4HJ8A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggttacgct)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj8A00
2KHIA 2UUAL 4A3JG 3W5OA 3RN2A 4JI0L 2VUMH 4O2DA 3KDFB 3SGIA 1YI2A 4A76A 1TWHH 2L15A 3KOJA 3CC2A 4IFDI 3T1YQ 1XNQQ 2IT1A 2Q2HA 3J80i 1XNRL 4YY3L 3EBEA 5FJ8H 4AYBE 4DUYQ 2JQOA 4DV5L 2KCMA 1Q1BA 4R4CA 1IBML 4LF4L 1WFQA 3U4ZA 1IBKQ 2HHHQ 1Q46A 2GVBA 4B3RQ 4L5TA 3CAMA 2IY5B 1LTLA 4DR3Q 3EIVA 3CC7A 3VDYA 1Y1WH 3A74A 2ZTDA 5ELNA 4BBRG 4HJ9A 1CKMA 4X62L 1HNXQ 1N9WA 4LF6Q 1CKNB 2KHJA 3HOWG 4DV4L 3L0OA 5IE8A 2ZM6Q 3CCJA 2RF4A 2UXDQ 2UXBQ 1EUJA 4A3DH 1FVIA 1L1OA 1YITA 1JB7A 1EYGA 3PUZA 1HJPA 1OXXK 3FP9A 4LUVA 1E22A 5J3BA 4JYAL 3HOVH 4Y52H 1HNZQ 2Q2IA 4YHHQ 4GOPB 1YIJA 2BH2A 2NZHA 1Q82C 4B3TL 4BA2I 3FKIH 1KIXA 1UE6A 1P8LA 1JE5A 1UE1A 4HJ5A 4JI4Q 4LF8L 3AFQA 2NVTH 3GTPH 2HQLA 1XPOA 5JJLA 2R6GA 1X54A 4NXNQ 4BBSH 4PMWA 5C4XG 1WCMH 1K3RA 2A8VA 2MFIA 1EFWA 3HOZG 4DR4L 4C3JH 4BXXH 2K50A 2UUBL 4QGUA 2JA5H 4UP8A 3CF5A 2IX0A 3PUXA 1CUKA 5IWAL 3J7ZC 4HIMA 4A3MG 1X9NA 3TRZA 2OWOA 3TREA 1SE8A 4IJLA 1YJ9A 5GADC 4DR1L 3ULLA 1E7ZA 4HJAA 4JC0A 1A62A 4TQUS 3PIPA 2AHOB 2B63G 1YHBA 5IP9G 1B8AA 4B3TQ 3UE0A 4NB3A 5ELOA 3HOUG 4LF5Q 2R7FA 2H5XA 1Y1VH 2EXDA 2E2IH 2JA8H 3CXCA 3S14H 3BJUA 4BA1I 4LFBL 3I56A 2ATWA 3I55A 4YCUA 3S2DH 3TS2A 4LWCA 5GAHC 1GD7A 2OQKA 1KRTA 3UDXA 4HIDA 3S17H 3HKZG 2FXQA 4BY1G 4A3EG 2HT1A 3B6YA 5IWAQ 1VCIA 3OTOQ 4DV6L 3UE1A 1KAWA 1W2BA 3CP0A 5AJ3Q 3H0GG 2VUMG 1WOCA 3L7ZC 1FL0A 1NMGA 3J81j 4DR1Q 3D31A 3KF6A 1QVFA 2F4VL 4A3CH 2PMZE 4PZ8A 2AKWB 1N32L 2PI2E 3CW2C 4IPGA 4L5QA 5FJ8G 3RLFA 1L2FA 1N34Q 2JA7G 1DGSA 4EQ5A 5FLXc 2HIXA 4B3SL 3A5UA 1I6HH 3CMAA 3A5ZB 4DUZL 2UXCQ 2ZTEA 1X65A 4PG3A 2N8NA 2NVXH 3U58A 1TWFH 1NE3A 1J5EQ 1AE3A 1YNXA 3CCRA 4LFBQ 4QQBX 1QVGA 1UEBA 4IJHA 4JBJA 1PH3A 3CD6A 1VQDA 2VQEL 2Q2UA 4DV2L 4DV1L 3S1RH 1Q8KA 1WJJA 1BBUA 4MZ9A 4Y7NH 4EX5A 3TQYA 4A3BH 1IBLL 4A3DG 2Y0SG 1SR3A 1GKHA 2JA6H 4O0AA 1NJIC 1K0RA 3M4QA 2CCZA 4KHPQ 3HKZE 4K0KL 1WYDA 4LF9Q 1Q86C 3M3YH 2I0QA 3HOVG 4LW1A 5C0XI 3BZCA 4DNIA 2VL6A 2V1CC 2D62A 3STBC 3HOYH 2B3GA 4YCVA 4LFAQ 3PIOA 1PH7A 4JOIC 4POGA 3FKIG 3ULJA 2UU9Q 3PUWA 2E8GA 3RR5A 1HR0L 2GN5A 3NENA 4P74A 3CQZH 5C3EH 2ES2A 2A1AA 4GKKL 2I5MX 4A3GH 1HNWL 2JK8A 4BBSG 2R93H 1E24A 1YVCA 1VQMA 1WCMG 3G6EA 3U4VA 3PO3G 3S1QH 4A3IH 1K73C 4OO1I 2BH8A 4KI0A 3J81c 4C3HH 4BXXG 4JI1Q 2ZTCA 2JA5G 4JV5Q 5IYCG 4RMFA 2ZJQA 2F52A 5IYBH 3CMEA 2ZJRA 4K0KQ 4DV3Q 3BZKA 5JJIA 5LMNL 1QVCA 1SROA 1GVPA 5EAYA 3LGJA 2OQ0A 4AQYQ 4X66Q 5C44H 1LUZA 4A4IA 3JAMc 2RHQB 1SMXA 2A19A 4OX9Q 3GTKH 1PYBA 2CQOA 2PQAB 1YJWA 2JE6I 2NVYH 1YHAA 1VQOA 1KRSA 4JI8Q 4JI2L 1EQRA 5M3MH 1N36Q 3GTOH 3RZDH 4A3KG 4OWTB 5JEAJ 3M4OH 1A63A 4UP9A 4DK3C 1VQAA 4JBMA 2HIVA 1EIFA 3J81i 2UUAQ 4GN5A 4JI0Q 3L2PA 1E1OA 4HIOA 3F8TA 1VQFA 1GM5A 4DR6L 1D7QA 2WB1G 5M5XH 3KFUA 4WJ4A 3Q8DA 4A3CG 1K8AC 4A3LH 2AWNA 1XNRQ 4YY3Q 4DV5Q 1B70B 2MO0A 4JOIA 3I4NH 1OXSC 2BA0A 1OXTA 4R1JA 1TWAH 2NN6G 1IBMQ 3H3VI 4LF4Q 3DLLA 4GOPC 4YWMA 3E9HA 3K7AH 3RLOA 2PI2A 2E5LL 4X62Q 1IYJB 4X64L 4IOCA 4BY7H 3I4OA 3S2HH 2IX1A 3CPFA 2R92H 1X3FA 3AFPA 4FDBA 1VS0A 4LUZA 1C9OA 4IPDA 3OYYA 4OXPA 4DV4Q 4QJFA 3KDFA 3W1GA 4R4IA 1IXRA 1HR0W 3K81C 3AYHB 3STBD 4L5SA 4OWWB 3KJOA 1N33L 4DR6Q 4DAMA 3TS0A 4R4OA 2N49A 3E0EA 4C2MH 2Q2TA 3S1NH 4IFDJ 3PO2H 4AH6A 2YTXA 2EQSA 1VQ4A 4A3BG 2Z0SA 4A93H 5H1SE 1NY4A 1XMOL 4MNOA 2WFWA 4GNXB 4DR7L 1I5FA 3PCOB 3I4MH 4JYAQ 1JJGA 4LF8Q 2AWOA 2JJQA 5M3FH 4JI3L 2UUCL 1CKNA 4LF7L 4TVAB 2JA9A 4A3GG 1X3GA 1A8VA 2ASBA 3GO5A 4IPCA 5IT9c 3HKSA 4QIWE 2R93G 4DR4Q 4NXML 5IP7H 1KHIA 4DR5L 4A3IG 2ZJPA 2UUBQ 1IL2A 5JJKA 3FHWA 3WWVA 1XPRA 4HJ7A 2KBNA 1PH9A 1KD1C 3KYHC 3RNUA 1J6QA 4GOPA 3CCUA 3S24A 1XMOQ 1G6PA 3EN2A 5GROA 1JJ2A 1LYLA 3GTLH 4GLAC 4BBRH 5C44G 3GD7A 2OCEA 4UPAA 1MJCA 3PUYA 4DV7L 4DR2L 3T1HL 1QUQB 4JI7L 1PYSB 4JI3Q 4LFCL 1UWVA 2PNHA 1KC8C 4DV0L 1Y1WG 3IRBA 1MKHA 1V43A 5M3MG 3HOWH 2XTIA 1IZ6A 2K52A 4LNQA 1X3EA 1YJNA 1I94L 2CWPA 4XTCS 4LUOA 1VQGA 2YYZA 4NXMQ 5IYDH 5DLQE 1ASYA 5BR8L 2YV5A 4DV6Q 5GQOA 1OTCA 3G48A 2I5HA 4X65L 1CSPA 3HOXH 4X6AH 4IFDG 2F4VQ 1TWCH 4MTNA 1R9TH 1RIPA 4KHZA 2E2HH 2WP8J 1BKBA 1N32Q 5C4JH 4A3FH 1C7YA 2BA1A 3CCQA 4B3ML 4A3LG 1RL2A 1A0IA 4C3IH 4ALPA 2CFMA 4H02A 1Z9FA 2K75A 3I4NG 3NEMA 1MIUA 1O7IA 1NBWA 4B3SQ 5M5YH 1NTGA 2OTJA 1QZHA 4DUZQ 4YWKA 5LMUL 3S16H 1VQLA 4GKJL 3M7NA 4JV5L 2VQFL 2MNAA 4JBWA 4QL5A 2CKZB 2Z6KC 5BR8Q 1HZCA 1YZ6A 3ULPA 4A3MH 2IHFA 1M90C 1K8GA 1XTDA 3A0JA 4JI5L 1Q12A 2VQEQ 1KQSA 4DV2Q 3CCEA 4DV1Q 3J7A5 5GAEC 4BY1H 1OXUA 4GN3B 3MEFA 2D0PA 2I5LX 4P73A 2NVQH 3J80c 1IBLQ 1L1OB 1NMFA 2LXJA 1XNQL 4A75A 2B63H 1E1TA 1Z47A 4DUYL 4B3MQ 3PF4A 3HOUH 3CCMA 2MQHA 4A93G 3PF5A 4P75A 2LXKA 1IBKL 2HHHL 4B3RL 2Y0SE 2VZAA 3UDIA 1XJVA 3PGZA 4DR3L 1X56A 2YTYA 3RN5A 1JJCB 1MJEA 3CCLA 5LMUQ 1V9PA 1PH4A 1HR0Q 1OXVA 1Y1VG 1HNXL 2JA8G 4GKKQ 1UE5A 3G71A 3F2CA 4LF6L 1HNWQ 3K80C 4AIMA 2VQFQ 4A3EH 1S3OA 4QY7A 1VQBA 2ZM6L 3I2ZA 3M85A 3KF8B 2GVAA 3H0GH 4R4TA 4JI5Q 4UY8C 3TEHB 2UXBL 2UXDL 5IP7G 3ERSX 4GS3A 2DUDA 1E3PA 2AMCB 4APVA 2MO1A 4IO9A 4P71A 3UDGA 3PUVA 1HNZL 4UP7A 1XPUA 2JA7H 2N3SA 1S72A 2XGTA 2K4KA 2YTVA 3NELA 5E7NA 4YHHL 5LMNQ 1U0LA 2R7ZH 4OONA 4DKAC 5C0XJ 1YBYA 4JI4L 3GTGH 2ALYB 1P16A 3JAMi 1VQ8A 1VQ5A 3F1ZA 3GTJH 1I50H 1B7YB 3I7FA 4NXNL 2K5HA 4JI2Q 2R7DA 2Z6KA 2B29A 1EWIA 1VQKA 3AEVA 3K7UC 3M4PA 3M9BA 3GTMH 1FGUA 1G51A 1PH1A 2K5NA 1TWGH 2JEAI 1Q81C 4GLXA 4OWXB 5IYDG 1HZBA 1AH9A 1EQQA 1VQ6A 4DK6C 1PH8A 4YWLA 4JCVE 5FLMH 1W3SA 3HOXG 4J15A 1WI5A 2C35B 3KF6B 4DAYB 2KENA 2JA6G 3H3VH 1L0WA 3E9IA 3CC4A 4A3FG 1FJGL 2JEBI 2PQAA 3PSIA 1UE7A 2DGYA 4GNXC 2WB1E 4LF5L 1KL9A 3HOYG 3AQQA 3GDEA 1M1KC 1V1QA 3CCVA 5LMNW 3PO3H 2E5LQ 4X64Q 1C0AA 3KLWA 5JEAG 3UDFA 5C3EG 1YHQA 4A3JH 3F2DA 4GN4B 1GO3E 2KCTA 3RLNA 1BVSA 5IYCH 3OTOL 5AJ3L 1CSQA 1HH2P 1N33Q 1X6OA 1Y14B 1VQPA 1VQHA 4GLVB 1JT8A 3MXNB 1K83H 1X55A 5IYBG 2ID0A 5C0XG 4XIGS 3NBHB 2K14A 1PA6A 1EOVA 1N34L 1FJGQ 4JI6L 1PV4A 1VQNA 2VNUD 2RCNA 2IHEA 1SLJA 2NN6I 2LSSA 1HZAA 4DR7Q 5K36G 2F3IA 1D8LA 1Q1EA 2VW9A 2N78A 1S40A 3S15H 2UXCL 4A3KH 4IPHA 4RG1A 3G4SA 2UUCQ 4LF7Q 1J5EL 2WAQG 3ZJYC 2QEXA 4JG2A 2QA4A 4HIKA 1SFOH 4OO1G 5M5WH 3RZOH 1PFSA 4NPSA 3CCSA 4DR5Q 1I3QH 1VQ9A 1PH5A 5HY6A 2CWAA 1KXLA 4IOAA 3HFZB 1K9MC 4PZ6A 1JMCA 2RHSB 3S1MH 1BBWA 1ASZA 2E2JH 4YCWA 4KHPL 4DPGA 2EIFA 5GAGC 4LF9L 3GTQH 4GNXA 2VS1A 3JC66 1PHJA 1H95A 4JI6Q 2QGQA 3PO2G 1N8RC 2R7ZG 1U5KA 4LFAL 3ICEA 1YEZA 3OW2A 1PVOA 4P72A 1XMQL 2UU9L 4JBKA 1HZ9A 4DV7Q 5C4XH 4DR2Q 3T1HQ 4JI7Q 3ER0A 4LFCQ 3CPWA 3DM3A 3HOZH 4DV0Q 4HJ8A 4R4QA 1I94Q 1VQIA 1EIYB 3K8AA 4BY7G 1SRUA 2NZOA 3H15A 4AYBG 4ME3A 4JI1L 2R92G 1SN8A 1G291 4POFA 4X65Q 2WAQE 3KJPA 3U50C 4DV3L 1VQ7A 3T1YL 5FLMG 1L1OC 3D0FA 3W1BA 5HGQA 5IP9H 1QZGA 3F2BA 4WJ3M 4AQYL 3PV0A 4X66L 4PZ7A 4L5RC 1VQJA 2YU9H 2D0OA 4OX9L 1QUQA 1XMQQ 1T9HA 1VQEA 1Q7YC 2OTLA 3I4MG 4JI8L 1CKOA 1PH6A 1PH2A 1N36L 3K0XA 4KLKA 1TXYA 2VY3A 5M3FG 1AE2A 1LM0A 3BU2A 2K5VA 4GKJQ 1VQCA 5IY0A
chains in the Genus database with same CATH superfamily
4CHTB 2F0DA 4JI0L 1YI2A 4A76A 4P2CB 1XNQQ 2Q2HA 4YY3L 3EBEA 5C4HA 2O4XA 3I8ZA 4AYBE 4DV5L 2L11A 4LJZC 3K58A 2DNEA 1A2TA 3H94A 4KD4A 4RHRA 4ME5A 1LTLA 3EIVA 3CC7A 3VDYA 3AU7A 1B50A 4CKBA 1W6KA 1PLFA 1STGA 3DHQA 3VR5A 1WTOA 2KHJA 5IE8A 2RF4A 3H0GB 2UXBQ 2QDBA 3MWYW 1D5ZC 4A3DH 1FVIA 5EKKA 5HGTA 3C1EA 1QNUA 1ENCA 1E22A 5J3BA 4G57A 3PO2B 1PZID 4YHHQ 1U4PA 1YIJA 4V0BA 2EY6A 4BA2I 4JI4Q 1KIXA 1UE6A 4HJ5A 1JE5A 4G7OC 3AFQA 2HQLA 5JJLA 2K01A 2IPKD 1K3RA 1EFWA 2L0CA 3VA7A 5ELEA 3S9WA 3A7AB 2IX0A 4J6HA 2NTSA 1GJXA 4ZRZA 3TREA 1YJ9A 5IIFA 3I70A 3OOCA 3A54A 1E7ZA 2SNSA 5JPNC 4TQUS 5IP9G 1KNAA 3FVQA 4NB3A 3HOUG 3H91A 2R7FA 2H5XA 2JA8H 2EXDA 3CXCA 4FXGC 5IGFA 1STHA 4ZUIA 4LWCA 5E4WC 2K04A 4HIDA 1KRTA 1HUNA 2RKSA 2HT1A 2LMCB 3P20A 3B6YA 1LTGD 4DV6L 1II3A 2LKVA 2F4VL 1FL0A 1JR0D 3J81j 4A3CH 4QF4A 4KKSA 3NPPA 3RLFA 1L2FA 1N34Q 2JA7G 1LTAD 1JORA 4HSPA 1SE3A 1DGSA 2JYOA 2RBMA 1HA6A 3A5ZB 2WIIB 3NQIA 5A2QE 3S15B 2NVXH 2KECA 2IW3A 2RCFA 2WKDA 1PFNA 1J5EQ 4ID6A 5CBEE 2RA4A 1XTCD 2VXWA 4EVOA 2LS01 4IJHA 2F0EA 4X3UA 4RGNA 2VQEL 4DV2L 4DV1L 3S1RH 1BBUA 1I3QB 3FMCA 5J39A 4A3DG 2Y0SG 2C9OA 2VNUD 4O0AA 4OELB 1B1ZA 1HPCA 4KHPQ 3NBHA 2G9DA 3DEOA 4K5VA 4LW1A 5C0XI 1RJTA 3BZCA 3OWEB 2KOLA 2V1CC 5IOCA 4YCVA 4LFAQ 5F2DA 4POGA 4IALA 4XT3B 4B9XA 1KABA 1HR0L 2GN5A 5JEAH 3VR2A 3CQZH 5CGKA 2ES2A 4GKKL 4A3GH 2I5MX 4K5XA 2ICIA 1E24A 1T5XD 3U4VA 2B2TC 5JVH3 1GUWA 4RWSC 4KI0A 1I4PA 4JI1Q 2ZTCA 4RMFA 2ZJRA 5IYBH 3CMEA 4DV3Q 1Q3LA 4OEMB 4ZCKA 1I4HA 2F0UA 5K36H 3LGJA 2OQ0A 1LUZA 2RHQB 4OX9Q 4R8IA 2NB0A 3GTKH 2CQOA 2PQAB 1EFID 2JE6I 1VQOA 1YHAA 3Q6SA 4H0LC 1OO9B 5M3MH 2F0WA 1K28A 4H13C 1SNCA 4OWTB 3M4OH 4BY1B 4DK3C 4JBMA 2HIVA 3J81i 4HIOA 1FD7D 1XWEA 1TWHB 3KFUA 4WJ4A 4A3CG 1K8AC 3V2TA 1ZEQX 2BA0A 1OXTA 1CZWA 1I4XA 1AEXA 2KHSA 2B2TA 4BY7H 4IOCA 2RSOA 2IX1A 1IW7C 1O78A 1JICA 3O13A 4OXPA 4DV4Q 1HQMC 1TT2A 4L5SA 1ZXTA 3AYHB 1G2TA 2TSSA 4C2MH 3W3AA 1NR2A 2PZWA 1LT5D 1AN8A 2XWBB 3GP7A 4PNYA 1XMOL 4MNOA 4GNXB 4JYAQ 2EOTA 2AUKA 3G7LA 3GTPB 2DJGC 5M3FH 1KDAA 4FVMA 4DFAA 1CKNA 4TVAB 4C1NI 4A3GG 2ZXRA 1Y8PB 1SJHD 2ASBA 2KUMA 4HTHA 4C3JB 4RFBA 2K28A 3IFDA 4OIJA 2UUBQ 3WWVA 1ILPA 5D65A 2KBNA 3EROA 4RA8A 1J6QA 3S24A 1XMOQ 5BN4A 5GROA 4N9TA 1XYIA 1LYLA 3GTLH 