6HB 4DXFA 4DN4M 2ZM6L 2D62A 3RUZA 3C46A 3MXUA 1KLGD 1HPCA 1TY2A 2XVSA 4QCLA 3KLRA 2E2HB 2R93H 2IW3A 1N32L 3UDFA 4CJ2C 2B2YA 1FGBD 2AMCB 4A3CH 1VQ6A 5C4XB 3GTPH 3K80C 4DK1A 3K5LA 1VMPA 4B9WA 1B3QA 2JXMB 2RSOA 2EYOA 2GVAA 3S14B 1MSHA 5ELDA 1PH7A 4H44C 4C3IB 2UUBL 1M90C 5GAGC 1BBXC 1M1KC 2VB3X 1TT2A 2NTTA 1BUVT 3OMGA 3A8IE 4IPDA 3BDLA 2L5TA 4K5VA 3GTQB 4L63B 2WINB 5FJ8G 1WTOA 2GVBA 5EBDA 3R3OA 2VUMG 4R4QA 4LF6Q 3PGZA 4AYBB 2LY7A 3CRLC 2F0DA 4X3UA 4GN3B 4A3GH 2VNUD 1STBA 1KDCA 1JOQA 4AYBE 1E2VA 5IODA 2EY6A 2A6HC 2M9VA 3DM3A 4K14A 4KKUA 2C9OA 2BDOA 4F7XA 4JI7Q 4P74A 5EKKA 2MQHA 2KCCA 5EQ0A 2A5HA 2NB0A 1S5ED 3W1BA 3I4OA 4LUOA 3U50C 1LLRD 1YNND 1HQMC 4RHRA 2OWOA 1KTKA 1KLUD 3HZXA 3SDZA 3PIO3 4G7ZC 3Q22A 4H13C 4HJAA 5DLQE 1EUJA 2ICIA 1RHPA 2AWNA 3GO5A 3BZCA 3STBD 3H09A 1UE7A 2CHBD 3FMCA 3ONAB 2K7VA 1IBLL 4FDBA 1W3SA 4K0KL 2Y0SB 2LXKA 3KJOA 2CCZA 2RQXA 1NSNS 5K5PA 3PUZA 4LF9L 2K05A 4YCWA 1H95A 1YHQA 4YIJA 4HCSA 5C3EB 2Y0SE 3H3VI 1ZYRC 1Q3LA 3OIQA 4IUNA 3ULPA 1C0AA 3M3YB 4K6LA 1H9SB 1K83H 2QCPX 3DWAA 4B3SQ 5LMUQ 1A6XA 4RGMA 1ASZA 3K0YA 1VQNA 2F0HA 1B1ZA 2J0TD 4WORA 2EYMA 2ZT9C 4HTHA 4E6IA 1CHPD 4NKLA 4ZAIA 1ZKOA 3T1HQ 4A3KB 1SE8A 2K50A 4LF6L 4L8JA 1WJJA 2EDGA 2HCCA 4X64Q 1ILPA 4A3CG 2WB1B 1VCIA 4N9PA 3Q24A 2EYLA 5GADC 2IL8A 4YHHQ 4UPAA 2LKVA 1SFOB 4FF1A 3MXPA 3V96A 2WB1E 4QB4A 2L9HA 2KQ3A 4JI7L 1IZ6A 3LWUA 2Q2TA 3QWNA 1KRTA 1YHBA 2JN4A 2EXZA 3JC66 3S1RB 1PZJD 3QOJA 3J7A5 2LS01 1LTSD 2NWGA 4RFBA 1PYSB 5IGBA 2BA1A 4MZ9A 3GP7A 4A3MH 1DGSA 1V1PB 4KD4A 1EIYB 3PV0A 2NVTH 2Z4IA 4GZYC 1T5EA 1YNJC 4DV3Q 5C0XH 4LUZA 2JK8A 4OEMB 1WCMH 4B3TQ 1EIHA 5KGUA 1EZ8A 2PZTA 5T1GA 3KF8B 4F87A 2NTSA 2EYFA 1VQJA 2ZTEA 4OHJA 4DNTB 1JWUD 1FNVA 2F0TA 1EL0A 3TS0A 2G5DA 4HIMA 1CZGA 2XSCA 1MGSA 3ERSX 3NQTA 1YEZA 2SDFA 3IRBA 1HNXQ 1Y14B 1D8LA 3UE0A 5JJKA 4B3SL 1B9NA 1H9RA 1LYLA 5EPLA 3OYYA 5LMUL 1DXMA 4KTAA 1II3A 5GQOA 3J7ZC 3TZUA 4DPGA 1V1OA 2HT1A 1STNA 1KAAA 3F2UA 1DOMA 1NUCA 3KLSA 3T1HL 4LF4Q 3H0GH 3R2IA 4X64L 4NXMQ 2RCNA 1ESFA 3PUVA 3KDFB 2I46A 2F3IA 4JCVE 1B50A 1JE4A 3NWTA 3CCJA 3SXHA 1DONA 2ZJPA 1WOCA 4YHHL 2F0KA 3CP0A 3E0EA 3PO2H 1DJRD 2I5LX 2NN6I 2K6AA 3S9WA 3KF6B 1ZYRD 1EOTA 2NZHA 3VR6A 3AMUA 3S17H 3MC0B 3G71A 3A5ZB 3E6ZX 3JAME 3F8TA 5ELBA 4JC0A 2NVXH 1PZID 1TVXA 3CW2C 5IWAQ 3S2DH 4DR5Q 1PA6A 4BY7G 2K1BA 3JAML 2B2WC 1LACA 5DEHA 2Q2HA 4GLAC 3N52A 2K5VA 1SJHD 1VQ5A 2WACA 1I4XA 2FXQA 4KD3A 4DK0A 2OQ0A 1KC8C 2QW7A 2WKCA 5CORA 2R7ZG 4POGA 3A5UA 4DR2Q 4P71A 1J9OA 1KABA 4DV4Q 1N33Q 3T16A 3NEMA 3CMAA 4DV3L 3RLFA 4B3TL 1RODA 1I50B 1PRTB 2MFIA 1GOZA 3RLOA 2F3WA 4YWKA 2F03A 3MTSA 1F2ZA 1WFQA 2MNAA 4BS9A 4JI8Q 2E5LQ 2X6GA 5JVG3 4EX5A 2BE5C 2DNCA 1QUQA 4R4IA 2F0VA 3HFZB 4ZKBB 4A93B 1IBMQ 3HOZH 2OTJA 2MJ8A 2B2TA 5M3FB 3NELA 1HNXL 3HS0C 4HSPA 4YY3Q 1O80A 1IBKQ 1Q46A 1SE3A 1FJGQ 2WAQE 5LMNQ 1NR2A 4LFAQ 4OL7A 3KJPA 4LF4L 5EJWA 2F0OA 1L1OA 1YNJD 1BBUA 1YJNA 4NXML 2EIFA 4FF4A 4G7HC 1KQSA 1XNQQ 5IGEA 3VR4A 3RZOH 3HOVB 3E0JA 2F0EA 3LGJA 2PZWA 5IT9c 4MIUA 2H4OA 3J80E 1XTDA 4C3HG 4GNXB 4F8MA 1C7YA 1FNUA 2F4IA 4ZQ3A 5C5MA 1E1OA 1CA5A 2JA6G 1R4QB 1FR3A 3KBXA 1HTLD 3VYRA 4LNQA 1A62A 3MAQA 3RZDB 5HGQA 5IWAL 4DR5L 1Z6HA 5FLXE 4C2MB 1I6HH 1E0BA 2RBMA 3AYHB 4EQOA 1HFGA 4S3SA 1WVLA 5FLXL 1SYDA 2E2HH 2OF1A 2CVRA 4P73A 1X54A 3OPOA 3A74A 3U9OA 3D6CA 4DR2L 3RN2A 4OO1I 5C4XH 4DV4L 1MJCA 5D3IB 1SNDA 1VQOA 2A74C 4QUCA 2PCFB 4K6DA 1Z9FA 4R4OA 1EIGA 3S14H 3W2DA 4C3IH 2O2LD 1PH1A 1ENFA 4A3EB 4LMQD 4JI8L 2E5LL 3GTQH 1Q82C 5FO7B 1QVFA 1D7QA 5JEAH 3S1MB 1IBML 1HUNA 1VF7A 3SK4A 1SAPA 1XMOQ 5LHY1 4XQJA 3A54A 5FO8B 1VQCA 3DEOA 3I4MG 2Z6KC 4YY3L 3AFPA 1IBKL 4RG1A 3IL8A 3R8BA 1RCVD 1N34Q 5LMNL 1FJGL 4IZ8A 3CMEA 4LFAL 3NXWA 1KDBA 4KN4C 4MTNA 3Q6SA 1DCZA 2F0QA 2UXDQ 1CKNB 2J7ZA 4J1MA 1JWMD 4OX9Q 1XNQL 1EYAA 5E1FA 3A8JE 1OXVA 3QR8A 3CCUA 1NY4A 3KLSX 1HUMA 4IJLA 3J80c 1WYDA 2E2IB 3C2PA 1GJXA 5KNBA 1QB5D 3L3OC 4UAIA 4R1JA 2I5HA 1B53A 3CCRA 1KNEA 5KYLA 2E2JB 4YCUA 2K5DA 1G6ZA 3GTGB 1UEBA 1QZHA 4JI3Q 1TWCB 2FINB 1AN8A 2CWAA 4ZK9B 1I94Q 3HOUB 5FLXc 2KHIA 2PI2E 2A8VA 3PQIA 4X3KA 5C3EH 2C5CA 4CJ1B 2IT1A 3G6JB 3K8AA 3GTLB 3SVMA 3M3YH 5KIXA 1B3AA 1STHA 2QDBA 4X3TA 4C1NK 1F9QA 2IX1A 3DWPA 3IAYA 2MHVA 1G291 3E9HA 1BNZA 3BVGA 1Y8OB 3PUYA 1STAA 3FKIB 1L2FA 2CW0C 2YV5A 4RAUC 4DK6C 1PH3A 4KJOA 3BZDB 3K5OA 1DYQA 2KEEA 2C35B 4O0AA 1XMOL 4HJ7A 3DMUA 1JOKA 3M4QA 1SLJA 4AIMA 4CKEA 1TR5A 4PZ7A 2XGTA 4C3IG 4A3FB 3Q8DA 1SMYC 5GAEC 5EKIA 2QEXA 2MP1A 3CC2A 4JVZA 2F0SA 3S2HB 2UXDL 5I6WA 2HCIA 1B44D 5A2QE 4NDXA 5JEAG 4OX9L 2EYHA 3HEJA 2KJXA 4IUPA 4P72A 5E4XA 3X3NA 4XQNA 2B2YC 1EOVA 5A2QL 3TEHB 3S1RH 3R2TA 3CU7A 1ENCA 2HHHQ 1DOKA 2GN5A 1NTGA 4CJ0B 4DA2A 4OO1G 1Y1VG 1BBWA 4IPGA 5EAYA 2RSNA 3OW7A 4QJFA 4EGVA 4XT1B 4C3JG 5KNDA 1GHJA 1I4RA 3TDQA 1PHJA 1PMRA 1EY0A 1S5CD 4ME3A 4LFCQ 4JI3L 2JQOA 3OHXC 1TKWB 2Z0SA 2E75C 1I94L 3C3LA 2KVMA 4BY1G 4A3JB 5J1ZA 1A0IA 2L4NA 3FPPA 3J81i 2F0UA 4UP9A 2Z4HA 1MBYA 2K4KA 3U4ZA 4IOAA 4B3MQ 1SJED 1TS5A 4UY8C 1YIJA 1JCKB 1AE3A 1JQYD 4N8FA 2IHFA 1EY8A 2ZTCA 1KRSA 1S5DD 1T9HA 4J8QA 3HOYB 3UI2A 4JV5Q 1EWHA 1LT5D 4GOPB 1YJ9A 2K14A 1AEXA 1GUGA 5LL6X 2LXJA 4Y7NB 1EY4A 2NUCA 2E8GA 2K5QA 3I3CA 1K8OA 4EQNA 2OCEA 2YTVA 1G8ZD 3PUWA 5DM63 2K5HA 3S1NB 5KEEA 5JJIA 4QF4A 1IHZA 1H9SA 5DAUA 1LO5D 4PZ6A 4HMJA 3NENA 3W1GA 4IPHA 4Z9CB 1A3TA 2KHSA 2PW7A 3K7AB 2IWHA 1G6PA 2PNRC 1N9WA 3OIPA 4R8IA 4RHSA 2Q2UA 4M1UB 1IBLQ 5C4HA 5IYBH 2IHEA 2HHHL 5COYA 4XIGS 5M3MG 2RF4A 2JA5B 4PV1C 1A15A 1SROA 3EQLC 3RLNA 1RF2D 4LF9Q 4Q5VA 3M4OB 3MHBA 2WIIB 4JOIC 4DV0Q 2VY3A 2JA8B 1QOHA 4LFCL 1L0YB 4B08A 3TBIB 5BN4A 1SMYD 1I50H 1FVIA 1PXUA 1U5KA 1VQMA 5JEAJ 1IKLA 3AB9A 1VQDA 4PMWA 5I9OA 4MN3A 5M5YB 2GA4B 1C8CA 1WTWA 1ET6A 2ZXPA 2ID0A 4A93H 5C4JB 4B3ML 4A3BG 3FEWX 1XPUA 1CSQA 1J8IA 2VL6A 4HR7B 4AH6A 3I4NB 1PTOH 2JE6I 1V1PA 5IP7H 1PDQA 5EPKA 1CQFA 2AWOA 1BQQT 1AE2A 5K36G 2DNEA 3HOWG 4JV5L 1PYBA 4DR4Q 3KF8A 1PVOA 1PTOC 5KYIA 3K0XA 4QMGA 1U0LA 2YU9B 3N6RA 2K5NA 3P1HA 4JI2Q 4GKJQ 1XWEA 1F9PA 2PMZB 3HOVH 2HUGA 1TWGB 4XDXA 4KY6A 2L0CA 3BYTB 2DY7A 1GVPA 2PMZE 4KMUC 1PRTF 1C4QA 2OTLA 5I2YA 3FVQA 2VZAA 3C1EA 4RCNA 4DV5Q 3MXGA 1MHWC 1Q81C 5C44G 1HZBA 4A4IA 3RZDH 3H15A 1HZ9A 3TREA 2AKWB 1EYGA 3CCEA 3CQZB 3KDFA 1EZ6A 5C5LA 1HTPA 3LNNA 4LF7Q 5JPNC 2KOLA 2F0LA 4IALA 4XYQA 3VR2A 1PTOF 3K81C 3ULJA 4TRDA 3MFGA 3VYTA 4DV0L 5LL6S 2M2LA 4FYDA 2KENA 1W6JA 1XMQQ 3BU2A 3HOXG 4BA2I 4I65A 3DLLA 1I5FA 3KF6A 4IUUA 1F2YA 5E4WC 4DAVA 3NHHA 5ELCA 1Q7YC 5CC4A 1GM5A 1TS4A 5IYBG 4A3EH 1AH9A 3GTJB 1I3QB 2B29A 3J7AV 3S1MH 3CXCA 1STGA 2NVYB 1I4QA 5J3BA 2F4VQ 4BBSB 4LWCA 2R93G 4DUZQ 1LT3D 1G2SA 1VQAA 1BCPB 3UE1A 3QG1A 3A56A 2EYJA 3CC7A 1EWIA 1PZKD 4RKLA 3S24A 2F0MA 2OEOA 2B63B 3RR5A 5C0XI 4DR4L 2DUDA 4WFN3 3VA7A 4JI2L 4EVOA 4O2DA 4GKJL 2JYOA 2F52A 2WAQG 1BDOA 3L2PA 5C4ZA 1G51A 2R92B 3PO3H 2QEJC 5IE8A 4A3GG 1P8LA 2QA4A 3H3VH 5F2DA 3L7ZC 1D5MC 1Q8IA 5IYDH 1HA6A 1AP0A 3A8KE 2NZOA 2E2IH 1CSPA 4KKTA 1QJOA 4DK3C 4FXKC 3D8GA 4RWSC 4DV5L 3NTHA 4ILWA 2L1BA 3KOJA 2N88A 2B2TC 2E2JH 2VXWA 3GTGH 3EJIA 1TWCH 2A6HD 3J7AF 2EVBA 4IFDH 3TS2A 4LF7L 1P16A 3HOUH 4A3DB 1CTMA 4OWTB 5CBAE 4DR3Q 1A2UA 4RKBA 2A1AA 2VUMB 4EQ5A 4HMIA 1XMQL 4GKKQ 3KK7A 1SNQA 4GNXA 4X65Q 3HKSA 1G2TA 3I70A 4K8JA 3PF4A 4TQUS 3GTLH 1VQBA 1OTCA 4BXXH 2B8GA 4KK7A 1SDFA 2LMCB 1PFBA 2MPMA 2FHTA 4HSVA 1PH2A 3FKIH 2HD3A 1ML0D 1PH9A 2RA4A 4UDUC 2F4VL 4DUZL 1GUTA 3MEFA 4N8X1 5JVH3 1EEID 2F0FA 5IT9E 4FF3A 5BN5A 4HIOA 4JI6Q 1S4ZA 1ZXTA 2K33A 2R61A 4IPCA 4A3FH 5IT9L 4ODGA 3TZDA 3NUCA 4RGNA 3S2HH 1V1QA 4CDDC 5LMNW 1HHVA 4BBRB 3E3XA 1LTTD 4IUQA 1F2LA 1KHIA 3W5OA 1TQOA 3OWEB 1KAWA 1EQRA 2XNAC 2MUYA 4JYAQ 2UXCQ 3CCLA 2VS1A 1VQFA 1Z47A 2Z6BA 2G9HD 4JBMA 1EIFA 1UWVA 3DM1A 1C9OA 4MTKA 1OXSC 2UU9Q 3AFQA 4GLVB 3BDCA 1VS0A 4DNIA 1YJWA 1F9RA 1CKNA 3D0FA 3PO3G 5EPJA 1EU4A 1LUZA 1U4LA 3EROA 3UDIA 3EN2A 4A3JH 3FRPB 4DR3L 2EYPA 1WD0A 2XRSD 2F0JA 2L12A 5FOBB 2CQAA 2QGQA 1KXLA 3VYSA 4GKKL 1F77A 1STYA 4X65L 2A68C 1B4OA 4A3MG 1EU3A 1BR9A 4IOCA 4QQBX 