5IGEA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igeA00
4IUNA 1AEXA 2F0FA 5C4ZA 5HGTA 2EYHA 2F0UA 3BDCA 4HTHA 1SNCA 3OSOA 4ODGA 5EKLA 1SNOA 2M00A 3NUCA 3OWFA 5IGDA 1EZ6A 4DGZA 4B9XA 4RKLA 3TP6A 5C5MA 3LX0A 4K8IA 3DMUA 2RDFA 2PYKA 3OMCA 3NQTA 1EYDA 2EYMA 4F7XA 2PQEA 1JORA 1U9RA 3D8GA 3SR1A 5E3FA 1ENAA 4HMJA 3TMEA 1EY6A 5F2DA 4DFAA 4K8JA 5KYIA 5IGBA 1TR5A 4WRDA 4J1MA 4S3SA 1EY7A 5CV7A 1SNQA 5J39A 4EVOA 4ME5A 1STHA 4KV6A 1KAAA 4ZQ3A 5JOBA 5KIXA 2SNSA 5CV6A 5KYLA 3MZ5A 5CGKA 4R8NA 2OF1A 1KDCA 4KY6A 1STGA 3NP8A 2EYPA 5I6WA 5CR3A 4J6HA 5C3WA 5IIFA 1JOQA 5CV5A 3SK8A 4KD4A 3E5SA 4K6DA 4G57A 2F0PA 5C5LA 4K2KA 2F0WA 3T13A 3U9OA 1A3VA 2EYLA 2F0HA 2O4XA 2F0GA 1KDAA 3C1FA 3MVVA 3TP7A 2LKVA 5J22A 5CV9A 1EYAA 1EY9A 1EQVA 2EY5A 3R3OA 2OXPA 1ENCA 5M9OA 1RKNA 3SK4A 5KGUA 1NUCA 2F0NA 3QB3A 4NP5A 3VA5A 1F2ZA 5IGFA 3C1EA 3ERQA 2RKSA 2F0EA 3SXHA 4LAAA 4K5WA 3S9WA 1IHZA 1EY4A 1KDBA 1STYA 1SYFA 2F0LA 4NMZA 3PMFA 1EY5A 5EKKA 4TRDA 4EQNA 5DAUA 5KEEA 2QDBA 1SYDA 2F0KA 4IALA 2F0TA 1JOOA 3MXPA 1EY8A 3T16A 2OEOA 2WACA 4E6IA 4ZUJA 1II3A 1SNMA 2HQEA 2PZWA 3QOJA 4EQOA 1STAA 4K5XA 5IGEA 4I65A 4RKBA 4YIJA 4KJNA 2EY2A 1TT2A 3DHQA 1EZ8A 4QMGA 5C4HA 3NK9A 2F0OA 3MHBA 1SNDA 1EY0A 3V2TA 4N9PA 4ZUIA 3HEJA 3P75A 2KQ3A 2F0SA 5DEHA 2F3WA 4N9TA 5ISRA 3TP5A 4PMCA 1SYCA 2EYJA 2PZUA 2KHSA 4K5VA 2PW7A 2RBMA 4IZ8A 4NDXA 2F3VA 3EJIA 3EROA 4DU9A 1F2YA 5CC4A 5HURA 3D6CA 4NKLA 4EQPA 5I6YA 3TP8A 4PNYA 1STNA 3H6MA 1SYBA 5IGCA 1TQOA 3SHLA 4KD3A 2F0MA 4MIUA 5K5PA 3SK5A 2PW5A 1JOKA 3ITPA 1A3UA 2EXZA 4K14A 3BDLA 4OL7A 4QF4A 5I9OA 1EYCA 3MEHA 4QB4A 2EYFA 5CV4A 2SOBA 5KRUA 4KY5A 5IOCA 2F0IA 1A2TA 2F0VA 4KTAA 5IODA 3SK6A 4HMIA 3P1HA 2SNMA 4F8MA 2EYOA 1SYGA 5NUCA 1NSNS 4WORA 4K2LA 2EY6A 4ID6A 5EGTA 1A2UA 4PMBA 1A3TA 2NUCA 3EVQA 1SNPA 3RUZA 4B9WA 3QOLA 3NXWA 3D4DA 1F2MA 4H7BA 5JAVA 3HZXA 5CV8A 2F0JA 1KABA 2ENBA 2F0QA 4KY7A 5E1FA 5I9PA 2EY1A 5C3XA 4DF7A 5J1ZA 5IGGA 1SYEA 4KJOA 3NHHA 2PZTA 4KHVA 2F0DA 3D4WA 5C6AA 1STBA 3OMGA
chains in the Genus database with same CATH superfamily
4IUNA 3S1MH 2MQHA 4RHSA 4A3GB 4DGZA 2JP1A 3BVMA 2C9OA 1YEZA 4RKLA 3S1NB 5C5MA 4DR4L 2ZJRA 1SE4A 1Y14B 4Q5VA 4YCUA 5LMUQ 4LJZC 3ER0A 1JE4A 4S3SA 1SMXA 1KAAA 5KYLA 5BR8L 1EQRA 3M7GA 4XQNA 1YIJA 2Q2IA 1QVGA 1QJOA 1CSQA 4NXNL 3GTLB 4A3IH 2IHEA 2C5CA 1VQDA 3RLOA 3CCMA 4OO1G 3E5SA 2NWGA 4JI7Q 5IP7H 1JQYD 2BDNA 3E0JA 4P71A 3I55A 1AE3A 3TBIB 1QCBD 3L7ZC 1YJNA 2XWBB 1V9PA 1A15A 1XNQQ 4NP5A 4GS3A 1O7ZA 3M4YA 4F87A 3CC4A 5EAYA 2EIFA 2ATWA 4FXDA 3D3RA 1MGSA 4DV2L 4LWCA 4GLAC 2Q8IB 4DV7Q 2PQAB 4DV5Q 2ZJQA 3TREA 2R92B 1SNMA 3OTOQ 2YU9H 3CRLC 1LTRD 4CDEC 3J81c 1NAPA 1EIGA 1EY0A 1PVOA 4QGUA 3HEJA 4CJ0B 3GTQB 4PMCA 1WD0A 1TIID 2PW7A 4DV4Q 2MUYA 3UDXA 4DU9A 2EQSA 5LMUL 1TWGH 5H1SE 3BS1A 2CVRA 2F0MA 1EQQA 1PA6A 1EU3A 3J7A5 1L1OA 2G5DA 2EXDA 5EBCA 4UY8C 3FEWX 4JI2L 2ID0A 1KIXA 4B3SL 2Y0SB 2EY6A 1PTOF 3A7LA 1SNPA 5EKIA 3GO5A 1VF5C 3S2HB 3E6ZX 4IOCA 3J81L 1TWFH 2Z4IA 3U50C 4XYOA 1NCVA 2O5IC 3RZOH 2AWOA 2JJQA 1KHIA 4C3JH 2NVXB 3ERSX 3KJPA 2N78A 1IBMQ 4UHVA 4A3GG 1LT3D 4BBSB 1CT1D 1EYDA 1VQ8A 3K0YA 1QG7A 3K5LA 1V43A 1L0XB 5ELDA 4HCEA 3E9IA 4FO2A 2IX1A 1WTQA 1XNRQ 4JOIC 2A68C 1X3GA 4YY3Q 5CBEE 2N55A 1I3QB 1X3QA 2JA6H 4J8QA 5C4XH 2EJGC 4KD4A 3CCQA 4A3IB 1JJGA 2O4XA 5EBDA 1FL0A 3EA6A 2FMCA 4I7AA 2NB0A 3VR2A 1EYAA 2I46A 3I4NB 1S5FD 4G7ZC 1NMGA 2UUBL 1K28A 1ZXTA 2E2IB 1V1OA 1SE3A 1EOTA 2K5NA 3Q8DA 1HZAA 1YI2A 2NVYH 4A3EH 1UUPA 1OXUA 3MXNB 1J6QA 1LT6D 1WTOA 1W2BA 1IBLQ 3QOJA 2R92G 3HKZB 4KMUC 1B2TA 3WOFA 3KF8B 4I65A 3DHQA 1KRSA 5C4HA 2MGSA 3OW7A 4DK6C 2HQLA 4FXKC 3OOCA 4DV3L 2KQ3A 2JE6I 5DEHA 4X3UA 1AE2A 4K5VA 3L9AX 1VQMA 1T5EA 1NBWA 3J7ZC 3F1ZA 5JJIA 4QY7A 2V4DA 1TWGB 2D2CC 4DR2Q 2K5QA 4LF6L 1O78A 4J15A 1YNJD 4LK1C 2BH2A 1HNXL 4A93H 3J81j 4JI8L 5EQ0A 4X65Q 1TWCH 3F2CA 1Y1VH 2JA5H 2SNMA 3JAMi 2Y0SG 4CHTB 4DK1A 4JYAQ 1D5XC 4LF4Q 4LFCL 1TWAH 4OEMB 1IKLA 3NXWA 5IWAQ 2Z6BA 3ULLA 2MFIA 1L1OC 5C4ZA 4AQYQ 4C3JB 1QB5D 3VYRA 1IBLL 4BY7B 1YITA 4JBKA 1AZQA 3T51B 5IYDH 3M3YH 3CC7A 4BBSG 4KN7C 1GJXA 5CORA 3GTGH 5I2YA 2VQFL 3CQZH 1RTNA 2NTSA 3GTOH 3HOUB 2KEDA 5IGBA 4GKJQ 1GHJA 1WVLA 4KV6A 1HA6A 1DOKA 2OF1A 4XQJA 3S1QH 3Q23A 3NWSA 2JA6B 5M5YB 3BG3A 4C3IB 1I6VC 3VR3A 3CHBD 2ICEC 2L15A 2Y0SE 5LMNL 5IP7G 4YWLA 2EY5A 1SN8A 1Z9FA 2OXPA 3I4NG 1NUCA 2H4OA 4I7ZC 3GD7A 3G7LA 3KLRA 2RDHA 2RKSA 4G7HC 2KEEA 4A3KH 1NMFA 4K5WA 5FOBB 1EY5A 5KNBA 3K80C 1I94Q 3S1RB 1HJPA 1JOOA 1WCMB 3F2UA 2PI2A 3K7AH 3RNUA 2GA4B 2UU9L 3HOWH 1CUKA 1WJJA 1W3SA 3I4MH 2K50A 5C44H 5BN5A 1CHPD 1T5XD 2NN6H 4QJFA 3W3AA 5I2XA 4DNIA 3HKZG 1K8MA 5FLXE 4OXPA 4RKBA 5AJ3Q 1B3AA 5I4DA 1CM9A 2Q2UA 1Q12A 3NQIA 5A35A 2PZUA 1N36Q 3F8TA 4IUTA 2VB2X 2R7ZB 5C3EH 2BA1A 3S15B 1G51A 4NKLA 1QE6A 4IPCA 3G6JB 3TDQA 1Q7YC 4MIUA 3NEMA 1Q3LA 1NJIC 1FVIA 1TS5A 3DWQA 2EYFA 3F2BA 3PUZA 2VY3A 1D5ZC 4ZAIA 3KUPA 5ELOA 4UP7A 3FVQA 1N8RC 2ZM6L 1QZHA 3P1HA 2UUCQ 4QQBX 2JN4A 3PUWA 3M7NA 4IURA 3OW2A 4UP8A 5FJ8G 1PTOB 2JA8B 1IL8A 1E0BA 1LTSD 1C0AA 5E1FA 3O13A 2KCCA 2XN9C 3HKZE 3HFZB 3FMCA 4HSVA 4DF7A 1CA6A 4L6TB 3KLSX 1ASZA 1Y69U 4Z9CB 3MFGA 3J80i 3SGIA 1GD7A 4BBRH 1SNCA 1BBUA 4DAVA 4C3JG 3Q6SA 3T4AC 3JAME 5TSSA 4BY7G 4DUYQ 4PV1C 3DWAA 4JI5Q 3UDFA 3BU2A 2VL6A 4A3JH 3HOUG 4QCLA 5BN4A 1ZKOA 2K01A 1VQBA 3URYA 4AIMA 4ZK9B 1HTLD 3DWPA 4K0KL 4ULLA 4IN3A 1KLGD 4DR5Q 2NVQH 4L8JA 1ENFA 1I4GA 1RHPA 1YZ6A 2JA6G 4G57A 2KENA 4C3IG 4CKEA 3SDZA 4MZ9A 5J22A 5FLMH 3OIPA 2B39A 4GN5A 1K0RA 3PUVA 4FVMA 1FJGQ 5IGFA 3CMAA 2XGTA 2UXCL 2YTYA 3R8BA 2A8VA 1VQ4A 5M3FH 4DV0Q 5K36G 3PMFA 3CAMA 3D6WA 3TS0A 1BF4A 2ZT9C 3AFPA 1WCMG 1A62A 4A4IA 5FK9C 4HSPA 4YHHQ 3QO2A 3NK9A 1SNDA 4R1JA 3V2TA 1SLJA 1PHJA 2CW0C 2Z9HA 2D5DA 1Q81C 4A3CG 3V05A 5L37A 4LNQA 2MHVA 2F3VA 2AHOB 1Y8NB 4HN7A 2R7ZG 1C48A 3OWEB 4KKTA 1I5FA 3BDLA 1TY2A 1JWUD 4DR3L 4DXGA 4DR5L 1AW7A 3I73A 1A2TA 3H15A 4GNXB 1R4QB 3DEPA 3QIAA 2A6ED 1SYGA 4RFBA 4ID6A 2E2HB 3EVQA 1F77A 2JA8G 1EUJA 1IZ6A 2HD3A 1QVCA 2DJFC 2EY1A 1TS3A 3GP7A 3ULJA 3I8ZA 4IJLA 4LW1A 3U9SA 4DR7L 2NBFA 4YWKA 3UI2A 4X3KA 1CKOA 1MD2D 1O80A 1I50H 1N32L 1HR0Q 2A5HA 4K8IA 4UAIA 4F7XA 3K0XA 4LF9L 4XT1B 3TMEA 2E2DC 5F2DA 1H9RA 1PYBA 1XMOL 2B2WA 4QUFA 5KNDA 4CJ2C 1K8GA 3J80E 3A56A 1PTOC 1JOQA 3PQIA 4HR7B 2NVQB 1Q82C 3KF6A 4TKOB 5C5LA 4K2KA 1F9PA 2V1CC 2L11A 2QEJC 1N9WA 1UEAB 2Z0SA 4HIKA 2VNUD 4DN4M 4OONA 3WWVA 4DV6Q 4X3TA 3SXHA 1S72A 2UXDL 1BCPF 3S9WA 1CSPA 1BVSA 1XMQL 2I5MX 1EEFD 5EPLA 3MWYW 2WACA 1SAPA 5JVH3 1VMCA 1UWVA 5A2QL 2HQEA 2VUMH 4IFDG 5IY0A 2ZJPA 3BYYB 4DPGA 4QMGA 1EZ8A 3VYTA 1ESFA 2MP1A 1MJCA 1ET6A 2WP8J 2JK8A 3E9HA 4G7OC 4IZ8A 3FP9A 4MNOA 2IY5B 3EROA 3NE5B 1JICA 3D6CA 3CCJA 3KDFB 5C0XG 1SYBA 5D3IB 2L1BA 2JA9A 2R93B 4GN4B 1D1IA 4QF4A 4LFBL 2CCZA 1EYCA 3MEHA 4CJ1B 5JJZA 5M3MH 3E3XA 4KY5A 4WJWA 2F0VA 5IODA 1IKMA 1WTVA 4IO9A 5G3LF 2O5JC 5NUCA 1CKNA 1CI3M 4DUZQ 3FDTA 3F2DA 5LMNW 2UUAQ 4LF8Q 1N33Q 1PFSA 4WJ4A 1CK1A 2M9VA 5C3XA 1EU4A 1LTAD 4O0AA 1G91A 3D4WA 1PH8A 4GKKL 2Q2TA 2F0FA 4EQ5A 5IYCG 2M00A 3H94A 2KECA 4KK7A 1ICWA 1SDFA 2Z8LA 3DMUA 5E7NA 2A19A 3I72A 1BKBA 4OELB 4KHPQ 3PIO3 2JA7B 2QA4A 1V1PB 2HHHQ 2OTJA 2GN5A 4GNXC 3FPUB 2DJGC 2F3IA 2MNAA 2OTLA 3MXUA 3A5UA 4GLXA 4UP9A 1VQLA 4LFAL 2EYPA 1WTHA 5GROA 4J6HA 5IIFA 5D3DA 4KI0A 1A3VA 2D9UA 2F0GA 1LT5D 3EQLC 5LHY1 4RCOA 2OWOA 1ZEQX 3VA5A 3ICEA 1KAWA 1GUGA 3CF5A 4PZ7A 2TMPA 1VQEA 2JEBI 4NMZA 2EZVA 5DLQE 4QL5A 4TRDA 4GN3B 1EYGA 1LO5D 3W1GA 5C0XI 1VCIA 1NNXA 1ET9A 3IKJA 1BQQT 4R4TA 3AMUA 4C3HB 4V190 2VXWA 3P75A 1D8LA 3M4OH 4PZ6A 2X6LA 3H3VI 3DXJC 3PF4A 3QR8A 1HFNA 1KXLA 4L5SA 1BXTA 2ZXRA 3IRBA 2LY7A 4PNYA 5D65A 1HZ9A 4X62L 3PO2H 3BVGA 1Z7TA 3BDOA 1JOKA 4OL7A 5JPNC 2R93G 3SEBA 4DNRB 3AB9A 1VQPA 2K6AA 5ELCA 4KHZA 2OQKA 2K04A 3LGJA 2NVTB 2HDLA 4ZCKA 4P73A 1N34Q 4A3LH 1S4ZA 1C7YA 1EL0A 4BY1H 1TWHH 3N6RA 2R6GA 3PIOA 2K5VA 2RHSB 1XTDA 3L3OC 3IFDA 1L1OB 1YHAA 4F88A 4U673 1ONLA 1O7YA 1KABA 1K8AC 4AYBB 2ZTDA 4DK0A 5C4JB 1VQKA 1MKHA 1STBA 3A74A 3H0GB 4EGVA 1GUWA 2DGYA 3CCUA 1S5CD 1Q8KA 3T1YQ 2RDFA 5KNCA 4JI7L 4L5TA 3VR4A 3GTPH 3TZDA 1IBKQ 1I4QA 4DR6Q 3VDYA 4HMJA 2JA7G 4O2DA 3HOVH 4ALPA 1IYVA 3PO3B 1SR3A 4RCNA 3ULPA 1XNQL 5JOBA 2XTIA 4OIKA 1PZID 2LMCB 4B3TQ 4KY6A 2RCNA 4P75A 2CKZB 2B63H 3GTMH 3HOZB 2K4KA 4R4QA 5EPJA 2IPKD 3NELA 4JI1Q 3STBC 4DV7L 4OO1I 3RLNA 2EYLA 3NENA 3S1MB 4DV5L 4LF5Q 3OTOL 4R4CA 1PH6A 4FF3A 5HY6A 4CDCC 3U58A 3R2IA 3ERQA 2F0EA 1CFMA 1TVXA 3PUYA 3C3LA 1BCPB 1G2SA 4HJ9A 4DV4L 1EQTA 4K6LA 2B2UA 4H13C 3J81i 3K6OA 1WYDA 4X64Q 3M9BA 