4DAYA

Crystal structure of the rmi core complex with mm2 peptide from fancm
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
144
structure length
144
Chain Sequence
b'IAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RecQ-mediated genome instability protein 1
publication title Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
total genus 35
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dayA01
3NBHA 4DAYA 3MXNA
chains in the Genus database with same CATH superfamily
4RGOS 2LFNA 2RF4A 2EYHA 4HCEA 4A3DB 4NW2A 3VR3A 3CHBD 3SK5A 5CBAE 2VUMH 3L0OA 3C3LA 2YU9B 1YHAA 1BBWA 4JI5L 1Q90A 1KLUD 1JWSD 2D0PA 4DXFA 2K28A 3J81i 4A3FB 4DK1A 4RHSA 3I4MB 3FVQA 4WJ3M 3BDOA 1NTGA 4QUFA 3C1EA 2ZT9C 3PO3G 4A3GB 1STBA 3W1BA 4DR4Q 1BCPF 2B2TA 3EQLC 4AH6A 4UP8A 1WYDA 1HR0W 1VQFA 2F0TA 2E2JH 4BY1G 1NE3A 4A3CG 5C3XA 3I3CA 4MN3A 3S1NH 4KI0A 4GKKQ 5BN4A 5KEEA 1NCVA 1IXRA 3BVZA 4LF7Q 4JW0A 1ENCA 2PPBC 4N9PA 4Y52H 4F7XA 1Z6HA 3PIPA 2HHHQ 2I46A 1Q8KA 1DD2A 4G7OC 4O0AA 3AU7A 4LF6L 3H3VI 1K8OA 5CORA 4NXNL 3RLFA 1PH3A 3U58A 1SE8A 5DLQE 2PZWA 1EY8A 3M3YH 4WORA 1EOVA 1TY2A 3G4SA 3OTOL 2ENBA 1JC7A 5EGTA 4AQYL 2HIXA 1XNRL 3TRZA 1UEBA 1BF4A 2XGTA 4LW1A 4OELB 3CAMA 1SFOH 1YJ9A 2LS01 4QF4A 3DUZA 5FLMG 3R3OA 1CHPD 2OXPA 4OONA 5LMUL 2I07B 2ZM6L 2XWBB 4B9XA 1PH9A 1DOLA 4JI2Q 5ELNA 2E2IH 2XVSA 1YVCA 4DR2L 3UDFA 1C7YA 2H1EA 4UY8C 3RR5A 5KGUA 4B3TQ 1A3VA 4ZQ3A 3BS1A 2YTXA 1F9PA 4OX9L 3S16B 5M3MG 4HN7A 2ZTCA 5EPJA 5G3LD 1HNXQ 2JQOA 5IE8A 4H44C 4LFBL 3NWTA 1X6OA 5FLXL 5EBCA 1ZXTA 3L7ZC 2RSNA 4NMZA 3WOEA 2F0GA 3W5OA 4YY3Q 1HTPA 3HOXG 2K05A 4YHHL 3GV6A 2VQFL 2ZXOA 1CSPA 4K2LA 2B29A 3EROA 1EU4A 4A3BH 4J15A 1HA5A 2F0DA 4KKTA 4J8QA 1GXDC 2B3GA 3MEHA 1PTOB 1E2VA 3QR8A 3BYTB 4DGZA 4ULLA 4JV5L 2WAQE 3E6ZX 4L63B 1AW7A 1LTBD 2QW7A 2IHEA 2EYOA 1SE4A 4HJ9A 4QQBX 1VQ5A 3PIOA 3A7LA 1LTAD 4DR7Q 2ES2A 3SGIA 3NBHA 2ICIA 