3S14H

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s14H00
1N33L 2WAQE 1Z9FA 4A3MH 1HNXL 1G6PA 4APVA 4UP7A 4BA1I 4JG2A 4LW1A 4MZ9A 2OWOA 4HJ8A 3EIVA 3M85A 2A8VA 4JI2L 4KLKA 3CCMA 2YYZA 2R7DA 2RF4A 1HZ9A 3FKIG 1JJ2A 2OTLA 1U5KA 2BH2A 2R93H 3BZCA 2B3GA 2Z0SA 4A3JG 3LGJA 4A3LH 3HOUG 1T9HA 2PMZE 1S3OA 1E22A 3RR5A 2IY5B 2AHOB 1KRTA 2ZJQA 2K75A 4YCUA 2KHIA 1I6HH 4DR3Q 3RLNA 4R4OA 1VQDA 1SROA 4A3BH 1N33Q 1X55A 4DNIA 5JEAJ 4LF8L 3PF4A 1L0WA 2F4VQ 4FDBA 2H5XA 1OXSC 3PSIA 1B7YB 2GVBA 1Q46A 3TRZA 2ZM6L 1XTDA 1PYSB 2C35B 3GTPH 2IHEA 1GKHA 1O7IA 4NPSA 2FXQA 1IBKL 1PH1A 4POGA 1YEZA 2HIXA 3GTOH 3CP0A 3D31A 2E8GA 4JI5Q 3HKZG 2PQAA 4B3TQ 1FJGL 1HZAA 3CXCA 3A0JA 2CWPA 3PUZA 4PG3A 1N34Q 3J80c 3OTOQ 2ZTDA 2UXDL 1I94Q 1KAWA 1VQJA 1EQQA 4A3GG 4O2DA 2K50A 4YWMA 3K80C 2BA0A 3CC7A 4DV4Q 4LNQA 1YJNA 4DR5L 1IBML 2JA5G 2LSSA 3AQQA 2JEBI 3UDFA 1XJVA 1XMQQ 4OWTB 3PGZA 4YHHQ 1V43A 4A3DH 3GD7A 4JI1L 1WOCA 3PUWA 3L0OA 1WCMH 1YJWA 4OXPA 4IFDG 4DV6L 2VZAA 4BY1H 1QVGA 3RLOA 3PO3G 3PIPA 1XPRA 4YY3L 2WFWA 1HNWQ 3E9HA 4QQBX 1NTGA 1QUQB 2NVXH 4LF9Q 4A3FG 1GD7A 4GN3B 4R1JA 1EFWA 2UXDQ 4DR2L 1YHQA 1N8RC 2HHHQ 1RIPA 3I4NH 1VQEA 5IP9G 5IT9c 3DM3A 4JOIC 1SLJA 1YHAA 3JAMc 1L1OA 1EIFA 4L5RC 2QEXA 4AYBE 1LTLA 3OYYA 1HNZL 2R92H 4PMWA 3CQZH 5JEAG 3GTJH 5M5XH 4JI1Q 4GOPA 1PH9A 1YI2A 4JYAL 3S24A 4JBWA 4DV6Q 2EIFA 4GLVB 3CCRA 1IBLL 2E2JH 5IYDG 2QA4A 4A3GH 4LF5L 2R7FA 3RZOH 3H0GG 3HOXH 2MO1A 5IP7H 2E2IH 4JV5L 4WJ3M 1M90C 1UWVA 5FLMH 3CCUA 4O0AA 3K7AH 2VL6A 1IYJB 2K52A 4X64Q 3SGIA 4LFBQ 4HJAA 3RN2A 3GTGH 4A3EG 4HJ5A 4A3KG 5GQOA 1E3PA 2JJQA 3PO3H 3HOZG 2MNAA 2GVAA 3MEFA 5C44G 4A3CH 2N8NA 3GO5A 1QZGA 3KDFB 4UPAA 5FLXc 3J81i 4B3RQ 3I4MG 3M4QA 4LF7L 1GO3E 2B63G 2BA1A 2KBNA 3CPFA 3KF6B 4AIMA 3J81j 1EIYB 3F2BA 4DR7L 4OONA 4DV1Q 1VQFA 3OW2A 4JC0A 5IY0A 2VQFQ 1SE8A 5M5WH 4DK3C 2VS1A 2OQKA 4X6AH 1I50H 5LMNL 5BR8Q 4JI0L 1PH2A 4BA2I 3A5ZB 2IX0A 3H0GH 4POFA 1Q81C 1GM5A 4JI4L 2R7ZG 1HH2P 2L15A 3G48A 4DV5L 5GAHC 1N36Q 3STBD 3KLWA 2VQEL 5LMNW 5GROA 3U4VA 1AE2A 4IPCA 2UXBL 2F3IA 4DR6L 4DV7Q 4LF7Q 1XMOQ 4OO1I 4QGUA 2Q2TA 2HT1A 3RN5A 4DR7Q 1S40A 1N9WA 2NVQH 4ME3A 4A3KH 1UE6A 1BBUA 1VS0A 2UUCQ 2ATWA 4BBSG 4LF6Q 1HJPA 1MKHA 2JA7H 3S1MH 4B3MQ 5C44H 1K9MC 3HOYH 4HIOA 3PUVA 1PH5A 2K5VA 1QZHA 3CPWA 2E5LQ 1TWGH 4NXNL 3I4MH 1LM0A 3F2CA 4IFDJ 4YWKA 1HZCA 4PZ7A 2OQ0A 5C3EG 4PZ6A 4DUYQ 4LF4L 1XNQL 3F1ZA 3J7A5 1PV4A 3UDXA 1CSQA 4C2MH 5C0XI 4R4QA 4DV3L 2UUAQ 5C4XH 1W3SA 4MTNA 5IYBH 4JI3Q 4BY7H 2ES2A 1A8VA 5LMUQ 2CKZB 1PH3A 2WB1G 4OX9L 1VQLA 1VQAA 2R7ZH 1PH8A 1C0AA 3AFQA 3K81C 2JA6H 1HNXQ 2Q2HA 1X9NA 4C3IH 5GADC 2QGQA 4DV0L 4JI7L 1N32L 5M3MH 3S14H 5IWAL 4JBMA 3EN2A 1IZ6A 2I5MX 1TWHH 3I7FA 4NXML 2GN5A 1E1TA 1PFSA 4JI2Q 2CFMA 3W5OA 3HOVH 2NN6I 3I56A 4GLXA 4DV2L 1YNXA 3CCLA 2YU9H 1OXXK 3W1BA 5K36G 2AKWB 2EXDA 3G71A 2CWAA 3PO2G 4AQYL 4LFAL 1UEBA 3BZKA 3ICEA 3HFZB 2MFIA 3CCSA 4B3SL 1AE3A 2LXJA 1X56A 3FKIH 3PUXA 2WAQG 4X66L 1EUJA 3PCOB 5ELOA 3W1GA 4BXXG 4LF8Q 4GKJL 5JJLA 1OXTA 4A3JH 3ULJA 3HOUH 2K5NA 2WP8J 4TVAB 3PIOA 1X65A 3S2HH 2ZM6Q 2HQLA 2YTVA 4JI8L 4L5SA 1Y1VG 1IBKQ 1J5EL 4A3IG 2I5HA 3FHWA 1VCIA 1BVSA 2AWNA 3A74A 4MNOA 1FJGQ 1KIXA 1VQIA 1AH9A 3TS2A 1C9OA 2IT1A 1Y1WG 3J81c 3PV0A 1Y14B 2B29A 2I0QA 2ASBA 4GKJQ 3STBC 3K0XA 2RCNA 1U0LA 4HIKA 1JT8A 4IJHA 4GLAC 1UE7A 1WI5A 4C3JH 1E24A 5H1SE 4DR5Q 1IBMQ 4IPHA 2NZHA 1MJCA 2ALYB 4GNXB 1TWCH 1NJIC 1D7QA 1J5EQ 3H3VH 2VUMG 3ZJYC 4JBKA 4YY3Q 3UDIA 3F2DA 1CKOA 4DR1L 1VQGA 2N78A 2CQOA 1X3EA 2Y0SE 5IYCG 1MJEA 4HJ9A 4PZ8A 4ALPA 4DR2Q 2JA5H 2IX1A 2A1AA 2JA8G 3CCEA 5AJ3L 3T1YL 4JI6L 1QVCA 1YHBA 2UXCL 1OXVA 3K8AA 4DPGA 4P74A 1Q86C 4A3IH 1J6QA 2K5HA 3AYHB 4J15A 5FJ8G 1VQ4A 4YWLA 5C0XJ 3GTLH 2KCTA 1JE5A 1CKNB 1G291 1CKMA 4LUVA 4YCWA 5M3FG 1JB7A 4X65L 1SN8A 3M9BA 4LWCA 1XPOA 4JYAQ 2YTYA 3U4ZA 3I2ZA 4QIWE 4A3FH 4K0KL 2ZTEA 1TXYA 4OWWB 5HGQA 1IBLQ 1TWAH 3EBEA 4DR4L 5IP9H 1UE5A 3ER0A 4LF5Q 5M5YH 3CMAA 3CCQA 1K8GA 3CW2C 3ERSX 4JV5Q 2D62A 3BU2A 5HY6A 3KFUA 4GS3A 2AMCB 1HR0L 1QUQA 5GAGC 4DKAC 1L1OC 1WFQA 4IJLA 1KXLA 3AFPA 3DLLA 2UU9L 4A4IA 1VQBA 3KF8B 3G4SA 3AEVA 4A75A 5IYDH 1HR0W 4TQUS 1UE1A 4HIDA 4AYBG 3U58A 2KCMA 4A3MG 2MO0A 2DGYA 3NBHB 1VQNA 3NEMA 1Q8KA 3E9IA 1KL9A 1X54A 1YVCA 5EAYA 1PH6A 1OXUA 4DR4Q 4DK6C 1B8AA 3ULLA 4X62L 1PA6A 4OO1G 3I55A 3KOJA 4A3EH 4LFCL 1CUKA 4KHZA 4C3HH 3GTKH 1PYBA 2R93G 1BKBA 3HOZH 3CAMA 1Q1BA 3M4PA 2JK8A 2OCEA 4QL5A 4A3LG 4IO9A 1S72A 2NVYH 1X3FA 2PI2A 2Z6KC 4GN5A 4JCVE 1ASZA 5LMNQ 3NELA 2Q2UA 4L5TA 4JI0Q 2B63H 3U50C 5IE8A 1MIUA 4A76A 4JI4Q 4DV5Q 2JA9A 4UP9A 4GNXC 3CC2A 2VQEQ 1SFOH 3S2DH 1KHIA 2UXBQ 4YCVA 2VY3A 4DR6Q 3CCJA 2JE6I 2PQAB 1KQSA 3KDFA 5C0XG 3HKZE 3S15H 1SMXA 2CCZA 1EOVA 1X6OA 2ZJRA 4LFCQ 4DR3L 3B6YA 1YIJA 3KJOA 1JJCB 2Q2IA 4HJ7A 1EWIA 3IRBA 2ZTCA 1E1OA 1YBYA 4NXNQ 1NE3A 2F4VL 5JJIA 2NVTH 4GKKL 4Y52H 1QVFA 4RG1A 4LF4Q 1XNQQ 4P72A 4DAYB 4GN4B 2AWOA 1Q82C 2NN6G 1VQ5A 3GTQH 5GAEC 4BBSH 4Y7NH 1SRUA 1PVOA 2VNUD 1TWFH 1YJ9A 4DV3Q 1X3GA 3CD6A 2LXKA 3A5UA 4JI5L 1LUZA 4L5QA 4B3TL 1L2FA 1NMFA 1D8LA 4OX9Q 4IOAA 1VQ6A 1KD1C 4A3DG 4LUZA 5C3EH 1DGSA 1N34L 3OTOL 1WCMG 2R6GA 3ULPA 1I94L 1ASYA 4DV0Q 4BY1G 1KRSA 4JI7Q 1N32Q 3BJUA 1PH7A 1VQHA 4IOCA 5IWAQ 1L1OB 2OTJA 3S1RH 4NXMQ 1IL2A 4DV4L 4GKKQ 2RHQB 5E7NA 4BBRG 4GOPB 1XNRL 4JOIA 2I5LX 2K4KA 3UE0A 4DV2Q 4YHHL 4XTCS 3L2PA 3KJPA 1XMQL 3I4NG 3S17H 1K83H 2N3SA 1VQ9A 2D0PA 4HIMA 2BH8A 3FP9A 3HKSA 5ELNA 4LFAQ 4AQYQ 2MQHA 1JMCA 2ZJPA 1K73C 1YITA 2UUBL 2R92G 1H95A 1HNWL 4RMFA 1W2BA 3L7ZC 3S1NH 4OWXB 1EQRA 3J7ZC 4B3SQ 4LF9L 4UP8A 3H3VI 2F52A 2RHSB 4KHPL 4P73A 2KHJA 4X66Q 2HHHL 1PH4A 3M4OH 2YTXA 1B70B 3HOXG 2JQOA 3D0FA 3PO2H 5IP7G 1BBWA 1C7YA 1P8LA 2IHFA 4QY7A 5FLMG 1XNRQ 1OTCA 3RLFA 2XGTA 4JI8Q 4IFDI 3I4OA 1R9TH 1IXRA 4QJFA 2DUDA 4R4IA 4BXXH 1PHJA 5JJKA 1K0RA 1YZ6A 4XIGS 2PI2E 3TREA 3CCVA 2UUBQ 3HOWG 1JJGA 4BBRH 4A3CG 3VDYA 3TQYA 1SR3A 3G6EA 4KHPQ 1A62A 1FVIA 1Q1EA 2HIVA 3MXNB 4X64L 4LFBL 1Z47A 4KI0A 1Y1VH 1EYGA 3NENA 3PF5A 2E2HH 2EQSA 3TEHB 3CMEA 4DUZL 1Y1WH 2JEAI 3M3YH 3J80i 4B3RL 1GVPA 5DLQE 1NMGA 3RNUA 2YV5A 4LUOA 1V9PA 1HNZQ 1RL2A 1WYDA 4JBJA 4DV1L 1WJJA 4DR1Q 1VQCA 1A63A 3WWVA 2VQFL 3E0EA 4R4TA 1Q12A 1NBWA 3S1QH 4JI6Q 5AJ3Q 3T1YQ 1VQKA 2ID0A 4UY8C 3GTMH 3K7UC 3S16H 1LYLA 2KENA 4A93G 2UXCQ 1FGUA 3RZDH 2VUMH 3TS0A 3JC66 4P75A 5BR8L 4GOPC 2NZOA 1I3QH 2Z6KA 1N36L 2JA7G 4X65Q 4K0KQ 3HOYG 4DUZQ 1VQ8A 4WJ4A 5IYCH 3HOWH 2JA8H 1KC8C 1A0IA 4DV7L 3T1HL 1XMOL 1NY4A 4GNXA 4IPDA 3UDGA 3CC4A 1G51A 2K14A 2WB1E 3GDEA 5FJ8H 4AH6A 2D0OA 3JAMi 1M1KC 2V1CC 1VQ7A 3M7NA 2UUCL 2PNHA 1K8AC 3H15A 5M3FH 2N49A 2Y0SG 3F8TA 1HR0Q 4LF6L 4NB3A 4B3ML 3KYHC 1CSPA 1I5FA 2UU9Q 5IYBG 4EQ5A 2E5LL 4BY7G 1VQOA 3Q8DA 5C4JH 5C4XG 1E7ZA 4EX5A 4H02A 1HZBA 4A3BG 4DUYL 1V1QA 2JA6G 2XTIA 1P16A 2VW9A 1CKNA 4R4CA 4P71A 5J3BA 3UE1A 5M3MG 3T1HQ 1VQPA 1FL0A 4IPGA 2UUAL 4A93H 4X62Q 4DAMA 4JI3L 3CF5A 1VQMA 5LMUL 3KF6A 1Q7YC 3PUYA 1XPUA 3HOVG 1K3RA 2A19A
chains in the Genus database with same CATH superfamily
4F87A 4UP7A 4BA1I 2K01A 4JG2A 4RGOS 1G91A 2CH4W 4JI2L 4FF2A 2K04A 1HZ9A 2RF4A 3FKIG 2OTLA 2BH2A 3BDCA 3VR3A 1U4MA 1S3OA 4CDCC 2IY5B 2ZJQA 2E75C 2Z4HA 3F2UA 5COYA 3PO2B 5JVH3 4C3JB 3IFDA 4L8JA 4PV1C 4DNIA 4LF8L 4XQQA 4RKLA 1OXSC 2SNSA 4OHJA 1GKHA 1O7IA 1Z6HA 2FXQA 1KDAA 1F2ZA 3CP0A 4JI5Q 3HKZG 2PQAA 4B3TQ 4OELB 3OPOA 3A0JA 2CWPA 3GTLB 3PUZA 3TBIB 5KYLA 2ZTDA 3OTOQ 2NN6H 1ET9A 4A3FB 1EY4A 4O2DA 1TVXA 3K80C 2F0VA 3DM1A 4C56C 2LSSA 3AQQA 3FMCA 5D3IB 1T5XD 3GD7A 4JI1L 2OXPA 3PUWA 1Q90A 3L0OA 4DAYA 4IFDG 4QQBX 2NZ1D 2NVXH 4LF9Q 1I3QB 1I4QA 1EFWA 3MZ5A 1YHQA 1N8RC 4ZUJA 3I4NH 5IP9G 1BOSA 4JOIC 4KD4A 5CV9A 2K03A 2GA4B 3J80L 1L1OA 1AEXA 5T1GA 2IWHA 1STYA 4KJOA 2E2JH 3CCRA 1JWMD 4A3GH 2RDHA 2QA4A 5C3XA 3H0GG 1SEBD 1L0YB 2B63B 4WJ3M 5IP7H 4JV5L 1RTOA 1IYJB 3S2DB 4CKEA 1X3PA 3RN2A 4A3EG 3R93A 1LLRD 5GQOA 1B53A 2JJQA 4M1UB 3PO3H 2MNAA 3Q0AA 3MEFA 5C44G 2N8NA 3C1FA 3D4WA 4RAUC 4UPAA 1CA5A 4FXGC 4LF7L 1GO3E 2BA1A 3FRPB 2EZVA 4DR7L 4OONA 1DJRD 1VQFA 2NVTB 3OW2A 1UEAB 2OQKA 5EKLA 3A5ZB 2R7ZG 1STBA 1GM5A 2L15A 1N36Q 1EY9A 1LV9A 2F3WA 2X6LA 3KLWA 5GROA 2XIWA 1VF7A 3TP6A 2MHVA 1CHPD 4DNTB 4EGVA 3RN5A 3LWEA 1BQQT 1STEA 2DNEA 1E2ZA 1NR2A 3HZXA 3HOYH 4CKCA 2K5VA 4NW2A 4DAVA 3CPWA 2E5LQ 1TWGH 4NXNL 2TSSA 2D5DA 1DYQA 4YWKA 2OQ0A 2IL8A 2J4XA 5CV8A 5C3EG 3S1NB 3C1EA 2EOTA 4C2MH 3U9SA 2L0CA 4IUUA 1PZID 1TS4A 5EBDA 2ES2A 3J81E 5LMUQ 2WB1G 1VQAA 4I65A 1PH8A 3HRZC 3AU7A 1RCVD 5HGTA 1N32L 1WCMB 1F9QA 5IWAL 3EN2A 1MHWC 4BY1B 3I56A 4YIJA 2LS01 3SK6A 3NTIA 1JC7A 2CWAA 2F0LA 4IALA 4LFAL 1Y1VB 1UEBA 2MFIA 2PMZB 3K5MA 1QJOA 3VR6A 1LO5D 2WAQG 3W1GA 3PCOB 5CGKA 1Y1WB 4BXXG 1F9RA 1OXTA 2VXWA 3ULJA 2K5NA 2A73B 1QILA 1L0XB 3S2HH 3S16B 4MNOA 1FJGQ 1Y8NB 4HSVA 1UNSA 1AH9A 1A3VA 1C9OA 3D3RA 2RCFA 3J81c 1HRJA 2I0QA 1Y14B 2B29A 3W3AA 2ASBA 4GKJQ 3STBC 2EY2A 3CRKC 3K0XA 2JA8B 2RCNA 1U0LA 4ZQ3A 2NYZD 4KN4C 1S5DD 4GLAC 4IJHA 3SXHA 1AZPA 2MPMA 3R8BA 4C3JH 5DNFA 4DR5Q 1IBMQ 2ZXRA 1XXGA 3R3OA 1WD0A 1TWCH 5M5WB 3OHXC 3UI2A 3ZJYC 3X3NA 3RD4A 4YY3Q 3UDIA 4DR1L 2B2UC 1MJEA 1H9KA 4DR2Q 2K28A 1AW7A 2A69D 1OXVA 3K8AA 5ISRA 4DPGA 4CBVA 4P74A 1Q86C 1J6QA 2K5HA 5FJ8G 4H7BA 4A93B 1X32A 3ONAB 3GTLH 4KKTA 1HNZQ 1CKMA 5M3FG 2AUKA 1SN8A 1XPOA 1MGSA 4A3FH 3NK9A 3NE5B 2ZTEA 1TXYA 3KUPA 4X3SA 2DN8A 1ZXTA 3OIPA 3CW2C 2L9HA 