2LXJA

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, lmcsp with dt7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQGDGFKSLDEGQAVTFDVEEGQRGPQAANVQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Cold shock-like protein CspLA
publication title Structural and Dynamic Features of Cold-Shock Proteins of Listeriamonocytogenes, a Psychrophilic Bacterium
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2lxjA00
4OXPA 1YIJA 1N36L 1LYLA 4B3SQ 3HOVH 2KHJA 2VW9A 4DR7Q 4OX9Q 2AWNA 3K80C 1XNQQ 1W2BA 2HHHL 3CCUA 4HJ5A 4P71A 1KXLA 4DV1L 1PH5A 2E5LQ 1B70B 2JJQA 5JEAJ 3PIPA 2JA7G 2WP8J 2N8NA 4X6AH 1J5EL 4JI7Q 3STBD 2NVTH 4AQYL 2UXBQ 2AHOB 3I4NH 1OTCA 1VQKA 3MEFA 5JJIA 1Q12A 1V1QA 4YHHL 3J80c 2JE6I 3EBEA 3OYYA 1X54A 3RN2A 3PF5A 1N32L 1M90C 1TWAH 1I94Q 1YJNA 1NJIC 5H1SE 1X3FA 1IBKL 1QVCA 3T1YL 1HR0Q 4KHZA 4A3CG 4R1JA 3CQZH 1GVPA 3VDYA 1EQQA 4BY7G 1SR3A 5GAGC 1PV4A 2N3SA 1PA6A 1K0RA 1N33L 4RMFA 2YU9H 2KCMA 3U4VA 4B3ML 4NB3A 4LF8Q 3ER0A 1OXSC 2JA9A 2V1CC 2KBNA 4DR7L 2RHQB 4OX9L 2A1AA 2K5NA 2AWOA 2LXKA 2N49A 5LMNQ 5GAHC 3J81j 4HJ9A 1EYGA 2E5LL 4DR2Q 1U5KA 1IBML 4QGUA 4DAYB 3KDFA 3ZJYC 2JA8H 2R7ZH 3LGJA 2B63G 5IYBG 1IZ6A 1BVSA 2UXBL 2N78A 3PF4A 1I50H 3T1HL 1EUJA 1OXXK 4KHPL 4JI8Q 3RLFA 3J81c 4BY7H 4GKJQ 3M4QA 4JOIA 2DGYA 2UUCL 1A63A 3CCQA 4IFDG 1VQ7A 1TWFH 5FJ8G 3K7UC 1MJEA 2YV5A 3HOYG 2PQAA 4NXML 3CCVA 4YWLA 5C4JH 2I5LX 2NN6G 3HKSA 2UXCQ 2ZTEA 1WOCA 1RL2A 1SMXA 2K75A 4JCVE 1S72A 2CFMA 5IYCH 4A3FH 3TS0A 4JI6Q 1G291 4ME3A 4P74A 1Q8KA 5M5XH 1DGSA 4DR6L 1VQHA 3BZCA 2IHFA 4BBSH 4DR2L 2MO1A 3CXCA 3RZDH 2EIFA 4JI0L 4JBJA 4R4IA 3HOYH 5IYDG 1X6OA 2F3IA 4EQ5A 5IWAL 4JI8L 4HIKA 1B8AA 4GKJL 3DM3A 3I2ZA 5M3FH 4DK6C 1EFWA 3A5ZB 1C0AA 4A3LG 2VQEQ 2D0PA 4AYBG 3PUYA 1J6QA 1WYDA 2UUAL 4OWXB 1QVGA 1K3RA 1SLJA 3Q8DA 4DR1L 4X65Q 1AE2A 3CCMA 2UXCL 4JI5Q 4IPHA 2F4VQ 4UP9A 1N9WA 3KJPA 1L2FA 4NXNQ 1MKHA 3TEHB 3W5OA 4B3RL 4X66L 1NMFA 1QZGA 3W1GA 1Q81C 1IBLQ 3S17H 3TRZA 1CSPA 3NELA 3CCRA 5GQOA 1XMOL 1N34L 3AFQA 1K83H 3HOUG 3PGZA 5C0XI 4DUZL 4DV3Q 4IO9A 1PVOA 4X62Q 1NE3A 2XGTA 2K4KA 1PH2A 2WFWA 4R4TA 1A62A 3AEVA 3I4NG 4A3LH 4HIMA 3J80i 3UDFA 2OTJA 2QA4A 5HY6A 4JYAQ 1EQRA 5IT9c 3JAMi 5HGQA 3CMAA 4A76A 1EIYB 2IHEA 1HZAA 4LF5L 4IFDJ 4GN3B 5C44G 3CCEA 5LMUL 3HKZE 2RCNA 1MIUA 3RZOH 1HNWL 2R93H 2B3GA 3TQYA 4DUYL 4JI1L 1EWIA 3S24A 5JJLA 2Y0SG 4X65L 3HOUH 3I55A 1UE5A 3KJOA 1YVCA 4JI5L 4DR5Q 4YY3Q 2F4VL 4DV0Q 1QUQA 1E1OA 3RN5A 3S16H 3S1MH 4TQUS 2BA0A 3D0FA 1PH6A 3CF5A 1ASYA 2R7DA 1CSQA 3FHWA 3F2DA 2KCTA 2RHSB 3AQQA 1XPRA 1VQ8A 4L5RC 2ZJRA 1FJGL 2JA8G 3CPFA 2JEAI 1YJ9A 2R7ZG 4LWCA 4QQBX 1VQBA 3CCJA 4IPDA 2Y0SE 1NMGA 1KAWA 2A19A 5ELNA 1UEBA 1YHAA 2F52A 1WI5A 4GLAC 4J15A 4LUVA 1M1KC 3S15H 4B3TQ 3S2HH 5C44H 1I6HH 4R4QA 3KF6A 1Q82C 3PV0A 1X55A 2NZHA 4LFCQ 1YZ6A 2PI2A 3PO3G 2PMZE 3SGIA 4GKKQ 3PUWA 4C3IH 3WWVA 4B3SL 2ID0A 1QUQB 3I4OA 3U50C 3OTOQ 2VQFQ 4FDBA 4JI3Q 4LF9Q 2Z0SA 2ES2A 3A74A 1XNQL 3HOXG 3GTOH 4IOAA 1B7YB 4IPGA 4A3BG 2D0OA 5GROA 4JBKA 1SN8A 1MJCA 1Q1EA 1WFQA 1HNZQ 1SROA 1NTGA 3E0EA 5EAYA 4H02A 2D62A 5IYCG 4UP7A 3PIOA 1U0LA 4DR5L 4A3FG 4JI7L 3K7AH 5ELOA 2CQOA 1UE6A 4ALPA 1XMQQ 3GO5A 3DLLA 1PH7A 3E9IA 3GTGH 1L1OC 1KRSA 3B6YA 1JE5A 5AJ3Q 2VUMH 4GOPC 4BBSG 1KD1C 3JC66 2HIXA 1I94L 3PO3H 4A3EH 2GVAA 1PFSA 1TXYA 3PUXA 5IP9G 3KYHC 1HR0L 2YYZA 4DV5Q 1KIXA 2I5MX 1VQFA 1VQGA 4HJAA 4B3TL 1WCMH 3HOXH 1HR0W 3U58A 5M3FG 4A3BH 1FGUA 1WJJA 4A3MH 5C0XG 2BH8A 1D8LA 1VQEA 2QEXA 3PUZA 2ZM6Q 1CUKA 3IRBA 3CC4A 4JI2Q 4UY8C 2E2HH 3KDFB 4LF8L 2A8VA 1S3OA 1YHBA 5IP7H 1QZHA 4A3JH 4C2MH 4A3KG 4JI3L 1SRUA 3OTOL 4DV4Q 4WJ3M 3PSIA 3L7ZC 1CKNA 4YCWA 5FLXc 4L5TA 5LMNL 1YI2A 3F2CA 2ZTDA 3ULLA 4BXXH 2WAQG 4LFBQ 2IY5B 4DAMA 4A75A 2Q2UA 4HIOA 5LMNW 2HT1A 1K73C 1X56A 1XMQL 5IP9H 3RLOA 1OXTA 2PI2E 1VQDA 2PQAB 3D31A 5M5WH 3U4ZA 2MNAA 3EN2A 3S1RH 2CCZA 4BBRG 4GLXA 4GLVB 1C7YA 3RLNA 4DR4Q 4JV5Q 2LXJA 4QY7A 1YHQA 1IXRA 4LF7Q 4O0AA 2K52A 4PMWA 3GTMH 1UWVA 1IL2A 3L0OA 2WAQE 3AYHB 1VQ4A 2VNUD 3ICEA 4Y52H 3G71A 2OQKA 1A0IA 3GDEA 1LTLA 2CWAA 5FLMG 3GTJH 4A3KH 1VQPA 2GVBA 4LUOA 2UU9Q 3HOWH 4P72A 2OQ0A 3ULJA 3M85A 1VQIA 1S40A 4Y7NH 1Y1VH 2LSSA 1G51A 1W3SA 4R4OA 1L0WA 1T9HA 2ZM6L 4HIDA 3RNUA 1Z47A 4QJFA 4A3GH 2R92H 1VQCA 2E2IH 2HQLA 1VQOA 2R93G 5C3EH 5GAEC 1PH4A 4JI6L 2NVQH 3UDGA 4AYBE 4DNIA 2VS1A 3I4MG 1Y1WG 2E8GA 4GS3A 1LM0A 1GD7A 2C35B 2YTYA 4L5SA 4JBWA 4NPSA 3PUVA 4APVA 4BBRH 4OWWB 4BA2I 1KHIA 4A93H 4GN4B 2HHHQ 5C4XG 1PYBA 1XNRQ 4DV1Q 2FXQA 1YITA 1HNZL 3UE0A 5FLMH 2JA5G 4BY1H 2IT1A 1O7IA 2AMCB 1JJGA 3UDXA 4C3JH 4LF6Q 2PNHA 3CCSA 4YHHQ 1E22A 2VQEL 3S1NH 3UE1A 1P8LA 4GNXC 3E9HA 1IYJB 1Y14B 3TREA 2IX1A 4IPCA 2OCEA 5DLQE 1K9MC 2YTVA 3I4MH 1Y1WH 1E24A 3T1YQ 2I5HA 3PO2H 3PCOB 1TWCH 1C9OA 2K5HA 4XIGS 4NXNL 2NVXH 2JA6H 1L1OA 4QL5A 4HJ7A 5C0XJ 1FL0A 4GOPA 3J7ZC 5C4XH 1RIPA 2GN5A 4PZ6A 1IBLL 1VQ5A 2AKWB 4X64Q 2UXDQ 1HH2P 4DV3L 3CD6A 5J3BA 2JA5H 4X62L 3S2DH 2NVYH 3EIVA 2ASBA 3CMEA 1YEZA 4DPGA 4A3IH 1HZCA 3F2BA 1PH1A 1X9NA 1YBYA 1XNRL 2VUMG 2Q2HA 3HOZG 5E7NA 1V43A 3FP9A 3J81i 1IBMQ 2BA1A 5K36G 2QGQA 1VQLA 4PG3A 3J7A5 4JYAL 2B29A 2XTIA 1VQMA 4POFA 2L15A 4UP8A 4A3EG 1QVFA 2ATWA 4R4CA 1EOVA 3CC2A 1FVIA 4DV6Q 3T1HQ 1LUZA 4LUZA 4DV7Q 1Q1BA 2OTLA 4LF6L 2IX0A 1L1OB 4A3DH 2K5VA 4KHPQ 1WCMG 2ZJPA 2UUCQ 1E1TA 2EXDA 3CW2C 4YCUA 4GOPB 1EIFA 4JI4Q 4A3MG 3CCLA 1ASZA 1P16A 3NEMA 4OWTB 1X3GA 3JAMc 1GKHA 4IOCA 4MZ9A 1XPOA 4A4IA 3BJUA 1VCIA 5IP7G 2Q2TA 3NBHB 4DK3C 3RR5A 4YY3L 3I56A 4DV0L 4A3JG 4NXMQ 4OO1I 1VQ9A 1E7ZA 5M5YH 3K81C 3KLWA 3G48A 1H95A 2ZJQA 3HOZH 1VS0A 4GN5A 1CKOA 3KFUA 4BXXG 3KF6B 4X64L 1K8AC 1HNXQ 2JA7H 2UXDL 1UE1A 2H5XA 1VQNA 5IE8A 3K0XA 2CWPA 4RG1A 1PHJA 4DKAC 1I3QH 3G6EA 2RF4A 3GTLH 4LF4Q 4K0KQ 3M3YH 2JEBI 4P73A 4DR6Q 2WB1G 1PH8A 5JJKA 3S1QH 2MFIA 2MQHA 5BR8Q 3GD7A 4P75A 3OW2A 4JI0Q 1HJPA 1XTDA 4LFCL 1AH9A 4IJLA 1UE7A 4GKKL 4KI0A 1BBUA 3ERSX 4A3CH 4PZ7A 4DV6L 4MNOA 4DV7L 3STBC 5IWAQ 3CAMA 2Q2IA 2VQFL 4LF9L 1V9PA 4YCVA 1YJWA 3GTQH 3HOWG 3TS2A 1VQJA 2YTXA 4JI4L 4WJ4A 4QIWE 2OWOA 3BU2A 1Y1VG 1VQAA 3BZKA 3G4SA 1A8VA 2WB1E 1OXVA 3CC7A 4A3GG 2R92G 2UUAQ 3I7FA 3NENA 5JEAG 1Q7YC 3M4OH 5C3EG 4DR1Q 3K8AA 1KQSA 1JMCA 1JJCB 1GO3E 2UUBQ 1D7QA 1NBWA 5AJ3L 3H3VH 2ALYB 1JB7A 4DV2Q 4A93G 1AE3A 2DUDA 4X66Q 1KL9A 1HNXL 2I0QA 4LW1A 4B3RQ 1SE8A 4L5QA 2B63H 4GNXA 5IYBH 4AIMA 1XMOQ 2KHIA 1N34Q 1PH9A 2CKZB 1HZBA 1TWGH 4DUZQ 2EQSA 2JQOA 4LF4L 4DV5L 4K0KL 4BY1G 4AH6A 1YNXA 4EX5A 3HFZB 3GTPH 5BR8L 3MXNB 1CKNB 1JJ2A 2KENA 3FKIG 3M4PA 3W1BA 1SFOH 5FJ8H 3ULPA 2E2JH 1TWHH 4JBMA 1HZ9A 2VZAA 2Z6KA 4LFAQ 1Q46A 3CPWA 1PH3A 4JI2L 3H3VI 3S14H 1X3EA 1Z9FA 3A0JA 4DR3Q 4BA1I 4DV4L 1I5FA 4YWMA 4HJ8A 2BH2A 1XJVA 3CP0A 3F1ZA 1N36Q 3PO2G 4LF5Q 4JOIC 1BBWA 5IY0A 1X65A 1Q86C 1KRTA 1N8RC 1K8GA 3KOJA 3H0GG 2JA6G 1VQ6A 2JK8A 5LMUQ 4UPAA 1XPUA 4LFBL 2VY3A 3AFPA 1HNWQ 2MO0A 1GM5A 4GNXB 4DUYQ 4JI1Q 3M9BA 5M3MG 1G6PA 1E3PA 3L2PA 4IFDI 3A5UA 1OXUA 2UUBL 1J5EQ 3GTKH 3HOVG 3H15A 3KF8B 1KC8C 4AQYQ 4DV2L 4YWKA 2NZOA 4A3IG 3M7NA 3FKIH 1PYSB 4DR4L 4JV5L 2NN6I 4PZ8A 5GADC 4LNQA 4LF7L 4JC0A 4MTNA 4JG2A 4OO1G 2ZTCA 1N32Q 1NY4A 1FJGQ 5IYDH 2K14A 3UDIA 4C3HH 2UU9L 3HKZG 2K50A 1IBKQ 4IJHA 1BKBA 2VL6A 4A3DG 4TVAB 4XTCS 1CKMA 3F8TA 3H0GH 1R9TH 4LFAL 2R6GA 2HIVA 2Z6KC 4DR3L 1N33Q 4B3MQ 4O2DA 4OONA 5M3MH 1JT8A 4KLKA 4POGA 2R7FA
chains in the Genus database with same CATH superfamily
4DR7Q 2AWNA 1XNQQ 1W2BA 1C8CA 3U9SA 1WCMB 3CCUA 1FYCA 3AB9A 4KD4A 4DV1L 1WTWA 1PH5A 2E5LQ 1B2TA 1B70B 5JEAJ 4ZKBB 3PIPA 4JI7Q 1PZKD 1E2VA 2UXBQ 1ESFA 4C2MB 4G7OC 1OTCA 4J1MA 4YHHL 2XSCA 1X54A 3RN2A 1AN8A 1IKLA 1M90C 1TWAH 2B2VC 2NBFA 3PIO3 1WTXA 1IBKL 3N6RA 3T1YL 4KHZA 4A3CG 1XYIA 3CQZH 4U673 3VDYA 1EQQA 4BY7G 4TKOB 1SR3A 3SVMA 1PV4A 2NTSA 2N3SA 1N33L 4RMFA 2YU9H 1STEA 2IPKD 5KIXA 4LF8Q 3K58A 1AW7A 1PTOF 1NR4A 4RA8A 2KBNA 2EYPA 4RGNA 2DNEA 5A2QE 5FKAC 3OHXC 3K59A 1U5KA 1Y1VB 4IUPA 5KYIA 4QGUA 3MXPA 4DAYB 2Z1CA 5IYBG 1BVSA 2TSSA 2N78A 1OXXK 1SXTA 3RLFA 4GKJQ 5LL6X 1SNDA 1VQ7A 1KLGD 4A93B 4RCNA 1OO9B 3NWTA 1G91A 3W2DA 2FFKB 4IUVA 3HOYG 3CCVA 3NTHA 4JK1C 3HKSA 2R3ZA 1D5MC 1QNKA 3CRKC 4K8IA 4QCLA 4UHVA 2KCNA 4KTAA 2F03A 1DOLA 5IT9L 3I4MB 1VQHA 1JB3A 1QOHA 3PO2B 1TWCB 3LX0A 2NVXB 5CV8A 3X3MA 4JI0L 2QF7A 1S5CD 2WKCA 4Q0FA 4R4IA 3QG1A 5L37A 1QCBD 1EFWA 5C0XH 4A3LG 1HUMA 2D0PA 1TS5A 2F0IA 4OHJA 1WYDA 5EBDA 5F2DA 3C46A 3Q8DA 3D4DA 4DR1L 2P5ZX 4X65Q 2UXCL 2CW0C 4NMZA 4IPHA 1MKHA 3W5OA 4X66L 1QZGA 1Q81C 5KGUA 1ENAA 3CCRA 1N34L 3AFQA 2B2VA 3HOUG 4DUZL 2F3VA 1EZ6A 3X3NA 2EJMA 3AEVA 2WFWA 3J80i 3SR1A 2DY8A 2QA4A 1CHPD 2LFNA 1EIYB 2F0DA 1KDBA 2IHEA 4EQOA 2XIWA 2PZTA 5LMUL 4Z9CB 3EROA 1DOMA 3HKZE 5NUCA 3RZOH 3DM1A 3TQYA 1EWIA 2Y0SG 1MGSA 1GUNA 1YVCA 4JI5L 4YY3Q 2F4VL 5C6AA 1E1OA 3S16H 1B3AA 5KEEA 2B2WC 1ASYA 4CHTB 1CSQA 2KCTA 5CBEE 3Q6SA 1XPRA 4KHVA 3D6CA 2RA4A 2KQ3A 1ML0D 1AZPA 1VQKA 1ENFA 1WI5A 1M1KC 3S15H 5I6WA 4LMQD 3PUWA 4B3SL 3U50C 1QUQB 4LF9Q 2JP1A 3OTOQ 2K5WA 4FDBA 2A68C 3HOXG 4IPGA 4A3BG 3E3XA 4JBKA 1HHVA 2ICEC 4RGTA 1EEFD 1SROA 3E0EA 3P75A 5EAYA 2K04A 3GQBA 4FP5D 5T1IA 3K7AH 2CQOA 3VR6A 1PH7A 3P7JA 1KRSA 1CQVA 4FNFA 2IJ0A 3ND9A 1YNJC 2L9HA 3PO3H 1LT3D 4DAVA 1ET9A 1PFSA 1HR0L 4HR7B 1KIXA 1EFID 3S9WA 4HJAA 3GTKB 3QR8A 4KY6A 3TP5A 3U58A 5D65A 5C0XG 5JVG3 1D8LA 2QEXA 2ZM6Q 4UY8C 2E2HH 2K5QA 3KDFB 4RKLA 1S3OA 3QJYA 5IP7H 2E74C 4A3KG 1SRUA 1RCVD 2NWGA 