5IGEA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igeA00
1ENAA 1EY4A 4IUNA 2EY6A 2F0IA 4WORA 3TP6A 1SYDA 5C3WA 5IGGA 5J22A 5KGUA 1JORA 2OF1A 5I6WA 3C1FA 5EKKA 4J6HA 1A3TA 3ITPA 2F0QA 2F3VA 3NK9A 1EQVA 2F0OA 4H7BA 3NP8A 3SK8A 3T13A 4K5WA 1EY7A 4DF7A 2F0DA 1F2MA 5C5MA 3QOJA 4ODGA 4N9PA 4WRDA 4RKLA 4ZUJA 1EY8A 3OMCA 5K5PA 3SK6A 1SNDA 2F0KA 4K5VA 2SNMA 3LX0A 4QMGA 4K8JA 5CV7A 5E1FA 4F8MA 2EXZA 1SNPA 5IGEA 3MHBA 3OMGA 3EROA 4HMIA 4LAAA 4OL7A 5IGBA 4QF4A 1EYDA 3D6CA 3MXPA 4ME5A 4DGZA 2F0VA 5CV9A 3P75A 4IALA 5DEHA 4DFAA 1SNMA 3DHQA 1A2TA 3H6MA 3OWFA 4K5XA 4KTAA 5IODA 4ZUIA 5JAVA 4DU9A 2RKSA 1NUCA 1EYAA 2EYFA 1EZ6A 1SNOA 1SNCA 5M9OA 5IOCA 1STGA 1SYFA 2NUCA 4ID6A 1EY9A 2F0HA 4NMZA 2KHSA 5CGKA 5IGFA 5KRUA 5KYIA 4B9WA 2WACA 2QDBA 2F0GA 2PZTA 3EJIA 2PZWA 4B9XA 2F0FA 5IGCA 3D4DA 5KIXA 5CR3A 1A3UA 2PW7A 1KAAA 3NQTA 2PYKA 2F3WA 1JOQA 1NSNS 1TQOA 2EYLA 5KYLA 1ENCA 1KDBA 5CV4A 4I65A 1F2ZA 1STBA 1SYEA 2RDFA 4R8NA 1KDAA 4YIJA 1JOOA 3SHLA 5CC4A 5ISRA 4K2LA 5EKLA 4K6DA 4QB4A 5J39A 1KDCA 3OSOA 2HQEA 3U9OA 3NHHA 2OEOA 4G57A 1EYCA 4KJOA 1EY0A 1A2UA 2F0MA 5F2DA 3SK4A 2ENBA 1STAA 2F0LA 5C4HA 2SNSA 1EY6A 5NUCA 5JOBA 3SR1A 2RBMA 3D8GA 4NDXA 3TP5A 2EY2A 1AEXA 2F0EA 3MEHA 4K8IA 4ZQ3A 2EYJA 2LKVA 3E5SA 2O4XA 4KY7A 4KY6A 4KV6A 4E6IA 4PMBA 4KD4A 1A3VA 1EZ8A 5I6YA 3V2TA 2PW5A 5I9PA 1STYA 4KHVA 3HZXA 4NKLA 4NP5A 3BDCA 5CV5A 4EQOA 1SNQA 1U9RA 2F0WA 1IHZA 4PMCA 4S3SA 1STHA 3C1EA 2KQ3A 2F0SA 3PMFA 3QB3A 2F0NA 3RUZA 4EVOA 4KD3A 5HURA 5DAUA 5J1ZA 3VA5A 5C3XA 3TMEA 5IIFA 3TP7A 1SYBA 2EYOA 3T16A 3NXWA 1SYCA 3SXHA 2M00A 3P1HA 2EY1A 2EY5A 5E3FA 2F0UA 3D4WA 4IZ8A 5HGTA 2F0PA 2SOBA 3BDLA 2EYPA 3HEJA 3MZ5A 3R3OA 4MIUA 4HMJA 3TP8A 1STNA 1TR5A 3ERQA 4KY5A 1JOKA 3MVVA 2EYHA 4K14A 5C4ZA 4EQNA 5C6AA 2EYMA 3NUCA 4PNYA 4HTHA 2F0JA 3DMUA 1EY5A 2PZUA 2F0TA 5EGTA 4K2KA 3SK5A 3EVQA 5C5LA 5CV8A 5IGDA 3QOLA 1F2YA 2PQEA 4KJNA 4F7XA 3S9WA 4N9TA 4EQPA 1KABA 4J1MA 1RKNA 1SYGA 5CV6A 1II3A 4RKBA 5I9OA 2OXPA 5KEEA 1TT2A 4TRDA
chains in the Genus database with same CATH superfamily
2RA4A 4JC0A 3RN2A 4CDDC 2HDMA 2I5MX 5I4DA 1KLGD 1XJVA 4ZLTF 1YJWA 2Z6KA 1S5BD 2A69D 1IKMA 3OMCA 3C2PA 1D5ZC 1JE4A 4C3IB 2GN5A 3BJUA 1KHIA 5FLMH 2PO4A 3ZYYX 4B3TL 3PIP3 3F2DA 3QWNA 1CZWA 5DEHA 4IALA 3STBC 1AE2A 3T51B 2CKZB 5LL6S 4DU9A 2EYFA 4IPGA 1TWHB 5BN4A 4JI3L 2JA7H 3FPPA 1ZKOA 1OXXK 4A3DB 3F1ZA 1HTLD 1PTOD 5IGCA 1X3GA 5GROA 4AYBE 2R92B 1EFID 1VMPA 3FKIH 4IFDI 2K5QA 4JOIA 2MP1A 2JA9A 2A69C 1C48A 3K6OA 4J8QA 5ISRA 2QEXA 2N55A 3OSOA 1D7QA 3DM3A 2OEOA 3E9HA 2A5HA 2JA8H 3FKIB 4HJ7A 2SNSA 5FOBB 3H91A 1SFOH 4GLAC 3MXNA 4RGMA 3KUPA 2O4XA 2WFWA 5EBDA 3D0FA 2YTYA 2DGYA 4JI1Q 1ESRA 1BQQT 1KRTA 1PTOC 1Z9FA 5IYCH 1TWAH 2AWNA 1X3FA 2DN8A 4R4CA 1EIGA 1WCMH 3OHXC 4A3KH 3VA5A 3NTIA 3TP7A 4EGVA 1RIPA 2PNHA 3F2BA 4HR7B 1CKOA 1KNEA 3QO2A 4NXMQ 3MFGA 1SE2A 4JI7L 3HP3A 3VR6A 1JOKA 3K59A 3MEFA 4DA2A 1I94L 3M3YB 1BXTA 3KF8A 2UUCL 3C3LA 1KABA 4LWCA 4DUZQ 5IYDG 4HJ5A 2J0TD 1JORA 4C3JG 4WJ3M 4FP5D 4QUCA 4L5SA 4RGOS 1EQVA 2B2UA 2K28A 1F9QA 4ME3A 2JXMB 1PTOH 3HFZB 1F2MA 1IKLA 2XGTA 5EKIA 5FLXL 1TWCB 4Y7NH 3H0GG 4LF8L 1E2WA 4K8JA 2K6AA 4DV7L 5IGEA 2G5DA 1QNKA 4RHRA 4A3FH 4LAAA 5DNFA 2UUBQ 2HCIA 1X32A 4RH6A 2QEJC 3S1MB 1LTBD 1MSGA 3D6WA 5ELBA 2ZXPA 3S16B 4LMQD 2L11A 2KCTA 5C3EB 1LT3D 1IBKL 1STGA 1EY9A 2F0HA 1CHQD 4RA8A 2PZTA 4X64Q 1N33Q 1BF4A 2EJFC 5D3IB 1KAAA 2Q2HA 3LNNA 3MXNB 3VR2A 1ENCA 1GM5A 1EIFA 4A3LG 3I4NH 4IJLA 3K7AH 4UHVA 2B2WC 2UU9L 4C3HG 2ID0A 3PUXA 5FJ8H 2Y0SB 2EJGC 1GO3E 2R7DA 4RFBA 1XMQQ 4KY6A 1DOKA 4IFDJ 2CWAA 5M5WH 1KRSA 5G3LF 5GQOA 5JVG3 3A7AB 3NSWA 1SNQA 5G3LD 3RLOA 2F0WA 2UXBL 1N32L 5IE8A 2MJ8A 3M4YA 1JC7A 5J1ZA 1BR9A 1GJXA 2K32A 2YTVA 3NXWA 1WD1A 1SYCA 5FLXE 1B3QA 4X62L 5DM63 3BDLA 4C1NI 1BKBA 1OO9B 4MIUA 3TP8A 5CBAE 3BVZA 2NTSA 4A3JG 4K6LA 3PCOB 5JVH3 1AZPA 2PZUA 1VQMA 2I46A 1CI3M 3MA2B 4IOAA 5CV6A 1W6KA 2UUAL 3ULPA 1BCPC 3W3AA 4DR1L 2HD3A 2IWHA 3BYYB 5KGUA 5JPMC 1PRTD 2HIVA 1WTWA 1WYDA 1B3AA 1GVPA 5FO9B 2B39A 4DNRB 4A3GH 2K04A 3F2CA 4IPHA 4DKAC 4A3LH 4B08A 3M85A 4WRDA 1ET6A 4DV7Q 3G4SA 3G71A 2GVBA 4K5VA 1F77A 3HOZB 2QA4A 2G9HD 1TXYA 4BBSH 1SMYD 2YV5A 1L1OA 2F4VL 5IGBA 2PCFB 3CXCA 2B2TA 2VQEL 1EYDA 1WFQA 3QIAA 4FXGC 4ZRZA 1M8AA 2B3GA 3PSIA 4TSSA 4CGYB 3E3XA 1SNOA 3IL8A 4LNQA 3CKIB 1QNUA 1W3SA 4ID6A 4A3MH 2UXDQ 2QDBA 4MTNA 1LTID 1VQ7A 4R4IA 2BOSA 3H94A 5JPNC 4JBWA 3I70A 3H0GH 5AJ3Q 1VQNA 1KL9A 2HQLA 4OONA 5FO8B 1YNJC 5C44G 1TIID 1UWVA 4G7ZC 4K2LA 3GTKH 1JJGA 3I73A 5LL6X 1VQ9A 4A3CH 1SMYC 2MFIA 3HKZB 1A2UA 2DNEA 4R9WA 3VR3A 5IYDH 2QF7A 3TP5A 4K8IA 4CKEA 3NTKA 1JB3A 4PMBA 3T1HL 2MGSA 3HZXA 4EQOA 2MNAA 3CCSA 4AQYL 4V190 4XYOA 4P75A 1WTOA 1I4QA 3A0JA 2EVBA 2VB2X 2A73B 2KENA 1MKHA 1NMGA 2BE5D 1UAPA 1GUTA 2RCFA 4YHHQ 1Q86C 2VUMH 1Y1VB 1C4QA 5EGTA 2GA4B 1BUVT 4BXXG 3GP7A 4DV5Q 3HOWH 2I5LX 1NR4A 2IT1A 2JJQA 2NWGA 4RCNA 5M3FH 3GTLB 2FINB 3Q8DA 4NXML 4A93H 5ELFA 2RQXA 1I6HH 3S16H 3C1FA 3NBHA 1XPOA 1Y1WH 5L37A 1U0LA 1VQ8A 3SK8A 3MWYW 3PIO3 1PLFA 3T13A 4K5WA 2E5LL 1XMOL 2VL6A 4N9PA 3TN2A 4ZUJA 3PQIA 3EIVA 2BA1A 3URYA 4UY8C 3CCMA 1MIUA 2JA7G 2NTTA 5HY6A 3CCLA 5M5YB 3NE5B 4LF5Q 2RHSB 5C4XB 1FNUA 2KUMA 4HCEA 1XPRA 2CWPA 1OXSC 1A62A 3EA6A 1G291 1M1KC 3KDFA 3QJYA 1IBMQ 1SYFA 5GADC 4JI4Q 1EFWA 2VQFL 2KCMA 1I4GA 1K3RA 2MUYA 3T1YL 4C2MB 5FLMG 2D2CC 3S15H 2NBFA 1VQCA 1PZID 1R4PB 2PI2A 1PTOF 3NEMA 2Z1CA 1O7YA 3TEHB 4AIMA 5GAEC 1NNXA 2KVMA 3NHHA 2WB1E 5F2DA 1STAA 1NAPA 3KF8B 4JI8Q 3AYHB 3ULJA 1XMOQ 3OTOL 4L63B 4TVAB 3K5OA 1HR0W 1Y1VG 4E6IA 4KV6A 4OGQC 3D3RA 3JAME 3TBIB 3DWAA 2P5ZX 3L7ZC 5CV5A 4WFN3 1U5KA 4A3GG 1VCIA 4G7OC 3GV6A 3KLWA 3J81L 1XPUA 1HUMA 1QVFA 3CD6A 2KHIA 1S72A 2F0UA 1N34Q 1VMCA 2CW0C 4XXEA 4DR5L 2L0CA 5BR8Q 3M7NA 2IY5B 3I4MG 2EYHA 4X3SA 1Y14B 2ZM6L 4DV4Q 5C44H 4HTHA 3A7LA 5JEAH 5IWAQ 3J7ZC 2CH4W 4HIDA 3PF5A 1I3QB 3Q6SA 3S2DH 2NZ1D 5A35A 2OTJA 4JV5Q 2B63B 3HOYH 2KOLA 1Q8KA 2JA5B 1JJ2A 4CDCC 1N36L 2R3ZA 4WORA 4BY7G 5J22A 4I7ZC 2AWOA 5I2XA 1B50A 1TWGB 4XT3B 3L3OC 5IWAL 5LMUQ 1X55A 2CW0D 4P73A 1CZGA 1VQPA 1H95A 4CDFC 5FJ8G 1BCPF 1MJEA 2SNMA 3EQLC 4DK6C 3KLSA 3CPWA 1C8CA 2ZTDA 5TSSA 3CCQA 2H4OA 1S5FD 2L5TA 4XTCS 3A8KE 2K4KA 4EQ5A 3JAML 3CQZH 2NVQH 1QG7A 1EYAA 2DY8A 4LF7L 2Q2TA 1PZKD 3U4ZA 4B9XA 3J81E 1UE5A 1I4RA 2IJ0A 3DEPA 3NQTA 4JI8L 1PHJA 4CBVA 2JN4A 5CV4A 1GXDC 4XQNA 1F2ZA 1SYEA 4L8JA 1N9WA 5CC4A 4UP7A 4LF4Q 4A3JH 5J39A 5C4XG 4A3FG 4L5RC 1EY0A 1HFNA 4DAYA 2SDFA 2ZXOA 2WIIB 1CKNA 1YHAA 3RZDB 2AUJD 1HA6A 4YY3L 3UDFA 5IP9G 4DNIA 1I4XA 3TSSA 1JWMD 5IT9c 2H1EA 3LWUA 3J81i 1E0BA 4NW2A 3K5NA 1KNAA 2FFKB 1N36Q 3R8BA 1EOTA 4HJAA 4LFAQ 5JEAJ 2UUAQ 1HCZA 2AHOB 4UDUC 1EL0A 2M00A 1Z6HA 5HGTA 2AQ3B 5H1SE 2JP1A 3MZ5A 2E76C 2I07B 2C5CA 3AFQA 2JQOA 3PO2B 3PO3B 2BH8A 1A8VA 2NN6G 4C3IH 1PH9A 4A3GB 3E9IA 3RLFA 5J3BA 1QWYA 3DUZA 4C3HB 4DPGA 2D0PA 1VQ6A 2UXBQ 4HIKA 4OO1G 5C3WA 1VS0A 5I6WA 1HHVA 4J6HA 3SVMA 4R1JA 3A5UA 4GKJL 4HN7A 1RTNA 4IOCA 2A68C 4A3BH 1U4RA 2CQAA 4A3DH 3GD7A 1H9SA 3UDGA 1K8OA 4J15A 4JI6Q 1UUPA 3D4RA 4F8MA 4R4QA 1PH2A 2M2LA 5C4JB 3EROA 1AZQA 2Z0SA 4G4KA 4A3DG 3S2HH 1G6ZA 1L1OC 4LF8Q 1E2ZA 4UPAA 1KAWA 2J4XA 1XXGA 1I5FA 2K05A 2R93B 5KRUA 4JK1C 1HNWL 1WTQA 2WACA 1SFOB 2WKDA 1HZAA 1B9MA 3J80E 2JA7B 1A3UA 2B63H 2A68D 4YCWA 4A75A 3HOVG 5EJWA 1XWEA 1TQOA 3HKSA 2NN6H 3BVGA 4C3IG 4UAIA 1F9RA 1EWCA 1KDAA 2KEEA 2K5NA 4YIJA 2NVXB 4KK7A 1LTTD 4LF6L 4WJ4A 4A3KB 2IX3A 2E2HH 1CSPA 2B29A 2HQEA 2IHEA 1EYCA 3HOVH 1YITA 3M7GA 1VQOA 2RBMA 4ALPA 4DR2L 3A5ZB 3PO3G 4KHZA 2XSCA 3I7FA 1NCVA 2UUBL 1STYA 2DJFC 1CA6A 3H3VI 4GOPB 4S3SA 3PMFA 3RUZA 2F0NA 3K81C 4A76A 3P7JA 1PH3A 3KJPA 1I6VC 2A19A 1SYBA 2FMMA 1FL0A 1SLJA 3S17B 4C56C 1ICFB 1EU3A 5E3FA 1V1QA 5LHY1 4KKSA 3KLRA 4UP8A 4KY5A 3BVMA 2K5VA 4HAEA 2KECA 5LMNW 2DJGC 1GHJA 2ZJQA 2EIFA 1TS3A 4BY1G 1K8GA 1GUNA 2PMZE 4JI1L 4N9TA 4EQPA 3K7AB 4J1MA 3S17H 4OO1H 4DUYL 3GTOH 4X6AH 2JEAI 2IW3A 3IKJA 2C9OA 2FXQA 1A15A 3T56B 1EY4A 3U58A 2NYZD 3G48A 4JBMA 3PUWA 3ITPA 3W1BA 5EPKA 1S40A 4DK1A 1LTAD 1KD1C 4C1NK 5IY0A 3PIOA 1I4HA 1X3PA 2F0KA 2N78A 5CV7A 2Q2UA 4KN7C 5EBCA 2WAQB 1P8LA 3MHBA 3MAQA 5M5XB 2Y0SG 4QIWB 2K5WA 2K5HA 1A63A 1Q12A 4GKJQ 3MXPA 4ME5A 4DGZA 1TS4A 1J6QA 3IAYA 5JAVA 4LW1A 4GKKL 4GLXA 1EZ6A 4B3RL 4JCVE 1F2LA 4FF3A 5M3MG 3UDIA 3WDNA 3CP0A 3M4OB 4BY7H 4JI6L 2JA6B 1LT6D 1VQIA 2XTIA 5KYIA 3CC7A 2JA6G 1H9JA 4X3KA 5COYA 3AFPA 3HOXG 1YNNC 4BBRH 2E5LQ 3FMCA 2JSOA 1X6OA 1KXLA 2WP8J 2F3WA 3I72A 3AEVA 1YHBA 3BZCA 1HUNA 1STBA 5JEAG 4BA2I 2XNAC 1A6XA 1QB5D 4YCUA 