3S14H

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s14H00
2IHEA 5DLQE 5BR8L 4DV3Q 2C35B 3G71A 4P74A 1V9PA 2QGQA 4R4QA 2QEXA 3G6EA 4LFAL 3U58A 3T1YL 1PFSA 3CMEA 3I4OA 1CKMA 3HOXG 2B63H 4DV6L 2EIFA 3S2HH 3HOWH 2WAQE 5C0XI 4IPGA 3LGJA 5C3EH 1MIUA 4L5TA 1PHJA 4BBSH 4X64L 2D0PA 1YJWA 2IT1A 4GN3B 1HZ9A 4JBMA 2GVAA 3PO2H 4DR2L 1N36L 5K36G 1VQNA 1PV4A 2Y0SE 1VQHA 2A8VA 3KDFA 3CW2C 4HIDA 1WCMG 4LF4L 4DV1Q 3ULLA 5C3EG 4LNQA 4X65Q 1WJJA 3GTGH 4P72A 4QL5A 4DUYL 4IPDA 4UP7A 5M5WH 1LUZA 4DV5Q 1W3SA 4JI0L 4R4OA 5GAEC 5J3BA 4YHHL 5FLXc 1QUQB 4A3CG 4JI3L 2WFWA 3RN2A 1W2BA 1HH2P 4BY7H 3E0EA 4TVAB 1XNQQ 4JC0A 3WWVA 4DR6L 4BA2I 4DR4L 3I4NH 2OCEA 4EQ5A 4A3JH 1IBKL 1NY4A 4JV5L 1QVGA 4KHPL 4QJFA 1K0RA 1OXVA 2LSSA 4HJ9A 2CQOA 1PH5A 2UUBQ 3RNUA 3KOJA 4AH6A 1IBML 2VUMG 4IFDG 1GM5A 5C4XG 2R92H 2YYZA 1YHAA 2CWAA 1MJEA 3S14H 4A3DH 5FLMH 1YJ9A 4DR1Q 3STBD 4HJ8A 5C44H 3OYYA 1N33Q 1VQPA 3GTKH 3HFZB 5IYBG 1VQBA 2R6GA 2Z0SA 3OTOL 1N34L 4X6AH 1PVOA 2UXDQ 2YTVA 3S1NH 1CSPA 2I5MX 4DNIA 1S72A 3K0XA 1HJPA 2AWNA 3L7ZC 2R92G 3CC7A 1U0LA 3KF6B 5FJ8H 3GTJH 2UUCL 5ELOA 3J80c 5C0XJ 1YHBA 1ASZA 4LWCA 4B3RQ 5H1SE 2XTIA 4OXPA 2UUAL 2F52A 5JJKA 2OTJA 3JAMc 3M9BA 4NXMQ 2Z6KA 4A3BG 1KXLA 4QIWE 4P73A 3G4SA 1KL9A 2MFIA 1WOCA 1EWIA 4POGA 3S2DH 4DK3C 1QZHA 3W1GA 5M3MH 3GO5A 2PI2A 2ID0A 4PZ7A 4YCWA 4A3KH 3H3VI 2K4KA 2NZOA 4BBRG 4ME3A 4OX9L 2LXJA 2ZM6Q 4DV1L 4OO1G 1XTDA 1S3OA 1HNXQ 2PQAA 1D8LA 4DV5L 2K5VA 3M7NA 2VQFL 2KCTA 1K9MC 2Z6KC 5GAHC 2YTXA 4YWMA 1LTLA 3CP0A 1JB7A 4YCUA 1A0IA 4LF8Q 1CKOA 1YIJA 2JEBI 4H02A 3H0GG 4APVA 3VDYA 4JI6L 4GOPA 3BZKA 3A5UA 3NELA 2BA1A 4NXNQ 1KAWA 3GD7A 5LMNL 2NN6I 1XJVA 1KQSA 1WI5A 1Q12A 2RCNA 3GTLH 2K5HA 3UE0A 2K75A 2LXKA 3M4PA 2V1CC 3ULJA 1KD1C 1EQQA 1YITA 3PUVA 3PUYA 2R7ZH 2WAQG 4K0KL 4YWKA 3RLFA 2UXDL 2FXQA 4AQYL 2B3GA 1IXRA 3E9IA 1HR0W 1NE3A 4DV4Q 2RHSB 4GOPC 3UE1A 4GN5A 4DR5Q 1SROA 1L1OB 1Y14B 2HT1A 1M90C 2VNUD 1N32Q 1BKBA 5IP9H 4HJ7A 3AEVA 2VL6A 4X62L 3DLLA 3HOVG 3RLNA 2QA4A 4DPGA 4HIKA 1NJIC 2JA7G 1Q1BA 2Y0SG 2CCZA 2UXCQ 4QQBX 4B3RL 1EUJA 2F3IA 4A3MG 1IBLL 2R7ZG 3GTOH 2VQEL 1PH7A 1Z9FA 1TWGH 1K83H 5IYCG 1ASYA 1YBYA 4A3LG 3F1ZA 5C4JH 4KI0A 3I55A 3I4MH 1HNWL 1CKNB 2ALYB 1XMOQ 3AYHB 1LYLA 2I0QA 3AFPA 2B29A 3F8TA 2KHIA 4FDBA 4DV7Q 2ATWA 2A19A 2JA5G 2NVTH 2BH8A 2XGTA 1YZ6A 2VS1A 3D0FA 4IJHA 5C0XG 4DUZL 1IL2A 2JA6H 3FP9A 4A3FG 4A3GG 2VW9A 3PCOB 3PO3G 2AHOB 1CUKA 1A8VA 1Y1VH 4QGUA 3F2CA 4BXXG 4JI2L 1TWHH 3NEMA 5HY6A 4DK6C 4LF8L 1XMQL 1Z47A 3BU2A 4Y7NH 1YHQA 1PH1A 4NXNL 4IOAA 4BY1H 3BJUA 1EIFA 2K50A 4LF5L 5JJIA 2PMZE 2K5NA 2B63G 5GROA 1VQIA 3RZOH 3HOWG 4B3TL 1OXTA 1X3FA 4AYBE 3CCVA 2E2HH 4GKKQ 2MNAA 1QVCA 2KBNA 2Q2HA 3KDFB 2HIVA 4NB3A 4A3EH 5IE8A 3PGZA 5IWAL 4POFA 2YU9H 4BBSG 1X9NA 4JI4Q 1AE2A 1VQDA 3PUZA 3CCMA 2GN5A 1C0AA 3PO2G 4DR5L 2VZAA 1EIYB 5GAGC 3CD6A 1YEZA 4LF7L 4JYAQ 3Q8DA 1Q7YC 2JJQA 1Q82C 3AQQA 3FHWA 1C9OA 3W5OA 1HNZL 4GKJL 4J15A 3HKSA 4IOCA 1Q46A 3T1HQ 4JI7L 4RMFA 3RR5A 4LF9Q 3TS2A 3RN5A 2UXBQ 1JJGA 3I7FA 3I56A 3EBEA 4L5QA 2RF4A 4X66L 3M85A 2E5LQ 3HOVH 1UEBA 1A63A 4BY7G 3AFQA 2D0OA 2OWOA 4P75A 1XMOL 1E22A 2ZJPA 2DGYA 3M3YH 4DR3L 3I4NG 3TRZA 2R7DA 2DUDA 4A3JG 3H3VH 3FKIH 4HIOA 4DKAC 5IP7H 5LMUQ 4DV3L 1XPUA 1OTCA 1J5EQ 4IJLA 2IHFA 2ZJQA 1HZAA 3GTMH 4A3DG 5FLMG 4RG1A 5C44G 3J81j 5HGQA 5AJ3Q 1FGUA 1NBWA 4DV0Q 4A75A 2N78A 3RLOA 3RZDH 1VQOA 1VQGA 3CCEA 2YTYA 1E1TA 4MTNA 2JA9A 1G51A 1VQJA 1V1QA 2AWOA 4DAYB 1I94Q 4IFDI 1X3EA 3HOUH 2N3SA 5FJ8G 3S1RH 1VQEA 4GN4B 4LUOA 1KRSA 1LM0A 3PIPA 1K8GA 3M4OH 1HR0Q 3KF6A 4PZ8A 4DR7Q 4X65L 1SMXA 4LFCQ 3UDXA 3ICEA 1P8LA 4JI4L 1XPRA 5M3MG 5IYDH 1MJCA 4A3IH 4A3KG 4JYAL 1XNQL 1C7YA 1SN8A 5M3FH 2N8NA 4GLAC 2YV5A 4B3MQ 3E9HA 2HHHQ 1X3GA 5E7NA 1B8AA 1B70B 4GOPB 5JJLA 1Q1EA 4OWXB 1BVSA 4JI8Q 5IT9c 2UUBL 3J81c 4JI1Q 4DR1L 3S24A 2Q2UA 3J80i 1BBWA 3KJPA 1N33L 3HOYH 1X55A 3UDFA 1OXXK 2JA8H 4IPHA 3JAMi 3T1YQ 4OO1I 2CKZB 2R93H 4L5SA 3U4VA 1L2FA 1FJGQ 3K80C 1J5EL 1UE1A 1PH3A 4OWTB 1GO3E 3CCRA 1EYGA 1L0WA 4YY3Q 1X65A 1PH2A 3CCJA 4GNXA 4A76A 3HOYG 3KFUA 2CFMA 2NVQH 1VQCA 1GKHA 2MO0A 4AYBG 1N36Q 1GVPA 3A5ZB 3CC4A 5IY0A 1VQMA 1YJNA 4NXML 1TWAH 2UU9Q 3HOZH 1D7QA 2I5HA 2WP8J 4LF4Q 1VQ9A 1EFWA 2OTLA 2MQHA 5IP9G 4JBWA 1VCIA 3CPWA 2ZTDA 3HKZE 4DUYQ 2F4VQ 1SFOH 4JI0Q 1DGSA 1L1OA 1HR0L 1U5KA 4L5RC 3CCUA 1RIPA 4YHHQ 3L0OA 3M4QA 2ZM6L 4GNXC 1Y1WH 1VQLA 4DR7L 2EXDA 4JCVE 4JI3Q 2IY5B 1HNXL 4LUZA 4UP8A 2K52A 5GADC 4DR6Q 1BBUA 4JG2A 4DR4Q 3JC66 3CMAA 1X6OA 3F2DA 3I4MG 5M5YH 1KIXA 2KHJA 3K7AH 3TEHB 4LW1A 1Q86C 1IBKQ 4JV5Q 4KHPQ 4HJAA 1TXYA 4B3SQ 1XNRQ 2HHHL 4PMWA 3HOXH 1E3PA 3KJOA 1YNXA 2JA6G 2OQ0A 1V43A 3NBHB 3J7A5 4JI8L 3D31A 3OTOQ 1N34Q 2NVXH 1Y1VG 4JI1L 3SGIA 2HIXA 1VS0A 3PUWA 4C3JH 4BY1G 3TREA 4JBJA 1E1OA 1UE6A 4DV4L 2UUCQ 4HJ5A 4O0AA 1WCMH 2MO1A 1K73C 1FJGL 2PNHA 3ERSX 2E2IH 4UP9A 3F2BA 2UUAQ 1N32L 1KC8C 1TWCH 5JEAJ 1IYJB 3CQZH 3NENA 4YY3L 3L2PA 1YI2A 2JQOA 2UXCL 2ZTEA 4A3EG 4A3CH 2WB1E 4PZ6A 2E2JH 4DV2Q 3MXNB 1B7YB 1VQAA 3EIVA 2PI2E 3STBC 2UU9L 1JMCA 3PSIA 4OX9Q 4IO9A 1OXUA 4JBKA 4LUVA 4JOIA 1O7IA 2D62A 1SRUA 3PIOA 2F4VL 1JE5A 1QUQA 1GD7A 5C4XH 2VQFQ 2IX1A 4DV7L 2VUMH 3PF4A 1JT8A 3CXCA 2I5LX 1CSQA 4GLXA 1A62A 4QY7A 1J6QA 2EQSA 2KCMA 4TQUS 3EN2A 3S16H 2N49A 1PYBA 3GTPH 2OQKA 3A74A 3W1BA 5IYBH 3H15A 1PA6A 4JI6Q 1SR3A 1NTGA 1UWVA 1VQKA 4C3IH 2ZTCA 1I50H 1HZBA 4MZ9A 1K8AC 1VQ5A 5LMNQ 3S15H 2JEAI 3KYHC 4JOIC 5EAYA 4R1JA 3CPFA 4B3SL 1XNRL 3S1MH 4LFBQ 3FKIG 1Q81C 5IP7G 3K81C 1OXSC 3PV0A 1YVCA 1VQ7A 3S17H 4K0KQ 2JK8A 3MEFA 4AQYQ 1T9HA 4A3BH 1UE7A 1HZCA 4PG3A 4GKKL 2NZHA 4GS3A 3J7ZC 1VQ4A 1WYDA 1AE3A 3OW2A 2CWPA 4X62Q 1H95A 3CCSA 1S40A 1K3RA 2PQAB 4BBRH 3KLWA 1JJCB 3U4ZA 1IBLQ 4A93H 3HOUG 5GQOA 4KHZA 2VQEQ 2NN6G 3PF5A 2KENA 4R4CA 2VY3A 4MNOA 1RL2A 4JI5Q 3HKZG 1X54A 4LF6Q 4HIMA 4YWLA 5LMNW 1N8RC 1PH6A 4KLKA 1HNWQ 4Y52H 4WJ4A 1FVIA 3T1HL 1PH4A 1N9WA 4XIGS 4LF9L 3CAMA 2E8GA 4DV2L 2UXBL 1G6PA 1E24A 3UDGA 3H0GH 3TS0A 4XTCS 2E5LL 5IYDG 4A93G 1SLJA 2ASBA 1NMGA 2HQLA 2RHQB 3CCQA 4A3IG 5BR8Q 4P71A 5M5XH 4C3HH 4DUZQ 1JJ2A 5M3FG 4WJ3M 1G291 4LFAQ 1VQFA 1I6HH 2JE6I 5JEAG 4BA1I 3PUXA 4DV6Q 3K7UC 2AMCB 4JI2Q 2Q2IA 5LMUL 1FL0A 1KHIA 1XMQQ 3UDIA 4GLVB 1TWFH 2A1AA 2NVYH 2BA0A 3B6YA 1M1KC 4IPCA 2GVBA 3K8AA 4X64Q 4LF5Q 1VQ6A 1X56A 4YCVA 5AJ3L 3BZCA 4DV0L 1R9TH 1EOVA 2JA8G 4DR2Q 1NMFA 4C2MH 4GNXB 4O2DA 2ZJRA 4LFBL 3S1QH 1SE8A 2AKWB 4B3TQ 2R93G 2JA7H 1P16A 3DM3A 1AH9A 1PH9A 3ER0A 4IFDJ 4A3MH 1I94L 3ZJYC 1VQ8A 3A0JA 5IWAQ 2K14A 1IZ6A 2Q2TA 3I2ZA 5IYCH 4DAMA 4A3LH 4ALPA 4UY8C 4R4TA 2L15A 4AIMA 2H5XA 3ULPA 1QVFA 4LFCL 1KRTA 3TQYA 1I5FA 4LF7Q 1EQRA 4UPAA 4OWWB 3HOZG 4R4IA 1Q8KA 2WB1G 4OONA 3J81i 1XPOA 4EX5A 1HNZQ 4GKJQ 2JA5H 3G48A 4NPSA 2IX0A 1QZGA 1MKHA 4JI7Q 3CC2A 2BH2A 1PH8A 3GTQH 4A4IA 1IBMQ 4JI5L 1CKNA 1WFQA 4X66Q 4A3FH 4B3ML 3IRBA 4A3GH 1L1OC 3GDEA 5ELNA 2R7FA 1Y1WG 3CCLA 4LF6L 3PO3H 1E7ZA 1UE5A 1PYSB 4BXXH 1I3QH 3CF5A 4DR3Q 3U50C 2ES2A 3KF8B
chains in the Genus database with same CATH superfamily
1TIID 4IUTA 1BF4A 5DNFA 2QGQA 3D6WA 4BS9A 4G57A 1EFID 4DV6L 4HN7A 3H09A 3HOWH 1CK1A 3IFTA 4X3SA 2CHBD 2ZT9C 1X3QA 4BBRB 1UUPA 3FRPB 2HCIA 2XIWA 1HQRD 3SK5A 2GVAA 1SMYD 1EYCA 3KK7A 3PO2H 1TY2A 4K5WA 1VQNA 1XYIA 1F2ZA 1GHJA 1VQHA 3CW2C 1WCMG 1WD0A 4A3KB 4LF4L 3N52A 1D2BA 3H0GB 3BVZA 5J22A 4IPDA 5EBCA 5M5WH 2EYPA 4C3HB 5E1FA 2HD3A 1QUQB 4JPBW 1HH2P 2PZWA 1AEXA 4EQ5A 4A3JH 2K7VA 4ME5A 2MJ8A 2NVYB 1QVGA 4KHPL 1OXVA 2A5HA 2UUBQ 1IBML 2YYZA 1YJ9A 4HJ8A 1EEID 5L37A 1N33Q 3HFZB 4X6AH 3OTOL 3IAYA 4CDFC 5CV7A 3S1NH 1CSPA 3R93A 2F0TA 4IZ8A 1HJPA 1II3A 1PMRA 2R92G 5FJ8H 2B39A 2L11A 4FNFA 4K14A 3H6MA 4HTHA 4LWCA 5H1SE 2XTIA 1VF5C 2RCFA 2F52A 4DAYA 2JA5B 4QIWE 2XRQD 4POGA 1WOCA 1RHPA 5JVH3 4DK3C 1SJHD 1EY8A 1IW7D 1IKMA 5IT9E 2N88A 2K5QA 3EVQA 2EY1A 1ZXTA 1RDPD 2NZOA 4BBRG 1O7LA 2LXJA 2HUGA 3SEBA 3VR6A 2WV6D 2PQAA 1D8LA 2KCTA 4EQOA 1RD9D 3CP0A 4YCUA 1S5CD 4LJZC 4KN7C 1F9RA 3H0GG 1YNJC 3VDYA 4JI6L 3HOWB 4FYDA 3K57A 1EU3A 3GD7A 4C3HG 2RCNA 1IYUA 2V4DA 2LXKA 3PO2B 3U9SA 3ULJA 2OT2A 1KD1C 4HR7B 4KV6A 5JOBA 2FXQA 1IXRA 1LTID 2O5IC 4DA2A 2RHSB 1F2YA 3GV3A 4GN5A 5M5WB 1PFBA 2HT1A 1N32Q 5IP9H 3DLLA 2PNRC 4HIKA 1K8OA 1Q1BA 2UXCQ 3NK9A 5IGEA 1IBLL 3Q6SA 1Z9FA 4N8X1 4NW2A 2A68C 5IYCG 4A3JB 1TR5A 1YBYA 1YNNC 3I55A 3AFPA 4FDBA 2A19A 2JA5G 5C4ZA 3D0FA 5C0XG 1KNEA 3DEPA 3EA6A 5G3LD 1A6XA 1Y1VH 3TP8A 2A74C 4BXXG 4DK6C 1I4PA 3NEMA 1V8QA 5T1IA 1STEA 3HG9A 4Y7NH 4IOAA 2K50A 3ITPA 4ID6A 3RZOH 1X3PA 3HOWG 2E2HH 2MNAA 2Q2HA 2HIVA 4NB3A 4KTAA 5IE8A 2YU9H 3QOJA 1LTAD 1D1KA 4POFA 4JI4Q 4G7OC 1HHVA 3PUZA 1C0AA 3PO2G 4CKEA 2VZAA 5CGKA 3CD6A 4JYAQ 4LF7L 4FF2A 2JJQA 3AQQA 3FHWA 1C9OA 1V1OA 1HNZL 4J15A 3MXNA 1O7YA 3HKSA 2AQ2B 2RBMA 4JI7L 4LF9Q 3TS2A 3RN5A 4X66L 3M85A 4QUFA 3HOVH 5EPJA 1UEBA 3AFQA 1E22A 1F77A 3M3YH 2PMZB 3TRZA 4ABNA 2R7DA 4A3JG 3FKIH 4N9PA 5CV4A 4AYBB 4DKAC 2L5TA 4DV3L 1WTQA 3DWAA 2ICIA 2IHFA 3A8KE 1PRTC 3ZYYX 1KAAA 2F3WA 3P1HA 1FNUA 2B8GA 1V1QA 2AWOA 2HDLA 1TWAB 1X3EA 5FJ8G 4GN4B 3G7LA 1SMXA 5K5PA 5KYIA 4LFCQ 5BN3A 3OSOA 4JI4L 2F0OA 5IYDH 4PNYA 4JYAL 1XNQL 1Y1VB 2MUYA 4XQJA 1STYA 2X6GA 2WACA 4Y7NB 5COYA 4GOPB 4IUNA 2PZUA 4OWXB 2KEDA 5J1ZA 4JI1Q 3C1FA 4DR1L 3NPPA 2KVMA 3J80i 1BBWA 2LFNA 2RSNA 3HOYH 5NUCA 3F2UA 2E2HB 1PTOC 3JAMi 1EOTA 1TU2B 2CKZB 2YU9B 3U4VA 1DCZA 3K80C 4RHRA 1PH3A 