5A35A 3L7ZC 1CKNA 5LMNL 3F2CA 4I7AA 2Q8RE 4A75A 5IP9H 3RLOA 3NQIA 1OXTA 2PI2E 3S1RH 2MNAA 1HNZQ 1BBXC 2CCZA 2PQEA 2Z4HA 2Z6BA 3DWAA 2VXWA 1CM9A 4GLVB 4JV5Q 1U4PA 4QY7A 1IXRA 4LF7Q 2K52A 4K8JA 4IZ8A 5CV6A 1I4RA 3G71A 1A15A 1VQPA 5CV4A 3C1FA 3NTIA 1GUGA 4LUOA 4R8IA 1B53A 4C1NI 2LSSA 5I9OA 2EJFC 3RNUA 2B2WA 1Z47A 3VR5A 1VQCA 2VB3X 2FHTA 1ICWA 4J6HA 4YIJA 2NB0A 1TWAB 3IKJA 4C1NK 2NZ1D 5EKIA 1Y1WG 2SDFA 2Q8TA 2JSOA 4L5SA 4APVA 3CQZB 1KHIA 1XNRQ 4DV1Q 2MP1A 4JVZA 2YU9B 1BCPD 4LK1C 1DM0B 1MSGA 2CH4W 2Y0SB 2JA5G 2A6ED 2IT1A 1NNXA 2A69D 2XWJB 4RCOA 4DN4M 4YHHQ 2Z8LA 3S1NH 4B9WA 3UE1A 1IYJB 2IX1A 4IPCA 1SJHD 3T1YQ 3MEHA 1F9RA 2K5HA 3NTKA 2F0WA 2IX3A 1FL0A 1QILA 5C4XH 1IBLL 1VQ5A 1U4LA 4J8QA 4DV3L 4IUNA 1PTOH 4ILWA 1BCPB 3S2DH 2NVYH 2ASBA 2A6HC 1YEZA 4DPGA 3CMEA 4A3IH 4CJ1B 4CDCC 1DCZA 2XWBB 4CJ0B 1V43A 2WINB 1TVXA 3J7AV 2BA1A 4OO1H 1EIHA 4PG3A 2C9OA 4UP8A 4HSPA 4R4CA 5E4XA 3TP6A 4ZYSA 3CC2A 4DV6Q 4LF6L 4LUZA 1O7YA 4A3DH 2L11A 2K5VA 3VYRA 3CW2C 3T51B 3A8IE 1ASZA 3OWEB 4IOCA 1XPOA 5EPLA 4A4IA 1DZ1A 3OIQA 2O4XA 1T5XD 5IP7G 2Q2TA 3WDNA 4DK3C 5C4ZA 3Q0AA 4DV0L 1E7ZA 5D3DA 3KLWA 2HUGA 2O5JC 3OIPA 1SMYD 3I3CA 2PYKA 3HOZH 1HNXQ 2UXDL 1LTBD 1WTRA 1EY6A 1VQNA 5E3FA 1YNNC 1VF5C 1I3QH 3M3YH 2ICIA 4DK1A 1I4QA 5EKLA 4P75A 1U4MA 4JI0Q 4LFCL 3EJIA 1EU4A 3K57A 4IJLA 4GKKL 1F2ZA 3A56A 1BBUA 4P2CB 3ERSX 3L9AX 4CKBA 2K33A 4MNOA 3CAMA 3TS2A 1V9PA 3GTQH 3KUPA 2YTXA 1MI2A 2X6LA 1VQAA 5C5LA 4AYBB 3J7AF 1Q7YC 3M4OH 1HQMC 2QILA 5C3XA 4DR1Q 3HEJA 4WRDA 1KQSA 2QDBA 3OSOA 5AJ3L 4DV2Q 4IUUA 4X66Q 1KL9A 3HP3A 1SE8A 2F0GA 1H9JA 5CORA 4AIMA 1N34Q 3RZOB 4DUZQ 2A73B 4WORA 4CJ2C 1EOTA 3GTPH 2C5CA 5BR8L 3MXNB 1BF4A 3A54A 1JJ2A 3FKIG 3S16B 3R93A 3W1BA 1HRJA 1TWHH 4CKCA 2J0TD 4RGOS 4LFAQ 4O1NA 1PH3A 4JI2L 1X3EA 1Z9FA 3I70A 2D5DA 5ELFA 4OGQC 1LTTD 3HZXA 4G7ZC 1KLUD 1BBWA 2PCFB 1X65A 3A55A 2BDOA 3H0GG 1ILQA 4K2KA 4ZQ3A 5LMUQ 1VQ6A 4DK0A 1WTQA 3S15B 3J80L 4GNXB 5M3MG 1E3PA 3A5UA 4TSSA 2UUBL 4RGMA 1KC8C 4AQYQ 2NZOA 4A3IG 2NN6I 1Y8PB 1J9OA 4MTNA 4OO1G 3OMCA 4C3HH 1WTPA 2UU9L 3KK7A 1SNOA 2K50A 5IIFA 4IJHA 1JCKB 3K7AB 2QKIC 4A3DG 1ZYRC 2Z6KC 1JT8A 1SYCA 4POGA 3PO3B 1O78A 1LACA 4QUCA 1LYLA 4B3SQ 1EL0A 1SSOA 2EYHA 2MUYA 2HHHL 2K1BA 3J81L 1EZ8A 5FO7B 1EYAA 3NQTA 5D14A 3MXUA 2WP8J 4X6AH 1J5EL 2E2HB 1ESRA 3DHQA 2F4IA 3STBD 2K28A 4MHEA 3I4NH 1V8QA 1RDPD 3OYYA 1N32L 5DM73 1M4VA 1YJNA 2O5IC 1NJIC 3HG9A 4G57A 1HR0Q 4RFBA 2PW7A 4R1JA 1GVPA 3S1RB 1F77A 5IODA 2RSOA 2PO4A 2N55A 2KCMA 4N8X1 1BXTA 3ER0A 2JA9A 2V1CC 4OX9L 1DD2A 1SE3A 2N49A 5LMNQ 1X32A 5GAHC 5BN5A 4DR2Q 1IBML 2EPBA 2XRQD 2JA8H 2R7ZH 2BDNA 4ZK9B 1I50H 3T1HL 4N9TA 4KHPL 4JI8Q 4BY7H 1V1OA 3BG3A 1A63A 4IFDG 1PRTC 3MWYW 5IGDA 3NHHA 1MJEA 1PTOD 4NXML 4YWLA 5C4JH 2ZTEA 3V05A 1RL2A 1BUVT 2K75A 3S1NB 5IYCH 2E75C 4DR6L 3BZCA 1F2YA 2IHFA 1EY0A 5DM63 1VMPA 2AQ3B 2MO1A 3CXCA 3RZDH 2EIFA 1PFBA 4K14A 5C4XB 2EOTA 4F8MA 3HOYH 1Q3LA 4ODGA 4EQ5A 4HIKA 1PTOB 1RTNA 4M8AA 4C3HG 5CMDA 2BE5C 3MXGA 3S2DB 1SAPA 5M3FH 1SDFA 2NVYB 2GA4B 1C0AA 4A3IB 3RMHA 2QDLA 4ZAIA 5I2YA 1BDOA 2UUAL 4OWXB 1QVGA 1K3RA 2BCOA 1FNVA 4RWSC 1I4XA 3CCMA 3D3RA 2AQ2B 2L12A 3KLSX 3TEHB 4A3DB 5LHY1 1IBLQ 1CSPA 1JR0D 4DV3Q 1LV9A 4NW2A 2XGTA 4HCEA 3K5NA 1PH2A 1MSHA 4R4TA 5JOBA 1ZKOA 4KY7A 3SHLA 3D6WA 1CA6A 3I4NG 4A3LH 1AP0A 1AEXA 1S5DD 3HOZB 5EJWA 2F0PA 1EQRA 5IT9c 2EY6A 1Q8IA 1HZAA 2KA7A 1I3QB 4LF5L 5C44G 3M3YB 2RCNA 1MIUA 3S24A 2EE1A 1UEAB 3HOUH 1UE5A 4DR5Q 3VYUA 4EGVA 4DV0Q 2N88A 4R8NA 1V1PA 1EY7A 5AFWA 3GTQB 3SEBA 2EYLA 4PNYA 3CF5A 1SEBD 3FHWA 4L5RC 2ZJRA 2JA8G 3H94A 4R9WA 3NBHA 2JEAI 2R7ZG 4LWCA 3M4OB 1VQBA 2Y0SE 2A19A 5ELNA 1UEBA 4B3TQ 2A5HA 4R4QA 3KF6A 5FLXL 3PV0A 3J80E 1CI3M 1PFMA 1IL8A 4LFCQ 2PI2A 4GKKQ 5ELEA 2B2TC 2Q8IB 1ONLA 2ID0A 3I4OA 1WTVA 4C56C 2ES2A 4IOAA 1FR3A 3GTPB 5GROA 4DF7A 1MJCA 1Q1EA 1SNPA 1WFQA 1TWHB 4XQJA 5IYCG 2CQAA 2HDLA 3OW7A 5ELOA 4CDEC 4ALPA 1D1IA 2I46A 4KJNA 4KV6A 4XYQA 3E9IA 4DFAA 4ULLA 3GTGH 3B6YA 1QJOA 4FVMA 5AJ3Q 2VUMH 4GOPC 1I94L 2WIIB 2DY7A 4A3EH 1TXYA 3PUXA 2CW0D 2CHBD 1VQGA 2SEBD 3HOXH 1HR0W 5M3FG 4A3BH 1FGUA 5CC4A 4A3MH 1H9SB 1VQEA 3PUZA 3CC4A 1VMCA 4JI2Q 1CZGA 4KY5A 5DEHA 3VR2A 1YHBA 1QZHA 1TY0A 4A3JH 1G8ZD 4JI3L 1II3A 3FEWX 1LTRD 4C3HB 1SYFA 5I6YA 4KJOA 1YI2A 2ZTDA 1B3QA 1EWCA 2WAQG 4HIOA 5LMNW 1K28A 1XMQL 2A74C 3LWUA 2PQAB 3D31A 3U4ZA 3EN2A 4BBRG 4GLXA 1YHQA 3GTMH 3IAYA 2VNUD 3L0OA 3AYHB 4V0BA 1I6VC 5J1ZA 3GDEA 5ELBA 5FLMG 4A3KH 3GTJH 3SK4A 1PH6A 2UU9Q 2L5TA 3KF8A 3ULJA 2F1MA 2OQ0A 3M85A 1U4RA 4Y7NH 1D5ZC 1L0WA 4HIDA 4R4OA 5TSSA 3I4NB 3IL8A 4A3GH 3C1EA 2HQLA 5JEAH 2F0TA 5GAEC 1PH4A 4JI6L 4AYBE 3BYTB 2VS1A 4JW0A 1GD7A 2C35B 2YTYA 3OWFA 5T1GA 1MBYA 3PUVA 4BA2I 2HHHQ 2FXQA 4L63B 2B8GA 3KLRA 1ILPA 1TS2A 1A2UA 3JAML 3UE0A 4PMBA 4BY1H 3FRPB 1SE2A 2B2TA 2A68D 3UDXA 2KJXA 3CCSA 1E22A 3E9HA 3BDOA 1Y14B 1GUOA 3PIP3 2PNRC 5DLQE 1Y8NB 2K5DA 2JA8B 2R7ZB 1Y1WH 2I5HA 1KNAA 3PCOB 1C9OA 4CKEA 4XIGS 2JA6H 1I50B 4QL5A 4HJ7A 3LNNA 2MHVA 4GOPA 4BY7B 2GN5A 4PZ6A 4ZUJA 1YNJD 5IGFA 2CVRA 2XNAC 2JA5H 4X62L 3OMGA 2F0QA 3BDCA 4IUQA 5C4JB 1HZCA 3F2BA 2VUMG 5E7NA 3J81i 1IBMQ 3J7A5 4JYAL 2ATWA 4ZRZA 4A3EG 2DNCA 1GUTA 3VA5A 1XWEA 3T1HQ 1LUZA 4KHPQ 2OTLA 1S5ED 2EDGA 2IX0A 5I4DA 2ZJPA 3Q24A 4JI4Q 5G3LD 4DAYA 4A3MG 1X3GA 3RZDB 1GKHA 1TS3A 1QG7A 2F0NA 1IKMA 2PZWA 4NXMQ 4A3JG 3HOYB 1H9KA 3VR4A 3G48A 2G9DA 3SE0A 1VS0A 5M3FB 2FMMA 2QCPX 4X64L 2JA7H 2H5XA 3PQIA 1K3BC 3K0XA 2CWPA 2ZT9C 4FXKC 3HGBA 4IQZA 3G6EA 2RF4A 3GTLH 1VF7A 4K0KQ 1PZJD 2JEBI 1XX8A 4DR6Q 1PH8A 3S1QH 1CT1D 5CBAE 2WAQB 1EY5A 4QB4A 3WOEA 4H44C 4KI0A 1CFMA 2RDHA 4DV7L 2EYMA 2VQFL 1WVLA 3BU2A 4TRDA 1A8VA 4XQQA 3CC7A 1TT2A 4A3GG 2UUAQ 5JEAG 1EYDA 2EY5A 1JMCA 1GO3E 2KCCA 1D7QA 5IGBA 2ALYB 1JB7A 1PYWD 2DUDA 2EXZA 3J7YW 5ELCA 2B63H 3I90A 1ZXTA 1BQQT 1PH9A 4ME5A 2CKZB 3E5SA 1S4ZA 2JQOA 4LF4L 3HOUB 4BY1G 3MHBA 3P20A 4AH6A 1YNXA 4EX5A 4DA2A 3M4PA 1SFOH 1EQTA 4OIJA 3U9OA 4JBMA 2VZAA 1Q46A 3A0JA 4BA1I 3URYA 4DV4L 1I5FA 4HJ8A 1FNUA 2NN6H 2BH2A 3F1ZA 3EQLC 1Y8OB 3O13A 1GOZA 2WACA 4LF5Q 4JOIC 1Q86C 2JA6G 1XPUA 3GV6A 2LMCB 4LFBL 2E2DC 5C4HA 2OT2A 1KTKA 1OXUA 4K6LA 1L0YB 3HOVG 3L3OC 5IOCA 5I2XA 3OPOA 4RHRA 1SYDA 3FKIH 1S5BD 3GP7A 2D2CC 3MC0B 4JC0A 3IFDA 2ZTCA 4ZKCB 3V2TA 1HA6A 5IYDH 2AUJD 2H1EA 5EBCA 3MVVA 2EZVA 3HKZG 1IBKQ 5IT9E 1JE4A 1ET6A 4FO2A 1CKMA 4XTCS 3F8TA 3GTGB 3H0GH 1GHKA 2VUMB 4HTHA 4DR3L 1N33Q 5M3MH 1N36L 4A3EB 2KHJA 2VW9A 3K80C 1NCVA 1TS4A 3HOXB 1EU3A 4BS9A 4P71A 1KXLA 4A3BB 4A3MB 2JA7G 2EY2A 4KN7C 2NVTH 1I4GA 3SK8A 4A3JB 2AHOB 4DNRB 3MEFA 3J80c 4S3SA 2G5DA 2JE6I 3PF5A 1I94Q 3KBXA 5H1SE 1X3FA 1QVCA 2RDGA 4BWGB 2NYZD 4FYDA 5GAGC 2F0MA 1PA6A 1K0RA 3VR3A 3U4VA 4B3ML 4NB3A 1BCPC 3BDLA 3GTMB 4DR7L 4IN3A 4A3KB 2A69C 2K5NA 4O42A 3GTJB 2AWOA 2LXKA 4JPBW 3J81j 2E5LL 4Y7NB 4ABNA 3H09A 3KDFA 3QO2A 3LGJA 2B63G 3A8KE 4A3GB 1IZ6A 2UXBL 2B2YC 3PF4A 3T16A 1EUJA 3E0JA 3J81c 1CZWA 4JOIA 2EYFA 5FO8B 1TR5A 4FF2A 3I91A 3K7UC 1G2TA 2YV5A 4HCSA 2EY1A 2Z9HA 2I5LX 2NN6G 1A3VA 4BY1B 2UXCQ 4RAUC 1WOCA 1GHJA 1STNA 1SMXA 4JCVE 3NPPA 1S72A 2CFMA 4A3FH 3TS0A 4JI6Q 1S5FD 4P74A 5M5XH 1Y1WB 2JA6B 1KAAA 4IFDH 1ZYRD 4UAIA 5M9OA 3TP8A 1B9MA 3F2UA 1XTCD 5IYDG 1X6OA 5IWAL 4G4KA 4GKJL 3DM3A 3I2ZA 2JA5B 1VDZA 1SMYC 4DK6C 1JWUD 1TY2A 1J6QA 4KKTA 5K5PA 3NWSA 5KNDA 1BCPF 3BYYB 1KABA 1SLJA 4CGYB 3NUCA 2LS01 5EKKA 4JI5Q 3HKZB 2F4VQ 2CH4A 1N9WA 1L2FA 3RUZA 3VYTA 5EGTA 2F3WA 3TRZA 3NELA 5KRUA 5GQOA 3DMUA 1K83H 4H7BA 4IO9A 3CHBD 1PVOA 2FINB 4X62Q 1NE3A 2K4KA 3MA2B 2ENBA 4HIMA 1A2TA 2OTJA 1IW7D 2JA7B 5HY6A 4JYAQ 3JAMi 1E0BA 3K5OA 1JORA 4ZCKA 1EIGA 4QF4A 3GTLB 2F0HA 1WD1A 5A2QL 4GN3B 3CCEA 3S1QB 1E2WA 2R93H 2NUCA 4LAAA 4DUYL 4JI1L 2OEOA 4X65L 2I07B 3TZDA 1AFPA 2SOBA 2B2YA 3S1MH 3D0FA 1QE6A 1TQOA 3BZDB 1RF2D 1PRTD 1RJTA 2R7DA 1VQ8A 4DU9A 5DAUA 1ICFB 1YJ9A 1SYEA 4QQBX 3CCJA 1O80A 1LTAD 1KAWA 3BVZA 3RN5A 2HCIA 4J15A 4LUVA 1SBBB 5C44H 4PQXA 1I6HH 1Q82C 1X55A 2NZHA 1X3PA 1YZ6A 2DN8A 2K01A 2B63B 2X69A 3WWVA 3M4YA 2VQFQ 2JXMB 2Z0SA 3A74A 3GTOH 1G2SA 2D0OA 3NP8A 1PRTB 1SFOB 3P1HA 1NTGA 4H02A 3PIOA 4A3FG 4UP7A 1U0LA 3M7GA 1UE6A 4IUTA 2BE5D 3DLLA 5CV5A 5E4WC 1L1OC 1JE5A 4XDXA 3G7LA 3JC66 5K36H 2HIXA 3VA7A 3MZ5A 2GVAA 3KYHC 2YYZA 4L8JA 2I5MX 3DEPA 5CGKA 1JWMD 1A3TA 1M8AA 2BH8A 3FKIB 1RTOA 1SNMA 2A8VA 1RKNA 4WJ3M 3OTOL 3A8JE 4DV4Q 2RVLA 3PSIA 2ZXOA 3MXNA 4YCWA 5FLXc 4L5TA 3ULLA 4BXXH 4LFBQ 3H0GB 1K73C 4XT3B 2PPBC 1X56A 3TMEA 1LT6D 1EQVA 5M3MB 5M5WH 3A7LA 2L1BA 2FJ2A 1DXMA 4FF3A 1H9MA 1JICA 2LXJA 2Z4IA 4F7XA 1UWVA 2WAQE 1VQ4A 3ICEA 4FF1A 2CWAA 1BOSA 1WTHA 3HOWH 1B44D 2NVTB 1ZEQX 1FGBD 2R61A 2M2LA 1G51A 1W3SA 3T56B 1T9HA 2ZM6L 4QJFA 2R92H 2E2IH 1VQOA 2R93G 5C3EH 3FVQA 2NVQH 4DNIA 3QIAA 3I4MG 5E1FA 4KN4C 4GS3A 3C2PA 1W6KA 2NTTA 1LM0A 4OWWB 4JBWA 4NPSA 4BBRH 4GN4B 1LTID 2LY7A 1PYBA 3TP7A 3ZYYX 1X3QA 1YITA 1HNZL 5JVH3 5FLMH 3AU7A 2AMCB 1JOQA 4C3JH 4LF6Q 2PNHA 1JQYD 2VQEL 4HMIA 1GJXA 3G6JB 1P8LA 2PMZB 3TREA 4HEDA 1WTOA 2OCEA 1K9MC 3SXHA 3TBIB 3DWQA 5ISRA 4NXNL 1L1OA 1C48A 5C0XJ 3WOFA 3IFTA 2UXDQ 2F0OA 3CD6A 1KNEA 1C4QA 5ELDA 2B2UC 4EVOA 4L6TB 5DNFA 3ONAB 1X9NA 1YBYA 1XNRL 5FK9C 3FP9A 5K36G 2MPMA 1NUCA 2QGQA 1VQLA 2B29A 1UNSA 2XTIA 4POFA 2L15A 1QVFA 4A3FB 2ZXRA 1FVIA 1TKWB 2FMCA 1U9RA 1Q1BA 5M5XB 1E1TA 2EXDA 4GOPB 3CCLA 3ND8A 1P16A 3NEMA 4K6DA 2ZXPA 4OEMB 2RCFA 3JAMc 4MZ9A 1SYBA 1MHWC 1VCIA 3KLSA 5M5YH 3K81C 1H95A 2ZJQA 