5IGEA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igeA00
1SYFA 1STYA 2PZWA 3TP8A 5KRUA 3VA5A 4EQPA 2EYPA 3OWFA 1F2YA 4KV6A 4HTHA 1A3UA 2QDBA 4WRDA 5JOBA 5IGFA 4DU9A 3MHBA 1EY5A 5M9OA 1NUCA 3SK5A 2PZUA 1SYEA 5CV4A 5KEEA 5J39A 4KTAA 5I6YA 1II3A 3BDCA 1SYDA 3SK4A 5IGBA 5IGEA 2EYJA 2F0HA 4K2LA 1STAA 1A3TA 1SNCA 2F3WA 3D4WA 4IALA 4MIUA 2SNSA 4DFAA 5IODA 1EY8A 2PW5A 5KIXA 1SYCA 5KGUA 1U9RA 3C1FA 5J1ZA 3OMCA 2KHSA 2F0WA 2M00A 2OXPA 1SYGA 3ERQA 4G57A 1KABA 1KDAA 4KY5A 2F0EA 3R3OA 2F0NA 1JOOA 2PQEA 1ENAA 5E1FA 4EVOA 4ODGA 5CV7A 1NSNS 1IHZA 2SOBA 2EY6A 4NP5A 5C3WA 1TR5A 2F0MA 5CGKA 4ME5A 1SNMA 1SYBA 2PZTA 5IOCA 3MXPA 4QB4A 1SNQA 3SXHA 3NP8A 4B9XA 3QOJA 4DF7A 4IZ8A 3NUCA 3BDLA 2OEOA 4K5VA 4YIJA 1EQVA 2EY2A 2EY5A 4KY6A 5HURA 2F0KA 4EQNA 5CV5A 1EZ6A 3TP5A 2EY1A 5CV9A 3DMUA 4N9TA 4R8NA 2EYMA 4K6DA 4B9WA 2PW7A 1STHA 3H6MA 1STGA 2NUCA 3NQTA 4KD4A 3SK6A 2F0SA 4IUNA 3MVVA 3V2TA 4KHVA 1KDCA 1EYCA 4NKLA 1A2TA 4K8IA 4EQOA 3T13A 2HQEA 4N9PA 1EYDA 4KD3A 4TRDA 2O4XA 4QMGA 2F0GA 4WORA 1F2MA 1A2UA 4I65A 1KAAA 4H7BA 5F2DA 3SK8A 2F0QA 1SNPA 4HMIA 3TMEA 5KYIA 2F0OA 4ZQ3A 4J1MA 2F0VA 3D8GA 4ZUIA 3EVQA 2EYOA 1AEXA 2EYHA 3NK9A 5I6WA 2EXZA 4LAAA 3DHQA 5EKKA 1EY9A 5C5MA 3E5SA 5ISRA 4F8MA 2F0JA 5NUCA 4RKLA 4RKBA 3C1EA 2PYKA 1KDBA 5IIFA 3EROA 4KJNA 4QF4A 2F0DA 2OF1A 3D4DA 4PMCA 5CV8A 1TQOA 3QB3A 3PMFA 2KQ3A 5CR3A 2F0FA 2EYFA 5CC4A 3NHHA 1STNA 2ENBA 3OSOA 5C4HA 5HGTA 3P1HA 3TP6A 4HMJA 3T16A 3S9WA 2F0UA 3U9OA 1EY0A 5J22A 4NDXA 5C6AA 5DAUA 4ID6A 4K2KA 5C4ZA 3HZXA 3TP7A 4K5XA 4KY7A 4ZUJA 1JOKA 1EY7A 5CV6A 2F0PA 3OMGA 1TT2A 1F2ZA 5IGDA 1EY6A 5IGGA 1JORA 3ITPA 5C5LA 4K5WA 4PNYA 5IGCA 3D6CA 3P75A 4S3SA 1SNOA 2WACA 4J6HA 4K8JA 5DEHA 3QOLA 3SHLA 3LX0A 1JOQA 1EYAA 2SNMA 2RKSA 3MEHA 1A3VA 5K5PA 5EGTA 4F7XA 1RKNA 1ENCA 2F0IA 4KJOA 2EYLA 4OL7A 4E6IA 5I9OA 2F3VA 2RDFA 5EKLA 5JAVA 1EZ8A 2RBMA 3MZ5A 3NXWA 1SNDA 4K14A 4NMZA 5E3FA 5C3XA 5I9PA 2F0LA 4DGZA 3HEJA 3SR1A 2LKVA 1STBA 3EJIA 4PMBA 1EY4A 5KYLA 3RUZA 2F0TA
chains in the Genus database with same CATH superfamily
1W2BA 2EYPA 4A3BG 1CT1D 4CBVA 5M9OA 1S5ED 2K5WA 2A68D 2AUKA 2QILA 2KCNA 1RIPA 2GVBA 1PH1A 4K2LA 1ASZA 3S1NH 3HOVB 1HCZA 4PZ7A 2B2WC 1XWEA 4JI7L 2N49A 3C1FA 5J1ZA 1BOSA 2K05A 4KKUA 3M4YA 2IPKD 3VR6A 4DV7Q 3IAYA 4C3JG 2FMCA 1QVGA 3A8KE 2A5HA 4OX9L 2HDLA 1ONLA 5BN3A 3BZCA 2BA1A 1SNMA 1SYBA 2AMCB 2PNRC 1MSHA 1SR3A 2CKZB 4FVMA 2EJFC 2QGQA 3FKIB 1NJIC 3E9IA 3RLOA 4LUOA 1IBMQ 1LT4D 3MVVA 3V2TA 4A3JH 3K5OA 1VQOA 3DUZA 4N9PA 3MXGA 5F2DA 5M5YB 1XX8A 5KYIA 1C4QA 2ICEC 4ZQ3A 5EBCA 3A8JE 3HOVG 2IHFA 1IKLA 4OWXB 2RQXA 2AQ2B 4BA2I 2SDFA 3GV6A 1EL0A 1TU2B 4A93B 1ML0D 1X3EA 3CU7A 5ELNA 3KDFA 3H0GB 5FLMH 1Y8NB 3PMFA 4B3SQ 1GUNA 1WYDA 4C1NI 1S40A 2EYFA 3OSOA 1LTBD 2LMCB 2AKWB 5KNDA 2IY5B 1EY0A 3KLRA 2E75C 2R6GA 3FKIG 5DNFA 2FINB 2H1EA 5IT9L 5A35A 1IL2A 3W3AA 5AJ3Q 4BXXH 4HIDA 1AZQA 1JORA 3K59A 1YNNC 2EIFA 1RCVD 5EPLA 5CBEE 4J6HA 5ELOA 4L8JA 1PH9A 3QOLA 3GTQH 3F2UA 1JWUD 5EBDA 2IHEA 2LFNA 3HOZB 4R9WA 2L4NA 4XIGS 4GOPA 1HNWL 4IQZA 3ERSX 1D6EC 3S2HB 1G91A 3S24A 4H44C 3VYUA 1X32A 1EY4A 3Q6SA 3NBIA 4DR1L 4A93G 3OWFA 1IW7D 3IL8A 2KENA 4C3HH 3H0GG 2PZUA 1DCZA 2K04A 2LSSA 3J81j 4LW1A 1QB5D 3S16B 3DEPA 2D2CC 4MIUA 3ULPA 1EY8A 5KIXA 3D0FA 1Y1VB 1D5XC 1W3SA 2MO1A 1HNZQ 4HIOA 3H3VC 1ENAA 1QZHA 1PRTD 5M5WH 3CRLC 3GTMB 5CV7A 1N32L 1PH6A 2ASBA 4L5QA 3RLFA 1GUOA 2JE6I 3HOZG 3HOXB 4DF7A 1QWYA 3BDLA 1UE5A 2G5DA 1UEAB 2PW7A 4CKEA 3H91A 1K28A 4A3GB 2L11A 3CMEA 4KLKA 3HKZE 4WORA 1EYGA 3NTHA 1WFQA 4JI7Q 1HPCA 4A3LH 1UEBA 3M85A 1JB3A 4ULLA 4XXEA 4PV1C 5GROA 1ET6A 3C3LA 4LJZC 1QE6A 1Y1VG 3K80C 3HOVH 4RKBA 4LF6L 5LMUL 4OX9Q 2F0DA 2KEEA 1JT8A 3FEWX 1SRUA 4IUPA 4EQ5A 5C4JB 4XYQA 1V43A 3K0YA 4IFDG 1VQMA 5C4HA 1GO3E 4LFCL 3HOXG 1PTOC 1ESFA 1MHWC 1D1KA 3AB9A 1AE3A 3RMHA 4UHVA 2N88A 1TT2A 2JP1A 2NZHA 3KLSX 4NB3A 2Q8RE 1YNJD 3F2DA 1G2SA 2K7VA 4R4QA 1A62A 3PF5A 3S1MB 1WCMB 4A3GG 3CP0A 1ENCA 3HKSA 1ENFA 4E6IA 5I9OA 1SNDA 4GLAC 3U4VA 3M4PA 1EEFD 1S5DD 3BU2A 3D31A 1Y1WH 1NMFA 2E2HH 1MD2D 3G6JB 2UUCL 2XWBB 1GKHA 1BVSA 1BO0A 2WIIB 3OHXC 3MXUA 4A93H 4C2MH 4X3KA 2YV5A 4IALA 3OYYA 3DWAA 4HSVA 3LNNA 1SSOA 3LWUA 2ZTCA 2R93H 4WJ4A 5E1FA 2JEBI 4F88A 1JICA 2KEDA 2SOBA 3B6YA 2D0PA 3I2ZA 4P75A 1EFWA 1N36L 3MC0B 1HUMA 2ID0A 2R61A 1WCMG 3GDEA 3T4AC 1HTLD 4GNXB 2JA6H 2Q8TA 1QCBD 4R4CA 1EQQA 4OELB 1FD7D 4MHEA 1NY4A 5JVH3 3VR5A 4BY1H 1NAPA 3DWQA 2Y0SE 3KF6A 4GKJQ 4N9TA 1K8MA 1VF7A 4DR3Q 4TKOB 1SBBB 5M3MB 4NW2A 3K8AA 3GTOB 4QMGA 5G3LF 4LF9Q 1WTRA 4IUVA 1LTID 2L5TA 1TWFH 4HJ8A 4KHZA 5K36G 1CHPD 2EQSA 3X3MA 1T5EA 3UDFA 2K50A 3VA7A 2CFMA 2PO4A 4R8IA 3VR4A 4UAIA 1B3AA 4ZRZA 3RZOH 4DK1A 5CR3A 1STNA 2DN8A 5C0XI 1XNRQ 4KMUC 3Q22A 5C4XB 2R3ZA 2R7FA 1L2FA 3R2IA 1V1QA 2WFWA 3I4NB 1I94Q 2ZJQA 1HZAA 2ZJRA 1FNVA 3BVGA 3W5OA 1BKBA 4PNYA 3SEBA 3SE0A 2WAQE 4YCVA 4HJ9A 1PYWD 3GTGB 4U673 3FPPA 2RA4A 1HRJA 1PYSB 5M3MG 4C3IB 5D3IB 1RF2D 4OL7A 4DAMA 3CF5A 5I9PA 1I6VC 3S14B 1SXTA 4CKBA 3TRZA 4JOIA 4GLXA 1PH4A 1PLFA 5KRUA 1BBWA 2K52A 4QL5A 3BG3A 2QDBA 2NZ1D 4YCWA 2Q8IB 4CDDC 2GA4B 2AWOA 3H15A 1AN8A 2FMMA 4DN4M 1A6XA 1EQRA 2CH4A 3KJPA 4G7OC 2XTIA 3UDIA 1T5XD 1C0AA 5KGUA 3E9HA 3STBD 2XN9C 5C4XG 2K5QA 2JSOA 3I4NG 1A63A 1B53A 2ZTEA 2F0NA 1HR0L 3BDOA 5FLXL 3J80i 1KHIA 4GOPC 2JA9A 2FHTA 5TSSA 2KHIA 3A7AB 3N52A 3PCOB 4ME5A 1VQLA 4Y7NB 1SLJA 2HHHL 4B3RL 4C3IG 2KUMA 3ONAB 1SNQA 4KKTA 1K83H 4A3IB 3Q24A 2B3GA 2UUBL 4LF5L 1KNAA 1UE1A 3CC4A 3FPUB 4JI1Q 3S1MH 1WCMH 2X6GA 3TP5A 3WDNA 4R8NA 2UUCQ 2QKIC 2IL8A 3SVMA 1JJCB 1B4OA 4JI5L 4LWCA 4OGQC 5EPKA 4A3KH 2LXKA 4K8IA 1ASYA 4KD3A 1Z47A 2Z6KA 1CM9A 2CWAA 1KAAA 2RCFA 4RGOS 4APVA 3JC66 4HMIA 1BXTA 2PMZE 4DV5L 2EZVA 1LTRD 4UP7A 3M4OB 1ILQA 4DA2A 3MA2B 2CH4W 3QG1A 4DR4L 1JE4A 5IIFA 1HJPA 2OF1A 1IKMA 2K6AA 1N36Q 3G4SA 1XPOA 2ENBA 2Z8LA 1SE2A 2UUAQ 3J80L 2MGSA 4NDXA 1PRTB 4A3IG 3MXNA 5M3FH 5GAHC 4JI6L 1N34Q 1J9OA 3E0EA 5CV6A 1Q46A 2OCEA 4JV5L 1RHPA 5BN5A 2MP1A 5IGCA 3TEHB 1KAWA 4JI8L 2WINB 2ES2A 2SNMA 2NN6G 3G48A 5FO8B 1Q86C 2CCZA 1AW7A 1XTDA 1QUQB 4KJOA 4ZKBB 4DAYB 1AFPA 5D14A 1PA6A 2D0OA 5DLQE 3WWVA 1DOMA 3AFQA 4DGZA 3EJIA 4I7ZC 1SEBD 1G2TA 1PFSA 3GTOH 3PO2B 2NYZD 3GP7A 3NEMA 3K7UC 5IYBG 5IGFA 1XYIA 4XQJA 1YVCA 1O7IA 3MEFA 1JR0D 2OTJA 3DEOA 1I4HA 3QR8A 2VXWA 3CAMA 1KRSA 4LFAL 1F9QA 2JK8A 3M7GA 2CWPA 2YYZA 1VQNA 3CCMA 2UXCL 1D2BA 2F0EA 1J8IA 2FXQA 4EVOA 5C0XG 2CQAA 3L2PA 4YWLA 2XGTA 1CSPA 3MTSA 3J7AF 1HNXL 3NP8A 3KUPA 1PTOD 1L1OB 1QNUA 3L7ZC 4DV6L 1PRTF 3PO2G 3NQTA 4DNIA 1R4QB 1Z7TA 1KIXA 4HCEA 3M3YB 4IPDA 1L0WA 3KLWA 1A2UA 2B8GA 1VF5C 1TY0A 2XRSD 4H13C 3SK8A 1B50A 2F0VA 5FO7B 3G71A 2EYOA 2LY7A 2DNCA 1QNKA 5EKKA 2Q2UA 3PO3B 3I4LA 5G3LD 4F8MA 2RSOA 1PH5A 1YNXA 3D4DA 2VNUD 2DGYA 2HHHQ 3BS1A 2R7ZH 3CQZB 4LUVA 4DV3L 5HGTA 3GO5A 4XTCS 4LF5Q 5I4DA 4JI4L 3K5MA 3L0OA 4LUZA 1O7LA 3HZXA 1U0LA 5D3DA 4Y7NH 1PH7A 1Y14B 2QCPX 3DM3A 4JI5Q 1FJGL 4MTKA 1RTNA 3E0JA 1O7YA 3Q23A 3LX0A 1WTVA 5JVG3 1XPUA 1BCPD 3Q0AA 2PPBC 1O78A 2C35B 4AIMA 3H94A 4DV5Q 3TBIB 1S72A 2QF7A 2A8VA 2QW7A 4B3ML 3T56B 4YHHL 2ZXOA 2F0TA 1CA5A 4RH6A 3PO3G 3K58A 2YTXA 3HOWB 1K8GA 3SGIA 3K57A 1QILA 1NUCA 1X3FA 1WTQA 1LT3D 3EQLC 1Q90A 3SK4A 3KJOA 4K0KQ 2ZT9C 4RFBA 3PUZA 3NPPA 3TN2A 1DZ1A 2E2JH 4HEDA 1KABA 5IYDH 4WJWA 4A3EH 1BNZA 2Z6BA 3R3OA 2I46A 2Z4HA 1E1OA 1YIJA 4M1UB 4JI8Q 1SAPA 2A73B 1PXUA 4QGUA 1AZPA 1XXGA 3PIPA 1NBWA 2PZTA 3M9BA 5C0XH 3SXHA 4LF4Q 4JOIC 2CHBD 5C3EH 4LMQD 3CCSA 4P72A 4JBJA 4BBRH 3U9SA 3C2PA 1DOKA 2JA5B 1KXLA 4Y52H 2D5DA 1GVPA 3S15H 1PYBA 3ND9A 5CV9A 2E2IB 1A8VA 4POGA 4IFDI 5KNBA 1JWSD 1VQCA 4DUYL 3HOWG 2IX3A 3PO2H 5M5XB 2IWHA 4LFAQ 2KBNA 5DM73 4PZ6A 4DV4L 1JQYD 1WD0A 4FF3A 2WAQB 3DHQA 1CK1A 4JI0L 2VS1A 4OWWB 1X9NA 1VQGA 5D65A 1DJRD 1RODA 3OOCA 1XNQL 1CQVA 3OTOL 5FO9B 2EXDA 4YWMA 3SDZA 1O7ZA 4JI2L 2VUMB 1M1KC 3S9WA 2UXDL 4KK7A 2F1MA 1TWGH 3TP7A 2JA5G 1MKHA 1I4QA 1R9TB 2F0PA 1M90C 3GQBA 1EIFA 1WTPA 2L1BA 1ZXTA 4GKKQ 2I5LX 2Z6KC 4MNOA 4Z9CB 2K33A 3WOEA 4DV2L 1SFOH 3JAMi 4BBSB 1SMYC 1CKNB 4DR5Q 2EVBA 5E3FA 3GTKB 3M3YH 2V4DA 3CCLA 3W1BA 3IKJA 5CORA 5IWAQ 3PIP3 2WAQG 1SYFA 2PZWA 1F2YA 4DK3C 4V190 1A3UA 3TREA 3VR2A 1SJHD 4LF8L 1PZKD 5JEAH 4DV3Q 3CCVA 4BY7H 1ZYRD 5IGBA 1EWHA 2X69A 3T53B 4JI4Q 4G7ZC 1VS0A 1Q1BA 3A56A 1OO9B 3K7AB 4V0BA 1I5FA 2VUMG 1B70B 1PFNA 1SYCA 2N3SA 4A3CH 2F4VQ 3DM1A 4L6TB 4ZKCB 3ERQA 3TS2A 2N55A 4IPHA 2HD3A 3L3OC 1EU3A 2PMZB 1BR9A 1IHZA 2EY6A 4NP5A 4DV0L 1IBKL 3UDGA 1TS4A 4DAPA 4JI3L 4BBSG 4AYBE 4EGVA 1HFNA 4YHHQ 5J3BA 4A3BH 3E6ZX 1A15A 