5IGEA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igeA00
3T13A 4DFAA 4E6IA 4EQNA 5KEEA 1AEXA 4G57A 1F2ZA 2F0JA 4K5VA 3P1HA 1TT2A 4PMBA 3SXHA 4DGZA 5C5LA 5KRUA 2EYHA 5C4ZA 5I6WA 2EXZA 3MHBA 4KJOA 2PZTA 5CGKA 5I9OA 3S9WA 2M00A 1JOKA 2EYFA 5CR3A 5HURA 5IGBA 5IOCA 2F3VA 4YIJA 2F0QA 1U9RA 2O4XA 2SNMA 5C3XA 1KAAA 2LKVA 3D6CA 4MIUA 2F0TA 2EYOA 4QF4A 5CV7A 3D4DA 3NXWA 3HEJA 3QOLA 4NP5A 2F0PA 5C3WA 4KJNA 1II3A 1A3TA 2F0MA 3NQTA 3D8GA 4IZ8A 1EZ8A 3OSOA 2QDBA 3EVQA 3T16A 3OWFA 2EYMA 3V2TA 5E1FA 1EYCA 3LX0A 4NMZA 2EY6A 2EYJA 2WACA 1NSNS 1A3UA 2NUCA 3E5SA 4S3SA 4ZUIA 4R8NA 2F0NA 2F0IA 1SYEA 3NUCA 1EY0A 5C4HA 5EKLA 1IHZA 3MXPA 4KY5A 4PNYA 4H7BA 4RKLA 1EY8A 2PW7A 5EGTA 5ISRA 4WRDA 4K6DA 5IGFA 1STYA 1KDAA 5E3FA 5IODA 5KYLA 1EY7A 4K14A 5KIXA 3EROA 5I9PA 2F0SA 4ZQ3A 1EY4A 1SNPA 5CV9A 1KDBA 1KABA 4DU9A 4NDXA 2F0KA 2KHSA 5I6YA 5IGEA 5J1ZA 2HQEA 5CV5A 4OL7A 3C1EA 3ITPA 3SK8A 4K2KA 3DMUA 4ID6A 5C6AA 4HTHA 3P75A 2F0UA 3H6MA 3DHQA 4B9WA 1JOQA 4HMIA 5KYIA 2EYLA 3NP8A 1STHA 4TRDA 5DAUA 2RDFA 5IGGA 1A3VA 2SOBA 1EY9A 1JOOA 1NUCA 4KY6A 4N9TA 4ZUJA 2F0DA 3BDLA 4LAAA 2PYKA 2F0FA 3OMGA 1SNMA 3NK9A 1KDCA 4KY7A 5CV6A 1SNQA 5J39A 1STAA 4J6HA 3MVVA 5JAVA 5K5PA 2F0WA 4NKLA 1SYDA 3SK5A 4EQPA 5CV8A 3D4WA 5M9OA 3SR1A 4KHVA 1ENCA 2F3WA 1RKNA 2KQ3A 1EYDA 2F0LA 2F0OA 1STGA 3ERQA 2OF1A 4N9PA 1F2MA 4QB4A 4IUNA 4KD4A 5KGUA 2ENBA 5EKKA 3MZ5A 3OMCA 1SNOA 2PQEA 1ENAA 1SYFA 4EQOA 2RBMA 4KTAA 2EYPA 4RKBA 4K5XA 5DEHA 4F7XA 1STBA 2F0HA 4WORA 3QB3A 3VA5A 5IGCA 4DF7A 3TMEA 3TP6A 1EY5A 3BDCA 4EVOA 4IALA 3MEHA 1SNDA 1F2YA 4ME5A 5JOBA 2PZWA 1SYBA 2OEOA 3NHHA 5IIFA 5C5MA 3EJIA 2EY5A 2EY2A 2OXPA 3SHLA 3TP8A 4K8IA 3TP7A 3TP5A 4B9XA 1EY6A 5HGTA 4QMGA 1SYCA 1EQVA 2F0GA 2SNSA 4K2LA 1TQOA 1SNCA 4F8MA 5IGDA 1JORA 3RUZA 3PMFA 4KV6A 2PZUA 4K5WA 3SK6A 4ODGA 3HZXA 5J22A 5NUCA 5CV4A 2PW5A 3C1FA 2F0EA 3R3OA 4HMJA 5F2DA 3SK4A 1STNA 2RKSA 5CC4A 1EZ6A 4KD3A 3QOJA 1A2UA 1SYGA 2F0VA 1A2TA 2EY1A 1EYAA 4I65A 4J1MA 4PMCA 3U9OA 1TR5A 4K8JA
chains in the Genus database with same CATH superfamily
1L0WA 4OX9L 3FPPA 2A6HD 1AEXA 2A8VA 1TT2A 1RTNA 5I9OA 4A3DB 1XNQL 5FJ8H 4O0AA 2ZJPA 3GTKH 1C9OA 3D6CA 2MQHA 4QF4A 1ENFA 1KLUD 1SDFA 4BBRG 2C35B 2B63B 5C4XB 1SEBD 2F0MA 1MD2D 3G7LA 1C4QA 1EEID 2NYZD 1OXVA 4LUZA 1PH1A 4V190 1SN8A 2BCOA 2CFMA 1YJNA 1GKHA 4HN7A 5C4JB 1E7ZA 1DJRD 2ZXPA 1MSHA 4DKAC 4DR1L 1I4HA 3H94A 2DY8A 4GN5A 4JI1Q 3V05A 4BXXH 2ASBA 4DV3L 4GZYC 2UUBQ 3E9HA 4DV6L 4FP5D 2WV6D 3CCVA 3HOUH 2F0UA 3QWNA 2C5CA 2DGYA 4HSVA 5IWAQ 2QDLA 4A3DG 1GO3E 1J8IA 1JOQA 3NP8A 2IWHA 1B44D 2JA7B 2VXWA 1A15A 4C2MH 2HIVA 2PYKA 1AZPA 4I7AA 1ESFA 5IYBG 2B63G 4UDUC 5C4XG 3CC2A 3MVVA 1PH4A 1R4QB 4KKTA 3TEHB 4A3IH 5ELDA 4BWGB 1Y1VH 2Q2IA 4DN4M 4L8JA 2R7ZH 1LTLA 4RCOA 1UE1A 1QG7A 5I2XA 4GLVB 2LXKA 2FMMA 2Z8LA 3CPFA 2BE5D 4KD4A 3HRZC 3MZ5A 5DNFA 2K5WA 5DEHA 1B3AA 1I3QH 1HZBA 2N55A 2VUMH 5COYA 4JI6L 3EJIA 2GN5A 2XWBB 4KI0A 3TP5A 3T1HL 1LT5D 4C3HB 1ZKOA 5LMUQ 1JORA 2JA7G 2NZOA 1HFGA 1SLJA 4P71A 1SBBB 2PW5A 2B2YC 3S2HB 1F77A 1Y1VB 1JB7A 1N9WA 3BZCA 4PMCA 2F0VA 3CD6A 4IFDI 2RF4A 4POFA 1HNWQ 3GQBA 1SMXA 1YJWA 1DZ1A 4DGZA 1TY2A 1WI5A 4IQZA 5DLQE 3PUXA 1LM0A 1JOKA 1I3QB 2FHTA 4BXXG 3SGIA 4A93B 1U9RA 2VUMB 2K5NA 4KHZA 1LO5D 4JBWA 3M9BA 3D4DA 1X3PA 3DWPA 1GUTA 1C0AA 2O5JC 3K57A 4PQXA 1VQ9A 3H09A 4LK1C 3F2UA 3NQIA 3X3MA 3IFTA 4PZ7A 5E1FA 4HJ5A 2YYZA 1KNEA 1V9PA 1Q8KA 1IYVA 4C3HG 2F0IA 1SYEA 4JI1L 4H7BA 4XTCS 4A3KH 4WRDA 4ALPA 2ICIA 1STYA 1KDAA 3QG1A 4H0LC 2UUBL 2KUMA 1UE5A 3NBHA 2K28A 3NTKA 2F0SA 2IL8A 5IWAL 1JWUD 1LYLA 5J1ZA 1IXRA 4BBSB 2RDHA 2L9HA 3P75A 3G48A 4TKOB 4YWMA 5GAGC 2VQEQ 1STHA 4ZLTF 3IL8A 5CYUA 1TVXA 4A93G 2VUMG 4PV1C 3GTJH 2OT2A 3J81j 4HJ9A 1VQFA 4DNTB 5I4DA 4GNXC 4A3GH 2ID0A 1OO9B 1UUPA 3RNUA 4JI8Q 1B9NA 2SDFA 4IURA 1QOHA 4C3IH 3FKIH 3HOXB 4C3JH 4A3KB 1S5BD 2KQ3A 1MKHA 2QEJC 3CCUA 3S15H 1D5ZC 2UUCQ 2A73B 2QF7A 2E2DC 1SNOA 1ENAA 3BYTB 4KTAA 1PRTF 5LMUL 3A7LA 3NHHA 3CPWA 4BBSG 3A0JA 3SHLA 2JN4A 2Z1CA 5HGTA 1EY6A 1NY4A 4QMGA 4DV4Q 1PRTD 5IP7G 1GHKA 2GVBA 1FGBD 3OPOA 3SK6A 4NXNQ 4A3GB 4BY1B 3K0XA 3HOVB 3S14B 1ICWA 1K8GA 1QNUA 4BA1I 4EQNA 5KEEA 4A3EB 3HOXG 1HNZL 5KRUA 3J81E 5I6WA 1PDQA 2EXZA 3T4AC 1B2TA 4I7ZC 3S9WA 3RN2A 5IYCH 2B8FA 5IYDH 2EYFA 4OGQC 1S5CD 3I70A 2LKVA 2F0TA 3MXUA 5CV7A 3J80E 4KJNA 4Z9CB 2K4KA 2CCZA 3K5LA 4RCNA 1ESRA 2L1BA 1K9MC 3SVMA 1V1PB 4X3KA 4DAVA 4WJ3M 4DR4Q 1B9MA 3KF6A 5C4HA 3UDFA 3HGBA 4C56C 1XWEA 5CMDA 4A3GG 4BY1G 3HOVG 1Y8OB 2HHHQ 4JI4Q 1VQGA 5JVH3 1N33L 5I6YA 2VQEL 5M5YH 1DOMA 2OQ0A 4G7HC 2HQEA 4A3EG 4K2KA 3R2TA 1Y8NB 3GDEA 1VQAA 2K6AA 4GN4B 4XT1B 4B3SQ 1PMRA 5IGGA 2I5LX 4WFN3 4DV0Q 1PH9A 1JOOA 4X62Q 3KBGA 3H3VI 1ASZA 1X6OA 3NK9A 3I4NB 3I8ZA 2F1MA 5TSSA 1EUJA 4UP9A 3CU7A 1JR0D 1GM5A 2UUCL 1FVIA 4X3TA 1ENCA 2L0CA 4IN3A 1STEA 3KK7A 1GD7A 4GN3B 4HR7B 4OWWB 4A75A 2HDMA 3BDOA 4IFDG 1W3SA 2PNRC 1H9JA 5C44H 1G291 2NB0A 4YWLA 1HR0Q 4A3MH 3W2DA 4DV4L 2XWJB 4K0KQ 1JQYD 1F2YA 3KFUA 2F52A 4DV5Q 3E6ZX 3U4ZA 3B6YA 4NXNL 1F9RA 1TWGB 1EQVA 1PTOD 3J7A5 2KCNA 4L5SA 4KK7A 3S24A 2PZUA 1HQMC 2UXDQ 3RR5A 1FNWA 2F0EA 1SSOA 2IX1A 3I4NG 2EJGC 3D4RA 3DXJC 1W6JA 4I65A 3U9OA 2PMZB 1L1OB 2BDOA 3NBIA 3BVGA 2JA8H 4DAMA 1EU3A 3AFPA 1VQ8A 5D3IB 5IY0A 1GUOA 1ZEQX 2F4VQ 4LF9Q 2L55A 4J8QA 4BS9A 4RH6A 2O4XA 2CQAA 2PCFB 1KAAA 2CWAA 2JA5B 2K04A 5EPJA 1HH2P 4DR4L 1II3A 5HGQA 1XYIA 2YTVA 2M2LA 2EYMA 4JI2Q 4NMZA 3K59A 3HKZE 1N32Q 1NR4A 4X66Q 3EN2A 1SAPA 4TSSA 5ELNA 4BY7B 5EKLA 4KY5A 3PIO3 1PFBA 3ULJA 3JC66 2KCMA 2MFIA 5M5XH 4LF5Q 3FVQA 4JG2A 2RQXA 1LABA 5JJIA 2XIWA 1HTPA 5CV9A 4B3SL 2IX0A 4RHRA 1D2BA 1KC8C 4DV0L 1PTOC 1NTGA 3ER0A 2SEBD 4B9WA 2I46A 3L9AX 1CTMA 3H91A 4MHEA 3TSSA 2J0TD 2MPMA 4ZUJA 3SDZA 4N9TA 2UU9Q 4LAAA 3BDLA 3GTPH 4RWSC 2JA5G 1Y69U 1IBKQ 1BCPF 1SFOH 1OTCA 2FFKB 2JYOA 5EBDA 2C9OA 4NKLA 4XYOA 1WJJA 2L12A 1I50B 2H1EA 1R9TB 1FD7D 3I2ZA 1EFID 1ICFB 4OIJA 2KVMA 2F3WA 4IOAA 1GJXA 3BVMA 1HR0L 4BY7G 3C2PA 1Y1WH 3CKIB 4DV5L 1YNJD 4EQOA 1O80A 1STBA 2F0HA 2JA6H 4FF1A 1XTCD 3AB9A 3BDCA 1S40A 1AW7A 1K28A 1K3RA 1IW7C 2M9VA 2EIFA 1N34Q 1P16A 2JSOA 4FYDA 3FHWA 3URYA 1TS4A 3PGZA 2F0GA 1H9SB 4XQJA 4QIWB 4PMWA 1U4LA 3PMFA 4JI0Q 3GTQB 1ONLA 1QJOA 3RN5A 3Q24A 2ICEC 1XPRA 3SK4A 1STNA 4LW1A 1PZKD 1EZ6A 4G7ZC 3QOJA 5EJWA 1A2TA 2A1AA 3JAMc 1SJHD 4HIDA 1PH5A 3DEPA 4AIMA 2OCEA 4NXMQ 2F4VL 4LF9L 1F2ZA 4JI3Q 3CF5A 2D0OA 1MBYA 3UI2A 2JQOA 2JA6B 2F3VA 2TSSA 1CFMA 4YY3L 2SNMA 1CM9A 1PVOA 2EXDA 3M85A 4JI2L 4TQUS 3CAMA 3CCQA 1CT1D 3AEVA 4AYBB 1RCVD 4IZ8A 3I56A 4X66L 1VDZA 2QDBA 3A54A 3OWFA 3LX0A 3KOJA 4CBVA 4DAYA 1H9KA 4LF5L 1D1KA 2BH2A 2MJ8A 5FKAC 1YNJC 2B2WA 2PQAB 1WCMH 3N52A 2AWOA 1EY7A 4K14A 1TWCH 2NVXH 4A3BB 2F4IA 4QQBX 3M4OH 2UU9L 3PO3B 3NWTA 2B29A 3ZYYX 1IBKL 4QJFA 1VQ7A 3AMUA 3K8AA 4KY6A 2G9DA 1YVCA 1AFPA 2Z4IA 1U4PA 4KKSA 1STAA 3RD4A 4AYBG 2ATWA 2F0WA 1TU2B 3CQZH 4GLAC 2H4OA 2B2UA 3F2DA 2EJMA 3VYSA 2NWGA 4A4IA 4DR1Q 1EFWA 3OYYA 4BBRH 2NVXB 1AN8A 2MNAA 1MSGA 1WD1A 1NBWA 3S16B 5FLXc 3RZOH 3BG3A 2R61A 3M4OB 3RLFA 2I0QA 1N34L 4Q5VA 4A3BG 3QB3A 1LTRD 3TP6A 1MIUA 5C3EH 3K58A 3TRZA 4JI0L 1LTTD 3J7ZC 1AZQA 4FNFA 3PO3G 2K14A 2B2VA 1TY0A 4V0BA 1TWHH 4ODGA 4QUFA 3NEMA 1JWSD 2RKSA 4JI3L 3TQYA 1EYAA 1TR5A 1F2LA 4DFAA 4A3DH 3Q0AA 5A35A 1IBMQ 2K1BA 1EWHA 3U4VA 5IYBH 1VMPA 2B63H 1IZ6A 1CHQD 5C4XH 1XMQQ 3GV3A 5C3EB 5JPMC 1HR0W 4LWCA 4NP5A 3DEOA 4UHVA 5C4JH 3ONAB 4DR2Q 1QNKA 4LFBQ 1TWHB 1G6PA 4GLXA 1I4RA 4R8NA 3HP3A 3A7AB 3RMHA 1BQQT 5IE8A 1K8OA 5D3DA 3D31A 1RL2A 2YV5A 4JK1C 3PIOA 3EROA 1PH3A 1EYGA 1KABA 4KHPQ 1BOSA 4O1NA 3ITPA 2X6GA 2JA7H 2ZXOA 1HZ9A 2VNUD 1KAWA 2BA1A 3K7AB 2JP1A 5JPNC 3RZDB 5DAUA 1FGUA 5KNBA 3X3NA 4YCVA 1QZHA 5C3EG 3GTGH 2EOTA 1FYCA 3LNNA 1G6ZA 1PYSB 5CV6A 1SNQA 5T1GA 3HOZG 1O7ZA 4R4IA 1EOVA 1SYDA 2LMCB 1O7IA 1XJVA 4KN4C 4FXDA 3T1YQ 1UNSA 4HJ8A 1OXTA 2MGSA 1KLGD 5GAHC 1STGA 1HZCA 1H9MA 1KTKA 4A3LG 1I4QA 3OMCA 4AH6A 3K80C 1Q1EA 3ICEA 1HA5A 3HKSA 2FINB 1V43A 2XNAC 1CQFA 1OXSC 4C3HH 2DNCA 3FP9A 1E1OA 1TXYA 2A6HC 5C5MA 4FF2A 1BDOA 1EIYB 4CDDC 3F2BA 3BZDB 3GTGB 2HQLA 1UEBA 2G9HD 1TWFB 4IPGA 3S2HH 3RUZA 5IT9c 1ET9A 2KEEA 3Q23A 1GUGA 4GOPA 1LTAD 1HZAA 5BN4A 1BBXC 1IBML 4OO1I 4XXEA 2EY1A 4U673 1C8CA 1VQKA 2QGQA 5FK9C 3P1HA 1XMQL 4PMBA 1Z6HA 1QZGA 4A93H 3MHBA 2CW0D 4BA2I 2E75C 2RSNA 3J7YW 2N88A 4DR2L 2XRQD 4PZ8A 3S2DB 3BS1A 3W1GA 3CCJA 4LFBL 4YCWA 1DD2A 2J4XA 1D1IA 1CKNA 2R7DA 1A3TA 3KF8B 4RHSA 1Q12A 2NBFA 5C0XI 3V2TA 1EYCA 2A19A 1B1ZA 5EKIA 2EY6A 2WACA 1CSQA 3GTMB 5HY6A 2F0NA 2KHIA 2E76C 3OTOQ 1QVGA 