4E6IA

Crystal structure of staphylococcal nuclease variant nviaga v99g at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
123
Chain Sequence
LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMGNEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Local flexibility as a determinant of pKa values of surface ionizable groups in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 123
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4e6iA00
4LAAA 3C1FA 2WACA 5E3FA 5KRUA 4KD4A 2PYKA 2SOBA 4ZUIA 3BDLA 4B9WA 4KY7A 4K5XA 2F0PA 2OEOA 2PW5A 3BDCA 5CV8A 5C6AA 3NP8A 2PQEA 5DEHA 3OMGA 1SYCA 3RUZA 2F3WA 1EY7A 3HEJA 3SK8A 3SR1A 4K8JA 4TRDA 4QF4A 4NP5A 5E1FA 4QMGA 4KJOA 4IZ8A 2RKSA 4OL7A 3C1EA 3DMUA 4K8IA 5IIFA 3MXPA 4EVOA 1KDAA 5IODA 3VA5A 1EY5A 3MHBA 4K5WA 1U9RA 2EY2A 4ZQ3A 1II3A 3ITPA 5F2DA 5IGFA 1EZ8A 3QB3A 4ODGA 2F0NA 1EYAA 1KAAA 2F0HA 3T13A 2F0FA 4DF7A 3MEHA 5K5PA 4KJNA 3PMFA 4NMZA 4YIJA 4J6HA 1SNMA 1STHA 3SXHA 1STBA 4PMCA 3SK5A 5I9OA 2EYOA 5C4ZA 5HURA 1SNPA 2PZWA 5IGEA 5KIXA 3P1HA 4KY5A 5EKLA 4NKLA 5I6YA 1STGA 1A2UA 1EY0A 5DAUA 5M9OA 3EVQA 4PMBA 2SNMA 3TP8A 4IUNA 5EGTA 4H7BA 2F0MA 1IHZA 2F0EA 2KHSA 4K6DA 4KD3A 2F0TA 3OWFA 4NDXA 1JOKA 5C5LA 4DU9A 4S3SA 3TP7A 5IGBA 2HQEA 4DGZA 1SYBA 1A3VA 3P75A 4ZUJA 1STAA 2M00A 3OMCA 2F0VA 1A3TA 2OXPA 4KV6A 5CV4A 4ID6A 4K14A 1EYCA 5CV9A 4MIUA 5KGUA 3MVVA 5ISRA 3V2TA 3D4DA 4F7XA 1ENCA 1STYA 3U9OA 1KDCA 5J22A 1TR5A 3ERQA 4K2LA 2EYPA 1EZ6A 1ENAA 2F0JA 2KQ3A 2NUCA 4RKLA 5JOBA 4EQOA 1TQOA 2EXZA 2EY1A 2F0GA 2F3VA 2RDFA 4EQNA 4HTHA 5I9PA 2PZUA 1EY4A 4R8NA 4IALA 5CC4A 1JORA 3NXWA 1SYDA 2EYHA 3SK6A 2ENBA 4WRDA 5C5MA 1RKNA 3QOLA 4I65A 1STNA 2EYLA 4K5VA 5NUCA 1SNDA 3NK9A 2F0SA 1EY8A 3EJIA 4N9PA 2F0LA 1F2YA 1KDBA 2O4XA 2RBMA 3R3OA 4G57A 4HMIA 4DFAA 5KEEA 1SNQA 5J1ZA 5IGDA 2SNSA 4EQPA 4PNYA 2F0DA 5CV6A 4N9TA 2F0IA 2OF1A 4RKBA 1AEXA 1SYGA 2PZTA 5CV7A 3TMEA 1A2TA 4KY6A 2EYMA 1F2ZA 1SYFA 2EYJA 5C3XA 2EY5A 3HZXA 3QOJA 3S9WA 4WORA 3SHLA 1JOQA 3TP5A 1NSNS 1SNCA 2F0KA 2F0UA 2F0WA 3NUCA 3NHHA 2EY6A 1NUCA 5CGKA 1TT2A 3MZ5A 3T16A 5IGCA 5CV5A 5KYIA 2F0QA 5CR3A 1EQVA 4F8MA 5KYLA 1EYDA 1F2MA 3E5SA 2PW7A 3EROA 1EY6A 3TP6A 5I6WA 3SK4A 1SYEA 3D4WA 3LX0A 3DHQA 3OSOA 4ME5A 4QB4A 2QDBA 5C4HA 5IOCA 2F0OA 2LKVA 4HMJA 4B9XA 5JAVA 1EY9A 5IGGA 4KTAA 1KABA 3D8GA 4J1MA 3D6CA 4KHVA 5C3WA 5EKKA 4K2KA 1A3UA 1JOOA 3NQTA 3H6MA 4E6IA 2EYFA 5HGTA 5J39A 1SNOA
chains in the Genus database with same CATH superfamily
1TS3A 2B63H 5IYBH 4MNOA 4IUVA 2J0TD 3ZYYX 4EQ5A 1BXTA 3NP8A 1SYCA 2G5DA 3KBXA 5EQ0A 1QUQA 3TDQA 4DK3C 2D62A 1Z7TA 1WTOA 3W1BA 1I3QH 3C1EA 3VR6A 4YHHQ 1OO9B 4G7ZC 3CP0A 2ZTCA 2KHIA 3TRZA 1Z6HA 3CXCA 3PUWA 1TKWB 1PFMA 4NXMQ 5F2DA 3W5OA 1G51A 2BCOA 2CHBD 1DM0B 4J6HA 1N32Q 1A8VA 1LT5D 2HQLA 1PH5A 5IY0A 1PH9A 2A73B 4A3KB 1X56A 4NKLA 1SSOA 1X54A 4OEMB 1HCZA 5A2QE 5CYUA 4FNFA 2E2HH 4KD3A 3R93A 3T1YL 3KJOA 2DNCA 3R8BA 3CCEA 1C7YA 4MTKA 3HOWB 3TZUA 5IT9L 1LTAD 1E2WA 1VF7A 3UI2A 3HKZE 3GTPH 3I91A 1FL0A 1HA5A 1JQYD 5J22A 1PTOC 2PMZB 4RKLA 2TMPA 2KQ3A 2Z4HA 2NWGA 2EVBA 2CH4A 2EY1A 4PZ8A 2QEJC 5I2YA 3RN5A 1TY0A 3R2TA 1SJED 2CWAA 2R92H 4JI7L 1QVFA 4OGQC 3ICEA 4HMIA 2F52A 5KEEA 4C1NK 3OW2A 1IW7C 1N36Q 2R7ZB 1AH9A 4QJFA 2PNRC 3MC0B 1R4PB 1VQ7A 1F2ZA 3CF5A 3HZXA 1YNNC 2Q8TA 5CMDA 5FK9C 1YNXA 2IX0A 3K6OA 1L2FA 1EYDA 3NEMA 2PW7A 4G4KA 1XWEA 4X65L 3H09A 3KF6A 4RH6A 3RLNA 1HR0W 3A7AB 2F0OA 2Z6BA 3CCQA 2Z9HA 2RQXA 3S17B 3J7AF 2GN5A 4BY7G 3L3OC 1I3QB 4HSVA 2K75A 3VR4A 3HKZG 1O7YA 1F2LA 3IL8A 2A6HD 2ZM6Q 2PQEA 4AIMA 4AYBG 2DNEA 1CQFA 4CDDC 3HEJA 2IY5B 1TY2A 3GTQH 4QMGA 4LUVA 3JAMi 2NBFA 1XNRL 5IIFA 2KCCA 5I4DA 1VCIA 1EY5A 4RA8A 4LFCL 4R9WA 3FP9A 3HOZG 4AQYQ 4ODGA 5GAGC 1B3QA 2F0FA 1LABA 3G6EA 4LF6Q 4MHEA 4BY7H 3Q23A 3SK5A 3NBIA 3VYTA 1SNPA 1U5KA 1SAPA 1Q82C 1XMQQ 3PUXA 4JI4L 2NN6G 1JOKA 5JPNC 4K0KQ 2A19A 4FVMA 1IYVA 3VDYA 3AYHB 2L5TA 2XVSA 3KK7A 3HOZH 1EYCA 4L6TB 1PTOD 2YTYA 3OIPA 4RGMA 2AUKA 1ENCA 2R92B 2IJ0A 1A63A 1JICA 2PZUA 3NQIA 1R9TH 4PQXA 3CMAA 2CWPA 1T9HA 2ENBA 3PUYA 1I4GA 4LK1C 4IURA 1MD2D 3J80c 4QCLA 3E6ZX 4LF7L 1IW7D 4R4OA 2A8VA 1EY8A 2NN6H 2WINB 4N9PA 2H1EA 3HOYB 3K7UC 4WJWA 1SR3A 2A68C 3BVZA 2K5NA 1DONA 1YNND 2UU9Q 3Q8DA 3TEHB 1A2TA 1EOTA 2GA4B 2IX1A 3JAML 3RZDH 3I4NG 1B53A 1MIUA 4JW0A 4OIJA 3UE1A 4KLKA 5C44B 2B2TC 1GHJA 1S5ED 4A3FB 3A74A 2E75C 1AN8A 1IYJB 3G7LA 5IOCA 2BH8A 3TREA 3J81j 2JA9A 4RG1A 2R3ZA 1ILPA 3CC4A 4K2KA 4KMUC 1VQ6A 1HTLD 3A55A 4U68A 2SOBA 3QO2A 2HIVA 2WB1E 2M2LA 5LMNW 3I4NH 3H91A 1AE2A 2NVXB 3UDGA 3E9IA 2UXCL 1DYQA 3SR1A 2OQ0A 4ZAIA 4JI7Q 3C46A 3FPPA 2UUAL 1IBLL 3I70A 1TWAB 1ET9A 1CM9A 1RJTA 1MGSA 2GVAA 3PIO3 5IODA 3MHBA 4FDBA 5C0XJ 1WTHA 4XT3B 1KLUD 2OQKA 3DEOA 3S1MH 3SXHA 3DWAA 2VXWA 5DNFA 1TXYA 4LNQA 4X65Q 2EZVA 2KJXA 3J80E 5DAUA 5G3LF 1KXLA 3A5UA 3TP8A 1OXSC 1FVIA 4N8X1 2F0TA 3M7GA 5C5LA 2AQ2B 1JMCA 1FJGL 2CVRA 3DWPA 5CORA 1R9TB 5CV4A 2EXDA 5KNBA 1TWHB 2D9UA 2KEDA 1YITA 3S2HH 4JBKA 3D4RA 1G291 2JA7G 4L8JA 3TS0A 2B2UC 5JJIA 4DR7L 1XNRQ 5T1IA 1D7QA 3AB9A 3RZDB 5M5WB 3I3CA 4LFCQ 4P74A 3J7ZC 4ZYSA 4DFAA 3PIPA 2F0DA 3J7AV 1PH3A 2PQAB 1IKLA 3OPOA 3CQZH 3HFZB 2XWBB 1JOQA 2HHHL 1A0IA 2F0KA 5A35A 2EY6A 3CPFA 3K5NA 1OTCA 3M4PA 2JA7H 2KECA 4JI4Q 1TWFH 3NPPA 2BA1A 1NMFA 2MQHA 3TP6A 1F9PA 2A5HA 1SYEA 2VUMG 1I6VC 4RGOS 4O2DA 3QR8A 4J1MA 2WKDA 3K7AH 1VQDA 5HGTA 4HJ8A 2RVLA 3PF5A 1Q90A 2LS01 2FXQA 1J5EL 1GM5A 1X3GA 1Y69U 4Y7NH 1SN8A 4NB3A 1NAPA 1LUZA 2IL8A 2KVMA 1F9QA 1I4RA 3SK8A 4NP5A 4DNIA 1BR9A 1VQIA 5IP9G 4A3IB 1HZCA 1IL8A 5EJWA 3MXPA 2VUMH 4LMQD 3GTLH 1HNWQ 4FF2A 3VA5A 3W3AA 1STEA 1AFPA 1WYDA 2NVQH 2NZ1D 3MEHA 1HFNA 2FINB 3GV3A 3HGBA 3PO3G 1GD7A 2DY7A 5I9OA 5E4WC 2LY7A 3D6WA 3OW7A 5KIXA 4DR5L 1HRJA 4C3IG 1RDPD 5L37A 1STGA 1SMXA 4R1JA 2QF7A 2SNMA 4GN4B 1IHZA 5IP9H 4NDXA 3KBGA 2CW0C 1IBKL 3ND8A 4I7AA 4A3JG 3PUVA 4DV1L 2D2CC 2M00A 5D3DA 1YIJA 4LF9L 2NVYH 1D5MC 3A8JE 3LNNA 3PO3H 1RCVD 5IYCG 1Y1WB 2UXCQ 4DR1Q 4UPAA 5I9PA 2UUAQ 1C9OA 4JI0L 4C3IH 3ND9A 3U9SA 3NXWA 1X32A 1NMGA 1S5FD 3SK6A 3CQZB 1RKNA 4A76A 5FLMG 3RZOH 1TIID 5EPLA 2WB1B 1KRSA 4CJ1B 3Q0AA 4A3DB 1AZQA 2JA7B 5ELFA 4A3JH 1EEFD 2DUDA 1HZAA 1YI2A 1UAPA 3TMEA 1WI5A 4KY6A 3CRKC 4JG2A 2RCNA 2EY5A 3PO2G 2P5ZX 4WORA 4P72A 5IYCH 1TT2A 2F4VL 1ASZA 5DM73 4KN4C 4B3RL 1UEBA 2JSOA 1F2MA 5EPKA 4IOAA 1FJGQ 3SK4A 3DXJC 1U4RA 3I4LA 4CGYB 2E2JH 5FLMH 2OT2A 4GOPB 1QUQB 1EY9A 4RHSA 2EPBA 5DLQE 1VQJA 5AJ3Q 3I4OA 2ZXRA 3U58A 1UUPA 4KY7A 1UE5A 2VQEL 2G9DA 2VUMB 2XRSD 4QL5A 4HJ9A 3PO2H 1V43A 2EJFC 4DR7Q 2L4NA 4BBSB 4C56C 2XN9C 2NTSA 2KHJA 2L15A 2AKWB 3KLSA 3NELA 4O0AA 2K7VA 2WAQB 5C4JH 1T5EA 2PQAA 5IP7G 1VQKA 3W1GA 4ZQ3A 4IPDA 4DR4L 5GADC 1O7ZA 4F87A 2AWNA 3P20A 1EYAA 2AQ1B 4RGNA 2BA0A 3CRLC 1UWVA 1E22A 1BNZA 3G6JB 4LWCA 1QVCA 5C4ZA 1YHBA 1BCPB 1K83B 2JA6G 1XTCD 1XNQL 2B29A 2PO4A 1JWUD 2CW0D 3UDIA 2A74C 4JPBW 3AFQA 3PO3B 2KENA 2HT1A 4S3SA 1GKHA 4XQQA 1PHJA 1X65A 1CK1A 4XXEA 3A56A 5IP7H 2R7FA 2I5LX 1GVPA 3M4YA 2NN6I 4CBVA 4ID6A 4K14A 1JJCB 3J81c 3Q22A 1J5EQ 4JI8L 2K52A 4TKOB 5JPMC 5ELCA 4YWKA 1SE2A 2NVTB 4GNXA 3BU2A 2EYPA 2N88A 1PDQA 2F3VA 3FRPB 4DV3L 5FO8B 4A3MG 2JA6H 1J6QA 5CC4A 1W2BA 1EL0A 1E7ZA 2HD3A 4POFA 4CDFC 4HIKA 1UEAB 4MTNA 3EFXD 4DXGA 3JC66 4KK7A 5J1ZA 4HJAA 2B2YC 3KF6B 1Y8PB 5C4XB 3M4QA 1LTID 4JI6L 1UNSA 4L5TA 4C3HB 1EQTA 4A3GG 3DM3A 2ZTDA 3FKIB 5CR3A 1KLGD 3SEBA 4A3MH 2K5QA 4TSSA 4DV5L 1LV9A 1D5XC 3HKSA 2EQSA 3DHQA 1FNVA 3NBHA 4DV1Q 5JAVA 4KHVA 4CDCC 4TQUS 5M3MG 1HTPA 4P73A 5FO9B 4JV5L 2KBNA 3BG3A 2Z6KA 4LAAA 1B44D 1LLRD 2PYKA 3NE5B 4OWXB 5C4JB 4JI0Q 5DEHA 3V05A 4OX9L 2K5HA 2ZXOA 4MZ9A 5M5XB 3DWQA 4A93B 3EQLC 4K8JA 3RNUA 2JEBI 2VW9A 1LTSD 3A7LA 3DMUA 3GTGH 4ABNA 1TWCB 1F77A 3S14B 2MO0A 4DV7Q 1KAAA 4QUFA 5T1GA 4IO9A 2K04A 5M3MH 4GN5A 1XMOL 1OXVA 4LUZA 2F4VQ 4IFDG 2EYOA 1NCVA 1S40A 3GTKH 1CUKA 1PXUA 2KCTA 4CKCA 2UUCL 3ULPA 5I6YA 2UXBL 4GOPA 3S1RB 4DR3Q 2A6HC 4DKAC 3UE0A 1G2TA 4K6DA 4TVAB 4BY1G 5IGBA 2WIIB 1LTTD 3KLSX 4IJHA 1EWHA 3NSWA 4MN3A 1HZBA 1D8LA 2VQEQ 1JCKB 1PA6A 1Q8KA 4IPHA 1KDCA 4H0LC 1U4MA 2E5LL 4K2LA 2NUCA 1RTOA 4ME3A 1B3AA 4HTHA 4DR6L 1N33L 1JWMD 1MSGA 1H9SA 4K5VA 2BDOA 3E0JA 1BO0A 1HR0L 4GLAC 4BY1H 2O5IC 4U673 2I46A 3M85A 4CKEA 5IGDA 3IFTA 2UUBL 4JI2L 3C2PA 1SEBD 1U4PA 1LT6D 1XNQQ 4UP7A 3GTJH 4FF1A 5KYIA 4YWLA 4AYBE 1PRTF 4FF4A 3EROA 3KJPA 2K33A 1SDFA 1VF5C 2MP1A 3S2DB 2B2WA 1L0XB 1BKBA 5IGGA 5KNDA 4H44C 1IBMQ 5C3WA 4A3EG 1P8LA 4E6IA 3NQTA 4QUCA 1S5BD 2EYFA 4YY3L 4IPGA 3PF4A 3OWEB 4HJ5A 1GHKA 3PIOA 2MGSA 4YCUA 1N8RC 2K14A 4DV3Q 1OXXK 1CI3M 1FGBD 4LFBQ 2F3WA 1HNXL 