1GO3E 1C8CA 1EYGA 1X65A 1V1PA 4GNXA 2EJGC 2MO0A 4AYBG 1N36Q 1GVPA 3I8ZA 1VQMA 2A6ED 1B44D 1VQ9A 1HUNA 1I4XA 5IP9G 3R2IA 2KUMA 3HKZE 1SFOH 4JI0Q 1L1OA 4L5RC 5IGBA 3CCUA 4C1NI 2ZM6L 1VQLA 3M3YB 3WOFA 2EXDA 3QO2A 3I91A 2K52A 4JG2A 3NWTA 1GUOA 4TKOB 3GTPB 3TMEA 4RH6A 1IBKQ 3ERQA 4RHSA 2FMCA 1E3PA 2OF1A 1YNXA 2WINB 3KJOA 3CRKC 3AU7A 3D31A 5EKLA 1Y1VG 2PYKA 4J8QA 4JI1L 2VXWA 1FNVA 4EGVA 1LV9A 2HIXA 5BN5A 2FFKB 1QWYA 2OXPA 3TREA 4ZCKA 1E1OA 2UUCQ 4O0AA 5EKKA 3ERSX 4K5VA 2WKDA 3DUZA 4UP9A 3F2BA 1HTLD 4XT3B 5JEAJ 1IYJB 1YI2A 3OIQA 2Q8TA 2WB1E 4RAUC 4OX9Q 3BYYB 2IX3A 4IO9A 1OXUA 2H4OA 2D5DA 5C4XH 3TBIB 3CXCA 2I5LX 2KCMA 2EXZA 2N49A 3LWUA 4FVMA 1VMPA 1STAA 2EY6A 5E4WC 3HOVG 1VDZA 1LLRD 1VQKA 3J80L 1G8ZD 2ZTCA 1K8AC 3S9WA 4CGYB 1CI3M 3JAML 5C5MA 3S1MH 4RWSC 3FKIG 3NTIA 1Q81C 5EKIA 1BDOA 1YVCA 1F2MA 3MAQA 4E6IA 4AQYQ 5D14A 4A3BH 3D4RA 1HZCA 4PG3A 3TP6A 1VQ4A 1WYDA 2F1MA 2DY8A 3C3LA 4OIKA 3OW2A 3CCSA 3AB9A 1KABA 4A93H 5D65A 2ZXPA 3E3XA 2KENA 1G2SA 4R8IA 1RL2A 4LF6Q 1HNWQ 3DWPA 3GTQB 4Y52H 1VF7A 1N9WA 4CJ0B 3TSSA 1SNCA 4DK0A 3TS0A 1EY7A 5IYDG 1CHQD 3V96A 5I6YA 5M5XH 2RVLA 1JJ2A 3GQBA 2DN8A 1VQFA 4S3SA 4WRDA 1AZQA 4IURA 3EROA 2AMCB 4JI2Q 2Q2IA 1FL0A 1KHIA 4GLVB 3S2HB 4ZUIA 4IPCA 1PYWD 2RDFA 1ENFA 4DV0L 3VR4A 3T16A 4DR2Q 5CMDA 1NMFA 4C2MH 1JE4A 2ZJRA 3S1QH 2AKWB 1EZ6A 2JA7H 3DM3A 3E6ZX 1I94L 3R8BA 1A3UA 1VQ8A 1IZ6A 3MC0B 1GUNA 4DAPA 1DJRD 5T1GA 4UY8C 4AIMA 2XN9C 3BDOA 1QVFA 4QB4A 5C4XB 1KRTA 1EL0A 1EQRA 4DXGA 3DMUA 1HFNA 1TQOA 1QZGA 3CC2A 4PQXA 3IKJA 4A4IA 1CKNA 4A3GH 2Z4IA 4LF6L 3KLSX 3CCLA 3K5LA 1I3QH 3S1MB 3U50C 5I2YA 2RSOA 1RODA 4HCSA 2C35B 4ZKBB 1V9PA 4R4QA 4A3BB 4XT1B 3G6EA 2LY7A 1PFSA 3CMEA 3I4OA 2B63H 5C0XI 3U9OA 2MPMA 2NBFA 1E2VA 4L5TA 1ENCA 4GN3B 4DR2L 4CDCC 2Y0SE 1MGSA 5M3MB 2A8VA 3OOCA 4DV1Q 4LNQA 4X65Q 4P72A 1PXUA 1PRTB 4DUYL 2WKCA 5GAEC 5M5XB 5FLXc 1H9SB 3SK4A 4JI3L 4BY7H 1RJTA 3E0EA 4JC0A 3J7YW 4JVZA 3QG1A 3URYA 3I4NH 2G9HD 4QJFA 1PH5A 3QWNA 5C4XG 4AH6A 4OL7A 2R92H 1D5MC 3S14H 4BWGB 4C2MB 3GTLB 1VQPA 4HAEA 1VQBA 2F0IA 1N34L 4CDEC 2YTVA 5KNCA 4Q5VA 3K0XA 3MTSA 5I9OA 1U0LA 3KF6B 5DM63 1ASZA 5C0XJ 1YHBA 1EQTA 1Y8PB 4OXPA 2UUAL 3IL8A 2Z6KA 4A3BG 2A69C 3G4SA 2EYHA 2I07B 1TWGB 3NUCA 1QZHA 1A3VA 2PI2A 4A3KH 2K4KA 2K28A 2F0PA 4XQNA 4DV1L 1XTDA 1HNXQ 1LT3D 4K6DA 2NVTB 1X32A 4ZYSA 3M7NA 1KDBA 2J0TD 5GAHC 2YTXA 5CV8A 1PRTF 1RTOA 4YWMA 3NBIA 1LTLA 2B63B 1YIJA 4APVA 2A6HC 3NELA 2BA1A 2A69D 3I73A 2D2CC 4EVOA 3VA7A 1KQSA 5JAVA 1KTKA 1Q12A 1FYCA 2K75A 1SYEA 1B4OA 2V1CC 3M4YA 4QIWB 3PUYA 4O42A 3WOEA 4K0KL 5ELCA 3RLFA 2K01A 1NE3A 2F0WA 4DV4Q 4GOPC 1F2LA 1GUGA 3MWYW 4DR5Q 1SROA 1M90C 1BKBA 1SYFA 4UAIA 4X62L 3RLNA 2JA7G 1G2TA 4QQBX 2CQAA 3HGBA 5KEEA 2BDNA 5LL6S 4LMQD 5IODA 3GTOH 3I4NB 5C0XH 2FJ2A 1EYDA 3I4MH 1LYLA 1Q8IA 3S14B 1IYVA 3EQLC 2B29A 4DV7Q 2KHIA 3LNNA 2BH8A 1YZ6A 3SHLA 1IL2A 4DUZL 2JA6H 1SNMA 2KOLA 4A3GG 2VW9A 2EPBA 3PCOB 5IGFA 1HQMC 1CUKA 1Z6HA 4KY5A 1CZWA 3F2CA 1MI2A 4QUCA 1Z7TA 1Z47A 3BU2A 2NTSA 1PH1A 3BVGA 3NBHA 1JOQA 4G7ZC 3BJUA 1CFMA 4H13C 4LF5L 3KF8A 5KNDA 4CJ1B 2K5NA 2B63G 1ENAA 4OEMB 4FO2A 1DD2A 4B3TL 1X3FA 5FO7B 1QNUA 1K0SA 5IWAL 2RQXA 3TZDA 5JPMC 3CCMA 2L1BA 4XDXA 2BE5C 4DR5L 1LABA 1EIYB 1YEZA 3Q8DA 1O80A 4Z9CB 3W5OA 4M1UB 3T56B 4RMFA 3RR5A 2UXBQ 3EBEA 4DF7A 1WVLA 2L55A 1NCVA 5C5LA 5M9OA 2Z4HA 4BY7G 3I70A 1GOZA 1CA5A 2DGYA 4DR3L 3I4NG 2EYMA 2NYZD 2DUDA 3Q22A 3KLSA 1T5XD 1J5EQ 1MHWC 2EE1A 5CORA 4F8MA 3SE0A 5AJ3Q 1BCPB 1NBWA 2B2WA 4ZK9B 1VQGA 5IGDA 2YTYA 1SXTA 4MTNA 2JA9A 1TS3A 3GTOB 1VQJA 4DAYB 4WORA 2F0FA 1DOMA 4IFDI 3S1RH 4ZLTF 3HOZB 4LUOA 4CBVA 5DM73 3I4MB 4HCEA 1VMCA 4PZ8A 3OWFA 1PZJD 1U4RA 2QCPX 5KRUA 2K32A 2KJXA 2R61A 3FMCA 1XPRA 2JA6B 4QCLA 1JWUD 1EY4A 4A3KG 1O78A 3A8IE 5IIFA 4XQQA 2HHHQ 4HSVA 4ILWA 1Q1EA 2UUBL 1EU4A 4JI8Q 2B2VA 3J81c 4DNRB 1EY0A 2Q2UA 3KJPA 2EZVA 1N33L 1OXXK 1JC7A 2NWGA 4IPHA 3T1YQ 4OO1I 2AQ1B 2EY2A 2R93H 4L5SA 1L2FA 1FJGQ 1I4RA 1J5EL 4OWTB 3CCRA 2E2IB 3CCJA 1YNJD 2CFMA 1LTSD 3CQZB 2DNCA 3CC4A 1TWAH 1BCPF 2CW0C 1NUCA 2I5HA 2F0LA 2OTLA 5I6WA 3BDLA 1T5EA 1RIPA 2IJ0A 4YHHQ 1L0YB 5KNBA 1Y1WH 1RKNA 4JCVE 4LUZA 5GADC 4DR6Q 1BBUA 4DR4Q 3JC66 1C4QA 3GP7A 3I4MG 1AN8A 2KHJA 3K7AH 3TEHB 4LW1A 4JV5Q 2I46A 1TXYA 4QMGA 3S15B 1AFPA 4B3SQ 1BR9A 2HHHL 2A68D 2JA6G 1CZGA 1YNND 5C3WA 1LTRD 4JI8L 2J7ZA 1QB5D 3S1RB 3PUWA 3FPPA 4C3JH 5K36H 1TS5A 3HKZB 5FLXE 4ZAIA 2MO1A 1K73C 1FJGL 1N32L 2VB2X 5KGUA 2UXCL 3I4LA 1DYQA 1HPCA 1ICFB 2WIIB 1GUSA 2DNEA 2ZTEA 4I65A 1GXDC 4PZ6A 3MXNB 3PQIA 3MA2B 1VQAA 4MIUA 1B53A 2CH4W 3STBC 1U9RA 2EJMA 3PSIA 1SEBD 4KK7A 3W3AA 4ZRZA 4LUVA 4JOIA 1O7IA 2IPKD 1K3BC 3QOLA 1GUTA 2VUMH 2VQFQ 4IFDH 4KKSA 1XTCD 1QILA 4RGTA 1CSQA 4V0BA 4F7XA 2F0KA 1ONLA 2DJGC 3EN2A 3GTPH 5IYBH 3OPOA 1MSGA 1PA6A 2R93B 1SR3A 2OEOA 1IL8A 4C3IH 4DNTB 5LMNQ 5EAYA 4R1JA 3WDNA 4B3SL 1ET6A 4LFBQ 4P2CB 2ZXRA 5JVG3 1VQ7A 2O5JC 5BN4A 2WB1B 3MEFA 3O13A 1T9HA 3PIP3 1TY0A 1JR0D 1HUMA 1D6EC 1QE6A 3MEHA 2CWPA 1Y1WB 4HMJA 3DXJC 4J1MA 3U4ZA 4OO1H 1PRTD 2VQEQ 1K8MA 3PF5A 3K7AB 2VY3A 1I6VC 4JI5Q 4DAVA 3C46A 2Q8RE 3HKZG 1X54A 4TSSA 1NSNS 4HIMA 4YWLA 1PFMA 1PH6A 5DAUA 4WJ4A 1FVIA 4DR3Q 4XIGS 4LF9L 2E8GA 1E24A 3MXPA 3DHQA 4XTCS 5I9PA 2G9DA 1NMGA 2RHQB 4HEDA 2PZTA 2B2YA 2KECA 5CV5A 3T13A 2JE6I 1W6JA 4Q0FA 1JQYD 2XNAC 3K7UC 4C3JB 1XMQQ 3UDIA 2SOBA 1M1KC 5C3EB 1V1PB 4GNXB 2F0MA 2EYJA 4WJWA 3QR8A 4LFBL 3D8GA 2R93G 3Q23A 1C48A 3VYSA 4KY6A 2K14A 2BOSA 4I7ZC 5CC4A 3SK6A 4ALPA 1PTOD 4CKCA 4K6LA 2VUMB 3R3OA 4LFCL 5CV9A 2EYLA 3H94A 4OWWB 4R4IA 1Q8KA 1SYGA 2WB1G 4GKJQ 2LKVA 4RA8A 3G48A 2KHSA 2XWBB 2BH2A 4C3IB 3GTQH 4JK1C 4JI5L 1WFQA 1Y1WG 1UNSA 5ELNA 2KCNA 3MZ5A 4IUUA 2F0HA 2E2DC 1EY9A 4DK1A 3GTKB 5DLQE 3G71A 1D1IA 4P74A 1QG7A 3D3RA 1BQQT 2LMCB 4KY7A 5EJWA 3U58A 1BNZA 3S2HH 1BUVT 2WAQE 3EFXD 2L9HA 5ISRA 4IPGA 3GTJB 3NP8A 5CYUA 5HGTA 1MIUA 4DFAA 1PHJA 3SK8A 2D0PA 1YJWA 3H3VC 5EQ0A 1N36L 4C3JG 5K36G 1PV4A 3KDFA 1W6KA 5C3EG 1WJJA 3GTGH 3A56A 1STGA 4DV5Q 1LUZA 3PIO3 1W3SA 4JI0L 3BVMA 1EQVA 1B3QA 2WFWA 3RN2A 3ND9A 4BA2I 3E0JA 1IBKL 4HJ9A 2LSSA 2CQOA 4H0LC 2VUMG 4IFDG 3OHXC 1MJEA 3SDZA 1WTPA 5IGGA 3TP5A 5C44H 3MVVA 5IYBG 2Z0SA 4R8NA 4C3IG 2Y0SB 2UXDQ 1BXTA 2R7ZB 1S72A 5KYLA 3CC7A 3K5OA 2CVRA 3NTHA 2UUCL 3J80c 1B2TA 4B3RQ 2TSSA 5JJKA 2OTJA 3JAMc 4NXMQ 1F9SA 3VR5A 1LO5D 4K8JA 1KL9A 2MFIA 1EWIA 1K83B 1S5ED 5M3MH 3GO5A 5IT9L 4PZ7A 3H3VI 3J81E 5DEHA 1BCPC 1JB3A 4ME3A 4OX9L 2R3ZA 3I72A 4OO1G 1S3OA 4NMZA 3TDQA 4DV5L 4H44C 1XXGA 2K5VA 1K9MC 1JB7A 1A0IA 1F9QA 1CKOA 2JEBI 2AQ3B 4H02A 1TWHB 3A5UA 4MN3A 4NXNQ 1LT4D 1UAPA 1WTXA 2NN6I 1XJVA 1WI5A 3UI2A 3GTLH 2DY7A 2K5HA 2XVSA 3W2DA 1RCVD 3VYRA 1YITA 3PUVA 1U4LA 4YWKA 1A3TA 1NR2A 2UXDL 4AQYL 2B3GA 3E9IA 3GTGB 5FOBB 1QCBD 3UE1A 1Y14B 3AEVA 2VL6A 3QJYA 4DPGA 1NJIC 2Y0SG 2CCZA 4B3RL 1EUJA 2F3IA 2R7ZG 1PH7A 1TWGH 1ASYA 5C4JH 2QILA 4OGQC 1HNWL 1CKNB 2ALYB 2RKSA 1FGBD 3AYHB 2I0QA 1BO0A 3T51B 3TZUA 4O1NA 5FK9C 4XXEA 5C44B 2NVTH 2VS1A 1PDQA 2JN4A 3Q24A 2E74C 2AHOB 1A8VA 4KD3A 5D3IB 4JI2L 3GTMB 5HY6A 2MP1A 3TN2A 3DM1A 3OWEB 3CRLC 4NXNL 4HSPA 4BY1H 1EIFA 4PMBA 1CQFA 1CA6A 4RCOA 4U673 5JJIA 3P20A 1VQIA 1OXTA 4GKKQ 1QVCA 2KBNA 2O4XA 4H7BA 1IHZA 1QJOA 1DOKA 3LWEA 4A3EH 2F4IA 3P7JA 1E2ZA 1X9NA 1VQDA 2GN5A 1I4HA 4DU9A 1SE3A 4ODGA 5I2XA 1Q82C 1S5BD 1NR4A 4IOCA 3T1HQ 1JJGA 4V190 4L5QA 2RF4A 2E5LQ 2EJFC 1O7ZA 2OWOA 4P75A 2JXMB 2X6LA 1H9SA 4B08A 2VB3X 1ILQA 3H3VH 2F0JA 5FO8B 5IP7H 5LMUQ 1XPUA 1OTCA 4IJLA 1FR3A 2F0SA 3J7AF 2O2LD 5C44G 3J81j 5HGQA 1FGUA 4A75A 3HZXA 2K05A 2N78A 3FVQA 3RLOA 3RZDH 1HFGA 5C6AA 3BYTB 1HXYD 2X69A 2N3SA 1VQEA 5C4JB 2NN6H 1WTVA 2BCOA 4RKLA 1Y8OB 3GV6A 1AW7A 3KF6A 4DR7Q 4X65L 3RUZA 1SBBB 1XX8A 3ICEA 4I7AA 3UDXA 1P8LA 1STHA 2B2TC 2P5ZX 2B2UC 2IL8A 5M3MG 4A3IH 4IQZA 1SN8A 4B3MQ 3G6JB 1X3GA 3RMHA 4FF1A 5JJLA 5KIXA 4BY1B 1I4QA 4YIJA 1Q3LA 3S24A 2MHVA 3UDFA 2JA8H 1G6ZA 3D4DA 3VR2A 2NTTA 1ZEQX 1WTOA 1JICA 4QF4A 4A3EB 3V05A 1ML0D 3MXGA 1HCZA 2F03A 1UE1A 2M00A 1WTHA 5I4DA 4YY3Q 1PH2A 2A6HD 1TWCB 1OO9B 1VQCA 1SE2A 3A5ZB 1K28A 2UU9Q 3ND8A 3HOZH 1D7QA 4NDXA 3NQTA 2E2JB 4LF4Q 5FO9B 1EFWA 2MQHA 1VCIA 3CPWA 2ZTDA 1DGSA 1JWSD 3M4QA 3NXWA 4GNXC 4DR7L 5A2QE 3NTKA 1HNXL 2F0VA 2EOTA 3CMAA 1X6OA 3F2DA 3S16B 1KIXA 1Q86C 4KHPQ 2J4XA 2E75C 2ZXOA 1CT1D 3RZDB 1SMYC 2AUJD 3HOXH 3NBHB 1ILPA 3OTOQ 1LT6D 4IALA 2NVXH 1A15A 5CV6A 3SGIA 1VS0A 5TSSA 4OELB 4BY1G 4DV4L 1UE6A 4LAAA 4HJ5A 2E2IH 2PW5A 2F0GA 1JCKB 3CQZH 4YY3L 3L2PA 1ZYRC 4A3IB 2JQOA 2AUKA 4A3EG 4KJNA 4A3CH 4EQNA 2D9UA 2H1EA 2UU9L 1A2UA 2PI2E 1JMCA 3HEJA 3E5SA 4ZKCB 4JBKA 1SRUA 1CQVA 1QUQA 2IX1A 1EY5A 4DV7L 4GZYC 1JT8A 1A62A 2JA8B 1D5ZC 1J6QA 2EQSA 4TQUS 1I6HB 1DONA 2BE5D 2EYFA 2DJFC 2OQKA 3H15A 1LACA 2SNSA 4JI6Q 3J80E 3KBXA 3L3OC 1VQ5A 4IUQA 3S15H 1ZYRD 3K5MA 2XRSD 2JEAI 3KUPA 3KYHC 3JAME 1AZPA 1U4MA 2L0CA 3CPFA 1IW7C 1EWHA 5IP7G 3K81C 4CHTB 1OXSC 1ZKOA 4FXGC 3T4AC 3S17H 1H9JA 3KBGA 1R4PB 4XYOA 1I4GA 2FINB 1Y69U 1UE7A 4EQPA 2NZHA 2K1BA 3J7ZC 1QNKA 1S40A 4RGOS 1K3RA 2EYOA 2PQAB 3KLWA 1IBLQ 4PMCA 1EWCA 4KHZA 2NN6G 4B9XA 3OW7A 4MNOA 5EPKA 4ZQ3A 5LMNW 1SYBA 2IWHA 5E3FA 4KLKA 3C2PA 1PH4A 3CAMA 2UXBL 3J81L 3HOXB 1TS2A 1KLUD 4A3IG 4FXKC 1CM9A 2K33A 5BR8Q 1ET9A 4FF3A 2NVXB 2L12A 2QKIC 2ENBA 4CJ2C 1G291 4LFAQ 3EJIA 3FDTA 3V2TA 2PPBC 4K2LA 1GUWA 1TWFH 2A1AA 3B6YA 1H9MA 2GVBA 4UDUC 4CKBA 3K8AA 