3HOVH

Complete rna polymerase ii elongation complex ii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 15
structure length 134
sequence length 145
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hovH00
3W5OA 2UXCQ 4A3LH 1N33Q 1UE5A 3CCMA 1HNWQ 1MKHA 4Y7NH 2PMZE 3CPWA 1VQFA 1SR3A 1FL0A 2AWOA 2QGQA 3J80c 4DV6Q 1IBLQ 1VQ9A 1VQNA 4X65L 2I5LX 2F4VL 4DR1Q 1M1KC 4DV3L 1QVGA 3CQZH 5IWAQ 5C44G 2JA7G 3RLFA 4A3GH 1NMFA 1OXSC 2R7FA 2I5MX 2Y0SG 4DK6C 4A3JH 1YJ9A 2R7ZH 3BZKA 4KHPL 5EAYA 2UU9L 4Y52H 1TWFH 2VUMG 2GVAA 2MO0A 3HOVG 1HNZQ 4BXXH 3K0XA 3RLOA 1SRUA 3HOUH 4OXPA 2Y0SE 1Y1VH 1ASYA 4LUZA 3F2DA 4LUVA 4A3CH 3U4ZA 4DR3Q 1XMQQ 1E1TA 3PUWA 4LF7Q 4BA2I 4A3DH 2L15A 1PH2A 1MJEA 5GAGC 1J5EL 1HNXL 2ZTEA 1EOVA 1VQKA 5JJLA 2FXQA 4YCWA 5LMNL 2OTLA 4C3IH 4P73A 5IYCG 4O2DA 3GTQH 3I4MG 2V1CC 4A3BH 3J7ZC 1VQEA 4A4IA 2UXBQ 1C9OA 2UXDL 4OX9L 2UXCL 1KRSA 2C35B 2KHIA 1VQ7A 1NY4A 4JI6Q 5M3MG 2EQSA 4DR4Q 4DV0Q 4DR6Q 1CKNB 1L1OA 4DV6L 1IBLL 4IJHA 4LF5Q 2EIFA 4UPAA 4OONA 2YV5A 5IYDG 2ZJQA 4A3FG 4DUYL 1OXTA 2HHHQ 3S14H 1L2FA 1A63A 3T1YQ 2K5NA 2JA8H 2XGTA 2JA8G 1IL2A 4KHZA 1G51A 1NE3A 2OQ0A 1YBYA 1Y1WH 5K36G 3G6EA 5JJIA 3UDXA 4X66Q 2K14A 3PGZA 4GOPC 1HNZL 1FJGL 4GOPB 1WCMH 1G291 2YTYA 4HJAA 2MNAA 4B3RQ 1YHAA 1DGSA 1GVPA 2LSSA 5FJ8H 2VY3A 3KOJA 3L7ZC 3OW2A 4TVAB 2A8VA 2JK8A 4IFDI 4JI7Q 1NMGA 1K0RA 3EIVA 2IT1A 1QVCA 4QIWE 3F2CA 1C7YA 2JJQA 3KF8B 3S2DH 2A1AA 3LGJA 4B3TQ 1VQ8A 5IYBH 2VQFQ 1YJWA 1K8GA 4P74A 3S1MH 3A74A 4C2MH 4IO9A 1H95A 4JI4Q 4DR4L 1NTGA 1X3GA 4JI6L 4IPGA 1N8RC 1IYJB 3FP9A 4DR7Q 3HKSA 4C3HH 3ULLA 4GLXA 1PH5A 4IPCA 1FVIA 3S24A 3K8AA 3HOZG 4A3IH 1M90C 2NVQH 3JC66 1KC8C 1PFSA 4BY1G 1YIJA 2ZM6Q 4R4IA 2VQEQ 1BBUA 4AYBG 3KYHC 3T1YL 4JOIC 3I4NH 4L5SA 4WJ4A 1PHJA 4YY3L 1AH9A 1G6PA 4LF6Q 1QUQB 4KI0A 1CUKA 2NZHA 1N9WA 4X66L 3GTKH 3D31A 1PA6A 4BY7G 1SE8A 1E24A 4X65Q 2F4VQ 1OTCA 4AYBE 4DV3Q 3K80C 5GAEC 4XIGS 3TS0A 1K9MC 1CKNA 4HIOA 4FDBA 1J6QA 1OXUA 1TWCH 2NZOA 4POGA 3PF4A 4A3GG 2H5XA 4KHPQ 1L0WA 2UU9Q 2OQKA 3F8TA 1LTLA 2ZTDA 1PH9A 5GADC 3CCSA 1Q82C 2K50A 2PNHA 2NN6I 4JI4L 3ULJA 4LUOA 1EFWA 3GTJH 3M4QA 1K3RA 1SMXA 1S40A 3CC2A 1TWGH 4DR7L 5C3EG 2NVXH 2AHOB 3UE0A 4APVA 4QL5A 4DKAC 4X64L 4GNXC 2R6GA 4A75A 1VQGA 1Y1VG 1SFOH 2IHFA 4GNXB 1C0AA 4GOPA 4A3CG 3ER0A 2UUCQ 1J5EQ 1WI5A 4GKJL 4P72A 1XMOL 1VQ6A 4JBKA 3PO2H 4LF6L 4JBWA 1D8LA 2UXDQ 4OX9Q 3HOXG 1VQPA 2F52A 1WJJA 2CWAA 5JEAJ 1X55A 3GDEA 3CCVA 2JA6H 3PUZA 2Q2TA 3GTPH 5H1SE 1E3PA 2RHQB 1I3QH 3CXCA 4IOCA 3IRBA 3K81C 3NENA 4GLAC 4DUYQ 2LXKA 4YHHL 3PUVA 4IPHA 4A93G 2IY5B 3CCJA 2R92H 4PMWA 4DAMA 3U50C 4JBMA 2HIXA 4UP7A 1GKHA 1EIFA 3AQQA 3J81j 1CSPA 4GS3A 4QJFA 1RL2A 4JG2A 3W1GA 4JI8L 2ASBA 1GO3E 1PYBA 2KENA 4H02A 3S15H 5LMUL 3PF5A 4YWLA 1FJGQ 2ZJRA 3TEHB 2NVTH 4JOIA 5M5WH 1E7ZA 1QUQA 2K75A 2JE6I 3B6YA 3G48A 4J15A 1WOCA 1B8AA 2E8GA 3GD7A 2QEXA 3AEVA 2Q2IA 3PUXA 5FJ8G 4DV1Q 2UUCL 4JYAQ 3PIOA 1VQAA 4TQUS 4A76A 3S1RH 1HZBA 1RIPA 1X54A 1PV4A 4K0KL 4A3MG 5M3FH 2Z0SA 3A5ZB 1W2BA 2ZTCA 3M9BA 4UP9A 5IYBG 1Q1EA 2YU9H 4OWXB 3RZOH 4JBJA 4EQ5A 3M7NA 3CPFA 1KXLA 1JT8A 2JA5H 1X9NA 1YJNA 4AIMA 4A3KH 1YITA 1EYGA 3PSIA 2VNUD 3I55A 1YEZA 1Q86C 3PO3G 2KCMA 2IHEA 3S2HH 2VZAA 4A3IG 1WFQA 5HY6A 3WWVA 4JCVE 4YY3Q 2WFWA 2CCZA 4OO1I 1V1QA 4NXNQ 3HOYH 5C4XH 1K8AC 3CC7A 4HJ7A 4GNXA 1X3EA 1VQHA 1YVCA 1KQSA 3A5UA 4JI1Q 3RN2A 5C4XG 1OXVA 2YTXA 3UE1A 1HJPA 1YNXA 4JI2Q 1XTDA 2JEBI 3D0FA 5C0XJ 1TXYA 3CAMA 1SN8A 2JA7H 3STBD 2BA0A 4JV5L 1JJ2A 2AKWB 1GM5A 4LFBQ 4DV1L 2E2HH 2B63G 1MIUA 3F1ZA 3GTLH 4LF8Q 2VUMH 3GTGH 2PQAB 1VQMA 1UE1A 4YCVA 3GO5A 1PH6A 3MEFA 3ERSX 5GQOA 3W1BA 4A3EH 3G4SA 1N34L 2E5LQ 1V43A 3HKZG 3E9HA 4ALPA 2BH2A 2I0QA 1XNRQ 4DV7L 1VQJA 1XPUA 4P75A 3KFUA 4X64Q 2R93G 3PCOB 5FLMG 4JI0L 2Z6KC 1CKMA 4GKJQ 2D0OA 4DUZL 4LFAL 1E22A 3E0EA 1XMOQ 3OTOL 3HKZE 5C0XG 2K4KA 3I4MH 2E2JH 1BBWA 4NXNL 4LWCA 5IE8A 1KRTA 1VQIA 4DV4Q 2Q2UA 3M85A 1KL9A 2LXJA 3G71A 4JI1L 4POFA 4B3SQ 2F3IA 3Q8DA 2DGYA 4A3LG 1IBKL 4JI2L 1JMCA 5IYDH 4QY7A 4A3FH 3GTOH 3CP0A 3CCRA 5M5XH 4YHHQ 2Q2HA 5IY0A 4DPGA 4LF4L 4LFBL 3UDFA 1KIXA 4ME3A 4LF9L 2EXDA 4OWWB 3KJOA 4DV2Q 4LF8L 2ZJPA 1P16A 1X3FA 4A3JG 2R92G 3H3VH 4JI8Q 2R7ZG 4R4QA 1Q8KA 1X65A 3RR5A 5LMUQ 4JI5Q 5J3BA 3H3VI 1A0IA 4X62L 1XNQQ 2E5LL 1LUZA 1XNRL 3K7AH 1VQBA 1QZGA 4BXXG 2AMCB 5IP7H 2B3GA 1I94Q 4IOAA 4HJ5A 3HOUG 1PH8A 3FKIH 2UUAL 5AJ3L 2NVYH 1JJGA 1I5FA 3F2BA 1KAWA 3ULPA 4A3DG 2N78A 3KDFB 3AFPA 4JI3L 4R4CA 5IP9H 4K0KQ 3S16H 1YHBA 3M4PA 3FHWA 3GTMH 4IPDA 1IZ6A 1R9TH 1VQOA 1YI2A 2UUBQ 4IFDJ 4A3BG 4DV4L 2D0PA 1PH3A 2WAQE 5M5YH 1Q12A 2D62A 4B3SL 1B7YB 2PQAA 1P8LA 4DR5L 4MZ9A 1VQCA 1UEBA 2KBNA 3HOZH 2WB1G 3NELA 1VS0A 4GN4B 3CMEA 3EN2A 4QGUA 4P71A 1Y14B 5GROA 2IX1A 3HOWH 2HIVA 4A3KG 4RMFA 1W3SA 4NXML 3JAMi 2ALYB 4DV2L 1N32Q 4AH6A 2N3SA 1SLJA 5BR8Q 4RG1A 3ICEA 1VCIA 4BBSH 2K5HA 1O7IA 4YCUA 3I56A 2WB1E 4BBRH 2Z6KA 4PZ6A 5IT9c 4JI5L 3KJPA 1S72A 3H0GH 1EUJA 1PH1A 1EIYB 1Y1WG 1XNQL 3CCEA 4PZ8A 1HH2P 1WCMG 4EX5A 4KLKA 2RCNA 1NBWA 3OYYA 4HIKA 1I94L 4JV5Q 1PVOA 1VQLA 1HZCA 2K5VA 4QQBX 1EQRA 3RNUA 5JEAG 1KHIA 2YYZA 4IFDG 4C3JH 3BZCA 1K73C 1A62A 4LFCQ 5E7NA 1JB7A 4UY8C 1V9PA 3JAMc 2MO1A 1MJCA 4L5QA 2UUBL 1ASZA 1N34Q 1PH4A 1IXRA 4B3ML 1HZ9A 5C3EH 4A3EG 4DV7Q 1E1OA 1PH7A 1LYLA 2MQHA 4DK3C 4DNIA 1IBMQ 1LM0A 4DV5L 4L5RC 5C4JH 3CC4A 4JI0Q 3NEMA 4DUZQ 4LFAQ 4JC0A 3DLLA 3I2ZA 3OTOQ 1N36Q 1KD1C 3CCLA 3RLNA 3KLWA 4NB3A 3RN5A 1HZAA 2CFMA 1UE7A 3J81i 1N32L 5BR8L 3I4OA 4YWMA 3HOXH 3I4NG 3MXNB 3U58A 4AQYQ 2OWOA 5JJKA 2N8NA 2AWNA 3KF6B 3KDFA 1QVFA 1CSQA 1Q81C 2RF4A 4O0AA 1IBKQ 1N33L 1HNWL 3PIPA 4HIMA 5C44H 4LNQA 1X6OA 4JYAL 1Q1BA 3UDIA 2GVBA 1Z47A 3U4VA 3CCQA 1T9HA 4DR1L 4DR2Q 1K83H 2R7DA 5IWAL 4LF4Q 3M3YH 2CKZB 4A93H 5ELOA 4LF9Q 1XPOA 2VS1A 4L5TA 2I5HA 2OCEA 2HT1A 4LFCL 4BA1I 3HOVH 1Z9FA 3S1QH 2YTVA 2BA1A 5DLQE 3J81c 2JQOA 2NN6G 4X62Q 2IX0A 1YZ6A 3T1HQ 1HR0W 1B70B 2B29A 2OTJA 3TREA 3TQYA 1EQQA 1IBML 2A19A 3BJUA 3AFQA 2UUAQ 5AJ3Q 3H15A 1NJIC 3SGIA 1GD7A 2WP8J 5IP7G 3L2PA 2VW9A 4DR3L 1XMQL 3EBEA 3FKIG 3CW2C 1N36L 4JI3Q 4LF7L 2BH8A 4WJ3M 5HGQA 5IYCH 4A3MH 3J7A5 1U0LA 3I7FA 1VQ4A 5IP9G 2PI2E 3PO2G 5M3MH 2DUDA 4DAYB 4AQYL 2UXBL 4GN3B 3STBC 4HIDA 1HR0Q 1S3OA 2QA4A 4DV0L 4DR5Q 4DR6L 3K7UC 2JA6G 1BVSA 4LF5L 1PYSB 4DR2L 1SROA 1AE3A 2CWPA 2ES2A 3PO3H 1Q46A 1X56A 4MTNA 5FLXc 2HHHL 4NXMQ 4HJ9A 1A8VA 3TS2A 3HOWG 4GLVB 2N49A 1AE2A 1TWAH 4R1JA 4GKKQ 1I50H 1FGUA 3PUYA 2CQOA 1JE5A 4BBSG 3CMAA 2E2IH 3T1HL 3AYHB 4BBRG 1EWIA 3H0GG 3TRZA 2JA9A 3VDYA 1U5KA 1WYDA 2ID0A 3KF6A 1UE6A 3L0OA 2WAQG 4B3RL 5GAHC 2B63H 3S17H 2MFIA 1OXXK 3S1NH 2ATWA 4MNOA 1CKOA 4JI7L 4NPSA 1L1OC 1XJVA 4X6AH 2VL6A 4HJ8A 5LMNW 1L1OB 3CF5A 1UWVA 4B3TL 4GN5A 4R4OA 2VQFL 3RZDH 1XPRA 5M3FG 4PG3A 3E9IA 3A0JA 4B3MQ 3CD6A 3J80i 1TWHH 3HFZB 1HR0L 2K52A 2XTIA 1Q7YC 2KHJA 1JJCB 3BU2A 1YHQA 4LW1A 1QZHA 1BKBA 4DV5Q 1I6HH 2R93H 2RHSB 1D7QA 1VQ5A 5FLMH 3PV0A 4R4TA 2JA5G 4BY1H 4PZ7A 3ZJYC 2GN5A 2JEAI 4GKKL 2PI2A 3DM3A 3CCUA 4IJLA 1HNXQ 4OO1G 3NBHB 2ZM6L 2VQEL 5C0XI 5LMNQ 3M4OH 3UDGA 4OWTB 2KCTA 4XTCS 4YWKA 1VQDA 5ELNA 4UP8A 3HOYG 2HQLA 4BY7H
chains in the Genus database with same CATH superfamily
2FMMA 3W5OA 1GUOA 4C3IB 1HHVA 1N33Q 1UE5A 1MKHA 3I70A 3QJYA 2PMZE 4NMZA 1VQFA 2AWOA 2I5LX 4DV3L 1QVGA 5IWAQ 1OXSC 2Y0SB 1YJ9A 2L12A 1HXYD 2UU9L 1TWFH 2HCIA 3G6JB 1BCPF 5COYA 2X6LA 3K0XA 2ZXOA 1Y1VH 4LUZA 1Y8PB 3F2DA 1KTKA 4CDCC 3U4ZA 3U9OA 4LF7Q 4JPBW 1PH2A 3OMCA 2RA4A 1D5ZC 2FXQA 1BQQT 3I4MG 4C3IH 5IYCG 4O2DA 2UXBQ 1VQEA 4EGVA 2Q8IB 2C35B 2A6EC 4ODGA 5EGTA 1L1OA 3QIAA 2EYOA 2WINB 3S14H 3PO3B 1A63A 3SEBA 2K1BA 2XGTA 1IL2A 3EVQA 1WTQA 1G51A 1NE3A 2BDOA 2OQ0A 5C4HA 2WACA 2E2IB 2MNAA 1EYDA 2SNMA 5G3LD 3H09A 1DGSA 3VYSA 3OW2A 4TVAB 2A8VA 2B63B 3S17B 4IFDI 4JI7Q 1TU2B 1K0RA 3F2CA 3K5NA 2A1AA 2F0IA 1K8GA 4P74A 4C2MH 1R4PB 4DR4L 1X3GA 2ZT9C 2IWHA 5KNDA 4JI6L 1K8MA 4DR7Q 4DNTB 1QJOA 4GLXA 1LTAD 3HOZG 2CH4W 2QKIC 5FO8B 3JC66 3GV6A 2B8GA 2ZM6Q 4AYBG 4WJ4A 3KYHC 1Q90A 1IYUA 3D4DA 1HPCA 4TRDA 5I9PA 1CUKA 2KQ3A 2NZHA 5ELBA 4X66L 1SMYD 4BY7G 1SE8A 2F4VQ 4X65Q 4KMUC 1W6KA 4N8FA 1ICFB 3TS0A 3SR1A 1EY4A 3FMCA 1M4VA 4FDBA 4A3GB 2NZOA 4KHPQ 1ONLA 1J8IA 5D14A 4A3JB 4RKBA 1PFNA 4DGZA 5JPNC 2PNHA 5C5MA 2NN6I 1FNVA 2NTTA 3ULJA 3M4QA 5IT9L 1SMXA 3CC2A 1SNOA 3NK9A 4A75A 4QL5A 4X64L 1VQGA 1Y1VG 5C0XH 2QEJC 3J81E 1J5EQ 4GKJL 4A3DB 4OGQC 4LF6L 1D8LA 2UXDQ 4OX9Q 3HOXG 1VQPA 4C3IG 4DN4M 2KUMA 1X55A 3CCVA 4DAPA 5H1SE 2RHQB 1I3QH 5A2QL 1LT3D 3I91A 4YHHL 4IPHA 2CH4A 5KRUA 4DA2A 4PMWA 2B2TA 4KTAA 4PMCA 2BE5C 2F0KA 1RL2A 3NWTA 4JI8L 4QCLA 1Y1WB 1KAAA 2VB3X 2BDNA 1FJGQ 1H9KA 4JOIA 4LAAA 5FLXE 3I8ZA 4K5VA 1ENFA 5C5LA 4Q5VA 2F0QA 1KNEA 1U4RA 1EY7A 2E8GA 4ZYSA 3VYUA 4JYAQ 4ZKCB 1X54A 1T5EA 5M3FH 5EKLA 3E3XA 2ZTCA 4HR7B 4EQ5A 4OIJA 1KXLA 1CQFA 4FNFA 3K0YA 2KEEA 2MP1A 4AIMA 5JJZA 4A3KH 1EYGA 1ESRA 3OIQA 1Q86C 3PO3G 4NXNQ 1KLGD 4GNXA 1VQHA 1C4QA 1YVCA 3EQLC 4FXGC 2HD3A 1OXVA 5C0XJ 1XTDA 3GTKB 5C4ZA 4IFDH 3STBD 4JV5L 2K5WA 1GM5A 1PZKD 3SDZA 1LLRD 1A6XA 2DY7A 2B63G 1TWCB 4LF8Q 2VUMH 5IGDA 4YCVA 2XWJB 1AW7A 4ZLTF 1PH6A 1QILA 3G4SA 2HDLA 2PQEA 3HKZG 2I0QA 1LV9A 1VQJA 1S5BD 1SFOB 4R9WA 4L8JA 2D0OA 4J1MA 3OTOL 5C0XG 2J4XA 1JWMD 4LWCA 1PRTF 3LX0A 1KRTA 2JXMB 2A73B 2H1EA 3LWEA 1W6JA 5T1IA 3M85A 4IURA 4B3SQ 2KCNA 2DJFC 3M7GA 1SEBD 4DXGA 1IBKL 2LFNA 4K2KA 2XIWA 3A7AB 4RFBA 5IY0A 