1ENCA 1CKOA 4BXXG 1JC7A 2L55A 2AUKA 4X3SA 1UE1A 5IE8A 3K5LA 4HAEA 5D3IB 4DKAC 4P73A 1WD0A 2WB1G 5JJKA 2MQHA 3T53B 4KK7A 5BR8Q 3GD7A 3J81E 1BNZA 1HJPA 1AH9A 2VB2X 4FF4A 1TIID 1F9PA 4PZ7A 1K83B 4DV6L 5IWAQ 2Q2IA 1D1KA 3TSSA 1YJWA 3HOWG 1VQJA 3QWNA 4N8FA 4WJ4A 3BZKA 2O2LD 2K05A 4PMCA 3TN2A 2R92G 3I7FA 3NENA 5C3EG 1EEID 1H9RA 5BN3A 1JJCB 2UUBQ 1KDCA 1NBWA 3W3AA 1QWYA 1AE3A 1HNXL 5JPMC 5BN4A 2J4XA 2R93B 1HZBA 1TWGH 4H0LC 2EQSA 4DV5L 2KVMA 3UI2A 4XT1B 2J7ZA 1CKNB 3PMFA 4C3JG 3Q22A 3S1MB 5FJ8H 3ULPA 2E2JH 4FXDA 3CPWA 3S14H 3H3VI 3K0YA 1HUNA 5KNCA 3I73A 1XJVA 3CP0A 2B2UA 3C3LA 5IY0A 1K8GA 1HTPA 3KOJA 2JK8A 1F9QA 5KYLA 3AFPA 4B9XA 4B08A 5C44B 1I6HB 4DUYQ 4DNTB 4JI1Q 1G6PA 3L2PA 1Z6HA 1F2LA 1J5EQ 3H15A 3A7AB 4DV2L 4Q5VA 3M7NA 4DR4L 3GTOB 5GADC 1NSNS 4QUFA 4LNQA 4XYOA 1DOKA 1N32Q 1SE4A 2K14A 2QW7A 5IGEA 1BKBA 2VL6A 1EYCA 4K5VA 1AZQA 5FOBB 1R9TH 4LFAL 2XVSA 2R6GA 4GZYC 2HIVA 4OIKA 2EYOA 2H4OA 4KLKA 4OXPA 1YIJA 3HOVH 4DXFA 4OX9Q 2V4DA 4HJ5A 1HCZA 2JJQA 2N8NA 1B4OA 3CU7A 4AQYL 2WV6D 5JJIA 5JJZA 1E2ZA 1Q12A 1V1QA 3FPPA 3EBEA 2RSNA 2HD3A 1LABA 1XXGA 1QB5D 4QIWB 5M5WB 1DJRD 3N52A 5HGTA 2WB1B 4XQNA 5CR3A 2K6AA 1JOKA 1OXSC 2RHQB 2A1AA 1CA5A 3HOWB 4HJ9A 3H3VC 1EYGA 1H9SA 1A3UA 3KBGA 5J22A 3ZJYC 1STGA 2R92B 3QOLA 4RH6A 2E2IB 5C3EB 2NVQB 2IWHA 3EFXD 3QB3A 3M4QA 2UUCL 2DGYA 2RKSA 4MIUA 4BBRB 3CCQA 1TWFH 5FJ8G 3I8ZA 3SDZA 1LT4D 2PQAA 1CTMA 3CRLC 2KHSA 1NR2A 4C3JB 4KKUA 5FLXE 5JAVA 1G291 3BS1A 1T5EA 4ME3A 1Q8KA 1DGSA 4BBSH 4DR2L 2F0LA 2IL8A 4JBJA 4DGZA 1O7ZA 3TDQA 5CV7A 1IYUA 1DONA 2F3IA 4JI8L 2KECA 1B8AA 3I72A 5JPNC 1PFNA 3H6MA 3Q23A 4OELB 2A6HD 1D5XC 1I4PA 5KNBA 3A5ZB 3FMCA 2VQEQ 4AYBG 3PUYA 4OL7A 5J39A 4DXGA 1G6ZA 2HCCA 1RD9D 1AE2A 4ZUIA 4UP9A 3KJPA 4NXNQ 3D4RA 3DXJC 4B3RL 1NMFA 3W1GA 3S17H 4HMJA 1XMOL 3PGZA 5C0XI 1GXDC 1EY8A 4IALA 5CV9A 1EY4A 5IGGA 1A62A 5M5YB 2KEEA 2OF1A 3UDFA 2M00A 3I4LA 3EVQA 1YNND 5HGQA 3CMAA 1HFNA 4A76A 2K32A 1SJED 1LO5D 4ZLTF 2F0SA 3CKIB 4IFDJ 1D2BA 3ITPA 1LT5D 3MFGA 4RKBA 1HNWL 2B3GA 2G9HD 3NE5B 1QNUA 5JJLA 2QEJC 3I55A 1LLRD 3KJOA 4WFN3 1QUQA 3GV3A 4TQUS 2BA0A 3RD4A 3R3OA 5G3LF 3R8BA 1HTLD 2KUMA 2RHSB 3F2DA 2E76C 3AQQA 1FJGL 3CPFA 2F0UA 4IPDA 1NMGA 1KDAA 1YHAA 2F52A 3S2HH 4GLAC 3HS0C 4I65A 1A6XA 3PO3G 3V96A 2PMZE 1L0XB 3SGIA 1O7LA 4C3IH 3JAME 1BO0A 2A6EC 5EPKA 1TWGB 4JI3Q 1F2MA 1XNQL 1B7YB 1R4QB 1SN8A 4V190 1JOOA 3NXWA 2E2JB 3S14B 2D62A 4DR5L 4JI7L 1D6EC 1XMQQ 3VYSA 3GO5A 3OOCA 2EJGC 2MJ8A 2JYOA 4BBSG 1KD1C 2SNMA 5C3WA 1CK1A 5IP9G 4F88A 4DV5Q 3MAQA 1Q90A 1VQFA 1Z7TA 4B3TL 1RODA 1WCMH 1R4PB 1WJJA 1CUKA 3IRBA 1STAA 5CYUA 4LF8L 4G7HC 1SYGA 4C2MH 2IW3A 2JN4A 2F0JA 2HQEA 1CQFA 2IY5B 4DAMA 3D8GA 2Q2UA 4HN7A 1R9TB 2HT1A 1SNCA 3SK5A 1HPCA 2EVBA 1I4HA 1PDQA 1VQDA 3E6ZX 2KEDA 4H13C 4X3UA 4CBVA 3HOVB 1C7YA 3RLNA 4DR4Q 1DYQA 2EYJA 4NP5A 4O0AA 4PMWA 1JJGA 1IL2A 2RBMA 4Y52H 2OQKA 1A0IA 2PZUA 2RQXA 1LTLA 2F0KA 2PW5A 4F87A 2GVBA 1HQRD 4P72A 4RHSA 3TZUA 1VQIA 1S40A 1Y1VH 5COYA 2L4NA 3HRZC 3D4WA 3UDGA 1PXUA 2E8GA 3EA6A 4A93H 4HSVA 5C4XG 5EPJA 2HDMA 5FO9B 1STBA 1F9SA 1IYVA 1K8MA 1O7IA 3BVMA 1Y69U 4WJWA 4CDFC 3AMUA 4GNXC 1TU2B 5I9PA 4N9PA 2YTVA 1RHPA 4C3IG 1E24A 3I4MH 3PO2H 1TWCH 2B8FA 4K5WA 2NVXH 3FDTA 4KMUC 4K2LA 3J7ZC 1RIPA 1B50A 4E6IA 2AKWB 4X64Q 4UDUC 1TWFB 1HH2P 2XRSD 5J3BA 2K03A 2XN9C 4NDXA 1PMRA 2X6GA 3EIVA 1B9NA 4U68A 2DJGC 1PH1A 2Q2HA 3HOZG 1GUSA 5IGCA 1VQMA 4NKLA 1EOVA 3DEOA 4DV7Q 3FPUB 1L1OB 3R2TA 1V1PB 1WCMG 1BR9A 2UUCQ 4YCUA 4BBSB 1EIFA 4LJZC 2F0EA 2WKDA 4OWTB 3SK6A 3BJUA 3NBHB 3RR5A 1JWSD 1PLFA 4YY3L 3I56A 4OO1I 2MGSA 1VQ9A 1GUWA 3MTSA 3QOJA 4GN5A 3KFUA 3KF6B 1K8AC 1IW7C 4KKSA 2K7VA 4RG1A 5EQ0A 1PHJA 1NAPA 4LF4Q 2MFIA 3K6OA 4M1UB 3LWEA 3OW2A 1HFGA 3NSWA 3R2IA 1UAPA 1XTDA 2D9UA 3S17B 1B1ZA 1UE7A 3DUZA 5C5MA 1HA5A 4A3CH 4QMGA 3STBC 4LF9L 3MFYA 4YCVA 2L0CA 4MTKA 4JI4L 4QIWE 2OWOA 1Y1VG 2BOSA 2B39A 3G4SA 2WB1E 4FXGC 2KOLA 1OXVA 3ERQA 3K8AA 3NBIA 1EWHA 3H3VH 1EY9A 4IURA 4PV1C 2TMPA 4A93G 4I7ZC 1LTGD 5HURA 2I0QA 4B3RQ 4LW1A 1W6JA 4L5QA 4ID6A 4GNXA 5IYBH 1XMOQ 2KHIA 4K0KL 4KD3A 1J8IA 1K0SA 3HFZB 1LTSD 2KENA 3T13A 4EQNA 1STYA 1HZ9A 2Z6KA 1IHZA 4DR3Q 3K5MA 1PZID 4YWMA 4MN3A 2DJFC 2SNSA 1N36Q 3PO2G 2OXPA 4X3KA 1KRTA 1N8RC 3S2HB 3H91A 4UPAA 4EQPA 1FNWA 2VY3A 3BVGA 1HNWQ 3T4AC 2MO0A 1GM5A 3M9BA 4IFDI 2RDFA 4K5XA 1PTOC 4DAPA 1HXYD 3GTKH 2LKVA 4C3IB 3KF8B 3NK9A 4YWKA 1PYSB 4JV5L 1FD7D 4PZ8A 1CHQD 1MD2D 4LF7L 4JG2A 1UUPA 1NY4A 1FJGQ 1SNQA 1K8OA 4CDDC 3UDIA 3DWPA 2F0VA 2F0FA 4TVAB 1PRTF 4XXEA 2AQ1B 4B3MQ 4O2DA 1STHA 4OONA 2M9VA 5LL6S 4X3TA 2R7FA
chains in the Genus database with same CATH topology
4OXPA 1YIJA 1N36L 1LYLA 4B3SQ 3HOVH 2KHJA 2VW9A 4DR7Q 4OX9Q 2AWNA 3K80C 1XNQQ 1W2BA 2HHHL 3CCUA 4HJ5A 4P71A 1KXLA 4DV1L 1PH5A 2E5LQ 1B70B 2JJQA 5JEAJ 3PIPA 2JA7G 2WP8J 2N8NA 4X6AH 1J5EL 4JI7Q 3STBD 2NVTH 4AQYL 2UXBQ 2AHOB 3I4NH 1OTCA 1VQKA 3MEFA 5JJIA 1Q12A 1V1QA 4YHHL 3J80c 2JE6I 3EBEA 3OYYA 1X54A 3RN2A 3PF5A 1N32L 1M90C 1TWAH 1I94Q 1YJNA 1NJIC 5H1SE 1X3FA 1IBKL 1QVCA 3T1YL 1HR0Q 4KHZA 4A3CG 4R1JA 3CQZH 1GVPA 3VDYA 1EQQA 4BY7G 1SR3A 5GAGC 1PV4A 2N3SA 1PA6A 1K0RA 1N33L 4RMFA 2YU9H 2KCMA 3U4VA 4B3ML 4NB3A 4LF8Q 3ER0A 1OXSC 2JA9A 2V1CC 2KBNA 4DR7L 2RHQB 4OX9L 2A1AA 2K5NA 2AWOA 2LXKA 2N49A 5LMNQ 5GAHC 3J81j 4HJ9A 1EYGA 2E5LL 4DR2Q 1U5KA 1IBML 4QGUA 4DAYB 3KDFA 3ZJYC 2JA8H 2R7ZH 3LGJA 2B63G 5IYBG 1IZ6A 1BVSA 2UXBL 2N78A 3PF4A 1I50H 3T1HL 1EUJA 1OXXK 4KHPL 4JI8Q 3RLFA 3J81c 4BY7H 4GKJQ 3M4QA 4JOIA 2DGYA 2UUCL 1A63A 3CCQA 4IFDG 1VQ7A 1TWFH 5FJ8G 3K7UC 1MJEA 2YV5A 3HOYG 2PQAA 4NXML 3CCVA 4YWLA 5C4JH 2I5LX 2NN6G 3HKSA 2UXCQ 2ZTEA 1WOCA 1RL2A 1SMXA 2K75A 4JCVE 1S72A 2CFMA 5IYCH 4A3FH 3TS0A 4JI6Q 1G291 4ME3A 4P74A 1Q8KA 5M5XH 1DGSA 4DR6L 1VQHA 3BZCA 2IHFA 4BBSH 4DR2L 2MO1A 3CXCA 3RZDH 2EIFA 4JI0L 4JBJA 4R4IA 3HOYH 5IYDG 1X6OA 2F3IA 4EQ5A 5IWAL 4JI8L 4HIKA 1B8AA 4GKJL 3DM3A 3I2ZA 5M3FH 4DK6C 1EFWA 3A5ZB 1C0AA 4A3LG 2VQEQ 2D0PA 4AYBG 3PUYA 1J6QA 1WYDA 2UUAL 4OWXB 1QVGA 1K3RA 1SLJA 3Q8DA 4DR1L 4X65Q 1AE2A 3CCMA 2UXCL 4JI5Q 4IPHA 2F4VQ 4UP9A 1N9WA 3KJPA 1L2FA 4NXNQ 1MKHA 3TEHB 3W5OA 4B3RL 4X66L 1NMFA 1QZGA 3W1GA 1Q81C 1IBLQ 3S17H 3TRZA 1CSPA 3NELA 3CCRA 5GQOA 1XMOL 1N34L 3AFQA 1K83H 3HOUG 3PGZA 5C0XI 4DUZL 4DV3Q 4IO9A 1PVOA 4X62Q 1NE3A 2XGTA 2K4KA 1PH2A 2WFWA 4R4TA 1A62A 3AEVA 3I4NG 4A3LH 4HIMA 3J80i 3UDFA 2OTJA 2QA4A 5HY6A 4JYAQ 1EQRA 5IT9c 3JAMi 5HGQA 3CMAA 4A76A 1EIYB 2IHEA 1HZAA 4LF5L 4IFDJ 4GN3B 5C44G 3CCEA 5LMUL 3HKZE 2RCNA 1MIUA 3RZOH 1HNWL 2R93H 2B3GA 3TQYA 4DUYL 4JI1L 1EWIA 3S24A 5JJLA 2Y0SG 4X65L 3HOUH 3I55A 1UE5A 3KJOA 1YVCA 4JI5L 4DR5Q 4YY3Q 2F4VL 4DV0Q 1QUQA 1E1OA 3RN5A 3S16H 3S1MH 4TQUS 2BA0A 3D0FA 1PH6A 3CF5A 1ASYA 2R7DA 1CSQA 3FHWA 3F2DA 2KCTA 2RHSB 3AQQA 1XPRA 1VQ8A 4L5RC 2ZJRA 1FJGL 2JA8G 3CPFA 2JEAI 1YJ9A 2R7ZG 4LWCA 4QQBX 1VQBA 3CCJA 4IPDA 2Y0SE 1NMGA 1KAWA 2A19A 5ELNA 1UEBA 1YHAA 2F52A 1WI5A 4GLAC 4J15A 4LUVA 1M1KC 3S15H 4B3TQ 3S2HH 5C44H 1I6HH 4R4QA 3KF6A 1Q82C 3PV0A 1X55A 2NZHA 4LFCQ 1YZ6A 2PI2A 3PO3G 2PMZE 3SGIA 4GKKQ 3PUWA 4C3IH 3WWVA 4B3SL 2ID0A 1QUQB 3I4OA 3U50C 3OTOQ 2VQFQ 4FDBA 4JI3Q 4LF9Q 2Z0SA 2ES2A 3A74A 1XNQL 3HOXG 3GTOH 4IOAA 1B7YB 4IPGA 4A3BG 2D0OA 5GROA 4JBKA 1SN8A 1MJCA 1Q1EA 1WFQA 1HNZQ 1SROA 1NTGA 3E0EA 5EAYA 4H02A 2D62A 5IYCG 4UP7A 3PIOA 1U0LA 4DR5L 4A3FG 4JI7L 3K7AH 5ELOA 2CQOA 1UE6A 4ALPA 1XMQQ 3GO5A 3DLLA 1PH7A 3E9IA 3GTGH 1L1OC 1KRSA 3B6YA 1JE5A 5AJ3Q 2VUMH 4GOPC 4BBSG 1KD1C 3JC66 2HIXA 1I94L 3PO3H 4A3EH 2GVAA 1PFSA 1TXYA 3PUXA 5IP9G 3KYHC 1HR0L 2YYZA 4DV5Q 1KIXA 2I5MX 1VQFA 1VQGA 4HJAA 4B3TL 1WCMH 3HOXH 1HR0W 3U58A 5M3FG 4A3BH 1FGUA 1WJJA 4A3MH 5C0XG 2BH8A 1D8LA 1VQEA 2QEXA 3PUZA 2ZM6Q 1CUKA 3IRBA 3CC4A 4JI2Q 4UY8C 2E2HH 3KDFB 4LF8L 2A8VA 1S3OA 1YHBA 5IP7H 1QZHA 4A3JH 4C2MH 4A3KG 4JI3L 1SRUA 3OTOL 4DV4Q 4WJ3M 3PSIA 3L7ZC 1CKNA 4YCWA 5FLXc 4L5TA 5LMNL 1YI2A 3F2CA 2ZTDA 3ULLA 4BXXH 2WAQG 4LFBQ 2IY5B 4DAMA 4A75A 2Q2UA 4HIOA 5LMNW 2HT1A 1K73C 1X56A 1XMQL 5IP9H 3RLOA 1OXTA 2PI2E 1VQDA 2PQAB 3D31A 5M5WH 3U4ZA 2MNAA 3EN2A 3S1RH 2CCZA 4BBRG 4GLXA 4GLVB 1C7YA 3RLNA 4DR4Q 4JV5Q 2LXJA 4QY7A 1YHQA 1IXRA 4LF7Q 4O0AA 2K52A 4PMWA 3GTMH 1UWVA 1IL2A 3L0OA 2WAQE 3AYHB 1VQ4A 2VNUD 3ICEA 4Y52H 3G71A 2OQKA 1A0IA 3GDEA 1LTLA 2CWAA 5FLMG 3GTJH 4A3KH 1VQPA 2GVBA 4LUOA 2UU9Q 3HOWH 4P72A 2OQ0A 3ULJA 3M85A 1VQIA 1S40A 4Y7NH 1Y1VH 2LSSA 1G51A 1W3SA 4R4OA 1L0WA 1T9HA 2ZM6L 4HIDA 3RNUA 1Z47A 4QJFA 4A3GH 2R92H 1VQCA 2E2IH 2HQLA 1VQOA 2R93G 5C3EH 5GAEC 1PH4A 4JI6L 2NVQH 3UDGA 4AYBE 4DNIA 2VS1A 3I4MG 1Y1WG 2E8GA 4GS3A 1LM0A 1GD7A 2C35B 2YTYA 4L5SA 4JBWA 4NPSA 3PUVA 4APVA 4BBRH 4OWWB 4BA2I 1KHIA 4A93H 4GN4B 2HHHQ 5C4XG 1PYBA 1XNRQ 4DV1Q 2FXQA 1YITA 1HNZL 3UE0A 5FLMH 2JA5G 4BY1H 2IT1A 1O7IA 2AMCB 1JJGA 3UDXA 4C3JH 4LF6Q 2PNHA 3CCSA 4YHHQ 1E22A 2VQEL 3S1NH 3UE1A 1P8LA 4GNXC 3E9HA 1IYJB 1Y14B 3TREA 2IX1A 4IPCA 2OCEA 5DLQE 1K9MC 2YTVA 3I4MH 1Y1WH 1E24A 3T1YQ 2I5HA 3PO2H 3PCOB 1TWCH 1C9OA 2K5HA 4XIGS 4NXNL 2NVXH 2JA6H 1L1OA 4QL5A 4HJ7A 5C0XJ 1FL0A 4GOPA 3J7ZC 5C4XH 1RIPA 2GN5A 4PZ6A 1IBLL 1VQ5A 2AKWB 4X64Q 2UXDQ 1HH2P 4DV3L 3CD6A 5J3BA 2JA5H 4X62L 3S2DH 2NVYH 3EIVA 2ASBA 3CMEA 1YEZA 4DPGA 4A3IH 1HZCA 3F2BA 1PH1A 1X9NA 1YBYA 1XNRL 2VUMG 2Q2HA 3HOZG 5E7NA 1V43A 3FP9A 3J81i 1IBMQ 2BA1A 5K36G 2QGQA 1VQLA 4PG3A 3J7A5 4JYAL 2B29A 2XTIA 1VQMA 4POFA 2L15A 4UP8A 4A3EG 1QVFA 2ATWA 4R4CA 1EOVA 3CC2A 