4L63B 2D62A 3I70A 2AMCB 1HR0L 5JEAH 3DLLA 4A4IA 1VQBA 2CW0D 4G7HC 4BY7B 4TQUS 1B50A 3Q23A 4AYBG 4HIDA 3NBHB 4A3BB 1Q8KA 5JAVA 2PCFB 1I4RA 1X54A 2FHTA 1OXUA 1F77A 4DK6C 3V96A 3KOJA 4LFCL 5JVG3 3M4PA 4QL5A 3GTPB 4JCVE 1X3FA 2Z6KC 5CV6A 4JI0Q 2B63H 3OIQA 5KNBA 1WTQA 1PTOF 1MIUA 2FMCA 3S2DH 1KHIA 2D9UA 3CCJA 2JE6I 1KQSA 3KDFA 1F2LA 1SMXA 2RDFA 2CCZA 1X6OA 2ZJRA 5FO8B 1GUTA 1YIJA 2NWGA 1B3AA 2Q2IA 4LMQD 2Z9HA 2BDOA 1E1OA 1NE3A 2NVTH 4GKKL 2MUYA 2QILA 3CRLC 3SK8A 4LF4Q 1Q82C 1NCVA 5ELCA 2NN6G 4PQXA 4ULLA 4JI5L 4B3TL 3SE0A 3X3MA 1KD1C 1M4VA 3SEBA 3OTOL 2R6GA 3ULPA 4K8JA 3GTJB 5M5XB 4JI7Q 1BUVT 1RDPD 1VQHA 2XWJB 2EDGA 1EQTA 2RHQB 4BBRG 3HOXB 4FVMA 4GOPB 1EY7A 3A54A 4HSPA 4DV2Q 3I4NG 2F0UA 4JPBW 2JA5B 2D0PA 4HIMA 3GTGB 1K73C 4RMFA 1XTCD 3A8KE 4OWXB 1EQRA 4B3SQ 1C8CA 2P5ZX 4LF9L 3S1NH 2RHSB 4KHPL 5KNDA 1B70B 1VDZA 1U4RA 2TMPA 4R9WA 5IP7G 4B9XA 1JR0D 4QY7A 1ILPA 4IFDI 1CZGA 1IXRA 4QJFA 2DUDA 3A8IE 1PHJA 1EY5A 3NWSA 1EU4A 1YZ6A 3MVVA 4XIGS 1HA6A 4PMCA 3VDYA 3G6EA 1SR3A 3CU7A 4JW0A 2EYMA 1Y1VH 1LABA 2SOBA 1BF4A 3PF5A 1LT5D 1Y1WH 2JEAI 3GV6A 2JA7B 3RNUA 1XX8A 2BOSA 4LUOA 5CBEE 1RL2A 3I4MB 1WYDA 2PO4A 1WJJA 4KV6A 3WWVA 2XNAC 4DK0A 3E0EA 1JB3A 3S16H 4UY8C 3GTMH 5KYIA 3H3VC 2UXCQ 1H9JA 2L4NA 1PRTF 3TS0A 4GOPC 4ILWA 4QUCA 3IAYA 1N36L 4X65Q 4K0KQ 3BG3A 3HOYG 4DUZQ 1O80A 3JAML 2JA8H 2JA6B 1A0IA 3T1HL 5G3LF 4C3IB 1YNND 4GNXA 4HMIA 3I4LA 2AQ2B 5M3MB 3S14B 3UDGA 3GDEA 2EYLA 3LX0A 2Y0SG 3NTKA 1TT2A 3QIAA 4NB3A 1RJTA 1CSPA 4EQ5A 2E5LL 1VQOA 5C4ZA 4EX5A 3KLSA 4H02A 1HZBA 1V1QA 2XTIA 4R4CA 4ZKCB 1B44D 1FL0A 4A93H 4X62Q 2QEJC 4K2LA 4DAPA 2AQ1B 5LMUL 3S1RB 3HOUB 4FXKC 1SMYC 4CGYB 5J39A 4KD3A 5C5LA 2EYHA 4LW1A 4MZ9A 1R4QB 4HJ8A 2OWOA 2A8VA 3OMGA 4OO1H 4KLKA 3CCMA 2YYZA 5EKKA 4LAAA 1ONLA 4F88A 2B3GA 4A3LH 3DWPA 2AHOB 2K75A 4YCUA 3H91A 4R4OA 2WACA 4A3BH 4MIUA 1N33Q 1X55A 3JAME 3QR8A 3PF4A 3A7AB 2E74C 2F4VQ 5C0XH 1WTVA 1B7YB 3MTSA 3TRZA 1XTDA 3GTPH 2IHEA 4QUFA 1PH1A 2HIXA 3WDNA 2B2VA 3D31A 1Y8OB 2E8GA 4C3JG 3R2IA 1FJGL 1HZAA 1S5FD 4PG3A 1N34Q 1HPCA 5E1FA 3BVZA 1VQJA 1EQQA 1ZEQX 2K50A 2A68C 4DV4Q 3EA6A 2B2WA 1CHQD 3T16A 5FLXE 4DR5L 1IBML 4WFN3 2KCNA 1I4HA 4YHHQ 3A56A 3PGZA 1D1KA 3SK4A 2SDFA 4DV6L 1F2MA 1SBBB 4IZ8A 2B2YC 3RLOA 3TMEA 4YY3L 1HNWQ 4EVOA 1NTGA 2RSNA 4A3FG 4R1JA 4XQJA 2UXDQ 4DR2L 4KMUC 2HHHQ 1RIPA 1NUCA 1Q8IA 3DM3A 1HCZA 1S5BD 4K5WA 2G5DA 4V190 3JAMc 1QG7A 2O5JC 4L5RC 2QEXA 1HNZL 5M9OA 5JEAG 4ZRZA 3GTJH 5M5XH 1AZQA 4EQPA 1YI2A 1DXMA 4JBWA 1TKWB 4GLVB 2NVYB 2R7FA 2C9OA 1X3QA 3HOXH 1QWYA 2QF7A 2SNMA 4DN4M 2F0GA 1M90C 3KLSX 3CCUA 4O0AA 1SFOB 4LFBQ 4HJAA 1YNJD 3GTGH 1SJED 4HJ5A 4A3KG 1K8MA 5I9PA 2EY5A 3Q24A 2GVAA 1RTNA 4OL7A 5ELDA 5FLXc 3A8JE 2VB3X 3J81i 3M4QA 2B63G 3KF6B 1FYCA 3CPFA 3J81j 2Q8RE 3F2BA 4O42A 5IY0A 1EOTA 1B4OA 3NSWA 4G57A 4H0LC 4DK3C 2VS1A 4BBSB 1CQFA 4Y7NB 5IGBA 1TWFB 4JI0L 4X3KA 1Q81C 1WTWA 3GV3A 2KUMA 1HQRD 3U4VA 1MI2A 4DV7Q 1B9MA 1XMOQ 2HT1A 1V1PB 1N9WA 3QOJA 1EYCA 1PTOD 2UUCQ 4HR7B 2ATWA 4H13C 3AMUA 5EJWA 5I2XA 2JA7H 1HQMC 4HIOA 3NWTA 5ELEA 1WTOA 3I4MH 4JVZA 3F2CA 4RH6A 2FFKB 1HZCA 4FXDA 4PZ6A 4DUYQ 4LF4L 2PZWA 5IGDA 1XWEA 3PIO3 2A5HA 5CV7A 4Z9CB 4MTNA 5IYBH 3G6JB 1A8VA 4DK1A 2KEDA 1RKNA 1C0AA 2JA6H 1HNXQ 1TY0A 4C3IH 2QGQA 4JI7L 2KQ3A 2O4XA 3VYUA 5M3MH 3S14H 2EJMA 4JK1C 5CV5A 1E1TA 1PZJD 2NN6I 4DV2L 1OXXK 5ELBA 3W1BA 2EXDA 5F2DA 3C46A 1WTXA 1HTPA 3VYRA 3FEWX 2RDGA 4B3SL 3TP7A 5TSSA 1X56A 2HCIA 4XYQA 2E2HB 4IUPA 1EUJA 2N55A 2XVSA 3HOUH 1I4PA 3RZOB 4TVAB 1EY8A 3PIOA 1X65A 1MSGA 3MXUA 3VA7A 2F0IA 5IGFA 4V0BA 5IOCA 4L5SA 4UAIA 4G7OC 1EL0A 3S1QB 1Y1VG 4A3IG 1CFMA 1BVSA 2X6GA 1OO9B 1KIXA 1K0SA 1LTBD 2NUCA 1Y1WG 1S5CD 3HOWB 1SE4A 4HIKA 1QB5D 3PMFA 1WI5A 1E24A 5H1SE 2NTTA 2NZHA 1MJCA 1J5EQ 5AFWA 3ND8A 3O13A 5KRUA 1H9SB 1CKOA 1PMRA 1TS5A 2CQOA 2DNCA 2JA8G 4PZ8A 1FGBD 2DY7A 2IX1A 2A1AA 1QVCA 2UXCL 4Q0FA 1SJHD 3QG1A 1TR5A 4J15A 2DY8A 2I46A 3L3OC 3J81L 1R4PB 4LUVA 1E2WA 4X65L 3M9BA 4JYAQ 4K0KL 3U4ZA 4QIWE 2KA7A 2WINB 4OWWB 1TWAH 4LF5Q 2K5DA 1PRTD 5M5YH 2N88A 3CCQA 3SVMA 1TS3A 2PNRC 1L1OC 2QDLA 1KTKA 5G3LD 1NNXA 3BDLA 3J7AF 1EYDA 2EXZA 4DA2A 3RUZA 3VYTA 4I7ZC 1SNMA 1SYFA 3U58A 3QWNA 1STNA 1I6HB 4NKLA 1VQNA 1TU2B 1YVCA 4DR4Q 4X62L 1G8ZD 2FINB 4QIWB 4OO1G 1WVLA 2VB2X 1CUKA 1Y8PB 3K59A 1BKBA 3HOZH 1Q1BA 3HOVB 3A7LA 3L9AX 4A3LG 4IO9A 2NVYH 2PI2A 5LL6X 1EIHA 4GN5A 1RHPA 1LT6D 4L5TA 3N6RA 3U50C 4JI4Q 2JA9A 5FO9B 2VQEQ 1SFOH 4ODGA 2UXBQ 4YCVA 5DM73 5C0XG 1BDOA 3HKZE 3LWUA 5BN3A 2MP1A 3MEHA 3B6YA 2Z1CA 1JJCB 1SAPA 3IRBA 4A3DB 4K6LA 4CKBA 1G2SA 2ZTCA 1YBYA 2F4VL 5JJIA 4Y52H 3M4YA 4GN4B 2AWOA 1VQ5A 4IUQA 1WTPA 4BBSH 4IQZA 4Y7NH 1PVOA 3BYYB 1TWFH 1YJ9A 4DV3Q 2A69C 1LUZA 4L5QA 3KLRA 5LL6S 4LK1C 1KABA 4IOAA 1N34L 2R92B 3CQZB 4DV0Q 1FNUA 1PH7A 1GUNA 1LTGD 3IKJA 3K5NA 5ELFA 2F0WA 4DV4L 4NXMQ 2RBMA 4HCEA 5E7NA 1EZ6A 1XNRL 2E2IB 2I5LX 2K4KA 4IUNA 4YHHL 5EPKA 3K7AB 4XT1B 1BCPF 4MHEA 5ELNA 4AQYQ 1JMCA 2ZJPA 2PZUA 3WOFA 1YITA 2UUBL 2CW0C 1HNWL 2IPKD 1AP0A 2KHJA 5DM63 1SNOA 2HHHL 1RF2D 3E0JA 2DJGC 1PFNA 1J9OA 2B2UA 3HOXG 5CMDA 3PO2H 1BBWA 1C7YA 1P8LA 1OTCA 3S9WA 3OWEB 4UDUC 4R4IA 1STAA 1I50B 3QOLA 3TREA 3H0GB 3FDTA 2OF1A 5K5PA 3TQYA 5I6YA 4DFAA 2HIVA 4ME5A 4LFBL 4HAEA 4TRDA 3NENA 4A3EB 4CJ2C 2E2HH 3CMEA 4U673 1W6JA 5C44B 2YV5A 1M8AA 1V9PA 2KECA 3NBIA 3HG9A 4N9TA 4JBJA 1PFBA 1JWUD 1IW7D 4F7XA 3S1QH 1ENFA 2ID0A 1DD2A 1LYLA 4C1NI 1FGUA 4RCOA 2NZOA 1DOLA 1QCBD 4RWSC 2F0KA 3CKIB 1I3QH 2Z6KA 1K28A 4KY5A 3CHBD 2JA7G 2R7ZB 4CJ1B 4WJ4A 5IYCH 3HOWH 2SEBD 1SYGA 4DV7L 1XMOL 2F0JA 1NY4A 4EQNA 4IPDA 1UAPA 3CC4A 1TWHB 2WB1E 3JAMi 2D0OA 2V1CC 1VQ7A 2UUCL 2PNHA 2G9DA 3VR4A 4DGZA 1K8AC 3H15A 3F8TA 5IIFA 5C4HA 2YU9B 1I5FA 5IYBG 1EEFD 1E7ZA 2HDLA 4DUYL 2JA6G 5J3BA 4P71A 5C3EB 5M3MG 1F9SA 3DWAA 3VR2A 4IPGA 1EFID 4G4KA 4ZK9B 4HCSA 4DAMA 4A3JB 3CF5A 1VQMA 1Q7YC 3PUYA 1AN8A 5A35A 4RGTA 2WB1B 2WAQE 1Z9FA 1HNXL 1CA6A 5EQ0A 3Q6SA 4BS9A 3EIVA 5EKIA 2R7DA 4HTHA 1JJ2A 1U5KA 1ILQA 4KY7A 3D6WA 2Z0SA 3LGJA 3NBHA 3HOUG 1T9HA 3RR5A 2AUJD 4OIJA 2XWBB 5FK9C 1KRTA 3TDQA 2XRQD 1I6HH 4DR3Q 1VQDA 1SROA 5IT9E 2JP1A 1GXDC 5C5MA 2PPBC 3M7GA 1L0WA 2QCPX 4FDBA 1C4QA 2H5XA 3PSIA 1Q46A 2JN4A 2C35B 2HQEA 4NPSA 1K8OA 2F03A 2A6HD 2EY6A 2B2TC 3DXJC 1I94Q 3T51B 1KAWA 4A3GG 5JOBA 3E3XA 1NSNS 1W6KA 1YNNC 1YJNA 4IURA 2JEBI 4FNFA 3UDFA 1XMQQ 4OWTB 4A3DH 1SNDA 2FMMA 1WCMH 1YJWA 1IKLA 4ZLTF 4XQNA 2JXMB 3MXGA 4BY1H 1QVGA 3PO3G 1S4ZA 2Q8IB 3H6MA 3E9HA 1QUQB 4RKBA 1GD7A 1JOQA 2LY7A 5J22A 5IT9c 3BZDB 1SLJA 1PXUA 3K58A 1GOZA 1YHAA 1Z7TA 3EJIA 4AYBE 4P2CB 2R92H 4C3HB 1CM9A 3KBGA 3VR5A 3CQZH 3GTKB 4JYAL 1TY2A 4JI1Q 4GOPA 2M9VA 2EYPA 3S24A 2L55A 1SYCA 2HCCA 4LF5L 5E3FA 2F0OA 5FO7B 5C4JB 2MO1A 2E2IH 1UWVA 4X3TA 5FLMH 3K7AH 2F0TA 1LTSD 3W2DA 4X64Q 2QW7A 3S15B 1JE4A 3HOZG 1SE3A 3OWFA 3GO5A 4AYBB 4B3RQ 1AFPA 1ZYRC 2WKCA 4N8X1 2KBNA 4AIMA 4JC0A 2VQFQ 1SE8A 5M5WH 3GTQB 3SK5A 4WORA 4CDFC 3DWQA 1I50H 3URYA 1LT3D 3GQBA 3H0GH 4JI4L 5GAHC 2LFNA 2VQEL 5LMNW 5D14A 3A55A 2F0FA 2UXBL 2F3IA 1CK1A 4LF7Q 4OO1I 1A3UA 2Q2TA 1QOHA 4DR7Q 2BCOA 4IN3A 1S40A 3J7YW 1UE6A 5FLXL 5KEEA 1VS0A 2RQXA 2MJ8A 4BBSG 1MKHA 1U4PA 5C44H 4E6IA 1PH5A 3PUVA 3S17B 1K83B 1QZHA 3C3LA 4ZCKA 2AQ3B 3KF8A 4PZ7A 4HMJA 2ICIA 3F1ZA 3IFTA 1PV4A 3I8ZA 1ET6A 1SNPA 5C0XI 1PTOB 1PZKD 4DV3L 2UUAQ 3T53B 1W3SA 4JI3Q 4BY7H 3M4OB 1GHKA 1F2YA 2R7ZH 1I4XA 3AFQA 3NPPA 2Q2HA 3MAQA 4DV0L 4JBMA 3T13A 2I5MX 1JCKB 1TWHH 4NXML 1F9PA 4O1NA 2GN5A 4K2KA 1KAAA 3H94A 3W5OA 5KNCA 4GLXA 4XXEA 1EU3A 4BBRB 1HHVA 2A6ED 2YU9H 2AKWB 3G71A 1GUOA 2KJXA 3I4NB 3PO2G 4AQYL 2BE5C 3BZKA 1YNJC 3ICEA 1MD2D 1KDCA 1AE3A 1MBYA 2LXJA 2EJGC 3PUXA 5ELOA 4GKJL 3M3YB 5EGTA 1BCPD 1SNQA 4A3JH 2JYOA 2Z8LA 1ZKOA 1ENCA 2ZM6Q 2HQLA 4KJNA 1IBKQ 3V2TA 3EQLC 1JOKA 2WKDA 2I5HA 3FHWA 3P75A 1VCIA 3RZDB 2VUMB 5E4WC 1VQIA 2IT1A 4KKUA 3NXWA 1DONA 4QCLA 3FPPA 2KVMA 2B2VC 1PTOC 3H3VH 3P1HA 4FO2A 3BDOA 3I91A 1VQGA 2N78A 1X3EA 2C5CA 2HUGA 2Y0SE 4S3SA 5IYCG 2J0TD 4ALPA 2JA5H 3HOWG 2LKVA 1O7LA 3QB3A 4KY6A 4L6TB 3AYHB 4K6DA 2F0DA 1GUWA 1G2TA 1VMCA 1CKNB 1EQVA 4DF7A 3FVQA 1LTTD 4LWCA 2YTYA 3I2ZA 5KGUA 1WTHA 4XDXA 4A3MB 5HGQA 3HOYB 1IBLQ 3D4DA 3EBEA 5IODA 4FYDA 1UE5A 3ER0A 1K8GA 3ERSX 5HY6A 2B8GA 1E2VA 2R93B 4IJLA 3AFPA 3MXNA 3G4SA 4B08A 5IYDH 2X69A 1B9NA 4HEDA 1II3A 2EPBA 3I73A 1I4GA 3E9IA 1KL9A 3I90A 4OEMB 2LMCB 1B8AA 2F0PA 2CH4A 3I55A 2EY1A 4C3HH 3BYTB 3GTKH 1FNVA 1PYBA 2JK8A 2OCEA 2BDNA 5LMNQ 3NELA 3V05A 3GTOB 2O2LD 5IE8A 5BN4A 4DV5Q 3HEJA 4UHVA 3BVMA 5I2YA 2VY3A 4DR6Q 2H1EA 3TZDA 2PQAB 3NHHA 4RGNA 2KCCA 3S15H 3TN2A 4LFCQ 2F0HA 4DR3L 3S2HB 4HJ7A 1EWIA 2R61A 4NDXA 4K8IA 3K5LA 5J1ZA 1QVFA 1JOOA 4RG1A 2K05A 1XNQQ 4DAYB 3GTQH 5GAEC 2NTSA 1SRUA 2LXKA 1V1PA 4OX9Q 1EIGA 3OMCA 4A3DG 1WCMG 1ASYA 1I94L 4GZYC 1KDBA 4BY1G 1KRSA 1TWCB 1H9MA 1L1OB 3S1RH 1A2TA 4GKKQ 2M2LA 4N9PA 3N52A 3SR1A 1PRTC 1CZWA 4JOIA 4KKSA 1XMQL 3UE0A 3L2PA 4XTCS 3AB9A 4CDDC 4FF3A 3S17H 1K83H 2N3SA 3MFGA 3EVQA 1VQ9A 3FP9A 3HKSA 3I72A 2MQHA 2ZXOA 3D8GA 2R92G 1H95A 1W2BA 3QO2A 1BNZA 4UP8A 2FJ2A 2K5QA 4K5VA 4KN7C 4P73A 1EY6A 4X66Q 1NAPA 1PTOH 1PH4A 5K36H 3M4OH 2JQOA 5IGEA 4TKOB 5FLMG 2IW3A 1RD9D 2XGTA 2B39A 4JI8Q 3K57A 1HFGA 3I4OA 3KK7A 3PQIA 2CHBD 2PI2E 3CCVA 1EWHA 1JJGA 4BBRH 2HDMA 4FF4A 4KHPQ 1A62A 1FVIA 4X64L 5I9OA 2IJ0A 1Z47A 1HA5A 3E6ZX 4KI0A 1ESRA 2NVQB 4A3KB 4RCNA 3TEHB 