4V190 4LFBL 1VMCA 2B2YC 1Y8OB 2F1MA 4L63B 5FO7B 1B9NA 2NN6H 1X3FA 2DN8A 3E5SA 4A3JG 3H3VH 3RR5A 5LMUQ 4KJNA 3BVZA 2E75C 2MHVA 1GHKA 2E5LL 5CV7A 5ELEA 3K7AH 2EXZA 3DHQA 3BYTB 1QZGA 5E4WC 3MXGA 3TSSA 1PH8A 2F0TA 1VDZA 2MPMA 2XWBB 3OWEB 4A3DG 3KDFB 3BDCA 4R4CA 5IP9H 4K0KQ 3FHWA 3OSOA 4KHVA 3GTMH 2F0EA 1YI2A 1RODA 2UUBQ 1D1IA 4K8IA 4IFDJ 1SE3A 2WAQE 5M5YH 1Q12A 2PQAA 3QOLA 4K6LA 3A8JE 1P8LA 3TBIB 4ID6A 4P71A 1Y14B 3HOWH 2HIVA 4A3KG 4XXEA 1W3SA 3S2HB 4DV2L 1N32Q 4AH6A 3VR4A 4YCUA 3I56A 3HOYB 3LWUA 5KEEA 1KABA 3VR6A 1Y1WG 2LY7A 2EDGA 3OIPA 4EX5A 1LT5D 2JA7B 4IFDG 2YYZA 4FF2A 4C3JH 1IKLA 3BZCA 2E2HB 1JB7A 1JC7A 1CA5A 4IUQA 3R2IA 1JB3A 4B3ML 3MXUA 5C3EH 4DV7Q 1PH7A 4DNIA 4DK3C 1IBMQ 1JWUD 1CTMA 1E0BA 1XWEA 5C4JH 2HUGA 3NEMA 1SJHD 4DUZQ 1NAPA 1H9SA 3IFDA 4JC0A 2XN9C 4CJ2C 1N36Q 4RAUC 1UE7A 3A56A 3J81i 5BR8L 2E2JB 2LS01 5JVG3 4AQYQ 3KF6B 1QVFA 1B4OA 2QILA 1LTBD 1CSQA 5E1FA 5M3MB 2KA7A 1HNWL 3PIPA 2FINB 1F9PA 4HCEA 4LNQA 1SXTA 1X6OA 3U4VA 1Z47A 4DR1L 2HCCA 4ZK9B 4LF4Q 2CKZB 4CHTB 5HGTA 1A2TA 5ELOA 2ZXPA 4LF9Q 4CDFC 4L5TA 4QF4A 2OCEA 3HOVH 2YTVA 3J81c 5I6WA 2NN6G 1WTPA 1VF5C 1TS5A 3TDQA 1HR0W 4PNYA 1PFMA 3RUZA 3TREA 2A19A 5AJ3Q 5JVH3 2PZTA 1AFPA 3EBEA 1HQMC 4ZQ3A 4JI3Q 2A6HC 1ZXTA 1E2VA 1VQ4A 3S16B 5IP9G 5M3MH 2DUDA 2FFKB 4DAYB 4GN3B 3STBC 4HIDA 4IQZA 4DR5Q 1ZEQX 4DR6L 3T13A 5KYLA 1K3BC 3R93A 1PYSB 4E6IA 1BXTA 1AE3A 2RVLA 1X56A 5DM73 5FLXc 4HJ9A 3HOWG 4GLVB 1MGSA 1I4PA 3HZXA 1TWAH 4GKKQ 3MC0B 1FGUA 4BBSB 2SNSA 3T1HL 1Q8IA 1EWIA 3TRZA 3VDYA 4LMQD 1RF2D 1HA6A 2MFIA 1OXXK 1MHWC 4MNOA 3PMFA 4OL7A 4CBVA 4NPSA 5G3LF 4C3JG 3O13A 5LMNW 1QG7A 3CF5A 1UWVA 4GN5A 1XX8A 1CK1A 4KN4C 2A69D 4O42A 4PG3A 1EEFD 4MN3A 3HFZB 1HR0L 1BCPC 2K52A 2XTIA 1Q7YC 1YHQA 1BCPB 1JOOA 2RHSB 1D7QA 5FLMH 3PV0A 4R4TA 2SDFA 1RDPD 1E2ZA 4GKKL 2PI2A 1F2MA 3CCUA 3NBHB 4OWTB 3D3RA 3SVMA 5K36G 3VYTA 3HOYG 2CW0C 2F03A 4BY7H 4A3LH 1KLUD 1TQOA 3CPWA 3PIP3 1VQNA 2QGQA 2EJGC 1GXDC 2IL8A 5EKIA 2EJFC 3QG1A 2JA7G 3RLFA 1NSNS 1EQTA 3NP8A 4A93B 3BZKA 2DJGC 4Y52H 3T4AC 1S5FD 5LHY1 2B2VA 1ZYRC 3HOVG 4BXXH 2K01A 3RLOA 1CHPD 1SYCA 3D6WA 3HOUH 4LUVA 4HTHA 1E1TA 3PUWA 3MFYA 1NNXA 3D4WA 3FDTA 1VQKA 2OTLA 4YCWA 5LMNL 3D8GA 4A3MB 2SEBD 1H9RA 4A4IA 1D6EC 2RQXA 2UXCL 4DR4Q 1VQ7A 1CA6A 4JI6Q 5M3MG 4DV0Q 1CKNB 4C1NK 4IUPA 1IBLL 2O4XA 4IJHA 3NXWA 4WORA 4LF5Q 2NB0A 3I3CA 4UPAA 5IYDG 2RDGA 1G6ZA 1L2FA 2NVQB 3KLSA 2K5NA 1II3A 1SNCA 5JJIA 1I50B 4X66Q 2ZXRA 1GUTA 1HNZL 1HUMA 2R61A 1WCMH 2Z6BA 4O1NA 3BDOA 1YNJD 2VY3A 1TR5A 5IT9E 3CRKC 3WOEA 1NMGA 4QIWE 3EIVA 1QVCA 2XSCA 1C7YA 3KF8B 3LGJA 4B3TQ 1IW7D 3MXPA 2F0HA 5IGEA 4IPGA 1N8RC 3FP9A 1WTOA 3HKSA 1TT2A 2R93B 1TWGB 1I6HB 1PH5A 4I7AA 3S24A 4Q0FA 3JAME 2NVQH 4K14A 4AYBB 4R4IA 5CV6A 3T1YL 3I4NH 1G6PA 5D65A 1PHJA 4LF6Q 4LJZC 3T56B 4QUFA 1QUQB 3M4OB 4IUVA 1AN8A 1O80A 1F9QA 5FKAC 5GAEC 4XIGS 3NTHA 4HIOA 3KK7A 4POGA 3PF4A 1A3VA 2H5XA 2FJ2A 2OQKA 1DONA 3F8TA 2R92B 1LTLA 3DEPA 1TWFB 1L0XB 2K50A 1G8ZD 2DNEA 3NE5B 4JI4L 3GTJH 4P2CB 1TWGH 2EY2A 2I46A 3SK8A 1XMOL 2TMPA 3PO2H 3X3MA 2EJMA 2F3VA 4YIJA 2CWAA 1QE6A 3GDEA 2JA6H 5J39A 1MD2D 1ENCA 4DUYQ 2LXKA 4F7XA 3PUVA 4A93G 2IY5B 2R92H 3S14B 4DAMA 3U50C 2PYKA 4H0LC 1S5CD 1XYIA 4QJFA 4JG2A 2ASBA 5C4XB 2KENA 3PF5A 3HGBA 3I4LA 2ZJRA 1K8OA 1MSGA 2NVTH 2Q8RE 5NUCA 4HAEA 2RDHA 2ICEC 2K5QA 2B39A 3T16A 1ESFA 1WOCA 4MIUA 3GD7A 4NW2A 2QEXA 3ND9A 3PUXA 2UUCL 2ICIA 3W3AA 3PIOA 4TQUS 2EYMA 4A76A 1HZBA 4QB4A 1RIPA 1PV4A 2RBMA 4RWSC 4C56C 4A3MG 1WTRA 4C2MB 3CPFA 5ELDA 1JT8A 1SE2A 3ITPA 3I72A 4XDXA 1YITA 3PSIA 2VNUD 4V0BA 3EFXD 1HRJA 2KCMA 4RH6A 1PXUA 1AP0A 4YY3Q 5EBCA 1V1QA 3VA5A 5C4XH 1UNSA 3CC7A 1X3EA 1KQSA 3A5UA 1PRTC 3RN2A 1PRTB 2JEBI 3D0FA 3CAMA 4TSSA 3C1EA 3VR5A 2Z1CA 3NSWA 1JJ2A 5JAVA 4LFBQ 4DV1L 3C1FA 4DXFA 3GTLH 2D2CC 3J80E 1VQMA 3MEFA 3ERSX 1STEA 5DAUA 3HKZB 2E5LQ 2BH2A 3KFUA 1XPUA 4P75A 2R93G 3PCOB 4JI0L 1CKMA 1IL8A 1VF7A 1O78A 1E22A 4KKTA 3NTIA 4ZAIA 2F0GA 2E76C 5C6AA 5IE8A 2M00A 3K5OA 2K5DA 5CC4A 3C3LA 1KL9A 1R9TB 4IN3A 4CJ0B 1WTHA 3Q8DA 1HUNA 4JI2L 1JMCA 1S5DD 4QY7A 4A3FH 1TVXA 3CP0A 3CCRA 5M5XH 2K05A 2O5JC 1I3QB 2VB2X 1V1OA 1RD9D 1SAPA 3UDFA 4ME3A 4F8MA 2EXDA 3KJOA 4DV2Q 1P16A 2R92G 4UHVA 1MBYA 1X65A 5J3BA 3H3VI 1A0IA 1KNAA 4U68A 2SOBA 1I6VC 4RCNA 1XNRL 1UAPA 1A2UA 5CR3A 5IP7H 2UUAL 4QMGA 1JJGA 3F2BA 3PIO3 2N78A 2EYLA 1R9TH 5JPMC 1VQOA 4X3TA 2I07B 1JR0D 4HCSA 5M3FB 5EPKA 1B7YB 1JQYD 4FO2A 1VS0A 4GN4B 2KECA 3X3NA 4DFAA 2BOSA 5GROA 2IX1A 4A3KB 2E74C 4NXML 3JAMi 1G2TA 5BR8Q 2WB1E 4PZ6A 5IT9c 1S72A 4JI5L 4FF4A 5C4XG 1PH1A 1XNQL 3CCEA 1SSOA 1HH2P 4KLKA 3OYYA 1HZCA 1KHIA 1K73C 3IL8A 5E7NA 4UY8C 3JAMc 2VUMB 1N34Q 1PH4A 2B2YA 5ELFA 4DK0A 1TS4A 4S3SA 1LYLA 2IX3A 3BYYB 4BWGB 1JORA 1EZ6A 4DV5L 3EROA 4R8NA 4LFAQ 3DLLA 3G7LA 4NB3A 2PPBC 5I2XA 2AQ2B 3OMGA 3EJIA 3MXNB 3U58A 3FVQA 1HFNA 2K32A 3KDFA 2RF4A 4EQOA 3FRPB 1N33L 1TS2A 3DXJC 4H13C 2OEOA 1Q1BA 2GVBA 1T9HA 3M3YH 4UDUC 1K83H 5IWAL 2MJ8A 1F2YA 3NWSA 4LFCL 2QDLA 3S1QH 2BA1A 5DLQE 1XTCD 3H3VC 3MFGA 1A3TA 2JQOA 1SYEA 4X62Q 1YZ6A 3T1HQ 3IKJA 4QIWB 4ZKBB 2LMCB 2OTJA 3TQYA 3K7AB 3KUPA 1GD7A 3L2PA 5IP7G 1AEXA 2A5HA 1EOTA 4LF7L 2BH8A 1BOSA 2NWGA 1U0LA 1EU3A 3E6ZX 1R4QB 4KY6A 2PI2E 3TP7A 3GTMB 2UXBL 4DK1A 1HR0Q 3RZDB 5M5YB 2QA4A 1IHZA 3K5LA 2Q8TA 4DR2L 2ES2A 4QUCA 1PTOD 3TS2A 2F0MA 3HOWB 4BS9A 2F0UA 4RGOS 2V4DA 5EPLA 3CMAA 3DM1A 2X69A 1EU4A 1U5KA 3KF6A 1SNPA 4K5XA 1WVLA 1PYWD 4RGNA 4EQNA 3OWFA 5GAHC 4ZUIA 3NUCA 1SMYC 4JI7L 4C3JB 1XJVA 4X6AH 5FK9C 1KDAA 3IAYA 1UEAB 1XPRA 3RZDH 3BDLA 5M3FG 3J80i 2OF1A 3SXHA 2J7ZA 4IUNA 2KHJA 3BU2A 5C3EB 2M9VA 1HQRD 1X3QA 3Q0AA 1C8CA 4BY1H 3ZJYC 2PMZB 5C4JB 3TMEA 5CMDA 3DM3A 2BCOA 2G5DA 2ZM6L 2L55A 5LMNQ 1VQDA 1PZJD 3BVGA 2HQLA 2QF7A 2UXCQ 2CQAA 3CCMA 4Y7NH 4N9PA 1VQ9A 3J80c 1IBLQ 2F4VL 4X65L 4DAYA 1M1KC 4RA8A 2L11A 3CQZH 4OHJA 5I2YA 4FP5D 2IPKD 2MUYA 1NMFA 2I5MX 4KHPL 2R7ZH 5EAYA 2L1BA 4IZ8A 2G9HD 2GVAA 2VUMG 2JA8B 3HOVB 4G7HC 2C5CA 1BBXC 2F0VA 1HNZQ 4OXPA 2Y0SE 1ASYA 4DR3Q 1XMQQ 2EZVA 5EKKA 1B9MA 3N52A 1FYCA 2EY5A 4XQJA 1MJEA 1J5EL 1ET9A 3C2PA 2ZTEA 1EOVA 5JJLA 2D5DA 3HG9A 1YNND 4A3BH 2UXDL 4OX9L 1QOHA 1TKWB 1NY4A 3S1MB 5LL6X 2EQSA 3ERQA 3J81L 4DV6L 1CHQD 5A35A 1TY2A 2EIFA 2ZJQA 3UI2A 4FXKC 5FOBB 2HHHQ 2EOTA 4A3IB 3T1YQ 4FF3A 2JA8H 1BO0A 1X3PA 2H4OA 1TWAB 3FPPA 1ICWA 3G6EA 1EZ8A 2K14A 3NBHA 2F0OA 4GOPC 5EPJA 1FJGL 4GOPB 2YTYA 3P20A 3GV3A 1TY0A 4B3RQ 1YHAA 4G4KA 4KKSA 2LSSA 5FJ8H 5JEAH 3L7ZC 1K0SA 3Q22A 2JK8A 4JYAL 3S2DH 2IT1A 5L37A 2JJQA 4OEMB 5FLXL 1VQ8A 5IYBH 2VQFQ 1YJWA 3S1MH 2QDBA 4IO9A 4WRDA 3AU7A 4JI4Q 1NTGA 1MI2A 1IYJB 1D5XC 4C3HH 1FGBD 5FO9B 4I7ZC 3K8AA 4A3IH 1M90C 1EEID 4BY1G 3IFTA 2VQEQ 1EIGA 4L5SA 4KI0A 2KJXA 2PW7A 1N9WA 2QCPX 4ULLA 1E24A 5C3XA 1STYA 4DV3Q 5JOBA 2JYOA 1S4ZA 4FXDA 1CKNA 2EYHA 1PLFA 1L0WA 2UU9Q 2RDFA 5GADC 1NUCA 3CCSA 4HSPA 1GJXA 1WTXA 1QNUA 1U9RA 4CKCA 1S40A 2F0PA 5C3EG 3NQIA 4X3UA 5M5WB 3HOUB 4DKAC 2IHFA 3ER0A 1VMPA 2UUCQ 5EJWA 3OW7A 2AQ1B 1BR9A 4JBKA 1V8QA 1UUPA 1WJJA 3QO2A 4F87A 5JEAJ 5CBAE 3KF8A 2YU9B 3PUZA 2Q2TA 3RZOB 4F88A 2WB1B 4GLAC 4HMJA 5CGKA 3CCJA 4G7OC 3KBGA 3EA6A 1GKHA 1ML0D 3AQQA 4GS3A 3W1GA 2JA8G 1GO3E 1DJRD 2NBFA 5LMUL 2K33A 1ILQA 1F77A 3TEHB 1PTOH 4TKOB 5M5WH 3CRLC 1E7ZA 1QUQA 2K75A 2JE6I 3B6YA 1WCMB 2A6ED 4DV1Q 5FJ8G 3VYRA 4CDEC 3Q23A 3TP8A 4K0KL 2XRQD 2OT2A 1EY5A 4XQQA 3A5ZB 3GTGB 4K5WA 5IYBG 1Q1EA 3F2UA 2YU9H 3RZOH 2B2UC 1V1PB 3M7NA 3AB9A 2JA5H 2GA4B 2PZWA 1QCBD 2PW5A 3A54A 1YJNA 4C3HG 1CT1D 3I55A 2VZAA 4A3IG 3WWVA 4OO1I 4JCVE 2WFWA 2B2WC 1RJTA 3MWYW 3I4NB 5TSSA 4Z9CB 3DEOA 1EQVA 5I4DA 2YTXA 1D1KA 4JI2Q 1TXYA 2ENBA 1QB5D 3M4YA 2AKWB 1FNWA 5J1ZA 1U4LA 3GTGH 1UE1A 2F0JA 2K28A 1NCVA 1TIID 1V43A 1EY8A 4ALPA 1XNRQ 3K6OA 4DV7L 3GTJB 4X64Q 1TS3A 4CDDC 5FLMG 2Z6KC 4GKJQ 2NTSA 4DUZL 3I4MH 1GUWA 2L5TA 5A2QE 2O2LD 2N88A 3PO2B 4K2LA 4FYDA 1B44D 3G71A 4JI1L 3MEHA 4PMBA 2F3IA 2DGYA 4A3LG 2JA6B 1B2TA 4JK1C 4YHHQ 2AQ3B 2B2VC 4DPGA 4LF4L 2JSOA 3DUZA 4DAVA 1KIXA 4LF9L 4G7ZC 4JI8Q 3A8KE 1Q8KA 5IGCA 4JI5Q 2WV6D 1EFID 1XNQQ 1LTTD 1EY6A 1ILPA 2RCFA 4BXXG 2NVTB 2B3GA 2L4NA 2QW7A 4IOAA 3HOUG 2WAQB 5AJ3L 1F2LA 2NVYH 1I5FA 1KAWA 3ULPA 1STNA 3AFPA 4JI3L 3MVVA 1GUSA 1YHBA 2A74C 3M4PA 4IPDA 1IZ6A 2NZ1D 4DF7A 4DV4L 1PH3A 3C46A 3ND8A 3CKIB 2KBNA 4MZ9A 4DR5L 1NR4A 2WB1G 3HOZH 3OHXC 3CMEA 3EN2A 2A69C 4RMFA 4IALA 1SLJA 4PV1C 2Z9HA 1VCIA 1ET6A 2K5HA 1O7IA 2EYFA 3ICEA 4BBRH 1EIYB 2J0TD 3H0GH 2A68D 1PTOF 5IGBA 5I9OA 3K5MA 1I94L 1WCMG 4HIKA 1RTOA 1NBWA 4JV5Q 1PVOA 5C44B 1VQLA 2K5VA 1LTSD 1EQRA 3RNUA 5CV4A 4K6DA 2Z4IA 4LFCQ 1V9PA 3GTLB 3CHBD 1MJCA 3MHBA 1ASZA 1IXRA 1E1OA 1WTWA 2MQHA 1XXGA 1Z6HA 1LM0A 3CC4A 2NUCA 4H44C 4OO1H 5EQ0A 3WOFA 3OTOQ 1KD1C 3CCLA 3HEJA 3KLWA 4KD3A 4ZUJA 4YWMA 3HOXH 3I4NG 1F2ZA 3URYA 2OWOA 5JJKA 1FR3A 1Q81C 5DNFA 4O0AA 1IBKQ 4RGMA 4HIMA 3HRZC 5C44H 4DR2Q 1EWHA 4L6TB 3T51B 3CCQA 4A3FB 2R7DA 5M5XB 5K5PA 1XPOA 3SK5A 4PQXA 3KBXA 2HT1A 4BA1I 2FHTA 3NHHA 2IX0A 4RHSA 3P1HA 1SYBA 2K6AA 4OELB 3BJUA 3NPPA 4B08A 5DEHA 1NJIC 2WP8J 2VW9A 3NTKA 5IIFA 2F0LA 3J7A5 3S1NB 1LABA 3ZYYX 4ABNA 2PCFB 3PO2G 2R3ZA 3KLRA 1YNJC 3SHLA 1S3OA 4DV0L 1LTID 2K04A 4FF1A 4N8X1 2JA6G 4LF5L 1FD7D 3DWQA 1SROA 3PO3H 1IW7C 5CYUA 4MTNA 1A8VA 3P7JA 1Q3LA 3HP3A 4R1JA 4G57A 1JE5A 2E2IH 3AYHB 4BBRG 1H9MA 3H0GG 4CJ1B 3MXNA 2ID0A 3QR8A 4JW0A 5KNBA 1D5MC 1UE6A 2WAQG 3L0OA 2RSOA 4EVOA 