2XIWA

Crystal structure of the sac7d-derived igg1-binder c3-c24s
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
VKVKFLLNGEEKEVDTSKIRDVSRQGKNVKFLYNDNGKYGAGNVDEKDAPKELLDMLARAEREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA-BINDING PROTEIN 7D
publication title Tolerance of the Archaeal Sac7D Scaffold Protein to Alternative Library Designs: Characterization of Anti-Immunoglobulin G Affitins.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 15
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xiwA00
1WTVA 1DONA 3Q6SA 1A15A 2N55A 2KEDA 1BF4A 1HUNA 2HDMA 1WTPA 1XYIA 1KNEA 1ILPA 1MGSA 4X3UA 5CBAE 1IKLA 1M8AA 5E4XA 4OIKA 3IL8A 3I8ZA 2B2WA 1ESRA 1HRJA 1E0BA 2B2YC 1HUMA 4R9WA 1U4MA 1EIGA 4IUPA 4RWSC 2Q8TA 5EKIA 2DY8A 2K03A 2XIWA 2MP1A 5CMDA 1X3QA 1B3AA 1EQTA 1CA5A 3ONAB 3GV3A 4CJ2C 2VXWA 1DOKA 1WD1A 4CJ1B 2JYOA 1IL8A 3GV6A 1RTNA 2EE1A 5CBEE 5EJWA 4QUCA 3KBXA 5EPLA 2J7ZA 4O42A 1JICA 4IUTA 3N52A 4OIJA 5D14A 3I91A 5T1GA 1U4LA 2IL8A 1ZXTA 1QE6A 4ZK9B 1BBXC 1J8IA 3P7JA 3MWYW 4IUVA 4X3SA 1ICWA 1G2TA 1CM9A 2FJ2A 1WD0A 2FFKB 1VMCA 3R93A 1B4OA 2RSNA 1GUWA 4ZLTF 1WVLA 4HEDA 1LV9A 4CJ0B 1G91A 1JE4A 1U4RA 1F9PA 3DEOA 2K04A 1BO0A 2MJ8A 1WTRA 2B2VC 3G7LA 1BNZA 1NCVA 2B2UA 1PDQA 1Q3LA 3SVMA 2B2TC 2HDLA 1NR2A 1S4ZA 2MPMA 4ZAIA 2NWGA 1NR4A 5EPJA 1IKMA 1HA6A 4XT1B 2RSOA 4DN4M 1O80A 4MN3A 1F9RA 1QNKA 2EOTA 3TN2A 3I90A 2X69A 1RHPA 2KOLA 1TVXA 1EOTA 2MGSA 2R3ZA 2RA4A 2KEEA 2K1BA 1NAPA 2HCIA 4U68A 4RA8A 4XT3B 4XDXA 2M2LA 4UAIA 5D65A 1F9SA 1SSOA 3DM1A 2H1EA 3I3CA 1WTWA 1KNAA 5CORA 1WTQA 2KECA 2B2YA 1RTOA 1DOMA 1F9QA 1VMPA 3UI2A 1X32A 2L9HA 3FDTA 1SAPA 1HHVA 2K05A 2B2TA 4QUFA 1U4PA 1CA6A 1PFNA 2JP1A 1EIHA 3H91A 1RJTA 5AFWA 4HAEA 5JJZA 3KUPA 2RVLA 5T1IA 2L12A 1HFGA 1SDFA 2FHTA 2BDNA 1WTXA 3F2UA 1MSGA 1B2TA 4IUUA 2L4NA 3MTSA 2HCCA 4R8IA 2KUMA 5EPKA 1MI2A 2K01A 4ZKBB 1AZQA 1HFNA 1ILQA 3DEPA 4HCSA 1AZPA 1AP0A 2X6GA 4X3TA 5DNFA 1EL0A 4LMQD 2X6LA 1B50A 4NW2A 4IUQA 1X3PA 1G2SA 4HSVA 5COYA 2DY7A 2L11A 4MHEA 1G6ZA 4IURA 1O7YA 2B2VA 2KVMA 2Q8RE 3HP3A 3QO2A 1O7ZA 1PFBA 1XX8A 1ML0D 2EPBA 1PFMA 2L1BA 2NYZD 2NZ1D 2HUGA 2SDFA 3IFDA 5EQ0A 1C8CA 2N88A 2B2WC 1QG7A 2K28A 1MSHA 4ZKCB 1DZ1A 1J9OA 3TZDA 1DOLA 2D9UA 1PLFA 3D6WA 5E4WC 2B2UC 2CVRA 2FMMA 1F2LA 1RODA 4X3KA 2FINB 1WTOA 1B53A 3LWEA 4RAUC 3FPUB
chains in the Genus database with same CATH superfamily
3PCOB 4KJNA 5FJ8G 1A2UA 1TWHH 4DV5Q 4HJ9A 4B3TQ 1QVFA 2QA4A 1ESRA 2DUDA 3W3AA 1R9TH 2R93H 3L2PA 1FGBD 3HOUH 3PO2H 4KHVA 4JBWA 3DWPA 1B1ZA 4KKUA 4X65L 5I4DA 4GNXB 2YTYA 2O4XA 1AE2A 2D2CC 3ND9A 4L63B 1N36L 4BY7G 3UDIA 1VQPA 2ATWA 1G51A 4ZK9B 1QE6A 2BCOA 2JA5H 3TP8A 4ODGA 2SNSA 3NTKA 2VL6A 2Z9HA 1WD0A 3VR5A 4IFDH 1BBUA 1EFWA 4DR6L 2K04A 2D5DA 3FMCA 4R4TA 2QGQA 5AJ3Q 1I50H 3T1YL 3KDFB 2EIFA 3T13A 4GLVB 3NTIA 1T5EA 4GKJL 2MGSA 2K1BA 3CF5A 4XT3B 5JPMC 4GNXA 4NP5A 2XGTA 4JI3Q 1CZWA 5D3IB 3V05A 2ZTEA 1YITA 3ZYYX 1HR0L 1TY0A 4A3IH 4U673 4DR1L 4DV1L 1SE2A 3SE0A 2RDHA 3E5SA 4OWTB 4QF4A 1A0IA 5T1IA 2EXDA 1SDFA 4DKAC 1TWFH 2HCCA 2Z6KC 3ER0A 4DNRB 2K01A 4ZKBB 1K3BC 3DEPA 4HCSA 4JBJA 1AP0A 3DLLA 1LTID 3KDFA 4DUYQ 3VYRA 3A55A 5C4JB 1YEZA 4FXKC 1N9WA 3IAYA 3K5NA 5CV8A 1Q86C 4R4QA 4YIJA 3NPPA 4JI7Q 1VQLA 3EN2A 3D6WA 1CSQA 2RCFA 1C8CA 1PFSA 1HNXQ 1ET6A 4NXNQ 3RZDB 1HA5A 5KEEA 1STBA 4F87A 4A3DG 1BUVT 3PO3G 4V190 3GTLH 3FPUB 2O2LD 4BBSG 1A15A 2KEDA 3S14H 5C3WA 3X3NA 4JCVE 1IW7C 3GDEA 1ZYRD 1X3EA 5IGEA 5IY0A 1XNQQ 2EY5A 2SEBD 1EEFD 3RZOB 5JPNC 2HHHL 5M3MG 2NVXH 4MTNA 5FK9C 1D7QA 2Q2UA 1DOKA 3MC0B 4PMWA 3R2TA 5CBEE 4DR2L 5M5XB 1V1PA 4JG2A 3QIAA 4AQYQ 4A93B 2WB1E 4JC0A 4GN4B 5C0XJ 1TWAB 3MWYW 2N78A 3GTJB 5ELNA 1QWYA 2Z0SA 4X62L 1F2MA 1BCPF 4YWMA 2PW5A 5IP7G 2VZAA 2IW3A 2Z8LA 1HA6A 4R8NA 1ZEQX 2CFMA 3FP9A 4A3FG 2KHSA 2JEAI 2QEXA 1GHJA 2B29A 1SSOA 1LTBD 5IWAQ 3RUZA 3Q23A 3HEJA 2PO4A 4DR7L 1HQRD 3GTQB 4F7XA 1PFNA 4J15A 3NELA 5C5MA 2F0UA 2BE5D 3S16B 2Q2IA 2VB2X 3N6RA 1I6VC 1RL2A 4HIOA 4L5SA 4DK6C 1B2TA 1EY9A 1GUNA 1RF2D 3KF6A 3HOYH 1S5CD 3D31A 1EFID 1WTHA 5GAEC 1HCZA 4KMUC 2E5LL 1ASYA 2F0KA 2GN5A 1VQEA 5COYA 4CKBA 1DD2A 3BJUA 4BXXH 4DV6L 3K58A 3AU7A 2PNRC 3QB3A 1M90C 3F1ZA 1PV4A 3NUCA 1PZKD 2K50A 4O0AA 2JA6G 1PXUA 4KLKA 1JJGA 1XNRL 2FMMA 2OTLA 1IBML 1MIUA 4C3HB 4EQPA 4X3KA 1A3VA 3PUZA 2A69D 1TXYA 1IBKL 3BZCA 3KJPA 3PQIA 2LY7A 4OO1G 1J5EQ 1JORA 1YVCA 2XRQD 1KDBA 2QDLA 4A3EB 2UUAQ 1LT5D 5E4XA 3ND8A 3OTOL 5CV9A 1PH1A 3TP5A 1CSPA 2OQ0A 1EIGA 1K3RA 5EKIA 3GTMB 3NSWA 5IYCG 4MZ9A 1EY7A 1V9PA 4DR3L 2EQSA 4ILWA 2F0JA 3GV6A 3CC2A 1EYGA 3KF8B 4IUTA 2A5HA 4A3GB 1U4LA 3NP8A 1UUPA 4IJLA 4X3SA 1PVOA 4UP7A 2J4XA 4YCWA 4KD4A 4HEDA 3I4NB 2R7ZG 3A7LA 4A93H 5I9PA 2K5NA 4DV7L 4MTKA 2QW7A 1V8QA 1NR4A 4PZ6A 2I0QA 3UDXA 1QNKA 4I7ZC 5G3LF 3GTJH 2PCFB 4OELB 4LK1C 4UHVA 1MKHA 3UE1A 2JXMB 5BR8L 1CHPD 1ONLA 3CMAA 4AYBB 4IFDJ 5HGQA 4A3JH 1C7YA 1H9SB 5D65A 1GXDC 2EY2A 1HZCA 5EBDA 3KF8A 4DV3L 2B2YA 4UY8C 4BY7B 2GA4B 1OXXK 1FJGL 5LMUL 1DM0B 2JP1A 3H0GH 3CCJA 2A6HC 3FHWA 2ES2A 2BOSA 1JB3A 5L37A 3SK8A 2XNAC 4LUOA 2EZVA 1A8VA 4R4IA 4X3TA 3JAMc 1F2ZA 4OO1I 3I4MB 3K0YA 2VB3X 3EIVA 1KC8C 1KAWA 3MEHA 5FLMG 4YWLA 3D4DA 1PFMA 1H9SA 2NZ1D 3IFDA 2EYPA 3MFGA 3L9AX 1Q46A 1QG7A 3A8KE 4UP8A 4NPSA 1N32L 3BZKA 1SYCA 5C3XA 3A8IE 1A3TA 2NVYH 4A4IA 2FMCA 1SNOA 1N33L 1SJED 3ULLA 2VS1A 1V1QA 3D6CA 4A76A 2P5ZX 1LTGD 1SJHD 3PUYA 1TS3A 4FP5D 1KAAA 5I2XA 5M3FH 3OWEB 1M8AA 3K7AB 4C2MB 1VF5C 1S5DD 1IBLL 4FNFA 1IYUA 1IHZA 5JJKA 1W2BA 3VR4A 3GTPB 1PZID 4DPGA 4IUPA 1OO9B 1EU4A 2DY8A 1PH4A 4OL7A 2K5DA 2CQOA 4CJ1B 4P71A 4B3TL 1XWEA 4O1NA 4DNIA 3KBXA 4BBRH 1LT6D 1JOQA 2A19A 5LMNQ 1VQJA 2WAQB 4ULLA 2DJGC 4IUVA 3GTMH 5C4XB 4DR5Q 2G5DA 4CDCC 4CKEA 2F4VQ 3A56A 4LF5L 1RD9D 4Q0FA 1OXUA 1V43A 5BN4A 1FR3A 3MFYA 5IGCA 1NCVA 2A73B 4IQZA 4FYDA 1EYCA 2WP8J 4L6TB 1B44D 2OT2A 1G8ZD 3TN2A 1PTOH 3S1RH 2EY1A 2KOLA 5ELEA 5M3MB 1GUTA 1EU3A 3SHLA 1EOTA 2AQ1B 4JOIA 4N9TA 3SGIA 1S5ED 4QB4A 4HN7A 4RA8A 2F3WA 5E7NA 5FJ8H 3OYYA 5J39A 1VDZA 3A5UA 4CBVA 5M5YH 1LABA 1JWUD 1PRTC 3TZUA 2K05A 2ENBA 1RJTA 5AFWA 4HAEA 1E7ZA 2KCNA 4ZUJA 3AEVA 3UDFA 1VCIA 1HFGA 4WJWA 4C3IB 3ITPA 3UE0A 2A74C 3AYHB 3NENA 1KDCA 1RIPA 3OPOA 4K14A 3OW2A 4BY7H 4LMQD 5JVG3 2ZJRA 2E76C 2F0IA 3LGJA 3RN2A 3NBHA 5IGDA 2DY7A 3Q24A 2CCZA 2F0DA 4MHEA 4A3FB 1YNND 1CFMA 1HNZQ 2IX1A 1Q81C 2B2WC 3W5OA 2D0OA 1J9OA 1M1KC 1X56A 3BS1A 3MXGA 3BVZA 5K36G 4PMCA 1QZGA 4JI7L 1UE6A 4RGOS 1TWCB 2K5HA 1SNPA 2NTTA 4PV1C 4JI0Q 4DXGA 4BY1B 4X3UA 5CBAE 3E6ZX 4KK7A 1NBWA 2E2IB 1XMQQ 4CGYB 1E0BA 4UP9A 1U4MA 3TP7A 2EYMA 2BH2A 1D1IA 1L1OB 1KLGD 1CHQD 1X3QA 4IJHA 1B3AA 3S17H 4JYAQ 1UE5A 3HOZB 2DJFC 1G291 3J7AV 1KHIA 2ZM6Q 1CI3M 1K0SA 4DAVA 3I91A 1CK1A 1JR0D 2A6EC 2JA6B 3E0EA 4BS9A 3S15B 3F2CA 4G7OC 4KI0A 1KQSA 4XQQA 1WCMG 5DLQE 4AQYL 1U4RA 4YHHL 4KY7A 1K8GA 3EVQA 2AUJD 2MJ8A 3CHBD 5CR3A 4IPCA 1PYSB 2NWGA 4YY3Q 3ERSX 3KLRA 1VQ4A 1W6KA 1SYBA 3FPPA 1ZKOA 2ZTCA 4JI4Q 4A3DH 2K4KA 3PO3H 1L1OA 2R3ZA 4BBSH 4R4OA 4LFCQ 4IN3A 1E2WA 4UAIA 4L5TA 3CRLC 5CORA 1JJCB 3BVGA 2L9HA 2UU9Q 1HHVA 4LF4L 1CA6A 1YBYA 5IP9H 3K5OA 5M3MH 4CKCA 1DXMA 1DCZA 2RDGA 1K83B 3T1HL 5IWAL 2UXCQ 3D4RA 5A2QL 4JW0A 1GUSA 3EBEA 2WB1B 3DMUA 4CDDC 4PZ7A 1FNVA 4JI1Q 3AFQA 4HIMA 4EGVA 4TVAB 2R92B 2JA9A 3K7UC 2L11A 2LFNA 4C3HG 2JSOA 2YYZA 2EJFC 1O7ZA 1U5KA 2L1BA 2XN9C 4JI2Q 4DF7A 5IP7H 3H3VI 1Q8IA 4HJ5A 4POFA 3Q0AA 3J7A5 5ISRA 2F52A 4RH6A 4KJOA 2UUCL 3S2HB 3J81j 4A3EG 1H9RA 1LT4D 2FINB 1UEAB 3EROA 1BOSA 4A3FH 2YTXA 3RN5A 3E9IA 2VQFL 1VF7A 1BBWA 1IKLA 2NVQB 3VR3A 2B2WA 5C44B 2NVTB 1VQ5A 2VQEQ 4B3RQ 1BVSA 3M3YB 1J5EL 1SNMA 4A3GG 2PQEA 5FO9B 4CJ2C 4KKSA 4LJZC 3WWVA 3OW7A 1LTRD 3N52A 5IGFA 1HR0W 3I4NG 2CW0C 1PMRA 4Y7NH 4LFBL 2GVBA 2EYFA 1CM9A 1PZJD 1PHJA 1G6PA 2E2JH 4ALPA 3HKZG 3R8BA 1FVIA 1TWGH 2PMZB 3B6YA 3I2ZA 2CH4A 2F0OA 2KBNA 3GTKH 1I6HH 1SE4A 2HIXA 2QDBA 3AB9A 1Y8OB 2HDLA 2JA6H 1X6OA 2YU9H 1UWVA 2V4DA 4AYBG 4A3KG 4YWKA 3TP6A 1TY2A 1TVXA 3A74A 5IYDG 1GOZA 2RA4A 3LX0A 1NMFA 2KHJA 4JBMA 4OO1H 4WFN3 1F9SA 1GM5A 1VQ8A 1VQHA 5LMNW 3MHBA 3V96A 4WJ4A 4KV6A 4KD3A 2AUKA 2RVLA 5IYBG 5IYCH 4H44C 4DA2A 4JV5Q 2WINB 3MA2B 4IUUA 3I4MG 3DUZA 4P72A 5EPKA 3KLSA 4NXMQ 1JMCA 1YHBA 4GN3B 1TIID 1YHAA 2X6LA 1J6QA 1IZ6A 1IW7D 1B8AA 1BCPC 4X66L 2VY3A 1NE3A 3TBIB 3OMCA 2R7ZH 4DR4L 5I6WA 1N34L 4DU9A 3M4OH 4A3CG 1SBBB 5KYIA 4DV0L 2ZXOA 3WOEA 2UUBL 1D6EC 3FVQA 4DXFA 1RDPD 3L0OA 4K8IA 1PH3A 1KL9A 4H13C 4JI5Q 3I7FA 3PMFA 1VQFA 3PUVA 4OIKA 4OGQC 1STHA 3KYHC 5JOBA 2KHIA 1HRJA 4A3BB 2JJQA 1SFOB 3RLOA 3C2PA 2Q8TA 2TSSA 