1FVIA 4DV6Q 3T1HQ 1LUZA 4LUZA 4DV7Q 1Q1BA 2OTLA 4LF6L 2IX0A 1L1OB 4A3DH 2K5VA 4KHPQ 1WCMG 2ZJPA 2UUCQ 1E1TA 2EXDA 3CW2C 4YCUA 4GOPB 1EIFA 4JI4Q 4A3MG 3CCLA 1ASZA 1P16A 3NEMA 4OWTB 1X3GA 3JAMc 1GKHA 4IOCA 4MZ9A 1XPOA 4A4IA 3BJUA 1VCIA 5IP7G 2Q2TA 3NBHB 4DK3C 3RR5A 4YY3L 3I56A 4DV0L 4A3JG 4NXMQ 4OO1I 1VQ9A 1E7ZA 5M5YH 3K81C 3KLWA 3G48A 1H95A 2ZJQA 3HOZH 1VS0A 4GN5A 1CKOA 3KFUA 4BXXG 3KF6B 4X64L 1K8AC 1HNXQ 2JA7H 2UXDL 1UE1A 2H5XA 1VQNA 5IE8A 3K0XA 2CWPA 4RG1A 1PHJA 4DKAC 1I3QH 3G6EA 2RF4A 3GTLH 4LF4Q 4K0KQ 3M3YH 2JEBI 4P73A 4DR6Q 2WB1G 1PH8A 5JJKA 3S1QH 2MFIA 2MQHA 5BR8Q 3GD7A 4P75A 3OW2A 4JI0Q 1HJPA 1XTDA 4LFCL 1AH9A 4IJLA 1UE7A 4GKKL 4KI0A 1BBUA 3ERSX 4A3CH 4PZ7A 4DV6L 4MNOA 4DV7L 3STBC 5IWAQ 3CAMA 2Q2IA 2VQFL 4LF9L 1V9PA 4YCVA 1YJWA 3GTQH 3HOWG 3TS2A 1VQJA 2YTXA 4JI4L 4WJ4A 4QIWE 2OWOA 3BU2A 1Y1VG 1VQAA 3BZKA 3G4SA 1A8VA 2WB1E 1OXVA 3CC7A 4A3GG 2R92G 2UUAQ 3I7FA 3NENA 5JEAG 1Q7YC 3M4OH 5C3EG 4DR1Q 3K8AA 1KQSA 1JMCA 1JJCB 1GO3E 2UUBQ 1D7QA 1NBWA 5AJ3L 3H3VH 2ALYB 1JB7A 4DV2Q 4A93G 1AE3A 2DUDA 4X66Q 1KL9A 1HNXL 2I0QA 4LW1A 4B3RQ 1SE8A 4L5QA 2B63H 4GNXA 5IYBH 4AIMA 1XMOQ 2KHIA 1N34Q 1PH9A 2CKZB 1HZBA 1TWGH 4DUZQ 2EQSA 2JQOA 4LF4L 4DV5L 4K0KL 4BY1G 4AH6A 1YNXA 4EX5A 3HFZB 3GTPH 5BR8L 3MXNB 1CKNB 1JJ2A 2KENA 3FKIG 3M4PA 3W1BA 1SFOH 5FJ8H 3ULPA 2E2JH 1TWHH 4JBMA 1HZ9A 2VZAA 2Z6KA 4LFAQ 1Q46A 3CPWA 1PH3A 4JI2L 3H3VI 3S14H 1X3EA 1Z9FA 3A0JA 4DR3Q 4BA1I 4DV4L 1I5FA 4YWMA 4HJ8A 2BH2A 1XJVA 3CP0A 3F1ZA 1N36Q 3PO2G 4LF5Q 4JOIC 1BBWA 5IY0A 1X65A 1Q86C 1KRTA 1N8RC 1K8GA 3KOJA 3H0GG 2JA6G 1VQ6A 2JK8A 5LMUQ 4UPAA 1XPUA 4LFBL 2VY3A 3AFPA 1HNWQ 2MO0A 1GM5A 4GNXB 4DUYQ 4JI1Q 3M9BA 5M3MG 1G6PA 1E3PA 3L2PA 4IFDI 3A5UA 1OXUA 2UUBL 1J5EQ 3GTKH 3HOVG 3H15A 3KF8B 1KC8C 4AQYQ 4DV2L 4YWKA 2NZOA 4A3IG 3M7NA 3FKIH 1PYSB 4DR4L 4JV5L 2NN6I 4PZ8A 5GADC 4LNQA 4LF7L 4JC0A 4MTNA 4JG2A 4OO1G 2ZTCA 1N32Q 1NY4A 1FJGQ 5IYDH 2K14A 3UDIA 4C3HH 2UU9L 3HKZG 2K50A 1IBKQ 4IJHA 1BKBA 2VL6A 4A3DG 4TVAB 4XTCS 1CKMA 3F8TA 3H0GH 1R9TH 4LFAL 2R6GA 2HIVA 2Z6KC 4DR3L 1N33Q 4B3MQ 4O2DA 4OONA 5M3MH 1JT8A 4KLKA 4POGA 2R7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OXP A;  1YIJ A;  1N36 L;  1LYL A;  4B3S Q;  3HOV H;  2KHJ A;  2VW9 A;  4DR7 Q;  4OX9 Q;  2AWN A;  3K80 C;  1XNQ Q;  1W2B A;  2HHH L;  3CCU A;  4HJ5 A;  4P71 A;  1KXL A;  4DV1 L;  1PH5 A;  2E5L Q;  1B70 B;  2JJQ A;  5JEA J;  3PIP A;  2JA7 G;  2WP8 J;  2N8N A;  4X6A H;  1J5E L;  4JI7 Q;  3STB D;  2NVT H;  4AQY L;  2UXB Q;  2AHO B;  3I4N H;  1OTC A;  1VQK A;  3MEF A;  5JJI A;  1Q12 A;  1V1Q A;  4YHH L;  3J80 c;  2JE6 I;  3EBE A;  3OYY A;  1X54 A;  3RN2 A;  3PF5 A;  1N32 L;  1M90 C;  1TWA H;  1I94 Q;  1YJN A;  1NJI C;  5H1S E;  1X3F A;  1IBK L;  1QVC A;  3T1Y L;  1HR0 Q;  4KHZ A;  4A3C G;  4R1J A;  3CQZ H;  1GVP A;  3VDY A;  1EQQ A;  4BY7 G;  1SR3 A;  5GAG C;  1PV4 A;  2N3S A;  1PA6 A;  1K0R A;  1N33 L;  4RMF A;  2YU9 H;  2KCM A;  3U4V A;  4B3M L;  4NB3 A;  4LF8 Q;  3ER0 A;  1OXS C;  2JA9 A;  2V1C C;  2KBN A;  4DR7 L;  2RHQ B;  4OX9 L;  2A1A A;  2K5N A;  2AWO A;  2LXK A;  2N49 A;  5LMN Q;  5GAH C;  3J81 j;  4HJ9 A;  1EYG A;  2E5L L;  4DR2 Q;  1U5K A;  1IBM L;  4QGU A;  4DAY B;  3KDF A;  3ZJY C;  2JA8 H;  2R7Z H;  3LGJ A;  2B63 G;  5IYB G;  1IZ6 A;  1BVS A;  2UXB L;  2N78 A;  3PF4 A;  1I50 H;  3T1H L;  1EUJ A;  1OXX K;  4KHP L;  4JI8 Q;  3RLF A;  3J81 c;  4BY7 H;  4GKJ Q;  3M4Q A;  4JOI A;  2DGY A;  2UUC L;  1A63 A;  3CCQ A;  4IFD G;  1VQ7 A;  1TWF H;  5FJ8 G;  3K7U C;  1MJE A;  2YV5 A;  3HOY G;  2PQA A;  4NXM L;  3CCV A;  4YWL A;  5C4J H;  2I5L X;  2NN6 G;  3HKS A;  2UXC Q;  2ZTE A;  1WOC A;  1RL2 A;  1SMX A;  2K75 A;  4JCV E;  1S72 A;  2CFM A;  5IYC H;  4A3F H;  3TS0 A;  4JI6 Q;  1G29 1;  4ME3 A;  4P74 A;  1Q8K A;  5M5X H;  1DGS A;  4DR6 L;  1VQH A;  3BZC A;  2IHF A;  4BBS H;  4DR2 L;  2MO1 A;  3CXC A;  3RZD H;  2EIF A;  4JI0 L;  4JBJ A;  4R4I A;  3HOY H;  5IYD G;  1X6O A;  2F3I A;  4EQ5 A;  5IWA L;  4JI8 L;  4HIK A;  1B8A A;  4GKJ L;  3DM3 A;  3I2Z A;  5M3F H;  4DK6 C;  1EFW A;  3A5Z B;  1C0A A;  4A3L G;  2VQE Q;  2D0P A;  4AYB G;  3PUY A;  1J6Q A;  1WYD A;  2UUA L;  4OWX B;  1QVG A;  1K3R A;  1SLJ A;  3Q8D A;  4DR1 L;  4X65 Q;  1AE2 A;  3CCM A;  2UXC L;  4JI5 Q;  4IPH A;  2F4V Q;  4UP9 A;  1N9W A;  3KJP A;  1L2F A;  4NXN Q;  1MKH A;  3TEH B;  3W5O A;  4B3R L;  4X66 L;  1NMF A;  1QZG A;  3W1G A;  1Q81 C;  1IBL Q;  3S17 H;  3TRZ A;  1CSP A;  3NEL A;  3CCR A;  5GQO A;  1XMO L;  1N34 L;  3AFQ A;  1K83 H;  3HOU G;  3PGZ A;  5C0X I;  4DUZ L;  4DV3 Q;  4IO9 A;  1PVO A;  4X62 Q;  1NE3 A;  2XGT A;  2K4K A;  1PH2 A;  2WFW A;  4R4T A;  1A62 A;  3AEV A;  3I4N G;  4A3L H;  4HIM A;  3J80 i;  3UDF A;  2OTJ A;  2QA4 A;  5HY6 A;  4JYA Q;  1EQR A;  5IT9 c;  3JAM i;  5HGQ A;  3CMA A;  4A76 A;  1EIY B;  2IHE A;  1HZA A;  4LF5 L;  4IFD J;  4GN3 B;  5C44 G;  3CCE A;  5LMU L;  3HKZ E;  2RCN A;  1MIU A;  3RZO H;  1HNW L;  2R93 H;  2B3G A;  3TQY A;  4DUY L;  4JI1 L;  1EWI A;  3S24 A;  5JJL A;  2Y0S G;  4X65 L;  3HOU H;  3I55 A;  1UE5 A;  3KJO A;  1YVC A;  4JI5 L;  4DR5 Q;  4YY3 Q;  2F4V L;  4DV0 Q;  1QUQ A;  1E1O A;  3RN5 A;  3S16 H;  3S1M H;  4TQU S;  2BA0 A;  3D0F A;  1PH6 A;  3CF5 A;  1ASY A;  2R7D A;  1CSQ A;  3FHW A;  3F2D A;  2KCT A;  2RHS B;  3AQQ A;  1XPR A;  1VQ8 A;  4L5R C;  2ZJR A;  1FJG L;  2JA8 G;  3CPF A;  2JEA I;  1YJ9 A;  2R7Z G;  4LWC A;  4QQB X;  1VQB A;  3CCJ A;  4IPD A;  2Y0S E;  1NMG A;  1KAW A;  2A19 A;  5ELN A;  1UEB A;  1YHA A;  2F52 A;  1WI5 A;  4GLA C;  4J15 A;  4LUV A;  1M1K C;  3S15 H;  4B3T Q;  3S2H H;  5C44 H;  1I6H H;  4R4Q A;  3KF6 A;  1Q82 C;  3PV0 A;  1X55 A;  2NZH A;  4LFC Q;  1YZ6 A;  2PI2 A;  3PO3 G;  2PMZ E;  3SGI A;  4GKK Q;  3PUW A;  4C3I H;  3WWV A;  4B3S L;  2ID0 A;  1QUQ B;  3I4O A;  3U50 C;  3OTO Q;  2VQF Q;  4FDB A;  4JI3 Q;  4LF9 Q;  2Z0S A;  2ES2 A;  3A74 A;  1XNQ L;  3HOX G;  3GTO H;  4IOA A;  1B7Y B;  4IPG A;  4A3B G;  2D0O A;  5GRO A;  4JBK A;  1SN8 A;  1MJC A;  1Q1E A;  1WFQ A;  1HNZ Q;  1SRO A;  1NTG A;  3E0E A;  5EAY A;  4H02 A;  2D62 A;  5IYC G;  4UP7 A;  3PIO A;  1U0L A;  4DR5 L;  4A3F G;  4JI7 L;  3K7A H;  5ELO A;  2CQO A;  1UE6 A;  4ALP A;  1XMQ Q;  3GO5 A;  3DLL A;  1PH7 A;  3E9I A;  3GTG H;  1L1O C;  1KRS A;  3B6Y A;  1JE5 A;  5AJ3 Q;  2VUM H;  4GOP C;  4BBS G;  1KD1 C;  3JC6 6;  2HIX A;  1I94 L;  3PO3 H;  4A3E H;  2GVA A;  1PFS A;  1TXY A;  3PUX A;  5IP9 G;  3KYH C;  1HR0 L;  2YYZ A;  4DV5 Q;  1KIX A;  2I5M X;  1VQF A;  1VQG A;  4HJA A;  4B3T L;  1WCM H;  3HOX H;  1HR0 W;  3U58 A;  5M3F G;  4A3B H;  1FGU A;  1WJJ A;  4A3M H;  5C0X G;  2BH8 A;  1D8L A;  1VQE A;  2QEX A;  3PUZ A;  2ZM6 Q;  1CUK A;  3IRB A;  3CC4 A;  4JI2 Q;  4UY8 C;  2E2H H;  3KDF B;  4LF8 L;  2A8V A;  1S3O A;  1YHB A;  5IP7 H;  1QZH A;  4A3J H;  4C2M H;  4A3K G;  4JI3 L;  1SRU A;  3OTO L;  4DV4 Q;  4WJ3 M;  3PSI A;  3L7Z C;  1CKN A;  4YCW A;  5FLX c;  4L5T A;  5LMN L;  1YI2 A;  3F2C A;  2ZTD A;  3ULL A;  4BXX H;  2WAQ G;  4LFB Q;  2IY5 B;  4DAM A;  4A75 A;  2Q2U A;  4HIO A;  5LMN W;  2HT1 A;  1K73 C;  1X56 A;  1XMQ L;  5IP9 H;  3RLO A;  1OXT A;  2PI2 E;  1VQD A;  2PQA B;  3D31 A;  5M5W H;  3U4Z A;  2MNA A;  3EN2 A;  3S1R H;  2CCZ A;  4BBR G;  4GLX A;  4GLV B;  1C7Y A;  3RLN A;  4DR4 Q;  4JV5 Q;  2LXJ A;  4QY7 A;  1YHQ A;  1IXR A;  4LF7 Q;  4O0A A;  2K52 A;  4PMW A;  3GTM H;  1UWV A;  1IL2 A;  3L0O A;  2WAQ E;  3AYH B;  1VQ4 A;  2VNU D;  3ICE A;  4Y52 H;  3G71 A;  2OQK A;  1A0I A;  3GDE A;  1LTL A;  2CWA A;  5FLM G;  3GTJ H;  4A3K H;  1VQP A;  2GVB A;  4LUO A;  2UU9 Q;  3HOW H;  4P72 A;  2OQ0 A;  3ULJ A;  3M85 A;  1VQI A;  1S40 A;  4Y7N H;  1Y1V H;  2LSS A;  1G51 A;  1W3S A;  4R4O A;  1L0W A;  1T9H A;  2ZM6 L;  4HID A;  3RNU A;  1Z47 A;  4QJF A;  4A3G H;  2R92 H;  1VQC A;  2E2I H;  2HQL A;  1VQO A;  2R93 G;  5C3E H;  5GAE C;  1PH4 A;  4JI6 L;  2NVQ H;  3UDG A;  4AYB E;  4DNI A;  2VS1 A;  3I4M G;  1Y1W G;  2E8G A;  4GS3 A;  1LM0 A;  1GD7 A;  2C35 B;  2YTY A;  4L5S A;  4JBW A;  4NPS A;  3PUV A;  4APV A;  4BBR H;  4OWW B;  4BA2 I;  1KHI A;  4A93 H;  4GN4 B;  2HHH Q;  5C4X G;  1PYB A;  1XNR Q;  4DV1 Q;  2FXQ A;  1YIT A;  1HNZ L;  3UE0 A;  5FLM H;  2JA5 G;  4BY1 H;  2IT1 A;  1O7I A;  2AMC B;  1JJG A;  3UDX A;  4C3J H;  4LF6 Q;  2PNH A;  3CCS A;  4YHH Q;  1E22 A;  2VQE L;  3S1N H;  3UE1 A;  1P8L A;  4GNX C;  3E9H A;  1IYJ B;  1Y14 B;  3TRE A;  2IX1 A;  4IPC A;  2OCE A;  5DLQ E;  1K9M C;  2YTV A;  3I4M H;  1Y1W H;  1E24 A;  3T1Y Q;  2I5H A;  3PO2 H;  3PCO B;  1TWC H;  1C9O A;  2K5H A;  4XIG S;  4NXN L;  2NVX H;  2JA6 H;  1L1O A;  4QL5 A;  4HJ7 A;  5C0X J;  1FL0 A;  4GOP A;  3J7Z C;  5C4X H;  1RIP A;  2GN5 A;  4PZ6 A;  1IBL L;  1VQ5 A;  2AKW B;  4X64 Q;  2UXD Q;  1HH2 P;  4DV3 L;  3CD6 A;  5J3B A;  2JA5 H;  4X62 L;  3S2D H;  2NVY H;  3EIV A;  2ASB A;  3CME A;  1YEZ A;  4DPG A;  4A3I H;  1HZC A;  3F2B A;  1PH1 A;  1X9N A;  1YBY A;  1XNR L;  2VUM G;  2Q2H A;  3HOZ G;  5E7N A;  1V43 A;  3FP9 A;  3J81 i;  1IBM Q;  2BA1 A;  5K36 G;  2QGQ A;  1VQL A;  4PG3 A;  3J7A 5;  4JYA L;  2B29 A;  2XTI A;  1VQM A;  4POF A;  2L15 A;  4UP8 A;  4A3E G;  1QVF A;  2ATW A;  4R4C A;  1EOV A;  3CC2 A;  1FVI A;  4DV6 Q;  3T1H Q;  1LUZ A;  4LUZ A;  4DV7 Q;  1Q1B A;  2OTL A;  4LF6 