4DUZL 3M3YH 4OIKA 3S1MB 4B3RL 1BXTA 1GVPA 5DLQE 1CT1D 5CORA 1HFNA 4PNYA 1A63A 4DU9A 3OW7A 2VQFL 1Q12A 1NBWA 1Q3LA 2K32A 4N8FA 4JI6Q 5AJ3Q 3T1YQ 4A93G 1D5XC 1Y69U 2E76C 4XYOA 3RZDH 2VUMH 5C4XB 4EQOA 5KIXA 3T56B 2EVBA 1LT4D 1KC8C 3DEOA 1IL8A 1TIID 1HUMA 4K5XA 1G51A 2K14A 4AH6A 5CR3A 5JPNC 3M7NA 2EJFC 1H9SA 1PYWD 3KYHC 4BY7G 2UU9Q 3Q8DA 4HN7A 4A3BG 1P16A 5EBCA 2VW9A 5IGGA 1FD7D 4NMZA 3UE1A 3T1HQ 3FKIB 3KBXA 2UUAL 4JI3L 1IYVA 3J80E 2OEOA 1N33L 1QNKA 1G6PA 4A3MH 1JICA 4APVA 1JQYD 3OOCA 4WRDA 4ZKBB 1VMPA 3M85A 1PFMA 3J7AV 2R93H 3BZCA 1DM0B 4A3JG 2K5WA 2PMZE 1E22A 2QKIC 2KHIA 2XN9C 3RLNA 3HKZB 2KEEA 1O78A 3PIP3 5JEAJ 1TS2A 1NR4A 1KLGD 2GVBA 2ZT9C 1FR3A 2PZTA 2ZM6L 4MTKA 4XT3B 1PYSB 1K3BC 1IW7C 1IBKL 4POGA 1YEZA 2R3ZA 3GTOH 4DNRB 4A3IB 5EPJA 3CXCA 4FP5D 3J80c 5T1IA 2UXDL 4YWMA 2BA0A 4M8AA 3T4AC 2L1BA 3CC7A 2L11A 2NBFA 4LNQA 3BVGA 2JA5G 1XJVA 5LHY1 1V43A 3H09A 1WOCA 3VYSA 1RODA 4OXPA 3GTMB 2VZAA 1QE6A 3WOEA 5JPMC 4RHSA 3PIPA 1XPRA 2WFWA 1A6XA 1XYIA 2IX3A 4GN3B 1DOKA 2ICEC 1VQEA 3DHQA 1EIFA 1LTLA 3OYYA 4PMWA 2DJFC 5CBAE 1PH9A 1B1ZA 4DV6Q 2EIFA 4G7ZC 1IBLL 5IYDG 3RZOH 4QF4A 2F0MA 1GJXA 3ZYYX 4R8IA 3U9OA 4DXFA 2VL6A 2K52A 2ZXPA 1D2BA 3SGIA 4BWGB 1UUPA 1C48A 4C3HG 1E3PA 2OT2A 5IT9L 4A3CH 1LTID 1QZGA 3KDFB 3I4MG 1EIYB 4DV1Q 1HUNA 2F1MA 3EFXD 1U4LA 4X6AH 1A3TA 5LMNL 4RHRA 5BR8Q 4BA2I 1PH2A 2HD3A 2CVRA 2IX0A 4POFA 1HH2P 4DV5L 3G48A 1EWCA 2A6HC 3IL8A 3STBD 4C3IG 1EZ8A 2JSOA 1AE2A 3DUZA 4IPCA 3P7JA 2M00A 4DR6L 2WIIB 1V1OA 3SDZA 3VA5A 4QGUA 4F8MA 2NVQH 4ME3A 4A3KH 4KK7A 1BBUA 4U68A 4LF6Q 1HJPA 1S5ED 3S1MH 4B3MQ 1K9MC 3HP3A 1LM0A 4IFDJ 2F4IA 1EYAA 3K6OA 3OSOA 2XRSD 2RVLA 1XNQL 2RKSA 3J7A5 1DCZA 1GUGA 1STGA 3UDXA 1CSQA 4RGMA 4R4QA 1ICFB 5C4XH 1E0BA 1U9RA 1SNCA 4B9WA 2CKZB 2Z4IA 1PH3A 4OX9L 3HGBA 1VQLA 2XSCA 3K81C 1BO0A 1O7YA 2PW5A 1KNAA 2F0NA 1DOMA 1X9NA 5GADC 4C1NK 3TSSA 1R9TB 1IZ6A 2WAQB 2B2TA 2L12A 3I7FA 1VF5C 4JI2Q 1PFSA 2CFMA 3HOVH 3D4RA 1YNXA 3CCLA 1I6VC 5K36G 1SYEA 3R2TA 3P20A 1HXYD 1J8IA 3HFZB 1PLFA 3CCSA 4PMBA 4RFBA 3FKIH 1SE2A 4X66L 1SDFA 5JJLA 4LF8Q 2J7ZA 1SYDA 2K33A 3MA2B 4ID6A 2WP8J 2K7VA 2YTVA 4JI8L 2PW7A 2K1BA 1J5EL 1KNEA 4R8NA 2AWNA 3A74A 3RMHA 2EE1A 1SSOA 2NB0A 1BCPB 3TS2A 2K6AA 1V8QA 2RSOA 3PV0A 1LTAD 1A2UA 4CJ0B 1JT8A 1UE7A 2F0QA 1ICWA 4IPHA 2EYFA 2ALYB 1PDQA 5D65A 5L37A 1H9RA 4GNXB 1STHA 3TZUA 5M3FB 1NJIC 1D7QA 2VUMG 2ENBA 4JBKA 5CV4A 3F2DA 1FNWA 4HJ9A 3CCEA 5AJ3L 3T1YL 3FPUB 4JI6L 1YHBA 4IFDH 1WTRA 4A3IH 1VQ4A 4YWLA 1EEID 5C0XJ 2KCTA 1JE5A 1G291 4YCWA 1JB7A 5HURA 3ND9A 4ZUIA 4DR4L 5EPLA 5IP9H 3CMAA 2V4DA 5FOBB 4JV5Q 3BU2A 3TP8A 3DEPA 2EYJA 4GS3A 3KFUA 2E2DC 1QUQA 3NQTA 5GAGC 1CI3M 4DKAC 4X3UA 1WFQA 1KXLA 2A6EC 2UU9L 3KF8B 3C2PA 3AEVA 4A75A 5DAUA 1HR0W 1UE1A 1D5ZC 1G6ZA 1LTRD 2KCMA 3EROA 4A3MG 2MO0A 3MWYW 2DGYA 3NEMA 4ZYSA 3HS0C 5EAYA 4LJZC 1PH6A 3ULLA 1PA6A 1BCPC 4A3EH 4KHZA 2R93G 3CAMA 1BBXC 3G7LA 5BN5A 4IUTA 3ERQA 5CYUA 1S72A 4ZAIA 1ASZA 2Q2UA 3LNNA 2KHSA 5A2QL 2G9HD 1GUSA 4A76A 3ITPA 1ENAA 4ABNA 4UP9A 4GNXC 3CC2A 5D3DA 2A74C 1EY0A 4H44C 3TP5A 1EOVA 2L5TA 4NP5A 4QB4A 2Q8TA 1WD1A 3KJOA 2F0EA 1KLUD 4J8QA 1LACA 4NXNQ 2PYKA 4K14A 1IKMA 1IYUA 5IGCA 1QNUA 4P72A 4J6HA 2QDBA 5NUCA 2NVXB 1A15A 1JWSD 4TSSA 1ESFA 2VNUD 1X3GA 3CD6A 3A5UA 1L2FA 2WV6D 1NMFA 1D8LA 5CC4A 1VQ6A 3K0YA 1ZYRD 4LUZA 1DGSA 2B2YA 5C3EH 3I3CA 1HTLD 2D2CC 1SYBA 1N32Q 3BJUA 4IOCA 3MHBA 5IWAQ 2E2JB 2OTJA 1IL2A 4A3GB 2I07B 5FKAC 1B2TA 2Z6BA 1ML0D 3KJPA 1GHJA 1O7ZA 5C3WA 2BH8A 4LFAQ 5A2QE 1D5MC 2PQEA 4CHTB 3L7ZC 3J7ZC 3PO3B 3H3VI 2F52A 4WJWA 2YTXA 3D0FA 1TWAB 1D6EC 1SMYD 2O5IC 5M5YB 5DEHA 2IHFA 4J1MA 1XNRQ 3QJYA 3RLFA 1R9TH 4BXXH 3NTHA 5JJKA 3NP8A 1K0RA 2UUBQ 1D1IA 2F3VA 4A3CG 3E5SA 1Q1EA 2B2WC 3MXNB 4FF1A 2RA4A 5I6WA 4MN3A 1BR9A 1TQOA 5JJZA 1EYGA 1MSHA 3GP7A 1JORA 2B8FA 2F0SA 2EQSA 3HOZB 3MFYA 3J80i 5C6AA 1NMGA 2H4OA 3SHLA 4Q5VA 1CTMA 1TWGB 4DV1L 3K5OA 4DR1Q 1VQCA 3BS1A 3MC0B 3NUCA 2CQAA 3D6CA 4R4TA 1VQKA 2BE5D 3K7UC 3Q22A 2KENA 2Y0SB 4KTAA 4C2MB 3NQIA 3JC66 4P75A 4I7AA 5E4XA 5BR8L 1DZ1A 4DXGA 1PRTB 4RA8A 1VQ8A 2A68D 1T5EA 4IUVA 5FJ8H 4KHVA 1M1KC 5M3FH 1HR0Q 2N49A 3DMUA 4LF6L 4B3ML 3MXPA 5C4XG 5C4JH 5I4DA 1B3QA 2EYOA 2KOLA 1CKNA 4CDEC 4OGQC 1VQPA 1CQVA 1SXTA 4QMGA 1IHZA 2MGSA 3KF6A 3HOVG 1XPUA 1K3RA 2A19A
chains in the Genus database with same CATH topology
1N33L 2WAQE 1Z9FA 4A3MH 1HNXL 1G6PA 4APVA 4UP7A 4BA1I 4JG2A 4LW1A 4MZ9A 2OWOA 4HJ8A 3EIVA 3M85A 2A8VA 4JI2L 4KLKA 3CCMA 2YYZA 2R7DA 2RF4A 1HZ9A 3FKIG 1JJ2A 2OTLA 1U5KA 2BH2A 2R93H 3BZCA 2B3GA 2Z0SA 4A3JG 3LGJA 4A3LH 3HOUG 1T9HA 2PMZE 1S3OA 1E22A 3RR5A 2IY5B 2AHOB 1KRTA 2ZJQA 2K75A 4YCUA 2KHIA 1I6HH 4DR3Q 3RLNA 4R4OA 1VQDA 1SROA 4A3BH 1N33Q 1X55A 4DNIA 5JEAJ 4LF8L 3PF4A 1L0WA 2F4VQ 4FDBA 2H5XA 1OXSC 3PSIA 1B7YB 2GVBA 1Q46A 3TRZA 2ZM6L 1XTDA 1PYSB 2C35B 3GTPH 2IHEA 1GKHA 1O7IA 4NPSA 2FXQA 1IBKL 1PH1A 4POGA 1YEZA 2HIXA 3GTOH 3CP0A 3D31A 2E8GA 4JI5Q 3HKZG 2PQAA 4B3TQ 1FJGL 1HZAA 3CXCA 3A0JA 2CWPA 3PUZA 4PG3A 1N34Q 3J80c 3OTOQ 2ZTDA 2UXDL 1I94Q 1KAWA 1VQJA 1EQQA 4A3GG 4O2DA 2K50A 4YWMA 3K80C 2BA0A 3CC7A 4DV4Q 4LNQA 1YJNA 4DR5L 1IBML 2JA5G 2LSSA 3AQQA 2JEBI 3UDFA 1XJVA 1XMQQ 4OWTB 3PGZA 4YHHQ 1V43A 4A3DH 3GD7A 4JI1L 1WOCA 3PUWA 3L0OA 1WCMH 1YJWA 4OXPA 4IFDG 4DV6L 2VZAA 4BY1H 1QVGA 3RLOA 3PO3G 3PIPA 1XPRA 4YY3L 2WFWA 1HNWQ 3E9HA 4QQBX 1NTGA 1QUQB 2NVXH 4LF9Q 4A3FG 1GD7A 4GN3B 4R1JA 1EFWA 2UXDQ 4DR2L 1YHQA 1N8RC 2HHHQ 1RIPA 3I4NH 1VQEA 5IP9G 5IT9c 3DM3A 4JOIC 1SLJA 1YHAA 3JAMc 1L1OA 1EIFA 4L5RC 2QEXA 4AYBE 1LTLA 3OYYA 1HNZL 2R92H 4PMWA 3CQZH 5JEAG 3GTJH 5M5XH 4JI1Q 4GOPA 1PH9A 1YI2A 4JYAL 3S24A 4JBWA 4DV6Q 2EIFA 4GLVB 3CCRA 1IBLL 2E2JH 5IYDG 2QA4A 4A3GH 4LF5L 2R7FA 3RZOH 3H0GG 3HOXH 2MO1A 5IP7H 2E2IH 4JV5L 4WJ3M 1M90C 1UWVA 5FLMH 3CCUA 4O0AA 3K7AH 2VL6A 1IYJB 2K52A 4X64Q 3SGIA 4LFBQ 4HJAA 3RN2A 3GTGH 4A3EG 4HJ5A 4A3KG 5GQOA 1E3PA 2JJQA 3PO3H 3HOZG 2MNAA 2GVAA 3MEFA 5C44G 4A3CH 2N8NA 3GO5A 1QZGA 3KDFB 4UPAA 5FLXc 3J81i 4B3RQ 3I4MG 3M4QA 4LF7L 1GO3E 2B63G 2BA1A 2KBNA 3CPFA 3KF6B 4AIMA 3J81j 1EIYB 3F2BA 4DR7L 4OONA 4DV1Q 1VQFA 3OW2A 4JC0A 5IY0A 2VQFQ 1SE8A 5M5WH 4DK3C 2VS1A 2OQKA 4X6AH 1I50H 5LMNL 5BR8Q 4JI0L 1PH2A 4BA2I 3A5ZB 2IX0A 3H0GH 4POFA 1Q81C 1GM5A 4JI4L 2R7ZG 1HH2P 2L15A 3G48A 4DV5L 5GAHC 1N36Q 3STBD 3KLWA 2VQEL 5LMNW 5GROA 3U4VA 1AE2A 4IPCA 2UXBL 2F3IA 4DR6L 4DV7Q 4LF7Q 1XMOQ 4OO1I 4QGUA 2Q2TA 2HT1A 3RN5A 4DR7Q 1S40A 1N9WA 2NVQH 4ME3A 4A3KH 1UE6A 1BBUA 1VS0A 2UUCQ 2ATWA 4BBSG 4LF6Q 1HJPA 1MKHA 2JA7H 3S1MH 4B3MQ 5C44H 1K9MC 3HOYH 4HIOA 3PUVA 1PH5A 2K5VA 1QZHA 3CPWA 2E5LQ 1TWGH 4NXNL 3I4MH 1LM0A 3F2CA 4IFDJ 4YWKA 1HZCA 4PZ7A 2OQ0A 5C3EG 4PZ6A 4DUYQ 4LF4L 1XNQL 3F1ZA 3J7A5 1PV4A 3UDXA 1CSQA 4C2MH 5C0XI 4R4QA 4DV3L 2UUAQ 5C4XH 1W3SA 4MTNA 5IYBH 4JI3Q 4BY7H 2ES2A 1A8VA 5LMUQ 2CKZB 1PH3A 2WB1G 4OX9L 1VQLA 1VQAA 2R7ZH 1PH8A 1C0AA 3AFQA 3K81C 2JA6H 1HNXQ 2Q2HA 1X9NA 4C3IH 5GADC 2QGQA 4DV0L 4JI7L 1N32L 5M3MH 3S14H 5IWAL 4JBMA 3EN2A 1IZ6A 2I5MX 1TWHH 3I7FA 4NXML 2GN5A 1E1TA 1PFSA 4JI2Q 2CFMA 3W5OA 3HOVH 2NN6I 3I56A 4GLXA 4DV2L 1YNXA 3CCLA 2YU9H 1OXXK 3W1BA 5K36G 2AKWB 2EXDA 3G71A 2CWAA 3PO2G 4AQYL 4LFAL 1UEBA 3BZKA 3ICEA 3HFZB 2MFIA 3CCSA 4B3SL 1AE3A 2LXJA 1X56A 3FKIH 3PUXA 2WAQG 4X66L 1EUJA 3PCOB 5ELOA 3W1GA 4BXXG 4LF8Q 4GKJL 5JJLA 1OXTA 4A3JH 3ULJA 3HOUH 2K5NA 2WP8J 4TVAB 3PIOA 1X65A 3S2HH 2ZM6Q 2HQLA 2YTVA 4JI8L 4L5SA 1Y1VG 1IBKQ 1J5EL 4A3IG 2I5HA 3FHWA 1VCIA 1BVSA 2AWNA 3A74A 4MNOA 1FJGQ 1KIXA 1VQIA 1AH9A 3TS2A 1C9OA 2IT1A 1Y1WG 3J81c 3PV0A 1Y14B 2B29A 2I0QA 2ASBA 4GKJQ 3STBC 3K0XA 2RCNA 1U0LA 4HIKA 1JT8A 4IJHA 4GLAC 1UE7A 1WI5A 4C3JH 1E24A 5H1SE 4DR5Q 1IBMQ 4IPHA 2NZHA 1MJCA 2ALYB 4GNXB 1TWCH 1NJIC 1D7QA 1J5EQ 3H3VH 2VUMG 3ZJYC 4JBKA 4YY3Q 3UDIA 3F2DA 1CKOA 4DR1L 1VQGA 2N78A 2CQOA 1X3EA 2Y0SE 5IYCG 1MJEA 4HJ9A 4PZ8A 4ALPA 4DR2Q 2JA5H 2IX1A 2A1AA 2JA8G 3CCEA 5AJ3L 3T1YL 4JI6L 1QVCA 1YHBA 2UXCL 1OXVA 3K8AA 4DPGA 4P74A 1Q86C 4A3IH 1J6QA 2K5HA 3AYHB 4J15A 5FJ8G 1VQ4A 4YWLA 5C0XJ 3GTLH 2KCTA 1JE5A 1CKNB 1G291 1CKMA 4LUVA 4YCWA 5M3FG 1JB7A 4X65L 1SN8A 3M9BA 4LWCA 1XPOA 4JYAQ 2YTYA 3U4ZA 3I2ZA 4QIWE 4A3FH 4K0KL 2ZTEA 1TXYA 4OWWB 5HGQA 1IBLQ 1TWAH 3EBEA 4DR4L 5IP9H 1UE5A 3ER0A 4LF5Q 5M5YH 3CMAA 3CCQA 1K8GA 3CW2C 3ERSX 4JV5Q 2D62A 3BU2A 5HY6A 3KFUA 4GS3A 2AMCB 1HR0L 1QUQA 5GAGC 4DKAC 1L1OC 1WFQA 4IJLA 1KXLA 3AFPA 3DLLA 2UU9L 4A4IA 1VQBA 3KF8B 3G4SA 3AEVA 4A75A 5IYDH 1HR0W 4TQUS 1UE1A 4HIDA 4AYBG 3U58A 2KCMA 4A3MG 2MO0A 2DGYA 3NBHB 1VQNA 3NEMA 1Q8KA 3E9IA 1KL9A 1X54A 1YVCA 5EAYA 1PH6A 1OXUA 4DR4Q 4DK6C 1B8AA 3ULLA 4X62L 1PA6A 4OO1G 3I55A 3KOJA 4A3EH 4LFCL 1CUKA 4KHZA 4C3HH 3GTKH 1PYBA 2R93G 1BKBA 3HOZH 3CAMA 1Q1BA 3M4PA 2JK8A 2OCEA 4QL5A 4A3LG 4IO9A 1S72A 2NVYH 1X3FA 2PI2A 2Z6KC 4GN5A 4JCVE 1ASZA 5LMNQ 3NELA 2Q2UA 4L5TA 4JI0Q 2B63H 3U50C 5IE8A 1MIUA 4A76A 4JI4Q 4DV5Q 2JA9A 4UP9A 4GNXC 3CC2A 2VQEQ 1SFOH 3S2DH 1KHIA 2UXBQ 4YCVA 2VY3A 4DR6Q 3CCJA 2JE6I 2PQAB 1KQSA 3KDFA 5C0XG 3HKZE 3S15H 1SMXA 2CCZA 1EOVA 1X6OA 2ZJRA 4LFCQ 4DR3L 3B6YA 1YIJA 3KJOA 1JJCB 2Q2IA 4HJ7A 1EWIA 3IRBA 2ZTCA 1E1OA 1YBYA 4NXNQ 1NE3A 2F4VL 5JJIA 2NVTH 4GKKL 4Y52H 1QVFA 4RG1A 4LF4Q 1XNQQ 4P72A 4DAYB 4GN4B 2AWOA 1Q82C 2NN6G 1VQ5A 3GTQH 5GAEC 4BBSH 4Y7NH 1SRUA 1PVOA 2VNUD 1TWFH 1YJ9A 4DV3Q 1X3GA 3CD6A 2LXKA 3A5UA 4JI5L 1LUZA 4L5QA 4B3TL 1L2FA 1NMFA 1D8LA 