2PNHA 5FKAC 2F4VQ 1NR4A 3RLFA 1WFQA 3AU7A 1F9SA 3K57A 1JE5A 2WB1B 4C3HG 3VYSA 2NYZD 3AEVA 4GOPA 4KKSA 2WIIB 2RBMA 1K83H 1KLUD 4A75A 1D1KA 4O1NA 4A3FH 4HJ5A 2NZHA 1H9SA 1F9QA 2QEXA 4JC0A 1B44D 1J5EQ 2SOBA 2YU9B 1LABA 3TSSA 4BA2I 1IBML 1HFGA 4C56C 1F2MA 1GM5A 4KY7A 2VS1A 5IGGA 1Y1WH 1MIUA 1XNRL 1IW7C 4AYBG 5CC4A 1PFBA 2X6GA 4DXFA 2EYHA 4YY3L 1IL2A 3MAQA 3H0GG 2QDLA 4IUVA 3RN2A 4PZ8A 2AKWB 1JMCA 1G8ZD 2EOTA 2O2LD 1ENAA 3FKIH 2JSOA 3PGZA 4K8JA 5JJKA 3HOVB 2L9HA 4RWSC 5D14A 1BUVT 5J39A 3PO3G 3A8KE 1VQFA 4MTKA 5JEAG 4B08A 2CWPA 2EDGA 3HKSA 4XQQA 3NP8A 5M5XH 1KC8C 2DY8A 2XRSD 5I6WA 2CW0D 1TWFB 3HOZG 3RZOB 1X6OA 2AQ2B 2F0PA 4XT3B 3U9OA 1PV4A 2IT1A 3C1FA 3EFXD 4HEDA 2TSSA 1RKNA 4OHJA 1LTGD 4LUZA 1SJHD 1VQAA 2L0CA 1K3BC 1K73C 4DAPA 3T53B 4RGMA 5JPMC 1G2TA 2F0LA 4AYBE 3S17H 2FFKB 4O42A 1YVCA 3HOYH 1EY8A 4NXMQ 4FYDA 2CHBD 2Q8TA 1HPCA 4YWMA 1YJWA 3OHXC 4M1UB 4ZUJA 3S2DH 2I0QA 5C4XB 2WFWA 1PRTF 4K5XA 4BWGB 5IGEA 2RSNA 4DR2L 4A3IG 4LF7Q 4POGA 3BVZA 5IT9c 1JT8A 4A3BH 1TXYA 2WB1G 2VZAA 4X65L 2IHFA 4PQXA 4DAMA 1E24A 2FHTA 3Q0AA 1K83B 4JYAL 1Q90A 3ZJYC 5IYBH 2R7DA 4LF4L 4B3RQ 2B2UC 5GAGC 2NVYB 3BZCA 5IGCA 3J81E 3CCSA 4A3EB 3SK5A 2PW5A 1JC7A 5EJWA 1BCPC 5IWAL 2N49A 4QB4A 4X3SA 1JJCB 5CBAE 3J80c 5IOCA 1JCKB 1LM0A 1JB3A 4GOPC 4AQYL 4IUQA 4IFDJ 1PTOD 3EN2A 4AH6A 1HCZA 3D31A 2FJ2A 1UNSA 4DR1Q 3GTKH 1UE6A 1W6JA 1C4QA 1U4MA 3KOJA 4BXXH 2FXQA 5AFWA 1U5KA 5IT9L 1XPUA 3GV3A 4GKJL 3S14H 1BR9A 4KHVA 3BDCA 4A93B 1SNOA 2WB1E 5C0XJ 2KVMA 3TRZA 2C35B 2Z6KA 5T1IA 1QUQA 4JI6Q 4TQUS 2PYKA 1TWCB 4OX9Q 4JI0Q 1Y1VB 4A3MH 2JA5B 5E3FA 2ZXOA 5T1GA 5DNFA 1E1TA 1SBBB 1X65A 1SNQA 2QCPX 3U4VA 3HOVG 4ME5A 4TSSA 1GKHA 1TWAB 1UAPA 4DAYA 4N8X1 3IAYA 2K75A 1K9MC 4A3DH 1YHBA 4K6DA 1I94L 1PH5A 3K5MA 4IOAA 4JI3Q 3MVVA 1WD1A 1O7LA 3TP7A 3G6EA 3H3VH 3CW2C 1FGBD 2ASBA 1EQVA 1SFOH 1ML0D 2D0PA 1CA5A 4N8FA 2F0NA 2MPMA 3WDNA 5AJ3L 1AH9A 3M3YB 5JJLA 4DV1Q 4LAAA 1TU2B 3GTGB 2K5HA 1IHZA 3CQZB 1STYA 1KDBA 3GTOB 2QDBA 1MHWC 3S17B 1VQ7A 3T16A 2B2TA 1N36L 4PG3A 1EOVA 3T1HQ 1V1QA 1XWEA 1ASYA 2A6HC 2LXKA 3H09A 1HZCA 4ZLTF 2DN8A 3S1QB 5C4XG 3JC66 4FNFA 4KJNA 1LTLA 1H9KA 2P5ZX 1X3EA 1HHVA 1PFMA 3C46A 5COYA 2PNRC 1LTTD 4NDXA 4IPDA 3NBHB 2UUCL 4A3KB 1ILQA 4CBVA 5HURA 4EQPA 4XTCS 2EJMA 1DOMA 3IL8A 4A3EG 3K7AB 4WFN3 3HOWB 3NBHA 3I4MB 1E7ZA 5C44B 1XTCD 2BDOA 2FINB 1G6ZA 2K1BA 2FMMA 3UE0A 3SK6A 1OXXK 2I5LX 2QKIC 2XSCA 2G9DA 1A2UA 3MXGA 1A3TA 2CH4W 4OWXB 4DUYL 4JI5L 1SJED 4B9WA 1AP0A 3S16H 5C3EB 4A76A 1NY4A 2NTTA 3P7JA 2K05A 3D4RA 4OO1H 1L2FA 1R9TH 3NHHA 3A8JE 5C6AA 4WJ3M 3OMGA 1QWYA 5EKLA 1FNUA 4IPHA 4A93G 4B9XA 2PI2E 4P72A 3UDIA 4DK3C 1A6XA 3NQTA 4M8AA 4C2MH 3SR1A 3KK7A 1Y1VG 2JA5G 3NSWA 3CU7A 4ZQ3A 1FJGL 2KHIA 4HJAA 4V0BA 2B2VA 1UEBA 2B3GA 1VQJA 5CR3A 4DV0L 1EIYB 3P20A 1FR3A 1LUZA 1KNEA 2Z6KC 4X6AH 4RGTA 2PMZB 1HH2P 2HCIA 4BBRB 5HGQA 2E2JH 5CV9A 3A7AB 4YHHL 5IYDG 1GUOA 1F9RA 2LSSA 3KF6B 1SYFA 3MFYA 4JVZA 5M5WH 4Y7NH 4A3JB 3TS2A 2R7FA 2WV6D 4X66Q 4IALA 2NZOA 3MXPA 1VQ6A 3VR6A 4HJ7A 1MSGA 4RMFA 3BZKA 1II3A 1HA5A 3RZDH 4CKCA 4QIWB 3GTJH 1I6HH 5GAEC 1PRTB 1YHQA 3RR5A 2KA7A 2F0SA 3AFQA 3CD6A 3TP5A 2KBNA 4HIMA 1J8IA 3QJYA 5GADC 2K28A 4A3KG 5M3FB 2EVBA 1HNZQ 1YBYA 2VW9A 2YTXA 1QNKA 3ITPA 2A73B 4A3GH 5I9OA 3HOWG 4IUPA 1KD1C 5JVG3 4RA8A 3PSIA 3I4MG 3S1NH 4GZYC 2KUMA 5C44G 1MI2A 2NN6G 4JV5Q 4H44C 1KNAA 1SROA 3A0JA 4HJ8A 1FGUA 1HNWQ 1NE3A 2ZXPA 1HR0L 1D2BA 3STBD 3MA2B 3PIPA 5CV8A 3CKIB 3GTLH 4BXXG 1EFID 5C3EG 1WTRA 3I3CA 2UXBQ 1EIHA 1ESRA 1Q1EA 5ELNA 1CKNB 4KN4C 5HGTA 1TKWB 4HTHA 3OSOA 1P16A 1UE5A 4ZKCB 1AN8A 1BBXC 2E74C 2A68D 4FF1A 1CQFA 3LNNA 1Q8IA 2NZ1D 5KYIA 1TR5A 2VQEQ 2IX0A 5CV7A 4JPBW 1HUMA 1PH9A 2WKCA 1GO3E 3MZ5A 4DV6L 4JCVE 4JBMA 1KDCA 2R92H 2KCMA 2AQ1B 3SK8A 3HRZC 2QF7A 4JG2A 2I5HA 2BA0A 4APVA 4FF2A 1X3PA 4BBRG 2AUKA 1I50B 1XXGA 3EBEA 4ZYSA 1GXDC 2E75C 3GTQH 2ES2A 5BR8Q 3W1BA 3J7AV 4FF4A 4RGOS 2N88A 2HCCA 4NXNQ 4EQNA 5EKKA 3MC0B 5M5WB 2K52A 4A3JG 2F0TA 2CFMA 2DUDA 1XYIA 2RVLA 1I4XA 2N8NA 2K32A 3TN2A 1JWSD 1Y8OB 2OT2A 5JEAJ 2EE1A 2JQOA 4IFDI 3GTJB 1S5BD 4ZUIA 5GAHC 4DV2Q 4IQZA 1PXUA 5FLMG 1EFWA 1SMYC 1UE1A 2B2WC 3H3VC 1YNNC 2HT1A 3S2HH 3EJIA 4DUZL 4JOIA 1PH3A 3UE1A 5M3FG 2UUAL 4LF8L 2XVSA 1VQCA 1XPRA 1M1KC 2PMZE 2NVXH 1N33L 1X9NA 3DUZA 1S5DD 3K5NA 4RGNA 3CXCA 1KRTA 2VUMB 4BBSH 2F0IA 2LFNA 3VR5A 2J0TD 1X54A 4KTAA 4JBWA 2K5WA 1BOSA 1B3QA 4FP5D 1SEBD 1STEA 2HIVA 1R4PB 4NB3A 4DA2A 4UPAA 5EGTA 1PRTC 1B9MA 1OO9B 1K3RA 4B3MQ 4KHPL 1I3QH 2HHHL 2F0JA 2A6EC 2L55A 2EPBA 4QIWE 1QILA 1PFNA 2F0HA 4H02A 2DY7A 1VQ9A 3BYTB 1VDZA 4JI2Q 2F0UA 2ZTCA 2LS01 2QGQA 4B3SQ 4GLVB 1K8OA 3I4NH 2Q8RE 4YCVA 5IGDA 5M3MB 3TP6A 3LX0A 3U4ZA 1JB7A 2E2IH 4JBJA 2ICIA 3CC2A 3J7YW 2BE5C 5LL6X 2LXJA 4IPGA 4J1MA 1CQVA 2IWHA 2IW3A 1W6KA 2RSOA 2YTVA 1B53A 4R8NA 3KLSA 2A69C 2D62A 4JK1C 3Q24A 4KLKA 3T56B 3KBXA 5A2QE 1KDAA 3K5OA 2PQAA 1EY9A 2KOLA 5M9OA 4CDDC 2PPBC 4L63B 1D6EC 3OYYA 4OWWB 1G291 2AQ3B 5FLXc 1BCPD 4C1NK 1NTGA 2K33A 4YCWA 2CWAA 1DGSA 1GUTA 5DAUA 2H1EA 5GQOA 1QZGA 1JJ2A 1I4PA 1GVPA 1WTWA 4B3ML 4JI4Q 1B4OA 2PZWA 1PH4A 3RMHA 2UUBQ 1STAA 2I07B 5BN3A 1T9HA 4EX5A 4L5RC 2XRQD 2KHJA 5FJ8H 1HQRD 1VQHA 4N9TA 2KHSA 4UDUC 1OTCA 1N34L 4XXEA 1ICFB 1VQNA 1ZYRC 1K0SA 2CH4A 4K14A 1RD9D 4DV3Q 4R4OA 5FLXL 1MJEA 4GOPB 4BY7H 3CCVA 1EEID 2L5TA 1B50A 2VUMG 5G3LD 1EWIA 3HOUH 2MO0A 3G71A 3M4OB 1H9SB 3T1YL 3PV0A 3JAMc 4LF6Q 1IBKL 4DR6L 1H9JA 3D4DA 1CKMA 3NTHA 1HNXQ 3HZXA 4ZRZA 4JI8Q 1Q46A 1U0LA 5M5YH 4HIDA 4C3IH 2PZTA 2J4XA 2F0DA 1PLFA 1B7YB 3PO2B 3PF5A 2Z1CA 1LTID 4B3TL 4ODGA 1EWHA 2WINB 2RHQB 4JI4L 3OWFA 1HZBA 3OPOA 3I90A 4LFCQ 5M3MG 4JI1L 4R4IA 2BH8A 2YYZA 1B1ZA 3H91A 1B70B 1RL2A 5K36H 2A6HD 4LF5L 1PZJD 3EIVA 1VQ5A 4BY1B 3A55A 1TWHB 1IYUA 3S1RH 2XIWA 1WCMH 5KIXA 5CV6A 5CGKA 1NR2A 3G48A 1LT4D 3N52A 3TQYA 3I7FA 1D5MC 1KQSA 2K5DA 4HCSA 2F0WA 4RAUC 2KCTA 3K59A 2N3SA 3R2TA 4POFA 3JAML 3DM1A 1E22A 2LKVA 3MXNA 2VQFQ 2L12A 2DNCA 4A3CH 1SSOA 1ENCA 4TVAB 4BS9A 3GQBA 4X64L 3GDEA 4FXGC 3MTSA 1F2ZA 2RCFA 1SRUA 3KF8A 2F4VL 3GTPB 3CCEA 5DM73 2R7ZH 5IP9H 3S15H 3NPPA 1SYDA 3L0OA 1A8VA 3HOXH 1HR0W 1X32A 2RQXA 4CDFC 5LMNQ 1PZKD 4OIJA 2B63B 3GTMB 2IJ0A 1DD2A 3ONAB 2ALYB 2BCOA 4C1NI 4ABNA 2A74C 1HUNA 1ILPA 1J5EL 1GOZA 1PTOH 2JA8H 1DJRD 1SYCA 2UU9Q 3BJUA 2L4NA 3HS0C 3PCOB 2WAQB 1E2ZA 2HDMA 3V96A 5K5PA 2KJXA 1DYQA 2XNAC 1MSHA 2ZTEA 1CZGA 1P8LA 1OXTA 2KCNA 1QVFA 3KFUA 4NW2A 5ELBA 3K8AA 1S5ED 2SDFA 4LUVA 1TS2A 1DCZA 1RDPD 4XIGS 4P2CB 2NUCA 3CRKC 3L2PA 1J9OA 2GVAA 4H7BA 1HTPA 1SE2A 4IUUA 2AMCB 1DXMA 3E0EA 4KKUA 3SE0A 3GV6A 3TZUA 4A3FB 1XJVA 2ZM6Q 4CGYB 3PO2G 2PCFB 3LWUA 5E4WC 3NUCA 1EZ6A 1FNWA 2R3ZA 1IYJB 4XYQA 2PQEA 1UE7A 2R61A 1U9RA 3D8GA 1EWCA 3M4QA 1RF2D 4A3LG 2J7ZA 1EY7A 3VYUA 4BY1G 1Y8PB 2H5XA 1BBWA 4ZKBB 3R93A 1X55A 3CPFA 1STGA 4IFDH 1QUQB 2GVBA 2X69A 5C3WA 3B6YA 4L5QA 2HUGA 1Y1WB 3CCLA 4PMWA 3ZYYX 2JXMB 4NXML 1YJ9A 1LTBD 5KGUA 4LF7L 1HRJA 1U4LA 4Y52H 1PYWD 4RH6A 4DAYB 3FHWA 1DZ1A 3FKIB 4K0KQ 5C0XH 3BZDB 3QG1A 2IL8A 4BA1I 3J80L 1RODA 3M85A 1H95A 2G9HD 3VA7A 3HOXB 1O7IA 5J3BA 5M5XB 2B63G 4B3RL 4R9WA 1WTPA 2F0OA 2UXCQ 4N9PA 2M2LA 2E2HH 5ELEA 1VQGA 1PH7A 5CYUA 2F3WA 2F52A 4CKBA 2HIXA 1OXSC 1HQMC 2AWNA 1OXVA 1FD7D 3FPPA 5I6YA 2WAQG 1RIPA 1AFPA 5IYCH 4U68A 4DR1L 3HOYB 1A3UA 2EXZA 3K81C 4RG1A 5CV4A 3HG9A 3S2DB 3DEOA 1CHQD 1M90C 4H0LC 1LACA 2K7VA 3A8IE 4A3BB 1FNVA 5EPKA 1M4VA 4JI6L 1E2VA 1JWMD 4OX9L 4JI0L 1U4PA 3RD4A 2B8FA 1VQOA 2OQ0A 5JAVA 2RF4A 2ENBA 4DR3Q 2RDGA 5J1ZA 1SYEA 2B29A 4KJOA 1H9MA 1FYCA 1LYLA 4ME3A 1BO0A 3X3MA 3ND8A 4A3FG 1AEXA 1XX8A 1QOHA 2WKDA 3KYHC 2DNEA 4MHEA 3OMCA 3K58A 2EYMA 3I4LA 1M8AA 4JI3L 1YNJC 3MEFA 1CZWA 4DKAC 1A63A 4DFAA 1PH2A 1VMPA 2Q2HA 2WAQE 4WRDA 5FO7B 1STHA 1Z47A 4DR7Q 3GTKB 4DV1L 3D0FA 1VS0A 1RJTA 1DM0B 2CQAA 1LV9A 1EIFA 3QWNA 1N32Q 5CV5A 3NTKA 3S14B 1Y1WG 1SMYD 3FRPB 4LF9Q 1YNND 3T1HL 1XMOQ 1RTOA 1SE8A 2QW7A 3SK4A 2Z4HA 3J7AF 3QB3A 3C2PA 2BOSA 1MBYA 1VF7A 4A3MB 3PIP3 3OIQA 2K03A 1JR0D 4Q0FA 1EY4A 3FKIG 1IXRA 2E5LQ 5IP9G 5KEEA 3LWEA 2D0OA 2R93H 3SVMA 2OEOA 3NBIA 2EJFC 4QUCA 3HOXG 4E6IA 3WOEA 1X3FA 1PRTD 1RCVD 3I2ZA 3W2DA 4A3DB 1WOCA 4YIJA 2EY2A 1TT2A 3KBGA 4MN3A 4JW0A 3NTIA 2UXDQ 5E4XA 2SEBD 1Q86C 3KLWA 1SFOB 2VB3X 2XWJB 4ILWA 1XMQQ 1BNZA 1WTXA 2EYJA 3NWTA 5FO8B 2B2YA 4GNXA 4LMQD 4OWTB 1CTMA 2F4IA 3TP8A 2B8GA 5IT9E 1TQOA 3SHLA 4KD3A 3HOYG 2QILA 1PYSB 1F2LA 2BE5D 1KL9A 5KRUA 3UDGA 1BDOA 1U4RA 1E3PA 1PDQA 2JA7H 3S24A 2A69D 4K2LA 3PUXA 3AQQA 4PMBA 4A3BG 3I91A 4P74A 3HP3A 3AYHB 3RUZA 1DONA 3QOLA 1WI5A 4LFBQ 2F1MA 2B2TC 2F0QA 5I9PA 2E5LL 4HIOA 5IYBG 3I70A 4DNTB 1L0WA 3I4OA 3DLLA 2E76C 3G4SA 3CCRA 1AZPA 3A5ZB 3CPWA 1JORA 1EY6A 2IX3A 3I56A 2K14A 1S40A 1PH1A 1VQIA 4EVOA 1D7QA 4RHRA 2SNSA 4GKKQ 3S16B 4G4KA 1C9OA 3CP0A 1R9TB 2A1AA 4X66L 3T13A 1GUNA 4NPSA 4C3HH 1B8AA 1SXTA 1I4HA 1A0IA 3R3OA 2E8GA 1ZYRD 3K7UC 2RA4A 5DM63 1PMRA 3C1EA 4C2MB 3Q22A 1S3OA 1L0YB 1QNUA 4LFAQ 4A3MG 3DM3A 3TEHB 3CMEA 2F0KA 4MTNA 1LLRD 4HAEA 5IE8A 1TY0A 1B9NA 5CMDA 5LL6S 3HGBA 4EQOA 4IJHA 4DR4Q 3KDFA 1HNZL 2NVTH 4A3DG 5ELFA 2JEAI 1XPOA 1KTKA 3MHBA 3RN5A 1TS4A 2E2JB 1GUSA 2YV5A 3IFTA 1G6PA 3A54A 5ISRA 4JV5L 2OCEA 1HXYD 1E1OA 2AUJD 2JYOA 1F2YA 1I4RA 3M4PA 1HNWL 1STNA 2B2VC 3W5OA 5C4JH 3H6MA 4Y7NB 1YNXA 3X3NA 3H0GH 4R8IA 1E2WA 1X56A 1GHKA 1Q1BA 4LUOA 4OGQC 4FDBA 2UXBL 3RZDB 2MO1A 4HMIA 2NN6I 1I6HB 3KJOA 4F8MA 1DOLA 2EYOA 1NSNS 4WORA 3PO3H 2B2YC 1V8QA 5JEAH 1IW7D 4X62Q 2MJ8A 3ND9A 5FO9B 1Z6HA 2CQOA 3HOZH 1V1PA 2PO4A 2VQEL 2F03A 1C8CA 4XDXA
