4HJ8A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggttacgct)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
b'SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj8A00
2E5LL 4YCVA 1Q82C 2L15A 1GD7A 5C0XJ 3OW2A 3UDGA 2K5VA 3TEHB 2Q2UA 1TWFH 5IP9H 3A5UA 3H0GH 2NZOA 5IP7G 4DR4Q 1Q1EA 4A3CH 3FHWA 1QUQB 4YWKA 3U4ZA 1KD1C 4C3IH 4PG3A 3I56A 2B63G 1VCIA 1MJCA 4LF7Q 3CCRA 4POFA 1HNZL 4B3TL 1KIXA 4P74A 5JJIA 1HR0Q 4RG1A 1MJEA 4JYAL 2E5LQ 5IWAL 1M1KC 4JI4L 4R4IA 4O0AA 4AH6A 3S1QH 1LUZA 5C0XG 1EQQA 2ZTEA 5HGQA 5FLMG 5IP7H 1X55A 1KXLA 1SRUA 2Q2TA 2RCNA 2B63H 1KRTA 3F1ZA 2N8NA 5IYBG 2N3SA 4IO9A 2K5HA 1PH9A 1PA6A 1HNZQ 2EQSA 4B3TQ 1EFWA 2JA5G 1X3EA 1Z9FA 1K9MC 1X3FA 3PUYA 4A3GG 5GQOA 1M90C 4DR2L 4JYAQ 5IWAQ 3H3VH 1L1OC 2CCZA 4JI4Q 1N8RC 2ZJPA 1AH9A 3H3VI 2KHIA 4X62L 4OWTB 5FLMH 3HOXG 3U58A 2YTYA 3UDIA 3S2DH 1N32L 4QY7A 4DR7Q 5DLQE 4GLXA 2N78A 3J81j 3T1HL 3RLFA 1U5KA 4ALPA 3DM3A 5IYBH 4BBSG 3CW2C 1A8VA 1FJGL 2JA5H 3MEFA 2ATWA 3KF8B 4DR5Q 1U0LA 2JA9A 4A3GH 4LF9L 4OO1I 1TXYA 3M4OH 4P71A 4DR2Q 4KHPL 4DUZL 4HIDA 3UE1A 4DNIA 1LTLA 4BBRG 4X62Q 5FLXc 3HOXH 1QUQA 1IXRA 1IYJB 1B70B 1AE2A 1SLJA 3ER0A 2VUMG 1CUKA 1HZAA 1QZHA 2UXCL 2B3GA 1N32Q 4DV0L 1EOVA 4HIKA 1OXSC 3T1HQ 2JK8A 1C7YA 4LF5L 1N9WA 1UEBA 2PI2A 2NZHA 3U4VA 4HJ5A 1PH8A 2JA8G 4BBSH 1I50H 1NMFA 1P16A 3EBEA 4JBMA 3D31A 1FJGQ 4DR6L 3TRZA 1EWIA 3A0JA 4QL5A 2NVYH 3F8TA 1YZ6A 1XMOQ 4BA2I 4LF9Q 1VQDA 3S17H 1JJCB 1YHBA 2K4KA 4O2DA 1WCMH 4DUZQ 5GAEC 1PHJA 3CQZH 2UXDQ 1C0AA 4PZ6A 4BBRH 3KOJA 1VQIA 1W3SA 3ZJYC 2QA4A 3K7UC 2VUMH 4NXNL 1YJWA 1XNRL 2UXCQ 3NEMA 2Q2HA 2OWOA 1QVFA 4OWXB 4DV0Q 4DUYL 1D8LA 4PZ8A 4LF5Q 2JA8H 1ASZA 2NVQH 2HHHL 3JC66 1CKOA 1YITA 2JEAI 3H15A 3GD7A 4OO1G 2EIFA 4DR6Q 3JAMc 4K0KL 2NVTH 3S1RH 4B3SL 4WJ4A 1KRSA 2AWOA 1EIYB 2MQHA 1FL0A 4JBKA 2F3IA 3GTLH 4GLVB 4AQYL 3L0OA 4R1JA 3J80c 3Q8DA 4NXNQ 4BXXG 1E7ZA 1HZBA 1NTGA 2YYZA 3PUVA 1YHQA 5C4XG 2OQKA 1FVIA 5ELNA 2HHHQ 2B29A 2I5HA 3CC7A 4DKAC 1PH5A 2C35B 1PYSB 4JOIA 4K0KQ 3GTGH 4B3SQ 3CCVA 2CFMA 4AIMA 1XJVA 2BA1A 2JA6H 1IBML 1R9TH 3CPFA 3TQYA 2D0OA 3J81i 4AQYQ 4P75A 4DAMA 4OWWB 2F4VL 4BXXH 3PCOB 3F2CA 4NB3A 1YVCA 2HQLA 3TS2A 1X6OA 2R7FA 4AYBE 2YV5A 3STBD 3KDFA 5C4XH 2UU9L 1K0RA 4X66L 1GO3E 3KFUA 1WI5A 3BZCA 3PO3G 5IYDG 1SE8A 2OQ0A 1SMXA 3MXNB 2DUDA 2CWAA 4LUVA 4A75A 1E1TA 4NXML 1X56A 2WAQE 3EN2A 5M5YH 4LF6Q 4JBWA 2D0PA 1VQ7A 4AYBG 4UY8C 4LFBL 1IBMQ 4IJHA 3HOUG 3KJOA 5IE8A 4GNXC 2A8VA 4RMFA 1VQOA 2F4VQ 1WFQA 4GOPC 3AYHB 5H1SE 3T1YL 1A0IA 4DPGA 3E9IA 2WAQG 4LF4Q 3CCQA 1I3QH 2UU9Q 4L5RC 1E24A 3UE0A 2ID0A 1PH7A 3PO3H 5IYDH 1HH2P 1UE7A 3HFZB 1HZ9A 4LFAL 4LFBQ 3A74A 4PMWA 1FGUA 4QGUA 3CXCA 4YWLA 3HOUH 2VQEL 4IFDI 1YEZA 2I5MX 1RIPA 2MO0A 4J15A 3K8AA 1VQAA 3T1YQ 4DAYB 1I94L 3GO5A 4JG2A 3CCUA 2LXJA 3GTJH 4MTNA 5C44G 4L5TA 5LMNW 1Y1WG 3F2BA 3VDYA 3M9BA 1KC8C 3TS0A 1B7YB 4DR1L 3RN2A 4JV5L 1T9HA 4Y52H 4LFAQ 1MKHA 4IFDJ 1CKNB 1OXTA 2ALYB 2VQEQ 1WYDA 2BA0A 3PUXA 3HOZG 1I94Q 1VS0A 2V1CC 2IHFA 3W1BA 3NELA 4MZ9A 5C44H 3KJPA 4A3FG 1A63A 1Y1WH 1VQ6A 1YBYA 1BBUA 4UPAA 5JJKA 2RF4A 1WCMG 4DR1Q 3OYYA 1ASYA 4JV5Q 5FJ8G 2YTXA 4A3BG 1KAWA 1YI2A 3CCMA 4A4IA 2JEBI 1SROA 4IFDG 2OTJA 1JT8A 4HIOA 1KQSA 3GTPH 3KF6A 3PV0A 1GKHA 1K3RA 3HOVH 2VY3A 5AJ3L 1VQLA 3HOZH 3KDFB 4EQ5A 4YCUA 2CKZB 4A3FH 1VQ9A 2E8GA 1G291 4HJ8A 4LF4L 1G6PA 1PH4A 1IBLL 1SN8A 1OTCA 3RZDH 4X65L 3HOWG 4KHPQ 1PH3A 3HKZE 3RR5A 2ZJRA 5FJ8H 3S24A 3AEVA 4A3BH 3I7FA 1VQEA 1VQ8A 1WOCA 4P73A 2R92G 3S1NH 4A3LG 4DV5L 2BH8A 5AJ3Q 3M3YH 3HKZG 1CSQA 4LWCA 4X64L 1AE3A 3J7ZC 4BY1G 4JI8L 4YHHL 3I55A 4R4TA 1PH2A 2K50A 2Z6KA 3E9HA 1Q81C 1QVGA 1DGSA 2HIXA 1IBLQ 1E22A 1I5FA 1S3OA 2MFIA 4TVAB 4LUZA 3CP0A 4UP9A 4IPGA 2JA6G 3HOWH 4WJ3M 1CKNA 1XPRA 2KENA 3M4PA 2N49A 1HR0W 1XNQL 1V9PA 3GTMH 2D62A 1RL2A 2Z0SA 1HNXL 1XNRQ 3UDXA 3S16H 4JI6L 4HJ9A 4POGA 4DUYQ 1XPUA 2R92H 4A3LH 4LF8L 3J81c 2R7ZG 3CD6A 2UUAL 2WP8J 1JJ2A 3ICEA 2VW9A 3ULJA 4X64Q 4BY1H 2KBNA 1KHIA 4JI8Q 4YHHQ 1MIUA 1X65A 1L1OB 2FXQA 3OTOL 3G6EA 4IOCA 2I0QA 3L7ZC 2BH2A 1E1OA 2WFWA 3K81C 2PNHA 1XPOA 4DV1L 1OXVA 2ASBA 2GVBA 2UUCL 1XNQQ 3U50C 3AQQA 5GAHC 1HNXQ 2UUBL 4JI6Q 2YTVA 4A3DG 2OCEA 2AKWB 1PV4A 4UP7A 1EYGA 1TWAH 5JEAG 4LF8Q 2HT1A 2R7ZH 1JMCA 3LGJA 1Q12A 1VQMA 4X6AH 5C3EG 1NJIC 3GTOH 5EAYA 2PI2E 3OTOQ 1Q86C 1GM5A 2DGYA 3DLLA 3BU2A 1N36L 4DK6C 2XTIA 1X54A 1XTDA 3W5OA 4DV1Q 1VQ4A 2YU9H 3F2DA 2ZJQA 4KLKA 3S15H 4GOPA 3PSIA 3PIPA 5JJLA 2QEXA 2UUBQ 4A3DH 2E2IH 3STBC 3KF6B 1O7IA 3RNUA 2I5LX 3RZOH 2CWPA 2UXBL 3S14H 2EXDA 3B6YA 4X66Q 4LFCL 3I4MG 1UE6A 2ZTDA 4YCWA 5C3EH 4IPDA 1X9NA 1OXXK 2ZM6L 1VQBA 1QZGA 4NXMQ 1D7QA 4A3IG 3CCLA 1VQNA 1TWGH 4JCVE 1N36Q 1IL2A 2R7DA 4FDBA 3PF4A 1IBKL 4QQBX 1I6HH 1HJPA 4JI5L 3NENA 2VQFL 4DR3L 4UP8A 1Q8KA 2AMCB 2IT1A 2VZAA 3WWVA 1PYBA 2E2HH 3RLOA 3I4NG 2IY5B 3E0EA 1BVSA 2VNUD 3CMAA 4B3ML 2UXBQ 1XMQL 5C4JH 2E2JH 3SGIA 4JC0A 3I4MH 4LFCQ 1L1OA 3K7AH 4DV7L 2Q2IA 3M85A 3I4OA 4DV3L 3PO2G 2K75A 4JI3L 2PQAA 2ZM6Q 4QJFA 2H5XA 2PMZE 4GN3B 2K52A 5GAGC 4Y7NH 4A3IH 2GN5A 4P72A 3PUWA 1YJNA 1VQPA 3TREA 1Y1VG 1IBKQ 4JI5Q 2VQFQ 4DR3Q 4APVA 1YJ9A 1EUJA 1EQRA 3J7A5 4YY3L 1UE5A 4A3EG 4H02A 1KL9A 2MO1A 1NE3A 2HIVA 4JI7L 3I4NH 4DR7L 1TWHH 5IT9c 1LM0A 1UWVA 3G48A 3CC4A 1V43A 3NBHB 4LUOA 4TQUS 3RLNA 2NN6I 4B3MQ 1SFOH 1XMQQ 1N33L 1HZCA 3PO2H 3G71A 4DR5L 1TWCH 3ULPA 4DV7Q 4DV3Q 1VQHA 1K8AC 2R93G 4DV6L 4JI3Q 1JJGA 1WJJA 1PH6A 3L2PA 4L5QA 4A3JG 4LNQA 2JJQA 1Y1VH 4GS3A 4MNOA 1S40A 2VS1A 1Y14B 3KLWA 3W1GA 5IYCG 1K8GA 2LXKA 1PH1A 4A3EH 4YY3Q 4JI7Q 1B8AA 3PIOA 2KCTA 4QIWE 2LSSA 1J5EL 1YIJA 5K36G 1NBWA 3ERSX 4KI0A 5LMUL 3CAMA 4R4QA 2VL6A 1N33Q 2R93H 3AFPA 4HJAA 2IHEA 1XMOL 3I2ZA 4DV6Q 1VQ5A 1K73C 4GKJL 4HJ7A 2JE6I 5IY0A 4A3JH 5M5WH 2MNAA 1N34L 1H95A 1GVPA 4NPSA 4L5SA 3M4QA 4GNXB 1G51A 2UXDL 5IYCH 4A3MG 3GTQH 3GDEA 4OXPA 1OXUA 4GOPB 3S1MH 1VQKA 4BA1I 4OX9L 1L2FA 5LMNL 1HNWL 1W2BA 3CCJA 4JI0L 5ELOA 2RHSB 3S2HH 2NN6G 4HIMA 3K0XA 1J5EQ 2KCMA 3M7NA 1Z47A 5GROA 3HOYG 1JE5A 2QGQA 1YNXA 2KHJA 5LMUQ 4A3KG 1NY4A 5M3FG 3FKIG 4B3RL 1X3GA 4IOAA 2OTLA 3AFQA 1CSPA 4X65Q 3A5ZB 4GKJQ 5E7NA 4A76A 2ES2A 1BBWA 1N34Q 2JA7G 4OONA 1IZ6A 2A1AA 4A3MH 3CMEA 2A19A 1PFSA 2WB1E 4XTCS 4GKKL 3CC2A 4ME3A 4OX9Q 2XGTA 5JEAJ 5LMNQ 3FP9A 3CCSA 4JI0Q 1CKMA 4R4CA 4C3HH 2R6GA 4DV4L 4DV5Q 1HNWQ 3IRBA 1LYLA 1JB7A 3PF5A 3UDFA 4JBJA 3HOYH 4A93G 2CQOA 4A3KH 3G4SA 1J6QA 5M3FH 3FKIH 4B3RQ 2WB1G 2K5NA 3PGZA 4C3JH 2PQAB 2AWNA 3ULLA 4JI2L 3GTKH 1S72A 3BZKA 1VQCA 2Y0SE 4KHZA 2Z6KC 5M5XH 3HOVG 5J3BA 1K83H 3CCEA 4GN5A 2JA7H 1BKBA 4DV2L 4JI1L 4GKKQ 1PVOA 3JAMi 4DK3C 4BY7G 4IPCA 1EIFA 2F52A 2IX0A 2Y0SG 5GADC 4DV4Q 2UUAQ 4A93H 3K80C 5BR8L 1A62A 3CF5A 1Q46A 2K14A 4GN4B 5M3MG 1V1QA 3RN5A 4PZ7A 2IX1A 1VQGA 2NVXH 1C9OA 3J80i 4JI2Q 1VQJA 4GLAC 1NMGA 4IJLA 3D0FA 4LF6L 1P8LA 2AHOB 4JOIC 4EX5A 1L0WA 5IP9G 4GNXA 2RHQB 3H0GG 1VQFA 2JQOA 5C0XI 5HY6A 4DR4L 2UUCQ 4YWMA 3BJUA 4A3CG 4DV2Q 4IPHA 1SR3A 3EIVA 4JI1Q 4LF7L 1E3PA 1QVCA 3KYHC 3HKSA 1Q1BA 1Q7YC 4BY7H 4LW1A 2ZTCA 3CPWA 1UE1A 4R4OA 3PUZA 4XIGS 1YHAA 5BR8Q 5M3MH 1HR0L 2GVAA 4C2MH
chains in the Genus database with same CATH superfamily
1S5BD 5DM73 2L15A 2Q8TA 3OW2A 4JPBW 5KRUA 2FJ2A 2E76C 2Q2UA 1LT5D 1TY2A 5IP7G 4A3CH 2XN9C 3U4ZA 2B63G 2KEDA 3D3RA 3OWEB 3BVGA 3CCRA 3D4RA 4POFA 4B9WA 2AQ2B 4B3TL 2Z9HA 4BS9A 1HR0Q 4RG1A 1MJEA 3GTJB 2D2CC 4O0AA 4CDDC 1EQQA 5HGQA 5FLMG 5JOBA 1X55A 2H1EA 2RA4A 4RHSA 4BWGB 1TVXA 5KNDA 2KVMA 3MHBA 4B3TQ 2EQSA 1EFWA 1K9MC 4A3GG 5GQOA 4DR2L 1SAPA 3J7AV 3H3VH 2ZJPA 3DMUA 1IKMA 1HFGA 2YTYA 3UDIA 1EEFD 4QY7A 1I4XA 1Y1VB 4RKBA 2HDMA 3T1HL 4FF4A 3RLFA 3DM3A 2OT2A 1XWEA 1EY4A 1SBBB 3I3CA 2ATWA 4J6HA 4DR2Q 4HIDA 1LTLA 1STEA 3HOXH 2VUMG 3P1HA 1IXRA 1IYJB 2UXCL 2KCCA 1QZHA 1HZAA 5M5WB 2B3GA 1WTWA 1VF7A 3PIP3 3T1HQ 4KV6A 3EJIA 2PI2A 3U4VA 4HJ5A 4BBSH 1I50H 5EKKA 4JBMA 2IWHA 1EWIA 1EY7A 2NVYH 1RODA 1YHBA 3IFDA 1WCMH 1RJTA 1S5FD 4PZ6A 5CC4A 3K7UC 4NXNL 4FF1A 2UXCQ 1QVFA 3ERQA 3MAQA 3HGBA 3C2PA 2JA8H 4C3HB 1EWHA 3HOYB 1MHWC 2XWJB 1K8OA 4CJ0B 1EQTA 4N8FA 4GLVB 2QILA 3L0OA 4R1JA 4R9WA 3J80c 1RD9D 2BE5C 4NXNQ 1HZBA 1LTAD 1NR4A 3NP8A 4OELB 5C4XG 4V0BA 1SYFA 3D4DA 2FINB 2I5HA 5LL6S 5JJZA 3CC7A 4OO1H 2G9DA 1PYSB 2MUYA 4JOIA 5CV5A 4DXFA 3GTGH 2CFMA 2V4DA 1HRJA 4CKEA 2KHSA 1G2TA 2JA6H 2I07B 2WIIB 1XYIA 4BXXH 1FGBD 1Q3LA 3S15B 4J8QA 4NB3A 1X6OA 3STBD 3N52A 2UU9L 2DY8A 2F0KA 1GO3E 3PIO3 1WI5A 3I70A 1F2ZA 2K5QA 1SE8A 1DCZA 2CWAA 3EN2A 4LFBL 2OEOA 2D0PA 2EE1A 3A7AB 4UY8C 5IOCA 4RMFA 1L0YB 4GOPC 3T1YL 4X3TA 2UU9Q 4L5RC 1YNND 1E24A 2NZ1D 1SYCA 3PO3H 3I4MB 2A5HA 2A68C 1XTCD 4LFAL 4LFBQ 3X3MA 1FGUA 3CXCA 2I5MX 2MPMA 3BDOA 2XRQD 3J80L 2MO0A 1O7ZA 2F3WA 3I4NB 3T1YQ 3L9AX 3GO5A 2FMMA 1JOOA 3KLSA 4L5TA 3F2BA 1SFOB 1SJHD 1L0XB 1KDAA 3TS0A 2E2DC 4Y52H 1CK1A 4LFAQ 1RDPD 4IFDJ 2O4XA 3TMEA 1M4VA 1Z7TA 2BA0A 1TIID 5KNBA 3PUXA 4I7ZC 1BOSA 4A3FG 3VR2A 5A2QE 1Y1WH 2MHVA 1YBYA 4UPAA 1CZWA 1WCMG 2JA5B 1ASYA 3I91A 4DN4M 5FJ8G 1Y8NB 5CYUA 4ME5A 2CVRA 3CCMA 2JEBI 4ILWA 3R93A 4L6TB 3NWTA 4A3JB 4HIOA 3GTPH 4WORA 3S1MB 2JSOA 2VY3A 5AJ3L 4DNTB 1G91A 4F7XA 4EQ5A 1KAAA 4LF4L 3S2HB 2EXZA 1GUWA 4HJ8A 1G6PA 1CHPD 1SDFA 4NP5A 1M8AA 2IX3A 3N6RA 4DA2A 2F0HA 1QNKA 3VA7A 4IFDH 2CQAA 4XQQA 4A3MB 4A3LG 4KN4C 5AJ3Q 3M3YH 2F0LA 1PRTF 1WTQA 1CSQA 4C1NI 4LF4Q 1A15A 2HIXA 1E22A 1I5FA 1S3OA 4LUZA 5C6AA 2JA6G 1CKNA 1XPRA 2N49A 