4HJ8A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggttacgct)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj8A00
2XTIA 2YTYA 1JJ2A 1VQ4A 3HOWG 3CAMA 4NXMQ 3GTOH 1TWHH 1OXTA 4YY3L 1E22A 5M3MH 4JI7Q 1L1OC 3E0EA 3HKZE 4OONA 1VQPA 2JA6H 4LNQA 3UE1A 4A3GH 1XJVA 1VQCA 1WCMG 3GTKH 4A3CH 4P73A 1N34L 2ATWA 4BBSH 4OX9L 3T1HL 5C0XG 2UU9L 2RCNA 4GLXA 2BH8A 2Z6KC 3D31A 2JJQA 2K52A 3Q8DA 1P8LA 2DGYA 2VY3A 3JAMi 4X6AH 4JI2L 4TQUS 5M3FH 2D62A 2B63H 4A3DH 4DUZL 4YWLA 2NZOA 3OYYA 1X54A 4KHZA 5JEAG 2VNUD 4IO9A 4IOAA 2PI2A 3NELA 4DR7L 4OO1G 1YI2A 3KF8B 4A3KG 2QA4A 4QIWE 4EX5A 2RHSB 4LUZA 1I50H 2D0OA 4DR2Q 4LF4Q 4QY7A 1QUQB 4R4CA 3K7UC 3A0JA 3G6EA 2R92H 3K80C 4JI1Q 5AJ3L 3S15H 4LF9L 1BKBA 4KHPL 1HNXL 4DR5Q 1NJIC 4WJ4A 1ASYA 1Y14B 3MXNB 1CKOA 5FJ8H 2Q2UA 1Y1WH 3S1QH 3KDFB 5HY6A 4RG1A 1IBKL 1YEZA 5IP7G 4A3JH 1QUQA 3AFQA 1HNZQ 1SRUA 3CQZH 1RIPA 3F2DA 1KIXA 5C44G 2QEXA 4LF7L 4A93H 2GN5A 2BA1A 1YZ6A 1Z47A 1W3SA 3PSIA 2BA0A 1X3EA 4DR3L 4DKAC 2K75A 3KDFA 3KYHC 5IT9c 1PH3A 1VQ5A 2MNAA 4JYAL 4DV1L 4HIDA 1N33L 4OXPA 5JJIA 4DV0Q 4JI8Q 4B3TL 1A63A 4LFAL 3RN2A 1NY4A 2CQOA 1NBWA 3PF4A 3KF6B 1FJGL 4AIMA 3ULJA 4KLKA 1XNRQ 2NVXH 3E9IA 3ULPA 3PO3G 2Q2HA 4YCWA 4JI3L 3F1ZA 4BBRG 4DPGA 3HOZH 4LFCL 4LFBL 1XNQL 1C7YA 5IWAL 4L5QA 3I4NH 3KF6A 4O2DA 3DM3A 1BVSA 1SFOH 2I5LX 1VQ7A 4FDBA 4A3EG 5J3BA 4O0AA 2HHHQ 1YHQA 4DV2Q 4PG3A 3UE0A 3OTOQ 3CC2A 3HOXG 3HOUG 2MO0A 3CMAA 5IYCH 1B70B 4DK3C 1X3GA 4UP7A 3I55A 4JCVE 3CCVA 1PH2A 3ERSX 4X65Q 2JA7G 4R4OA 1PVOA 4DV6Q 3NEMA 2VQFQ 1QVGA 4UP9A 2KCMA 2KENA 3J80c 2C35B 1A62A 1YVCA 4UPAA 3CMEA 1VCIA 3GTMH 1AH9A 1L0WA 1VQ6A 1PYSB 1AE3A 1K0RA 2LSSA 3U4ZA 4A76A 2JK8A 2JE6I 1TWCH 1UE1A 1LM0A 2I5MX 2AHOB 2KCTA 2E2IH 1BBUA 4NXML 4A3DG 2MQHA 3MEFA 4JI7L 2OTLA 1M90C 1MJCA 4GKJQ 1QVFA 5C3EG 1HZ9A 4DV5Q 2ZJQA 1J5EQ 1HH2P 3S2DH 4A3FG 1G6PA 1TWFH 5IYBH 2ZJRA 4L5RC 4DV3Q 1WFQA 1KQSA 1C9OA 1HNWQ 4HJ5A 3CC4A 2E2JH 2HIVA 1CSPA 4B3MQ 1VQGA 1XMQL 3F8TA 1Q8KA 5IP9H 2GVAA 1Q1BA 1PA6A 1KRSA 2IT1A 4JI4Q 1VQ8A 1MKHA 1HJPA 1JJCB 2UXCQ 4NXNQ 2UUAQ 4BY1G 4GNXC 3H3VI 5IYDG 1EIFA 2B3GA 2VS1A 3K8AA 3HOYH 4POFA 1IBMQ 1DGSA 3PIOA 1LTLA 4MZ9A 2K4KA 1PH6A 4DR2L 4A3BH 4YWKA 1V9PA 4A3IH 4LF4L 5FLMG 1XMOQ 4B3SL 1H95A 4AYBG 1YJWA 3H0GH 2VL6A 4IPCA 4JOIC 4ME3A 4JI1L 2R7ZG 4X62Q 3TQYA 4DR5L 4XIGS 2ZJPA 2AKWB 2JA5G 5DLQE 2Y0SG 1Q86C 1PFSA 1JMCA 5IE8A 3STBC 5JJLA 1YNXA 1HNZL 4PZ6A 1K8AC 1SLJA 4DAYB 3S16H 2ALYB 4HJ8A 2K50A 4A3MH 4BA1I 4YHHQ 2IHEA 4GLVB 3GO5A 4HIMA 3ICEA 4IFDJ 5FLXc 3FKIH 2K14A 4LWCA 1E1OA 3TS0A 1EOVA 5GAGC 4DV0L 4JI8L 1Q7YC 3FP9A 1A8VA 4IOCA 1CKNB 3HOVG 2IY5B 1KAWA 3EBEA 2MO1A 3CPWA 1VQAA 4BXXG 1Q46A 1XNRL 2D0PA 2IHFA 1B7YB 2IX0A 2N49A 1PH5A 3NBHB 4DR1Q 4AQYQ 2JA8G 5GAEC 3M4OH 3KLWA 4JV5L 1JJGA 1N9WA 1CKMA 1YHAA 1CKNA 2LXKA 2OWOA 1XPOA 3AFPA 4QQBX 1U0LA 4X66Q 4IPHA 2JA6G 3K81C 5M3MG 3UDGA 5LMNQ 1YIJA 1QZHA 4GN3B 2HHHL 4DV2L 1EFWA 2EXDA 3OTOL 4GOPC 1MJEA 4DV4Q 4A3GG 1EYGA 1S40A 2VUMH 1VQNA 1Y1VG 4ALPA 1OXVA 4A3CG 5C0XI 1N32Q 1SR3A 3T1YL 3RZDH 2DUDA 3S24A 4HJ7A 1AE2A 1QZGA 3NENA 4BBSG 1TWAH 3KJOA 1IZ6A 2VQEL 2PI2E 3UDFA 1KHIA 4QJFA 2R93H 5K36G 3EN2A 3G71A 1PHJA 4OWWB 5M3FG 3UDIA 1HR0W 1L2FA 1MIUA 4JI0Q 2OCEA 2B63G 4DAMA 2NN6G 2YTXA 3EIVA 4UP8A 1UE7A 1Q12A 2AWNA 3CXCA 3CCUA 3PO2H 4OO1I 1KD1C 1GM5A 4P75A 1X3FA 1PH7A 2YU9H 1YJ9A 1L1OB 4GKJL 4DV5L 1J5EL 1ASZA 5LMNW 1NMFA 2WAQE 3PGZA 4GS3A 2R92G 2N3SA 2JA9A 2K5VA 4C3HH 4OWTB 3HFZB 1IXRA 1SN8A 2WP8J 3ZJYC 5M5YH 4B3ML 5GQOA 3ER0A 1VQEA 3GDEA 1L1OA 5FJ8G 2KHJA 1I3QH 3STBD 1Y1WG 1UE5A 4JI4L 2UXDQ 2PQAB 2H5XA 2E2HH 2WB1E 4A3LH 4NPSA 3PUWA 2UXCL 2OQ0A 2V1CC 1G291 4A3JG 2UUAL 1HZAA 3L2PA 4JI5Q 5HGQA 2A1AA 3L7ZC 4A93G 5C4XH 1IBML 4DR7Q 1P16A 4IJHA 5C0XJ 3PCOB 4LF6Q 2Y0SE 2Z6KA 2PQAA 1UEBA 5BR8L 2NN6I 1XPRA 1YITA 3AQQA 1G51A 1VQFA 2WFWA 4GKKQ 4IFDG 3I4MH 1Z9FA 4DV7Q 1PH1A 4X62L 1HNXQ 5H1SE 3S1NH 4YCVA 4BY7H 3BJUA 3D0FA 5JEAJ 2VW9A 4LF6L 3CCEA 4J15A 3S1RH 3PUYA 2IX1A 3HOZG 4B3RQ 1C0AA 3J81c 4R4QA 3I4NG 1VQDA 3RZOH 4A75A 4YHHL 4Y52H 1CUKA 1EUJA 2KHIA 2L15A 4DNIA 3I4OA 3F2BA 4RMFA 1S72A 4GOPA 5FLMH 2CKZB 1I94Q 5IYCG 1KL9A 4JC0A 2AWOA 2Q2IA 5LMUQ 1VQLA 3HOWH 1FJGQ 4JI6Q 3GTGH 3J7A5 4BA2I 1OXXK 4C3JH 4C3IH 4DR1L 2HQLA 1RL2A 3CCQA 1YBYA 2HIXA 4K0KQ 1PYBA 1EWIA 3RLFA 1WCMH 2F4VQ 3ULLA 4DR6Q 1V43A 2PMZE 3K0XA 4KI0A 3S2HH 4LUVA 3J80i 1KRTA 3JAMc 4X64Q 4LF8Q 4X66L 4L5TA 4R1JA 3GTJH 2EQSA 1VQHA 4PMWA 1S3OA 3E9HA 1OXSC 2MFIA 1IBLQ 2PNHA 2YYZA 4DV4L 3OW2A 4POGA 1TWGH 5IYBG 3TEHB 3G4SA 3PUVA 4LF5Q 5M5XH 1N36Q 2KBNA 2ASBA 1N8RC 1YJNA 4DR4Q 3U58A 1N32L 5JJKA 2ZM6Q 2HT1A 3RN5A 4LW1A 3U4VA 4MTNA 2UUCQ 2Z0SA 2AMCB 2ZTEA 4A3KH 2JEBI 4QGUA 1GD7A 2ZTDA 5IP9G 3LGJA 2OTJA 4DUYQ 1VQOA 3M4PA 4GLAC 5E7NA 3BU2A 1VQMA 4JI0L 1D7QA 3W5OA 2ZTCA 1D8LA 3A5ZB 1Q82C 1M1KC 4NB3A 3HOYG 2E5LQ 1IYJB 1X55A 3CCJA 1I6HH 1GKHA 3GD7A 1PH8A 1HR0Q 4JBMA 3CP0A 1KXLA 5IP7H 4A3BG 1NMGA 1Y1VH 4A3IG 1PH4A 3M4QA 1JE5A 5C44H 4YCUA 5ELNA 4WJ3M 2UXBQ 3H0GG 1UE6A 4UY8C 3B6YA 4DK6C 2NVQH 1NE3A 1XMQQ 4PZ8A 1VQJA 3H15A 4A4IA 2N8NA 1SROA 2UXDL 2JEAI 2A19A 3PIPA 3CC7A 2VZAA 1TXYA 3G48A 5C4JH 4JI5L 3CCLA 4X65L 4P72A 1K73C 2Q2TA 1B8AA 4GNXB 4DV6L 4A3MG 3PO3H 3A74A 1E1TA 1O7IA 4BBRH 2VQFL 1NTGA 4HIOA 4XTCS 3A5UA 3FKIG 3BZCA 2CCZA 2UUBQ 4L5SA 4LUOA 3GTLH 2JQOA 4HJAA 3CW2C 2R7FA 1SE8A 4B3SQ 1U5KA 5GAHC 2BH2A 2A8VA 1K3RA 4GKKL 4GNXA 3TREA 4DV7L 4YY3Q 3SGIA 1EQRA 1UWVA 4A3EH 1OXUA 1XTDA 2EIFA 3HOXH 3HOUH 3S1MH 4B3RL 5IY0A 2JA7H 1CSQA 1T9HA 4DV3L 1N34Q 1GO3E 1I5FA 3W1BA 3KJPA 3S17H 1HNWL 3HKSA 3M3YH 4OX9Q 4JOIA 3U50C 3T1HQ 3H3VH 2UU9Q 2K5HA 3HKZG 3PF5A 1VQ9A 5EAYA 2F3IA 1R9TH 1KC8C 4YWMA 3AYHB 2VUMG 4JI2Q 1I94L 2K5NA 2I5HA 1JT8A 4JBKA 5LMUL 1QVCA 4NXNL 4DUZQ 3RLNA 4AYBE 4GN5A 3GTPH 4JI6L 4H02A 5ELOA 2E8GA 1WOCA 3M7NA 1V1QA 1VS0A 1A0IA 5C3EH 4K0KL 4JV5Q 3I2ZA 4A3FH 2R93G 3M9BA 4JBJA 1FGUA 3W1GA 5GADC 2RHQB 3CF5A 2F4VL 1PV4A 1XMOL 4DR6L 2R6GA 2N78A 1Q81C 2QGQA 5AJ3Q 4X64L 3I56A 4LF8L 4LF9Q 3TS2A 3PO2G 4KHPQ 4HIKA 3TRZA 2RF4A 3PUZA 3K7AH 3J7ZC 4JBWA 1IBLL 3KOJA 4R4TA 1X6OA 3I7FA 1IBKQ 2B29A 1X9NA 4GOPB 4JG2A 3UDXA 4LF5L 3RR5A 2R7DA 3JC66 1N36L 4BY1H 2LXJA 2NVTH 1WI5A 2CWPA 4AH6A 3T1YQ 4DR4L 5IYDH 2ZM6L 3M85A 5M5WH 1K8GA 2CWAA 2UUCL 4LF7Q 2VQEQ 3RLOA 1LYLA 4DR3Q 3CCRA 4P74A 4JYAQ 3CPFA 2NVYH 5GROA 4DUYL 2OQKA 4DV1Q 1EIYB 1N33Q 1IL2A 2YTVA 4A3LG 4GN4B 4B3TQ 4LFAQ 1YHBA 1K83H 3CCMA 3GTQH 1GVPA 2R7ZH 4HJ9A 1E3PA 1VQBA 3S14H 3FHWA 1JB7A 1LUZA 1J6QA 1K9MC 3L0OA 1WJJA 2GVBA 2E5LL 2JA5H 4AQYL 5C4XG 1XPUA 3VDYA 4JI3Q 1HR0L 4LFCQ 3RNUA 4LFBQ 1VQKA 3PV0A 4APVA 1HZBA 1BBWA 1Q1EA 2NZHA 3PUXA 1PH9A 1XNQQ 5IWAQ 1X65A 4IFDI 1FVIA 2UXBL 1E24A 1OTCA 3I4MG 1SMXA 2CFMA 3WWVA 4EQ5A 4BY7G 4OWXB 3KFUA 1EQQA 2ES2A 2F52A 3AEVA 5LMNL 4C2MH 3DLLA 3J81j 2ID0A 1FL0A 2XGTA 4P71A 3HOVH 1X56A 2WAQG 4PZ7A 4IPGA 4QL5A 4BXXH 3IRBA 3F2CA 1E7ZA 4IJLA 1VQIA 2JA8H 1W2BA 3J81i 1HZCA 1WYDA 3CCSA 3BZKA 2UUBL 4R4IA 2I0QA 5BR8Q 3CD6A 2FXQA 2WB1G 4TVAB 4IPDA 4Y7NH 4MNOA 2YV5A
chains in the Genus database with same CATH superfamily
2XTIA 4O1NA 5EKLA 5I2YA 4NXMQ 5M5YB 4JI7Q 4C3IG 4LNQA 3S2HB 2EE1A 4B9WA 1VQCA 1WCMG 1DXMA 4OX9L 1KDAA 2RCNA 3NP8A 3ZYYX 1NSNS 3EQLC 4GLXA 5JPNC 2JJQA 1P8LA 1GUNA 2VY3A 4X6AH 2PYKA 1X3PA 4RKBA 4TQUS 3VA7A 3O13A 4K2LA 4X3SA 1CZWA 3A7LA 4HTHA 3S1NB 4IOAA 1YI2A 4EX5A 1FD7D 2FJ2A 5EPLA 2E74C 1QUQB 1TWFB 3QO2A 3K7UC 4R4CA 1D2BA 3S15H 2DNCA 4LF9L 4KHPL 2XWJB 1ASYA 1ML0D 2P5ZX 3S1QH 5CV8A 3KDFB 4RG1A 2PZWA 1HNZQ 1SRUA 3CQZH 1EY7A 4LF7L 1Z47A 1ET6A 3PSIA 1X3EA 5T1IA 4JYAL 1VQ5A 3MZ5A 2SNMA 1SYCA 1N33L 1S5ED 2XN9C 1WCMB 1A63A 4LFAL 3PF4A 1SYFA 2CH4A 2TSSA 3KF6B 5CV7A 1FJGL 1JOKA 3NE5B 4XQJA 1SNCA 1PFMA 3HS0C 4LFBL 1KDBA 1SYDA 4V190 4L5QA 3I4NH 5M5XB 3DM3A 2JXMB 3K5LA 4DFAA 2I5LX 2QDLA 3VYSA 4A3EG 1CFMA 4L8JA 4RHRA 3CC2A 3HOUG 5IYCH 4DK3C 1PTOH 1X3GA 3I55A 2JA7G 2R3ZA 1PH2A 2EYMA 1PVOA 4R4OA 3V2TA 1NCVA 4C1NK 2VQFQ 1QVGA 4UPAA 4DU9A 1AH9A 1L0WA 1VQ6A 1O80A 1AE3A 2LSSA 2XVSA 4H0LC 4A76A 2JK8A 1TWCH 1UE1A 4NXML 2AHOB 1V8QA 4XT3B 4JI7L 2JYOA 3EA6A 1I4PA 3BVMA 1HZ9A 2ZJQA 2SOBA 4PQXA 3T13A 4L5RC 3OSOA 5C4JB 1C9OA 3P1HA 4HJ5A 5ELCA 2NBFA 1PA6A 1Q90A 3OPOA 1Q1BA 1KRSA 4M1UB 1VQ8A 1PXUA 2Z9HA 5IYDG 1EIFA 2HDLA 2EYLA 4NKLA 4OEMB 4HSVA 1IBMQ 3PIOA 5DM73 1PH6A 4A3BH 4FP5D 4A3IH 5I9OA 2JA7B 3FRPB 3H0GH 4JOIC 4IPCA 3TQYA 2ZJPA 1E2VA 2HUGA 4KY5A 1YNXA 1HNZL 3DHQA 3S16H 1B1ZA 1JQYD 4IURA 4YHHQ 2F0LA 3ICEA 1L0YB 5FLXc 1ZXTA 4LWCA 1E1OA 1EOVA 3OWEB 5F2DA 2K01A 3HOVG 5IGEA 1A8VA 1CKNB 4DAYA 1KAWA 4I65A 4BXXG 3C3LA 1M8AA 4FXDA 5FO9B 2JA8G 5GAEC 2O2LD 2XIWA 3TP6A 2I46A 4CGYB 3I70A 1YHAA 3K5OA 4RKLA 1STBA 4QQBX 3FEWX 1EEID 4IPHA 2JA6G 3UDGA 3SK8A 1EFWA 2EXDA 3J7AF 2OXPA 1VQNA 5IT9E 5G3LD 1Y1VG 5KEEA 5C0XI 4HJ7A 1AE2A 3S14B 5D3IB 1I4QA 1YNJD 2FHTA 5M3FG 1HR0W 4JI0Q 1L2FA 1H9SA 2B63G 4DAMA 2NN6G 2YTXA 1UE7A 3CCUA 5EBCA 1M4VA 2WINB 2N88A 1CTMA 1FGBD 4C2MB 4Z9CB 1E2ZA 1STYA 3HOVB 4QMGA 4F7XA 5EPJA 5IIFA 4MHEA 2K5VA 5M5YH 1S72A 3HFZB 2V4DA 2F0UA 2WP8J 1RD9D 5GQOA 1BCPD 3GDEA 2JA8B 3S2HH 2R61A 1UE5A 2WB1E 3BVGA 2V1CC 1STNA 3L2PA 2QDBA 1CM9A 3H94A 3NTKA 2Q8IB 1H9JA 1TWHB 5C4XH 4QF4A 1IBML 1P16A 2JA6B 1SBBB 4IJHA 3PCOB 4LF6Q 1LTRD 4LMQD 2NN6I 2F0HA 3AQQA 1Y1VB 2PMZB 4GKKQ 1EU4A 3S1NH 1PH1A 3D0FA 5JEAJ 3U9SA 1PTOC 2Q8RE 5M3FB 2B63B 1NNXA 