L;  2IX0 A;  1L1O B;  4A3D H;  2K5V A;  4KHP Q;  1WCM G;  2ZJP A;  2UUC Q;  1E1T A;  2EXD A;  3CW2 C;  4YCU A;  4GOP B;  1EIF A;  4JI4 Q;  4A3M G;  3CCL A;  1ASZ A;  1P16 A;  3NEM A;  4OWT B;  1X3G A;  3JAM c;  1GKH A;  4IOC A;  4MZ9 A;  1XPO A;  4A4I A;  3BJU A;  1VCI A;  5IP7 G;  2Q2T A;  3NBH B;  4DK3 C;  3RR5 A;  4YY3 L;  3I56 A;  4DV0 L;  4A3J G;  4NXM Q;  4OO1 I;  1VQ9 A;  1E7Z A;  5M5Y H;  3K81 C;  3KLW A;  3G48 A;  1H95 A;  2ZJQ A;  3HOZ H;  1VS0 A;  4GN5 A;  1CKO A;  3KFU A;  4BXX G;  3KF6 B;  4X64 L;  1K8A C;  1HNX Q;  2JA7 H;  2UXD L;  1UE1 A;  2H5X A;  1VQN A;  5IE8 A;  3K0X A;  2CWP A;  4RG1 A;  1PHJ A;  4DKA C;  1I3Q H;  3G6E A;  2RF4 A;  3GTL H;  4LF4 Q;  4K0K Q;  3M3Y H;  2JEB I;  4P73 A;  4DR6 Q;  2WB1 G;  1PH8 A;  5JJK A;  3S1Q H;  2MFI A;  2MQH A;  5BR8 Q;  3GD7 A;  4P75 A;  3OW2 A;  4JI0 Q;  1HJP A;  1XTD A;  4LFC L;  1AH9 A;  4IJL A;  1UE7 A;  4GKK L;  4KI0 A;  1BBU A;  3ERS X;  4A3C H;  4PZ7 A;  4DV6 L;  4MNO A;  4DV7 L;  3STB C;  5IWA Q;  3CAM A;  2Q2I A;  2VQF L;  4LF9 L;  1V9P A;  4YCV A;  1YJW A;  3GTQ H;  3HOW G;  3TS2 A;  1VQJ A;  2YTX A;  4JI4 L;  4WJ4 A;  4QIW E;  2OWO A;  3BU2 A;  1Y1V G;  1VQA A;  3BZK A;  3G4S A;  1A8V A;  2WB1 E;  1OXV A;  3CC7 A;  4A3G G;  2R92 G;  2UUA Q;  3I7F A;  3NEN A;  5JEA G;  1Q7Y C;  3M4O H;  5C3E G;  4DR1 Q;  3K8A A;  1KQS A;  1JMC A;  1JJC B;  1GO3 E;  2UUB Q;  1D7Q A;  1NBW A;  5AJ3 L;  3H3V H;  2ALY B;  1JB7 A;  4DV2 Q;  4A93 G;  1AE3 A;  2DUD A;  4X66 Q;  1KL9 A;  1HNX L;  2I0Q A;  4LW1 A;  4B3R Q;  1SE8 A;  4L5Q A;  2B63 H;  4GNX A;  5IYB H;  4AIM A;  1XMO Q;  2KHI A;  1N34 Q;  1PH9 A;  2CKZ B;  1HZB A;  1TWG H;  4DUZ Q;  2EQS A;  2JQO A;  4LF4 L;  4DV5 L;  4K0K L;  4BY1 G;  4AH6 A;  1YNX A;  4EX5 A;  3HFZ B;  3GTP H;  5BR8 L;  3MXN B;  1CKN B;  1JJ2 A;  2KEN A;  3FKI G;  3M4P A;  3W1B A;  1SFO H;  5FJ8 H;  3ULP A;  2E2J H;  1TWH H;  4JBM A;  1HZ9 A;  2VZA A;  2Z6K A;  4LFA Q;  1Q46 A;  3CPW A;  1PH3 A;  4JI2 L;  3H3V I;  3S14 H;  1X3E A;  1Z9F A;  3A0J A;  4DR3 Q;  4BA1 I;  4DV4 L;  1I5F A;  4YWM A;  4HJ8 A;  2BH2 A;  1XJV A;  3CP0 A;  3F1Z A;  1N36 Q;  3PO2 G;  4LF5 Q;  4JOI C;  1BBW A;  5IY0 A;  1X65 A;  1Q86 C;  1KRT A;  1N8R C;  1K8G A;  3KOJ A;  3H0G G;  2JA6 G;  1VQ6 A;  2JK8 A;  5LMU Q;  4UPA A;  1XPU A;  4LFB L;  2VY3 A;  3AFP A;  1HNW Q;  2MO0 A;  1GM5 A;  4GNX B;  4DUY Q;  4JI1 Q;  3M9B A;  5M3M G;  1G6P A;  1E3P A;  3L2P A;  4IFD I;  3A5U A;  1OXU A;  2UUB L;  1J5E Q;  3GTK H;  3HOV G;  3H15 A;  3KF8 B;  1KC8 C;  4AQY Q;  4DV2 L;  4YWK A;  2NZO A;  4A3I G;  3M7N A;  3FKI H;  1PYS B;  4DR4 L;  4JV5 L;  2NN6 I;  4PZ8 A;  5GAD C;  4LNQ A;  4LF7 L;  4JC0 A;  4MTN A;  4JG2 A;  4OO1 G;  2ZTC A;  1N32 Q;  1NY4 A;  1FJG Q;  5IYD H;  2K14 A;  3UDI A;  4C3H H;  2UU9 L;  3HKZ G;  2K50 A;  1IBK Q;  4IJH A;  1BKB A;  2VL6 A;  4A3D G;  4TVA B;  4XTC S;  1CKM A;  3F8T A;  3H0G H;  1R9T H;  4LFA L;  2R6G A;  2HIV A;  2Z6K C;  4DR3 L;  1N33 Q;  4B3M Q;  4O2D A;  4OON A;  5M3M H;  1JT8 A;  4KLK A;  4POG A;  2R7F A; 
#chains in the Genus database with same CATH topology
 4DR7 Q;  2AWN A;  1XNQ Q;  1W2B A;  1C8C A;  3U9S A;  1WCM B;  3CCU A;  1FYC A;  3AB9 A;  4KD4 A;  4DV1 L;  1WTW A;  1PH5 A;  2E5L Q;  1B2T A;  1B70 B;  5JEA J;  4ZKB B;  3PIP A;  4JI7 Q;  1PZK D;  1E2V A;  2UXB Q;  1ESF A;  4C2M B;  4G7O C;  1OTC A;  4J1M A;  4YHH L;  2XSC A;  1X54 A;  3RN2 A;  1AN8 A;  1IKL A;  1M90 C;  1TWA H;  2B2V C;  2NBF A;  3PIO 3;  1WTX A;  1IBK L;  3N6R A;  3T1Y L;  4KHZ A;  4A3C G;  1XYI A;  3CQZ H;  4U67 3;  3VDY A;  1EQQ A;  4BY7 G;  4TKO B;  1SR3 A;  3SVM A;  1PV4 A;  2NTS A;  2N3S A;  1N33 L;  4RMF A;  2YU9 H;  1STE A;  2IPK D;  5KIX A;  4LF8 Q;  3K58 A;  1AW7 A;  1PTO F;  1NR4 A;  4RA8 A;  2KBN A;  2EYP A;  4RGN A;  2DNE A;  5A2Q E;  5FKA C;  3OHX C;  3K59 A;  1U5K A;  1Y1V B;  4IUP A;  5KYI A;  4QGU A;  3MXP A;  4DAY B;  2Z1C A;  5IYB G;  1BVS A;  2TSS A;  2N78 A;  1OXX K;  1SXT A;  3RLF A;  4GKJ Q;  5LL6 X;  1SND A;  1VQ7 A;  1KLG D;  4A93 B;  4RCN A;  1OO9 B;  3NWT A;  1G91 A;  3W2D A;  2FFK B;  4IUV A;  3HOY G;  3CCV A;  3NTH A;  4JK1 C;  3HKS A;  2R3Z A;  1D5M C;  1QNK A;  3CRK C;  4K8I A;  4QCL A;  4UHV A;  2KCN A;  4KTA A;  2F03 A;  1DOL A;  5IT9 L;  3I4M B;  1VQH A;  1JB3 A;  1QOH A;  3PO2 B;  1TWC B;  3LX0 A;  2NVX B;  5CV8 A;  3X3M A;  4JI0 L;  2QF7 A;  1S5C D;  2WKC A;  4Q0F A;  4R4I A;  3QG1 A;  5L37 A;  1QCB D;  1EFW A;  5C0X H;  4A3L G;  1HUM A;  2D0P A;  1TS5 A;  2F0I A;  4OHJ A;  1WYD A;  5EBD A;  5F2D A;  3C46 A;  3Q8D A;  3D4D A;  4DR1 L;  2P5Z X;  4X65 Q;  2UXC L;  2CW0 C;  4NMZ A;  4IPH A;  1MKH A;  3W5O A;  4X66 L;  1QZG A;  1Q81 C;  5KGU A;  1ENA A;  3CCR A;  1N34 L;  3AFQ A;  2B2V A;  3HOU G;  4DUZ L;  2F3V A;  1EZ6 A;  3X3N A;  2EJM A;  3AEV A;  2WFW A;  3J80 i;  3SR1 A;  2DY8 A;  2QA4 A;  1CHP D;  2LFN A;  1EIY B;  2F0D A;  1KDB A;  2IHE A;  4EQO A;  2XIW A;  2PZT A;  5LMU L;  4Z9C B;  3ERO A;  1DOM A;  3HKZ E;  5NUC A;  3RZO H;  3DM1 A;  3TQY A;  1EWI A;  2Y0S G;  1MGS A;  1GUN A;  1YVC A;  4JI5 L;  4YY3 Q;  2F4V L;  5C6A A;  1E1O A;  3S16 H;  1B3A A;  5KEE A;  2B2W C;  1ASY A;  4CHT B;  1CSQ A;  2KCT A;  5CBE E;  3Q6S A;  1XPR A;  4KHV A;  3D6C A;  2RA4 A;  2KQ3 A;  1ML0 D;  1AZP A;  1VQK A;  1ENF A;  1WI5 A;  1M1K C;  3S15 H;  5I6W A;  4LMQ D;  3PUW A;  4B3S L;  3U50 C;  1QUQ B;  4LF9 Q;  2JP1 A;  3OTO Q;  2K5W A;  4FDB A;  2A68 C;  3HOX G;  4IPG A;  4A3B G;  3E3X A;  4JBK A;  1HHV A;  2ICE C;  4RGT A;  1EEF D;  1SRO A;  3E0E A;  3P75 A;  5EAY A;  2K04 A;  3GQB A;  4FP5 D;  5T1I A;  3K7A H;  2CQO A;  3VR6 A;  1PH7 A;  3P7J A;  1KRS A;  1CQV A;  4FNF A;  2IJ0 A;  3ND9 A;  1YNJ C;  2L9H A;  3PO3 H;  1LT3 D;  4DAV A;  1ET9 A;  1PFS A;  1HR0 L;  4HR7 B;  1KIX A;  1EFI D;  3S9W A;  4HJA A;  3GTK B;  3QR8 A;  4KY6 A;  3TP5 A;  3U58 A;  5D65 A;  5C0X G;  5JVG 3;  1D8L A;  2QEX A;  2ZM6 Q;  4UY8 C;  2E2H H;  2K5Q A;  3KDF B;  4RKL A;  1S3O A;  3QJY A;  5IP7 H;  2E74 C;  4A3K G;  1SRU A;  1RCV D;  2NWG A;  5A35 A;  3L7Z C;  1CKN A;  5LMN L;  3F2C A;  4I7A A;  2Q8R E;  4A75 A;  5IP9 H;  3RLO A;  3NQI A;  1OXT A;  2PI2 E;  3S1R H;  2MNA A;  1HNZ Q;  1BBX C;  2CCZ A;  2PQE A;  2Z4H A;  2Z6B A;  3DWA A;  2VXW A;  1CM9 A;  4GLV B;  4JV5 Q;  1U4P A;  4QY7 A;  1IXR A;  4LF7 Q;  2K52 A;  4K8J A;  4IZ8 A;  5CV6 A;  1I4R A;  3G71 A;  1A15 A;  1VQP A;  5CV4 A;  3C1F A;  3NTI A;  1GUG A;  4LUO A;  4R8I A;  1B53 A;  4C1N I;  2LSS A;  5I9O A;  2EJF C;  3RNU A;  2B2W A;  1Z47 A;  3VR5 A;  1VQC A;  2VB3 X;  2FHT A;  1ICW A;  4J6H A;  4YIJ A;  2NB0 A;  1TWA B;  3IKJ A;  4C1N K;  2NZ1 D;  5EKI A;  1Y1W G;  2SDF A;  2Q8T A;  2JSO A;  4L5S A;  4APV A;  3CQZ B;  1KHI A;  1XNR Q;  4DV1 Q;  2MP1 A;  4JVZ A;  2YU9 B;  1BCP D;  4LK1 C;  1DM0 B;  1MSG A;  2CH4 W;  2Y0S B;  2JA5 G;  2A6E D;  2IT1 A;  1NNX A;  2A69 D;  2XWJ B;  4RCO A;  4DN4 M;  4YHH Q;  2Z8L A;  3S1N H;  4B9W A;  3UE1 A;  1IYJ B;  2IX1 A;  4IPC A;  1SJH D;  3T1Y Q;  3MEH A;  1F9R A;  2K5H A;  3NTK A;  2F0W A;  2IX3 A;  1FL0 A;  1QIL A;  5C4X H;  1IBL L;  1VQ5 A;  1U4L A;  4J8Q A;  4DV3 L;  4IUN A;  1PTO H;  4ILW A;  1BCP B;  3S2D H;  2NVY H;  2ASB A;  2A6H C;  1YEZ A;  4DPG A;  3CME A;  4A3I H;  4CJ1 B;  4CDC C;  1DCZ A;  2XWB B;  4CJ0 B;  1V43 A;  2WIN B;  1TVX A;  3J7A V;  2BA1 A;  4OO1 H;  1EIH A;  4PG3 A;  2C9O A;  4UP8 A;  4HSP A;  4R4C A;  5E4X A;  3TP6 A;  4ZYS A;  3CC2 A;  4DV6 Q;  4LF6 L;  4LUZ A;  1O7Y A;  4A3D H;  2L11 A;  2K5V A;  3VYR A;  3CW2 C;  3T51 B;  3A8I E;  1ASZ A;  3OWE B;  4IOC A;  1XPO A;  5EPL A;  4A4I A;  1DZ1 A;  3OIQ A;  2O4X A;  1T5X D;  5IP7 G;  2Q2T A;  3WDN A;  4DK3 C;  5C4Z A;  3Q0A A;  4DV0 L;  1E7Z A;  5D3D A;  3KLW A;  2HUG A;  2O5J C;  3OIP A;  1SMY D;  3I3C A;  2PYK A;  3HOZ H;  1HNX Q;  2UXD L;  1LTB D;  1WTR A;  1EY6 A;  1VQN A;  5E3F A;  1YNN C;  1VF5 C;  1I3Q H;  3M3Y H;  2ICI A;  4DK1 A;  1I4Q A;  5EKL A;  4P75 A;  1U4M A;  4JI0 Q;  4LFC L;  3EJI A;  1EU4 A;  3K57 A;  4IJL A;  4GKK L;  1F2Z A;  3A56 A;  1BBU A;  4P2C B;  3ERS X;  3L9A X;  4CKB A;  2K33 A;  4MNO A;  3CAM A;  3TS2 A;  1V9P A;  3GTQ H;  3KUP A;  2YTX A;  1MI2 A;  2X6L A;  1VQA A;  5C5L A;  4AYB B;  3J7A F;  1Q7Y C;  3M4O H;  1HQM C;  2QIL A;  5C3X A;  4DR1 Q;  3HEJ A;  4WRD A;  1KQS A;  2QDB A;  3OSO A;  5AJ3 L;  4DV2 Q;  4IUU A;  4X66 Q;  1KL9 A;  3HP3 A;  1SE8 A;  2F0G A;  1H9J A;  5COR A;  4AIM A;  1N34 Q;  3RZO B;  4DUZ Q;  2A73 B;  4WOR A;  4CJ2 C;  1EOT A;  3GTP H;  2C5C A;  5BR8 L;  3MXN B;  1BF4 A;  3A54 A;  1JJ2 A;  3FKI G;  3S16 B;  3R93 A;  3W1B A;  1HRJ A;  1TWH H;  4CKC A;  2J0T D;  4RGO S;  4LFA Q;  4O1N A;  1PH3 A;  4JI2 L;  1X3E A;  1Z9F A;  3I70 A;  2D5D A;  5ELF A;  4OGQ C;  1LTT D;  3HZX A;  4G7Z C;  1KLU D;  1BBW A;  2PCF B;  1X65 A;  3A55 A;  2BDO A;  3H0G G;  1ILQ A;  4K2K A;  4ZQ3 A;  5LMU Q;  1VQ6 A;  4DK0 A;  1WTQ A;  3S15 B;  3J80 L;  4GNX B;  5M3M G;  1E3P A;  3A5U A;  4TSS A;  2UUB L;  4RGM A;  1KC8 C;  4AQY Q;  2NZO A;  4A3I G;  2NN6 I;  1Y8P B;  1J9O A;  4MTN A;  4OO1 G;  3OMC A;  4C3H H;  1WTP A;  2UU9 L;  3KK7 A;  1SNO A;  2K50 A;  5IIF A;  4IJH A;  1JCK B;  3K7A B;  2QKI C;  4A3D G;  1ZYR C;  2Z6K C;  