chains in the Genus database with same CATH topology
4IUNA 4RHSA 4A3GB 4DGZA 2JP1A 3BVMA 2C9OA 4RKLA 3S1NB 5C5MA 1SE4A 4Q5VA 4LJZC 1JE4A 4S3SA 1KAAA 5KYLA 3M7GA 4XQNA 1QJOA 3GTLB 2C5CA 4OO1G 3E5SA 2NWGA 1JQYD 2BDNA 3E0JA 3TBIB 1QCBD 3L7ZC 2XWBB 1A15A 4NP5A 1O7ZA 3M4YA 4F87A 4FXDA 3D3RA 1MGSA 2Q8IB 2R92B 1SNMA 3CRLC 1LTRD 1NAPA 1EIGA 1EY0A 3HEJA 4CJ0B 3GTQB 4PMCA 1WD0A 1TIID 2PW7A 2MUYA 4DU9A 3BS1A 2CVRA 2F0MA 1EU3A 5EBCA 3FEWX 2ID0A 2Y0SB 2EY6A 1PTOF 3A7LA 1SNPA 5EKIA 3GO5A 1VF5C 3S2HB 3E6ZX 3J81L 2Z4IA 4XYOA 1NCVA 2O5IC 2AWOA 2NVXB 1LT3D 4BBSB 1CT1D 1EYDA 3K0YA 1QG7A 3K5LA 1V43A 1L0XB 5ELDA 4HCEA 4FO2A 2IX1A 1WTQA 2A68C 5CBEE 2N55A 1I3QB 1X3QA 4J8QA 2EJGC 4KD4A 4A3IB 2O4XA 5EBDA 3EA6A 2FMCA 2NB0A 3VR2A 1EYAA 2I46A 3I4NB 1S5FD 4G7ZC 1ZXTA 2E2IB 1V1OA 1SE3A 1EOTA 1UUPA 1OXUA 1LT6D 1WTOA 3QOJA 3HKZB 4KMUC 1B2TA 3WOFA 4I65A 3DHQA 5C4HA 2MGSA 3OW7A 4FXKC 3OOCA 2KQ3A 2JE6I 5DEHA 4X3UA 4K5VA 3L9AX 1T5EA 2V4DA 1TWGB 2D2CC 2K5QA 1O78A 1YNJD 4LK1C 5EQ0A 2SNMA 4CHTB 4DK1A 1D5XC 1IKLA 3NXWA 5C4ZA 4C3JB 1QB5D 3VYRA 4BY7B 1AZQA 3T51B 4KN7C 1GJXA 5CORA 5I2YA 1RTNA 2NTSA 3HOUB 2KEDA 5IGBA 1GHJA 1WVLA 4KV6A 1HA6A 1DOKA 2OF1A 4XQJA 3Q23A 3NWSA 2JA6B 5M5YB 3BG3A 4C3IB 1I6VC 3VR3A 3CHBD 2ICEC 2EY5A 2OXPA 1NUCA 2H4OA 4I7ZC 3GD7A 3G7LA 3KLRA 2RDHA 2RKSA 4G7HC 2KEEA 4K5WA 5FOBB 1EY5A 5KNBA 3S1RB 1JOOA 1WCMB 3F2UA 2GA4B 5BN5A 1CHPD 1T5XD 2NN6H 3W3AA 5I2XA 1K8MA 5FLXE 4RKBA 1B3AA 5I4DA 1CM9A 1Q12A 3NQIA 5A35A 2PZUA 4IUTA 2VB2X 2R7ZB 2BA1A 3S15B 4NKLA 1QE6A 3G6JB 3TDQA 4MIUA 1Q3LA 1TS5A 3DWQA 2EYFA 3PUZA 4ZAIA 1D5ZC 3KUPA 3FVQA 3P1HA 3PUWA 3M7NA 4IURA 1PTOB 2JA8B 1IL8A 1E0BA 1LTSD 5E1FA 3O13A 2KCCA 2XN9C 4DF7A 3FMCA 4HSVA 1CA6A 4L6TB 3KLSX 1Y69U 4Z9CB 3MFGA 1SNCA 4DAVA 4C3JG 3Q6SA 3T4AC 3JAME 5TSSA 4PV1C 3DWAA 4QCLA 5BN4A 1ZKOA 2K01A 3URYA 4ZK9B 1HTLD 3DWPA 4ULLA 4IN3A 1KLGD 4L8JA 1ENFA 1I4GA 1RHPA 4G57A 4C3IG 4CKEA 3SDZA 5J22A 3OIPA 2B39A 3PUVA 4FVMA 5IGFA 3R8BA 5K36G 3PMFA 3D6WA 1BF4A 2ZT9C 5FK9C 4HSPA 3QO2A 3NK9A 1SNDA 3V2TA 2CW0C 2D5DA 3V05A 2MHVA 2F3VA 1Y8NB 4HN7A 1C48A 3OWEB 4KKTA 3BDLA 1TY2A 1JWUD 4DXGA 1AW7A 3I73A 1A2TA 1R4QB 3DEPA 3QIAA 2A6ED 1SYGA 4RFBA 4ID6A 2E2HB 3EVQA 1F77A 2EY1A 1TS3A 3GP7A 3I8ZA 3U9SA 2NBFA 3UI2A 4X3KA 1MD2D 1O80A 2A5HA 4K8IA 4UAIA 4F7XA 4XT1B 3TMEA 2E2DC 5F2DA 1H9RA 2B2WA 4QUFA 5KNDA 4CJ2C 3J80E 3A56A 1PTOC 1JOQA 4HR7B 2NVQB 4TKOB 5C5LA 4K2KA 1F9PA 2L11A 2QEJC 1UEAB 2VNUD 4DN4M 4X3TA 3SXHA 1BCPF 3S9WA 1EEFD 5EPLA 3MWYW 2WACA 1SAPA 5JVH3 1VMCA 5A2QL 2HQEA 4IFDG 3BYYB 4QMGA 1EZ8A 3VYTA 1ESFA 2MP1A 1ET6A 2WP8J 4G7OC 4IZ8A 3EROA 3NE5B 1JICA 3D6CA 5C0XG 1SYBA 5D3IB 2L1BA 2R93B 1D1IA 4QF4A 1EYCA 3MEHA 4CJ1B 5JJZA 4KY5A 4WJWA 2F0VA 5IODA 1IKMA 1WTVA 2O5JC 5G3LF 5NUCA 1CI3M 3FDTA 1CK1A 2M9VA 5C3XA 1EU4A 1LTAD 1G91A 3D4WA 2F0FA 2M00A 3H94A 2KECA 4KK7A 1ICWA 1SDFA 2Z8LA 3DMUA 3I72A 3PIO3 2JA7B 1V1PB 3FPUB 3MXUA 2EYPA 4J6HA 5IIFA 5D3DA 4KI0A 1A3VA 2D9UA 2F0GA 1LT5D 3EQLC 5LHY1 4RCOA 1ZEQX 3VA5A 1GUGA 2TMPA 2JEBI 4NMZA 2EZVA 4TRDA 1LO5D 5C0XI 1VCIA 1ET9A 3IKJA 1BQQT 3AMUA 4C3HB 4V190 2VXWA 3P75A 2X6LA 3DXJC 1HFNA 1BXTA 2ZXRA 2LY7A 4PNYA 5D65A 3BVGA 1Z7TA 3BDOA 1JOKA 5JPNC 4OL7A 3SEBA 4DNRB 3AB9A 2K6AA 5ELCA 4KHZA 2K04A 2NVTB 2HDLA 1S4ZA 1EL0A 3N6RA 2R6GA 3L3OC 3IFDA 4F88A 4U673 1ONLA 1O7YA 1KABA 4AYBB 4DK0A 5C4JB 1STBA 3H0GB 4EGVA 1GUWA 1S5CD 2RDFA 5KNCA 3VR4A 3TZDA 1I4QA 4HMJA 1IYVA 3PO3B 4RCNA 5JOBA 4OIKA 1PZID 2LMCB 4KY6A 3HOZB 5EPJA 2IPKD 4OO1I 2EYLA 3S1MB 4FF3A 3ERQA 3R2IA 2F0EA 1CFMA 1TVXA 3PUYA 3C3LA 1BCPB 1G2SA 1EQTA 4K6LA 2B2UA 4H13C 3K6OA 5FKAC 1NR4A 3RLFA 3AU7A 1F9SA 3K57A 2WB1B 4C3HG 3VYSA 2NYZD 4KKSA 2WIIB 2RBMA 1KLUD 1D1KA 4O1NA 1H9SA 1F9QA 1B44D 2SOBA 2YU9B 1LABA 3TSSA 4BA2I 1HFGA 4C56C 1F2MA 4KY7A 5IGGA 1IW7C 5CC4A 1PFBA 2X6GA 4DXFA 2EYHA 3MAQA 4IUVA 1G8ZD 2EOTA 2O2LD 1ENAA 2JSOA 4K8JA 3HOVB 2L9HA 4RWSC 5D14A 1BUVT 5J39A 3A8KE 5JEAG 4B08A 2EDGA 4XQQA 3NP8A 5I6WA 2DY8A 2XRSD 2CW0D 1TWFB 3RZOB 2AQ2B 2F0PA 4XT3B 3U9OA 2IT1A 3C1FA 3EFXD 4HEDA 2TSSA 1RKNA 4OHJA 1LTGD 1SJHD 2L0CA 4DAPA 3T53B 4RGMA 5JPMC 1G2TA 2F0LA 2FFKB 4O42A 1EY8A 4FYDA 2CHBD 2Q8TA 1HPCA 3OHXC 4M1UB 4ZUJA 5C4XB 1PRTF 4K5XA 4BWGB 5IGEA 2RSNA 3BVZA 4PQXA 2FHTA 3Q0AA 1K83B 1Q90A 2B2UC 2NVYB 5IGCA 3J81E 4A3EB 3SK5A 2PW5A 1JC7A 5EJWA 1BCPC 4QB4A 4X3SA 5CBAE 5IOCA 1JCKB 1JB3A 4IUQA 4IFDJ 1PTOD 1HCZA 3D31A 2FJ2A 1UNSA 1W6JA 1C4QA 1U4MA 5AFWA 5IT9L 3GV3A 1BR9A 4KHVA 3BDCA 4A93B 1SNOA 5C0XJ 2KVMA 5T1IA 4TQUS 2PYKA 1TWCB 1Y1VB 2JA5B 5E3FA 2ZXOA 5T1GA 5DNFA 1SBBB 1SNQA 2QCPX 4ME5A 4TSSA 1TWAB 1UAPA 4DAYA 3IAYA 4K6DA 3K5MA 3MVVA 1WD1A 1O7LA 3TP7A 1FGBD 1EQVA 1ML0D 1CA5A 2F0NA 2MPMA 3WDNA 3M3YB 4LAAA 1TU2B 3GTGB 1IHZA 3CQZB 1STYA 1KDBA 3GTOB 2QDBA 3S17B 3T16A 2B2TA 1XWEA 2A6HC 3H09A 4ZLTF 2DN8A 3S1QB 4FNFA 4KJNA 1H9KA 1HHVA 1PFMA 3C46A 5COYA 2PNRC 1LTTD 4NDXA 4A3KB 1ILQA 4CBVA 5HURA 4EQPA 4XTCS 2EJMA 1DOMA 3IL8A 3K7AB 4WFN3 3HOWB 3NBHA 3I4MB 5C44B 1XTCD 2BDOA 2FINB 1G6ZA 2K1BA 2FMMA 3SK6A 1OXXK 2QKIC 2XSCA 2G9DA 1A2UA 3MXGA 1A3TA 1SJED 4B9WA 1AP0A 5C3EB 3D4RA 2NTTA 3P7JA 2K05A 4OO1H 3NHHA 3A8JE 5C6AA 3OMGA 1QWYA 5EKLA 1FNUA 4B9XA 1A6XA 3NQTA 4M8AA 3SR1A 3KK7A 3NSWA 3CU7A 4ZQ3A 4V0BA 2B2VA 5CR3A 3P20A 1FR3A 1KNEA 4RGTA 2PMZB 2HCIA 4BBRB 5CV9A 3A7AB 1GUOA 1F9RA 3MFYA 1SYFA 4A3JB 2WV6D 4IALA 3MXPA 3VR6A 1MSGA 1II3A 1HA5A 4CKCA 4QIWB 1PRTB 2KA7A 2F0SA 3TP5A 1J8IA 3QJYA 2K28A 5M3FB 2EVBA 1QNKA 3ITPA 2A73B 5I9OA 4IUPA 5JVG3 4RA8A 4GZYC 2KUMA 1MI2A 2NN6G 4H44C 1KNAA 2ZXPA 1D2BA 3MA2B 5CV8A 3CKIB 1EFID 1WTRA 3I3CA 1EIHA 1ESRA 1Q1EA 5HGTA 4KN4C 1TKWB 4HTHA 3OSOA 4ZKCB 1AN8A 1BBXC 2E74C 2A68D 4FF1A 1CQFA 3LNNA 1Q8IA 2NZ1D 5KYIA 1TR5A 2IX0A 5CV7A 1HUMA 2WKCA 3MZ5A 1KDCA 2AQ1B 3SK8A 3HRZC 2QF7A 2BA0A 4FF2A 1X3PA 2AUKA 1I50B 1XXGA 4ZYSA 1GXDC 2E75C 3J7AV 4FF4A 4RGOS 2N88A 2HCCA 4EQNA 5EKKA 3MC0B 5M5WB 2F0TA 1XYIA 2RVLA 1I4XA 2K32A 3TN2A 1JWSD 1Y8OB 2OT2A 5JEAJ 2EE1A 4IFDI 3GTJB 1S5BD 4ZUIA 4IQZA 1PXUA 1SMYC 2B2WC 3H3VC 1YNNC 3EJIA 2XVSA 3DUZA 1S5DD 3K5NA 4RGNA 2VUMB 2F0IA 2LFNA 3VR5A 2J0TD 4KTAA 4JBWA 2K5WA 1BOSA 4FP5D 1SEBD 1STEA 1R4PB 4DA2A 5EGTA 1PRTC 1B9MA 1OO9B 2F0JA 2A6EC 2L55A 2EPBA 1QILA 1PFNA 2F0HA 2DY7A 3BYTB 1VDZA 2F0UA 2LS01 1K8OA 2Q8RE 5IGDA 5M3MB 3TP6A 3LX0A 2ICIA 3J7YW 2BE5C 5LL6X 4J1MA 1CQVA 2IWHA 2IW3A 1W6KA 2RSOA 1B53A 4R8NA 3KLSA 2A69C 2D62A 4JK1C 3Q24A 3T56B 3KBXA 5A2QE 1KDAA 3K5OA 1EY9A 2KOLA 5M9OA 2PPBC 4L63B 1D6EC 1G291 2AQ3B 1BCPD 4C1NK 2K33A 1GUTA 5DAUA 2H1EA 1I4PA 1WTWA 1B4OA 2PZWA 3RMHA 1STAA 2I07B 5BN3A 2XRQD 1HQRD 4N9TA 2KHSA 4UDUC 4XXEA 1ZYRC 4K14A 1RD9D 5FLXL 1EEID 2L5TA 1B50A 5G3LD 3M4OB 1H9SB 3PV0A 1H9JA 3D4DA 3NTHA 3HZXA 4ZRZA 2PZTA 2J4XA 2F0DA 1PLFA 3PO2B 2Z1CA 1LTID 4ODGA 1EWHA 2WINB 3OWFA 3OPOA 3I90A 2YYZA 3H91A 1B1ZA 5K36H 2A6HD 1PZJD 4BY1B 3A55A 1TWHB 1IYUA 2XIWA 5KIXA 5CV6A 5CGKA 1NR2A 1LT4D 3N52A 1D5MC 2K5DA 4HCSA 2F0WA 4RAUC 3K59A 3R2TA 3JAML 3DM1A 2LKVA 3MXNA 2L12A 2DNCA 1SSOA 1ENCA 4BS9A 3GQBA 4FXGC 3MTSA 1F2ZA 3KF8A 3GTPB 5DM73 3NPPA 1SYDA 1X32A 2RQXA 1PZKD 4OIJA 2B63B 3GTMB 2IJ0A 1DD2A 3ONAB 4C1NI 2BCOA 4ABNA 2A74C 1HUNA 1ILPA 1GOZA 1PTOH 1DJRD 1SYCA 2L4NA 3HS0C 2WAQB 1E2ZA 2HDMA 3V96A 5K5PA 2KJXA 1DYQA 2XNAC 1MSHA 1CZGA 1OXTA 2KCNA 4NW2A 5ELBA 1S5ED 2SDFA 1TS2A 1DCZA 1RDPD 4XIGS 4P2CB 2NUCA 3CRKC 1J9OA 4H7BA 1HTPA 1SE2A 4IUUA 1DXMA 4KKUA 3SE0A 3GV6A 3TZUA 4A3FB 4CGYB 2PCFB 3LWUA 5E4WC 3NUCA 1EZ6A 1FNWA 2R3ZA 4XYQA 2PQEA 2R61A 1U9RA 3D8GA 1EWCA 1RF2D 2J7ZA 1EY7A 3VYUA 1Y8PB 