1RTNA 3RZOH 4XYOA 4YHHL 1FNUA 1O7YA 2L15A 2NYZD 2A68C 3Q6SA 2K1BA 4GOPA 1BBXC 1I94Q 1STEA 4JC0A 2Q2IA 4JI6Q 1ENFA 1WTRA 1OXXK 5IGDA 4XXEA 4C3IH 1RL2A 3VR5A 2HIXA 4UAIA 4FVMA 1SNDA 1WCMH 4C56C 1MSHA 1V43A 3K0XA 1KRTA 3NUCA 2RA4A 2WIIB 5A2QL 4R1JA 2EQSA 3R2TA 4N8X1 4PMWA 1S3OA 3E9HA 3D4DA 3OW2A 4POGA 3G4SA 2ASBA 5M5XH 2F0NA 2KBNA 1EU3A 4DR4Q 4FYDA 2DJGC 3RN5A 4MTNA 5IOCA 2AMCB 5NUCA 3TMEA 4QGUA 2B2TA 2ZTDA 5IP9G 3LGJA 1EIGA 1KDCA 1EWCA 4JI0L 2B2YA 3D8GA 3W5OA 1C48A 3NQTA 5C4HA 4NB3A 2AQ3B 3SHLA 3CCJA 1I6HH 1ICFB 3K7AB 2F0SA 1TKWB 4KK7A 1NAPA 3M4QA 2EOTA 2EYFA 3D4RA 4YCUA 1GHKA 2UXBQ 5C5MA 1UE6A 4UY8C 5M5WB 3MAQA 1XMQQ 4PZ8A 3MFYA 2N8NA 2A19A 2KOLA 5E4WC 1KNEA 2NVYB 2VZAA 3PIPA 5C4JH 1TQOA 3T51B 1GUTA 1K83B 4DV6L 1U4RA 3J7YW 1O7IA 4LF6L 3A5UA 3FKIG 4RGTA 3S2DB 3SK4A 4B3SQ 1K3RA 4GKKL 1ENCA 3IKJA 3A55A 1B50A 4A3EH 1EQRA 1UWVA 4HAEA 4RHSA 4CDEC 2OF1A 2EIFA 2KECA 3HOUH 5IY0A 2JA7H 1T9HA 1LT5D 2PO4A 3HKSA 3BS1A 3U50C 2UU9Q 2K5HA 5AFWA 1VF5C 1I94L 2EJMA 2K5NA 4NXNL 1X3QA 4GN5A 5LHY1 4JI6L 3E5SA 4I7ZC 1WTWA 1U9RA 3DM1A 2A5HA 2LS01 2A6ED 2RHQB 2R6GA 4ILWA 2QGQA 5AJ3Q 3J81E 3TS2A 3PO2G 1D5XC 3NPPA 4XQNA 2NWGA 5CV9A 3BG3A 3URYA 1O7LA 3FKIB 1X9NA 5J22A 1AFPA 4DR4L 5IYDH 2QW7A 4PMBA 2CWAA 2F0OA 4UDUC 1STAA 5GROA 4A3LG 4FXKC 4GN4B 4B3TQ 1T5EA 5BN5A 1YHBA 1B2TA 1GVPA 2E75C 2K33A 5CV6A 2O5JC 3GV3A 3S14H 2HCCA 4KJNA 3MHBA 1DZ1A 3JAME 1WJJA 1JOQA 2DJFC 1JE4A 4LFCQ 1PDQA 1XNQQ 1VDZA 2EYJA 4RCOA 1K28A 5IWAQ 1X65A 1FVIA 1QB5D 3CQZB 2UXBL 3RZDB 3I4MG 2CFMA 3FPPA 2D2CC 4OWXB 1TWAB 3TP5A 3G7LA 4C2MH 3DLLA 5EQ0A 2ID0A 1YNJC 1EY8A 3AU7A 3HOVH 1HA5A 1E0BA 4QL5A 4BXXH 1EY0A 2QILA 4R8NA 3PO2B 1SJED 1VQIA 2JA8H 4LJZC 3J81L 2I0QA 3GP7A 2WB1G 1G2TA 4Y7NH 4MNOA 3KLWA 2YTYA 1S4ZA 2RCFA 1JJ2A 3HOWG 1TWHH 2G9DA 1E22A 2JA6H 3E0EA 3HKZE 1VQPA 3Q0AA 3UE1A 1I3QB 3QOLA 1XJVA 1PTOB 2GA4B 2F3VA 1B3AA 2UU9L 3MEHA 2Z6BA 3N6RA 4ZRZA 4OIJA 3GQBA 4X3TA 3JAML 5M3FH 2B63H 1XX8A 2NN6H 3MXPA 1W6JA 5KYIA 1X54A 4KHZA 5JEAG 3EVQA 2PI2A 1CHQD 4DR7L 4OO1G 4G7HC 4A3KG 1VMPA 2RHSB 3KBGA 1I50H 4CKEA 1XTCD 4QY7A 1L0XB 3A0JA 1EL0A 2HDMA 5C3WA 5AJ3L 5EBDA 1HNXL 4IQZA 3NXWA 3KLSX 3KF8A 2EJFC 1G2SA 5JVH3 2K32A 2MUYA 4H44C 3HOWB 1BXTA 1CHPD 2GN5A 2BA1A 2XRSD 3MXNA 1PH3A 1RTOA 3HEJA 1QOHA 1H9RA 5JJIA 4DV0Q 1CQVA 1U4MA 2Q8TA 4B3TL 2KJXA 1XNRQ 3H0GB 3VYTA 3PO3G 1VMCA 2SEBD 4H13C 4YCWA 4BBRG 4DPGA 4LFCL 1FYCA 2EY2A 1XNQL 1HTLD 5IWAL 1BVSA 2RBMA 2N55A 1V1PB 1B9MA 5I4DA 4O0AA 4A3KB 5FKAC 5CC4A 3HOXG 2F0WA 1EOTA 1B70B 3CCVA 1OO9B 2D5DA 1ICWA 3NEMA 4RCNA 4F88A 5CMDA 1GUOA 2KENA 3J80c 3CMEA 1A62A 3GTMH 3K6OA 1S5DD 2G5DA 5IGFA 3Q22A 3NWSA 2B2WC 2JE6I 2I5MX 2KCTA 2MQHA 2ENBA 2E2DC 2NVQB 4EVOA 1D1KA 1QVFA 5C3EG 4ZK9B 1HH2P 4N9PA 3K5MA 3S2DH 2EYHA 2ZJRA 3IAYA 3K5NA 4KY7A 1LTGD 2HIVA 3OIPA 5FOBB 1VQGA 1BQQT 5IP9H 1B4OA 1LTID 4JI4Q 4BBRB 5BN4A 4ULLA 1MKHA 3RD4A 1HJPA 2XNAC 2UXCQ 1HQMC 4GNXC 2B3GA 3K8AA 4POFA 3LNNA 1HFNA 1WVLA 3L3OC 1JWSD 1V9PA 3S1MB 1XMOQ 5IODA 1RJTA 1H95A 3S17B 2VL6A 4IZ8A 5EPKA 3M3YB 5ISRA 1JWUD 2Y0SG 1Q86C 1D1IA 4ZUIA 3STBC 1IW7D 5JJLA 1A3TA 1K8AC 4HJ8A 2K50A 4PNYA 3GTPB 5EJWA 2HD3A 4GLVB 3V05A 3FDTA 5C4XB 3FKIH 1KAAA 2ZXPA 5C3EB 1C4QA 5GAGC 1HQRD 2RSOA 4DV0L 1Q7YC 2IY5B 2BE5D 4IUPA 1QWYA 3EBEA 1VQAA 4I7AA 5IGGA 1QNKA 2D0PA 2IX0A 1JWMD 1XNRL 4DR1Q 1MI2A 1RF2D 2MGSA 2VXWA 4NMZA 1JJGA 4E6IA 3K57A 2LXKA 3HG9A 1XPOA 3AFPA 3RZOB 2X69A 3NBHA 5E4XA 4GN3B 1HTPA 3NTIA 3CHBD 4A3GG 1GUGA 1EYGA 1XYIA 1EQVA 4ALPA 4A3CG 2XSCA 1GUSA 1TR5A 3T1YL 3RZDH 2JSOA 3S24A 1A6XA 5I2XA 4BBSG 3IL8A 4KKSA 1TWAH 1IZ6A 3UDFA 4C3IB 4QJFA 2Y0SB 5K36G 3EN2A 3G71A 4OWWB 1R4QB 3UDIA 3EIVA 4WFN3 3PO2H 1QILA 2DY7A 2PPBC 4RA8A 2YU9H 1EY5A 1QJOA 1CI3M 1ASZA 1JC7A 1ET9A 3QG1A 5LMNW 2XWBB 1A15A 2WAQE 1EEFD 2PQEA 2N3SA 4GS3A 4OWTB 1SN8A 4PMCA 3QB3A 1HFGA 1L1OA 5FJ8G 2KHJA 1I3QH 1Y1WG 2A69D 2LFNA 4JI4L 3OW7A 3PMFA 1J8IA 4A3LH 4NPSA 2UXCL 1W6KA 2OQ0A 4A3JG 5HGQA 3VR3A 3L7ZC 3NQIA 4A93G 4O42A 4HMJA 2Z6KA 1I6HB 4A3GB 2PQAA 1UEBA 5BR8L 3BZDB 5BN3A 5FO7B 4JW0A 1SE2A 3CU7A 2I07B 3I4MH 2PZTA 4BBSB 1DOMA 2VW9A 4V0BA 3PQIA 3R3OA 3KLRA 3CCEA 3DMUA 3HOZG 4B3RQ 1KLUD 1NUCA 3P7JA 3I90A 4A75A 4Y52H 4L63B 1EUJA 1NR4A 2KHIA 4NP5A 3T56B 3OMGA 1UUPA 1HUMA 3FPUB 2AWOA 3HOWH 2F0GA 1ILPA 3GTGH 4DR1L 1JICA 4A3EB 3EROA 1Y1WB 1EFID 3HOUB 4A3JB 3ULLA 5EKKA 3J80i 1S5CD 4L5TA 1LABA 3GTJH 4A93B 4KD3A 1OXSC 2MFIA 2PNHA 2YYZA 2CW0C 3OOCA 2NTSA 4LF5Q 3PUVA 1YJNA 5JEAH 3U4VA 4OO1H 2NVXB 3SE0A 4A3KH 2JEBI 1GD7A 1AEXA 1TS3A 3LWUA 3A8KE 3HOZB 3M4PA 4EQNA 4KMUC 5KGUA 2F0MA 1EIHA 2SNSA 2KCCA 3A5ZB 1SFOB 3HOYG 1CK1A 3MXGA 1X55A 1F77A 3Q23A 2KA7A 1KXLA 2O4XA 1PH4A 2K5DA 1DD2A 4WJ3M 1LTBD 1EYAA 2M00A 5E1FA 4DK6C 3A8JE 2NVQH 1NE3A 1PRTC 1VQJA 1YNNC 1F2MA 1TY0A 1F9PA 3CC7A 3G48A 4P72A 4GNXB 3MFGA 4A3MG 3PO3H 4HIOA 4BBRH 2VQFL 3GTLH 2B8FA 1GHJA 3W3AA 1U5KA 4FF1A 2O5IC 4K8JA 2E2JB 4GZYC 1OXUA 3HOXH 3S1MH 4B3RL 4DA2A 4EQPA 3S17H 1I5FA 3W1BA 3M3YH 4KTAA 1SXTA 3T1HQ 3HOYB 4KV6A 4C1NI 1R9TH 1KC8C 1PFNA 4HCSA 3AYHB 3I72A 1BR9A 5A2QE 3TP8A 1QVCA 4DUZQ 4Y7NB 3RLNA 1V1OA 3GTPH 4H02A 2PNRC 2E8GA 1VS0A 2PZUA 5C3EH 1KTKA 4JV5Q 3I2ZA 1Y8NB 2WV6D 4JBJA 2H4OA 3W1GA 2EYPA 2AQ1B 1FR3A 2N78A 3I56A 3H3VC 4A3MB 2RF4A 3J7ZC 1T5XD 1X6OA 3D6CA 1PTOF 1IBKQ 1IL8A 1II3A 2B8GA 5HURA 5I6WA 1BNZA 4LF5L 5J39A 2B2VA 2R7DA 2LXJA 1WI5A 4AH6A 1XWEA 3R93A 4C3HG 2VQEQ 2HQEA 3RLOA 5CBAE 1LYLA 4HSPA 4IN3A 3CPFA 3E6ZX 5CV4A 1JT8A 4DV1Q 1EIYB 4QCLA 1I50B 4CKCA 1SMYD 1K0SA 3HZXA 4HJ9A 1VQBA 3VA5A 1LUZA 1ZYRD 1J6QA 3VDYA 4JI3Q 1VQKA 1B3QA 3PV0A 1Q1EA 1PZID 5CV5A 1SMXA 4BY7G 1IHZA 2A74C 1AP0A 2A6HD 4J1MA 1PFBA 4NDXA 4N9TA 2WAQG 1RHPA 4K5XA 4EGVA 4UHVA 3DEOA 1JR0D 1WYDA 1SSOA 1EQTA 2BDNA 4TVAB 3NHHA 2PW7A 4ZQ3A 1VQ4A 3VYRA 4TSSA 4C3JG 5C5LA 3SEBA 3AMUA 1Y69U 4OONA 1CA6A 4A3GH 2NUCA 2F0TA 3N52A 2A69C 3GTKH 1I6VC 4A3CH 4P73A 2FFKB 4RGOS 2X6LA 2ATWA 4BBSH 3UI2A 3T1HL 3FVQA 3R8BA 2BH8A 2QKIC 3Q8DA 5JJZA 2DGYA 5K36H 4QB4A 2LMCB 3GTMB 2EXZA 4DUZL 4YWLA 2NZOA 3OYYA 2VNUD 4IO9A 1NR2A 4BY7B 4QIWE 4KKTA 1AZPA 2KEEA 3NWTA 4K8IA 3K80C 2L1BA 5FJ8H 2K5WA 2Q2UA 1ESFA 1Y1WH 5HY6A 1IBKL 1XXGA 5IP7G 4A3JH 1QUQA 1RIPA 3F2DA 4R9WA 4A93H 1HCZA 1W3SA 4DKAC 2K75A 3KDFA 4DXFA 5IT9c 2MNAA 4DV1L 1RKNA 3RN2A 1NY4A 3ULJA 2NVXH 3ULPA 2Q2HA 1CQFA 3F1ZA 4JI3L 4RWSC 3HOZH 1F9QA 5CBEE 2QF7A 1R4PB 3KF6A 4O2DA 1SFOH 1VQ7A 2XRQD 2B2TC 5J3BA 1PRTB 1YHQA 4DV2Q 4PG3A 3UE0A 3HP3A 3OTOQ 4DN4M 2F0QA 3CMAA 4UP7A 2B2YC 3TZUA 4X65Q 1GXDC 2L11A 1JCKB 4IUQA 3SDZA 5L37A 2J7ZA 4UP9A 2KUMA 2K7VA 2KCMA 3A54A 2C35B 1YVCA 1PYSB 1K0RA 3MEFA 1M90C 1STGA 1MJCA 4GKJQ 4DV5Q 2DNEA 4A3FG 1G6PA 3ITPA 1U4PA 1WFQA 2RSNA 4DV3Q 1KQSA 4F87A 1HNWQ 3QJYA 2E2JH 1G6ZA 1CSPA 1XMQL 3F8TA 1Q8KA 5IGBA 1SE4A 2RDHA 3IFTA 3H3VI 2SDFA 2J4XA 3HOYH 1DGSA 3NSWA 4DAVA 2YU9B 4YWKA 3W2DA 3DEPA 1EZ6A 4B3SL 1FNVA 2JP1A 3I73A 1B44D 4Q5VA 4X62Q 4XIGS 5D14A 2AKWB 2JA5G 5DLQE 5JOBA 1PFSA 1BCPC 2LY7A 5IE8A 1DCZA 1QCBD 4XQQA 1D6EC 2C5CA 4PZ6A 4DAYB 1O7ZA 2ALYB 4KD4A 4A3MH 4BA1I 4CDCC 2IHEA 2B2UA 1LO5D 1Q3LA 3I3CA 4U673 5COYA 4A3FB 3QOJA 3FP9A 2MO1A 1EY6A 3C1FA 1Q46A 2IHFA 3I4MB 1PH5A 4AQYQ 1TVXA 5DAUA 3H6MA 1CKMA 4TRDA 1CKNA 1SNMA 3OMCA 2NVTB 2OWOA 1U0LA 1D5MC 5M3MG 5LMNQ 1VF7A 4Q0FA 4DV2L 3OTOL 1MJEA 4DV4Q 4XDXA 2WB1B 1HPCA 4L6TB 1H9SB 1OXVA 4X3UA 1EWHA 3GTGB 2PI2E 1KHIA 4P2CB 2G9HD 1F9SA 2KVMA 4A3DG 4UP8A 2KHSA 3CXCA 2DN8A 2AWNA 3MXUA 4OO1I 1WTVA 3KUPA 3Q24A 1GM5A 5LL6X 4P75A 1X3FA 3GTJB 4GKJL 1SYBA 2F0IA 4DV5L 1DOKA 1NMFA 4FF3A 1DYQA 2A6HC 2KQ3A 4XYQA 2R92G 2JA9A 4C3HH 3PIO3 1MGSA 1VQEA 3VR2A 2F0JA 2H5XA 2E2HH 3PUWA 5E3FA 1G291 4IUNA 4K6DA 2A1AA 1SDFA 3OIQA 5M3MB 5C0XJ 2KEDA 4XT1B 2RKSA 1QNUA 4ZAIA 1YITA 3D6WA 3X3NA 1G51A 4F8MA 4IFDG 3BDOA 4X62L 4BY7H 5H1SE 1K8MA 1SE3A 4OHJA 4B9XA 4OIKA 5J1ZA 3S1RH 2IX1A 4G7OC 2B39A 3J81c 1VQDA 1CUKA 1STHA 3QIAA 1A3UA 2IW3A 3BDCA 3I4OA 4KHVA 3PO3B 1HXYD 5FLMH 5I6YA 3GTLB 2F0FA 4DAPA 4U68A 4RAUC 1TY2A 4N8FA 1FJGQ 2TMPA 2R92B 3J7A5 4BA2I 4C3JH 1PYBA 3SXHA 3HOXB 3RLFA 1BOSA 4BS9A 1BUVT 4DR6Q 2PMZE 1A2TA 4LUVA 3JAMc 4LF8Q 1EZ8A 2EVBA 1H9KA 1JORA 1VQHA 1PLFA 1IBLQ 1SYGA 4DV4L 2DY8A 5FLXE 1R9TB 5IYBG 3TEHB 3BDLA 1N8RC 1ZEQX 3CRKC 4CDFC 2ZM6Q 2Z0SA 3E0JA 2ZTEA 3I8ZA 3TBIB 5E7NA 4GLAC 1VQMA 1D7QA 2A6EC 1D8LA 5IGCA 3QR8A 1Q82C 2RDFA 1IYJB 1SNPA 1GKHA 4FO2A 3GD7A 1F2ZA 1PH8A 1HR0Q 5ELBA 5IP7H 1AZQA 5ELNA 3B6YA 5FO8B 1DOLA 1PTOD 1SAPA 2ZT9C 1TXYA 1EYDA 3CCLA 2Q2TA 2A68D 2NB0A 2ZXOA 4PV1C 2E2IB 1WTOA 5JAVA 1GOZA 3A74A 1E1TA 1ZKOA 1NTGA 2CCZA 2UUBQ 3BZCA 4LUOA 4HJAA 1I4GA 3SVMA 3HGBA 3A56A 5GAHC 2A8VA 5FLXL 4CJ0B 3NK9A 4YY3Q 5CORA 4S3SA 1XTDA 3WDNA 1BCPB 3SK6A 4HMIA 1WTXA 1N34Q 1GO3E 3KJPA 3M4YA 4JOIA 3H3VH 3HKZG 4DF7A 5EAYA 1AW7A 2VUMG 4JI2Q 1LT3D 4JBKA 4OELB 4AYBE 1ESRA 2L55A 3M7NA 3OWFA 4K2KA 1F9RA 1F2YA 4A3FH 2R93G 3CF5A 1UAPA 3H91A 1PV4A 1XMOL 2EY5A 4DR6L 3GTKB 4LF8L 4HR7B 3TRZA 3MVVA 1IBLL 3NTHA 3I7FA 2B29A 3IFDA 4JG2A 1PMRA 1E2WA 5CR3A 1KNAA 3JC66 4NW2A 2NVTH 2ZM6L 1TIID 1KABA 2RQXA 4DR3Q 4OGQC 4P74A 2BDOA 3M4OB 1S5FD 2Z1CA 1ILQA 3CCMA 3FHWA 2F1MA 3L0OA 2GVBA 3HKZB 2JA5H 4K5VA 5C4ZA 3PIP3 1HR0L 3RNUA 4APVA 2VUMB 2NZHA 1HZBA 2IJ0A 2QCPX 4ZLTF 3GV6A 3WWVA 4EQ5A 1J9OA 3KFUA 4TKOB 2ES2A 3AEVA 1U4LA 3J81j 1FL0A 4P71A 4DNRB 2R93B 3ND9A 1TS5A 3BVZA 4K5WA 3C2PA 2FINB 1E7ZA 2J0TD 