3S14H

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s14H00
2EXDA 4X66L 3IRBA 3M9BA 1EYGA 4QGUA 3CQZH 4C3JH 2R92G 3KF6B 2JA6H 5JJKA 4LW1A 4O0AA 5C0XI 5C0XG 4JI1Q 4DV4L 2OTLA 4DV0Q 5JJIA 1AE2A 1VQNA 3CC7A 3TRZA 1UEBA 2D62A 3CCQA 3AFPA 3HKZG 3KDFB 1G6PA 1IL2A 3M85A 4DR1Q 4UP9A 2JA6G 1EUJA 3J81c 1EFWA 3PUZA 3RLOA 3S2HH 1TWCH 3JAMc 1VQPA 1S40A 4LFAL 5ELOA 1VQBA 1VQOA 2PQAA 4QIWE 3S1NH 5IYCH 2K5VA 4A3KH 2KHIA 5FLMH 3TS0A 4X6AH 2NN6G 1K0RA 4R4TA 4LF9Q 4LF9L 1A62A 5GAHC 2AWNA 1B7YB 4P74A 5BR8L 1YI2A 1KAWA 2L15A 2XTIA 1O7IA 4J15A 3W1GA 4JI8L 2A8VA 2AMCB 1EWIA 1DGSA 1PH8A 5IYCG 4A3KG 1TWHH 3F8TA 4MTNA 1SFOH 3J81j 1HH2P 1L0WA 4IPHA 1JJ2A 4POGA 4JBJA 4IOAA 4BBRH 1L1OB 3SGIA 1VQ5A 3H0GH 2VZAA 1SMXA 1KHIA 4YCUA 1WFQA 4DAMA 3LGJA 3F2CA 3CCJA 4A3IH 2DGYA 4BBRG 4DR4L 2QGQA 4JI6L 3H0GG 1Z47A 1X3FA 4FDBA 4GOPA 1VQ8A 4JV5Q 4GN3B 1J6QA 2Z0SA 1XPOA 2JA9A 3AYHB 3NELA 1PH9A 1FGUA 3E0EA 3L7ZC 4NB3A 4X65Q 4X65L 2ZJRA 4PMWA 2ZTDA 2VQEL 3CCVA 1X56A 1V9PA 1HZBA 4K0KQ 1CSQA 2NVTH 5GAEC 4P73A 1VQ6A 1SE8A 1X3GA 4OX9L 1CSPA 1VQ7A 3M3YH 4WJ3M 4JI5L 1D8LA 4HIMA 1QUQB 4R1JA 1CKMA 1QVCA 1C9OA 3S16H 1KL9A 3HKSA 2UXCL 2Y0SG 3A5UA 4IPDA 4IFDI 4IFDG 4YHHQ 2KHJA 5M5YH 3CPWA 3CD6A 2WP8J 2R6GA 2Z6KA 1PHJA 3BU2A 2HIVA 2UUBQ 2YU9H 2WAQE 3M4PA 2UUBL 1YEZA 1VQIA 1KRSA 2ZTCA 2CFMA 1GM5A 1MJEA 1OXXK 1XMQQ 2ZJPA 4JOIA 1L1OC 2VUMH 4JC0A 1VQHA 2VQFQ 2VQFL 3CF5A 4RG1A 4A3JH 4GN5A 2JA8H 3KJPA 3NENA 4KHZA 3FHWA 4DR5L 3PO3H 1K73C 1N32Q 3CC4A 3PUYA 2K5NA 1NE3A 2VUMG 4ALPA 2WB1E 4GN4B 5JJLA 5GAGC 1XNRQ 2NZOA 5C0XJ 2ES2A 4A3JG 3STBC 2JA8G 1X3EA 4A3LH 5GADC 1HNWL 1K8AC 3CCUA 4DV5L 1N33L 3K7UC 3PO3G 1XMOQ 4A3BH 2UXDQ 1XMOL 3I7FA 4LFCQ 3KF6A 4QL5A 4BA2I 1NJIC 3GTJH 2OQKA 2CKZB 1XTDA 1RL2A 1WJJA 4H02A 4R4CA 3ULJA 2UUAL 1PH6A 4B3RQ 1S3OA 1UE1A 2KENA 4NXNQ 4A3LG 2UUCQ 2UUCL 4A3BG 1GVPA 1K3RA 5IP9H 4B3TQ 3PGZA 2F52A 2I5HA 3PIOA 3GO5A 1VCIA 4GLVB 1ASZA 4BXXH 4LUVA 1HNXL 1OXVA 3MEFA 4BA1I 1VQLA 1VQCA 1YHAA 1H95A 5IP9G 3CPFA 3A0JA 3U4ZA 3HOXH 5JEAJ 1Q46A 1Z9FA 4DAYB 4LUZA 1A8VA 4X64Q 4BXXG 1XPRA 1YZ6A 3J81i 4JI3Q 4JI3L 2UXBQ 1UE5A 3TS2A 2B3GA 4OXPA 3I2ZA 5GROA 3I55A 4XIGS 2CQOA 3S15H 4OONA 3AQQA 4DKAC 3JAMi 4LFBQ 3HOXG 3U50C 3CCMA 4A3DH 5LMNL 1V1QA 1YITA 2E2HH 1VQJA 5IP7H 1TWGH 4QQBX 1BKBA 3E9IA 2JEAI 3H15A 4DV2Q 3UDXA 2PI2A 1X54A 1L1OA 1MKHA 3J80i 2C35B 2MQHA 4JI1L 1VQKA 4DV0L 4A3DG 3S24A 1YHQA 3AEVA 2K75A 4A3FH 2IHFA 2ASBA 3UDGA 5IP7G 3GTPH 1K83H 2I5LX 4DR1L 4YCWA 1PYBA 4GKJQ 1D7QA 4BY1H 4OWWB 2JA5H 3PV0A 4IPCA 4TVAB 4BY7H 3HOWG 1PH1A 3S2DH 2JA7H 1LM0A 4A3FG 2CCZA 2OWOA 3BZKA 4JCVE 2NVXH 4BY1G 2AWOA 4YY3Q 4B3SQ 4B3SL 2CWAA 1IXRA 2Q2IA 4RMFA 2NN6I 1MIUA 2JA5G 3E9HA 4BY7G 4GNXA 2B29A 2JA7G 4P72A 4GLXA 2LXJA 1NTGA 2JEBI 1IYJB 3ICEA 4IPGA 1QVFA 1Q81C 1QZGA 4X62Q 5ELNA 1P16A 4X62L 2OCEA 3ER0A 3S1QH 1VQMA 1Q7YC 1OXUA 2WB1G 2V1CC 2B63H 1WI5A 2AKWB 4UPAA 1X55A 5LMNW 1IBKQ 3STBD 1IBKL 3PIPA 3KJOA 3EIVA 2F3IA 1GD7A 1GKHA 1GO3E 3TQYA 1X65A 4EQ5A 2NVQH 4KHPQ 1JT8A 3G4SA 1BBUA 4GS3A 2BA1A 3HFZB 1YJWA 1UE7A 1TWAH 2B63G 3EBEA 3DLLA 2ZJQA 1IBLQ 1SR3A 1SLJA 2K5HA 3CW2C 2MNAA 4HJAA 1JB7A 4JV5L 4OWTB 1OTCA 1E3PA 2A1AA 1LYLA 2AHOB 1KIXA 3GTQH 1Q1EA 1T9HA 1JE5A 2EIFA 1VQDA 3CMAA 4HJ5A 3S17H 4UP8A 5HY6A 3T1HQ 1Q12A 1AE3A 3EN2A 2BH2A 1PV4A 4K0KL 2EQSA 3RNUA 2I0QA 5LMUQ 5LMUL 1PH2A 2YYZA 1KD1C 5IYBH 3K7AH 4JI7Q 2YTVA 4JI7L 1NMGA 1J5EQ 4YHHL 3AFQA 5HGQA 1PA6A 4OO1I 4OO1G 1N9WA 3PUXA 2DUDA 3U58A 4HJ7A 2PMZE 2R7FA 3OYYA 5IYBG 2PQAB 1N36Q 3K8AA 3H3VH 2Q2TA 4JI0Q 4EX5A 4QY7A 4WJ4A 3F2BA 2GVAA 1XMQL 4O2DA 2ZM6Q 4A93H 2ZM6L 5M5XH 1BBWA 3DM3A 5GQOA 5C44H 3OTOQ 3HOUH 1SN8A 3S1MH 2QEXA 1U0LA 1I3QH 2VY3A 3U4VA 1I94Q 3ULPA 1I94L 1EQRA 4GKKQ 2JJQA 4HIOA 4DR2Q 3UDIA 4A93G 3I56A 1Q1BA 2H5XA 5J3BA 5C44G 1XNRL 3ZJYC 3UDFA 3PF5A 3HOUG 4IOCA 2IHEA 4DV3Q 3VDYA 4DV3L 1IBMQ 3TEHB 5M3MH 4DR3Q 1KQSA 4R4OA 3GTOH 3K0XA 1AH9A 3UE1A 1HR0Q 4DR7L 1YNXA 3KOJA 1UE6A 1B70B 4LFCL 1HR0L 1HJPA 1W3SA 4B3RL 4NXNL 5M3MG 4GOPB 1QZHA 4YWMA 3RLNA 2KBNA 3KDFA 3Q8DA 4B3TL 4LUOA 1G51A 1VQ4A 4JI4Q 1UWVA 2HQLA 2RHQB 1JJCB 2K50A 2JE6I 1E1OA 1PH7A 4BBSH 2XGTA 4MZ9A 1FL0A 1PFSA 1CKNB 1OXSC 3JC66 2K4KA 1G291 5M3FH 4YWKA 4A3GH 4L5RC 2E8GA 4X64L 1C7YA 5IWAQ 2Q2UA 3NBHB 2VL6A 4JI2Q 4BBSG 2RCNA 3W1BA 3I4NG 4A3GG 2UXBL 1U5KA 3UE0A 4Y7NH 2NZHA 1A63A 1PYSB 4A76A 1XNQQ 4DUZQ 1XNQL 3J7A5 4DUZL 4LFBL 5M3FG 2UU9Q 1M90C 3TREA 4AQYQ 2VW9A 1FVIA 4HIKA 4DV2L 3HOZH 4B3MQ 1JMCA 3I4MH 4IJHA 2NVYH 2BA0A 1VQEA 5AJ3Q 2OQ0A 1YIJA 1X9NA 3HOWH 2MFIA 1B8AA 4JG2A 3CAMA 2Q2HA 4R4QA 1I50H 3F2DA 3KFUA 4TQUS 2R93H 3ERSX 3HOZG 1HR0W 4A3EH 4LWCA 4PG3A 3I4MG 2Y0SE 4GKJL 4P75A 4YCVA 4A3MH 3CC2A 4AYBE 4DV6Q 4JBMA 4C3HH 2QA4A 4GOPC 1WYDA 5EAYA 3S1RH 4DR7Q 1HZ9A 2R93G 1VQ9A 3K80C 2WAQG 4A3EG 1YHBA 2WFWA 1Q8KA 3CCEA 4YY3L 3CP0A 2ALYB 4A3MG 1N32L 1NMFA 4GLAC 4PZ8A 3HOVG 1YJ9A 4DV4Q 1I6HH 4IFDJ 2VNUD 1HZAA 4IO9A 2VS1A 3PUWA 2E2IH 3KYHC 1QUQA 4LNQA 3M4OH 3CCRA 1K8GA 1SRUA 1KC8C 4PZ7A 1Q82C 1X6OA 1EIFA 1N8RC 1K9MC 4JYAQ 3OW2A 3BJUA 1RIPA 4JYAL 4Y52H 2I5MX 4LFAQ 3ULLA 1PVOA 5E7NA 5C4XH 1WCMH 2Z6KC 3A74A 3FP9A 2JQOA 1E24A 4POFA 2HHHQ 1HNZQ 4L5QA 2HHHL 1HNZL 4KHPL 3W5OA 3I4OA 1LUZA 3J80c 4LF6Q 1FJGQ 4JOIC 4LF6L 1FJGL 5BR8Q 1IBLL 5C4XG 1WCMG 5IE8A 4C2MH 4JI8Q 5JEAG 4DK3C 2YV5A 4OX9Q 2PNHA 3CCSA 1YJNA 4JBKA 2HT1A 4AH6A 2D0PA 5FLMG 1PH4A 4LF4Q 1CKOA 4LF4L 4DV1Q 4NXMQ 4DV1L 4AIMA 4NXML 2N8NA 1IZ6A 3T1HL 2A19A 3CCLA 3D0FA 4L5SA 1LTLA 3L0OA 4LF5Q 3M4QA 5FLXc 5DLQE 4LF5L 1TXYA 3GTKH 2N49A 1Y14B 1Y1VH 3PUVA 2KCMA 1QVGA 4DR4Q 2E5LQ 4JI6Q 2E5LL 3HOYH 2GVBA 3RN2A 4A3CH 3GD7A 1J5EL 1M1KC 1HZCA 3K81C 4DPGA 4DK6C 4HIDA 4A3IG 1Y1VG 2N78A 1N36L 4KI0A 3CMEA 1A0IA 1XPUA 3HOYG 4JI0L 4KLKA 4IJLA 2ZTEA 4A3CG 2VQEQ 4LF8Q 1TWFH 1YBYA 2IX0A 4LF8L 4GNXB 3G71A 2ID0A 1CKNA 3PO2H 1WOCA 1SROA 2CWPA 2KCTA 3OTOL 4XTCS 5IY0A 3HKZE 1NY4A 2JK8A 3GTLH 3H3VI 5IT9c 4JI5Q 1E1TA 1Y1WH 2UXCQ 1I5FA 1W2BA 4GKKL 4ME3A 4R4IA 3RLFA 4DR2L 3PO2G 3F1ZA 3M7NA 2RHSB 3T1YQ 3T1YL 4YWLA 4APVA 4AYBG 1XJVA 2UXDL 1IBML 5IYDH 4DR3L 1Y1WG 1N34Q 2R7DA 2RF4A 1N34L 4LF7Q 4LF7L 1Q86C 1PH3A 5FJ8H 2IX1A 1OXTA 2F4VQ 2R7ZH 3G6EA 2F4VL 4P71A 2K52A 1MJCA 5C3EH 5K36G 4UY8C 3BZCA 1R9TH 3KF8B 2IT1A 2N3SA 4DR6Q 3A5ZB 5IYDG 3GDEA 5M5WH 3MXNB 4DR6L 1KXLA 2OTJA 3RZDH 2PI2E 1P8LA 2GN5A 3WWVA 5FJ8G 4DR5Q 2R7ZG 4JI4L 1E7ZA 5C3EG 4JBWA 3GTMH 3RZOH 1ASYA 3J7ZC 4DV7Q 4HJ8A 4DV7L 4L5TA 4C3IH 3I4NH 4A4IA 3S14H 1VQAA 1VQFA 3FKIH 1EOVA 1HNWQ 1E22A 4DNIA 1EIYB 4DV5Q 1N33Q 3G48A 3PCOB 1C0AA 4HJ9A 1NBWA 2MO0A 1V43A 4PZ6A 1PH5A 5IWAL 2ATWA 3PSIA 4JI2L 2UUAQ 4MNOA 3FKIG 1L2FA 4OWXB 4GNXC 1EQQA 1BVSA 2FXQA 3KLWA 1S72A 2UU9L 1YVCA 2YTYA 2HIXA 4AQYL 2LXKA 4QJFA 1CUKA 2E2JH 3PF4A 2D0OA 1HNXQ 5H1SE 4B3ML 2YTXA 1VQGA 3CXCA 2K14A 3D31A 2IY5B 5AJ3L 1JJGA 1KRTA 2LSSA 3HOVH 3RN5A 5C4JH 2R92H 2MO1A 3B6YA 3GTGH 1VS0A 3L2PA 2BH8A 4UP7A 3NEMA 4DV6L 4DUYQ 4A75A 4DUYL 5LMNQ 3RR5A 4X66Q 4NPSA
chains in the Genus database with same CATH superfamily
1B3AA 3M9BA 3KF6B 5C0XI 3ONAB 4DV4L 2OTLA 2PQEA 5JJIA 1UEBA 3VA7A 3S15B 4C3JG 2QF7A 1HCZA 1EUJA 4WFN3 4XT1B 2L1BA 3S2HH 4RGTA 1TWCH 1VQPA 2KECA 4LFAL 2PQAA 3S1NH 5IYCH 3TS0A 1B2TA 1RCVD 3NWSA 4A3EB 3W1GA 3RD4A 1EWIA 1DGSA 4ZKCB 4OX9L 1L0WA 4IPHA 1PTOH 4JBJA 2TSSA 1STHA 1L1OB 2PZWA 3SGIA 4BBRH 1LTID 4DAMA 5F2DA 3LGJA 3LWEA 3F2CA 3CCJA 3C3LA 2CW0C 4JI6L 2OXPA 1X3FA 4GOPA 4GN3B 2Z0SA 2IPKD 2EJMA 2E74C 1PTOF 2H4OA 5C4XB 1XX8A 3E0EA 4HSVA 1K8MA 4NB3A 1IW7C 3N6RA 1BXTA 3CCVA 1HZBA 5GAEC 1SAPA 1F2ZA 1QUQB 2VB2X 4KHVA 1SYFA 2RBMA 3S16H 1L0YB 1B50A 4IPDA 4IFDG 2ICIA 1JWSD 2EXZA 2L12A 2WP8J 2R6GA 3CD6A 5IT9L 5C3WA 3TZDA 3ITPA 4ME5A 1CA6A 4X3KA 1XMQQ 1L1OC 5FO9B 1B44D 3CF5A 2JA8H 2FINB 3FHWA 4G7OC 1SE2A 2EY6A 2VUMG 4FXKC 5GAGC 4A3JG 1X3EA 1HNWL 4K5VA 1K8AC 2BDOA 1FNWA 3K7UC 1XMOL 2LKVA 4G7ZC 1WD1A 3KF6A 4LFCQ 3S1MB 1NJIC 1XTDA 1RL2A 4ZRZA 3NK9A 1WD0A 1UE1A 5C3XA 5IGBA 4A3LG 1R4QB 1GVPA 5IP9H 3PGZA 2LY7A 3PIOA 2EYHA 4FYDA 1VCIA 4GLVB 1ASZA 1OO9B 4BA1I 1KDCA 1H95A 2QCPX 1Q3LA 3U4ZA 3MXGA 4BXXG 1XPRA 1YZ6A 2UXBQ 1LT6D 2B2YC 2B3GA 3MHBA 4OXPA 4HSPA 4XIGS 3I55A 4OONA 1T5XD 1YITA 1VQJA 1GHJA 1TWGH 4ZCKA 3T13A 3KLSA 5LL6S 5IP7H 4K2LA 5M3FB 1BF4A 1CTMA 1L1OA 5ELDA 5I6WA 2OEOA 2F4IA 2JXMB 3BDCA 1VQKA 2IHFA 2ASBA 3C2PA 2I5LX 4PQXA 3C1EA 3EQLC 2NUCA 4RGNA 4OWWB 4NKLA 3BZDB 3A54A 2R3ZA 3LX0A 4IPCA 4MIUA 4ID6A 2VXWA 3HOZB 4BY7H 4A3FG 2K5WA 1O7YA 2Z1CA 1QCBD 3CU7A 4BY1G 4YY3Q 2XRQD 1SYCA 4B3SL 3L3OC 2R93B 2B29A 4J1MA 1ML0D 3I72A 2LXJA 4H13C 2QDLA 2E76C 4A3MB 1CQFA 3MEHA 3H6MA 1Q81C 4X62Q 3J80L 5ELFA 4C56C 3S1QH 1OXUA 3NWTA 2V1CC 4IALA 4UPAA 2AKWB 2SNMA 5ELCA 1EOTA 3STBD 1IBKL 2K7VA 3KBXA 5EBCA 1UUPA 2F3IA 1GO3E 3TQYA 1I4QA 1SYEA 2B2UA 3G4SA 2BA1A 1JOQA 1YJWA 1UE7A 1T5EA 4PMBA 3M4OB 3KF8A 3DLLA 3BYTB 1EY5A 1SLJA 4RKLA 2MNAA 4DNRB 1OTCA 1KIXA 4HJ5A 2EIFA 3S17H 1VQDA 3A7LA 1A15A 2K28A 1ILQA 4A3KB 1EY7A 4IZ8A 3RNUA 4OO1H 4ULLA 2NWGA 2KCCA 2YTVA 1U4RA 3QIAA 1LACA 3AFQA 4HJ7A 1NR4A 1WTHA 1N36Q 1WTVA 3H3VH 3KUPA 3HS0C 4EX5A 2O5JC 5IGFA 4HAEA 1XMQL 2ZM6Q 4A93H 3J7AF 3DWAA 3HOYB 5EKKA 1QG7A 2QEXA 5K5PA 1I3QH 3U4VA 1I94Q 1KLUD 3ULPA 3T56B 2JJQA 3UDIA 2O5IC 1Q1BA 1SMYC 3KBGA 3LNNA 4RGMA 3HOUG 3PF5A 2UXDQ 4DV3Q 3KK7A 1KQSA 2NB0A 2F0GA 1GUTA 3G7LA 2K33A 2WACA 3KOJA 4LFCL 1B70B 3W2DA 1HR0L 