1KC8C 1NMFA 2VY3A 2RDHA 3K8AA 2F0SA 4OO1G 1FJGL 2JA8H 3D3RA 4BBRB 1KDCA 1QUQB 2V1CC 4JI6Q 5IP7H 1IYUA 2FXQA 3EBEA 2UU9Q 1PZJD 5K5PA 2ZTDA 5IP9G 3S1MB 1I6HB 3G6EA 5BN5A 5C0XG 4A75A 4BY7H 1A15A 3NTIA 1YJNA 5C4XG 5EKIA 1BNZA 1VQOA 5E4WC 2FMMA 3CRLC 1STGA 4MTKA 4IPHA 1XPRA 1WVLA 4KJNA 3H91A 2VB3X 4JBJA 3SEBA 2VNUD 1PRTC 2RQXA 3E0JA 2JEBI 2CQOA 3Q8DA 1PYWD 2NTSA 1K83H 3MWYW 1EY9A 1ICFB 1VQ9A 2RDFA 3J80i 4MZ9A 4GNXA 4GLXA 3RLOA 4ZCKA 1XJVA 4C3HG 1LO5D 4O1NA 1KABA 3HZXA 3J81L 3TZUA 1GJXA 1X3EA 3H0GH 5FK9C 4F87A 4PMCA 1B7YB 1TWAB 1X3QA 3GTOB 1UAPA 1VCIA 5A35A 4LJZC 4CKBA 1V1QA 5JPNC 3VR5A 3RD4A 1D1IA 2L4NA 2SNSA 4KN4C 3EIVA 1NR2A 1ZKOA 1QJOA 1YNND 2DN8A 2FMCA 3ERSX 1DXMA 3GTGB 1W2BA 3GTMH 1FNUA 1OXVA 2OWOA 5D3IB 4LFCL 4F8MA 5M3FB 4JCVE 3TZDA 4Y7NH 4A3LG 5BN3A 1PFNA 1PMRA 3G7LA 1OTCA 2PNHA 2QA4A 2VS1A 1EZ8A 4A3EB 4CBVA 1SSOA 3MXNB 2PCFB 1EIFA 4LF8L 1L1OB 1WCMH 4BY1H 3S2DB 3CF5A 1I50B 2NTTA 4DV0L 2NVQH 5IIFA 4JI3L 1CZGA 1RODA 2JSOA 2KJXA 1H9KA 4LF5L 1SNCA 1EQTA 2A69C 2CCZA 4C2MH 4R4TA 4NB3A 2B2UC 1EFID 1QVCA 4DUYL 1O7LA 5TSSA 3OW7A 3SE0A 3JAME 1L2FA 5HGTA 5M5XB 3F2BA 4HJ7A 1H9MA 1TU2B 4X64L 3ND9A 1EYCA 1V1OA 3BZCA 1VMPA 4B3RL 2MUYA 3OWFA 2EIFA 4R8IA 4RG1A 2KECA 1VQNA 4HR7B 5CV9A 2O5JC 2K5QA 4NDXA 2E2HH 5FLMH 3HOZB 3OMCA 4LFAL 4NXNQ 3GQBA 5IGCA 2Z4HA 1IBLQ 1I3QH 4GN4B 4JI1L 1Y1VB 3OTOQ 4AQYQ 2XN9C 4DV1L 4A3DG 3E5SA 4X3KA 4UP7A 1DCZA 1D5XC 5M3MH 4A3FG 2DNEA 1EY7A 4IUTA 5EPKA 1SYBA 3DHQA 3I4MG 5IYDG 2R7FA 1XPOA 3K7UC 3X3NA 4DR2Q 1CT1D 5FO7B 3HOXH 3HOVB 2R7DA 1MSHA 2HQEA 4OX9Q 4MIUA 3I4LA 3MXPA 2YV5A 1WCMB 2MNAA 2K04A 3NEMA 4HSVA 3HGBA 1F2ZA 3T1YL 4LFBQ 2WFWA 3NQIA 2CWAA 1EIYB 3QB3A 2FFKB 2RKSA 3MXUA 2RCNA 3H3VC 4KN7C 1E2ZA 4YHHQ 1DOMA 4DV7L 2VQFQ 2WIIB 3K80C 3KYHC 2R7ZB 1KL9A 1RKNA 2Z9HA 1JR0D 3PF4A 3X3MA 4DNIA 3T1HL 2QF7A 1PLFA 3PUZA 4DR3L 1X3PA 5C4ZA 3PSIA 2Q2IA 1D5MC 1HZAA 1N8RC 1ASZA 