2AUKA 2B63H 4XT1B 3S17H 2Z4HA 3S1NH 2Z8LA 1L1OC 1L1OB 2F3WA 4B3TL 2PNRC 4B3MQ 3A0JA 3BS1A 3CD6A 3TN2A 3NQTA 1JJCB 1QZHA 4LW1A 1BKBA 2AUJD 4CKBA 1H9JA 4PZ7A 2JN4A 4OO1G 5D3IB 3RMHA 1D2BA 1STHA 4YWKA 2O5IC 1ENAA 5HURA 3GTQB 1CQVA 4B9WA 2DNCA 3I90A 3JAML 1HNWQ 1SR3A 1FL0A 4DV6Q 2EYJA 1DOKA 4DR1Q 4JVZA 1SYGA 1O7YA 1Z7TA 3TP5A 5C44G 3SK6A 4A3GH 3M3YB 1K83B 2R7FA 2LKVA 3GQBA 4KN7C 4DK6C 2Y0SG 2CHBD 3TZUA 3U9SA 4A3JH 4RCOA 2MO0A 3J7AF 3S1QB 3VR2A 1I4GA 1SRUA 1J9OA 4R8IA 4A3CH 2P5ZX 1PDQA 1DCZA 4BA2I 4A3DH 2L15A 1SYDA 1K28A 5GAGC 2A68C 4CKEA 1HNXL 3GTQH 4P73A 1QWYA 2V1CC 3J7ZC 1C9OA 3MTSA 2PZUA 5BN5A 1KRSA 2KHIA 3A55A 4M1UB 4DR6Q 2KOLA 1STAA 3E0JA 2KCCA 1GOZA 4KKUA 5ELCA 4OONA 2YV5A 4A3FG 1S5ED 1B3QA 3OOCA 4DUYL 1OXTA 1Y8NB 1EYAA 3R3OA 3L3OC 4KHZA 2EY1A 1EY0A 1YBYA 1Y1WH 1KDCA 3UDXA 3PGZA 4C1NI 2A6HD 4EQPA 3NBIA 1G291 4HJAA 5KYIA 2F0SA 1GVPA 1SNMA 2OXPA 1QNKA 3KOJA 1SYFA 2KEDA 2EYPA 2XRSD 5IGFA 4J8QA 4X3KA 3A74A 1H95A 5E3FA 3TP6A 1HFGA 3DMUA 3SK4A 3ULLA 3K59A 2B2TC 1FVIA 4IPCA 4GZYC 2NVXB 4UAIA 1JOKA 4BY1B 1KC8C 3VR3A 1PFSA 1YIJA 1BBUA 1DYQA 1DZ1A 4JOIC 1AH9A 4YY3L 5DM63 1RTNA 1L0YB 2EE1A 4KD4A 4MHEA 3GTKH 2XVSA 3D31A 1PA6A 4H7BA 1NR2A 5KGUA 4Y7NB 5EBDA 5M9OA 1OTCA 4AYBE 3K80C 1K9MC 3GTPB 3CQZB 1BCPD 1J6QA 1OXUA 1TWCH 5D3DA 4A3GG 4I65A 2R7ZB 2ZTDA 1PH9A 5LL6S 1Q82C 1PMRA 3TZDA 3PQIA 1JCKB 4RHRA 4LUOA 1EFWA 3S15B 2N55A 1K3RA 1ZKOA 3J7AV 4DR7L 2NVXH 1OO9B 2AHOB 3UE0A 2CW0D 2FMCA 4APVA 4GNXC 3J80L 1SFOH 2R6GA 1C0AA 4GNXB 1BDOA 4GOPA 4A3CG 1WI5A 4P72A 1VQ6A 1EIHA 2KVMA 2MGSA 4JBWA 1SNDA 3S1RB 5ISRA 1F9RA 3N6RA 3GP7A 2F52A 5BN3A 1BF4A 4A3BB 3FPUB 1SBBB 1WD1A 3P75A 1G2SA 2EVBA 3GTPH 1AZQA 1E3PA 3QB3A 4HSVA 1ZYRD 3CXCA 4IOCA 3IRBA 3K81C 3NENA 3W2DA 4OIKA 1WD0A 1EWCA 3FEWX 2HIXA 4UP7A 4JBMA 1RKNA 1EIFA 3J81j 1CSPA 4FVMA 3S15H 1PYBA 4H02A 1KDBA 4YWLA 1M8AA 2JP1A 2IW3A 3G48A 4J15A 1B8AA 4XT3B 2Q2IA 1VQAA 4WFN3 3S1RH 1G91A 4X3SA 5IGGA 3S2DB 3RD4A 2Z0SA 1W2BA 1LTRD 3M9BA 4UP9A 5J22A 3K58A 3BVMA 1CZWA 4OWXB 4JBJA 4A3EB 1X9NA 3D6CA 3A7LA 5CORA 4C3HB 2F0WA 3R2TA 4DU9A 1F9SA 1YEZA 3DWPA 2IHEA 4ZRZA 3S2HH 1WFQA 5HY6A 2CCZA 5K36H 3HOYH 4J6HA 4HJ7A 1K8AC 1STGA 4IUTA 1CI3M 4JI1Q 4N9TA 3UE1A 1GUGA 1HJPA 1YNXA 1SN8A 3QOJA 2JA7H 4KY5A 2F4IA 2BA0A 3GTOB 5CBEE 1JWSD 2E2HH 1MIUA 3F1ZA 2C9OA 1LACA 1JOQA 2CVRA 3QWNA 2PQAB 3GO5A 3ONAB 3W1BA 5GQOA 4A3EH 1Y69U 1HTPA 3Q24A 1N34L 3E9HA 1B53A 4KV6A 1DD2A 1FNUA 4B9XA 2NYZD 2F0DA 3V96A 2F0FA 3FKIB 4LFAL 1O7LA 3E0EA 1WTVA 1XMOQ 1U4PA 2B8FA 3HKZE 2K4KA 2DY8A 2E2JH 3SE0A 1BBWA 4KJOA 4NXNL 1CFMA 1VQIA 2L0CA 3K57A 4DV4Q 5E4XA 2Q2UA 2LXJA 4POFA 2XNAC 5IYDH 3A8IE 2RKSA 4K8JA 5CV8A 3GTOH 3WDNA 2Q2HA 4IUUA 1V1PA 2B2UA 3H94A 4ME5A 4OWWB 4LF8L 1E2WA 2ZJPA 3BG3A 2R7ZG 4R4QA 3T53B 3H91A 1HCZA 5IOCA 4X62L 1PTOC 1LUZA 2G9DA 1H9SB 2B2WA 4NP5A 1VQBA 1I4QA 1PTOB 2AMCB 4ILWA 1I94Q 4HJ5A 1DOMA 3FKIH 1EL0A 1T5XD 3S16H 5BN4A 4CGYB 4MTKA 4KY7A 3CU7A 4A3BG 1I4RA 2D0PA 3L9AX 2D62A 4B3SL 1RCVD 1LT4D 2IJ0A 1B1ZA 2F0NA 1SJED 1VQCA 1UEBA 3NELA 2JA5B 3MAQA 4QGUA 2WKCA 4NDXA 2ALYB 5F2DA 2N3SA 4RG1A 3V05A 4BBSH 3AEVA 2Z6KA 1JE4A 3KJPA 1EUJA 1IYVA 3H6MA 5IODA 4KK7A 3HS0C 4PZ8A 2RCNA 1A15A 5C3WA 4QQBX 5JEAG 2L9HA 1A62A 2MO1A 4L5QA 1CM9A 2UUBL 1HZ9A 1CZGA 4NKLA 1RHPA 5KNCA 4A3EG 1BNZA 1STBA 4L5RC 1PRTD 4XYQA 4JI0Q 5I6YA 1MSHA 3I2ZA 1JICA 3RLNA 3RN5A 1HZAA 2X6GA 2CFMA 3MZ5A 4HMIA 1N32L 3I4MB 3I4OA 2M2LA 4ZCKA 1PZID 2N8NA 2AWNA 1I4HA 5AFWA 3D4RA 3V2TA 3VA7A 1LO5D 3UDIA 1HA5A 1YNNC 5T1GA 4RGTA 4HEDA 4A93H 3I73A 2VS1A 2I5HA 2HQEA 3R8BA 1C48A 1DOLA 1LTGD 1Z9FA 4WJWA 3LNNA 1DXMA 1O7ZA 1IKMA 1B70B 2B29A 3OPOA 1EQQA 2KHSA 1IBML 1HTLD 3AFQA 2UUAQ 3H15A 3J7YW 3SGIA 1B50A 2EPBA 4DR3L 1XMQL 1DM0B 3FKIG 3CW2C 1N36L 1BUVT 2NVYB 4WJ3M 5HGQA 5IYCH 4A3MH 4U673 5CV5A 2E2DC 2D9UA 3I7FA 1X32A 1SE4A 4AQYL 2HDMA 4HN7A 1TWHB 3K7UC 1LT6D 1BVSA 1AZPA 2VXWA 3AMUA 3HOZB 2CWPA 1Q46A 2HHHL 4NXMQ 3DWAA 2N49A 1AE2A 1I50H 1SNQA 3PUYA 2CQOA 1SDFA 4XQNA 1GHJA 4BBSG 3KLSX 4BBRB 4BY7B 3H0GB 2JA9A 3Q6SA 1WYDA 2EY6A 2K7VA 3BZDB 2RSNA 4B3RL 3S9WA 5KIXA 2ATWA 2TSSA 1CKOA 2VL6A 1EYCA 3MA2B 5CV9A 4HJ8A 4R4OA 2WIIB 2VQFL 3E9IA 1TWHH 1PFBA 1I4XA 2R93H 1I6HH 2BE5D 4M8AA 2WKDA 4DV5Q 1GUNA 1VQ5A 2JA5G 1B3AA 1Y1VB 2GN5A 2PO4A 2JEAI 2K03A 1U4MA 4IJLA 1HNXQ 4DNRB 2VQEL 4RKLA 5C0XI 4XYOA 1EY9A 3UDGA 3M4OH 2KCTA 4XTCS 5ELNA 4UP8A 1A3UA 4LK1C 3HOXB
chains in the Genus database with same CATH topology
3W5OA 2UXCQ 4A3LH 1N33Q 1UE5A 3CCMA 1HNWQ 1MKHA 4Y7NH 2PMZE 3CPWA 1VQFA 1SR3A 1FL0A 2AWOA 2QGQA 3J80c 4DV6Q 1IBLQ 1VQ9A 1VQNA 4X65L 2I5LX 2F4VL 4DR1Q 1M1KC 4DV3L 1QVGA 3CQZH 5IWAQ 5C44G 2JA7G 3RLFA 4A3GH 1NMFA 1OXSC 2R7FA 2I5MX 2Y0SG 4DK6C 4A3JH 1YJ9A 2R7ZH 3BZKA 4KHPL 5EAYA 2UU9L 4Y52H 1TWFH 2VUMG 2GVAA 2MO0A 3HOVG 1HNZQ 4BXXH 3K0XA 3RLOA 1SRUA 3HOUH 4OXPA 2Y0SE 1Y1VH 1ASYA 4LUZA 3F2DA 4LUVA 4A3CH 3U4ZA 4DR3Q 1XMQQ 1E1TA 3PUWA 4LF7Q 4BA2I 4A3DH 2L15A 1PH2A 1MJEA 5GAGC 1J5EL 1HNXL 2ZTEA 1EOVA 1VQKA 5JJLA 2FXQA 4YCWA 5LMNL 2OTLA 4C3IH 4P73A 5IYCG 4O2DA 3GTQH 3I4MG 2V1CC 4A3BH 3J7ZC 1VQEA 4A4IA 2UXBQ 1C9OA 2UXDL 4OX9L 2UXCL 1KRSA 2C35B 2KHIA 1VQ7A 1NY4A 4JI6Q 5M3MG 2EQSA 4DR4Q 4DV0Q 4DR6Q 1CKNB 1L1OA 4DV6L 1IBLL 4IJHA 4LF5Q 2EIFA 4UPAA 4OONA 2YV5A 5IYDG 2ZJQA 4A3FG 4DUYL 1OXTA 2HHHQ 3S14H 1L2FA 1A63A 3T1YQ 2K5NA 2JA8H 2XGTA 2JA8G 1IL2A 4KHZA 1G51A 1NE3A 2OQ0A 1YBYA 1Y1WH 5K36G 3G6EA 5JJIA 3UDXA 4X66Q 2K14A 3PGZA 4GOPC 1HNZL 1FJGL 4GOPB 1WCMH 1G291 2YTYA 4HJAA 2MNAA 4B3RQ 1YHAA 1DGSA 1GVPA 2LSSA 5FJ8H 2VY3A 3KOJA 3L7ZC 3OW2A 4TVAB 2A8VA 2JK8A 4IFDI 4JI7Q 1NMGA 1K0RA 3EIVA 2IT1A 1QVCA 4QIWE 3F2CA 1C7YA 2JJQA 3KF8B 3S2DH 2A1AA 3LGJA 4B3TQ 1VQ8A 5IYBH 2VQFQ 1YJWA 1K8GA 4P74A 3S1MH 3A74A 4C2MH 4IO9A 1H95A 4JI4Q 4DR4L 1NTGA 1X3GA 4JI6L 4IPGA 1N8RC 1IYJB 3FP9A 4DR7Q 3HKSA 4C3HH 3ULLA 4GLXA 1PH5A 4IPCA 1FVIA 3S24A 3K8AA 3HOZG 4A3IH 1M90C 2NVQH 3JC66 1KC8C 1PFSA 4BY1G 1YIJA 2ZM6Q 4R4IA 2VQEQ 1BBUA 4AYBG 3KYHC 3T1YL 4JOIC 3I4NH 4L5SA 4WJ4A 1PHJA 4YY3L 1AH9A 1G6PA 4LF6Q 1QUQB 4KI0A 1CUKA 2NZHA 1N9WA 4X66L 3GTKH 3D31A 1PA6A 4BY7G 1SE8A 1E24A 4X65Q 2F4VQ 1OTCA 4AYBE 4DV3Q 3K80C 5GAEC 4XIGS 3TS0A 1K9MC 1CKNA 4HIOA 4FDBA 1J6QA 1OXUA 1TWCH 2NZOA 4POGA 3PF4A 4A3GG 2H5XA 4KHPQ 1L0WA 2UU9Q 2OQKA 3F8TA 1LTLA 2ZTDA 1PH9A 5GADC 3CCSA 1Q82C 2K50A 2PNHA 2NN6I 4JI4L 3ULJA 4LUOA 1EFWA 3GTJH 3M4QA 1K3RA 1SMXA 1S40A 3CC2A 1TWGH 4DR7L 5C3EG 2NVXH 2AHOB 3UE0A 4APVA 4QL5A 4DKAC 4X64L 4GNXC 2R6GA 4A75A 1VQGA 1Y1VG 1SFOH 2IHFA 4GNXB 1C0AA 4GOPA 4A3CG 3ER0A 2UUCQ 1J5EQ 1WI5A 4GKJL 4P72A 1XMOL 1VQ6A 4JBKA 3PO2H 4LF6L 4JBWA 1D8LA 2UXDQ 4OX9Q 3HOXG 1VQPA 2F52A 1WJJA 2CWAA 5JEAJ 1X55A 3GDEA 3CCVA 2JA6H 3PUZA 2Q2TA 3GTPH 5H1SE 1E3PA 2RHQB 1I3QH 3CXCA 4IOCA 3IRBA 3K81C 3NENA 4GLAC 4DUYQ 2LXKA 4YHHL 3PUVA 4IPHA 4A93G 2IY5B 3CCJA 2R92H 4PMWA 4DAMA 3U50C 4JBMA 2HIXA 4UP7A 1GKHA 1EIFA 3AQQA 3J81j 1CSPA 4GS3A 4QJFA 1RL2A 4JG2A 3W1GA 4JI8L 2ASBA 1GO3E 1PYBA 2KENA 4H02A 3S15H 5LMUL 3PF5A 4YWLA 1FJGQ 2ZJRA 3TEHB 2NVTH 4JOIA 5M5WH 1E7ZA 1QUQA 2K75A 2JE6I 3B6YA 3G48A 4J15A 1WOCA 1B8AA 2E8GA 3GD7A 2QEXA 3AEVA 2Q2IA 3PUXA 5FJ8G 4DV1Q 2UUCL 4JYAQ 3PIOA 1VQAA 4TQUS 4A76A 3S1RH 1HZBA 1RIPA 1X54A 1PV4A 4K0KL 4A3MG 5M3FH 2Z0SA 3A5ZB 1W2BA 2ZTCA 3M9BA 4UP9A 5IYBG 1Q1EA 2YU9H 4OWXB 3RZOH 4JBJA 4EQ5A 3M7NA 3CPFA 1KXLA 1JT8A 2JA5H 1X9NA 1YJNA 4AIMA 4A3KH 1YITA 1EYGA 3PSIA 2VNUD 3I55A 1YEZA 1Q86C 3PO3G 2KCMA 2IHEA 3S2HH 2VZAA 4A3IG 1WFQA 5HY6A 3WWVA 4JCVE 4YY3Q 2WFWA 2CCZA 4OO1I 1V1QA 4NXNQ 3HOYH 5C4XH 1K8AC 3CC7A 4HJ7A 4GNXA 1X3EA 1VQHA 1YVCA 1KQSA 3A5UA 4JI1Q 3RN2A 5C4XG 1OXVA 2YTXA 3UE1A 1HJPA 1YNXA 4JI2Q 1XTDA 2JEBI 3D0FA 5C0XJ 1TXYA 3CAMA 1SN8A 2JA7H 3STBD 2BA0A 4JV5L 1JJ2A 2AKWB 1GM5A 4LFBQ 4DV1L 2E2HH 2B63G 1MIUA 3F1ZA 3GTLH 4LF8Q 2VUMH 3GTGH 2PQAB 1VQMA 1UE1A 4YCVA 3GO5A 1PH6A 3MEFA 3ERSX 5GQOA 3W1BA 4A3EH 3G4SA 1N34L 2E5LQ 1V43A 3HKZG 3E9HA 4ALPA 2BH2A 2I0QA 1XNRQ 4DV7L 1VQJA 1XPUA 4P75A 3KFUA 4X64Q 2R93G 3PCOB 5FLMG 4JI0L 2Z6KC 1CKMA 4GKJQ 2D0OA 4DUZL 4LFAL 1E22A 3E0EA 1XMOQ 3OTOL 3HKZE 5C0XG 2K4KA 3I4MH 2E2JH 1BBWA 4NXNL 4LWCA 5IE8A 1KRTA 1VQIA 4DV4Q 2Q2UA 3M85A 1KL9A 2LXJA 3G71A 4JI1L 4POFA 4B3SQ 2F3IA 3Q8DA 2DGYA 4A3LG 1IBKL 4JI2L 1JMCA 5IYDH 4QY7A 4A3FH 3GTOH 3CP0A 3CCRA 5M5XH 4YHHQ 2Q2HA 5IY0A 4DPGA 4LF4L 4LFBL 3UDFA 1KIXA 4ME3A 4LF9L 2EXDA 4OWWB 3KJOA 4DV2Q 4LF8L 2ZJPA 1P16A 1X3FA 4A3JG 2R92G 3H3VH 4JI8Q 2R7ZG 4R4QA 1Q8KA 1X65A 3RR5A 5LMUQ 4JI5Q 5J3BA 3H3VI 1A0IA 4X62L 1XNQQ 2E5LL 1LUZA 1XNRL 3K7AH 1VQBA 1QZGA 4BXXG 2AMCB 5IP7H 2B3GA 1I94Q 4IOAA 4HJ5A 3HOUG 1PH8A 3FKIH 2UUAL 5AJ3L 2NVYH 1JJGA 1I5FA 3F2BA 1KAWA 3ULPA 4A3DG 2N78A 3KDFB 3AFPA 4JI3L 4R4CA 5IP9H 4K0KQ 3S16H 1YHBA 3M4PA 3FHWA 3GTMH 4IPDA 1IZ6A 1R9TH 1VQOA 1YI2A 2UUBQ 4IFDJ 4A3BG 4DV4L 2D0PA 1PH3A 2WAQE 5M5YH 1Q12A 2D62A 4B3SL 1B7YB 2PQAA 1P8LA 4DR5L 4MZ9A 1VQCA 1UEBA 2KBNA 3HOZH 2WB1G 3NELA 1VS0A 4GN4B 3CMEA 3EN2A 4QGUA 4P71A 1Y14B 5GROA 2IX1A 3HOWH 2HIVA 4A3KG 4RMFA 1W3SA 4NXML 3JAMi 2ALYB 4DV2L 1N32Q 4AH6A 2N3SA 1SLJA 5BR8Q 4RG1A 3ICEA 1VCIA 4BBSH 2K5HA 1O7IA 4YCUA 3I56A 2WB1E 4BBRH 2Z6KA 4PZ6A 5IT9c 4JI5L 3KJPA 1S72A 3H0GH 1EUJA 1PH1A 1EIYB 1Y1WG 1XNQL 3CCEA 4PZ8A 1HH2P 1WCMG 4EX5A 4KLKA 2RCNA 1NBWA 3OYYA 4HIKA 1I94L 4JV5Q 1PVOA 1VQLA 1HZCA 2K5VA 4QQBX 1EQRA 3RNUA 5JEAG 1KHIA 2YYZA 4IFDG 4C3JH 3BZCA 