1XNQL 1V9PA 1XNRQ 3UDXA 1A2UA 4HJ9A 1BNZA 1XPUA 1V1PA 1A3UA 5KNCA 3J81c 1Y8OB 1BF4A 2KJXA 1KHIA 1B44D 3K81C 2EYFA 2A74C 2KQ3A 4ABNA 4DAPA 4N9PA 1HXYD 3D4WA 2GVBA 1XNQQ 5CMDA 5C5MA 3U50C 5GAHC 3OMCA 2OCEA 2AKWB 1PV4A 2F0JA 3FEWX 2A6EC 2R7ZH 2HT1A 3LGJA 3GV3A 4RFBA 5EAYA 2F0TA 1Q86C 4OGQC 1N36L 4DK6C 1VQ4A 3W5OA 1V8QA 4KLKA 3PSIA 3PIPA 4H0LC 1O78A 3H0GB 3MXUA 5FLXE 5JJLA 3KF6B 2I5LX 3OIPA 1LTRD 1LT4D 2BOSA 3S14H 3B6YA 5E4XA 5KIXA 3I4MG 3OPOA 5C3EH 2F0IA 1DOKA 1X9NA 1EOTA 2PZUA 3NHHA 1BCPF 2DN8A 1I3QB 2N88A 4TKOB 1TWGH 5JVG3 1N36Q 3PF4A 4FDBA 2Z1CA 1HJPA 3NENA 2AMCB 2VZAA 3I4NG 1TY0A 1BVSA 2VNUD 1JWUD 3DM1A 5ELEA 1ENCA 3FVQA 1XMQL 5C4JH 4HCSA 3M85A 4JI3L 1DYQA 2WACA 3K6OA 2PMZE 2B2WA 3MVVA 4Y7NH 4A3IH 4P72A 3JAME 3TREA 2L11A 1ZKOA 3VYTA 2D5DA 3KBXA 3J7A5 1EQRA 1UE5A 4DR7L 1TWHH 4CDEC 4HAEA 1V43A 3NQTA 2FFKB 1QOHA 5C5LA 3DUZA 3T16A 5A35A 3EA6A 1XMQQ 1UEAB 2CW0C 1IKLA 4DR5L 5A2QL 1K8AC 4X6AH 4DV6L 4JI3Q 1YNJC 1BBXC 2AUKA 3L2PA 4L5QA 4A3JG 2JJQA 4GS3A 4EQPA 1CHQD 2VS1A 1K8MA 2RSOA 3PIOA 1J5EL 2F0WA 5LMUL 4R4QA 3C1EA 3VR6A 4U673 1RTOA 2VB3X 4HJAA 3A55A 4DV6Q 1H95A 1N34L 2MNAA 2UXDL 4RH6A 1R4PB 4A3MG 5T1GA 3GDEA 4GOPB 1KNEA 3K57A 2NN6G 4HIMA 3K0XA 1J5EQ 2KCMA 3MFGA 1Z47A 1SSOA 1YNXA 1EQVA 2KHJA 5LMUQ 2XRSD 1UNSA 5M3FG 1DJRD 5DEHA 3A56A 1FNWA 1CSPA 3DWPA 5BN3A 3W2DA 4A76A 3OWFA 1N34Q 5IGBA 2A69C 3HOWB 2J0TD 3CRLC 3MEHA 4IUPA 3NBHA 2BE5D 1JWMD 1JQYD 4DV4L 3IRBA 3UDFA 2R92B 1F2LA 4A3KH 3G4SA 1J6QA 2HD3A 3NUCA 4C3JH 2PQAB 1CT1D 4GZYC 1S72A 3BZKA 4KHZA 4E6IA 4XYQA 4GN5A 4HTHA 4DV2L 3H3VC 1X32A 1PVOA 3IKJA 4O1NA 1BUVT 4LAAA 1SYBA 3QIAA 1EIFA 2F52A 2IX0A 4DV4Q 2EY1A 5HGTA 5I2YA 3NPPA 4OL7A 4IQZA 5LL6X 1EWCA 4GN4B 1PYWD 4ZCKA 1FNUA 1V1QA 4JK1C 1ZEQX 2IX1A 5ELBA 1PZKD 3TZDA 4HMIA 1VQJA 3GTOB 3H3VI 3D0FA 1P8LA 3C3LA 3HOVH 3H0GG 2JQOA 4DV2Q 3Q22A 3A54A 1SR3A 2YU9B 5FLXL 2CH4W 4LW1A 2XWBB 3VYSA 5DAUA 1JJGA 2E5LL 1Q82C 2ZXOA 1STAA 2EJMA 3KLRA 1TWFH 5IP9H 2A68D 1NR2A 1Q1EA 3FHWA 2EZVA 4YWKA 5D3DA 5CGKA 1I4RA 1SE4A 1KD1C 2B2VA 1QILA 1HNZL 2HCIA 4P74A 3TP6A 4R8NA 4JYAL 2E5LQ 1M1KC 4AH6A 5C3WA 3JAML 2F0DA 5IP7H 2D9UA 1KXLA 2L4NA 4G4KA 3P20A 1SRUA 2B63H 2X6GA 1U9RA 1VDZA 2N8NA 5IYBG 3T13A 4IZ8A 4MIUA 1HNZQ 1C4QA 1Z9FA 4G7OC 4JYAQ 1M90C 3PO2B 2CCZA 1AH9A 1JORA 2PW7A 5JVH3 2KHIA 2C5CA 2PZTA 3MC0B 2B2WC 4OWTB 4NKLA 5FLMH 2H4OA 5DLQE 3U9OA 2L9HA 4GLXA 4K8JA 4ALPA 1PZID 1O80A 2ZXRA 3WOEA 4B08A 3KF8B 5D14A 4A3GH 4OO1I 1SEBD 5JAVA 2DY7A 4KHPL 4DUZL 2R93B 4DNIA 4DNRB 3S1QH 1QUQA 5K36G 1EY6A 1KDBA 1ENFA 4DV0L 4HIKA 1N9WA 1UEBA 2NZHA 1GHKA 1PH8A 3SR1A 3EBEA 1B4OA 3D31A 4DR6L 4QL5A 1XMOQ 4BA2I 3S17H 1JJCB 1UAPA 5GAEC 4DUZQ 2K05A 3CQZH 3QJYA 2SEBD 3QWNA 3KOJA 5CORA 3ZJYC 2VUMH 1IW7C 2FHTA 2Q2HA 1O7YA 4DV0Q 4ZK9B 4HSPA 5C4HA 4MHEA 3IAYA 2JEAI 2X69A 4DR6Q 1TT2A 2NVTH 3S1RH 1AN8A 3W3AA 3FKIB 1FYCA 3GTLH 2F3IA 1F9QA 1EU3A 1GUOA 3BYYB 4AQYL 2JA7B 1E7ZA 1NTGA 4CKCA 2OQKA 5ELNA 5J1ZA 2B29A 2A6ED 1TWAB 3TDQA 4A93B 1EIHA 4EVOA 4IUVA 1XJVA 2J7ZA 4HN7A 1R9TH 2JN4A 4AQYQ 4UAIA 4DAMA 3F2CA 1YVCA 2R7FA 3KDFA 5C4XH 2ZXPA 4RAUC 4X66L 3KFUA 4BY7B 3BZCA 5IYDG 3J7YW 4A75A 2L1BA 1J9OA 1E1TA 1B50A 1F2MA 5M3MB 1FNVA 2O2LD 4LF6Q 4JBWA 1JOQA 1DXMA 3HOUG 1I6HB 1WFQA 2E2HB 3E9IA 5IGEA 3CCQA 3I8ZA 3UE0A 1EU4A 1HH2P 1T5EA 3HFZB 5CV8A 2HDLA 3A74A 2RCFA 1QE6A 4YWLA 4LK1C 1R4QB 2XNAC 5F2DA 4IFDI 2LY7A 4J15A 5FO8B 3K8AA 3QO2A 4JG2A 2B2VC 3GTJH 5C44G 3SK6A 2O5IC 5LMNW 3NWSA 1C8CA 2CW0D 1B7YB 2C9OA 1EY5A 4JV5L 3NXWA 1ZYRC 2PZWA 1CM9A 3EVQA 1YNJD 1MKHA 3BYTB 1CKNB 4Q0FA 1STBA 1SYEA 3T53B 1B53A 1ICFB 1WYDA 4HSVA 1VF5C 3PQIA 1KNAA 4N8X1 3HOZG 5I2XA 3KJPA 2NUCA 3W1BA 1A63A 3MXNA 3NELA 1VQ6A 2RF4A 1VMPA 4FXDA 3MWYW 4JV5Q 4I7AA 2SNSA 1JT8A 2OTJA 1KQSA 3HOXB 3D8GA 1Y69U 1K3RA 2PNRC 5JPNC 4YCUA 2TSSA 4A3FH 2E8GA 1G291 1B9NA 1LTTD 2ICEC 1SNQA 1II3A 1I50B 1SN8A 3RZDH 1D2BA 5CR3A 4X65L 1PH3A 2E74C 2ZJRA 2NVYB 5FJ8H 1WVLA 3I7FA 1VQEA 1I4GA 2A69D 2L0CA 3S1NH 1IL8A 4DV5L 2XIWA 4LWCA 3T4AC 3NTIA 3J7ZC 2ENBA 4BY1G 3I55A 2F0MA 4R4TA 2K50A 2Z6KA 3E9HA 1QVGA 1PH2A 1DGSA 3ITPA 4UP9A 4IPGA 4WJ3M 3ZYYX 3M4PA 5IIFA 3GTKB 2PW5A 1E2ZA 4A3LH 3CD6A 2UUAL 2WP8J 1T5XD 3EQLC 4QMGA 3ULJA 4KJOA 2VW9A 3LWEA 5K5PA 3G6EA 2K5DA 2FXQA 3LNNA 3L7ZC 2BH2A 1XPOA 1CTMA 4I65A 3R2IA 5M3MH 4XDXA 1MBYA 4CHTB 2PQEA 3AQQA 1K28A 1A2TA 5CV9A 1EFID 5JEAG 2F0EA 1JMCA 1PTOH 1NJIC 1U4MA 2PI2E 1Q90A 4C2MB 1H9RA 1X54A 1XTDA 1WTHA 3S15H 1D5ZC 3S9WA 3VYUA 1O7IA 3RNUA 3RZOH 3DWQA 4C3IB 1KTKA 2EXDA 5ISRA 4IPDA 4PQXA 2ZM6L 1SMYC 1VQNA 4ODGA 1RHPA 3PO3B 1Z6HA 3H94A 4JI5L 4DR3L 4UP8A 1Q8KA 3WWVA 1PYBA 1TS4A 3RLOA 4AYBB 1DONA 3A7LA 4B3ML 3I4MH 4DV7L 2Q2IA 4DV3L 2WAQB 2K75A 3DXJC 2ZM6Q 1WTRA 2Z4HA 1YJNA 3IL8A 1VQPA 1Y1VG 1K0SA 3SVMA 4JI5Q 4DR3Q 3TP8A 1TKWB 4H02A 2M00A 2MO1A 4RGOS 3I4NH 1B3QA 4N9TA 1UWVA 3S2DB 3CC4A 1E2VA 3NBHB 3X3NA 4LUOA 4TQUS 1RKNA 4B3MQ 2QEJC 1V1OA 1SFOH 2QKIC 3G71A 4FXKC 4DV7Q 4DV3Q 1VQHA 2Q8IB 2PYKA 1D1IA 1Y1WB 4LNQA 2XVSA 4MNOA 4IALA 3KLWA 1KLUD 1EYAA 1Y14B 5COYA 5IYCG 2LXKA 1PH1A 3M7GA 1F9PA 2KCTA 4EQNA 2LSSA 1F77A 3SEBA 3GTPB 2J4XA 3NTHA 3O13A 3I2ZA 5IODA 5E3FA 5FO9B 1B1ZA 1K73C 4A3JH 2TMPA 1GVPA 5E4WC 1WD1A 4X3KA 1OXUA 3S1MH 4BA1I 3UI2A 4BBRB 1D1KA 1HUMA 3K58A 1HNWL 1IW7D 1NNXA 3TBIB 4C3HG 3S2HH 3HOYG 5IGDA 2NVQB 1X3GA 2CHBD 4DGZA 4IOAA 2NB0A 3ND8A 3EROA 5E7NA 3URYA 1BBWA 1JICA 3ONAB 4OONA 1IZ6A 4A3MH 4MN3A 1PFSA 4XTCS 3CC2A 4XT1B 3FP9A 3CCSA 1HNWQ 3DWAA 4R4CA 2R6GA 2NN6H 1EY8A 1LYLA 4XQNA 5M3FH 4KKUA 5EGTA 3HKZB 3PGZA 3ULLA 2Z6KC 3WDNA 1K83H 1BKBA 5C3XA 4G57A 3BS1A 2K04A 4IUNA 4DK3C 1GHJA 1S4ZA 4IPCA 5GADC 1RCVD 1SE2A 4WFN3 2RSNA 2K14A 4RCOA 3AMUA 2NVXH 3J80i 2AHOB 4JOIC 3VYRA 4GNXA 1L0WA 2RHQB 3RMHA 4IPHA 4C3IG 4HEDA 1QVCA 3HKSA 1Q1BA 1OO9B 3MZ5A 1UE1A 4R4OA 4FVMA 3S14B 1GD7A 5C3EB 2K5VA 3H0GH 2NZOA 4PV1C 1QUQB 1B3AA 1VCIA 1MJCA 1MSHA 1SJED 4KKSA 2OF1A 5JJIA 2F0SA 5IWAL 4R4IA 1LUZA 5C0XG 2ZTEA 4G7ZC 5EPJA 4A3IB 1ZYRD 3V96A 3AB9A 3KK7A 1KRTA 3F1ZA 2N3SA 2K5HA 1AFPA 1PH9A 2K33A 2JA5G 2F0VA 5CV4A 1X3FA 3PUYA 5IWAQ 3QB3A 4IUTA 1N8RC 4X62L 2KOLA 1N32L 1SNPA 4DR7Q 5EJWA 1STHA 3A8JE 1S5DD 5IYBH 3OSOA 2F4IA 2EDGA 5EPKA 3CW2C 1A8VA 2BDOA 1FJGL 3MEFA 4DR5Q 1U0LA 1ILQA 1NUCA 2EYHA 1TXYA 4DK1A 3M4OH 4Q5VA 4BBRG 4X62Q 5FLXc 1JCKB 1B70B 1AE2A 2B39A 1N32Q 3QOJA 4A3BB 4QUFA 3HRZC 1OXSC 4YIJA 2JK8A 1C7YA 4LF5L 4XXEA 4DXGA 3LX0A 4FF3A 1JC7A 1FJGQ 3TRZA 3F8TA 1YZ6A 5M9OA 2K4KA 4O2DA 4V190 1PZJD 2QDBA 1PHJA 2UXDQ 1PLFA 1VQIA 1W3SA 2QA4A 5K36H 5DM63 5G3LF 4QIWB 1EYDA 1YJWA 4LJZC 3NEMA 4X3SA 4DUYL 1D8LA 3S16B 1DM0B 4JW0A 4PZ8A 4LF5Q 4TSSA 3JC66 1GUGA 1H9SA 1HTPA 1GOZA 3Q0AA 3H15A 3GD7A 2EIFA 3JAMc 4B3SL 1E2WA 4WJ4A 1KRSA 2AWOA 1CA5A 1EIYB 2MQHA 4JBKA 3I90A 4C3JB 1EYCA 2L55A 1GJXA 5EKLA 2Z8LA 4B9XA 3Q8DA 3NTKA 4K5XA 5L37A 3PUVA 5IT9E 2LS01 1DZ1A 3CHBD 4B3SQ 2DNEA 2EVBA 1IBML 2WB1B 1G8ZD 3CPFA 2AQ3B 3TQYA 3J81i 3HOVB 3LWUA 1JR0D 4ZRZA 2F4VL 3PCOB 3EFXD 5C4ZA 2HQLA 2NBFA 2OXPA 4AYBE 4A3DB 1D5MC 1K0RA 5KGUA 5ELCA 1GUTA 2Y0SB 2JP1A 2OQ0A 1SMXA 3DHQA 1GUNA 2DUDA 3MXNB 4NW2A 4NXML 1X56A 2QDLA 2WAQE 5M5YH 1SMYD 1HUNA 3SE0A 1IBMQ 5CBAE 4IJHA 1LT3D 4GNXC 1U4LA 2A8VA 1TWFB 1ET9A 2F4VQ 2NWGA 3K59A 2ID0A 1MD2D 5IYDH 2E2JB 1UE7A 3K7AB 4FYDA 3RD4A 1HZ9A 2ZT9C 4QUCA 4PNYA 3HOUH 3FDTA 3SXHA 2VQEL 1YEZA 1CQFA 2R3ZA 4RKLA 4RWSC 4CGYB 3CCUA 2B63B 1PFNA 4MTNA 4RGTA 2F0GA 3P7JA 4DR1L 1TWCB 3J7AF 1J8IA 3NSWA 5CV6A 1OXTA 2ALYB 4KY7A 4J1MA 2VQEQ 1TU2B 2RDGA 1FR3A 4A3EB 5EQ0A 1W6JA 2IHFA 5C44H 1MI2A 5JJKA 3U9SA 3SK5A 1MGSA 3OYYA 4DR1Q 1PTOC 1TQOA 4A3GB 4FNFA 4A3BG 1DOLA 1KAWA 4KY5A 1YI2A 2K6AA 4A4IA 2IPKD 3HEJA 4K5WA 1SROA 4MTKA 3GTQB 3KF6A 3PV0A 1GKHA 3S1QB 1H9KA 1VQLA 3HOZH 2CKZB 1BR9A 4ZLTF 3TN2A 1IBLL 1OTCA 4ZUIA 3HOWG 4KHPQ 1DD2A 3HKZE 3AEVA 3E5SA 1Y8PB 3R3OA 1WOCA 5KYLA 2NTSA 4P73A 2R92G 4K8IA 4DAYA 3E6ZX 2F0OA 3OOCA 1HHVA 1H9MA 1AE3A 3BVMA 1Q81C 4QB4A 1IBLQ 1EZ6A 4S3SA 4CDFC 2NVTB 2I46A 2KENA 3GTMH 1HR0W 1AEXA 1RL2A 2Z0SA 5M5XB 1HNXL 4TRDA 5IT9L 3MXGA 2L5TA 4BY1H 2KBNA 4IOCA 1MIUA 1X65A 3OTOL 4ZQ3A 1BO0A 2HQEA 2PNHA 4DV1L 2UUCL 3SK8A 1HNXQ 2YTVA 4A3DG 2B8GA 2B2YA 3M4YA 2P5ZX 4UP7A 1EYGA 1TWAH 5T1IA 3NQIA 1EY9A 2M2LA 5G3LD 4ZAIA 1PFMA 3OTOQ 1GM5A 2DGYA 4M1UB 3BU2A 3DLLA 2B8FA 4DV1Q 5NUCA 4GOPA 1XX8A 4CJ1B 2QEXA 2PPBC 2E2IH 2HUGA 3KUPA 2UXBL 5JEAH 4H13C 4X66Q 1UE6A 2ZTDA 4YCWA 3BDLA 1OXXK 1VQBA 1D7QA 3CCLA 4JCVE 1WTPA 1I6HH 1IL2A 2R7DA 1IBKL 1HA5A 5D3IB 3G7LA 2VQFL 4JVZA 4XYOA 2AUJD 2E2HH 2IY5B 5FOBB 4DAVA 2VB2X 3CMAA 2UXBQ 2SOBA 4F87A 4DK0A 1QCBD 3OW7A 4JC0A 3PO2G 1L1OA 5EKIA 3I4OA 2PQAA 4QJFA 2H5XA 3PUWA 5CV7A 1IBKQ 2F0UA 2KCNA 3FRPB 2VQFQ 1STNA 1CFMA 4JI7L 4A3EG 4C1NK 1KL9A 2HIVA 3G48A 3J80E 1LACA 1V1PB 2NN6I 3ULPA 2R93G 3GQBA 2A73B 1WJJA 1UUPA 1PH6A 2G5DA 1Y1VH 3W1GA 1QNUA 4Z9CB 1K8GA 4JI7Q 1B8AA 1CZGA 2A6HC 4K2KA 4QIWE 5AFWA 5IGFA 1NBWA 4C56C 3ERSX 4KI0A 3CAMA 2PMZB 3AFPA 4BBSB 2IHEA 4H44C 1VQ5A 4FF2A 1KABA 4A3FB 4GKJL 1PDQA 3SDZA 3I73A 5IY0A 5M5WH 4NPSA 2F03A 3M4QA 4GNXB 3RZDB 5IYCH 1WCMB 4OXPA 5LMNL 2QCPX 1W2BA 3CCJA 1HQRD 1HFNA 2RHSB 2EYOA 3M7NA 4U68A 1JE5A 4O42A 5I4DA 3S1NB 2PCFB 2JA8B 3FKIG 4KTAA 2O5JC 1SNMA 2K01A 4K2LA 4X65Q 4GKJQ 2Z4IA 1EZ8A 2JA7G 2A1AA 1HQMC 2A19A 2WB1E 4KN7C 1SYDA 2XGTA 5LMNQ 2K7VA 3C1FA 1CKMA 4KD3A 4C3HH 4DV5Q 3R2TA 4A93G 3PF5A 3HOYH 2CQOA 1AZQA 