2O4XA 2F0DA 1NCVA 4IUUA 5AFWA 5EPJA 5CR3A 4YWMA 3KDFA 2A5HA 4LUOA 1G51A 1GUNA 2RHQB 2JE6I 1PH7A 2F0WA 1PZKD 2R7ZB 4MZ9A 3VR4A 5M9OA 1PFSA 5C3EB 1CKNB 3BS1A 1PZID 2K4KA 2P5ZX 3NBHB 4JI2Q 2UXBL 3UE0A 3HZXA 1LT4D 1M4VA 1PYSB 3IKJA 1XNQL 2IJ0A 3TREA 3R2IA 2VW9A 4B3MQ 1JMCA 4K2KA 4IJHA 2NVYH 4ZYSA 5AJ3Q 3K5NA 3HOWH 2B2TC 1IKMA 4LWCA 3OMGA 1PXUA 3R3OA 1Z6HA 5KEEA 1EU4A 3SXHA 4JBMA 1WYDA 5EAYA 4M1UB 3K80C 4A3EG 2WFWA 3CCEA 4YY3L 1E2VA 4PZ8A 4IFDJ 4IO9A 1MD2D 3V96A 5CV6A 4LNQA 1EL0A 1Q82C 1N8RC 3J80E 1EYCA 4JYAL 3BJUA 1RIPA 2I5MX 2FHTA 5E7NA 1I4RA 1WCMH 1HA5A 3HEJA 2JQOA 5FKAC 5BN3A 4POFA 3VR5A 1QILA 1ICWA 3I4OA 3TP5A 3EJIA 5C4XG 4RCNA 4C2MH 2JA5B 4LAAA 2PNHA 5JOBA 3S2DB 2ICEC 1HHVA 2KUMA 3W3AA 4LF5Q 3M4QA 2A6ED 3C1FA 1AN8A 2N49A 1Y1VH 4K5XA 4DR4Q 2EYJA 2F0QA 2PW5A 1HZCA 4DPGA 5TSSA 3MTSA 1HTPA 1N36L 4KI0A 1U9RA 1BNZA 1DZ1A 4IJLA 2ZTEA 4RKBA 1TWFH 1YBYA 2EYFA 4GNXB 2ID0A 1CKNA 1WTOA 1WOCA 1SROA 1GHKA 1S5ED 4XTCS 1KTKA 4TRDA 3H3VI 2BOSA 1GUGA 3NBHA 1ENAA 2RDFA 2UXCQ 4ME3A 1RTNA 2VB3X 1H9RA 2AUJD 3T1YL 4APVA 4AYBG 1XJVA 2UXDL 3CRKC 5IYDH 1LT5D 2RF4A 2WKDA 1A2UA 2F4VQ 3G6EA 4P71A 2K52A 1MJCA 3M3YB 3NP8A 1R9TH 1EY0A 3A5ZB 1SE3A 2AQ3B 3RZDH 4IUTA 1P8LA 5D65A 5M5YB 4DR5Q 4RHRA 2MPMA 5KNDA 4ZUJA 1V8QA 1S4ZA 3OIPA 1ASYA 3J7ZC 4DV7L 4L5TA 4C3IH 1AZQA 3I4NH 4X3TA 3S14H 1VQFA 3FKIH 4FF2A 5EPLA 1FYCA 2VUMB 4PNYA 5C44B 3BVMA 4PZ6A 4A3JB 4JI2L 4MNOA 1SJHD 5KIXA 4GNXC 4OWXB 3H94A 2EZVA 1BVSA 3J7YW 2FXQA 1S72A 2MGSA 2NTTA 2B2VC 4B9WA 4B3ML 2YTXA 1VQGA 5JPMC 3CXCA 1D5ZC 5AJ3L 1HXYD 2Z4IA 2LSSA 3HOVH 1UNSA 1JWUD 3RN5A 2RSOA 4ZLTF 3QOLA 3I3CA 2BH8A 4UP7A 5C0XH 1HQMC 4A75A 4BBSB 1CFMA 3IRBA 4CDCC 3CQZH 2JA6H 3J81E 4O0AA 1TT2A 4WRDA 1EIHA 3K0YA 2WIIB 1FD7D 3AFPA 1G6PA 1CHPD 1PMRA 4H0LC 4I65A 4LMQD 4UP9A 3TBIB 1LTBD 2E2HB 4N8X1 4S3SA 3RLOA 5BN5A 1S40A 4WORA 5I6YA 4FNFA 1VQOA 5T1GA 5CV5A 4A3FB 5FLMH 3TMEA 4K5WA 2NN6G 1K0RA 1K83B 1G2SA 2PMZB 5IGEA 1A62A 4LF9L 3DHQA 2WAQB 1IYVA 4BY1B 2A8VA 4J15A 2KQ3A 2AMCB 1PH8A 4C3HB 4A3KG 1SFOH 2EY2A 4PMCA 2E75C 1JOKA 5D3DA 3MVVA 3H0GH 1Y8PB 1PTOD 1HUMA 5D3IB 2KA7A 4O1NA 1KLGD 4DR4L 5KYLA 4Q5VA 2QGQA 1Y69U 3H09A 4FDBA 2ZT9C 4X3SA 1SXTA 1J6QA 1XPOA 1F2LA 3L7ZC 4X65L 3NBIA 1X56A 1V9PA 4K0KQ 2NVTH 4P73A 5E1FA 1ZXTA 1CSPA 1BCPB 1D8LA 1XXGA 2PNRC 4R1JA 4L8JA 2UXCL 3NXWA 1KL9A 3HKSA 3TP6A 1LT3D 4IFDI 2L0CA 2KHJA 2X6LA 2Z6KA 1H9SA 3BU2A 2WAQE 3M4PA 2UUBL 4C1NI 1GM5A 1OXXK 1HPCA 1VQHA 4CDDC 5T1IA 2AUKA 4RG1A 4GN5A 3BDLA 4QF4A 4DR5L 1MHWC 2F0KA 4F87A 4B9XA 1ZYRC 3BYYB 1XNRQ 1TIID 2Z4HA 3MFYA 5JPNC 5GADC 3PO3G 5M5XB 1XMOQ 3HOUB 3T51B 1XYIA 4H02A 1YNND 3ULJA 1WJJA 1PH6A 3BDOA 2Q8RE 2UUCL 4A3BG 1K3RA 5C5LA 2KCNA 4B3TQ 1BCPC 3GO5A 4X3UA 2IW3A 1YHAA 1J8IA 1DM0B 2EYLA 1M8AA 3CPFA 5I2YA 2G9HD 2PCFB 1Z9FA 4DAYB 1I4XA 4JI3L 2J0TD 5IGGA 3S15H 3AQQA 4DKAC 3GTMB 3HOXG 3U50C 2B2WA 3CCMA 4A3DH 3E9IA 2JEAI 3H15A 4OIJA 4DV2Q 2PI2A 5EJWA 2C35B 1LLRD 2RDGA 1SYGA 1SNPA 2KEDA 1YHQA 2V4DA 3UDGA 1PYBA 3HOWG 1EFID 4CKCA 2JA7H 1LM0A 2CCZA 3DXJC 1XWEA 5LL6X 2PPBC 2AWOA 4B3SQ 5CGKA 1JT8A 1IXRA 2Q2IA 2JA5G 1I50B 3D4RA 1LO5D 1FGBD 4GLXA 1A2TA 2JEBI 4G7HC 3ICEA 4IPGA 1P16A 3OIQA 3I8ZA 1HTLD 1AP0A 2B63H 1O78A 4R9WA 2NYZD 4TKOB 1H9KA 5KYIA 1X55A 2D9UA 1IBKQ 3KJOA 3EIVA 1GD7A 1GKHA 2E2IB 3I90A 4GS3A 1JR0D 3AB9A 3FMCA 1RDPD 2IL8A 2ZJQA 3V05A 2L9HA 1IBLQ 1SR3A 2K5HA 3ND9A 1SYDA 3CW2C 4J8QA 3Q22A 1JB7A 4OWTB 1PFNA 2F0SA 1LYLA 4XT3B 1JE5A 1DONA 1SEBD 1EZ6A 4CJ0B 3ZYYX 3S1NB 1LTRD 4K0KL 3Q24A 4ZQ3A 3VYTA 4DK1A 1KAAA 5LMUL 5D14A 3IFTA 1KD1C 5JJZA 3FPUB 3C46A 4KY5A 4JI7L 1NMGA 1J5EQ 1PA6A 5HGQA 1N9WA 2PZTA 2R7FA 5IYBG 1LTGD 3F2UA 3SHLA 4JI0Q 4QY7A 3PIO3 1TVXA 3GTKB 5CV9A 1BBWA 1WTRA 5GQOA 3OTOQ 1SN8A 1PFBA 3SK6A 3S1MH 3AMUA 4DAYA 1EQRA 2HD3A 1QNKA 5J3BA 5C44G 1XNRL 2XRSD 1CQVA 3UDFA 3ZJYC 4OIKA 3TEHB 5M3MH 4R4OA 2OF1A 3GTLB 3UE1A 4AYBB 1HR0Q 1IYUA 5FO8B 3A8KE 5EKLA 1W3SA 1QZHA 3S16B 3M4YA 1E2ZA 1AFPA 4B3TL 4JI4Q 1JJCB 1SBBB 2K50A 2EVBA 2BDNA 4K8JA 4N8FA 1GUWA 4ZUIA 5CYUA 5M3FH 5EPKA 1Y8OB 5M5WB 4KKSA 2E8GA 2AQ2B 5IWAQ 4BBSG 2VL6A 3U9OA 3SK4A 3I4NG 1U5KA 4Y7NH 3OMCA 2XSCA 1XNQQ 1A63A 3DM1A 4DUZL 2L5TA 4HEDA 1SNDA 1WTXA 4AQYQ 4ABNA 3HOZH 4DV2L 4ZAIA 2BA0A 3A56A 1VQEA 4CJ1B 3PQIA 1D2BA 4R4QA 3WOFA 4GZYC 4MTKA 3KFUA 2R93H 2F0PA 3ERSX 1HR0W 4RAUC 3I4MG 4P75A 4A3MH 4AYBE 2E2JB 5G3LF 3MAQA 5LHY1 4DR7Q 3NUCA 1HZ9A 5IGDA 1KNAA 2WAQG 1VQ9A 1Q8KA 2DY7A 2XNAC 3JAML 4C3HG 2DY8A 1HZAA 2XN9C 2VS1A 2KHSA 1QUQA 3NQIA 3EFXD 3M4OH 4OL7A 1D5XC 1WTPA 1F9RA 1EIFA 3VR3A 1TWGB 4JYAQ 1H9JA 3OW2A 3WOEA 3SDZA 3A74A 1G6ZA 4DF7A 4Z9CB 4BS9A 2B2YA 1HNZL 2HHHL 3HG9A 2PW7A 3FVQA 3J80c 4JOIC 4DXGA 4LF6L 5BR8Q 1IBLL 1FJGL 5IGCA 2EY5A 4JI8Q 5JEAG 4DK3C 4QCLA 2DJFC 2M2LA 4JBKA 3MWYW 3R8BA 5FLMG 4DV1L 2A19A 3CCLA 1BQQT 4L5SA 4KD3A 1LTLA 3L0OA 1EY9A 1TKWB 1TXYA 1Y14B 1RODA 3K58A 2E5LL 3HOYH 1TWHB 3NE5B 4A3CH 3GD7A 1J5EL 1M1KC 3K81C 4LJZC 3S1QB 1HFGA 4DK6C 4HIDA 2F1MA 5IT9E 4KV6A 2F0UA 3CMEA 3OHXC 1XPUA 4JI0L 1CT1D 5FO7B 2DN8A 4LF8L 2IX0A 2FMCA 2WV6D 4XQQA 1ENCA 2K1BA 3OTOL 1NY4A 2JK8A 4HN7A 2K32A 4JI5Q 1E1TA 1Y1WH 2JSOA 5L37A 1W2BA 3PO2G 2SNSA 2RVLA 5K36H 2EYPA 3T1YQ 3S17B 4JVZA 1V1PB 1N34L 4HCEA 1VMPA 1Q86C 4N9TA 3IL8A 1PH3A 2IX1A 2R7ZH 1I6VC 2A74C 4QMGA 1IHZA 4KKTA 3HRZC 5C3EH 1CHQD 4UY8C 3O13A 1F9PA 2N3SA 1QJOA 4DR6L 1CA5A 3MXNB 2OTJA 2K5QA 4DU9A 5FJ8G 4WJWA 4JI4L 4F8MA 3OWFA 4DV7Q 4HJ8A 4A3GH 1ICFB 1VQAA 1STAA 1E22A 4DNIA 3G48A 1LV9A 4HJ9A 1V43A 5IWAL 3QR8A 1I3QB 2UUAQ 2F0NA 3IFDA 3PO3B 1HFNA 2ENBA 2H1EA 4QIWB 1UEAB 1YVCA 1L0XB 2HIXA 4AQYL 2LXKA 4QJFA 4A3BB 2HCCA 5I4DA 2Z8LA 3GTJB 2ZXRA 5C4JH 3B6YA 3GTGH 2LMCB 3P75A 3NEMA 4DUYL 1EQVA 5LMNQ 4DFAA 1STEA 2EE1A 2EXDA 5E4XA 2Z6BA 4X66L 4DR7L 4QGUA 4C3JH 2R92G 3HOXB 4QUCA 5JJKA 5EGTA 4JI1Q 1STBA 4RGOS 1PRTF 4MN3A 3JAME 3CC7A 2D62A 2F0JA 1SSOA 2BE5D 4DR1Q 1II3A 2KOLA 3J81c 1Q8IA 1LABA 4KJOA 1EFWA 3K6OA 3PUZA 2OT2A 2SOBA 1BO0A 3DEPA 4FP5D 4QIWE 4P2CB 2A68D 3HOWB 2K5VA 2KHIA 3NPPA 3GTPB 4LF9Q 5GAHC 2AWNA 1B7YB 5BR8L 1Q90A 2AQ1B 2XTIA 1O7IA 4JI8L 1DOLA 2C5CA 5IYCG 1DD2A 2A6HD 3F8TA 2F0IA 4MTNA 1HH2P 5IIFA 3J81j 4POGA 4IOAA 1TQOA 3S9WA 1VQ5A 2VZAA 1SMXA 1KHIA 1V1PA 2B2TA 1WFQA 2Z9HA 4YCUA 1E0BA 3L9AX 2HQEA 1ONLA 4A3IH 4M8AA 4KKUA 5IODA 2E2DC 3TZUA 4BBRG 3OOCA 1JB3A 3MXNA 3GV3A 1YNJD 2FJ2A 2JA9A 3AYHB 3NELA 1PH9A 1TR5A 4X65Q 3TP8A 2ZJRA 4DK0A 2ZTDA 1DOMA 4IFDH 1TWAB 5EKIA 2D5DA 1X3GA 3E6ZX 1U4LA 2GA4B 4IN3A 1VQ7A 2PYKA 5CC4A 4JI5L 3M3YH 3TN2A 4C2MB 3FRPB 1QVCA 4DNTB 1O80A 5M5YH 3TP7A 4RFBA 1PHJA 2HIVA 2UUBQ 2YU9H 1KRSA 4NP5A 3N52A 2ZJPA 3HP3A 2VUMH 1PDQA 2K05A 1D6EC 2VQFL 2XWJB 3K59A 5JAVA 4A3JH 3KJPA 3NENA 1K73C 3CC4A 3PUYA 2K5NA 4OGQC 1NE3A 4ALPA 1LTTD 3PMFA 4L63B 5C0XJ 2ES2A 4FF3A 2JA8G 3STBC 4A3LH 1GJXA 1JC7A 3I7FA 1EWCA 4QL5A 4BA2I 2CKZB 4L6TB 5KNCA 2UUAL 4B3RQ 3VYSA 1EIGA 2UUCQ 1EY8A 2PO4A 5E4WC 3NTKA 3QB3A 1IKLA 1ILPA 5HGTA 2F52A 5JVH3 4UDUC 3GTOB 4BXXH 2D2CC 1OXVA 3MEFA 1BBXC 4HTHA 3QJYA 2WKCA 2JN4A 5IP9G 3A0JA 4G57A 5JEAJ 1VF7A 1STYA 4X64Q 1A8VA 3RZDB 4JI3Q 3J81i 2FMMA 4ODGA 3I2ZA 2CW0D 3A8JE 3KLRA 3K5OA 1DJRD 3I4NB 5LMNL 3SK5A 1EEID 1V1QA 3FKIB 2E2HH 3U9SA 2F0HA 3UDXA 1X54A 1MKHA 1IW7D 1F9QA 2MQHA 2Q8TA 4JI1L 2HDMA 2DNEA 4A3FH 1C4QA 5IP7G 4DGZA 5JVG3 1K83H 1LTAD 3PIP3 4DR1L 3IAYA 3SVMA 4BY1H 4TSSA 4J6HA 4TVAB 3I4MB 2OWOA 3BZKA 3NSWA 2QW7A 2F0OA 2NVXH 1SNCA 3HOVB 1N32Q 4RWSC 3E9HA 4BY7G 4GNXA 1JOOA 2MHVA 3K5MA 1NTGA 3OSOA 2SDFA 1QZGA 2B2VA 3S1RB 1AEXA 2OCEA 4ZKBB 1KNEA 1VQMA 2WB1G 3CQZB 1I4HA 2JA6B 2LS01 3QWNA 1UAPA 1I6HB 2DNCA 3PIPA 4KJNA 4EQ5A 2HDLA 2NVQH 3CHBD 3HFZB 1GXDC 3DEOA 4FXGC 5COYA 4HJAA 5FLXL 3Q0AA 1E3PA 2A1AA 2AHOB 3RMHA 3GTQH 3CMAA 1T9HA 2KJXA 2RKSA 1IL8A 4UP8A 1Y8NB 4BWGB 3D4WA 1BDOA 1Q12A 4XYOA 2QDBA 2EQSA 2I0QA 5LMUQ 1PH2A 5CV7A 3K7AH 4JI7Q 1BCPF 1A3VA 1NAPA 4EQOA 4OO1G 3PUXA 3NQTA 2PMZE 3X3NA 2RSNA 3H0GB 3OYYA 2PQAB 3K8AA 2Q2TA 2GVAA 4O2DA 1NSNS 2KEEA 5M5XH 3HOUH 3NHHA 3SK8A 1U0LA 2VY3A 3FDTA 4GKKQ 4HIOA 2HUGA 1ZEQX 4A93G 1A3TA 2H5XA 1QOHA 4IOCA 3VDYA 1IBMQ 2I07B 4KN7C 4DR3Q 3PO2B 3Q6SA 2Y0SB 2K03A 3K0XA 2A68C 2NVTB 1AH9A 5DM63 2QILA 3QOJA 4KN4C 4FVMA 5KRUA 1YNXA 1UE6A 2WINB 4B3RL 1GUSA 1B4OA 4GOPB 4ILWA 3BG3A 3P20A 3GV6A 1S5CD 3GQBA 3Q8DA 3R93A 1K3BC 1SNQA 1VQ4A 1UWVA 2HQLA 5C6AA 1E1OA 1FNVA 2XGTA 1FL0A 3TDQA 2A6EC 3JC66 1G291 4I7ZC 2G9DA 4L5RC 4X64L 1C7YA 2Q2UA 1S5FD 4YIJA 2RCNA 3W1BA 4A3GG 4N9PA 4DUZQ 3RZOB 2UU9Q 1HUNA 2K01A 1BUVT 1BOSA 3AU7A 5G3LD 1HA6A 1K8OA 4V190 1YIJA 1X9NA 3D8GA 2MFIA 4JG2A 3CAMA 2Q2HA 1I50H 3F2DA 4A3EH 4PG3A 2Y0SE 3VR6A 3CC2A 4FXDA 4GOPC 2Q8IB 3X3MA 1A3UA 5KNBA 1B53A 2ALYB 1NR2A 1N32L 1NMFA 2VNUD 2E2IH 2R92B 1K0SA 3KYHC 3CCRA 1K8GA 4A3DB 1KC8C 4PZ7A 3R2TA 1K9MC 1D1KA 1SMYD 1X3QA 2X6GA 1PVOA 1RD9D 4CDFC 5C4XH 1BR9A 5J22A 2A69D 2HHHQ 1HNZQ 4L5QA 4H44C 3W5OA 3UI2A 4LF6Q 1FJGQ 4CKEA 3EA6A 5A2QL 1WCMG 1TS3A 1KDBA 2YV5A 3S2HB 1TWCB 5FLXE 1YJNA 1VMCA 2JA7B 4AH6A 2D0PA 1RKNA 1PH4A 1CKOA 2IX3A 4LF4L 4DV1Q 2F0MA 4AIMA 2N8NA 1IZ6A 4NXML 2B8GA 3VYRA 4XQJA 3D0FA 1EY6A 4QB4A 5DAUA 3MZ5A 5DLQE 2X69A 3GTKH 2F0VA 4FO2A 2E5LQ 3A8IE 1QWYA 1PTOB 4BBRB 3E5SA 2B63B 4A3IG 1Y1VG 2N78A 5DNFA 3T53B 4H7BA 1A0IA 1PYWD 4KLKA 2VQEQ 4LF8Q 3G71A 3DUZA 2CWPA 3GTLH 5IT9c 4XYQA 1DYQA 4GKKL 3RLFA 2EY1A 3P1HA 1IBML 2R61A 1F2YA 1ET6A 