1K73C 1A62A 4LFCQ 5E7NA 1JB7A 4UY8C 1V9PA 3JAMc 2MO1A 1MJCA 4L5QA 2UUBL 1ASZA 1N34Q 1PH4A 1IXRA 4B3ML 1HZ9A 5C3EH 4A3EG 4DV7Q 1E1OA 1PH7A 1LYLA 2MQHA 4DK3C 4DNIA 1IBMQ 1LM0A 4DV5L 4L5RC 5C4JH 3CC4A 4JI0Q 3NEMA 4DUZQ 4LFAQ 4JC0A 3DLLA 3I2ZA 3OTOQ 1N36Q 1KD1C 3CCLA 3RLNA 3KLWA 4NB3A 3RN5A 1HZAA 2CFMA 1UE7A 3J81i 1N32L 5BR8L 3I4OA 4YWMA 3HOXH 3I4NG 3MXNB 3U58A 4AQYQ 2OWOA 5JJKA 2N8NA 2AWNA 3KF6B 3KDFA 1QVFA 1CSQA 1Q81C 2RF4A 4O0AA 1IBKQ 1N33L 1HNWL 3PIPA 4HIMA 5C44H 4LNQA 1X6OA 4JYAL 1Q1BA 3UDIA 2GVBA 1Z47A 3U4VA 3CCQA 1T9HA 4DR1L 4DR2Q 1K83H 2R7DA 5IWAL 4LF4Q 3M3YH 2CKZB 4A93H 5ELOA 4LF9Q 1XPOA 2VS1A 4L5TA 2I5HA 2OCEA 2HT1A 4LFCL 4BA1I 3HOVH 1Z9FA 3S1QH 2YTVA 2BA1A 5DLQE 3J81c 2JQOA 2NN6G 4X62Q 2IX0A 1YZ6A 3T1HQ 1HR0W 1B70B 2B29A 2OTJA 3TREA 3TQYA 1EQQA 1IBML 2A19A 3BJUA 3AFQA 2UUAQ 5AJ3Q 3H15A 1NJIC 3SGIA 1GD7A 2WP8J 5IP7G 3L2PA 2VW9A 4DR3L 1XMQL 3EBEA 3FKIG 3CW2C 1N36L 4JI3Q 4LF7L 2BH8A 4WJ3M 5HGQA 5IYCH 4A3MH 3J7A5 1U0LA 3I7FA 1VQ4A 5IP9G 2PI2E 3PO2G 5M3MH 2DUDA 4DAYB 4AQYL 2UXBL 4GN3B 3STBC 4HIDA 1HR0Q 1S3OA 2QA4A 4DV0L 4DR5Q 4DR6L 3K7UC 2JA6G 1BVSA 4LF5L 1PYSB 4DR2L 1SROA 1AE3A 2CWPA 2ES2A 3PO3H 1Q46A 1X56A 4MTNA 5FLXc 2HHHL 4NXMQ 4HJ9A 1A8VA 3TS2A 3HOWG 4GLVB 2N49A 1AE2A 1TWAH 4R1JA 4GKKQ 1I50H 1FGUA 3PUYA 2CQOA 1JE5A 4BBSG 3CMAA 2E2IH 3T1HL 3AYHB 4BBRG 1EWIA 3H0GG 3TRZA 2JA9A 3VDYA 1U5KA 1WYDA 2ID0A 3KF6A 1UE6A 3L0OA 2WAQG 4B3RL 5GAHC 2B63H 3S17H 2MFIA 1OXXK 3S1NH 2ATWA 4MNOA 1CKOA 4JI7L 4NPSA 1L1OC 1XJVA 4X6AH 2VL6A 4HJ8A 5LMNW 1L1OB 3CF5A 1UWVA 4B3TL 4GN5A 4R4OA 2VQFL 3RZDH 1XPRA 5M3FG 4PG3A 3E9IA 3A0JA 4B3MQ 3CD6A 3J80i 1TWHH 3HFZB 1HR0L 2K52A 2XTIA 1Q7YC 2KHJA 1JJCB 3BU2A 1YHQA 4LW1A 1QZHA 1BKBA 4DV5Q 1I6HH 2R93H 2RHSB 1D7QA 1VQ5A 5FLMH 3PV0A 4R4TA 2JA5G 4BY1H 4PZ7A 3ZJYC 2GN5A 2JEAI 4GKKL 2PI2A 3DM3A 3CCUA 4IJLA 1HNXQ 4OO1G 3NBHB 2ZM6L 2VQEL 5C0XI 5LMNQ 3M4OH 3UDGA 4OWTB 2KCTA 4XTCS 4YWKA 1VQDA 5ELNA 4UP8A 3HOYG 2HQLA 4BY7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5O A;  2UXC Q;  4A3L H;  1N33 Q;  1UE5 A;  3CCM A;  1HNW Q;  1MKH A;  4Y7N H;  2PMZ E;  3CPW A;  1VQF A;  1SR3 A;  1FL0 A;  2AWO A;  2QGQ A;  3J80 c;  4DV6 Q;  1IBL Q;  1VQ9 A;  1VQN A;  4X65 L;  2I5L X;  2F4V L;  4DR1 Q;  1M1K C;  4DV3 L;  1QVG A;  3CQZ H;  5IWA Q;  5C44 G;  2JA7 G;  3RLF A;  4A3G H;  1NMF A;  1OXS C;  2R7F A;  2I5M X;  2Y0S G;  4DK6 C;  4A3J H;  1YJ9 A;  2R7Z H;  3BZK A;  4KHP L;  5EAY A;  2UU9 L;  4Y52 H;  1TWF H;  2VUM G;  2GVA A;  2MO0 A;  3HOV G;  1HNZ Q;  4BXX H;  3K0X A;  3RLO A;  1SRU A;  3HOU H;  4OXP A;  2Y0S E;  1Y1V H;  1ASY A;  4LUZ A;  3F2D A;  4LUV A;  4A3C H;  3U4Z A;  4DR3 Q;  1XMQ Q;  1E1T A;  3PUW A;  4LF7 Q;  4BA2 I;  4A3D H;  2L15 A;  1PH2 A;  1MJE A;  5GAG C;  1J5E L;  1HNX L;  2ZTE A;  1EOV A;  1VQK A;  5JJL A;  2FXQ A;  4YCW A;  5LMN L;  2OTL A;  4C3I H;  4P73 A;  5IYC G;  4O2D A;  3GTQ H;  3I4M G;  2V1C C;  4A3B H;  3J7Z C;  1VQE A;  4A4I A;  2UXB Q;  1C9O A;  2UXD L;  4OX9 L;  2UXC L;  1KRS A;  2C35 B;  2KHI A;  1VQ7 A;  1NY4 A;  4JI6 Q;  5M3M G;  2EQS A;  4DR4 Q;  4DV0 Q;  4DR6 Q;  1CKN B;  1L1O A;  4DV6 L;  1IBL L;  4IJH A;  4LF5 Q;  2EIF A;  4UPA A;  4OON A;  2YV5 A;  5IYD G;  2ZJQ A;  4A3F G;  4DUY L;  1OXT A;  2HHH Q;  3S14 H;  1L2F A;  1A63 A;  3T1Y Q;  2K5N A;  2JA8 H;  2XGT A;  2JA8 G;  1IL2 A;  4KHZ A;  1G51 A;  1NE3 A;  2OQ0 A;  1YBY A;  1Y1W H;  5K36 G;  3G6E A;  5JJI A;  3UDX A;  4X66 Q;  2K14 A;  3PGZ A;  4GOP C;  1HNZ L;  1FJG L;  4GOP B;  1WCM H;  1G29 1;  2YTY A;  4HJA A;  2MNA A;  4B3R Q;  1YHA A;  1DGS A;  1GVP A;  2LSS A;  5FJ8 H;  2VY3 A;  3KOJ A;  3L7Z C;  3OW2 A;  4TVA B;  2A8V A;  2JK8 A;  4IFD I;  4JI7 Q;  1NMG A;  1K0R A;  3EIV A;  2IT1 A;  1QVC A;  4QIW E;  3F2C A;  1C7Y A;  2JJQ A;  3KF8 B;  3S2D H;  2A1A A;  3LGJ A;  4B3T Q;  1VQ8 A;  5IYB H;  2VQF Q;  1YJW A;  1K8G A;  4P74 A;  3S1M H;  3A74 A;  4C2M H;  4IO9 A;  1H95 A;  4JI4 Q;  4DR4 L;  1NTG A;  1X3G A;  4JI6 L;  4IPG A;  1N8R C;  1IYJ B;  3FP9 A;  4DR7 Q;  3HKS A;  4C3H H;  3ULL A;  4GLX A;  1PH5 A;  4IPC A;  1FVI A;  3S24 A;  3K8A A;  3HOZ G;  4A3I H;  1M90 C;  2NVQ H;  3JC6 6;  1KC8 C;  1PFS A;  4BY1 G;  1YIJ A;  2ZM6 Q;  4R4I A;  2VQE Q;  1BBU A;  4AYB G;  3KYH C;  3T1Y L;  4JOI C;  3I4N H;  4L5S A;  4WJ4 A;  1PHJ A;  4YY3 L;  1AH9 A;  1G6P A;  4LF6 Q;  1QUQ B;  4KI0 A;  1CUK A;  2NZH A;  1N9W A;  4X66 L;  3GTK H;  3D31 A;  1PA6 A;  4BY7 G;  1SE8 A;  1E24 A;  4X65 Q;  2F4V Q;  1OTC A;  4AYB E;  4DV3 Q;  3K80 C;  5GAE C;  4XIG S;  3TS0 A;  1K9M C;  1CKN A;  4HIO A;  4FDB A;  1J6Q A;  1OXU A;  1TWC H;  2NZO A;  4POG A;  3PF4 A;  4A3G G;  2H5X A;  4KHP Q;  1L0W A;  2UU9 Q;  2OQK A;  3F8T A;  1LTL A;  2ZTD A;  1PH9 A;  5GAD C;  3CCS A;  1Q82 C;  2K50 A;  2PNH A;  2NN6 I;  4JI4 L;  3ULJ A;  4LUO A;  1EFW A;  3GTJ H;  3M4Q A;  1K3R A;  1SMX A;  1S40 A;  3CC2 A;  1TWG H;  4DR7 L;  5C3E G;  2NVX H;  2AHO B;  3UE0 A;  4APV A;  4QL5 A;  4DKA C;  4X64 L;  4GNX C;  2R6G A;  4A75 A;  1VQG A;  1Y1V G;  1SFO H;  2IHF A;  4GNX B;  1C0A A;  4GOP A;  4A3C G;  3ER0 A;  2UUC Q;  1J5E Q;  1WI5 A;  4GKJ L;  4P72 A;  1XMO L;  1VQ6 A;  4JBK A;  3PO2 H;  4LF6 L;  4JBW A;  1D8L A;  2UXD Q;  4OX9 Q;  3HOX G;  1VQP A;  2F52 A;  1WJJ A;  2CWA A;  5JEA J;  1X55 A;  3GDE A;  3CCV A;  2JA6 H;  3PUZ A;  2Q2T A;  3GTP H;  5H1S E;  1E3P A;  2RHQ B;  1I3Q H;  3CXC A;  4IOC A;  3IRB A;  3K81 C;  3NEN A;  4GLA C;  4DUY Q;  2LXK A;  4YHH L;  3PUV A;  4IPH A;  4A93 G;  2IY5 B;  3CCJ A;  2R92 H;  4PMW A;  4DAM A;  3U50 C;  4JBM A;  2HIX A;  4UP7 A;  1GKH A;  1EIF A;  3AQQ A;  3J81 j;  1CSP A;  4GS3 A;  4QJF A;  1RL2 A;  4JG2 A;  3W1G A;  4JI8 L;  2ASB A;  1GO3 E;  1PYB A;  2KEN A;  4H02 A;  3S15 H;  5LMU L;  3PF5 A;  4YWL A;  1FJG Q;  2ZJR A;  3TEH B;  2NVT H;  4JOI A;  5M5W H;  1E7Z A;  1QUQ A;  2K75 A;  2JE6 I;  3B6Y A;  3G48 A;  4J15 A;  1WOC A;  1B8A A;  2E8G A;  3GD7 A;  2QEX A;  3AEV A;  2Q2I A;  3PUX A;  5FJ8 G;  4DV1 Q;  2UUC L;  4JYA Q;  3PIO A;  1VQA A;  4TQU S;  4A76 A;  3S1R H;  1HZB A;  1RIP A;  1X54 A;  1PV4 A;  4K0K L;  4A3M G;  5M3F H;  2Z0S A;  3A5Z B;  1W2B A;  2ZTC A;  3M9B A;  4UP9 A;  5IYB G;  1Q1E A;  2YU9 H;  4OWX B;  3RZO H;  4JBJ A;  4EQ5 A;  3M7N A;  3CPF A;  1KXL A;  1JT8 A;  2JA5 H;  1X9N A;  1YJN A;  4AIM A;  4A3K H;  1YIT A;  1EYG A;  3PSI A;  2VNU D;  3I55 A;  1YEZ A;  1Q86 C;  3PO3 G;  2KCM A;  2IHE A;  3S2H H;  2VZA A;  4A3I G;  1WFQ A;  5HY6 A;  3WWV A;  4JCV E;  4YY3 Q;  2WFW A;  2CCZ A;  4OO1 I;  1V1Q A;  4NXN Q;  3HOY H;  5C4X H;  1K8A C;  3CC7 A;  4HJ7 A;  4GNX A;  1X3E A;  1VQH A;  1YVC A;  1KQS A;  3A5U A;  4JI1 Q;  3RN2 A;  5C4X G;  1OXV A;  2YTX A;  3UE1 A;  1HJP A;  1YNX A;  4JI2 Q;  1XTD A;  2JEB I;  3D0F A;  5C0X J;  1TXY A;  3CAM A;  1SN8 A;  2JA7 H;  3STB D;  2BA0 A;  4JV5 L;  1JJ2 A;  2AKW B;  1GM5 A;  4LFB Q;  4DV1 L;  2E2H H;  2B63 G;  1MIU A;  3F1Z A;  3GTL H;  4LF8 Q;  2VUM H;  3GTG H;  2PQA B;  1VQM A;  1UE1 A;  4YCV A;  3GO5 A;  1PH6 A;  3MEF A;  3ERS X;  5GQO A;  3W1B A;  4A3E H;  3G4S A;  1N34 L;  2E5L Q;  1V43 A;  3HKZ G;  3E9H A;  4ALP A;  2BH2 A;  2I0Q A;  1XNR Q;  4DV7 L;  1VQJ A;  1XPU A;  4P75 A;  3KFU A;  4X64 Q;  2R93 G;  3PCO B;  5FLM G;  4JI0 L;  2Z6K C;  1CKM A;  4GKJ Q;  2D0O A;  4DUZ L;  4LFA L;  1E22 A;  3E0E A;  1XMO Q;  3OTO L;  3HKZ E;  5C0X G;  2K4K A;  3I4M H;  2E2J H;  1BBW A;  4NXN L;  4LWC A;  5IE8 A;  1KRT A;  1VQI A;  4DV4 Q;  2Q2U A;  3M85 A;  1KL9 A;  2LXJ A;  3G71 A;  4JI1 L;  4POF A;  4B3S Q;  2F3I A;  3Q8D A;  2DGY A;  4A3L G;  1IBK L;  4JI2 L;  1JMC A;  5IYD H;  4QY7 A;  4A3F H;  3GTO H;  3CP0 A;  3CCR A;  5M5X H;  4YHH Q;  2Q2H A;  5IY0 A;  4DPG A;  4LF4 L;  4LFB L;  3UDF A;  1KIX A;  4ME3 A;  4LF9 L;  2EXD A;  4OWW B;  3KJO A;  4DV2 Q;  4LF8 L;  2ZJP A;  1P16 A;  1X3F A;  4A3J G;  2R92 G;  3H3V H;  4JI8 Q;  2R7Z G;  4R4Q A;  1Q8K A;  1X65 A;  3RR5 A;  5LMU Q;  4JI5 Q;  5J3B A;  3H3V I;  1A0I A;  4X62 L;  1XNQ Q;  2E5L L;  1LUZ A;  1XNR L;  3K7A H;  1VQB A;  1QZG A;  4BXX G;  2AMC B;  5IP7 H;  2B3G A;  1I94 Q;  4IOA A;  4HJ5 A;  3HOU G;  1PH8 A;  3FKI H;  2UUA L;  5AJ3 L;  2NVY H;  1JJG A;  1I5F A;  3F2B A;  1KAW A;  3ULP A;  4A3D G;  2N78 A;  3KDF B;  3AFP A;  4JI3 L;  4R4C A;  5IP9 H;  4K0K Q;  3S16 H;  1YHB A;  3M4P A;  3FHW A;  3GTM H;  4IPD A;  1IZ6 A;  1R9T H;  1VQO A;  1YI2 A;  2UUB Q;  4IFD J;  4A3B G;  4DV4 L;  2D0P A;  1PH3 A;  2WAQ E;  5M5Y H;  1Q12 A;  2D62 A;  4B3S L;  1B7Y B;  2PQA A;  1P8L A;  4DR5 L;  4MZ9 A;  1VQC A;  1UEB A;  2KBN A;  3HOZ H;  2WB1 G;  3NEL A;  1VS0 A;  4GN4 B;  3CME A;  3EN2 A;  4QGU A;  4P71 A;  1Y14 B;  5GRO A;  2IX1 A;  3HOW H;  2HIV A;  4A3K G;  4RMF A;  1W3S A;  4NXM L;  3JAM i;  2ALY B;  4DV2 L;  1N32 Q;  4AH6 A;  2N3S A;  1SLJ A;  5BR8 Q;  4RG1 A;  3ICE A;  1VCI A;  4BBS H;  2K5H A;  1O7I A;  4YCU A;  3I56 A;  2WB1 E;  4BBR H;  2Z6K A;  4PZ6 A;  5IT9 c;  4JI5 L;  3KJP A;  1S72 A;  3H0G H;  1EUJ A;  1PH1 A;  1EIY B;  1Y1W G;  1XNQ L;  3CCE A;  4PZ8 A;  1HH2 P;  1WCM G;  4EX5 A;  4KLK A;  2RCN A;  1NBW A;  3OYY A;  4HIK A;  1I94 L;  4JV5 Q;  1PVO A;  1VQL A;  1HZC A;  2K5V A;  4QQB X;  1EQR A;  3RNU A;  5JEA G;  1KHI A;  2YYZ A;  4IFD