2BDOA 5CYUA 4K5WA 1V1PB 2MP1A 2F0VA 1A3UA 1X55A 2WAQG 2BA1A 1OXTA 2JYOA 3I70A 4LF8Q 1A63A 5C4XG 5D14A 3NEMA 2IT1A 2PW7A 1AEXA 1TKWB 2CWPA 4LUZA 1Y1VB 5CV7A 2WACA 3M4YA 2F3VA 4CJ0B 1JT8A 2AQ3B 4EQ5A 4LF7Q 4GKKL 5FLMH 3PIOA 3SK4A 1M4VA 1Z47A 2B2VC 1JWSD 3QG1A 3CQZB 4K5XA 4LF9Q 1PTOD 2X69A 3NHHA 1RHPA 3ULPA 1NSNS 2QCPX 4HSPA 1B9NA 4A3MB 1IYJB 4JI8Q 4KHPQ 1EYAA 1WTWA 1B3QA 1STNA 4C3IG 1X32A 3KLSX 1B9MA 3KLWA 5GADC 4DV4L 1UE1A 3KF6B 3D0FA 1SYEA 2F4IA 1E2ZA 2DNEA 1SNDA 2VW9A 5TSSA 4P2CB 3S2DB 1X9NA 2HT1A 1HNWL 1WCMB 1IXRA 1FL0A 4FXGC 1AZPA 1SE8A 2JEBI 5A35A 4B3MQ 4KTAA 4HMIA 1EL0A 4F88A 3MXUA 1O78A 4HSVA 1Y1WB 2VUMG 1D2BA 1W3SA 3W1BA 4FXDA 3OIQA 4LFAL 2ZT9C 1K28A 3HP3A 2EPBA 1HFNA 4ZKCB 1PTOC 3PIPA 1B70B 3URYA 2CVRA 4BY1G 2C35B 3GD7A 2I46A 1EY4A 2N55A 4ABNA 1YNJC 2HDMA 4N8FA 3QWNA 4I7AA 2E74C 2B8GA 3K5LA 2JA7B 3T56B 4UDUC 3HOZG 1VQ7A 1QB5D 4B3SL 1HXYD 4P73A 2A8VA 5JEAG 4G4KA 4DUZQ 1CTMA 1A62A 2K03A 2L0CA 2PI2E 3HOXB 2Z6KA 3WDNA 1MJEA 3M9BA 4OX9Q 1IL8A 1RTNA 2JA8B 1SMXA 3TREA 5C4JH 3JC66 3QOLA 5A2QE 4HTHA 1PA6A 2RKSA 1EY8A 2DNCA 1X54A 1XMOQ 2AQ2B 3W2DA 4EX5A 4YCUA 4B9WA 1ICWA 1I4RA 1STYA 3RZDH 2MUYA 5IT9c 1L0WA 1VQAA 2WKDA 2HD3A 1I94Q 3NTHA 2MPMA 4ZAIA 5FLXL 2A6HD 1T9HA 4DV2L 1A6XA 2K33A 2IWHA 5KGUA 5K36H 2LKVA 4NKLA 2UXDL 3J7YW 2F0LA 1Q7YC 1PH5A 1FD7D 3RZOH 1EY6A 4LUVA 1EWIA 1KLUD 2K75A 3CCQA 2H1EA 5JEAJ 2CWAA 1PH7A 2IHEA 3T4AC 4EVOA 3G6EA 3H3VH 2WB1G 5M5XH 4WRDA 1VQCA 3KUPA 2R92G 2N3SA 2UXBQ 3U4ZA 3HKZB 1TWAH 1BR9A 2SOBA 1HQMC 5ELBA 3IRBA 4R8IA 3FKIB 3BU2A 1E2VA 2CKZB 2X6GA 5K5PA 1TS5A 2K6AA 1X3GA 4X65Q 4A3KB 1N36Q 4IURA 4N9PA 3ULJA 1WCMH 2F0GA 5IIFA 3PUWA 4O2DA 4FF2A 4JI6L 3DM3A 5EQ0A 3W1GA 3TRZA 2F0NA 2IJ0A 1Q8KA 3CCVA 2KQ3A 3A0JA 1PLFA 4J1MA 2B2UC 2B8FA 1HTLD 1QOHA 2HQLA 4DR6Q 1Z7TA 2RHSB 4L5RC 2HIVA 4IPHA 4RCNA 4QMGA 5C44G 2RHQB 3GTQH 2EXZA 1DJRD 3T1YQ 3K6OA 2VNUD 1QCBD 3S16H 4A75A 1I4XA 2Y0SE 1I4GA 3VYSA 1PH9A 2I5MX 2XIWA 2LXKA 3STBD 1QVCA 1IYVA 4RMFA 2VXWA 3ERQA 1HR0Q 3JAML 1LT3D 4M1UB 4DV1Q 3I56A 4X64L 3TSSA 3PF5A 1KRTA 4B08A 5C3EB 1Y69U 1G2TA 1VMCA 3R93A 4IOCA 4ZLTF 2NN6G 5KYLA 1PRTD 2F0MA 4FF4A 1TT2A 4C3HH 5EKLA 5JJIA 2BA0A 1YIJA 4FF3A 2B2TC 3J80L 4DV5L 5EAYA 1O80A 4KHZA 4A3EH 1MBYA 2LXJA 2AWNA 2OQKA 2EVBA 3GP7A 2Z4IA 3RNUA 2O5IC 4C3JB 3E0JA 1KD1C 1DOMA 3GTGB 4L5QA 3HOVG 1EIHA 2NZOA 4GOPC 1H9JA 2OWOA 3STBC 1VQBA 1STGA 1EEID 4A3GH 1T5XD 2B63B 5LL6S 4AIMA 2HHHQ 3NBHB 4WJ3M 1VS0A 3I4NH 1JC7A 1SROA 1Z9FA 2O5JC 1JOKA 5AJ3L 4DR2Q 3S1MB 2BH8A 1DYQA 3QR8A 3GTOB 4LF6Q 3CMEA 3BYTB 2AMCB 1I3QB 2F1MA 2OEOA 1K0RA 2A68D 2CH4W 4JI3L 3TZDA 1DOLA 3CPWA 3SEBA 4A3KH 3KBGA 4PG3A 4X62Q 1AH9A 4HIDA 2D0PA 1B53A 2GVAA 3OMGA 2XVSA 3HOWB 4A3BG 5IYDH 2A6ED 2EYHA 3CW2C 1C9OA 1E24A 1S72A 4PMBA 1L0YB 1LTSD 1VQOA 1Y8NB 2NN6I 3KFUA 1SLJA 1VQGA 5D3DA 1CKMA 3HRZC 1VQNA 2F0SA 4XIGS 5CMDA 5KNBA 2VUMB 3ZJYC 5IYBH 2K5VA 2ZTDA 3M4PA 5JVH3 4JI5L 5M9OA 1Y1VG 4DUYL 1WD1A 1TR5A 4DR7Q 3I4MH 4LW1A 4RCOA 1ASZA 2PZWA 1EQVA 4KY5A 1BBXC 1HNXL 3BZDB 3G48A 4FF1A 1EWHA 1ENCA 4NXNL 3S1NB 2Q8IB 1R4QB 1PH6A 3DHQA 3K59A 2E2HB 1XTCD 4K0KQ 5M5WB 4DAYA 1D8LA 2F0FA 1QUQB 2A68C 3SVMA 2E5LQ 1NR2A 1UAPA 3HZXA 1F77A 2MFIA 5EPJA 3I55A 4A3CH 2RSOA 1KRSA 1XNQL 4A3MG 5IE8A 1JE5A 4DV6Q 2KCTA 2XRSD 3K7AH 4C2MH 4LNQA 2D62A 1WOCA 4Q5VA 4H0LC 3GTPH 1LTTD 1NAPA 1SXTA 1YJNA 2AHOB 5CC4A 4H7BA 1XNRQ 1H95A 1IBMQ 1F9QA 4JK1C 3UI2A 2XTIA 2B2TA 1TWHB 4DK1A 1IBKQ 3S9WA 3M4QA 4QIWE 4RHSA 2R93B 2G9DA 3HOUB 1PRTB 3OTOQ 1Y1WG 3PO2B 3U58A 2KUMA 1QUQA 5C4XH 4QQBX 3T16A 1B50A 1YZ6A 4DR3Q 1TU2B 2QILA 2H4OA 3AMUA 1FYCA 1LYLA 3HG9A 1SN8A 4G7HC 3CCEA 1O7IA 4IOAA 2D9UA 3P20A 1OTCA 2MNAA 1K73C 2E8GA 4DFAA 2OCEA 5LHY1 4IPGA 4K8JA 5ELOA 5HGTA 2JA7G 5FLXE 3LWEA 1GO3E 1WTVA 1I50B 1D5XC 4FVMA 2CW0D 4DV7Q 1JCKB 1KNEA 2EJGC 1ILPA 1CT1D 1EIYB 1I3QH 4ID6A 3K8AA 3G71A 3HOXG 4GNXC 3TS2A 1SYFA 1E1TA 3H15A 2Z6BA 3NQIA 3SR1A 4C3IH 3X3MA 2JA8G 1KXLA 5BR8Q 2QEJC 1YNXA 4A3IB 3ONAB 3BDLA 4DV3Q 4IZ8A 1CQFA 2M00A 2EE1A 2ZJQA 3CD6A 1FJGQ 5LMUQ 4OEMB 2EY6A 4OIJA 4HJ8A 1KTKA 3NWSA 3KJOA 1TWFB 4JPBW 1NMGA 2FJ2A 2NBFA 2VUMH 2RSNA 4QGUA 4QL5A 1SNCA 1P8LA 3Q22A 3J81L 4JBKA 1F2YA 2LS01 1STEA 3PGZA 2DGYA 1BO0A 3HS0C 3VR6A 1D1KA 4HCEA 1EY5A 5J3BA 1TWCH 3FEWX 2R7FA 2UUAL 3S1NH 4BY1H 3V2TA 2EOTA 2E2IH 5IOCA 1TQOA 1EUJA 3J7ZC 4XYQA 1HZBA 1N32Q 1HZ9A 3DM1A 1KIXA 3GTLB 2L15A 1WTQA 1SMYC 3E9HA 3U4VA 5C4ZA 1N33Q 3S14B 1BCPD 3HOZH 1TS2A 4A3LG 2LMCB 2F0EA 3H91A 3FKIG 1JQYD 5JEAH 5KRUA 2L12A 1WTXA 5GAGC 1IBLQ 3S15H 2NVXB 3KOJA 4K6LA 1AZQA 3JAME 1L0XB 2Z1CA 3M7GA 2XWBB 1PH8A 1U0LA 2UXBL 4RGMA 1X3PA 3NE5B 4GZYC 1I5FA 4I65A 2PPBC 1XJVA 1EOVA 2KVMA 1LM0A 1X3FA 3H94A 2N88A 2K28A 4XTCS 2PNHA 4RGTA 1E22A 4QY7A 2PI2A 3J80E 3HOVB 4LF5Q 4RHRA 3DWAA 3MVVA 1BF4A 3MXPA 2E75C 1HH2P 4C1NK 1MGSA 4IO9A 1I4QA 5I9OA 5HY6A 1K83H 2I5HA 3IL8A 1XPOA 3H3VC 4R9WA 2CQAA 1CKOA 4KN4C 4C1NI 5E3FA 3GV3A 2R92H 3G4SA 4RFBA 5C3EG 1LTAD 3RLFA 2EYLA 2K5WA 1E1OA 1Q1BA 4NMZA 3VA7A 1EYDA 4P74A 2ZJPA 4X6AH 1HZAA 2A1AA 2OF1A 3HOYB 3OSOA 3MXNB 1JE4A 5JJLA 1AE3A 3S2HH 5I2YA 2OXPA 1WJJA 1PDQA 1S4ZA 4OWWB 1LUZA 3VDYA 2KJXA 4C3JG 2DN8A 4UPAA 3S24A 4CHTB 2L55A 4R4CA 4H02A 2NVQH 5GQOA 5C44H 2F0HA 2NVTH 1EIFA 2JN4A 1GKHA 2JE6I 3GQBA 1S5BD 5C0XG 3M3YH 3P1HA 3M7NA 2Y0SB 2RCNA 2B63G 1CQVA 3M85A 3VA5A 2MO1A 1LACA 5LMNL 1CUKA 1SNQA 3OHXC 2FHTA 2NUCA 2BDNA 4BA1I 5ELFA 3CAMA 3MXNA 5G3LD 1A2TA 4DR5L 4LAAA 4L8JA 2EYOA 3K80C 4EQOA 2F4VL 1JWMD 3BG3A 2M9VA 2NTSA 1R4PB 1YNJD 4IUQA 5EGTA 5IODA 5I6YA 5IP9G 2NN6H 2R7DA 4ZYSA 3VYTA 4HMJA 3QO2A 1PFBA 4MNOA 5CGKA 3ICEA 3HOWG 5IGGA 4G57A 4GN5A 1B7YB 1BCPB 2ZXRA 4QJFA 1WTOA 2AKWB 4LF6L 4YHHQ 4RKBA 3Q6SA 2EJMA 3L7ZC 4NB3A 1I4HA 1C0AA 2IY5B 3I8ZA 3TEHB 4XQNA 5DEHA 2B2YC 4A3JB 4PQXA 3HOVH 4DAPA 3QJYA 1JOOA 1EQTA 1EWCA 1CA5A 4RGNA 3Q8DA 3PF4A 5E1FA 2PYKA 3H0GB 2TMPA 4LF4Q 5EJWA 4QUCA 5EPLA 4O42A 3OWFA 3CXCA 3H6MA 4WORA 1ZYRC 1HNZL 3D4WA 3QOJA 3T1HQ 4TQUS 1K9MC 4TKOB 5C0XI 2WIIB 5DM73 3EJIA 4IPDA 1K8AC 4TRDA 2FXQA 3DEOA 1SEBD 1LTLA 4EQNA 1NTGA 2F0TA 3NWTA 4Y52H 1NJIC 1DZ1A 5CV4A 1IKMA 4JI0L 2B39A 4XT1B 4OWXB 4CDFC 1YI2A 5F2DA 2F3IA 1XMQL 3P75A 4K0KL 4IALA 1TS4A 1QZHA 2KCCA 2ICEC 4DGZA 2HCIA 4A3BH 4U68A 1SFOH 1BDOA 2NVYB 4JYAL 2RQXA 2UUCQ 4CDEC 2QKIC 1RTOA 1VMPA 2R93G 3FDTA 3A54A 2PMZE 3BVMA 2ZM6L 4HIKA 3HOUG 4QUFA 1U4PA 3PO2G 2I5LX 1OXVA 2Q2HA 2VQFQ 5M3FB 4DAMA 5J1ZA 4DK3C 1VQIA 1GUGA 4FO2A 1Y1VH 3EFXD 5EBCA 5FLXc 1MI2A 3F8TA 1ILQA 3HFZB 2IPKD 2C5CA 2JA5G 3C3LA 4HJAA 5IT9L 2YTVA 2N8NA 2MO0A 1LO5D 4PNYA 4IFDG 5KNDA 4YY3L 5DM63 2E2DC 3CQZH 4BBRB 3C1FA 1D5ZC 4JI4L 3SXHA 2B2VA 2BE5C 3RD4A 3T51B 5J22A 5ELCA 4LFBQ 1IL2A 4LFCL 3J81E 4OHJA 1RCVD 5FOBB 5HURA 4A3MH 2UU9L 4RAUC 1BQQT 4KY6A 4JOIC 1PTOB 2F0PA 3NBIA 3S1RB 2UXCL 4A3IG 3F2DA 3CRKC 1PYBA 2F0QA 3S2DH 1VQDA 5IGBA 4RWSC 4QIWB 4JI1L 5M5YB 3VYUA 3I72A 4F8MA 1VQ6A 1PTOF 2A69C 1C48A 1Y1WH 1QJOA 2RF4A 2J7ZA 3CC7A 1JICA 3R2IA 1GVPA 2QF7A 3NXWA 5T1GA 1S40A 1QILA 1ZXTA 1QVGA 4JI2L 3P7JA 1DGSA 3OIPA 1K8OA 3MAQA 2FFKB 1KABA 2R61A 4NDXA 1LV9A 1YHQA 1STAA 1G91A 1F9PA 4GKJQ 3J7AF 4BA2I 2WV6D 3G7LA 1BNZA 1Q3LA 4RKLA 4QCLA 4X66Q 4DN4M 2K32A 1F9RA 3JAMi 4DR1Q 2K7VA 2JA7H 1CKNB 2KEEA 2VQEL 4B3RL 5JAVA 4DR4Q 1N34Q 5ELDA 4IFDI 4DV0Q 2EDGA 3HOXH 1SAPA 2UUBQ 4ZCKA 1ET9A 2C9OA 1SRUA 2JA8H 5JJZA 1H9KA 1X65A 1Q12A 4J6HA 4IUNA 3KK7A 3F2BA 1MJCA 3J80i 3F2UA 1MSGA 1OXSC 3MTSA 3J80c 2PZTA 3S17B 2G9HD 4K5VA 4HR7B 3G6JB 3RMHA 5LL6X 3T53B 3MEFA 1CKNA 2AWOA 3K81C 1Y14B 3IKJA 3R3OA 2Q8RE 1SYDA 1XX8A 2B3GA 1CZGA 2NYZD 4YCVA 1NUCA 3NQTA 3PSIA 1LLRD 3AQQA 1O7LA 1BXTA 5CV5A 2XSCA 5E4WC 4ZQ3A 1H9MA 4FDBA 1F2LA 1D5MC 4GKKQ 1ENFA 3DXJC 3EA6A 1EY0A 3MZ5A 1L1OC 4A3DB 4JV5L 1HTPA 3GO5A 3PO3B 2ICIA 5NUCA 2ZXPA 3CCMA 4GLXA 2SNMA 4K2LA 4BBSB 2YV5A 1ICFB 4NXML 1K8MA 3NK9A 4A3LH 1GHKA 2K5QA 3AFPA 3FKIH 3SK6A 1AN8A 1VQ9A 1MHWC 1BKBA 1GD7A 2N49A 3FRPB 1JJ2A 2R6GA 1EZ8A 2PQAB 2H5XA 1Q90A 1SE3A 2RBMA 4DV4Q 3HOYG 2IL8A 4G7ZC 1J8IA 1ENAA 4M8AA 2WKCA 4DAYB 1N8RC 1SR3A 1HNWQ 3K0XA 4BXXG 1GUWA 1XTDA 3BDOA 3E3XA 1NNXA 1WTRA 4K2KA 5CV6A 1HUNA 2B2UA 2F0WA 1WTPA 4E6IA 1JB7A 3LWUA 4C56C 4MN3A 3CC4A 4LFAQ 3I90A 3TDQA 5H1SE 2Y0SG 1U9RA 4JVZA 4GS3A 1PH2A 2ASBA 2IX3A 4XDXA 2M2LA 1HPCA 2PQAA 2MHVA 5EKKA 3RR5A 5KNCA 4LF8L 5C6AA 1E3PA 4XXEA 4ZUIA 3SK5A 4TSSA 3H09A 4GLAC 3K57A 3HGBA 5BN5A 3PUXA 5C5LA 1W6JA 4OONA 1II3A 2K52A 4DNTB 1EZ6A 5C3EH 4B3SQ 1UNSA 2ID0A 3I73A 1RKNA 4LF7L 4GOPB 3TMEA 1PYWD 1Y8PB 5FKAC 1GJXA 3WOFA 3S1QB 3CCSA 3D8GA 4LF9L 1G2SA 2WFWA 