4E6IA

Crystal structure of staphylococcal nuclease variant nviaga v99g at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
123
Chain Sequence
LHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMGNEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Local flexibility as a determinant of pKa values of surface ionizable groups in proteins
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 123
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4e6iA00
3PMFA 5M9OA 1EQVA 1SNMA 1JOKA 4KD4A 5EGTA 2PZUA 4NKLA 3QOJA 4KJNA 5I6WA 4NDXA 5DAUA 2PZWA 3EVQA 3P75A 5C6AA 2F0DA 4G57A 1STYA 3BDCA 1KABA 1SNOA 1TR5A 3R3OA 2O4XA 4KTAA 5HURA 2PW7A 4KY5A 4EQPA 3V2TA 1KAAA 4ZQ3A 3HZXA 5IGBA 1EYAA 4MIUA 3ERQA 4DF7A 5J22A 1A3UA 1SYCA 1NSNS 2WACA 3NUCA 1STAA 1STGA 5KYLA 4DGZA 4K8JA 2EYHA 4KY7A 1A3VA 2PQEA 5ISRA 3TP7A 1SYDA 3D8GA 4PNYA 2EXZA 3SXHA 4KJOA 5C4ZA 1EY7A 4RKBA 1SYBA 5NUCA 5K5PA 1TQOA 3MVVA 1STHA 3D4DA 3D6CA 1EY8A 1F2ZA 2F3VA 2NUCA 3HEJA 4KY6A 5C5MA 3SK8A 3OMGA 3VA5A 2M00A 5CV9A 5I9OA 3DMUA 3NXWA 5J39A 1A2TA 1KDCA 1JOOA 1TT2A 2PW5A 3MEHA 5CR3A 4K2KA 3TP5A 5KRUA 3SR1A 2ENBA 2EY2A 4WORA 2F0NA 3C1FA 1SNPA 1STBA 2F0IA 3OMCA 2EY5A 3TP6A 4K5WA 3RUZA 4TRDA 2SNMA 4LAAA 5J1ZA 5E1FA 2QDBA 1JOQA 4IZ8A 4PMBA 3NQTA 4WRDA 4OL7A 5KIXA 5HGTA 5JAVA 1SYFA 4K14A 3ITPA 1EYDA 2F0VA 3D4WA 3E5SA 3TP8A 5IGGA 2F0GA 3U9OA 4KD3A 4ME5A 1EY9A 1KDAA 1KDBA 4ZUJA 4K6DA 4R8NA 5EKKA 2OXPA 3QB3A 4S3SA 5IGCA 2F0EA 2RDFA 1SNCA 4QB4A 2EYLA 5I9PA 4F7XA 2EYOA 1EY5A 1EY0A 2EYFA 2F0SA 2F0LA 1EY6A 2F0OA 5DEHA 4DFAA 1F2MA 2KHSA 3NK9A 5IGDA 5IODA 1STNA 5C4HA 4ZUIA 4E6IA 4ID6A 4I65A 2LKVA 3BDLA 1JORA 3NHHA 5F2DA 5CV8A 4K2LA 1AEXA 4KHVA 5IGEA 2F0TA 4RKLA 5KYIA 4HMIA 4EVOA 5CGKA 5JOBA 2F0KA 4QMGA 4EQOA 4B9WA 2EY6A 1F2YA 5CC4A 4B9XA 4ODGA 1EZ8A 4PMCA 4YIJA 2F0UA 4NP5A 1SYGA 3EJIA 2F3WA 3QOLA 2PYKA 1EY4A 5CV4A 5CV6A 3LX0A 5CV5A 1A2UA 2RBMA 1RKNA 3NP8A 3SHLA 2F0FA 3P1HA 4K5VA 4HTHA 2F0MA 4H7BA 2RKSA 4K5XA 5CV7A 4EQNA 4DU9A 2OEOA 1EZ6A 2F0HA 5KEEA 1II3A 3C1EA 5EKLA 2EY1A 4F8MA 2F0WA 5IGFA 5I6YA 3SK5A 3MXPA 4J1MA 4NMZA 5IOCA 1ENAA 5KGUA 5C3XA 2OF1A 1NUCA 4N9TA 1EYCA 4QF4A 5C3WA 1U9RA 2KQ3A 3H6MA 3OWFA 4KV6A 1SNQA 4IALA 4N9PA 1IHZA 2F0QA 5E3FA 3SK6A 3T13A 3DHQA 3TMEA 1ENCA 5C5LA 2F0PA 1A3TA 3EROA 1SNDA 2EYPA 2SNSA 3MZ5A 3T16A 3MHBA 2SOBA 3OSOA 4IUNA 3SK4A 3S9WA 1SYEA 4HMJA 4J6HA 4K8IA 2HQEA 2EYJA 2EYMA 5IIFA 2PZTA 2F0JA
chains in the Genus database with same CATH superfamily
4G4KA 3SDZA 2HUGA 4DV3Q 4NKLA 1D1IA 1PZID 3CCVA 4NDXA 4DR3L 5C6AA 3BS1A 3BYYB 1KRSA 2A68C 2WB1E 4EQPA 4DAVA 1K3RA 1PH3A 2JA6G 1IW7D 2ZTDA 1EOVA 1ICWA 3H0GH 1IBLQ 1NSNS 1STAA 4P73A 5KNCA 2UXDQ 2BH8A 1F9SA 3PO3G 4KJOA 1KLGD 4TQUS 1YJWA 3L2PA 1A15A 1VQEA 2EVBA 2A19A 1Q7YC 1F2ZA 5GADC 1ICFB 5IWAQ 4K6LA 1IL8A 2LY7A 4DR4Q 1LUZA 1I4QA 2SNMA 4HSVA 4HCSA 1XMQL 4LF8Q 4LF5Q 1F77A 2HCCA 3NQTA 4CDEC 5JAVA 5FLXL 4Q5VA 4POGA 4K14A 4B3SL 1QVFA 1T9HA 3TP8A 4CKBA 4DR1Q 2L11A 3GTQB 2QGQA 3DWAA 1PHJA 4C3IH 4JG2A 4F87A 1ZYRC 4IUQA 5IGCA 1LABA 2XTIA 1JWMD 1SNCA 1PLFA 4F7XA 1EY0A 2F0LA 1VQPA 1B9MA 2NN6I 3NK9A 1VQ6A 3NQIA 3IFTA 2CH4W 3F2DA 3HOUB 5C4XB 1Y14B 4V190 1B1ZA 4MN3A 4YCUA 3TREA 2QF7A 2Z8LA 4IUTA 1Q86C 4QMGA 1G2SA 1F2YA 3HKZE 4ZKBB 4BY1H 4POFA 2J4XA 4HJ5A 2QEXA 4YY3Q 2F0FA 2ZJPA 3G7LA 1SJED 3I4OA 1WFQA 2AKWB 4DV6Q 5JVG3 1VQ7A 2WKDA 2N78A 1VQDA 3W2DA 3FRPB 3SK5A 4H44C 3KJPA 2VUMG 3SE0A 3OTOQ 3S2HH 2XWJB 2Q8RE 1Y1WH 3HOUG 5C4XG 1KNEA 3WOFA 1HNZQ 2VXWA 1YJ9A 4K8IA 4DV3L 3E0EA 2HQLA 1VQKA 2GN5A 2PZUA 1HFGA 3TEHB 1Y8OB 3X3MA 5FO9B 2F0DA 1STYA 3BDCA 1S5ED 2EOTA 2WB1B 3GTLH 1WTHA 4IURA 3K5MA 1GVPA 1IBLL 4ZQ3A 5IGBA 3L7ZC 4DK6C 1SE3A 2ICEC 4RGTA 2UXDL 3CCRA 1CI3M 1NY4A 1OXTA 1SJHD 1X3FA 4XIGS 4DR2Q 3A5ZB 1Q90A 1F9PA 2IT1A 1VQ4A 4A76A 4A3KH 5NUCA 4ZKCB 2R3ZA 3TBIB 5IWAL 4FF1A 3D6CA 2KA7A 5CV9A 4DR4L 1KDCA 2XIWA 2DY8A 4P71A 3K6OA 4WORA 4LF8L 2BA1A 1VQFA 4LF5L 1RODA 5ELBA 5EBCA 3VR2A 1D2BA 3K80C 2B63B 4JI4Q 1JOQA 4IZ8A 1TWGB 1NTGA 2IJ0A 2NWGA 5KIXA 3HP3A 4DR1L 3M7GA 3LWUA 3PSIA 2R92B 4LFAQ 3S1RH 4UY8C 2K5NA 1VS0A 3CC7A 5CMDA 1SXTA 4ME5A 5IYCG 4OX9Q 4U68A 2I46A 3A55A 1HA6A 2ALYB 4IFDH 4S3SA 3NBHA 4FXKC 2L12A 2A6EC 5EQ0A 5IYBH 2JA5G 5LL6S 3F2UA 3R93A 4A4IA 2NTSA 1BCPC 1PRTF 3IAYA 1PDQA 2B63G 4LFBQ 2OT2A 2BCOA 4YWLA 4JI1Q 4EQOA 1XNRQ 4DV1Q 2DN8A 4YY3L 5AJ3Q 1ILQA 2F3WA 2XSCA 2FMCA 4IPHA 1RKNA 4DV6L 4QGUA 1NR4A 2Q8IB 4TKOB 1YIJA 3VR3A 3QWNA 5IGFA 4JBMA 1CA5A 5FLXc 1DYQA 3CRKC 4QF4A 3OTOL 1VQCA 3GTKH 2HT1A 1Q1BA 1HNZL 1MSGA 4U673 5D3IB 5E7NA 2NB0A 3QO2A 4C3HG 3MHBA 1GO3E 1PVOA 4J6HA 4GOPC 1ASYA 4XXEA 2AUJD 1O78A 1HZAA 5DAUA 1SMYC 1KABA 4DNRB 1SNOA 2PPBC 5BR8Q 5FKAC 4DR2L 1KAAA 2QCPX 3KJOA 3PO2H 4DGZA 4YWKA 5ISRA 2L5TA 4H13C 3PIP3 3F8TA 3H94A 4JBJA 1TQOA 1UE5A 2M2LA 2AQ2B 4OELB 4HIDA 2MPMA 4RFBA 4A3LH 5C5MA 3OMGA 2K14A 1N9WA 3DMUA 3NXWA 5FJ8H 5J39A 5CR3A 1VQHA 3O13A 3J81L 2F0NA 3FPPA 3BU2A 4GZYC 1STBA 5M5YH 3OMCA 3M85A 4JI4L 4F88A 3D31A 2VQFQ 1J8IA 2L15A 4HIMA 5HGTA 4GOPB 2PQAA 2CQOA 3ITPA 1JJGA 3ULPA 4LFAL 1EYDA 3E5SA 1E1OA 4IOCA 1XPUA 2JA6H 4C2MB 3J80i 3NBHB 4LF6Q 2KHIA 2A68D 2QDLA 1Y1VG 2JN4A 2VZAA 1X3GA 3FKIH 5EKKA 1PH6A 3C3LA 1DOMA 4HJAA 4YCWA 1E1TA 3FHWA 3AMUA 3FVQA 5M5WB 4XTCS 2PI2E 3JAME 1F2MA 1LTID 1YNJC 2QEJC 5A35A 2G9DA 4LFBL 3RZOB 4JI1L 4BY7G 2D0OA 4DV1L 4EVOA 3STBC 5AJ3L 2TMPA 2MP1A 4ODGA 5D14A 4YIJA 3VR5A 2Z4IA 3BZCA 1TWAB 3S16B 5ELCA 1PFMA 3SHLA 2VS1A 3PF5A 1EZ6A 1WYDA 2RQXA 2VY3A 1Z9FA 4OXPA 3NTHA 1NUCA 1PYWD 3AU7A 4KV6A 2DJGC 1VQ8A 2DJFC 1MIUA 3BVZA 4I7ZC 3T13A 1SFOB 4JYAQ 2F0PA 3EROA 4DUYQ 2JQOA 4MZ9A 3NTKA 3PUWA 1ZYRD 1CKMA 4A3IB 1VF7A 2EYMA 5C3EG 2IY5B 1UEAB 1QUQA 1JOKA 1LV9A 2NZ1D 5T1IA 4L63B 3P75A 5BR8L 4DV7Q 5ELFA 5M3MB 1HRJA 1IYJB 3GTQH 1ENFA 2UUBQ 3HG9A 4WJWA 5LMUQ 3VYUA 2B2YA 2A1AA 2KJXA 4IUPA 3FPUB 1Y8NB 4KN4C 5K5PA 3NEMA 2QILA 1STHA 1PTOF 1B44D 2RHSB 1V43A 2NZOA 5JPMC 2HIVA 1BOSA 5C4XH 3HOUH 1TT2A 1A0IA 1J5EQ 1GXDC 2Z1CA 4MTNA 2C9OA 2VQFL 2PQAB 3PUYA 4TRDA 1PYBA 2RDHA 1VMCA 3PCOB 1U5KA 5KNDA 1WTVA 1K73C 2K6AA 1Q3LA 4XT1B 4AYBE 1W3SA 4FO2A 1O7ZA 3VA7A 2F0VA 5IGGA 4LF6L 1JJCB 2MO0A 2K4KA 2WFWA 1IBMQ 1PH7A 3EQLC 5ELOA 4HEDA 4RHSA 4K6DA 2A69C 1PMRA 2A6HC 3KDFA 1GUNA 4HAEA 1PH5A 1Z7TA 3HKSA 5EPJA 2KHSA 5C0XG 5C4HA 3J7AV 3CP0A 5JJZA 1WTWA 1FR3A 4BWGB 2B2YC 4DV5Q 3WOEA 4OO1I 2UU9L 3LGJA 2HDLA 1YHAA 1RTOA 3EJIA 2NVTB 5CV4A 4JCVE 3U9SA 2G5DA 3I55A 1OTCA 1XTCD 4ZCKA 2RKSA 2NVXB 5ELNA 5I2XA 2RSNA 1D6EC 4ALPA 3CMEA 1QVGA 1Q8KA 4DA2A 2EZVA 2L0CA 5DNFA 4ABNA 4JYAL 3OWFA 1J9OA 4DUYL 1E2ZA 5JJIA 3KK7A 1QUQB 4CDFC 2SNSA 2IHFA 3UDXA 1HQMC 1BXTA 2BDNA 3S9WA 1SYEA 5BN5A 4HN7A 4A3CH 2F3IA 1I4GA 3UDIA 1CHPD 2ASBA 2EJGC 2A6ED 1RHPA 3N52A 3DXJC 2K75A 4DV7L 2B63H 1WD0A 1TWGH 4BA2I 1EIYB 1GUTA 3KBGA 1BCPD 2JA8B 1NBWA 2MJ8A 2UUBL 1WOCA 3V2TA 3NE5B 1K9MC 5LMUL 2R92H 1RD9D 4G7ZC 1BNZA 5GAHC 2K5QA 1NNXA 3KFUA 3GV6A 2Q8TA 3HOYB 4PNYA 2OQ0A 1EEFD 1SYBA 1DD2A 2DUDA 1GJXA 1SBBB 5EJWA 4NXMQ 1WTQA 3KYHC 2MHVA 4AH6A 1J5EL 1R9TB 4C3HH 4P75A 2PW5A 1EQRA 2B2WA 4TVAB 1GUSA 2JA8G 3HOZG 4X3KA 2WIIB 3ONAB 4WRDA 5JPNC 1PH9A 3K59A 2SDFA 1IBML 3Q6SA 4IJHA 3FP9A 2PO4A 3HOYG 3KDFB 4L6TB 1KXLA 1EU4A 4GN5A 2R6GA 3G6EA 1CFMA 2Z6BA 2OXPA 5DLQE 4LF7Q 4KMUC 1PV4A 1V8QA 4QB4A 5I9PA 1XX8A 1B8AA 4DV5L 4CKCA 4RHRA 1SR3A 1ML0D 4DXGA 4R4TA 1VQGA 3Q8DA 3A56A 3WDNA 4CDCC 1AZPA 4NP5A 2N3SA 4XQQA 2KCMA 3P1HA 2Q2HA 3ER0A 2B2WC 3BJUA 1D5MC 5M3FG 1I50B 4LW1A 3OW2A 2KHJA 1BVSA 3I72A 4ZRZA 2VL6A 5EPKA 1ENAA 1S4ZA 3VYTA 1R4PB 5FLMG 4EQ5A 2EJFC 4IO9A 2E5LL 3M4PA 1X3EA 3I4MB 1VQMA 3H15A 2K52A 2E2DC 1CK1A 4WJ3M 1SNMA 4CJ1B 1YNJD 4GN3B 2JA9A 3I8ZA 2X6LA 1E0BA 3S14B 4OONA 3C2PA 2GA4B 3I73A 4UP9A 4HR7B 3STBD 1GUOA 2EXDA 3X3NA 2G9HD 3ZJYC 4C2MH 5J22A 1SYCA 2TSSA 3JAML 1LTAD 2HIXA 4O0AA 1HA5A 3PO3B 1FD7D 1C7YA 1CKNA 3I4MG 4B08A 5M5WH 4NXML 1EY8A 1PH4A 1TWCB 3W3AA 4JOIC 3GV3A 3RZOH 1N36Q 2MFIA 4K2KA 2BDOA 1XPOA 1IZ6A 4Y52H 3EFXD 1KC8C 4OHJA 4QIWE 1NMGA 1JC7A 2F52A 3RZDB 2CKZB 2QDBA 1TWAH 3VYRA 3S16H 1YNNC 4A3BG 4CGYB 3OW7A 1DZ1A 3BDOA 2C35B 1TWHB 4ZLTF 5KNBA 4I7AA 4LF7L 1Z47A 1B50A 1EY9A 1KDAA 2WAQB 2XNAC 1YEZA 4GKJQ 2CFMA 1SFOH 2X6GA 1EY5A 2F0OA 1EY6A 3K5OA 5IODA 2B2VC 4A3IH 1CT1D 1HCZA 4GKKQ 3OOCA 3KLRA 1P16A 1J6QA 4RMFA 1HZBA 4MHEA 3A7AB 2EY6A 5G3LF 1M8AA 3GTJB 5M3MH 2VB3X 4YCVA 2NZHA 4ILWA 1WJJA 5K36G 3DEPA 1L1OA 5CV7A 4LMQD 1HPCA 4CJ2C 1TXYA 2WAQG 3D0FA 4CKEA 1OXXK 2F0WA 5I6YA 2MUYA 4IPGA 3GTPB 2OF1A 1O7YA 2VUMB 4RG1A 3HOVB 5CORA 1IBKQ 2UXCQ 1QNUA 1FGUA 2FINB 1G51A 3SK4A 4BXXG 2A69D 