3X3MA 1W2BA 5HGTA 1HZCA 3J81i 2WKCA 3BZKA 5D3DA 2UUBL 3CD6A 1LTTD 2FXQA 4IPDA 2M2LA 1K3BC 1JB3A 3CAMA 4JPBW 2MPMA 2F03A 3GTOH 1OXTA 1Y8PB 4YY3L 5M3MH 1L1OC 1A3VA 1SEBD 1DJRD 2Z8LA 4CHTB 1CT1D 1N34L 4CJ1B 4HN7A 4FF4A 1PRTF 5KNDA 2F3WA 3LX0A 2F0EA 5C0XG 2OEOA 2Z4HA 2Z6KC 1HHVA 3D31A 3T16A 2K52A 3DUZA 3JAMi 4JI2L 2D62A 2L9HA 5KNCA 4A3DH 1IYVA 2AUJD 3DWPA 4ZCKA 4MIUA 2AUKA 3NELA 3KF8B 2L4NA 2QA4A 5KRUA 4LUZA 2D0OA 4DR2Q 2WACA 4LF4Q 4DXGA 3G6EA 1WTHA 2R92H 3ND8A 3TSSA 4JI1Q 1WD0A 1BKBA 4FF2A 4DR5Q 1NJIC 4WJ4A 1Y14B 5JPMC 3MXNB 1CKOA 2D9UA 3D4WA 2F0DA 4ZKBB 1YEZA 4OL7A 2FMCA 3AFQA 2ICIA 1KIXA 5C44G 2QEXA 1YZ6A 4DNTB 2BA0A 4DR3L 1EYCA 5EGTA 3KYHC 4HIDA 4OXPA 4JI8Q 2CQOA 1NBWA 4IFDH 1UEAB 4AIMA 4KLKA 3E9IA 1X32A 4KN4C 4RFBA 1TWGB 1WTQA 2CH4W 1C7YA 1G8ZD 2VB3X 1IW7C 4FDBA 1BF4A 3K58A 3R2IA 2HHHQ 3P75A 3TN2A 2MO0A 1JOOA 3MWYW 4JCVE 1K8OA 1FNWA 3ERSX 2BOSA 4DV6Q 2BE5C 1V1PA 1G91A 3H09A 1VCIA 2OT2A 4HEDA 4ZYSA 3U4ZA 3F2UA 4EQOA 2K6AA 2E2IH 1LM0A 5C44B 4HCEA 1BBUA 5IT9L 1WTPA 2OTLA 3NBIA 4J8QA 3QWNA 1S5BD 2IX3A 1BDOA 1J5EQ 4FNFA 1TWFH 5IYBH 1H9MA 4DK0A 4WRDA 1LV9A 3CC4A 2K05A 1TU2B 4B3MQ 1IYUA 2GVAA 3WOFA 2ZXRA 2IT1A 4K6LA 2L5TA 5A35A 1JJCB 4NXNQ 2UUAQ 3SK5A 1SNQA 5T1GA 4BY1G 1PZKD 2F0VA 2VS1A 1LTLA 4MZ9A 2MJ8A 2K4KA 1BO0A 4DR2L 1SNOA 1B9NA 4LK1C 4LF4L 5FLMG 2RVLA 3P20A 4AYBG 1YJWA 2ICEC 4ME3A 4JI1L 2R7ZG 4DR5L 4C3HB 4CDDC 3CKIB 1JMCA 4KJOA 2E2HB 1EY9A 1SLJA 1RODA 1IKLA 1B53A 4ID6A 2MP1A 4HIMA 3GO5A 4IFDJ 2EPBA 1QE6A 2K14A 3KBXA 3TS0A 4JI8L 1RDPD 4IOCA 3A8IE 3CPWA 5FK9C 1B7YB 2N49A 3KLSA 3NBHB 1HRJA 3M4OH 4JV5L 2PCFB 4RGNA 2B2VC 4ME5A 5M9OA 1N9WA 3S1RB 2IL8A 3TZDA 2WAQB 4BY1B 4RH6A 2IWHA 3I91A 4X66Q 2F4IA 3K81C 1YIJA 5TSSA 1QZHA 2HHHL 4GOPC 2VUMH 1S40A 4J6HA 2EYOA 3TP7A 4AYBB 1N32Q 4MTKA 1SR3A 1LACA 3GTQB 2DUDA 2R7ZB 1QZGA 3NENA 5KIXA 1Q8IA 2Z4IA 3KJOA 2VQEL 4C3JB 2R93H 5JVG3 1PHJA 1RCVD 4CKBA 1HUNA 1MIUA 2OCEA 1Q12A 1MBYA 5KYLA 1KD1C 1PH7A 1YJ9A 1ENAA 1L1OB 4K14A 1J5EL 1TS4A 1UNSA 4LAAA 3MC0B 3PGZA 4JK1C 3T4AC 1IXRA 3ZJYC 4M8AA 4IALA 4G7ZC 4KKUA 4B3ML 3ER0A 3STBD 1DONA 2UXDQ 2PQAB 1TT2A 1I4XA 3J80E 4JI5Q 2UUAL 1HZAA 1MSGA 4ODGA 4ZUJA 1CA5A 1LT6D 4FXGC 4X3KA 4DR7Q 2Y0SE 2QEJC 1TS2A 2FMMA 3BYYB 3SR1A 1XPRA 5ELFA 3ERQA 1SJHD 1VQFA 2WFWA 3S9WA 4ZKCB 1Z9FA 4DV7Q 3FMCA 1HNXQ 5CYUA 3K59A 4YCVA 3BJUA 4H7BA 2H1EA 4J15A 1QG7A 3PUYA 1C0AA 1SYEA 4R4QA 5G3LF 3CRLC 3I4NG 2K5QA 2KCNA 2C9OA 3KK7A 2F0PA 4WJWA 3EJIA 3E3XA 4DNIA 3F2BA 2F0KA 4RMFA 2CKZB 5IYCG 2EZVA 1KL9A 5LMUQ 3DWAA 1VQLA 2AQ2B 5ELDA 3MA2B 3S15B 1AN8A 2HQLA 3CCQA 1YBYA 3WOEA 4K0KQ 3S1QB 4QUFA 1IKMA 1EWIA 4DK1A 2PW5A 4KN7C 2X6GA 2F4VQ 4KY6A 4KI0A 4X64Q 5K5PA 5C0XH 3K0YA 4X66L 3J80L 1PYWD 1BCPF 2K03A 1TWGH 2IPKD 1N36Q 5JJKA 3U58A 3MTSA 1LTAD 1N32L 2HT1A 2M9VA 4LW1A 2EJGC 2UUCQ 3DXJC 5DEHA 1LLRD 2EY1A 2OTJA 4DUYQ 3VR4A 4IUTA 1VQOA 4G57A 3BU2A 1LT4D 3A7AB 3I4NB 2ZTCA 1M1KC 2HCIA 2E5LQ 4CJ2C 4JBMA 4JVZA 3CP0A 4R8IA 3VR6A 2JN4A 4A3BG 1NMGA 1Y1VH 2RDGA 4A3IG 1PZJD 1JE5A 2B2WA 5C44H 1F2LA 2A73B 3H0GG 3T53B 3RMHA 4MN3A 4CBVA 3H15A 4A4IA 1SROA 2UXDL 2JEAI 3BYTB 5D65A 1A2UA 4JI5L 3I4LA 4X65L 1K73C 2CHBD 3ONAB 1TWCB 1B8AA 4WORA 1SMYC 1GJXA 3C1EA 4YIJA 3OHXC 1ZYRC 4XTCS 2JA5B 2NZ1D 4L5SA 5KNBA 2JQOA 3TDQA 3CW2C 2R7FA 1SE8A 2K04A 2BH2A 2BCOA 3D3RA 3U9OA 3TREA 4DV7L 4GNXA 3SGIA 5LL6S 1MHWC 3J7AV 1D5ZC 1CSQA 4DV3L 1HNWL 4DGZA 4OX9Q 3PF5A 1VQ9A 5CGKA 2CW0D 2MHVA 3L9AX 2F3IA 2K28A 2WKDA 4YWMA 1ONLA 4A3BB 2I5HA 4A3IB 5LMUL 3RUZA 5ELOA 1Z6HA 1WOCA 3GTOB 1V1QA 3VYUA 2CVRA 1KLGD 1A0IA 4K0KL 1LTSD 1I4HA 2EY6A 2L12A 3M9BA 1FGUA 5GADC 5DM63 2F4VL 1HA6A 3S16B 1Q81C 4ABNA 4X64L 2B2UC 4LF9Q 3DWQA 3AB9A 4HIKA 3C46A 4KHPQ 2EDGA 3PUZA 3K7AH 2E76C 4JBWA 3G6JB 3KOJA 4R4TA 3HRZC 1C8CA 4GOPB 3UDXA 1GUWA 3RR5A 1N36L 4BY1H 2NTTA 1O78A 2CWPA 1PRTD 3T1YQ 4A3DB 3M85A 5M5WH 1K8GA 1YNND 2UUCL 4LF7Q 5EKIA 3M7GA 5DNFA 1WD1A 3CCRA 5ELEA 4JYAQ 2NVYH 4DUYL 2OQKA 1N33Q 1IL2A 2YTVA 4LFAQ 1K83H 3GTQH 2R7ZH 1E3PA 1JB7A 4B08A 4IUUA 1K9MC 2E5LL 5C4XG 4AQYL 1XPUA 5C3XA 4IUVA 4LFBQ 3PUXA 3EFXD 1BBWA 1PH9A 4G4KA 2LKVA 4IFDI 5I9PA 1E24A 5C6AA 1OTCA 1DM0B 2VB2X 4BWGB 1I4RA 2L0CA 1CZGA 2F52A 3V96A 5LMNL 1EQQA 4RGMA 1EY4A 2XGTA 1X56A 4PZ7A 4IPGA 1MD2D 3LWEA 3IRBA 3F2CA 4IJLA 4QUCA 1Y8OB 3CCSA 4R4IA 4QIWB 5BR8Q 1Z7TA 2YV5A 2CQAA
chains in the Genus database with same CATH topology
2XTIA 2YTYA 1JJ2A 1VQ4A 3HOWG 3CAMA 4NXMQ 3GTOH 1TWHH 1OXTA 4YY3L 1E22A 5M3MH 4JI7Q 1L1OC 3E0EA 3HKZE 4OONA 1VQPA 2JA6H 4LNQA 3UE1A 4A3GH 1XJVA 1VQCA 1WCMG 3GTKH 4A3CH 4P73A 1N34L 2ATWA 4BBSH 4OX9L 3T1HL 5C0XG 2UU9L 2RCNA 4GLXA 2BH8A 2Z6KC 3D31A 2JJQA 2K52A 3Q8DA 1P8LA 2DGYA 2VY3A 3JAMi 4X6AH 4JI2L 4TQUS 5M3FH 2D62A 2B63H 4A3DH 4DUZL 4YWLA 2NZOA 3OYYA 1X54A 4KHZA 5JEAG 2VNUD 4IO9A 4IOAA 2PI2A 3NELA 4DR7L 4OO1G 1YI2A 3KF8B 4A3KG 2QA4A 4QIWE 4EX5A 2RHSB 4LUZA 1I50H 2D0OA 4DR2Q 4LF4Q 4QY7A 1QUQB 4R4CA 3K7UC 3A0JA 3G6EA 2R92H 3K80C 4JI1Q 5AJ3L 3S15H 4LF9L 1BKBA 4KHPL 1HNXL 4DR5Q 1NJIC 4WJ4A 1ASYA 1Y14B 3MXNB 1CKOA 5FJ8H 2Q2UA 1Y1WH 3S1QH 3KDFB 5HY6A 4RG1A 1IBKL 1YEZA 5IP7G 4A3JH 1QUQA 3AFQA 1HNZQ 1SRUA 3CQZH 1RIPA 3F2DA 1KIXA 5C44G 2QEXA 4LF7L 4A93H 2GN5A 2BA1A 1YZ6A 1Z47A 1W3SA 3PSIA 2BA0A 1X3EA 4DR3L 4DKAC 2K75A 3KDFA 3KYHC 5IT9c 1PH3A 1VQ5A 2MNAA 4JYAL 4DV1L 4HIDA 1N33L 4OXPA 5JJIA 4DV0Q 4JI8Q 4B3TL 1A63A 4LFAL 3RN2A 1NY4A 2CQOA 1NBWA 3PF4A 3KF6B 1FJGL 4AIMA 3ULJA 4KLKA 1XNRQ 2NVXH 3E9IA 3ULPA 3PO3G 2Q2HA 4YCWA 4JI3L 3F1ZA 4BBRG 4DPGA 3HOZH 4LFCL 4LFBL 1XNQL 1C7YA 5IWAL 4L5QA 3I4NH 3KF6A 4O2DA 3DM3A 1BVSA 1SFOH 2I5LX 1VQ7A 4FDBA 4A3EG 5J3BA 4O0AA 2HHHQ 1YHQA 4DV2Q 4PG3A 3UE0A 3OTOQ 3CC2A 3HOXG 3HOUG 2MO0A 3CMAA 5IYCH 1B70B 4DK3C 1X3GA 4UP7A 3I55A 4JCVE 3CCVA 1PH2A 3ERSX 4X65Q 2JA7G 4R4OA 1PVOA 4DV6Q 3NEMA 2VQFQ 1QVGA 4UP9A 2KCMA 2KENA 3J80c 2C35B 1A62A 1YVCA 4UPAA 3CMEA 1VCIA 3GTMH 1AH9A 1L0WA 1VQ6A 1PYSB 1AE3A 1K0RA 2LSSA 3U4ZA 4A76A 2JK8A 2JE6I 1TWCH 1UE1A 1LM0A 2I5MX 2AHOB 2KCTA 2E2IH 1BBUA 4NXML 4A3DG 2MQHA 3MEFA 4JI7L 2OTLA 1M90C 1MJCA 4GKJQ 1QVFA 5C3EG 1HZ9A 4DV5Q 2ZJQA 1J5EQ 1HH2P 3S2DH 4A3FG 1G6PA 1TWFH 5IYBH 2ZJRA 4L5RC 4DV3Q 1WFQA 1KQSA 1C9OA 1HNWQ 4HJ5A 3CC4A 2E2JH 2HIVA 1CSPA 4B3MQ 1VQGA 1XMQL 3F8TA 1Q8KA 5IP9H 2GVAA 1Q1BA 1PA6A 1KRSA 2IT1A 4JI4Q 1VQ8A 1MKHA 1HJPA 1JJCB 2UXCQ 4NXNQ 2UUAQ 4BY1G 4GNXC 3H3VI 5IYDG 1EIFA 2B3GA 2VS1A 3K8AA 3HOYH 4POFA 1IBMQ 1DGSA 3PIOA 1LTLA 4MZ9A 2K4KA 1PH6A 4DR2L 4A3BH 4YWKA 1V9PA 4A3IH 4LF4L 5FLMG 1XMOQ 4B3SL 1H95A 4AYBG 1YJWA 3H0GH 2VL6A 4IPCA 4JOIC 4ME3A 4JI1L 2R7ZG 4X62Q 3TQYA 4DR5L 4XIGS 2ZJPA 2AKWB 2JA5G 5DLQE 2Y0SG 1Q86C 1PFSA 1JMCA 5IE8A 3STBC 5JJLA 1YNXA 1HNZL 4PZ6A 1K8AC 1SLJA 4DAYB 3S16H 2ALYB 4HJ8A 2K50A 4A3MH 4BA1I 4YHHQ 2IHEA 4GLVB 3GO5A 4HIMA 3ICEA 4IFDJ 5FLXc 3FKIH 2K14A 4LWCA 1E1OA 3TS0A 1EOVA 5GAGC 4DV0L 4JI8L 1Q7YC 3FP9A 1A8VA 4IOCA 1CKNB 3HOVG 2IY5B 1KAWA 3EBEA 2MO1A 3CPWA 1VQAA 4BXXG 1Q46A 1XNRL 2D0PA 2IHFA 1B7YB 2IX0A 2N49A 1PH5A 3NBHB 4DR1Q 4AQYQ 2JA8G 5GAEC 3M4OH 3KLWA 4JV5L 1JJGA 1N9WA 1CKMA 1YHAA 1CKNA 2LXKA 2OWOA 1XPOA 3AFPA 4QQBX 1U0LA 4X66Q 4IPHA 2JA6G 3K81C 5M3MG 3UDGA 5LMNQ 1YIJA 1QZHA 4GN3B 2HHHL 4DV2L 1EFWA 2EXDA 3OTOL 4GOPC 1MJEA 4DV4Q 4A3GG 1EYGA 1S40A 2VUMH 1VQNA 1Y1VG 4ALPA 1OXVA 4A3CG 5C0XI 1N32Q 1SR3A 3T1YL 3RZDH 2DUDA 3S24A 4HJ7A 1AE2A 1QZGA 3NENA 4BBSG 1TWAH 3KJOA 1IZ6A 2VQEL 2PI2E 3UDFA 1KHIA 4QJFA 2R93H 5K36G 3EN2A 3G71A 1PHJA 4OWWB 5M3FG 3UDIA 1HR0W 1L2FA 1MIUA 4JI0Q 2OCEA 2B63G 4DAMA 2NN6G 2YTXA 3EIVA 4UP8A 1UE7A 1Q12A 2AWNA 3CXCA 3CCUA 3PO2H 4OO1I 1KD1C 1GM5A 4P75A 1X3FA 1PH7A 2YU9H 1YJ9A 1L1OB 4GKJL 4DV5L 1J5EL 1ASZA 5LMNW 1NMFA 2WAQE 3PGZA 4GS3A 2R92G 2N3SA 2JA9A 2K5VA 4C3HH 4OWTB 3HFZB 1IXRA 1SN8A 2WP8J 3ZJYC 5M5YH 4B3ML 5GQOA 3ER0A 1VQEA 3GDEA 1L1OA 5FJ8G 2KHJA 1I3QH 3STBD 1Y1WG 1UE5A 4JI4L 2UXDQ 2PQAB 2H5XA 2E2HH 2WB1E 4A3LH 4NPSA 3PUWA 2UXCL 2OQ0A 2V1CC 1G291 4A3JG 2UUAL 1HZAA 3L2PA 4JI5Q 5HGQA 2A1AA 3L7ZC 4A93G 5C4XH 1IBML 4DR7Q 1P16A 4IJHA 5C0XJ 3PCOB 4LF6Q 2Y0SE 2Z6KA 2PQAA 1UEBA 5BR8L 2NN6I 1XPRA 1YITA 3AQQA 1G51A 1VQFA 2WFWA 4GKKQ 4IFDG 3I4MH 1Z9FA 4DV7Q 1PH1A 4X62L 1HNXQ 5H1SE 3S1NH 4YCVA 4BY7H 3BJUA 3D0FA 5JEAJ 2VW9A 4LF6L 3CCEA 4J15A 3S1RH 3PUYA 2IX1A 3HOZG 4B3RQ 1C0AA 3J81c 4R4QA 3I4NG 1VQDA 3RZOH 4A75A 4YHHL 4Y52H 1CUKA 1EUJA 2KHIA 2L15A 4DNIA 3I4OA 3F2BA 4RMFA 1S72A 4GOPA 5FLMH 2CKZB 1I94Q 5IYCG 1KL9A 4JC0A 2AWOA 2Q2IA 5LMUQ 1VQLA 3HOWH 1FJGQ 4JI6Q 3GTGH 3J7A5 4BA2I 1OXXK 4C3JH 4C3IH 4DR1L 2HQLA 1RL2A 3CCQA 1YBYA 2HIXA 4K0KQ 1PYBA 1EWIA 3RLFA 1WCMH 2F4VQ 3ULLA 4DR6Q 1V43A 2PMZE 3K0XA 4KI0A 3S2HH 4LUVA 3J80i 1KRTA 3JAMc 4X64Q 4LF8Q 4X66L 4L5TA 4R1JA 3GTJH 2EQSA 1VQHA 4PMWA 1S3OA 3E9HA 1OXSC 2MFIA 1IBLQ 2PNHA 2YYZA 4DV4L 3OW2A 4POGA 1TWGH 5IYBG 3TEHB 3G4SA 3PUVA 4LF5Q 5M5XH 1N36Q 2KBNA 2ASBA 1N8RC 1YJNA 4DR4Q 3U58A 1N32L 5JJKA 2ZM6Q 2HT1A 3RN5A 4LW1A 3U4VA 4MTNA 2UUCQ 2Z0SA 2AMCB 2ZTEA 4A3KH 2JEBI 4QGUA 1GD7A 2ZTDA 5IP9G 3LGJA 2OTJA 4DUYQ 1VQOA 3M4PA 4GLAC 5E7NA 3BU2A 1VQMA 4JI0L 1D7QA 3W5OA 2ZTCA 1D8LA 3A5ZB 1Q82C 1M1KC 4NB3A 3HOYG 2E5LQ 1IYJB 1X55A 3CCJA 1I6HH 1GKHA 3GD7A 1PH8A 1HR0Q 4JBMA 3CP0A 1KXLA 5IP7H 4A3BG 1NMGA 1Y1VH 4A3IG 1PH4A 3M4QA 1JE5A 5C44H 4YCUA 5ELNA 4WJ3M 2UXBQ 3H0GG 1UE6A 4UY8C 3B6YA 4DK6C 2NVQH 1NE3A 1XMQQ 4PZ8A 1VQJA 3H15A 4A4IA 2N8NA 1SROA 