4OX9Q 4IOAA 1VQ6A 1KD1C 4A3DG 4LUZA 5C3EH 1DGSA 1N34L 3OTOL 1WCMG 2R6GA 3ULPA 1I94L 1ASYA 4DV0Q 4BY1G 1KRSA 4JI7Q 1N32Q 3BJUA 1PH7A 1VQHA 4IOCA 5IWAQ 1L1OB 2OTJA 3S1RH 4NXMQ 1IL2A 4DV4L 4GKKQ 2RHQB 5E7NA 4BBRG 4GOPB 1XNRL 4JOIA 2I5LX 2K4KA 3UE0A 4DV2Q 4YHHL 4XTCS 3L2PA 3KJPA 1XMQL 3I4NG 3S17H 1K83H 2N3SA 1VQ9A 2D0PA 4HIMA 2BH8A 3FP9A 3HKSA 5ELNA 4LFAQ 4AQYQ 2MQHA 1JMCA 2ZJPA 1K73C 1YITA 2UUBL 2R92G 1H95A 1HNWL 4RMFA 1W2BA 3L7ZC 3S1NH 4OWXB 1EQRA 3J7ZC 4B3SQ 4LF9L 4UP8A 3H3VI 2F52A 2RHSB 4KHPL 4P73A 2KHJA 4X66Q 2HHHL 1PH4A 3M4OH 2YTXA 1B70B 3HOXG 2JQOA 3D0FA 3PO2H 5IP7G 1BBWA 1C7YA 1P8LA 2IHFA 4QY7A 5FLMG 1XNRQ 1OTCA 3RLFA 2XGTA 4JI8Q 4IFDI 3I4OA 1R9TH 1IXRA 4QJFA 2DUDA 4R4IA 4BXXH 1PHJA 5JJKA 1K0RA 1YZ6A 4XIGS 2PI2E 3TREA 3CCVA 2UUBQ 3HOWG 1JJGA 4BBRH 4A3CG 3VDYA 3TQYA 1SR3A 3G6EA 4KHPQ 1A62A 1FVIA 1Q1EA 2HIVA 3MXNB 4X64L 4LFBL 1Z47A 4KI0A 1Y1VH 1EYGA 3NENA 3PF5A 2E2HH 2EQSA 3TEHB 3CMEA 4DUZL 1Y1WH 2JEAI 3M3YH 3J80i 4B3RL 1GVPA 5DLQE 1NMGA 3RNUA 2YV5A 4LUOA 1V9PA 1HNZQ 1RL2A 1WYDA 4JBJA 4DV1L 1WJJA 4DR1Q 1VQCA 1A63A 3WWVA 2VQFL 3E0EA 4R4TA 1Q12A 1NBWA 3S1QH 4JI6Q 5AJ3Q 3T1YQ 1VQKA 2ID0A 4UY8C 3GTMH 3K7UC 3S16H 1LYLA 2KENA 4A93G 2UXCQ 1FGUA 3RZDH 2VUMH 3TS0A 3JC66 4P75A 5BR8L 4GOPC 2NZOA 1I3QH 2Z6KA 1N36L 2JA7G 4X65Q 4K0KQ 3HOYG 4DUZQ 1VQ8A 4WJ4A 5IYCH 3HOWH 2JA8H 1KC8C 1A0IA 4DV7L 3T1HL 1XMOL 1NY4A 4GNXA 4IPDA 3UDGA 3CC4A 1G51A 2K14A 2WB1E 3GDEA 5FJ8H 4AH6A 2D0OA 3JAMi 1M1KC 2V1CC 1VQ7A 3M7NA 2UUCL 2PNHA 1K8AC 3H15A 5M3FH 2N49A 2Y0SG 3F8TA 1HR0Q 4LF6L 4NB3A 4B3ML 3KYHC 1CSPA 1I5FA 2UU9Q 5IYBG 4EQ5A 2E5LL 4BY7G 1VQOA 3Q8DA 5C4JH 5C4XG 1E7ZA 4EX5A 4H02A 1HZBA 4A3BG 4DUYL 1V1QA 2JA6G 2XTIA 1P16A 2VW9A 1CKNA 4R4CA 4P71A 5J3BA 3UE1A 5M3MG 3T1HQ 1VQPA 1FL0A 4IPGA 2UUAL 4A93H 4X62Q 4DAMA 4JI3L 3CF5A 1VQMA 5LMUL 3KF6A 1Q7YC 3PUYA 1XPUA 3HOVG 1K3RA 2A19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 L;  2WAQ E;  1Z9F A;  4A3M H;  1HNX L;  1G6P A;  4APV A;  4UP7 A;  4BA1 I;  4JG2 A;  4LW1 A;  4MZ9 A;  2OWO A;  4HJ8 A;  3EIV A;  3M85 A;  2A8V A;  4JI2 L;  4KLK A;  3CCM A;  2YYZ A;  2R7D A;  2RF4 A;  1HZ9 A;  3FKI G;  1JJ2 A;  2OTL A;  1U5K A;  2BH2 A;  2R93 H;  3BZC A;  2B3G A;  2Z0S A;  4A3J G;  3LGJ A;  4A3L H;  3HOU G;  1T9H A;  2PMZ E;  1S3O A;  1E22 A;  3RR5 A;  2IY5 B;  2AHO B;  1KRT A;  2ZJQ A;  2K75 A;  4YCU A;  2KHI A;  1I6H H;  4DR3 Q;  3RLN A;  4R4O A;  1VQD A;  1SRO A;  4A3B H;  1N33 Q;  1X55 A;  4DNI A;  5JEA J;  4LF8 L;  3PF4 A;  1L0W A;  2F4V Q;  4FDB A;  2H5X A;  1OXS C;  3PSI A;  1B7Y B;  2GVB A;  1Q46 A;  3TRZ A;  2ZM6 L;  1XTD A;  1PYS B;  2C35 B;  3GTP H;  2IHE A;  1GKH A;  1O7I A;  4NPS A;  2FXQ A;  1IBK L;  1PH1 A;  4POG A;  1YEZ A;  2HIX A;  3GTO H;  3CP0 A;  3D31 A;  2E8G A;  4JI5 Q;  3HKZ G;  2PQA A;  4B3T Q;  1FJG L;  1HZA A;  3CXC A;  3A0J A;  2CWP A;  3PUZ A;  4PG3 A;  1N34 Q;  3J80 c;  3OTO Q;  2ZTD A;  2UXD L;  1I94 Q;  1KAW A;  1VQJ A;  1EQQ A;  4A3G G;  4O2D A;  2K50 A;  4YWM A;  3K80 C;  2BA0 A;  3CC7 A;  4DV4 Q;  4LNQ A;  1YJN A;  4DR5 L;  1IBM L;  2JA5 G;  2LSS A;  3AQQ A;  2JEB I;  3UDF A;  1XJV A;  1XMQ Q;  4OWT B;  3PGZ A;  4YHH Q;  1V43 A;  4A3D H;  3GD7 A;  4JI1 L;  1WOC A;  3PUW A;  3L0O A;  1WCM H;  1YJW A;  4OXP A;  4IFD G;  4DV6 L;  2VZA A;  4BY1 H;  1QVG A;  3RLO A;  3PO3 G;  3PIP A;  1XPR A;  4YY3 L;  2WFW A;  1HNW Q;  3E9H A;  4QQB X;  1NTG A;  1QUQ B;  2NVX H;  4LF9 Q;  4A3F G;  1GD7 A;  4GN3 B;  4R1J A;  1EFW A;  2UXD Q;  4DR2 L;  1YHQ A;  1N8R C;  2HHH Q;  1RIP A;  3I4N H;  1VQE A;  5IP9 G;  5IT9 c;  3DM3 A;  4JOI C;  1SLJ A;  1YHA A;  3JAM c;  1L1O A;  1EIF A;  4L5R C;  2QEX A;  4AYB E;  1LTL A;  3OYY A;  1HNZ L;  2R92 H;  4PMW A;  3CQZ H;  5JEA G;  3GTJ H;  5M5X H;  4JI1 Q;  4GOP A;  1PH9 A;  1YI2 A;  4JYA L;  3S24 A;  4JBW A;  4DV6 Q;  2EIF A;  4GLV B;  3CCR A;  1IBL L;  2E2J H;  5IYD G;  2QA4 A;  4A3G H;  4LF5 L;  2R7F A;  3RZO H;  3H0G G;  3HOX H;  2MO1 A;  5IP7 H;  2E2I H;  4JV5 L;  4WJ3 M;  1M90 C;  1UWV A;  5FLM H;  3CCU A;  4O0A A;  3K7A H;  2VL6 A;  1IYJ B;  2K52 A;  4X64 Q;  3SGI A;  4LFB Q;  4HJA A;  3RN2 A;  3GTG H;  4A3E G;  4HJ5 A;  4A3K G;  5GQO A;  1E3P A;  2JJQ A;  3PO3 H;  3HOZ G;  2MNA A;  2GVA A;  3MEF A;  5C44 G;  4A3C H;  2N8N A;  3GO5 A;  1QZG A;  3KDF B;  4UPA A;  5FLX c;  3J81 i;  4B3R Q;  3I4M G;  3M4Q A;  4LF7 L;  1GO3 E;  2B63 G;  2BA1 A;  2KBN A;  3CPF A;  3KF6 B;  4AIM A;  3J81 j;  1EIY B;  3F2B A;  4DR7 L;  4OON A;  4DV1 Q;  1VQF A;  3OW2 A;  4JC0 A;  5IY0 A;  2VQF Q;  1SE8 A;  5M5W H;  4DK3 C;  2VS1 A;  2OQK A;  4X6A H;  1I50 H;  5LMN L;  5BR8 Q;  4JI0 L;  1PH2 A;  4BA2 I;  3A5Z B;  2IX0 A;  3H0G H;  4POF A;  1Q81 C;  1GM5 A;  4JI4 L;  2R7Z G;  1HH2 P;  2L15 A;  3G48 A;  4DV5 L;  5GAH C;  1N36 Q;  3STB D;  3KLW A;  2VQE L;  5LMN W;  5GRO A;  3U4V A;  1AE2 A;  4IPC A;  2UXB L;  2F3I A;  4DR6 L;  4DV7 Q;  4LF7 Q;  1XMO Q;  4OO1 I;  4QGU A;  2Q2T A;  2HT1 A;  3RN5 A;  4DR7 Q;  1S40 A;  1N9W A;  2NVQ H;  4ME3 A;  4A3K H;  1UE6 A;  1BBU A;  1VS0 A;  2UUC Q;  2ATW A;  4BBS G;  4LF6 Q;  1HJP A;  1MKH A;  2JA7 H;  3S1M H;  4B3M Q;  5C44 H;  1K9M C;  3HOY H;  4HIO A;  3PUV A;  1PH5 A;  2K5V A;  1QZH A;  3CPW A;  2E5L Q;  1TWG H;  4NXN L;  3I4M H;  1LM0 A;  3F2C A;  4IFD J;  4YWK A;  1HZC A;  4PZ7 A;  2OQ0 A;  5C3E G;  4PZ6 A;  4DUY Q;  4LF4 L;  1XNQ L;  3F1Z A;  3J7A 5;  1PV4 A;  3UDX A;  1CSQ A;  4C2M H;  5C0X I;  4R4Q A;  4DV3 L;  2UUA Q;  5C4X H;  1W3S A;  4MTN A;  5IYB H;  4JI3 Q;  4BY7 H;  2ES2 A;  1A8V A;  5LMU Q;  2CKZ B;  1PH3 A;  2WB1 G;  4OX9 L;  1VQL A;  1VQA A;  2R7Z H;  1PH8 A;  1C0A A;  3AFQ A;  3K81 C;  2JA6 H;  1HNX Q;  2Q2H A;  1X9N A;  4C3I H;  5GAD C;  2QGQ A;  4DV0 L;  4JI7 L;  1N32 L;  5M3M H;  3S14 H;  5IWA L;  4JBM A;  3EN2 A;  1IZ6 A;  2I5M X;  1TWH H;  3I7F A;  4NXM L;  2GN5 A;  1E1T A;  1PFS A;  4JI2 Q;  2CFM A;  3W5O A;  3HOV H;  2NN6 I;  3I56 A;  4GLX A;  4DV2 L;  1YNX A;  3CCL A;  2YU9 H;  1OXX K;  3W1B A;  5K36 G;  2AKW B;  2EXD A;  3G71 A;  2CWA A;  3PO2 G;  4AQY L;  4LFA L;  1UEB A;  3BZK A;  3ICE A;  3HFZ B;  2MFI A;  3CCS A;  4B3S L;  1AE3 A;  2LXJ A;  1X56 A;  3FKI H;  3PUX A;  2WAQ G;  4X66 L;  1EUJ A;  3PCO B;  5ELO A;  3W1G A;  4BXX G;  4LF8 Q;  4GKJ L;  5JJL A;  1OXT A;  4A3J H;  3ULJ A;  3HOU H;  2K5N A;  2WP8 J;  4TVA B;  3PIO A;  1X65 A;  3S2H H;  2ZM6 Q;  2HQL A;  2YTV A;  4JI8 L;  4L5S A;  1Y1V G;  1IBK Q;  1J5E L;  4A3I G;  2I5H A;  3FHW A;  1VCI A;  1BVS A;  2AWN A;  3A74 A;  4MNO A;  1FJG Q;  1KIX A;  1VQI A;  1AH9 A;  3TS2 A;  1C9O A;  2IT1 A;  1Y1W G;  3J81 c;  3PV0 A;  1Y14 B;  2B29 A;  2I0Q A;  2ASB A;  4GKJ Q;  3STB C;  3K0X A;  2RCN A;  1U0L A;  4HIK A;  1JT8 A;  4IJH A;  4GLA C;  1UE7 A;  1WI5 A;  4C3J H;  1E24 A;  5H1S E;  4DR5 Q;  1IBM Q;  4IPH A;  2NZH A;  1MJC A;  2ALY B;  4GNX B;  1TWC H;  1NJI C;  1D7Q A;  1J5E Q;  3H3V H;  2VUM G;  3ZJY C;  4JBK A;  4YY3 Q;  3UDI A;  3F2D A;  1CKO A;  4DR1 L;  1VQG A;  2N78 A;  2CQO A;  1X3E A;  2Y0S E;  5IYC G;  1MJE A;  4HJ9 A;  4PZ8 A;  4ALP A;  4DR2 Q;  2JA5 H;  2IX1 A;  2A1A A;  2JA8 G;  3CCE A;  5AJ3 L;  3T1Y L;  4JI6 L;  1QVC A;  1YHB A;  2UXC L;  1OXV A;  3K8A A;  4DPG A;  4P74 A;  1Q86 C;  4A3I H;  1J6Q A;  2K5H A;  3AYH B;  4J15 A;  5FJ8 G;  1VQ4 A;  4YWL A;  5C0X J;  3GTL H;  2KCT A;  1JE5 A;  1CKN B;  1G29 1;  1CKM A;  4LUV A;  4YCW A;  5M3F G;  1JB7 A;  4X65 L;  1SN8 A;  3M9B A;  4LWC A;  1XPO A;  4JYA Q;  2YTY A;  3U4Z A;  3I2Z A;  4QIW E;  4A3F H;  4K0K L;  2ZTE A;  1TXY A;  4OWW B;  5HGQ A;  1IBL Q;  1TWA H;  3EBE A;  4DR4 L;  5IP9 H;  1UE5 A;  3ER0 A;  4LF5 Q;  5M5Y H;  3CMA A;  3CCQ A;  1K8G A;  3CW2 C;  3ERS X;  4JV5 Q;  2D62 A;  3BU2 A;  5HY6 A;  3KFU A;  4GS3 A;  2AMC B;  1HR0 L;  1QUQ A;  5GAG C;  4DKA C;  1L1O C;  1WFQ A;  4IJL A;  1KXL A;  3AFP A;  3DLL A;  2UU9 L;  4A4I A;  1VQB A;  3KF8 B;  3G4S A;  3AEV A;  4A75 A;  5IYD H;  1HR0 W;  4TQU S;  1UE1 A;  4HID A;  4AYB G;  3U58 A;  2KCM A;  4A3M G;  2MO0 A;  2DGY A;  3NBH B;  1VQN A;  3NEM A;  1Q8K A;  3E9I A;  1KL9 A;  1X54 A;  1YVC A;  5EAY A;  1PH6 A;  1OXU A;  4DR4 Q;  4DK6 C;  1B8A A;  3ULL A;  4X62 L;  1PA6 A;  4OO1 G;  3I55 A;  3KOJ A;  4A3E H;  4LFC L;  1CUK A;  4KHZ A;  4C3H H;  3GTK H;  1PYB A;  2R93 G;  1BKB A;  3HOZ H;  3CAM A;  1Q1B A;  3M4P A;  2JK8 A;  2OCE A;  4QL5 A;  4A3L G;  4IO9 A;  1S72 A;  2NVY H;  1X3F A;  2PI2 A;  2Z6K C;  4GN5 A;  4JCV E;  1ASZ A;  5LMN Q;  3NEL A;  2Q2U A;  4L5T A;  4JI0 Q;  2B63 H;  3U50 C;  5IE8 A;  1MIU A;  4A76 A;  4JI4 Q;  4DV5 Q;  2JA9 A;  4UP9 A;  4GNX C;  3CC2 A;  2VQE Q;  1SFO H;  3S2D H;  1KHI A;  2UXB Q;  4YCV A;  2VY3 A;  4DR6 Q;  3CCJ A;  2JE6 I;  2PQA B;  1KQS A;  3KDF A;  5C0X G;  3HKZ E;  3S15 H;  1SMX A;  2CCZ A;  1EOV A;  1X6O A;  2ZJR A;  4LFC Q;  4DR3 L;  3B6Y A;  1YIJ A;  3KJO A;  1JJC B;  2Q2I A;  4HJ7 A;  1EWI A;  3IRB A;  2ZTC A;  1E1O A;  1YBY A;  4NXN Q;  1NE3 A;  2F4V L;  5JJI A;  2NVT H;  4GKK L;  4Y52 H;  1QVF A;  4RG1 A;  4LF4 Q;  1XNQ Q;  4P72 A;  4DAY B;  4GN4 B;  2AWO A;  1Q82 C;  2NN6 G;  1VQ5 A;  3GTQ H;  5GAE C;  4BBS H;  4Y7N H;  1SRU A;  1PVO A;  2VNU D;  1TWF H;  1YJ9 A;  4DV3 Q;  1X3G A;  3CD6 