2NN6H 5AFWA 5C0XG 3KLWA 1CT1D 1WCMG 1ILQA 1RJTA 1QG7A 1H9MA 2PI2A 3AQQA 1LT6D 2I0QA 2O5IC 2O4XA 3HOYH 4IN3A 3TP5A 4F88A 3K5NA 5M5WB 1KNAA 5ELEA 3WDNA 1LTGD 1R9TB 1JJGA 2M00A 1UEAB 3IFDA 3FDTA 5G3LF 3PIOA 4JI6L 3KUPA 4QY7A 2R6GA 2ES2A 3S1NH 2RCFA 1HRJA 1HXYD 4HIKA 1X56A 3D4RA 2JA7H 4O42A 1Y1WH 5NUCA 2KCNA 5ELOA 3J80L 3A0JA 1OXXK 1KIXA 5IYCH 1FYCA 1Q90A 3K7AH 1X6OA 1MSGA 3H0GG 2PO4A 1E24A 3VR5A 4DU9A 1E1TA 3F2DA 4JYAL 3EVQA 2JA5H 1QE6A 3NBIA 3M4OH 1Y69U 1G91A 3PO2G 2UXCL 1K0SA 4JI4Q 5E3FA 1O7ZA 1PFNA 1EYCA 2HDMA 3NTKA 1DOLA 4ALPA 2UU9L 1D5XC 2Q8RE 2JA8H 4B3RQ 3ERQA 4APVA 1A63A 4IUTA 3CPFA 4HEDA 5M9OA 2K52A 3V05A 1RIPA 5I2XA 5AJ3Q 5M5YH 2OT2A 1L0WA 1CKMA 1GUOA 2ICEC 2VW9A 1V43A 1W6KA 5C4JH 5DNFA 5EBCA 4DAYB 3KBGA 5IIFA 2XWBB 2E76C 1QVGA 3I4NH 2RHQB 1QILA 2AQ2B 1NJIC 2B2WA 3LX0A 5HURA 1QCBD 1HNZQ 1ASYA 4P75A 4HJ9A 2F1MA 4GLXA 1EEFD 1H9JA 3BVMA 2YU9H 1B9MA 1CHQD 3HOZG 3K7UC 2L15A 4MHEA 1TWGH 1TWFB 4BY7B 4NB3A 5I6YA 2OQKA 2BE5D 2CFMA 1FGUA 2BDNA 3D4DA 2A68D 4KHZA 2ALYB 4OXPA 1CKOA 5C0XJ 1D6EC 1B8AA 2R7ZB 4AQYQ 1AZQA 1GKHA 1HCZA 2LSSA 1GO3E 4J6HA 3P7JA 5I4DA 3HGBA 4YWLA 4WJ4A 1E3PA 1S40A 4GOPA 1C48A 3I7FA 1U4RA 1YNXA 2D2CC 2CWPA 2B2UA 3CHBD 3P20A 3I55A 4XXEA 2JA9A 3CQZH 2PQAB 3GV6A 1VF5C 4JI4L 1GUNA 3I90A 3TQYA 2Z9HA 2JEBI 3QO2A 3J81c 2JA7G 2O5JC 1Y1WG 1WTRA 4KHVA 4B3RL 1SYFA 3QIAA 3HP3A 4HJ8A 5IYCG 1WD1A 1HR0Q 2NVTB 1J5EQ 3JAMi 4DR6Q 1IKMA 3BYYB 1DD2A 5AJ3L 2OXPA 2XIWA 5DM73 3S1QB 5IY0A 4ID6A 2KA7A 3GTJH 1I3QH 1K3RA 2MO0A 1SR3A 4FNFA 1B70B 4A3KH 2NVYH 3TRZA 2PNHA 4OIKA 4DKAC 2JA8G 1E22A 5C4XG 1XTCD 2VB2X 2K5WA 3NP8A 4HCEA 4O1NA 3VA5A 1LTRD 1WI5A 2ZXOA 2FMCA 4HJ5A 1PLFA 1SFOH 1HNZL 4C3HB 5FLMH 2B63H 2KHJA 4UHVA 3K5MA 2JA6B 1SYEA 3I2ZA 2D0PA 4DR7Q 2K04A 1NMFA 4BWGB 1IL8A 5I9PA 4AYBG 2KEDA 1PH8A 4DV7Q 2NVQB 3I4NG 4KY7A 4DV6Q 4CDFC 4OGQC 5ELNA 3MZ5A 3SGIA 2L55A 3I73A 2AQ1B 2WKDA 3CCSA 1XYIA 1EQTA 3TSSA 4AQYL 4OWXB 3T56B 1CQVA 1SNPA 2NBFA 5CBEE 3MEHA 4JPBW 1TXYA 2CH4W 3M7GA 1VQLA 2EE1A 3NPPA 2CH4A 1ET9A 1WTPA 3G4SA 3S2DB 1MKHA 2QILA 3TMEA 2JP1A 3HKZB 1BCPF 5E7NA 4A3DH 1BF4A 5CR3A 3URYA 5FJ8H 3M9BA 1X55A 2B2VA 1MJEA 1Y8NB 1D1IA 2PQEA 1E2ZA 2RKSA 3HKZE 3NBHB 1TS2A 5GAHC 2ZXRA 1MIUA 3RNUA 1HR0L 5C6AA 5JPMC 3NK9A 2K01A 2ENBA 3M4PA 1J5EL 3I4MB 1I6VC 3R93A 4DR6L 1CM9A 3I8ZA 1JJCB 2YYZA 4J15A 3PSIA 2Y0SG 3S15B 1UE5A 4RCOA 4ZKCB 1LTBD 1UUPA 3I4LA 1ICFB 2BOSA 4FXGC 1WTXA 1EY6A 1ONLA 4DNRB 5C3EG 2VQFQ 1CI3M 2ATWA 3L9AX 3CC4A 2KCMA 4ZLTF 3QJYA 2JJQA 2KUMA 4IO9A 5GROA 3A55A 4I7ZC 1HQRD 1S72A 3ZJYC 2H1EA 2HIVA 4ABNA 1BXTA 1LTID 4BBRH 4A3KG 4DR7L 1B2TA 1JWSD 5FO9B 1CZWA 2D5DA 1X3FA 2WB1G 4DV7L 4DV6L 4NPSA 2B39A 2CW0D 4OWWB 4A3IB 3K58A 2K75A 1JC7A 3W3AA 2IJ0A 5IP9H 1SNOA 4DV1Q 4FF2A 1VQ8A 5T1IA 1B7YB 4PZ8A 4PQXA 1ICWA 3F2BA 4POFA 4QIWB 1JMCA 1EY5A 1EY9A 1SRUA 4LK1C 2P5ZX 1Q12A 1F9SA 1VQ4A 3ICEA 4NW2A 1N8RC 1PRTC 4QIWE 5TSSA 1SEBD 4GS3A 5M3FH 3FPUB 3U9SA 1EQVA 2N55A 1GUSA 3MXNB 4L5RC 5A35A 1JT8A 3A7AB 1EFWA 1BKBA 4A3DG 1SYGA 5IGDA 2FMMA 5BN3A 5M5WH 1OO9B 2VQFL 3WWVA 4LJZC 4JI1Q 3T13A 5IOCA 1R9TH 2CKZB 1VQ9A 2KECA 4C56C 4GN4B 2Z1CA 3BJUA 1PV4A 1PH4A 1HNWQ 1VQ7A 2EY1A 4L5TA 3PIP3 4WRDA 1Y1VB 2D9UA 1A3UA 4RGOS 3RD4A 4RA8A 4ZCKA 5ISRA 5CV4A 5JOBA 4C3JB 1V8QA 3GTOB 4LF5Q 3GTKB 1A2TA 1NBWA 3D4WA 4G57A 4NMZA 4ZUJA 4R8NA 1W2BA 4GNXC 1GUWA 1O7YA 3TP7A 5JJLA 4G4KA 1HFNA 4C2MH 3BS1A 1NAPA 4BY1B 2XTIA 4A3LH 1S3OA 1XXGA 1RDPD 4PG3A 1XJVA 4ME5A 2TMPA 1HJPA 3CKIB 4JK1C 3I91A 3BZKA 2NYZD 1STEA 2F0WA 3UDGA 3DHQA 2SOBA 2R7FA 4DV1L 4IJHA 4KY5A 3CCVA 4BBRG 4JBJA 3M85A 2XWJB 3OWFA 4TKOB 4QGUA 1ENAA 1XNRQ 1FD7D 1X3EA 3S16B 3NSWA 2UUCQ 4ULLA 5CV5A 2QKIC 3BVZA 3A7LA 4H0LC 3VR3A 3X3MA 2PZUA 2WFWA 1VQEA 3T1YQ 3LWEA 2UUAQ 5JAVA 5IP9G 3ND8A 2B3GA 1V9PA 1X65A 1MD2D 2YTYA 3K57A 1QNKA 4OONA 2E2DC 3EIVA 2HDLA 1VMCA 4JOIA 2E74C 4LUVA 1RKNA 2IX0A 2J4XA 4X62Q 4K8IA 4IFDI 1Y8PB 4JI1L 4FXDA 4A93G 4FP5D 3ND9A 5M3FG 1X9NA 4CDCC 1MI2A 4TSSA 4HN7A 1SSOA 4YWMA 3T53B 3Q23A 1HNWL 1TWFH 3K59A 4BY7H 3OOCA 4R4CA 3TN2A 5M3MB 5IP7G 2IPKD 1PRTD 3CD6A 1AW7A 2HIXA 3U4VA 4WJ3M 2HQEA 2ZJQA 2R7ZH 4LF5L 5H1SE 4X6AH 1JJ2A 3QOLA 2AUJD 5ELFA 3AU7A 4Q0FA 5HY6A 1LABA 1K8GA 3H3VC 3DXJC 5M5XB 1S5BD 4DXGA 5J39A 3HOVG 1TIID 3NWSA 1PFSA 1VQKA 3H94A 1PTOD 2XN9C 1JB7A 3SE0A 2FFKB 1FL0A 4DF7A 4RH6A 3K6OA 1L0XB 1VQHA 1CUKA 4A3BB 4DR1Q 3I72A 4DAPA 1L1OC 1RL2A 1O78A 4R4TA 3T51B 2RDHA 3QB3A 4L5SA 2EY2A 1XNRL 4HAEA 2B8FA 2Z8LA 5CYUA 2UUCL 1VQGA 3HOWB 4A3LG 3S1QH 1E2WA 1WTHA 4JW0A 4JG2A 1E7ZA 3T1YL 4K2LA 2UUAL 4KJNA 2YTXA 4K2KA 3GTMB 3CAMA 4B9XA 1WTQA 3D3RA 1BOSA 1OXUA 4PMCA 4G7OC 1LTLA 1RTOA 4V190 3OSOA 4M8AA 2BH8A 2XRQD 4C3HH 4A3EG 1QZGA 3TP8A 1TWHB 3BDOA 5IGFA 3KYHC 4X62L 2JA6H 2H5XA 5C44B 1M4VA 1IYJB 1X32A 1YHAA 3ER0A 3OTOQ 3DWQA 1OXTA 3V2TA 2NVQH 2KBNA 3ZYYX 4H7BA 4DAYA 3SK8A 5EGTA 4H02A 3EA6A 2PW5A 2SNMA 4RMFA 3SK6A 1TS3A 1NMGA 3HOXB 1LM0A 2EOTA 1CFMA 3CRKC 4KHPQ 4U68A 3Q0AA 3CPWA 3GDEA 3U58A 1TWAB 3PMFA 1SMXA 4IUVA 4ZRZA 3MFYA 5JJZA 4GN5A 2IX3A 1RTNA 2Q8IB 5IYDG 2I07B 1AZPA 2R93B 3BG3A 4DR1L 2HQLA 4DV2Q 3PUXA 3GTPB 3J7YW 3I4MH 4JI0Q 4NXNQ 1EQQA 3DUZA 3C1FA 3RMHA 1A8VA 1YBYA 5HGTA 3T4AC 1CA6A 3S15H 3G48A 2I5MX 4IFDG 3HOUG 2F0IA 1IYUA 3NE5B 5FK9C 1VQIA 2PQAA 1VQPA 4Y7NH 3M7NA 3MA2B 1JOOA 1U4PA 2WAQB 3E5SA 3PIPA 2MO1A 4BXXG 1N36Q 1PTOB 4A3GB 1HH2P 4GOPC 2DJFC 2RVLA 4NP5A 2B2UC 5L37A 2A69C 4LFBQ 3FKIG 2ZJRA 1I4HA 5J22A 5CMDA 1YITA 1JR0D 4V0BA 1KDAA 2L11A 3OTOL 4QL5A 3NQIA 1GXDC 4XQQA 1FNWA 4A3IH 3VDYA 2MGSA 4A3FG 1QNUA 1UE6A 2CQOA 4K5XA 3J81E 1J6QA 2Q2IA 4CGYB 2R7DA 4L5QA 1HZCA 1K28A 2TSSA 1D2BA 3J81L 1T5XD 4KHPL 3PCOB 4A75A 1YZ6A 1VDZA 1EYDA 1UNSA 2K03A 2DGYA 2EXDA 3JAMc 3G6EA 1SYBA 4K5WA 1SBBB 4XTCS 2RHSB 3B6YA 2DY8A 4R9WA 2D0OA 3AEVA 4DV2L 2NZ1D 4UP7A 3L0OA 1Q1EA 1AFPA 1YI2A 3GD7A 5C3WA 1N33L 2BA0A 4JI0L 4NXNL 5IGGA 1K83B 1K8AC 2RDFA 1LV9A 2UXBQ 1ESRA 1IYVA 2AQ3B 1HR0W 1DM0B 2WV6D 4YCVA 3D6WA 3HKZG 1KL9A 4A3JG 1A3VA 2RDGA 3NTIA 2A73B 5G3LD 3TP6A
chains in the Genus database with same CATH topology
4X3SA 1DZ1A 2NN6G 1X3QA 3NBHA 5CV9A 2A6EC 2F0GA 2EJFC 4JBWA 3SEBA 4OO1H 1Q1BA 3SR1A 2SNSA 4L6TB 3P75A 3SHLA 2B2VC 3GQBA 4IFDJ 1IW7C 1D5ZC 1EWCA 1WTVA 1NCVA 2LFNA 4WJWA 3WOFA 3PO3B 3WOEA 1TU2B 1JICA 4IURA 2AUKA 5EKLA 3DEPA 1BO0A 4N9TA 4A3MB 2A69D 3GV3A 1WCMB 3M4YA 2PPBC 4PMBA 1X3PA 3OMCA 2V4DA 1RD9D 2EY5A 4RGTA 3EFXD 4C1NI 4U673 2WP8J 1U9RA 1EFID 1BCPC 1SNCA 4EQPA 3IFTA 3IKJA 3H0GB 2QF7A 1PFMA 2F0NA 2F3VA 4QUFA 4OIJA 5C3XA 3VYUA 2FJ2A 1SXTA 2G9DA 2Q8TA 3PO2B 3MWYW 2R3ZA 2X69A 4XYOA 4KV6A 1HA5A 3MXNA 4KI0A 4LAAA 4PNYA 1JB3A 3S17B 1SYCA 5D3DA 2NVXB 3SK5A 4FVMA 1UAPA 5CGKA 5D65A 1SNMA 3ITPA 1XX8A 3H6MA 2PYKA 2EPBA 2EZVA 2X6LA 5CV7A 1H9KA 5IGCA 1GHKA 1CK1A 4CHTB 1I4GA 1I4PA 2A6ED 1D1KA 3O13A 4CKBA 5FKAC 1ZEQX 5KRUA 3D31A 1PYWD 3G7LA 1U4MA 1EY7A 5K36H 5D14A 4CKCA 1IW7D 1YNNC 4XT3B 4DGZA 5CV6A 1NR4A 1SE2A 3H91A 3HOZB 4ZUIA 2SEBD 1LT4D 1JORA 4P2CB 2BCOA 5CV8A 4ZYSA 2K32A 4FO2A 5KNCA 3MVVA 1LTAD 1SE4A 2EJMA 2F0PA 3HG9A 3HRZC 4KKSA 2EJGC 2DN8A 2JEAI 1QWYA 3RZOB 1Z7TA 4KN7C 1M8AA 2JSOA 1K8MA 2K28A 1O7LA 1S5FD 2JA7B 1F2MA 1Y1WB 4BA1I 4DFAA 4IQZA 4CBVA 1TY0A 1R4PB 1BCPD 1I6HB 4DXFA 4DN4M 2D62A 3RUZA 3C46A 3MXUA 1KLGD 1HPCA 1TY2A 2XVSA 4QCLA 3KLRA 2E2HB 2IW3A 4CJ2C 2B2YA 1FGBD 5C4XB 4DK1A 3K5LA 1VMPA 4B9WA 2JXMB 2RSOA 2EYOA 3S14B 1MSHA 5ELDA 4H44C 4C3IB 1BBXC 2VB3X 1TT2A 2NTTA 1BUVT 3OMGA 3A8IE 3BDLA 2L5TA 4K5VA 3GTQB 4L63B 2WINB 1WTOA 5EBDA 3R3OA 4AYBB 2LY7A 3CRLC 2F0DA 4X3UA 2VNUD 1STBA 1KDCA 1JOQA 1E2VA 5IODA 2EY6A 2A6HC 2M9VA 4K14A 4KKUA 2C9OA 2BDOA 4F7XA 5EKKA 2KCCA 5EQ0A 2A5HA 2NB0A 1S5ED 1LLRD 1YNND 1HQMC 4RHRA 1KTKA 1KLUD 3HZXA 3SDZA 3PIO3 4G7ZC 3Q22A 4H13C 2ICIA 1RHPA 2AWNA 3GO5A 3H09A 2CHBD 3FMCA 3ONAB 2K7VA 2Y0SB 2RQXA 1NSNS 5K5PA 3PUZA 2K05A 4YIJA 4HCSA 5C3EB 1ZYRC 1Q3LA 3OIQA 4IUNA 3M3YB 4K6LA 1H9SB 2QCPX 3DWAA 1A6XA 4RGMA 3K0YA 2F0HA 1B1ZA 2J0TD 4WORA 2EYMA 2ZT9C 4HTHA 4E6IA 1CHPD 4NKLA 4ZAIA 1ZKOA 4A3KB 4L8JA 