1DD2A 1SMYD 2EYOA 1F2LA 1CA6A 3TZDA 5I4DA 1UWVA 3MXUA 1KC8C 4DV0L 1Y1WG 4FYDA 3TSSA 5FLXE 5M3MG 2XTIA 4LNQA 1V1PA 1X3EA 4YIJA 2CWPA 3S2DB 2XNAC 1EY0A 3I73A 1GUOA 1IHZA 2NUCA 2I5HA 1CSPA 1SBBB 4KHZA 1HTLD 2RDFA 2AQ2B 3NE5B 1C7YA 1A0IA 4H02A 5JOBA 2K6AA 1BCPB 3HS0C 3SK8A 3I72A 5IGCA 5M5YH 1I6HB 5LMUL 4B08A 5T1IA 1TWFB 1VQLA 3VA5A 3L3OC 1V1OA 1H9JA 2MPMA 4GKJL 4QL5A 1M90C 3D4WA 2NYZD 1KQSA 5AFWA 3CCEA 3HOXB 1MSHA 2D2CC 4GN3B 1OXUA 3MEFA 2D0PA 1TS3A 1EL0A 1NMFA 1E1TA 1Z47A 1QB5D 3CCMA 2B2WC 2VZAA 3UDIA 3RN5A 4DR3L 5LMUQ 1HNXL 3JAME 4Z9CB 3K80C 4OO1H 2J7ZA 1JWSD 1S3OA 3K5OA 3I2ZA 4K8JA 2GVAA 3DM1A 3H0GH 4K2LA 1SNPA 1E3PA 5J22A 3UDGA 3BYYB 5LHY1 1HNZL 1B3AA 3DWQA 3PO2H 2YTVA 4ULLA 3E0JA 1EIGA 1YBYA 4Q5VA 4TSSA 3K0YA 1SE2A 3JAMi 1VQ8A 2NVYB 4NXNL 4J8QA 1D1KA 4JI2Q 3GTOB 1BDOA 3NTKA 5KEEA 1PH1A 2KEEA 4RGOS 4UDUC 4RGMA 4DK6C 1TKWB 5FLMH 2DY7A 2A6EC 1PRTD 2C35B 1WTXA 2B2WA 2JA6G 3E9IA 4DNTB 4RKLA 1FJGL 5KRUA 1PTOD 4LF5L 1STAA 3OHXC 3QOLA 1F2MA 1A3VA 4TKOB 2E5LQ 4B9WA 5C3EG 2D9UA 1U4LA 4AYBB 4K6DA 4GN4B 3RLNA 2KCTA 3OTOL 3MHBA 2XRSD 5AJ3L 1HH2P 1X6OA 5ELCA 1VQHA 4KY6A 3S1NB 3KBGA 1X55A 4L6TB 2ID0A 3NBHB 1FJGQ 1VQNA 1EOVA 3FRPB 2RCNA 4DR7Q 2LSSA 2F3IA 2KCNA 3RMHA 1Q1EA 1RD9D 2N78A 3S15H 4FF1A 1VMCA 4WRDA 2ZT9C 4HIKA 4JG2A 4OO1G 1RTNA 3CCSA 1I3QH 4HR7B 3OPOA 5HY6A 1ML0D 3K59A 4IOAA 3HFZB 2PW7A 3SVMA 4PZ6A 1JMCA 5KNCA 4HCEA 3KLSX 1WVLA 2NN6H 3BVZA 3JC66 3PO2G 1N8RC 1U5KA 4DF7A 1F77A 4K2KA 1YEZA 1TY0A 3OW2A 3N52A 4P72A 2UU9L 4JBKA 3T1HQ 2R3ZA 4LFCQ 3D3RA 4KKTA 3V05A 4HJ8A 2Z6BA 2R92G 1SN8A 1YNND 4F7XA 2CH4W 1HCZA 3HRZC 3NSWA 2X6LA 1EIHA 2WAQE 2BE5D 5BN3A 1TWCB 4RCNA 5FLMG 4A3FB 4KV6A 2IWHA 3EJIA 1K0SA 2Z9HA 1A6XA 2F0PA 1T9HA 1VQEA 5DEHA 2Z8LA 1EY8A 1N36L 1JWUD 1AE2A 1QWYA 1LM0A 3BU2A 2K5VA 1E2VA 4BY1H 1O7LA 2KHIA 3D4DA 3W5OA 2J4XA 1H9SA 4HSVA 4O2DA 4RGTA 2JXMB 1TWHH 3KOJA 2NVQB 2B63B 1XNRL 1EU4A 4DXFA 3HG9A 1BBXC 1QG7A 4LF4L 4C56C 1IBKQ 2HHHQ 1Q46A 4L5TA 3CAMA 4X3SA 4BBRG 1CKMA 4X62L 3T13A 1UAPA 1CKNB 3I4LA 3HOWG 3L0OA 3I3CA 2UXDQ 2VUMB 3J7AF 1MBYA 1BQQT 1YITA 1FNVA 4QCLA 4Y52H 2Q2IA 2AQ1B 2R7ZB 5CR3A 2BH2A 1G6ZA 4B3TL 1CFMA 3T56B 1P8LA 1UE1A 3OWFA 4C3IG 3GTPH 1J8IA 1X54A 2PNRC 4OL7A 2N88A 3A7LA 2MFIA 3EVQA 3MTSA 3GTMB 4C3JH 2K50A 1V1PB 2L5TA 4QGUA 1IKMA 1CUKA 5IWAL 4A3MG 5CBAE 2QILA 4RKBA 4IJLA 3ULLA 3V96A 5IGBA 1RKNA 4HJAA 4JC0A 3VR6A 1A62A 1YHBA 3R2IA 4RH6A 1STNA 4B3TQ 4PMCA 4KY7A 1XXGA 5TSSA 1B3QA 1SEBD 3PO3B 4BA1I 1QJOA 4LFBL 1BCPF 2SNMA 2ATWA 3S2DH 2A69D 1VF7A 3KLRA 1HFGA 3L9AX 3HKZG 2FXQA 4BY1G 4A3EG 5IWAQ 1RHPA 2I07B 3IAYA 3CP0A 1JQYD 1NMGA 1QVFA 1PYWD 3KF6A 4DAYA 1EYAA 2PI2E 3TDQA 1JOKA 1VF5C 2SOBA 4EQ5A 5FLXc 2HIXA 1I6HH 3CMAA 2UXCQ 4A3KB 1TWFH 4K14A 4LFBQ 1AE3A 1EOTA 4XYOA 1DJRD 1SFOB 1PH3A 1VQDA 1Q8KA 1WJJA 4MZ9A 4EX5A 4IUPA 5CC4A 3A8IE 1SR3A 1GKHA 1NJIC 1K0RA 2H1EA 5NUCA 1MSGA 2QW7A 4MHEA 2CCZA 2E2JB 3QJYA 2K5DA 2I0QA 2R61A 2VL6A 2EY2A 1EQVA 1I4QA 4IUTA 3RR5A 2E8GA 1HNWL 2JK8A 3K5MA 1YVCA 3FDTA 1VQMA 3G6EA 1K73C 4E6IA 4OO1I 2XRQD 2BH8A 1SYCA 2RQXA 2B2VC 1AFPA 2ENBA 2K5QA 2F52A 1LV9A 3MVVA 1FGBD 5JJIA 5C5LA 1SROA 1GVPA 2DN8A 5EAYA 4AQYQ 4X66Q 1ESRA 5C44H 1NNXA 3JAMc 1SMXA 4F87A 2NVYH 5FOBB 3GTOH 1W6JA 4CDCC 1A63A 1SMYC 4JI0Q 2Z1CA 1D6EC 2FJ2A 3Q8DA 3SR1A 2AWNA 4L8JA 4YY3Q 3FEWX 1SE4A 4DV5Q 1OXSC 4R1JA 4GOPC 3D4RA 4YWMA 1STYA 5C6AA 3TP6A 3DEPA 1S4ZA 3RLOA 2PI2A 2OXPA 3I4OA 1D2BA 2H4OA 3CPFA 4FDBA 1VS0A 2B2VA 4HEDA 4LUZA 3OYYA 3C46A 4QJFA 2P5ZX 1B9NA 4R4IA 1IXRA 2VB3X 3K81C 3STBD 1N33L 4TRDA 4KN7C 5IGGA 2Q2TA 3AMUA 2QCPX 3S1NH 4IFDJ 1VQ4A 5I2XA 5H1SE 2F0LA 2WFWA 2C5CA 3H3VC 4G7ZC 2NZ1D 2X6GA 3E6ZX 1LTRD 2A74C 3VR3A 2NVTB 1QILA 1VMPA 2UUCL 4LF7L 1WCMB 2JA9A 4CJ1B 1U9RA 4IPCA 4NXML 5IP7H 1KHIA 4DR5L 5LL6X 2JA5B 5JJKA 2F0SA 3R2TA 1H9RA 3DWAA 4HJ7A 4NDXA 1KD1C 3IKJA 4XT1B 4KTAA 3IL8A 3KYHC 2F0QA 4DU9A 4GOPA 5EBDA 3N6RA 3EN2A 1DOKA 5C5MA 1NR4A 5C44G 3GD7A 2OCEA 1Y1VB 1MJCA 5I2YA 4DV7L 4JI7L 2E2IB 1CM9A 4DK1A 1MKHA 1V43A 2Z4IA 3S14B 2K52A 5EPKA 3Q24A 1I94L 4LUOA 1VQGA 2NTTA 4NXMQ 5IYDH 5DLQE 5ELFA 2YV5A 3TP8A 5C4ZA 4DV6Q 4X6AH 1H9SB 2F4VQ 1TWCH 2F0HA 1RIPA 1BKBA 4A3FH 1F9PA 2BA1A 2CH4A 4OIKA 4ALPA 2CFMA 2K75A 4FNFA 4HCSA 2Q8IB 1B9MA 4FF3A 1QZHA 2OTJA 4YWKA 1PRTC 3S16H 1T5EA 4JVZA 4JV5L 2VQFL 2MNAA 1PTOC 3HEJA 3X3MA 3EFXD 1XTDA 2VQEQ 2B2UC 3QG1A 1VDZA 4DV1Q 4DV2Q 4Y7NB 2B39A 2KQ3A 3U9SA 1CT1D 2RDHA 4N9PA 2NVQH 1R9TB 2B63H 2LXJA 3J81E 2PO4A 3NP8A 4DUYL 3PF4A 2HDLA 3M3YB 3EQLC 3UI2A 5DM63 2MUYA 5A2QL 3HOYB 5JPMC 4B3RL 1X56A 1MJEA 2B2YC 1PH4A 5DM73 1HR0Q 2MP1A 5I6WA 5FK9C 2JA8G 2O5IC 4GKKQ 1UE5A 3F2CA 4LF6L 1BO0A 4AIMA 2VQFQ 2DNCA 3GQBA 2ICEC 2ZM6L 4MTKA 2EYHA 4A3IB 2PPBC 4C3HB 5IP7G 3NXWA 4JPBW 1SSOA 2DUDA 3T53B 3P7JA 4APVA 1XPUA 3SDZA 3PIP3 2N3SA 1S72A 2XGTA 2K4KA 3NELA 5E7NA 2R7ZH 1U0LA 4DKAC 1O7ZA 1P16A 1EZ6A 1AZQA 1B7YB 2KJXA 3DWPA 2WAQB 1EWIA 3MXGA 3BVMA 3RZDB 2B2UA 3GTMH 1FGUA 1G51A 3J81L 4ZQ3A 4OWXB 5IYDG 1LT4D 1HZBA 1JOQA 1VQ6A 3CHBD 4YWLA 1W3SA 3TP5A 1GHKA 1WI5A 3KF6B 1Q8IA 4DAYB 1MGSA 4L63B 4XDXA 3I4NB 4A3FG 1YNNC 4R8NA 2B2YA 3PSIA 1UE7A 4QMGA 2WB1E 4JK1C 2BE5C 3GDEA 5C3WA 1V1QA 3CCVA 5LMNW 3PO3H 1I4GA 1A2UA 2FMCA 5JEAG 3UDFA 3S2HB 5G3LD 1EY6A 1GO3E 5IYCH 1BVSA 1SNQA 2A68D 5IT9E 1Y14B 4A93B 5IYBG 4XIGS 1PV4A 2IHEA 1SLJA 3PIO3 3MAQA 3I4MB 5K36G 2Q8TA 3I90A 1Z6HA 4ABNA 2CVRA 4A3KH 2HCCA 4RG1A 2M9VA 1GHJA 2QEXA 2QA4A 1SFOH 5I9OA 5FKAC 1PH5A 5CV6A 3DMUA 1KXLA 2DY8A 4H7BA 1NCVA 1TY2A 1BBWA 2DJFC 1HQRD 2E2JH 4LF9L 2VS1A 1HXYD 1U4MA 3WOFA 2EJGC 4WORA 2R7ZG 3E5SA 3ICEA 2PZUA 1IL8A 4DV0Q 4PMBA 1VQIA 1EIYB 4BY7G 1LABA 1X3PA 3KJPA 4DXGA 5FO7B 2FFKB 4DNRB 3T1YL 2E2HB 1L1OC 2K33A 3D0FA 3W1BA 4CDEC 1RF2D 5C4JB 3P1HA 3F2BA 1TS5A 4WJ3M 1GUGA 3PV0A 5COYA 4PZ7A 3J80E 1BNZA 2D0OA 5FLXL 4ZYSA 1Q7YC 1KLUD 4JI8L 1CKOA 1PH6A 1PH2A 2MHVA 2J0TD 1TXYA 2VY3A 5M3FG 4GKJQ 3CC4A 2EZVA 1MD2D 5IY0A 1EEFD 5BN5A 2UUAL 1SNDA 2L15A 3FPPA 4RHSA 3T1YQ 2IT1A 3J80i 1M4VA 5FJ8H 2A69C 2F0KA 2JQOA 3HOUB 2KCMA 1Q1BA 5FO8B 5JVG3 1IBML 1WFQA 3U4ZA 3T4AC 4DR3Q 4CKEA 3A74A 2ZTDA 1UUPA 4M8AA 4IN3A 5ELNA 3QB3A 4DK0A 1HNXQ 3RD4A 3T16A 1G2SA 2LFNA 3CCJA 4IUUA 2EYPA 2EJMA 1X3QA 1L1OA 1S5BD 1JB7A 1EYGA 3PUZA 1LLRD 1PFBA 4LUVA 3MZ5A 2JA7B 1HNZQ 1Z7TA 4GOPB 2NZHA 1Q82C 2NVTH 3GTGB 3JAML 4LF8L 2R6GA 5E1FA 1I50B 2BOSA 2A6HD 4NXNQ 1WTPA 4PMWA 3RUZA 4DAVA 1WCMH 3OMGA 4EGVA 3KF8A 3SEBA 2EYLA 4DR4L 1TWGB 2F0GA 2JA5H 2EXZA 3CF5A 3PUXA 1LTBD 4A3DB 3WOEA 1F9SA 1X9NA 2OWOA 2K32A 2QEJC 1SE8A 1EY4A 5GADC 4DR1L 5DAUA 1FNUA 2AHOB 1B8AA 1PFMA 1WTWA 5ELOA 3DUZA 2RDGA 4LF5Q 1Y1VH 2E2IH 1EYDA 1QNKA 1Y8NB 4KMUC 5CORA 1V8QA 3S14H 1C4QA 4YCUA 3BDLA 3TS2A 1JC7A 5GAHC 2OQKA 4A3JB 1PZJD 3OTOQ 5ELBA 4HAEA 2OF1A 1GUTA 5AJ3Q 3H0GG 1WOCA 1F2YA 2EJFC 4DR1Q 2CW0C 1EU3A 1C8CA 2PMZE 4PZ8A 2AKWB 1N32L 4CGYB 3CW2C 3R3OA 4IPGA 4L5QA 3R8BA 4XQJA 5FJ8G 4MN3A 5IGEA 4LMQD 2LY7A 1B4OA 3I91A 4B3SL 4DUZL 2ZTEA 1L0YB 2N8NA 1LTID 3U58A 1NE3A 3CCRA 4X3TA 1K8MA 4FXKC 5KYLA 4JBJA 3CD6A 1EZ8A 1HRJA 3PQIA 2Q2UA 4GZYC 4Y7NH 1LTSD 2IJ0A 2XN9C 1SYDA 4XQQA 1KNEA 3MXNA 3TQYA 1IBLL 5CV5A 3QIAA 2I46A 3S1MB 3M4QA 4K0KL 3HKZE 1WYDA 3M3YH 3GTQB 4KJNA 3QOJA 4CJ2C 2HQEA 2NWGA 3LWUA 3STBC 3HOYH 5DNFA 1PH7A 3SXHA 3ULJA 1PRTB 4CBVA 2UU9Q 2RSNA 5L37A 4ILWA 3PUWA 4KJOA 5CYUA 4NMZA 5C4XB 3NENA 2A1AA 1WD1A 1PXUA 1DZ1A 3HOZB 1PTOB 1WCMG 4A3IH 3J81c 4C3HH 4OHJA 2JA5G 3OIQA 2EPBA 4K0KQ 1LT6D 3BZKA 4FF2A 5LMNL 2O2LD 3R93A 1O80A 4PV1C 1JWMD 1CK1A 4A4IA 1SYEA 1WTRA 1CQFA 1KRSA 1BOSA 1A3TA 1N36Q 3RZDH 1H9MA 1DXMA 1UNSA 5CV4A 4HMJA 4IFDH 2VB2X 1GM5A 1D7QA 3LX0A 2F0IA 1S5DD 1QCBD 4A3LH 1XNRQ 1HHVA 5IODA 1TU2B 4S3SA 1B70B 3I4NH 3TMEA 4G7HC 2NN6G 4LF4Q 4UHVA 3U9OA 2Q8RE 1Y1WB 3MXPA 4X62Q 4X64L 4HN7A 5CV9A 3S2HH 1PMRA 2F0MA 4IPDA 3W1GA 3KDFA 3MFYA 1HR0W 3KJOA 4DAMA 2CHBD 4R4OA 2EQSA 1E2WA 3HOVB 3C1FA 4A93H 2M2LA 1NY4A 3NTIA 4KY5A 3TBIB 3I4MH 3FKIB 1JJGA 3NQTA 2AWOA 1YNJD 4JI3L 4BBSB 2K05A 1STBA 1X3GA 3SHLA 3GO5A 5IT9c 4QIWE 3K6OA 5EBCA 5FO9B 4A3IG 1IL2A 3FHWA 3KBXA 1PH9A 4KHVA 3ND8A 4UAIA 3RNUA 1G6PA 1NSNS 1SYGA 4U68A 2QKIC 3J7AV 2F0OA 2EE1A 4GLAC 5C3XA 3PUYA 4DR2L 1J9OA 2F0FA 4JI3Q 5JAVA 2PNHA 3A8JE 3IRBA 1G91A 2HUGA 1YJNA 2SEBD 2YYZA 2BCOA 3S17B 1KDCA 2WB1B 4X65L 2L12A 3HOXH 4IFDG 1F2ZA 1K8OA 1S5CD 2E2HH 2F4IA 2F03A 5C4JH 2RVLA 4B3ML 4A3LG 3K5LA 2F0VA 3NK9A 5CV8A 3I4NG 3NEMA 3P75A 1MIUA 1NTGA 5KNBA 4N8FA 1SDFA 4RAUC 3M7NA 1TS2A 4JBWA 2CKZB 1K8GA 1HZCA 1YZ6A 2IHFA 3A0JA 4C3JG 3J7A5 4P73A 4A3BB 3J80c 1XNQL 1L1OB 2JA6B 4B3MQ 1QE6A 4ZKCB 3HOUH 4IURA 2WINB 3PF5A 4A93G 4P75A 3QR8A 3ONAB 2F1MA 2A68C 1DCZA 2Y0SE 4FO2A 1XJVA 3PGZA 5M5YB 2AUJD 2YTYA 5IGDA 1V9PA 1S5ED 3M7GA 1MHWC 2BDNA 5C3EB 2EYJA 4KN4C 5KGUA 3G71A 1HNWQ 2R93B 2CW0D 3C2PA 4FF4A 4QY7A 1VQBA 3S1QB 1EY7A 1B44D 2F3VA 1S5FD 3KF8B 3D6CA 2UXBL 1R4QB 3GV6A 4OGQC 4GS3A 2AMCB 4KK7A 1IYUA 3PUVA 2JA7H 4UP7A 3MFGA 1JE4A 4YHHL 4OONA 5C0XJ 4O42A 4JI4L 1U4RA 3GTGH 2ALYB 3A8KE 2NBFA 4BS9A 5K5PA 3C3LA 1I50H 3EA6A 1RODA 2K5HA 1DOLA 3M4PA 3M9BA 4U673 4DAPA 3LWEA 1DM0B 2G9HD 1TWGH 2K5NA 1Q81C 4GLXA 1AH9A 4IQZA 2JSOA 4EQPA 5M5XB 3HOXG 5CV7A 4J15A 1IYVA 1M8AA 4ZLTF 3H3VH 5LL6S 2XVSA 1TWAB 4NKLA 3ZYYX 2DGYA 3VYTA 1M1KC 5D3DA 3K7AB 1C0AA 3KLWA 1YHQA 1EY5A 2R92B 4A3JH 3F2DA 3A55A 2MJ8A 1JB3A 2F0TA 1CSQA 1N33Q 1VQPA 4GLVB 1JT8A 