3NK9A 3GTKH 4DU9A 1VQCA 2Y0SE 4K6DA 3GTGB 2B2UA 2JA6B 5I9PA 4JI1L 4IURA 3CKIB 4BY7G 5HURA 2UUAQ 1PXUA 5BN5A 5J39A 5BR8L 1A62A 3KF8A 1BXTA 4RA8A 5M3MG 4CJ2C 1FD7D 2RBMA 2F0NA 3RN5A 1VQGA 1PTOB 4KKTA 5LHY1 1S5CD 1SNDA 4GLAC 4EX5A 1LABA 5EBCA 1VMCA 4DR4L 4M8AA 4YWMA 4PMBA 4A3CG 3EIVA 4JI1Q 4LF7L 2E75C 1E3PA 3KYHC 1QWYA 1Q7YC 1NAPA 3Q24A 2HCCA 3CPWA 2B2YC 3PUZA 2KA7A 5BR8Q 3OMGA 3RZOB 2GVAA 4C2MH 1ESFA 4YCVA 4CKBA 1K3BC 1PRTC 5C0XJ 5EPLA 1E0BA 1SNCA 3UDGA 3A8IE 4XT3B 3TEHB 1GXDC 3AU7A 3A5UA 3BDCA 4DR4Q 5J22A 2EPBA 3Q23A 4K14A 4C3IH 4PG3A 2F0QA 4OEMB 3I56A 4LF7Q 1KLGD 2RDFA 1KIXA 1BQQT 2BCOA 1B2TA 3FPUB 4FO2A 3KLSX 1HCZA 3D6CA 4JI4L 5DNFA 1WTOA 1RF2D 2Q2TA 5KYIA 2RCNA 2EY6A 4IO9A 4L8JA 2RQXA 4X3UA 1PA6A 3J81E 1X3EA 1H9SB 1ENAA 1L1OC 4JI4Q 5C0XH 4F88A 3HOXG 3U58A 1PTOD 2FMCA 3S2DH 4HR7B 4H7BA 2N78A 3J81j 1U5KA 3K0YA 4BBSG 2WKCA 1O7LA 3K5LA 2JA5H 2JA9A 4LF9L 3PMFA 1KDCA 4P71A 1A6XA 1PMRA 5I6YA 1WD0A 5I6WA 3UE1A 1LTGD 1BCPC 1SLJA 2BDNA 1SNOA 1CUKA 3ER0A 3HS0C 1EOVA 1U4RA 2JA8G 4R8IA 1IYUA 1NMFA 1P16A 3M3YB 3A0JA 2EYJA 4LF9Q 1VQDA 4RHRA 1EL0A 4KK7A 3QG1A 3SK4A 1C0AA 4BBRH 3K5OA 2SDFA 1XNRL 2OWOA 4OWXB 3H91A 2IW3A 2R61A 1ASZA 1QJOA 2NVQH 1DOMA 2HHHL 1CKOA 1YITA 1EEID 4ULLA 4OO1G 4K0KL 2EY2A 2M9VA 1HA6A 1ZXTA 5M3FB 2EYPA 1FL0A 4LMQD 4BXXG 4FXGC 1K83B 2QW7A 2YYZA 1YHQA 2IL8A 1FVIA 2DNCA 2HHHQ 4P2CB 3OHXC 2R7ZB 4DKAC 1PH5A 2C35B 3F2UA 1IYVA 4K0KQ 3E0JA 3FMCA 4ID6A 3CCVA 4AIMA 2G9HD 2BA1A 3VR4A 2NVXB 2D0OA 3V05A 3QOLA 4P75A 4OWWB 2B2UC 2F1MA 3SHLA 4KY6A 3TS2A 2NYZD 4UHVA 1H9JA 2YV5A 5JPMC 3PO3G 3A8KE 4LUVA 2CH4A 4KJNA 2EY5A 2EJGC 4L63B 2LFNA 1VQ7A 4AYBG 1STYA 2K1BA 1TWGB 3KJOA 4XQJA 3R8BA 5IE8A 1LV9A 1VQOA 3V2TA 1I4PA 3AYHB 5H1SE 1A0IA 4DPGA 2WAQG 1I3QH 3MFYA 1PH7A 5C4JB 3BVZA 1B9MA 3Q6SA 4ZKCB 2Z6BA 4Y7NB 4PMWA 4QGUA 2MP1A 2GA4B 1RIPA 1VQAA 4DAYB 1TWHB 1I94L 2EJFC 2LXJA 3J81L 1Y1WG 1ET6A 3VDYA 3M9BA 1KC8C 3TP7A 1LO5D 2LKVA 3RN2A 1AZPA 1T9HA 1QG7A 3DEPA 5TSSA 1EIGA 5KEEA 1LTBD 4DF7A 1RTNA 4OIJA 4CDCC 2JYOA 2X6LA 1I94Q 2A6HD 1LTSD 1VS0A 2V1CC 3BZDB 4MZ9A 3TP5A 1BBUA 3C46A 4KMUC 2ICIA 2EYMA 2YTXA 1LT6D 3M4OB 1Q8IA 1I4HA 4IFDG 3ND9A 3K5MA 4NDXA 4K6LA 5I9OA 3KDFB 1VQ9A 1LLRD 1STGA 4OHJA 1PH4A 3HP3A 1PRTB 2B2TA 3K5NA 2MJ8A 1TS3A 4KD4A 3RR5A 3S24A 4A3BH 1VQ8A 3H09A 2BH8A 4ZUJA 3HKZG 5FKAC 3TZUA 4X64L 1X3QA 1I6VC 4JI8L 4YHHL 3MXPA 4A3KB 2MFIA 4TVAB 3HOWH 3CP0A 5ELDA 2D62A 3TSSA 1SE3A 3S16H 4JI6L 3FPPA 4POGA 4DUYQ 5ELFA 2R92H 4KHVA 4LF8L 2R7ZG 4IN3A 1JJ2A 3ICEA 4X64Q 2MGSA 4WRDA 1WTVA 4JI8Q 1IHZA 4YHHQ 1L1OB 2I0QA 1MSGA 2K28A 1E1OA 2WFWA 5BN4A 5CBEE 2KECA 1OXVA 2ASBA 2RDHA 1NSNS 1I4QA 2UUBL 4JI6Q 1ICWA 2QF7A 4IUQA 5E1FA 4LF8Q 1NCVA 1Q12A 1VQMA 5C3EG 5EBDA 3GTOH 4PMCA 3I72A 1C48A 2DJGC 3VR3A 3E3XA 3HG9A 4QCLA 2XTIA 1BCPB 3H6MA 1PRTD 2YU9H 4HCEA 3F2DA 2ZJQA 1PFBA 5M5YB 2UUBQ 4A3DH 3STBC 1W6KA 4HMJA 2F0FA 2CWPA 4LFCL 4K5VA 2L12A 4FP5D 3GP7A 3KBGA 1QZGA 4NXMQ 4A3IG 4QQBX 1G2SA 1SYGA 2RVLA 3NE5B 4RCNA 5D65A 3WOFA 2IT1A 3BG3A 1LTID 2WKDA 3E0EA 3VA5A 3HOUB 2K5WA 1YNNC 2E2JH 3SGIA 2K03A 3G6JB 3RUZA 4LFCQ 3K7AH 4G7HC 2PO4A 1ESRA 4GN3B 5GAGC 4WJWA 2K52A 2GN5A 1WTXA 4APVA 1YJ9A 1EUJA 2LMCB 4YY3L 1F9SA 1GUSA 1NE3A 5IT9c 1LM0A 3MTSA 3D6WA 3RLNA 2JXMB 1N33L 3HZXA 1HZCA 1A3VA 3PO2H 1JOKA 1TWCH 5C44B 3IFTA 3NBIA 2EOTA 1S40A 2XSCA 1AP0A 4A3EH 4YY3Q 1BCPD 1S5ED 2EYLA 1TR5A 1YIJA 4EQOA 5IGCA 3MA2B 3T56B 3T51B 1N33Q 2VL6A 1HTLD 2R93H 2AQ1B 1ML0D 1XMOL 1EY0A 3HOZB 1U4PA 4DFAA 2KUMA 1BDOA 4HJ7A 2JE6I 3S17B 2NTTA 4L5SA 1G51A 1JE4A 3GTQH 3CU7A 1VQKA 3CQZB 1D5XC 4OX9L 1L2FA 1AW7A 2VUMB 4JI0L 1HPCA 2VXWA 5ELOA 5GROA 2QGQA 4A3KG 1NY4A 3OIQA 4B3RL 2Q8RE 4CBVA 4C3JG 2OTLA 5IGGA 3AFQA 3A5ZB 4EGVA 1X3PA 2B2TC 3S1RB 1ONLA 2ES2A 2WINB 1F9RA 2F0PA 3CMEA 3GTLB 2N55A 4GKKL 4ME3A 4OX9Q 4IUUA 5JEAJ 3GTMB 1CI3M 4JI0Q 3P75A 1JB7A 2F3VA 4RGMA 4JBJA 3L3OC 4F8MA 3FKIH 4B3RQ 2WB1G 2K5NA 1F2YA 2AWNA 4JI2L 3CRKC 4BY1B 4RGNA 5M5XH 3HOVG 1TS2A 2WV6D 5J3BA 3CCEA 5FK9C 2JA7H 1CA6A 4NMZA 4ZKBB 4OIKA 1G6ZA 1CQVA 3QR8A 1R9TB 4GKKQ 1D6EC 1JWSD 3DEOA 3VR5A 1JB3A 1XXGA 2KEEA 3JAMi 2Y0SG 4ZYSA 4A93H 2RKSA 1TS5A 3K80C 3CF5A 1Q46A 1SXTA 5C4XB 4QF4A 4PZ7A 1QB5D 1C9OA 4JI2Q 1NMGA 4IJLA 4UDUC 4LF6L 5IP9G 2IJ0A 5C0XI 1VQFA 5HY6A 2UUCQ 3BJUA 1ILPA 2DJFC 3GV6A 1A3TA 4BY7H 3I4LA 2ZTCA 5FO7B 2K32A 2E2IB 4XIGS 1YHAA 1PTOF 1HR0L 2SNMA
chains in the Genus database with same CATH topology
2E5LL 4YCVA 1Q82C 2L15A 1GD7A 5C0XJ 3OW2A 3UDGA 2K5VA 3TEHB 2Q2UA 1TWFH 5IP9H 3A5UA 3H0GH 2NZOA 5IP7G 4DR4Q 1Q1EA 4A3CH 3FHWA 1QUQB 4YWKA 3U4ZA 1KD1C 4C3IH 4PG3A 3I56A 2B63G 1VCIA 1MJCA 4LF7Q 3CCRA 4POFA 1HNZL 4B3TL 1KIXA 4P74A 5JJIA 1HR0Q 4RG1A 1MJEA 4JYAL 2E5LQ 5IWAL 1M1KC 4JI4L 4R4IA 4O0AA 4AH6A 3S1QH 1LUZA 5C0XG 1EQQA 2ZTEA 5HGQA 5FLMG 5IP7H 1X55A 1KXLA 1SRUA 2Q2TA 2RCNA 2B63H 1KRTA 3F1ZA 2N8NA 5IYBG 2N3SA 4IO9A 2K5HA 1PH9A 1PA6A 1HNZQ 2EQSA 4B3TQ 1EFWA 2JA5G 1X3EA 1Z9FA 1K9MC 1X3FA 3PUYA 4A3GG 5GQOA 1M90C 4DR2L 4JYAQ 5IWAQ 3H3VH 1L1OC 2CCZA 4JI4Q 1N8RC 2ZJPA 1AH9A 3H3VI 2KHIA 4X62L 4OWTB 5FLMH 3HOXG 3U58A 2YTYA 3UDIA 3S2DH 1N32L 4QY7A 4DR7Q 5DLQE 4GLXA 2N78A 3J81j 3T1HL 3RLFA 1U5KA 4ALPA 3DM3A 5IYBH 4BBSG 3CW2C 1A8VA 1FJGL 2JA5H 3MEFA 2ATWA 3KF8B 4DR5Q 1U0LA 2JA9A 4A3GH 4LF9L 4OO1I 1TXYA 3M4OH 4P71A 4DR2Q 4KHPL 4DUZL 4HIDA 3UE1A 4DNIA 1LTLA 4BBRG 4X62Q 5FLXc 3HOXH 1QUQA 1IXRA 1IYJB 1B70B 1AE2A 1SLJA 3ER0A 2VUMG 1CUKA 1HZAA 1QZHA 2UXCL 2B3GA 1N32Q 4DV0L 1EOVA 4HIKA 1OXSC 3T1HQ 2JK8A 1C7YA 4LF5L 1N9WA 1UEBA 2PI2A 2NZHA 3U4VA 4HJ5A 1PH8A 2JA8G 4BBSH 1I50H 1NMFA 1P16A 3EBEA 4JBMA 3D31A 1FJGQ 4DR6L 3TRZA 1EWIA 3A0JA 4QL5A 2NVYH 3F8TA 1YZ6A 1XMOQ 4BA2I 4LF9Q 1VQDA 3S17H 1JJCB 1YHBA 2K4KA 4O2DA 1WCMH 4DUZQ 5GAEC 1PHJA 3CQZH 2UXDQ 1C0AA 4PZ6A 4BBRH 3KOJA 1VQIA 1W3SA 3ZJYC 2QA4A 3K7UC 2VUMH 4NXNL 1YJWA 1XNRL 2UXCQ 3NEMA 2Q2HA 2OWOA 1QVFA 4OWXB 4DV0Q 4DUYL 1D8LA 4PZ8A 4LF5Q 2JA8H 1ASZA 2NVQH 2HHHL 3JC66 1CKOA 1YITA 2JEAI 3H15A 3GD7A 4OO1G 2EIFA 4DR6Q 3JAMc 4K0KL 2NVTH 3S1RH 4B3SL 4WJ4A 1KRSA 2AWOA 1EIYB 2MQHA 1FL0A 4JBKA 2F3IA 3GTLH 4GLVB 4AQYL 3L0OA 4R1JA 3J80c 3Q8DA 4NXNQ 4BXXG 1E7ZA 1HZBA 1NTGA 2YYZA 3PUVA 1YHQA 5C4XG 2OQKA 1FVIA 5ELNA 2HHHQ 2B29A 2I5HA 3CC7A 4DKAC 1PH5A 2C35B 1PYSB 4JOIA 4K0KQ 3GTGH 4B3SQ 3CCVA 2CFMA 4AIMA 1XJVA 2BA1A 2JA6H 1IBML 1R9TH 3CPFA 3TQYA 2D0OA 3J81i 4AQYQ 4P75A 4DAMA 4OWWB 2F4VL 4BXXH 3PCOB 3F2CA 4NB3A 1YVCA 2HQLA 3TS2A 1X6OA 2R7FA 4AYBE 2YV5A 3STBD 3KDFA 5C4XH 2UU9L 1K0RA 4X66L 1GO3E 3KFUA 1WI5A 3BZCA 3PO3G 5IYDG 1SE8A 2OQ0A 1SMXA 3MXNB 2DUDA 2CWAA 4LUVA 4A75A 1E1TA 4NXML 1X56A 2WAQE 3EN2A 5M5YH 4LF6Q 4JBWA 2D0PA 1VQ7A 4AYBG 4UY8C 4LFBL 1IBMQ 4IJHA 3HOUG 3KJOA 5IE8A 4GNXC 2A8VA 4RMFA 1VQOA 2F4VQ 1WFQA 4GOPC 3AYHB 5H1SE 3T1YL 1A0IA 4DPGA 3E9IA 2WAQG 4LF4Q 3CCQA 1I3QH 2UU9Q 4L5RC 1E24A 3UE0A 2ID0A 1PH7A 3PO3H 5IYDH 1HH2P 1UE7A 3HFZB 1HZ9A 4LFAL 4LFBQ 3A74A 4PMWA 1FGUA 4QGUA 3CXCA 4YWLA 3HOUH 2VQEL 4IFDI 1YEZA 2I5MX 1RIPA 2MO0A 4J15A 3K8AA 1VQAA 3T1YQ 4DAYB 1I94L 3GO5A 4JG2A 3CCUA 2LXJA 3GTJH 4MTNA 5C44G 4L5TA 5LMNW 1Y1WG 3F2BA 3VDYA 3M9BA 1KC8C 3TS0A 1B7YB 4DR1L 3RN2A 4JV5L 1T9HA 4Y52H 4LFAQ 1MKHA 4IFDJ 1CKNB 1OXTA 2ALYB 2VQEQ 1WYDA 2BA0A 3PUXA 3HOZG 1I94Q 1VS0A 2V1CC 2IHFA 3W1BA 3NELA 4MZ9A 5C44H 3KJPA 4A3FG 1A63A 1Y1WH 1VQ6A 1YBYA 1BBUA 4UPAA 5JJKA 2RF4A 1WCMG 4DR1Q 3OYYA 1ASYA 4JV5Q 5FJ8G 2YTXA 4A3BG 1KAWA 1YI2A 3CCMA 4A4IA 2JEBI 1SROA 4IFDG 2OTJA 1JT8A 4HIOA 1KQSA 3GTPH 3KF6A 3PV0A 1GKHA 1K3RA 3HOVH 2VY3A 5AJ3L 1VQLA 3HOZH 3KDFB 4EQ5A 4YCUA 2CKZB 4A3FH 1VQ9A 2E8GA 1G291 4HJ8A 4LF4L 1G6PA 1PH4A 1IBLL 1SN8A 1OTCA 3RZDH 4X65L 3HOWG 4KHPQ 1PH3A 3HKZE 3RR5A 2ZJRA 5FJ8H 3S24A 3AEVA 4A3BH 3I7FA 1VQEA 1VQ8A 1WOCA 4P73A 2R92G 3S1NH 4A3LG 4DV5L 2BH8A 5AJ3Q 3M3YH 3HKZG 1CSQA 4LWCA 4X64L 1AE3A 3J7ZC 4BY1G 4JI8L 4YHHL 3I55A 4R4TA 1PH2A 2K50A 2Z6KA 3E9HA 1Q81C 1QVGA 1DGSA 2HIXA 1IBLQ 1E22A 1I5FA 1S3OA 2MFIA 4TVAB 4LUZA 3CP0A 4UP9A 4IPGA 2JA6G 3HOWH 4WJ3M 1CKNA 1XPRA 2KENA 3M4PA 2N49A 1HR0W 1XNQL 1V9PA 3GTMH 2D62A 1RL2A 2Z0SA 1HNXL 1XNRQ 3UDXA 3S16H 4JI6L 4HJ9A 4POGA 4DUYQ 1XPUA 2R92H 4A3LH 4LF8L 3J81c 2R7ZG 3CD6A 2UUAL 2WP8J 1JJ2A 3ICEA 2VW9A 3ULJA 4X64Q 4BY1H 2KBNA 1KHIA 4JI8Q 4YHHQ 1MIUA 1X65A 1L1OB 2FXQA 3OTOL 3G6EA 4IOCA 2I0QA 3L7ZC 2BH2A 1E1OA 2WFWA 3K81C 2PNHA 1XPOA 4DV1L 1OXVA 2ASBA 2GVBA 2UUCL 1XNQQ 3U50C 3AQQA 5GAHC 1HNXQ 2UUBL 4JI6Q 2YTVA 4A3DG 2OCEA 2AKWB 1PV4A 4UP7A 1EYGA 1TWAH 5JEAG 4LF8Q 2HT1A 2R7ZH 1JMCA 3LGJA 1Q12A 1VQMA 4X6AH 5C3EG 1NJIC 3GTOH 5EAYA 2PI2E 3OTOQ 1Q86C 1GM5A 2DGYA 3DLLA 3BU2A 1N36L 4DK6C 2XTIA 1X54A 1XTDA 3W5OA 4DV1Q 1VQ4A 2YU9H 3F2DA 2ZJQA 4KLKA 3S15H 4GOPA 3PSIA 3PIPA 5JJLA 2QEXA 2UUBQ 4A3DH 2E2IH 3STBC 3KF6B 1O7IA 3RNUA 2I5LX 3RZOH 2CWPA 2UXBL 3S14H 2EXDA 3B6YA 4X66Q 4LFCL 3I4MG 1UE6A 2ZTDA 4YCWA 5C3EH 4IPDA 1X9NA 1OXXK 2ZM6L 1VQBA 1QZGA 4NXMQ 1D7QA 4A3IG 3CCLA 1VQNA 1TWGH 4JCVE 1N36Q 1IL2A 2R7DA 4FDBA 3PF4A 1IBKL 4QQBX 1I6HH 1HJPA 4JI5L 3NENA 2VQFL 4DR3L 4UP8A 1Q8KA 2AMCB 2IT1A 2VZAA 3WWVA 1PYBA 2E2HH 3RLOA 3I4NG 2IY5B 3E0EA 1BVSA 2VNUD 3CMAA 4B3ML 2UXBQ 1XMQL 5C4JH 2E2JH 3SGIA 4JC0A 3I4MH 4LFCQ 1L1OA 3K7AH 4DV7L 2Q2IA 3M85A 3I4OA 4DV3L 3PO2G 2K75A 4JI3L 2PQAA 2ZM6Q 4QJFA 2H5XA 2PMZE 4GN3B 2K52A 5GAGC 4Y7NH 4A3IH 2GN5A 4P72A 3PUWA 1YJNA 1VQPA 3TREA 1Y1VG 1IBKQ 4JI5Q 2VQFQ 4DR3Q 