2LXJA

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, lmcsp with dt7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Dynamic Features of Cold-Shock Proteins of Listeriamonocytogenes, a Psychrophilic Bacterium
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords Cold shock-like protein CspLA
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2lxjA00
1Y14B 4PZ7A 4LUZA 1X54A 1CUKA 3F2BA 3EBEA 4B3RL 3I2ZA 4DR5L 1EWIA 3AYHB 3WWVA 4LUOA 3T1YQ 1SLJA 1YJNA 1VQHA 2N78A 5IYBH 4A3DG 4IFDJ 3L0OA 1CKNB 4QGUA 1FJGQ 4OWXB 4IPGA 2DGYA 1K83H 3OTOL 5C0XI 4K0KL 1P8LA 2RHQB 1IXRA 1QZHA 1G6PA 4L5TA 4A93G 2YV5A 4R1JA 3JAMi 3G71A 4LFCQ 1FVIA 1XTDA 3HOXH 2MNAA 4JI7Q 4B3SL 4GNXA 4A3BG 2AHOB 4L5RC 4DUZL 2AKWB 1WJJA 1NTGA 3SGIA 3RLFA 4LF5L 1UWVA 1DGSA 3FP9A 5GQOA 4JI6L 2ZJRA 4LF4Q 5IP7G 1VQ6A 5GAHC 2HIXA 4JOIC 2ZJQA 4A3MH 4WJ4A 1JT8A 1PH6A 1TWFH 1VQ5A 2E5LQ 4A3LG 3GTMH 4NPSA 4DK3C 5IP7H 5C44G 1M90C 3I55A 4LNQA 1YI2A 1A63A 5H1SE 1HZCA 2KBNA 2LSSA 1NE3A 3K8AA 1XJVA 3GTKH 1VQGA 1VQ8A 3I7FA 2MO0A 3HKZG 2VUMH 1EYGA 1VQLA 2LXKA 3J80i 3RR5A 1Q86C 1AE3A 2KENA 2WFWA 2JE6I 3F2DA 1QUQB 5M5XH 3Q8DA 1Q46A 1U5KA 2EQSA 3S1MH 1TXYA 5IYDH 1EOVA 2I0QA 2CFMA 3T1HL 2ES2A 1JMCA 3HFZB 2K75A 2PI2A 4YCVA 2FXQA 3J81j 4DR3Q 2CKZB 1GM5A 1EUJA 1YHQA 3S17H 2B3GA 2A8VA 5HGQA 1HH2P 5M3MG 1N34L 2YTYA 1V1QA 1LUZA 3CD6A 2ZM6Q 1XNQL 3HKSA 4A3KG 5M3FH 1WOCA 4DV3Q 1X6OA 1PHJA 1IBKL 4DAMA 3HOWH 2B29A 2N49A 4A3JH 4DPGA 2QGQA 1OXUA 4DV6L 3BZKA 5IT9c 4QQBX 3IRBA 1PH2A 1HNXQ 2IHEA 1OTCA 4GKKL 4YWMA 1PYSB 3TS2A 2Z6KA 5FLMG 4JI2L 2ZTEA 1IL2A 1L0WA 1N9WA 1TWCH 2F3IA 4JI3Q 3KLWA 4JC0A 2UUAQ 4JI1L 2PQAB 3CCVA 4OX9Q 3CF5A 3D0FA 4LWCA 4DV5L 4A3CH 1EIYB 2H5XA 1UE7A 1XNQQ 3HOWG 1FL0A 4A3DH 3AEVA 1IBLL 1SROA 2CQOA 1KD1C 2CWAA 1E24A 2JQOA 1X3FA 2BA1A 3GDEA 2JEBI 5ELNA 3J81i 2YU9H 1FJGL 1SMXA 2GN5A 4GLAC 1I3QH 2E2HH 3RZOH 1HNWL 4KI0A 1N33L 4JG2A 4IOCA 2AMCB 4X66L 1TWGH 3B6YA 1QZGA 5HY6A 4GNXC 5IP9G 2ATWA 3M4OH 2K4KA 4RMFA 1IYJB 1RIPA 4DR1L 1XMQL 4A3GG 2VQFQ 4JBMA 5IY0A 3A5UA 3G48A 4POGA 1O7IA 5JEAJ 1VQAA 3GTLH 1XPOA 4WJ3M 1PH3A 3M85A 2NVYH 4A76A 3TEHB 3CC7A 1XNRQ 1X3GA 1X56A 1IBLQ 1K8GA 1OXSC 3K80C 2UU9L 3RN2A 1AH9A 2XGTA 1X9NA 1GO3E 1MIUA 3KDFA 4Y7NH 3ICEA 3FKIG 3EIVA 1YHAA 2RCNA 5E7NA 2VS1A 4QIWE 4QY7A 3W5OA 5M5WH 4X62L 1UE6A 3UE1A 1E22A 5GAGC 4IFDG 3AFQA 1Q7YC 2R7FA 1FGUA 3RLOA 3CMEA 4GOPB 4B3ML 2L15A 3HOUG 2ZTCA 2EIFA 4A3CG 2WP8J 3PO3G 2OQ0A 3HOYH 4AH6A 3HOZG 4P71A 1UEBA 2ALYB 2VQEQ 3U50C 4X64Q 3ERSX 2A1AA 1VQFA 3S1NH 3H15A 1WYDA 2PI2E 1HR0Q 2UU9Q 4GOPA 4DR7L 2R6GA 1SE8A 3G6EA 1NMFA 1KHIA 3CCRA 4LF7L 4R4IA 1E7ZA 3PUXA 5FJ8G 1HZ9A 2K5VA 1CSQA 3GTQH 2ZTDA 2B63G 1NY4A 4UPAA 1TWAH 3HOYG 4X65L 4A3GH 1NMGA 2VW9A 2UXDQ 4L5SA 2Y0SG 3HOZH 2KCTA 4JV5L 4DR5Q 2HT1A 3HOVG 1HNZQ 4YHHL 3BU2A 2MQHA 2VNUD 2LXJA 1PA6A 1HZAA 4HIOA 4JYAQ 3CC4A 4KHPL 1UE1A 1AE2A 2UUBQ 3PF5A 2UXCQ 2E5LL 1KQSA 4GKKQ 1MJCA 2B63H 4JBKA 4DUYL 5IWAQ 4LFAL 1X65A 4DK6C 4NXMQ 1VQMA 4MTNA 4HIKA 5GADC 1M1KC 3S14H 4A3BH 5FLXc 1L1OA 2MFIA 2F4VQ 4DV4Q 2OQKA 3HKZE 4DUZQ 1VQIA 1K3RA 3CCMA 4LUVA 3GD7A 4A75A 3GTOH 2K5NA 5AJ3L 2E2JH 2OTLA 2BH8A 3CPWA 1L2FA 3K7AH 1CSPA 4GLVB 3S1QH 1V9PA 2CWPA 4DV7L 2A19A 4LF6Q 4GKJL 4LFCL 5C4JH 4NB3A 2KCMA 5IE8A 2R7ZH 1C0AA 4A3MG 3T1HQ 3S1RH 4R4CA 4LF8L 1JB7A 2Q2TA 1L1OC 5LMUL 4DV1Q 1VQ9A 4OX9L 2AWOA 5FJ8H 2HHHQ 4B3TQ 3EN2A 1XPRA 1Q12A 4DV4L 2VQFL 2Y0SE 1K73C 4OO1G 5IYBG 4IOAA 2IX0A 1VQ4A 4OO1I 2R92G 1OXVA 3S16H 3CMAA 2JEAI 1EIFA 1IZ6A 3J80c 1S3OA 4KHZA 5LMNQ 4DV0Q 1PV4A 4PMWA 3PV0A 2OWOA 2IY5B 1E1OA 1YEZA 2JA6G 4JBWA 4AIMA 3S2DH 2UXBQ 4X66Q 4NXNL 3M9BA 4BA2I 2KHIA 4A3FG 3PUYA 2C35B 5J3BA 1SRUA 5FLMH 4GKJQ 1B70B 3L2PA 3AFPA 3G4SA 4JI2Q 4JOIA 4HJ9A 3NEMA 2ID0A 1E1TA 2Z0SA 3CW2C 3PO2G 2UUAL 2PQAA 2YTVA 1C7YA 4DR6Q 4BY1H 1CKMA 4HIDA 2Q2UA 2VZAA 4JCVE 5LMNL 1YZ6A 2I5HA 3W1BA 4HJ8A 1W2BA 2WB1G 4DV2L 3PUZA 1N8RC 4POFA 2K52A 4A3JG 3STBD 3J7ZC 4JBJA 3U4ZA 1VQOA 2E2IH 5C0XG 1R9TH 4A3FH 1XPUA 2NZHA 4JI5L 3PUWA 2Z6KC 3FKIH 2N8NA 1YJWA 2R7ZG 1GKHA 3I4OA 2R93H 1J6QA 3KF8B 2UUCQ 3J81c 1I94Q 3U58A 3CCLA 1KRTA 1KIXA 4C2MH 3TREA 3PSIA 1CKOA 3AQQA 3UDXA 1Y1WG 1Z47A 1SFOH 1BBUA 2VY3A 3M4QA 3CPFA 4GN5A 1J5EQ 4BXXH 1PVOA 5JJIA 4LF7Q 4EQ5A 2NN6G 3BJUA 4GLXA 5C44H 1PH9A 2NN6I 1QUQA 2UXCL 2NZOA 4JI7L 3MEFA 2NVQH 4A3LH 2JA7G 4OXPA 3A0JA 4JI1Q 1XMOL 4IPCA 4DAYB 4DUYQ 2YTXA 4HJAA 4A93H 4DR2Q 1MKHA 1YHBA 1Y1WH 5BR8Q 1CKNA 4GN3B 4RG1A 4A3IG 1QVFA 4YHHQ 1PH7A 4LFBL 4BBSH 1K0RA 4C3JH 2MO1A 1L1OB 4B3RQ 3DLLA 3KJOA 4DNIA 3S24A 2UUBL 2JA8G 2HQLA 3T1YL 4ME3A 1QVCA 5C3EG 1N32L 3U4VA 2D0PA 3RZDH 1IBKQ 1N33Q 4IJLA 4MZ9A 3ZJYC 4DR7Q 1OXTA 1RL2A 4MNOA 5IWAL 1VQ7A 4NXML 1Q1BA 2OTJA 4UP9A 1KAWA 2JA5H 2R7DA 1ASZA 3S15H 1H95A 4BBRH 2K5HA 1D7QA 4LF8Q 4BY7G 1WI5A 4AQYL 4GS3A 1UE5A 1PH4A 4DR4L 2R93G 1YVCA 2PMZE 3CAMA 4JI4Q 1JJGA 4B3SQ 3PF4A 1WCMH 3UDFA 2K50A 4JI3L 1YITA 4JI8Q 2BA0A 1JE5A 4XTCS 3M3YH 4YCWA 4GNXB 4A3KH 3NELA 5JJKA 3UE0A 3CCSA 1KRSA 1PYBA 3OTOQ 2Q2HA 4UP8A 3UDGA 4X64L 2VUMG 1N32Q 3A74A 4TQUS 4JI6Q 1A62A 1U0LA 2WAQG 4Y52H 4P75A 4X62Q 3D31A 4BBRG 4DKAC 3KFUA 2HHHL 2JJQA 4R4TA 4UP7A 3GTJH 4JI0L 2I5MX 5DLQE 3K81C 3GTPH 2ZJPA 1X55A 4KLKA 1KC8C 1VQEA 4J15A 3K7UC 1E3PA 1BVSA 1T9HA 4YWKA 4FDBA 4LF5Q 4HIMA 1VQJA 3JC66 4JI8L 3PO3H 1Q81C 4IPHA 2R92H 4HJ5A 4A3IH 5AJ3Q 5IYCG 1PFSA 1X3EA 2GVBA 1HNWQ 4DV2Q 2E8GA 4IO9A 4DV7Q 4K0KQ 3PIPA 3CC2A 2I5LX 1HNXL 4LF9Q 1TWHH 2EXDA 2F52A 3KDFB 1NBWA 1SN8A 1JJCB 3OW2A 1JJ2A 3M7NA 4P74A 2UUCL 1G51A 1Y1VH 4P73A 1MJEA 2DUDA 4GOPC 4BXXG 4DR1Q 1XMQQ 1LTLA 1NJIC 1W3SA 1HNZL 2K14A 1BKBA 3PCOB 4AYBG 5M5YH 1HR0W 4OWWB 2JA6H 4DV0L 1VCIA 1VQBA 2PNHA 3ER0A 3W1GA 3CCQA 4LW1A 2WB1E 4LF4L 3A5ZB 4QJFA 3KYHC 5C0XJ 3TS0A 1HR0L 3I4MH 4TVAB 3KOJA 3DM3A 4IFDI 4YY3Q 3ULJA 1Q82C 4O0AA 4R4QA 2F4VL 1LYLA 1Y1VG 3HOUH 4OWTB 3GTGH 3CCUA 1B7YB 5IP9H 3HOVH 1KL9A 4DR6L 4B3MQ 1J5EL 5BR8L 2IHFA 4DV3L 1HJPA 2RHSB 3KF6B 1K8AC 3H0GG 4DV5Q 3PIOA 1EQQA 3K0XA 4JV5Q 2VQEL 2CCZA 3STBC 3ULLA 1OXXK 3MXNB 1VQCA 4C3HH 2UXBL 4KHPQ 3BZCA 1Q1EA 2JA5G 4O2DA 4YY3L 4C3IH 1YNXA 1V43A 1PH8A 3I4NH 2ASBA 3E9HA 4BA1I 4BY1G 2JA7H 3H3VI 1D8LA 1LM0A 3H0GH 5M3MH 5C4XH 3PO2H 3FHWA 3E0EA 1EQRA 4X65Q 3UDIA 2XTIA 1PH1A 4X6AH 1Q8KA 4R4OA 1VQDA 4GN4B 4UY8C 1XNRL 5LMNW 4ALPA 5IYDG 3CQZH 5GAEC 3I4MG 1G291 2Q2IA 3TQYA 3NENA 4A3EH 2JA8H 3I4NG 4JYAL 3NBHB 5C3EH 3KF6A 3CXCA 2NVXH 2VL6A 1GD7A 2UXDL 2AWNA 3L7ZC 2QA4A 1B8AA 2HIVA 4OONA 4A3EG 1QVGA 1N36L 3E9IA 4AYBE 5EAYA 4LFAQ 1IBMQ 5GROA 4BBSG 3PUVA 5JJLA 3RNUA 1P16A 3ULPA 5IYCH 1N34Q 4LF6L 1GVPA 3CCJA 4XIGS 4PZ8A 2V1CC 1Z9FA 3F8TA 4PG3A 4L5QA 4JI0Q 2OCEA 3J7A5 2D62A 1BBWA 4QL5A 3F2CA 2WAQE 3HOXG 3RLNA 1I5FA 5LMUQ 4DV1L 1YIJA 2JK8A 3I56A 1S72A 4NXNQ 3LGJA 3TRZA 4DR3L 1I94L 1ASYA 2N3SA 4YCUA 1S40A 4A4IA 1WCMG 4AQYQ 4DR4Q 1I6HH 1C9OA 3KJPA 1WFQA 2GVAA 4H02A 1VQKA 5K36G 4JI4L 1YBYA 2JA9A 1N36Q 1IBML 1A8VA 4YWLA 2YYZA 4P72A 2ZM6L 3GO5A 1YJ9A 1KXLA 2NVTH 4PZ6A 1HZBA 4B3TL 5ELOA 3F1ZA 3CCEA 3RN5A 4EX5A 4LFBQ 3H3VH 5M3FG 4LF9L 5C4XG 4APVA 1PH5A 2IT1A 2IX1A 2QEXA 4DV6Q 1VQPA 1SR3A 2KHJA 3VDYA 1VS0A 1K9MC 4HJ7A 1EFWA 1I50H 3CP0A 2RF4A 1XMOQ 3M4PA 1A0IA 4IJHA 2D0OA 4IPDA 3OYYA 4JI5Q 4DR2L 1VQNA 4BY7H 3PGZA 3S2HH 3JAMc 2BH2A 5JEAG
chains in the Genus database with same CATH superfamily
4LUZA 4XQQA 3PO2B 1EQVA 3I2ZA 2PPBC 2HQEA 2N78A 2RBMA 4ZRZA 3L0OA 4OWXB 1STEA 3OTOL 4LJZC 5ELEA 3DM1A 2JA8B 1CI3M 4KN7C 4A93G 3VA5A 1XTDA 3HOXH 4EVOA 1CHQD 4GNXA 4L5RC 1KDBA 4OHJA 2AKWB 1ENCA 4ULLA 1E0BA 1PFBA 5LL6S 1EWCA 2K05A 2HIXA 1BQQT 1OO9B 4WJ4A 4A3MH 1JT8A 3KF8A 2E5LQ 4R8NA 4DK3C 1M90C 4BWGB 2PW7A 3ZYYX 2LSSA 1XJVA 1PZJD 2NVTB 3KK7A 3DEPA 1VQ8A 2RSNA 3RR5A 3WDNA 2XWJB 1AE3A 2WFWA 1Q86C 1QUQB 4CHTB 1I50B 3DWQA 3I8ZA 4ZCKA 3S2HB 3S17B 5KIXA 1RDPD 2PI2A 1ZKOA 3I4NB 3J81j 2F0UA 4ZK9B 5BN4A 1X3PA 3K59A 1N34L 2KCNA 1RCVD 1XNQL 3MHBA 3HOWB 4A3KG 2A69C 5I9OA 1WTVA 2PYKA 4A3JH 1HNXQ 3BDOA 1JB3A 3WOFA 4JI2L 1V1PB 3KLWA 4JC0A 2UUAQ 2E2DC 3K5MA 4CGYB 3D0FA 4LWCA 4A3CH 1EIYB 1PTOB 4KJOA 2CQOA 3Q0AA 1X3FA 2BA1A 5ELNA 1BR9A 4MTKA 5LHY1 1N33L 4X66L 5DM73 1TWGH 2ATWA 2B2TA 1DYQA 2QCPX 5T1GA 4RMFA 4DR1L 4CJ1B 2VQFQ 2LY7A 1DXMA 5IY0A 3A5UA 3M4OB 5M3MB 3G48A 1O7IA 1NNXA 3C2PA 1DZ1A 1EY7A 4FVMA 3VYSA 1SDFA 1OXSC 3K80C 1TVXA 2XGTA 4FP5D 3KDFA 4Y7NH 3HOXB 4K5WA 1YHAA 2RCNA 4QIWE 3W5OA 3SK4A 1UE6A 4IFDG 2CQAA 5C6AA 2PZUA 1Q7YC 1ZEQX 5JVG3 1D5MC 3MFYA 5EPKA 2OQ0A 4ZKCB 2HD3A 2O2LD 5CBEE 4X64Q 1EIGA 2A1AA 3QIAA 3H15A 2WB1B 1QG7A 4DF7A 2UU9Q 3DHQA 1NMFA 3ERQA 3GTQB 1KHIA 3W3AA 1E7ZA 3PUXA 1I6HB 4N8FA 1CSQA 1SSOA 1DOMA 1KDCA 1NY4A 1TWAH 1I4XA 1NMGA 2VW9A 4JK1C 3I4LA 1JICA 4L5SA 1LV9A 4JV5L 3MFGA 1O7ZA 3PF5A 2B2VA 2E5LL 4JBKA 2D2CC 5C3XA 4HIKA 2B63B 5GADC 3S14H 2QF7A 2OQKA 1J8IA 2Y0SB 4FXKC 5IIFA 1SNMA 1K3RA 3A56A 3CCMA 3VR2A 5AJ3L 2E2JH 1SFOB 3CPWA 2FMMA 4GLVB 2CWPA 2K5QA 2A19A 4DK0A 4GKJL 3OWFA 4NB3A 2D9UA 2B2TC 2QDLA 4LF8L 5C4JB 2Q2TA 5LMUL 4OX9L 2AWOA 2R93H 4OO1I 1MI2A 2KECA 1IZ6A 1S3OA 2YU9B 1WTQA 3FRPB 4JBWA 1I3QB 2K6AA 3R8BA 4CDFC 3PIO3 2UXBQ 1I4HA 4A3FG 3PUYA 4ZAIA 2F0OA 3MXNA 3AFPA 2HCIA 3GTKB 4NMZA 1YNNC 2LS01 1C7YA 4HIDA 5FLXE 4DAPA 4XYQA 4JCVE 3NWSA 2I5HA 4POFA 1JWMD 2PQEA 2E2IH 4YIJA 2Z6KC 3I4OA 2UUCQ 3U58A 3UDXA 4PV1C 1F2ZA 2VY3A 1WD0A 3VYUA 4BXXH 5KNBA 4XT1B 5F2DA 1I4RA 2X69A 3BJUA 1PH9A 2NN6I 1D1KA 