3K57A 3MXNB 1AW7A 3BYTB 3T51B 3CRKC 1N34L 5A35A 4Q0FA 2KA7A 1B2TA 2NN6I 1HZAA 3BG3A 1D8LA 2VW9A 1EQTA 1S40A 2UUCQ 4LF7Q 1RCVD 1J5EL 5KNDA 2EVBA 1PRTF 1LT3D 1GUSA 1PFSA 2K7VA 4NPSA 4DR5Q 3MC0B 1PTOF 1TQOA 2CWAA 5CMDA 1K9MC 3S1MH 2RHSB 4KHPL 4YCWA 2EIFA 2E74C 3GTQH 1PHJA 1H95A 2QGQA 4LFAL 4BBRB 1PVOA 1XMQL 3QWNA 4JI7Q 4DV7Q 5C4XH 3SK4A 1FR3A 3CPWA 3HOZH 3HOWB 1PTOH 3LNNA 3MA2B 4R4QA 1I94Q 3CRLC 3K8AA 4PQXA 4IUVA 1SRUA 2NZOA 3H15A 4AYBG 4JI1L 3QO2A 2A6HC 4POFA 3SE0A 3U50C 4DV3L 5I9PA 3NTHA 3J7YW 5HGQA 1QZGA 4CKCA 2PW5A 4C3IB 3ND9A 1VQJA 5JJZA 4OX9L 2D5DA 2E76C 1QUQA 1XMQQ 1DYQA 2OTLA 1ILQA 1EY9A 1BF4A 2XWJB 3DXJC 4K8IA 1GXDC 3K0XA 2PMZB 4X3KA 2EY5A 4RCOA 4JV5Q 1A15A 4LAAA 4A3MB 4A3JG 3RN2A 2VUMH 4ZUJA 1O7YA 3KDFB 3CU7A 3SGIA 3URYA 4ODGA 5EPLA 1EWCA 3A56A 3CC2A 4IFDI 4LK1C 3ITPA 4DUYQ 3BS1A 4NP5A 4R4CA 3SK5A 4DGZA 1PDQA 2GVBA 4B3RQ 2IY5B 1Y1WH 4HJ9A 3Q0AA 1Y8OB 3K5NA 1N9WA 4I7ZC 4LF6Q 2PZTA 3HKZB 4A3EB 3X3NA 4DV4L 2ZM6Q 1TIID 1ENFA 1EUJA 4DA2A 1Q90A 1HJPA 1BCPD 1OXXK 3FP9A 3HOVH 1K3BC 3MEHA 1E0BA 1TR5A 4JYAL 3FKIH 1X32A 1XPOA 3GTJB 4I7AA 1SYFA 1ZYRD 4BBSH 4EQOA 5C4XG 2JN4A 2BDOA 5J1ZA 2A8VA 3HOZG 4QB4A 3GV3A 4BXXH 2K1BA 2UUBL 2A73B 4UP8A 4HIMA 3J7ZC 1QOHA 3PMFA 3TRZA 1JCKB 1SAPA 2B63G 3PIPA 2PCFB 4XXEA 3UE0A 2F0JA 2ZXPA 3BDOA 4J1MA 4M1UB 3BJUA 3I56A 3I55A 4WJWA 1GD7A 5EGTA 2X69A 3UDXA 3S17H 1WTQA 2FHTA 1VCIA 3UE1A 1KAWA 1ET9A 1W2BA 2VUMG 3L7ZC 3D31A 1C48A 1D5XC 1K83B 2E75C 1ENAA 2ZXOA 2XSCA 1SJED 2HCIA 2MGSA 5EJWA 3A5UA 4PG3A 1X65A 1HTPA 1SXTA 1YNXA 4BWGB 4QQBX 1SNOA 1D1IA 1ZKOA 3OW7A 5IT9L 1QVGA 5M5WB 1EYCA 1UEBA 3RZOB 3H09A 2G5DA 4HMIA 4A3BH 2JA6H 4LF9Q 1Q86C 3HOVG 4DNIA 5ISRA 2D62A 1R4PB 4QIWB 3TZUA 2B3GA 3PIOA 1EWHA 4JOIC 4KKUA 2EDGA 3FKIG 3VYRA 1MI2A 4P74A 5C3EH 4BBSG 2R93H 2TMPA 3PO3G 3S1QH 2HD3A 2OEOA 4BXXG 1F9QA 1YNJC 5IYCG 2M00A 2ZJQA 1XX8A 1QVCA 3NWSA 2YU9B 2A19A 1WD0A 1PYBA 1YJWA 1BXTA 2WKCA 4JI8Q 1EQRA 4JI2L 4DN4M 5D14A 1LO5D 5KYIA 4A3KG 5JEAJ 5E3FA 4UP9A 2KVMA 3D8GA 1VQAA 1EIFA 4R9WA 3E3XA 2UUAQ 4GN5A 4F8MA 1SYBA 3L2PA 1E1OA 2GA4B 3F8TA 1VQFA 4DR6L 1CTMA 1H9KA 2WB1G 5M5XH 3J80L 2E2DC 2MO0A 4JOIA 2AQ3B 5C44B 1TWAH 1DONA 1IBMQ 3H3VI 3DLLA 3CKIB 1HA5A 3E9HA 3VYSA 3HGBA 3K7AH 5I6YA 2E5LL 1IYJB 1CZGA 2R92H 1X3FA 3AFPA 5KIXA 5EKIA 1C9OA 5HURA 1FYCA 4OWWB 4DR6Q 2Y0SB 3TS0A 2N49A 3E0EA 4O1NA 4ZAIA 4C1NK 1D5MC 4A3BG 4AH6A 2YTXA 2EY1A 2Z0SA 4K6LA 2FMMA 3BDCA 4DR7L 1I5FA 3KLSA 3PCOB 2KCCA 3NHHA 4LF8Q 1DOMA 4V190 2WV6D 4G4KA 2JJQA 3M4YA 1ICFB 5E4XA 3HZXA 1A3UA 2QF7A 1A8VA 3FPUB 2R93G 3HKSA 4DR4Q 3TP7A 1CI3M 2ZJPA 4WFN3 1XPRA 1F9RA 2IL8A 2KEDA 1RTOA 5T1GA 1WTHA 1BR9A 2PYKA 4NW2A 3CCUA 2O5JC 1GUNA 1JJ2A 4XQNA 4BBRH 4UPAA 2JA8B 3T1HL 1QUQB 1PYSB 4LFCL 3ERQA 3HOWH 4IZ8A 1IZ6A 4F88A 1I6VC 3NUCA 4XTCS 3KK7A 1ASYA 5BR8L 5GQOA 1OTCA 3G48A 4CJ0B 1HFNA 2EYMA 4MTNA 1R9TH 1KDBA 2WP8J 1N32Q 3CCQA 4FXDA 1RL2A 4C3IH 3VR4A 1IW7D 1Z9FA 4I65A 3OSOA 1IKLA 1O7IA 1NBWA 2WACA 1ONLA 4B3SQ 4DUZQ 4CDFC 4JW0A 3Q23A 2NVXB 3VYUA 1TVXA 3D6WA 2Z6KC 4A3MH 5BR8Q 3ULPA 4JI5L 1Q12A 3S1RB 1RDPD 5GAEC 4ZKBB 2N55A 2I5LX 1IBLQ 4H44C 4A75A 5C0XH 2Z4HA 3NBIA 1ESFA 2MQHA 2HDMA 4K5WA 5EKLA 2LXKA 1IBKL 2HHHL 3IFTA 4ZK9B 3CCLA 1JJCB 1G8ZD 3S16B 2FINB 1OXVA 2K5WA 1Y1VG 3CQZB 4A3GB 1WTVA 4A3EH 1UEAB 3M85A 4UY8C 4R4TA 1SNMA 4JI5Q 2UXDL 3TEHB 3ERSX 1CHPD 3H6MA 2MO1A 4IO9A 4P71A 3OIPA 2F3WA 5LMNQ 1NAPA 2A5HA 3GTKB 1VQ5A 3F1ZA 3GTJH 3I7FA 2R7DA 1PZKD 2Z6KA 5M3MB 2B29A 1VQKA 3AEVA 5D3IB 3K7UC 4N8X1 3M4OB 2JEAI 1BUVT 2SDFA 1EQQA 1PH8A 4JCVE 2L4NA 3BZDB 2KENA 1L0WA 2JEBI 2PQAA 4GNXC 1KL9A 3HOYG 3AQQA 3NWTA 1B53A 1GOZA 4IUNA 4BY7B 1LACA 2L55A 4X64Q 3Q22A 1FNWA 1STEA 2B8FA 2F0NA 1KLGD 1AP0A 4C3HG 2L9HA 2JP1A 2EYFA 3OMCA 4C2MB 3HP3A 2B8GA 4CDDC 4QUCA 5EPJA 3G6JB 1K83H 5C0XG 1PA6A 2K14A 5ELDA 4KD3A 4JI6L 3F2UA 4IUQA 4XYQA 2UXCL 5M3FB 4IPHA 3G4SA 4EQNA 1Y69U 3WDNA 4QUFA 2WAQG 3ZJYC 5M5WH 3RZOH 5EQ0A 1EEID 2V4DA 5M9OA 1CQVA 2L1BA 1AZPA 1VQ9A 2PQEA 1ASZA 4DPGA 5GAGC 4GNXA 4JI6Q 1ET6A 4MIUA 5G3LF 1L0XB 3GTLB 1BCPC 3AB9A 1HZ9A 4DR2Q 3ER0A 3KUPA 1I4RA 2IX3A 1KAAA 3DM3A 1LTTD 2A6ED 3TN2A 2OT2A 3W2DA 4ME3A 1G291 1ICWA 1TS4A 4FP5D 1ZYRC 1NUCA 1CHQD 4X65Q 1VQ7A 1KTKA 2XIWA 5IP9H 4AQYL 4X66L 4L5RC 2YU9H 1E2ZA 1JOOA 3BVGA 3SK6A 3I4MG 2K03A 1HUMA 4KLKA 2CQAA 2QDLA 1CA5A 1VQCA
chains in the Genus database with same CATH topology
2KHIA 2UUAL 4A3JG 3W5OA 3RN2A 4JI0L 2VUMH 4O2DA 3KDFB 3SGIA 1YI2A 4A76A 1TWHH 2L15A 3KOJA 3CC2A 4IFDI 3T1YQ 1XNQQ 2IT1A 2Q2HA 3J80i 1XNRL 4YY3L 3EBEA 5FJ8H 4AYBE 4DUYQ 2JQOA 4DV5L 2KCMA 1Q1BA 4R4CA 1IBML 4LF4L 1WFQA 3U4ZA 1IBKQ 2HHHQ 1Q46A 2GVBA 4B3RQ 4L5TA 3CAMA 2IY5B 1LTLA 4DR3Q 3EIVA 3CC7A 3VDYA 1Y1WH 3A74A 2ZTDA 5ELNA 4BBRG 4HJ9A 1CKMA 4X62L 1HNXQ 1N9WA 4LF6Q 1CKNB 2KHJA 3HOWG 4DV4L 3L0OA 5IE8A 2ZM6Q 3CCJA 2RF4A 2UXDQ 2UXBQ 1EUJA 4A3DH 1FVIA 1L1OA 1YITA 1JB7A 1EYGA 3PUZA 1HJPA 1OXXK 3FP9A 4LUVA 1E22A 5J3BA 4JYAL 3HOVH 4Y52H 1HNZQ 2Q2IA 4YHHQ 4GOPB 1YIJA 2BH2A 2NZHA 1Q82C 4B3TL 4BA2I 3FKIH 1KIXA 1UE6A 1P8LA 1JE5A 1UE1A 4HJ5A 4JI4Q 4LF8L 3AFQA 2NVTH 3GTPH 2HQLA 1XPOA 5JJLA 2R6GA 1X54A 4NXNQ 4BBSH 4PMWA 5C4XG 1WCMH 1K3RA 2A8VA 2MFIA 1EFWA 3HOZG 4DR4L 4C3JH 4BXXH 2K50A 2UUBL 4QGUA 2JA5H 4UP8A 3CF5A 2IX0A 3PUXA 1CUKA 5IWAL 3J7ZC 4HIMA 4A3MG 1X9NA 3TRZA 2OWOA 3TREA 1SE8A 4IJLA 1YJ9A 5GADC 4DR1L 3ULLA 1E7ZA 4HJAA 4JC0A 1A62A 4TQUS 3PIPA 2AHOB 2B63G 1YHBA 5IP9G 1B8AA 4B3TQ 3UE0A 4NB3A 5ELOA 3HOUG 4LF5Q 2R7FA 2H5XA 1Y1VH 2EXDA 2E2IH 2JA8H 3CXCA 3S14H 3BJUA 4BA1I 4LFBL 3I56A 2ATWA 3I55A 4YCUA 3S2DH 3TS2A 4LWCA 5GAHC 1GD7A 2OQKA 1KRTA 3UDXA 4HIDA 3S17H 3HKZG 2FXQA 4BY1G 4A3EG 2HT1A 3B6YA 5IWAQ 1VCIA 3OTOQ 4DV6L 3UE1A 1KAWA 1W2BA 3CP0A 5AJ3Q 3H0GG 2VUMG 1WOCA 3L7ZC 1FL0A 1NMGA 3J81j 4DR1Q 3D31A 3KF6A 1QVFA 2F4VL 4A3CH 2PMZE 4PZ8A 2AKWB 1N32L 2PI2E 3CW2C 4IPGA 4L5QA 5FJ8G 3RLFA 1L2FA 1N34Q 2JA7G 1DGSA 4EQ5A 5FLXc 2HIXA 4B3SL 3A5UA 1I6HH 3CMAA 3A5ZB 4DUZL 2UXCQ 2ZTEA 1X65A 4PG3A 2N8NA 2NVXH 3U58A 1TWFH 1NE3A 1J5EQ 1AE3A 1YNXA 3CCRA 4LFBQ 4QQBX 1QVGA 1UEBA 4IJHA 4JBJA 1PH3A 3CD6A 1VQDA 2VQEL 2Q2UA 4DV2L 4DV1L 3S1RH 1Q8KA 1WJJA 1BBUA 4MZ9A 4Y7NH 4EX5A 3TQYA 4A3BH 1IBLL 4A3DG 2Y0SG 1SR3A 1GKHA 2JA6H 4O0AA 1NJIC 1K0RA 3M4QA 2CCZA 4KHPQ 3HKZE 4K0KL 1WYDA 4LF9Q 1Q86C 3M3YH 2I0QA 3HOVG 4LW1A 5C0XI 3BZCA 4DNIA 2VL6A 2V1CC 2D62A 3STBC 3HOYH 2B3GA 4YCVA 4LFAQ 3PIOA 1PH7A 4JOIC 4POGA 3FKIG 3ULJA 2UU9Q 3PUWA 2E8GA 3RR5A 1HR0L 2GN5A 3NENA 4P74A 3CQZH 5C3EH 2ES2A 2A1AA 4GKKL 2I5MX 4A3GH 1HNWL 2JK8A 4BBSG 2R93H 1E24A 1YVCA 1VQMA 1WCMG 3G6EA 3U4VA 3PO3G 3S1QH 4A3IH 1K73C 4OO1I 2BH8A 4KI0A 3J81c 4C3HH 4BXXG 4JI1Q 2ZTCA 2JA5G 4JV5Q 5IYCG 4RMFA 2ZJQA 2F52A 5IYBH 3CMEA 2ZJRA 4K0KQ 4DV3Q 3BZKA 5JJIA 5LMNL 1QVCA 1SROA 1GVPA 5EAYA 3LGJA 2OQ0A 4AQYQ 4X66Q 5C44H 1LUZA 4A4IA 3JAMc 2RHQB 1SMXA 2A19A 4OX9Q 3GTKH 1PYBA 2CQOA 2PQAB 1YJWA 2JE6I 2NVYH 1YHAA 1VQOA 1KRSA 4JI8Q 4JI2L 1EQRA 5M3MH 1N36Q 3GTOH 3RZDH 4A3KG 4OWTB 5JEAJ 3M4OH 1A63A 4UP9A 4DK3C 1VQAA 4JBMA 2HIVA 1EIFA 3J81i 2UUAQ 4GN5A 4JI0Q 3L2PA 1E1OA 4HIOA 3F8TA 1VQFA 1GM5A 4DR6L 1D7QA 2WB1G 5M5XH 3KFUA 4WJ4A 3Q8DA 4A3CG 1K8AC 4A3LH 2AWNA 1XNRQ 4YY3Q 4DV5Q 1B70B 2MO0A 4JOIA 3I4NH 1OXSC 2BA0A 1OXTA 4R1JA 1TWAH 2NN6G 1IBMQ 3H3VI 4LF4Q 3DLLA 4GOPC 4YWMA 3E9HA 3K7AH 3RLOA 2PI2A 2E5LL 4X62Q 1IYJB 4X64L 4IOCA 4BY7H 3I4OA 3S2HH 2IX1A 3CPFA 2R92H 1X3FA 3AFPA 4FDBA 1VS0A 4LUZA 1C9OA 4IPDA 3OYYA 4OXPA 4DV4Q 4QJFA 3KDFA 3W1GA 4R4IA 1IXRA 1HR0W 3K81C 3AYHB 3STBD 4L5SA 4OWWB 3KJOA 1N33L 4DR6Q 4DAMA 3TS0A 4R4OA 2N49A 3E0EA 4C2MH 2Q2TA 3S1NH 4IFDJ 3PO2H 4AH6A 2YTXA 2EQSA 1VQ4A 4A3BG 2Z0SA 4A93H 5H1SE 1NY4A 1XMOL 4MNOA 2WFWA 4GNXB 4DR7L 1I5FA 3PCOB 3I4MH 4JYAQ 1JJGA 4LF8Q 2AWOA 2JJQA 5M3FH 4JI3L 2UUCL 1CKNA 4LF7L 4TVAB 2JA9A 4A3GG 1X3GA 1A8VA 2ASBA 3GO5A 4IPCA 5IT9c 3HKSA 4QIWE 2R93G 4DR4Q 4NXML 5IP7H 1KHIA 4DR5L 4A3IG 2ZJPA 2UUBQ 1IL2A 5JJKA 3FHWA 3WWVA 1XPRA 4HJ7A 2KBNA 1PH9A 1KD1C 3KYHC 3RNUA 1J6QA 4GOPA 3CCUA 3S24A 1XMOQ 1G6PA 3EN2A 5GROA 1JJ2A 1LYLA 3GTLH 4GLAC 4BBRH 5C44G 3GD7A 2OCEA 4UPAA 1MJCA 3PUYA 4DV7L 4DR2L 3T1HL 1QUQB 4JI7L 1PYSB 4JI3Q 4LFCL 1UWVA 2PNHA 1KC8C 4DV0L 1Y1WG 3IRBA 1MKHA 1V43A 5M3MG 3HOWH 2XTIA 1IZ6A 2K52A 4LNQA 1X3EA 1YJNA 1I94L 2CWPA 4XTCS 4LUOA 1VQGA 2YYZA 4NXMQ 5IYDH 5DLQE 1ASYA 5BR8L 2YV5A 4DV6Q 5GQOA 1OTCA 3G48A 2I5HA 4X65L 1CSPA 3HOXH 4X6AH 4IFDG 2F4VQ 1TWCH 4MTNA 1R9TH 1RIPA 4KHZA 2E2HH 2WP8J 1BKBA 1N32Q 5C4JH 4A3FH 1C7YA 2BA1A 3CCQA 4B3ML 4A3LG 1RL2A 1A0IA 4C3IH 4ALPA 2CFMA 4H02A 1Z9FA 2K75A 3I4NG 3NEMA 1MIUA 1O7IA 1NBWA 4B3SQ 5M5YH 1NTGA 2OTJA 1QZHA 4DUZQ 4YWKA 5LMUL 3S16H 1VQLA 4GKJL 3M7NA 4JV5L 2VQFL 2MNAA 4JBWA 4QL5A 2CKZB 2Z6KC 5BR8Q 1HZCA 1YZ6A 3ULPA 4A3MH 2IHFA 1M90C 1K8GA 1XTDA 3A0JA 4JI5L 1Q12A 2VQEQ 1KQSA 4DV2Q 3CCEA 4DV1Q 3J7A5 5GAEC 4BY1H 1OXUA 4GN3B 3MEFA 2D0PA 2I5LX 4P73A 2NVQH 3J80c 1IBLQ 1L1OB 1NMFA 2LXJA 1XNQL 4A75A 2B63H 1E1TA 1Z47A 4DUYL 4B3MQ 3PF4A 3HOUH 3CCMA 2MQHA 4A93G 3PF5A 4P75A 2LXKA 1IBKL 2HHHL 4B3RL 2Y0SE 2VZAA 3UDIA 1XJVA 3PGZA 4DR3L 1X56A 2YTYA 3RN5A 1JJCB 1MJEA 3CCLA 5LMUQ 1V9PA 1PH4A 1HR0Q 1OXVA 1Y1VG 1HNXL 2JA8G 4GKKQ 1UE5A 3G71A 3F2CA 4LF6L 1HNWQ 3K80C 4AIMA 2VQFQ 4A3EH 1S3OA 4QY7A 1VQBA 2ZM6L 3I2ZA 3M85A 3KF8B 2GVAA 3H0GH 4R4TA 4JI5Q 4UY8C 3TEHB 2UXBL 2UXDL 5IP7G 3ERSX 4GS3A 2DUDA 1E3PA 2AMCB 