1XPUA 4JV5Q 1EWIA 2KCNA 3CCEA 2R93B 4OO1H 2K52A 2F0FA 3FKIB 4IFDH 1SYGA 3F2DA 2Y0SB 3A5UA 3D6CA 2A6EC 5ELBA 3GTJB 3TBIB 2P5ZX 3OPOA 5C5MA 5IP9H 5KNBA 2C5CA 2AQ2B 4C1NI 5C0XH 1WTOA 3CCQA 2NZOA 5C4XH 4QJFA 1FJGQ 1VQCA 3A8KE 1SR3A 4HAEA 2OTLA 4L8JA 4GS3A 1HFNA 2ID0A 2VUMG 5C44B 1RHPA 2NVTH 2KQ3A 5I6WA 3QG1A 2RA4A 1LACA 1KDBA 4K8IA 2ZJRA 1ONLA 1CA6A 2V4DA 1HNZQ 3FHWA 4LF7L 2N8NA 4UAIA 1S5DD 3EVQA 4RMFA 4C3JH 3GO5A 2NUCA 5JAVA 2MGSA 4FXGC 2CWPA 2K75A 2HHHL 1PTOC 1QG7A 1E1TA 4DXGA 1KAAA 4BA2I 3FRPB 5IOCA 1NNXA 3DEPA 3J81j 3I56A 1DYQA 2C35B 5C3WA 2HT1A 3K59A 2B2VC 3KLWA 3K81C 2EY6A 2YTYA 1I5FA 2ZJQA 4YWLA 2XWJB 3S17B 2E76C 3DM1A 2B2YC 4IUQA 3I7FA 1G6ZA 1ASYA 3S15H 1UEAB 5FKAC 3L9AX 2WP8J 1TWGB 1Y8PB 4DNTB 1GVPA 3STBD 5KNCA 1PH4A 1ZEQX 4KHPL 4BBRG 2QKIC 2K6AA 3NP8A 2MPMA 4A93H 4JYAQ 1JORA 2X6LA 1VQKA 3MVVA 1F9QA 2F0EA 4V190 1BCPD 4Z9CB 4DF7A 1K0SA 4LF9L 3M4QA 1SNOA 3A54A 1GUWA 2IW3A 1GUGA 1Q81C 4LF8Q 4OWTB 3AEVA 4DV0Q 1SLJA 1EUJA 1E24A 3J80c 2FHTA 3NWSA 4JI3Q 4RAUC 2EY2A 2VW9A 1W6JA 5IT9c 2OQKA 4WRDA 2BH2A 1VQJA 2DUDA 1UE7A 3A5ZB 2VXWA 5E3FA 3IRBA 1A63A 1PRTB 1WFQA 2YTVA 1Q7YC 1SROA 2Z6BA 4DUYQ 1YI2A 4C3JB 3DXJC 4YWKA 3G71A 2NB0A 1LLRD 2OT2A 3NTKA 1N36Q 1XTCD 2PW7A 1U4RA 4A3BG 1C0AA 1WTXA 3BG3A 5H1SE 4A3MH 2AQ3B 2BA1A 2FINB 4X64Q 1HHVA 1W6KA 1FVIA 1CSQA 1RJTA 4A3DH 4B3RQ 5D65A 2YU9H 4PQXA 4HMJA 1TY0A 4LFAQ 2RHQB 4A3FH 4OIJA 5GROA 4UDUC 3KF8B 1J8IA 2JE6I 1XNQL 4JI1Q 4P74A 5IYDH 1R9TH 4HSPA 4M8AA 4R8NA 5M3FG 4IFDJ 4A3GH 2J7ZA 4DV1Q 1VS0A 3QO2A 1LV9A 5A2QL 1L1OC 4A3KB 2NVXB 4A3EG 1CKMA 4A3JB 3PO2H 5C0XJ 3LWEA 1EY6A 5LMNQ 4IJLA 4A93B 1R4PB 4EQPA 4QGUA 2R92H 3U50C 4IOCA 1Q86C 3I55A 1X3FA 1LTSD 4BY7G 2K03A 4CDEC 4IOAA 1CUKA 3H3VH 2OCEA 2I5LX 2C9OA 2O2LD 1B70B 3N52A 1QB5D 1F9RA 2F0HA 3KFUA 4F88A 1D1KA 3MTSA 1XMOL 3C1FA 1MHWC 3VYRA 1XWEA 3QWNA 3M4OB 3JAMi 4DV7Q 3GTKB 1AZPA 2MQHA 5IGGA 5DEHA 