1GXDC 4APVA 4KHPL 1X3FA 1CA5A 1YHQA 3QJYA 4GNXB 4FF3A 2CVRA 2NVTH 5GADC 4BBSH 1HNZQ 2CHBD 2PNHA 1KDBA 1IBLL 3CC4A 3UE1A 5IP7H 3QO2A 5C6AA 1WTXA 4IUTA 4HJAA 1W2BA 4TRDA 2WAQE 4XT3B 3SE0A 5JJKA 1EY9A 1K83B 1WTPA 2OTJA 1I4PA 3JAME 2PPBC 3T1YL 2ZJQA 2BE5C 2K03A 2YU9H 4LF4Q 3HOXH 3T56B 3A55A 4IJLA 3E0EA 4N8X1 1VQ6A 2BOSA 4UPAA 3HS0C 1QB5D 1CA6A 2MO0A 5ELEA 2FXQA 1RKNA 1C7YA 2NVTB 2JXMB 1JJCB 1EIHA 2ES2A 1F2MA 3TZUA 3U50C 4XQNA 1N33Q 5M3FH 1YJ9A 2X69A 3QR8A 5EPKA 1IL2A 4F7XA 5LL6X 4FDBA 4OXPA 5CBAE 3D6WA 5EBCA 1B7YB 4K8IA 3C46A 1KD1C 2Z4HA 2LY7A 2GA4B 2IW3A 4RG1A 2YU9B 3GTLB 4BY1H 4A3JH 3HOVH 3S14H 2VB2X 2K33A 3HZXA 4R4TA 4O42A 4HMJA 2NVQH 3MXNB 4HSPA 4A3EH 3GP7A 3SXHA 5C4ZA 3PF5A 3G6EA 2YTXA 4R1JA 3OOCA 2EQSA 1ILPA 2VS1A 3MEFA 3S1NH 1VCIA 1PHJA 1L0XB 1ET6A 1D6EC 1ZYRD 1E2VA 5M3FB 3CMAA 1DXMA 4KJOA 4DAPA 3KJPA 3NSWA 2K52A 4DNIA 1VF7A 4DR6Q 4CHTB 3F2CA 1HCZA 4C1NK 3L3OC 1PRTB 1EZ8A 3MFYA 4A3JB 3OTOL 3M3YB 3MC0B 4OIKA 1RJTA 5FO9B 1M90C 1X55A 1UAPA 3F8TA 2NVQB 5FLXE 4IFDH 1I5FA 1GVPA 1A8VA 2J7ZA 1LT4D 2KJXA 3AQQA 3PSIA 3C3LA 1HA6A 4K6DA 3I4MB 2AWNA 1CKMA 3S1NB 2PO4A 3BZKA 1V1QA 1DYQA 1HJPA 1SNPA 3M7GA 4K6LA 4NDXA 3C1EA 3BJUA 4ID6A 3JAML 5M3FG 4H02A 4ZAIA 4LF4L 2DY7A 3I4NH 4DR3L 1NUCA 3G6JB 1V8QA 3NE5B 2OWOA 1KQSA 3PV0A 2UUAQ 1IKLA 1GHJA 1KIXA 1HTLD 4DV1L 4EQPA 1ZYRC 3HKZB 4A3JG 2QILA 2O5IC 5K36G 1U5KA 4KHVA 1IYUA 1PYWD 1EYDA 1S3OA 1PRTC 3IKJA 4QB4A 1X3EA 1TWAH 3T51B 4OO1G 3PIPA 3I4MG 3DWQA 4X3SA 1QUQA 2E2JH 1AE3A 2K01A 1TWGH 4EVOA 1RD9D 1V1OA 2KOLA 5E7NA 4TVAB 4LNQA 5IIFA 1HPCA 2N3SA 3TP7A 1FNUA 4DR7Q 1Y14B 4F8MA 2E2HB 4KV6A 2JE6I 4DPGA 4DUYL 3VR5A 1A0IA 5C0XG 4FVMA 1SYGA 4K8JA 1L2FA 2K5QA 3HKZG 1WTVA 4K5VA 1SMYD 4DR6L 1TWAB 2D0PA 2EYHA 4KKUA 2PZTA 2UXBQ 2JA5H 1BKBA 2A74C 1B3QA 4YIJA 2I5HA 2E2JB 3D0FA 4GKKQ 4XIGS 1AE2A 4U68A 1UE7A 3ULLA 1Q46A 2K5VA 1PTOB 3KUPA 1WTHA 5FLXL 1QVCA 4JW0A 3J81L 4BY7H 4LUVA 5ELFA 2B2WC 4DNRB 2DUDA 1RODA 4CKEA 1EY8A 1Z7TA 4JYAL 4B08A 3J80L 3H0GB 2NVYB 3AFQA 4LFCQ 4DU9A 3ND8A 2FJ2A 3DUZA 5D65A 2F0KA 1J5EQ 4CDEC 1VQDA 2RA4A 1K8MA 3J81i 4RGTA 3NWSA 5GAEC 4YCUA 5IT9E 4YY3Q 3DHQA 1NR2A 2EYLA 1QE6A 4HCEA 1RTOA 2RCFA 2UUAL 1Q82C 4MN3A 3UDIA 3J80i 4DK6C 2N78A 1N36Q 1EIFA 1UE6A 1F9PA 1YNND 5JEAG 1CHPD 2B2TA 2RSOA 1I50H 5K5PA 2B2UC 1R9TH 1OXUA 4H13C 2XTIA 4LF6Q 4YWKA 1K8AC 2P5ZX 2R93B 2IY5B 5LL6S 1T5XD 5LMNL 4N9PA 2JJQA 3PUWA 1TS3A 1PFNA 3H0GG 3IFDA 1K3BC 4MTKA 5BN5A 5JVG3 4HEDA 1CI3M 2NN6I 4LF8Q 5M3MB 1BVSA 5I2YA 5FLMG 4DR7L 2EDGA 1NNXA 1VS0A 2I5MX 3H3VH 4LJZC 1ZXTA 3GTQH 3TP8A 3WWVA 2NTSA 2SNSA 1F9QA 1T5EA 3IRBA 5CV4A 1BCPD 4DK0A 3K5MA 3R3OA 4DR5Q 1EQQA 2QA4A 1PFSA 1Q3LA 3MA2B 1S72A 1CSPA 3TREA 2UXBL 1X56A 1EWIA 4JV5L 2AUKA 1E24A 1G51A 2HCCA 3OW7A 3DM1A 4AQYQ 4GKKL 2EZVA 3TZDA 2R93G 4R4CA 2HD3A 5C3XA 2L5TA 2QW7A 4CGYB 3VA7A 2ZJRA 3K7UC 5FO8B 1ML0D 1D5XC 2ZM6Q 1CZWA 5M3MG 3T16A 2N8NA 1SROA 1HQRD 4OELB 4DV7L 3L0OA 4DV2Q 3ND9A 3CRKC 2K50A 1YIJA 1C48A 2MP1A 1BXTA 3M4YA 4LFCL 1LTBD 3U58A 1FL0A 1DOKA 4RKLA 5ISRA 4A3BH 1VMCA 4NB3A 1J5EL 3S1MB 3P7JA 1X54A 5IT9L 3KYHC 4RGNA 3PO3H 2HT1A 3KLRA 5IGEA 2JA9A 4L63B 1JE4A 4CJ1B 3M4PA 1I4GA 1N36L 2E5LQ 2YTYA 1Q90A 4B3MQ 1MI2A 1BCPC 3A5ZB 3A56A 1YZ6A 5C0XJ 1WTWA 5KNDA 3S17H 3OMGA 1KDCA 4KY7A 1E2WA 1YITA 4LF6L 5JAVA 2VW9A 1VQOA 1QVFA 4A3CG 1B50A 1UWVA 1S5DD 3S16H 3KJOA 1SE2A 3OIQA 3V96A 2F0LA 1RIPA 4LF8L 2F03A 4CKBA 4IUNA 4JOIA 1N8RC 4UP7A 2K05A 4RKBA 4XDXA 3M7NA 4IALA 2PZWA 2NTTA 2RCNA 4DR5L 2BA0A 3S17B 1Q81C 3NTIA 1GUSA 4IOCA 4RA8A 4ABNA 4QGUA 1B8AA 1GUWA 4GOPC 4LMQD 3K81C 1CZGA 5F2DA 3S1RH 3NELA 3RLOA 1T9HA 5A2QE 2IPKD 4KD3A 4AQYL 4G7OC 3CC7A 2CKZB 2AKWB 3VYTA 2KECA 1S4ZA 3F1ZA 2D5DA 3BVZA 3NBHB 2ZM6L 3J7AF 2Z6KA 1PXUA 5JEAJ 3HOZH 2F0QA 3WOFA 3CXCA 4MIUA 5LMNW 4DV2L 1PLFA 3TBIB 2MHVA 1DGSA 3NQTA 5E4XA 3OSOA 2V1CC 3EVQA 4JPBW 4FXGC 2D2CC 4R4QA 1VQNA 2KHJA 4L5TA 1XNRQ 1A3UA 2NUCA 2Y0SE 1DCZA 4A3LH 1J6QA 4GKJQ 4XYQA 1RDPD 3S1RB 1L1OA 2KCCA 3WOEA 1D5MC 1AH9A 1XMOQ 5EGTA 4JI5Q 5E3FA 2IJ0A 1X32A 3KLSA 3ULPA 2E5LL 3Q8DA 4B3ML 3K7AH 1YHAA 3RZDH 3LWEA 3HOZB 4P2CB 4OWTB 2IT1A 4CDFC 2VY3A 1ASYA 2Q8RE 2D62A 2DNEA 1A3VA 2ZTEA 1EIGA 1BBUA 3G71A 3G4SA 1MGSA 4A76A 4CJ2C 5CORA 3EFXD 4ZKCB 2DN8A 5ELBA 2N49A 3A8JE 3LWUA 2ZTCA 4R9WA 1NMFA 2OQKA 3TS2A 1PH2A 4UAIA 1HUNA 3D3RA 4ZRZA 1WD0A 1IBLQ 3EQLC 1ILQA 3VA5A 3R93A 2ZT9C 4DF7A 2IHEA 1TWFH 3MEHA 4ME5A 1CUKA 4POGA 2WAQB 3K5OA 3HOWB 2KA7A 2NZ1D 1SYCA 3SEBA 5IP9G 5A2QL 4B3RQ 1K0SA 3FRPB 4P74A 1B70B 2WB1E 3PIP3 1YBYA 1EL0A 3VR6A 1HNXQ 4ZCKA 3DLLA 2R6GA 5BR8Q 1M1KC 3KF6B 2AMCB 2IHFA 2WFWA 3I4OA 4IJHA 3S2DH 3ZJYC 2M00A 1BNZA 3MFGA 4FO2A 4MZ9A 1LV9A 5HURA 5IOCA 5T1IA 3QOLA 1H9SA 2XVSA 1XNRL 3D8GA 3GTMH 4GKJL 3GTKB 3S1QH 3NENA 1IL8A 2VB3X 4IO9A 4L5RC 1XMOL 4JI5L 4FF4A 1NSNS 1QUQB 2WAQG 5AJ3Q 1JCKB 4LUOA 3HOWG 1SJED 3NUCA 1KRSA 1WTRA 4UY8C 1PYBA 3MXPA 5LHY1 5IGFA 4JBMA 2Q8IB 1JICA 1I6VC 5I9PA 4ZQ3A 3PUZA 1XXGA 1U4RA 2KHSA 3CRLC 4C1NI 2AHOB 2VZAA 3VYRA 5CV5A 2K32A 4Y52H 1K83H 4JC0A 4IPHA 4WJWA 1H9RA 3H6MA 2EVBA 3HOUB 1E22A 3KDFA 3S1QB 3K6OA 1SNMA 2MO1A 1X3GA 3HG9A 1FR3A 5J39A 5FJ8G 1X9NA 1Q86C 1Q8IA 2F3IA 4C2MB 5AFWA 2PQAA 1NMGA 3CCMA 2ALYB 2D9UA 3OWEB 3D4WA 4HCSA 1TS2A 1G2TA 2AQ3B 1VQJA 4A3IB 2Q2UA 1DM0B 3U9SA 3N6RA 2OF1A 3I90A 3LGJA 1M4VA 3E9IA 2R7ZB 3CCRA 5KGUA 4IUPA 1H95A 1EQTA 1SE4A 4MTNA 1JE5A 5DM63 3FEWX 1PH6A 4B3RL 2AUJD 4N8FA 1U0LA 3FPUB 2H5XA 1JWMD 2A5HA 1SYBA 2OEOA 2CH4A 3GTLH 1YNXA 4EGVA 4DR3Q 1WTOA 2HIXA 1MHWC 2HDLA 2WKDA 1TQOA 2CW0C 4JBKA 1QWYA 1HNXL 3HOUG 4IUQA 5BR8L 4LFAQ 4DV1Q 4HIOA 3J7AV 1BBWA 2L15A 2RHQB 2NZHA 5JOBA 2XRSD 4IPDA 3Q6SA 2LS01 2JK8A 1Q7YC 4F88A 2O2LD 2K75A 4A3IG 5BN3A 1VQ4A 3I73A 1Y1VG 2QCPX 2R7ZG 1MJEA 4QCLA 5DM73 4O2DA 2EYOA 3M3YH 3MXGA 5AJ3L 3L2PA 5K36H 4YHHQ 5FO7B 3QIAA 1QCBD 2EYJA 2L11A 4ZUIA 3FMCA 4DUYQ 4OO1H 1I94Q 3I4MH 1DONA 1EWCA 4B3TQ 2PW7A 1EU4A 3W5OA 4DUZQ 1D8LA 1A63A 4DXFA 2B8GA 2R92H 3E3XA 1LTID 4OHJA 3WDNA 5ELOA 1Y8PB 1KNAA 4EQ5A 3EBEA 2KENA 3DWAA 2WINB 2V4DA 5C0XH 3CCLA 4M8AA 4Y7NH 2DJGC 1CQVA 2B2TC 1IKMA 5EQ0A 4J6HA 1TKWB 3VDYA 2LXJA 4NW2A 2BDNA 4IUVA 1QILA 1SE3A 3GTJB 1G2SA 1P8LA 2MUYA 4JYAQ 4L6TB 1HNWL 4C3IB 1NE3A 2K7VA 3FKIB 4C3JB 1Q1BA 4JI7Q 1AP0A 1YI2A 5EKKA 1I6HH 2KBNA 2TMPA 2R92B 3S15B 3I72A 3HOYH 4A3KG 4HIKA 1KHIA 3I91A 1E2ZA 1NJIC 2E2HH 1LT3D 1VQHA 1HXYD 3PQIA 3W1BA 4B9XA 4Y7NB 1EQRA 4LFAL 4A3FH 4QL5A 1JB3A 4JVZA 3JAMi 3A8KE 1CK1A 4IUUA 5JJLA 1OXXK 2B3GA 2B2YA 4DAYB 3O13A 5GQOA 1E0BA 1YEZA 1L0YB 1LACA 3T13A 4E6IA 2LFNA 2WP8J 2F0JA 1FJGQ 4X64Q 5LMNQ 1I6HB 3FDTA 4HJ7A 3HOYB 4C3IG 3FKIG 5JEAH 4C3JG 1XTDA 1PTOH 4YHHL 3CW2C 4M1UB 1LTSD 4QY7A 2R92G 4ULLA 3HEJA 2KEDA 4A3FB 4PZ6A 3VR2A 1I94L 3STBD 3M4QA 3GO5A 2DJFC 1BUVT 4B3TL 4MNOA 4HAEA 1DOLA 4WJ4A 4S3SA 4DUZL 4FXKC 3H0GH 1X65A 2CH4W 4JI8L 1PZJD 1HRJA 2NVYH 1HUMA 5FLMH 3Q22A 5IODA 4NPSA 2WKCA 4JV5Q 5H1SE 3EA6A 3T53B 1WTQA 2XSCA 1HHVA 3SK8A 4P75A 1GOZA 3UE0A 1G8ZD 1K0RA 2Z6BA 4X65Q 3HFZB 3KF8A 5M5YB 1O7YA 4HMIA 4CDCC 3HOYG 2B39A 1PTOF 1KXLA 2SOBA 2PI2E 3GTOH 5IYCG 5FOBB 1UEAB 5IYDG 4DV7Q 1VQ5A 4A3FG 4KN7C 3SK5A 4DK1A 3PO2H 4PG3A 5CV8A 2R93H 4GNXA 4JI7L 1E3PA 3CHBD 2VQFQ 2A69D 2F0OA 3ERQA 4JOIC 4JBJA 5JJZA 1VQBA 1TIID 5M3MH 4GS3A 2ENBA 3AU7A 2I07B 3STBC 1EEFD 4OWXB 2BH8A 1VQMA 1SNDA 5C44B 3OHXC 2EY5A 2EY2A 4A3MB 1XPOA 1SMYC 1LUZA 2Q8TA 3GTOB 3TDQA 4K2LA 3AYHB 2A68D 1BO0A 4K5WA 5J22A 3PO2B 1FJGL 1K73C 4CJ0B 4X64L 2G5DA 1A2UA 3KBXA 1Z47A 2X6LA 5IGDA 1IW7D 4G57A 2HHHL 1G91A 4JI4L 5L37A 4ZK9B 4DK3C 5CGKA 1X3QA 2WIIB 3MWYW 4H44C 2Z6KC 3BU2A 1LT6D 1B53A 2JA8B 4EX5A 1E1TA 2A6ED 1JMCA 1KL9A 5CR3A 3I3CA 3TN2A 1WFQA 2B2VC 5EPLA 4X6AH 3NXWA 3A74A 1VQIA 5C3WA 3RLNA 4X62L 4A3CH 1BR9A 4G4KA 2EE1A 3KLWA 5GROA 2AQ2B 4DXGA 1VQLA 5C44G 3MXNA 2E8GA 1BCPB 4X3UA 1EOTA 2A69C 1S5FD 1L1OC 4A3MG 3E0JA 1LTGD 5G3LF 1IYJB 3S1MH 2EJFC 1EY0A 5ELCA 1IHZA 1LLRD 1CKOA 5M5WH 5CBEE 3PO2G 2Q2HA 4ZKBB 5KIXA 4X65L 5G3LD 4HIMA 2KCTA 1EY4A 1WOCA 1YNNC 5M5XB 1WVLA 2XGTA 3MAQA 1A6XA 2PI2A 3DMUA 1VQCA 2FMCA 2LSSA 4K0KL 2A68C 4RAUC 3TS0A 1XPUA 1A62A 2JA8G 1S5ED 2QEXA 1O78A 3VYUA 4F87A 2F0DA 2XN9C 1HFNA 3CMEA 1RHPA 1I4XA 2UXDL 3GTPB 1NCVA 2VQFL 2ZXRA 2Y0SB 1O7LA 1SFOB 3UDXA 2PMZE 4LF7Q 4GOPB 5M5WB 2A6EC 4P72A 3DM3A 1F9SA 1JC7A 3NPPA 1VF5C 3GV6A 4RGOS 2JEAI 4R8IA 1U4MA 2Q2TA 3W3AA 1B4OA 3PF4A 1SYFA 2EYPA 4ZYSA 1J9OA 4DA2A 4WORA 3H15A 1Y1WB 1V1PA 4KMUC 5IGCA 3TMEA 3IAYA 4UP8A 1PA6A 3VR4A 5E4WC 1CKNB 3PUYA 4P73A 2OTLA 1N32L 4CKCA 3C1FA 1NAPA 2UXCQ 1VQPA 2Z9HA 3KDFB 4J1MA 3GD7A 4IPCA 1XX8A 2Y0SG 4IFDJ 1KRTA 1PH7A 4ME3A 3UDGA 3CCEA 5C5LA 2NN6H 4OX9Q 1PH8A 1PFMA 2VL6A 1GUNA 5IGBA 2R7FA 1RF2D 3I4LA 3H3VC 1FNVA 2F0PA 2HCIA 1XNQQ 1Y1WG 1JT8A 3R8BA 3NTHA 1JJ2A 4L5QA 3E5SA 2JA6G 1SRUA 3K0YA 3I55A 2E2IH 2ZTDA 2WB1B 4PNYA 2R3ZA 5KYLA 1SE8A 2CWPA 4Q0FA 4RGMA 3P20A 5EAYA 5KNCA 1WCMB 1SR3A 4R4OA 5IP9H 3A5UA 1TWCB 4OL7A 2RHSB 3PCOB 4HTHA 3CP0A 3EIVA 2RDGA 1PZID 4DV3Q 4RMFA 5KYIA 2RDFA 4OONA 4DV6Q 3J81c 3R2IA 4XQQA 4QIWE 4JCVE 4RFBA 1W6KA 2F0FA 1YHBA 3CCSA 4J15A 4LF7L 3MTSA 4OEMB 4QUCA 3J80c 5D14A 2E2IB 1JJGA 4ILWA 5M9OA 2K5DA 3CQZB 3SR1A 1D7QA 1R4PB 4NXML 1MJCA 2EPBA 1SXTA 3PUVA 2E74C 2WB1G 2L4NA 2PQEA 1BF4A 4BBRB 2JEBI 2HUGA 2RBMA 4K5XA 1WCMG 2NN6G 2QKIC 3RZOB 2IX3A 3HOWH 1EY5A 4AYBE 1Z9FA 3A8IE 1VQEA 2OXPA 3OW2A 2Z0SA 2RVLA 3ERSX 1SNCA 3L7ZC 2UXCL 4JI6Q 5J3BA 2AQ1B 1WYDA 5NUCA 3T1HQ 2CQOA 2K5HA 1M8AA 3I7FA 3OIPA 4KLKA 5CC4A 3K5NA 1PV4A 3VR3A 3KLSX 2GVAA 1TS5A 3BYYB