1KHIA 2HDLA 2L55A 5M3MB 3F1ZA 2B63B 2Y0SB 4DK1A 1W6KA 1D2BA 4DK6C 1YJ9A 1ICFB 1VQFA 2XIWA 3VYRA 2Q2TA 1KDAA 1R4QB 4H13C 1II3A 3URYA 1WTWA 2I5HA 1ILQA 4ILWA 1STHA 2ZJPA 5EBDA 1FD7D 1PFBA 3L0OA 1C8CA 1WOCA 5IGEA 3I55A 1U0LA 1WFQA 4X3SA 5EKLA 3DM1A 3GP7A 1PYSB 3GO5A 3DLLA 4PV1C 4DV5Q 1H9KA 3G71A 5EGTA 1DOKA 3CCUA 3OWFA 3TP7A 3ERSX 4JV5Q 1A3VA 4L5QA 4LF8L 1C0AA 5GQOA 1NTGA 4B3TL 1V1QA 3MVVA 4GN3B 1ZYRD 4JOIA 1STYA 1SXTA 2E2HB 1KIXA 4GOPC 1JB3A 3BVGA 1QNKA 1FNWA 1TQOA 2F0GA 4NW2A 4EGVA 1WTXA 3M3YH 3UDFA 3TBIB 3WOFA 1XX8A 3GTPB 1GO3E 4DV2L 3M9BA 3K81C 2YTVA 3GTJB 2AWOA 1XMOQ 1L0WA 1B9NA 2F3IA 2NTTA 2QCPX 1V9PA 1BBUA 1E2ZA 2EYMA 2UUCQ 2UXBQ 1EU4A 2F0UA 5LMNL 2FFKB 3FDTA 4KHZA 2X69A 3H0GG 4PZ7A 1TVXA 2K1BA 3QIAA 4DV0L 4BBRG 2XWJB 2UXDL 1O80A 1QWYA 1JWSD 4A3LG 2H4OA 1BCPC 1TS2A 1K3BC 3GTOH 3T1HL 3R3OA 3U50C 5BN3A 3OYYA 1JR0D 3K58A 4NXNL 1NJIC 4V190 4APVA 2AUJD 4O1NA 3FPUB 5C6AA 2B3GA 3OMGA 4M1UB 4O42A 1N33Q 4FO2A 3H0GH 2B2WC 3G4SA 3T1YQ 4IUUA 1LTLA 4BBRH 3L2PA 4ULLA 1SE3A 1NY4A 5H1SE 1IXRA 3MA2B 5IE8A 2UUBQ 4A3LH 2WP8J 4OHJA 1VQBA 4AH6A 3QB3A 2LMCB 3GTQB 3MFYA 4Z9CB 1WD1A 1QG7A 2BOSA 1G6PA 1HPCA 1D1KA 3PQIA 2PZWA 1VQAA 1DJRD 5GROA 2I5MX 2G9HD 2RCFA 4FP5D 4DAMA 2EE1A 2F0EA 4BY7B 1SE4A 2K5VA 1A15A 1QNUA 2KEEA 1DGSA 3PGZA 1ASYA 3HKZB 4YY3Q 1BDOA 2F0VA 2OXPA 4AYBB 4LJZC 1VQEA 4G7OC 1PH4A 3TN2A 4K6LA 4DXFA 1M90C 1HNXQ 4GKKL 5M5YH 2RHSB 4DV4L 5A2QL 3HOZB 1Z9FA 4UHVA 4I65A 5AFWA 1PH2A 3EJIA 3T53B 1I50H 2K4KA 3BYYB 3CCSA 1EOVA 1BOSA 1FNUA 3TSSA 2OF1A 1AW7A 1K9MC 1ONLA 3HG9A 3X3NA 1PYBA 3OTOL 4G7HC 1YNJC 3VYUA 2BDNA 1PTOH 3CKIB 2QILA 5CV5A 1PV4A 3A8KE 5IWAL 4DNRB 4XQNA 3E5SA 1PH6A 1BQQT 1BCPD 5I6WA 2QDBA 3HS0C 1GUGA 1FR3A 4XDXA 4R8IA 1G91A 4LF8Q 3DUZA 5EKKA 4KKSA 4X3TA 1VQOA 3H6MA 4GKJL 5FLXc 2WACA 4BBRB 1IYUA 2ZT9C 5GAEC 4K5XA 1V1PB 3S1QH 2PW5A 1YJNA 1S5CD 1E0BA 1WCMG 1EY7A 4JI5L 3BDOA 1W3SA 3BZCA 4KJOA 4DV2Q 1JJ2A 5E7NA 1DCZA 5D65A 1HH2P 1KRTA 3I4NB 3CHBD 1PH8A 2JQOA 2QGQA 4K5WA 1B9MA 2VB2X 1VQ8A 1ESFA 5JJKA 1I4XA 3PMFA 4RMFA 3Q6SA 4GLVB 4NPSA 1GUSA 1LYLA 1STBA 4PMCA 2K32A 2TSSA 3P1HA 4IUPA 1WCMH 1NR2A 5M3FG 3C3LA 3WOEA 3K57A 4LF7Q 3MXNA 4IFDI 1E2VA 4GNXB 4PMBA 1OXUA 3S1MB 4HEDA 1V8QA 3T1HQ 2XSCA 3CPWA 2R93G 2RHQB 3O13A 4PZ6A 1W6JA 4NXNQ 1VDZA 1JB7A 4J8QA 3D4DA 2RA4A 4ZKCB 4OWWB 1TWGH 5ELEA 5ELNA 1I50B 1LACA 1PZID 2K50A 2B2VA 5M3FH 2IHFA 5JVG3 2EYLA 3LWEA 4PG3A 4JYAL 1QJOA 2Q2UA 3S2HB 1XPRA 2Z1CA 3S1NH 2R93H 1HNZL 1LTGD 1EQRA 5FLXE 3F8TA 1GOZA 1YNJD 2Z0SA 1Y8OB 3NBHB 2N3SA 2WKCA 2YV5A 5LL6X 4DUYL 3SHLA 3TP5A 5CGKA 4EX5A 4HCEA 1HZ9A 1Z47A 1IBLQ 1I6HH 2J7ZA 4R4CA 1D6EC 1EY6A 2IW3A 3AFPA 1KAWA 2N8NA 4XYQA 3KF8A 5HGQA 4KKTA 2HCIA 2OTLA 4Y52H 3J80i 1BVSA 3K0YA 1EFID 1MBYA 1CA6A 1TWFB 4A4IA 3AU7A 4KD4A 1U4LA 3CU7A 4DV4Q 3BDCA 2CKZB 3J7A5 2KA7A 2R6GA 2E2IH 3HOVG 1PZJD 2JA8G 3K7AB 3FEWX 1VQGA 4C2MH 1ZEQX 2IHEA 4A3CG 1PMRA 1PTOF 1SRUA 1I5FA 1O78A 4Y7NB 2F0HA 3OTOQ 4CKBA 2VQFL 1JC7A 5IT9E 3S15H 4DAYB 1HA6A 5IWAQ 4P75A 4KY5A 3GTLB 3K5OA 1EWIA 2EDGA 2B8FA 2A6ED 3HOVH 1MSHA 2JA8H 1A2UA 1DXMA 2L9HA 5TSSA 2NVQB 5M9OA 3EVQA 3H3VI 4A3CH 2F0MA 2YU9H 4FF3A 4GKJQ 4YHHL 2E76C 1DOMA 4I7ZC 1STAA 5E4XA 4GLXA 1V1PA 1A3TA 1H9SB 1NNXA 5D14A 2HHHQ 3V2TA 3ERQA 1SJHD 3VR3A 4JI5Q 1CTMA 1PLFA 4A3BG 3ULLA 3I7FA 2EIFA 2JA5G 2RDFA 3S1NB 2R93B 2XRQD 3PIP3 3J80L 2KOLA 2NVYB 2VL6A 1E1OA 2VY3A 2PMZE 3L9AX 5NUCA 1EEID 1PZKD 2F0SA 5KNCA 2ICIA 1KDBA 2JJQA 2XGTA 1SNQA 4EQPA 4PNYA 4BA1I 1S4ZA 4F88A 4C3IB 1I6HB 2ZJQA 2PZTA 4L63B 1S5DD 3RZOB 1K8GA 1L0YB 1K28A 3JAMc 3S16H 5IGCA 1CKNB 3QWNA 4A3BH 4IUTA 1KTKA 1XPOA 2JA5H 1EUJA 1F9RA 4A3JB 4HIMA 2K05A 4A3KG 4R4IA 3GQBA 1O7LA 1YBYA 2HCCA 1MI2A 1JOOA 4C2MB 1VQPA 2RF4A 5J39A 4JK1C 5BN4A 4LF5L 5C0XG 2LXJA 2DJFC 1RL2A 4DR5Q 3U4ZA 2E2JB 3TS2A 2QW7A 3RMHA 3HOWG 1K8AC 2C35B 1EQQA 1BF4A 1JE4A 3LWUA 3SDZA 2CQOA 1M1KC 1SFOH 4JYAQ 3S15B 4HIOA 1IBKQ 2ATWA 4V0BA 1I4QA 1EYGA 4A3KH 1HNZQ 3PO2B 2IWHA 2EY2A 4LF9Q 1AE3A 2QDLA 5DM63 1Q12A 1B50A 3EA6A 3SE0A 5KRUA 3X3MA 2FMCA 4NMZA 1HFGA 4YIJA 1MJEA 1ICWA 1RIPA 2YU9B 3B6YA 5C0XH 3NTIA 2L1BA 4FYDA 2R7ZG 4DV6L 1EIHA 5ELBA 3HOWH 1Y8NB 1Y14B 4A3GH 5FOBB 1ESRA 3EN2A 1WD0A 2I0QA 3BVMA 1TU2B 2A1AA 4IUNA 2K5WA 4RGTA 3CCVA 3M7NA 3CCMA 3NTKA 1EIGA 4ZK9B 5JJZA 3ZJYC 1CKMA 4GS3A 4AQYL 1J9OA 4M8AA 5ISRA 1IKMA 4ZCKA 4LF6L 4FXDA 3QJYA 4DK0A 3JAME 1QILA 1ENAA 4B3RQ 2MFIA 2DJGC 2R7ZH 1SYDA 1PRTB 4LF4L 4JVZA 3F2DA 3VR2A 1QZHA 2QKIC 1X6OA 4ALPA 4DAYA 4K0KL 1PYWD 5G3LD 2JA6B 4N9TA 2F0IA 3I72A 1OXTA 1RHPA 1VS0A 1BBWA 5CV7A 3AEVA 3LGJA 4XQJA 5CBAE 2EYJA 1G2SA 1WTQA 1AP0A 3RR5A 4B08A 1NSNS 4R4QA 1CQVA 2N55A 2O5JC 1ZYRC 1QCBD 1VQMA 1PFNA 2F0QA 3S17H 4IFDH 5BR8L 2FHTA 3CCJA 2RSNA 1HQRD 4RCOA 2F1MA 1L1OB 1CFMA 3STBD 3D4WA 4X66L 3D31A 4DR4Q 2MJ8A 2MUYA 3D8GA 3NTHA 3I90A 4RFBA 2ZTEA 3ONAB 1NE3A 1Y1VG 1SFOB 4GNXC 1SNOA 4A3MB 3BYTB 4ZUIA 2UU9L 4C1NI 2F0PA 3GD7A 2LFNA 1QVGA 3IAYA 3T56B 2Q2IA 4DPGA 1K8MA 4HJ7A 3MWYW 5E1FA 2ICEC 1B4OA 3I2ZA 1I94L 2R92G 3D0FA 4OL7A 3QG1A 3E0EA 4ZKBB 2ZJRA 3I4MG 3AMUA 3HOXG 1QE6A 4A3GB 4JI8Q 3T13A 1K3RA 1Y1VH 4DR2L 1PVOA 5C3EG 3BS1A 1CKNA 1NR4A 4WJ4A 1B8AA 3VA7A 3HOYG 1KL9A 2MO1A 4DUZL 5JEAG 3GTGB 4X64L 3T51B 3S24A 2XTIA 1IL2A 2E2DC 3CAMA 1YZ6A 1RF2D 2B2TA 1WVLA 2VZAA 3I8ZA 4LW1A 5C44G 1B7YB 4CHTB 2Z6KC 4A3FG 3MXUA 3GTKB 4ZUJA 1K73C 4LF5Q 3I4MH 1BBXC 2IT1A 1GUTA 3OMCA 4KV6A 3HOXH 2WV6D 3M4OH 4JI6Q 4A3EH 1XYIA 1KNAA 5FO7B 5C3EH 3HOYH 4QIWE 4JCVE 3HP3A 3KYHC 5JEAH 1CZGA 4QY7A 1WTPA 3P7JA 1AZPA 4CDEC 1VMCA 4UAIA 1STNA 4OELB 5J3BA 1SNDA 1HUNA 3NK9A 1WTRA 3RLFA 1Q1EA 2F0LA 5GAHC 5C44H 4A3FH 1HJPA 2SNSA 5CV6A 4Q5VA 5JVH3 1SYGA 4ZRZA 3J7YW 4OX9Q 3MXGA 4DV6Q 1LO5D 1X3QA 3KUPA 5HY6A 4DNTB 3J81i 1GUWA 4BY1B 2M9VA 4UP9A 1YHAA 4XT1B 1XJVA 1EQVA 5LL6S 3H3VH 2QA4A 3RLOA 5EKIA 1SMYC 4QQBX 2D5DA 1TS4A 4WFN3 2NVXH 2F4IA 1KABA 3MFGA 2KCNA 4KKUA 1WJJA 2K03A 3KOJA 3W2DA 3C1FA 2RSOA 3NWTA 5E3FA 2K5DA 1TWAH 4IJLA 1RTNA 4JBJA 3CC7A 3WDNA 1Q81C 4TRDA 4LF4Q 1C48A 2ZXPA 1Y1VB 3KDFB 4IZ8A 4JI1L 4UDUC 4X6AH 1SROA 2JP1A 2B2UA 2Q8IB 4LFAL 2X6LA 2J4XA 3UDXA 3MXNB 3F2CA 2K6AA 2F0NA 4DF7A 1M4VA 1B2TA 1SNMA 2E5LQ 1XTDA 1D1IA 5HURA 5BR8Q 1E3PA 1IZ6A 1G8ZD 3NENA 1L1OA 4DR6Q 3I4MB 1DD2A 4P71A 3HOXB 3M4OB 2PI2E 4CJ0B 4X66Q 4A3EB 4H7BA 1TWHH 1HR0Q 5C3EB 3H15A 3HRZC 3CW2C 4OIKA 1N34L 1MKHA 1SYBA 4HR7B 4L5RC 1C4QA 3J81L 4JI2Q 1HNWL 5CV9A 1M8AA 4OWTB 5M5WH 4F7XA 1ZXTA 3BZDB 2R61A 1I94Q 3DEPA 4A75A 4Q0FA 1EY4A 3HOUG 2EYHA 4WRDA 1MHWC 4POGA 3OIQA 1XXGA 2CCZA 3KFUA 2SEBD 1LT3D 3H94A 3PUZA 4DR2Q 4A3IG 3M3YB 3KF8B 4DUZQ 2YYZA 4B3SL 4X64Q 1SNCA 4DAVA 1I4HA 3T16A 1SMYD 4OO1G 4DR1L 4F8MA 3TZDA 5EBCA 4CJ2C 3RN2A 2R7DA 3HOUH 3FMCA 3OSOA 4DAPA 1K0RA 5C4HA 4X62L 3Q24A 5LMUL 2B39A 2LKVA 4HMJA 4YCVA 1CHPD 4KTAA 1CHQD 4B3ML 3D6CA 1ENFA 4JOIC 1D5ZC 4A3IH 1VQNA 1Q3LA 4N8FA 4B9WA 2VB3X 1E1TA 4DN4M 2OEOA 3KLWA 3R2IA 2MPMA 4JBWA 4BS9A 5C0XI 3RUZA 1JT8A 3GTOB 4OO1H 2BE5C 2RDGA 1Y1WG 2RKSA 1ET6A 2IX3A 2PCFB 2OWOA 2AHOB 2C5CA 1CT1D 1O7IA 3A54A 3ITPA 4QIWB 1EZ8A 4B3TQ 3H0GB 1RD9D 2WAQE 1PRTC 5AJ3L 1B70B 2WB1G 1TS5A 4A3DG 2KUMA 1YHQA 1CSPA 4QGUA 3CD6A 4JBMA 4H02A 4RHRA 1CZWA 1EY0A 2BH2A 3D3RA 2A68D 4FXKC 1EFWA 1Y1WH 3T4AC 3K0XA 2HQEA 4LUOA 4DGZA 3U4VA 4IPCA 1QB5D 2HUGA 3VR5A 4KHPL 4IUQA 2PPBC 1J8IA 4MIUA 1L1OC 5FKAC 2O2LD 2ALYB 2D0PA 4IFDJ 5LMNQ 1TR5A 5ELOA 4RCNA 3KDFA 1EZ6A 2D0OA 4ZLTF 3S9WA 4DV0Q 3K59A 2EXZA 1BUVT 4JI1Q 4EQNA 4A3DH 2UXDQ 4R8NA 3AQQA 1S72A 4IALA 1Q8IA 5C5MA 4LFAQ 1Q1BA 2A6EC 4IOCA 4BBSG 5M5YB 2RBMA 3RD4A 4XYOA 2QEXA 1WTVA 1HHVA 2L0CA 4HCSA 2WAQG 3HOUB 3MEFA 1SYFA 5FJ8G 3QOJA 5IT9c 2Z4IA 1GUNA 3NHHA 1ML0D 1NUCA 2JEAI 1S3OA 2SDFA 2LSSA 2JXMB 1X9NA 1FGUA 1YVCA 1V1OA 1RODA 2K28A 3LX0A 1N34Q 4ME5A 2A69C 4IN3A 4J15A 1PTOB 1A62A 4BBSH 1DZ1A 1A3UA 1X3PA 3NWSA 3E3XA 2C9OA 2CFMA 1NBWA 3BJUA 4HSPA 5FJ8H 1UE7A 2BE5D 2F03A 1LTBD 3N52A 2DN8A 3ER0A 1VQ4A 5BN5A 1HXYD 3OOCA 2XNAC 3S1QB 1B1ZA 1EU3A 1K83H 1UE6A 1Q86C 1LTRD 4RWSC 5IGFA 1PRTD 3K80C 4C3JG 3MAQA 4B3SQ 4JI3L 1PFSA 1JE5A 1VQCA 2MNAA 1KNEA 4GKKQ 5JEAJ 1GJXA 2B2YA 1HQMC 1UE1A 1KD1C 2NB0A 3FVQA 2YTXA 3KLRA 4HAEA 1YEZA 5C4XG 5IYDG 3A5ZB 4X62Q 3N6RA 5LMUQ 4C3HG 1YJWA 3FHWA 1K8OA 4B3MQ 2NVTH 3FKIG 1GUOA 4X3KA 2JK8A 1DOLA 2VNUD 2L12A 1WCMB 2NZOA 2AQ3B 4C3JH 4DV7L 2MHVA 3K8AA 4YWMA 2OCEA 3E9HA 3F2UA 5JOBA 2F0JA 3I56A 4P2CB 3MTSA 3PCOB 1N9WA 4OONA 1JORA 5C4XH 3CC2A 2E74C 2N49A 3A0JA 5IYDH 5CBEE 4DR3L 4C3HH 4XTCS 2X6GA 1EIFA 2E8GA 1EWCA 3ULJA 1Q7YC 1TWGB 4R4TA 4RAUC 3FKIH 1F2YA 4PMWA 3CCLA 4BA2I 4BXXG 4A93G 1F9SA 4JC0A 