3T1HQ 4PNYA 4CGYB 4DR3Q 1I4PA 5L37A 3H0GG 4MHEA 3HOWB 3S1QB 4A3MB 4YCWA 4JBKA 1Y1VG 1PH6A 3R2TA 4P75A 1TIID 2D62A 1EWCA 1Q12A 4K14A 1JOKA 1MIUA 3S1RB 1PFBA 3S16H 1BKBA 1LTID 1PYSB 3QOLA 1CZWA 2IX1A 3SDZA 1R9TB 1DOKA 2BE5D 3I2ZA 3KF6B 3BYYB 3D31A 1UWVA 2F0VA 3C46A 2JYOA 4K0KL 3V05A 4CDDC 3HEJA 4ZUIA 1PFMA 1NSNS 3PO2B 1NMGA 1WCMG 3ICEA 3CKIB 1KTKA 4LUVA 3LWUA 4JBWA 1DGSA 3KK7A 2R92B 1PTOH 1SAPA 3K57A 1IYJB 3ULLA 2KA7A 1JB3A 4BA1I 1N33L 3HFZB 3ER0A 1SDFA 3FDTA 3M4PA 3OMGA 4XYOA 1GUOA 1MKHA 2K5WA 4DKAC 2JA6B 2DNCA 1EYGA 1SYFA 2F0PA 4NPSA 3CCJA 2DY8A 2A6HD 1IBLL 1PH1A 4OWXB 1X56A 3J7AF 2R93G 1Q82C 1B9MA 2L15A 2Q8IB 3I73A 1GM5A 4BBRH 5F2DA 2KCTA 3KDFB 1AEXA 2Y0SG 2RBMA 4DAYB 4BWGB 2Z1CA 1KIXA 1QNKA 1I94L 2K14A 4CDFC 2PI2E 3S1MH 1I6HH 4B3MQ 3CC2A 4FF3A 2HUGA 3QIAA 2J0TD 3T16A 4DR1Q 4PG3A 4HJ5A 1PYBA 1VF5C 2A8VA 4KHPQ 4AYBB 1Q1BA 1I4XA 1SE2A 2UUAQ 2QGQA 4OWWB 3A0JA 3KBXA 3I4NH 5C44G 3NENA 1Y69U 1EIHA 3Q22A 4X62L 4WFN3 1O78A 4LF9Q 4OEMB 2HCCA 5LL6S 4DR6L 1PA6A 1LTRD 1F9SA 5C6AA 4KK7A 4JOIA 4KMUC 5DNFA 3MXGA 5KYLA 1O7IA 3RZDH 1Z7TA 3A55A 3D4RA 4DK6C 2XRSD 3CC4A 1PH5A 1LTLA 1HQMC 1WI5A 3CCSA 5ELOA 4L5SA 4JVZA 1TWAH 3GTOH 5M5YB 3F1ZA 3NHHA 2F0IA 3I70A 1K0RA 3S14B 2D5DA 2D0OA 1O7YA 2F0KA 2F0WA 4XT1B 3GTGH 3ZYYX 1JT8A 3T56B 3K58A 4Q5VA 1BCPB 5M3FH 1SNDA 2JP1A 2UUCL 1TS5A 2I0QA 4KY5A 2Z6KA 4A3IB 2G9DA 1D7QA 1HH2P 1G91A 4A3EH 5CBEE 1PXUA 4C3IB 5GAEC 3K5NA 1IBMQ 3OIPA 3S2DH 3GV3A 4IFDG 1I50H 1XNQQ 4DNRB 3TREA 2B2WA 1EEID 1VQEA 1VQDA 3ERQA 3IFDA 1SYEA 3K0YA 3OHXC 1VQ8A 1VMCA 4N8X1 1YHQA 4J6HA 3RZOH 1IHZA 1YHBA 2DJFC 1BDOA 2K01A 1HNZL 2F0UA 1I4QA 1HFGA 2EDGA 5IGDA 2ASBA 4AIMA 2PNRC 3I4NB 5M5XH 3MEFA 4PMBA 3VA5A 5HURA 3I72A 3CCRA 2JEAI 1YNNC 3CD6A 1GO3E 3UDGA 4FXDA 4RKBA 4C3JG 4PZ8A 5JVG3 3CMEA 2KEDA 1IW7D 3RZDB 1X65A 1XMOQ 5CR3A 5EPLA 1I6VC 3RLNA 3HOZH 2JA7B 2RHSB 2EQSA 1I4HA 2EYFA 3PUVA 1MI2A 3HKZG 