1HZCA 3I4MH 1WTPA 3U9OA 5CORA 2F0MA 5C4HA 3S15B 5DM73 1QUQA 5BN5A 1D1IA 2R7ZH 5JOBA 1MBYA 3OW7A 1KC8C 1U4PA 4CJ2C 1AE3A 4RGTA 2Z6BA 3MXGA 1TS2A 4GNXB 1PYWD 1VQ4A 1JB7A 3MFYA 4JI4L 1N8RC 5C4JH 2RDGA 3I8ZA 1CKNB 1CQFA 4X3TA 5M5WB 3BDCA 2CQOA 3I56A 2L15A 1Y69U 2E2JB 1UE7A 1KTKA 3KDFB 1Q3LA 1YNXA 1BCPB 2K01A 2KQ3A 4PZ8A 5KNCA 4KD3A 2OT2A 3TMEA 3V05A 3AU7A 2KBNA 2EYOA 3T16A 1Y8PB 4FYDA 3S2DB 4GZYC 2EY5A 2F0PA 2SOBA 3H3VH 1BVSA 4QL5A 1XTCD 4JG2A 2OTLA 4OXPA 2OQKA 4HIMA 4PNYA 2KHJA 4JVZA 2F0TA 3S1NB 1G91A 3IFDA 5CV8A 3FDTA 1Q90A 1F2YA 5C0XI 3F2UA 4RKBA 1TY2A 4ZCKA 3GDEA 4LF7Q 4NXNQ 3K5MA 1SYDA 2BDNA 2CHBD 4GS3A 2CCZA 3GTPH 1HZBA 4HIOA 1I3QH 3CPFA 3CRLC 1EEID 1T5EA 3TZDA 4PQXA 3HOXB 1BO0A 3CHBD 3PGZA 3SK6A 1UE1A 1MGSA 4QMGA 3I2ZA 5IP7H 3CW2C 4YWMA 3GTKB 4LFBQ 3ONAB 2AQ1B 3D6CA 4U68A 4OX9Q 2Z4IA 1RDPD 4CKCA 2A6HC 3DHQA 3ULLA 4AQYQ 3CC2A 3K7UC 3RR5A 3H15A 1Y1WG 3OOCA 2A74C 5IT9E 4PZ7A 4A3IB 1U4MA 5FK9C 4BS9A 2R93H 3HS0C 2OCEA 1PYSB 1PH6A 3GV3A 1IBKQ 2PW7A 2K52A 1HNXQ 1SN8A 5CYUA 4P72A 5ELNA 4A3IG 2A8VA 2K50A 3H0GB 1XTDA 1S3OA 2QDLA 3K0YA 5E4XA 4B3ML 4OWWB 3S14B 4LFBL 4OWTB 5EPLA 4NB3A 5A2QE 2NVXH 1FJGQ 1HNWQ 1SRUA 4C3JB 2AUKA 3W2DA 4DNTB 1B70B 4DAPA 1B44D 4BY1B 4OEMB 2EYJA 2LKVA 2RHQB 3E5SA 4POGA 2QW7A 2GVAA 1EZ8A 1K9MC 1MD2D 5LMNQ 3A56A 3TREA 2L55A 2RCNA 1STHA 1PH1A 3KBXA 3SEBA 4L5TA 3X3MA 1Q8IA 5IP7G 1LABA 1FYCA 4B3SL 1B2TA 5AFWA 4N8FA 3U9SA 4IZ8A 1DONA 3R3OA 4LF6Q 2J7ZA 3W1GA 5C6AA 5C0XJ 1VQDA 2JYOA 1D6EC 3E0JA 3DMUA 2WV6D 3ZJYC 1I50H 2YU9B 3IFTA 4CDEC 1VQFA 1PH5A 2ZJPA 3R2TA 4LUVA 2OXPA 5KEEA 3AQQA 1IBML 2K33A 2F0IA 3EFXD 1WTXA 2ZT9C 3HOWG 1TY0A 2XN9C 1PYBA 1DM0B 2LXJA 1ESFA 2RSOA 1GUWA 4NPSA 4KKTA 1YI2A 3NENA 3V96A 2F03A 5BN3A 5A2QL 4GOPC 1XMQL 2D62A 4OL7A 4K0KQ 4RGNA 1H9RA 1QZGA 3CAMA 3GTMB 5C3EH 3TZUA 1N32Q 2R61A 5IODA 1CM9A 3QR8A 2UU9Q 2PQAB 4ZYSA 4IUQA 5C44B 1AFPA 4XYQA 4ILWA 2NUCA 3VYUA 1NR2A 3M4OH 4IFDH 4JYAQ 2FMCA 1G6PA 2B2VC 3M4PA 4ABNA 1UEAB 4GN5A 2AMCB 1ZEQX 5T1IA 1FR3A 2IHFA 4LJZC 1TWFB 3G6JB 1UEBA 1HNZQ 1LTGD 2H5XA 2N8NA 2O5IC 3GQBA 2WKCA 4DR6Q 4LUZA 4A4IA 3RMHA 4FXKC 4LFAL 2OQ0A 3LGJA 1ASZA 4FO2A 4DUYQ 2VXWA 2R92H 5I9PA 3ND9A 1G2TA 1SEBD 3S24A 3ER0A 3C1EA 2BE5C 3A74A 2UXCL 3OW2A 1D2BA 1EU4A 4XT1B 3X3NA 1PFMA 3R93A 5BR8L 3GTPB 1M4VA 1QVCA 4KI0A 2DY7A 3NELA 3HOZH 3MVVA 4DUZL 4ZKBB 1JT8A 1V9PA 1B4OA 5FO7B 2TSSA 3SK5A 2B2TC 4IJHA 1NE3A 3S9WA 4YHHL 4A3JB 1QJOA 4CHTB 2B2VA 1DCZA 4TRDA 4A3FB 2JEBI 5D14A 5CBEE 1SE8A 4F88A 1DGSA 4A3MB 3OWEB 4OIKA 1EQRA 4YCVA 2F3VA 1ZYRD 4P2CB 2LXKA 4DV2L 4TQUS 1N34L 2HHHL 2R92G 2ZTEA 1O7LA 1EY7A 2F0DA 2Y0SE 4RKLA 5FLXc 2KA7A 4HJ8A 4BBRG 5E1FA 1AN8A 1FJGL 2EXZA 1Q81C 4X65L 4YWKA 5JJLA 5D3DA 2JA6H 1D5MC 2F1MA 4X66Q 4B3MQ 1KIXA 2MO0A 5CV9A 2VZAA 2MQHA 4K5XA 2AKWB 4XIGS 1V1PB 2VS1A 4ZUIA 1NUCA 1HRJA 1HNZL 3PO3H 3S1QB 2PNRC 3J81j 2E2DC 1L0XB 1O7IA 2ZJRA 4DXFA 4OELB 5EQ0A 1G8ZD 1MI2A 2VW9A 1M90C 4I65A 3NWSA 1PV4A 2HT1A 4R8NA 1LM0A 1Q82C 4FF2A 4JW0A 5EKLA 4GN4B 4EX5A 5GAHC 1WI5A 3LWEA 4A3EH 1XYIA 4MNOA 5ELEA 2EOTA 4KJOA 2B63G 1Q7YC 4AH6A 1SE4A 2FHTA 1FGBD 2K75A 3MEHA 1WCMG 2JE6I 4APVA 3GTLH 3J80c 3AB9A 1R9TH 4LF5L 1A3VA 1VF7A 5I6YA 3CMAA 2Z9HA 1YJNA 4JI2L 3J80i 4DV5L 3GTMH 1IHZA 1PRTF 4X62Q 1EQQA 3KFUA 1PRTC 3QB3A 4DV6L 2QILA 4C2MH 1NMFA 4HJ9A 4OO1I 2MHVA 1LV9A 4N8X1 5IIFA 1CKMA 1PA6A 4IUUA 3P1HA 1XNQQ 4DR3L 2EY1A 1G2SA 3U50C 2VUMB 1VQJA 1ICWA 2NVTH 4HMJA 3ERQA 1TVXA 1V1OA 2K03A 1K8AC 3K58A 1Q46A 2XRQD 4OHJA 4XQJA 4K2KA 4IUPA 1OTCA 5C5LA 3RZOH 1PZJD 2PQEA 4F7XA 1SJED 2NZHA 1BBXC 2EJMA 2E2HB 3CCEA 1SXTA 1SYGA 2I5HA 2QKIC 1C7YA 4HSVA 3RZOB 1A3TA 3L0OA 1LACA 4IPDA 4A3EG 3CRKC 1S5ED 3DM1A 4QCLA 3KF6B 3QOJA 1PRTB 1YNJD 1SNDA 3Q23A 4IQZA 1WJJA 2WB1B 1V8QA 2CFMA 3VR5A 4ZAIA 3OMGA 2XRSD 1NY4A 4QF4A 3OYYA 1SBBB 1B53A 1QUQB 3JC66 2EQSA 1IZ6A 3P75A 4KHPQ 2ALYB 2F4IA 4O42A 3M9BA 1SNCA 1FGUA 5IP9H 3BYTB 4L6TB 1MJCA 2EZVA 3MXUA 3J7AV 3EJIA 3KF6A 2R93G 3O13A 3D4DA 1W6JA 4B3RQ 1JICA 5JJKA 4BBSB 2WB1G 2D9UA 1KDBA 1O80A 1XNRL 2NB0A 2E75C 2ZXRA 3VA7A 1IBLQ 2WAQG 3MTSA 1E1OA 1JQYD 4G57A 4HEDA 2ENBA 1SSOA 2F0LA 1EY6A 5NUCA 1C9OA 2HUGA 3FP9A 4DR1Q 4MN3A 1EOVA 3D8GA 1K3BC 1AEXA 1S4ZA 4LUOA 2NZOA 2JA5H 1WD0A 1TWAB 2Z8LA 3VYRA 3S1RB 4NKLA 3UE0A 1L0YB 1U9RA 3L9AX 1JR0D 2LFNA 1K0RA 5HURA 2PI2E 3H3VC 3MC0B 2DNCA 4BY7B 3CCJA 4KMUC 1E2VA 2L12A 4RAUC 4DV0L 4YWLA 3HEJA 2EYPA 4GNXC 3OPOA 3S1RH 1IBLL 2E2IH 4LF9Q 1STNA 1SR3A 2B2WA 1Z7TA 4IURA 4EQNA 4FF4A 3FRPB 1HJPA 2KJXA 2L1BA 4KJNA 3NTHA 3RNUA 3I4MB 1LLRD 2PQAA 2UXDL 1C0AA 2Z4HA 4DR4L 1SDFA 3BDOA 1TT2A 2E2IB 2O2LD 3M4QA 3TP6A 4BA1I 2BA0A 1E1TA 5C4XH 2CH4A 4MZ9A 3GO5A 1T5XD 3TQYA 3GTJB 3PV0A 4DAVA 1TWCH 4Q0FA 4DF7A 5C5MA 3E0EA 4ODGA 2R6GA 3W5OA 4XQQA 2E2JH 1LTSD 3D31A 3LX0A 1PXUA 3HKZE 4POFA 2EDGA 1V1PA 2E8GA 1CUKA 5M3FB 1MSHA 4GKKQ 4DV1L 2XVSA 3GTJH 5K36H 4JI5Q 2VQFQ 2F0VA 2KCCA 4F87A 4X3UA 2ICIA 1GD7A 3S1NH 1FD7D 2NN6I 4B9WA 1LTLA 1OXUA 2PZWA 4DV1Q 3TRZA 3HOUB 1GUSA 1JOQA 1FVIA 1NSNS 3N6RA 1K0SA 2V4DA 3I90A 4PZ6A 1KDCA 2DUDA 1KLUD 3A55A 4A3EB 2B2YA 3FPUB 2D0OA 3H09A 2R7ZB 1VQKA 4JI2Q 5ELOA 4JI0Q 4JPBW 2XIWA 1YJ9A 1K73C 2JA5G 3J81c 3RD4A 3U4VA 1HQMC 1S5DD 1RJTA 4PMWA 1ASYA 2N49A 3UE1A 1NTGA 3T4AC 2L9HA 1O7ZA 1X3QA 2IPKD 2QGQA 4R8IA 3IRBA 2A6EC 3NUCA 1TWHH 4H02A 2XWJB 4XDXA 4OIJA 1HNXL 4MHEA 2VB3X 1RCVD 4LF4L 5I2YA 4A93G 1YBYA 2X6GA 2LMCB 1B7YB 1ILPA 3L2PA 1ENAA 2YTXA 1CQVA 1S5CD 2EY6A 4PV1C 1ZXTA 1KQSA 4JBKA 1PFNA 4A3BB 3C46A 1GOZA 1T9HA 2F0QA 2C35B 3NQIA 4BXXH 3NK9A 1FNWA 4RMFA 2VNUD 1PMRA 4DV0Q 1WTRA 1I6HB 4DK0A 1BCPD 3NWTA 4H44C 3I4OA 1XNRQ 4A3IH 5LMNL 2B8GA 1EY8A 2RDHA 3A8IE 4CJ1B 1VQ5A 2B2YC 3VYTA 2M9VA 3I91A 1SE3A 3VYSA 4G7HC 3HOVB 2K14A 2N88A 1LT5D 4RHSA 1HPCA 1JJCB 3SDZA 4JI3Q 3G7LA 4KTAA 2HCCA 1ILQA 2RKSA 4Z9CB 2YYZA 3P20A 5E4WC 1WOCA 2MO1A 3K0XA 4OWXB 4FF1A 5FKAC 3UDXA 4DR6L 1PTOB 4DR2Q 5EPJA 3RZDH 2F4VQ 4H13C 1AH9A 1YEZA 1GUOA 1TU2B 1EEFD 2NVYB 3KK7A 1QILA 1I94Q 4V0BA 3M3YH 4QY7A 1ET9A 2HIXA 4JI7Q 4K6DA 3A8JE 2FJ2A 1K28A 3UI2A 4DV3L 3PUYA 5IYBH 1WVLA 4IUTA 4FVMA 3I4LA 4CKBA 5M5YH 5M3FG 4NDXA 4A3MG 2PPBC 4ULLA 4DR3Q 1VQLA 3PF4A 1NBWA 4KD4A 1HQRD 3FHWA 4KHVA 3SE0A 1AP0A 1I50B 2YU9H 2VUMG 1TS5A 3I4NB 4Y7NB 3NPPA 1CFMA 3PO2G 3F8TA 5DAUA 3RN5A 5C3XA 1HA5A 1BBUA 1EWHA 3SXHA 3GTQB 3OTOQ 4QJFA 5DLQE 5HGQA 2ZM6Q 4DV4L 1LO5D 1EWIA 4H0LC 3HOUH 1J5EL 3DLLA 3Q0AA 3NBIA 2F0JA 1EY5A 2LY7A 1CK1A 1TKWB 4PG3A 4HSPA 1BNZA 1QE6A 1IL2A 4JYAL 1QCBD 4QQBX 1RKNA 3PUVA 3G6EA 1II3A 2SEBD 1RL2A 4KN4C 2R7ZG 4IUNA 1STEA 3DEOA 5IGGA 4RWSC 2BDOA 3J80L 3HOYB 2RVLA 2OF1A 1PFSA 1DXMA 5JJIA 5KNDA 2AQ2B 2VY3A 4WJWA 4X64L 1F9PA 4A3CG 1DZ1A 3BZDB 2Z6KC 3NP8A 3I55A 4DN4M 1YVCA 1HFGA 1F9SA 1PVOA 2K1BA 3PIPA 1UNSA 1YHQA 1VQEA 2Q2IA 1EUJA 3HKZG 4LF9L 3HOXH 1SMXA 1YIJA 2EPBA 1VF5C 1K83H 1JWSD 3CCUA 1DOMA 4DFAA 4DR7L 3OWFA 3H6MA 2EE1A 3DWQA 2KEDA 2EXDA 1JCKB 1U4LA 4BBRB 3SGIA 1ONLA 1OXTA 4DV2Q 1LYLA 1HZ9A 1K83B 4IFDG 4BBSG 2F0FA 2JA8B 2E74C 3KJOA 3R2IA 4JOIC 1LT4D 4HCSA 1B1ZA 1E24A 1H9MA 1EQTA 2EYLA 4KLKA 4DAMA 5KYLA 3S2HB 1D1KA 2WINB 3CF5A 5C3EG 3CC4A 2QCPX 1O78A 3A54A 2HHHQ 3BU2A 4X65Q 3HOZG 3EBEA 3SK4A 3DWPA 2G9DA 4LFCL 1PDQA 1X54A 3SR1A 4QIWE 2EY2A 2F0EA 1RHPA 3VR4A 3J7A5 3CQZB 3EN2A 1PFBA 2A1AA 3HGBA 4NP5A 4RCOA 4O1NA 2XWBB 1VQHA 5E7NA 1BBWA 4LFCQ 4DR4Q 2LSSA 3HOYG 3NBHB 2UUCQ 2N3SA 1GKHA 4R4OA 5IYBG 3KBGA 2BH2A 1X56A 1L2FA 5C4ZA 4K14A 2LS01 4GNXA 1EIHA 1VQBA 2NVYH 4BWGB 4C3JH 1PH4A 1IW7D 2JK8A 2NVQB 3GTGB 2O5JC 4TKOB 1RTOA 5JJZA 1VQAA 2D5DA 1D8LA 1HXYD 1Z47A 2A6ED 1CA5A 5AJ3L 1Q1BA 1QZHA 4I7AA 4C3HH 1LTRD 2V1CC 2B2UC 3OIPA 1YNND 2F0OA 4H7BA 2I0QA 4IO9A 3I4NG 1R9TB 3S1MH 1CSQA 1ML0D 1Y1VH 1EIYB 5KNBA 3HOUG 4RG1A 1H9SB 2ZTCA 1MHWC 2UXCQ 1V43A 5IT9L 1HR0L 4K0KL 4ZK9B 4A3KG 3K80C 4B3TQ 3PO2H 3T53B 5IYCG 1IW7C 3GTQH 1BDOA 1YZ6A 2IX0A 1SNMA 3FEWX 4P71A 2R7FA 1LUZA 3Q24A 1Y1WB 1Q1EA 5M9OA 4JI0L 3K57A 4NMZA 1HH2P 5CGKA 4FDBA 1CTMA 3HG9A 1E7ZA 2F0GA 3S1QH 5KIXA 1SROA 2RF4A 2JA8G 1HR0Q 3DXJC 5M5XH 2PYKA 3T1YQ 1OXVA 2RSNA 1NJIC 4JBJA 1IYVA 2Q8TA 2RDFA 2VQEQ 2MPMA 1ENFA 4A3BG 3SHLA 3ICEA 1RD9D 1WTVA 1TWFH 4IN3A 1DOLA 4JI5L 1CT1D 4A93B 2PMZB 3J7AF 3KYHC 1B8AA 1L1OB 4ZQ3A 1Y8OB 1VQGA 4DXGA 1J5EQ 2PW5A 1JWUD 5ELDA 4M1UB 2ICEC 4DV6Q 4DAYB 4EVOA 1W2BA 3WOFA 3QG1A 4R4TA 2B8FA 2Q8IB 4CJ0B 1IXRA 4P74A 4FNFA 1L0WA 3D4WA 4DV3Q 4GOPA 4B3SQ 3BG3A 1HTPA 1TR5A 4QGUA 4FXDA 4O0AA 2NVTB 1DYQA 2EYMA 3CU7A 1SJHD 5IGDA 1JE5A 1H9KA 3VDYA 1CHPD 3RLNA 1ZYRC 3BS1A 3K5LA 3TS2A 2WAQE 4O2DA 2A6HD 3Q22A 1RODA 4MTKA 5I9OA 2ES2A 1J9OA 4Y52H 1WCMB 3TS0A 3KOJA 3N52A 2K7VA 3E6ZX 1N33L 5EKKA 1FNVA 3I3CA 1TWGH 4L5QA 1BOSA 5K36G 5GAGC 1XX8A 1PH7A 1IYJB 1QOHA 3FKIG 5ELCA 5K5PA 1X65A 1G51A 1RF2D 4X66L 3OIQA 2ATWA 4YY3Q 1SNPA 1UE6A 1SAPA 1B9NA 3K8AA 5LMUL 4HMIA 3FVQA 1E22A 1IL8A 2Q8RE 1K8MA 5T1GA 1WTHA 1A2TA 3CCVA 5M3MB 2IX1A 1R4QB 1D5XC 1QVGA 4IUVA 5IOCA 3JAMi 3CCRA 5IGFA 3T1HQ 2KHSA 5CMDA 4OX9L 2KCNA 3HRZC 4JV5L 3PUZA 4ZKCB 3JAMc 1DD2A 5CR3A 1AW7A 1EYGA 1GUGA 5M3MH 1X3EA 1P16A 1A0IA 3ERSX 3J7YW 3WOEA 3CMEA 1JOOA 4UP9A 3TDQA 1PH8A 4QB4A 4U673 2K5DA 4QUFA 4GLVB 1X9NA 1JMCA 2BCOA 4DK3C 4NXNL 2ASBA 5C0XG 4DR7Q 1J8IA 4LK1C 4KY7A 2HDLA 1Y8NB 1DJRD 4M8AA 3V2TA 3S14H 2X69A 3BZKA 1IYUA 1GHKA 4PMCA 1XNQL 4KHPL 2F0SA 2X6LA 3KLSX 1E3PA 4IPCA 2OWOA 1VDZA 3HOWB 2IL8A 1I4PA 4AYBB 2L4NA 2TMPA 3ND8A 4BY1H 5D65A 2CVRA 2F52A 3AMUA 3GTOB 3EVQA 2F3IA 4KKUA 3B6YA 3QOLA 4GN3B 3WWVA 4AYBG 5EAYA 3STBD 5C0XH 4Q5VA 4DR5Q 3GTGH