G;  4C3J H;  3BZC A;  1K73 C;  1A62 A;  4LFC Q;  5E7N A;  1JB7 A;  4UY8 C;  1V9P A;  3JAM c;  2MO1 A;  1MJC A;  4L5Q A;  2UUB L;  1ASZ A;  1N34 Q;  1PH4 A;  1IXR A;  4B3M L;  1HZ9 A;  5C3E H;  4A3E G;  4DV7 Q;  1E1O A;  1PH7 A;  1LYL A;  2MQH A;  4DK3 C;  4DNI A;  1IBM Q;  1LM0 A;  4DV5 L;  4L5R C;  5C4J H;  3CC4 A;  4JI0 Q;  3NEM A;  4DUZ Q;  4LFA Q;  4JC0 A;  3DLL A;  3I2Z A;  3OTO Q;  1N36 Q;  1KD1 C;  3CCL A;  3RLN A;  3KLW A;  4NB3 A;  3RN5 A;  1HZA A;  2CFM A;  1UE7 A;  3J81 i;  1N32 L;  5BR8 L;  3I4O A;  4YWM A;  3HOX H;  3I4N G;  3MXN B;  3U58 A;  4AQY Q;  2OWO A;  5JJK A;  2N8N A;  2AWN A;  3KF6 B;  3KDF A;  1QVF A;  1CSQ A;  1Q81 C;  2RF4 A;  4O0A A;  1IBK Q;  1N33 L;  1HNW L;  3PIP A;  4HIM A;  5C44 H;  4LNQ A;  1X6O A;  4JYA L;  1Q1B A;  3UDI A;  2GVB A;  1Z47 A;  3U4V A;  3CCQ A;  1T9H A;  4DR1 L;  4DR2 Q;  1K83 H;  2R7D A;  5IWA L;  4LF4 Q;  3M3Y H;  2CKZ B;  4A93 H;  5ELO A;  4LF9 Q;  1XPO A;  2VS1 A;  4L5T A;  2I5H A;  2OCE A;  2HT1 A;  4LFC L;  4BA1 I;  3HOV H;  1Z9F A;  3S1Q H;  2YTV A;  2BA1 A;  5DLQ E;  3J81 c;  2JQO A;  2NN6 G;  4X62 Q;  2IX0 A;  1YZ6 A;  3T1H Q;  1HR0 W;  1B70 B;  2B29 A;  2OTJ A;  3TRE A;  3TQY A;  1EQQ A;  1IBM L;  2A19 A;  3BJU A;  3AFQ A;  2UUA Q;  5AJ3 Q;  3H15 A;  1NJI C;  3SGI A;  1GD7 A;  2WP8 J;  5IP7 G;  3L2P A;  2VW9 A;  4DR3 L;  1XMQ L;  3EBE A;  3FKI G;  3CW2 C;  1N36 L;  4JI3 Q;  4LF7 L;  2BH8 A;  4WJ3 M;  5HGQ A;  5IYC H;  4A3M H;  3J7A 5;  1U0L A;  3I7F A;  1VQ4 A;  5IP9 G;  2PI2 E;  3PO2 G;  5M3M H;  2DUD A;  4DAY B;  4AQY L;  2UXB L;  4GN3 B;  3STB C;  4HID A;  1HR0 Q;  1S3O A;  2QA4 A;  4DV0 L;  4DR5 Q;  4DR6 L;  3K7U C;  2JA6 G;  1BVS A;  4LF5 L;  1PYS B;  4DR2 L;  1SRO A;  1AE3 A;  2CWP A;  2ES2 A;  3PO3 H;  1Q46 A;  1X56 A;  4MTN A;  5FLX c;  2HHH L;  4NXM Q;  4HJ9 A;  1A8V A;  3TS2 A;  3HOW G;  4GLV B;  2N49 A;  1AE2 A;  1TWA H;  4R1J A;  4GKK Q;  1I50 H;  1FGU A;  3PUY A;  2CQO A;  1JE5 A;  4BBS G;  3CMA A;  2E2I H;  3T1H L;  3AYH B;  4BBR G;  1EWI A;  3H0G G;  3TRZ A;  2JA9 A;  3VDY A;  1U5K A;  1WYD A;  2ID0 A;  3KF6 A;  1UE6 A;  3L0O A;  2WAQ G;  4B3R L;  5GAH C;  2B63 H;  3S17 H;  2MFI A;  1OXX K;  3S1N H;  2ATW A;  4MNO A;  1CKO A;  4JI7 L;  4NPS A;  1L1O C;  1XJV A;  4X6A H;  2VL6 A;  4HJ8 A;  5LMN W;  1L1O B;  3CF5 A;  1UWV A;  4B3T L;  4GN5 A;  4R4O A;  2VQF L;  3RZD H;  1XPR A;  5M3F G;  4PG3 A;  3E9I A;  3A0J A;  4B3M Q;  3CD6 A;  3J80 i;  1TWH H;  3HFZ B;  1HR0 L;  2K52 A;  2XTI A;  1Q7Y C;  2KHJ A;  1JJC B;  3BU2 A;  1YHQ A;  4LW1 A;  1QZH A;  1BKB A;  4DV5 Q;  1I6H H;  2R93 H;  2RHS B;  1D7Q A;  1VQ5 A;  5FLM H;  3PV0 A;  4R4T A;  2JA5 G;  4BY1 H;  4PZ7 A;  3ZJY C;  2GN5 A;  2JEA I;  4GKK L;  2PI2 A;  3DM3 A;  3CCU A;  4IJL A;  1HNX Q;  4OO1 G;  3NBH B;  2ZM6 L;  2VQE L;  5C0X I;  5LMN Q;  3M4O H;  3UDG A;  4OWT B;  2KCT A;  4XTC S;  4YWK A;  1VQD A;  5ELN A;  4UP8 A;  3HOY G;  2HQL A;  4BY7 H; 
#chains in the Genus database with same CATH topology
 2FMM A;  3W5O A;  1GUO A;  4C3I B;  1HHV A;  1N33 Q;  1UE5 A;  1MKH A;  3I70 A;  3QJY A;  2PMZ E;  4NMZ A;  1VQF A;  2AWO A;  2I5L X;  4DV3 L;  1QVG A;  5IWA Q;  1OXS C;  2Y0S B;  1YJ9 A;  2L12 A;  1HXY D;  2UU9 L;  1TWF H;  2HCI A;  3G6J B;  1BCP F;  5COY A;  2X6L A;  3K0X A;  2ZXO A;  1Y1V H;  4LUZ A;  1Y8P B;  3F2D A;  1KTK A;  4CDC C;  3U4Z A;  3U9O A;  4LF7 Q;  4JPB W;  1PH2 A;  3OMC A;  2RA4 A;  1D5Z C;  2FXQ A;  1BQQ T;  3I4M G;  4C3I H;  5IYC G;  4O2D A;  2UXB Q;  1VQE A;  4EGV A;  2Q8I B;  2C35 B;  2A6E C;  4ODG A;  5EGT A;  1L1O A;  3QIA A;  2EYO A;  2WIN B;  3S14 H;  3PO3 B;  1A63 A;  3SEB A;  2K1B A;  2XGT A;  1IL2 A;  3EVQ A;  1WTQ A;  1G51 A;  1NE3 A;  2BDO A;  2OQ0 A;  5C4H A;  2WAC A;  2E2I B;  2MNA A;  1EYD A;  2SNM A;  5G3L D;  3H09 A;  1DGS A;  3VYS A;  3OW2 A;  4TVA B;  2A8V A;  2B63 B;  3S17 B;  4IFD I;  4JI7 Q;  1TU2 B;  1K0R A;  3F2C A;  3K5N A;  2A1A A;  2F0I A;  1K8G A;  4P74 A;  4C2M H;  1R4P B;  4DR4 L;  1X3G A;  2ZT9 C;  2IWH A;  5KND A;  4JI6 L;  1K8M A;  4DR7 Q;  4DNT B;  1QJO A;  4GLX A;  1LTA D;  3HOZ G;  2CH4 W;  2QKI C;  5FO8 B;  3JC6 6;  3GV6 A;  2B8G A;  2ZM6 Q;  4AYB G;  4WJ4 A;  3KYH C;  1Q90 A;  1IYU A;  3D4D A;  1HPC A;  4TRD A;  5I9P A;  1CUK A;  2KQ3 A;  2NZH A;  5ELB A;  4X66 L;  1SMY D;  4BY7 G;  1SE8 A;  2F4V Q;  4X65 Q;  4KMU C;  1W6K A;  4N8F A;  1ICF B;  3TS0 A;  3SR1 A;  1EY4 A;  3FMC A;  1M4V A;  4FDB A;  4A3G B;  2NZO A;  4KHP Q;  1ONL A;  1J8I A;  5D14 A;  4A3J B;  4RKB A;  1PFN A;  4DGZ A;  5JPN C;  2PNH A;  5C5M A;  2NN6 I;  1FNV A;  2NTT A;  3ULJ A;  3M4Q A;  5IT9 L;  1SMX A;  3CC2 A;  1SNO A;  3NK9 A;  4A75 A;  4QL5 A;  4X64 L;  1VQG A;  1Y1V G;  5C0X H;  2QEJ C;  3J81 E;  1J5E Q;  4GKJ L;  4A3D B;  4OGQ C;  4LF6 L;  1D8L A;  2UXD Q;  4OX9 Q;  3HOX G;  1VQP A;  4C3I G;  4DN4 M;  2KUM A;  1X55 A;  3CCV A;  4DAP A;  5H1S E;  2RHQ B;  1I3Q H;  5A2Q L;  1LT3 D;  3I91 A;  4YHH L;  4IPH A;  2CH4 A;  5KRU A;  4DA2 A;  4PMW A;  2B2T A;  4KTA A;  4PMC A;  2BE5 C;  2F0K A;  1RL2 A;  3NWT A;  4JI8 L;  4QCL A;  1Y1W B;  1KAA A;  2VB3 X;  2BDN A;  1FJG Q;  1H9K A;  4JOI A;  4LAA A;  5FLX E;  3I8Z A;  4K5V A;  1ENF A;  5C5L A;  4Q5V A;  2F0Q A;  1KNE A;  1U4R A;  1EY7 A;  2E8G A;  4ZYS A;  3VYU A;  4JYA Q;  4ZKC B;  1X54 A;  1T5E A;  5M3F H;  5EKL A;  3E3X A;  2ZTC A;  4HR7 B;  4EQ5 A;  4OIJ A;  1KXL A;  1CQF A;  4FNF A;  3K0Y A;  2KEE A;  2MP1 A;  4AIM A;  5JJZ A;  4A3K H;  1EYG A;  1ESR A;  3OIQ A;  1Q86 C;  3PO3 G;  4NXN Q;  1KLG D;  4GNX A;  1VQH A;  1C4Q A;  1YVC A;  3EQL C;  4FXG C;  2HD3 A;  1OXV A;  5C0X J;  1XTD A;  3GTK B;  5C4Z A;  4IFD H;  3STB D;  4JV5 L;  2K5W A;  1GM5 A;  1PZK D;  3SDZ A;  1LLR D;  1A6X A;  2DY7 A;  2B63 G;  1TWC B;  4LF8 Q;  2VUM H;  5IGD A;  4YCV A;  2XWJ B;  1AW7 A;  4ZLT F;  1PH6 A;  1QIL A;  3G4S A;  2HDL A;  2PQE A;  3HKZ G;  2I0Q A;  1LV9 A;  1VQJ A;  1S5B D;  1SFO B;  4R9W A;  4L8J A;  2D0O A;  4J1M A;  3OTO L;  5C0X G;  2J4X A;  1JWM D;  4LWC A;  1PRT F;  3LX0 A;  1KRT A;  2JXM B;  2A73 B;  2H1E A;  3LWE A;  1W6J A;  5T1I A;  3M85 A;  4IUR A;  4B3S Q;  2KCN A;  2DJF C;  3M7G A;  1SEB D;  4DXG A;  1IBK L;  2LFN A;  4K2K A;  2XIW A;  3A7A B;  4RFB A;  5IY0 A;  4V19 0;  4LFB L;  1VMC A;  2B2Y C;  1Y8O B;  2F1M A;  4L63 B;  5FO7 B;  1B9N A;  2NN6 H;  1X3F A;  2DN8 A;  3E5S A;  4A3J G;  3H3V H;  3RR5 A;  5LMU Q;  4KJN A;  3BVZ A;  2E75 C;  2MHV A;  1GHK A;  2E5L L;  5CV7 A;  5ELE A;  3K7A H;  2EXZ A;  3DHQ A;  3BYT B;  1QZG A;  5E4W C;  3MXG A;  3TSS A;  1PH8 A;  2F0T A;  1VDZ A;  2MPM A;  2XWB B;  3OWE B;  4A3D G;  3KDF B;  3BDC A;  4R4C A;  5IP9 H;  4K0K Q;  3FHW A;  3OSO A;  4KHV A;  3GTM H;  2F0E A;  1YI2 A;  1ROD A;  2UUB Q;  1D1I A;  4K8I A;  4IFD J;  1SE3 A;  2WAQ E;  5M5Y H;  1Q12 A;  2PQA A;  3QOL A;  4K6L A;  3A8J E;  1P8L A;  3TBI B;  4ID6 A;  4P71 A;  1Y14 B;  3HOW H;  2HIV A;  4A3K G;  4XXE A;  1W3S A;  3S2H B;  4DV2 L;  1N32 Q;  4AH6 A;  3VR4 A;  4YCU A;  3I56 A;  3HOY B;  3LWU A;  5KEE A;  1KAB A;  3VR6 A;  1Y1W G;  2LY7 A;  2EDG A;  3OIP A;  4EX5 A;  1LT5 D;  2JA7 B;  4IFD G;  2YYZ A;  4FF2 A;  4C3J H;  1IKL A;  3BZC A;  2E2H B;  1JB7 A;  1JC7 A;  1CA5 A;  4IUQ A;  3R2I A;  1JB3 A;  4B3M L;  3MXU A;  5C3E H;  4DV7 Q;  1PH7 A;  4DNI A;  4DK3 C;  1IBM Q;  1JWU D;  1CTM A;  1E0B A;  1XWE A;  5C4J H;  2HUG A;  3NEM A;  1SJH D;  4DUZ Q;  1NAP A;  1H9S A;  3IFD A;  4JC0 A;  2XN9 C;  4CJ2 C;  1N36 Q;  4RAU C;  1UE7 A;  3A56 A;  3J81 i;  5BR8 L;  2E2J B;  2LS0 1;  5JVG 3;  4AQY Q;  3KF6 B;  1QVF A;  1B4O A;  2QIL A;  1LTB D;  1CSQ A;  5E1F A;  5M3M B;  2KA7 A;  1HNW L;  3PIP A;  2FIN B;  1F9P A;  4HCE A;  4LNQ A;  1SXT A;  1X6O A;  3U4V A;  1Z47 A;  4DR1 L;  2HCC A;  4ZK9 B;  4LF4 Q;  2CKZ B;  4CHT B;  5HGT A;  1A2T A;  5ELO A;  2ZXP A;  4LF9 Q;  4CDF C;  4L5T A;  4QF4 A;  2OCE A;  3HOV H;  2YTV A;  3J81 c;  5I6W A;  2NN6 G;  1WTP A;  1VF5 C;  1TS5 A;  3TDQ A;  1HR0 W;  4PNY A;  1PFM A;  3RUZ A;  3TRE A;  2A19 A;  5AJ3 Q;  5JVH 3;  2PZT A;  1AFP A;  3EBE A;  1HQM C;  4ZQ3 A;  4JI3 Q;  2A6H C;  1ZXT A;  1E2V A;  1VQ4 A;  3S16 B;  5IP9 G;  5M3M H;  2DUD A;  2FFK B;  4DAY B;  4GN3 B;  3STB C;  4HID A;  4IQZ A;  4DR5 Q;  1ZEQ X;  4DR6 L;  3T13 A;  5KYL A;  1K3B C;  3R93 A;  1PYS B;  4E6I A;  1BXT A;  1AE3 A;  2RVL A;  1X56 A;  5DM7 3;  5FLX c;  4HJ9 A;  3HOW G;  4GLV B;  1MGS A;  1I4P A;  3HZX A;  1TWA H;  4GKK Q;  3MC0 B;  1FGU A;  4BBS B;  2SNS A;  3T1H L;  1Q8I A;  1EWI A;  3TRZ A;  3VDY A;  4LMQ D;  1RF2 D;  1HA6 A;  2MFI A;  1OXX K;  1MHW C;  4MNO A;  3PMF A;  4OL7 A;  4CBV A;  4NPS A;  5G3L F;  4C3J G;  3O13 A;  5LMN W;  1QG7 A;  3CF5 A;  1UWV A;  4GN5 A;  1XX8 A;  1CK1 A;  4KN4 C;  2A69 D;  4O42 A;  4PG3 A;  1EEF D;  4MN3 A;  3HFZ B;  1HR0 L;  1BCP C;  2K52 A;  2XTI A;  1Q7Y C;  1YHQ A;  1BCP B;  1JOO A;  2RHS B;  1D7Q A;  5FLM H;  3PV0 A;  4R4T A;  2SDF A;  1RDP D;  1E2Z A;  4GKK L;  2PI2 A;  1F2M A;  3CCU A;  3NBH B;  4OWT B;  3D3R A;  3SVM A;  5K36 G;  3VYT A;  3HOY G;  2CW0 C;  2F03 A;  4BY7 H;  4A3L H;  1KLU D;  1TQO A;  3CPW A;  3PIP 3;  1VQN A;  2QGQ A;  2EJG C;  1GXD C;  2IL8 A;  5EKI A;  2EJF C;  3QG1 A;  2JA7 G;  