4APVA 2MO1A 4IO9A 4P71A 3UDGA 3PUVA 1HNZL 4UP7A 1XPUA 2JA7H 2N3SA 1S72A 2XGTA 2K4KA 2YTVA 3NELA 5E7NA 4YHHL 5LMNQ 1U0LA 2R7ZH 4OONA 4DKAC 5C0XJ 1YBYA 4JI4L 3GTGH 2ALYB 1P16A 3JAMi 1VQ8A 1VQ5A 3F1ZA 3GTJH 1I50H 1B7YB 3I7FA 4NXNL 2K5HA 4JI2Q 2R7DA 2Z6KA 2B29A 1EWIA 1VQKA 3AEVA 3K7UC 3M4PA 3M9BA 3GTMH 1FGUA 1G51A 1PH1A 2K5NA 1TWGH 2JEAI 1Q81C 4GLXA 4OWXB 5IYDG 1HZBA 1AH9A 1EQQA 1VQ6A 4DK6C 1PH8A 4YWLA 4JCVE 5FLMH 1W3SA 3HOXG 4J15A 1WI5A 2C35B 3KF6B 4DAYB 2KENA 2JA6G 3H3VH 1L0WA 3E9IA 3CC4A 4A3FG 1FJGL 2JEBI 2PQAA 3PSIA 1UE7A 2DGYA 4GNXC 2WB1E 4LF5L 1KL9A 3HOYG 3AQQA 3GDEA 1M1KC 1V1QA 3CCVA 5LMNW 3PO3H 2E5LQ 4X64Q 1C0AA 3KLWA 5JEAG 3UDFA 5C3EG 1YHQA 4A3JH 3F2DA 4GN4B 1GO3E 2KCTA 3RLNA 1BVSA 5IYCH 3OTOL 5AJ3L 1CSQA 1HH2P 1N33Q 1X6OA 1Y14B 1VQPA 1VQHA 4GLVB 1JT8A 3MXNB 1K83H 1X55A 5IYBG 2ID0A 5C0XG 4XIGS 3NBHB 2K14A 1PA6A 1EOVA 1N34L 1FJGQ 4JI6L 1PV4A 1VQNA 2VNUD 2RCNA 2IHEA 1SLJA 2NN6I 2LSSA 1HZAA 4DR7Q 5K36G 2F3IA 1D8LA 1Q1EA 2VW9A 2N78A 1S40A 3S15H 2UXCL 4A3KH 4IPHA 4RG1A 3G4SA 2UUCQ 4LF7Q 1J5EL 2WAQG 3ZJYC 2QEXA 4JG2A 2QA4A 4HIKA 1SFOH 4OO1G 5M5WH 3RZOH 1PFSA 4NPSA 3CCSA 4DR5Q 1I3QH 1VQ9A 1PH5A 5HY6A 2CWAA 1KXLA 4IOAA 3HFZB 1K9MC 4PZ6A 1JMCA 2RHSB 3S1MH 1BBWA 1ASZA 2E2JH 4YCWA 4KHPL 4DPGA 2EIFA 5GAGC 4LF9L 3GTQH 4GNXA 2VS1A 3JC66 1PHJA 1H95A 4JI6Q 2QGQA 3PO2G 1N8RC 2R7ZG 1U5KA 4LFAL 3ICEA 1YEZA 3OW2A 1PVOA 4P72A 1XMQL 2UU9L 4JBKA 1HZ9A 4DV7Q 5C4XH 4DR2Q 3T1HQ 4JI7Q 3ER0A 4LFCQ 3CPWA 3DM3A 3HOZH 4DV0Q 4HJ8A 4R4QA 1I94Q 1VQIA 1EIYB 3K8AA 4BY7G 1SRUA 2NZOA 3H15A 4AYBG 4ME3A 4JI1L 2R92G 1SN8A 1G291 4POFA 4X65Q 2WAQE 3KJPA 3U50C 4DV3L 1VQ7A 3T1YL 5FLMG 1L1OC 3D0FA 3W1BA 5HGQA 5IP9H 1QZGA 3F2BA 4WJ3M 4AQYL 3PV0A 4X66L 4PZ7A 4L5RC 1VQJA 2YU9H 2D0OA 4OX9L 1QUQA 1XMQQ 1T9HA 1VQEA 1Q7YC 2OTLA 3I4MG 4JI8L 1CKOA 1PH6A 1PH2A 1N36L 3K0XA 4KLKA 1TXYA 2VY3A 5M3FG 1AE2A 1LM0A 3BU2A 2K5VA 4GKJQ 1VQCA 5IY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHI A;  2UUA L;  4A3J G;  3W5O A;  3RN2 A;  4JI0 L;  2VUM H;  4O2D A;  3KDF B;  3SGI A;  1YI2 A;  4A76 A;  1TWH H;  2L15 A;  3KOJ A;  3CC2 A;  4IFD I;  3T1Y Q;  1XNQ Q;  2IT1 A;  2Q2H A;  3J80 i;  1XNR L;  4YY3 L;  3EBE A;  5FJ8 H;  4AYB E;  4DUY Q;  2JQO A;  4DV5 L;  2KCM A;  1Q1B A;  4R4C A;  1IBM L;  4LF4 L;  1WFQ A;  3U4Z A;  1IBK Q;  2HHH Q;  1Q46 A;  2GVB A;  4B3R Q;  4L5T A;  3CAM A;  2IY5 B;  1LTL A;  4DR3 Q;  3EIV A;  3CC7 A;  3VDY A;  1Y1W H;  3A74 A;  2ZTD A;  5ELN A;  4BBR G;  4HJ9 A;  1CKM A;  4X62 L;  1HNX Q;  1N9W A;  4LF6 Q;  1CKN B;  2KHJ A;  3HOW G;  4DV4 L;  3L0O A;  5IE8 A;  2ZM6 Q;  3CCJ A;  2RF4 A;  2UXD Q;  2UXB Q;  1EUJ A;  4A3D H;  1FVI A;  1L1O A;  1YIT A;  1JB7 A;  1EYG A;  3PUZ A;  1HJP A;  1OXX K;  3FP9 A;  4LUV A;  1E22 A;  5J3B A;  4JYA L;  3HOV H;  4Y52 H;  1HNZ Q;  2Q2I A;  4YHH Q;  4GOP B;  1YIJ A;  2BH2 A;  2NZH A;  1Q82 C;  4B3T L;  4BA2 I;  3FKI H;  1KIX A;  1UE6 A;  1P8L A;  1JE5 A;  1UE1 A;  4HJ5 A;  4JI4 Q;  4LF8 L;  3AFQ A;  2NVT H;  3GTP H;  2HQL A;  1XPO A;  5JJL A;  2R6G A;  1X54 A;  4NXN Q;  4BBS H;  4PMW A;  5C4X G;  1WCM H;  1K3R A;  2A8V A;  2MFI A;  1EFW A;  3HOZ G;  4DR4 L;  4C3J H;  4BXX H;  2K50 A;  2UUB L;  4QGU A;  2JA5 H;  4UP8 A;  3CF5 A;  2IX0 A;  3PUX A;  1CUK A;  5IWA L;  3J7Z C;  4HIM A;  4A3M G;  1X9N A;  3TRZ A;  2OWO A;  3TRE A;  1SE8 A;  4IJL A;  1YJ9 A;  5GAD C;  4DR1 L;  3ULL A;  1E7Z A;  4HJA A;  4JC0 A;  1A62 A;  4TQU S;  3PIP A;  2AHO B;  2B63 G;  1YHB A;  5IP9 G;  1B8A A;  4B3T Q;  3UE0 A;  4NB3 A;  5ELO A;  3HOU G;  4LF5 Q;  2R7F A;  2H5X A;  1Y1V H;  2EXD A;  2E2I H;  2JA8 H;  3CXC A;  3S14 H;  3BJU A;  4BA1 I;  4LFB L;  3I56 A;  2ATW A;  3I55 A;  4YCU A;  3S2D H;  3TS2 A;  4LWC A;  5GAH C;  1GD7 A;  2OQK A;  1KRT A;  3UDX A;  4HID A;  3S17 H;  3HKZ G;  2FXQ A;  4BY1 G;  4A3E G;  2HT1 A;  3B6Y A;  5IWA Q;  1VCI A;  3OTO Q;  4DV6 L;  3UE1 A;  1KAW A;  1W2B A;  3CP0 A;  5AJ3 Q;  3H0G G;  2VUM G;  1WOC A;  3L7Z C;  1FL0 A;  1NMG A;  3J81 j;  4DR1 Q;  3D31 A;  3KF6 A;  1QVF A;  2F4V L;  4A3C H;  2PMZ E;  4PZ8 A;  2AKW B;  1N32 L;  2PI2 E;  3CW2 C;  4IPG A;  4L5Q A;  5FJ8 G;  3RLF A;  1L2F A;  1N34 Q;  2JA7 G;  1DGS A;  4EQ5 A;  5FLX c;  2HIX A;  4B3S L;  3A5U A;  1I6H H;  3CMA A;  3A5Z B;  4DUZ L;  2UXC Q;  2ZTE A;  1X65 A;  4PG3 A;  2N8N A;  2NVX H;  3U58 A;  1TWF H;  1NE3 A;  1J5E Q;  1AE3 A;  1YNX A;  3CCR A;  4LFB Q;  4QQB X;  1QVG A;  1UEB A;  4IJH A;  4JBJ A;  1PH3 A;  3CD6 A;  1VQD A;  2VQE L;  2Q2U A;  4DV2 L;  4DV1 L;  3S1R H;  1Q8K A;  1WJJ A;  1BBU A;  4MZ9 A;  4Y7N H;  4EX5 A;  3TQY A;  4A3B H;  1IBL L;  4A3D G;  2Y0S G;  1SR3 A;  1GKH A;  2JA6 H;  4O0A A;  1NJI C;  1K0R A;  3M4Q A;  2CCZ A;  4KHP Q;  3HKZ E;  4K0K L;  1WYD A;  4LF9 Q;  1Q86 C;  3M3Y H;  2I0Q A;  3HOV G;  4LW1 A;  5C0X I;  3BZC A;  4DNI A;  2VL6 A;  2V1C C;  2D62 A;  3STB C;  3HOY H;  2B3G A;  4YCV A;  4LFA Q;  3PIO A;  1PH7 A;  4JOI C;  4POG A;  3FKI G;  3ULJ A;  2UU9 Q;  3PUW A;  2E8G A;  3RR5 A;  1HR0 L;  2GN5 A;  3NEN A;  4P74 A;  3CQZ H;  5C3E H;  2ES2 A;  2A1A A;  4GKK L;  2I5M X;  4A3G H;  1HNW L;  2JK8 A;  4BBS G;  2R93 H;  1E24 A;  1YVC A;  1VQM A;  1WCM G;  3G6E A;  3U4V A;  3PO3 G;  3S1Q H;  4A3I H;  1K73 C;  4OO1 I;  2BH8 A;  4KI0 A;  3J81 c;  4C3H H;  4BXX G;  4JI1 Q;  2ZTC A;  2JA5 G;  4JV5 Q;  5IYC G;  4RMF A;  2ZJQ A;  2F52 A;  5IYB H;  3CME A;  2ZJR A;  4K0K Q;  4DV3 Q;  3BZK A;  5JJI A;  5LMN L;  1QVC A;  1SRO A;  1GVP A;  5EAY A;  3LGJ A;  2OQ0 A;  4AQY Q;  4X66 Q;  5C44 H;  1LUZ A;  4A4I A;  3JAM c;  2RHQ B;  1SMX A;  2A19 A;  4OX9 Q;  3GTK H;  1PYB A;  2CQO A;  2PQA B;  1YJW A;  2JE6 I;  2NVY H;  1YHA A;  1VQO A;  1KRS A;  4JI8 Q;  4JI2 L;  1EQR A;  5M3M H;  1N36 Q;  3GTO H;  3RZD H;  4A3K G;  4OWT B;  5JEA J;  3M4O H;  1A63 A;  4UP9 A;  4DK3 C;  1VQA A;  4JBM A;  2HIV A;  1EIF A;  3J81 i;  2UUA Q;  4GN5 A;  4JI0 Q;  3L2P A;  1E1O A;  4HIO A;  3F8T A;  1VQF A;  1GM5 A;  4DR6 L;  1D7Q A;  2WB1 G;  5M5X H;  3KFU A;  4WJ4 A;  3Q8D A;  4A3C G;  1K8A C;  4A3L H;  2AWN A;  1XNR Q;  4YY3 Q;  4DV5 Q;  1B70 B;  2MO0 A;  4JOI A;  3I4N H;  1OXS C;  2BA0 A;  1OXT A;  4R1J A;  1TWA H;  2NN6 G;  1IBM Q;  3H3V I;  4LF4 Q;  3DLL A;  4GOP C;  4YWM A;  3E9H A;  3K7A H;  3RLO A;  2PI2 A;  2E5L L;  4X62 Q;  1IYJ B;  4X64 L;  4IOC A;  4BY7 H;  3I4O A;  3S2H H;  2IX1 A;  3CPF A;  2R92 H;  1X3F A;  3AFP A;  4FDB A;  1VS0 A;  4LUZ A;  1C9O A;  4IPD A;  3OYY A;  4OXP A;  4DV4 Q;  4QJF A;  3KDF A;  3W1G A;  4R4I A;  1IXR A;  1HR0 W;  3K81 C;  3AYH B;  3STB D;  4L5S A;  4OWW B;  3KJO A;  1N33 L;  4DR6 Q;  4DAM A;  3TS0 A;  4R4O A;  2N49 A;  3E0E A;  4C2M H;  2Q2T A;  3S1N H;  4IFD J;  3PO2 H;  4AH6 A;  2YTX A;  2EQS A;  1VQ4 A;  4A3B G;  2Z0S A;  4A93 H;  5H1S E;  1NY4 A;  1XMO L;  4MNO A;  2WFW A;  4GNX B;  4DR7 L;  1I5F A;  3PCO B;  3I4M H;  4JYA Q;  1JJG A;  4LF8 Q;  2AWO A;  2JJQ A;  5M3F H;  4JI3 L;  2UUC L;  1CKN A;  4LF7 L;  4TVA B;  2JA9 A;  4A3G G;  1X3G A;  1A8V A;  2ASB A;  3GO5 A;  4IPC A;  5IT9 c;  3HKS A;  4QIW E;  2R93 G;  4DR4 Q;  4NXM L;  5IP7 H;  1KHI A;  4DR5 L;  4A3I G;  2ZJP A;  2UUB Q;  1IL2 A;  5JJK A;  3FHW A;  3WWV A;  1XPR A;  4HJ7 A;  2KBN A;  1PH9 A;  1KD1 C;  3KYH C;  3RNU A;  1J6Q A;  4GOP A;  3CCU A;  3S24 A;  1XMO Q;  1G6P A;  3EN2 A;  5GRO A;  1JJ2 A;  1LYL A;  3GTL H;  4GLA C;  4BBR H;  5C44 G;  3GD7 A;  2OCE A;  4UPA A;  1MJC A;  3PUY A;  4DV7 L;  4DR2 L;  3T1H L;  1QUQ B;  4JI7 L;  1PYS B;  4JI3 Q;  4LFC L;  1UWV A;  2PNH A;  1KC8 C;  4DV0 L;  1Y1W G;  3IRB A;  1MKH A;  1V43 A;  5M3M G;  3HOW H;  2XTI A;  1IZ6 A;  2K52 A;  4LNQ A;  1X3E A;  1YJN A;  1I94 L;  2CWP A;  4XTC S;  4LUO A;  1VQG A;  2YYZ A;  4NXM Q;  5IYD H;  5DLQ E;  1ASY A;  5BR8 L;  2YV5 A;  4DV6 Q;  5GQO A;  1OTC A;  3G48 A;  2I5H A;  4X65 L;  1CSP A;  3HOX H;  4X6A H;  4IFD G;  2F4V Q;  1TWC H;  4MTN A;  1R9T H;  1RIP A;  4KHZ A;  2E2H H;  2WP8 J;  1BKB A;  1N32 Q;  5C4J H;  4A3F H;  1C7Y A;  2BA1 A;  3CCQ A;  4B3M L;  4A3L G;  1RL2 A;  1A0I A;  4C3I H;  4ALP A;  2CFM A;  4H02 A;  1Z9F A;  2K75 A;  3I4N G;  3NEM A;  1MIU A;  1O7I A;  1NBW A;  4B3S Q;  5M5Y H;  1NTG A;  2OTJ A;  1QZH A;  4DUZ Q;  4YWK A;  5LMU L;  3S16 H;  1VQL A;  4GKJ L;  3M7N A;  4JV5 L;  2VQF L;  2MNA A;  4JBW A;  4QL5 A;  2CKZ B;  2Z6K C;  5BR8 Q;  1HZC A;  1YZ6 A;  3ULP A;  4A3M H;  2IHF A;  1M90 C;  1K8G A;  1XTD A;  3A0J A;  4JI5 L;  1Q12 A;  2VQE Q;  1KQS A;  4DV2 Q;  3CCE A;  4DV1 Q;  3J7A 5;  5GAE C;  4BY1 H;  1OXU A;  4GN3 B;  3MEF A;  2D0P A;  2I5L X;  4P73 A;  2NVQ H;  3J80 c;  1IBL Q;  1L1O B;  1NMF A;  2LXJ A;  1XNQ L;  4A75 A;  2B63 H;  1E1T A;  1Z47 A;  4DUY L;  4B3M Q;  3PF4 A;  3HOU H;  3CCM A;  2MQH A;  4A93 G;  3PF5 A;  4P75 A;  2LXK A;  1IBK L;  2HHH L;  4B3R L;  2Y0S E;  2VZA A;  3UDI A;  1XJV A;  3PGZ A;  4DR3 L;  1X56 A;  2YTY A;  3RN5 A;  1JJC B;  1MJE A;  3CCL A;  5LMU Q;  1V9P A;  1PH4 A;  1HR0 Q;  1OXV A;  1Y1V G;  1HNX L;  2JA8 G;  4GKK Q;  1UE5 A;  3G71 A;  3F2C A;  4LF6 L;  1HNW Q;  3K80 C;  4AIM A;  2VQF Q;  4A3E H;  1S3O A;  4QY7 A;  1VQB A;  2ZM6 L;  3I2Z A;  3M85 A;  3KF8 B;  2GVA A;  3H0G H;  4R4T A;  4JI5 Q;  4UY8 C;  3TEH B;  2UXB L;  2UXD L;  