chains in the Genus database with same CATH topology
3FPPA 2A6HD 1AEXA 1TT2A 1RTNA 5I9OA 4A3DB 3D6CA 4QF4A 1ENFA 1KLUD 1SDFA 2B63B 5C4XB 1SEBD 2F0MA 1MD2D 3G7LA 1C4QA 1EEID 2NYZD 1OXVA 4V190 2BCOA 4HN7A 5C4JB 1DJRD 2ZXPA 1MSHA 1I4HA 3H94A 2DY8A 3V05A 4GZYC 4FP5D 2WV6D 2F0UA 3QWNA 2C5CA 4HSVA 1J8IA 1JOQA 3NP8A 2IWHA 1B44D 2JA7B 2VXWA 1A15A 2PYKA 1AZPA 1ESFA 4UDUC 3MVVA 1R4QB 4KKTA 5ELDA 4BWGB 4DN4M 4L8JA 4RCOA 1QG7A 5I2XA 2FMMA 2Z8LA 2BE5D 4KD4A 3HRZC 3MZ5A 5DNFA 2K5WA 5DEHA 1B3AA 2N55A 5COYA 3EJIA 2XWBB 4KI0A 3TP5A 1LT5D 4C3HB 1ZKOA 1JORA 1HFGA 1SBBB 2PW5A 2B2YC 3S2HB 1F77A 1Y1VB 4PMCA 2F0VA 4IFDI 3GQBA 1DZ1A 4DGZA 1TY2A 4IQZA 3PUXA 1JOKA 1I3QB 2FHTA 4A93B 1U9RA 2VUMB 4KHZA 1LO5D 4JBWA 3D4DA 1X3PA 3DWPA 1GUTA 2O5JC 3K57A 4PQXA 3H09A 4LK1C 3F2UA 3NQIA 3X3MA 3IFTA 5E1FA 2YYZA 1KNEA 1IYVA 4C3HG 2F0IA 1SYEA 4H7BA 4XTCS 4WRDA 2ICIA 1STYA 1KDAA 3QG1A 4H0LC 2KUMA 3NBHA 2K28A 3NTKA 2F0SA 2IL8A 1JWUD 5J1ZA 4BBSB 2RDHA 2L9HA 3P75A 4TKOB 1STHA 4ZLTF 3IL8A 5CYUA 1TVXA 4PV1C 2OT2A 4DNTB 5I4DA 2ID0A 1OO9B 1UUPA 1B9NA 2SDFA 4IURA 1QOHA 3HOXB 4A3KB 1S5BD 2KQ3A 2QEJC 1D5ZC 2A73B 2QF7A 2E2DC 1SNOA 1ENAA 3BYTB 4KTAA 1PRTF 3A7LA 3NHHA 3SHLA 5HGTA 2Z1CA 1EY6A 4QMGA 1PRTD 1GHKA 1FGBD 3OPOA 3SK6A 4A3GB 4BY1B 3HOVB 3S14B 1ICWA 1QNUA 4BA1I 4EQNA 5KEEA 4A3EB 5KRUA 3J81E 5I6WA 1PDQA 2EXZA 3T4AC 1B2TA 4I7ZC 3S9WA 2B8FA 2EYFA 4OGQC 1S5CD 3I70A 2LKVA 2F0TA 3MXUA 5CV7A 3J80E 4KJNA 4Z9CB 3K5LA 4RCNA 1ESRA 2L1BA 3SVMA 1V1PB 4X3KA 4DAVA 1B9MA 5C4HA 3HGBA 4C56C 1XWEA 5CMDA 1Y8OB 5JVH3 5I6YA 4G7HC 1DOMA 2HQEA 4K2KA 3R2TA 1Y8NB 2K6AA 4XT1B 1PMRA 5IGGA 4WFN3 1JOOA 3KBGA 3NK9A 3I4NB 3I8ZA 2F1MA 5TSSA 3CU7A 1JR0D 4X3TA 1ENCA 2L0CA 4IN3A 1STEA 3KK7A 4HR7B 2HDMA 3BDOA 4IFDG 2PNRC 1H9JA 1G291 2NB0A 3W2DA 2XWJB 1JQYD 1F2YA 3E6ZX 1F9RA 1TWGB 1EQVA 1PTOD 2KCNA 4KK7A 2PZUA 1HQMC 1FNWA 2F0EA 1SSOA 2IX1A 2EJGC 3D4RA 3DXJC 1W6JA 4I65A 3U9OA 2PMZB 2BDOA 3NBIA 3BVGA 1EU3A 5D3IB 1GUOA 1ZEQX 2L55A 4J8QA 4BS9A 4RH6A 2O4XA 2CQAA 2PCFB 1KAAA 2JA5B 2K04A 5EPJA 1II3A 1XYIA 2M2LA 2EYMA 4NMZA 3K59A 1NR4A 1SAPA 4TSSA 4BY7B 5EKLA 4KY5A 3PIO3 1PFBA 3FVQA 2RQXA 1LABA 2XIWA 1HTPA 5CV9A 2IX0A 4RHRA 1D2BA 1PTOC 2SEBD 4B9WA 2I46A 3L9AX 1CTMA 3H91A 4MHEA 3TSSA 2J0TD 2MPMA 4ZUJA 3SDZA 4N9TA 4LAAA 3BDLA 4RWSC 1Y69U 1BCPF 2FFKB 2JYOA 5EBDA 2C9OA 4NKLA 4XYOA 2L12A 1I50B 2H1EA 1R9TB 1FD7D 4OIJA 1EFID 2KVMA 2F3WA 1GJXA 3BVMA 3C2PA 3CKIB 1YNJD 4EQOA 1O80A 1STBA 2F0HA 4FF1A 1XTCD 3AB9A 3BDCA 1AW7A 1IW7C 2M9VA 4FYDA 2JSOA 3URYA 1TS4A 2F0GA 1H9SB 4XQJA 4QIWB 4PMWA 1U4LA 3PMFA 3GTQB 1ONLA 1QJOA 3Q24A 2ICEC 3SK4A 1STNA 1PZKD 1EZ6A 4G7ZC 3QOJA 5EJWA 1A2TA 1SJHD 3DEPA 1F2ZA 1MBYA 3UI2A 2JA6B 2F3VA 2TSSA 1CFMA 2SNMA 1CM9A 3M85A 4TQUS 1CT1D 4AYBB 1RCVD 4IZ8A 1VDZA 2QDBA 3A54A 3OWFA 3LX0A 4CBVA 4DAYA 1H9KA 1D1KA 2MJ8A 5FKAC 1YNJC 2B2WA 3N52A 2AWOA 1EY7A 4K14A 4A3BB 2F4IA 3PO3B 3NWTA 3ZYYX 3AMUA 4KY6A 2G9DA 1AFPA 2Z4IA 1U4PA 4KKSA 1STAA 3RD4A 2F0WA 1TU2B 2H4OA 2B2UA 2EJMA 3VYSA 2NWGA 2NVXB 1AN8A 1MSGA 1WD1A 3S16B 3BG3A 2R61A 3M4OB 3RLFA 4Q5VA 3QB3A 1LTRD 3TP6A 3K58A 1LTTD 1AZQA 4FNFA 2B2VA 1TY0A 4V0BA 4ODGA 4QUFA 1JWSD 2RKSA 1EYAA 1TR5A 1F2LA 4DFAA 3Q0AA 5A35A 2K1BA 1EWHA 1VMPA 1CHQD 3GV3A 5C3EB 5JPMC 4NP5A 3DEOA 3ONAB 1QNKA 1TWHB 1I4RA 4R8NA 3HP3A 3A7AB 3RMHA 1BQQT 1K8OA 5D3DA 3D31A 4JK1C 3EROA 1KABA 1BOSA 4O1NA 3ITPA 2X6GA 2ZXOA 2VNUD 2BA1A 3K7AB 2JP1A 5JPNC 3RZDB 5DAUA 5KNBA 3X3NA 2EOTA 1FYCA 3LNNA 1G6ZA 5CV6A 1SNQA 5T1GA 1O7ZA 1SYDA 2LMCB 4KN4C 4FXDA 1UNSA 1OXTA 2MGSA 1KLGD 1STGA 1H9MA 1KTKA 1I4QA 3OMCA 1Q1EA 1HA5A 2FINB 1V43A 2XNAC 1CQFA 1OXSC 2DNCA 4FF2A 2A6HC 5C5MA 1BDOA 3BZDB 3GTGB 2G9HD 1TWFB 3RUZA 1ET9A 2KEEA 3Q23A 1GUGA 1LTAD 5BN4A 1BBXC 4OO1I 4XXEA 2EY1A 4U673 1C8CA 5FK9C 3P1HA 4PMBA 1Z6HA 3MHBA 2CW0D 4BA2I 2E75C 2RSNA 3J7YW 2N88A 2XRQD 3S2DB 3BS1A 1DD2A 2J4XA 1D1IA 1A3TA 4RHSA 1Q12A 2NBFA 5C0XI 3V2TA 1EYCA 1B1ZA 5EKIA 2EY6A 2WACA 3GTMB 2F0NA 2E76C 1GXDC 1CA5A 3QJYA 4FF3A 2CVRA 2CHBD 1KDBA 3QO2A 5C6AA 1WTXA 4IUTA 4TRDA 4XT3B 3SE0A 1EY9A 1K83B 1WTPA 1I4PA 3JAME 2PPBC 2BE5C 2K03A 3T56B 3A55A 2BOSA 3HS0C 1QB5D 1CA6A 5ELEA 1RKNA 2NVTB 2JXMB 1EIHA 1F2MA 3TZUA 4XQNA 2X69A 5EPKA 4F7XA 5LL6X 5CBAE 3D6WA 5EBCA 4K8IA 3C46A 2LY7A 2Z4HA 2GA4B 2IW3A 2YU9B 3GTLB 2VB2X 2K33A 3HZXA 4O42A 4HMJA 4HSPA 3GP7A 3SXHA 5C4ZA 3OOCA 1ILPA 1VCIA 1L0XB 1ET6A 1D6EC 1ZYRD 1E2VA 5M3FB 1DXMA 4KJOA 4DAPA 3NSWA 1VF7A 4CHTB 1HCZA 4C1NK 3L3OC 1PRTB 1EZ8A 3MFYA 4A3JB 3M3YB 3MC0B 4OIKA 1RJTA 5FO9B 1UAPA 2NVQB 5FLXE 4IFDH 2J7ZA 1LT4D 2KJXA 3C3LA 1HA6A 4K6DA 3I4MB 2AWNA 3S1NB 2PO4A 1DYQA 1SNPA 3M7GA 4K6LA 4NDXA 3C1EA 4ID6A 3JAML 4ZAIA 2DY7A 1NUCA 3G6JB 1V8QA 3NE5B 3PV0A 1IKLA 1GHJA 1HTLD 4EQPA 1ZYRC 3HKZB 2QILA 2O5IC 5K36G 4KHVA 1IYUA 1PYWD 1EYDA 1PRTC 3IKJA 4QB4A 3T51B 4OO1G 3DWQA 4X3SA 2K01A 4EVOA 1RD9D 1V1OA 2KOLA 5IIFA 1HPCA 3TP7A 1FNUA 4F8MA 2E2HB 4KV6A 2JE6I 3VR5A 5C0XG 4FVMA 1SYGA 4K8JA 2K5QA 1WTVA 4K5VA 1SMYD 1TWAB 2EYHA 4KKUA 2PZTA 2A74C 2E2JB 4YIJA 4XIGS 4U68A 1PTOB 3KUPA 5FLXL 3J81L 5ELFA 2B2WC 4DNRB 1RODA 4CKEA 1EY8A 1Z7TA 4B08A 3J80L 3H0GB 2NVYB 4DU9A 3ND8A 2FJ2A 3DUZA 5D65A 2F0KA 2RA4A 1K8MA 4RGTA 3NWSA 5IT9E 3DHQA 1NR2A 2EYLA 1QE6A 4HCEA 1RTOA 4MN3A 1F9PA 1YNND 5JEAG 1CHPD 2B2TA 2RSOA 5K5PA 2B2UC 1OXUA 4H13C 2R93B 5LL6S 1T5XD 4N9PA 3PUWA 1TS3A 1PFNA 3IFDA 5BN5A 5JVG3 4HEDA 1CI3M 2NN6I 5M3MB 5I2YA 2EDGA 4LJZC 1ZXTA 3TP8A 2NTSA 2SNSA 1F9QA 1T5EA 5CV4A 1BCPD 4DK0A 3K5MA 3R3OA 1Q3LA 3MA2B 2AUKA 3OW7A 2HCCA 3DM1A 2EZVA 3TZDA 5C3XA 2L5TA 4CGYB 3VA7A 5FO8B 1D5XC 1ML0D 1CZWA 3T16A 1HQRD 3ND9A 3CRKC 1C48A 2MP1A 1BXTA 3M4YA 1LTBD 1DOKA 4RKLA 5ISRA 1VMCA 3S1MB 3P7JA 5IT9L 4RGNA 3KLRA 5IGEA 4L63B 1JE4A 4CJ1B 1I4GA 1Q90A 1MI2A 1BCPC 3A56A 5C0XJ 1WTWA 5KNDA 3OMGA 1KDCA 4KY7A 1E2WA 5JAVA 1B50A 1S5DD 1SE2A 3OIQA 3V96A 2F0LA 2F03A 4CKBA 4IUNA 2K05A 4RKBA 4XDXA 3M7NA 4IALA 2PZWA 2NTTA 2BA0A 3S17B 3NTIA 1GUSA 4RA8A 4ABNA 1GUWA 4LMQD 1CZGA 5F2DA 5A2QE 2IPKD 4KD3A 4G7OC 3VYTA 2KECA 1S4ZA 2D5DA 3BVZA 3J7AF 1PXUA 5JEAJ 2F0QA 3WOFA 4MIUA 1PLFA 3TBIB 2MHVA 3NQTA 5E4XA 3OSOA 3EVQA 4FXGC 2D2CC 1A3UA 2NUCA 1DCZA 4XYQA 1RDPD 3S1RB 2KCCA 3WOEA 1D5MC 5EGTA 5E3FA 2IJ0A 1X32A 3KLSA 3LWEA 3HOZB 4P2CB 2IT1A 2Q8RE 2D62A 2DNEA 1A3VA 1EIGA 1MGSA 4CJ2C 5CORA 3EFXD 4ZKCB 2DN8A 5ELBA 3A8JE 3LWUA 4R9WA 4UAIA 1HUNA 3D3RA 4ZRZA 1WD0A 3EQLC 1ILQA 3VA5A 3R93A 2ZT9C 4DF7A 3MEHA 4ME5A 2WAQB 3K5OA 3HOWB 2KA7A 2NZ1D 1SYCA 3SEBA 5A2QL 3FRPB 3PIP3 1EL0A 3VR6A 2R6GA 2M00A 1BNZA 3MFGA 4FO2A 1LV9A 5HURA 5IOCA 5T1IA 3QOLA 1H9SA 2XVSA 3D8GA 3GTKB 1IL8A 2VB3X 4FF4A 1NSNS 1JCKB 1SJED 3NUCA 1WTRA 3MXPA 5LHY1 5IGFA 2Q8IB 1JICA 1I6VC 5I9PA 4ZQ3A 3PUZA 1XXGA 1U4RA 2KHSA 3CRLC 4C1NI 3VYRA 5CV5A 2K32A 4WJWA 1H9RA 3H6MA 2EVBA 3HOUB 3S1QB 3K6OA 1SNMA 3HG9A 1FR3A 5J39A 1Q8IA 4C2MB 5AFWA 2D9UA 3OWEB 3D4WA 4HCSA 1TS2A 1G2TA 2AQ3B 4A3IB 1DM0B 3U9SA 3N6RA 2OF1A 3I90A 1M4VA 2R7ZB 5KGUA 4IUPA 1EQTA 1SE4A 5DM63 3FEWX 2AUJD 2A5HA 1JWMD 3FPUB 1SYBA 2OEOA 4EGVA 1WTOA 2HDLA 2WKDA 1TQOA 2CW0C 1QWYA 4IUQA 3J7AV 5JOBA 2XRSD 3Q6SA 2LS01 4F88A 2O2LD 5BN3A 3I73A 2QCPX 4QCLA 5DM73 2EYOA 3MXGA 5K36H 5FO7B 3QIAA 1QCBD 2EYJA 2L11A 4ZUIA 3FMCA 4OO1H 1DONA 1EWCA 2PW7A 1EU4A 4DXFA 2B8GA 1LTID 4OHJA 3WDNA 1Y8PB 1KNAA 3DWAA 2WINB 2V4DA 5C0XH 4M8AA 1CQVA 2B2TC 1IKMA 5EQ0A 4J6HA 1TKWB 4NW2A 2BDNA 4IUVA 1QILA 1SE3A 3GTJB 1G2SA 2MUYA 4L6TB 4C3IB 2K7VA 3FKIB 4C3JB 1Q1BA 1AP0A 5EKKA 2TMPA 2R92B 3S15B 3I72A 3I91A 1E2ZA 1LT3D 1HXYD 4B9XA 4Y7NB 1JB3A 3A8KE 1CK1A 4IUUA 