3K5MA 1AEXA 1MJCA 4NXML 1GXDC 2JYOA 5M3FB 2ES2A 2NYZD 1VQ5A 4HIDA 1N32L 2V4DA 2V1CC 3NUCA 2JE6I 1XPUA 3GDEA 4IQZA 2VS1A 5EAYA 5JJLA 2A69D 3EBEA 5K36G 4QB4A 2AMCB 1G6ZA 1KQSA 4KHPQ 3OHXC 1EIYB 3I73A 3PSIA 5M5XH 4OXPA 2GVBA 4BXXH 2B8GA 4A93H 1LM0A 1E24A 5D3IB 4YCWA 3GTMH 3BDLA 5ELDA 5CV8A 2KCMA 3L7ZC 2ID0A 1TWCH 2B2VC 3S14H 4DA2A 4BWGB 2L11A 4QF4A 1X3FA 4X3UA 2LXKA 1QZGA 1H9MA 3GV6A 4K8IA 4WJ3M 3CMEA 5K36H 2HIXA 4EVOA 1LT4D 4KN7C 2E2IB 1U9RA 3STBC 1KC8C 2Y0SE 4UP8A 5K5PA 2WFWA 3S1RH 1IBML 4KJNA 2Q8RE 1N36L 1VQHA 1VMPA 2EOTA 2N78A 3IRBA 1H9JA 2NZHA 3EIVA 2IPKD 3H3VC 4GZYC 4LFBL 4C3JB 2Q2HA 4UY8C 2EJGC 2KHSA 5KGUA 1PH1A 4DU9A 2CQAA 2OTJA 1Q46A 2PI2A 3P75A 3A8IE 4KI0A 4L5SA 3WWVA 3G48A 1CKOA 3HOVB 3SGIA 2JA8B 4DUYQ 1BCPF 4HN7A 5LHY1 3U9OA 2DGYA 1ZKOA 1JJGA 5COYA 3BZKA 3F2BA 4EQOA 2Z8LA 1X55A 2PNHA 1A6XA 2EJMA 1K0SA 2DY8A 2ZM6L 3PV0A 3K5LA 1SE8A 1CA5A 3QOLA 5EPJA 2FMMA 1I4PA 5I2XA 2I07B 4JI3Q 1X3EA 2O4XA 4G57A 1T5XD 2B63G 5IYBG 2RDHA 1CSQA 2Y0SG 2K01A 3IFDA 1P16A 4RKBA 3IKJA 1HUMA 1SBBB 2JN4A 3VYSA 5C3XA 3S2DH 1H9RA 1VQ9A 1PH7A 2F0WA 3CCRA 3MZ5A 3SVMA 2HDMA 1QOHA 1FYCA 5KYLA 1H95A 3V96A 3GTMB 2ASBA 3TQYA 1VQLA 1XMQL 4OO1I 4B9XA 2H5XA 2CH4W 5FLXL 3S16B 3J81E 4XIGS 4A3BB 2VQFQ 1SLJA 2JA5B 2FJ2A 4FXGC
chains in the Genus database with same CATH topology
1TS3A 4IUVA 2J0TD 3ZYYX 1BXTA 3NP8A 1SYCA 3KBXA 5EQ0A 3TDQA 2D62A 1Z7TA 1WTOA 3C1EA 3VR6A 4G7ZC 1OO9B 1Z6HA 3PUWA 1TKWB 1PFMA 5F2DA 2BCOA 2CHBD 1DM0B 4J6HA 1LT5D 2A73B 4A3KB 4NKLA 1SSOA 1HCZA 5A2QE 5CYUA 4FNFA 4KD3A 3R93A 2DNCA 3R8BA 3HOWB 3TZUA 5IT9L 1LTAD 1E2WA 1VF7A 3UI2A 3I91A 1HA5A 1JQYD 5J22A 1PTOC 2PMZB 4RKLA 2TMPA 2KQ3A 2Z4HA 2NWGA 2EVBA 2EY1A 2QEJC 5I2YA 1TY0A 3R2TA 1SJED 4OGQC 4HMIA 5KEEA 4C1NK 1IW7C 2R7ZB 2PNRC 3MC0B 1R4PB 1F2ZA 3HZXA 1YNNC 2Q8TA 5CMDA 5FK9C 2IX0A 3K6OA 1EYDA 2PW7A 4G4KA 1XWEA 3H09A 4RH6A 3A7AB 2F0OA 2RQXA 3S17B 3J7AF 3L3OC 1I3QB 4HSVA 3VR4A 1O7YA 1F2LA 3IL8A 2A6HD 2PQEA 2DNEA 1CQFA 3HEJA 1TY2A 4QMGA 2NBFA 5IIFA 2KCCA 5I4DA 1VCIA 1EY5A 4RA8A 4R9WA 4ODGA 2F0FA 1LABA 4MHEA 3Q23A 3SK5A 3NBIA 3VYTA 1SNPA 1SAPA 3PUXA 2NN6G 1JOKA 5JPNC 4FVMA 1IYVA 2L5TA 2XVSA 3KK7A 1EYCA 4L6TB 1PTOD 3OIPA 4RGMA 2AUKA 1ENCA 2R92B 2IJ0A 1JICA 2PZUA 3NQIA 4PQXA 2ENBA 1I4GA 3PUYA 4LK1C 4IURA 1MD2D 4QCLA 3E6ZX 1IW7D 1EY8A 2NN6H 2WINB 4N9PA 2H1EA 3HOYB 4WJWA 2A68C 3BVZA 1DONA 1YNND 1A2TA 1EOTA 2GA4B 2IX1A 3JAML 1B53A 4OIJA 5C44B 2B2TC 1GHJA 1S5ED 4A3FB 2E75C 1AN8A 3G7LA 5IOCA 2R3ZA 1ILPA 4K2KA 4KMUC 1HTLD 3A55A 4U68A 2SOBA 3QO2A 2M2LA 3H91A 2NVXB 1DYQA 3SR1A 4ZAIA 3C46A 3FPPA 3I70A 1TWAB 1ET9A 1CM9A 1RJTA 1MGSA 3PIO3 5IODA 3MHBA 5C0XJ 4XT3B 1KLUD 3DEOA 3SXHA 3DWAA 2VXWA 5DNFA 2EZVA 2KJXA 3J80E 5DAUA 5G3LF 3TP8A 1OXSC 2F0TA 3M7GA 5C5LA 2AQ2B 2CVRA 3DWPA 5CORA 1R9TB 5CV4A 5KNBA 1TWHB 2D9UA 2KEDA 3D4RA 1G291 4L8JA 2B2UC 5T1IA 3AB9A 3RZDB 5M5WB 3I3CA 4ZYSA 4DFAA 2F0DA 3J7AV 1IKLA 3OPOA 2XWBB 1JOQA 2F0KA 5A35A 2EY6A 3K5NA 2KECA 3NPPA 2BA1A 3TP6A 1F9PA 2A5HA 1SYEA 1I6VC 4RGOS 4J1MA 2WKDA 5HGTA 2RVLA 1Q90A 2LS01 1Y69U 1NAPA 2IL8A 2KVMA 1F9QA 1I4RA 3SK8A 4NP5A 1BR9A 4A3IB 1IL8A 5EJWA 3MXPA 4LMQD 4FF2A 3VA5A 3W3AA 1STEA 1AFPA 2NZ1D 3MEHA 1HFNA 2FINB 3GV3A 3HGBA 2DY7A 5I9OA 5E4WC 2LY7A 3D6WA 3OW7A 5KIXA 1HRJA 4C3IG 1RDPD 1STGA 2QF7A 2SNMA 1IHZA 4NDXA 3KBGA 2CW0C 3ND8A 3PUVA 2D2CC 2M00A 5D3DA 1D5MC 3A8JE 3LNNA 1RCVD 1Y1WB 5I9PA 3ND9A 3U9SA 3NXWA 1X32A 1S5FD 3SK6A 3CQZB 1RKNA 1TIID 5EPLA 2WB1B 4CJ1B 3Q0AA 4A3DB 1AZQA 2JA7B 5ELFA 1EEFD 1UAPA 3TMEA 4KY6A 3CRKC 2EY5A 4WORA 1TT2A 5DM73 4KN4C 2JSOA 1F2MA 5EPKA 3SK4A 3DXJC 1U4RA 3I4LA 4CGYB 2OT2A 1EY9A 4RHSA 2EPBA 2ZXRA 1UUPA 4KY7A 2G9DA 2VUMB 2XRSD 1V43A 2EJFC 2L4NA 4BBSB 4C56C 2XN9C 2NTSA 3KLSA 2K7VA 2WAQB 1T5EA 4ZQ3A 1O7ZA 4F87A 2AWNA 3P20A 1EYAA 2AQ1B 4RGNA 2BA0A 3CRLC 1BNZA 3G6JB 5C4ZA 1BCPB 1K83B 1XTCD 2PO4A 1JWUD 2CW0D 2A74C 3PO3B 4S3SA 4XQQA 1CK1A 4XXEA 3A56A 3M4YA 2NN6I 4CBVA 4ID6A 4K14A 3Q22A 4TKOB 5JPMC 5ELCA 1SE2A 2NVTB 2EYPA 2N88A 1PDQA 2F3VA 3FRPB 5FO8B 5CC4A 1EL0A 1UEAB 4DXGA 3EFXD 4KK7A 5J1ZA 2B2YC 1Y8PB 5C4XB 1LTID 1UNSA 4C3HB 1EQTA 3FKIB 5CR3A 1KLGD 3SEBA 2K5QA 4TSSA 1LV9A 1D5XC 3DHQA 1FNVA 3NBHA 5JAVA 4KHVA 4TQUS 1HTPA 5FO9B 3BG3A 4LAAA 1B44D 1LLRD 2PYKA 3NE5B 5C4JB 5DEHA 3V05A 2ZXOA 5M5XB 3DWQA 4A93B 3EQLC 4K8JA 2JEBI 1LTSD 3A7LA 3DMUA 4ABNA 1TWCB 1F77A 3S14B 1KAAA 4QUFA 5T1GA 2K04A 1OXVA 4IFDG 2EYOA 1NCVA 1PXUA 4CKCA 5I6YA 3S1RB 2A6HC 1G2TA 4K6DA 5IGBA 2WIIB 1LTTD 3KLSX 1EWHA 3NSWA 4MN3A 1JCKB 1KDCA 4H0LC 1U4MA 4K2LA 2NUCA 1RTOA 1B3AA 4HTHA 1JWMD 1MSGA 1H9SA 4K5VA 2BDOA 3E0JA 1BO0A 2O5IC 4U673 2I46A 3M85A 4CKEA 5IGDA 3IFTA 3C2PA 1SEBD 1U4PA 1LT6D 4FF1A 5KYIA 1PRTF 4FF4A 3EROA 2K33A 1SDFA 1VF5C 2MP1A 3S2DB 2B2WA 1L0XB 5IGGA 5KNDA 4H44C 5C3WA 4E6IA 3NQTA 4QUCA 1S5BD 2EYFA 3OWEB 1GHKA 2MGSA 1OXXK 1CI3M 1FGBD 2F3WA 2HDLA 2L55A 5M3MB 2B63B 2Y0SB 4DK1A 1W6KA 1D2BA 3VYRA 2XIWA 1KDAA 1R4QB 4H13C 1II3A 3URYA 1WTWA 1ILQA 4ILWA 1STHA 5EBDA 1FD7D 1PFBA 1C8CA 5IGEA 4X3SA 5EKLA 3DM1A 3GP7A 3GO5A 4PV1C 1H9KA 5EGTA 1DOKA 3OWFA 3TP7A 1A3VA 3MVVA 1ZYRD 1STYA 1SXTA 2E2HB 1JB3A 3BVGA 1QNKA 1FNWA 1TQOA 2F0GA 4NW2A 4EGVA 1WTXA 3TBIB 3WOFA 1XX8A 3GTPB 3GTJB 2AWOA 1B9NA 2NTTA 2QCPX 1E2ZA 2EYMA 1EU4A 2F0UA 2FFKB 3FDTA 4KHZA 2X69A 1TVXA 2K1BA 3QIAA 2XWJB 1O80A 1QWYA 1JWSD 2H4OA 1BCPC 1TS2A 3R3OA 5BN3A 1JR0D 3K58A 4V190 2AUJD 4O1NA 3FPUB 5C6AA 3OMGA 4M1UB 4O42A 4FO2A 2B2WC 4IUUA 4ULLA 1SE3A 3MA2B 2WP8J 4OHJA 3QB3A 2LMCB 3GTQB 3MFYA 4Z9CB 1WD1A 1QG7A 2BOSA 1HPCA 1D1KA 2PZWA 1DJRD 2G9HD 4FP5D 2EE1A 2F0EA 4BY7B 1SE4A 1A15A 1QNUA 2KEEA 3HKZB 1BDOA 2F0VA 2OXPA 4AYBB 4LJZC 4G7OC 3TN2A 4K6LA 4DXFA 5A2QL 3HOZB 4I65A 5AFWA 3EJIA 3T53B 3BYYB 1BOSA 3TSSA 1FNUA 2OF1A 1AW7A 1ONLA 3HG9A 3X3NA 4G7HC 1YNJC 3VYUA 2BDNA 1PTOH 3CKIB 2QILA 5CV5A 3A8KE 4DNRB 4XQNA 3E5SA 1BQQT 1BCPD 5I6WA 2QDBA 3HS0C 1GUGA 1FR3A 4XDXA 4R8IA 1G91A 3DUZA 5EKKA 4KKSA 4X3TA 3H6MA 2WACA 4BBRB 1IYUA 2ZT9C 4K5XA 1V1PB 2PW5A 1S5CD 1E0BA 1EY7A 3BDOA 4KJOA 1DCZA 5D65A 3I4NB 3CHBD 4K5WA 1B9MA 2VB2X 1ESFA 1I4XA 3PMFA 3Q6SA 1GUSA 1STBA 4PMCA 2K32A 2TSSA 3P1HA 4IUPA 1NR2A 3C3LA 3WOEA 3K57A 3MXNA 4IFDI 1E2VA 4PMBA 1OXUA 3S1MB 4HEDA 1V8QA 2XSCA 3O13A 1W6JA 1VDZA 4J8QA 3D4DA 2RA4A 4ZKCB 5ELEA 1I50B 1LACA 1PZID 2B2VA 5JVG3 2EYLA 3LWEA 1QJOA 3S2HB 2Z1CA 1LTGD 5FLXE 1GOZA 1YNJD 1Y8OB 2WKCA 5LL6X 3SHLA 3TP5A 5CGKA 4HCEA 1Z47A 2J7ZA 1D6EC 1EY6A 2IW3A 4XYQA 3KF8A 4KKTA 2HCIA 3K0YA 1EFID 1MBYA 1CA6A 1TWFB 3AU7A 4KD4A 1U4LA 3CU7A 3BDCA 2KA7A 2R6GA 1PZJD 3K7AB 3FEWX 1ZEQX 1PMRA 1PTOF 1O78A 4Y7NB 2F0HA 4CKBA 1JC7A 5IT9E 1HA6A 4KY5A 3GTLB 3K5OA 2EDGA 2B8FA 2A6ED 1MSHA 1A2UA 1DXMA 2L9HA 5TSSA 2NVQB 5M9OA 3EVQA 2F0MA 4FF3A 2E76C 1DOMA 4I7ZC 1STAA 5E4XA 1V1PA 1A3TA 1H9SB 5D14A 3V2TA 3ERQA 1SJHD 3VR3A 1CTMA 1PLFA 2RDFA 3S1NB 2R93B 2XRQD 3PIP3 3J80L 2KOLA 2NVYB 3L9AX 5NUCA 1EEID 1PZKD 2F0SA 5KNCA 2ICIA 1KDBA 1SNQA 4EQPA 4PNYA 4BA1I 1S4ZA 4F88A 4C3IB 1I6HB 2PZTA 4L63B 1S5DD 3RZOB 1L0YB 5IGCA 3QWNA 4IUTA 1KTKA 1F9RA 4A3JB 2K05A 3GQBA 1O7LA 2HCCA 1MI2A 1JOOA 4C2MB 5J39A 4JK1C 5BN4A 5C0XG 2E2JB 3RMHA 1BF4A 1JE4A 3LWUA 3SDZA 3S15B 4V0BA 1I4QA 3PO2B 2IWHA 2EY2A 5DM63 1Q12A 1B50A 3EA6A 3SE0A 5KRUA 3X3MA 2FMCA 4NMZA 1HFGA 4YIJA 1ICWA 2YU9B 5C0XH 3NTIA 2L1BA 4FYDA 1EIHA 5ELBA 1Y8NB 5FOBB 1ESRA 1WD0A 3BVMA 1TU2B 4IUNA 2K5WA 4RGTA 3M7NA 3NTKA 1EIGA 4ZK9B 5JJZA 1J9OA 4M8AA 5ISRA 1IKMA 4FXDA 3QJYA 4DK0A 3JAME 1QILA 1ENAA 1SYDA 1PRTB 3VR2A 2QKIC 4DAYA 1PYWD 5G3LD 2JA6B 4N9TA 2F0IA 1OXTA 3I72A 1RHPA 5CV7A 4XQJA 5CBAE 2EYJA 1G2SA 1WTQA 1AP0A 4B08A 1NSNS 1CQVA 2N55A 2O5JC 1ZYRC 1QCBD 4IFDH 1PFNA 2F0QA 2FHTA 2RSNA 1HQRD 4RCOA 2F1MA 1CFMA 3D4WA 3D31A 2MJ8A 2MUYA 3D8GA 3NTHA 3I90A 4RFBA 3ONAB 1SFOB 1SNOA 4A3MB 3BYTB 4ZUIA 4C1NI 2F0PA 3GD7A 2LFNA 3IAYA 3T56B 1K8MA 3MWYW 5E1FA 2ICEC 1B4OA 4OL7A 3QG1A 4ZKBB 3AMUA 1QE6A 4A3GB 3T13A 3BS1A 1NR4A 3VA7A 5JEAG 3GTGB 3T51B 2E2DC 1RF2D 2B2TA 1WVLA 3I8ZA 4CHTB 3MXUA 3GTKB 4ZUJA 1BBXC 2IT1A 1GUTA 3OMCA 4KV6A 2WV6D 1XYIA 1KNAA 5FO7B 3HP3A 5JEAH 1CZGA 1WTPA 3P7JA 1AZPA 1VMCA 4UAIA 1STNA 1SNDA 1HUNA 3NK9A 1WTRA 3RLFA 1Q1EA 2F0LA 2SNSA 5CV6A 4Q5VA 5JVH3 1SYGA 4ZRZA 3J7YW 3MXGA 1LO5D 1X3QA 3KUPA 4DNTB 1GUWA 4BY1B 2M9VA 4XT1B 1EQVA 5LL6S 5EKIA 1SMYC 2D5DA 1TS4A 4WFN3 2F4IA 1KABA 3MFGA 2KCNA 4KKUA 2K03A 3W2DA 3C1FA 2RSOA 3NWTA 5E3FA 2K5DA 1RTNA 3WDNA 4TRDA 1C48A 2ZXPA 1Y1VB 4IZ8A 4UDUC 2JP1A 2B2UA 2Q8IB 2X6LA 2J4XA 2K6AA 2F0NA 4DF7A 1M4VA 1B2TA 1SNMA 1D1IA 5HURA 1G8ZD 3I4MB 1DD2A 3HOXB 3M4OB 4CJ0B 4A3EB 4H7BA 