3RLF A;  1NSN S;  1EQT A;  3NP8 A;  4A93 B;  3BZK A;  2DJG C;  4Y52 H;  3T4A C;  1S5F D;  5LHY 1;  2B2V A;  1ZYR C;  3HOV G;  4BXX H;  2K01 A;  3RLO A;  1CHP D;  1SYC A;  3D6W A;  3HOU H;  4LUV A;  4HTH A;  1E1T A;  3PUW A;  3MFY A;  1NNX A;  3D4W A;  3FDT A;  1VQK A;  2OTL A;  4YCW A;  5LMN L;  3D8G A;  4A3M B;  2SEB D;  1H9R A;  4A4I A;  1D6E C;  2RQX A;  2UXC L;  4DR4 Q;  1VQ7 A;  1CA6 A;  4JI6 Q;  5M3M G;  4DV0 Q;  1CKN B;  4C1N K;  4IUP A;  1IBL L;  2O4X A;  4IJH A;  3NXW A;  4WOR A;  4LF5 Q;  2NB0 A;  3I3C A;  4UPA A;  5IYD G;  2RDG A;  1G6Z A;  1L2F A;  2NVQ B;  3KLS A;  2K5N A;  1II3 A;  1SNC A;  5JJI A;  1I50 B;  4X66 Q;  2ZXR A;  1GUT A;  1HNZ L;  1HUM A;  2R61 A;  1WCM H;  2Z6B A;  4O1N A;  3BDO A;  1YNJ D;  2VY3 A;  1TR5 A;  5IT9 E;  3CRK C;  3WOE A;  1NMG A;  4QIW E;  3EIV A;  1QVC A;  2XSC A;  1C7Y A;  3KF8 B;  3LGJ A;  4B3T Q;  1IW7 D;  3MXP A;  2F0H A;  5IGE A;  4IPG A;  1N8R C;  3FP9 A;  1WTO A;  3HKS A;  1TT2 A;  2R93 B;  1TWG B;  1I6H B;  1PH5 A;  4I7A A;  3S24 A;  4Q0F A;  3JAM E;  2NVQ H;  4K14 A;  4AYB B;  4R4I A;  5CV6 A;  3T1Y L;  3I4N H;  1G6P A;  5D65 A;  1PHJ A;  4LF6 Q;  4LJZ C;  3T56 B;  4QUF A;  1QUQ B;  3M4O B;  4IUV A;  1AN8 A;  1O80 A;  1F9Q A;  5FKA C;  5GAE C;  4XIG S;  3NTH A;  4HIO A;  3KK7 A;  4POG A;  3PF4 A;  1A3V A;  2H5X A;  2FJ2 A;  2OQK A;  1DON A;  3F8T A;  2R92 B;  1LTL A;  3DEP A;  1TWF B;  1L0X B;  2K50 A;  1G8Z D;  2DNE A;  3NE5 B;  4JI4 L;  3GTJ H;  4P2C B;  1TWG H;  2EY2 A;  2I46 A;  3SK8 A;  1XMO L;  2TMP A;  3PO2 H;  3X3M A;  2EJM A;  2F3V A;  4YIJ A;  2CWA A;  1QE6 A;  3GDE A;  2JA6 H;  5J39 A;  1MD2 D;  1ENC A;  4DUY Q;  2LXK A;  4F7X A;  3PUV A;  4A93 G;  2IY5 B;  2R92 H;  3S14 B;  4DAM A;  3U50 C;  2PYK A;  4H0L C;  1S5C D;  1XYI A;  4QJF A;  4JG2 A;  2ASB A;  5C4X B;  2KEN A;  3PF5 A;  3HGB A;  3I4L A;  2ZJR A;  1K8O A;  1MSG A;  2NVT H;  2Q8R E;  5NUC A;  4HAE A;  2RDH A;  2ICE C;  2K5Q A;  2B39 A;  3T16 A;  1ESF A;  1WOC A;  4MIU A;  3GD7 A;  4NW2 A;  2QEX A;  3ND9 A;  3PUX A;  2UUC L;  2ICI A;  3W3A A;  3PIO A;  4TQU S;  2EYM A;  4A76 A;  1HZB A;  4QB4 A;  1RIP A;  1PV4 A;  2RBM A;  4RWS C;  4C56 C;  4A3M G;  1WTR A;  4C2M B;  3CPF A;  5ELD A;  1JT8 A;  1SE2 A;  3ITP A;  3I72 A;  4XDX A;  1YIT A;  3PSI A;  2VNU D;  4V0B A;  3EFX D;  1HRJ A;  2KCM A;  4RH6 A;  1PXU A;  1AP0 A;  4YY3 Q;  5EBC A;  1V1Q A;  3VA5 A;  5C4X H;  1UNS A;  3CC7 A;  1X3E A;  1KQS A;  3A5U A;  1PRT C;  3RN2 A;  1PRT B;  2JEB I;  3D0F A;  3CAM A;  4TSS A;  3C1E A;  3VR5 A;  2Z1C A;  3NSW A;  1JJ2 A;  5JAV A;  4LFB Q;  4DV1 L;  3C1F A;  4DXF A;  3GTL H;  2D2C C;  3J80 E;  1VQM A;  3MEF A;  3ERS X;  1STE A;  5DAU A;  3HKZ B;  2E5L Q;  2BH2 A;  3KFU A;  1XPU A;  4P75 A;  2R93 G;  3PCO B;  4JI0 L;  1CKM A;  1IL8 A;  1VF7 A;  1O78 A;  1E22 A;  4KKT A;  3NTI A;  4ZAI A;  2F0G A;  2E76 C;  5C6A A;  5IE8 A;  2M00 A;  3K5O A;  2K5D A;  5CC4 A;  3C3L A;  1KL9 A;  1R9T B;  4IN3 A;  4CJ0 B;  1WTH A;  3Q8D A;  1HUN A;  4JI2 L;  1JMC A;  1S5D D;  4QY7 A;  4A3F H;  1TVX A;  3CP0 A;  3CCR A;  5M5X H;  2K05 A;  2O5J C;  1I3Q B;  2VB2 X;  1V1O A;  1RD9 D;  1SAP A;  3UDF A;  4ME3 A;  4F8M A;  2EXD A;  3KJO A;  4DV2 Q;  1P16 A;  2R92 G;  4UHV A;  1MBY A;  1X65 A;  5J3B A;  3H3V I;  1A0I A;  1KNA A;  4U68 A;  2SOB A;  1I6V C;  4RCN A;  1XNR L;  1UAP A;  1A2U A;  5CR3 A;  5IP7 H;  2UUA L;  4QMG A;  1JJG A;  3F2B A;  3PIO 3;  2N78 A;  2EYL A;  1R9T H;  5JPM C;  1VQO A;  4X3T A;  2I07 B;  1JR0 D;  4HCS A;  5M3F B;  5EPK A;  1B7Y B;  1JQY D;  4FO2 A;  1VS0 A;  4GN4 B;  2KEC A;  3X3N A;  4DFA A;  2BOS A;  5GRO A;  2IX1 A;  4A3K B;  2E74 C;  4NXM L;  3JAM i;  1G2T A;  5BR8 Q;  2WB1 E;  4PZ6 A;  5IT9 c;  1S72 A;  4JI5 L;  4FF4 A;  5C4X G;  1PH1 A;  1XNQ L;  3CCE A;  1SSO A;  1HH2 P;  4KLK A;  3OYY A;  1HZC A;  1KHI A;  1K73 C;  3IL8 A;  5E7N A;  4UY8 C;  3JAM c;  2VUM B;  1N34 Q;  1PH4 A;  2B2Y A;  5ELF A;  4DK0 A;  1TS4 A;  4S3S A;  1LYL A;  2IX3 A;  3BYY B;  4BWG B;  1JOR A;  1EZ6 A;  4DV5 L;  3ERO A;  4R8N A;  4LFA Q;  3DLL A;  3G7L A;  4NB3 A;  2PPB C;  5I2X A;  2AQ2 B;  3OMG A;  3EJI A;  3MXN B;  3U58 A;  3FVQ A;  1HFN A;  2K32 A;  3KDF A;  2RF4 A;  4EQO A;  3FRP B;  1N33 L;  1TS2 A;  3DXJ C;  4H13 C;  2OEO A;  1Q1B A;  2GVB A;  1T9H A;  3M3Y H;  4UDU C;  1K83 H;  5IWA L;  2MJ8 A;  1F2Y A;  3NWS A;  4LFC L;  2QDL A;  3S1Q H;  2BA1 A;  5DLQ E;  1XTC D;  3H3V C;  3MFG A;  1A3T A;  2JQO A;  1SYE A;  4X62 Q;  1YZ6 A;  3T1H Q;  3IKJ A;  4QIW B;  4ZKB B;  2LMC B;  2OTJ A;  3TQY A;  3K7A B;  3KUP A;  1GD7 A;  3L2P A;  5IP7 G;  1AEX A;  2A5H A;  1EOT A;  4LF7 L;  2BH8 A;  1BOS A;  2NWG A;  1U0L A;  1EU3 A;  3E6Z X;  1R4Q B;  4KY6 A;  2PI2 E;  3TP7 A;  3GTM B;  2UXB L;  4DK1 A;  1HR0 Q;  3RZD B;  5M5Y B;  2QA4 A;  1IHZ A;  3K5L A;  2Q8T A;  4DR2 L;  2ES2 A;  4QUC A;  1PTO D;  3TS2 A;  2F0M A;  3HOW B;  4BS9 A;  2F0U A;  4RGO S;  2V4D A;  5EPL A;  3CMA A;  3DM1 A;  2X69 A;  1EU4 A;  1U5K A;  3KF6 A;  1SNP A;  4K5X A;  1WVL A;  1PYW D;  4RGN A;  4EQN A;  3OWF A;  5GAH C;  4ZUI A;  3NUC A;  1SMY C;  4JI7 L;  4C3J B;  1XJV A;  4X6A H;  5FK9 C;  1KDA A;  3IAY A;  1UEA B;  1XPR A;  3RZD H;  3BDL A;  5M3F G;  3J80 i;  2OF1 A;  3SXH A;  2J7Z A;  4IUN A;  2KHJ A;  3BU2 A;  5C3E B;  2M9V A;  1HQR D;  1X3Q A;  3Q0A A;  1C8C A;  4BY1 H;  3ZJY C;  2PMZ B;  5C4J B;  3TME A;  5CMD A;  3DM3 A;  2BCO A;  2G5D A;  2ZM6 L;  2L55 A;  5LMN Q;  1VQD A;  1PZJ D;  3BVG A;  2HQL A;  2QF7 A;  2UXC Q;  2CQA A;  3CCM A;  4Y7N H;  4N9P A;  1VQ9 A;  3J80 c;  1IBL Q;  2F4V L;  4X65 L;  4DAY A;  1M1K C;  4RA8 A;  2L11 A;  3CQZ H;  4OHJ A;  5I2Y A;  4FP5 D;  2IPK D;  2MUY A;  1NMF A;  2I5M X;  4KHP L;  2R7Z H;  5EAY A;  2L1B A;  4IZ8 A;  2G9H D;  2GVA A;  2VUM G;  2JA8 B;  3HOV B;  4G7H C;  2C5C A;  1BBX C;  2F0V A;  1HNZ Q;  4OXP A;  2Y0S E;  1ASY A;  4DR3 Q;  1XMQ Q;  2EZV A;  5EKK A;  1B9M A;  3N52 A;  1FYC A;  2EY5 A;  4XQJ A;  1MJE A;  1J5E L;  1ET9 A;  3C2P A;  2ZTE A;  1EOV A;  5JJL A;  2D5D A;  3HG9 A;  1YNN D;  4A3B H;  2UXD L;  4OX9 L;  1QOH A;  1TKW B;  1NY4 A;  3S1M B;  5LL6 X;  2EQS A;  3ERQ A;  3J81 L;  4DV6 L;  1CHQ D;  5A35 A;  1TY2 A;  2EIF A;  2ZJQ A;  3UI2 A;  4FXK C;  5FOB B;  2HHH Q;  2EOT A;  4A3I B;  3T1Y Q;  4FF3 A;  2JA8 H;  1BO0 A;  1X3P A;  2H4O A;  1TWA B;  3FPP A;  1ICW A;  3G6E A;  1EZ8 A;  2K14 A;  3NBH A;  2F0O A;  4GOP C;  5EPJ A;  1FJG L;  4GOP B;  2YTY A;  3P20 A;  3GV3 A;  1TY0 A;  4B3R Q;  1YHA A;  4G4K A;  4KKS A;  2LSS A;  5FJ8 H;  5JEA H;  3L7Z C;  1K0S A;  3Q22 A;  2JK8 A;  4JYA L;  3S2D H;  2IT1 A;  5L37 A;  2JJQ A;  4OEM B;  5FLX L;  1VQ8 A;  5IYB H;  2VQF Q;  1YJW A;  3S1M H;  2QDB A;  4IO9 A;  4WRD A;  3AU7 A;  4JI4 Q;  1NTG A;  1MI2 A;  1IYJ B;  1D5X C;  4C3H H;  1FGB D;  5FO9 B;  4I7Z C;  3K8A A;  4A3I H;  1M90 C;  1EEI D;  4BY1 G;  3IFT A;  2VQE Q;  1EIG A;  4L5S A;  4KI0 A;  2KJX A;  2PW7 A;  1N9W A;  2QCP X;  4ULL A;  1E24 A;  5C3X A;  1STY A;  4DV3 Q;  5JOB A;  2JYO A;  1S4Z A;  4FXD A;  1CKN A;  2EYH A;  1PLF A;  1L0W A;  2UU9 Q;  2RDF A;  5GAD C;  1NUC A;  3CCS A;  4HSP A;  1GJX A;  1WTX A;  1QNU A;  1U9R A;  4CKC A;  1S40 A;  2F0P A;  5C3E G;  3NQI A;  4X3U A;  5M5W B;  3HOU B;  4DKA C;  2IHF A;  3ER0 A;  1VMP A;  2UUC Q;  5EJW A;  3OW7 A;  2AQ1 B;  1BR9 A;  4JBK A;  1V8Q A;  1UUP A;  1WJJ A;  3QO2 A;  4F87 A;  5JEA J;  5CBA E;  3KF8 A;  2YU9 B;  3PUZ A;  2Q2T A;  3RZO B;  4F88 A;  2WB1 B;  4GLA C;  4HMJ A;  5CGK A;  3CCJ A;  4G7O C;  3KBG A;  3EA6 A;  1GKH A;  1ML0 D;  3AQQ A;  4GS3 A;  3W1G A;  2JA8 G;  1GO3 E;  1DJR D;  2NBF A;  5LMU L;  2K33 A;  1ILQ A;  1F77 A;  3TEH B;  1PTO H;  4TKO B;  5M5W H;  3CRL C;  1E7Z A;  1QUQ A;  2K75 A;  2JE6 I;  3B6Y A;  1WCM B;  2A6E D;  4DV1 Q;  5FJ8 G;  3VYR A;  4CDE C;  3Q23 A;  3TP8 A;  4K0K L;  2XRQ D;  2OT2 A;  1EY5 A;  4XQQ A;  3A5Z B;  3GTG B;  4K5W A;  5IYB G;  1Q1E A;  3F2U A;  2YU9 H;  3RZO H;  2B2U C;  1V1P B;  3M7N A;  3AB9 A;  2JA5 H;  2GA4 B;  2PZW A;  1QCB D;  2PW5 A;  3A54 A;  1YJN A;  4C3H G;  1CT1 D;  3I55 A;  2VZA A;  4A3I G;  3WWV A;  4OO1 I;  4JCV E;  2WFW A;  2B2W C;  1RJT A;  3MWY W;  3I4N B;  5TSS A;  4Z9C B;  3DEO A;  1EQV A;  5I4D A;  2YTX A;  1D1K A;  4JI2 Q;  1TXY A;  2ENB A;  1QB5 D;  3M4Y A;  2AKW B;  1FNW A;  5J1Z A;  1U4L A;  3GTG H;  1UE1 A;  2F0J A;  2K28 A;  1NCV A;  1TII D;  1V43 A;  1EY8 A;  4ALP A;  1XNR Q;  3K6O A;  4DV7 L;  3GTJ B;  4X64 Q;  1TS3 A;  4CDD C;  5FLM G;  2Z6K C;  4GKJ Q;  2NTS A;  4DUZ L;  3I4M H;  1GUW A;  2L5T A;  5A2Q E;  2O2L D;  2N88 A;  3PO2 B;  4K2L A;  4FYD A;  1B44 D;  3G71 A;  4JI1 L;  3MEH A;  4PMB A;  2F3I A;  2DGY A;  4A3L G;  2JA6 B;  1B2T A;  4JK1 C;  4YHH Q;  2AQ3 B;  2B2V C;  4DPG A;  4LF4 L;  2JSO A;  3DUZ A;  4DAV A;  1KIX A;  4LF9 L;  4G7Z C;  4JI8 Q;  3A8K E;  1Q8K A;  5IGC A;  4JI5 Q;  2WV6 D;  1EFI D;  1XNQ Q;  1LTT D;  1EY6 A;  1ILP A;  2RCF A;  4BXX G;  2NVT B;  2B3G A;  2L4N A;  2QW7 A;  4IOA A;  3HOU G;  2WAQ B;  5AJ3 L;  1F2L A;  2NVY H;  1I5F A;  1KAW A;  3ULP A;  1STN A;  3AFP A;  4JI3 L;  3MVV A;  1GUS A;  1YHB A;  2A74 C;  3M4P A;  4IPD A;  1IZ6 A;  2NZ1 D;  4DF7 A;  4DV4 L;  1PH3 A;  3C46 