2R92B 1E2WA 1NCVA 3ER0A 4QUCA 5JEAJ 2K03A 3H6MA 1STGA 2NVYB 1MGSA 2A69C 2RF4A 2A6ED 2Z9HA 1TWHB 4OEMB 1MJCA 2JXMB 1HR0W 4C3JH 2UU9Q 2YTVA 4CKCA 3S17B 5A2QL 2IJ0A 1LT5D 1AP0A 4LAAA 3J81i 4IO9A 3N6RA 4H0LC 3TDQA 1H9MA 4PMCA 1SROA 4X65L 5CMDA 1E3PA 1W6JA 3T16A 1U4LA 2A1AA 2N8NA 1LACA 4K2KA 4IUQA 3TSSA 5LMNL 2R92G 3PIOA 5IGGA 1VQEA 4LF7L 5E4XA 1PTOB 1HHVA 4DAVA 2PQAB 4A3DB 3HGBA 2H5XA 4GS3A 4F7XA 1VDZA 5EKLA 4K14A 5ELFA 2JQOA 1LT6D 2K5DA 2VB3X 3CKIB 4JI0Q 3R8BA 1F9SA 1O80A 2BCOA 2D62A 1XNQQ 1MI2A 3OTOQ 4JI2Q 1QVCA 3J81L 2UXDQ 3FKIH 1NR4A 2F0HA 1PZJD 1A3TA 5EAYA 1VQIA 4X66L 1XMQL 1B7YB 2F0WA 4PMWA 4RCOA 3KF8B 2VY3A 2VUMH 1JC7A 1K8AC 1C8CA 5E7NA 4X62L 4POFA 1NSNS 3I8ZA 3NE5B 5M5YH 3KK7A 1PFBA 5C3WA 4UP9A 1R9TH 3NBHB 4A3DG 2RVLA 3F8TA 3AYHB 2HIXA 1IBLL 4A3MB 3BJUA 2QEXA 3I7FA 1S5FD 2MUYA 1ICWA 3BZDB 1P16A 4P2CB 1JJGA 4XT3B 3T1HL 1H9SA 3H0GH 4K6DA 1BCPB 2NUCA 4LF8Q 4YY3L 1EIGA 3P7JA 1B2TA 4NKLA 2JA8B 2KCTA 1PTOF 1G6ZA 3KLSA 4RGMA 3PIO3 3S2DB 5T1GA 5IYCG 2B2TC 3D8GA 1HNWQ 3EVQA 3L9AX 1J6QA 3PUXA 4U68A 2EXZA 4L5SA 1EY9A 2NN6I 3GTJB 2RHQB 2MO0A 4RKLA 3K7AH 3EROA 2ZM6L 3ZYYX 4TVAB 4DV0Q 3HOZH 1TQOA 3QB3A 1IBKQ 1GOZA 4DR1Q 3R2TA 2B63B 5IP7G 2KQ3A 3PUYA 4JI3Q 3S2HH 1ET9A 2D9UA 4HMJA 3A54A 4G4KA 1VQAA 2GVAA 3LWEA 4RHSA 4A3MG 1IZ6A 1V1OA 2KCMA 4F87A 4NXML 4LFBL 1EY6A 3UDXA 3FVQA 2YU9B 3D6CA 3BVMA 3S16H 2HDMA 1TWCB 1V1PA 1N32Q 2JA8G 2OTLA 4IUUA 1PVOA 1BBXC 1L0XB 1Y1VH 1XTCD 4EX5A 2PCFB 3SR1A 1STBA 1K3RA 4I7AA 1D5MC 3RUZA 3GTMH 3U9OA 4QIWE 1C48A 1CSQA 4KV6A 2DUDA 4IFDH 4WRDA 3I73A 1JJ2A 3MHBA 1BCPF 3KDFB 2V1CC 4HIMA 3S1QB 3CPWA 1N9WA 3HOXH 4IPCA 2B63G 1BF4A 5C44B 2K5HA 5IODA 2PW5A 5LMNQ 1U9RA 1VMPA 4HJAA 1LV9A 2IT1A 4HJ7A 4KI0A 4A3GH 2KVMA 2PQEA 2A68C 5EJWA 2MNAA 3RZDB 2HIVA 4LF6Q 1YHBA 5LMUQ 1TR5A 2I5MX 5IT9E 1CUKA 1PDQA 3QOJA 1E2ZA 4GOPB 4YIJA 4LFCQ 4IFDJ 3I4MB 3PSIA 4WJ3M 5FJ8G 1YHQA 1MIUA 3EFXD 2EY1A 2NZOA 5BR8L 2J0TD 1BQQT 1VMCA 5C4JH 2F0SA 1F77A 4KHVA 1EYCA 3I70A 3HS0C 4FP5D 4DUZL 1GHKA 3Q8DA 4A76A 2HQLA 3BVZA 3OW7A 3CC7A 5COYA 4X66Q 3EN2A 5C44G 3CCJA 4JYAL 4JC0A 2CW0C 2EJGC 3NK9A 5JJIA 4DNRB 4UP8A 4L5RC 2E74C 5IYCH 3AQQA 4DR7L 1HQRD 3C46A 4X62Q 3S1RB 3GV3A 2KJXA 4XYOA 2RSNA 3FHWA 4O1NA 3J7A5 2ZXRA 4P73A 1YNND 3BZKA 5HY6A 1K8OA 2ZJPA 1VQJA 5CC4A 4OWTB 2Z4IA 3CPFA 4OXPA 1JE5A 3TP6A 1VQ6A 1I6HB 5IP7H 5C6AA 1WVLA 1HFGA 2E2DC 2G9DA 1EY7A 5GAGC 4O42A 3I4MG 1AE2A 5A2QE 3DXJC 1WTHA 3PUWA 3K0XA 4S3SA 3EIVA 2PI2E 3SHLA 5K36H 1EYAA 5GAEC 3GTLB 3MFYA 3HOUB 1RKNA 5ELEA 4NXNL 4FYDA 4XDXA 2Z1CA 3W2DA 1F9PA 2EJMA 5IT9c 5C3XA 3QIAA 2F0LA 1WD1A 2JA8H 1VQ4A 2K28A 1UNSA 1GUSA 1R4PB 3VA5A 1DONA 1YJWA 3H09A 4AYBB 5HGQA 2NVTB 1SYEA 4Q0FA 1N33L 1STAA 3EA6A 1TS3A 2RCNA 1DD2A 4GZYC 1CTMA 2RHSB 3OIPA 1TIID 1G8ZD 3NENA 4B3TL 4LFBQ 5M3MH 2XRQD 1Z6HA 4UDUC 2K75A 1SE4A 1KNEA 2TSSA 3UE0A 4IJHA 4XQQA 1E2VA 1C7YA 3IFDA 1LABA 2VQEL 1EWCA 4QCLA 1LYLA 3A55A 3HOUG 2MHVA 2YU9H 4QUFA 5IP9G 4DR2L 1H9RA 3M7NA 1LTLA 1HA6A 3S1NB 2F0KA 1TWCH 2L15A 2L9HA 4LK1C 2PI2A 5JPNC 1LLRD 3I3CA 1NMGA 4N8X1 4PQXA 4DK6C 3HKZB 4JBWA 4C1NK 4AYBG 4ALPA 1E24A 5C4XH 1UE7A 1GJXA 3I4NH 4ZUIA 2LXJA 1I4XA 4DV7L 1LTAD 4N8FA 1WTOA 3S1QH 1CHQD 5C5MA 5C44H 3E5SA 3QO2A 3GTGH 4C3IH 5CV8A 5JJZA 2WP8J 4R4OA 3QWNA 4A3JB 2Q2HA 3AFPA 3ULJA 3S14H 2VZAA 1K0RA 3I91A 1FNWA 4KY7A 5FKAC 1IBML 2XNAC 3KF6B 5IGDA 1Z9FA 3CMAA 4OO1I 4QJFA 1I4RA 2KCCA 3P75A 5KNCA 1SNOA 1HR0Q 2NWGA 3K81C 1D1IA 2NTTA 3HKZG 5EGTA 1NR2A 3K5LA 4FDBA 1VQFA 4JYAQ 4JK1C 5JAVA 2RBMA 4B3RQ 4CDEC 4J15A 4PMBA 4Q5VA 5EQ0A 2UUBQ 4DR7Q 1YNJC 3NWTA 3TP8A 2NVQB 4B3SL 4O2DA 3PV0A 4DU9A 3F1ZA 5LMNW 4A3IH 3BDCA 1SN8A 4IUTA 3GTQB 4FO2A 4A3JG 1SNCA 1VQBA 3I90A 5AJ3L 2OXPA 1SYGA 2AWNA 2KHJA 4ME3A 2NN6H 4TQUS 2F4IA 4DR4Q 3OIQA 1T9HA 4NXNQ 1IL8A 3MFGA 5EPJA 3MXPA 5FLMG 1F9RA 4FF4A 3HRZC 3M4OH 2M2LA 2Y0SB 2YTYA 1JMCA 5IYBH 1YJNA 1X54A 2EYMA 4JI6Q 5LL6X 3CD6A 1LTSD 3HP3A 1EOVA 2B2TA 1A2TA 4BXXG 4JV5Q 3H3VI 1H9KA 4MN3A 1U4PA 4I65A 3W1GA 4HJ5A 1HXYD 1PFMA 1FGBD 4A75A 1AEXA 4B3TQ 5I6WA 1Y69U 4ZCKA 1H95A 3NTKA 2WKCA 5EKIA 5DM63 1KD1C 4KJNA 2K4KA 3CW2C 2JN4A 1I4GA 4RHRA 2VQEQ 3D3RA 4DPGA 2F0FA 1FVIA 1CQFA 3T1YL 3LGJA 4QIWB 1UWVA 5FLXE 1QZGA 5C4ZA 3BYYB 1FGUA 1LTGD 1XJVA 2Y0SG 1KL9A 2N78A 2LS01 1EOTA 2TMPA 2UXCQ 4RAUC 3PF4A 3CCQA 5K5PA 4GNXA 1B8AA 4RWSC 1EIHA 4FF1A 5C0XJ 3T51B 1WTXA 3IRBA 4R4TA 1HZBA 3GD7A 2A74C 4IJLA 1RTOA 2C9OA 4P71A 3URYA 1RJTA 1HNXQ 1W6KA 2MFIA 2VL6A 3V05A 1PH2A 1GHJA 5L37A 4DV6Q 4MTNA 1I4PA 3SK5A 4BA1I 4KHPL 5CV4A 4H02A 5J39A 4HSPA 2SEBD 2E8GA 1S5CD 4M8AA 4FXDA 1FR3A 1L0YB 2CW0D 2KHSA 1XPRA 3KFUA 3MXNB 1EIYB 4A3LG 3G6EA 1X6OA 3CCUA 1Y1WB 1QVFA 5IE8A 2E2HB 1UE6A 2OWOA 2Q2TA 3J80E 2B2UA 3U4ZA 2BDOA 2DJGC 1GUTA 4FXKC 3STBC 4IZ8A 1GXDC 3PO3H 4C2MB 4BS9A 4FNFA 1EQVA 3K6OA 4OO1G 5FLXc 2X6LA 1TY2A 2RDHA 2EDGA 1D5ZC 4CJ1B 1M4VA 4OIJA 2R93B 2JEAI 1X56A 4B08A 1KDCA 3CQZH 1FJGQ 3ZJYC 1EYDA 4TRDA 3A74A 4H7BA 2NVQH 1VQKA 2VB2X 1VQPA 5JJLA 2JA6B 2EYHA 1U4RA 1PV4A 1S4ZA 1EUJA 4BY1B 1CZGA 4B3MQ 1G6PA 4ZAIA 1B1ZA 3TZDA 3X3NA 4QF4A 1Y1WG 3JAML 4DNTB 3NWSA 3NTIA 1SDFA 1E7ZA 1HA5A 1J5EL 1Q3LA 1Y8OB 1PH3A 2I5HA 1E0BA 2F0UA 2K5NA 4ZK9B 4HIKA 4GKJL 2G9HD 3WOFA 1TWFB 1PZID 2WB1E 4A3FB 3FDTA 4BWGB 4ZUJA 4DR3L 3HOWH 2KOLA 2GN5A 2QEJC 1N8RC 3VYSA 4J8QA 1MBYA 4DXGA 3G7LA 5C5LA 5GQOA 2B2VA 2R93G 4LF9L 5DEHA 1TWAB 2DY8A 4JW0A 3R93A 4IOCA 1Q82C 3RZOB 3J80c 2RKSA 1JOQA 2F0IA 4DKAC 2Z0SA 4RG1A 3HEJA 2LKVA 2JA6G 1X55A 4FXGC 4BY1G 1TXYA 3DLLA 2KECA 2HCCA 3T1YQ 1XNRL 5KEEA 4KTAA 4DUYQ 1GM5A 4FF2A 2WV6D 1MSGA 2JA5H 1I94L 2E2IH 1LTTD 2P5ZX 1HH2P 4AQYL 4DV4Q 1NNXA 4A3FG 1DXMA 1VQHA 3HFZB 3K5NA 2MPMA 4GN5A 4K6LA 5CBAE 5M5XH 2MJ8A 3FMCA 3MAQA 5CGKA 3NELA 1S5BD 2UXBL 4JVZA 5ELDA 2A6HC 2XIWA 4JBMA 4CDFC 1OXXK 1HUNA 2EY5A 4KY6A 5HURA 2NVXB 2ALYB 5FK9C 2ATWA 1OXSC 3DMUA 3NSWA 1D8LA 1V8QA 4OO1H 2K5VA 4HAEA 4X3UA 1Q8IA 4KHPQ 5I2XA 1QUQA 3T13A 4DAYA 3CRKC 1DYQA 4DR6L 1VQ5A 3RR5A 3I56A 2K14A 2F0QA 1SNPA 4DV2Q 2CQOA 4J1MA 4QQBX 4XT1B 2O5JC 1K83B 2E76C 2B2YA 1WTWA 4BBSH 4RMFA 4WFN3 2FJ2A 1Q1EA 3ULLA 1LO5D 4A3KB 3GTKH 1B3QA 3P1HA 4JI1L 2K01A 4AH6A 2B8FA 1YI2A 3TZUA 1EEID 1QG7A 1YITA 3OMGA 1BUVT 1IYVA 4K5WA 1K73C 1B9NA 1MJEA 3D6WA 2BA0A 3QJYA 3CHBD 1YZ6A 1L1OA 3M4QA 1KLGD 3BYTB 4UPAA 1EZ8A 4RGTA 2JA7B 3NQIA 2EPBA 1S3OA 5KYLA 3FRPB 3I55A 5M3FB 4EQPA 1VQDA 1DOLA 5JOBA 3PUVA 1BCPC 4JBKA 3VYTA 2I0QA 2UUAL 3GTPB 1J5EQ 3H3VH 1II3A 1SYDA 4A3KG 2R92H 1X3GA 2CVRA 1N34L 1JCKB 3OMCA 2BH2A 1TVXA 1KC8C 5JJKA 1KDAA 3AMUA 2AUJD 1I3QB 2NVYH 4GNXC 1JOOA 1XMOL 1TWHH 4MZ9A 4A3FH 2MQHA 2F0MA 2ZTDA 1PMRA 3ND8A 1G291 3S17H 1BBUA 4YWKA 4X65Q 4YCUA 4K5VA 1TWAH 3U58A 4EQNA 4X64L 2JA7G 1B9MA 2BE5C 1HQMC 2F3IA 3O13A 4R1JA 1STHA 4KD4A 1VQ7A 3CCEA 4HN7A 1WI5A 5M3FG 2OT2A 3I72A 1QOHA 1H9JA 1Q12A 2R7DA 4ZYSA 1FL0A 2L0CA 4EQOA 2HQEA 4LF7Q 1GUWA 2XVSA 2F0GA 3KBXA 2K32A 2F0OA 1Q81C 3A8IE 3MWYW 4OONA 3J7ZC 2C5CA 4AQYQ 2O2LD 2NB0A 1JWMD 1VQ8A 3DWPA 1CKMA 2B2UC 1PTOH 1YHAA 1KDBA 4A3DH 1G51A 3RN2A 1K9MC 1CA6A 4GN3B 4KN7C 2UXBQ 1X3PA 4CJ0B 2E5LL 4A4IA 2PNHA 1KLUD 3V96A 5H1SE 5J22A 1EWIA 5DAUA 1SMYD 4ZLTF 2B29A 1XMQQ 2B2WA 4DV1L 3HOYB 1B44D 2QDLA 2ZXPA 4K8JA 1JB7A 2NVXH 4DR6Q 1CKOA 4R4IA 1U4MA 5AFWA 3JAME 2EYLA 1K3BC 2AQ3B 4RCNA 2F3VA 2JYOA 2RDFA 2L12A 4ILWA 2NTSA 3CXCA 2R7ZB 1AH9A 4NMZA 1HTPA 1SMXA 1STEA 3A0JA 1FYCA 3KBGA 1IBLQ 4OIKA 4X6AH 3T1HQ 1PH8A 1EY5A 1C9OA 4YY3Q 2BOSA 1SE3A 1EQTA 3E3XA 1VCIA 3RNUA 4A3MH 1P8LA 2EYJA 3D4WA 2F3WA 3PQIA 3KOJA 2EE1A 1ESRA 2J7ZA 2M00A 2B2VC 1BDOA 3J7YW 1V9PA 3F2CA 4CJ2C 3A5ZB 3A5UA 1K0SA 4OHJA 3HOYG 1ZYRC 1EU4A 1QJOA 5T1IA 4LNQA 3J7AV 2ZM6Q 3S2DH 1NE3A 1KTKA 2HCIA 4HCSA 3I4OA 3AEVA 1SJED 2K1BA 5IOCA 2A69D 2M9VA 4DK0A 1I50B 2R7ZG 2OEOA 1ICFB 4TSSA 3GTJH 1GD7A 5I2YA 5CV5A 1EZ6A 1CZWA 4X3SA 4B9WA 2VQFL 2E2JB 2B63H 1RD9D 3OWEB 4A3EB 4NXMQ 1X3QA 2JA7H 1IW7C 1U5KA 2VW9A 1RDPD 4K0KL 4KN4C 1CKNA 5BN4A 1LUZA 2O4XA 2WB1B 3TMEA 1OXTA 3EBEA 3JAMc 4IN3A 2I07B 4P74A 5JPMC 2ICIA 3GTPH 5C3EB 1RL2A 4BBRB 4DXFA 2IX0A 2F0JA 4GN4B 3J81E 2IX1A 1XMOQ 2A19A 3S15B 3CC2A 2A6EC 1PRTC 4O0AA 4LF4L 4JPBW 1I3QH 2XWJB 4IURA 1M8AA 5FJ8H 1IYJB 1KRTA 1Y8PB 4HR7B 4X64Q 2DY7A 4ABNA 2DJFC 1YEZA 4K5XA 2NBFA 1H9SB 1HZ9A 1OTCA 2HT1A 2JJQA 3RD4A 1CFMA 5IYDG 2RDGA 4A3EG 3ICEA 5CYUA 3MEHA 2A6HD 3UE1A 2WB1G 4G7HC 3MZ5A 1IYUA 3TQYA 2L55A 1E22A 2B2YC 1LM0A 1FNUA 1NTGA 5C3EG 2BDNA 3RZDH 1TWGB 1F2LA 1STYA 3VYRA 3VR3A 1SE8A 4BBRG 1KQSA 4HTHA 4CHTB 5IY0A 3P20A 5BR8Q 3U50C 2Q2IA 2E5LQ 5I6YA 3D4RA 2BH8A 2J4XA 5IGEA 1YBYA 1EFID 4DUZQ 1WOCA 1ZKOA 1HZCA 1PHJA 1SFOB 3I4MH 2SNSA 4JG2A 4DFAA 5GADC 4G57A 3OW2A 4GKKL 4KY5A 4DV1Q 4PG3A 1A0IA 1ZEQX 4IPGA 1ILPA 3J81c 1L1OC 1Q8KA 4ODGA 3HG9A 1UAPA 1CI3M 5ELCA 2HUGA 4L63B 4DR5L 4UY8C 4B9XA 4QB4A 3PGZA 3HOYH 1V1PB 4X3TA 5IWAL 4BY7B 3NUCA 1TS2A 3VDYA 4PZ8A 2EY2A 2OQ0A 2XSCA 4L5TA 3S1RH 2FFKB 4RGNA 2AQ1B 1DGSA 1TS5A 2IW3A 1OXUA 3SK6A 3A7LA 2PQAA 2F52A 4IUNA 1OXVA 4IOAA 2F03A 4GLVB 4XQNA 3CCRA 3TS0A 1F2MA 1I6HH 2AHOB 3IFTA 2F4VL 1UUPA 2B39A 4RA8A 5E4WC 4CDCC 2KA7A 4C3HB 3KYHC 4QY7A 5ISRA 2DNEA 4A3BB 5NUCA 3OPOA 3C1EA 2PYKA 1WJJA 4KKSA 3UI2A 3GTLH 3AU7A 3HOUH 2H4OA 5IP9H 1E1TA 1Q7YC 1TKWB 3NHHA 1GUGA 5M5WB 5JEAG 1N33Q 3KF8A 4ID6A 4BY7G 4C56C 5LHY1 4CGYB 4C3JB 2VQFQ 1JOKA 2O5IC 2EOTA 1F2ZA 4JCVE 5LL6S 3RN5A 3ITPA 2NVTH 4A3CG 1D7QA 1I50H 1HNZL 2QA4A 2WACA 5FOBB 3F2BA 3NBHA 3RLNA 1A3VA 2OQKA 2UU9L 1IXRA 5ELBA 3FP9A 3NXWA 1YJ9A 4C3HG 1DM0B 2WKDA 2BE5D 4DR2Q 1VQ9A 1X65A 4NPSA