2A6HD 4HMJA 3VR4A 5C0XH 1I94Q 1O80A 2CW0C 4UP7A 1EWIA 4JW0A 3A54A 1HUMA 1I6VC 1PFNA 3A0JA 4JI8Q 4KTAA 3QR8A 3ZYYX 4OGQC 1PA6A 1XTDA 1I4RA 3PQIA 4KI0A 3H3VI 3CHBD 5A2QL 4R4QA 1A3UA 4DV2L 2GVAA 3HOVG 4JV5Q 1YHQA 4JI7Q 2R7ZB 5JVH3 4XYOA 4IJLA 4HJ7A 4A3FG 2YV5A 1KQSA 1TKWB 3DLLA 1MBYA 1M4VA 1N36L 1L1OC 1V9PA 4BBRB 4DAYA 2B8FA 5HY6A 1D7QA 4G7OC 1SAPA 2E8GA 2ZXPA 3MA2B 2D62A 4QIWB 1X54A 1B53A 4LAAA 1NJIC 2KECA 2NVTH 4JK1C 1QCBD 1E7ZA 4R9WA 2NVXH 3S2DB 1A8VA 2R7ZG 2ZTEA 4L5QA 4C56C 4DN4M 3I70A 1L0WA 4GKJL 3F2CA 1HHVA 5I2YA 2E2IB 3DEOA 3LWEA 1EYGA 1BUVT 3K0XA 2RDFA 4J15A 1KIXA 3MXGA 2JXMB 2EYLA 1WCMG 4BBRG 2JA5B 3G71A 2EYFA 4GKKL 4LUZA 3JAMc 1LT6D 5IGDA 5H1SE 3KLSX 4RH6A 1MSHA 1VCIA 5IGEA 4X3SA 2ZXRA 5KYIA 3CD6A 2I0QA 3UDGA 3KUPA 3CU7A 2K03A 2L4NA 3TSSA 4A3MB 1O7IA 2JA8H 3HOZH 3SVMA 4PZ7A 1S5FD 5CV5A 4JBWA 4X3TA 3KLWA 4RGOS 2J0TD 1DOLA 2K7VA 4EQNA 1JWUD 4DAPA 1ZKOA 2OEOA 5CBAE 3HOYH 3R2TA 1IBKL 2DNEA 2UXCL 2K05A 4N9TA 4DUZQ 1V1PA 4C3HB 1LTBD 1VQ5A 1I94L 3MZ5A 1R9TH 2SOBA 4C1NK 3AYHB 4B3MQ 4KN7C 5IP7G 1YNXA 1RCVD 4DR6Q 3L0OA 4N8X1 4A3MG 4FDBA 3QOJA 2OQKA 3MAQA 2H4OA 1A63A 1TR5A 5IT9E 3GP7A 3HRZC 1KHIA 2HD3A 2E74C 3I4LA 4AQYQ 1JICA 4JV5L 1LTLA 4JI7L 3IL8A 2RCNA 3UI2A 4JI3Q 2NN6G 3F1ZA 4X3UA 5KYLA 3A5UA 1Q12A 1H9JA 4JI2Q 3SXHA 4L5SA 4DAYB 2IX0A 3MVVA 5FLMH 1HR0W 4WFN3 3GTMB 2L1BA 1MGSA 1WTOA 1WTPA 5I9OA 2A8VA 1EWCA 2A74C 2JSOA 2MNAA 1ONLA 1X6OA 2E2HB 2GVBA 2JYOA 4A93B 3CPWA 4HIOA 3I7FA 1BCPB 5JEAH 1MI2A 1GHKA 2IL8A 2SEBD 2B8GA 3J7ZC 1Y8PB 4IPCA 4V0BA 1G6ZA 1HUNA 4R4IA 3OIPA 1U4PA 3CXCA 3RN2A 1I50H 3D6WA 2JEBI 2N55A 2AWOA 1Y1VB 1SSOA 3K0YA 3KLSA 2UUAQ 4ZUJA 1N33Q 1D5ZC 3I4MH 3MTSA 1B2TA 3CPFA 1M90C 3EBEA 1PH2A 2K5WA 1SLJA 3NENA 5C4JB 4A93G 4X6AH 4MTKA 1YBYA 4ME3A 1BBXC 4BY7B 2ZTCA 2B2TA 1OXUA 1XNQQ 3S14H 1G2TA 2F0KA 5CC4A 2ZXOA 3GO5A 4OX9L 3PIOA 5CV6A 4QCLA 3QOLA 2PCFB 3QJYA 3LX0A 4CHTB 1A2UA 4GLXA 3CC2A 3TQYA 2K28A 2C5CA 1FGBD 3PO3H 4RA8A 1YNND 2EY1A 2K04A 4CDDC 1IYVA 4DUZL 4J1MA 1UE6A 5IOCA 3RLOA 3S1QB 4PZ8A 1UEBA 3U58A 1H95A 1S5CD 2M9VA 3RN5A 1TWCH 4B3ML 1B7YB 1XNRL 4H02A 1ASZA 4DR6L 5C3EB 3ICEA 1KTKA 2HQEA 5CV8A 4DK0A 1OXVA 2R61A 4PMCA 1L2FA 1EQVA 1HTPA 1XMOQ 3RZDH 3S1NB 1CM9A 2AWNA 3GD7A 1ILPA 4AQYL 1TS2A 1VQIA 4A75A 1TWHH 4BS9A 4JI3L 3KF8A 2O5IC 3BG3A 4JI2L 3TP7A 3H91A 1IL2A 3S24A 1C8CA 3J81i 3LNNA 5J3BA 4A3GG 4PZ6A 2YYZA 4GLAC 1H9SA 4MNOA 1SN8A 1SNPA 5C44G 2Q2UA 1LM0A 2N88A 1UE1A 2FMMA 4FXGC 3GTJH 4A3JB 2CW0D 1HTLD 3I56A 4C3JB 1U4LA 1PRTC 1K28A 4XYQA 3OPOA 3I4NB 1RTNA 1X9NA 1YVCA 3GTGB 2UUAL 3OIQA 1N33L 3GTPH 2VUMH 3HOVH 1W2BA 4LF9Q 1KRTA 4OEMB 5I4DA 3QB3A 1EIHA 1GUWA 3M9BA 2QW7A 4QUFA 2KENA 2WV6D 4K0KQ 2DGYA 4IUUA 3J7YW 1IXRA 3CAMA 4I65A 4IFDI 1CZWA 1ET9A 1XNQL 1H9RA 4A3JG 1QE6A 5CGKA 4C3JG 1LACA 2IX1A 1DM0B 1YZ6A 3G4SA 3I4NG 2R93B 1LTGD 1O7LA 5E4XA 2KUMA 4K5XA 4O2DA 4JI0Q 2VNUD 1QVCA 2R7ZH 2JK8A 1SMXA 3I2ZA 1PRTB 1N34Q 3M7NA 1EU3A 2Z4HA 3S1MB 4BBRH 3PF4A 2LXJA 1FYCA 1V1OA 4FP5D 1LT3D 1XMOL 3MWYW 3I91A 4BBSB 1L0YB 2R93G 2NTTA 3BZKA 1CTMA 2A5HA 3J81c 3EVQA 3G48A 3KF8B 4FXDA 2R7FA 1YI2A 1D8LA 3S2DH 5FOBB 2OTLA 1I6HB 5IYCH 3S17B 2UXBQ 1WI5A 4FNFA 2E2IH 1Q81C 3T1HQ 1IKMA 3KOJA 2JA5H 2D5DA 2EDGA 1H9SB 1B3QA 3N6RA 3SK8A 2E2JB 3AQQA 4Y7NB 4APVA 4BBSG 3MEHA 1Y1WG 1JE4A 2ENBA 3HGBA 4DAMA 3HOZB 5IP7H 5IE8A 3RNUA 5BN4A 4A3MH 3J7A5 5J1ZA 3E3XA 1EQTA 3OHXC 1CZGA 3A8IE 3HFZB 5LMNW 2XRSD 3UE1A 3CC4A 1CQVA 4LF9L 4UP8A 1EFWA 3T56B 3PGZA 4K0KL 4GNXA 5DEHA 3ND8A 2F0SA 4FF4A 2BA0A 1SEBD 4DFAA 1S5BD 3RD4A 2YTYA 5EKIA 2ATWA 3NSWA 3IFDA 5IT9L 1IYUA 3MFGA 1E22A 4IOAA 3K58A 1VQAA 5JOBA 4B9WA 2VQEQ 1XXGA 4FF3A 3BZDB 4X64Q 1SYGA 2LXKA 1AE3A 3Q0AA 1U4RA 4JI0L 2FXQA 5M3FB 3K81C 2WAQE 4QL5A 3W1BA 2XWBB 2KOLA 4F8MA 3B6YA 3OWEB 5C3XA 1N34L 1AW7A 3VYSA 4LF4Q 3GTMH 1E3PA 1IKLA 2AUKA 3RR5A 2ZJRA 2AQ1B 1VMPA 2I07B 5IYBG 2E2HH 4A93H 4X62Q 2PMZE 1JMCA 4Z9CB 4FYDA 3J80E 1PTOC 2BE5D 3CCEA 3AB9A 4GNXC 3Q23A 4KKTA 3I3CA 4L5TA 2PW7A 1EL0A 2UXBL 2P5ZX 3MXNA 4DF7A 3V96A 1Y1VH 3RLFA 1JE5A 2NVYB 1U0LA 3CCSA 4G7HC 4XQJA 2KCTA 1Z6HA 4LFCQ 4OO1G 5C4JH 2NUCA 3CQZB 4KY6A 4BA1I 3UE0A 2DNCA 3SGIA 4BY7H 4QUCA 1JOOA 1M1KC 1WTXA 5FK9C 1KLUD 1JT8A 2LFNA 2VW9A 1RF2D 2CWPA 3J7AF 2EY5A 4ULLA 2YU9B 2H1EA 3H09A 1VQBA 2L55A 3OYYA 3HOXB 3S15B 4A3BB 3T53B 1FVIA 3DUZA 2CVRA 3TZUA 2WKCA 2ES2A 1PTOB 5FO8B 4ZAIA 4M8AA 3S1QH 1XPRA 1I4PA 4OIJA 4R8NA 3PO2G 4DNTB 2K32A 3HOWB 2EYOA 3BYTB 3NTIA 2D2CC 3Q22A 5C3EH 2CCZA 4KHZA 2XVSA 4E6IA 5M5XB 4A3LG 4ZYSA 1AEXA 3K57A 3HOXG 2VQEL 3URYA 1STEA 2J7ZA 4X64L 3S1NH 5EPLA 2F0UA 1UWVA 3A74A 3T51B 3K7AB 1XYIA 3CW2C 3ND9A 1Q82C 1TY0A 1II3A 4NPSA 4LF4L 1PRTD 3HOWG 3TZDA 1BCPF 1S5DD 1QZGA 3VR6A 1SNQA 4N9PA 5AFWA 1AE2A 3Q24A 3FKIG 1I4XA 1BO0A 3SK6A 1K8OA 3TMEA 5BN3A 2IHEA 3MEFA 4X62L 2PMZB 4OIKA 5EGTA 5I6WA 4B3TQ 4A3JH 5JJLA 4C3JH 1N32Q 1Y69U 3MXNB 1RDPD 3JAMi 5IT9c 2O4XA 1CQFA 3NWSA 4L8JA 4PMWA 3I4NH 4HCEA 1V1QA 2EE1A 1W6KA 3GTGH 4MIUA 1TIID 4NW2A 4QY7A 3EN2A 5LL6X 1STGA 1MD2D 1G8ZD 1LYLA 1K0RA 2PQEA 4LFCL 4ZK9B 1PYSB 4A3FB 2PNRC 2IW3A 1L0XB 2OWOA 2FHTA 1TWFB 3HEJA 2F3VA 2Q2TA 3L9AX 1HZCA 1QILA 4O42A 2CWAA 4R4OA 2OCEA 2Q2IA 4KHPQ 5KRUA 2XN9C 2VB2X 3M3YB 5LMNQ 4P2CB 1CHQD 2R93H 1LLRD 1DCZA 1CKNB 4IQZA 2DY7A 1HFNA 3PV0A 2HCIA 1Q1EA 4RGMA 3CMAA 3PIO3 1I5FA 1Q8IA 1SRUA 2FFKB 3MC0B 3BVMA 2NYZD 3CCLA 3M4OB 3TN2A 4R8IA 1K83B 4HSPA 1WCMB 2F0EA 5GROA 3MXUA 3S1MH 1DXMA 5IY0A 2HHHQ 3E9HA 4R1JA 4X66Q 2AQ3B 1K3BC 3P7JA 5C0XJ 2V4DA 4O1NA 5F2DA 1U4MA 4BBSH 2D0PA 2V1CC 2CH4A 1ESRA 1EZ8A 3TRZA 4LK1C 3A7LA 1I6HH 2RBMA 3F2BA 4JI5Q 3NP8A 1DGSA 1AP0A 2IX3A 3S17H 4KKSA 3AFQA 2ICIA 2MQHA 1PZJD 3MXPA 2F1MA 3K7UC 1YHBA 1HJPA 3NWTA 5ELDA 2E2JH 3H3VC 3DHQA 4Y7NH 2X69A 2K1BA 1SNDA 1EWHA 2QKIC 4IUNA 2EJMA 1WVLA 3EA6A 1TU2B 5CBEE 1L1OB 1H9KA 4XT3B 4B3TL 1BBUA 1PZKD 5E4WC 1N32L 1A6XA 2N8NA 2RSOA 3NBIA 4UHVA 4NB3A 3CRLC 2RHQB 4GN4B 3R3OA 2WB1G 4KY5A 2ZT9C 4DPGA 2Z6KA 2EPBA 1PFBA 1DJRD 3V05A 3IKJA 1B4OA 2EYHA 2O5JC 1A3VA 1EY7A 3CKIB 4RKBA 2Y0SE 1S3OA 4GOPA 5L37A 3K8AA 4KHPL 5LMNL 3P20A 4JI8L 5TSSA 3TP5A 2JE6I 3SR1A 5LHY1 1LTSD 3T1YQ 4A3CG 2WINB 2F4VQ 4DKAC 3TP6A 4PG3A 3RUZA 4EGVA 1ZXTA 1C48A 4LUOA 5DM73 1WTRA 1MJEA 1CSQA 4JBKA 3E6ZX 5M3FH 3HKZB 1B9NA 2NBFA 5IYDG 4UDUC 1PTOD 4A3DB 2I5LX 2WP8J 4IFDJ 2E76C 3R2IA 3DM3A 4J8QA 1R4QB 4KD3A 2R92G 4LWCA 3MFYA 3PUZA 2AMCB 4UAIA 1FJGQ 1HNWQ 3CCUA 2HHHL 4A3EB 1VQLA 2B39A 4LNQA 4X66L 2RCFA 3J80L 4OO1H 1NMFA 2Z6KC 4N8FA 4CJ0B 2Z9HA 2LKVA 1P8LA 3CF5A 3TS0A 1YJNA 2H5XA 2NVQB 3PUVA 3HKZG 4B9XA 4A3DG 1BDOA 4JI5L 1EOTA 1HNXQ 4B3RQ 1NE3A 4C1NI 1SROA 1TS4A 1TS5A 4K5VA 1B70B 4KLKA 2JA7B 1FL0A 2NVYH 4DU9A 1QNKA 4A3EG 3ERSX 1X3QA 1FNVA 4M1UB 1ESFA 2BE5C 4GS3A 5C3WA 2KQ3A 1S72A 3CQZH 1BBWA 1IHZA 3KF6A 2ZJQA 5C5LA 2QA4A 4P74A 4HJ8A 5DM63 1KL9A 1RL2A 3NELA 1I3QB 1GKHA 2F0JA 2Z0SA 2YU9H 1EFID 1CA6A 1ET6A 4Q0FA 3HOXH 3S15H 1TY2A 2KCCA 4A3BH 5JEAJ 1EUJA 5C0XI 1QB5D 3WWVA 4JI6Q 1V1PB 2JA7G 2JP1A 1JB7A 2O2LD 4WJ4A 1E2VA 1EYAA 2B2UA 1PTOH 4TSSA 1QZHA 4GLVB 1BF4A 4OWWB 5FO7B 3W5OA 5IP9G 4RAUC 4XDXA 2Y0SB 1VQOA 3HOWH 1TS3A 1RJTA 4DXFA 2L9HA 3D4DA 1VF5C 1S40A 4A3GB 1X3PA 3D4RA 5GAEC 5M5XH 2KEDA 4IN3A 3T1YL 3GTOB 2F4VL 4DR7Q 5C44B 1SE8A 3C1FA 1PFSA 1HQRD 2PI2A 5E1FA 5K36H 2BOSA 4YWMA 2XRQD 1JR0D 2B2TC 4OL7A 1OO9B 3C46A 1LTTD 3K7AH 1XJVA 3D4WA 1KD1C 2UU9Q 1I4HA 2F0GA 1FJGL 2K5VA 3U9OA 1HNWL 2Y0SG 5CYUA 3H0GB 1K0SA 4OWTB 1X65A 1T5EA 2K5HA 1Q46A 2KBNA 3FMCA 2LSSA 4BXXH 1CKOA 1K8AC 1PH1A 1SDFA 2B2UC 3TS2A 2FJ2A 1STNA 1X56A 4QQBX 4DV4Q 1JORA 2KCNA 4XQNA 4KHVA 1T5XD 4RKLA 2RDGA 2RA4A 4HMIA 3TDQA 1VQ9A 3U50C 1HNXL 3CCMA 1IW7C 1KAWA 4B3RL 1QWYA 1LO5D 4LUVA 4R4CA 1KNAA 4NXNQ 1D5XC 2F0MA 1C4QA 3H0GG 3JC66 3VDYA 1PXUA 4KKUA 5GQOA 2F0HA 3C1EA 1EEID 4JPBW 3R8BA 4A3FH 4NMZA 3KF6B 5FLXE 4DNIA 4C3IB 1UE7A 4HIKA 1TWFH 2EQSA 4IALA 1EIFA 5COYA 2KEEA 1TVXA 1MHWC 2EYPA 3T16A 3E9IA 3M3YH 2EYJA 4A3IG 1QOHA 4KD4A 5M9OA 1OXSC 3J80c 4KJNA 5HGQA 2PZWA 1K8MA 4JI6L 1EIGA 4LJZC 4BY1B 2YTVA 2BH2A 3QG1A 2IWHA 2KVMA 5M3MG 3QIAA 3M4OH 4DR5Q 2WACA 2JEAI 3NUCA 1NR2A 4C3IG 5JJKA 3RMHA 3E0JA 1K83H 1SYDA 1WCMH 3CCJA 5C4ZA 3K5LA 2K50A 5T1GA 1AH9A 1F9QA 4OWXB 4IUVA 3DWQA 1AN8A 3S2HB 2M00A 3AFPA 4DR7L 1Y1WB 1BR9A 4FVMA 3W1GA 5A2QE 2EY2A 1GHJA 4KK7A 3T4AC 2HDMA 1YITA 4BY1G 1G6PA 1X55A 1DONA 1VQJA 3I90A 1HR0Q 2UUCQ 4PMBA 5EBDA 1EQQA 1CSPA 3G6JB 4RCNA 2CHBD 4X65Q 1SYFA 3GTLB 4PQXA 3RLNA 1VDZA 1GUGA 3PIPA 2N49A 1KDBA 3CCQA 2ZM6Q 4DV0Q 5D3DA 2MGSA 4JC0A 4RGNA 4A3KB 1G91A 5D65A 4DV4L 4EX5A 3GQBA 1N8RC 4ID6A 1GM5A 2B3GA 1PH8A 3NHHA 