3LNNA 1S3OA 3A8JE 4LWCA 1YJWA 2I07B 3RLNA 4B9XA 1EQRA 1MD2D 4Y7NB 1AW7A 2IX0A 2KCMA 4ME5A 2SDFA 4A93G 1XXGA 2F03A 1EQQA 2E2JB 2JK8A 1TWGB 3U50C 1I6HB 4V0BA 4JI8L 3GTKB 4KHPL 1R9TB 3HKZE 4C3JH 4PZ8A 4Z9CB 2NZHA 4BWGB 3C46A 5FO7B 1DONA 3GTGH 1S5FD 2YU9B 4R1JA 4A3JG 5FO8B 1XYIA 1C4QA 1WYDA 2ALYB 4AYBE 3HKSA 3CCLA 1SYGA 4DV2Q 5C0XH 2JQOA 4ME3A 1YNNC 4GOPA 3O13A 2UXDQ 3H0GG 2JA5B 2B63H 1HUMA 1PRTF 3D3RA 3CKIB 3I4LA 3PIO3 4B3ML 4P75A 1FNUA 5C4HA 3IFTA 5BN3A 3CCUA 3CU7A 4XYOA 1ESFA 2J0TD 1Q82C 2IHFA 3S1MH 1P16A 4HJ7A 4DK0A 4OXPA 2RDFA 3U9SA 3GTOH 2CHBD 1QNUA 3OOCA 1B4OA 5IT9E 2Z4HA 1Q1EA 1WVLA 3UDGA 1SMYD 4AH6A 1V1OA 5DAUA 3CCRA 4KN7C 3PV0A 3A7AB 3L3OC 2K14A 3HOWH 1FNWA 4ZRZA 4RG1A 1L2FA 2R7ZB 3VR2A 1GUOA 4JI6Q 4S3SA 3M4OB 3CPFA 1NY4A 4DUZL 2PZUA 1AFPA 5M3FG 3C1EA 2Q2TA 3A5ZB 3U9OA 3I3CA 1KNAA 4POGA 2KECA 1FGUA 1KDAA 4OX9L 4N8X1 3BYYB 2NB0A 5GROA 3J81i 1HJPA 2L5TA 1I4PA 1UEBA 3BDCA 3J81c 1XMOL 4K6DA 3CP0A 2HQEA 1XPUA 2OTJA 2XWJB 2L4NA 3PIP3 4KKTA 3TS0A 4BBRG 2KA7A 3EQLC 3I4OA 1WFQA 2LSSA 2E2HH 5DNFA 1I94L 4APVA 1WI5A 5KIXA 5M5WH 2EYJA 4NW2A 1VQKA 2WAQE 2MQHA 3K5MA 4XQJA 4X64Q 1G6ZA 1O7YA 4MIUA 3SDZA 3DWQA 1UE7A 3TQYA 1YJ9A 1ML0D 2HUGA 4J8QA 1MSHA 1Z6HA 2V1CC 3S1QH 1RODA 2KENA 5GAHC 1XPRA 1VQMA
chains in the Genus database with same CATH topology
4KJNA 1A2UA 1ESRA 3W3AA 1FGBD 4KHVA 4JBWA 3DWPA 1B1ZA 4KKUA 5I4DA 2O4XA 2D2CC 3ND9A 4L63B 4ZK9B 1QE6A 2BCOA 3TP8A 4ODGA 2SNSA 3NTKA 1WD0A 3VR5A 4IFDH 2K04A 2D5DA 3FMCA 3T13A 3NTIA 1T5EA 2MGSA 2K1BA 4XT3B 5JPMC 4NP5A 1CZWA 5D3IB 3V05A 3ZYYX 1TY0A 4U673 1SE2A 3SE0A 2RDHA 3E5SA 4QF4A 5T1IA 1SDFA 2HCCA 4DNRB 2K01A 4ZKBB 3DEPA 1AP0A 4HCSA 1LTID 3VYRA 3A55A 5C4JB 4FXKC 3IAYA 3K5NA 5CV8A 4YIJA 3NPPA 3D6WA 1C8CA 1ET6A 3RZDB 1HA5A 5KEEA 1STBA 4F87A 1BUVT 4V190 3FPUB 2O2LD 1A15A 2KEDA 5C3WA 3X3NA 1IW7C 1ZYRD 5IGEA 2EY5A 2SEBD 1EEFD 3RZOB 5JPNC 5FK9C 1DOKA 3MC0B 4PMWA 3R2TA 5CBEE 5M5XB 1V1PA 3QIAA 4A93B 5C0XJ 1TWAB 3MWYW 3GTJB 1QWYA 1F2MA 1BCPF 2PW5A 2IW3A 2Z8LA 1HA6A 4R8NA 1ZEQX 2KHSA 2JEAI 1GHJA 1SSOA 1LTBD 3RUZA 3Q23A 3HEJA 2PO4A 1HQRD 3GTQB 4F7XA 1PFNA 5C5MA 2F0UA 2BE5D 3S16B 2VB2X 3N6RA 1I6VC 1B2TA 1EY9A 1GUNA 1RF2D 1S5CD 3D31A 1EFID 1HCZA 4KMUC 2F0KA 5COYA 4CKBA 1DD2A 3K58A 3AU7A 2PNRC 3QB3A 3NUCA 1PZKD 1PXUA 2FMMA 4C3HB 4EQPA 4X3KA 1A3VA 3PUZA 2A69D 2LY7A 4OO1G 1JORA 2XRQD 1KDBA 4A3EB 1LT5D 5E4XA 3ND8A 5CV9A 3TP5A 1EIGA 5EKIA 3GTMB 3NSWA 1EY7A 4ILWA 2F0JA 3GV6A 4IUTA 2A5HA 4A3GB 1U4LA 3NP8A 1UUPA 4X3SA 2J4XA 4KD4A 4HEDA 3I4NB 3A7LA 5I9PA 1V8QA 1NR4A 1QNKA 4I7ZC 5G3LF 2PCFB 4LK1C 2JXMB 1CHPD 1ONLA 4AYBB 4IFDJ 1H9SB 5D65A 1GXDC 2EY2A 5EBDA 3KF8A 2B2YA 4BY7B 2GA4B 1OXXK 1DM0B 2JP1A 2A6HC 2BOSA 1JB3A 3SK8A 2XNAC 2EZVA 4X3TA 1F2ZA 4OO1I 3I4MB 3K0YA 2VB3X 3MEHA 3D4DA 1PFMA 1H9SA 2NZ1D 3IFDA 2EYPA 3MFGA 3L9AX 1QG7A 3A8KE 1SYCA 5C3XA 3A8IE 1A3TA 2FMCA 1SNOA 1SJED 3D6CA 1LTGD 1SJHD 3PUYA 1TS3A 4FP5D 1KAAA 5I2XA 3OWEB 1M8AA 3K7AB 4C2MB 1VF5C 1S5DD 4FNFA 1IYUA 1IHZA 3VR4A 3GTPB 1PZID 4IUPA 1OO9B 1EU4A 2DY8A 4OL7A 2K5DA 4CJ1B 1XWEA 4O1NA 3KBXA 1LT6D 1JOQA 2WAQB 4ULLA 4IUVA 5C4XB 4CKEA 3A56A 1RD9D 4Q0FA 1OXUA 1V43A 5BN4A 1FR3A 3MFYA 5IGCA 1NCVA 2A73B 4IQZA 4FYDA 1EYCA 2WP8J 4L6TB 1B44D 2OT2A 1G8ZD 3TN2A 1PTOH 2EY1A 2KOLA 5ELEA 5M3MB 1GUTA 1EU3A 3SHLA 1EOTA 2AQ1B 4N9TA 1S5ED 4QB4A 4HN7A 4RA8A 2F3WA 5J39A 1VDZA 4CBVA 1LABA 1JWUD 1PRTC 3TZUA 2K05A 2ENBA 1RJTA 5AFWA 4HAEA 4ZUJA 2KCNA 1VCIA 1HFGA 4WJWA 4C3IB 3ITPA 2A74C 1KDCA 3OPOA 4K14A 4LMQD 5JVG3 2E76C 2F0IA 3NBHA 5IGDA 2DY7A 3Q24A 2F0DA 4MHEA 4A3FB 1YNND 1CFMA 2IX1A 2B2WC 1J9OA 3BS1A 3MXGA 3BVZA 5K36G 4PMCA 4RGOS 1TWCB 1SNPA 2NTTA 4PV1C 4DXGA 4BY1B 4X3UA 5CBAE 3E6ZX 4KK7A 2E2IB 4CGYB 1E0BA 1U4MA 3TP7A 2EYMA 1D1IA 1KLGD 1CHQD 1X3QA 1B3AA 3HOZB 1G291 3J7AV 1CI3M 4DAVA 3I91A 1CK1A 1JR0D 2A6EC 2JA6B 4BS9A 3S15B 4G7OC 4KI0A 4XQQA 1U4RA 4KY7A 3EVQA 2AUJD 2MJ8A 3CHBD 5CR3A 2NWGA 3KLRA 1W6KA 1SYBA 3FPPA 1ZKOA 2R3ZA 4IN3A 1E2WA 4UAIA 3CRLC 5CORA 3BVGA 2L9HA 1HHVA 1CA6A 3K5OA 4CKCA 1DXMA 1DCZA 2RDGA 1K83B 3D4RA 5A2QL 1GUSA 2WB1B 3DMUA 1FNVA 4EGVA 2R92B 2L11A 2LFNA 4C3HG 2JSOA 2YYZA 2EJFC 1O7ZA 2L1BA 2XN9C 4DF7A 1Q8IA 3Q0AA 5ISRA 4RH6A 4KJOA 3S2HB 1H9RA 1LT4D 2FINB 1UEAB 3EROA 1BOSA 1VF7A 1IKLA 2NVQB 3VR3A 2B2WA 5C44B 2NVTB 3M3YB 1SNMA 2PQEA 5FO9B 4CJ2C 4KKSA 4LJZC 3OW7A 1LTRD 3N52A 5IGFA 2CW0C 1PMRA 2EYFA 1CM9A 1PZJD 3R8BA 2PMZB 2F0OA 1SE4A 2QDBA 3AB9A 1Y8OB 2HDLA 2V4DA 3TP6A 1TY2A 1TVXA 1GOZA 2RA4A 3LX0A 4OO1H 4WFN3 1F9SA 3MHBA 3V96A 4KV6A 4KD3A 2AUKA 2RVLA 4H44C 4DA2A 2WINB 3MA2B 4IUUA 3DUZA 5EPKA 3KLSA 1TIID 2X6LA 1IW7D 1BCPC 3TBIB 3OMCA 5I6WA 4DU9A 1SBBB 5KYIA 2ZXOA 3WOEA 1D6EC 3FVQA 4DXFA 1RDPD 4K8IA 4H13C 3PMFA 3PUVA 4OIKA 4OGQC 1STHA 5JOBA 1HRJA 4A3BB 1SFOB 3C2PA 2Q8TA 2TSSA 2BDOA 5CYUA 4K5WA 1V1PB 2MP1A 2F0VA 1A3UA 2BA1A 1OXTA 2JYOA 3I70A 5D14A 2IT1A 2PW7A 1AEXA 1TKWB 1Y1VB 5CV7A 2WACA 3M4YA 2F3VA 4CJ0B 2AQ3B 3SK4A 1M4VA 1Z47A 2B2VC 1JWSD 3QG1A 3CQZB 4K5XA 1PTOD 2X69A 3NHHA 1RHPA 1NSNS 2QCPX 4HSPA 1B9NA 4A3MB 1EYAA 1WTWA 1STNA 4C3IG 1X32A 3KLSX 1B9MA 1SYEA 2F4IA 1E2ZA 2DNEA 1SNDA 5TSSA 4P2CB 3S2DB 1WCMB 4FXGC 1AZPA 2JEBI 5A35A 4KTAA 4HMIA 1EL0A 4F88A 3MXUA 1O78A 4HSVA 1Y1WB 1D2BA 4FXDA 3OIQA 2ZT9C 3HP3A 2EPBA 1HFNA 4ZKCB 1PTOC 3URYA 2CVRA 3GD7A 2I46A 1EY4A 2N55A 4ABNA 1YNJC 2HDMA 3QWNA 2E74C 2B8GA 3K5LA 2JA7B 3T56B 4UDUC 1QB5D 1HXYD 5JEAG 4G4KA 1CTMA 2K03A 2L0CA 3HOXB 3WDNA 1IL8A 1RTNA 2JA8B 3QOLA 5A2QE 4HTHA 2RKSA 1EY8A 2DNCA 2AQ2B 3W2DA 4B9WA 1ICWA 1I4RA 1STYA 2MUYA 2WKDA 3NTHA 2MPMA 4ZAIA 5FLXL 2A6HD 1A6XA 2K33A 2IWHA 5KGUA 5K36H 2LKVA 4NKLA 3J7YW 2F0LA 1FD7D 1EY6A 1KLUD 2H1EA 5JEAJ 3T4AC 4EVOA 4WRDA 3KUPA 3HKZB 1BR9A 2SOBA 1HQMC 5ELBA 4R8IA 3FKIB 1E2VA 2X6GA 5K5PA 1TS5A 2K6AA 4A3KB 4IURA 4N9PA 2F0GA 5IIFA 3PUWA 4FF2A 5EQ0A 2F0NA 2IJ0A 2KQ3A 1PLFA 4J1MA 2B2UC 2B8FA 1HTLD 1QOHA 1Z7TA 4RCNA 4QMGA 2EXZA 1DJRD 3K6OA 2VNUD 1QCBD 1I4XA 1I4GA 3VYSA 2XIWA 1IYVA 2VXWA 3ERQA 3JAML 1LT3D 4M1UB 3TSSA 4B08A 5C3EB 1Y69U 1G2TA 1VMCA 3R93A 4ZLTF 2NN6G 5KYLA 1PRTD 2F0MA 4FF4A 1TT2A 5EKLA 2BA0A 4FF3A 2B2TC 3J80L 1O80A 4KHZA 1MBYA 2AWNA 3GP7A 2EVBA 2Z4IA 2O5IC 4C3JB 3E0JA 1DOMA 3GTGB 1EIHA 1H9JA 1STGA 1EEID 1T5XD 2B63B 5LL6S 1JC7A 2O5JC 1JOKA 3S1MB 1DYQA 3GTOB 3BYTB 1I3QB 2F1MA 2OEOA 2A68D 3TZDA 1DOLA 3SEBA 3KBGA 1B53A 3OMGA 2XVSA 3HOWB 2A6ED 2EYHA 4PMBA 1L0YB 1LTSD 1Y8NB 2NN6I 5D3DA 3HRZC 2F0SA 4XIGS 5CMDA 5KNBA 2VUMB 5JVH3 1WD1A 5M9OA 1TR5A 4RCOA 2PZWA 1EQVA 4KY5A 1BBXC 3BZDB 4FF1A 1EWHA 1ENCA 3S1NB 2Q8IB 1R4QB 3DHQA 3K59A 2E2HB 1XTCD 5M5WB 4DAYA 2F0FA 2A68C 3SVMA 1NR2A 1UAPA 3HZXA 1F77A 5EPJA 2RSOA 2XRSD 2D62A 4Q5VA 4H0LC 1LTTD 1NAPA 1SXTA 5CC4A 4H7BA 1F9QA 4JK1C 3UI2A 2B2TA 1TWHB 4DK1A 3S9WA 4RHSA 2R93B 2G9DA 3HOUB 1PRTB 3PO2B 2KUMA 3T16A 1B50A 1TU2B 2QILA 2H4OA 3AMUA 1FYCA 3HG9A 4G7HC 2D9UA 3P20A 4DFAA 5LHY1 4K8JA 5HGTA 5FLXE 3LWEA 1WTVA 1I50B 1D5XC 2CW0D 4FVMA 1JCKB 1KNEA 2EJGC 1ILPA 1CT1D 4ID6A 1SYFA 3NQIA 3SR1A 3X3MA 2QEJC 4A3IB 3ONAB 3BDLA 4IZ8A 1CQFA 2M00A 2EE1A 2EY6A 4OIJA 1KTKA 3NWSA 1TWFB 2FJ2A 2NBFA 2RSNA 1SNCA 3Q22A 3J81L 1F2YA 2LS01 1STEA 1BO0A 3HS0C 3VR6A 1D1KA 4HCEA 1EY5A 3FEWX 3V2TA 2EOTA 5IOCA 1TQOA 4XYQA 3DM1A 3GTLB 1WTQA 1SMYC 5C4ZA 3S14B 1BCPD 1TS2A 2LMCB 2F0EA 3H91A 1JQYD 5JEAH 5KRUA 2L12A 1WTXA 2NVXB 4K6LA 1AZQA 3JAME 1L0XB 2Z1CA 3M7GA 2XWBB 4RGMA 1X3PA 3NE5B 4GZYC 4I65A 2PPBC 2KVMA 3H94A 2N88A 2K28A 4XTCS 4RGTA 3J80E 3HOVB 4RHRA 3DWAA 3MVVA 1BF4A 3MXPA 2E75C 4C1NK 1MGSA 1I4QA 5I9OA 3IL8A 3H3VC 4R9WA 2CQAA 4KN4C 4C1NI 5E3FA 3GV3A 4RFBA 1LTAD 3RLFA 2EYLA 2K5WA 1Q1BA 4NMZA 3VA7A 1EYDA 2OF1A 3HOYB 3OSOA 1JE4A 5I2YA 2OXPA 1PDQA 1S4ZA 2KJXA 4C3JG 2DN8A 4CHTB 2L55A 2F0HA 2JE6I 3GQBA 1S5BD 5C0XG 3P1HA 3M7NA 2Y0SB 1CQVA 3M85A 3VA5A 1LACA 1SNQA 3OHXC 2FHTA 2NUCA 2BDNA 4BA1I 5ELFA 3MXNA 5G3LD 1A2TA 4LAAA 4L8JA 2EYOA 4EQOA 1JWMD 3BG3A 2M9VA 2NTSA 1R4PB 1YNJD 4IUQA 5EGTA 5IODA 5I6YA 2NN6H 4ZYSA 3VYTA 4HMJA 3QO2A 1PFBA 5CGKA 5IGGA 4G57A 1BCPB 2ZXRA 1WTOA 4RKBA 3Q6SA 2EJMA 3L7ZC 1I4HA 3I8ZA 4XQNA 5DEHA 2B2YC 4A3JB 4PQXA 4DAPA 3QJYA 1JOOA 1EQTA 1EWCA 1CA5A 4RGNA 5E1FA 2PYKA 3H0GB 2TMPA 5EJWA 4QUCA 5EPLA 4O42A 3OWFA 3H6MA 4WORA 1ZYRC 3D4WA 3QOJA 4TQUS 4TKOB 5C0XI 2WIIB 5DM73 3EJIA 4TRDA 3DEOA 1SEBD 4EQNA 2F0TA 3NWTA 1DZ1A 5CV4A 1IKMA 2B39A 4XT1B 5F2DA 3P75A 4IALA 1TS4A 2KCCA 2ICEC 4DGZA 2HCIA 4U68A 1BDOA 2NVYB 2RQXA 2QKIC 1RTOA 1VMPA 3FDTA 3A54A 3BVMA 4QUFA 1U4PA 1OXVA 5M3FB 5J1ZA 1GUGA 4FO2A 3EFXD 5EBCA 1MI2A 1ILQA 2IPKD 