1OXXK 2B2YA 3O13A 1E0BA 1L0YB 1LACA 3T13A 4E6IA 2LFNA 2WP8J 2F0JA 1I6HB 3FDTA 3HOYB 4C3IG 5JEAH 4C3JG 1PTOH 4M1UB 1LTSD 4ULLA 3HEJA 2KEDA 4A3FB 3VR2A 3GO5A 1BUVT 4HAEA 1DOLA 4S3SA 4FXKC 1PZJD 1HRJA 1HUMA 3Q22A 5IODA 2WKCA 3EA6A 3T53B 1WTQA 2XSCA 1HHVA 3SK8A 1GOZA 1G8ZD 3KF8A 5M5YB 1O7YA 4HMIA 2B39A 1PTOF 2SOBA 5FOBB 1UEAB 4KN7C 3SK5A 4DK1A 5CV8A 3CHBD 2A69D 2F0OA 3ERQA 5JJZA 1TIID 2ENBA 3AU7A 2I07B 1EEFD 1SNDA 5C44B 3OHXC 2EY5A 2EY2A 4A3MB 1SMYC 2Q8TA 3GTOB 3TDQA 4K2LA 2A68D 1BO0A 4K5WA 5J22A 3PO2B 4CJ0B 1A2UA 3KBXA 1Z47A 2X6LA 5IGDA 1IW7D 4G57A 1G91A 4ZK9B 5CGKA 1X3QA 2WIIB 3MWYW 4H44C 2JA8B 1LT6D 1B53A 2A6ED 5CR3A 3I3CA 3TN2A 2B2VC 5EPLA 3NXWA 5C3WA 1BR9A 4G4KA 2EE1A 2AQ2B 4DXGA 3MXNA 1BCPB 4X3UA 1EOTA 2A69C 1S5FD 3E0JA 1LTGD 5G3LF 2EJFC 1EY0A 5ELCA 1IHZA 1LLRD 5CBEE 4ZKBB 5KIXA 5G3LD 1EY4A 1YNNC 5M5XB 1WVLA 3MAQA 1A6XA 3DMUA 2FMCA 2A68C 4RAUC 1S5ED 1O78A 3VYUA 4F87A 2F0DA 2XN9C 1HFNA 1RHPA 1I4XA 3GTPB 1NCVA 2ZXRA 2Y0SB 1O7LA 1SFOB 5M5WB 2A6EC 1F9SA 1JC7A 3NPPA 1VF5C 3GV6A 4RGOS 2JEAI 4R8IA 1U4MA 3W3AA 1B4OA 1SYFA 2EYPA 4ZYSA 1J9OA 4DA2A 4WORA 1Y1WB 1V1PA 4KMUC 5IGCA 3TMEA 3IAYA 3VR4A 5E4WC 3PUYA 4CKCA 3C1FA 1NAPA 4J1MA 3GD7A 1XX8A 4IFDJ 5C5LA 2NN6H 1PFMA 1GUNA 5IGBA 1RF2D 3I4LA 3H3VC 1FNVA 2F0PA 2HCIA 3R8BA 3NTHA 3E5SA 3K0YA 2WB1B 4PNYA 2R3ZA 5KYLA 4Q0FA 4RGMA 3P20A 5KNCA 1WCMB 1TWCB 4OL7A 4HTHA 2RDGA 1PZID 5KYIA 2RDFA 3R2IA 4XQQA 4RFBA 1W6KA 2F0FA 3MTSA 4QUCA 5D14A 2E2IB 4ILWA 5M9OA 2K5DA 3CQZB 3SR1A 1R4PB 2EPBA 1SXTA 3PUVA 2E74C 2L4NA 2PQEA 1BF4A 4BBRB 2JEBI 2HUGA 2RBMA 4K5XA 2NN6G 2QKIC 3RZOB 2IX3A 1EY5A 3A8IE 2OXPA 2RVLA 1SNCA 3L7ZC 2AQ1B 5NUCA 3OIPA 3K5NA 1M8AA 5CC4A 3VR3A 3KLSX 1TS5A 3BYYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T13 A;  4DFA A;  4E6I A;  4EQN A;  5KEE A;  1AEX A;  4G57 A;  1F2Z A;  2F0J A;  4K5V A;  3P1H A;  1TT2 A;  4PMB A;  3SXH A;  4DGZ A;  5C5L A;  5KRU A;  2EYH A;  5C4Z A;  5I6W A;  2EXZ A;  3MHB A;  4KJO A;  2PZT A;  5CGK A;  5I9O A;  3S9W A;  2M00 A;  1JOK A;  2EYF A;  5CR3 A;  5HUR A;  5IGB A;  5IOC A;  2F3V A;  4YIJ A;  2F0Q A;  1U9R A;  2O4X A;  2SNM A;  5C3X A;  1KAA A;  2LKV A;  3D6C A;  4MIU A;  2F0T A;  2EYO A;  4QF4 A;  5CV7 A;  3D4D A;  3NXW A;  3HEJ A;  3QOL A;  4NP5 A;  2F0P A;  5C3W A;  4KJN A;  1II3 A;  1A3T A;  2F0M A;  3NQT A;  3D8G A;  4IZ8 A;  1EZ8 A;  3OSO A;  2QDB A;  3EVQ A;  3T16 A;  3OWF A;  2EYM A;  3V2T A;  5E1F A;  1EYC A;  3LX0 A;  4NMZ A;  2EY6 A;  2EYJ A;  2WAC A;  1NSN S;  1A3U A;  2NUC A;  3E5S A;  4S3S A;  4ZUI A;  4R8N A;  2F0N A;  2F0I A;  1SYE A;  3NUC A;  1EY0 A;  5C4H A;  5EKL A;  1IHZ A;  3MXP A;  4KY5 A;  4PNY A;  4H7B A;  4RKL A;  1EY8 A;  2PW7 A;  5EGT A;  5ISR A;  4WRD A;  4K6D A;  5IGF A;  1STY A;  1KDA A;  5E3F A;  5IOD A;  5KYL A;  1EY7 A;  4K14 A;  5KIX A;  3ERO A;  5I9P A;  2F0S A;  4ZQ3 A;  1EY4 A;  1SNP A;  5CV9 A;  1KDB A;  1KAB A;  4DU9 A;  4NDX A;  2F0K A;  2KHS A;  5I6Y A;  5IGE A;  5J1Z A;  2HQE A;  5CV5 A;  4OL7 A;  3C1E A;  3ITP A;  3SK8 A;  4K2K A;  3DMU A;  4ID6 A;  5C6A A;  4HTH A;  3P75 A;  2F0U A;  3H6M A;  3DHQ A;  4B9W A;  1JOQ A;  4HMI A;  5KYI A;  2EYL A;  3NP8 A;  1STH A;  4TRD A;  5DAU A;  2RDF A;  5IGG A;  1A3V A;  2SOB A;  1EY9 A;  1JOO A;  1NUC A;  4KY6 A;  4N9T A;  4ZUJ A;  2F0D A;  3BDL A;  4LAA A;  2PYK A;  2F0F A;  3OMG A;  1SNM A;  3NK9 A;  1KDC A;  4KY7 A;  5CV6 A;  1SNQ A;  5J39 A;  1STA A;  4J6H A;  3MVV A;  5JAV A;  5K5P A;  2F0W A;  4NKL A;  1SYD A;  3SK5 A;  4EQP A;  5CV8 A;  3D4W A;  5M9O A;  3SR1 A;  4KHV A;  1ENC A;  2F3W A;  1RKN A;  2KQ3 A;  1EYD A;  2F0L A;  2F0O A;  1STG A;  3ERQ A;  2OF1 A;  4N9P A;  1F2M A;  4QB4 A;  4IUN A;  4KD4 A;  5KGU A;  2ENB A;  5EKK A;  3MZ5 A;  3OMC A;  1SNO A;  2PQE A;  1ENA A;  1SYF A;  4EQO A;  2RBM A;  4KTA A;  2EYP A;  4RKB A;  4K5X A;  5DEH A;  4F7X A;  1STB A;  2F0H A;  4WOR A;  3QB3 A;  3VA5 A;  5IGC A;  4DF7 A;  3TME A;  3TP6 A;  1EY5 A;  3BDC A;  4EVO A;  4IAL A;  3MEH A;  1SND A;  1F2Y A;  4ME5 A;  5JOB A;  2PZW A;  1SYB A;  2OEO A;  3NHH A;  5IIF A;  5C5M A;  3EJI A;  2EY5 A;  2EY2 A;  2OXP A;  3SHL A;  3TP8 A;  4K8I A;  3TP7 A;  3TP5 A;  4B9X A;  1EY6 A;  5HGT A;  4QMG A;  1SYC A;  1EQV A;  2F0G A;  2SNS A;  4K2L A;  1TQO A;  1SNC A;  4F8M A;  5IGD A;  1JOR A;  3RUZ A;  3PMF A;  4KV6 A;  2PZU A;  4K5W A;  3SK6 A;  4ODG A;  3HZX A;  5J22 A;  5NUC A;  5CV4 A;  2PW5 A;  3C1F A;  2F0E A;  3R3O A;  4HMJ A;  5F2D A;  3SK4 A;  1STN A;  2RKS A;  5CC4 A;  1EZ6 A;  4KD3 A;  3QOJ A;  1A2U A;  1SYG A;  2F0V A;  1A2T A;  2EY1 A;  1EYA A;  4I65 A;  4J1M A;  4PMC A;  3U9O A;  1TR5 A;  4K8J A; 
#chains in the Genus database with same CATH topology
 1L0W A;  4OX9 L;  3FPP A;  2A6H D;  1AEX A;  2A8V A;  1TT2 A;  1RTN A;  5I9O A;  4A3D B;  1XNQ L;  5FJ8 H;  4O0A A;  2ZJP A;  3GTK H;  1C9O A;  3D6C A;  2MQH A;  4QF4 A;  1ENF A;  1KLU D;  1SDF A;  4BBR G;  2C35 B;  2B63 B;  5C4X B;  1SEB D;  2F0M A;  1MD2 D;  3G7L A;  1C4Q A;  1EEI D;  2NYZ D;  1OXV A;  4LUZ A;  1PH1 A;  4V19 0;  1SN8 A;  2BCO A;  2CFM A;  1YJN A;  1GKH A;  4HN7 A;  5C4J B;  1E7Z A;  1DJR D;  2ZXP A;  1MSH A;  4DKA C;  4DR1 L;  1I4H A;  3H94 A;  2DY8 A;  4GN5 A;  4JI1 Q;  3V05 A;  4BXX H;  2ASB A;  4DV3 L;  4GZY C;  2UUB Q;  3E9H A;  4DV6 L;  4FP5 D;  2WV6 D;  3CCV A;  3HOU H;  2F0U A;  3QWN A;  2C5C A;  2DGY A;  4HSV A;  5IWA Q;  2QDL A;  4A3D G;  1GO3 E;  1J8I A;  1JOQ A;  3NP8 A;  2IWH A;  1B44 D;  2JA7 B;  2VXW A;  1A15 A;  4C2M H;  2HIV A;  2PYK A;  1AZP A;  4I7A A;  1ESF A;  5IYB G;  2B63 G;  4UDU C;  5C4X G;  3CC2 A;  3MVV A;  1PH4 A;  1R4Q B;  4KKT A;  3TEH B;  4A3I H;  5ELD A;  4BWG B;  1Y1V H;  2Q2I A;  4DN4 M;  4L8J A;  2R7Z H;  1LTL A;  4RCO A;  1UE1 A;  1QG7 A;  5I2X A;  4GLV B;  2LXK A;  2FMM A;  2Z8L A;  3CPF A;  2BE5 D;  4KD4 A;  3HRZ C;  3MZ5 A;  5DNF A;  2K5W A;  5DEH A;  1B3A A;  1I3Q H;  1HZB A;  2N55 A;  2VUM H;  5COY A;  4JI6 L;  3EJI A;  2GN5 A;  2XWB B;  4KI0 A;  3TP5 A;  3T1H L;  1LT5 D;  4C3H B;  1ZKO A;  5LMU Q;  1JOR A;  2JA7 G;  2NZO A;  1HFG A;  1SLJ A;  4P71 A;  1SBB B;  2PW5 A;  2B2Y C;  3S2H B;  1F77 A;  1Y1V B;  1JB7 A;  1N9W A;  3BZC A;  4PMC A;  2F0V A;  3CD6 A;  4IFD I;  2RF4 A;  4POF A;  1HNW Q;  3GQB A;  1SMX A;  1YJW A;  1DZ1 A;  4DGZ A;  1TY2 A;  1WI5 A;  4IQZ A;  5DLQ E;  3PUX A;  1LM0 A;  1JOK A;  1I3Q B;  2FHT A;  4BXX G;  3SGI A;  4A93 B;  1U9R A;  2VUM B;  2K5N A;  4KHZ A;  1LO5 D;  4JBW A;  3M9B A;  3D4D A;  1X3P A;  3DWP A;  1GUT A;  1C0A A;  2O5J C;  3K57 A;  4PQX A;  1VQ9 A;  3H09 A;  4LK1 C;  3F2U A;  3NQI A;  3X3M A;  3IFT A;  4PZ7 A;  5E1F A;  4HJ5 A;  2YYZ A;  1KNE A;  1V9P A;  1Q8K A;  1IYV A;  4C3H G;  2F0I A;  1SYE A;  4JI1 L;  4H7B A;  4XTC S;  4A3K H;  4WRD A;  4ALP A;  2ICI A;  1STY A;  1KDA A;  3QG1 A;  4H0L C;  2UUB L;  2KUM A;  1UE5 A;  3NBH A;  2K28 A;  3NTK A;  2F0S A;  2IL8 A;  5IWA L;  1JWU D;  1LYL A;  5J1Z A;  1IXR A;  4BBS B;  2RDH A;  2L9H A;  3P75 A;  3G48 A;  4TKO B;  4YWM A;  5GAG C;  2VQE Q;  1STH A;  4ZLT F;  3IL8 A;  5CYU A;  1TVX A;  4A93 G;  2VUM G;  4PV1 C;  3GTJ H;  2OT2 A;  3J81 j;  4HJ9 A;  1VQF A;  4DNT B;  5I4D A;  4GNX C;  4A3G H;  2ID0 A;  1OO9 B;  1UUP A;  3RNU A;  4JI8 Q;  1B9N A;  2SDF A;  4IUR A;  1QOH A;  4C3I H;  3FKI H;  3HOX B;  4C3J H;  4A3K B;  1S5B D;  2KQ3 A;  1MKH A;  2QEJ C;  3CCU A;  3S15 H;  1D5Z C;  2UUC Q;  2A73 B;  2QF7 A;  2E2D C;  1SNO A;  1ENA A;  3BYT B;  4KTA A;  1PRT F;  5LMU L;  3A7L A;  3NHH A;  3CPW A;  4BBS G;  3A0J A;  3SHL A;  2JN4 A;  2Z1C A;  5HGT A;  1EY6 A;  1NY4 A;  4QMG A;  4DV4 Q;  1PRT D;  5IP7 G;  1GHK A;  2GVB A;  1FGB D;  3OPO A;  3SK6 A;  4NXN Q;  4A3G B;  4BY1 B;  3K0X A;  3HOV B;  3S14 B;  1ICW A;  1K8G A;  1QNU A;  4BA1 I;  4EQN A;  5KEE A;  4A3E B;  3HOX G;  1HNZ L;  5KRU A;  3J81 E;  5I6W A;  1PDQ A;  2EXZ A;  3T4A C;  1B2T A;  4I7Z C;  3S9W A;  3RN2 A;  5IYC H;  2B8F A;  5IYD H;  2EYF A;  4OGQ C;  1S5C D;  3I70 A;  2LKV A;  2F0T A;  3MXU A;  5CV7 A;  3J80 E;  4KJN A;  4Z9C B;  2K4K A;  2CCZ A;  3K5L A;  4RCN A;  1ESR A;  2L1B A;  1K9M C;  3SVM A;  1V1P B;  4X3K A;  4DAV A;  4WJ3 M;  4DR4 Q;  1B9M A;  3KF6 A;  5C4H A;  3UDF A;  3HGB A;  4C56 C;  1XWE A;  5CMD A;  4A3G G;  4BY1 G;  3HOV G;  1Y8O B;  2HHH Q;  4JI4 Q;  1VQG A;  5JVH 3;  1N33 L;  5I6Y A;  2VQE L;  5M5Y H;  1DOM A;  2OQ0 A;  4G7H C;  2HQE A;  4A3E G;  4K2K A;  