3HS0C 4K2LA 1F2LA 3FDTA 2E5LQ 2F0TA 1JWSD 3J81j 4RWSC 1C9OA 4YHHQ 1X32A 4NXNL 2PYKA 1EY4A 1SE4A 1CUKA 1H9MA 2NN6H 4HTHA 2AHOB 2CQAA 2K5DA 5IYDH 4JVZA 1HH2P 3FEWX 5EKLA 3AEVA 3S1RB 4A3KG 2ID0A 4QJFA 1LTRD 3M4QA 1U9RA 3DWPA 3ULJA 2F0QA 2PNHA 5G3LD 1FNWA 1B3AA 5IIFA 3SEBA 3K5NA 2PZTA 1VQNA 1BKBA 3PMFA 1DOKA 4P72A 2K01A 2RVLA 4DK1A 3H3VH 2MO1A 4H0LC 1JCKB 3A8KE 4G57A 2LMCB 1ZEQX 1HZ9A 3A8JE 3IRBA 4DR3Q 5HURA 4A3DH 4DR5L 4AIMA 3HZXA 2XGTA 1UNSA 3ERQA 1D1KA 1BQQT 1JJ2A 4L5RC 4CBVA 4AYBB 4K8JA 4KY7A 1WD1A 4IFDG 3D8GA 4A3EH 1LT4D 2EXZA 3PUXA 3GDEA 1SMYD 1NCVA 4DK3C 3GTKB 1JQYD 3KBXA 1G291 2RF4A 3VA5A 1JB3A 4IPDA 5EAYA 5ELEA 1A2TA 2NVQH 1HXYD 1RIPA 1F9RA 2F0IA 1MKHA 3D3RA 4K5WA 1HR0L 2UUCL 1GOZA 2F03A 2D9UA 4X65L 1UAPA 4RCOA 3T1HL 1W6JA 1GD7A 1XMQQ 2B29A 2JJQA 1NAPA 4AYBG 2JA7H 3BVGA 1QJOA 3U4ZA 4B3SQ 4UPAA 2ZM6L 3UDFA 4DV0L 3PO2B 5IP9H 4JOIA 3EIVA 1UUPA 2I5HA 2LS01 1A62A 4PV1C 1E24A 1XWEA 1I3QH 4ZUIA 2I5MX 2E75C 3BDLA 3L3OC 1AFPA 4YHHL 3DM1A 1AZQA 2K33A 1K8GA 3ULLA 4FF2A 5M5YB 2F4IA 2A73B 1LT5D 1MJCA 1SE2A 3J81E 2YTXA 3U4VA 5JEAG 4GNXB 2IPKD 4H7BA 5GAGC 5KEEA 3M4YA 2JA6B 3NPPA 5KGUA 4HJ9A 2B2VA 1EYCA 1C0AA 3H6MA 3FKIB 4A3GH 1QG7A 5E3FA 1FNUA 4DV2Q 1ENCA 5FJ8G 1A3TA 1E2WA 3GTOH 3OSOA 2R7DA 2EIFA 2OTJA 5C44H
chains in the Genus database with same CATH topology
4G4KA 3SDZA 2HUGA 4NKLA 1D1IA 1PZID 4NDXA 5C6AA 3BS1A 3BYYB 2A68C 4EQPA 4DAVA 1IW7D 1ICWA 1NSNS 1STAA 5KNCA 1F9SA 4KJOA 1KLGD 4TQUS 1A15A 2EVBA 1F2ZA 4K6LA 1IL8A 2LY7A 1I4QA 2SNMA 4HSVA 4HCSA 1F77A 2HCCA 3NQTA 5JAVA 5FLXL 4Q5VA 4K14A 3TP8A 4CKBA 2L11A 3GTQB 3DWAA 4F87A 1ZYRC 4IUQA 5IGCA 1LABA 1JWMD 1SNCA 1PLFA 4F7XA 1EY0A 2F0LA 1B9MA 2NN6I 3NK9A 3NQIA 3IFTA 3HOUB 5C4XB 4V190 1B1ZA 4MN3A 2QF7A 2Z8LA 4IUTA 4QMGA 1G2SA 1F2YA 4ZKBB 2J4XA 2F0FA 3G7LA 1SJED 5JVG3 2WKDA 3W2DA 3FRPB 3SK5A 4H44C 3SE0A 2XWJB 2Q8RE 1KNEA 3WOFA 2VXWA 4K8IA 2PZUA 1HFGA 1Y8OB 3X3MA 5FO9B 2F0DA 1STYA 3BDCA 1S5ED 2EOTA 2WB1B 4IURA 3K5MA 4ZQ3A 5IGBA 3L7ZC 1SE3A 2ICEC 4RGTA 1CI3M 1OXTA 1SJHD 4XIGS 1Q90A 1F9PA 2IT1A 5NUCA 4ZKCB 2R3ZA 3TBIB 4FF1A 3D6CA 2KA7A 5CV9A 1KDCA 2XIWA 2DY8A 3K6OA 4WORA 2BA1A 1RODA 5ELBA 5EBCA 3VR2A 1D2BA 2B63B 1JOQA 4IZ8A 1TWGB 5KIXA 2IJ0A 2NWGA 3HP3A 3M7GA 3LWUA 2R92B 5CMDA 1SXTA 4ME5A 4U68A 2I46A 3A55A 1HA6A 4IFDH 4S3SA 3NBHA 4FXKC 2L12A 2A6EC 5EQ0A 5LL6S 3F2UA 3R93A 2NTSA 1BCPC 1PRTF 3IAYA 1PDQA 2OT2A 2BCOA 4EQOA 2DN8A 1ILQA 2F3WA 2XSCA 2FMCA 1RKNA 1NR4A 2Q8IB 4TKOB 3VR3A 3QWNA 5IGFA 1CA5A 1DYQA 3CRKC 4QF4A 1Q1BA 1MSGA 4U673 5D3IB 2NB0A 3QO2A 4C3HG 3MHBA 4J6HA 4XXEA 2AUJD 1O78A 5DAUA 1SMYC 1KABA 4DNRB 1SNOA 2PPBC 5FKAC 1KAAA 2QCPX 4DGZA 5ISRA 2L5TA 4H13C 3PIP3 3H94A 1TQOA 2M2LA 2AQ2B 2MPMA 4RFBA 5C5MA 3OMGA 3DMUA 3NXWA 5J39A 5CR3A 3O13A 3J81L 2F0NA 3FPPA 4GZYC 1STBA 3OMCA 3M85A 4F88A 3D31A 1J8IA 5HGTA 3ITPA 1EYDA 3E5SA 4C2MB 2A68D 5EKKA 3C3LA 1DOMA 3AMUA 3FVQA 5M5WB 4XTCS 3JAME 1F2MA 1LTID 1YNJC 2QEJC 5A35A 2G9DA 3RZOB 4EVOA 2TMPA 2MP1A 4ODGA 5D14A 4YIJA 3VR5A 2Z4IA 1TWAB 3S16B 5ELCA 1PFMA 3SHLA 1EZ6A 2RQXA 3NTHA 1NUCA 1PYWD 3AU7A 4KV6A 3BVZA 3T13A 1SFOB 4I7ZC 2F0PA 3EROA 3NTKA 3PUWA 1ZYRD 4A3IB 1VF7A 2EYMA 1UEAB 1JOKA 1LV9A 2NZ1D 5T1IA 4L63B 3P75A 5ELFA 5M3MB 1HRJA 1ENFA 3HG9A 4WJWA 3VYUA 2B2YA 2KJXA 4IUPA 3FPUB 1Y8NB 4KN4C 5K5PA 2QILA 1STHA 1PTOF 1B44D 1V43A 5JPMC 1BOSA 1TT2A 1GXDC 2Z1CA 2C9OA 3PUYA 4TRDA 2RDHA 1VMCA 5KNDA 1WTVA 2K6AA 1Q3LA 4XT1B 4FO2A 1O7ZA 3VA7A 2F0VA 5IGGA 3EQLC 4HEDA 4RHSA 4K6DA 2A69C 1PMRA 2A6HC 1GUNA 4HAEA 1Z7TA 5EPJA 2KHSA 5C0XG 5C4HA 3J7AV 5JJZA 1WTWA 1FR3A 4BWGB 2B2YC 3WOEA 4OO1I 2HDLA 1RTOA 3EJIA 2NVTB 5CV4A 3U9SA 1XTCD 2RKSA 2NVXB 5I2XA 2RSNA 1D6EC 4DA2A 2EZVA 2L0CA 5DNFA 4ABNA 3OWFA 1J9OA 1E2ZA 3KK7A 2SNSA 1HQMC 1BXTA 2BDNA 3S9WA 1SYEA 5BN5A 4HN7A 1I4GA 1CHPD 2EJGC 2A6ED 1RHPA 3N52A 3DXJC 1WD0A 4BA2I 1GUTA 3KBGA 1BCPD 2JA8B 2MJ8A 3V2TA 3NE5B 1RD9D 4G7ZC 1BNZA 2K5QA 3GV6A 2Q8TA 3HOYB 4PNYA 1EEFD 1SYBA 1DD2A 1GJXA 1SBBB 5EJWA 1WTQA 2MHVA 1R9TB 2PW5A 2B2WA 1GUSA 4X3KA 2WIIB 3ONAB 4WRDA 5JPNC 3K59A 2SDFA 3Q6SA 2PO4A 4L6TB 1EU4A 2R6GA 1CFMA 2OXPA 4KMUC 1V8QA 4QB4A 5I9PA 1XX8A 4CKCA 4RHRA 1ML0D 4DXGA 3A56A 3WDNA 1AZPA 4NP5A 4XQQA 3P1HA 2B2WC 1D5MC 1I50B 3I72A 4ZRZA 5EPKA 1ENAA 1S4ZA 3VYTA 1R4PB 2EJFC 3I4MB 2E2DC 1CK1A 1SNMA 4CJ1B 1YNJD 3I8ZA 2X6LA 1E0BA 3S14B 3C2PA 2GA4B 3I73A 4HR7B 1GUOA 3X3NA 2G9HD 5J22A 1SYCA 2TSSA 3JAML 1LTAD 1HA5A 3PO3B 1FD7D 4B08A 1EY8A 1TWCB 3W3AA 3GV3A 4K2KA 2BDOA 3EFXD 4OHJA 1JC7A 3RZDB 2QDBA 3VYRA 1YNNC 4CGYB 3OW7A 1DZ1A 3BDOA 1TWHB 4ZLTF 5KNBA 1Z47A 1B50A 1EY9A 1KDAA 2WAQB 2XNAC 2X6GA 1EY5A 2F0OA 1EY6A 3K5OA 5IODA 2B2VC 1CT1D 1HCZA 3OOCA 3KLRA 4MHEA 3A7AB 2EY6A 5G3LF 1M8AA 3GTJB 2VB3X 4ILWA 5K36G 3DEPA 5CV7A 4LMQD 1HPCA 4CJ2C 4CKEA 1OXXK 2F0WA 5I6YA 2MUYA 3GTPB 2OF1A 1O7YA 2VUMB 3HOVB 5CORA 1QNUA 2FINB 3SK4A 2A69D 2A6HD 4HMJA 3VR4A 5C0XH 1O80A 2CW0C 3A54A 1HUMA 1I6VC 1PFNA 4KTAA 3ZYYX 4OGQC 1I4RA 4KI0A 3CHBD 5A2QL 1A3UA 2R7ZB 5JVH3 4XYOA 1TKWB 1MBYA 1M4VA 4BBRB 4DAYA 2B8FA 4G7OC 1SAPA 2ZXPA 3MA2B 2D62A 4QIWB 1B53A 4LAAA 2KECA 4JK1C 1QCBD 4R9WA 3S2DB 4C56C 4DN4M 3I70A 1HHVA 5I2YA 2E2IB 3DEOA 3LWEA 1BUVT 2RDFA 3MXGA 2JXMB 2EYLA 2JA5B 2EYFA 1LT6D 5IGDA 3KLSX 4RH6A 1MSHA 1VCIA 5IGEA 4X3SA 2ZXRA 5KYIA 3KUPA 3CU7A 2K03A 2L4NA 3TSSA 4A3MB 3SVMA 1S5FD 5CV5A 4JBWA 4X3TA 4RGOS 2J0TD 1DOLA 2K7VA 4EQNA 1JWUD 4DAPA 1ZKOA 2OEOA 5CBAE 3R2TA 2DNEA 2K05A 4N9TA 1V1PA 4C3HB 1LTBD 3MZ5A 2SOBA 4C1NK 4KN7C 1RCVD 3QOJA 3MAQA 2H4OA 1TR5A 5IT9E 3GP7A 3HRZC 2E74C 3I4LA 1JICA 3IL8A 3UI2A 2NN6G 4X3UA 5KYLA 1Q12A 1H9JA 3SXHA 2IX0A 3MVVA 3GTMB 4WFN3 2L1BA 1MGSA 1WTOA 1WTPA 5I9OA 1EWCA 2A74C 2JSOA 1ONLA 2E2HB 2JYOA 4A93B 1BCPB 5JEAH 1MI2A 1GHKA 2IL8A 2SEBD 2B8GA 1Y8PB 4V0BA 1G6ZA 1HUNA 3OIPA 1U4PA 3D6WA 2JEBI 2N55A 2AWOA 1Y1VB 1SSOA 3K0YA 3KLSA 4ZUJA 1D5ZC 3MTSA 1B2TA 2K5WA 5C4JB 4BY7B 1BBXC 2B2TA 1OXUA 1G2TA 2F0KA 5CC4A 2ZXOA 3GO5A 5CV6A 4QCLA 3QOLA 2PCFB 3QJYA 3LX0A 4CHTB 1A2UA 2K28A 2C5CA 1FGBD 4RA8A 1YNND 2EY1A 2K04A 1IYVA 4J1MA 5IOCA 3S1QB 1S5CD 2M9VA 5C3EB 1KTKA 2HQEA 5CV8A 4DK0A 1OXVA 2R61A 4PMCA 1EQVA 1HTPA 3S1NB 1CM9A 2AWNA 3GD7A 1ILPA 1TS2A 4BS9A 3KF8A 2O5IC 3BG3A 3TP7A 3H91A 1C8CA 3LNNA 2YYZA 1H9SA 1SNPA 2N88A 2FMMA 4FXGC 4A3JB 2CW0D 1HTLD 4C3JB 1U4LA 1PRTC 4XYQA 3OPOA 3I4NB 1RTNA 3GTGB 3OIQA 5I4DA 3QB3A 1EIHA 1GUWA 4QUFA 2WV6D 4IUUA 3J7YW 4I65A 4IFDI 1CZWA 1ET9A 1H9RA 1QE6A 5CGKA 4C3JG 1LACA 2IX1A 1DM0B 2R93B 1LTGD 1O7LA 5E4XA 2KUMA 4K5XA 2VNUD 1PRTB 3M7NA 1EU3A 2Z4HA 3S1MB 1FYCA 1V1OA 4FP5D 1LT3D 3MWYW 3I91A 4BBSB 1L0YB 2NTTA 1CTMA 2A5HA 3EVQA 4FXDA 5FOBB 1I6HB 3S17B 4FNFA 1IKMA 2D5DA 2EDGA 1H9SB 3N6RA 3SK8A 2E2JB 4Y7NB 3MEHA 1JE4A 2ENBA 3HGBA 3HOZB 5BN4A 5J1ZA 1EQTA 3OHXC 1CZGA 3A8IE 2XRSD 1CQVA 3T56B 5DEHA 3ND8A 2F0SA 4FF4A 2BA0A 1SEBD 4DFAA 1S5BD 3RD4A 5EKIA 3NSWA 3IFDA 5IT9L 1IYUA 3MFGA 3K58A 5JOBA 4B9WA 1XXGA 4FF3A 3BZDB 1SYGA 3Q0AA 1U4RA 5M3FB 2XWBB 2KOLA 4F8MA 3OWEB 5C3XA 1AW7A 3VYSA 1IKLA 2AUKA 2AQ1B 1VMPA 2I07B 4Z9CB 4FYDA 3J80E 1PTOC 2BE5D 3AB9A 3Q23A 4KKTA 3I3CA 2PW7A 1EL0A 3MXNA 4DF7A 3V96A 3RLFA 2NVYB 4G7HC 4XQJA 1Z6HA 4OO1G 2NUCA 3CQZB 4KY6A 4BA1I 2DNCA 4QUCA 1JOOA 1WTXA 5FK9C 1KLUD 2LFNA 1RF2D 3J7AF 2EY5A 4ULLA 2YU9B 2H1EA 3H09A 3HOXB 2L55A 3S15B 4A3BB 3T53B 3DUZA 2CVRA 3TZUA 2WKCA 1PTOB 5FO8B 4ZAIA 4M8AA 1I4PA 4OIJA 4R8NA 4DNTB 2K32A 3HOWB 2EYOA 3BYTB 3NTIA 2D2CC 3Q22A 4KHZA 2XVSA 4E6IA 5M5XB 4ZYSA 1AEXA 3K57A 3URYA 1STEA 2J7ZA 5EPLA 2F0UA 3T51B 3K7AB 1XYIA 3ND9A 1TY0A 1II3A 1PRTD 3TZDA 1BCPF 1S5DD 3VR6A 1SNQA 4N9PA 5AFWA 3Q24A 1I4XA 1BO0A 3SK6A 1K8OA 3TMEA 5BN3A 2PMZB 4OIKA 5EGTA 5I6WA 1Y69U 1RDPD 2O4XA 1CQFA 3NWSA 4L8JA 4PMWA 4HCEA 2EE1A 1W6KA 4MIUA 1TIID 4NW2A 5LL6X 1STGA 1MD2D 1G8ZD 2PQEA 4ZK9B 4A3FB 2PNRC 2IW3A 1L0XB 2FHTA 1TWFB 3HEJA 2F3VA 3L9AX 1QILA 4O42A 5KRUA 2XN9C 2VB2X 3M3YB 4P2CB 1CHQD 1LLRD 1DCZA 4IQZA 2DY7A 1HFNA 3PV0A 2HCIA 1Q1EA 4RGMA 3PIO3 1Q8IA 2FFKB 3MC0B 3BVMA 2NYZD 3M4OB 3TN2A 4R8IA 1K83B 4HSPA 1WCMB 2F0EA 3MXUA 1DXMA 2AQ3B 3P7JA 5C0XJ 2V4DA 4O1NA 5F2DA 1U4MA 1ESRA 1EZ8A 4LK1C 3A7LA 2RBMA 3NP8A 1AP0A 2IX3A 4KKSA 2ICIA 1PZJD 3MXPA 2F1MA 5ELDA 3NWTA 3H3VC 3DHQA 2X69A 2K1BA 1SNDA 4IUNA 1EWHA 2QKIC 2EJMA 1WVLA 3EA6A 5CBEE 1TU2B 1H9KA 4XT3B 1PZKD 5E4WC 1A6XA 2RSOA 3NBIA 3CRLC 3R3OA 4KY5A 2ZT9C 2EPBA 1PFBA 1DJRD 3V05A 3IKJA 1B4OA 2EYHA 2O5JC 1A3VA 1EY7A 3CKIB 4RKBA 3P20A 5TSSA 3TP5A 2JE6I 3SR1A 5LHY1 1LTSD 2WINB 3TP6A 3RUZA 4EGVA 1ZXTA 1C48A 5DM73 1WTRA 3E6ZX 3HKZB 1B9NA 2NBFA 4A3DB 4UDUC 1PTOD 4IFDJ 2WP8J 2E76C 