5C3EB 3HRZC 4OIKA 1SYBA 4HR7B 1C4QA 3J81L 5CV9A 1M8AA 4F7XA 1ZXTA 3BZDB 2R61A 3DEPA 4Q0FA 1EY4A 2EYHA 4WRDA 3OIQA 1XXGA 2SEBD 1LT3D 3H94A 3PUZA 3M3YB 2YYZA 1SNCA 4DAVA 1I4HA 3T16A 1SMYD 4OO1G 4F8MA 3TZDA 5EBCA 4CJ2C 3FMCA 3OSOA 4DAPA 5C4HA 3Q24A 2B39A 2LKVA 4HMJA 1CHPD 4KTAA 1CHQD 3D6CA 1ENFA 1D5ZC 1Q3LA 4B9WA 2VB3X 4DN4M 2OEOA 3R2IA 2MPMA 4JBWA 4BS9A 5C0XI 3RUZA 3GTOB 4OO1H 2BE5C 2RDGA 2RKSA 1ET6A 2IX3A 2PCFB 2C5CA 1CT1D 3A54A 3ITPA 4QIWB 1EZ8A 3H0GB 1RD9D 1PRTC 1TS5A 2KUMA 4RHRA 1CZWA 1EY0A 3D3RA 2A68D 4FXKC 3T4AC 2HQEA 4DGZA 1QB5D 2HUGA 3VR5A 4IUQA 2PPBC 1J8IA 4MIUA 5FKAC 2O2LD 4IFDJ 1TR5A 4RCNA 1EZ6A 4ZLTF 3S9WA 3K59A 2EXZA 1BUVT 4EQNA 4R8NA 4IALA 1Q8IA 5C5MA 1Q1BA 2A6EC 5M5YB 2RBMA 3RD4A 4XYOA 1WTVA 1HHVA 2L0CA 4HCSA 3HOUB 1SYFA 3QOJA 2Z4IA 1GUNA 3NHHA 1ML0D 1NUCA 2JEAI 2SDFA 2JXMB 1V1OA 1RODA 2K28A 3LX0A 4ME5A 2A69C 4IN3A 1PTOB 1DZ1A 1A3UA 1X3PA 3NWSA 2C9OA 4HSPA 2BE5D 2F03A 1LTBD 3N52A 2DN8A 5BN5A 1HXYD 3OOCA 2XNAC 3S1QB 1B1ZA 1EU3A 1LTRD 4RWSC 5IGFA 1PRTD 4C3JG 3MAQA 1KNEA 5JEAJ 1GJXA 2B2YA 1HQMC 2NB0A 3FVQA 3KLRA 4HAEA 3N6RA 4C3HG 1K8OA 1GUOA 4X3KA 1DOLA 2VNUD 2L12A 1WCMB 2AQ3B 2MHVA 3F2UA 5JOBA 2F0JA 4P2CB 3MTSA 1JORA 2E74C 5CBEE 4XTCS 2X6GA 1EWCA 1TWGB 4RAUC 1F2YA 4PMWA 4BA2I 1F9SA 3K5MA 1AEXA 1GXDC 2JYOA 5M3FB 2NYZD 2V4DA 3NUCA 2JE6I 4IQZA 2A69D 5K36G 4QB4A 1G6ZA 3OHXC 3I73A 2B8GA 5D3IB 3BDLA 5ELDA 5CV8A 3L7ZC 2ID0A 2B2VC 4DA2A 4BWGB 2L11A 4QF4A 4X3UA 1H9MA 3GV6A 4K8IA 5K36H 4EVOA 1LT4D 4KN7C 2E2IB 1U9RA 5K5PA 4KJNA 2Q8RE 1VMPA 2EOTA 1H9JA 2IPKD 3H3VC 4GZYC 4C3JB 2EJGC 2KHSA 5KGUA 4DU9A 2CQAA 3P75A 3A8IE 4KI0A 3HOVB 2JA8B 1BCPF 4HN7A 5LHY1 3U9OA 1ZKOA 5COYA 4EQOA 2Z8LA 1A6XA 2EJMA 2DY8A 3PV0A 3K5LA 1CA5A 3QOLA 5EPJA 2FMMA 1I4PA 5I2XA 2I07B 2O4XA 4G57A 1T5XD 2RDHA 2K01A 3IFDA 4RKBA 3IKJA 1HUMA 1SBBB 3VYSA 5C3XA 1H9RA 2F0WA 3MZ5A 3SVMA 2HDMA 1QOHA 1FYCA 5KYLA 3V96A 3GTMB 4OO1I 4B9XA 5FLXL 3S16B 3J81E 4XIGS 4A3BB 2JA5B 2FJ2A 4FXGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAA A;  3C1F A;  2WAC A;  5E3F A;  5KRU A;  4KD4 A;  2PYK A;  2SOB A;  4ZUI A;  3BDL A;  4B9W A;  4KY7 A;  4K5X A;  2F0P A;  2OEO A;  2PW5 A;  3BDC A;  5CV8 A;  5C6A A;  3NP8 A;  2PQE A;  5DEH A;  3OMG A;  1SYC A;  3RUZ A;  2F3W A;  1EY7 A;  3HEJ A;  3SK8 A;  3SR1 A;  4K8J A;  4TRD A;  4QF4 A;  4NP5 A;  5E1F A;  4QMG A;  4KJO A;  4IZ8 A;  2RKS A;  4OL7 A;  3C1E A;  3DMU A;  4K8I A;  5IIF A;  3MXP A;  4EVO A;  1KDA A;  5IOD A;  3VA5 A;  1EY5 A;  3MHB A;  4K5W A;  1U9R A;  2EY2 A;  4ZQ3 A;  1II3 A;  3ITP A;  5F2D A;  5IGF A;  1EZ8 A;  3QB3 A;  4ODG A;  2F0N A;  1EYA A;  1KAA A;  2F0H A;  3T13 A;  2F0F A;  4DF7 A;  3MEH A;  5K5P A;  4KJN A;  3PMF A;  4NMZ A;  4YIJ A;  4J6H A;  1SNM A;  1STH A;  3SXH A;  1STB A;  4PMC A;  3SK5 A;  5I9O A;  2EYO A;  5C4Z A;  5HUR A;  1SNP A;  2PZW A;  5IGE A;  5KIX A;  3P1H A;  4KY5 A;  5EKL A;  4NKL A;  5I6Y A;  1STG A;  1A2U A;  1EY0 A;  5DAU A;  5M9O A;  3EVQ A;  4PMB A;  2SNM A;  3TP8 A;  4IUN A;  5EGT A;  4H7B A;  2F0M A;  1IHZ A;  2F0E A;  2KHS A;  4K6D A;  4KD3 A;  2F0T A;  3OWF A;  4NDX A;  1JOK A;  5C5L A;  4DU9 A;  4S3S A;  3TP7 A;  5IGB A;  2HQE A;  4DGZ A;  1SYB A;  1A3V A;  3P75 A;  4ZUJ A;  1STA A;  2M00 A;  3OMC A;  2F0V A;  1A3T A;  2OXP A;  4KV6 A;  5CV4 A;  4ID6 A;  4K14 A;  1EYC A;  5CV9 A;  4MIU A;  5KGU A;  3MVV A;  5ISR A;  3V2T A;  3D4D A;  4F7X A;  1ENC A;  1STY A;  3U9O A;  1KDC A;  5J22 A;  1TR5 A;  3ERQ A;  4K2L A;  2EYP A;  1EZ6 A;  1ENA A;  2F0J A;  2KQ3 A;  2NUC A;  4RKL A;  5JOB A;  4EQO A;  1TQO A;  2EXZ A;  2EY1 A;  2F0G A;  2F3V A;  2RDF A;  4EQN A;  4HTH A;  5I9P A;  2PZU A;  1EY4 A;  4R8N A;  4IAL A;  5CC4 A;  1JOR A;  3NXW A;  1SYD A;  2EYH A;  3SK6 A;  2ENB A;  4WRD A;  5C5M A;  1RKN A;  3QOL A;  4I65 A;  1STN A;  2EYL A;  4K5V A;  5NUC A;  1SND A;  3NK9 A;  2F0S A;  1EY8 A;  3EJI A;  4N9P A;  2F0L A;  1F2Y A;  1KDB A;  2O4X A;  2RBM A;  3R3O A;  4G57 A;  4HMI A;  4DFA A;  5KEE A;  1SNQ A;  5J1Z A;  5IGD A;  2SNS A;  4EQP A;  4PNY A;  2F0D A;  5CV6 A;  4N9T A;  2F0I A;  2OF1 A;  4RKB A;  1AEX A;  1SYG A;  2PZT A;  5CV7 A;  3TME A;  1A2T A;  4KY6 A;  2EYM A;  1F2Z A;  1SYF A;  2EYJ A;  5C3X A;  2EY5 A;  3HZX A;  3QOJ A;  3S9W A;  4WOR A;  3SHL A;  1JOQ A;  3TP5 A;  1NSN S;  1SNC A;  2F0K A;  2F0U A;  2F0W A;  3NUC A;  3NHH A;  2EY6 A;  1NUC A;  5CGK A;  1TT2 A;  3MZ5 A;  3T16 A;  5IGC A;  5CV5 A;  5KYI A;  2F0Q A;  5CR3 A;  1EQV A;  4F8M A;  5KYL A;  1EYD A;  1F2M A;  3E5S A;  2PW7 A;  3ERO A;  1EY6 A;  3TP6 A;  5I6W A;  3SK4 A;  1SYE A;  3D4W A;  3LX0 A;  3DHQ A;  3OSO A;  4ME5 A;  4QB4 A;  2QDB A;  5C4H A;  5IOC A;  2F0O A;  2LKV A;  4HMJ A;  4B9X A;  5JAV A;  1EY9 A;  5IGG A;  4KTA A;  1KAB A;  3D8G A;  4J1M A;  3D6C A;  4KHV A;  5C3W A;  5EKK A;  4K2K A;  1A3U A;  1JOO A;  3NQT A;  3H6M A;  4E6I A;  2EYF A;  5HGT A;  5J39 A;  1SNO A; 
#chains in the Genus database with same CATH topology
 1TS3 A;  2B63 H;  5IYB H;  4MNO A;  4IUV A;  2J0T D;  3ZYY X;  4EQ5 A;  1BXT A;  3NP8 A;  1SYC A;  2G5D A;  3KBX A;  5EQ0 A;  1QUQ A;  3TDQ A;  4DK3 C;  2D62 A;  1Z7T A;  1WTO A;  3W1B A;  1I3Q H;  3C1E A;  3VR6 A;  4YHH Q;  1OO9 B;  4G7Z C;  3CP0 A;  2ZTC A;  2KHI A;  3TRZ A;  1Z6H A;  3CXC A;  3PUW A;  1TKW B;  1PFM A;  4NXM Q;  5F2D A;  3W5O A;  1G51 A;  2BCO A;  2CHB D;  1DM0 B;  4J6H A;  1N32 Q;  1A8V A;  1LT5 D;  2HQL A;  1PH5 A;  5IY0 A;  1PH9 A;  2A73 B;  4A3K B;  1X56 A;  4NKL A;  1SSO A;  1X54 A;  4OEM B;  1HCZ A;  5A2Q E;  5CYU A;  4FNF A;  2E2H H;  4KD3 A;  3R93 A;  3T1Y L;  3KJO A;  2DNC A;  3R8B A;  3CCE A;  1C7Y A;  4MTK A;  3HOW B;  3TZU A;  5IT9 L;  1LTA D;  1E2W A;  1VF7 A;  3UI2 A;  3HKZ E;  3GTP H;  3I91 A;  1FL0 A;  1HA5 A;  1JQY D;  5J22 A;  1PTO C;  2PMZ B;  4RKL A;  2TMP A;  2KQ3 A;  2Z4H A;  2NWG A;  2EVB A;  2CH4 A;  2EY1 A;  4PZ8 A;  2QEJ C;  5I2Y A;  3RN5 A;  1TY0 A;  3R2T A;  1SJE D;  2CWA A;  2R92 H;  4JI7 L;  1QVF A;  4OGQ C;  3ICE A;  4HMI A;  2F52 A;  5KEE A;  4C1N K;  3OW2 A;  1IW7 C;  1N36 Q;  2R7Z B;  1AH9 A;  4QJF A;  2PNR C;  3MC0 B;  1R4P B;  1VQ7 A;  1F2Z A;  3CF5 A;  3HZX A;  1YNN C;  2Q8T A;  5CMD A;  5FK9 C;  1YNX A;  2IX0 A;  3K6O A;  1L2F A;  1EYD A;  3NEM A;  2PW7 A;  4G4K A;  1XWE A;  4X65 L;  3H09 A;  3KF6 A;  4RH6 A;  3RLN A;  1HR0 W;  3A7A B;  2F0O A;  2Z6B A;  3CCQ A;  2Z9H A;  2RQX A;  3S17 B;  3J7A F;  2GN5 A;  4BY7 G;  3L3O C;  1I3Q B;  4HSV A;  2K75 A;  3VR4 A;  3HKZ G;  1O7Y A;  1F2L A;  3IL8 A;  2A6H D;  2ZM6 Q;  2PQE A;  4AIM A;  4AYB G;  2DNE A;  1CQF A;  4CDD C;  3HEJ A;  2IY5 B;  1TY2 A;  3GTQ H;  4QMG A;  4LUV A;  3JAM i;  2NBF A;  1XNR L;  5IIF A;  2KCC A;  5I4D A;  1VCI A;  1EY5 A;  4RA8 A;  4LFC L;  4R9W A;  3FP9 A;  3HOZ G;  4AQY Q;  4ODG A;  5GAG C;  1B3Q A;  2F0F A;  1LAB A;  3G6E A;  4LF6 Q;  4MHE A;  4BY7 H;  3Q23 A;  3SK5 A;  3NBI A;  3VYT A;  1SNP A;  1U5K A;  1SAP A;  1Q82 C;  1XMQ Q;  3PUX A;  4JI4 L;  2NN6 G;  1JOK A;  5JPN C;  4K0K Q;  2A19 A;  4FVM A;  1IYV A;  3VDY A;  3AYH B;  2L5T A;  2XVS A;  3KK7 A;  3HOZ H;  1EYC A;  4L6T B;  1PTO D;  2YTY A;  3OIP A;  4RGM A;  2AUK A;  1ENC A;  2R92 B;  2IJ0 A;  1A63 A;  1JIC A;  2PZU A;  3NQI A;  1R9T H;  4PQX A;  3CMA A;  2CWP A;  1T9H A;  2ENB A;  3PUY A;  1I4G A;  4LK1 C;  4IUR A;  1MD2 D;  3J80 c;  4QCL A;  3E6Z X;  4LF7 L;  1IW7 D;  4R4O A;  2A8V A;  1EY8 A;  2NN6 H;  2WIN B;  4N9P A;  2H1E A;  3HOY B;  3K7U C;  4WJW A;  1SR3 A;  2A68 C;  3BVZ A;  2K5N A;  1DON A;  1YNN D;  2UU9 Q;  3Q8D A;  3TEH B;  1A2T A;  1EOT A;  2GA4 B;  2IX1 A;  3JAM L;  3RZD H;  3I4N G;  1B53 A;  1MIU A;  4JW0 A;  4OIJ A;  3UE1 A;  4KLK A;  5C44 B;  2B2T C;  1GHJ A;  1S5E D;  4A3F B;  3A74 A;  2E75 C;  1AN8 A;  1IYJ B;  3G7L A;  5IOC A;  2BH8 A;  3TRE A;  3J81 j;  2JA9 A;  4RG1 A;  2R3Z A;  1ILP A;  3CC4 A;  4K2K A;  4KMU C;  1VQ6 A;  1HTL D;  3A55 A;  4U68 A;  2SOB A;  3QO2 A;  2HIV A;  2WB1 E;  2M2L A;  5LMN W;  3I4N H;  3H91 A;  1AE2 A;  2NVX B;  3UDG A;  3E9I A;  2UXC L;  1DYQ A;  3SR1 A;  2OQ0 A;  4ZAI A;  4JI7 Q;  3C46 A;  3FPP A;  2UUA L;  1IBL L;  3I70 A;  1TWA B;  1ET9 A;  1CM9 A;  1RJT A;  1MGS A;  2GVA A;  3PIO 3;  5IOD A;  3MHB A;  4FDB A;  5C0X J;  1WTH A;  4XT3 B;  1KLU D;  2OQK A;  3DEO A;  3S1M H;  3SXH A;  3DWA A;  2VXW A;  5DNF A;  1TXY A;  4LNQ A;  4X65 Q;  2EZV A;  2KJX A;  3J80 E;  5DAU A;  5G3L F;  1KXL A;  3A5U A;  3TP8 A;  1OXS C;  1FVI A;  4N8X 1;  2F0T A;  3M7G