5IGEA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igeA00
4IUNA 1AEXA 3U9OA 1A3VA 5CV7A 1SYCA 2F3VA 4K8JA 4KHVA 4N9TA 2F0VA 5CV4A 1F2MA 1STHA 5CV5A 5KGUA 2PW7A 4PNYA 5JOBA 4N9PA 5C5LA 3QB3A 4B9WA 5IGFA 4ME5A 2QDBA 2EYHA 5J22A 3DHQA 5DAUA 1EY9A 2EYFA 4F8MA 3MZ5A 5KIXA 3T16A 2OF1A 1II3A 3NP8A 1NSNS 3C1EA 3EJIA 2F0PA 3SXHA 2F0FA 1A2TA 5KYIA 5C4ZA 1TT2A 4J6HA 3TP5A 2HQEA 1SNPA 2F0TA 2WACA 3QOLA 4RKBA 3SK8A 2O4XA 4NKLA 5CV8A 5I6WA 4HMIA 5C5MA 3D8GA 1EYCA 4B9XA 1SYFA 2PZTA 2EYJA 4TRDA 4K5VA 1KABA 4EQNA 2EY6A 4F7XA 1A2UA 2EYPA 4K5XA 2SOBA 2EYLA 3EROA 4DGZA 1KDCA 2F0KA 2F0DA 4K5WA 5JAVA 1TQOA 2PZWA 4OL7A 1U9RA 2EYOA 2F0OA 1TR5A 3EVQA 4ZQ3A 2F0LA 3DMUA 1ENAA 1EY6A 1STNA 3NXWA 4K2KA 4MIUA 4QMGA 5NUCA 4EQPA 2EXZA 3BDCA 5EKLA 1EY8A 4KY6A 1F2ZA 1EYAA 4R8NA 2KQ3A 2PQEA 1STYA 1A3UA 3NUCA 5E1FA 3BDLA 3ERQA 4LAAA 5CV9A 2PYKA 3RUZA 2F0IA 5HURA 5KEEA 2OEOA 1F2YA 3E5SA 2PW5A 5C6AA 5E3FA 5IGGA 5ISRA 4KD3A 4EQOA 2EY2A 3S9WA 5EGTA 4HMJA 1JOQA 1EZ8A 1EY4A 2ENBA 4PMCA 5IGDA 4DFAA 1EY7A 5IODA 2F0HA 3QOJA 3SK5A 2F0JA 4K14A 4E6IA 3MVVA 1SYGA 3P75A 1EYDA 3PMFA 5IOCA 3NQTA 4NMZA 5K5PA 5EKKA 4K2LA 1STAA 4DU9A 5IIFA 4KJNA 4PMBA 2EYMA 1JOKA 1KDAA 4YIJA 2F3WA 4ZUJA 3LX0A 4I65A 5M9OA 4KJOA 4RKLA 3TP8A 1SNMA 3VA5A 5C3WA 3MXPA 5IGEA 2KHSA 3TP6A 5KYLA 2F0UA 4S3SA 3SR1A 5HGTA 3D4DA 4KY5A 1EY5A 4NP5A 5CGKA 4IALA 3OMCA 1EQVA 1SYDA 3D6CA 4KTAA 1KAAA 5F2DA 5C4HA 2RKSA 3C1FA 3SK4A 4QF4A 2NUCA 5I9PA 4WRDA 4KY7A 5I6YA 5IGBA 1SNCA 4H7BA 3T13A 1A3TA 3TP7A 2SNSA 3H6MA 3ITPA 3P1HA 2EY1A 1SYEA 2RBMA 2F0SA 3SHLA 5C3XA 4G57A 1STGA 5CV6A 5J1ZA 3MHBA 2LKVA 1SNDA 2F0EA 4KD4A 4HTHA 2M00A 4QB4A 1EZ6A 2F0NA 4WORA 5CC4A 1IHZA 4IZ8A 3HEJA 1SNOA 2F0MA 1NUCA 1EY0A 1SYBA 3OWFA 4NDXA 2EY5A 3V2TA 4EVOA 3MEHA 4DF7A 3TMEA 4KV6A 1RKNA 2PZUA 1ENCA 4J1MA 3OMGA 1SNQA 1STBA 2F0GA 4ODGA 5KRUA 2OXPA 3HZXA 4K8IA 5J39A 2F0WA 3NHHA 5CR3A 5I9OA 3D4WA 3OSOA 2F0QA 2SNMA 3R3OA 1JOOA 4ID6A 4K6DA 5DEHA 5IGCA 4ZUIA 1JORA 2RDFA 1KDBA 3NK9A 3SK6A
chains in the Genus database with same CATH superfamily
1TWAH 4Y7NB 1CK1A 1WTPA 3J81j 3VR6A 5GAHC 4RHSA 2L0CA 5LMNW 2JA8B 5M3FH 3PO3G 4ME5A 3QJYA 3VYSA 3MZ5A 4ZCKA 2NB0A 1J9OA 4R4TA 2WACA 2UXCQ 2WB1G 1BCPF 2MJ8A 1HA5A 4NXNQ 4JV5Q 4ZYSA 2EYJA 3F1ZA 4FXDA 5M3MH 3NBHB 4F7XA 2K50A 3EROA 2AQ3B 4B3TQ 1TWGH 1Z7TA 1PFSA 1F77A 2AUJD 4HCEA 4HJAA 1SMYD 4KN4C 3S2HH 2EYOA 4Q0FA 1PH7A 3B6YA 1EY6A 3H0GB 3KLWA 1V1PB 2HT1A 1Y69U 1JWUD 4DV5L 3PUVA 4BY1B 1CA5A 2PYKA 2HDLA 3I8ZA 1DONA 4O0AA 4DV0Q 3DXJC 4X3TA 4A93G 5ELBA 4PMCA 5C4JB 2Y0SG 4QY7A 2XGTA 3K8AA 5EKKA 5C44H 4DU9A 4C3HB 2ID0A 1V8QA 4APVA 3VA5A 4ZKBB 3NENA 2A6HC 4PZ7A 2Z9HA 2UU9Q 3DUZA 4JBWA 1KL9A 4S3SA 3PUWA 2K5HA 3PIPA 3AQQA 3OMCA 4QIWB 1HZAA 2PMZE 2Y0SB 4IPDA 1LT4D 4LUOA 3C1FA 1DJRD 3F8TA 3J7A5 4IOCA 3RN5A 3K6OA 4H13C 2M2LA 3T13A 1WTQA 1S5BD 1A15A 2MO1A 2KCCA 4HIDA 5LMUQ 1X32A 2F0SA 4OX9L 3AFQA 1SNDA 2NVYH 4BXXH 1H9JA 3PUXA 1CSPA 1YVCA 1JJ2A 5CC4A 4LF4Q 3LGJA 1NBWA 3IFDA 1XTDA 1O7YA 2XRQD 3PV0A 2HHHL 3FVQA 2OTJA 2H1EA 4C1NI 1G6PA 4BA1I 4Q5VA 2F0GA 2AWOA 5IP9G 2ZXRA 4B3TL 3GTPH 3GTMB 3BVZA 2ALYB 3M85A 1GHKA 3UE1A 3BDOA 1RD9D 4GOPC 1U4LA 1PZID 4IUNA 1VQJA 2UXCL 1YIJA 4AIMA 1W3SA 2B2YC 1TS5A 2CFMA 4LF8L 1K0SA 1I3QH 4CKCA 1YJNA 3K59A 1GKHA 4U68A 4B9WA 2SEBD 2JA7G 2EYHA 3BZDB 4A3MH 4LK1C 4HR7B 2Q8TA 4O42A 1IZ6A 2G5DA 4A75A 2B3GA 1X3FA 5LL6X 4DAPA 3TP5A 4YY3L 4GKJL 3A5ZB 2AUKA 4IFDG 2K14A 1WYDA 1Z6HA 4K0KL 4DR3Q 2EYPA 5FK9C 4A76A 1K3RA 2UUAL 4BBSB 1L1OB 3K81C 3RMHA 1T5EA 1VDZA 4MTKA 5NUCA 1KIXA 3QIAA 4I7AA 1C48A 2XNAC 5L37A 3NBIA 3I4NG 3MXUA 4L5SA 2R61A 1RDPD 1TWCB 3H0GG 3K80C 3J7AV 2XWBB 1KTKA 1HZ9A 1ZKOA 2KA7A 3PIP3 1GUNA 2LSSA 4KI0A 1EYDA 2A19A 1YITA 4RCOA 5FJ8H 4A3CH 1CM9A 3S17B 1NNXA 3T1HQ 5G3LF 1LTTD 1RHPA 5KYLA 4UHVA 3SR1A 2B2WA 3S15B 2L15A 2DJGC 3VR3A 3STBD 2NN6H 2NN6I 1LTAD 1MKHA 2NYZD 4KY7A 3ZJYC 1G291 3E0EA 4BBSG 2O5JC 3TP7A 3P1HA 5C3XA 2EY1A 4DR4L 4XIGS 2KBNA 1X6OA 1D1KA 1B3QA 3H3VH 2BE5D 3MHBA 3K5MA 1Q3LA 1EEFD 2KUMA 1EEID 4GKKL 1MIUA 2WFWA 2NWGA 4B3SQ 3MA2B 4DR2Q 3UDFA 3Q22A 3J80i 1S5ED 3JAML 4UPAA 4GOPA 5J3BA 1SNQA 3HFZB 4DK6C 1PFBA 3D31A 3OYYA 4X3KA 5LL6S 2C5CA 2F0QA 4IPHA 1Y1WG 3A5UA 3QO2A 3FKIB 2PQAA 2JA8G 1VMCA 4A3JH 1V1QA 1EQRA 3KDFA 1A62A 1MHWC 5I2XA 4A3GH 1PZKD 1R9TB 5LMNL 3GTLH 4A4IA 1VQPA 5ELNA 1IBKQ 3DEPA 1X54A 2D62A 3HOYG 4LF6L 1KD1C 3SK8A 5HGQA 1BDOA 5JJZA 2K5VA 3D8GA 3KJPA 1XNQL 2K01A 1U0LA 1SSOA 3BS1A 1A0IA 1BUVT 4LFBQ 1WCMG 5KNBA 1AE3A 2PZWA 4KMUC 4OL7A 2F0OA 1TR5A 1V9PA 2I07B 2EXZA 4HCSA 1CQVA 1SDFA 1XNRL 3BDLA 1C0AA 5FLMH 4RA8A 3KBGA 4X3UA 4K6LA 4KD3A 3BJUA 4DR3L 1HFNA 1S4ZA 4C3HG 4I7ZC 1SAPA 3R2TA 3U9SA 1U5KA 4LUZA 2LXJA 4BY7B 1UE1A 4ZRZA 4A3BH 4C3JG 2NVXH 1PTOH 5C3WA 1WVLA 2FHTA 4C1NK 1HTPA 5A35A 1JQYD 2UXDQ 1YJ9A 2DJFC 3TEHB 2F3IA 1A3TA 1ICWA 2FMCA 1YZ6A 1PRTB 4IUUA 2KHJA 3CP0A 4G4KA 1KNAA 2F0EA 1B3AA 3PUZA 1B70B 4X64Q 4B3RQ 4FF2A 3ND9A 3GTQB 2IX3A 1MJEA 1CI3M 4ALPA 2JA5G 2RHQB 1Y1VG 4ODGA 5IYDG 4A3EG 1S3OA 2R7ZB 5CR3A 1QVGA 2MFIA 4DV6L 5IYCG 3H91A 2F1MA 4ZUIA 1O78A 1I94L 1HFGA 1CSQA 5CV7A 2CKZB 1UE7A 2N88A 1LTRD 4LNQA 3QB3A 1HNWQ 1PMRA 4OWTB 3MXGA 3HOUG 1E1TA 4RWSC 5GAGC 1NR2A 4CDEC 2F0PA 5A2QL 2RDGA 4OIKA 4NKLA 5IP7H 4IFDI 1SYFA 1OTCA 4OO1I 2WKCA 2EY6A 4R4QA 3KLSA 1WOCA 4YWKA 4BBRB 2SOBA 1Y8OB 4C2MH 3HOUB 1B9NA 1ZYRD 2BH2A 1U9RA 4TQUS 2ZT9C 2JXMB 4LJZC 1D1IA 2K75A 4MIUA 1B53A 5I9OA 1GHJA 4HIMA 1D5ZC 2WB1B 2E2JB 3S2DH 1XYIA 5E3FA 2EY2A 2GVAA 1X3EA 2H4OA 3RR5A 3GTJB 3I4MB 1A6XA 3PGZA 3S1MH 4JG2A 1OXVA 2B2WC 4NXML 2EYMA 1M90C 3GQBA 2UUAQ 5M3MG 2JEBI 5E7NA 2K04A 4A3DH 1JWSD 4KY5A 5JEAJ 2FJ2A 1AFPA 5FO9B 2UUCL 1SMXA 3FPPA 4GZYC 5KNCA 4BBRG 1GUTA 3H3VI 1OXXK 4JI0L 4DR1L 2B2UA 2I46A 4OGQC 5M3MB 1XMQL 4P75A 1TIID 2KCMA 2ICIA 3E9HA 2E2HH 2KCNA 1W2BA 4NXMQ 1GD7A 1BR9A 2PMZB 4IPGA 1LLRD 3JAME 5EPLA 2B63H 2AQ2B 2B2YA 2QEJC 5CYUA 4BY1H 4UP8A 2VNUD 3I90A 1FYCA 2UXBQ 1QUQB 1B7YB 2CVRA 2VB3X 2K32A 2JA6B 3QG1A 3OPOA 4JV5L 1UEAB 5IWAQ 5C4JH 5BN3A 1YHQA 3HOYH 3KFUA 2JQOA 5K36H 3U9OA 1E0BA 1WJJA 1RJTA 3MWYW 5KGUA 2XN9C 1VF7A 2AKWB 1WCMH 5IGFA 1ILPA 4X6AH 3DHQA 1ZEQX 3M4QA 5A2QE 1CFMA 4G7ZC 1HQRD 5AJ3Q 3H94A 5E4XA 1EIFA 3VYTA 4KKUA 3CRKC 3MXNA 4FDBA 4UY8C 2PZTA 3L2PA 4K5VA 1KABA 4FYDA 4JI8Q 4C3IB 4LFCQ 4K5XA 2R7DA 2EYLA 1LUZA 1X56A 4GLAC 4JI6L 1H9SA 1SFOB 2PNRC 3FPUB 2WV6D 3RLNA 3DWQA 4CHTB 5KEEA 2GA4B 5IGGA 1EU4A 3S9WA 1H9MA 3GTMH 1ESRA 4HMJA 4JOIC 2ENBA 4OO1G 5IGDA 4DFAA 1EY7A 3UDGA 4E6IA 4B3RL 4DR2L 1UE5A 3MVVA 1SYGA 1G6ZA 3I4MG 1RF2D 3NQTA 5IIFA 4LFBL 2LFNA 1EUJA 1I3QB 1SJED 3OIQA 4RCNA 5H1SE 1I4HA 2E2DC 2YU9B 3BU2A 1BCPD 3Q0AA 2KHSA 3I4LA 5EBDA 2ICEC 3NE5B 3OIPA 2NVQB 1K73C 2PI2E 2IHFA 4FNFA 3I55A 2VQFQ 5D14A 1AN8A 2NUCA 3M4OH 1AP0A 1CA6A 4KLKA 1CKMA 3C46A 4RGNA 1E7ZA 2RSOA 3JAMi 1DCZA 2QDLA 1C9OA 1GOZA 3KLSX 3IFTA 1PLFA 3ER0A 3CHBD 2E2IH 1LABA 1Z9FA 1D6EC 2F0NA 3KLRA 4M8AA 2J0TD 4LMQD 1WTWA 2YTVA 1ONLA 1QE6A 2Z6BA 4CJ2C 2N55A 3GTKH 4NB3A 4DV2L 3TMEA 1HR0W 2CCZA 3I72A 1OO9B 5ELFA 3NWSA 3CC7A 1N9WA 2RVLA 2NN6G 3OSOA 4CKBA 3O13A 4MHEA 1JORA 1E24A 4OONA 1GUGA 4GKKQ 1BVSA 3KF6B 4IO9A 3D0FA 5CV4A 4HSVA 2PW7A 5CORA 5KNDA 2B29A 3CCLA 4IQZA 1X55A 1PYWD 3S15H 4A3FH 4DR7L 1IYVA 2ZJRA 2EYFA 3S16B 2VZAA 4ULLA 1AZQA 1IBLL 3SXHA 1CT1D 2F0FA 4OHJA 1SNPA 2DNEA 3BG3A 2I0QA 1BBUA 3TS0A 3T1YQ 2E76C 1TVXA 2DNCA 3FDTA 3OW7A 2IPKD 3G4SA 4KN7C 1XWEA 2ZXOA 2J4XA 4TSSA 4QMGA 3ERSX 3NXWA 4FO2A 4H02A 4P71A 3BVGA 2KQ3A 1SE2A 3W3AA 5JJIA 4CJ0B 4A3GG 1B44D 3E3XA 3SGIA 4DR5Q 5IODA 4A3LG 2F0HA 2R92H 3PF5A 1VQ9A 2NVTH 4UP9A 5IOCA 1LTLA 3R93A 2JEAI 4LF9L 1IBML 1ESFA 4YIJA 3ULPA 2HIVA 5LMUL 1NR4A 4GN4B 4A3GB 1Q7YC 4A3KB 3M7GA 2ZTDA 3D4DA 1PRTF 2WKDA 5CGKA 4IALA 2VQEL 1F2LA 1SYDA 3E6ZX 2HIXA 5HY6A 3PO3B 1KXLA 1K83B 5C4HA 1PRTD 5IGBA 4L5RC 3L3OC 1I4PA 4BY1G 5I6YA 2KVMA 3OOCA 4WJ4A 2NTSA 2TMPA 2ZJQA 1DD2A 3H6MA 2IHEA 4PG3A 1ASZA 4LF8Q 1IXRA 2M00A 1IBLQ 2C9OA 4HJ8A 2Z8LA 4DR7Q 4QUFA 1TWFB 3SEBA 5IYBH 1TU2B 5BR8L 2A68D 1XJVA 1TWHH 1IBMQ 4RGOS 1MGSA 3MFYA 1AW7A 2CHBD 5J39A 1NMFA 5C4XH 4JI5Q 2EIFA 1DOMA 2L4NA 2XSCA 1Q82C 2ZJPA 2J7ZA 3J81E 4DK0A 1A3VA 1SYCA 3N6RA 4K8JA 4OX9Q 3E0JA 2E5LQ 3L0OA 1F2MA 2OQ0A 4N9PA 4N8X1 3DLLA 3HOZB 1UWVA 2E8GA 1YNNC 1A8VA 3K7AH 1VQNA 1VQHA 2KCTA 1X9NA 2KHIA 2D9UA 3G48A 4DAMA 4JI3L 4OWXB 5IT9L 2JA5H 3M4YA 1FR3A 4LF5L 4ME3A 4EQNA 1EU3A 4OO1H 1C7YA 1W6KA 2EJMA 1UE6A 3EVQA 1GO3E 3S14H 3K5LA 4ABNA 5EKLA 5IP9H 1PH6A 1PFMA 2I5MX 5JVH3 2A5HA 2Z6KA 5C6AA 2CW0C 3GTGB 2X6LA 