A;  3ND8 A;  3CKI B;  2KBN A;  4MZ9 A;  4DR5 L;  1NR4 A;  2WB1 G;  3HOZ H;  3OHX C;  3CME A;  3EN2 A;  2A69 C;  4RMF A;  4IAL A;  1SLJ A;  4PV1 C;  2Z9H A;  1VCI A;  1ET6 A;  2K5H A;  1O7I A;  2EYF A;  3ICE A;  4BBR H;  1EIY B;  2J0T D;  3H0G H;  2A68 D;  1PTO F;  5IGB A;  5I9O A;  3K5M A;  1I94 L;  1WCM G;  4HIK A;  1RTO A;  1NBW A;  4JV5 Q;  1PVO A;  5C44 B;  1VQL A;  2K5V A;  1LTS D;  1EQR A;  3RNU A;  5CV4 A;  4K6D A;  2Z4I A;  4LFC Q;  1V9P A;  3GTL B;  3CHB D;  1MJC A;  3MHB A;  1ASZ A;  1IXR A;  1E1O A;  1WTW A;  2MQH A;  1XXG A;  1Z6H A;  1LM0 A;  3CC4 A;  2NUC A;  4H44 C;  4OO1 H;  5EQ0 A;  3WOF A;  3OTO Q;  1KD1 C;  3CCL A;  3HEJ A;  3KLW A;  4KD3 A;  4ZUJ A;  4YWM A;  3HOX H;  3I4N G;  1F2Z A;  3URY A;  2OWO A;  5JJK A;  1FR3 A;  1Q81 C;  5DNF A;  4O0A A;  1IBK Q;  4RGM A;  4HIM A;  3HRZ C;  5C44 H;  4DR2 Q;  1EWH A;  4L6T B;  3T51 B;  3CCQ A;  4A3F B;  2R7D A;  5M5X B;  5K5P A;  1XPO A;  3SK5 A;  4PQX A;  3KBX A;  2HT1 A;  4BA1 I;  2FHT A;  3NHH A;  2IX0 A;  4RHS A;  3P1H A;  1SYB A;  2K6A A;  4OEL B;  3BJU A;  3NPP A;  4B08 A;  5DEH A;  1NJI C;  2WP8 J;  2VW9 A;  3NTK A;  5IIF A;  2F0L A;  3J7A 5;  3S1N B;  1LAB A;  3ZYY X;  4ABN A;  2PCF B;  3PO2 G;  2R3Z A;  3KLR A;  1YNJ C;  3SHL A;  1S3O A;  4DV0 L;  1LTI D;  2K04 A;  4FF1 A;  4N8X 1;  2JA6 G;  4LF5 L;  1FD7 D;  3DWQ A;  1SRO A;  3PO3 H;  1IW7 C;  5CYU A;  4MTN A;  1A8V A;  3P7J A;  1Q3L A;  3HP3 A;  4R1J A;  4G57 A;  1JE5 A;  2E2I H;  3AYH B;  4BBR G;  1H9M A;  3H0G G;  4CJ1 B;  3MXN A;  2ID0 A;  3QR8 A;  4JW0 A;  5KNB A;  1D5M C;  1UE6 A;  2WAQ G;  3L0O A;  2RSO A;  4EVO A;  2AUK A;  2B63 H;  4XT1 B;  3S17 H;  2Z4H A;  3S1N H;  2Z8L A;  1L1O C;  1L1O B;  2F3W A;  4B3T L;  2PNR C;  4B3M Q;  3A0J A;  3BS1 A;  3CD6 A;  3TN2 A;  3NQT A;  1JJC B;  1QZH A;  4LW1 A;  1BKB A;  2AUJ D;  4CKB A;  1H9J A;  4PZ7 A;  2JN4 A;  4OO1 G;  5D3I B;  3RMH A;  1D2B A;  1STH A;  4YWK A;  2O5I C;  1ENA A;  5HUR A;  3GTQ B;  1CQV A;  4B9W A;  2DNC A;  3I90 A;  3JAM L;  1HNW Q;  1SR3 A;  1FL0 A;  4DV6 Q;  2EYJ A;  1DOK A;  4DR1 Q;  4JVZ A;  1SYG A;  1O7Y A;  1Z7T A;  3TP5 A;  5C44 G;  3SK6 A;  4A3G H;  3M3Y B;  1K83 B;  2R7F A;  2LKV A;  3GQB A;  4KN7 C;  4DK6 C;  2Y0S G;  2CHB D;  3TZU A;  3U9S A;  4A3J H;  4RCO A;  2MO0 A;  3J7A F;  3S1Q B;  3VR2 A;  1I4G A;  1SRU A;  1J9O A;  4R8I A;  4A3C H;  2P5Z X;  1PDQ A;  1DCZ A;  4BA2 I;  4A3D H;  2L15 A;  1SYD A;  1K28 A;  5GAG C;  2A68 C;  4CKE A;  1HNX L;  3GTQ H;  4P73 A;  1QWY A;  2V1C C;  3J7Z C;  1C9O A;  3MTS A;  2PZU A;  5BN5 A;  1KRS A;  2KHI A;  3A55 A;  4M1U B;  4DR6 Q;  2KOL A;  1STA A;  3E0J A;  2KCC A;  1GOZ A;  4KKU A;  5ELC A;  4OON A;  2YV5 A;  4A3F G;  1S5E D;  1B3Q A;  3OOC A;  4DUY L;  1OXT A;  1Y8N B;  1EYA A;  3R3O A;  3L3O C;  4KHZ A;  2EY1 A;  1EY0 A;  1YBY A;  1Y1W H;  1KDC A;  3UDX A;  3PGZ A;  4C1N I;  2A6H D;  4EQP A;  3NBI A;  1G29 1;  4HJA A;  5KYI A;  2F0S A;  1GVP A;  1SNM A;  2OXP A;  1QNK A;  3KOJ A;  1SYF A;  2KED A;  2EYP A;  2XRS D;  5IGF A;  4J8Q A;  4X3K A;  3A74 A;  1H95 A;  5E3F A;  3TP6 A;  1HFG A;  3DMU A;  3SK4 A;  3ULL A;  3K59 A;  2B2T C;  1FVI A;  4IPC A;  4GZY C;  2NVX B;  4UAI A;  1JOK A;  4BY1 B;  1KC8 C;  3VR3 A;  1PFS A;  1YIJ A;  1BBU A;  1DYQ A;  1DZ1 A;  4JOI C;  1AH9 A;  4YY3 L;  5DM6 3;  1RTN A;  1L0Y B;  2EE1 A;  4KD4 A;  4MHE A;  3GTK H;  2XVS A;  3D31 A;  1PA6 A;  4H7B A;  1NR2 A;  5KGU A;  4Y7N B;  5EBD A;  5M9O A;  1OTC A;  4AYB E;  3K80 C;  1K9M C;  3GTP B;  3CQZ B;  1BCP D;  1J6Q A;  1OXU A;  1TWC H;  5D3D A;  4A3G G;  4I65 A;  2R7Z B;  2ZTD A;  1PH9 A;  5LL6 S;  1Q82 C;  1PMR A;  3TZD A;  3PQI A;  1JCK B;  4RHR A;  4LUO A;  1EFW A;  3S15 B;  2N55 A;  1K3R A;  1ZKO A;  3J7A V;  4DR7 L;  2NVX H;  1OO9 B;  2AHO B;  3UE0 A;  2CW0 D;  2FMC A;  4APV A;  4GNX C;  3J80 L;  1SFO H;  2R6G A;  1C0A A;  4GNX B;  1BDO A;  4GOP A;  4A3C G;  1WI5 A;  4P72 A;  1VQ6 A;  1EIH A;  2KVM A;  2MGS A;  4JBW A;  1SND A;  3S1R B;  5ISR A;  1F9R A;  3N6R A;  3GP7 A;  2F52 A;  5BN3 A;  1BF4 A;  4A3B B;  3FPU B;  1SBB B;  1WD1 A;  3P75 A;  1G2S A;  2EVB A;  3GTP H;  1AZQ A;  1E3P A;  3QB3 A;  4HSV A;  1ZYR D;  3CXC A;  4IOC A;  3IRB A;  3K81 C;  3NEN A;  3W2D A;  4OIK A;  1WD0 A;  1EWC A;  3FEW X;  2HIX A;  4UP7 A;  4JBM A;  1RKN A;  1EIF A;  3J81 j;  1CSP A;  4FVM A;  3S15 H;  1PYB A;  4H02 A;  1KDB A;  4YWL A;  1M8A A;  2JP1 A;  2IW3 A;  3G48 A;  4J15 A;  1B8A A;  4XT3 B;  2Q2I A;  1VQA A;  4WFN 3;  3S1R H;  1G91 A;  4X3S A;  5IGG A;  3S2D B;  3RD4 A;  2Z0S A;  1W2B A;  1LTR D;  3M9B A;  4UP9 A;  5J22 A;  3K58 A;  3BVM A;  1CZW A;  4OWX B;  4JBJ A;  4A3E B;  1X9N A;  3D6C A;  3A7L A;  5COR A;  4C3H B;  2F0W A;  3R2T A;  4DU9 A;  1F9S A;  1YEZ A;  3DWP A;  2IHE A;  4ZRZ A;  3S2H H;  1WFQ A;  5HY6 A;  2CCZ A;  5K36 H;  3HOY H;  4J6H A;  4HJ7 A;  1K8A C;  1STG A;  4IUT A;  1CI3 M;  4JI1 Q;  4N9T A;  3UE1 A;  1GUG A;  1HJP A;  1YNX A;  1SN8 A;  3QOJ A;  2JA7 H;  4KY5 A;  2F4I A;  2BA0 A;  3GTO B;  5CBE E;  1JWS D;  2E2H H;  1MIU A;  3F1Z A;  2C9O A;  1LAC A;  1JOQ A;  2CVR A;  3QWN A;  2PQA B;  3GO5 A;  3ONA B;  3W1B A;  5GQO A;  4A3E H;  1Y69 U;  1HTP A;  3Q24 A;  1N34 L;  3E9H A;  1B53 A;  4KV6 A;  1DD2 A;  1FNU A;  4B9X A;  2NYZ D;  2F0D A;  3V96 A;  2F0F A;  3FKI B;  4LFA L;  1O7L A;  3E0E A;  1WTV A;  1XMO Q;  1U4P A;  2B8F A;  3HKZ E;  2K4K A;  2DY8 A;  2E2J H;  3SE0 A;  1BBW A;  4KJO A;  4NXN L;  1CFM A;  1VQI A;  2L0C A;  3K57 A;  4DV4 Q;  5E4X A;  2Q2U A;  2LXJ A;  4POF A;  2XNA C;  5IYD H;  3A8I E;  2RKS A;  4K8J A;  5CV8 A;  3GTO H;  3WDN A;  2Q2H A;  4IUU A;  1V1P A;  2B2U A;  3H94 A;  4ME5 A;  4OWW B;  4LF8 L;  1E2W A;  2ZJP A;  3BG3 A;  2R7Z G;  4R4Q A;  3T53 B;  3H91 A;  1HCZ A;  5IOC A;  4X62 L;  1PTO C;  1LUZ A;  2G9D A;  1H9S B;  2B2W A;  4NP5 A;  1VQB A;  1I4Q A;  1PTO B;  2AMC B;  4ILW A;  1I94 Q;  4HJ5 A;  1DOM A;  3FKI H;  1EL0 A;  1T5X D;  3S16 H;  5BN4 A;  4CGY B;  4MTK A;  4KY7 A;  3CU7 A;  4A3B G;  1I4R A;  2D0P A;  3L9A X;  2D62 A;  4B3S L;  1RCV D;  1LT4 D;  2IJ0 A;  1B1Z A;  2F0N A;  1SJE D;  1VQC A;  1UEB A;  3NEL A;  2JA5 B;  3MAQ A;  4QGU A;  2WKC A;  4NDX A;  2ALY B;  5F2D A;  2N3S A;  4RG1 A;  3V05 A;  4BBS H;  3AEV A;  2Z6K A;  1JE4 A;  3KJP A;  1EUJ A;  1IYV A;  3H6M A;  5IOD A;  4KK7 A;  3HS0 C;  4PZ8 A;  2RCN A;  1A15 A;  5C3W A;  4QQB X;  5JEA G;  2L9H A;  1A62 A;  2MO1 A;  4L5Q A;  1CM9 A;  2UUB L;  1HZ9 A;  1CZG A;  4NKL A;  1RHP A;  5KNC A;  4A3E G;  1BNZ A;  1STB A;  4L5R C;  1PRT D;  4XYQ A;  4JI0 Q;  5I6Y A;  1MSH A;  3I2Z A;  1JIC A;  3RLN A;  3RN5 A;  1HZA A;  2X6G A;  2CFM A;  3MZ5 A;  4HMI A;  1N32 L;  3I4M B;  3I4O A;  2M2L A;  4ZCK A;  1PZI D;  2N8N A;  2AWN A;  1I4H A;  5AFW A;  3D4R A;  3V2T A;  3VA7 A;  1LO5 D;  3UDI A;  1HA5 A;  1YNN C;  5T1G A;  4RGT A;  4HED A;  4A93 H;  3I73 A;  2VS1 A;  2I5H A;  2HQE A;  3R8B A;  1C48 A;  1DOL A;  1LTG D;  1Z9F A;  4WJW A;  3LNN A;  1DXM A;  1O7Z A;  1IKM A;  1B70 B;  2B29 A;  3OPO A;  1EQQ A;  2KHS A;  1IBM L;  1HTL D;  3AFQ A;  2UUA Q;  3H15 A;  3J7Y W;  3SGI A;  1B50 A;  2EPB A;  4DR3 L;  1XMQ L;  1DM0 B;  3FKI G;  3CW2 C;  1N36 L;  1BUV T;  2NVY B;  4WJ3 M;  5HGQ A;  5IYC H;  4A3M H;  4U67 3;  5CV5 A;  2E2D C;  2D9U A;  3I7F A;  1X32 A;  1SE4 A;  4AQY L;  2HDM A;  4HN7 A;  1TWH B;  3K7U C;  1LT6 D;  1BVS A;  1AZP A;  2VXW A;  3AMU A;  3HOZ B;  2CWP A;  1Q46 A;  2HHH L;  4NXM Q;  3DWA A;  2N49 A;  1AE2 A;  1I50 H;  1SNQ A;  3PUY A;  2CQO A;  1SDF A;  4XQN A;  1GHJ A;  4BBS G;  3KLS X;  4BBR B;  4BY7 B;  3H0G B;  2JA9 A;  3Q6S A;  1WYD A;  2EY6 A;  2K7V A;  3BZD B;  2RSN A;  4B3R L;  3S9W A;  5KIX A;  2ATW A;  2TSS A;  1CKO A;  2VL6 A;  1EYC A;  3MA2 B;  5CV9 A;  4HJ8 A;  4R4O A;  2WII B;  2VQF L;  3E9I A;  1TWH H;  1PFB A;  1I4X A;  2R93 H;  1I6H H;  2BE5 D;  4M8A A;  2WKD A;  4DV5 Q;  1GUN A;  1VQ5 A;  2JA5 G;  1B3A A;  1Y1V B;  2GN5 A;  2PO4 A;  2JEA I;  2K03 A;  1U4M A;  4IJL A;  1HNX Q;  4DNR B;  2VQE L;  4RKL A;  5C0X I;  4XYO A;  1EY9 A;  3UDG A;  3M4O H;  2KCT A;  4XTC S;  5ELN A;  4UP8 A;  1A3U A;  4LK1 C;  3HOX B; 
#chains in the Genus database with same CATH homology