3R2IA 4J8QA 4KD3A 1R4QB 3MFYA 3PUZA 4UAIA 4A3EB 2B39A 3J80L 4OO1H 4CJ0B 2LKVA 2NVQB 3PUVA 4B9XA 1BDOA 1EOTA 4C1NI 1TS4A 1TS5A 4K5VA 2JA7B 4DU9A 1QNKA 1X3QA 1FNVA 4M1UB 1ESFA 2BE5C 5C3WA 2KQ3A 1IHZA 5C5LA 5DM63 1I3QB 2F0JA 1EFID 1CA6A 1ET6A 4Q0FA 1TY2A 2KCCA 5JEAJ 5C0XI 1QB5D 1V1PB 2JP1A 2O2LD 1E2VA 1EYAA 2B2UA 1PTOH 4TSSA 1BF4A 5FO7B 4RAUC 4XDXA 2Y0SB 1TS3A 1RJTA 4DXFA 2L9HA 3D4DA 1VF5C 4A3GB 1X3PA 3D4RA 2KEDA 4IN3A 3GTOB 5C44B 3C1FA 1HQRD 5E1FA 5K36H 2BOSA 2XRQD 1JR0D 2B2TC 4OL7A 1OO9B 3C46A 1LTTD 3D4WA 1I4HA 2F0GA 3U9OA 5CYUA 3H0GB 1T5EA 3FMCA 1SDFA 2B2UC 2FJ2A 1STNA 1JORA 2KCNA 4XQNA 4KHVA 1T5XD 4RKLA 2RDGA 2RA4A 4HMIA 3TDQA 1IW7C 1QWYA 1LO5D 1KNAA 1D5XC 2F0MA 1C4QA 1PXUA 4KKUA 2F0HA 3C1EA 1EEID 3R8BA 4NMZA 5FLXE 4C3IB 4IALA 5COYA 2KEEA 1TVXA 2EYPA 3T16A 2EYJA 1QOHA 4KD4A 5M9OA 1OXSC 4KJNA 2PZWA 1K8MA 1EIGA 4LJZC 4BY1B 3QG1A 2IWHA 2KVMA 3QIAA 2WACA 2JEAI 3NUCA 1NR2A 4C3IG 3RMHA 3E0JA 1SYDA 5C4ZA 3K5LA 5T1GA 1F9QA 4IUVA 3DWQA 1AN8A 3S2HB 2M00A 1Y1WB 1BR9A 4FVMA 5A2QE 2EY2A 1GHJA 4KK7A 3T4AC 2HDMA 1DONA 3I90A 4PMBA 5EBDA 3G6JB 4RCNA 2CHBD 1SYFA 3GTLB 4PQXA 1VDZA 1GUGA 1KDBA 5D3DA 2MGSA 4RGNA 4A3KB 1G91A 5D65A 3GQBA 4ID6A 3NHHA 3HS0C 4K2LA 1F2LA 3FDTA 2F0TA 1JWSD 4RWSC 1X32A 2PYKA 1EY4A 1SE4A 1H9MA 2NN6H 4HTHA 2CQAA 2K5DA 3FEWX 5EKLA 3S1RB 2ID0A 1LTRD 1U9RA 3DWPA 2F0QA 5G3LD 1FNWA 1B3AA 5IIFA 3SEBA 3K5NA 2PZTA 3PMFA 1DOKA 2K01A 2RVLA 4DK1A 4H0LC 1JCKB 3A8KE 4G57A 2LMCB 1ZEQX 3A8JE 5HURA 3HZXA 1UNSA 3ERQA 1D1KA 1BQQT 4CBVA 4AYBB 4K8JA 4KY7A 1WD1A 4IFDG 3D8GA 1LT4D 2EXZA 3PUXA 1SMYD 1NCVA 3GTKB 1JQYD 3KBXA 1G291 3VA5A 1JB3A 5ELEA 1A2TA 1HXYD 1F9RA 2F0IA 3D3RA 4K5WA 1GOZA 2F03A 2D9UA 1UAPA 4RCOA 1W6JA 1NAPA 3BVGA 1QJOA 3PO2B 1UUPA 2LS01 4PV1C 1XWEA 4ZUIA 2E75C 3BDLA 3L3OC 1AFPA 3DM1A 1AZQA 2K33A 5M5YB 4FF2A 2F4IA 2A73B 1LT5D 1SE2A 3J81E 5JEAG 2IPKD 4H7BA 5KEEA 3M4YA 2JA6B 3NPPA 5KGUA 2B2VA 1EYCA 3H6MA 3FKIB 1QG7A 5E3FA 1FNUA 1ENCA 1A3TA 1E2WA 3OSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMF A;  5M9O A;  1EQV A;  1SNM A;  1JOK A;  4KD4 A;  5EGT A;  2PZU A;  4NKL A;  3QOJ A;  4KJN A;  5I6W A;  4NDX A;  5DAU A;  2PZW A;  3EVQ A;  3P75 A;  5C6A A;  2F0D A;  4G57 A;  1STY A;  3BDC A;  1KAB A;  1SNO A;  1TR5 A;  3R3O A;  2O4X A;  4KTA A;  5HUR A;  2PW7 A;  4KY5 A;  4EQP A;  3V2T A;  1KAA A;  4ZQ3 A;  3HZX A;  5IGB A;  1EYA A;  4MIU A;  3ERQ A;  4DF7 A;  5J22 A;  1A3U A;  1SYC A;  1NSN S;  2WAC A;  3NUC A;  1STA A;  1STG A;  5KYL A;  4DGZ A;  4K8J A;  2EYH A;  4KY7 A;  1A3V A;  2PQE A;  5ISR A;  3TP7 A;  1SYD A;  3D8G A;  4PNY A;  2EXZ A;  3SXH A;  4KJO A;  5C4Z A;  1EY7 A;  4RKB A;  1SYB A;  5NUC A;  5K5P A;  1TQO A;  3MVV A;  1STH A;  3D4D A;  3D6C A;  1EY8 A;  1F2Z A;  2F3V A;  2NUC A;  3HEJ A;  4KY6 A;  5C5M A;  3SK8 A;  3OMG A;  3VA5 A;  2M00 A;  5CV9 A;  5I9O A;  3DMU A;  3NXW A;  5J39 A;  1A2T A;  1KDC A;  1JOO A;  1TT2 A;  2PW5 A;  3MEH A;  5CR3 A;  4K2K A;  3TP5 A;  5KRU A;  3SR1 A;  2ENB A;  2EY2 A;  4WOR A;  2F0N A;  3C1F A;  1SNP A;  1STB A;  2F0I A;  3OMC A;  2EY5 A;  3TP6 A;  4K5W A;  3RUZ A;  4TRD A;  2SNM A;  4LAA A;  5J1Z A;  5E1F A;  2QDB A;  1JOQ A;  4IZ8 A;  4PMB A;  3NQT A;  4WRD A;  4OL7 A;  5KIX A;  5HGT A;  5JAV A;  1SYF A;  4K14 A;  3ITP A;  1EYD A;  2F0V A;  3D4W A;  3E5S A;  3TP8 A;  5IGG A;  2F0G A;  3U9O A;  4KD3 A;  4ME5 A;  1EY9 A;  1KDA A;  1KDB A;  4ZUJ A;  4K6D A;  4R8N A;  5EKK A;  2OXP A;  3QB3 A;  4S3S A;  5IGC A;  2F0E A;  2RDF A;  1SNC A;  4QB4 A;  2EYL A;  5I9P A;  4F7X A;  2EYO A;  1EY5 A;  1EY0 A;  2EYF A;  2F0S A;  2F0L A;  1EY6 A;  2F0O A;  5DEH A;  4DFA A;  1F2M A;  2KHS A;  3NK9 A;  5IGD A;  5IOD A;  1STN A;  5C4H A;  4ZUI A;  4E6I A;  4ID6 A;  4I65 A;  2LKV A;  3BDL A;  1JOR A;  3NHH A;  5F2D A;  5CV8 A;  4K2L A;  1AEX A;  4KHV A;  5IGE A;  2F0T A;  4RKL A;  5KYI A;  4HMI A;  4EVO A;  5CGK A;  5JOB A;  2F0K A;  4QMG A;  4EQO A;  4B9W A;  2EY6 A;  1F2Y A;  5CC4 A;  4B9X A;  4ODG A;  1EZ8 A;  4PMC A;  4YIJ A;  2F0U A;  4NP5 A;  1SYG A;  3EJI A;  2F3W A;  3QOL A;  2PYK A;  1EY4 A;  5CV4 A;  5CV6 A;  3LX0 A;  5CV5 A;  1A2U A;  2RBM A;  1RKN A;  3NP8 A;  3SHL A;  2F0F A;  3P1H A;  4K5V A;  4HTH A;  2F0M A;  4H7B A;  2RKS A;  4K5X A;  5CV7 A;  4EQN A;  4DU9 A;  2OEO A;  1EZ6 A;  2F0H A;  5KEE A;  1II3 A;  3C1E A;  5EKL A;  2EY1 A;  4F8M A;  2F0W A;  5IGF A;  5I6Y A;  3SK5 A;  3MXP A;  4J1M A;  4NMZ A;  5IOC A;  1ENA A;  5KGU A;  5C3X A;  2OF1 A;  1NUC A;  4N9T A;  1EYC A;  4QF4 A;  5C3W A;  1U9R A;  2KQ3 A;  3H6M A;  3OWF A;  4KV6 A;  1SNQ A;  4IAL A;  4N9P A;  1IHZ A;  2F0Q A;  5E3F A;  3SK6 A;  3T13 A;  3DHQ A;  3TME A;  1ENC A;  5C5L A;  2F0P A;  1A3T A;  3ERO A;  1SND A;  2EYP A;  2SNS A;  3MZ5 A;  3T16 A;  3MHB A;  2SOB A;  3OSO A;  4IUN A;  3SK4 A;  3S9W A;  1SYE A;  4HMJ A;  4J6H A;  4K8I A;  2HQE A;  2EYJ A;  2EYM A;  5IIF A;  2PZT A;  2F0J A; 
#chains in the Genus database with same CATH topology
 4G4K A;  3SDZ A;  2HUG A;  4DV3 Q;  4NKL A;  1D1I A;  1PZI D;  3CCV A;  4NDX A;  4DR3 L;  5C6A A;  3BS1 A;  3BYY B;  1KRS A;  2A68 C;  2WB1 E;  4EQP A;  4DAV A;  1K3R A;  1PH3 A;  2JA6 G;  1IW7 D;  2ZTD A;  1EOV A;  1ICW A;  3H0G H;  1IBL Q;  1NSN S;  1STA A;  4P73 A;  5KNC A;  2UXD Q;  2BH8 A;  1F9S A;  3PO3 G;  4KJO A;  1KLG D;  4TQU S;  1YJW A;  3L2P A;  1A15 A;  1VQE A;  2EVB A;  2A19 A;  1Q7Y C;  1F2Z A;  5GAD C;  1ICF B;  5IWA Q;  4K6L A;  1IL8 A;  2LY7 A;  4DR4 Q;  1LUZ A;  1I4Q A;  2SNM A;  4HSV A;  4HCS A;  1XMQ L;  4LF8 Q;  4LF5 Q;  1F77 A;  2HCC A;  3NQT A;  4CDE C;  5JAV A;  5FLX L;  4Q5V A;  4POG A;  4K14 A;  4B3S L;  1QVF A;  1T9H A;  3TP8 A;  4CKB A;  4DR1 Q;  2L11 A;  3GTQ B;  2QGQ A;  3DWA A;  1PHJ A;  4C3I H;  4JG2 A;  4F87 A;  1ZYR C;  4IUQ A;  5IGC A;  1LAB A;  2XTI A;  1JWM D;  1SNC A;  1PLF A;  4F7X A;  1EY0 A;  2F0L A;  1VQP A;  1B9M A;  2NN6 I;  3NK9 A;  1VQ6 A;  3NQI A;  3IFT A;  2CH4 W;  3F2D A;  3HOU B;  5C4X B;  1Y14 B;  4V19 0;  1B1Z A;  4MN3 A;  4YCU A;  3TRE A;  2QF7 A;  2Z8L A;  4IUT A;  1Q86 C;  4QMG A;  1G2S A;  1F2Y A;  3HKZ E;  4ZKB B;  4BY1 H;  4POF A;  2J4X A;  4HJ5 A;  2QEX A;  4YY3 Q;  2F0F A;  2ZJP A;  3G7L A;  1SJE D;  3I4O A;  1WFQ A;  2AKW B;  4DV6 Q;  5JVG 3;  1VQ7 A;  2WKD A;  2N78 A;  1VQD A;  3W2D A;  3FRP B;  3SK5 A;  4H44 C;  3KJP A;  2VUM G;  3SE0 A;  3OTO Q;  3S2H H;  2XWJ B;  2Q8R E;  1Y1W H;  3HOU G;  5C4X G;  1KNE A;  3WOF A;  1HNZ Q;  2VXW A;  1YJ9 A;  4K8I A;  4DV3 L;  3E0E A;  2HQL A;  1VQK A;  2GN5 A;  2PZU A;  1HFG A;  3TEH B;  1Y8O B;  3X3M A;  5FO9 B;  2F0D A;  1STY A;  3BDC A;  1S5E D;  2EOT A;  2WB1 B;  3GTL H;  1WTH A;  4IUR A;  3K5M A;  1GVP A;  1IBL L;  4ZQ3 A;  5IGB A;  3L7Z C;  4DK6 C;  1SE3 A;  2ICE C;  4RGT A;  2UXD L;  3CCR A;  1CI3 M;  1NY4 A;  1OXT A;  1SJH D;  1X3F A;  4XIG S;  4DR2 Q;  3A5Z B;  1Q90 A;  1F9P A;  2IT1 A;  1VQ4 A;  4A76 A;  4A3K H;  5NUC A;  4ZKC B;  2R3Z A;  3TBI B;  5IWA L;  4FF1 A;  3D6C A;  2KA7 A;  5CV9 A;  4DR4 L;  1KDC A;  2XIW A;  2DY8 A;  4P71 A;  3K6O A;  4WOR A;  4LF8 L;  2BA1 A;  1VQF A;  4LF5 L;  1ROD A;  5ELB A;  5EBC A;  3VR2 A;  1D2B A;  3K80 C;  2B63 B;  4JI4 Q;  1JOQ A;  4IZ8 A;  1TWG B;  1NTG A;  2IJ0 A;  2NWG A;  5KIX A;  3HP3 A;  4DR1 L;  3M7G A;  3LWU A;  3PSI A;  2R92 B;  4LFA Q;  3S1R H;  4UY8 C;  2K5N A;  1VS0 A;  3CC7 A;  5CMD A;  1SXT A;  4ME5 A;  5IYC G;  4OX9 Q;  4U68 A;  2I46 A;  3A55 A;  1HA6 A;  2ALY B;  4IFD H;  4S3S A;  3NBH A;  4FXK C;  2L12 A;  2A6E C;  5EQ0 A;  5IYB H;  2JA5 G;  5LL6 S;  3F2U A;  3R93 A;  4A4I A;  2NTS A;  1BCP C;  1PRT F;  3IAY A;  1PDQ A;  2B63 G;  4LFB Q;  2OT2 A;  2BCO A;  4YWL A;  4JI1 Q;  4EQO A;  1XNR Q;  4DV1 Q;  2DN8 A;  4YY3 L;  5AJ3 Q;  1ILQ A;  2F3W A;  2XSC A;  2FMC A;  4IPH A;  1RKN A;  4DV6 L;  4QGU A;  1NR4 A;  2Q8I B;  4TKO B;  1YIJ A;  3VR3 A;  3QWN A;  5IGF A;  4JBM A;  1CA5 A;  5FLX c;  1DYQ A;  3CRK C;  4QF4 A;  3OTO L;  1VQC A;  3GTK H;  2HT1 A;  1Q1B A;  1HNZ L;  1MSG A;  4U67 3;  5D3I B;  5E7N A;  2NB0 A;  3QO2 A;  4C3H G;  3MHB A;  1GO3 E;  1PVO A;  4J6H A;  4GOP C;  1ASY A;  4XXE A;  2AUJ D;  1O78 A;  1HZA A;  5DAU A;  1SMY C;  1KAB A;  4DNR B;  1SNO A;  2PPB C;  5BR8 Q;  5FKA C;  4DR2 L;  1KAA A;  2QCP X;  3KJO A;  3PO2 H;  4DGZ A;  4YWK A;  5ISR A;  2L5T A;  4H13 C;  3PIP 3;  3F8T A;  3H94 A;  4JBJ A;  1TQO A;  1UE5 A;  2M2L A;  2AQ2 B;  4OEL B;  4HID A;  2MPM A;  4RFB A;  4A3L H;  5C5M A;  3OMG A;  2K14 A;  