2EDGA 2HCCA 1ILPA 2WB1B 1VCIA 4N9PA 3Q24A 2EYLA 2IL8A 2LKVA 1SFOB 4FF1A 3MXPA 3V96A 4QB4A 2L9HA 2KQ3A 3LWUA 3QWNA 2EXZA 3S1RB 1PZJD 3QOJA 2LS01 1LTSD 2NWGA 4RFBA 5IGBA 2BA1A 3GP7A 1V1PB 4KD4A 3PV0A 2Z4IA 4GZYC 1T5EA 1YNJC 5C0XH 1EIHA 5KGUA 1EZ8A 2PZTA 5T1GA 4F87A 2NTSA 2EYFA 4OHJA 4DNTB 1JWUD 1FNVA 2F0TA 1EL0A 1CZGA 2XSCA 1MGSA 3NQTA 2SDFA 1B9NA 1H9RA 5EPLA 1DXMA 4KTAA 1II3A 3TZUA 1V1OA 1STNA 1KAAA 3F2UA 1DOMA 1NUCA 3KLSA 3R2IA 1ESFA 3PUVA 2I46A 1B50A 1JE4A 3NWTA 1DONA 3SXHA 2F0KA 1DJRD 2NN6I 2K6AA 3S9WA 1ZYRD 1EOTA 3VR6A 3AMUA 3MC0B 3E6ZX 3JAME 5ELBA 1PZID 1TVXA 2K1BA 3JAML 2B2WC 1LACA 5DEHA 3N52A 1SJHD 2WACA 1I4XA 4KD3A 4DK0A 2WKCA 5CORA 1J9OA 1KABA 3T16A 3RLFA 1RODA 1I50B 1PRTB 1GOZA 2F3WA 2F03A 3MTSA 1F2ZA 4BS9A 2X6GA 5JVG3 2BE5C 2DNCA 4ZKBB 2F0VA 4A93B 2MJ8A 2B2TA 5M3FB 3HS0C 4HSPA 1O80A 1SE3A 1NR2A 4OL7A 5EJWA 2F0OA 1YNJD 4FF4A 4G7HC 5IGEA 3VR4A 3HOVB 3E0JA 2F0EA 2PZWA 4MIUA 2H4OA 3J80E 4C3HG 4F8MA 1FNUA 2F4IA 4ZQ3A 5C5MA 1CA5A 1R4QB 1FR3A 3KBXA 1HTLD 3VYRA 3MAQA 3RZDB 1Z6HA 5FLXE 4C2MB 1E0BA 2RBMA 4EQOA 1HFGA 4S3SA 1WVLA 5FLXL 1SYDA 2OF1A 2CVRA 3OPOA 3U9OA 3D6CA 4OO1I 5D3IB 1SNDA 2A74C 4QUCA 2PCFB 4K6DA 1EIGA 3W2DA 2O2LD 1ENFA 4A3EB 4LMQD 5FO7B 5JEAH 3S1MB 1HUNA 1VF7A 3SK4A 1SAPA 5LHY1 4XQJA 3A54A 5FO8B 3DEOA 3IL8A 3R8BA 1RCVD 4IZ8A 3NXWA 1KDBA 4KN4C 3Q6SA 1DCZA 2F0QA 2J7ZA 4J1MA 1JWMD 1EYAA 5E1FA 3A8JE 1OXVA 3KLSX 1HUMA 1GJXA 2E2IB 3C2PA 5KNBA 1QB5D 3L3OC 4UAIA 1B53A 1KNEA 5KYLA 2E2JB 2K5DA 1G6ZA 3GTGB 1TWCB 2FINB 1AN8A 4ZK9B 3HOUB 4X3KA 2C5CA 4CJ1B 2IT1A 3G6JB 3GTLB 3SVMA 5KIXA 1B3AA 1STHA 2QDBA 4X3TA 4C1NK 1F9QA 2IX1A 3DWPA 3IAYA 2MHVA 1G291 1BNZA 3BVGA 1Y8OB 3PUYA 1STAA 3FKIB 2CW0C 4RAUC 4KJOA 3BZDB 3K5OA 1DYQA 2KEEA 3DMUA 1JOKA 4CKEA 1TR5A 4C3IG 4A3FB 1SMYC 5EKIA 2MP1A 2F0SA 3S2HB 5I6WA 2HCIA 1B44D 5A2QE 4NDXA 5JEAG 2EYHA 3HEJA 2KJXA 4IUPA 5E4XA 3X3NA 4XQNA 2B2YC 5A2QL 3R2TA 3CU7A 1ENCA 1DOKA 4CJ0B 4DA2A 4OO1G 2RSNA 3OW7A 4EGVA 4XT1B 4C3JG 5KNDA 1GHJA 1I4RA 3TDQA 1PMRA 1EY0A 1S5CD 3OHXC 1TKWB 2E75C 3C3LA 2KVMA 4A3JB 5J1ZA 2L4NA 3FPPA 2F0UA 2Z4HA 1MBYA 1SJED 1TS5A 1JCKB 1JQYD 1EY8A 1S5DD 4J8QA 3HOYB 3UI2A 1EWHA 1LT5D 1AEXA 1GUGA 5LL6X 4Y7NB 1EY4A 2NUCA 3I3CA 2K5QA 1K8OA 4EQNA 1G8ZD 3PUWA 5DM63 3S1NB 5KEEA 5DAUA 4QF4A 1IHZA 1H9SA 1LO5D 4HMJA 4Z9CB 1A3TA 2KHSA 2PW7A 3K7AB 2IWHA 2PNRC 3OIPA 4R8IA 4RHSA 4M1UB 5C4HA 5COYA 4XIGS 2JA5B 4PV1C 1A15A 3EQLC 1RF2D 4Q5VA 3M4OB 3MHBA 2WIIB 2JA8B 1QOHA 1L0YB 4B08A 3TBIB 5BN4A 1SMYD 1PXUA 5JEAJ 1IKLA 3AB9A 4PMWA 5I9OA 4MN3A 5M5YB 2GA4B 1C8CA 1WTWA 1ET6A 2ZXPA 2ID0A 5C4JB 3FEWX 1J8IA 4HR7B 3I4NB 1PTOH 2JE6I 1V1PA 1PDQA 5EPKA 1CQFA 2AWOA 1BQQT 5K36G 2DNEA 3KF8A 1PTOC 5KYIA 4QMGA 2YU9B 3N6RA 3P1HA 1XWEA 1F9PA 2PMZB 2HUGA 1TWGB 4XDXA 4KY6A 2L0CA 3BYTB 2DY7A 4KMUC 1PRTF 1C4QA 5I2YA 3FVQA 3C1EA 4RCNA 3MXGA 3CQZB 5C5LA 1EZ6A 1HTPA 3LNNA 5JPNC 2KOLA 2F0LA 4IALA 4XYQA 3VR2A 1PTOF 4TRDA 3MFGA 3VYTA 4FYDA 5LL6S 2M2LA 1W6JA 4BA2I 4I65A 4IUUA 1F2YA 5E4WC 4DAVA 3NHHA 5ELCA 5CC4A 1TS4A 3GTJB 1I3QB 3J7AV 1STGA 2NVYB 1I4QA 4BBSB 1LT3D 1G2SA 1BCPB 3QG1A 3A56A 2EYJA 1PZKD 4RKLA 2F0MA 2OEOA 2B63B 5C0XI 4WFN3 3VA7A 4EVOA 2JYOA 1BDOA 5C4ZA 2R92B 2QEJC 5F2DA 3L7ZC 1D5MC 1Q8IA 1HA6A 1AP0A 3A8KE 4KKTA 1QJOA 4FXKC 3D8GA 4RWSC 3NTHA 4ILWA 2L1BA 2N88A 2B2TC 2VXWA 3EJIA 2A6HD 3J7AF 2EVBA 4IFDH 4A3DB 1CTMA 5CBAE 1A2UA 4RKBA 2VUMB 4HMIA 3KK7A 1SNQA 1G2TA 3I70A 4K8JA 4TQUS 2B8GA 4KK7A 1SDFA 2LMCB 1PFBA 2MPMA 2FHTA 4HSVA 1ML0D 2RA4A 4UDUC 1GUTA 5JVH3 1EEID 2F0FA 5IT9E 4FF3A 5BN5A 1S4ZA 1ZXTA 2K33A 2R61A 5IT9L 4ODGA 3TZDA 3NUCA 4RGNA 1HHVA 4BBRB 1LTTD 4IUQA 1F2LA 1TQOA 3OWEB 2XNAC 2MUYA 1Z47A 2G9HD 3DM1A 1OXSC 3BDCA 1F9RA 5EPJA 1EU4A 1U4LA 3EROA 3FRPB 2EYPA 1WD0A 2XRSD 2F0JA 2L12A 5FOBB 2CQAA 3VYSA 1F77A 1STYA 2A68C 1B4OA 1EU3A 1BR9A 2NN6H 5AFWA 5C0XG 1CT1D 1ILQA 1RJTA 1QG7A 1H9MA 1LT6D 2O5IC 2O4XA 4IN3A 3TP5A 4F88A 3K5NA 5M5WB 1KNAA 5ELEA 3WDNA 1LTGD 1R9TB 2M00A 1UEAB 3IFDA 3FDTA 5G3LF 3KUPA 2R6GA 1HRJA 1HXYD 3D4RA 4O42A 5NUCA 2KCNA 3J80L 1OXXK 1FYCA 1Q90A 1MSGA 2PO4A 3VR5A 4DU9A 3EVQA 1QE6A 3NBIA 1G91A 1Y69U 5E3FA 1O7ZA 1PFNA 1EYCA 2HDMA 3NTKA 1DOLA 1D5XC 2Q8RE 3ERQA 4IUTA 4HEDA 5M9OA 3V05A 5I2XA 2OT2A 1GUOA 2ICEC 1V43A 1W6KA 5DNFA 5EBCA 3KBGA 5IIFA 2XWBB 2E76C 1QILA 2AQ2B 2B2WA 3LX0A 5HURA 1QCBD 2F1MA 1EEFD 1H9JA 3BVMA 1B9MA 1CHQD 4MHEA 1TWFB 4BY7B 5I6YA 2BE5D 2BDNA 3D4DA 2A68D 4KHZA 5C0XJ 1D6EC 2R7ZB 1AZQA 1HCZA 4J6HA 3P7JA 5I4DA 3HGBA 1C48A 1U4RA 2D2CC 2B2UA 3CHBD 3P20A 4XXEA 3GV6A 1VF5C 1GUNA 3I90A 2JEBI 3QO2A 2O5JC 1WTRA 4KHVA 1SYFA 3QIAA 3HP3A 1WD1A 2NVTB 1IKMA 3BYYB 1DD2A 2OXPA 2XIWA 5DM73 3S1QB 4ID6A 2KA7A 4FNFA 4OIKA 1XTCD 2VB2X 2K5WA 3NP8A 4HCEA 4O1NA 3VA5A 1LTRD 2ZXOA 2FMCA 1PLFA 4C3HB 3K5MA 2JA6B 1SYEA 2K04A 4BWGB 1IL8A 5I9PA 2KEDA 2NVQB 4KY7A 4OGQC 3MZ5A 2L55A 3I73A 2AQ1B 2WKDA 1XYIA 1EQTA 3TSSA 3T56B 1CQVA 1SNPA 2NBFA 5CBEE 3MEHA 3M7GA 2EE1A 3NPPA 1ET9A 1WTPA 3S2DB 2QILA 3TMEA 2JP1A 3HKZB 1BCPF 1BF4A 5CR3A 3URYA 2B2VA 1Y8NB 1D1IA 2PQEA 1E2ZA 2RKSA 1TS2A 2ZXRA 5C6AA 5JPMC 3NK9A 2K01A 2ENBA 3I4MB 1I6VC 3R93A 1CM9A 3I8ZA 2YYZA 3S15B 4RCOA 4ZKCB 1LTBD 1UUPA 3I4LA 1WTXA 2BOSA 4FXGC 1EY6A 1ONLA 4DNRB 1CI3M 3L9AX 4ZLTF 3QJYA 2KUMA 3A55A 4I7ZC 1HQRD 2H1EA 4ABNA 1BXTA 1LTID 1B2TA 1JWSD 5FO9B 1CZWA 2D5DA 2B39A 2CW0D 4A3IB 3K58A 1JC7A 3W3AA 2IJ0A 1SNOA 4FF2A 5T1IA 4PQXA 1ICWA 4QIWB 1EY5A 1EY9A 4LK1C 1Q12A 1F9SA 4NW2A 1PRTC 5TSSA 1SEBD 3FPUB 3U9SA 1EQVA 2N55A 1GUSA 5A35A 3A7AB 1SYGA 5IGDA 2FMMA 5BN3A 1OO9B 4LJZC 5IOCA 3T13A 2KECA 4C56C 2Z1CA 2EY1A 3PIP3 4WRDA 1Y1VB 2D9UA 1A3UA 4RGOS 3RD4A 4RA8A 5ISRA 5CV4A 5JOBA 4C3JB 1V8QA 3GTOB 3GTKB 1A2TA 3D4WA 4G57A 4NMZA 4ZUJA 4R8NA 1GUWA 1O7YA 3TP7A 4G4KA 1HFNA 3BS1A 1NAPA 4BY1B 1XXGA 1RDPD 4ME5A 2TMPA 3CKIB 4JK1C 3I91A 2NYZD 1STEA 2F0WA 3DHQA 2SOBA 4KY5A 3M85A 2XWJB 3OWFA 4TKOB 1ENAA 1FD7D 3S16B 3NSWA 4ULLA 5CV5A 2QKIC 3BVZA 3A7LA 4H0LC 3VR3A 3X3MA 2PZUA 3LWEA 5JAVA 3ND8A 1MD2D 3K57A 1QNKA 2E2DC 2HDLA 1VMCA 2E74C 1RKNA 2IX0A 2J4XA 4K8IA 4IFDI 1Y8PB 4FXDA 4FP5D 3ND9A 1MI2A 4TSSA 4HN7A 1SSOA 3T53B 3Q23A 3K59A 3OOCA 3TN2A 5M3MB 2IPKD 1PRTD 1AW7A 2HQEA 3QOLA 5ELFA 2AUJD 3AU7A 4Q0FA 1LABA 3H3VC 3DXJC 5M5XB 1S5BD 4DXGA 5J39A 1TIID 3NWSA 3H94A 1PTOD 2XN9C 3SE0A 2FFKB 4DF7A 4RH6A 3K6OA 1L0XB 4A3BB 3I72A 4DAPA 1O78A 3T51B 2RDHA 3QB3A 2EY2A 4HAEA 2B8FA 2Z8LA 5CYUA 3HOWB 1E2WA 4K2LA 4KJNA 4K2KA 3GTMB 4B9XA 1WTQA 3D3RA 1BOSA 1OXUA 4PMCA 4G7OC 1RTOA 4V190 3OSOA 4M8AA 2XRQD 3TP8A 1TWHB 3BDOA 5IGFA 5C44B 1M4VA 1X32A 3DWQA 1OXTA 3V2TA 3ZYYX 4H7BA 4DAYA 3SK8A 5EGTA 3EA6A 2PW5A 2SNMA 3SK6A 1TS3A 3HOXB 2EOTA 1CFMA 3CRKC 4U68A 3Q0AA 1TWAB 3PMFA 4IUVA 4ZRZA 3MFYA 5JJZA 2IX3A 1RTNA 2Q8IB 2I07B 1AZPA 2R93B 3BG3A 3PUXA 3GTPB 3J7YW 3DUZA 3C1FA 3RMHA 5HGTA 3T4AC 1CA6A 4IFDG 2F0IA 1IYUA 3NE5B 5FK9C 3M7NA 3MA2B 1JOOA 1U4PA 2WAQB 3E5SA 1PTOB 4A3GB 2RVLA 4NP5A 2B2UC 2A69C 1I4HA 5J22A 5CMDA 1JR0D 4V0BA 1KDAA 2L11A 3NQIA 1GXDC 4XQQA 1FNWA 2MGSA 1QNUA 4K5XA 3J81E 4CGYB 2TSSA 1D2BA 3J81L 1T5XD 1VDZA 1EYDA 1UNSA 2K03A 1SYBA 4K5WA 1SBBB 4XTCS 2DY8A 4R9WA 2NZ1D 1AFPA 1Q1EA 3GD7A 5C3WA 2BA0A 5IGGA 1K83B 2RDFA 1LV9A 1ESRA 1IYVA 2AQ3B 1DM0B 2WV6D 3D6WA 1A3VA 2RDGA 3NTIA 2A73B 5G3LD 3TP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKL A;  1STA A;  1SYC A;  5J39 A;  2OF1 A;  2F0L A;  4HMJ A;  4IAL A;  2EY1 A;  3C1F A;  3U9O A;  3D6C A;  4KJO A;  4TRD A;  4WRD A;  4B9W A;  1A3T A;  5HGT A;  5CV9 A;  3SK5 A;  2EYO A;  2KHS A;  2PW7 A;  4N9P A;  2F0G A;  1A3U A;  1SND A;  5NUC A;  5CGK A;  3DMU A;  1JOK A;  1EY6 A;  1SNM A;  4I65 A;  2EYL A;  2F0I A;  3ITP A;  4K6D A;  1F2Y A;  5CV4 A;  1TR5 A;  3H6M A;  1TT2 A;  2SNS A;  2F0F A;  3OMG A;  1SYF A;  4KHV A;  3SR1 A;  1A2T A;  2LKV A;  2PYK A;  3BDL A;  3NHH A;  3P75 A;  5C4H A;  4K5V A;  3MXP A;  3D4W A;  5CV7 A;  5DEH A;  4G57 A;  4NMZ A;  4QB4 A;  4ZUJ A;  3SHL A;  4DU9 A;  4R8N A;  5CC4 A;  5IGC A;  2KQ3 A;  5DAU A;  3R3O A;  1JOO A;  2WAC