chains in the Genus database with same CATH topology
2RA4A 2HDMA 5I4DA 1KLGD 4ZLTF 1S5BD 2A69D 1IKMA 3OMCA 3C2PA 1D5ZC 1JE4A 4C3IB 2PO4A 3ZYYX 3PIP3 3QWNA 1CZWA 5DEHA 4IALA 3T51B 5LL6S 4DU9A 2EYFA 1TWHB 5BN4A 3FPPA 1ZKOA 1OXXK 4A3DB 1HTLD 1PTOD 5IGCA 2R92B 1EFID 1VMPA 4IFDI 2K5QA 2MP1A 2A69C 1C48A 3K6OA 4J8QA 5ISRA 2N55A 3OSOA 2OEOA 2A5HA 3FKIB 2SNSA 5FOBB 3H91A 3MXNA 4RGMA 3KUPA 2O4XA 5EBDA 1ESRA 1BQQT 1PTOC 2DN8A 2AWNA 1EIGA 3OHXC 3VA5A 3NTIA 3TP7A 4EGVA 4HR7B 1KNEA 3QO2A 3MFGA 1SE2A 3HP3A 3VR6A 1JOKA 3K59A 4DA2A 3M3YB 1BXTA 3KF8A 3C3LA 1KABA 2J0TD 1JORA 4C3JG 4FP5D 4QUCA 4RGOS 1EQVA 2B2UA 2K28A 1F9QA 2JXMB 1PTOH 1F2MA 1IKLA 5EKIA 5FLXL 1TWCB 1E2WA 4K8JA 2K6AA 5IGEA 1QNKA 4RHRA 4LAAA 5DNFA 2HCIA 1X32A 4RH6A 2QEJC 3S1MB 1LTBD 1MSGA 3D6WA 5ELBA 2ZXPA 3S16B 4LMQD 2L11A 5C3EB 1LT3D 1STGA 1EY9A 2F0HA 1CHQD 4RA8A 2PZTA 1BF4A 2EJFC 5D3IB 1KAAA 3LNNA 3VR2A 1ENCA 2B2WC 4C3HG 2ID0A 3PUXA 2Y0SB 2EJGC 4RFBA 4KY6A 1DOKA 4IFDJ 5G3LF 5JVG3 3A7AB 3NSWA 1SNQA 5G3LD 2F0WA 2MJ8A 3M4YA 1JC7A 5J1ZA 1BR9A 1GJXA 2K32A 3NXWA 1WD1A 1SYCA 5FLXE 5DM63 4C1NI 5CBAE 3BDLA 1OO9B 4MIUA 3TP8A 3BVZA 2NTSA 4K6LA 5JVH3 1AZPA 2PZUA 2I46A 1CI3M 3MA2B 5CV6A 1W6KA 1BCPC 3W3AA 5KGUA 2IWHA 3BYYB 5JPMC 1PRTD 1WTWA 1B3AA 5FO9B 2B39A 4DNRB 2K04A 4B08A 3M85A 4WRDA 1ET6A 4K5VA 1F77A 3HOZB 2G9HD 1SMYD 5IGBA 2PCFB 2B2TA 1EYDA 3QIAA 4FXGC 4ZRZA 1M8AA 4TSSA 4CGYB 1SNOA 3IL8A 3CKIB 1QNUA 4ID6A 2QDBA 1LTID 2BOSA 3H94A 5JPNC 4JBWA 3I70A 5FO8B 1YNJC 1TIID 4G7ZC 4K2LA 3I73A 5LL6X 1SMYC 3HKZB 1A2UA 2DNEA 4R9WA 3VR3A 2QF7A 3TP5A 4K8IA 4CKEA 3NTKA 1JB3A 4PMBA 2MGSA 3HZXA 4EQOA 4V190 4XYOA 1WTOA 1I4QA 2EVBA 2VB2X 2A73B 2BE5D 1UAPA 1GUTA 1Y1VB 1C4QA 5EGTA 2GA4B 1BUVT 3GP7A 1NR4A 2IT1A 2NWGA 4RCNA 3GTLB 2FINB 5ELFA 2RQXA 3C1FA 3NBHA 3SK8A 3MWYW 3PIO3 1PLFA 3T13A 4K5WA 4N9PA 3TN2A 4ZUJA 2BA1A 3URYA 2NTTA 5M5YB 3NE5B 5C4XB 1FNUA 2KUMA 4HCEA 1OXSC 3EA6A 1G291 3QJYA 1SYFA 1I4GA 2MUYA 4C2MB 2D2CC 2NBFA 1PZID 1R4PB 1PTOF 2Z1CA 1O7YA 2KVMA 3NHHA 5F2DA 1STAA 1NAPA 4L63B 3K5OA 4E6IA 4KV6A 4OGQC 3D3RA 3JAME 3TBIB 3DWAA 3L7ZC 5CV5A 4WFN3 1VCIA 4G7OC 3GV6A 3J81L 1HUMA 2F0UA 1VMCA 2CW0C 4XXEA 3M7NA 2L0CA 2EYHA 4X3SA 4HTHA 3A7LA 5JEAH 1I3QB 3Q6SA 2NZ1D 5A35A 2B63B 2KOLA 2JA5B 2R3ZA 4WORA 5J22A 4I7ZC 2AWOA 5I2XA 1B50A 1TWGB 4XT3B 3L3OC 2CW0D 1CZGA 1BCPF 2SNMA 3EQLC 3KLSA 1C8CA 5TSSA 2H4OA 1S5FD 2L5TA 4XTCS 3A8KE 3JAML 1QG7A 1EYAA 2DY8A 1PZKD 4B9XA 3J81E 1I4RA 2IJ0A 3DEPA 3NQTA 4CBVA 5CV4A 1GXDC 4XQNA 1F2ZA 1SYEA 4L8JA 5CC4A 5J39A 1EY0A 1HFNA 4DAYA 2SDFA 2ZXOA 2WIIB 3RZDB 2AUJD 1HA6A 1I4XA 3TSSA 1JWMD 2H1EA 3LWUA 1E0BA 4NW2A 3K5NA 1KNAA 2FFKB 3R8BA 1EOTA 5JEAJ 1HCZA 4UDUC 1EL0A 2M00A 1Z6HA 5HGTA 2AQ3B 2JP1A 3MZ5A 2E76C 2I07B 2C5CA 3PO2B 3PO3B 2NN6G 4A3GB 3RLFA 1QWYA 3DUZA 4C3HB 4OO1G 5C3WA 5I6WA 1HHVA 4J6HA 3SVMA 4HN7A 1RTNA 2A68C 1U4RA 2CQAA 3GD7A 1H9SA 1K8OA 1UUPA 3D4RA 4F8MA 2M2LA 5C4JB 3EROA 1AZQA 4G4KA 1G6ZA 1E2ZA 2J4XA 1XXGA 2K05A 2R93B 5KRUA 4JK1C 1WTQA 2WACA 1SFOB 2WKDA 1B9MA 3J80E 2JA7B 1A3UA 2A68D 5EJWA 1XWEA 1TQOA 2NN6H 3BVGA 4C3IG 4UAIA 1F9RA 1EWCA 1KDAA 2KEEA 4YIJA 2NVXB 4KK7A 1LTTD 4A3KB 2IX3A 2HQEA 1EYCA 3M7GA 2RBMA 4KHZA 2XSCA 1NCVA 1STYA 1CA6A 4S3SA 3PMFA 3RUZA 2F0NA 3P7JA 1I6VC 1SYBA 2FMMA 3S17B 4C56C 1EU3A 5E3FA 5LHY1 4KKSA 3KLRA 4KY5A 3BVMA 4HAEA 2KECA 1GHJA 1TS3A 1GUNA 4N9TA 4EQPA 3K7AB 4J1MA 4OO1H 2JEAI 2IW3A 3IKJA 2C9OA 3T56B 1A15A 1EY4A 2NYZD 3PUWA 3ITPA 5EPKA 4DK1A 1LTAD 4C1NK 1I4HA 1X3PA 2F0KA 5CV7A 4KN7C 5EBCA 2WAQB 3MHBA 3MAQA 5M5XB 4QIWB 2K5WA 1Q12A 3MXPA 4ME5A 4DGZA 1TS4A 3IAYA 5JAVA 1EZ6A 1F2LA 4FF3A 3WDNA 3M4OB 2JA6B 1LT6D 5KYIA 1H9JA 4X3KA 5COYA 1YNNC 3FMCA 2JSOA 2WP8J 2F3WA 3I72A 1HUNA 1STBA 5JEAG 4BA2I 2XNAC 1A6XA 1QB5D 1WTPA 3U9OA 5CORA 2F0MA 5C4HA 3S15B 5DM73 5BN5A 1D1IA 5JOBA 1MBYA 3OW7A 1U4PA 4CJ2C 4RGTA 3MXGA 1TS2A 1PYWD 3MFYA 2RDGA 3I8ZA 1CQFA 4X3TA 5M5WB 3BDCA 1Y69U 2E2JB 1KTKA 1Q3LA 2KQ3A 1BCPB 2K01A 5KNCA 4KD3A 2OT2A 3TMEA 3V05A 3AU7A 2EYOA 3T16A 1Y8PB 4FYDA 3S2DB 4GZYC 2EY5A 2F0PA 2SOBA 1XTCD 4PNYA 2F0TA 3S1NB 1G91A 3IFDA 5CV8A 3FDTA 1Q90A 1F2YA 5C0XI 3F2UA 4RKBA 1TY2A 3K5MA 1SYDA 2BDNA 2CHBD 3CRLC 1EEID 1T5EA 3TZDA 4PQXA 3HOXB 1BO0A 3CHBD 3SK6A 1MGSA 4QMGA 3GTKB 3ONAB 2AQ1B 3D6CA 4U68A 2Z4IA 1RDPD 4CKCA 2A6HC 3DHQA 3OOCA 2A74C 5IT9E 4A3IB 1U4MA 5FK9C 4BS9A 3HS0C 3GV3A 2PW7A 5CYUA 3S14B 3H0GB 3K0YA 5E4XA 5EPLA 5A2QE 4C3JB 2AUKA 3W2DA 4DNTB 4DAPA 1B44D 4BY1B 2EYJA 2LKVA 3E5SA 1EZ8A 1MD2D 3A56A 2L55A 1STHA 3KBXA 3SEBA 3X3MA 1Q8IA 1LABA 1FYCA 1B2TA 5AFWA 3U9SA 4IZ8A 1DONA 3R3OA 2J7ZA 5C6AA 5C0XJ 2JYOA 1D6EC 3E0JA 3DMUA 2WV6D 2YU9B 3IFTA 3R2TA 2OXPA 5KEEA 2K33A 2F0IA 3EFXD 1WTXA 2ZT9C 1TY0A 2XN9C 1DM0B 1ESFA 2RSOA 1GUWA 4KKTA 3V96A 2F03A 5BN3A 5A2QL 2D62A 4OL7A 4RGNA 1H9RA 3GTMB 3TZUA 2R61A 5IODA 1CM9A 4ZYSA 4IUQA 5C44B 1AFPA 4XYQA 4ILWA 2NUCA 3VYUA 1NR2A 4IFDH 2FMCA 2B2VC 4ABNA 1UEAB 1ZEQX 5T1IA 1FR3A 4LJZC 1TWFB 3G6JB 1LTGD 2O5IC 3GQBA 2WKCA 3RMHA 4FXKC 4FO2A 2VXWA 5I9PA 3ND9A 1G2TA 1SEBD 3C1EA 2BE5C 1D2BA 1EU4A 4XT1B 3X3NA 1PFMA 3R93A 3GTPB 1M4VA 4KI0A 2DY7A 3MVVA 4ZKBB 1B4OA 5FO7B 2TSSA 3SK5A 2B2TC 3S9WA 4A3JB 1QJOA 4CHTB 2B2VA 1DCZA 4TRDA 4A3FB 2JEBI 5D14A 5CBEE 4F88A 4A3MB 3OWEB 4OIKA 2F3VA 1ZYRD 4P2CB 4TQUS 1O7LA 1EY7A 2F0DA 4RKLA 2KA7A 5E1FA 1AN8A 2EXZA 5D3DA 1D5MC 2F1MA 5CV9A 4K5XA 4XIGS 1V1PB 4ZUIA 1NUCA 1HRJA 3S1QB 2PNRC 2E2DC 1L0XB 4DXFA 5EQ0A 1G8ZD 1MI2A 4I65A 3NWSA 4R8NA 4FF2A 5EKLA 3LWEA 1XYIA 5ELEA 2EOTA 4KJOA 1SE4A 2FHTA 1FGBD 3MEHA 2JE6I 3AB9A 1A3VA 1VF7A 5I6YA 1IHZA 1PRTF 1PRTC 3QB3A 2QILA 4OO1I 2MHVA 1LV9A 5IIFA 4IUUA 3P1HA 2EY1A 1G2SA 2VUMB 1ICWA 4HMJA 3ERQA 1TVXA 1V1OA 2K03A 3K58A 2XRQD 4OHJA 4XQJA 4K2KA 4IUPA 5C5LA 1PZJD 2PQEA 4F7XA 1SJED 1BBXC 2EJMA 2E2HB 1SXTA 1SYGA 2QKIC 4HSVA 3RZOB 1A3TA 1LACA 3CRKC 1S5ED 3DM1A 4QCLA 3QOJA 1PRTB 1YNJD 1SNDA 3Q23A 4IQZA 2WB1B 1V8QA 3VR5A 4ZAIA 3OMGA 2XRSD 4QF4A 1SBBB 1B53A 3P75A 2F4IA 4O42A 1SNCA 3BYTB 4L6TB 2EZVA 3MXUA 3J7AV 3EJIA 3O13A 3D4DA 1W6JA 1JICA 4BBSB 2D9UA 1KDBA 1O80A 2NB0A 2E75C 2ZXRA 3VA7A 3MTSA 1JQYD 4G57A 4HEDA 2ENBA 1SSOA 2F0LA 1EY6A 5NUCA 2HUGA 4MN3A 3D8GA 1AEXA 1S4ZA 1WD0A 1TWAB 2Z8LA 3VYRA 3S1RB 4NKLA 1L0YB 1U9RA 3L9AX 1JR0D 2LFNA 5HURA 3H3VC 3MC0B 2DNCA 4BY7B 1E2VA 4KMUC 2L12A 4RAUC 3HEJA 2EYPA 3OPOA 1STNA 2B2WA 1Z7TA 4IURA 4EQNA 4FF4A 3FRPB 2KJXA 2L1BA 4KJNA 3NTHA 3I4MB 1LLRD 2Z4HA 1SDFA 3BDOA 1TT2A 2E2IB 2O2LD 3TP6A 4BA1I 2BA0A 3GO5A 1T5XD 3GTJB 3PV0A 4DAVA 4Q0FA 4DF7A 5C5MA 4ODGA 2R6GA 4XQQA 1LTSD 3D31A 3LX0A 1PXUA 2EDGA 1V1PA 5M3FB 1MSHA 2XVSA 5K36H 2F0VA 2KCCA 4F87A 4X3UA 2ICIA 1FD7D 2NN6I 4B9WA 1OXUA 2PZWA 3HOUB 1GUSA 1JOQA 3N6RA 1NSNS 2V4DA 3I90A 1KDCA 1KLUD 3A55A 4A3EB 2B2YA 3FPUB 3H09A 2R7ZB 2XIWA 3RD4A 1HQMC 1S5DD 1RJTA 4PMWA 3T4AC 2L9HA 1O7ZA 1X3QA 2IPKD 4R8IA 2A6EC 3NUCA 2XWJB 4XDXA 4OIJA 4MHEA 2VB3X 1RCVD 5I2YA 2X6GA 2LMCB 1ILPA 1ENAA 1CQVA 1S5CD 2EY6A 4PV1C 1ZXTA 1PFNA 4A3BB 3C46A 1GOZA 2F0QA 3NQIA 3NK9A 1FNWA 2VNUD 1PMRA 1WTRA 1I6HB 4DK0A 1BCPD 3NWTA 4H44C 2B8GA 1EY8A 2RDHA 3A8IE 4CJ1B 2B2YC 3VYTA 2M9VA 3I91A 1SE3A 3VYSA 4G7HC 3HOVB 2N88A 1LT5D 4RHSA 1HPCA 3SDZA 3G7LA 4KTAA 2HCCA 1ILQA 2RKSA 4Z9CB 2YYZA 3P20A 5E4WC 4FF1A 5FKAC 1PTOB 5EPJA 4H13C 1GUOA 1TU2B 1EEFD 2NVYB 3KK7A 1QILA 4V0BA 1ET9A 4K6DA 3A8JE 2FJ2A 3UI2A 3PUYA 1WVLA 4IUTA 4FVMA 3I4LA 4CKBA 4NDXA 2PPBC 4ULLA 4KD4A 1HQRD 4KHVA 3SE0A 1AP0A 1I50B 1TS5A 3I4NB 4Y7NB 3NPPA 1CFMA 5DAUA 5C3XA 1HA5A 1EWHA 3SXHA 3GTQB 1LO5D 4H0LC 3Q0AA 3NBIA 2F0JA 1EY5A 2LY7A 