3M7GA 4X64Q 1IKLA 5AJ3L 3BZCA 1R9TH 2JA8G 1EOVA 2SNMA 4L8JA 2K5WA 1XWEA 2QDLA 1AH9A 3ER0A 4IFDJ 4A3MH 3A0JA 3K58A 3I2ZA 4A3LH 1LTGD 4R4TA 2H5XA 3ULPA 4NKLA 4JW0A 3TQYA 1I5FA 4LF7Q 4OIJA 1SYDA 3HOZG 1EYAA 1HNZQ 3QIAA 2NUCA 4MTKA 2B8FA 3DEOA 4NPSA 3VYTA 4JI7Q 2K03A 4A3FH 4X66Q 3PO3H 3GDEA 2R7FA 2CW0D 2QDBA 4K5XA 1UE5A 2KQ3A 2F0DA 4HMIA 1H95A 2ES2A 1PLFA 1U4PA 2IHEA 3S17B 5BR8L 3A54A 4G4KA 4L63B 4DV3Q 3S1NB 3OIPA 2QEXA 4LFAL 5JPNC 3T1YL 1CKMA 1STBA 3HOXG 1JORA 2EIFA 3LGJA 5C3EH 1WTRA 4BBSH 4KJOA 4X64L 2IT1A 1HZ9A 1MSHA 4JBMA 2Z1CA 1SDFA 4HIDA 2K04A 4IUVA 3ULLA 4QL5A 4UP7A 5ELDA 5D3DA 4R4OA 1PFNA 5J3BA 4YHHL 1PZKD 4KKUA 4A3CG 1W2BA 1J9OA 4MHEA 4TVAB 1XNQQ 1BBXC 3WWVA 4DR6L 3X3NA 4DR4L 2OCEA 2QEJC 2FMMA 1TWFB 1NY4A 1QOHA 2WAQB 1KDAA 4JV5L 1K0RA 3RNUA 3KOJA 1GM5A 1YHAA 2CWAA 1R9TB 3TP7A 4A3DH 5FLMH 2IW3A 4DR1Q 3STBD 1B3AA 3OYYA 3GTKH 2R6GA 3MHBA 1PVOA 1B1ZA 1SNQA 4A3MB 2I5MX 1TT2A 4DNIA 1SNDA 4RGMA 2AWNA 2SDFA 3L7ZC 1PZID 2M9VA 3GTJH 5ELOA 4ULLA 2B2TA 3RD4A 1G91A 3M9BA 2B2UA 5J39A 1KXLA 2TMPA 4P73A 3S2DH 4B9WA 3W1GA 4KN4C 4PV1C 4X3KA 4A3FB 2ID0A 4YCWA 3PO3B 5FKAC 2ZM6Q 1J8IA 5LL6X 2VQFL 4DN4M 2Z6KC 1KLGD 4K8IA 1GHKA 3C1EA 4LF8Q 2JSOA 4GOPA 3BZKA 1KAWA 5LMNL 2A6EC 4BBSB 3UE0A 3M4PA 1L0XB 1A2TA 1LT5D 1EQQA 2R7ZH 3N6RA 3RZOB 2WAQG 4KHVA 1HR0W 4DXFA 1LTTD 5ELEA 1L1OB 1GJXA 2VNUD 2EY5A 3A8JE 3MXUA 4HJ7A 3D4WA 3HRZC 2QA4A 3A7LA 1B9MA 3CKIB 4A3MG 2VQEL 3ONAB 5EPLA 1K83H 4A3LG 3F1ZA 4KI0A 3A7AB 2RDGA 3H91A 1XMOQ 3HOVB 4U68A 4A3DB 5IGCA 2PW7A 3F8TA 2ATWA 2XGTA 5A2QL 4IJHA 2F3VA 3FP9A 5JJZA 4A3FG 3FKIB 3PO3G 2C5CA 4QGUA 1Y8NB 1F9PA 4XYQA 1TWHH 4LF8L 1XMQL 3QB3A 3K5NA 2ICEC 4R9WA 1YHQA 2NZ1D 3HP3A 1JWMD 2K6AA 2PMZE 5CR3A 3S2DB 3VA5A 5GROA 4J6HA 4AYBE 3CCVA 3KDFB 3DWQA 3PGZA 3NE5B 4ZUJA 1R4QB 4BBSG 2XWJB 1AE2A 2JP1A 2HCCA 2SEBD 4WFN3 3J7AV 2QW7A 5GAGC 1Q7YC 4G7HC 2Q8IB 3KLRA 2RDHA 4GKJL 5EBDA 1WTWA 1Q46A 1HRJA 1SAPA 2KEEA 2QF7A 4C56C 3I7FA 3I56A 4N9TA 1A63A 3FPUB 2D0OA 1XMOL 2ZJPA 5C4HA 4FXDA 3HOYB 5CBEE 3NWSA 4KD4A 1STNA 4HIOA 2C9OA 2ZJQA 1HZAA 2MGSA 3GTMH 4F88A 5FLMG 4A3DG 1D5XC 4RG1A 1S4ZA 5IOCA 4DV0Q 1VQOA 3BS1A 1BOSA 3CCEA 2PCFB 1E1TA 1DM0B 5F2DA 1Q90A 3NSWA 1G51A 1SSOA 3Q0AA 1NAPA 1I94Q 3HOUH 1S5DD 1FNWA 1KRSA 1LM0A 1ESRA 2L4NA 2PQEA 3PIPA 1K8GA 1HR0Q 3M4OH 2GA4B 1KDCA 5LHY1 1SFOB 2B2WC 3NHHA 1TVXA 1MJCA 1SNPA 1C7YA 5M3FH 2N8NA 4GLAC 2YV5A 3E9HA 4RKBA 5E7NA 5JEAH 1B8AA 1B70B 1E0BA 1BVSA 2A73B 4K2KA 4DGZA 5IT9c 1EY6A 2HQEA 1BCPD 1X55A 1M4VA 4FP5D 5CBAE 3K0YA 2BDOA 3MFYA 3VR3A 1EZ8A 1L0WA 2B2VC 3K6OA 5A35A 4A76A 3HOYG 3KFUA 2NVQH 1GKHA 2LS01 4IN3A 3BG3A 5IY0A 1M8AA 2HDMA 1YJNA 4NXML 2NB0A 3VYUA 2WP8J 4JBWA 3BZDB 4DUYQ 2F4VQ 1HR0L 1U5KA 3I90A 3L0OA 3D6CA 2IY5B 4JI3Q 4RFBA 1TKWB 3L9AX 1SJED 4UP8A 5AFWA 5M5YH 3SXHA 4C1NK 2F0QA 5ELFA 3X3MA 2G5DA 4X3UA 1PTOH 1HA5A 3NQIA 4HJAA 1XNRQ 4PMWA 4RGNA 3T53B 3PMFA 2OQ0A 1V43A 3J7A5 1N34Q 3CU7A 1CTMA 1JOKA 1CHPD 3HOUB 1EIHA 2M2LA 2KCCA 2JYOA 5E4XA 5G3LF 3SR1A 3M4OB 4JBJA 5FLXL 2F0NA 1WCMH 1MD2D 1S5FD 2PNHA 1B50A 2UUAQ 1KC8C 3I3CA 1TWCH 2RA4A 3NENA 4A93B 1FD7D 1HA6A 5M3FB 1DOLA 2E2JH 4DV2Q 2Z6BA 1B7YB 3EIVA 3IFDA 1EIGA 4KMUC 2PO4A 1B9NA 3K59A 2D62A 2EDGA 3PIOA 2F4VL 1JE5A 1GD7A 2Z8LA 1RF2D 4KKTA 3PF4A 1EEFD 4GLXA 4QY7A 2E76C 1UEAB 3AMUA 3S16H 1PYBA 3A74A 3W1BA 1SE4A 1UWVA 1NTGA 1ESFA 4X3TA 1I50H 1HZBA 4MZ9A 4JOIC 2F0EA 1KNAA 1XNRL 2NVQB 1H9KA 3PV0A 4OHJA 1WD1A 3S1QB 4FF4A 3P75A 4K0KQ 2JK8A 2JA7B 4LK1C 1AP0A 4GKKL 4GS3A 3OMCA 1AE3A 3OMGA 1H9RA 4X62Q 1DXMA 4BBRH 1JJCB 3HOUG 5GQOA 5HURA 4R4CA 5C3XA 5M5YB 1DZ1A 3R2TA 1LTBD 1PTOB 1N8RC 4A3GB 3T1HL 2F0UA 2CH4A 4DV2L 1E2WA 1MBYA 1JOOA 1G6PA 1SNOA 5EGTA 3UDGA 3H0GH 2E5LL 4A93G 1I3QB 1SLJA 2ASBA 2HQLA 3CCQA 1HTPA 4P71A 4C3HH 3MFGA 4DUZQ 4N8FA 5M3FG 4WJ3M 2FHTA 3BDCA 4RCNA 4TRDA 1I6HH 5JEAG 4L6TB 4BA1I 3PUXA 4DV6Q 3HS0C 5LMUL 2NVYH 2BA0A 1WCMB 1NNXA 5ELBA 4LF5Q 1VQ6A 1X56A 4YCVA 2N55A 3CHBD 3A55A 2B2YC 4O2DA 1SE8A 4B3TQ 1P16A 4M8AA 1PH9A 3ZJYC 5IWAQ 2Q2TA 5IYCH 4DAMA 4IUPA 2L15A 2XSCA 4CDDC 4UPAA 2K5DA 4OONA 4F87A 3J81i 4EX5A 1ICWA 1XPOA 2JA5H 4BY7B 1RTNA 2IX0A 1MKHA 1SYCA 3SVMA 1PH8A 1IBMQ 1I50B 3FEWX 4B3ML 3IRBA 1L1OC 1TS4A 2KA7A 4NP5A 1E7ZA 4BXXH 1PYSB 4UHVA 2R92B 3CF5A 2EVBA 2Z9HA 1PTOF 3LX0A 3KF8B
chains in the Genus database with same CATH topology
2IHEA 5DLQE 5BR8L 4DV3Q 2C35B 3G71A 4P74A 1V9PA 2QGQA 4R4QA 2QEXA 3G6EA 4LFAL 3U58A 3T1YL 1PFSA 3CMEA 3I4OA 1CKMA 3HOXG 2B63H 4DV6L 2EIFA 3S2HH 3HOWH 2WAQE 5C0XI 4IPGA 3LGJA 5C3EH 1MIUA 4L5TA 1PHJA 4BBSH 4X64L 2D0PA 1YJWA 2IT1A 4GN3B 1HZ9A 4JBMA 2GVAA 3PO2H 4DR2L 1N36L 5K36G 1VQNA 1PV4A 2Y0SE 1VQHA 2A8VA 3KDFA 3CW2C 4HIDA 1WCMG 4LF4L 4DV1Q 3ULLA 5C3EG 4LNQA 4X65Q 1WJJA 3GTGH 4P72A 4QL5A 4DUYL 4IPDA 4UP7A 5M5WH 1LUZA 4DV5Q 1W3SA 4JI0L 4R4OA 5GAEC 5J3BA 4YHHL 5FLXc 1QUQB 4A3CG 4JI3L 2WFWA 3RN2A 1W2BA 1HH2P 4BY7H 3E0EA 4TVAB 1XNQQ 4JC0A 3WWVA 4DR6L 4BA2I 4DR4L 3I4NH 2OCEA 4EQ5A 4A3JH 1IBKL 1NY4A 4JV5L 1QVGA 4KHPL 4QJFA 1K0RA 1OXVA 2LSSA 4HJ9A 2CQOA 1PH5A 2UUBQ 3RNUA 3KOJA 4AH6A 1IBML 2VUMG 4IFDG 1GM5A 5C4XG 2R92H 2YYZA 1YHAA 2CWAA 1MJEA 3S14H 4A3DH 5FLMH 1YJ9A 4DR1Q 3STBD 4HJ8A 5C44H 3OYYA 1N33Q 1VQPA 3GTKH 3HFZB 5IYBG 1VQBA 2R6GA 2Z0SA 3OTOL 1N34L 4X6AH 1PVOA 2UXDQ 2YTVA 3S1NH 1CSPA 2I5MX 4DNIA 1S72A 3K0XA 1HJPA 2AWNA 3L7ZC 2R92G 3CC7A 1U0LA 3KF6B 5FJ8H 3GTJH 2UUCL 5ELOA 3J80c 5C0XJ 1YHBA 1ASZA 4LWCA 4B3RQ 5H1SE 2XTIA 4OXPA 2UUAL 2F52A 5JJKA 2OTJA 3JAMc 3M9BA 4NXMQ 2Z6KA 4A3BG 1KXLA 4QIWE 4P73A 3G4SA 1KL9A 2MFIA 1WOCA 1EWIA 4POGA 3S2DH 4DK3C 1QZHA 3W1GA 5M3MH 3GO5A 2PI2A 2ID0A 4PZ7A 4YCWA 4A3KH 3H3VI 2K4KA 2NZOA 4BBRG 4ME3A 4OX9L 2LXJA 2ZM6Q 4DV1L 4OO1G 1XTDA 1S3OA 1HNXQ 2PQAA 1D8LA 4DV5L 2K5VA 3M7NA 2VQFL 2KCTA 1K9MC 2Z6KC 5GAHC 2YTXA 4YWMA 1LTLA 3CP0A 1JB7A 4YCUA 1A0IA 4LF8Q 1CKOA 1YIJA 2JEBI 4H02A 3H0GG 4APVA 3VDYA 4JI6L 4GOPA 3BZKA 3A5UA 3NELA 2BA1A 4NXNQ 1KAWA 3GD7A 5LMNL 2NN6I 1XJVA 1KQSA 1WI5A 1Q12A 2RCNA 3GTLH 2K5HA 3UE0A 2K75A 2LXKA 3M4PA 2V1CC 3ULJA 1KD1C 1EQQA 1YITA 3PUVA 3PUYA 2R7ZH 2WAQG 4K0KL 4YWKA 3RLFA 2UXDL 2FXQA 4AQYL 2B3GA 1IXRA 3E9IA 1HR0W 1NE3A 4DV4Q 2RHSB 4GOPC 3UE1A 4GN5A 4DR5Q 1SROA 1L1OB 1Y14B 2HT1A 1M90C 2VNUD 1N32Q 1BKBA 5IP9H 4HJ7A 3AEVA 2VL6A 4X62L 3DLLA 3HOVG 3RLNA 2QA4A 4DPGA 4HIKA 1NJIC 2JA7G 1Q1BA 2Y0SG 2CCZA 2UXCQ 4QQBX 4B3RL 1EUJA 2F3IA 4A3MG 1IBLL 2R7ZG 3GTOH 2VQEL 1PH7A 1Z9FA 1TWGH 1K83H 5IYCG 1ASYA 1YBYA 4A3LG 3F1ZA 5C4JH 4KI0A 3I55A 3I4MH 1HNWL 1CKNB 2ALYB 1XMOQ 3AYHB 1LYLA 2I0QA 3AFPA 2B29A 3F8TA 2KHIA 4FDBA 4DV7Q 2ATWA 2A19A 2JA5G 2NVTH 2BH8A 2XGTA 1YZ6A 2VS1A 3D0FA 4IJHA 5C0XG 4DUZL 1IL2A 2JA6H 3FP9A 4A3FG 4A3GG 2VW9A 3PCOB 3PO3G 2AHOB 1CUKA 1A8VA 1Y1VH 4QGUA 3F2CA 4BXXG 4JI2L 1TWHH 3NEMA 5HY6A 4DK6C 4LF8L 1XMQL 1Z47A 3BU2A 4Y7NH 1YHQA 1PH1A 4NXNL 4IOAA 4BY1H 3BJUA 1EIFA 2K50A 4LF5L 5JJIA 2PMZE 2K5NA 2B63G 5GROA 1VQIA 3RZOH 3HOWG 4B3TL 1OXTA 1X3FA 4AYBE 3CCVA 2E2HH 4GKKQ 2MNAA 1QVCA 2KBNA 2Q2HA 3KDFB 2HIVA 4NB3A 4A3EH 5IE8A 3PGZA 5IWAL 4POFA 2YU9H 4BBSG 1X9NA 4JI4Q 1AE2A 1VQDA 3PUZA 3CCMA 2GN5A 1C0AA 3PO2G 4DR5L 2VZAA 1EIYB 5GAGC 3CD6A 1YEZA 4LF7L 4JYAQ 3Q8DA 1Q7YC 2JJQA 1Q82C 3AQQA 3FHWA 1C9OA 3W5OA 1HNZL 4GKJL 4J15A 3HKSA 4IOCA 1Q46A 3T1HQ 4JI7L 4RMFA 3RR5A 4LF9Q 3TS2A 3RN5A 2UXBQ 1JJGA 3I7FA 3I56A 3EBEA 4L5QA 2RF4A 4X66L 3M85A 2E5LQ 3HOVH 1UEBA 1A63A 4BY7G 3AFQA 2D0OA 2OWOA 4P75A 1XMOL 1E22A 2ZJPA 2DGYA 3M3YH 4DR3L 3I4NG 3TRZA 2R7DA 2DUDA 4A3JG 3H3VH 3FKIH 4HIOA 4DKAC 5IP7H 5LMUQ 4DV3L 1XPUA 1OTCA 1J5EQ 4IJLA 2IHFA 2ZJQA 1HZAA 3GTMH 4A3DG 5FLMG 4RG1A 5C44G 3J81j 5HGQA 5AJ3Q 1FGUA 1NBWA 4DV0Q 4A75A 2N78A 3RLOA 3RZDH 1VQOA 1VQGA 3CCEA 2YTYA 1E1TA 4MTNA 2JA9A 1G51A 1VQJA 1V1QA 2AWOA 4DAYB 1I94Q 4IFDI 1X3EA 3HOUH 2N3SA 5FJ8G 3S1RH 1VQEA 4GN4B 4LUOA 1KRSA 1LM0A 3PIPA 1K8GA 3M4OH 1HR0Q 3KF6A 4PZ8A 4DR7Q 4X65L 1SMXA 4LFCQ 3UDXA 3ICEA 1P8LA 4JI4L 1XPRA 5M3MG 5IYDH 1MJCA 4A3IH 4A3KG 4JYAL 1XNQL 1C7YA 1SN8A 5M3FH 2N8NA 4GLAC 2YV5A 4B3MQ 3E9HA 2HHHQ 1X3GA 5E7NA 1B8AA 1B70B 4GOPB 5JJLA 1Q1EA 4OWXB 1BVSA 4JI8Q 5IT9c 2UUBL 3J81c 4JI1Q 4DR1L 3S24A 2Q2UA 3J80i 1BBWA 3KJPA 1N33L 3HOYH 1X55A 3UDFA 1OXXK 2JA8H 4IPHA 3JAMi 3T1YQ 4OO1I 2CKZB 2R93H 4L5SA 3U4VA 1L2FA 1FJGQ 3K80C 1J5EL 1UE1A 1PH3A 4OWTB 1GO3E 3CCRA 1EYGA 1L0WA 4YY3Q 1X65A 1PH2A 3CCJA 4GNXA 4A76A 3HOYG 3KFUA 2CFMA 2NVQH 1VQCA 1GKHA 2MO0A 4AYBG 1N36Q 1GVPA 3A5ZB 3CC4A 5IY0A 1VQMA 1YJNA 4NXML 1TWAH 2UU9Q 3HOZH 1D7QA 2I5HA 2WP8J 4LF4Q 1VQ9A 1EFWA 2OTLA 2MQHA 5IP9G 4JBWA 1VCIA 3CPWA 2ZTDA 3HKZE 4DUYQ 2F4VQ 1SFOH 4JI0Q 1DGSA 1L1OA 1HR0L 1U5KA 4L5RC 3CCUA 1RIPA 4YHHQ 3L0OA 3M4QA 2ZM6L 4GNXC 1Y1WH 1VQLA 4DR7L 2EXDA 4JCVE 4JI3Q 2IY5B 1HNXL 4LUZA 4UP8A 2K52A 5GADC 4DR6Q 1BBUA 4JG2A 4DR4Q 3JC66 3CMAA 1X6OA 3F2DA 3I4MG 5M5YH 1KIXA 2KHJA 3K7AH 3TEHB 4LW1A 1Q86C 1IBKQ 4JV5Q 4KHPQ 4HJAA 1TXYA 4B3SQ 1XNRQ 2HHHL 4PMWA 3HOXH 1E3PA 3KJOA 1YNXA 2JA6G 2OQ0A 1V43A 3NBHB 3J7A5 4JI8L 3D31A 3OTOQ 1N34Q 2NVXH 1Y1VG 4JI1L 3SGIA 2HIXA 1VS0A 3PUWA 4C3JH 4BY1G 3TREA 4JBJA 1E1OA 1UE6A 4DV4L 2UUCQ 4HJ5A 4O0AA 1WCMH 2MO1A 1K73C 1FJGL 2PNHA 3ERSX 2E2IH 4UP9A 3F2BA 2UUAQ 1N32L 1KC8C 1TWCH 5JEAJ 1IYJB 3CQZH 3NENA 4YY3L 3L2PA 1YI2A 2JQOA 2UXCL 2ZTEA 4A3EG 4A3CH 2WB1E 4PZ6A 2E2JH 4DV2Q 3MXNB 1B7YB 1VQAA 3EIVA 2PI2E 3STBC 2UU9L 1JMCA 3PSIA 4OX9Q 4IO9A 1OXUA 