A;  4KD3 A;  5C5L A;  3E5S A;  3TP7 A;  3QB3 A;  4ODG A;  2EY2 A;  3EVQ A;  3MHB A;  2F0S A;  5I6W A;  3NUC A;  2OXP A;  5K5P A;  2F0D A;  1KAB A;  4ID6 A;  4NDX A;  5E3F A;  2EYH A;  2EXZ A;  3HEJ A;  3SK4 A;  1STG A;  3T16 A;  4NP5 A;  1EYC A;  3TP6 A;  1STB A;  4ME5 A;  1KDC A;  1EY7 A;  1JOQ A;  3QOJ A;  5EKL A;  2F0W A;  3DHQ A;  2SOB A;  4N9T A;  2F3W A;  3ERQ A;  2EY6 A;  4K2L A;  4DGZ A;  5IOD A;  5J22 A;  1F2Z A;  4K14 A;  1ENC A;  2EYJ A;  4KY5 A;  1TQO A;  5IGB A;  4IZ8 A;  4KJN A;  5M9O A;  4F7X A;  5CV6 A;  3NP8 A;  3OWF A;  4K2K A;  4RKL A;  3NXW A;  4ZUI A;  5EKK A;  3VA5 A;  1KDB A;  5I9O A;  1KDA A;  5ISR A;  2F0M A;  2OEO A;  1ENA A;  2F0V A;  4B9X A;  5JOB A;  2F0Q A;  4KD4 A;  4PMC A;  1JOR A;  4J1M A;  4DF7 A;  3OSO A;  5CV8 A;  1EY0 A;  1EYA A;  4PMB A;  5CV5 A;  5E1F A;  3MVV A;  4EVO A;  5KGU A;  1EZ8 A;  1SYE A;  3TP8 A;  2PZT A;  2F0P A;  2PZU A;  4K5X A;  3HZX A;  5IGF A;  1SNO A;  2EYF A;  3BDC A;  5C4Z A;  3OMC A;  5IIF A;  5I9P A;  5JAV A;  2F0T A;  4S3S A;  5J1Z A;  4OL7 A;  5F2D A;  3LX0 A;  3ERO A;  3NQT A;  4KY7 A;  5HUR A;  2EY5 A;  2F0O A;  1EYD A;  2F0U A;  3V2T A;  2EYP A;  5KYI A;  3MZ5 A;  1EY5 A;  4H7B A;  2F0J A;  4QMG A;  1EY9 A;  1U9R A;  5IGE A;  3D8G A;  3P1H A;  1SYB A;  4K5W A;  5KYL A;  3SK8 A;  1STY A;  5EGT A;  2F0E A;  1SNC A;  1RKN A;  1II3 A;  1NSN S;  2PW5 A;  2PZW A;  2SNM A;  4K8I A;  4KTA A;  4MIU A;  3SK6 A;  1EY8 A;  4KY6 A;  1SNP A;  3EJI A;  4EQP A;  3MEH A;  4YIJ A;  1STN A;  1F2M A;  1KAA A;  4F8M A;  1EQV A;  1NUC A;  5C3W A;  4DFA A;  4ZQ3 A;  5C5M A;  5I6Y A;  2F0N A;  3TME A;  5IGG A;  1A2U A;  2F3V A;  2RDF A;  3PMF A;  4IUN A;  4RKB A;  2O4X A;  5CR3 A;  3D4D A;  5KRU A;  1AEX A;  3TP5 A;  5C3X A;  3C1E A;  4HMI A;  1EY4 A;  2NUC A;  3SXH A;  1SYG A;  1SNQ A;  2HQE A;  5IGD A;  4EQN A;  5KIX A;  1STH A;  2QDB A;  1A3V A;  2PQE A;  2F0K A;  2M00 A;  2RKS A;  4K8J A;  3RUZ A;  2F0H A;  4J6H A;  3QOL A;  5IOC A;  3T13 A;  2RBM A;  4KV6 A;  5C6A A;  4WOR A;  3NK9 A;  4EQO A;  2ENB A;  2EYM A;  4LAA A;  5KEE A;  3S9W A;  4HTH A;  4E6I A;  4PNY A;  1EZ6 A;  4QF4 A;  1IHZ A;  1SYD A; 
#chains in the Genus database with same CATH topology
 4X3S A;  1DZ1 A;  2ZTD A;  1N36 L;  2NN6 G;  1X3Q A;  3PF5 A;  3NBH A;  5CV9 A;  2A6E C;  2F0G A;  4DAM A;  2QDL A;  2EJF C;  4JBW A;  4KLK A;  4TVA B;  3SEB A;  4OO1 H;  1Q1B A;  1Y1V H;  1XPR A;  2DJG C;  3SR1 A;  2SNS A;  4L6T B;  4LF8 Q;  4LFB L;  3P75 A;  4C3J H;  3SHL A;  3HOY G;  2B2V C;  3GTO H;  3GQB A;  3GTK H;  4JI5 Q;  3UDX A;  4IFD J;  1IW7 C;  1D5Z C;  1EWC A;  1WTV A;  1NCV A;  2LFN A;  4WJW A;  3WOF A;  3FHW A;  4X66 Q;  3PO3 B;  3WOE A;  1TU2 B;  1JIC A;  4BY1 H;  1QUQ B;  4IUR A;  2AUK A;  2VQE Q;  5EKL A;  2AHO B;  1BO0 A;  3DEP A;  4N9T A;  1IXR A;  3F1Z A;  4A3M B;  1K0R A;  2A69 D;  3GV3 A;  3J81 j;  1WCM B;  3CCM A;  3M4Y A;  2PPB C;  3S16 H;  4PMB A;  1L1O B;  1UE1 A;  4A3I G;  2JA5 G;  1JE5 A;  1X3P A;  3OMC A;  2V4D A;  4BBS H;  1RD9 D;  2N78 A;  2KCT A;  2EY5 A;  4RGT A;  3EFX D;  4DUY Q;  4C1N I;  4U67 3;  2WP8 J;  2UXB L;  1U9R A;  1EFI D;  1BCP C;  1SNC A;  2N8N A;  4EQP A;  1X3G A;  3IFT A;  3IKJ A;  3OW2 A;  1NNX A;  3H0G B;  4HID A;  2QF7 A;  1PFM A;  2F0N A;  2F3V A;  4QUF A;  4OIJ A;  2R92 H;  5C3X A;  3VYU A;  2FJ2 A;  5M3M H;  1N34 L;  1SXT A;  2G9D A;  2Q8T A;  3PO2 B;  2N3S A;  4CDE C;  1QVC A;  2R3Z A;  3MWY W;  4JBK A;  4LF8 L;  2X69 A;  4XYO A;  4KV6 A;  1HA5 A;  2EQS A;  3MXN A;  4KI0 A;  4JI5 L;  4LAA A;  1PH6 A;  2ASB A;  4PNY A;  1JB3 A;  3E9I A;  3S17 B;  1SYC A;  4LW1 A;  5BR8 Q;  5M5X H;  5D3D A;  2Z6K A;  4X66 L;  3FP9 A;  3SK5 A;  4FVM A;  1UAP A;  2NVX B;  4MNO A;  5CGK A;  5D65 A;  1SNM A;  3ITP A;  1XX8 A;  3J80 i;  3H6M A;  2VQE L;  1XPO A;  2ZM6 Q;  2PYK A;  2EPB A;  2EZV A;  2X6L A;  5CV7 A;  1KD1 C;  1H9K A;  5IGC A;  2VUM H;  4A3B H;  1GD7 A;  1GHK A;  1O7I A;  1CK1 A;  1N32 Q;  4CHT B;  1I4G A;  3RN5 A;  1SN8 A;  1I4P A;  2A6E D;  1D1K A;  3O13 A;  4CKB A;  5FKA C;  3F2C A;  1ZEQ X;  5KRU A;  3D31 A;  1PYW D;  1PH5 A;  3G7L A;  1U4M A;  2UUB Q;  1EY7 A;  1K3B C;  5K36 H;  3I56 A;  1Q86 C;  3CF5 A;  5D14 A;  4CKC A;  3HOW H;  1IW7 D;  1YNN C;  4XT3 B;  4DGZ A;  3KFU A;  5CV6 A;  1K9M C;  1NR4 A;  1SE2 A;  3H91 A;  1IL2 A;  3HOZ B;  4ZUI A;  2SEB D;  3GTM H;  4DUY L;  1LT4 D;  1JOR A;  2V1C C;  4P2C B;  2N49 A;  2BCO A;  1K73 C;  5CV8 A;  4ZYS A;  2K32 A;  4FO2 A;  3STB C;  5KNC A;  3MVV A;  3CCQ A;  1LTA D;  1SE4 A;  2EJM A;  4UP8 A;  2F0P A;  3HG9 A;  3HRZ C;  4KKS A;  2A19 A;  1TWH H;  1Q8K A;  3ULL A;  2IY5 B;  5C44 H;  4BBS G;  2EJG C;  2DN8 A;  4OEL B;  2JEA I;  1QWY A;  3RZO B;  1Z7T A;  4KN7 C;  1M8A A;  4A76 A;  1HZA A;  2JSO A;  4Y52 H;  1K8M A;  2K28 A;  4I7A A;  5FLM G;  2B63 G;  1O7L A;  1S5F D;  2JA7 B;  1F2M A;  1Y1W B;  4BA1 I;  3HOX H;  4DFA A;  5BR8 L;  4IQZ A;  1NE3 A;  4CBV A;  1TY0 A;  1R4P B;  2BH2 A;  3EBE A;  1BVS A;  1TWA H;  1BCP D;  1YVC A;  4K0K Q;  2R92 G;  1I6H B;  4DXF A;  4DN4 M;  2ZM6 L;  2D62 A;  3RUZ A;  3C46 A;  3MXU A;  1KLG D;  1HPC A;  1TY2 A;  2XVS A;  4QCL A;  3KLR A;  2E2H B;  2R93 H;  2IW3 A;  1N32 L;  3UDF A;  4CJ2 C;  2B2Y A;  1FGB D;  2AMC B;  4A3C H;  1VQ6 A;  5C4X B;  3GTP H;  3K80 C;  4DK1 A;  3K5L A;  1VMP A;  4B9W A;  1B3Q A;  2JXM B;  2RSO A;  2EYO A;  2GVA A;  3S14 B;  1MSH A;  5ELD A;  1PH7 A;  4H44 C;  4C3I B;  2UUB L;  1M90 C;  5GAG C;  1BBX C;  1M1K C;  2VB3 X;  1TT2 A;  2NTT A;  1BUV T;  3OMG A;  3A8I E;  4IPD A;  3BDL A;  2L5T A;  4K5V A;  3GTQ B;  4L63 B;  2WIN B;  5FJ8 G;  1WTO A;  2GVB A;  5EBD A;  3R3O A;  2VUM G;  4R4Q A;  4LF6 Q;  3PGZ A;  4AYB B;  2LY7 A;  3CRL C;  2F0D A;  4X3U A;  4GN3 B;  4A3G H;  2VNU D;  1STB A;  1KDC A;  1JOQ A;  4AYB E;  1E2V A;  5IOD A;  2EY6 A;  2A6H C;  2M9V A;  3DM3 A;  4K14 A;  4KKU A;  2C9O A;  2BDO A;  4F7X A;  4JI7 Q;  4P74 A;  5EKK A;  2MQH A;  2KCC A;  5EQ0 A;  2A5H A;  2NB0 A;  1S5E D;  3W1B A;  3I4O A;  4LUO A;  3U50 C;  1LLR D;  1YNN D;  1HQM C;  4RHR A;  2OWO A;  1KTK A;  1KLU D;  3HZX A;  3SDZ A;  3PIO 3;  4G7Z C;  3Q22 A;  4H13 C;  4HJA A;  5DLQ E;  1EUJ A;  2ICI A;  1RHP A;  2AWN A;  3GO5 A;  3BZC A;  3STB D;  3H09 A;  1UE7 A;  2CHB D;  3FMC A;  3ONA B;  2K7V A;  1IBL L;  4FDB A;  1W3S A;  4K0K L;  2Y0S B;  2LXK A;  3KJO A;  2CCZ A;  2RQX A;  1NSN S;  5K5P A;  3PUZ A;  4LF9 L;  2K05 A;  4YCW A;  1H95 A;  1YHQ A;  4YIJ A;  4HCS A;  5C3E B;  2Y0S E;  3H3V I;  1ZYR C;  1Q3L A;  3OIQ A;  4IUN A;  3ULP A;  1C0A A;  3M3Y B;  4K6L A;  1H9S B;  1K83 H;  2QCP X;  3DWA A;  4B3S Q;  5LMU Q;  1A6X A;  4RGM A;  1ASZ A;  3K0Y A;  1VQN A;  2F0H A;  1B1Z A;  2J0T D;  4WOR A;  2EYM A;  2ZT9 C;  4HTH A;  4E6I A;  1CHP D;  4NKL A;  4ZAI A;  1ZKO A;  3T1H Q;  4A3K B;  1SE8 A;  2K50 A;  4LF6 L;  4L8J A;  1WJJ A;  2EDG A;  2HCC A;  4X64 Q;  1ILP A;  4A3C G;  2WB1 B;  1VCI A;  4N9P A;  3Q24 A;  2EYL A;  5GAD C;  2IL8 A;  4YHH Q;  4UPA A;  2LKV A;  1SFO B;  4FF1 A;  3MXP A;  3V96 A;  2WB1 E;  4QB4 A;  2L9H A;  2KQ3 A;  4JI7 L;  1IZ6 A;  3LWU A;  2Q2T A;  3QWN A;  1KRT A;  1YHB A;  2JN4 A;  2EXZ A;  3JC6 6;  3S1R B;  1PZJ D;  3QOJ A;  3J7A 5;  2LS0 1;  1LTS D;  2NWG A;  4RFB A;  1PYS B;  5IGB A;  2BA1 A;  4MZ9 A;  3GP7 A;  4A3M H;  1DGS A;  1V1P B;  4KD4 A;  1EIY B;  3PV0 A;  2NVT H;  2Z4I A;  4GZY C;  1T5E A;  1YNJ C;  4DV3 Q;  5C0X H;  4LUZ A;  2JK8 A;  4OEM B;  1WCM H;  4B3T Q;  1EIH A;  5KGU A;  1EZ8 A;  2PZT A;  5T1G A;  3KF8 B;  4F87 A;  2NTS A;  2EYF A;  1VQJ A;  2ZTE A;  4OHJ A;  4DNT B;  1JWU D;  1FNV A;  2F0T A;  1EL0 A;  3TS0 A;  2G5D A;  4HIM A;  1CZG A;  2XSC A;  1MGS A;  3ERS X;  3NQT A;  1YEZ A;  2SDF A;  3IRB A;  1HNX Q;  1Y14 B;  1D8L A;  3UE0 A;  5JJK A;  4B3S L;  1B9N A;  1H9R A;  1LYL A;  5EPL A;  3OYY A;  5LMU L;  1DXM A;  4KTA A;  1II3 A;  5GQO A;  3J7Z