4DR3L 1N34Q 5ELBA 4LF7L 2EOTA 4IUVA 2K5DA 3BZCA 2B39A 3KF8B 2IT1A 4DR6Q 1KXLA 5IYDG 3GDEA 5M5WH 4JPBW 1E7ZA 1SNMA 1TY0A 1TS4A 4A4IA 4UAIA 1PTOC 1EOVA 1EIYB 4DV5Q 1N33Q 1C0AA 1NBWA 2MO0A 2JA8B 5CBAE 2ZXOA 2ATWA 4MHEA 4C3IG 3D3RA 3FKIG 1L2FA 4HMIA 1MSHA 1E2WA 1S5DD 4RCOA 4UHVA 2UU9L 3MA2B 1EYDA 4IUPA 5M3MB 2YTYA 2E2JH 2D0OA 1HNXQ 5H1SE 2ZXPA 4KTAA 2K14A 2BCOA 1JJGA 2RCFA 1D5MC 1KRTA 1SJED 4DXFA 2B2UC 4I7AA 4DA2A 2MO1A 2G5DA 1PRTD 1VS0A 1RJTA 4DUYQ 3HOVG 3RR5A 4X66Q 1EYGA 3SEBA 3I73A 4PV1C 4EVOA 4LW1A 1H9MA 5C0XG 4DV0Q 1AE2A 1VQNA 4Y7NB 3TRZA 3CCQA 3HKZG 4JK1C 3KDFB 1IL2A 5I9OA 4K6LA 4CJ2C 3M85A 2JA6G 4U673 1B9NA 3A7AB 4HR7B 2NN6H 3JAMc 1X3PA 1VQBA 5ELOA 3ND8A 1MBYA 1ESFA 1YNNC 2LFNA 4A3KH 2MUYA 4X6AH 4R4TA 2M9VA 2A73B 4KY7A 4P74A 1YI2A 1F77A 1KAWA 2L15A 1A6XA 5A2QE 4G4KA 3H91A 4BY7B 1M90C 1JJ2A 1MGSA 1TWHH 2HCIA 4R8IA 4DAVA 4OHJA 3T4AC 2MP1A 3E3XA 1CK1A 2WB1B 5EBDA 2DGYA 3H0GG 1Z47A 1DOKA 3HGBA 1VQ8A 3FPPA 4JV5Q 2N88A 1RTOA 1GOZA 2KVMA 1ESRA 3BVGA 1FGUA 1KDAA 1VDZA 4PMWA 2VQEL 1CSQA 3V2TA 1VQ6A 3E0JA 5CBEE 1SE8A 4WJ3M 5I9PA 4HIMA 1CKMA 4O42A 1C9OA 1B9MA 2Y0SG 3A5UA 1V1OA 4YHHQ 3MXPA 3CPWA 3I4LA 3URYA 1YEZA 3DWQA 1NUCA 1VQIA 2ZTCA 2CFMA 3EROA 1MJEA 4XQNA 4JOIA 4JC0A 2VQFQ 2RQXA 1SE4A 4CDEC 4KHZA 3PO3H 2N55A 4IUQA 5ELEA 3T16A 3GP7A 5KGUA 2WB1E 4GN4B 2NTSA 5JJLA 3QG1A 2NZOA 1ZKOA 1X32A 3OWEB 1C8CA 2DJGC 5BN4A 4A93B 5DEHA 4XXEA 3CCUA 1JE4A 2A69C 4DV5L 1N33L 4A3BH 4KMUC 1B1ZA 1EEFD 4R8NA 3GTJH 2OQKA 4R4CA 1Y1WB 1S3OA 2KENA 4NXNQ 2J7ZA 1D1IA 1J9OA 2CH4W 2I5HA 4IUNA 4OEMB 1QB5D 4LUVA 1HNXL 2B8FA 1EQTA 1VQCA 4U68A 1VQLA 5FK9C 1XTCD 1QNUA 3HOXH 1Q46A 3OW7A 1NNXA 4LUZA 3SR1A 4CBVA 1UE5A 3TS2A 4DAPA 5GROA 2CQOA 4LFBQ 3JAMi 2K04A 4A3GB 1VF5C 3NTHA 3WDNA 1BKBA 2CVRA 5FOBB 3J80i 3H3VC 1TS2A 5HURA 4EGVA 4DV0L 4A3DG 3S24A 3AEVA 2K75A 3GTPH 1EWHA 1TU2B 2CQAA 2EDGA 1I4PA 4YCWA 4GKJQ 2NBFA 1D7QA 1KABA 2JA5H 1SNOA 3PV0A 1QE6A 1PH1A 3S2DH 2L11A 1O7ZA 2MJ8A 2NVYB 4JCVE 5C5MA 3J81L 1W6KA 2CWAA 1PRTB 4RMFA 2NN6I 1MIUA 2JA7G 4JW0A 5C4JB 4P72A 3FEWX 1AZPA 1IYJB 4CGYB 3GTGB 4ZK9B 1PFMA 2QKIC 1QVFA 5ELNA 4X62L 3ER0A 1ZYRD 1Q7YC 2F0TA 4C3JB 3KLSX 1JORA 1WI5A 1CM9A 5LMNW 1X65A 2RA4A 4KHPQ 1BBUA 1SYBA 1TWAH 2B63G 3EBEA 4IQZA 2F0LA 1CI3M 4JV5L 2K6AA 1SDFA 1Q1EA 1BCPD 1WCMB 5HY6A 4RA8A 3T1HQ 3EN2A 1AE3A 2BH2A 5CV4A 1PV4A 2YYZA 2F0FA 1AW7A 5IYBH 1O7LA 1PRTC 4E6IA 4YHHL 4OO1I 3J7AV 3U58A 2DUDA 1WVLA 4FF4A 1EZ8A 2EYMA 3I91A 1HQRD 5I2XA 4WJ4A 3F2BA 2IWHA 4A3IB 5CV8A 2ZM6L 2EJGC 1Y1VB 1TY2A 3DM3A 5C44H 4KD4A 3QO2A 4IURA 4HCSA 3OPOA 4LK1C 2F3WA 1I94L 2I46A 4F7XA 4DR2Q 3I56A 4CHTB 1G8ZD 2L4NA 2IHEA 2JYOA 4DV3L 3MXUA 5A35A 1TWFB 3GTOH 1WTWA 1EY4A 1RF2D 4K6DA 5C4ZA 2RDHA 1HJPA 5NUCA 1ET9A 4NXNL 5M3MG 3RLNA 2KBNA 1B3QA 1LTSD 3DWPA 1U4MA 2YU9B 4BBSH 1MSGA 2O2LD 2EPBA 4NW2A 1OXSC 1R9TB 3M7GA 4YWKA 5C4HA 3P7JA 2NZHA 2EYOA 4A76A 3J7A5 4LFBL 5M3FG 2XWBB 1W6JA 3S14B 4C3IB 1H9SB 4F88A 2C9OA 1EU3A 3ERQA 1FVIA 3VA5A 4HIKA 2PZUA 2FFKB 3I4MH 5J39A 1DCZA 2OQ0A 4EQPA 1B8AA 4K8IA 1Z7TA 4TQUS 3HOZG 4GKJL 2J4XA 4YCVA 3VR2A 4DV6Q 4C3HH 2QA4A 3G6JB 3S1RH 4FF1A 2R93G 4C1NK 1YHBA 3SE0A 3CP0A 4A3MG 4GLAC 1I6HH 2XIWA 1YJ9A 4DV4Q 3MFGA 1F9SA 2SEBD 3PUWA 4V0BA 4K14A 1F2MA 4NDXA 2EJFC 1SRUA 3EVQA 1X6OA 3HKZB 4Y52H 4LFAQ 3ULLA 3D6WA 2Z6KC 3FP9A 5JEAH 1E24A 4KHPL 2F3VA 1DXMA 1LUZA 4HMJA 1K28A 2F03A 1RHPA 5IE8A 1R4PB 4NMZA 4KK7A 1PLFA 3CCSA 4OX9Q 2HT1A 1JICA 4LF4Q 3BVZA 3CKIB 2QEJC 4NXMQ 2NVXB 5EQ0A 3T1HL 5IOCA 1TS5A 1G91A 1WTQA 5FLXc 4LF5L 2F0EA 3PUVA 2KCMA 4CKBA 1QVGA 4EQNA 1JQYD 4JI6Q 1SFOB 2GVBA 1GUOA 3RN2A 5CMDA 3RUZA 1EYAA 3HOYG 1U4PA 4A3CG 3PO2H 2NVQB 1STGA 1CZGA 1PH5A 2KCTA 1JCKB 5IY0A 1FNUA 3HKZE 2BE5C 3I70A 4KY6A 1MI2A 4RH6A 1I5FA 5ISRA 4R4IA 4QUFA 4DR2L 3F1ZA 4B08A 3GTQB 3M7NA 2RHSB 4YWLA 4DN4M 4Q0FA 3LWUA 2B2WC 1Y1WG 4LF7Q 2R7DA 3K57A 1PZJD 3D4DA 4RHSA 5FJ8H 1OXTA 2F4VL 5K36G 1STNA 2NZ1D 3K7AB 2TMPA 2PI2E 2A6HC 2CHBD 2GN5A 3WWVA 2R7ZG 5J1ZA 5C3EG 2JP1A 4JBWA 3MC0B 3TSSA 3GTMH 3RZOH 1HRJA 1HNWQ 2CH4A 3PCOB 2M00A 3NTIA 1JWMD 3K5LA 3PSIA 2XVSA 1G2TA 3CRLC 3Q23A 1ENFA 1EQQA 3DMUA 1YNJC 3KLWA 1CZWA 5DM73 1I4GA 4XDXA 3PF4A 1CUKA 1FR3A 2L55A 3D31A 2IY5B 1C48A 3A55A 3D6CA 5E3FA 1S5BD 4OELB 2R92H 4QQBX 3L2PA 5CORA 4DV6L 3VYUA 4NPSA
chains in the Genus database with same CATH topology
2EXDA 4X66L 3IRBA 3M9BA 1EYGA 4QGUA 3CQZH 4C3JH 2R92G 3KF6B 2JA6H 5JJKA 4LW1A 4O0AA 5C0XI 5C0XG 4JI1Q 4DV4L 2OTLA 4DV0Q 5JJIA 1AE2A 1VQNA 3CC7A 3TRZA 1UEBA 2D62A 3CCQA 3AFPA 3HKZG 3KDFB 1G6PA 1IL2A 3M85A 4DR1Q 4UP9A 2JA6G 1EUJA 3J81c 1EFWA 3PUZA 3RLOA 3S2HH 1TWCH 3JAMc 1VQPA 1S40A 4LFAL 5ELOA 1VQBA 1VQOA 2PQAA 4QIWE 3S1NH 5IYCH 2K5VA 4A3KH 2KHIA 5FLMH 3TS0A 4X6AH 2NN6G 1K0RA 4R4TA 4LF9Q 4LF9L 1A62A 5GAHC 2AWNA 1B7YB 4P74A 5BR8L 1YI2A 1KAWA 2L15A 2XTIA 1O7IA 4J15A 3W1GA 4JI8L 2A8VA 2AMCB 1EWIA 1DGSA 1PH8A 5IYCG 4A3KG 1TWHH 3F8TA 4MTNA 1SFOH 3J81j 1HH2P 1L0WA 4IPHA 1JJ2A 4POGA 4JBJA 4IOAA 4BBRH 1L1OB 3SGIA 1VQ5A 3H0GH 2VZAA 1SMXA 1KHIA 4YCUA 1WFQA 4DAMA 3LGJA 3F2CA 3CCJA 4A3IH 2DGYA 4BBRG 4DR4L 2QGQA 4JI6L 3H0GG 1Z47A 1X3FA 4FDBA 4GOPA 1VQ8A 4JV5Q 4GN3B 1J6QA 2Z0SA 1XPOA 2JA9A 3AYHB 3NELA 1PH9A 1FGUA 3E0EA 3L7ZC 4NB3A 4X65Q 4X65L 2ZJRA 4PMWA 2ZTDA 2VQEL 3CCVA 1X56A 1V9PA 1HZBA 4K0KQ 1CSQA 2NVTH 5GAEC 4P73A 1VQ6A 1SE8A 1X3GA 4OX9L 1CSPA 1VQ7A 3M3YH 4WJ3M 4JI5L 1D8LA 4HIMA 1QUQB 4R1JA 1CKMA 1QVCA 1C9OA 3S16H 1KL9A 3HKSA 2UXCL 2Y0SG 3A5UA 4IPDA 4IFDI 4IFDG 4YHHQ 2KHJA 5M5YH 3CPWA 3CD6A 2WP8J 2R6GA 2Z6KA 1PHJA 3BU2A 2HIVA 2UUBQ 2YU9H 2WAQE 3M4PA 2UUBL 1YEZA 1VQIA 1KRSA 2ZTCA 2CFMA 1GM5A 1MJEA 1OXXK 1XMQQ 2ZJPA 4JOIA 1L1OC 2VUMH 4JC0A 1VQHA 2VQFQ 2VQFL 3CF5A 4RG1A 4A3JH 4GN5A 2JA8H 3KJPA 3NENA 4KHZA 3FHWA 4DR5L 3PO3H 1K73C 1N32Q 3CC4A 3PUYA 2K5NA 1NE3A 2VUMG 4ALPA 2WB1E 4GN4B 5JJLA 5GAGC 1XNRQ 2NZOA 5C0XJ 2ES2A 4A3JG 3STBC 2JA8G 1X3EA 4A3LH 5GADC 1HNWL 1K8AC 3CCUA 4DV5L 1N33L 3K7UC 3PO3G 1XMOQ 4A3BH 2UXDQ 1XMOL 3I7FA 4LFCQ 3KF6A 4QL5A 4BA2I 1NJIC 3GTJH 2OQKA 2CKZB 1XTDA 1RL2A 1WJJA 4H02A 4R4CA 3ULJA 2UUAL 1PH6A 4B3RQ 1S3OA 1UE1A 2KENA 4NXNQ 4A3LG 2UUCQ 2UUCL 4A3BG 1GVPA 1K3RA 5IP9H 4B3TQ 3PGZA 2F52A 2I5HA 3PIOA 3GO5A 1VCIA 4GLVB 1ASZA 4BXXH 4LUVA 1HNXL 1OXVA 3MEFA 4BA1I 1VQLA 1VQCA 1YHAA 1H95A 5IP9G 3CPFA 3A0JA 3U4ZA 3HOXH 5JEAJ 1Q46A 1Z9FA 4DAYB 4LUZA 1A8VA 4X64Q 4BXXG 1XPRA 1YZ6A 3J81i 4JI3Q 4JI3L 2UXBQ 1UE5A 3TS2A 2B3GA 4OXPA 3I2ZA 5GROA 3I55A 4XIGS 2CQOA 3S15H 4OONA 3AQQA 4DKAC 3JAMi 4LFBQ 3HOXG 3U50C 3CCMA 4A3DH 5LMNL 1V1QA 1YITA 2E2HH 1VQJA 5IP7H 1TWGH 4QQBX 1BKBA 3E9IA 2JEAI 3H15A 4DV2Q 3UDXA 2PI2A 1X54A 1L1OA 1MKHA 3J80i 2C35B 2MQHA 4JI1L 1VQKA 4DV0L 4A3DG 3S24A 1YHQA 3AEVA 2K75A 4A3FH 2IHFA 2ASBA 3UDGA 5IP7G 3GTPH 1K83H 2I5LX 4DR1L 4YCWA 1PYBA 4GKJQ 1D7QA 4BY1H 4OWWB 2JA5H 3PV0A 4IPCA 4TVAB 4BY7H 3HOWG 1PH1A 3S2DH 2JA7H 1LM0A 4A3FG 2CCZA 2OWOA 3BZKA 4JCVE 2NVXH 4BY1G 2AWOA 4YY3Q 4B3SQ 4B3SL 2CWAA 1IXRA 2Q2IA 4RMFA 2NN6I 1MIUA 2JA5G 3E9HA 4BY7G 4GNXA 2B29A 2JA7G 4P72A 4GLXA 2LXJA 1NTGA 2JEBI 1IYJB 3ICEA 4IPGA 1QVFA 1Q81C 1QZGA 4X62Q 5ELNA 1P16A 4X62L 2OCEA 3ER0A 3S1QH 1VQMA 1Q7YC 1OXUA 2WB1G 2V1CC 2B63H 1WI5A 2AKWB 4UPAA 1X55A 5LMNW 1IBKQ 3STBD 1IBKL 3PIPA 3KJOA 3EIVA 2F3IA 1GD7A 1GKHA 1GO3E 3TQYA 1X65A 4EQ5A 2NVQH 4KHPQ 1JT8A 3G4SA 1BBUA 4GS3A 2BA1A 3HFZB 1YJWA 1UE7A 1TWAH 2B63G 3EBEA 3DLLA 2ZJQA 1IBLQ 1SR3A 1SLJA 2K5HA 3CW2C 2MNAA 4HJAA 1JB7A 4JV5L 4OWTB 1OTCA 1E3PA 2A1AA 1LYLA 2AHOB 1KIXA 3GTQH 1Q1EA 1T9HA 1JE5A 2EIFA 1VQDA 3CMAA 4HJ5A 3S17H 4UP8A 5HY6A 3T1HQ 1Q12A 1AE3A 3EN2A 2BH2A 1PV4A 4K0KL 2EQSA 3RNUA 2I0QA 5LMUQ 5LMUL 1PH2A 2YYZA 1KD1C 5IYBH 3K7AH 4JI7Q 2YTVA 4JI7L 1NMGA 1J5EQ 4YHHL 3AFQA 5HGQA 1PA6A 4OO1I 4OO1G 1N9WA 3PUXA 2DUDA 3U58A 4HJ7A 2PMZE 2R7FA 3OYYA 5IYBG 2PQAB 1N36Q 3K8AA 3H3VH 2Q2TA 4JI0Q 4EX5A 4QY7A 4WJ4A 3F2BA 2GVAA 1XMQL 4O2DA 2ZM6Q 4A93H 2ZM6L 5M5XH 1BBWA 3DM3A 5GQOA 5C44H 3OTOQ 3HOUH 1SN8A 3S1MH 2QEXA 1U0LA 1I3QH 2VY3A 3U4VA 1I94Q 3ULPA 1I94L 1EQRA 4GKKQ 2JJQA 4HIOA 4DR2Q 3UDIA 4A93G 3I56A 1Q1BA 2H5XA 5J3BA 5C44G 1XNRL 3ZJYC 3UDFA 3PF5A 3HOUG 4IOCA 2IHEA 4DV3Q 3VDYA 4DV3L 1IBMQ 3TEHB 5M3MH 4DR3Q 1KQSA 4R4OA 3GTOH 3K0XA 1AH9A 3UE1A 1HR0Q 4DR7L 1YNXA 3KOJA 1UE6A 1B70B 4LFCL 1HR0L 1HJPA 1W3SA 4B3RL 4NXNL 5M3MG 4GOPB 1QZHA 4YWMA 3RLNA 2KBNA 3KDFA 3Q8DA 4B3TL 4LUOA 1G51A 1VQ4A 4JI4Q 1UWVA 2HQLA 2RHQB 1JJCB 2K50A 2JE6I 1E1OA 1PH7A 4BBSH 2XGTA 4MZ9A 1FL0A 1PFSA 1CKNB 1OXSC 3JC66 2K4KA 1G291 5M3FH 4YWKA 4A3GH 4L5RC 2E8GA 4X64L 1C7YA 5IWAQ 2Q2UA 3NBHB 2VL6A 4JI2Q 4BBSG 2RCNA 3W1BA 3I4NG 4A3GG 2UXBL 1U5KA 3UE0A 4Y7NH 2NZHA 1A63A 1PYSB 4A76A 1XNQQ 4DUZQ 1XNQL 3J7A5 4DUZL 4LFBL 5M3FG 2UU9Q 1M90C 3TREA 4AQYQ 2VW9A 1FVIA 4HIKA 4DV2L 3HOZH 4B3MQ 1JMCA 3I4MH 4IJHA 2NVYH 2BA0A 1VQEA 5AJ3Q 2OQ0A 1YIJA 1X9NA 3HOWH 2MFIA 1B8AA 4JG2A 3CAMA 2Q2HA 4R4QA 1I50H 3F2DA 3KFUA 4TQUS 2R93H 3ERSX 3HOZG 1HR0W 4A3EH 4LWCA 4PG3A 3I4MG 2Y0SE 4GKJL 4P75A 4YCVA 4A3MH 3CC2A 4AYBE 4DV6Q 4JBMA 4C3HH 2QA4A 4GOPC 1WYDA 5EAYA 3S1RH 4DR7Q 1HZ9A 2R93G 1VQ9A 3K80C 2WAQG 4A3EG 1YHBA 2WFWA 1Q8KA 3CCEA 4YY3L 3CP0A 2ALYB 4A3MG 1N32L 1NMFA 4GLAC 4PZ8A 3HOVG 1YJ9A 4DV4Q 1I6HH 4IFDJ 2VNUD 1HZAA 4IO9A 2VS1A 3PUWA 2E2IH 3KYHC 1QUQA 4LNQA 3M4OH 3CCRA 1K8GA 1SRUA 1KC8C 4PZ7A 1Q82C 1X6OA 1EIFA 1N8RC 1K9MC 4JYAQ 3OW2A 3BJUA 1RIPA 4JYAL 