2XIWA

Crystal structure of the sac7d-derived igg1-binder c3-c24s
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
VKVKFLLNGEEKEVDTSKIRDVSRQGKNVKFLYNDNGKYGAGNVDEKDAPKELLDMLARAEREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tolerance of the Archaeal Sac7D Scaffold Protein to Alternative Library Designs: Characterization of Anti-Immunoglobulin G Affitins.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein
molecule keywords DNA-BINDING PROTEIN 7D
total genus 15
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xiwA00
1ZXTA 5CBEE 4X3SA 1G6ZA 3HP3A 4HCSA 3H91A 1MI2A 1MGSA 3F2UA 1S4ZA 4HEDA 5T1IA 1F9SA 5E4WC 1B53A 1O7YA 1PFBA 2D9UA 3D6WA 4IURA 1XYIA 1BNZA 5EKIA 3I91A 5JJZA 2FMMA 2XIWA 3QO2A 1E0BA 3FDTA 4ZK9B 1J9OA 2B2UC 2KECA 2B2TC 1EIGA 1B3AA 2RSNA 1U4MA 1RODA 2M2LA 5AFWA 3DM1A 4IUVA 2K03A 1QE6A 4R9WA 5EPKA 1VMPA 1WTWA 1AZPA 4X3UA 1DOLA 2N88A 1HFGA 3KBXA 3TZDA 2MGSA 1WTVA 4UAIA 1A15A 2FINB 2MP1A 2DY8A 5EPLA 1HFNA 1X3PA 1BBXC 1O7ZA 2EPBA 4QUFA 1CA6A 3DEPA 4X3TA 2K28A 4IUPA 1Q3LA 2B2WA 4CJ1B 1AZQA 3I8ZA 1EIHA 2J7ZA 1JE4A 2NZ1D 4HAEA 3UI2A 4IUQA 1B4OA 4XT3B 2L9HA 2BDNA 5EPJA 2CVRA 4ZAIA 1AP0A 2KEEA 2X6LA 1NCVA 2B2WC 4OIKA 5CORA 3FPUB 2JYOA 1X32A 4IUTA 1WTQA 3SVMA 4R8IA 4XDXA 1XX8A 1TVXA 1GUWA 1X3QA 4U68A 1ICWA 1NR4A 1VMCA 4ZKBB 3LWEA 2L11A 1LV9A 2RA4A 3N52A 2NYZD 3GV6A 1DOMA 2K04A 3GV3A 1RTOA 2B2YC 5EJWA 2K05A 1WTOA 1WD1A 1PLFA 2VXWA 1ML0D 2R3ZA 4DN4M 1ESRA 1IKLA 2L4NA 1B50A 3MWYW 4ZLTF 2K01A 4MN3A 3IL8A 2Q8RE 3R93A 2B2YA 1ILQA 1HHVA 1WD0A 4LMQD 1F9PA 3I3CA 1WVLA 1WTXA 1KNEA 1IKMA 1PDQA 2NWGA 1WTPA 2FJ2A 1U4RA 2DY7A 2IL8A 3P7JA 1SDFA 4OIJA 2FHTA 1RHPA 5D14A 5CMDA 2H1EA 1CA5A 4RA8A 1PFNA 1EOTA 2EE1A 1BO0A 1QNKA 4RWSC 2HCIA 2HUGA 2K1BA 1NR2A 1HUMA 2MPMA 2FFKB 4MHEA 2B2VC 2SDFA 1SAPA 2KVMA 1PFMA 1NAPA 4HSVA 1HUNA 1EQTA 2HDLA 4ZKCB 2L12A 1IL8A 1RJTA 1F9QA 1QG7A 2X6GA 4CJ0B 1EL0A 4O42A 1KNAA 2JP1A 1DOKA 2RVLA 3G7LA 4CJ2C 1U4PA 1RTNA 2B2VA 1U4LA 2B2UA 1B2TA 1DZ1A 3ONAB 2B2TA 1F9RA 2KEDA 4IUUA 2RSOA 4QUCA 1G2TA 1MSGA 5T1GA 1ILPA 5E4XA 1G2SA 4X3KA 1JICA 2KOLA 4RAUC 2Q8TA 1DONA 1C8CA 1BF4A 3I90A 1J8IA 5DNFA 3DEOA 5CBAE 2X69A 2KUMA 2L1BA 3KUPA 2HCCA 1G91A 1HA6A 2HDMA 1F2LA 3Q6SA 5EQ0A 3TN2A 2N55A 1HRJA 5D65A 1O80A 1CM9A 1M8AA 1WTRA 1SSOA 2MJ8A 2EOTA 3MTSA 4XT1B 3IFDA 5COYA 4NW2A 1MSHA
chains in the Genus database with same CATH superfamily
5KYLA 4GKJQ 3TSSA 3S15B 1DXMA 3H91A 3NUCA 2VQFQ 4DV1L 2NB0A 1FJGQ 1F9SA 1LABA 2D9UA 1SE3A 3RN2A 4POGA 4L63B 2PO4A 3OMCA 3QR8A 2XIWA 1VQPA 2R6GA 4WJ4A 1PH9A 1Z7TA 4A3IH 1FGBD 5JEAG 1FNWA 1GUGA 2A6ED 1JMCA 2BOSA 2JEBI 4GZYC 2E5LL 2J4XA 3EROA 4Z9CB 4O2DA 1MHWC 2D0PA 5IGBA 3E6ZX 1VQOA 5IODA 2CW0C 2ENBA 2OF1A 2JA5G 4S3SA 4WRDA 1O7ZA 1EQRA 1K0RA 4NDXA 3OSOA 4PG3A 1I50H 2EVBA 2J7ZA 1XNRL 2VUMB 4LF4Q 1STNA 2AQ1B 3PUZA 4FP5D 1UE5A 4OIKA 5CORA 2H4OA 4RG1A 2JYOA 5CR3A 1XPUA 1TWAB 1TS4A 4NKLA 1GUWA 4U68A 4A3CH 4KJNA 1EY7A 1JWUD 3VYSA 3GV3A 4JC0A 2QEJC 2B39A 2MFIA 2RF4A 2WIIB 3PIP3 4IPGA 1VQNA 3IRBA 2CW0D 5LMUL 4F8MA 5D14A 1GM5A 1EOTA 1BOSA 1JB3A 1FNVA 1AE2A 4B08A 2MPMA 3DMUA 4UY8C 2R92H 2MO0A 4HSVA 1L0XB 3STBD 5IYCG 1IYVA 4JI2L 3H0GB 4CJ0B 1E22A 3EA6A 4A3FG 3GTGH 2A6HC 4JCVE 1UEBA 1ILPA 4CHTB 2UU9Q 5L37A 3C46A 1LTAD 2FMCA 5GQOA 1KXLA 2KJXA 3MEFA 1A3TA 4FYDA 5M5YB 3H09A 2WACA 3FEWX 3EVQA 4OO1H 1HTLD 4GN5A 1BNZA 5LMUQ 4KKTA 1RCVD 1FR3A 3HRZC 1EYCA 5CV4A 2HQLA 1VDZA 2DUDA 3DM1A 1ICFB 4N9PA 3HOVG 1E1OA 3VR5A 4B9XA 4H44C 2C5CA 3RR5A 1E2ZA 3GQBA 2K5QA 1HPCA 1YNJD 5I2YA 4ALPA 1F2MA 2E8GA 2FINB 2I0QA 1B9NA 1PRTC 1SMYD 1C0AA 4DNIA 4A3JH 2PQEA 3D0FA 3M4PA 3U4VA 3IAYA 3RN5A 2JA6G 4L5TA 4LF4L 2L9HA 1PA6A 2IHFA 2JEAI 1PYSB 2Z6KC 1OXTA 1WI5A 3PF5A 1TVXA 4KY5A 1IW7C 4KHZA 1RTOA 4JI6L 3I73A 2K50A 5M5WH 5IP9G 1SYEA 3R2IA 3GTPH 3MXGA 4UDUC 5I9OA 3I7FA 1KDAA 3OHXC 1G291 2IX1A 1WTPA 1EY5A 3D8GA 2DNCA 5EBDA 4A3GG 3E3XA 1CSQA 5C5LA 5M3MH 4DV2Q 5M3MB 3CMAA 3J7AV 4OO1G 1VQCA 4UHVA 1SE4A 3H0GG 1HR0W 1D7QA 3RLNA 3HOUG 5NUCA 4A3MH 4C3JB 4LNQA 1QILA 1U4PA 2PI2A 3AQQA 2CFMA 4CKEA 5GADC 2CWAA 3PSIA 2VUMH 4DV0Q 4B9WA 1EIFA 5IGEA 2R93B 1U0LA 4CKCA 2BE5C 1X55A 4GNXC 3PIO3 4BY1B 2AWOA 1TS5A 5CBAE 2UXCL 1X3GA 1IBMQ 3JC66 1UE1A 2F1MA 3TN2A 3S14B 2JA8G 2V1CC 1Y8OB 4FF3A 1QUQA 5COYA 4FF2A 3BYYB 4FF4A 1W2BA 3J7A5 3T56B 5IIFA 1B53A 1Y1WG 1V1PB 1GUSA 3RZDH 2QILA 2NZOA 2B2UC 3URYA 5M3FB 1EIGA 2NBFA 4LFAQ 1O7LA 1VQ7A 2PQAA 1WTWA 3KFUA 5C5MA 4A3DB 3HFZB 4H7BA 5EBCA 3TRZA 4AIMA 4A3MB 2NVTH 4IFDI 4E6IA 1PXUA 4DGZA 3ULLA 5C0XH 2MUYA 3RZOH 1W3SA 3QOJA 2IW3A 2BA0A 1YJWA 3OTOL 3DEPA 2K28A 4A93B 5C0XI 2BA1A 1QB5D 3H6MA 1BBUA 4Y52H 1CUKA 4DR5L 2BDNA 4BWGB 4R4QA 4DXFA 1D1KA 1NCVA 3MXNB 5C0XG 4DXGA 4DR3L 3MA2B 1WCMH 4R8IA 1T9HA 2G5DA 1AW7A 1VMCA 1WFQA 2K6AA 2RA4A 4BY1G 2K04A 4N8X1 4LF9Q 2R7ZH 3I4NB 2JA7B 3GP7A 1ZKOA 2ATWA 3CPWA 4V0BA 1AH9A 1X9NA 4CDFC 3K8AA 1G51A 2IL8A 3I55A 4IOCA 3FVQA 3U50C 1E7ZA 2RCFA 2EE1A 2YU9H 4JYAQ 3D6CA 1SNCA 2Y0SG 3M3YB 1NAPA 5JEAJ 1QCBD 2HDLA 4ZKCB 3S1NH 1IL8A 4A76A 2IX0A 2LKVA 1TWCH 1A8VA 2VZAA 3M4YA 2B2UA 2F0HA 2HQEA 3VYTA 1YJ9A 2WFWA 1YHBA 3JAMc 4JI5Q 3HOZG 4DR5Q 2I5HA 3X3NA 3HOUB 1OXUA 2KUMA 4FXGC 3T4AC 3EBEA 2HDMA 3Q6SA 2Z4IA 3VR6A 5M3MG 2UUCQ 4DR4L 3CD6A 1Y8PB 4XT1B 1Y1VH 5IWAL 1ZXTA 5ISRA 1G6ZA 1YNXA 5IYDG 3GDEA 1HNWQ 2CWPA 3KJOA 1T5EA 1NMGA 2R7FA 5CV6A 3ERSX 4A3LG 4A3IB 1J6QA 4EQ5A 1B3AA 3PO2G 4R9WA 4PZ6A 4ZQ3A 4BXXG 5EAYA 3NTIA 5IT9c 4DNRB 1YHQA 5FLXL 1LTID 2LXJA 2MP1A 3HGBA 2F4IA 3J81L 5ELNA 4GLXA 1MJCA 3A74A 5C3EG 4GN3B 4OONA 2VQEL 4B3TQ 3I4MB 4F88A 1K3BC 5AJ3Q 3UI2A 4RGMA 1SNQA 4L8JA 4ODGA 4B3SQ 2R93H 2WAQG 3F1ZA 1QNUA 1HNZL 3BZDB 5AJ3L 3PUWA 3B6YA 3DLLA 1GO3E 1X3QA 3KF8A 3VA5A 4OX9Q 1BKBA 2B8GA 3E5SA 1LV9A 3N52A 3GV6A 3JAMi 4HMJA 5HURA 4DUYL 3T1HQ 3OYYA 2EYPA 4DV6L 1A0IA 3NBIA 4ME5A 2B63G 1H95A 4MN3A 1ILQA 1K8AC 2QA4A 3R8BA 3J7ZC 3S2DB 1N36L 3A5UA 1KTKA 2DY7A 1EFWA 2XGTA 3ND9A 3KF6A 4N8FA 4ME3A 4Y7NB 2EY5A 3S1RB 3E0JA 2HCIA 1A2UA 3CQZB 3HZXA 2F0MA 3FKIH 4I7AA 3HOWB 2B2VC 3RMHA 1VQDA 2JA8H 3CU7A 1N32Q 2ZXRA 1XMQL 3K58A 1F9RA 1HQRD 4AYBG 1S5DD 1N32L 3T16A 4BS9A 3CRKC 1BXTA 1BF4A 3HOXB 1EOVA 2NN6G 2L0CA 4HIOA 4JG2A 4KMUC 3MEHA 4P2CB 3J7AF 2NVTB 1FD7D 2SOBA 1HA6A 1KAWA 2UUBQ 1HRJA 1C4QA 1KHIA 4ZUJA 3TS2A 4H13C 3F2UA 1XJVA 1L1OB 1O7YA 2F0OA 3OOCA 1UE7A 3KF8B 3PUVA 2QDBA 5IGGA 1QZHA 5G3LF 4JI1Q 2XSCA 1XNQL 5BR8Q 3GTJB 2F0PA 1TS3A 5GROA 2ZM6Q 3AFQA 1HXYD 1N9WA 1SRUA 1DOLA 4KKSA 3H15A 2JA8B 2ZJQA 2RBMA 1SNOA 5IP9H 3OWFA 1IBLQ 5JJLA 3LWUA 2A19A 3C2PA 1BUVT 4LUZA 5D3IB 3QG1A 4JI0L 5FLMG 4K8JA 3GTJH 4XYQA 3QIAA 2BH2A 4DUZL 4CBVA 4LUOA 4QMGA 1PH3A 2HT1A 4R4TA 3KLWA 4IUTA 1WTQA 1XX8A 4QY7A 1B9MA 3LWEA 3GTLH 2EY6A 4AQYQ 5ELDA 5BN4A 3S1NB 4C3IB 3K5NA 4DN4M 3F2CA 4BXXH 2XVSA 1HCZA 3EFXD 3G71A 2EZVA 3TMEA 2Q8RE 1YNNC 4DPGA 2EYJA 1E1TA 1PZID 4DNTB 4IJHA 2RHSB 1SDFA 3WWVA 1VQ4A 4RA8A 4R8NA 1AE3A 1R4PB 2UUAQ 3RZDB 2UXBL 1GXDC 1YZ6A 4TSSA 1E2VA 1E2WA 1E24A 2V4DA 5IY0A 3CCMA 3CC7A 2K4KA 2M9VA 1R4QB 4KI0A 2IY5B 1F9QA 3KK7A 1KNAA 1DOKA 3O13A 4OGQC 1BVSA 3NBHA 4ZUIA 1DYQA 2K5NA 4YY3L 5D3DA 1JOQA 1VQKA 4A3FH 4CKBA 2E74C 4YWKA 3TP8A 3NELA 5JVG3 4YY3Q 3I4LA 4B3TL 2YTVA 5J22A 1UEAB 5H1SE 3HKSA 4B3RQ 1TWHB 3Q24A 4JI4Q 4Y7NH 1C7YA 5C4JB 4HJ5A 2Q8IB 3W5OA 1VQHA 1K0SA 4DK1A 1YHAA 3HOVB 3QWNA 5I6YA 1V9PA 4JYAL 2OCEA 5M5YH 5CC4A 2LMCB 1U5KA 3CCVA 3RLFA 1Q86C 5JAVA 1XNQQ 3L0OA 5M5WB 1CT1D 3A7LA 3J81i 3L7ZC 5AFWA 4JW0A 5EPKA 2N49A 3M7GA 2NVYH 1EQVA 1YIJA 1K9MC 2NVXB 4DV1Q 2B63B 1H9RA 1AN8A 5F2DA 1B44D 3OWEB 4DR3Q 3DWQA 2UU9L 4A3CG 3I4NH 1WCMG 4X64L 3K6OA 3NEMA 2PQAB 2VQEQ 3VR3A 2EDGA 2R93G 1VQJA 2B2WC 2BCOA 4JBJA 1K28A 2LY7A 3A8JE 3PIPA 2WINB 4NPSA 2A1AA 2YU9B 4XQJA 3G4SA 3UDFA 2CQAA 2ZJPA 1TS2A 1AFPA 3TP7A 3KJPA 1EEID 1QVCA 1VQAA 5CV8A 1N34Q 5ELOA 1KNEA 5E1FA 2NWGA 2XWJB 1ET9A 4A3IG 1N8RC 4C1NI 2CCZA 4HJAA 5EGTA 1TWFB 4RKLA 2DJFC 5IYDH 1SFOB 2EYLA 3S2HB 1KLUD 2IT1A 5ELBA 2YV5A 2L12A 2UXCQ 4BY7H 1LO5D 1TWCB 1VQMA 4K14A 1KIXA 4GOPC 1G2TA 3PQIA 1EWCA 5E4XA 3S24A 3JAME 4DV4Q 1DONA 4KLKA 2LSSA 2CH4W 4QB4A 1BCPC 3NSWA 4KY6A 1FL0A 1LTSD 1LTGD 3DEOA 3SEBA 4GNXB 3BZCA 3FMCA 4PQXA 4JI2Q 4JV5Q 2ZXOA 1NSNS 1MSHA 2F0GA 3DWAA 4NMZA 3S14H 3CCJA 2NVQB 1WYDA 5LMNW 1OTCA 2PZUA 5KEEA 4BBRG 3QO2A 2VNUD 3FDTA 1EWIA 1EZ6A 3OIPA 1SFOH 3S2HH 3BU2A 1LT6D 5IWAQ 2WB1G 2Q2IA 2EYFA 3HOZB 2F0JA 1Y1VB 3K7UC 1TWGH 4R1JA 2DY8A 3OW2A 3C1FA 4RH6A 2RDGA 3HKZE 3RNUA 1KABA 1IBML 4QCLA 3GTOH 3I8ZA 1EIHA 2Z9HA 2A69C 3IFTA 2CVRA 1AP0A 4C3IG 2KEEA 