1CK1A 1TKWB 4HSPA 1BNZA 1QE6A 1QCBD 1RKNA 3PUVA 1II3A 2SEBD 4KN4C 4IUNA 1STEA 3DEOA 5IGGA 4RWSC 2BDOA 3J80L 3HOYB 2RVLA 2OF1A 1DXMA 5KNDA 2AQ2B 4WJWA 1DZ1A 1F9PA 3BZDB 3NP8A 4DN4M 1HFGA 1F9SA 2K1BA 1UNSA 2EPBA 1VF5C 1JWSD 1DOMA 4DFAA 3OWFA 3H6MA 2EE1A 3DWQA 2KEDA 1JCKB 1U4LA 4BBRB 1ONLA 1OXTA 1K83B 4IFDG 2F0FA 2JA8B 2E74C 3R2IA 1LT4D 4HCSA 1B1ZA 1H9MA 1EQTA 2EYLA 5KYLA 3S2HB 1D1KA 2WINB 2QCPX 1O78A 3A54A 3SK4A 3DWPA 2G9DA 1PDQA 3SR1A 2EY2A 2F0EA 1RHPA 3VR4A 3CQZB 1PFBA 3HGBA 4NP5A 4RCOA 4O1NA 2XWBB 3KBGA 5C4ZA 4K14A 2LS01 1EIHA 4BWGB 1IW7D 2NVQB 3GTGB 2O5JC 4TKOB 1RTOA 5JJZA 2D5DA 1HXYD 1Z47A 2A6ED 1CA5A 1Q1BA 1LTRD 2B2UC 3OIPA 1YNND 2F0OA 4H7BA 1R9TB 1ML0D 5KNBA 1H9SB 1V43A 5IT9L 4ZK9B 3T53B 1IW7C 1BDOA 2IX0A 1SNMA 3FEWX 3Q24A 1Y1WB 1Q1EA 5M9OA 3K57A 4NMZA 5CGKA 1CTMA 3HG9A 2F0GA 5KIXA 3DXJC 2PYKA 1OXVA 2RSNA 1IYVA 2Q8TA 2RDFA 2MPMA 1ENFA 3SHLA 1RD9D 1WTVA 4IN3A 1DOLA 1CT1D 4A93B 2PMZB 3J7AF 4ZQ3A 1Y8OB 4DXGA 2PW5A 1JWUD 5ELDA 4M1UB 2ICEC 4EVOA 3WOFA 3QG1A 2B8FA 2Q8IB 4CJ0B 4FNFA 3D4WA 3BG3A 1HTPA 1TR5A 4FXDA 2NVTB 1DYQA 2EYMA 3CU7A 1SJHD 5IGDA 1H9KA 1CHPD 1ZYRC 3BS1A 3K5LA 3Q22A 2A6HD 1RODA 5I9OA 1J9OA 1WCMB 3N52A 2K7VA 3E6ZX 5EKKA 1FNVA 3I3CA 1BOSA 5K36G 1XX8A 1QOHA 5ELCA 5K5PA 1RF2D 3OIQA 1SNPA 1SAPA 1B9NA 4HMIA 3FVQA 1IL8A 2Q8RE 1K8MA 5T1GA 1A2TA 5M3MB 2IX1A 1R4QB 1D5XC 4IUVA 5IOCA 5IGFA 2KHSA 5CMDA 2KCNA 3HRZC 3PUZA 4ZKCB 1DD2A 5CR3A 1AW7A 1GUGA 3J7YW 3WOEA 1JOOA 3TDQA 4QB4A 4U673 2K5DA 4QUFA 2BCOA 5C0XG 1J8IA 4KY7A 4LK1C 2HDLA 1Y8NB 1DJRD 4M8AA 3V2TA 2X69A 1IYUA 1GHKA 4PMCA 2F0SA 2X6LA 3KLSX 1VDZA 3HOWB 2IL8A 1I4PA 4AYBB 2L4NA 2TMPA 3ND8A 5D65A 2CVRA 3AMUA 3GTOB 3EVQA 4KKUA 3QOLA 5C0XH 4Q5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENA A;  1EY4 A;  4IUN A;  2EY6 A;  2F0I A;  4WOR A;  3TP6 A;  1SYD A;  5C3W A;  5IGG A;  5J22 A;  5KGU A;  1JOR A;  2OF1 A;  5I6W A;  3C1F A;  5EKK A;  4J6H A;  1A3T A;  3ITP A;  2F0Q A;  2F3V A;  3NK9 A;  1EQV A;  2F0O A;  4H7B A;  3NP8 A;  3SK8 A;  3T13 A;  4K5W A;  1EY7 A;  4DF7 A;  2F0D A;  1F2M A;  5C5M A;  3QOJ A;  4ODG A;  4N9P A;  4WRD A;  4RKL A;  4ZUJ A;  1EY8 A;  3OMC A;  5K5P A;  3SK6 A;  1SND A;  2F0K A;  4K5V A;  2SNM A;  3LX0 A;  4QMG A;  4K8J A;  5CV7 A;  5E1F A;  4F8M A;  2EXZ A;  1SNP A;  5IGE A;  3MHB A;  3OMG A;  3ERO A;  4HMI A;  4LAA A;  4OL7 A;  5IGB A;  4QF4 A;  1EYD A;  3D6C A;  3MXP A;  4ME5 A;  4DGZ A;  2F0V A;  5CV9 A;  3P75 A;  4IAL A;  5DEH A;  4DFA A;  1SNM A;  3DHQ A;  1A2T A;  3H6M A;  3OWF A;  4K5X A;  4KTA A;  5IOD A;  4ZUI A;  5JAV A;  4DU9 A;  2RKS A;  1NUC A;  1EYA A;  2EYF A;  1EZ6 A;  1SNO A;  1SNC A;  5M9O A;  5IOC A;  1STG A;  1SYF A;  2NUC A;  4ID6 A;  1EY9 A;  2F0H A;  4NMZ A;  2KHS A;  5CGK A;  5IGF A;  5KRU A;  5KYI A;  4B9W A;  2WAC A;  2QDB A;  2F0G A;  2PZT A;  3EJI A;  2PZW A;  4B9X A;  2F0F A;  5IGC A;  3D4D A;  5KIX A;  5CR3 A;  1A3U A;  2PW7 A;  1KAA A;  3NQT A;  2PYK A;  2F3W A;  1JOQ A;  1NSN S;  1TQO A;  2EYL A;  5KYL A;  1ENC A;  1KDB A;  5CV4 A;  4I65 A;  1F2Z A;  1STB A;  1SYE A;  2RDF A;  4R8N A;  1KDA A;  4YIJ A;  1JOO A;  3SHL A;  5CC4 A;  5ISR A;  4K2L A;  5EKL A;  4K6D A;  4QB4 A;  5J39 A;  1KDC A;  3OSO A;  2HQE A;  3U9O A;  3NHH A;  2OEO A;  4G57 A;  1EYC A;  4KJO A;  1EY0 A;  1A2U A;  2F0M A;  5F2D A;  3SK4 A;  2ENB A;  1STA A;  2F0L A;  5C4H A;  2SNS A;  1EY6 A;  5NUC A;  5JOB A;  3SR1 A;  2RBM A;  3D8G A;  4NDX A;  3TP5 A;  2EY2 A;  1AEX A;  2F0E A;  3MEH A;  4K8I A;  4ZQ3 A;  2EYJ A;  2LKV A;  3E5S A;  2O4X A;  4KY7 A;  4KY6 A;  4KV6 A;  4E6I A;  4PMB A;  4KD4 A;  1A3V A;  1EZ8 A;  5I6Y A;  3V2T A;  2PW5 A;  5I9P A;  1STY A;  4KHV A;  3HZX A;  4NKL A;  4NP5 A;  3BDC A;  5CV5 A;  4EQO A;  1SNQ A;  1U9R A;  2F0W A;  1IHZ A;  4PMC A;  4S3S A;  1STH A;  3C1E A;  2KQ3 A;  2F0S A;  3PMF A;  3QB3 A;  2F0N A;  3RUZ A;  4EVO A;  4KD3 A;  5HUR A;  5DAU A;  5J1Z A;  3VA5 A;  5C3X A;  3TME A;  5IIF A;  3TP7 A;  1SYB A;  2EYO A;  3T16 A;  3NXW A;  1SYC A;  3SXH A;  2M00 A;  3P1H A;  2EY1 A;  2EY5 A;  5E3F A;  2F0U A;  3D4W A;  4IZ8 A;  5HGT A;  2F0P A;  2SOB A;  3BDL A;  2EYP A;  3HEJ A;  3MZ5 A;  3R3O A;  4MIU A;  4HMJ A;  3TP8 A;  1STN A;  1TR5 A;  3ERQ A;  4KY5 A;  1JOK A;  3MVV A;  2EYH A;  4K14 A;  5C4Z A;  4EQN A;  5C6A A;  2EYM A;  3NUC A;  4PNY A;  4HTH A;  2F0J A;  3DMU A;  1EY5 A;  2PZU A;  2F0T A;  5EGT A;  4K2K A;  3SK5 A;  3EVQ A;  5C5L A;  5CV8 A;  5IGD A;  3QOL A;  1F2Y A;  2PQE A;  4KJN A;  4F7X A;  3S9W A;  4N9T A;  4EQP A;  1KAB A;  4J1M A;  1RKN A;  1SYG A;  5CV6 A;  1II3 A;  4RKB A;  5I9O A;  2OXP A;  5KEE A;  1TT2 A;  4TRD A; 
#chains in the Genus database with same CATH topology
 2RA4 A;  4JC0 A;  3RN2 A;  4CDD C;  2HDM A;  2I5M X;  5I4D A;  1KLG D;  1XJV A;  4ZLT F;  1YJW A;  2Z6K A;  1S5B D;  2A69 D;  1IKM A;  3OMC A;  3C2P A;  1D5Z C;  1JE4 A;  4C3I B;  2GN5 A;  3BJU A;  1KHI A;  5FLM H;  2PO4 A;  3ZYY X;  4B3T L;  3PIP 3;  3F2D A;  3QWN A;  1CZW A;  5DEH A;  4IAL A;  3STB C;  1AE2 A;  3T51 B;  2CKZ B;  5LL6 S;  4DU9 A;  2EYF A;  4IPG A;  1TWH B;  5BN4 A;  4JI3 L;  2JA7 H;  3FPP A;  1ZKO A;  1OXX K;  4A3D B;  3F1Z A;  1HTL D;  1PTO D;  5IGC A;  1X3G A;  5GRO A;  4AYB E;  2R92 B;  1EFI D;  1VMP A;  3FKI H;  4IFD I;  2K5Q A;  4JOI A;  2MP1 A;  2JA9 A;  2A69 C;  1C48 A;  3K6O A;  4J8Q A;  5ISR A;  2QEX A;  2N55 A;  3OSO A;  1D7Q A;  3DM3 A;  2OEO A;  3E9H A;  2A5H A;  2JA8 H;  3FKI B;  4HJ7 A;  2SNS A;  5FOB B;  3H91 A;  1SFO H;  4GLA C;  3MXN A;  4RGM A;  3KUP A;  2O4X A;  2WFW A;  5EBD A;  3D0F A;  2YTY A;  2DGY A;  4JI1 Q;  1ESR A;  1BQQ T;  1KRT A;  1PTO C;  1Z9F A;  5IYC H;  1TWA H;  2AWN A;  1X3F A;  2DN8 A;  4R4C A;  1EIG A;  1WCM H;  3OHX C;  4A3K H;  3VA5 A;  3NTI A;  3TP7 A;  4EGV A;  1RIP A;  2PNH A;  3F2B A;  4HR7 B;  1CKO A;  1KNE A;  3QO2 A;  4NXM Q;  3MFG A;  1SE2 A;  4JI7 L;  3HP3 A;  3VR6 A;  1JOK A;  3K59 A;  3MEF A;  4DA2 A;  1I94 L;  3M3Y B;  1BXT A;  3KF8 A;  2UUC L;  3C3L A;  1KAB A;  4LWC A;  4DUZ Q;  5IYD G;  4HJ5 A;  2J0T D;  1JOR A;  4C3J G;  4WJ3 M;  4FP5 D;  4QUC A;  4L5S A;  4RGO S;  1EQV A;  2B2U A;  2K28 A;  1F9Q A;  4ME3 A;  2JXM B;  1PTO H;  3HFZ B;  1F2M A;  1IKL A;  2XGT A;  5EKI A;  5FLX L;  1TWC B;  4Y7N H;  3H0G G;  4LF8 L;  1E2W A;  4K8J A;  2K6A A;  4DV7 L;  5IGE A;  2G5D A;  1QNK A;  4RHR A;  4A3F H;  4LAA A;  5DNF A;  2UUB Q;  2HCI A;  1X32 A;  4RH6 A;  2QEJ C;  3S1M B;  1LTB D;  1MSG A;  3D6W A;  5ELB A;  2ZXP A;  3S16 B;  4LMQ D;  2L11 A;  2KCT A;  5C3E B;  1LT3 D;  1IBK L;  1STG A;  1EY9 A;  2F0H A;  1CHQ D;  4RA8 A;  2PZT A;  4X64 Q;  1N33 Q;  1BF4 A;  2EJF C;  5D3I B;  1KAA A;  2Q2H A;  3LNN A;  3MXN B;  3VR2 A;  1ENC A;  1GM5 A;  1EIF A;  4A3L G;  3I4N H;  4IJL A;  3K7A H;  4UHV A;  2B2W C;  2UU9 L;  4C3H G;  2ID0 A;  3PUX A;  5FJ8 H;  2Y0S B;  2EJG C;  1GO3 E;  2R7D A;  4RFB A;  1XMQ Q;  4KY6 A;  1DOK A;  4IFD J;  2CWA A;  5M5W H;  1KRS A;  5G3L F;  5GQO A;  5JVG 3;  3A7A B;  3NSW A;  1SNQ A;  5G3L D;  3RLO A;  2F0W A;  2UXB L;  1N32 L;  5IE8 A;  2MJ8 A;  3M4Y A;  1JC7 A;  5J1Z A;  1BR9 A;  1GJX A;  2K32 A;  2YTV A;  3NXW A;  1WD1 A;  1SYC A;  5FLX E;  1B3Q A;  4X62 L;  5DM6 3;  3BDL A;  4C1N I;  1BKB A;  1OO9 B;  4MIU A;  3TP8 A;  5CBA E;  3BVZ A;  2NTS A;  4A3J G;  4K6L A;  3PCO B;  5JVH 3;  1AZP A;  2PZU A;  1VQM A;  2I46 A;  1CI3 M;  3MA2 B;  4IOA A;  5CV6 A;  1W6K A;  2UUA L;  3ULP A;  1BCP C;  3W3A A;  4DR1 L;  2HD3 A;  2IWH A;  3BYY B;  5KGU A;  5JPM C;  1PRT D;  2HIV A;  1WTW A;  1WYD A;  1B3A A;  1GVP A;  5FO9 B;  2B39 A;  4DNR B;  4A3G H;  2K04 A;  3F2C A;  4IPH A;  4DKA C;  4A3L H;  4B08 A;  3M85 A;  4WRD A;  1ET6 A;  4DV7 Q;  3G4S A;  3G71 A;  2GVB A;  4K5V A;  1F77 A;  3HOZ B;  2QA4 A;  2G9H D;  1TXY A;  4BBS H;  1SMY D;  2YV5 A;  1L1O A;  2F4V L;  5IGB A;  2PCF B;  3CXC A;  2B2T A;  2VQE L;  1EYD A;  1WFQ A;  3QIA A;  4FXG C;  4ZRZ A;  1M8A A;  2B3G A;  3PSI A;  4TSS A;  4CGY B;  3E3X A;  1SNO A;  3IL8 A;  4LNQ A;  3CKI B;  1QNU A;  1W3S A;  4ID6 A;  4A3M H;  2UXD Q;  2QDB A;  4MTN A;  1LTI D;  1VQ7 A;  4R4I A;  2BOS A;  3H94 A;  5JPN C;  4JBW A;  3I70 A;  3H0G H;  5AJ3 Q;  1VQN A;  1KL9 A;  2HQL A;  4OON A;  5FO8 B;  1YNJ C;  5C44 G;  1TII D;  1UWV A;  4G7Z C;  4K2L A;  3GTK H;  1JJG A;  3I73 A;  5LL6 X;  1VQ9 A;  4A3C H;  1SMY C;  2MFI A;  3HKZ B;  1A2U A;  2DNE A;  4R9W A;  3VR3 A;  