3R2T A;  1Y8N B;  3GDE A;  1VQA A;  2K6A A;  4GN4 B;  4XT1 B;  4B3S Q;  1PMR A;  5IGG A;  2I5L X;  4WFN 3;  4DV0 Q;  1PH9 A;  1JOO A;  4X62 Q;  3KBG A;  3H3V I;  1ASZ A;  1X6O A;  3NK9 A;  3I4N B;  3I8Z A;  2F1M A;  5TSS A;  1EUJ A;  4UP9 A;  3CU7 A;  1JR0 D;  1GM5 A;  2UUC L;  1FVI A;  4X3T A;  1ENC A;  2L0C A;  4IN3 A;  1STE A;  3KK7 A;  1GD7 A;  4GN3 B;  4HR7 B;  4OWW B;  4A75 A;  2HDM A;  3BDO A;  4IFD G;  1W3S A;  2PNR C;  1H9J A;  5C44 H;  1G29 1;  2NB0 A;  4YWL A;  1HR0 Q;  4A3M H;  3W2D A;  4DV4 L;  2XWJ B;  4K0K Q;  1JQY D;  1F2Y A;  3KFU A;  2F52 A;  4DV5 Q;  3E6Z X;  3U4Z A;  3B6Y A;  4NXN L;  1F9R A;  1TWG B;  1EQV A;  1PTO D;  3J7A 5;  2KCN A;  4L5S A;  4KK7 A;  3S24 A;  2PZU A;  1HQM C;  2UXD Q;  3RR5 A;  1FNW A;  2F0E A;  1SSO A;  2IX1 A;  3I4N G;  2EJG C;  3D4R A;  3DXJ C;  1W6J A;  4I65 A;  3U9O A;  2PMZ B;  1L1O B;  2BDO A;  3NBI A;  3BVG A;  2JA8 H;  4DAM A;  1EU3 A;  3AFP A;  1VQ8 A;  5D3I B;  5IY0 A;  1GUO A;  1ZEQ X;  2F4V Q;  4LF9 Q;  2L55 A;  4J8Q A;  4BS9 A;  4RH6 A;  2O4X A;  2CQA A;  2PCF B;  1KAA A;  2CWA A;  2JA5 B;  2K04 A;  5EPJ A;  1HH2 P;  4DR4 L;  1II3 A;  5HGQ A;  1XYI A;  2YTV A;  2M2L A;  2EYM A;  4JI2 Q;  4NMZ A;  3K59 A;  3HKZ E;  1N32 Q;  1NR4 A;  4X66 Q;  3EN2 A;  1SAP A;  4TSS A;  5ELN A;  4BY7 B;  5EKL A;  4KY5 A;  3PIO 3;  1PFB A;  3ULJ A;  3JC6 6;  2KCM A;  2MFI A;  5M5X H;  4LF5 Q;  3FVQ A;  4JG2 A;  2RQX A;  1LAB A;  5JJI A;  2XIW A;  1HTP A;  5CV9 A;  4B3S L;  2IX0 A;  4RHR A;  1D2B A;  1KC8 C;  4DV0 L;  1PTO C;  1NTG A;  3ER0 A;  2SEB D;  4B9W A;  2I46 A;  3L9A X;  1CTM A;  3H91 A;  4MHE A;  3TSS A;  2J0T D;  2MPM A;  4ZUJ A;  3SDZ A;  4N9T A;  2UU9 Q;  4LAA A;  3BDL A;  3GTP H;  4RWS C;  2JA5 G;  1Y69 U;  1IBK Q;  1BCP F;  1SFO H;  1OTC A;  2FFK B;  2JYO A;  5EBD A;  2C9O A;  4NKL A;  4XYO A;  1WJJ A;  2L12 A;  1I50 B;  2H1E A;  1R9T B;  1FD7 D;  3I2Z A;  1EFI D;  1ICF B;  4OIJ A;  2KVM A;  2F3W A;  4IOA A;  1GJX A;  3BVM A;  1HR0 L;  4BY7 G;  3C2P A;  1Y1W H;  3CKI B;  4DV5 L;  1YNJ D;  4EQO A;  1O80 A;  1STB A;  2F0H A;  2JA6 H;  4FF1 A;  1XTC D;  3AB9 A;  3BDC A;  1S40 A;  1AW7 A;  1K28 A;  1K3R A;  1IW7 C;  2M9V A;  2EIF A;  1N34 Q;  1P16 A;  2JSO A;  4FYD A;  3FHW A;  3URY A;  1TS4 A;  3PGZ A;  2F0G A;  1H9S B;  4XQJ A;  4QIW B;  4PMW A;  1U4L A;  3PMF A;  4JI0 Q;  3GTQ B;  1ONL A;  1QJO A;  3RN5 A;  3Q24 A;  2ICE C;  1XPR A;  3SK4 A;  1STN A;  4LW1 A;  1PZK D;  1EZ6 A;  4G7Z C;  3QOJ A;  5EJW A;  1A2T A;  2A1A A;  3JAM c;  1SJH D;  4HID A;  1PH5 A;  3DEP A;  4AIM A;  2OCE A;  4NXM Q;  2F4V L;  4LF9 L;  1F2Z A;  4JI3 Q;  3CF5 A;  2D0O A;  1MBY A;  3UI2 A;  2JQO A;  2JA6 B;  2F3V A;  2TSS A;  1CFM A;  4YY3 L;  2SNM A;  1CM9 A;  1PVO A;  2EXD A;  3M85 A;  4JI2 L;  4TQU S;  3CAM A;  3CCQ A;  1CT1 D;  3AEV A;  4AYB B;  1RCV D;  4IZ8 A;  3I56 A;  4X66 L;  1VDZ A;  2QDB A;  3A54 A;  3OWF A;  3LX0 A;  3KOJ A;  4CBV A;  4DAY A;  1H9K A;  4LF5 L;  1D1K A;  2BH2 A;  2MJ8 A;  5FKA C;  1YNJ C;  2B2W A;  2PQA B;  1WCM H;  3N52 A;  2AWO A;  1EY7 A;  4K14 A;  1TWC H;  2NVX H;  4A3B B;  2F4I A;  4QQB X;  3M4O H;  2UU9 L;  3PO3 B;  3NWT A;  2B29 A;  3ZYY X;  1IBK L;  4QJF A;  1VQ7 A;  3AMU A;  3K8A A;  4KY6 A;  2G9D A;  1YVC A;  1AFP A;  2Z4I A;  1U4P A;  4KKS A;  1STA A;  3RD4 A;  4AYB G;  2ATW A;  2F0W A;  1TU2 B;  3CQZ H;  4GLA C;  2H4O A;  2B2U A;  3F2D A;  2EJM A;  3VYS A;  2NWG A;  4A4I A;  4DR1 Q;  1EFW A;  3OYY A;  4BBR H;  2NVX B;  1AN8 A;  2MNA A;  1MSG A;  1WD1 A;  1NBW A;  3S16 B;  5FLX c;  3RZO H;  3BG3 A;  2R61 A;  3M4O B;  3RLF A;  2I0Q A;  1N34 L;  4Q5V A;  4A3B G;  3QB3 A;  1LTR D;  3TP6 A;  1MIU A;  5C3E H;  3K58 A;  3TRZ A;  4JI0 L;  1LTT D;  3J7Z C;  1AZQ A;  4FNF A;  3PO3 G;  2K14 A;  2B2V A;  1TY0 A;  4V0B A;  1TWH H;  4ODG A;  4QUF A;  3NEM A;  1JWS D;  2RKS A;  4JI3 L;  3TQY A;  1EYA A;  1TR5 A;  1F2L A;  4DFA A;  4A3D H;  3Q0A A;  5A35 A;  1IBM Q;  2K1B A;  1EWH A;  3U4V A;  5IYB H;  1VMP A;  2B63 H;  1IZ6 A;  1CHQ D;  5C4X H;  1XMQ Q;  3GV3 A;  5C3E B;  5JPM C;  1HR0 W;  4LWC A;  4NP5 A;  3DEO A;  4UHV A;  5C4J H;  3ONA B;  4DR2 Q;  1QNK A;  4LFB Q;  1TWH B;  1G6P A;  4GLX A;  1I4R A;  4R8N A;  3HP3 A;  3A7A B;  3RMH A;  1BQQ T;  5IE8 A;  1K8O A;  5D3D A;  3D31 A;  1RL2 A;  2YV5 A;  4JK1 C;  3PIO A;  3ERO A;  1PH3 A;  1EYG A;  1KAB A;  4KHP Q;  1BOS A;  4O1N A;  3ITP A;  2X6G A;  2JA7 H;  2ZXO A;  1HZ9 A;  2VNU D;  1KAW A;  2BA1 A;  3K7A B;  2JP1 A;  5JPN C;  3RZD B;  5DAU A;  1FGU A;  5KNB A;  3X3N A;  4YCV A;  1QZH A;  5C3E G;  3GTG H;  2EOT A;  1FYC A;  3LNN A;  1G6Z A;  1PYS B;  5CV6 A;  1SNQ A;  5T1G A;  3HOZ G;  1O7Z A;  4R4I A;  1EOV A;  1SYD A;  2LMC B;  1O7I A;  1XJV A;  4KN4 C;  4FXD A;  3T1Y Q;  1UNS A;  4HJ8 A;  1OXT A;  2MGS A;  1KLG D;  5GAH C;  1STG A;  1HZC A;  1H9M A;  1KTK A;  4A3L G;  1I4Q A;  3OMC A;  4AH6 A;  3K80 C;  1Q1E A;  3ICE A;  1HA5 A;  3HKS A;  2FIN B;  1V43 A;  2XNA C;  1CQF A;  1OXS C;  4C3H H;  2DNC A;  3FP9 A;  1E1O A;  1TXY A;  2A6H C;  5C5M A;  4FF2 A;  1BDO A;  1EIY B;  4CDD C;  3F2B A;  3BZD B;  3GTG B;  2HQL A;  1UEB A;  2G9H D;  1TWF B;  4IPG A;  3S2H H;  3RUZ A;  5IT9 c;  1ET9 A;  2KEE A;  3Q23 A;  1GUG A;  4GOP A;  1LTA D;  1HZA A;  5BN4 A;  1BBX C;  1IBM L;  4OO1 I;  4XXE A;  2EY1 A;  4U67 3;  1C8C A;  1VQK A;  2QGQ A;  5FK9 C;  3P1H A;  1XMQ L;  4PMB A;  1Z6H A;  1QZG A;  4A93 H;  3MHB A;  2CW0 D;  4BA2 I;  2E75 C;  2RSN A;  3J7Y W;  2N88 A;  4DR2 L;  2XRQ D;  4PZ8 A;  3S2D B;  3BS1 A;  3W1G A;  3CCJ A;  4LFB L;  4YCW A;  1DD2 A;  2J4X A;  1D1I A;  1CKN A;  2R7D A;  1A3T A;  3KF8 B;  4RHS A;  1Q12 A;  2NBF A;  5C0X I;  3V2T A;  1EYC A;  2A19 A;  1B1Z A;  5EKI A;  2EY6 A;  2WAC A;  1CSQ A;  3GTM B;  5HY6 A;  2F0N A;  2KHI A;  2E76 C;  3OTO Q;  1QVG A;  1GXD C;  4APV A;  4KHP L;  1X3F A;  1CA5 A;  1YHQ A;  3QJY A;  4GNX B;  4FF3 A;  2CVR A;  2NVT H;  5GAD C;  4BBS H;  1HNZ Q;  2CHB D;  2PNH A;  1KDB A;  1IBL L;  3CC4 A;  3UE1 A;  5IP7 H;  3QO2 A;  5C6A A;  1WTX A;  4IUT A;  4HJA A;  1W2B A;  4TRD A;  2WAQ E;  4XT3 B;  3SE0 A;  5JJK A;  1EY9 A;  1K83 B;  1WTP A;  2OTJ A;  1I4P A;  3JAM E;  2PPB C;  3T1Y L;  2ZJQ A;  2BE5 C;  2K03 A;  2YU9 H;  4LF4 Q;  3HOX H;  3T56 B;  3A55 A;  4IJL A;  3E0E A;  4N8X 1;  1VQ6 A;  2BOS A;  4UPA A;  3HS0 C;  1QB5 D;  1CA6 A;  2MO0 A;  5ELE A;  2FXQ A;  1RKN A;  1C7Y A;  2NVT B;  2JXM B;  1JJC B;  1EIH A;  2ES2 A;  1F2M A;  3TZU A;  3U50 C;  4XQN A;  1N33 Q;  5M3F H;  1YJ9 A;  2X69 A;  3QR8 A;  5EPK A;  1IL2 A;  4F7X A;  5LL6 X;  4FDB A;  4OXP A;  5CBA E;  3D6W A;  5EBC A;  1B7Y B;  4K8I A;  3C46 A;  1KD1 C;  2Z4H A;  2LY7 A;  2GA4 B;  2IW3 A;  4RG1 A;  2YU9 B;  3GTL B;  4BY1 H;  4A3J H;  3HOV H;  3S14 H;  2VB2 X;  2K33 A;  3HZX A;  4R4T A;  4O42 A;  4HMJ A;  2NVQ H;  3MXN B;  4HSP A;  4A3E H;  3GP7 A;  3SXH A;  5C4Z A;  3PF5 A;  3G6E A;  2YTX A;  4R1J A;  3OOC A;  2EQS A;  1ILP A;  2VS1 A;  3MEF A;  3S1N H;  1VCI A;  1PHJ A;  1L0X B;  1ET6 A;  1D6E C;  1ZYR D;  1E2V A;  5M3F B;  3CMA A;  1DXM A;  4KJO A;  4DAP A;  3KJP A;  3NSW A;  2K52 A;  4DNI A;  1VF7 A;  4DR6 Q;  4CHT B;  3F2C A;  1HCZ A;  4C1N K;  3L3O C;  1PRT B;  1EZ8 A;  3MFY A;  4A3J B;  3OTO L;  3M3Y B;  3MC0 B;  4OIK A;  1RJT A;  5FO9 B;  1M90 C;  1X55 A;  1UAP A;  3F8T A;  2NVQ B;  5FLX E;  4IFD H;  1I5F A;  1GVP A;  1A8V A;  2J7Z A;  1LT4 D;  2KJX A;  3AQQ A;  3PSI A;  3C3L A;  1HA6 A;  4K6D A;  3I4M B;  2AWN A;  1CKM A;  3S1N B;  2PO4 A;  3BZK A;  1V1Q A;  1DYQ A;  1HJP A;  1SNP A;  3M7G A;  4K6L A;  4NDX A;  3C1E A;  3BJU A;  4ID6 A;  3JAM L;  5M3F G;  4H02 A;  4ZAI A;  4LF4 L;  2DY7 A;  3I4N H;  4DR3 L;  1NUC A;  3G6J B;  1V8Q A;  3NE5 B;  2OWO A;  1KQS A;  3PV0 A;  2UUA Q;  1IKL A;  1GHJ A;  1KIX A;  1HTL D;  4DV1 L;  4EQP A;  1ZYR C;  3HKZ B;  4A3J G;  2QIL A;  2O5I C;  5K36 G;  1U5K A;  4KHV A;  1IYU A;  1PYW D;  1EYD A;  1S3O A;  1PRT C;  3IKJ A;  4QB4 A;  1X3E A;  1TWA H;  3T51 B;  4OO1 G;  3PIP A;  3I4M G;  3DWQ A;  4X3S A;  1QUQ A;  2E2J H;  1AE3 A;  2K01 A;  1TWG H;  4EVO A;  1RD9 D;  1V1O A;  2KOL A;  5E7N A;  4TVA B;  4LNQ A;  5IIF A;  1HPC A;  2N3S A;  3TP7 A;  1FNU A;  4DR7 Q;  1Y14 B;  4F8M A;  2E2H B;  4KV6 A;  2JE6 I;  4DPG A;  4DUY L;  3VR5 A;  1A0I A;  5C0X G;  4FVM A;  1SYG A;  4K8J A;  1L2F A;  2K5Q A;  3HKZ G;  1WTV A;  4K5V A;  1SMY D;  4DR6 L;  1TWA