4ZKBB 3R93A 1STGA 4IFDH 2X69A 5C3WA 2HUGA 1Y1WB 4PMWA 3ZYYX 2JXMB 1LTBD 5KGUA 1HRJA 1U4LA 1PYWD 4RH6A 1DZ1A 3FKIB 5C0XH 3BZDB 3QG1A 2IL8A 4BA1I 3J80L 1RODA 3M85A 2G9HD 3VA7A 3HOXB 5M5XB 4R9WA 1WTPA 2F0OA 4N9PA 2M2LA 5ELEA 5CYUA 2F3WA 4CKBA 1OXSC 1HQMC 2AWNA 1OXVA 1FD7D 3FPPA 5I6YA 1AFPA 4U68A 3HOYB 1A3UA 2EXZA 5CV4A 3HG9A 3S2DB 3DEOA 1CHQD 4H0LC 1LACA 2K7VA 3A8IE 4A3BB 1FNVA 5EPKA 1M4VA 1E2VA 1JWMD 1U4PA 3RD4A 2B8FA 5JAVA 2ENBA 2RDGA 5J1ZA 1SYEA 4KJOA 1H9MA 1FYCA 1BO0A 3X3MA 3ND8A 1AEXA 1XX8A 1QOHA 2WKDA 2DNEA 4MHEA 3OMCA 3K58A 2EYMA 3I4LA 1M8AA 1YNJC 1CZWA 4DFAA 1VMPA 4WRDA 5FO7B 1STHA 1Z47A 3GTKB 1RJTA 1DM0B 2CQAA 1LV9A 3QWNA 5CV5A 3NTKA 3S14B 1SMYD 3FRPB 1YNND 1RTOA 3SK4A 2Z4HA 3J7AF 3QB3A 3C2PA 2BOSA 1MBYA 1VF7A 4A3MB 3PIP3 3OIQA 2K03A 1JR0D 4Q0FA 1EY4A 5KEEA 3LWEA 3SVMA 2OEOA 3NBIA 2EJFC 4QUCA 4E6IA 3WOEA 1PRTD 1RCVD 4A3DB 3W2DA 4YIJA 2EY2A 1TT2A 3KBGA 4MN3A 3NTIA 5E4XA 2SEBD 1SFOB 2VB3X 2XWJB 4ILWA 1BNZA 1WTXA 2EYJA 3NWTA 5FO8B 2B2YA 4LMQD 1CTMA 2F4IA 3TP8A 2B8GA 5IT9E 1TQOA 3SHLA 4KD3A 2QILA 1F2LA 2BE5D 5KRUA 1BDOA 1U4RA 1PDQA 2A69D 4K2LA 3PUXA 4PMBA 3I91A 3HP3A 3RUZA 1DONA 3QOLA 2F1MA 2B2TC 2F0QA 5I9PA 3I70A 4DNTB 2E76C 1AZPA 1JORA 1EY6A 2IX3A 4EVOA 4RHRA 2SNSA 3S16B 4G4KA 1R9TB 3T13A 1GUNA 1SXTA 1I4HA 3R3OA 1ZYRD 2RA4A 5DM63 1PMRA 3C1EA 4C2MB 3Q22A 1L0YB 1QNUA 2F0KA 1LLRD 4HAEA 1TY0A 1B9NA 5CMDA 5LL6S 3HGBA 4EQOA 5ELFA 2JEAI 1KTKA 3MHBA 1TS4A 2E2JB 1GUSA 3IFTA 3A54A 5ISRA 1HXYD 2AUJD 2JYOA 1F2YA 1I4RA 1STNA 2B2VC 4Y7NB 3H6MA 3X3NA 4R8IA 1E2WA 1GHKA 1Q1BA 4OGQC 3RZDB 4HMIA 2NN6I 1I6HB 4F8MA 1DOLA 2EYOA 1NSNS 4WORA 2B2YC 1V8QA 5JEAH 1IW7D 2MJ8A 3ND9A 5FO9B 1Z6HA 1V1PA 2PO4A 2F03A 1C8CA 4XDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUN A;  1AEX A;  2F0F A;  5C4Z A;  5HGT A;  2EYH A;  2F0U A;  3BDC A;  4HTH A;  1SNC A;  3OSO A;  4ODG A;  5EKL A;  1SNO A;  2M00 A;  3NUC A;  3OWF A;  5IGD A;  1EZ6 A;  4DGZ A;  4B9X A;  4RKL A;  3TP6 A;  5C5M A;  3LX0 A;  4K8I A;  3DMU A;  2RDF A;  2PYK A;  3OMC A;  3NQT A;  1EYD A;  2EYM A;  4F7X A;  2PQE A;  1JOR A;  1U9R A;  3D8G A;  3SR1 A;  5E3F A;  1ENA A;  4HMJ A;  3TME A;  1EY6 A;  5F2D A;  4DFA A;  4K8J A;  5KYI A;  5IGB A;  1TR5 A;  4WRD A;  4J1M A;  4S3S A;  1EY7 A;  5CV7 A;  1SNQ A;  5J39 A;  4EVO A;  4ME5 A;  1STH A;  4KV6 A;  1KAA A;  4ZQ3 A;  5JOB A;  5KIX A;  2SNS A;  5CV6 A;  5KYL A;  3MZ5 A;  5CGK A;  4R8N A;  2OF1 A;  1KDC A;  4KY6 A;  1STG A;  3NP8 A;  2EYP A;  5I6W A;  5CR3 A;  4J6H A;  5C3W A;  5IIF A;  1JOQ A;  5CV5 A;  3SK8 A;  4KD4 A;  3E5S A;  4K6D A;  4G57 A;  2F0P A;  5C5L A;  4K2K A;  2F0W A;  3T13 A;  3U9O A;  1A3V A;  2EYL A;  2F0H A;  2O4X A;  2F0G A;  1KDA A;  3C1F A;  3MVV A;  3TP7 A;  2LKV A;  5J22 A;  5CV9 A;  1EYA A;  1EY9 A;  1EQV A;  2EY5 A;  3R3O A;  2OXP A;  1ENC A;  5M9O A;  1RKN A;  3SK4 A;  5KGU A;  1NUC A;  2F0N A;  3QB3 A;  4NP5 A;  3VA5 A;  1F2Z A;  5IGF A;  3C1E A;  3ERQ A;  2RKS A;  2F0E A;  3SXH A;  4LAA A;  4K5W A;  3S9W A;  1IHZ A;  1EY4 A;  1KDB A;  1STY A;  1SYF A;  2F0L A;  4NMZ A;  3PMF A;  1EY5 A;  5EKK A;  4TRD A;  4EQN A;  5DAU A;  5KEE A;  2QDB A;  1SYD A;  2F0K A;  4IAL A;  2F0T A;  1JOO A;  3MXP A;  1EY8 A;  3T16 A;  2OEO A;  2WAC A;  4E6I A;  4ZUJ A;  1II3 A;  1SNM A;  2HQE A;  2PZW A;  3QOJ A;  4EQO A;  1STA A;  4K5X A;  5IGE A;  4I65 A;  4RKB A;  4YIJ A;  4KJN A;  2EY2 A;  1TT2 A;  3DHQ A;  1EZ8 A;  4QMG A;  5C4H A;  3NK9 A;  2F0O A;  3MHB A;  1SND A;  1EY0 A;  3V2T A;  4N9P A;  4ZUI A;  3HEJ A;  3P75 A;  2KQ3 A;  2F0S A;  5DEH A;  2F3W A;  4N9T A;  5ISR A;  3TP5 A;  4PMC A;  1SYC A;  2EYJ A;  2PZU A;  2KHS A;  4K5V A;  2PW7 A;  2RBM A;  4IZ8 A;  4NDX A;  2F3V A;  3EJI A;  3ERO A;  4DU9 A;  1F2Y A;  5CC4 A;  5HUR A;  3D6C A;  4NKL A;  4EQP A;  5I6Y A;  3TP8 A;  4PNY A;  1STN A;  3H6M A;  1SYB A;  5IGC A;  1TQO A;  3SHL A;  4KD3 A;  2F0M A;  4MIU A;  5K5P A;  3SK5 A;  2PW5 A;  1JOK A;  3ITP A;  1A3U A;  2EXZ A;  4K14 A;  3BDL A;  4OL7 A;  4QF4 A;  5I9O A;  1EYC A;  3MEH A;  4QB4 A;  2EYF A;  5CV4 A;  2SOB A;  5KRU A;  4KY5 A;  5IOC A;  2F0I A;  1A2T A;  2F0V A;  4KTA A;  5IOD A;  3SK6 A;  4HMI A;  3P1H A;  2SNM A;  4F8M A;  2EYO A;  1SYG A;  5NUC A;  1NSN S;  4WOR A;  4K2L A;  2EY6 A;  4ID6 A;  5EGT A;  1A2U A;  4PMB A;  1A3T A;  2NUC A;  3EVQ A;  1SNP A;  3RUZ A;  4B9W A;  3QOL A;  3NXW A;  3D4D A;  1F2M A;  4H7B A;  5JAV A;  3HZX A;  5CV8 A;  2F0J A;  1KAB A;  2ENB A;  2F0Q A;  4KY7 A;  5E1F A;  5I9P A;  2EY1 A;  5C3X A;  4DF7 A;  5J1Z A;  5IGG A;  1SYE A;  4KJO A;  3NHH A;  2PZT A;  4KHV A;  2F0D A;  3D4W A;  5C6A A;  1STB A;  3OMG A; 
#chains in the Genus database with same CATH topology
 4IUN A;  3S1M H;  2MQH A;  4RHS A;  4A3G B;  4DGZ A;  2JP1 A;  3BVM A;  2C9O A;  1YEZ A;  4RKL A;  3S1N B;  5C5M A;  4DR4 L;  2ZJR A;  1SE4 A;  1Y14 B;  4Q5V A;  4YCU A;  5LMU Q;  4LJZ C;  3ER0 A;  1JE4 A;  4S3S A;  1SMX A;  1KAA A;  5KYL A;  5BR8 L;  1EQR A;  3M7G A;  4XQN A;  1YIJ A;  2Q2I A;  1QVG A;  1QJO A;  1CSQ A;  4NXN L;  3GTL B;  4A3I H;  2IHE A;  2C5C A;  1VQD A;  3RLO A;  3CCM A;  4OO1 G;  3E5S A;  2NWG A;  4JI7 Q;  5IP7 H;  1JQY D;  2BDN A;  3E0J A;  4P71 A;  3I55 A;  1AE3 A;  3TBI B;  1QCB D;  3L7Z C;  1YJN A;  2XWB B;  1V9P A;  1A15 A;  1XNQ Q;  4NP5 A;  4GS3 A;  1O7Z A;  3M4Y A;  4F87 A;  3CC4 A;  5EAY A;  2EIF A;  2ATW A;  4FXD A;  3D3R A;  1MGS A;  4DV2 L;  4LWC A;  4GLA C;  2Q8I B;  4DV7 Q;  2PQA B;  4DV5 Q;  2ZJQ A;  3TRE A;  2R92 B;  1SNM A;  3OTO Q;  2YU9 H;  3CRL C;  1LTR D;  4CDE C;  3J81 c;  1NAP A;  1EIG A;  1EY0 A;  1PVO A;  4QGU A;  3HEJ A;  4CJ0 B;  3GTQ B;  4PMC A;  1WD0 A;  1TII D;  2PW7 A;  4DV4 Q;  2MUY A;  3UDX A;  4DU9 A;  2EQS A;  5LMU L;  1TWG H;  5H1S E;  3BS1 A;  2CVR A;  2F0M A;  1EQQ A;  1PA6 A;  1EU3 A;  3J7A 5;  1L1O A;  2G5D A;  2EXD A;  5EBC A;  4UY8 C;  3FEW X;  4JI2 L;  2ID0 A;  1KIX A;  4B3S L;  2Y0S B;  2EY6 A;  1PTO F;  3A7L A;  1SNP A;  5EKI A;  3GO5 A;  1VF5 C;  3S2H B;  3E6Z X;  4IOC A;  3J81 L;  1TWF H;  2Z4I A;  3U50 C;  4XYO A;  1NCV A;  2O5I C;  3RZO H;  2AWO A;  2JJQ A;  1KHI A;  4C3J H;  2NVX B;  3ERS X;  3KJP A;  2N78 A;  1IBM Q;  4UHV A;  4A3G G;  1LT3 D;  4BBS B;  1CT1 D;  1EYD A;  1VQ8 A;  3K0Y A;  1QG7 A;  3K5L A;  1V43 A;  1L0X B;  5ELD A;  4HCE A;  3E9I A;  4FO2 A;  2IX1 A;  1WTQ A;  1XNR Q;  4JOI C;  2A68 C;  1X3G A;  4YY3 Q;  5CBE E;  2N55 A;  1I3Q B;  1X3Q A;  2JA6 H;  4J8Q A;  5C4X H;  2EJG C;  4KD4 A;  3CCQ A;  4A3I B;  1JJG A;  2O4X A;  5EBD A;  1FL0 A;  3EA6 A;  2FMC A;  4I7A A;  2NB0 A;  3VR2 A;  1EYA A;  2I46 A;  3I4N B;  1S5F D;  4G7Z C;  1NMG A;  2UUB L;  1K28 A;  1ZXT A;  2E2I B;  1V1O A;  1SE3 A;  1EOT A;  2K5N A;  3Q8D A;  1HZA A;  1YI2 A;  2NVY H;  4A3E H;  1UUP A;  1OXU A;  3MXN B;  1J6Q A;  1LT6 D;  1WTO A;  1W2B A;  1IBL Q;  3QOJ A;  2R92 G;  3HKZ B;  4KMU C;  1B2T A;  3WOF A;  3KF8 B;  4I65 A;  3DHQ A;  1KRS A;  5C4H A;  2MGS A;  3OW7 A;  4DK6 C;  2HQL A;  4FXK C;  3OOC A;  4DV3 L;  2KQ3 A;  2JE6 I;  5DEH A;  4X3U A;  1AE2 A;  4K5V A;  3L9A X;  1VQM A;  1T5E A;  1NBW A;  3J7Z C;  3F1Z A;  5JJI A;  4QY7 A;  2V4D A;  1TWG B;  2D2C C;  4DR2 Q;  2K5Q A;  4LF6 L;  1O78 A;  4J15 A;  1YNJ D;  4LK1 C;  2BH2 A;  1HNX L;  4A93 H;  3J81 j;  4JI8 L;  5EQ0 A;  4X65 Q;  1TWC H;  3F2C A;  1Y1V H;  2JA5 H;  2SNM A;  3JAM i;  2Y0S G;  4CHT B;  4DK1 A;  4JYA Q;  1D5X C;  4LF4 Q;  4LFC L;  1TWA H;  4OEM B;  1IKL A;  3NXW A;  5IWA Q;  2Z6B A;  3ULL A;  2MFI A;  1L1O C;  5C4Z A;  4AQY Q;  4C3J B;  1QB5 D;  3VYR A;  1IBL L;  4BY7 B;  1YIT A;  4JBK A;  1AZQ A;  3T51 B;  5IYD H;  3M3Y H;  3CC7 A;  4BBS G;  4KN7 C;  1GJX A;  5COR A;  3GTG H;  5I2Y A;  2VQF L;  3CQZ H;  1RTN A;  2NTS A;  3GTO H;  3HOU B;  2KED A;  5IGB A;  4GKJ Q;  1GHJ A;  1WVL A;  4KV6 A;  1HA6 A;  1DOK A;  2OF1 A;  4XQJ A;  3S1Q H;  3Q23 A;  3NWS A;  2JA6 B;  5M5Y B;  3BG3 A;  4C3I B;  1I6V C;  3VR3 A;  3CHB D;  2ICE C;  2L15 A;  2Y0S E;  5LMN L;  5IP7 G;  4YWL A;  2EY5 A;  1SN8 A;  1Z9F A;  2OXP A;  3I4N G;  1NUC A;  2H4O A;  4I7Z C;  3GD7 A;  3G7L A;  3KLR A;  2RDH A;  2RKS A;  4G7H C;  2KEE A;  4A3K H;  1NMF A;  4K5W A;  5FOB B;  1EY5 A;  5KNB A;  3K80 C;  1I94 Q;  3S1R B;  1HJP A;  1JOO A;  1WCM B;  3F2U A;  2PI2 A;  3K7A H;  3RNU A;  2GA4 B;  2UU9 L;  3HOW H;  1CUK A;  1WJJ A;  1W3S A;  3I4M H;  2K50 A;  5C44 H;  5BN5 A;  1CHP D;  1T5X D;  