5IYD H;  2QF7 A;  3TP5 A;  4K8I A;  4CKE A;  3NTK A;  1JB3 A;  4PMB A;  3T1H L;  2MGS A;  3HZX A;  4EQO A;  2MNA A;  3CCS A;  4AQY L;  4V19 0;  4XYO A;  4P75 A;  1WTO A;  1I4Q A;  3A0J A;  2EVB A;  2VB2 X;  2A73 B;  2KEN A;  1MKH A;  1NMG A;  2BE5 D;  1UAP A;  1GUT A;  2RCF A;  4YHH Q;  1Q86 C;  2VUM H;  1Y1V B;  1C4Q A;  5EGT A;  2GA4 B;  1BUV T;  4BXX G;  3GP7 A;  4DV5 Q;  3HOW H;  2I5L X;  1NR4 A;  2IT1 A;  2JJQ A;  2NWG A;  4RCN A;  5M3F H;  3GTL B;  2FIN B;  3Q8D A;  4NXM L;  4A93 H;  5ELF A;  2RQX A;  1I6H H;  3S16 H;  3C1F A;  3NBH A;  1XPO A;  1Y1W H;  5L37 A;  1U0L A;  1VQ8 A;  3SK8 A;  3MWY W;  3PIO 3;  1PLF A;  3T13 A;  4K5W A;  2E5L L;  1XMO L;  2VL6 A;  4N9P A;  3TN2 A;  4ZUJ A;  3PQI A;  3EIV A;  2BA1 A;  3URY A;  4UY8 C;  3CCM A;  1MIU A;  2JA7 G;  2NTT A;  5HY6 A;  3CCL A;  5M5Y B;  3NE5 B;  4LF5 Q;  2RHS B;  5C4X B;  1FNU A;  2KUM A;  4HCE A;  1XPR A;  2CWP A;  1OXS C;  1A62 A;  3EA6 A;  1G29 1;  1M1K C;  3KDF A;  3QJY A;  1IBM Q;  1SYF A;  5GAD C;  4JI4 Q;  1EFW A;  2VQF L;  2KCM A;  1I4G A;  1K3R A;  2MUY A;  3T1Y L;  4C2M B;  5FLM G;  2D2C C;  3S15 H;  2NBF A;  1VQC A;  1PZI D;  1R4P B;  2PI2 A;  1PTO F;  3NEM A;  2Z1C A;  1O7Y A;  3TEH B;  4AIM A;  5GAE C;  1NNX A;  2KVM A;  3NHH A;  2WB1 E;  5F2D A;  1STA A;  1NAP A;  3KF8 B;  4JI8 Q;  3AYH B;  3ULJ A;  1XMO Q;  3OTO L;  4L63 B;  4TVA B;  3K5O A;  1HR0 W;  1Y1V G;  4E6I A;  4KV6 A;  4OGQ C;  3D3R A;  3JAM E;  3TBI B;  3DWA A;  2P5Z X;  3L7Z C;  5CV5 A;  4WFN 3;  1U5K A;  4A3G G;  1VCI A;  4G7O C;  3GV6 A;  3KLW A;  3J81 L;  1XPU A;  1HUM A;  1QVF A;  3CD6 A;  2KHI A;  1S72 A;  2F0U A;  1N34 Q;  1VMC A;  2CW0 C;  4XXE A;  4DR5 L;  2L0C A;  5BR8 Q;  3M7N A;  2IY5 B;  3I4M G;  2EYH A;  4X3S A;  1Y14 B;  2ZM6 L;  4DV4 Q;  5C44 H;  4HTH A;  3A7L A;  5JEA H;  5IWA Q;  3J7Z C;  2CH4 W;  4HID A;  3PF5 A;  1I3Q B;  3Q6S A;  3S2D H;  2NZ1 D;  5A35 A;  2OTJ A;  4JV5 Q;  2B63 B;  3HOY H;  2KOL A;  1Q8K A;  2JA5 B;  1JJ2 A;  4CDC C;  1N36 L;  2R3Z A;  4WOR A;  4BY7 G;  5J22 A;  4I7Z C;  2AWO A;  5I2X A;  1B50 A;  1TWG B;  4XT3 B;  3L3O C;  5IWA L;  5LMU Q;  1X55 A;  2CW0 D;  4P73 A;  1CZG A;  1VQP A;  1H95 A;  4CDF C;  5FJ8 G;  1BCP F;  1MJE A;  2SNM A;  3EQL C;  4DK6 C;  3KLS A;  3CPW A;  1C8C A;  2ZTD A;  5TSS A;  3CCQ A;  2H4O A;  1S5F D;  2L5T A;  4XTC S;  3A8K E;  2K4K A;  4EQ5 A;  3JAM L;  3CQZ H;  2NVQ H;  1QG7 A;  1EYA A;  2DY8 A;  4LF7 L;  2Q2T A;  1PZK D;  3U4Z A;  4B9X A;  3J81 E;  1UE5 A;  1I4R A;  2IJ0 A;  3DEP A;  3NQT A;  4JI8 L;  1PHJ A;  4CBV A;  2JN4 A;  5CV4 A;  1GXD C;  4XQN A;  1F2Z A;  1SYE A;  4L8J A;  1N9W A;  5CC4 A;  4UP7 A;  4LF4 Q;  4A3J H;  5J39 A;  5C4X G;  4A3F G;  4L5R C;  1EY0 A;  1HFN A;  4DAY A;  2SDF A;  2ZXO A;  2WII B;  1CKN A;  1YHA A;  3RZD B;  2AUJ D;  1HA6 A;  4YY3 L;  3UDF A;  5IP9 G;  4DNI A;  1I4X A;  3TSS A;  1JWM D;  5IT9 c;  2H1E A;  3LWU A;  3J81 i;  1E0B A;  4NW2 A;  3K5N A;  1KNA A;  2FFK B;  1N36 Q;  3R8B A;  1EOT A;  4HJA A;  4LFA Q;  5JEA J;  2UUA Q;  1HCZ A;  2AHO B;  4UDU C;  1EL0 A;  2M00 A;  1Z6H A;  5HGT A;  2AQ3 B;  5H1S E;  2JP1 A;  3MZ5 A;  2E76 C;  2I07 B;  2C5C A;  3AFQ A;  2JQO A;  3PO2 B;  3PO3 B;  2BH8 A;  1A8V A;  2NN6 G;  4C3I H;  1PH9 A;  4A3G B;  3E9I A;  3RLF A;  5J3B A;  1QWY A;  3DUZ A;  4C3H B;  4DPG A;  2D0P A;  1VQ6 A;  2UXB Q;  4HIK A;  4OO1 G;  5C3W A;  1VS0 A;  5I6W A;  1HHV A;  4J6H A;  3SVM A;  4R1J A;  3A5U A;  4GKJ L;  4HN7 A;  1RTN A;  4IOC A;  2A68 C;  4A3B H;  1U4R A;  2CQA A;  4A3D H;  3GD7 A;  1H9S A;  3UDG A;  1K8O A;  4J15 A;  4JI6 Q;  1UUP A;  3D4R A;  4F8M A;  4R4Q A;  1PH2 A;  2M2L A;  5C4J B;  3ERO A;  1AZQ A;  2Z0S A;  4G4K A;  4A3D G;  3S2H H;  1G6Z A;  1L1O C;  4LF8 Q;  1E2Z A;  4UPA A;  1KAW A;  2J4X A;  1XXG A;  1I5F A;  2K05 A;  2R93 B;  5KRU A;  4JK1 C;  1HNW L;  1WTQ A;  2WAC A;  1SFO B;  2WKD A;  1HZA A;  1B9M A;  3J80 E;  2JA7 B;  1A3U A;  2B63 H;  2A68 D;  4YCW A;  4A75 A;  3HOV G;  5EJW A;  1XWE A;  1TQO A;  3HKS A;  2NN6 H;  3BVG A;  4C3I G;  4UAI A;  1F9R A;  1EWC A;  1KDA A;  2KEE A;  2K5N A;  4YIJ A;  2NVX B;  4KK7 A;  1LTT D;  4LF6 L;  4WJ4 A;  4A3K B;  2IX3 A;  2E2H H;  1CSP A;  2B29 A;  2HQE A;  2IHE A;  1EYC A;  3HOV H;  1YIT A;  3M7G A;  1VQO A;  2RBM A;  4ALP A;  4DR2 L;  3A5Z B;  3PO3 G;  4KHZ A;  2XSC A;  3I7F A;  1NCV A;  2UUB L;  1STY A;  2DJF C;  1CA6 A;  3H3V I;  4GOP B;  4S3S A;  3PMF A;  3RUZ A;  2F0N A;  3K81 C;  4A76 A;  3P7J A;  1PH3 A;  3KJP A;  1I6V C;  2A19 A;  1SYB A;  2FMM A;  1FL0 A;  1SLJ A;  3S17 B;  4C56 C;  1ICF B;  1EU3 A;  5E3F A;  1V1Q A;  5LHY 1;  4KKS A;  3KLR A;  4UP8 A;  4KY5 A;  3BVM A;  2K5V A;  4HAE A;  2KEC A;  5LMN W;  2DJG C;  1GHJ A;  2ZJQ A;  2EIF A;  1TS3 A;  4BY1 G;  1K8G A;  1GUN A;  2PMZ E;  4JI1 L;  4N9T A;  4EQP A;  3K7A B;  4J1M A;  3S17 H;  4OO1 H;  4DUY L;  3GTO H;  4X6A H;  2JEA I;  2IW3 A;  3IKJ A;  2C9O A;  2FXQ A;  1A15 A;  3T56 B;  1EY4 A;  3U58 A;  2NYZ D;  3G48 A;  4JBM A;  3PUW A;  3ITP A;  3W1B A;  5EPK A;  1S40 A;  4DK1 A;  1LTA D;  1KD1 C;  4C1N K;  5IY0 A;  3PIO A;  1I4H A;  1X3P A;  2F0K A;  2N78 A;  5CV7 A;  2Q2U A;  4KN7 C;  5EBC A;  2WAQ B;  1P8L A;  3MHB A;  3MAQ A;  5M5X B;  2Y0S G;  4QIW B;  2K5W A;  2K5H A;  1A63 A;  1Q12 A;  4GKJ Q;  3MXP A;  4ME5 A;  4DGZ A;  1TS4 A;  1J6Q A;  3IAY A;  5JAV A;  4LW1 A;  4GKK L;  4GLX A;  1EZ6 A;  4B3R L;  4JCV E;  1F2L A;  4FF3 A;  5M3M G;  3UDI A;  3WDN A;  3CP0 A;  3M4O B;  4BY7 H;  4JI6 L;  2JA6 B;  1LT6 D;  1VQI A;  2XTI A;  5KYI A;  3CC7 A;  2JA6 G;  1H9J A;  4X3K A;  5COY A;  3AFP A;  3HOX G;  1YNN C;  4BBR H;  2E5L Q;  3FMC A;  2JSO A;  1X6O A;  1KXL A;  2WP8 J;  2F3W A;  3I72 A;  3AEV A;  1YHB A;  3BZC A;  1HUN A;  1STB A;  5JEA G;  4BA2 I;  2XNA C;  1A6X A;  1QB5 D;  4YCU A;  1HZC A;  3I4M H;  1WTP A;  3U9O A;  5COR A;  2F0M A;  5C4H A;  3S15 B;  5DM7 3;  1QUQ A;  5BN5 A;  1D1I A;  2R7Z H;  5JOB A;  1MBY A;  3OW7 A;  1KC8 C;  1U4P A;  4CJ2 C;  1AE3 A;  4RGT A;  2Z6B A;  3MXG A;  1TS2 A;  4GNX B;  1PYW D;  1VQ4 A;  1JB7 A;  3MFY A;  4JI4 L;  1N8R C;  5C4J H;  2RDG A;  3I8Z A;  1CKN B;  1CQF A;  4X3T A;  5M5W B;  3BDC A;  2CQO A;  3I56 A;  2L15 A;  1Y69 U;  2E2J B;  1UE7 A;  1KTK A;  3KDF B;  1Q3L A;  1YNX A;  1BCP B;  2K01 A;  2KQ3 A;  4PZ8 A;  5KNC A;  4KD3 A;  2OT2 A;  3TME A;  3V05 A;  3AU7 A;  2KBN A;  2EYO A;  3T16 A;  1Y8P B;  4FYD A;  3S2D B;  4GZY C;  2EY5 A;  2F0P A;  2SOB A;  3H3V H;  1BVS A;  4QL5 A;  1XTC D;  4JG2 A;  2OTL A;  4OXP A;  2OQK A;  4HIM A;  4PNY A;  2KHJ A;  4JVZ A;  2F0T A;  3S1N B;  1G91 A;  3IFD A;  5CV8 A;  3FDT A;  1Q90 A;  1F2Y A;  5C0X I;  3F2U A;  4RKB A;  1TY2 A;  4ZCK A;  3GDE A;  4LF7 Q;  4NXN Q;  3K5M A;  1SYD A;  2BDN A;  2CHB D;  4GS3 A;  2CCZ A;  3GTP H;  1HZB A;  4HIO A;  1I3Q H;  3CPF A;  3CRL C;  1EEI D;  1T5E A;  3TZD A;  4PQX A;  3HOX B;  1BO0 A;  3CHB D;  3PGZ A;  3SK6 A;  1UE1 A;  1MGS A;  4QMG A;  3I2Z A;  5IP7 H;  3CW2 C;  4YWM A;  3GTK B;  4LFB Q;  3ONA B;  2AQ1 B;  3D6C A;  4U68 A;  4OX9 Q;  2Z4I A;  1RDP D;  4CKC A;  2A6H C;  3DHQ A;  3ULL A;  4AQY Q;  3CC2 A;  3K7U C;  3RR5 A;  3H15 A;  1Y1W G;  3OOC A;  2A74 C;  5IT9 E;  4PZ7 A;  4A3I B;  1U4M A;  5FK9 C;  4BS9 A;  2R93 H;  3HS0 C;  2OCE A;  1PYS B;  1PH6 A;  3GV3 A;  1IBK Q;  2PW7 A;  2K52 A;  1HNX Q;  1SN8 A;  5CYU A;  4P72 A;  5ELN A;  4A3I G;  2A8V A;  2K50 A;  3H0G B;  1XTD A;  1S3O A;  2QDL A;  3K0Y A;  5E4X A;  4B3M L;  4OWW B;  3S14 B;  4LFB L;  4OWT B;  5EPL A;  4NB3 A;  5A2Q E;  2NVX H;  1FJG Q;  1HNW Q;  1SRU A;  4C3J B;  2AUK A;  3W2D A;  4DNT B;  1B70 B;  4DAP A;  1B44 D;  4BY1 B;  4OEM B;  2EYJ A;  2LKV A;  2RHQ B;  3E5S A;  4POG A;  2QW7 A;  2GVA A;  1EZ8 A;  1K9M C;  1MD2 D;  5LMN Q;  3A56 A;  3TRE A;  2L55 A;  2RCN A;  1STH A;  1PH1 A;  3KBX A;  3SEB A;  4L5T A;  3X3M A;  1Q8I A;  5IP7 G;  1LAB A;  1FYC A;  4B3S L;  1B2T A;  5AFW A;  4N8F A;  3U9S A;  4IZ8 A;  1DON A;  3R3O A;  4LF6 Q;  2J7Z A;  3W1G A;  5C6A A;  5C0X J;  1VQD A;  2JYO A;  1D6E C;  3E0J A;  3DMU A;  2WV6 D;  3ZJY C;  1I50 H;  2YU9 B;  3IFT A;  4CDE C;  1VQF A;  1PH5 A;  2ZJP A;  3R2T A;  4LUV A;  2OXP A;  5KEE A;  3AQQ A;  1IBM L;  2K33 A;  2F0I A;  3EFX D;  1WTX A;  2ZT9 C;  3HOW G;  1TY0 A;  2XN9 C;  1PYB A;  1DM0 B;  2LXJ A;  1ESF A;  2RSO A;  1GUW A;  4NPS A;  4KKT A;  1YI2 A;  3NEN A;  3V96 A;  2F03 