1N9W A;  3DMU A;  3NXW A;  5FJ8 H;  5J39 A;  5CR3 A;  1VQH A;  3O13 A;  3J81 L;  2F0N A;  3FPP A;  3BU2 A;  4GZY C;  1STB A;  5M5Y H;  3OMC A;  3M85 A;  4JI4 L;  4F88 A;  3D31 A;  2VQF Q;  1J8I A;  2L15 A;  4HIM A;  5HGT A;  4GOP B;  2PQA A;  2CQO A;  3ITP A;  1JJG A;  3ULP A;  4LFA L;  1EYD A;  3E5S A;  1E1O A;  4IOC A;  1XPU A;  2JA6 H;  4C2M B;  3J80 i;  3NBH B;  4LF6 Q;  2KHI A;  2A68 D;  2QDL A;  1Y1V G;  2JN4 A;  2VZA A;  1X3G A;  3FKI H;  5EKK A;  1PH6 A;  3C3L A;  1DOM A;  4HJA A;  4YCW A;  1E1T A;  3FHW A;  3AMU A;  3FVQ A;  5M5W B;  4XTC S;  2PI2 E;  3JAM E;  1F2M A;  1LTI D;  1YNJ C;  2QEJ C;  5A35 A;  2G9D A;  4LFB L;  3RZO B;  4JI1 L;  4BY7 G;  2D0O A;  4DV1 L;  4EVO A;  3STB C;  5AJ3 L;  2TMP A;  2MP1 A;  4ODG A;  5D14 A;  4YIJ A;  3VR5 A;  2Z4I A;  3BZC A;  1TWA B;  3S16 B;  5ELC A;  1PFM A;  3SHL A;  2VS1 A;  3PF5 A;  1EZ6 A;  1WYD A;  2RQX A;  2VY3 A;  1Z9F A;  4OXP A;  3NTH A;  1NUC A;  1PYW D;  3AU7 A;  4KV6 A;  2DJG C;  1VQ8 A;  2DJF C;  1MIU A;  3BVZ A;  4I7Z C;  3T13 A;  1SFO B;  4JYA Q;  2F0P A;  3ERO A;  4DUY Q;  2JQO A;  4MZ9 A;  3NTK A;  3PUW A;  1ZYR D;  1CKM A;  4A3I B;  1VF7 A;  2EYM A;  5C3E G;  2IY5 B;  1UEA B;  1QUQ A;  1JOK A;  1LV9 A;  2NZ1 D;  5T1I A;  4L63 B;  3P75 A;  5BR8 L;  4DV7 Q;  5ELF A;  5M3M B;  1HRJ A;  1IYJ B;  3GTQ H;  1ENF A;  2UUB Q;  3HG9 A;  4WJW A;  5LMU Q;  3VYU A;  2B2Y A;  2A1A A;  2KJX A;  4IUP A;  3FPU B;  1Y8N B;  4KN4 C;  5K5P A;  3NEM A;  2QIL A;  1STH A;  1PTO F;  1B44 D;  2RHS B;  1V43 A;  2NZO A;  5JPM C;  2HIV A;  1BOS A;  5C4X H;  3HOU H;  1TT2 A;  1A0I A;  1J5E Q;  1GXD C;  2Z1C A;  4MTN A;  2C9O A;  2VQF L;  2PQA B;  3PUY A;  4TRD A;  1PYB A;  2RDH A;  1VMC A;  3PCO B;  1U5K A;  5KND A;  1WTV A;  1K73 C;  2K6A A;  1Q3L A;  4XT1 B;  4AYB E;  1W3S A;  4FO2 A;  1O7Z A;  3VA7 A;  2F0V A;  5IGG A;  4LF6 L;  1JJC B;  2MO0 A;  2K4K A;  2WFW A;  1IBM Q;  1PH7 A;  3EQL C;  5ELO A;  4HED A;  4RHS A;  4K6D A;  2A69 C;  1PMR A;  2A6H C;  3KDF A;  1GUN A;  4HAE A;  1PH5 A;  1Z7T A;  3HKS A;  5EPJ A;  2KHS A;  5C0X G;  5C4H A;  3J7A V;  3CP0 A;  5JJZ A;  1WTW A;  1FR3 A;  4BWG B;  2B2Y C;  4DV5 Q;  3WOE A;  4OO1 I;  2UU9 L;  3LGJ A;  2HDL A;  1YHA A;  1RTO A;  3EJI A;  2NVT B;  5CV4 A;  4JCV E;  3U9S A;  2G5D A;  3I55 A;  1OTC A;  1XTC D;  4ZCK A;  2RKS A;  2NVX B;  5ELN A;  5I2X A;  2RSN A;  1D6E C;  4ALP A;  3CME A;  1QVG A;  1Q8K A;  4DA2 A;  2EZV A;  2L0C A;  5DNF A;  4ABN A;  4JYA L;  3OWF A;  1J9O A;  4DUY L;  1E2Z A;  5JJI A;  3KK7 A;  1QUQ B;  4CDF C;  2SNS A;  2IHF A;  3UDX A;  1HQM C;  1BXT A;  2BDN A;  3S9W A;  1SYE A;  5BN5 A;  4HN7 A;  4A3C H;  2F3I A;  1I4G A;  3UDI A;  1CHP D;  2ASB A;  2EJG C;  2A6E D;  1RHP A;  3N52 A;  3DXJ C;  2K75 A;  4DV7 L;  2B63 H;  1WD0 A;  1TWG H;  4BA2 I;  1EIY B;  1GUT A;  3KBG A;  1BCP D;  2JA8 B;  1NBW A;  2MJ8 A;  2UUB L;  1WOC A;  3V2T A;  3NE5 B;  1K9M C;  5LMU L;  2R92 H;  1RD9 D;  4G7Z C;  1BNZ A;  5GAH C;  2K5Q A;  1NNX A;  3KFU A;  3GV6 A;  2Q8T A;  3HOY B;  4PNY A;  2OQ0 A;  1EEF D;  1SYB A;  1DD2 A;  2DUD A;  1GJX A;  1SBB B;  5EJW A;  4NXM Q;  1WTQ A;  3KYH C;  2MHV A;  4AH6 A;  1J5E L;  1R9T B;  4C3H H;  4P75 A;  2PW5 A;  1EQR A;  2B2W A;  4TVA B;  1GUS A;  2JA8 G;  3HOZ G;  4X3K A;  2WII B;  3ONA B;  4WRD A;  5JPN C;  1PH9 A;  3K59 A;  2SDF A;  1IBM L;  3Q6S A;  4IJH A;  3FP9 A;  2PO4 A;  3HOY G;  3KDF B;  4L6T B;  1KXL A;  1EU4 A;  4GN5 A;  2R6G A;  3G6E A;  1CFM A;  2Z6B A;  2OXP A;  5DLQ E;  4LF7 Q;  4KMU C;  1PV4 A;  1V8Q A;  4QB4 A;  5I9P A;  1XX8 A;  1B8A A;  4DV5 L;  4CKC A;  4RHR A;  1SR3 A;  1ML0 D;  4DXG A;  4R4T A;  1VQG A;  3Q8D A;  3A56 A;  3WDN A;  4CDC C;  1AZP A;  4NP5 A;  2N3S A;  4XQQ A;  2KCM A;  3P1H A;  2Q2H A;  3ER0 A;  2B2W C;  3BJU A;  1D5M C;  5M3F G;  1I50 B;  4LW1 A;  3OW2 A;  2KHJ A;  1BVS A;  3I72 A;  4ZRZ A;  2VL6 A;  5EPK A;  1ENA A;  1S4Z A;  3VYT A;  1R4P B;  5FLM G;  4EQ5 A;  2EJF C;  4IO9 A;  2E5L L;  3M4P A;  1X3E A;  3I4M B;  1VQM A;  3H15 A;  2K52 A;  2E2D C;  1CK1 A;  4WJ3 M;  1SNM A;  4CJ1 B;  1YNJ D;  4GN3 B;  2JA9 A;  3I8Z A;  2X6L A;  1E0B A;  3S14 B;  4OON A;  3C2P A;  2GA4 B;  3I73 A;  4UP9 A;  4HR7 B;  3STB D;  1GUO A;  2EXD A;  3X3N A;  2G9H D;  3ZJY C;  4C2M H;  5J22 A;  1SYC A;  2TSS A;  3JAM L;  1LTA D;  2HIX A;  4O0A A;  1HA5 A;  3PO3 B;  1FD7 D;  1C7Y A;  1CKN A;  3I4M G;  4B08 A;  5M5W H;  4NXM L;  1EY8 A;  1PH4 A;  1TWC B;  3W3A A;  4JOI C;  3GV3 A;  3RZO H;  1N36 Q;  2MFI A;  4K2K A;  2BDO A;  1XPO A;  1IZ6 A;  4Y52 H;  3EFX D;  1KC8 C;  4OHJ A;  4QIW E;  1NMG A;  1JC7 A;  2F52 A;  3RZD B;  2CKZ B;  2QDB A;  1TWA H;  3VYR A;  3S16 H;  1YNN C;  4A3B G;  4CGY B;  3OW7 A;  1DZ1 A;  3BDO A;  2C35 B;  1TWH B;  4ZLT F;  5KNB A;  4I7A A;  4LF7 L;  1Z47 A;  1B50 A;  1EY9 A;  1KDA A;  2WAQ B;  2XNA C;  1YEZ A;  4GKJ Q;  2CFM A;  1SFO H;  2X6G A;  1EY5 A;  2F0O A;  1EY6 A;  3K5O A;  5IOD A;  2B2V C;  4A3I H;  1CT1 D;  1HCZ A;  4GKK Q;  3OOC A;  3KLR A;  1P16 A;  1J6Q A;  4RMF A;  1HZB A;  4MHE A;  3A7A B;  2EY6 A;  5G3L F;  1M8A A;  3GTJ B;  5M3M H;  2VB3 X;  4YCV A;  2NZH A;  4ILW A;  1WJJ A;  5K36 G;  3DEP A;  1L1O A;  5CV7 A;  4LMQ D;  1HPC A;  4CJ2 C;  1TXY A;  2WAQ G;  3D0F A;  4CKE A;  1OXX K;  2F0W A;  5I6Y A;  2MUY A;  4IPG A;  3GTP B;  2OF1 A;  1O7Y A;  2VUM B;  4RG1 A;  3HOV B;  5COR A;  1IBK Q;  2UXC Q;  1QNU A;  1FGU A;  2FIN B;  1G51 A;  3SK4 A;  4BXX G;  2A69 D;  2A6H D;  4HMJ A;  3VR4 A;  5C0X H;  1I94 Q;  1O80 A;  2CW0 C;  4UP7 A;  1EWI A;  4JW0 A;  3A54 A;  1HUM A;  1I6V C;  1PFN A;  3A0J A;  4JI8 Q;  4KTA A;  3QR8 A;  3ZYY X;  4OGQ C;  1PA6 A;  1XTD A;  1I4R A;  3PQI A;  4KI0 A;  3H3V I;  3CHB D;  5A2Q L;  4R4Q A;  1A3U A;  4DV2 L;  2GVA A;  3HOV G;  4JV5 Q;  1YHQ A;  4JI7 Q;  2R7Z B;  5JVH 3;  4XYO A;  4IJL A;  4HJ7 A;  4A3F G;  2YV5 A;  1KQS A;  1TKW B;  3DLL A;  1MBY A;  1M4V A;  1N36 L;  1L1O C;  1V9P A;  4BBR B;  4DAY A;  2B8F A;  5HY6 A;  1D7Q A;  4G7O C;  1SAP A;  2E8G A;  2ZXP A;  3MA2 B;  2D62 A;  4QIW B;  1X54 A;  1B53 A;  4LAA A;  1NJI C;  2KEC A;  2NVT H;  4JK1 C;  1QCB D;  1E7Z A;  4R9W A;  2NVX H;  3S2D B;  1A8V A;  2R7Z G;  2ZTE A;  4L5Q A;  4C56 C;  4DN4 M;  3I70 A;  1L0W A;  4GKJ L;  3F2C A;  1HHV A;  5I2Y A;  2E2I B;  3DEO A;  3LWE A;  1EYG A;  1BUV T;  3K0X A;  2RDF A;  4J15 A;  1KIX A;  3MXG A;  2JXM B;  2EYL A;  1WCM G;  4BBR G;  2JA5 B;  3G71 A;  2EYF A;  4GKK L;  4LUZ A;  3JAM c;  1LT6 D;  5IGD A;  5H1S E;  3KLS X;  4RH6 A;  1MSH A;  1VCI A;  5IGE A;  4X3S A;  2ZXR A;  5KYI A;  3CD6 A;  2I0Q A;  3UDG A;  3KUP A;  3CU7 A;  2K03 A;  2L4N A;  3TSS A;  4A3M B;  1O7I A;  2JA8 H;  3HOZ H;  3SVM A;  4PZ7 A;  1S5F D;  5CV5 A;  4JBW A;  4X3T A;  3KLW A;  4RGO S;  2J0T D;  1DOL A;  2K7V A;  4EQN A;  1JWU D;  4DAP A;  1ZKO A;  2OEO A;  5CBA E;  3HOY H;  3R2T A;  1IBK L;  2DNE A;  2UXC L;  2K05 A;  4N9T A;  4DUZ Q;  1V1P A;  4C3H B;  1LTB D;  1VQ5 A;  1I94 L;  3MZ5 A;  1R9T H;  2SOB A;  4C1N K;  3AYH B;  4B3M Q;  4KN7 C;  5IP7 G;  1YNX A;  1RCV D;  4DR6 Q;  3L0O A;  4N8X 1;  4A3M G;  4FDB A;  3QOJ A;  2OQK A;  3MAQ A;  2H4O A;  1A63 A;  1TR5 A;  5IT9 E;  3GP7 A;  3HRZ C;  1KHI A;  2HD3 A;  2E74 C;  3I4L A;  4AQY Q;  1JIC A;  4JV5 L;  1LTL A;  4JI7 L;  3IL8 A;  2RCN A;  3UI2 A;  4JI3 Q;  2NN6 G;  3F1Z A;  4X3U A;  5KYL A;  3A5U A;  1Q12 A;  1H9J A;  4JI2 Q;  3SXH A;  4L5S A;  4DAY B;  2IX0 A;  3MVV A;  5FLM H;  1HR0 W;  4WFN 3;  3GTM B;  2L1B A;  1MGS A;  1WTO A;  1WTP A;  5I9O A;  2A8V A;  1EWC A;  2A74 C;  2JSO A;  2MNA A;  1ONL A;  1X6O A;  2E2H B;  2GVB A;  2JYO A;  4A93 B;  3CPW A;  4HIO A;  3I7F A;  1BCP B;  5JEA H;  1MI2 A;  1GHK A;  2IL8 A;  2SEB D;  2B8G A;  3J7Z C;  1Y8P B;  4IPC A;  4V0B A;  1G6Z A;  1HUN A;  4R4I A;  3OIP A;  1U4P A;  3CXC A;  3RN2 A;  1I50 H;  3D6W A;  2JEB I;  2N55 A;  2AWO A;  1Y1V B;  1SSO A;  3K0Y A;  3KLS A;  2UUA Q;  4ZUJ A;  1N33 Q;  1D5Z C;  3I4M H;  3MTS A;  1B2T A;  3CPF A;  1M90 C;  3EBE A;  1PH2 A;  2K5W A;  1SLJ A;  3NEN A;  5C4J B;  4A93 G;  4X6A H;  4MTK A;  1YBY A;  4ME3 A;  1BBX C;  4BY7 B;  2ZTC A;  2B2T A;  1OXU A;  1XNQ Q;  3S14 H;  1G2T A;  2F0K A;  5CC4 A;  2ZXO A;  3GO5 A;  4OX9 L;  3PIO A;  5CV6 A;  4QCL A;  3QOL A;  2PCF B;  3QJY A;  3LX0 A;  4CHT B;  1A2U A;  4GLX A;  3CC2 A;  3TQY A;  2K28 A;  2C5C A;  1FGB D;  3PO3 H;  4RA8 A;  1YNN D;  2EY1 A;  2K04 A;  4CDD C;  1IYV A;  4DUZ L;  