chains in the Genus database with same CATH topology
2EYPA 1CT1D 4CBVA 5M9OA 1S5ED 2K5WA 2A68D 2AUKA 2QILA 2KCNA 4K2LA 3HOVB 1HCZA 2B2WC 1XWEA 3C1FA 5J1ZA 1BOSA 2K05A 4KKUA 3M4YA 2IPKD 3VR6A 3IAYA 4C3JG 2FMCA 3A8KE 2A5HA 2HDLA 1ONLA 5BN3A 2BA1A 1SNMA 1SYBA 2PNRC 1MSHA 4FVMA 2EJFC 3FKIB 1LT4D 3MVVA 3V2TA 3K5OA 3DUZA 4N9PA 3MXGA 5F2DA 5M5YB 1XX8A 5KYIA 1C4QA 2ICEC 4ZQ3A 5EBCA 3A8JE 1IKLA 2RQXA 2AQ2B 4BA2I 2SDFA 3GV6A 1EL0A 1TU2B 4A93B 1ML0D 3CU7A 3H0GB 1Y8NB 3PMFA 1GUNA 4C1NI 2EYFA 3OSOA 1LTBD 2LMCB 5KNDA 1EY0A 3KLRA 2E75C 2R6GA 5DNFA 2FINB 2H1EA 5IT9L 5A35A 3W3AA 1AZQA 1JORA 3K59A 1YNNC 5EPLA 1RCVD 5CBEE 4J6HA 4L8JA 3QOLA 3F2UA 1JWUD 5EBDA 2LFNA 3HOZB 4R9WA 2L4NA 4XIGS 4IQZA 1D6EC 3S2HB 1G91A 4H44C 3VYUA 1X32A 1EY4A 3Q6SA 3NBIA 3OWFA 1IW7D 3IL8A 2PZUA 1DCZA 2K04A 1QB5D 3S16B 3DEPA 2D2CC 4MIUA 1EY8A 5KIXA 1Y1VB 1D5XC 3H3VC 1ENAA 1PRTD 3CRLC 3GTMB 5CV7A 3RLFA 1GUOA 2JE6I 3HOXB 4DF7A 1QWYA 3BDLA 1UEAB 2PW7A 4CKEA 3H91A 4A3GB 2L11A 4WORA 3NTHA 1HPCA 3M85A 1JB3A 4ULLA 4XXEA 4PV1C 1ET6A 3C3LA 4LJZC 1QE6A 4RKBA 2F0DA 2KEEA 3FEWX 4IUPA 5C4JB 4XYQA 1V43A 3K0YA 4IFDG 5C4HA 1PTOC 1ESFA 1D1KA 3AB9A 3RMHA 2N88A 1TT2A 2JP1A 3KLSX 2Q8RE 1YNJD 1G2SA 2K7VA 3S1MB 1WCMB 1ENCA 1ENFA 4E6IA 5I9OA 1SNDA 1EEFD 1S5DD 3D31A 1MD2D 3G6JB 2XWBB 1BO0A 2WIIB 3OHXC 3MXUA 4X3KA 4IALA 3DWAA 4HSVA 3LNNA 1SSOA 3LWUA 5E1FA 2JEBI 4F88A 1JICA 2KEDA 2SOBA 1HUMA 2ID0A 3MC0B 2R61A 3T4AC 1HTLD 2Q8TA 1QCBD 1FD7D 4MHEA 5JVH3 3VR5A 1NAPA 3DWQA 4N9TA 1K8MA 1VF7A 4TKOB 1SBBB 5M3MB 4NW2A 3GTOB 4QMGA 5G3LF 1WTRA 4IUVA 1LTID 2L5TA 4KHZA 5K36G 1CHPD 3X3MA 1T5EA 3VA7A 2PO4A 4R8IA 3VR4A 4UAIA 1B3AA 4ZRZA 4DK1A 5CR3A 1STNA 2DN8A 5C0XI 4KMUC 3Q22A 5C4XB 2R3ZA 3R2IA 3I4NB 1FNVA 3BVGA 4PNYA 3SEBA 3SE0A 3GTGB 1PYWD 4U673 3FPPA 2RA4A 1HRJA 4C3IB 5D3IB 1RF2D 4OL7A 5I9PA 1I6VC 3S14B 1SXTA 4CKBA 1PLFA 5KRUA 3BG3A 2QDBA 2NZ1D 2Q8IB 2GA4B 2AWOA 1AN8A 2FMMA 4DN4M 1A6XA 4G7OC 1T5XD 5KGUA 2XN9C 2K5QA 2JSOA 1B53A 2F0NA 3BDOA 5FLXL 2FHTA 5TSSA 3A7AB 3N52A 4ME5A 4Y7NB 4C3IG 2KUMA 3ONAB 1SNQA 4KKTA 4A3IB 3Q24A 1KNAA 3FPUB 2X6GA 3TP5A 3WDNA 4R8NA 2QKIC 2IL8A 3SVMA 1B4OA 4OGQC 5EPKA 4K8IA 4KD3A 1Z47A 1CM9A 1KAAA 4RGOS 4HMIA 1BXTA 2EZVA 1LTRD 3M4OB 1ILQA 4DA2A 3MA2B 3QG1A 1JE4A 5IIFA 2OF1A 1IKMA 2K6AA 2ENBA 2Z8LA 1SE2A 3J80L 2MGSA 4NDXA 1PRTB 3MXNA 1J9OA 5CV6A 1RHPA 5BN5A 2MP1A 5IGCA 2WINB 2SNMA 2NN6G 5FO8B 1AW7A 4KJOA 4ZKBB 1AFPA 5D14A 1DOMA 4DGZA 3EJIA 4I7ZC 1SEBD 1G2TA 3PO2B 2NYZD 3GP7A 5IGFA 1XYIA 4XQJA 1JR0D 3DEOA 1I4HA 2VXWA 1F9QA 3M7GA 2YYZA 1D2BA 2F0EA 1J8IA 4EVOA 5C0XG 2CQAA 3MTSA 3J7AF 3NP8A 3KUPA 1PTOD 1QNUA 3L7ZC 1PRTF 3NQTA 1R4QB 1Z7TA 4HCEA 3M3YB 1A2UA 2B8GA 1VF5C 1TY0A 2XRSD 4H13C 3SK8A 1B50A 2F0VA 5FO7B 2EYOA 2LY7A 2DNCA 1QNKA 5EKKA 3PO3B 3I4LA 5G3LD 4F8MA 2RSOA 3D4DA 2VNUD 3BS1A 3CQZB 5HGTA 3GO5A 4XTCS 5I4DA 3K5MA 1O7LA 3HZXA 5D3DA 2QCPX 1RTNA 3E0JA 1O7YA 3Q23A 3LX0A 1WTVA 5JVG3 1BCPD 3Q0AA 2PPBC 1O78A 3H94A 3TBIB 2QF7A 3T56B 2ZXOA 2F0TA 1CA5A 4RH6A 3K58A 3HOWB 3K57A 1QILA 1NUCA 1WTQA 1LT3D 3EQLC 1Q90A 3SK4A 2ZT9C 4RFBA 3PUZA 3NPPA 3TN2A 1DZ1A 4HEDA 1KABA 4WJWA 1BNZA 3R3OA 2I46A 2Z4HA 4M1UB 1SAPA 2A73B 1PXUA 1AZPA 1XXGA 2PZTA 5C0XH 3SXHA 2CHBD 4LMQD 2JA5B 3U9SA 3C2PA 1DOKA 2D5DA 3ND9A 5CV9A 2E2IB 4IFDI 5KNBA 1JWSD 2IX3A 5M5XB 2IWHA 5DM73 1JQYD 1WD0A 4FF3A 2WAQB 3DHQA 1CK1A 5D65A 1DJRD 1RODA 3OOCA 1CQVA 5FO9B 3SDZA 1O7ZA 2VUMB 3S9WA 4KK7A 2F1MA 3TP7A 1I4QA 1R9TB 2F0PA 3GQBA 1WTPA 2L1BA 1ZXTA 4Z9CB 2K33A 3WOEA 4BBSB 1SMYC 2EVBA 5E3FA 3GTKB 2V4DA 3IKJA 5CORA 3PIP3 1SYFA 2PZWA 1F2YA 4V190 1A3UA 3VR2A 1SJHD 1PZKD 5JEAH 1ZYRD 5IGBA 1EWHA 2X69A 3T53B 4G7ZC 3A56A 1Q1BA 3K7AB 1OO9B 4V0BA 1PFNA 1SYCA 3DM1A 4ZKCB 4L6TB 3ERQA 2N55A 3L3OC 1EU3A 2PMZB 1BR9A 1IHZA 2EY6A 4NP5A 1TS4A 4DAPA 4EGVA 1HFNA 3E6ZX 1A15A 2R92B 1E2WA 1NCVA 4QUCA 5JEAJ 2K03A 3H6MA 1STGA 2NVYB 1MGSA 2A69C 2A6ED 1TWHB 2JXMB 4CKCA 3S17B 5A2QL 2IJ0A 1LT5D 1AP0A 4LAAA 3N6RA 4H0LC 3TDQA 1H9MA 4PMCA 5CMDA 1W6JA 3T16A 1U4LA 1LACA 4K2KA 4IUQA 3TSSA 5IGGA 5E4XA 1PTOB 1HHVA 4DAVA 4A3DB 3HGBA 4F7XA 1VDZA 5EKLA 4K14A 5ELFA 1LT6D 2K5DA 2VB3X 3CKIB 3R8BA 1F9SA 1O80A 2BCOA 2D62A 1MI2A 3J81L 1NR4A 2F0HA 1PZJD 1A3TA 2F0WA 4PMWA 4RCOA 1JC7A 1C8CA 1NSNS 3I8ZA 3NE5B 3KK7A 1PFBA 5C3WA 2RVLA 4A3MB 1S5FD 2MUYA 1ICWA 3BZDB 4P2CB 4XT3B 1H9SA 4K6DA 1BCPB 2NUCA 1EIGA 3P7JA 1B2TA 4NKLA 2JA8B 1G6ZA 1PTOF 3KLSA 4RGMA 3PIO3 3S2DB 5T1GA 2B2TC 3D8GA 3EVQA 3L9AX 4U68A 3PUXA 2EXZA 1EY9A 2NN6I 3GTJB 4RKLA 3EROA 3ZYYX 1TQOA 3QB3A 1GOZA 3R2TA 2B63B 2KQ3A 3PUYA 1ET9A 2D9UA 4HMJA 3A54A 4G4KA 3LWEA 4RHSA 1V1OA 4F87A 1EY6A 3FVQA 2YU9B 3D6CA 3BVMA 2HDMA 1TWCB 1V1PA 4IUUA 1BBXC 1L0XB 1XTCD 2PCFB 3SR1A 1STBA 1D5MC 3RUZA 3U9OA 1C48A 4KV6A 4IFDH 4WRDA 3I73A 3MHBA 1BCPF 3S1QB 1BF4A 5C44B 5IODA 2PW5A 1U9RA 1VMPA 1LV9A 2IT1A 4KI0A 2KVMA 2PQEA 2A68C 5EJWA 3RZDB 1TR5A 5IT9E 1PDQA 3QOJA 1E2ZA 4YIJA 4IFDJ 3I4MB 3EFXD 2EY1A 2J0TD 1BQQT 1VMCA 2F0SA 1F77A 4KHVA 1EYCA 3I70A 3HS0C 4FP5D 1GHKA 3BVZA 3OW7A 5COYA 2CW0C 2EJGC 3NK9A 4DNRB 2E74C 1HQRD 3C46A 3S1RB 3GV3A 2KJXA 4XYOA 2RSNA 4O1NA 2ZXRA 1YNND 1K8OA 5CC4A 2Z4IA 3TP6A 1I6HB 5C6AA 1WVLA 1HFGA 2E2DC 2G9DA 1EY7A 4O42A 5A2QE 3DXJC 3PUWA 4S3SA 3SHLA 5K36H 1EYAA 3GTLB 3MFYA 3HOUB 1RKNA 5ELEA 4FYDA 4XDXA 2Z1CA 3W2DA 1F9PA 2EJMA 5C3XA 3QIAA 2F0LA 1WD1A 2K28A 1UNSA 1GUSA 1R4PB 3VA5A 1DONA 3H09A 4AYBB 2NVTB 1SYEA 4Q0FA 1STAA 3EA6A 1TS3A 1DD2A 4GZYC 1CTMA 3OIPA 1TIID 1G8ZD 2XRQD 1Z6HA 4UDUC 1SE4A 1KNEA 2TSSA 4XQQA 1E2VA 3IFDA 1LABA 1EWCA 4QCLA 3A55A 2MHVA 4QUFA 1H9RA 3M7NA 1HA6A 3S1NB 2F0KA 2L9HA 4LK1C 5JPNC 1LLRD 3I3CA 4PQXA 3HKZB 4JBWA 4C1NK 1GJXA 4ZUIA 1I4XA 1LTAD 1WTOA 1CHQD 5C5MA 3E5SA 3QO2A 5CV8A 5JJZA 2WP8J 3QWNA 4A3JB 3I91A 1FNWA 4KY7A 5FKAC 2XNAC 5IGDA 4OO1I 1I4RA 2KCCA 3P75A 5KNCA 1SNOA 2NWGA 1D1IA 2NTTA 5EGTA 1NR2A 3K5LA 4JK1C 5JAVA 2RBMA 4PMBA 4Q5VA 5EQ0A 1YNJC 3NWTA 3TP8A 2NVQB 3PV0A 4DU9A 3BDCA 4IUTA 3GTQB 4FO2A 1SNCA 3I90A 2OXPA 1SYGA 2AWNA 2NN6H 4TQUS 2F4IA 3OIQA 1IL8A 3MFGA 5EPJA 3MXPA 1F9RA 4FF4A 3HRZC 2M2LA 2Y0SB 2EYMA 5LL6X 1LTSD 3HP3A 2B2TA 1A2TA 1H9KA 4MN3A 1U4PA 4I65A 1HXYD 1PFMA 1FGBD 1AEXA 5I6WA 1Y69U 3NTKA 2WKCA 5EKIA 5DM63 4KJNA 1I4GA 4RHRA 3D3RA 2F0FA 1CQFA 4QIWB 5FLXE 5C4ZA 3BYYB 1LTGD 2LS01 1EOTA 2TMPA 4RAUC 5K5PA 4RWSC 1EIHA 4FF1A 5C0XJ 3T51B 1WTXA 3GD7A 2A74C 1RTOA 2C9OA 3URYA 1RJTA 1W6KA 3V05A 1GHJA 1I4PA 3SK5A 4BA1I 5CV4A 5J39A 4HSPA 2SEBD 1S5CD 4M8AA 4FXDA 1FR3A 1L0YB 2CW0D 2KHSA 1Y1WB 2E2HB 3J80E 2B2UA 2BDOA 1GUTA 4FXKC 4IZ8A 1GXDC 4C2MB 4BS9A 4FNFA 1EQVA 3K6OA 4OO1G 2X6LA 1TY2A 2RDHA 2EDGA 1D5ZC 4CJ1B 1M4VA 4OIJA 2R93B 2JEAI 4B08A 1KDCA 1EYDA 4TRDA 4H7BA 2VB2X 2JA6B 2EYHA 1U4RA 1S4ZA 4BY1B 1CZGA 3TZDA 1B1ZA 3X3NA 4ZAIA 4QF4A 3JAML 4DNTB 3NWSA 3NTIA 1SDFA 1HA5A 1Q3LA 1Y8OB 1E0BA 2F0UA 4ZK9B 2G9HD 3WOFA 1TWFB 1PZID 4A3FB 3FDTA 4BWGB 4ZUJA 2KOLA 2QEJC 3VYSA 4J8QA 1MBYA 4DXGA 3G7LA 5C5LA 2B2VA 5DEHA 1TWAB 2DY8A 3R93A 3RZOB 1JOQA 2RKSA 2F0IA 3HEJA 2LKVA 4FXGC 2KECA 2HCCA 5KEEA 4KTAA 4FF2A 2WV6D 1MSGA 1LTTD 1DXMA 3K5NA 2MPMA 4K6LA 5CBAE 2MJ8A 3FMCA 3MAQA 5CGKA 1S5BD 5ELDA 2A6HC 2XIWA 1OXXK 1HUNA 2EY5A 4KY6A 5HURA 2NVXB 5FK9C 1OXSC 3DMUA 3NSWA 1V8QA 4OO1H 4HAEA 4X3UA 1Q8IA 5I2XA 3T13A 4DAYA 3CRKC 1DYQA 2F0QA 1SNPA 4J1MA 4XT1B 2O5JC 1K83B 2E76C 2B2YA 1WTWA 4WFN3 2FJ2A 1Q1EA 1LO5D 4A3KB 3P1HA 2K01A 2B8FA 3TZUA 1EEID 1QG7A 3OMGA 1BUVT 1IYVA 4K5WA 1B9NA 3D6WA 2BA0A 3QJYA 3CHBD 1KLGD 3BYTB 1EZ8A 4RGTA 2JA7B 3NQIA 2EPBA 5KYLA 3FRPB 5M3FB 4EQPA 1DOLA 5JOBA 3PUVA 