4JBKA 4LUVA 4JOIA 1O7IA 2D62A 1SRUA 3PIOA 2F4VL 1JE5A 1QUQA 1GD7A 5C4XH 2VQFQ 2IX1A 4DV7L 2VUMH 3PF4A 1JT8A 3CXCA 2I5LX 1CSQA 4GLXA 1A62A 4QY7A 1J6QA 2EQSA 2KCMA 4TQUS 3EN2A 3S16H 2N49A 1PYBA 3GTPH 2OQKA 3A74A 3W1BA 5IYBH 3H15A 1PA6A 4JI6Q 1SR3A 1NTGA 1UWVA 1VQKA 4C3IH 2ZTCA 1I50H 1HZBA 4MZ9A 1K8AC 1VQ5A 5LMNQ 3S15H 2JEAI 3KYHC 4JOIC 5EAYA 4R1JA 3CPFA 4B3SL 1XNRL 3S1MH 4LFBQ 3FKIG 1Q81C 5IP7G 3K81C 1OXSC 3PV0A 1YVCA 1VQ7A 3S17H 4K0KQ 2JK8A 3MEFA 4AQYQ 1T9HA 4A3BH 1UE7A 1HZCA 4PG3A 4GKKL 2NZHA 4GS3A 3J7ZC 1VQ4A 1WYDA 1AE3A 3OW2A 2CWPA 4X62Q 1H95A 3CCSA 1S40A 1K3RA 2PQAB 4BBRH 3KLWA 1JJCB 3U4ZA 1IBLQ 4A93H 3HOUG 5GQOA 4KHZA 2VQEQ 2NN6G 3PF5A 2KENA 4R4CA 2VY3A 4MNOA 1RL2A 4JI5Q 3HKZG 1X54A 4LF6Q 4HIMA 4YWLA 5LMNW 1N8RC 1PH6A 4KLKA 1HNWQ 4Y52H 4WJ4A 1FVIA 3T1HL 1PH4A 1N9WA 4XIGS 4LF9L 3CAMA 2E8GA 4DV2L 2UXBL 1G6PA 1E24A 3UDGA 3H0GH 3TS0A 4XTCS 2E5LL 5IYDG 4A93G 1SLJA 2ASBA 1NMGA 2HQLA 2RHQB 3CCQA 4A3IG 5BR8Q 4P71A 5M5XH 4C3HH 4DUZQ 1JJ2A 5M3FG 4WJ3M 1G291 4LFAQ 1VQFA 1I6HH 2JE6I 5JEAG 4BA1I 3PUXA 4DV6Q 3K7UC 2AMCB 4JI2Q 2Q2IA 5LMUL 1FL0A 1KHIA 1XMQQ 3UDIA 4GLVB 1TWFH 2A1AA 2NVYH 2BA0A 3B6YA 1M1KC 4IPCA 2GVBA 3K8AA 4X64Q 4LF5Q 1VQ6A 1X56A 4YCVA 5AJ3L 3BZCA 4DV0L 1R9TH 1EOVA 2JA8G 4DR2Q 1NMFA 4C2MH 4GNXB 4O2DA 2ZJRA 4LFBL 3S1QH 1SE8A 2AKWB 4B3TQ 2R93G 2JA7H 1P16A 3DM3A 1AH9A 1PH9A 3ER0A 4IFDJ 4A3MH 1I94L 3ZJYC 1VQ8A 3A0JA 5IWAQ 2K14A 1IZ6A 2Q2TA 3I2ZA 5IYCH 4DAMA 4A3LH 4ALPA 4UY8C 4R4TA 2L15A 4AIMA 2H5XA 3ULPA 1QVFA 4LFCL 1KRTA 3TQYA 1I5FA 4LF7Q 1EQRA 4UPAA 4OWWB 3HOZG 4R4IA 1Q8KA 2WB1G 4OONA 3J81i 1XPOA 4EX5A 1HNZQ 4GKJQ 2JA5H 3G48A 4NPSA 2IX0A 1QZGA 1MKHA 4JI7Q 3CC2A 2BH2A 1PH8A 3GTQH 4A4IA 1IBMQ 4JI5L 1CKNA 1WFQA 4X66Q 4A3FH 4B3ML 3IRBA 4A3GH 1L1OC 3GDEA 5ELNA 2R7FA 1Y1WG 3CCLA 4LF6L 3PO3H 1E7ZA 1UE5A 1PYSB 4BXXH 1I3QH 3CF5A 4DR3Q 3U50C 2ES2A 3KF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHE A;  5DLQ E;  5BR8 L;  4DV3 Q;  2C35 B;  3G71 A;  4P74 A;  1V9P A;  2QGQ A;  4R4Q A;  2QEX A;  3G6E A;  4LFA L;  3U58 A;  3T1Y L;  1PFS A;  3CME A;  3I4O A;  1CKM A;  3HOX G;  2B63 H;  4DV6 L;  2EIF A;  3S2H H;  3HOW H;  2WAQ E;  5C0X I;  4IPG A;  3LGJ A;  5C3E H;  1MIU A;  4L5T A;  1PHJ A;  4BBS H;  4X64 L;  2D0P A;  1YJW A;  2IT1 A;  4GN3 B;  1HZ9 A;  4JBM A;  2GVA A;  3PO2 H;  4DR2 L;  1N36 L;  5K36 G;  1VQN A;  1PV4 A;  2Y0S E;  1VQH A;  2A8V A;  3KDF A;  3CW2 C;  4HID A;  1WCM G;  4LF4 L;  4DV1 Q;  3ULL A;  5C3E G;  4LNQ A;  4X65 Q;  1WJJ A;  3GTG H;  4P72 A;  4QL5 A;  4DUY L;  4IPD A;  4UP7 A;  5M5W H;  1LUZ A;  4DV5 Q;  1W3S A;  4JI0 L;  4R4O A;  5GAE C;  5J3B A;  4YHH L;  5FLX c;  1QUQ B;  4A3C G;  4JI3 L;  2WFW A;  3RN2 A;  1W2B A;  1HH2 P;  4BY7 H;  3E0E A;  4TVA B;  1XNQ Q;  4JC0 A;  3WWV A;  4DR6 L;  4BA2 I;  4DR4 L;  3I4N H;  2OCE A;  4EQ5 A;  4A3J H;  1IBK L;  1NY4 A;  4JV5 L;  1QVG A;  4KHP L;  4QJF A;  1K0R A;  1OXV A;  2LSS A;  4HJ9 A;  2CQO A;  1PH5 A;  2UUB Q;  3RNU A;  3KOJ A;  4AH6 A;  1IBM L;  2VUM G;  4IFD G;  1GM5 A;  5C4X G;  2R92 H;  2YYZ A;  1YHA A;  2CWA A;  1MJE A;  3S14 H;  4A3D H;  5FLM H;  1YJ9 A;  4DR1 Q;  3STB D;  4HJ8 A;  5C44 H;  3OYY A;  1N33 Q;  1VQP A;  3GTK H;  3HFZ B;  5IYB G;  1VQB A;  2R6G A;  2Z0S A;  3OTO L;  1N34 L;  4X6A H;  1PVO A;  2UXD Q;  2YTV A;  3S1N H;  1CSP A;  2I5M X;  4DNI A;  1S72 A;  3K0X A;  1HJP A;  2AWN A;  3L7Z C;  2R92 G;  3CC7 A;  1U0L A;  3KF6 B;  5FJ8 H;  3GTJ H;  2UUC L;  5ELO A;  3J80 c;  5C0X J;  1YHB A;  1ASZ A;  4LWC A;  4B3R Q;  5H1S E;  2XTI A;  4OXP A;  2UUA L;  2F52 A;  5JJK A;  2OTJ A;  3JAM c;  3M9B A;  4NXM Q;  2Z6K A;  4A3B G;  1KXL A;  4QIW E;  4P73 A;  3G4S A;  1KL9 A;  2MFI A;  1WOC A;  1EWI A;  4POG A;  3S2D H;  4DK3 C;  1QZH A;  3W1G A;  5M3M H;  3GO5 A;  2PI2 A;  2ID0 A;  4PZ7 A;  4YCW A;  4A3K H;  3H3V I;  2K4K A;  2NZO A;  4BBR G;  4ME3 A;  4OX9 L;  2LXJ A;  2ZM6 Q;  4DV1 L;  4OO1 G;  1XTD A;  1S3O A;  1HNX Q;  2PQA A;  1D8L A;  4DV5 L;  2K5V A;  3M7N A;  2VQF L;  2KCT A;  1K9M C;  2Z6K C;  5GAH C;  2YTX A;  4YWM A;  1LTL A;  3CP0 A;  1JB7 A;  4YCU A;  1A0I A;  4LF8 Q;  1CKO A;  1YIJ A;  2JEB I;  4H02 A;  3H0G G;  4APV A;  3VDY A;  4JI6 L;  4GOP A;  3BZK A;  3A5U A;  3NEL A;  2BA1 A;  4NXN Q;  1KAW A;  3GD7 A;  5LMN L;  2NN6 I;  1XJV A;  1KQS A;  1WI5 A;  1Q12 A;  2RCN A;  3GTL H;  2K5H A;  3UE0 A;  2K75 A;  2LXK A;  3M4P A;  2V1C C;  3ULJ A;  1KD1 C;  1EQQ A;  1YIT A;  3PUV A;  3PUY A;  2R7Z H;  2WAQ G;  4K0K L;  4YWK A;  3RLF A;  2UXD L;  2FXQ A;  4AQY L;  2B3G A;  1IXR A;  3E9I A;  1HR0 W;  1NE3 A;  4DV4 Q;  2RHS B;  4GOP C;  3UE1 A;  4GN5 A;  4DR5 Q;  1SRO A;  1L1O B;  1Y14 B;  2HT1 A;  1M90 C;  2VNU D;  1N32 Q;  1BKB A;  5IP9 H;  4HJ7 A;  3AEV A;  2VL6 A;  4X62 L;  3DLL A;  3HOV G;  3RLN A;  2QA4 A;  4DPG A;  4HIK A;  1NJI C;  2JA7 G;  1Q1B A;  2Y0S G;  2CCZ A;  2UXC Q;  4QQB X;  4B3R L;  1EUJ A;  2F3I A;  4A3M G;  1IBL L;  2R7Z G;  3GTO H;  2VQE L;  1PH7 A;  1Z9F A;  1TWG H;  1K83 H;  5IYC G;  1ASY A;  1YBY A;  4A3L G;  3F1Z A;  5C4J H;  4KI0 A;  3I55 A;  3I4M H;  1HNW L;  1CKN B;  2ALY B;  1XMO Q;  3AYH B;  1LYL A;  2I0Q A;  3AFP A;  2B29 A;  3F8T A;  2KHI A;  4FDB A;  4DV7 Q;  2ATW A;  2A19 A;  2JA5 G;  2NVT H;  2BH8 A;  2XGT A;  1YZ6 A;  2VS1 A;  3D0F A;  4IJH A;  5C0X G;  4DUZ L;  1IL2 A;  2JA6 H;  3FP9 A;  4A3F G;  4A3G G;  2VW9 A;  3PCO B;  3PO3 G;  2AHO B;  1CUK A;  1A8V A;  1Y1V H;  4QGU A;  3F2C A;  4BXX G;  4JI2 L;  1TWH H;  3NEM A;  5HY6 A;  4DK6 C;  4LF8 L;  1XMQ L;  1Z47 A;  3BU2 A;  4Y7N H;  1YHQ A;  1PH1 A;  4NXN L;  4IOA A;  4BY1 H;  3BJU A;  1EIF A;  2K50 A;  4LF5 L;  5JJI A;  2PMZ E;  2K5N A;  2B63 G;  5GRO A;  1VQI A;  3RZO H;  3HOW G;  4B3T L;  1OXT A;  1X3F A;  4AYB E;  3CCV A;  2E2H H;  4GKK Q;  2MNA A;  1QVC A;  2KBN A;  2Q2H A;  3KDF B;  2HIV A;  4NB3 A;  4A3E H;  5IE8 A;  3PGZ A;  5IWA L;  4POF A;  2YU9 H;  4BBS G;  1X9N A;  4JI4 Q;  1AE2 A;  1VQD A;  3PUZ A;  3CCM A;  2GN5 A;  1C0A A;  3PO2 G;  4DR5 L;  2VZA A;  1EIY B;  5GAG C;  3CD6 A;  1YEZ A;  4LF7 L;  4JYA Q;  3Q8D A;  1Q7Y C;  2JJQ A;  1Q82 C;  3AQQ A;  3FHW A;  1C9O A;  3W5O A;  1HNZ L;  4GKJ L;  4J15 A;  3HKS A;  4IOC A;  1Q46 A;  3T1H Q;  4JI7 L;  4RMF A;  3RR5 A;  4LF9 Q;  3TS2 A;  3RN5 A;  2UXB Q;  1JJG A;  3I7F A;  3I56 A;  3EBE A;  4L5Q A;  2RF4 A;  4X66 L;  3M85 A;  2E5L Q;  3HOV H;  1UEB A;  1A63 A;  4BY7 G;  3AFQ A;  2D0O A;  2OWO A;  4P75 A;  1XMO L;  1E22 A;  2ZJP A;  2DGY A;  3M3Y H;  4DR3 L;  3I4N G;  3TRZ A;  2R7D A;  2DUD A;  4A3J G;  3H3V H;  3FKI H;  4HIO A;  4DKA C;  5IP7 H;  5LMU Q;  4DV3 L;  1XPU A;  1OTC A;  1J5E Q;  4IJL A;  2IHF A;  2ZJQ A;  1HZA A;  3GTM H;  4A3D G;  5FLM G;  4RG1 A;  5C44 G;  3J81 j;  5HGQ A;  5AJ3 Q;  1FGU A;  1NBW A;  4DV0 Q;  4A75 A;  2N78 A;  3RLO A;  3RZD H;  1VQO A;  1VQG A;  3CCE A;  2YTY A;  1E1T A;  4MTN A;  2JA9 A;  1G51 A;  1VQJ A;  1V1Q A;  2AWO A;  4DAY B;  1I94 Q;  4IFD I;  1X3E A;  3HOU H;  2N3S A;  5FJ8 G;  3S1R H;  1VQE A;  4GN4 B;  4LUO A;  1KRS A;  1LM0 A;  3PIP A;  1K8G A;  3M4O H;  1HR0 Q;  3KF6 A;  4PZ8 A;  4DR7 Q;  4X65 L;  1SMX A;  4LFC Q;  3UDX A;  3ICE A;  1P8L A;  4JI4 L;  1XPR A;  5M3M G;  5IYD H;  1MJC A;  4A3I H;  4A3K G;  4JYA L;  1XNQ L;  1C7Y A;  1SN8 A;  5M3F H;  2N8N A;  4GLA C;  2YV5 A;  4B3M Q;  3E9H A;  2HHH Q;  1X3G A;  5E7N A;  1B8A A;  1B70 B;  4GOP B;  5JJL A;  1Q1E A;  4OWX B;  1BVS A;  4JI8 Q;  5IT9 c;  2UUB L;  3J81 c;  4JI1 Q;  4DR1 L;  3S24 A;  2Q2U A;  3J80 i;  1BBW A;  3KJP A;  1N33 L;  3HOY H;  1X55 A;  3UDF A;  1OXX K;  2JA8 H;  4IPH A;  3JAM i;  3T1Y Q;  4OO1 I;  2CKZ B;  2R93 H;  4L5S A;  3U4V A;  1L2F A;  1FJG Q;  3K80 C;  1J5E L;  1UE1 A;  1PH3 A;  4OWT B;  1GO3 E;  3CCR A;  1EYG A;  1L0W A;  4YY3 Q;  1X65 A;  1PH2 A;  3CCJ A;  4GNX A;  4A76 A;  3HOY G;  3KFU A;  2CFM A;  2NVQ H;  1VQC A;  1GKH A;  2MO0 A;  4AYB G;  1N36 Q;  1GVP A;  3A5Z B;  3CC4 A;  5IY0 A;  1VQM A;  1YJN A;  4NXM L;  1TWA H;  2UU9 Q;  3HOZ H;  1D7Q A;  2I5H A;  2WP8 J;  4LF4 Q;  1VQ9 A;  1EFW A;  2OTL A;  2MQH A;  5IP9 G;  4JBW A;  1VCI A;  3CPW A;  2ZTD A;  3HKZ E;  4DUY Q;  2F4V Q;  1SFO H;  4JI0 Q;  1DGS A;  1L1O A;  1HR0 L;  1U5K A;  4L5R C;  3CCU A;  1RIP A;  4YHH Q;  3L0O A;  3M4Q A;  2ZM6 L;  4GNX C;  1Y1W H;  1VQL A;  4DR7 L;  2EXD A;  4JCV E;  4JI3 Q;  2IY5 B;  1HNX L;  4LUZ A;  4UP8 A;  2K52 A;  5GAD C;  4DR6 Q;  1BBU A;  4JG2 A;  4DR4 Q;  3JC6 6;  3CMA A;  1X6O A;  3F2D A;  3I4M G;  5M5Y H;  1KIX A;  2KHJ A;  3K7A H;  3TEH B;  4LW1 A;  1Q86 C;  1IBK Q;  4JV5 Q;  4KHP Q;  4HJA A;  1TXY A;  4B3S Q;  1XNR Q;  2HHH L;  4PMW A;  3HOX H;  1E3P A;  3KJO A;  1YNX A;  2JA6 G;  2OQ0 A;  1V43 A;  3NBH B;  3J7A 5;  4JI8 L;  3D31 A;  3OTO Q;  1N34 Q;  2NVX H;  1Y1V G;  4JI1 L;  3SGI A;  2HIX A;  1VS0 A;  3PUW A;  4C3J H;  4BY1 G;  3TRE A;  4JBJ A;  1E1O A;  1UE6 A;  4DV4 L;  2UUC Q;  4HJ5 A;  4O0A A;  1WCM H;  2MO1 A;  1K73 C;  1FJG L;  2PNH A;  3ERS X;  2E2I H;  4UP9 A;  3F2B A;  2UUA Q;  1N32 L;  1KC8 C;  1TWC H;  5JEA J;  1IYJ B;  3CQZ H;  3NEN A;  4YY3 L;  3L2P A;  1YI2 A;  2JQO A;  2UXC L;  2ZTE A;  4A3E G;  4A3C H;  2WB1 E;  4PZ6 A;  2E2J H;  4DV2 Q;  3MXN B;  1B7Y B;  1VQA