4OEMB 5ELFA 4JI7Q 2G9HD 3CKIB 2CHBD 1MKHA 3RD4A 1PTOF 1X32A 2KENA 3DWPA 4A3BH 4XDXA 4A93G 1LM0A 1EYGA 1ICWA 3P75A 3VYUA 1P8LA 2QGQA 1K8GA 5LHY1 1IZ6A 1Y14B 1KD1C 2Z1CA 2L4NA 3K81C 5E7NA 5KNDA 4ZLTF 4IO9A 1O7IA 2P5ZX 5JJIA 3MFGA 3M4OH 3PMFA 2HIXA 1SJHD 4WJ3M 4LF6Q 1PZKD 2WB1E 1IKMA 2FJ2A 3HS0C 2GVBA 1YVCA 3K5MA 5C4HA 5M9OA 2L5TA 1Y1WB 1I4QA 3VDYA 2CH4A 3E0EA 1EU3A 5GAGC 3H3VC 2FFKB 1SBBB 3UE1A 1L1OC 2O2LD 3ZJYC 2F0UA 4CJ2C 1RTNA 1STAA 2E75C 3M3YH 2K32A 4X62L 4FDBA 2PZTA 2KEDA 1S5FD 3CC2A 5C6AA 5T1GA 3ULPA 4DV4L 5KNCA 1LT5D 1RD9D 1STEA 2PYKA 4G7ZC 5A2QE 5DNFA 1J8IA 2F0DA 4P74A 4RCOA 1I50B 3EN2A 4C3JG 5C44G 1XPRA 1EUJA 2SNSA 3Q0AA 4PMBA 3CCUA 1ZEQX 2BH8A 1GOZA 3ICEA 2RCNA 4X3SA 1JT8A 4EX5A 1I3QB 1B8AA 1XYIA 4K5XA 4K6LA 3CC4A 3I91A 4X6AH 4LF6L 2RQXA 2KCNA 3M7NA 4JI8Q 2BDOA 3KYHC 4GOPA 4DV5Q 3GTMH 1HNWL 1KAAA 1RODA 3HOWG 2AUJD 4ILWA 1DGSA 3PGZA 2F0TA 3KBXA 3STBC 2PMZE 4JI4L 4A3BG 1PH7A 3U9SA 2ZT9C 3GTQB 5I4DA 1R9TH 3L3OC 1TWGB 2NZ1D 4TQUS 2WAQE 4XT3B 1G6PA 3GD7A 3HOYB 2A6HD 1S3OA 4CGYB 1IBLL 1D5MC 4M1UB 3QB3A 4R4IA 2F0QA 4B3MQ 5IYBH 2F0NA 1LTBD 3R3OA 2K05A 4RGTA 2R61A 3PIOA 3SK4A 2HIVA 4V190 5JJKA 4IN3A 1D6EC 3R93A 1OXXK 4DAVA 1F9PA 1WTXA 4OXPA 1GHKA 1PDQA 5IGCA 3HOVH 3A8KE 4LFBQ 1VQGA 5IE8A 1EU4A 1PYWD 5CMDA 2EQSA 1CSPA 2K1BA 4JI6Q 1BCPB 1Z47A 1NR2A 2OQKA 5HGTA 4HMIA 1MD2D 2F3WA 4ZYSA 4RGOS 2A8VA 3CCLA 1Q46A 1B70B 2JN4A 1HH2P 3UDIA 1DZ1A 1A63A 4QUCA 3I56A 1G2SA 1I4HA 2PZWA 1JOOA 4J1MA 3TS0A 3NHHA 1SN8A 2L1BA 4J15A 1G91A 2A68C 5C3WA 1X56A 4GNXA 2EJMA 3HOXH 3W1GA 4BY7G 4C3HG 2WB1B 4JBMA 2JA7G 1IW7D 1NTGA 3HP3A 3NWSA 4A3KH 1SYGA 4HEDA 3V2TA 5BN5A 4N9TA 2Y0SB 1HZ9A 3S15H 3S17B 1QE6A 3DHQA 2AHOB 4KN4C 2HD3A 2K7VA 2N88A 4CDEC 3J80i 1YEZA 4HJ9A 1BQQT 4ZRZA 1XTCD 1A15A 4KN7C 4YCWA 1BBXC 2PCFB 3J7YW 4LFCL 4A3JB 5JVH3 5IYBG 1SR3A 3NQIA 1CKOA 4CJ1B 1GKHA 2BE5D 3I4NG 3MVVA 2OWOA 5I9PA 2GA4B 1SNPA 4DR2Q 1K8MA 1CKNA 1PTOH 2QW7A 2PNHA 3BVGA 3CPFA 1LYLA 1D5ZC 4X62Q 1CQFA 1NNXA 3HG9A 4EQOA 3OTOQ 1P16A 4RFBA 2Z6KA 2F0WA 4XTCS 4IOAA 3PUXA 1QOHA 4BBSG 1W6JA 1CFMA 4BBSB 2IJ0A 4DAYB 2ZM6L 2B2YA 1Q8IA 3A7AB 1WD0A 1ZYRC 2F03A 1Y1WH 5CGKA 1D2BA 1LTTD 1SMXA 1PYBA 3BYTB 4DV6Q 1H9SA 2LFNA 2HHHL 5K36G 2Y0SE 4RCNA 2SNMA 4DR4Q 2K14A 3K0XA 3NENA 2I5MX 2B8FA 4DV7Q 2R7ZB 4MHEA 1PH4A 4P75A 5KRUA 4RHSA 1UAPA 1EL0A 3HOXG 4B3RL 2CKZB 3ER0A 2F0KA 2IHEA 4AYBB 3CCEA 3S1MB 1WCMB 4K0KL 2Z4HA 1VCIA 2NTTA 3T13A 1C8CA 2A5HA 3E9HA 4DK3C 1B3QA 1LUZA 1EY8A 5FJ8H 2KCTA 1ENFA 4L5RC 1BCPF 1F2LA 2K75A 4PZ7A 5D65A 1O80A 4C2MB 1B1ZA 1Y8NB 3FPPA 1EY9A 3IFDA 1PMRA 2B3GA 3BJUA 3TZDA 1WTVA 4GN4B 3NTHA 4K2LA 5I6WA 2ZTCA 2F52A 2QKIC 4RKBA 5HGQA 5C4JH 2O5JC 2UUAL 4JBKA 2UXBQ 4QJFA 2VB3X 1PFBA 4FXKC 4JI1L 3A54A 3NBHB 4CDCC 3P1HA 2FMMA 5LL6X 3SDZA 3UDXA 3X3MA 2LS01 1LT4D 1YITA 1EIYB 4A3GH 4IUVA 4L6TB 2A6EC 4UP7A 3ULJA 4X3UA 4HJ7A 2F3IA 3KDFB 3FP9A 1H9KA 3KLRA 2KCCA 1HTPA 3ND8A 4DR6Q 2M00A 4PZ8A 2EJGC 2C9OA 4IUPA 2VY3A 1Q3LA 4NXNL 1DD2A 1Q12A 4FNFA 1SYFA 2F0VA 2LXKA 2Z6BA 1EYAA 1I6VC 4ZAIA 5C3EH 2RDFA 4K0KQ 5IP7G 4KKUA 3BG3A 3F2BA 3SR1A 1HZAA 1VQBA 2YTYA 1SJED 4K6DA 4FO2A 1HNXQ 1QZGA 2B2YC 5EJWA 2UXDL 4LF5Q 2K33A 4LK1C 1I6HB 3FRPB 4DU9A 1TT2A 2F0EA 2K01A 4QGUA 5BR8L 1KC8C 3BS1A 2JA6B 1JJCB 2JJQA 4JI3L 3GTLB 3C3LA 2AQ2B 1HA5A 3I3CA 4HIKA 1E3PA 2JSOA 1JQYD 2H1EA 1N34L 4X65Q 1LLRD 1GD7A 1STGA 1F2YA 2F0SA 1PH5A 1C9OA 1RDPD 2K52A 1KQSA 5A2QL 4IALA 4POFA 1TU2B 3VYRA 4A3EB 2EXDA 3PUYA 3QOLA 1ENAA 3HOZH 1WJJA 4LJZC 1PRTF 2G9DA 3NQTA 3S1QB 1I3QH 4H0LC 2OQ0A 1WOCA 2X69A 4DV3Q 1TIID 1IYJB 3M4QA 3CXCA 2E2IH 4XQQA 3RLOA 4WORA 4TVAB 3EIVA 5CBEE 5K5PA 4HCSA 1MI2A 3FKIG 1S5CD 3J81j 2CQOA 2N8NA 5T1IA 3MFYA 1Q82C 3SK6A 2WP8J 4LFAL 1D8LA 2EXZA 2NVYB 2NVXH 1EY6A 1NJIC 4QQBX 1J9OA 2JK8A 2KECA 1TQOA 1STHA 2R7ZG 2VQFL 2GVAA 2K5HA 4IPDA 1EY0A 2UUCL 4UAIA 4LF9L 1SYCA 4BBSH 4B3ML 1QVFA 3KF6B 3MAQA 1X3PA 3G6JB 2EPBA 5C4XH 4AYBE 2VB2X 3T53B 4TKOB 2MQHA 2B2WA 3D4RA 3FKIB 1PH1A 2K5VA 4B3SL 3HKZG 5KNBA 2O4XA 3FHWA 1JE4A 1HNZQ 3CHBD 3HKZB 4DV0L 1H9MA 2X6LA 3NK9A 4K5WA 4PMCA 3AMUA 4DK6C 1KDCA 1F77A 1SE8A 1VQEA 2TMPA 4O0AA 2PNRC 5FO9B 4EQPA 2L11A 2K5DA 3D4DA 4GS3A 4DV2L 1CKMA 2VXWA 5JEAH 3T1YL 4LF7Q 1FGUA 5M3FG 3PO3G 1HHVA 1HQMC 3OPOA 4KHPQ 1C48A 2XRSD 4LMQD 1WVLA 1EWHA 3SGIA 2ES2A 3PV0A 2TSSA 3P7JA 3A5ZB 4K8IA 2JE6I 1RHPA 4HIMA 1SEBD 3NP8A 3IKJA 3MHBA 4BBRH 4DAMA 1Y69U 3KDFA 1I94Q 1K3RA 1VQLA 4FXDA 4X66L 1PRTD 1SMYC 1HZBA 3TDQA 4YIJA 4R4OA 1RIPA 5DM73 1F2ZA 1SAPA 1YNJC 2NVQH 3K5OA 3M9BA 4C3HH 2A68D 2X6GA 2WAQB 1ET6A 1GHJA 2JP1A 1XPOA 1U4LA 4HCEA 1Q1EA 4RHRA 4DUZQ 1L0YB 2KOLA 4YCUA 4QIWB 4IPHA 4C2MH 3GTKH 4P73A 1K8OA 4P72A 2PI2E 1TWHH 1STBA 1IHZA 4G57A 1LTRD 1QJOA 5BN3A 4IFDG 2N55A 3WOEA 1PTOD 1M8AA 2MJ8A 4DV7L 3BVMA 1O78A 1FNUA 2WV6D 1MGSA 4A3GB 1JWMD 2AQ3B 1XTDA 1U9RA 2AKWB 2Q2UA 4LF8L 5M3FH 2DJGC 1X3FA 3A55A 4YWLA 1VQIA 2JA9A 1I4RA 3CAMA 2Q2HA 3J81c 3HOYG 4EGVA 3PO3H 2ZXPA 4C1NK 1YJNA 1H9SB 3BVZA 4OHJA 1L0WA 1I5FA 1TY0A 3Q23A 3U9OA 5FLXE 4QUFA 1BBWA 5IP7H 4FVMA 5FLXc 1VQ8A 1JJGA 1CI3M 1TXYA 2F4VQ 1NMFA 3OW7A 4LAAA 5IOCA 4F7XA 5M5XB 1RL2A 2Z0SA 3FPUB 2K5WA 2A73B 2N3SA 3SVMA 3K80C 1TKWB 2J0TD 1G8ZD 3I72A 1H9JA 3M4OB 1TR5A 5C4XG 4Q0FA 5FOBB 2PPBC 5KIXA 4UP8A 4APVA 1I94L 1WTHA 3MXNA 2E5LQ 4XQNA 3I4OA 1IKLA 2I5LX 4HN7A 1CKNB 2YYZA 4KJOA 4NXML 5EKKA 2DN8A 1A6XA 2WKDA 1XWEA 4PV1C 5C44B 2N78A 2KHSA 1J5EQ 1T5XD 3TREA 3G6EA 1FJGL 1GJXA 1JCKB 1CA5A 1PFNA 4JI3Q 1MJEA 2ZTEA 1QWYA 1VF5C 2EYOA 5JOBA 5CV7A 1ONLA 4DUYQ 1HUMA 1KDBA 3T1HL 1PHJA 4OX9L 2SDFA 4OO1I 3V96A 1PFMA 2ICEC 2YTXA 1HNXL 1EQTA 3VR2A 5C4XB 1RJTA 5C44H 2RVLA 5EKLA 5DM63 1V1PA 4U673 3S16B 1KRTA 1B2TA 3P20A 4AH6A 4JI0Q 3F2DA 1Q7YC 5IT9E 4WFN3 1UWVA 3HOUH 2PW7A 1XNRQ 1QUQB 1DJRD 3BDLA 3MZ5A 1N33Q 2HCCA 4KD4A 1CHPD 1ENCA 5DAUA 5J3BA 4A3MG 1CM9A 1CZGA 3GTQH 5K36H 3NXWA 3MTSA 2XWBB 1M4VA 5IT9L 4X66Q 1Q90A 2PMZB 3BDCA 5CV9A 3D6WA 4IURA 5EKIA 1PV4A 5JJZA 2EYMA 1MBYA 1M90C 3PO2B 1OXSC 3CP0A 4IQZA 4A4IA 3GTGB 2WKCA 1J5EL 3CCQA 2QEXA 1VQ5A 1GUTA 2OTJA 1MIUA 2MHVA 1VQ6A 3D3RA 1CQVA 1XMOL 3BZKA 2VS1A 2B63H 3AYHB 3RUZA 3DXJC 1TY2A 4HJ8A 2A74C 1K83B 3E9IA 1CA6A 4X3TA 1JORA 4JOIC 2Z8LA 4A93H 4YHHL 1BCPD 2NUCA 4HAEA 4XYOA 4DKAC 5A35A 4X64Q 1B4OA 4C56C 4L5SA 4DK0A 4OELB 4ULLA 2E2JB 4BY7B 2F4VL 4A3JG 4G7OC 1JC7A 2JA5H 3C1EA 4A3EG 4MTKA 1D5XC 2EY2A 3D31A 1NR4A 1IL2A 1DOMA 1EY4A 1HR0Q 1K83H 1VF7A 2R3ZA 3MC0B 1B50A 2XRQD 1STYA 2F0LA 3MWYW 3PO2H 4KY7A 1PZJD 4J6HA 4RGNA 1X3EA 4DFAA 2VW9A 4DR1L 3R2TA 3GO5A 1JOKA 2RHQB 1IBKQ 1EFID 4M8AA 1JB7A 4GKKL 4DR1Q 1VQ9A 2OT2A 1SYBA 1Y1VG 3LNNA 3CRLC 4I65A 4MNOA 3PO3B 1ASZA 2EJFC 4GKJL 2B29A 3OIQA 5LMNL 3CCRA 2Q2TA 5FJ8G 4CDDC 3ERQA 4GOPB 2H5XA 2UUBL 1QG7A 4O42A 4IFDH 4DV3L 2DGYA 4FF1A 3ONAB 3S9WA 3SE0A 1VQFA 4HR7B 1S40A 1PTOB 1RF2D 4MIUA 2Q8TA 4RAUC 4QL5A 4UPAA 3I90A 4GLAC 4IJLA 3KUPA 2ICIA 3WDNA 1PH6A 2E2DC 4HSPA 4IFDJ 4PMWA 5IYCH 1TWAH 2KBNA 4QF4A 5FKAC 3KBGA 3D4WA 1SNDA 2R7DA 5LL6S 2GN5A 3KLSX 2D2CC 4A3DG 5E4WC 1LACA 5M5XH 3N6RA 1E0BA 4F87A 3I2ZA 1N36Q 2B2TC 1U4MA 1PVOA 5IGDA 2DNEA 4A3KB 1SLJA 1EQQA 4O1NA 1HFGA 4BA2I 2RDHA 4JV5L 4KTAA 4PNYA 5TSSA 1HR0L 5EPLA 3S17H 1HFNA 1CHQD 3S1RH 1FYCA 1N33L 3H3VH 1DM0B 1NUCA 5EPJA 3KLSA 1UE6A 3TZUA 4NXNQ 1OXVA 2I07B 1CTMA 2NZHA 4LWCA 1B7YB 4A3BB 4DR7L 1L1OA 4DF7A 3SK8A 4K2KA 1WTOA 1WD1A 3EJIA 1PLFA 1V1OA 1R9TB 4JVZA 4OWWB 3SK5A 2JXMB 2SEBD 3HOWH 2EIFA 4OL7A 1GUOA 3IL8A 1QVGA 1YNND 3HOYH 1TWFH 4XIGS 1EEFD 3J80E 4TRDA 1V8QA 3CMEA 4G7HC 1PFSA 4JBWA 2D5DA 1U4RA 3S2DH 4OIJA 3CF5A 3KOJA 3W3AA 1UNSA 2JA7H 3J81E 2IX3A 4BA1I 1BO0A 5G3LD 5IGFA 2HUGA 4A3DH 4A3KG 1JJ2A 3CQZH 1YBYA 3S16H 4LUVA 4IPCA 2QCPX 4JPBW 1NY4A 3K57A 1Q8KA 5ELEA 2VUMG 2RSOA 2OXPA 1MSGA 1JWSD 1FVIA 4Q5VA 4JI5L 1OO9B 1V43A 2D0OA 2ZTDA 3QJYA 3K59A 3PCOB 4LFCQ 3K5LA 1A3VA 2IPKD 3H0GH 2EOTA 3MXUA 4NW2A 1GVPA 5LMNQ 2KHIA 3PF4A 3OMGA 5FK9C 4A75A 2HHHQ 1S4ZA 2QF7A 3K0YA 1Q1BA 2KA7A 3K7AH 2XTIA 1IBKL 3K7AB 1JE5A 1EYDA 4JI8L 3BDOA 4LF8Q 1EZ8A 2E2HB 4RMFA 1VMPA 3M85A 1AZPA 4LF5L 1X54A 3AB9A 4H02A 1X6OA 1PH2A 1DCZA 3VR4A 3I4MH 2ID0A 1I4XA 4EVOA 4A3EH 3NWTA 1D1IA 4BBRB 3H3VI 4MTNA 2KQ3A 4C3IH 4BY1H 3CCSA 4GLVB 1NE3A 2QDLA 5FLMH 3GTKB 2C35B 5FO8B 2AMCB 1JR0D 1S5BD 2E2HH 1X65A 4DA2A 2RKSA 2MO1A 4EQNA 3UE0A 4QIWE 1AEXA 3TQYA 1PH8A 3V05A 2JA6H 4ZKBB 5E3FA 1XMOQ 1VS0A 5I2XA 3Q8DA 4MZ9A 4JK1C 5FO7B 2JQOA 1I4GA 4OWTB 1PRTB 4P71A 4LFBL 4L5QA 3ZYYX 1XXGA 3NTKA 3GTOB 1LTLA 5HY6A 2FHTA 4LF7L 3NE5B 3U4ZA 1SXTA 2E2IB 4KHPL 3RZOB 4LW1A 3T51B 