A;  2LXK A;  3A5U A;  4JI5 L;  1LUZ A;  4L5Q A;  4B3T L;  1L2F A;  1NMF A;  1D8L A;  4OX9 Q;  4IOA A;  1VQ6 A;  1KD1 C;  4A3D G;  4LUZ A;  5C3E H;  1DGS A;  1N34 L;  3OTO L;  1WCM G;  2R6G A;  3ULP A;  1I94 L;  1ASY A;  4DV0 Q;  4BY1 G;  1KRS A;  4JI7 Q;  1N32 Q;  3BJU A;  1PH7 A;  1VQH A;  4IOC A;  5IWA Q;  1L1O B;  2OTJ A;  3S1R H;  4NXM Q;  1IL2 A;  4DV4 L;  4GKK Q;  2RHQ B;  5E7N A;  4BBR G;  4GOP B;  1XNR L;  4JOI A;  2I5L X;  2K4K A;  3UE0 A;  4DV2 Q;  4YHH L;  4XTC S;  3L2P A;  3KJP A;  1XMQ L;  3I4N G;  3S17 H;  1K83 H;  2N3S A;  1VQ9 A;  2D0P A;  4HIM A;  2BH8 A;  3FP9 A;  3HKS A;  5ELN A;  4LFA Q;  4AQY Q;  2MQH A;  1JMC A;  2ZJP A;  1K73 C;  1YIT A;  2UUB L;  2R92 G;  1H95 A;  1HNW L;  4RMF A;  1W2B A;  3L7Z C;  3S1N H;  4OWX B;  1EQR A;  3J7Z C;  4B3S Q;  4LF9 L;  4UP8 A;  3H3V I;  2F52 A;  2RHS B;  4KHP L;  4P73 A;  2KHJ A;  4X66 Q;  2HHH L;  1PH4 A;  3M4O H;  2YTX A;  1B70 B;  3HOX G;  2JQO A;  3D0F A;  3PO2 H;  5IP7 G;  1BBW A;  1C7Y A;  1P8L A;  2IHF A;  4QY7 A;  5FLM G;  1XNR Q;  1OTC A;  3RLF A;  2XGT A;  4JI8 Q;  4IFD I;  3I4O A;  1R9T H;  1IXR A;  4QJF A;  2DUD A;  4R4I A;  4BXX H;  1PHJ A;  5JJK A;  1K0R A;  1YZ6 A;  4XIG S;  2PI2 E;  3TRE A;  3CCV A;  2UUB Q;  3HOW G;  1JJG A;  4BBR H;  4A3C G;  3VDY A;  3TQY A;  1SR3 A;  3G6E A;  4KHP Q;  1A62 A;  1FVI A;  1Q1E A;  2HIV A;  3MXN B;  4X64 L;  4LFB L;  1Z47 A;  4KI0 A;  1Y1V H;  1EYG A;  3NEN A;  3PF5 A;  2E2H H;  2EQS A;  3TEH B;  3CME A;  4DUZ L;  1Y1W H;  2JEA I;  3M3Y H;  3J80 i;  4B3R L;  1GVP A;  5DLQ E;  1NMG A;  3RNU A;  2YV5 A;  4LUO A;  1V9P A;  1HNZ Q;  1RL2 A;  1WYD A;  4JBJ A;  4DV1 L;  1WJJ A;  4DR1 Q;  1VQC A;  1A63 A;  3WWV A;  2VQF L;  3E0E A;  4R4T A;  1Q12 A;  1NBW A;  3S1Q H;  4JI6 Q;  5AJ3 Q;  3T1Y Q;  1VQK A;  2ID0 A;  4UY8 C;  3GTM H;  3K7U C;  3S16 H;  1LYL A;  2KEN A;  4A93 G;  2UXC Q;  1FGU A;  3RZD H;  2VUM H;  3TS0 A;  3JC6 6;  4P75 A;  5BR8 L;  4GOP C;  2NZO A;  1I3Q H;  2Z6K A;  1N36 L;  2JA7 G;  4X65 Q;  4K0K Q;  3HOY G;  4DUZ Q;  1VQ8 A;  4WJ4 A;  5IYC H;  3HOW H;  2JA8 H;  1KC8 C;  1A0I A;  4DV7 L;  3T1H L;  1XMO L;  1NY4 A;  4GNX A;  4IPD A;  3UDG A;  3CC4 A;  1G51 A;  2K14 A;  2WB1 E;  3GDE A;  5FJ8 H;  4AH6 A;  2D0O A;  3JAM i;  1M1K C;  2V1C C;  1VQ7 A;  3M7N A;  2UUC L;  2PNH A;  1K8A C;  3H15 A;  5M3F H;  2N49 A;  2Y0S G;  3F8T A;  1HR0 Q;  4LF6 L;  4NB3 A;  4B3M L;  3KYH C;  1CSP A;  1I5F A;  2UU9 Q;  5IYB G;  4EQ5 A;  2E5L L;  4BY7 G;  1VQO A;  3Q8D A;  5C4J H;  5C4X G;  1E7Z A;  4EX5 A;  4H02 A;  1HZB A;  4A3B G;  4DUY L;  1V1Q A;  2JA6 G;  2XTI A;  1P16 A;  2VW9 A;  1CKN A;  4R4C A;  4P71 A;  5J3B A;  3UE1 A;  5M3M G;  3T1H Q;  1VQP A;  1FL0 A;  4IPG A;  2UUA L;  4A93 H;  4X62 Q;  4DAM A;  4JI3 L;  3CF5 A;  1VQM A;  5LMU L;  3KF6 A;  1Q7Y C;  3PUY A;  1XPU A;  3HOV G;  1K3R A;  2A19 A; 
#chains in the Genus database with same CATH topology
 4F87 A;  4UP7 A;  4BA1 I;  2K01 A;  4JG2 A;  4RGO S;  1G91 A;  2CH4 W;  4JI2 L;  4FF2 A;  2K04 A;  1HZ9 A;  2RF4 A;  3FKI G;  2OTL A;  2BH2 A;  3BDC A;  3VR3 A;  1U4M A;  1S3O A;  4CDC C;  2IY5 B;  2ZJQ A;  2E75 C;  2Z4H A;  3F2U A;  5COY A;  3PO2 B;  5JVH 3;  4C3J B;  3IFD A;  4L8J A;  4PV1 C;  4DNI A;  4LF8 L;  4XQQ A;  4RKL A;  1OXS C;  2SNS A;  4OHJ A;  1GKH A;  1O7I A;  1Z6H A;  2FXQ A;  1KDA A;  1F2Z A;  3CP0 A;  4JI5 Q;  3HKZ G;  2PQA A;  4B3T Q;  4OEL B;  3OPO A;  3A0J A;  2CWP A;  3GTL B;  3PUZ A;  3TBI B;  5KYL A;  2ZTD A;  3OTO Q;  2NN6 H;  1ET9 A;  4A3F B;  1EY4 A;  4O2D A;  1TVX A;  3K80 C;  2F0V A;  3DM1 A;  4C56 C;  2LSS A;  3AQQ A;  3FMC A;  5D3I B;  1T5X D;  3GD7 A;  4JI1 L;  2OXP A;  3PUW A;  1Q90 A;  3L0O A;  4DAY A;  4IFD G;  4QQB X;  2NZ1 D;  2NVX H;  4LF9 Q;  1I3Q B;  1I4Q A;  1EFW A;  3MZ5 A;  1YHQ A;  1N8R C;  4ZUJ A;  3I4N H;  5IP9 G;  1BOS A;  4JOI C;  4KD4 A;  5CV9 A;  2K03 A;  2GA4 B;  3J80 L;  1L1O A;  1AEX A;  5T1G A;  2IWH A;  1STY A;  4KJO A;  2E2J H;  3CCR A;  1JWM D;  4A3G H;  2RDH A;  2QA4 A;  5C3X A;  3H0G G;  1SEB D;  1L0Y B;  2B63 B;  4WJ3 M;  5IP7 H;  4JV5 L;  1RTO A;  1IYJ B;  3S2D B;  4CKE A;  1X3P A;  3RN2 A;  4A3E G;  3R93 A;  1LLR D;  5GQO A;  1B53 A;  2JJQ A;  4M1U B;  3PO3 H;  2MNA A;  3Q0A A;  3MEF A;  5C44 G;  2N8N A;  3C1F A;  3D4W A;  4RAU C;  4UPA A;  1CA5 A;  4FXG C;  4LF7 L;  1GO3 E;  2BA1 A;  3FRP B;  2EZV A;  4DR7 L;  4OON A;  1DJR D;  1VQF A;  2NVT B;  3OW2 A;  1UEA B;  2OQK A;  5EKL A;  3A5Z B;  2R7Z G;  1STB A;  1GM5 A;  2L15 A;  1N36 Q;  1EY9 A;  1LV9 A;  2F3W A;  2X6L A;  3KLW A;  5GRO A;  2XIW A;  1VF7 A;  3TP6 A;  2MHV A;  1CHP D;  4DNT B;  4EGV A;  3RN5 A;  3LWE A;  1BQQ T;  1STE A;  2DNE A;  1E2Z A;  1NR2 A;  3HZX A;  3HOY H;  4CKC A;  2K5V A;  4NW2 A;  4DAV A;  3CPW A;  2E5L Q;  1TWG H;  4NXN L;  2TSS A;  2D5D A;  1DYQ A;  4YWK A;  2OQ0 A;  2IL8 A;  2J4X A;  5CV8 A;  5C3E G;  3S1N B;  3C1E A;  2EOT A;  4C2M H;  3U9S A;  2L0C A;  4IUU A;  1PZI D;  1TS4 A;  5EBD A;  2ES2 A;  3J81 E;  5LMU Q;  2WB1 G;  1VQA A;  4I65 A;  1PH8 A;  3HRZ C;  3AU7 A;  1RCV D;  5HGT A;  1N32 L;  1WCM B;  1F9Q A;  5IWA L;  3EN2 A;  1MHW C;  4BY1 B;  3I56 A;  4YIJ A;  2LS0 1;  3SK6 A;  3NTI A;  1JC7 A;  2CWA A;  2F0L A;  4IAL A;  4LFA L;  1Y1V B;  1UEB A;  2MFI A;  2PMZ B;  3K5M A;  1QJO A;  3VR6 A;  1LO5 D;  2WAQ G;  3W1G A;  3PCO B;  5CGK A;  1Y1W B;  4BXX G;  1F9R A;  1OXT A;  2VXW A;  3ULJ A;  2K5N A;  2A73 B;  1QIL A;  1L0X B;  3S2H H;  3S16 B;  4MNO A;  1FJG Q;  1Y8N B;  4HSV A;  1UNS A;  1AH9 A;  1A3V A;  1C9O A;  3D3R A;  2RCF A;  3J81 c;  1HRJ A;  2I0Q A;  1Y14 B;  2B29 A;  3W3A A;  2ASB A;  4GKJ Q;  3STB C;  2EY2 A;  3CRK C;  3K0X A;  2JA8 B;  2RCN A;  1U0L A;  4ZQ3 A;  2NYZ D;  4KN4 C;  1S5D D;  4GLA C;  4IJH A;  3SXH A;  1AZP A;  2MPM A;  3R8B A;  4C3J H;  5DNF A;  4DR5 Q;  1IBM Q;  2ZXR A;  1XXG A;  3R3O A;  1WD0 A;  1TWC H;  5M5W B;  3OHX C;  3UI2 A;  3ZJY C;  3X3N A;  3RD4 A;  4YY3 Q;  3UDI A;  4DR1 L;  2B2U C;  1MJE A;  1H9K A;  4DR2 Q;  2K28 A;  1AW7 A;  2A69 D;  1OXV A;  3K8A A;  5ISR A;  4DPG A;  4CBV A;  4P74 A;  1Q86 C;  1J6Q A;  2K5H A;  5FJ8 G;  4H7B A;  4A93 B;  1X32 A;  3ONA B;  3GTL H;  4KKT A;  1HNZ Q;  1CKM A;  5M3F G;  2AUK A;  1SN8 A;  1XPO A;  1MGS A;  4A3F H;  3NK9 A;  3NE5 B;  2ZTE A;  1TXY A;  3KUP A;  4X3S A;  2DN8 A;  1ZXT A;  3OIP A;  3CW2 C;  2L9H A;  4L63 B;  2D62 A;  3I70 A;  2AMC B;  1HR0 L;  5JEA H;  3DLL A;  4A4I A;  1VQB A;  2CW0 D;  4G7H C;  4BY7 B;  4TQU S;  1B50 A;  3Q23 A;  4AYB G;  4HID A;  3NBH B;  4A3B B;  1Q8K A;  5JAV A;  2PCF B;  1I4R A;  1X54 A;  2FHT A;  1OXU A;  1F77 A;  4DK6 C;  3V96 A;  3KOJ A;  4LFC L;  5JVG 3;  3M4P A;  4QL5 A;  3GTP B;  4JCV E;  1X3F A;  2Z6K C;  5CV6 A;  4JI0 Q;  2B63 H;  3OIQ A;  5KNB A;  1WTQ A;  1PTO F;  1MIU A;  2FMC A;  3S2D H;  1KHI A;  2D9U A;  3CCJ A;  2JE6 I;  1KQS A;  3KDF A;  1F2L A;  1SMX A;  2RDF A;  2CCZ A;  1X6O A;  2ZJR A;  5FO8 B;  1GUT A;  1YIJ A;  2NWG A;  1B3A A;  2Q2I A;  4LMQ D;  2Z9H A;  2BDO A;  1E1O A;  1NE3 A;  2NVT H;  4GKK L;  2MUY A;  2QIL A;  3CRL C;  3SK8 A;  4LF4 Q;  1Q82 C;  1NCV A;  5ELC A;  2NN6 G;  4PQX A;  4ULL A;  4JI5 L;  4B3T L;  3SE0 A;  3X3M A;  1KD1 C;  1M4V A;  3SEB A;  3OTO L;  2R6G A;  3ULP A;  4K8J A;  3GTJ B;  5M5X B;  4JI7 Q;  1BUV T;  1RDP D;  1VQH A;  2XWJ B;  2EDG A;  1EQT A;  2RHQ B;  4BBR G;  3HOX B;  4FVM A;  4GOP B;  1EY7 A;  3A54 A;  4HSP A;  4DV2 Q;  3I4N G;  2F0U A;  4JPB W;  2JA5 B;  2D0P A;  4HIM A;  3GTG B;  1K73 C;  4RMF A;  1XTC D;  3A8K E;  4OWX B;  1EQR A;  4B3S Q;  1C8C A;  2P5Z X;  4LF9 L;  3S1N H;  2RHS B;  4KHP L;  5KND A;  1B70 B;  1VDZ A;  1U4R A;  2TMP A;  4R9W A;  5IP7 G;  4B9X A;  1JR0 D;  4QY7 A;  1ILP A;  4IFD I;  1CZG A;  1IXR A;  4QJF A;  2DUD A;  3A8I E;  1PHJ A;  1EY5 A;  3NWS A;  1EU4 A;  1YZ6 A;  3MVV A;  4XIG S;  1HA6 A;  4PMC A;  3VDY A;  3G6E A;  1SR3 A;  3CU7 A;  4JW0 A;  2EYM A;  1Y1V H;  1LAB A;  2SOB A;  1BF4 A;  3PF5 A;  1LT5 D;  1Y1W H;  2JEA I;  3GV6 A;  2JA7 B;  3RNU A;  1XX8 A;  2BOS A;  4LUO A;  5CBE E;  1RL2 A;  3I4M B;  1WYD A;  2PO4 A;  1WJJ A;  4KV6 A;  3WWV A;  2XNA C;  4DK0 A;  3E0E A;  1JB3 A;  3S16 H;  4UY8 C;  3GTM H;  5KYI A;  3H3V C;  2UXC Q;  1H9J A;  2L4N A;  1PRT F;  3TS0 A;  4GOP C;  4ILW A;  4QUC A;  3IAY A;  1N36 L;  4X65 Q;  4K0K Q;  3BG3 A;  3HOY G;  4DUZ Q;  1O80 A;  3JAM L;  2JA8 H;  2JA6 B;  1A0I A;  3T1H L;  5G3L F;  4C3I B;  1YNN D;  4GNX A;  4HMI A;  3I4L A;  2AQ2 B;  5M3M B;  3S14 B;  3UDG A;  3GDE A;  2EYL A;  3LX0 A;  2Y0S G;  3NTK A;  1TT2 A;  3QIA A;  4NB3 A;  1RJT A;  1CSP A;  4EQ5 A;  2E5L L;  1VQO A;  5C4Z A;  4EX5 A;  3KLS A;  4H02 A;  1HZB A;  1V1Q A;  2XTI A;  4R4C A;  4ZKC B;  1B44 D;  1FL0 A;  4A93 H;  4X62 Q;  2QEJ C;  4K2L A;  4DAP A;  2AQ1 B;  5LMU L;  3S1R B;  3HOU B;  4FXK C;  1SMY C;  4CGY B;  5J39 A;  4KD3 A;  5C5L A;  2EYH A;  4LW1 A;  4MZ9 A;  1R4Q B;  4HJ8 A;  2OWO A;  2A8V A;  3OMG A;  4OO1 H;  4KLK A;  3CCM A;  2YYZ A;  5EKK A;  4LAA A;  1ONL A;  4F88 A;  2B3G A;  4A3L H;  3DWP A;  2AHO B;  2K75 A;  4YCU A;  3H91 A;  4R4O A;  2WAC A;  4A3B H;  4MIU A;  1N33 Q;  1X55 A;  3JAM E;  3QR8 A;  3PF4 A;  3A7A B;  