4APVA 1YJ9A 1EUJA 1EQRA 3J7A5 4YY3L 1UE5A 4A3EG 4H02A 1KL9A 2MO1A 1NE3A 2HIVA 4JI7L 3I4NH 4DR7L 1TWHH 5IT9c 1LM0A 1UWVA 3G48A 3CC4A 1V43A 3NBHB 4LUOA 4TQUS 3RLNA 2NN6I 4B3MQ 1SFOH 1XMQQ 1N33L 1HZCA 3PO2H 3G71A 4DR5L 1TWCH 3ULPA 4DV7Q 4DV3Q 1VQHA 1K8AC 2R93G 4DV6L 4JI3Q 1JJGA 1WJJA 1PH6A 3L2PA 4L5QA 4A3JG 4LNQA 2JJQA 1Y1VH 4GS3A 4MNOA 1S40A 2VS1A 1Y14B 3KLWA 3W1GA 5IYCG 1K8GA 2LXKA 1PH1A 4A3EH 4YY3Q 4JI7Q 1B8AA 3PIOA 2KCTA 4QIWE 2LSSA 1J5EL 1YIJA 5K36G 1NBWA 3ERSX 4KI0A 5LMUL 3CAMA 4R4QA 2VL6A 1N33Q 2R93H 3AFPA 4HJAA 2IHEA 1XMOL 3I2ZA 4DV6Q 1VQ5A 1K73C 4GKJL 4HJ7A 2JE6I 5IY0A 4A3JH 5M5WH 2MNAA 1N34L 1H95A 1GVPA 4NPSA 4L5SA 3M4QA 4GNXB 1G51A 2UXDL 5IYCH 4A3MG 3GTQH 3GDEA 4OXPA 1OXUA 4GOPB 3S1MH 1VQKA 4BA1I 4OX9L 1L2FA 5LMNL 1HNWL 1W2BA 3CCJA 4JI0L 5ELOA 2RHSB 3S2HH 2NN6G 4HIMA 3K0XA 1J5EQ 2KCMA 3M7NA 1Z47A 5GROA 3HOYG 1JE5A 2QGQA 1YNXA 2KHJA 5LMUQ 4A3KG 1NY4A 5M3FG 3FKIG 4B3RL 1X3GA 4IOAA 2OTLA 3AFQA 1CSPA 4X65Q 3A5ZB 4GKJQ 5E7NA 4A76A 2ES2A 1BBWA 1N34Q 2JA7G 4OONA 1IZ6A 2A1AA 4A3MH 3CMEA 2A19A 1PFSA 2WB1E 4XTCS 4GKKL 3CC2A 4ME3A 4OX9Q 2XGTA 5JEAJ 5LMNQ 3FP9A 3CCSA 4JI0Q 1CKMA 4R4CA 4C3HH 2R6GA 4DV4L 4DV5Q 1HNWQ 3IRBA 1LYLA 1JB7A 3PF5A 3UDFA 4JBJA 3HOYH 4A93G 2CQOA 4A3KH 3G4SA 1J6QA 5M3FH 3FKIH 4B3RQ 2WB1G 2K5NA 3PGZA 4C3JH 2PQAB 2AWNA 3ULLA 4JI2L 3GTKH 1S72A 3BZKA 1VQCA 2Y0SE 4KHZA 2Z6KC 5M5XH 3HOVG 5J3BA 1K83H 3CCEA 4GN5A 2JA7H 1BKBA 4DV2L 4JI1L 4GKKQ 1PVOA 3JAMi 4DK3C 4BY7G 4IPCA 1EIFA 2F52A 2IX0A 2Y0SG 5GADC 4DV4Q 2UUAQ 4A93H 3K80C 5BR8L 1A62A 3CF5A 1Q46A 2K14A 4GN4B 5M3MG 1V1QA 3RN5A 4PZ7A 2IX1A 1VQGA 2NVXH 1C9OA 3J80i 4JI2Q 1VQJA 4GLAC 1NMGA 4IJLA 3D0FA 4LF6L 1P8LA 2AHOB 4JOIC 4EX5A 1L0WA 5IP9G 4GNXA 2RHQB 3H0GG 1VQFA 2JQOA 5C0XI 5HY6A 4DR4L 2UUCQ 4YWMA 3BJUA 4A3CG 4DV2Q 4IPHA 1SR3A 3EIVA 4JI1Q 4LF7L 1E3PA 1QVCA 3KYHC 3HKSA 1Q1BA 1Q7YC 4BY7H 4LW1A 2ZTCA 3CPWA 1UE1A 4R4OA 3PUZA 4XIGS 1YHAA 5BR8Q 5M3MH 1HR0L 2GVAA 4C2MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L L;  4YCV A;  1Q82 C;  2L15 A;  1GD7 A;  5C0X J;  3OW2 A;  3UDG A;  2K5V A;  3TEH B;  2Q2U A;  1TWF H;  5IP9 H;  3A5U A;  3H0G H;  2NZO A;  5IP7 G;  4DR4 Q;  1Q1E A;  4A3C H;  3FHW A;  1QUQ B;  4YWK A;  3U4Z A;  1KD1 C;  4C3I H;  4PG3 A;  3I56 A;  2B63 G;  1VCI A;  1MJC A;  4LF7 Q;  3CCR A;  4POF A;  1HNZ L;  4B3T L;  1KIX A;  4P74 A;  5JJI A;  1HR0 Q;  4RG1 A;  1MJE A;  4JYA L;  2E5L Q;  5IWA L;  1M1K C;  4JI4 L;  4R4I A;  4O0A A;  4AH6 A;  3S1Q H;  1LUZ A;  5C0X G;  1EQQ A;  2ZTE A;  5HGQ A;  5FLM G;  5IP7 H;  1X55 A;  1KXL A;  1SRU A;  2Q2T A;  2RCN A;  2B63 H;  1KRT A;  3F1Z A;  2N8N A;  5IYB G;  2N3S A;  4IO9 A;  2K5H A;  1PH9 A;  1PA6 A;  1HNZ Q;  2EQS A;  4B3T Q;  1EFW A;  2JA5 G;  1X3E A;  1Z9F A;  1K9M C;  1X3F A;  3PUY A;  4A3G G;  5GQO A;  1M90 C;  4DR2 L;  4JYA Q;  5IWA Q;  3H3V H;  1L1O C;  2CCZ A;  4JI4 Q;  1N8R C;  2ZJP A;  1AH9 A;  3H3V I;  2KHI A;  4X62 L;  4OWT B;  5FLM H;  3HOX G;  3U58 A;  2YTY A;  3UDI A;  3S2D H;  1N32 L;  4QY7 A;  4DR7 Q;  5DLQ E;  4GLX A;  2N78 A;  3J81 j;  3T1H L;  3RLF A;  1U5K A;  4ALP A;  3DM3 A;  5IYB H;  4BBS G;  3CW2 C;  1A8V A;  1FJG L;  2JA5 H;  3MEF A;  2ATW A;  3KF8 B;  4DR5 Q;  1U0L A;  2JA9 A;  4A3G H;  4LF9 L;  4OO1 I;  1TXY A;  3M4O H;  4P71 A;  4DR2 Q;  4KHP L;  4DUZ L;  4HID A;  3UE1 A;  4DNI A;  1LTL A;  4BBR G;  4X62 Q;  5FLX c;  3HOX H;  1QUQ A;  1IXR A;  1IYJ B;  1B70 B;  1AE2 A;  1SLJ A;  3ER0 A;  2VUM G;  1CUK A;  1HZA A;  1QZH A;  2UXC L;  2B3G A;  1N32 Q;  4DV0 L;  1EOV A;  4HIK A;  1OXS C;  3T1H Q;  2JK8 A;  1C7Y A;  4LF5 L;  1N9W A;  1UEB A;  2PI2 A;  2NZH A;  3U4V A;  4HJ5 A;  1PH8 A;  2JA8 G;  4BBS H;  1I50 H;  1NMF A;  1P16 A;  3EBE A;  4JBM A;  3D31 A;  1FJG Q;  4DR6 L;  3TRZ A;  1EWI A;  3A0J A;  4QL5 A;  2NVY H;  3F8T A;  1YZ6 A;  1XMO Q;  4BA2 I;  4LF9 Q;  1VQD A;  3S17 H;  1JJC B;  1YHB A;  2K4K A;  4O2D A;  1WCM H;  4DUZ Q;  5GAE C;  1PHJ A;  3CQZ H;  2UXD Q;  1C0A A;  4PZ6 A;  4BBR H;  3KOJ A;  1VQI A;  1W3S A;  3ZJY C;  2QA4 A;  3K7U C;  2VUM H;  4NXN L;  1YJW A;  1XNR L;  2UXC Q;  3NEM A;  2Q2H A;  2OWO A;  1QVF A;  4OWX B;  4DV0 Q;  4DUY L;  1D8L A;  4PZ8 A;  4LF5 Q;  2JA8 H;  1ASZ A;  2NVQ H;  2HHH L;  3JC6 6;  1CKO A;  1YIT A;  2JEA I;  3H15 A;  3GD7 A;  4OO1 G;  2EIF A;  4DR6 Q;  3JAM c;  4K0K L;  2NVT H;  3S1R H;  4B3S L;  4WJ4 A;  1KRS A;  2AWO A;  1EIY B;  2MQH A;  1FL0 A;  4JBK A;  2F3I A;  3GTL H;  4GLV B;  4AQY L;  3L0O A;  4R1J A;  3J80 c;  3Q8D A;  4NXN Q;  4BXX G;  1E7Z A;  1HZB A;  1NTG A;  2YYZ A;  3PUV A;  1YHQ A;  5C4X G;  2OQK A;  1FVI A;  5ELN A;  2HHH Q;  2B29 A;  2I5H A;  3CC7 A;  4DKA C;  1PH5 A;  2C35 B;  1PYS B;  4JOI A;  4K0K Q;  3GTG H;  4B3S Q;  3CCV A;  2CFM A;  4AIM A;  1XJV A;  2BA1 A;  2JA6 H;  1IBM L;  1R9T H;  3CPF A;  3TQY A;  2D0O A;  3J81 i;  4AQY Q;  4P75 A;  4DAM A;  4OWW B;  2F4V L;  4BXX H;  3PCO B;  3F2C A;  4NB3 A;  1YVC A;  2HQL A;  3TS2 A;  1X6O A;  2R7F A;  4AYB E;  2YV5 A;  3STB D;  3KDF A;  5C4X H;  2UU9 L;  1K0R A;  4X66 L;  1GO3 E;  3KFU A;  1WI5 A;  3BZC A;  3PO3 G;  5IYD G;  1SE8 A;  2OQ0 A;  1SMX A;  3MXN B;  2DUD A;  2CWA A;  4LUV A;  4A75 A;  1E1T A;  4NXM L;  1X56 A;  2WAQ E;  3EN2 A;  5M5Y H;  4LF6 Q;  4JBW A;  2D0P A;  1VQ7 A;  4AYB G;  4UY8 C;  4LFB L;  1IBM Q;  4IJH A;  3HOU G;  3KJO A;  5IE8 A;  4GNX C;  2A8V A;  4RMF A;  1VQO A;  2F4V Q;  1WFQ A;  4GOP C;  3AYH B;  5H1S E;  3T1Y L;  1A0I A;  4DPG A;  3E9I A;  2WAQ G;  4LF4 Q;  3CCQ A;  1I3Q H;  2UU9 Q;  4L5R C;  1E24 A;  3UE0 A;  2ID0 A;  1PH7 A;  3PO3 H;  5IYD H;  1HH2 P;  1UE7 A;  3HFZ B;  1HZ9 A;  4LFA L;  4LFB Q;  3A74 A;  4PMW A;  1FGU A;  4QGU A;  3CXC A;  4YWL A;  3HOU H;  2VQE L;  4IFD I;  1YEZ A;  2I5M X;  1RIP A;  2MO0 A;  4J15 A;  3K8A A;  1VQA A;  3T1Y Q;  4DAY B;  1I94 L;  3GO5 A;  4JG2 A;  3CCU A;  2LXJ A;  3GTJ H;  4MTN A;  5C44 G;  4L5T A;  5LMN W;  1Y1W G;  3F2B A;  3VDY A;  3M9B A;  1KC8 C;  3TS0 A;  1B7Y B;  4DR1 L;  3RN2 A;  4JV5 L;  1T9H A;  4Y52 H;  4LFA Q;  1MKH A;  4IFD J;  1CKN B;  1OXT A;  2ALY B;  2VQE Q;  1WYD A;  2BA0 A;  3PUX A;  3HOZ G;  1I94 Q;  1VS0 A;  2V1C C;  2IHF A;  3W1B A;  3NEL A;  4MZ9 A;  5C44 H;  3KJP A;  4A3F G;  1A63 A;  1Y1W H;  1VQ6 A;  1YBY A;  1BBU A;  4UPA A;  5JJK A;  2RF4 A;  1WCM G;  4DR1 Q;  3OYY A;  1ASY A;  4JV5 Q;  5FJ8 G;  2YTX A;  4A3B G;  1KAW A;  1YI2 A;  3CCM A;  4A4I A;  2JEB I;  1SRO A;  4IFD G;  2OTJ A;  1JT8 A;  4HIO A;  1KQS A;  3GTP H;  3KF6 A;  3PV0 A;  1GKH A;  1K3R A;  3HOV H;  2VY3 A;  5AJ3 L;  1VQL A;  3HOZ H;  3KDF B;  4EQ5 A;  4YCU A;  2CKZ B;  4A3F H;  1VQ9 A;  2E8G A;  1G29 1;  4HJ8 A;  4LF4 L;  1G6P A;  1PH4 A;  1IBL L;  1SN8 A;  1OTC A;  3RZD H;  4X65 L;  3HOW G;  4KHP Q;  1PH3 A;  3HKZ E;  3RR5 A;  2ZJR A;  5FJ8 H;  3S24 A;  3AEV A;  4A3B H;  3I7F A;  1VQE A;  1VQ8 A;  1WOC A;  4P73 A;  2R92 G;  3S1N H;  4A3L G;  4DV5 L;  2BH8 A;  5AJ3 Q;  3M3Y H;  3HKZ G;  1CSQ A;  4LWC A;  4X64 L;  1AE3 A;  3J7Z C;  4BY1 G;  4JI8 L;  4YHH L;  3I55 A;  4R4T A;  1PH2 A;  2K50 A;  2Z6K A;  3E9H A;  1Q81 C;  1QVG A;  1DGS A;  2HIX A;  1IBL Q;  1E22 A;  1I5F A;  1S3O A;  2MFI A;  4TVA B;  4LUZ A;  3CP0 A;  4UP9 A;  4IPG A;  2JA6 G;  3HOW H;  4WJ3 M;  1CKN A;  1XPR A;  2KEN A;  3M4P A;  2N49 A;  1HR0 W;  1XNQ L;  1V9P A;  3GTM H;  2D62 A;  1RL2 A;  2Z0S A;  1HNX L;  1XNR Q;  3UDX A;  3S16 H;  4JI6 L;  4HJ9 A;  4POG A;  4DUY Q;  1XPU A;  2R92 H;  4A3L H;  4LF8 L;  3J81 c;  2R7Z G;  3CD6 A;  2UUA L;  2WP8 J;  1JJ2 A;  3ICE A;  2VW9 A;  3ULJ A;  4X64 Q;  4BY1 H;  2KBN A;  1KHI A;  4JI8 Q;  4YHH Q;  1MIU A;  1X65 A;  1L1O B;  2FXQ A;  3OTO L;  3G6E A;  4IOC A;  2I0Q A;  3L7Z C;  2BH2 A;  1E1O A;  2WFW A;  3K81 C;  2PNH A;  1XPO A;  4DV1 L;  1OXV A;  2ASB A;  2GVB A;  2UUC L;  1XNQ Q;  3U50 C;  3AQQ A;  5GAH C;  1HNX Q;  2UUB L;  4JI6 Q;  2YTV A;  4A3D G;  2OCE A;  2AKW B;  1PV4 A;  4UP7 A;  1EYG A;  1TWA H;  5JEA G;  4LF8 Q;  2HT1 A;  2R7Z H;  1JMC A;  3LGJ A;  1Q12 A;  1VQM A;  4X6A H;  5C3E G;  1NJI C;  3GTO H;  5EAY A;  2PI2 E;  3OTO Q;  1Q86 C;  1GM5 A;  2DGY A;  3DLL A;  3BU2 A;  1N36 L;  4DK6 C;  2XTI A;  1X54 A;  1XTD A;  3W5O A;  4DV1 Q;  1VQ4 A;  2YU9 H;  3F2D A;  2ZJQ A;  4KLK A;  3S15 H;  4GOP A;  3PSI A;  3PIP A;  5JJL A;  2QEX A;  2UUB Q;  4A3D H;  2E2I H;  3STB C;  3KF6 B;  1O7I A;  3RNU A;  2I5L X;  3RZO H;  2CWP A;  2UXB L;  3S14 H;  2EXD A;  3B6Y A;  4X66 Q;  4LFC L;  3I4M G;  1UE6 A;  2ZTD A;  4YCW A;  5C3E H;  4IPD A;  1X9N A;  1OXX K;  2ZM6 L;  1VQB A;  1QZG A;  4NXM Q;  1D7Q A;  4A3I G;  3CCL A;  1VQN A;  1TWG H;  4JCV E;  1N36 Q;  1IL2 A;  2R7D A;  4FDB A;  3PF4 A;  1IBK L;  4QQB X;  1I6H H;  1HJP A;  4JI5 L;  3NEN A;  2VQF L;  4DR3 L;  4UP8 A;  1Q8K A;  2AMC B;  2IT1 A;  2VZA A;  3WWV A;  1PYB A;  2E2H H;  3RLO A;  3I4N G;  2IY5 B;  3E0E A;  1BVS A;  2VNU D;  3CMA A;  4B3M L;  2UXB Q;  1XMQ L;  5C4J H;  2E2J H;  3SGI A;  4JC0 A;  3I4M H;  4LFC Q;  1L1O A;  3K7A H;  4DV7 L;  2Q2I A;  3M85 A;  3I4O A;  4DV3 L;  3PO2 G;  2K75 A;  4JI3 L;  2PQA A;  2ZM6 Q;  4QJF A;  2H5X A;  2PMZ E;  4GN3 B;  2K52 A;  5GAG C;  4Y7N H;  4A3I H;  2GN5 A;  4P72 A;  3PUW A;  1YJN A;  1VQP A;  3TRE A;  1Y1V G;  1IBK Q;  