2KUMA 4JI7L 2NVQH 2EXZA 2UXCL 1XMOL 4DAYB 1R4QB 1YHBA 4H13C 2KQ3A 4LFBL 4ID6A 1XX8A 4C3JH 2MO1A 2RDGA 4B08A 5D65A 4DNIA 3OHXC 3T1YL 3RZDH 1N33Q 2A73B 2PCFB 1RL2A 5IWAL 3S15B 3U9OA 4BBRB 5IGCA 4BBRH 4LF8Q 4GS3A 4DN4M 1PH4A 1AW7A 1JC7A 2PMZE 1JJGA 5JJZA 1YITA 2F0GA 3H91A 3M3YH 4GNXB 2HCCA 1S5FD 2H4OA 1BXTA 1EZ8A 1KRSA 1PYBA 5KYIA 2VUMG 1N32Q 3A74A 2F03A 1A62A 2F1MA 3D31A 2JJQA 3GTPH 3K81C 2ZJPA 2EY6A 3ONAB 5BN5A 2L0CA 1E3PA 4K6DA 1BVSA 1F9PA 1PRTC 4FDBA 5EPJA 4HIMA 2EYFA 1VQJA 4L6TB 1Q81C 2R92H 5AJ3Q 5IYCG 4I7ZC 1X3EA 4DV2Q 2E8GA 4K0KQ 3CC2A 2I5LX 5C3WA 1NBWA 5JPMC 1SN8A 5CR3A 4DAVA 1ICFB 3HZXA 1PFMA 1WTOA 2M2LA 3J81E 4BY7B 1ENAA 4P74A 1A15A 1G51A 4P73A 1MJEA 4K14A 1CK1A 2IW3A 1BKBA 3PCOB 4AYBG 4DNRB 5M5YH 4G7HC 2WB1E 1TT2A 1TY0A 4QJFA 1B4OA 5C0XJ 2K28A 3N6RA 4TVAB 4DU9A 1KAAA 4A3BB 2F4VL 5C0XH 1SBBB 3CCUA 4DA2A 4DV3L 3KF6B 3CRKC 5C5LA 3H0GG 3PIOA 3QG1A 1EQQA 2K03A 4JV5Q 4C3HB 2CCZA 3STBC 4KN4C 3MXNB 1JORA 1VQCA 4KHPQ 4CKEA 1Q1EA 4OIKA 2JA5G 1VF7A 2OF1A 4YY3L 4XT3B 1JWUD 2F3VA 4BA1I 2B2YC 1ML0D 3OWEB 2EZVA 3H3VI 1D8LA 5M3MH 3PO2H 2XRQD 3E0EA 2F0NA 2XTIA 2X6LA 4R4OA 4X3UA 1EZ6A 4GN4B 1PRTF 5EBCA 5LMNW 1K8MA 4ALPA 3CQZH 2K1BA 4B9XA 3C1EA 2Q2IA 3VR4A 4DGZA 2JA8H 3FPUB 1BNZA 3KF6A 1F2YA 3M3YB 1B8AA 3E9IA 4AYBE 4LFAQ 4KV6A 4ABNA 1SAPA 4IUTA 3C46A 1SNQA 5IYCH 1BO0A 1GVPA 5EPLA 3CCJA 2V1CC 5M3FB 2IL8A 1S5ED 1DOLA 2Z9HA 4PG3A 4L5QA 3RUZA 4JI0Q 4K8IA 3TP7A 4QL5A 1BBWA 5LMUQ 3HOXG 4A3MB 3TRZA 2SNMA 5G3LF 3P7JA 2N3SA 1S40A 1I6HH 1WCMG 1WFQA 2GVAA 3I70A 5CV6A 5K36G 4JI4L 2JA9A 1IBML 1A8VA 1SNOA 4QMGA 2NVTH 4ODGA 2J0TD 3NBIA 5ELOA 3CCEA 2IX1A 4DV6Q 2RKSA 3K5LA 4A3DB 1XWEA 5BN3A 5C5MA 1CM9A 2VB3X 3UI2A 1VS0A 3VDYA 1EFWA 1I50H 5CV9A 5IGBA 4IPDA 3D8GA 3OYYA 4WJWA 3S2HH 3VYRA 2BH2A 2JA7B 3J81L 4KY5A 2DY8A 3EBEA 4B3RL 2GA4B 1EWIA 3AYHB 1SNCA 5I6WA 4K0KL 1WTRA 4IUPA 1P8LA 1TU2B 5FO8B 5AFWA 5DEHA 2YV5A 3JAMi 2F0WA 4Y7NB 3VA7A 1PYWD 3FEWX 2OT2A 3R2TA 4A3BG 2JP1A 3QJYA 4RGTA 4C1NK 1QWYA 1KLGD 3HKZB 3A8IE 2ZJRA 5IP7G 1IW7D 4JOIC 1HTLD 4TSSA 1EY0A 2EYMA 1TWFH 3P1HA 4A3LG 4NPSA 4RGMA 3BYYB 4LNQA 1U4LA 1A63A 5H1SE 1HZCA 2KBNA 3L9AX 2EJMA 3K8AA 5JVH3 1O7YA 3GTKH 1Y8NB 3K5NA 4U673 3I7FA 1EU3A 1EYGA 1VQLA 2KENA 3CHBD 2KCCA 1D6EC 1B3AA 1V1PA 2Q8TA 1TXYA 3T1HL 2F0DA 3HFZB 4DR3Q 1GM5A 1EUJA 1TQOA 1HH2P 5M3MG 2AUJD 4EQOA 2YTYA 2KHSA 5DNFA 1LUZA 5KRUA 3QB3A 3HKSA 5M3FH 3R3OA 4LAAA 1X6OA 2L4NA 4HEDA 3I90A 3BZKA 1W6KA 5IT9c 1PH2A 1PYSB 3TS2A 4PQXA 5FLMG 1IL2A 1N9WA 1TWCH 2F3IA 4JI3Q 5DAUA 1LT4D 4DV5L 1FR3A 2H5XA 1XNQQ 4EQNA 4HR7B 1FL0A 4A3DH 3J7AV 1T5XD 1J9OA 1KD1C 2JEBI 1FJGL 1SMXA 2GN5A 3A8JE 3SK5A 1I3QH 2E2HH 1HNWL 1IKMA 4KI0A 2F0EA 3MTSA 4IOCA 3V05A 2AMCB 4GNXC 5J1ZA 4DXFA 4CKBA 3M4OH 1RIPA 2EYOA 3Q6SA 1HFGA 3I3CA 1TKWB 5JEAJ 5KYLA 1XPOA 3FVQA 1EYAA 3HP3A 1PH3A 1JOQA 4A76A 3TEHB 1X3GA 4H44C 2BDNA 1LTGD 1IHZA 1QNUA 1I4QA 1IBLQ 4G57A 5ELCA 2L11A 2N55A 3RN2A 2H1EA 4M1UB 3SHLA 1GO3E 2NUCA 4L8JA 5TSSA 3ICEA 1KABA 3TN2A 1TR5A 2UXDQ 4X62L 3UE1A 1FGUA 1GUOA 4B3ML 2L15A 1F2MA 3HOYB 1K0SA 4A3CG 4NDXA 2CVRA 3HOYH 4AH6A 4P71A 4HSPA 2ALYB 3M4YA 5EJWA 2A69D 2JXMB 3U50C 4TKOB 5E3FA 4C56C 2PI2E 1UUPA 2Q8IB 2DN8A 4GOPA 4C3HG 4DR7L 1JR0D 4ME5A 4LF7L 3TDQA 1HZ9A 1H9RA 2F0HA 4UPAA 4X65L 4B9WA 3QR8A 4R8IA 3HOZH 1K8OA 4ZUJA 4YHHL 2B8GA 4NKLA 5G3LD 1YNJC 2LXJA 4JYAQ 3CC4A 2EE1A 1AE2A 2UUBQ 3BZDB 1EEID 1RODA 5KGUA 3PIP3 4GKKQ 4NW2A 1X65A 1JCKB 3EJIA 3NPPA 1M1KC 2MFIA 4DV4Q 1HFNA 3Q24A 3HKZE 5I2XA 4I7AA 4Q0FA 2NTTA 1SYBA 2K5NA 1GJXA 1L2FA 1STYA 4DV7L 1Q90A 2F0SA 4JPBW 3NBHA 5C4JH 3P75A 4A3MG 4J6HA 2L5TA 1STBA 1VQ9A 4FF1A 3S16B 3EN2A 1XPRA 1Q12A 2Y0SE 4OO1G 2IX0A 2RDFA 1G2TA 2R92G 5FK9C 5C4XB 3ND9A 2OWOA 4PMWA 4UDUC 1YEZA 3BVZA 3S2DH 4X66Q 5FLXL 4BA2I 1FNWA 2C35B 4DNTB 4O42A 3TP5A 4JOIA 3FDTA 1KNAA 2MJ8A 3HRZC 2C9OA 2PNRC 2PQAA 5IGEA 3HOZB 1JOKA 2VZAA 3QWNA 4KY7A 3S9WA 1JQYD 1N8RC 2JA6B 2CHBD 2K52A 1EFID 3SE0A 3STBD 4A3FB 4JBJA 1VQOA 5EGTA 2NZHA 2JYOA 1D5ZC 3FKIH 3DXJC 1J6QA 3J81c 1I94Q 1BCPB 2G9HD 3CCLA 4CBVA 1KRTA 4C2MH 3PSIA 3A55A 1Y1WG 1VF5C 2KEDA 1BBUA 3HOVB 3VYTA 1PVOA 5JJIA 4DK1A 1PRTB 2JSOA 4EQ5A 2NN6G 4GLXA 1WVLA 1QUQA 1TIID 2BDOA 3MEFA 2MP1A 1QCBD 1WTHA 4A3GB 4IPCA 4RCOA 5CGKA 4HJAA 3L3OC 4A93H 4ZQ3A 4DR2Q 1MKHA 1JOOA 1Y1WH 1CKNA 3QO2A 2SNSA 4YHHQ 3W2DA 3DLLA 4OL7A 2D5DA 2UUBL 2HQLA 5C3EG 3NTHA 2D0PA 1B1ZA 3C1FA 4HMIA 3U4VA 3RZOB 3K0YA 1OXTA 2OTJA 2Z4HA 2JA5H 2R7DA 1W6JA 1D7QA 2R93G 4BY7G 1WI5A 4AQYL 4DR4L 1YVCA 3CAMA 2XRSD 4JI4Q 3PF4A 3TBIB 4XTCS 4A3KH 2B2VC 1TY2A 3TMEA 2HUGA 2B39A 3CCSA 3NTIA 3OTOQ 1GUGA 1STGA 1CT1D 4X64L 4TQUS 1EQTA 1AFPA 1CFMA 2WAQG 4Y52H 4X62Q 3BDLA 3GTMB 2F0QA 4KLKA 4J15A 4MN3A 1ICWA 3PO3H 3BVGA 2K33A 2VUMB 2AQ3B 5JOBA 2GVBA 1IL8A 4DAYA 4IO9A 2EXDA 3S1MB 1HQMC 3H94A 3AMUA 3OW2A 1EY6A 3NTKA 1JJ2A 3M7NA 1DD2A 2DUDA 1SE4A 1HUMA 3SK8A 4DXGA 4KD3A 1EYCA 2K14A 3K57A 1NJIC 2CH4W 3GQBA 1HR0W 1A6XA 4DV0L 1VCIA 2B2UA 3ER0A 2Z1CA 1B2TA 3TS0A 2FINB 1HR0L 1SJHD 3EQLC 3EROA 2NWGA 4YY3Q 4O0AA 2CW0D 4OWTB 1EY9A 5JAVA 3GTGH 1TS5A 1MSGA 5IP9H 2QILA 1J5EL 1RD9D 5K5PA 1HJPA 1K8AC 4DV5Q 3S1QB 3K0XA 1RTOA 4OELB 1CQVA 1NUCA 3NUCA 1IKLA 1S5BD 1OXXK 4C3HH 1K28A 2UXBL 1C48A 3J80L 4O2DA 2XVSA 3IKJA 4WORA 1YNXA 1V43A 3TP8A 1BCPF 3E9HA 3GV3A 2RCFA 4N8X1 2RDHA 4BY1G 1PZID 3KLRA 3FHWA 1EQRA 4X65Q 3UDIA 1LTBD 3V2TA 1KLUD 1VQDA 1S4ZA 1XNRL 5D14A 5GAEC 4KKUA 3I4MG 2JA5B 1BCPC 1G291 5C3EB 4FYDA 3TQYA 1M8AA 3NENA 1B3QA 4Q5VA 4JYAL 5A2QL 4EGVA 1Y1VB 1QJOA 3L7ZC 2HIVA 1N36L 4BBSG 5K36H 5JJLA 3RNUA 3ULPA 5EBDA 1N34Q 3H09A 2WACA 1DCZA 1FD7D 4PZ8A 1Z9FA 2NN6H 2OCEA 3F2CA 2WAQE 3RLNA 4J8QA 1B44D 2HDLA 1JE4A 4A4IA 4AQYQ 4DR4Q 1X32A 2MHVA 2FHTA 1FYCA 1VQKA 4C2MB 1YBYA 1N36Q 1AP0A 3GO5A 4X3SA 1HZBA 2AQ1B 3A54A 1HRJA 3RN5A 1G6ZA 2F0MA 3H3VH 5M3FG 5C4XG 4APVA 2SOBA 2SDFA 2KHJA 2DNCA 3SEBA 2ZT9C 3CP0A 2RF4A 3M4PA 4IJHA 4JI5Q 1HTPA 4DR2L 3PGZA 1ENFA 3JAMc 5JEAG 4B3MQ 4R9WA 1SE2A 2L1BA 3F2BA 3E5SA 1EWHA 4DR5L 3GTLB 3WWVA 1YJNA 1SLJA 1VQHA 1ZYRD 4A3DG 1CKNB 1ILQA 5C0XI 2RHQB 1IXRA 1H9JA 3EVQA 1QZHA 4L5TA 5E4WC 3G71A 5DM63 1SMYD 4CJ0B 1FVIA 4LFCQ 2R7ZB 3S1RB 4JI7Q 2NBFA 5EKLA 2BE5D 1EYDA 3A8KE 2AHOB 4PNYA 3LWEA 3MXUA 4OO1H 3H6MA 1WJJA 1NTGA 3SGIA 4KMUC 1UAPA 4LF5L 2B8FA 1DGSA 3FP9A 5GQOA 4JI6L 1QILA 1VDZA 1PTOH 4LF4Q 5GAHC 3MZ5A 1F9SA 2PO4A 2OXPA 3GTMH 2EYHA 5IP7H 5C44G 3I55A 1E2WA 1STHA 4C3IG 1SE3A 1BF4A 1VQGA 2R92B 2MO0A 3I91A 3HKZG 2VUMH 5JPNC 2LXKA 3J80i 3CQZB 2JE6I 1MSHA 2P5ZX 3J7YW 2M9VA 2B2YA 3Q8DA 1Q46A 2EQSA 3DWAA 3SR1A 1EOVA 2I0QA 2CFMA 5IOCA 2ES2A 1JMCA 1EY8A 3JAME 3AB9A 1SEBD 4YCVA 2F4IA 3S17H 1TS2A 2B3GA 2BCOA 3X3MA 1VMCA 3R2IA 4BS9A 1V1QA 3CD6A 2ZM6Q 4GZYC 1BCPD 4OIJA 4DV3Q 1MBYA 1A2UA 3MWYW 5T1IA 3LWUA 4DAMA 2B29A 4C3JG 3HOWH 2K5DA 5CV5A 2QGQA 4DPGA 4QQBX 2IHEA 2A68C 4YWMA 3FPPA 3FMCA 1PZKD 1SYEA 1O78A 2ZTEA 3NQIA 2EPBA 2ZXRA 3D4RA 4RH6A 2PMZB 2QKIC 4ILWA 1O80A 3MVVA 4OX9Q 2J7ZA 2DY7A 3D4WA 1UE7A 3HOWG 2KA7A 2NB0A 1E24A 2JQOA 3GDEA 1ESFA 3D6CA 2B2WC 4L63B 3CKIB 1F77A 3B6YA 4RCNA 4FXDA 2K4KA 4A3GG 1II3A 4HTHA 1PMRA 2EDGA 3GTLH 4WJ3M 3LNNA 1FGBD 5KEEA 3M85A 2NVYH 3CC7A 1EIHA 2VB2X 1K8GA 3BS1A 4V190 2UU9L 1X9NA 1E2ZA 1MIUA 3FKIG 2KOLA 5M5WH 2VS1A 3DUZA 5CV8A 5GAGC 3AFQA 3RLOA 1S5DD 2QDBA 3CMEA 2ZTCA 2EIFA 2WP8J 3PO3G 3N52A 1GUWA 1UEBA 2VQEQ 3OIQA 1VQFA 3S1NH 1WYDA 3O13A 4JVZA 1AZQA 1WD1A 1L0XB 3S1NB 2O4XA 3OW7A 3G6EA 1SE8A 3KUPA 3MA2B 3CCRA 2K5VA 3GTQH 2B63G 1KTKA 4KJNA 4KKTA 3P20A 4A3GH 2EY2A 3DEOA 1EY4A 4E6IA 3IFTA 2R61A 3DMUA 3C3LA 2DJGC 2HT1A 1HNZQ 2Z6BA 2X6GA 3J7AF 2MQHA 1WTWA 3OPOA 4KHPL 1UE1A 3NE5B 2UXCQ 1R9TB 5A2QE 1KQSA 1HUNA 1MJCA 2B63H 2KEEA 3S14B 1A3UA 5IWAQ 4DUYL 4DK6C 4LFAL 4A3BH 5FLXc 1MD2D 1IW7C 2QW7A 3CU7A 4DUZQ 4QB4A 5D3IB 1VQIA 4A75A 3GTOH 3GD7A 3T51B 1QE6A 1XTCD 2BH8A 3K7AH 1PTOF 1S5CD 1F2LA 1U9RA 4XDXA 1GHJA 1U4MA 3K6OA 4H0LC 3T13A 4LFCL 2KCMA 2R7ZH 3MXPA 3S1RH 3D3RA 4R4CA 2C5CA 4DV1Q 2IWHA 3HEJA 2A5HA 3GTJB 2OEOA 2HHHQ 4B3TQ 1CZGA 4DV4L 2VQFL 1Y1WB 1E2VA 1VQ4A 1OXVA 4FXGC 3CMAA 2JEAI 1EIFA 3J80c 2A6HD 4HCEA 4KHZA 4DV0Q 1PV4A 1E1OA 5EQ0A 4AIMA 5E1FA 3VR6A 2LMCB 4NXNL 1TWGB 3S2DB 1SRUA 1B70B 2M00A 4A3EB 5C4ZA 4JI2Q 3NEMA 3VR5A 1E1TA 2Z0SA 3CW2C 2ICIA 2UUAL 1FNVA 1H9KA 4PMCA 4DR6Q 4BY1H 1NSNS 1T5EA 4WFN3 3W1BA 1W2BA 3Q23A 1F9RA 2WB1G 4DV2L 2E2IB 4G7OC 3J7ZC 4JW0A 3U4ZA 1LABA 1D5XC 1Z7TA 5C0XG 3ND8A 2XNAC 4JI5L 4IUQA 3MAQA 1RF2D 2R7ZG 1LTRD 4FNFA 2E75C 4ZLTF 3OMGA 1X3QA 2F0TA 1KIXA 1AZPA 3TREA 4G7ZC 3AQQA 1Z47A 4QUFA 1SFOH 3PO3B 3M4QA 4GN5A 4IZ8A 4LF7Q 2WAQB 3OOCA 2PW5A 5C44H 3HG9A 2NZOA 2XN9C 5C44B 4OXPA 1ET9A 4JI1Q 2YTXA 2DNEA 2WIIB 4ZKBB 2HDMA 4C3IB 3J80E 4RG1A 4A3IG 4N9TA 1K0RA 1RTNA 4B3RQ 4P2CB 3KJOA 3RZDB 2Q8RE 3S24A 1STAA 1LT3D 2JA8G 1N32L 3HGBA 1IBKQ 4IJLA 3ZJYC 4DR7Q 4MNOA 5I6YA 1Q1BA 4UP9A 1H95A 1GXDC 1ASZA 2K5HA 5CBAE 1UE5A 2RQXA 4B3SQ 3HOUB 3GTOB 3OMCA 3TP6A 2K50A 2NVXB 4JI3L 2BA0A 1JE5A 4YCWA 5JJKA 2LKVA 1BUVT 4UP8A 4XXEA 1V1OA 1HQRD 1U0LA 4RFBA 3MXGA 1V8QA 4BBRG 2HHHL 4R4TA 4JI0L 2PZWA 2I5MX 1X55A 3H3VC 1VQEA 4LF5Q 2A6HC 3E3XA 3JC66 4JI8L 4IPHA 1DONA 1FNUA 1UEAB 4HJ5A 2K32A 4A3IH 3HS0C 3OSOA 1HNWQ 3NHHA 4DV7Q 4LF9Q 4F87A 3KDFB 1CTMA 4K2KA 3E0JA 1EEFD 2UUCL 5M5YB 4BXXG 4DR1Q 1HNZL 1W3SA 5D3DA 2IJ0A 1BBXC 1VQBA 2A6ED 3W1GA 3CCQA 4LF4L 3IAYA 3A5ZB 2EYJA 3I4MB 5IGGA 3EA6A 3Q22A 1LTTD 