1JT8 A;  1SYC A;  4POG A;  3PO3 B;  1O78 A;  1LAC A;  4QUC A;  1LYL A;  4B3S Q;  1EL0 A;  1SSO A;  2EYH A;  2MUY A;  2HHH L;  2K1B A;  3J81 L;  1EZ8 A;  5FO7 B;  1EYA A;  3NQT A;  5D14 A;  3MXU A;  2WP8 J;  4X6A H;  1J5E L;  2E2H B;  1ESR A;  3DHQ A;  2F4I A;  3STB D;  2K28 A;  4MHE A;  3I4N H;  1V8Q A;  1RDP D;  3OYY A;  1N32 L;  5DM7 3;  1M4V A;  1YJN A;  2O5I C;  1NJI C;  3HG9 A;  4G57 A;  1HR0 Q;  4RFB A;  2PW7 A;  4R1J A;  1GVP A;  3S1R B;  1F77 A;  5IOD A;  2RSO A;  2PO4 A;  2N55 A;  2KCM A;  4N8X 1;  1BXT A;  3ER0 A;  2JA9 A;  2V1C C;  4OX9 L;  1DD2 A;  1SE3 A;  2N49 A;  5LMN Q;  1X32 A;  5GAH C;  5BN5 A;  4DR2 Q;  1IBM L;  2EPB A;  2XRQ D;  2JA8 H;  2R7Z H;  2BDN A;  4ZK9 B;  1I50 H;  3T1H L;  4N9T A;  4KHP L;  4JI8 Q;  4BY7 H;  1V1O A;  3BG3 A;  1A63 A;  4IFD G;  1PRT C;  3MWY W;  5IGD A;  3NHH A;  1MJE A;  1PTO D;  4NXM L;  4YWL A;  5C4J H;  2ZTE A;  3V05 A;  1RL2 A;  1BUV T;  2K75 A;  3S1N B;  5IYC H;  2E75 C;  4DR6 L;  3BZC A;  1F2Y A;  2IHF A;  1EY0 A;  5DM6 3;  1VMP A;  2AQ3 B;  2MO1 A;  3CXC A;  3RZD H;  2EIF A;  1PFB A;  4K14 A;  5C4X B;  2EOT A;  4F8M A;  3HOY H;  1Q3L A;  4ODG A;  4EQ5 A;  4HIK A;  1PTO B;  1RTN A;  4M8A A;  4C3H G;  5CMD A;  2BE5 C;  3MXG A;  3S2D B;  1SAP A;  5M3F H;  1SDF A;  2NVY B;  2GA4 B;  1C0A A;  4A3I B;  3RMH A;  2QDL A;  4ZAI A;  5I2Y A;  1BDO A;  2UUA L;  4OWX B;  1QVG A;  1K3R A;  2BCO A;  1FNV A;  4RWS C;  1I4X A;  3CCM A;  3D3R A;  2AQ2 B;  2L12 A;  3KLS X;  3TEH B;  4A3D B;  5LHY 1;  1IBL Q;  1CSP A;  1JR0 D;  4DV3 Q;  1LV9 A;  4NW2 A;  2XGT A;  4HCE A;  3K5N A;  1PH2 A;  1MSH A;  4R4T A;  5JOB A;  1ZKO A;  4KY7 A;  3SHL A;  3D6W A;  1CA6 A;  3I4N G;  4A3L H;  1AP0 A;  1AEX A;  1S5D D;  3HOZ B;  5EJW A;  2F0P A;  1EQR A;  5IT9 c;  2EY6 A;  1Q8I A;  1HZA A;  2KA7 A;  1I3Q B;  4LF5 L;  5C44 G;  3M3Y B;  2RCN A;  1MIU A;  3S24 A;  2EE1 A;  1UEA B;  3HOU H;  1UE5 A;  4DR5 Q;  3VYU A;  4EGV A;  4DV0 Q;  2N88 A;  4R8N A;  1V1P A;  1EY7 A;  5AFW A;  3GTQ B;  3SEB A;  2EYL A;  4PNY A;  3CF5 A;  1SEB D;  3FHW A;  4L5R C;  2ZJR A;  2JA8 G;  3H94 A;  4R9W A;  3NBH A;  2JEA I;  2R7Z G;  4LWC A;  3M4O B;  1VQB A;  2Y0S E;  2A19 A;  5ELN A;  1UEB A;  4B3T Q;  2A5H A;  4R4Q A;  3KF6 A;  5FLX L;  3PV0 A;  3J80 E;  1CI3 M;  1PFM A;  1IL8 A;  4LFC Q;  2PI2 A;  4GKK Q;  5ELE A;  2B2T C;  2Q8I B;  1ONL A;  2ID0 A;  3I4O A;  1WTV A;  4C56 C;  2ES2 A;  4IOA A;  1FR3 A;  3GTP B;  5GRO A;  4DF7 A;  1MJC A;  1Q1E A;  1SNP A;  1WFQ A;  1TWH B;  4XQJ A;  5IYC G;  2CQA A;  2HDL A;  3OW7 A;  5ELO A;  4CDE C;  4ALP A;  1D1I A;  2I46 A;  4KJN A;  4KV6 A;  4XYQ A;  3E9I A;  4DFA A;  4ULL A;  3GTG H;  3B6Y A;  1QJO A;  4FVM A;  5AJ3 Q;  2VUM H;  4GOP C;  1I94 L;  2WII B;  2DY7 A;  4A3E H;  1TXY A;  3PUX A;  2CW0 D;  2CHB D;  1VQG A;  2SEB D;  3HOX H;  1HR0 W;  5M3F G;  4A3B H;  1FGU A;  5CC4 A;  4A3M H;  1H9S B;  1VQE A;  3PUZ A;  3CC4 A;  1VMC A;  4JI2 Q;  1CZG A;  4KY5 A;  5DEH A;  3VR2 A;  1YHB A;  1QZH A;  1TY0 A;  4A3J H;  1G8Z D;  4JI3 L;  1II3 A;  3FEW X;  1LTR D;  4C3H B;  1SYF A;  5I6Y A;  4KJO A;  1YI2 A;  2ZTD A;  1B3Q A;  1EWC A;  2WAQ G;  4HIO A;  5LMN W;  1K28 A;  1XMQ L;  2A74 C;  3LWU A;  2PQA B;  3D31 A;  3U4Z A;  3EN2 A;  4BBR G;  4GLX A;  1YHQ A;  3GTM H;  3IAY A;  2VNU D;  3L0O A;  3AYH B;  4V0B A;  1I6V C;  5J1Z A;  3GDE A;  5ELB A;  5FLM G;  4A3K H;  3GTJ H;  3SK4 A;  1PH6 A;  2UU9 Q;  2L5T A;  3KF8 A;  3ULJ A;  2F1M A;  2OQ0 A;  3M85 A;  1U4R A;  4Y7N H;  1D5Z C;  1L0W A;  4HID A;  4R4O A;  5TSS A;  3I4N B;  3IL8 A;  4A3G H;  3C1E A;  2HQL A;  5JEA H;  2F0T A;  5GAE C;  1PH4 A;  4JI6 L;  4AYB E;  3BYT B;  2VS1 A;  4JW0 A;  1GD7 A;  2C35 B;  2YTY A;  3OWF A;  5T1G A;  1MBY A;  3PUV A;  4BA2 I;  2HHH Q;  2FXQ A;  4L63 B;  2B8G A;  3KLR A;  1ILP A;  1TS2 A;  1A2U A;  3JAM L;  3UE0 A;  4PMB A;  4BY1 H;  3FRP B;  1SE2 A;  2B2T A;  2A68 D;  3UDX A;  2KJX A;  3CCS A;  1E22 A;  3E9H A;  3BDO A;  1Y14 B;  1GUO A;  3PIP 3;  2PNR C;  5DLQ E;  1Y8N B;  2K5D A;  2JA8 B;  2R7Z B;  1Y1W H;  2I5H A;  1KNA A;  3PCO B;  1C9O A;  4CKE A;  4XIG S;  2JA6 H;  1I50 B;  4QL5 A;  4HJ7 A;  3LNN A;  2MHV A;  4GOP A;  4BY7 B;  2GN5 A;  4PZ6 A;  4ZUJ A;  1YNJ D;  5IGF A;  2CVR A;  2XNA C;  2JA5 H;  4X62 L;  3OMG A;  2F0Q A;  3BDC A;  4IUQ A;  5C4J B;  1HZC A;  3F2B A;  2VUM G;  5E7N A;  3J81 i;  1IBM Q;  3J7A 5;  4JYA L;  2ATW A;  4ZRZ A;  4A3E G;  2DNC A;  1GUT A;  3VA5 A;  1XWE A;  3T1H Q;  1LUZ A;  4KHP Q;  2OTL A;  1S5E D;  2EDG A;  2IX0 A;  5I4D A;  2ZJP A;  3Q24 A;  4JI4 Q;  5G3L D;  4DAY A;  4A3M G;  1X3G A;  3RZD B;  1GKH A;  1TS3 A;  1QG7 A;  2F0N A;  1IKM A;  2PZW A;  4NXM Q;  4A3J G;  3HOY B;  1H9K A;  3VR4 A;  3G48 A;  2G9D A;  3SE0 A;  1VS0 A;  5M3F B;  2FMM A;  2QCP X;  4X64 L;  2JA7 H;  2H5X A;  3PQI A;  1K3B C;  3K0X A;  2CWP A;  2ZT9 C;  4FXK C;  3HGB A;  4IQZ A;  3G6E A;  2RF4 A;  3GTL H;  1VF7 A;  4K0K Q;  1PZJ D;  2JEB I;  1XX8 A;  4DR6 Q;  1PH8 A;  3S1Q H;  1CT1 D;  5CBA E;  2WAQ B;  1EY5 A;  4QB4 A;  3WOE A;  4H44 C;  4KI0 A;  1CFM A;  2RDH A;  4DV7 L;  2EYM A;  2VQF L;  1WVL A;  3BU2 A;  4TRD A;  1A8V A;  4XQQ A;  3CC7 A;  1TT2 A;  4A3G G;  2UUA Q;  5JEA G;  1EYD A;  2EY5 A;  1JMC A;  1GO3 E;  2KCC A;  1D7Q A;  5IGB A;  2ALY B;  1JB7 A;  1PYW D;  2DUD A;  2EXZ A;  3J7Y W;  5ELC A;  2B63 H;  3I90 A;  1ZXT A;  1BQQ T;  1PH9 A;  4ME5 A;  2CKZ B;  3E5S A;  1S4Z A;  2JQO A;  4LF4 L;  3HOU B;  4BY1 G;  3MHB A;  3P20 A;  4AH6 A;  1YNX A;  4EX5 A;  4DA2 A;  3M4P A;  1SFO H;  1EQT A;  4OIJ A;  3U9O A;  4JBM A;  2VZA A;  1Q46 A;  3A0J A;  4BA1 I;  3URY A;  4DV4 L;  1I5F A;  4HJ8 A;  1FNU A;  2NN6 H;  2BH2 A;  3F1Z A;  3EQL C;  1Y8O B;  3O13 A;  1GOZ A;  2WAC A;  4LF5 Q;  4JOI C;  1Q86 C;  2JA6 G;  1XPU A;  3GV6 A;  2LMC B;  4LFB L;  2E2D C;  5C4H A;  2OT2 A;  1KTK A;  1OXU A;  4K6L A;  1L0Y B;  3HOV G;  3L3O C;  5IOC A;  5I2X A;  3OPO A;  4RHR A;  1SYD A;  3FKI H;  1S5B D;  3GP7 A;  2D2C C;  3MC0 B;  4JC0 A;  3IFD A;  2ZTC A;  4ZKC B;  3V2T A;  1HA6 A;  5IYD H;  2AUJ D;  2H1E A;  5EBC A;  3MVV A;  2EZV A;  3HKZ G;  1IBK Q;  5IT9 E;  1JE4 A;  1ET6 A;  4FO2 A;  1CKM A;  4XTC S;  3F8T A;  3GTG B;  3H0G H;  1GHK A;  2VUM B;  4HTH A;  4DR3 L;  1N33 Q;  5M3M H;  1N36 L;  4A3E B;  2KHJ A;  2VW9 A;  3K80 C;  1NCV A;  1TS4 A;  3HOX B;  1EU3 A;  4BS9 A;  4P71 A;  1KXL A;  4A3B B;  4A3M B;  2JA7 G;  2EY2 A;  4KN7 C;  2NVT H;  1I4G A;  3SK8 A;  4A3J B;  2AHO B;  4DNR B;  3MEF A;  3J80 c;  4S3S A;  2G5D A;  2JE6 I;  3PF5 A;  1I94 Q;  3KBX A;  5H1S E;  1X3F A;  1QVC A;  2RDG A;  4BWG B;  2NYZ D;  4FYD A;  5GAG C;  2F0M A;  1PA6 A;  1K0R A;  3VR3 A;  3U4V A;  4B3M L;  4NB3 A;  1BCP C;  3BDL A;  3GTM B;  4DR7 L;  4IN3 A;  4A3K B;  2A69 C;  2K5N A;  4O42 A;  3GTJ B;  2AWO A;  2LXK A;  4JPB W;  3J81 j;  2E5L L;  4Y7N B;  4ABN A;  3H09 A;  3KDF A;  3QO2 A;  3LGJ A;  2B63 G;  3A8K E;  4A3G B;  1IZ6 A;  2UXB L;  2B2Y C;  3PF4 A;  3T16 A;  1EUJ A;  3E0J A;  3J81 c;  1CZW A;  4JOI A;  2EYF A;  5FO8 B;  1TR5 A;  4FF2 A;  3I91 A;  3K7U C;  1G2T A;  2YV5 A;  4HCS A;  2EY1 A;  2Z9H A;  2I5L X;  2NN6 G;  1A3V A;  4BY1 B;  2UXC Q;  4RAU C;  1WOC A;  1GHJ A;  1STN A;  1SMX A;  4JCV E;  3NPP A;  1S72 A;  2CFM A;  4A3F H;  3TS0 A;  4JI6 Q;  1S5F D;  4P74 A;  5M5X H;  1Y1W B;  2JA6 B;  1KAA A;  4IFD H;  1ZYR D;  4UAI A;  5M9O A;  3TP8 A;  1B9M A;  3F2U A;  1XTC D;  5IYD G;  1X6O A;  5IWA L;  4G4K A;  4GKJ L;  3DM3 A;  3I2Z A;  2JA5 B;  1VDZ A;  1SMY C;  4DK6 C;  1JWU D;  1TY2 A;  1J6Q A;  4KKT A;  5K5P A;  3NWS A;  5KND A;  1BCP F;  3BYY B;  1KAB A;  1SLJ A;  4CGY B;  3NUC A;  2LS0 1;  5EKK A;  4JI5 Q;  3HKZ B;  2F4V Q;  2CH4 A;  1N9W A;  1L2F A;  3RUZ A;  3VYT A;  5EGT A;  2F3W A;  3TRZ A;  3NEL A;  5KRU A;  5GQO A;  3DMU A;  1K83 H;  4H7B A;  4IO9 A;  3CHB D;  1PVO A;  2FIN B;  4X62 Q;  1NE3 A;  2K4K A;  3MA2 B;  2ENB A;  4HIM A;  1A2T A;  2OTJ A;  1IW7 D;  2JA7 B;  5HY6 A;  4JYA Q;  3JAM i;  1E0B A;  3K5O A;  1JOR A;  4ZCK A;  1EIG A;  4QF4 A;  3GTL B;  2F0H A;  1WD1 A;  5A2Q L;  4GN3 B;  3CCE A;  3S1Q B;  1E2W A;  2R93 H;  2NUC A;  4LAA A;  4DUY L;  4JI1 L;  2OEO A;  4X65 L;  2I07 B;  3TZD A;  1AFP A;  2SOB A;  2B2Y A;  3S1M H;  3D0F A;  1QE6 A;  1TQO A;  3BZD B;  1RF2 D;  1PRT D;  1RJT A;  2R7D A;  1VQ8 A;  4DU9 A;  5DAU A;  1ICF B;  1YJ9 A;  1SYE A;  4QQB X;  3CCJ A;  1O80 A;  1LTA D;  1KAW A;  3BVZ A;  3RN5 A;  2HCI A;  4J15 A;  4LUV A;  1SBB B;  5C44 H;  4PQX A;  1I6H H;  1Q82 C;  1X55 A;  2NZH A;  1X3P A;  1YZ6 A;  2DN8 A;  2K01 A;  2B63 B;  2X69 A;  3WWV A;  3M4Y A;  2VQF Q;  2JXM B;  2Z0S A;  3A74 A;  3GTO H;  1G2S A;  2D0O A;  3NP8 A;  1PRT B;  1SFO B;  3P1H A;  1NTG A;  4H02 A;  3PIO A;  4A3F G;  4UP7 A;  1U0L A;  3M7G A;  1UE6 A;  4IUT A;  2BE5 D;  3DLL A;  5CV5 A;  5E4W C;  1L1O C;  1JE5 A;  4XDX A;  3G7L A;  3JC6 6;  5K36 H;  2HIX A;  3VA7 A;  3MZ5 A;  2GVA A;  3KYH C;  2YYZ A;  4L8J A;  2I5M X;  3DEP A;  5CGK A;  1JWM D;  1A3T A;  1M8A A;  2BH8 A;  3FKI B;  1RTO A;  1SNM A;  2A8V A;  1RKN A;  4WJ3 M;  3OTO L;  3A8J E;  4DV4 Q;  2RVL A;  3PSI A;  2ZXO A;  3MXN A;  4YCW A;  5FLX c;  4L5T A;  3ULL A;  4BXX H;  4LFB Q;  3H0G B;  1K73 C;  4XT3 B;  2PPB