4Y52H 2I5MX 4LFAQ 3ULLA 1PVOA 5E7NA 5C4XH 1WCMH 2Z6KC 3A74A 3FP9A 2JQOA 1E24A 4POFA 2HHHQ 1HNZQ 4L5QA 2HHHL 1HNZL 4KHPL 3W5OA 3I4OA 1LUZA 3J80c 4LF6Q 1FJGQ 4JOIC 4LF6L 1FJGL 5BR8Q 1IBLL 5C4XG 1WCMG 5IE8A 4C2MH 4JI8Q 5JEAG 4DK3C 2YV5A 4OX9Q 2PNHA 3CCSA 1YJNA 4JBKA 2HT1A 4AH6A 2D0PA 5FLMG 1PH4A 4LF4Q 1CKOA 4LF4L 4DV1Q 4NXMQ 4DV1L 4AIMA 4NXML 2N8NA 1IZ6A 3T1HL 2A19A 3CCLA 3D0FA 4L5SA 1LTLA 3L0OA 4LF5Q 3M4QA 5FLXc 5DLQE 4LF5L 1TXYA 3GTKH 2N49A 1Y14B 1Y1VH 3PUVA 2KCMA 1QVGA 4DR4Q 2E5LQ 4JI6Q 2E5LL 3HOYH 2GVBA 3RN2A 4A3CH 3GD7A 1J5EL 1M1KC 1HZCA 3K81C 4DPGA 4DK6C 4HIDA 4A3IG 1Y1VG 2N78A 1N36L 4KI0A 3CMEA 1A0IA 1XPUA 3HOYG 4JI0L 4KLKA 4IJLA 2ZTEA 4A3CG 2VQEQ 4LF8Q 1TWFH 1YBYA 2IX0A 4LF8L 4GNXB 3G71A 2ID0A 1CKNA 3PO2H 1WOCA 1SROA 2CWPA 2KCTA 3OTOL 4XTCS 5IY0A 3HKZE 1NY4A 2JK8A 3GTLH 3H3VI 5IT9c 4JI5Q 1E1TA 1Y1WH 2UXCQ 1I5FA 1W2BA 4GKKL 4ME3A 4R4IA 3RLFA 4DR2L 3PO2G 3F1ZA 3M7NA 2RHSB 3T1YQ 3T1YL 4YWLA 4APVA 4AYBG 1XJVA 2UXDL 1IBML 5IYDH 4DR3L 1Y1WG 1N34Q 2R7DA 2RF4A 1N34L 4LF7Q 4LF7L 1Q86C 1PH3A 5FJ8H 2IX1A 1OXTA 2F4VQ 2R7ZH 3G6EA 2F4VL 4P71A 2K52A 1MJCA 5C3EH 5K36G 4UY8C 3BZCA 1R9TH 3KF8B 2IT1A 2N3SA 4DR6Q 3A5ZB 5IYDG 3GDEA 5M5WH 3MXNB 4DR6L 1KXLA 2OTJA 3RZDH 2PI2E 1P8LA 2GN5A 3WWVA 5FJ8G 4DR5Q 2R7ZG 4JI4L 1E7ZA 5C3EG 4JBWA 3GTMH 3RZOH 1ASYA 3J7ZC 4DV7Q 4HJ8A 4DV7L 4L5TA 4C3IH 3I4NH 4A4IA 3S14H 1VQAA 1VQFA 3FKIH 1EOVA 1HNWQ 1E22A 4DNIA 1EIYB 4DV5Q 1N33Q 3G48A 3PCOB 1C0AA 4HJ9A 1NBWA 2MO0A 1V43A 4PZ6A 1PH5A 5IWAL 2ATWA 3PSIA 4JI2L 2UUAQ 4MNOA 3FKIG 1L2FA 4OWXB 4GNXC 1EQQA 1BVSA 2FXQA 3KLWA 1S72A 2UU9L 1YVCA 2YTYA 2HIXA 4AQYL 2LXKA 4QJFA 1CUKA 2E2JH 3PF4A 2D0OA 1HNXQ 5H1SE 4B3ML 2YTXA 1VQGA 3CXCA 2K14A 3D31A 2IY5B 5AJ3L 1JJGA 1KRTA 2LSSA 3HOVH 3RN5A 5C4JH 2R92H 2MO1A 3B6YA 3GTGH 1VS0A 3L2PA 2BH8A 4UP7A 3NEMA 4DV6L 4DUYQ 4A75A 4DUYL 5LMNQ 3RR5A 4X66Q 4NPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXD A;  4X66 L;  3IRB A;  3M9B A;  1EYG A;  4QGU A;  3CQZ H;  4C3J H;  2R92 G;  3KF6 B;  2JA6 H;  5JJK A;  4LW1 A;  4O0A A;  5C0X I;  5C0X G;  4JI1 Q;  4DV4 L;  2OTL A;  4DV0 Q;  5JJI A;  1AE2 A;  1VQN A;  3CC7 A;  3TRZ A;  1UEB A;  2D62 A;  3CCQ A;  3AFP A;  3HKZ G;  3KDF B;  1G6P A;  1IL2 A;  3M85 A;  4DR1 Q;  4UP9 A;  2JA6 G;  1EUJ A;  3J81 c;  1EFW A;  3PUZ A;  3RLO A;  3S2H H;  1TWC H;  3JAM c;  1VQP A;  1S40 A;  4LFA L;  5ELO A;  1VQB A;  1VQO A;  2PQA A;  4QIW E;  3S1N H;  5IYC H;  2K5V A;  4A3K H;  2KHI A;  5FLM H;  3TS0 A;  4X6A H;  2NN6 G;  1K0R A;  4R4T A;  4LF9 Q;  4LF9 L;  1A62 A;  5GAH C;  2AWN A;  1B7Y B;  4P74 A;  5BR8 L;  1YI2 A;  1KAW A;  2L15 A;  2XTI A;  1O7I A;  4J15 A;  3W1G A;  4JI8 L;  2A8V A;  2AMC B;  1EWI A;  1DGS A;  1PH8 A;  5IYC G;  4A3K G;  1TWH H;  3F8T A;  4MTN A;  1SFO H;  3J81 j;  1HH2 P;  1L0W A;  4IPH A;  1JJ2 A;  4POG A;  4JBJ A;  4IOA A;  4BBR H;  1L1O B;  3SGI A;  1VQ5 A;  3H0G H;  2VZA A;  1SMX A;  1KHI A;  4YCU A;  1WFQ A;  4DAM A;  3LGJ A;  3F2C A;  3CCJ A;  4A3I H;  2DGY A;  4BBR G;  4DR4 L;  2QGQ A;  4JI6 L;  3H0G G;  1Z47 A;  1X3F A;  4FDB A;  4GOP A;  1VQ8 A;  4JV5 Q;  4GN3 B;  1J6Q A;  2Z0S A;  1XPO A;  2JA9 A;  3AYH B;  3NEL A;  1PH9 A;  1FGU A;  3E0E A;  3L7Z C;  4NB3 A;  4X65 Q;  4X65 L;  2ZJR A;  4PMW A;  2ZTD A;  2VQE L;  3CCV A;  1X56 A;  1V9P A;  1HZB A;  4K0K Q;  1CSQ A;  2NVT H;  5GAE C;  4P73 A;  1VQ6 A;  1SE8 A;  1X3G A;  4OX9 L;  1CSP A;  1VQ7 A;  3M3Y H;  4WJ3 M;  4JI5 L;  1D8L A;  4HIM A;  1QUQ B;  4R1J A;  1CKM A;  1QVC A;  1C9O A;  3S16 H;  1KL9 A;  3HKS A;  2UXC L;  2Y0S G;  3A5U A;  4IPD A;  4IFD I;  4IFD G;  4YHH Q;  2KHJ A;  5M5Y H;  3CPW A;  3CD6 A;  2WP8 J;  2R6G A;  2Z6K A;  1PHJ A;  3BU2 A;  2HIV A;  2UUB Q;  2YU9 H;  2WAQ E;  3M4P A;  2UUB L;  1YEZ A;  1VQI A;  1KRS A;  2ZTC A;  2CFM A;  1GM5 A;  1MJE A;  1OXX K;  1XMQ Q;  2ZJP A;  4JOI A;  1L1O C;  2VUM H;  4JC0 A;  1VQH A;  2VQF Q;  2VQF L;  3CF5 A;  4RG1 A;  4A3J H;  4GN5 A;  2JA8 H;  3KJP A;  3NEN A;  4KHZ A;  3FHW A;  4DR5 L;  3PO3 H;  1K73 C;  1N32 Q;  3CC4 A;  3PUY A;  2K5N A;  1NE3 A;  2VUM G;  4ALP A;  2WB1 E;  4GN4 B;  5JJL A;  5GAG C;  1XNR Q;  2NZO A;  5C0X J;  2ES2 A;  4A3J G;  3STB C;  2JA8 G;  1X3E A;  4A3L H;  5GAD C;  1HNW L;  1K8A C;  3CCU A;  4DV5 L;  1N33 L;  3K7U C;  3PO3 G;  1XMO Q;  4A3B H;  2UXD Q;  1XMO L;  3I7F A;  4LFC Q;  3KF6 A;  4QL5 A;  4BA2 I;  1NJI C;  3GTJ H;  2OQK A;  2CKZ B;  1XTD A;  1RL2 A;  1WJJ A;  4H02 A;  4R4C A;  3ULJ A;  2UUA L;  1PH6 A;  4B3R Q;  1S3O A;  1UE1 A;  2KEN A;  4NXN Q;  4A3L G;  2UUC Q;  2UUC L;  4A3B G;  1GVP A;  1K3R A;  5IP9 H;  4B3T Q;  3PGZ A;  2F52 A;  2I5H A;  3PIO A;  3GO5 A;  1VCI A;  4GLV B;  1ASZ A;  4BXX H;  4LUV A;  1HNX L;  1OXV A;  3MEF A;  4BA1 I;  1VQL A;  1VQC A;  1YHA A;  1H95 A;  5IP9 G;  3CPF A;  3A0J A;  3U4Z A;  3HOX H;  5JEA J;  1Q46 A;  1Z9F A;  4DAY B;  4LUZ A;  1A8V A;  4X64 Q;  4BXX G;  1XPR A;  1YZ6 A;  3J81 i;  4JI3 Q;  4JI3 L;  2UXB Q;  1UE5 A;  3TS2 A;  2B3G A;  4OXP A;  3I2Z A;  5GRO A;  3I55 A;  4XIG S;  2CQO A;  3S15 H;  4OON A;  3AQQ A;  4DKA C;  3JAM i;  4LFB Q;  3HOX G;  3U50 C;  3CCM A;  4A3D H;  5LMN L;  1V1Q A;  1YIT A;  2E2H H;  1VQJ A;  5IP7 H;  1TWG H;  4QQB X;  1BKB A;  3E9I A;  2JEA I;  3H15 A;  4DV2 Q;  3UDX A;  2PI2 A;  1X54 A;  1L1O A;  1MKH A;  3J80 i;  2C35 B;  2MQH A;  4JI1 L;  1VQK A;  4DV0 L;  4A3D G;  3S24 A;  1YHQ A;  3AEV A;  2K75 A;  4A3F H;  2IHF A;  2ASB A;  3UDG A;  5IP7 G;  3GTP H;  1K83 H;  2I5L X;  4DR1 L;  4YCW A;  1PYB A;  4GKJ Q;  1D7Q A;  4BY1 H;  4OWW B;  2JA5 H;  3PV0 A;  4IPC A;  4TVA B;  4BY7 H;  3HOW G;  1PH1 A;  3S2D H;  2JA7 H;  1LM0 A;  4A3F G;  2CCZ A;  2OWO A;  3BZK A;  4JCV E;  2NVX H;  4BY1 G;  2AWO A;  4YY3 Q;  4B3S Q;  4B3S L;  2CWA A;  1IXR A;  2Q2I A;  4RMF A;  2NN6 I;  1MIU A;  2JA5 G;  3E9H A;  4BY7 G;  4GNX A;  2B29 A;  2JA7 G;  4P72 A;  4GLX A;  2LXJ A;  1NTG A;  2JEB I;  1IYJ B;  3ICE A;  4IPG A;  1QVF A;  1Q81 C;  1QZG A;  4X62 Q;  5ELN A;  1P16 A;  4X62 L;  2OCE A;  3ER0 A;  3S1Q H;  1VQM A;  1Q7Y C;  1OXU A;  2WB1 G;  2V1C C;  2B63 H;  1WI5 A;  2AKW B;  4UPA A;  1X55 A;  5LMN W;  1IBK Q;  3STB D;  1IBK L;  3PIP A;  3KJO A;  3EIV A;  2F3I A;  1GD7 A;  1GKH A;  1GO3 E;  3TQY A;  1X65 A;  4EQ5 A;  2NVQ H;  4KHP Q;  1JT8 A;  3G4S A;  1BBU A;  4GS3 A;  2BA1 A;  3HFZ B;  1YJW A;  1UE7 A;  1TWA H;  2B63 G;  3EBE A;  3DLL A;  2ZJQ A;  1IBL Q;  1SR3 A;  1SLJ A;  2K5H A;  3CW2 C;  2MNA A;  4HJA A;  1JB7 A;  4JV5 L;  4OWT B;  1OTC A;  1E3P A;  2A1A A;  1LYL A;  2AHO B;  1KIX A;  3GTQ H;  1Q1E A;  1T9H A;  1JE5 A;  2EIF A;  1VQD A;  3CMA A;  4HJ5 A;  3S17 H;  4UP8 A;  5HY6 A;  3T1H Q;  1Q12 A;  1AE3 A;  3EN2 A;  2BH2 A;  1PV4 A;  4K0K L;  2EQS A;  3RNU A;  2I0Q A;  5LMU Q;  5LMU L;  1PH2 A;  2YYZ A;  1KD1 C;  5IYB H;  3K7A H;  4JI7 Q;  2YTV A;  4JI7 L;  1NMG A;  1J5E Q;  4YHH L;  3AFQ A;  5HGQ A;  1PA6 A;  4OO1 I;  4OO1 G;  1N9W A;  3PUX A;  2DUD A;  3U58 A;  4HJ7 A;  2PMZ E;  2R7F A;  3OYY A;  5IYB G;  2PQA B;  1N36 Q;  3K8A A;  3H3V H;  2Q2T A;  4JI0 Q;  4EX5 A;  4QY7 A;  4WJ4 A;  3F2B A;  2GVA A;  1XMQ L;  4O2D A;  2ZM6 Q;  4A93 H;  2ZM6 L;  5M5X H;  1BBW A;  3DM3 A;  5GQO A;  5C44 H;  3OTO Q;  3HOU H;  1SN8 A;  3S1M H;  2QEX A;  1U0L A;  1I3Q H;  2VY3 A;  3U4V A;  1I94 Q;  3ULP A;  1I94 L;  1EQR A;  4GKK Q;  2JJQ A;  4HIO A;  4DR2 Q;  3UDI A;  4A93 G;  3I56 A;  1Q1B A;  2H5X A;  5J3B A;  5C44 G;  1XNR L;  3ZJY C;  3UDF A;  3PF5 A;  3HOU G;  4IOC A;  2IHE A;  4DV3 Q;  3VDY A;  4DV3 L;  1IBM Q;  3TEH B;  5M3M H;  4DR3 Q;  1KQS A;  4R4O A;  3GTO H;  3K0X A;  1AH9 A;  3UE1 A;  1HR0 Q;  4DR7 L;  1YNX A;  3KOJ A;  1UE6 A;  1B70 B;  4LFC L;  1HR0 L;  1HJP A;  1W3S A;  4B3R L;  4NXN L;  5M3M G;  4GOP B;  1QZH A;  4YWM A;  3RLN A;  2KBN A;  3KDF A;  3Q8D A;  4B3T L;  4LUO A;  1G51 A;  1VQ4 A;  4JI4 Q;  1UWV A;  2HQL A;  2RHQ B;  1JJC B;  2K50 A;  2JE6 I;  1E1O A;  1PH7 A;  4BBS H;  2XGT A;  4MZ9 A;  1FL0 A;  1PFS A;  1CKN B;  1OXS C;  3JC6 6;  2K4K A;  1G29 1;  5M3F H;  4YWK A;  4A3G H;  4L5R C;  2E8G A;  4X64 L;  1C7Y A;  5IWA Q;  2Q2U A;  3NBH B;  2VL6 A;  4JI2 Q;  4BBS G;  2RCN A;  3W1B A;  3I4N G;  4A3G G;  2UXB L;  1U5K A;  3UE0 A;  4Y7N H;  2NZH A;  1A63 A;  1PYS B;  4A76 A;  1XNQ Q;  4DUZ Q;  1XNQ L;  3J7A 5;  4DUZ L;  4LFB L;  5M3F G;  2UU9 Q;  1M90 C;  3TRE A;  4AQY Q;  2VW9 A;  1FVI A;  4HIK A;  4DV2 L;  3HOZ H;  4B3M Q;  1JMC A;  3I4M H;  4IJH A;  2NVY H;  2BA0 A;  1VQE A;  5AJ3 Q;  2OQ0 A;  1YIJ A;  1X9N A;  3HOW H;  2MFI A;  1B8A A;  4JG2 A;  3CAM A;  2Q2H A;  4R4Q A;  1I50 H;  3F2D A;  3KFU A;  4TQU S;  2R93 H;  3ERS X;  3HOZ G;  1HR0 W;  4A3E H;  4LWC A;  4PG3 A;  3I4M G;  2Y0S E;  4GKJ L;  4P75 A;  4YCV A;  4A3M H;  3CC2 A;  4AYB E;  4DV6 Q;  4JBM A;  4C3H H;  2QA4 A;  4GOP C;  1WYD A;  5EAY A;  3S1R H;  4DR7 Q;  1HZ9 A;  2R93 G;  1VQ9 A;  3K80 C;  2WAQ G;  4A3E G;  1YHB A;  2WFW A;  1Q8K A;  3CCE A;  4YY3 L;  3CP0 A;  2ALY B;  4A3M G;  1N32 L;  1NMF A;  4GLA C;  4PZ8 A;  3HOV G;  1YJ9 A;  4DV4 Q;  1I6H H;  4IFD J;  2VNU D;  1HZA A;  4IO9 A;  2VS1 A;  3PUW A;  2E2I H;  3KYH C;  1QUQ A;  4LNQ A;  3M4O H;  3CCR A;  1K8G A;  1SRU A;  1KC8 C;  4PZ7 A;  1Q82 