1XPUA 2B2VC 3K0YA 3P7JA 5FLXE 3QOJA 2NZHA 4B3SL 2L5TA 1SN8A 4K14A 1LYLA 5JPNC 1TWAB 4DNIA 4Y7NH 1JOKA 1FGUA 4ZUJA 4CDDC 5M9OA 3LX0A 5M5YH 2R6GA 1MBYA 3PF4A 1BXTA 3E9IA 2EOTA 2JP1A 3MXPA 3GV6A 4NXNL 3U58A 4XXEA 4DV7Q 4BY7G 4C3JB 1CKOA 2XRSD 2NBFA 3UI2A 3NSWA 3TDQA 2RKSA 1F9SA 1SNCA 2UUBL 2HCCA 1FJGL 1EQQA 4UP7A 2K4KA 3BZCA 3FP9A 4C2MB 3FMCA 1TWGB 5C3EH 3J80c 4A3IG 3HEJA 3H0GH 1SYBA 2ZM6L 1AZPA 4JI2Q 3UDXA 3TSSA 3IKJA 1SRUA 1Q1EA 1EIYB 2F52A 3J80L 1ASYA 5FKAC 3RLFA 1LACA 4BS9A 2Q2TA 4JBMA 4DAYA 3D4WA 2D5DA 5IGCA 1YJWA 1S72A 1WD0A 2IJ0A 1BCPC 5C44B 4DV4L 2F3VA 5CV5A 1QILA 3NTHA 3D4RA 3URYA 1D5MC 1NMGA 5C5LA 3KF6A 3F2CA 3KBXA 3GTOB 1B1ZA 4X64L 1ET9A 1EY9A 3R8BA 5C0XI 4ZAIA 1E2ZA 1II3A 3NP8A 2N3SA 2B63G 1PXUA 1SBBB 2A69C 2K5NA 1EWCA 2QCPX 3F2DA 2VUMH 5BN5A 1VMPA 2KECA 3M3YH 2ZM6Q 1FVIA 2A8VA 1HRJA 2FINB 2O2LD 2RDHA 1PH8A 4DGZA 4GKJQ 3TS2A 3OWEB 2E2HB 2Z6KC 2JSOA 2QW7A 4ZQ3A 4XQNA 1EWIA 4EVOA 1ENFA 3BDCA 1EY8A 3Q6SA 1F2ZA 1QJOA 4JBKA 4XDXA 3T51B 1EIGA 4LUVA 1FL0A 2BOSA 1VQLA 4ZK9B 1SE3A 3HS0C 3NEMA 4DN4M 1G2SA 3HOWB 3IRBA 1TS4A 4A93B 4Y52H 2QA4A 2PPBC 1H9RA 1HNZL 3U4ZA 2RCFA 2P5ZX 4LWCA 3HOVG 4YHHL 5IGEA 4BA2I 2VXWA 3X3MA 4JI6Q 4A3MB 1S5FD 3NELA 4X65Q 1PH2A 3OW2A 1XMQQ 4QGUA 1HH2P 2BA0A 4WRDA 3V96A 1XPRA 4NPSA 5ELEA 2WINB 1XXGA 2LKVA 5D65A 1KLGD 1PVOA 4B3ML 2ZTEA 4FF3A 1SFOH 3S1RB 1HNXQ 2VY3A 4ZLTF 3L9AX 1QUQA 4R9WA 1TWCH 5E4WC 4DAYB 3CCJA 2F0WA 4J15A 2A6HD 2BA1A 4KK7A 1TKWB 2VL6A 4OEMB 3UE0A 5ELCA 3T56B 2OTLA 3PUYA 4A3BG 2JA6G 1N32L 1K8OA 1DOKA 4L6TB 4XT1B 3VR4A 3HOVB 4LW1A 2JA7H 4KHVA 2IT1A 2A73B 3RZDH 3TN2A 2R93H 5JOBA 2MPMA 1PA6A 3F2UA 5IT9E 4RH6A 1A63A 1PRTC 4GLXA 1J5EQ 2VS1A 5DNFA 4A3KG 2L1BA 4OWWB 1QVCA 1A2TA 4M1UB 4J6HA 3K57A 1QZGA 3WDNA 2F0TA 2O4XA 2QKIC 5CV8A 1VQKA 4UAIA 3PIO3 1CTMA 1GJXA 3S1NH 2EQSA 1D2BA 2XTIA 1IYUA 2WB1E 5M5XH 2GVBA 4IJHA 3I3CA 2V1CC 1ENAA 1VS0A 1Y1VH 2EJFC 4A3EH 5IYDH 4R4CA 1NAPA 3GTKB 3G71A 1V43A 5E1FA 3R2IA 5CV9A 4PMWA 4ILWA 3CCEA 1K28A 3PSIA 5CMDA 2QGQA 2VQEQ 1S40A 4O1NA 5FJ8G 2Q2IA 4V0BA 2NZOA 2F0JA 3P75A 3I91A 3Q8DA 1FNUA 4A3JB 4QIWE 1PH5A 4GNXC 2Y0SE 3BYYB 1Q8IA 4YCUA 3S16H 3RZOB 3TRZA 4KTAA 3C2PA 1EQTA 1IL2A 3SK4A 4WJ3M 3W5OA 1NE3A 1OXSC 2K7VA 3HOXG 3AYHB 4H0LC 5CV6A 1I6HH 3G6JB 4IUTA 1UUPA 4YCVA 4JPBW 2F0MA 4B08A 3TQYA 3OTOL 1PYSB 2LY7A 3MEHA 1K8AC 4KV6A 4X65L 1I94Q 3IL8A 5FO8B 3FEWX 3A7AB 4GN3B 1O7IA 2F4IA 3J7YW 2YTXA 3J80E 4DV7L 5EBCA 4QL5A 2NVTB 2Q2HA 4XTCS 1UNSA 1JJGA 2D0PA 2PO4A 2JJQA 3GV3A 3I4NB 5M5WB 2IY5B 1CKNB 3CQZH 5EAYA 1Q8KA 5C0XJ 1L2FA 2N49A 4RMFA 3I56A 4JC0A 1OXUA 3T4AC 4IFDJ 3T16A 2A1AA 3PO3H 3EJIA 2UXBL 5C4ZA 4DV3L 3PO2B 3QOLA 4XQJA 1RODA 2RHSB 5C5MA 1K3BC 5C4XG 1L1OC 1LO5D 1NJIC 1NCVA 4HJ9A 3M4PA 2D0OA 2HCIA 3KJOA 1H95A 3HKZG 1PH4A 3EFXD 3LWEA 1JR0D 3EIVA 3GTQH 4FXGC 5GADC 1VQBA 4LAAA 2YV5A 4A3IB 4FF4A 1WFQA 4EQOA 1B8AA 2R7ZH 5C4XB 2CQOA 5K36G 3LNNA 2L11A 1I4XA 1E2WA 4L5TA 4KJNA 1JC7A 2MGSA 4G7HC 1XNRQ 2B2UC 4FVMA 1K9MC 5EPJA 5M3FB 3HOZH 3TZDA 1NY4A 2WIIB 1MJCA 1TS3A 2DN8A 2ZTCA 3K7AB 5DM73 2SDFA 3NTIA 4L63B 5DLQE 2FFKB 4X66Q 4IURA 1RCVD 3CKIB 1GXDC 2AMCB 2RF4A 1VQFA 3SHLA 4KHZA 4X62L 5CBAE 1EZ6A 1IHZA 3T53B 4JI4Q 1NUCA 1EY0A 4BXXG 1Y8PB 3GD7A 4LFAL 3JC66 4DPGA 1PH9A 2R93G 3K7UC 1RKNA 3D6WA 1ENCA 4J1MA 1Y8NB 3HZXA 1CZGA 5FLXc 3NHHA 5JPMC 3GTJH 3I4MH 1STEA 3STBC 3DWPA 1VQ6A 5DEHA 4X66L 4QQBX 4PV1C 3SK6A 4DAVA 1XTCD 5EKIA 5M5YB 1F9QA 1N33Q 1HA6A 5JJLA 1PTOD 3W1GA 1RTOA 3A0JA 1X3QA 3A54A 5DAUA 3CD6A 1VQ7A 4CBVA 1YHBA 3VDYA 2MNAA 4A3MG 2HQEA 3OHXC 4NW2A 2VW9A 1JCKB 4JYAL 2A6ED 3EA6A 4PQXA 4DR6Q 1Z47A 1HTLD 4JOIA 1A2UA 1SEBD 3DEOA 4IFDH 3HRZC 4K5WA 3NWTA 1SE4A 4EGVA 3G6EA 4AYBG 1M1KC 2YTYA 2B63B 1XMOQ 3CRLC 4KY6A 1VQEA 1QCBD 1YHAA 3RUZA 4R4OA 4RAUC 4RHRA 2KEEA 2F0IA 2K6AA 1F2YA 2HQLA 2CWPA 3GTPB 1VCIA 4HSPA 2CW0D 3K5NA 2HDMA 2KEDA 1ICFB 1VQ8A 4NMZA 2VUMG 4AYBB 4JBJA 4K2LA 5T1IA 1PFNA 1KDAA 4A3DG 4I65A 4KJOA 1LV9A 2JE6I 5EPKA 1Q12A 1E22A 3NTKA 1WCMB 3GTOH 1QOHA 1QNUA 2L55A 5M3FG 5F2DA 1HXYD 5BR8Q 4H7BA 4DK1A 4FF1A 4AYBE 1N8RC 2H5XA 3ITPA 4OELB 5COYA 1SYEA 4BBSH 1QG7A 4MNOA 4YCWA 1U4MA 3A56A 4JW0A 1XX8A 3CCSA 4U673 2EY5A 2PCFB 3C3LA 5GQOA 4A3LH 1EFID 2A69D 1R4QB 3AEVA 2K28A 4OXPA 4R4IA 5AJ3L 3CU7A 2SNMA 3R3OA 1UEBA 1WTXA 1SMYC 2UUBQ 3HOWH 2F4VL 5JVG3 4HJ7A 1PHJA 4DV1Q 4A93H 2OWOA 1B4OA 4JI4L 1JJCB 1AEXA 3I4OA 4MN3A 3J7AF 3D3RA 4N9TA 4JI7Q 2YU9H 1K8GA 4PZ8A 2FXQA 2D2CC 3H15A 4A3JG 2IX0A 4JVZA 4DUYL 4LF4L 2NVQH 3HKSA 2X6GA 3MTSA 2CWAA 3HGBA 3SDZA 4F8MA 2OF1A 1EOVA 1T9HA 2K1BA 3CXCA 2O5IC 3N52A 4IUPA 2I5HA 1HNZQ 1Y1WB 1PH1A 3CCUA 4RKBA 3M4OB 3CCRA 4DUYQ 4HMIA 4KKSA 1IKMA 2QF7A 1DYQA 4B9XA 4IN3A 4O2DA 1G91A 1GUOA 4V190 3J81i 2E2IB 5JAVA 3J81L 3T1YL 4CJ1B 2NZ1D 2K03A 3RD4A 3J7ZC 3S1RH 2F4VQ 2X69A 1BO0A 1S5CD 3ERQA 2LMCB 4HEDA 2UUCQ 4L5QA 3KOJA 1VQGA 3E5SA 4KHPQ 2PW5A 2DY7A 4L8JA 3PIOA 1D8LA 1JOQA 1SR3A 1EY4A 4JI1Q 3S24A 1HZCA 3ND8A 3CF5A 3A8IE 1HQMC 3NBHA 4IPCA 3FKIH 1KQSA 1LT6D 1HUMA 1ET6A 2EPBA 1OXTA 1SNMA 3U50C 3K58A 3RZDB 2R93B 1N36L 1O7ZA 1C8CA 1RL2A 1O7LA 1SLJA 3TP6A 4JYAQ 4A3FB 2LS01 1VQIA 1AH9A 1I50H 3H3VC 3D6CA 3HP3A 3S1QH 1JE5A 2WP8J 4JK1C 2DGYA 3EQLC 1VQAA 2YYZA 5JEAG 3KF8A 1EYGA 2ATWA 3A8KE 4CDCC 1N36Q 4JI5L 5D3IB 1E3PA 1M8AA 2KJXA 4JI7L 3A55A 1JE4A 2RCNA 4POGA 4HTHA 1TXYA 1Q86C 4C56C 1PH3A 4DV1L 1BCPB 4IZ8A 4DR4Q 4KKTA 4QUCA 4NDXA 4P74A 4DA2A 2RQXA 1PDQA 2UXDL 4DF7A 1PYBA 4LF6Q 3J81c 2QEXA 3PCOB 4XYQA 2OT2A 4C3IG 2QILA 1QB5D 1GUWA 1RTNA 2JN4A 3VYUA 4K6DA 1J6QA 1G51A 2RDFA 2AQ1B 1FJGQ 4IUVA 1KDBA 1HNWL 2BE5C 1PTOC 3KUPA 1YNXA 3HOXH 4BY7H 3I70A 1J5EL 1CUKA 2IWHA 1STHA 2HHHQ 4DR6L 2NVXB 2Q8IB 1FNWA 4WFN3 2QDBA 3F2BA 3ICEA 4DV6Q 4GS3A 3RZOH 1Q46A 4LF9Q 3C1EA 2LXKA 4F88A 1TT2A 3ZYYX 1JB3A 5I6WA 2GN5A 3W1BA 1N33L 3IAYA 4DR5L 4R8IA 2EE1A 1I6HB 4IOAA 1KDCA 1BOSA 1LT5D 3MC0B 1U4RA 2TSSA 4K0KQ 5GAEC 4JI1L 2E74C 1CHQD 4R1JA 4R8NA 2CQAA 1F9RA 1TWHB 3A8JE 1G8ZD 2OEOA 4IUQA 1JWMD 2EXDA 5AFWA 1BNZA 1S5DD 1YNJC 4HIKA 1JB7A 2E75C 4LFAQ 4EQ5A 4DUZL 5JJKA 1D7QA 4H44C 1LT3D 2I5LX 5C0XG 2BDNA 4TKOB 3TP8A 5M5WH 1WD1A 1EL0A 2JA8H 4ZKCB 5D3DA 2F0UA 2MQHA 1E2VA 1EY5A 3DM3A 1XPOA 3K5OA 2Z1CA 3VYRA 1WI5A 2ZXPA 3CPWA 4DV4Q 2B2TA 2IL8A 4DK3C 3PO2H 1X3GA 1B2TA 5T1GA 2JA5B 1IYJB 5G3LD 4GNXB 2MHVA 1KHIA 2SNSA 2K5WA 5IE8A 4BBRH 5J1ZA 1UAPA 4QB4A 3WOFA 5IYBG 3HKZE 3S2HB 3ULJA 4JI0Q 3S14B 3VR5A 4AQYQ 2B2VA 1XNQQ 3HG9A 3TREA 1KLUD 3WWVA 3SVMA 2E2JH 3S2DB 3H09A 2OXPA 3CW2C 4K8IA 4OIJA 3FHWA 3OTOQ 4LF5Q 1LTID 5IY0A 3NK9A 4JI3Q 4YWLA 4HIOA 1SJHD 4XQQA 4C3HH 1B9MA 1WTOA 1P8LA 1I6VC 1VQ4A 4PNYA 2HUGA 1CHPD 4A3DB 5J22A 2C35B 4C3JH 4DNRB 1B50A 1SROA 2BH8A 1MSGA 3CC4A 1YNND 2L9HA 5BN4A 3I7FA 1BBWA 3W2DA 5C44G 4CKEA 1EYCA 1MSHA 4TRDA 4RFBA 1KRSA 1E1OA 2B8GA 2NVYB 1HR0L 2F0DA 1I5FA 1QWYA 5C3EB 3U4VA 2M9VA 3ONAB 1YNJD 1STNA 4EQPA 2VB2X 1YI2A 1YBYA 1N34Q 2KENA 1EYAA 2JA6H 1SE8A 4QJFA 4GLVB 4LFCL 4JI8L 3CC2A 1HHVA 1EZ8A 3RLOA 3CCMA 1WTRA 1R4PB 1V1OA 3AU7A 1T5XD 5LMNQ 1HPCA 3M9BA 3HOYB 1KNEA 3T1HL 3GDEA 3Q23A 2R7FA 2B8FA 1BQQT 4DXGA 1STAA 5GROA 5IYCH 3A74A 1GM5A 2FMMA 4PZ6A 2WAQG 4AQYL 4P73A 4TVAB 2K5DA 3GP7A 1BF4A 3P20A 5HGTA 1DGSA 4NP5A 1KC8C 3Q24A 4WJWA 3DWAA 1VQDA 1BBXC 1VQMA 3K0XA 2WAQE 4YWMA 1EOTA 2XWJB 1FGBD 2VUMB 1GVPA 1J8IA 3M3YB 1DZ1A 2AHOB 1CZWA 5ELDA 3NPPA 2B39A 2OCEA 2MO0A 1IW7D 3X3NA 2WAQB 4C3IH 1IKLA 4LF7L 2PI2A 3BVMA 4DV2Q 4WORA 5EJWA 3MEFA 1BKBA 1D5XC 3V2TA 2IW3A 3KF8B 1STBA 2KOLA 2EZVA 4GOPB 4POFA 1HUNA 1PTOF 2Z4IA 3CMAA 3AB9A 4ID6A 4JCVE 1ZXTA 3S17H 4X62Q 4KHPL 2PQAB 3EN2A 1WTHA 2R3ZA 1JT8A 3KDFB 1IL8A 2ES2A 4DKAC 1CKNA 2K05A 2BDOA 1NSNS 4LF7Q 4MTNA 4A3FG 2L12A 3ULLA 2V4DA 3KYHC 5FOBB 5IWAL 1I4RA 2EDGA 2A6EC 2F0KA 1L0WA 3RNUA 3HOWG 1TQOA 1EFWA 1C4QA 1GUSA 5I2YA 3BZKA 3DMUA 4K2KA 1VQOA 1N32Q 2RSNA 2PQEA 5FO7B 1STYA 1QVFA 5HURA 1ML0D 3QR8A 5ISRA 1IBKL 1NTGA 2DY8A 4AH6A 3MFGA 2XIWA 4DR1Q 1MD2D 1SXTA 5IT9c 3SK5A 1VQ5A 3HOVH 3LWUA 1X65A 2R92G 3AMUA 3EBEA 5LHY1 2G9DA 2JA7B 2F3WA 4RKLA 4F87A 2B2TC 1R9TH 3V05A 1RIPA 3GTLB 3HKZB 2N8NA 2A74C 1HR0Q 1G2TA 3M7NA 1QNKA 1Y1WH 4QF4A 2XVSA 2K33A 4XYOA 2HD3A 1WTVA 4DNTB 3CCVA 4QCLA 4G7OC 1O80A 2RBMA 4YHHQ 4GNXA 4G57A 3S1NB 3TBIB 4CDFC 1PZJD 4KD4A 1L0XB 1MI2A 3SE0A 5M5XB 4N8FA 3CMEA 4HN7A 1X3PA 3FKIG 3CAMA 1Y1VB 4A3EB 3OWFA 4DXFA 1HJPA 4EX5A 3L7ZC 2R7ZG 2G9HD 1Q90A 3TZUA 3OMGA 4RGTA 5CBEE 2JK8A 2MP1A 4HAEA 4CGYB 2R92B 1JOOA 1TS2A 1VF5C 5ELOA 3BYTB 4B3MQ 4BWGB 1F9PA 5JEAH 1HCZA 3HOZG 2CH4W 1VQCA 4A3BB 1K8MA 2F0VA 1L1OA 3CCQA 1PTOB 5FLMG 1PV4A 4A3KH 1H9SB 1IW7C 5KIXA 1YEZA 1I50B 4DV0L 3S1QB 1K83H 2ASBA 5KYIA 2CH4A 2JYOA 3FRPB 3MXNB 4DV5Q 3A7LA 3I2ZA 1LTSD 2DUDA 2K52A 1H9KA 1AE2A 4J8QA 4DV3Q 3VR2A 1DXMA 2F03A 2PNHA 2RA4A 1JMCA 2F0LA 1FNVA 3MAQA 1TWFH 5DM63 5I4DA 4YY3Q 5TSSA 1HZBA 1V1PA 1A3UA 1Q1BA 3NUCA 2EJGC 4DUZQ 5EGTA 1TY0A 4Z9CB 3GO5A 3VA7A 1LTGD 2EVBA 2Q8RE 1HNXL 4JI2L 3PMFA 2VQFL 2AWNA 5K5PA 4PMBA 3HOXB 3I4NH 4IJLA 2K5QA 3CQZB 4FP5D 1DM0B 1KRTA 1EIHA 1KAWA 1U4PA 2JA9A 3JAMc 4P72A 1XMOL 3PQIA 1EQVA 2IX1A 5FLXL 1W6JA 1EWHA 1L0YB 1KAAA 1TY2A 4RGMA 5I9PA 4MZ9A 1ILQA 2Q2UA 3G7LA 3RN2A 4A3CG 2BCOA 3DM1A 3KK7A 1N34L 1JICA 1LTBD 4XT3B 1I4QA 1STGA 4UDUC 2E5LL 3NQIA 1M4VA 3HOUH 1LM0A 4FXKC 4P2CB 5EQ0A 2N78A 3AFPA 2OQKA 1SNOA 3CPFA 3WOEA 5C0XH 5C3EG 4HJ5A 1Y14B 1FD7D 2NTTA 4A3IH 5IP7G 2PZUA 3QWNA 1CQFA 5KRUA 3I73A 2A68C 3GTGH 1P16A 2MUYA 1Q81C 2Z4HA 3UDIA 1DOLA 2UU9L 1K0RA 2Z0SA 4GN5A 3S1MB 1QZHA 1ZYRC 1I4GA 4RG1A 3PO2G 4X3SA