4JI5 Q;  2VQF Q;  4DR3 Q;  4APV A;  1YJ9 A;  1EUJ A;  1EQR A;  3J7A 5;  4YY3 L;  1UE5 A;  4A3E G;  4H02 A;  1KL9 A;  2MO1 A;  1NE3 A;  2HIV A;  4JI7 L;  3I4N H;  4DR7 L;  1TWH H;  5IT9 c;  1LM0 A;  1UWV A;  3G48 A;  3CC4 A;  1V43 A;  3NBH B;  4LUO A;  4TQU S;  3RLN A;  2NN6 I;  4B3M Q;  1SFO H;  1XMQ Q;  1N33 L;  1HZC A;  3PO2 H;  3G71 A;  4DR5 L;  1TWC H;  3ULP A;  4DV7 Q;  4DV3 Q;  1VQH A;  1K8A C;  2R93 G;  4DV6 L;  4JI3 Q;  1JJG A;  1WJJ A;  1PH6 A;  3L2P A;  4L5Q A;  4A3J G;  4LNQ A;  2JJQ A;  1Y1V H;  4GS3 A;  4MNO A;  1S40 A;  2VS1 A;  1Y14 B;  3KLW A;  3W1G A;  5IYC G;  1K8G A;  2LXK A;  1PH1 A;  4A3E H;  4YY3 Q;  4JI7 Q;  1B8A A;  3PIO A;  2KCT A;  4QIW E;  2LSS A;  1J5E L;  1YIJ A;  5K36 G;  1NBW A;  3ERS X;  4KI0 A;  5LMU L;  3CAM A;  4R4Q A;  2VL6 A;  1N33 Q;  2R93 H;  3AFP A;  4HJA A;  2IHE A;  1XMO L;  3I2Z A;  4DV6 Q;  1VQ5 A;  1K73 C;  4GKJ L;  4HJ7 A;  2JE6 I;  5IY0 A;  4A3J H;  5M5W H;  2MNA A;  1N34 L;  1H95 A;  1GVP A;  4NPS A;  4L5S A;  3M4Q A;  4GNX B;  1G51 A;  2UXD L;  5IYC H;  4A3M G;  3GTQ H;  3GDE A;  4OXP A;  1OXU A;  4GOP B;  3S1M H;  1VQK A;  4BA1 I;  4OX9 L;  1L2F A;  5LMN L;  1HNW L;  1W2B A;  3CCJ A;  4JI0 L;  5ELO A;  2RHS B;  3S2H H;  2NN6 G;  4HIM A;  3K0X A;  1J5E Q;  2KCM A;  3M7N A;  1Z47 A;  5GRO A;  3HOY G;  1JE5 A;  2QGQ A;  1YNX A;  2KHJ A;  5LMU Q;  4A3K G;  1NY4 A;  5M3F G;  3FKI G;  4B3R L;  1X3G A;  4IOA A;  2OTL A;  3AFQ A;  1CSP A;  4X65 Q;  3A5Z B;  4GKJ Q;  5E7N A;  4A76 A;  2ES2 A;  1BBW A;  1N34 Q;  2JA7 G;  4OON A;  1IZ6 A;  2A1A A;  4A3M H;  3CME A;  2A19 A;  1PFS A;  2WB1 E;  4XTC S;  4GKK L;  3CC2 A;  4ME3 A;  4OX9 Q;  2XGT A;  5JEA J;  5LMN Q;  3FP9 A;  3CCS A;  4JI0 Q;  1CKM A;  4R4C A;  4C3H H;  2R6G A;  4DV4 L;  4DV5 Q;  1HNW Q;  3IRB A;  1LYL A;  1JB7 A;  3PF5 A;  3UDF A;  4JBJ A;  3HOY H;  4A93 G;  2CQO A;  4A3K H;  3G4S A;  1J6Q A;  5M3F H;  3FKI H;  4B3R Q;  2WB1 G;  2K5N A;  3PGZ A;  4C3J H;  2PQA B;  2AWN A;  3ULL A;  4JI2 L;  3GTK H;  1S72 A;  3BZK A;  1VQC A;  2Y0S E;  4KHZ A;  2Z6K C;  5M5X H;  3HOV G;  5J3B A;  1K83 H;  3CCE A;  4GN5 A;  2JA7 H;  1BKB A;  4DV2 L;  4JI1 L;  4GKK Q;  1PVO A;  3JAM i;  4DK3 C;  4BY7 G;  4IPC A;  1EIF A;  2F52 A;  2IX0 A;  2Y0S G;  5GAD C;  4DV4 Q;  2UUA Q;  4A93 H;  3K80 C;  5BR8 L;  1A62 A;  3CF5 A;  1Q46 A;  2K14 A;  4GN4 B;  5M3M G;  1V1Q A;  3RN5 A;  4PZ7 A;  2IX1 A;  1VQG A;  2NVX H;  1C9O A;  3J80 i;  4JI2 Q;  1VQJ A;  4GLA C;  1NMG A;  4IJL A;  3D0F A;  4LF6 L;  1P8L A;  2AHO B;  4JOI C;  4EX5 A;  1L0W A;  5IP9 G;  4GNX A;  2RHQ B;  3H0G G;  1VQF A;  2JQO A;  5C0X I;  5HY6 A;  4DR4 L;  2UUC Q;  4YWM A;  3BJU A;  4A3C G;  4DV2 Q;  4IPH A;  1SR3 A;  3EIV A;  4JI1 Q;  4LF7 L;  1E3P A;  1QVC A;  3KYH C;  3HKS A;  1Q1B A;  1Q7Y C;  4BY7 H;  4LW1 A;  2ZTC A;  3CPW A;  1UE1 A;  4R4O A;  3PUZ A;  4XIG S;  1YHA A;  5BR8 Q;  5M3M H;  1HR0 L;  2GVA A;  4C2M H; 
#chains in the Genus database with same CATH topology
 1S5B D;  5DM7 3;  2L15 A;  2Q8T A;  3OW2 A;  4JPB W;  5KRU A;  2FJ2 A;  2E76 C;  2Q2U A;  1LT5 D;  1TY2 A;  5IP7 G;  4A3C H;  2XN9 C;  3U4Z A;  2B63 G;  2KED A;  3D3R A;  3OWE B;  3BVG A;  3CCR A;  3D4R A;  4POF A;  4B9W A;  2AQ2 B;  4B3T L;  2Z9H A;  4BS9 A;  1HR0 Q;  4RG1 A;  1MJE A;  3GTJ B;  2D2C C;  4O0A A;  4CDD C;  1EQQ A;  5HGQ A;  5FLM G;  5JOB A;  1X55 A;  2H1E A;  2RA4 A;  4RHS A;  4BWG B;  1TVX A;  5KND A;  2KVM A;  3MHB A;  4B3T Q;  2EQS A;  1EFW A;  1K9M C;  4A3G G;  5GQO A;  4DR2 L;  1SAP A;  3J7A V;  3H3V H;  2ZJP A;  3DMU A;  1IKM A;  1HFG A;  2YTY A;  3UDI A;  1EEF D;  4QY7 A;  1I4X A;  1Y1V B;  4RKB A;  2HDM A;  3T1H L;  4FF4 A;  3RLF A;  3DM3 A;  2OT2 A;  1XWE A;  1EY4 A;  1SBB B;  3I3C A;  2ATW A;  4J6H A;  4DR2 Q;  4HID A;  1LTL A;  1STE A;  3HOX H;  2VUM G;  3P1H A;  1IXR A;  1IYJ B;  2UXC L;  2KCC A;  1QZH A;  1HZA A;  5M5W B;  2B3G A;  1WTW A;  1VF7 A;  3PIP 3;  3T1H Q;  4KV6 A;  3EJI A;  2PI2 A;  3U4V A;  4HJ5 A;  4BBS H;  1I50 H;  5EKK A;  4JBM A;  2IWH A;  1EWI A;  1EY7 A;  2NVY H;  1ROD A;  1YHB A;  3IFD A;  1WCM H;  1RJT A;  1S5F D;  4PZ6 A;  5CC4 A;  3K7U C;  4NXN L;  4FF1 A;  2UXC Q;  1QVF A;  3ERQ A;  3MAQ A;  3HGB A;  3C2P A;  2JA8 H;  4C3H B;  1EWH A;  3HOY B;  1MHW C;  2XWJ B;  1K8O A;  4CJ0 B;  1EQT A;  4N8F A;  4GLV B;  2QIL A;  3L0O A;  4R1J A;  4R9W A;  3J80 c;  1RD9 D;  2BE5 C;  4NXN Q;  1HZB A;  1LTA D;  1NR4 A;  3NP8 A;  4OEL B;  5C4X G;  4V0B A;  1SYF A;  3D4D A;  2FIN B;  2I5H A;  5LL6 S;  5JJZ A;  3CC7 A;  4OO1 H;  2G9D A;  1PYS B;  2MUY A;  4JOI A;  5CV5 A;  4DXF A;  3GTG H;  2CFM A;  2V4D A;  1HRJ A;  4CKE A;  2KHS A;  1G2T A;  2JA6 H;  2I07 B;  2WII B;  1XYI A;  4BXX H;  1FGB D;  1Q3L A;  3S15 B;  4J8Q A;  4NB3 A;  1X6O A;  3STB D;  3N52 A;  2UU9 L;  2DY8 A;  2F0K A;  1GO3 E;  3PIO 3;  1WI5 A;  3I70 A;  1F2Z A;  2K5Q A;  1SE8 A;  1DCZ A;  2CWA A;  3EN2 A;  4LFB L;  2OEO A;  2D0P A;  2EE1 A;  3A7A B;  4UY8 C;  5IOC A;  4RMF A;  1L0Y B;  4GOP C;  3T1Y L;  4X3T A;  2UU9 Q;  4L5R C;  1YNN D;  1E24 A;  2NZ1 D;  1SYC A;  3PO3 H;  3I4M B;  2A5H A;  2A68 C;  1XTC D;  4LFA L;  4LFB Q;  3X3M A;  1FGU A;  3CXC A;  2I5M X;  2MPM A;  3BDO A;  2XRQ D;  3J80 L;  2MO0 A;  1O7Z A;  2F3W A;  3I4N B;  3T1Y Q;  3L9A X;  3GO5 A;  2FMM A;  1JOO A;  3KLS A;  4L5T A;  3F2B A;  1SFO B;  1SJH D;  1L0X B;  1KDA A;  3TS0 A;  2E2D C;  4Y52 H;  1CK1 A;  4LFA Q;  1RDP D;  4IFD J;  2O4X A;  3TME A;  1M4V A;  1Z7T A;  2BA0 A;  1TII D;  5KNB A;  3PUX A;  4I7Z C;  1BOS A;  4A3F G;  3VR2 A;  5A2Q E;  1Y1W H;  2MHV A;  1YBY A;  4UPA A;  1CZW A;  1WCM G;  2JA5 B;  1ASY A;  3I91 A;  4DN4 M;  5FJ8 G;  1Y8N B;  5CYU A;  4ME5 A;  2CVR A;  3CCM A;  2JEB I;  4ILW A;  3R93 A;  4L6T B;  3NWT A;  4A3J B;  4HIO A;  3GTP H;  4WOR A;  3S1M B;  2JSO A;  2VY3 A;  5AJ3 L;  4DNT B;  1G91 A;  4F7X A;  4EQ5 A;  1KAA A;  4LF4 L;  3S2H B;  2EXZ A;  1GUW A;  4HJ8 A;  1G6P A;  1CHP D;  1SDF A;  4NP5 A;  1M8A A;  2IX3 A;  3N6R A;  4DA2 A;  2F0H A;  1QNK A;  3VA7 A;  4IFD H;  2CQA A;  4XQQ A;  4A3M B;  4A3L G;  4KN4 C;  5AJ3 Q;  3M3Y H;  2F0L A;  1PRT F;  1WTQ A;  1CSQ A;  4C1N I;  4LF4 Q;  1A15 A;  2HIX A;  1E22 A;  1I5F A;  1S3O A;  4LUZ A;  5C6A A;  2JA6 G;  1CKN A;  1XPR A;  2N49 A;  1XNQ L;  1V9P A;  1XNR Q;  3UDX A;  1A2U A;  4HJ9 A;  1BNZ A;  1XPU A;  1V1P A;  1A3U A;  5KNC A;  3J81 c;  1Y8O B;  1BF4 A;  2KJX A;  1KHI A;  1B44 D;  3K81 C;  2EYF A;  2A74 C;  2KQ3 A;  4ABN A;  4DAP A;  4N9P A;  1HXY D;  3D4W A;  2GVB A;  1XNQ Q;  5CMD A;  5C5M A;  3U50 C;  5GAH C;  3OMC A;  2OCE A;  2AKW B;  1PV4 A;  2F0J A;  3FEW X;  2A6E C;  2R7Z H;  2HT1 A;  3LGJ A;  3GV3 A;  4RFB A;  5EAY A;  2F0T A;  1Q86 C;  4OGQ C;  1N36 L;  4DK6 C;  1VQ4 A;  3W5O A;  1V8Q A;  4KLK A;  3PSI A;  3PIP A;  4H0L C;  1O78 A;  3H0G B;  3MXU A;  5FLX E;  5JJL A;  3KF6 B;  2I5L X;  3OIP A;  1LTR D;  1LT4 D;  2BOS A;  3S14 H;  3B6Y A;  5E4X A;  5KIX A;  3I4M G;  3OPO A;  5C3E H;  2F0I A;  1DOK A;  1X9N A;  1EOT A;  2PZU A;  3NHH A;  1BCP F;  2DN8 A;  1I3Q B;  2N88 A;  4TKO B;  1TWG H;  5JVG 3;  1N36 Q;  3PF4 A;  4FDB A;  2Z1C A;  1HJP A;  3NEN A;  2AMC B;  2VZA A;  3I4N G;  1TY0 A;  1BVS A;  2VNU D;  1JWU D;  3DM1 A;  5ELE A;  1ENC A;  3FVQ A;  1XMQ L;  5C4J H;  4HCS A;  3M85 A;  4JI3 L;  1DYQ A;  2WAC A;  3K6O A;  2PMZ E;  2B2W A;  3MVV A;  4Y7N H;  4A3I H;  4P72 A;  3JAM E;  3TRE A;  2L11 A;  1ZKO A;  3VYT A;  2D5D A;  3KBX A;  3J7A 5;  1EQR A;  1UE5 A;  4DR7 L;  1TWH H;  4CDE C;  4HAE A;  1V43 A;  3NQT A;  2FFK B;  1QOH A;  5C5L A;  3DUZ A;  3T16 A;  5A35 A;  3EA6 A;  1XMQ Q;  1UEA B;  2CW0 C;  1IKL A;  4DR5 L;  5A2Q L;  1K8A C;  4X6A H;  4DV6 L;  4JI3 Q;  1YNJ C;  1BBX C;  2AUK A;  3L2P A;  4L5Q A;  4A3J G;  2JJQ A;  4GS3 A;  4EQP A;  1CHQ D;  2VS1 A;  1K8M A;  2RSO A;  3PIO A;  1J5E L;  2F0W A;  5LMU L;  4R4Q A;  3C1E A;  3VR6 A;  4U67 3;  1RTO A;  2VB3 X;  4HJA A;  3A55 A;  4DV6 Q;  1H95 A;  1N34 L;  2MNA A;  2UXD L;  4RH6 A;  1R4P B;  4A3M G;  5T1G A;  3GDE A;  4GOP B;  1KNE A;  3K57 A;  2NN6 G;  4HIM A;  3K0X A;  1J5E Q;  2KCM A;  3MFG A;  1Z47 A;  1SSO A;  1YNX A;  1EQV A;  2KHJ A;  5LMU Q;  2XRS D;  1UNS A;  5M3F G;  1DJR D;  5DEH A;  3A56 A;  1FNW A;  1CSP A;  3DWP A;  5BN3 A;  3W2D A;  4A76 A;  3OWF A;  1N34 Q;  5IGB A;  2A69 C;  3HOW B;  2J0T D;  3CRL C;  3MEH A;  4IUP A;  3NBH A;  2BE5 D;  1JWM D;  1JQY D;  4DV4 L;  3IRB A;  3UDF A;  2R92 B;  1F2L A;  4A3K H;  3G4S A;  1J6Q A;  2HD3 A;  3NUC A;  4C3J H;  2PQA B;  1CT1 D;  4GZY C;  1S72 A;  3BZK A;  4KHZ A;  4E6I A;  4XYQ A;  4GN5 A;  4HTH A;  4DV2 L;  3H3V C;  1X32 A;  1PVO A;  3IKJ A;  4O1N A;  1BUV T;  4LAA A;  1SYB A;  3QIA A;  1EIF A;  2F52 A;  2IX0 A;  4DV4 Q;  2EY1 A;  5HGT A;  5I2Y A;  3NPP A;  4OL7 A;  4IQZ A;  5LL6 X;  1EWC A;  4GN4 B;  1PYW D;  4ZCK A;  1FNU A;  1V1Q A;  4JK1 C;  1ZEQ X;  2IX1 A;  5ELB A;  1PZK D;  3TZD A;  4HMI A;  1VQJ A;  3GTO B;  3H3V I;  3D0F A;  1P8L A;  3C3L A;  3HOV H;  3H0G G;  2JQO A;  4DV2 Q;  3Q22 A;  3A54 A;  1SR3 A;  2YU9 B;  5FLX L;  2CH4 W;  4LW1 A;  2XWB B;  3VYS A;  5DAU A;  1JJG A;  2E5L L;  1Q82 C;  2ZXO A;  1STA A;  2EJM A;  3KLR A;  1TWF H;  5IP9 H;  