4I7ZC 2ZJRA 1HZCA 2ASBA 1IXRA 2OTLA 1ASYA 3LX0A 3EQLC 4NP5A 3S1QH 1HUNA 5KYIA 3CW2C 2NN6I 3G7LA 3MXPA 5CV5A 2L15A 4C3JH 1ESFA 1YI2A 4IUUA 2KHJA 4JI7L 2NN6H 1Z9FA 1CK1A 4X3KA 1JICA 5KGUA 1L2FA 3A0JA 3J80c 1IYUA 1I4PA 4YHHQ 2R92G 3JAML 3AEVA 1KL9A 3A8IE 2VL6A 4DAYA 1PTOC 4HIDA 1WTRA 1SSOA 2JA5B 4ZCKA 2NTSA 4KK7A 3G48A 3A56A 1ZYRD 2XNAC 3GTMB 1UUPA 3S1MH 1KRSA 1S72A 1K73C 2FXQA 1Q81C 4ZK9B 4KD3A 4G4KA 3DM3A 2RSNA 2M2LA 3NPPA 4J8QA 2F0FA 2K03A 3Q22A 5J1ZA 1BR9A 3L9AX 2F0IA 2MGSA 4HTHA 4WJWA 4JOIA 1SNMA 4C3HB 2R92B 1Z6HA 5JPMC 4AQYL 1LT3D 1V1QA 3HEJA 1AZQA 3TP5A 2OEOA 3TBIB 3SXHA 4IUQA 2O5IC 3AFPA 3F8TA 4DR2L 5DLQE 3TP6A 4ID6A 3TEHB 3U58A 5ELCA 3GTPB 4KHVA 2MNAA 3AU7A 1S5ED 2NYZD 2AWNA 4XXEA 5JPNC 1ML0D 5C0XJ 1ESRA 3ITPA 3W1BA 3I4MG 3L2PA 5CYUA 3LGJA 4X65L 5C3EB 3W2DA 1BDOA 3VA7A 4K5VA 1SROA 4IUNA 4DV5L 4R4CA 5C3XA 2F3VA 4ABNA 4YCVA 4GKKQ 4A3LH 4KV6A 3T1YQ 3WOFA 2AUKA 4DAPA 3SHLA 3I70A 1QNKA 4RWSC 4NXMQ 2ALYB 2UXDQ 3J80L 2PW5A 5GAEC 4DR7Q 1A62A 1KLGD 2D62A 1SYDA 2KVMA 4IZ8A 4UP9A 1M1KC 1W6KA 4YWMA 4OWXB 1SE2A 3H94A 5DEHA 2IWHA 1II3A 2E2JH 2I46A 2B2VA 2B2TA 1HJPA 1RKNA 1A2TA 3UDGA 2EY1A 5C4ZA 2A69D 1I6HH 4NB3A 1XMQQ 2L55A 5GAHC 2KCMA 4A3FB 1GUNA 5EQ0A 2XN9C 2E76C 3DUZA 5J39A 4DR6L 1A3UA 1CZWA 2EYHA 1NBWA
chains in the Genus database with same CATH topology
5KYLA 3TSSA 3S15B 1DXMA 3H91A 3NUCA 2NB0A 1F9SA 1LABA 2D9UA 1SE3A 4L63B 2PO4A 3OMCA 2XIWA 2R6GA 1Z7TA 1FGBD 5JEAG 1FNWA 1GUGA 2A6ED 4GZYC 2BOSA 2JEBI 2J4XA 3EROA 4Z9CB 5IGBA 3E6ZX 5IODA 2CW0C 2ENBA 2OF1A 4S3SA 4WRDA 1O7ZA 4NDXA 3OSOA 2EVBA 2J7ZA 2VUMB 1STNA 2AQ1B 3PUZA 4FP5D 5CORA 4OIKA 2H4OA 2JYOA 5CR3A 1TWAB 1TS4A 4NKLA 1GUWA 4U68A 4KJNA 1EY7A 1JWUD 3VYSA 3GV3A 2QEJC 2B39A 2WIIB 3PIP3 2CW0D 4F8MA 5D14A 1EOTA 1BOSA 1JB3A 1FNVA 4B08A 2MPMA 3DMUA 4HSVA 1L0XB 1IYVA 3H0GB 4CJ0B 3EA6A 2A6HC 1ILPA 4CHTB 3C46A 1LTAD 2FMCA 2KJXA 1A3TA 4FYDA 5M5YB 3H09A 2WACA 3FEWX 3EVQA 4OO1H 1HTLD 1BNZA 4KKTA 1RCVD 1FR3A 3HRZC 1EYCA 5CV4A 1VDZA 3DM1A 4N9PA 3VR5A 4B9XA 4H44C 2C5CA 1E2ZA 3GQBA 2K5QA 1HPCA 1YNJD 5I2YA 1F2MA 2FINB 1B9NA 1PRTC 1SMYD 2PQEA 3IAYA 2L9HA 2JEAI 1OXTA 1TVXA 4KY5A 1IW7C 4KHZA 1RTOA 3I73A 1SYEA 3R2IA 3MXGA 4UDUC 5I9OA 1KDAA 3OHXC 1G291 2IX1A 1WTPA 1EY5A 3D8GA 2DNCA 5EBDA 5C5LA 5M3MB 3J7AV 4OO1G 1SE4A 5NUCA 4C3JB 1QILA 1U4PA 4CKEA 4B9WA 5IGEA 2R93B 4CKCA 2BE5C 3PIO3 4BY1B 2AWOA 1TS5A 5CBAE 2F1MA 3TN2A 3S14B 1Y8OB 4FF3A 5COYA 4FF2A 3BYYB 4FF4A 3T56B 5IIFA 1B53A 1V1PB 1GUSA 2QILA 3URYA 2B2UC 5M3FB 1EIGA 2NBFA 1O7LA 1WTWA 5C5MA 4A3DB 4H7BA 5EBCA 4A3MB 4IFDI 4E6IA 1PXUA 4DGZA 5C0XH 2MUYA 3QOJA 2IW3A 2BA0A 3DEPA 2K28A 4A93B 5C0XI 2BA1A 1QB5D 3H6MA 2BDNA 4BWGB 4DXFA 1D1KA 1NCVA 5C0XG 4DXGA 3MA2B 4R8IA 1AW7A 1VMCA 2K6AA 2RA4A 2K04A 3I4NB 2JA7B 3GP7A 1ZKOA 4V0BA 2IL8A 3FVQA 2EE1A 3D6CA 1SNCA 3M3YB 1NAPA 5JEAJ 1QCBD 2HDLA 4ZKCB 1IL8A 2IX0A 2LKVA 3VYTA 2B2UA 2F0HA 3M4YA 2HQEA 3X3NA 3HOUB 1OXUA 2KUMA 4FXGC 3T4AC 2HDMA 3Q6SA 2Z4IA 3VR6A 1Y8PB 4XT1B 1ZXTA 5ISRA 1G6ZA 1T5EA 5CV6A 4A3IB 1B3AA 4R9WA 4ZQ3A 3NTIA 4DNRB 5FLXL 1LTID 2MP1A 3HGBA 2F4IA 3J81L 3I4MB 4F88A 3UI2A 4RGMA 1SNQA 4L8JA 4ODGA 1QNUA 3BZDB 3PUWA 1X3QA 3KF8A 3VA5A 2B8GA 3E5SA 1LV9A 3N52A 3GV6A 4HMJA 5HURA 2EYPA 4ME5A 3NBIA 4MN3A 1ILQA 3R8BA 3S2DB 1KTKA 2DY7A 3ND9A 4Y7NB 2EY5A 3S1RB 3E0JA 2HCIA 1A2UA 3CQZB 3HZXA 2F0MA 3HOWB 2B2VC 3RMHA 3CU7A 2ZXRA 3K58A 1F9RA 1HQRD 1S5DD 3T16A 4BS9A 3CRKC 1BXTA 1BF4A 3HOXB 2NN6G 2L0CA 4KMUC 3MEHA 4P2CB 3J7AF 2NVTB 1FD7D 2SOBA 1HA6A 1HRJA 1C4QA 4ZUJA 4H13C 3F2UA 1O7YA 2F0OA 3OOCA 3PUVA 2QDBA 5IGGA 5G3LF 2XSCA 3GTJB 2F0PA 1TS3A 1HXYD 1DOLA 4KKSA 2JA8B 2RBMA 1SNOA 3OWFA 3LWUA 3C2PA 1BUVT 5D3IB 3QG1A 4K8JA 4XYQA 3QIAA 4CBVA 4QMGA 4IUTA 1WTQA 1XX8A 1B9MA 3LWEA 2EY6A 5ELDA 5BN4A 3S1NB 4C3IB 3K5NA 4DN4M 2XVSA 1HCZA 3EFXD 2EZVA 3TMEA 2Q8RE 1YNNC 2EYJA 1PZID 4DNTB 1SDFA 4RA8A 4R8NA 1R4PB 3RZDB 1GXDC 4TSSA 1E2VA 1E2WA 2V4DA 2M9VA 1R4QB 4KI0A 1F9QA 3KK7A 1KNAA 1DOKA 3O13A 4OGQC 3NBHA 4ZUIA 1DYQA 1JOQA 5D3DA 4CKBA 2E74C 3TP8A 5JVG3 3I4LA 5J22A 1UEAB 1TWHB 3Q24A 5C4JB 2Q8IB 4DK1A 3HOVB 3QWNA 5I6YA 5CC4A 2LMCB 3RLFA 5JAVA 5M5WB 1CT1D 3A7LA 3L7ZC 5AFWA 5EPKA 3M7GA 2NVXB 1EQVA 2B63B 1H9RA 1AN8A 5F2DA 1B44D 3OWEB 3DWQA 3K6OA 3VR3A 2EDGA 2B2WC 2BCOA 2LY7A 3A8JE 2WINB 2YU9B 4XQJA 2CQAA 1TS2A 1AFPA 3TP7A 1EEID 5CV8A 1KNEA 5E1FA 2NWGA 2XWJB 1ET9A 4C1NI 5EGTA 1TWFB 4RKLA 1SFOB 2EYLA 3S2HB 1KLUD 2IT1A 5ELBA 2L12A 1LO5D 1TWCB 4K14A 1G2TA 1EWCA 5E4XA 3JAME 1DONA 4QB4A 1BCPC 3NSWA 4KY6A 1LTSD 3DEOA 1LTGD 3SEBA 3FMCA 4PQXA 2ZXOA 1NSNS 1MSHA 2F0GA 3DWAA 4NMZA 2NVQB 2PZUA 5KEEA 3QO2A 2VNUD 3FDTA 1EZ6A 3OIPA 1LT6D 2EYFA 3HOZB 2F0JA 1Y1VB 2DY8A 3C1FA 4RH6A 2RDGA 1KABA 4QCLA 3I8ZA 1EIHA 2A69C 3IFTA 2CVRA 1AP0A 4C3IG 2KEEA 5ELFA 2G9HD 3CKIB 2CHBD 3RD4A 1PTOF 1X32A 3DWPA 4XDXA 1ICWA 3P75A 3VYUA 5LHY1 2Z1CA 2L4NA 5KNDA 4ZLTF 3MFGA 3PMFA 1SJHD 1PZKD 1IKMA 2FJ2A 3HS0C 3K5MA 5C4HA 5M9OA 2L5TA 1Y1WB 1I4QA 1EU3A 3H3VC 2FFKB 1SBBB 2O2LD 2F0UA 4CJ2C 1RTNA 1STAA 2E75C 2K32A 2PZTA 2KEDA 1S5FD 5C6AA 5T1GA 5KNCA 1LT5D 1RD9D 1STEA 2PYKA 4G7ZC 5A2QE 5DNFA 1J8IA 2F0DA 4RCOA 1I50B 4C3JG 2SNSA 3Q0AA 4PMBA 1ZEQX 1GOZA 4X3SA 1XYIA 1I3QB 4K5XA 4K6LA 3I91A 2RQXA 2KCNA 3M7NA 2BDOA 1KAAA 1RODA 2AUJD 4ILWA 2F0TA 3KBXA 3U9SA 2ZT9C 3GTQB 5I4DA 3L3OC 1TWGB 2NZ1D 4TQUS 4XT3B 3GD7A 3HOYB 2A6HD 4CGYB 1D5MC 4M1UB 3QB3A 2F0QA 2F0NA 1LTBD 3R3OA 2K05A 4RGTA 2R61A 3SK4A 4V190 4IN3A 1D6EC 3R93A 1OXXK 4DAVA 1F9PA 1WTXA 1GHKA 1PDQA 5IGCA 3A8KE 1EU4A 1PYWD 5CMDA 2K1BA 1BCPB 1Z47A 1NR2A 5HGTA 4HMIA 1MD2D 2F3WA 4ZYSA 4RGOS 1DZ1A 4QUCA 1G2SA 1I4HA 2PZWA 1JOOA 4J1MA 3NHHA 2L1BA 1G91A 5C3WA 2A68C 2EJMA 4C3HG 2WB1B 1IW7D 3HP3A 3NWSA 1SYGA 4HEDA 3V2TA 5BN5A 4N9TA 2Y0SB 3S17B 1QE6A 3DHQA 4KN4C 2K7VA 2N88A 1BQQT 4ZRZA 1XTCD 1A15A 4KN7C 1BBXC 2PCFB 3J7YW 4A3JB 5JVH3 3NQIA 4CJ1B 2BE5D 3MVVA 5I9PA 2GA4B 1SNPA 1K8MA 1PTOH 3BVGA 1D5ZC 1CQFA 3HG9A 4EQOA 4RFBA 2F0WA 4XTCS 3PUXA 1QOHA 1W6JA 1CFMA 4BBSB 2IJ0A 2B2YA 1Q8IA 3A7AB 1WD0A 1ZYRC 2F03A 5CGKA 1D2BA 1LTTD 3BYTB 1H9SA 2LFNA 5K36G 4RCNA 2SNMA 2B8FA 2R7ZB 4MHEA 5KRUA 4RHSA 1UAPA 1EL0A 2F0KA 4AYBB 3S1MB 1WCMB 2Z4HA 1VCIA 2NTTA 3T13A 1C8CA 2A5HA 1EY8A 1ENFA 1BCPF 1F2LA 5D65A 1O80A 4C2MB 1B1ZA 1Y8NB 3FPPA 1EY9A 3IFDA 1PMRA 3TZDA 1WTVA 3NTHA 4K2LA 5I6WA 2QKIC 4RKBA 2O5JC 2VB3X 1PFBA 4FXKC 3A54A 3P1HA 2FMMA 5LL6X 3SDZA 3X3MA 2LS01 1LT4D 4IUVA 4L6TB 2A6EC 4X3UA 1H9KA 3KLRA 2KCCA 1HTPA 3ND8A 2M00A 2EJGC 2C9OA 4IUPA 1Q3LA 1DD2A 1Q12A 4FNFA 1SYFA 2F0VA 1EYAA 1I6VC 4ZAIA 2RDFA 4KKUA 3BG3A 3SR1A 1SJED 4K6DA 4FO2A 2B2YC 5EJWA 2K33A 4LK1C 1I6HB 3FRPB 4DU9A 1TT2A 2F0EA 2K01A 2JA6B 3BS1A 3GTLB 3C3LA 2AQ2B 1HA5A 3I3CA 2JSOA 1JQYD 2H1EA 1LLRD 1STGA 1F2YA 2F0SA 1RDPD 5A2QL 4IALA 1TU2B 3VYRA 4A3EB 3PUYA 3QOLA 1ENAA 4LJZC 1PRTF 2G9DA 3NQTA 3S1QB 4H0LC 2X69A 1TIID 4XQQA 4WORA 5CBEE 5K5PA 4HCSA 1MI2A 1S5CD 5T1IA 3MFYA 3SK6A 2WP8J 2EXZA 2NVYB 1EY6A 1J9OA 2KECA 1TQOA 1STHA 1EY0A 4UAIA 1SYCA 3MAQA 1X3PA 3G6JB 2EPBA 2VB2X 3T53B 4TKOB 2B2WA 3D4RA 3FKIB 5KNBA 2O4XA 1JE4A 3CHBD 3HKZB 1H9MA 4PMCA 2X6LA 3NK9A 4K5WA 3AMUA 1KDCA 1F77A 2TMPA 2PNRC 5FO9B 4EQPA 2L11A 2K5DA 3D4DA 2VXWA 5JEAH 1HHVA 1HQMC 3OPOA 1C48A 2XRSD 4LMQD 1WVLA 1EWHA 3PV0A 2TSSA 3P7JA 4K8IA 2JE6I 1RHPA 1SEBD 3NP8A 3IKJA 3MHBA 1Y69U 4FXDA 1PRTD 1SMYC 3TDQA 4YIJA 5DM73 1F2ZA 1SAPA 1YNJC 3K5OA 2A68D 2X6GA 2WAQB 1ET6A 1GHJA 2JP1A 1U4LA 4HCEA 1Q1EA 4RHRA 1L0YB 2KOLA 4QIWB 1K8OA 1STBA 1IHZA 4G57A 1LTRD 1QJOA 5BN3A 4IFDG 2N55A 3WOEA 1PTOD 1M8AA 2MJ8A 3BVMA 1O78A 1FNUA 2WV6D 1MGSA 4A3GB 1JWMD 2AQ3B 1U9RA 3A55A 1I4RA 4EGVA 2ZXPA 4C1NK 1H9SB 3BVZA 4OHJA 1TY0A 3Q23A 3U9OA 5FLXE 4QUFA 4FVMA 1CI3M 4LAAA 3OW7A 5IOCA 4F7XA 5M5XB 3FPUB 2K5WA 2A73B 3SVMA 1TKWB 2J0TD 1G8ZD 3I72A 1H9JA 3M4OB 1TR5A 4Q0FA 5FOBB 2PPBC 5KIXA 3MXNA 4XQNA 1IKLA 4HN7A 2YYZA 4KJOA 5EKKA 2DN8A 1A6XA 2WKDA 1XWEA 4PV1C 5C44B 2KHSA 1T5XD 1GJXA 1JCKB 1CA5A 1PFNA 5JOBA 1QWYA 1VF5C 2EYOA 5CV7A 1ONLA 1HUMA 1KDBA 2SDFA 4OO1I 3V96A 1PFMA 2ICEC 5C4XB 1EQTA 3VR2A 1RJTA 2RVLA 5EKLA 5DM63 1V1PA 4U673 3S16B 1B2TA 3P20A 5IT9E 4WFN3 2PW7A 1DJRD 3BDLA 3MZ5A 2HCCA 4KD4A 1CHPD 1ENCA 5DAUA 1CM9A 1CZGA 5K36H 3NXWA 3MTSA 2XWBB 1M4VA 5IT9L 1Q90A 2PMZB 3BDCA 5CV9A 3D6WA 4IURA 5EKIA 5JJZA 2EYMA 1MBYA 3PO2B 1OXSC 4IQZA 3GTGB 2WKCA 1GUTA 2MHVA 3D3RA 1CQVA 3RUZA 3DXJC 1TY2A 2A74C 1K83B 1CA6A 4X3TA 1JORA 2Z8LA 1BCPD 2NUCA 4HAEA 4XYOA 5A35A 1B4OA 4C56C 4DK0A 4ULLA 2E2JB 4BY7B 4G7OC 1JC7A 3C1EA 1D5XC 2EY2A 3D31A 1NR4A 1DOMA 1EY4A 