C;  3TZU A;  4DPG A;  1V1O A;  2HT1 A;  1STN A;  1KAA A;  3F2U A;  1DOM A;  1NUC A;  3KLS A;  3T1H L;  4LF4 Q;  3H0G H;  3R2I A;  4X64 L;  4NXM Q;  2RCN A;  1ESF A;  3PUV A;  3KDF B;  2I46 A;  2F3I A;  4JCV E;  1B50 A;  1JE4 A;  3NWT A;  3CCJ A;  3SXH A;  1DON A;  2ZJP A;  1WOC A;  4YHH L;  2F0K A;  3CP0 A;  3E0E A;  3PO2 H;  1DJR D;  2I5L X;  2NN6 I;  2K6A A;  3S9W A;  3KF6 B;  1ZYR D;  1EOT A;  2NZH A;  3VR6 A;  3AMU A;  3S17 H;  3MC0 B;  3G71 A;  3A5Z B;  3E6Z X;  3JAM E;  3F8T A;  5ELB A;  4JC0 A;  2NVX H;  1PZI D;  1TVX A;  3CW2 C;  5IWA Q;  3S2D H;  4DR5 Q;  1PA6 A;  4BY7 G;  2K1B A;  3JAM L;  2B2W C;  1LAC A;  5DEH A;  2Q2H A;  4GLA C;  3N52 A;  2K5V A;  1SJH D;  1VQ5 A;  2WAC A;  1I4X A;  2FXQ A;  4KD3 A;  4DK0 A;  2OQ0 A;  1KC8 C;  2QW7 A;  2WKC A;  5COR A;  2R7Z G;  4POG A;  3A5U A;  4DR2 Q;  4P71 A;  1J9O A;  1KAB A;  4DV4 Q;  1N33 Q;  3T16 A;  3NEM A;  3CMA A;  4DV3 L;  3RLF A;  4B3T L;  1ROD A;  1I50 B;  1PRT B;  2MFI A;  1GOZ A;  3RLO A;  2F3W A;  4YWK A;  2F03 A;  3MTS A;  1F2Z A;  1WFQ A;  2MNA A;  4BS9 A;  4JI8 Q;  2E5L Q;  2X6G A;  5JVG 3;  4EX5 A;  2BE5 C;  2DNC A;  1QUQ A;  4R4I A;  2F0V A;  3HFZ B;  4ZKB B;  4A93 B;  1IBM Q;  3HOZ H;  2OTJ A;  2MJ8 A;  2B2T A;  5M3F B;  3NEL A;  1HNX L;  3HS0 C;  4HSP A;  4YY3 Q;  1O80 A;  1IBK Q;  1Q46 A;  1SE3 A;  1FJG Q;  2WAQ E;  5LMN Q;  1NR2 A;  4LFA Q;  4OL7 A;  3KJP A;  4LF4 L;  5EJW A;  2F0O A;  1L1O A;  1YNJ D;  1BBU A;  1YJN A;  4NXM L;  2EIF A;  4FF4 A;  4G7H C;  1KQS A;  1XNQ Q;  5IGE A;  3VR4 A;  3RZO H;  3HOV B;  3E0J A;  2F0E A;  3LGJ A;  2PZW A;  5IT9 c;  4MIU A;  2H4O A;  3J80 E;  1XTD A;  4C3H G;  4GNX B;  4F8M A;  1C7Y A;  1FNU A;  2F4I A;  4ZQ3 A;  5C5M A;  1E1O A;  1CA5 A;  2JA6 G;  1R4Q B;  1FR3 A;  3KBX A;  1HTL D;  3VYR A;  4LNQ A;  1A62 A;  3MAQ A;  3RZD B;  5HGQ A;  5IWA L;  4DR5 L;  1Z6H A;  5FLX E;  4C2M B;  1I6H H;  1E0B A;  2RBM A;  3AYH B;  4EQO A;  1HFG A;  4S3S A;  1WVL A;  5FLX L;  1SYD A;  2E2H H;  2OF1 A;  2CVR A;  4P73 A;  1X54 A;  3OPO A;  3A74 A;  3U9O A;  3D6C A;  4DR2 L;  3RN2 A;  4OO1 I;  5C4X H;  4DV4 L;  1MJC A;  5D3I B;  1SND A;  1VQO A;  2A74 C;  4QUC A;  2PCF B;  4K6D A;  1Z9F A;  4R4O A;  1EIG A;  3S14 H;  3W2D A;  4C3I H;  2O2L D;  1PH1 A;  1ENF A;  4A3E B;  4LMQ D;  4JI8 L;  2E5L L;  3GTQ H;  1Q82 C;  5FO7 B;  1QVF A;  1D7Q A;  5JEA H;  3S1M B;  1IBM L;  1HUN A;  1VF7 A;  3SK4 A;  1SAP A;  1XMO Q;  5LHY 1;  4XQJ A;  3A54 A;  5FO8 B;  1VQC A;  3DEO A;  3I4M G;  2Z6K C;  4YY3 L;  3AFP A;  1IBK L;  4RG1 A;  3IL8 A;  3R8B A;  1RCV D;  1N34 Q;  5LMN L;  1FJG L;  4IZ8 A;  3CME A;  4LFA L;  3NXW A;  1KDB A;  4KN4 C;  4MTN A;  3Q6S A;  1DCZ A;  2F0Q A;  2UXD Q;  1CKN B;  2J7Z A;  4J1M A;  1JWM D;  4OX9 Q;  1XNQ L;  1EYA A;  5E1F A;  3A8J E;  1OXV A;  3QR8 A;  3CCU A;  1NY4 A;  3KLS X;  1HUM A;  4IJL A;  3J80 c;  1WYD A;  2E2I B;  3C2P A;  1GJX A;  5KNB A;  1QB5 D;  3L3O C;  4UAI A;  4R1J A;  2I5H A;  1B53 A;  3CCR A;  1KNE A;  5KYL A;  2E2J B;  4YCU A;  2K5D A;  1G6Z A;  3GTG B;  1UEB A;  1QZH A;  4JI3 Q;  1TWC B;  2FIN B;  1AN8 A;  2CWA A;  4ZK9 B;  1I94 Q;  3HOU B;  5FLX c;  2KHI A;  2PI2 E;  2A8V A;  3PQI A;  4X3K A;  5C3E H;  2C5C A;  4CJ1 B;  2IT1 A;  3G6J B;  3K8A A;  3GTL B;  3SVM A;  3M3Y H;  5KIX A;  1B3A A;  1STH A;  2QDB A;  4X3T A;  4C1N K;  1F9Q A;  2IX1 A;  3DWP A;  3IAY A;  2MHV A;  1G29 1;  3E9H A;  1BNZ A;  3BVG A;  1Y8O B;  3PUY A;  1STA A;  3FKI B;  1L2F A;  2CW0 C;  2YV5 A;  4RAU C;  4DK6 C;  1PH3 A;  4KJO A;  3BZD B;  3K5O A;  1DYQ A;  2KEE A;  2C35 B;  4O0A A;  1XMO L;  4HJ7 A;  3DMU A;  1JOK A;  3M4Q A;  1SLJ A;  4AIM A;  4CKE A;  1TR5 A;  4PZ7 A;  2XGT A;  4C3I G;  4A3F B;  3Q8D A;  1SMY C;  5GAE C;  5EKI A;  2QEX A;  2MP1 A;  3CC2 A;  4JVZ A;  2F0S A;  3S2H B;  2UXD L;  5I6W A;  2HCI A;  1B44 D;  5A2Q E;  4NDX A;  5JEA G;  4OX9 L;  2EYH A;  3HEJ A;  2KJX A;  4IUP A;  4P72 A;  5E4X A;  3X3N A;  4XQN A;  2B2Y C;  1EOV A;  5A2Q L;  3TEH B;  3S1R H;  3R2T A;  3CU7 A;  1ENC A;  2HHH Q;  1DOK A;  2GN5 A;  1NTG A;  4CJ0 B;  4DA2 A;  4OO1 G;  1Y1V G;  1BBW A;  4IPG A;  5EAY A;  2RSN A;  3OW7 A;  4QJF A;  4EGV A;  4XT1 B;  4C3J G;  5KND A;  1GHJ A;  1I4R A;  3TDQ A;  1PHJ A;  1PMR A;  1EY0 A;  1S5C D;  4ME3 A;  4LFC Q;  4JI3 L;  2JQO A;  3OHX C;  1TKW B;  2Z0S A;  2E75 C;  1I94 L;  3C3L A;  2KVM A;  4BY1 G;  4A3J B;  5J1Z A;  1A0I A;  2L4N A;  3FPP A;  3J81 i;  2F0U A;  4UP9 A;  2Z4H A;  1MBY A;  2K4K A;  3U4Z A;  4IOA A;  4B3M Q;  1SJE D;  1TS5 A;  4UY8 C;  1YIJ A;  1JCK B;  1AE3 A;  1JQY D;  4N8F A;  2IHF A;  1EY8 A;  2ZTC A;  1KRS A;  1S5D D;  1T9H A;  4J8Q A;  3HOY B;  3UI2 A;  4JV5 Q;  1EWH A;  1LT5 D;  4GOP B;  1YJ9 A;  2K14 A;  1AEX A;  1GUG A;  5LL6 X;  2LXJ A;  4Y7N B;  1EY4 A;  2NUC A;  2E8G A;  2K5Q A;  3I3C A;  1K8O A;  4EQN A;  2OCE A;  2YTV A;  1G8Z D;  3PUW A;  5DM6 3;  2K5H A;  3S1N B;  5KEE A;  5JJI A;  4QF4 A;  1IHZ A;  1H9S A;  5DAU A;  1LO5 D;  4PZ6 A;  4HMJ A;  3NEN A;  3W1G A;  4IPH A;  4Z9C B;  1A3T A;  2KHS A;  2PW7 A;  3K7A B;  2IWH A;  1G6P A;  2PNR C;  1N9W A;  3OIP A;  4R8I A;  4RHS A;  2Q2U A;  4M1U B;  1IBL Q;  5C4H A;  5IYB H;  2IHE A;  2HHH L;  5COY A;  4XIG S;  5M3M G;  2RF4 A;  2JA5 B;  4PV1 C;  1A15 A;  1SRO A;  3EQL C;  3RLN A;  1RF2 D;  4LF9 Q;  4Q5V A;  3M4O B;  3MHB A;  2WII B;  4JOI C;  4DV0 Q;  2VY3 A;  2JA8 B;  1QOH A;  4LFC L;  1L0Y B;  4B08 A;  3TBI B;  5BN4 A;  1SMY D;  1I50 H;  1FVI A;  1PXU A;  1U5K A;  1VQM A;  5JEA J;  1IKL A;  3AB9 A;  1VQD A;  4PMW A;  5I9O A;  4MN3 A;  5M5Y B;  2GA4 B;  1C8C A;  1WTW A;  1ET6 A;  2ZXP A;  2ID0 A;  4A93 H;  5C4J B;  4B3M L;  4A3B G;  3FEW X;  1XPU A;  1CSQ A;  1J8I A;  2VL6 A;  4HR7 B;  4AH6 A;  3I4N B;  1PTO H;  2JE6 I;  1V1P A;  5IP7 H;  1PDQ A;  5EPK A;  1CQF A;  2AWO A;  1BQQ T;  1AE2 A;  5K36 G;  2DNE A;  3HOW G;  4JV5 L;  1PYB A;  4DR4 Q;  3KF8 A;  1PVO A;  1PTO C;  5KYI A;  3K0X A;  4QMG A;  1U0L A;  2YU9 B;  3N6R A;  2K5N A;  3P1H A;  4JI2 Q;  4GKJ Q;  1XWE A;  1F9P A;  2PMZ B;  3HOV H;  2HUG A;  1TWG B;  4XDX A;  4KY6 A;  2L0C A;  3BYT B;  2DY7 A;  1GVP A;  2PMZ E;  4KMU C;  1PRT F;  1C4Q A;  2OTL A;  5I2Y A;  3FVQ A;  2VZA A;  3C1E A;  4RCN A;  4DV5 Q;  3MXG A;  1MHW C;  1Q81 C;  5C44 G;  1HZB A;  4A4I A;  3RZD H;  3H15 A;  1HZ9 A;  3TRE A;  2AKW B;  1EYG A;  3CCE A;  3CQZ B;  3KDF A;  1EZ6 A;  5C5L A;  1HTP A;  3LNN A;  4LF7 Q;  5JPN C;  2KOL A;  2F0L A;  4IAL A;  4XYQ A;  3VR2 A;  1PTO F;  3K81 C;  3ULJ A;  4TRD A;  3MFG A;  3VYT A;  4DV0 L;  5LL6 S;  2M2L A;  4FYD A;  2KEN A;  1W6J A;  1XMQ Q;  3BU2 A;  3HOX G;  4BA2 I;  4I65 A;  3DLL A;  1I5F A;  3KF6 A;  4IUU A;  1F2Y A;  5E4W C;  4DAV A;  3NHH A;  5ELC A;  1Q7Y C;  5CC4 A;  1GM5 A;  1TS4 A;  5IYB G;  4A3E H;  1AH9 A;  3GTJ B;  1I3Q B;  2B29 A;  3J7A V;  3S1M H;  3CXC A;  1STG A;  2NVY B;  1I4Q A;  5J3B A;  2F4V Q;  4BBS B;  4LWC A;  2R93 G;  4DUZ Q;  1LT3 D;  1G2S A;  1VQA A;  1BCP B;  3UE1 A;  3QG1 A;  3A56 A;  2EYJ A;  3CC7 A;  1EWI A;  1PZK D;  4RKL A;  3S24 A;  2F0M A;  2OEO A;  2B63 B;  3RR5 A;  5C0X I;  4DR4 L;  2DUD A;  4WFN 3;  3VA7 A;  4JI2 L;  4EVO A;  4O2D A;  4GKJ L;  2JYO A;  2F52 A;  2WAQ G;  1BDO A;  3L2P A;  5C4Z A;  1G51 A;  2R92 B;  3PO3 H;  2QEJ C;  5IE8 A;  4A3G G;  1P8L A;  2QA4 A;  3H3V H;  5F2D A;  3L7Z C;  1D5M C;  1Q8I A;  5IYD H;  1HA6 A;  1AP0 A;  3A8K E;  2NZO A;  2E2I H;  1CSP A;  4KKT A;  1QJO A;  4DK3 C;  4FXK C;  3D8G A;  4RWS C;  4DV5 L;  3NTH A;  4ILW A;  2L1B A;  3KOJ A;  2N88 A;  2B2T C;  2E2J H;  2VXW A;  3GTG H;  3EJI A;  1TWC H;  2A6H D;  3J7A F;  2EVB A;  4IFD H;  3TS2 A;  4LF7 L;  1P16 A;  3HOU H;  4A3D B;  1CTM A;  4OWT B;  5CBA E;  4DR3 Q;  1A2U A;  4RKB A;  2A1A A;  2VUM B;  4EQ5 A;  4HMI A;  1XMQ L;  4GKK Q;  3KK7 A;  1SNQ A;  4GNX A;  4X65 Q;  3HKS A;  1G2T A;  3I70 A;  4K8J A;  3PF4 A;  4TQU S;  3GTL H;  