3I4MH 1O7LA 3DM3A 1NCVA 3KOJA 1RHPA 4R4QA 1LYLA 1Y1VG 3T4AC 3HOUH 2ICEC 3BVMA 4QUCA 1STNA 3HOVH 1KL9A 3G7LA 5BR8L 2XWBB 5ELBA 4XYOA 4V0BA 2QEJC 3U9SA 2VQEL 4UHVA 5EKIA 3ULLA 3URYA 2NVQB 2F0JA 5IGFA 2NYZD 2BOSA 5ELFA 4C3IH 1L0YB 1HPCA 1LM0A 4S3SA 3H0GB 2F0PA 1PH1A 2MUYA 1Q8KA 5FOBB 1SYDA 1XXGA 1TWHB 5IYDG 1LLRD 1CHPD 4A3EH 3RD4A 4EQPA 1WCMB 3CXCA 1GD7A 2AWNA 3I4NH 1QVGA 1IBMQ 5EAYA 1U4PA 5IGDA 3PUVA 2O5JC 1I4PA 5EKKA 1GUTA 3JAML 1VMPA 3F8TA 1CA5A 2EYPA 2D62A 1YIJA 4DV1L 3FKIB 1I5FA 1G8ZD 4X3TA 2JK8A 2DJFC 3IFDA 3I56A 3LGJA 1I94L 1ASYA 1D2BA 3K58A 3GTGB 2RSOA 3KLSA 1C9OA 2KJXA 2PZTA 4H02A 1TS4A 3IL8A 4YWLA 4P72A 1YJ9A 4IQZA 1MGSA 3SDZA 3V96A 4LF9L 1PH5A 2IT1A 2QEXA 1SR3A 3KLSX 4IURA 2EY5A 1K9MC 4HJ7A 4K6LA 1PXUA 5ELDA 1XMOQ 2D0OA 2E2HB 4A93B 4RAUC 2IX3A 1Y14B 4PZ7A 1X54A 1CUKA 1BOSA 2EY1A 3VR3A 4LUOA 3T1YQ 4IFDJ 5IYBH 2RVLA 3TSSA 2NVYB 4QGUA 1FJGQ 2F0VA 4IPGA 1HA5A 1K83H 2DGYA 4DFAA 1PDQA 4CDCC 1G6PA 4IFDH 4R1JA 2EVBA 4QCLA 4F8MA 2MNAA 2B2UC 4B3SL 2NZ1D 3MC0B 4DUZL 3RLFA 1WTPA 1UWVA 1HHVA 4C1NI 1VQ6A 1TWFB 2ZJQA 2I46A 1QB5D 1PH6A 1VQ5A 1I4GA 3NSWA 1YI2A 1ET6A 2E76C 1NE3A 4KK7A 2A68D 3BG3A 4A3IB 5COYA 5M5XB 1ONLA 1F9QA 3F2DA 2BE5C 5M5XH 1CZWA 1U5KA 3S1MH 5IYDH 4J1MA 4KY6A 1B9NA 4XQNA 1PTOD 2K75A 4KHVA 5I4DA 2ZXOA 2FXQA 2CKZB 1GUNA 1YHQA 2A8VA 5HGQA 1EU4A 1Y8PB 3NP8A 4MIUA 4RKLA 4K2LA 3CRLC 1WOCA 2EOTA 1PHJA 2L9HA 1IBKL 2N49A 3GV6A 4DV6L 1OXUA 2EJGC 3IRBA 5IT9L 4GKKL 1OTCA 1K3BC 1SYFA 3QOLA 4QF4A 2Z6KA 4HN7A 2B2WA 2F3WA 1L0WA 2XIWA 4JI1L 2PQAB 3CCVA 2A6EC 3CF5A 2E74C 4WRDA 1B53A 3EFXD 5CV4A 1PTOC 3NWTA 1PFNA 4C3JB 3AEVA 1IBLL 1SROA 4NP5A 2CWAA 3RMHA 1CA6A 1Y8OB 3J81i 1DJRD 2YU9H 1LT5D 2EJFC 4CDDC 1SNDA 5LL6X 1B9MA 4GLAC 3RZOH 1Y69U 3K5OA 4JG2A 4OEMB 1LT6D 1QZGA 5HY6A 1H9SA 5IP9G 2TMPA 1KDAA 1IYJB 5HURA 1XMQL 4JBMA 4POGA 1VQAA 2RA4A 1KNEA 1SJED 4CJ2C 4BY1B 1XNRQ 1EL0A 1X56A 1QNKA 3SK6A 3T56B 2E2JB 2WINB 5FKAC 1AH9A 3EIVA 4PMBA 5E7NA 4QY7A 1E22A 4X3KA 2R7FA 5J22A 1SXTA 4GOPB 1UNSA 4KKSA 3HOUG 5NUCA 1AEXA 1JWSD 3HOZG 1RJTA 3ERSX 3OIPA 4RGOS 1HR0Q 1NAPA 2R6GA 2K04A 2Z4IA 4R4IA 5FJ8G 1TWCB 2ZTDA 1TS3A 2J4XA 3HOYG 1YNND 4AYBB 2F0LA 4ZUIA 5L37A 3NXWA 2Y0SG 4K8JA 2Z8LA 2KCTA 4DR5Q 3HOVG 2F0IA 3BU2A 2VNUD 1HCZA 3TZDA 1PA6A 2L12A 1HZAA 4HIOA 4XQJA 1GHKA 4NXMQ 3LX0A 1LTSD 2K7VA 1VQMA 4MTNA 4UAIA 1L1OA 2FMCA 4FO2A 2F4VQ 4RHSA 3SXHA 4LUVA 4MHEA 5M9OA 2OTLA 4RGNA 1LTAD 1CSPA 1Z6HA 3S1QH 1V9PA 4LF6Q 1ZXTA 5IE8A 1C0AA 3T1HQ 1PLFA 4ZYSA 1JB7A 1L1OC 4K5VA 3AU7A 3WOEA 2R93B 5FJ8H 1R4PB 5ISRA 1A3TA 4IUUA 4M8AA 1K73C 4HSVA 5IYBG 4IOAA 3S16H 4N9PA 2F0KA 1I6VC 1PRTD 5LMNQ 2IY5B 3PV0A 2AUKA 2JA6G 3MEHA 3M9BA 2KHIA 2IPKD 5E4XA 3KBGA 5J3BA 5FLMH 4GKJQ 1C4QA 3L2PA 2CW0C 3G4SA 4HJ9A 4Z9CB 2ID0A 3PO2G 4OGQC 1LACA 2YTVA 5CV7A 1CKMA 1SMYC 1HXYD 2KVMA 5J39A 2Q2UA 4IUNA 4LMQD 1XYIA 5LMNL 4A3KB 1YZ6A 4HJ8A 3PUZA 2SEBD 4A3JG 2FFKB 4I65A 5M5WB 1R9TH 4A3FH 1XPUA 3PUWA 2N8NA 1YJWA 5CYUA 1GKHA 1SYCA 2K5WA 3KF8B 3G6JB 1G91A 2F0FA 1CKOA 3I72A 5IT9E 3CPFA 3NK9A 4G4KA 1J5EQ 5IODA 1EOTA 4IN3A 4A3LH 2JA7G 1GOZA 3A0JA 5FO7B 3SVMA 4DUYQ 2O5IC 1B50A 5BR8Q 1C8CA 2MGSA 2WKDA 4GN3B 1QVFA 1PH7A 3D6WA 2MPMA 4BBSH 1L1OB 1GUSA 4IUVA 4CKCA 5KNDA 4ME3A 1QVCA 4O1NA 4MZ9A 1VQ7A 1ESRA 1K83B 4NXML 1IYUA 4F7XA 3A7AB 1KAWA 3S15H 4FF3A 2G5DA 1WCMH 3UDFA 4JI8Q 3K7AB 3NELA 3T53B 3GP7A 3UE0A 4RA8A 3T16A 2Q2HA 4H7BA 5KNCA 3UDGA 4JI6Q 1D1IA 3GTPB 4P75A 1EY5A 2LFNA 4DKAC 4HMJA 3KFUA 4UP7A 3GTJH 3E6ZX 4HCSA 5DLQE 1H9MA 2I07B 1G2SA 4IALA 1KC8C 3K7UC 1T9HA 4YWKA 5CMDA 2XSCA 2ENBA 1PFSA 3F2UA 3PIPA 1M4VA 1HNXL 1TWHH 2F52A 5C4HA 3I73A 2EYLA 1JJCB 1TWAB 1Y1VH 2R3ZA 2K01A 5FO9B 4GOPC 1XMQQ 1MHWC 1LTLA 2JA6H 4OWWB 2VXWA 4FF4A 2PNHA 1H9SB 4LW1A 4F88A 3KYHC 2WV6D 1ILPA 4A3JB 1SNPA 1BDOA 1NR2A 1AN8A 4IFDI 3ULJA 1Q82C 3ITPA 5I2YA 4KTAA 5I9PA 5A35A 2TSSA 4K5XA 2CH4A 1B7YB 4DR6L 2V4DA 2IHFA 1DM0B 2RHSB 1Q8IA 3M7GA 3BYTB 1U4RA 4TRDA 4HAEA 1DOKA 2N88A 3D4DA 1IYVA 3BZCA 2AQ2B 4RWSC 5CORA 1PH8A 2ASBA 4RKBA 4BBSB 1RKNA 1NR4A 3QOJA 2JA7H 3H0GH 5C4XH 4X6AH 2FJ2A 2JN4A 3NQTA 1Q3LA 1WTXA 4UY8C 1CQFA 2WKCA 3PMFA 4CDEC 3DWPA 5HGTA 3I4NG 3NBHB 2NTSA 5C3EH 5JEAH 3KBXA 3BDCA 2NVXH 2VL6A 2UXDL 1HA6A 4KD4A 2QA4A 3A7LA 4A3EG 4OONA 5CC4A 5GROA 4LK1C 1P16A 1YNJD 4LF6L 4XIGS 4FF2A 3J7A5 4NXNQ 1QOHA 1S72A 2A74C 4DR3L 4YCUA 2ZXPA 1SYGA 3KJPA 1A2TA 4QIWB 3PQIA 1A3VA 1LO5D 2YYZA 2ZM6L 3R93A 1KXLA 1ZYRC 4PZ6A 4B3TL 3X3NA 3F1ZA 4LFBQ 4EX5A 4RHRA 3TZUA 1VQPA 4U68A 2L55A 1A0IA 4BY7H 1VQNA 1LTID 2G9DA
chains in the Genus database with same CATH topology
1Y14B 4PZ7A 4LUZA 1X54A 1CUKA 3F2BA 3EBEA 4B3RL 3I2ZA 4DR5L 1EWIA 3AYHB 3WWVA 4LUOA 3T1YQ 1SLJA 1YJNA 1VQHA 2N78A 5IYBH 4A3DG 4IFDJ 3L0OA 1CKNB 4QGUA 1FJGQ 4OWXB 4IPGA 2DGYA 1K83H 3OTOL 5C0XI 4K0KL 1P8LA 2RHQB 1IXRA 1QZHA 1G6PA 4L5TA 4A93G 2YV5A 4R1JA 3JAMi 3G71A 4LFCQ 1FVIA 1XTDA 3HOXH 2MNAA 4JI7Q 4B3SL 4GNXA 4A3BG 2AHOB 4L5RC 4DUZL 2AKWB 1WJJA 1NTGA 3SGIA 3RLFA 4LF5L 1UWVA 1DGSA 3FP9A 5GQOA 4JI6L 2ZJRA 4LF4Q 5IP7G 1VQ6A 5GAHC 2HIXA 4JOIC 2ZJQA 4A3MH 4WJ4A 1JT8A 1PH6A 1TWFH 1VQ5A 2E5LQ 4A3LG 3GTMH 4NPSA 4DK3C 5IP7H 5C44G 1M90C 3I55A 4LNQA 1YI2A 1A63A 5H1SE 1HZCA 2KBNA 2LSSA 1NE3A 3K8AA 1XJVA 3GTKH 1VQGA 1VQ8A 3I7FA 2MO0A 3HKZG 2VUMH 1EYGA 1VQLA 2LXKA 3J80i 3RR5A 1Q86C 1AE3A 2KENA 2WFWA 2JE6I 3F2DA 1QUQB 5M5XH 3Q8DA 1Q46A 1U5KA 2EQSA 3S1MH 1TXYA 5IYDH 1EOVA 2I0QA 2CFMA 3T1HL 2ES2A 1JMCA 3HFZB 2K75A 2PI2A 4YCVA 2FXQA 3J81j 4DR3Q 2CKZB 1GM5A 1EUJA 1YHQA 3S17H 2B3GA 2A8VA 5HGQA 1HH2P 5M3MG 1N34L 2YTYA 1V1QA 1LUZA 3CD6A 2ZM6Q 1XNQL 3HKSA 4A3KG 5M3FH 1WOCA 4DV3Q 1X6OA 1PHJA 1IBKL 4DAMA 3HOWH 2B29A 2N49A 4A3JH 4DPGA 2QGQA 1OXUA 4DV6L 3BZKA 5IT9c 4QQBX 3IRBA 1PH2A 1HNXQ 2IHEA 1OTCA 4GKKL 4YWMA 1PYSB 3TS2A 2Z6KA 5FLMG 4JI2L 2ZTEA 1IL2A 1L0WA 1N9WA 1TWCH 2F3IA 4JI3Q 3KLWA 4JC0A 2UUAQ 4JI1L 2PQAB 3CCVA 4OX9Q 3CF5A 3D0FA 4LWCA 4DV5L 4A3CH 1EIYB 2H5XA 1UE7A 1XNQQ 3HOWG 1FL0A 4A3DH 3AEVA 1IBLL 1SROA 2CQOA 1KD1C 2CWAA 1E24A 2JQOA 1X3FA 2BA1A 3GDEA 2JEBI 5ELNA 3J81i 2YU9H 1FJGL 1SMXA 2GN5A 4GLAC 1I3QH 2E2HH 3RZOH 1HNWL 4KI0A 1N33L 4JG2A 4IOCA 2AMCB 4X66L 1TWGH 3B6YA 1QZGA 5HY6A 4GNXC 5IP9G 2ATWA 3M4OH 2K4KA 4RMFA 1IYJB 1RIPA 4DR1L 1XMQL 4A3GG 2VQFQ 4JBMA 5IY0A 3A5UA 3G48A 4POGA 1O7IA 5JEAJ 1VQAA 3GTLH 1XPOA 4WJ3M 1PH3A 3M85A 2NVYH 4A76A 3TEHB 3CC7A 1XNRQ 1X3GA 1X56A 1IBLQ 1K8GA 1OXSC 3K80C 2UU9L 3RN2A 1AH9A 2XGTA 1X9NA 1GO3E 1MIUA 3KDFA 4Y7NH 3ICEA 3FKIG 3EIVA 1YHAA 2RCNA 5E7NA 2VS1A 4QIWE 4QY7A 3W5OA 5M5WH 4X62L 1UE6A 3UE1A 1E22A 5GAGC 4IFDG 3AFQA 1Q7YC 2R7FA 1FGUA 3RLOA 3CMEA 4GOPB 4B3ML 2L15A 3HOUG 2ZTCA 2EIFA 4A3CG 2WP8J 3PO3G 2OQ0A 3HOYH 4AH6A 3HOZG 4P71A 1UEBA 2ALYB 2VQEQ 3U50C 4X64Q 3ERSX 2A1AA 1VQFA 3S1NH 3H15A 1WYDA 2PI2E 1HR0Q 2UU9Q 4GOPA 4DR7L 2R6GA 1SE8A 3G6EA 1NMFA 1KHIA 3CCRA 4LF7L 4R4IA 1E7ZA 3PUXA 5FJ8G 1HZ9A 2K5VA 1CSQA 3GTQH 2ZTDA 2B63G 1NY4A 4UPAA 1TWAH 3HOYG 4X65L 4A3GH 1NMGA 2VW9A 2UXDQ 4L5SA 2Y0SG 3HOZH 2KCTA 4JV5L 4DR5Q 2HT1A 3HOVG 1HNZQ 4YHHL 3BU2A 2MQHA 2VNUD 2LXJA 1PA6A 1HZAA 4HIOA 4JYAQ 3CC4A 4KHPL 1UE1A 1AE2A 2UUBQ 3PF5A 2UXCQ 2E5LL 1KQSA 4GKKQ 1MJCA 2B63H 4JBKA 4DUYL 5IWAQ 4LFAL 1X65A 4DK6C 4NXMQ 1VQMA 4MTNA 4HIKA 5GADC 1M1KC 3S14H 4A3BH 5FLXc 1L1OA 2MFIA 2F4VQ 4DV4Q 2OQKA 3HKZE 4DUZQ 1VQIA 1K3RA 3CCMA 4LUVA 3GD7A 4A75A 3GTOH 2K5NA 5AJ3L 2E2JH 2OTLA 2BH8A 3CPWA 1L2FA 3K7AH 1CSPA 4GLVB 3S1QH 1V9PA 2CWPA 4DV7L 2A19A 4LF6Q 4GKJL 4LFCL 5C4JH 4NB3A 2KCMA 5IE8A 2R7ZH 1C0AA 4A3MG 3T1HQ 3S1RH 4R4CA 4LF8L 1JB7A 2Q2TA 1L1OC 5LMUL 4DV1Q 1VQ9A 4OX9L 2AWOA 5FJ8H 2HHHQ 4B3TQ 3EN2A 1XPRA 1Q12A 4DV4L 2VQFL 2Y0SE 1K73C 4OO1G 5IYBG 4IOAA 2IX0A 1VQ4A 4OO1I 2R92G 1OXVA 3S16H 3CMAA 2JEAI 1EIFA 1IZ6A 3J80c 1S3OA 4KHZA 5LMNQ 4DV0Q 1PV4A 4PMWA 3PV0A 2OWOA 2IY5B 1E1OA 1YEZA 2JA6G 4JBWA 4AIMA 3S2DH 2UXBQ 4X66Q 4NXNL 3M9BA 4BA2I 2KHIA 4A3FG 3PUYA 2C35B 5J3BA 1SRUA 5FLMH 4GKJQ 1B70B 3L2PA 3AFPA 3G4SA 4JI2Q 4JOIA 4HJ9A 3NEMA 2ID0A 1E1TA 2Z0SA 3CW2C 3PO2G 2UUAL 2PQAA 2YTVA 1C7YA 4DR6Q 4BY1H 1CKMA 4HIDA 2Q2UA 2VZAA 4JCVE 5LMNL 1YZ6A 2I5HA 3W1BA 4HJ8A 1W2BA 2WB1G 4DV2L 3PUZA 1N8RC 4POFA 2K52A 4A3JG 3STBD 3J7ZC 4JBJA 3U4ZA 1VQOA 2E2IH 5C0XG 1R9TH 4A3FH 1XPUA 2NZHA 4JI5L 3PUWA 2Z6KC 3FKIH 2N8NA 1YJWA 2R7ZG 1GKHA 3I4OA 2R93H 1J6QA 3KF8B 2UUCQ 3J81c 1I94Q 3U58A 3CCLA 1KRTA 1KIXA 4C2MH 3TREA 3PSIA 1CKOA 3AQQA 3UDXA 1Y1WG 1Z47A 1SFOH 1BBUA 2VY3A 3M4QA 3CPFA 4GN5A 1J5EQ 4BXXH 1PVOA 5JJIA 4LF7Q 4EQ5A 2NN6G 3BJUA 4GLXA 5C44H 1PH9A 2NN6I 1QUQA 2UXCL 2NZOA 4JI7L 3MEFA 2NVQH 4A3LH 2JA7G 4OXPA 3A0JA 4JI1Q 1XMOL 4IPCA 4DAYB 4DUYQ 2YTXA 4HJAA 4A93H 4DR2Q 1MKHA 1YHBA 1Y1WH 5BR8Q 1CKNA 4GN3B 4RG1A 4A3IG 1QVFA 4YHHQ 1PH7A 4LFBL 4BBSH 1K0RA 4C3JH 2MO1A 1L1OB 4B3RQ 3DLLA 3KJOA 4DNIA 3S24A 2UUBL 2JA8G 2HQLA 3T1YL 4ME3A 1QVCA 5C3EG 1N32L 3U4VA 2D0PA 3RZDH 1IBKQ 1N33Q 4IJLA 4MZ9A 3ZJYC 4DR7Q 1OXTA 1RL2A 4MNOA 5IWAL 1VQ7A 4NXML 1Q1BA 2OTJA 4UP9A 1KAWA 2JA5H 2R7DA 1ASZA 3S15H 1H95A 4BBRH 2K5HA 1D7QA 4LF8Q 4BY7G 1WI5A 4AQYL 4GS3A 1UE5A 1PH4A 4DR4L 2R93G 1YVCA 2PMZE 3CAMA 4JI4Q 1JJGA 4B3SQ 3PF4A 1WCMH 3UDFA 2K50A 4JI3L 1YITA 4JI8Q 2BA0A 1JE5A 4XTCS 3M3YH 4YCWA 4GNXB 4A3KH 3NELA 5JJKA 3UE0A 3CCSA 1KRSA 1PYBA 3OTOQ 2Q2HA 4UP8A 3UDGA 4X64L 2VUMG 1N32Q 3A74A 4TQUS 4JI6Q 1A62A 1U0LA 2WAQG 4Y52H 4P75A 4X62Q 3D31A 4BBRG 4DKAC 3KFUA 2HHHL 2JJQA 4R4TA 4UP7A 3GTJH 4JI0L 