2UXDL 2JEAI 2A19A 3PIPA 3CC7A 2VZAA 1TXYA 3G48A 5C4JH 4JI5L 3CCLA 4X65L 4P72A 1K73C 2Q2TA 1B8AA 4GNXB 4DV6L 4A3MG 3PO3H 3A74A 1E1TA 1O7IA 4BBRH 2VQFL 1NTGA 4HIOA 4XTCS 3A5UA 3FKIG 3BZCA 2CCZA 2UUBQ 4L5SA 4LUOA 3GTLH 2JQOA 4HJAA 3CW2C 2R7FA 1SE8A 4B3SQ 1U5KA 5GAHC 2BH2A 2A8VA 1K3RA 4GKKL 4GNXA 3TREA 4DV7L 4YY3Q 3SGIA 1EQRA 1UWVA 4A3EH 1OXUA 1XTDA 2EIFA 3HOXH 3HOUH 3S1MH 4B3RL 5IY0A 2JA7H 1CSQA 1T9HA 4DV3L 1N34Q 1GO3E 1I5FA 3W1BA 3KJPA 3S17H 1HNWL 3HKSA 3M3YH 4OX9Q 4JOIA 3U50C 3T1HQ 3H3VH 2UU9Q 2K5HA 3HKZG 3PF5A 1VQ9A 5EAYA 2F3IA 1R9TH 1KC8C 4YWMA 3AYHB 2VUMG 4JI2Q 1I94L 2K5NA 2I5HA 1JT8A 4JBKA 5LMUL 1QVCA 4NXNL 4DUZQ 3RLNA 4AYBE 4GN5A 3GTPH 4JI6L 4H02A 5ELOA 2E8GA 1WOCA 3M7NA 1V1QA 1VS0A 1A0IA 5C3EH 4K0KL 4JV5Q 3I2ZA 4A3FH 2R93G 3M9BA 4JBJA 1FGUA 3W1GA 5GADC 2RHQB 3CF5A 2F4VL 1PV4A 1XMOL 4DR6L 2R6GA 2N78A 1Q81C 2QGQA 5AJ3Q 4X64L 3I56A 4LF8L 4LF9Q 3TS2A 3PO2G 4KHPQ 4HIKA 3TRZA 2RF4A 3PUZA 3K7AH 3J7ZC 4JBWA 1IBLL 3KOJA 4R4TA 1X6OA 3I7FA 1IBKQ 2B29A 1X9NA 4GOPB 4JG2A 3UDXA 4LF5L 3RR5A 2R7DA 3JC66 1N36L 4BY1H 2LXJA 2NVTH 1WI5A 2CWPA 4AH6A 3T1YQ 4DR4L 5IYDH 2ZM6L 3M85A 5M5WH 1K8GA 2CWAA 2UUCL 4LF7Q 2VQEQ 3RLOA 1LYLA 4DR3Q 3CCRA 4P74A 4JYAQ 3CPFA 2NVYH 5GROA 4DUYL 2OQKA 4DV1Q 1EIYB 1N33Q 1IL2A 2YTVA 4A3LG 4GN4B 4B3TQ 4LFAQ 1YHBA 1K83H 3CCMA 3GTQH 1GVPA 2R7ZH 4HJ9A 1E3PA 1VQBA 3S14H 3FHWA 1JB7A 1LUZA 1J6QA 1K9MC 3L0OA 1WJJA 2GVBA 2E5LL 2JA5H 4AQYL 5C4XG 1XPUA 3VDYA 4JI3Q 1HR0L 4LFCQ 3RNUA 4LFBQ 1VQKA 3PV0A 4APVA 1HZBA 1BBWA 1Q1EA 2NZHA 3PUXA 1PH9A 1XNQQ 5IWAQ 1X65A 4IFDI 1FVIA 2UXBL 1E24A 1OTCA 3I4MG 1SMXA 2CFMA 3WWVA 4EQ5A 4BY7G 4OWXB 3KFUA 1EQQA 2ES2A 2F52A 3AEVA 5LMNL 4C2MH 3DLLA 3J81j 2ID0A 1FL0A 2XGTA 4P71A 3HOVH 1X56A 2WAQG 4PZ7A 4IPGA 4QL5A 4BXXH 3IRBA 3F2CA 1E7ZA 4IJLA 1VQIA 2JA8H 1W2BA 3J81i 1HZCA 1WYDA 3CCSA 3BZKA 2UUBL 4R4IA 2I0QA 5BR8Q 3CD6A 2FXQA 2WB1G 4TVAB 4IPDA 4Y7NH 4MNOA 2YV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTI A;  2YTY A;  1JJ2 A;  1VQ4 A;  3HOW G;  3CAM A;  4NXM Q;  3GTO H;  1TWH H;  1OXT A;  4YY3 L;  1E22 A;  5M3M H;  4JI7 Q;  1L1O C;  3E0E A;  3HKZ E;  4OON A;  1VQP A;  2JA6 H;  4LNQ A;  3UE1 A;  4A3G H;  1XJV A;  1VQC A;  1WCM G;  3GTK H;  4A3C H;  4P73 A;  1N34 L;  2ATW A;  4BBS H;  4OX9 L;  3T1H L;  5C0X G;  2UU9 L;  2RCN A;  4GLX A;  2BH8 A;  2Z6K C;  3D31 A;  2JJQ A;  2K52 A;  3Q8D A;  1P8L A;  2DGY A;  2VY3 A;  3JAM i;  4X6A H;  4JI2 L;  4TQU S;  5M3F H;  2D62 A;  2B63 H;  4A3D H;  4DUZ L;  4YWL A;  2NZO A;  3OYY A;  1X54 A;  4KHZ A;  5JEA G;  2VNU D;  4IO9 A;  4IOA A;  2PI2 A;  3NEL A;  4DR7 L;  4OO1 G;  1YI2 A;  3KF8 B;  4A3K G;  2QA4 A;  4QIW E;  4EX5 A;  2RHS B;  4LUZ A;  1I50 H;  2D0O A;  4DR2 Q;  4LF4 Q;  4QY7 A;  1QUQ B;  4R4C A;  3K7U C;  3A0J A;  3G6E A;  2R92 H;  3K80 C;  4JI1 Q;  5AJ3 L;  3S15 H;  4LF9 L;  1BKB A;  4KHP L;  1HNX L;  4DR5 Q;  1NJI C;  4WJ4 A;  1ASY A;  1Y14 B;  3MXN B;  1CKO A;  5FJ8 H;  2Q2U A;  1Y1W H;  3S1Q H;  3KDF B;  5HY6 A;  4RG1 A;  1IBK L;  1YEZ A;  5IP7 G;  4A3J H;  1QUQ A;  3AFQ A;  1HNZ Q;  1SRU A;  3CQZ H;  1RIP A;  3F2D A;  1KIX A;  5C44 G;  2QEX A;  4LF7 L;  4A93 H;  2GN5 A;  2BA1 A;  1YZ6 A;  1Z47 A;  1W3S A;  3PSI A;  2BA0 A;  1X3E A;  4DR3 L;  4DKA C;  2K75 A;  3KDF A;  3KYH C;  5IT9 c;  1PH3 A;  1VQ5 A;  2MNA A;  4JYA L;  4DV1 L;  4HID A;  1N33 L;  4OXP A;  5JJI A;  4DV0 Q;  4JI8 Q;  4B3T L;  1A63 A;  4LFA L;  3RN2 A;  1NY4 A;  2CQO A;  1NBW A;  3PF4 A;  3KF6 B;  1FJG L;  4AIM A;  3ULJ A;  4KLK A;  1XNR Q;  2NVX H;  3E9I A;  3ULP A;  3PO3 G;  2Q2H A;  4YCW A;  4JI3 L;  3F1Z A;  4BBR G;  4DPG A;  3HOZ H;  4LFC L;  4LFB L;  1XNQ L;  1C7Y A;  5IWA L;  4L5Q A;  3I4N H;  3KF6 A;  4O2D A;  3DM3 A;  1BVS A;  1SFO H;  2I5L X;  1VQ7 A;  4FDB A;  4A3E G;  5J3B A;  4O0A A;  2HHH Q;  1YHQ A;  4DV2 Q;  4PG3 A;  3UE0 A;  3OTO Q;  3CC2 A;  3HOX G;  3HOU G;  2MO0 A;  3CMA A;  5IYC H;  1B70 B;  4DK3 C;  1X3G A;  4UP7 A;  3I55 A;  4JCV E;  3CCV A;  1PH2 A;  3ERS X;  4X65 Q;  2JA7 G;  4R4O A;  1PVO A;  4DV6 Q;  3NEM A;  2VQF Q;  1QVG A;  4UP9 A;  2KCM A;  2KEN A;  3J80 c;  2C35 B;  1A62 A;  1YVC A;  4UPA A;  3CME A;  1VCI A;  3GTM H;  1AH9 A;  1L0W A;  1VQ6 A;  1PYS B;  1AE3 A;  1K0R A;  2LSS A;  3U4Z A;  4A76 A;  2JK8 A;  2JE6 I;  1TWC H;  1UE1 A;  1LM0 A;  2I5M X;  2AHO B;  2KCT A;  2E2I H;  1BBU A;  4NXM L;  4A3D G;  2MQH A;  3MEF A;  4JI7 L;  2OTL A;  1M90 C;  1MJC A;  4GKJ Q;  1QVF A;  5C3E G;  1HZ9 A;  4DV5 Q;  2ZJQ A;  1J5E Q;  1HH2 P;  3S2D H;  4A3F G;  1G6P A;  1TWF H;  5IYB H;  2ZJR A;  4L5R C;  4DV3 Q;  1WFQ A;  1KQS A;  1C9O A;  1HNW Q;  4HJ5 A;  3CC4 A;  2E2J H;  2HIV A;  1CSP A;  4B3M Q;  1VQG A;  1XMQ L;  3F8T A;  1Q8K A;  5IP9 H;  2GVA A;  1Q1B A;  1PA6 A;  1KRS A;  2IT1 A;  4JI4 Q;  1VQ8 A;  1MKH A;  1HJP A;  1JJC B;  2UXC Q;  4NXN Q;  2UUA Q;  4BY1 G;  4GNX C;  3H3V I;  5IYD G;  1EIF A;  2B3G A;  2VS1 A;  3K8A A;  3HOY H;  4POF A;  1IBM Q;  1DGS A;  3PIO A;  1LTL A;  4MZ9 A;  2K4K A;  1PH6 A;  4DR2 L;  4A3B H;  4YWK A;  1V9P A;  4A3I H;  4LF4 L;  5FLM G;  1XMO Q;  4B3S L;  1H95 A;  4AYB G;  1YJW A;  3H0G H;  2VL6 A;  4IPC A;  4JOI C;  4ME3 A;  4JI1 L;  2R7Z G;  4X62 Q;  3TQY A;  4DR5 L;  4XIG S;  2ZJP A;  2AKW B;  2JA5 G;  5DLQ E;  2Y0S G;  1Q86 C;  1PFS A;  1JMC A;  5IE8 A;  3STB C;  5JJL A;  1YNX A;  1HNZ L;  4PZ6 A;  1K8A C;  1SLJ A;  4DAY B;  3S16 H;  2ALY B;  4HJ8 A;  2K50 A;  4A3M H;  4BA1 I;  4YHH Q;  2IHE A;  4GLV B;  3GO5 A;  4HIM A;  3ICE A;  4IFD J;  5FLX c;  3FKI H;  2K14 A;  4LWC A;  1E1O A;  3TS0 A;  1EOV A;  5GAG C;  4DV0 L;  4JI8 L;  1Q7Y C;  3FP9 A;  1A8V A;  4IOC A;  1CKN B;  3HOV G;  2IY5 B;  1KAW A;  3EBE A;  2MO1 A;  3CPW A;  1VQA A;  4BXX G;  1Q46 A;  1XNR L;  2D0P A;  2IHF A;  1B7Y B;  2IX0 A;  2N49 A;  1PH5 A;  3NBH B;  4DR1 Q;  4AQY Q;  2JA8 G;  5GAE C;  3M4O H;  3KLW A;  4JV5 L;  1JJG A;  1N9W A;  1CKM A;  1YHA A;  1CKN A;  2LXK A;  2OWO A;  1XPO A;  3AFP A;  4QQB X;  1U0L A;  4X66 Q;  4IPH A;  2JA6 G;  3K81 C;  5M3M G;  3UDG A;  5LMN Q;  1YIJ A;  1QZH A;  4GN3 B;  2HHH L;  4DV2 L;  1EFW A;  2EXD A;  3OTO L;  4GOP C;  1MJE A;  4DV4 Q;  4A3G G;  1EYG A;  1S40 A;  2VUM H;  1VQN A;  1Y1V G;  4ALP A;  1OXV A;  4A3C G;  5C0X I;  1N32 Q;  1SR3 A;  3T1Y L;  3RZD H;  2DUD A;  3S24 A;  4HJ7 A;  1AE2 A;  1QZG A;  3NEN A;  4BBS G;  1TWA H;  3KJO A;  1IZ6 A;  2VQE L;  2PI2 E;  3UDF A;  1KHI A;  4QJF A;  2R93 H;  5K36 G;  3EN2 A;  3G71 A;  1PHJ A;  4OWW B;  5M3F G;  3UDI A;  1HR0 W;  1L2F A;  1MIU A;  4JI0 Q;  2OCE A;  2B63 G;  4DAM A;  2NN6 G;  2YTX A;  3EIV A;  4UP8 A;  1UE7 A;  1Q12 A;  2AWN A;  3CXC A;  3CCU A;  3PO2 H;  4OO1 I;  1KD1 C;  1GM5 A;  4P75 A;  1X3F A;  1PH7 A;  2YU9 H;  1YJ9 A;  1L1O B;  4GKJ L;  4DV5 L;  1J5E L;  1ASZ A;  5LMN W;  1NMF A;  2WAQ E;  3PGZ A;  4GS3 A;  2R92 G;  2N3S A;  2JA9 A;  2K5V A;  4C3H H;  4OWT B;  3HFZ B;  1IXR A;  1SN8 A;  2WP8 J;  3ZJY C;  5M5Y H;  4B3M L;  5GQO A;  3ER0 A;  1VQE A;  3GDE A;  1L1O A;  5FJ8 G;  2KHJ A;  1I3Q H;  3STB D;  1Y1W G;  1UE5 A;  4JI4 L;  2UXD Q;  2PQA B;  2H5X A;  2E2H H;  2WB1 E;  4A3L H;  4NPS A;  3PUW A;  2UXC L;  2OQ0 A;  2V1C C;  1G29 1;  4A3J G;  2UUA L;  1HZA A;  3L2P A;  4JI5 Q;  5HGQ A;  2A1A A;  3L7Z C;  4A93 G;  5C4X H;  1IBM L;  4DR7 Q;  1P16 A;  4IJH A;  5C0X J;  3PCO B;  4LF6 Q;  2Y0S E;  2Z6K A;  2PQA A;  1UEB A;  5BR8 L;  2NN6 I;  1XPR A;  1YIT A;  3AQQ A;  1G51 A;  1VQF A;  2WFW A;  4GKK Q;  4IFD G;  3I4M H;  1Z9F A;  4DV7 Q;  1PH1 A;  4X62 L;  1HNX Q;  5H1S E;  3S1N H;  4YCV A;  4BY7 H;  3BJU A;  3D0F A;  5JEA J;  2VW9 A;  4LF6 L;  3CCE A;  4J15 A;  3S1R H;  3PUY A;  2IX1 A;  3HOZ G;  4B3R Q;  1C0A A;  3J81 c;  4R4Q A;  3I4N G;  1VQD A;  3RZO H;  4A75 A;  4YHH L;  4Y52 H;  1CUK A;  1EUJ A;  2KHI A;  2L15 A;  4DNI A;  3I4O A;  3F2B A;  4RMF A;  1S72 A;  4GOP A;  5FLM H;  2CKZ B;  1I94 Q;  5IYC G;  1KL9 A;  4JC0 A;  2AWO A;  2Q2I A;  5LMU Q;  1VQL A;  3HOW H;  1FJG Q;  4JI6 Q;  3GTG H;  3J7A 5;  4BA2 I;  1OXX K;  4C3J H;  4C3I H;  4DR1 L;  2HQL A;  1RL2 A;  3CCQ A;  1YBY A;  2HIX A;  4K0K Q;  1PYB A;  1EWI A;  3RLF A;  1WCM H;  2F4V Q;  3ULL A;  4DR6 Q;  1V43 A;  2PMZ E;  3K0X A;  4KI0 A;  3S2H H;  4LUV A;  3J80 i;  1KRT A;  3JAM c;  4X64 Q;  4LF8 Q;  4X66 L;  4L5T A;  4R1J A;  3GTJ H;  2EQS A;  1VQH A;  4PMW A;  1S3O A;  3E9H A;  1OXS C;  2MFI A;  1IBL Q;  2PNH A;  2YYZ A;  4DV4 L;  3OW2 A;  4POG A;  1TWG H;  5IYB G;  3TEH B;  3G4S A;  3PUV A;  4LF5 Q;  5M5X H;  1N36 Q;  2KBN A;  2ASB A;  1N8R C;  1YJN A;  4DR4 Q;  3U58 A;  1N32 L;  5JJK A;  2ZM6 Q;  2HT1 A;  3RN5 A;  4LW1 A;  3U4V A;  4MTN A;  2UUC Q;  2Z0S A;  2AMC B;  2ZTE A;  4A3K H;  2JEB I;  4QGU A;  1GD7 A;  2ZTD A;  5IP9 G;  3LGJ A;  2OTJ A;  4DUY Q;  1VQO A;  3M4P A;  4GLA C;  5E7N A;  3BU2 A;  1VQM A;  4JI0 L;  1D7Q A;  3W5O A;  2ZTC A;  1D8L A;  3A5Z B;  1Q82 C;  1M1K C;  4NB3 A;  3HOY G;  2E5L Q;  1IYJ B;  1X55 A;  3CCJ A;  1I6H H;  1GKH A;  3GD7 A;  1PH8 A;  1HR0 Q;  4JBM A;  3CP0 A;  1KXL A;  5IP7 H;  4A3B G;  1NMG A;  1Y1V H;  4A3I G;  1PH4 A;  3M4Q A;  1JE5 A;  5C44 H;  4YCU A;  5ELN A;  4WJ3 M;  2UXB Q;  3H0G G;  1UE6 A;  4UY8 C;  3B6Y A;  4DK6 C;  2NVQ H;  1NE3 A;  1XMQ Q;  