1BCPC 3VYTA 3GTPB 1II3A 1SYDA 2CVRA 1JCKB 3OMCA 1TVXA 1KDAA 3AMUA 2AUJD 1I3QB 1JOOA 2F0MA 1PMRA 3ND8A 1G291 4K5VA 4EQNA 1B9MA 2BE5C 1HQMC 3O13A 1STHA 4KD4A 4HN7A 2OT2A 3I72A 1QOHA 1H9JA 1Q12A 4ZYSA 2L0CA 4EQOA 2HQEA 1GUWA 2XVSA 2F0GA 3KBXA 2K32A 2F0OA 3A8IE 3MWYW 2C5CA 2O2LD 2NB0A 1JWMD 3DWPA 2B2UC 1PTOH 1KDBA 1CA6A 4KN7C 1X3PA 4CJ0B 1KLUD 3V96A 5J22A 5DAUA 1SMYD 4ZLTF 2B2WA 3HOYB 1B44D 2ZXPA 4K8JA 1U4MA 5AFWA 3JAME 2EYLA 2AQ3B 4RCNA 2F3VA 2JYOA 2RDFA 2L12A 4ILWA 2NTSA 2R7ZB 4NMZA 1HTPA 1STEA 1FYCA 3KBGA 4OIKA 1EY5A 2BOSA 1SE3A 1EQTA 1VCIA 2EYJA 3D4WA 2F3WA 2EE1A 1ESRA 2J7ZA 2M00A 2B2VC 1BDOA 3J7YW 4CJ2C 4OHJA 1ZYRC 1EU4A 1QJOA 5T1IA 3J7AV 1KTKA 2HCIA 4HCSA 5IOCA 1SJED 2K1BA 2A69D 2M9VA 4DK0A 1I50B 2OEOA 4TSSA 5I2YA 5CV5A 1EZ6A 1CZWA 4X3SA 4B9WA 2E2JB 1RD9D 3OWEB 4A3EB 1X3QA 1IW7C 1RDPD 4KN4C 5BN4A 2O4XA 2WB1B 3TMEA 1OXTA 4IN3A 2I07B 5JPMC 2ICIA 5C3EB 4BBRB 4DXFA 2IX0A 2F0JA 3J81E 2IX1A 3S15B 2A6EC 1PRTC 2XWJB 4IURA 1M8AA 1Y8PB 4HR7B 2DY7A 4ABNA 4K5XA 2NBFA 1H9SB 3RD4A 1CFMA 2RDGA 5CYUA 3MEHA 2A6HD 4G7HC 3MZ5A 1IYUA 2L55A 2B2YC 1FNUA 2BDNA 1TWGB 1F2LA 1STYA 3VYRA 3VR3A 4HTHA 4CHTB 3P20A 5I6YA 3D4RA 2J4XA 5IGEA 1EFID 1SFOB 1ZKOA 2SNSA 4DFAA 4G57A 4KY5A 1ZEQX 1ILPA 4ODGA 3HG9A 1UAPA 1CI3M 5ELCA 2HUGA 4L63B 4B9XA 4QB4A 1V1PB 4X3TA 4BY7B 3NUCA 1TS2A 2EY2A 2XSCA 2FFKB 4RGNA 2AQ1B 1TS5A 2IW3A 1OXUA 3SK6A 3A7LA 4IUNA 1OXVA 2F03A 4XQNA 1F2MA 3IFTA 1UUPA 2B39A 4RA8A 5E4WC 2KA7A 4C3HB 5ISRA 2DNEA 4A3BB 5NUCA 3OPOA 3C1EA 2PYKA 4KKSA 3UI2A 3AU7A 2H4OA 1TKWB 3NHHA 1GUGA 5M5WB 5JEAG 3KF8A 4ID6A 4C56C 5LHY1 4CGYB 4C3JB 1JOKA 2O5IC 2EOTA 1F2ZA 5LL6S 3ITPA 2WACA 5FOBB 3NBHA 1A3VA 5ELBA 3NXWA 1DM0B 2WKDA 2BE5D 4C3HG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYF A;  1STY A;  2PZW A;  3TP8 A;  5KRU A;  3VA5 A;  4EQP A;  2EYP A;  3OWF A;  1F2Y A;  4KV6 A;  4HTH A;  1A3U A;  2QDB A;  4WRD A;  5JOB A;  5IGF A;  4DU9 A;  3MHB A;  1EY5 A;  5M9O A;  1NUC A;  3SK5 A;  2PZU A;  1SYE A;  5CV4 A;  5KEE A;  5J39 A;  4KTA A;  5I6Y A;  1II3 A;  3BDC A;  1SYD A;  3SK4 A;  5IGB A;  5IGE A;  2EYJ A;  2F0H A;  4K2L A;  1STA A;  1A3T A;  1SNC A;  2F3W A;  3D4W A;  4IAL A;  4MIU A;  2SNS A;  4DFA A;  5IOD A;  1EY8 A;  2PW5 A;  5KIX A;  1SYC A;  5KGU A;  1U9R A;  3C1F A;  5J1Z A;  3OMC A;  2KHS A;  2F0W A;  2M00 A;  2OXP A;  1SYG A;  3ERQ A;  4G57 A;  1KAB A;  1KDA A;  4KY5 A;  2F0E A;  3R3O A;  2F0N A;  1JOO A;  2PQE A;  1ENA A;  5E1F A;  4EVO A;  4ODG A;  5CV7 A;  1NSN S;  1IHZ A;  2SOB A;  2EY6 A;  4NP5 A;  5C3W A;  1TR5 A;  2F0M A;  5CGK A;  4ME5 A;  1SNM A;  1SYB A;  2PZT A;  5IOC A;  3MXP A;  4QB4 A;  1SNQ A;  3SXH A;  3NP8 A;  4B9X A;  3QOJ A;  4DF7 A;  4IZ8 A;  3NUC A;  3BDL A;  2OEO A;  4K5V A;  4YIJ A;  1EQV A;  2EY2 A;  2EY5 A;  4KY6 A;  5HUR A;  2F0K A;  4EQN A;  5CV5 A;  1EZ6 A;  3TP5 A;  2EY1 A;  5CV9 A;  3DMU A;  4N9T A;  4R8N A;  2EYM A;  4K6D A;  4B9W A;  2PW7 A;  1STH A;  3H6M A;  1STG A;  2NUC A;  3NQT A;  4KD4 A;  3SK6 A;  2F0S A;  4IUN A;  3MVV A;  3V2T A;  4KHV A;  1KDC A;  1EYC A;  4NKL A;  1A2T A;  4K8I A;  4EQO A;  3T13 A;  2HQE A;  4N9P A;  1EYD A;  4KD3 A;  4TRD A;  2O4X A;  4QMG A;  2F0G A;  4WOR A;  1F2M A;  1A2U A;  4I65 A;  1KAA A;  4H7B A;  5F2D A;  3SK8 A;  2F0Q A;  1SNP A;  4HMI A;  3TME A;  5KYI A;  2F0O A;  4ZQ3 A;  4J1M A;  2F0V A;  3D8G A;  4ZUI A;  3EVQ A;  2EYO A;  1AEX A;  2EYH A;  3NK9 A;  5I6W A;  2EXZ A;  4LAA A;  3DHQ A;  5EKK A;  1EY9 A;  5C5M A;  3E5S A;  5ISR A;  4F8M A;  2F0J A;  5NUC A;  4RKL A;  4RKB A;  3C1E A;  2PYK A;  1KDB A;  5IIF A;  3ERO A;  4KJN A;  4QF4 A;  2F0D A;  2OF1 A;  3D4D A;  4PMC A;  5CV8 A;  1TQO A;  3QB3 A;  3PMF A;  2KQ3 A;  5CR3 A;  2F0F A;  2EYF A;  5CC4 A;  3NHH A;  1STN A;  2ENB A;  3OSO A;  5C4H A;  5HGT A;  3P1H A;  3TP6 A;  4HMJ A;  3T16 A;  3S9W A;  2F0U A;  3U9O A;  1EY0 A;  5J22 A;  4NDX A;  5C6A A;  5DAU A;  4ID6 A;  4K2K A;  5C4Z A;  3HZX A;  3TP7 A;  4K5X A;  4KY7 A;  4ZUJ A;  1JOK A;  1EY7 A;  5CV6 A;  2F0P A;  3OMG A;  1TT2 A;  1F2Z A;  5IGD A;  1EY6 A;  5IGG A;  1JOR A;  3ITP A;  5C5L A;  4K5W A;  4PNY A;  5IGC A;  3D6C A;  3P75 A;  4S3S A;  1SNO A;  2WAC A;  4J6H A;  4K8J A;  5DEH A;  3QOL A;  3SHL A;  3LX0 A;  1JOQ A;  1EYA A;  2SNM A;  2RKS A;  3MEH A;  1A3V A;  5K5P A;  5EGT A;  4F7X A;  1RKN A;  1ENC A;  2F0I A;  4KJO A;  2EYL A;  4OL7 A;  4E6I A;  5I9O A;  2F3V A;  2RDF A;  5EKL A;  5JAV A;  1EZ8 A;  2RBM A;  3MZ5 A;  3NXW A;  1SND A;  4K14 A;  4NMZ A;  5E3F A;  5C3X A;  5I9P A;  2F0L A;  4DGZ A;  3HEJ A;  3SR1 A;  2LKV A;  1STB A;  3EJI A;  4PMB A;  1EY4 A;  5KYL A;  3RUZ A;  2F0T A; 
#chains in the Genus database with same CATH topology
 1W2B A;  2EYP A;  4A3B G;  1CT1 D;  4CBV A;  5M9O A;  1S5E D;  2K5W A;  2A68 D;  2AUK A;  2QIL A;  2KCN A;  1RIP A;  2GVB A;  1PH1 A;  4K2L A;  1ASZ A;  3S1N H;  3HOV B;  1HCZ A;  4PZ7 A;  2B2W C;  1XWE A;  4JI7 L;  2N49 A;  3C1F A;  5J1Z A;  1BOS A;  2K05 A;  4KKU A;  3M4Y A;  2IPK D;  3VR6 A;  4DV7 Q;  3IAY A;  4C3J G;  2FMC A;  1QVG A;  3A8K E;  2A5H A;  4OX9 L;  2HDL A;  1ONL A;  5BN3 A;  3BZC A;  2BA1 A;  1SNM A;  1SYB A;  2AMC B;  2PNR C;  1MSH A;  1SR3 A;  2CKZ B;  4FVM A;  2EJF C;  2QGQ A;  3FKI B;  1NJI C;  3E9I A;  3RLO A;  4LUO A;  1IBM Q;  1LT4 D;  3MVV A;  3V2T A;  4A3J H;  3K5O A;  1VQO A;  3DUZ A;  4N9P A;  3MXG A;  5F2D A;  5M5Y B;  1XX8 A;  5KYI A;  1C4Q A;  2ICE C;  4ZQ3 A;  5EBC A;  3A8J E;  3HOV G;  2IHF A;  1IKL A;  4OWX B;  2RQX A;  2AQ2 B;  4BA2 I;  2SDF A;  3GV6 A;  1EL0 A;  1TU2 B;  4A93 B;  1ML0 D;  1X3E A;  3CU7 A;  5ELN A;  3KDF A;  3H0G B;  5FLM H;  1Y8N B;  3PMF A;  4B3S Q;  1GUN A;  1WYD A;  4C1N I;  1S40 A;  2EYF A;  3OSO A;  1LTB D;  2LMC B;  2AKW B;  5KND A;  2IY5 B;  1EY0 A;  3KLR A;  2E75 C;  2R6G A;  3FKI G;  5DNF A;  2FIN B;  2H1E A;  5IT9 L;  5A35 A;  1IL2 A;  3W3A A;  5AJ3 Q;  4BXX H;  4HID A;  1AZQ A;  1JOR A;  3K59 A;  1YNN C;  2EIF A;  1RCV D;  5EPL A;  5CBE E;  4J6H A;  5ELO A;  4L8J A;  1PH9 A;  3QOL A;  3GTQ H;  3F2U A;  1JWU D;  5EBD A;  2IHE A;  2LFN A;  3HOZ B;  4R9W A;  2L4N A;  4XIG S;  4GOP A;  1HNW L;  4IQZ A;  3ERS X;  1D6E C;  3S2H B;  1G91 A;  3S24 A;  4H44 C;  3VYU A;  1X32 A;  1EY4 A;  3Q6S A;  3NBI A;  4DR1 L;  4A93 G;  3OWF A;  1IW7 D;  3IL8 A;  2KEN A;  4C3H H;  3H0G G;  2PZU A;  1DCZ A;  2K04 A;  2LSS A;  3J81 j;  4LW1 A;  1QB5 D;  3S16 B;  3DEP A;  2D2C C;  4MIU A;  3ULP A;  1EY8 A;  5KIX A;  3D0F A;  1Y1V B;  1D5X C;  1W3S A;  2MO1 A;  1HNZ Q;  4HIO A;  3H3V C;  1ENA A;  1QZH A;  1PRT D;  5M5W H;  3CRL C;  3GTM B;  5CV7 A;  1N32 L;  1PH6 A;  2ASB A;  4L5Q A;  3RLF A;  1GUO A;  2JE6 I;  3HOZ G;  3HOX B;  4DF7 A;  1QWY A;  3BDL A;  1UE5 A;  2G5D A;  1UEA B;  2PW7 A;  4CKE A;  3H91 A;  1K28 A;  4A3G B;  2L11 A;  3CME A;  4KLK A;  3HKZ E;  4WOR A;  1EYG A;  3NTH A;  1WFQ A;  4JI7 Q;  1HPC A;  4A3L H;  1UEB A;  3M85 A;  1JB3 A;  4ULL A;  4XXE A;  4PV1 C;  5GRO A;  1ET6 A;  3C3L A;  4LJZ C;  1QE6 A;  1Y1V G;  3K80 C;  3HOV H;  4RKB A;  4LF6 L;  5LMU L;  4OX9 Q;  2F0D A;  2KEE A;  1JT8 A;  3FEW X;  1SRU A;  4IUP A;  4EQ5 A;  5C4J B;  4XYQ A;  1V43 A;  3K0Y A;  4IFD G;  1VQM A;  5C4H A;  1GO3 E;  4LFC L;  3HOX G;  1PTO C;  1ESF A;  1MHW C;  1D1K A;  3AB9 A;  1AE3 A;  3RMH A;  4UHV A;  2N88 A;  1TT2 A;  2JP1 A;  2NZH A;  3KLS X;  4NB3 A;  2Q8R E;  1YNJ D;  3F2D A;  1G2S A;  2K7V A;  4R4Q A;  1A62 A;  3PF5 A;  3S1M B;  1WCM B;  4A3G G;  3CP0 A;  1ENC A;  3HKS A;  1ENF A;  4E6I A;  5I9O A;  1SND A;  4GLA C;  3U4V A;  3M4P A;  1EEF D;  1S5D D;  3BU2 A;  3D31 A;  1Y1W H;  1NMF A;  2E2H H;  1MD2 D;  3G6J B;  2UUC L;  2XWB B;  1GKH A;  1BVS A;  1BO0 A;  2WII B;  3OHX C;  3MXU A;  4A93 H;  4C2M H;  4X3K A;  2YV5 A;  4IAL A;  3OYY A;  3DWA A;  4HSV A;  3LNN A;  1SSO A;  3LWU A;  2ZTC A;  2R93 H;  4WJ4 A;  5E1F A;  2JEB I;  4F88 A;  1JIC A;  2KED A;  2SOB A;  3B6Y A;  2D0P A;  3I2Z A;  4P75 A;  1EFW A;  1N36 L;  3MC0 B;  1HUM A;  2ID0 A;  2R61 A;  1WCM G;  3GDE A;  3T4A C;  1HTL D;  4GNX B;  2JA6 H;  2Q8T A;  1QCB D;  4R4C A;  1EQQ A;  4OEL B;  1FD7 D;  4MHE A;  1NY4 A;  5JVH 3;  3VR5 A;  4BY1 H;  1NAP A;  3DWQ A;  2Y0S E;  3KF6 A;  4GKJ Q;  4N9T A;  1K8M A;  1VF7 A;  4DR3 Q;  4TKO B;  1SBB B;  5M3M B;  4NW2 A;  3K8A A;  3GTO B;  4QMG A;  5G3L F;  4LF9 Q;  1WTR A;  4IUV A;  1LTI D;  2L5T A;  1TWF H;  4HJ8 A;  4KHZ A;  5K36 G;  1CHP