A;  3EIV A;  2PI2 E;  3STB C;  2UU9 L;  1JMC A;  3PSI A;  4OX9 Q;  4IO9 A;  1OXU A;  4JBK A;  4LUV A;  4JOI A;  1O7I A;  2D62 A;  1SRU A;  3PIO A;  2F4V L;  1JE5 A;  1QUQ A;  1GD7 A;  5C4X H;  2VQF Q;  2IX1 A;  4DV7 L;  2VUM H;  3PF4 A;  1JT8 A;  3CXC A;  2I5L X;  1CSQ A;  4GLX A;  1A62 A;  4QY7 A;  1J6Q A;  2EQS A;  2KCM A;  4TQU S;  3EN2 A;  3S16 H;  2N49 A;  1PYB A;  3GTP H;  2OQK A;  3A74 A;  3W1B A;  5IYB H;  3H15 A;  1PA6 A;  4JI6 Q;  1SR3 A;  1NTG A;  1UWV A;  1VQK A;  4C3I H;  2ZTC A;  1I50 H;  1HZB A;  4MZ9 A;  1K8A C;  1VQ5 A;  5LMN Q;  3S15 H;  2JEA I;  3KYH C;  4JOI C;  5EAY A;  4R1J A;  3CPF A;  4B3S L;  1XNR L;  3S1M H;  4LFB Q;  3FKI G;  1Q81 C;  5IP7 G;  3K81 C;  1OXS C;  3PV0 A;  1YVC A;  1VQ7 A;  3S17 H;  4K0K Q;  2JK8 A;  3MEF A;  4AQY Q;  1T9H A;  4A3B H;  1UE7 A;  1HZC A;  4PG3 A;  4GKK L;  2NZH A;  4GS3 A;  3J7Z C;  1VQ4 A;  1WYD A;  1AE3 A;  3OW2 A;  2CWP A;  4X62 Q;  1H95 A;  3CCS A;  1S40 A;  1K3R A;  2PQA B;  4BBR H;  3KLW A;  1JJC B;  3U4Z A;  1IBL Q;  4A93 H;  3HOU G;  5GQO A;  4KHZ A;  2VQE Q;  2NN6 G;  3PF5 A;  2KEN A;  4R4C A;  2VY3 A;  4MNO A;  1RL2 A;  4JI5 Q;  3HKZ G;  1X54 A;  4LF6 Q;  4HIM A;  4YWL A;  5LMN W;  1N8R C;  1PH6 A;  4KLK A;  1HNW Q;  4Y52 H;  4WJ4 A;  1FVI A;  3T1H L;  1PH4 A;  1N9W A;  4XIG S;  4LF9 L;  3CAM A;  2E8G A;  4DV2 L;  2UXB L;  1G6P A;  1E24 A;  3UDG A;  3H0G H;  3TS0 A;  4XTC S;  2E5L L;  5IYD G;  4A93 G;  1SLJ A;  2ASB A;  1NMG A;  2HQL A;  2RHQ B;  3CCQ A;  4A3I G;  5BR8 Q;  4P71 A;  5M5X H;  4C3H H;  4DUZ Q;  1JJ2 A;  5M3F G;  4WJ3 M;  1G29 1;  4LFA Q;  1VQF A;  1I6H H;  2JE6 I;  5JEA G;  4BA1 I;  3PUX A;  4DV6 Q;  3K7U C;  2AMC B;  4JI2 Q;  2Q2I A;  5LMU L;  1FL0 A;  1KHI A;  1XMQ Q;  3UDI A;  4GLV B;  1TWF H;  2A1A A;  2NVY H;  2BA0 A;  3B6Y A;  1M1K C;  4IPC A;  2GVB A;  3K8A A;  4X64 Q;  4LF5 Q;  1VQ6 A;  1X56 A;  4YCV A;  5AJ3 L;  3BZC A;  4DV0 L;  1R9T H;  1EOV A;  2JA8 G;  4DR2 Q;  1NMF A;  4C2M H;  4GNX B;  4O2D A;  2ZJR A;  4LFB L;  3S1Q H;  1SE8 A;  2AKW B;  4B3T Q;  2R93 G;  2JA7 H;  1P16 A;  3DM3 A;  1AH9 A;  1PH9 A;  3ER0 A;  4IFD J;  4A3M H;  1I94 L;  3ZJY C;  1VQ8 A;  3A0J A;  5IWA Q;  2K14 A;  1IZ6 A;  2Q2T A;  3I2Z A;  5IYC H;  4DAM A;  4A3L H;  4ALP A;  4UY8 C;  4R4T A;  2L15 A;  4AIM A;  2H5X A;  3ULP A;  1QVF A;  4LFC L;  1KRT A;  3TQY A;  1I5F A;  4LF7 Q;  1EQR A;  4UPA A;  4OWW B;  3HOZ G;  4R4I A;  1Q8K A;  2WB1 G;  4OON A;  3J81 i;  1XPO A;  4EX5 A;  1HNZ Q;  4GKJ Q;  2JA5 H;  3G48 A;  4NPS A;  2IX0 A;  1QZG A;  1MKH A;  4JI7 Q;  3CC2 A;  2BH2 A;  1PH8 A;  3GTQ H;  4A4I A;  1IBM Q;  4JI5 L;  1CKN A;  1WFQ A;  4X66 Q;  4A3F H;  4B3M L;  3IRB A;  4A3G H;  1L1O C;  3GDE A;  5ELN A;  2R7F A;  1Y1W G;  3CCL A;  4LF6 L;  3PO3 H;  1E7Z A;  1UE5 A;  1PYS B;  4BXX H;  1I3Q H;  3CF5 A;  4DR3 Q;  3U50 C;  2ES2 A;  3KF8 B; 
#chains in the Genus database with same CATH topology
 1TII D;  4IUT A;  1BF4 A;  5DNF A;  2QGQ A;  3D6W A;  4BS9 A;  4G57 A;  1EFI D;  4DV6 L;  4HN7 A;  3H09 A;  3HOW H;  1CK1 A;  3IFT A;  4X3S A;  2CHB D;  2ZT9 C;  1X3Q A;  4BBR B;  1UUP A;  3FRP B;  2HCI A;  2XIW A;  1HQR D;  3SK5 A;  2GVA A;  1SMY D;  1EYC A;  3KK7 A;  3PO2 H;  1TY2 A;  4K5W A;  1VQN A;  1XYI A;  1F2Z A;  1GHJ A;  1VQH A;  3CW2 C;  1WCM G;  1WD0 A;  4A3K B;  4LF4 L;  3N52 A;  1D2B A;  3H0G B;  3BVZ A;  5J22 A;  4IPD A;  5EBC A;  5M5W H;  2EYP A;  4C3H B;  5E1F A;  2HD3 A;  1QUQ B;  4JPB W;  1HH2 P;  2PZW A;  1AEX A;  4EQ5 A;  4A3J H;  2K7V A;  4ME5 A;  2MJ8 A;  2NVY B;  1QVG A;  4KHP L;  1OXV A;  2A5H A;  2UUB Q;  1IBM L;  2YYZ A;  1YJ9 A;  4HJ8 A;  1EEI D;  5L37 A;  1N33 Q;  3HFZ B;  4X6A H;  3OTO L;  3IAY A;  4CDF C;  5CV7 A;  3S1N H;  1CSP A;  3R93 A;  2F0T A;  4IZ8 A;  1HJP A;  1II3 A;  1PMR A;  2R92 G;  5FJ8 H;  2B39 A;  2L11 A;  4FNF A;  4K14 A;  3H6M A;  4HTH A;  4LWC A;  5H1S E;  2XTI A;  1VF5 C;  2RCF A;  2F52 A;  4DAY A;  2JA5 B;  4QIW E;  2XRQ D;  4POG A;  1WOC A;  1RHP A;  5JVH 3;  4DK3 C;  1SJH D;  1EY8 A;  1IW7 D;  1IKM A;  5IT9 E;  2N88 A;  2K5Q A;  3EVQ A;  2EY1 A;  1ZXT A;  1RDP D;  2NZO A;  4BBR G;  1O7L A;  2LXJ A;  2HUG A;  3SEB A;  3VR6 A;  2WV6 D;  2PQA A;  1D8L A;  2KCT A;  4EQO A;  1RD9 D;  3CP0 A;  4YCU A;  1S5C D;  4LJZ C;  4KN7 C;  1F9R A;  3H0G G;  1YNJ C;  3VDY A;  4JI6 L;  3HOW B;  4FYD A;  3K57 A;  1EU3 A;  3GD7 A;  4C3H G;  2RCN A;  1IYU A;  2V4D A;  2LXK A;  3PO2 B;  3U9S A;  3ULJ A;  2OT2 A;  1KD1 C;  4HR7 B;  4KV6 A;  5JOB A;  2FXQ A;  1IXR A;  1LTI D;  2O5I C;  4DA2 A;  2RHS B;  1F2Y A;  3GV3 A;  4GN5 A;  5M5W B;  1PFB A;  2HT1 A;  1N32 Q;  5IP9 H;  3DLL A;  2PNR C;  4HIK A;  1K8O A;  1Q1B A;  2UXC Q;  3NK9 A;  5IGE A;  1IBL L;  3Q6S A;  1Z9F A;  4N8X 1;  4NW2 A;  2A68 C;  5IYC G;  4A3J B;  1TR5 A;  1YBY A;  1YNN C;  3I55 A;  3AFP A;  4FDB A;  2A19 A;  2JA5 G;  5C4Z A;  3D0F A;  5C0X G;  1KNE A;  3DEP A;  3EA6 A;  5G3L D;  1A6X A;  1Y1V H;  3TP8 A;  2A74 C;  4BXX G;  4DK6 C;  1I4P A;  3NEM A;  1V8Q A;  5T1I A;  1STE A;  3HG9 A;  4Y7N H;  4IOA A;  2K50 A;  3ITP A;  4ID6 A;  3RZO H;  1X3P A;  3HOW G;  2E2H H;  2MNA A;  2Q2H A;  2HIV A;  4NB3 A;  4KTA A;  5IE8 A;  2YU9 H;  3QOJ A;  1LTA D;  1D1K A;  4POF A;  4JI4 Q;  4G7O C;  1HHV A;  3PUZ A;  1C0A A;  3PO2 G;  4CKE A;  2VZA A;  5CGK A;  3CD6 A;  4JYA Q;  4LF7 L;  4FF2 A;  2JJQ A;  3AQQ A;  3FHW A;  1C9O A;  1V1O A;  1HNZ L;  4J15 A;  3MXN A;  1O7Y A;  3HKS A;  2AQ2 B;  2RBM A;  4JI7 L;  4LF9 Q;  3TS2 A;  3RN5 A;  4X66 L;  3M85 A;  4QUF A;  3HOV H;  5EPJ A;  1UEB A;  3AFQ A;  1E22 A;  1F77 A;  3M3Y H;  2PMZ B;  3TRZ A;  4ABN A;  2R7D A;  4A3J G;  3FKI H;  4N9P A;  5CV4 A;  4AYB B;  4DKA C;  2L5T A;  4DV3 L;  1WTQ A;  3DWA A;  2ICI A;  2IHF A;  3A8K E;  1PRT C;  3ZYY X;  1KAA A;  2F3W A;  3P1H A;  1FNU A;  2B8G A;  1V1Q A;  2AWO A;  2HDL A;  1TWA B;  1X3E A;  5FJ8 G;  4GN4 B;  3G7L A;  1SMX A;  5K5P A;  5KYI A;  4LFC Q;  5BN3 A;  3OSO A;  4JI4 L;  2F0O A;  5IYD H;  4PNY A;  4JYA L;  1XNQ L;  1Y1V B;  2MUY A;  4XQJ A;  1STY A;  2X6G A;  2WAC A;  4Y7N B;  5COY A;  4GOP B;  4IUN A;  2PZU A;  4OWX B;  2KED A;  5J1Z A;  4JI1 Q;  3C1F A;  4DR1 L;  3NPP A;  2KVM A;  3J80 i;  1BBW A;  2LFN A;  2RSN A;  3HOY H;  5NUC A;  3F2U A;  2E2H B;  1PTO C;  3JAM i;  1EOT A;  1TU2 B;  2CKZ B;  2YU9 B;  3U4V A;  1DCZ A;  3K80 C;  4RHR A;  1PH3 A;  1GO3 E;  1C8C A;  1EYG A;  1X65 A;  1V1P A;  4GNX A;  2EJG C;  2MO0 A;  4AYB G;  1N36 Q;  1GVP A;  3I8Z A;  1VQM A;  2A6E D;  1B44 D;  1VQ9 A;  1HUN A;  1I4X A;  5IP9 G;  3R2I A;  2KUM A;  3HKZ E;  1SFO H;  4JI0 Q;  1L1O A;  4L5R C;  5IGB A;  3CCU A;  4C1N I;  2ZM6 L;  1VQL A;  3M3Y B;  3WOF A;  2EXD A;  3QO2 A;  3I91 A;  2K52 A;  4JG2 A;  3NWT A;  1GUO A;  4TKO B;  3GTP B;  3TME A;  4RH6 A;  1IBK Q;  3ERQ A;  4RHS A;  2FMC A;  1E3P A;  2OF1 A;  1YNX A;  2WIN B;  3KJO A;  3CRK C;  3AU7 A;  3D31 A;  5EKL A;  1Y1V G;  2PYK A;  4J8Q A;  4JI1 L;  2VXW A;  1FNV A;  4EGV A;  1LV9 A;  2HIX A;  5BN5 A;  2FFK B;  1QWY A;  2OXP A;  3TRE A;  4ZCK A;  1E1O A;  2UUC Q;  4O0A A;  5EKK A;  3ERS X;  4K5V A;  2WKD A;  3DUZ A;  4UP9 A;  3F2B A;  1HTL D;  4XT3 B;  5JEA J;  1IYJ B;  1YI2 A;  3OIQ A;  2Q8T A;  2WB1 E;  4RAU C;  4OX9 Q;  3BYY B;  2IX3 A;  4IO9 A;  1OXU A;  2H4O A;  2D5D A;  5C4X H;  3TBI B;  3CXC A;  2I5L X;  2KCM A;  2EXZ A;  2N49 A;  3LWU A;  4FVM A;  1VMP A;  1STA A;  2EY6 A;  5E4W C;  3HOV G;  1VDZ A;  1LLR D;  1VQK A;  3J80 L;  1G8Z D;  2ZTC A;  1K8A C;  3S9W A;  4CGY B;  1CI3 M;  3JAM L;  5C5M A;  3S1M H;  4RWS C;  3FKI G;  3NTI A;  1Q81 C;  5EKI A;  1BDO A;  1YVC A;  1F2M A;  3MAQ A;  4E6I A;  4AQY Q;  5D14 A;  4A3B H;  3D4R A;  1HZC A;  4PG3 A;  3TP6 A;  1VQ4 A;  1WYD A;  2F1M A;  2DY8 A;  3C3L A;  4OIK A;  3OW2 A;  3CCS A;  3AB9 A;  1KAB A;  4A93 H;  5D65 A;  2ZXP A;  3E3X A;  2KEN A;  1G2S A;  4R8I A;  1RL2 A;  4LF6 Q;  1HNW Q;  3DWP A;  3GTQ B;  4Y52 H;  1VF7 A;  1N9W A;  4CJ0 B;  3TSS A;  1SNC A;  4DK0 A;  3TS0 A;  1EY7 A;  5IYD G;  1CHQ D;  3V96 A;  5I6Y A;  5M5X H;  2RVL A;  1JJ2 A;  3GQB A;  2DN8 A;  1VQF A;  4S3S A;  4WRD A;  1AZQ A;  4IUR A;  3ERO A;  2AMC B;  4JI2 Q;  2Q2I A;  1FL0 A;  1KHI A;  4GLV B;  3S2H B;  4ZUI A;  4IPC A;  1PYW D;  2RDF A;  1ENF A;  4DV0 L;  3VR4 A;  3T16 A;  4DR2 Q;  5CMD A;  1NMF A;  4C2M H;  1JE4 A;  2ZJR A;  3S1Q H;  2AKW B;  1EZ6 A;  2JA7 H;  3DM3 A;  3E6Z X;  1I94 L;  3R8B A;  1A3U A;  1VQ8 A;  1IZ6 A;  3MC0 B;  1GUN A;  4DAP A;  1DJR D;  5T1G A;  4UY8 C;  4AIM A;  2XN9 C;  3BDO A;  1QVF A;  4QB4 A;  5C4X B;  1KRT A;  1EL0 A;  1EQR A;  4DXG A;  3DMU A;  1HFN A;  1TQO A;  1QZG A;  3CC2 A;  4PQX A;  3IKJ A;  4A4I A;  1CKN A;  4A3G H;  2Z4I A;  4LF6 L;  3KLS X;  3CCL A;  3K5L A;  1I3Q H;  3S1M B;  3U50 C;  5I2Y A;  2RSO A;  1ROD A;  4HCS A;  2C35 B;  4ZKB B;  1V9P A;  4R4Q A;  4A3B B;  4XT1 B;  3G6E A;  2LY7 A;  1PFS A;  3CME A;  3I4O A;  2B63 H;  5C0X I;  3U9O A;  2MPM A;  2NBF A;  1E2V A;  4L5T A;  1ENC A;  4GN3 B;  4DR2 L;  4CDC C;  2Y0S E;  1MGS A;  5M3M B;  2A8V A;  3OOC A;  4DV1 Q;  4LNQ A;  4X65 Q;  4P72 A;  1PXU A;  1PRT B;  4DUY L;  2WKC A;  5GAE C;  5M5X B;  5FLX c;  1H9S B;  3SK4 A;  4JI3 L;  