C;  1X6O A;  1EIF A;  1N8R C;  1K9M C;  4JYA Q;  3OW2 A;  3BJU A;  1RIP A;  4JYA L;  4Y52 H;  2I5M X;  4LFA Q;  3ULL A;  1PVO A;  5E7N A;  5C4X H;  1WCM H;  2Z6K C;  3A74 A;  3FP9 A;  2JQO A;  1E24 A;  4POF A;  2HHH Q;  1HNZ Q;  4L5Q A;  2HHH L;  1HNZ L;  4KHP L;  3W5O A;  3I4O A;  1LUZ A;  3J80 c;  4LF6 Q;  1FJG Q;  4JOI C;  4LF6 L;  1FJG L;  5BR8 Q;  1IBL L;  5C4X G;  1WCM G;  5IE8 A;  4C2M H;  4JI8 Q;  5JEA G;  4DK3 C;  2YV5 A;  4OX9 Q;  2PNH A;  3CCS A;  1YJN A;  4JBK A;  2HT1 A;  4AH6 A;  2D0P A;  5FLM G;  1PH4 A;  4LF4 Q;  1CKO A;  4LF4 L;  4DV1 Q;  4NXM Q;  4DV1 L;  4AIM A;  4NXM L;  2N8N A;  1IZ6 A;  3T1H L;  2A19 A;  3CCL A;  3D0F A;  4L5S A;  1LTL A;  3L0O A;  4LF5 Q;  3M4Q A;  5FLX c;  5DLQ E;  4LF5 L;  1TXY A;  3GTK H;  2N49 A;  1Y14 B;  1Y1V H;  3PUV A;  2KCM A;  1QVG A;  4DR4 Q;  2E5L Q;  4JI6 Q;  2E5L L;  3HOY H;  2GVB A;  3RN2 A;  4A3C H;  3GD7 A;  1J5E L;  1M1K C;  1HZC A;  3K81 C;  4DPG A;  4DK6 C;  4HID A;  4A3I G;  1Y1V G;  2N78 A;  1N36 L;  4KI0 A;  3CME A;  1A0I A;  1XPU A;  3HOY G;  4JI0 L;  4KLK A;  4IJL A;  2ZTE A;  4A3C G;  2VQE Q;  4LF8 Q;  1TWF H;  1YBY A;  2IX0 A;  4LF8 L;  4GNX B;  3G71 A;  2ID0 A;  1CKN A;  3PO2 H;  1WOC A;  1SRO A;  2CWP A;  2KCT A;  3OTO L;  4XTC S;  5IY0 A;  3HKZ E;  1NY4 A;  2JK8 A;  3GTL H;  3H3V I;  5IT9 c;  4JI5 Q;  1E1T A;  1Y1W H;  2UXC Q;  1I5F A;  1W2B A;  4GKK L;  4ME3 A;  4R4I A;  3RLF A;  4DR2 L;  3PO2 G;  3F1Z A;  3M7N A;  2RHS B;  3T1Y Q;  3T1Y L;  4YWL A;  4APV A;  4AYB G;  1XJV A;  2UXD L;  1IBM L;  5IYD H;  4DR3 L;  1Y1W G;  1N34 Q;  2R7D A;  2RF4 A;  1N34 L;  4LF7 Q;  4LF7 L;  1Q86 C;  1PH3 A;  5FJ8 H;  2IX1 A;  1OXT A;  2F4V Q;  2R7Z H;  3G6E A;  2F4V L;  4P71 A;  2K52 A;  1MJC A;  5C3E H;  5K36 G;  4UY8 C;  3BZC A;  1R9T H;  3KF8 B;  2IT1 A;  2N3S A;  4DR6 Q;  3A5Z B;  5IYD G;  3GDE A;  5M5W H;  3MXN B;  4DR6 L;  1KXL A;  2OTJ A;  3RZD H;  2PI2 E;  1P8L A;  2GN5 A;  3WWV A;  5FJ8 G;  4DR5 Q;  2R7Z G;  4JI4 L;  1E7Z A;  5C3E G;  4JBW A;  3GTM H;  3RZO H;  1ASY A;  3J7Z C;  4DV7 Q;  4HJ8 A;  4DV7 L;  4L5T A;  4C3I H;  3I4N H;  4A4I A;  3S14 H;  1VQA A;  1VQF A;  3FKI H;  1EOV A;  1HNW Q;  1E22 A;  4DNI A;  1EIY B;  4DV5 Q;  1N33 Q;  3G48 A;  3PCO B;  1C0A A;  4HJ9 A;  1NBW A;  2MO0 A;  1V43 A;  4PZ6 A;  1PH5 A;  5IWA L;  2ATW A;  3PSI A;  4JI2 L;  2UUA Q;  4MNO A;  3FKI G;  1L2F A;  4OWX B;  4GNX C;  1EQQ A;  1BVS A;  2FXQ A;  3KLW A;  1S72 A;  2UU9 L;  1YVC A;  2YTY A;  2HIX A;  4AQY L;  2LXK A;  4QJF A;  1CUK A;  2E2J H;  3PF4 A;  2D0O A;  1HNX Q;  5H1S E;  4B3M L;  2YTX A;  1VQG A;  3CXC A;  2K14 A;  3D31 A;  2IY5 B;  5AJ3 L;  1JJG A;  1KRT A;  2LSS A;  3HOV H;  3RN5 A;  5C4J H;  2R92 H;  2MO1 A;  3B6Y A;  3GTG H;  1VS0 A;  3L2P A;  2BH8 A;  4UP7 A;  3NEM A;  4DV6 L;  4DUY Q;  4A75 A;  4DUY L;  5LMN Q;  3RR5 A;  4X66 Q;  4NPS A; 
#chains in the Genus database with same CATH topology
 1B3A A;  3M9B A;  3KF6 B;  5C0X I;  3ONA B;  4DV4 L;  2OTL A;  2PQE A;  5JJI A;  1UEB A;  3VA7 A;  3S15 B;  4C3J G;  2QF7 A;  1HCZ A;  1EUJ A;  4WFN 3;  4XT1 B;  2L1B A;  3S2H H;  4RGT A;  1TWC H;  1VQP A;  2KEC A;  4LFA L;  2PQA A;  3S1N H;  5IYC H;  3TS0 A;  1B2T A;  1RCV D;  3NWS A;  4A3E B;  3W1G A;  3RD4 A;  1EWI A;  1DGS A;  4ZKC B;  4OX9 L;  1L0W A;  4IPH A;  1PTO H;  4JBJ A;  2TSS A;  1STH A;  1L1O B;  2PZW A;  3SGI A;  4BBR H;  1LTI D;  4DAM A;  5F2D A;  3LGJ A;  3LWE A;  3F2C A;  3CCJ A;  3C3L A;  2CW0 C;  4JI6 L;  2OXP A;  1X3F A;  4GOP A;  4GN3 B;  2Z0S A;  2IPK D;  2EJM A;  2E74 C;  1PTO F;  2H4O A;  5C4X B;  1XX8 A;  3E0E A;  4HSV A;  1K8M A;  4NB3 A;  1IW7 C;  3N6R A;  1BXT A;  3CCV A;  1HZB A;  5GAE C;  1SAP A;  1F2Z A;  1QUQ B;  2VB2 X;  4KHV A;  1SYF A;  2RBM A;  3S16 H;  1L0Y B;  1B50 A;  4IPD A;  4IFD G;  2ICI A;  1JWS D;  2EXZ A;  2L12 A;  2WP8 J;  2R6G A;  3CD6 A;  5IT9 L;  5C3W A;  3TZD A;  3ITP A;  4ME5 A;  1CA6 A;  4X3K A;  1XMQ Q;  1L1O C;  5FO9 B;  1B44 D;  3CF5 A;  2JA8 H;  2FIN B;  3FHW A;  4G7O C;  1SE2 A;  2EY6 A;  2VUM G;  4FXK C;  5GAG C;  4A3J G;  1X3E A;  1HNW L;  4K5V A;  1K8A C;  2BDO A;  1FNW A;  3K7U C;  1XMO L;  2LKV A;  4G7Z C;  1WD1 A;  3KF6 A;  4LFC Q;  3S1M B;  1NJI C;  1XTD A;  1RL2 A;  4ZRZ A;  3NK9 A;  1WD0 A;  1UE1 A;  5C3X A;  5IGB A;  4A3L G;  1R4Q B;  1GVP A;  5IP9 H;  3PGZ A;  2LY7 A;  3PIO A;  2EYH A;  4FYD A;  1VCI A;  4GLV B;  1ASZ A;  1OO9 B;  4BA1 I;  1KDC A;  1H95 A;  2QCP X;  1Q3L A;  3U4Z A;  3MXG A;  4BXX G;  1XPR A;  1YZ6 A;  2UXB Q;  1LT6 D;  2B2Y C;  2B3G A;  3MHB A;  4OXP A;  4HSP A;  4XIG S;  3I55 A;  4OON A;  1T5X D;  1YIT A;  1VQJ A;  1GHJ A;  1TWG H;  4ZCK A;  3T13 A;  3KLS A;  5LL6 S;  5IP7 H;  4K2L A;  5M3F B;  1BF4 A;  1CTM A;  1L1O A;  5ELD A;  5I6W A;  2OEO A;  2F4I A;  2JXM B;  3BDC A;  1VQK A;  2IHF A;  2ASB A;  3C2P A;  2I5L X;  4PQX A;  3C1E A;  3EQL C;  2NUC A;  4RGN A;  4OWW B;  4NKL A;  3BZD B;  3A54 A;  2R3Z A;  3LX0 A;  4IPC A;  4MIU A;  4ID6 A;  2VXW A;  3HOZ B;  4BY7 H;  4A3F G;  2K5W A;  1O7Y A;  2Z1C A;  1QCB D;  3CU7 A;  4BY1 G;  4YY3 Q;  2XRQ D;  1SYC A;  4B3S L;  3L3O C;  2R93 B;  2B29 A;  4J1M A;  1ML0 D;  3I72 A;  2LXJ A;  4H13 C;  2QDL A;  2E76 C;  4A3M B;  1CQF A;  3MEH A;  3H6M A;  1Q81 C;  4X62 Q;  3J80 L;  5ELF A;  4C56 C;  3S1Q H;  1OXU A;  3NWT A;  2V1C C;  4IAL A;  4UPA A;  2AKW B;  2SNM A;  5ELC A;  1EOT A;  3STB D;  1IBK L;  2K7V A;  3KBX A;  5EBC A;  1UUP A;  2F3I A;  1GO3 E;  3TQY A;  1I4Q A;  1SYE A;  2B2U A;  3G4S A;  2BA1 A;  1JOQ A;  1YJW A;  1UE7 A;  1T5E A;  4PMB A;  3M4O B;  3KF8 A;  3DLL A;  3BYT B;  1EY5 A;  1SLJ A;  4RKL A;  2MNA A;  4DNR B;  1OTC A;  1KIX A;  4HJ5 A;  2EIF A;  3S17 H;  1VQD A;  3A7L A;  1A15 A;  2K28 A;  1ILQ A;  4A3K B;  1EY7 A;  4IZ8 A;  3RNU A;  4OO1 H;  4ULL A;  2NWG A;  2KCC A;  2YTV A;  1U4R A;  3QIA A;  1LAC A;  3AFQ A;  4HJ7 A;  1NR4 A;  1WTH A;  1N36 Q;  1WTV A;  3H3V H;  3KUP A;  3HS0 C;  4EX5 A;  2O5J C;  5IGF A;  4HAE A;  1XMQ L;  2ZM6 Q;  4A93 H;  3J7A F;  3DWA A;  3HOY B;  5EKK A;  1QG7 A;  2QEX A;  5K5P A;  1I3Q H;  3U4V A;  1I94 Q;  1KLU D;  3ULP A;  3T56 B;  2JJQ A;  3UDI A;  2O5I C;  1Q1B A;  1SMY C;  3KBG A;  3LNN A;  4RGM A;  3HOU G;  3PF5 A;  2UXD Q;  4DV3 Q;  3KK7 A;  1KQS A;  2NB0 A;  2F0G A;  1GUT A;  3G7L A;  2K33 A;  2WAC A;  3KOJ A;  4LFC L;  1B70 B;  3W2D A;  1HR0 L;  2O4X A;  2F0D A;  1NCV A;  4IUU A;  5AFW A;  5EPJ A;  5CR3 A;  4YWM A;  3KDF A;  2A5H A;  4LUO A;  1G51 A;  1GUN A;  2RHQ B;  2JE6 I;  1PH7 A;  2F0W A;  1PZK D;  2R7Z B;  4MZ9 A;  3VR4 A;  5M9O A;  1PFS A;  5C3E B;  1CKN B;  3BS1 A;  1PZI D;  2K4K A;  2P5Z X;  3NBH B;  4JI2 Q;  2UXB L;  3UE0 A;  3HZX A;  1LT4 D;  1M4V A;  1PYS B;  3IKJ A;  1XNQ L;  2IJ0 A;  3TRE A;  3R2I A;  2VW9 A;  4B3M Q;  1JMC A;  4K2K A;  4IJH A;  2NVY H;  4ZYS A;  5AJ3 Q;  3K5N A;  3HOW H;  2B2T C;  1IKM A;  4LWC A;  3OMG A;  1PXU A;  3R3O A;  1Z6H A;  5KEE A;  1EU4 A;  3SXH A;  4JBM A;  1WYD A;  5EAY A;  4M1U B;  3K80 C;  4A3E G;  2WFW A;  3CCE A;  4YY3 L;  1E2V A;  4PZ8 A;  4IFD J;  4IO9 A;  1MD2 D;  3V96 A;  5CV6 A;  4LNQ A;  1EL0 A;  1Q82 C;  1N8R C;  3J80 E;  1EYC A;  4JYA L;  3BJU A;  1RIP A;  2I5M X;  2FHT A;  5E7N A;  1I4R A;  1WCM H;  1HA5 A;  3HEJ A;  2JQO A;  5FKA C;  5BN3 A;  4POF A;  3VR5 A;  1QIL A;  1ICW A;  3I4O A;  3TP5 A;  3EJI A;  5C4X G;  4RCN A;  4C2M H;  2JA5 B;  4LAA A;  2PNH A;  5JOB A;  3S2D B;  2ICE C;  1HHV A;  2KUM A;  3W3A A;  4LF5 Q;  3M4Q A;  2A6E D;  3C1F A;  1AN8 A;  2N49 A;  1Y1V H;  4K5X A;  4DR4 Q;  2EYJ A;  2F0Q A;  2PW5 A;  1HZC A;  4DPG A;  5TSS A;  3MTS A;  1HTP A;  1N36 L;  4KI0 A;  1U9R A;  1BNZ A;  1DZ1 A;  4IJL A;  2ZTE A;  4RKB A;  1TWF H;  1YBY A;  2EYF A;  4GNX B;  2ID0 A;  1CKN A;  1WTO A;  1WOC A;  1SRO A;  1GHK A;  1S5E D;  4XTC S;  1KTK A;  4TRD A;  3H3V I;  2BOS A;  1GUG A;  3NBH A;  1ENA A;  2RDF A;  2UXC Q;  4ME3 A;  1RTN A;  2VB3 X;  1H9R A;  2AUJ D;  3T1Y L;  4APV A;  4AYB G;  1XJV A;  2UXD L;  3CRK C;  5IYD H;  1LT5 D;  2RF4 A;  2WKD A;  1A2U A;  2F4V Q;  3G6E A;  4P71 A;  2K52 A;  1MJC A;  3M3Y B;  3NP8 A;  1R9T H;  1EY0 A;  3A5Z B;  1SE3 A;  2AQ3 B;  3RZD H;  4IUT A;  1P8L A;  5D65 A;  5M5Y B;  4DR5 Q;  4RHR A;  2MPM A;  5KND A;  4ZUJ A;  1V8Q A;  1S4Z A;  3OIP A;  1ASY A;  3J7Z C;  4DV7 L;  4L5T A;  4C3I H;  1AZQ A;  3I4N H;  4X3T A;  3S14 H;  1VQF A;  3FKI H;  4FF2 A;  5EPL A;  1FYC A;  2VUM B;  4PNY A;  5C44 B;  3BVM A;  4PZ6 A;  4A3J B;  4JI2 L;  4MNO A;  1SJH D;  5KIX A;  4GNX C;  4OWX B;  3H94 A;  2EZV A;  1BVS A;  3J7Y W;  2FXQ A;  1S72 A;  2MGS A;  2NTT A;  2B2V C;  4B9W A;  4B3M L;  2YTX A;  1VQG A;  5JPM C;  3CXC A;  1D5Z C;  5AJ3 L;  1HXY D;  2Z4I A;  2LSS A;  3HOV H;  1UNS A;  1JWU D;  3RN5 A;  2RSO A;  4ZLT F;  3QOL A;  3I3C A;  2BH8 A;  4UP7 A;  5C0X H;  1HQM C;  4A75 A;  4BBS B;  1CFM A;  3IRB A;  4CDC C;  3CQZ H;  2JA6 H;  3J81 E;  4O0A A;  1TT2 A;  4WRD A;  1EIH A;  3K0Y A;  2WII B;  1FD7 D;  3AFP A;  1G6P A;  1CHP D;  1PMR A;  4H0L C;  4I65 A;  4LMQ D;  4UP9 A;  3TBI B;  1LTB D;  2E2H B;  4N8X 1;  4S3S A;  3RLO A;  5BN5 A;  1S40 A;  4WOR A;  5I6Y A;  4FNF A;  1VQO A;  5T1G A;  5CV5 A;  4A3F B;  