2NN6 H;  4QJF A;  3W3A A;  5I2X A;  4DNI A;  3HKZ G;  1K8M A;  5FLX E;  4OXP A;  4RKB A;  5AJ3 Q;  1B3A A;  5I4D A;  1CM9 A;  2Q2U A;  1Q12 A;  3NQI A;  5A35 A;  2PZU A;  1N36 Q;  3F8T A;  4IUT A;  2VB2 X;  2R7Z B;  5C3E H;  2BA1 A;  3S15 B;  1G51 A;  4NKL A;  1QE6 A;  4IPC A;  3G6J B;  3TDQ A;  1Q7Y C;  4MIU A;  3NEM A;  1Q3L A;  1NJI C;  1FVI A;  1TS5 A;  3DWQ A;  2EYF A;  3F2B A;  3PUZ A;  2VY3 A;  1D5Z C;  4ZAI A;  3KUP A;  5ELO A;  4UP7 A;  3FVQ A;  1N8R C;  2ZM6 L;  1QZH A;  3P1H A;  2UUC Q;  4QQB X;  2JN4 A;  3PUW A;  3M7N A;  4IUR A;  3OW2 A;  4UP8 A;  5FJ8 G;  1PTO B;  2JA8 B;  1IL8 A;  1E0B A;  1LTS D;  1C0A A;  5E1F A;  3O13 A;  2KCC A;  2XN9 C;  3HKZ E;  3HFZ B;  3FMC A;  4HSV A;  4DF7 A;  1CA6 A;  4L6T B;  3KLS X;  1ASZ A;  1Y69 U;  4Z9C B;  3MFG A;  3J80 i;  3SGI A;  1GD7 A;  4BBR H;  1SNC A;  1BBU A;  4DAV A;  4C3J G;  3Q6S A;  3T4A C;  3JAM E;  5TSS A;  4BY7 G;  4DUY Q;  4PV1 C;  3DWA A;  4JI5 Q;  3UDF A;  3BU2 A;  2VL6 A;  4A3J H;  3HOU G;  4QCL A;  5BN4 A;  1ZKO A;  2K01 A;  1VQB A;  3URY A;  4AIM A;  4ZK9 B;  1HTL D;  3DWP A;  4K0K L;  4ULL A;  4IN3 A;  1KLG D;  4DR5 Q;  2NVQ H;  4L8J A;  1ENF A;  1I4G A;  1RHP A;  1YZ6 A;  2JA6 G;  4G57 A;  2KEN A;  4C3I G;  4CKE A;  3SDZ A;  4MZ9 A;  5J22 A;  5FLM H;  3OIP A;  2B39 A;  4GN5 A;  1K0R A;  3PUV A;  4FVM A;  1FJG Q;  5IGF A;  3CMA A;  2XGT A;  2UXC L;  2YTY A;  3R8B A;  2A8V A;  1VQ4 A;  5M3F H;  4DV0 Q;  5K36 G;  3PMF A;  3CAM A;  3D6W A;  3TS0 A;  1BF4 A;  2ZT9 C;  3AFP A;  1WCM G;  1A62 A;  4A4I A;  5FK9 C;  4HSP A;  4YHH Q;  3QO2 A;  3NK9 A;  1SND A;  4R1J A;  3V2T A;  1SLJ A;  1PHJ A;  2CW0 C;  2Z9H A;  2D5D A;  1Q81 C;  4A3C G;  3V05 A;  5L37 A;  4LNQ A;  2MHV A;  2F3V A;  2AHO B;  1Y8N B;  4HN7 A;  2R7Z G;  1C48 A;  3OWE B;  4KKT A;  1I5F A;  3BDL A;  1TY2 A;  1JWU D;  4DR3 L;  4DXG A;  4DR5 L;  1AW7 A;  3I73 A;  1A2T A;  3H15 A;  4GNX B;  1R4Q B;  3DEP A;  3QIA A;  2A6E D;  1SYG A;  4RFB A;  4ID6 A;  2E2H B;  3EVQ A;  1F77 A;  2JA8 G;  1EUJ A;  1IZ6 A;  2HD3 A;  1QVC A;  2DJF C;  2EY1 A;  1TS3 A;  3GP7 A;  3ULJ A;  3I8Z A;  4IJL A;  4LW1 A;  3U9S A;  4DR7 L;  2NBF A;  4YWK A;  3UI2 A;  4X3K A;  1CKO A;  1MD2 D;  1O80 A;  1I50 H;  1N32 L;  1HR0 Q;  2A5H A;  4K8I A;  4UAI A;  4F7X A;  3K0X A;  4LF9 L;  4XT1 B;  3TME A;  2E2D C;  5F2D A;  1H9R A;  1PYB A;  1XMO L;  2B2W A;  4QUF A;  5KND A;  4CJ2 C;  1K8G A;  3J80 E;  3A56 A;  1PTO C;  1JOQ A;  3PQI A;  4HR7 B;  2NVQ B;  1Q82 C;  3KF6 A;  4TKO B;  5C5L A;  4K2K A;  1F9P A;  2V1C C;  2L11 A;  2QEJ C;  1N9W A;  1UEA B;  2Z0S A;  4HIK A;  2VNU D;  4DN4 M;  4OON A;  3WWV A;  4DV6 Q;  4X3T A;  3SXH A;  1S72 A;  2UXD L;  1BCP F;  3S9W A;  1CSP A;  1BVS A;  1XMQ L;  2I5M X;  1EEF D;  5EPL A;  3MWY W;  2WAC A;  1SAP A;  5JVH 3;  1VMC A;  1UWV A;  5A2Q L;  2HQE A;  2VUM H;  4IFD G;  5IY0 A;  2ZJP A;  3BYY B;  4DPG A;  4QMG A;  1EZ8 A;  3VYT A;  1ESF A;  2MP1 A;  1MJC A;  1ET6 A;  2WP8 J;  2JK8 A;  3E9H A;  4G7O C;  4IZ8 A;  3FP9 A;  4MNO A;  2IY5 B;  3ERO A;  3NE5 B;  1JIC A;  3D6C A;  3CCJ A;  3KDF B;  5C0X G;  1SYB A;  5D3I B;  2L1B A;  2JA9 A;  2R93 B;  4GN4 B;  1D1I A;  4QF4 A;  4LFB L;  2CCZ A;  1EYC A;  3MEH A;  4CJ1 B;  5JJZ A;  5M3M H;  3E3X A;  4KY5 A;  4WJW A;  2F0V A;  5IOD A;  1IKM A;  1WTV A;  4IO9 A;  5G3L F;  2O5J C;  5NUC A;  1CKN A;  1CI3 M;  4DUZ Q;  3FDT A;  3F2D A;  5LMN W;  2UUA Q;  4LF8 Q;  1N33 Q;  1PFS A;  4WJ4 A;  1CK1 A;  2M9V A;  5C3X A;  1EU4 A;  1LTA D;  4O0A A;  1G91 A;  3D4W A;  1PH8 A;  4GKK L;  2Q2T A;  2F0F A;  4EQ5 A;  5IYC G;  2M00 A;  3H94 A;  2KEC A;  4KK7 A;  1ICW A;  1SDF A;  2Z8L A;  3DMU A;  5E7N A;  2A19 A;  3I72 A;  1BKB A;  4OEL B;  4KHP Q;  3PIO 3;  2JA7 B;  2QA4 A;  1V1P B;  2HHH Q;  2OTJ A;  2GN5 A;  4GNX C;  3FPU B;  2DJG C;  2F3I A;  2MNA A;  2OTL A;  3MXU A;  3A5U A;  4GLX A;  4UP9 A;  1VQL A;  4LFA L;  2EYP A;  1WTH A;  5GRO A;  4J6H A;  5IIF A;  5D3D A;  4KI0 A;  1A3V A;  2D9U A;  2F0G A;  1LT5 D;  3EQL C;  5LHY 1;  4RCO A;  2OWO A;  1ZEQ X;  3VA5 A;  3ICE A;  1KAW A;  1GUG A;  3CF5 A;  4PZ7 A;  2TMP A;  1VQE A;  2JEB I;  4NMZ A;  2EZV A;  5DLQ E;  4QL5 A;  4TRD A;  4GN3 B;  1EYG A;  1LO5 D;  3W1G A;  5C0X I;  1VCI A;  1NNX A;  1ET9 A;  3IKJ A;  1BQQ T;  4R4T A;  3AMU A;  4C3H B;  4V19 0;  2VXW A;  3P75 A;  1D8L A;  3M4O H;  4PZ6 A;  2X6L A;  3H3V I;  3DXJ C;  3PF4 A;  3QR8 A;  1HFN A;  1KXL A;  4L5S A;  1BXT A;  2ZXR A;  3IRB A;  2LY7 A;  4PNY A;  5D65 A;  1HZ9 A;  4X62 L;  3PO2 H;  3BVG A;  1Z7T A;  3BDO A;  1JOK A;  4OL7 A;  5JPN C;  2R93 G;  3SEB A;  4DNR B;  3AB9 A;  1VQP A;  2K6A A;  5ELC A;  4KHZ A;  2OQK A;  2K04 A;  3LGJ A;  2NVT B;  2HDL A;  4ZCK A;  4P73 A;  1N34 Q;  4A3L H;  1S4Z A;  1C7Y A;  1EL0 A;  4BY1 H;  1TWH H;  3N6R A;  2R6G A;  3PIO A;  2K5V A;  2RHS B;  1XTD A;  3L3O C;  3IFD A;  1L1O B;  1YHA A;  4F88 A;  4U67 3;  1ONL A;  1O7Y A;  1KAB A;  1K8A C;  4AYB B;  2ZTD A;  4DK0 A;  5C4J B;  1VQK A;  1MKH A;  1STB A;  3A74 A;  3H0G B;  4EGV A;  1GUW A;  2DGY A;  3CCU A;  1S5C D;  1Q8K A;  3T1Y Q;  2RDF A;  5KNC A;  4JI7 L;  4L5T A;  3VR4 A;  3GTP H;  3TZD A;  1IBK Q;  1I4Q A;  4DR6 Q;  3VDY A;  4HMJ A;  2JA7 G;  4O2D A;  3HOV H;  4ALP A;  1IYV A;  3PO3 B;  1SR3 A;  4RCN A;  3ULP A;  1XNQ L;  5JOB A;  2XTI A;  4OIK A;  1PZI D;  2LMC B;  4B3T Q;  4KY6 A;  2RCN A;  4P75 A;  2CKZ B;  2B63 H;  3GTM H;  3HOZ B;  2K4K A;  4R4Q A;  5EPJ A;  2IPK D;  3NEL A;  4JI1 Q;  3STB C;  4DV7 L;  4OO1 I;  3RLN A;  2EYL A;  3NEN A;  3S1M B;  4DV5 L;  4LF5 Q;  3OTO L;  4R4C A;  1PH6 A;  4FF3 A;  5HY6 A;  4CDC C;  3U58 A;  3R2I A;  3ERQ A;  2F0E A;  1CFM A;  1TVX A;  3PUY A;  3C3L A;  1BCP B;  1G2S A;  4HJ9 A;  4DV4 L;  1EQT A;  4K6L A;  2B2U A;  4H13 C;  3J81 i;  3K6O A;  1WYD A;  4X64 Q;  3M9B A;  2PNH A;  5FKA C;  2F4V Q;  1NR4 A;  3RLF A;  1WFQ A;  3AU7 A;  1F9S A;  3K57 A;  1JE5 A;  2WB1 B;  4C3H G;  3VYS A;  2NYZ D;  3AEV A;  4GOP A;  4KKS A;  2WII B;  2RBM A;  1K83 H;  1KLU D;  4A75 A;  1D1K A;  4O1N A;  4A3F H;  4HJ5 A;  2NZH A;  1H9S A;  1F9Q A;  2QEX A;  4JC0 A;  1B44 D;  1J5E Q;  2SOB A;  2YU9 B;  1LAB A;  3TSS A;  4BA2 I;  1IBM L;  1HFG A;  4C56 C;  1F2M A;  1GM5 A;  4KY7 A;  2VS1 A;  5IGG A;  1Y1W H;  1MIU A;  1XNR L;  1IW7 C;  4AYB G;  5CC4 A;  1PFB A;  2X6G A;  4DXF A;  2EYH A;  4YY3 L;  1IL2 A;  3MAQ A;  3H0G G;  2QDL A;  4IUV A;  3RN2 A;  4PZ8 A;  2AKW B;  1JMC A;  1G8Z D;  2EOT A;  2O2L D;  1ENA A;  3FKI H;  2JSO A;  3PGZ A;  4K8J A;  5JJK A;  3HOV B;  2L9H A;  4RWS C;  5D14 A;  1BUV T;  5J39 A;  3PO3 G;  3A8K E;  1VQF A;  4MTK A;  5JEA G;  4B08 A;  2CWP A;  2EDG A;  3HKS A;  4XQQ A;  3NP8 A;  5M5X H;  1KC8 C;  2DY8 A;  2XRS D;  5I6W A;  2CW0 D;  1TWF B;  3HOZ G;  3RZO B;  1X6O A;  2AQ2 B;  2F0P A;  4XT3 B;  3U9O A;  1PV4 A;  2IT1 A;  3C1F A;  3EFX D;  4HED A;  2TSS A;  1RKN A;  4OHJ A;  1LTG D;  4LUZ A;  1SJH D;  1VQA A;  2L0C A;  1K3B C;  1K73 C;  4DAP A;  3T53 B;  4RGM A;  5JPM C;  1G2T A;  2F0L A;  4AYB E;  3S17 H;  2FFK B;  4O42 A;  1YVC A;  3HOY H;  1EY8 A;  4NXM Q;  4FYD A;  2CHB D;  2Q8T A;  1HPC A;  4YWM A;  1YJW A;  3OHX C;  4M1U B;  4ZUJ A;  3S2D H;  2I0Q A;  5C4X B;  2WFW A;  1PRT F;  4K5X A;  4BWG B;  5IGE A;  2RSN A;  4DR2 L;  4A3I G;  4LF7 Q;  4POG A;  3BVZ A;  5IT9 c;  1JT8 A;  4A3B H;  1TXY A;  2WB1 G;  2VZA A;  4X65 L;  2IHF A;  4PQX A;  4DAM A;  1E24 A;  2FHT A;  3Q0A A;  1K83 B;  4JYA L;  1Q90 A;  3ZJY C;  5IYB H;  2R7D A;  4LF4 L;  4B3R Q;  2B2U C;  5GAG C;  2NVY B;  3BZC A;  5IGC A;  3J81 E;  3CCS A;  4A3E B;  3SK5 A;  2PW5 A;  1JC7 A;  5EJW A;  1BCP C;  5IWA L;  2N49 A;  4QB4 A;  4X3S A;  1JJC B;  5CBA E;  3J80 c;  5IOC A;  1JCK B;  1LM0 A;  1JB3 A;  4GOP C;  4AQY L;  4IUQ A;  4IFD J;  1PTO D;  3EN2 A;  4AH6 A;  1HCZ A;  3D31 A;  2FJ2 A;  1UNS A;  4DR1 Q;  3GTK H;  1UE6 A;  1W6J A;  1C4Q A;  1U4M A;  3KOJ A;  4BXX H;  2FXQ A;  5AFW A;  1U5K A;  5IT9 L;  1XPU A;  3GV3 A;  4GKJ L;  3S14 H;  1BR9 A;  4KHV A;  3BDC A;  4A93 B;  1SNO A;  2WB1 E;  5C0X J;  2KVM A;  3TRZ A;  2C35 B;  2Z6K A;  5T1I A;  1QUQ A;  4JI6 Q;  4TQU S;  2PYK A;  1TWC B;  4OX9 Q;  4JI0 Q;  1Y1V B;  4A3M H;  2JA5 B;  5E3F A;  2ZXO A;  5T1G A;  5DNF A;  1E1T A;  1SBB B;  1X65 A;  1SNQ A;  2QCP X;  3U4V A;  3HOV G;  4ME5 A;  4TSS A;  1GKH A;  1TWA B;  1UAP A;  4DAY A;  4N8X 1;  3IAY A;  2K75 A;  1K9M C;  4A3D