1VQB A;  1OTC A;  4BXX H;  2B8G A;  4KK7 A;  1SDF A;  2LMC B;  1PFB A;  2MPM A;  2FHT A;  4HSV A;  1PH2 A;  3FKI H;  2HD3 A;  1ML0 D;  1PH9 A;  2RA4 A;  4UDU C;  2F4V L;  4DUZ L;  1GUT A;  3MEF A;  4N8X 1;  5JVH 3;  1EEI D;  2F0F A;  5IT9 E;  4FF3 A;  5BN5 A;  4HIO A;  4JI6 Q;  1S4Z A;  1ZXT A;  2K33 A;  2R61 A;  4IPC A;  4A3F H;  5IT9 L;  4ODG A;  3TZD A;  3NUC A;  4RGN A;  3S2H H;  1V1Q A;  4CDD C;  5LMN W;  1HHV A;  4BBR B;  3E3X A;  1LTT D;  4IUQ A;  1F2L A;  1KHI A;  3W5O A;  1TQO A;  3OWE B;  1KAW A;  1EQR A;  2XNA C;  2MUY A;  4JYA Q;  2UXC Q;  3CCL A;  2VS1 A;  1VQF A;  1Z47 A;  2Z6B A;  2G9H D;  4JBM A;  1EIF A;  1UWV A;  3DM1 A;  1C9O A;  4MTK A;  1OXS C;  2UU9 Q;  3AFQ A;  4GLV B;  3BDC A;  1VS0 A;  4DNI A;  1YJW A;  1F9R A;  1CKN A;  3D0F A;  3PO3 G;  5EPJ A;  1EU4 A;  1LUZ A;  1U4L A;  3ERO A;  3UDI A;  3EN2 A;  4A3J H;  3FRP B;  4DR3 L;  2EYP A;  1WD0 A;  2XRS D;  2F0J A;  2L12 A;  5FOB B;  2CQA A;  2QGQ A;  1KXL A;  3VYS A;  4GKK L;  1F77 A;  1STY A;  4X65 L;  2A68 C;  1B4O A;  4A3M G;  1EU3 A;  1BR9 A;  4IOC A;  4QQB X;  2NN6 H;  5AFW A;  5C0X G;  3KLW A;  1CT1 D;  1WCM G;  1ILQ A;  1RJT A;  1QG7 A;  1H9M A;  2PI2 A;  3AQQ A;  1LT6 D;  2I0Q A;  2O5I C;  2O4X A;  3HOY H;  4IN3 A;  3TP5 A;  4F88 A;  3K5N A;  5M5W B;  1KNA A;  5ELE A;  3WDN A;  1LTG D;  1R9T B;  1JJG A;  2M00 A;  1UEA B;  3IFD A;  3FDT A;  5G3L F;  3PIO A;  4JI6 L;  3KUP A;  4QY7 A;  2R6G A;  2ES2 A;  3S1N H;  2RCF A;  1HRJ A;  1HXY D;  4HIK A;  1X56 A;  3D4R A;  2JA7 H;  4O42 A;  1Y1W H;  5NUC A;  2KCN A;  5ELO A;  3J80 L;  3A0J A;  1OXX K;  1KIX A;  5IYC H;  1FYC A;  1Q90 A;  3K7A H;  1X6O A;  1MSG A;  3H0G G;  2PO4 A;  1E24 A;  3VR5 A;  4DU9 A;  1E1T A;  3F2D A;  4JYA L;  3EVQ A;  2JA5 H;  1QE6 A;  3NBI A;  3M4O H;  1Y69 U;  1G91 A;  3PO2 G;  2UXC L;  1K0S A;  4JI4 Q;  5E3F A;  1O7Z A;  1PFN A;  1EYC A;  2HDM A;  3NTK A;  1DOL A;  4ALP A;  2UU9 L;  1D5X C;  2Q8R E;  2JA8 H;  4B3R Q;  3ERQ A;  4APV A;  1A63 A;  4IUT A;  3CPF A;  4HED A;  5M9O A;  2K52 A;  3V05 A;  1RIP A;  5I2X A;  5AJ3 Q;  5M5Y H;  2OT2 A;  1L0W A;  1CKM A;  1GUO A;  2ICE C;  2VW9 A;  1V43 A;  1W6K A;  5C4J H;  5DNF A;  5EBC A;  4DAY B;  3KBG A;  5IIF A;  2XWB B;  2E76 C;  1QVG A;  3I4N H;  2RHQ B;  1QIL A;  2AQ2 B;  1NJI C;  2B2W A;  3LX0 A;  5HUR A;  1QCB D;  1HNZ Q;  1ASY A;  4P75 A;  4HJ9 A;  2F1M A;  4GLX A;  1EEF D;  1H9J A;  3BVM A;  2YU9 H;  1B9M A;  1CHQ D;  3HOZ G;  3K7U C;  2L15 A;  4MHE A;  1TWG H;  1TWF B;  4BY7 B;  4NB3 A;  5I6Y A;  2OQK A;  2BE5 D;  2CFM A;  1FGU A;  2BDN A;  3D4D A;  2A68 D;  4KHZ A;  2ALY B;  4OXP A;  1CKO A;  5C0X J;  1D6E C;  1B8A A;  2R7Z B;  4AQY Q;  1AZQ A;  1GKH A;  1HCZ A;  2LSS A;  1GO3 E;  4J6H A;  3P7J A;  5I4D A;  3HGB A;  4YWL A;  4WJ4 A;  1E3P A;  1S40 A;  4GOP A;  1C48 A;  3I7F A;  1U4R A;  1YNX A;  2D2C C;  2CWP A;  2B2U A;  3CHB D;  3P20 A;  3I55 A;  4XXE A;  2JA9 A;  3CQZ H;  2PQA B;  3GV6 A;  1VF5 C;  4JI4 L;  1GUN A;  3I90 A;  3TQY A;  2Z9H A;  2JEB I;  3QO2 A;  3J81 c;  2JA7 G;  2O5J C;  1Y1W G;  1WTR A;  4KHV A;  4B3R L;  1SYF A;  3QIA A;  3HP3 A;  4HJ8 A;  5IYC G;  1WD1 A;  1HR0 Q;  2NVT B;  1J5E Q;  3JAM i;  4DR6 Q;  1IKM A;  3BYY B;  1DD2 A;  5AJ3 L;  2OXP A;  2XIW A;  5DM7 3;  3S1Q B;  5IY0 A;  4ID6 A;  2KA7 A;  3GTJ H;  1I3Q H;  1K3R A;  2MO0 A;  1SR3 A;  4FNF A;  1B70 B;  4A3K H;  2NVY H;  3TRZ A;  2PNH A;  4OIK A;  4DKA C;  2JA8 G;  1E22 A;  5C4X G;  1XTC D;  2VB2 X;  2K5W A;  3NP8 A;  4HCE A;  4O1N A;  3VA5 A;  1LTR D;  1WI5 A;  2ZXO A;  2FMC A;  4HJ5 A;  1PLF A;  1SFO H;  1HNZ L;  4C3H B;  5FLM H;  2B63 H;  2KHJ A;  4UHV A;  3K5M A;  2JA6 B;  1SYE A;  3I2Z A;  2D0P A;  4DR7 Q;  2K04 A;  1NMF A;  4BWG B;  1IL8 A;  5I9P A;  4AYB G;  2KED A;  1PH8 A;  4DV7 Q;  2NVQ B;  3I4N G;  4KY7 A;  4DV6 Q;  4CDF C;  4OGQ C;  5ELN A;  3MZ5 A;  3SGI A;  2L55 A;  3I73 A;  2AQ1 B;  2WKD A;  3CCS A;  1XYI A;  1EQT A;  3TSS A;  4AQY L;  4OWX B;  3T56 B;  1CQV A;  1SNP A;  2NBF A;  5CBE E;  3MEH A;  4JPB W;  1TXY A;  2CH4 W;  3M7G A;  1VQL A;  2EE1 A;  3NPP A;  2CH4 A;  1ET9 A;  1WTP A;  3G4S A;  3S2D B;  1MKH A;  2QIL A;  3TME A;  2JP1 A;  3HKZ B;  1BCP F;  5E7N A;  4A3D H;  1BF4 A;  5CR3 A;  3URY A;  5FJ8 H;  3M9B A;  1X55 A;  2B2V A;  1MJE A;  1Y8N B;  1D1I A;  2PQE A;  1E2Z A;  2RKS A;  3HKZ E;  3NBH B;  1TS2 A;  5GAH C;  2ZXR A;  1MIU A;  3RNU A;  1HR0 L;  5C6A A;  5JPM C;  3NK9 A;  2K01 A;  2ENB A;  3M4P A;  1J5E L;  3I4M B;  1I6V C;  3R93 A;  4DR6 L;  1CM9 A;  3I8Z A;  1JJC B;  2YYZ A;  4J15 A;  3PSI A;  2Y0S G;  3S15 B;  1UE5 A;  4RCO A;  4ZKC B;  1LTB D;  1UUP A;  3I4L A;  1ICF B;  2BOS A;  4FXG C;  1WTX A;  1EY6 A;  1ONL A;  4DNR B;  5C3E G;  2VQF Q;  1CI3 M;  2ATW A;  3L9A X;  3CC4 A;  2KCM A;  4ZLT F;  3QJY A;  2JJQ A;  2KUM A;  4IO9 A;  5GRO A;  3A55 A;  4I7Z C;  1HQR D;  1S72 A;  3ZJY C;  2H1E A;  2HIV A;  4ABN A;  1BXT A;  1LTI D;  4BBR H;  4A3K G;  4DR7 L;  1B2T A;  1JWS D;  5FO9 B;  1CZW A;  2D5D A;  1X3F A;  2WB1 G;  4DV7 L;  4DV6 L;  4NPS A;  2B39 A;  2CW0 D;  4OWW B;  4A3I B;  3K58 A;  2K75 A;  1JC7 A;  3W3A A;  2IJ0 A;  5IP9 H;  1SNO A;  4DV1 Q;  4FF2 A;  1VQ8 A;  5T1I A;  1B7Y B;  4PZ8 A;  4PQX A;  1ICW A;  3F2B A;  4POF A;  4QIW B;  1JMC A;  1EY5 A;  1EY9 A;  1SRU A;  4LK1 C;  2P5Z X;  1Q12 A;  1F9S A;  1VQ4 A;  3ICE A;  4NW2 A;  1N8R C;  1PRT C;  4QIW E;  5TSS A;  1SEB D;  4GS3 A;  5M3F H;  3FPU B;  3U9S A;  1EQV A;  2N55 A;  1GUS A;  3MXN B;  4L5R C;  5A35 A;  1JT8 A;  3A7A B;  1EFW A;  1BKB A;  4A3D G;  1SYG A;  5IGD A;  2FMM A;  5BN3 A;  5M5W H;  1OO9 B;  2VQF L;  3WWV A;  4LJZ C;  4JI1 Q;  3T13 A;  5IOC A;  1R9T H;  2CKZ B;  1VQ9 A;  2KEC A;  4C56 C;  4GN4 B;  2Z1C A;  3BJU A;  1PV4 A;  1PH4 A;  1HNW Q;  1VQ7 A;  2EY1 A;  4L5T A;  3PIP 3;  4WRD A;  1Y1V B;  2D9U A;  1A3U A;  4RGO S;  3RD4 A;  4RA8 A;  4ZCK A;  5ISR A;  5CV4 A;  5JOB A;  4C3J B;  1V8Q A;  3GTO B;  4LF5 Q;  3GTK B;  1A2T A;  1NBW A;  3D4W A;  4G57 A;  4NMZ A;  4ZUJ A;  4R8N A;  1W2B A;  4GNX C;  1GUW A;  1O7Y A;  3TP7 A;  5JJL A;  4G4K A;  1HFN A;  4C2M H;  3BS1 A;  1NAP A;  4BY1 B;  2XTI A;  4A3L H;  1S3O A;  1XXG A;  1RDP D;  4PG3 A;  1XJV A;  4ME5 A;  2TMP A;  1HJP A;  3CKI B;  4JK1 C;  3I91 A;  3BZK A;  2NYZ D;  1STE A;  2F0W A;  3UDG A;  3DHQ A;  2SOB A;  2R7F A;  4DV1 L;  4IJH A;  4KY5 A;  3CCV A;  4BBR G;  4JBJ A;  3M85 A;  2XWJ B;  3OWF A;  4TKO B;  4QGU A;  1ENA A;  1XNR Q;  1FD7 D;  1X3E A;  3S16 B;  3NSW A;  2UUC Q;  4ULL A;  5CV5 A;  2QKI C;  3BVZ A;  3A7L A;  4H0L C;  3VR3 A;  3X3M A;  2PZU A;  2WFW A;  1VQE A;  3T1Y Q;  3LWE A;  2UUA Q;  5JAV A;  5IP9 G;  3ND8 A;  2B3G A;  1V9P A;  1X65 A;  1MD2 D;  2YTY A;  3K57 A;  1QNK A;  4OON A;  2E2D C;  3EIV A;  2HDL A;  1VMC A;  4JOI A;  2E74 C;  4LUV A;  1RKN A;  2IX0 A;  2J4X A;  4X62 Q;  4K8I A;  4IFD I;  1Y8P B;  4JI1 L;  4FXD A;  4A93 G;  4FP5 D;  3ND9 A;  5M3F G;  1X9N A;  4CDC C;  1MI2 A;  4TSS A;  4HN7 A;  1SSO A;  4YWM A;  3T53 B;  3Q23 A;  1HNW L;  1TWF H;  3K59 A;  4BY7 H;  3OOC A;  4R4C A;  3TN2 A;  5M3M B;  5IP7 G;  2IPK D;  1PRT D;  3CD6 A;  1AW7 A;  2HIX A;  3U4V A;  4WJ3 M;  2HQE A;  2ZJQ A;  2R7Z H;  4LF5 L;  5H1S E;  4X6A H;  1JJ2 A;  3QOL A;  2AUJ D;  5ELF A;  3AU7 A;  4Q0F A;  5HY6 A;  1LAB A;  1K8G A;  3H3V C;  3DXJ C;  5M5X B;  1S5B D;  4DXG A;  5J39 A;  3HOV G;  1TII D;  3NWS A;  1PFS A;  1VQK A;  3H94 A;  1PTO D;  2XN9 C;  1JB7 A;  3SE0 A;  2FFK B;  1FL0 A;  4DF7 A;  4RH6 A;  3K6O A;  1L0X B;  1VQH A;  1CUK A;  4A3B B;  4DR1 Q;  3I72 A;  4DAP A;  1L1O C;  1RL2 A;  1O78 A;  4R4T A;  3T51 B;  2RDH A;  3QB3 A;  4L5S A;  2EY2 A;  1XNR L;  4HAE A;  2B8F A;  2Z8L A;  5CYU A;  2UUC L;  1VQG A;  3HOW B;  4A3L G;  3S1Q H;  1E2W A;  1WTH A;  4JW0 A;  4JG2 A;  1E7Z A;  3T1Y L;  4K2L A;  2UUA L;  4KJN A;  2YTX A;  4K2K A;  3GTM B;  3CAM A;  4B9X A;  1WTQ A;  