4BY7 H;  1RJT A;  3E0E A;  4JC0 A;  3J7Y W;  4JVZ A;  3QG1 A;  3URY A;  3I4N H;  2G9H D;  4QJF A;  1PH5 A;  3QWN A;  5C4X G;  4AH6 A;  4OL7 A;  2R92 H;  1D5M C;  3S14 H;  4BWG B;  4C2M B;  3GTL B;  1VQP A;  4HAE A;  1VQB A;  2F0I A;  1N34 L;  4CDE C;  2YTV A;  5KNC A;  4Q5V A;  3K0X A;  3MTS A;  5I9O A;  1U0L A;  3KF6 B;  5DM6 3;  1ASZ A;  5C0X J;  1YHB A;  1EQT A;  1Y8P B;  4OXP A;  2UUA L;  3IL8 A;  2Z6K A;  4A3B G;  2A69 C;  3G4S A;  2EYH A;  2I07 B;  1TWG B;  3NUC A;  1QZH A;  1A3V A;  2PI2 A;  4A3K H;  2K4K A;  2K28 A;  2F0P A;  4XQN A;  4DV1 L;  1XTD A;  1HNX Q;  1LT3 D;  4K6D A;  2NVT B;  1X32 A;  4ZYS A;  3M7N A;  1KDB A;  2J0T D;  5GAH C;  2YTX A;  5CV8 A;  1PRT F;  1RTO A;  4YWM A;  3NBI A;  1LTL A;  2B63 B;  1YIJ A;  4APV A;  2A6H C;  3NEL A;  2BA1 A;  2A69 D;  3I73 A;  2D2C C;  4EVO A;  3VA7 A;  1KQS A;  5JAV A;  1KTK A;  1Q12 A;  1FYC A;  2K75 A;  1SYE A;  1B4O A;  2V1C C;  3M4Y A;  4QIW B;  3PUY A;  4O42 A;  3WOE A;  4K0K L;  5ELC A;  3RLF A;  2K01 A;  1NE3 A;  2F0W A;  4DV4 Q;  4GOP C;  1F2L A;  1GUG A;  3MWY W;  4DR5 Q;  1SRO A;  1M90 C;  1BKB A;  1SYF A;  4UAI A;  4X62 L;  3RLN A;  2JA7 G;  1G2T A;  4QQB X;  2CQA A;  3HGB A;  5KEE A;  2BDN A;  5LL6 S;  4LMQ D;  5IOD A;  3GTO H;  3I4N B;  5C0X H;  2FJ2 A;  1EYD A;  3I4M H;  1LYL A;  1Q8I A;  3S14 B;  1IYV A;  3EQL C;  2B29 A;  4DV7 Q;  2KHI A;  3LNN A;  2BH8 A;  1YZ6 A;  3SHL A;  1IL2 A;  4DUZ L;  2JA6 H;  1SNM A;  2KOL A;  4A3G G;  2VW9 A;  2EPB A;  3PCO B;  5IGF A;  1HQM C;  1CUK A;  1Z6H A;  4KY5 A;  1CZW A;  3F2C A;  1MI2 A;  4QUC A;  1Z7T A;  1Z47 A;  3BU2 A;  2NTS A;  1PH1 A;  3BVG A;  3NBH A;  1JOQ A;  4G7Z C;  3BJU A;  1CFM A;  4H13 C;  4LF5 L;  3KF8 A;  5KND A;  4CJ1 B;  2K5N A;  2B63 G;  1ENA A;  4OEM B;  4FO2 A;  1DD2 A;  4B3T L;  1X3F A;  5FO7 B;  1QNU A;  1K0S A;  5IWA L;  2RQX A;  3TZD A;  5JPM C;  3CCM A;  2L1B A;  4XDX A;  2BE5 C;  4DR5 L;  1LAB A;  1EIY B;  1YEZ A;  3Q8D A;  1O80 A;  4Z9C B;  3W5O A;  4M1U B;  3T56 B;  4RMF A;  3RR5 A;  2UXB Q;  3EBE A;  4DF7 A;  1WVL A;  2L55 A;  1NCV A;  5C5L A;  5M9O A;  2Z4H A;  4BY7 G;  3I70 A;  1GOZ A;  1CA5 A;  2DGY A;  4DR3 L;  3I4N G;  2EYM A;  2NYZ D;  2DUD A;  3Q22 A;  3KLS A;  1T5X D;  1J5E Q;  1MHW C;  2EE1 A;  5COR A;  4F8M A;  3SE0 A;  5AJ3 Q;  1BCP B;  1NBW A;  2B2W A;  4ZK9 B;  1VQG A;  5IGD A;  2YTY A;  1SXT A;  4MTN A;  2JA9 A;  1TS3 A;  3GTO B;  1VQJ A;  4DAY B;  4WOR A;  2F0F A;  1DOM A;  4IFD I;  3S1R H;  4ZLT F;  3HOZ B;  4LUO A;  4CBV A;  5DM7 3;  3I4M B;  4HCE A;  1VMC A;  4PZ8 A;  3OWF A;  1PZJ D;  1U4R A;  2QCP X;  5KRU A;  2K32 A;  2KJX A;  2R61 A;  3FMC A;  1XPR A;  2JA6 B;  4QCL A;  1JWU D;  1EY4 A;  4A3K G;  1O78 A;  3A8I E;  5IIF A;  4XQQ A;  2HHH Q;  4HSV A;  4ILW A;  1Q1E A;  2UUB L;  1EU4 A;  4JI8 Q;  2B2V A;  3J81 c;  4DNR B;  1EY0 A;  2Q2U A;  3KJP A;  2EZV A;  1N33 L;  1OXX K;  1JC7 A;  2NWG A;  4IPH A;  3T1Y Q;  4OO1 I;  2AQ1 B;  2EY2 A;  2R93 H;  4L5S A;  1L2F A;  1FJG Q;  1I4R A;  1J5E L;  4OWT B;  3CCR A;  2E2I B;  3CCJ A;  1YNJ D;  2CFM A;  1LTS D;  3CQZ B;  2DNC A;  3CC4 A;  1TWA H;  1BCP F;  2CW0 C;  1NUC A;  2I5H A;  2F0L A;  2OTL A;  5I6W A;  3BDL A;  1T5E A;  1RIP A;  2IJ0 A;  4YHH Q;  1L0Y B;  5KNB A;  1Y1W H;  1RKN A;  4JCV E;  4LUZ A;  5GAD C;  4DR6 Q;  1BBU A;  4DR4 Q;  3JC6 6;  1C4Q A;  3GP7 A;  3I4M G;  1AN8 A;  2KHJ A;  3K7A H;  3TEH B;  4LW1 A;  4JV5 Q;  2I46 A;  1TXY A;  4QMG A;  3S15 B;  1AFP A;  4B3S Q;  1BR9 A;  2HHH L;  2A68 D;  2JA6 G;  1CZG A;  1YNN D;  5C3W A;  1LTR D;  4JI8 L;  2J7Z A;  1QB5 D;  3S1R B;  3PUW A;  3FPP A;  4C3J H;  5K36 H;  1TS5 A;  3HKZ B;  5FLX E;  4ZAI A;  2MO1 A;  1K73 C;  1FJG L;  1N32 L;  2VB2 X;  5KGU A;  2UXC L;  3I4L A;  1DYQ A;  1HPC A;  1ICF B;  2WII B;  1GUS A;  2DNE A;  2ZTE A;  4I65 A;  1GXD C;  4PZ6 A;  3MXN B;  3PQI A;  3MA2 B;  1VQA A;  4MIU A;  1B53 A;  2CH4 W;  3STB C;  1U9R A;  2EJM A;  3PSI A;  1SEB D;  4KK7 A;  3W3A A;  4ZRZ A;  4LUV A;  4JOI A;  1O7I A;  2IPK D;  1K3B C;  3QOL A;  1GUT A;  2VUM H;  2VQF Q;  4IFD H;  4KKS A;  1XTC D;  1QIL A;  4RGT A;  1CSQ A;  4V0B A;  4F7X A;  2F0K A;  1ONL A;  2DJG C;  3EN2 A;  3GTP H;  5IYB H;  3OPO A;  1MSG A;  1PA6 A;  2R93 B;  1SR3 A;  2OEO A;  1IL8 A;  4C3I H;  4DNT B;  5LMN Q;  5EAY A;  4R1J A;  3WDN A;  4B3S L;  1ET6 A;  4LFB Q;  4P2C B;  2ZXR A;  5JVG 3;  1VQ7 A;  2O5J C;  5BN4 A;  2WB1 B;  3MEF A;  3O13 A;  1T9H A;  3PIP 3;  1TY0 A;  1JR0 D;  1HUM A;  1D6E C;  1QE6 A;  3MEH A;  2CWP A;  1Y1W B;  4HMJ A;  3DXJ C;  4J1M A;  3U4Z A;  4OO1 H;  1PRT D;  2VQE Q;  1K8M A;  3PF5 A;  3K7A B;  2VY3 A;  1I6V C;  4JI5 Q;  4DAV A;  3C46 A;  2Q8R E;  3HKZ G;  1X54 A;  4TSS A;  1NSN S;  4HIM A;  4YWL A;  1PFM A;  1PH6 A;  5DAU A;  4WJ4 A;  1FVI A;  4DR3 Q;  4XIG S;  4LF9 L;  2E8G A;  1E24 A;  3MXP A;  3DHQ A;  4XTC S;  5I9P A;  2G9D A;  1NMG A;  2RHQ B;  4HED A;  2PZT A;  2B2Y A;  2KEC A;  5CV5 A;  3T13 A;  2JE6 I;  1W6J A;  4Q0F A;  1JQY D;  2XNA C;  3K7U C;  4C3J B;  1XMQ Q;  3UDI A;  2SOB A;  1M1K C;  5C3E B;  1V1P B;  4GNX B;  2F0M A;  2EYJ A;  4WJW A;  3QR8 A;  4LFB L;  3D8G A;  2R93 G;  3Q23 A;  1C48 A;  3VYS A;  4KY6 A;  2K14 A;  2BOS A;  4I7Z C;  5CC4 A;  3SK6 A;  4ALP A;  1PTO D;  4CKC A;  4K6L A;  2VUM B;  3R3O A;  4LFC L;  5CV9 A;  2EYL A;  3H94 A;  4OWW B;  4R4I A;  1Q8K A;  1SYG A;  2WB1 G;  4GKJ Q;  2LKV A;  4RA8 A;  3G48 A;  2KHS A;  2XWB B;  2BH2 A;  4C3I B;  3GTQ H;  4JK1 C;  4JI5 L;  1WFQ A;  1Y1W G;  1UNS A;  5ELN A;  2KCN A;  3MZ5 A;  4IUU A;  2F0H A;  2E2D C;  1EY9 A;  4DK1 A;  3GTK B;  5DLQ E;  3G71 A;  1D1I A;  4P74 A;  1QG7 A;  3D3R A;  1BQQ T;  2LMC B;  4KY7 A;  5EJW A;  3U58 A;  1BNZ A;  3S2H H;  1BUV T;  2WAQ E;  3EFX D;  2L9H A;  5ISR A;  4IPG A;  3GTJ B;  3NP8 A;  5CYU A;  5HGT A;  1MIU A;  4DFA A;  1PHJ A;  3SK8 A;  2D0P A;  1YJW A;  3H3V C;  5EQ0 A;  1N36 L;  4C3J G;  5K36 G;  1PV4 A;  3KDF A;  1W6K A;  5C3E G;  1WJJ A;  3GTG H;  3A56 A;  1STG A;  4DV5 Q;  1LUZ A;  3PIO 3;  1W3S A;  4JI0 L;  3BVM A;  1EQV A;  1B3Q A;  2WFW A;  3RN2 A;  3ND9 A;  4BA2 I;  3E0J A;  1IBK L;  4HJ9 A;  2LSS A;  2CQO A;  4H0L C;  2VUM G;  4IFD G;  3OHX C;  1MJE A;  3SDZ A;  1WTP A;  5IGG A;  3TP5 A;  5C44 H;  3MVV A;  5IYB G;  2Z0S A;  4R8N A;  4C3I G;  2Y0S B;  2UXD Q;  1BXT A;  2R7Z B;  1S72 A;  5KYL A;  3CC7 A;  3K5O A;  2CVR A;  3NTH A;  2UUC L;  3J80 c;  1B2T A;  4B3R Q;  2TSS A;  5JJK A;  2OTJ A;  3JAM c;  4NXM Q;  1F9S A;  3VR5 A;  1LO5 D;  4K8J A;  1KL9 A;  2MFI A;  1EWI A;  1K83 B;  1S5E D;  5M3M H;  3GO5 A;  5IT9 L;  4PZ7 A;  3H3V I;  3J81 E;  5DEH A;  1BCP C;  1JB3 A;  4ME3 A;  4OX9 L;  2R3Z A;  3I72 A;  4OO1 G;  1S3O A;  4NMZ A;  3TDQ A;  4DV5 L;  4H44 C;  1XXG A;  2K5V A;  1K9M C;  1JB7 A;  1A0I A;  1F9Q A;  1CKO A;  2JEB I;  2AQ3 B;  4H02 A;  1TWH B;  3A5U A;  4MN3 A;  4NXN Q;  1LT4 D;  1UAP A;  1WTX A;  2NN6 I;  1XJV A;  1WI5 A;  3UI2 A;  3GTL H;  2DY7 A;  2K5H A;  2XVS A;  3W2D A;  1RCV D;  3VYR A;  1YIT A;  3PUV A;  1U4L A;  4YWK A;  1A3T A;  1NR2 A;  2UXD L;  4AQY L;  2B3G A;  3E9I A;  3GTG B;  5FOB B;  1QCB D;  3UE1 A;  1Y14 B;  3AEV A;  2VL6 A;  3QJY A;  4DPG A;  1NJI C;  2Y0S G;  2CCZ A;  4B3R L;  1EUJ A;  2F3I A;  2R7Z G;  1PH7 A;  1TWG H;  1ASY A;  5C4J H;  2QIL A;  4OGQ C;  1HNW L;  1CKN B;  2ALY B;  2RKS A;  1FGB D;  3AYH B;  2I0Q A;  1BO0 A;  3T51 B;  3TZU A;  4O1N A;  5FK9 C;  4XXE A;  5C44 B;  2NVT H;  2VS1 A;  1PDQ A;  2JN4 A;  3Q24 A;  2E74 C;  2AHO B;  1A8V A;  4KD3 A;  5D3I B;  4JI2 L;  3GTM B;  5HY6 A;  2MP1 A;  3TN2 A;  3DM1 A;  3OWE B;  3CRL C;  4NXN L;  4HSP A;  4BY1 H;  1EIF A;  4PMB A;  1CQF A;  1CA6 A;  4RCO A;  4U67 3;  5JJI A;  3P20 A;  1VQI A;  1OXT A;  4GKK Q;  1QVC A;  2KBN A;  2O4X A;  4H7B A;  1IHZ A;  1QJO A;  1DOK A;  3LWE A;  4A3E H;  2F4I A;  3P7J A;  1E2Z A;  1X9N A;  1VQD A;  2GN5 A;  1I4H A;  4DU9 A;  1SE3 A;  4ODG A;  5I2X A;  1Q82 C;  1S5B D;  1NR4 A;  4IOC A;  3T1H Q;  1JJG A;  4V19 0;  4L5Q A;  2RF4 A;  2E5L Q;  2EJF C;  1O7Z A;  2OWO A;  4P75 A;  2JXM B;  2X6L A;  1H9S A;  4B08 A;  2VB3 X;  1ILQ A;  3H3V H;  2F0J A;  5FO8 B;  5IP7 H;  5LMU Q;  1XPU A;  1OTC A;  4IJL A;  1FR3 A;  2F0S A;  3J7A F;  2O2L D;  5C44 G;  3J81 j;  5HGQ A;  1FGU A;  4A75 A;  3HZX A;  2K05 A;  2N78 A;  3FVQ A;  3RLO A;  3RZD H;  1HFG A;  5C6A A;  3BYT B;  1HXY D;  2X69 A;  2N3S A;  1VQE A;  5C4J B;  2NN6 H;  1WTV A;  2BCO A;  4RKL A;  1Y8O B;  3GV6 A;  1AW7 A;  3KF6 A;  4DR7 Q;  4X65 L;  3RUZ A;  1SBB B;  1XX8 A;  3ICE A;  4I7A A;  3UDX A;  1P8L A;  1STH A;  2B2T C;  2P5Z X;  2B2U C;  2IL8 A;  5M3M G;  4A3I H;  4IQZ A;  1SN8 A;  4B3M Q;  3G6J B;  1X3G A;  3RMH A;  4FF1 A;  5JJL A;  5KIX A;  4BY1 B;  1I4Q A;  4YIJ A;  1Q3L A;  3S24 A;  2MHV A;  3UDF A;  2JA8 H;  1G6Z A;  3D4D A;  3VR2 A;  2NTT A;  1ZEQ X;  1WTO A;  1JIC A;  4QF4 A;  4A3E B;  3V05 A;  1ML0 D;  3MXG A;  1HCZ A;  2F03 A;  1UE1 A;  2M00 A;  1WTH A;  5I4D A;  4YY3 Q;  1PH2 A;  2A6H D;  1TWC B;  1OO9 B;  1VQC A;  1SE2 A;  3A5Z B;  1K28 A;  2UU9 Q;  3ND8 A;  3HOZ H;  1D7Q A;  4NDX A;  3NQT A;  2E2J B;  4LF4 Q;  5FO9 B;  1EFW A;  2MQH A;  1VCI A;  3CPW A;  2ZTD A;  1DGS