A;  5BN3 A;  5A2Q L;  4GOP C;  1XMQ L;  2D62 A;  4OL7 A;  4K0K Q;  4RGN A;  1H9R A;  1QZG A;  3CAM A;  3GTM B;  5C3E H;  3TZU A;  1N32 Q;  2R61 A;  5IOD A;  1CM9 A;  3QR8 A;  2UU9 Q;  2PQA B;  4ZYS A;  4IUQ A;  5C44 B;  1AFP A;  4XYQ A;  4ILW A;  2NUC A;  3VYU A;  1NR2 A;  3M4O H;  4IFD H;  4JYA Q;  2FMC A;  1G6P A;  2B2V C;  3M4P A;  4ABN A;  1UEA B;  4GN5 A;  2AMC B;  1ZEQ X;  5T1I A;  1FR3 A;  2IHF A;  4LJZ C;  1TWF B;  3G6J B;  1UEB A;  1HNZ Q;  1LTG D;  2H5X A;  2N8N A;  2O5I C;  3GQB A;  2WKC A;  4DR6 Q;  4LUZ A;  4A4I A;  3RMH A;  4FXK C;  4LFA L;  2OQ0 A;  3LGJ A;  1ASZ A;  4FO2 A;  4DUY Q;  2VXW A;  2R92 H;  5I9P A;  3ND9 A;  1G2T A;  1SEB D;  3S24 A;  3ER0 A;  3C1E A;  2BE5 C;  3A74 A;  2UXC L;  3OW2 A;  1D2B A;  1EU4 A;  4XT1 B;  3X3N A;  1PFM A;  3R93 A;  5BR8 L;  3GTP B;  1M4V A;  1QVC A;  4KI0 A;  2DY7 A;  3NEL A;  3HOZ H;  3MVV A;  4DUZ L;  4ZKB B;  1JT8 A;  1V9P A;  1B4O A;  5FO7 B;  2TSS A;  3SK5 A;  2B2T C;  4IJH A;  1NE3 A;  3S9W A;  4YHH L;  4A3J B;  1QJO A;  4CHT B;  2B2V A;  1DCZ A;  4TRD A;  4A3F B;  2JEB I;  5D14 A;  5CBE E;  1SE8 A;  4F88 A;  1DGS A;  4A3M B;  3OWE B;  4OIK A;  1EQR A;  4YCV A;  2F3V A;  1ZYR D;  4P2C B;  2LXK A;  4DV2 L;  4TQU S;  1N34 L;  2HHH L;  2R92 G;  2ZTE A;  1O7L A;  1EY7 A;  2F0D A;  2Y0S E;  4RKL A;  5FLX c;  2KA7 A;  4HJ8 A;  4BBR G;  5E1F A;  1AN8 A;  1FJG L;  2EXZ A;  1Q81 C;  4X65 L;  4YWK A;  5JJL A;  5D3D A;  2JA6 H;  1D5M C;  2F1M A;  4X66 Q;  4B3M Q;  1KIX A;  2MO0 A;  5CV9 A;  2VZA A;  2MQH A;  4K5X A;  2AKW B;  4XIG S;  1V1P B;  2VS1 A;  4ZUI A;  1NUC A;  1HRJ A;  1HNZ L;  3PO3 H;  3S1Q B;  2PNR C;  3J81 j;  2E2D C;  1L0X B;  1O7I A;  2ZJR A;  4DXF A;  4OEL B;  5EQ0 A;  1G8Z D;  1MI2 A;  2VW9 A;  1M90 C;  4I65 A;  3NWS A;  1PV4 A;  2HT1 A;  4R8N A;  1LM0 A;  1Q82 C;  4FF2 A;  4JW0 A;  5EKL A;  4GN4 B;  4EX5 A;  5GAH C;  1WI5 A;  3LWE A;  4A3E H;  1XYI A;  4MNO A;  5ELE A;  2EOT A;  4KJO A;  2B63 G;  1Q7Y C;  4AH6 A;  1SE4 A;  2FHT A;  1FGB D;  2K75 A;  3MEH A;  1WCM G;  2JE6 I;  4APV A;  3GTL H;  3J80 c;  3AB9 A;  1R9T H;  4LF5 L;  1A3V A;  1VF7 A;  5I6Y A;  3CMA A;  2Z9H A;  1YJN A;  4JI2 L;  3J80 i;  4DV5 L;  3GTM H;  1IHZ A;  1PRT F;  4X62 Q;  1EQQ A;  3KFU A;  1PRT C;  3QB3 A;  4DV6 L;  2QIL A;  4C2M H;  1NMF A;  4HJ9 A;  4OO1 I;  2MHV A;  1LV9 A;  4N8X 1;  5IIF A;  1CKM A;  1PA6 A;  4IUU A;  3P1H A;  1XNQ Q;  4DR3 L;  2EY1 A;  1G2S A;  3U50 C;  2VUM B;  1VQJ A;  1ICW A;  2NVT H;  4HMJ A;  3ERQ A;  1TVX A;  1V1O A;  2K03 A;  1K8A C;  3K58 A;  1Q46 A;  2XRQ D;  4OHJ A;  4XQJ A;  4K2K A;  4IUP A;  1OTC A;  5C5L A;  3RZO H;  1PZJ D;  2PQE A;  4F7X A;  1SJE D;  2NZH A;  1BBX C;  2EJM A;  2E2H B;  3CCE A;  1SXT A;  1SYG A;  2I5H A;  2QKI C;  1C7Y A;  4HSV A;  3RZO B;  1A3T A;  3L0O A;  1LAC A;  4IPD A;  4A3E G;  3CRK C;  1S5E D;  3DM1 A;  4QCL A;  3KF6 B;  3QOJ A;  1PRT B;  1YNJ D;  1SND A;  3Q23 A;  4IQZ A;  1WJJ A;  2WB1 B;  1V8Q A;  2CFM A;  3VR5 A;  4ZAI A;  3OMG A;  2XRS D;  1NY4 A;  4QF4 A;  3OYY A;  1SBB B;  1B53 A;  1QUQ B;  3JC6 6;  2EQS A;  1IZ6 A;  3P75 A;  4KHP Q;  2ALY B;  2F4I A;  4O42 A;  3M9B A;  1SNC A;  1FGU A;  5IP9 H;  3BYT B;  4L6T B;  1MJC A;  2EZV A;  3MXU A;  3J7A V;  3EJI A;  3KF6 A;  2R93 G;  3O13 A;  3D4D A;  1W6J A;  4B3R Q;  1JIC A;  5JJK A;  4BBS B;  2WB1 G;  2D9U A;  1KDB A;  1O80 A;  1XNR L;  2NB0 A;  2E75 C;  2ZXR A;  3VA7 A;  1IBL Q;  2WAQ G;  3MTS A;  1E1O A;  1JQY D;  4G57 A;  4HED A;  2ENB A;  1SSO A;  2F0L A;  1EY6 A;  5NUC A;  1C9O A;  2HUG A;  3FP9 A;  4DR1 Q;  4MN3 A;  1EOV A;  3D8G A;  1K3B C;  1AEX A;  1S4Z A;  4LUO A;  2NZO A;  2JA5 H;  1WD0 A;  1TWA B;  2Z8L A;  3VYR A;  3S1R B;  4NKL A;  3UE0 A;  1L0Y B;  1U9R A;  3L9A X;  1JR0 D;  2LFN A;  1K0R A;  5HUR A;  2PI2 E;  3H3V C;  3MC0 B;  2DNC A;  4BY7 B;  3CCJ A;  4KMU C;  1E2V A;  2L12 A;  4RAU C;  4DV0 L;  4YWL A;  3HEJ A;  2EYP A;  4GNX C;  3OPO A;  3S1R H;  1IBL L;  2E2I H;  4LF9 Q;  1STN A;  1SR3 A;  2B2W A;  1Z7T A;  4IUR A;  4EQN A;  4FF4 A;  3FRP B;  1HJP A;  2KJX A;  2L1B A;  4KJN A;  3NTH A;  3RNU A;  3I4M B;  1LLR D;  2PQA A;  2UXD L;  1C0A A;  2Z4H A;  4DR4 L;  1SDF A;  3BDO A;  1TT2 A;  2E2I B;  2O2L D;  3M4Q A;  3TP6 A;  4BA1 I;  2BA0 A;  1E1T A;  5C4X H;  2CH4 A;  4MZ9 A;  3GO5 A;  1T5X D;  3TQY A;  3GTJ B;  3PV0 A;  4DAV A;  1TWC H;  4Q0F A;  4DF7 A;  5C5M A;  3E0E A;  4ODG A;  2R6G A;  3W5O A;  4XQQ A;  2E2J H;  1LTS D;  3D31 A;  3LX0 A;  1PXU A;  3HKZ E;  4POF A;  2EDG A;  1V1P A;  2E8G A;  1CUK A;  5M3F B;  1MSH A;  4GKK Q;  4DV1 L;  2XVS A;  3GTJ H;  5K36 H;  4JI5 Q;  2VQF Q;  2F0V A;  2KCC A;  4F87 A;  4X3U A;  2ICI A;  1GD7 A;  3S1N H;  1FD7 D;  2NN6 I;  4B9W A;  1LTL A;  1OXU A;  2PZW A;  4DV1 Q;  3TRZ A;  3HOU B;  1GUS A;  1JOQ A;  1FVI A;  1NSN S;  3N6R A;  1K0S A;  2V4D A;  3I90 A;  4PZ6 A;  1KDC A;  2DUD A;  1KLU D;  3A55 A;  4A3E B;  2B2Y A;  3FPU B;  2D0O A;  3H09 A;  2R7Z B;  1VQK A;  4JI2 Q;  5ELO A;  4JI0 Q;  4JPB W;  2XIW A;  1YJ9 A;  1K73 C;  2JA5 G;  3J81 c;  3RD4 A;  3U4V A;  1HQM C;  1S5D D;  1RJT A;  4PMW A;  1ASY A;  2N49 A;  3UE1 A;  1NTG A;  3T4A C;  2L9H A;  1O7Z A;  1X3Q A;  2IPK D;  2QGQ A;  4R8I A;  3IRB A;  2A6E C;  3NUC A;  1TWH H;  4H02 A;  2XWJ B;  4XDX A;  4OIJ A;  1HNX L;  4MHE A;  2VB3 X;  1RCV D;  4LF4 L;  5I2Y A;  4A93 G;  1YBY A;  2X6G A;  2LMC B;  1B7Y B;  1ILP A;  3L2P A;  1ENA A;  2YTX A;  1CQV A;  1S5C D;  2EY6 A;  4PV1 C;  1ZXT A;  1KQS A;  4JBK A;  1PFN A;  4A3B B;  3C46 A;  1GOZ A;  1T9H A;  2F0Q A;  2C35 B;  3NQI A;  4BXX H;  3NK9 A;  1FNW A;  4RMF A;  2VNU D;  1PMR A;  4DV0 Q;  1WTR A;  1I6H B;  4DK0 A;  1BCP D;  3NWT A;  4H44 C;  3I4O A;  1XNR Q;  4A3I H;  5LMN L;  2B8G A;  1EY8 A;  2RDH A;  3A8I E;  4CJ1 B;  1VQ5 A;  2B2Y C;  3VYT A;  2M9V A;  3I91 A;  1SE3 A;  3VYS A;  4G7H C;  3HOV B;  2K14 A;  2N88 A;  1LT5 D;  4RHS A;  1HPC A;  1JJC B;  3SDZ A;  4JI3 Q;  3G7L A;  4KTA A;  2HCC A;  1ILQ A;  2RKS A;  4Z9C B;  2YYZ A;  3P20 A;  5E4W C;  1WOC A;  2MO1 A;  3K0X A;  4OWX B;  4FF1 A;  5FKA C;  3UDX A;  4DR6 L;  1PTO B;  4DR2 Q;  5EPJ A;  3RZD H;  2F4V Q;  4H13 C;  1AH9 A;  1YEZ A;  1GUO A;  1TU2 B;  1EEF D;  2NVY B;  3KK7 A;  1QIL A;  1I94 Q;  4V0B A;  3M3Y H;  4QY7 A;  1ET9 A;  2HIX A;  4JI7 Q;  4K6D A;  3A8J E;  2FJ2 A;  1K28 A;  3UI2 A;  4DV3 L;  3PUY A;  5IYB H;  1WVL A;  4IUT A;  4FVM A;  3I4L A;  4CKB A;  5M5Y H;  5M3F G;  4NDX A;  4A3M G;  2PPB C;  4ULL A;  4DR3 Q;  1VQL A;  3PF4 A;  1NBW A;  4KD4 A;  1HQR D;  3FHW A;  4KHV A;  3SE0 A;  1AP0 A;  1I50 B;  2YU9 H;  2VUM G;  1TS5 A;  3I4N B;  4Y7N B;  3NPP A;  1CFM A;  3PO2 G;  3F8T A;  5DAU A;  3RN5 A;  5C3X A;  1HA5 A;  1BBU A;  1EWH A;  3SXH A;  3GTQ B;  3OTO Q;  4QJF A;  5DLQ E;  5HGQ A;  2ZM6 Q;  4DV4 L;  1LO5 D;  1EWI A;  4H0L C;  3HOU H;  1J5E L;  3DLL A;  3Q0A A;  3NBI A;  2F0J A;  1EY5 A;  2LY7 A;  1CK1 A;  1TKW B;  4PG3 A;  4HSP A;  1BNZ A;  1QE6 A;  1IL2 A;  4JYA L;  1QCB D;  4QQB X;  1RKN A;  3PUV A;  3G6E A;  1II3 A;  2SEB D;  1RL2 A;  4KN4 C;  2R7Z G;  4IUN A;  1STE A;  3DEO A;  5IGG A;  4RWS C;  2BDO A;  3J80 L;  3HOY B;  2RVL A;  2OF1 A;  1PFS A;  1DXM A;  5JJI A;  5KND A;  2AQ2 B;  2VY3 A;  4WJW A;  4X64 L;  1F9P A;  4A3C G;  1DZ1 A;  3BZD B;  2Z6K C;  3NP8 A;  3I55 A;  4DN4 M;  1YVC A;  1HFG A;  1F9S A;  1PVO A;  2K1B A;  3PIP A;  1UNS A;  1YHQ A;  1VQE A;  2Q2I A;  1EUJ A;  3HKZ G;  4LF9 L;  3HOX H;  1SMX A;  1YIJ A;  2EPB A;  1VF5 C;  1K83 H;  1JWS D;  3CCU A;  1DOM A;  4DFA A;  4DR7 L;  3OWF A;  3H6M A;  2EE1 A;  3DWQ A;  2KED A;  2EXD A;  1JCK B;  1U4L A;  4BBR B;  3SGI A;  1ONL A;  1OXT A;  4DV2 Q;  1LYL A;  1HZ9 A;  1K83 B;  4IFD G;  4BBS G;  2F0F A;  2JA8 B;  2E74 C;  3KJO A;  3R2I A;  4JOI C;  1LT4 D;  4HCS A;  1B1Z A;  1E24 A;  1H9M A;  1EQT A;  2EYL A;  4KLK A;  4DAM A;  5KYL A;  3S2H B;  1D1K A;  2WIN B;  3CF5 A;  5C3E G;  3CC4 A;  2QCP X;  1O78 A;  3A54 A;  2HHH Q;  3BU2 A;  4X65 Q;  3HOZ G;  3EBE A;  3SK4 A;  3DWP A;  2G9D A;  4LFC L;  1PDQ A;  1X54 A;  3SR1 A;  4QIW E;  2EY2 A;  2F0E A;  1RHP A;  3VR4 A;  3J7A 5;  3CQZ B;  3EN2 A;  1PFB A;  2A1A A;  3HGB A;  4NP5 A;  4RCO A;  4O1N A;  2XWB B;  1VQH A;  5E7N A;  1BBW A;  4LFC Q;  4DR4 Q;  2LSS A;  3HOY G;  3NBH B;  2UUC Q;  2N3S A;  1GKH A;  4R4O A;  5IYB G;  3KBG A;  2BH2 A;  1X56 A;  1L2F A;  5C4Z A;  4K14 A;  2LS0 1;  