 3W5O A;  2UXC Q;  4A3L H;  1N33 Q;  1UE5 A;  3CCM A;  1HNW Q;  1MKH A;  4Y7N H;  2PMZ E;  3CPW A;  1VQF A;  1SR3 A;  1FL0 A;  2AWO A;  2QGQ A;  3J80 c;  4DV6 Q;  1IBL Q;  1VQ9 A;  1VQN A;  4X65 L;  2I5L X;  2F4V L;  4DR1 Q;  1M1K C;  4DV3 L;  1QVG A;  3CQZ H;  5IWA Q;  5C44 G;  2JA7 G;  3RLF A;  4A3G H;  1NMF A;  1OXS C;  2R7F A;  2I5M X;  2Y0S G;  4DK6 C;  4A3J H;  1YJ9 A;  2R7Z H;  3BZK A;  4KHP L;  5EAY A;  2UU9 L;  4Y52 H;  1TWF H;  2VUM G;  2GVA A;  2MO0 A;  3HOV G;  1HNZ Q;  4BXX H;  3K0X A;  3RLO A;  1SRU A;  3HOU H;  4OXP A;  2Y0S E;  1Y1V H;  1ASY A;  4LUZ A;  3F2D A;  4LUV A;  4A3C H;  3U4Z A;  4DR3 Q;  1XMQ Q;  1E1T A;  3PUW A;  4LF7 Q;  4BA2 I;  4A3D H;  2L15 A;  1PH2 A;  1MJE A;  5GAG C;  1J5E L;  1HNX L;  2ZTE A;  1EOV A;  1VQK A;  5JJL A;  2FXQ A;  4YCW A;  5LMN L;  2OTL A;  4C3I H;  4P73 A;  5IYC G;  4O2D A;  3GTQ H;  3I4M G;  2V1C C;  4A3B H;  3J7Z C;  1VQE A;  4A4I A;  2UXB Q;  1C9O A;  2UXD L;  4OX9 L;  2UXC L;  1KRS A;  2C35 B;  2KHI A;  1VQ7 A;  1NY4 A;  4JI6 Q;  5M3M G;  2EQS A;  4DR4 Q;  4DV0 Q;  4DR6 Q;  1CKN B;  1L1O A;  4DV6 L;  1IBL L;  4IJH A;  4LF5 Q;  2EIF A;  4UPA A;  4OON A;  2YV5 A;  5IYD G;  2ZJQ A;  4A3F G;  4DUY L;  1OXT A;  2HHH Q;  3S14 H;  1L2F A;  1A63 A;  3T1Y Q;  2K5N A;  2JA8 H;  2XGT A;  2JA8 G;  1IL2 A;  4KHZ A;  1G51 A;  1NE3 A;  2OQ0 A;  1YBY A;  1Y1W H;  5K36 G;  3G6E A;  5JJI A;  3UDX A;  4X66 Q;  2K14 A;  3PGZ A;  4GOP C;  1HNZ L;  1FJG L;  4GOP B;  1WCM H;  1G29 1;  2YTY A;  4HJA A;  2MNA A;  4B3R Q;  1YHA A;  1DGS A;  1GVP A;  2LSS A;  5FJ8 H;  2VY3 A;  3KOJ A;  3L7Z C;  3OW2 A;  4TVA B;  2A8V A;  2JK8 A;  4IFD I;  4JI7 Q;  1NMG A;  1K0R A;  3EIV A;  2IT1 A;  1QVC A;  4QIW E;  3F2C A;  1C7Y A;  2JJQ A;  3KF8 B;  3S2D H;  2A1A A;  3LGJ A;  4B3T Q;  1VQ8 A;  5IYB H;  2VQF Q;  1YJW A;  1K8G A;  4P74 A;  3S1M H;  3A74 A;  4C2M H;  4IO9 A;  1H95 A;  4JI4 Q;  4DR4 L;  1NTG A;  1X3G A;  4JI6 L;  4IPG A;  1N8R C;  1IYJ B;  3FP9 A;  4DR7 Q;  3HKS A;  4C3H H;  3ULL A;  4GLX A;  1PH5 A;  4IPC A;  1FVI A;  3S24 A;  3K8A A;  3HOZ G;  4A3I H;  1M90 C;  2NVQ H;  3JC6 6;  1KC8 C;  1PFS A;  4BY1 G;  1YIJ A;  2ZM6 Q;  4R4I A;  2VQE Q;  1BBU A;  4AYB G;  3KYH C;  3T1Y L;  4JOI C;  3I4N H;  4L5S A;  4WJ4 A;  1PHJ A;  4YY3 L;  1AH9 A;  1G6P A;  4LF6 Q;  1QUQ B;  4KI0 A;  1CUK A;  2NZH A;  1N9W A;  4X66 L;  3GTK H;  3D31 A;  1PA6 A;  4BY7 G;  1SE8 A;  1E24 A;  4X65 Q;  2F4V Q;  1OTC A;  4AYB E;  4DV3 Q;  3K80 C;  5GAE C;  4XIG S;  3TS0 A;  1K9M C;  1CKN A;  4HIO A;  4FDB A;  1J6Q A;  1OXU A;  1TWC H;  2NZO A;  4POG A;  3PF4 A;  4A3G G;  2H5X A;  4KHP Q;  1L0W A;  2UU9 Q;  2OQK A;  3F8T A;  1LTL A;  2ZTD A;  1PH9 A;  5GAD C;  3CCS A;  1Q82 C;  2K50 A;  2PNH A;  2NN6 I;  4JI4 L;  3ULJ A;  4LUO A;  1EFW A;  3GTJ H;  3M4Q A;  1K3R A;  1SMX A;  1S40 A;  3CC2 A;  1TWG H;  4DR7 L;  5C3E G;  2NVX H;  2AHO B;  3UE0 A;  4APV A;  4QL5 A;  4DKA C;  4X64 L;  4GNX C;  2R6G A;  4A75 A;  1VQG A;  1Y1V G;  1SFO H;  2IHF A;  4GNX B;  1C0A A;  4GOP A;  4A3C G;  3ER0 A;  2UUC Q;  1J5E Q;  1WI5 A;  4GKJ L;  4P72 A;  1XMO L;  1VQ6 A;  4JBK A;  3PO2 H;  4LF6 L;  4JBW A;  1D8L A;  2UXD Q;  4OX9 Q;  3HOX G;  1VQP A;  2F52 A;  1WJJ A;  2CWA A;  5JEA J;  1X55 A;  3GDE A;  3CCV A;  2JA6 H;  3PUZ A;  2Q2T A;  3GTP H;  5H1S E;  1E3P A;  2RHQ B;  1I3Q H;  3CXC A;  4IOC A;  3IRB A;  3K81 C;  3NEN A;  4GLA C;  4DUY Q;  2LXK A;  4YHH L;  3PUV A;  4IPH A;  4A93 G;  2IY5 B;  3CCJ A;  2R92 H;  4PMW A;  4DAM A;  3U50 C;  4JBM A;  2HIX A;  4UP7 A;  1GKH A;  1EIF A;  3AQQ A;  3J81 j;  1CSP A;  4GS3 A;  4QJF A;  1RL2 A;  4JG2 A;  3W1G A;  4JI8 L;  2ASB A;  1GO3 E;  1PYB A;  2KEN A;  4H02 A;  3S15 H;  5LMU L;  3PF5 A;  4YWL A;  1FJG Q;  2ZJR A;  3TEH B;  2NVT H;  4JOI A;  5M5W H;  1E7Z A;  1QUQ A;  2K75 A;  2JE6 I;  3B6Y A;  3G48 A;  4J15 A;  1WOC A;  1B8A A;  2E8G A;  3GD7 A;  2QEX A;  3AEV A;  2Q2I A;  3PUX A;  5FJ8 G;  4DV1 Q;  2UUC L;  4JYA Q;  3PIO A;  1VQA A;  4TQU S;  4A76 A;  3S1R H;  1HZB A;  1RIP A;  1X54 A;  1PV4 A;  4K0K L;  4A3M G;  5M3F H;  2Z0S A;  3A5Z B;  1W2B A;  2ZTC A;  3M9B A;  4UP9 A;  5IYB G;  1Q1E A;  2YU9 H;  4OWX B;  3RZO H;  4JBJ A;  4EQ5 A;  3M7N A;  3CPF A;  1KXL A;  1JT8 A;  2JA5 H;  1X9N A;  1YJN A;  4AIM A;  4A3K H;  1YIT A;  1EYG A;  3PSI A;  2VNU D;  3I55 A;  1YEZ A;  1Q86 C;  3PO3 G;  2KCM A;  2IHE A;  3S2H H;  2VZA A;  4A3I G;  1WFQ A;  5HY6 A;  3WWV A;  4JCV E;  4YY3 Q;  2WFW A;  2CCZ A;  4OO1 I;  1V1Q A;  4NXN Q;  3HOY H;  5C4X H;  1K8A C;  3CC7 A;  4HJ7 A;  4GNX A;  1X3E A;  1VQH A;  1YVC A;  1KQS A;  3A5U A;  4JI1 Q;  3RN2 A;  5C4X G;  1OXV A;  2YTX A;  3UE1 A;  1HJP A;  1YNX A;  4JI2 Q;  1XTD A;  2JEB I;  3D0F A;  5C0X J;  1TXY A;  3CAM A;  1SN8 A;  2JA7 H;  3STB D;  2BA0 A;  4JV5 L;  1JJ2 A;  2AKW B;  1GM5 A;  4LFB Q;  4DV1 L;  2E2H H;  2B63 G;  1MIU A;  3F1Z A;  3GTL H;  4LF8 Q;  2VUM H;  3GTG H;  2PQA B;  1VQM A;  1UE1 A;  4YCV A;  3GO5 A;  1PH6 A;  3MEF A;  3ERS X;  5GQO A;  3W1B A;  4A3E H;  3G4S A;  1N34 L;  2E5L Q;  1V43 A;  3HKZ G;  3E9H A;  4ALP A;  2BH2 A;  2I0Q A;  1XNR Q;  4DV7 L;  1VQJ A;  1XPU A;  4P75 A;  3KFU A;  4X64 Q;  2R93 G;  3PCO B;  5FLM G;  4JI0 L;  2Z6K C;  1CKM A;  4GKJ Q;  2D0O A;  4DUZ L;  4LFA L;  1E22 A;  3E0E A;  1XMO Q;  3OTO L;  3HKZ E;  5C0X G;  2K4K A;  3I4M H;  2E2J H;  1BBW A;  4NXN L;  4LWC A;  5IE8 A;  1KRT A;  1VQI A;  4DV4 Q;  2Q2U A;  3M85 A;  1KL9 A;  2LXJ A;  3G71 A;  4JI1 L;  4POF A;  4B3S Q;  2F3I A;  3Q8D A;  2DGY A;  4A3L G;  1IBK L;  4JI2 L;  1JMC A;  5IYD H;  4QY7 A;  4A3F H;  3GTO H;  3CP0 A;  3CCR A;  5M5X H;  4YHH Q;  2Q2H A;  5IY0 A;  4DPG A;  4LF4 L;  4LFB L;  3UDF A;  1KIX A;  4ME3 A;  4LF9 L;  2EXD A;  4OWW B;  3KJO A;  4DV2 Q;  4LF8 L;  2ZJP A;  1P16 A;  1X3F A;  4A3J G;  2R92 G;  3H3V H;  4JI8 Q;  2R7Z G;  4R4Q A;  1Q8K A;  1X65 A;  3RR5 A;  5LMU Q;  4JI5 Q;  5J3B A;  3H3V I;  1A0I A;  4X62 L;  1XNQ Q;  2E5L L;  1LUZ A;  1XNR L;  3K7A H;  1VQB A;  1QZG A;  4BXX G;  2AMC B;  5IP7 H;  2B3G A;  1I94 Q;  4IOA A;  4HJ5 A;  3HOU G;  1PH8 A;  3FKI H;  2UUA L;  5AJ3 L;  2NVY H;  1JJG A;  1I5F A;  3F2B A;  1KAW A;  3ULP A;  4A3D G;  2N78 A;  3KDF B;  3AFP A;  4JI3 L;  4R4C A;  5IP9 H;  4K0K Q;  3S16 H;  1YHB A;  3M4P A;  3FHW A;  3GTM H;  4IPD A;  1IZ6 A;  1R9T H;  1VQO A;  1YI2 A;  2UUB Q;  4IFD J;  4A3B G;  4DV4 L;  2D0P A;  1PH3 A;  2WAQ E;  5M5Y H;  1Q12 A;  2D62 A;  4B3S L;  1B7Y B;  2PQA A;  1P8L A;  4DR5 L;  4MZ9 A;  1VQC A;  1UEB A;  2KBN A;  3HOZ H;  2WB1 G;  3NEL A;  1VS0 A;  4GN4 B;  3CME A;  3EN2 A;  4QGU A;  4P71 A;  1Y14 B;  5GRO A;  2IX1 A;  3HOW H;  2HIV A;  4A3K G;  4RMF A;  1W3S A;  4NXM L;  3JAM i;  2ALY B;  4DV2 L;  1N32 Q;  4AH6 A;  2N3S A;  1SLJ A;  5BR8 Q;  4RG1 A;  3ICE A;  1VCI A;  4BBS H;  2K5H A;  1O7I A;  4YCU A;  3I56 A;  2WB1 E;  4BBR H;  2Z6K A;  4PZ6 A;  5IT9 c;  4JI5 L;  3KJP A;  1S72 A;  3H0G H;  1EUJ A;  1PH1 A;  1EIY B;  1Y1W G;  1XNQ L;  3CCE A;  4PZ8 A;  1HH2 P;  1WCM G;  4EX5 A;  4KLK A;  2RCN A;  1NBW A;  3OYY A;  4HIK A;  1I94 L;  4JV5 Q;  1PVO A;  1VQL A;  1HZC A;  2K5V A;  4QQB X;  1EQR A;  3RNU A;  5JEA G;  1KHI A;  2YYZ A;  4IFD G;  4C3J H;  3BZC A;  1K73 C;  1A62 A;  4LFC Q;  5E7N A;  1JB7 A;  4UY8 C;  1V9P A;  3JAM c;  2MO1 A;  1MJC A;  4L5Q A;  2UUB L;  1ASZ A;  1N34 Q;  1PH4 A;  1IXR A;  4B3M L;  1HZ9 A;  5C3E H;  4A3E G;  4DV7 Q;  1E1O A;  1PH7 A;  1LYL A;  2MQH A;  4DK3 C;  4DNI A;  1IBM Q;  1LM0 A;  4DV5 L;  4L5R C;  5C4J H;  3CC4 A;  4JI0 Q;  3NEM A;  4DUZ Q;  4LFA Q;  4JC0 A;  3DLL A;  3I2Z A;  3OTO Q;  1N36 Q;  1KD1 C;  3CCL A;  3RLN A;  3KLW A;  4NB3 A;  3RN5 A;  1HZA A;  2CFM A;  1UE7 A;  3J81 i;  1N32 L;  5BR8 L;  3I4O A;  4YWM A;  3HOX H;  3I4N G;  3MXN B;  3U58 A;  4AQY Q;  2OWO A;  5JJK A;  2N8N A;  2AWN A;  3KF6 B;  3KDF A;  1QVF A;  1CSQ A;  1Q81 C;  2RF4 A;  4O0A A;  1IBK Q;  1N33 L;  1HNW L;  3PIP A;  4HIM A;  5C44 H;  4LNQ A;  1X6O A;  4JYA L;  1Q1B A;  3UDI A;  2GVB A;  1Z47 A;  3U4V A;  3CCQ A;  1T9H A;  4DR1 L;  4DR2 Q;  1K83 H;  2R7D A;  5IWA L;  4LF4 Q;  3M3Y H;  2CKZ B;  4A93 H;  5ELO A;  4LF9 Q;  1XPO A;  2VS1 A;  4L5T A;  2I5H A;  2OCE A;  2HT1 A;  4LFC L;  4BA1 I;  3HOV H;  1Z9F A;  3S1Q H;  2YTV A;  2BA1 A;  5DLQ E;  3J81 c;  2JQO A;  2NN6 G;  4X62 Q;  2IX0 A;  1YZ6 A;  3T1H Q;  1HR0 W;  1B70 B;  2B29 A;  2OTJ A;  3TRE A;  3TQY A;  1EQQ A;  1IBM L;  2A19 A;  3BJU A;  3AFQ A;  2UUA Q;  5AJ3 Q;  3H15 A;  1NJI C;  3SGI A;  1GD7 A;  2WP8 J;  5IP7 G;  3L2P A;  2VW9 A;  4DR3 L;  1XMQ L;  3EBE A;  3FKI G;  3CW2 C;  1N36 L;  4JI3 Q;  4LF7 L;  2BH8 A;  4WJ3 M;  5HGQ A;  5IYC H;  4A3M H;  3J7A 5;  1U0L A;  3I7F A;  1VQ4 A;  5IP9 G;  2PI2 E;  3PO2 G;  5M3M H;  2DUD A;  4DAY B;  4AQY L;  2UXB L;  4GN3 B;  3STB C;  4HID A;  1HR0 Q;  1S3O A;  2QA4 A;  4DV0 L;  4DR5 Q;  4DR6 L;  3K7U C;  2JA6 G;  1BVS A;  4LF5 L;  1PYS B;  4DR2 L;  1SRO A;  1AE3 A;  2CWP A;  2ES2 A;  3PO3 H;  1Q46 A;  1X56 A;  4MTN A;  5FLX c;  2HHH L;  4NXM Q;  4HJ9 A;  1A8V A;  3TS2 A;  3HOW G;  4GLV B;  2N49 A;  1AE2 A;  1TWA H;  4R1J A;  4GKK Q;  1I50 H;  1FGU A;  3PUY A;  2CQO A;  1JE5 A;  4BBS G;  3CMA A;  2E2I H;  3T1H L;  3AYH B;  4BBR G;  1EWI A;  3H0G G;  3TRZ A;  2JA9 A;  3VDY A;  1U5K A;  1WYD A;  2ID0 A;  3KF6 A;  1UE6 A;  3L0O A;  2WAQ G;  4B3R L;  5GAH C;  2B63 H;  3S17 H;  2MFI A;  1OXX K;  3S1N H;  2ATW A;  4MNO A;  1CKO A;  4JI7 L;  4NPS A;  1L1O C;  1XJV A;  4X6A H;  2VL6 A;  4HJ8 A;  5LMN W;  1L1O B;  3CF5 A;  1UWV A;  4B3T L;  4GN5 A;  4R4O A;  2VQF L;  3RZD H;  1XPR A;  5M3F G;  4PG3 A;  3E9I A;  3A0J A;  4B3M Q;  3CD6 A;  3J80 i;  1TWH H;  3HFZ B;  1HR0 L;  2K52 A;  2XTI A;  1Q7Y C;  2KHJ A;  1JJC B;  3BU2 A;  1YHQ A;  4LW1 A;  1QZH A;  1BKB A;  4DV5 Q;  1I6H H;  2R93 H;  2RHS B;  1D7Q A;  1VQ5 A;  5FLM H;  3PV0 A;  4R4T A;  2JA5 G;  4BY1 H;  4PZ7 A;  3ZJY C;  2GN5 A;  2JEA I;  4GKK L;  2PI2 A;  3DM3 A;  3CCU A;  4IJL A;  1HNX Q;  4OO1 G;  3NBH B;  2ZM6 L;  2VQE L;  5C0X I;  5LMN Q;  3M4O H;  3UDG A;  4OWT B;  2KCT A;  4XTC S;  4YWK A;  1VQD A;  5ELN A;  4UP8 A;  3HOY G;  2HQL A;  4BY7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...