H;  1YHB A;  4K6D A;  1I94 L;  1PH5 A;  3K5M A;  4IOA A;  4JI3 Q;  3MVV A;  1WD1 A;  1O7L A;  3TP7 A;  3G6E A;  3H3V H;  3CW2 C;  1FGB D;  2ASB A;  1EQV A;  1SFO H;  1ML0 D;  2D0P A;  1CA5 A;  4N8F A;  2F0N A;  2MPM A;  3WDN A;  5AJ3 L;  1AH9 A;  3M3Y B;  5JJL A;  4DV1 Q;  4LAA A;  1TU2 B;  3GTG B;  2K5H A;  1IHZ A;  3CQZ B;  1STY A;  1KDB A;  3GTO B;  2QDB A;  1MHW C;  3S17 B;  1VQ7 A;  3T16 A;  2B2T A;  1N36 L;  4PG3 A;  1EOV A;  3T1H Q;  1V1Q A;  1XWE A;  1ASY A;  2A6H C;  2LXK A;  3H09 A;  1HZC A;  4ZLT F;  2DN8 A;  3S1Q B;  5C4X G;  3JC6 6;  4FNF A;  4KJN A;  1LTL A;  1H9K A;  2P5Z X;  1X3E A;  1HHV A;  1PFM A;  3C46 A;  5COY A;  2PNR C;  1LTT D;  4NDX A;  4IPD A;  3NBH B;  2UUC L;  4A3K B;  1ILQ A;  4CBV A;  5HUR A;  4EQP A;  4XTC S;  2EJM A;  1DOM A;  3IL8 A;  4A3E G;  3K7A B;  4WFN 3;  3HOW B;  3NBH A;  3I4M B;  1E7Z A;  5C44 B;  1XTC D;  2BDO A;  2FIN B;  1G6Z A;  2K1B A;  2FMM A;  3UE0 A;  3SK6 A;  1OXX K;  2I5L X;  2QKI C;  2XSC A;  2G9D A;  1A2U A;  3MXG A;  1A3T A;  2CH4 W;  4OWX B;  4DUY L;  4JI5 L;  1SJE D;  4B9W A;  1AP0 A;  3S16 H;  5C3E B;  4A76 A;  1NY4 A;  2NTT A;  3P7J A;  2K05 A;  3D4R A;  4OO1 H;  1L2F A;  1R9T H;  3NHH A;  3A8J E;  5C6A A;  4WJ3 M;  3OMG A;  1QWY A;  5EKL A;  1FNU A;  4IPH A;  4A93 G;  4B9X A;  2PI2 E;  4P72 A;  3UDI A;  4DK3 C;  1A6X A;  3NQT A;  4M8A A;  4C2M H;  3SR1 A;  3KK7 A;  1Y1V G;  2JA5 G;  3NSW A;  3CU7 A;  4ZQ3 A;  1FJG L;  2KHI A;  4HJA A;  4V0B A;  2B2V A;  1UEB A;  2B3G A;  1VQJ A;  5CR3 A;  4DV0 L;  1EIY B;  3P20 A;  1FR3 A;  1LUZ A;  1KNE A;  2Z6K C;  4X6A H;  4RGT A;  2PMZ B;  1HH2 P;  2HCI A;  4BBR B;  5HGQ A;  2E2J H;  5CV9 A;  3A7A B;  4YHH L;  5IYD G;  1GUO A;  1F9R A;  2LSS A;  3KF6 B;  1SYF A;  3MFY A;  4JVZ A;  5M5W H;  4Y7N H;  4A3J B;  3TS2 A;  2R7F A;  2WV6 D;  4X66 Q;  4IAL A;  2NZO A;  3MXP A;  1VQ6 A;  3VR6 A;  4HJ7 A;  1MSG A;  4RMF A;  3BZK A;  1II3 A;  1HA5 A;  3RZD H;  4CKC A;  4QIW B;  3GTJ H;  1I6H H;  5GAE C;  1PRT B;  1YHQ A;  3RR5 A;  2KA7 A;  2F0S A;  3AFQ A;  3CD6 A;  3TP5 A;  2KBN A;  4HIM A;  1J8I A;  3QJY A;  5GAD C;  2K28 A;  4A3K G;  5M3F B;  2EVB A;  1HNZ Q;  1YBY A;  2VW9 A;  2YTX A;  1QNK A;  3ITP A;  2A73 B;  4A3G H;  5I9O A;  3HOW G;  4IUP A;  1KD1 C;  5JVG 3;  4RA8 A;  3PSI A;  3I4M G;  3S1N H;  4GZY C;  2KUM A;  5C44 G;  1MI2 A;  2NN6 G;  4JV5 Q;  4H44 C;  1KNA A;  1SRO A;  3A0J A;  4HJ8 A;  1FGU A;  1HNW Q;  1NE3 A;  2ZXP A;  1HR0 L;  1D2B A;  3STB D;  3MA2 B;  3PIP A;  5CV8 A;  3CKI B;  3GTL H;  4BXX G;  1EFI D;  5C3E G;  1WTR A;  3I3C A;  2UXB Q;  1EIH A;  1ESR A;  1Q1E A;  5ELN A;  1CKN B;  4KN4 C;  5HGT A;  1TKW B;  4HTH A;  3OSO A;  1P16 A;  1UE5 A;  4ZKC B;  1AN8 A;  1BBX C;  2E74 C;  2A68 D;  4FF1 A;  1CQF A;  3LNN A;  1Q8I A;  2NZ1 D;  5KYI A;  1TR5 A;  2VQE Q;  2IX0 A;  5CV7 A;  4JPB W;  1HUM A;  1PH9 A;  2WKC A;  1GO3 E;  3MZ5 A;  4DV6 L;  4JCV E;  4JBM A;  1KDC A;  2R92 H;  2KCM A;  2AQ1 B;  3SK8 A;  3HRZ C;  2QF7 A;  4JG2 A;  2I5H A;  2BA0 A;  4APV A;  4FF2 A;  1X3P A;  4BBR G;  2AUK A;  1I50 B;  1XXG A;  3EBE A;  4ZYS A;  1GXD C;  2E75 C;  3GTQ H;  2ES2 A;  5BR8 Q;  3W1B A;  3J7A V;  4FF4 A;  4RGO S;  2N88 A;  2HCC A;  4NXN Q;  4EQN A;  5EKK A;  3MC0 B;  5M5W B;  2K52 A;  4A3J G;  2F0T A;  2CFM A;  2DUD A;  1XYI A;  2RVL A;  1I4X A;  2N8N A;  2K32 A;  3TN2 A;  1JWS D;  1Y8O B;  2OT2 A;  5JEA J;  2EE1 A;  2JQO A;  4IFD I;  3GTJ B;  1S5B D;  4ZUI A;  5GAH C;  4DV2 Q;  4IQZ A;  1PXU A;  5FLM G;  1EFW A;  1SMY C;  1UE1 A;  2B2W C;  3H3V C;  1YNN C;  2HT1 A;  3S2H H;  3EJI A;  4DUZ L;  4JOI A;  1PH3 A;  3UE1 A;  5M3F G;  2UUA L;  4LF8 L;  2XVS A;  1VQC A;  1XPR A;  1M1K C;  2PMZ E;  2NVX H;  1N33 L;  1X9N A;  3DUZ A;  1S5D D;  3K5N A;  4RGN A;  3CXC A;  1KRT A;  2VUM B;  4BBS H;  2F0I A;  2LFN A;  3VR5 A;  2J0T D;  1X54 A;  4KTA A;  4JBW A;  2K5W A;  1BOS A;  1B3Q A;  4FP5 D;  1SEB D;  1STE A;  2HIV A;  1R4P B;  4NB3 A;  4DA2 A;  4UPA A;  5EGT A;  1PRT C;  1B9M A;  1OO9 B;  1K3R A;  4B3M Q;  4KHP L;  1I3Q H;  2HHH L;  2F0J A;  2A6E C;  2L55 A;  2EPB A;  4QIW E;  1QIL A;  1PFN A;  2F0H A;  4H02 A;  2DY7 A;  1VQ9 A;  3BYT B;  1VDZ A;  4JI2 Q;  2F0U A;  2ZTC A;  2LS0 1;  2QGQ A;  4B3S Q;  4GLV B;  1K8O A;  3I4N H;  2Q8R E;  4YCV A;  5IGD A;  5M3M B;  3TP6 A;  3LX0 A;  3U4Z A;  1JB7 A;  2E2I H;  4JBJ A;  2ICI A;  3CC2 A;  3J7Y W;  2BE5 C;  5LL6 X;  2LXJ A;  4IPG A;  4J1M A;  1CQV A;  2IWH A;  2IW3 A;  1W6K A;  2RSO A;  2YTV A;  1B53 A;  4R8N A;  3KLS A;  2A69 C;  2D62 A;  4JK1 C;  3Q24 A;  4KLK A;  3T56 B;  3KBX A;  5A2Q E;  1KDA A;  3K5O A;  2PQA A;  1EY9 A;  2KOL A;  5M9O A;  4CDD C;  2PPB C;  4L63 B;  1D6E C;  3OYY A;  4OWW B;  1G29 1;  2AQ3 B;  5FLX c;  1BCP D;  4C1N K;  1NTG A;  2K33 A;  4YCW A;  2CWA A;  1DGS A;  1GUT A;  5DAU A;  2H1E A;  5GQO A;  1QZG A;  1JJ2 A;  1I4P A;  1GVP A;  1WTW A;  4B3M L;  4JI4 Q;  1B4O A;  2PZW A;  1PH4 A;  3RMH A;  2UUB Q;  1STA A;  2I07 B;  5BN3 A;  1T9H A;  4EX5 A;  4L5R C;  2XRQ D;  2KHJ A;  5FJ8 H;  1HQR D;  1VQH A;  4N9T A;  2KHS A;  4UDU C;  1OTC A;  1N34 L;  4XXE A;  1ICF B;  1VQN A;  1ZYR C;  1K0S A;  2CH4 A;  4K14 A;  1RD9 D;  4DV3 Q;  4R4O A;  5FLX L;  1MJE A;  4GOP B;  4BY7 H;  3CCV A;  1EEI D;  2L5T A;  1B50 A;  2VUM G;  5G3L D;  1EWI A;  3HOU H;  2MO0 A;  3G71 A;  3M4O B;  1H9S B;  3T1Y L;  3PV0 A;  3JAM c;  4LF6 Q;  1IBK L;  4DR6 L;  1H9J A;  3D4D A;  1CKM A;  3NTH A;  1HNX Q;  3HZX A;  4ZRZ A;  4JI8 Q;  1Q46 A;  1U0L A;  5M5Y H;  4HID A;  4C3I H;  2PZT A;  2J4X A;  2F0D A;  1PLF A;  1B7Y B;  3PO2 B;  3PF5 A;  2Z1C A;  1LTI D;  4B3T L;  4ODG A;  1EWH A;  2WIN B;  2RHQ B;  4JI4 L;  3OWF A;  1HZB A;  3OPO A;  3I90 A;  4LFC Q;  5M3M G;  4JI1 L;  4R4I A;  2BH8 A;  2YYZ A;  1B1Z A;  3H91 A;  1B70 B;  1RL2 A;  5K36 H;  2A6H D;  4LF5 L;  1PZJ D;  3EIV A;  1VQ5 A;  4BY1 B;  3A55 A;  1TWH B;  1IYU A;  3S1R H;  2XIW A;  1WCM H;  5KIX A;  5CV6 A;  5CGK A;  1NR2 A;  3G48 A;  1LT4 D;  3N52 A;  3TQY A;  3I7F A;  1D5M C;  1KQS A;  2K5D A;  4HCS A;  2F0W A;  4RAU C;  2KCT A;  3K59 A;  2N3S A;  3R2T A;  4POF A;  3JAM L;  3DM1 A;  1E22 A;  2LKV A;  3MXN A;  2VQF Q;  2L12 A;  2DNC A;  4A3C H;  1SSO A;  1ENC A;  4TVA B;  4BS9 A;  3GQB A;  4X64 L;  3GDE A;  4FXG C;  3MTS A;  1F2Z A;  2RCF A;  1SRU A;  3KF8 A;  2F4V L;  3GTP B;  3CCE A;  5DM7 3;  2R7Z H;  5IP9 H;  3S15 H;  3NPP A;  1SYD A;  3L0O A;  1A8V A;  3HOX H;  1HR0 W;  1X32 A;  2RQX A;  4CDF C;  5LMN Q;  1PZK D;  4OIJ A;  2B63 B;  3GTM B;  2IJ0 A;  1DD2 A;  3ONA B;  2ALY B;  2BCO A;  4C1N I;  4ABN A;  2A74 C;  1HUN A;  1ILP A;  1J5E L;  1GOZ A;  1PTO H;  2JA8 H;  1DJR D;  1SYC A;  2UU9 Q;  3BJU A;  2L4N A;  3HS0 C;  3PCO B;  2WAQ B;  1E2Z A;  2HDM A;  3V96 A;  5K5P A;  2KJX A;  1DYQ A;  2XNA C;  1MSH A;  2ZTE A;  1CZG A;  1P8L A;  1OXT A;  2KCN A;  1QVF A;  3KFU A;  4NW2 A;  5ELB A;  3K8A A;  1S5E D;  2SDF A;  4LUV A;  1TS2 A;  1DCZ A;  1RDP D;  4XIG S;  4P2C B;  2NUC A;  3CRK C;  3L2P A;  1J9O A;  2GVA A;  4H7B A;  1HTP A;  1SE2 A;  4IUU A;  2AMC B;  1DXM A;  3E0E A;  4KKU A;  3SE0 A;  3GV6 A;  3TZU A;  4A3F B;  1XJV A;  2ZM6 Q;  4CGY B;  3PO2 G;  2PCF B;  3LWU A;  5E4W C;  3NUC A;  1EZ6 A;  1FNW A;  2R3Z A;  1IYJ B;  4XYQ A;  2PQE A;  1UE7 A;  2R61 A;  1U9R A;  3D8G A;  1EWC A;  3M4Q A;  1RF2 D;  4A3L G;  2J7Z A;  1EY7 A;  3VYU A;  4BY1 G;  1Y8P B;  2H5X A;  1BBW A;  4ZKB B;  3R93 A;  1X55 A;  3CPF A;  1STG A;  4IFD H;  1QUQ B;  2GVB A;  2X69 A;  5C3W A;  3B6Y A;  4L5Q A;  2HUG A;  1Y1W B;  3CCL A;  4PMW A;  3ZYY X;  2JXM B;  4NXM L;  1YJ9 A;  1LTB D;  5KGU A;  4LF7 L;  1HRJ A;  1U4L A;  4Y52 H;  1PYW D;  4RH6 A;  4DAY B;  3FHW A;  1DZ1 A;  3FKI B;  4K0K Q;  5C0X H;  3BZD B;  3QG1 A;  2IL8 A;  4BA1 I;  3J80 L;  1ROD A;  3M85 A;  1H95 A;  2G9H D;  3VA7 A;  3HOX B;  1O7I A;  5J3B A;  5M5X B;  2B63 G;  4B3R L;  4R9W A;  1WTP A;  2F0O A;  2UXC Q;  4N9P A;  2M2L A;  2E2H H;  5ELE A;  1VQG A;  1PH7 A;  5CYU A;  2F3W A;  2F52 A;  4CKB A;  2HIX A;  1OXS C;  1HQM C;  2AWN A;  1OXV A;  1FD7 D;  3FPP A;  5I6Y A;  2WAQ G;  1RIP A;  1AFP A;  5IYC H;  4U68 A;  4DR1 L;  3HOY B;  1A3U A;  2EXZ A;  3K81 C;  4RG1 A;  5CV4 A;  3HG9 A;  3S2D B;  3DEO A;  1CHQ D;  1M90 C;  4H0L C;  1LAC A;  2K7V A;  3A8I E;  4A3B B;  1FNV A;  5EPK A;  1M4V A;  4JI6 L;  1E2V A;  1JWM D;  4OX9 L;  4JI0 L;  1U4P A;  3RD4 A;  