2C5CA 3C3LA 5IT9L 1LO5D 4PNYA 4IFDG 5KNDA 5DM63 2E2DC 4BBRB 3C1FA 1D5ZC 3SXHA 2B2VA 2BE5C 3RD4A 3T51B 5J22A 5ELCA 3J81E 4OHJA 1RCVD 5FOBB 5HURA 4RAUC 1BQQT 4KY6A 1PTOB 2F0PA 3NBIA 3S1RB 3CRKC 2F0QA 5IGBA 4RWSC 4QIWB 5M5YB 3VYUA 3I72A 4F8MA 1PTOF 2A69C 1C48A 1QJOA 2J7ZA 1JICA 3R2IA 2QF7A 5T1GA 3NXWA 1QILA 1ZXTA 3P7JA 1K8OA 3OIPA 3MAQA 2FFKB 1KABA 2R61A 4NDXA 1LV9A 1STAA 1G91A 1F9PA 3J7AF 4BA2I 2WV6D 3G7LA 1BNZA 1Q3LA 4RKLA 4QCLA 4DN4M 2K32A 1F9RA 2K7VA 2KEEA 5JAVA 5ELDA 4IFDI 2EDGA 1SAPA 1ET9A 2C9OA 5JJZA 1H9KA 1Q12A 4J6HA 4IUNA 3KK7A 3F2UA 1MSGA 1OXSC 3MTSA 2PZTA 3S17B 2G9HD 4K5VA 4HR7B 3G6JB 3RMHA 5LL6X 3T53B 2AWOA 3IKJA 2Q8RE 3R3OA 1SYDA 1XX8A 1CZGA 2NYZD 1NUCA 3NQTA 1LLRD 1O7LA 1BXTA 5CV5A 2XSCA 5E4WC 4ZQ3A 1H9MA 1F2LA 1D5MC 1ENFA 3DXJC 3EA6A 1EY0A 3MZ5A 4A3DB 1HTPA 3GO5A 3PO3B 2ICIA 5NUCA 2ZXPA 2SNMA 4K2LA 4BBSB 1K8MA 3NK9A 1GHKA 2K5QA 3SK6A 1AN8A 3FRPB 2R6GA 1EZ8A 1Q90A 1SE3A 2RBMA 2IL8A 4G7ZC 1J8IA 1ENAA 4M8AA 2WKCA 1GUWA 3BDOA 1WTRA 4K2KA 5CV6A 1HUNA 2B2UA 2F0WA 1WTPA 4E6IA 3LWUA 4C56C 4MN3A 3I90A 3TDQA 1U9RA 2IX3A 4XDXA 2M2LA 1HPCA 2MHVA 5EKKA 5KNCA 5C6AA 4XXEA 4ZUIA 3SK5A 4TSSA 3H09A 3K57A 3HGBA 5BN5A 3PUXA 5C5LA 1W6JA 1II3A 4DNTB 1EZ6A 1UNSA 2ID0A 3I73A 1RKNA 3TMEA 1PYWD 1Y8PB 5FKAC 1GJXA 3WOFA 3S1QB 3D8GA 1G2SA 3LNNA 3A8JE 2I07B 4B9XA 1MD2D 4Y7NB 1AW7A 2IX0A 4ME5A 2SDFA 1XXGA 2F03A 2E2JB 1TWGB 1I6HB 4V0BA 3GTKB 1R9TB 4Z9CB 4BWGB 3C46A 5FO7B 1DONA 1S5FD 2YU9B 5FO8B 1XYIA 1C4QA 1SYGA 5C0XH 1YNNC 3O13A 2JA5B 1HUMA 1PRTF 3D3RA 3CKIB 3I4LA 3PIO3 1FNUA 5C4HA 3IFTA 5BN3A 3CU7A 4XYOA 1ESFA 2J0TD 4DK0A 2RDFA 3U9SA 2CHBD 1QNUA 3OOCA 1B4OA 5IT9E 2Z4HA 1Q1EA 1WVLA 1SMYD 1V1OA 5DAUA 4KN7C 3PV0A 3A7AB 3L3OC 1FNWA 4ZRZA 2R7ZB 3VR2A 1GUOA 4S3SA 3M4OB 2PZUA 1AFPA 3C1EA 3U9OA 3I3CA 1KNAA 2KECA 1KDAA 3BYYB 2NB0A 2L5TA 1I4PA 3BDCA 4K6DA 2HQEA 2XWJB 2L4NA 3PIP3 4KKTA 2KA7A 3EQLC 5DNFA 5KIXA 2EYJA 4NW2A 3K5MA 4XQJA 1G6ZA 1O7YA 4MIUA 3SDZA 3DWQA 1ML0D 2HUGA 4J8QA 1MSHA 1Z6HA 1RODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTV A;  1DON A;  3Q6S A;  1A15 A;  2N55 A;  2KED A;  1BF4 A;  1HUN A;  2HDM A;  1WTP A;  1XYI A;  1KNE A;  1ILP A;  1MGS A;  4X3U A;  5CBA E;  1IKL A;  1M8A A;  5E4X A;  4OIK A;  3IL8 A;  3I8Z A;  2B2W A;  1ESR A;  1HRJ A;  1E0B A;  2B2Y C;  1HUM A;  4R9W A;  1U4M A;  1EIG A;  4IUP A;  4RWS C;  2Q8T A;  5EKI A;  2DY8 A;  2K03 A;  2XIW A;  2MP1 A;  5CMD A;  1X3Q A;  1B3A A;  1EQT A;  1CA5 A;  3ONA B;  3GV3 A;  4CJ2 C;  2VXW A;  1DOK A;  1WD1 A;  4CJ1 B;  2JYO A;  1IL8 A;  3GV6 A;  1RTN A;  2EE1 A;  5CBE E;  5EJW A;  4QUC A;  3KBX A;  5EPL A;  2J7Z A;  4O42 A;  1JIC A;  4IUT A;  3N52 A;  4OIJ A;  5D14 A;  3I91 A;  5T1G A;  1U4L A;  2IL8 A;  1ZXT A;  1QE6 A;  4ZK9 B;  1BBX C;  1J8I A;  3P7J A;  3MWY W;  4IUV A;  4X3S A;  1ICW A;  1G2T A;  1CM9 A;  2FJ2 A;  1WD0 A;  2FFK B;  1VMC A;  3R93 A;  1B4O A;  2RSN A;  1GUW A;  4ZLT F;  1WVL A;  4HED A;  1LV9 A;  4CJ0 B;  1G91 A;  1JE4 A;  1U4R A;  1F9P A;  3DEO A;  2K04 A;  1BO0 A;  2MJ8 A;  1WTR A;  2B2V C;  3G7L A;  1BNZ A;  1NCV A;  2B2U A;  1PDQ A;  1Q3L A;  3SVM A;  2B2T C;  2HDL A;  1NR2 A;  1S4Z A;  2MPM A;  4ZAI A;  2NWG A;  1NR4 A;  5EPJ A;  1IKM A;  1HA6 A;  4XT1 B;  2RSO A;  4DN4 M;  1O80 A;  4MN3 A;  1F9R A;  1QNK A;  2EOT A;  3TN2 A;  3I90 A;  2X69 A;  1RHP A;  2KOL A;  1TVX A;  1EOT A;  2MGS A;  2R3Z A;  2RA4 A;  2KEE A;  2K1B A;  1NAP A;  2HCI A;  4U68 A;  4RA8 A;  4XT3 B;  4XDX A;  2M2L A;  4UAI A;  5D65 A;  1F9S A;  1SSO A;  3DM1 A;  2H1E A;  3I3C A;  1WTW A;  1KNA A;  5COR A;  1WTQ A;  2KEC A;  2B2Y A;  1RTO A;  1DOM A;  1F9Q A;  1VMP A;  3UI2 A;  1X32 A;  2L9H A;  3FDT A;  1SAP A;  1HHV A;  2K05 A;  2B2T A;  4QUF A;  1U4P A;  1CA6 A;  1PFN A;  2JP1 A;  1EIH A;  3H91 A;  1RJT A;  5AFW A;  4HAE A;  5JJZ A;  3KUP A;  2RVL A;  5T1I A;  2L12 A;  1HFG A;  1SDF A;  2FHT A;  2BDN A;  1WTX A;  3F2U A;  1MSG A;  1B2T A;  4IUU A;  2L4N A;  3MTS A;  2HCC A;  4R8I A;  2KUM A;  5EPK A;  1MI2 A;  2K01 A;  4ZKB B;  1AZQ A;  1HFN A;  1ILQ A;  3DEP A;  4HCS A;  1AZP A;  1AP0 A;  2X6G A;  4X3T A;  5DNF A;  1EL0 A;  4LMQ D;  2X6L A;  1B50 A;  4NW2 A;  4IUQ A;  1X3P A;  1G2S A;  4HSV A;  5COY A;  2DY7 A;  2L11 A;  4MHE A;  1G6Z A;  4IUR A;  1O7Y A;  2B2V A;  2KVM A;  2Q8R E;  3HP3 A;  3QO2 A;  1O7Z A;  1PFB A;  1XX8 A;  1ML0 D;  2EPB A;  1PFM A;  2L1B A;  2NYZ D;  2NZ1 D;  2HUG A;  2SDF A;  3IFD A;  5EQ0 A;  1C8C A;  2N88 A;  2B2W C;  1QG7 A;  2K28 A;  1MSH A;  4ZKC B;  1DZ1 A;  1J9O A;  3TZD A;  1DOL A;  2D9U A;  1PLF A;  3D6W A;  5E4W C;  2B2U C;  2CVR A;  2FMM A;  1F2L A;  1ROD A;  4X3K A;  2FIN B;  1WTO A;  1B53 A;  3LWE A;  4RAU C;  3FPU B; 
#chains in the Genus database with same CATH topology
 3PCO B;  4KJN A;  5FJ8 G;  1A2U A;  1TWH H;  4DV5 Q;  4HJ9 A;  4B3T Q;  1QVF A;  2QA4 A;  1ESR A;  2DUD A;  3W3A A;  1R9T H;  2R93 H;  3L2P A;  1FGB D;  3HOU H;  3PO2 H;  4KHV A;  4JBW A;  3DWP A;  1B1Z A;  4KKU A;  4X65 L;  5I4D A;  4GNX B;  2YTY A;  2O4X A;  1AE2 A;  2D2C C;  3ND9 A;  4L63 B;  1N36 L;  4BY7 G;  3UDI A;  1VQP A;  2ATW A;  1G51 A;  4ZK9 B;  1QE6 A;  2BCO A;  2JA5 H;  3TP8 A;  4ODG A;  2SNS A;  3NTK A;  2VL6 A;  2Z9H A;  1WD0 A;  3VR5 A;  4IFD H;  1BBU A;  1EFW A;  4DR6 L;  2K04 A;  2D5D A;  3FMC A;  4R4T A;  2QGQ A;  5AJ3 Q;  1I50 H;  3T1Y L;  3KDF B;  2EIF A;  3T13 A;  4GLV B;  3NTI A;  1T5E A;  4GKJ L;  2MGS A;  2K1B A;  3CF5 A;  4XT3 B;  5JPM C;  4GNX A;  4NP5 A;  2XGT A;  4JI3 Q;  1CZW A;  5D3I B;  3V05 A;  2ZTE A;  1YIT A;  3ZYY X;  1HR0 L;  1TY0 A;  4A3I H;  4U67 3;  4DR1 L;  4DV1 L;  1SE2 A;  3SE0 A;  2RDH A;  3E5S A;  4OWT B;  4QF4 A;  1A0I A;  5T1I A;  2EXD A;  1SDF A;  4DKA C;  1TWF H;  2HCC A;  2Z6K C;  3ER0 A;  4DNR B;  2K01 A;  4ZKB B;  1K3B C;  3DEP A;  4HCS A;  4JBJ A;  1AP0 A;  3DLL A;  1LTI D;  3KDF A;  4DUY Q;  3VYR A;  3A55 A;  5C4J B;  1YEZ A;  4FXK C;  1N9W A;  3IAY A;  3K5N A;  5CV8 A;  1Q86 C;  4R4Q A;  4YIJ A;  3NPP A;  4JI7 Q;  1VQL A;  3EN2 A;  3D6W A;  1CSQ A;  2RCF A;  1C8C A;  1PFS A;  1HNX Q;  1ET6 A;  4NXN Q;  3RZD B;  1HA5 A;  5KEE A;  1STB A;  4F87 A;  4A3D G;  1BUV T;  3PO3 G;  4V19 0;  3GTL H;  3FPU B;  2O2L D;  4BBS G;  1A15 A;  2KED A;  3S14 H;  5C3W A;  3X3N A;  4JCV E;  1IW7 C;  3GDE A;  1ZYR D;  1X3E A;  5IGE A;  5IY0 A;  1XNQ Q;  2EY5 A;  2SEB D;  1EEF D;  3RZO B;  5JPN C;  2HHH L;  5M3M G;  2NVX H;  4MTN A;  5FK9 C;  1D7Q A;  2Q2U A;  1DOK A;  3MC0 B;  4PMW A;  3R2T A;  5CBE E;  4DR2 L;  5M5X B;  1V1P A;  4JG2 A;  3QIA A;  4AQY Q;  4A93 B;  2WB1 E;  4JC0 A;  4GN4 B;  5C0X J;  1TWA B;  3MWY W;  2N78 A;  3GTJ B;  5ELN A;  1QWY A;  2Z0S A;  4X62 L;  1F2M A;  1BCP F;  4YWM A;  2PW5 A;  5IP7 G;  2VZA A;  2IW3 A;  2Z8L A;  1HA6 A;  4R8N A;  1ZEQ X;  2CFM A;  3FP9 A;  4A3F G;  2KHS A;  2JEA I;  2QEX A;  1GHJ A;  2B29 A;  1SSO A;  1LTB D;  5IWA Q;  3RUZ A;  3Q23 A;  3HEJ A;  2PO4 A;  4DR7 L;  1HQR D;  3GTQ B;  4F7X A;  1PFN A;  4J15 A;  3NEL A;  5C5M A;  2F0U A;  2BE5 D;  3S16 B;  2Q2I A;  2VB2 X;  3N6R A;  1I6V C;  1RL2 A;  4HIO A;  4L5S A;  4DK6 C;  1B2T A;  1EY9 A;  1GUN A;  1RF2 D;  3KF6 A;  3HOY H;  1S5C D;  3D31 A;  1EFI D;  1WTH A;  5GAE C;  1HCZ A;  4KMU C;  2E5L L;  1ASY A;  2F0K A;  2GN5 A;  1VQE A;  5COY A;  4CKB A;  1DD2 A;  3BJU A;  4BXX H;  4DV6 L;  3K58 A;  3AU7 A;  2PNR C;  3QB3 A;  1M90 C;  3F1Z A;  1PV4 A;  3NUC A;  1PZK D;  2K50 A;  4O0A A;  2JA6 G;  1PXU A;  4KLK A;  1JJG A;  1XNR L;  2FMM A;  2OTL A;  1IBM L;  1MIU A;  4C3H B;  4EQP A;  4X3K A;  1A3V A;  3PUZ A;  2A69 D;  1TXY A;  1IBK L;  3BZC A;  3KJP A;  3PQI A;  2LY7 A;  4OO1 G;  1J5E Q;  1JOR A;  1YVC A;  2XRQ D;  1KDB A;  2QDL A;  4A3E B;  2UUA Q;  1LT5 D;  5E4X A;  3ND8 A;  3OTO L;  5CV9 A;  1PH1 A;  3TP5 A;  1CSP A;  2OQ0 A;  1EIG A;  1K3R A;  5EKI A;  3GTM B;  3NSW A;  5IYC G;  4MZ9 A;  1EY7 A;  1V9P A;  4DR3 L;  2EQS A;  4ILW A;  2F0J A;  3GV6 A;  3CC2 A;  1EYG A;  3KF8 B;  4IUT A;  2A5H A;  4A3G B;  1U4L A;  3NP8 A;  1UUP A;  4IJL A;  4X3S A;  1PVO A;  4UP7 A;  2J4X A;  4YCW A;  4KD4 A;  4HED A;  3I4N B;  2R7Z G;  3A7L A;  4A93 H;  5I9P A;  2K5N A;  4DV7 L;  4MTK A;  2QW7 A;  1V8Q A;  1NR4 A;  4PZ6 A;  2I0Q A;  3UDX A;  1QNK A;  4I7Z C;  5G3L F;  3GTJ H;  2PCF B;  4OEL B;  4LK1 C;  4UHV A;  1MKH A;  3UE1 A;  2JXM B;  5BR8 L;  1CHP D;  1ONL A;  3CMA A;  4AYB B;  4IFD J;  5HGQ A;  4A3J H;  1C7Y A;  1H9S