chains in the Genus database with same CATH topology
4Y7NB 1CK1A 1WTPA 3VR6A 4RHSA 2L0CA 2JA8B 4ME5A 3QJYA 3VYSA 3MZ5A 2NB0A 1J9OA 2WACA 1BCPF 2MJ8A 1HA5A 4ZYSA 2EYJA 4FXDA 4F7XA 3EROA 2AQ3B 2AUJD 1Z7TA 4HCEA 1F77A 1SMYD 4KN4C 2EYOA 4Q0FA 1EY6A 3H0GB 1V1PB 1Y69U 1JWUD 3PUVA 4BY1B 1CA5A 2PYKA 2HDLA 3I8ZA 1DONA 3DXJC 4X3TA 5ELBA 4PMCA 5C4JB 5EKKA 4DU9A 4C3HB 2ID0A 1V8QA 3VA5A 4ZKBB 2A6HC 3DUZA 4JBWA 4S3SA 3PUWA 3OMCA 4QIWB 2Y0SB 1LT4D 3C1FA 1DJRD 3K6OA 4H13C 2M2LA 3T13A 1WTQA 1S5BD 1A15A 2KCCA 1X32A 2F0SA 1SNDA 1H9JA 3PUXA 5CC4A 3IFDA 1O7YA 2XRQD 3PV0A 3FVQA 2H1EA 4C1NI 4BA1I 4Q5VA 2F0GA 2AWOA 2ZXRA 3GTMB 3BVZA 3M85A 1GHKA 3BDOA 1RD9D 1U4LA 1PZID 4IUNA 2B2YC 1TS5A 4CKCA 3K59A 4U68A 4B9WA 2SEBD 2EYHA 3BZDB 4LK1C 4HR7B 2Q8TA 4O42A 5LL6X 4DAPA 3TP5A 2AUKA 4IFDG 1Z6HA 2EYPA 5FK9C 4BBSB 3RMHA 1T5EA 1VDZA 5NUCA 3QIAA 1C48A 2XNAC 3NBIA 3MXUA 2R61A 1RDPD 1TWCB 3J7AV 2XWBB 1KTKA 1ZKOA 2KA7A 3PIP3 1GUNA 4KI0A 1EYDA 4RCOA 1CM9A 3S17B 5G3LF 1LTTD 1RHPA 5KYLA 3SR1A 2B2WA 3S15B 3VR3A 2NN6H 2NN6I 1LTAD 2NYZD 4KY7A 1G291 2O5JC 3TP7A 3P1HA 5C3XA 2EY1A 4XIGS 1D1KA 2BE5D 3MHBA 3K5MA 1Q3LA 1EEFD 2KUMA 1EEID 2NWGA 3MA2B 3Q22A 1S5ED 3JAML 1SNQA 1PFBA 3D31A 4X3KA 5LL6S 2C5CA 2F0QA 3QO2A 3FKIB 1VMCA 5I2XA 1PZKD 1R9TB 3DEPA 2D62A 3SK8A 1BDOA 5JJZA 3D8GA 2K01A 1SSOA 3BS1A 1BUVT 5KNBA 2PZWA 4KMUC 4OL7A 2F0OA 1TR5A 2I07B 2EXZA 4HCSA 1CQVA 1SDFA 3BDLA 4RA8A 3KBGA 4X3UA 4K6LA 4KD3A 1HFNA 1S4ZA 4C3HG 4I7ZC 1SAPA 3R2TA 3U9SA 4BY7B 4ZRZA 4C3JG 1PTOH 5C3WA 1WVLA 2FHTA 4C1NK 1HTPA 5A35A 1JQYD 1A3TA 1ICWA 2FMCA 1PRTB 4IUUA 4G4KA 1KNAA 2F0EA 1B3AA 3PUZA 4FF2A 3ND9A 3GTQB 2IX3A 1CI3M 4ODGA 2R7ZB 5CR3A 3H91A 2F1MA 4ZUIA 1O78A 1HFGA 5CV7A 2N88A 1LTRD 3QB3A 1PMRA 3MXGA 4RWSC 1NR2A 2F0PA 5A2QL 2RDGA 4OIKA 4NKLA 4IFDI 1SYFA 4OO1I 2WKCA 2EY6A 3KLSA 4BBRB 2SOBA 1Y8OB 3HOUB 1B9NA 1ZYRD 1U9RA 4TQUS 2ZT9C 2JXMB 4LJZC 1D1IA 4MIUA 1B53A 5I9OA 1GHJA 1D5ZC 2WB1B 2E2JB 1XYIA 5E3FA 2EY2A 3GTJB 2H4OA 3I4MB 1A6XA 1OXVA 2B2WC 2EYMA 3GQBA 2JEBI 2K04A 1JWSD 4KY5A 5JEAJ 2FJ2A 1AFPA 5FO9B 3FPPA 4GZYC 5KNCA 1GUTA 1OXXK 2B2UA 2I46A 4OGQC 5M3MB 1TIID 2ICIA 2KCNA 1BR9A 2PMZB 1LLRD 3JAME 5EPLA 2AQ2B 2B2YA 2QEJC 5CYUA 2VNUD 3I90A 1FYCA 2CVRA 2VB3X 2K32A 2JA6B 3QG1A 3OPOA 1UEAB 5BN3A 5K36H 3U9OA 1E0BA 3MWYW 1RJTA 5KGUA 2XN9C 1VF7A 5IGFA 1ILPA 3DHQA 1ZEQX 5A2QE 1CFMA 4G7ZC 1HQRD 3H94A 5E4XA 3VYTA 4KKUA 3CRKC 3MXNA 2PZTA 4K5VA 1KABA 4FYDA 4C3IB 4K5XA 2EYLA 1H9SA 1SFOB 2PNRC 3FPUB 2WV6D 3DWQA 4CHTB 5KEEA 2GA4B 5IGGA 1EU4A 3S9WA 1H9MA 1ESRA 4HMJA 2ENBA 4OO1G 5IGDA 4DFAA 1EY7A 4E6IA 3MVVA 1SYGA 1G6ZA 1RF2D 3NQTA 5IIFA 2LFNA 1I3QB 1SJED 3OIQA 4RCNA 2YU9B 1I4HA 2E2DC 3Q0AA 1BCPD 2KHSA 3I4LA 5EBDA 2ICEC 3NE5B 3OIPA 2NVQB 4FNFA 5D14A 1AN8A 2NUCA 1AP0A 1CA6A 3C46A 4RGNA 2RSOA 1DCZA 1GOZA 3KLSX 3IFTA 1PLFA 3CHBD 1LABA 2F0NA 1D6EC 3KLRA 4M8AA 2J0TD 4LMQD 1WTWA 1ONLA 4CJ2C 1QE6A 2N55A 3TMEA 3I72A 1OO9B 5ELFA 3NWSA 2RVLA 2NN6G 3OSOA 4CKBA 3O13A 4MHEA 1JORA 1GUGA 5CV4A 4HSVA 2PW7A 5CORA 5KNDA 4IQZA 1PYWD 1IYVA 2EYFA 3S16B 4ULLA 1AZQA 3SXHA 1CT1D 2F0FA 4OHJA 1SNPA 2DNEA 3BG3A 2E76C 1TVXA 2DNCA 3FDTA 3OW7A 2IPKD 4KN7C 1XWEA 2ZXOA 2J4XA 4TSSA 4QMGA 3NXWA 4FO2A 3BVGA 2KQ3A 1SE2A 3W3AA 4CJ0B 1B44D 5IODA 2F0HA 5IOCA 3R93A 2JEAI 1ESFA 4YIJA 1NR4A 4A3GB 4A3KB 3M7GA 3D4DA 1PRTF 2WKDA 5CGKA 4IALA 1F2LA 1SYDA 3E6ZX 3PO3B 1K83B 5C4HA 1PRTD 5IGBA 3L3OC 1I4PA 5I6YA 2KVMA 3OOCA 2NTSA 2TMPA 1DD2A 3H6MA 2M00A 2C9OA 2Z8LA 4QUFA 1TWFB 3SEBA 1TU2B 2A68D 4RGOS 1MGSA 3MFYA 1AW7A 2CHBD 5J39A 1DOMA 2L4NA 2XSCA 2J7ZA 3J81E 4DK0A 1A3VA 1SYCA 3N6RA 4K8JA 3E0JA 1F2MA 4N9PA 3HOZB 1YNNC 2D9UA 5IT9L 3M4YA 1FR3A 4EQNA 1EU3A 4OO1H 1W6KA 2EJMA 3EVQA 3K5LA 4ABNA 5EKLA 1PFMA 5JVH3 2A5HA 5C6AA 2CW0C 3GTGB 2X6LA 2B2VC 3K0YA 3P7JA 5FLXE 3QOJA 2L5TA 4K14A 5JPNC 1TWAB 1JOKA 4ZUJA 5M9OA 3LX0A 2R6GA 1MBYA 1BXTA 2EOTA 2JP1A 3MXPA 3GV6A 4XXEA 4C3JB 2XRSD 2NBFA 3UI2A 3NSWA 3TDQA 2RKSA 1F9SA 1SNCA 2HCCA 4C2MB 3FMCA 1TWGB 3HEJA 1SYBA 1AZPA 3TSSA 3IKJA 1Q1EA 3J80L 5FKAC 3RLFA 1LACA 4BS9A 4DAYA 3D4WA 2D5DA 5IGCA 1WD0A 2IJ0A 1BCPC 5C44B 2F3VA 5CV5A 1QILA 3NTHA 3D4RA 3URYA 1D5MC 5C5LA 3KBXA 3GTOB 1B1ZA 1ET9A 1EY9A 3R8BA 5C0XI 4ZAIA 1E2ZA 1II3A 3NP8A 1PXUA 1SBBB 2A69C 1EWCA 2QCPX 5BN5A 1VMPA 2KECA 1HRJA 2FINB 2O2LD 2RDHA 4DGZA 3OWEB 2E2HB 2JSOA 4ZQ3A 4XQNA 4EVOA 1ENFA 3BDCA 1EY8A 3Q6SA 1F2ZA 1QJOA 4XDXA 3T51B 1EIGA 2BOSA 4ZK9B 1SE3A 3HS0C 4DN4M 1G2SA 3HOWB 1TS4A 4A93B 2PPBC 1H9RA 5IGEA 4BA2I 2VXWA 3X3MA 4A3MB 1S5FD 4WRDA 2BA0A 3V96A 5ELEA 2WINB 1XXGA 2LKVA 5D65A 1KLGD 4FF3A 3S1RB 4ZLTF 3L9AX 4R9WA 5E4WC 2F0WA 2A6HD 2BA1A 4KK7A 1TKWB 5ELCA 3T56B 3PUYA 1K8OA 1DOKA 4L6TB 4XT1B 3VR4A 3HOVB 4KHVA 2IT1A 2A73B 3TN2A 5JOBA 2MPMA 3F2UA 5IT9E 4RH6A 1PRTC 5DNFA 2L1BA 1A2TA 4M1UB 4J6HA 3K57A 3WDNA 2F0TA 2O4XA 2QKIC 5CV8A 4UAIA 3PIO3 1CTMA 1GJXA 1D2BA 1IYUA 3I3CA 1ENAA 2EJFC 1NAPA 3GTKB 1V43A 5E1FA 3R2IA 5CV9A 4PMWA 4ILWA 5CMDA 4O1NA 4V0BA 2F0JA 3P75A 3I91A 1FNUA 4A3JB 3BYYB 1Q8IA 3RZOB 4KTAA 3C2PA 1EQTA 3SK4A 1OXSC 2K7VA 4H0LC 5CV6A 3G6JB 4IUTA 1UUPA 2F0MA 4B08A 2LY7A 3MEHA 4KV6A 3IL8A 5FO8B 3FEWX 3A7AB 3J7YW 2F4IA 3J80E 5EBCA 2NVTB 4XTCS 1UNSA 2PO4A 3GV3A 3I4NB 5M5WB 5C0XJ 1OXUA 3T4AC 4IFDJ 3T16A 3EJIA 5C4ZA 3PO2B 3QOLA 4XQJA 1RODA 5C5MA 1LO5D 1NCVA 2HCIA 3EFXD 3LWEA 1JR0D 4FXGC 4LAAA 4A3IB 4FF4A 4EQOA 5C4XB 5K36G 3LNNA 2L11A 1I4XA 1E2WA 4KJNA 1JC7A 2MGSA 4G7HC 2B2UC 4FVMA 5EPJA 5M3FB 3TZDA 2WIIB 1TS3A 2DN8A 3K7AB 5DM73 2SDFA 3NTIA 4L63B 2FFKB 4IURA 1RCVD 3CKIB 1GXDC 3SHLA 4KHZA 5CBAE 1EZ6A 1IHZA 3T53B 1NUCA 1EY0A 1Y8PB 3GD7A 1RKNA 3D6WA 1ENCA 4J1MA 1Y8NB 3HZXA 1CZGA 3NHHA 5JPMC 1STEA 3DWPA 5DEHA 4PV1C 3SK6A 4DAVA 1XTCD 5EKIA 5M5YB 1F9QA 1HA6A 1PTOD 1RTOA 1X3QA 3A54A 5DAUA 4CBVA 2HQEA 3OHXC 4NW2A 1JCKB 2A6ED 3EA6A 4PQXA 1Z47A 1HTLD 1A2UA 1SEBD 3DEOA 4IFDH 3HRZC 4K5WA 3NWTA 1SE4A 4EGVA 2B63B 3CRLC 4KY6A 1QCBD 3RUZA 4RAUC 4RHRA 2KEEA 2F0IA 2K6AA 1F2YA 3GTPB 1VCIA 4HSPA 2CW0D 3K5NA 2HDMA 2KEDA 4NMZA 4AYBB 4K2LA 5T1IA 1PFNA 1KDAA 4I65A 4KJOA 1LV9A 2JE6I 5EPKA 1Q12A 3NTKA 1WCMB 1QOHA 1QNUA 2L55A 5F2DA 1HXYD 4H7BA 4DK1A 4FF1A 3ITPA 5COYA 1SYEA 1QG7A 1U4MA 3A56A 1XX8A 4U673 2EY5A 2PCFB 3C3LA 1EFID 2A69D 1R4QB 2K28A 3CU7A 2SNMA 3R3OA 1WTXA 1SMYC 5JVG3 1B4OA 1AEXA 4MN3A 3J7AF 3D3RA 4N9TA 2D2CC 2IX0A 2X6GA 3MTSA 3SDZA 3HGBA 4F8MA 2OF1A 2K1BA 2O5IC 3N52A 4IUPA 1Y1WB 4RKBA 3M4OB 4HMIA 4KKSA 1IKMA 2QF7A 1DYQA 4B9XA 4IN3A 1G91A 1GUOA 4V190 2E2IB 5JAVA 3J81L 4CJ1B 2NZ1D 2K03A 3RD4A 2X69A 1BO0A 1S5CD 3ERQA 2LMCB 4HEDA 3E5SA 2PW5A 2DY7A 4L8JA 1JOQA 1EY4A 3ND8A 3A8IE 1HQMC 3NBHA 1LT6D 1HUMA 1ET6A 2EPBA 1OXTA 1SNMA 3K58A 3RZDB 2R93B 1O7ZA 1C8CA 1O7LA 3TP6A 4A3FB 2LS01 3H3VC 3D6CA 3HP3A 2WP8J 4JK1C 3EQLC 2YYZA 5JEAG 3KF8A 3A8KE 5D3IB 1M8AA 2KJXA 3A55A 1JE4A 4HTHA 4C56C 1BCPB 4IZ8A 4KKTA 4QUCA 4NDXA 4DA2A 2RQXA 1PDQA 4DF7A 4XYQA 2OT2A 4C3IG 2QILA 1QB5D 1GUWA 1RTNA 3VYUA 4K6DA 2RDFA 2AQ1B 4IUVA 1KDBA 2BE5C 1PTOC 3KUPA 3I70A 2IWHA 1STHA 2NVXB 2Q8IB 1FNWA 4WFN3 2QDBA 3C1EA 4F88A 1TT2A 3ZYYX 1JB3A 5I6WA 3IAYA 4R8IA 2EE1A 1I6HB 1KDCA 1BOSA 1LT5D 3MC0B 1U4RA 2TSSA 2E74C 1CHQD 4R8NA 2CQAA 1F9RA 1TWHB 3A8JE 1G8ZD 2OEOA 4IUQA 1JWMD 5AFWA 1BNZA 1S5DD 1YNJC 2E75C 4H44C 1LT3D 5C0XG 2BDNA 4TKOB 3TP8A 1WD1A 1EL0A 4ZKCB 5D3DA 2F0UA 1E2VA 1EY5A 3K5OA 2Z1CA 3VYRA 2ZXPA 2B2TA 2IL8A 1B2TA 5T1GA 2JA5B 5G3LD 2MHVA 2SNSA 2K5WA 5J1ZA 1UAPA 4QB4A 3WOFA 3S2HB 3S14B 3VR5A 2B2VA 3HG9A 1KLUD 3SVMA 3S2DB 3H09A 2OXPA 4K8IA 4OIJA 1LTID 3NK9A 1SJHD 4XQQA 1B9MA 1WTOA 1I6VC 4PNYA 2HUGA 1CHPD 4A3DB 5J22A 4DNRB 1B50A 1MSGA 1YNND 2L9HA 5BN4A 3W2DA 4CKEA 1EYCA 1MSHA 4TRDA 4RFBA 2B8GA 2NVYB 2F0DA 5C3EB 1QWYA 2M9VA 3ONAB 1YNJD 1STNA 4EQPA 2VB2X 1EYAA 1HHVA 1EZ8A 1WTRA 1R4PB 1V1OA 3AU7A 1T5XD 1HPCA 3HOYB 1KNEA 3Q23A 2B8FA 1BQQT 4DXGA 1STAA 2FMMA 2K5DA 3GP7A 1BF4A 3P20A 5HGTA 4NP5A 3Q24A 4WJWA 3DWAA 1BBXC 1EOTA 2XWJB 1FGBD 2VUMB 1J8IA 3M3YB 1DZ1A 1CZWA 5ELDA 2B39A 3NPPA 1IW7D 3X3NA 2WAQB 1IKLA 3BVMA 4WORA 5EJWA 1D5XC 3V2TA 2IW3A 1STBA 2KOLA 2EZVA 1HUNA 1PTOF 2Z4IA 3AB9A 4ID6A 1ZXTA 2R3ZA 1IL8A 2K05A 2BDOA 1NSNS 2L12A 2V4DA 5FOBB 1I4RA 2EDGA 2A6EC 2F0KA 1TQOA 1C4QA 1GUSA 5I2YA 3DMUA 4K2KA 2RSNA 2PQEA 5FO7B 1STYA 5HURA 1ML0D 5ISRA 2DY8A 3MFGA 2XIWA 1MD2D 1SXTA 3SK5A 3LWUA 3AMUA 5LHY1 2G9DA 2JA7B 2F3WA 4RKLA 4F87A 2B2TC 3V05A 3GTLB 3HKZB 2A74C 1G2TA 3M7NA 1QNKA 4QF4A 2XVSA 2K33A 4XYOA 1WTVA 4DNTB 4QCLA 4G7OC 1O80A 2RBMA 4G57A 3S1NB 3TBIB 1PZJD 4KD4A 1L0XB 1MI2A 3SE0A 5M5XB 4HN7A 1X3PA 1Y1VB 4A3EB 3OWFA 4DXFA 3L7ZC 2G9HD 1Q90A 3TZUA 3OMGA 4RGTA 5CBEE 2MP1A 4HAEA 4CGYB 2R92B 1JOOA 1TS2A 1VF5C 3BYTB 4BWGB 1F9PA 5JEAH 1HCZA 4A3BB 1K8MA 2F0VA 1PTOB 1H9SB 1IW7C 5KIXA 1I50B 3S1QB 5KYIA 2JYOA 3FRPB 3A7LA 1LTSD 1H9KA 4J8QA 3VR2A 1DXMA 2F03A 2RA4A 2F0LA 1FNVA 3MAQA 5DM63 5I4DA 5TSSA 1V1PA 1A3UA 1Q1BA 3NUCA 2EJGC 5EGTA 1TY0A 4Z9CB 3GO5A 3VA7A 1LTGD 2EVBA 2Q8RE 3PMFA 2AWNA 5K5PA 4PMBA 3HOXB 2K5QA 3CQZB 4FP5D 1DM0B 1EIHA 1U4PA 1EQVA 2IX1A 5FLXL 1W6JA 1EWHA 1L0YB 1KAAA 1TY2A 4RGMA 5I9PA 1ILQA 3G7LA 2BCOA 3DM1A 3KK7A 1JICA 1LTBD 4XT3B 1I4QA 1STGA 4UDUC 3NQIA 1M4VA 4FXKC 4P2CB 5EQ0A 1SNOA 3WOEA 5C0XH 1FD7D 2NTTA 2PZUA 3QWNA 1CQFA 5KRUA 3I73A 2A68C 2MUYA 2Z4HA 1DOLA 3S1MB 1ZYRC 1I4GA 4X3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUN A;  1AEX A;  3U9O A;  1A3V A;  5CV7 A;  1SYC A;  2F3V A;  4K8J A;  4KHV A;  4N9T A;  2F0V A;  5CV4 A;  1F2M A;  1STH A;  5CV5 A;  5KGU A;  2PW7 A;  4PNY A;  5JOB A;  4N9P A;  5C5L A;  3QB3 A;  4B9W A;  5IGF A;  4ME5 A;  2QDB A;  2EYH A;  5J22 A;  3DHQ A;  5DAU A;  1EY9 A;  2EYF A;  4F8M A;  3MZ5 A;  5KIX A;  3T16 A;  2OF1 A;  1II3 A;  3NP8 A;  1NSN S;  3C1E A;  3EJI A;  2F0P A;  3SXH A;  2F0F A;  1A2T A;  5KYI A;  5C4Z A;  1TT2 A;  4J6H A;  3TP5 A;  2HQE A;  1SNP A;  2F0T A;  2WAC A;  3QOL A;  4RKB A;  3SK8 A;  2O4X A;  4NKL A;  5CV8 A;  5I6W A;  4HMI A;  5C5M A;  3D8G A;  1EYC A;  4B9X A;  1SYF A;  2PZT A;  2EYJ A;  4TRD A;  4K5V A;  1KAB A;  4EQN A;  2EY6 A;  4F7X A;  1A2U A;  2EYP A;  4K5X A;  2SOB A;  2EYL A;  3ERO A;  4DGZ A;  1KDC A;  2F0K A;  2F0D A;  4K5W A;  5JAV A;  1TQO A;  2PZW A;  4OL7 A;  1U9R A;  2EYO A;  2F0O A;  1TR5 A;  3EVQ A;  4ZQ3 A;  2F0L A;  3DMU A;  1ENA A;  1EY6 A;  1STN A;  3NXW A;  4K2K A;  4MIU A;  4QMG A;  5NUC A;  4EQP A;  2EXZ A;  3BDC A;  5EKL A;  1EY8 A;  4KY6 A;  1F2Z A;  1EYA A;  4R8N A;  2KQ3 A;  2PQE A;  1STY A;  1A3U A;  3NUC A;  5E1F A;  3BDL A;  3ERQ A;  4LAA A;  5CV9 A;  2PYK A;  3RUZ A;  2F0I A;  5HUR A;  5KEE A;  2OEO A;  1F2Y A;  3E5S A;  2PW5 A;  5C6A A;  5E3F A;  5IGG A;  5ISR A;  4KD3 A;  4EQO A;  2EY2 A;  3S9W A;  5EGT A;  4HMJ A;  1JOQ A;  1EZ8 A;  1EY4 A;  2ENB A;  4PMC A;  5IGD A;  4DFA A;  1EY7 A;  5IOD A;  2F0H A;  3QOJ A;  3SK5 A;  2F0J A;  4K14 A;  4E6I A;  3MVV A;  1SYG A;  3P75 A;  1EYD A;  3PMF A;  5IOC A;  3NQT A;  4NMZ A;  5K5P A;  5EKK A;  4K2L A;  1STA A;  4DU9 A;  5IIF A;  4KJN A;  4PMB A;  2EYM A;  1JOK A;  1KDA A;  4YIJ A;  2F3W A;  4ZUJ A;  3LX0 A;  4I65 A;  5M9O A;  4KJO A;  4RKL A;  3TP8 A;  1SNM A;  3VA5 A;  5C3W A;  3MXP A;  5IGE A;  2KHS A;  3TP6 A;  5KYL A;  2F0U A;  4S3S A;  3SR1 A;  5HGT A;  3D4D A;  4KY5 A;  1EY5 A;  4NP5 A;  5CGK A;  4IAL A;  3OMC A;  1EQV A;  1SYD A;  3D6C A;  4KTA A;  1KAA A;  5F2D A;  5C4H A;  2RKS A;  3C1F A;  3SK4 A;  4QF4 A;  2NUC A;  5I9P A;  4WRD A;  4KY7 A;  5I6Y A;  5IGB A;  1SNC A;  4H7B A;  3T13 A;  1A3T A;  3TP7 A;  2SNS A;  3H6M A;  3ITP A;  3P1H A;  2EY1 A;  1SYE A;  2RBM A;  2F0S A;  3SHL A;  5C3X A;  4G57 A;  1STG A;  5CV6 A;  5J1Z A;  3MHB A;  2LKV A;  1SND A;  2F0E A;  4KD4 A;  4HTH A;  2M00 A;  4QB4 A;  1EZ6 A;  2F0N A;  4WOR A;  5CC4 A;  1IHZ A;  4IZ8 A;  3HEJ A;  1SNO A;  2F0M A;  1NUC A;  1EY0 A;  1SYB A;  3OWF A;  4NDX A;  2EY5 A;  3V2T A;  4EVO A;  3MEH A;  4DF7 A;  3TME A;  4KV6 A;  1RKN A;  2PZU A;  1ENC A;  4J1M A;  3OMG A;  1SNQ A;  1STB A;  2F0G A;  4ODG A;  5KRU A;  2OXP A;  3HZX A;  4K8I A;  5J39 A;  2F0W A;  3NHH A;  5CR3 A;  5I9O A;  3D4W A;  3OSO A;  2F0Q A;  2SNM A;  3R3O A;  1JOO A;  4ID6 A;  4K6D A;  5DEH A;  5IGC A;  4ZUI A;  1JOR A;  2RDF A;  1KDB A;  3NK9 A;  3SK6 A; 
#chains in the Genus database with same CATH topology
 1TWA H;  4Y7N B;  1CK1 A;  1WTP A;  3J81 j;  3VR6 A;  5GAH C;  4RHS A;  2L0C A;  5LMN W;  2JA8 B;  5M3F H;  3PO3 G;  4ME5 A;  3QJY A;  3VYS A;  3MZ5 A;  4ZCK A;  2NB0 A;  1J9O A;  4R4T A;  2WAC A;  2UXC Q;  2WB1 G;  1BCP F;  2MJ8 A;  1HA5 A;  4NXN Q;  4JV5 Q;  4ZYS A;  2EYJ A;  3F1Z A;  4FXD A;  5M3M H;  3NBH B;  4F7X A;  2K50 A;  3ERO A;  2AQ3 B;  4B3T Q;  1TWG H;  1Z7T A;  1PFS A;  1F77 A;  2AUJ D;  4HCE A;  4HJA A;  1SMY D;  4KN4 C;  3S2H H;  2EYO A;  4Q0F A;  1PH7 A;  3B6Y A;  1EY6 A;  3H0G B;  3KLW A;  1V1P B;  2HT1 A;  1Y69 U;  1JWU D;  4DV5 L;  3PUV A;  4BY1 B;  1CA5 A;  2PYK A;  2HDL A;  3I8Z A;  1DON A;  4O0A A;  4DV0 Q;  3DXJ C;  4X3T A;  4A93 G;  5ELB A;  4PMC A;  5C4J B;  2Y0S G;  4QY7 A;  2XGT A;  3K8A A;  5EKK A;  5C44 H;  4DU9 A;  4C3H B;  2ID0 A;  1V8Q A;  4APV A;  3VA5 A;  4ZKB B;  3NEN A;  2A6H C;  4PZ7 A;  2Z9H A;  2UU9 Q;  3DUZ A;  4JBW A;  1KL9 A;  4S3S A;  3PUW A;  2K5H A;  3PIP A;  3AQQ A;  3OMC A;  4QIW B;  1HZA A;  2PMZ E;  2Y0S B;  4IPD A;  1LT4 D;  4LUO A;  3C1F A;  1DJR D;  3F8T A;  3J7A 5;  4IOC A;  3RN5 A;  3K6O A;  4H13 C;  2M2L A;  3T13 A;  1WTQ A;  1S5B D;  1A15 A;  2MO1 A;  2KCC A;  4HID A;  5LMU Q;  1X32 A;  2F0S A;  4OX9 L;  3AFQ A;  1SND A;  2NVY H;  4BXX H;  1H9J A;  3PUX A;  1CSP A;  1YVC A;  1JJ2 A;  5CC4 A;  4LF4 Q;  3LGJ A;  1NBW A;  3IFD A;  1XTD A;  1O7Y A;  2XRQ D;  3PV0 A;  2HHH L;  3FVQ A;  2OTJ A;  2H1E A;  4C1N I;  1G6P A;  4BA1 I;  4Q5V A;  2F0G A;  2AWO A;  5IP9 G;  2ZXR A;  4B3T L;  3GTP H;  3GTM B;  3BVZ A;  2ALY B;  3M85 A;  1GHK A;  3UE1 A;  3BDO A;  1RD9 D;  4GOP C;  1U4L A;  1PZI D;  4IUN A;  1VQJ A;  2UXC L;  1YIJ A;  4AIM A;  1W3S A;  2B2Y C;  1TS5 A;  2CFM A;  4LF8 L;  1K0S A;  1I3Q H;  4CKC A;  1YJN A;  3K59 A;  1GKH A;  4U68 A;  4B9W A;  2SEB D;  2JA7 G;  2EYH A;  3BZD B;  4A3M H;  4LK1 C;  4HR7 B;  2Q8T A;  4O42 A;  1IZ6 A;  2G5D A;  4A75 A;  2B3G A;  1X3F A;  5LL6 X;  4DAP A;  3TP5 A;  4YY3 L;  4GKJ L;  3A5Z B;  2AUK A;  4IFD G;  2K14 A;  1WYD A;  1Z6H A;  4K0K L;  4DR3 Q;  2EYP A;  5FK9 C;  4A76 A;  1K3R A;  2UUA L;  4BBS B;  1L1O B;  3K81 C;  3RMH A;  1T5E A;  1VDZ A;  4MTK A;  5NUC A;  1KIX A;  3QIA A;  4I7A A;  1C48 A;  2XNA C;  5L37 A;  3NBI A;  3I4N G;  3MXU A;  4L5S A;  2R61 A;  1RDP D;  1TWC B;  3H0G G;  3K80 C;  3J7A V;  2XWB B;  1KTK A;  1HZ9 A;  1ZKO A;  2KA7 A;  3PIP 3;  1GUN A;  2LSS A;  4KI0 A;  1EYD A;  2A19 A;  1YIT A;  4RCO A;  5FJ8 H;  4A3C H;  1CM9 A;  3S17 B;  1NNX A;  3T1H Q;  5G3L F;  1LTT D;  1RHP A;  5KYL A;  4UHV A;  3SR1 A;  2B2W A;  3S15 B;  2L15 A;  2DJG C;  3VR3 A;  3STB D;  2NN6 H;  2NN6 I;  1LTA D;  1MKH A;  2NYZ D;  4KY7 A;  3ZJY C;  1G29 1;  3E0E A;  4BBS G;  2O5J C;  3TP7 A;  3P1H A;  5C3X A;  2EY1 A;  4DR4 L;  4XIG S;  2KBN A;  1X6O A;  1D1K A;  1B3Q A;  3H3V H;  2BE5 D;  3MHB A;  3K5M A;  1Q3L A;  1EEF D;  2KUM A;  1EEI D;  4GKK L;  1MIU A;  2WFW A;  2NWG A;  4B3S Q;  3MA2 B;  4DR2 Q;  3UDF A;  3Q22 A;  3J80 i;  1S5E D;  3JAM L;  4UPA A;  4GOP A;  5J3B A;  1SNQ A;  3HFZ B;  4DK6 C;  1PFB A;  3D31 A;  3OYY A;  4X3K A;  5LL6 S;  2C5C A;  2F0Q A;  4IPH A;  1Y1W G;  3A5U A;  3QO2 A;  3FKI B;  2PQA A;  2JA8 G;  1VMC A;  4A3J H;  1V1Q A;  1EQR A;  3KDF A;  1A62 A;  1MHW C;  5I2X A;  4A3G H;  1PZK D;  1R9T B;  5LMN L;  3GTL H;  4A4I A;  1VQP A;  5ELN A;  1IBK Q;  3DEP A;  1X54 A;  2D62 A;  3HOY G;  4LF6 L;  1KD1 C;  3SK8 A;  5HGQ A;  1BDO A;  5JJZ A;  2K5V A;  3D8G A;  3KJP A;  1XNQ L;  2K01 A;  1U0L A;  1SSO A;  3BS1 A;  1A0I A;  1BUV T;  4LFB Q;  1WCM G;  5KNB A;  1AE3 A;  2PZW A;  4KMU C;  4OL7 A;  2F0O A;  1TR5 A;  1V9P A;  2I07 B;  2EXZ A;  4HCS A;  1CQV A;  1SDF A;  1XNR L;  