2B8F A;  1VQO A;  2OQ0 A;  5JAV A;  2RF4 A;  2ENB A;  4DR3 Q;  2RDG A;  5J1Z A;  1SYE A;  2B29 A;  4KJO A;  1H9M A;  1FYC A;  1LYL A;  4ME3 A;  1BO0 A;  3X3M A;  3ND8 A;  4A3F G;  1AEX A;  1XX8 A;  1QOH A;  2WKD A;  3KYH C;  2DNE A;  4MHE A;  3OMC A;  3K58 A;  2EYM A;  3I4L A;  1M8A A;  4JI3 L;  1YNJ C;  3MEF A;  1CZW A;  4DKA C;  1A63 A;  4DFA A;  1PH2 A;  1VMP A;  2Q2H A;  2WAQ E;  4WRD A;  5FO7 B;  1STH A;  1Z47 A;  4DR7 Q;  3GTK B;  4DV1 L;  3D0F A;  1VS0 A;  1RJT A;  1DM0 B;  2CQA A;  1LV9 A;  1EIF A;  3QWN A;  1N32 Q;  5CV5 A;  3NTK A;  3S14 B;  1Y1W G;  1SMY D;  3FRP B;  4LF9 Q;  1YNN D;  3T1H L;  1XMO Q;  1RTO A;  1SE8 A;  2QW7 A;  3SK4 A;  2Z4H A;  3J7A F;  3QB3 A;  3C2P A;  2BOS A;  1MBY A;  1VF7 A;  4A3M B;  3PIP 3;  3OIQ A;  2K03 A;  1JR0 D;  4Q0F A;  1EY4 A;  3FKI G;  1IXR A;  2E5L Q;  5IP9 G;  5KEE A;  3LWE A;  2D0O A;  2R93 H;  3SVM A;  2OEO A;  3NBI A;  2EJF C;  4QUC A;  3HOX G;  4E6I A;  3WOE A;  1X3F A;  1PRT D;  1RCV D;  3I2Z A;  3W2D A;  4A3D B;  1WOC A;  4YIJ A;  2EY2 A;  1TT2 A;  3KBG A;  4MN3 A;  4JW0 A;  3NTI A;  2UXD Q;  5E4X A;  2SEB D;  1Q86 C;  3KLW A;  1SFO B;  2VB3 X;  2XWJ B;  4ILW A;  1XMQ Q;  1BNZ A;  1WTX A;  2EYJ A;  3NWT A;  5FO8 B;  2B2Y A;  4GNX A;  4LMQ D;  4OWT B;  1CTM A;  2F4I A;  3TP8 A;  2B8G A;  5IT9 E;  1TQO A;  3SHL A;  4KD3 A;  3HOY G;  2QIL A;  1PYS B;  1F2L A;  2BE5 D;  1KL9 A;  5KRU A;  3UDG A;  1BDO A;  1U4R A;  1E3P A;  1PDQ A;  2JA7 H;  3S24 A;  2A69 D;  4K2L A;  3PUX A;  3AQQ A;  4PMB A;  4A3B G;  3I91 A;  4P74 A;  3HP3 A;  3AYH B;  3RUZ A;  1DON A;  3QOL A;  1WI5 A;  4LFB Q;  2F1M A;  2B2T C;  2F0Q A;  5I9P A;  2E5L L;  4HIO A;  5IYB G;  3I70 A;  4DNT B;  1L0W A;  3I4O A;  3DLL A;  2E76 C;  3G4S A;  3CCR A;  1AZP A;  3A5Z B;  3CPW A;  1JOR A;  1EY6 A;  2IX3 A;  3I56 A;  2K14 A;  1S40 A;  1PH1 A;  1VQI A;  4EVO A;  1D7Q A;  4RHR A;  2SNS A;  4GKK Q;  3S16 B;  4G4K A;  1C9O A;  3CP0 A;  1R9T B;  2A1A A;  4X66 L;  3T13 A;  1GUN A;  4NPS A;  4C3H H;  1B8A A;  1SXT A;  1I4H A;  1A0I A;  3R3O A;  2E8G A;  1ZYR D;  3K7U C;  2RA4 A;  5DM6 3;  1PMR A;  3C1E A;  4C2M B;  3Q22 A;  1S3O A;  1L0Y B;  1QNU A;  4LFA Q;  4A3M G;  3DM3 A;  3TEH B;  3CME A;  2F0K A;  4MTN A;  1LLR D;  4HAE A;  5IE8 A;  1TY0 A;  1B9N A;  5CMD A;  5LL6 S;  3HGB A;  4EQO A;  4IJH A;  4DR4 Q;  3KDF A;  1HNZ L;  2NVT H;  4A3D G;  5ELF A;  2JEA I;  1XPO A;  1KTK A;  3MHB A;  3RN5 A;  1TS4 A;  2E2J B;  1GUS A;  2YV5 A;  3IFT A;  1G6P A;  3A54 A;  5ISR A;  4JV5 L;  2OCE A;  1HXY D;  1E1O A;  2AUJ D;  2JYO A;  1F2Y A;  1I4R A;  3M4P A;  1HNW L;  1STN A;  2B2V C;  3W5O A;  5C4J H;  3H6M A;  4Y7N B;  1YNX A;  3X3N A;  3H0G H;  4R8I A;  1E2W A;  1X56 A;  1GHK A;  1Q1B A;  4LUO A;  4OGQ C;  4FDB A;  2UXB L;  3RZD B;  2MO1 A;  4HMI A;  2NN6 I;  1I6H B;  3KJO A;  4F8M A;  1DOL A;  2EYO A;  1NSN S;  4WOR A;  3PO3 H;  2B2Y C;  1V8Q A;  5JEA H;  1IW7 D;  4X62 Q;  2MJ8 A;  3ND9 A;  5FO9 B;  1Z6H A;  2CQO A;  3HOZ H;  1V1P A;  2PO4 A;  2VQE L;  2F03 A;  1C8C A;  4XDX A; 
#chains in the Genus database with same CATH homology
 4IUN A;  4RHS A;  4A3G B;  4DGZ A;  2JP1 A;  3BVM A;  2C9O A;  4RKL A;  3S1N B;  5C5M A;  1SE4 A;  4Q5V A;  4LJZ C;  1JE4 A;  4S3S A;  1KAA A;  5KYL A;  3M7G A;  4XQN A;  1QJO A;  3GTL B;  2C5C A;  4OO1 G;  3E5S A;  2NWG A;  1JQY D;  2BDN A;  3E0J A;  3TBI B;  1QCB D;  3L7Z C;  2XWB B;  1A15 A;  4NP5 A;  1O7Z A;  3M4Y A;  4F87 A;  4FXD A;  3D3R A;  1MGS A;  2Q8I B;  2R92 B;  1SNM A;  3CRL C;  1LTR D;  1NAP A;  1EIG A;  1EY0 A;  3HEJ A;  4CJ0 B;  3GTQ B;  4PMC A;  1WD0 A;  1TII D;  2PW7 A;  2MUY A;  4DU9 A;  3BS1 A;  2CVR A;  2F0M A;  1EU3 A;  5EBC A;  3FEW X;  2ID0 A;  2Y0S B;  2EY6 A;  1PTO F;  3A7L A;  1SNP A;  5EKI A;  3GO5 A;  1VF5 C;  3S2H B;  3E6Z X;  3J81 L;  2Z4I A;  4XYO A;  1NCV A;  2O5I C;  2AWO A;  2NVX B;  1LT3 D;  4BBS B;  1CT1 D;  1EYD A;  3K0Y A;  1QG7 A;  3K5L A;  1V43 A;  1L0X B;  5ELD A;  4HCE A;  4FO2 A;  2IX1 A;  1WTQ A;  2A68 C;  5CBE E;  2N55 A;  1I3Q B;  1X3Q A;  4J8Q A;  2EJG C;  4KD4 A;  4A3I B;  2O4X A;  5EBD A;  3EA6 A;  2FMC A;  2NB0 A;  3VR2 A;  1EYA A;  2I46 A;  3I4N B;  1S5F D;  4G7Z C;  1ZXT A;  2E2I B;  1V1O A;  1SE3 A;  1EOT A;  1UUP A;  1OXU A;  1LT6 D;  1WTO A;  3QOJ A;  3HKZ B;  4KMU C;  1B2T A;  3WOF A;  4I65 A;  3DHQ A;  5C4H A;  2MGS A;  3OW7 A;  4FXK C;  3OOC A;  2KQ3 A;  2JE6 I;  5DEH A;  4X3U A;  4K5V A;  3L9A X;  1T5E A;  2V4D A;  1TWG B;  2D2C C;  2K5Q A;  1O78 A;  1YNJ D;  4LK1 C;  5EQ0 A;  2SNM A;  4CHT B;  4DK1 A;  1D5X C;  1IKL A;  3NXW A;  5C4Z A;  4C3J B;  1QB5 D;  3VYR A;  4BY7 B;  1AZQ A;  3T51 B;  4KN7 C;  1GJX A;  5COR A;  5I2Y A;  1RTN A;  2NTS A;  3HOU B;  2KED A;  5IGB A;  1GHJ A;  1WVL A;  4KV6 A;  1HA6 A;  1DOK A;  2OF1 A;  4XQJ A;  3Q23 A;  3NWS A;  2JA6 B;  5M5Y B;  3BG3 A;  4C3I B;  1I6V C;  3VR3 A;  3CHB D;  2ICE C;  2EY5 A;  2OXP A;  1NUC A;  2H4O A;  4I7Z C;  3GD7 A;  3G7L A;  3KLR A;  2RDH A;  2RKS A;  4G7H C;  2KEE A;  4K5W A;  5FOB B;  1EY5 A;  5KNB A;  3S1R B;  1JOO A;  1WCM B;  3F2U A;  2GA4 B;  5BN5 A;  1CHP D;  1T5X D;  2NN6 H;  3W3A A;  5I2X A;  1K8M A;  5FLX E;  4RKB A;  1B3A A;  5I4D A;  1CM9 A;  1Q12 A;  3NQI A;  5A35 A;  2PZU A;  4IUT A;  2VB2 X;  2R7Z B;  2BA1 A;  3S15 B;  4NKL A;  1QE6 A;  3G6J B;  3TDQ A;  4MIU A;  1Q3L A;  1TS5 A;  3DWQ A;  2EYF A;  3PUZ A;  4ZAI A;  1D5Z C;  3KUP A;  3FVQ A;  3P1H A;  3PUW A;  3M7N A;  4IUR A;  1PTO B;  2JA8 B;  1IL8 A;  1E0B A;  1LTS D;  5E1F A;  3O13 A;  2KCC A;  2XN9 C;  4DF7 A;  3FMC A;  4HSV A;  1CA6 A;  4L6T B;  3KLS X;  1Y69 U;  4Z9C B;  3MFG A;  1SNC A;  4DAV A;  4C3J G;  3Q6S A;  3T4A C;  3JAM E;  5TSS A;  4PV1 C;  3DWA A;  4QCL A;  5BN4 A;  1ZKO A;  2K01 A;  3URY A;  4ZK9 B;  1HTL D;  3DWP A;  4ULL A;  4IN3 A;  1KLG D;  4L8J A;  1ENF A;  1I4G A;  1RHP A;  4G57 A;  4C3I G;  4CKE A;  3SDZ A;  5J22 A;  3OIP A;  2B39 A;  3PUV A;  4FVM A;  5IGF A;  3R8B A;  5K36 G;  3PMF A;  3D6W A;  1BF4 A;  2ZT9 C;  5FK9 C;  4HSP A;  3QO2 A;  3NK9 A;  1SND A;  3V2T A;  2CW0 C;  2D5D A;  3V05 A;  2MHV A;  2F3V A;  1Y8N B;  4HN7 A;  1C48 A;  3OWE B;  4KKT A;  3BDL A;  1TY2 A;  1JWU D;  4DXG A;  1AW7 A;  3I73 A;  1A2T A;  1R4Q B;  3DEP A;  3QIA A;  2A6E D;  1SYG A;  4RFB A;  4ID6 A;  2E2H B;  3EVQ A;  1F77 A;  2EY1 A;  1TS3 A;  3GP7 A;  3I8Z A;  3U9S A;  2NBF A;  3UI2 A;  4X3K A;  1MD2 D;  1O80 A;  2A5H A;  4K8I A;  4UAI A;  4F7X A;  4XT1 B;  3TME A;  2E2D C;  5F2D A;  1H9R A;  2B2W A;  4QUF A;  5KND A;  4CJ2 C;  3J80 E;  3A56 A;  1PTO C;  1JOQ A;  4HR7 B;  2NVQ B;  4TKO B;  5C5L A;  4K2K A;  1F9P A;  2L11 A;  2QEJ C;  1UEA B;  2VNU D;  4DN4 M;  4X3T A;  3SXH A;  1BCP F;  3S9W A;  1EEF D;  5EPL A;  3MWY W;  2WAC A;  1SAP A;  5JVH 3;  1VMC A;  5A2Q L;  2HQE A;  4IFD G;  3BYY B;  4QMG A;  1EZ8 A;  3VYT A;  1ESF A;  2MP1 A;  1ET6 A;  2WP8 J;  4G7O C;  4IZ8 A;  3ERO A;  3NE5 B;  1JIC A;  3D6C A;  5C0X G;  1SYB A;  5D3I B;  2L1B A;  2R93 B;  1D1I A;  4QF4 A;  1EYC A;  3MEH A;  4CJ1 B;  5JJZ A;  4KY5 A;  4WJW A;  2F0V A;  5IOD A;  1IKM A;  1WTV A;  2O5J C;  5G3L F;  5NUC A;  1CI3 M;  3FDT A;  1CK1 A;  2M9V A;  5C3X A;  1EU4 A;  1LTA D;  1G91 A;  3D4W A;  2F0F A;  2M00 A;  3H94 A;  2KEC A;  4KK7 A;  1ICW A;  1SDF A;  2Z8L A;  3DMU A;  3I72 A;  3PIO 3;  2JA7 B;  1V1P B;  3FPU B;  3MXU A;  2EYP A;  4J6H A;  5IIF A;  5D3D A;  4KI0 A;  1A3V A;  2D9U A;  2F0G A;  1LT5 D;  3EQL C;  5LHY 1;  4RCO A;  1ZEQ X;  3VA5 A;  1GUG A;  2TMP A;  2JEB I;  4NMZ A;  2EZV A;  4TRD A;  1LO5 D;  5C0X I;  1VCI A;  1ET9 A;  3IKJ A;  1BQQ T;  3AMU A;  4C3H B;  4V19 0;  2VXW A;  3P75 A;  2X6L A;  3DXJ C;  1HFN A;  1BXT A;  2ZXR A;  2LY7 A;  4PNY A;  5D65 A;  3BVG A;  1Z7T A;  3BDO A;  1JOK A;  5JPN C;  4OL7 A;  3SEB A;  4DNR B;  3AB9 A;  2K6A A;  5ELC A;  4KHZ A;  2K04 A;  2NVT B;  2HDL A;  1S4Z A;  1EL0 A;  3N6R A;  2R6G A;  3L3O C;  3IFD A;  4F88 A;  4U67 3;  1ONL A;  1O7Y A;  1KAB A;  4AYB B;  4DK0 A;  5C4J B;  1STB A;  3H0G B;  4EGV A;  1GUW A;  1S5C D;  2RDF A;  5KNC A;  3VR4 A;  3TZD A;  1I4Q A;  4HMJ A;  1IYV A;  3PO3 B;  4RCN A;  5JOB A;  4OIK A;  1PZI D;  2LMC B;  4KY6 A;  3HOZ B;  5EPJ A;  2IPK D;  4OO1 I;  2EYL A;  3S1M B;  4FF3 A;  3ERQ A;  3R2I A;  2F0E A;  1CFM A;  1TVX A;  3PUY A;  3C3L A;  1BCP B;  1G2S A;  1EQT A;  4K6L A;  2B2U A;  4H13 C;  3K6O A;  5FKA C;  