5IP7 G;  3ERS X;  4GS3 A;  2DUD A;  1E3P A;  2AMC B;  4APV A;  2MO1 A;  4IO9 A;  4P71 A;  3UDG A;  3PUV A;  1HNZ L;  4UP7 A;  1XPU A;  2JA7 H;  2N3S A;  1S72 A;  2XGT A;  2K4K A;  2YTV A;  3NEL A;  5E7N A;  4YHH L;  5LMN Q;  1U0L A;  2R7Z H;  4OON A;  4DKA C;  5C0X J;  1YBY A;  4JI4 L;  3GTG H;  2ALY B;  1P16 A;  3JAM i;  1VQ8 A;  1VQ5 A;  3F1Z A;  3GTJ H;  1I50 H;  1B7Y B;  3I7F A;  4NXN L;  2K5H A;  4JI2 Q;  2R7D A;  2Z6K A;  2B29 A;  1EWI A;  1VQK A;  3AEV A;  3K7U C;  3M4P A;  3M9B A;  3GTM H;  1FGU A;  1G51 A;  1PH1 A;  2K5N A;  1TWG H;  2JEA I;  1Q81 C;  4GLX A;  4OWX B;  5IYD G;  1HZB A;  1AH9 A;  1EQQ A;  1VQ6 A;  4DK6 C;  1PH8 A;  4YWL A;  4JCV E;  5FLM H;  1W3S A;  3HOX G;  4J15 A;  1WI5 A;  2C35 B;  3KF6 B;  4DAY B;  2KEN A;  2JA6 G;  3H3V H;  1L0W A;  3E9I A;  3CC4 A;  4A3F G;  1FJG L;  2JEB I;  2PQA A;  3PSI A;  1UE7 A;  2DGY A;  4GNX C;  2WB1 E;  4LF5 L;  1KL9 A;  3HOY G;  3AQQ A;  3GDE A;  1M1K C;  1V1Q A;  3CCV A;  5LMN W;  3PO3 H;  2E5L Q;  4X64 Q;  1C0A A;  3KLW A;  5JEA G;  3UDF A;  5C3E G;  1YHQ A;  4A3J H;  3F2D A;  4GN4 B;  1GO3 E;  2KCT A;  3RLN A;  1BVS A;  5IYC H;  3OTO L;  5AJ3 L;  1CSQ A;  1HH2 P;  1N33 Q;  1X6O A;  1Y14 B;  1VQP A;  1VQH A;  4GLV B;  1JT8 A;  3MXN B;  1K83 H;  1X55 A;  5IYB G;  2ID0 A;  5C0X G;  4XIG S;  3NBH B;  2K14 A;  1PA6 A;  1EOV A;  1N34 L;  1FJG Q;  4JI6 L;  1PV4 A;  1VQN A;  2VNU D;  2RCN A;  2IHE A;  1SLJ A;  2NN6 I;  2LSS A;  1HZA A;  4DR7 Q;  5K36 G;  2F3I A;  1D8L A;  1Q1E A;  2VW9 A;  2N78 A;  1S40 A;  3S15 H;  2UXC L;  4A3K H;  4IPH A;  4RG1 A;  3G4S A;  2UUC Q;  4LF7 Q;  1J5E L;  2WAQ G;  3ZJY C;  2QEX A;  4JG2 A;  2QA4 A;  4HIK A;  1SFO H;  4OO1 G;  5M5W H;  3RZO H;  1PFS A;  4NPS A;  3CCS A;  4DR5 Q;  1I3Q H;  1VQ9 A;  1PH5 A;  5HY6 A;  2CWA A;  1KXL A;  4IOA A;  3HFZ B;  1K9M C;  4PZ6 A;  1JMC A;  2RHS B;  3S1M H;  1BBW A;  1ASZ A;  2E2J H;  4YCW A;  4KHP L;  4DPG A;  2EIF A;  5GAG C;  4LF9 L;  3GTQ H;  4GNX A;  2VS1 A;  3JC6 6;  1PHJ A;  1H95 A;  4JI6 Q;  2QGQ A;  3PO2 G;  1N8R C;  2R7Z G;  1U5K A;  4LFA L;  3ICE A;  1YEZ A;  3OW2 A;  1PVO A;  4P72 A;  1XMQ L;  2UU9 L;  4JBK A;  1HZ9 A;  4DV7 Q;  5C4X H;  4DR2 Q;  3T1H Q;  4JI7 Q;  3ER0 A;  4LFC Q;  3CPW A;  3DM3 A;  3HOZ H;  4DV0 Q;  4HJ8 A;  4R4Q A;  1I94 Q;  1VQI A;  1EIY B;  3K8A A;  4BY7 G;  1SRU A;  2NZO A;  3H15 A;  4AYB G;  4ME3 A;  4JI1 L;  2R92 G;  1SN8 A;  1G29 1;  4POF A;  4X65 Q;  2WAQ E;  3KJP A;  3U50 C;  4DV3 L;  1VQ7 A;  3T1Y L;  5FLM G;  1L1O C;  3D0F A;  3W1B A;  5HGQ A;  5IP9 H;  1QZG A;  3F2B A;  4WJ3 M;  4AQY L;  3PV0 A;  4X66 L;  4PZ7 A;  4L5R C;  1VQJ A;  2YU9 H;  2D0O A;  4OX9 L;  1QUQ A;  1XMQ Q;  1T9H A;  1VQE A;  1Q7Y C;  2OTL A;  3I4M G;  4JI8 L;  1CKO A;  1PH6 A;  1PH2 A;  1N36 L;  3K0X A;  4KLK A;  1TXY A;  2VY3 A;  5M3F G;  1AE2 A;  1LM0 A;  3BU2 A;  2K5V A;  4GKJ Q;  1VQC A;  5IY0 A; 
#chains in the Genus database with same CATH topology
 4CHT B;  2F0D A;  4JI0 L;  1YI2 A;  4A76 A;  4P2C B;  1XNQ Q;  2Q2H A;  4YY3 L;  3EBE A;  5C4H A;  2O4X A;  3I8Z A;  4AYB E;  4DV5 L;  2L11 A;  4LJZ C;  3K58 A;  2DNE A;  1A2T A;  3H94 A;  4KD4 A;  4RHR A;  4ME5 A;  1LTL A;  3EIV A;  3CC7 A;  3VDY A;  3AU7 A;  1B50 A;  4CKB A;  1W6K A;  1PLF A;  1STG A;  3DHQ A;  3VR5 A;  1WTO A;  2KHJ A;  5IE8 A;  2RF4 A;  3H0G B;  2UXB Q;  2QDB A;  3MWY W;  1D5Z C;  4A3D H;  1FVI A;  5EKK A;  5HGT A;  3C1E A;  1QNU A;  1ENC A;  1E22 A;  5J3B A;  4G57 A;  3PO2 B;  1PZI D;  4YHH Q;  1U4P A;  1YIJ A;  4V0B A;  2EY6 A;  4BA2 I;  4JI4 Q;  1KIX A;  1UE6 A;  4HJ5 A;  1JE5 A;  4G7O C;  3AFQ A;  2HQL A;  5JJL A;  2K01 A;  2IPK D;  1K3R A;  1EFW A;  2L0C A;  3VA7 A;  5ELE A;  3S9W A;  3A7A B;  2IX0 A;  4J6H A;  2NTS A;  1GJX A;  4ZRZ A;  3TRE A;  1YJ9 A;  5IIF A;  3I70 A;  3OOC A;  3A54 A;  1E7Z A;  2SNS A;  5JPN C;  4TQU S;  5IP9 G;  1KNA A;  3FVQ A;  4NB3 A;  3HOU G;  3H91 A;  2R7F A;  2H5X A;  2JA8 H;  2EXD A;  3CXC A;  4FXG C;  5IGF A;  1STH A;  4ZUI A;  4LWC A;  5E4W C;  2K04 A;  4HID A;  1KRT A;  1HUN A;  2RKS A;  2HT1 A;  2LMC B;  3P20 A;  3B6Y A;  1LTG D;  4DV6 L;  1II3 A;  2LKV A;  2F4V L;  1FL0 A;  1JR0 D;  3J81 j;  4A3C H;  4QF4 A;  4KKS A;  3NPP A;  3RLF A;  1L2F A;  1N34 Q;  2JA7 G;  1LTA D;  1JOR A;  4HSP A;  1SE3 A;  1DGS A;  2JYO A;  2RBM A;  1HA6 A;  3A5Z B;  2WII B;  3NQI A;  5A2Q E;  3S15 B;  2NVX H;  2KEC A;  2IW3 A;  2RCF A;  2WKD A;  1PFN A;  1J5E Q;  4ID6 A;  5CBE E;  2RA4 A;  1XTC D;  2VXW A;  4EVO A;  2LS0 1;  4IJH A;  2F0E A;  4X3U A;  4RGN A;  2VQE L;  4DV2 L;  4DV1 L;  3S1R H;  1BBU A;  1I3Q B;  3FMC A;  5J39 A;  4A3D G;  2Y0S G;  2C9O A;  2VNU D;  4O0A A;  4OEL B;  1B1Z A;  1HPC A;  4KHP Q;  3NBH A;  2G9D A;  3DEO A;  4K5V A;  4LW1 A;  5C0X I;  1RJT A;  3BZC A;  3OWE B;  2KOL A;  2V1C C;  5IOC A;  4YCV A;  4LFA Q;  5F2D A;  4POG A;  4IAL A;  4XT3 B;  4B9X A;  1KAB A;  1HR0 L;  2GN5 A;  5JEA H;  3VR2 A;  3CQZ H;  5CGK A;  2ES2 A;  4GKK L;  4A3G H;  2I5M X;  4K5X A;  2ICI A;  1E24 A;  1T5X D;  3U4V A;  2B2T C;  5JVH 3;  1GUW A;  4RWS C;  4KI0 A;  1I4P A;  4JI1 Q;  2ZTC A;  4RMF A;  2ZJR A;  5IYB H;  3CME A;  4DV3 Q;  1Q3L A;  4OEM B;  4ZCK A;  1I4H A;  2F0U A;  5K36 H;  3LGJ A;  2OQ0 A;  1LUZ A;  2RHQ B;  4OX9 Q;  4R8I A;  2NB0 A;  3GTK H;  2CQO A;  2PQA B;  1EFI D;  2JE6 I;  1VQO A;  1YHA A;  3Q6S A;  4H0L C;  1OO9 B;  5M3M H;  2F0W A;  1K28 A;  4H13 C;  1SNC A;  4OWT B;  3M4O H;  4BY1 B;  4DK3 C;  4JBM A;  2HIV A;  3J81 i;  4HIO A;  1FD7 D;  1XWE A;  1TWH B;  3KFU A;  4WJ4 A;  4A3C G;  1K8A C;  3V2T A;  1ZEQ X;  2BA0 A;  1OXT A;  1CZW A;  1I4X A;  1AEX A;  2KHS A;  2B2T A;  4BY7 H;  4IOC A;  2RSO A;  2IX1 A;  1IW7 C;  1O78 A;  1JIC A;  3O13 A;  4OXP A;  4DV4 Q;  1HQM C;  1TT2 A;  4L5S A;  1ZXT A;  3AYH B;  1G2T A;  2TSS A;  4C2M H;  3W3A A;  1NR2 A;  2PZW A;  1LT5 D;  1AN8 A;  2XWB B;  3GP7 A;  4PNY A;  1XMO L;  4MNO A;  4GNX B;  4JYA Q;  2EOT A;  2AUK A;  3G7L A;  3GTP B;  2DJG C;  5M3F H;  1KDA A;  4FVM A;  4DFA A;  1CKN A;  4TVA B;  4C1N I;  4A3G G;  2ZXR A;  1Y8P B;  1SJH D;  2ASB A;  2KUM A;  4HTH A;  4C3J B;  4RFB A;  2K28 A;  3IFD A;  4OIJ A;  2UUB Q;  3WWV A;  1ILP A;  5D65 A;  2KBN A;  3ERO A;  4RA8 A;  1J6Q A;  3S24 A;  1XMO Q;  5BN4 A;  5GRO A;  4N9T A;  1XYI A;  1LYL A;  3GTL H;  1DD2 A;  1SMY D;  2EYO A;  1F2L A;  1CA6 A;  3TZD A;  5I4D A;  1UWV A;  3MXU A;  1KC8 C;  4DV0 L;  1Y1W G;  4FYD A;  3TSS A;  5FLX E;  5M3M G;  2XTI A;  4LNQ A;  1V1P A;  1X3E A;  4YIJ A;  2CWP A;  3S2D B;  2XNA C;  1EY0 A;  3I73 A;  1GUO A;  1IHZ A;  2NUC A;  2I5H A;  1CSP A;  1SBB B;  4KHZ A;  1HTL D;  2RDF A;  2AQ2 B;  3NE5 B;  1C7Y A;  1A0I A;  4H02 A;  5JOB A;  2K6A A;  1BCP B;  3HS0 C;  3SK8 A;  3I72 A;  5IGC A;  5M5Y H;  1I6H B;  5LMU L;  4B08 A;  5T1I A;  1TWF B;  1VQL A;  3VA5 A;  3L3O C;  1V1O A;  1H9J A;  2MPM A;  4GKJ L;  4QL5 A;  1M90 C;  3D4W A;  2NYZ D;  1KQS A;  5AFW A;  3CCE A;  3HOX B;  1MSH A;  2D2C C;  4GN3 B;  1OXU A;  3MEF A;  2D0P A;  1TS3 A;  1EL0 A;  1NMF A;  1E1T A;  1Z47 A;  1QB5 D;  3CCM A;  2B2W C;  2VZA A;  3UDI A;  3RN5 A;  4DR3 L;  5LMU Q;  1HNX L;  3JAM E;  4Z9C B;  3K80 C;  4OO1 H;  2J7Z A;  1JWS D;  1S3O A;  3K5O A;  3I2Z A;  4K8J A;  2GVA A;  3DM1 A;  3H0G H;  4K2L A;  1SNP A;  1E3P A;  5J22 A;  3UDG A;  3BYY B;  5LHY 1;  1HNZ L;  1B3A A;  3DWQ A;  3PO2 H;  2YTV A;  4ULL A;  3E0J A;  1EIG A;  1YBY A;  4Q5V A;  4TSS A;  3K0Y A;  1SE2 A;  3JAM i;  1VQ8 A;  2NVY B;  4NXN L;  4J8Q A;  1D1K A;  4JI2 Q;  3GTO B;  1BDO A;  3NTK A;  5KEE A;  1PH1 A;  2KEE A;  4RGO S;  4UDU C;  4RGM A;  4DK6 C;  1TKW B;  5FLM H;  2DY7 A;  2A6E C;  1PRT D;  2C35 B;  1WTX A;  2B2W A;  2JA6 G;  3E9I A;  4DNT B;  4RKL A;  1FJG L;  5KRU A;  1PTO D;  4LF5 L;  1STA A;  3OHX C;  3QOL A;  1F2M A;  1A3V A;  4TKO B;  2E5L Q;  4B9W A;  5C3E G;  2D9U A;  1U4L A;  4AYB B;  4K6D A;  4GN4 B;  3RLN A;  2KCT A;  3OTO L;  3MHB A;  2XRS D;  5AJ3 L;  1HH2 P;  1X6O A;  5ELC A;  1VQH A;  4KY6 A;  3S1N B;  3KBG A;  1X55 A;  4L6T B;  2ID0 A;  3NBH B;  1FJG Q;  1VQN A;  1EOV A;  3FRP B;  2RCN A;  4DR7 Q;  2LSS A;  2F3I A;  2KCN A;  3RMH A;  1Q1E A;  1RD9 D;  2N78 A;  3S15 H;  4FF1 A;  1VMC A;  4WRD A;  2ZT9 C;  4HIK A;  4JG2 A;  4OO1 G;  1RTN A;  3CCS A;  1I3Q H;  4HR7 B;  3OPO A;  5HY6 A;  1ML0 D;  3K59 A;  4IOA A;  3HFZ B;  2PW7 A;  3SVM A;  4PZ6 A;  1JMC A;  5KNC A;  4HCE A;  3KLS X;  1WVL A;  2NN6 H;  3BVZ A;  3JC6 6;  3PO2 G;  1N8R C;  1U5K A;  4DF7 A;  1F77 A;  4K2K A;  1YEZ A;  1TY0 A;  3OW2 A;  3N52 A;  4P72 A;  2UU9 L;  4JBK A;  3T1H Q;  2R3Z A;  4LFC Q;  3D3R A;  4KKT A;  3V05 A;  4HJ8 A;  2Z6B A;  2R92 G;  1SN8 A;  1YNN D;  4F7X A;  2CH4 W;  1HCZ A;  3HRZ C;  3NSW A;  2X6L A;  1EIH A;  2WAQ E;  2BE5 D;  5BN3 A;  1TWC B;  4RCN A;  5FLM G;  4A3F B;  4KV6 A;  2IWH A;  3EJI A;  1K0S A;  2Z9H A;  1A6X A;  2F0P A;  1T9H A;  1VQE A;  5DEH A;  2Z8L A;  1EY8 A;  1N36 L;  1JWU D;  1AE2 A;  1QWY A;  1LM0 A;  3BU2 A;  2K5V A;  1E2V A;  4BY1 H;  1O7L A;  2KHI A;  3D4D A;  3W5O A;  2J4X A;  1H9S A;  4HSV A;  4O2D A;  4RGT A;  2JXM B;  1TWH H;  3KOJ A;  2NVQ B;  2B63 B;  1XNR L;  1EU4 A;  4DXF A;  3HG9 A;  1BBX C;  1QG7 