4PZ8 A;  1VQJ A;  3H15 A;  4A4I A;  2N8N A;  1SRO A;  2UXD L;  2JEA I;  2A19 A;  3PIP A;  3CC7 A;  2VZA A;  1TXY A;  3G48 A;  5C4J H;  4JI5 L;  3CCL A;  4X65 L;  4P72 A;  1K73 C;  2Q2T A;  1B8A A;  4GNX B;  4DV6 L;  4A3M G;  3PO3 H;  3A74 A;  1E1T A;  1O7I A;  4BBR H;  2VQF L;  1NTG A;  4HIO A;  4XTC S;  3A5U A;  3FKI G;  3BZC A;  2CCZ A;  2UUB Q;  4L5S A;  4LUO A;  3GTL H;  2JQO A;  4HJA A;  3CW2 C;  2R7F A;  1SE8 A;  4B3S Q;  1U5K A;  5GAH C;  2BH2 A;  2A8V A;  1K3R A;  4GKK L;  4GNX A;  3TRE A;  4DV7 L;  4YY3 Q;  3SGI A;  1EQR A;  1UWV A;  4A3E H;  1OXU A;  1XTD A;  2EIF A;  3HOX H;  3HOU H;  3S1M H;  4B3R L;  5IY0 A;  2JA7 H;  1CSQ A;  1T9H A;  4DV3 L;  1N34 Q;  1GO3 E;  1I5F A;  3W1B A;  3KJP A;  3S17 H;  1HNW L;  3HKS A;  3M3Y H;  4OX9 Q;  4JOI A;  3U50 C;  3T1H Q;  3H3V H;  2UU9 Q;  2K5H A;  3HKZ G;  3PF5 A;  1VQ9 A;  5EAY A;  2F3I A;  1R9T H;  1KC8 C;  4YWM A;  3AYH B;  2VUM G;  4JI2 Q;  1I94 L;  2K5N A;  2I5H A;  1JT8 A;  4JBK A;  5LMU L;  1QVC A;  4NXN L;  4DUZ Q;  3RLN A;  4AYB E;  4GN5 A;  3GTP H;  4JI6 L;  4H02 A;  5ELO A;  2E8G A;  1WOC A;  3M7N A;  1V1Q A;  1VS0 A;  1A0I A;  5C3E H;  4K0K L;  4JV5 Q;  3I2Z A;  4A3F H;  2R93 G;  3M9B A;  4JBJ A;  1FGU A;  3W1G A;  5GAD C;  2RHQ B;  3CF5 A;  2F4V L;  1PV4 A;  1XMO L;  4DR6 L;  2R6G A;  2N78 A;  1Q81 C;  2QGQ A;  5AJ3 Q;  4X64 L;  3I56 A;  4LF8 L;  4LF9 Q;  3TS2 A;  3PO2 G;  4KHP Q;  4HIK A;  3TRZ A;  2RF4 A;  3PUZ A;  3K7A H;  3J7Z C;  4JBW A;  1IBL L;  3KOJ A;  4R4T A;  1X6O A;  3I7F A;  1IBK Q;  2B29 A;  1X9N A;  4GOP B;  4JG2 A;  3UDX A;  4LF5 L;  3RR5 A;  2R7D A;  3JC6 6;  1N36 L;  4BY1 H;  2LXJ A;  2NVT H;  1WI5 A;  2CWP A;  4AH6 A;  3T1Y Q;  4DR4 L;  5IYD H;  2ZM6 L;  3M85 A;  5M5W H;  1K8G A;  2CWA A;  2UUC L;  4LF7 Q;  2VQE Q;  3RLO A;  1LYL A;  4DR3 Q;  3CCR A;  4P74 A;  4JYA Q;  3CPF A;  2NVY H;  5GRO A;  4DUY L;  2OQK A;  4DV1 Q;  1EIY B;  1N33 Q;  1IL2 A;  2YTV A;  4A3L G;  4GN4 B;  4B3T Q;  4LFA Q;  1YHB A;  1K83 H;  3CCM A;  3GTQ H;  1GVP A;  2R7Z H;  4HJ9 A;  1E3P A;  1VQB A;  3S14 H;  3FHW A;  1JB7 A;  1LUZ A;  1J6Q A;  1K9M C;  3L0O A;  1WJJ A;  2GVB A;  2E5L L;  2JA5 H;  4AQY L;  5C4X G;  1XPU A;  3VDY A;  4JI3 Q;  1HR0 L;  4LFC Q;  3RNU A;  4LFB Q;  1VQK A;  3PV0 A;  4APV A;  1HZB A;  1BBW A;  1Q1E A;  2NZH A;  3PUX A;  1PH9 A;  1XNQ Q;  5IWA Q;  1X65 A;  4IFD I;  1FVI A;  2UXB L;  1E24 A;  1OTC A;  3I4M G;  1SMX A;  2CFM A;  3WWV A;  4EQ5 A;  4BY7 G;  4OWX B;  3KFU A;  1EQQ A;  2ES2 A;  2F52 A;  3AEV A;  5LMN L;  4C2M H;  3DLL A;  3J81 j;  2ID0 A;  1FL0 A;  2XGT A;  4P71 A;  3HOV H;  1X56 A;  2WAQ G;  4PZ7 A;  4IPG A;  4QL5 A;  4BXX H;  3IRB A;  3F2C A;  1E7Z A;  4IJL A;  1VQI A;  2JA8 H;  1W2B A;  3J81 i;  1HZC A;  1WYD A;  3CCS A;  3BZK A;  2UUB L;  4R4I A;  2I0Q A;  5BR8 Q;  3CD6 A;  2FXQ A;  2WB1 G;  4TVA B;  4IPD A;  4Y7N H;  4MNO A;  2YV5 A; 
#chains in the Genus database with same CATH topology
 2XTI A;  4O1N A;  5EKL A;  5I2Y A;  4NXM Q;  5M5Y B;  4JI7 Q;  4C3I G;  4LNQ A;  3S2H B;  2EE1 A;  4B9W A;  1VQC A;  1WCM G;  1DXM A;  4OX9 L;  1KDA A;  2RCN A;  3NP8 A;  3ZYY X;  1NSN S;  3EQL C;  4GLX A;  5JPN C;  2JJQ A;  1P8L A;  1GUN A;  2VY3 A;  4X6A H;  2PYK A;  1X3P A;  4RKB A;  4TQU S;  3VA7 A;  3O13 A;  4K2L A;  4X3S A;  1CZW A;  3A7L A;  4HTH A;  3S1N B;  4IOA A;  1YI2 A;  4EX5 A;  1FD7 D;  2FJ2 A;  5EPL A;  2E74 C;  1QUQ B;  1TWF B;  3QO2 A;  3K7U C;  4R4C A;  1D2B A;  3S15 H;  2DNC A;  4LF9 L;  4KHP L;  2XWJ B;  1ASY A;  1ML0 D;  2P5Z X;  3S1Q H;  5CV8 A;  3KDF B;  4RG1 A;  2PZW A;  1HNZ Q;  1SRU A;  3CQZ H;  1EY7 A;  4LF7 L;  1Z47 A;  1ET6 A;  3PSI A;  1X3E A;  5T1I A;  4JYA L;  1VQ5 A;  3MZ5 A;  2SNM A;  1SYC A;  1N33 L;  1S5E D;  2XN9 C;  1WCM B;  1A63 A;  4LFA L;  3PF4 A;  1SYF A;  2CH4 A;  2TSS A;  3KF6 B;  5CV7 A;  1FJG L;  1JOK A;  3NE5 B;  4XQJ A;  1SNC A;  1PFM A;  3HS0 C;  4LFB L;  1KDB A;  1SYD A;  4V19 0;  4L5Q A;  3I4N H;  5M5X B;  3DM3 A;  2JXM B;  3K5L A;  4DFA A;  2I5L X;  2QDL A;  3VYS A;  4A3E G;  1CFM A;  4L8J A;  4RHR A;  3CC2 A;  3HOU G;  5IYC H;  4DK3 C;  1PTO H;  1X3G A;  3I55 A;  2JA7 G;  2R3Z A;  1PH2 A;  2EYM A;  1PVO A;  4R4O A;  3V2T A;  1NCV A;  4C1N K;  2VQF Q;  1QVG A;  4UPA A;  4DU9 A;  1AH9 A;  1L0W A;  1VQ6 A;  1O80 A;  1AE3 A;  2LSS A;  2XVS A;  4H0L C;  4A76 A;  2JK8 A;  1TWC H;  1UE1 A;  4NXM L;  2AHO B;  1V8Q A;  4XT3 B;  4JI7 L;  2JYO A;  3EA6 A;  1I4P A;  3BVM A;  1HZ9 A;  2ZJQ A;  2SOB A;  4PQX A;  3T13 A;  4L5R C;  3OSO A;  5C4J B;  1C9O A;  3P1H A;  4HJ5 A;  5ELC A;  2NBF A;  1PA6 A;  1Q90 A;  3OPO A;  1Q1B A;  1KRS A;  4M1U B;  1VQ8 A;  1PXU A;  2Z9H A;  5IYD G;  1EIF A;  2HDL A;  2EYL A;  4NKL A;  4OEM B;  4HSV A;  1IBM Q;  3PIO A;  5DM7 3;  1PH6 A;  4A3B H;  4FP5 D;  4A3I H;  5I9O A;  2JA7 B;  3FRP B;  3H0G H;  4JOI C;  4IPC A;  3TQY A;  2ZJP A;  1E2V A;  2HUG A;  4KY5 A;  1YNX A;  1HNZ L;  3DHQ A;  3S16 H;  1B1Z A;  1JQY D;  4IUR A;  4YHH Q;  2F0L A;  3ICE A;  1L0Y B;  5FLX c;  1ZXT A;  4LWC A;  1E1O A;  1EOV A;  3OWE B;  5F2D A;  2K01 A;  3HOV G;  5IGE A;  1A8V A;  1CKN B;  4DAY A;  1KAW A;  4I65 A;  4BXX G;  3C3L A;  1M8A A;  4FXD A;  5FO9 B;  2JA8 G;  5GAE C;  2O2L D;  2XIW A;  3TP6 A;  2I46 A;  4CGY B;  3I70 A;  1YHA A;  3K5O A;  4RKL A;  1STB A;  4QQB X;  3FEW X;  1EEI D;  4IPH A;  2JA6 G;  3UDG A;  3SK8 A;  1EFW A;  2EXD A;  3J7A F;  2OXP A;  1VQN A;  5IT9 E;  5G3L D;  1Y1V G;  5KEE A;  5C0X I;  4HJ7 A;  1AE2 A;  3S14 B;  5D3I B;  1I4Q A;  1YNJ D;  2FHT A;  5M3F G;  1HR0 W;  4JI0 Q;  1L2F A;  1H9S A;  2B63 G;  4DAM A;  2NN6 G;  2YTX A;  1UE7 A;  3CCU A;  5EBC A;  1M4V A;  2WIN B;  2N88 A;  1CTM A;  1FGB D;  4C2M B;  4Z9C B;  1E2Z A;  1STY A;  3HOV B;  4QMG A;  4F7X A;  5EPJ A;  5IIF A;  4MHE A;  2K5V A;  5M5Y H;  1S72 A;  3HFZ B;  2V4D A;  2F0U A;  2WP8 J;  1RD9 D;  5GQO A;  1BCP D;  3GDE A;  2JA8 B;  3S2H H;  2R61 A;  1UE5 A;  2WB1 E;  3BVG A;  2V1C C;  1STN A;  3L2P A;  2QDB A;  1CM9 A;  3H94 A;  3NTK A;  2Q8I B;  1H9J A;  1TWH B;  5C4X H;  4QF4 A;  1IBM L;  1P16 A;  2JA6 B;  1SBB B;  4IJH A;  3PCO B;  4LF6 Q;  1LTR D;  4LMQ D;  2NN6 I;  2F0H A;  3AQQ A;  1Y1V B;  2PMZ B;  4GKK Q;  1EU4 A;  3S1N H;  1PH1 A;  3D0F A;  5JEA J;  3U9S A;  1PTO C;  2Q8R E;  5M3F B;  2B63 B;  1NNX A;  1RTN A;  3RZO H;  4XYO A;  4YHH L;  1FNU A;  1O7Y A;  2L15 A;  2NYZ D;  2A68 C;  3Q6S A;  2K1B A;  4GOP A;  1BBX C;  1I94 Q;  1STE A;  4JC0 A;  2Q2I A;  4JI6 Q;  1ENF A;  1WTR A;  1OXX K;  5IGD A;  4XXE A;  4C3I H;  1RL2 A;  3VR5 A;  2HIX A;  4UAI A;  4FVM A;  1SND A;  1WCM H;  4C56 C;  1MSH A;  1V43 A;  3K0X A;  1KRT A;  3NUC A;  2RA4 A;  2WII B;  5A2Q L;  4R1J A;  2EQS A;  3R2T A;  4N8X 1;  4PMW A;  1S3O A;  3E9H A;  3D4D A;  3OW2 A;  4POG A;  3G4S A;  2ASB A;  5M5X H;  2F0N A;  2KBN A;  1EU3 A;  4DR4 Q;  4FYD A;  2DJG C;  3RN5 A;  4MTN A;  5IOC A;  2AMC B;  5NUC A;  3TME A;  4QGU A;  2B2T A;  2ZTD A;  5IP9 G;  3LGJ A;  1EIG A;  1KDC A;  1EWC A;  4JI0 L;  2B2Y A;  3D8G A;  3W5O A;  1C48 A;  3NQT A;  5C4H A;  4NB3 A;  2AQ3 B;  3SHL A;  3CCJ A;  1I6H H;  1ICF B;  3K7A B;  2F0S A;  1TKW B;  4KK7 A;  1NAP A;  3M4Q A;  2EOT A;  2EYF A;  3D4R A;  4YCU A;  1GHK A;  2UXB Q;  5C5M A;  1UE6 A;  4UY8 C;  5M5W B;  3MAQ A;  1XMQ Q;  4PZ8 A;  3MFY A;  2N8N A;  2A19 A;  2KOL A;  5E4W C;  1KNE A;  2NVY B;  2VZA A;  3PIP A;  5C4J H;  1TQO A;  3T51 B;  1GUT A;  1K83 B;  4DV6 L;  1U4R A;  3J7Y W;  1O7I A;  4LF6 L;  3A5U A;  3FKI G;  4RGT A;  3S2D B;  3SK4 A;  4B3S Q;  1K3R A;  4GKK L;  1ENC A;  3IKJ A;  3A55 A;  1B50 A;  4A3E H;  1EQR A;  1UWV A;  4HAE A;  4RHS A;  4CDE C;  2OF1 A;  2EIF A;  2KEC A;  3HOU H;  5IY0 A;  2JA7 H;  1T9H A;  1LT5 D;  2PO4 A;  3HKS A;  3BS1 A;  3U50 C;  2UU9 Q;  2K5H A;  5AFW A;  1VF5 C;  1I94 L;  2EJM A;  2K5N A;  4NXN L;  1X3Q A;  4GN5 A;  5LHY 1;  4JI6 L;  3E5S A;  4I7Z C;  1WTW A;  1U9R A;  3DM1 A;  2A5H A;  2LS0 1;  2A6E D;  2RHQ B;  2R6G A;  4ILW A;  2QGQ A;  5AJ3 Q;  3J81 E;  3TS2 A;  3PO2 G;  1D5X C;  3NPP A;  4XQN A;  2NWG A;  5CV9 A;  3BG3 A;  3URY A;  1O7L A;  3FKI B;  1X9N A;  5J22 A;  1AFP A;  4DR4 L;  5IYD H;  2QW7 A;  4PMB A;  2CWA A;  2F0O A;  4UDU C;  1STA A;  5GRO A;  4A3L G;  4FXK C;  4GN4 B;  4B3T Q;  1T5E A;  5BN5 A;  1YHB A;  1B2T A;  1GVP A;  2E75 C;  2K33 A;  5CV6 A;  2O5J C;  3GV3 A;  3S14 H;  2HCC A;  4KJN A;  3MHB A;  1DZ1 A;  3JAM E;  1WJJ A;  1JOQ A;  2DJF C;  1JE4 A;  4LFC Q;  1PDQ A;  1XNQ Q;  1VDZ A;  2EYJ A;  4RCO A;  1K28 A;  5IWA Q;  1X65 A;  1FVI A;  1QB5 D;  3CQZ B;  2UXB L;  3RZD B;  3I4M G;  2CFM A;  3FPP A;  2D2C C;  4OWX B;  1TWA B;  3TP5 A;  3G7L A;  4C2M H;  3DLL A;  5EQ0 A;  2ID0 A;  1YNJ C;  1EY8 A;  3AU7 A;  3HOV H;  1HA5 A;  1E0B A;  4QL5 A;  4BXX H;  1EY0 A;  2QIL A;  4R8N A;  3PO2 B;  1SJE D;  1VQI A;  2JA8 H;  4LJZ C;  3J81 L;  2I0Q A;  3GP7 A;  2WB1 G;  1G2T A;  4Y7N H;  4MNO A;  3KLW A;  2YTY A;  1S4Z A;  2RCF A;  1JJ2 A;  3HOW G;  1TWH H;  2G9D A;  1E22 A;  2JA6 H;  3E0E A;  3HKZ E;  1VQP A;  3Q0A A;  3UE1 A;  1I3Q B;  3QOL A;  1XJV A;  1PTO B;  2GA4 B;  2F3V A;  1B3A A;  2UU9 L;  3MEH A;  2Z6B A;  3N6R A;  4ZRZ A;  4OIJ A;  3GQB A;  4X3T