1YNJD 3AQQA 5FOBB 4QY7A 1IBKQ 1BQQT 2JA5B 3SXHA 4XDXA 1Y1VH 1ZYRD 4RHRA 2NN6I 5IYCH 4EVOA 4JI8L 1QUQA 3EA6A 2SNMA 4R4IA 3P75A 3HOYB 1TWFB 1A6XA 5FLXc 2A19A 1FNWA 5BR8L 1VQ7A 4G4KA 1TS4A 1ENAA 2PYKA 4A4IA 5LMNW 4JYAL 1F2LA 3J7A5 5FLXE 1B8AA 2VB2X 2EJMA 2PMZB 3C2PA 4KKUA 4LUZA 3HOVH 4IN3A 4YCUA 4LUOA 3SK6A 3U9SA 2PI2A 1GHJA 4JPBW 5EKLA 1F2YA 1STNA 1U5KA 1VF7A 4LAAA 1G2TA 2LSSA 2MFIA 4A3JG 1YEZA 1T9HA 4TQUS 5CV6A 1WOCA 2BA0A 2PO4A 3HS0C 4A93G 2CH4W 4L5TA 1JICA 1R4QB 4K0KQ 3RZOB 1JE4A 3KOJA 1C48A 2R7ZH 2O4XA 4K6LA 5ELFA 4GKJQ 3JAMc 1CKNB 1GKHA 3T13A 2EOTA 3M9BA 1MGSA 1N36L 2AWNA 2Y0SE 5C3EB 1ML0D 5GQOA 2I5MX 3R2IA 1VQLA 4G57A 1X9NA 1A2UA 2X6GA 1J5EL 3GTLB 5M9OA 5G3LF 2R93H 1N33Q 4BBSH 1TVXA 4YWMA 1XYIA 2B2TC 1QCBD 1A0IA 3FKIH 3MFYA 1TQOA 1VQ4A 1S5FD 2GA4B 5IYBH 4CDCC 3GTJH 3GD7A 4EX5A 5IGEA 4HIMA 1KRTA 3CC7A 5JVH3 1S5CD 2GVAA 4A3MG 3CMAA 5DM63 4P72A 3MXNA 3SVMA 1L1OA 3J7YW 3VYUA 1P8LA 5CMDA 4V0BA 5C44H 1I94Q 1II3A 3SHLA 3MAQA 3HOUH 3RN2A 4NKLA 3NTHA 2ICEC 2JN4A 5LMNL 2QDBA 4ZRZA 2EVBA 3GTPB 4CKCA 1SE3A 1UE5A 3T51B 4A3GG 4NXML 1MD2D 4DV2Q 2NBFA 3TS2A 1I4GA 1HNWL 2G9HD 2WB1B 3GP7A 3J81E 1B4OA 3PO2G 3MFGA 4X62Q 1N9WA 2MHVA 4P73A 4DR6Q 3I4OA 5LHY1 2R92G 3F2CA 3PO3B 1SMYD 2EYMA 5EQ0A 1JJ2A 1HUMA 4GN5A 4B3SQ 2L0CA 1HUNA 1U9RA 4IPCA 1VQBA 5EKKA 5IY0A 5J22A 2JA6G 3MC0B 4ME3A 3S17H 2QILA 1E2WA 1K73C 4HMIA 1KDAA 1M8AA 1TWGH 1YITA 4BBSB 4GZYC 1AP0A 4DAMA 1V9PA 3NQTA 4C56C 1LUZA 3OWEB 2NZHA 1O7ZA 1KNEA 2XNAC 3RNUA 1YJWA 4LNQA 2UUCQ 2DGYA 3BVMA 1S72A 1LT5D 1TT2A 2QDLA 1B3AA 1STHA 2XIWA 4J1MA 3J80L 4AYBG 3A56A 2OF1A 3N6RA 1C9OA 1HJPA 1XTDA 3DWQA 2F0JA 5JEAG 2OQ0A 5IT9L 1PRTF 3TN2A 3EN2A 2A73B 3HOUB 1BVSA 2IPKD 3FMCA 4L5RC 1VDZA 3R8BA 2UXCL 1LABA 4TRDA 2LXJA 1O80A 2K32A 4LF4L 5COYA 4APVA 1A2TA 1LTTD 3HKZE 1H95A 1RCVD 4X65L 1TWCH 1WTRA 2SOBA 3MZ5A 5LL6X 5IGFA 4R1JA 2EJFC 2IX0A 4EQ5A 1E0BA 3KLSA 