1B50A 1VF7A 2R3ZA 3MC0B 2XRQD 1STYA 2F0LA 3MWYW 4KY7A 1PZJD 4J6HA 4RGNA 4DFAA 3R2TA 3GO5A 1JOKA 1EFID 4M8AA 2OT2A 1SYBA 3LNNA 3CRLC 4I65A 3PO3B 2EJFC 3OIQA 3ERQA 1QG7A 4O42A 4IFDH 4FF1A 3ONAB 3S9WA 3SE0A 4HR7B 1PTOB 1RF2D 4MIUA 2Q8TA 4RAUC 3I90A 3KUPA 2ICIA 3WDNA 2E2DC 4HSPA 4IFDJ 4PMWA 4QF4A 5FKAC 3KBGA 3D4WA 1SNDA 5LL6S 3KLSX 2D2CC 5E4WC 1LACA 3N6RA 1E0BA 4F87A 2B2TC 1U4MA 5IGDA 2DNEA 4A3KB 4O1NA 1HFGA 4BA2I 2RDHA 4KTAA 4PNYA 5TSSA 5EPLA 1HFNA 1CHQD 1FYCA 1DM0B 1NUCA 5EPJA 3KLSA 3TZUA 1OXVA 2I07B 1CTMA 4A3BB 4DF7A 3SK8A 4K2KA 1WTOA 1WD1A 3EJIA 1PLFA 1V1OA 1R9TB 3SK5A 2JXMB 2SEBD 4OL7A 1GUOA 3IL8A 1YNND 4XIGS 1EEFD 3J80E 4TRDA 1V8QA 4G7HC 4JBWA 2D5DA 1U4RA 4OIJA 3W3AA 1UNSA 3J81E 2IX3A 4BA1I 1BO0A 5G3LD 5IGFA 2HUGA 2QCPX 3K57A 5ELEA 2RSOA 2OXPA 1MSGA 1JWSD 4Q5VA 1OO9B 1V43A 3QJYA 3K59A 3K5LA 1A3VA 2IPKD 2EOTA 3MXUA 4NW2A 3OMGA 5FK9C 1S4ZA 2QF7A 3K0YA 1Q1BA 2KA7A 3K7AB 1EYDA 3BDOA 1EZ8A 2E2HB 1VMPA 3M85A 1AZPA 3AB9A 1DCZA 3VR4A 2ID0A 1I4XA 4EVOA 3NWTA 1D1IA 4BBRB 2KQ3A 3GTKB 5FO8B 1JR0D 1S5BD 4DA2A 2RKSA 4EQNA 1AEXA 3V05A 4ZKBB 5E3FA 5I2XA 4JK1C 5FO7B 1I4GA 1PRTB 3ZYYX 1XXGA 3NTKA 3GTOB 2FHTA 3NE5B 1SXTA 2E2IB 3RZOB 3T51B 4I7ZC 3LX0A 3EQLC 4NP5A 1HUNA 5KYIA 2NN6I 3G7LA 3MXPA 5CV5A 1ESFA 4IUUA 2NN6H 1CK1A 4X3KA 1JICA 5KGUA 1IYUA 1I4PA 3JAML 3A8IE 4DAYA 1PTOC 1WTRA 1SSOA 2JA5B 2NTSA 4KK7A 3A56A 1ZYRD 2XNAC 3GTMB 1UUPA 4ZK9B 4KD3A 4G4KA 2RSNA 2M2LA 3NPPA 4J8QA 2F0FA 2K03A 3Q22A 5J1ZA 1BR9A 3L9AX 2F0IA 2MGSA 4HTHA 4WJWA 1SNMA 4C3HB 2R92B 1Z6HA 5JPMC 1LT3D 3HEJA 1AZQA 3TP5A 2OEOA 3TBIB 3SXHA 4IUQA 2O5IC 3TP6A 4ID6A 5ELCA 3GTPB 4KHVA 3AU7A 1S5ED 2NYZD 2AWNA 4XXEA 5JPNC 1ML0D 5C0XJ 1ESRA 3ITPA 5CYUA 5C3EB 3W2DA 1BDOA 3VA7A 4K5VA 4IUNA 5C3XA 2F3VA 4ABNA 4KV6A 3WOFA 2AUKA 4DAPA 3SHLA 3I70A 1QNKA 4RWSC 3J80L 2PW5A 1KLGD 2D62A 1SYDA 2KVMA 4IZ8A 1W6KA 1SE2A 3H94A 5DEHA 2IWHA 1II3A 2I46A 2B2VA 2B2TA 1RKNA 1A2TA 2EY1A 5C4ZA 2A69D 2L55A 4A3FB 1GUNA 5EQ0A 2XN9C 2E76C 3DUZA 5J39A 1A3UA 1CZWA 2EYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXT A;  5CBE E;  4X3S A;  1G6Z A;  3HP3 A;  4HCS A;  3H91 A;  1MI2 A;  1MGS A;  3F2U A;  1S4Z A;  4HED A;  5T1I A;  1F9S A;  5E4W C;  1B53 A;  1O7Y A;  1PFB A;  2D9U A;  3D6W A;  4IUR A;  1XYI A;  1BNZ A;  5EKI A;  3I91 A;  5JJZ A;  2FMM A;  2XIW A;  3QO2 A;  1E0B A;  3FDT A;  4ZK9 B;  1J9O A;  2B2U C;  2KEC A;  2B2T C;  1EIG A;  1B3A A;  2RSN A;  1U4M A;  1ROD A;  2M2L A;  5AFW A;  3DM1 A;  4IUV A;  2K03 A;  1QE6 A;  4R9W A;  5EPK A;  1VMP A;  1WTW A;  1AZP A;  4X3U A;  1DOL A;  2N88 A;  1HFG A;  3KBX A;  3TZD A;  2MGS A;  1WTV A;  4UAI A;  1A15 A;  2FIN B;  2MP1 A;  2DY8 A;  5EPL A;  1HFN A;  1X3P A;  1BBX C;  1O7Z A;  2EPB A;  4QUF A;  1CA6 A;  3DEP A;  4X3T A;  2K28 A;  4IUP A;  1Q3L A;  2B2W A;  4CJ1 B;  1AZQ A;  3I8Z A;  1EIH A;  2J7Z A;  1JE4 A;  2NZ1 D;  4HAE A;  3UI2 A;  4IUQ A;  1B4O A;  4XT3 B;  2L9H A;  2BDN A;  5EPJ A;  2CVR A;  4ZAI A;  1AP0 A;  2KEE A;  2X6L A;  1NCV A;  2B2W C;  4OIK A;  5COR A;  3FPU B;  2JYO A;  1X32 A;  4IUT A;  1WTQ A;  3SVM A;  4R8I A;  4XDX A;  1XX8 A;  1TVX A;  1GUW A;  1X3Q A;  4U68 A;  1ICW A;  1NR4 A;  1VMC A;  4ZKB B;  3LWE A;  2L11 A;  1LV9 A;  2RA4 A;  3N52 A;  2NYZ D;  3GV6 A;  1DOM A;  2K04 A;  3GV3 A;  1RTO A;  2B2Y C;  5EJW A;  2K05 A;  1WTO A;  1WD1 A;  1PLF A;  2VXW A;  1ML0 D;  2R3Z A;  4DN4 M;  1ESR A;  1IKL A;  2L4N A;  1B50 A;  3MWY W;  4ZLT F;  2K01 A;  4MN3 A;  3IL8 A;  2Q8R E;  3R93 A;  2B2Y A;  1ILQ A;  1HHV A;  1WD0 A;  4LMQ D;  1F9P A;  3I3C A;  1WVL A;  1WTX A;  1KNE A;  1IKM A;  1PDQ A;  2NWG A;  1WTP A;  2FJ2 A;  1U4R A;  2DY7 A;  2IL8 A;  3P7J A;  1SDF A;  4OIJ A;  2FHT A;  1RHP A;  5D14 A;  5CMD A;  2H1E A;  1CA5 A;  4RA8 A;  1PFN A;  1EOT A;  2EE1 A;  1BO0 A;  1QNK A;  4RWS C;  2HCI A;  2HUG A;  2K1B A;  1NR2 A;  1HUM A;  2MPM A;  2FFK B;  4MHE A;  2B2V C;  2SDF A;  1SAP A;  2KVM A;  1PFM A;  1NAP A;  4HSV A;  1HUN A;  1EQT A;  2HDL A;  4ZKC B;  2L12 A;  1IL8 A;  1RJT A;  1F9Q A;  1QG7 A;  2X6G A;  4CJ0 B;  1EL0 A;  4O42 A;  1KNA A;  2JP1 A;  1DOK A;  2RVL A;  3G7L A;  4CJ2 C;  1U4P A;  1RTN A;  2B2V A;  1U4L A;  2B2U A;  1B2T A;  1DZ1 A;  3ONA B;  2B2T A;  1F9R A;  2KED A;  4IUU A;  2RSO A;  4QUC A;  1G2T A;  1MSG A;  5T1G A;  1ILP A;  5E4X A;  1G2S A;  4X3K A;  1JIC A;  2KOL A;  4RAU C;  2Q8T A;  1DON A;  1C8C A;  1BF4 A;  3I90 A;  1J8I A;  5DNF A;  3DEO A;  5CBA E;  2X69 A;  2KUM A;  2L1B A;  3KUP A;  2HCC A;  1G91 A;  1HA6 A;  2HDM A;  1F2L A;  3Q6S A;  5EQ0 A;  3TN2 A;  2N55 A;  1HRJ A;  5D65 A;  1O80 A;  1CM9 A;  1M8A A;  1WTR A;  1SSO A;  2MJ8 A;  2EOT A;  3MTS A;  4XT1 B;  3IFD A;  5COY A;  4NW2 A;  1MSH A; 
#chains in the Genus database with same CATH topology
 5KYL A;  4GKJ Q;  3TSS A;  3S15 B;  1DXM A;  3H91 A;  3NUC A;  2VQF Q;  4DV1 L;  2NB0 A;  1FJG Q;  1F9S A;  1LAB A;  2D9U A;  1SE3 A;  3RN2 A;  4POG A;  4L63 B;  2PO4 A;  3OMC A;  3QR8 A;  2XIW A;  1VQP A;  2R6G A;  4WJ4 A;  1PH9 A;  1Z7T A;  4A3I H;  1FGB D;  5JEA G;  1FNW A;  1GUG A;  2A6E D;  1JMC A;  2BOS A;  2JEB I;  4GZY C;  2E5L L;  2J4X A;  3ERO A;  4Z9C B;  4O2D A;  1MHW C;  2D0P A;  5IGB A;  3E6Z X;  1VQO A;  5IOD A;  2CW0 C;  2ENB A;  2OF1 A;  2JA5 G;  4S3S A;  4WRD A;  1O7Z A;  1EQR A;  1K0R A;  4NDX A;  3OSO A;  4PG3 A;  1I50 H;  2EVB A;  2J7Z A;  1XNR L;  2VUM B;  4LF4 Q;  1STN A;  2AQ1 B;  3PUZ A;  4FP5 D;  1UE5 A;  4OIK A;  5COR A;  2H4O A;  4RG1 A;  2JYO A;  5CR3 A;  1XPU A;  1TWA B;  1TS4 A;  4NKL A;  1GUW A;  4U68 A;  4A3C H;  4KJN A;  1EY7 A;  1JWU D;  3VYS A;  3GV3 A;  4JC0 A;  2QEJ C;  2B39 A;  2MFI A;  2RF4 A;  2WII B;  3PIP 3;  4IPG A;  1VQN A;  3IRB A;  2CW0 D;  5LMU L;  4F8M A;  5D14 A;  1GM5 A;  1EOT A;  1BOS A;  1JB3 A;  1FNV A;  1AE2 A;  4B08 A;  2MPM A;  3DMU A;  4UY8 C;  2R92 H;  2MO0 A;  4HSV A;  1L0X B;  3STB D;  5IYC G;  1IYV A;  4JI2 L;  3H0G B;  4CJ0 B;  1E22 A;  3EA6 A;  4A3F G;  3GTG H;  2A6H C;  4JCV E;  1UEB A;  1ILP A;  4CHT B;  2UU9 Q;  5L37 A;  3C46 A;  1LTA D;  2FMC A;  5GQO A;  1KXL A;  2KJX A;  3MEF A;  1A3T A;  4FYD A;  5M5Y B;  3H09 A;  2WAC A;  3FEW X;  3EVQ A;  4OO1 H;  1HTL D;  4GN5 A;  1BNZ A;  5LMU Q;  4KKT A;  1RCV D;  1FR3 A;  3HRZ C;  1EYC A;  5CV4 A;  2HQL A;  1VDZ A;  2DUD A;  3DM1 A;  1ICF B;  4N9P A;  3HOV G;  1E1O A;  3VR5 A;  4B9X A;  4H44 C;  2C5C A;  3RR5 A;  1E2Z A;  3GQB A;  2K5Q A;  1HPC A;  1YNJ D;  5I2Y A;  4ALP A;  1F2M A;  2E8G A;  2FIN B;  2I0Q A;  1B9N A;  1PRT C;  1SMY D;  1C0A A;  4DNI A;  4A3J H;  2PQE A;  3D0F A;  3M4P A;  3U4V A;  3IAY A;  3RN5 A;  2JA6 G;  4L5T A;  4LF4 L;  2L9H A;  1PA6 A;  2IHF A;  2JEA I;  1PYS B;  2Z6K C;  1OXT A;  1WI5 A;  3PF5 A;  1TVX A;  4KY5 A;  1IW7 C;  4KHZ A;  1RTO A;  4JI6 L;  3I73 A;  2K50 A;  5M5W H;  5IP9 G;  1SYE A;  3R2I A;  3GTP H;  3MXG A;  4UDU C;  5I9O A;  3I7F A;  1KDA A;  3OHX C;  1G29 1;  2IX1 A;  1WTP A;  1EY5 A;  3D8G A;  2DNC A;  5EBD A;  4A3G G;  3E3X A;  1CSQ A;  5C5L A;  5M3M H;  4DV2 Q;  5M3M B;  3CMA A;  3J7A V;  4OO1 G;  1VQC A;  4UHV A;  1SE4 A;  3H0G G;  1HR0 W;  1D7Q A;  3RLN A;  3HOU G;  5NUC A;  4A3M H;  4C3J B;  4LNQ A;  1QIL A;  1U4P A;  2PI2 A;  3AQQ A;  2CFM A;  4CKE A;  5GAD C;  2CWA A;  3PSI A;  2VUM H;  4DV0 Q;  4B9W A;  1EIF A;  5IGE A;  2R93 B;  1U0L A;  4CKC A;  2BE5 C;  1X55 A;  4GNX C;  3PIO 3;  4BY1 B;  2AWO A;  1TS5 A;  5CBA E;  2UXC L;  1X3G A;  1IBM Q;  3JC6 6;  1UE1 A;  2F1M A;  3TN2 A;  3S14 B;  2JA8 G;  2V1C C;  1Y8O B;  4FF3 A;  1QUQ A;  5COY A;  4FF2 A;  3BYY B;  4FF4 A;  1W2B A;  3J7A 5;  3T56 B;  5IIF A;  1B53 A;  1Y1W G;  1V1P B;  1GUS A;  3RZD H;  2QIL A;  2NZO A;  2B2U C;  3URY A;  5M3F B;  1EIG A;  2NBF A;  4LFA Q;  1O7L A;  1VQ7 A;  2PQA A;  1WTW A;  3KFU A;  5C5M A;  4A3D B;  3HFZ B;  4H7B A;  5EBC A;  3TRZ A;  4AIM A;  4A3M B;  2NVT H;  4IFD I;  4E6I A;  1PXU A;  4DGZ A;  3ULL A;  5C0X H;  2MUY A;  3RZO H;  1W3S A;  3QOJ A;  2IW3 A;  2BA0 A;  1YJW A;  3OTO L;  3DEP A;  2K28 A;  4A93 B;  5C0X I;  2BA1 A;  1QB5 D;  3H6M A;  1BBU A;  4Y52 H;  1CUK A;  4DR5 L;  2BDN A;  4BWG B;  4R4Q A;  4DXF A;  1D1K A;  1NCV A;  3MXN B;  5C0X G;  4DXG A;  4DR3 L;  3MA2 B;  1WCM H;  4R8I A;  1T9H A;  2G5D A;  1AW7 A;  1VMC A;  1WFQ A;  2K6A A;  2RA4 A;  4BY1 G;  2K04 A;  4N8X 1;  4LF9 Q;  2R7Z H;  3I4N B;  2JA7 B;  3GP7 A;  1ZKO A;  2ATW A;  3CPW A;  4V0B A;  1AH9 A;  1X9N A;  4CDF