2A68 D;  1NR2 A;  1Q1E A;  3FHW A;  2EZV A;  4YWK A;  5D3D A;  5CGK A;  1I4R A;  1SE4 A;  1KD1 C;  2B2V A;  1QIL A;  1HNZ L;  2HCI A;  4P74 A;  3TP6 A;  4R8N A;  4JYA L;  2E5L Q;  1M1K C;  4AH6 A;  5C3W A;  3JAM L;  2F0D A;  5IP7 H;  2D9U A;  1KXL A;  2L4N A;  4G4K A;  3P20 A;  1SRU A;  2B63 H;  2X6G A;  1U9R A;  1VDZ A;  2N8N A;  5IYB G;  3T13 A;  4IZ8 A;  4MIU A;  1HNZ Q;  1C4Q A;  1Z9F A;  4G7O C;  4JYA Q;  1M90 C;  3PO2 B;  2CCZ A;  1AH9 A;  1JOR A;  2PW7 A;  5JVH 3;  2KHI A;  2C5C A;  2PZT A;  3MC0 B;  2B2W C;  4OWT B;  4NKL A;  5FLM H;  2H4O A;  5DLQ E;  3U9O A;  2L9H A;  4GLX A;  4K8J A;  4ALP A;  1PZI D;  1O80 A;  2ZXR A;  3WOE A;  4B08 A;  3KF8 B;  5D14 A;  4A3G H;  4OO1 I;  1SEB D;  5JAV A;  2DY7 A;  4KHP L;  4DUZ L;  2R93 B;  4DNI A;  4DNR B;  3S1Q H;  1QUQ A;  5K36 G;  1EY6 A;  1KDB A;  1ENF A;  4DV0 L;  4HIK A;  1N9W A;  1UEB A;  2NZH A;  1GHK A;  1PH8 A;  3SR1 A;  3EBE A;  1B4O A;  3D31 A;  4DR6 L;  4QL5 A;  1XMO Q;  4BA2 I;  3S17 H;  1JJC B;  1UAP A;  5GAE C;  4DUZ Q;  2K05 A;  3CQZ H;  3QJY A;  2SEB D;  3QWN A;  3KOJ A;  5COR A;  3ZJY C;  2VUM H;  1IW7 C;  2FHT A;  2Q2H A;  1O7Y A;  4DV0 Q;  4ZK9 B;  4HSP A;  5C4H A;  4MHE A;  3IAY A;  2JEA I;  2X69 A;  4DR6 Q;  1TT2 A;  2NVT H;  3S1R H;  1AN8 A;  3W3A A;  3FKI B;  1FYC A;  3GTL H;  2F3I A;  1F9Q A;  1EU3 A;  1GUO A;  3BYY B;  4AQY L;  2JA7 B;  1E7Z A;  1NTG A;  4CKC A;  2OQK A;  5ELN A;  5J1Z A;  2B29 A;  2A6E D;  1TWA B;  3TDQ A;  4A93 B;  1EIH A;  4EVO A;  4IUV A;  1XJV A;  2J7Z A;  4HN7 A;  1R9T H;  2JN4 A;  4AQY Q;  4UAI A;  4DAM A;  3F2C A;  1YVC A;  2R7F A;  3KDF A;  5C4X H;  2ZXP A;  4RAU C;  4X66 L;  3KFU A;  4BY7 B;  3BZC A;  5IYD G;  3J7Y W;  4A75 A;  2L1B A;  1J9O A;  1E1T A;  1B50 A;  1F2M A;  5M3M B;  1FNV A;  2O2L D;  4LF6 Q;  4JBW A;  1JOQ A;  1DXM A;  3HOU G;  1I6H B;  1WFQ A;  2E2H B;  3E9I A;  5IGE A;  3CCQ A;  3I8Z A;  3UE0 A;  1EU4 A;  1HH2 P;  1T5E A;  3HFZ B;  5CV8 A;  2HDL A;  3A74 A;  2RCF A;  1QE6 A;  4YWL A;  4LK1 C;  1R4Q B;  2XNA C;  5F2D A;  4IFD I;  2LY7 A;  4J15 A;  5FO8 B;  3K8A A;  3QO2 A;  4JG2 A;  2B2V C;  3GTJ H;  5C44 G;  3SK6 A;  2O5I C;  5LMN W;  3NWS A;  1C8C A;  2CW0 D;  1B7Y B;  2C9O A;  1EY5 A;  4JV5 L;  3NXW A;  1ZYR C;  2PZW A;  1CM9 A;  3EVQ A;  1YNJ D;  1MKH A;  3BYT B;  1CKN B;  4Q0F A;  1STB A;  1SYE A;  3T53 B;  1B53 A;  1ICF B;  1WYD A;  4HSV A;  1VF5 C;  3PQI A;  1KNA A;  4N8X 1;  3HOZ G;  5I2X A;  3KJP A;  2NUC A;  3W1B A;  1A63 A;  3MXN A;  3NEL A;  1VQ6 A;  2RF4 A;  1VMP A;  4FXD A;  3MWY W;  4JV5 Q;  4I7A A;  2SNS A;  1JT8 A;  2OTJ A;  1KQS A;  3HOX B;  3D8G A;  1Y69 U;  1K3R A;  2PNR C;  5JPN C;  4YCU A;  2TSS A;  4A3F H;  2E8G A;  1G29 1;  1B9N A;  1LTT D;  2ICE C;  1SNQ A;  1II3 A;  1I50 B;  1SN8 A;  3RZD H;  1D2B A;  5CR3 A;  4X65 L;  1PH3 A;  2E74 C;  2ZJR A;  2NVY B;  5FJ8 H;  1WVL A;  3I7F A;  1VQE A;  1I4G A;  2A69 D;  2L0C A;  3S1N H;  1IL8 A;  4DV5 L;  2XIW A;  4LWC A;  3T4A C;  3NTI A;  3J7Z C;  2ENB A;  4BY1 G;  3I55 A;  2F0M A;  4R4T A;  2K50 A;  2Z6K A;  3E9H A;  1QVG A;  1PH2 A;  1DGS A;  3ITP A;  4UP9 A;  4IPG A;  4WJ3 M;  3ZYY X;  3M4P A;  5IIF A;  3GTK B;  2PW5 A;  1E2Z A;  4A3L H;  3CD6 A;  2UUA L;  2WP8 J;  1T5X D;  3EQL C;  4QMG A;  3ULJ A;  4KJO A;  2VW9 A;  3LWE A;  5K5P A;  3G6E A;  2K5D A;  2FXQ A;  3LNN A;  3L7Z C;  2BH2 A;  1XPO A;  1CTM A;  4I65 A;  3R2I A;  5M3M H;  4XDX A;  1MBY A;  4CHT B;  2PQE A;  3AQQ A;  1K28 A;  1A2T A;  5CV9 A;  1EFI D;  5JEA G;  2F0E A;  1JMC A;  1PTO H;  1NJI C;  1U4M A;  2PI2 E;  1Q90 A;  4C2M B;  1H9R A;  1X54 A;  1XTD A;  1WTH A;  3S15 H;  1D5Z C;  3S9W A;  3VYU A;  1O7I A;  3RNU A;  3RZO H;  3DWQ A;  4C3I B;  1KTK A;  2EXD A;  5ISR A;  4IPD A;  4PQX A;  2ZM6 L;  1SMY C;  1VQN A;  4ODG A;  1RHP A;  3PO3 B;  1Z6H A;  3H94 A;  4JI5 L;  4DR3 L;  4UP8 A;  1Q8K A;  3WWV A;  1PYB A;  1TS4 A;  3RLO A;  4AYB B;  1DON A;  3A7L A;  4B3M L;  3I4M H;  4DV7 L;  2Q2I A;  4DV3 L;  2WAQ B;  2K75 A;  3DXJ C;  2ZM6 Q;  1WTR A;  2Z4H A;  1YJN A;  3IL8 A;  1VQP A;  1Y1V G;  1K0S A;  3SVM A;  4JI5 Q;  4DR3 Q;  3TP8 A;  1TKW B;  4H02 A;  2M00 A;  2MO1 A;  4RGO S;  3I4N H;  1B3Q A;  4N9T A;  1UWV A;  3S2D B;  3CC4 A;  1E2V A;  3NBH B;  3X3N A;  4LUO A;  4TQU S;  1RKN A;  4B3M Q;  2QEJ C;  1V1O A;  1SFO H;  2QKI C;  3G71 A;  4FXK C;  4DV7 Q;  4DV3 Q;  1VQH A;  2Q8I B;  2PYK A;  1D1I A;  1Y1W B;  4LNQ A;  2XVS A;  4MNO A;  4IAL A;  3KLW A;  1KLU D;  1EYA A;  1Y14 B;  5COY A;  5IYC G;  2LXK A;  1PH1 A;  3M7G A;  1F9P A;  2KCT A;  4EQN A;  2LSS A;  1F77 A;  3SEB A;  3GTP B;  2J4X A;  3NTH A;  3O13 A;  3I2Z A;  5IOD A;  5E3F A;  5FO9 B;  1B1Z A;  1K73 C;  4A3J H;  2TMP A;  1GVP A;  5E4W C;  1WD1 A;  4X3K A;  1OXU A;  3S1M H;  4BA1 I;  3UI2 A;  4BBR B;  1D1K A;  1HUM A;  3K58 A;  1HNW L;  1IW7 D;  1NNX A;  3TBI B;  4C3H G;  3S2H H;  3HOY G;  5IGD A;  2NVQ B;  1X3G A;  2CHB D;  4DGZ A;  4IOA A;  2NB0 A;  3ND8 A;  3ERO A;  5E7N A;  3URY A;  1BBW A;  1JIC A;  3ONA B;  4OON A;  1IZ6 A;  4A3M H;  4MN3 A;  1PFS A;  4XTC S;  3CC2 A;  4XT1 B;  3FP9 A;  3CCS A;  1HNW Q;  3DWA A;  4R4C A;  2R6G A;  2NN6 H;  1EY8 A;  1LYL A;  4XQN A;  5M3F H;  4KKU A;  5EGT A;  3HKZ B;  3PGZ A;  3ULL A;  2Z6K C;  3WDN A;  1K83 H;  1BKB A;  5C3X A;  4G57 A;  3BS1 A;  2K04 A;  4IUN A;  4DK3 C;  1GHJ A;  1S4Z A;  4IPC A;  5GAD C;  1RCV D;  1SE2 A;  4WFN 3;  2RSN A;  2K14 A;  4RCO A;  3AMU A;  2NVX H;  3J80 i;  2AHO B;  4JOI C;  3VYR A;  4GNX A;  1L0W A;  2RHQ B;  3RMH A;  4IPH A;  4C3I G;  4HED A;  1QVC A;  3HKS A;  1Q1B A;  1OO9 B;  3MZ5 A;  1UE1 A;  4R4O A;  4FVM A;  3S14 B;  1GD7 A;  5C3E B;  2K5V A;  3H0G H;  2NZO A;  4PV1 C;  1QUQ B;  1B3A A;  1VCI A;  1MJC A;  1MSH A;  1SJE D;  4KKS A;  2OF1 A;  5JJI A;  2F0S A;  5IWA L;  4R4I A;  1LUZ A;  5C0X G;  2ZTE A;  4G7Z C;  5EPJ A;  4A3I B;  1ZYR D;  3V96 A;  3AB9 A;  3KK7 A;  1KRT A;  3F1Z A;  2N3S A;  2K5H A;  1AFP A;  1PH9 A;  2K33 A;  2JA5 G;  2F0V A;  5CV4 A;  1X3F A;  3PUY A;  5IWA Q;  3QB3 A;  4IUT A;  1N8R C;  4X62 L;  2KOL A;  1N32 L;  1SNP A;  4DR7 Q;  5EJW A;  1STH A;  3A8J E;  1S5D D;  5IYB H;  3OSO A;  2F4I A;  2EDG A;  5EPK A;  3CW2 C;  1A8V A;  2BDO A;  1FJG L;  3MEF A;  4DR5 Q;  1U0L A;  1ILQ A;  1NUC A;  2EYH A;  1TXY A;  4DK1 A;  3M4O H;  4Q5V A;  4BBR G;  4X62 Q;  5FLX c;  1JCK B;  1B70 B;  1AE2 A;  2B39 A;  1N32 Q;  3QOJ A;  4A3B B;  4QUF A;  3HRZ C;  1OXS C;  4YIJ A;  2JK8 A;  1C7Y A;  4LF5 L;  4XXE A;  4DXG A;  3LX0 A;  4FF3 A;  1JC7 A;  1FJG Q;  3TRZ A;  3F8T A;  1YZ6 A;  5M9O A;  2K4K A;  4O2D A;  4V19 0;  1PZJ D;  2QDB A;  1PHJ A;  2UXD Q;  1PLF A;  1VQI A;  1W3S A;  2QA4 A;  5K36 H;  5DM6 3;  5G3L F;  4QIW B;  1EYD A;  1YJW A;  4LJZ C;  3NEM A;  4X3S A;  4DUY L;  1D8L A;  3S16 B;  1DM0 B;  4JW0 A;  4PZ8 A;  4LF5 Q;  4TSS A;  3JC6 6;  1GUG A;  1H9S A;  1HTP A;  1GOZ A;  3Q0A A;  3H15 A;  3GD7 A;  2EIF A;  3JAM c;  4B3S L;  1E2W A;  4WJ4 A;  1KRS A;  2AWO A;  1CA5 A;  1EIY B;  2MQH A;  4JBK A;  3I90 A;  4C3J B;  1EYC A;  2L55 A;  1GJX A;  5EKL A;  2Z8L A;  4B9X A;  3Q8D A;  3NTK A;  4K5X A;  5L37 A;  3PUV A;  5IT9 E;  2LS0 1;  1DZ1 A;  3CHB D;  4B3S Q;  2DNE A;  2EVB A;  1IBM L;  2WB1 B;  1G8Z D;  3CPF A;  2AQ3 B;  3TQY A;  3J81 i;  3HOV B;  3LWU A;  1JR0 D;  4ZRZ A;  2F4V L;  3PCO B;  3EFX D;  5C4Z A;  2HQL A;  2NBF A;  2OXP A;  4AYB E;  4A3D B;  1D5M C;  1K0R A;  5KGU A;  5ELC A;  1GUT A;  2Y0S B;  2JP1 A;  2OQ0 A;  1SMX A;  3DHQ A;  1GUN A;  2DUD A;  3MXN B;  4NW2 A;  4NXM L;  1X56 A;  2QDL A;  2WAQ E;  5M5Y H;  1SMY D;  1HUN A;  3SE0 A;  1IBM Q;  5CBA E;  4IJH A;  1LT3 D;  4GNX C;  1U4L A;  2A8V A;  1TWF B;  1ET9 A;  2F4V Q;  2NWG A;  3K59 A;  2ID0 A;  1MD2 D;  5IYD H;  2E2J B;  1UE7 A;  3K7A B;  4FYD A;  3RD4 A;  1HZ9 A;  2ZT9 C;  4QUC A;  4PNY A;  3HOU H;  3FDT A;  3SXH A;  2VQE L;  1YEZ A;  1CQF A;  2R3Z A;  4RKL A;  4RWS C;  4CGY B;  3CCU A;  2B63 B;  1PFN A;  4MTN A;  4RGT A;  2F0G A;  3P7J A;  4DR1 L;  1TWC B;  3J7A F;  1J8I A;  3NSW A;  5CV6 A;  1OXT A;  2ALY B;  4KY7 A;  4J1M A;  2VQE Q;  1TU2 B;  2RDG A;  1FR3 A;  4A3E B;  5EQ0 A;  1W6J A;  2IHF A;  5C44 H;  1MI2 A;  5JJK A;  3U9S A;  3SK5 A;  1MGS A;  3OYY A;  4DR1 Q;  1PTO C;  1TQO A;  4A3G B;  4FNF A;  4A3B G;  1DOL A;  1KAW A;  4KY5 A;  1YI2 A;  2K6A A;  4A4I A;  2IPK D;  3HEJ A;  4K5W A;  1SRO A;  4MTK A;  3GTQ B;  3KF6 A;  3PV0 A;  1GKH A;  3S1Q B;  1H9K A;  1VQL A;  3HOZ H;  2CKZ B;  1BR9 A;  4ZLT F;  3TN2 A;  1IBL L;  1OTC A;  4ZUI A;  3HOW G;  4KHP Q;  1DD2 A;  3HKZ E;  3AEV A;  3E5S A;  1Y8P B;  3R3O A;  1WOC A;  5KYL A;  2NTS A;  4P73 A;  2R92 G;  4K8I A;  4DAY A;  3E6Z X;  2F0O A;  3OOC A;  1HHV A;  1H9M A;  1AE3 A;  3BVM A;  1Q81 C;  4QB4 A;  1IBL Q;  1EZ6 A;  4S3S A;  4CDF C;  2NVT B;  2I46 A;  2KEN A;  3GTM H;  1HR0 W;  1AEX A;  1RL2 A;  2Z0S A;  5M5X B;  1HNX L;  4TRD A;  5IT9 L;  3MXG A;  2L5T A;  4BY1 H;  2KBN A;  4IOC A;  1MIU A;  1X65 A;  3OTO L;  4ZQ3 A;  1BO0 A;  2HQE A;  2PNH A;  4DV1 L;  2UUC L;  3SK8 A;  1HNX Q;  2YTV A;  4A3D G;  2B8G A;  2B2Y A;  3M4Y A;  2P5Z X;  4UP7 A;  1EYG A;  1TWA H;  5T1I A;  3NQI A;  1EY9 A;  2M2L A;  5G3L D;  4ZAI A;  1PFM