A;  3JAM L;  5M3F H;  2B63 H;  1XX8 A;  2NN6 H;  3MXP A;  1W6J A;  5KYI A;  1X54 A;  4KHZ A;  5JEA G;  3EVQ A;  2PI2 A;  1CHQ D;  4DR7 L;  4OO1 G;  4G7H C;  4A3K G;  1VMP A;  2RHS B;  3KBG A;  1I50 H;  4CKE A;  1XTC D;  4QY7 A;  1L0X B;  3A0J A;  1EL0 A;  2HDM A;  5C3W A;  5AJ3 L;  5EBD A;  1HNX L;  4IQZ A;  3NXW A;  3KLS X;  3KF8 A;  2EJF C;  1G2S A;  5JVH 3;  2K32 A;  2MUY A;  4H44 C;  3HOW B;  1BXT A;  1CHP D;  2GN5 A;  2BA1 A;  2XRS D;  3MXN A;  1PH3 A;  1RTO A;  3HEJ A;  1QOH A;  1H9R A;  5JJI A;  4DV0 Q;  1CQV A;  1U4M A;  2Q8T A;  4B3T L;  2KJX A;  1XNR Q;  3H0G B;  3VYT A;  3PO3 G;  1VMC A;  2SEB D;  4H13 C;  4YCW A;  4BBR G;  4DPG A;  4LFC L;  1FYC A;  2EY2 A;  1XNQ L;  1HTL D;  5IWA L;  1BVS A;  2RBM A;  2N55 A;  1V1P B;  1B9M A;  5I4D A;  4O0A A;  4A3K B;  5FKA C;  5CC4 A;  3HOX G;  2F0W A;  1EOT A;  1B70 B;  3CCV A;  1OO9 B;  2D5D A;  1ICW A;  3NEM A;  4RCN A;  4F88 A;  5CMD A;  1GUO A;  2KEN A;  3J80 c;  3CME A;  1A62 A;  3GTM H;  3K6O A;  1S5D D;  2G5D A;  5IGF A;  3Q22 A;  3NWS A;  2B2W C;  2JE6 I;  2I5M X;  2KCT A;  2MQH A;  2ENB A;  2E2D C;  2NVQ B;  4EVO A;  1D1K A;  1QVF A;  5C3E G;  4ZK9 B;  1HH2 P;  4N9P A;  3K5M A;  3S2D H;  2EYH A;  2ZJR A;  3IAY A;  3K5N A;  4KY7 A;  1LTG D;  2HIV A;  3OIP A;  5FOB B;  1VQG A;  1BQQ T;  5IP9 H;  1B4O A;  1LTI D;  4JI4 Q;  4BBR B;  5BN4 A;  4ULL A;  1MKH A;  3RD4 A;  1HJP A;  2XNA C;  2UXC Q;  1HQM C;  4GNX C;  2B3G A;  3K8A A;  4POF A;  3LNN A;  1HFN A;  1WVL A;  3L3O C;  1JWS D;  1V9P A;  3S1M B;  1XMO Q;  5IOD A;  1RJT A;  1H95 A;  3S17 B;  2VL6 A;  4IZ8 A;  5EPK A;  3M3Y B;  5ISR A;  1JWU D;  2Y0S G;  1Q86 C;  1D1I A;  4ZUI A;  3STB C;  1IW7 D;  5JJL A;  1A3T A;  1K8A C;  4HJ8 A;  2K50 A;  4PNY A;  3GTP B;  5EJW A;  2HD3 A;  4GLV B;  3V05 A;  3FDT A;  5C4X B;  3FKI H;  1KAA A;  2ZXP A;  5C3E B;  1C4Q A;  5GAG C;  1HQR D;  2RSO A;  4DV0 L;  1Q7Y C;  2IY5 B;  2BE5 D;  4IUP A;  1QWY A;  3EBE A;  1VQA A;  4I7A A;  5IGG A;  1QNK A;  2D0P A;  2IX0 A;  1JWM D;  1XNR L;  4DR1 Q;  1MI2 A;  1RF2 D;  2MGS A;  2VXW A;  4NMZ A;  1JJG A;  4E6I A;  3K57 A;  2LXK A;  3HG9 A;  1XPO A;  3AFP A;  3RZO B;  2X69 A;  3NBH A;  5E4X A;  4GN3 B;  1HTP A;  3NTI A;  3CHB D;  4A3G G;  1GUG A;  1EYG A;  1XYI A;  1EQV A;  4ALP A;  4A3C G;  2XSC A;  1GUS A;  1TR5 A;  3T1Y L;  3RZD H;  2JSO A;  3S24 A;  1A6X A;  5I2X A;  4BBS G;  3IL8 A;  4KKS A;  1TWA H;  1IZ6 A;  3UDF A;  4C3I B;  4QJF A;  2Y0S B;  5K36 G;  3EN2 A;  3G71 A;  4OWW B;  1R4Q B;  3UDI A;  3EIV A;  4WFN 3;  3PO2 H;  1QIL A;  2DY7 A;  2PPB C;  4RA8 A;  2YU9 H;  1EY5 A;  1QJO A;  1CI3 M;  1ASZ A;  1JC7 A;  1ET9 A;  3QG1 A;  5LMN W;  2XWB B;  1A15 A;  2WAQ E;  1EEF D;  2PQE A;  2N3S A;  4GS3 A;  4OWT B;  1SN8 A;  4PMC A;  3QB3 A;  1HFG A;  1L1O A;  5FJ8 G;  2KHJ A;  1I3Q H;  1Y1W G;  2A69 D;  2LFN A;  4JI4 L;  3OW7 A;  3PMF A;  1J8I A;  4A3L H;  4NPS A;  2UXC L;  1W6K A;  2OQ0 A;  4A3J G;  5HGQ A;  3VR3 A;  3L7Z C;  3NQI A;  4A93 G;  4O42 A;  4HMJ A;  2Z6K A;  1I6H B;  4A3G B;  2PQA A;  1UEB A;  5BR8 L;  3BZD B;  5BN3 A;  5FO7 B;  4JW0 A;  1SE2 A;  3CU7 A;  2I07 B;  3I4M H;  2PZT A;  4BBS B;  1DOM A;  2VW9 A;  4V0B A;  3PQI A;  3R3O A;  3KLR A;  3CCE A;  3DMU A;  3HOZ G;  4B3R Q;  1KLU D;  1NUC A;  3P7J A;  3I90 A;  4A75 A;  4Y52 H;  4L63 B;  1EUJ A;  1NR4 A;  2KHI A;  4NP5 A;  3T56 B;  3OMG A;  1UUP A;  1HUM A;  3FPU B;  2AWO A;  3HOW H;  2F0G A;  1ILP A;  3GTG H;  4DR1 L;  1JIC A;  4A3E B;  3ERO A;  1Y1W B;  1EFI D;  3HOU B;  4A3J B;  3ULL A;  5EKK A;  3J80 i;  1S5C D;  4L5T A;  1LAB A;  3GTJ H;  4A93 B;  4KD3 A;  1OXS C;  2MFI A;  2PNH A;  2YYZ A;  2CW0 C;  3OOC A;  2NTS A;  4LF5 Q;  3PUV A;  1YJN A;  5JEA H;  3U4V A;  4OO1 H;  2NVX B;  3SE0 A;  4A3K H;  2JEB I;  1GD7 A;  1AEX A;  1TS3 A;  3LWU A;  3A8K E;  3HOZ B;  3M4P A;  4EQN A;  4KMU C;  5KGU A;  2F0M A;  1EIH A;  2SNS A;  2KCC A;  3A5Z B;  1SFO B;  3HOY G;  1CK1 A;  3MXG A;  1X55 A;  1F77 A;  3Q23 A;  2KA7 A;  1KXL A;  2O4X A;  1PH4 A;  2K5D A;  1DD2 A;  4WJ3 M;  1LTB D;  1EYA A;  2M00 A;  5E1F A;  4DK6 C;  3A8J E;  2NVQ H;  1NE3 A;  1PRT C;  1VQJ A;  1YNN C;  1F2M A;  1TY0 A;  1F9P A;  3CC7 A;  3G48 A;  4P72 A;  4GNX B;  3MFG A;  4A3M G;  3PO3 H;  4HIO A;  4BBR H;  2VQF L;  3GTL H;  2B8F A;  1GHJ A;  3W3A A;  1U5K A;  4FF1 A;  2O5I C;  4K8J A;  2E2J B;  4GZY C;  1OXU A;  3HOX H;  3S1M H;  4B3R L;  4DA2 A;  4EQP A;  3S17 H;  1I5F A;  3W1B A;  3M3Y H;  4KTA A;  1SXT A;  3T1H Q;  3HOY B;  4KV6 A;  4C1N I;  1R9T H;  1KC8 C;  1PFN A;  4HCS A;  3AYH B;  3I72 A;  1BR9 A;  5A2Q E;  3TP8 A;  1QVC A;  4DUZ Q;  4Y7N B;  3RLN A;  1V1O A;  3GTP H;  4H02 A;  2PNR C;  2E8G A;  1VS0 A;  2PZU A;  5C3E H;  1KTK A;  4JV5 Q;  3I2Z A;  1Y8N B;  2WV6 D;  4JBJ A;  2H4O A;  3W1G A;  2EYP A;  2AQ1 B;  1FR3 A;  2N78 A;  3I56 A;  3H3V C;  4A3M B;  2RF4 A;  3J7Z C;  1T5X D;  1X6O A;  3D6C A;  1PTO F;  1IBK Q;  1IL8 A;  1II3 A;  2B8G A;  5HUR A;  5I6W A;  1BNZ A;  4LF5 L;  5J39 A;  2B2V A;  2R7D A;  2LXJ A;  1WI5 A;  4AH6 A;  1XWE A;  3R93 A;  4C3H G;  2VQE Q;  2HQE A;  3RLO A;  5CBA E;  1LYL A;  4HSP A;  4IN3 A;  3CPF A;  3E6Z X;  5CV4 A;  1JT8 A;  4DV1 Q;  1EIY B;  4QCL A;  1I50 B;  4CKC A;  1SMY D;  1K0S A;  3HZX A;  4HJ9 A;  1VQB A;  3VA5 A;  1LUZ A;  1ZYR D;  1J6Q A;  3VDY A;  4JI3 Q;  1VQK A;  1B3Q A;  3PV0 A;  1Q1E A;  1PZI D;  5CV5 A;  1SMX A;  4BY7 G;  1IHZ A;  2A74 C;  1AP0 A;  2A6H D;  4J1M A;  1PFB A;  4NDX A;  4N9T A;  2WAQ G;  1RHP A;  4K5X A;  4EGV A;  4UHV A;  3DEO A;  1JR0 D;  1WYD A;  1SSO A;  1EQT A;  2BDN A;  4TVA B;  3NHH A;  2PW7 A;  4ZQ3 A;  1VQ4 A;  3VYR A;  4TSS A;  4C3J G;  5C5L A;  3SEB A;  3AMU A;  1Y69 U;  4OON A;  1CA6 A;  4A3G H;  2NUC A;  2F0T A;  3N52 A;  2A69 C;  3GTK H;  1I6V C;  4A3C H;  4P73 A;  2FFK B;  4RGO S;  2X6L A;  2ATW A;  4BBS H;  3UI2 A;  3T1H L;  3FVQ A;  3R8B A;  2BH8 A;  2QKI C;  3Q8D A;  5JJZ A;  2DGY A;  5K36 H;  4QB4 A;  2LMC B;  3GTM B;  2EXZ A;  4DUZ L;  4YWL A;  2NZO A;  3OYY A;  2VNU D;  4IO9 A;  1NR2 A;  4BY7 B;  4QIW E;  4KKT A;  1AZP A;  2KEE A;  3NWT A;  4K8I A;  3K80 C;  2L1B A;  5FJ8 H;  2K5W A;  2Q2U A;  1ESF A;  1Y1W H;  5HY6 A;  1IBK L;  1XXG A;  5IP7 G;  4A3J H;  1QUQ A;  1RIP A;  3F2D A;  4R9W A;  4A93 H;  1HCZ A;  1W3S A;  4DKA C;  2K75 A;  3KDF A;  4DXF A;  5IT9 c;  2MNA A;  4DV1 L;  1RKN A;  3RN2 A;  1NY4 A;  3ULJ A;  2NVX H;  3ULP A;  2Q2H A;  1CQF A;  3F1Z A;  4JI3 L;  4RWS C;  3HOZ H;  1F9Q A;  5CBE E;  2QF7 A;  1R4P B;  3KF6 A;  4O2D A;  1SFO H;  1VQ7 A;  2XRQ D;  2B2T C;  5J3B A;  1PRT B;  1YHQ A;  4DV2 Q;  4PG3 A;  3UE0 A;  3HP3 A;  3OTO Q;  4DN4 M;  2F0Q A;  3CMA A;  4UP7 A;  2B2Y C;  3TZU A;  4X65 Q;  1GXD C;  2L11 A;  1JCK B;  4IUQ A;  3SDZ A;  5L37 A;  2J7Z A;  4UP9 A;  2KUM A;  2K7V A;  2KCM A;  3A54 A;  2C35 B;  1YVC A;  1PYS B;  1K0R A;  3MEF A;  1M90 C;  1STG A;  1MJC A;  4GKJ Q;  4DV5 Q;  2DNE A;  4A3F G;  1G6P A;  3ITP A;  1U4P A;  1WFQ A;  2RSN A;  4DV3 Q;  1KQS A;  4F87 A;  1HNW Q;  3QJY A;  2E2J H;  1G6Z A;  1CSP A;  1XMQ L;  3F8T A;  1Q8K A;  5IGB A;  1SE4 A;  2RDH A;  3IFT A;  3H3V I;  2SDF A;  2J4X A;  3HOY H;  1DGS A;  3NSW A;  4DAV A;  2YU9 B;  4YWK A;  3W2D A;  3DEP A;  1EZ6 A;  4B3S L;  1FNV A;  2JP1 A;  3I73 A;  1B44 D;  4Q5V A;  4X62 Q;  4XIG S;  5D14 A;  2AKW B;  2JA5 G;  5DLQ E;  5JOB A;  1PFS A;  1BCP C;  2LY7 A;  5IE8 A;  1DCZ A;  1QCB D;  4XQQ A;  1D6E C;  2C5C A;  4PZ6 A;  4DAY B;  1O7Z A;  2ALY B;  4KD4 A;  4A3M H;  4BA1 I;  4CDC C;  2IHE A;  2B2U A;  1LO5 D;  1Q3L A;  3I3C A;  4U67 3;  5COY A;  4A3F B;  3QOJ A;  3FP9 A;  2MO1 A;  1EY6 A;  3C1F A;  1Q46 A;  2IHF A;  3I4M B;  1PH5 A;  4AQY Q;  1TVX A;  5DAU A;  3H6M A;  1CKM A;  4TRD A;  1CKN A;  1SNM A;  3OMC A;  2NVT B;  2OWO A;  1U0L A;  1D5M C;  5M3M G;  5LMN Q;  1VF7 A;  4Q0F A;  4DV2 L;  3OTO L;  1MJE A;  4DV4 Q;  4XDX A;  2WB1 B;  1HPC A;  4L6T B;  1H9S B;  1OXV A;  4X3U A;  1EWH A;  3GTG B;  2PI2 E;  1KHI A;  4P2C B;  2G9H D;  1F9S A;  2KVM A;  4A3D G;  4UP8 A;  2KHS A;  3CXC A;  2DN8 A;  2AWN A;  3MXU A;  4OO1 I;  1WTV A;  3KUP A;  3Q24 A;  1GM5 A;  5LL6 X;  4P75 A;  1X3F A;  3GTJ B;  4GKJ L;  1SYB A;  2F0I A;  4DV5 L;  1DOK A;  1NMF A;  4FF3 A;  1DYQ A;  2A6H C;  2KQ3 A;  4XYQ A;  2R92 G;  2JA9 A;  4C3H H;  3PIO 3;  1MGS A;  1VQE A;  3VR2 A;  2F0J A;  2H5X A;  2E2H H;  3PUW A;  5E3F A;  1G29 1;  4IUN A;  4K6D A;  2A1A A;  1SDF A;  3OIQ A;  5M3M B;  5C0X J;  2KED A;  4XT1 B;  2RKS A;  1QNU A;  4ZAI A;  1YIT A;  3D6W A;  3X3N A;  1G51 A;  4F8M A;  4IFD G;  3BDO A;  4X62 L;  4BY7 H;  5H1S E;  1K8M A;  1SE3 A;  4OHJ A;  4B9X A;  4OIK A;  5J1Z A;  3S1R H;  2IX1 A;  4G7O C;  2B39 A;  3J81 c;  1VQD A;  1CUK A;  1STH A;  3QIA A;  1A3U A;  2IW3 A;  3BDC A;  3I4O A;  4KHV A;  3PO3 B;  1HXY D;  5FLM H;  5I6Y A;  3GTL B;  2F0F A;  4DAP A;  4U68 A;  4RAU C;  1TY2 A;  4N8F A;  1FJG Q;  2TMP A;  2R92 B;  3J7A 5;  4BA2 I;  4C3J H;  1PYB A;  3SXH A;  3HOX B;  3RLF A;  1BOS A;  4BS9 A;  1BUV T;  4DR6 Q;  2PMZ E;  1A2T A;  4LUV A;  3JAM c;  4LF8 Q;  1EZ8 A;  2EVB A;  1H9K A;  1JOR A;  1VQH A;  1PLF A;  1IBL Q;  1SYG A;  4DV4 L;  2DY8 A;  5FLX E;  1R9T B;  