D;  2EQS A;  3X3M A;  1T5E A;  3UDF A;  2K50 A;  3VA7 A;  2CFM A;  2PO4 A;  4R8I A;  3VR4 A;  4UAI A;  1B3A A;  4ZRZ A;  3RZO H;  4DK1 A;  5CR3 A;  1STN A;  2DN8 A;  5C0X I;  1XNR Q;  4KMU C;  3Q22 A;  5C4X B;  2R3Z A;  2R7F A;  1L2F A;  3R2I A;  1V1Q A;  2WFW A;  3I4N B;  1I94 Q;  2ZJQ A;  1HZA A;  2ZJR A;  1FNV A;  3BVG A;  3W5O A;  1BKB A;  4PNY A;  3SEB A;  3SE0 A;  2WAQ E;  4YCV A;  4HJ9 A;  1PYW D;  3GTG B;  4U67 3;  3FPP A;  2RA4 A;  1HRJ A;  1PYS B;  5M3M G;  4C3I B;  5D3I B;  1RF2 D;  4OL7 A;  4DAM A;  3CF5 A;  5I9P A;  1I6V C;  3S14 B;  1SXT A;  4CKB A;  3TRZ A;  4JOI A;  4GLX A;  1PH4 A;  1PLF A;  5KRU A;  1BBW A;  2K52 A;  4QL5 A;  3BG3 A;  2QDB A;  2NZ1 D;  4YCW A;  2Q8I B;  4CDD C;  2GA4 B;  2AWO A;  3H15 A;  1AN8 A;  2FMM A;  4DN4 M;  1A6X A;  1EQR A;  2CH4 A;  3KJP A;  4G7O C;  2XTI A;  3UDI A;  1T5X D;  1C0A A;  5KGU A;  3E9H A;  3STB D;  2XN9 C;  5C4X G;  2K5Q A;  2JSO A;  3I4N G;  1A63 A;  1B53 A;  2ZTE A;  2F0N A;  1HR0 L;  3BDO A;  5FLX L;  3J80 i;  1KHI A;  4GOP C;  2JA9 A;  2FHT A;  5TSS A;  2KHI A;  3A7A B;  3N52 A;  3PCO B;  4ME5 A;  1VQL A;  4Y7N B;  1SLJ A;  2HHH L;  4B3R L;  4C3I G;  2KUM A;  3ONA B;  1SNQ A;  4KKT A;  1K83 H;  4A3I B;  3Q24 A;  2B3G A;  2UUB L;  4LF5 L;  1KNA A;  1UE1 A;  3CC4 A;  3FPU B;  4JI1 Q;  3S1M H;  1WCM H;  2X6G A;  3TP5 A;  3WDN A;  4R8N A;  2UUC Q;  2QKI C;  2IL8 A;  3SVM A;  1JJC B;  1B4O A;  4JI5 L;  4LWC A;  4OGQ C;  5EPK A;  4A3K H;  2LXK A;  4K8I A;  1ASY A;  4KD3 A;  1Z47 A;  2Z6K A;  1CM9 A;  2CWA A;  1KAA A;  2RCF A;  4RGO S;  4APV A;  3JC6 6;  4HMI A;  1BXT A;  2PMZ E;  4DV5 L;  2EZV A;  1LTR D;  4UP7 A;  3M4O B;  1ILQ A;  4DA2 A;  3MA2 B;  2CH4 W;  3QG1 A;  4DR4 L;  1JE4 A;  5IIF A;  1HJP A;  2OF1 A;  1IKM A;  2K6A A;  1N36 Q;  3G4S A;  1XPO A;  2ENB A;  2Z8L A;  1SE2 A;  2UUA Q;  3J80 L;  2MGS A;  4NDX A;  1PRT B;  4A3I G;  3MXN A;  5M3F H;  5GAH C;  4JI6 L;  1N34 Q;  1J9O A;  3E0E A;  5CV6 A;  1Q46 A;  2OCE A;  4JV5 L;  1RHP A;  5BN5 A;  2MP1 A;  5IGC A;  3TEH B;  1KAW A;  4JI8 L;  2WIN B;  2ES2 A;  2SNM A;  2NN6 G;  3G48 A;  5FO8 B;  1Q86 C;  2CCZ A;  1AW7 A;  1XTD A;  1QUQ B;  4KJO A;  4ZKB B;  4DAY B;  1AFP A;  5D14 A;  1PA6 A;  2D0O A;  5DLQ E;  3WWV A;  1DOM A;  3AFQ A;  4DGZ A;  3EJI A;  4I7Z C;  1SEB D;  1G2T A;  1PFS A;  3GTO H;  3PO2 B;  2NYZ D;  3GP7 A;  3NEM A;  3K7U C;  5IYB G;  5IGF A;  1XYI A;  4XQJ A;  1YVC A;  1O7I A;  3MEF A;  1JR0 D;  2OTJ A;  3DEO A;  1I4H A;  3QR8 A;  2VXW A;  3CAM A;  1KRS A;  4LFA L;  1F9Q A;  2JK8 A;  3M7G A;  2CWP A;  2YYZ A;  1VQN A;  3CCM A;  2UXC L;  1D2B A;  2F0E A;  1J8I A;  2FXQ A;  4EVO A;  5C0X G;  2CQA A;  3L2P A;  4YWL A;  2XGT A;  1CSP A;  3MTS A;  3J7A F;  1HNX L;  3NP8 A;  3KUP A;  1PTO D;  1L1O B;  1QNU A;  3L7Z C;  4DV6 L;  1PRT F;  3PO2 G;  3NQT A;  4DNI A;  1R4Q B;  1Z7T A;  1KIX A;  4HCE A;  3M3Y B;  4IPD A;  1L0W A;  3KLW A;  1A2U A;  2B8G A;  1VF5 C;  1TY0 A;  2XRS D;  4H13 C;  3SK8 A;  1B50 A;  2F0V A;  5FO7 B;  3G71 A;  2EYO A;  2LY7 A;  2DNC A;  1QNK A;  5EKK A;  2Q2U A;  3PO3 B;  3I4L A;  5G3L D;  4F8M A;  2RSO A;  1PH5 A;  1YNX A;  3D4D A;  2VNU D;  2DGY A;  2HHH Q;  3BS1 A;  2R7Z H;  3CQZ B;  4LUV A;  4DV3 L;  5HGT A;  3GO5 A;  4XTC S;  4LF5 Q;  5I4D A;  4JI4 L;  3K5M A;  3L0O A;  4LUZ A;  1O7L A;  3HZX A;  1U0L A;  5D3D A;  4Y7N H;  1PH7 A;  1Y14 B;  2QCP X;  3DM3 A;  4JI5 Q;  1FJG L;  4MTK A;  1RTN A;  3E0J A;  1O7Y A;  3Q23 A;  3LX0 A;  1WTV A;  5JVG 3;  1XPU A;  1BCP D;  3Q0A A;  2PPB C;  1O78 A;  2C35 B;  4AIM A;  3H94 A;  4DV5 Q;  3TBI B;  1S72 A;  2QF7 A;  2A8V A;  2QW7 A;  4B3M L;  3T56 B;  4YHH L;  2ZXO A;  2F0T A;  1CA5 A;  4RH6 A;  3PO3 G;  3K58 A;  2YTX A;  3HOW B;  1K8G A;  3SGI A;  3K57 A;  1QIL A;  1NUC A;  1X3F A;  1WTQ A;  1LT3 D;  3EQL C;  1Q90 A;  3SK4 A;  3KJO A;  4K0K Q;  2ZT9 C;  4RFB A;  3PUZ A;  3NPP A;  3TN2 A;  1DZ1 A;  2E2J H;  4HED A;  1KAB A;  5IYD H;  4WJW A;  4A3E H;  1BNZ A;  2Z6B A;  3R3O A;  2I46 A;  2Z4H A;  1E1O A;  1YIJ A;  4M1U B;  4JI8 Q;  1SAP A;  2A73 B;  1PXU A;  4QGU A;  1AZP A;  1XXG A;  3PIP A;  1NBW A;  2PZT A;  3M9B A;  5C0X H;  3SXH A;  4LF4 Q;  4JOI C;  2CHB D;  5C3E H;  4LMQ D;  3CCS A;  4P72 A;  4JBJ A;  4BBR H;  3U9S A;  3C2P A;  1DOK A;  2JA5 B;  1KXL A;  4Y52 H;  2D5D A;  1GVP A;  3S15 H;  1PYB A;  3ND9 A;  5CV9 A;  2E2I B;  1A8V A;  4POG A;  4IFD I;  5KNB A;  1JWS D;  1VQC A;  4DUY L;  3HOW G;  2IX3 A;  3PO2 H;  5M5X B;  2IWH A;  4LFA Q;  2KBN A;  5DM7 3;  4PZ6 A;  4DV4 L;  1JQY D;  1WD0 A;  4FF3 A;  2WAQ B;  3DHQ A;  1CK1 A;  4JI0 L;  2VS1 A;  4OWW B;  1X9N A;  1VQG A;  5D65 A;  1DJR D;  1ROD A;  3OOC A;  1XNQ L;  1CQV A;  3OTO L;  5FO9 B;  2EXD A;  4YWM A;  3SDZ A;  1O7Z A;  4JI2 L;  2VUM B;  1M1K C;  3S9W A;  2UXD L;  4KK7 A;  2F1M A;  1TWG H;  3TP7 A;  2JA5 G;  1MKH A;  1I4Q A;  1R9T B;  2F0P A;  1M90 C;  3GQB A;  1EIF A;  1WTP A;  2L1B A;  1ZXT A;  4GKK Q;  2I5L X;  2Z6K C;  4MNO A;  4Z9C B;  2K33 A;  3WOE A;  4DV2 L;  1SFO H;  3JAM i;  4BBS B;  1SMY C;  1CKN B;  4DR5 Q;  2EVB A;  5E3F A;  3GTK B;  3M3Y H;  2V4D A;  3CCL A;  3W1B A;  3IKJ A;  5COR A;  5IWA Q;  3PIP 3;  2WAQ G;  1SYF A;  2PZW A;  1F2Y A;  4DK3 C;  4V19 0;  1A3U A;  3TRE A;  3VR2 A;  1SJH D;  4LF8 L;  1PZK D;  5JEA H;  4DV3 Q;  3CCV A;  4BY7 H;  1ZYR D;  5IGB A;  1EWH A;  2X69 A;  3T53 B;  4JI4 Q;  4G7Z C;  1VS0 A;  1Q1B A;  3A56 A;  1OO9 B;  3K7A B;  4V0B A;  1I5F A;  2VUM G;  1B70 B;  1PFN A;  1SYC A;  2N3S A;  4A3C H;  2F4V Q;  3DM1 A;  4L6T B;  4ZKC B;  3ERQ A;  3TS2 A;  2N55 A;  4IPH A;  2HD3 A;  3L3O C;  1EU3 A;  2PMZ B;  1BR9 A;  1IHZ A;  2EY6 A;  4NP5 A;  4DV0 L;  1IBK L;  3UDG A;  1TS4 A;  4DAP A;  4JI3 L;  4BBS G;  4AYB E;  4EGV A;  1HFN A;  4YHH Q;  5J3B A;  4A3B H;  3E6Z X;  1A15 A;  2R92 B;  1E2W A;  1NCV A;  3ER0 A;  4QUC A;  5JEA J;  2K03 A;  3H6M A;  1STG A;  2NVY B;  1MGS A;  2A69 C;  2RF4 A;  2A6E D;  2Z9H A;  1TWH B;  4OEM B;  1MJC A;  2JXM B;  1HR0 W;  4C3J H;  2UU9 Q;  2YTV A;  4CKC A;  3S17 B;  5A2Q L;  2IJ0 A;  1LT5 D;  1AP0 A;  4LAA A;  3J81 i;  4IO9 A;  3N6R A;  4H0L C;  3TDQ A;  1H9M A;  4PMC A;  1SRO A;  4X65 L;  5CMD A;  1E3P A;  1W6J A;  3T16 A;  1U4L A;  2A1A A;  2N8N A;  1LAC A;  4K2K A;  4IUQ A;  3TSS A;  5LMN L;  2R92 G;  3PIO A;  5IGG A;  1VQE A;  4LF7 L;  5E4X A;  1PTO B;  1HHV A;  4DAV A;  2PQA B;  4A3D B;  3HGB A;  2H5X A;  4GS3 A;  4F7X A;  1VDZ A;  5EKL A;  4K14 A;  5ELF A;  2JQO A;  1LT6 D;  2K5D A;  2VB3 X;  3CKI B;  4JI0 Q;  3R8B A;  1F9S A;  1O80 A;  2BCO A;  2D62 A;  1XNQ Q;  1MI2 A;  3OTO Q;  4JI2 Q;  1QVC A;  3J81 L;  2UXD Q;  3FKI H;  1NR4 A;  2F0H A;  1PZJ D;  1A3T A;  5EAY A;  1VQI A;  4X66 L;  1XMQ L;  1B7Y B;  2F0W A;  4PMW A;  4RCO A;  3KF8 B;  2VY3 A;  2VUM H;  1JC7 A;  1K8A C;  1C8C A;  5E7N A;  4X62 L;  4POF A;  1NSN S;  3I8Z A;  3NE5 B;  5M5Y H;  3KK7 A;  1PFB A;  5C3W A;  4UP9 A;  1R9T H;  3NBH B;  4A3D G;  2RVL A;  3F8T A;  3AYH B;  2HIX A;  1IBL L;  4A3M B;  3BJU A;  2QEX A;  3I7F A;  1S5F D;  2MUY A;  1ICW A;  3BZD B;  1P16 A;  4P2C B;  1JJG A;  4XT3 B;  3T1H L;  1H9S A;  3H0G H;  4K6D A;  1BCP B;  2NUC A;  4LF8 Q;  4YY3 L;  1EIG A;  3P7J A;  1B2T A;  4NKL A;  2JA8 B;  2KCT A;  1PTO F;  1G6Z A;  3KLS A;  4RGM A;  3PIO 3;  3S2D B;  5T1G A;  5IYC G;  2B2T C;  3D8G A;  1HNW Q;  3EVQ A;  3L9A X;  1J6Q A;  3PUX A;  4U68 A;  2EXZ A;  4L5S A;  1EY9 A;  2NN6 I;  3GTJ B;  2RHQ B;  2MO0 A;  4RKL A;  3K7A H;  3ERO A;  2ZM6 L;  3ZYY X;  4TVA B;  4DV0 Q;  3HOZ H;  1TQO A;  3QB3 A;  1IBK Q;  1GOZ A;  4DR1 Q;  3R2T A;  2B63 B;  5IP7 G;  2KQ3 A;  3PUY A;  4JI3 Q;  3S2H H;  1ET9 A;  2D9U A;  4HMJ A;  3A54 A;  4G4K A;  1VQA A;  2GVA A;  3LWE A;  4RHS A;  4A3M G;  1IZ6 A;  1V1O A;  2KCM A;  4F87 A;  4NXM L;  4LFB L;  1EY6 A;  3UDX A;  3FVQ A;  2YU9 B;  3D6C A;  3BVM A;  3S16 H;  2HDM A;  1TWC B;  1V1P A;  1N32 Q;  2JA8 G;  2OTL A;  4IUU A;  1PVO A;  1BBX C;  1L0X B;  1Y1V H;  1XTC D;  4EX5 A;  2PCF B;  3SR1 A;  1STB A;  1K3R A;  4I7A A;  1D5M C;  3RUZ A;  3GTM H;  3U9O A;  4QIW E;  1C48 A;  1CSQ A;  4KV6 A;  2DUD A;  4IFD H;  4WRD A;  3I73 A;  1JJ2 A;  3MHB A;  1BCP F;  3KDF B;  2V1C C;  4HIM A;  3S1Q B;  3CPW A;  1N9W A;  3HOX H;  4IPC A;  2B63 G;  1BF4 A;  5C44 B;  2K5H A;  5IOD A;  2PW5 A;  5LMN Q;  1U9R A;  1VMP A;  4HJA A;  1LV9 A;  2IT1 A;  4HJ7 A;  4KI0 A;  4A3G