A;  1JWS D;  3M4Q A;  3NXW A;  4GNX C;  4DR7 L;  5A2Q E;  3NTK A;  1HNX L;  2F0V A;  2EOT A;  3CMA A;  1X6O A;  3F2D A;  3S16 B;  1KIX A;  1Q86 C;  4KHP Q;  2J4X A;  2E75 C;  2ZXO A;  1CT1 D;  3RZD B;  1SMY C;  2AUJ D;  3HOX H;  3NBH B;  1ILP A;  3OTO Q;  1LT6 D;  4IAL A;  2NVX H;  1A15 A;  5CV6 A;  3SGI A;  1VS0 A;  5TSS A;  4OEL B;  4BY1 G;  4DV4 L;  1UE6 A;  4LAA A;  4HJ5 A;  2E2I H;  2PW5 A;  2F0G A;  1JCK B;  3CQZ H;  4YY3 L;  3L2P A;  1ZYR C;  4A3I B;  2JQO A;  2AUK A;  4A3E G;  4KJN A;  4A3C H;  4EQN A;  2D9U A;  2H1E A;  2UU9 L;  1A2U A;  2PI2 E;  1JMC A;  3HEJ A;  3E5S A;  4ZKC B;  4JBK A;  1SRU A;  1CQV A;  1QUQ A;  2IX1 A;  1EY5 A;  4DV7 L;  4GZY C;  1JT8 A;  1A62 A;  2JA8 B;  1D5Z C;  1J6Q A;  2EQS A;  4TQU S;  1I6H B;  1DON A;  2BE5 D;  2EYF A;  2DJF C;  2OQK A;  3H15 A;  1LAC A;  2SNS A;  4JI6 Q;  3J80 E;  3KBX A;  3L3O C;  1VQ5 A;  4IUQ A;  3S15 H;  1ZYR D;  3K5M A;  2XRS D;  2JEA I;  3KUP A;  3KYH C;  3JAM E;  1AZP A;  1U4M A;  2L0C A;  3CPF A;  1IW7 C;  1EWH A;  5IP7 G;  3K81 C;  4CHT B;  1OXS C;  1ZKO A;  4FXG C;  3T4A C;  3S17 H;  1H9J A;  3KBG A;  1R4P B;  4XYO A;  1I4G A;  2FIN B;  1Y69 U;  1UE7 A;  4EQP A;  2NZH A;  2K1B A;  3J7Z C;  1QNK A;  1S40 A;  4RGO S;  1K3R A;  2EYO A;  2PQA B;  3KLW A;  1IBL Q;  4PMC A;  1EWC A;  4KHZ A;  2NN6 G;  4B9X A;  3OW7 A;  4MNO A;  5EPK A;  4ZQ3 A;  5LMN W;  1SYB A;  2IWH A;  5E3F A;  4KLK A;  3C2P A;  1PH4 A;  3CAM A;  2UXB L;  3J81 L;  3HOX B;  1TS2 A;  1KLU D;  4A3I G;  4FXK C;  1CM9 A;  2K33 A;  5BR8 Q;  1ET9 A;  4FF3 A;  2NVX B;  2L12 A;  2QKI C;  2ENB A;  4CJ2 C;  1G29 1;  4LFA Q;  3EJI A;  3FDT A;  3V2T A;  2PPB C;  4K2L A;  1GUW A;  1TWF H;  2A1A A;  3B6Y A;  1H9M A;  2GVB A;  4UDU C;  4CKB A;  3K8A A;  3M7G A;  4X64 Q;  1IKL A;  5AJ3 L;  3BZC A;  1R9T H;  2JA8 G;  1EOV A;  2SNM A;  4L8J A;  2K5W A;  1XWE A;  2QDL A;  1AH9 A;  3ER0 A;  4IFD J;  4A3M H;  3A0J A;  3K58 A;  3I2Z A;  4A3L H;  1LTG D;  4R4T A;  2H5X A;  3ULP A;  4NKL A;  4JW0 A;  3TQY A;  1I5F A;  4LF7 Q;  4OIJ A;  1SYD A;  3HOZ G;  1EYA A;  1HNZ Q;  3QIA A;  2NUC A;  4MTK A;  2B8F A;  3DEO A;  4NPS A;  3VYT A;  4JI7 Q;  2K03 A;  4A3F H;  4X66 Q;  3PO3 H;  3GDE A;  2R7F A;  2CW0 D;  2QDB A;  4K5X A;  1UE5 A;  2KQ3 A;  2F0D A;  4HMI A;  1H95 A;  2ES2 A;  1PLF A;  1U4P A;  2IHE A;  3S17 B;  5BR8 L;  3A54 A;  4G4K A;  4L63 B;  4DV3 Q;  3S1N B;  3OIP A;  2QEX A;  4LFA L;  5JPN C;  3T1Y L;  1CKM A;  1STB A;  3HOX G;  1JOR A;  2EIF A;  3LGJ A;  5C3E H;  1WTR A;  4BBS H;  4KJO A;  4X64 L;  2IT1 A;  1HZ9 A;  1MSH A;  4JBM A;  2Z1C A;  1SDF A;  4HID A;  2K04 A;  4IUV A;  3ULL A;  4QL5 A;  4UP7 A;  5ELD A;  5D3D A;  4R4O A;  1PFN A;  5J3B A;  4YHH L;  1PZK D;  4KKU A;  4A3C G;  1W2B A;  1J9O A;  4MHE A;  4TVA B;  1XNQ Q;  1BBX C;  3WWV A;  4DR6 L;  3X3N A;  4DR4 L;  2OCE A;  2QEJ C;  2FMM A;  1TWF B;  1NY4 A;  1QOH A;  2WAQ B;  1KDA A;  4JV5 L;  1K0R A;  3RNU A;  3KOJ A;  1GM5 A;  1YHA A;  2CWA A;  1R9T B;  3TP7 A;  4A3D H;  5FLM H;  2IW3 A;  4DR1 Q;  3STB D;  1B3A A;  3OYY A;  3GTK H;  2R6G A;  3MHB A;  1PVO A;  1B1Z A;  1SNQ A;  4A3M B;  2I5M X;  1TT2 A;  4DNI A;  1SND A;  4RGM A;  2AWN A;  2SDF A;  3L7Z C;  1PZI D;  2M9V A;  3GTJ H;  5ELO A;  4ULL A;  2B2T A;  3RD4 A;  1G91 A;  3M9B A;  2B2U A;  5J39 A;  1KXL A;  2TMP A;  4P73 A;  3S2D H;  4B9W A;  3W1G A;  4KN4 C;  4PV1 C;  4X3K A;  4A3F B;  2ID0 A;  4YCW A;  3PO3 B;  5FKA C;  2ZM6 Q;  1J8I A;  5LL6 X;  2VQF L;  4DN4 M;  2Z6K C;  1KLG D;  4K8I A;  1GHK A;  3C1E A;  4LF8 Q;  2JSO A;  4GOP A;  3BZK A;  1KAW A;  5LMN L;  2A6E C;  4BBS B;  3UE0 A;  3M4P A;  1L0X B;  1A2T A;  1LT5 D;  1EQQ A;  2R7Z H;  3N6R A;  3RZO B;  2WAQ G;  4KHV A;  1HR0 W;  4DXF A;  1LTT D;  5ELE A;  1L1O B;  1GJX A;  2VNU D;  2EY5 A;  3A8J E;  3MXU A;  4HJ7 A;  3D4W A;  3HRZ C;  2QA4 A;  3A7L A;  1B9M A;  3CKI B;  4A3M G;  2VQE L;  3ONA B;  5EPL A;  1K83 H;  4A3L G;  3F1Z A;  4KI0 A;  3A7A B;  2RDG A;  3H91 A;  1XMO Q;  3HOV B;  4U68 A;  4A3D B;  5IGC A;  2PW7 A;  3F8T A;  2ATW A;  2XGT A;  5A2Q L;  4IJH A;  2F3V A;  3FP9 A;  5JJZ A;  4A3F G;  3FKI B;  3PO3 G;  2C5C A;  4QGU A;  1Y8N B;  1F9P A;  4XYQ A;  1TWH H;  4LF8 L;  1XMQ L;  3QB3 A;  3K5N A;  2ICE C;  4R9W A;  1YHQ A;  2NZ1 D;  3HP3 A;  1JWM D;  2K6A A;  2PMZ E;  5CR3 A;  3S2D B;  3VA5 A;  5GRO A;  4J6H A;  4AYB E;  3CCV A;  3KDF B;  3DWQ A;  3PGZ A;  3NE5 B;  4ZUJ A;  1R4Q B;  4BBS G;  2XWJ B;  1AE2 A;  2JP1 A;  2HCC A;  2SEB D;  4WFN 3;  3J7A V;  2QW7 A;  5GAG C;  1Q7Y C;  4G7H C;  2Q8I B;  3KLR A;  2RDH A;  4GKJ L;  5EBD A;  1WTW A;  1Q46 A;  1HRJ A;  1SAP A;  2KEE A;  2QF7 A;  4C56 C;  3I7F A;  3I56 A;  4N9T A;  1A63 A;  3FPU B;  2D0O A;  1XMO L;  2ZJP A;  5C4H A;  4FXD A;  3HOY B;  5CBE E;  3NWS A;  4KD4 A;  1STN A;  4HIO A;  2C9O A;  2ZJQ A;  1HZA A;  2MGS A;  3GTM H;  4F88 A;  5FLM G;  4A3D G;  1D5X C;  4RG1 A;  1S4Z A;  5IOC A;  4DV0 Q;  1VQO A;  3BS1 A;  1BOS A;  3CCE A;  2PCF B;  1E1T A;  1DM0 B;  5F2D A;  1Q90 A;  3NSW A;  1G51 A;  1SSO A;  3Q0A A;  1NAP A;  1I94 Q;  3HOU H;  1S5D D;  1FNW A;  1KRS A;  1LM0 A;  1ESR A;  2L4N A;  2PQE A;  3PIP A;  1K8G A;  1HR0 Q;  3M4O H;  2GA4 B;  1KDC A;  5LHY 1;  1SFO B;  2B2W C;  3NHH A;  1TVX A;  1MJC A;  1SNP A;  1C7Y A;  5M3F H;  2N8N A;  4GLA C;  2YV5 A;  3E9H A;  4RKB A;  5E7N A;  5JEA H;  1B8A A;  1B70 B;  1E0B A;  1BVS A;  2A73 B;  4K2K A;  4DGZ A;  5IT9 c;  1EY6 A;  2HQE A;  1BCP D;  1X55 A;  1M4V A;  4FP5 D;  5CBA E;  3K0Y A;  2BDO A;  3MFY A;  3VR3 A;  1EZ8 A;  1L0W A;  2B2V C;  3K6O A;  5A35 A;  4A76 A;  3HOY G;  3KFU A;  2NVQ H;  1GKH A;  2LS0 1;  4IN3 A;  3BG3 A;  5IY0 A;  1M8A A;  2HDM A;  1YJN A;  4NXM L;  2NB0 A;  3VYU A;  2WP8 J;  4JBW A;  3BZD B;  4DUY Q;  2F4V Q;  1HR0 L;  1U5K A;  3I90 A;  3L0O A;  3D6C A;  2IY5 B;  4JI3 Q;  4RFB A;  1TKW B;  3L9A X;  1SJE D;  4UP8 A;  5AFW A;  5M5Y H;  3SXH A;  4C1N K;  2F0Q A;  5ELF A;  3X3M A;  2G5D A;  4X3U A;  1PTO H;  1HA5 A;  3NQI A;  4HJA A;  1XNR Q;  4PMW A;  4RGN A;  3T53 B;  3PMF A;  2OQ0 A;  1V43 A;  3J7A 5;  1N34 Q;  3CU7 A;  1CTM A;  1JOK A;  1CHP D;  3HOU B;  1EIH A;  2M2L A;  2KCC A;  2JYO A;  5E4X A;  5G3L F;  3SR1 A;  3M4O B;  4JBJ A;  5FLX L;  2F0N A;  1WCM H;  1MD2 D;  1S5F D;  2PNH A;  1B50 A;  2UUA Q;  1KC8 C;  3I3C A;  1TWC H;  2RA4 A;  3NEN A;  4A93 B;  1FD7 D;  1HA6 A;  5M3F B;  1DOL A;  2E2J H;  4DV2 Q;  2Z6B A;  1B7Y B;  3EIV A;  3IFD A;  1EIG A;  4KMU C;  2PO4 A;  1B9N A;  3K59 A;  2D62 A;  2EDG A;  3PIO A;  2F4V L;  1JE5 A;  1GD7 A;  2Z8L A;  1RF2 D;  4KKT A;  3PF4 A;  1EEF D;  4GLX A;  4QY7 A;  2E76 C;  1UEA B;  3AMU A;  3S16 H;  1PYB A;  3A74 A;  3W1B A;  1SE4 A;  1UWV A;  1NTG A;  1ESF A;  4X3T A;  1I50 H;  1HZB A;  4MZ9 A;  4JOI C;  2F0E A;  1KNA A;  1XNR L;  2NVQ B;  1H9K A;  3PV0 A;  4OHJ A;  1WD1 A;  3S1Q B;  4FF4 A;  3P75 A;  4K0K Q;  2JK8 A;  2JA7 B;  4LK1 C;  1AP0 A;  4GKK L;  4GS3 A;  3OMC A;  1AE3 A;  3OMG A;  1H9R A;  4X62 Q;  1DXM A;  4BBR H;  1JJC B;  3HOU G;  5GQO A;  5HUR A;  4R4C A;  5C3X A;  5M5Y B;  1DZ1 A;  3R2T A;  1LTB D;  1PTO B;  1N8R C;  4A3G B;  3T1H L;  2F0U A;  2CH4 A;  4DV2 L;  1E2W A;  1MBY A;  1JOO A;  1G6P A;  1SNO A;  5EGT A;  3UDG A;  3H0G H;  2E5L L;  4A93 G;  1I3Q B;  1SLJ A;  2ASB A;  2HQL A;  3CCQ A;  1HTP A;  4P71 A;  4C3H H;  3MFG A;  4DUZ Q;  4N8F A;  5M3F G;  4WJ3 M;  2FHT A;  3BDC A;  4RCN A;  4TRD A;  1I6H H;  5JEA G;  4L6T B;  4BA1 I;  3PUX A;  4DV6 Q;  3HS0 C;  5LMU L;  2NVY H;  2BA0 A;  1WCM B;  1NNX A;  5ELB A;  4LF5 Q;  1VQ6 A;  1X56 A;  4YCV A;  2N55 A;  3CHB D;  3A55 A;  2B2Y C;  4O2D A;  1SE8 A;  4B3T Q;  1P16 A;  4M8A A;  1PH9 A;  3ZJY C;  5IWA Q;  2Q2T A;  5IYC H;  4DAM A;  4IUP A;  2L15 A;  2XSC A;  4CDD C;  4UPA A;  2K5D A;  4OON A;  4F87 A;  3J81 i;  4EX5 A;  1ICW A;  1XPO A;  2JA5 H;  4BY7 B;  1RTN A;  2IX0 A;  1MKH A;  1SYC A;  3SVM A;  1PH8 A;  1IBM Q;  1I50 B;  3FEW X;  4B3M L;  3IRB A;  1L1O C;  1TS4 A;  2KA7 A;  4NP5 A;  1E7Z A;  4BXX H;  1PYS B;  4UHV A;  2R92 B;  3CF5 A;  2EVB A;  2Z9H A;  1PTO F;  3LX0 A;  3KF8 B; 
#chains in the Genus database with same CATH homology