5FLM H;  3TME A;  4K5W A;  2NN6 G;  1K0R A;  1K83 B;  1G2S A;  2PMZ B;  5IGE A;  1A62 A;  4LF9 L;  3DHQ A;  2WAQ B;  1IYV A;  4BY1 B;  2A8V A;  4J15 A;  2KQ3 A;  2AMC B;  1PH8 A;  4C3H B;  4A3K G;  1SFO H;  2EY2 A;  4PMC A;  2E75 C;  1JOK A;  5D3D A;  3MVV A;  3H0G H;  1Y8P B;  1PTO D;  1HUM A;  5D3I B;  2KA7 A;  4O1N A;  1KLG D;  4DR4 L;  5KYL A;  4Q5V A;  2QGQ A;  1Y69 U;  3H09 A;  4FDB A;  2ZT9 C;  4X3S A;  1SXT A;  1J6Q A;  1XPO A;  1F2L A;  3L7Z C;  4X65 L;  3NBI A;  1X56 A;  1V9P A;  4K0K Q;  2NVT H;  4P73 A;  5E1F A;  1ZXT A;  1CSP A;  1BCP B;  1D8L A;  1XXG A;  2PNR C;  4R1J A;  4L8J A;  2UXC L;  3NXW A;  1KL9 A;  3HKS A;  3TP6 A;  1LT3 D;  4IFD I;  2L0C A;  2KHJ A;  2X6L A;  2Z6K A;  1H9S A;  3BU2 A;  2WAQ E;  3M4P A;  2UUB L;  4C1N I;  1GM5 A;  1OXX K;  1HPC A;  1VQH A;  4CDD C;  5T1I A;  2AUK A;  4RG1 A;  4GN5 A;  3BDL A;  4QF4 A;  4DR5 L;  1MHW C;  2F0K A;  4F87 A;  4B9X A;  1ZYR C;  3BYY B;  1XNR Q;  1TII D;  2Z4H A;  3MFY A;  5JPN C;  5GAD C;  3PO3 G;  5M5X B;  1XMO Q;  3HOU B;  3T51 B;  1XYI A;  4H02 A;  1YNN D;  3ULJ A;  1WJJ A;  1PH6 A;  3BDO A;  2Q8R E;  2UUC L;  4A3B G;  1K3R A;  5C5L A;  2KCN A;  4B3T Q;  1BCP C;  3GO5 A;  4X3U A;  2IW3 A;  1YHA A;  1J8I A;  1DM0 B;  2EYL A;  1M8A A;  3CPF A;  5I2Y A;  2G9H D;  2PCF B;  1Z9F A;  4DAY B;  1I4X A;  4JI3 L;  2J0T D;  5IGG A;  3S15 H;  3AQQ A;  4DKA C;  3GTM B;  3HOX G;  3U50 C;  2B2W A;  3CCM A;  4A3D H;  3E9I A;  2JEA I;  3H15 A;  4OIJ A;  4DV2 Q;  2PI2 A;  5EJW A;  2C35 B;  1LLR D;  2RDG A;  1SYG A;  1SNP A;  2KED A;  1YHQ A;  2V4D A;  3UDG A;  1PYB A;  3HOW G;  1EFI D;  4CKC A;  2JA7 H;  1LM0 A;  2CCZ A;  3DXJ C;  1XWE A;  5LL6 X;  2PPB C;  2AWO A;  4B3S Q;  5CGK A;  1JT8 A;  1IXR A;  2Q2I A;  2JA5 G;  1I50 B;  3D4R A;  1LO5 D;  1FGB D;  4GLX A;  1A2T A;  2JEB I;  4G7H C;  3ICE A;  4IPG A;  1P16 A;  3OIQ A;  3I8Z A;  1HTL D;  1AP0 A;  2B63 H;  1O78 A;  4R9W A;  2NYZ D;  4TKO B;  1H9K A;  5KYI A;  1X55 A;  2D9U A;  1IBK Q;  3KJO A;  3EIV A;  1GD7 A;  1GKH A;  2E2I B;  3I90 A;  4GS3 A;  1JR0 D;  3AB9 A;  3FMC A;  1RDP D;  2IL8 A;  2ZJQ A;  3V05 A;  2L9H A;  1IBL Q;  1SR3 A;  2K5H A;  3ND9 A;  1SYD A;  3CW2 C;  4J8Q A;  3Q22 A;  1JB7 A;  4OWT B;  1PFN A;  2F0S A;  1LYL A;  4XT3 B;  1JE5 A;  1DON A;  1SEB D;  1EZ6 A;  4CJ0 B;  3ZYY X;  3S1N B;  1LTR D;  4K0K L;  3Q24 A;  4ZQ3 A;  3VYT A;  4DK1 A;  1KAA A;  5LMU L;  5D14 A;  3IFT A;  1KD1 C;  5JJZ A;  3FPU B;  3C46 A;  4KY5 A;  4JI7 L;  1NMG A;  1J5E Q;  1PA6 A;  5HGQ A;  1N9W A;  2PZT A;  2R7F A;  5IYB G;  1LTG D;  3F2U A;  3SHL A;  4JI0 Q;  4QY7 A;  3PIO 3;  1TVX A;  3GTK B;  5CV9 A;  1BBW A;  1WTR A;  5GQO A;  3OTO Q;  1SN8 A;  1PFB A;  3SK6 A;  3S1M H;  3AMU A;  4DAY A;  1EQR A;  2HD3 A;  1QNK A;  5J3B A;  5C44 G;  1XNR L;  2XRS D;  1CQV A;  3UDF A;  3ZJY C;  4OIK A;  3TEH B;  5M3M H;  4R4O A;  2OF1 A;  3GTL B;  3UE1 A;  4AYB B;  1HR0 Q;  1IYU A;  5FO8 B;  3A8K E;  5EKL A;  1W3S A;  1QZH A;  3S16 B;  3M4Y A;  1E2Z A;  1AFP A;  4B3T L;  4JI4 Q;  1JJC B;  1SBB B;  2K50 A;  2EVB A;  2BDN A;  4K8J A;  4N8F A;  1GUW A;  4ZUI A;  5CYU A;  5M3F H;  5EPK A;  1Y8O B;  5M5W B;  4KKS A;  2E8G A;  2AQ2 B;  5IWA Q;  4BBS G;  2VL6 A;  3U9O A;  3SK4 A;  3I4N G;  1U5K A;  4Y7N H;  3OMC A;  2XSC A;  1XNQ Q;  1A63 A;  3DM1 A;  4DUZ L;  2L5T A;  4HED A;  1SND A;  1WTX A;  4AQY Q;  4ABN A;  3HOZ H;  4DV2 L;  4ZAI A;  2BA0 A;  3A56 A;  1VQE A;  4CJ1 B;  3PQI A;  1D2B A;  4R4Q A;  3WOF A;  4GZY C;  4MTK A;  3KFU A;  2R93 H;  2F0P A;  3ERS X;  1HR0 W;  4RAU C;  3I4M G;  4P75 A;  4A3M H;  4AYB E;  2E2J B;  5G3L F;  3MAQ A;  5LHY 1;  4DR7 Q;  3NUC A;  1HZ9 A;  5IGD A;  1KNA A;  2WAQ G;  1VQ9 A;  1Q8K A;  2DY7 A;  2XNA C;  3JAM L;  4C3H G;  2DY8 A;  1HZA A;  2XN9 C;  2VS1 A;  2KHS A;  1QUQ A;  3NQI A;  3EFX D;  3M4O H;  4OL7 A;  1D5X C;  1WTP A;  1F9R A;  1EIF A;  3VR3 A;  1TWG B;  4JYA Q;  1H9J A;  3OW2 A;  3WOE A;  3SDZ A;  3A74 A;  1G6Z A;  4DF7 A;  4Z9C B;  4BS9 A;  2B2Y A;  1HNZ L;  2HHH L;  3HG9 A;  2PW7 A;  3FVQ A;  3J80 c;  4JOI C;  4DXG A;  4LF6 L;  5BR8 Q;  1IBL L;  1FJG L;  5IGC A;  2EY5 A;  4JI8 Q;  5JEA G;  4DK3 C;  4QCL A;  2DJF C;  2M2L A;  4JBK A;  3MWY W;  3R8B A;  5FLM G;  4DV1 L;  2A19 A;  3CCL A;  1BQQ T;  4L5S A;  4KD3 A;  1LTL A;  3L0O A;  1EY9 A;  1TKW B;  1TXY A;  1Y14 B;  1ROD A;  3K58 A;  2E5L L;  3HOY H;  1TWH B;  3NE5 B;  4A3C H;  3GD7 A;  1J5E L;  1M1K C;  3K81 C;  4LJZ C;  3S1Q B;  1HFG A;  4DK6 C;  4HID A;  2F1M A;  5IT9 E;  4KV6 A;  2F0U A;  3CME A;  3OHX C;  1XPU A;  4JI0 L;  1CT1 D;  5FO7 B;  2DN8 A;  4LF8 L;  2IX0 A;  2FMC A;  2WV6 D;  4XQQ A;  1ENC A;  2K1B A;  3OTO L;  1NY4 A;  2JK8 A;  4HN7 A;  2K32 A;  4JI5 Q;  1E1T A;  1Y1W H;  2JSO A;  5L37 A;  1W2B A;  3PO2 G;  2SNS A;  2RVL A;  5K36 H;  2EYP A;  3T1Y Q;  3S17 B;  4JVZ A;  1V1P B;  1N34 L;  4HCE A;  1VMP A;  1Q86 C;  4N9T A;  3IL8 A;  1PH3 A;  2IX1 A;  2R7Z H;  1I6V C;  2A74 C;  4QMG A;  1IHZ A;  4KKT A;  3HRZ C;  5C3E H;  1CHQ D;  4UY8 C;  3O13 A;  1F9P A;  2N3S A;  1QJO A;  4DR6 L;  1CA5 A;  3MXN B;  2OTJ A;  2K5Q A;  4DU9 A;  5FJ8 G;  4WJW A;  4JI4 L;  4F8M A;  3OWF A;  4DV7 Q;  4HJ8 A;  4A3G H;  1ICF B;  1VQA A;  1STA A;  1E22 A;  4DNI A;  3G48 A;  1LV9 A;  4HJ9 A;  1V43 A;  5IWA L;  3QR8 A;  1I3Q B;  2UUA Q;  2F0N A;  3IFD A;  3PO3 B;  1HFN A;  2ENB A;  2H1E A;  4QIW B;  1UEA B;  1YVC A;  1L0X B;  2HIX A;  4AQY L;  2LXK A;  4QJF A;  4A3B B;  2HCC A;  5I4D A;  2Z8L A;  3GTJ B;  2ZXR A;  5C4J H;  3B6Y A;  3GTG H;  2LMC B;  3P75 A;  3NEM A;  4DUY L;  1EQV A;  5LMN Q;  4DFA A;  1STE A;  2EE1 A;  2EXD A;  5E4X A;  2Z6B A;  4X66 L;  4DR7 L;  4QGU A;  4C3J H;  2R92 G;  3HOX B;  4QUC A;  5JJK A;  5EGT A;  4JI1 Q;  1STB A;  4RGO S;  1PRT F;  4MN3 A;  3JAM E;  3CC7 A;  2D62 A;  2F0J A;  1SSO A;  2BE5 D;  4DR1 Q;  1II3 A;  2KOL A;  3J81 c;  1Q8I A;  1LAB A;  4KJO A;  1EFW A;  3K6O A;  3PUZ A;  2OT2 A;  2SOB A;  1BO0 A;  3DEP A;  4FP5 D;  4QIW E;  4P2C B;  2A68 D;  3HOW B;  2K5V A;  2KHI A;  3NPP A;  3GTP B;  4LF9 Q;  5GAH C;  2AWN A;  1B7Y B;  5BR8 L;  1Q90 A;  2AQ1 B;  2XTI A;  1O7I A;  4JI8 L;  1DOL A;  2C5C A;  5IYC G;  1DD2 A;  2A6H D;  3F8T A;  2F0I A;  4MTN A;  1HH2 P;  5IIF A;  3J81 j;  4POG A;  4IOA A;  1TQO A;  3S9W A;  1VQ5 A;  2VZA A;  1SMX A;  1KHI A;  1V1P A;  2B2T A;  1WFQ A;  2Z9H A;  4YCU A;  1E0B A;  3L9A X;  2HQE A;  1ONL A;  4A3I H;  4M8A A;  4KKU A;  5IOD A;  2E2D C;  3TZU A;  4BBR G;  3OOC A;  1JB3 A;  3MXN A;  3GV3 A;  1YNJ D;  2FJ2 A;  2JA9 A;  3AYH B;  3NEL A;  1PH9 A;  1TR5 A;  4X65 Q;  3TP8 A;  2ZJR A;  4DK0 A;  2ZTD A;  1DOM A;  4IFD H;  1TWA B;  5EKI A;  2D5D A;  1X3G A;  3E6Z X;  1U4L A;  2GA4 B;  4IN3 A;  1VQ7 A;  2PYK A;  5CC4 A;  4JI5 L;  3M3Y H;  3TN2 A;  4C2M B;  3FRP B;  1QVC A;  4DNT B;  1O80 A;  5M5Y H;  3TP7 A;  4RFB A;  1PHJ A;  2HIV A;  2UUB Q;  2YU9 H;  1KRS A;  4NP5 A;  3N52 A;  2ZJP A;  3HP3 A;  2VUM H;  1PDQ A;  2K05 A;  1D6E C;  2VQF L;  2XWJ B;  3K59 A;  5JAV A;  4A3J H;  3KJP A;  3NEN A;  1K73 C;  3CC4 A;  3PUY A;  2K5N A;  4OGQ C;  1NE3 A;  4ALP A;  1LTT D;  3PMF A;  4L63 B;  5C0X J;  2ES2 A;  4FF3 A;  2JA8 G;  3STB C;  4A3L H;  1GJX A;  1JC7 A;  3I7F A;  1EWC A;  4QL5 A;  4BA2 I;  2CKZ B;  4L6T B;  5KNC A;  2UUA L;  4B3R Q;  3VYS A;  1EIG A;  2UUC Q;  1EY8 A;  2PO4 A;  5E4W C;  3NTK A;  3QB3 A;  1IKL A;  1ILP A;  5HGT A;  2F52 A;  5JVH 3;  4UDU C;  3GTO B;  4BXX H;  2D2C C;  1OXV A;  3MEF A;  1BBX C;  4HTH A;  3QJY A;  2WKC A;  2JN4 A;  5IP9 G;  3A0J A;  4G57 A;  5JEA J;  1VF7 A;  1STY A;  4X64 Q;  1A8V A;  3RZD B;  4JI3 Q;  3J81 i;  2FMM A;  4ODG A;  3I2Z A;  2CW0 D;  3A8J E;  3KLR A;  3K5O A;  1DJR D;  3I4N B;  5LMN L;  3SK5 A;  1EEI D;  1V1Q A;  3FKI B;  2E2H H;  3U9S A;  2F0H A;  3UDX A;  1X54 A;  1MKH A;  1IW7 D;  1F9Q A;  2MQH A;  2Q8T A;  4JI1 L;  2HDM A;  2DNE A;  4A3F H;  1C4Q A;  5IP7 G;  4DGZ A;  5JVG 3;  1K83 H;  1LTA D;  3PIP 3;  4DR1 L;  3IAY A;  3SVM A;  4BY1 H;  4TSS A;  4J6H A;  4TVA B;  3I4M B;  2OWO A;  3BZK A;  3NSW A;  2QW7 A;  2F0O A;  2NVX H;  1SNC A;  3HOV B;  1N32 Q;  4RWS C;  3E9H A;  4BY7 G;  4GNX A;  1JOO A;  2MHV A;  3K5M A;  1NTG A;  3OSO A;  2SDF A;  1QZG A;  2B2V A;  3S1R B;  1AEX A;  2OCE A;  4ZKB B;  1KNE A;  1VQM A;  2WB1 G;  3CQZ B;  1I4H A;  2JA6 B;  2LS0 1;  3QWN A;  1UAP A;  1I6H B;  2DNC A;  3PIP A;  4KJN A;  4EQ5 A;  2HDL A;  2NVQ H;  3CHB D;  3HFZ B;  1GXD C;  3DEO A;  4FXG C;  5COY A;  4HJA A;  5FLX L;  3Q0A A;  1E3P A;  2A1A A;  2AHO B;  3RMH A;  3GTQ H;  3CMA A;  1T9H A;  2KJX A;  2RKS A;  1IL8 A;  4UP8 A;  1Y8N B;  4BWG B;  3D4W A;  1BDO A;  1Q12 A;  4XYO A;  2QDB A;  2EQS A;  2I0Q A;  5LMU Q;  1PH2 A;  5CV7 A;  3K7A H;  4JI7 Q;  1BCP F;  1A3V A;  1NAP A;  4EQO A;  4OO1 G;  3PUX A;  3NQT A;  2PMZ E;  3X3N A;  2RSN A;  3H0G B;  3OYY A;  2PQA B;  3K8A A;  2Q2T A;  2GVA A;  4O2D A;  1NSN S;  2KEE A;  5M5X H;  3HOU H;  3NHH A;  3SK8 A;  1U0L A;  2VY3 A;  3FDT A;  4GKK Q;  4HIO A;  2HUG A;  1ZEQ X;  4A93 G;  1A3T A;  2H5X A;  1QOH A;  4IOC A;  3VDY A;  1IBM Q;  2I07 B;  4KN7 C;  4DR3 Q;  3PO2 B;  3Q6S A;  2Y0S B;  2K03 A;  3K0X A;  2A68 C;  2NVT