2I5MX 5DLQE 3K81C 3GTPH 2ZJPA 1X55A 4KLKA 1KC8C 1VQEA 4J15A 3K7UC 1E3PA 1BVSA 1T9HA 4YWKA 4FDBA 4LF5Q 4HIMA 1VQJA 3JC66 4JI8L 3PO3H 1Q81C 4IPHA 2R92H 4HJ5A 4A3IH 5AJ3Q 5IYCG 1PFSA 1X3EA 2GVBA 1HNWQ 4DV2Q 2E8GA 4IO9A 4DV7Q 4K0KQ 3PIPA 3CC2A 2I5LX 1HNXL 4LF9Q 1TWHH 2EXDA 2F52A 3KDFB 1NBWA 1SN8A 1JJCB 3OW2A 1JJ2A 3M7NA 4P74A 2UUCL 1G51A 1Y1VH 4P73A 1MJEA 2DUDA 4GOPC 4BXXG 4DR1Q 1XMQQ 1LTLA 1NJIC 1W3SA 1HNZL 2K14A 1BKBA 3PCOB 4AYBG 5M5YH 1HR0W 4OWWB 2JA6H 4DV0L 1VCIA 1VQBA 2PNHA 3ER0A 3W1GA 3CCQA 4LW1A 2WB1E 4LF4L 3A5ZB 4QJFA 3KYHC 5C0XJ 3TS0A 1HR0L 3I4MH 4TVAB 3KOJA 3DM3A 4IFDI 4YY3Q 3ULJA 1Q82C 4O0AA 4R4QA 2F4VL 1LYLA 1Y1VG 3HOUH 4OWTB 3GTGH 3CCUA 1B7YB 5IP9H 3HOVH 1KL9A 4DR6L 4B3MQ 1J5EL 5BR8L 2IHFA 4DV3L 1HJPA 2RHSB 3KF6B 1K8AC 3H0GG 4DV5Q 3PIOA 1EQQA 3K0XA 4JV5Q 2VQEL 2CCZA 3STBC 3ULLA 1OXXK 3MXNB 1VQCA 4C3HH 2UXBL 4KHPQ 3BZCA 1Q1EA 2JA5G 4O2DA 4YY3L 4C3IH 1YNXA 1V43A 1PH8A 3I4NH 2ASBA 3E9HA 4BA1I 4BY1G 2JA7H 3H3VI 1D8LA 1LM0A 3H0GH 5M3MH 5C4XH 3PO2H 3FHWA 3E0EA 1EQRA 4X65Q 3UDIA 2XTIA 1PH1A 4X6AH 1Q8KA 4R4OA 1VQDA 4GN4B 4UY8C 1XNRL 5LMNW 4ALPA 5IYDG 3CQZH 5GAEC 3I4MG 1G291 2Q2IA 3TQYA 3NENA 4A3EH 2JA8H 3I4NG 4JYAL 3NBHB 5C3EH 3KF6A 3CXCA 2NVXH 2VL6A 1GD7A 2UXDL 2AWNA 3L7ZC 2QA4A 1B8AA 2HIVA 4OONA 4A3EG 1QVGA 1N36L 3E9IA 4AYBE 5EAYA 4LFAQ 1IBMQ 5GROA 4BBSG 3PUVA 5JJLA 3RNUA 1P16A 3ULPA 5IYCH 1N34Q 4LF6L 1GVPA 3CCJA 4XIGS 4PZ8A 2V1CC 1Z9FA 3F8TA 4PG3A 4L5QA 4JI0Q 2OCEA 3J7A5 2D62A 1BBWA 4QL5A 3F2CA 2WAQE 3HOXG 3RLNA 1I5FA 5LMUQ 4DV1L 1YIJA 2JK8A 3I56A 1S72A 4NXNQ 3LGJA 3TRZA 4DR3L 1I94L 1ASYA 2N3SA 4YCUA 1S40A 4A4IA 1WCMG 4AQYQ 4DR4Q 1I6HH 1C9OA 3KJPA 1WFQA 2GVAA 4H02A 1VQKA 5K36G 4JI4L 1YBYA 2JA9A 1N36Q 1IBML 1A8VA 4YWLA 2YYZA 4P72A 2ZM6L 3GO5A 1YJ9A 1KXLA 2NVTH 4PZ6A 1HZBA 4B3TL 5ELOA 3F1ZA 3CCEA 3RN5A 4EX5A 4LFBQ 3H3VH 5M3FG 4LF9L 5C4XG 4APVA 1PH5A 2IT1A 2IX1A 2QEXA 4DV6Q 1VQPA 1SR3A 2KHJA 3VDYA 1VS0A 1K9MC 4HJ7A 1EFWA 1I50H 3CP0A 2RF4A 1XMOQ 3M4PA 1A0IA 4IJHA 2D0OA 4IPDA 3OYYA 4JI5Q 4DR2L 1VQNA 4BY7H 3PGZA 3S2HH 3JAMc 2BH2A 5JEAG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y14 B;  4PZ7 A;  4LUZ A;  1X54 A;  1CUK A;  3F2B A;  3EBE A;  4B3R L;  3I2Z A;  4DR5 L;  1EWI A;  3AYH B;  3WWV A;  4LUO A;  3T1Y Q;  1SLJ A;  1YJN A;  1VQH A;  2N78 A;  5IYB H;  4A3D G;  4IFD J;  3L0O A;  1CKN B;  4QGU A;  1FJG Q;  4OWX B;  4IPG A;  2DGY A;  1K83 H;  3OTO L;  5C0X I;  4K0K L;  1P8L A;  2RHQ B;  1IXR A;  1QZH A;  1G6P A;  4L5T A;  4A93 G;  2YV5 A;  4R1J A;  3JAM i;  3G71 A;  4LFC Q;  1FVI A;  1XTD A;  3HOX H;  2MNA A;  4JI7 Q;  4B3S L;  4GNX A;  4A3B G;  2AHO B;  4L5R C;  4DUZ L;  2AKW B;  1WJJ A;  1NTG A;  3SGI A;  3RLF A;  4LF5 L;  1UWV A;  1DGS A;  3FP9 A;  5GQO A;  4JI6 L;  2ZJR A;  4LF4 Q;  5IP7 G;  1VQ6 A;  5GAH C;  2HIX A;  4JOI C;  2ZJQ A;  4A3M H;  4WJ4 A;  1JT8 A;  1PH6 A;  1TWF H;  1VQ5 A;  2E5L Q;  4A3L G;  3GTM H;  4NPS A;  4DK3 C;  5IP7 H;  5C44 G;  1M90 C;  3I55 A;  4LNQ A;  1YI2 A;  1A63 A;  5H1S E;  1HZC A;  2KBN A;  2LSS A;  1NE3 A;  3K8A A;  1XJV A;  3GTK H;  1VQG A;  1VQ8 A;  3I7F A;  2MO0 A;  3HKZ G;  2VUM H;  1EYG A;  1VQL A;  2LXK A;  3J80 i;  3RR5 A;  1Q86 C;  1AE3 A;  2KEN A;  2WFW A;  2JE6 I;  3F2D A;  1QUQ B;  5M5X H;  3Q8D A;  1Q46 A;  1U5K A;  2EQS A;  3S1M H;  1TXY A;  5IYD H;  1EOV A;  2I0Q A;  2CFM A;  3T1H L;  2ES2 A;  1JMC A;  3HFZ B;  2K75 A;  2PI2 A;  4YCV A;  2FXQ A;  3J81 j;  4DR3 Q;  2CKZ B;  1GM5 A;  1EUJ A;  1YHQ A;  3S17 H;  2B3G A;  2A8V A;  5HGQ A;  1HH2 P;  5M3M G;  1N34 L;  2YTY A;  1V1Q A;  1LUZ A;  3CD6 A;  2ZM6 Q;  1XNQ L;  3HKS A;  4A3K G;  5M3F H;  1WOC A;  4DV3 Q;  1X6O A;  1PHJ A;  1IBK L;  4DAM A;  3HOW H;  2B29 A;  2N49 A;  4A3J H;  4DPG A;  2QGQ A;  1OXU A;  4DV6 L;  3BZK A;  5IT9 c;  4QQB X;  3IRB A;  1PH2 A;  1HNX Q;  2IHE A;  1OTC A;  4GKK L;  4YWM A;  1PYS B;  3TS2 A;  2Z6K A;  5FLM G;  4JI2 L;  2ZTE A;  1IL2 A;  1L0W A;  1N9W A;  1TWC H;  2F3I A;  4JI3 Q;  3KLW A;  4JC0 A;  2UUA Q;  4JI1 L;  2PQA B;  3CCV A;  4OX9 Q;  3CF5 A;  3D0F A;  4LWC A;  4DV5 L;  4A3C H;  1EIY B;  2H5X A;  1UE7 A;  1XNQ Q;  3HOW G;  1FL0 A;  4A3D H;  3AEV A;  1IBL L;  1SRO A;  2CQO A;  1KD1 C;  2CWA A;  1E24 A;  2JQO A;  1X3F A;  2BA1 A;  3GDE A;  2JEB I;  5ELN A;  3J81 i;  2YU9 H;  1FJG L;  1SMX A;  2GN5 A;  4GLA C;  1I3Q H;  2E2H H;  3RZO H;  1HNW L;  4KI0 A;  1N33 L;  4JG2 A;  4IOC A;  2AMC B;  4X66 L;  1TWG H;  3B6Y A;  1QZG A;  5HY6 A;  4GNX C;  5IP9 G;  2ATW A;  3M4O H;  2K4K A;  4RMF A;  1IYJ B;  1RIP A;  4DR1 L;  1XMQ L;  4A3G G;  2VQF Q;  4JBM A;  5IY0 A;  3A5U A;  3G48 A;  4POG A;  1O7I A;  5JEA J;  1VQA A;  3GTL H;  1XPO A;  4WJ3 M;  1PH3 A;  3M85 A;  2NVY H;  4A76 A;  3TEH B;  3CC7 A;  1XNR Q;  1X3G A;  1X56 A;  1IBL Q;  1K8G A;  1OXS C;  3K80 C;  2UU9 L;  3RN2 A;  1AH9 A;  2XGT A;  1X9N A;  1GO3 E;  1MIU A;  3KDF A;  4Y7N H;  3ICE A;  3FKI G;  3EIV A;  1YHA A;  2RCN A;  5E7N A;  2VS1 A;  4QIW E;  4QY7 A;  3W5O A;  5M5W H;  4X62 L;  1UE6 A;  3UE1 A;  1E22 A;  5GAG C;  4IFD G;  3AFQ A;  1Q7Y C;  2R7F A;  1FGU A;  3RLO A;  3CME A;  4GOP B;  4B3M L;  2L15 A;  3HOU G;  2ZTC A;  2EIF A;  4A3C G;  2WP8 J;  3PO3 G;  2OQ0 A;  3HOY H;  4AH6 A;  3HOZ G;  4P71 A;  1UEB A;  2ALY B;  2VQE Q;  3U50 C;  4X64 Q;  3ERS X;  2A1A A;  1VQF A;  3S1N H;  3H15 A;  1WYD A;  2PI2 E;  1HR0 Q;  2UU9 Q;  4GOP A;  4DR7 L;  2R6G A;  1SE8 A;  3G6E A;  1NMF A;  1KHI A;  3CCR A;  4LF7 L;  4R4I A;  1E7Z A;  3PUX A;  5FJ8 G;  1HZ9 A;  2K5V A;  1CSQ A;  3GTQ H;  2ZTD A;  2B63 G;  1NY4 A;  4UPA A;  1TWA H;  3HOY G;  4X65 L;  4A3G H;  1NMG A;  2VW9 A;  2UXD Q;  4L5S A;  2Y0S G;  3HOZ H;  2KCT A;  4JV5 L;  4DR5 Q;  2HT1 A;  3HOV G;  1HNZ Q;  4YHH L;  3BU2 A;  2MQH A;  2VNU D;  2LXJ A;  1PA6 A;  1HZA A;  4HIO A;  4JYA Q;  3CC4 A;  4KHP L;  1UE1 A;  1AE2 A;  2UUB Q;  3PF5 A;  2UXC Q;  2E5L L;  1KQS A;  4GKK Q;  1MJC A;  2B63 H;  4JBK A;  4DUY L;  5IWA Q;  4LFA L;  1X65 A;  4DK6 C;  4NXM Q;  1VQM A;  4MTN A;  4HIK A;  5GAD C;  1M1K C;  3S14 H;  4A3B H;  5FLX c;  1L1O A;  2MFI A;  2F4V Q;  4DV4 Q;  2OQK A;  3HKZ E;  4DUZ Q;  1VQI A;  1K3R A;  3CCM A;  4LUV A;  3GD7 A;  4A75 A;  3GTO H;  2K5N A;  5AJ3 L;  2E2J H;  2OTL A;  2BH8 A;  3CPW A;  1L2F A;  3K7A H;  1CSP A;  4GLV B;  3S1Q H;  1V9P A;  2CWP A;  4DV7 L;  2A19 A;  4LF6 Q;  4GKJ L;  4LFC L;  5C4J H;  4NB3 A;  2KCM A;  5IE8 A;  2R7Z H;  1C0A A;  4A3M G;  3T1H Q;  3S1R H;  4R4C A;  4LF8 L;  1JB7 A;  2Q2T A;  1L1O C;  5LMU L;  4DV1 Q;  1VQ9 A;  4OX9 L;  2AWO A;  5FJ8 H;  2HHH Q;  4B3T Q;  3EN2 A;  1XPR A;  1Q12 A;  4DV4 L;  2VQF L;  2Y0S E;  1K73 C;  4OO1 G;  5IYB G;  4IOA A;  2IX0 A;  1VQ4 A;  4OO1 I;  2R92 G;  1OXV A;  3S16 H;  3CMA A;  2JEA I;  1EIF A;  1IZ6 A;  3J80 c;  1S3O A;  4KHZ A;  5LMN Q;  4DV0 Q;  1PV4 A;  4PMW A;  3PV0 A;  2OWO A;  2IY5 B;  1E1O A;  1YEZ A;  2JA6 G;  4JBW A;  4AIM A;  3S2D H;  2UXB Q;  4X66 Q;  4NXN L;  3M9B A;  4BA2 I;  2KHI A;  4A3F G;  3PUY A;  2C35 B;  5J3B A;  1SRU A;  5FLM H;  4GKJ Q;  1B70 B;  3L2P A;  3AFP A;  3G4S A;  4JI2 Q;  4JOI A;  4HJ9 A;  3NEM A;  2ID0 A;  1E1T A;  2Z0S A;  3CW2 C;  3PO2 G;  2UUA L;  2PQA A;  2YTV A;  1C7Y A;  4DR6 Q;  4BY1 H;  1CKM A;  4HID A;  2Q2U A;  2VZA A;  4JCV E;  5LMN L;  1YZ6 A;  2I5H A;  3W1B A;  4HJ8 A;  1W2B A;  2WB1 G;  4DV2 L;  3PUZ A;  1N8R C;  4POF A;  2K52 A;  4A3J G;  3STB D;  3J7Z C;  4JBJ A;  3U4Z A;  1VQO A;  2E2I H;  5C0X G;  1R9T H;  4A3F H;  1XPU A;  2NZH A;  4JI5 L;  3PUW A;  2Z6K C;  3FKI H;  2N8N A;  1YJW A;  2R7Z G;  1GKH A;  3I4O A;  2R93 H;  1J6Q A;  3KF8 B;  2UUC Q;  3J81 c;  1I94 Q;  3U58 A;  3CCL A;  1KRT A;  1KIX A;  4C2M H;  3TRE A;  3PSI A;  1CKO A;  3AQQ A;  3UDX A;  1Y1W G;  1Z47 A;  1SFO H;  1BBU A;  2VY3 A;  3M4Q A;  3CPF A;  4GN5 A;  1J5E Q;  4BXX H;  1PVO A;  5JJI A;  4LF7 Q;  4EQ5 A;  2NN6 G;  3BJU A;  4GLX A;  5C44 H;  1PH9 A;  2NN6 I;  1QUQ A;  2UXC L;  2NZO A;  4JI7 L;  3MEF A;  2NVQ H;  4A3L H;  2JA7 G;  4OXP A;  3A0J A;  4JI1 Q;  1XMO L;  4IPC A;  4DAY B;  4DUY Q;  2YTX A;  4HJA A;  4A93 H;  4DR2 Q;  1MKH A;  1YHB A;  1Y1W H;  5BR8 Q;  1CKN A;  4GN3 B;  4RG1 A;  4A3I G;  1QVF A;  4YHH Q;  1PH7 A;  4LFB L;  4BBS H;  1K0R A;  4C3J H;  2MO1 A;  1L1O B;  4B3R Q;  3DLL A;  3KJO A;  4DNI A;  3S24 A;  2UUB L;  2JA8 G;  2HQL A;  3T1Y L;  4ME3 A;  1QVC A;  5C3E G;  1N32 L;  3U4V A;  2D0P A;  3RZD H;  1IBK Q;  1N33 Q;  4IJL A;  4MZ9 A;  3ZJY C;  4DR7 Q;  1OXT A;  1RL2 A;  4MNO A;  5IWA L;  1VQ7 A;  4NXM L;  1Q1B A;  2OTJ A;  4UP9 A;  1KAW A;  2JA5 H;  2R7D A;  1ASZ A;  3S15 H;  1H95 A;  4BBR H;  2K5H A;  1D7Q A;  4LF8 Q;  4BY7 G;  1WI5 A;  4AQY L;  4GS3 A;  1UE5 A;  1PH4 A;  4DR4 L;  2R93 G;  1YVC A;  2PMZ E;  3CAM A;  4JI4 Q;  1JJG A;  4B3S Q;  3PF4 A;  1WCM H;  3UDF A;  2K50 A;  4JI3 L;  1YIT A;  4JI8 Q;  2BA0 A;  1JE5 A;  4XTC S;  3M3Y H;  4YCW A;  4GNX B;  4A3K H;  3NEL A;  5JJK A;  3UE0 A;  3CCS A;  1KRS A;  1PYB A;  3OTO Q;  2Q2H A;  4UP8 A;  3UDG A;  4X64 L;  2VUM G;  1N32 Q;  3A74 A;  4TQU S;  4JI6 Q;  1A62 A;  1U0L A;  2WAQ G;  4Y52 H;  4P75 A;  4X62 Q;  3D31 A;  4BBR G;  4DKA C;  3KFU A;  2HHH L;  2JJQ A;  4R4T A;  4UP7 A;  3GTJ H;  4JI0 L;  2I5M X;  5DLQ E;  3K81 C;  3GTP H;  2ZJP A;  1X55 