A;  3OTO Q;  1GM5 A;  2DGY A;  4M1U B;  3BU2 A;  3DLL A;  2B8F A;  4DV1 Q;  5NUC A;  4GOP A;  1XX8 A;  4CJ1 B;  2QEX A;  2PPB C;  2E2I H;  2HUG A;  3KUP A;  2UXB L;  5JEA H;  4H13 C;  4X66 Q;  1UE6 A;  2ZTD A;  4YCW A;  3BDL A;  1OXX K;  1VQB A;  1D7Q A;  3CCL A;  4JCV E;  1WTP A;  1I6H H;  1IL2 A;  2R7D A;  1IBK L;  1HA5 A;  5D3I B;  3G7L A;  2VQF L;  4JVZ A;  4XYO A;  2AUJ D;  2E2H H;  2IY5 B;  5FOB B;  4DAV A;  2VB2 X;  3CMA A;  2UXB Q;  2SOB A;  4F87 A;  4DK0 A;  1QCB D;  3OW7 A;  4JC0 A;  3PO2 G;  1L1O A;  5EKI A;  3I4O A;  2PQA A;  4QJF A;  2H5X A;  3PUW A;  5CV7 A;  1IBK Q;  2F0U A;  2KCN A;  3FRP B;  2VQF Q;  1STN A;  1CFM A;  4JI7 L;  4A3E G;  4C1N K;  1KL9 A;  2HIV A;  3G48 A;  3J80 E;  1LAC A;  1V1P B;  2NN6 I;  3ULP A;  2R93 G;  3GQB A;  2A73 B;  1WJJ A;  1UUP A;  1PH6 A;  2G5D A;  1Y1V H;  3W1G A;  1QNU A;  4Z9C B;  1K8G A;  4JI7 Q;  1B8A A;  1CZG A;  2A6H C;  4K2K A;  4QIW E;  5AFW A;  5IGF A;  1NBW A;  4C56 C;  3ERS X;  4KI0 A;  3CAM A;  2PMZ B;  3AFP A;  4BBS B;  2IHE A;  4H44 C;  1VQ5 A;  4FF2 A;  1KAB A;  4A3F B;  4GKJ L;  1PDQ A;  3SDZ A;  3I73 A;  5IY0 A;  5M5W H;  4NPS A;  2F03 A;  3M4Q A;  4GNX B;  3RZD B;  5IYC H;  1WCM B;  4OXP A;  5LMN L;  2QCP X;  1W2B A;  3CCJ A;  1HQR D;  1HFN A;  2RHS B;  2EYO A;  3M7N A;  4U68 A;  1JE5 A;  4O42 A;  5I4D A;  3S1N B;  2PCF B;  2JA8 B;  3FKI G;  4KTA A;  2O5J C;  1SNM A;  2K01 A;  4K2L A;  4X65 Q;  4GKJ Q;  2Z4I A;  1EZ8 A;  2JA7 G;  2A1A A;  1HQM C;  2A19 A;  2WB1 E;  4KN7 C;  1SYD A;  2XGT A;  5LMN Q;  2K7V A;  3C1F A;  1CKM A;  4KD3 A;  4C3H H;  4DV5 Q;  3R2T A;  4A93 G;  3PF5 A;  3HOY H;  2CQO A;  1AZQ A;  3NK9 A;  3GTK H;  4DU9 A;  1VQC A;  2Y0S E;  4K6D A;  3GTG B;  2B2U A;  2JA6 B;  5I9P A;  4JI1 L;  4IUR A;  3CKI B;  4BY7 G;  5HUR A;  2UUA Q;  1PXU A;  5BN5 A;  5J39 A;  5BR8 L;  1A62 A;  3KF8 A;  1BXT A;  4RA8 A;  5M3M G;  4CJ2 C;  1FD7 D;  2RBM A;  2F0N A;  3RN5 A;  1VQG A;  1PTO B;  4KKT A;  5LHY 1;  1S5C D;  1SND A;  4GLA C;  4EX5 A;  1LAB A;  5EBC A;  1VMC A;  4DR4 L;  4M8A A;  4YWM A;  4PMB A;  4A3C G;  3EIV A;  4JI1 Q;  4LF7 L;  2E75 C;  1E3P A;  3KYH C;  1QWY A;  1Q7Y C;  1NAP A;  3Q24 A;  2HCC A;  3CPW A;  2B2Y C;  3PUZ A;  2KA7 A;  5BR8 Q;  3OMG A;  3RZO B;  2GVA A;  4C2M H;  1ESF A;  4YCV A;  4CKB A;  1K3B C;  1PRT C;  5C0X J;  5EPL A;  1E0B A;  1SNC A;  3UDG A;  3A8I E;  4XT3 B;  3TEH B;  1GXD C;  3AU7 A;  3A5U A;  3BDC A;  4DR4 Q;  5J22 A;  2EPB A;  3Q23 A;  4K14 A;  4C3I H;  4PG3 A;  2F0Q A;  4OEM B;  3I56 A;  4LF7 Q;  1KLG D;  2RDF A;  1KIX A;  1BQQ T;  2BCO A;  1B2T A;  3FPU B;  4FO2 A;  3KLS X;  1HCZ A;  3D6C A;  4JI4 L;  5DNF A;  1WTO A;  1RF2 D;  2Q2T A;  5KYI A;  2RCN A;  2EY6 A;  4IO9 A;  4L8J A;  2RQX A;  4X3U A;  1PA6 A;  3J81 E;  1X3E A;  1H9S B;  1ENA A;  1L1O C;  4JI4 Q;  5C0X H;  4F88 A;  3HOX G;  3U58 A;  1PTO D;  2FMC A;  3S2D H;  4HR7 B;  4H7B A;  2N78 A;  3J81 j;  1U5K A;  3K0Y A;  4BBS G;  2WKC A;  1O7L A;  3K5L A;  2JA5 H;  2JA9 A;  4LF9 L;  3PMF A;  1KDC A;  4P71 A;  1A6X A;  1PMR A;  5I6Y A;  1WD0 A;  5I6W A;  3UE1 A;  1LTG D;  1BCP C;  1SLJ A;  2BDN A;  1SNO A;  1CUK A;  3ER0 A;  3HS0 C;  1EOV A;  1U4R A;  2JA8 G;  4R8I A;  1IYU A;  1NMF A;  1P16 A;  3M3Y B;  3A0J A;  2EYJ A;  4LF9 Q;  1VQD A;  4RHR A;  1EL0 A;  4KK7 A;  3QG1 A;  3SK4 A;  1C0A A;  4BBR H;  3K5O A;  2SDF A;  1XNR L;  2OWO A;  4OWX B;  3H91 A;  2IW3 A;  2R61 A;  1ASZ A;  1QJO A;  2NVQ H;  1DOM A;  2HHH L;  1CKO A;  1YIT A;  1EEI D;  4ULL A;  4OO1 G;  4K0K L;  2EY2 A;  2M9V A;  1HA6 A;  1ZXT A;  5M3F B;  2EYP A;  1FL0 A;  4LMQ D;  4BXX G;  4FXG C;  1K83 B;  2QW7 A;  2YYZ A;  1YHQ A;  2IL8 A;  1FVI A;  2DNC A;  2HHH Q;  4P2C B;  3OHX C;  2R7Z B;  4DKA C;  1PH5 A;  2C35 B;  3F2U A;  1IYV A;  4K0K Q;  3E0J A;  3FMC A;  4ID6 A;  3CCV A;  4AIM A;  2G9H D;  2BA1 A;  3VR4 A;  2NVX B;  2D0O A;  3V05 A;  3QOL A;  4P75 A;  4OWW B;  2B2U C;  2F1M A;  3SHL A;  4KY6 A;  3TS2 A;  2NYZ D;  4UHV A;  1H9J A;  2YV5 A;  5JPM C;  3PO3 G;  3A8K E;  4LUV A;  2CH4 A;  4KJN A;  2EY5 A;  2EJG C;  4L63 B;  2LFN A;  1VQ7 A;  4AYB G;  1STY A;  2K1B A;  1TWG B;  3KJO A;  4XQJ A;  3R8B A;  5IE8 A;  1LV9 A;  1VQO A;  3V2T A;  1I4P A;  3AYH B;  5H1S E;  1A0I A;  4DPG A;  2WAQ G;  1I3Q H;  3MFY A;  1PH7 A;  5C4J B;  3BVZ A;  1B9M A;  3Q6S A;  4ZKC B;  2Z6B A;  4Y7N B;  4PMW A;  4QGU A;  2MP1 A;  2GA4 B;  1RIP A;  1VQA A;  4DAY B;  1TWH B;  1I94 L;  2EJF C;  2LXJ A;  3J81 L;  1Y1W G;  1ET6 A;  3VDY A;  3M9B A;  1KC8 C;  3TP7 A;  1LO5 D;  2LKV A;  3RN2 A;  1AZP A;  1T9H A;  1QG7 A;  3DEP A;  5TSS A;  1EIG A;  5KEE A;  1LTB D;  4DF7 A;  1RTN A;  4OIJ A;  4CDC C;  2JYO A;  2X6L A;  1I94 Q;  2A6H D;  1LTS D;  1VS0 A;  2V1C C;  3BZD B;  4MZ9 A;  3TP5 A;  1BBU A;  3C46 A;  4KMU C;  2ICI A;  2EYM A;  2YTX A;  1LT6 D;  3M4O B;  1Q8I A;  1I4H A;  4IFD G;  3ND9 A;  3K5M A;  4NDX A;  4K6L A;  5I9O A;  3KDF B;  1VQ9 A;  1LLR D;  1STG A;  4OHJ A;  1PH4 A;  3HP3 A;  1PRT B;  2B2T A;  3K5N A;  2MJ8 A;  1TS3 A;  4KD4 A;  3RR5 A;  3S24 A;  4A3B H;  1VQ8 A;  3H09 A;  2BH8 A;  4ZUJ A;  3HKZ G;  5FKA C;  3TZU A;  4X64 L;  1X3Q A;  1I6V C;  4JI8 L;  4YHH L;  3MXP A;  4A3K B;  2MFI A;  4TVA B;  3HOW H;  3CP0 A;  5ELD A;  2D62 A;  3TSS A;  1SE3 A;  3S16 H;  4JI6 L;  3FPP A;  4POG A;  4DUY Q;  5ELF A;  2R92 H;  4KHV A;  4LF8 L;  2R7Z G;  4IN3 A;  1JJ2 A;  3ICE A;  4X64 Q;  2MGS A;  4WRD A;  1WTV A;  4JI8 Q;  1IHZ A;  4YHH Q;  1L1O B;  2I0Q A;  1MSG A;  2K28 A;  1E1O A;  2WFW A;  5BN4 A;  5CBE E;  2KEC A;  1OXV A;  2ASB A;  2RDH A;  1NSN S;  1I4Q A;  2UUB L;  4JI6 Q;  1ICW A;  2QF7 A;  4IUQ A;  5E1F A;  4LF8 Q;  1NCV A;  1Q12 A;  1VQM A;  5C3E G;  5EBD A;  3GTO H;  4PMC A;  3I72 A;  1C48 A;  2DJG C;  3VR3 A;  3E3X A;  3HG9 A;  4QCL A;  2XTI A;  1BCP B;  3H6M A;  1PRT D;  2YU9 H;  4HCE A;  3F2D A;  2ZJQ A;  1PFB A;  5M5Y B;  2UUB Q;  4A3D H;  3STB C;  1W6K A;  4HMJ A;  2F0F A;  2CWP A;  4LFC L;  4K5V A;  2L12 A;  4FP5 D;  3GP7 A;  3KBG A;  1QZG A;  4NXM Q;  4A3I G;  4QQB X;  1G2S A;  1SYG A;  2RVL A;  3NE5 B;  4RCN A;  5D65 A;  3WOF A;  2IT1 A;  3BG3 A;  1LTI D;  2WKD A;  3E0E A;  3VA5 A;  3HOU B;  2K5W A;  1YNN C;  2E2J H;  3SGI A;  2K03 A;  3G6J B;  3RUZ A;  4LFC Q;  3K7A H;  4G7H C;  2PO4 A;  1ESR A;  4GN3 B;  5GAG C;  4WJW A;  2K52 A;  2GN5 A;  1WTX A;  4APV A;  1YJ9 A;  1EUJ A;  2LMC B;  4YY3 L;  1F9S A;  1GUS A;  1NE3 A;  5IT9 c;  1LM0 A;  3MTS A;  3D6W A;  3RLN A;  2JXM B;  1N33 L;  3HZX A;  1HZC A;  1A3V A;  3PO2 H;  1JOK A;  1TWC H;  5C44 B;  3IFT A;  3NBI A;  2EOT A;  1S40 A;  2XSC A;  1AP0 A;  4A3E H;  4YY3 Q;  1BCP D;  1S5E D;  2EYL A;  1TR5 A;  1YIJ A;  4EQO A;  5IGC A;  3MA2 B;  3T56 B;  3T51 B;  1N33 Q;  2VL6 A;  1HTL D;  2R93 H;  2AQ1 B;  1ML0 D;  1XMO L;  1EY0 A;  3HOZ B;  1U4P A;  4DFA A;  2KUM A;  1BDO A;  4HJ7 A;  2JE6 I;  3S17 B;  2NTT A;  4L5S A;  1G51 A;  1JE4 A;  3GTQ H;  3CU7 A;  1VQK A;  3CQZ B;  1D5X C;  4OX9 L;  1L2F A;  1AW7 A;  2VUM B;  4JI0 L;  1HPC A;  2VXW A;  5ELO A;  5GRO A;  2QGQ A;  4A3K G;  1NY4 A;  3OIQ A;  4B3R L;  2Q8R E;  4CBV A;  4C3J G;  2OTL A;  5IGG A;  3AFQ A;  3A5Z B;  4EGV A;  1X3P A;  2B2T C;  3S1R B;  1ONL A;  2ES2 A;  2WIN B;  1F9R A;  2F0P A;  3CME A;  3GTL B;  2N55 A;  4GKK L;  4ME3 A;  4OX9 Q;  4IUU A;  5JEA J;  3GTM B;  1CI3 M;  4JI0 Q;  3P75 A;  1JB7 A;  2F3V A;  4RGM A;  4JBJ A;  3L3O C;  4F8M A;  3FKI H;  4B3R Q;  2WB1 G;  2K5N A;  1F2Y A;  2AWN A;  4JI2 L;  3CRK C;  4BY1 B;  4RGN A;  5M5X H;  3HOV G;  1TS2 A;  2WV6 D;  5J3B A;  3CCE A;  5FK9 C;  2JA7 H;  1CA6 A;  4NMZ A;  4ZKB B;  4OIK A;  1G6Z A;  1CQV A;  3QR8 A;  1R9T B;  4GKK Q;  1D6E C;  1JWS D;  3DEO A;  3VR5 A;  1JB3 A;  1XXG A;  2KEE A;  3JAM i;  2Y0S G;  4ZYS A;  4A93 H;  2RKS A;  1TS5 A;  3K80 C;  3CF5 A;  1Q46 A;  1SXT A;  5C4X B;  4QF4 A;  4PZ7 A;  1QB5 D;  1C9O A;  4JI2 Q;  1NMG A;  4IJL A;  4UDU C;  4LF6 L;  5IP9 G;  2IJ0 A;  5C0X I;  1VQF A;  5HY6 A;  2UUC Q;  3BJU A;  1ILP A;  2DJF C;  3GV6 A;  1A3T A;  4BY7 H;  3I4L A;  2ZTC A;  5FO7 B;  2K32 A;  2E2I B;  4XIG S;  1YHA A;  1PTO F;  1HR0 L;  2SNM A; 
#chains in the Genus database with same CATH homology