3BDL A;  1C0A A;  5FLM H;  4RA8 A;  3KBG A;  4X3U A;  4K6L A;  4KD3 A;  3BJU A;  4DR3 L;  1HFN A;  1S4Z A;  4C3H G;  4I7Z C;  1SAP A;  3R2T A;  3U9S A;  1U5K A;  4LUZ A;  2LXJ A;  4BY7 B;  1UE1 A;  4ZRZ A;  4A3B H;  4C3J G;  2NVX H;  1PTO H;  5C3W A;  1WVL A;  2FHT A;  4C1N K;  1HTP A;  5A35 A;  1JQY D;  2UXD Q;  1YJ9 A;  2DJF C;  3TEH B;  2F3I A;  1A3T A;  1ICW A;  2FMC A;  1YZ6 A;  1PRT B;  4IUU A;  2KHJ A;  3CP0 A;  4G4K A;  1KNA A;  2F0E A;  1B3A A;  3PUZ A;  1B70 B;  4X64 Q;  4B3R Q;  4FF2 A;  3ND9 A;  3GTQ B;  2IX3 A;  1MJE A;  1CI3 M;  4ALP A;  2JA5 G;  2RHQ B;  1Y1V G;  4ODG A;  5IYD G;  4A3E G;  1S3O A;  2R7Z B;  5CR3 A;  1QVG A;  2MFI A;  4DV6 L;  5IYC G;  3H91 A;  2F1M A;  4ZUI A;  1O78 A;  1I94 L;  1HFG A;  1CSQ A;  5CV7 A;  2CKZ B;  1UE7 A;  2N88 A;  1LTR D;  4LNQ A;  3QB3 A;  1HNW Q;  1PMR A;  4OWT B;  3MXG A;  3HOU G;  1E1T A;  4RWS C;  5GAG C;  1NR2 A;  4CDE C;  2F0P A;  5A2Q L;  2RDG A;  4OIK A;  4NKL A;  5IP7 H;  4IFD I;  1SYF A;  1OTC A;  4OO1 I;  2WKC A;  2EY6 A;  4R4Q A;  3KLS A;  1WOC A;  4YWK A;  4BBR B;  2SOB A;  1Y8O B;  4C2M H;  3HOU B;  1B9N A;  1ZYR D;  2BH2 A;  1U9R A;  4TQU S;  2ZT9 C;  2JXM B;  4LJZ C;  1D1I A;  2K75 A;  4MIU A;  1B53 A;  5I9O A;  1GHJ A;  4HIM A;  1D5Z C;  2WB1 B;  2E2J B;  3S2D H;  1XYI A;  5E3F A;  2EY2 A;  2GVA A;  1X3E A;  2H4O A;  3RR5 A;  3GTJ B;  3I4M B;  1A6X A;  3PGZ A;  3S1M H;  4JG2 A;  1OXV A;  2B2W C;  4NXM L;  2EYM A;  1M90 C;  3GQB A;  2UUA Q;  5M3M G;  2JEB I;  5E7N A;  2K04 A;  4A3D H;  1JWS D;  4KY5 A;  5JEA J;  2FJ2 A;  1AFP A;  5FO9 B;  2UUC L;  1SMX A;  3FPP A;  4GZY C;  5KNC A;  4BBR G;  1GUT A;  3H3V I;  1OXX K;  4JI0 L;  4DR1 L;  2B2U A;  2I46 A;  4OGQ C;  5M3M B;  1XMQ L;  4P75 A;  1TII D;  2KCM A;  2ICI A;  3E9H A;  2E2H H;  2KCN A;  1W2B A;  4NXM Q;  1GD7 A;  1BR9 A;  2PMZ B;  4IPG A;  1LLR D;  3JAM E;  5EPL A;  2B63 H;  2AQ2 B;  2B2Y A;  2QEJ C;  5CYU A;  4BY1 H;  4UP8 A;  2VNU D;  3I90 A;  1FYC A;  2UXB Q;  1QUQ B;  1B7Y B;  2CVR A;  2VB3 X;  2K32 A;  2JA6 B;  3QG1 A;  3OPO A;  4JV5 L;  1UEA B;  5IWA Q;  5C4J H;  5BN3 A;  1YHQ A;  3HOY H;  3KFU A;  2JQO A;  5K36 H;  3U9O A;  1E0B A;  1WJJ A;  1RJT A;  3MWY W;  5KGU A;  2XN9 C;  1VF7 A;  2AKW B;  1WCM H;  5IGF A;  1ILP A;  4X6A H;  3DHQ A;  1ZEQ X;  3M4Q A;  5A2Q E;  1CFM A;  4G7Z C;  1HQR D;  5AJ3 Q;  3H94 A;  5E4X A;  1EIF A;  3VYT A;  4KKU A;  3CRK C;  3MXN A;  4FDB A;  4UY8 C;  2PZT A;  3L2P A;  4K5V A;  1KAB A;  4FYD A;  4JI8 Q;  4C3I B;  4LFC Q;  4K5X A;  2R7D A;  2EYL A;  1LUZ A;  1X56 A;  4GLA C;  4JI6 L;  1H9S A;  1SFO B;  2PNR C;  3FPU B;  2WV6 D;  3RLN A;  3DWQ A;  4CHT B;  5KEE A;  2GA4 B;  5IGG A;  1EU4 A;  3S9W A;  1H9M A;  3GTM H;  1ESR A;  4HMJ A;  4JOI C;  2ENB A;  4OO1 G;  5IGD A;  4DFA A;  1EY7 A;  3UDG A;  4E6I A;  4B3R L;  4DR2 L;  1UE5 A;  3MVV A;  1SYG A;  1G6Z A;  3I4M G;  1RF2 D;  3NQT A;  5IIF A;  4LFB L;  2LFN A;  1EUJ A;  1I3Q B;  1SJE D;  3OIQ A;  4RCN A;  5H1S E;  1I4H A;  2E2D C;  2YU9 B;  3BU2 A;  1BCP D;  3Q0A A;  2KHS A;  3I4L A;  5EBD A;  2ICE C;  3NE5 B;  3OIP A;  2NVQ B;  1K73 C;  2PI2 E;  2IHF A;  4FNF A;  3I55 A;  2VQF Q;  5D14 A;  1AN8 A;  2NUC A;  3M4O H;  1AP0 A;  1CA6 A;  4KLK A;  1CKM A;  3C46 A;  4RGN A;  1E7Z A;  2RSO A;  3JAM i;  1DCZ A;  2QDL A;  1C9O A;  1GOZ A;  3KLS X;  3IFT A;  1PLF A;  3ER0 A;  3CHB D;  2E2I H;  1LAB A;  1Z9F A;  1D6E C;  2F0N A;  3KLR A;  4M8A A;  2J0T D;  4LMQ D;  1WTW A;  2YTV A;  1ONL A;  1QE6 A;  2Z6B A;  4CJ2 C;  2N55 A;  3GTK H;  4NB3 A;  4DV2 L;  3TME A;  1HR0 W;  2CCZ A;  3I72 A;  1OO9 B;  5ELF A;  3NWS A;  3CC7 A;  1N9W A;  2RVL A;  2NN6 G;  3OSO A;  4CKB A;  3O13 A;  4MHE A;  1JOR A;  1E24 A;  4OON A;  1GUG A;  4GKK Q;  1BVS A;  3KF6 B;  4IO9 A;  3D0F A;  5CV4 A;  4HSV A;  2PW7 A;  5COR A;  5KND A;  2B29 A;  3CCL A;  4IQZ A;  1X55 A;  1PYW D;  3S15 H;  4A3F H;  4DR7 L;  1IYV A;  2ZJR A;  2EYF A;  3S16 B;  2VZA A;  4ULL A;  1AZQ A;  1IBL L;  3SXH A;  1CT1 D;  2F0F A;  4OHJ A;  1SNP A;  2DNE A;  3BG3 A;  2I0Q A;  1BBU A;  3TS0 A;  3T1Y Q;  2E76 C;  1TVX A;  2DNC A;  3FDT A;  3OW7 A;  2IPK D;  3G4S A;  4KN7 C;  1XWE A;  2ZXO A;  2J4X A;  4TSS A;  4QMG A;  3ERS X;  3NXW A;  4FO2 A;  4H02 A;  4P71 A;  3BVG A;  2KQ3 A;  1SE2 A;  3W3A A;  5JJI A;  4CJ0 B;  4A3G G;  1B44 D;  3E3X A;  3SGI A;  4DR5 Q;  5IOD A;  4A3L G;  2F0H A;  2R92 H;  3PF5 A;  1VQ9 A;  2NVT H;  4UP9 A;  5IOC A;  1LTL A;  3R93 A;  2JEA I;  4LF9 L;  1IBM L;  1ESF A;  4YIJ A;  3ULP A;  2HIV A;  5LMU L;  1NR4 A;  4GN4 B;  4A3G B;  1Q7Y C;  4A3K B;  3M7G A;  2ZTD A;  3D4D A;  1PRT F;  2WKD A;  5CGK A;  4IAL A;  2VQE L;  1F2L A;  1SYD A;  3E6Z X;  2HIX A;  5HY6 A;  3PO3 B;  1KXL A;  1K83 B;  5C4H A;  1PRT D;  5IGB A;  4L5R C;  3L3O C;  1I4P A;  4BY1 G;  5I6Y A;  2KVM A;  3OOC A;  4WJ4 A;  2NTS A;  2TMP A;  2ZJQ A;  1DD2 A;  3H6M A;  2IHE A;  4PG3 A;  1ASZ A;  4LF8 Q;  1IXR A;  2M00 A;  1IBL Q;  2C9O A;  4HJ8 A;  2Z8L A;  4DR7 Q;  4QUF A;  1TWF B;  3SEB A;  5IYB H;  1TU2 B;  5BR8 L;  2A68 D;  1XJV A;  1TWH H;  1IBM Q;  4RGO S;  1MGS A;  3MFY A;  1AW7 A;  2CHB D;  5J39 A;  1NMF A;  5C4X H;  4JI5 Q;  2EIF A;  1DOM A;  2L4N A;  2XSC A;  1Q82 C;  2ZJP A;  2J7Z A;  3J81 E;  4DK0 A;  1A3V A;  1SYC A;  3N6R A;  4K8J A;  4OX9 Q;  3E0J A;  2E5L Q;  3L0O A;  1F2M A;  2OQ0 A;  4N9P A;  4N8X 1;  3DLL A;  3HOZ B;  1UWV A;  2E8G A;  1YNN C;  1A8V A;  3K7A H;  1VQN A;  1VQH A;  2KCT A;  1X9N A;  2KHI A;  2D9U A;  3G48 A;  4DAM A;  4JI3 L;  4OWX B;  5IT9 L;  2JA5 H;  3M4Y A;  1FR3 A;  4LF5 L;  4ME3 A;  4EQN A;  1EU3 A;  4OO1 H;  1C7Y A;  1W6K A;  2EJM A;  1UE6 A;  3EVQ A;  1GO3 E;  3S14 H;  3K5L A;  4ABN A;  5EKL A;  5IP9 H;  1PH6 A;  1PFM A;  2I5M X;  5JVH 3;  2A5H A;  2Z6K A;  5C6A A;  2CW0 C;  3GTG B;  2X6L A;  1XPU A;  2B2V C;  3K0Y A;  3P7J A;  5FLX E;  3QOJ A;  2NZH A;  4B3S L;  2L5T A;  1SN8 A;  4K14 A;  1LYL A;  5JPN C;  1TWA B;  4DNI A;  4Y7N H;  1JOK A;  1FGU A;  4ZUJ A;  4CDD C;  5M9O A;  3LX0 A;  5M5Y H;  2R6G A;  1MBY A;  3PF4 A;  1BXT A;  3E9I A;  2EOT A;  2JP1 A;  3MXP A;  3GV6 A;  4NXN L;  3U58 A;  4XXE A;  4DV7 Q;  4BY7 G;  4C3J B;  1CKO A;  2XRS D;  2NBF A;  3UI2 A;  3NSW A;  3TDQ A;  2RKS A;  1F9S A;  1SNC A;  2UUB L;  2HCC A;  1FJG L;  1EQQ A;  4UP7 A;  2K4K A;  3BZC A;  3FP9 A;  4C2M B;  3FMC A;  1TWG B;  5C3E H;  3J80 c;  4A3I G;  3HEJ A;  3H0G H;  1SYB A;  2ZM6 L;  1AZP A;  4JI2 Q;  3UDX A;  3TSS A;  3IKJ A;  1SRU A;  1Q1E A;  1EIY B;  2F52 A;  3J80 L;  1ASY A;  5FKA C;  3RLF A;  1LAC A;  4BS9 A;  2Q2T A;  4JBM A;  4DAY A;  3D4W A;  2D5D A;  5IGC A;  1YJW A;  1S72 A;  1WD0 A;  2IJ0 A;  1BCP C;  5C44 B;  4DV4 L;  2F3V A;  5CV5 A;  1QIL A;  3NTH A;  3D4R A;  3URY A;  1D5M C;  1NMG A;  5C5L A;  3KF6 A;  3F2C A;  3KBX A;  3GTO B;  1B1Z A;  4X64 L;  1ET9 A;  1EY9 A;  3R8B A;  5C0X I;  4ZAI A;  1E2Z A;  1II3 A;  3NP8 A;  2N3S A;  2B63 G;  1PXU A;  1SBB B;  2A69 C;  2K5N A;  1EWC A;  2QCP X;  3F2D A;  2VUM H;  5BN5 A;  1VMP A;  2KEC A;  3M3Y H;  2ZM6 Q;  1FVI A;  2A8V A;  1HRJ A;  2FIN B;  2O2L D;  2RDH A;  1PH8 A;  4DGZ A;  4GKJ Q;  3TS2 A;  3OWE B;  2E2H B;  2Z6K C;  2JSO A;  2QW7 A;  4ZQ3 A;  4XQN A;  1EWI A;  4EVO A;  1ENF A;  3BDC A;  1EY8 A;  3Q6S A;  1F2Z A;  1QJO A;  4JBK A;  4XDX A;  3T51 B;  1EIG A;  4LUV A;  1FL0 A;  2BOS A;  1VQL A;  4ZK9 B;  1SE3 A;  3HS0 C;  3NEM A;  4DN4 M;  1G2S A;  3HOW B;  3IRB A;  1TS4 A;  4A93 B;  4Y52 H;  2QA4 A;  2PPB C;  1H9R A;  1HNZ L;  3U4Z A;  2RCF A;  2P5Z X;  4LWC A;  3HOV G;  4YHH L;  5IGE A;  4BA2 I;  2VXW A;  3X3M A;  4JI6 Q;  4A3M B;  1S5F D;  3NEL A;  4X65 Q;  1PH2 A;  3OW2 A;  1XMQ Q;  4QGU A;  1HH2 P;  2BA0 A;  4WRD A;  3V96 A;  1XPR A;  4NPS A;  5ELE A;  2WIN B;  1XXG A;  2LKV A;  5D65 A;  1KLG D;  1PVO A;  4B3M L;  2ZTE A;  4FF3 A;  1SFO H;  3S1R B;  1HNX Q;  2VY3 A;  4ZLT F;  3L9A X;  1QUQ A;  4R9W A;  1TWC H;  5E4W C;  4DAY B;  3CCJ A;  2F0W A;  4J15 A;  2A6H D;  2BA1 A;  4KK7 A;  1TKW B;  2VL6 A;  4OEM B;  3UE0 A;  5ELC A;  3T56 B;  2OTL A;  3PUY A;  4A3B G;  2JA6 G;  1N32 L;  1K8O A;  1DOK A;  4L6T B;  4XT1 B;  3VR4 A;  3HOV B;  4LW1 A;  2JA7 H;  4KHV A;  2IT1 A;  2A73 B;  3RZD H;  3TN2 A;  2R93 H;  5JOB A;  2MPM A;  1PA6 A;  3F2U A;  5IT9 E;  4RH6 A;  1A63 A;  1PRT C;  4GLX A;  1J5E Q;  2VS1 A;  5DNF A;  4A3K G;  2L1B A;  4OWW B;  1QVC A;  1A2T A;  4M1U