C;  1X56 A;  3TME A;  1LT6 D;  1EQV A;  5M3M B;  5M5W H;  3A7L A;  2L1B A;  2FJ2 A;  1DXM A;  4FF3 A;  1H9M A;  1JIC A;  2LXJ A;  2Z4I A;  4F7X A;  1UWV A;  2WAQ E;  1VQ4 A;  3ICE A;  4FF1 A;  2CWA A;  1BOS A;  1WTH A;  3HOW H;  1B44 D;  2NVT B;  1ZEQ X;  1FGB D;  2R61 A;  2M2L A;  1G51 A;  1W3S A;  3T56 B;  1T9H A;  2ZM6 L;  4QJF A;  2R92 H;  2E2I H;  1VQO A;  2R93 G;  5C3E H;  3FVQ A;  2NVQ H;  4DNI A;  3QIA A;  3I4M G;  5E1F A;  4KN4 C;  4GS3 A;  3C2P A;  1W6K A;  2NTT A;  1LM0 A;  4OWW B;  4JBW A;  4NPS A;  4BBR H;  4GN4 B;  1LTI D;  2LY7 A;  1PYB A;  3TP7 A;  3ZYY X;  1X3Q A;  1YIT A;  1HNZ L;  5JVH 3;  5FLM H;  3AU7 A;  2AMC B;  1JOQ A;  4C3J H;  4LF6 Q;  2PNH A;  1JQY D;  2VQE L;  4HMI A;  1GJX A;  3G6J B;  1P8L A;  2PMZ B;  3TRE A;  4HED A;  1WTO A;  2OCE A;  1K9M C;  3SXH A;  3TBI B;  3DWQ A;  5ISR A;  4NXN L;  1L1O A;  1C48 A;  5C0X J;  3WOF A;  3IFT A;  2UXD Q;  2F0O A;  3CD6 A;  1KNE A;  1C4Q A;  5ELD A;  2B2U C;  4EVO A;  4L6T B;  5DNF A;  3ONA B;  1X9N A;  1YBY A;  1XNR L;  5FK9 C;  3FP9 A;  5K36 G;  2MPM A;  1NUC A;  2QGQ A;  1VQL A;  2B29 A;  1UNS A;  2XTI A;  4POF A;  2L15 A;  1QVF A;  4A3F B;  2ZXR A;  1FVI A;  1TKW B;  2FMC A;  1U9R A;  1Q1B A;  5M5X B;  1E1T A;  2EXD A;  4GOP B;  3CCL A;  3ND8 A;  1P16 A;  3NEM A;  4K6D A;  2ZXP A;  4OEM B;  2RCF A;  3JAM c;  4MZ9 A;  1SYB A;  1MHW C;  1VCI A;  3KLS A;  5M5Y H;  3K81 C;  1H95 A;  2ZJQ A;  1ENC A;  1CKO A;  4BXX G;  1JC7 A;  2L55 A;  2AUK A;  4X3S A;  1UE1 A;  5IE8 A;  3K5L A;  4HAE A;  5D3I B;  4DKA C;  4P73 A;  1WD0 A;  2WB1 G;  5JJK A;  2MQH A;  3T53 B;  4KK7 A;  5BR8 Q;  3GD7 A;  3J81 E;  1BNZ A;  1HJP A;  1AH9 A;  2VB2 X;  4FF4 A;  1TII D;  1F9P A;  4PZ7 A;  1K83 B;  4DV6 L;  5IWA Q;  2Q2I A;  1D1K A;  3TSS A;  1YJW A;  3HOW G;  1VQJ A;  3QWN A;  4N8F A;  4WJ4 A;  3BZK A;  2O2L D;  2K05 A;  4PMC A;  3TN2 A;  2R92 G;  3I7F A;  3NEN A;  5C3E G;  1EEI D;  1H9R A;  5BN3 A;  1JJC B;  2UUB Q;  1KDC A;  1NBW A;  3W3A A;  1QWY A;  1AE3 A;  1HNX L;  5JPM C;  5BN4 A;  2J4X A;  2R93 B;  1HZB A;  1TWG H;  4H0L C;  2EQS A;  4DV5 L;  2KVM A;  3UI2 A;  4XT1 B;  2J7Z A;  1CKN B;  3PMF A;  4C3J G;  3Q22 A;  3S1M B;  5FJ8 H;  3ULP A;  2E2J H;  4FXD A;  3CPW A;  3S14 H;  3H3V I;  3K0Y A;  1HUN A;  5KNC A;  3I73 A;  1XJV A;  3CP0 A;  2B2U A;  3C3L A;  5IY0 A;  1K8G A;  1HTP A;  3KOJ A;  2JK8 A;  1F9Q A;  5KYL A;  3AFP A;  4B9X A;  4B08 A;  5C44 B;  1I6H B;  4DUY Q;  4DNT B;  4JI1 Q;  1G6P A;  3L2P A;  1Z6H A;  1F2L A;  1J5E Q;  3H15 A;  3A7A B;  4DV2 L;  4Q5V A;  3M7N A;  4DR4 L;  3GTO B;  5GAD C;  1NSN S;  4QUF A;  4LNQ A;  4XYO A;  1DOK A;  1N32 Q;  1SE4 A;  2K14 A;  2QW7 A;  5IGE A;  1BKB A;  2VL6 A;  1EYC A;  4K5V A;  1AZQ A;  5FOB B;  1R9T H;  4LFA L;  2XVS A;  2R6G A;  4GZY C;  2HIV A;  4OIK A;  2EYO A;  2H4O A;  4KLK A;  4OXP A;  1YIJ A;  3HOV H;  4DXF A;  4OX9 Q;  2V4D A;  4HJ5 A;  1HCZ A;  2JJQ A;  2N8N A;  1B4O A;  3CU7 A;  4AQY L;  2WV6 D;  5JJI A;  5JJZ A;  1E2Z A;  1Q12 A;  1V1Q A;  3FPP A;  3EBE A;  2RSN A;  2HD3 A;  1LAB A;  1XXG A;  1QB5 D;  4QIW B;  5M5W B;  1DJR D;  3N52 A;  5HGT A;  2WB1 B;  4XQN A;  5CR3 A;  2K6A A;  1JOK A;  1OXS C;  2RHQ B;  2A1A A;  1CA5 A;  3HOW B;  4HJ9 A;  3H3V C;  1EYG A;  1H9S A;  1A3U A;  3KBG A;  5J22 A;  3ZJY C;  1STG A;  2R92 B;  3QOL A;  4RH6 A;  2E2I B;  5C3E B;  2NVQ B;  2IWH A;  3EFX D;  3QB3 A;  3M4Q A;  2UUC L;  2DGY A;  2RKS A;  4MIU A;  4BBR B;  3CCQ A;  1TWF H;  5FJ8 G;  3I8Z A;  3SDZ A;  1LT4 D;  2PQA A;  1CTM A;  3CRL C;  2KHS A;  1NR2 A;  4C3J B;  4KKU A;  5FLX E;  5JAV A;  1G29 1;  3BS1 A;  1T5E A;  4ME3 A;  1Q8K A;  1DGS A;  4BBS H;  4DR2 L;  2F0L A;  2IL8 A;  4JBJ A;  4DGZ A;  1O7Z A;  3TDQ A;  5CV7 A;  1IYU A;  1DON A;  2F3I A;  4JI8 L;  2KEC A;  1B8A A;  3I72 A;  5JPN C;  1PFN A;  3H6M A;  3Q23 A;  4OEL B;  2A6H D;  1D5X C;  1I4P A;  5KNB A;  3A5Z B;  3FMC A;  2VQE Q;  4AYB G;  3PUY A;  4OL7 A;  5J39 A;  4DXG A;  1G6Z A;  2HCC A;  1RD9 D;  1AE2 A;  4ZUI A;  4UP9 A;  3KJP A;  4NXN Q;  3D4R A;  3DXJ C;  4B3R L;  1NMF A;  3W1G A;  3S17 H;  4HMJ A;  1XMO L;  3PGZ A;  5C0X I;  1GXD C;  1EY8 A;  4IAL A;  5CV9 A;  1EY4 A;  5IGG A;  1A62 A;  5M5Y B;  2KEE A;  2OF1 A;  3UDF A;  2M00 A;  3I4L A;  3EVQ A;  1YNN D;  5HGQ A;  3CMA A;  1HFN A;  4A76 A;  2K32 A;  1SJE D;  1LO5 D;  4ZLT F;  2F0S A;  3CKI B;  4IFD J;  1D2B A;  3ITP A;  1LT5 D;  3MFG A;  4RKB A;  1HNW L;  2B3G A;  2G9H D;  3NE5 B;  1QNU A;  5JJL A;  2QEJ C;  3I55 A;  1LLR D;  3KJO A;  4WFN 3;  1QUQ A;  3GV3 A;  4TQU S;  2BA0 A;  3RD4 A;  3R3O A;  5G3L F;  3R8B A;  1HTL D;  2KUM A;  2RHS B;  3F2D A;  2E76 C;  3AQQ A;  1FJG L;  3CPF A;  2F0U A;  4IPD A;  1NMG A;  1KDA A;  1YHA A;  2F52 A;  3S2H H;  4GLA C;  3HS0 C;  4I65 A;  1A6X A;  3PO3 G;  3V96 A;  2PMZ E;  1L0X B;  3SGI A;  1O7L A;  4C3I H;  3JAM E;  1BO0 A;  2A6E C;  5EPK A;  1TWG B;  4JI3 Q;  1F2M A;  1XNQ L;  1B7Y B;  1R4Q B;  1SN8 A;  4V19 0;  1JOO A;  3NXW A;  2E2J B;  3S14 B;  2D62 A;  4DR5 L;  4JI7 L;  1D6E C;  1XMQ Q;  3VYS A;  3GO5 A;  3OOC A;  2EJG C;  2MJ8 A;  2JYO A;  4BBS G;  1KD1 C;  2SNM A;  5C3W A;  1CK1 A;  5IP9 G;  4F88 A;  4DV5 Q;  3MAQ A;  1Q90 A;  1VQF A;  1Z7T A;  4B3T L;  1ROD A;  1WCM H;  1R4P B;  1WJJ A;  1CUK A;  3IRB A;  1STA A;  5CYU A;  4LF8 L;  4G7H C;  1SYG A;  4C2M H;  2IW3 A;  2JN4 A;  2F0J A;  2HQE A;  1CQF A;  2IY5 B;  4DAM A;  3D8G A;  2Q2U A;  4HN7 A;  1R9T B;  2HT1 A;  1SNC A;  3SK5 A;  1HPC A;  2EVB A;  1I4H A;  1PDQ A;  1VQD A;  3E6Z X;  2KED A;  4H13 C;  4X3U A;  4CBV A;  3HOV B;  1C7Y A;  3RLN A;  4DR4 Q;  1DYQ A;  2EYJ A;  4NP5 A;  4O0A A;  4PMW A;  1JJG A;  1IL2 A;  2RBM A;  4Y52 H;  2OQK A;  1A0I A;  2PZU A;  2RQX A;  1LTL A;  2F0K A;  2PW5 A;  4F87 A;  2GVB A;  1HQR D;  4P72 A;  4RHS A;  3TZU A;  1VQI A;  1S40 A;  1Y1V H;  5COY A;  2L4N A;  3HRZ C;  3D4W A;  3UDG A;  1PXU A;  2E8G A;  3EA6 A;  4A93 H;  4HSV A;  5C4X G;  5EPJ A;  2HDM A;  5FO9 B;  1STB A;  1F9S A;  1IYV A;  1K8M A;  1O7I A;  3BVM A;  1Y69 U;  4WJW A;  4CDF C;  3AMU A;  4GNX C;  1TU2 B;  5I9P A;  4N9P A;  2YTV A;  1RHP A;  4C3I G;  1E24 A;  3I4M H;  3PO2 H;  1TWC H;  2B8F A;  4K5W A;  2NVX H;  3FDT A;  4KMU C;  4K2L A;  3J7Z C;  1RIP A;  1B50 A;  4E6I A;  2AKW B;  4X64 Q;  4UDU C;  1TWF B;  1HH2 P;  2XRS D;  5J3B A;  2K03 A;  2XN9 C;  4NDX A;  1PMR A;  2X6G A;  3EIV A;  1B9N A;  4U68 A;  2DJG C;  1PH1 A;  2Q2H A;  3HOZ G;  1GUS A;  5IGC A;  1VQM A;  4NKL A;  1EOV A;  3DEO A;  4DV7 Q;  3FPU B;  1L1O B;  3R2T A;  1V1P B;  1WCM G;  1BR9 A;  2UUC Q;  4YCU A;  4BBS B;  1EIF A;  4LJZ C;  2F0E A;  2WKD A;  4OWT B;  3SK6 A;  3BJU A;  3NBH B;  3RR5 A;  1JWS D;  1PLF A;  4YY3 L;  3I56 A;  4OO1 I;  2MGS A;  1VQ9 A;  1GUW A;  3MTS A;  3QOJ A;  4GN5 A;  3KFU A;  3KF6 B;  1K8A C;  1IW7 C;  4KKS A;  2K7V A;  4RG1 A;  5EQ0 A;  1PHJ A;  1NAP A;  4LF4 Q;  2MFI A;  3K6O A;  4M1U B;  3LWE A;  3OW2 A;  1HFG A;  3NSW A;  3R2I A;  1UAP A;  1XTD A;  2D9U A;  3S17 B;  1B1Z A;  1UE7 A;  3DUZ A;  5C5M A;  1HA5 A;  4A3C H;  4QMG A;  3STB C;  4LF9 L;  3MFY A;  4YCV A;  2L0C A;  4MTK A;  4JI4 L;  4QIW E;  2OWO A;  1Y1V G;  2BOS A;  2B39 A;  3G4S A;  2WB1 E;  4FXG C;  2KOL A;  1OXV A;  3ERQ A;  3K8A A;  3NBI A;  1EWH A;  3H3V H;  1EY9 A;  4IUR A;  4PV1 C;  2TMP A;  4A93 G;  4I7Z C;  1LTG D;  5HUR A;  2I0Q A;  4B3R Q;  4LW1 A;  1W6J A;  4L5Q A;  4ID6 A;  4GNX A;  5IYB H;  1XMO Q;  2KHI A;  4K0K L;  4KD3 A;  1J8I A;  1K0S A;  3HFZ B;  1LTS D;  2KEN A;  3T13 A;  4EQN A;  1STY A;  1HZ9 A;  2Z6K A;  1IHZ A;  4DR3 Q;  3K5M A;  1PZI D;  4YWM A;  4MN3 A;  2DJF C;  2SNS A;  1N36 Q;  3PO2 G;  2OXP A;  4X3K A;  1KRT A;  1N8R C;  3S2H B;  3H91 A;  4UPA A;  4EQP A;  1FNW A;  2VY3 A;  3BVG A;  1HNW Q;  3T4A C;  2MO0 A;  1GM5 A;  3M9B A;  4IFD I;  2RDF A;  4K5X A;  1PTO C;  4DAP A;  1HXY D;  3GTK H;  2LKV A;  4C3I B;  3KF8 B;  3NK9 A;  4YWK A;  1PYS B;  4JV5 L;  1FD7 D;  4PZ8 A;  1CHQ D;  1MD2 D;  4LF7 L;  4JG2 A;  1UUP A;  1NY4 A;  1FJG Q;  1SNQ A;  1K8O A;  4CDD C;  3UDI A;  3DWP A;  2F0V A;  2F0F A;  4TVA B;  1PRT F;  4XXE A;  2AQ1 B;  4B3M Q;  4O2D A;  1STH A;  4OON A;  2M9V A;  5LL6 S;  4X3T A;  2R7F A; 
#chains in the Genus database with same CATH homology