1NR4 A;  3RLF A;  3AU7 A;  1F9S A;  3K57 A;  2WB1 B;  4C3H G;  3VYS A;  2NYZ D;  4KKS A;  2WII B;  2RBM A;  1KLU D;  1D1K A;  4O1N A;  1H9S A;  1F9Q A;  1B44 D;  2SOB A;  2YU9 B;  1LAB A;  3TSS A;  4BA2 I;  1HFG A;  4C56 C;  1F2M A;  4KY7 A;  5IGG A;  1IW7 C;  5CC4 A;  1PFB A;  2X6G A;  4DXF A;  2EYH A;  3MAQ A;  4IUV A;  1G8Z D;  2EOT A;  2O2L D;  1ENA A;  2JSO A;  4K8J A;  3HOV B;  2L9H A;  4RWS C;  5D14 A;  1BUV T;  5J39 A;  3A8K E;  5JEA G;  4B08 A;  2EDG A;  4XQQ A;  3NP8 A;  5I6W A;  2DY8 A;  2XRS D;  2CW0 D;  1TWF B;  3RZO B;  2AQ2 B;  2F0P A;  4XT3 B;  3U9O A;  2IT1 A;  3C1F A;  3EFX D;  4HED A;  2TSS A;  1RKN A;  4OHJ A;  1LTG D;  1SJH D;  2L0C A;  4DAP A;  3T53 B;  4RGM A;  5JPM C;  1G2T A;  2F0L A;  2FFK B;  4O42 A;  1EY8 A;  4FYD A;  2CHB D;  2Q8T A;  1HPC A;  3OHX C;  4M1U B;  4ZUJ A;  5C4X B;  1PRT F;  4K5X A;  4BWG B;  5IGE A;  2RSN A;  3BVZ A;  4PQX A;  2FHT A;  3Q0A A;  1K83 B;  1Q90 A;  2B2U C;  2NVY B;  5IGC A;  3J81 E;  4A3E B;  3SK5 A;  2PW5 A;  1JC7 A;  5EJW A;  1BCP C;  4QB4 A;  4X3S A;  5CBA E;  5IOC A;  1JCK B;  1JB3 A;  4IUQ A;  4IFD J;  1PTO D;  1HCZ A;  3D31 A;  2FJ2 A;  1UNS A;  1W6J A;  1C4Q A;  1U4M A;  5AFW A;  5IT9 L;  3GV3 A;  1BR9 A;  4KHV A;  3BDC A;  4A93 B;  1SNO A;  5C0X J;  2KVM A;  5T1I A;  4TQU S;  2PYK A;  1TWC B;  1Y1V B;  2JA5 B;  5E3F A;  2ZXO A;  5T1G A;  5DNF A;  1SBB B;  1SNQ A;  2QCP X;  4ME5 A;  4TSS A;  1TWA B;  1UAP A;  4DAY A;  3IAY A;  4K6D A;  3K5M A;  3MVV A;  1WD1 A;  1O7L A;  3TP7 A;  1FGB D;  1EQV A;  1ML0 D;  1CA5 A;  2F0N A;  2MPM A;  3WDN A;  3M3Y B;  4LAA A;  1TU2 B;  3GTG B;  1IHZ A;  3CQZ B;  1STY A;  1KDB A;  3GTO B;  2QDB A;  3S17 B;  3T16 A;  2B2T A;  1XWE A;  2A6H C;  3H09 A;  4ZLT F;  2DN8 A;  3S1Q B;  4FNF A;  4KJN A;  1H9K A;  1HHV A;  1PFM A;  3C46 A;  5COY A;  2PNR C;  1LTT D;  4NDX A;  4A3K B;  1ILQ A;  4CBV A;  5HUR A;  4EQP A;  4XTC S;  2EJM A;  1DOM A;  3IL8 A;  3K7A B;  4WFN 3;  3HOW B;  3NBH A;  3I4M B;  5C44 B;  1XTC D;  2BDO A;  2FIN B;  1G6Z A;  2K1B A;  2FMM A;  3SK6 A;  1OXX K;  2QKI C;  2XSC A;  2G9D A;  1A2U A;  3MXG A;  1A3T A;  1SJE D;  4B9W A;  1AP0 A;  5C3E B;  3D4R A;  2NTT A;  3P7J A;  2K05 A;  4OO1 H;  3NHH A;  3A8J E;  5C6A A;  3OMG A;  1QWY A;  5EKL A;  1FNU A;  4B9X A;  1A6X A;  3NQT A;  4M8A A;  3SR1 A;  3KK7 A;  3NSW A;  3CU7 A;  4ZQ3 A;  4V0B A;  2B2V A;  5CR3 A;  3P20 A;  1FR3 A;  1KNE A;  4RGT A;  2PMZ B;  2HCI A;  4BBR B;  5CV9 A;  3A7A B;  1GUO A;  1F9R A;  3MFY A;  1SYF A;  4A3J B;  2WV6 D;  4IAL A;  3MXP A;  3VR6 A;  1MSG A;  1II3 A;  1HA5 A;  4CKC A;  4QIW B;  1PRT B;  2KA7 A;  2F0S A;  3TP5 A;  1J8I A;  3QJY A;  2K28 A;  5M3F B;  2EVB A;  1QNK A;  3ITP A;  2A73 B;  5I9O A;  4IUP A;  5JVG 3;  4RA8 A;  4GZY C;  2KUM A;  1MI2 A;  2NN6 G;  4H44 C;  1KNA A;  2ZXP A;  1D2B A;  3MA2 B;  5CV8 A;  3CKI B;  1EFI D;  1WTR A;  3I3C A;  1EIH A;  1ESR A;  1Q1E A;  5HGT A;  4KN4 C;  1TKW B;  4HTH A;  3OSO A;  4ZKC B;  1AN8 A;  1BBX C;  2E74 C;  2A68 D;  4FF1 A;  1CQF A;  3LNN A;  1Q8I A;  2NZ1 D;  5KYI A;  1TR5 A;  2IX0 A;  5CV7 A;  1HUM A;  2WKC A;  3MZ5 A;  1KDC A;  2AQ1 B;  3SK8 A;  3HRZ C;  2QF7 A;  2BA0 A;  4FF2 A;  1X3P A;  2AUK A;  1I50 B;  1XXG A;  4ZYS A;  1GXD C;  2E75 C;  3J7A V;  4FF4 A;  4RGO S;  2N88 A;  2HCC A;  4EQN A;  5EKK A;  3MC0 B;  5M5W B;  2F0T A;  1XYI A;  2RVL A;  1I4X A;  2K32 A;  3TN2 A;  1JWS D;  1Y8O B;  2OT2 A;  5JEA J;  2EE1 A;  4IFD I;  3GTJ B;  1S5B D;  4ZUI A;  4IQZ A;  1PXU A;  1SMY C;  2B2W C;  3H3V C;  1YNN C;  3EJI A;  2XVS A;  3DUZ A;  1S5D D;  3K5N A;  4RGN A;  2VUM B;  2F0I A;  2LFN A;  3VR5 A;  2J0T D;  4KTA A;  4JBW A;  2K5W A;  1BOS A;  4FP5 D;  1SEB D;  1STE A;  1R4P B;  4DA2 A;  5EGT A;  1PRT C;  1B9M A;  1OO9 B;  2F0J A;  2A6E C;  2L55 A;  2EPB A;  1QIL A;  1PFN A;  2F0H A;  2DY7 A;  3BYT B;  1VDZ A;  2F0U A;  2LS0 1;  1K8O A;  2Q8R E;  5IGD A;  5M3M B;  3TP6 A;  3LX0 A;  2ICI A;  3J7Y W;  2BE5 C;  5LL6 X;  4J1M A;  1CQV A;  2IWH A;  2IW3 A;  1W6K A;  2RSO A;  1B53 A;  4R8N A;  3KLS A;  2A69 C;  2D62 A;  4JK1 C;  3Q24 A;  3T56 B;  3KBX A;  5A2Q E;  1KDA A;  3K5O A;  1EY9 A;  2KOL A;  5M9O A;  2PPB C;  4L63 B;  1D6E C;  1G29 1;  2AQ3 B;  1BCP D;  4C1N K;  2K33 A;  1GUT A;  5DAU A;  2H1E A;  1I4P A;  1WTW A;  1B4O A;  2PZW A;  3RMH A;  1STA A;  2I07 B;  5BN3 A;  2XRQ D;  1HQR D;  4N9T A;  2KHS A;  4UDU C;  4XXE A;  1ZYR C;  4K14 A;  1RD9 D;  5FLX L;  1EEI D;  2L5T A;  1B50 A;  5G3L D;  3M4O B;  1H9S B;  3PV0 A;  1H9J A;  3D4D A;  3NTH A;  3HZX A;  4ZRZ A;  2PZT A;  2J4X A;  2F0D A;  1PLF A;  3PO2 B;  2Z1C A;  1LTI D;  4ODG A;  1EWH A;  2WIN B;  3OWF A;  3OPO A;  3I90 A;  2YYZ A;  3H91 A;  1B1Z A;  5K36 H;  2A6H D;  1PZJ D;  4BY1 B;  3A55 A;  1TWH B;  1IYU A;  2XIW A;  5KIX A;  5CV6 A;  5CGK A;  1NR2 A;  1LT4 D;  3N52 A;  1D5M C;  2K5D A;  4HCS A;  2F0W A;  4RAU C;  3K59 A;  3R2T A;  3JAM L;  3DM1 A;  2LKV A;  3MXN A;  2L12 A;  2DNC A;  1SSO A;  1ENC A;  4BS9 A;  3GQB A;  4FXG C;  3MTS A;  1F2Z A;  3KF8 A;  3GTP B;  5DM7 3;  3NPP A;  1SYD A;  1X32 A;  2RQX A;  1PZK D;  4OIJ A;  2B63 B;  3GTM B;  2IJ0 A;  1DD2 A;  3ONA B;  4C1N I;  2BCO A;  4ABN A;  2A74 C;  1HUN A;  1ILP A;  1GOZ A;  1PTO H;  1DJR D;  1SYC A;  2L4N A;  3HS0 C;  2WAQ B;  1E2Z A;  2HDM A;  3V96 A;  5K5P A;  2KJX A;  1DYQ A;  2XNA C;  1MSH A;  1CZG A;  1OXT A;  2KCN A;  4NW2 A;  5ELB A;  1S5E D;  2SDF A;  1TS2 A;  1DCZ A;  1RDP D;  4XIG S;  4P2C B;  2NUC A;  3CRK C;  1J9O A;  4H7B A;  1HTP A;  1SE2 A;  4IUU A;  1DXM A;  4KKU A;  3SE0 A;  3GV6 A;  3TZU A;  4A3F B;  4CGY B;  2PCF B;  3LWU A;  5E4W C;  3NUC A;  1EZ6 A;  1FNW A;  2R3Z A;  4XYQ A;  2PQE A;  2R61 A;  1U9R A;  3D8G A;  1EWC A;  1RF2 D;  2J7Z A;  1EY7 A;  3VYU A;  1Y8P B;  4ZKB B;  3R93 A;  1STG A;  4IFD H;  2X69 A;  5C3W A;  2HUG A;  1Y1W B;  4PMW A;  3ZYY X;  2JXM B;  1LTB D;  5KGU A;  1HRJ A;  1U4L A;  1PYW D;  4RH6 A;  1DZ1 A;  3FKI B;  5C0X H;  3BZD B;  3QG1 A;  2IL8 A;  4BA1 I;  3J80 L;  1ROD A;  3M85 A;  2G9H D;  3VA7 A;  3HOX B;  5M5X B;  4R9W A;  1WTP A;  2F0O A;  4N9P A;  2M2L A;  5ELE A;  5CYU A;  2F3W A;  4CKB A;  1OXS C;  1HQM C;  2AWN A;  1OXV A;  1FD7 D;  3FPP A;  5I6Y A;  1AFP A;  4U68 A;  3HOY B;  1A3U A;  2EXZ A;  5CV4 A;  3HG9 A;  3S2D B;  3DEO A;  1CHQ D;  4H0L C;  1LAC A;  2K7V A;  3A8I E;  4A3B B;  1FNV A;  5EPK A;  1M4V A;  1E2V A;  1JWM D;  1U4P A;  3RD4 A;  2B8F A;  5JAV A;  2ENB A;  2RDG A;  5J1Z A;  1SYE A;  4KJO A;  1H9M A;  1FYC A;  1BO0 A;  3X3M A;  3ND8 A;  1AEX A;  1XX8 A;  1QOH A;  2WKD A;  2DNE A;  4MHE A;  3OMC A;  3K58 A;  2EYM A;  3I4L A;  1M8A A;  1YNJ C;  1CZW A;  4DFA A;  1VMP A;  4WRD A;  5FO7 B;  1STH A;  1Z47 A;  3GTK B;  1RJT A;  1DM0 B;  2CQA A;  1LV9 A;  3QWN A;  5CV5 A;  3NTK A;  3S14 B;  1SMY D;  3FRP B;  1YNN D;  1RTO A;  3SK4 A;  2Z4H A;  3J7A F;  3QB3 A;  3C2P A;  2BOS A;  1MBY A;  1VF7 A;  4A3M B;  3PIP 3;  3OIQ A;  2K03 A;  1JR0 D;  4Q0F A;  1EY4 A;  5KEE A;  3LWE A;  3SVM A;  2OEO A;  3NBI A;  2EJF C;  4QUC A;  4E6I A;  3WOE A;  1PRT D;  1RCV D;  4A3D B;  3W2D A;  4YIJ A;  2EY2 A;  1TT2 A;  3KBG A;  4MN3 A;  3NTI A;  5E4X A;  2SEB D;  1SFO B;  2VB3 X;  2XWJ B;  4ILW A;  1BNZ A;  1WTX A;  2EYJ A;  3NWT A;  5FO8 B;  2B2Y A;  4LMQ D;  1CTM A;  2F4I A;  3TP8 A;  2B8G A;  5IT9 E;  1TQO A;  3SHL A;  4KD3 A;  2QIL A;  1F2L A;  2BE5 D;  5KRU A;  1BDO A;  1U4R A;  1PDQ A;  2A69 D;  4K2L A;  3PUX A;  4PMB A;  3I91 A;  3HP3 A;  3RUZ A;  1DON A;  3QOL A;  2F1M A;  2B2T C;  2F0Q A;  5I9P A;  3I70 A;  4DNT B;  2E76 C;  1AZP A;  1JOR A;  1EY6 A;  2IX3 A;  4EVO A;  4RHR A;  2SNS A;  3S16 B;  4G4K A;  1R9T B;  3T13 A;  1GUN A;  1SXT A;  1I4H A;  3R3O A;  1ZYR D;  2RA4 A;  5DM6 3;  1PMR A;  3C1E A;  4C2M B;  3Q22 A;  1L0Y B;  1QNU A;  2F0K A;  1LLR D;  4HAE A;  1TY0 A;  1B9N A;  5CMD A;  5LL6 S;  3HGB A;  4EQO A;  5ELF A;  2JEA I;  1KTK A;  3MHB A;  1TS4 A;  2E2J B;  1GUS A;  3IFT A;  3A54 A;  5ISR A;  1HXY D;  2AUJ D;  2JYO A;  1F2Y A;  1I4R A;  1STN A;  2B2V C;  4Y7N B;  3H6M A;  3X3N A;  4R8I A;  1E2W A;  1GHK A;  1Q1B A;  4OGQ C;  3RZD B;  4HMI A;  2NN6 I;  1I6H B;  4F8M A;  1DOL A;  2EYO A;  1NSN S;  4WOR A;  2B2Y C;  1V8Q A;  5JEA H;  1IW7 D;  2MJ8 A;  3ND9 A;  5FO9 B;  1Z6H A;  1V1P A;  2PO4 A;  2F03 A;  1C8C A;  4XDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...