B;  2D0P A;  2EYH A;  4KKU A;  2PZT A;  2UXB Q;  2JA5 H;  1BKB A;  2A74 C;  1B3Q A;  4YIJ A;  2I5H A;  2E2J B;  3D0F A;  4GKK Q;  4XIG S;  1AE2 A;  4U68 A;  1UE7 A;  3ULL A;  1Q46 A;  2K5V A;  1PTO B;  3KUP A;  1WTH A;  5FLX L;  1QVC A;  4JW0 A;  3J81 L;  4BY7 H;  4LUV A;  5ELF A;  2B2W C;  4DNR B;  2DUD A;  1ROD A;  4CKE A;  1EY8 A;  1Z7T A;  4JYA L;  4B08 A;  3J80 L;  3H0G B;  2NVY B;  3AFQ A;  4LFC Q;  4DU9 A;  3ND8 A;  2FJ2 A;  3DUZ A;  5D65 A;  2F0K A;  1J5E Q;  4CDE C;  1VQD A;  2RA4 A;  1K8M A;  3J81 i;  4RGT A;  3NWS A;  5GAE C;  4YCU A;  5IT9 E;  4YY3 Q;  3DHQ A;  1NR2 A;  2EYL A;  1QE6 A;  4HCE A;  1RTO A;  2RCF A;  2UUA L;  1Q82 C;  4MN3 A;  3UDI A;  3J80 i;  4DK6 C;  2N78 A;  1N36 Q;  1EIF A;  1UE6 A;  1F9P A;  1YNN D;  5JEA G;  1CHP D;  2B2T A;  2RSO A;  1I50 H;  5K5P A;  2B2U C;  1R9T H;  1OXU A;  4H13 C;  2XTI A;  4LF6 Q;  4YWK A;  1K8A C;  2P5Z X;  2R93 B;  2IY5 B;  5LL6 S;  1T5X D;  5LMN L;  4N9P A;  2JJQ A;  3PUW A;  1TS3 A;  1PFN A;  3H0G G;  3IFD A;  1K3B C;  4MTK A;  5BN5 A;  5JVG 3;  4HED A;  1CI3 M;  2NN6 I;  4LF8 Q;  5M3M B;  1BVS A;  5I2Y A;  5FLM G;  4DR7 L;  2EDG A;  1NNX A;  1VS0 A;  2I5M X;  3H3V H;  4LJZ C;  1ZXT A;  3GTQ H;  3TP8 A;  3WWV A;  2NTS A;  2SNS A;  1F9Q A;  1T5E A;  3IRB A;  5CV4 A;  1BCP D;  4DK0 A;  3K5M A;  3R3O A;  4DR5 Q;  1EQQ A;  2QA4 A;  1PFS A;  1Q3L A;  3MA2 B;  1S72 A;  1CSP A;  3TRE A;  2UXB L;  1X56 A;  1EWI A;  4JV5 L;  2AUK A;  1E24 A;  1G51 A;  2HCC A;  3OW7 A;  3DM1 A;  4AQY Q;  4GKK L;  2EZV A;  3TZD A;  2R93 G;  4R4C A;  2HD3 A;  5C3X A;  2L5T A;  2QW7 A;  4CGY B;  3VA7 A;  2ZJR A;  3K7U C;  5FO8 B;  1ML0 D;  1D5X C;  2ZM6 Q;  1CZW A;  5M3M G;  3T16 A;  2N8N A;  1SRO A;  1HQR D;  4OEL B;  4DV7 L;  3L0O A;  4DV2 Q;  3ND9 A;  3CRK C;  2K50 A;  1YIJ A;  1C48 A;  2MP1 A;  1BXT A;  3M4Y A;  4LFC L;  1LTB D;  3U58 A;  1FL0 A;  1DOK A;  4RKL A;  5ISR A;  4A3B H;  1VMC A;  4NB3 A;  1J5E L;  3S1M B;  3P7J A;  1X54 A;  5IT9 L;  3KYH C;  4RGN A;  3PO3 H;  2HT1 A;  3KLR A;  5IGE A;  2JA9 A;  4L63 B;  1JE4 A;  4CJ1 B;  3M4P A;  1I4G A;  1N36 L;  2E5L Q;  2YTY A;  1Q90 A;  4B3M Q;  1MI2 A;  1BCP C;  3A5Z B;  3A56 A;  1YZ6 A;  5C0X J;  1WTW A;  5KND A;  3S17 H;  3OMG A;  1KDC A;  4KY7 A;  1E2W A;  1YIT A;  4LF6 L;  5JAV A;  2VW9 A;  1VQO A;  1QVF A;  4A3C G;  1B50 A;  1UWV A;  1S5D D;  3S16 H;  3KJO A;  1SE2 A;  3OIQ A;  3V96 A;  2F0L A;  1RIP A;  4LF8 L;  2F03 A;  4CKB A;  4IUN A;  4JOI A;  1N8R C;  4UP7 A;  2K05 A;  4RKB A;  4XDX A;  3M7N A;  4IAL A;  2PZW A;  2NTT A;  2RCN A;  4DR5 L;  2BA0 A;  3S17 B;  1Q81 C;  3NTI A;  1GUS A;  4IOC A;  4RA8 A;  4ABN A;  4QGU A;  1B8A A;  1GUW A;  4GOP C;  4LMQ D;  3K81 C;  1CZG A;  5F2D A;  3S1R H;  3NEL A;  3RLO A;  1T9H A;  5A2Q E;  2IPK D;  4KD3 A;  4AQY L;  4G7O C;  3CC7 A;  2CKZ B;  2AKW B;  3VYT A;  2KEC A;  1S4Z A;  3F1Z A;  2D5D A;  3BVZ A;  3NBH B;  2ZM6 L;  3J7A F;  2Z6K A;  1PXU A;  5JEA J;  3HOZ H;  2F0Q A;  3WOF A;  3CXC A;  4MIU A;  5LMN W;  4DV2 L;  1PLF A;  3TBI B;  2MHV A;  1DGS A;  3NQT A;  5E4X A;  3OSO A;  2V1C C;  3EVQ A;  4JPB W;  4FXG C;  2D2C C;  4R4Q A;  1VQN A;  2KHJ A;  4L5T A;  1XNR Q;  1A3U A;  2NUC A;  2Y0S E;  1DCZ A;  4A3L H;  1J6Q A;  4GKJ Q;  4XYQ A;  1RDP D;  3S1R B;  1L1O A;  2KCC A;  3WOE A;  1D5M C;  1AH9 A;  1XMO Q;  5EGT A;  4JI5 Q;  5E3F A;  2IJ0 A;  1X32 A;  3KLS A;  3ULP A;  2E5L L;  3Q8D A;  4B3M L;  3K7A H;  1YHA A;  3RZD H;  3LWE A;  3HOZ B;  4P2C B;  4OWT B;  2IT1 A;  4CDF C;  2VY3 A;  1ASY A;  2Q8R E;  2D62 A;  2DNE A;  1A3V A;  2ZTE A;  1EIG A;  1BBU A;  3G71 A;  3G4S A;  1MGS A;  4A76 A;  4CJ2 C;  5COR A;  3EFX D;  4ZKC B;  2DN8 A;  5ELB A;  2N49 A;  3A8J E;  3LWU A;  2ZTC A;  4R9W A;  1NMF A;  2OQK A;  3TS2 A;  1PH2 A;  4UAI A;  1HUN A;  3D3R A;  4ZRZ A;  1WD0 A;  1IBL Q;  3EQL C;  1ILQ A;  3VA5 A;  3R93 A;  2ZT9 C;  4DF7 A;  2IHE A;  1TWF H;  3MEH A;  4ME5 A;  1CUK A;  4POG A;  2WAQ B;  3K5O A;  3HOW B;  2KA7 A;  2NZ1 D;  1SYC A;  3SEB A;  5IP9 G;  5A2Q L;  4B3R Q;  1K0S A;  3FRP B;  4P74 A;  1B70 B;  2WB1 E;  3PIP 3;  1YBY A;  1EL0 A;  3VR6 A;  1HNX Q;  4ZCK A;  3DLL A;  2R6G A;  5BR8 Q;  1M1K C;  3KF6 B;  2AMC B;  2IHF A;  2WFW A;  3I4O A;  4IJH A;  3S2D H;  3ZJY C;  2M00 A;  1BNZ A;  3MFG A;  4FO2 A;  4MZ9 A;  1LV9 A;  5HUR A;  5IOC A;  5T1I A;  3QOL A;  1H9S A;  2XVS A;  1XNR L;  3D8G A;  3GTM H;  4GKJ L;  3GTK B;  3S1Q H;  3NEN A;  1IL8 A;  2VB3 X;  4IO9 A;  4L5R C;  1XMO L;  4JI5 L;  4FF4 A;  1NSN S;  1QUQ B;  2WAQ G;  5AJ3 Q;  1JCK B;  4LUO A;  3HOW G;  1SJE D;  3NUC A;  1KRS A;  1WTR A;  4UY8 C;  1PYB A;  3MXP A;  5LHY 1;  5IGF A;  4JBM A;  2Q8I B;  1JIC A;  1I6V C;  5I9P A;  4ZQ3 A;  3PUZ A;  1XXG A;  1U4R A;  2KHS A;  3CRL C;  4C1N I;  2AHO B;  2VZA A;  3VYR A;  5CV5 A;  2K32 A;  4Y52 H;  1K83 H;  4JC0 A;  4IPH A;  4WJW A;  1H9R A;  3H6M A;  2EVB A;  3HOU B;  1E22 A;  3KDF A;  3S1Q B;  3K6O A;  1SNM A;  2MO1 A;  1X3G A;  3HG9 A;  1FR3 A;  5J39 A;  5FJ8 G;  1X9N A;  1Q86 C;  1Q8I A;  2F3I A;  4C2M B;  5AFW A;  2PQA A;  1NMG A;  3CCM A;  2ALY B;  2D9U A;  3OWE B;  3D4W A;  4HCS A;  1TS2 A;  1G2T A;  2AQ3 B;  1VQJ A;  4A3I B;  2Q2U A;  1DM0 B;  3U9S A;  3N6R A;  2OF1 A;  3I90 A;  3LGJ A;  1M4V A;  3E9I A;  2R7Z B;  3CCR A;  5KGU A;  4IUP A;  1H95 A;  1EQT A;  1SE4 A;  4MTN A;  1JE5 A;  5DM6 3;  3FEW X;  1PH6 A;  4B3R L;  2AUJ D;  4N8F A;  1U0L A;  3FPU B;  2H5X A;  1JWM D;  2A5H A;  1SYB A;  2OEO A;  2CH4 A;  3GTL H;  1YNX A;  4EGV A;  4DR3 Q;  1WTO A;  2HIX A;  1MHW C;  2HDL A;  2WKD A;  1TQO A;  2CW0 C;  4JBK A;  1QWY A;  1HNX L;  3HOU G;  4IUQ A;  5BR8 L;  4LFA Q;  4DV1 Q;  4HIO A;  3J7A V;  1BBW A;  2L15 A;  2RHQ B;  2NZH A;  5JOB A;  2XRS D;  4IPD A;  3Q6S A;  2LS0 1;  2JK8 A;  1Q7Y C;  4F88 A;  2O2L D;  2K75 A;  4A3I G;  5BN3 A;  1VQ4 A;  3I73 A;  1Y1V G;  2QCP X;  2R7Z G;  1MJE A;  4QCL A;  5DM7 3;  4O2D A;  2EYO A;  3M3Y H;  3MXG A;  5AJ3 L;  3L2P A;  5K36 H;  4YHH Q;  5FO7 B;  3QIA A;  1QCB D;  2EYJ A;  2L11 A;  4ZUI A;  3FMC A;  4DUY Q;  4OO1 H;  1I94 Q;  3I4M H;  1DON A;  1EWC A;  4B3T Q;  2PW7 A;  1EU4 A;  3W5O A;  4DUZ Q;  1D8L A;  1A63 A;  4DXF A;  2B8G A;  2R92 H;  3E3X A;  1LTI D;  4OHJ A;  3WDN A;  5ELO A;  1Y8P B;  1KNA A;  4EQ5 A;  3EBE A;  2KEN A;  3DWA A;  2WIN B;  2V4D A;  5C0X H;  3CCL A;  4M8A A;  4Y7N H;  2DJG C;  1CQV A;  2B2T C;  1IKM A;  5EQ0 A;  4J6H A;  1TKW B;  3VDY A;  2LXJ A;  4NW2 A;  2BDN A;  4IUV A;  1QIL A;  1SE3 A;  3GTJ B;  1G2S A;  1P8L A;  2MUY A;  4JYA Q;  4L6T B;  1HNW L;  4C3I B;  1NE3 A;  2K7V A;  3FKI B;  4C3J B;  1Q1B A;  4JI7 Q;  1AP0 A;  1YI2 A;  5EKK A;  1I6H H;  2KBN A;  2TMP A;  2R92 B;  3S15 B;  3I72 A;  3HOY H;  4A3K G;  4HIK A;  1KHI A;  3I91 A;  1E2Z A;  1NJI C;  2E2H H;  1LT3 D;  1VQH A;  1HXY D;  3PQI A;  3W1B A;  4B9X A;  4Y7N B;  1EQR A;  4LFA L;  4A3F H;  4QL5 A;  1JB3 A;  4JVZ A;  3JAM i;  3A8K E;  1CK1 A;  4IUU A;  5JJL A;  1OXX K;  2B3G A;  2B2Y A;  4DAY B;  3O13 A;  5GQO A;  1E0B A;  1YEZ A;  1L0Y B;  1LAC A;  3T13 A;  4E6I A;  2LFN A;  2WP8 J;  2F0J A;  1FJG Q;  4X64 Q;  5LMN Q;  1I6H B;  3FDT A;  4HJ7 A;  3HOY B;  4C3I G;  3FKI G;  5JEA H;  4C3J G;  1XTD A;  1PTO H;  4YHH L;  3CW2 C;  4M1U B;  1LTS D;  4QY7 A;  2R92 G;  4ULL A;  3HEJ A;  2KED A;  4A3F B;  4PZ6 A;  3VR2 A;  1I94 L;  3STB D;  3M4Q A;  3GO5 A;  2DJF C;  1BUV T;  4B3T L;  4MNO A;  4HAE A;  1DOL A;  4WJ4 A;  4S3S A;  4DUZ L;  4FXK C;  3H0G H;  1X65 A;  2CH4 W;  4JI8 L;  1PZJ D;  1HRJ A;  2NVY H;  1HUM A;  5FLM H;  3Q22 A;  5IOD A;  4NPS A;  2WKC A;  4JV5 Q;  5H1S E;  3EA6 A;  3T53 B;  1WTQ A;  2XSC A;  1HHV A;  3SK8 A;  4P75 A;  1GOZ A;  3UE0 A;  1G8Z D;  1K0R A;  2Z6B A;  4X65 Q;  3HFZ B;  3KF8 A;  5M5Y B;  1O7Y A;  4HMI A;  4CDC C;  3HOY G;  2B39 A;  1PTO F;  1KXL A;  2SOB A;  2PI2 E;  3GTO H;  5IYC G;  5FOB B;  1UEA B;  5IYD G;  4DV7 Q;  1VQ5 A;  4A3F G;  4KN7 C;  3SK5 A;  4DK1 A;  3PO2 H;  4PG3 A;  5CV8 A;  2R93 H;  4GNX A;  4JI7 L;  1E3P A;  3CHB D;  2VQF Q;  2A69 D;  2F0O A;  3ERQ A;  4JOI C;  4JBJ A;  5JJZ A;  1VQB A;  1TII D;  5M3M H;  4GS3 A;  2ENB A;  3AU7 A;  2I07 B;  3STB C;  1EEF D;  4OWX B;  2BH8 A;  1VQM A;  1SND A;  5C44 B;  3OHX C;  2EY5 A;  2EY2 A;  4A3M B;  1XPO A;  1SMY C;  1LUZ A;  2Q8T A;  3GTO B;  3TDQ A;  4K2L A;  3AYH B;  2A68 D;  1BO0 A;  4K5W A;  5J22 A;  3PO2 B;  1FJG L;  