A;  4KLK A;  1KC8 C;  1VQE A;  4J15 A;  3K7U C;  1E3P A;  1BVS A;  1T9H A;  4YWK A;  4FDB A;  4LF5 Q;  4HIM A;  1VQJ A;  3JC6 6;  4JI8 L;  3PO3 H;  1Q81 C;  4IPH A;  2R92 H;  4HJ5 A;  4A3I H;  5AJ3 Q;  5IYC G;  1PFS A;  1X3E A;  2GVB A;  1HNW Q;  4DV2 Q;  2E8G A;  4IO9 A;  4DV7 Q;  4K0K Q;  3PIP A;  3CC2 A;  2I5L X;  1HNX L;  4LF9 Q;  1TWH H;  2EXD A;  2F52 A;  3KDF B;  1NBW A;  1SN8 A;  1JJC B;  3OW2 A;  1JJ2 A;  3M7N A;  4P74 A;  2UUC L;  1G51 A;  1Y1V H;  4P73 A;  1MJE A;  2DUD A;  4GOP C;  4BXX G;  4DR1 Q;  1XMQ Q;  1LTL A;  1NJI C;  1W3S A;  1HNZ L;  2K14 A;  1BKB A;  3PCO B;  4AYB G;  5M5Y H;  1HR0 W;  4OWW B;  2JA6 H;  4DV0 L;  1VCI A;  1VQB A;  2PNH A;  3ER0 A;  3W1G A;  3CCQ A;  4LW1 A;  2WB1 E;  4LF4 L;  3A5Z B;  4QJF A;  3KYH C;  5C0X J;  3TS0 A;  1HR0 L;  3I4M H;  4TVA B;  3KOJ A;  3DM3 A;  4IFD I;  4YY3 Q;  3ULJ A;  1Q82 C;  4O0A A;  4R4Q A;  2F4V L;  1LYL A;  1Y1V G;  3HOU H;  4OWT B;  3GTG H;  3CCU A;  1B7Y B;  5IP9 H;  3HOV H;  1KL9 A;  4DR6 L;  4B3M Q;  1J5E L;  5BR8 L;  2IHF A;  4DV3 L;  1HJP A;  2RHS B;  3KF6 B;  1K8A C;  3H0G G;  4DV5 Q;  3PIO A;  1EQQ A;  3K0X A;  4JV5 Q;  2VQE L;  2CCZ A;  3STB C;  3ULL A;  1OXX K;  3MXN B;  1VQC A;  4C3H H;  2UXB L;  4KHP Q;  3BZC A;  1Q1E A;  2JA5 G;  4O2D A;  4YY3 L;  4C3I H;  1YNX A;  1V43 A;  1PH8 A;  3I4N H;  2ASB A;  3E9H A;  4BA1 I;  4BY1 G;  2JA7 H;  3H3V I;  1D8L A;  1LM0 A;  3H0G H;  5M3M H;  5C4X H;  3PO2 H;  3FHW A;  3E0E A;  1EQR A;  4X65 Q;  3UDI A;  2XTI A;  1PH1 A;  4X6A H;  1Q8K A;  4R4O A;  1VQD A;  4GN4 B;  4UY8 C;  1XNR L;  5LMN W;  4ALP A;  5IYD G;  3CQZ H;  5GAE C;  3I4M G;  1G29 1;  2Q2I A;  3TQY A;  3NEN A;  4A3E H;  2JA8 H;  3I4N G;  4JYA L;  3NBH B;  5C3E H;  3KF6 A;  3CXC A;  2NVX H;  2VL6 A;  1GD7 A;  2UXD L;  2AWN A;  3L7Z C;  2QA4 A;  1B8A A;  2HIV A;  4OON A;  4A3E G;  1QVG A;  1N36 L;  3E9I A;  4AYB E;  5EAY A;  4LFA Q;  1IBM Q;  5GRO A;  4BBS G;  3PUV A;  5JJL A;  3RNU A;  1P16 A;  3ULP A;  5IYC H;  1N34 Q;  4LF6 L;  1GVP A;  3CCJ A;  4XIG S;  4PZ8 A;  2V1C C;  1Z9F A;  3F8T A;  4PG3 A;  4L5Q A;  4JI0 Q;  2OCE A;  3J7A 5;  2D62 A;  1BBW A;  4QL5 A;  3F2C A;  2WAQ E;  3HOX G;  3RLN A;  1I5F A;  5LMU Q;  4DV1 L;  1YIJ A;  2JK8 A;  3I56 A;  1S72 A;  4NXN Q;  3LGJ A;  3TRZ A;  4DR3 L;  1I94 L;  1ASY A;  2N3S A;  4YCU A;  1S40 A;  4A4I A;  1WCM G;  4AQY Q;  4DR4 Q;  1I6H H;  1C9O A;  3KJP A;  1WFQ A;  2GVA A;  4H02 A;  1VQK A;  5K36 G;  4JI4 L;  1YBY A;  2JA9 A;  1N36 Q;  1IBM L;  1A8V A;  4YWL A;  2YYZ A;  4P72 A;  2ZM6 L;  3GO5 A;  1YJ9 A;  1KXL A;  2NVT H;  4PZ6 A;  1HZB A;  4B3T L;  5ELO A;  3F1Z A;  3CCE A;  3RN5 A;  4EX5 A;  4LFB Q;  3H3V H;  5M3F G;  4LF9 L;  5C4X G;  4APV A;  1PH5 A;  2IT1 A;  2IX1 A;  2QEX A;  4DV6 Q;  1VQP A;  1SR3 A;  2KHJ A;  3VDY A;  1VS0 A;  1K9M C;  4HJ7 A;  1EFW A;  1I50 H;  3CP0 A;  2RF4 A;  1XMO Q;  3M4P A;  1A0I A;  4IJH A;  2D0O A;  4IPD A;  3OYY A;  4JI5 Q;  4DR2 L;  1VQN A;  4BY7 H;  3PGZ A;  3S2H H;  3JAM c;  2BH2 A;  5JEA G; 
#chains in the Genus database with same CATH topology
 4LUZ A;  4XQQ A;  3PO2 B;  1EQV A;  3I2Z A;  2PPB C;  2HQE A;  2N78 A;  2RBM A;  4ZRZ A;  3L0O A;  4OWX B;  1STE A;  3OTO L;  4LJZ C;  5ELE A;  3DM1 A;  2JA8 B;  1CI3 M;  4KN7 C;  4A93 G;  3VA5 A;  1XTD A;  3HOX H;  4EVO A;  1CHQ D;  4GNX A;  4L5R C;  1KDB A;  4OHJ A;  2AKW B;  1ENC A;  4ULL A;  1E0B A;  1PFB A;  5LL6 S;  1EWC A;  2K05 A;  2HIX A;  1BQQ T;  1OO9 B;  4WJ4 A;  4A3M H;  1JT8 A;  3KF8 A;  2E5L Q;  4R8N A;  4DK3 C;  1M90 C;  4BWG B;  2PW7 A;  3ZYY X;  2LSS A;  1XJV A;  1PZJ D;  2NVT B;  3KK7 A;  3DEP A;  1VQ8 A;  2RSN A;  3RR5 A;  3WDN A;  2XWJ B;  1AE3 A;  2WFW A;  1Q86 C;  1QUQ B;  4CHT B;  1I50 B;  3DWQ A;  3I8Z A;  4ZCK A;  3S2H B;  3S17 B;  5KIX A;  1RDP D;  2PI2 A;  1ZKO A;  3I4N B;  3J81 j;  2F0U A;  4ZK9 B;  5BN4 A;  1X3P A;  3K59 A;  1N34 L;  2KCN A;  1RCV D;  1XNQ L;  3MHB A;  3HOW B;  4A3K G;  2A69 C;  5I9O A;  1WTV A;  2PYK A;  4A3J H;  1HNX Q;  3BDO A;  1JB3 A;  3WOF A;  4JI2 L;  1V1P B;  3KLW A;  4JC0 A;  2UUA Q;  2E2D C;  3K5M A;  4CGY B;  3D0F A;  4LWC A;  4A3C H;  1EIY B;  1PTO B;  4KJO A;  2CQO A;  3Q0A A;  1X3F A;  2BA1 A;  5ELN A;  1BR9 A;  4MTK A;  5LHY 1;  1N33 L;  4X66 L;  5DM7 3;  1TWG H;  2ATW A;  2B2T A;  1DYQ A;  2QCP X;  5T1G A;  4RMF A;  4DR1 L;  4CJ1 B;  2VQF Q;  2LY7 A;  1DXM A;  5IY0 A;  3A5U A;  3M4O B;  5M3M B;  3G48 A;  1O7I A;  1NNX A;  3C2P A;  1DZ1 A;  1EY7 A;  4FVM A;  3VYS A;  1SDF A;  1OXS C;  3K80 C;  1TVX A;  2XGT A;  4FP5 D;  3KDF A;  4Y7N H;  3HOX B;  4K5W A;  1YHA A;  2RCN A;  4QIW E;  3W5O A;  3SK4 A;  1UE6 A;  4IFD G;  2CQA A;  5C6A A;  2PZU A;  1Q7Y C;  1ZEQ X;  5JVG 3;  1D5M C;  3MFY A;  5EPK A;  2OQ0 A;  4ZKC B;  2HD3 A;  2O2L D;  5CBE E;  4X64 Q;  1EIG A;  2A1A A;  3QIA A;  3H15 A;  2WB1 B;  1QG7 A;  4DF7 A;  2UU9 Q;  3DHQ A;  1NMF A;  3ERQ A;  3GTQ B;  1KHI A;  3W3A A;  1E7Z A;  3PUX A;  1I6H B;  4N8F A;  1CSQ A;  1SSO A;  1DOM A;  1KDC A;  1NY4 A;  1TWA H;  1I4X A;  1NMG A;  2VW9 A;  4JK1 C;  3I4L A;  1JIC A;  4L5S A;  1LV9 A;  4JV5 L;  3MFG A;  1O7Z A;  3PF5 A;  2B2V A;  2E5L L;  4JBK A;  2D2C C;  5C3X A;  4HIK A;  2B63 B;  5GAD C;  3S14 H;  2QF7 A;  2OQK A;  1J8I A;  2Y0S B;  4FXK C;  5IIF A;  1SNM A;  1K3R A;  3A56 A;  3CCM A;  3VR2 A;  5AJ3 L;  2E2J H;  1SFO B;  3CPW A;  2FMM A;  4GLV B;  2CWP A;  2K5Q A;  2A19 A;  4DK0 A;  4GKJ L;  3OWF A;  4NB3 A;  2D9U A;  2B2T C;  2QDL A;  4LF8 L;  5C4J B;  2Q2T A;  5LMU L;  4OX9 L;  2AWO A;  2R93 H;  4OO1 I;  1MI2 A;  2KEC A;  1IZ6 A;  1S3O A;  2YU9 B;  1WTQ A;  3FRP B;  4JBW A;  1I3Q B;  2K6A A;  3R8B A;  4CDF C;  3PIO 3;  2UXB Q;  1I4H A;  4A3F G;  3PUY A;  4ZAI A;  2F0O A;  3MXN A;  3AFP A;  2HCI A;  3GTK B;  4NMZ A;  1YNN C;  2LS0 1;  1C7Y A;  4HID A;  5FLX E;  4DAP A;  4XYQ A;  4JCV E;  3NWS A;  2I5H A;  4POF A;  1JWM D;  2PQE A;  2E2I H;  4YIJ A;  2Z6K C;  3I4O A;  2UUC Q;  3U58 A;  3UDX A;  4PV1 C;  1F2Z A;  2VY3 A;  1WD0 A;  3VYU A;  4BXX H;  5KNB A;  4XT1 B;  5F2D A;  1I4R A;  2X69 A;  3BJU A;  1PH9 A;  2NN6 I;  1D1K A;  2KUM A;  4JI7 L;  2NVQ H;  2EXZ A;  2UXC L;  1XMO L;  4DAY B;  1R4Q B;  1YHB A;  4H13 C;  2KQ3 A;  4LFB L;  4ID6 A;  1XX8 A;  4C3J H;  2MO1 A;  2RDG A;  4B08 A;  5D65 A;  4DNI A;  3OHX C;  3T1Y L;  3RZD H;  1N33 Q;  2A73 B;  2PCF B;  1RL2 A;  5IWA L;  3S15 B;  3U9O A;  4BBR B;  5IGC A;  4BBR H;  4LF8 Q;  4GS3 A;  4DN4 M;  1PH4 A;  1AW7 A;  1JC7 A;  2PMZ E;  1JJG A;  5JJZ A;  1YIT A;  2F0G A;  3H91 A;  3M3Y H;  4GNX B;  2HCC A;  1S5F D;  2H4O A;  1BXT A;  1EZ8 A;  1KRS A;  1PYB A;  5KYI A;  2VUM G;  1N32 Q;  3A74 A;  2F03 A;  1A62 A;  2F1M A;  3D31 A;  2JJQ A;  3GTP H;  3K81 C;  2ZJP A;  2EY6 A;  3ONA B;  5BN5 A;  2L0C A;  1E3P A;  4K6D A;  1BVS A;  1F9P A;  1PRT C;  4FDB A;  5EPJ A;  4HIM A;  2EYF A;  1VQJ A;  4L6T B;  1Q81 C;  2R92 H;  5AJ3 Q;  5IYC G;  4I7Z C;  1X3E A;  4DV2 Q;  2E8G A;  4K0K Q;  3CC2 A;  2I5L X;  5C3W A;  1NBW A;  5JPM C;  1SN8 A;  5CR3 A;  4DAV A;  1ICF B;  3HZX A;  1PFM A;  1WTO A;  2M2L A;  3J81 E;  4BY7 B;  1ENA A;  4P74 A;  1A15 A;  1G51 A;  4P73 A;  1MJE A;  4K14 A;  1CK1 A;  2IW3 A;  1BKB A;  3PCO B;  4AYB G;  4DNR B;  5M5Y H;  4G7H C;  2WB1 E;  1TT2 A;  1TY0 A;  4QJF A;  1B4O A;  5C0X J;  2K28 A;  3N6R A;  4TVA B;  4DU9 A;  1KAA A;  4A3B B;  2F4V L;  5C0X H;  1SBB B;  3CCU A;  4DA2 A;  4DV3 L;  3KF6 B;  3CRK C;  5C5L A;  3H0G G;  3PIO A;  3QG1 A;  1EQQ A;  2K03 A;  4JV5 Q;  4C3H B;  2CCZ A;  3STB C;  4KN4 C;  3MXN B;  1JOR A;  1VQC A;  4KHP Q;  4CKE A;  1Q1E A;  4OIK A;  2JA5 G;  1VF7 A;  2OF1 A;  4YY3 L;  4XT3 B;  1JWU D;  2F3V A;  4BA1 I;  2B2Y C;  1ML0 D;  3OWE B;  2EZV A;  3H3V I;  1D8L A;  5M3M H;  3PO2 H;  2XRQ D;  3E0E A;  2F0N A;  2XTI A;  2X6L A;  4R4O A;  4X3U A;  1EZ6 A;  4GN4 B;  1PRT F;  5EBC A;  5LMN W;  1K8M A;  4ALP A;  3CQZ H;  2K1B A;  4B9X A;  3C1E A;  2Q2I A;  3VR4 A;  4DGZ A;  2JA8 H;  3FPU B;  1BNZ A;  3KF6 A;  1F2Y A;  3M3Y B;  1B8A A;  3E9I A;  4AYB E;  4LFA Q;  4KV6 A;  4ABN A;  1SAP A;  4IUT A;  3C46 A;  1SNQ A;  5IYC H;  1BO0 A;  1GVP A;  5EPL A;  3CCJ A;  2V1C C;  5M3F B;  2IL8 A;  1S5E D;  1DOL A;  2Z9H A;  4PG3 A;  4L5Q A;  3RUZ A;  4JI0 Q;  4K8I A;  3TP7 A;  4QL5 A;  1BBW A;  5LMU Q;  3HOX G;  4A3M B;  3TRZ A;  2SNM A;  5G3L F;  3P7J A;  2N3S A;  1S40 A;  1I6H H;  1WCM G;  1WFQ A;  2GVA A;  3I70 A;  5CV6 A;  5K36 G;  4JI4 L;  2JA9 A;  1IBM L;  1A8V A;  1SNO A;  4QMG A;  2NVT H;  4ODG A;  2J0T D;  3NBI A;  5ELO A;  3CCE A;  2IX1 A;  4DV6 Q;  2RKS A;  3K5L A;  4A3D B;  1XWE A;  5BN3 A;  5C5M A;  1CM9 A;  2VB3 X;  3UI2 A;  1VS0 A;  3VDY A;  1EFW A;  1I50 H;  5CV9 A;  5IGB A;  4IPD A;  3D8G A;  3OYY A;  4WJW A;  3S2H H;  3VYR A;  2BH2 A;  2JA7 B;  3J81 L;  4KY5 A;  2DY8 A;  3EBE A;  4B3R L;  2GA4 B;  1EWI A;  3AYH B;  1SNC A;  5I6W A;  4K0K L;  1WTR A;  4IUP A;  1P8L A;  1TU2 B;  5FO8 B;  5AFW A;  5DEH A;  2YV5 A;  3JAM i;  2F0W A;  4Y7N B;  3VA7 A;  1PYW D;  3FEW X;  2OT2 A;  3R2T A;  4A3B G;  2JP1 A;  3QJY A;  4RGT A;  4C1N K;  1QWY A;  1KLG D;  3HKZ B;  3A8I E;  2ZJR A;  5IP7 G;  1IW7 D;  4JOI C;  1HTL D;  4TSS A;  1EY0 A;  2EYM A;  1TWF H;  3P1H A;  4A3L G;  4NPS