4J1M A;  1UE6 A;  5IOC A;  3RLO A;  3S1Q B;  4PZ8 A;  1UEB A;  3U58 A;  1H95 A;  1S5C D;  2M9V A;  3RN5 A;  1TWC H;  4B3M L;  1B7Y B;  1XNR L;  4H02 A;  1ASZ A;  4DR6 L;  5C3E B;  3ICE A;  1KTK A;  2HQE A;  5CV8 A;  4DK0 A;  1OXV A;  2R61 A;  4PMC A;  1L2F A;  1EQV A;  1HTP A;  1XMO Q;  3RZD H;  3S1N B;  1CM9 A;  2AWN A;  3GD7 A;  1ILP A;  4AQY L;  1TS2 A;  1VQI A;  4A75 A;  1TWH H;  4BS9 A;  4JI3 L;  3KF8 A;  2O5I C;  3BG3 A;  4JI2 L;  3TP7 A;  3H91 A;  1IL2 A;  3S24 A;  1C8C A;  3J81 i;  3LNN A;  5J3B A;  4A3G G;  4PZ6 A;  2YYZ A;  4GLA C;  1H9S A;  4MNO A;  1SN8 A;  1SNP A;  5C44 G;  2Q2U A;  1LM0 A;  2N88 A;  1UE1 A;  2FMM A;  4FXG C;  3GTJ H;  4A3J B;  2CW0 D;  1HTL D;  3I56 A;  4C3J B;  1U4L A;  1PRT C;  1K28 A;  4XYQ A;  3OPO A;  3I4N B;  1RTN A;  1X9N A;  1YVC A;  3GTG B;  2UUA L;  3OIQ A;  1N33 L;  3GTP H;  2VUM H;  3HOV H;  1W2B A;  4LF9 Q;  1KRT A;  4OEM B;  5I4D A;  3QB3 A;  1EIH A;  1GUW A;  3M9B A;  2QW7 A;  4QUF A;  2KEN A;  2WV6 D;  4K0K Q;  2DGY A;  4IUU A;  3J7Y W;  1IXR A;  3CAM A;  4I65 A;  4IFD I;  1CZW A;  1ET9 A;  1XNQ L;  1H9R A;  4A3J G;  1QE6 A;  5CGK A;  4C3J G;  1LAC A;  2IX1 A;  1DM0 B;  1YZ6 A;  3G4S A;  3I4N G;  2R93 B;  1LTG D;  1O7L A;  5E4X A;  2KUM A;  4K5X A;  4O2D A;  4JI0 Q;  2VNU D;  1QVC A;  2R7Z H;  2JK8 A;  1SMX A;  3I2Z A;  1PRT B;  1N34 Q;  3M7N A;  1EU3 A;  2Z4H A;  3S1M B;  4BBR H;  3PF4 A;  2LXJ A;  1FYC A;  1V1O A;  4FP5 D;  1LT3 D;  1XMO L;  3MWY W;  3I91 A;  4BBS B;  1L0Y B;  2R93 G;  2NTT A;  3BZK A;  1CTM A;  2A5H A;  3J81 c;  3EVQ A;  3G48 A;  3KF8 B;  4FXD A;  2R7F A;  1YI2 A;  1D8L A;  3S2D H;  5FOB B;  2OTL A;  1I6H B;  5IYC H;  3S17 B;  2UXB Q;  1WI5 A;  4FNF A;  2E2I H;  1Q81 C;  3T1H Q;  1IKM A;  3KOJ A;  2JA5 H;  2D5D A;  2EDG A;  1H9S B;  1B3Q A;  3N6R A;  3SK8 A;  2E2J B;  3AQQ A;  4Y7N B;  4APV A;  4BBS G;  3MEH A;  1Y1W G;  1JE4 A;  2ENB A;  3HGB A;  4DAM A;  3HOZ B;  5IP7 H;  5IE8 A;  3RNU A;  5BN4 A;  4A3M H;  3J7A 5;  5J1Z A;  3E3X A;  1EQT A;  3OHX C;  1CZG A;  3A8I E;  3HFZ B;  5LMN W;  2XRS D;  3UE1 A;  3CC4 A;  1CQV A;  4LF9 L;  4UP8 A;  1EFW A;  3T56 B;  3PGZ A;  4K0K L;  4GNX A;  5DEH A;  3ND8 A;  2F0S A;  4FF4 A;  2BA0 A;  1SEB D;  4DFA A;  1S5B D;  3RD4 A;  2YTY A;  5EKI A;  2ATW A;  3NSW A;  3IFD A;  5IT9 L;  1IYU A;  3MFG A;  1E22 A;  4IOA A;  3K58 A;  1VQA A;  5JOB A;  4B9W A;  2VQE Q;  1XXG A;  4FF3 A;  3BZD B;  4X64 Q;  1SYG A;  2LXK A;  1AE3 A;  3Q0A A;  1U4R A;  4JI0 L;  2FXQ A;  5M3F B;  3K81 C;  2WAQ E;  4QL5 A;  3W1B A;  2XWB B;  2KOL A;  4F8M A;  3B6Y A;  3OWE B;  5C3X A;  1N34 L;  1AW7 A;  3VYS A;  4LF4 Q;  3GTM H;  1E3P A;  1IKL A;  2AUK A;  3RR5 A;  2ZJR A;  2AQ1 B;  1VMP A;  2I07 B;  5IYB G;  2E2H H;  4A93 H;  4X62 Q;  2PMZ E;  1JMC A;  4Z9C B;  4FYD A;  3J80 E;  1PTO C;  2BE5 D;  3CCE A;  3AB9 A;  4GNX C;  3Q23 A;  4KKT A;  3I3C A;  4L5T A;  2PW7 A;  1EL0 A;  2UXB L;  2P5Z X;  3MXN A;  4DF7 A;  3V96 A;  1Y1V H;  3RLF A;  1JE5 A;  2NVY B;  1U0L A;  3CCS A;  4G7H C;  4XQJ A;  2KCT A;  1Z6H A;  4LFC Q;  4OO1 G;  5C4J H;  2NUC A;  3CQZ B;  4KY6 A;  4BA1 I;  3UE0 A;  2DNC A;  3SGI A;  4BY7 H;  4QUC A;  1JOO A;  1M1K C;  1WTX A;  5FK9 C;  1KLU D;  1JT8 A;  2LFN A;  2VW9 A;  1RF2 D;  2CWP A;  3J7A F;  2EY5 A;  4ULL A;  2YU9 B;  2H1E A;  3H09 A;  1VQB A;  2L55 A;  3OYY A;  3HOX B;  3S15 B;  4A3B B;  3T53 B;  1FVI A;  3DUZ A;  2CVR A;  3TZU A;  2WKC A;  2ES2 A;  1PTO B;  5FO8 B;  4ZAI A;  4M8A A;  3S1Q H;  1XPR A;  1I4P A;  4OIJ A;  4R8N A;  3PO2 G;  4DNT B;  2K32 A;  3HOW B;  2EYO A;  3BYT B;  3NTI A;  2D2C C;  3Q22 A;  5C3E H;  2CCZ A;  4KHZ A;  2XVS A;  4E6I A;  5M5X B;  4A3L G;  4ZYS A;  1AEX A;  3K57 A;  3HOX G;  2VQE L;  3URY A;  1STE A;  2J7Z A;  4X64 L;  3S1N H;  5EPL A;  2F0U A;  1UWV A;  3A74 A;  3T51 B;  3K7A B;  1XYI A;  3CW2 C;  3ND9 A;  1Q82 C;  1TY0 A;  1II3 A;  4NPS A;  4LF4 L;  1PRT D;  3HOW G;  3TZD A;  1BCP F;  1S5D D;  1QZG A;  3VR6 A;  1SNQ A;  4N9P A;  5AFW A;  1AE2 A;  3Q24 A;  3FKI G;  1I4X A;  1BO0 A;  3SK6 A;  1K8O A;  3TME A;  5BN3 A;  2IHE A;  3MEF A;  4X62 L;  2PMZ B;  4OIK A;  5EGT A;  5I6W A;  4B3T Q;  4A3J H;  5JJL A;  4C3J H;  1N32 Q;  1Y69 U;  3MXN B;  1RDP D;  3JAM i;  5IT9 c;  2O4X A;  1CQF A;  3NWS A;  4L8J A;  4PMW A;  3I4N H;  4HCE A;  1V1Q A;  2EE1 A;  1W6K A;  3GTG H;  4MIU A;  1TII D;  4NW2 A;  4QY7 A;  3EN2 A;  5LL6 X;  1STG A;  1MD2 D;  1G8Z D;  1LYL A;  1K0R A;  2PQE A;  4LFC L;  4ZK9 B;  1PYS B;  4A3F B;  2PNR C;  2IW3 A;  1L0X B;  2OWO A;  2FHT A;  1TWF B;  3HEJ A;  2F3V A;  2Q2T A;  3L9A X;  1HZC A;  1QIL A;  4O42 A;  2CWA A;  4R4O A;  2OCE A;  2Q2I A;  4KHP Q;  5KRU A;  2XN9 C;  2VB2 X;  3M3Y B;  5LMN Q;  4P2C B;  1CHQ D;  2R93 H;  1LLR D;  1DCZ A;  1CKN B;  4IQZ A;  2DY7 A;  1HFN A;  3PV0 A;  2HCI A;  1Q1E A;  4RGM A;  3CMA A;  3PIO 3;  1I5F A;  1Q8I A;  1SRU A;  2FFK B;  3MC0 B;  3BVM A;  2NYZ D;  3CCL A;  3M4O B;  3TN2 A;  4R8I A;  1K83 B;  4HSP A;  1WCM B;  2F0E A;  5GRO A;  3MXU A;  3S1M H;  1DXM A;  5IY0 A;  2HHH Q;  3E9H A;  4R1J A;  4X66 Q;  2AQ3 B;  1K3B C;  3P7J A;  5C0X J;  2V4D A;  4O1N A;  5F2D A;  1U4M A;  4BBS H;  2D0P A;  2V1C C;  2CH4 A;  1ESR A;  1EZ8 A;  3TRZ A;  4LK1 C;  3A7L A;  1I6H H;  2RBM A;  3F2B A;  4JI5 Q;  3NP8 A;  1DGS A;  1AP0 A;  2IX3 A;  3S17 H;  4KKS A;  3AFQ A;  2ICI A;  2MQH A;  1PZJ D;  3MXP A;  2F1M A;  3K7U C;  1YHB A;  1HJP A;  3NWT A;  5ELD A;  2E2J H;  3H3V C;  3DHQ A;  4Y7N H;  2X69 A;  2K1B A;  1SND A;  1EWH A;  2QKI C;  4IUN A;  2EJM A;  1WVL A;  3EA6 A;  1TU2 B;  5CBE E;  1L1O B;  1H9K A;  4XT3 B;  4B3T L;  1BBU A;  1PZK D;  5E4W C;  1N32 L;  1A6X A;  2N8N A;  2RSO A;  3NBI A;  4UHV A;  4NB3 A;  3CRL C;  2RHQ B;  4GN4 B;  3R3O A;  2WB1 G;  4KY5 A;  2ZT9 C;  4DPG A;  2Z6K A;  2EPB A;  1PFB A;  1DJR D;  3V05 A;  3IKJ A;  1B4O A;  2EYH A;  2O5J C;  1A3V A;  1EY7 A;  3CKI B;  4RKB A;  2Y0S E;  1S3O A;  4GOP A;  5L37 A;  3K8A A;  4KHP L;  5LMN L;  3P20 A;  4JI8 L;  5TSS A;  3TP5 A;  2JE6 I;  3SR1 A;  5LHY 1;  1LTS D;  3T1Y Q;  4A3C G;  2WIN B;  2F4V Q;  4DKA C;  3TP6 A;  4PG3 A;  3RUZ A;  4EGV A;  1ZXT A;  1C48 A;  4LUO A;  5DM7 3;  1WTR A;  1MJE A;  1CSQ A;  4JBK A;  3E6Z X;  5M3F H;  3HKZ B;  1B9N A;  2NBF A;  5IYD G;  4UDU C;  1PTO D;  4A3D B;  2I5L X;  2WP8 J;  4IFD J;  2E76 C;  3R2I A;  3DM3 A;  4J8Q A;  1R4Q B;  4KD3 A;  2R92 G;  4LWC A;  3MFY A;  3PUZ A;  2AMC B;  4UAI A;  1FJG Q;  1HNW Q;  3CCU A;  2HHH L;  4A3E B;  1VQL A;  2B39 A;  4LNQ A;  4X66 L;  2RCF A;  3J80 L;  4OO1 H;  1NMF A;  2Z6K C;  4N8F A;  4CJ0 B;  2Z9H A;  2LKV A;  1P8L A;  3CF5 A;  3TS0 A;  1YJN A;  2H5X A;  2NVQ B;  3PUV A;  3HKZ G;  4B9X A;  4A3D G;  1BDO A;  4JI5 L;  1EOT A;  1HNX Q;  4B3R Q;  1NE3 A;  4C1N I;  1SRO A;  1TS4 A;  1TS5 A;  4K5V A;  1B70 B;  4KLK A;  2JA7 B;  1FL0 A;  2NVY H;  4DU9 A;  1QNK A;  4A3E G;  3ERS X;  1X3Q A;  1FNV A;  4M1U B;  1ESF A;  2BE5 C;  4GS3 A;  5C3W A;  2KQ3 A;  1S72 A;  3CQZ H;  1BBW A;  1IHZ A;  3KF6 A;  2ZJQ A;  5C5L A;  2QA4 A;  4P74 A;  4HJ8 A;  5DM6 3;  1KL9 A;  1RL2 A;  3NEL A;  1I3Q B;  1GKH A;  2F0J A;  2Z0S A;  2YU9 H;  1EFI D;  1CA6 A;  1ET6 A;  4Q0F A;  3HOX H;  3S15 H;  1TY2 A;  2KCC A;  4A3B H;  5JEA J;  1EUJ A;  5C0X I;  1QB5 D;  3WWV A;  4JI6 Q;  1V1P B;  2JA7 G;  2JP1 A;  1JB7 A;  2O2L D;  4WJ4 A;  1E2V A;  1EYA A;  2B2U A;  1PTO H;  4TSS A;  1QZH A;  4GLV B;  1BF4 A;  4OWW B;  5FO7 B;  3W5O A;  5IP9 G;  4RAU C;  4XDX A;  2Y0S B;  1VQO A;  3HOW H;  1TS3 A;  1RJT A;  4DXF A;  2L9H A;  3D4D A;  1VF5 C;  1S40 A;  4A3G B;  1X3P A;  3D4R A;  5GAE C;  5M5X H;  2KED A;  4IN3 A;  3T1Y L;  3GTO B;  2F4V L;  4DR7 Q;  5C44 B;  1SE8 A;  3C1F A;  1PFS A;  1HQR D;  2PI2 A;  5E1F A;  5K36 H;  2BOS A;  4YWM A;  2XRQ D;  1JR0 D;  2B2T C;  4OL7 A;  1OO9 B;  3C46 A;  1LTT D;  3K7A H;  1XJV A;  3D4W A;  1KD1 C;  2UU9 Q;  1I4H A;  2F0G A;  1FJG L;  2K5V A;  3U9O A;  1HNW L;  2Y0S G;  5CYU A;  3H0G B;  1K0S A;  4OWT B;  1X65 A;  1T5E A;  2K5H A;  1Q46 A;  2KBN A;  3FMC A;  2LSS A;  4BXX H;  1CKO A;  1K8A C;  1PH1 A;  1SDF A;  2B2U C;  3TS2 A;  2FJ2 A;  1STN A;  1X56 A;  4QQB X;  4DV4 Q;  1JOR A;  2KCN A;  4XQN A;  4KHV A;  1T5X D;  4RKL A;  2RDG A;  2RA4 A;  4HMI A;  3TDQ A;  1VQ9 A;  3U50 C;  1HNX L;  3CCM A;  1IW7 C;  1KAW A;  4B3R L;  1QWY A;  1LO5 D;  4LUV A;  4R4C A;  1KNA A;  4NXN Q;  1D5X C;  2F0M A;  1C4Q A;  3H0G G;  3JC6 6;  3VDY A;  