 4OXP A;  1YIJ A;  1N36 L;  1LYL A;  4B3S Q;  3HOV H;  2KHJ A;  2VW9 A;  4DR7 Q;  4OX9 Q;  2AWN A;  3K80 C;  1XNQ Q;  1W2B A;  2HHH L;  3CCU A;  4HJ5 A;  4P71 A;  1KXL A;  4DV1 L;  1PH5 A;  2E5L Q;  1B70 B;  2JJQ A;  5JEA J;  3PIP A;  2JA7 G;  2WP8 J;  2N8N A;  4X6A H;  1J5E L;  4JI7 Q;  3STB D;  2NVT H;  4AQY L;  2UXB Q;  2AHO B;  3I4N H;  1OTC A;  1VQK A;  3MEF A;  5JJI A;  1Q12 A;  1V1Q A;  4YHH L;  3J80 c;  2JE6 I;  3EBE A;  3OYY A;  1X54 A;  3RN2 A;  3PF5 A;  1N32 L;  1M90 C;  1TWA H;  1I94 Q;  1YJN A;  1NJI C;  5H1S E;  1X3F A;  1IBK L;  1QVC A;  3T1Y L;  1HR0 Q;  4KHZ A;  4A3C G;  4R1J A;  3CQZ H;  1GVP A;  3VDY A;  1EQQ A;  4BY7 G;  1SR3 A;  5GAG C;  1PV4 A;  2N3S A;  1PA6 A;  1K0R A;  1N33 L;  4RMF A;  2YU9 H;  2KCM A;  3U4V A;  4B3M L;  4NB3 A;  4LF8 Q;  3ER0 A;  1OXS C;  2JA9 A;  2V1C C;  2KBN A;  4DR7 L;  2RHQ B;  4OX9 L;  2A1A A;  2K5N A;  2AWO A;  2LXK A;  2N49 A;  5LMN Q;  5GAH C;  3J81 j;  4HJ9 A;  1EYG A;  2E5L L;  4DR2 Q;  1U5K A;  1IBM L;  4QGU A;  4DAY B;  3KDF A;  3ZJY C;  2JA8 H;  2R7Z H;  3LGJ A;  2B63 G;  5IYB G;  1IZ6 A;  1BVS A;  2UXB L;  2N78 A;  3PF4 A;  1I50 H;  3T1H L;  1EUJ A;  1OXX K;  4KHP L;  4JI8 Q;  3RLF A;  3J81 c;  4BY7 H;  4GKJ Q;  3M4Q A;  4JOI A;  2DGY A;  2UUC L;  1A63 A;  3CCQ A;  4IFD G;  1VQ7 A;  1TWF H;  5FJ8 G;  3K7U C;  1MJE A;  2YV5 A;  3HOY G;  2PQA A;  4NXM L;  3CCV A;  4YWL A;  5C4J H;  2I5L X;  2NN6 G;  3HKS A;  2UXC Q;  2ZTE A;  1WOC A;  1RL2 A;  1SMX A;  2K75 A;  4JCV E;  1S72 A;  2CFM A;  5IYC H;  4A3F H;  3TS0 A;  4JI6 Q;  1G29 1;  4ME3 A;  4P74 A;  1Q8K A;  5M5X H;  1DGS A;  4DR6 L;  1VQH A;  3BZC A;  2IHF A;  4BBS H;  4DR2 L;  2MO1 A;  3CXC A;  3RZD H;  2EIF A;  4JI0 L;  4JBJ A;  4R4I A;  3HOY H;  5IYD G;  1X6O A;  2F3I A;  4EQ5 A;  5IWA L;  4JI8 L;  4HIK A;  1B8A A;  4GKJ L;  3DM3 A;  3I2Z A;  5M3F H;  4DK6 C;  1EFW A;  3A5Z B;  1C0A A;  4A3L G;  2VQE Q;  2D0P A;  4AYB G;  3PUY A;  1J6Q A;  1WYD A;  2UUA L;  4OWX B;  1QVG A;  1K3R A;  1SLJ A;  3Q8D A;  4DR1 L;  4X65 Q;  1AE2 A;  3CCM A;  2UXC L;  4JI5 Q;  4IPH A;  2F4V Q;  4UP9 A;  1N9W A;  3KJP A;  1L2F A;  4NXN Q;  1MKH A;  3TEH B;  3W5O A;  4B3R L;  4X66 L;  1NMF A;  1QZG A;  3W1G A;  1Q81 C;  1IBL Q;  3S17 H;  3TRZ A;  1CSP A;  3NEL A;  3CCR A;  5GQO A;  1XMO L;  1N34 L;  3AFQ A;  1K83 H;  3HOU G;  3PGZ A;  5C0X I;  4DUZ L;  4DV3 Q;  4IO9 A;  1PVO A;  4X62 Q;  1NE3 A;  2XGT A;  2K4K A;  1PH2 A;  2WFW A;  4R4T A;  1A62 A;  3AEV A;  3I4N G;  4A3L H;  4HIM A;  3J80 i;  3UDF A;  2OTJ A;  2QA4 A;  5HY6 A;  4JYA Q;  1EQR A;  5IT9 c;  3JAM i;  5HGQ A;  3CMA A;  4A76 A;  1EIY B;  2IHE A;  1HZA A;  4LF5 L;  4IFD J;  4GN3 B;  5C44 G;  3CCE A;  5LMU L;  3HKZ E;  2RCN A;  1MIU A;  3RZO H;  1HNW L;  2R93 H;  2B3G A;  3TQY A;  4DUY L;  4JI1 L;  1EWI A;  3S24 A;  5JJL A;  2Y0S G;  4X65 L;  3HOU H;  3I55 A;  1UE5 A;  3KJO A;  1YVC A;  4JI5 L;  4DR5 Q;  4YY3 Q;  2F4V L;  4DV0 Q;  1QUQ A;  1E1O A;  3RN5 A;  3S16 H;  3S1M H;  4TQU S;  2BA0 A;  3D0F A;  1PH6 A;  3CF5 A;  1ASY A;  2R7D A;  1CSQ A;  3FHW A;  3F2D A;  2KCT A;  2RHS B;  3AQQ A;  1XPR A;  1VQ8 A;  4L5R C;  2ZJR A;  1FJG L;  2JA8 G;  3CPF A;  2JEA I;  1YJ9 A;  2R7Z G;  4LWC A;  4QQB X;  1VQB A;  3CCJ A;  4IPD A;  2Y0S E;  1NMG A;  1KAW A;  2A19 A;  5ELN A;  1UEB A;  1YHA A;  2F52 A;  1WI5 A;  4GLA C;  4J15 A;  4LUV A;  1M1K C;  3S15 H;  4B3T Q;  3S2H H;  5C44 H;  1I6H H;  4R4Q A;  3KF6 A;  1Q82 C;  3PV0 A;  1X55 A;  2NZH A;  4LFC Q;  1YZ6 A;  2PI2 A;  3PO3 G;  2PMZ E;  3SGI A;  4GKK Q;  3PUW A;  4C3I H;  3WWV A;  4B3S L;  2ID0 A;  1QUQ B;  3I4O A;  3U50 C;  3OTO Q;  2VQF Q;  4FDB A;  4JI3 Q;  4LF9 Q;  2Z0S A;  2ES2 A;  3A74 A;  1XNQ L;  3HOX G;  3GTO H;  4IOA A;  1B7Y B;  4IPG A;  4A3B G;  2D0O A;  5GRO A;  4JBK A;  1SN8 A;  1MJC A;  1Q1E A;  1WFQ A;  1HNZ Q;  1SRO A;  1NTG A;  3E0E A;  5EAY A;  4H02 A;  2D62 A;  5IYC G;  4UP7 A;  3PIO A;  1U0L A;  4DR5 L;  4A3F G;  4JI7 L;  3K7A H;  5ELO A;  2CQO A;  1UE6 A;  4ALP A;  1XMQ Q;  3GO5 A;  3DLL A;  1PH7 A;  3E9I A;  3GTG H;  1L1O C;  1KRS A;  3B6Y A;  1JE5 A;  5AJ3 Q;  2VUM H;  4GOP C;  4BBS G;  1KD1 C;  3JC6 6;  2HIX A;  1I94 L;  3PO3 H;  4A3E H;  2GVA A;  1PFS A;  1TXY A;  3PUX A;  5IP9 G;  3KYH C;  1HR0 L;  2YYZ A;  4DV5 Q;  1KIX A;  2I5M X;  1VQF A;  1VQG A;  4HJA A;  4B3T L;  1WCM H;  3HOX H;  1HR0 W;  3U58 A;  5M3F G;  4A3B H;  1FGU A;  1WJJ A;  4A3M H;  5C0X G;  2BH8 A;  1D8L A;  1VQE A;  2QEX A;  3PUZ A;  2ZM6 Q;  1CUK A;  3IRB A;  3CC4 A;  4JI2 Q;  4UY8 C;  2E2H H;  3KDF B;  4LF8 L;  2A8V A;  1S3O A;  1YHB A;  5IP7 H;  1QZH A;  4A3J H;  4C2M H;  4A3K G;  4JI3 L;  1SRU A;  3OTO L;  4DV4 Q;  4WJ3 M;  3PSI A;  3L7Z C;  1CKN A;  4YCW A;  5FLX c;  4L5T A;  5LMN L;  1YI2 A;  3F2C A;  2ZTD A;  3ULL A;  4BXX H;  2WAQ G;  4LFB Q;  2IY5 B;  4DAM A;  4A75 A;  2Q2U A;  4HIO A;  5LMN W;  2HT1 A;  1K73 C;  1X56 A;  1XMQ L;  5IP9 H;  3RLO A;  1OXT A;  2PI2 E;  1VQD A;  2PQA B;  3D31 A;  5M5W H;  3U4Z A;  2MNA A;  3EN2 A;  3S1R H;  2CCZ A;  4BBR G;  4GLX A;  4GLV B;  1C7Y A;  3RLN A;  4DR4 Q;  4JV5 Q;  2LXJ A;  4QY7 A;  1YHQ A;  1IXR A;  4LF7 Q;  4O0A A;  2K52 A;  4PMW A;  3GTM H;  1UWV A;  1IL2 A;  3L0O A;  2WAQ E;  3AYH B;  1VQ4 A;  2VNU D;  3ICE A;  4Y52 H;  3G71 A;  2OQK A;  1A0I A;  3GDE A;  1LTL A;  2CWA A;  5FLM G;  3GTJ H;  4A3K H;  1VQP A;  2GVB A;  4LUO A;  2UU9 Q;  3HOW H;  4P72 A;  2OQ0 A;  3ULJ A;  3M85 A;  1VQI A;  1S40 A;  4Y7N H;  1Y1V H;  2LSS A;  1G51 A;  1W3S A;  4R4O A;  1L0W A;  1T9H A;  2ZM6 L;  4HID A;  3RNU A;  1Z47 A;  4QJF A;  4A3G H;  2R92 H;  1VQC A;  2E2I H;  2HQL A;  1VQO A;  2R93 G;  5C3E H;  5GAE C;  1PH4 A;  4JI6 L;  2NVQ H;  3UDG A;  4AYB E;  4DNI A;  2VS1 A;  3I4M G;  1Y1W G;  2E8G A;  4GS3 A;  1LM0 A;  1GD7 A;  2C35 B;  2YTY A;  4L5S A;  4JBW A;  4NPS A;  3PUV A;  4APV A;  4BBR H;  4OWW B;  4BA2 I;  1KHI A;  4A93 H;  4GN4 B;  2HHH Q;  5C4X G;  1PYB A;  1XNR Q;  4DV1 Q;  2FXQ A;  1YIT A;  1HNZ L;  3UE0 A;  5FLM H;  2JA5 G;  4BY1 H;  2IT1 A;  1O7I A;  2AMC B;  1JJG A;  3UDX A;  4C3J H;  4LF6 Q;  2PNH A;  3CCS A;  4YHH Q;  1E22 A;  2VQE L;  3S1N H;  3UE1 A;  1P8L A;  4GNX C;  3E9H A;  1IYJ B;  1Y14 B;  3TRE A;  2IX1 A;  4IPC A;  2OCE A;  5DLQ E;  1K9M C;  2YTV A;  3I4M H;  1Y1W H;  1E24 A;  3T1Y Q;  2I5H A;  3PO2 H;  3PCO B;  1TWC H;  1C9O A;  2K5H A;  4XIG S;  4NXN L;  2NVX H;  2JA6 H;  1L1O A;  4QL5 A;  4HJ7 A;  5C0X J;  1FL0 A;  4GOP A;  3J7Z C;  5C4X H;  1RIP A;  2GN5 A;  4PZ6 A;  1IBL L;  1VQ5 A;  2AKW B;  4X64 Q;  2UXD Q;  1HH2 P;  4DV3 L;  3CD6 A;  5J3B A;  2JA5 H;  4X62 L;  3S2D H;  2NVY H;  3EIV A;  2ASB A;  3CME A;  1YEZ A;  4DPG A;  4A3I H;  1HZC A;  3F2B A;  1PH1 A;  1X9N A;  1YBY A;  1XNR L;  2VUM G;  2Q2H A;  3HOZ G;  5E7N A;  1V43 A;  3FP9 A;  3J81 i;  1IBM Q;  2BA1 A;  5K36 G;  2QGQ A;  1VQL A;  4PG3 A;  3J7A 5;  4JYA L;  2B29 A;  2XTI A;  1VQM A;  4POF A;  2L15 A;  4UP8 A;  4A3E G;  1QVF A;  2ATW A;  4R4C A;  1EOV A;  3CC2 A;  1FVI A;  4DV6 Q;  3T1H Q;  1LUZ A;  4LUZ A;  4DV7 Q;  1Q1B A;  2OTL A;  4LF6 L;  2IX0 A;  1L1O B;  4A3D H;  2K5V A;  4KHP Q;  1WCM G;  2ZJP A;  2UUC Q;  1E1T A;  2EXD A;  3CW2 C;  4YCU A;  4GOP B;  1EIF A;  4JI4 Q;  4A3M G;  3CCL A;  1ASZ A;  1P16 A;  3NEM A;  4OWT B;  1X3G A;  3JAM c;  1GKH A;  4IOC A;  4MZ9 A;  1XPO A;  4A4I A;  3BJU A;  1VCI A;  5IP7 G;  2Q2T A;  3NBH B;  4DK3 C;  3RR5 A;  4YY3 L;  3I56 A;  4DV0 L;  4A3J G;  4NXM Q;  4OO1 I;  1VQ9 A;  1E7Z A;  5M5Y H;  3K81 C;  3KLW A;  3G48 A;  1H95 A;  2ZJQ A;  3HOZ H;  1VS0 A;  4GN5 A;  1CKO A;  3KFU A;  4BXX G;  3KF6 B;  4X64 L;  1K8A C;  1HNX Q;  2JA7 H;  2UXD L;  1UE1 A;  2H5X A;  1VQN A;  5IE8 A;  3K0X A;  2CWP A;  4RG1 A;  1PHJ A;  4DKA C;  1I3Q H;  3G6E A;  2RF4 A;  3GTL H;  4LF4 Q;  4K0K Q;  3M3Y H;  2JEB I;  4P73 A;  4DR6 Q;  2WB1 G;  1PH8 A;  5JJK A;  3S1Q H;  2MFI A;  2MQH A;  5BR8 Q;  3GD7 A;  4P75 A;  3OW2 A;  4JI0 Q;  1HJP A;  1XTD A;  4LFC L;  1AH9 A;  4IJL A;  1UE7 A;  4GKK L;  4KI0 A;  1BBU A;  3ERS X;  4A3C H;  4PZ7 A;  4DV6 L;  4MNO A;  4DV7 L;  3STB C;  5IWA Q;  3CAM A;  2Q2I A;  2VQF L;  4LF9 L;  1V9P A;  4YCV A;  1YJW A;  3GTQ H;  3HOW G;  3TS2 A;  1VQJ A;  2YTX A;  4JI4 L;  4WJ4 A;  4QIW E;  2OWO A;  3BU2 A;  1Y1V G;  1VQA A;  3BZK A;  3G4S A;  1A8V A;  2WB1 E;  1OXV A;  3CC7 A;  4A3G G;  2R92 G;  2UUA Q;  3I7F A;  3NEN A;  5JEA G;  1Q7Y C;  3M4O H;  5C3E G;  4DR1 Q;  3K8A A;  1KQS A;  1JMC A;  1JJC B;  1GO3 E;  2UUB Q;  1D7Q A;  1NBW A;  5AJ3 L;  3H3V H;  2ALY B;  1JB7 A;  4DV2 Q;  4A93 G;  1AE3 A;  2DUD A;  4X66 Q;  1KL9 A;  1HNX L;  2I0Q A;  4LW1 A;  4B3R Q;  1SE8 A;  4L5Q A;  2B63 H;  4GNX A;  5IYB H;  4AIM A;  1XMO Q;  2KHI A;  1N34 Q;  1PH9 A;  2CKZ B;  1HZB A;  1TWG H;  4DUZ Q;  2EQS A;  2JQO A;  4LF4 L;  4DV5 L;  4K0K L;  4BY1 G;  4AH6 A;  1YNX A;  4EX5 A;  3HFZ B;  3GTP H;  5BR8 L;  3MXN B;  1CKN B;  1JJ2 A;  2KEN A;  3FKI G;  3M4P A;  3W1B A;  1SFO H;  5FJ8 H;  3ULP A;  2E2J H;  1TWH H;  4JBM A;  1HZ9 A;  2VZA A;  2Z6K A;  4LFA Q;  1Q46 A;  3CPW A;  1PH3 A;  4JI2 L;  3H3V I;  3S14 H;  1X3E A;  1Z9F A;  3A0J A;  4DR3 Q;  4BA1 I;  4DV4 L;  1I5F A;  4YWM A;  4HJ8 A;  2BH2 A;  1XJV A;  3CP0 A;  3F1Z A;  1N36 Q;  3PO2 G;  4LF5 Q;  4JOI C;  1BBW A;  5IY0 A;  1X65 A;  1Q86 C;  1KRT A;  1N8R C;  1K8G A;  3KOJ A;  3H0G G;  2JA6 G;  1VQ6 A;  2JK8 A;  5LMU Q;  4UPA A;  1XPU A;  4LFB L;  2VY3 A;  3AFP A;  1HNW Q;  2MO0 A;  1GM5 A;  4GNX B;  4DUY Q;  4JI1 Q;  3M9B A;  5M3M G;  1G6P A;  1E3P A;  3L2P A;  4IFD I;  3A5U A;  1OXU A;  2UUB L;  1J5E Q;  3GTK H;  3HOV G;  3H15 A;  3KF8 B;  1KC8 C;  4AQY Q;  4DV2 L;  4YWK A;  2NZO A;  4A3I G;  3M7N A;  3FKI H;  1PYS B;  4DR4 L;  4JV5 L;  2NN6 I;  4PZ8 A;  5GAD C;  4LNQ A;  4LF7 L;  4JC0 A;  4MTN A;  4JG2 A;  4OO1 G;  2ZTC A;  1N32 Q;  1NY4 A;  1FJG Q;  5IYD H;  2K14 A;  3UDI A;  4C3H H;  2UU9 L;  3HKZ G;  2K50 A;  1IBK Q;  4IJH A;  1BKB A;  2VL6 A;  4A3D G;  4TVA B;  4XTC S;  1CKM A;  3F8T A;  3H0G H;  1R9T H;  4LFA L;  2R6G A;  2HIV A;  2Z6K C;  4DR3 L;  1N33 Q;  4B3M Q;  4O2D A;  4OON A;  5M3M H;  1JT8 A;  4KLK A;  4POG A;  2R7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...