A;  5C5L A;  2AQ2 B;  1JMC A;  1FJG L;  2CVR A;  3DWP A;  5COR A;  1R9T B;  5CV4 A;  2EXD A;  5KNB A;  1TWH B;  2D9U A;  2KED A;  1YIT A;  3S2H H;  4JBK A;  3D4R A;  1G29 1;  2JA7 G;  4L8J A;  3TS0 A;  2B2U C;  5JJI A;  4DR7 L;  1XNR Q;  5T1I A;  1D7Q A;  3AB9 A;  3RZD B;  5M5W B;  3I3C A;  4LFC Q;  4P74 A;  3J7Z C;  4ZYS A;  4DFA A;  3PIP A;  2F0D A;  3J7A V;  1PH3 A;  2PQA B;  1IKL A;  3OPO A;  3CQZ H;  3HFZ B;  2XWB B;  1JOQ A;  2HHH L;  1A0I A;  2F0K A;  5A35 A;  2EY6 A;  3CPF A;  3K5N A;  1OTC A;  3M4P A;  2JA7 H;  2KEC A;  4JI4 Q;  1TWF H;  3NPP A;  2BA1 A;  1NMF A;  2MQH A;  3TP6 A;  1F9P A;  2A5H A;  1SYE A;  2VUM G;  1I6V C;  4RGO S;  4O2D A;  3QR8 A;  4J1M A;  2WKD A;  3K7A H;  1VQD A;  5HGT A;  4HJ8 A;  2RVL A;  3PF5 A;  1Q90 A;  2LS0 1;  2FXQ A;  1J5E L;  1GM5 A;  1X3G A;  1Y69 U;  4Y7N H;  1SN8 A;  4NB3 A;  1NAP A;  1LUZ A;  2IL8 A;  2KVM A;  1F9Q A;  1I4R A;  3SK8 A;  4NP5 A;  4DNI A;  1BR9 A;  1VQI A;  5IP9 G;  4A3I B;  1HZC A;  1IL8 A;  5EJW A;  3MXP A;  2VUM H;  4LMQ D;  3GTL H;  1HNW Q;  4FF2 A;  3VA5 A;  3W3A A;  1STE A;  1AFP A;  1WYD A;  2NVQ H;  2NZ1 D;  3MEH A;  1HFN A;  2FIN B;  3GV3 A;  3HGB A;  3PO3 G;  1GD7 A;  2DY7 A;  5I9O A;  5E4W C;  2LY7 A;  3D6W A;  3OW7 A;  5KIX A;  4DR5 L;  1HRJ A;  4C3I G;  1RDP D;  5L37 A;  1STG A;  1SMX A;  4R1J A;  2QF7 A;  2SNM A;  4GN4 B;  1IHZ A;  5IP9 H;  4NDX A;  3KBG A;  2CW0 C;  1IBK L;  3ND8 A;  4I7A A;  4A3J G;  3PUV A;  4DV1 L;  2D2C C;  2M00 A;  5D3D A;  1YIJ A;  4LF9 L;  2NVY H;  1D5M C;  3A8J E;  3LNN A;  3PO3 H;  1RCV D;  5IYC G;  1Y1W B;  2UXC Q;  4DR1 Q;  4UPA A;  5I9P A;  2UUA Q;  1C9O A;  4JI0 L;  4C3I H;  3ND9 A;  3U9S A;  3NXW A;  1X32 A;  1NMG A;  1S5F D;  3SK6 A;  3CQZ B;  1RKN A;  4A76 A;  5FLM G;  3RZO H;  1TII D;  5EPL A;  2WB1 B;  1KRS A;  4CJ1 B;  3Q0A A;  4A3D B;  1AZQ A;  2JA7 B;  5ELF A;  4A3J H;  1EEF D;  2DUD A;  1HZA A;  1YI2 A;  1UAP A;  3TME A;  1WI5 A;  4KY6 A;  3CRK C;  4JG2 A;  2RCN A;  2EY5 A;  3PO2 G;  2P5Z X;  4WOR A;  4P72 A;  5IYC H;  1TT2 A;  2F4V L;  1ASZ A;  5DM7 3;  4KN4 C;  4B3R L;  1UEB A;  2JSO A;  1F2M A;  5EPK A;  4IOA A;  1FJG Q;  3SK4 A;  3DXJ C;  1U4R A;  3I4L A;  4CGY B;  2E2J H;  5FLM H;  2OT2 A;  4GOP B;  1QUQ B;  1EY9 A;  4RHS A;  2EPB A;  5DLQ E;  1VQJ A;  5AJ3 Q;  3I4O A;  2ZXR A;  3U58 A;  1UUP A;  4KY7 A;  1UE5 A;  2VQE L;  2G9D A;  2VUM B;  2XRS D;  4QL5 A;  4HJ9 A;  3PO2 H;  1V43 A;  2EJF C;  4DR7 Q;  2L4N A;  4BBS B;  4C56 C;  2XN9 C;  2NTS A;  2KHJ A;  2L15 A;  2AKW B;  3KLS A;  3NEL A;  4O0A A;  2K7V A;  2WAQ B;  5C4J H;  1T5E A;  2PQA A;  5IP7 G;  1VQK A;  3W1G A;  4ZQ3 A;  4IPD A;  4DR4 L;  5GAD C;  1O7Z A;  4F87 A;  2AWN A;  3P20 A;  1EYA A;  2AQ1 B;  4RGN A;  2BA0 A;  3CRL C;  1UWV A;  1E22 A;  1BNZ A;  3G6J B;  4LWC A;  1QVC A;  5C4Z A;  1YHB A;  1BCP B;  1K83 B;  2JA6 G;  1XTC D;  1XNQ L;  2B29 A;  2PO4 A;  1JWU D;  2CW0 D;  3UDI A;  2A74 C;  4JPB W;  3AFQ A;  3PO3 B;  2KEN A;  2HT1 A;  4S3S A;  1GKH A;  4XQQ A;  1PHJ A;  1X65 A;  1CK1 A;  4XXE A;  3A56 A;  5IP7 H;  2R7F A;  2I5L X;  1GVP A;  3M4Y A;  2NN6 I;  4CBV A;  4ID6 A;  4K14 A;  1JJC B;  3J81 c;  3Q22 A;  1J5E Q;  4JI8 L;  2K52 A;  4TKO B;  5JPM C;  5ELC A;  4YWK A;  1SE2 A;  2NVT B;  4GNX A;  3BU2 A;  2EYP A;  2N88 A;  1PDQ A;  2F3V A;  3FRP B;  4DV3 L;  5FO8 B;  4A3M G;  2JA6 H;  1J6Q A;  5CC4 A;  1W2B A;  1EL0 A;  1E7Z A;  2HD3 A;  4POF A;  4CDF C;  4HIK A;  1UEA B;  4MTN A;  3EFX D;  4DXG A;  3JC6 6;  4KK7 A;  5J1Z A;  4HJA A;  2B2Y C;  3KF6 B;  1Y8P B;  5C4X B;  3M4Q A;  1LTI D;  4JI6 L;  1UNS A;  4L5T A;  4C3H B;  1EQT A;  4A3G G;  3DM3 A;  2ZTD A;  3FKI B;  5CR3 A;  1KLG D;  3SEB A;  4A3M H;  2K5Q A;  4TSS A;  4DV5 L;  1LV9 A;  1D5X C;  3HKS A;  2EQS A;  3DHQ A;  1FNV A;  3NBH A;  4DV1 Q;  5JAV A;  4KHV A;  4CDC C;  4TQU S;  5M3M G;  1HTP A;  4P73 A;  5FO9 B;  4JV5 L;  2KBN A;  3BG3 A;  2Z6K A;  4LAA A;  1B44 D;  1LLR D;  2PYK A;  3NE5 B;  4OWX B;  5C4J B;  4JI0 Q;  5DEH A;  3V05 A;  4OX9 L;  2K5H A;  2ZXO A;  4MZ9 A;  5M5X B;  3DWQ A;  4A93 B;  3EQL C;  4K8J A;  3RNU A;  2JEB I;  2VW9 A;  1LTS D;  3A7L A;  3DMU A;  3GTG H;  4ABN A;  1TWC B;  1F77 A;  3S14 B;  2MO0 A;  4DV7 Q;  1KAA A;  4QUF A;  5T1G A;  4IO9 A;  2K04 A;  5M3M H;  4GN5 A;  1XMO L;  1OXV A;  4LUZ A;  2F4V Q;  4IFD G;  2EYO A;  1NCV A;  1S40 A;  3GTK H;  1CUK A;  1PXU A;  2KCT A;  4CKC A;  2UUC L;  3ULP A;  5I6Y A;  2UXB L;  4GOP A;  3S1R B;  4DR3 Q;  2A6H C;  4DKA C;  3UE0 A;  1G2T A;  4K6D A;  4TVA B;  4BY1 G;  5IGB A;  2WII B;  1LTT D;  3KLS X;  4IJH A;  1EWH A;  3NSW A;  4MN3 A;  1HZB A;  1D8L A;  2VQE Q;  1JCK B;  1PA6 A;  1Q8K A;  4IPH A;  1KDC A;  4H0L C;  1U4M A;  2E5L L;  4K2L A;  2NUC A;  1RTO A;  4ME3 A;  1B3A A;  4HTH A;  4DR6 L;  1N33 L;  1JWM D;  1MSG A;  1H9S A;  4K5V A;  2BDO A;  3E0J A;  1BO0 A;  1HR0 L;  4GLA C;  4BY1 H;  2O5I C;  4U67 3;  2I46 A;  3M85 A;  4CKE A;  5IGD A;  3IFT A;  2UUB L;  4JI2 L;  3C2P A;  1SEB D;  1U4P A;  1LT6 D;  1XNQ Q;  4UP7 A;  3GTJ H;  4FF1 A;  5KYI A;  4YWL A;  4AYB E;  1PRT F;  4FF4 A;  3ERO A;  3KJP A;  2K33 A;  1SDF A;  1VF5 C;  2MP1 A;  3S2D B;  2B2W A;  1L0X B;  1BKB A;  5IGG A;  5KND A;  4H44 C;  1IBM Q;  5C3W A;  4A3E G;  1P8L A;  4E6I A;  3NQT A;  4QUC A;  1S5B D;  2EYF A;  4YY3 L;  4IPG A;  3PF4 A;  3OWE B;  4HJ5 A;  1GHK A;  3PIO A;  2MGS A;  4YCU A;  1N8R C;  2K14 A;  4DV3 Q;  1OXX K;  1CI3 M;  1FGB D;  4LFB Q;  2F3W A;  1HNX L;  1KHI A;  2HDL A;  2L55 A;  5M3M B;  3F1Z A;  2B63 B;  2Y0S B;  4DK1 A;  1W6K A;  1D2B A;  4DK6 C;  1YJ9 A;  1ICF B;  1VQF A;  2XIW A;  3VYR A;  2Q2T A;  1KDA A;  1R4Q B;  4H13 C;  1II3 A;  3URY A;  1WTW A;  2I5H A;  1ILQ A;  4ILW A;  1STH A;  2ZJP A;  5EBD A;  1FD7 D;  1PFB A;  3L0O A;  1C8C A;  1WOC A;  5IGE A;  3I55 A;  1U0L A;  1WFQ A;  4X3S A;  5EKL A;  3DM1 A;  3GP7 A;  1PYS B;  3GO5 A;  3DLL A;  4PV1 C;  4DV5 Q;  1H9K A;  3G71 A;  5EGT A;  1DOK A;  3CCU A;  3OWF A;  3TP7 A;  3ERS X;  4JV5 Q;  1A3V A;  4L5Q A;  4LF8 L;  1C0A A;  5GQO A;  1NTG A;  4B3T L;  1V1Q A;  3MVV A;  4GN3 B;  1ZYR D;  4JOI A;  1STY A;  1SXT A;  2E2H B;  1KIX A;  4GOP C;  1JB3 A;  3BVG A;  1QNK A;  1FNW A;  1TQO A;  2F0G A;  4NW2 A;  4EGV A;  1WTX A;  3M3Y H;  3UDF A;  3TBI B;  3WOF A;  1XX8 A;  3GTP B;  1GO3 E;  4DV2 L;  3M9B A;  3K81 C;  2YTV A;  3GTJ B;  2AWO A;  1XMO Q;  1L0W A;  1B9N A;  2F3I A;  2NTT A;  2QCP X;  1V9P A;  1BBU A;  1E2Z A;  2EYM A;  2UUC Q;  2UXB Q;  1EU4 A;  2F0U A;  5LMN L;  2FFK B;  3FDT A;  4KHZ A;  2X69 A;  3H0G G;  4PZ7 A;  1TVX A;  2K1B A;  3QIA A;  4DV0 L;  4BBR G;  2XWJ B;  2UXD L;  1O80 A;  1QWY A;  1JWS D;  4A3L G;  2H4O A;  1BCP C;  1TS2 A;  1K3B C;  3GTO H;  3T1H L;  3R3O A;  3U50 C;  5BN3 A;  3OYY A;  1JR0 D;  3K58 A;  4NXN L;  1NJI C;  4V19 0;  4APV A;  2AUJ D;  4O1N A;  3FPU B;  5C6A A;  2B3G A;  3OMG A;  4M1U B;  4O42 A;  1N33 Q;  4FO2 A;  3H0G H;  2B2W C;  3G4S A;  3T1Y Q;  4IUU A;  1LTL A;  4BBR H;  3L2P A;  4ULL A;  1SE3 A;  1NY4 A;  5H1S E;  1IXR A;  3MA2 B;  5IE8 A;  2UUB Q;  4A3L H;  2WP8 J;  4OHJ A;  1VQB A;  4AH6 A;  3QB3 A;  2LMC B;  3GTQ B;  3MFY A;  4Z9C B;  1WD1 A;  1QG7 A;  2BOS A;  1G6P A;  1HPC A;  1D1K A;  3PQI A;  2PZW A;  1VQA A;  1DJR D;  5GRO A;  2I5M X;  2G9H D;  2RCF A;  4FP5 D;  4DAM A;  2EE1 A;  2F0E A;  4BY7 B;  1SE4 A;  2K5V A;  1A15 A;  1QNU A;  2KEE A;  1DGS A;  3PGZ A;  1ASY A;  3HKZ B;  4YY3 Q;  1BDO A;  2F0V A;  2OXP A;  4AYB B;  4LJZ C;  1VQE A;  4G7O C;  1PH4 A;  3TN2 A;  4K6L A;  4DXF A;  1M90 C;  1HNX Q;  4GKK L;  5M5Y H;  2RHS B;  4DV4 L;  5A2Q L;  3HOZ B;  1Z9F A;  4UHV A;  4I65 A;  5AFW A;  1PH2 A;  3EJI A;  3T53 B;  1I50 H;  2K4K A;  3BYY B;  3CCS A;  1EOV A;  1BOS A;  1FNU A;  3TSS A;  2OF1 A;  1AW7 A;  1K9M C;  1ONL A;  3HG9 A;  3X3N A;  1PYB A;  3OTO L;  4G7H C;  1YNJ C;  3VYU A;  2BDN A;  1PTO H;  3CKI B;  2QIL A;  5CV5 A;  1PV4 A;  3A8K E;  5IWA L;  4DNR B;  4XQN A;  3E5S A;  1PH6 A;  1BQQ T;  1BCP D;  5I6W A;  2QDB A;  3HS0 C;  1GUG A;  1FR3 A;  4XDX A;  4R8I A;  1G91 A;  4LF8 Q;  3DUZ A;  5EKK A;  4KKS A;  4X3T A;  1VQO A;  3H6M A;  4GKJ L;  5FLX c;  2WAC A;  4BBR B;  1IYU A;  2ZT9 C;  5GAE C;  4K5X A;  1V1P B;  3S1Q H;  2PW5 A;  1YJN A;  1S5C D;  1E0B A;  1WCM G;  1EY7 A;  4JI5 L;  3BDO A;  1W3S A;  3BZC A;  4KJO A;  4DV2 Q;  1JJ2 A;  5E7N A;  1DCZ A;  5D65 A;  1HH2 P;  1KRT A;  3I4N B;  3CHB D;  1PH8 A;  2JQO A;  2QGQ A;  4K5W A;  1B9M A;  2VB2 X;  1VQ8 A;  1ESF A;  5JJK A;  1I4X A;  3PMF A;  4RMF A;  3Q6S A;  4GLV B;  4NPS A;  1GUS A;  1LYL A;  1STB A;  4PMC A;  2K32 A;  2TSS A;  3P1H A;  4IUP A;  1WCM H;  1NR2 A;  5M3F G;  3C3L A;  3WOE A;  3K57 A;  4LF7 Q;  3MXN A;  4IFD I;  1E2V A;  4GNX B;  4PMB A;  1OXU A;  3S1M B;  4HED A;  1V8Q A;  3T1H Q;  2XSC A;  3CPW A;  2R93 G;  2RHQ B;  3O13 A;  4PZ6 A;  1W6J A;  4NXN Q;  1VDZ A;  1JB7 A;  4J8Q A;  3D4D A;  2RA4 A;  4ZKC B;  4OWW B;  1TWG H;  5ELE A;  5ELN A;  1I50 B;  1LAC A;  1PZI D;  2K50 A;  2B2V A;  5M3F H;  2IHF A;  5JVG 3;  2EYL A;  3LWE A;  4PG3 A;  4JYA L;  1QJO A;  2Q2U A;  3S2H B;  1XPR A;  2Z1C A;  3S1N H;  2R93 H;  1HNZ L;  1LTG D;  1EQR A;  5FLX E;  3F8T A;  1GOZ A;  1YNJ D;  2Z0S A;  1Y8O B;  3NBH B;  2N3S A;  2WKC A;  2YV5 A;  5LL6 X;  4DUY L;  3SHL A;  3TP5 A;  5CGK A;  4EX5 A;  4HCE A;  1HZ9 A;  1Z47 A;  1IBL Q;  1I6H H;  2J7Z A;  4R4C A;  1D6E C;  1EY6 A;  2IW3 A;  3AFP A;  1KAW A;  2N8N A;  4XYQ A;  3KF8 A;  5HGQ A;  4KKT A;  2HCI A;  2OTL A;  4Y52 H;  3J80 i;  1BVS A;  3K0Y A;  1EFI D;  1MBY A;  1CA6 A;  1TWF B;  4A4I A;  3AU7 A;  4KD4 A;  1U4L A;  3CU7 A;  4DV4 Q;  3BDC A;  2CKZ B;  3J7A 5;  2KA7 A;  2R6G A;  2E2I H;  3HOV G;  1PZJ D;  2JA8 G;  3K7A B;  3FEW X;  1VQG A;  4C2M H;  1ZEQ X;  2IHE A;  4A3C G;  1PMR A;  1PTO F;  1SRU A;  1I5F A;  1O78 A;  4Y7N B;  2F0H A;  3OTO Q;  4CKB A;  2VQF L;  1JC7 A;  5IT9 E;  3S15 H;  4DAY B;  1HA6 A;  5IWA Q;  4P75 A;  4KY5 A;  3GTL B;  3K5O A;  1EWI A;  2EDG A;  2B8F A;  2A6E D;  3HOV H;  1MSH A;  2JA8 H;  1A2U A;  1DXM A;  2L9H A;  5TSS A;  2NVQ B;  5M9O A;  3EVQ A;  3H3V I;  4A3C H;  2F0M A;  2YU9 H;  4FF3 A;  4GKJ Q;  4YHH L;  2E76 C;  1DOM A;  4I7Z C;  1STA A;  5E4X A;  4GLX A;  1V1P A;  1A3T A;  1H9S B;  1NNX A;  5D14 A;  2HHH Q;  3V2T A;  3ERQ A;  1SJH D;  3VR3 A;  4JI5 Q;  1CTM A;  1PLF A;  4A3B G;  3ULL A;  3I7F A;  2EIF A;  2JA5 G;  2RDF A;  3S1N B;  2R93 B;  2XRQ D;  3PIP 3;  3J80 L;  2KOL A;  2NVY B;  2VL6 A;  1E1O A;  2VY3 A;  2PMZ E;  3L9A X;  5NUC A;  1EEI D;  1PZK D;  2F0S A;  5KNC A;  2ICI A;  1KDB A;  2JJQ A;  2XGT A;  1SNQ A;  4EQP A;  4PNY A;  4BA1 I;  1S4Z A;  4F88 A;  4C3I B;  1I6H B;  2ZJQ A;  2PZT A;  4L63 B;  1S5D D;  3RZO B;  1K8G A;  1L0Y B;  1K28 A;  3JAM c;  3S16 H;  5IGC A;  1CKN B;  3QWN A;  4A3B H;  4IUT A;  1KTK A;  1XPO A;  2JA5 H;  1EUJ A;  1F9R A;  4A3J B;  4HIM A;  2K05 A;  4A3K G;  4R4I A;  3GQB A;  1O7L A;  1YBY A;  2HCC A;  1MI2 A;  1JOO A;  4C2M B;  1VQP A;  2RF4 A;  5J39 A;  4JK1 C;  5BN4 A;  4LF5 L;  5C0X G;  2LXJ A;  2DJF C;  1RL2 A;  4DR5 Q;  3U4Z A;  2E2J B;  3TS2 A;  2QW7 A;  3RMH A;  3HOW G;  1K8A C;  2C35 B;  1EQQ A;  1BF4 A;  1JE4 A;  3LWU A;  3SDZ A;  2CQO A;  1M1K C;  1SFO H;  4JYA Q;  3S15 B;  4HIO A;  1IBK Q;  2ATW A;  4V0B A;  1I4Q A;  1EYG A;  4A3K H;  1HNZ Q;  3PO2 B;  2IWH A;  2EY2 A;  4LF9 Q;  1AE3 A;  2QDL A;  5DM6 3;  1Q12 A;  1B50 A;  3EA6 A;  3SE0 A;  5KRU A;  3X3M A;  2FMC A;  4NMZ A;  1HFG A;  4YIJ A;  1MJE A;  1ICW A;  1RIP A;  2YU9 B;  3B6Y A;  5C0X H;  3NTI A;  2L1B A;  4FYD A;  2R7Z G;  4DV6 L;  1EIH A;  5ELB A;  3HOW H;  1Y8N B;  1Y14 B;  4A3G H;  5FOB B;  1ESR A;  3EN2 A;  1WD0 A;  2I0Q A;  3BVM A;  1TU2 B;  2A1A A;  4IUN A;  2K5W A;  4RGT A;  3CCV A;  3M7N A;  3CCM A;  3NTK A;  1EIG A;  4ZK9 B;  5JJZ A;  3ZJY C;  1CKM A;  4GS3 A;  4AQY L;  1J9O A;  4M8A A;  5ISR A;  1IKM A;  4ZCK A;  4LF6 L;  4FXD A;  3QJY A;  4DK0 A;  3JAM E;  1QIL A;  1ENA A;  4B3R Q;  2MFI A;  2DJG C;  2R7Z H;  1SYD A;  1PRT B;  4LF4 L;  4JVZ A;  3F2D A;  3VR2 A;  1QZH A;  2QKI C;  1X6O A;  4ALP A;  4DAY A;  4K0K L;  1PYW D;  5G3L D;  2JA6 B;  4N9T A;  2F0I A;  3I72 A;  1OXT A;  1RHP A;  1VS0 A;  1BBW A;  5CV7 A;  3AEV A;  3LGJ A;  4XQJ A;  5CBA E;  2EYJ A;  1G2S A;  1WTQ A;  1AP0 A;  3RR5 A;  4B08 A;  1NSN S;  4R4Q A;  1CQV A;  2N55 A;  2O5J C;  1ZYR C;  1QCB D;  1VQM A;  1PFN A;  2F0Q A;  3S17 H;  4IFD H;  5BR8 L;  2FHT A;  3CCJ A;  2RSN A;  1HQR D;  4RCO A;  2F1M A;  1L1O B;  1CFM A;  3STB D;  3D4W A;  4X66 L;  3D31 A;  4DR4 Q;  2MJ8 A;  2MUY A;  3D8G A;  3NTH A;  3I90 A;  4RFB A;  2ZTE A;  3ONA B;  1NE3 A;  1Y1V G;  1SFO B;  4GNX C;  1SNO A;  4A3M B;  3BYT B;  4ZUI A;  2UU9 L;  4C1N I;  2F0P A;  3GD7 A;  2LFN A;  1QVG A;  3IAY A;  3T56 B;  2Q2I A;  4DPG A;  1K8M A;  4HJ7 A;  3MWY W;  5E1F A;  2ICE C;  1B4O A;  3I2Z A;  1I94 L;  2R92 G;  3D0F A;  4OL7 A;  3QG1 A;  3E0E A;  4ZKB B;  2ZJR A;  3I4M G;  3AMU A;  3HOX G;  1QE6 A;  4A3G B;  4JI8 Q;  3T13 A;  1K3R A;  1Y1V H;  4DR2 L;  1PVO A;  5C3E G;  3BS1 A;  1CKN A;  1NR4 A;  4WJ4 A;  1B8A A;  3VA7 A;  3HOY G;  1KL9 A;  2MO1 A;  4DUZ L;  5JEA G;  3GTG B;  4X64 L;  3T51 B;  3S24 A;  2XTI A;  1IL2 A;  2E2D C;  3CAM A;  1YZ6 A;  1RF2 D;  2B2T A;  1WVL A;  2VZA A;  3I8Z A;  4LW1 A;  5C44 G;  1B7Y B;  4CHT B;  2Z6K C;  4A3F G;  3MXU A;  3GTK B;  4ZUJ A;  1K73 C;  4LF5 Q;  3I4M H;  1BBX C;  2IT1 A;  1GUT A;  3OMC A;  4KV6 A;  3HOX H;  2WV6 D;  3M4O H;  4JI6 Q;  4A3E H;  1XYI A;  1KNA A;  5FO7 B;  5C3E H;  3HOY H;  4QIW E;  4JCV E;  3HP3 A;  3KYH C;  5JEA H;  1CZG A;  4QY7 A;  1WTP A;  3P7J A;  1AZP A;  4CDE C;  1VMC A;  4UAI A;  1STN A;  4OEL B;  5J3B A;  1SND A;  1HUN A;  3NK9 A;  1WTR A;  3RLF A;  1Q1E A;  2F0L A;  5GAH C;  5C44 H;  4A3F H;  1HJP A;  2SNS A;  5CV6 A;  4Q5V A;  5JVH 3;  1SYG A;  4ZRZ A;  3J7Y W;  4OX9 Q;  3MXG A;  4DV6 Q;  1LO5 D;  1X3Q A;  3KUP A;  5HY6 A;  4DNT B;  3J81 i;  1GUW A;  4BY1 B;  2M9V A;  4UP9 A;  1YHA A;  4XT1 B;  1XJV A;  1EQV A;  5LL6 S;  3H3V H;  2QA4 A;  3RLO A;  5EKI A;  1SMY C;  4QQB X;  2D5D A;  1TS4 A;  4WFN 3;  2NVX H;  2F4I A;  1KAB A;  3MFG A;  2KCN A;  4KKU A;  1WJJ A;  2K03 A;  3KOJ A;  3W2D A;  3C1F A;  2RSO A;  3NWT A;  5E3F A;  2K5D A;  1TWA H;  4IJL A;  1RTN A;  4JBJ A;  3CC7 A;  3WDN A;  1Q81 C;  4TRD A;  4LF4 Q;  1C48 A;  2ZXP A;  1Y1V B;  3KDF B;  4IZ8 A;  4JI1 L;  4UDU C;  4X6A H;  1SRO A;  2JP1 A;  2B2U A;  2Q8I B;  4LFA L;  2X6L A;  2J4X A;  3UDX A;  3MXN B;  3F2C A;  2K6A A;  2F0N A;  4DF7 A;  1M4V A;  1B2T A;  1SNM A;  2E5L Q;  1XTD A;  1D1I A;  5HUR A;  5BR8 Q;  1E3P A;  1IZ6 A;  1G8Z D;  3NEN A;  1L1O A;  4DR6 Q;  3I4M B;  1DD2 A;  4P71 A;  3HOX B;  3M4O B;  2PI2 E;  4CJ0 B;  4X66 Q;  4A3E B;  4H7B A;  1TWH H;  1HR0 Q;  5C3E B;  3H15 A;  3HRZ C;  3CW2 C;  4OIK A;  1N34 L;  1MKH A;  1SYB A;  4HR7 B;  4L5R C;  1C4Q A;  3J81 L;  4JI2 Q;  1HNW L;  5CV9 A;  1M8A A;  4OWT B;  5M5W H;  4F7X A;  1ZXT A;  3BZD B;  2R61 A;  1I94 Q;  3DEP A;  4A75 A;  4Q0F A;  1EY4 A;  3HOU G;  2EYH A;  4WRD A;  1MHW C;  4POG A;  3OIQ A;  1XXG A;  2CCZ A;  3KFU A;  2SEB D;  1LT3 D;  3H94 A;  3PUZ A;  4DR2 Q;  4A3I G;  3M3Y B;  3KF8 B;  4DUZ Q;  2YYZ A;  4B3S L;  4X64 Q;  1SNC A;  4DAV A;  1I4H A;  3T16 A;  1SMY D;  4OO1 G;  4DR1 L;  4F8M A;  3TZD A;  5EBC A;  4CJ2 C;  3RN2 A;  2R7D A;  3HOU H;  3FMC A;  3OSO A;  4DAP A;  1K0R A;  5C4H A;  4X62 L;  3Q24 A;  5LMU L;  2B39 A;  2LKV A;  4HMJ A;  4YCV A;  1CHP D;  4KTA A;  1CHQ D;  4B3M L;  3D6C A;  1ENF A;  4JOI C;  1D5Z C;  4A3I H;  1VQN A;  1Q3L A;  4N8F A;  4B9W A;  2VB3 X;  1E1T A;  4DN4 M;  2OEO A;  3KLW A;  3R2I A;  2MPM A;  4JBW A;  4BS9 A;  5C0X I;  3RUZ A;  1JT8 A;  3GTO B;  4OO1 H;  2BE5 C;  2RDG A;  1Y1W G;  2RKS A;  1ET6 A;  2IX3 A;  2PCF B;  2OWO A;  2AHO B;  2C5C A;  1CT1 D;  1O7I A;  3A54 A;  3ITP A;  4QIW B;  1EZ8 A;  4B3T Q;  3H0G B;  1RD9 D;  2WAQ E;  1PRT C;  5AJ3 L;  1B70 B;  2WB1 G;  1TS5 A;  4A3D G;  2KUM A;  1YHQ A;  1CSP A;  4QGU A;  3CD6 A;  4JBM A;  4H02 A;  4RHR A;  1CZW A;  1EY0 A;  2BH2 A;  3D3R A;  2A68 D;  4FXK C;  1EFW A;  1Y1W H;  3T4A C;  3K0X A;  2HQE A;  4LUO A;  4DGZ A;  3U4V A;  4IPC A;  1QB5 D;  2HUG A;  3VR5 A;  4KHP L;  4IUQ A;  2PPB C;  1J8I A;  4MIU A;  1L1O C;  5FKA C;  2O2L D;  2ALY B;  2D0P A;  4IFD J;  5LMN Q;  1TR5 A;  5ELO A;  4RCN A;  3KDF A;  1EZ6 A;  2D0O A;  4ZLT F;  3S9W A;  4DV0 Q;  3K59 A;  2EXZ A;  1BUV T;  4JI1 Q;  4EQN A;  4A3D H;  2UXD Q;  4R8N A;  3AQQ A;  1S72 A;  4IAL A;  1Q8I A;  5C5M A;  4LFA Q;  1Q1B A;  2A6E C;  4IOC A;  4BBS G;  5M5Y B;  2RBM A;  3RD4 A;  4XYO A;  2QEX A;  1WTV A;  1HHV A;  2L0C A;  4HCS A;  2WAQ G;  3HOU B;  3MEF A;  1SYF A;  5FJ8 G;  3QOJ A;  5IT9 c;  2Z4I A;  1GUN A;  3NHH A;  1ML0 D;  1NUC A;  2JEA I;  1S3O A;  2SDF A;  2LSS A;  2JXM B;  1X9N A;  1FGU A;  1YVC A;  1V1O A;  