 2IHE A;  5DLQ E;  5BR8 L;  4DV3 Q;  2C35 B;  3G71 A;  4P74 A;  1V9P A;  2QGQ A;  4R4Q A;  2QEX A;  3G6E A;  4LFA L;  3U58 A;  3T1Y L;  1PFS A;  3CME A;  3I4O A;  1CKM A;  3HOX G;  2B63 H;  4DV6 L;  2EIF A;  3S2H H;  3HOW H;  2WAQ E;  5C0X I;  4IPG A;  3LGJ A;  5C3E H;  1MIU A;  4L5T A;  1PHJ A;  4BBS H;  4X64 L;  2D0P A;  1YJW A;  2IT1 A;  4GN3 B;  1HZ9 A;  4JBM A;  2GVA A;  3PO2 H;  4DR2 L;  1N36 L;  5K36 G;  1VQN A;  1PV4 A;  2Y0S E;  1VQH A;  2A8V A;  3KDF A;  3CW2 C;  4HID A;  1WCM G;  4LF4 L;  4DV1 Q;  3ULL A;  5C3E G;  4LNQ A;  4X65 Q;  1WJJ A;  3GTG H;  4P72 A;  4QL5 A;  4DUY L;  4IPD A;  4UP7 A;  5M5W H;  1LUZ A;  4DV5 Q;  1W3S A;  4JI0 L;  4R4O A;  5GAE C;  5J3B A;  4YHH L;  5FLX c;  1QUQ B;  4A3C G;  4JI3 L;  2WFW A;  3RN2 A;  1W2B A;  1HH2 P;  4BY7 H;  3E0E A;  4TVA B;  1XNQ Q;  4JC0 A;  3WWV A;  4DR6 L;  4BA2 I;  4DR4 L;  3I4N H;  2OCE A;  4EQ5 A;  4A3J H;  1IBK L;  1NY4 A;  4JV5 L;  1QVG A;  4KHP L;  4QJF A;  1K0R A;  1OXV A;  2LSS A;  4HJ9 A;  2CQO A;  1PH5 A;  2UUB Q;  3RNU A;  3KOJ A;  4AH6 A;  1IBM L;  2VUM G;  4IFD G;  1GM5 A;  5C4X G;  2R92 H;  2YYZ A;  1YHA A;  2CWA A;  1MJE A;  3S14 H;  4A3D H;  5FLM H;  1YJ9 A;  4DR1 Q;  3STB D;  4HJ8 A;  5C44 H;  3OYY A;  1N33 Q;  1VQP A;  3GTK H;  3HFZ B;  5IYB G;  1VQB A;  2R6G A;  2Z0S A;  3OTO L;  1N34 L;  4X6A H;  1PVO A;  2UXD Q;  2YTV A;  3S1N H;  1CSP A;  2I5M X;  4DNI A;  1S72 A;  3K0X A;  1HJP A;  2AWN A;  3L7Z C;  2R92 G;  3CC7 A;  1U0L A;  3KF6 B;  5FJ8 H;  3GTJ H;  2UUC L;  5ELO A;  3J80 c;  5C0X J;  1YHB A;  1ASZ A;  4LWC A;  4B3R Q;  5H1S E;  2XTI A;  4OXP A;  2UUA L;  2F52 A;  5JJK A;  2OTJ A;  3JAM c;  3M9B A;  4NXM Q;  2Z6K A;  4A3B G;  1KXL A;  4QIW E;  4P73 A;  3G4S A;  1KL9 A;  2MFI A;  1WOC A;  1EWI A;  4POG A;  3S2D H;  4DK3 C;  1QZH A;  3W1G A;  5M3M H;  3GO5 A;  2PI2 A;  2ID0 A;  4PZ7 A;  4YCW A;  4A3K H;  3H3V I;  2K4K A;  2NZO A;  4BBR G;  4ME3 A;  4OX9 L;  2LXJ A;  2ZM6 Q;  4DV1 L;  4OO1 G;  1XTD A;  1S3O A;  1HNX Q;  2PQA A;  1D8L A;  4DV5 L;  2K5V A;  3M7N A;  2VQF L;  2KCT A;  1K9M C;  2Z6K C;  5GAH C;  2YTX A;  4YWM A;  1LTL A;  3CP0 A;  1JB7 A;  4YCU A;  1A0I A;  4LF8 Q;  1CKO A;  1YIJ A;  2JEB I;  4H02 A;  3H0G G;  4APV A;  3VDY A;  4JI6 L;  4GOP A;  3BZK A;  3A5U A;  3NEL A;  2BA1 A;  4NXN Q;  1KAW A;  3GD7 A;  5LMN L;  2NN6 I;  1XJV A;  1KQS A;  1WI5 A;  1Q12 A;  2RCN A;  3GTL H;  2K5H A;  3UE0 A;  2K75 A;  2LXK A;  3M4P A;  2V1C C;  3ULJ A;  1KD1 C;  1EQQ A;  1YIT A;  3PUV A;  3PUY A;  2R7Z H;  2WAQ G;  4K0K L;  4YWK A;  3RLF A;  2UXD L;  2FXQ A;  4AQY L;  2B3G A;  1IXR A;  3E9I A;  1HR0 W;  1NE3 A;  4DV4 Q;  2RHS B;  4GOP C;  3UE1 A;  4GN5 A;  4DR5 Q;  1SRO A;  1L1O B;  1Y14 B;  2HT1 A;  1M90 C;  2VNU D;  1N32 Q;  1BKB A;  5IP9 H;  4HJ7 A;  3AEV A;  2VL6 A;  4X62 L;  3DLL A;  3HOV G;  3RLN A;  2QA4 A;  4DPG A;  4HIK A;  1NJI C;  2JA7 G;  1Q1B A;  2Y0S G;  2CCZ A;  2UXC Q;  4QQB X;  4B3R L;  1EUJ A;  2F3I A;  4A3M G;  1IBL L;  2R7Z G;  3GTO H;  2VQE L;  1PH7 A;  1Z9F A;  1TWG H;  1K83 H;  5IYC G;  1ASY A;  1YBY A;  4A3L G;  3F1Z A;  5C4J H;  4KI0 A;  3I55 A;  3I4M H;  1HNW L;  1CKN B;  2ALY B;  1XMO Q;  3AYH B;  1LYL A;  2I0Q A;  3AFP A;  2B29 A;  3F8T A;  2KHI A;  4FDB A;  4DV7 Q;  2ATW A;  2A19 A;  2JA5 G;  2NVT H;  2BH8 A;  2XGT A;  1YZ6 A;  2VS1 A;  3D0F A;  4IJH A;  5C0X G;  4DUZ L;  1IL2 A;  2JA6 H;  3FP9 A;  4A3F G;  4A3G G;  2VW9 A;  3PCO B;  3PO3 G;  2AHO B;  1CUK A;  1A8V A;  1Y1V H;  4QGU A;  3F2C A;  4BXX G;  4JI2 L;  1TWH H;  3NEM A;  5HY6 A;  4DK6 C;  4LF8 L;  1XMQ L;  1Z47 A;  3BU2 A;  4Y7N H;  1YHQ A;  1PH1 A;  4NXN L;  4IOA A;  4BY1 H;  3BJU A;  1EIF A;  2K50 A;  4LF5 L;  5JJI A;  2PMZ E;  2K5N A;  2B63 G;  5GRO A;  1VQI A;  3RZO H;  3HOW G;  4B3T L;  1OXT A;  1X3F A;  4AYB E;  3CCV A;  2E2H H;  4GKK Q;  2MNA A;  1QVC A;  2KBN A;  2Q2H A;  3KDF B;  2HIV A;  4NB3 A;  4A3E H;  5IE8 A;  3PGZ A;  5IWA L;  4POF A;  2YU9 H;  4BBS G;  1X9N A;  4JI4 Q;  1AE2 A;  1VQD A;  3PUZ A;  3CCM A;  2GN5 A;  1C0A A;  3PO2 G;  4DR5 L;  2VZA A;  1EIY B;  5GAG C;  3CD6 A;  1YEZ A;  4LF7 L;  4JYA Q;  3Q8D A;  1Q7Y C;  2JJQ A;  1Q82 C;  3AQQ A;  3FHW A;  1C9O A;  3W5O A;  1HNZ L;  4GKJ L;  4J15 A;  3HKS A;  4IOC A;  1Q46 A;  3T1H Q;  4JI7 L;  4RMF A;  3RR5 A;  4LF9 Q;  3TS2 A;  3RN5 A;  2UXB Q;  1JJG A;  3I7F A;  3I56 A;  3EBE A;  4L5Q A;  2RF4 A;  4X66 L;  3M85 A;  2E5L Q;  3HOV H;  1UEB A;  1A63 A;  4BY7 G;  3AFQ A;  2D0O A;  2OWO A;  4P75 A;  1XMO L;  1E22 A;  2ZJP A;  2DGY A;  3M3Y H;  4DR3 L;  3I4N G;  3TRZ A;  2R7D A;  2DUD A;  4A3J G;  3H3V H;  3FKI H;  4HIO A;  4DKA C;  5IP7 H;  5LMU Q;  4DV3 L;  1XPU A;  1OTC A;  1J5E Q;  4IJL A;  2IHF A;  2ZJQ A;  1HZA A;  3GTM H;  4A3D G;  5FLM G;  4RG1 A;  5C44 G;  3J81 j;  5HGQ A;  5AJ3 Q;  1FGU A;  1NBW A;  4DV0 Q;  4A75 A;  2N78 A;  3RLO A;  3RZD H;  1VQO A;  1VQG A;  3CCE A;  2YTY A;  1E1T A;  4MTN A;  2JA9 A;  1G51 A;  1VQJ A;  1V1Q A;  2AWO A;  4DAY B;  1I94 Q;  4IFD I;  1X3E A;  3HOU H;  2N3S A;  5FJ8 G;  3S1R H;  1VQE A;  4GN4 B;  4LUO A;  1KRS A;  1LM0 A;  3PIP A;  1K8G A;  3M4O H;  1HR0 Q;  3KF6 A;  4PZ8 A;  4DR7 Q;  4X65 L;  1SMX A;  4LFC Q;  3UDX A;  3ICE A;  1P8L A;  4JI4 L;  1XPR A;  5M3M G;  5IYD H;  1MJC A;  4A3I H;  4A3K G;  4JYA L;  1XNQ L;  1C7Y A;  1SN8 A;  5M3F H;  2N8N A;  4GLA C;  2YV5 A;  4B3M Q;  3E9H A;  2HHH Q;  1X3G A;  5E7N A;  1B8A A;  1B70 B;  4GOP B;  5JJL A;  1Q1E A;  4OWX B;  1BVS A;  4JI8 Q;  5IT9 c;  2UUB L;  3J81 c;  4JI1 Q;  4DR1 L;  3S24 A;  2Q2U A;  3J80 i;  1BBW A;  3KJP A;  1N33 L;  3HOY H;  1X55 A;  3UDF A;  1OXX K;  2JA8 H;  4IPH A;  3JAM i;  3T1Y Q;  4OO1 I;  2CKZ B;  2R93 H;  4L5S A;  3U4V A;  1L2F A;  1FJG Q;  3K80 C;  1J5E L;  1UE1 A;  1PH3 A;  4OWT B;  1GO3 E;  3CCR A;  1EYG A;  1L0W A;  4YY3 Q;  1X65 A;  1PH2 A;  3CCJ A;  4GNX A;  4A76 A;  3HOY G;  3KFU A;  2CFM A;  2NVQ H;  1VQC A;  1GKH A;  2MO0 A;  4AYB G;  1N36 Q;  1GVP A;  3A5Z B;  3CC4 A;  5IY0 A;  1VQM A;  1YJN A;  4NXM L;  1TWA H;  2UU9 Q;  3HOZ H;  1D7Q A;  2I5H A;  2WP8 J;  4LF4 Q;  1VQ9 A;  1EFW A;  2OTL A;  2MQH A;  5IP9 G;  4JBW A;  1VCI A;  3CPW A;  2ZTD A;  3HKZ E;  4DUY Q;  2F4V Q;  1SFO H;  4JI0 Q;  1DGS A;  1L1O A;  1HR0 L;  1U5K A;  4L5R C;  3CCU A;  1RIP A;  4YHH Q;  3L0O A;  3M4Q A;  2ZM6 L;  4GNX C;  1Y1W H;  1VQL A;  4DR7 L;  2EXD A;  4JCV E;  4JI3 Q;  2IY5 B;  1HNX L;  4LUZ A;  4UP8 A;  2K52 A;  5GAD C;  4DR6 Q;  1BBU A;  4JG2 A;  4DR4 Q;  3JC6 6;  3CMA A;  1X6O A;  3F2D A;  3I4M G;  5M5Y H;  1KIX A;  2KHJ A;  3K7A H;  3TEH B;  4LW1 A;  1Q86 C;  1IBK Q;  4JV5 Q;  4KHP Q;  4HJA A;  1TXY A;  4B3S Q;  1XNR Q;  2HHH L;  4PMW A;  3HOX H;  1E3P A;  3KJO A;  1YNX A;  2JA6 G;  2OQ0 A;  1V43 A;  3NBH B;  3J7A 5;  4JI8 L;  3D31 A;  3OTO Q;  1N34 Q;  2NVX H;  1Y1V G;  4JI1 L;  3SGI A;  2HIX A;  1VS0 A;  3PUW A;  4C3J H;  4BY1 G;  3TRE A;  4JBJ A;  1E1O A;  1UE6 A;  4DV4 L;  2UUC Q;  4HJ5 A;  4O0A A;  1WCM H;  2MO1 A;  1K73 C;  1FJG L;  2PNH A;  3ERS X;  2E2I H;  4UP9 A;  3F2B A;  2UUA Q;  1N32 L;  1KC8 C;  1TWC H;  5JEA J;  1IYJ B;  3CQZ H;  3NEN A;  4YY3 L;  3L2P A;  1YI2 A;  2JQO A;  2UXC L;  2ZTE A;  4A3E G;  4A3C H;  2WB1 E;  4PZ6 A;  2E2J H;  4DV2 Q;  3MXN B;  1B7Y B;  1VQA A;  3EIV A;  2PI2 E;  3STB C;  2UU9 L;  1JMC A;  3PSI A;  4OX9 Q;  4IO9 A;  1OXU A;  4JBK A;  4LUV A;  4JOI A;  1O7I A;  2D62 A;  1SRU A;  3PIO A;  2F4V L;  1JE5 A;  1QUQ A;  1GD7 A;  5C4X H;  2VQF Q;  2IX1 A;  4DV7 L;  2VUM H;  3PF4 A;  1JT8 A;  3CXC A;  2I5L X;  1CSQ A;  4GLX A;  1A62 A;  4QY7 A;  1J6Q A;  2EQS A;  2KCM A;  4TQU S;  3EN2 A;  3S16 H;  2N49 A;  1PYB A;  3GTP H;  2OQK A;  3A74 A;  3W1B A;  5IYB H;  3H15 A;  1PA6 A;  4JI6 Q;  1SR3 A;  1NTG A;  1UWV A;  1VQK A;  4C3I H;  2ZTC A;  1I50 H;  1HZB A;  4MZ9 A;  1K8A C;  1VQ5 A;  5LMN Q;  3S15 H;  2JEA I;  3KYH C;  4JOI C;  5EAY A;  4R1J A;  3CPF A;  4B3S L;  1XNR L;  3S1M H;  4LFB Q;  3FKI G;  1Q81 C;  5IP7 G;  3K81 C;  1OXS C;  3PV0 A;  1YVC A;  1VQ7 A;  3S17 H;  4K0K Q;  2JK8 A;  3MEF A;  4AQY Q;  1T9H A;  4A3B H;  1UE7 A;  1HZC A;  4PG3 A;  4GKK L;  2NZH A;  4GS3 A;  3J7Z C;  1VQ4 A;  1WYD A;  1AE3 A;  3OW2 A;  2CWP A;  4X62 Q;  1H95 A;  3CCS A;  1S40 A;  1K3R A;  2PQA B;  4BBR H;  3KLW A;  1JJC B;  3U4Z A;  1IBL Q;  4A93 H;  3HOU G;  5GQO A;  4KHZ A;  2VQE Q;  2NN6 G;  3PF5 A;  2KEN A;  4R4C A;  2VY3 A;  4MNO A;  1RL2 A;  4JI5 Q;  3HKZ G;  1X54 A;  4LF6 Q;  4HIM A;  4YWL A;  5LMN W;  1N8R C;  1PH6 A;  4KLK A;  1HNW Q;  4Y52 H;  4WJ4 A;  1FVI A;  3T1H L;  1PH4 A;  1N9W A;  4XIG S;  4LF9 L;  3CAM A;  2E8G A;  4DV2 L;  2UXB L;  1G6P A;  1E24 A;  3UDG A;  3H0G H;  3TS0 A;  4XTC S;  2E5L L;  5IYD G;  4A93 G;  1SLJ A;  2ASB A;  1NMG A;  2HQL A;  2RHQ B;  3CCQ A;  4A3I G;  5BR8 Q;  4P71 A;  5M5X H;  4C3H H;  4DUZ Q;  1JJ2 A;  5M3F G;  4WJ3 M;  1G29 1;  4LFA Q;  1VQF A;  1I6H H;  2JE6 I;  5JEA G;  4BA1 I;  3PUX A;  4DV6 Q;  3K7U C;  2AMC B;  4JI2 Q;  2Q2I A;  5LMU L;  1FL0 A;  1KHI A;  1XMQ Q;  3UDI A;  4GLV B;  1TWF H;  2A1A A;  2NVY H;  2BA0 A;  3B6Y A;  1M1K C;  4IPC A;  2GVB A;  3K8A A;  4X64 Q;  4LF5 Q;  1VQ6 A;  1X56 A;  4YCV A;  5AJ3 L;  3BZC A;  4DV0 L;  1R9T H;  1EOV A;  2JA8 G;  4DR2 Q;  1NMF A;  4C2M H;  4GNX B;  4O2D A;  2ZJR A;  4LFB L;  3S1Q H;  1SE8 A;  2AKW B;  4B3T Q;  2R93 G;  2JA7 H;  1P16 A;  3DM3 A;  1AH9 A;  1PH9 A;  3ER0 A;  4IFD J;  4A3M H;  1I94 L;  3ZJY C;  1VQ8 A;  3A0J A;  5IWA Q;  2K14 A;  1IZ6 A;  2Q2T A;  3I2Z A;  5IYC H;  4DAM A;  4A3L H;  4ALP A;  4UY8 C;  4R4T A;  2L15 A;  4AIM A;  2H5X A;  3ULP A;  1QVF A;  4LFC L;  1KRT A;  3TQY A;  1I5F A;  4LF7 Q;  1EQR A;  4UPA A;  4OWW B;  3HOZ G;  4R4I A;  1Q8K A;  2WB1 G;  4OON A;  3J81 i;  1XPO A;  4EX5 A;  1HNZ Q;  4GKJ Q;  2JA5 H;  3G48 A;  4NPS A;  2IX0 A;  1QZG A;  1MKH A;  4JI7 Q;  3CC2 A;  2BH2 A;  1PH8 A;  3GTQ H;  4A4I A;  1IBM Q;  4JI5 L;  1CKN A;  1WFQ A;  4X66 Q;  4A3F H;  4B3M L;  3IRB A;  4A3G H;  1L1O C;  3GDE A;  5ELN A;  2R7F A;  1Y1W G;  3CCL A;  4LF6 L;  3PO3 H;  1E7Z A;  1UE5 A;  1PYS B;  4BXX H;  1I3Q H;  3CF5 A;  4DR3 Q;  3U50 C;  2ES2 A;  3KF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...