B;  4J6H A;  3K57 A;  1QZG A;  3WDN A;  2F0T A;  2O4X A;  2QKI C;  5CV8 A;  1VQK A;  4UAI A;  3PIO 3;  1CTM A;  1GJX A;  3S1N H;  2EQS A;  1D2B A;  2XTI A;  1IYU A;  2WB1 E;  5M5X H;  2GVB A;  4IJH A;  3I3C A;  2V1C C;  1ENA A;  1VS0 A;  1Y1V H;  2EJF C;  4A3E H;  5IYD H;  4R4C A;  1NAP A;  3GTK B;  3G71 A;  1V43 A;  5E1F A;  3R2I A;  5CV9 A;  4PMW A;  4ILW A;  3CCE A;  1K28 A;  3PSI A;  5CMD A;  2QGQ A;  2VQE Q;  1S40 A;  4O1N A;  5FJ8 G;  2Q2I A;  4V0B A;  2NZO A;  2F0J A;  3P75 A;  3I91 A;  3Q8D A;  1FNU A;  4A3J B;  4QIW E;  1PH5 A;  4GNX C;  2Y0S E;  3BYY B;  1Q8I A;  4YCU A;  3S16 H;  3RZO B;  3TRZ A;  4KTA A;  3C2P A;  1EQT A;  1IL2 A;  3SK4 A;  4WJ3 M;  3W5O A;  1NE3 A;  1OXS C;  2K7V A;  3HOX G;  3AYH B;  4H0L C;  5CV6 A;  1I6H H;  3G6J B;  4IUT A;  1UUP A;  4YCV A;  4JPB W;  2F0M A;  4B08 A;  3TQY A;  3OTO L;  1PYS B;  2LY7 A;  3MEH A;  1K8A C;  4KV6 A;  4X65 L;  1I94 Q;  3IL8 A;  5FO8 B;  3FEW X;  3A7A B;  4GN3 B;  1O7I A;  2F4I A;  3J7Y W;  2YTX A;  3J80 E;  4DV7 L;  5EBC A;  4QL5 A;  2NVT B;  2Q2H A;  4XTC S;  1UNS A;  1JJG A;  2D0P A;  2PO4 A;  2JJQ A;  3GV3 A;  3I4N B;  5M5W B;  2IY5 B;  1CKN B;  3CQZ H;  5EAY A;  1Q8K A;  5C0X J;  1L2F A;  2N49 A;  4RMF A;  3I56 A;  4JC0 A;  1OXU A;  3T4A C;  4IFD J;  3T16 A;  2A1A A;  3PO3 H;  3EJI A;  2UXB L;  5C4Z A;  4DV3 L;  3PO2 B;  3QOL A;  4XQJ A;  1ROD A;  2RHS B;  5C5M A;  1K3B C;  5C4X G;  1L1O C;  1LO5 D;  1NJI C;  1NCV A;  4HJ9 A;  3M4P A;  2D0O A;  2HCI A;  3KJO A;  1H95 A;  3HKZ G;  1PH4 A;  3EFX D;  3LWE A;  1JR0 D;  3EIV A;  3GTQ H;  4FXG C;  5GAD C;  1VQB A;  4LAA A;  2YV5 A;  4A3I B;  4FF4 A;  1WFQ A;  4EQO A;  1B8A A;  2R7Z H;  5C4X B;  2CQO A;  5K36 G;  3LNN A;  2L11 A;  1I4X A;  1E2W A;  4L5T A;  4KJN A;  1JC7 A;  2MGS A;  4G7H C;  1XNR Q;  2B2U C;  4FVM A;  1K9M C;  5EPJ A;  5M3F B;  3HOZ H;  3TZD A;  1NY4 A;  2WII B;  1MJC A;  1TS3 A;  2DN8 A;  2ZTC A;  3K7A B;  5DM7 3;  2SDF A;  3NTI A;  4L63 B;  5DLQ E;  2FFK B;  4X66 Q;  4IUR A;  1RCV D;  3CKI B;  1GXD C;  2AMC B;  2RF4 A;  1VQF A;  3SHL A;  4KHZ A;  4X62 L;  5CBA E;  1EZ6 A;  1IHZ A;  3T53 B;  4JI4 Q;  1NUC A;  1EY0 A;  4BXX G;  1Y8P B;  3GD7 A;  4LFA L;  3JC6 6;  4DPG A;  1PH9 A;  2R93 G;  3K7U C;  1RKN A;  3D6W A;  1ENC A;  4J1M A;  1Y8N B;  3HZX A;  1CZG A;  5FLX c;  3NHH A;  5JPM C;  3GTJ H;  3I4M H;  1STE A;  3STB C;  3DWP A;  1VQ6 A;  5DEH A;  4X66 L;  4QQB X;  4PV1 C;  3SK6 A;  4DAV A;  1XTC D;  5EKI A;  5M5Y B;  1F9Q A;  1N33 Q;  1HA6 A;  5JJL A;  1PTO D;  3W1G A;  1RTO A;  3A0J A;  1X3Q A;  3A54 A;  5DAU A;  3CD6 A;  1VQ7 A;  4CBV A;  1YHB A;  3VDY A;  2MNA A;  4A3M G;  2HQE A;  3OHX C;  4NW2 A;  2VW9 A;  1JCK B;  4JYA L;  2A6E D;  3EA6 A;  4PQX A;  4DR6 Q;  1Z47 A;  1HTL D;  4JOI A;  1A2U A;  1SEB D;  3DEO A;  4IFD H;  3HRZ C;  4K5W A;  3NWT A;  1SE4 A;  4EGV A;  3G6E A;  4AYB G;  1M1K C;  2YTY A;  2B63 B;  1XMO Q;  3CRL C;  4KY6 A;  1VQE A;  1QCB D;  1YHA A;  3RUZ A;  4R4O A;  4RAU C;  4RHR A;  2KEE A;  2F0I A;  2K6A A;  1F2Y A;  2HQL A;  2CWP A;  3GTP B;  1VCI A;  4HSP A;  2CW0 D;  3K5N A;  2HDM A;  2KED A;  1ICF B;  1VQ8 A;  4NMZ A;  2VUM G;  4AYB B;  4JBJ A;  4K2L A;  5T1I A;  1PFN A;  1KDA A;  4A3D G;  4I65 A;  4KJO A;  1LV9 A;  2JE6 I;  5EPK A;  1Q12 A;  1E22 A;  3NTK A;  1WCM B;  3GTO H;  1QOH A;  1QNU A;  2L55 A;  5M3F G;  5F2D A;  1HXY D;  5BR8 Q;  4H7B A;  4DK1 A;  4FF1 A;  4AYB E;  1N8R C;  2H5X A;  3ITP A;  4OEL B;  5COY A;  1SYE A;  4BBS H;  1QG7 A;  4MNO A;  4YCW A;  1U4M A;  3A56 A;  4JW0 A;  1XX8 A;  3CCS A;  4U67 3;  2EY5 A;  2PCF B;  3C3L A;  5GQO A;  4A3L H;  1EFI D;  2A69 D;  1R4Q B;  3AEV A;  2K28 A;  4OXP A;  4R4I A;  5AJ3 L;  3CU7 A;  2SNM A;  3R3O A;  1UEB A;  1WTX A;  1SMY C;  2UUB Q;  3HOW H;  2F4V L;  5JVG 3;  4HJ7 A;  1PHJ A;  4DV1 Q;  4A93 H;  2OWO A;  1B4O A;  4JI4 L;  1JJC B;  1AEX A;  3I4O A;  4MN3 A;  3J7A F;  3D3R A;  4N9T A;  4JI7 Q;  2YU9 H;  1K8G A;  4PZ8 A;  2FXQ A;  2D2C C;  3H15 A;  4A3J G;  2IX0 A;  4JVZ A;  4DUY L;  4LF4 L;  2NVQ H;  3HKS A;  2X6G A;  3MTS A;  2CWA A;  3HGB A;  3SDZ A;  4F8M A;  2OF1 A;  1EOV A;  1T9H A;  2K1B A;  3CXC A;  2O5I C;  3N52 A;  4IUP A;  2I5H A;  1HNZ Q;  1Y1W B;  1PH1 A;  3CCU A;  4RKB A;  3M4O B;  3CCR A;  4DUY Q;  4HMI A;  4KKS A;  1IKM A;  2QF7 A;  1DYQ A;  4B9X A;  4IN3 A;  4O2D A;  1G91 A;  1GUO A;  4V19 0;  3J81 i;  2E2I B;  5JAV A;  3J81 L;  3T1Y L;  4CJ1 B;  2NZ1 D;  2K03 A;  3RD4 A;  3J7Z C;  3S1R H;  2F4V Q;  2X69 A;  1BO0 A;  1S5C D;  3ERQ A;  2LMC B;  4HED A;  2UUC Q;  4L5Q A;  3KOJ A;  1VQG A;  3E5S A;  4KHP Q;  2PW5 A;  2DY7 A;  4L8J A;  3PIO A;  1D8L A;  1JOQ A;  1SR3 A;  1EY4 A;  4JI1 Q;  3S24 A;  1HZC A;  3ND8 A;  3CF5 A;  3A8I E;  1HQM C;  3NBH A;  4IPC A;  3FKI H;  1KQS A;  1LT6 D;  1HUM A;  1ET6 A;  2EPB A;  1OXT A;  1SNM A;  3U50 C;  3K58 A;  3RZD B;  2R93 B;  1N36 L;  1O7Z A;  1C8C A;  1RL2 A;  1O7L A;  1SLJ A;  3TP6 A;  4JYA Q;  4A3F B;  2LS0 1;  1VQI A;  1AH9 A;  1I50 H;  3H3V C;  3D6C A;  3HP3 A;  3S1Q H;  1JE5 A;  2WP8 J;  4JK1 C;  2DGY A;  3EQL C;  1VQA A;  2YYZ A;  5JEA G;  3KF8 A;  1EYG A;  2ATW A;  3A8K E;  4CDC C;  1N36 Q;  4JI5 L;  5D3I B;  1E3P A;  1M8A A;  2KJX A;  4JI7 L;  3A55 A;  1JE4 A;  2RCN A;  4POG A;  4HTH A;  1TXY A;  1Q86 C;  4C56 C;  1PH3 A;  4DV1 L;  1BCP B;  4IZ8 A;  4DR4 Q;  4KKT A;  4QUC A;  4NDX A;  4P74 A;  4DA2 A;  2RQX A;  1PDQ A;  2UXD L;  4DF7 A;  1PYB A;  4LF6 Q;  3J81 c;  2QEX A;  3PCO B;  4XYQ A;  2OT2 A;  4C3I G;  2QIL A;  1QB5 D;  1GUW A;  1RTN A;  2JN4 A;  3VYU A;  4K6D A;  1J6Q A;  1G51 A;  2RDF A;  2AQ1 B;  1FJG Q;  4IUV A;  1KDB A;  1HNW L;  2BE5 C;  1PTO C;  3KUP A;  1YNX A;  3HOX H;  4BY7 H;  3I70 A;  1J5E L;  1CUK A;  2IWH A;  1STH A;  2HHH Q;  4DR6 L;  2NVX B;  2Q8I B;  1FNW A;  4WFN 3;  2QDB A;  3F2B A;  3ICE A;  4DV6 Q;  4GS3 A;  3RZO H;  1Q46 A;  4LF9 Q;  3C1E A;  2LXK A;  4F88 A;  1TT2 A;  3ZYY X;  1JB3 A;  5I6W A;  2GN5 A;  3W1B A;  1N33 L;  3IAY A;  4DR5 L;  4R8I A;  2EE1 A;  1I6H B;  4IOA A;  1KDC A;  1BOS A;  1LT5 D;  3MC0 B;  1U4R A;  2TSS A;  4K0K Q;  5GAE C;  4JI1 L;  2E74 C;  1CHQ D;  4R1J A;  4R8N A;  2CQA A;  1F9R A;  1TWH B;  3A8J E;  1G8Z D;  2OEO A;  4IUQ A;  1JWM D;  2EXD A;  5AFW A;  1BNZ A;  1S5D D;  1YNJ C;  4HIK A;  1JB7 A;  2E75 C;  4LFA Q;  4EQ5 A;  4DUZ L;  5JJK A;  1D7Q A;  4H44 C;  1LT3 D;  2I5L X;  5C0X G;  2BDN A;  4TKO B;  3TP8 A;  5M5W H;  1WD1 A;  1EL0 A;  2JA8 H;  4ZKC B;  5D3D A;  2F0U A;  2MQH A;  1E2V A;  1EY5 A;  3DM3 A;  1XPO A;  3K5O A;  2Z1C A;  3VYR A;  1WI5 A;  2ZXP A;  3CPW A;  4DV4 Q;  2B2T A;  2IL8 A;  4DK3 C;  3PO2 H;  1X3G A;  1B2T A;  5T1G A;  2JA5 B;  1IYJ B;  5G3L D;  4GNX B;  2MHV A;  1KHI A;  2SNS A;  2K5W A;  5IE8 A;  4BBR H;  5J1Z A;  1UAP A;  4QB4 A;  3WOF A;  5IYB G;  3HKZ E;  3S2H B;  3ULJ A;  4JI0 Q;  3S14 B;  3VR5 A;  4AQY Q;  2B2V A;  1XNQ Q;  3HG9 A;  3TRE A;  1KLU D;  3WWV A;  3SVM A;  2E2J H;  3S2D B;  3H09 A;  2OXP A;  3CW2 C;  4K8I A;  4OIJ A;  3FHW A;  3OTO Q;  4LF5 Q;  1LTI D;  5IY0 A;  3NK9 A;  4JI3 Q;  4YWL A;  4HIO A;  1SJH D;  4XQQ A;  4C3H H;  1B9M A;  1WTO A;  1P8L A;  1I6V C;  1VQ4 A;  4PNY A;  2HUG A;  1CHP D;  4A3D B;  5J22 A;  2C35 B;  4C3J H;  4DNR B;  1B50 A;  1SRO A;  2BH8 A;  1MSG A;  3CC4 A;  1YNN D;  2L9H A;  5BN4 A;  3I7F A;  1BBW A;  3W2D A;  5C44 G;  4CKE A;  1EYC A;  1MSH A;  4TRD A;  4RFB A;  1KRS A;  1E1O A;  2B8G A;  2NVY B;  1HR0 L;  2F0D A;  1I5F A;  1QWY A;  5C3E B;  3U4V A;  2M9V A;  3ONA B;  1YNJ D;  1STN A;  4EQP A;  2VB2 X;  1YI2 A;  1YBY A;  1N34 Q;  2KEN A;  1EYA A;  2JA6 H;  1SE8 A;  4QJF A;  4GLV B;  4LFC L;  4JI8 L;  3CC2 A;  1HHV A;  1EZ8 A;  3RLO A;  3CCM A;  1WTR A;  1R4P B;  1V1O A;  3AU7 A;  1T5X D;  5LMN Q;  1HPC A;  3M9B A;  3HOY B;  1KNE A;  3T1H L;  3GDE A;  3Q23 A;  2R7F A;  2B8F A;  1BQQ T;  4DXG A;  1STA A;  5GRO A;  5IYC H;  3A74 A;  1GM5 A;  2FMM A;  4PZ6 A;  2WAQ G;  4AQY L;  4P73 A;  4TVA B;  2K5D A;  3GP7 A;  1BF4 A;  3P20 A;  5HGT A;  1DGS A;  4NP5 A;  1KC8 C;  3Q24 A;  4WJW A;  3DWA A;  1VQD A;  1BBX C;  1VQM A;  3K0X A;  2WAQ E;  4YWM A;  1EOT A;  2XWJ B;  1FGB D;  2VUM B;  1GVP A;  1J8I A;  3M3Y B;  1DZ1 A;  2AHO B;  1CZW A;  5ELD A;  3NPP A;  2B39 A;  2OCE A;  2MO0 A;  1IW7 D;  3X3N A;  2WAQ B;  4C3I H;  1IKL A;  4LF7 L;  2PI2 A;  3BVM A;  4DV2 Q;  4WOR A;  5EJW A;  3MEF A;  