1ROD A;  2K28 A;  3LX0 A;  1N34 Q;  4ME5 A;  2A69 C;  4IN3 A;  4J15 A;  1PTO B;  1A62 A;  4BBS H;  1DZ1 A;  1A3U A;  1X3P A;  3NWS A;  3E3X A;  2C9O A;  2CFM A;  1NBW A;  3BJU A;  4HSP A;  5FJ8 H;  1UE7 A;  2BE5 D;  2F03 A;  1LTB D;  3N52 A;  2DN8 A;  3ER0 A;  1VQ4 A;  5BN5 A;  1HXY D;  3OOC A;  2XNA C;  3S1Q B;  1B1Z A;  1EU3 A;  1K83 H;  1UE6 A;  1Q86 C;  1LTR D;  4RWS C;  5IGF A;  1PRT D;  3K80 C;  4C3J G;  3MAQ A;  4B3S Q;  4JI3 L;  1PFS A;  1JE5 A;  1VQC A;  2MNA A;  1KNE A;  4GKK Q;  5JEA J;  1GJX A;  2B2Y A;  1HQM C;  1UE1 A;  1KD1 C;  2NB0 A;  3FVQ A;  2YTX A;  3KLR A;  4HAE A;  1YEZ A;  5C4X G;  5IYD G;  3A5Z B;  4X62 Q;  3N6R A;  5LMU Q;  4C3H G;  1YJW A;  3FHW A;  1K8O A;  4B3M Q;  2NVT H;  3FKI G;  1GUO A;  4X3K A;  2JK8 A;  1DOL A;  2VNU D;  2L12 A;  1WCM B;  2NZO A;  2AQ3 B;  4C3J H;  4DV7 L;  2MHV A;  3K8A A;  4YWM A;  2OCE A;  3E9H A;  3F2U A;  5JOB A;  2F0J A;  3I56 A;  4P2C B;  3MTS A;  3PCO B;  1N9W A;  4OON A;  1JOR A;  5C4X H;  3CC2 A;  2E74 C;  2N49 A;  3A0J A;  5IYD H;  5CBE E;  4DR3 L;  4C3H H;  4XTC S;  2X6G A;  1EIF A;  2E8G A;  1EWC A;  3ULJ A;  1Q7Y C;  1TWG B;  4R4T A;  4RAU C;  3FKI H;  1F2Y A;  4PMW A;  3CCL A;  4BA2 I;  4BXX G;  4A93 G;  1F9S A;  4JC0 A;  3K5M A;  1AEX A;  1MJC A;  4NXM L;  1GXD C;  2JYO A;  5M3F B;  2ES2 A;  2NYZ D;  1VQ5 A;  4HID A;  1N32 L;  2V4D A;  2V1C C;  3NUC A;  2JE6 I;  1XPU A;  3GDE A;  4IQZ A;  2VS1 A;  5EAY A;  5JJL A;  2A69 D;  3EBE A;  5K36 G;  4QB4 A;  2AMC B;  1G6Z A;  1KQS A;  4KHP Q;  3OHX C;  1EIY B;  3I73 A;  3PSI A;  5M5X H;  4OXP A;  2GVB A;  4BXX H;  2B8G A;  4A93 H;  1LM0 A;  1E24 A;  5D3I B;  4YCW A;  3GTM H;  3BDL A;  5ELD A;  5CV8 A;  2KCM A;  3L7Z C;  2ID0 A;  1TWC H;  2B2V C;  3S14 H;  4DA2 A;  4BWG B;  2L11 A;  4QF4 A;  1X3F A;  4X3U A;  2LXK A;  1QZG A;  1H9M A;  3GV6 A;  4K8I A;  4WJ3 M;  3CME A;  5K36 H;  2HIX A;  4EVO A;  1LT4 D;  4KN7 C;  2E2I B;  1U9R A;  3STB C;  1KC8 C;  2Y0S E;  4UP8 A;  5K5P A;  2WFW A;  3S1R H;  1IBM L;  4KJN A;  2Q8R E;  1N36 L;  1VQH A;  1VMP A;  2EOT A;  2N78 A;  3IRB A;  1H9J A;  2NZH A;  3EIV A;  2IPK D;  3H3V C;  4GZY C;  4LFB L;  4C3J B;  2Q2H A;  4UY8 C;  2EJG C;  2KHS A;  5KGU A;  1PH1 A;  4DU9 A;  2CQA A;  2OTJ A;  1Q46 A;  2PI2 A;  3P75 A;  3A8I E;  4KI0 A;  4L5S A;  3WWV A;  3G48 A;  1CKO A;  3HOV B;  3SGI A;  2JA8 B;  4DUY Q;  1BCP F;  4HN7 A;  5LHY 1;  3U9O A;  2DGY A;  1ZKO A;  1JJG A;  5COY A;  3BZK A;  3F2B A;  4EQO A;  2Z8L A;  1X55 A;  2PNH A;  1A6X A;  2EJM A;  1K0S A;  2DY8 A;  2ZM6 L;  3PV0 A;  3K5L A;  1SE8 A;  1CA5 A;  3QOL A;  5EPJ A;  2FMM A;  1I4P A;  5I2X A;  2I07 B;  4JI3 Q;  1X3E A;  2O4X A;  4G57 A;  1T5X D;  2B63 G;  5IYB G;  2RDH A;  1CSQ A;  2Y0S G;  2K01 A;  3IFD A;  1P16 A;  4RKB A;  3IKJ A;  1HUM A;  1SBB B;  2JN4 A;  3VYS A;  5C3X A;  3S2D H;  1H9R A;  1VQ9 A;  1PH7 A;  2F0W A;  3CCR A;  3MZ5 A;  3SVM A;  2HDM A;  1QOH A;  1FYC A;  5KYL A;  1H95 A;  3V96 A;  3GTM B;  2ASB A;  3TQY A;  1VQL A;  1XMQ L;  4OO1 I;  4B9X A;  2H5X A;  2CH4 W;  5FLX L;  3S16 B;  3J81 E;  4XIG S;  4A3B B;  2VQF Q;  1SLJ A;  2JA5 B;  2FJ2 A;  4FXG C; 
#chains in the Genus database with same CATH homology
 1TS3 A;  4IUV A;  2J0T D;  3ZYY X;  1BXT A;  3NP8 A;  1SYC A;  3KBX A;  5EQ0 A;  3TDQ A;  2D62 A;  1Z7T A;  1WTO A;  3C1E A;  3VR6 A;  4G7Z C;  1OO9 B;  1Z6H A;  3PUW A;  1TKW B;  1PFM A;  5F2D A;  2BCO A;  2CHB D;  1DM0 B;  4J6H A;  1LT5 D;  2A73 B;  4A3K B;  4NKL A;  1SSO A;  1HCZ A;  5A2Q E;  5CYU A;  4FNF A;  4KD3 A;  3R93 A;  2DNC A;  3R8B A;  3HOW B;  3TZU A;  5IT9 L;  1LTA D;  1E2W A;  1VF7 A;  3UI2 A;  3I91 A;  1HA5 A;  1JQY D;  5J22 A;  1PTO C;  2PMZ B;  4RKL A;  2TMP A;  2KQ3 A;  2Z4H A;  2NWG A;  2EVB A;  2EY1 A;  2QEJ C;  5I2Y A;  1TY0 A;  3R2T A;  1SJE D;  4OGQ C;  4HMI A;  5KEE A;  4C1N K;  1IW7 C;  2R7Z B;  2PNR C;  3MC0 B;  1R4P B;  1F2Z A;  3HZX A;  1YNN C;  2Q8T A;  5CMD A;  5FK9 C;  2IX0 A;  3K6O A;  1EYD A;  2PW7 A;  4G4K A;  1XWE A;  3H09 A;  4RH6 A;  3A7A B;  2F0O A;  2RQX A;  3S17 B;  3J7A F;  3L3O C;  1I3Q B;  4HSV A;  3VR4 A;  1O7Y A;  1F2L A;  3IL8 A;  2A6H D;  2PQE A;  2DNE A;  1CQF A;  3HEJ A;  1TY2 A;  4QMG A;  2NBF A;  5IIF A;  2KCC A;  5I4D A;  1VCI A;  1EY5 A;  4RA8 A;  4R9W A;  4ODG A;  2F0F A;  1LAB A;  4MHE A;  3Q23 A;  3SK5 A;  3NBI A;  3VYT A;  1SNP A;  1SAP A;  3PUX A;  2NN6 G;  1JOK A;  5JPN C;  4FVM A;  1IYV A;  2L5T A;  2XVS A;  3KK7 A;  1EYC A;  4L6T B;  1PTO D;  3OIP A;  4RGM A;  2AUK A;  1ENC A;  2R92 B;  2IJ0 A;  1JIC A;  2PZU A;  3NQI A;  4PQX A;  2ENB A;  1I4G A;  3PUY A;  4LK1 C;  4IUR A;  1MD2 D;  4QCL A;  3E6Z X;  1IW7 D;  1EY8 A;  2NN6 H;  2WIN B;  4N9P A;  2H1E A;  3HOY B;  4WJW A;  2A68 C;  3BVZ A;  1DON A;  1YNN D;  1A2T A;  1EOT A;  2GA4 B;  2IX1 A;  3JAM L;  1B53 A;  4OIJ A;  5C44 B;  2B2T C;  1GHJ A;  1S5E D;  4A3F B;  2E75 C;  1AN8 A;  3G7L A;  5IOC A;  2R3Z A;  1ILP A;  4K2K A;  4KMU C;  1HTL D;  3A55 A;  4U68 A;  2SOB A;  3QO2 A;  2M2L A;  3H91 A;  2NVX B;  1DYQ A;  3SR1 A;  4ZAI A;  3C46 A;  3FPP A;  3I70 A;  1TWA B;  1ET9 A;  1CM9 A;  1RJT A;  1MGS A;  3PIO 3;  5IOD A;  3MHB A;  5C0X J;  4XT3 B;  1KLU D;  3DEO A;  3SXH A;  3DWA A;  2VXW A;  5DNF A;  2EZV A;  2KJX A;  3J80 E;  5DAU A;  5G3L F;  3TP8 A;  1OXS C;  2F0T A;  3M7G A;  5C5L A;  2AQ2 B;  2CVR A;  3DWP A;  5COR A;  1R9T B;  5CV4 A;  5KNB A;  1TWH B;  2D9U A;  2KED A;  3D4R A;  1G29 1;  4L8J A;  2B2U C;  5T1I A;  3AB9 A;  3RZD B;  5M5W B;  3I3C A;  4ZYS A;  4DFA A;  2F0D A;  3J7A V;  1IKL A;  3OPO A;  2XWB B;  1JOQ A;  2F0K A;  5A35 A;  2EY6 A;  3K5N A;  2KEC A;  3NPP A;  2BA1 A;  3TP6 A;  1F9P A;  2A5H A;  1SYE A;  1I6V C;  4RGO S;  4J1M A;  2WKD A;  5HGT A;  2RVL A;  1Q90 A;  2LS0 1;  1Y69 U;  1NAP A;  2IL8 A;  2KVM A;  1F9Q A;  1I4R A;  3SK8 A;  4NP5 A;  1BR9 A;  4A3I B;  1IL8 A;  5EJW A;  3MXP A;  4LMQ D;  4FF2 A;  3VA5 A;  3W3A A;  1STE A;  1AFP A;  2NZ1 D;  3MEH A;  1HFN A;  2FIN B;  3GV3 A;  3HGB A;  2DY7 A;  5I9O A;  5E4W C;  2LY7 A;  3D6W A;  3OW7 A;  5KIX A;  1HRJ A;  4C3I G;  1RDP D;  1STG A;  2QF7 A;  2SNM A;  1IHZ A;  4NDX A;  3KBG A;  2CW0 C;  3ND8 A;  3PUV A;  2D2C C;  2M00 A;  5D3D A;  1D5M C;  3A8J E;  3LNN A;  1RCV D;  1Y1W B;  5I9P A;  3ND9 A;  3U9S A;  3NXW A;  1X32 A;  1S5F D;  3SK6 A;  3CQZ B;  1RKN A;  1TII D;  5EPL A;  2WB1 B;  4CJ1 B;  3Q0A A;  4A3D B;  1AZQ A;  2JA7 B;  5ELF A;  1EEF D;  1UAP A;  3TME A;  4KY6 A;  3CRK C;  2EY5 A;  4WOR A;  1TT2 A;  5DM7 3;  4KN4 C;  2JSO A;  1F2M A;  5EPK A;  3SK4 A;  3DXJ C;  1U4R A;  3I4L A;  4CGY B;  2OT2 A;  1EY9 A;  4RHS A;  2EPB A;  2ZXR A;  1UUP A;  4KY7 A;  2G9D A;  2VUM B;  2XRS D;  1V43 A;  2EJF C;  2L4N A;  4BBS B;  4C56 C;  2XN9 C;  2NTS A;  3KLS A;  2K7V A;  2WAQ B;  1T5E A;  4ZQ3 A;  1O7Z A;  4F87 A;  2AWN A;  3P20 A;  1EYA A;  2AQ1 B;  4RGN A;  2BA0 A;  3CRL C;  1BNZ A;  3G6J B;  5C4Z A;  1BCP B;  1K83 B;  1XTC D;  2PO4 A;  1JWU D;  2CW0 D;  2A74 C;  3PO3 B;  4S3S A;  4XQQ A;  1CK1 A;  4XXE A;  3A56 A;  3M4Y A;  2NN6 I;  4CBV A;  4ID6 A;  4K14 A;  3Q22 A;  4TKO B;  5JPM C;  5ELC A;  1SE2 A;  2NVT B;  2EYP A;  2N88 A;  1PDQ A;  2F3V A;  3FRP B;  5FO8 B;  5CC4 A;  1EL0 A;  1UEA B;  4DXG A;  3EFX D;  4KK7 A;  5J1Z A;  2B2Y C;  1Y8P B;  5C4X B;  1LTI D;  1UNS A;  4C3H B;  1EQT A;  3FKI B;  5CR3 A;  1KLG D;  3SEB A;  2K5Q A;  4TSS A;  1LV9 A;  1D5X C;  3DHQ A;  1FNV A;  3NBH A;  5JAV A;  4KHV A;  4TQU S;  1HTP A;  5FO9 B;  3BG3 A;  4LAA A;  1B44 D;  1LLR D;  2PYK A;  3NE5 B;  5C4J B;  5DEH A;  3V05 A;  2ZXO A;  5M5X B;  3DWQ A;  4A93 B;  3EQL C;  4K8J A;  2JEB I;  1LTS D;  3A7L A;  3DMU A;  4ABN A;  1TWC B;  1F77 A;  3S14 B;  1KAA A;  4QUF A;  5T1G A;  2K04 A;  1OXV A;  4IFD G;  2EYO A;  1NCV A;  1PXU A;  4CKC A;  5I6Y A;  3S1R B;  2A6H C;  1G2T A;  4K6D A;  5IGB A;  2WII B;  1LTT D;  3KLS X;  1EWH A;  3NSW A;  4MN3 A;  1JCK B;  1KDC A;  4H0L C;  1U4M A;  4K2L A;  2NUC A;  1RTO A;  1B3A A;  4HTH A;  1JWM D;  1MSG A;  1H9S A;  4K5V A;  2BDO A;  3E0J A;  1BO0 A;  2O5I C;  4U67 3;  2I46 A;  3M85 A;  4CKE A;  5IGD A;  3IFT A;  3C2P A;  1SEB D;  1U4P A;  1LT6 D;  4FF1 A;  5KYI A;  1PRT F;  4FF4 A;  3ERO A;  2K33 A;  1SDF A;  1VF5 C;  2MP1 A;  3S2D B;  2B2W A;  1L0X B;  5IGG A;  5KND A;  4H44 C;  5C3W A;  4E6I A;  3NQT A;  4QUC A;  1S5B D;  2EYF A;  3OWE B;  1GHK A;  2MGS A;  1OXX K;  1CI3 M;  1FGB D;  2F3W A;  2HDL A;  