A;  4LF4 L;  4C56 C;  1IBK Q;  2HHH Q;  1Q46 A;  4L5T A;  3CAM A;  4X3S A;  4BBR G;  1CKM A;  4X62 L;  3T13 A;  1UAP A;  1CKN B;  3I4L A;  3HOW G;  3L0O A;  3I3C A;  2UXD Q;  2VUM B;  3J7A F;  1MBY A;  1BQQ T;  1YIT A;  1FNV A;  4QCL A;  4Y52 H;  2Q2I A;  2AQ1 B;  2R7Z B;  5CR3 A;  2BH2 A;  1G6Z A;  4B3T L;  1CFM A;  3T56 B;  1P8L A;  1UE1 A;  3OWF A;  4C3I G;  3GTP H;  1J8I A;  1X54 A;  2PNR C;  4OL7 A;  2N88 A;  3A7L A;  2MFI A;  3EVQ A;  3MTS A;  3GTM B;  4C3J H;  2K50 A;  1V1P B;  2L5T A;  4QGU A;  1IKM A;  1CUK A;  5IWA L;  4A3M G;  5CBA E;  2QIL A;  4RKB A;  4IJL A;  3ULL A;  3V96 A;  5IGB A;  1RKN A;  4HJA A;  4JC0 A;  3VR6 A;  1A62 A;  1YHB A;  3R2I A;  4RH6 A;  1STN A;  4B3T Q;  4PMC A;  4KY7 A;  1XXG A;  5TSS A;  1B3Q A;  1SEB D;  3PO3 B;  4BA1 I;  1QJO A;  4LFB L;  1BCP F;  2SNM A;  2ATW A;  3S2D H;  2A69 D;  1VF7 A;  3KLR A;  1HFG A;  3L9A X;  3HKZ G;  2FXQ A;  4BY1 G;  4A3E G;  5IWA Q;  1RHP A;  2I07 B;  3IAY A;  3CP0 A;  1JQY D;  1NMG A;  1QVF A;  1PYW D;  3KF6 A;  4DAY A;  1EYA A;  2PI2 E;  3TDQ A;  1JOK A;  1VF5 C;  2SOB A;  4EQ5 A;  5FLX c;  2HIX A;  1I6H H;  3CMA A;  2UXC Q;  4A3K B;  1TWF H;  4K14 A;  4LFB Q;  1AE3 A;  1EOT A;  4XYO A;  1DJR D;  1SFO B;  1PH3 A;  1VQD A;  1Q8K A;  1WJJ A;  4MZ9 A;  4EX5 A;  4IUP A;  5CC4 A;  3A8I E;  1SR3 A;  1GKH A;  1NJI C;  1K0R A;  2H1E A;  5NUC A;  1MSG A;  2QW7 A;  4MHE A;  2CCZ A;  2E2J B;  3QJY A;  2K5D A;  2I0Q A;  2R61 A;  2VL6 A;  2EY2 A;  1EQV A;  1I4Q A;  4IUT A;  3RR5 A;  2E8G A;  1HNW L;  2JK8 A;  3K5M A;  1YVC A;  3FDT A;  1VQM A;  3G6E A;  1K73 C;  4E6I A;  4OO1 I;  2XRQ D;  2BH8 A;  1SYC A;  2RQX A;  2B2V C;  1AFP A;  2ENB A;  2K5Q A;  2F52 A;  1LV9 A;  3MVV A;  1FGB D;  5JJI A;  5C5L A;  1SRO A;  1GVP A;  2DN8 A;  5EAY A;  4AQY Q;  4X66 Q;  1ESR A;  5C44 H;  1NNX A;  3JAM c;  1SMX A;  4F87 A;  2NVY H;  5FOB B;  3GTO H;  1W6J A;  4CDC C;  1A63 A;  1SMY C;  4JI0 Q;  2Z1C A;  1D6E C;  2FJ2 A;  3Q8D A;  3SR1 A;  2AWN A;  4L8J A;  4YY3 Q;  3FEW X;  1SE4 A;  4DV5 Q;  1OXS C;  4R1J A;  4GOP C;  3D4R A;  4YWM A;  1STY A;  5C6A A;  3TP6 A;  3DEP A;  1S4Z A;  3RLO A;  2PI2 A;  2OXP A;  3I4O A;  1D2B A;  2H4O A;  3CPF A;  4FDB A;  1VS0 A;  2B2V A;  4HED A;  4LUZ A;  3OYY A;  3C46 A;  4QJF A;  2P5Z X;  1B9N A;  4R4I A;  1IXR A;  2VB3 X;  3K81 C;  3STB D;  1N33 L;  4TRD A;  4KN7 C;  5IGG A;  2Q2T A;  3AMU A;  2QCP X;  3S1N H;  4IFD J;  1VQ4 A;  5I2X A;  5H1S E;  2F0L A;  2WFW A;  2C5C A;  3H3V C;  4G7Z C;  2NZ1 D;  2X6G A;  3E6Z X;  1LTR D;  2A74 C;  3VR3 A;  2NVT B;  1QIL A;  1VMP A;  2UUC L;  4LF7 L;  1WCM B;  2JA9 A;  4CJ1 B;  1U9R A;  4IPC A;  4NXM L;  5IP7 H;  1KHI A;  4DR5 L;  5LL6 X;  2JA5 B;  5JJK A;  2F0S A;  3R2T A;  1H9R A;  3DWA A;  4HJ7 A;  4NDX A;  1KD1 C;  3IKJ A;  4XT1 B;  4KTA A;  3IL8 A;  3KYH C;  2F0Q A;  4DU9 A;  4GOP A;  5EBD A;  3N6R A;  3EN2 A;  1DOK A;  5C5M A;  1NR4 A;  5C44 G;  3GD7 A;  2OCE A;  1Y1V B;  1MJC A;  5I2Y A;  4DV7 L;  4JI7 L;  2E2I B;  1CM9 A;  4DK1 A;  1MKH A;  1V43 A;  2Z4I A;  3S14 B;  2K52 A;  5EPK A;  3Q24 A;  1I94 L;  4LUO A;  1VQG A;  2NTT A;  4NXM Q;  5IYD H;  5DLQ E;  5ELF A;  2YV5 A;  3TP8 A;  5C4Z A;  4DV6 Q;  4X6A H;  1H9S B;  2F4V Q;  1TWC H;  2F0H A;  1RIP A;  1BKB A;  4A3F H;  1F9P A;  2BA1 A;  2CH4 A;  4OIK A;  4ALP A;  2CFM A;  2K75 A;  4FNF A;  4HCS A;  2Q8I B;  1B9M A;  4FF3 A;  1QZH A;  2OTJ A;  4YWK A;  1PRT C;  3S16 H;  1T5E A;  4JVZ A;  4JV5 L;  2VQF L;  2MNA A;  1PTO C;  3HEJ A;  3X3M A;  3EFX D;  1XTD A;  2VQE Q;  2B2U C;  3QG1 A;  1VDZ A;  4DV1 Q;  4DV2 Q;  4Y7N B;  2B39 A;  2KQ3 A;  3U9S A;  1CT1 D;  2RDH A;  4N9P A;  2NVQ H;  1R9T B;  2B63 H;  2LXJ A;  3J81 E;  2PO4 A;  3NP8 A;  4DUY L;  3PF4 A;  2HDL A;  3M3Y B;  3EQL C;  3UI2 A;  5DM6 3;  2MUY A;  5A2Q L;  3HOY B;  5JPM C;  4B3R L;  1X56 A;  1MJE A;  2B2Y C;  1PH4 A;  5DM7 3;  1HR0 Q;  2MP1 A;  5I6W A;  5FK9 C;  2JA8 G;  2O5I C;  4GKK Q;  1UE5 A;  3F2C A;  4LF6 L;  1BO0 A;  4AIM A;  2VQF Q;  2DNC A;  3GQB A;  2ICE C;  2ZM6 L;  4MTK A;  2EYH A;  4A3I B;  2PPB C;  4C3H B;  5IP7 G;  3NXW A;  4JPB W;  1SSO A;  2DUD A;  3T53 B;  3P7J A;  4APV A;  1XPU A;  3SDZ A;  3PIP 3;  2N3S A;  1S72 A;  2XGT A;  2K4K A;  3NEL A;  5E7N A;  2R7Z H;  1U0L A;  4DKA C;  1O7Z A;  1P16 A;  1EZ6 A;  1AZQ A;  1B7Y B;  2KJX A;  3DWP A;  2WAQ B;  1EWI A;  3MXG A;  3BVM A;  3RZD B;  2B2U A;  3GTM H;  1FGU A;  1G51 A;  3J81 L;  4ZQ3 A;  4OWX B;  5IYD G;  1LT4 D;  1HZB A;  1JOQ A;  1VQ6 A;  3CHB D;  4YWL A;  1W3S A;  3TP5 A;  1GHK A;  1WI5 A;  3KF6 B;  1Q8I A;  4DAY B;  1MGS A;  4L63 B;  4XDX A;  3I4N B;  4A3F G;  1YNN C;  4R8N A;  2B2Y A;  3PSI A;  1UE7 A;  4QMG A;  2WB1 E;  4JK1 C;  2BE5 C;  3GDE A;  5C3W A;  1V1Q A;  3CCV A;  5LMN W;  3PO3 H;  1I4G A;  1A2U A;  2FMC A;  5JEA G;  3UDF A;  3S2H B;  5G3L D;  1EY6 A;  1GO3 E;  5IYC H;  1BVS A;  1SNQ A;  2A68 D;  5IT9 E;  1Y14 B;  4A93 B;  5IYB G;  4XIG S;  1PV4 A;  2IHE A;  1SLJ A;  3PIO 3;  3MAQ A;  3I4M B;  5K36 G;  2Q8T A;  3I90 A;  1Z6H A;  4ABN A;  2CVR A;  4A3K H;  2HCC A;  4RG1 A;  2M9V A;  1GHJ A;  2QEX A;  2QA4 A;  1SFO H;  5I9O A;  5FKA C;  1PH5 A;  5CV6 A;  3DMU A;  1KXL A;  2DY8 A;  4H7B A;  1NCV A;  1TY2 A;  1BBW A;  2DJF C;  1HQR D;  2E2J H;  4LF9 L;  2VS1 A;  1HXY D;  1U4M A;  3WOF A;  2EJG C;  4WOR A;  2R7Z G;  3E5S A;  3ICE A;  2PZU A;  1IL8 A;  4DV0 Q;  4PMB A;  1VQI A;  1EIY B;  4BY7 G;  1LAB A;  1X3P A;  3KJP A;  4DXG A;  5FO7 B;  2FFK B;  4DNR B;  3T1Y L;  2E2H B;  1L1O C;  2K33 A;  3D0F A;  3W1B A;  4CDE C;  1RF2 D;  5C4J B;  3P1H A;  3F2B A;  1TS5 A;  4WJ3 M;  1GUG A;  3PV0 A;  5COY A;  4PZ7 A;  3J80 E;  1BNZ A;  2D0O A;  5FLX L;  4ZYS A;  1Q7Y C;  1KLU D;  4JI8 L;  1CKO A;  1PH6 A;  1PH2 A;  2MHV A;  2J0T D;  1TXY A;  2VY3 A;  5M3F G;  4GKJ Q;  3CC4 A;  2EZV A;  1MD2 D;  5IY0 A;  1EEF D;  5BN5 A;  2UUA L;  1SND A;  2L15 A;  3FPP A;  4RHS A;  3T1Y Q;  2IT1 A;  3J80 i;  1M4V A;  5FJ8 H;  2A69 C;  2F0K A;  2JQO A;  3HOU B;  2KCM A;  1Q1B A;  5FO8 B;  5JVG 3;  1IBM L;  1WFQ A;  3U4Z A;  3T4A C;  4DR3 Q;  4CKE A;  3A74 A;  2ZTD A;  1UUP A;  4M8A A;  4IN3 A;  5ELN A;  3QB3 A;  4DK0 A;  1HNX Q;  3RD4 A;  3T16 A;  1G2S A;  2LFN A;  3CCJ A;  4IUU A;  2EYP A;  2EJM A;  1X3Q A;  1L1O A;  1S5B D;  1JB7 A;  1EYG A;  3PUZ A;  1LLR D;  1PFB A;  4LUV A;  3MZ5 A;  2JA7 B;  1HNZ Q;  1Z7T A;  4GOP B;  2NZH A;  1Q82 C;  2NVT H;  3GTG B;  3JAM L;  4LF8 L;  2R6G A;  5E1F A;  1I50 B;  2BOS A;  2A6H D;  4NXN Q;  1WTP A;  4PMW A;  3RUZ A;  4DAV A;  1WCM H;  3OMG A;  4EGV A;  3KF8 A;  3SEB A;  2EYL A;  4DR4 L;  1TWG B;  2F0G A;  2JA5 H;  2EXZ A;  3CF5 A;  3PUX A;  1LTB D;  4A3D B;  3WOE A;  1F9S A;  1X9N A;  2OWO A;  2K32 A;  2QEJ C;  1SE8 A;  1EY4 A;  5GAD C;  4DR1 L;  5DAU A;  1FNU A;  2AHO B;  1B8A A;  1PFM A;  1WTW A;  5ELO A;  3DUZ A;  2RDG A;  4LF5 Q;  1Y1V H;  2E2I H;  1EYD A;  1QNK A;  1Y8N B;  4KMU C;  5COR A;  1V8Q A;  3S14 H;  1C4Q A;  4YCU A;  3BDL A;  3TS2 A;  1JC7 A;  5GAH C;  2OQK A;  4A3J B;  1PZJ D;  3OTO Q;  5ELB A;  4HAE A;  2OF1 A;  1GUT A;  5AJ3 Q;  3H0G G;  1WOC A;  1F2Y A;  2EJF C;  4DR1 Q;  2CW0 C;  1EU3 A;  1C8C A;  2PMZ E;  4PZ8 A;  2AKW B;  1N32 L;  4CGY B;  3CW2 C;  3R3O A;  4IPG A;  4L5Q A;  3R8B A;  4XQJ A;  5FJ8 G;  4MN3 A;  5IGE A;  4LMQ D;  2LY7 A;  1B4O A;  3I91 A;  4B3S L;  4DUZ L;  2ZTE A;  1L0Y B;  2N8N A;  1LTI D;  3U58 A;  1NE3 A;  3CCR A;  4X3T A;  1K8M A;  4FXK C;  5KYL A;  4JBJ A;  3CD6 A;  1EZ8 A;  1HRJ A;  3PQI A;  2Q2U A;  4GZY C;  4Y7N H;  1LTS D;  2IJ0 A;  2XN9 C;  1SYD A;  4XQQ A;  1KNE A;  3MXN A;  3TQY A;  1IBL L;  5CV5 A;  3QIA A;  2I46 A;  3S1M B;  3M4Q A;  4K0K L;  3HKZ E;  1WYD A;  3M3Y H;  3GTQ B;  4KJN A;  3QOJ A;  4CJ2 C;  2HQE A;  2NWG A;  3LWU A;  3STB C;  3HOY H;  5DNF A;  1PH7 A;  3SXH A;  3ULJ A;  1PRT B;  4CBV A;  2UU9 Q;  2RSN A;  5L37 A;  4ILW A;  3PUW A;  4KJO A;  5CYU A;  4NMZ A;  5C4X B;  3NEN A;  2A1A A;  1WD1 A;  1PXU A;  1DZ1 A;  3HOZ B;  1PTO B;  1WCM G;  4A3I H;  3J81 c;  4C3H H;  4OHJ A;  2JA5 G;  3OIQ A;  2EPB A;  4K0K Q;  1LT6 D;  3BZK A;  4FF2 A;  5LMN L;  2O2L D;  3R93 A;  1O80 A;  4PV1 C;  1JWM D;  1CK1 A;  4A4I A;  1SYE A;  1WTR A;  1CQF A;  1KRS A;  1BOS A;  1A3T A;  1N36 Q;  3RZD H;  1H9M A;  1DXM A;  1UNS A;  5CV4 A;  4HMJ A;  4IFD H;  2VB2 X;  1GM5 A;  1D7Q A;  3LX0 A;  2F0I A;  1S5D D;  1QCB D;  4A3L H;  1XNR Q;  1HHV A;  5IOD A;  1TU2 B;  4S3S A;  1B70 B;  3I4N H;  3TME A;  4G7H C;  2NN6 G;  4LF4 Q;  4UHV A;  3U9O A;  2Q8R E;  1Y1W B;  3MXP A;  4X62 Q;  4X64 L;  4HN7 A;  5CV9 A;  3S2H H;  1PMR A;  2F0M A;  4IPD A;  3W1G A;  3KDF A;  3MFY A;  1HR0 W;  3KJO A;  4DAM A;  2CHB D;  4R4O A;  2EQS A;  1E2W A;  3HOV B;  3C1F A;  4A93 H;  2M2L A;  1NY4 A;  3NTI A;  4KY5 A;  3TBI B;  3I4M H;  3FKI B;  1JJG A;  3NQT A;  2AWO A;  1YNJ D;  4JI3 L;  4BBS B;  2K05 A;  1STB A;  1X3G A;  3SHL A;  3GO5 A;  5IT9 c;  4QIW E;  3K6O A;  5EBC A;  5FO9 B;  4A3I G;  1IL2 A;  3FHW A;  3KBX A;  1PH9 A;  4KHV A;  3ND8 A;  4UAI A;  3RNU A;  1G6P A;  1NSN S;  1SYG A;  4U68 A;  2QKI C;  3J7A V;  2F0O A;  2EE1 A;  4GLA C;  5C3X A;  3PUY A;  4DR2 L;  1J9O A;  2F0F A;  4JI3 Q;  