1BKB A;  1D5X C;  3V2T A;  2IW3 A;  3KF8 B;  1STB A;  2KOL A;  2EZV A;  4GOP B;  4POF A;  1HUN A;  1PTO F;  2Z4I A;  3CMA A;  3AB9 A;  4ID6 A;  4JCV E;  1ZXT A;  3S17 H;  4X62 Q;  4KHP L;  2PQA B;  3EN2 A;  1WTH A;  2R3Z A;  1JT8 A;  3KDF B;  1IL8 A;  2ES2 A;  4DKA C;  1CKN A;  2K05 A;  2BDO A;  1NSN S;  4LF7 Q;  4MTN A;  4A3F G;  2L12 A;  3ULL A;  2V4D A;  3KYH C;  5FOB B;  5IWA L;  1I4R A;  2EDG A;  2A6E C;  2F0K A;  1L0W A;  3RNU A;  3HOW G;  1TQO A;  1EFW A;  1C4Q A;  1GUS A;  5I2Y A;  3BZK A;  3DMU A;  4K2K A;  1VQO A;  1N32 Q;  2RSN A;  2PQE A;  5FO7 B;  1STY A;  1QVF A;  5HUR A;  1ML0 D;  3QR8 A;  5ISR A;  1IBK L;  1NTG A;  2DY8 A;  4AH6 A;  3MFG A;  2XIW A;  4DR1 Q;  1MD2 D;  1SXT A;  5IT9 c;  3SK5 A;  1VQ5 A;  3HOV H;  3LWU A;  1X65 A;  2R92 G;  3AMU A;  3EBE A;  5LHY 1;  2G9D A;  2JA7 B;  2F3W A;  4RKL A;  4F87 A;  2B2T C;  1R9T H;  3V05 A;  1RIP A;  3GTL B;  3HKZ B;  2N8N A;  2A74 C;  1HR0 Q;  1G2T A;  3M7N A;  1QNK A;  1Y1W H;  4QF4 A;  2XVS A;  2K33 A;  4XYO A;  2HD3 A;  1WTV A;  4DNT B;  3CCV A;  4QCL A;  4G7O C;  1O80 A;  2RBM A;  4YHH Q;  4GNX A;  4G57 A;  3S1N B;  3TBI B;  4CDF C;  1PZJ D;  4KD4 A;  1L0X B;  1MI2 A;  3SE0 A;  5M5X B;  4N8F A;  3CME A;  4HN7 A;  1X3P A;  3FKI G;  3CAM A;  1Y1V B;  4A3E B;  3OWF A;  4DXF A;  1HJP A;  4EX5 A;  3L7Z C;  2R7Z G;  2G9H D;  1Q90 A;  3TZU A;  3OMG A;  4RGT A;  5CBE E;  2JK8 A;  2MP1 A;  4HAE A;  4CGY B;  2R92 B;  1JOO A;  1TS2 A;  1VF5 C;  5ELO A;  3BYT B;  4B3M Q;  4BWG B;  1F9P A;  5JEA H;  1HCZ A;  3HOZ G;  2CH4 W;  1VQC A;  4A3B B;  1K8M A;  2F0V A;  1L1O A;  3CCQ A;  1PTO B;  5FLM G;  1PV4 A;  4A3K H;  1H9S B;  1IW7 C;  5KIX A;  1YEZ A;  1I50 B;  4DV0 L;  3S1Q B;  1K83 H;  2ASB A;  5KYI A;  2CH4 A;  2JYO A;  3FRP B;  3MXN B;  4DV5 Q;  3A7L A;  3I2Z A;  1LTS D;  2DUD A;  2K52 A;  1H9K A;  1AE2 A;  4J8Q A;  4DV3 Q;  3VR2 A;  1DXM A;  2F03 A;  2PNH A;  2RA4 A;  1JMC A;  2F0L A;  1FNV A;  3MAQ A;  1TWF H;  5DM6 3;  5I4D A;  4YY3 Q;  5TSS A;  1HZB A;  1V1P A;  1A3U A;  1Q1B A;  3NUC A;  2EJG C;  4DUZ Q;  5EGT A;  1TY0 A;  4Z9C B;  3GO5 A;  3VA7 A;  1LTG D;  2EVB A;  2Q8R E;  1HNX L;  4JI2 L;  3PMF A;  2VQF L;  2AWN A;  5K5P A;  4PMB A;  3HOX B;  3I4N H;  4IJL A;  2K5Q A;  3CQZ B;  4FP5 D;  1DM0 B;  1KRT A;  1EIH A;  1KAW A;  1U4P A;  2JA9 A;  3JAM c;  4P72 A;  1XMO L;  3PQI A;  1EQV A;  2IX1 A;  5FLX L;  1W6J A;  1EWH A;  1L0Y B;  1KAA A;  1TY2 A;  4RGM A;  5I9P A;  4MZ9 A;  1ILQ A;  2Q2U A;  3G7L A;  3RN2 A;  4A3C G;  2BCO A;  3DM1 A;  3KK7 A;  1N34 L;  1JIC A;  1LTB D;  4XT3 B;  1I4Q A;  1STG A;  4UDU C;  2E5L L;  3NQI A;  1M4V A;  3HOU H;  1LM0 A;  4FXK C;  4P2C B;  5EQ0 A;  2N78 A;  3AFP A;  2OQK A;  1SNO A;  3CPF A;  3WOE A;  5C0X H;  5C3E G;  4HJ5 A;  1Y14 B;  1FD7 D;  2NTT A;  4A3I H;  5IP7 G;  2PZU A;  3QWN A;  1CQF A;  5KRU A;  3I73 A;  2A68 C;  3GTG H;  1P16 A;  2MUY A;  1Q81 C;  2Z4H A;  3UDI A;  1DOL A;  2UU9 L;  1K0R A;  2Z0S A;  4GN5 A;  3S1M B;  1QZH A;  1ZYR C;  1I4G A;  4RG1 A;  3PO2 G;  4X3S A; 
#chains in the Genus database with same CATH homology
 4Y7N B;  1CK1 A;  1WTP A;  3VR6 A;  4RHS A;  2L0C A;  2JA8 B;  4ME5 A;  3QJY A;  3VYS A;  3MZ5 A;  2NB0 A;  1J9O A;  2WAC A;  1BCP F;  2MJ8 A;  1HA5 A;  4ZYS A;  2EYJ A;  4FXD A;  4F7X A;  3ERO A;  2AQ3 B;  2AUJ D;  1Z7T A;  4HCE A;  1F77 A;  1SMY D;  4KN4 C;  2EYO A;  4Q0F A;  1EY6 A;  3H0G B;  1V1P B;  1Y69 U;  1JWU D;  3PUV A;  4BY1 B;  1CA5 A;  2PYK A;  2HDL A;  3I8Z A;  1DON A;  3DXJ C;  4X3T A;  5ELB A;  4PMC A;  5C4J B;  5EKK A;  4DU9 A;  4C3H B;  2ID0 A;  1V8Q A;  3VA5 A;  4ZKB B;  2A6H C;  3DUZ A;  4JBW A;  4S3S A;  3PUW A;  3OMC A;  4QIW B;  2Y0S B;  1LT4 D;  3C1F A;  1DJR D;  3K6O A;  4H13 C;  2M2L A;  3T13 A;  1WTQ A;  1S5B D;  1A15 A;  2KCC A;  1X32 A;  2F0S A;  1SND A;  1H9J A;  3PUX A;  5CC4 A;  3IFD A;  1O7Y A;  2XRQ D;  3PV0 A;  3FVQ A;  2H1E A;  4C1N I;  4BA1 I;  4Q5V A;  2F0G A;  2AWO A;  2ZXR A;  3GTM B;  3BVZ A;  3M85 A;  1GHK A;  3BDO A;  1RD9 D;  1U4L A;  1PZI D;  4IUN A;  2B2Y C;  1TS5 A;  4CKC A;  3K59 A;  4U68 A;  4B9W A;  2SEB D;  2EYH A;  3BZD B;  4LK1 C;  4HR7 B;  2Q8T A;  4O42 A;  5LL6 X;  4DAP A;  3TP5 A;  2AUK A;  4IFD G;  1Z6H A;  2EYP A;  5FK9 C;  4BBS B;  3RMH A;  1T5E A;  1VDZ A;  5NUC A;  3QIA A;  1C48 A;  2XNA C;  3NBI A;  3MXU A;  2R61 A;  1RDP D;  1TWC B;  3J7A V;  2XWB B;  1KTK A;  1ZKO A;  2KA7 A;  3PIP 3;  1GUN A;  4KI0 A;  1EYD A;  4RCO A;  1CM9 A;  3S17 B;  5G3L F;  1LTT D;  1RHP A;  5KYL A;  3SR1 A;  2B2W A;  3S15 B;  3VR3 A;  2NN6 H;  2NN6 I;  1LTA D;  2NYZ D;  4KY7 A;  1G29 1;  2O5J C;  3TP7 A;  3P1H A;  5C3X A;  2EY1 A;  4XIG S;  1D1K A;  2BE5 D;  3MHB A;  3K5M A;  1Q3L A;  1EEF D;  2KUM A;  1EEI D;  2NWG A;  3MA2 B;  3Q22 A;  1S5E D;  3JAM L;  1SNQ A;  1PFB A;  3D31 A;  4X3K A;  5LL6 S;  2C5C A;  2F0Q A;  3QO2 A;  3FKI B;  1VMC A;  5I2X A;  1PZK D;  1R9T B;  3DEP A;  2D62 A;  3SK8 A;  1BDO A;  5JJZ A;  3D8G A;  2K01 A;  1SSO A;  3BS1 A;  1BUV T;  5KNB A;  2PZW A;  4KMU C;  4OL7 A;  2F0O A;  1TR5 A;  2I07 B;  2EXZ A;  4HCS A;  1CQV A;  1SDF A;  3BDL A;  4RA8 A;  3KBG A;  4X3U A;  4K6L A;  4KD3 A;  1HFN A;  1S4Z A;  4C3H G;  4I7Z C;  1SAP A;  3R2T A;  3U9S A;  4BY7 B;  4ZRZ A;  4C3J G;  1PTO H;  5C3W A;  1WVL A;  2FHT A;  4C1N K;  1HTP A;  5A35 A;  1JQY D;  1A3T A;  1ICW A;  2FMC A;  1PRT B;  4IUU A;  4G4K A;  1KNA A;  2F0E A;  1B3A A;  3PUZ A;  4FF2 A;  3ND9 A;  3GTQ B;  2IX3 A;  1CI3 M;  4ODG A;  2R7Z B;  5CR3 A;  3H91 A;  2F1M A;  4ZUI A;  1O78 A;  1HFG A;  5CV7 A;  2N88 A;  1LTR D;  3QB3 A;  1PMR A;  3MXG A;  4RWS C;  1NR2 A;  2F0P A;  5A2Q L;  2RDG A;  4OIK A;  4NKL A;  4IFD I;  1SYF A;  4OO1 I;  2WKC A;  2EY6 A;  3KLS A;  4BBR B;  2SOB A;  1Y8O B;  3HOU B;  1B9N A;  1ZYR D;  1U9R A;  4TQU S;  2ZT9 C;  2JXM B;  4LJZ C;  1D1I A;  4MIU A;  1B53 A;  5I9O A;  1GHJ A;  1D5Z C;  2WB1 B;  2E2J B;  1XYI A;  5E3F A;  2EY2 A;  3GTJ B;  2H4O A;  3I4M B;  1A6X A;  1OXV A;  2B2W C;  2EYM A;  3GQB A;  2JEB I;  2K04 A;  1JWS D;  4KY5 A;  5JEA J;  2FJ2 A;  1AFP A;  5FO9 B;  3FPP A;  4GZY C;  5KNC A;  1GUT A;  1OXX K;  2B2U A;  2I46 A;  4OGQ C;  5M3M B;  1TII D;  2ICI A;  2KCN A;  1BR9 A;  2PMZ B;  1LLR D;  3JAM E;  5EPL A;  2AQ2 B;  2B2Y A;  2QEJ C;  5CYU A;  2VNU D;  3I90 A;  1FYC A;  2CVR A;  2VB3 X;  2K32 A;  2JA6 B;  3QG1 A;  3OPO A;  1UEA B;  5BN3 A;  5K36 H;  3U9O A;  1E0B A;  3MWY W;  1RJT A;  5KGU A;  2XN9 C;  1VF7 A;  5IGF A;  1ILP A;  3DHQ A;  1ZEQ X;  5A2Q E;  1CFM A;  4G7Z C;  1HQR D;  3H94 A;  5E4X A;  3VYT A;  4KKU A;  3CRK C;  3MXN A;  2PZT A;  4K5V A;  1KAB A;  4FYD A;  4C3I B;  4K5X A;  2EYL A;  1H9S A;  1SFO B;  2PNR C;  3FPU B;  2WV6 D;  3DWQ A;  4CHT B;  5KEE A;  2GA4 B;  5IGG A;  1EU4 A;  3S9W A;  1H9M A;  1ESR A;  4HMJ A;  2ENB A;  4OO1 G;  5IGD A;  4DFA A;  1EY7 A;  4E6I A;  3MVV A;  1SYG A;  1G6Z A;  1RF2 D;  3NQT A;  5IIF A;  2LFN A;  1I3Q B;  1SJE D;  3OIQ A;  4RCN A;  2YU9 B;  1I4H A;  2E2D C;  3Q0A A;  1BCP D;  2KHS A;  3I4L A;  5EBD A;  2ICE C;  3NE5 B;  3OIP A;  2NVQ B;  4FNF A;  5D14 A;  1AN8 A;  2NUC A;  1AP0 A;  1CA6 A;  3C46 A;  4RGN A;  2RSO A;  1DCZ A;  1GOZ A;  3KLS X;  3IFT A;  1PLF A;  3CHB D;  1LAB A;  2F0N A;  1D6E C;  3KLR A;  4M8A A;  2J0T D;  4LMQ D;  1WTW A;  1ONL A;  4CJ2 C;  1QE6 A;  2N55 A;  3TME A;  3I72 A;  1OO9 B;  5ELF A;  3NWS A;  2RVL A;  2NN6 G;  3OSO A;  4CKB A;  3O13 A;  4MHE A;  1JOR A;  1GUG A;  5CV4 A;  4HSV A;  2PW7 A;  5COR A;  5KND A;  4IQZ A;  1PYW D;  1IYV A;  2EYF A;  3S16 B;  4ULL A;  1AZQ A;  3SXH A;  1CT1 D;  2F0F A;  4OHJ A;  1SNP A;  2DNE A;  3BG3 A;  2E76 C;  1TVX A;  2DNC A;  3FDT A;  3OW7 A;  2IPK D;  4KN7 C;  1XWE A;  2ZXO A;  2J4X A;  4TSS A;  4QMG A;  3NXW A;  4FO2 A;  3BVG A;  2KQ3 A;  1SE2 A;  3W3A A;  4CJ0 B;  1B44 D;  5IOD A;  2F0H A;  5IOC A;  3R93 A;  2JEA I;  1ESF A;  4YIJ A;  1NR4 A;  4A3G B;  4A3K B;  3M7G A;  3D4D A;  1PRT F;  2WKD A;  5CGK A;  4IAL A;  1F2L A;  1SYD A;  3E6Z X;  3PO3 B;  1K83 B;  5C4H A;  1PRT D;  5IGB A;  3L3O C;  1I4P A;  5I6Y A;  2KVM A;  3OOC A;  2NTS A;  2TMP A;  1DD2 A;  3H6M A;  2M00 A;  2C9O A;  2Z8L A;  4QUF A;  1TWF B;  3SEB A;  1TU2 B;  2A68 D;  4RGO S;  1MGS A;  3MFY A;  1AW7 A;  2CHB D;  5J39 A;  1DOM A;  2L4N A;  2XSC A;  2J7Z A;  3J81 E;  4DK0 A;  1A3V A;  1SYC A;  3N6R A;  4K8J A;  3E0J A;  