2L55 A;  5M3M B;  2B63 B;  2Y0S B;  4DK1 A;  1W6K A;  1D2B A;  3VYR A;  2XIW A;  1KDA A;  1R4Q B;  4H13 C;  1II3 A;  3URY A;  1WTW A;  1ILQ A;  4ILW A;  1STH A;  5EBD A;  1FD7 D;  1PFB A;  1C8C A;  5IGE A;  4X3S A;  5EKL A;  3DM1 A;  3GP7 A;  3GO5 A;  4PV1 C;  1H9K A;  5EGT A;  1DOK A;  3OWF A;  3TP7 A;  1A3V A;  3MVV A;  1ZYR D;  1STY A;  1SXT A;  2E2H B;  1JB3 A;  3BVG A;  1QNK A;  1FNW A;  1TQO A;  2F0G A;  4NW2 A;  4EGV A;  1WTX A;  3TBI B;  3WOF A;  1XX8 A;  3GTP B;  3GTJ B;  2AWO A;  1B9N A;  2NTT A;  2QCP X;  1E2Z A;  2EYM A;  1EU4 A;  2F0U A;  2FFK B;  3FDT A;  4KHZ A;  2X69 A;  1TVX A;  2K1B A;  3QIA A;  2XWJ B;  1O80 A;  1QWY A;  1JWS D;  2H4O A;  1BCP C;  1TS2 A;  3R3O A;  5BN3 A;  1JR0 D;  3K58 A;  4V19 0;  2AUJ D;  4O1N A;  3FPU B;  5C6A A;  3OMG A;  4M1U B;  4O42 A;  4FO2 A;  2B2W C;  4IUU A;  4ULL A;  1SE3 A;  3MA2 B;  2WP8 J;  4OHJ A;  3QB3 A;  2LMC B;  3GTQ B;  3MFY A;  4Z9C B;  1WD1 A;  1QG7 A;  2BOS A;  1HPC A;  1D1K A;  2PZW A;  1DJR D;  2G9H D;  4FP5 D;  2EE1 A;  2F0E A;  4BY7 B;  1SE4 A;  1A15 A;  1QNU A;  2KEE A;  3HKZ B;  1BDO A;  2F0V A;  2OXP A;  4AYB B;  4LJZ C;  4G7O C;  3TN2 A;  4K6L A;  4DXF A;  5A2Q L;  3HOZ B;  4I65 A;  5AFW A;  3EJI A;  3T53 B;  3BYY B;  1BOS A;  3TSS A;  1FNU A;  2OF1 A;  1AW7 A;  1ONL A;  3HG9 A;  3X3N A;  4G7H C;  1YNJ C;  3VYU A;  2BDN A;  1PTO H;  3CKI B;  2QIL A;  5CV5 A;  3A8K E;  4DNR B;  4XQN A;  3E5S A;  1BQQ T;  1BCP D;  5I6W A;  2QDB A;  3HS0 C;  1GUG A;  1FR3 A;  4XDX A;  4R8I A;  1G91 A;  3DUZ A;  5EKK A;  4KKS A;  4X3T A;  3H6M A;  2WAC A;  4BBR B;  1IYU A;  2ZT9 C;  4K5X A;  1V1P B;  2PW5 A;  1S5C D;  1E0B A;  1EY7 A;  3BDO A;  4KJO A;  1DCZ A;  5D65 A;  3I4N B;  3CHB D;  4K5W A;  1B9M A;  2VB2 X;  1ESF A;  1I4X A;  3PMF A;  3Q6S A;  1GUS A;  1STB A;  4PMC A;  2K32 A;  2TSS A;  3P1H A;  4IUP A;  1NR2 A;  3C3L A;  3WOE A;  3K57 A;  3MXN A;  4IFD I;  1E2V A;  4PMB A;  1OXU A;  3S1M B;  4HED A;  1V8Q A;  2XSC A;  3O13 A;  1W6J A;  1VDZ A;  4J8Q A;  3D4D A;  2RA4 A;  4ZKC B;  5ELE A;  1I50 B;  1LAC A;  1PZI D;  2B2V A;  5JVG 3;  2EYL A;  3LWE A;  1QJO A;  3S2H B;  2Z1C A;  1LTG D;  5FLX E;  1GOZ A;  1YNJ D;  1Y8O B;  2WKC A;  5LL6 X;  3SHL A;  3TP5 A;  5CGK A;  4HCE A;  1Z47 A;  2J7Z A;  1D6E C;  1EY6 A;  2IW3 A;  4XYQ A;  3KF8 A;  4KKT A;  2HCI A;  3K0Y A;  1EFI D;  1MBY A;  1CA6 A;  1TWF B;  3AU7 A;  4KD4 A;  1U4L A;  3CU7 A;  3BDC A;  2KA7 A;  2R6G A;  1PZJ D;  3K7A B;  3FEW X;  1ZEQ X;  1PMR A;  1PTO F;  1O78 A;  4Y7N B;  2F0H A;  4CKB A;  1JC7 A;  5IT9 E;  1HA6 A;  4KY5 A;  3GTL B;  3K5O A;  2EDG A;  2B8F A;  2A6E D;  1MSH A;  1A2U A;  1DXM A;  2L9H A;  5TSS A;  2NVQ B;  5M9O A;  3EVQ A;  2F0M A;  4FF3 A;  2E76 C;  1DOM A;  4I7Z C;  1STA A;  5E4X A;  1V1P A;  1A3T A;  1H9S B;  5D14 A;  3V2T A;  3ERQ A;  1SJH D;  3VR3 A;  1CTM A;  1PLF A;  2RDF A;  3S1N B;  2R93 B;  2XRQ D;  3PIP 3;  3J80 L;  2KOL A;  2NVY B;  3L9A X;  5NUC A;  1EEI D;  1PZK D;  2F0S A;  5KNC A;  2ICI A;  1KDB A;  1SNQ A;  4EQP A;  4PNY A;  4BA1 I;  1S4Z A;  4F88 A;  4C3I B;  1I6H B;  2PZT A;  4L63 B;  1S5D D;  3RZO B;  1L0Y B;  5IGC A;  3QWN A;  4IUT A;  1KTK A;  1F9R A;  4A3J B;  2K05 A;  3GQB A;  1O7L A;  2HCC A;  1MI2 A;  1JOO A;  4C2M B;  5J39 A;  4JK1 C;  5BN4 A;  5C0X G;  2E2J B;  3RMH A;  1BF4 A;  1JE4 A;  3LWU A;  3SDZ A;  3S15 B;  4V0B A;  1I4Q A;  3PO2 B;  2IWH A;  2EY2 A;  5DM6 3;  1Q12 A;  1B50 A;  3EA6 A;  3SE0 A;  5KRU A;  3X3M A;  2FMC A;  4NMZ A;  1HFG A;  4YIJ A;  1ICW A;  2YU9 B;  5C0X H;  3NTI A;  2L1B A;  4FYD A;  1EIH A;  5ELB A;  1Y8N B;  5FOB B;  1ESR A;  1WD0 A;  3BVM A;  1TU2 B;  4IUN A;  2K5W A;  4RGT A;  3M7N A;  3NTK A;  1EIG A;  4ZK9 B;  5JJZ A;  1J9O A;  4M8A A;  5ISR A;  1IKM A;  4FXD A;  3QJY A;  4DK0 A;  3JAM E;  1QIL A;  1ENA A;  1SYD A;  1PRT B;  3VR2 A;  2QKI C;  4DAY A;  1PYW D;  5G3L D;  2JA6 B;  4N9T A;  2F0I A;  1OXT A;  3I72 A;  1RHP A;  5CV7 A;  4XQJ A;  5CBA E;  2EYJ A;  1G2S A;  1WTQ A;  1AP0 A;  4B08 A;  1NSN S;  1CQV A;  2N55 A;  2O5J C;  1ZYR C;  1QCB D;  4IFD H;  1PFN A;  2F0Q A;  2FHT A;  2RSN A;  1HQR D;  4RCO A;  2F1M A;  1CFM A;  3D4W A;  3D31 A;  2MJ8 A;  2MUY A;  3D8G A;  3NTH A;  3I90 A;  4RFB A;  3ONA B;  1SFO B;  1SNO A;  4A3M B;  3BYT B;  4ZUI A;  4C1N I;  2F0P A;  3GD7 A;  2LFN A;  3IAY A;  3T56 B;  1K8M A;  3MWY W;  5E1F A;  2ICE C;  1B4O A;  4OL7 A;  3QG1 A;  4ZKB B;  3AMU A;  1QE6 A;  4A3G B;  3T13 A;  3BS1 A;  1NR4 A;  3VA7 A;  5JEA G;  3GTG B;  3T51 B;  2E2D C;  1RF2 D;  2B2T A;  1WVL A;  3I8Z A;  4CHT B;  3MXU A;  3GTK B;  4ZUJ A;  1BBX C;  2IT1 A;  1GUT A;  3OMC A;  4KV6 A;  2WV6 D;  1XYI A;  1KNA A;  5FO7 B;  3HP3 A;  5JEA H;  1CZG A;  1WTP A;  3P7J A;  1AZP A;  1VMC A;  4UAI A;  1STN A;  1SND A;  1HUN A;  3NK9 A;  1WTR A;  3RLF A;  1Q1E A;  2F0L A;  2SNS A;  5CV6 A;  4Q5V A;  5JVH 3;  1SYG A;  4ZRZ A;  3J7Y W;  3MXG A;  1LO5 D;  1X3Q A;  3KUP A;  4DNT B;  1GUW A;  4BY1 B;  2M9V A;  4XT1 B;  1EQV A;  5LL6 S;  5EKI A;  1SMY C;  2D5D A;  1TS4 A;  4WFN 3;  2F4I A;  1KAB A;  3MFG A;  2KCN A;  4KKU A;  2K03 A;  3W2D A;  3C1F A;  2RSO A;  3NWT A;  5E3F A;  2K5D A;  1RTN A;  3WDN A;  4TRD A;  1C48 A;  2ZXP A;  1Y1V B;  4IZ8 A;  4UDU C;  2JP1 A;  2B2U A;  2Q8I B;  2X6L A;  2J4X A;  2K6A A;  2F0N A;  4DF7 A;  1M4V A;  1B2T A;  1SNM A;  1D1I A;  5HUR A;  1G8Z D;  3I4M B;  1DD2 A;  3HOX B;  3M4O B;  4CJ0 B;  4A3E B;  4H7B A;  5C3E B;  3HRZ C;  4OIK A;  1SYB A;  4HR7 B;  1C4Q A;  3J81 L;  5CV9 A;  1M8A A;  4F7X A;  1ZXT A;  3BZD B;  2R61 A;  3DEP A;  4Q0F A;  1EY4 A;  2EYH A;  4WRD A;  3OIQ A;  1XXG A;  2SEB D;  1LT3 D;  3H94 A;  3PUZ A;  3M3Y B;  2YYZ A;  1SNC A;  4DAV A;  1I4H A;  3T16 A;  1SMY D;  4OO1 G;  4F8M A;  3TZD A;  5EBC A;  4CJ2 C;  3FMC A;  3OSO A;  4DAP A;  5C4H A;  3Q24 A;  2B39 A;  2LKV A;  4HMJ A;  1CHP D;  4KTA A;  1CHQ D;  3D6C A;  1ENF A;  1D5Z C;  1Q3L A;  4B9W A;  2VB3 X;  4DN4 M;  2OEO A;  3R2I A;  2MPM A;  4JBW A;  4BS9 A;  5C0X I;  3RUZ A;  3GTO B;  4OO1 H;  2BE5 C;  2RDG A;  2RKS A;  1ET6 A;  2IX3 A;  2PCF B;  2C5C A;  1CT1 D;  3A54 A;  3ITP A;  4QIW B;  1EZ8 A;  3H0G B;  1RD9 D;  1PRT C;  1TS5 A;  2KUM A;  4RHR A;  1CZW A;  1EY0 A;  3D3R A;  2A68 D;  4FXK C;  3T4A C;  2HQE A;  4DGZ A;  1QB5 D;  2HUG A;  3VR5 A;  4IUQ A;  2PPB C;  1J8I A;  4MIU A;  5FKA C;  2O2L D;  4IFD J;  1TR5 A;  4RCN A;  1EZ6 A;  4ZLT F;  3S9W A;  3K59 A;  2EXZ A;  1BUV T;  4EQN A;  4R8N A;  4IAL A;  1Q8I A;  5C5M A;  1Q1B A;  2A6E C;  5M5Y B;  2RBM A;  3RD4 A;  4XYO A;  1WTV A;  1HHV A;  2L0C A;  4HCS A;  3HOU B;  1SYF A;  3QOJ A;  2Z4I A;  1GUN A;  3NHH A;  1ML0 D;  1NUC A;  2JEA I;  2SDF A;  2JXM B;  1V1O A;  1ROD A;  2K28 A;  3LX0 A;  4ME5 A;  2A69 C;  4IN3 A;  1PTO B;  1DZ1 A;  1A3U A;  1X3P A;  3NWS A;  2C9O A;  4HSP A;  2BE5 D;  2F03 A;  1LTB D;  3N52 A;  2DN8 A;  5BN5 A;  1HXY D;  3OOC A;  2XNA C;  3S1Q B;  1B1Z A;  1EU3 A;  1LTR D;  4RWS C;  5IGF A;  1PRT D;  4C3J G;  3MAQ A;  1KNE A;  5JEA J;  1GJX A;  2B2Y A;  1HQM C;  2NB0 A;  3FVQ A;  3KLR A;  4HAE A;  3N6R A;  4C3H G;  1K8O A;  1GUO A;  4X3K A;  1DOL A;  2VNU D;  2L12 A;  1WCM B;  2AQ3 B;  2MHV A;  3F2U A;  5JOB A;  2F0J A;  4P2C B;  3MTS A;  1JOR A;  2E74 C;  5CBE E;  4XTC S;  2X6G A;  1EWC A;  1TWG B;  4RAU C;  1F2Y A;  4PMW A;  4BA2 I;  1F9S A;  3K5M A;  1AEX A;  1GXD C;  2JYO A;  5M3F B;  2NYZ D;  2V4D A;  3NUC A;  2JE6 I;  4IQZ A;  2A69 D;  5K36 G;  4QB4 A;  1G6Z A;  3OHX C;  3I73 A;  2B8G A;  5D3I B;  3BDL A;  5ELD A;  5CV8 A;  3L7Z C;  2ID0 A;  2B2V C;  4DA2 A;  4BWG B;  2L11 A;  4QF4 A;  4X3U A;  1H9M A;  3GV6 A;  4K8I A;  5K36 H;  4EVO A;  1LT4 D;  4KN7 C;  2E2I B;  1U9R A;  5K5P A;  4KJN A;  2Q8R E;  1VMP A;  2EOT A;  1H9J A;  2IPK D;  3H3V C;  4GZY C;  4C3J B;  2EJG C;  2KHS A;  5KGU A;  4DU9 A;  2CQA A;  3P75 A;  3A8I E;  4KI0 A;  3HOV B;  2JA8 B;  1BCP F;  4HN7 A;  5LHY 1;  3U9O A;  1ZKO A;  5COY A;  4EQO A;  2Z8L A;  1A6X A;  2EJM A;  2DY8 A;  3PV0 A;  3K5L A;  1CA5 A;  3QOL A;  5EPJ A;  2FMM A;  1I4P A;  5I2X A;  2I07 B;  2O4X A;  4G57 A;  1T5X D;  2RDH A;  2K01 A;  3IFD A;  4RKB A;  3IKJ A;  1HUM A;  1SBB B;  3VYS A;  5C3X A;  1H9R A;  2F0W A;  3MZ5 A;  3SVM A;  2HDM A;  1QOH A;  1FYC A;  5KYL A;  3V96 A;  3GTM B;  4OO1 I;  4B9X A;  5FLX L;  3S16 B;  3J81 E;  4XIG S;  4A3B B;  2JA5 B;  2FJ2 A;  4FXG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...