A;  4RGM A;  3BYY B;  4LNQ A;  1U4L A;  1A63 A;  5H1S E;  1HZC A;  2KBN A;  3L9A X;  2EJM A;  3K8A A;  5JVH 3;  1O7Y A;  3GTK H;  1Y8N B;  3K5N A;  4U67 3;  3I7F A;  1EU3 A;  1EYG A;  1VQL A;  2KEN A;  3CHB D;  2KCC A;  1D6E C;  1B3A A;  1V1P A;  2Q8T A;  1TXY A;  3T1H L;  2F0D A;  3HFZ B;  4DR3 Q;  1GM5 A;  1EUJ A;  1TQO A;  1HH2 P;  5M3M G;  2AUJ D;  4EQO A;  2YTY A;  2KHS A;  5DNF A;  1LUZ A;  5KRU A;  3QB3 A;  3HKS A;  5M3F H;  3R3O A;  4LAA A;  1X6O A;  2L4N A;  4HED A;  3I90 A;  3BZK A;  1W6K A;  5IT9 c;  1PH2 A;  1PYS B;  3TS2 A;  4PQX A;  5FLM G;  1IL2 A;  1N9W A;  1TWC H;  2F3I A;  4JI3 Q;  5DAU A;  1LT4 D;  4DV5 L;  1FR3 A;  2H5X A;  1XNQ Q;  4EQN A;  4HR7 B;  1FL0 A;  4A3D H;  3J7A V;  1T5X D;  1J9O A;  1KD1 C;  2JEB I;  1FJG L;  1SMX A;  2GN5 A;  3A8J E;  3SK5 A;  1I3Q H;  2E2H H;  1HNW L;  1IKM A;  4KI0 A;  2F0E A;  3MTS A;  4IOC A;  3V05 A;  2AMC B;  4GNX C;  5J1Z A;  4DXF A;  4CKB A;  3M4O H;  1RIP A;  2EYO A;  3Q6S A;  1HFG A;  3I3C A;  1TKW B;  5JEA J;  5KYL A;  1XPO A;  3FVQ A;  1EYA A;  3HP3 A;  1PH3 A;  1JOQ A;  4A76 A;  3TEH B;  1X3G A;  4H44 C;  2BDN A;  1LTG D;  1IHZ A;  1QNU A;  1I4Q A;  1IBL Q;  4G57 A;  5ELC A;  2L11 A;  2N55 A;  3RN2 A;  2H1E A;  4M1U B;  3SHL A;  1GO3 E;  2NUC A;  4L8J A;  5TSS A;  3ICE A;  1KAB A;  3TN2 A;  1TR5 A;  2UXD Q;  4X62 L;  3UE1 A;  1FGU A;  1GUO A;  4B3M L;  2L15 A;  1F2M A;  3HOY B;  1K0S A;  4A3C G;  4NDX A;  2CVR A;  3HOY H;  4AH6 A;  4P71 A;  4HSP A;  2ALY B;  3M4Y A;  5EJW A;  2A69 D;  2JXM B;  3U50 C;  4TKO B;  5E3F A;  4C56 C;  2PI2 E;  1UUP A;  2Q8I B;  2DN8 A;  4GOP A;  4C3H G;  4DR7 L;  1JR0 D;  4ME5 A;  4LF7 L;  3TDQ A;  1HZ9 A;  1H9R A;  2F0H A;  4UPA A;  4X65 L;  4B9W A;  3QR8 A;  4R8I A;  3HOZ H;  1K8O A;  4ZUJ A;  4YHH L;  2B8G A;  4NKL A;  5G3L D;  1YNJ C;  2LXJ A;  4JYA Q;  3CC4 A;  2EE1 A;  1AE2 A;  2UUB Q;  3BZD B;  1EEI D;  1ROD A;  5KGU A;  3PIP 3;  4GKK Q;  4NW2 A;  1X65 A;  1JCK B;  3EJI A;  3NPP A;  1M1K C;  2MFI A;  4DV4 Q;  1HFN A;  3Q24 A;  3HKZ E;  5I2X A;  4I7A A;  4Q0F A;  2NTT A;  1SYB A;  2K5N A;  1GJX A;  1L2F A;  1STY A;  4DV7 L;  1Q90 A;  2F0S A;  4JPB W;  3NBH A;  5C4J H;  3P75 A;  4A3M G;  4J6H A;  2L5T A;  1STB A;  1VQ9 A;  4FF1 A;  3S16 B;  3EN2 A;  1XPR A;  1Q12 A;  2Y0S E;  4OO1 G;  2IX0 A;  2RDF A;  1G2T A;  2R92 G;  5FK9 C;  5C4X B;  3ND9 A;  2OWO A;  4PMW A;  4UDU C;  1YEZ A;  3BVZ A;  3S2D H;  4X66 Q;  5FLX L;  4BA2 I;  1FNW A;  2C35 B;  4DNT B;  4O42 A;  3TP5 A;  4JOI A;  3FDT A;  1KNA A;  2MJ8 A;  3HRZ C;  2C9O A;  2PNR C;  2PQA A;  5IGE A;  3HOZ B;  1JOK A;  2VZA A;  3QWN A;  4KY7 A;  3S9W A;  1JQY D;  1N8R C;  2JA6 B;  2CHB D;  2K52 A;  1EFI D;  3SE0 A;  3STB D;  4A3F B;  4JBJ A;  1VQO A;  5EGT A;  2NZH A;  2JYO A;  1D5Z C;  3FKI H;  3DXJ C;  1J6Q A;  3J81 c;  1I94 Q;  1BCP B;  2G9H D;  3CCL A;  4CBV A;  1KRT A;  4C2M H;  3PSI A;  3A55 A;  1Y1W G;  1VF5 C;  2KED A;  1BBU A;  3HOV B;  3VYT A;  1PVO A;  5JJI A;  4DK1 A;  1PRT B;  2JSO A;  4EQ5 A;  2NN6 G;  4GLX A;  1WVL A;  1QUQ A;  1TII D;  2BDO A;  3MEF A;  2MP1 A;  1QCB D;  1WTH A;  4A3G B;  4IPC A;  4RCO A;  5CGK A;  4HJA A;  3L3O C;  4A93 H;  4ZQ3 A;  4DR2 Q;  1MKH A;  1JOO A;  1Y1W H;  1CKN A;  3QO2 A;  2SNS A;  4YHH Q;  3W2D A;  3DLL A;  4OL7 A;  2D5D A;  2UUB L;  2HQL A;  5C3E G;  3NTH A;  2D0P A;  1B1Z A;  3C1F A;  4HMI A;  3U4V A;  3RZO B;  3K0Y A;  1OXT A;  2OTJ A;  2Z4H A;  2JA5 H;  2R7D A;  1W6J A;  1D7Q A;  2R93 G;  4BY7 G;  1WI5 A;  4AQY L;  4DR4 L;  1YVC A;  3CAM A;  2XRS D;  4JI4 Q;  3PF4 A;  3TBI B;  4XTC S;  4A3K H;  2B2V C;  1TY2 A;  3TME A;  2HUG A;  2B39 A;  3CCS A;  3NTI A;  3OTO Q;  1GUG A;  1STG A;  1CT1 D;  4X64 L;  4TQU S;  1EQT A;  1AFP A;  1CFM A;  2WAQ G;  4Y52 H;  4X62 Q;  3BDL A;  3GTM B;  2F0Q A;  4KLK A;  4J15 A;  4MN3 A;  1ICW A;  3PO3 H;  3BVG A;  2K33 A;  2VUM B;  2AQ3 B;  5JOB A;  2GVB A;  1IL8 A;  4DAY A;  4IO9 A;  2EXD A;  3S1M B;  1HQM C;  3H94 A;  3AMU A;  3OW2 A;  1EY6 A;  3NTK A;  1JJ2 A;  3M7N A;  1DD2 A;  2DUD A;  1SE4 A;  1HUM A;  3SK8 A;  4DXG A;  4KD3 A;  1EYC A;  2K14 A;  3K57 A;  1NJI C;  2CH4 W;  3GQB A;  1HR0 W;  1A6X A;  4DV0 L;  1VCI A;  2B2U A;  3ER0 A;  2Z1C A;  1B2T A;  3TS0 A;  2FIN B;  1HR0 L;  1SJH D;  3EQL C;  3ERO A;  2NWG A;  4YY3 Q;  4O0A A;  2CW0 D;  4OWT B;  1EY9 A;  5JAV A;  3GTG H;  1TS5 A;  1MSG A;  5IP9 H;  2QIL A;  1J5E L;  1RD9 D;  5K5P A;  1HJP A;  1K8A C;  4DV5 Q;  3S1Q B;  3K0X A;  1RTO A;  4OEL B;  1CQV A;  1NUC A;  3NUC A;  1IKL A;  1S5B D;  1OXX K;  4C3H H;  1K28 A;  2UXB L;  1C48 A;  3J80 L;  4O2D A;  2XVS A;  3IKJ A;  4WOR A;  1YNX A;  1V43 A;  3TP8 A;  1BCP F;  3E9H A;  3GV3 A;  2RCF A;  4N8X 1;  2RDH A;  4BY1 G;  1PZI D;  3KLR A;  3FHW A;  1EQR A;  4X65 Q;  3UDI A;  1LTB D;  3V2T A;  1KLU D;  1VQD A;  1S4Z A;  1XNR L;  5D14 A;  5GAE C;  4KKU A;  3I4M G;  2JA5 B;  1BCP C;  1G29 1;  5C3E B;  4FYD A;  3TQY A;  1M8A A;  3NEN A;  1B3Q A;  4Q5V A;  4JYA L;  5A2Q L;  4EGV A;  1Y1V B;  1QJO A;  3L7Z C;  2HIV A;  1N36 L;  4BBS G;  5K36 H;  5JJL A;  3RNU A;  3ULP A;  5EBD A;  1N34 Q;  3H09 A;  2WAC A;  1DCZ A;  1FD7 D;  4PZ8 A;  1Z9F A;  2NN6 H;  2OCE A;  3F2C A;  2WAQ E;  3RLN A;  4J8Q A;  1B44 D;  2HDL A;  1JE4 A;  4A4I A;  4AQY Q;  4DR4 Q;  1X32 A;  2MHV A;  2FHT A;  1FYC A;  1VQK A;  4C2M B;  1YBY A;  1N36 Q;  1AP0 A;  3GO5 A;  4X3S A;  1HZB A;  2AQ1 B;  3A54 A;  1HRJ A;  3RN5 A;  1G6Z A;  2F0M A;  3H3V H;  5M3F G;  5C4X G;  4APV A;  2SOB A;  2SDF A;  2KHJ A;  2DNC A;  3SEB A;  2ZT9 C;  3CP0 A;  2RF4 A;  3M4P A;  4IJH A;  4JI5 Q;  1HTP A;  4DR2 L;  3PGZ A;  1ENF A;  3JAM c;  5JEA G;  4B3M Q;  4R9W A;  1SE2 A;  2L1B A;  3F2B A;  3E5S A;  1EWH A;  4DR5 L;  3GTL B;  3WWV A;  1YJN A;  1SLJ A;  1VQH A;  1ZYR D;  4A3D G;  1CKN B;  1ILQ A;  5C0X I;  2RHQ B;  1IXR A;  1H9J A;  3EVQ A;  1QZH A;  4L5T A;  5E4W C;  3G71 A;  5DM6 3;  1SMY D;  4CJ0 B;  1FVI A;  4LFC Q;  2R7Z B;  3S1R B;  4JI7 Q;  2NBF A;  5EKL A;  2BE5 D;  1EYD A;  3A8K E;  2AHO B;  4PNY A;  3LWE A;  3MXU A;  4OO1 H;  3H6M A;  1WJJ A;  1NTG A;  3SGI A;  4KMU C;  1UAP A;  4LF5 L;  2B8F A;  1DGS A;  3FP9 A;  5GQO A;  4JI6 L;  1QIL A;  1VDZ A;  1PTO H;  4LF4 Q;  5GAH C;  3MZ5 A;  1F9S A;  2PO4 A;  2OXP A;  3GTM H;  2EYH A;  5IP7 H;  5C44 G;  3I55 A;  1E2W A;  1STH A;  4C3I G;  1SE3 A;  1BF4 A;  1VQG A;  2R92 B;  2MO0 A;  3I91 A;  3HKZ G;  2VUM H;  5JPN C;  2LXK A;  3J80 i;  3CQZ B;  2JE6 I;  1MSH A;  2P5Z X;  3J7Y W;  2M9V A;  2B2Y A;  3Q8D A;  1Q46 A;  2EQS A;  3DWA A;  3SR1 A;  1EOV A;  2I0Q A;  2CFM A;  5IOC A;  2ES2 A;  1JMC A;  1EY8 A;  3JAM E;  3AB9 A;  1SEB D;  4YCV A;  2F4I A;  3S17 H;  1TS2 A;  2B3G A;  2BCO A;  3X3M A;  1VMC A;  3R2I A;  4BS9 A;  1V1Q A;  3CD6 A;  2ZM6 Q;  4GZY C;  1BCP D;  4OIJ A;  4DV3 Q;  1MBY A;  1A2U A;  3MWY W;  5T1I A;  3LWU A;  4DAM A;  2B29 A;  4C3J G;  3HOW H;  2K5D A;  5CV5 A;  2QGQ A;  4DPG A;  4QQB X;  2IHE A;  2A68 C;  4YWM A;  3FPP A;  3FMC A;  1PZK D;  1SYE A;  1O78 A;  2ZTE A;  3NQI A;  2EPB A;  2ZXR A;  3D4R A;  4RH6 A;  2PMZ B;  2QKI C;  4ILW A;  1O80 A;  3MVV A;  4OX9 Q;  2J7Z A;  2DY7 A;  3D4W A;  1UE7 A;  3HOW G;  2KA7 A;  2NB0 A;  1E24 A;  2JQO A;  3GDE A;  1ESF A;  3D6C A;  2B2W C;  4L63 B;  3CKI B;  1F77 A;  3B6Y A;  4RCN A;  4FXD A;  2K4K A;  4A3G G;  1II3 A;  4HTH A;  1PMR A;  2EDG A;  3GTL H;  4WJ3 M;  3LNN A;  1FGB D;  5KEE A;  3M85 A;  2NVY H;  3CC7 A;  1EIH A;  2VB2 X;  1K8G A;  3BS1 A;  4V19 0;  2UU9 L;  1X9N A;  1E2Z A;  1MIU A;  3FKI G;  2KOL A;  5M5W H;  2VS1 A;  3DUZ A;  5CV8 A;  5GAG C;  3AFQ A;  3RLO A;  1S5D D;  2QDB A;  3CME A;  2ZTC A;  2EIF A;  2WP8 J;  3PO3 G;  3N52 A;  1GUW A;  1UEB A;  2VQE Q;  3OIQ A;  1VQF A;  3S1N H;  1WYD A;  3O13 A;  4JVZ A;  1AZQ A;  1WD1 A;  1L0X B;  3S1N B;  2O4X A;  3OW7 A;  3G6E A;  1SE8 A;  3KUP A;  3MA2 B;  3CCR A;  2K5V A;  3GTQ H;  2B63 G;  1KTK A;  4KJN A;  4KKT A;  3P20 A;  4A3G H;  2EY2 A;  3DEO A;  1EY4 A;  4E6I A;  3IFT A;  2R61 A;  3DMU A;  3C3L A;  2DJG C;  2HT1 A;  1HNZ Q;  2Z6B A;  2X6G A;  3J7A F;  2MQH A;  1WTW A;  3OPO A;  4KHP L;  1UE1 A;  3NE5 B;  2UXC Q;  1R9T B;  5A2Q E;  1KQS A;  1HUN A;  1MJC A;  2B63 H;  2KEE A;  3S14 B;  1A3U A;  5IWA Q;  4DUY L;  4DK6 C;  4LFA L;  4A3B H;  5FLX c;  1MD2 D;  1IW7 C;  2QW7 A;  3CU7 A;  4DUZ Q;  4QB4 A;  5D3I B;  1VQI A;  4A75 A;  3GTO H;  3GD7 A;  3T51 B;  1QE6 A;  1XTC D;  2BH8 A;  3K7A H;  1PTO F;  1S5C D;  1F2L A;  1U9R A;  4XDX A;  1GHJ A;  1U4M A;  3K6O A;  4H0L C;  3T13 A;  4LFC L;  2KCM A;  2R7Z H;  3MXP A;  3S1R H;  3D3R A;  4R4C A;  2C5C A;  4DV1 Q;  2IWH A;  3HEJ A;  2A5H A;  3GTJ B;  2OEO A;  2HHH Q;  4B3T Q;  1CZG A;  4DV4 L;  2VQF L;  1Y1W B;  1E2V A;  1VQ4 A;  1OXV A;  4FXG C;  3CMA A;  2JEA I;  1EIF A;  3J80 c;  2A6H D;  4HCE A;  4KHZ A;  4DV0 Q;  1PV4 A;  1E1O A;  5EQ0 A;  4AIM A;  5E1F A;  3VR6 A;  2LMC B;  4NXN L;  1TWG B;  3S2D B;  1SRU A;  1B70 B;  2M00 A;  4A3E B;  5C4Z A;  4JI2 Q;  3NEM A;  3VR5 A;  1E1T A;  2Z0S A;  3CW2 C;  2ICI A;  2UUA L;  1FNV A;  1H9K A;  4PMC A;  4DR6 Q;  4BY1 H;  1NSN S;  1T5E A;  4WFN 3;  3W1B A;  1W2B A;  3Q23 A;  1F9R A;  2WB1 G;  4DV2 L;  2E2I B;  4G7O C;  3J7Z C;  4JW0 