5IYB G;  3TEH B;  3BDL A;  1N8R C;  1ZEQ X;  3CRK C;  4CDF C;  2ZM6 Q;  2Z0S A;  3E0J A;  2ZTE A;  3I8Z A;  3TBI B;  5E7N A;  4GLA C;  1VQM A;  1D7Q A;  2A6E C;  1D8L A;  5IGC A;  3QR8 A;  1Q82 C;  2RDF A;  1IYJ B;  1SNP A;  1GKH A;  4FO2 A;  3GD7 A;  1F2Z A;  1PH8 A;  1HR0 Q;  5ELB A;  5IP7 H;  1AZQ A;  5ELN A;  3B6Y A;  5FO8 B;  1DOL A;  1PTO D;  1SAP A;  2ZT9 C;  1TXY A;  1EYD A;  3CCL A;  2Q2T A;  2A68 D;  2NB0 A;  2ZXO A;  4PV1 C;  2E2I B;  1WTO A;  5JAV A;  1GOZ A;  3A74 A;  1E1T A;  1ZKO A;  1NTG A;  2CCZ A;  2UUB Q;  3BZC A;  4LUO A;  4HJA A;  1I4G A;  3SVM A;  3HGB A;  3A56 A;  5GAH C;  2A8V A;  5FLX L;  4CJ0 B;  3NK9 A;  4YY3 Q;  5COR A;  4S3S A;  1XTD A;  3WDN A;  1BCP B;  3SK6 A;  4HMI A;  1WTX A;  1N34 Q;  1GO3 E;  3KJP A;  3M4Y A;  4JOI A;  3H3V H;  3HKZ G;  4DF7 A;  5EAY A;  1AW7 A;  2VUM G;  4JI2 Q;  1LT3 D;  4JBK A;  4OEL B;  4AYB E;  1ESR A;  2L55 A;  3M7N A;  3OWF A;  4K2K A;  1F9R A;  1F2Y A;  4A3F H;  2R93 G;  3CF5 A;  1UAP A;  3H91 A;  1PV4 A;  1XMO L;  2EY5 A;  4DR6 L;  3GTK B;  4LF8 L;  4HR7 B;  3TRZ A;  3MVV A;  1IBL L;  3NTH A;  3I7F A;  2B29 A;  3IFD A;  4JG2 A;  1PMR A;  1E2W A;  5CR3 A;  1KNA A;  3JC6 6;  4NW2 A;  2NVT H;  2ZM6 L;  1TII D;  1KAB A;  2RQX A;  4DR3 Q;  4OGQ C;  4P74 A;  2BDO A;  3M4O B;  1S5F D;  2Z1C A;  1ILQ A;  3CCM A;  3FHW A;  2F1M A;  3L0O A;  2GVB A;  3HKZ B;  2JA5 H;  4K5V A;  5C4Z A;  3PIP 3;  1HR0 L;  3RNU A;  4APV A;  2VUM B;  2NZH A;  1HZB A;  2IJ0 A;  2QCP X;  4ZLT F;  3GV6 A;  3WWV A;  4EQ5 A;  1J9O A;  3KFU A;  4TKO B;  2ES2 A;  3AEV A;  1U4L A;  3J81 j;  1FL0 A;  4P71 A;  4DNR B;  2R93 B;  3ND9 A;  1TS5 A;  3BVZ A;  4K5W A;  3C2P A;  2FIN B;  1E7Z A;  2J0T D;  3X3M A;  1W2B A;  5HGT A;  1HZC A;  3J81 i;  2WKC A;  3BZK A;  5D3D A;  2UUB L;  3CD6 A;  1LTT D;  2FXQ A;  4IPD A;  2M2L A;  1K3B C;  1JB3 A;  3CAM A;  4JPB W;  2MPM A;  2F03 A;  3GTO H;  1OXT A;  1Y8P B;  4YY3 L;  5M3M H;  1L1O C;  1A3V A;  1SEB D;  1DJR D;  2Z8L A;  4CHT B;  1CT1 D;  1N34 L;  4CJ1 B;  4HN7 A;  4FF4 A;  1PRT F;  5KND A;  2F3W A;  3LX0 A;  2F0E A;  5C0X G;  2OEO A;  2Z4H A;  2Z6K C;  1HHV A;  3D31 A;  3T16 A;  2K52 A;  3DUZ A;  3JAM i;  4JI2 L;  2D62 A;  2L9H A;  5KNC A;  4A3D H;  1IYV A;  2AUJ D;  3DWP A;  4ZCK A;  4MIU A;  2AUK A;  3NEL A;  3KF8 B;  2L4N A;  2QA4 A;  5KRU A;  4LUZ A;  2D0O A;  4DR2 Q;  2WAC A;  4LF4 Q;  4DXG A;  3G6E A;  1WTH A;  2R92 H;  3ND8 A;  3TSS A;  4JI1 Q;  1WD0 A;  1BKB A;  4FF2 A;  4DR5 Q;  1NJI C;  4WJ4 A;  1Y14 B;  5JPM C;  3MXN B;  1CKO A;  2D9U A;  3D4W A;  2F0D A;  4ZKB B;  1YEZ A;  4OL7 A;  2FMC A;  3AFQ A;  2ICI A;  1KIX A;  5C44 G;  2QEX A;  1YZ6 A;  4DNT B;  2BA0 A;  4DR3 L;  1EYC A;  5EGT A;  3KYH C;  4HID A;  4OXP A;  4JI8 Q;  2CQO A;  1NBW A;  4IFD H;  1UEA B;  4AIM A;  4KLK A;  3E9I A;  1X32 A;  4KN4 C;  4RFB A;  1TWG B;  1WTQ A;  2CH4 W;  1C7Y A;  1G8Z D;  2VB3 X;  1IW7 C;  4FDB A;  1BF4 A;  3K58 A;  3R2I A;  2HHH Q;  3P75 A;  3TN2 A;  2MO0 A;  1JOO A;  3MWY W;  4JCV E;  1K8O A;  1FNW A;  3ERS X;  2BOS A;  4DV6 Q;  2BE5 C;  1V1P A;  1G91 A;  3H09 A;  1VCI A;  2OT2 A;  4HED A;  4ZYS A;  3U4Z A;  3F2U A;  4EQO A;  2K6A A;  2E2I H;  1LM0 A;  5C44 B;  4HCE A;  1BBU A;  5IT9 L;  1WTP A;  2OTL A;  3NBI A;  4J8Q A;  3QWN A;  1S5B D;  2IX3 A;  1BDO A;  1J5E Q;  4FNF A;  1TWF H;  5IYB H;  1H9M A;  4DK0 A;  4WRD A;  1LV9 A;  3CC4 A;  2K05 A;  1TU2 B;  4B3M Q;  1IYU A;  2GVA A;  3WOF A;  2ZXR A;  2IT1 A;  4K6L A;  2L5T A;  5A35 A;  1JJC B;  4NXN Q;  2UUA Q;  3SK5 A;  1SNQ A;  5T1G A;  4BY1 G;  1PZK D;  2F0V A;  2VS1 A;  1LTL A;  4MZ9 A;  2MJ8 A;  2K4K A;  1BO0 A;  4DR2 L;  1SNO A;  1B9N A;  4LK1 C;  4LF4 L;  5FLM G;  2RVL A;  3P20 A;  4AYB G;  1YJW A;  2ICE C;  4ME3 A;  4JI1 L;  2R7Z G;  4DR5 L;  4C3H B;  4CDD C;  3CKI B;  1JMC A;  4KJO A;  2E2H B;  1EY9 A;  1SLJ A;  1ROD A;  1IKL A;  1B53 A;  4ID6 A;  2MP1 A;  4HIM A;  3GO5 A;  4IFD J;  2EPB A;  1QE6 A;  2K14 A;  3KBX A;  3TS0 A;  4JI8 L;  1RDP D;  4IOC A;  3A8I E;  3CPW A;  5FK9 C;  1B7Y B;  2N49 A;  3KLS A;  3NBH B;  1HRJ A;  3M4O H;  4JV5 L;  2PCF B;  4RGN A;  2B2V C;  4ME5 A;  5M9O A;  1N9W A;  3S1R B;  2IL8 A;  3TZD A;  2WAQ B;  4BY1 B;  4RH6 A;  2IWH A;  3I91 A;  4X66 Q;  2F4I A;  3K81 C;  1YIJ A;  5TSS A;  1QZH A;  2HHH L;  4GOP C;  2VUM H;  1S40 A;  4J6H A;  2EYO A;  3TP7 A;  4AYB B;  1N32 Q;  4MTK A;  1SR3 A;  1LAC A;  3GTQ B;  2DUD A;  2R7Z B;  1QZG A;  3NEN A;  5KIX A;  1Q8I A;  2Z4I A;  3KJO A;  2VQE L;  4C3J B;  2R93 H;  5JVG 3;  1PHJ A;  1RCV D;  4CKB A;  1HUN A;  1MIU A;  2OCE A;  1Q12 A;  1MBY A;  5KYL A;  1KD1 C;  1PH7 A;  1YJ9 A;  1ENA A;  1L1O B;  4K14 A;  1J5E L;  1TS4 A;  1UNS A;  4LAA A;  3MC0 B;  3PGZ A;  4JK1 C;  3T4A C;  1IXR A;  3ZJY C;  4M8A A;  4IAL A;  4G7Z C;  4KKU A;  4B3M L;  3ER0 A;  3STB D;  1DON A;  2UXD Q;  2PQA B;  1TT2 A;  1I4X A;  3J80 E;  4JI5 Q;  2UUA L;  1HZA A;  1MSG A;  4ODG A;  4ZUJ A;  1CA5 A;  1LT6 D;  4FXG C;  4X3K A;  4DR7 Q;  2Y0S E;  2QEJ C;  1TS2 A;  2FMM A;  3BYY B;  3SR1 A;  1XPR A;  5ELF A;  3ERQ A;  1SJH D;  1VQF A;  2WFW A;  3S9W A;  4ZKC B;  1Z9F A;  4DV7 Q;  3FMC A;  1HNX Q;  5CYU A;  3K59 A;  4YCV A;  3BJU A;  4H7B A;  2H1E A;  4J15 A;  1QG7 A;  3PUY A;  1C0A A;  1SYE A;  4R4Q A;  5G3L F;  3CRL C;  3I4N G;  2K5Q A;  2KCN A;  2C9O A;  3KK7 A;  2F0P A;  4WJW A;  3EJI A;  3E3X A;  4DNI A;  3F2B A;  2F0K A;  4RMF A;  2CKZ B;  5IYC G;  2EZV A;  1KL9 A;  5LMU Q;  3DWA A;  1VQL A;  2AQ2 B;  5ELD A;  3MA2 B;  3S15 B;  1AN8 A;  2HQL A;  3CCQ A;  1YBY A;  3WOE A;  4K0K Q;  3S1Q B;  4QUF A;  1IKM A;  1EWI A;  4DK1 A;  2PW5 A;  4KN7 C;  2X6G A;  2F4V Q;  4KY6 A;  4KI0 A;  4X64 Q;  5K5P A;  5C0X H;  3K0Y A;  4X66 L;  3J80 L;  1PYW D;  1BCP F;  2K03 A;  1TWG H;  2IPK D;  1N36 Q;  5JJK A;  3U58 A;  3MTS A;  1LTA D;  1N32 L;  2HT1 A;  2M9V A;  4LW1 A;  2EJG C;  2UUC Q;  3DXJ C;  5DEH A;  1LLR D;  2EY1 A;  2OTJ A;  4DUY Q;  3VR4 A;  4IUT A;  1VQO A;  4G57 A;  3BU2 A;  1LT4 D;  3A7A B;  3I4N B;  2ZTC A;  1M1K C;  2HCI A;  2E5L Q;  4CJ2 C;  4JBM A;  4JVZ A;  3CP0 A;  4R8I A;  3VR6 A;  2JN4 A;  4A3B G;  1NMG A;  1Y1V H;  2RDG A;  4A3I G;  1PZJ D;  1JE5 A;  2B2W A;  5C44 H;  1F2L A;  2A73 B;  3H0G G;  3T53 B;  3RMH A;  4MN3 A;  4CBV A;  3H15 A;  4A4I A;  1SRO A;  2UXD L;  2JEA I;  3BYT B;  5D65 A;  1A2U A;  4JI5 L;  3I4L A;  4X65 L;  1K73 C;  2CHB D;  3ONA B;  1TWC B;  1B8A A;  4WOR A;  1SMY C;  1GJX A;  3C1E A;  4YIJ A;  3OHX C;  1ZYR C;  4XTC S;  2JA5 B;  2NZ1 D;  4L5S A;  5KNB A;  2JQO A;  3TDQ A;  3CW2 C;  2R7F A;  1SE8 A;  2K04 A;  2BH2 A;  2BCO A;  3D3R A;  3U9O A;  3TRE A;  4DV7 L;  4GNX A;  3SGI A;  5LL6 S;  1MHW C;  3J7A V;  1D5Z C;  1CSQ A;  4DV3 L;  1HNW L;  4DGZ A;  4OX9 Q;  3PF5 A;  1VQ9 A;  5CGK A;  2CW0 D;  2MHV A;  3L9A X;  2F3I A;  2K28 A;  2WKD A;  4YWM A;  1ONL A;  4A3B B;  2I5H A;  4A3I B;  5LMU L;  3RUZ A;  5ELO A;  1Z6H A;  1WOC A;  3GTO B;  1V1Q A;  3VYU A;  2CVR A;  1KLG D;  1A0I A;  4K0K L;  1LTS D;  1I4H A;  2EY6 A;  2L12 A;  3M9B A;  1FGU A;  5GAD C;  5DM6 3;  2F4V L;  1HA6 A;  3S16 B;  1Q81 C;  4ABN A;  4X64 L;  2B2U C;  4LF9 Q;  3DWQ A;  3AB9 A;  4HIK A;  3C46 A;  4KHP Q;  2EDG A;  3PUZ A;  3K7A H;  2E76 C;  4JBW A;  3G6J B;  3KOJ A;  4R4T A;  3HRZ C;  1C8C A;  4GOP B;  3UDX A;  1GUW A;  3RR5 A;  1N36 L;  4BY1 H;  2NTT A;  1O78 A;  2CWP A;  1PRT D;  3T1Y Q;  4A3D B;  3M85 A;  5M5W H;  1K8G A;  1YNN D;  2UUC L;  4LF7 Q;  5EKI A;  3M7G A;  5DNF A;  1WD1 A;  3CCR A;  5ELE A;  4JYA Q;  2NVY H;  4DUY L;  2OQK A;  1N33 Q;  1IL2 A;  2YTV A;  4LFA Q;  1K83 H;  3GTQ H;  2R7Z H;  1E3P A;  1JB7 A;  4B08 A;  4IUU A;  1K9M C;  2E5L L;  5C4X G;  4AQY L;  1XPU A;  5C3X A;  4IUV A;  4LFB Q;  3PUX A;  3EFX D;  1BBW A;  1PH9 A;  4G4K A;  2LKV A;  4IFD I;  5I9P A;  1E24 A;  5C6A A;  1OTC A;  1DM0 B;  2VB2 X;  4BWG B;  1I4R A;  2L0C A;  1CZG A;  2F52 A;  3V96 A;  5LMN L;  1EQQ A;  4RGM A;  1EY4 A;  2XGT A;  1X56 A;  4PZ7 A;  4IPG A;  1MD2 D;  3LWE A;  3IRB A;  3F2C A;  4IJL A;  4QUC A;  1Y8O B;  3CCS A;  4R4I A;  4QIW B;  5BR8 Q;  1Z7T A;  2YV5 A;  2CQA A; 
#chains in the Genus database with same CATH homology