 2E5L L;  4YCV A;  1Q82 C;  2L15 A;  1GD7 A;  5C0X J;  3OW2 A;  3UDG A;  2K5V A;  3TEH B;  2Q2U A;  1TWF H;  5IP9 H;  3A5U A;  3H0G H;  2NZO A;  5IP7 G;  4DR4 Q;  1Q1E A;  4A3C H;  3FHW A;  1QUQ B;  4YWK A;  3U4Z A;  1KD1 C;  4C3I H;  4PG3 A;  3I56 A;  2B63 G;  1VCI A;  1MJC A;  4LF7 Q;  3CCR A;  4POF A;  1HNZ L;  4B3T L;  1KIX A;  4P74 A;  5JJI A;  1HR0 Q;  4RG1 A;  1MJE A;  4JYA L;  2E5L Q;  5IWA L;  1M1K C;  4JI4 L;  4R4I A;  4O0A A;  4AH6 A;  3S1Q H;  1LUZ A;  5C0X G;  1EQQ A;  2ZTE A;  5HGQ A;  5FLM G;  5IP7 H;  1X55 A;  1KXL A;  1SRU A;  2Q2T A;  2RCN A;  2B63 H;  1KRT A;  3F1Z A;  2N8N A;  5IYB G;  2N3S A;  4IO9 A;  2K5H A;  1PH9 A;  1PA6 A;  1HNZ Q;  2EQS A;  4B3T Q;  1EFW A;  2JA5 G;  1X3E A;  1Z9F A;  1K9M C;  1X3F A;  3PUY A;  4A3G G;  5GQO A;  1M90 C;  4DR2 L;  4JYA Q;  5IWA Q;  3H3V H;  1L1O C;  2CCZ A;  4JI4 Q;  1N8R C;  2ZJP A;  1AH9 A;  3H3V I;  2KHI A;  4X62 L;  4OWT B;  5FLM H;  3HOX G;  3U58 A;  2YTY A;  3UDI A;  3S2D H;  1N32 L;  4QY7 A;  4DR7 Q;  5DLQ E;  4GLX A;  2N78 A;  3J81 j;  3T1H L;  3RLF A;  1U5K A;  4ALP A;  3DM3 A;  5IYB H;  4BBS G;  3CW2 C;  1A8V A;  1FJG L;  2JA5 H;  3MEF A;  2ATW A;  3KF8 B;  4DR5 Q;  1U0L A;  2JA9 A;  4A3G H;  4LF9 L;  4OO1 I;  1TXY A;  3M4O H;  4P71 A;  4DR2 Q;  4KHP L;  4DUZ L;  4HID A;  3UE1 A;  4DNI A;  1LTL A;  4BBR G;  4X62 Q;  5FLX c;  3HOX H;  1QUQ A;  1IXR A;  1IYJ B;  1B70 B;  1AE2 A;  1SLJ A;  3ER0 A;  2VUM G;  1CUK A;  1HZA A;  1QZH A;  2UXC L;  2B3G A;  1N32 Q;  4DV0 L;  1EOV A;  4HIK A;  1OXS C;  3T1H Q;  2JK8 A;  1C7Y A;  4LF5 L;  1N9W A;  1UEB A;  2PI2 A;  2NZH A;  3U4V A;  4HJ5 A;  1PH8 A;  2JA8 G;  4BBS H;  1I50 H;  1NMF A;  1P16 A;  3EBE A;  4JBM A;  3D31 A;  1FJG Q;  4DR6 L;  3TRZ A;  1EWI A;  3A0J A;  4QL5 A;  2NVY H;  3F8T A;  1YZ6 A;  1XMO Q;  4BA2 I;  4LF9 Q;  1VQD A;  3S17 H;  1JJC B;  1YHB A;  2K4K A;  4O2D A;  1WCM H;  4DUZ Q;  5GAE C;  1PHJ A;  3CQZ H;  2UXD Q;  1C0A A;  4PZ6 A;  4BBR H;  3KOJ A;  1VQI A;  1W3S A;  3ZJY C;  2QA4 A;  3K7U C;  2VUM H;  4NXN L;  1YJW A;  1XNR L;  2UXC Q;  3NEM A;  2Q2H A;  2OWO A;  1QVF A;  4OWX B;  4DV0 Q;  4DUY L;  1D8L A;  4PZ8 A;  4LF5 Q;  2JA8 H;  1ASZ A;  2NVQ H;  2HHH L;  3JC6 6;  1CKO A;  1YIT A;  2JEA I;  3H15 A;  3GD7 A;  4OO1 G;  2EIF A;  4DR6 Q;  3JAM c;  4K0K L;  2NVT H;  3S1R H;  4B3S L;  4WJ4 A;  1KRS A;  2AWO A;  1EIY B;  2MQH A;  1FL0 A;  4JBK A;  2F3I A;  3GTL H;  4GLV B;  4AQY L;  3L0O A;  4R1J A;  3J80 c;  3Q8D A;  4NXN Q;  4BXX G;  1E7Z A;  1HZB A;  1NTG A;  2YYZ A;  3PUV A;  1YHQ A;  5C4X G;  2OQK A;  1FVI A;  5ELN A;  2HHH Q;  2B29 A;  2I5H A;  3CC7 A;  4DKA C;  1PH5 A;  2C35 B;  1PYS B;  4JOI A;  4K0K Q;  3GTG H;  4B3S Q;  3CCV A;  2CFM A;  4AIM A;  1XJV A;  2BA1 A;  2JA6 H;  1IBM L;  1R9T H;  3CPF A;  3TQY A;  2D0O A;  3J81 i;  4AQY Q;  4P75 A;  4DAM A;  4OWW B;  2F4V L;  4BXX H;  3PCO B;  3F2C A;  4NB3 A;  1YVC A;  2HQL A;  3TS2 A;  1X6O A;  2R7F A;  4AYB E;  2YV5 A;  3STB D;  3KDF A;  5C4X H;  2UU9 L;  1K0R A;  4X66 L;  1GO3 E;  3KFU A;  1WI5 A;  3BZC A;  3PO3 G;  5IYD G;  1SE8 A;  2OQ0 A;  1SMX A;  3MXN B;  2DUD A;  2CWA A;  4LUV A;  4A75 A;  1E1T A;  4NXM L;  1X56 A;  2WAQ E;  3EN2 A;  5M5Y H;  4LF6 Q;  4JBW A;  2D0P A;  1VQ7 A;  4AYB G;  4UY8 C;  4LFB L;  1IBM Q;  4IJH A;  3HOU G;  3KJO A;  5IE8 A;  4GNX C;  2A8V A;  4RMF A;  1VQO A;  2F4V Q;  1WFQ A;  4GOP C;  3AYH B;  5H1S E;  3T1Y L;  1A0I A;  4DPG A;  3E9I A;  2WAQ G;  4LF4 Q;  3CCQ A;  1I3Q H;  2UU9 Q;  4L5R C;  1E24 A;  3UE0 A;  2ID0 A;  1PH7 A;  3PO3 H;  5IYD H;  1HH2 P;  1UE7 A;  3HFZ B;  1HZ9 A;  4LFA L;  4LFB Q;  3A74 A;  4PMW A;  1FGU A;  4QGU A;  3CXC A;  4YWL A;  3HOU H;  2VQE L;  4IFD I;  1YEZ A;  2I5M X;  1RIP A;  2MO0 A;  4J15 A;  3K8A A;  1VQA A;  3T1Y Q;  4DAY B;  1I94 L;  3GO5 A;  4JG2 A;  3CCU A;  2LXJ A;  3GTJ H;  4MTN A;  5C44 G;  4L5T A;  5LMN W;  1Y1W G;  3F2B A;  3VDY A;  3M9B A;  1KC8 C;  3TS0 A;  1B7Y B;  4DR1 L;  3RN2 A;  4JV5 L;  1T9H A;  4Y52 H;  4LFA Q;  1MKH A;  4IFD J;  1CKN B;  1OXT A;  2ALY B;  2VQE Q;  1WYD A;  2BA0 A;  3PUX A;  3HOZ G;  1I94 Q;  1VS0 A;  2V1C C;  2IHF A;  3W1B A;  3NEL A;  4MZ9 A;  5C44 H;  3KJP A;  4A3F G;  1A63 A;  1Y1W H;  1VQ6 A;  1YBY A;  1BBU A;  4UPA A;  5JJK A;  2RF4 A;  1WCM G;  4DR1 Q;  3OYY A;  1ASY A;  4JV5 Q;  5FJ8 G;  2YTX A;  4A3B G;  1KAW A;  1YI2 A;  3CCM A;  4A4I A;  2JEB I;  1SRO A;  4IFD G;  2OTJ A;  1JT8 A;  4HIO A;  1KQS A;  3GTP H;  3KF6 A;  3PV0 A;  1GKH A;  1K3R A;  3HOV H;  2VY3 A;  5AJ3 L;  1VQL A;  3HOZ H;  3KDF B;  4EQ5 A;  4YCU A;  2CKZ B;  4A3F H;  1VQ9 A;  2E8G A;  1G29 1;  4HJ8 A;  4LF4 L;  1G6P A;  1PH4 A;  1IBL L;  1SN8 A;  1OTC A;  3RZD H;  4X65 L;  3HOW G;  4KHP Q;  1PH3 A;  3HKZ E;  3RR5 A;  2ZJR A;  5FJ8 H;  3S24 A;  3AEV A;  4A3B H;  3I7F A;  1VQE A;  1VQ8 A;  1WOC A;  4P73 A;  2R92 G;  3S1N H;  4A3L G;  4DV5 L;  2BH8 A;  5AJ3 Q;  3M3Y H;  3HKZ G;  1CSQ A;  4LWC A;  4X64 L;  1AE3 A;  3J7Z C;  4BY1 G;  4JI8 L;  4YHH L;  3I55 A;  4R4T A;  1PH2 A;  2K50 A;  2Z6K A;  3E9H A;  1Q81 C;  1QVG A;  1DGS A;  2HIX A;  1IBL Q;  1E22 A;  1I5F A;  1S3O A;  2MFI A;  4TVA B;  4LUZ A;  3CP0 A;  4UP9 A;  4IPG A;  2JA6 G;  3HOW H;  4WJ3 M;  1CKN A;  1XPR A;  2KEN A;  3M4P A;  2N49 A;  1HR0 W;  1XNQ L;  1V9P A;  3GTM H;  2D62 A;  1RL2 A;  2Z0S A;  1HNX L;  1XNR Q;  3UDX A;  3S16 H;  4JI6 L;  4HJ9 A;  4POG A;  4DUY Q;  1XPU A;  2R92 H;  4A3L H;  4LF8 L;  3J81 c;  2R7Z G;  3CD6 A;  2UUA L;  2WP8 J;  1JJ2 A;  3ICE A;  2VW9 A;  3ULJ A;  4X64 Q;  4BY1 H;  2KBN A;  1KHI A;  4JI8 Q;  4YHH Q;  1MIU A;  1X65 A;  1L1O B;  2FXQ A;  3OTO L;  3G6E A;  4IOC A;  2I0Q A;  3L7Z C;  2BH2 A;  1E1O A;  2WFW A;  3K81 C;  2PNH A;  1XPO A;  4DV1 L;  1OXV A;  2ASB A;  2GVB A;  2UUC L;  1XNQ Q;  3U50 C;  3AQQ A;  5GAH C;  1HNX Q;  2UUB L;  4JI6 Q;  2YTV A;  4A3D G;  2OCE A;  2AKW B;  1PV4 A;  4UP7 A;  1EYG A;  1TWA H;  5JEA G;  4LF8 Q;  2HT1 A;  2R7Z H;  1JMC A;  3LGJ A;  1Q12 A;  1VQM A;  4X6A H;  5C3E G;  1NJI C;  3GTO H;  5EAY A;  2PI2 E;  3OTO Q;  1Q86 C;  1GM5 A;  2DGY A;  3DLL A;  3BU2 A;  1N36 L;  4DK6 C;  2XTI A;  1X54 A;  1XTD A;  3W5O A;  4DV1 Q;  1VQ4 A;  2YU9 H;  3F2D A;  2ZJQ A;  4KLK A;  3S15 H;  4GOP A;  3PSI A;  3PIP A;  5JJL A;  2QEX A;  2UUB Q;  4A3D H;  2E2I H;  3STB C;  3KF6 B;  1O7I A;  3RNU A;  2I5L X;  3RZO H;  2CWP A;  2UXB L;  3S14 H;  2EXD A;  3B6Y A;  4X66 Q;  4LFC L;  3I4M G;  1UE6 A;  2ZTD A;  4YCW A;  5C3E H;  4IPD A;  1X9N A;  1OXX K;  2ZM6 L;  1VQB A;  1QZG A;  4NXM Q;  1D7Q A;  4A3I G;  3CCL A;  1VQN A;  1TWG H;  4JCV E;  1N36 Q;  1IL2 A;  2R7D A;  4FDB A;  3PF4 A;  1IBK L;  4QQB X;  1I6H H;  1HJP A;  4JI5 L;  3NEN A;  2VQF L;  4DR3 L;  4UP8 A;  1Q8K A;  2AMC B;  2IT1 A;  2VZA A;  3WWV A;  1PYB A;  2E2H H;  3RLO A;  3I4N G;  2IY5 B;  3E0E A;  1BVS A;  2VNU D;  3CMA A;  4B3M L;  2UXB Q;  1XMQ L;  5C4J H;  2E2J H;  3SGI A;  4JC0 A;  3I4M H;  4LFC Q;  1L1O A;  3K7A H;  4DV7 L;  2Q2I A;  3M85 A;  3I4O A;  4DV3 L;  3PO2 G;  2K75 A;  4JI3 L;  2PQA A;  2ZM6 Q;  4QJF A;  2H5X A;  2PMZ E;  4GN3 B;  2K52 A;  5GAG C;  4Y7N H;  4A3I H;  2GN5 A;  4P72 A;  3PUW A;  1YJN A;  1VQP A;  3TRE A;  1Y1V G;  1IBK Q;  4JI5 Q;  2VQF Q;  4DR3 Q;  4APV A;  1YJ9 A;  1EUJ A;  1EQR A;  3J7A 5;  4YY3 L;  1UE5 A;  4A3E G;  4H02 A;  1KL9 A;  2MO1 A;  1NE3 A;  2HIV A;  4JI7 L;  3I4N H;  4DR7 L;  1TWH H;  5IT9 c;  1LM0 A;  1UWV A;  3G48 A;  3CC4 A;  1V43 A;  3NBH B;  4LUO A;  4TQU S;  3RLN A;  2NN6 I;  4B3M Q;  1SFO H;  1XMQ Q;  1N33 L;  1HZC A;  3PO2 H;  3G71 A;  4DR5 L;  1TWC H;  3ULP A;  4DV7 Q;  4DV3 Q;  1VQH A;  1K8A C;  2R93 G;  4DV6 L;  4JI3 Q;  1JJG A;  1WJJ A;  1PH6 A;  3L2P A;  4L5Q A;  4A3J G;  4LNQ A;  2JJQ A;  1Y1V H;  4GS3 A;  4MNO A;  1S40 A;  2VS1 A;  1Y14 B;  3KLW A;  3W1G A;  5IYC G;  1K8G A;  2LXK A;  1PH1 A;  4A3E H;  4YY3 Q;  4JI7 Q;  1B8A A;  3PIO A;  2KCT A;  4QIW E;  2LSS A;  1J5E L;  1YIJ A;  5K36 G;  1NBW A;  3ERS X;  4KI0 A;  5LMU L;  3CAM A;  4R4Q A;  2VL6 A;  1N33 Q;  2R93 H;  3AFP A;  4HJA A;  2IHE A;  1XMO L;  3I2Z A;  4DV6 Q;  1VQ5 A;  1K73 C;  4GKJ L;  4HJ7 A;  2JE6 I;  5IY0 A;  4A3J H;  5M5W H;  2MNA A;  1N34 L;  1H95 A;  1GVP A;  4NPS A;  4L5S A;  3M4Q A;  4GNX B;  1G51 A;  2UXD L;  5IYC H;  4A3M G;  3GTQ H;  3GDE A;  4OXP A;  1OXU A;  4GOP B;  3S1M H;  1VQK A;  4BA1 I;  4OX9 L;  1L2F A;  5LMN L;  1HNW L;  1W2B A;  3CCJ A;  4JI0 L;  5ELO A;  2RHS B;  3S2H H;  2NN6 G;  4HIM A;  3K0X A;  1J5E Q;  2KCM A;  3M7N A;  1Z47 A;  5GRO A;  3HOY G;  1JE5 A;  2QGQ A;  1YNX A;  2KHJ A;  5LMU Q;  4A3K G;  1NY4 A;  5M3F G;  3FKI G;  4B3R L;  1X3G A;  4IOA A;  2OTL A;  3AFQ A;  1CSP A;  4X65 Q;  3A5Z B;  4GKJ Q;  5E7N A;  4A76 A;  2ES2 A;  1BBW A;  1N34 Q;  2JA7 G;  4OON A;  1IZ6 A;  2A1A A;  4A3M H;  3CME A;  2A19 A;  1PFS A;  2WB1 E;  4XTC S;  4GKK L;  3CC2 A;  4ME3 A;  4OX9 Q;  2XGT A;  5JEA J;  5LMN Q;  3FP9 A;  3CCS A;  4JI0 Q;  1CKM A;  4R4C A;  4C3H H;  2R6G A;  4DV4 L;  4DV5 Q;  1HNW Q;  3IRB A;  1LYL A;  1JB7 A;  3PF5 A;  3UDF A;  4JBJ A;  3HOY H;  4A93 G;  2CQO A;  4A3K H;  3G4S A;  1J6Q A;  5M3F H;  3FKI H;  4B3R Q;  2WB1 G;  2K5N A;  3PGZ A;  4C3J H;  2PQA B;  2AWN A;  3ULL A;  4JI2 L;  3GTK H;  1S72 A;  3BZK A;  1VQC A;  2Y0S E;  4KHZ A;  2Z6K C;  5M5X H;  3HOV G;  5J3B A;  1K83 H;  3CCE A;  4GN5 A;  2JA7 H;  1BKB A;  4DV2 L;  4JI1 L;  4GKK Q;  1PVO A;  3JAM i;  4DK3 C;  4BY7 G;  4IPC A;  1EIF A;  2F52 A;  2IX0 A;  2Y0S G;  5GAD C;  4DV4 Q;  2UUA Q;  4A93 H;  3K80 C;  5BR8 L;  1A62 A;  3CF5 A;  1Q46 A;  2K14 A;  4GN4 B;  5M3M G;  1V1Q A;  3RN5 A;  4PZ7 A;  2IX1 A;  1VQG A;  2NVX H;  1C9O A;  3J80 i;  4JI2 Q;  1VQJ A;  4GLA C;  1NMG A;  4IJL A;  3D0F A;  4LF6 L;  1P8L A;  2AHO B;  4JOI C;  4EX5 A;  1L0W A;  5IP9 G;  4GNX A;  2RHQ B;  3H0G G;  1VQF A;  2JQO A;  5C0X I;  5HY6 A;  4DR4 L;  2UUC Q;  4YWM A;  3BJU A;  4A3C G;  4DV2 Q;  4IPH A;  1SR3 A;  3EIV A;  4JI1 Q;  4LF7 L;  1E3P A;  1QVC A;  3KYH C;  3HKS A;  1Q1B A;  1Q7Y C;  4BY7 H;  4LW1 A;  2ZTC A;  3CPW A;  1UE1 A;  4R4O A;  3PUZ A;  4XIG S;  1YHA A;  5BR8 Q;  5M3M H;  1HR0 L;  2GVA A;  4C2M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...