5JAV A;  2PNH A;  3A8J E;  3IRB A;  1G91 A;  2HUG A;  1YJN A;  2SEB D;  2YYZ A;  2BCO A;  3S17 B;  1KDC A;  2WB1 B;  4X65 L;  2L12 A;  3HOX H;  4IFD G;  1F2Z A;  1K8O A;  1S5C D;  2E2H H;  2F4I A;  2F03 A;  5C4J H;  2RVL A;  4B3M L;  4A3L G;  3K5L A;  2F0V A;  3NK9 A;  5CV8 A;  3I4N G;  3NEM A;  3P75 A;  1MIU A;  1NTG A;  5KNB A;  4N8F A;  1SDF A;  4RAU C;  3M7N A;  1TS2 A;  4JBW A;  2CKZ B;  1K8G A;  1HZC A;  1YZ6 A;  2IHF A;  3A0J A;  4C3J G;  3J7A 5;  4P73 A;  4A3B B;  3J80 c;  1XNQ L;  1L1O B;  2JA6 B;  4B3M Q;  1QE6 A;  4ZKC B;  3HOU H;  4IUR A;  2WIN B;  3PF5 A;  4A93 G;  4P75 A;  3QR8 A;  3ONA B;  2F1M A;  2A68 C;  1DCZ A;  2Y0S E;  4FO2 A;  1XJV A;  3PGZ A;  5M5Y B;  2AUJ D;  2YTY A;  5IGD A;  1V9P A;  1S5E D;  3M7G A;  1MHW C;  2BDN A;  5C3E B;  2EYJ A;  4KN4 C;  5KGU A;  3G71 A;  1HNW Q;  2R93 B;  2CW0 D;  3C2P A;  4FF4 A;  4QY7 A;  1VQB A;  3S1Q B;  1EY7 A;  1B44 D;  2F3V A;  1S5F D;  3KF8 B;  3D6C A;  2UXB L;  1R4Q B;  3GV6 A;  4OGQ C;  4GS3 A;  2AMC B;  4KK7 A;  1IYU A;  3PUV A;  2JA7 H;  4UP7 A;  3MFG A;  1JE4 A;  4YHH L;  4OON A;  5C0X J;  4O42 A;  4JI4 L;  1U4R A;  3GTG H;  2ALY B;  3A8K E;  2NBF A;  4BS9 A;  5K5P A;  3C3L A;  1I50 H;  3EA6 A;  1ROD A;  2K5H A;  1DOL A;  3M4P A;  3M9B A;  4U67 3;  4DAP A;  3LWE A;  1DM0 B;  2G9H D;  1TWG H;  2K5N A;  1Q81 C;  4GLX A;  1AH9 A;  4IQZ A;  2JSO A;  4EQP A;  5M5X B;  3HOX G;  5CV7 A;  4J15 A;  1IYV A;  1M8A A;  4ZLT F;  3H3V H;  5LL6 S;  2XVS A;  1TWA B;  4NKL A;  3ZYY X;  2DGY A;  3VYT A;  1M1K C;  5D3D A;  3K7A B;  1C0A A;  3KLW A;  1YHQ A;  1EY5 A;  2R92 B;  4A3J H;  3F2D A;  3A55 A;  2MJ8 A;  1JB3 A;  2F0T A;  1CSQ A;  1N33 Q;  1VQP A;  4GLV B;  1JT8 A;  3K57 A;  3MXN B;  1AW7 A;  3BYT B;  3T51 B;  3CRK C;  1N34 L;  5A35 A;  4Q0F A;  2KA7 A;  1B2T A;  2NN6 I;  1HZA A;  3BG3 A;  1D8L A;  2VW9 A;  1EQT A;  1S40 A;  2UUC Q;  4LF7 Q;  1RCV D;  1J5E L;  5KND A;  2EVB A;  1PRT F;  1LT3 D;  1GUS A;  1PFS A;  2K7V A;  4NPS A;  4DR5 Q;  3MC0 B;  1PTO F;  1TQO A;  2CWA A;  5CMD A;  1K9M C;  3S1M H;  2RHS B;  4KHP L;  4YCW A;  2EIF A;  2E74 C;  3GTQ H;  1PHJ A;  1H95 A;  2QGQ A;  4LFA L;  4BBR B;  1PVO A;  1XMQ L;  3QWN A;  4JI7 Q;  4DV7 Q;  5C4X H;  3SK4 A;  1FR3 A;  3CPW A;  3HOZ H;  3HOW B;  1PTO H;  3LNN A;  3MA2 B;  4R4Q A;  1I94 Q;  3CRL C;  3K8A A;  4PQX A;  4IUV A;  1SRU A;  2NZO A;  3H15 A;  4AYB G;  4JI1 L;  3QO2 A;  2A6H C;  4POF A;  3SE0 A;  3U50 C;  4DV3 L;  5I9P A;  3NTH A;  3J7Y W;  5HGQ A;  1QZG A;  4CKC A;  2PW5 A;  4C3I B;  3ND9 A;  1VQJ A;  5JJZ A;  4OX9 L;  2D5D A;  2E76 C;  1QUQ A;  1XMQ Q;  1DYQ A;  2OTL A;  1ILQ A;  1EY9 A;  1BF4 A;  2XWJ B;  3DXJ C;  4K8I A;  1GXD C;  3K0X A;  2PMZ B;  4X3K A;  2EY5 A;  4RCO A;  4JV5 Q;  1A15 A;  4LAA A;  4A3M B;  4A3J G;  3RN2 A;  2VUM H;  4ZUJ A;  1O7Y A;  3KDF B;  3CU7 A;  3SGI A;  3URY A;  4ODG A;  5EPL A;  1EWC A;  3A56 A;  3CC2 A;  4IFD I;  4LK1 C;  3ITP A;  4DUY Q;  3BS1 A;  4NP5 A;  4R4C A;  3SK5 A;  4DGZ A;  1PDQ A;  2GVB A;  4B3R Q;  2IY5 B;  1Y1W H;  4HJ9 A;  3Q0A A;  1Y8O B;  3K5N A;  1N9W A;  4I7Z C;  4LF6 Q;  2PZT A;  3HKZ B;  4A3E B;  3X3N A;  4DV4 L;  2ZM6 Q;  1TII D;  1ENF A;  1EUJ A;  4DA2 A;  1Q90 A;  1HJP A;  1BCP D;  1OXX K;  3FP9 A;  3HOV H;  1K3B C;  3MEH A;  1E0B A;  1TR5 A;  4JYA L;  3FKI H;  1X32 A;  1XPO A;  3GTJ B;  4I7A A;  1SYF A;  1ZYR D;  4BBS H;  4EQO A;  5C4X G;  2JN4 A;  2BDO A;  5J1Z A;  2A8V A;  3HOZ G;  4QB4 A;  3GV3 A;  4BXX H;  2K1B A;  2UUB L;  2A73 B;  4UP8 A;  4HIM A;  3J7Z C;  1QOH A;  3PMF A;  3TRZ A;  1JCK B;  1SAP A;  2B63 G;  3PIP A;  2PCF B;  4XXE A;  3UE0 A;  2F0J A;  2ZXP A;  3BDO A;  4J1M A;  4M1U B;  3BJU A;  3I56 A;  3I55 A;  4WJW A;  1GD7 A;  5EGT A;  2X69 A;  3UDX A;  3S17 H;  1WTQ A;  2FHT A;  1VCI A;  3UE1 A;  1KAW A;  1ET9 A;  1W2B A;  2VUM G;  3L7Z C;  3D31 A;  1C48 A;  1D5X C;  1K83 B;  2E75 C;  1ENA A;  2ZXO A;  2XSC A;  1SJE D;  2HCI A;  2MGS A;  5EJW A;  3A5U A;  4PG3 A;  1X65 A;  1HTP A;  1SXT A;  1YNX A;  4BWG B;  4QQB X;  1SNO A;  1D1I A;  1ZKO A;  3OW7 A;  5IT9 L;  1QVG A;  5M5W B;  1EYC A;  1UEB A;  3RZO B;  3H09 A;  2G5D A;  4HMI A;  4A3B H;  2JA6 H;  4LF9 Q;  1Q86 C;  3HOV G;  4DNI A;  5ISR A;  2D62 A;  1R4P B;  4QIW B;  3TZU A;  2B3G A;  3PIO A;  1EWH A;  4JOI C;  4KKU A;  2EDG A;  3FKI G;  3VYR A;  1MI2 A;  4P74 A;  5C3E H;  4BBS G;  2R93 H;  2TMP A;  3PO3 G;  3S1Q H;  2HD3 A;  2OEO A;  4BXX G;  1F9Q A;  1YNJ C;  5IYC G;  2M00 A;  2ZJQ A;  1XX8 A;  1QVC A;  3NWS A;  2YU9 B;  2A19 A;  1WD0 A;  1PYB A;  1YJW A;  1BXT A;  2WKC A;  4JI8 Q;  1EQR A;  4JI2 L;  4DN4 M;  5D14 A;  1LO5 D;  5KYI A;  4A3K G;  5JEA J;  5E3F A;  4UP9 A;  2KVM A;  3D8G A;  1VQA A;  1EIF A;  4R9W A;  3E3X A;  2UUA Q;  4GN5 A;  4F8M A;  1SYB A;  3L2P A;  1E1O A;  2GA4 B;  3F8T A;  1VQF A;  4DR6 L;  1CTM A;  1H9K A;  2WB1 G;  5M5X H;  3J80 L;  2E2D C;  2MO0 A;  4JOI A;  2AQ3 B;  5C44 B;  1TWA H;  1DON A;  1IBM Q;  3H3V I;  3DLL A;  3CKI B;  1HA5 A;  3E9H A;  3VYS A;  3HGB A;  3K7A H;  5I6Y A;  2E5L L;  1IYJ B;  1CZG A;  2R92 H;  1X3F A;  3AFP A;  5KIX A;  5EKI A;  1C9O A;  5HUR A;  1FYC A;  4OWW B;  4DR6 Q;  2Y0S B;  3TS0 A;  2N49 A;  3E0E A;  4O1N A;  4ZAI A;  4C1N K;  1D5M C;  4A3B G;  4AH6 A;  2YTX A;  2EY1 A;  2Z0S A;  4K6L A;  2FMM A;  3BDC A;  4DR7 L;  1I5F A;  3KLS A;  3PCO B;  2KCC A;  3NHH A;  4LF8 Q;  1DOM A;  4V19 0;  2WV6 D;  4G4K A;  2JJQ A;  3M4Y A;  1ICF B;  5E4X A;  3HZX A;  1A3U A;  2QF7 A;  1A8V A;  3FPU B;  2R93 G;  3HKS A;  4DR4 Q;  3TP7 A;  1CI3 M;  2ZJP A;  4WFN 3;  1XPR A;  1F9R A;  2IL8 A;  2KED A;  1RTO A;  5T1G A;  1WTH A;  1BR9 A;  2PYK A;  4NW2 A;  3CCU A;  2O5J C;  1GUN A;  1JJ2 A;  4XQN A;  4BBR H;  4UPA A;  2JA8 B;  3T1H L;  1QUQ B;  1PYS B;  4LFC L;  3ERQ A;  3HOW H;  4IZ8 A;  1IZ6 A;  4F88 A;  1I6V C;  3NUC A;  4XTC S;  3KK7 A;  1ASY A;  5BR8 L;  5GQO A;  1OTC A;  3G48 A;  4CJ0 B;  1HFN A;  2EYM A;  4MTN A;  1R9T H;  1KDB A;  2WP8 J;  1N32 Q;  3CCQ A;  4FXD A;  1RL2 A;  4C3I H;  3VR4 A;  1IW7 D;  1Z9F A;  4I65 A;  3OSO A;  1IKL A;  1O7I A;  1NBW A;  2WAC A;  1ONL A;  4B3S Q;  4DUZ Q;  4CDF C;  4JW0 A;  3Q23 A;  2NVX B;  3VYU A;  1TVX A;  3D6W A;  2Z6K C;  4A3M H;  5BR8 Q;  3ULP A;  4JI5 L;  1Q12 A;  3S1R B;  1RDP D;  5GAE C;  4ZKB B;  2N55 A;  2I5L X;  1IBL Q;  4H44 C;  4A75 A;  5C0X H;  2Z4H A;  3NBI A;  1ESF A;  2MQH A;  2HDM A;  4K5W A;  5EKL A;  2LXK A;  1IBK L;  2HHH L;  3IFT A;  4ZK9 B;  3CCL A;  1JJC B;  1G8Z D;  3S16 B;  2FIN B;  1OXV A;  2K5W A;  1Y1V G;  3CQZ B;  4A3G B;  1WTV A;  4A3E H;  1UEA B;  3M85 A;  4UY8 C;  4R4T A;  1SNM A;  4JI5 Q;  2UXD L;  3TEH B;  3ERS X;  1CHP D;  3H6M A;  2MO1 A;  4IO9 A;  4P71 A;  3OIP A;  2F3W A;  5LMN Q;  1NAP A;  2A5H A;  3GTK B;  1VQ5 A;  3F1Z A;  3GTJ H;  3I7F A;  2R7D A;  1PZK D;  2Z6K A;  5M3M B;  2B29 A;  1VQK A;  3AEV A;  5D3I B;  3K7U C;  4N8X 1;  3M4O B;  2JEA I;  1BUV T;  2SDF A;  1EQQ A;  1PH8 A;  4JCV E;  2L4N A;  3BZD B;  2KEN A;  1L0W A;  2JEB I;  2PQA A;  4GNX C;  1KL9 A;  3HOY G;  3AQQ A;  3NWT A;  1B53 A;  1GOZ A;  4IUN A;  4BY7 B;  1LAC A;  2L55 A;  4X64 Q;  3Q22 A;  1FNW A;  1STE A;  2B8F A;  2F0N A;  1KLG D;  1AP0 A;  4C3H G;  2L9H A;  2JP1 A;  2EYF A;  3OMC A;  4C2M B;  3HP3 A;  2B8G A;  4CDD C;  4QUC A;  5EPJ A;  3G6J B;  1K83 H;  5C0X G;  1PA6 A;  2K14 A;  5ELD A;  4KD3 A;  4JI6 L;  3F2U A;  4IUQ A;  4XYQ A;  2UXC L;  5M3F B;  4IPH A;  3G4S A;  4EQN A;  1Y69 U;  3WDN A;  4QUF A;  2WAQ G;  3ZJY C;  5M5W H;  3RZO H;  5EQ0 A;  1EEI D;  2V4D A;  5M9O A;  1CQV A;  2L1B A;  1AZP A;  1VQ9 A;  2PQE A;  1ASZ A;  4DPG A;  5GAG C;  4GNX A;  4JI6 Q;  1ET6 A;  4MIU A;  5G3L F;  1L0X B;  3GTL B;  1BCP C;  3AB9 A;  1HZ9 A;  4DR2 Q;  3ER0 A;  3KUP A;  1I4R A;  2IX3 A;  1KAA A;  3DM3 A;  1LTT D;  2A6E D;  3TN2 A;  2OT2 A;  3W2D A;  4ME3 A;  1G29 1;  1ICW A;  1TS4 A;  4FP5 D;  1ZYR C;  1NUC A;  1CHQ D;  4X65 Q;  1VQ7 A;  1KTK A;  2XIW A;  5IP9 H;  4AQY L;  4X66 L;  4L5R C;  2YU9 H;  1E2Z A;  1JOO A;  3BVG A;  3SK6 A;  3I4M G;  2K03 A;  1HUM A;  4KLK A;  2CQA A;  2QDL A;  1CA5 A;  1VQC A; 
#chains in the Genus database with same CATH homology