B;  5D65 A;  1GXD C;  2EY2 A;  1HZC A;  5EBD A;  3KF8 A;  4DV3 L;  2B2Y A;  4UY8 C;  4BY7 B;  2GA4 B;  1OXX K;  1FJG L;  5LMU L;  1DM0 B;  2JP1 A;  3H0G H;  3CCJ A;  2A6H C;  3FHW A;  2ES2 A;  2BOS A;  1JB3 A;  5L37 A;  3SK8 A;  2XNA C;  4LUO A;  2EZV A;  1A8V A;  4R4I A;  4X3T A;  3JAM c;  1F2Z A;  4OO1 I;  3I4M B;  3K0Y A;  2VB3 X;  3EIV A;  1KC8 C;  1KAW A;  3MEH A;  5FLM G;  4YWL A;  3D4D A;  1PFM A;  1H9S A;  2NZ1 D;  3IFD A;  2EYP A;  3MFG A;  3L9A X;  1Q46 A;  1QG7 A;  3A8K E;  4UP8 A;  4NPS A;  1N32 L;  3BZK A;  1SYC A;  5C3X A;  3A8I E;  1A3T A;  2NVY H;  4A4I A;  2FMC A;  1SNO A;  1N33 L;  1SJE D;  3ULL A;  2VS1 A;  1V1Q A;  3D6C A;  4A76 A;  2P5Z X;  1LTG D;  1SJH D;  3PUY A;  1TS3 A;  4FP5 D;  1KAA A;  5I2X A;  5M3F H;  3OWE B;  1M8A A;  3K7A B;  4C2M B;  1VF5 C;  1S5D D;  1IBL L;  4FNF A;  1IYU A;  1IHZ A;  5JJK A;  1W2B A;  3VR4 A;  3GTP B;  1PZI D;  4DPG A;  4IUP A;  1OO9 B;  1EU4 A;  2DY8 A;  1PH4 A;  4OL7 A;  2K5D A;  2CQO A;  4CJ1 B;  4P71 A;  4B3T L;  1XWE A;  4O1N A;  4DNI A;  3KBX A;  4BBR H;  1LT6 D;  1JOQ A;  2A19 A;  5LMN Q;  1VQJ A;  2WAQ B;  4ULL A;  2DJG C;  4IUV A;  3GTM H;  5C4X B;  4DR5 Q;  2G5D A;  4CDC C;  4CKE A;  2F4V Q;  3A56 A;  4LF5 L;  1RD9 D;  4Q0F A;  1OXU A;  1V43 A;  5BN4 A;  1FR3 A;  3MFY A;  5IGC A;  1NCV A;  2A73 B;  4IQZ A;  4FYD A;  1EYC A;  2WP8 J;  4L6T B;  1B44 D;  2OT2 A;  1G8Z D;  3TN2 A;  1PTO H;  3S1R H;  2EY1 A;  2KOL A;  5ELE A;  5M3M B;  1GUT A;  1EU3 A;  3SHL A;  1EOT A;  2AQ1 B;  4JOI A;  4N9T A;  3SGI A;  1S5E D;  4QB4 A;  4HN7 A;  4RA8 A;  2F3W A;  5E7N A;  5FJ8 H;  3OYY A;  5J39 A;  1VDZ A;  3A5U A;  4CBV A;  5M5Y H;  1LAB A;  1JWU D;  1PRT C;  3TZU A;  2K05 A;  2ENB A;  1RJT A;  5AFW A;  4HAE A;  1E7Z A;  2KCN A;  4ZUJ A;  3AEV A;  3UDF A;  1VCI A;  1HFG A;  4WJW A;  4C3I B;  3ITP A;  3UE0 A;  2A74 C;  3AYH B;  3NEN A;  1KDC A;  1RIP A;  3OPO A;  4K14 A;  3OW2 A;  4BY7 H;  4LMQ D;  5JVG 3;  2ZJR A;  2E76 C;  2F0I A;  3LGJ A;  3RN2 A;  3NBH A;  5IGD A;  2DY7 A;  3Q24 A;  2CCZ A;  2F0D A;  4MHE A;  4A3F B;  1YNN D;  1CFM A;  1HNZ Q;  2IX1 A;  1Q81 C;  2B2W C;  3W5O A;  2D0O A;  1J9O A;  1M1K C;  1X56 A;  3BS1 A;  3MXG A;  3BVZ A;  5K36 G;  4PMC A;  1QZG A;  4JI7 L;  1UE6 A;  4RGO S;  1TWC B;  2K5H A;  1SNP A;  2NTT A;  4PV1 C;  4JI0 Q;  4DXG A;  4BY1 B;  4X3U A;  5CBA E;  3E6Z X;  4KK7 A;  1NBW A;  2E2I B;  1XMQ Q;  4CGY B;  1E0B A;  4UP9 A;  1U4M A;  3TP7 A;  2EYM A;  2BH2 A;  1D1I A;  1L1O B;  1KLG D;  1CHQ D;  1X3Q A;  4IJH A;  1B3A A;  3S17 H;  4JYA Q;  1UE5 A;  3HOZ B;  2DJF C;  1G29 1;  3J7A V;  1KHI A;  2ZM6 Q;  1CI3 M;  1K0S A;  4DAV A;  3I91 A;  1CK1 A;  1JR0 D;  2A6E C;  2JA6 B;  3E0E A;  4BS9 A;  3S15 B;  3F2C A;  4G7O C;  4KI0 A;  1KQS A;  4XQQ A;  1WCM G;  5DLQ E;  4AQY L;  1U4R A;  4YHH L;  4KY7 A;  1K8G A;  3EVQ A;  2AUJ D;  2MJ8 A;  3CHB D;  5CR3 A;  4IPC A;  1PYS B;  2NWG A;  4YY3 Q;  3ERS X;  3KLR A;  1VQ4 A;  1W6K A;  1SYB A;  3FPP A;  1ZKO A;  2ZTC A;  4JI4 Q;  4A3D H;  2K4K A;  3PO3 H;  1L1O A;  2R3Z A;  4BBS H;  4R4O A;  4LFC Q;  4IN3 A;  1E2W A;  4UAI A;  4L5T A;  3CRL C;  5COR A;  1JJC B;  3BVG A;  2L9H A;  2UU9 Q;  1HHV A;  4LF4 L;  1CA6 A;  1YBY A;  5IP9 H;  3K5O A;  5M3M H;  4CKC A;  1DXM A;  1DCZ A;  2RDG A;  1K83 B;  3T1H L;  5IWA L;  2UXC Q;  3D4R A;  5A2Q L;  4JW0 A;  1GUS A;  3EBE A;  2WB1 B;  3DMU A;  4CDD C;  4PZ7 A;  1FNV A;  4JI1 Q;  3AFQ A;  4HIM A;  4EGV A;  4TVA B;  2R92 B;  2JA9 A;  3K7U C;  2L11 A;  2LFN A;  4C3H G;  2JSO A;  2YYZ A;  2EJF C;  1O7Z A;  1U5K A;  2L1B A;  2XN9 C;  4JI2 Q;  4DF7 A;  5IP7 H;  3H3V I;  1Q8I A;  4HJ5 A;  4POF A;  3Q0A A;  3J7A 5;  5ISR A;  2F52 A;  4RH6 A;  4KJO A;  2UUC L;  3S2H B;  3J81 j;  4A3E G;  1H9R A;  1LT4 D;  2FIN B;  1UEA B;  3ERO A;  1BOS A;  4A3F H;  2YTX A;  3RN5 A;  3E9I A;  2VQF L;  1VF7 A;  1BBW A;  1IKL A;  2NVQ B;  3VR3 A;  2B2W A;  5C44 B;  2NVT B;  1VQ5 A;  2VQE Q;  4B3R Q;  1BVS A;  3M3Y B;  1J5E L;  1SNM A;  4A3G G;  2PQE A;  5FO9 B;  4CJ2 C;  4KKS A;  4LJZ C;  3WWV A;  3OW7 A;  1LTR D;  3N52 A;  5IGF A;  1HR0 W;  3I4N G;  2CW0 C;  1PMR A;  4Y7N H;  4LFB L;  2GVB A;  2EYF A;  1CM9 A;  1PZJ D;  1PHJ A;  1G6P A;  2E2J H;  4ALP A;  3HKZ G;  3R8B A;  1FVI A;  1TWG H;  2PMZ B;  3B6Y A;  3I2Z A;  2CH4 A;  2F0O A;  2KBN A;  3GTK H;  1I6H H;  1SE4 A;  2HIX A;  2QDB A;  3AB9 A;  1Y8O B;  2HDL A;  2JA6 H;  1X6O A;  2YU9 H;  1UWV A;  2V4D A;  4AYB G;  4A3K G;  4YWK A;  3TP6 A;  1TY2 A;  1TVX A;  3A74 A;  5IYD G;  1GOZ A;  2RA4 A;  3LX0 A;  1NMF A;  2KHJ A;  4JBM A;  4OO1 H;  4WFN 3;  1F9S A;  1GM5 A;  1VQ8 A;  1VQH A;  5LMN W;  3MHB A;  3V96 A;  4WJ4 A;  4KV6 A;  4KD3 A;  2AUK A;  2RVL A;  5IYB G;  5IYC H;  4H44 C;  4DA2 A;  4JV5 Q;  2WIN B;  3MA2 B;  4IUU A;  3I4M G;  3DUZ A;  4P72 A;  5EPK A;  3KLS A;  4NXM Q;  1JMC A;  1YHB A;  4GN3 B;  1TII D;  1YHA A;  2X6L A;  1J6Q A;  1IZ6 A;  1IW7 D;  1B8A A;  1BCP C;  4X66 L;  2VY3 A;  1NE3 A;  3TBI B;  3OMC A;  2R7Z H;  4DR4 L;  5I6W A;  1N34 L;  4DU9 A;  3M4O H;  4A3C G;  1SBB B;  5KYI A;  4DV0 L;  2ZXO A;  3WOE A;  2UUB L;  1D6E C;  3FVQ A;  4DXF A;  1RDP D;  3L0O A;  4K8I A;  1PH3 A;  1KL9 A;  4H13 C;  4JI5 Q;  3I7F A;  3PMF A;  1VQF A;  3PUV A;  4OIK A;  4OGQ C;  1STH A;  3KYH C;  5JOB A;  2KHI A;  1HRJ A;  4A3B B;  2JJQ A;  1SFO B;  3RLO A;  3C2P A;  2Q8T A;  2TSS A;  2BDO A;  5CYU A;  4K5W A;  1V1P B;  2MP1 A;  2F0V A;  1A3U A;  1X55 A;  2WAQ G;  2BA1 A;  1OXT A;  2JYO A;  3I70 A;  4LF8 Q;  1A63 A;  5C4X G;  5D14 A;  3NEM A;  2IT1 A;  2PW7 A;  1AEX A;  1TKW B;  2CWP A;  4LUZ A;  1Y1V B;  5CV7 A;  2WAC A;  3M4Y A;  2F3V A;  4CJ0 B;  1JT8 A;  2AQ3 B;  4EQ5 A;  4LF7 Q;  4GKK L;  5FLM H;  3PIO A;  3SK4 A;  1M4V A;  1Z47 A;  2B2V C;  1JWS D;  3QG1 A;  3CQZ B;  4K5X A;  4LF9 Q;  1PTO D;  2X69 A;  3NHH A;  1RHP A;  3ULP A;  1NSN S;  2QCP X;  4HSP A;  1B9N A;  4A3M B;  1IYJ B;  4JI8 Q;  4KHP Q;  1EYA A;  1WTW A;  1B3Q A;  1STN A;  4C3I G;  1X32 A;  3KLS X;  1B9M A;  3KLW A;  5GAD C;  4DV4 L;  1UE1 A;  3KF6 B;  3D0F A;  1SYE A;  2F4I A;  1E2Z A;  2DNE A;  1SND A;  2VW9 A;  5TSS A;  4P2C B;  3S2D B;  1X9N A;  2HT1 A;  1HNW L;  1WCM B;  1IXR A;  1FL0 A;  4FXG C;  1AZP A;  1SE8 A;  2JEB I;  5A35 A;  4B3M Q;  4KTA A;  4HMI A;  1EL0 A;  4F88 A;  3MXU A;  1O78 A;  4HSV A;  1Y1W B;  2VUM G;  1D2B A;  1W3S A;  3W1B A;  4FXD A;  3OIQ A;  4LFA L;  2ZT9 C;  1K28 A;  3HP3 A;  2EPB A;  1HFN A;  4ZKC B;  1PTO C;  3PIP A;  1B70 B;  3URY A;  2CVR A;  4BY1 G;  2C35 B;  3GD7 A;  2I46 A;  1EY4 A;  2N55 A;  4ABN A;  1YNJ C;  2HDM A;  4N8F A;  3QWN A;  4I7A A;  2E74 C;  2B8G A;  3K5L A;  2JA7 B;  3T56 B;  4UDU C;  3HOZ G;  1VQ7 A;  1QB5 D;  4B3S L;  1HXY D;  4P73 A;  2A8V A;  5JEA G;  4G4K A;  4DUZ Q;  1CTM A;  1A62 A;  2K03 A;  2L0C A;  2PI2 E;  3HOX B;  2Z6K A;  3WDN A;  1MJE A;  3M9B A;  4OX9 Q;  1IL8 A;  1RTN A;  2JA8 B;  1SMX A;  3TRE A;  5C4J H;  3JC6 6;  3QOL A;  5A2Q E;  4HTH A;  1PA6 A;  2RKS A;  1EY8 A;  2DNC A;  1X54 A;  1XMO Q;  2AQ2 B;  3W2D A;  4EX5 A;  4YCU A;  4B9W A;  1ICW A;  1I4R A;  1STY A;  3RZD H;  2MUY A;  5IT9 c;  1L0W A;  1VQA A;  2WKD A;  2HD3 A;  1I94 Q;  3NTH A;  2MPM A;  4ZAI A;  5FLX L;  2A6H D;  1T9H A;  4DV2 L;  1A6X A;  2K33 A;  2IWH A;  5KGU A;  5K36 H;  2LKV A;  4NKL A;  2UXD L;  3J7Y W;  2F0L A;  1Q7Y C;  1PH5 A;  1FD7 D;  3RZO H;  1EY6 A;  4LUV A;  1EWI A;  1KLU D;  2K75 A;  3CCQ A;  2H1E A;  5JEA J;  2CWA A;  1PH7 A;  2IHE A;  3T4A C;  4EVO A;  3G6E A;  3H3V H;  2WB1 G;  5M5X H;  4WRD A;  1VQC A;  3KUP A;  2R92 G;  2N3S A;  2UXB Q;  3U4Z A;  3HKZ B;  1TWA H;  1BR9 A;  2SOB A;  1HQM C;  5ELB A;  3IRB A;  4R8I A;  3FKI B;  3BU2 A;  1E2V A;  2CKZ B;  2X6G A;  5K5P A;  1TS5 A;  2K6A A;  1X3G A;  4X65 Q;  4A3K B;  1N36 Q;  4IUR A;  4N9P A;  3ULJ A;  1WCM H;  2F0G A;  5IIF A;  3PUW A;  4O2D A;  4FF2 A;  4JI6 L;  3DM3 A;  5EQ0 A;  3W1G A;  3TRZ A;  2F0N A;  2IJ0 A;  1Q8K A;  3CCV A;  2KQ3 A;  3A0J A;  1PLF A;  4J1M A;  2B2U C;  2B8F A;  1HTL D;  1QOH A;  2HQL A;  4DR6 Q;  1Z7T A;  2RHS B;  4L5R C;  2HIV A;  4IPH A;  4RCN A;  4QMG A;  5C44 G;  2RHQ B;  3GTQ H;  2EXZ A;  1DJR D;  3T1Y Q;  3K6O A;  2VNU D;  1QCB D;  3S16 H;  4A75 A;  1I4X A;  2Y0S E;  1I4G A;  3VYS A;  1PH9 A;  2I5M X;  2XIW A;  2LXK A;  3STB D;  1QVC A;  1IYV A;  4RMF A;  2VXW A;  3ERQ A;  1HR0 Q;  3JAM L;  1LT3 D;  4M1U B;  