3D3R A;  1BOS A;  1OXU A;  4PMC A;  4G7O C;  1LTL A;  1RTO A;  4V19 0;  3OSO A;  4M8A A;  2BH8 A;  2XRQ D;  4C3H H;  4A3E G;  1QZG A;  3TP8 A;  1TWH B;  3BDO A;  5IGF A;  3KYH C;  4X62 L;  2JA6 H;  2H5X A;  5C44 B;  1M4V A;  1IYJ B;  1X32 A;  1YHA A;  3ER0 A;  3OTO Q;  3DWQ A;  1OXT A;  3V2T A;  2NVQ H;  2KBN A;  3ZYY X;  4H7B A;  4DAY A;  3SK8 A;  5EGT A;  4H02 A;  3EA6 A;  2PW5 A;  2SNM A;  4RMF A;  3SK6 A;  1TS3 A;  1NMG A;  3HOX B;  1LM0 A;  2EOT A;  1CFM A;  3CRK C;  4KHP Q;  4U68 A;  3Q0A A;  3CPW A;  3GDE A;  3U58 A;  1TWA B;  3PMF A;  1SMX A;  4IUV A;  4ZRZ A;  3MFY A;  5JJZ A;  4GN5 A;  2IX3 A;  1RTN A;  2Q8I B;  5IYD G;  2I07 B;  1AZP A;  2R93 B;  3BG3 A;  4DR1 L;  2HQL A;  4DV2 Q;  3PUX A;  3GTP B;  3J7Y W;  3I4M H;  4JI0 Q;  4NXN Q;  1EQQ A;  3DUZ A;  3C1F A;  3RMH A;  1A8V A;  1YBY A;  5HGT A;  3T4A C;  1CA6 A;  3S15 H;  3G48 A;  2I5M X;  4IFD G;  3HOU G;  2F0I A;  1IYU A;  3NE5 B;  5FK9 C;  1VQI A;  2PQA A;  1VQP A;  4Y7N H;  3M7N A;  3MA2 B;  1JOO A;  1U4P A;  2WAQ B;  3E5S A;  3PIP A;  2MO1 A;  4BXX G;  1N36 Q;  1PTO B;  4A3G B;  1HH2 P;  4GOP C;  2DJF C;  2RVL A;  4NP5 A;  2B2U C;  5L37 A;  2A69 C;  4LFB Q;  3FKI G;  2ZJR A;  1I4H A;  5J22 A;  5CMD A;  1YIT A;  1JR0 D;  4V0B A;  1KDA A;  2L11 A;  3OTO L;  4QL5 A;  3NQI A;  1GXD C;  4XQQ A;  1FNW A;  4A3I H;  3VDY A;  2MGS A;  4A3F G;  1QNU A;  1UE6 A;  2CQO A;  4K5X A;  3J81 E;  1J6Q A;  2Q2I A;  4CGY B;  2R7D A;  4L5Q A;  1HZC A;  1K28 A;  2TSS A;  1D2B A;  3J81 L;  1T5X D;  4KHP L;  3PCO B;  4A75 A;  1YZ6 A;  1VDZ A;  1EYD A;  1UNS A;  2K03 A;  2DGY A;  2EXD A;  3JAM c;  3G6E A;  1SYB A;  4K5W A;  1SBB B;  4XTC S;  2RHS B;  3B6Y A;  2DY8 A;  4R9W A;  2D0O A;  3AEV A;  4DV2 L;  2NZ1 D;  4UP7 A;  3L0O A;  1Q1E A;  1AFP A;  1YI2 A;  3GD7 A;  5C3W A;  1N33 L;  2BA0 A;  4JI0 L;  4NXN L;  5IGG A;  1K83 B;  1K8A C;  2RDF A;  1LV9 A;  2UXB Q;  1ESR A;  1IYV A;  2AQ3 B;  1HR0 W;  1DM0 B;  2WV6 D;  4YCV A;  3D6W A;  3HKZ G;  1KL9 A;  4A3J G;  1A3V A;  2RDG A;  3NTI A;  2A73 B;  5G3L D;  3TP6 A; 
#chains in the Genus database with same CATH homology
 4X3S A;  1DZ1 A;  2NN6 G;  1X3Q A;  3NBH A;  5CV9 A;  2A6E C;  2F0G A;  2EJF C;  4JBW A;  3SEB A;  4OO1 H;  1Q1B A;  3SR1 A;  2SNS A;  4L6T B;  3P75 A;  3SHL A;  2B2V C;  3GQB A;  4IFD J;  1IW7 C;  1D5Z C;  1EWC A;  1WTV A;  1NCV A;  2LFN A;  4WJW A;  3WOF A;  3PO3 B;  3WOE A;  1TU2 B;  1JIC A;  4IUR A;  2AUK A;  5EKL A;  3DEP A;  1BO0 A;  4N9T A;  4A3M B;  2A69 D;  3GV3 A;  1WCM B;  3M4Y A;  2PPB C;  4PMB A;  1X3P A;  3OMC A;  2V4D A;  1RD9 D;  2EY5 A;  4RGT A;  3EFX D;  4C1N I;  4U67 3;  2WP8 J;  1U9R A;  1EFI D;  1BCP C;  1SNC A;  4EQP A;  3IFT A;  3IKJ A;  3H0G B;  2QF7 A;  1PFM A;  2F0N A;  2F3V A;  4QUF A;  4OIJ A;  5C3X A;  3VYU A;  2FJ2 A;  1SXT A;  2G9D A;  2Q8T A;  3PO2 B;  3MWY W;  2R3Z A;  2X69 A;  4XYO A;  4KV6 A;  1HA5 A;  3MXN A;  4KI0 A;  4LAA A;  4PNY A;  1JB3 A;  3S17 B;  1SYC A;  5D3D A;  2NVX B;  3SK5 A;  4FVM A;  1UAP A;  5CGK A;  5D65 A;  1SNM A;  3ITP A;  1XX8 A;  3H6M A;  2PYK A;  2EPB A;  2EZV A;  2X6L A;  5CV7 A;  1H9K A;  5IGC A;  1GHK A;  1CK1 A;  4CHT B;  1I4G A;  1I4P A;  2A6E D;  1D1K A;  3O13 A;  4CKB A;  5FKA C;  1ZEQ X;  5KRU A;  3D31 A;  1PYW D;  3G7L A;  1U4M A;  1EY7 A;  5K36 H;  5D14 A;  4CKC A;  1IW7 D;  1YNN C;  4XT3 B;  4DGZ A;  5CV6 A;  1NR4 A;  1SE2 A;  3H91 A;  3HOZ B;  4ZUI A;  2SEB D;  1LT4 D;  1JOR A;  4P2C B;  2BCO A;  5CV8 A;  4ZYS A;  2K32 A;  4FO2 A;  5KNC A;  3MVV A;  1LTA D;  1SE4 A;  2EJM A;  2F0P A;  3HG9 A;  3HRZ C;  4KKS A;  2EJG C;  2DN8 A;  2JEA I;  1QWY A;  3RZO B;  1Z7T A;  4KN7 C;  1M8A A;  2JSO A;  1K8M A;  2K28 A;  1O7L A;  1S5F D;  2JA7 B;  1F2M A;  1Y1W B;  4BA1 I;  4DFA A;  4IQZ A;  4CBV A;  1TY0 A;  1R4P B;  1BCP D;  1I6H B;  4DXF A;  4DN4 M;  2D62 A;  3RUZ A;  3C46 A;  3MXU A;  1KLG D;  1HPC A;  1TY2 A;  2XVS A;  4QCL A;  3KLR A;  2E2H B;  2IW3 A;  4CJ2 C;  2B2Y A;  1FGB D;  5C4X B;  4DK1 A;  3K5L A;  1VMP A;  4B9W A;  2JXM B;  2RSO A;  2EYO A;  3S14 B;  1MSH A;  5ELD A;  4H44 C;  4C3I B;  1BBX C;  2VB3 X;  1TT2 A;  2NTT A;  1BUV T;  3OMG A;  3A8I E;  3BDL A;  2L5T A;  4K5V A;  3GTQ B;  4L63 B;  2WIN B;  1WTO A;  5EBD A;  3R3O A;  4AYB B;  2LY7 A;  3CRL C;  2F0D A;  4X3U A;  2VNU D;  1STB A;  1KDC A;  1JOQ A;  1E2V A;  5IOD A;  2EY6 A;  2A6H C;  2M9V A;  4K14 A;  4KKU A;  2C9O A;  2BDO A;  4F7X A;  5EKK A;  2KCC A;  5EQ0 A;  2A5H A;  2NB0 A;  1S5E D;  1LLR D;  1YNN D;  1HQM C;  4RHR A;  1KTK A;  1KLU D;  3HZX A;  3SDZ A;  3PIO 3;  4G7Z C;  3Q22 A;  4H13 C;  2ICI A;  1RHP A;  2AWN A;  3GO5 A;  3H09 A;  2CHB D;  3FMC A;  3ONA B;  2K7V A;  2Y0S B;  2RQX A;  1NSN S;  5K5P A;  3PUZ A;  2K05 A;  4YIJ A;  4HCS A;  5C3E B;  1ZYR C;  1Q3L A;  3OIQ A;  4IUN A;  3M3Y B;  4K6L A;  1H9S B;  2QCP X;  3DWA A;  1A6X A;  4RGM A;  3K0Y A;  2F0H A;  1B1Z A;  2J0T D;  4WOR A;  2EYM A;  2ZT9 C;  4HTH A;  4E6I A;  1CHP D;  4NKL A;  4ZAI A;  1ZKO A;  4A3K B;  4L8J A;  2EDG A;  2HCC A;  1ILP A;  2WB1 B;  1VCI A;  4N9P A;  3Q24 A;  2EYL A;  2IL8 A;  2LKV A;  1SFO B;  4FF1 A;  3MXP A;  3V96 A;  4QB4 A;  2L9H A;  2KQ3 A;  3LWU A;  3QWN A;  2EXZ A;  3S1R B;  1PZJ D;  3QOJ A;  2LS0 1;  1LTS D;  2NWG A;  4RFB A;  5IGB A;  2BA1 A;  3GP7 A;  1V1P B;  4KD4 A;  3PV0 A;  2Z4I A;  4GZY C;  1T5E A;  1YNJ C;  5C0X H;  1EIH A;  5KGU A;  1EZ8 A;  2PZT A;  5T1G A;  4F87 A;  2NTS A;  2EYF A;  4OHJ A;  4DNT B;  1JWU D;  1FNV A;  2F0T A;  1EL0 A;  1CZG A;  2XSC A;  1MGS A;  3NQT A;  2SDF A;  1B9N A;  1H9R A;  5EPL A;  1DXM A;  4KTA A;  1II3 A;  3TZU A;  1V1O A;  1STN A;  1KAA A;  3F2U A;  1DOM A;  1NUC A;  3KLS A;  3R2I A;  1ESF A;  3PUV A;  2I46 A;  1B50 A;  1JE4 A;  3NWT A;  1DON A;  3SXH A;  2F0K A;  1DJR D;  2NN6 I;  2K6A A;  3S9W A;  1ZYR D;  1EOT A;  3VR6 A;  3AMU A;  3MC0 B;  3E6Z X;  3JAM E;  5ELB A;  1PZI D;  1TVX A;  2K1B A;  3JAM L;  2B2W C;  1LAC A;  5DEH A;  3N52 A;  1SJH D;  2WAC A;  1I4X A;  4KD3 A;  4DK0 A;  2WKC A;  5COR A;  1J9O A;  1KAB A;  3T16 A;  3RLF A;  1ROD A;  1I50 B;  1PRT B;  1GOZ A;  2F3W A;  2F03 A;  3MTS A;  1F2Z A;  4BS9 A;  2X6G A;  5JVG 3;  2BE5 C;  2DNC A;  4ZKB B;  2F0V A;  4A93 B;  2MJ8 A;  2B2T A;  5M3F B;  3HS0 C;  4HSP A;  1O80 A;  1SE3 A;  1NR2 A;  4OL7 A;  5EJW A;  2F0O A;  1YNJ D;  4FF4 A;  4G7H C;  5IGE A;  3VR4 A;  3HOV B;  3E0J A;  2F0E A;  2PZW A;  4MIU A;  2H4O A;  3J80 E;  4C3H G;  4F8M A;  1FNU A;  2F4I A;  4ZQ3 A;  5C5M A;  1CA5 A;  1R4Q B;  1FR3 A;  3KBX A;  1HTL D;  3VYR A;  3MAQ A;  3RZD B;  1Z6H A;  5FLX E;  4C2M B;  1E0B A;  2RBM A;  4EQO A;  1HFG A;  4S3S A;  1WVL A;  5FLX L;  1SYD A;  2OF1 A;  2CVR A;  3OPO A;  3U9O A;  3D6C A;  4OO1 I;  5D3I B;  1SND A;  2A74 C;  4QUC A;  2PCF B;  4K6D A;  1EIG A;  3W2D A;  2O2L D;  1ENF A;  4A3E B;  4LMQ D;  5FO7 B;  5JEA H;  3S1M B;  1HUN A;  1VF7 A;  3SK4 A;  1SAP A;  5LHY 1;  4XQJ A;  3A54 A;  5FO8 B;  3DEO A;  3IL8 A;  3R8B A;  1RCV D;  4IZ8 A;  3NXW A;  1KDB A;  4KN4 C;  3Q6S A;  1DCZ A;  2F0Q A;  2J7Z A;  4J1M A;  1JWM D;  1EYA A;  5E1F A;  3A8J E;  1OXV A;  3KLS X;  1HUM A;  1GJX A;  2E2I B;  3C2P A;  5KNB A;  1QB5 D;  3L3O C;  4UAI A;  1B53 A;  1KNE A;  5KYL A;  2E2J B;  2K5D A;  1G6Z A;  3GTG B;  1TWC B;  2FIN B;  1AN8 A;  4ZK9 B;  3HOU B;  4X3K A;  2C5C A;  4CJ1 B;  2IT1 A;  3G6J B;  3GTL B;  3SVM A;  5KIX A;  1B3A A;  1STH A;  2QDB A;  4X3T A;  4C1N K;  1F9Q A;  2IX1 A;  3DWP A;  3IAY A;  2MHV A;  1G29 1;  1BNZ A;  3BVG A;  1Y8O B;  3PUY A;  1STA A;  3FKI B;  2CW0 C;  4RAU C;  4KJO A;  3BZD B;  3K5O A;  1DYQ A;  2KEE A;  3DMU A;  1JOK A;  4CKE A;  1TR5 A;  4C3I G;  4A3F B;  1SMY C;  5EKI A;  2MP1 A;  2F0S A;  3S2H B;  5I6W A;  2HCI A;  1B44 D;  5A2Q E;  4NDX A;  5JEA G;  2EYH A;  3HEJ A;  2KJX A;  4IUP A;  5E4X A;  3X3N A;  4XQN A;  2B2Y C;  5A2Q L;  3R2T A;  3CU7 A;  1ENC A;  1DOK