1K73 C;  4CJ0 B;  4X64 L;  2G5D A;  1A2U A;  3KBX A;  1Z47 A;  2X6L A;  5IGD A;  1IW7 D;  4G57 A;  2HHH L;  1G91 A;  4JI4 L;  5L37 A;  4ZK9 B;  4DK3 C;  5CGK A;  1X3Q A;  2WII B;  3MWY W;  4H44 C;  2Z6K C;  3BU2 A;  1LT6 D;  1B53 A;  2JA8 B;  4EX5 A;  1E1T A;  2A6E D;  1JMC A;  1KL9 A;  5CR3 A;  3I3C A;  3TN2 A;  1WFQ A;  2B2V C;  5EPL A;  4X6A H;  3NXW A;  3A74 A;  1VQI A;  5C3W A;  3RLN A;  4X62 L;  4A3C H;  1BR9 A;  4G4K A;  2EE1 A;  3KLW A;  5GRO A;  2AQ2 B;  4DXG A;  1VQL A;  5C44 G;  3MXN A;  2E8G A;  1BCP B;  4X3U A;  1EOT A;  2A69 C;  1S5F D;  1L1O C;  4A3M G;  3E0J A;  1LTG D;  5G3L F;  1IYJ B;  3S1M H;  2EJF C;  1EY0 A;  5ELC A;  1IHZ A;  1LLR D;  1CKO A;  5M5W H;  5CBE E;  3PO2 G;  2Q2H A;  4ZKB B;  5KIX A;  4X65 L;  5G3L D;  4HIM A;  2KCT A;  1EY4 A;  1WOC A;  1YNN C;  5M5X B;  1WVL A;  2XGT A;  3MAQ A;  1A6X A;  2PI2 A;  3DMU A;  1VQC A;  2FMC A;  2LSS A;  4K0K L;  2A68 C;  4RAU C;  3TS0 A;  1XPU A;  1A62 A;  2JA8 G;  1S5E D;  2QEX A;  1O78 A;  3VYU A;  4F87 A;  2F0D A;  2XN9 C;  1HFN A;  3CME A;  1RHP A;  1I4X A;  2UXD L;  3GTP B;  1NCV A;  2VQF L;  2ZXR A;  2Y0S B;  1O7L A;  1SFO B;  3UDX A;  2PMZ E;  4LF7 Q;  4GOP B;  5M5W B;  2A6E C;  4P72 A;  3DM3 A;  1F9S A;  1JC7 A;  3NPP A;  1VF5 C;  3GV6 A;  4RGO S;  2JEA I;  4R8I A;  1U4M A;  2Q2T A;  3W3A A;  1B4O A;  3PF4 A;  1SYF A;  2EYP A;  4ZYS A;  1J9O A;  4DA2 A;  4WOR A;  3H15 A;  1Y1W B;  1V1P A;  4KMU C;  5IGC A;  3TME A;  3IAY A;  4UP8 A;  1PA6 A;  3VR4 A;  5E4W C;  1CKN B;  3PUY A;  4P73 A;  2OTL A;  1N32 L;  4CKC A;  3C1F A;  1NAP A;  2UXC Q;  1VQP A;  2Z9H A;  3KDF B;  4J1M A;  3GD7 A;  4IPC A;  1XX8 A;  2Y0S G;  4IFD J;  1KRT A;  1PH7 A;  4ME3 A;  3UDG A;  3CCE A;  5C5L A;  2NN6 H;  4OX9 Q;  1PH8 A;  1PFM A;  2VL6 A;  1GUN A;  5IGB A;  2R7F A;  1RF2 D;  3I4L A;  3H3V C;  1FNV A;  2F0P A;  2HCI A;  1XNQ Q;  1Y1W G;  1JT8 A;  3R8B A;  3NTH A;  1JJ2 A;  4L5Q A;  3E5S A;  2JA6 G;  1SRU A;  3K0Y A;  3I55 A;  2E2I H;  2ZTD A;  2WB1 B;  4PNY A;  2R3Z A;  5KYL A;  1SE8 A;  2CWP A;  4Q0F A;  4RGM A;  3P20 A;  5EAY A;  5KNC A;  1WCM B;  1SR3 A;  4R4O A;  5IP9 H;  3A5U A;  1TWC B;  4OL7 A;  2RHS B;  3PCO B;  4HTH A;  3CP0 A;  3EIV A;  2RDG A;  1PZI D;  4DV3 Q;  4RMF A;  5KYI A;  2RDF A;  4OON A;  4DV6 Q;  3J81 c;  3R2I A;  4XQQ A;  4QIW E;  4JCV E;  4RFB A;  1W6K A;  2F0F A;  1YHB A;  3CCS A;  4J15 A;  4LF7 L;  3MTS A;  4OEM B;  4QUC A;  3J80 c;  5D14 A;  2E2I B;  1JJG A;  4ILW A;  5M9O A;  2K5D A;  3CQZ B;  3SR1 A;  1D7Q A;  1R4P B;  4NXM L;  1MJC A;  2EPB A;  1SXT A;  3PUV A;  2E74 C;  2WB1 G;  2L4N A;  2PQE A;  1BF4 A;  4BBR B;  2JEB I;  2HUG A;  2RBM A;  4K5X A;  1WCM G;  2NN6 G;  2QKI C;  3RZO B;  2IX3 A;  3HOW H;  1EY5 A;  4AYB E;  1Z9F A;  3A8I E;  1VQE A;  2OXP A;  3OW2 A;  2Z0S A;  2RVL A;  3ERS X;  1SNC A;  3L7Z C;  2UXC L;  4JI6 Q;  5J3B A;  2AQ1 B;  1WYD A;  5NUC A;  3T1H Q;  2CQO A;  2K5H A;  1M8A A;  3I7F A;  3OIP A;  4KLK A;  5CC4 A;  3K5N A;  1PV4 A;  3VR3 A;  3KLS X;  2GVA A;  1TS5 A;  3BYY B; 
#chains in the Genus database with same CATH homology
 3FPP A;  2A6H D;  1AEX A;  1TT2 A;  1RTN A;  5I9O A;  4A3D B;  3D6C A;  4QF4 A;  1ENF A;  1KLU D;  1SDF A;  2B63 B;  5C4X B;  1SEB D;  2F0M A;  1MD2 D;  3G7L A;  1C4Q A;  1EEI D;  2NYZ D;  1OXV A;  4V19 0;  2BCO A;  4HN7 A;  5C4J B;  1DJR D;  2ZXP A;  1MSH A;  1I4H A;  3H94 A;  2DY8 A;  3V05 A;  4GZY C;  4FP5 D;  2WV6 D;  2F0U A;  3QWN A;  2C5C A;  4HSV A;  1J8I A;  1JOQ A;  3NP8 A;  2IWH A;  1B44 D;  2JA7 B;  2VXW A;  1A15 A;  2PYK A;  1AZP A;  1ESF A;  4UDU C;  3MVV A;  1R4Q B;  4KKT A;  5ELD A;  4BWG B;  4DN4 M;  4L8J A;  4RCO A;  1QG7 A;  5I2X A;  2FMM A;  2Z8L A;  2BE5 D;  4KD4 A;  3HRZ C;  3MZ5 A;  5DNF A;  2K5W A;  5DEH A;  1B3A A;  2N55 A;  5COY A;  3EJI A;  2XWB B;  4KI0 A;  3TP5 A;  1LT5 D;  4C3H B;  1ZKO A;  1JOR A;  1HFG A;  1SBB B;  2PW5 A;  2B2Y C;  3S2H B;  1F77 A;  1Y1V B;  4PMC A;  2F0V A;  4IFD I;  3GQB A;  1DZ1 A;  4DGZ A;  1TY2 A;  4IQZ A;  3PUX A;  1JOK A;  1I3Q B;  2FHT A;  4A93 B;  1U9R A;  2VUM B;  4KHZ A;  1LO5 D;  4JBW A;  3D4D A;  1X3P A;  3DWP A;  1GUT A;  2O5J C;  3K57 A;  4PQX A;  3H09 A;  4LK1 C;  3F2U A;  3NQI A;  3X3M A;  3IFT A;  5E1F A;  2YYZ A;  1KNE A;  1IYV A;  4C3H G;  2F0I A;  1SYE A;  4H7B A;  4XTC S;  4WRD A;  2ICI A;  1STY A;  1KDA A;  3QG1 A;  4H0L C;  2KUM A;  3NBH A;  2K28 A;  3NTK A;  2F0S A;  2IL8 A;  1JWU D;  5J1Z A;  4BBS B;  2RDH A;  2L9H A;  3P75 A;  4TKO B;  1STH A;  4ZLT F;  3IL8 A;  5CYU A;  1TVX A;  4PV1 C;  2OT2 A;  4DNT B;  5I4D A;  2ID0 A;  1OO9 B;  1UUP A;  1B9N A;  2SDF A;  4IUR A;  1QOH A;  3HOX B;  4A3K B;  1S5B D;  2KQ3 A;  2QEJ C;  1D5Z C;  2A73 B;  2QF7 A;  2E2D C;  1SNO A;  1ENA A;  3BYT B;  4KTA A;  1PRT F;  3A7L A;  3NHH A;  3SHL A;  5HGT A;  2Z1C A;  1EY6 A;  4QMG A;  1PRT D;  1GHK A;  1FGB D;  3OPO A;  3SK6 A;  4A3G B;  4BY1 B;  3HOV B;  3S14 B;  1ICW A;  1QNU A;  4BA1 I;  4EQN A;  5KEE A;  4A3E B;  5KRU A;  3J81 E;  5I6W A;  1PDQ A;  2EXZ A;  3T4A C;  1B2T A;  4I7Z C;  3S9W A;  2B8F A;  2EYF A;  4OGQ C;  1S5C D;  3I70 A;  2LKV A;  2F0T A;  3MXU A;  5CV7 A;  3J80 E;  4KJN A;  4Z9C B;  3K5L A;  4RCN A;  1ESR A;  2L1B A;  3SVM A;  1V1P B;  4X3K A;  4DAV A;  1B9M A;  5C4H A;  3HGB A;  4C56 C;  1XWE A;  5CMD A;  1Y8O B;  5JVH 3;  5I6Y A;  4G7H C;  1DOM A;  2HQE A;  4K2K A;  3R2T A;  1Y8N B;  2K6A A;  4XT1 B;  1PMR A;  5IGG A;  4WFN 3;  1JOO A;  3KBG A;  3NK9 A;  3I4N B;  3I8Z A;  2F1M A;  5TSS A;  3CU7 A;  1JR0 D;  4X3T A;  1ENC A;  2L0C A;  4IN3 A;  1STE A;  3KK7 A;  4HR7 B;  2HDM A;  3BDO A;  4IFD G;  2PNR C;  1H9J A;  1G29 1;  2NB0 A;  3W2D A;  2XWJ B;  1JQY D;  1F2Y A;  3E6Z X;  1F9R A;  1TWG B;  1EQV A;  1PTO D;  2KCN A;  4KK7 A;  2PZU A;  1HQM C;  1FNW A;  2F0E A;  1SSO A;  2IX1 A;  2EJG C;  3D4R A;  3DXJ C;  1W6J A;  4I65 A;  3U9O A;  2PMZ B;  2BDO A;  3NBI A;  3BVG A;  1EU3 A;  5D3I B;  1GUO A;  1ZEQ X;  2L55 A;  4J8Q A;  4BS9 A;  4RH6 A;  2O4X A;  2CQA A;  2PCF B;  1KAA A;  2JA5 B;  2K04 A;  5EPJ A;  1II3 A;  1XYI A;  2M2L A;  2EYM A;  4NMZ A;  3K59 A;  1NR4 A;  1SAP A;  4TSS A;  4BY7 B;  5EKL A;  4KY5 A;  3PIO 3;  1PFB A;  3FVQ A;  2RQX A;  1LAB A;  2XIW A;  1HTP A;  5CV9 A;  2IX0 A;  4RHR A;  1D2B A;  1PTO C;  2SEB D;  4B9W A;  2I46 A;  3L9A X;  1CTM A;  3H91 A;  4MHE A;  3TSS A;  2J0T D;  2MPM A;  4ZUJ A;  3SDZ A;  4N9T A;  4LAA A;  3BDL A;  4RWS C;  1Y69 U;  1BCP F;  2FFK B;  2JYO A;  5EBD A;  2C9O A;  4NKL A;  4XYO A;  2L12 A;  1I50 B;  2H1E A;  1R9T B;  1FD7 D;  4OIJ A;  1EFI D;  2KVM A;  2F3W A;  1GJX A;  3BVM A;  3C2P A;  3CKI B;  1YNJ D;  4EQO A;  1O80 A;  1STB A;  2F0H A;  4FF1 A;  1XTC D;  3AB9 A;  3BDC A;  1AW7 A;  1IW7 C;  2M9V A;  4FYD A;  2JSO A;  3URY A;  1TS4 A;  2F0G A;  1H9S B;  4XQJ A;  4QIW B;  4PMW A;  1U4L A;  3PMF A;  3GTQ B;  1ONL A;  1QJO A;  3Q24 A;  2ICE C;  3SK4 A;  1STN A;  1PZK D;  1EZ6 A;  4G7Z C;  3QOJ A;  5EJW A;  1A2T A;  1SJH D;  3DEP A;  1F2Z A;  1MBY A;  3UI2 A;  2JA6 B;  2F3V A;  2TSS A;  1CFM A;  2SNM A;  1CM9 A;  3M85 A;  4TQU S;  1CT1 D;  4AYB B;  1RCV D;  4IZ8 A;  1VDZ A;  2QDB A;  3A54 A;  3OWF A;  3LX0 A;  4CBV A;  4DAY A;  1H9K A;  1D1K A;  2MJ8 A;  5FKA C;  1YNJ C;  2B2W A;  3N52 A;  2AWO A;  1EY7 A;  4K14 A;  4A3B B;  2F4I A;  3PO3 B;  3NWT A;  3ZYY X;  3AMU A;  4KY6 A;  2G9D A;  1AFP A;  2Z4I A;  1U4P A;  4KKS A;  1STA A;  3RD4 A;  2F0W A;  1TU2 B;  2H4O A;  2B2U A;  2EJM A;  3VYS A;  2NWG A;  2NVX B;  1AN8 A;  1MSG A;  1WD1 A;  3S16 B;  3BG3 A;  2R61 A;  3M4O B;  3RLF A;  4Q5V A;  3QB3 A;  1LTR D;  3TP6 A;  3K58 A;  1LTT D;  1AZQ A;  4FNF A;  2B2V A;  1TY0 A;  4V0B A;  4ODG A;  4QUF A;  1JWS D;  2RKS A;  1EYA A;  1TR5 A;  1F2L A;  4DFA A;  3Q0A A;  5A35 A;  2K1B A;  1EWH A;  1VMP A;  1CHQ D;  3GV3 A;  5C3E B;  5JPM C;  4NP5 A;  3DEO A;  3ONA B;  1QNK A;  1TWH B;  1I4R A;  4R8N A;  3HP3 A;  3A7A B;  3RMH A;  1BQQ T;  1K8O A;  5D3D A;  3D31 A;  4JK1 C;  3ERO A;  1KAB A;  1BOS A;  4O1N A;  3ITP A;  2X6G A;  2ZXO A;  2VNU D;  2BA1 A;  3K7A B;  2JP1 A;  5JPN C;  3RZD B;  5DAU A;  5KNB A;  3X3N A;  2EOT A;  1FYC A;  3LNN A;  1G6Z A;  5CV6 A;  1SNQ A;  5T1G A;  1O7Z A;  1SYD A;  2LMC B;  4KN4 C;  4FXD A;  1UNS A;  1OXT A;  2MGS A;  1KLG D;  1STG A;  1H9M A;  1KTK A;  1I4Q A;  3OMC A;  1Q1E A;  1HA5 A;  2FIN B;  1V43 A;  2XNA C;  