C;  3K8A A;  1G51 A;  2IL8 A;  3I55 A;  4IOC A;  3FVQ A;  3U50 C;  1E7Z A;  2RCF A;  2EE1 A;  2YU9 H;  4JYA Q;  3D6C A;  1SNC A;  2Y0S G;  3M3Y B;  1NAP A;  5JEA J;  1QCB D;  2HDL A;  4ZKC B;  3S1N H;  1IL8 A;  4A76 A;  2IX0 A;  2LKV A;  1TWC H;  1A8V A;  2VZA A;  3M4Y A;  2B2U A;  2F0H A;  2HQE A;  3VYT A;  1YJ9 A;  2WFW A;  1YHB A;  3JAM c;  4JI5 Q;  3HOZ G;  4DR5 Q;  2I5H A;  3X3N A;  3HOU B;  1OXU A;  2KUM A;  4FXG C;  3T4A C;  3EBE A;  2HDM A;  3Q6S A;  2Z4I A;  3VR6 A;  5M3M G;  2UUC Q;  4DR4 L;  3CD6 A;  1Y8P B;  4XT1 B;  1Y1V H;  5IWA L;  1ZXT A;  5ISR A;  1G6Z A;  1YNX A;  5IYD G;  3GDE A;  1HNW Q;  2CWP A;  3KJO A;  1T5E A;  1NMG A;  2R7F A;  5CV6 A;  3ERS X;  4A3L G;  4A3I B;  1J6Q A;  4EQ5 A;  1B3A A;  3PO2 G;  4R9W A;  4PZ6 A;  4ZQ3 A;  4BXX G;  5EAY A;  3NTI A;  5IT9 c;  4DNR B;  1YHQ A;  5FLX L;  1LTI D;  2LXJ A;  2MP1 A;  3HGB A;  2F4I A;  3J81 L;  5ELN A;  4GLX A;  1MJC A;  3A74 A;  5C3E G;  4GN3 B;  4OON A;  2VQE L;  4B3T Q;  3I4M B;  4F88 A;  1K3B C;  5AJ3 Q;  3UI2 A;  4RGM A;  1SNQ A;  4L8J A;  4ODG A;  4B3S Q;  2R93 H;  2WAQ G;  3F1Z A;  1QNU A;  1HNZ L;  3BZD B;  5AJ3 L;  3PUW A;  3B6Y A;  3DLL A;  1GO3 E;  1X3Q A;  3KF8 A;  3VA5 A;  4OX9 Q;  1BKB A;  2B8G A;  3E5S A;  1LV9 A;  3N52 A;  3GV6 A;  3JAM i;  4HMJ A;  5HUR A;  4DUY L;  3T1H Q;  3OYY A;  2EYP A;  4DV6 L;  1A0I A;  3NBI A;  4ME5 A;  2B63 G;  1H95 A;  4MN3 A;  1ILQ A;  1K8A C;  2QA4 A;  3R8B A;  3J7Z C;  3S2D B;  1N36 L;  3A5U A;  1KTK A;  2DY7 A;  1EFW A;  2XGT A;  3ND9 A;  3KF6 A;  4N8F A;  4ME3 A;  4Y7N B;  2EY5 A;  3S1R B;  3E0J A;  2HCI A;  1A2U A;  3CQZ B;  3HZX A;  2F0M A;  3FKI H;  4I7A A;  3HOW B;  2B2V C;  3RMH A;  1VQD A;  2JA8 H;  3CU7 A;  1N32 Q;  2ZXR A;  1XMQ L;  3K58 A;  1F9R A;  1HQR D;  4AYB G;  1S5D D;  1N32 L;  3T16 A;  4BS9 A;  3CRK C;  1BXT A;  1BF4 A;  3HOX B;  1EOV A;  2NN6 G;  2L0C A;  4HIO A;  4JG2 A;  4KMU C;  3MEH A;  4P2C B;  3J7A F;  2NVT B;  1FD7 D;  2SOB A;  1HA6 A;  1KAW A;  2UUB Q;  1HRJ A;  1C4Q A;  1KHI A;  4ZUJ A;  3TS2 A;  4H13 C;  3F2U A;  1XJV A;  1L1O B;  1O7Y A;  2F0O A;  3OOC A;  1UE7 A;  3KF8 B;  3PUV A;  2QDB A;  5IGG A;  1QZH A;  5G3L F;  4JI1 Q;  2XSC A;  1XNQ L;  5BR8 Q;  3GTJ B;  2F0P A;  1TS3 A;  5GRO A;  2ZM6 Q;  3AFQ A;  1HXY D;  1N9W A;  1SRU A;  1DOL A;  4KKS A;  3H15 A;  2JA8 B;  2ZJQ A;  2RBM A;  1SNO A;  5IP9 H;  3OWF A;  1IBL Q;  5JJL A;  3LWU A;  2A19 A;  3C2P A;  1BUV T;  4LUZ A;  5D3I B;  3QG1 A;  4JI0 L;  5FLM G;  4K8J A;  3GTJ H;  4XYQ A;  3QIA A;  2BH2 A;  4DUZ L;  4CBV A;  4LUO A;  4QMG A;  1PH3 A;  2HT1 A;  4R4T A;  3KLW A;  4IUT A;  1WTQ A;  1XX8 A;  4QY7 A;  1B9M A;  3LWE A;  3GTL H;  2EY6 A;  4AQY Q;  5ELD A;  5BN4 A;  3S1N B;  4C3I B;  3K5N A;  4DN4 M;  3F2C A;  4BXX H;  2XVS A;  1HCZ A;  3EFX D;  3G71 A;  2EZV A;  3TME A;  2Q8R E;  1YNN C;  4DPG A;  2EYJ A;  1E1T A;  1PZI D;  4DNT B;  4IJH A;  2RHS B;  1SDF A;  3WWV A;  1VQ4 A;  4RA8 A;  4R8N A;  1AE3 A;  1R4P B;  2UUA Q;  3RZD B;  2UXB L;  1GXD C;  1YZ6 A;  4TSS A;  1E2V A;  1E2W A;  1E24 A;  2V4D A;  5IY0 A;  3CCM A;  3CC7 A;  2K4K A;  2M9V A;  1R4Q B;  4KI0 A;  2IY5 B;  1F9Q A;  3KK7 A;  1KNA A;  1DOK A;  3O13 A;  4OGQ C;  1BVS A;  3NBH A;  4ZUI A;  1DYQ A;  2K5N A;  4YY3 L;  5D3D A;  1JOQ A;  1VQK A;  4A3F H;  4CKB A;  2E74 C;  4YWK A;  3TP8 A;  3NEL A;  5JVG 3;  4YY3 Q;  3I4L A;  4B3T L;  2YTV A;  5J22 A;  1UEA B;  5H1S E;  3HKS A;  4B3R Q;  1TWH B;  3Q24 A;  4JI4 Q;  4Y7N H;  1C7Y A;  5C4J B;  4HJ5 A;  2Q8I B;  3W5O A;  1VQH A;  1K0S A;  4DK1 A;  1YHA A;  3HOV B;  3QWN A;  5I6Y A;  1V9P A;  4JYA L;  2OCE A;  5M5Y H;  5CC4 A;  2LMC B;  1U5K A;  3CCV A;  3RLF A;  1Q86 C;  5JAV A;  1XNQ Q;  3L0O A;  5M5W B;  1CT1 D;  3A7L A;  3J81 i;  3L7Z C;  5AFW A;  4JW0 A;  5EPK A;  2N49 A;  3M7G A;  2NVY H;  1EQV A;  1YIJ A;  1K9M C;  2NVX B;  4DV1 Q;  2B63 B;  1H9R A;  1AN8 A;  5F2D A;  1B44 D;  3OWE B;  4DR3 Q;  3DWQ A;  2UU9 L;  4A3C G;  3I4N H;  1WCM G;  4X64 L;  3K6O A;  3NEM A;  2PQA B;  2VQE Q;  3VR3 A;  2EDG A;  2R93 G;  1VQJ A;  2B2W C;  2BCO A;  4JBJ A;  1K28 A;  2LY7 A;  3A8J E;  3PIP A;  2WIN B;  4NPS A;  2A1A A;  2YU9 B;  4XQJ A;  3G4S A;  3UDF A;  2CQA A;  2ZJP A;  1TS2 A;  1AFP A;  3TP7 A;  3KJP A;  1EEI D;  1QVC A;  1VQA A;  5CV8 A;  1N34 Q;  5ELO A;  1KNE A;  5E1F A;  2NWG A;  2XWJ B;  1ET9 A;  4A3I G;  1N8R C;  4C1N I;  2CCZ A;  4HJA A;  5EGT A;  1TWF B;  4RKL A;  2DJF C;  5IYD H;  1SFO B;  2EYL A;  3S2H B;  1KLU D;  2IT1 A;  5ELB A;  2YV5 A;  2L12 A;  2UXC Q;  4BY7 H;  1LO5 D;  1TWC B;  1VQM A;  4K14 A;  1KIX A;  4GOP C;  1G2T A;  3PQI A;  1EWC A;  5E4X A;  3S24 A;  3JAM E;  4DV4 Q;  1DON A;  4KLK A;  2LSS A;  2CH4 W;  4QB4 A;  1BCP C;  3NSW A;  4KY6 A;  1FL0 A;  1LTS D;  1LTG D;  3DEO A;  3SEB A;  4GNX B;  3BZC A;  3FMC A;  4PQX A;  4JI2 Q;  4JV5 Q;  2ZXO A;  1NSN S;  1MSH A;  2F0G A;  3DWA A;  4NMZ A;  3S14 H;  3CCJ A;  2NVQ B;  1WYD A;  5LMN W;  1OTC A;  2PZU A;  5KEE A;  4BBR G;  3QO2 A;  2VNU D;  3FDT A;  1EWI A;  1EZ6 A;  3OIP A;  1SFO H;  3S2H H;  3BU2 A;  1LT6 D;  5IWA Q;  2WB1 G;  2Q2I A;  2EYF A;  3HOZ B;  2F0J A;  1Y1V B;  3K7U C;  1TWG H;  4R1J A;  2DY8 A;  3OW2 A;  3C1F A;  4RH6 A;  2RDG A;  3HKZ E;  3RNU A;  1KAB A;  1IBM L;  4QCL A;  3GTO H;  3I8Z A;  1EIH A;  2Z9H A;  2A69 C;  3IFT A;  2CVR A;  1AP0 A;  4C3I G;  2KEE A;  4OEM B;  5ELF A;  4JI7 Q;  2G9H D;  3CKI B;  2CHB D;  1MKH A;  3RD4 A;  1PTO F;  1X32 A;  2KEN A;  3DWP A;  4A3B H;  4XDX A;  4A93 G;  1LM0 A;  1EYG A;  1ICW A;  3P75 A;  3VYU A;  1P8L A;  2QGQ A;  1K8G A;  5LHY 1;  1IZ6 A;  1Y14 B;  1KD1 C;  2Z1C A;  2L4N A;  3K81 C;  5E7N A;  5KND A;  4ZLT F;  4IO9 A;  1O7I A;  2P5Z X;  5JJI A;  3MFG A;  3M4O H;  3PMF A;  2HIX A;  1SJH D;  4WJ3 M;  4LF6 Q;  1PZK D;  2WB1 E;  1IKM A;  2FJ2 A;  3HS0 C;  2GVB A;  1YVC A;  3K5M A;  5C4H A;  5M9O A;  2L5T A;  1Y1W B;  1I4Q A;  3VDY A;  2CH4 A;  3E0E A;  1EU3 A;  5GAG C;  3H3V C;  2FFK B;  1SBB B;  3UE1 A;  1L1O C;  2O2L D;  3ZJY C;  2F0U A;  4CJ2 C;  1RTN A;  1STA A;  2E75 C;  3M3Y H;  2K32 A;  4X62 L;  4FDB A;  2PZT A;  2KED A;  1S5F D;  3CC2 A;  5C6A A;  5T1G A;  3ULP A;  4DV4 L;  5KNC A;  1LT5 D;  1RD9 D;  1STE A;  2PYK A;  4G7Z C;  5A2Q E;  5DNF A;  1J8I A;  2F0D A;  4P74 A;  4RCO A;  1I50 B;  3EN2 A;  4C3J G;  5C44 G;  1XPR A;  1EUJ A;  2SNS A;  3Q0A A;  4PMB A;  3CCU A;  1ZEQ X;  2BH8 A;  1GOZ A;  3ICE A;  2RCN A;  4X3S A;  1JT8 A;  4EX5 A;  1I3Q B;  1B8A A;  1XYI A;  4K5X A;  4K6L A;  3CC4 A;  3I91 A;  4X6A H;  4LF6 L;  2RQX A;  2KCN A;  3M7N A;  4JI8 Q;  2BDO A;  3KYH C;  4GOP A;  4DV5 Q;  3GTM H;  1HNW L;  1KAA A;  1ROD A;  3HOW G;  2AUJ D;  4ILW A;  1DGS A;  3PGZ A;  2F0T A;  3KBX A;  3STB C;  2PMZ E;  4JI4 L;  4A3B G;  1PH7 A;  3U9S A;  2ZT9 C;  3GTQ B;  5I4D A;  1R9T H;  3L3O C;  1TWG B;  2NZ1 D;  4TQU S;  2WAQ E;  4XT3 B;  1G6P A;  3GD7 A;  3HOY B;  2A6H D;  1S3O A;  4CGY B;  1IBL L;  1D5M C;  4M1U B;  3QB3 A;  4R4I A;  2F0Q A;  4B3M Q;  5IYB H;  2F0N A;  1LTB D;  3R3O A;  2K05 A;  4RGT A;  2R61 A;  3PIO A;  3SK4 A;  2HIV A;  4V19 0;  5JJK A;  4IN3 A;  1D6E C;  3R93 A;  1OXX K;  4DAV A;  1F9P A;  1WTX A;  4OXP A;  1GHK A;  1PDQ A;  5IGC A;  3HOV H;  3A8K E;  4LFB Q;  1VQG A;  5IE8 A;  1EU4 A;  1PYW D;  5CMD A;  2EQS A;  1CSP A;  2K1B A;  4JI6 Q;  1BCP B;  1Z47 A;  1NR2 A;  2OQK A;  5HGT A;  4HMI A;  1MD2 D;  2F3W A;  4ZYS A;  4RGO S;  2A8V A;  3CCL A;  1Q46 A;  1B70 B;  2JN4 A;  1HH2 P;  3UDI A;  1DZ1 A;  1A63 A;  4QUC A;  3I56 A;  1G2S A;  1I4H A;  2PZW A;  1JOO A;  4J1M A;  3TS0 A;  3NHH A;  1SN8 A;  2L1B A;  4J15 A;  1G91 A;  2A68 C;  5C3W A;  1X56 A;  4GNX A;  2EJM A;  3HOX H;  3W1G A;  4BY7 G;  4C3H G;  2WB1 B;  4JBM A;  2JA7 G;  1IW7 D;  1NTG A;  3HP3 A;  3NWS A;  4A3K H;  1SYG A;  4HED A;  3V2T A;  5BN5 A;  4N9T A;  2Y0S B;  1HZ9 A;  3S15 H;  3S17 B;  1QE6 A;  3DHQ A;  2AHO B;  4KN4 C;  2HD3 A;  2K7V A;  2N88 A;  4CDE C;  3J80 i;  1YEZ A;  4HJ9 A;  1BQQ T;  4ZRZ A;  1XTC D;  1A15 A;  4KN7 C;  4YCW A;  1BBX C;  2PCF B;  3J7Y W;  4LFC L;  4A3J B;  5JVH 3;  5IYB G;  1SR3 A;  3NQI A;  1CKO A;  4CJ1 B;  1GKH A;  2BE5 D;  3I4N G;  3MVV A;  2OWO A;  5I9P A;  2GA4 B;  1SNP A;  4DR2 Q;  1K8M A;  1CKN A;  1PTO H;  2QW7 A;  2PNH A;  3BVG A;  3CPF A;  1LYL A;  1D5Z C;  4X62 Q;  1CQF A;  1NNX A;  3HG9 A;  4EQO A;  3OTO Q;  1P16 A;  4RFB A;  2Z6K A;  2F0W