4GNX A;  1EIH A;  1VQB A;  2NVY H;  4BWG B;  4C3J H;  1PH4 A;  1IW7 D;  2JK8 A;  2NVQ B;  3GTG B;  2O5J C;  4TKO B;  1RTO A;  5JJZ A;  1VQA A;  2D5D A;  1D8L A;  1HXY D;  1Z47 A;  2A6E D;  1CA5 A;  5AJ3 L;  1Q1B A;  1QZH A;  4I7A A;  4C3H H;  1LTR D;  2V1C C;  2B2U C;  3OIP A;  1YNN D;  2F0O A;  4H7B A;  2I0Q A;  4IO9 A;  3I4N G;  1R9T B;  3S1M H;  1CSQ A;  1ML0 D;  1Y1V H;  1EIY B;  5KNB A;  3HOU G;  4RG1 A;  1H9S B;  2ZTC A;  1MHW C;  2UXC Q;  1V43 A;  5IT9 L;  1HR0 L;  4K0K L;  4ZK9 B;  4A3K G;  3K80 C;  4B3T Q;  3PO2 H;  3T53 B;  5IYC G;  1IW7 C;  3GTQ H;  1BDO A;  1YZ6 A;  2IX0 A;  1SNM A;  3FEW X;  4P71 A;  2R7F A;  1LUZ A;  3Q24 A;  1Y1W B;  1Q1E A;  5M9O A;  4JI0 L;  3K57 A;  4NMZ A;  1HH2 P;  5CGK A;  4FDB A;  1CTM A;  3HG9 A;  1E7Z A;  2F0G A;  3S1Q H;  5KIX A;  1SRO A;  2RF4 A;  2JA8 G;  1HR0 Q;  3DXJ C;  5M5X H;  2PYK A;  3T1Y Q;  1OXV A;  2RSN A;  1NJI C;  4JBJ A;  1IYV A;  2Q8T A;  2RDF A;  2VQE Q;  2MPM A;  1ENF A;  4A3B G;  3SHL A;  3ICE A;  1RD9 D;  1WTV A;  1TWF H;  4IN3 A;  1DOL A;  4JI5 L;  1CT1 D;  4A93 B;  2PMZ B;  3J7A F;  3KYH C;  1B8A A;  1L1O B;  4ZQ3 A;  1Y8O B;  1VQG A;  4DXG A;  1J5E Q;  2PW5 A;  1JWU D;  5ELD A;  4M1U B;  2ICE C;  4DV6 Q;  4DAY B;  4EVO A;  1W2B A;  3WOF A;  3QG1 A;  4R4T A;  2B8F A;  2Q8I B;  4CJ0 B;  1IXR A;  4P74 A;  4FNF A;  1L0W A;  3D4W A;  4DV3 Q;  4GOP A;  4B3S Q;  3BG3 A;  1HTP A;  1TR5 A;  4QGU A;  4FXD A;  4O0A A;  2NVT B;  1DYQ A;  2EYM A;  3CU7 A;  1SJH D;  5IGD A;  1JE5 A;  1H9K A;  3VDY A;  1CHP D;  3RLN A;  1ZYR C;  3BS1 A;  3K5L A;  3TS2 A;  2WAQ E;  4O2D A;  2A6H D;  3Q22 A;  1ROD A;  4MTK A;  5I9O A;  2ES2 A;  1J9O A;  4Y52 H;  1WCM B;  3TS0 A;  3KOJ A;  3N52 A;  2K7V A;  3E6Z X;  1N33 L;  5EKK A;  1FNV A;  3I3C A;  1TWG H;  4L5Q A;  1BOS A;  5K36 G;  5GAG C;  1XX8 A;  1PH7 A;  1IYJ B;  1QOH A;  3FKI G;  5ELC A;  5K5P A;  1X65 A;  1G51 A;  1RF2 D;  4X66 L;  3OIQ A;  2ATW A;  4YY3 Q;  1SNP A;  1UE6 A;  1SAP A;  1B9N A;  3K8A A;  5LMU L;  4HMI A;  3FVQ A;  1E22 A;  1IL8 A;  2Q8R E;  1K8M A;  5T1G A;  1WTH A;  1A2T A;  3CCV A;  5M3M B;  2IX1 A;  1R4Q B;  1D5X C;  1QVG A;  4IUV A;  5IOC A;  3JAM i;  3CCR A;  5IGF A;  3T1H Q;  2KHS A;  5CMD A;  4OX9 L;  2KCN A;  3HRZ C;  4JV5 L;  3PUZ A;  4ZKC B;  3JAM c;  1DD2 A;  5CR3 A;  1AW7 A;  1EYG A;  1GUG A;  5M3M H;  1X3E A;  1P16 A;  1A0I A;  3ERS X;  3J7Y W;  3WOE A;  3CME A;  1JOO A;  4UP9 A;  3TDQ A;  1PH8 A;  4QB4 A;  4U67 3;  2K5D A;  4QUF A;  4GLV B;  1X9N A;  1JMC A;  2BCO A;  4DK3 C;  4NXN L;  2ASB A;  5C0X G;  4DR7 Q;  1J8I A;  4LK1 C;  4KY7 A;  2HDL A;  1Y8N B;  1DJR D;  4M8A A;  3V2T A;  3S14 H;  2X69 A;  3BZK A;  1IYU A;  1GHK A;  4PMC A;  1XNQ L;  4KHP L;  2F0S A;  2X6L A;  3KLS X;  1E3P A;  4IPC A;  2OWO A;  1VDZ A;  3HOW B;  2IL8 A;  1I4P A;  4AYB B;  2L4N A;  2TMP A;  3ND8 A;  4BY1 H;  5D65 A;  2CVR A;  2F52 A;  3AMU A;  3GTO B;  3EVQ A;  2F3I A;  4KKU A;  3B6Y A;  3QOL A;  4GN3 B;  3WWV A;  4AYB G;  5EAY A;  3STB D;  5C0X H;  4Q5V A;  4DR5 Q;  3GTG H; 
#chains in the Genus database with same CATH homology
 2RA4 A;  2HDM A;  5I4D A;  1KLG D;  4ZLT F;  1S5B D;  2A69 D;  1IKM A;  3OMC A;  3C2P A;  1D5Z C;  1JE4 A;  4C3I B;  2PO4 A;  3ZYY X;  3PIP 3;  3QWN A;  1CZW A;  5DEH A;  4IAL A;  3T51 B;  5LL6 S;  4DU9 A;  2EYF A;  1TWH B;  5BN4 A;  3FPP A;  1ZKO A;  1OXX K;  4A3D B;  1HTL D;  1PTO D;  5IGC A;  2R92 B;  1EFI D;  1VMP A;  4IFD I;  2K5Q A;  2MP1 A;  2A69 C;  1C48 A;  3K6O A;  4J8Q A;  5ISR A;  2N55 A;  3OSO A;  2OEO A;  2A5H A;  3FKI B;  2SNS A;  5FOB B;  3H91 A;  3MXN A;  4RGM A;  3KUP A;  2O4X A;  5EBD A;  1ESR A;  1BQQ T;  1PTO C;  2DN8 A;  2AWN A;  1EIG A;  3OHX C;  3VA5 A;  3NTI A;  3TP7 A;  4EGV A;  4HR7 B;  1KNE A;  3QO2 A;  3MFG A;  1SE2 A;  3HP3 A;  3VR6 A;  1JOK A;  3K59 A;  4DA2 A;  3M3Y B;  1BXT A;  3KF8 A;  3C3L A;  1KAB A;  2J0T D;  1JOR A;  4C3J G;  4FP5 D;  4QUC A;  4RGO S;  1EQV A;  2B2U A;  2K28 A;  1F9Q A;  2JXM B;  1PTO H;  1F2M A;  1IKL A;  5EKI A;  5FLX L;  1TWC B;  1E2W A;  4K8J A;  2K6A A;  5IGE A;  1QNK A;  4RHR A;  4LAA A;  5DNF A;  2HCI A;  1X32 A;  4RH6 A;  2QEJ C;  3S1M B;  1LTB D;  1MSG A;  3D6W A;  5ELB A;  2ZXP A;  3S16 B;  4LMQ D;  2L11 A;  5C3E B;  1LT3 D;  1STG A;  1EY9 A;  2F0H A;  1CHQ D;  4RA8 A;  2PZT A;  1BF4 A;  2EJF C;  5D3I B;  1KAA A;  3LNN A;  3VR2 A;  1ENC A;  2B2W C;  4C3H G;  2ID0 A;  3PUX A;  2Y0S B;  2EJG C;  4RFB A;  4KY6 A;  1DOK A;  4IFD J;  5G3L F;  5JVG 3;  3A7A B;  3NSW A;  1SNQ A;  5G3L D;  2F0W A;  2MJ8 A;  3M4Y A;  1JC7 A;  5J1Z A;  1BR9 A;  1GJX A;  2K32 A;  3NXW A;  1WD1 A;  1SYC A;  5FLX E;  5DM6 3;  4C1N I;  5CBA E;  3BDL A;  1OO9 B;  4MIU A;  3TP8 A;  3BVZ A;  2NTS A;  4K6L A;  5JVH 3;  1AZP A;  2PZU A;  2I46 A;  1CI3 M;  3MA2 B;  5CV6 A;  1W6K A;  1BCP C;  3W3A A;  5KGU A;  2IWH A;  3BYY B;  5JPM C;  1PRT D;  1WTW A;  1B3A A;  5FO9 B;  2B39 A;  4DNR B;  2K04 A;  4B08 A;  3M85 A;  4WRD A;  1ET6 A;  4K5V A;  1F77 A;  3HOZ B;  2G9H D;  1SMY D;  5IGB A;  2PCF B;  2B2T A;  1EYD A;  3QIA A;  4FXG C;  4ZRZ A;  1M8A A;  4TSS A;  4CGY B;  1SNO A;  3IL8 A;  3CKI B;  1QNU A;  4ID6 A;  2QDB A;  1LTI D;  2BOS A;  3H94 A;  5JPN C;  4JBW A;  3I70 A;  5FO8 B;  1YNJ C;  1TII D;  4G7Z C;  4K2L A;  3I73 A;  5LL6 X;  1SMY C;  3HKZ B;  1A2U A;  2DNE A;  4R9W A;  3VR3 A;  2QF7 A;  3TP5 A;  4K8I A;  4CKE A;  3NTK A;  1JB3 A;  4PMB A;  2MGS A;  3HZX A;  4EQO A;  4V19 0;  4XYO A;  1WTO A;  1I4Q A;  2EVB A;  2VB2 X;  2A73 B;  2BE5 D;  1UAP A;  1GUT A;  1Y1V B;  1C4Q A;  5EGT A;  2GA4 B;  1BUV T;  3GP7 A;  1NR4 A;  2IT1 A;  2NWG A;  4RCN A;  3GTL B;  2FIN B;  5ELF A;  2RQX A;  3C1F A;  3NBH A;  3SK8 A;  3MWY W;  3PIO 3;  1PLF A;  3T13 A;  4K5W A;  4N9P A;  3TN2 A;  4ZUJ A;  2BA1 A;  3URY A;  2NTT A;  5M5Y B;  3NE5 B;  5C4X B;  1FNU A;  2KUM A;  4HCE A;  1OXS C;  3EA6 A;  1G29 1;  3QJY A;  1SYF A;  1I4G A;  2MUY A;  4C2M B;  2D2C C;  2NBF A;  1PZI D;  1R4P B;  1PTO F;  2Z1C A;  1O7Y A;  2KVM A;  3NHH A;  5F2D A;  1STA A;  1NAP A;  4L63 B;  3K5O A;  4E6I A;  4KV6 A;  4OGQ C;  3D3R A;  3JAM E;  3TBI B;  3DWA A;  3L7Z C;  5CV5 A;  4WFN 3;  1VCI A;  4G7O C;  3GV6 A;  3J81 L;  1HUM A;  2F0U A;  1VMC A;  2CW0 C;  4XXE A;  3M7N A;  2L0C A;  2EYH A;  4X3S A;  4HTH A;  3A7L A;  5JEA H;  1I3Q B;  3Q6S A;  2NZ1 D;  5A35 A;  2B63 B;  2KOL A;  2JA5 B;  2R3Z A;  4WOR A;  5J22 A;  4I7Z C;  2AWO A;  5I2X A;  1B50 A;  1TWG B;  4XT3 B;  3L3O C;  2CW0 D;  1CZG A;  1BCP F;  2SNM A;  3EQL C;  3KLS A;  1C8C A;  5TSS A;  2H4O A;  1S5F D;  2L5T A;  4XTC S;  3A8K E;  3JAM L;  1QG7 A;  1EYA A;  2DY8 A;  1PZK D;  4B9X A;  3J81 E;  1I4R A;  2IJ0 A;  3DEP A;  3NQT A;  4CBV A;  5CV4 A;  1GXD C;  4XQN A;  1F2Z A;  1SYE A;  4L8J A;  5CC4 A;  5J39 A;  1EY0 A;  1HFN A;  4DAY A;  2SDF A;  2ZXO A;  2WII B;  3RZD B;  2AUJ D;  1HA6 A;  1I4X A;  3TSS A;  1JWM D;  2H1E A;  3LWU A;  1E0B A;  4NW2 A;  3K5N A;  1KNA A;  2FFK B;  3R8B A;  1EOT A;  5JEA J;  1HCZ A;  4UDU C;  1EL0 A;  2M00 A;  1Z6H A;  5HGT A;  2AQ3 B;  2JP1 A;  3MZ5 A;  2E76 C;  2I07 B;  2C5C A;  3PO2 B;  3PO3 B;  2NN6 G;  4A3G B;  3RLF A;  1QWY A;  3DUZ A;  4C3H B;  4OO1 G;  5C3W A;  5I6W A;  1HHV A;  4J6H A;  3SVM A;  4HN7 A;  1RTN A;  2A68 C;  1U4R A;  2CQA A;  3GD7 A;  1H9S A;  1K8O A;  1UUP A;  3D4R A;  4F8M A;  2M2L A;  5C4J B;  3ERO A;  1AZQ A;  4G4K A;  1G6Z A;  1E2Z A;  2J4X A;  1XXG A;  2K05 A;  2R93 B;  5KRU A;  4JK1 C;  1WTQ A;  2WAC A;  1SFO B;  2WKD A;  1B9M A;  3J80 E;  2JA7 B;  1A3U A;  2A68 D;  5EJW A;  1XWE A;  1TQO A;  2NN6 H;  3BVG A;  4C3I G;  4UAI A;  1F9R A;  1EWC A;  1KDA A;  2KEE A;  4YIJ A;  2NVX B;  4KK7 A;  1LTT D;  4A3K B;  2IX3 A;  2HQE A;  1EYC A;  3M7G A;  2RBM A;  4KHZ A;  2XSC A;  1NCV A;  1STY A;  1CA6 A;  4S3S A;  3PMF A;  3RUZ A;  2F0N A;  3P7J A;  1I6V C;  1SYB A;  2FMM A;  3S17 B;  4C56 C;  1EU3 A;  5E3F A;  5LHY 1;  4KKS A;  3KLR A;  4KY5 A;  3BVM A;  4HAE A;  2KEC A;  1GHJ A;  1TS3 A;  1GUN A;  4N9T A;  4EQP A;  3K7A B;  4J1M A;  4OO1 H;  2JEA I;  2IW3 A;  3IKJ A;  2C9O A;  3T56 B;  1A15 A;  1EY4 A;  2NYZ D;  3PUW A;  3ITP A;  5EPK A;  4DK1 A;  1LTA D;  4C1N K;  1I4H A;  1X3P A;  2F0K A;  5CV7 A;  4KN7 C;  5EBC A;  2WAQ B;  3MHB A;  3MAQ A;  5M5X B;  4QIW B;  2K5W A;  1Q12 A;  3MXP A;  4ME5 A;  4DGZ A;  1TS4 A;  3IAY A;  5JAV A;  1EZ6 A;  1F2L A;  