2E74 C;  2F4V Q;  5C0X H;  1WTV A;  1B7Y B;  3MTS A;  3TRZ A;  1XTD A;  3GTP H;  2IHE A;  4QUF A;  1PH1 A;  2HIX A;  3WDN A;  2B2V A;  3D31 A;  1Y8O B;  2E8G A;  4C3J G;  3R2I A;  1FJG L;  1HZA A;  1S5F D;  4PG3 A;  1N34 Q;  1HPC A;  5E1F A;  3BVZ A;  1VQJ A;  1EQQ A;  1ZEQ X;  2K50 A;  2A68 C;  4DV4 Q;  3EA6 A;  2B2W A;  1CHQ D;  3T16 A;  5FLX E;  4DR5 L;  1IBM L;  4WFN 3;  2KCN A;  1I4H A;  4YHH Q;  3A56 A;  3PGZ A;  1D1K A;  3SK4 A;  2SDF A;  4DV6 L;  1F2M A;  1SBB B;  4IZ8 A;  2B2Y C;  3RLO A;  3TME A;  4YY3 L;  1HNW Q;  4EVO A;  1NTG A;  2RSN A;  4A3F G;  4R1J A;  4XQJ A;  2UXD Q;  4DR2 L;  4KMU C;  2HHH Q;  1RIP A;  1NUC A;  1Q8I A;  3DM3 A;  1HCZ A;  1S5B D;  4K5W A;  2G5D A;  4V19 0;  3JAM c;  1QG7 A;  2O5J C;  4L5R C;  2QEX A;  1HNZ L;  5M9O A;  5JEA G;  4ZRZ A;  3GTJ H;  5M5X H;  1AZQ A;  4EQP A;  1YI2 A;  1DXM A;  4JBW A;  1TKW B;  4GLV B;  2NVY B;  2R7F A;  2C9O A;  1X3Q A;  3HOX H;  1QWY A;  2QF7 A;  2SNM A;  4DN4 M;  2F0G A;  1M90 C;  3KLS X;  3CCU A;  4O0A A;  1SFO B;  4LFB Q;  4HJA A;  1YNJ D;  3GTG H;  1SJE D;  4HJ5 A;  4A3K G;  1K8M A;  5I9P A;  2EY5 A;  3Q24 A;  2GVA A;  1RTN A;  4OL7 A;  5ELD A;  5FLX c;  3A8J E;  2VB3 X;  3J81 i;  3M4Q A;  2B63 G;  3KF6 B;  1FYC A;  3CPF A;  3J81 j;  2Q8R E;  3F2B A;  4O42 A;  5IY0 A;  1EOT A;  1B4O A;  3NSW A;  4G57 A;  4H0L C;  4DK3 C;  2VS1 A;  4BBS B;  1CQF A;  4Y7N B;  5IGB A;  1TWF B;  4JI0 L;  4X3K A;  1Q81 C;  1WTW A;  3GV3 A;  2KUM A;  1HQR D;  3U4V A;  1MI2 A;  4DV7 Q;  1B9M A;  1XMO Q;  2HT1 A;  1V1P B;  1N9W A;  3QOJ A;  1EYC A;  1PTO D;  2UUC Q;  4HR7 B;  2ATW A;  4H13 C;  3AMU A;  5EJW A;  5I2X A;  2JA7 H;  1HQM C;  4HIO A;  3NWT A;  5ELE A;  1WTO A;  3I4M H;  4JVZ A;  3F2C A;  4RH6 A;  2FFK B;  1HZC A;  4FXD A;  4PZ6 A;  4DUY Q;  4LF4 L;  2PZW A;  5IGD A;  1XWE A;  3PIO 3;  2A5H A;  5CV7 A;  4Z9C B;  4MTN A;  5IYB H;  3G6J B;  1A8V A;  4DK1 A;  2KED A;  1RKN A;  1C0A A;  2JA6 H;  1HNX Q;  1TY0 A;  4C3I H;  2QGQ A;  4JI7 L;  2KQ3 A;  2O4X A;  3VYU A;  5M3M H;  3S14 H;  2EJM A;  4JK1 C;  5CV5 A;  1E1T A;  1PZJ D;  2NN6 I;  4DV2 L;  1OXX K;  5ELB A;  3W1B A;  2EXD A;  5F2D A;  3C46 A;  1WTX A;  1HTP A;  3VYR A;  3FEW X;  2RDG A;  4B3S L;  3TP7 A;  5TSS A;  1X56 A;  2HCI A;  4XYQ A;  2E2H B;  4IUP A;  1EUJ A;  2N55 A;  2XVS A;  3HOU H;  1I4P A;  3RZO B;  4TVA B;  1EY8 A;  3PIO A;  1X65 A;  1MSG A;  3MXU A;  3VA7 A;  2F0I A;  5IGF A;  4V0B A;  5IOC A;  4L5S A;  4UAI A;  4G7O C;  1EL0 A;  3S1Q B;  1Y1V G;  4A3I G;  1CFM A;  1BVS A;  2X6G A;  1OO9 B;  1KIX A;  1K0S A;  1LTB D;  2NUC A;  1Y1W G;  1S5C D;  3HOW B;  1SE4 A;  4HIK A;  1QB5 D;  3PMF A;  1WI5 A;  1E24 A;  5H1S E;  2NTT A;  2NZH A;  1MJC A;  1J5E Q;  5AFW A;  3ND8 A;  3O13 A;  5KRU A;  1H9S B;  1CKO A;  1PMR A;  1TS5 A;  2CQO A;  2DNC A;  2JA8 G;  4PZ8 A;  1FGB D;  2DY7 A;  2IX1 A;  2A1A A;  1QVC A;  2UXC L;  4Q0F A;  1SJH D;  3QG1 A;  1TR5 A;  4J15 A;  2DY8 A;  2I46 A;  3L3O C;  3J81 L;  1R4P B;  4LUV A;  1E2W A;  4X65 L;  3M9B A;  4JYA Q;  4K0K L;  3U4Z A;  4QIW E;  2KA7 A;  2WIN B;  4OWW B;  1TWA H;  4LF5 Q;  2K5D A;  1PRT D;  5M5Y H;  2N88 A;  3CCQ A;  3SVM A;  1TS3 A;  2PNR C;  1L1O C;  2QDL A;  1KTK A;  5G3L D;  1NNX A;  3BDL A;  3J7A F;  1EYD A;  2EXZ A;  4DA2 A;  3RUZ A;  3VYT A;  4I7Z C;  1SNM A;  1SYF A;  3U58 A;  3QWN A;  1STN A;  1I6H B;  4NKL A;  1VQN A;  1TU2 B;  1YVC A;  4DR4 Q;  4X62 L;  1G8Z D;  2FIN B;  4QIW B;  4OO1 G;  1WVL A;  2VB2 X;  1CUK A;  1Y8P B;  3K59 A;  1BKB A;  3HOZ H;  1Q1B A;  3HOV B;  3A7L A;  3L9A X;  4A3L G;  4IO9 A;  2NVY H;  2PI2 A;  5LL6 X;  1EIH A;  4GN5 A;  1RHP A;  1LT6 D;  4L5T A;  3N6R A;  3U50 C;  4JI4 Q;  2JA9 A;  5FO9 B;  2VQE Q;  1SFO H;  4ODG A;  2UXB Q;  4YCV A;  5DM7 3;  5C0X G;  1BDO A;  3HKZ E;  3LWU A;  5BN3 A;  2MP1 A;  3MEH A;  3B6Y A;  2Z1C A;  1JJC B;  1SAP A;  3IRB A;  4A3D B;  4K6L A;  4CKB A;  1G2S A;  2ZTC A;  1YBY A;  2F4V L;  5JJI A;  4Y52 H;  3M4Y A;  4GN4 B;  2AWO A;  1VQ5 A;  4IUQ A;  1WTP A;  4BBS H;  4IQZ A;  4Y7N H;  1PVO A;  3BYY B;  1TWF H;  1YJ9 A;  4DV3 Q;  2A69 C;  1LUZ A;  4L5Q A;  3KLR A;  5LL6 S;  4LK1 C;  1KAB A;  4IOA A;  1N34 L;  2R92 B;  3CQZ B;  4DV0 Q;  1FNU A;  1PH7 A;  1GUN A;  1LTG D;  3IKJ A;  3K5N A;  5ELF A;  2F0W A;  4DV4 L;  4NXM Q;  2RBM A;  4HCE A;  5E7N A;  1EZ6 A;  1XNR L;  2E2I B;  2I5L X;  2K4K A;  4IUN A;  4YHH L;  5EPK A;  3K7A B;  4XT1 B;  1BCP F;  4MHE A;  5ELN A;  4AQY Q;  1JMC A;  2ZJP A;  2PZU A;  3WOF A;  1YIT A;  2UUB L;  2CW0 C;  1HNW L;  2IPK D;  1AP0 A;  2KHJ A;  5DM6 3;  1SNO A;  2HHH L;  1RF2 D;  3E0J A;  2DJG C;  1PFN A;  1J9O A;  2B2U A;  3HOX G;  5CMD A;  3PO2 H;  1BBW A;  1C7Y A;  1P8L A;  1OTC A;  3S9W A;  3OWE B;  4UDU C;  4R4I A;  1STA A;  1I50 B;  3QOL A;  3TRE A;  3H0G B;  3FDT A;  2OF1 A;  5K5P A;  3TQY A;  5I6Y A;  4DFA A;  2HIV A;  4ME5 A;  4LFB L;  4HAE A;  4TRD A;  3NEN A;  4A3E B;  4CJ2 C;  2E2H H;  3CME A;  4U67 3;  1W6J A;  5C44 B;  2YV5 A;  1M8A A;  1V9P A;  2KEC A;  3NBI A;  3HG9 A;  4N9T A;  4JBJ A;  1PFB A;  1JWU D;  1IW7 D;  4F7X A;  3S1Q H;  1ENF A;  2ID0 A;  1DD2 A;  1LYL A;  4C1N I;  1FGU A;  4RCO A;  2NZO A;  1DOL A;  1QCB D;  4RWS C;  2F0K A;  3CKI B;  1I3Q H;  2Z6K A;  1K28 A;  4KY5 A;  3CHB D;  2JA7 G;  2R7Z B;  4CJ1 B;  4WJ4 A;  5IYC H;  3HOW H;  2SEB D;  1SYG A;  4DV7 L;  1XMO L;  2F0J A;  1NY4 A;  4EQN A;  4IPD A;  1UAP A;  3CC4 A;  1TWH B;  2WB1 E;  3JAM i;  2D0O A;  2V1C C;  1VQ7 A;  2UUC L;  2PNH A;  2G9D A;  3VR4 A;  4DGZ A;  1K8A C;  3H15 A;  3F8T A;  5IIF A;  5C4H A;  2YU9 B;  1I5F A;  5IYB G;  1EEF D;  1E7Z A;  2HDL A;  4DUY L;  2JA6 G;  5J3B A;  4P71 A;  5C3E B;  5M3M G;  1F9S A;  3DWA A;  3VR2 A;  4IPG A;  1EFI D;  4G4K A;  4ZK9 B;  4HCS A;  4DAM A;  4A3J B;  3CF5 A;  1VQM A;  1Q7Y C;  3PUY A;  1AN8 A;  5A35 A;  4RGT A;  2WB1 B;  2WAQ E;  1Z9F A;  1HNX L;  1CA6 A;  5EQ0 A;  3Q6S A;  4BS9 A;  3EIV A;  5EKI A;  2R7D A;  4HTH A;  1JJ2 A;  1U5K A;  1ILQ A;  4KY7 A;  3D6W A;  2Z0S A;  3LGJ A;  3NBH A;  3HOU G;  1T9H A;  3RR5 A;  2AUJ D;  4OIJ A;  2XWB B;  5FK9 C;  1KRT A;  3TDQ A;  2XRQ D;  1I6H H;  4DR3 Q;  1VQD A;  1SRO A;  5IT9 E;  2JP1 A;  1GXD C;  5C5M A;  2PPB C;  3M7G A;  1L0W A;  2QCP X;  4FDB A;  1C4Q A;  2H5X A;  3PSI A;  1Q46 A;  2JN4 A;  2C35 B;  2HQE A;  4NPS A;  1K8O A;  2F03 A;  2A6H D;  2EY6 A;  2B2T C;  3DXJ C;  1I94 Q;  3T51 B;  1KAW A;  4A3G G;  5JOB A;  3E3X A;  1NSN S;  1W6K A;  1YNN C;  1YJN A;  4IUR A;  2JEB I;  4FNF A;  3UDF A;  1XMQ Q;  4OWT B;  4A3D H;  1SND A;  2FMM A;  1WCM H;  1YJW A;  1IKL A;  4ZLT F;  4XQN A;  2JXM B;  3MXG A;  4BY1 H;  1QVG A;  3PO3 G;  1S4Z A;  2Q8I B;  3H6M A;  3E9H A;  1QUQ B;  4RKB A;  1GD7 A;  1JOQ A;  2LY7 A;  5J22 A;  5IT9 c;  3BZD B;  1SLJ A;  1PXU A;  3K58 A;  1GOZ A;  1YHA A;  1Z7T A;  3EJI A;  4AYB E;  4P2C B;  2R92 H;  4C3H B;  1CM9 A;  3KBG A;  3VR5 A;  3CQZ H;  3GTK B;  4JYA L;  1TY2 A;  4JI1 Q;  4GOP A;  2M9V A;  2EYP A;  3S24 A;  2L55 A;  1SYC A;  2HCC A;  4LF5 L;  5E3F A;  2F0O A;  5FO7 B;  5C4J B;  2MO1 A;  2E2I H;  1UWV A;  4X3T A;  5FLM H;  3K7A H;  2F0T A;  1LTS D;  3W2D A;  4X64 Q;  2QW7 A;  3S15 B;  1JE4 A;  3HOZ G;  1SE3 A;  3OWF A;  3GO5 A;  4AYB B;  4B3R Q;  1AFP A;  1ZYR C;  2WKC A;  4N8X 1;  2KBN A;  4AIM A;  4JC0 A;  2VQF Q;  1SE8 A;  5M5W H;  3GTQ B;  3SK5 A;  4WOR A;  4CDF C;  3DWQ A;  1I50 H;  3URY A;  1LT3 D;  3GQB A;  3H0G H;  4JI4 L;  5GAH C;  2LFN A;  2VQE L;  5LMN W;  5D14 A;  3A55 A;  2F0F A;  2UXB L;  2F3I A;  1CK1 A;  4LF7 Q;  4OO1 I;  1A3U A;  2Q2T A;  1QOH A;  4DR7 Q;  2BCO A;  4IN3 A;  1S40 A;  3J7Y W;  1UE6 A;  5FLX L;  5KEE A;  1VS0 A;  2RQX A;  2MJ8 A;  4BBS G;  1MKH A;  1U4P A;  5C44 H;  4E6I A;  1PH5 A;  3PUV A;  3S17 B;  1K83 B;  1QZH A;  3C3L A;  4ZCK A;  2AQ3 B;  3KF8 A;  4PZ7 A;  4HMJ A;  2ICI A;  3F1Z A;  3IFT A;  1PV4 A;  3I8Z A;  1ET6 A;  1SNP A;  5C0X I;  1PTO B;  1PZK D;  4DV3 L;  2UUA Q;  3T53 B;  1W3S A;  4JI3 Q;  4BY7 H;  3M4O B;  1GHK A;  1F2Y A;  2R7Z H;  1I4X A;  3AFQ A;  3NPP A;  2Q2H A;  3MAQ A;  4DV0 L;  4JBM A;  3T13 A;  2I5M X;  1JCK B;  1TWH H;  4NXM L;  1F9P A;  4O1N A;  2GN5 A;  4K2K A;  1KAA A;  3H94 A;  3W5O A;  5KNC A;  4GLX A;  4XXE A;  1EU3 A;  4BBR B;  1HHV A;  2A6E D;  2YU9 H;  2AKW B;  3G71 A;  1GUO A;  2KJX A;  3I4N B;  3PO2 G;  4AQY L;  2BE5 C;  3BZK A;  1YNJ C;  3ICE A;  1MD2 D;  1KDC A;  1AE3 A;  1MBY A;  2LXJ A;  2EJG C;  3PUX A;  5ELO A;  4GKJ L;  3M3Y B;  5EGT A;  1BCP D;  1SNQ A;  4A3J H;  2JYO A;  2Z8L A;  1ZKO A;  1ENC A;  2ZM6 Q;  2HQL A;  4KJN A;  1IBK Q;  3V2T A;  3EQL C;  1JOK A;  2WKD A;  2I5H A;  3FHW A;  3P75 A;  1VCI A;  3RZD B;  2VUM B;  5E4W C;  1VQI A;  2IT1 A;  4KKU A;  3NXW A;  1DON A;  4QCL A;  3FPP A;  2KVM A;  2B2V C;  1PTO C;  3H3V H;  3P1H A;  4FO2 A;  3BDO A;  3I91 A;  1VQG A;  2N78 A;  1X3E A;  2C5C A;  2HUG A;  2Y0S E;  4S3S A;  5IYC G;  2J0T D;  4ALP A;  2JA5 H;  3HOW G;  2LKV A;  1O7L A;  3QB3 A;  4KY6 A;  4L6T B;  3AYH B;  4K6D A;  2F0D A;  1GUW A;  1G2T A;  1VMC A;  1CKN B;  1EQV A;  4DF7 A;  3FVQ A;  1LTT D;  4LWC A;  2YTY A;  3I2Z A;  5KGU A;  1WTH A;  4XDX A;  4A3M B;  5HGQ A;  3HOY