4DV1 Q;  3I56 A;  4X64 L;  3TSS A;  3PF5 A;  1KRT A;  4B08 A;  5C3E B;  1Y69 U;  1G2T A;  1VMC A;  3R93 A;  4IOC A;  4ZLT F;  2NN6 G;  5KYL A;  1PRT D;  2F0M A;  4FF4 A;  1TT2 A;  4C3H H;  5EKL A;  5JJI A;  2BA0 A;  1YIJ A;  4FF3 A;  2B2T C;  3J80 L;  4DV5 L;  5EAY A;  1O80 A;  4KHZ A;  4A3E H;  1MBY A;  2LXJ A;  2AWN A;  2OQK A;  2EVB A;  3GP7 A;  2Z4I A;  3RNU A;  2O5I C;  4C3J B;  3E0J A;  1KD1 C;  1DOM A;  3GTG B;  4L5Q A;  3HOV G;  1EIH A;  2NZO A;  4GOP C;  1H9J A;  2OWO A;  3STB C;  1VQB A;  1STG A;  1EEI D;  4A3G H;  1T5X D;  2B63 B;  5LL6 S;  4AIM A;  2HHH Q;  3NBH B;  4WJ3 M;  1VS0 A;  3I4N H;  1JC7 A;  1SRO A;  1Z9F A;  2O5J C;  1JOK A;  5AJ3 L;  4DR2 Q;  3S1M B;  2BH8 A;  1DYQ A;  3QR8 A;  3GTO B;  4LF6 Q;  3CME A;  3BYT B;  2AMC B;  1I3Q B;  2F1M A;  2OEO A;  1K0R A;  2A68 D;  2CH4 W;  4JI3 L;  3TZD A;  1DOL A;  3CPW A;  3SEB A;  4A3K H;  3KBG A;  4PG3 A;  4X62 Q;  1AH9 A;  4HID A;  2D0P A;  1B53 A;  2GVA A;  3OMG A;  2XVS A;  3HOW B;  4A3B G;  5IYD H;  2A6E D;  2EYH A;  3CW2 C;  1C9O A;  1E24 A;  1S72 A;  4PMB A;  1L0Y B;  1LTS D;  1VQO A;  1Y8N B;  2NN6 I;  3KFU A;  1SLJ A;  1VQG A;  5D3D A;  1CKM A;  3HRZ C;  1VQN A;  2F0S A;  4XIG S;  5CMD A;  5KNB A;  2VUM B;  3ZJY C;  5IYB H;  2K5V A;  2ZTD A;  3M4P A;  5JVH 3;  4JI5 L;  5M9O A;  1Y1V G;  4DUY L;  1WD1 A;  1TR5 A;  4DR7 Q;  3I4M H;  4LW1 A;  4RCO A;  1ASZ A;  2PZW A;  1EQV A;  4KY5 A;  1BBX C;  1HNX L;  3BZD B;  3G48 A;  4FF1 A;  1EWH A;  1ENC A;  4NXN L;  3S1N B;  2Q8I B;  1R4Q B;  1PH6 A;  3DHQ A;  3K59 A;  2E2H B;  1XTC D;  4K0K Q;  5M5W B;  4DAY A;  1D8L A;  2F0F A;  1QUQ B;  2A68 C;  3SVM A;  2E5L Q;  1NR2 A;  1UAP A;  3HZX A;  1F77 A;  2MFI A;  5EPJ A;  3I55 A;  4A3C H;  2RSO A;  1KRS A;  1XNQ L;  4A3M G;  5IE8 A;  1JE5 A;  4DV6 Q;  2KCT A;  2XRS D;  3K7A H;  4C2M H;  4LNQ A;  2D62 A;  1WOC A;  4Q5V A;  4H0L C;  3GTP H;  1LTT D;  1NAP A;  1SXT A;  1YJN A;  2AHO B;  5CC4 A;  4H7B A;  1XNR Q;  1H95 A;  1IBM Q;  1F9Q A;  4JK1 C;  3UI2 A;  2XTI A;  2B2T A;  1TWH B;  4DK1 A;  1IBK Q;  3S9W A;  3M4Q A;  4QIW E;  4RHS A;  2R93 B;  2G9D A;  3HOU B;  1PRT B;  3OTO Q;  1Y1W G;  3PO2 B;  3U58 A;  2KUM A;  1QUQ A;  5C4X H;  4QQB X;  3T16 A;  1B50 A;  1YZ6 A;  4DR3 Q;  1TU2 B;  2QIL A;  2H4O A;  3AMU A;  1FYC A;  1LYL A;  3HG9 A;  1SN8 A;  4G7H C;  3CCE A;  1O7I A;  4IOA A;  2D9U A;  3P20 A;  1OTC A;  2MNA A;  1K73 C;  2E8G A;  4DFA A;  2OCE A;  5LHY 1;  4IPG A;  4K8J A;  5ELO A;  5HGT A;  2JA7 G;  5FLX E;  3LWE A;  1GO3 E;  1WTV A;  1I50 B;  1D5X C;  4FVM A;  2CW0 D;  4DV7 Q;  1JCK B;  1KNE A;  2EJG C;  1ILP A;  1CT1 D;  1EIY B;  1I3Q H;  4ID6 A;  3K8A A;  3G71 A;  3HOX G;  4GNX C;  3TS2 A;  1SYF A;  1E1T A;  3H15 A;  2Z6B A;  3NQI A;  3SR1 A;  4C3I H;  3X3M A;  2JA8 G;  1KXL A;  5BR8 Q;  2QEJ C;  1YNX A;  4A3I B;  3ONA B;  3BDL A;  4DV3 Q;  4IZ8 A;  1CQF A;  2M00 A;  2EE1 A;  2ZJQ A;  3CD6 A;  1FJG Q;  5LMU Q;  4OEM B;  2EY6 A;  4OIJ A;  4HJ8 A;  1KTK A;  3NWS A;  3KJO A;  1TWF B;  4JPB W;  1NMG A;  2FJ2 A;  2NBF A;  2VUM H;  2RSN A;  4QGU A;  4QL5 A;  1SNC A;  1P8L A;  3Q22 A;  3J81 L;  4JBK A;  1F2Y A;  2LS0 1;  1STE A;  3PGZ A;  2DGY A;  1BO0 A;  3HS0 C;  3VR6 A;  1D1K A;  4HCE A;  1EY5 A;  5J3B A;  1TWC H;  3FEW X;  2R7F A;  2UUA L;  3S1N H;  4BY1 H;  3V2T A;  2EOT A;  2E2I H;  5IOC A;  1TQO A;  1EUJ A;  3J7Z C;  4XYQ A;  1HZB A;  1N32 Q;  1HZ9 A;  3DM1 A;  1KIX A;  3GTL B;  2L15 A;  1WTQ A;  1SMY C;  3E9H A;  3U4V A;  5C4Z A;  1N33 Q;  3S14 B;  1BCP D;  3HOZ H;  1TS2 A;  4A3L G;  2LMC B;  2F0E A;  3H91 A;  3FKI G;  1JQY D;  5JEA H;  5KRU A;  2L12 A;  1WTX A;  5GAG C;  1IBL Q;  3S15 H;  2NVX B;  3KOJ A;  4K6L A;  1AZQ A;  3JAM E;  1L0X B;  2Z1C A;  3M7G A;  2XWB B;  1PH8 A;  1U0L A;  2UXB L;  4RGM A;  1X3P A;  3NE5 B;  4GZY C;  1I5F A;  4I65 A;  2PPB C;  1XJV A;  1EOV A;  2KVM A;  1LM0 A;  1X3F A;  3H94 A;  2N88 A;  2K28 A;  4XTC S;  2PNH A;  4RGT A;  1E22 A;  4QY7 A;  2PI2 A;  3J80 E;  3HOV B;  4LF5 Q;  4RHR A;  3DWA A;  3MVV A;  1BF4 A;  3MXP A;  2E75 C;  1HH2 P;  4C1N K;  1MGS A;  4IO9 A;  1I4Q A;  5I9O A;  5HY6 A;  1K83 H;  2I5H A;  3IL8 A;  1XPO A;  3H3V C;  4R9W A;  2CQA A;  1CKO A;  4KN4 C;  4C1N I;  5E3F A;  3GV3 A;  2R92 H;  3G4S A;  4RFB A;  5C3E G;  1LTA D;  3RLF A;  2EYL A;  2K5W A;  1E1O A;  1Q1B A;  4NMZ A;  3VA7 A;  1EYD A;  4P74 A;  2ZJP A;  4X6A H;  1HZA A;  2A1A A;  2OF1 A;  3HOY B;  3OSO A;  3MXN B;  1JE4 A;  5JJL A;  1AE3 A;  3S2H H;  5I2Y A;  2OXP A;  1WJJ A;  1PDQ A;  1S4Z A;  4OWW B;  1LUZ A;  3VDY A;  2KJX A;  4C3J G;  2DN8 A;  4UPA A;  3S24 A;  4CHT B;  2L55 A;  4R4C A;  4H02 A;  2NVQ H;  5GQO A;  5C44 H;  2F0H A;  2NVT H;  1EIF A;  2JN4 A;  1GKH A;  2JE6 I;  3GQB A;  1S5B D;  5C0X G;  3M3Y H;  3P1H A;  3M7N A;  2Y0S B;  2RCN A;  2B63 G;  1CQV A;  3M85 A;  3VA5 A;  2MO1 A;  1LAC A;  5LMN L;  1CUK A;  1SNQ A;  3OHX C;  2FHT A;  2NUC A;  2BDN A;  4BA1 I;  5ELF A;  3CAM A;  3MXN A;  5G3L D;  1A2T A;  4DR5 L;  4LAA A;  4L8J A;  2EYO A;  3K80 C;  4EQO A;  2F4V L;  1JWM D;  3BG3 A;  2M9V A;  2NTS A;  1R4P B;  1YNJ D;  4IUQ A;  5EGT A;  5IOD A;  5I6Y A;  5IP9 G;  2NN6 H;  2R7D A;  4ZYS A;  3VYT A;  4HMJ A;  3QO2 A;  1PFB A;  4MNO A;  5CGK A;  3ICE A;  3HOW G;  5IGG A;  4G57 A;  4GN5 A;  1B7Y B;  1BCP B;  2ZXR A;  4QJF A;  1WTO A;  2AKW B;  4LF6 L;  4YHH Q;  4RKB A;  3Q6S A;  2EJM A;  3L7Z C;  4NB3 A;  1I4H A;  1C0A A;  2IY5 B;  3I8Z A;  3TEH B;  4XQN A;  5DEH A;  2B2Y C;  4A3J B;  4PQX A;  3HOV H;  4DAP A;  3QJY A;  1JOO A;  1EQT A;  1EWC A;  1CA5 A;  4RGN A;  3Q8D A;  3PF4 A;  5E1F A;  2PYK A;  3H0G B;  2TMP A;  4LF4 Q;  5EJW A;  4QUC A;  5EPL A;  4O42 A;  3OWF A;  3CXC A;  3H6M A;  4WOR A;  1ZYR C;  1HNZ L;  3D4W A;  3QOJ A;  3T1H Q;  4TQU S;  1K9M C;  4TKO B;  5C0X I;  2WII B;  5DM7 3;  3EJI A;  4IPD A;  1K8A C;  4TRD A;  2FXQ A;  3DEO A;  1SEB D;  1LTL A;  4EQN A;  1NTG A;  2F0T A;  3NWT A;  4Y52 H;  1NJI C;  1DZ1 A;  5CV4 A;  1IKM A;  4JI0 L;  2B39 A;  4XT1 B;  4OWX B;  4CDF C;  1YI2 A;  5F2D A;  2F3I A;  1XMQ L;  3P75 A;  4K0K L;  4IAL A;  1TS4 A;  1QZH A;  2KCC A;  2ICE C;  4DGZ A;  2HCI A;  4A3B H;  4U68 A;  1SFO H;  1BDO A;  2NVY B;  4JYA L;  2RQX A;  2UUC Q;  4CDE C;  2QKI C;  1RTO A;  1VMP A;  2R93 G;  3FDT A;  3A54 A;  2PMZ E;  3BVM A;  2ZM6 L;  4HIK A;  3HOU G;  4QUF A;  1U4P A;  3PO2 G;  2I5L X;  1OXV A;  2Q2H A;  2VQF Q;  5M3F B;  4DAM A;  5J1Z A;  4DK3 C;  1VQI A;  1GUG A;  4FO2 A;  1Y1V H;  3EFX D;  5EBC A;  5FLX c;  1MI2 A;  3F8T A;  1ILQ A;  3HFZ B;  2IPK D;  2C5C A;  2JA5 G;  3C3L A;  4HJA A;  5IT9 L;  2YTV A;  2N8N A;  2MO0 A;  1LO5 D;  4PNY A;  4IFD G;  5KND A;  4YY3 L;  5DM6 3;  2E2D C;  3CQZ H;  4BBR B;  3C1F A;  1D5Z C;  4JI4 L;  3SXH A;  2B2V A;  2BE5 C;  3RD4 A;  3T51 B;  5J22 A;  5ELC A;  4LFB Q;  1IL2 A;  4LFC L;  3J81 E;  4OHJ A;  1RCV D;  5FOB B;  5HUR A;  4A3M H;  2UU9 L;  4RAU C;  1BQQ T;  4KY6 A;  4JOI C;  1PTO B;  2F0P A;  3NBI A;  3S1R B;  2UXC L;  4A3I G;  3F2D A;  3CRK C;  1PYB A;  2F0Q A;  3S2D H;  1VQD A;  5IGB A;  4RWS C;  4QIW B;  4JI1 L;  5M5Y B;  3VYU A;  3I72 A;  4F8M A;  1VQ6 A;  1PTO F;  2A69 C;  1C48 A;  1Y1W H;  1QJO A;  2RF4 A;  2J7Z A;  3CC7 A;  1JIC A;  3R2I A;  1GVP A;  2QF7 A;  3NXW A;  5T1G A;  1S40 A;  1QIL A;  1ZXT A;  1QVG A;  4JI2 L;  3P7J A;  1DGS A;  3OIP A;  1K8O A;  3MAQ A;  2FFK B;  1KAB A;  2R61 A;  4NDX A;  1LV9 A;  1YHQ A;  1STA A;  1G91 A;  1F9P A;  4GKJ Q;  3J7A F;  4BA2 I;  2WV6 D;  3G7L A;  1BNZ A;  1Q3L A;  4RKL A;  4QCL A;  4X66 Q;  4DN4 M;  2K32 A;  1F9R A;  3JAM i;  4DR1 Q;  2K7V A;  2JA7 H;  1CKN B;  2KEE A;  2VQE L;  4B3R L;  5JAV A;  4DR4 Q;  1N34 Q;  5ELD A;  4IFD I;  4DV0 Q;  2EDG A;  3HOX H;  1SAP A;  2UUB Q;  4ZCK A;  1ET9 A;  2C9O A;  1SRU A;  2JA8 H;  5JJZ A;  1H9K A;  1X65 A;  1Q12 A;  4J6H A;  4IUN A;  3KK7 A;  3F2B A;  1MJC A;  3J80 i;  3F2U A;  1MSG A;  1OXS C;  3MTS A;  3J80 c;  2PZT A;  3S17 B;  2G9H D;  4K5V A;  4HR7 B;  3G6J B;  3RMH A;  5LL6 X;  3T53 B;  3MEF A;  1CKN A;  2AWO A;  3K81 C;  1Y14 B;  3IKJ A;  3R3O A;  2Q8R E;  1SYD A;  1XX8 A;  2B3G A;  1CZG A;  2NYZ D;  4YCV A;  1NUC A;  3NQT A;  3PSI A;  1LLR D;  3AQQ A;  1O7L A;  1BXT A;  5CV5 A;  2XSC A;  5E4W C;  4ZQ3 A;  1H9M A;  4FDB A;  1F2L A;  1D5M C;  4GKK Q;  1ENF A;  3DXJ C;  3EA6 A;  1EY0 A;  3MZ5 A;  1L1O C;  4A3D B;  4JV5 L;  1HTP A;  3GO5 