1CQF A;  1OXS C;  2DNC A;  4FF2 A;  2A6H C;  5C5M A;  1BDO A;  3BZD B;  3GTG B;  2G9H D;  1TWF B;  3RUZ A;  1ET9 A;  2KEE A;  3Q23 A;  1GUG A;  1LTA D;  5BN4 A;  1BBX C;  4OO1 I;  4XXE A;  2EY1 A;  4U67 3;  1C8C A;  5FK9 C;  3P1H A;  4PMB A;  1Z6H A;  3MHB A;  2CW0 D;  4BA2 I;  2E75 C;  2RSN A;  3J7Y W;  2N88 A;  2XRQ D;  3S2D B;  3BS1 A;  1DD2 A;  2J4X A;  1D1I A;  1A3T A;  4RHS A;  1Q12 A;  2NBF A;  5C0X I;  3V2T A;  1EYC A;  1B1Z A;  5EKI A;  2EY6 A;  2WAC A;  3GTM B;  2F0N A;  2E76 C;  1GXD C;  1CA5 A;  3QJY A;  4FF3 A;  2CVR A;  2CHB D;  1KDB A;  3QO2 A;  5C6A A;  1WTX A;  4IUT A;  4TRD A;  4XT3 B;  3SE0 A;  1EY9 A;  1K83 B;  1WTP A;  1I4P A;  3JAM E;  2PPB C;  2BE5 C;  2K03 A;  3T56 B;  3A55 A;  2BOS A;  3HS0 C;  1QB5 D;  1CA6 A;  5ELE A;  1RKN A;  2NVT B;  2JXM B;  1EIH A;  1F2M A;  3TZU A;  4XQN A;  2X69 A;  5EPK A;  4F7X A;  5LL6 X;  5CBA E;  3D6W A;  5EBC A;  4K8I A;  3C46 A;  2LY7 A;  2Z4H A;  2GA4 B;  2IW3 A;  2YU9 B;  3GTL B;  2VB2 X;  2K33 A;  3HZX A;  4O42 A;  4HMJ A;  4HSP A;  3GP7 A;  3SXH A;  5C4Z A;  3OOC A;  1ILP A;  1VCI A;  1L0X B;  1ET6 A;  1D6E C;  1ZYR D;  1E2V A;  5M3F B;  1DXM A;  4KJO A;  4DAP A;  3NSW A;  1VF7 A;  4CHT B;  1HCZ A;  4C1N K;  3L3O C;  1PRT B;  1EZ8 A;  3MFY A;  4A3J B;  3M3Y B;  3MC0 B;  4OIK A;  1RJT A;  5FO9 B;  1UAP A;  2NVQ B;  5FLX E;  4IFD H;  2J7Z A;  1LT4 D;  2KJX A;  3C3L A;  1HA6 A;  4K6D A;  3I4M B;  2AWN A;  3S1N B;  2PO4 A;  1DYQ A;  1SNP A;  3M7G A;  4K6L A;  4NDX A;  3C1E A;  4ID6 A;  3JAM L;  4ZAI A;  2DY7 A;  1NUC A;  3G6J B;  1V8Q A;  3NE5 B;  3PV0 A;  1IKL A;  1GHJ A;  1HTL D;  4EQP A;  1ZYR C;  3HKZ B;  2QIL A;  2O5I C;  5K36 G;  4KHV A;  1IYU A;  1PYW D;  1EYD A;  1PRT C;  3IKJ A;  4QB4 A;  3T51 B;  4OO1 G;  3DWQ A;  4X3S A;  2K01 A;  4EVO A;  1RD9 D;  1V1O A;  2KOL A;  5IIF A;  1HPC A;  3TP7 A;  1FNU A;  4F8M A;  2E2H B;  4KV6 A;  2JE6 I;  3VR5 A;  5C0X G;  4FVM A;  1SYG A;  4K8J A;  2K5Q A;  1WTV A;  4K5V A;  1SMY D;  1TWA B;  2EYH A;  4KKU A;  2PZT A;  2A74 C;  2E2J B;  4YIJ A;  4XIG S;  4U68 A;  1PTO B;  3KUP A;  5FLX L;  3J81 L;  5ELF A;  2B2W C;  4DNR B;  1ROD A;  4CKE A;  1EY8 A;  1Z7T A;  4B08 A;  3J80 L;  3H0G B;  2NVY B;  4DU9 A;  3ND8 A;  2FJ2 A;  3DUZ A;  5D65 A;  2F0K A;  2RA4 A;  1K8M A;  4RGT A;  3NWS A;  5IT9 E;  3DHQ A;  1NR2 A;  2EYL A;  1QE6 A;  4HCE A;  1RTO A;  4MN3 A;  1F9P A;  1YNN D;  5JEA G;  1CHP D;  2B2T A;  2RSO A;  5K5P A;  2B2U C;  1OXU A;  4H13 C;  2R93 B;  5LL6 S;  1T5X D;  4N9P A;  3PUW A;  1TS3 A;  1PFN A;  3IFD A;  5BN5 A;  5JVG 3;  4HED A;  1CI3 M;  2NN6 I;  5M3M B;  5I2Y A;  2EDG A;  4LJZ C;  1ZXT A;  3TP8 A;  2NTS A;  2SNS A;  1F9Q A;  1T5E A;  5CV4 A;  1BCP D;  4DK0 A;  3K5M A;  3R3O A;  1Q3L A;  3MA2 B;  2AUK A;  3OW7 A;  2HCC A;  3DM1 A;  2EZV A;  3TZD A;  5C3X A;  2L5T A;  4CGY B;  3VA7 A;  5FO8 B;  1D5X C;  1ML0 D;  1CZW A;  3T16 A;  1HQR D;  3ND9 A;  3CRK C;  1C48 A;  2MP1 A;  1BXT A;  3M4Y A;  1LTB D;  1DOK A;  4RKL A;  5ISR A;  1VMC A;  3S1M B;  3P7J A;  5IT9 L;  4RGN A;  3KLR A;  5IGE A;  4L63 B;  1JE4 A;  4CJ1 B;  1I4G A;  1Q90 A;  1MI2 A;  1BCP C;  3A56 A;  5C0X J;  1WTW A;  5KND A;  3OMG A;  1KDC A;  4KY7 A;  1E2W A;  5JAV A;  1B50 A;  1S5D D;  1SE2 A;  3OIQ A;  3V96 A;  2F0L A;  2F03 A;  4CKB A;  4IUN A;  2K05 A;  4RKB A;  4XDX A;  3M7N A;  4IAL A;  2PZW A;  2NTT A;  2BA0 A;  3S17 B;  3NTI A;  1GUS A;  4RA8 A;  4ABN A;  1GUW A;  4LMQ D;  1CZG A;  5F2D A;  5A2Q E;  2IPK D;  4KD3 A;  4G7O C;  3VYT A;  2KEC A;  1S4Z A;  2D5D A;  3BVZ A;  3J7A F;  1PXU A;  5JEA J;  2F0Q A;  3WOF A;  4MIU A;  1PLF A;  3TBI B;  2MHV A;  3NQT A;  5E4X A;  3OSO A;  3EVQ A;  4FXG C;  2D2C C;  1A3U A;  2NUC A;  1DCZ A;  4XYQ A;  1RDP D;  3S1R B;  2KCC A;  3WOE A;  1D5M C;  5EGT A;  5E3F A;  2IJ0 A;  1X32 A;  3KLS A;  3LWE A;  3HOZ B;  4P2C B;  2IT1 A;  2Q8R E;  2D62 A;  2DNE A;  1A3V A;  1EIG A;  1MGS A;  4CJ2 C;  5COR A;  3EFX D;  4ZKC B;  2DN8 A;  5ELB A;  3A8J E;  3LWU A;  4R9W A;  4UAI A;  1HUN A;  3D3R A;  4ZRZ A;  1WD0 A;  3EQL C;  1ILQ A;  3VA5 A;  3R93 A;  2ZT9 C;  4DF7 A;  3MEH A;  4ME5 A;  2WAQ B;  3K5O A;  3HOW B;  2KA7 A;  2NZ1 D;  1SYC A;  3SEB A;  5A2Q L;  3FRP B;  3PIP 3;  1EL0 A;  3VR6 A;  2R6G A;  2M00 A;  1BNZ A;  3MFG A;  4FO2 A;  1LV9 A;  5HUR A;  5IOC A;  5T1I A;  3QOL A;  1H9S A;  2XVS A;  3D8G A;  3GTK B;  1IL8 A;  2VB3 X;  4FF4 A;  1NSN S;  1JCK B;  1SJE D;  3NUC A;  1WTR A;  3MXP A;  5LHY 1;  5IGF A;  2Q8I B;  1JIC A;  1I6V C;  5I9P A;  4ZQ3 A;  3PUZ A;  1XXG A;  1U4R A;  2KHS A;  3CRL C;  4C1N I;  3VYR A;  5CV5 A;  2K32 A;  4WJW A;  1H9R A;  3H6M A;  2EVB A;  3HOU B;  3S1Q B;  3K6O A;  1SNM A;  3HG9 A;  1FR3 A;  5J39 A;  1Q8I A;  4C2M B;  5AFW A;  2D9U A;  3OWE B;  3D4W A;  4HCS A;  1TS2 A;  1G2T A;  2AQ3 B;  4A3I B;  1DM0 B;  3U9S A;  3N6R A;  2OF1 A;  3I90 A;  1M4V A;  2R7Z B;  5KGU A;  4IUP A;  1EQT A;  1SE4 A;  5DM6 3;  3FEW X;  2AUJ D;  2A5H A;  1JWM D;  3FPU B;  1SYB A;  2OEO A;  4EGV A;  1WTO A;  2HDL A;  2WKD A;  1TQO A;  2CW0 C;  1QWY A;  4IUQ A;  3J7A V;  5JOB A;  2XRS D;  3Q6S A;  2LS0 1;  4F88 A;  2O2L D;  5BN3 A;  3I73 A;  2QCP X;  4QCL A;  5DM7 3;  2EYO A;  3MXG A;  5K36 H;  5FO7 B;  3QIA A;  1QCB D;  2EYJ A;  2L11 A;  4ZUI A;  3FMC A;  4OO1 H;  1DON A;  1EWC A;  2PW7 A;  1EU4 A;  4DXF A;  2B8G A;  1LTI D;  4OHJ A;  3WDN A;  1Y8P B;  1KNA A;  3DWA A;  2WIN B;  2V4D A;  5C0X H;  4M8A A;  1CQV A;  2B2T C;  1IKM A;  5EQ0 A;  4J6H A;  1TKW B;  4NW2 A;  2BDN A;  4IUV A;  1QIL A;  1SE3 A;  3GTJ B;  1G2S A;  2MUY A;  4L6T B;  4C3I B;  2K7V A;  3FKI B;  4C3J B;  1Q1B A;  1AP0 A;  5EKK A;  2TMP A;  2R92 B;  3S15 B;  3I72 A;  3I91 A;  1E2Z A;  1LT3 D;  1HXY D;  4B9X A;  4Y7N B;  1JB3 A;  3A8K E;  1CK1 A;  4IUU A;  1OXX K;  2B2Y A;  3O13 A;  1E0B A;  1L0Y B;  1LAC A;  3T13 A;  4E6I A;  2LFN A;  2WP8 J;  2F0J A;  1I6H B;  3FDT A;  3HOY B;  4C3I G;  5JEA H;  4C3J G;  1PTO H;  4M1U B;  1LTS D;  4ULL A;  3HEJ A;  2KED A;  4A3F B;  3VR2 A;  3GO5 A;  1BUV T;  4HAE A;  1DOL A;  4S3S A;  4FXK C;  1PZJ D;  1HRJ A;  1HUM A;  3Q22 A;  5IOD A;  2WKC A;  3EA6 A;  3T53 B;  1WTQ A;  2XSC A;  1HHV A;  3SK8 A;  1GOZ A;  1G8Z D;  3KF8 A;  5M5Y B;  1O7Y A;  4HMI A;  2B39 A;  1PTO F;  2SOB A;  5FOB B;  1UEA B;  4KN7 C;  3SK5 A;  4DK1 A;  5CV8 A;  3CHB D;  2A69 D;  2F0O A;  3ERQ A;  5JJZ A;  1TII D;  2ENB A;  3AU7 A;  2I07 B;  1EEF D;  1SND A;  5C44 B;  3OHX C;  2EY5 A;  2EY2 A;  4A3M B;  1SMY C;  2Q8T A;  3GTO B;  3TDQ A;  4K2L A;  2A68 D;  1BO0 A;  4K5W A;  5J22 A;  3PO2 B;  4CJ0 B;  1A2U A;  3KBX A;  1Z47 A;  2X6L A;  5IGD A;  1IW7 D;  4G57 A;  1G91 A;  4ZK9 B;  5CGK A;  1X3Q A;  2WII B;  3MWY W;  4H44 C;  2JA8 B;  1LT6 D;  1B53 A;  2A6E D;  5CR3 A;  3I3C A;  3TN2 A;  2B2V C;  5EPL A;  3NXW A;  5C3W A;  1BR9 A;  4G4K A;  2EE1 A;  2AQ2 B;  4DXG A;  3MXN A;  1BCP B;  4X3U A;  1EOT A;  2A69 C;  1S5F D;  3E0J A;  1LTG D;  5G3L F;  2EJF C;  1EY0 A;  5ELC A;  1IHZ A;  1LLR D;  5CBE E;  4ZKB B;  5KIX A;  5G3L D;  1EY4 A;  1YNN C;  5M5X B;  1WVL A;  3MAQ A;  1A6X A;  3DMU A;  2FMC A;  2A68 C;  4RAU C;  1S5E D;  1O78 A;  3VYU A;  4F87 A;  2F0D A;  2XN9 C;  1HFN A;  1RHP A;  1I4X A;  3GTP B;  1NCV A;  2ZXR A;  2Y0S B;  1O7L A;  1SFO B;  5M5W B;  2A6E C;  1F9S A;  1JC7 A;  3NPP A;  1VF5 C;  3GV6 A;  4RGO S;  2JEA I;  4R8I A;  1U4M A;  3W3A A;  1B4O A;  1SYF A;  2EYP A;  4ZYS A;  1J9O A;  4DA2 A;  4WOR A;  1Y1W B;  1V1P A;  4KMU C;  5IGC A;  3TME A;  3IAY A;  3VR4 A;  5E4W C;  3PUY A;  4CKC A;  3C1F A;  1NAP A;  4J1M A;  3GD7 A;  1XX8 A;  4IFD J;  5C5L A;  2NN6 H;  1PFM A;  1GUN A;  5IGB A;  1RF2 D;  3I4L A;  3H3V C;  1FNV A;  2F0P A;  2HCI A;  3R8B A;  3NTH A;  3E5S A;  3K0Y A;  2WB1 B;  4PNY A;  2R3Z A;  5KYL A;  4Q0F A;  4RGM A;  3P20 A;  5KNC A;  1WCM B;  1TWC B;  4OL7 A;  4HTH A;  2RDG A;  1PZI D;  5KYI A;  2RDF A;  3R2I A;  4XQQ A;  4RFB A;  1W6K A;  2F0F A;  3MTS A;  4QUC A;  5D14 A;  2E2I B;  4ILW A;  5M9O A;  2K5D A;  3CQZ B;  3SR1 A;  1R4P B;  2EPB A;  1SXT A;  3PUV A;  2E74 C;  2L4N A;  2PQE A;  1BF4 A;  4BBR B;  2JEB I;  2HUG A;  2RBM A;  4K5X A;  2NN6 G;  2QKI C;  3RZO B;  2IX3 A;  1EY5 A;  3A8I E;  2OXP A;  2RVL A;  1SNC A;  3L7Z C;  2AQ1 B;  5NUC A;  3OIP A;  3K5N A;  1M8A A;  5CC4 A;  3VR3 A;  3KLS X;  1TS5 A;  3BYY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...