A;  4XTC S;  4IOA A;  3PUX A;  1QOH A;  4BBS G;  1W6J A;  1CFM A;  4BBS B;  2IJ0 A;  4DAY B;  2ZM6 L;  2B2Y A;  1Q8I A;  3A7A B;  1WD0 A;  1ZYR C;  2F03 A;  1Y1W H;  5CGK A;  1D2B A;  1LTT D;  1SMX A;  1PYB A;  3BYT B;  4DV6 Q;  1H9S A;  2LFN A;  2HHH L;  5K36 G;  2Y0S E;  4RCN A;  2SNM A;  4DR4 Q;  2K14 A;  3K0X A;  3NEN A;  2I5M X;  2B8F A;  4DV7 Q;  2R7Z B;  4MHE A;  1PH4 A;  4P75 A;  5KRU A;  4RHS A;  1UAP A;  1EL0 A;  3HOX G;  4B3R L;  2CKZ B;  3ER0 A;  2F0K A;  2IHE A;  4AYB B;  3CCE A;  3S1M B;  1WCM B;  4K0K L;  2Z4H A;  1VCI A;  2NTT A;  3T13 A;  1C8C A;  2A5H A;  3E9H A;  4DK3 C;  1B3Q A;  1LUZ A;  1EY8 A;  5FJ8 H;  2KCT A;  1ENF A;  4L5R C;  1BCP F;  1F2L A;  2K75 A;  4PZ7 A;  5D65 A;  1O80 A;  4C2M B;  1B1Z A;  1Y8N B;  3FPP A;  1EY9 A;  3IFD A;  1PMR A;  2B3G A;  3BJU A;  3TZD A;  1WTV A;  4GN4 B;  3NTH A;  4K2L A;  5I6W A;  2ZTC A;  2F52 A;  2QKI C;  4RKB A;  5HGQ A;  5C4J H;  2O5J C;  2UUA L;  4JBK A;  2UXB Q;  4QJF A;  2VB3 X;  1PFB A;  4FXK C;  4JI1 L;  3A54 A;  3NBH B;  4CDC C;  3P1H A;  2FMM A;  5LL6 X;  3SDZ A;  3UDX A;  3X3M A;  2LS0 1;  1LT4 D;  1YIT A;  1EIY B;  4A3G H;  4IUV A;  4L6T B;  2A6E C;  4UP7 A;  3ULJ A;  4X3U A;  4HJ7 A;  2F3I A;  3KDF B;  3FP9 A;  1H9K A;  3KLR A;  2KCC A;  1HTP A;  3ND8 A;  4DR6 Q;  2M00 A;  4PZ8 A;  2EJG C;  2C9O A;  4IUP A;  2VY3 A;  1Q3L A;  4NXN L;  1DD2 A;  1Q12 A;  4FNF A;  1SYF A;  2F0V A;  2LXK A;  2Z6B A;  1EYA A;  1I6V C;  4ZAI A;  5C3E H;  2RDF A;  4K0K Q;  5IP7 G;  4KKU A;  3BG3 A;  3F2B A;  3SR1 A;  1HZA A;  1VQB A;  2YTY A;  1SJE D;  4K6D A;  4FO2 A;  1HNX Q;  1QZG A;  2B2Y C;  5EJW A;  2UXD L;  4LF5 Q;  2K33 A;  4LK1 C;  1I6H B;  3FRP B;  4DU9 A;  1TT2 A;  2F0E A;  2K01 A;  4QGU A;  5BR8 L;  1KC8 C;  3BS1 A;  2JA6 B;  1JJC B;  2JJQ A;  4JI3 L;  3GTL B;  3C3L A;  2AQ2 B;  1HA5 A;  3I3C A;  4HIK A;  1E3P A;  2JSO A;  1JQY D;  2H1E A;  1N34 L;  4X65 Q;  1LLR D;  1GD7 A;  1STG A;  1F2Y A;  2F0S A;  1PH5 A;  1C9O A;  1RDP D;  2K52 A;  1KQS A;  5A2Q L;  4IAL A;  4POF A;  1TU2 B;  3VYR A;  4A3E B;  2EXD A;  3PUY A;  3QOL A;  1ENA A;  3HOZ H;  1WJJ A;  4LJZ C;  1PRT F;  2G9D A;  3NQT A;  3S1Q B;  1I3Q H;  4H0L C;  2OQ0 A;  1WOC A;  2X69 A;  4DV3 Q;  1TII D;  1IYJ B;  3M4Q A;  3CXC A;  2E2I H;  4XQQ A;  3RLO A;  4WOR A;  4TVA B;  3EIV A;  5CBE E;  5K5P A;  4HCS A;  1MI2 A;  3FKI G;  1S5C D;  3J81 j;  2CQO A;  2N8N A;  5T1I A;  3MFY A;  1Q82 C;  3SK6 A;  2WP8 J;  4LFA L;  1D8L A;  2EXZ A;  2NVY B;  2NVX H;  1EY6 A;  1NJI C;  4QQB X;  1J9O A;  2JK8 A;  2KEC A;  1TQO A;  1STH A;  2R7Z G;  2VQF L;  2GVA A;  2K5H A;  4IPD A;  1EY0 A;  2UUC L;  4UAI A;  4LF9 L;  1SYC A;  4BBS H;  4B3M L;  1QVF A;  3KF6 B;  3MAQ A;  1X3P A;  3G6J B;  2EPB A;  5C4X H;  4AYB E;  2VB2 X;  3T53 B;  4TKO B;  2MQH A;  2B2W A;  3D4R A;  3FKI B;  1PH1 A;  2K5V A;  4B3S L;  3HKZ G;  5KNB A;  2O4X A;  3FHW A;  1JE4 A;  1HNZ Q;  3CHB D;  3HKZ B;  4DV0 L;  1H9M A;  2X6L A;  3NK9 A;  4K5W A;  4PMC A;  3AMU A;  4DK6 C;  1KDC A;  1F77 A;  1SE8 A;  1VQE A;  2TMP A;  4O0A A;  2PNR C;  5FO9 B;  4EQP A;  2L11 A;  2K5D A;  3D4D A;  4GS3 A;  4DV2 L;  1CKM A;  2VXW A;  5JEA H;  3T1Y L;  4LF7 Q;  1FGU A;  5M3F G;  3PO3 G;  1HHV A;  1HQM C;  3OPO A;  4KHP Q;  1C48 A;  2XRS D;  4LMQ D;  1WVL A;  1EWH A;  3SGI A;  2ES2 A;  3PV0 A;  2TSS A;  3P7J A;  3A5Z B;  4K8I A;  2JE6 I;  1RHP A;  4HIM A;  1SEB D;  3NP8 A;  3IKJ A;  3MHB A;  4BBR H;  4DAM A;  1Y69 U;  3KDF A;  1I94 Q;  1K3R A;  1VQL A;  4FXD A;  4X66 L;  1PRT D;  1SMY C;  1HZB A;  3TDQ A;  4YIJ A;  4R4O A;  1RIP A;  5DM7 3;  1F2Z A;  1SAP A;  1YNJ C;  2NVQ H;  3K5O A;  3M9B A;  4C3H H;  2A68 D;  2X6G A;  2WAQ B;  1ET6 A;  1GHJ A;  2JP1 A;  1XPO A;  1U4L A;  4HCE A;  1Q1E A;  4RHR A;  4DUZ Q;  1L0Y B;  2KOL A;  4YCU A;  4QIW B;  4IPH A;  4C2M H;  3GTK H;  4P73 A;  1K8O A;  4P72 A;  2PI2 E;  1TWH H;  1STB A;  1IHZ A;  4G57 A;  1LTR D;  1QJO A;  5BN3 A;  4IFD G;  2N55 A;  3WOE A;  1PTO D;  1M8A A;  2MJ8 A;  4DV7 L;  3BVM A;  1O78 A;  1FNU A;  2WV6 D;  1MGS A;  4A3G B;  1JWM D;  2AQ3 B;  1XTD A;  1U9R A;  2AKW B;  2Q2U A;  4LF8 L;  5M3F H;  2DJG C;  1X3F A;  3A55 A;  4YWL A;  1VQI A;  2JA9 A;  1I4R A;  3CAM A;  2Q2H A;  3J81 c;  3HOY G;  4EGV A;  3PO3 H;  2ZXP A;  4C1N K;  1YJN A;  1H9S B;  3BVZ A;  4OHJ A;  1L0W A;  1I5F A;  1TY0 A;  3Q23 A;  3U9O A;  5FLX E;  4QUF A;  1BBW A;  5IP7 H;  4FVM A;  5FLX c;  1VQ8 A;  1JJG A;  1CI3 M;  1TXY A;  2F4V Q;  1NMF A;  3OW7 A;  4LAA A;  5IOC A;  4F7X A;  5M5X B;  1RL2 A;  2Z0S A;  3FPU B;  2K5W A;  2A73 B;  2N3S A;  3SVM A;  3K80 C;  1TKW B;  2J0T D;  1G8Z D;  3I72 A;  1H9J A;  3M4O B;  1TR5 A;  5C4X G;  4Q0F A;  5FOB B;  2PPB C;  5KIX A;  4UP8 A;  4APV A;  1I94 L;  1WTH A;  3MXN A;  2E5L Q;  4XQN A;  3I4O A;  1IKL A;  2I5L X;  4HN7 A;  1CKN B;  2YYZ A;  4KJO A;  4NXM L;  5EKK A;  2DN8 A;  1A6X A;  2WKD A;  1XWE A;  4PV1 C;  5C44 B;  2N78 A;  2KHS A;  1J5E Q;  1T5X D;  3TRE A;  3G6E A;  1FJG L;  1GJX A;  1JCK B;  1CA5 A;  1PFN A;  4JI3 Q;  1MJE A;  2ZTE A;  1QWY A;  1VF5 C;  2EYO A;  5JOB A;  5CV7 A;  1ONL A;  4DUY Q;  1HUM A;  1KDB A;  3T1H L;  1PHJ A;  4OX9 L;  2SDF A;  4OO1 I;  3V96 A;  1PFM A;  2ICE C;  2YTX A;  1HNX L;  1EQT A;  3VR2 A;  5C4X B;  1RJT A;  5C44 H;  2RVL A;  5EKL A;  5DM6 3;  1V1P A;  4U67 3;  3S16 B;  1KRT A;  1B2T A;  3P20 A;  4AH6 A;  4JI0 Q;  3F2D A;  1Q7Y C;  5IT9 E;  4WFN 3;  1UWV A;  3HOU H;  2PW7 A;  1XNR Q;  1QUQ B;  1DJR D;  3BDL A;  3MZ5 A;  1N33 Q;  2HCC A;  4KD4 A;  1CHP D;  1ENC A;  5DAU A;  5J3B A;  4A3M G;  1CM9 A;  1CZG A;  3GTQ H;  5K36 H;  3NXW A;  3MTS A;  2XWB B;  1M4V A;  5IT9 L;  4X66 Q;  1Q90 A;  2PMZ B;  3BDC A;  5CV9 A;  3D6W A;  4IUR A;  5EKI A;  1PV4 A;  5JJZ A;  2EYM A;  1MBY A;  1M90 C;  3PO2 B;  1OXS C;  3CP0 A;  4IQZ A;  4A4I A;  3GTG B;  2WKC A;  1J5E L;  3CCQ A;  2QEX A;  1VQ5 A;  1GUT A;  2OTJ A;  1MIU A;  2MHV A;  1VQ6 A;  3D3R A;  1CQV A;  1XMO L;  3BZK A;  2VS1 A;  2B63 H;  3AYH B;  3RUZ A;  3DXJ C;  1TY2 A;  4HJ8 A;  2A74 C;  1K83 B;  3E9I A;  1CA6 A;  4X3T A;  1JOR A;  4JOI C;  2Z8L A;  4A93 H;  4YHH L;  1BCP D;  2NUC A;  4HAE A;  4XYO A;  4DKA C;  5A35 A;  4X64 Q;  1B4O A;  4C56 C;  4L5S A;  4DK0 A;  4OEL B;  4ULL A;  2E2J B;  4BY7 B;  2F4V L;  4A3J G;  4G7O C;  1JC7 A;  2JA5 H;  3C1E A;  4A3E G;  4MTK A;  1D5X C;  2EY2 A;  3D31 A;  1NR4 A;  1IL2 A;  1DOM A;  1EY4 A;  1HR0 Q;  1K83 H;  1VF7 A;  2R3Z A;  3MC0 B;  1B50 A;  2XRQ D;  1STY A;  2F0L A;  3MWY W;  3PO2 H;  4KY7 A;  1PZJ D;  4J6H A;  4RGN A;  1X3E A;  4DFA A;  2VW9 A;  4DR1 L;  3R2T A;  3GO5 A;  1JOK A;  2RHQ B;  1IBK Q;  1EFI D;  4M8A A;  1JB7 A;  4GKK L;  4DR1 Q;  1VQ9 A;  2OT2 A;  1SYB A;  1Y1V G;  3LNN A;  3CRL C;  4I65 A;  4MNO A;  3PO3 B;  1ASZ A;  2EJF C;  4GKJ L;  2B29 A;  3OIQ A;  5LMN L;  3CCR A;  2Q2T A;  5FJ8 G;  4CDD C;  3ERQ A;  4GOP B;  2H5X A;  2UUB L;  1QG7 A;  4O42 A;  4IFD H;  4DV3 L;  2DGY A;  4FF1 A;  3ONA B;  3S9W A;  3SE0 A;  1VQF A;  4HR7 B;  1S40 A;  1PTO B;  1RF2 D;  4MIU A;  2Q8T A;  4RAU C;  4QL5 A;  4UPA A;  3I90 A;  4GLA C;  4IJL A;  3KUP A;  2ICI A;  3WDN A;  1PH6 A;  2E2D C;  4HSP A;  4IFD J;  4PMW A;  5IYC H;  1TWA H;  2KBN A;  4QF4 A;  5FKA C;  3KBG A;  3D4W A;  1SND A;  2R7D A;  5LL6 S;  2GN5 A;  3KLS X;  2D2C C;  4A3D G;  5E4W C;  1LAC A;  5M5X H;  3N6R A;  1E0B A;  4F87 A;  3I2Z A;  1N36 Q;  2B2T C;  1U4M A;  1PVO A;  5IGD A;  2DNE A;  4A3K B;  1SLJ A;  1EQQ A;  4O1N A;  1HFG A;  4BA2 I;  2RDH A;  4JV5 L;  4KTA A;  4PNY A;  5TSS A;  1HR0 L;  5EPL A;  3S17 H;  1HFN A;  1CHQ D;  3S1R H;  1FYC A;  1N33 L;  3H3V H;  1DM0 B;  1NUC A;  5EPJ A;  3KLS A;  1UE6 A;  3TZU A;  4NXN Q;  1OXV A;  2I07 B;  1CTM A;  2NZH A;  4LWC A;  1B7Y B;  4A3B B;  4DR7 L;  1L1O A;  4DF7 A;  3SK8 A;  4K2K A;  1WTO A;  1WD1 A;  3EJI A;  1PLF A;  1V1O A;  1R9T B;  4JVZ A;  4OWW B;  3SK5 A;  2JXM B;  2SEB D;  3HOW H;  2EIF A;  4OL7 A;  1GUO A;  3IL8 A;  1QVG A;  1YNN D;  3HOY H;  1TWF H;  4XIG S;  1EEF D;  3J80 E;  4TRD A;  1V8Q A;  3CME A;  4G7H C;  1PFS A;  4JBW A;  2D5D A;  1U4R A;  3S2D H;  4OIJ A;  3CF5 A;  3KOJ A;  3W3A A;  1UNS A;  2JA7 H;  3J81 E;  2IX3 A;  4BA1 I;  1BO0 A;  5G3L D;  5IGF A;  2HUG A;  4A3D H;  4A3K G;  1JJ2 A;  3CQZ H;  1YBY A;  3S16 H;  4LUV A;  4IPC A;  2QCP X;  4JPB W;  1NY4 A;  3K57 A;  1Q8K A;  5ELE A;  2VUM G;  2RSO A;  2OXP A;  