A;  4CJ0 B;  4DA2 A;  4OO1 G;  2RSN A;  3OW7 A;  4EGV A;  4XT1 B;  4C3J G;  5KND A;  1GHJ A;  1I4R A;  3TDQ A;  1PMR A;  1EY0 A;  1S5C D;  3OHX C;  1TKW B;  2E75 C;  3C3L A;  2KVM A;  4A3J B;  5J1Z A;  2L4N A;  3FPP A;  2F0U A;  2Z4H A;  1MBY A;  1SJE D;  1TS5 A;  1JCK B;  1JQY D;  1EY8 A;  1S5D D;  4J8Q A;  3HOY B;  3UI2 A;  1EWH A;  1LT5 D;  1AEX A;  1GUG A;  5LL6 X;  4Y7N B;  1EY4 A;  2NUC A;  3I3C A;  2K5Q A;  1K8O A;  4EQN A;  1G8Z D;  3PUW A;  5DM6 3;  3S1N B;  5KEE A;  5DAU A;  4QF4 A;  1IHZ A;  1H9S A;  1LO5 D;  4HMJ A;  4Z9C B;  1A3T A;  2KHS A;  2PW7 A;  3K7A B;  2IWH A;  2PNR C;  3OIP A;  4R8I A;  4RHS A;  4M1U B;  5C4H A;  5COY A;  4XIG S;  2JA5 B;  4PV1 C;  1A15 A;  3EQL C;  1RF2 D;  4Q5V A;  3M4O B;  3MHB A;  2WII B;  2JA8 B;  1QOH A;  1L0Y B;  4B08 A;  3TBI B;  5BN4 A;  1SMY D;  1PXU A;  5JEA J;  1IKL A;  3AB9 A;  4PMW A;  5I9O A;  4MN3 A;  5M5Y B;  2GA4 B;  1C8C A;  1WTW A;  1ET6 A;  2ZXP A;  2ID0 A;  5C4J B;  3FEW X;  1J8I A;  4HR7 B;  3I4N B;  1PTO H;  2JE6 I;  1V1P A;  1PDQ A;  5EPK A;  1CQF A;  2AWO A;  1BQQ T;  5K36 G;  2DNE A;  3KF8 A;  1PTO C;  5KYI A;  4QMG A;  2YU9 B;  3N6R A;  3P1H A;  1XWE A;  1F9P A;  2PMZ B;  2HUG A;  1TWG B;  4XDX A;  4KY6 A;  2L0C A;  3BYT B;  2DY7 A;  4KMU C;  1PRT F;  1C4Q A;  5I2Y A;  3FVQ A;  3C1E A;  4RCN A;  3MXG A;  3CQZ B;  5C5L A;  1EZ6 A;  1HTP A;  3LNN A;  5JPN C;  2KOL A;  2F0L A;  4IAL A;  4XYQ A;  3VR2 A;  1PTO F;  4TRD A;  3MFG A;  3VYT A;  4FYD A;  5LL6 S;  2M2L A;  1W6J A;  4BA2 I;  4I65 A;  4IUU A;  1F2Y A;  5E4W C;  4DAV A;  3NHH A;  5ELC A;  5CC4 A;  1TS4 A;  3GTJ B;  1I3Q B;  3J7A V;  1STG A;  2NVY B;  1I4Q A;  4BBS B;  1LT3 D;  1G2S A;  1BCP B;  3QG1 A;  3A56 A;  2EYJ A;  1PZK D;  4RKL A;  2F0M A;  2OEO A;  2B63 B;  5C0X I;  4WFN 3;  3VA7 A;  4EVO A;  2JYO A;  1BDO A;  5C4Z A;  2R92 B;  2QEJ C;  5F2D A;  3L7Z C;  1D5M C;  1Q8I A;  1HA6 A;  1AP0 A;  3A8K E;  4KKT A;  1QJO A;  4FXK C;  3D8G A;  4RWS C;  3NTH A;  4ILW A;  2L1B A;  2N88 A;  2B2T C;  2VXW A;  3EJI A;  2A6H D;  3J7A F;  2EVB A;  4IFD H;  4A3D B;  1CTM A;  5CBA E;  1A2U A;  4RKB A;  2VUM B;  4HMI A;  3KK7 A;  1SNQ A;  1G2T A;  3I70 A;  4K8J A;  4TQU S;  2B8G A;  4KK7 A;  1SDF A;  2LMC B;  1PFB A;  2MPM A;  2FHT A;  4HSV A;  1ML0 D;  2RA4 A;  4UDU C;  1GUT A;  5JVH 3;  1EEI D;  2F0F A;  5IT9 E;  4FF3 A;  5BN5 A;  1S4Z A;  1ZXT A;  2K33 A;  2R61 A;  5IT9 L;  4ODG A;  3TZD A;  3NUC A;  4RGN A;  1HHV A;  4BBR B;  1LTT D;  4IUQ A;  1F2L A;  1TQO A;  3OWE B;  2XNA C;  2MUY A;  1Z47 A;  2G9H D;  3DM1 A;  1OXS C;  3BDC A;  1F9R A;  5EPJ A;  1EU4 A;  1U4L A;  3ERO A;  3FRP B;  2EYP A;  1WD0 A;  2XRS D;  2F0J A;  2L12 A;  5FOB B;  2CQA A;  3VYS A;  1F77 A;  1STY A;  2A68 C;  1B4O A;  1EU3 A;  1BR9 A;  2NN6 H;  5AFW A;  5C0X G;  1CT1 D;  1ILQ A;  1RJT A;  1QG7 A;  1H9M A;  1LT6 D;  2O5I C;  2O4X A;  4IN3 A;  3TP5 A;  4F88 A;  3K5N A;  5M5W B;  1KNA A;  5ELE A;  3WDN A;  1LTG D;  1R9T B;  2M00 A;  1UEA B;  3IFD A;  3FDT A;  5G3L F;  3KUP A;  2R6G A;  1HRJ A;  1HXY D;  3D4R A;  4O42 A;  5NUC A;  2KCN A;  3J80 L;  1OXX K;  1FYC A;  1Q90 A;  1MSG A;  2PO4 A;  3VR5 A;  4DU9 A;  3EVQ A;  1QE6 A;  3NBI A;  1G91 A;  1Y69 U;  5E3F A;  1O7Z A;  1PFN A;  1EYC A;  2HDM A;  3NTK A;  1DOL A;  1D5X C;  2Q8R E;  3ERQ A;  4IUT A;  4HED A;  5M9O A;  3V05 A;  5I2X A;  2OT2 A;  1GUO A;  2ICE C;  1V43 A;  1W6K A;  5DNF A;  5EBC A;  3KBG A;  5IIF A;  2XWB B;  2E76 C;  1QIL A;  2AQ2 B;  2B2W A;  3LX0 A;  5HUR A;  1QCB D;  2F1M A;  1EEF D;  1H9J A;  3BVM A;  1B9M A;  1CHQ D;  4MHE A;  1TWF B;  4BY7 B;  5I6Y A;  2BE5 D;  2BDN A;  3D4D A;  2A68 D;  4KHZ A;  5C0X J;  1D6E C;  2R7Z B;  1AZQ A;  1HCZ A;  4J6H A;  3P7J A;  5I4D A;  3HGB A;  1C48 A;  1U4R A;  2D2C C;  2B2U A;  3CHB D;  3P20 A;  4XXE A;  3GV6 A;  1VF5 C;  1GUN A;  3I90 A;  2JEB I;  3QO2 A;  2O5J C;  1WTR A;  4KHV A;  1SYF A;  3QIA A;  3HP3 A;  1WD1 A;  2NVT B;  1IKM A;  3BYY B;  1DD2 A;  2OXP A;  2XIW A;  5DM7 3;  3S1Q B;  4ID6 A;  2KA7 A;  4FNF A;  4OIK A;  1XTC D;  2VB2 X;  2K5W A;  3NP8 A;  4HCE A;  4O1N A;  3VA5 A;  1LTR D;  2ZXO A;  2FMC A;  1PLF A;  4C3H B;  3K5M A;  2JA6 B;  1SYE A;  2K04 A;  4BWG B;  1IL8 A;  5I9P A;  2KED A;  2NVQ B;  4KY7 A;  4OGQ C;  3MZ5 A;  2L55 A;  3I73 A;  2AQ1 B;  2WKD A;  1XYI A;  1EQT A;  3TSS A;  3T56 B;  1CQV A;  1SNP A;  2NBF A;  5CBE E;  3MEH A;  3M7G A;  2EE1 A;  3NPP A;  1ET9 A;  1WTP A;  3S2D B;  2QIL A;  3TME A;  2JP1 A;  3HKZ B;  1BCP F;  1BF4 A;  5CR3 A;  3URY A;  2B2V A;  1Y8N B;  1D1I A;  2PQE A;  1E2Z A;  2RKS A;  1TS2 A;  2ZXR A;  5C6A A;  5JPM C;  3NK9 A;  2K01 A;  2ENB A;  3I4M B;  1I6V C;  3R93 A;  1CM9 A;  3I8Z A;  2YYZ A;  3S15 B;  4RCO A;  4ZKC B;  1LTB D;  1UUP A;  3I4L A;  1WTX A;  2BOS A;  4FXG C;  1EY6 A;  1ONL A;  4DNR B;  1CI3 M;  3L9A X;  4ZLT F;  3QJY A;  2KUM A;  3A55 A;  4I7Z C;  1HQR D;  2H1E A;  4ABN A;  1BXT A;  1LTI D;  1B2T A;  1JWS D;  5FO9 B;  1CZW A;  2D5D A;  2B39 A;  2CW0 D;  4A3I B;  3K58 A;  1JC7 A;  3W3A A;  2IJ0 A;  1SNO A;  4FF2 A;  5T1I A;  4PQX A;  1ICW A;  4QIW B;  1EY5 A;  1EY9 A;  4LK1 C;  1Q12 A;  1F9S A;  4NW2 A;  1PRT C;  5TSS A;  1SEB D;  3FPU B;  3U9S A;  1EQV A;  2N55 A;  1GUS A;  5A35 A;  3A7A B;  1SYG A;  5IGD A;  2FMM A;  5BN3 A;  1OO9 B;  4LJZ C;  5IOC A;  3T13 A;  2KEC A;  4C56 C;  2Z1C A;  2EY1 A;  3PIP 3;  4WRD A;  1Y1V B;  2D9U A;  1A3U A;  4RGO S;  3RD4 A;  4RA8 A;  5ISR A;  5CV4 A;  5JOB A;  4C3J B;  1V8Q A;  3GTO B;  3GTK B;  1A2T A;  3D4W A;  4G57 A;  4NMZ A;  4ZUJ A;  4R8N A;  1GUW A;  1O7Y A;  3TP7 A;  4G4K A;  1HFN A;  3BS1 A;  1NAP A;  4BY1 B;  1XXG A;  1RDP D;  4ME5 A;  2TMP A;  3CKI B;  4JK1 C;  3I91 A;  2NYZ D;  1STE A;  2F0W A;  3DHQ A;  2SOB A;  4KY5 A;  3M85 A;  2XWJ B;  3OWF A;  4TKO B;  1ENA A;  1FD7 D;  3S16 B;  3NSW A;  4ULL A;  5CV5 A;  2QKI C;  3BVZ A;  3A7L A;  4H0L C;  3VR3 A;  3X3M A;  2PZU A;  3LWE A;  5JAV A;  3ND8 A;  1MD2 D;  3K57 A;  1QNK A;  2E2D C;  2HDL A;  1VMC A;  2E74 C;  1RKN A;  2IX0 A;  2J4X A;  4K8I A;  4IFD I;  1Y8P B;  4FXD A;  4FP5 D;  3ND9 A;  1MI2 A;  4TSS A;  4HN7 A;  1SSO A;  3T53 B;  3Q23 A;  3K59 A;  3OOC A;  3TN2 A;  5M3M B;  2IPK D;  1PRT D;  1AW7 A;  2HQE A;  3QOL A;  5ELF A;  2AUJ D;  3AU7 A;  4Q0F A;  1LAB A;  3H3V C;  3DXJ C;  5M5X B;  1S5B D;  4DXG A;  5J39 A;  1TII D;  3NWS A;  3H94 A;  1PTO D;  2XN9 C;  3SE0 A;  2FFK B;  4DF7 A;  4RH6 A;  3K6O A;  1L0X B;  4A3B B;  3I72 A;  4DAP A;  1O78 A;  3T51 B;  2RDH A;  3QB3 A;  2EY2 A;  4HAE A;  2B8F A;  2Z8L A;  5CYU A;  3HOW B;  1E2W A;  4K2L A;  4KJN A;  4K2K A;  3GTM B;  4B9X A;  1WTQ A;  3D3R A;  1BOS A;  1OXU A;  4PMC A;  4G7O C;  1RTO A;  4V19 0;  3OSO A;  4M8A A;  2XRQ D;  3TP8 A;  1TWH B;  3BDO A;  5IGF A;  5C44 B;  1M4V A;  1X32 A;  3DWQ A;  1OXT A;  3V2T A;  3ZYY X;  4H7B A;  4DAY A;  3SK8 A;  5EGT A;  3EA6 A;  2PW5 A;  2SNM A;  3SK6 A;  1TS3 A;  3HOX B;  2EOT A;  1CFM A;  3CRK C;  4U68 A;  3Q0A A;  1TWA B;  3PMF A;  4IUV A;  4ZRZ A;  3MFY A;  5JJZ A;  2IX3 A;  1RTN A;  2Q8I B;  2I07 B;  1AZP A;  2R93 B;  3BG3 A;  3PUX A;  3GTP B;  3J7Y W;  3DUZ A;  3C1F A;  3RMH A;  5HGT A;  3T4A C;  1CA6 A;  4IFD G;  2F0I A;  1IYU A;  3NE5 B;  5FK9 C;  3M7N A;  3MA2 B;  1JOO A;  1U4P A;  2WAQ B;  3E5S A;  1PTO B;  4A3G B;  2RVL A;  4NP5 A;  2B2U C;  2A69 C;  1I4H A;  5J22 A;  5CMD A;  1JR0 D;  4V0B A;  1KDA A;  2L11 A;  3NQI A;  1GXD C;  4XQQ A;  1FNW A;  2MGS A;  1QNU A;  4K5X A;  3J81 E;  4CGY B;  2TSS A;  1D2B A;  3J81 L;  1T5X D;  1VDZ A;  1EYD A;  1UNS A;  2K03 A;  1SYB A;  4K5W A;  1SBB B;  4XTC S;  2DY8 A;  4R9W A;  2NZ1 D;  1AFP A;  1Q1E A;  3GD7 A;  5C3W A;  2BA0 A;  5IGG A;  1K83 B;  2RDF A;  1LV9 A;  1ESR A;  1IYV A;  2AQ3 B;  1DM0 B;  2WV6 D;  3D6W A;  1A3V A;  2RDG A;  3NTI A;  2A73 B;  5G3L D;  3TP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...