A;  3PO3 B;  2ICI A;  5NUC A;  2ZXP A;  3CCM A;  4GLX A;  2SNM A;  4K2L A;  4BBS B;  2YV5 A;  1ICF B;  4NXM L;  1K8M A;  3NK9 A;  4A3L H;  1GHK A;  2K5Q A;  3AFP A;  3FKI H;  3SK6 A;  1AN8 A;  1VQ9 A;  1MHW C;  1BKB A;  1GD7 A;  2N49 A;  3FRP B;  1JJ2 A;  2R6G A;  1EZ8 A;  2PQA B;  2H5X A;  1Q90 A;  1SE3 A;  2RBM A;  4DV4 Q;  3HOY G;  2IL8 A;  4G7Z C;  1J8I A;  1ENA A;  4M8A A;  2WKC A;  4DAY B;  1N8R C;  1SR3 A;  1HNW Q;  3K0X A;  4BXX G;  1GUW A;  1XTD A;  3BDO A;  3E3X A;  1NNX A;  1WTR A;  4K2K A;  5CV6 A;  1HUN A;  2B2U A;  2F0W A;  1WTP A;  4E6I A;  1JB7 A;  3LWU A;  4C56 C;  4MN3 A;  3CC4 A;  4LFA Q;  3I90 A;  3TDQ A;  5H1S E;  2Y0S G;  1U9R A;  4JVZ A;  4GS3 A;  1PH2 A;  2ASB A;  2IX3 A;  4XDX A;  2M2L A;  1HPC A;  2PQA A;  2MHV A;  5EKK A;  3RR5 A;  5KNC A;  4LF8 L;  5C6A A;  1E3P A;  4XXE A;  4ZUI A;  3SK5 A;  4TSS A;  3H09 A;  4GLA C;  3K57 A;  3HGB A;  5BN5 A;  3PUX A;  5C5L A;  1W6J A;  4OON A;  1II3 A;  2K52 A;  4DNT B;  1EZ6 A;  5C3E H;  4B3S Q;  1UNS A;  2ID0 A;  3I73 A;  1RKN A;  4LF7 L;  4GOP B;  3TME A;  1PYW D;  1Y8P B;  5FKA C;  1GJX A;  3WOF A;  3S1Q B;  3CCS A;  3D8G A;  4LF9 L;  1G2S A;  2WFW A;  3LNN A;  1S3O A;  3A8J E;  4LWC A;  1YJW A;  2I07 B;  3RLN A;  4B9X A;  1EQR A;  1MD2 D;  4Y7N B;  1AW7 A;  2IX0 A;  2KCM A;  4ME5 A;  2SDF A;  4A93 G;  1XXG A;  2F03 A;  1EQQ A;  2E2J B;  2JK8 A;  1TWG B;  3U50 C;  1I6H B;  4V0B A;  4JI8 L;  3GTK B;  4KHP L;  1R9T B;  3HKZ E;  4C3J H;  4PZ8 A;  4Z9C B;  2NZH A;  4BWG B;  3C46 A;  5FO7 B;  1DON A;  3GTG H;  1S5F D;  2YU9 B;  4R1J A;  4A3J G;  5FO8 B;  1XYI A;  1C4Q A;  1WYD A;  2ALY B;  4AYB E;  3HKS A;  3CCL A;  1SYG A;  4DV2 Q;  5C0X H;  2JQO A;  4ME3 A;  1YNN C;  4GOP A;  3O13 A;  2UXD Q;  3H0G G;  2JA5 B;  2B63 H;  1HUM A;  1PRT F;  3D3R A;  3CKI B;  3I4L A;  3PIO 3;  4B3M L;  4P75 A;  1FNU A;  5C4H A;  3IFT A;  5BN3 A;  3CCU A;  3CU7 A;  4XYO A;  1ESF A;  2J0T D;  1Q82 C;  2IHF A;  3S1M H;  1P16 A;  4HJ7 A;  4DK0 A;  4OXP A;  2RDF A;  3U9S A;  3GTO H;  2CHB D;  1QNU A;  3OOC A;  1B4O A;  5IT9 E;  2Z4H A;  1Q1E A;  1WVL A;  3UDG A;  1SMY D;  4AH6 A;  1V1O A;  5DAU A;  3CCR A;  4KN7 C;  3PV0 A;  3A7A B;  3L3O C;  2K14 A;  3HOW H;  1FNW A;  4ZRZ A;  4RG1 A;  1L2F A;  2R7Z B;  3VR2 A;  1GUO A;  4JI6 Q;  4S3S A;  3M4O B;  3CPF A;  1NY4 A;  4DUZ L;  2PZU A;  1AFP A;  5M3F G;  3C1E A;  2Q2T A;  3A5Z B;  3U9O A;  3I3C A;  1KNA A;  4POG A;  2KEC A;  1FGU A;  1KDA A;  4OX9 L;  4N8X 1;  3BYY B;  2NB0 A;  5GRO A;  3J81 i;  1HJP A;  2L5T A;  1I4P A;  1UEB A;  3BDC A;  3J81 c;  1XMO L;  4K6D A;  3CP0 A;  2HQE A;  1XPU A;  2OTJ A;  2XWJ B;  2L4N A;  3PIP 3;  4KKT A;  3TS0 A;  4BBR G;  2KA7 A;  3EQL C;  3I4O A;  1WFQ A;  2LSS A;  2E2H H;  5DNF A;  1I94 L;  4APV A;  1WI5 A;  5KIX A;  5M5W H;  2EYJ A;  4NW2 A;  1VQK A;  2WAQ E;  2MQH A;  3K5M A;  4XQJ A;  4X64 Q;  1G6Z A;  1O7Y A;  4MIU A;  3SDZ A;  3DWQ A;  1UE7 A;  3TQY A;  1YJ9 A;  1ML0 D;  2HUG A;  4J8Q A;  1MSH A;  1Z6H A;  2V1C C;  3S1Q H;  1ROD A;  2KEN A;  5GAH C;  1XPR A;  1VQM A; 
#chains in the Genus database with same CATH homology
 4KJN A;  1A2U A;  1ESR A;  3W3A A;  1FGB D;  4KHV A;  4JBW A;  3DWP A;  1B1Z A;  4KKU A;  5I4D A;  2O4X A;  2D2C C;  3ND9 A;  4L63 B;  4ZK9 B;  1QE6 A;  2BCO A;  3TP8 A;  4ODG A;  2SNS A;  3NTK A;  1WD0 A;  3VR5 A;  4IFD H;  2K04 A;  2D5D A;  3FMC A;  3T13 A;  3NTI A;  1T5E A;  2MGS A;  2K1B A;  4XT3 B;  5JPM C;  4NP5 A;  1CZW A;  5D3I B;  3V05 A;  3ZYY X;  1TY0 A;  4U67 3;  1SE2 A;  3SE0 A;  2RDH A;  3E5S A;  4QF4 A;  5T1I A;  1SDF A;  2HCC A;  4DNR B;  2K01 A;  4ZKB B;  3DEP A;  1AP0 A;  4HCS A;  1LTI D;  3VYR A;  3A55 A;  5C4J B;  4FXK C;  3IAY A;  3K5N A;  5CV8 A;  4YIJ A;  3NPP A;  3D6W A;  1C8C A;  1ET6 A;  3RZD B;  1HA5 A;  5KEE A;  1STB A;  4F87 A;  1BUV T;  4V19 0;  3FPU B;  2O2L D;  1A15 A;  2KED A;  5C3W A;  3X3N A;  1IW7 C;  1ZYR D;  5IGE A;  2EY5 A;  2SEB D;  1EEF D;  3RZO B;  5JPN C;  5FK9 C;  1DOK A;  3MC0 B;  4PMW A;  3R2T A;  5CBE E;  5M5X B;  1V1P A;  3QIA A;  4A93 B;  5C0X J;  1TWA B;  3MWY W;  3GTJ B;  1QWY A;  1F2M A;  1BCP F;  2PW5 A;  2IW3 A;  2Z8L A;  1HA6 A;  4R8N A;  1ZEQ X;  2KHS A;  2JEA I;  1GHJ A;  1SSO A;  1LTB D;  3RUZ A;  3Q23 A;  3HEJ A;  2PO4 A;  1HQR D;  3GTQ B;  4F7X A;  1PFN A;  5C5M A;  2F0U A;  2BE5 D;  3S16 B;  2VB2 X;  3N6R A;  1I6V C;  1B2T A;  1EY9 A;  1GUN A;  1RF2 D;  1S5C D;  3D31 A;  1EFI D;  1HCZ A;  4KMU C;  2F0K A;  5COY A;  4CKB A;  1DD2 A;  3K58 A;  3AU7 A;  2PNR C;  3QB3 A;  3NUC A;  1PZK D;  1PXU A;  2FMM A;  4C3H B;  4EQP A;  4X3K A;  1A3V A;  3PUZ A;  2A69 D;  2LY7 A;  4OO1 G;  1JOR A;  2XRQ D;  1KDB A;  4A3E B;  1LT5 D;  5E4X A;  3ND8 A;  5CV9 A;  3TP5 A;  1EIG A;  5EKI A;  3GTM B;  3NSW A;  1EY7 A;  4ILW A;  2F0J A;  3GV6 A;  4IUT A;  2A5H A;  4A3G B;  1U4L A;  3NP8 A;  1UUP A;  4X3S A;  2J4X A;  4KD4 A;  4HED A;  3I4N B;  3A7L A;  5I9P A;  1V8Q A;  1NR4 A;  1QNK A;  4I7Z C;  5G3L F;  2PCF B;  4LK1 C;  2JXM B;  1CHP D;  1ONL A;  4AYB B;  4IFD J;  1H9S B;  5D65 A;  1GXD C;  2EY2 A;  5EBD A;  3KF8 A;  2B2Y A;  4BY7 B;  2GA4 B;  1OXX K;  1DM0 B;  2JP1 A;  2A6H C;  2BOS A;  1JB3 A;  3SK8 A;  2XNA C;  2EZV A;  4X3T A;  1F2Z A;  4OO1 I;  3I4M B;  3K0Y A;  2VB3 X;  3MEH A;  3D4D A;  1PFM A;  1H9S A;  2NZ1 D;  3IFD A;  2EYP A;  3MFG A;  3L9A X;  1QG7 A;  3A8K E;  1SYC A;  5C3X A;  3A8I E;  1A3T A;  2FMC A;  1SNO A;  1SJE D;  3D6C A;  1LTG D;  1SJH D;  3PUY A;  1TS3 A;  4FP5 D;  1KAA A;  5I2X A;  3OWE B;  1M8A A;  3K7A B;  4C2M B;  1VF5 C;  1S5D D;  4FNF A;  1IYU A;  1IHZ A;  3VR4 A;  3GTP B;  1PZI D;  4IUP A;  1OO9 B;  1EU4 A;  2DY8 A;  4OL7 A;  2K5D A;  4CJ1 B;  1XWE A;  4O1N A;  3KBX A;  1LT6 D;  1JOQ A;  2WAQ B;  4ULL A;  4IUV A;  5C4X B;  4CKE A;  3A56 A;  1RD9 D;  4Q0F A;  1OXU A;  1V43 A;  5BN4 A;  1FR3 A;  3MFY A;  5IGC A;  1NCV A;  2A73 B;  4IQZ A;  4FYD A;  1EYC A;  2WP8 J;  4L6T B;  1B44 D;  2OT2 A;  1G8Z D;  3TN2 A;  1PTO H;  2EY1 A;  2KOL A;  5ELE A;  5M3M B;  1GUT A;  1EU3 A;  3SHL A;  1EOT A;  2AQ1 B;  4N9T A;  1S5E D;  4QB4 A;  4HN7 A;  4RA8 A;  2F3W A;  5J39 A;  1VDZ A;  4CBV A;  1LAB A;  1JWU D;  1PRT C;  3TZU A;  2K05 A;  2ENB A;  1RJT A;  5AFW A;  4HAE A;  4ZUJ A;  2KCN A;  1VCI A;  1HFG A;  4WJW A;  4C3I B;  3ITP A;  2A74 C;  1KDC A;  3OPO A;  4K14 A;  4LMQ D;  5JVG 3;  2E76 C;  2F0I A;  3NBH A;  5IGD A;  2DY7 A;  3Q24 A;  2F0D A;  4MHE A;  4A3F B;  1YNN D;  1CFM A;  2IX1 A;  2B2W C;  1J9O A;  3BS1 A;  3MXG A;  3BVZ A;  5K36 G;  4PMC A;  4RGO S;  1TWC B;  1SNP A;  2NTT A;  4PV1 C;  4DXG A;  4BY1 B;  4X3U A;  5CBA E;  3E6Z X;  4KK7 A;  2E2I B;  4CGY B;  1E0B A;  1U4M A;  3TP7 A;  2EYM A;  1D1I A;  1KLG D;  1CHQ D;  1X3Q A;  1B3A A;  3HOZ B;  1G29 1;  3J7A V;  1CI3 M;  4DAV A;  3I91 A;  1CK1 A;  1JR0 D;  2A6E C;  2JA6 B;  4BS9 A;  3S15 B;  4G7O C;  4KI0 A;  4XQQ A;  1U4R A;  4KY7 A;  3EVQ A;  2AUJ D;  2MJ8 A;  3CHB D;  5CR3 A;  2NWG A;  3KLR A;  1W6K A;  1SYB A;  3FPP A;  1ZKO A;  2R3Z A;  4IN3 A;  1E2W A;  4UAI A;  3CRL C;  5COR A;  3BVG A;  2L9H A;  1HHV A;  1CA6 A;  3K5O A;  4CKC A;  1DXM A;  1DCZ A;  2RDG A;  1K83 B;  3D4R A;  5A2Q L;  1GUS A;  2WB1 B;  3DMU A;  1FNV A;  4EGV A;  2R92 B;  2L11 A;  2LFN A;  4C3H G;  2JSO A;  2YYZ A;  2EJF C;  1O7Z A;  2L1B A;  2XN9 C;  4DF7 A;  1Q8I A;  3Q0A A;  5ISR A;  4RH6 A;  4KJO A;  3S2H B;  1H9R A;  1LT4 D;  2FIN B;  1UEA B;  3ERO A;  1BOS A;  1VF7 A;  1IKL A;  2NVQ B;  3VR3 A;  2B2W A;  5C44 B;  2NVT B;  3M3Y B;  1SNM A;  2PQE A;  5FO9 B;  4CJ2 C;  4KKS A;  4LJZ C;  3OW7 A;  1LTR D;  3N52 A;  5IGF A;  2CW0 C;  1PMR A;  2EYF A;  1CM9 A;  1PZJ D;  3R8B A;  2PMZ B;  2F0O A;  1SE4 A;  2QDB A;  3AB9 A;  1Y8O B;  2HDL A;  2V4D A;  3TP6 A;  1TY2 A;  1TVX A;  1GOZ A;  2RA4 A;  3LX0 A;  4OO1 H;  4WFN 3;  1F9S A;  3MHB A;  3V96 A;  4KV6 A;  4KD3 A;  2AUK A;  2RVL A;  4H44 C;  4DA2 A;  2WIN B;  3MA2 B;  4IUU A;  3DUZ A;  5EPK A;  3KLS A;  1TII D;  2X6L A;  1IW7 D;  1BCP C;  3TBI B;  3OMC A;  5I6W A;  4DU9 A;  1SBB B;  5KYI A;  2ZXO A;  3WOE A;  1D6E C;  3FVQ A;  4DXF A;  1RDP D;  4K8I A;  4H13 C;  3PMF A;  3PUV A;  4OIK A;  4OGQ C;  1STH A;  5JOB A;  1HRJ A;  4A3B B;  1SFO B;  3C2P A;  2Q8T A;  2TSS A;  2BDO A;  5CYU A;  4K5W A;  1V1P B;  2MP1 A;  2F0V A;  1A3U A;  2BA1 A;  1OXT A;  2JYO A;  3I70 A;  5D14 A;  2IT1 A;  2PW7 A;  1AEX A;  