1MSG A;  1JWS D;  1FVI A;  4Q5V A;  4JI5 L;  1OO9 B;  1V43 A;  2D0O A;  2ZTD A;  3QJY A;  3K59 A;  3PCO B;  4LFC Q;  3K5L A;  1A3V A;  2IPK D;  3H0G H;  2EOT A;  3MXU A;  4NW2 A;  1GVP A;  5LMN Q;  2KHI A;  3PF4 A;  3OMG A;  5FK9 C;  4A75 A;  2HHH Q;  1S4Z A;  2QF7 A;  3K0Y A;  1Q1B A;  2KA7 A;  3K7A H;  2XTI A;  1IBK L;  3K7A B;  1JE5 A;  1EYD A;  4JI8 L;  3BDO A;  4LF8 Q;  1EZ8 A;  2E2H B;  4RMF A;  1VMP A;  3M85 A;  1AZP A;  4LF5 L;  1X54 A;  3AB9 A;  4H02 A;  1X6O A;  1PH2 A;  1DCZ A;  3VR4 A;  3I4M H;  2ID0 A;  1I4X A;  4EVO A;  4A3E H;  3NWT A;  1D1I A;  4BBR B;  3H3V I;  4MTN A;  2KQ3 A;  4C3I H;  4BY1 H;  3CCS A;  4GLV B;  1NE3 A;  2QDL A;  5FLM H;  3GTK B;  2C35 B;  5FO8 B;  2AMC B;  1JR0 D;  1S5B D;  2E2H H;  1X65 A;  4DA2 A;  2RKS A;  2MO1 A;  4EQN A;  3UE0 A;  4QIW E;  1AEX A;  3TQY A;  1PH8 A;  3V05 A;  2JA6 H;  4ZKB B;  5E3F A;  1XMO Q;  1VS0 A;  5I2X A;  3Q8D A;  4MZ9 A;  4JK1 C;  5FO7 B;  2JQO A;  1I4G A;  4OWT B;  1PRT B;  4P71 A;  4LFB L;  4L5Q A;  3ZYY X;  1XXG A;  3NTK A;  3GTO B;  1LTL A;  5HY6 A;  2FHT A;  4LF7 L;  3NE5 B;  3U4Z A;  1SXT A;  2E2I B;  4KHP L;  3RZO B;  4LW1 A;  3T51 B;  4I7Z C;  2ZJR A;  1HZC A;  2ASB A;  1IXR A;  2OTL A;  1ASY A;  3LX0 A;  3EQL C;  4NP5 A;  3S1Q H;  1HUN A;  5KYI A;  3CW2 C;  2NN6 I;  3G7L A;  3MXP A;  5CV5 A;  2L15 A;  4C3J H;  1ESF A;  1YI2 A;  4IUU A;  2KHJ A;  4JI7 L;  2NN6 H;  1Z9F A;  1CK1 A;  4X3K A;  1JIC A;  5KGU A;  1L2F A;  3A0J A;  3J80 c;  1IYU A;  1I4P A;  4YHH Q;  2R92 G;  3JAM L;  3AEV A;  1KL9 A;  3A8I E;  2VL6 A;  4DAY A;  1PTO C;  4HID A;  1WTR A;  1SSO A;  2JA5 B;  4ZCK A;  2NTS A;  4KK7 A;  3G48 A;  3A56 A;  1ZYR D;  2XNA C;  3GTM B;  1UUP A;  3S1M H;  1KRS A;  1S72 A;  1K73 C;  2FXQ A;  1Q81 C;  4ZK9 B;  4KD3 A;  4G4K A;  3DM3 A;  2RSN A;  2M2L A;  3NPP A;  4J8Q A;  2F0F A;  2K03 A;  3Q22 A;  5J1Z A;  1BR9 A;  3L9A X;  2F0I A;  2MGS A;  4HTH A;  4WJW A;  4JOI A;  1SNM A;  4C3H B;  2R92 B;  1Z6H A;  5JPM C;  4AQY L;  1LT3 D;  1V1Q A;  3HEJ A;  1AZQ A;  3TP5 A;  2OEO A;  3TBI B;  3SXH A;  4IUQ A;  2O5I C;  3AFP A;  3F8T A;  4DR2 L;  5DLQ E;  3TP6 A;  4ID6 A;  3TEH B;  3U58 A;  5ELC A;  3GTP B;  4KHV A;  2MNA A;  3AU7 A;  1S5E D;  2NYZ D;  2AWN A;  4XXE A;  5JPN C;  1ML0 D;  5C0X J;  1ESR A;  3ITP A;  3W1B A;  3I4M G;  3L2P A;  5CYU A;  3LGJ A;  4X65 L;  5C3E B;  3W2D A;  1BDO A;  3VA7 A;  4K5V A;  1SRO A;  4IUN A;  4DV5 L;  4R4C A;  5C3X A;  2F3V A;  4ABN A;  4YCV A;  4GKK Q;  4A3L H;  4KV6 A;  3T1Y Q;  3WOF A;  2AUK A;  4DAP A;  3SHL A;  3I70 A;  1QNK A;  4RWS C;  4NXM Q;  2ALY B;  2UXD Q;  3J80 L;  2PW5 A;  5GAE C;  4DR7 Q;  1A62 A;  1KLG D;  2D62 A;  1SYD A;  2KVM A;  4IZ8 A;  4UP9 A;  1M1K C;  1W6K A;  4YWM A;  4OWX B;  1SE2 A;  3H94 A;  5DEH A;  2IWH A;  1II3 A;  2E2J H;  2I46 A;  2B2V A;  2B2T A;  1HJP A;  1RKN A;  1A2T A;  3UDG A;  2EY1 A;  5C4Z A;  2A69 D;  1I6H H;  4NB3 A;  1XMQ Q;  2L55 A;  5GAH C;  2KCM A;  4A3F B;  1GUN A;  5EQ0 A;  2XN9 C;  2E76 C;  3DUZ A;  5J39 A;  4DR6 L;  1A3U A;  1CZW A;  2EYH A;  1NBW A; 
#chains in the Genus database with same CATH homology
 5KYL A;  3TSS A;  3S15 B;  1DXM A;  3H91 A;  3NUC A;  2NB0 A;  1F9S A;  1LAB A;  2D9U A;  1SE3 A;  4L63 B;  2PO4 A;  3OMC A;  2XIW A;  2R6G A;  1Z7T A;  1FGB D;  5JEA G;  1FNW A;  1GUG A;  2A6E D;  4GZY C;  2BOS A;  2JEB I;  2J4X A;  3ERO A;  4Z9C B;  5IGB A;  3E6Z X;  5IOD A;  2CW0 C;  2ENB A;  2OF1 A;  4S3S A;  4WRD A;  1O7Z A;  4NDX A;  3OSO A;  2EVB A;  2J7Z A;  2VUM B;  1STN A;  2AQ1 B;  3PUZ A;  4FP5 D;  5COR A;  4OIK A;  2H4O A;  2JYO A;  5CR3 A;  1TWA B;  1TS4 A;  4NKL A;  1GUW A;  4U68 A;  4KJN A;  1EY7 A;  1JWU D;  3VYS A;  3GV3 A;  2QEJ C;  2B39 A;  2WII B;  3PIP 3;  2CW0 D;  4F8M A;  5D14 A;  1EOT A;  1BOS A;  1JB3 A;  1FNV A;  4B08 A;  2MPM A;  3DMU A;  4HSV A;  1L0X B;  1IYV A;  3H0G B;  4CJ0 B;  3EA6 A;  2A6H C;  1ILP A;  4CHT B;  3C46 A;  1LTA D;  2FMC A;  2KJX A;  1A3T A;  4FYD A;  5M5Y B;  3H09 A;  2WAC A;  3FEW X;  3EVQ A;  4OO1 H;  1HTL D;  1BNZ A;  4KKT A;  1RCV D;  1FR3 A;  3HRZ C;  1EYC A;  5CV4 A;  1VDZ A;  3DM1 A;  4N9P A;  3VR5 A;  4B9X A;  4H44 C;  2C5C A;  1E2Z A;  3GQB A;  2K5Q A;  1HPC A;  1YNJ D;  5I2Y A;  1F2M A;  2FIN B;  1B9N A;  1PRT C;  1SMY D;  2PQE A;  3IAY A;  2L9H A;  2JEA I;  1OXT A;  1TVX A;  4KY5 A;  1IW7 C;  4KHZ A;  1RTO A;  3I73 A;  1SYE A;  3R2I A;  3MXG A;  4UDU C;  5I9O A;  1KDA A;  3OHX C;  1G29 1;  2IX1 A;  1WTP A;  1EY5 A;  3D8G A;  2DNC A;  5EBD A;  5C5L A;  5M3M B;  3J7A V;  4OO1 G;  1SE4 A;  5NUC A;  4C3J B;  1QIL A;  1U4P A;  4CKE A;  4B9W A;  5IGE A;  2R93 B;  4CKC A;  2BE5 C;  3PIO 3;  4BY1 B;  2AWO A;  1TS5 A;  5CBA E;  2F1M A;  3TN2 A;  3S14 B;  1Y8O B;  4FF3 A;  5COY A;  4FF2 A;  3BYY B;  4FF4 A;  3T56 B;  5IIF A;  1B53 A;  1V1P B;  1GUS A;  2QIL A;  3URY A;  2B2U C;  5M3F B;  1EIG A;  2NBF A;  1O7L A;  1WTW A;  5C5M A;  4A3D B;  4H7B A;  5EBC A;  4A3M B;  4IFD I;  4E6I A;  1PXU A;  4DGZ A;  5C0X H;  2MUY A;  3QOJ A;  2IW3 A;  2BA0 A;  3DEP A;  2K28 A;  4A93 B;  5C0X I;  2BA1 A;  1QB5 D;  3H6M A;  2BDN A;  4BWG B;  4DXF A;  1D1K A;  1NCV A;  5C0X G;  4DXG A;  3MA2 B;  4R8I A;  1AW7 A;  1VMC A;  2K6A A;  2RA4 A;  2K04 A;  3I4N B;  2JA7 B;  3GP7 A;  1ZKO A;  4V0B A;  2IL8 A;  3FVQ A;  2EE1 A;  3D6C A;  1SNC A;  3M3Y B;  1NAP A;  5JEA J;  1QCB D;  2HDL A;  4ZKC B;  1IL8 A;  2IX0 A;  2LKV A;  3VYT A;  2B2U A;  2F0H A;  3M4Y A;  2HQE A;  3X3N A;  3HOU B;  1OXU A;  2KUM A;  4FXG C;  3T4A C;  2HDM A;  3Q6S A;  2Z4I A;  3VR6 A;  1Y8P B;  4XT1 B;  1ZXT A;  5ISR A;  1G6Z A;  1T5E A;  5CV6 A;  4A3I B;  1B3A A;  4R9W A;  4ZQ3 A;  3NTI A;  4DNR B;  5FLX L;  1LTI D;  2MP1 A;  3HGB A;  2F4I A;  3J81 L;  3I4M B;  4F88 A;  3UI2 A;  4RGM A;  1SNQ A;  4L8J A;  4ODG A;  1QNU A;  3BZD B;  3PUW A;  1X3Q A;  3KF8 A;  3VA5 A;  2B8G A;  3E5S A;  1LV9 A;  3N52 A;  3GV6 A;  4HMJ A;  5HUR A;  2EYP A;  4ME5 A;  3NBI A;  4MN3 A;  1ILQ A;  3R8B A;  3S2D B;  1KTK A;  2DY7 A;  3ND9 A;  4Y7N B;  2EY5 A;  3S1R B;  3E0J A;  2HCI A;  1A2U A;  3CQZ B;  3HZX A;  2F0M A;  3HOW B;  2B2V C;  3RMH A;  3CU7 A;  2ZXR A;  3K58 A;  1F9R A;  1HQR D;  1S5D D;  3T16 A;  4BS9 A;  3CRK C;  1BXT A;  1BF4 A;  3HOX B;  2NN6 G;  2L0C A;  4KMU C;  3MEH A;  4P2C B;  3J7A F;  2NVT B;  1FD7 D;  2SOB A;  1HA6 A;  1HRJ A;  1C4Q A;  4ZUJ A;  4H13 C;  3F2U A;  1O7Y A;  2F0O A;  3OOC A;  3PUV A;  2QDB A;  5IGG A;  5G3L F;  2XSC A;  3GTJ B;  2F0P A;  1TS3 A;  1HXY D;  1DOL A;  4KKS A;  2JA8 B;  2RBM A;  1SNO A;  3OWF A;  3LWU A;  3C2P A;  1BUV T;  5D3I B;  3QG1 A;  4K8J A;  4XYQ A;  3QIA A;  4CBV A;  4QMG A;  4IUT A;  1WTQ A;  1XX8 A;  1B9M A;  3LWE A;  2EY6 A;  5ELD A;  5BN4 A;  3S1N B;  4C3I B;  3K5N A;  4DN4 M;  2XVS A;  1HCZ A;  3EFX D;  2EZV A;  3TME A;  2Q8R E;  1YNN C;  2EYJ A;  1PZI D;  4DNT B;  1SDF A;  4RA8 A;  4R8N A;  1R4P B;  3RZD B;  1GXD C;  4TSS A;  1E2V A;  1E2W A;  2V4D A;  2M9V A;  1R4Q B;  4KI0 A;  1F9Q A;  3KK7 A;  1KNA A;  1DOK A;  3O13 A;  4OGQ C;  3NBH A;  4ZUI A;  1DYQ A;  1JOQ A;  5D3D A;  4CKB A;  2E74 C;  3TP8 A;  5JVG 3;  3I4L A;  5J22 A;  1UEA B;  1TWH B;  3Q24 A;  5C4J B;  2Q8I B;  4DK1 A;  3HOV B;  3QWN A;  5I6Y A;  5CC4 A;  2LMC B;  3RLF A;  5JAV A;  5M5W B;  1CT1 D;  3A7L A;  3L7Z C;  5AFW A;  5EPK A;  3M7G A;  2NVX B;  1EQV A;  2B63 B;  1H9R A;  1AN8 A;  5F2D A;  1B44 D;  3OWE B;  3DWQ A;  3K6O A;  3VR3 A;  2EDG A;  2B2W C;  2BCO A;  2LY7 A;  3A8J E;  2WIN B;  2YU9 B;  4XQJ A;  2CQA A;  1TS2 A;  1AFP A;  3TP7 A;  1EEI D;  5CV8 A;  1KNE A;  5E1F A;  2NWG A;  2XWJ B;  1ET9 A;  4C1N I;  5EGT A;  1TWF B;  4RKL A;  1SFO B;  2EYL A;  3S2H B;  1KLU D;  2IT1 A;  5ELB A;  2L12 A;  1LO5 D;  1TWC B;  4K14 A;  1G2T A;  1EWC A;  5E4X A;  3JAM E;  1DON A;  4QB4 A;  1BCP C;  3NSW A;  4KY6 A;  1LTS D;  3DEO A;  1LTG D;  3SEB A;  3FMC A;  4PQX A;  2ZXO A;  1NSN S;  1MSH A;  2F0G A;  3DWA A;  4NMZ A;  2NVQ B;  2PZU A;  5KEE A;  3QO2 A;  2VNU D;  3FDT A;  1EZ6 A;  3OIP A;  1LT6 D;  2EYF A;  3HOZ B;  2F0J A;  1Y1V B;  2DY8 A;  3C1F A;  4RH6 A;  2RDG A;  1KAB A;  4QCL A;  3I8Z A;  1EIH A;  2A69 C;  3IFT A;  2CVR A;  1AP0 A;  4C3I G;  2KEE A;  5ELF A;  2G9H D;  3CKI B;  2CHB D;  3RD4 A;  1PTO F;  1X32 A;  3DWP A;  4XDX A;  1ICW A;  3P75 A;  3VYU A;  5LHY 1;  2Z1C A;  2L4N A;  5KND A;  4ZLT F;  3MFG A;  3PMF A;  1SJH D;  1PZK D;  