 2XTI A;  2YTY A;  1JJ2 A;  1VQ4 A;  3HOW G;  3CAM A;  4NXM Q;  3GTO H;  1TWH H;  1OXT A;  4YY3 L;  1E22 A;  5M3M H;  4JI7 Q;  1L1O C;  3E0E A;  3HKZ E;  4OON A;  1VQP A;  2JA6 H;  4LNQ A;  3UE1 A;  4A3G H;  1XJV A;  1VQC A;  1WCM G;  3GTK H;  4A3C H;  4P73 A;  1N34 L;  2ATW A;  4BBS H;  4OX9 L;  3T1H L;  5C0X G;  2UU9 L;  2RCN A;  4GLX A;  2BH8 A;  2Z6K C;  3D31 A;  2JJQ A;  2K52 A;  3Q8D A;  1P8L A;  2DGY A;  2VY3 A;  3JAM i;  4X6A H;  4JI2 L;  4TQU S;  5M3F H;  2D62 A;  2B63 H;  4A3D H;  4DUZ L;  4YWL A;  2NZO A;  3OYY A;  1X54 A;  4KHZ A;  5JEA G;  2VNU D;  4IO9 A;  4IOA A;  2PI2 A;  3NEL A;  4DR7 L;  4OO1 G;  1YI2 A;  3KF8 B;  4A3K G;  2QA4 A;  4QIW E;  4EX5 A;  2RHS B;  4LUZ A;  1I50 H;  2D0O A;  4DR2 Q;  4LF4 Q;  4QY7 A;  1QUQ B;  4R4C A;  3K7U C;  3A0J A;  3G6E A;  2R92 H;  3K80 C;  4JI1 Q;  5AJ3 L;  3S15 H;  4LF9 L;  1BKB A;  4KHP L;  1HNX L;  4DR5 Q;  1NJI C;  4WJ4 A;  1ASY A;  1Y14 B;  3MXN B;  1CKO A;  5FJ8 H;  2Q2U A;  1Y1W H;  3S1Q H;  3KDF B;  5HY6 A;  4RG1 A;  1IBK L;  1YEZ A;  5IP7 G;  4A3J H;  1QUQ A;  3AFQ A;  1HNZ Q;  1SRU A;  3CQZ H;  1RIP A;  3F2D A;  1KIX A;  5C44 G;  2QEX A;  4LF7 L;  4A93 H;  2GN5 A;  2BA1 A;  1YZ6 A;  1Z47 A;  1W3S A;  3PSI A;  2BA0 A;  1X3E A;  4DR3 L;  4DKA C;  2K75 A;  3KDF A;  3KYH C;  5IT9 c;  1PH3 A;  1VQ5 A;  2MNA A;  4JYA L;  4DV1 L;  4HID A;  1N33 L;  4OXP A;  5JJI A;  4DV0 Q;  4JI8 Q;  4B3T L;  1A63 A;  4LFA L;  3RN2 A;  1NY4 A;  2CQO A;  1NBW A;  3PF4 A;  3KF6 B;  1FJG L;  4AIM A;  3ULJ A;  4KLK A;  1XNR Q;  2NVX H;  3E9I A;  3ULP A;  3PO3 G;  2Q2H A;  4YCW A;  4JI3 L;  3F1Z A;  4BBR G;  4DPG A;  3HOZ H;  4LFC L;  4LFB L;  1XNQ L;  1C7Y A;  5IWA L;  4L5Q A;  3I4N H;  3KF6 A;  4O2D A;  3DM3 A;  1BVS A;  1SFO H;  2I5L X;  1VQ7 A;  4FDB A;  4A3E G;  5J3B A;  4O0A A;  2HHH Q;  1YHQ A;  4DV2 Q;  4PG3 A;  3UE0 A;  3OTO Q;  3CC2 A;  3HOX G;  3HOU G;  2MO0 A;  3CMA A;  5IYC H;  1B70 B;  4DK3 C;  1X3G A;  4UP7 A;  3I55 A;  4JCV E;  3CCV A;  1PH2 A;  3ERS X;  4X65 Q;  2JA7 G;  4R4O A;  1PVO A;  4DV6 Q;  3NEM A;  2VQF Q;  1QVG A;  4UP9 A;  2KCM A;  2KEN A;  3J80 c;  2C35 B;  1A62 A;  1YVC A;  4UPA A;  3CME A;  1VCI A;  3GTM H;  1AH9 A;  1L0W A;  1VQ6 A;  1PYS B;  1AE3 A;  1K0R A;  2LSS A;  3U4Z A;  4A76 A;  2JK8 A;  2JE6 I;  1TWC H;  1UE1 A;  1LM0 A;  2I5M X;  2AHO B;  2KCT A;  2E2I H;  1BBU A;  4NXM L;  4A3D G;  2MQH A;  3MEF A;  4JI7 L;  2OTL A;  1M90 C;  1MJC A;  4GKJ Q;  1QVF A;  5C3E G;  1HZ9 A;  4DV5 Q;  2ZJQ A;  1J5E Q;  1HH2 P;  3S2D H;  4A3F G;  1G6P A;  1TWF H;  5IYB H;  2ZJR A;  4L5R C;  4DV3 Q;  1WFQ A;  1KQS A;  1C9O A;  1HNW Q;  4HJ5 A;  3CC4 A;  2E2J H;  2HIV A;  1CSP A;  4B3M Q;  1VQG A;  1XMQ L;  3F8T A;  1Q8K A;  5IP9 H;  2GVA A;  1Q1B A;  1PA6 A;  1KRS A;  2IT1 A;  4JI4 Q;  1VQ8 A;  1MKH A;  1HJP A;  1JJC B;  2UXC Q;  4NXN Q;  2UUA Q;  4BY1 G;  4GNX C;  3H3V I;  5IYD G;  1EIF A;  2B3G A;  2VS1 A;  3K8A A;  3HOY H;  4POF A;  1IBM Q;  1DGS A;  3PIO A;  1LTL A;  4MZ9 A;  2K4K A;  1PH6 A;  4DR2 L;  4A3B H;  4YWK A;  1V9P A;  4A3I H;  4LF4 L;  5FLM G;  1XMO Q;  4B3S L;  1H95 A;  4AYB G;  1YJW A;  3H0G H;  2VL6 A;  4IPC A;  4JOI C;  4ME3 A;  4JI1 L;  2R7Z G;  4X62 Q;  3TQY A;  4DR5 L;  4XIG S;  2ZJP A;  2AKW B;  2JA5 G;  5DLQ E;  2Y0S G;  1Q86 C;  1PFS A;  1JMC A;  5IE8 A;  3STB C;  5JJL A;  1YNX A;  1HNZ L;  4PZ6 A;  1K8A C;  1SLJ A;  4DAY B;  3S16 H;  2ALY B;  4HJ8 A;  2K50 A;  4A3M H;  4BA1 I;  4YHH Q;  2IHE A;  4GLV B;  3GO5 A;  4HIM A;  3ICE A;  4IFD J;  5FLX c;  3FKI H;  2K14 A;  4LWC A;  1E1O A;  3TS0 A;  1EOV A;  5GAG C;  4DV0 L;  4JI8 L;  1Q7Y C;  3FP9 A;  1A8V A;  4IOC A;  1CKN B;  3HOV G;  2IY5 B;  1KAW A;  3EBE A;  2MO1 A;  3CPW A;  1VQA A;  4BXX G;  1Q46 A;  1XNR L;  2D0P A;  2IHF A;  1B7Y B;  2IX0 A;  2N49 A;  1PH5 A;  3NBH B;  4DR1 Q;  4AQY Q;  2JA8 G;  5GAE C;  3M4O H;  3KLW A;  4JV5 L;  1JJG A;  1N9W A;  1CKM A;  1YHA A;  1CKN A;  2LXK A;  2OWO A;  1XPO A;  3AFP A;  4QQB X;  1U0L A;  4X66 Q;  4IPH A;  2JA6 G;  3K81 C;  5M3M G;  3UDG A;  5LMN Q;  1YIJ A;  1QZH A;  4GN3 B;  2HHH L;  4DV2 L;  1EFW A;  2EXD A;  3OTO L;  4GOP C;  1MJE A;  4DV4 Q;  4A3G G;  1EYG A;  1S40 A;  2VUM H;  1VQN A;  1Y1V G;  4ALP A;  1OXV A;  4A3C G;  5C0X I;  1N32 Q;  1SR3 A;  3T1Y L;  3RZD H;  2DUD A;  3S24 A;  4HJ7 A;  1AE2 A;  1QZG A;  3NEN A;  4BBS G;  1TWA H;  3KJO A;  1IZ6 A;  2VQE L;  2PI2 E;  3UDF A;  1KHI A;  4QJF A;  2R93 H;  5K36 G;  3EN2 A;  3G71 A;  1PHJ A;  4OWW B;  5M3F G;  3UDI A;  1HR0 W;  1L2F A;  1MIU A;  4JI0 Q;  2OCE A;  2B63 G;  4DAM A;  2NN6 G;  2YTX A;  3EIV A;  4UP8 A;  1UE7 A;  1Q12 A;  2AWN A;  3CXC A;  3CCU A;  3PO2 H;  4OO1 I;  1KD1 C;  1GM5 A;  4P75 A;  1X3F A;  1PH7 A;  2YU9 H;  1YJ9 A;  1L1O B;  4GKJ L;  4DV5 L;  1J5E L;  1ASZ A;  5LMN W;  1NMF A;  2WAQ E;  3PGZ A;  4GS3 A;  2R92 G;  2N3S A;  2JA9 A;  2K5V A;  4C3H H;  4OWT B;  3HFZ B;  1IXR A;  1SN8 A;  2WP8 J;  3ZJY C;  5M5Y H;  4B3M L;  5GQO A;  3ER0 A;  1VQE A;  3GDE A;  1L1O A;  5FJ8 G;  2KHJ A;  1I3Q H;  3STB D;  1Y1W G;  1UE5 A;  4JI4 L;  2UXD Q;  2PQA B;  2H5X A;  2E2H H;  2WB1 E;  4A3L H;  4NPS A;  3PUW A;  2UXC L;  2OQ0 A;  2V1C C;  1G29 1;  4A3J G;  2UUA L;  1HZA A;  3L2P A;  4JI5 Q;  5HGQ A;  2A1A A;  3L7Z C;  4A93 G;  5C4X H;  1IBM L;  4DR7 Q;  1P16 A;  4IJH A;  5C0X J;  3PCO B;  4LF6 Q;  2Y0S E;  2Z6K A;  2PQA A;  1UEB A;  5BR8 L;  2NN6 I;  1XPR A;  1YIT A;  3AQQ A;  1G51 A;  1VQF A;  2WFW A;  4GKK Q;  4IFD G;  3I4M H;  1Z9F A;  4DV7 Q;  1PH1 A;  4X62 L;  1HNX Q;  5H1S E;  3S1N H;  4YCV A;  4BY7 H;  3BJU A;  3D0F A;  5JEA J;  2VW9 A;  4LF6 L;  3CCE A;  4J15 A;  3S1R H;  3PUY A;  2IX1 A;  3HOZ G;  4B3R Q;  1C0A A;  3J81 c;  4R4Q A;  3I4N G;  1VQD A;  3RZO H;  4A75 A;  4YHH L;  4Y52 H;  1CUK A;  1EUJ A;  2KHI A;  2L15 A;  4DNI A;  3I4O A;  3F2B A;  4RMF A;  1S72 A;  4GOP A;  5FLM H;  2CKZ B;  1I94 Q;  5IYC G;  1KL9 A;  4JC0 A;  2AWO A;  2Q2I A;  5LMU Q;  1VQL A;  3HOW H;  1FJG Q;  4JI6 Q;  3GTG H;  3J7A 5;  4BA2 I;  1OXX K;  4C3J H;  4C3I H;  4DR1 L;  2HQL A;  1RL2 A;  3CCQ A;  1YBY A;  2HIX A;  4K0K Q;  1PYB A;  1EWI A;  3RLF A;  1WCM H;  2F4V Q;  3ULL A;  4DR6 Q;  1V43 A;  2PMZ E;  3K0X A;  4KI0 A;  3S2H H;  4LUV A;  3J80 i;  1KRT A;  3JAM c;  4X64 Q;  4LF8 Q;  4X66 L;  4L5T A;  4R1J A;  3GTJ H;  2EQS A;  1VQH A;  4PMW A;  1S3O A;  3E9H A;  1OXS C;  2MFI A;  1IBL Q;  2PNH A;  2YYZ A;  4DV4 L;  3OW2 A;  4POG A;  1TWG H;  5IYB G;  3TEH B;  3G4S A;  3PUV A;  4LF5 Q;  5M5X H;  1N36 Q;  2KBN A;  2ASB A;  1N8R C;  1YJN A;  4DR4 Q;  3U58 A;  1N32 L;  5JJK A;  2ZM6 Q;  2HT1 A;  3RN5 A;  4LW1 A;  3U4V A;  4MTN A;  2UUC Q;  2Z0S A;  2AMC B;  2ZTE A;  4A3K H;  2JEB I;  4QGU A;  1GD7 A;  2ZTD A;  5IP9 G;  3LGJ A;  2OTJ A;  4DUY Q;  1VQO A;  3M4P A;  4GLA C;  5E7N A;  3BU2 A;  1VQM A;  4JI0 L;  1D7Q A;  3W5O A;  2ZTC A;  1D8L A;  3A5Z B;  1Q82 C;  1M1K C;  4NB3 A;  3HOY G;  2E5L Q;  1IYJ B;  1X55 A;  3CCJ A;  1I6H H;  1GKH A;  3GD7 A;  1PH8 A;  1HR0 Q;  4JBM A;  3CP0 A;  1KXL A;  5IP7 H;  4A3B G;  1NMG A;  1Y1V H;  4A3I G;  1PH4 A;  3M4Q A;  1JE5 A;  5C44 H;  4YCU A;  5ELN A;  4WJ3 M;  2UXB Q;  3H0G G;  1UE6 A;  4UY8 C;  3B6Y A;  4DK6 C;  2NVQ H;  1NE3 A;  1XMQ Q;  4PZ8 A;  1VQJ A;  3H15 A;  4A4I A;  2N8N A;  1SRO A;  2UXD L;  2JEA I;  2A19 A;  3PIP A;  3CC7 A;  2VZA A;  1TXY A;  3G48 A;  5C4J H;  4JI5 L;  3CCL A;  4X65 L;  4P72 A;  1K73 C;  2Q2T A;  1B8A A;  4GNX B;  4DV6 L;  4A3M G;  3PO3 H;  3A74 A;  1E1T A;  1O7I A;  4BBR H;  2VQF L;  1NTG A;  4HIO A;  4XTC S;  3A5U A;  3FKI G;  3BZC A;  2CCZ A;  2UUB Q;  4L5S A;  4LUO A;  3GTL H;  2JQO A;  4HJA A;  3CW2 C;  2R7F A;  1SE8 A;  4B3S Q;  1U5K A;  5GAH C;  2BH2 A;  2A8V A;  1K3R A;  4GKK L;  4GNX A;  3TRE A;  4DV7 L;  4YY3 Q;  3SGI A;  1EQR A;  1UWV A;  4A3E H;  1OXU A;  1XTD A;  2EIF A;  3HOX H;  3HOU H;  3S1M H;  4B3R L;  5IY0 A;  2JA7 H;  1CSQ A;  1T9H A;  4DV3 L;  1N34 Q;  1GO3 E;  1I5F A;  3W1B A;  3KJP A;  3S17 H;  1HNW L;  3HKS A;  3M3Y H;  4OX9 Q;  4JOI A;  3U50 C;  3T1H Q;  3H3V H;  2UU9 Q;  2K5H A;  3HKZ G;  3PF5 A;  1VQ9 A;  5EAY A;  2F3I A;  1R9T H;  1KC8 C;  4YWM A;  3AYH B;  2VUM G;  4JI2 Q;  1I94 L;  2K5N A;  2I5H A;  1JT8 A;  4JBK A;  5LMU L;  1QVC A;  4NXN L;  4DUZ Q;  3RLN A;  4AYB E;  4GN5 A;  3GTP H;  4JI6 L;  4H02 A;  5ELO A;  2E8G A;  1WOC A;  3M7N A;  1V1Q A;  1VS0 A;  1A0I A;  5C3E H;  4K0K L;  4JV5 Q;  3I2Z A;  4A3F H;  2R93 G;  3M9B A;  4JBJ A;  1FGU A;  3W1G A;  5GAD C;  2RHQ B;  3CF5 A;  2F4V L;  1PV4 A;  1XMO L;  4DR6 L;  2R6G A;  2N78 A;  1Q81 C;  2QGQ A;  5AJ3 Q;  4X64 L;  3I56 A;  4LF8 L;  4LF9 Q;  3TS2 A;  3PO2 G;  4KHP Q;  4HIK A;  3TRZ A;  2RF4 A;  3PUZ A;  3K7A H;  3J7Z C;  4JBW A;  1IBL L;  3KOJ A;  4R4T A;  1X6O A;  3I7F A;  1IBK Q;  2B29 A;  1X9N A;  4GOP B;  4JG2 A;  3UDX A;  4LF5 L;  3RR5 A;  2R7D A;  3JC6 6;  1N36 L;  4BY1 H;  2LXJ A;  2NVT H;  1WI5 A;  2CWP A;  4AH6 A;  3T1Y Q;  4DR4 L;  5IYD H;  2ZM6 L;  3M85 A;  5M5W H;  1K8G A;  2CWA A;  2UUC L;  4LF7 Q;  2VQE Q;  3RLO A;  1LYL A;  4DR3 Q;  3CCR A;  4P74 A;  4JYA Q;  3CPF A;  2NVY H;  5GRO A;  4DUY L;  2OQK A;  4DV1 Q;  1EIY B;  1N33 Q;  1IL2 A;  2YTV A;  4A3L G;  4GN4 B;  4B3T Q;  4LFA Q;  1YHB A;  1K83 H;  3CCM A;  3GTQ H;  1GVP A;  2R7Z H;  4HJ9 A;  1E3P A;  1VQB A;  3S14 H;  3FHW A;  1JB7 A;  1LUZ A;  1J6Q A;  1K9M C;  3L0O A;  1WJJ A;  2GVB A;  2E5L L;  2JA5 H;  4AQY L;  5C4X G;  1XPU A;  3VDY A;  4JI3 Q;  1HR0 L;  4LFC Q;  3RNU A;  4LFB Q;  1VQK A;  3PV0 A;  4APV A;  1HZB A;  1BBW A;  1Q1E A;  2NZH A;  3PUX A;  1PH9 A;  1XNQ Q;  5IWA Q;  1X65 A;  4IFD I;  1FVI A;  2UXB L;  1E24 A;  1OTC A;  3I4M G;  1SMX A;  2CFM A;  3WWV A;  4EQ5 A;  4BY7 G;  4OWX B;  3KFU A;  1EQQ A;  2ES2 A;  2F52 A;  3AEV A;  5LMN L;  4C2M H;  3DLL A;  3J81 j;  2ID0 A;  1FL0 A;  2XGT A;  4P71 A;  3HOV H;  1X56 A;  2WAQ G;  4PZ7 A;  4IPG A;  4QL5 A;  4BXX H;  3IRB A;  3F2C A;  1E7Z A;  4IJL A;  1VQI A;  2JA8 H;  1W2B A;  3J81 i;  1HZC A;  1WYD A;  3CCS A;  3BZK A;  2UUB L;  4R4I A;  2I0Q A;  5BR8 Q;  3CD6 A;  2FXQ A;  2WB1 G;  4TVA B;  4IPD A;  4Y7N H;  4MNO A;  2YV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...