A;  3U4Z A;  1LAB A;  1D5X C;  1Z7T A;  5C0X G;  3ND8 A;  2XNA C;  4JI5 L;  4IUQ A;  3MAQ A;  1RF2 D;  2R7Z G;  1LTR D;  4FNF A;  2E75 C;  4ZLT F;  3OMG A;  1X3Q A;  2F0T A;  1KIX A;  1AZP A;  3TRE A;  4G7Z C;  3AQQ A;  1Z47 A;  4QUF A;  1SFO H;  3PO3 B;  3M4Q A;  4GN5 A;  4IZ8 A;  4LF7 Q;  2WAQ B;  3OOC A;  2PW5 A;  5C44 H;  3HG9 A;  2NZO A;  2XN9 C;  5C44 B;  4OXP A;  1ET9 A;  4JI1 Q;  2YTX A;  2DNE A;  2WII B;  4ZKB B;  2HDM A;  4C3I B;  3J80 E;  4RG1 A;  4A3I G;  4N9T A;  1K0R A;  1RTN A;  4B3R Q;  4P2C B;  3KJO A;  3RZD B;  2Q8R E;  3S24 A;  1STA A;  1LT3 D;  2JA8 G;  1N32 L;  3HGB A;  1IBK Q;  4IJL A;  3ZJY C;  4DR7 Q;  4MNO A;  5I6Y A;  1Q1B A;  4UP9 A;  1H95 A;  1GXD C;  1ASZ A;  2K5H A;  5CBA E;  1UE5 A;  2RQX A;  4B3S Q;  3HOU B;  3GTO B;  3OMC A;  3TP6 A;  2K50 A;  2NVX B;  4JI3 L;  2BA0 A;  1JE5 A;  4YCW A;  5JJK A;  2LKV A;  1BUV T;  4UP8 A;  4XXE A;  1V1O A;  1HQR D;  1U0L A;  4RFB A;  3MXG A;  1V8Q A;  4BBR G;  2HHH L;  4R4T A;  4JI0 L;  2PZW A;  2I5M X;  1X55 A;  3H3V C;  1VQE A;  4LF5 Q;  2A6H C;  3E3X A;  3JC6 6;  4JI8 L;  4IPH A;  1DON A;  1FNU A;  1UEA B;  4HJ5 A;  2K32 A;  4A3I H;  3HS0 C;  3OSO A;  1HNW Q;  3NHH A;  4DV7 Q;  4LF9 Q;  4F87 A;  3KDF B;  1CTM A;  4K2K A;  3E0J A;  1EEF D;  2UUC L;  5M5Y B;  4BXX G;  4DR1 Q;  1HNZ L;  1W3S A;  5D3D A;  2IJ0 A;  1BBX C;  1VQB A;  2A6E D;  3W1G A;  3CCQ A;  4LF4 L;  3IAY A;  3A5Z B;  2EYJ A;  3I4M B;  5IGG A;  3EA6 A;  3Q22 A;  1LTT D;  3I4M H;  1O7L A;  3DM3 A;  1NCV A;  3KOJ A;  1RHP A;  4R4Q A;  1LYL A;  1Y1V G;  3T4A C;  3HOU H;  2ICE C;  3BVM A;  4QUC A;  1STN A;  3HOV H;  1KL9 A;  3G7L A;  5BR8 L;  2XWB B;  5ELB A;  4XYO A;  4V0B A;  2QEJ C;  3U9S A;  2VQE L;  4UHV A;  5EKI A;  3ULL A;  3URY A;  2NVQ B;  2F0J A;  5IGF A;  2NYZ D;  2BOS A;  5ELF A;  4C3I H;  1L0Y B;  1HPC A;  1LM0 A;  4S3S A;  3H0G B;  2F0P A;  1PH1 A;  2MUY A;  1Q8K A;  5FOB B;  1SYD A;  1XXG A;  1TWH B;  5IYD G;  1LLR D;  1CHP D;  4A3E H;  3RD4 A;  4EQP A;  1WCM B;  3CXC A;  1GD7 A;  2AWN A;  3I4N H;  1QVG A;  1IBM Q;  5EAY A;  1U4P A;  5IGD A;  3PUV A;  2O5J C;  1I4P A;  5EKK A;  1GUT A;  3JAM L;  1VMP A;  3F8T A;  1CA5 A;  2EYP A;  2D62 A;  1YIJ A;  4DV1 L;  3FKI B;  1I5F A;  1G8Z D;  4X3T A;  2JK8 A;  2DJF C;  3IFD A;  3I56 A;  3LGJ A;  1I94 L;  1ASY A;  1D2B A;  3K58 A;  3GTG B;  2RSO A;  3KLS A;  1C9O A;  2KJX A;  2PZT A;  4H02 A;  1TS4 A;  3IL8 A;  4YWL A;  4P72 A;  1YJ9 A;  4IQZ A;  1MGS A;  3SDZ A;  3V96 A;  4LF9 L;  1PH5 A;  2IT1 A;  2QEX A;  1SR3 A;  3KLS X;  4IUR A;  2EY5 A;  1K9M C;  4HJ7 A;  4K6L A;  1PXU A;  5ELD A;  1XMO Q;  2D0O A;  2E2H B;  4A93 B;  4RAU C;  2IX3 A;  1Y14 B;  4PZ7 A;  1X54 A;  1CUK A;  1BOS A;  2EY1 A;  3VR3 A;  4LUO A;  3T1Y Q;  4IFD J;  5IYB H;  2RVL A;  3TSS A;  2NVY B;  4QGU A;  1FJG Q;  2F0V A;  4IPG A;  1HA5 A;  1K83 H;  2DGY A;  4DFA A;  1PDQ A;  4CDC C;  1G6P A;  4IFD H;  4R1J A;  2EVB A;  4QCL A;  4F8M A;  2MNA A;  2B2U C;  4B3S L;  2NZ1 D;  3MC0 B;  4DUZ L;  3RLF A;  1WTP A;  1UWV A;  1HHV A;  4C1N I;  1VQ6 A;  1TWF B;  2ZJQ A;  2I46 A;  1QB5 D;  1PH6 A;  1VQ5 A;  1I4G A;  3NSW A;  1YI2 A;  1ET6 A;  2E76 C;  1NE3 A;  4KK7 A;  2A68 D;  3BG3 A;  4A3I B;  5COY A;  5M5X B;  1ONL A;  1F9Q A;  3F2D A;  2BE5 C;  5M5X H;  1CZW A;  1U5K A;  3S1M H;  5IYD H;  4J1M A;  4KY6 A;  1B9N A;  4XQN A;  1PTO D;  2K75 A;  4KHV A;  5I4D A;  2ZXO A;  2FXQ A;  2CKZ B;  1GUN A;  1YHQ A;  2A8V A;  5HGQ A;  1EU4 A;  1Y8P B;  3NP8 A;  4MIU A;  4RKL A;  4K2L A;  3CRL C;  1WOC A;  2EOT A;  1PHJ A;  2L9H A;  1IBK L;  2N49 A;  3GV6 A;  4DV6 L;  1OXU A;  2EJG C;  3IRB A;  5IT9 L;  4GKK L;  1OTC A;  1K3B C;  1SYF A;  3QOL A;  4QF4 A;  2Z6K A;  4HN7 A;  2B2W A;  2F3W A;  1L0W A;  2XIW A;  4JI1 L;  2PQA B;  3CCV A;  2A6E C;  3CF5 A;  2E74 C;  4WRD A;  1B53 A;  3EFX D;  5CV4 A;  1PTO C;  3NWT A;  1PFN A;  4C3J B;  3AEV A;  1IBL L;  1SRO A;  4NP5 A;  2CWA A;  3RMH A;  1CA6 A;  1Y8O B;  3J81 i;  1DJR D;  2YU9 H;  1LT5 D;  2EJF C;  4CDD C;  1SND A;  5LL6 X;  1B9M A;  4GLA C;  3RZO H;  1Y69 U;  3K5O A;  4JG2 A;  4OEM B;  1LT6 D;  1QZG A;  5HY6 A;  1H9S A;  5IP9 G;  2TMP A;  1KDA A;  1IYJ B;  5HUR A;  1XMQ L;  4JBM A;  4POG A;  1VQA A;  2RA4 A;  1KNE A;  1SJE D;  4CJ2 C;  4BY1 B;  1XNR Q;  1EL0 A;  1X56 A;  1QNK A;  3SK6 A;  3T56 B;  2E2J B;  2WIN B;  5FKA C;  1AH9 A;  3EIV A;  4PMB A;  5E7N A;  4QY7 A;  1E22 A;  4X3K A;  2R7F A;  5J22 A;  1SXT A;  4GOP B;  1UNS A;  4KKS A;  3HOU G;  5NUC A;  1AEX A;  1JWS D;  3HOZ G;  1RJT A;  3ERS X;  3OIP A;  4RGO S;  1HR0 Q;  1NAP A;  2R6G A;  2K04 A;  2Z4I A;  4R4I A;  5FJ8 G;  1TWC B;  2ZTD A;  1TS3 A;  2J4X A;  3HOY G;  1YNN D;  4AYB B;  2F0L A;  4ZUI A;  5L37 A;  3NXW A;  2Y0S G;  4K8J A;  2Z8L A;  2KCT A;  4DR5 Q;  3HOV G;  2F0I A;  3BU2 A;  2VNU D;  1HCZ A;  3TZD A;  1PA6 A;  2L12 A;  1HZA A;  4HIO A;  4XQJ A;  1GHK A;  4NXM Q;  3LX0 A;  1LTS D;  2K7V A;  1VQM A;  4MTN A;  4UAI A;  1L1O A;  2FMC A;  4FO2 A;  2F4V Q;  4RHS A;  3SXH A;  4LUV A;  4MHE A;  5M9O A;  2OTL A;  4RGN A;  1LTA D;  1CSP A;  1Z6H A;  3S1Q H;  1V9P A;  4LF6 Q;  1ZXT A;  5IE8 A;  1C0A A;  3T1H Q;  1PLF A;  4ZYS A;  1JB7 A;  1L1O C;  4K5V A;  3AU7 A;  3WOE A;  2R93 B;  5FJ8 H;  1R4P B;  5ISR A;  1A3T A;  4IUU A;  4M8A A;  1K73 C;  4HSV A;  5IYB G;  4IOA A;  3S16 H;  4N9P A;  2F0K A;  1I6V C;  1PRT D;  5LMN Q;  2IY5 B;  3PV0 A;  2AUK A;  2JA6 G;  3MEH A;  3M9B A;  2KHI A;  2IPK D;  5E4X A;  3KBG A;  5J3B A;  5FLM H;  4GKJ Q;  1C4Q A;  3L2P A;  2CW0 C;  3G4S A;  4HJ9 A;  4Z9C B;  2ID0 A;  3PO2 G;  4OGQ C;  1LAC A;  2YTV A;  5CV7 A;  1CKM A;  1SMY C;  1HXY D;  2KVM A;  5J39 A;  2Q2U A;  4IUN A;  4LMQ D;  1XYI A;  5LMN L;  4A3K B;  1YZ6 A;  4HJ8 A;  3PUZ A;  2SEB D;  4A3J G;  2FFK B;  4I65 A;  5M5W B;  1R9T H;  4A3F H;  1XPU A;  3PUW A;  2N8N A;  1YJW A;  5CYU A;  1GKH A;  1SYC A;  2K5W A;  3KF8 B;  3G6J B;  1G91 A;  2F0F A;  1CKO A;  3I72 A;  5IT9 E;  3CPF A;  3NK9 A;  4G4K A;  1J5E Q;  5IOD A;  1EOT A;  4IN3 A;  4A3L H;  2JA7 G;  1GOZ A;  3A0J A;  5FO7 B;  3SVM A;  4DUY Q;  2O5I C;  1B50 A;  5BR8 Q;  1C8C A;  2MGS A;  2WKD A;  4GN3 B;  1QVF A;  1PH7 A;  3D6W A;  2MPM A;  4BBS H;  1L1O B;  1GUS A;  4IUV A;  4CKC A;  5KND A;  4ME3 A;  1QVC A;  4O1N A;  4MZ9 A;  1VQ7 A;  1ESR A;  1K83 B;  4NXM L;  1IYU A;  4F7X A;  3A7A B;  1KAW A;  3S15 H;  4FF3 A;  2G5D A;  1WCM H;  3UDF A;  4JI8 Q;  3K7A B;  3NEL A;  3T53 B;  3GP7 A;  3UE0 A;  4RA8 A;  3T16 A;  2Q2H A;  4H7B A;  5KNC A;  3UDG A;  4JI6 Q;  1D1I A;  3GTP B;  4P75 A;  1EY5 A;  2LFN A;  4DKA C;  4HMJ A;  3KFU A;  4UP7 A;  3GTJ H;  3E6Z X;  4HCS A;  5DLQ E;  1H9M A;  2I07 B;  1G2S A;  4IAL A;  1KC8 C;  3K7U C;  1T9H A;  4YWK A;  5CMD A;  2XSC A;  2ENB A;  1PFS A;  3F2U A;  3PIP A;  1M4V A;  1HNX L;  1TWH H;  2F52 A;  5C4H A;  3I73 A;  2EYL A;  1JJC B;  1TWA B;  1Y1V H;  2R3Z A;  2K01 A;  5FO9 B;  4GOP C;  1XMQ Q;  1MHW C;  1LTL A;  2JA6 H;  4OWW B;  2VXW A;  4FF4 A;  2PNH A;  1H9S B;  4LW1 A;  4F88 A;  3KYH C;  2WV6 D;  1ILP A;  4A3J B;  1SNP A;  1BDO A;  1NR2 A;  1AN8 A;  4IFD I;  3ULJ A;  1Q82 C;  3ITP A;  5I2Y A;  4KTA A;  5I9P A;  5A35 A;  2TSS A;  4K5X A;  2CH4 A;  1B7Y B;  4DR6 L;  2V4D A;  2IHF A;  1DM0 B;  2RHS B;  1Q8I A;  3M7G A;  3BYT B;  1U4R A;  4TRD A;  4HAE A;  1DOK A;  2N88 A;  3D4D A;  1IYV A;  3BZC A;  2AQ2 B;  4RWS C;  5COR A;  1PH8 A;  2ASB A;  4RKB A;  4BBS B;  1RKN A;  1NR4 A;  3QOJ A;  2JA7 H;  3H0G H;  5C4X H;  4X6A H;  2FJ2 A;  2JN4 A;  3NQT A;  1Q3L A;  1WTX A;  4UY8 C;  1CQF A;  2WKC A;  3PMF A;  4CDE C;  3DWP A;  5HGT A;  3I4N G;  3NBH B;  2NTS A;  5C3E H;  5JEA H;  3KBX A;  3BDC A;  2NVX H;  2VL6 A;  2UXD L;  1HA6 A;  4KD4 A;  2QA4 A;  3A7L A;  4A3E G;  4OON A;  5CC4 A;  5GRO A;  4LK1 C;  1P16 A;  1YNJ D;  4LF6 L;  4XIG S;  4FF2 A;  3J7A 5;  4NXN Q;  1QOH A;  1S72 A;  2A74 C;  4DR3 L;  4YCU A;  2ZXP A;  1SYG A;  3KJP A;  1A2T A;  4QIW B;  3PQI A;  1A3V A;  1LO5 D;  2YYZ A;  2ZM6 L;  3R93 A;  1KXL A;  1ZYR C;  4PZ6 A;  4B3T L;  3X3N A;  3F1Z A;  4LFB Q;  4EX5 A;  4RHR A;  3TZU A;  1VQP A;  4U68 A;  2L55 A;  1A0I A;  4BY7 H;  1VQN A;  1LTI D;  2G9D A; 
#chains in the Genus database with same CATH homology