1IKM A;  2FJ2 A;  3HS0 C;  3K5M A;  5C4H A;  5M9O A;  2L5T A;  1Y1W B;  1I4Q A;  1EU3 A;  3H3V C;  2FFK B;  1SBB B;  2O2L D;  2F0U A;  4CJ2 C;  1RTN A;  1STA A;  2E75 C;  2K32 A;  2PZT A;  2KED A;  1S5F D;  5C6A A;  5T1G A;  5KNC A;  1LT5 D;  1RD9 D;  1STE A;  2PYK A;  4G7Z C;  5A2Q E;  5DNF A;  1J8I A;  2F0D A;  4RCO A;  1I50 B;  4C3J G;  2SNS A;  3Q0A A;  4PMB A;  1ZEQ X;  1GOZ A;  4X3S A;  1XYI A;  1I3Q B;  4K5X A;  4K6L A;  3I91 A;  2RQX A;  2KCN A;  3M7N A;  2BDO A;  1KAA A;  1ROD A;  2AUJ D;  4ILW A;  2F0T A;  3KBX A;  3U9S A;  2ZT9 C;  3GTQ B;  5I4D A;  3L3O C;  1TWG B;  2NZ1 D;  4TQU S;  4XT3 B;  3GD7 A;  3HOY B;  2A6H D;  4CGY B;  1D5M C;  4M1U B;  3QB3 A;  2F0Q A;  2F0N A;  1LTB D;  3R3O A;  2K05 A;  4RGT A;  2R61 A;  3SK4 A;  4V19 0;  4IN3 A;  1D6E C;  3R93 A;  1OXX K;  4DAV A;  1F9P A;  1WTX A;  1GHK A;  1PDQ A;  5IGC A;  3A8K E;  1EU4 A;  1PYW D;  5CMD A;  2K1B A;  1BCP B;  1Z47 A;  1NR2 A;  5HGT A;  4HMI A;  1MD2 D;  2F3W A;  4ZYS A;  4RGO S;  1DZ1 A;  4QUC A;  1G2S A;  1I4H A;  2PZW A;  1JOO A;  4J1M A;  3NHH A;  2L1B A;  1G91 A;  5C3W A;  2A68 C;  2EJM A;  4C3H G;  2WB1 B;  1IW7 D;  3HP3 A;  3NWS A;  1SYG A;  4HED A;  3V2T A;  5BN5 A;  4N9T A;  2Y0S B;  3S17 B;  1QE6 A;  3DHQ A;  4KN4 C;  2K7V A;  2N88 A;  1BQQ T;  4ZRZ A;  1XTC D;  1A15 A;  4KN7 C;  1BBX C;  2PCF B;  3J7Y W;  4A3J B;  5JVH 3;  3NQI A;  4CJ1 B;  2BE5 D;  3MVV A;  5I9P A;  2GA4 B;  1SNP A;  1K8M A;  1PTO H;  3BVG A;  1D5Z C;  1CQF A;  3HG9 A;  4EQO A;  4RFB A;  2F0W A;  4XTC S;  3PUX A;  1QOH A;  1W6J A;  1CFM A;  4BBS B;  2IJ0 A;  2B2Y A;  1Q8I A;  3A7A B;  1WD0 A;  1ZYR C;  2F03 A;  5CGK A;  1D2B A;  1LTT D;  3BYT B;  1H9S A;  2LFN A;  5K36 G;  4RCN A;  2SNM A;  2B8F A;  2R7Z B;  4MHE A;  5KRU A;  4RHS A;  1UAP A;  1EL0 A;  2F0K A;  4AYB B;  3S1M B;  1WCM B;  2Z4H A;  1VCI A;  2NTT A;  3T13 A;  1C8C A;  2A5H A;  1EY8 A;  1ENF A;  1BCP F;  1F2L A;  5D65 A;  1O80 A;  4C2M B;  1B1Z A;  1Y8N B;  3FPP A;  1EY9 A;  3IFD A;  1PMR A;  3TZD A;  1WTV A;  3NTH A;  4K2L A;  5I6W A;  2QKI C;  4RKB A;  2O5J C;  2VB3 X;  1PFB A;  4FXK C;  3A54 A;  3P1H A;  2FMM A;  5LL6 X;  3SDZ A;  3X3M A;  2LS0 1;  1LT4 D;  4IUV A;  4L6T B;  2A6E C;  4X3U A;  1H9K A;  3KLR A;  2KCC A;  1HTP A;  3ND8 A;  2M00 A;  2EJG C;  2C9O A;  4IUP A;  1Q3L A;  1DD2 A;  1Q12 A;  4FNF A;  1SYF A;  2F0V A;  1EYA A;  1I6V C;  4ZAI A;  2RDF A;  4KKU A;  3BG3 A;  3SR1 A;  1SJE D;  4K6D A;  4FO2 A;  2B2Y C;  5EJW A;  2K33 A;  4LK1 C;  1I6H B;  3FRP B;  4DU9 A;  1TT2 A;  2F0E A;  2K01 A;  2JA6 B;  3BS1 A;  3GTL B;  3C3L A;  2AQ2 B;  1HA5 A;  3I3C A;  2JSO A;  1JQY D;  2H1E A;  1LLR D;  1STG A;  1F2Y A;  2F0S A;  1RDP D;  5A2Q L;  4IAL A;  1TU2 B;  3VYR A;  4A3E B;  3PUY A;  3QOL A;  1ENA A;  4LJZ C;  1PRT F;  2G9D A;  3NQT A;  3S1Q B;  4H0L C;  2X69 A;  1TII D;  4XQQ A;  4WOR A;  5CBE E;  5K5P A;  4HCS A;  1MI2 A;  1S5C D;  5T1I A;  3MFY A;  3SK6 A;  2WP8 J;  2EXZ A;  2NVY B;  1EY6 A;  1J9O A;  2KEC A;  1TQO A;  1STH A;  1EY0 A;  4UAI A;  1SYC A;  3MAQ A;  1X3P A;  3G6J B;  2EPB A;  2VB2 X;  3T53 B;  4TKO B;  2B2W A;  3D4R A;  3FKI B;  5KNB A;  2O4X A;  1JE4 A;  3CHB D;  3HKZ B;  1H9M A;  4PMC A;  2X6L A;  3NK9 A;  4K5W A;  3AMU A;  1KDC A;  1F77 A;  2TMP A;  2PNR C;  5FO9 B;  4EQP A;  2L11 A;  2K5D A;  3D4D A;  2VXW A;  5JEA H;  1HHV A;  1HQM C;  3OPO A;  1C48 A;  2XRS D;  4LMQ D;  1WVL A;  1EWH A;  3PV0 A;  2TSS A;  3P7J A;  4K8I A;  2JE6 I;  1RHP A;  1SEB D;  3NP8 A;  3IKJ A;  3MHB A;  1Y69 U;  4FXD A;  1PRT D;  1SMY C;  3TDQ A;  4YIJ A;  5DM7 3;  1F2Z A;  1SAP A;  1YNJ C;  3K5O A;  2A68 D;  2X6G A;  2WAQ B;  1ET6 A;  1GHJ A;  2JP1 A;  1U4L A;  4HCE A;  1Q1E A;  4RHR A;  1L0Y B;  2KOL A;  4QIW B;  1K8O A;  1STB A;  1IHZ A;  4G57 A;  1LTR D;  1QJO A;  5BN3 A;  4IFD G;  2N55 A;  3WOE A;  1PTO D;  1M8A A;  2MJ8 A;  3BVM A;  1O78 A;  1FNU A;  2WV6 D;  1MGS A;  4A3G B;  1JWM D;  2AQ3 B;  1U9R A;  3A55 A;  1I4R A;  4EGV A;  2ZXP A;  4C1N K;  1H9S B;  3BVZ A;  4OHJ A;  1TY0 A;  3Q23 A;  3U9O A;  5FLX E;  4QUF A;  4FVM A;  1CI3 M;  4LAA A;  3OW7 A;  5IOC A;  4F7X A;  5M5X B;  3FPU B;  2K5W A;  2A73 B;  3SVM A;  1TKW B;  2J0T D;  1G8Z D;  3I72 A;  1H9J A;  3M4O B;  1TR5 A;  4Q0F A;  5FOB B;  2PPB C;  5KIX A;  3MXN A;  4XQN A;  1IKL A;  4HN7 A;  2YYZ A;  4KJO A;  5EKK A;  2DN8 A;  1A6X A;  2WKD A;  1XWE A;  4PV1 C;  5C44 B;  2KHS A;  1T5X D;  1GJX A;  1JCK B;  1CA5 A;  1PFN A;  5JOB A;  1QWY A;  1VF5 C;  2EYO A;  5CV7 A;  1ONL A;  1HUM A;  1KDB A;  2SDF A;  4OO1 I;  3V96 A;  1PFM A;  2ICE C;  5C4X B;  1EQT A;  3VR2 A;  1RJT A;  2RVL A;  5EKL A;  5DM6 3;  1V1P A;  4U67 3;  3S16 B;  1B2T A;  3P20 A;  5IT9 E;  4WFN 3;  2PW7 A;  1DJR D;  3BDL A;  3MZ5 A;  2HCC A;  4KD4 A;  1CHP D;  1ENC A;  5DAU A;  1CM9 A;  1CZG A;  5K36 H;  3NXW A;  3MTS A;  2XWB B;  1M4V A;  5IT9 L;  1Q90 A;  2PMZ B;  3BDC A;  5CV9 A;  3D6W A;  4IUR A;  5EKI A;  5JJZ A;  2EYM A;  1MBY A;  3PO2 B;  1OXS C;  4IQZ A;  3GTG B;  2WKC A;  1GUT A;  2MHV A;  3D3R A;  1CQV A;  3RUZ A;  3DXJ C;  1TY2 A;  2A74 C;  1K83 B;  1CA6 A;  4X3T A;  1JOR A;  2Z8L A;  1BCP D;  2NUC A;  4HAE A;  4XYO A;  5A35 A;  1B4O A;  4C56 C;  4DK0 A;  4ULL A;  2E2J B;  4BY7 B;  4G7O C;  1JC7 A;  3C1E A;  1D5X C;  2EY2 A;  3D31 A;  1NR4 A;  1DOM A;  1EY4 A;  1B50 A;  1VF7 A;  2R3Z A;  3MC0 B;  2XRQ D;  1STY A;  2F0L A;  3MWY W;  4KY7 A;  1PZJ D;  4J6H A;  4RGN A;  4DFA A;  3R2T A;  3GO5 A;  1JOK A;  1EFI D;  4M8A A;  2OT2 A;  1SYB A;  3LNN A;  3CRL C;  4I65 A;  3PO3 B;  2EJF C;  3OIQ A;  3ERQ A;  1QG7 A;  4O42 A;  4IFD H;  4FF1 A;  3ONA B;  3S9W A;  3SE0 A;  4HR7 B;  1PTO B;  1RF2 D;  4MIU A;  2Q8T A;  4RAU C;  3I90 A;  3KUP A;  2ICI A;  3WDN A;  2E2D C;  4HSP A;  4IFD J;  4PMW A;  4QF4 A;  5FKA C;  3KBG A;  3D4W A;  1SND A;  5LL6 S;  3KLS X;  2D2C C;  5E4W C;  1LAC A;  3N6R A;  1E0B A;  4F87 A;  2B2T C;  1U4M A;  5IGD A;  2DNE A;  4A3K B;  4O1N A;  1HFG A;  4BA2 I;  2RDH A;  4KTA A;  4PNY A;  5TSS A;  5EPL A;  1HFN A;  1CHQ D;  1FYC A;  1DM0 B;  1NUC A;  5EPJ A;  3KLS A;  3TZU A;  1OXV A;  2I07 B;  1CTM A;  4A3B B;  4DF7 A;  3SK8 A;  4K2K A;  1WTO A;  1WD1 A;  3EJI A;  1PLF A;  1V1O A;  1R9T B;  3SK5 A;  2JXM B;  2SEB D;  4OL7 A;  1GUO A;  3IL8 A;  1YNN D;  4XIG S;  1EEF D;  3J80 E;  4TRD A;  1V8Q A;  4G7H C;  4JBW A;  2D5D A;  1U4R A;  4OIJ A;  3W3A A;  1UNS A;  3J81 E;  2IX3 A;  4BA1 I;  1BO0 A;  5G3L D;  5IGF A;  2HUG A;  2QCP X;  3K57 A;  5ELE A;  2RSO A;  2OXP A;  1MSG A;  1JWS D;  4Q5V A;  1OO9 B;  1V43 A;  3QJY A;  3K59 A;  3K5L A;  1A3V A;  2IPK D;  2EOT A;  3MXU A;  4NW2 A;  3OMG A;  5FK9 C;  1S4Z A;  2QF7 A;  3K0Y A;  1Q1B A;  2KA7 A;  3K7A B;  1EYD A;  3BDO A;  1EZ8 A;  2E2H B;  1VMP A;  3M85 A;  1AZP A;  3AB9 A;  1DCZ A;  3VR4 A;  2ID0 A;  1I4X A;  4EVO A;  3NWT A;  1D1I A;  4BBR B;  2KQ3 A;  3GTK B;  5FO8 B;  1JR0 D;  1S5B D;  4DA2 A;  2RKS A;  4EQN A;  1AEX A;  3V05 A;  4ZKB B;  5E3F A;  5I2X A;  4JK1 C;  5FO7 B;  1I4G A;  1PRT B;  3ZYY X;  1XXG A;  3NTK A;  3GTO B;  2FHT A;  3NE5 B;  1SXT A;  2E2I B;  3RZO B;  3T51 B;  4I7Z C;  3LX0 A;  3EQL C;  4NP5 A;  1HUN A;  5KYI A;  2NN6 I;  3G7L A;  3MXP A;  5CV5 A;  1ESF A;  4IUU A;  2NN6 H;  1CK1 A;  4X3K A;  1JIC A;  5KGU A;  1IYU A;  1I4P A;  3JAM L;  3A8I E;  4DAY A;  1PTO C;  1WTR A;  1SSO A;  2JA5 B;  2NTS A;  4KK7 A;  3A56 A;  1ZYR D;  2XNA C;  3GTM B;  1UUP A;  4ZK9 B;  4KD3 A;  4G4K A;  2RSN A;  2M2L A;  3NPP A;  4J8Q A;  2F0F A;  2K03 A;  3Q22 A;  5J1Z A;  1BR9 A;  3L9A X;  2F0I A;  2MGS A;  4HTH A;  4WJW A;  1SNM A;  4C3H B;  2R92 B;  1Z6H A;  5JPM C;  1LT3 D;  3HEJ A;  1AZQ A;  3TP5 A;  2OEO A;  3TBI B;  3SXH A;  4IUQ A;  2O5I C;  3TP6 A;  4ID6 A;  5ELC A;  3GTP B;  4KHV A;  3AU7 A;  1S5E D;  2NYZ D;  2AWN A;  4XXE A;  5JPN C;  1ML0 D;  5C0X J;  1ESR A;  3ITP A;  5CYU A;  5C3E B;  3W2D A;  1BDO A;  3VA7 A;  4K5V A;  4IUN A;  5C3X A;  2F3V A;  4ABN A;  4KV6 A;  3WOF A;  2AUK A;  4DAP A;  3SHL A;  3I70 A;  1QNK A;  4RWS C;  3J80 L;  2PW5 A;  1KLG D;  2D62 A;  1SYD A;  2KVM A;  4IZ8 A;  1W6K A;  1SE2 A;  3H94 A;  5DEH A;  2IWH A;  1II3 A;  2I46 A;  2B2V A;  2B2T A;  1RKN A;  1A2T A;  2EY1 A;  5C4Z A;  2A69 D;  2L55 A;  4A3F B;  1GUN A;  5EQ0 A;  2XN9 C;  2E76 C;  3DUZ A;  5J39 A;  1A3U A;  1CZW A;  2EYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...