4FF3 A;  3WDN A;  3M4O B;  2JA6 B;  1LT6 D;  5KYI A;  1H9J A;  4X3K A;  5COY A;  1YNN C;  3FMC A;  2JSO A;  2WP8 J;  2F3W A;  3I72 A;  1HUN A;  1STB A;  5JEA G;  4BA2 I;  2XNA C;  1A6X A;  1QB5 D;  1WTP A;  3U9O A;  5COR A;  2F0M A;  5C4H A;  3S15 B;  5DM7 3;  5BN5 A;  1D1I A;  5JOB A;  1MBY A;  3OW7 A;  1U4P A;  4CJ2 C;  4RGT A;  3MXG A;  1TS2 A;  1PYW D;  3MFY A;  2RDG A;  3I8Z A;  1CQF A;  4X3T A;  5M5W B;  3BDC A;  1Y69 U;  2E2J B;  1KTK A;  1Q3L A;  2KQ3 A;  1BCP B;  2K01 A;  5KNC A;  4KD3 A;  2OT2 A;  3TME A;  3V05 A;  3AU7 A;  2EYO A;  3T16 A;  1Y8P B;  4FYD A;  3S2D B;  4GZY C;  2EY5 A;  2F0P A;  2SOB A;  1XTC D;  4PNY A;  2F0T A;  3S1N B;  1G91 A;  3IFD A;  5CV8 A;  3FDT A;  1Q90 A;  1F2Y A;  5C0X I;  3F2U A;  4RKB A;  1TY2 A;  3K5M A;  1SYD A;  2BDN A;  2CHB D;  3CRL C;  1EEI D;  1T5E A;  3TZD A;  4PQX A;  3HOX B;  1BO0 A;  3CHB D;  3SK6 A;  1MGS A;  4QMG A;  3GTK B;  3ONA B;  2AQ1 B;  3D6C A;  4U68 A;  2Z4I A;  1RDP D;  4CKC A;  2A6H C;  3DHQ A;  3OOC A;  2A74 C;  5IT9 E;  4A3I B;  1U4M A;  5FK9 C;  4BS9 A;  3HS0 C;  3GV3 A;  2PW7 A;  5CYU A;  3S14 B;  3H0G B;  3K0Y A;  5E4X A;  5EPL A;  5A2Q E;  4C3J B;  2AUK A;  3W2D A;  4DNT B;  4DAP A;  1B44 D;  4BY1 B;  2EYJ A;  2LKV A;  3E5S A;  1EZ8 A;  1MD2 D;  3A56 A;  2L55 A;  1STH A;  3KBX A;  3SEB A;  3X3M A;  1Q8I A;  1LAB A;  1FYC A;  1B2T A;  5AFW A;  3U9S A;  4IZ8 A;  1DON A;  3R3O A;  2J7Z A;  5C6A A;  5C0X J;  2JYO A;  1D6E C;  3E0J A;  3DMU A;  2WV6 D;  2YU9 B;  3IFT A;  3R2T A;  2OXP A;  5KEE A;  2K33 A;  2F0I A;  3EFX D;  1WTX A;  2ZT9 C;  1TY0 A;  2XN9 C;  1DM0 B;  1ESF A;  2RSO A;  1GUW A;  4KKT A;  3V96 A;  2F03 A;  5BN3 A;  5A2Q L;  2D62 A;  4OL7 A;  4RGN A;  1H9R A;  3GTM B;  3TZU A;  2R61 A;  5IOD A;  1CM9 A;  4ZYS A;  4IUQ A;  5C44 B;  1AFP A;  4XYQ A;  4ILW A;  2NUC A;  3VYU A;  1NR2 A;  4IFD H;  2FMC A;  2B2V C;  4ABN A;  1UEA B;  1ZEQ X;  5T1I A;  1FR3 A;  4LJZ C;  1TWF B;  3G6J B;  1LTG D;  2O5I C;  3GQB A;  2WKC A;  3RMH A;  4FXK C;  4FO2 A;  2VXW A;  5I9P A;  3ND9 A;  1G2T A;  1SEB D;  3C1E A;  2BE5 C;  1D2B A;  1EU4 A;  4XT1 B;  3X3N A;  1PFM A;  3R93 A;  3GTP B;  1M4V A;  4KI0 A;  2DY7 A;  3MVV A;  4ZKB B;  1B4O A;  5FO7 B;  2TSS A;  3SK5 A;  2B2T C;  3S9W A;  4A3J B;  1QJO A;  4CHT B;  2B2V A;  1DCZ A;  4TRD A;  4A3F B;  2JEB I;  5D14 A;  5CBE E;  4F88 A;  4A3M B;  3OWE B;  4OIK A;  2F3V A;  1ZYR D;  4P2C B;  4TQU S;  1O7L A;  1EY7 A;  2F0D A;  4RKL A;  2KA7 A;  5E1F A;  1AN8 A;  2EXZ A;  5D3D A;  1D5M C;  2F1M A;  5CV9 A;  4K5X A;  4XIG S;  1V1P B;  4ZUI A;  1NUC A;  1HRJ A;  3S1Q B;  2PNR C;  2E2D C;  1L0X B;  4DXF A;  5EQ0 A;  1G8Z D;  1MI2 A;  4I65 A;  3NWS A;  4R8N A;  4FF2 A;  5EKL A;  3LWE A;  1XYI A;  5ELE A;  2EOT A;  4KJO A;  1SE4 A;  2FHT A;  1FGB D;  3MEH A;  2JE6 I;  3AB9 A;  1A3V A;  1VF7 A;  5I6Y A;  1IHZ A;  1PRT F;  1PRT C;  3QB3 A;  2QIL A;  4OO1 I;  2MHV A;  1LV9 A;  5IIF A;  4IUU A;  3P1H A;  2EY1 A;  1G2S A;  2VUM B;  1ICW A;  4HMJ A;  3ERQ A;  1TVX A;  1V1O A;  2K03 A;  3K58 A;  2XRQ D;  4OHJ A;  4XQJ A;  4K2K A;  4IUP A;  5C5L A;  1PZJ D;  2PQE A;  4F7X A;  1SJE D;  1BBX C;  2EJM A;  2E2H B;  1SXT A;  1SYG A;  2QKI C;  4HSV A;  3RZO B;  1A3T A;  1LAC A;  3CRK C;  1S5E D;  3DM1 A;  4QCL A;  3QOJ A;  1PRT B;  1YNJ D;  1SND A;  3Q23 A;  4IQZ A;  2WB1 B;  1V8Q A;  3VR5 A;  4ZAI A;  3OMG A;  2XRS D;  4QF4 A;  1SBB B;  1B53 A;  3P75 A;  2F4I A;  4O42 A;  1SNC A;  3BYT B;  4L6T B;  2EZV A;  3MXU A;  3J7A V;  3EJI A;  3O13 A;  3D4D A;  1W6J A;  1JIC A;  4BBS B;  2D9U A;  1KDB A;  1O80 A;  2NB0 A;  2E75 C;  2ZXR A;  3VA7 A;  3MTS A;  1JQY D;  4G57 A;  4HED A;  2ENB A;  1SSO A;  2F0L A;  1EY6 A;  5NUC A;  2HUG A;  4MN3 A;  3D8G A;  1AEX A;  1S4Z A;  1WD0 A;  1TWA B;  2Z8L A;  3VYR A;  3S1R B;  4NKL A;  1L0Y B;  1U9R A;  3L9A X;  1JR0 D;  2LFN A;  5HUR A;  3H3V C;  3MC0 B;  2DNC A;  4BY7 B;  1E2V A;  4KMU C;  2L12 A;  4RAU C;  3HEJ A;  2EYP A;  3OPO A;  1STN A;  2B2W A;  1Z7T A;  4IUR A;  4EQN A;  4FF4 A;  3FRP B;  2KJX A;  2L1B A;  4KJN A;  3NTH A;  3I4M B;  1LLR D;  2Z4H A;  1SDF A;  3BDO A;  1TT2 A;  2E2I B;  2O2L D;  3TP6 A;  4BA1 I;  2BA0 A;  3GO5 A;  1T5X D;  3GTJ B;  3PV0 A;  4DAV A;  4Q0F A;  4DF7 A;  5C5M A;  4ODG A;  2R6G A;  4XQQ A;  1LTS D;  3D31 A;  3LX0 A;  1PXU A;  2EDG A;  1V1P A;  5M3F B;  1MSH A;  2XVS A;  5K36 H;  2F0V A;  2KCC A;  4F87 A;  4X3U A;  2ICI A;  1FD7 D;  2NN6 I;  4B9W A;  1OXU A;  2PZW A;  3HOU B;  1GUS A;  1JOQ A;  3N6R A;  1NSN S;  2V4D A;  3I90 A;  1KDC A;  1KLU D;  3A55 A;  4A3E B;  2B2Y A;  3FPU B;  3H09 A;  2R7Z B;  2XIW A;  3RD4 A;  1HQM C;  1S5D D;  1RJT A;  4PMW A;  3T4A C;  2L9H A;  1O7Z A;  1X3Q A;  2IPK D;  4R8I A;  2A6E C;  3NUC A;  2XWJ B;  4XDX A;  4OIJ A;  4MHE A;  2VB3 X;  1RCV D;  5I2Y A;  2X6G A;  2LMC B;  1ILP A;  1ENA A;  1CQV A;  1S5C D;  2EY6 A;  4PV1 C;  1ZXT A;  1PFN A;  4A3B B;  3C46 A;  1GOZ A;  2F0Q A;  3NQI A;  3NK9 A;  1FNW A;  2VNU D;  1PMR A;  1WTR A;  1I6H B;  4DK0 A;  1BCP D;  3NWT A;  4H44 C;  2B8G A;  1EY8 A;  2RDH A;  3A8I E;  4CJ1 B;  2B2Y C;  3VYT A;  2M9V A;  3I91 A;  1SE3 A;  3VYS A;  4G7H C;  3HOV B;  2N88 A;  1LT5 D;  4RHS A;  1HPC A;  3SDZ A;  3G7L A;  4KTA A;  2HCC A;  1ILQ A;  2RKS A;  4Z9C B;  2YYZ A;  3P20 A;  5E4W C;  4FF1 A;  5FKA C;  1PTO B;  5EPJ A;  4H13 C;  1GUO A;  1TU2 B;  1EEF D;  2NVY B;  3KK7 A;  1QIL A;  4V0B A;  1ET9 A;  4K6D A;  3A8J E;  2FJ2 A;  3UI2 A;  3PUY A;  1WVL A;  4IUT A;  4FVM A;  3I4L A;  4CKB A;  4NDX A;  2PPB C;  4ULL A;  4KD4 A;  1HQR D;  4KHV A;  3SE0 A;  1AP0 A;  1I50 B;  1TS5 A;  3I4N B;  4Y7N B;  3NPP A;  1CFM A;  5DAU A;  5C3X A;  1HA5 A;  1EWH A;  3SXH A;  3GTQ B;  1LO5 D;  4H0L C;  3Q0A A;  3NBI A;  2F0J A;  1EY5 A;  2LY7 A;  1CK1 A;  1TKW B;  4HSP A;  1BNZ A;  1QE6 A;  1QCB D;  1RKN A;  3PUV A;  1II3 A;  2SEB D;  4KN4 C;  4IUN A;  1STE A;  3DEO A;  5IGG A;  4RWS C;  2BDO A;  3J80 L;  3HOY B;  2RVL A;  2OF1 A;  1DXM A;  5KND A;  2AQ2 B;  4WJW A;  1DZ1 A;  1F9P A;  3BZD B;  3NP8 A;  4DN4 M;  1HFG A;  1F9S A;  2K1B A;  1UNS A;  2EPB A;  1VF5 C;  1JWS D;  1DOM A;  4DFA A;  3OWF A;  3H6M A;  2EE1 A;  3DWQ A;  2KED A;  1JCK B;  1U4L A;  4BBR B;  1ONL A;  1OXT A;  1K83 B;  4IFD G;  2F0F A;  2JA8 B;  2E74 C;  3R2I A;  1LT4 D;  4HCS A;  1B1Z A;  1H9M A;  1EQT A;  2EYL A;  5KYL A;  3S2H B;  1D1K A;  2WIN B;  2QCP X;  1O78 A;  3A54 A;  3SK4 A;  3DWP A;  2G9D A;  1PDQ A;  3SR1 A;  2EY2 A;  2F0E A;  1RHP A;  3VR4 A;  3CQZ B;  1PFB A;  3HGB A;  4NP5 A;  4RCO A;  4O1N A;  2XWB B;  3KBG A;  5C4Z A;  4K14 A;  2LS0 1;  1EIH A;  4BWG B;  1IW7 D;  2NVQ B;  3GTG B;  2O5J C;  4TKO B;  1RTO A;  5JJZ A;  2D5D A;  1HXY D;  1Z47 A;  2A6E D;  1CA5 A;  1Q1B A;  1LTR D;  2B2U C;  3OIP A;  1YNN D;  2F0O A;  4H7B A;  1R9T B;  1ML0 D;  5KNB A;  1H9S B;  1V43 A;  5IT9 L;  4ZK9 B;  3T53 B;  1IW7 C;  1BDO A;  2IX0 A;  1SNM A;  3FEW X;  3Q24 A;  1Y1W B;  1Q1E A;  5M9O A;  3K57 A;  4NMZ A;  5CGK A;  1CTM A;  3HG9 A;  2F0G A;  5KIX A;  3DXJ C;  2PYK A;  1OXV A;  2RSN A;  1IYV A;  2Q8T A;  2RDF A;  2MPM A;  1ENF A;  3SHL A;  1RD9 D;  1WTV A;  4IN3 A;  1DOL A;  1CT1 D;  4A93 B;  2PMZ B;  3J7A F;  4ZQ3 A;  1Y8O B;  4DXG A;  2PW5 A;  1JWU D;  5ELD A;  4M1U B;  2ICE C;  4EVO A;  3WOF A;  3QG1 A;  2B8F A;  2Q8I B;  4CJ0 B;  4FNF A;  3D4W A;  3BG3 A;  1HTP A;  1TR5 A;  4FXD A;  2NVT B;  1DYQ A;  2EYM A;  3CU7 A;  1SJH D;  5IGD A;  1H9K A;  1CHP D;  1ZYR C;  3BS1 A;  3K5L A;  3Q22 A;  2A6H D;  1ROD A;  5I9O A;  1J9O A;  1WCM B;  3N52 A;  2K7V A;  3E6Z X;  5EKK A;  1FNV A;  3I3C A;  1BOS A;  5K36 G;  1XX8 A;  1QOH A;  5ELC A;  5K5P A;  1RF2 D;  3OIQ A;  1SNP A;  1SAP A;  1B9N A;  4HMI A;  3FVQ A;  1IL8 A;  2Q8R E;  1K8M A;  5T1G A;  1A2T A;  5M3M B;  2IX1 A;  1R4Q B;  1D5X C;  4IUV A;  5IOC A;  5IGF A;  2KHS A;  5CMD A;  2KCN A;  3HRZ C;  3PUZ A;  4ZKC B;  1DD2 A;  5CR3 A;  1AW7 A;  1GUG A;  3J7Y W;  3WOE A;  1JOO A;  3TDQ A;  4QB4 A;  4U67 3;  2K5D A;  4QUF A;  2BCO A;  5C0X G;  1J8I A;  4KY7 A;  4LK1 C;  2HDL A;  1Y8N B;  1DJR D;  4M8A A;  3V2T A;  2X69 A;  1IYU A;  1GHK A;  4PMC A;  2F0S A;  2X6L A;  3KLS X;  1VDZ A;  3HOW B;  2IL8 A;  1I4P A;  4AYB B;  2L4N A;  2TMP A;  3ND8 A;  5D65 A;  2CVR A;  3AMU A;  3GTO B;  3EVQ A;  4KKU A;  3QOL A;  5C0X H;  4Q5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...