 1Y14 B;  4PZ7 A;  4LUZ A;  1X54 A;  1CUK A;  3F2B A;  3EBE A;  4B3R L;  3I2Z A;  4DR5 L;  1EWI A;  3AYH B;  3WWV A;  4LUO A;  3T1Y Q;  1SLJ A;  1YJN A;  1VQH A;  2N78 A;  5IYB H;  4A3D G;  4IFD J;  3L0O A;  1CKN B;  4QGU A;  1FJG Q;  4OWX B;  4IPG A;  2DGY A;  1K83 H;  3OTO L;  5C0X I;  4K0K L;  1P8L A;  2RHQ B;  1IXR A;  1QZH A;  1G6P A;  4L5T A;  4A93 G;  2YV5 A;  4R1J A;  3JAM i;  3G71 A;  4LFC Q;  1FVI A;  1XTD A;  3HOX H;  2MNA A;  4JI7 Q;  4B3S L;  4GNX A;  4A3B G;  2AHO B;  4L5R C;  4DUZ L;  2AKW B;  1WJJ A;  1NTG A;  3SGI A;  3RLF A;  4LF5 L;  1UWV A;  1DGS A;  3FP9 A;  5GQO A;  4JI6 L;  2ZJR A;  4LF4 Q;  5IP7 G;  1VQ6 A;  5GAH C;  2HIX A;  4JOI C;  2ZJQ A;  4A3M H;  4WJ4 A;  1JT8 A;  1PH6 A;  1TWF H;  1VQ5 A;  2E5L Q;  4A3L G;  3GTM H;  4NPS A;  4DK3 C;  5IP7 H;  5C44 G;  1M90 C;  3I55 A;  4LNQ A;  1YI2 A;  1A63 A;  5H1S E;  1HZC A;  2KBN A;  2LSS A;  1NE3 A;  3K8A A;  1XJV A;  3GTK H;  1VQG A;  1VQ8 A;  3I7F A;  2MO0 A;  3HKZ G;  2VUM H;  1EYG A;  1VQL A;  2LXK A;  3J80 i;  3RR5 A;  1Q86 C;  1AE3 A;  2KEN A;  2WFW A;  2JE6 I;  3F2D A;  1QUQ B;  5M5X H;  3Q8D A;  1Q46 A;  1U5K A;  2EQS A;  3S1M H;  1TXY A;  5IYD H;  1EOV A;  2I0Q A;  2CFM A;  3T1H L;  2ES2 A;  1JMC A;  3HFZ B;  2K75 A;  2PI2 A;  4YCV A;  2FXQ A;  3J81 j;  4DR3 Q;  2CKZ B;  1GM5 A;  1EUJ A;  1YHQ A;  3S17 H;  2B3G A;  2A8V A;  5HGQ A;  1HH2 P;  5M3M G;  1N34 L;  2YTY A;  1V1Q A;  1LUZ A;  3CD6 A;  2ZM6 Q;  1XNQ L;  3HKS A;  4A3K G;  5M3F H;  1WOC A;  4DV3 Q;  1X6O A;  1PHJ A;  1IBK L;  4DAM A;  3HOW H;  2B29 A;  2N49 A;  4A3J H;  4DPG A;  2QGQ A;  1OXU A;  4DV6 L;  3BZK A;  5IT9 c;  4QQB X;  3IRB A;  1PH2 A;  1HNX Q;  2IHE A;  1OTC A;  4GKK L;  4YWM A;  1PYS B;  3TS2 A;  2Z6K A;  5FLM G;  4JI2 L;  2ZTE A;  1IL2 A;  1L0W A;  1N9W A;  1TWC H;  2F3I A;  4JI3 Q;  3KLW A;  4JC0 A;  2UUA Q;  4JI1 L;  2PQA B;  3CCV A;  4OX9 Q;  3CF5 A;  3D0F A;  4LWC A;  4DV5 L;  4A3C H;  1EIY B;  2H5X A;  1UE7 A;  1XNQ Q;  3HOW G;  1FL0 A;  4A3D H;  3AEV A;  1IBL L;  1SRO A;  2CQO A;  1KD1 C;  2CWA A;  1E24 A;  2JQO A;  1X3F A;  2BA1 A;  3GDE A;  2JEB I;  5ELN A;  3J81 i;  2YU9 H;  1FJG L;  1SMX A;  2GN5 A;  4GLA C;  1I3Q H;  2E2H H;  3RZO H;  1HNW L;  4KI0 A;  1N33 L;  4JG2 A;  4IOC A;  2AMC B;  4X66 L;  1TWG H;  3B6Y A;  1QZG A;  5HY6 A;  4GNX C;  5IP9 G;  2ATW A;  3M4O H;  2K4K A;  4RMF A;  1IYJ B;  1RIP A;  4DR1 L;  1XMQ L;  4A3G G;  2VQF Q;  4JBM A;  5IY0 A;  3A5U A;  3G48 A;  4POG A;  1O7I A;  5JEA J;  1VQA A;  3GTL H;  1XPO A;  4WJ3 M;  1PH3 A;  3M85 A;  2NVY H;  4A76 A;  3TEH B;  3CC7 A;  1XNR Q;  1X3G A;  1X56 A;  1IBL Q;  1K8G A;  1OXS C;  3K80 C;  2UU9 L;  3RN2 A;  1AH9 A;  2XGT A;  1X9N A;  1GO3 E;  1MIU A;  3KDF A;  4Y7N H;  3ICE A;  3FKI G;  3EIV A;  1YHA A;  2RCN A;  5E7N A;  2VS1 A;  4QIW E;  4QY7 A;  3W5O A;  5M5W H;  4X62 L;  1UE6 A;  3UE1 A;  1E22 A;  5GAG C;  4IFD G;  3AFQ A;  1Q7Y C;  2R7F A;  1FGU A;  3RLO A;  3CME A;  4GOP B;  4B3M L;  2L15 A;  3HOU G;  2ZTC A;  2EIF A;  4A3C G;  2WP8 J;  3PO3 G;  2OQ0 A;  3HOY H;  4AH6 A;  3HOZ G;  4P71 A;  1UEB A;  2ALY B;  2VQE Q;  3U50 C;  4X64 Q;  3ERS X;  2A1A A;  1VQF A;  3S1N H;  3H15 A;  1WYD A;  2PI2 E;  1HR0 Q;  2UU9 Q;  4GOP A;  4DR7 L;  2R6G A;  1SE8 A;  3G6E A;  1NMF A;  1KHI A;  3CCR A;  4LF7 L;  4R4I A;  1E7Z A;  3PUX A;  5FJ8 G;  1HZ9 A;  2K5V A;  1CSQ A;  3GTQ H;  2ZTD A;  2B63 G;  1NY4 A;  4UPA A;  1TWA H;  3HOY G;  4X65 L;  4A3G H;  1NMG A;  2VW9 A;  2UXD Q;  4L5S A;  2Y0S G;  3HOZ H;  2KCT A;  4JV5 L;  4DR5 Q;  2HT1 A;  3HOV G;  1HNZ Q;  4YHH L;  3BU2 A;  2MQH A;  2VNU D;  2LXJ A;  1PA6 A;  1HZA A;  4HIO A;  4JYA Q;  3CC4 A;  4KHP L;  1UE1 A;  1AE2 A;  2UUB Q;  3PF5 A;  2UXC Q;  2E5L L;  1KQS A;  4GKK Q;  1MJC A;  2B63 H;  4JBK A;  4DUY L;  5IWA Q;  4LFA L;  1X65 A;  4DK6 C;  4NXM Q;  1VQM A;  4MTN A;  4HIK A;  5GAD C;  1M1K C;  3S14 H;  4A3B H;  5FLX c;  1L1O A;  2MFI A;  2F4V Q;  4DV4 Q;  2OQK A;  3HKZ E;  4DUZ Q;  1VQI A;  1K3R A;  3CCM A;  4LUV A;  3GD7 A;  4A75 A;  3GTO H;  2K5N A;  5AJ3 L;  2E2J H;  2OTL A;  2BH8 A;  3CPW A;  1L2F A;  3K7A H;  1CSP A;  4GLV B;  3S1Q H;  1V9P A;  2CWP A;  4DV7 L;  2A19 A;  4LF6 Q;  4GKJ L;  4LFC L;  5C4J H;  4NB3 A;  2KCM A;  5IE8 A;  2R7Z H;  1C0A A;  4A3M G;  3T1H Q;  3S1R H;  4R4C A;  4LF8 L;  1JB7 A;  2Q2T A;  1L1O C;  5LMU L;  4DV1 Q;  1VQ9 A;  4OX9 L;  2AWO A;  5FJ8 H;  2HHH Q;  4B3T Q;  3EN2 A;  1XPR A;  1Q12 A;  4DV4 L;  2VQF L;  2Y0S E;  1K73 C;  4OO1 G;  5IYB G;  4IOA A;  2IX0 A;  1VQ4 A;  4OO1 I;  2R92 G;  1OXV A;  3S16 H;  3CMA A;  2JEA I;  1EIF A;  1IZ6 A;  3J80 c;  1S3O A;  4KHZ A;  5LMN Q;  4DV0 Q;  1PV4 A;  4PMW A;  3PV0 A;  2OWO A;  2IY5 B;  1E1O A;  1YEZ A;  2JA6 G;  4JBW A;  4AIM A;  3S2D H;  2UXB Q;  4X66 Q;  4NXN L;  3M9B A;  4BA2 I;  2KHI A;  4A3F G;  3PUY A;  2C35 B;  5J3B A;  1SRU A;  5FLM H;  4GKJ Q;  1B70 B;  3L2P A;  3AFP A;  3G4S A;  4JI2 Q;  4JOI A;  4HJ9 A;  3NEM A;  2ID0 A;  1E1T A;  2Z0S A;  3CW2 C;  3PO2 G;  2UUA L;  2PQA A;  2YTV A;  1C7Y A;  4DR6 Q;  4BY1 H;  1CKM A;  4HID A;  2Q2U A;  2VZA A;  4JCV E;  5LMN L;  1YZ6 A;  2I5H A;  3W1B A;  4HJ8 A;  1W2B A;  2WB1 G;  4DV2 L;  3PUZ A;  1N8R C;  4POF A;  2K52 A;  4A3J G;  3STB D;  3J7Z C;  4JBJ A;  3U4Z A;  1VQO A;  2E2I H;  5C0X G;  1R9T H;  4A3F H;  1XPU A;  2NZH A;  4JI5 L;  3PUW A;  2Z6K C;  3FKI H;  2N8N A;  1YJW A;  2R7Z G;  1GKH A;  3I4O A;  2R93 H;  1J6Q A;  3KF8 B;  2UUC Q;  3J81 c;  1I94 Q;  3U58 A;  3CCL A;  1KRT A;  1KIX A;  4C2M H;  3TRE A;  3PSI A;  1CKO A;  3AQQ A;  3UDX A;  1Y1W G;  1Z47 A;  1SFO H;  1BBU A;  2VY3 A;  3M4Q A;  3CPF A;  4GN5 A;  1J5E Q;  4BXX H;  1PVO A;  5JJI A;  4LF7 Q;  4EQ5 A;  2NN6 G;  3BJU A;  4GLX A;  5C44 H;  1PH9 A;  2NN6 I;  1QUQ A;  2UXC L;  2NZO A;  4JI7 L;  3MEF A;  2NVQ H;  4A3L H;  2JA7 G;  4OXP A;  3A0J A;  4JI1 Q;  1XMO L;  4IPC A;  4DAY B;  4DUY Q;  2YTX A;  4HJA A;  4A93 H;  4DR2 Q;  1MKH A;  1YHB A;  1Y1W H;  5BR8 Q;  1CKN A;  4GN3 B;  4RG1 A;  4A3I G;  1QVF A;  4YHH Q;  1PH7 A;  4LFB L;  4BBS H;  1K0R A;  4C3J H;  2MO1 A;  1L1O B;  4B3R Q;  3DLL A;  3KJO A;  4DNI A;  3S24 A;  2UUB L;  2JA8 G;  2HQL A;  3T1Y L;  4ME3 A;  1QVC A;  5C3E G;  1N32 L;  3U4V A;  2D0P A;  3RZD H;  1IBK Q;  1N33 Q;  4IJL A;  4MZ9 A;  3ZJY C;  4DR7 Q;  1OXT A;  1RL2 A;  4MNO A;  5IWA L;  1VQ7 A;  4NXM L;  1Q1B A;  2OTJ A;  4UP9 A;  1KAW A;  2JA5 H;  2R7D A;  1ASZ A;  3S15 H;  1H95 A;  4BBR H;  2K5H A;  1D7Q A;  4LF8 Q;  4BY7 G;  1WI5 A;  4AQY L;  4GS3 A;  1UE5 A;  1PH4 A;  4DR4 L;  2R93 G;  1YVC A;  2PMZ E;  3CAM A;  4JI4 Q;  1JJG A;  4B3S Q;  3PF4 A;  1WCM H;  3UDF A;  2K50 A;  4JI3 L;  1YIT A;  4JI8 Q;  2BA0 A;  1JE5 A;  4XTC S;  3M3Y H;  4YCW A;  4GNX B;  4A3K H;  3NEL A;  5JJK A;  3UE0 A;  3CCS A;  1KRS A;  1PYB A;  3OTO Q;  2Q2H A;  4UP8 A;  3UDG A;  4X64 L;  2VUM G;  1N32 Q;  3A74 A;  4TQU S;  4JI6 Q;  1A62 A;  1U0L A;  2WAQ G;  4Y52 H;  4P75 A;  4X62 Q;  3D31 A;  4BBR G;  4DKA C;  3KFU A;  2HHH L;  2JJQ A;  4R4T A;  4UP7 A;  3GTJ H;  4JI0 L;  2I5M X;  5DLQ E;  3K81 C;  3GTP H;  2ZJP A;  1X55 A;  4KLK A;  1KC8 C;  1VQE A;  4J15 A;  3K7U C;  1E3P A;  1BVS A;  1T9H A;  4YWK A;  4FDB A;  4LF5 Q;  4HIM A;  1VQJ A;  3JC6 6;  4JI8 L;  3PO3 H;  1Q81 C;  4IPH A;  2R92 H;  4HJ5 A;  4A3I H;  5AJ3 Q;  5IYC G;  1PFS A;  1X3E A;  2GVB A;  1HNW Q;  4DV2 Q;  2E8G A;  4IO9 A;  4DV7 Q;  4K0K Q;  3PIP A;  3CC2 A;  2I5L X;  1HNX L;  4LF9 Q;  1TWH H;  2EXD A;  2F52 A;  3KDF B;  1NBW A;  1SN8 A;  1JJC B;  3OW2 A;  1JJ2 A;  3M7N A;  4P74 A;  2UUC L;  1G51 A;  1Y1V H;  4P73 A;  1MJE A;  2DUD A;  4GOP C;  4BXX G;  4DR1 Q;  1XMQ Q;  1LTL A;  1NJI C;  1W3S A;  1HNZ L;  2K14 A;  1BKB A;  3PCO B;  4AYB G;  5M5Y H;  1HR0 W;  4OWW B;  2JA6 H;  4DV0 L;  1VCI A;  1VQB A;  2PNH A;  3ER0 A;  3W1G A;  3CCQ A;  4LW1 A;  2WB1 E;  4LF4 L;  3A5Z B;  4QJF A;  3KYH C;  5C0X J;  3TS0 A;  1HR0 L;  3I4M H;  4TVA B;  3KOJ A;  3DM3 A;  4IFD I;  4YY3 Q;  3ULJ A;  1Q82 C;  4O0A A;  4R4Q A;  2F4V L;  1LYL A;  1Y1V G;  3HOU H;  4OWT B;  3GTG H;  3CCU A;  1B7Y B;  5IP9 H;  3HOV H;  1KL9 A;  4DR6 L;  4B3M Q;  1J5E L;  5BR8 L;  2IHF A;  4DV3 L;  1HJP A;  2RHS B;  3KF6 B;  1K8A C;  3H0G G;  4DV5 Q;  3PIO A;  1EQQ A;  3K0X A;  4JV5 Q;  2VQE L;  2CCZ A;  3STB C;  3ULL A;  1OXX K;  3MXN B;  1VQC A;  4C3H H;  2UXB L;  4KHP Q;  3BZC A;  1Q1E A;  2JA5 G;  4O2D A;  4YY3 L;  4C3I H;  1YNX A;  1V43 A;  1PH8 A;  3I4N H;  2ASB A;  3E9H A;  4BA1 I;  4BY1 G;  2JA7 H;  3H3V I;  1D8L A;  1LM0 A;  3H0G H;  5M3M H;  5C4X H;  3PO2 H;  3FHW A;  3E0E A;  1EQR A;  4X65 Q;  3UDI A;  2XTI A;  1PH1 A;  4X6A H;  1Q8K A;  4R4O A;  1VQD A;  4GN4 B;  4UY8 C;  1XNR L;  5LMN W;  4ALP A;  5IYD G;  3CQZ H;  5GAE C;  3I4M G;  1G29 1;  2Q2I A;  3TQY A;  3NEN A;  4A3E H;  2JA8 H;  3I4N G;  4JYA L;  3NBH B;  5C3E H;  3KF6 A;  3CXC A;  2NVX H;  2VL6 A;  1GD7 A;  2UXD L;  2AWN A;  3L7Z C;  2QA4 A;  1B8A A;  2HIV A;  4OON A;  4A3E G;  1QVG A;  1N36 L;  3E9I A;  4AYB E;  5EAY A;  4LFA Q;  1IBM Q;  5GRO A;  4BBS G;  3PUV A;  5JJL A;  3RNU A;  1P16 A;  3ULP A;  5IYC H;  1N34 Q;  4LF6 L;  1GVP A;  3CCJ A;  4XIG S;  4PZ8 A;  2V1C C;  1Z9F A;  3F8T A;  4PG3 A;  4L5Q A;  4JI0 Q;  2OCE A;  3J7A 5;  2D62 A;  1BBW A;  4QL5 A;  3F2C A;  2WAQ E;  3HOX G;  3RLN A;  1I5F A;  5LMU Q;  4DV1 L;  1YIJ A;  2JK8 A;  3I56 A;  1S72 A;  4NXN Q;  3LGJ A;  3TRZ A;  4DR3 L;  1I94 L;  1ASY A;  2N3S A;  4YCU A;  1S40 A;  4A4I A;  1WCM G;  4AQY Q;  4DR4 Q;  1I6H H;  1C9O A;  3KJP A;  1WFQ A;  2GVA A;  4H02 A;  1VQK A;  5K36 G;  4JI4 L;  1YBY A;  2JA9 A;  1N36 Q;  1IBM L;  1A8V A;  4YWL A;  2YYZ A;  4P72 A;  2ZM6 L;  3GO5 A;  1YJ9 A;  1KXL A;  2NVT H;  4PZ6 A;  1HZB A;  4B3T L;  5ELO A;  3F1Z A;  3CCE A;  3RN5 A;  4EX5 A;  4LFB Q;  3H3V H;  5M3F G;  4LF9 L;  5C4X G;  4APV A;  1PH5 A;  2IT1 A;  2IX1 A;  2QEX A;  4DV6 Q;  1VQP A;  1SR3 A;  2KHJ A;  3VDY A;  1VS0 A;  1K9M C;  4HJ7 A;  1EFW A;  1I50 H;  3CP0 A;  2RF4 A;  1XMO Q;  3M4P A;  1A0I A;  4IJH A;  2D0O A;  4IPD A;  3OYY A;  4JI5 Q;  4DR2 L;  1VQN A;  4BY7 H;  3PGZ A;  3S2H H;  3JAM c;  2BH2 A;  5JEA G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...