H;  2KVM A;  2PQE A;  2A68 C;  5EJW A;  2MNA A;  3RZD B;  2HIV A;  4LF6 Q;  1YHB A;  5LMU Q;  1TR5 A;  2I5M X;  5IT9 E;  1CUK A;  1PDQ A;  3QOJ A;  1E2Z A;  4GOP B;  4YIJ A;  4LFC Q;  4IFD J;  3I4M B;  3PSI A;  4WJ3 M;  5FJ8 G;  1YHQ A;  1MIU A;  3EFX D;  2EY1 A;  2NZO A;  5BR8 L;  2J0T D;  1BQQ T;  1VMC A;  5C4J H;  2F0S A;  1F77 A;  4KHV A;  1EYC A;  3I70 A;  3HS0 C;  4FP5 D;  4DUZ L;  1GHK A;  3Q8D A;  4A76 A;  2HQL A;  3BVZ A;  3OW7 A;  3CC7 A;  5COY A;  4X66 Q;  3EN2 A;  5C44 G;  3CCJ A;  4JYA L;  4JC0 A;  2CW0 C;  2EJG C;  3NK9 A;  5JJI A;  4DNR B;  4UP8 A;  4L5R C;  2E74 C;  5IYC H;  3AQQ A;  4DR7 L;  1HQR D;  3C46 A;  4X62 Q;  3S1R B;  3GV3 A;  2KJX A;  4XYO A;  2RSN A;  3FHW A;  4O1N A;  3J7A 5;  2ZXR A;  4P73 A;  1YNN D;  3BZK A;  5HY6 A;  1K8O A;  2ZJP A;  1VQJ A;  5CC4 A;  4OWT B;  2Z4I A;  3CPF A;  4OXP A;  1JE5 A;  3TP6 A;  1VQ6 A;  1I6H B;  5IP7 H;  5C6A A;  1WVL A;  1HFG A;  2E2D C;  2G9D A;  1EY7 A;  5GAG C;  4O42 A;  3I4M G;  1AE2 A;  5A2Q E;  3DXJ C;  1WTH A;  3PUW A;  3K0X A;  4S3S A;  3EIV A;  2PI2 E;  3SHL A;  5K36 H;  1EYA A;  5GAE C;  3GTL B;  3MFY A;  3HOU B;  1RKN A;  5ELE A;  4NXN L;  4FYD A;  4XDX A;  2Z1C A;  3W2D A;  1F9P A;  2EJM A;  5IT9 c;  5C3X A;  3QIA A;  2F0L A;  1WD1 A;  2JA8 H;  1VQ4 A;  2K28 A;  1UNS A;  1GUS A;  1R4P B;  3VA5 A;  1DON A;  1YJW A;  3H09 A;  4AYB B;  5HGQ A;  2NVT B;  1SYE A;  4Q0F A;  1N33 L;  1STA A;  3EA6 A;  1TS3 A;  2RCN A;  1DD2 A;  4GZY C;  1CTM A;  2RHS B;  3OIP A;  1TII D;  1G8Z D;  3NEN A;  4B3T L;  4LFB Q;  5M3M H;  2XRQ D;  1Z6H A;  4UDU C;  2K75 A;  1SE4 A;  1KNE A;  2TSS A;  3UE0 A;  4IJH A;  4XQQ A;  1E2V A;  1C7Y A;  3IFD A;  1LAB A;  2VQE L;  1EWC A;  4QCL A;  1LYL A;  3A55 A;  3HOU G;  2MHV A;  2YU9 H;  4QUF A;  5IP9 G;  4DR2 L;  1H9R A;  3M7N A;  1LTL A;  1HA6 A;  3S1N B;  2F0K A;  1TWC H;  2L15 A;  2L9H A;  4LK1 C;  2PI2 A;  5JPN C;  1LLR D;  3I3C A;  1NMG A;  4N8X 1;  4PQX A;  4DK6 C;  3HKZ B;  4JBW A;  4C1N K;  4AYB G;  4ALP A;  1E24 A;  5C4X H;  1UE7 A;  1GJX A;  3I4N H;  4ZUI A;  2LXJ A;  1I4X A;  4DV7 L;  1LTA D;  4N8F A;  1WTO A;  3S1Q H;  1CHQ D;  5C5M A;  5C44 H;  3E5S A;  3QO2 A;  3GTG H;  4C3I H;  5CV8 A;  5JJZ A;  2WP8 J;  4R4O A;  3QWN A;  4A3J B;  2Q2H A;  3AFP A;  3ULJ A;  3S14 H;  2VZA A;  1K0R A;  3I91 A;  1FNW A;  4KY7 A;  5FKA C;  1IBM L;  2XNA C;  3KF6 B;  5IGD A;  1Z9F A;  3CMA A;  4OO1 I;  4QJF A;  1I4R A;  2KCC A;  3P75 A;  5KNC A;  1SNO A;  1HR0 Q;  2NWG A;  3K81 C;  1D1I A;  2NTT A;  3HKZ G;  5EGT A;  1NR2 A;  3K5L A;  4FDB A;  1VQF A;  4JYA Q;  4JK1 C;  5JAV A;  2RBM A;  4B3R Q;  4CDE C;  4J15 A;  4PMB A;  4Q5V A;  5EQ0 A;  2UUB Q;  4DR7 Q;  1YNJ C;  3NWT A;  3TP8 A;  2NVQ B;  4B3S L;  4O2D A;  3PV0 A;  4DU9 A;  3F1Z A;  5LMN W;  4A3I H;  3BDC A;  1SN8 A;  4IUT A;  3GTQ B;  4FO2 A;  4A3J G;  1SNC A;  1VQB A;  3I90 A;  5AJ3 L;  2OXP A;  1SYG A;  2AWN A;  2KHJ A;  4ME3 A;  2NN6 H;  4TQU S;  2F4I A;  4DR4 Q;  3OIQ A;  1T9H A;  4NXN Q;  1IL8 A;  3MFG A;  5EPJ A;  3MXP A;  5FLM G;  1F9R A;  4FF4 A;  3HRZ C;  3M4O H;  2M2L A;  2Y0S B;  2YTY A;  1JMC A;  5IYB H;  1YJN A;  1X54 A;  2EYM A;  4JI6 Q;  5LL6 X;  3CD6 A;  1LTS D;  3HP3 A;  1EOV A;  2B2T A;  1A2T A;  4BXX G;  4JV5 Q;  3H3V I;  1H9K A;  4MN3 A;  1U4P A;  4I65 A;  3W1G A;  4HJ5 A;  1HXY D;  1PFM A;  1FGB D;  4A75 A;  1AEX A;  4B3T Q;  5I6W A;  1Y69 U;  4ZCK A;  1H95 A;  3NTK A;  2WKC A;  5EKI A;  5DM6 3;  1KD1 C;  4KJN A;  2K4K A;  3CW2 C;  2JN4 A;  1I4G A;  4RHR A;  2VQE Q;  3D3R A;  4DPG A;  2F0F A;  1FVI A;  1CQF A;  3T1Y L;  3LGJ A;  4QIW B;  1UWV A;  5FLX E;  1QZG A;  5C4Z A;  3BYY B;  1FGU A;  1LTG D;  1XJV A;  2Y0S G;  1KL9 A;  2N78 A;  2LS0 1;  1EOT A;  2TMP A;  2UXC Q;  4RAU C;  3PF4 A;  3CCQ A;  5K5P A;  4GNX A;  1B8A A;  4RWS C;  1EIH A;  4FF1 A;  5C0X J;  3T51 B;  1WTX A;  3IRB A;  4R4T A;  1HZB A;  3GD7 A;  2A74 C;  4IJL A;  1RTO A;  2C9O A;  4P71 A;  3URY A;  1RJT A;  1HNX Q;  1W6K A;  2MFI A;  2VL6 A;  3V05 A;  1PH2 A;  1GHJ A;  5L37 A;  4DV6 Q;  4MTN A;  1I4P A;  3SK5 A;  4BA1 I;  4KHP L;  5CV4 A;  4H02 A;  5J39 A;  4HSP A;  2SEB D;  2E8G A;  1S5C D;  4M8A A;  4FXD A;  1FR3 A;  1L0Y B;  2CW0 D;  2KHS A;  1XPR A;  3KFU A;  3MXN B;  1EIY B;  4A3L G;  3G6E A;  1X6O A;  3CCU A;  1Y1W B;  1QVF A;  5IE8 A;  2E2H B;  1UE6 A;  2OWO A;  2Q2T A;  3J80 E;  2B2U A;  3U4Z A;  2BDO A;  2DJG C;  1GUT A;  4FXK C;  3STB C;  4IZ8 A;  1GXD C;  3PO3 H;  4C2M B;  4BS9 A;  4FNF A;  1EQV A;  3K6O A;  4OO1 G;  5FLX c;  2X6L A;  1TY2 A;  2RDH A;  2EDG A;  1D5Z C;  4CJ1 B;  1M4V A;  4OIJ A;  2R93 B;  2JEA I;  1X56 A;  4B08 A;  1KDC A;  3CQZ H;  1FJG Q;  3ZJY C;  1EYD A;  4TRD A;  3A74 A;  4H7B A;  2NVQ H;  1VQK A;  2VB2 X;  1VQP A;  5JJL A;  2JA6 B;  2EYH A;  1U4R A;  1PV4 A;  1S4Z A;  1EUJ A;  4BY1 B;  1CZG A;  4B3M Q;  1G6P A;  4ZAI A;  1B1Z A;  3TZD A;  3X3N A;  4QF4 A;  1Y1W G;  3JAM L;  4DNT B;  3NWS A;  3NTI A;  1SDF A;  1E7Z A;  1HA5 A;  1J5E L;  1Q3L A;  1Y8O B;  1PH3 A;  2I5H A;  1E0B A;  2F0U A;  2K5N A;  4ZK9 B;  4HIK A;  4GKJ L;  2G9H D;  3WOF A;  1TWF B;  1PZI D;  2WB1 E;  4A3F B;  3FDT A;  4BWG B;  4ZUJ A;  4DR3 L;  3HOW H;  2KOL A;  2GN5 A;  2QEJ C;  1N8R C;  3VYS A;  4J8Q A;  1MBY A;  4DXG A;  3G7L A;  5C5L A;  5GQO A;  2B2V A;  2R93 G;  4LF9 L;  5DEH A;  1TWA B;  2DY8 A;  4JW0 A;  3R93 A;  4IOC A;  1Q82 C;  3RZO B;  3J80 c;  2RKS A;  1JOQ A;  2F0I A;  4DKA C;  2Z0S A;  4RG1 A;  3HEJ A;  2LKV A;  2JA6 G;  1X55 A;  4FXG C;  4BY1 G;  1TXY A;  3DLL A;  2KEC A;  2HCC A;  3T1Y Q;  1XNR L;  5KEE A;  4KTA A;  4DUY Q;  1GM5 A;  4FF2 A;  2WV6 D;  1MSG A;  2JA5 H;  1I94 L;  2E2I H;  1LTT D;  2P5Z X;  1HH2 P;  4AQY L;  4DV4 Q;  1NNX A;  4A3F G;  1DXM A;  1VQH A;  3HFZ B;  3K5N A;  2MPM A;  4GN5 A;  4K6L A;  5CBA E;  5M5X H;  2MJ8 A;  3FMC A;  3MAQ A;  5CGK A;  3NEL A;  1S5B D;  2UXB L;  4JVZ A;  5ELD A;  2A6H C;  2XIW A;  4JBM A;  4CDF C;  1OXX K;  1HUN A;  2EY5 A;  4KY6 A;  5HUR A;  2NVX B;  2ALY B;  5FK9 C;  2ATW A;  1OXS C;  3DMU A;  3NSW A;  1D8L A;  1V8Q A;  4OO1 H;  2K5V A;  4HAE A;  4X3U A;  1Q8I A;  4KHP Q;  5I2X A;  1QUQ A;  3T13 A;  4DAY A;  3CRK C;  1DYQ A;  4DR6 L;  1VQ5 A;  3RR5 A;  3I56 A;  2K14 A;  2F0Q A;  1SNP A;  4DV2 Q;  2CQO A;  4J1M A;  4QQB X;  4XT1 B;  2O5J C;  1K83 B;  2E76 C;  2B2Y A;  1WTW A;  4BBS H;  4RMF A;  4WFN 3;  2FJ2 A;  1Q1E A;  3ULL A;  1LO5 D;  4A3K B;  3GTK H;  1B3Q A;  3P1H A;  4JI1 L;  2K01 A;  4AH6 A;  2B8F A;  1YI2 A;  3TZU A;  1EEI D;  1QG7 A;  1YIT A;  3OMG A;  1BUV T;  1IYV A;  4K5W A;  1K73 C;  1B9N A;  1MJE A;  3D6W A;  2BA0 A;  3QJY A;  3CHB D;  1YZ6 A;  1L1O A;  3M4Q A;  1KLG D;  3BYT B;  4UPA A;  1EZ8 A;  4RGT A;  2JA7 B;  3NQI A;  2EPB A;  1S3O A;  5KYL A;  3FRP B;  3I55 A;  5M3F B;  4EQP A;  1VQD A;  1DOL A;  5JOB A;  3PUV A;  1BCP C;  4JBK A;  3VYT A;  2I0Q A;  2UUA L;  3GTP B;  1J5E Q;  3H3V H;  1II3 A;  1SYD A;  4A3K G;  2R92 H;  1X3G A;  2CVR A;  1N34 L;  1JCK B;  3OMC A;  2BH2 A;  1TVX A;  1KC8 C;  5JJK A;  1KDA A;  3AMU A;  2AUJ D;  1I3Q B;  2NVY H;  4GNX C;  1JOO A;  1XMO L;  1TWH H;  4MZ9 A;  4A3F H;  2MQH A;  2F0M A;  2ZTD A;  1PMR A;  3ND8 A;  1G29 1;  3S17 H;  1BBU A;  4YWK A;  4X65 Q;  4YCU A;  4K5V A;  1TWA H;  3U58 A;  4EQN A;  4X64 L;  2JA7 G;  1B9M A;  2BE5 C;  1HQM C;  2F3I A;  3O13 A;  4R1J A;  1STH A;  4KD4 A;  1VQ7 A;  3CCE A;  4HN7 A;  1WI5 A;  5M3F G;  2OT2 A;  3I72 A;  1QOH A;  1H9J A;  1Q12 A;  2R7D A;  4ZYS A;  1FL0 A;  2L0C A;  4EQO A;  2HQE A;  4LF7 Q;  1GUW A;  2XVS A;  2F0G A;  3KBX A;  2K32 A;  2F0O A;  1Q81 C;  3A8I E;  3MWY W;  4OON A;  3J7Z C;  2C5C A;  4AQY Q;  2O2L D;  2NB0 A;  1JWM D;  1VQ8 A;  3DWP A;  1CKM A;  2B2U C;  1PTO H;  1YHA A;  1KDB A;  4A3D H;  1G51 A;  3RN2 A;  1K9M C;  1CA6 A;  4GN3 B;  4KN7 C;  2UXB Q;  1X3P A;  4CJ0 B;  2E5L L;  4A4I A;  2PNH A;  1KLU D;  3V96 A;  5H1S E;  5J22 A;  1EWI A;  5DAU A;  1SMY D;  4ZLT F;  2B29 A;  1XMQ Q;  2B2W A;  4DV1 L;  3HOY B;  1B44 D;  2QDL A;  2ZXP A;  4K8J A;  1JB7 A;  2NVX H;  4DR6 Q;  1CKO A;  4R4I A;  1U4M A;  5AFW A;  3JAM E;  2EYL A;  1K3B C;  2AQ3 B;  4RCN A;  2F3V A;  2JYO A;  2RDF A;  2L12 A;  4ILW A;  2NTS A;  3CXC A;  2R7Z B;  1AH9 A;  4NMZ A;  1HTP A;  1SMX A;  1STE A;  3A0J A;  1FYC A;  3KBG A;  1IBL Q;  4OIK A;  4X6A H;  3T1H Q;  1PH8 A;  1EY5 A;  1C9O A;  4YY3 Q;  2BOS A;  