B;  1AH9 A;  5DM6 3;  2QIL A;  3QOJ A;  4KN4 C;  4FVM A;  5KRU A;  1YNX A;  1UE6 A;  2WIN B;  4B3R L;  1GUS A;  1B4O A;  4GOP B;  4ILW A;  3BG3 A;  3P20 A;  3GV6 A;  1S5C D;  3GQB A;  3Q8D A;  3R93 A;  1K3B C;  1SNQ A;  1VQ4 A;  1UWV A;  2HQL A;  5C6A A;  1E1O A;  1FNV A;  2XGT A;  1FL0 A;  3TDQ A;  2A6E C;  3JC6 6;  1G29 1;  4I7Z C;  2G9D A;  4L5R C;  4X64 L;  1C7Y A;  2Q2U A;  1S5F D;  4YIJ A;  2RCN A;  3W1B A;  4A3G G;  4N9P A;  4DUZ Q;  3RZO B;  2UU9 Q;  1HUN A;  2K01 A;  1BUV T;  1BOS A;  3AU7 A;  5G3L D;  1HA6 A;  1K8O A;  4V19 0;  1YIJ A;  1X9N A;  3D8G A;  2MFI A;  4JG2 A;  3CAM A;  2Q2H A;  1I50 H;  3F2D A;  4A3E H;  4PG3 A;  2Y0S E;  3VR6 A;  3CC2 A;  4FXD A;  4GOP C;  2Q8I B;  3X3M A;  1A3U A;  5KNB A;  1B53 A;  2ALY B;  1NR2 A;  1N32 L;  1NMF A;  2VNU D;  2E2I H;  2R92 B;  1K0S A;  3KYH C;  3CCR A;  1K8G A;  4A3D B;  1KC8 C;  4PZ7 A;  3R2T A;  1K9M C;  1D1K A;  1SMY D;  1X3Q A;  2X6G A;  1PVO A;  1RD9 D;  4CDF C;  5C4X H;  1BR9 A;  5J22 A;  2A69 D;  2HHH Q;  1HNZ Q;  4L5Q A;  4H44 C;  3W5O A;  3UI2 A;  4LF6 Q;  1FJG Q;  4CKE A;  3EA6 A;  5A2Q L;  1WCM G;  1TS3 A;  1KDB A;  2YV5 A;  3S2H B;  1TWC B;  5FLX E;  1YJN A;  1VMC A;  2JA7 B;  4AH6 A;  2D0P A;  1RKN A;  1PH4 A;  1CKO A;  2IX3 A;  4LF4 L;  4DV1 Q;  2F0M A;  4AIM A;  2N8N A;  1IZ6 A;  4NXM L;  2B8G A;  3VYR A;  4XQJ A;  3D0F A;  1EY6 A;  4QB4 A;  5DAU A;  3MZ5 A;  5DLQ E;  2X69 A;  3GTK H;  2F0V A;  4FO2 A;  2E5L Q;  3A8I E;  1QWY A;  1PTO B;  4BBR B;  3E5S A;  2B63 B;  4A3I G;  1Y1V G;  2N78 A;  5DNF A;  3T53 B;  4H7B A;  1A0I A;  1PYW D;  4KLK A;  2VQE Q;  4LF8 Q;  3G71 A;  3DUZ A;  2CWP A;  3GTL H;  5IT9 c;  4XYQ A;  1DYQ A;  4GKK L;  3RLF A;  2EY1 A;  3P1H A;  1IBM L;  2R61 A;  1F2Y A;  1ET6 A;  4DR3 L;  1N34 Q;  5ELB A;  4LF7 L;  2EOT A;  4IUV A;  2K5D A;  3BZC A;  2B39 A;  3KF8 B;  2IT1 A;  4DR6 Q;  1KXL A;  5IYD G;  3GDE A;  5M5W H;  4JPB W;  1E7Z A;  1SNM A;  1TY0 A;  1TS4 A;  4A4I A;  4UAI A;  1PTO C;  1EOV A;  1EIY B;  4DV5 Q;  1N33 Q;  1C0A A;  1NBW A;  2MO0 A;  2JA8 B;  5CBA E;  2ZXO A;  2ATW A;  4MHE A;  4C3I G;  3D3R A;  3FKI G;  1L2F A;  4HMI A;  1MSH A;  1E2W A;  1S5D D;  4RCO A;  4UHV A;  2UU9 L;  3MA2 B;  1EYD A;  4IUP A;  5M3M B;  2YTY A;  2E2J H;  2D0O A;  1HNX Q;  5H1S E;  2ZXP A;  4KTA A;  2K14 A;  2BCO A;  1JJG A;  2RCF A;  1D5M C;  1KRT A;  1SJE D;  4DXF A;  2B2U C;  4I7A A;  4DA2 A;  2MO1 A;  2G5D A;  1PRT D;  1VS0 A;  1RJT A;  4DUY Q;  3HOV G;  3RR5 A;  4X66 Q;  1EYG A;  3SEB A;  3I73 A;  4PV1 C;  4EVO A;  4LW1 A;  1H9M A;  5C0X G;  4DV0 Q;  1AE2 A;  1VQN A;  4Y7N B;  3TRZ A;  3CCQ A;  3HKZ G;  4JK1 C;  3KDF B;  1IL2 A;  5I9O A;  4K6L A;  4CJ2 C;  3M85 A;  2JA6 G;  4U67 3;  1B9N A;  3A7A B;  4HR7 B;  2NN6 H;  3JAM c;  1X3P A;  1VQB A;  5ELO A;  3ND8 A;  1MBY A;  1ESF A;  1YNN C;  2LFN A;  4A3K H;  2MUY A;  4X6A H;  4R4T A;  2M9V A;  2A73 B;  4KY7 A;  4P74 A;  1YI2 A;  1F77 A;  1KAW A;  2L15 A;  1A6X A;  5A2Q E;  4G4K A;  3H91 A;  4BY7 B;  1M90 C;  1JJ2 A;  1MGS A;  1TWH H;  2HCI A;  4R8I A;  4DAV A;  4OHJ A;  3T4A C;  2MP1 A;  3E3X A;  1CK1 A;  2WB1 B;  5EBD A;  2DGY A;  3H0G G;  1Z47 A;  1DOK A;  3HGB A;  1VQ8 A;  3FPP A;  4JV5 Q;  2N88 A;  1RTO A;  1GOZ A;  2KVM A;  1ESR A;  3BVG A;  1FGU A;  1KDA A;  1VDZ A;  4PMW A;  2VQE L;  1CSQ A;  3V2T A;  1VQ6 A;  3E0J A;  5CBE E;  1SE8 A;  4WJ3 M;  5I9P A;  4HIM A;  1CKM A;  4O42 A;  1C9O A;  1B9M A;  2Y0S G;  3A5U A;  1V1O A;  4YHH Q;  3MXP A;  3CPW A;  3I4L A;  3URY A;  1YEZ A;  3DWQ A;  1NUC A;  1VQI A;  2ZTC A;  2CFM A;  3ERO A;  1MJE A;  4XQN A;  4JOI A;  4JC0 A;  2VQF Q;  2RQX A;  1SE4 A;  4CDE C;  4KHZ A;  3PO3 H;  2N55 A;  4IUQ A;  5ELE A;  3T16 A;  3GP7 A;  5KGU A;  2WB1 E;  4GN4 B;  2NTS A;  5JJL A;  3QG1 A;  2NZO A;  1ZKO A;  1X32 A;  3OWE B;  1C8C A;  2DJG C;  5BN4 A;  4A93 B;  5DEH A;  4XXE A;  3CCU A;  1JE4 A;  2A69 C;  4DV5 L;  1N33 L;  4A3B H;  4KMU C;  1B1Z A;  1EEF D;  4R8N A;  3GTJ H;  2OQK A;  4R4C A;  1Y1W B;  1S3O A;  2KEN A;  4NXN Q;  2J7Z A;  1D1I A;  1J9O A;  2CH4 W;  2I5H A;  4IUN A;  4OEM B;  1QB5 D;  4LUV A;  1HNX L;  2B8F A;  1EQT A;  1VQC A;  4U68 A;  1VQL A;  5FK9 C;  1XTC D;  1QNU A;  3HOX H;  1Q46 A;  3OW7 A;  1NNX A;  4LUZ A;  3SR1 A;  4CBV A;  1UE5 A;  3TS2 A;  4DAP A;  5GRO A;  2CQO A;  4LFB Q;  3JAM i;  2K04 A;  4A3G B;  1VF5 C;  3NTH A;  3WDN A;  1BKB A;  2CVR A;  5FOB B;  3J80 i;  3H3V C;  1TS2 A;  5HUR A;  4EGV A;  4DV0 L;  4A3D G;  3S24 A;  3AEV A;  2K75 A;  3GTP H;  1EWH A;  1TU2 B;  2CQA A;  2EDG A;  1I4P A;  4YCW A;  4GKJ Q;  2NBF A;  1D7Q A;  1KAB A;  2JA5 H;  1SNO A;  3PV0 A;  1QE6 A;  1PH1 A;  3S2D H;  2L11 A;  1O7Z A;  2MJ8 A;  2NVY B;  4JCV E;  5C5M A;  3J81 L;  1W6K A;  2CWA A;  1PRT B;  4RMF A;  2NN6 I;  1MIU A;  2JA7 G;  4JW0 A;  5C4J B;  4P72 A;  3FEW X;  1AZP A;  1IYJ B;  4CGY B;  3GTG B;  4ZK9 B;  1PFM A;  2QKI C;  1QVF A;  5ELN A;  4X62 L;  3ER0 A;  1ZYR D;  1Q7Y C;  2F0T A;  4C3J B;  3KLS X;  1JOR A;  1WI5 A;  1CM9 A;  5LMN W;  1X65 A;  2RA4 A;  4KHP Q;  1BBU A;  1SYB A;  1TWA H;  2B63 G;  3EBE A;  4IQZ A;  2F0L A;  1CI3 M;  4JV5 L;  2K6A A;  1SDF A;  1Q1E A;  1BCP D;  1WCM B;  5HY6 A;  4RA8 A;  3T1H Q;  3EN2 A;  1AE3 A;  2BH2 A;  5CV4 A;  1PV4 A;  2YYZ A;  2F0F A;  1AW7 A;  5IYB H;  1O7L A;  1PRT C;  4E6I A;  4YHH L;  4OO1 I;  3J7A V;  3U58 A;  2DUD A;  1WVL A;  4FF4 A;  1EZ8 A;  2EYM A;  3I91 A;  1HQR D;  5I2X A;  4WJ4 A;  3F2B A;  2IWH A;  4A3I B;  5CV8 A;  2ZM6 L;  2EJG C;  1Y1V B;  1TY2 A;  3DM3 A;  5C44 H;  4KD4 A;  3QO2 A;  4IUR A;  4HCS A;  3OPO A;  4LK1 C;  2F3W A;  1I94 L;  2I46 A;  4F7X A;  4DR2 Q;  3I56 A;  4CHT B;  1G8Z D;  2L4N A;  2IHE A;  2JYO A;  4DV3 L;  3MXU A;  5A35 A;  1TWF B;  3GTO H;  1WTW A;  1EY4 A;  1RF2 D;  4K6D A;  5C4Z A;  2RDH A;  1HJP A;  5NUC A;  1ET9 A;  4NXN L;  5M3M G;  3RLN A;  2KBN A;  1B3Q A;  1LTS D;  3DWP A;  1U4M A;  2YU9 B;  4BBS H;  1MSG A;  2O2L D;  2EPB A;  4NW2 A;  1OXS C;  1R9T B;  3M7G A;  4YWK A;  5C4H A;  3P7J A;  2NZH A;  2EYO A;  4A76 A;  3J7A 5;  4LFB L;  5M3F G;  2XWB B;  1W6J A;  3S14 B;  4C3I B;  1H9S B;  4F88 A;  2C9O A;  1EU3 A;  3ERQ A;  1FVI A;  3VA5 A;  4HIK A;  2PZU A;  2FFK B;  3I4M H;  5J39 A;  1DCZ A;  2OQ0 A;  4EQP A;  1B8A A;  4K8I A;  1Z7T A;  4TQU S;  3HOZ G;  4GKJ L;  2J4X A;  4YCV A;  3VR2 A;  4DV6 Q;  4C3H H;  2QA4 A;  3G6J B;  3S1R H;  4FF1 A;  2R93 G;  4C1N K;  1YHB A;  3SE0 A;  3CP0 A;  4A3M G;  4GLA C;  1I6H H;  2XIW A;  1YJ9 A;  4DV4 Q;  3MFG A;  1F9S A;  2SEB D;  3PUW A;  4V0B A;  4K14 A;  1F2M A;  4NDX A;  2EJF C;  1SRU A;  3EVQ A;  1X6O A;  3HKZ B;  4Y52 H;  4LFA Q;  3ULL A;  3D6W A;  2Z6K C;  3FP9 A;  5JEA H;  1E24 A;  4KHP L;  2F3V A;  1DXM A;  1LUZ A;  4HMJ A;  1K28 A;  2F03 A;  1RHP A;  5IE8 A;  1R4P B;  4NMZ A;  4KK7 A;  1PLF A;  3CCS A;  4OX9 Q;  2HT1 A;  1JIC A;  4LF4 Q;  3BVZ A;  3CKI B;  2QEJ C;  4NXM Q;  2NVX B;  5EQ0 A;  3T1H L;  5IOC A;  1TS5 A;  1G91 A;  1WTQ A;  5FLX c;  4LF5 L;  2F0E A;  3PUV A;  2KCM A;  4CKB A;  1QVG A;  4EQN A;  1JQY D;  4JI6 Q;  1SFO B;  2GVB A;  1GUO A;  3RN2 A;  5CMD A;  3RUZ A;  1EYA A;  3HOY G;  1U4P A;  4A3C G;  3PO2 H;  2NVQ B;  1STG A;  1CZG A;  1PH5 A;  2KCT A;  1JCK B;  5IY0 A;  1FNU A;  3HKZ E;  2BE5 C;  3I70 A;  4KY6 A;  1MI2 A;  4RH6 A;  1I5F A;  5ISR A;  4R4I A;  4QUF A;  4DR2 L;  3F1Z A;  4B08 A;  3GTQ B;  3M7N A;  2RHS B;  4YWL A;  4DN4 M;  4Q0F A;  3LWU A;  2B2W C;  1Y1W G;  4LF7 Q;  2R7D A;  3K57 A;  1PZJ D;  3D4D A;  4RHS A;  5FJ8 H;  1OXT A;  2F4V L;  5K36 G;  1STN A;  2NZ1 D;  3K7A B;  2TMP A;  2PI2 E;  2A6H C;  2CHB D;  2GN5 A;  3WWV A;  2R7Z G;  5J1Z A;  5C3E G;  2JP1 A;  4JBW A;  3MC0 B;  3TSS A;  3GTM H;  3RZO H;  1HRJ A;  1HNW Q;  2CH4 A;  3PCO B;  2M00 A;  3NTI A;  1JWM D;  3K5L A;  3PSI A;  2XVS A;  1G2T A;  3CRL C;  3Q23 A;  1ENF A;  1EQQ A;  3DMU A;  1YNJ C;  3KLW A;  1CZW A;  5DM7 3;  1I4G A;  4XDX A;  3PF4 A;  1CUK A;  1FR3 A;  2L55 A;  3D31 A;  2IY5 B;  1C48 A;  3A55 A;  3D6C A;  5E3F A;  1S5B D;  4OEL B;  2R92 H;  4QQB X;  3L2P A;  5COR A;  4DV6 L;  3VYU A;  4NPS A; 
#chains in the Genus database with same CATH homology