1TKW B;  1Y1V B;  5CV7 A;  2WAC A;  3M4Y A;  2F3V A;  4CJ0 B;  2AQ3 B;  3SK4 A;  1M4V A;  1Z47 A;  2B2V C;  1JWS D;  3QG1 A;  3CQZ B;  4K5X A;  1PTO D;  2X69 A;  3NHH A;  1RHP A;  1NSN S;  2QCP X;  4HSP A;  1B9N A;  4A3M B;  1EYA A;  1WTW A;  1STN A;  4C3I G;  1X32 A;  3KLS X;  1B9M A;  1SYE A;  2F4I A;  1E2Z A;  2DNE A;  1SND A;  5TSS A;  4P2C B;  3S2D B;  1WCM B;  4FXG C;  1AZP A;  2JEB I;  5A35 A;  4KTA A;  4HMI A;  1EL0 A;  4F88 A;  3MXU A;  1O78 A;  4HSV A;  1Y1W B;  1D2B A;  4FXD A;  3OIQ A;  2ZT9 C;  3HP3 A;  2EPB A;  1HFN A;  4ZKC B;  1PTO C;  3URY A;  2CVR A;  3GD7 A;  2I46 A;  1EY4 A;  2N55 A;  4ABN A;  1YNJ C;  2HDM A;  3QWN A;  2E74 C;  2B8G A;  3K5L A;  2JA7 B;  3T56 B;  4UDU C;  1QB5 D;  1HXY D;  5JEA G;  4G4K A;  1CTM A;  2K03 A;  2L0C A;  3HOX B;  3WDN A;  1IL8 A;  1RTN A;  2JA8 B;  3QOL A;  5A2Q E;  4HTH A;  2RKS A;  1EY8 A;  2DNC A;  2AQ2 B;  3W2D A;  4B9W A;  1ICW A;  1I4R A;  1STY A;  2MUY A;  2WKD A;  3NTH A;  2MPM A;  4ZAI A;  5FLX L;  2A6H D;  1A6X A;  2K33 A;  2IWH A;  5KGU A;  5K36 H;  2LKV A;  4NKL A;  3J7Y W;  2F0L A;  1FD7 D;  1EY6 A;  1KLU D;  2H1E A;  5JEA J;  3T4A C;  4EVO A;  4WRD A;  3KUP A;  3HKZ B;  1BR9 A;  2SOB A;  1HQM C;  5ELB A;  4R8I A;  3FKI B;  1E2V A;  2X6G A;  5K5P A;  1TS5 A;  2K6A A;  4A3K B;  4IUR A;  4N9P A;  2F0G A;  5IIF A;  3PUW A;  4FF2 A;  5EQ0 A;  2F0N A;  2IJ0 A;  2KQ3 A;  1PLF A;  4J1M A;  2B2U C;  2B8F A;  1HTL D;  1QOH A;  1Z7T A;  4RCN A;  4QMG A;  2EXZ A;  1DJR D;  3K6O A;  2VNU D;  1QCB D;  1I4X A;  1I4G A;  3VYS A;  2XIW A;  1IYV A;  2VXW A;  3ERQ A;  3JAM L;  1LT3 D;  4M1U B;  3TSS A;  4B08 A;  5C3E B;  1Y69 U;  1G2T A;  1VMC A;  3R93 A;  4ZLT F;  2NN6 G;  5KYL A;  1PRT D;  2F0M A;  4FF4 A;  1TT2 A;  5EKL A;  2BA0 A;  4FF3 A;  2B2T C;  3J80 L;  1O80 A;  4KHZ A;  1MBY A;  2AWN A;  3GP7 A;  2EVB A;  2Z4I A;  2O5I C;  4C3J B;  3E0J A;  1DOM A;  3GTG B;  1EIH A;  1H9J A;  1STG A;  1EEI D;  1T5X D;  2B63 B;  5LL6 S;  1JC7 A;  2O5J C;  1JOK A;  3S1M B;  1DYQ A;  3GTO B;  3BYT B;  1I3Q B;  2F1M A;  2OEO A;  2A68 D;  3TZD A;  1DOL A;  3SEB A;  3KBG A;  1B53 A;  3OMG A;  2XVS A;  3HOW B;  2A6E D;  2EYH A;  4PMB A;  1L0Y B;  1LTS D;  1Y8N B;  2NN6 I;  5D3D A;  3HRZ C;  2F0S A;  4XIG S;  5CMD A;  5KNB A;  2VUM B;  5JVH 3;  1WD1 A;  5M9O A;  1TR5 A;  4RCO A;  2PZW A;  1EQV A;  4KY5 A;  1BBX C;  3BZD B;  4FF1 A;  1EWH A;  1ENC A;  3S1N B;  2Q8I B;  1R4Q B;  3DHQ A;  3K59 A;  2E2H B;  1XTC D;  5M5W B;  4DAY A;  2F0F A;  2A68 C;  3SVM A;  1NR2 A;  1UAP A;  3HZX A;  1F77 A;  5EPJ A;  2RSO A;  2XRS D;  2D62 A;  4Q5V A;  4H0L C;  1LTT D;  1NAP A;  1SXT A;  5CC4 A;  4H7B A;  1F9Q A;  4JK1 C;  3UI2 A;  2B2T A;  1TWH B;  4DK1 A;  3S9W A;  4RHS A;  2R93 B;  2G9D A;  3HOU B;  1PRT B;  3PO2 B;  2KUM A;  3T16 A;  1B50 A;  1TU2 B;  2QIL A;  2H4O A;  3AMU A;  1FYC A;  3HG9 A;  4G7H C;  2D9U A;  3P20 A;  4DFA A;  5LHY 1;  4K8J A;  5HGT A;  5FLX E;  3LWE A;  1WTV A;  1I50 B;  1D5X C;  2CW0 D;  4FVM A;  1JCK B;  1KNE A;  2EJG C;  1ILP A;  1CT1 D;  4ID6 A;  1SYF A;  3NQI A;  3SR1 A;  3X3M A;  2QEJ C;  4A3I B;  3ONA B;  3BDL A;  4IZ8 A;  1CQF A;  2M00 A;  2EE1 A;  2EY6 A;  4OIJ A;  1KTK A;  3NWS A;  1TWF B;  2FJ2 A;  2NBF A;  2RSN A;  1SNC A;  3Q22 A;  3J81 L;  1F2Y A;  2LS0 1;  1STE A;  1BO0 A;  3HS0 C;  3VR6 A;  1D1K A;  4HCE A;  1EY5 A;  3FEW X;  3V2T A;  2EOT A;  5IOC A;  1TQO A;  4XYQ A;  3DM1 A;  3GTL B;  1WTQ A;  1SMY C;  5C4Z A;  3S14 B;  1BCP D;  1TS2 A;  2LMC B;  2F0E A;  3H91 A;  1JQY D;  5JEA H;  5KRU A;  2L12 A;  1WTX A;  2NVX B;  4K6L A;  1AZQ A;  3JAM E;  1L0X B;  2Z1C A;  3M7G A;  2XWB B;  4RGM A;  1X3P A;  3NE5 B;  4GZY C;  4I65 A;  2PPB C;  2KVM A;  3H94 A;  2N88 A;  2K28 A;  4XTC S;  4RGT A;  3J80 E;  3HOV B;  4RHR A;  3DWA A;  3MVV A;  1BF4 A;  3MXP A;  2E75 C;  4C1N K;  1MGS A;  1I4Q A;  5I9O A;  3IL8 A;  3H3V C;  4R9W A;  2CQA A;  4KN4 C;  4C1N I;  5E3F A;  3GV3 A;  4RFB A;  1LTA D;  3RLF A;  2EYL A;  2K5W A;  1Q1B A;  4NMZ A;  3VA7 A;  1EYD A;  2OF1 A;  3HOY B;  3OSO A;  1JE4 A;  5I2Y A;  2OXP A;  1PDQ A;  1S4Z A;  2KJX A;  4C3J G;  2DN8 A;  4CHT B;  2L55 A;  2F0H A;  2JE6 I;  3GQB A;  1S5B D;  5C0X G;  3P1H A;  3M7N A;  2Y0S B;  1CQV A;  3M85 A;  3VA5 A;  1LAC A;  1SNQ A;  3OHX C;  2FHT A;  2NUC A;  2BDN A;  4BA1 I;  5ELF A;  3MXN A;  5G3L D;  1A2T A;  4LAA A;  4L8J A;  2EYO A;  4EQO A;  1JWM D;  3BG3 A;  2M9V A;  2NTS A;  1R4P B;  1YNJ D;  4IUQ A;  5EGT A;  5IOD A;  5I6Y A;  2NN6 H;  4ZYS A;  3VYT A;  4HMJ A;  3QO2 A;  1PFB A;  5CGK A;  5IGG A;  4G57 A;  1BCP B;  2ZXR A;  1WTO A;  4RKB A;  3Q6S A;  2EJM A;  3L7Z C;  1I4H A;  3I8Z A;  4XQN A;  5DEH A;  2B2Y C;  4A3J B;  4PQX A;  4DAP A;  3QJY A;  1JOO A;  1EQT A;  1EWC A;  1CA5 A;  4RGN A;  5E1F A;  2PYK A;  3H0G B;  2TMP A;  5EJW A;  4QUC A;  5EPL A;  4O42 A;  3OWF A;  3H6M A;  4WOR A;  1ZYR C;  3D4W A;  3QOJ A;  4TQU S;  4TKO B;  5C0X I;  2WII B;  5DM7 3;  3EJI A;  4TRD A;  3DEO A;  1SEB D;  4EQN A;  2F0T A;  3NWT A;  1DZ1 A;  5CV4 A;  1IKM A;  2B39 A;  4XT1 B;  5F2D A;  3P75 A;  4IAL A;  1TS4 A;  2KCC A;  2ICE C;  4DGZ A;  2HCI A;  4U68 A;  1BDO A;  2NVY B;  2RQX A;  2QKI C;  1RTO A;  1VMP A;  3FDT A;  3A54 A;  3BVM A;  4QUF A;  1U4P A;  1OXV A;  5M3F B;  5J1Z A;  1GUG A;  4FO2 A;  3EFX D;  5EBC A;  1MI2 A;  1ILQ A;  2IPK D;  2C5C A;  3C3L A;  5IT9 L;  1LO5 D;  4PNY A;  4IFD G;  5KND A;  5DM6 3;  2E2D C;  4BBR B;  3C1F A;  1D5Z C;  3SXH A;  2B2V A;  2BE5 C;  3RD4 A;  3T51 B;  5J22 A;  5ELC A;  3J81 E;  4OHJ A;  1RCV D;  5FOB B;  5HUR A;  4RAU C;  1BQQ T;  4KY6 A;  1PTO B;  2F0P A;  3NBI A;  3S1R B;  3CRK C;  2F0Q A;  5IGB A;  4RWS C;  4QIW B;  5M5Y B;  3VYU A;  3I72 A;  4F8M A;  1PTO F;  2A69 C;  1C48 A;  1QJO A;  2J7Z A;  1JIC A;  3R2I A;  2QF7 A;  5T1G A;  3NXW A;  1QIL A;  1ZXT A;  3P7J A;  1K8O A;  3OIP A;  3MAQ A;  2FFK B;  1KAB A;  2R61 A;  4NDX A;  1LV9 A;  1STA A;  1G91 A;  1F9P A;  3J7A F;  4BA2 I;  2WV6 D;  3G7L A;  1BNZ A;  1Q3L A;  4RKL A;  4QCL A;  4DN4 M;  2K32 A;  1F9R A;  2K7V A;  2KEE A;  5JAV A;  5ELD A;  4IFD I;  2EDG A;  1SAP A;  1ET9 A;  2C9O A;  5JJZ A;  1H9K A;  1Q12 A;  4J6H A;  4IUN A;  3KK7 A;  3F2U A;  1MSG A;  1OXS C;  3MTS A;  2PZT A;  3S17 B;  2G9H D;  4K5V A;  4HR7 B;  3G6J B;  3RMH A;  5LL6 X;  3T53 B;  2AWO A;  3IKJ A;  2Q8R E;  3R3O A;  1SYD A;  1XX8 A;  1CZG A;  2NYZ D;  1NUC A;  3NQT A;  1LLR D;  1O7L A;  1BXT A;  5CV5 A;  2XSC A;  5E4W C;  4ZQ3 A;  1H9M A;  1F2L A;  1D5M C;  1ENF A;  3DXJ C;  3EA6 A;  1EY0 A;  3MZ5 A;  4A3D B;  1HTP A;  3GO5 A;  3PO3 B;  2ICI A;  5NUC A;  2ZXP A;  2SNM A;  4K2L A;  4BBS B;  1K8M A;  3NK9 A;  1GHK A;  2K5Q A;  3SK6 A;  1AN8 A;  3FRP B;  2R6G A;  1EZ8 A;  1Q90 A;  1SE3 A;  2RBM A;  2IL8 A;  4G7Z C;  1J8I A;  1ENA A;  4M8A A;  2WKC A;  1GUW A;  3BDO A;  1WTR A;  4K2K A;  5CV6 A;  1HUN A;  2B2U A;  2F0W A;  1WTP A;  4E6I A;  3LWU A;  4C56 C;  4MN3 A;  3I90 A;  3TDQ A;  1U9R A;  2IX3 A;  4XDX A;  2M2L A;  1HPC A;  2MHV A;  5EKK A;  5KNC A;  5C6A A;  4XXE A;  4ZUI A;  3SK5 A;  4TSS A;  3H09 A;  3K57 A;  3HGB A;  5BN5 A;  3PUX A;  5C5L A;  1W6J A;  1II3 A;  4DNT B;  1EZ6 A;  1UNS A;  2ID0 A;  3I73 A;  1RKN A;  3TME A;  1PYW D;  1Y8P B;  5FKA C;  1GJX A;  3WOF A;  3S1Q B;  3D8G A;  1G2S A;  3LNN A;  3A8J E;  2I07 B;  4B9X A;  1MD2 D;  4Y7N B;  1AW7 A;  2IX0 A;  4ME5 A;  2SDF A;  1XXG A;  2F03 A;  2E2J B;  1TWG B;  1I6H B;  4V0B A;  3GTK B;  1R9T B;  4Z9C B;  4BWG B;  3C46 A;  5FO7 B;  1DON A;  1S5F D;  2YU9 B;  5FO8 B;  1XYI A;  1C4Q A;  1SYG A;  5C0X H;  1YNN C;  3O13 A;  2JA5 B;  1HUM A;  1PRT F;  3D3R A;  3CKI B;  3I4L A;  3PIO 3;  1FNU A;  5C4H A;  3IFT A;  5BN3 A;  3CU7 A;  4XYO A;  1ESF A;  2J0T D;  4DK0 A;  2RDF A;  3U9S A;  2CHB D;  1QNU A;  3OOC A;  1B4O A;  5IT9 E;  2Z4H A;  1Q1E A;  1WVL A;  1SMY D;  1V1O A;  5DAU A;  4KN7 C;  3PV0 A;  3A7A B;  3L3O C;  1FNW A;  4ZRZ A;  2R7Z B;  3VR2 A;  1GUO A;  4S3S A;  3M4O B;  2PZU A;  1AFP A;  3C1E A;  3U9O A;  3I3C A;  1KNA A;  2KEC A;  1KDA A;  3BYY B;  2NB0 A;  2L5T A;  1I4P A;  3BDC A;  4K6D A;  2HQE A;  2XWJ B;  2L4N A;  3PIP 3;  4KKT A;  2KA7 A;  3EQL C;  5DNF A;  5KIX A;  2EYJ A;  4NW2 A;  3K5M A;  4XQJ A;  1G6Z A;  1O7Y A;  4MIU A;  3SDZ A;  3DWQ A;  1ML0 D;  2HUG A;  4J8Q A;  1MSH A;  1Z6H A;  1ROD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...