 2KHI A;  2UUA L;  4A3J G;  3W5O A;  3RN2 A;  4JI0 L;  2VUM H;  4O2D A;  3KDF B;  3SGI A;  1YI2 A;  4A76 A;  1TWH H;  2L15 A;  3KOJ A;  3CC2 A;  4IFD I;  3T1Y Q;  1XNQ Q;  2IT1 A;  2Q2H A;  3J80 i;  1XNR L;  4YY3 L;  3EBE A;  5FJ8 H;  4AYB E;  4DUY Q;  2JQO A;  4DV5 L;  2KCM A;  1Q1B A;  4R4C A;  1IBM L;  4LF4 L;  1WFQ A;  3U4Z A;  1IBK Q;  2HHH Q;  1Q46 A;  2GVB A;  4B3R Q;  4L5T A;  3CAM A;  2IY5 B;  1LTL A;  4DR3 Q;  3EIV A;  3CC7 A;  3VDY A;  1Y1W H;  3A74 A;  2ZTD A;  5ELN A;  4BBR G;  4HJ9 A;  1CKM A;  4X62 L;  1HNX Q;  1N9W A;  4LF6 Q;  1CKN B;  2KHJ A;  3HOW G;  4DV4 L;  3L0O A;  5IE8 A;  2ZM6 Q;  3CCJ A;  2RF4 A;  2UXD Q;  2UXB Q;  1EUJ A;  4A3D H;  1FVI A;  1L1O A;  1YIT A;  1JB7 A;  1EYG A;  3PUZ A;  1HJP A;  1OXX K;  3FP9 A;  4LUV A;  1E22 A;  5J3B A;  4JYA L;  3HOV H;  4Y52 H;  1HNZ Q;  2Q2I A;  4YHH Q;  4GOP B;  1YIJ A;  2BH2 A;  2NZH A;  1Q82 C;  4B3T L;  4BA2 I;  3FKI H;  1KIX A;  1UE6 A;  1P8L A;  1JE5 A;  1UE1 A;  4HJ5 A;  4JI4 Q;  4LF8 L;  3AFQ A;  2NVT H;  3GTP H;  2HQL A;  1XPO A;  5JJL A;  2R6G A;  1X54 A;  4NXN Q;  4BBS H;  4PMW A;  5C4X G;  1WCM H;  1K3R A;  2A8V A;  2MFI A;  1EFW A;  3HOZ G;  4DR4 L;  4C3J H;  4BXX H;  2K50 A;  2UUB L;  4QGU A;  2JA5 H;  4UP8 A;  3CF5 A;  2IX0 A;  3PUX A;  1CUK A;  5IWA L;  3J7Z C;  4HIM A;  4A3M G;  1X9N A;  3TRZ A;  2OWO A;  3TRE A;  1SE8 A;  4IJL A;  1YJ9 A;  5GAD C;  4DR1 L;  3ULL A;  1E7Z A;  4HJA A;  4JC0 A;  1A62 A;  4TQU S;  3PIP A;  2AHO B;  2B63 G;  1YHB A;  5IP9 G;  1B8A A;  4B3T Q;  3UE0 A;  4NB3 A;  5ELO A;  3HOU G;  4LF5 Q;  2R7F A;  2H5X A;  1Y1V H;  2EXD A;  2E2I H;  2JA8 H;  3CXC A;  3S14 H;  3BJU A;  4BA1 I;  4LFB L;  3I56 A;  2ATW A;  3I55 A;  4YCU A;  3S2D H;  3TS2 A;  4LWC A;  5GAH C;  1GD7 A;  2OQK A;  1KRT A;  3UDX A;  4HID A;  3S17 H;  3HKZ G;  2FXQ A;  4BY1 G;  4A3E G;  2HT1 A;  3B6Y A;  5IWA Q;  1VCI A;  3OTO Q;  4DV6 L;  3UE1 A;  1KAW A;  1W2B A;  3CP0 A;  5AJ3 Q;  3H0G G;  2VUM G;  1WOC A;  3L7Z C;  1FL0 A;  1NMG A;  3J81 j;  4DR1 Q;  3D31 A;  3KF6 A;  1QVF A;  2F4V L;  4A3C H;  2PMZ E;  4PZ8 A;  2AKW B;  1N32 L;  2PI2 E;  3CW2 C;  4IPG A;  4L5Q A;  5FJ8 G;  3RLF A;  1L2F A;  1N34 Q;  2JA7 G;  1DGS A;  4EQ5 A;  5FLX c;  2HIX A;  4B3S L;  3A5U A;  1I6H H;  3CMA A;  3A5Z B;  4DUZ L;  2UXC Q;  2ZTE A;  1X65 A;  4PG3 A;  2N8N A;  2NVX H;  3U58 A;  1TWF H;  1NE3 A;  1J5E Q;  1AE3 A;  1YNX A;  3CCR A;  4LFB Q;  4QQB X;  1QVG A;  1UEB A;  4IJH A;  4JBJ A;  1PH3 A;  3CD6 A;  1VQD A;  2VQE L;  2Q2U A;  4DV2 L;  4DV1 L;  3S1R H;  1Q8K A;  1WJJ A;  1BBU A;  4MZ9 A;  4Y7N H;  4EX5 A;  3TQY A;  4A3B H;  1IBL L;  4A3D G;  2Y0S G;  1SR3 A;  1GKH A;  2JA6 H;  4O0A A;  1NJI C;  1K0R A;  3M4Q A;  2CCZ A;  4KHP Q;  3HKZ E;  4K0K L;  1WYD A;  4LF9 Q;  1Q86 C;  3M3Y H;  2I0Q A;  3HOV G;  4LW1 A;  5C0X I;  3BZC A;  4DNI A;  2VL6 A;  2V1C C;  2D62 A;  3STB C;  3HOY H;  2B3G A;  4YCV A;  4LFA Q;  3PIO A;  1PH7 A;  4JOI C;  4POG A;  3FKI G;  3ULJ A;  2UU9 Q;  3PUW A;  2E8G A;  3RR5 A;  1HR0 L;  2GN5 A;  3NEN A;  4P74 A;  3CQZ H;  5C3E H;  2ES2 A;  2A1A A;  4GKK L;  2I5M X;  4A3G H;  1HNW L;  2JK8 A;  4BBS G;  2R93 H;  1E24 A;  1YVC A;  1VQM A;  1WCM G;  3G6E A;  3U4V A;  3PO3 G;  3S1Q H;  4A3I H;  1K73 C;  4OO1 I;  2BH8 A;  4KI0 A;  3J81 c;  4C3H H;  4BXX G;  4JI1 Q;  2ZTC A;  2JA5 G;  4JV5 Q;  5IYC G;  4RMF A;  2ZJQ A;  2F52 A;  5IYB H;  3CME A;  2ZJR A;  4K0K Q;  4DV3 Q;  3BZK A;  5JJI A;  5LMN L;  1QVC A;  1SRO A;  1GVP A;  5EAY A;  3LGJ A;  2OQ0 A;  4AQY Q;  4X66 Q;  5C44 H;  1LUZ A;  4A4I A;  3JAM c;  2RHQ B;  1SMX A;  2A19 A;  4OX9 Q;  3GTK H;  1PYB A;  2CQO A;  2PQA B;  1YJW A;  2JE6 I;  2NVY H;  1YHA A;  1VQO A;  1KRS A;  4JI8 Q;  4JI2 L;  1EQR A;  5M3M H;  1N36 Q;  3GTO H;  3RZD H;  4A3K G;  4OWT B;  5JEA J;  3M4O H;  1A63 A;  4UP9 A;  4DK3 C;  1VQA A;  4JBM A;  2HIV A;  1EIF A;  3J81 i;  2UUA Q;  4GN5 A;  4JI0 Q;  3L2P A;  1E1O A;  4HIO A;  3F8T A;  1VQF A;  1GM5 A;  4DR6 L;  1D7Q A;  2WB1 G;  5M5X H;  3KFU A;  4WJ4 A;  3Q8D A;  4A3C G;  1K8A C;  4A3L H;  2AWN A;  1XNR Q;  4YY3 Q;  4DV5 Q;  1B70 B;  2MO0 A;  4JOI A;  3I4N H;  1OXS C;  2BA0 A;  1OXT A;  4R1J A;  1TWA H;  2NN6 G;  1IBM Q;  3H3V I;  4LF4 Q;  3DLL A;  4GOP C;  4YWM A;  3E9H A;  3K7A H;  3RLO A;  2PI2 A;  2E5L L;  4X62 Q;  1IYJ B;  4X64 L;  4IOC A;  4BY7 H;  3I4O A;  3S2H H;  2IX1 A;  3CPF A;  2R92 H;  1X3F A;  3AFP A;  4FDB A;  1VS0 A;  4LUZ A;  1C9O A;  4IPD A;  3OYY A;  4OXP A;  4DV4 Q;  4QJF A;  3KDF A;  3W1G A;  4R4I A;  1IXR A;  1HR0 W;  3K81 C;  3AYH B;  3STB D;  4L5S A;  4OWW B;  3KJO A;  1N33 L;  4DR6 Q;  4DAM A;  3TS0 A;  4R4O A;  2N49 A;  3E0E A;  4C2M H;  2Q2T A;  3S1N H;  4IFD J;  3PO2 H;  4AH6 A;  2YTX A;  2EQS A;  1VQ4 A;  4A3B G;  2Z0S A;  4A93 H;  5H1S E;  1NY4 A;  1XMO L;  4MNO A;  2WFW A;  4GNX B;  4DR7 L;  1I5F A;  3PCO B;  3I4M H;  4JYA Q;  1JJG A;  4LF8 Q;  2AWO A;  2JJQ A;  5M3F H;  4JI3 L;  2UUC L;  1CKN A;  4LF7 L;  4TVA B;  2JA9 A;  4A3G G;  1X3G A;  1A8V A;  2ASB A;  3GO5 A;  4IPC A;  5IT9 c;  3HKS A;  4QIW E;  2R93 G;  4DR4 Q;  4NXM L;  5IP7 H;  1KHI A;  4DR5 L;  4A3I G;  2ZJP A;  2UUB Q;  1IL2 A;  5JJK A;  3FHW A;  3WWV A;  1XPR A;  4HJ7 A;  2KBN A;  1PH9 A;  1KD1 C;  3KYH C;  3RNU A;  1J6Q A;  4GOP A;  3CCU A;  3S24 A;  1XMO Q;  1G6P A;  3EN2 A;  5GRO A;  1JJ2 A;  1LYL A;  3GTL H;  4GLA C;  4BBR H;  5C44 G;  3GD7 A;  2OCE A;  4UPA A;  1MJC A;  3PUY A;  4DV7 L;  4DR2 L;  3T1H L;  1QUQ B;  4JI7 L;  1PYS B;  4JI3 Q;  4LFC L;  1UWV A;  2PNH A;  1KC8 C;  4DV0 L;  1Y1W G;  3IRB A;  1MKH A;  1V43 A;  5M3M G;  3HOW H;  2XTI A;  1IZ6 A;  2K52 A;  4LNQ A;  1X3E A;  1YJN A;  1I94 L;  2CWP A;  4XTC S;  4LUO A;  1VQG A;  2YYZ A;  4NXM Q;  5IYD H;  5DLQ E;  1ASY A;  5BR8 L;  2YV5 A;  4DV6 Q;  5GQO A;  1OTC A;  3G48 A;  2I5H A;  4X65 L;  1CSP A;  3HOX H;  4X6A H;  4IFD G;  2F4V Q;  1TWC H;  4MTN A;  1R9T H;  1RIP A;  4KHZ A;  2E2H H;  2WP8 J;  1BKB A;  1N32 Q;  5C4J H;  4A3F H;  1C7Y A;  2BA1 A;  3CCQ A;  4B3M L;  4A3L G;  1RL2 A;  1A0I A;  4C3I H;  4ALP A;  2CFM A;  4H02 A;  1Z9F A;  2K75 A;  3I4N G;  3NEM A;  1MIU A;  1O7I A;  1NBW A;  4B3S Q;  5M5Y H;  1NTG A;  2OTJ A;  1QZH A;  4DUZ Q;  4YWK A;  5LMU L;  3S16 H;  1VQL A;  4GKJ L;  3M7N A;  4JV5 L;  2VQF L;  2MNA A;  4JBW A;  4QL5 A;  2CKZ B;  2Z6K C;  5BR8 Q;  1HZC A;  1YZ6 A;  3ULP A;  4A3M H;  2IHF A;  1M90 C;  1K8G A;  1XTD A;  3A0J A;  4JI5 L;  1Q12 A;  2VQE Q;  1KQS A;  4DV2 Q;  3CCE A;  4DV1 Q;  3J7A 5;  5GAE C;  4BY1 H;  1OXU A;  4GN3 B;  3MEF A;  2D0P A;  2I5L X;  4P73 A;  2NVQ H;  3J80 c;  1IBL Q;  1L1O B;  1NMF A;  2LXJ A;  1XNQ L;  4A75 A;  2B63 H;  1E1T A;  1Z47 A;  4DUY L;  4B3M Q;  3PF4 A;  3HOU H;  3CCM A;  2MQH A;  4A93 G;  3PF5 A;  4P75 A;  2LXK A;  1IBK L;  2HHH L;  4B3R L;  2Y0S E;  2VZA A;  3UDI A;  1XJV A;  3PGZ A;  4DR3 L;  1X56 A;  2YTY A;  3RN5 A;  1JJC B;  1MJE A;  3CCL A;  5LMU Q;  1V9P A;  1PH4 A;  1HR0 Q;  1OXV A;  1Y1V G;  1HNX L;  2JA8 G;  4GKK Q;  1UE5 A;  3G71 A;  3F2C A;  4LF6 L;  1HNW Q;  3K80 C;  4AIM A;  2VQF Q;  4A3E H;  1S3O A;  4QY7 A;  1VQB A;  2ZM6 L;  3I2Z A;  3M85 A;  3KF8 B;  2GVA A;  3H0G H;  4R4T A;  4JI5 Q;  4UY8 C;  3TEH B;  2UXB L;  2UXD L;  5IP7 G;  3ERS X;  4GS3 A;  2DUD A;  1E3P A;  2AMC B;  4APV A;  2MO1 A;  4IO9 A;  4P71 A;  3UDG A;  3PUV A;  1HNZ L;  4UP7 A;  1XPU A;  2JA7 H;  2N3S A;  1S72 A;  2XGT A;  2K4K A;  2YTV A;  3NEL A;  5E7N A;  4YHH L;  5LMN Q;  1U0L A;  2R7Z H;  4OON A;  4DKA C;  5C0X J;  1YBY A;  4JI4 L;  3GTG H;  2ALY B;  1P16 A;  3JAM i;  1VQ8 A;  1VQ5 A;  3F1Z A;  3GTJ H;  1I50 H;  1B7Y B;  3I7F A;  4NXN L;  2K5H A;  4JI2 Q;  2R7D A;  2Z6K A;  2B29 A;  1EWI A;  1VQK A;  3AEV A;  3K7U C;  3M4P A;  3M9B A;  3GTM H;  1FGU A;  1G51 A;  1PH1 A;  2K5N A;  1TWG H;  2JEA I;  1Q81 C;  4GLX A;  4OWX B;  5IYD G;  1HZB A;  1AH9 A;  1EQQ A;  1VQ6 A;  4DK6 C;  1PH8 A;  4YWL A;  4JCV E;  5FLM H;  1W3S A;  3HOX G;  4J15 A;  1WI5 A;  2C35 B;  3KF6 B;  4DAY B;  2KEN A;  2JA6 G;  3H3V H;  1L0W A;  3E9I A;  3CC4 A;  4A3F G;  1FJG L;  2JEB I;  2PQA A;  3PSI A;  1UE7 A;  2DGY A;  4GNX C;  2WB1 E;  4LF5 L;  1KL9 A;  3HOY G;  3AQQ A;  3GDE A;  1M1K C;  1V1Q A;  3CCV A;  5LMN W;  3PO3 H;  2E5L Q;  4X64 Q;  1C0A A;  3KLW A;  5JEA G;  3UDF A;  5C3E G;  1YHQ A;  4A3J H;  3F2D A;  4GN4 B;  1GO3 E;  2KCT A;  3RLN A;  1BVS A;  5IYC H;  3OTO L;  5AJ3 L;  1CSQ A;  1HH2 P;  1N33 Q;  1X6O A;  1Y14 B;  1VQP A;  1VQH A;  4GLV B;  1JT8 A;  3MXN B;  1K83 H;  1X55 A;  5IYB G;  2ID0 A;  5C0X G;  4XIG S;  3NBH B;  2K14 A;  1PA6 A;  1EOV A;  1N34 L;  1FJG Q;  4JI6 L;  1PV4 A;  1VQN A;  2VNU D;  2RCN A;  2IHE A;  1SLJ A;  2NN6 I;  2LSS A;  1HZA A;  4DR7 Q;  5K36 G;  2F3I A;  1D8L A;  1Q1E A;  2VW9 A;  2N78 A;  1S40 A;  3S15 H;  2UXC L;  4A3K H;  4IPH A;  4RG1 A;  3G4S A;  2UUC Q;  4LF7 Q;  1J5E L;  2WAQ G;  3ZJY C;  2QEX A;  4JG2 A;  2QA4 A;  4HIK A;  1SFO H;  4OO1 G;  5M5W H;  3RZO H;  1PFS A;  4NPS A;  3CCS A;  4DR5 Q;  1I3Q H;  1VQ9 A;  1PH5 A;  5HY6 A;  2CWA A;  1KXL A;  4IOA A;  3HFZ B;  1K9M C;  4PZ6 A;  1JMC A;  2RHS B;  3S1M H;  1BBW A;  1ASZ A;  2E2J H;  4YCW A;  4KHP L;  4DPG A;  2EIF A;  5GAG C;  4LF9 L;  3GTQ H;  4GNX A;  2VS1 A;  3JC6 6;  1PHJ A;  1H95 A;  4JI6 Q;  2QGQ A;  3PO2 G;  1N8R C;  2R7Z G;  1U5K A;  4LFA L;  3ICE A;  1YEZ A;  3OW2 A;  1PVO A;  4P72 A;  1XMQ L;  2UU9 L;  4JBK A;  1HZ9 A;  4DV7 Q;  5C4X H;  4DR2 Q;  3T1H Q;  4JI7 Q;  3ER0 A;  4LFC Q;  3CPW A;  3DM3 A;  3HOZ H;  4DV0 Q;  4HJ8 A;  4R4Q A;  1I94 Q;  1VQI A;  1EIY B;  3K8A A;  4BY7 G;  1SRU A;  2NZO A;  3H15 A;  4AYB G;  4ME3 A;  4JI1 L;  2R92 G;  1SN8 A;  1G29 1;  4POF A;  4X65 Q;  2WAQ E;  3KJP A;  3U50 C;  4DV3 L;  1VQ7 A;  3T1Y L;  5FLM G;  1L1O C;  3D0F A;  3W1B A;  5HGQ A;  5IP9 H;  1QZG A;  3F2B A;  4WJ3 M;  4AQY L;  3PV0 A;  4X66 L;  4PZ7 A;  4L5R C;  1VQJ A;  2YU9 H;  2D0O A;  4OX9 L;  1QUQ A;  1XMQ Q;  1T9H A;  1VQE A;  1Q7Y C;  2OTL A;  3I4M G;  4JI8 L;  1CKO A;  1PH6 A;  1PH2 A;  1N36 L;  3K0X A;  4KLK A;  1TXY A;  2VY3 A;  5M3F G;  1AE2 A;  1LM0 A;  3BU2 A;  2K5V A;  4GKJ Q;  1VQC A;  5IY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...