B;  1IBL Q;  3D4D A;  3EBE A;  5IOD A;  4FYD A;  1UE5 A;  3ER0 A;  1K8G A;  3ERS X;  5HY6 A;  2B8G A;  1E2V A;  2R93 B;  4IJL A;  3AFP A;  3MXN A;  3G4S A;  4B08 A;  5IYD H;  2X69 A;  1B9N A;  4HED A;  1II3 A;  2EPB A;  3I73 A;  1I4G A;  3E9I A;  1KL9 A;  3I90 A;  4OEM B;  2LMC B;  1B8A A;  2F0P A;  2CH4 A;  3I55 A;  2EY1 A;  4C3H H;  3BYT B;  3GTK H;  1FNV A;  1PYB A;  2JK8 A;  2OCE A;  2BDN A;  5LMN Q;  3NEL A;  3V05 A;  3GTO B;  2O2L D;  5IE8 A;  5BN4 A;  4DV5 Q;  3HEJ A;  4UHV A;  3BVM A;  5I2Y A;  2VY3 A;  4DR6 Q;  2H1E A;  3TZD A;  2PQA B;  3NHH A;  4RGN A;  2KCC A;  3S15 H;  3TN2 A;  4LFC Q;  2F0H A;  4DR3 L;  3S2H B;  4HJ7 A;  1EWI A;  2R61 A;  4NDX A;  4K8I A;  3K5L A;  5J1Z A;  1QVF A;  1JOO A;  4RG1 A;  2K05 A;  1XNQ Q;  4DAY B;  3GTQ H;  5GAE C;  2NTS A;  1SRU A;  2LXK A;  1V1P A;  4OX9 Q;  1EIG A;  3OMC A;  4A3D G;  1WCM G;  1ASY A;  1I94 L;  4GZY C;  1KDB A;  4BY1 G;  1KRS A;  1TWC B;  1H9M A;  1L1O B;  3S1R H;  1A2T A;  4GKK Q;  2M2L A;  4N9P A;  3N52 A;  3SR1 A;  1PRT C;  1CZW A;  4JOI A;  4KKS A;  1XMQ L;  3UE0 A;  3L2P A;  4XTC S;  3AB9 A;  4CDD C;  4FF3 A;  3S17 H;  1K83 H;  2N3S A;  3MFG A;  3EVQ A;  1VQ9 A;  3FP9 A;  3HKS A;  3I72 A;  2MQH A;  2ZXO A;  3D8G A;  2R92 G;  1H95 A;  1W2B A;  3QO2 A;  1BNZ A;  4UP8 A;  2FJ2 A;  2K5Q A;  4K5V A;  4KN7 C;  4P73 A;  1EY6 A;  4X66 Q;  1NAP A;  1PTO H;  1PH4 A;  5K36 H;  3M4O H;  2JQO A;  5IGE A;  4TKO B;  5FLM G;  2IW3 A;  1RD9 D;  2XGT A;  2B39 A;  4JI8 Q;  3K57 A;  1HFG A;  3I4O A;  3KK7 A;  3PQI A;  2CHB D;  2PI2 E;  3CCV A;  1EWH A;  1JJG A;  4BBR H;  2HDM A;  4FF4 A;  4KHP Q;  1A62 A;  1FVI A;  4X64 L;  5I9O A;  2IJ0 A;  1Z47 A;  1HA5 A;  3E6Z X;  4KI0 A;  1ESR A;  2NVQ B;  4A3K B;  4RCN A;  3TEH B;  4DUZ L;  3M3Y H;  4OIK A;  3S1M B;  4B3R L;  1BXT A;  1GVP A;  5DLQ E;  1CT1 D;  5COR A;  1HFN A;  4PNY A;  1A63 A;  4DU9 A;  3OW7 A;  2VQF L;  1Q12 A;  1NBW A;  1Q3L A;  2K32 A;  4N8F A;  4JI6 Q;  5AJ3 Q;  3T1Y Q;  4A93 G;  1D5X C;  1Y69 U;  2E76 C;  4XYO A;  3RZD H;  2VUM H;  5C4X B;  4EQO A;  5KIX A;  3T56 B;  2EVB A;  1LT4 D;  1KC8 C;  3DEO A;  1IL8 A;  1TII D;  1HUM A;  4K5X A;  1G51 A;  2K14 A;  4AH6 A;  5CR3 A;  5JPN C;  3M7N A;  2EJF C;  1H9S A;  1PYW D;  3KYH C;  4BY7 G;  2UU9 Q;  3Q8D A;  4HN7 A;  4A3B G;  1P16 A;  5EBC A;  2VW9 A;  5IGG A;  1FD7 D;  4NMZ A;  3UE1 A;  3T1H Q;  3FKI B;  3KBX A;  2UUA L;  4JI3 L;  1IYV A;  3J80 E;  2OEO A;  1N33 L;  1QNK A;  1G6P A;  4A3M H;  1JIC A;  4APV A;  1JQY D;  3OOC A;  4WRD A;  4ZKB B;  1VMP A;  3M85 A;  1PFM A;  3J7A V;  2R93 H;  3BZC A;  1DM0 B;  4A3J G;  2K5W A;  2PMZ E;  1E22 A;  2QKI C;  2KHI A;  2XN9 C;  3RLN A;  3HKZ B;  2KEE A;  1O78 A;  3PIP 3;  5JEA J;  1TS2 A;  1NR4 A;  1KLG D;  2GVB A;  2ZT9 C;  1FR3 A;  2PZT A;  2ZM6 L;  4MTK A;  4XT3 B;  1PYS B;  1K3B C;  1IW7 C;  1IBK L;  4POG A;  1YEZ A;  2R3Z A;  3GTO H;  4DNR B;  4A3I B;  5EPJ A;  3CXC A;  4FP5 D;  3J80 c;  5T1I A;  2UXD L;  4YWM A;  2BA0 A;  4M8A A;  3T4A C;  2L1B A;  3CC7 A;  2L11 A;  2NBF A;  4LNQ A;  3BVG A;  2JA5 G;  1XJV A;  5LHY 1;  1V43 A;  3H09 A;  1WOC A;  3VYS A;  1ROD A;  4OXP A;  3GTM B;  2VZA A;  1QE6 A;  3WOE A;  5JPM C;  4RHS A;  3PIP A;  1XPR A;  2WFW A;  1A6X A;  1XYI A;  2IX3 A;  4GN3 B;  1DOK A;  2ICE C;  1VQE A;  3DHQ A;  1EIF A;  1LTL A;  3OYY A;  4PMW A;  2DJF C;  5CBA E;  1PH9 A;  1B1Z A;  4DV6 Q;  2EIF A;  4G7Z C;  1IBL L;  5IYD G;  3RZO H;  4QF4 A;  2F0M A;  1GJX A;  3ZYY X;  4R8I A;  3U9O A;  4DXF A;  2VL6 A;  2K52 A;  2ZXP A;  1D2B A;  3SGI A;  4BWG B;  1UUP A;  1C48 A;  4C3H G;  1E3P A;  2OT2 A;  5IT9 L;  4A3C H;  1LTI D;  1QZG A;  3KDF B;  3I4M G;  1EIY B;  4DV1 Q;  1HUN A;  2F1M A;  3EFX D;  1U4L A;  4X6A H;  1A3T A;  5LMN L;  4RHR A;  5BR8 Q;  4BA2 I;  1PH2 A;  2HD3 A;  2CVR A;  2IX0 A;  4POF A;  1HH2 P;  4DV5 L;  3G48 A;  1EWC A;  2A6H C;  3IL8 A;  3STB D;  4C3I G;  1EZ8 A;  2JSO A;  1AE2 A;  3DUZ A;  4IPC A;  3P7J A;  2M00 A;  4DR6 L;  2WII B;  1V1O A;  3SDZ A;  3VA5 A;  4QGU A;  4F8M A;  2NVQ H;  4ME3 A;  4A3K H;  4KK7 A;  1BBU A;  4U68 A;  4LF6 Q;  1HJP A;  1S5E D;  3S1M H;  4B3M Q;  1K9M C;  3HP3 A;  1LM0 A;  4IFD J;  2F4I A;  1EYA A;  3K6O A;  3OSO A;  2XRS D;  2RVL A;  1XNQ L;  2RKS A;  3J7A 5;  1DCZ A;  1GUG A;  1STG A;  3UDX A;  1CSQ A;  4RGM A;  4R4Q A;  1ICF B;  5C4X H;  1E0B A;  1U9R A;  1SNC A;  4B9W A;  2CKZ B;  2Z4I A;  1PH3 A;  4OX9 L;  3HGB A;  1VQL A;  2XSC A;  3K81 C;  1BO0 A;  1O7Y A;  2PW5 A;  1KNA A;  2F0N A;  1DOM A;  1X9N A;  5GAD C;  4C1N K;  3TSS A;  1R9T B;  1IZ6 A;  2WAQ B;  2B2T A;  2L12 A;  3I7F A;  1VF5 C;  4JI2 Q;  1PFS A;  2CFM A;  3HOV H;  3D4R A;  1YNX A;  3CCL A;  1I6V C;  5K36 G;  1SYE A;  3R2T A;  3P20 A;  1HXY D;  1J8I A;  3HFZ B;  1PLF A;  3CCS A;  4PMB A;  4RFB A;  3FKI H;  1SE2 A;  4X66 L;  1SDF A;  5JJL A;  4LF8 Q;  2J7Z A;  1SYD A;  2K33 A;  3MA2 B;  4ID6 A;  2WP8 J;  2K7V A;  2YTV A;  4JI8 L;  2PW7 A;  2K1B A;  1J5E L;  1KNE A;  4R8N A;  2AWN A;  3A74 A;  3RMH A;  2EE1 A;  1SSO A;  2NB0 A;  1BCP B;  3TS2 A;  2K6A A;  1V8Q A;  2RSO A;  3PV0 A;  1LTA D;  1A2U A;  4CJ0 B;  1JT8 A;  1UE7 A;  2F0Q A;  1ICW A;  4IPH A;  2EYF A;  2ALY B;  1PDQ A;  5D65 A;  5L37 A;  1H9R A;  4GNX B;  1STH A;  3TZU A;  5M3F B;  1NJI C;  1D7Q A;  2VUM G;  2ENB A;  4JBK A;  5CV4 A;  3F2D A;  1FNW A;  4HJ9 A;  3CCE A;  5AJ3 L;  3T1Y L;  3FPU B;  4JI6 L;  1YHB A;  4IFD H;  1WTR A;  4A3I H;  1VQ4 A;  4YWL A;  1EEI D;  5C0X J;  2KCT A;  1JE5 A;  1G29 1;  4YCW A;  1JB7 A;  5HUR A;  3ND9 A;  4ZUI A;  4DR4 L;  5EPL A;  5IP9 H;  3CMA A;  2V4D A;  5FOB B;  4JV5 Q;  3BU2 A;  3TP8 A;  3DEP A;  2EYJ A;  4GS3 A;  3KFU A;  2E2D C;  1QUQ A;  3NQT A;  5GAG C;  1CI3 M;  4DKA C;  4X3U A;  1WFQ A;  1KXL A;  2A6E C;  2UU9 L;  3KF8 B;  3C2P A;  3AEV A;  4A75 A;  5DAU A;  1HR0 W;  1UE1 A;  1D5Z C;  1G6Z A;  1LTR D;  2KCM A;  3ERO A;  4A3M G;  2MO0 A;  3MWY W;  2DGY A;  3NEM A;  4ZYS A;  3HS0 C;  5EAY A;  4LJZ C;  1PH6 A;  3ULL A;  1PA6 A;  1BCP C;  4A3E H;  4KHZ A;  2R93 G;  3CAM A;  1BBX C;  3G7L A;  5BN5 A;  4IUT A;  3ERQ A;  5CYU A;  1S72 A;  4ZAI A;  1ASZ A;  2Q2U A;  3LNN A;  2KHS A;  5A2Q L;  2G9H D;  1GUS A;  4A76 A;  3ITP A;  1ENA A;  4ABN A;  4UP9 A;  4GNX C;  3CC2 A;  5D3D A;  2A74 C;  1EY0 A;  4H44 C;  3TP5 A;  1EOV A;  2L5T A;  4NP5 A;  4QB4 A;  2Q8T A;  1WD1 A;  3KJO A;  2F0E A;  1KLU D;  4J8Q A;  1LAC A;  4NXN Q;  2PYK A;  4K14 A;  1IKM A;  1IYU A;  5IGC A;  1QNU A;  4P72 A;  4J6H A;  2QDB A;  5NUC A;  2NVX B;  1A15 A;  1JWS D;  4TSS A;  1ESF A;  2VNU D;  1X3G A;  3CD6 A;  3A5U A;  1L2F A;  2WV6 D;  1NMF A;  1D8L A;  5CC4 A;  1VQ6 A;  3K0Y A;  1ZYR D;  4LUZ A;  1DGS A;  2B2Y A;  5C3E H;  3I3C A;  1HTL D;  2D2C C;  1SYB A;  1N32 Q;  3BJU A;  4IOC A;  3MHB A;  5IWA Q;  2E2J B;  2OTJ A;  1IL2 A;  4A3G B;  2I07 B;  5FKA C;  1B2T A;  2Z6B A;  1ML0 D;  3KJP A;  1GHJ A;  1O7Z A;  5C3W A;  2BH8 A;  4LFA Q;  5A2Q E;  1D5M C;  2PQE A;  4CHT B;  3L7Z C;  3J7Z C;  3PO3 B;  3H3V I;  2F52 A;  4WJW A;  2YTX A;  3D0F A;  1TWA B;  1D6E C;  1SMY D;  2O5I C;  5M5Y B;  5DEH A;  2IHF A;  4J1M A;  1XNR Q;  3QJY A;  3RLF A;  1R9T H;  4BXX H;  3NTH A;  5JJK A;  3NP8 A;  1K0R A;  2UUB Q;  1D1I A;  2F3V A;  4A3C G;  3E5S A;  1Q1E A;  2B2W C;  3MXN B;  4FF1 A;  2RA4 A;  5I6W A;  4MN3 A;  1BR9 A;  1TQO A;  5JJZ A;  1EYG A;  1MSH A;  3GP7 A;  1JOR A;  2B8F A;  2F0S A;  2EQS A;  3HOZ B;  3MFY A;  3J80 i;  5C6A A;  1NMG A;  2H4O A;  3SHL A;  4Q5V A;  1CTM A;  1TWG B;  4DV1 L;  3K5O A;  4DR1 Q;  1VQC A;  3BS1 A;  3MC0 B;  3NUC A;  2CQA A;  3D6C A;  4R4T A;  1VQK A;  2BE5 D;  3K7U C;  3Q22 A;  2KEN A;  2Y0S B;  4KTA A;  4C2M B;  3NQI A;  3JC6 6;  4P75 A;  4I7A A;  5E4X A;  5BR8 L;  1DZ1 A;  4DXG A;  1PRT B;  4RA8 A;  1VQ8 A;  2A68 D;  1T5E A;  4IUV A;  5FJ8 H;  4KHV A;  1M1K C;  5M3F H;  1HR0 Q;  2N49 A;  3DMU A;  4LF6 L;  4B3M L;  3MXP A;  5C4X G;  5C4J H;  5I4D A;  1B3Q A;  2EYO A;  2KOL A;  1CKN A;  4CDE C;  4OGQ C;  1VQP A;  1CQV A;  1SXT A;  4QMG A;  1IHZ A;  2MGS A;  3KF6 A;  3HOV G;  1XPU A;  1K3R A;  2A19 A; 
#chains in the Genus database with same CATH homology