 2EXD A;  4X66 L;  3IRB A;  3M9B A;  1EYG A;  4QGU A;  3CQZ H;  4C3J H;  2R92 G;  3KF6 B;  2JA6 H;  5JJK A;  4LW1 A;  4O0A A;  5C0X I;  5C0X G;  4JI1 Q;  4DV4 L;  2OTL A;  4DV0 Q;  5JJI A;  1AE2 A;  1VQN A;  3CC7 A;  3TRZ A;  1UEB A;  2D62 A;  3CCQ A;  3AFP A;  3HKZ G;  3KDF B;  1G6P A;  1IL2 A;  3M85 A;  4DR1 Q;  4UP9 A;  2JA6 G;  1EUJ A;  3J81 c;  1EFW A;  3PUZ A;  3RLO A;  3S2H H;  1TWC H;  3JAM c;  1VQP A;  1S40 A;  4LFA L;  5ELO A;  1VQB A;  1VQO A;  2PQA A;  4QIW E;  3S1N H;  5IYC H;  2K5V A;  4A3K H;  2KHI A;  5FLM H;  3TS0 A;  4X6A H;  2NN6 G;  1K0R A;  4R4T A;  4LF9 Q;  4LF9 L;  1A62 A;  5GAH C;  2AWN A;  1B7Y B;  4P74 A;  5BR8 L;  1YI2 A;  1KAW A;  2L15 A;  2XTI A;  1O7I A;  4J15 A;  3W1G A;  4JI8 L;  2A8V A;  2AMC B;  1EWI A;  1DGS A;  1PH8 A;  5IYC G;  4A3K G;  1TWH H;  3F8T A;  4MTN A;  1SFO H;  3J81 j;  1HH2 P;  1L0W A;  4IPH A;  1JJ2 A;  4POG A;  4JBJ A;  4IOA A;  4BBR H;  1L1O B;  3SGI A;  1VQ5 A;  3H0G H;  2VZA A;  1SMX A;  1KHI A;  4YCU A;  1WFQ A;  4DAM A;  3LGJ A;  3F2C A;  3CCJ A;  4A3I H;  2DGY A;  4BBR G;  4DR4 L;  2QGQ A;  4JI6 L;  3H0G G;  1Z47 A;  1X3F A;  4FDB A;  4GOP A;  1VQ8 A;  4JV5 Q;  4GN3 B;  1J6Q A;  2Z0S A;  1XPO A;  2JA9 A;  3AYH B;  3NEL A;  1PH9 A;  1FGU A;  3E0E A;  3L7Z C;  4NB3 A;  4X65 Q;  4X65 L;  2ZJR A;  4PMW A;  2ZTD A;  2VQE L;  3CCV A;  1X56 A;  1V9P A;  1HZB A;  4K0K Q;  1CSQ A;  2NVT H;  5GAE C;  4P73 A;  1VQ6 A;  1SE8 A;  1X3G A;  4OX9 L;  1CSP A;  1VQ7 A;  3M3Y H;  4WJ3 M;  4JI5 L;  1D8L A;  4HIM A;  1QUQ B;  4R1J A;  1CKM A;  1QVC A;  1C9O A;  3S16 H;  1KL9 A;  3HKS A;  2UXC L;  2Y0S G;  3A5U A;  4IPD A;  4IFD I;  4IFD G;  4YHH Q;  2KHJ A;  5M5Y H;  3CPW A;  3CD6 A;  2WP8 J;  2R6G A;  2Z6K A;  1PHJ A;  3BU2 A;  2HIV A;  2UUB Q;  2YU9 H;  2WAQ E;  3M4P A;  2UUB L;  1YEZ A;  1VQI A;  1KRS A;  2ZTC A;  2CFM A;  1GM5 A;  1MJE A;  1OXX K;  1XMQ Q;  2ZJP A;  4JOI A;  1L1O C;  2VUM H;  4JC0 A;  1VQH A;  2VQF Q;  2VQF L;  3CF5 A;  4RG1 A;  4A3J H;  4GN5 A;  2JA8 H;  3KJP A;  3NEN A;  4KHZ A;  3FHW A;  4DR5 L;  3PO3 H;  1K73 C;  1N32 Q;  3CC4 A;  3PUY A;  2K5N A;  1NE3 A;  2VUM G;  4ALP A;  2WB1 E;  4GN4 B;  5JJL A;  5GAG C;  1XNR Q;  2NZO A;  5C0X J;  2ES2 A;  4A3J G;  3STB C;  2JA8 G;  1X3E A;  4A3L H;  5GAD C;  1HNW L;  1K8A C;  3CCU A;  4DV5 L;  1N33 L;  3K7U C;  3PO3 G;  1XMO Q;  4A3B H;  2UXD Q;  1XMO L;  3I7F A;  4LFC Q;  3KF6 A;  4QL5 A;  4BA2 I;  1NJI C;  3GTJ H;  2OQK A;  2CKZ B;  1XTD A;  1RL2 A;  1WJJ A;  4H02 A;  4R4C A;  3ULJ A;  2UUA L;  1PH6 A;  4B3R Q;  1S3O A;  1UE1 A;  2KEN A;  4NXN Q;  4A3L G;  2UUC Q;  2UUC L;  4A3B G;  1GVP A;  1K3R A;  5IP9 H;  4B3T Q;  3PGZ A;  2F52 A;  2I5H A;  3PIO A;  3GO5 A;  1VCI A;  4GLV B;  1ASZ A;  4BXX H;  4LUV A;  1HNX L;  1OXV A;  3MEF A;  4BA1 I;  1VQL A;  1VQC A;  1YHA A;  1H95 A;  5IP9 G;  3CPF A;  3A0J A;  3U4Z A;  3HOX H;  5JEA J;  1Q46 A;  1Z9F A;  4DAY B;  4LUZ A;  1A8V A;  4X64 Q;  4BXX G;  1XPR A;  1YZ6 A;  3J81 i;  4JI3 Q;  4JI3 L;  2UXB Q;  1UE5 A;  3TS2 A;  2B3G A;  4OXP A;  3I2Z A;  5GRO A;  3I55 A;  4XIG S;  2CQO A;  3S15 H;  4OON A;  3AQQ A;  4DKA C;  3JAM i;  4LFB Q;  3HOX G;  3U50 C;  3CCM A;  4A3D H;  5LMN L;  1V1Q A;  1YIT A;  2E2H H;  1VQJ A;  5IP7 H;  1TWG H;  4QQB X;  1BKB A;  3E9I A;  2JEA I;  3H15 A;  4DV2 Q;  3UDX A;  2PI2 A;  1X54 A;  1L1O A;  1MKH A;  3J80 i;  2C35 B;  2MQH A;  4JI1 L;  1VQK A;  4DV0 L;  4A3D G;  3S24 A;  1YHQ A;  3AEV A;  2K75 A;  4A3F H;  2IHF A;  2ASB A;  3UDG A;  5IP7 G;  3GTP H;  1K83 H;  2I5L X;  4DR1 L;  4YCW A;  1PYB A;  4GKJ Q;  1D7Q A;  4BY1 H;  4OWW B;  2JA5 H;  3PV0 A;  4IPC A;  4TVA B;  4BY7 H;  3HOW G;  1PH1 A;  3S2D H;  2JA7 H;  1LM0 A;  4A3F G;  2CCZ A;  2OWO A;  3BZK A;  4JCV E;  2NVX H;  4BY1 G;  2AWO A;  4YY3 Q;  4B3S Q;  4B3S L;  2CWA A;  1IXR A;  2Q2I A;  4RMF A;  2NN6 I;  1MIU A;  2JA5 G;  3E9H A;  4BY7 G;  4GNX A;  2B29 A;  2JA7 G;  4P72 A;  4GLX A;  2LXJ A;  1NTG A;  2JEB I;  1IYJ B;  3ICE A;  4IPG A;  1QVF A;  1Q81 C;  1QZG A;  4X62 Q;  5ELN A;  1P16 A;  4X62 L;  2OCE A;  3ER0 A;  3S1Q H;  1VQM A;  1Q7Y C;  1OXU A;  2WB1 G;  2V1C C;  2B63 H;  1WI5 A;  2AKW B;  4UPA A;  1X55 A;  5LMN W;  1IBK Q;  3STB D;  1IBK L;  3PIP A;  3KJO A;  3EIV A;  2F3I A;  1GD7 A;  1GKH A;  1GO3 E;  3TQY A;  1X65 A;  4EQ5 A;  2NVQ H;  4KHP Q;  1JT8 A;  3G4S A;  1BBU A;  4GS3 A;  2BA1 A;  3HFZ B;  1YJW A;  1UE7 A;  1TWA H;  2B63 G;  3EBE A;  3DLL A;  2ZJQ A;  1IBL Q;  1SR3 A;  1SLJ A;  2K5H A;  3CW2 C;  2MNA A;  4HJA A;  1JB7 A;  4JV5 L;  4OWT B;  1OTC A;  1E3P A;  2A1A A;  1LYL A;  2AHO B;  1KIX A;  3GTQ H;  1Q1E A;  1T9H A;  1JE5 A;  2EIF A;  1VQD A;  3CMA A;  4HJ5 A;  3S17 H;  4UP8 A;  5HY6 A;  3T1H Q;  1Q12 A;  1AE3 A;  3EN2 A;  2BH2 A;  1PV4 A;  4K0K L;  2EQS A;  3RNU A;  2I0Q A;  5LMU Q;  5LMU L;  1PH2 A;  2YYZ A;  1KD1 C;  5IYB H;  3K7A H;  4JI7 Q;  2YTV A;  4JI7 L;  1NMG A;  1J5E Q;  4YHH L;  3AFQ A;  5HGQ A;  1PA6 A;  4OO1 I;  4OO1 G;  1N9W A;  3PUX A;  2DUD A;  3U58 A;  4HJ7 A;  2PMZ E;  2R7F A;  3OYY A;  5IYB G;  2PQA B;  1N36 Q;  3K8A A;  3H3V H;  2Q2T A;  4JI0 Q;  4EX5 A;  4QY7 A;  4WJ4 A;  3F2B A;  2GVA A;  1XMQ L;  4O2D A;  2ZM6 Q;  4A93 H;  2ZM6 L;  5M5X H;  1BBW A;  3DM3 A;  5GQO A;  5C44 H;  3OTO Q;  3HOU H;  1SN8 A;  3S1M H;  2QEX A;  1U0L A;  1I3Q H;  2VY3 A;  3U4V A;  1I94 Q;  3ULP A;  1I94 L;  1EQR A;  4GKK Q;  2JJQ A;  4HIO A;  4DR2 Q;  3UDI A;  4A93 G;  3I56 A;  1Q1B A;  2H5X A;  5J3B A;  5C44 G;  1XNR L;  3ZJY C;  3UDF A;  3PF5 A;  3HOU G;  4IOC A;  2IHE A;  4DV3 Q;  3VDY A;  4DV3 L;  1IBM Q;  3TEH B;  5M3M H;  4DR3 Q;  1KQS A;  4R4O A;  3GTO H;  3K0X A;  1AH9 A;  3UE1 A;  1HR0 Q;  4DR7 L;  1YNX A;  3KOJ A;  1UE6 A;  1B70 B;  4LFC L;  1HR0 L;  1HJP A;  1W3S A;  4B3R L;  4NXN L;  5M3M G;  4GOP B;  1QZH A;  4YWM A;  3RLN A;  2KBN A;  3KDF A;  3Q8D A;  4B3T L;  4LUO A;  1G51 A;  1VQ4 A;  4JI4 Q;  1UWV A;  2HQL A;  2RHQ B;  1JJC B;  2K50 A;  2JE6 I;  1E1O A;  1PH7 A;  4BBS H;  2XGT A;  4MZ9 A;  1FL0 A;  1PFS A;  1CKN B;  1OXS C;  3JC6 6;  2K4K A;  1G29 1;  5M3F H;  4YWK A;  4A3G H;  4L5R C;  2E8G A;  4X64 L;  1C7Y A;  5IWA Q;  2Q2U A;  3NBH B;  2VL6 A;  4JI2 Q;  4BBS G;  2RCN A;  3W1B A;  3I4N G;  4A3G G;  2UXB L;  1U5K A;  3UE0 A;  4Y7N H;  2NZH A;  1A63 A;  1PYS B;  4A76 A;  1XNQ Q;  4DUZ Q;  1XNQ L;  3J7A 5;  4DUZ L;  4LFB L;  5M3F G;  2UU9 Q;  1M90 C;  3TRE A;  4AQY Q;  2VW9 A;  1FVI A;  4HIK A;  4DV2 L;  3HOZ H;  4B3M Q;  1JMC A;  3I4M H;  4IJH A;  2NVY H;  2BA0 A;  1VQE A;  5AJ3 Q;  2OQ0 A;  1YIJ A;  1X9N A;  3HOW H;  2MFI A;  1B8A A;  4JG2 A;  3CAM A;  2Q2H A;  4R4Q A;  1I50 H;  3F2D A;  3KFU A;  4TQU S;  2R93 H;  3ERS X;  3HOZ G;  1HR0 W;  4A3E H;  4LWC A;  4PG3 A;  3I4M G;  2Y0S E;  4GKJ L;  4P75 A;  4YCV A;  4A3M H;  3CC2 A;  4AYB E;  4DV6 Q;  4JBM A;  4C3H H;  2QA4 A;  4GOP C;  1WYD A;  5EAY A;  3S1R H;  4DR7 Q;  1HZ9 A;  2R93 G;  1VQ9 A;  3K80 C;  2WAQ G;  4A3E G;  1YHB A;  2WFW A;  1Q8K A;  3CCE A;  4YY3 L;  3CP0 A;  2ALY B;  4A3M G;  1N32 L;  1NMF A;  4GLA C;  4PZ8 A;  3HOV G;  1YJ9 A;  4DV4 Q;  1I6H H;  4IFD J;  2VNU D;  1HZA A;  4IO9 A;  2VS1 A;  3PUW A;  2E2I H;  3KYH C;  1QUQ A;  4LNQ A;  3M4O H;  3CCR A;  1K8G A;  1SRU A;  1KC8 C;  4PZ7 A;  1Q82 C;  1X6O A;  1EIF A;  1N8R C;  1K9M C;  4JYA Q;  3OW2 A;  3BJU A;  1RIP A;  4JYA L;  4Y52 H;  2I5M X;  4LFA Q;  3ULL A;  1PVO A;  5E7N A;  5C4X H;  1WCM H;  2Z6K C;  3A74 A;  3FP9 A;  2JQO A;  1E24 A;  4POF A;  2HHH Q;  1HNZ Q;  4L5Q A;  2HHH L;  1HNZ L;  4KHP L;  3W5O A;  3I4O A;  1LUZ A;  3J80 c;  4LF6 Q;  1FJG Q;  4JOI C;  4LF6 L;  1FJG L;  5BR8 Q;  1IBL L;  5C4X G;  1WCM G;  5IE8 A;  4C2M H;  4JI8 Q;  5JEA G;  4DK3 C;  2YV5 A;  4OX9 Q;  2PNH A;  3CCS A;  1YJN A;  4JBK A;  2HT1 A;  4AH6 A;  2D0P A;  5FLM G;  1PH4 A;  4LF4 Q;  1CKO A;  4LF4 L;  4DV1 Q;  4NXM Q;  4DV1 L;  4AIM A;  4NXM L;  2N8N A;  1IZ6 A;  3T1H L;  2A19 A;  3CCL A;  3D0F A;  4L5S A;  1LTL A;  3L0O A;  4LF5 Q;  3M4Q A;  5FLX c;  5DLQ E;  4LF5 L;  1TXY A;  3GTK H;  2N49 A;  1Y14 B;  1Y1V H;  3PUV A;  2KCM A;  1QVG A;  4DR4 Q;  2E5L Q;  4JI6 Q;  2E5L L;  3HOY H;  2GVB A;  3RN2 A;  4A3C H;  3GD7 A;  1J5E L;  1M1K C;  1HZC A;  3K81 C;  4DPG A;  4DK6 C;  4HID A;  4A3I G;  1Y1V G;  2N78 A;  1N36 L;  4KI0 A;  3CME A;  1A0I A;  1XPU A;  3HOY G;  4JI0 L;  4KLK A;  4IJL A;  2ZTE A;  4A3C G;  2VQE Q;  4LF8 Q;  1TWF H;  1YBY A;  2IX0 A;  4LF8 L;  4GNX B;  3G71 A;  2ID0 A;  1CKN A;  3PO2 H;  1WOC A;  1SRO A;  2CWP A;  2KCT A;  3OTO L;  4XTC S;  5IY0 A;  3HKZ E;  1NY4 A;  2JK8 A;  3GTL H;  3H3V I;  5IT9 c;  4JI5 Q;  1E1T A;  1Y1W H;  2UXC Q;  1I5F A;  1W2B A;  4GKK L;  4ME3 A;  4R4I A;  3RLF A;  4DR2 L;  3PO2 G;  3F1Z A;  3M7N A;  2RHS B;  3T1Y Q;  3T1Y L;  4YWL A;  4APV A;  4AYB G;  1XJV A;  2UXD L;  1IBM L;  5IYD H;  4DR3 L;  1Y1W G;  1N34 Q;  2R7D A;  2RF4 A;  1N34 L;  4LF7 Q;  4LF7 L;  1Q86 C;  1PH3 A;  5FJ8 H;  2IX1 A;  1OXT A;  2F4V Q;  2R7Z H;  3G6E A;  2F4V L;  4P71 A;  2K52 A;  1MJC A;  5C3E H;  5K36 G;  4UY8 C;  3BZC A;  1R9T H;  3KF8 B;  2IT1 A;  2N3S A;  4DR6 Q;  3A5Z B;  5IYD G;  3GDE A;  5M5W H;  3MXN B;  4DR6 L;  1KXL A;  2OTJ A;  3RZD H;  2PI2 E;  1P8L A;  2GN5 A;  3WWV A;  5FJ8 G;  4DR5 Q;  2R7Z G;  4JI4 L;  1E7Z A;  5C3E G;  4JBW A;  3GTM H;  3RZO H;  1ASY A;  3J7Z C;  4DV7 Q;  4HJ8 A;  4DV7 L;  4L5T A;  4C3I H;  3I4N H;  4A4I A;  3S14 H;  1VQA A;  1VQF A;  3FKI H;  1EOV A;  1HNW Q;  1E22 A;  4DNI A;  1EIY B;  4DV5 Q;  1N33 Q;  3G48 A;  3PCO B;  1C0A A;  4HJ9 A;  1NBW A;  2MO0 A;  1V43 A;  4PZ6 A;  1PH5 A;  5IWA L;  2ATW A;  3PSI A;  4JI2 L;  2UUA Q;  4MNO A;  3FKI G;  1L2F A;  4OWX B;  4GNX C;  1EQQ A;  1BVS A;  2FXQ A;  3KLW A;  1S72 A;  2UU9 L;  1YVC A;  2YTY A;  2HIX A;  4AQY L;  2LXK A;  4QJF A;  1CUK A;  2E2J H;  3PF4 A;  2D0O A;  1HNX Q;  5H1S E;  4B3M L;  2YTX A;  1VQG A;  3CXC A;  2K14 A;  3D31 A;  2IY5 B;  5AJ3 L;  1JJG A;  1KRT A;  2LSS A;  3HOV H;  3RN5 A;  5C4J H;  2R92 H;  2MO1 A;  3B6Y A;  3GTG H;  1VS0 A;  3L2P A;  2BH8 A;  4UP7 A;  3NEM A;  4DV6 L;  4DUY Q;  4A75 A;  4DUY L;  5LMN Q;  3RR5 A;  4X66 Q;  4NPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...