1SE3 A;  1EQT A;  3E3X A;  1VCI A;  3RNU A;  4A3M H;  1P8L A;  2EYJ A;  3D4W A;  2F3W A;  3PQI A;  3KOJ A;  2EE1 A;  1ESR A;  2J7Z A;  2M00 A;  2B2V C;  1BDO A;  3J7Y W;  1V9P A;  3F2C A;  4CJ2 C;  3A5Z B;  3A5U A;  1K0S A;  4OHJ A;  3HOY G;  1ZYR C;  1EU4 A;  1QJO A;  5T1I A;  4LNQ A;  3J7A V;  2ZM6 Q;  3S2D H;  1NE3 A;  1KTK A;  2HCI A;  4HCS A;  3I4O A;  3AEV A;  1SJE D;  2K1B A;  5IOC A;  2A69 D;  2M9V A;  4DK0 A;  1I50 B;  2R7Z G;  2OEO A;  1ICF B;  4TSS A;  3GTJ H;  1GD7 A;  5I2Y A;  5CV5 A;  1EZ6 A;  1CZW A;  4X3S A;  4B9W A;  2VQF L;  2E2J B;  2B63 H;  1RD9 D;  3OWE B;  4A3E B;  4NXM Q;  1X3Q A;  2JA7 H;  1IW7 C;  1U5K A;  2VW9 A;  1RDP D;  4K0K L;  4KN4 C;  1CKN A;  5BN4 A;  1LUZ A;  2O4X A;  2WB1 B;  3TME A;  1OXT A;  3EBE A;  3JAM c;  4IN3 A;  2I07 B;  4P74 A;  5JPM C;  2ICI A;  3GTP H;  5C3E B;  1RL2 A;  4BBR B;  4DXF A;  2IX0 A;  2F0J A;  4GN4 B;  3J81 E;  2IX1 A;  1XMO Q;  2A19 A;  3S15 B;  3CC2 A;  2A6E C;  1PRT C;  4O0A A;  4LF4 L;  4JPB W;  1I3Q H;  2XWJ B;  4IUR A;  1M8A A;  5FJ8 H;  1IYJ B;  1KRT A;  1Y8P B;  4HR7 B;  4X64 Q;  2DY7 A;  4ABN A;  2DJF C;  1YEZ A;  4K5X A;  2NBF A;  1H9S B;  1HZ9 A;  1OTC A;  2HT1 A;  2JJQ A;  3RD4 A;  1CFM A;  5IYD G;  2RDG A;  4A3E G;  3ICE A;  5CYU A;  3MEH A;  2A6H D;  3UE1 A;  2WB1 G;  4G7H C;  3MZ5 A;  1IYU A;  3TQY A;  2L55 A;  1E22 A;  2B2Y C;  1LM0 A;  1FNU A;  1NTG A;  5C3E G;  2BDN A;  3RZD H;  1TWG B;  1F2L A;  1STY A;  3VYR A;  3VR3 A;  1SE8 A;  4BBR G;  1KQS A;  4HTH A;  4CHT B;  5IY0 A;  3P20 A;  5BR8 Q;  3U50 C;  2Q2I A;  2E5L Q;  5I6Y A;  3D4R A;  2BH8 A;  2J4X A;  5IGE A;  1YBY A;  1EFI D;  4DUZ Q;  1WOC A;  1ZKO A;  1HZC A;  1PHJ A;  1SFO B;  3I4M H;  2SNS A;  4JG2 A;  4DFA A;  5GAD C;  4G57 A;  3OW2 A;  4GKK L;  4KY5 A;  4DV1 Q;  4PG3 A;  1A0I A;  1ZEQ X;  4IPG A;  1ILP A;  3J81 c;  1L1O C;  1Q8K A;  4ODG A;  3HG9 A;  1UAP A;  1CI3 M;  5ELC A;  2HUG A;  4L63 B;  4DR5 L;  4UY8 C;  4B9X A;  4QB4 A;  3PGZ A;  3HOY H;  1V1P B;  4X3T A;  5IWA L;  4BY7 B;  3NUC A;  1TS2 A;  3VDY A;  4PZ8 A;  2EY2 A;  2OQ0 A;  2XSC A;  4L5T A;  3S1R H;  2FFK B;  4RGN A;  2AQ1 B;  1DGS A;  1TS5 A;  2IW3 A;  1OXU A;  3SK6 A;  3A7L A;  2PQA A;  2F52 A;  4IUN A;  1OXV A;  4IOA A;  2F03 A;  4GLV B;  4XQN A;  3CCR A;  3TS0 A;  1F2M A;  1I6H H;  2AHO B;  3IFT A;  2F4V L;  1UUP A;  2B39 A;  4RA8 A;  5E4W C;  4CDC C;  2KA7 A;  4C3H B;  3KYH C;  4QY7 A;  5ISR A;  2DNE A;  4A3B B;  5NUC A;  3OPO A;  3C1E A;  2PYK A;  1WJJ A;  4KKS A;  3UI2 A;  3GTL H;  3AU7 A;  3HOU H;  2H4O A;  5IP9 H;  1E1T A;  1Q7Y C;  1TKW B;  3NHH A;  1GUG A;  5M5W B;  5JEA G;  1N33 Q;  3KF8 A;  4ID6 A;  4BY7 G;  4C56 C;  5LHY 1;  4CGY B;  4C3J B;  2VQF Q;  1JOK A;  2O5I C;  2EOT A;  1F2Z A;  4JCV E;  5LL6 S;  3RN5 A;  3ITP A;  2NVT H;  4A3C G;  1D7Q A;  1I50 H;  1HNZ L;  2QA4 A;  2WAC A;  5FOB B;  3F2B A;  3NBH A;  3RLN A;  1A3V A;  2OQK A;  2UU9 L;  1IXR A;  5ELB A;  3FP9 A;  3NXW A;  1YJ9 A;  4C3H G;  1DM0 B;  2WKD A;  2BE5 D;  4DR2 Q;  1VQ9 A;  1X65 A;  4NPS A; 
#chains in the Genus database with same CATH homology
 2EYP A;  1CT1 D;  4CBV A;  5M9O A;  1S5E D;  2K5W A;  2A68 D;  2AUK A;  2QIL A;  2KCN A;  4K2L A;  3HOV B;  1HCZ A;  2B2W C;  1XWE A;  3C1F A;  5J1Z A;  1BOS A;  2K05 A;  4KKU A;  3M4Y A;  2IPK D;  3VR6 A;  3IAY A;  4C3J G;  2FMC A;  3A8K E;  2A5H A;  2HDL A;  1ONL A;  5BN3 A;  2BA1 A;  1SNM A;  1SYB A;  2PNR C;  1MSH A;  4FVM A;  2EJF C;  3FKI B;  1LT4 D;  3MVV A;  3V2T A;  3K5O A;  3DUZ A;  4N9P A;  3MXG A;  5F2D A;  5M5Y B;  1XX8 A;  5KYI A;  1C4Q A;  2ICE C;  4ZQ3 A;  5EBC A;  3A8J E;  1IKL A;  2RQX A;  2AQ2 B;  4BA2 I;  2SDF A;  3GV6 A;  1EL0 A;  1TU2 B;  4A93 B;  1ML0 D;  3CU7 A;  3H0G B;  1Y8N B;  3PMF A;  1GUN A;  4C1N I;  2EYF A;  3OSO A;  1LTB D;  2LMC B;  5KND A;  1EY0 A;  3KLR A;  2E75 C;  2R6G A;  5DNF A;  2FIN B;  2H1E A;  5IT9 L;  5A35 A;  3W3A A;  1AZQ A;  1JOR A;  3K59 A;  1YNN C;  5EPL A;  1RCV D;  5CBE E;  4J6H A;  4L8J A;  3QOL A;  3F2U A;  1JWU D;  5EBD A;  2LFN A;  3HOZ B;  4R9W A;  2L4N A;  4XIG S;  4IQZ A;  1D6E C;  3S2H B;  1G91 A;  4H44 C;  3VYU A;  1X32 A;  1EY4 A;  3Q6S A;  3NBI A;  3OWF A;  1IW7 D;  3IL8 A;  2PZU A;  1DCZ A;  2K04 A;  1QB5 D;  3S16 B;  3DEP A;  2D2C C;  4MIU A;  1EY8 A;  5KIX A;  1Y1V B;  1D5X C;  3H3V C;  1ENA A;  1PRT D;  3CRL C;  3GTM B;  5CV7 A;  3RLF A;  1GUO A;  2JE6 I;  3HOX B;  4DF7 A;  1QWY A;  3BDL A;  1UEA B;  2PW7 A;  4CKE A;  3H91 A;  4A3G B;  2L11 A;  4WOR A;  3NTH A;  1HPC A;  3M85 A;  1JB3 A;  4ULL A;  4XXE A;  4PV1 C;  1ET6 A;  3C3L A;  4LJZ C;  1QE6 A;  4RKB A;  2F0D A;  2KEE A;  3FEW X;  4IUP A;  5C4J B;  4XYQ A;  1V43 A;  3K0Y A;  4IFD G;  5C4H A;  1PTO C;  1ESF A;  1D1K A;  3AB9 A;  3RMH A;  2N88 A;  1TT2 A;  2JP1 A;  3KLS X;  2Q8R E;  1YNJ D;  1G2S A;  2K7V A;  3S1M B;  1WCM B;  1ENC A;  1ENF A;  4E6I A;  5I9O A;  1SND A;  1EEF D;  1S5D D;  3D31 A;  1MD2 D;  3G6J B;  2XWB B;  1BO0 A;  2WII B;  3OHX C;  3MXU A;  4X3K A;  4IAL A;  3DWA A;  4HSV A;  3LNN A;  1SSO A;  3LWU A;  5E1F A;  2JEB I;  4F88 A;  1JIC A;  2KED A;  2SOB A;  1HUM A;  2ID0 A;  3MC0 B;  2R61 A;  3T4A C;  1HTL D;  2Q8T A;  1QCB D;  1FD7 D;  4MHE A;  5JVH 3;  3VR5 A;  1NAP A;  3DWQ A;  4N9T A;  1K8M A;  1VF7 A;  4TKO B;  1SBB B;  5M3M B;  4NW2 A;  3GTO B;  4QMG A;  5G3L F;  1WTR A;  4IUV A;  1LTI D;  2L5T A;  4KHZ A;  5K36 G;  1CHP D;  3X3M A;  1T5E A;  3VA7 A;  2PO4 A;  4R8I A;  3VR4 A;  4UAI A;  1B3A A;  4ZRZ A;  4DK1 A;  5CR3 A;  1STN A;  2DN8 A;  5C0X I;  4KMU C;  3Q22 A;  5C4X B;  2R3Z A;  3R2I A;  3I4N B;  1FNV A;  3BVG A;  4PNY A;  3SEB A;  3SE0 A;  3GTG B;  1PYW D;  4U67 3;  3FPP A;  2RA4 A;  1HRJ A;  4C3I B;  5D3I B;  1RF2 D;  4OL7 A;  5I9P A;  1I6V C;  3S14 B;  1SXT A;  4CKB A;  1PLF A;  5KRU A;  3BG3 A;  2QDB A;  2NZ1 D;  2Q8I B;  2GA4 B;  2AWO A;  1AN8 A;  2FMM A;  4DN4 M;  1A6X A;  4G7O C;  1T5X D;  5KGU A;  2XN9 C;  2K5Q A;  2JSO A;  1B53 A;  2F0N A;  3BDO A;  5FLX L;  2FHT A;  5TSS A;  3A7A B;  3N52 A;  4ME5 A;  4Y7N B;  4C3I G;  2KUM A;  3ONA B;  1SNQ A;  4KKT A;  4A3I B;  3Q24 A;  1KNA A;  3FPU B;  2X6G A;  3TP5 A;  3WDN A;  4R8N A;  2QKI C;  2IL8 A;  3SVM A;  1B4O A;  4OGQ C;  5EPK A;  4K8I A;  4KD3 A;  1Z47 A;  1CM9 A;  1KAA A;  4RGO S;  4HMI A;  1BXT A;  2EZV A;  1LTR D;  3M4O B;  1ILQ A;  4DA2 A;  3MA2 B;  3QG1 A;  1JE4 A;  5IIF A;  2OF1 A;  1IKM A;  2K6A A;  2ENB A;  2Z8L A;  1SE2 A;  3J80 L;  2MGS A;  4NDX A;  1PRT B;  3MXN A;  1J9O A;  5CV6 A;  1RHP A;  5BN5 A;  2MP1 A;  5IGC A;  2WIN B;  2SNM A;  2NN6 G;  5FO8 B;  1AW7 A;  4KJO A;  4ZKB B;  1AFP A;  5D14 A;  1DOM A;  4DGZ A;  3EJI A;  4I7Z C;  1SEB D;  1G2T A;  3PO2 B;  2NYZ D;  3GP7 A;  5IGF A;  1XYI A;  4XQJ A;  1JR0 D;  3DEO A;  1I4H A;  2VXW A;  1F9Q A;  3M7G A;  2YYZ A;  1D2B A;  2F0E A;  1J8I A;  4EVO A;  5C0X G;  2CQA A;  3MTS A;  3J7A F;  3NP8 A;  3KUP A;  1PTO D;  1QNU A;  3L7Z C;  1PRT F;  3NQT A;  1R4Q B;  1Z7T A;  4HCE A;  3M3Y B;  1A2U A;  2B8G A;  1VF5 C;  1TY0 A;  2XRS D;  4H13 C;  3SK8 A;  1B50 A;  2F0V A;  5FO7 B;  2EYO A;  2LY7 A;  2DNC A;  1QNK A;  5EKK A;  3PO3 B;  3I4L A;  5G3L D;  4F8M A;  2RSO A;  3D4D A;  2VNU D;  3BS1 A;  3CQZ B;  5HGT A;  3GO5 A;  4XTC S;  5I4D A;  3K5M A;  1O7L A;  3HZX A;  5D3D A;  2QCP X;  1RTN A;  3E0J A;  1O7Y A;  3Q23 A;  3LX0 A;  1WTV A;  5JVG 3;  1BCP D;  3Q0A A;  2PPB C;  1O78 A;  3H94 A;  3TBI B;  2QF7 A;  3T56 B;  2ZXO A;  2F0T A;  1CA5 A;  4RH6 A;  3K58 A;  3HOW B;  3K57 A;  1QIL A;  1NUC A;  1WTQ A;  1LT3 D;  3EQL C;  1Q90 A;  3SK4 A;  2ZT9 C;  4RFB A;  3PUZ A;  3NPP A;  3TN2 A;  1DZ1 A;  4HED A;  1KAB A;  4WJW A;  1BNZ A;  3R3O A;  2I46 A;  2Z4H A;  4M1U B;  1SAP A;  2A73 B;  1PXU A;  1AZP A;  1XXG A;  2PZT A;  5C0X H;  3SXH A;  2CHB D;  4LMQ D;  2JA5 B;  3U9S A;  3C2P A;  1DOK A;  2D5D A;  3ND9 A;  5CV9 A;  2E2I B;  4IFD I;  5KNB A;  1JWS D;  2IX3 A;  5M5X B;  2IWH A;  5DM7 3;  1JQY D;  1WD0 A;  4FF3 A;  2WAQ B;  3DHQ A;  1CK1 A;  5D65 A;  1DJR D;  1ROD A;  3OOC A;  1CQV A;  5FO9 B;  3SDZ A;  1O7Z A;  2VUM B;  3S9W A;  4KK7 A;  2F1M A;  3TP7 A;  1I4Q A;  1R9T B;  2F0P A;  3GQB A;  1WTP A;  2L1B A;  1ZXT A;  4Z9C B;  2K33 A;  3WOE A;  4BBS B;  1SMY C;  2EVB A;  5E3F A;  3GTK B;  2V4D A;  3IKJ A;  5COR A;  3PIP 3;  1SYF A;  2PZW A;  1F2Y A;  4V19 0;  1A3U A;  3VR2 A;  1SJH D;  1PZK D;  5JEA