 1N33 L;  2WAQ E;  1Z9F A;  4A3M H;  1HNX L;  1G6P A;  4APV A;  4UP7 A;  4BA1 I;  4JG2 A;  4LW1 A;  4MZ9 A;  2OWO A;  4HJ8 A;  3EIV A;  3M85 A;  2A8V A;  4JI2 L;  4KLK A;  3CCM A;  2YYZ A;  2R7D A;  2RF4 A;  1HZ9 A;  3FKI G;  1JJ2 A;  2OTL A;  1U5K A;  2BH2 A;  2R93 H;  3BZC A;  2B3G A;  2Z0S A;  4A3J G;  3LGJ A;  4A3L H;  3HOU G;  1T9H A;  2PMZ E;  1S3O A;  1E22 A;  3RR5 A;  2IY5 B;  2AHO B;  1KRT A;  2ZJQ A;  2K75 A;  4YCU A;  2KHI A;  1I6H H;  4DR3 Q;  3RLN A;  4R4O A;  1VQD A;  1SRO A;  4A3B H;  1N33 Q;  1X55 A;  4DNI A;  5JEA J;  4LF8 L;  3PF4 A;  1L0W A;  2F4V Q;  4FDB A;  2H5X A;  1OXS C;  3PSI A;  1B7Y B;  2GVB A;  1Q46 A;  3TRZ A;  2ZM6 L;  1XTD A;  1PYS B;  2C35 B;  3GTP H;  2IHE A;  1GKH A;  1O7I A;  4NPS A;  2FXQ A;  1IBK L;  1PH1 A;  4POG A;  1YEZ A;  2HIX A;  3GTO H;  3CP0 A;  3D31 A;  2E8G A;  4JI5 Q;  3HKZ G;  2PQA A;  4B3T Q;  1FJG L;  1HZA A;  3CXC A;  3A0J A;  2CWP A;  3PUZ A;  4PG3 A;  1N34 Q;  3J80 c;  3OTO Q;  2ZTD A;  2UXD L;  1I94 Q;  1KAW A;  1VQJ A;  1EQQ A;  4A3G G;  4O2D A;  2K50 A;  4YWM A;  3K80 C;  2BA0 A;  3CC7 A;  4DV4 Q;  4LNQ A;  1YJN A;  4DR5 L;  1IBM L;  2JA5 G;  2LSS A;  3AQQ A;  2JEB I;  3UDF A;  1XJV A;  1XMQ Q;  4OWT B;  3PGZ A;  4YHH Q;  1V43 A;  4A3D H;  3GD7 A;  4JI1 L;  1WOC A;  3PUW A;  3L0O A;  1WCM H;  1YJW A;  4OXP A;  4IFD G;  4DV6 L;  2VZA A;  4BY1 H;  1QVG A;  3RLO A;  3PO3 G;  3PIP A;  1XPR A;  4YY3 L;  2WFW A;  1HNW Q;  3E9H A;  4QQB X;  1NTG A;  1QUQ B;  2NVX H;  4LF9 Q;  4A3F G;  1GD7 A;  4GN3 B;  4R1J A;  1EFW A;  2UXD Q;  4DR2 L;  1YHQ A;  1N8R C;  2HHH Q;  1RIP A;  3I4N H;  1VQE A;  5IP9 G;  5IT9 c;  3DM3 A;  4JOI C;  1SLJ A;  1YHA A;  3JAM c;  1L1O A;  1EIF A;  4L5R C;  2QEX A;  4AYB E;  1LTL A;  3OYY A;  1HNZ L;  2R92 H;  4PMW A;  3CQZ H;  5JEA G;  3GTJ H;  5M5X H;  4JI1 Q;  4GOP A;  1PH9 A;  1YI2 A;  4JYA L;  3S24 A;  4JBW A;  4DV6 Q;  2EIF A;  4GLV B;  3CCR A;  1IBL L;  2E2J H;  5IYD G;  2QA4 A;  4A3G H;  4LF5 L;  2R7F A;  3RZO H;  3H0G G;  3HOX H;  2MO1 A;  5IP7 H;  2E2I H;  4JV5 L;  4WJ3 M;  1M90 C;  1UWV A;  5FLM H;  3CCU A;  4O0A A;  3K7A H;  2VL6 A;  1IYJ B;  2K52 A;  4X64 Q;  3SGI A;  4LFB Q;  4HJA A;  3RN2 A;  3GTG H;  4A3E G;  4HJ5 A;  4A3K G;  5GQO A;  1E3P A;  2JJQ A;  3PO3 H;  3HOZ G;  2MNA A;  2GVA A;  3MEF A;  5C44 G;  4A3C H;  2N8N A;  3GO5 A;  1QZG A;  3KDF B;  4UPA A;  5FLX c;  3J81 i;  4B3R Q;  3I4M G;  3M4Q A;  4LF7 L;  1GO3 E;  2B63 G;  2BA1 A;  2KBN A;  3CPF A;  3KF6 B;  4AIM A;  3J81 j;  1EIY B;  3F2B A;  4DR7 L;  4OON A;  4DV1 Q;  1VQF A;  3OW2 A;  4JC0 A;  5IY0 A;  2VQF Q;  1SE8 A;  5M5W H;  4DK3 C;  2VS1 A;  2OQK A;  4X6A H;  1I50 H;  5LMN L;  5BR8 Q;  4JI0 L;  1PH2 A;  4BA2 I;  3A5Z B;  2IX0 A;  3H0G H;  4POF A;  1Q81 C;  1GM5 A;  4JI4 L;  2R7Z G;  1HH2 P;  2L15 A;  3G48 A;  4DV5 L;  5GAH C;  1N36 Q;  3STB D;  3KLW A;  2VQE L;  5LMN W;  5GRO A;  3U4V A;  1AE2 A;  4IPC A;  2UXB L;  2F3I A;  4DR6 L;  4DV7 Q;  4LF7 Q;  1XMO Q;  4OO1 I;  4QGU A;  2Q2T A;  2HT1 A;  3RN5 A;  4DR7 Q;  1S40 A;  1N9W A;  2NVQ H;  4ME3 A;  4A3K H;  1UE6 A;  1BBU A;  1VS0 A;  2UUC Q;  2ATW A;  4BBS G;  4LF6 Q;  1HJP A;  1MKH A;  2JA7 H;  3S1M H;  4B3M Q;  5C44 H;  1K9M C;  3HOY H;  4HIO A;  3PUV A;  1PH5 A;  2K5V A;  1QZH A;  3CPW A;  2E5L Q;  1TWG H;  4NXN L;  3I4M H;  1LM0 A;  3F2C A;  4IFD J;  4YWK A;  1HZC A;  4PZ7 A;  2OQ0 A;  5C3E G;  4PZ6 A;  4DUY Q;  4LF4 L;  1XNQ L;  3F1Z A;  3J7A 5;  1PV4 A;  3UDX A;  1CSQ A;  4C2M H;  5C0X I;  4R4Q A;  4DV3 L;  2UUA Q;  5C4X H;  1W3S A;  4MTN A;  5IYB H;  4JI3 Q;  4BY7 H;  2ES2 A;  1A8V A;  5LMU Q;  2CKZ B;  1PH3 A;  2WB1 G;  4OX9 L;  1VQL A;  1VQA A;  2R7Z H;  1PH8 A;  1C0A A;  3AFQ A;  3K81 C;  2JA6 H;  1HNX Q;  2Q2H A;  1X9N A;  4C3I H;  5GAD C;  2QGQ A;  4DV0 L;  4JI7 L;  1N32 L;  5M3M H;  3S14 H;  5IWA L;  4JBM A;  3EN2 A;  1IZ6 A;  2I5M X;  1TWH H;  3I7F A;  4NXM L;  2GN5 A;  1E1T A;  1PFS A;  4JI2 Q;  2CFM A;  3W5O A;  3HOV H;  2NN6 I;  3I56 A;  4GLX A;  4DV2 L;  1YNX A;  3CCL A;  2YU9 H;  1OXX K;  3W1B A;  5K36 G;  2AKW B;  2EXD A;  3G71 A;  2CWA A;  3PO2 G;  4AQY L;  4LFA L;  1UEB A;  3BZK A;  3ICE A;  3HFZ B;  2MFI A;  3CCS A;  4B3S L;  1AE3 A;  2LXJ A;  1X56 A;  3FKI H;  3PUX A;  2WAQ G;  4X66 L;  1EUJ A;  3PCO B;  5ELO A;  3W1G A;  4BXX G;  4LF8 Q;  4GKJ L;  5JJL A;  1OXT A;  4A3J H;  3ULJ A;  3HOU H;  2K5N A;  2WP8 J;  4TVA B;  3PIO A;  1X65 A;  3S2H H;  2ZM6 Q;  2HQL A;  2YTV A;  4JI8 L;  4L5S A;  1Y1V G;  1IBK Q;  1J5E L;  4A3I G;  2I5H A;  3FHW A;  1VCI A;  1BVS A;  2AWN A;  3A74 A;  4MNO A;  1FJG Q;  1KIX A;  1VQI A;  1AH9 A;  3TS2 A;  1C9O A;  2IT1 A;  1Y1W G;  3J81 c;  3PV0 A;  1Y14 B;  2B29 A;  2I0Q A;  2ASB A;  4GKJ Q;  3STB C;  3K0X A;  2RCN A;  1U0L A;  4HIK A;  1JT8 A;  4IJH A;  4GLA C;  1UE7 A;  1WI5 A;  4C3J H;  1E24 A;  5H1S E;  4DR5 Q;  1IBM Q;  4IPH A;  2NZH A;  1MJC A;  2ALY B;  4GNX B;  1TWC H;  1NJI C;  1D7Q A;  1J5E Q;  3H3V H;  2VUM G;  3ZJY C;  4JBK A;  4YY3 Q;  3UDI A;  3F2D A;  1CKO A;  4DR1 L;  1VQG A;  2N78 A;  2CQO A;  1X3E A;  2Y0S E;  5IYC G;  1MJE A;  4HJ9 A;  4PZ8 A;  4ALP A;  4DR2 Q;  2JA5 H;  2IX1 A;  2A1A A;  2JA8 G;  3CCE A;  5AJ3 L;  3T1Y L;  4JI6 L;  1QVC A;  1YHB A;  2UXC L;  1OXV A;  3K8A A;  4DPG A;  4P74 A;  1Q86 C;  4A3I H;  1J6Q A;  2K5H A;  3AYH B;  4J15 A;  5FJ8 G;  1VQ4 A;  4YWL A;  5C0X J;  3GTL H;  2KCT A;  1JE5 A;  1CKN B;  1G29 1;  1CKM A;  4LUV A;  4YCW A;  5M3F G;  1JB7 A;  4X65 L;  1SN8 A;  3M9B A;  4LWC A;  1XPO A;  4JYA Q;  2YTY A;  3U4Z A;  3I2Z A;  4QIW E;  4A3F H;  4K0K L;  2ZTE A;  1TXY A;  4OWW B;  5HGQ A;  1IBL Q;  1TWA H;  3EBE A;  4DR4 L;  5IP9 H;  1UE5 A;  3ER0 A;  4LF5 Q;  5M5Y H;  3CMA A;  3CCQ A;  1K8G A;  3CW2 C;  3ERS X;  4JV5 Q;  2D62 A;  3BU2 A;  5HY6 A;  3KFU A;  4GS3 A;  2AMC B;  1HR0 L;  1QUQ A;  5GAG C;  4DKA C;  1L1O C;  1WFQ A;  4IJL A;  1KXL A;  3AFP A;  3DLL A;  2UU9 L;  4A4I A;  1VQB A;  3KF8 B;  3G4S A;  3AEV A;  4A75 A;  5IYD H;  1HR0 W;  4TQU S;  1UE1 A;  4HID A;  4AYB G;  3U58 A;  2KCM A;  4A3M G;  2MO0 A;  2DGY A;  3NBH B;  1VQN A;  3NEM A;  1Q8K A;  3E9I A;  1KL9 A;  1X54 A;  1YVC A;  5EAY A;  1PH6 A;  1OXU A;  4DR4 Q;  4DK6 C;  1B8A A;  3ULL A;  4X62 L;  1PA6 A;  4OO1 G;  3I55 A;  3KOJ A;  4A3E H;  4LFC L;  1CUK A;  4KHZ A;  4C3H H;  3GTK H;  1PYB A;  2R93 G;  1BKB A;  3HOZ H;  3CAM A;  1Q1B A;  3M4P A;  2JK8 A;  2OCE A;  4QL5 A;  4A3L G;  4IO9 A;  1S72 A;  2NVY H;  1X3F A;  2PI2 A;  2Z6K C;  4GN5 A;  4JCV E;  1ASZ A;  5LMN Q;  3NEL A;  2Q2U A;  4L5T A;  4JI0 Q;  2B63 H;  3U50 C;  5IE8 A;  1MIU A;  4A76 A;  4JI4 Q;  4DV5 Q;  2JA9 A;  4UP9 A;  4GNX C;  3CC2 A;  2VQE Q;  1SFO H;  3S2D H;  1KHI A;  2UXB Q;  4YCV A;  2VY3 A;  4DR6 Q;  3CCJ A;  2JE6 I;  2PQA B;  1KQS A;  3KDF A;  5C0X G;  3HKZ E;  3S15 H;  1SMX A;  2CCZ A;  1EOV A;  1X6O A;  2ZJR A;  4LFC Q;  4DR3 L;  3B6Y A;  1YIJ A;  3KJO A;  1JJC B;  2Q2I A;  4HJ7 A;  1EWI A;  3IRB A;  2ZTC A;  1E1O A;  1YBY A;  4NXN Q;  1NE3 A;  2F4V L;  5JJI A;  2NVT H;  4GKK L;  4Y52 H;  1QVF A;  4RG1 A;  4LF4 Q;  1XNQ Q;  4P72 A;  4DAY B;  4GN4 B;  2AWO A;  1Q82 C;  2NN6 G;  1VQ5 A;  3GTQ H;  5GAE C;  4BBS H;  4Y7N H;  1SRU A;  1PVO A;  2VNU D;  1TWF H;  1YJ9 A;  4DV3 Q;  1X3G A;  3CD6 A;  2LXK A;  3A5U A;  4JI5 L;  1LUZ A;  4L5Q A;  4B3T L;  1L2F A;  1NMF A;  1D8L A;  4OX9 Q;  4IOA A;  1VQ6 A;  1KD1 C;  4A3D G;  4LUZ A;  5C3E H;  1DGS A;  1N34 L;  3OTO L;  1WCM G;  2R6G A;  3ULP A;  1I94 L;  1ASY A;  4DV0 Q;  4BY1 G;  1KRS A;  4JI7 Q;  1N32 Q;  3BJU A;  1PH7 A;  1VQH A;  4IOC A;  5IWA Q;  1L1O B;  2OTJ A;  3S1R H;  4NXM Q;  1IL2 A;  4DV4 L;  4GKK Q;  2RHQ B;  5E7N A;  4BBR G;  4GOP B;  1XNR L;  4JOI A;  2I5L X;  2K4K A;  3UE0 A;  4DV2 Q;  4YHH L;  4XTC S;  3L2P A;  3KJP A;  1XMQ L;  3I4N G;  3S17 H;  1K83 H;  2N3S A;  1VQ9 A;  2D0P A;  4HIM A;  2BH8 A;  3FP9 A;  3HKS A;  5ELN A;  4LFA Q;  4AQY Q;  2MQH A;  1JMC A;  2ZJP A;  1K73 C;  1YIT A;  2UUB L;  2R92 G;  1H95 A;  1HNW L;  4RMF A;  1W2B A;  3L7Z C;  3S1N H;  4OWX B;  1EQR A;  3J7Z C;  4B3S Q;  4LF9 L;  4UP8 A;  3H3V I;  2F52 A;  2RHS B;  4KHP L;  4P73 A;  2KHJ A;  4X66 Q;  2HHH L;  1PH4 A;  3M4O H;  2YTX A;  1B70 B;  3HOX G;  2JQO A;  3D0F A;  3PO2 H;  5IP7 G;  1BBW A;  1C7Y A;  1P8L A;  2IHF A;  4QY7 A;  5FLM G;  1XNR Q;  1OTC A;  3RLF A;  2XGT A;  4JI8 Q;  4IFD I;  3I4O A;  1R9T H;  1IXR A;  4QJF A;  2DUD A;  4R4I A;  4BXX H;  1PHJ A;  5JJK A;  1K0R A;  1YZ6 A;  4XIG S;  2PI2 E;  3TRE A;  3CCV A;  2UUB Q;  3HOW G;  1JJG A;  4BBR H;  4A3C G;  3VDY A;  3TQY A;  1SR3 A;  3G6E A;  4KHP Q;  1A62 A;  1FVI A;  1Q1E A;  2HIV A;  3MXN B;  4X64 L;  4LFB L;  1Z47 A;  4KI0 A;  1Y1V H;  1EYG A;  3NEN A;  3PF5 A;  2E2H H;  2EQS A;  3TEH B;  3CME A;  4DUZ L;  1Y1W H;  2JEA I;  3M3Y H;  3J80 i;  4B3R L;  1GVP A;  5DLQ E;  1NMG A;  3RNU A;  2YV5 A;  4LUO A;  1V9P A;  1HNZ Q;  1RL2 A;  1WYD A;  4JBJ A;  4DV1 L;  1WJJ A;  4DR1 Q;  1VQC A;  1A63 A;  3WWV A;  2VQF L;  3E0E A;  4R4T A;  1Q12 A;  1NBW A;  3S1Q H;  4JI6 Q;  5AJ3 Q;  3T1Y Q;  1VQK A;  2ID0 A;  4UY8 C;  3GTM H;  3K7U C;  3S16 H;  1LYL A;  2KEN A;  4A93 G;  2UXC Q;  1FGU A;  3RZD H;  2VUM H;  3TS0 A;  3JC6 6;  4P75 A;  5BR8 L;  4GOP C;  2NZO A;  1I3Q H;  2Z6K A;  1N36 L;  2JA7 G;  4X65 Q;  4K0K Q;  3HOY G;  4DUZ Q;  1VQ8 A;  4WJ4 A;  5IYC H;  3HOW H;  2JA8 H;  1KC8 C;  1A0I A;  4DV7 L;  3T1H L;  1XMO L;  1NY4 A;  4GNX A;  4IPD A;  3UDG A;  3CC4 A;  1G51 A;  2K14 A;  2WB1 E;  3GDE A;  5FJ8 H;  4AH6 A;  2D0O A;  3JAM i;  1M1K C;  2V1C C;  1VQ7 A;  3M7N A;  2UUC L;  2PNH A;  1K8A C;  3H15 A;  5M3F H;  2N49 A;  2Y0S G;  3F8T A;  1HR0 Q;  4LF6 L;  4NB3 A;  4B3M L;  3KYH C;  1CSP A;  1I5F A;  2UU9 Q;  5IYB G;  4EQ5 A;  2E5L L;  4BY7 G;  1VQO A;  3Q8D A;  5C4J H;  5C4X G;  1E7Z A;  4EX5 A;  4H02 A;  1HZB A;  4A3B G;  4DUY L;  1V1Q A;  2JA6 G;  2XTI A;  1P16 A;  2VW9 A;  1CKN A;  4R4C A;  4P71 A;  5J3B A;  3UE1 A;  5M3M G;  3T1H Q;  1VQP A;  1FL0 A;  4IPG A;  2UUA L;  4A93 H;  4X62 Q;  4DAM A;  4JI3 L;  3CF5 A;  1VQM A;  5LMU L;  3KF6 A;  1Q7Y C;  3PUY A;  1XPU A;  3HOV G;  1K3R A;  2A19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...