1F2M A;  4N9P A;  3HOZ B;  1YNN C;  2D9U A;  5IT9 L;  3M4Y A;  1FR3 A;  4EQN A;  1EU3 A;  4OO1 H;  1W6K A;  2EJM A;  3EVQ A;  3K5L A;  4ABN A;  5EKL A;  1PFM A;  5JVH 3;  2A5H A;  5C6A A;  2CW0 C;  3GTG B;  2X6L A;  2B2V C;  3K0Y A;  3P7J A;  5FLX E;  3QOJ A;  2L5T A;  4K14 A;  5JPN C;  1TWA B;  1JOK A;  4ZUJ A;  5M9O A;  3LX0 A;  2R6G A;  1MBY A;  1BXT A;  2EOT A;  2JP1 A;  3MXP A;  3GV6 A;  4XXE A;  4C3J B;  2XRS D;  2NBF A;  3UI2 A;  3NSW A;  3TDQ A;  2RKS A;  1F9S A;  1SNC A;  2HCC A;  4C2M B;  3FMC A;  1TWG B;  3HEJ A;  1SYB A;  1AZP A;  3TSS A;  3IKJ A;  1Q1E A;  3J80 L;  5FKA C;  3RLF A;  1LAC A;  4BS9 A;  4DAY A;  3D4W A;  2D5D A;  5IGC A;  1WD0 A;  2IJ0 A;  1BCP C;  5C44 B;  2F3V A;  5CV5 A;  1QIL A;  3NTH A;  3D4R A;  3URY A;  1D5M C;  5C5L A;  3KBX A;  3GTO B;  1B1Z A;  1ET9 A;  1EY9 A;  3R8B A;  5C0X I;  4ZAI A;  1E2Z A;  1II3 A;  3NP8 A;  1PXU A;  1SBB B;  2A69 C;  1EWC A;  2QCP X;  5BN5 A;  1VMP A;  2KEC A;  1HRJ A;  2FIN B;  2O2L D;  2RDH A;  4DGZ A;  3OWE B;  2E2H B;  2JSO A;  4ZQ3 A;  4XQN A;  4EVO A;  1ENF A;  3BDC A;  1EY8 A;  3Q6S A;  1F2Z A;  1QJO A;  4XDX A;  3T51 B;  1EIG A;  2BOS A;  4ZK9 B;  1SE3 A;  3HS0 C;  4DN4 M;  1G2S A;  3HOW B;  1TS4 A;  4A93 B;  2PPB C;  1H9R A;  5IGE A;  4BA2 I;  2VXW A;  3X3M A;  4A3M B;  1S5F D;  4WRD A;  2BA0 A;  3V96 A;  5ELE A;  2WIN B;  1XXG A;  2LKV A;  5D65 A;  1KLG D;  4FF3 A;  3S1R B;  4ZLT F;  3L9A X;  4R9W A;  5E4W C;  2F0W A;  2A6H D;  2BA1 A;  4KK7 A;  1TKW B;  5ELC A;  3T56 B;  3PUY A;  1K8O A;  1DOK A;  4L6T B;  4XT1 B;  3VR4 A;  3HOV B;  4KHV A;  2IT1 A;  2A73 B;  3TN2 A;  5JOB A;  2MPM A;  3F2U A;  5IT9 E;  4RH6 A;  1PRT C;  5DNF A;  2L1B A;  1A2T A;  4M1U B;  4J6H A;  3K57 A;  3WDN A;  2F0T A;  2O4X A;  2QKI C;  5CV8 A;  4UAI A;  3PIO 3;  1CTM A;  1GJX A;  1D2B A;  1IYU A;  3I3C A;  1ENA A;  2EJF C;  1NAP A;  3GTK B;  1V43 A;  5E1F A;  3R2I A;  5CV9 A;  4PMW A;  4ILW A;  5CMD A;  4O1N A;  4V0B A;  2F0J A;  3P75 A;  3I91 A;  1FNU A;  4A3J B;  3BYY B;  1Q8I A;  3RZO B;  4KTA A;  3C2P A;  1EQT A;  3SK4 A;  1OXS C;  2K7V A;  4H0L C;  5CV6 A;  3G6J B;  4IUT A;  1UUP A;  2F0M A;  4B08 A;  2LY7 A;  3MEH A;  4KV6 A;  3IL8 A;  5FO8 B;  3FEW X;  3A7A B;  3J7Y W;  2F4I A;  3J80 E;  5EBC A;  2NVT B;  4XTC S;  1UNS A;  2PO4 A;  3GV3 A;  3I4N B;  5M5W B;  5C0X J;  1OXU A;  3T4A C;  4IFD J;  3T16 A;  3EJI A;  5C4Z A;  3PO2 B;  3QOL A;  4XQJ A;  1ROD A;  5C5M A;  1LO5 D;  1NCV A;  2HCI A;  3EFX D;  3LWE A;  1JR0 D;  4FXG C;  4LAA A;  4A3I B;  4FF4 A;  4EQO A;  5C4X B;  5K36 G;  3LNN A;  2L11 A;  1I4X A;  1E2W A;  4KJN A;  1JC7 A;  2MGS A;  4G7H C;  2B2U C;  4FVM A;  5EPJ A;  5M3F B;  3TZD A;  2WII B;  1TS3 A;  2DN8 A;  3K7A B;  5DM7 3;  2SDF A;  3NTI A;  4L63 B;  2FFK B;  4IUR A;  1RCV D;  3CKI B;  1GXD C;  3SHL A;  4KHZ A;  5CBA E;  1EZ6 A;  1IHZ A;  3T53 B;  1NUC A;  1EY0 A;  1Y8P B;  3GD7 A;  1RKN A;  3D6W A;  1ENC A;  4J1M A;  1Y8N B;  3HZX A;  1CZG A;  3NHH A;  5JPM C;  1STE A;  3DWP A;  5DEH A;  4PV1 C;  3SK6 A;  4DAV A;  1XTC D;  5EKI A;  5M5Y B;  1F9Q A;  1HA6 A;  1PTO D;  1RTO A;  1X3Q A;  3A54 A;  5DAU A;  4CBV A;  2HQE A;  3OHX C;  4NW2 A;  1JCK B;  2A6E D;  3EA6 A;  4PQX A;  1Z47 A;  1HTL D;  1A2U A;  1SEB D;  3DEO A;  4IFD H;  3HRZ C;  4K5W A;  3NWT A;  1SE4 A;  4EGV A;  2B63 B;  3CRL C;  4KY6 A;  1QCB D;  3RUZ A;  4RAU C;  4RHR A;  2KEE A;  2F0I A;  2K6A A;  1F2Y A;  3GTP B;  1VCI A;  4HSP A;  2CW0 D;  3K5N A;  2HDM A;  2KED A;  4NMZ A;  4AYB B;  4K2L A;  5T1I A;  1PFN A;  1KDA A;  4I65 A;  4KJO A;  1LV9 A;  2JE6 I;  5EPK A;  1Q12 A;  3NTK A;  1WCM B;  1QOH A;  1QNU A;  2L55 A;  5F2D A;  1HXY D;  4H7B A;  4DK1 A;  4FF1 A;  3ITP A;  5COY A;  1SYE A;  1QG7 A;  1U4M A;  3A56 A;  1XX8 A;  4U67 3;  2EY5 A;  2PCF B;  3C3L A;  1EFI D;  2A69 D;  1R4Q B;  2K28 A;  3CU7 A;  2SNM A;  3R3O A;  1WTX A;  1SMY C;  5JVG 3;  1B4O A;  1AEX A;  4MN3 A;  3J7A F;  3D3R A;  4N9T A;  2D2C C;  2IX0 A;  2X6G A;  3MTS A;  3SDZ A;  3HGB A;  4F8M A;  2OF1 A;  2K1B A;  2O5I C;  3N52 A;  4IUP A;  1Y1W B;  4RKB A;  3M4O B;  4HMI A;  4KKS A;  1IKM A;  2QF7 A;  1DYQ A;  4B9X A;  4IN3 A;  1G91 A;  1GUO A;  4V19 0;  2E2I B;  5JAV A;  3J81 L;  4CJ1 B;  2NZ1 D;  2K03 A;  3RD4 A;  2X69 A;  1BO0 A;  1S5C D;  3ERQ A;  2LMC B;  4HED A;  3E5S A;  2PW5 A;  2DY7 A;  4L8J A;  1JOQ A;  1EY4 A;  3ND8 A;  3A8I E;  1HQM C;  3NBH A;  1LT6 D;  1HUM A;  1ET6 A;  2EPB A;  1OXT A;  1SNM A;  3K58 A;  3RZD B;  2R93 B;  1O7Z A;  1C8C A;  1O7L A;  3TP6 A;  4A3F B;  2LS0 1;  3H3V C;  3D6C A;  3HP3 A;  2WP8 J;  4JK1 C;  3EQL C;  2YYZ A;  5JEA G;  3KF8 A;  3A8K E;  5D3I B;  1M8A A;  2KJX A;  3A55 A;  1JE4 A;  4HTH A;  4C56 C;  1BCP B;  4IZ8 A;  4KKT A;  4QUC A;  4NDX A;  4DA2 A;  2RQX A;  1PDQ A;  4DF7 A;  4XYQ A;  2OT2 A;  4C3I G;  2QIL A;  1QB5 D;  1GUW A;  1RTN A;  3VYU A;  4K6D A;  2RDF A;  2AQ1 B;  4IUV A;  1KDB A;  2BE5 C;  1PTO C;  3KUP A;  3I70 A;  2IWH A;  1STH A;  2NVX B;  2Q8I B;  1FNW A;  4WFN 3;  2QDB A;  3C1E A;  4F88 A;  1TT2 A;  3ZYY X;  1JB3 A;  5I6W A;  3IAY A;  4R8I A;  2EE1 A;  1I6H B;  1KDC A;  1BOS A;  1LT5 D;  3MC0 B;  1U4R A;  2TSS A;  2E74 C;  1CHQ D;  4R8N A;  2CQA A;  1F9R A;  1TWH B;  3A8J E;  1G8Z D;  2OEO A;  4IUQ A;  1JWM D;  5AFW A;  1BNZ A;  1S5D D;  1YNJ C;  2E75 C;  4H44 C;  1LT3 D;  5C0X G;  2BDN A;  4TKO B;  3TP8 A;  1WD1 A;  1EL0 A;  4ZKC B;  5D3D A;  2F0U A;  1E2V A;  1EY5 A;  3K5O A;  2Z1C A;  3VYR A;  2ZXP A;  2B2T A;  2IL8 A;  1B2T A;  5T1G A;  2JA5 B;  5G3L D;  2MHV A;  2SNS A;  2K5W A;  5J1Z A;  1UAP A;  4QB4 A;  3WOF A;  3S2H B;  3S14 B;  3VR5 A;  2B2V A;  3HG9 A;  1KLU D;  3SVM A;  3S2D B;  3H09 A;  2OXP A;  4K8I A;  4OIJ A;  1LTI D;  3NK9 A;  1SJH D;  4XQQ A;  1B9M A;  1WTO A;  1I6V C;  4PNY A;  2HUG A;  1CHP D;  4A3D B;  5J22 A;  4DNR B;  1B50 A;  1MSG A;  1YNN D;  2L9H A;  5BN4 A;  3W2D A;  4CKE A;  1EYC A;  1MSH A;  4TRD A;  4RFB A;  2B8G A;  2NVY B;  2F0D A;  5C3E B;  1QWY A;  2M9V A;  3ONA B;  1YNJ D;  1STN A;  4EQP A;  2VB2 X;  1EYA A;  1HHV A;  1EZ8 A;  1WTR A;  1R4P B;  1V1O A;  3AU7 A;  1T5X D;  1HPC A;  3HOY B;  1KNE A;  3Q23 A;  2B8F A;  1BQQ T;  4DXG A;  1STA A;  2FMM A;  2K5D A;  3GP7 A;  1BF4 A;  3P20 A;  5HGT A;  4NP5 A;  3Q24 A;  4WJW A;  3DWA A;  1BBX C;  1EOT A;  2XWJ B;  1FGB D;  2VUM B;  1J8I A;  3M3Y B;  1DZ1 A;  1CZW A;  5ELD A;  2B39 A;  3NPP A;  1IW7 D;  3X3N A;  2WAQ B;  1IKL A;  3BVM A;  4WOR A;  5EJW A;  1D5X C;  3V2T A;  2IW3 A;  1STB A;  2KOL A;  2EZV A;  1HUN A;  1PTO F;  2Z4I A;  3AB9 A;  4ID6 A;  1ZXT A;  2R3Z A;  1IL8 A;  2K05 A;  2BDO A;  1NSN S;  2L12 A;  2V4D A;  5FOB B;  1I4R A;  2EDG A;  2A6E C;  2F0K A;  1TQO A;  1C4Q A;  1GUS A;  5I2Y A;  3DMU A;  4K2K A;  2RSN A;  2PQE A;  5FO7 B;  1STY A;  5HUR A;  1ML0 D;  5ISR A;  2DY8 A;  3MFG A;  2XIW A;  1MD2 D;  1SXT A;  3SK5 A;  3LWU A;  3AMU A;  5LHY 1;  2G9D A;  2JA7 B;  2F3W A;  4RKL A;  4F87 A;  2B2T C;  3V05 A;  3GTL B;  3HKZ B;  2A74 C;  1G2T A;  3M7N A;  1QNK A;  4QF4 A;  2XVS A;  2K33 A;  4XYO A;  1WTV A;  4DNT B;  4QCL A;  4G7O C;  1O80 A;  2RBM A;  4G57 A;  3S1N B;  3TBI B;  1PZJ D;  4KD4 A;  1L0X B;  1MI2 A;  3SE0 A;  5M5X B;  4HN7 A;  1X3P A;  1Y1V B;  4A3E B;  3OWF A;  4DXF A;  3L7Z C;  2G9H D;  1Q90 A;  3TZU A;  3OMG A;  4RGT A;  5CBE E;  2MP1 A;  4HAE A;  4CGY B;  2R92 B;  1JOO A;  1TS2 A;  1VF5 C;  3BYT B;  4BWG B;  1F9P A;  5JEA H;  1HCZ A;  4A3B B;  1K8M A;  2F0V A;  1PTO B;  1H9S B;  1IW7 C;  5KIX A;  1I50 B;  3S1Q B;  5KYI A;  2JYO A;  3FRP B;  3A7L A;  1LTS D;  1H9K A;  4J8Q A;  3VR2 A;  1DXM A;  2F03 A;  2RA4 A;  2F0L A;  1FNV A;  3MAQ A;  5DM6 3;  5I4D A;  5TSS A;  1V1P A;  1A3U A;  1Q1B A;  3NUC A;  2EJG C;  5EGT A;  1TY0 A;  4Z9C B;  3GO5 A;  3VA7 A;  1LTG D;  2EVB A;  2Q8R E;  3PMF A;  2AWN A;  5K5P A;  4PMB A;  3HOX B;  2K5Q A;  3CQZ B;  4FP5 D;  1DM0 B;  1EIH A;  1U4P A;  1EQV A;  2IX1 A;  5FLX L;  1W6J A;  1EWH A;  1L0Y B;  1KAA A;  1TY2 A;  4RGM A;  5I9P A;  1ILQ A;  3G7L A;  2BCO A;  3DM1 A;  3KK7 A;  1JIC A;  1LTB D;  4XT3 B;  1I4Q A;  1STG A;  4UDU C;  3NQI A;  1M4V A;  4FXK C;  4P2C B;  5EQ0 A;  1SNO A;  3WOE A;  5C0X H;  1FD7 D;  2NTT A;  2PZU A;  3QWN A;  1CQF A;  5KRU A;  3I73 A;  2A68 C;  2MUY A;  2Z4H A;  1DOL A;  3S1M B;  1ZYR C;  1I4G A;  4X3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...