H;  1ZYR D;  5IGB A;  1EWH A;  2X69 A;  3T53 B;  4G7Z C;  3A56 A;  1Q1B A;  3K7A B;  1OO9 B;  4V0B A;  1PFN A;  1SYC A;  3DM1 A;  4ZKC B;  4L6T B;  3ERQ A;  2N55 A;  3L3O C;  1EU3 A;  2PMZ B;  1BR9 A;  1IHZ A;  2EY6 A;  4NP5 A;  1TS4 A;  4DAP A;  4EGV A;  1HFN A;  3E6Z X;  1A15 A;  2R92 B;  1E2W A;  1NCV A;  4QUC A;  5JEA J;  2K03 A;  3H6M A;  1STG A;  2NVY B;  1MGS A;  2A69 C;  2A6E D;  1TWH B;  2JXM B;  4CKC A;  3S17 B;  5A2Q L;  2IJ0 A;  1LT5 D;  1AP0 A;  4LAA A;  3N6R A;  4H0L C;  3TDQ A;  1H9M A;  4PMC A;  5CMD A;  1W6J A;  3T16 A;  1U4L A;  1LAC A;  4K2K A;  4IUQ A;  3TSS A;  5IGG A;  5E4X A;  1PTO B;  1HHV A;  4DAV A;  4A3D B;  3HGB A;  4F7X A;  1VDZ A;  5EKL A;  4K14 A;  5ELF A;  1LT6 D;  2K5D A;  2VB3 X;  3CKI B;  3R8B A;  1F9S A;  1O80 A;  2BCO A;  2D62 A;  1MI2 A;  3J81 L;  1NR4 A;  2F0H A;  1PZJ D;  1A3T A;  2F0W A;  4PMW A;  4RCO A;  1JC7 A;  1C8C A;  1NSN S;  3I8Z A;  3NE5 B;  3KK7 A;  1PFB A;  5C3W A;  2RVL A;  4A3M B;  1S5F D;  2MUY A;  1ICW A;  3BZD B;  4P2C B;  4XT3 B;  1H9S A;  4K6D A;  1BCP B;  2NUC A;  1EIG A;  3P7J A;  1B2T A;  4NKL A;  2JA8 B;  1G6Z A;  1PTO F;  3KLS A;  4RGM A;  3PIO 3;  3S2D B;  5T1G A;  2B2T C;  3D8G A;  3EVQ A;  3L9A X;  4U68 A;  3PUX A;  2EXZ A;  1EY9 A;  2NN6 I;  3GTJ B;  4RKL A;  3ERO A;  3ZYY X;  1TQO A;  3QB3 A;  1GOZ A;  3R2T A;  2B63 B;  2KQ3 A;  3PUY A;  1ET9 A;  2D9U A;  4HMJ A;  3A54 A;  4G4K A;  3LWE A;  4RHS A;  1V1O A;  4F87 A;  1EY6 A;  3FVQ A;  2YU9 B;  3D6C A;  3BVM A;  2HDM A;  1TWC B;  1V1P A;  4IUU A;  1BBX C;  1L0X B;  1XTC D;  2PCF B;  3SR1 A;  1STB A;  1D5M C;  3RUZ A;  3U9O A;  1C48 A;  4KV6 A;  4IFD H;  4WRD A;  3I73 A;  3MHB A;  1BCP F;  3S1Q B;  1BF4 A;  5C44 B;  5IOD A;  2PW5 A;  1U9R A;  1VMP A;  1LV9 A;  2IT1 A;  4KI0 A;  2KVM A;  2PQE A;  2A68 C;  5EJW A;  3RZD B;  1TR5 A;  5IT9 E;  1PDQ A;  3QOJ A;  1E2Z A;  4YIJ A;  4IFD J;  3I4M B;  3EFX D;  2EY1 A;  2J0T D;  1BQQ T;  1VMC A;  2F0S A;  1F77 A;  4KHV A;  1EYC A;  3I70 A;  3HS0 C;  4FP5 D;  1GHK A;  3BVZ A;  3OW7 A;  5COY A;  2CW0 C;  2EJG C;  3NK9 A;  4DNR B;  2E74 C;  1HQR D;  3C46 A;  3S1R B;  3GV3 A;  2KJX A;  4XYO A;  2RSN A;  4O1N A;  2ZXR A;  1YNN D;  1K8O A;  5CC4 A;  2Z4I A;  3TP6 A;  1I6H B;  5C6A A;  1WVL A;  1HFG A;  2E2D C;  2G9D A;  1EY7 A;  4O42 A;  5A2Q E;  3DXJ C;  3PUW A;  4S3S A;  3SHL A;  5K36 H;  1EYA A;  3GTL B;  3MFY A;  3HOU B;  1RKN A;  5ELE A;  4FYD A;  4XDX A;  2Z1C A;  3W2D A;  1F9P A;  2EJM A;  5C3X A;  3QIA A;  2F0L A;  1WD1 A;  2K28 A;  1UNS A;  1GUS A;  1R4P B;  3VA5 A;  1DON A;  3H09 A;  4AYB B;  2NVT B;  1SYE A;  4Q0F A;  1STA A;  3EA6 A;  1TS3 A;  1DD2 A;  4GZY C;  1CTM A;  3OIP A;  1TII D;  1G8Z D;  2XRQ D;  1Z6H A;  4UDU C;  1SE4 A;  1KNE A;  2TSS A;  4XQQ A;  1E2V A;  3IFD A;  1LAB A;  1EWC A;  4QCL A;  3A55 A;  2MHV A;  4QUF A;  1H9R A;  3M7N A;  1HA6 A;  3S1N B;  2F0K A;  2L9H A;  4LK1 C;  5JPN C;  1LLR D;  3I3C A;  4PQX A;  3HKZ B;  4JBW A;  4C1N K;  1GJX A;  4ZUI A;  1I4X A;  1LTA D;  1WTO A;  1CHQ D;  5C5M A;  3E5S A;  3QO2 A;  5CV8 A;  5JJZ A;  2WP8 J;  3QWN A;  4A3J B;  3I91 A;  1FNW A;  4KY7 A;  5FKA C;  2XNA C;  5IGD A;  4OO1 I;  1I4R A;  2KCC A;  3P75 A;  5KNC A;  1SNO A;  2NWG A;  1D1I A;  2NTT A;  5EGT A;  1NR2 A;  3K5L A;  4JK1 C;  5JAV A;  2RBM A;  4PMB A;  4Q5V A;  5EQ0 A;  1YNJ C;  3NWT A;  3TP8 A;  2NVQ B;  3PV0 A;  4DU9 A;  3BDC A;  4IUT A;  3GTQ B;  4FO2 A;  1SNC A;  3I90 A;  2OXP A;  1SYG A;  2AWN A;  2NN6 H;  4TQU S;  2F4I A;  3OIQ A;  1IL8 A;  3MFG A;  5EPJ A;  3MXP A;  1F9R A;  4FF4 A;  3HRZ C;  2M2L A;  2Y0S B;  2EYM A;  5LL6 X;  1LTS D;  3HP3 A;  2B2T A;  1A2T A;  1H9K A;  4MN3 A;  1U4P A;  4I65 A;  1HXY D;  1PFM A;  1FGB D;  1AEX A;  5I6W A;  1Y69 U;  3NTK A;  2WKC A;  5EKI A;  5DM6 3;  4KJN A;  1I4G A;  4RHR A;  3D3R A;  2F0F A;  1CQF A;  4QIW B;  5FLX E;  5C4Z A;  3BYY B;  1LTG D;  2LS0 1;  1EOT A;  2TMP A;  4RAU C;  5K5P A;  4RWS C;  1EIH A;  4FF1 A;  5C0X J;  3T51 B;  1WTX A;  3GD7 A;  2A74 C;  1RTO A;  2C9O A;  3URY A;  1RJT A;  1W6K A;  3V05 A;  1GHJ A;  1I4P A;  3SK5 A;  4BA1 I;  5CV4 A;  5J39 A;  4HSP A;  2SEB D;  1S5C D;  4M8A A;  4FXD A;  1FR3 A;  1L0Y B;  2CW0 D;  2KHS A;  1Y1W B;  2E2H B;  3J80 E;  2B2U A;  2BDO A;  1GUT A;  4FXK C;  4IZ8 A;  1GXD C;  4C2M B;  4BS9 A;  4FNF A;  1EQV A;  3K6O A;  4OO1 G;  2X6L A;  1TY2 A;  2RDH A;  2EDG A;  1D5Z C;  4CJ1 B;  1M4V A;  4OIJ A;  2R93 B;  2JEA I;  4B08 A;  1KDC A;  1EYD A;  4TRD A;  4H7B A;  2VB2 X;  2JA6 B;  2EYH A;  1U4R A;  1S4Z A;  4BY1 B;  1CZG A;  3TZD A;  1B1Z A;  3X3N A;  4ZAI A;  4QF4 A;  3JAM L;  4DNT B;  3NWS A;  3NTI A;  1SDF A;  1HA5 A;  1Q3L A;  1Y8O B;  1E0B A;  2F0U A;  4ZK9 B;  2G9H D;  3WOF A;  1TWF B;  1PZI D;  4A3F B;  3FDT A;  4BWG B;  4ZUJ A;  2KOL A;  2QEJ C;  3VYS A;  4J8Q A;  1MBY A;  4DXG A;  3G7L A;  5C5L A;  2B2V A;  5DEH A;  1TWA B;  2DY8 A;  3R93 A;  3RZO B;  1JOQ A;  2RKS A;  2F0I A;  3HEJ A;  2LKV A;  4FXG C;  2KEC A;  2HCC A;  5KEE A;  4KTA A;  4FF2 A;  2WV6 D;  1MSG A;  1LTT D;  1DXM A;  3K5N A;  2MPM A;  4K6L A;  5CBA E;  2MJ8 A;  3FMC A;  3MAQ A;  5CGK A;  1S5B D;  5ELD A;  2A6H C;  2XIW A;  1OXX K;  1HUN A;  2EY5 A;  4KY6 A;  5HUR A;  2NVX B;  5FK9 C;  1OXS C;  3DMU A;  3NSW A;  1V8Q A;  4OO1 H;  4HAE A;  4X3U A;  1Q8I A;  5I2X A;  3T13 A;  4DAY A;  3CRK C;  1DYQ A;  2F0Q A;  1SNP A;  4J1M A;  4XT1 B;  2O5J C;  1K83 B;  2E76 C;  2B2Y A;  1WTW A;  4WFN 3;  2FJ2 A;  1Q1E A;  1LO5 D;  4A3K B;  3P1H A;  2K01 A;  2B8F A;  3TZU A;  1EEI D;  1QG7 A;  3OMG A;  1BUV T;  1IYV A;  4K5W A;  1B9N A;  3D6W A;  2BA0 A;  3QJY A;  3CHB D;  1KLG D;  3BYT B;  1EZ8 A;  4RGT A;  2JA7 B;  3NQI A;  2EPB A;  5KYL A;  3FRP B;  5M3F B;  4EQP A;  1DOL A;  5JOB A;  3PUV A;  1BCP C;  3VYT A;  3GTP B;  1II3 A;  1SYD A;  2CVR A;  1JCK B;  3OMC A;  1TVX A;  1KDA A;  3AMU A;  2AUJ D;  1I3Q B;  1JOO A;  2F0M A;  1PMR A;  3ND8 A;  1G29 1;  4K5V A;  4EQN A;  1B9M A;  2BE5 C;  1HQM C;  3O13 A;  1STH A;  4KD4 A;  4HN7 A;  2OT2 A;  3I72 A;  1QOH A;  1H9J A;  1Q12 A;  4ZYS A;  2L0C A;  4EQO A;  2HQE A;  1GUW A;  2XVS A;  2F0G A;  3KBX A;  2K32 A;  2F0O A;  3A8I E;  3MWY W;  2C5C A;  2O2L D;  2NB0 A;  1JWM D;  3DWP A;  2B2U C;  1PTO H;  1KDB A;  1CA6 A;  4KN7 C;  1X3P A;  4CJ0 B;  1KLU D;  3V96 A;  5J22 A;  5DAU A;  1SMY D;  4ZLT F;  2B2W A;  3HOY B;  1B44 D;  2ZXP A;  4K8J A;  1U4M A;  5AFW A;  3JAM E;  2EYL A;  2AQ3 B;  4RCN A;  2F3V A;  2JYO A;  2RDF A;  2L12 A;  4ILW A;  2NTS A;  2R7Z B;  4NMZ A;  1HTP A;  1STE A;  1FYC A;  3KBG A;  4OIK A;  1EY5 A;  2BOS A;  1SE3 A;  1EQT A;  1VCI A;  2EYJ A;  3D4W A;  2F3W A;  2EE1 A;  1ESR A;  2J7Z A;  2M00 A;  2B2V C;  1BDO A;  3J7Y W;  4CJ2 C;  4OHJ A;  1ZYR C;  1EU4 A;  1QJO A;  5T1I A;  3J7A V;  1KTK A;  2HCI A;  4HCS A;  5IOC A;  1SJE D;  2K1B A;  2A69 D;  2M9V A;  4DK0 A;  1I50 B;  2OEO A;  4TSS A;  5I2Y A;  5CV5 A;  1EZ6 A;  1CZW A;  4X3S A;  4B9W A;  2E2J B;  1RD9 D;  3OWE B;  4A3E B;  1X3Q A;  1IW7 C;  1RDP D;  4KN4 C;  5BN4 A;  2O4X A;  2WB1 B;  3TME A;  1OXT A;  4IN3 A;  2I07 B;  5JPM C;  2ICI A;  5C3E B;  4BBR B;  4DXF A;  2IX0 A;  2F0J A;  3J81 E;  2IX1 A;  3S15 B;  2A6E C;  1PRT C;  2XWJ B;  4IUR A;  1M8A A;  1Y8P B;  4HR7 B;  2DY7 A;  4ABN A;  4K5X A;  2NBF A;  1H9S B;  3RD4 A;  1CFM A;  2RDG A;  5CYU A;  3MEH A;  2A6H D;  4G7H C;  3MZ5 A;  1IYU A;  2L55 A;  2B2Y C;  1FNU A;  2BDN A;  1TWG B;  1F2L A;  1STY A;  3VYR A;  3VR3 A;  4HTH A;  4CHT B;  3P20 A;  5I6Y A;  3D4R A;  2J4X A;  5IGE A;  1EFI D;  1SFO B;  1ZKO A;  2SNS A;  4DFA A;  4G57 A;  4KY5 A;  1ZEQ X;  1ILP A;  4ODG A;  3HG9 A;  1UAP A;  1CI3 M;  5ELC A;  2HUG A;  4L63 B;  4B9X A;  4QB4 A;  1V1P B;  4X3T A;  4BY7 B;  3NUC A;  1TS2 A;  2EY2 A;  2XSC A;  2FFK B;  4RGN A;  2AQ1 B;  1TS5 A;  2IW3 A;  1OXU A;  3SK6 A;  3A7L A;  4IUN A;  1OXV A;  2F03 A;  4XQN A;  1F2M A;  3IFT A;  1UUP A;  2B39 A;  4RA8 A;  5E4W C;  2KA7 A;  4C3H B;  5ISR A;  2DNE A;  4A3B B;  5NUC A;  3OPO A;  3C1E A;  2PYK A;  4KKS A;  3UI2 A;  3AU7 A;  2H4O A;  1TKW B;  3NHH A;  1GUG A;  5M5W B;  5JEA G;  3KF8 A;  4ID6 A;  4C56 C;  5LHY 1;  4CGY B;  4C3J B;  1JOK A;  2O5I C;  2EOT A;  1F2Z A;  5LL6 S;  3ITP A;  2WAC A;  5FOB B;  3NBH A;  1A3V A;  5ELB A;  3NXW A;  1DM0 B;  2WKD A;  2BE5 D;  4C3H G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...