1PXU A;  4KKU A;  5GQO A;  2F0H A;  3C1E A;  1EEI D;  4JPB W;  3R8B A;  4A3F H;  4NMZ A;  3KF6 B;  5FLX E;  4DNI A;  4C3I B;  1UE7 A;  4HIK A;  1TWF H;  2EQS A;  4IAL A;  1EIF A;  5COY A;  2KEE A;  1TVX A;  1MHW C;  2EYP A;  3T16 A;  3E9I A;  3M3Y H;  2EYJ A;  4A3I G;  1QOH A;  4KD4 A;  5M9O A;  1OXS C;  3J80 c;  4KJN A;  5HGQ A;  2PZW A;  1K8M A;  4JI6 L;  1EIG A;  4LJZ C;  4BY1 B;  2YTV A;  2BH2 A;  3QG1 A;  2IWH A;  2KVM A;  5M3M G;  3QIA A;  3M4O H;  4DR5 Q;  2WAC A;  2JEA I;  3NUC A;  1NR2 A;  4C3I G;  5JJK A;  3RMH A;  3E0J A;  1K83 H;  1SYD A;  1WCM H;  3CCJ A;  5C4Z A;  3K5L A;  2K50 A;  5T1G A;  1AH9 A;  1F9Q A;  4OWX B;  4IUV A;  3DWQ A;  1AN8 A;  3S2H B;  2M00 A;  3AFP A;  4DR7 L;  1Y1W B;  1BR9 A;  4FVM A;  3W1G A;  5A2Q E;  2EY2 A;  1GHJ A;  4KK7 A;  3T4A C;  2HDM A;  1YIT A;  4BY1 G;  1G6P A;  1X55 A;  1DON A;  1VQJ A;  3I90 A;  1HR0 Q;  2UUC Q;  4PMB A;  5EBD A;  1EQQ A;  1CSP A;  3G6J B;  4RCN A;  2CHB D;  4X65 Q;  1SYF A;  3GTL B;  4PQX A;  3RLN A;  1VDZ A;  1GUG A;  3PIP A;  2N49 A;  1KDB A;  3CCQ A;  2ZM6 Q;  4DV0 Q;  5D3D A;  2MGS A;  4JC0 A;  4RGN A;  4A3K B;  1G91 A;  5D65 A;  4DV4 L;  4EX5 A;  3GQB A;  1N8R C;  4ID6 A;  1GM5 A;  2B3G A;  1PH8 A;  3NHH A;  3HS0 C;  4K2L A;  1F2L A;  3FDT A;  2E5L Q;  2F0T A;  1JWS D;  3J81 j;  4RWS C;  1C9O A;  4YHH Q;  1X32 A;  4NXN L;  2PYK A;  1EY4 A;  1SE4 A;  1CUK A;  1H9M A;  2NN6 H;  4HTH A;  2AHO B;  2CQA A;  2K5D A;  5IYD H;  4JVZ A;  1HH2 P;  3FEW X;  5EKL A;  3AEV A;  3S1R B;  4A3K G;  2ID0 A;  4QJF A;  1LTR D;  3M4Q A;  1U9R A;  3DWP A;  3ULJ A;  2F0Q A;  2PNH A;  5G3L D;  1FNW A;  1B3A A;  5IIF A;  3SEB A;  3K5N A;  2PZT A;  1VQN A;  1BKB A;  3PMF A;  1DOK A;  4P72 A;  2K01 A;  2RVL A;  4DK1 A;  3H3V H;  2MO1 A;  4H0L C;  1JCK B;  3A8K E;  4G57 A;  2LMC B;  1ZEQ X;  1HZ9 A;  3A8J E;  3IRB A;  4DR3 Q;  5HUR A;  4A3D H;  4DR5 L;  4AIM A;  3HZX A;  2XGT A;  1UNS A;  3ERQ A;  1D1K A;  1BQQ T;  1JJ2 A;  4L5R C;  4CBV A;  4AYB B;  4K8J A;  4KY7 A;  1WD1 A;  4IFD G;  3D8G A;  4A3E H;  1LT4 D;  2EXZ A;  3PUX A;  3GDE A;  1SMY D;  1NCV A;  4DK3 C;  3GTK B;  1JQY D;  3KBX A;  1G29 1;  2RF4 A;  3VA5 A;  1JB3 A;  4IPD A;  5EAY A;  5ELE A;  1A2T A;  2NVQ H;  1HXY D;  1RIP A;  1F9R A;  2F0I A;  1MKH A;  3D3R A;  4K5W A;  1HR0 L;  2UUC L;  1GOZ A;  2F03 A;  2D9U A;  4X65 L;  1UAP A;  4RCO A;  3T1H L;  1W6J A;  1GD7 A;  1XMQ Q;  2B29 A;  2JJQ A;  1NAP A;  4AYB G;  2JA7 H;  3BVG A;  1QJO A;  3U4Z A;  4B3S Q;  4UPA A;  2ZM6 L;  3UDF A;  4DV0 L;  3PO2 B;  5IP9 H;  4JOI A;  3EIV A;  1UUP A;  2I5H A;  2LS0 1;  1A62 A;  4PV1 C;  1E24 A;  1XWE A;  1I3Q H;  4ZUI A;  2I5M X;  2E75 C;  3BDL A;  3L3O C;  1AFP A;  4YHH L;  3DM1 A;  1AZQ A;  2K33 A;  1K8G A;  3ULL A;  4FF2 A;  5M5Y B;  2F4I A;  2A73 B;  1LT5 D;  1MJC A;  1SE2 A;  3J81 E;  2YTX A;  3U4V A;  5JEA G;  4GNX B;  2IPK D;  4H7B A;  5GAG C;  5KEE A;  3M4Y A;  2JA6 B;  3NPP A;  5KGU A;  4HJ9 A;  2B2V A;  1EYC A;  1C0A A;  3H6M A;  3FKI B;  4A3G H;  1QG7 A;  5E3F A;  1FNU A;  4DV2 Q;  1ENC A;  5FJ8 G;  1A3T A;  1E2W A;  3GTO H;  3OSO A;  2R7D A;  2EIF A;  2OTJ A;  5C44 H; 
#chains in the Genus database with same CATH homology
 4G4K A;  3SDZ A;  2HUG A;  4NKL A;  1D1I A;  1PZI D;  4NDX A;  5C6A A;  3BS1 A;  3BYY B;  2A68 C;  4EQP A;  4DAV A;  1IW7 D;  1ICW A;  1NSN S;  1STA A;  5KNC A;  1F9S A;  4KJO A;  1KLG D;  4TQU S;  1A15 A;  2EVB A;  1F2Z A;  4K6L A;  1IL8 A;  2LY7 A;  1I4Q A;  2SNM A;  4HSV A;  4HCS A;  1F77 A;  2HCC A;  3NQT A;  5JAV A;  5FLX L;  4Q5V A;  4K14 A;  3TP8 A;  4CKB A;  2L11 A;  3GTQ B;  3DWA A;  4F87 A;  1ZYR C;  4IUQ A;  5IGC A;  1LAB A;  1JWM D;  1SNC A;  1PLF A;  4F7X A;  1EY0 A;  2F0L A;  1B9M A;  2NN6 I;  3NK9 A;  3NQI A;  3IFT A;  3HOU B;  5C4X B;  4V19 0;  1B1Z A;  4MN3 A;  2QF7 A;  2Z8L A;  4IUT A;  4QMG A;  1G2S A;  1F2Y A;  4ZKB B;  2J4X A;  2F0F A;  3G7L A;  1SJE D;  5JVG 3;  2WKD A;  3W2D A;  3FRP B;  3SK5 A;  4H44 C;  3SE0 A;  2XWJ B;  2Q8R E;  1KNE A;  3WOF A;  2VXW A;  4K8I A;  2PZU A;  1HFG A;  1Y8O B;  3X3M A;  5FO9 B;  2F0D A;  1STY A;  3BDC A;  1S5E D;  2EOT A;  2WB1 B;  4IUR A;  3K5M A;  4ZQ3 A;  5IGB A;  3L7Z C;  1SE3 A;  2ICE C;  4RGT A;  1CI3 M;  1OXT A;  1SJH D;  4XIG S;  1Q90 A;  1F9P A;  2IT1 A;  5NUC A;  4ZKC B;  2R3Z A;  3TBI B;  4FF1 A;  3D6C A;  2KA7 A;  5CV9 A;  1KDC A;  2XIW A;  2DY8 A;  3K6O A;  4WOR A;  2BA1 A;  1ROD A;  5ELB A;  5EBC A;  3VR2 A;  1D2B A;  2B63 B;  1JOQ A;  4IZ8 A;  1TWG B;  5KIX A;  2IJ0 A;  2NWG A;  3HP3 A;  3M7G A;  3LWU A;  2R92 B;  5CMD A;  1SXT A;  4ME5 A;  4U68 A;  2I46 A;  3A55 A;  1HA6 A;  4IFD H;  4S3S A;  3NBH A;  4FXK C;  2L12 A;  2A6E C;  5EQ0 A;  5LL6 S;  3F2U A;  3R93 A;  2NTS A;  1BCP C;  1PRT F;  3IAY A;  1PDQ A;  2OT2 A;  2BCO A;  4EQO A;  2DN8 A;  1ILQ A;  2F3W A;  2XSC A;  2FMC A;  1RKN A;  1NR4 A;  2Q8I B;  4TKO B;  3VR3 A;  3QWN A;  5IGF A;  1CA5 A;  1DYQ A;  3CRK C;  4QF4 A;  1Q1B A;  1MSG A;  4U67 3;  5D3I B;  2NB0 A;  3QO2 A;  4C3H G;  3MHB A;  4J6H A;  4XXE A;  2AUJ D;  1O78 A;  5DAU A;  1SMY C;  1KAB A;  4DNR B;  1SNO A;  2PPB C;  5FKA C;  1KAA A;  2QCP X;  4DGZ A;  5ISR A;  2L5T A;  4H13 C;  3PIP 3;  3H94 A;  1TQO A;  2M2L A;  2AQ2 B;  2MPM A;  4RFB A;  5C5M A;  3OMG A;  3DMU A;  3NXW A;  5J39 A;  5CR3 A;  3O13 A;  3J81 L;  2F0N A;  3FPP A;  4GZY C;  1STB A;  3OMC A;  3M85 A;  4F88 A;  3D31 A;  1J8I A;  5HGT A;  3ITP A;  1EYD A;  3E5S A;  4C2M B;  2A68 D;  5EKK A;  3C3L A;  1DOM A;  3AMU A;  3FVQ A;  5M5W B;  4XTC S;  3JAM E;  1F2M A;  1LTI D;  1YNJ C;  2QEJ C;  5A35 A;  2G9D A;  3RZO B;  4EVO A;  2TMP A;  2MP1 A;  4ODG A;  5D14 A;  4YIJ A;  3VR5 A;  2Z4I A;  1TWA B;  3S16 B;  5ELC A;  1PFM A;  3SHL A;  1EZ6 A;  2RQX A;  3NTH A;  1NUC A;  1PYW D;  3AU7 A;  4KV6 A;  3BVZ A;  3T13 A;  1SFO B;  4I7Z C;  2F0P A;  3ERO A;  3NTK A;  3PUW A;  1ZYR D;  4A3I B;  1VF7 A;  2EYM A;  1UEA B;  1JOK A;  1LV9 A;  2NZ1 D;  5T1I A;  4L63 B;  3P75 A;  5ELF A;  5M3M B;  1HRJ A;  1ENF A;  3HG9 A;  4WJW A;  3VYU A;  2B2Y A;  2KJX A;  4IUP A;  3FPU B;  1Y8N B;  4KN4 C;  5K5P A;  2QIL A;  1STH A;  1PTO F;  1B44 D;  1V43 A;  5JPM C;  1BOS A;  1TT2 A;  1GXD C;  2Z1C A;  2C9O A;  3PUY A;  4TRD A;  2RDH A;  1VMC A;  5KND A;  1WTV A;  2K6A A;  1Q3L A;  4XT1 B;  4FO2 A;  1O7Z A;  3VA7 A;  2F0V A;  5IGG A;  3EQL C;  4HED A;  4RHS A;  4K6D A;  2A69 C;  1PMR A;  2A6H C;  1GUN A;  4HAE A;  1Z7T A;  5EPJ A;  2KHS A;  5C0X G;  5C4H A;  3J7A V;  5JJZ A;  1WTW A;  1FR3 A;  4BWG B;  2B2Y C;  3WOE A;  4OO1 I;  2HDL A;  1RTO A;  3EJI A;  2NVT B;  5CV4 A;  3U9S A;  1XTC D;  2RKS A;  2NVX B;  5I2X A;  2RSN A;  1D6E C;  4DA2 A;  2EZV A;  2L0C A;  5DNF A;  4ABN A;  3OWF A;  1J9O A;  1E2Z A;  3KK7 A;  2SNS A;  1HQM C;  1BXT A;  2BDN A;  3S9W A;  1SYE A;  5BN5 A;  4HN7 A;  1I4G A;  1CHP D;  2EJG C;  2A6E D;  1RHP A;  3N52 A;  3DXJ C;  1WD0 A;  4BA2 I;  1GUT A;  3KBG A;  1BCP D;  2JA8 B;  2MJ8 A;  3V2T A;  3NE5 B;  1RD9 D;  4G7Z C;  1BNZ A;  2K5Q A;  3GV6 A;  2Q8T A;  3HOY B;  4PNY A;  1EEF D;  1SYB A;  1DD2 A;  1GJX A;  1SBB B;  5EJW A;  1WTQ A;  2MHV A;  1R9T B;  2PW5 A;  2B2W A;  1GUS A;  4X3K A;  2WII B;  3ONA B;  4WRD A;  5JPN C;  3K59 A;  2SDF A;  3Q6S A;  2PO4 A;  4L6T B;  1EU4 A;  2R6G A;  1CFM A;  2OXP A;  4KMU C;  1V8Q A;  4QB4 A;  5I9P A;  1XX8 A;  4CKC A;  4RHR A;  1ML0 D;  4DXG A;  3A56 A;  3WDN A;  1AZP A;  4NP5 A;  4XQQ A;  3P1H A;  2B2W C;  1D5M C;  1I50 B;  3I72 A;  4ZRZ A;  5EPK A;  1ENA A;  1S4Z A;  3VYT A;  1R4P B;  2EJF C;  3I4M B;  2E2D C;  1CK1 A;  1SNM A;  4CJ1 B;  1YNJ D;  3I8Z A;  2X6L A;  1E0B A;  3S14 B;  3C2P A;  2GA4 B;  3I73 A;  4HR7 B;  1GUO A;  3X3N A;  2G9H D;  5J22 A;  1SYC A;  2TSS A;  3JAM L;  1LTA D;  1HA5 A;  3PO3 B;  1FD7 D;  4B08 A;  1EY8 A;  1TWC B;  3W3A A;  3GV3 A;  4K2K A;  2BDO A;  3EFX D;  4OHJ A;  1JC7 A;  3RZD B;  2QDB A;  3VYR A;  1YNN C;  4CGY B;  3OW7 A;  1DZ1 A;  3BDO A;  1TWH B;  4ZLT F;  5KNB A;  1Z47 A;  1B50 A;  1EY9 A;  1KDA A;  2WAQ B;  2XNA C;  2X6G A;  1EY5 A;  2F0O A;  1EY6 A;  3K5O A;  5IOD A;  2B2V C;  1CT1 D;  1HCZ A;  3OOC A;  3KLR A;  4MHE A;  3A7A B;  2EY6 A;  5G3L F;  1M8A A;  3GTJ B;  2VB3 X;  4ILW A;  5K36 G;  3DEP A;  5CV7 A;  4LMQ D;  1HPC A;  4CJ2 C;  4CKE A;  1OXX K;  2F0W A;  5I6Y A;  2MUY A;  3GTP B;  2OF1 A;  1O7Y A;  2VUM B;  3HOV B;  5COR A;  1QNU A;  2FIN B;  3SK4 A;  2A69 D;  2A6H D;  4HMJ A;  3VR4 A;  5C0X H;  1O80 A;  2CW0 C;  3A54 A;  1HUM A;  1I6V C;  1PFN A;  4KTA A;  3ZYY X;  4OGQ C;  1I4R A;  4KI0 A;  3CHB D;  5A2Q L;  1A3U A;  2R7Z B;  5JVH 3;  4XYO A;  1TKW B;  1MBY A;  1M4V A;  4BBR B;  4DAY A;  2B8F A;  4G7O C;  1SAP A;  2ZXP A;  3MA2 B;  2D62 A;  4QIW B;  1B53 A;  4LAA A;  2KEC A;  4JK1 C;  1QCB D;  4R9W A;  3S2D B;  4C56 C;  4DN4 M;  3I70 A;  1HHV A;  5I2Y A;  2E2I B;  3DEO A;  3LWE A;  1BUV T;  2RDF A;  3MXG A;  2JXM B;  2EYL A;  2JA5 B;  2EYF A;  1LT6 D;  5IGD A;  3KLS X;  4RH6 A;  1MSH A;  1VCI A;  5IGE A;  4X3S A;  2ZXR A;  5KYI A;  3KUP A;  3CU7 A;  2K03 A;  2L4N A;  3TSS A;  4A3M B;  3SVM A;  1S5F D;  5CV5 A;  4JBW A;  4X3T A;  4RGO S;  2J0T D;  1DOL A;  2K7V A;  4EQN A;  1JWU D;  4DAP A;  1ZKO A;  2OEO A;  5CBA E;  3R2T A;  2DNE A;  2K05 A;  4N9T A;  1V1P A;  4C3H B;  1LTB D;  3MZ5 A;  2SOB A;  4C1N K;  4KN7 C;  1RCV D;  3QOJ A;  3MAQ A;  2H4O A;  1TR5 A;  5IT9 E;  3GP7 A;  3HRZ C;  2E74 C;  3I4L A;  1JIC A;  3IL8 A;  3UI2 A;  2NN6 G;  4X3U A;  5KYL A;  1Q12 A;  1H9J A;  3SXH A;  2IX0 A;  3MVV A;  3GTM B;  4WFN 3;  2L1B A;  1MGS A;  1WTO A;  1WTP A;  5I9O A;  1EWC A;  2A74 C;  2JSO A;  1ONL A;  2E2H B;  2JYO A;  4A93 B;  1BCP B;  5JEA H;  1MI2 A;  1GHK A;  2IL8 A;  2SEB D;  2B8G A;  1Y8P B;  4V0B A;  1G6Z A;  1HUN A;  3OIP A;  1U4P A;  3D6W A;  2JEB I;  2N55 A;  2AWO A;  1Y1V B;  1SSO A;  3K0Y A;  3KLS A;  4ZUJ A;  1D5Z C;  3MTS A;  1B2T A;  2K5W A;  5C4J B;  4BY7 B;  1BBX C;  2B2T A;  1OXU A;  1G2T A;  2F0K A;  5CC4 A;  2ZXO A;  3GO5 A;  5CV6 A;  4QCL A;  3QOL A;  2PCF B;  3QJY A;  3LX0 A;  4CHT B;  1A2U A;  2K28 A;  2C5C A;  1FGB D;  4RA8 A;  1YNN D;  2EY1 A;  2K04 A;  1IYV A;  4J1M A;  5IOC A;  3S1Q B;  1S5C D;  2M9V A;  5C3E B;  1KTK A;  2HQE A;  5CV8 A;  4DK0 A;  1OXV A;  2R61 A;  4PMC A;  1EQV A;  1HTP A;  3S1N B;  1CM9 A;  2AWN A;  3GD7 A;  1ILP A;  1TS2 A;  4BS9 A;  3KF8 A;  2O5I C;  3BG3 A;  3TP7 A;  3H91 A;  1C8C A;  3LNN A;  2YYZ A;  1H9S A;  1SNP A;  2N88 A;  2FMM A;  4FXG C;  4A3J B;  2CW0 D;  1HTL D;  4C3J B;  1U4L A;  1PRT C;  4XYQ A;  3OPO A;  3I4N B;  1RTN A;  3GTG B;  3OIQ A;  5I4D A;  3QB3 A;  1EIH A;  1GUW A;  4QUF A;  2WV6 D;  4IUU A;  3J7Y W;  4I65 A;  4IFD I;  1CZW A;  1ET9 A;  1H9R A;  1QE6 A;  5CGK A;  4C3J G;  1LAC A;  2IX1 A;  1DM0 B;  2R93 B;  1LTG D;  1O7L A;  5E4X A;  2KUM A;  4K5X A;  2VNU D;  1PRT B;  3M7N A;  1EU3 A;  2Z4H A;  3S1M B;  1FYC A;  1V1O A;  4FP5 D;  1LT3 D;  3MWY W;  3I91 A;  4BBS B;  1L0Y B;  2NTT A;  1CTM A;  2A5H A;  3EVQ A;  4FXD A;  5FOB B;  1I6H B;  3S17 B;  4FNF A;  1IKM A;  2D5D A;  2EDG A;  1H9S B;  3N6R A;  3SK8 A;  2E2J B;  4Y7N B;  3MEH A;  1JE4 A;  2ENB A;  3HGB A;  3HOZ B;  5BN4 A;  5J1Z A;  1EQT A;  3OHX C;  1CZG A;  3A8I E;  2XRS D;  1CQV A;  3T56 B;  5DEH A;  3ND8 A;  2F0S A;  4FF4 A;  2BA0 A;  1SEB D;  4DFA A;  1S5B D;  3RD4 A;  5EKI A;  3NSW A;  3IFD A;  5IT9 L;  1IYU A;  3MFG A;  3K58 A;  5JOB A;  4B9W A;  1XXG A;  4FF3 A;  3BZD B;  1SYG A;  3Q0A A;  1U4R A;  5M3F B;  2XWB B;  2KOL A;  4F8M A;  3OWE B;  5C3X A;  1AW7 A;  3VYS A;  1IKL A;  2AUK A;  2AQ1 B;  1VMP A;  2I07 B;  4Z9C B;  4FYD A;  3J80 E;  1PTO C;  2BE5 D;  3AB9 A;  3Q23 A;  4KKT A;  3I3C A;  2PW7 A;  1EL0 A;  3MXN A;  4DF7 A;  3V96 A;  3RLF A;  2NVY B;  4G7H C;  4XQJ A;  1Z6H A;  4OO1 G;  2NUC A;  3CQZ B;  4KY6 A;  4BA1 I;  2DNC A;  4QUC A;  1JOO A;  1WTX A;  5FK9 C;  1KLU D;  2LFN A;  1RF2 D;  3J7A F;  2EY5 A;  4ULL A;  2YU9 B;  2H1E A;  3H09 A;  3HOX B;  2L55 A;  3S15 B;  4A3B B;  3T53 B;  3DUZ A;  2CVR A;  3TZU A;  2WKC A;  1PTO B;  5FO8 B;  4ZAI A;  4M8A A;  1I4P A;  4OIJ A;  4R8N A;  4DNT B;  2K32 A;  3HOW B;  2EYO A;  3BYT B;  3NTI A;  2D2C C;  3Q22 A;  4KHZ A;  2XVS A;  4E6I A;  5M5X B;  4ZYS A;  1AEX A;  3K57 A;  3URY A;  1STE A;  2J7Z A;  5EPL A;  2F0U A;  3T51 B;  3K7A B;  1XYI A;  3ND9 A;  1TY0 A;  1II3 A;  1PRT D;  3TZD A;  1BCP F;  1S5D D;  3VR6 A;  1SNQ A;  4N9P A;  5AFW A;  3Q24 A;  1I4X A;  1BO0 A;  3SK6 A;  1K8O A;  3TME A;  5BN3 A;  2PMZ B;  4OIK A;  5EGT A;  5I6W A;  1Y69 U;  1RDP D;  2O4X A;  1CQF A;  3NWS A;  4L8J A;  4PMW A;  4HCE A;  2EE1 A;  1W6K A;  4MIU A;  1TII D;  4NW2 A;  5LL6 X;  1STG A;  1MD2 D;  1G8Z D;  2PQE A;  4ZK9 B;  4A3F B;  2PNR C;  2IW3 A;  1L0X B;  2FHT A;  1TWF B;  3HEJ A;  2F3V A;  3L9A X;  1QIL A;  4O42 A;  5KRU A;  2XN9 C;  2VB2 X;  3M3Y B;  4P2C B;  1CHQ D;  1LLR D;  1DCZ A;  4IQZ A;  2DY7 A;  1HFN A;  3PV0 A;  2HCI A;  1Q1E A;  4RGM A;  3PIO 3;  1Q8I A;  2FFK B;  3MC0 B;  3BVM A;  2NYZ D;  3M4O B;  3TN2 A;  4R8I A;  1K83 B;  4HSP A;  1WCM B;  2F0E A;  3MXU A;  1DXM A;  2AQ3 B;  3P7J A;  5C0X J;  2V4D A;  4O1N A;  5F2D A;  1U4M A;  1ESR A;  1EZ8 A;  4LK1 C;  3A7L A;  2RBM A;  3NP8 A;  1AP0 A;  2IX3 A;  4KKS A;  2ICI A;  1PZJ D;  3MXP A;  2F1M A;  5ELD A;  3NWT A;  3H3V C;  3DHQ A;  2X69 A;  2K1B A;  1SND A;  4IUN A;  1EWH A;  2QKI C;  2EJM A;  1WVL A;  3EA6 A;  5CBE E;  1TU2 B;  1H9K A;  4XT3 B;  1PZK D;  5E4W C;  1A6X A;  2RSO A;  3NBI A;  3CRL C;  3R3O A;  4KY5 A;  2ZT9 C;  2EPB A;  1PFB A;  1DJR D;  3V05 A;  3IKJ A;  1B4O A;  2EYH A;  2O5J C;  1A3V A;  1EY7 A;  3CKI B;  4RKB A;  3P20 A;  5TSS A;  3TP5 A;  2JE6 I;  3SR1 A;  5LHY 1;  1LTS D;  2WIN B;  3TP6 A;  3RUZ A;  4EGV A;  1ZXT A;  1C48 A;  5DM7 3;  1WTR A;  3E6Z X;  3HKZ B;  1B9N A;  2NBF A;  4A3D B;  4UDU C;  1PTO D;  4IFD J;  2WP8 J;  2E76 C;  3R2I A;  4J8Q A;  4KD3 A;  1R4Q B;  3MFY A;  3PUZ A;  4UAI A;  4A3E B;  2B39 A;  3J80 L;  4OO1 H;  4CJ0 B;  2LKV A;  2NVQ B;  3PUV A;  4B9X A;  1BDO A;  1EOT A;  4C1N I;  1TS4 A;  1TS5 A;  4K5V A;  2JA7 B;  4DU9 A;  1QNK A;  1X3Q A;  1FNV A;  4M1U B;  1ESF A;  2BE5 C;  5C3W A;  2KQ3 A;  1IHZ A;  5C5L A;  5DM6 3;  1I3Q B;  2F0J A;  1EFI D;  1CA6 A;  1ET6 A;  4Q0F A;  1TY2 A;  2KCC A;  5JEA J;  5C0X I;  1QB5 D;  1V1P B;  2JP1 A;  2O2L D;  1E2V A;  1EYA A;  2B2U A;  1PTO H;  4TSS A;  1BF4 A;  5FO7 B;  4RAU C;  4XDX A;  2Y0S B;  1TS3 A;  1RJT A;  4DXF A;  2L9H A;  3D4D A;  1VF5 C;  4A3G B;  1X3P A;  3D4R A;  2KED A;  4IN3 A;  3GTO B;  5C44 B;  3C1F A;  1HQR D;  5E1F A;  5K36 H;  2BOS A;  2XRQ D;  1JR0 D;  2B2T C;  4OL7 A;  1OO9 B;  3C46 A;  1LTT D;  3D4W A;  1I4H A;  2F0G A;  3U9O A;  5CYU A;  3H0G B;  1T5E A;  3FMC A;  1SDF A;  2B2U C;  2FJ2 A;  1STN A;  1JOR A;  2KCN A;  4XQN A;  4KHV A;  1T5X D;  4RKL A;  2RDG A;  2RA4 A;  4HMI A;  3TDQ A;  1IW7 C;  1QWY A;  1LO5 D;  1KNA A;  1D5X C;  2F0M A;  1C4Q A;  1PXU A;  4KKU A;  2F0H A;  3C1E A;  1EEI D;  3R8B A;  4NMZ A;  5FLX E;  4C3I B;  4IAL A;  5COY A;  2KEE A;  1TVX A;  2EYP A;  3T16 A;  2EYJ A;  1QOH A;  4KD4 A;  5M9O A;  1OXS C;  4KJN A;  2PZW A;  1K8M A;  1EIG A;  4LJZ C;  4BY1 B;  3QG1 A;  2IWH A;  2KVM A;  3QIA A;  2WAC A;  2JEA I;  3NUC A;  1NR2 A;  4C3I G;  3RMH A;  3E0J A;  1SYD A;  5C4Z A;  3K5L A;  5T1G A;  1F9Q A;  4IUV A;  3DWQ A;  1AN8 A;  3S2H B;  2M00 A;  1Y1W B;  1BR9 A;  4FVM A;  5A2Q E;  2EY2 A;  1GHJ A;  4KK7 A;  3T4A C;  2HDM A;  1DON A;  3I90 A;  4PMB A;  5EBD A;  3G6J B;  4RCN A;  2CHB D;  1SYF A;  3GTL B;  4PQX A;  1VDZ A;  1GUG A;  1KDB A;  5D3D A;  2MGS A;  4RGN A;  4A3K B;  1G91 A;  5D65 A;  3GQB A;  4ID6 A;  3NHH A;  3HS0 C;  4K2L A;  1F2L A;  3FDT A;  2F0T A;  1JWS D;  4RWS C;  1X32 A;  2PYK A;  1EY4 A;  1SE4 A;  1H9M A;  2NN6 H;  4HTH A;  2CQA A;  2K5D A;  3FEW X;  5EKL A;  3S1R B;  2ID0 A;  1LTR D;  1U9R A;  3DWP A;  2F0Q A;  5G3L D;  1FNW A;  1B3A A;  5IIF A;  3SEB A;  3K5N A;  2PZT A;  3PMF A;  1DOK A;  2K01 A;  2RVL A;  4DK1 A;  4H0L C;  1JCK B;  3A8K E;  4G57 A;  2LMC B;  1ZEQ X;  3A8J E;  5HUR A;  3HZX A;  1UNS A;  3ERQ A;  1D1K A;  1BQQ T;  4CBV A;  4AYB B;  4K8J A;  4KY7 A;  1WD1 A;  4IFD G;  3D8G A;  1LT4 D;  2EXZ A;  3PUX A;  1SMY D;  1NCV A;  3GTK B;  1JQY D;  3KBX A;  1G29 1;  3VA5 A;  1JB3 A;  5ELE A;  1A2T A;  1HXY D;  1F9R A;  2F0I A;  3D3R A;  4K5W A;  1GOZ A;  2F03 A;  2D9U A;  1UAP A;  4RCO A;  1W6J A;  1NAP A;  3BVG A;  1QJO A;  3PO2 B;  1UUP A;  2LS0 1;  4PV1 C;  1XWE A;  4ZUI A;  2E75 C;  3BDL A;  3L3O C;  1AFP A;  3DM1 A;  1AZQ A;  2K33 A;  5M5Y B;  4FF2 A;  2F4I A;  2A73 B;  1LT5 D;  1SE2 A;  3J81 E;  5JEA G;  2IPK D;  4H7B A;  5KEE A;  3M4Y A;  2JA6 B;  3NPP A;  5KGU A;  2B2V A;  1EYC A;  3H6M A;  3FKI B;  1QG7 A;  5E3F A;  1FNU A;  1ENC A;  1A3T A;  1E2W A;  3OSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...