1F2MA 2K7VA 5ELEA 3STBC 1HTLD 4CHTB 4QCLA 4HJ8A 1EU3A 1L0YB 5JJKA 1BUVT 3QOJA 3E9HA 3WDNA 2GN5A 4LMQD 3HKSA 4RFBA 3J7ZC 1HCZA 2Q2UA 1H9SB 4CJ0B 4IALA 1BCPC 3ZJYC 5KRUA 5C4JB 1QZGA 3U4VA 4A76A 2NWGA 4TKOB 4FNFA 1SMXA 2E5LL 2PW5A 2F0LA 4GLAC 1BXTA 1BR9A 4JI8Q 4B3ML 5I4DA 4DR1L 4A3KH 2NVXH 4GNXC 4KD4A 4MNOA 3D8GA 4A3JH 1V1PB 2F52A 4I65A 1CTMA 5BR8Q 4CJ2C 2UUAL 1F77A 2LMCB 2BCOA 4KLKA 1QZHA 4HIKA 4FF2A 4ALPA 4FP5D 1Y8OB 1G8ZD 2ZTEA 1D5ZC 2CW0D 2OEOA 3S2HB 5D14A 4CJ1B 1FR3A 3UE0A 1U4MA 3K5MA 4C1NK 4Q0FA 5J1ZA 3A8JE 3ND8A 3I4NG 1Z9FA 2WKDA 4QB4A 2ZJPA 2SDFA 1CI3M 3M4OH 3GTQB 3GTKH 2B63B 5I6YA 2AQ1B 3D6WA 1TWCB 1N34Q 3A7AB 3F2UA 3M7GA 4DAPA 1WTQA 1NUCA 3LX0A 3TMEA 2PQAB 2R6GA 1EYDA 2EZVA 2F03A 2VZAA 2SEBD 1V8QA 2NN6G 1J5EQ 1LT3D 3HOWH 5KIXA 3S1QH 1QILA 3CCLA 1ESRA 5I2YA 3S9WA 3NBIA 4O42A 4RKLA 2QEJC 2LXKA 1CFMA 1SEBD 1Q46A 3IAYA 1V1PA 1LYLA 1UNSA 5I2XA 1STAA 2J4XA 1T5XD 4G7ZC 5GAHC 3S1RH 1ILPA 2H5XA 3HOYG 4K5VA 4C3HB 2JJQA 3NSWA 5FJ8G 4G7HC 3AFPA 1IBML 1TS3A 1CK1A 4HIOA 2AUJD 3BVGA 1Q8IA 3UDIA 1WD1A 2NYZD 3O13A 1KAWA 3PV0A 4U68A 2IY5B 1TS2A 1PDQA 1XXGA 1A62A 2HDLA 1YIJA 2UUBQ 3L2PA 1B9NA 3SR1A 1KNAA 3W2DA 1G291 4NXMQ 2GVBA 2XTIA 3MHBA 4DV5L 3RMHA 3NPPA 1T5EA 2E74C 2N3SA 4OHJA 4GOPB 1HNWQ 3Q24A 1BO0A 4RWSC 2IHFA 4P71A 4H13C 2UXDL 2K5VA 4XQQA 4EQOA 3H6MA 3HP3A 2NVYB 3MA2B 3NELA 2VQEL 2JA6H 4HCSA 3BZKA 4NP5A 2CFMA 2N49A 4OL7A 2HIVA 1MJCA 1QWYA 5C3EG 3PMFA 3VR4A 2A5HA 3RUZA 1IBKL 3IKJA 3K0XA 2AKWB 3DWAA 2HD3A 3AB9A 4JI0L 1P16A 3CPWA 1SNPA 1B53A 3KF8A 2BE5C 4AYBE 1WJJA 2TMPA 1DJRD 5KNDA 3HOZG 3UI2A 4K8JA 5JJZA 1Z47A 3P1HA 4JK1C 5IYCG 4PZ6A 1K8AC 1ET6A 4H7BA 1SRUA 2BDNA 5JEAH 2Q8TA 2M2LA 2KVMA 4DV3Q 1UUPA 1XMQL 2EYJA 4QIWB 1JWUD 2KOLA 1RF2D 1EQQA 4BS9A 2CH4A 1MBYA 3HOVG 1SNQA 1PTOF 4XQNA 2A6HC 2WB1G 4GKJL 2B2UA 4ZKBB 1RTNA 4KY7A 1Y14B 2H4OA 4S3SA 4LF4Q 2F3VA 2L5TA 2UXCQ 1HZCA 4XTCS 5M5YH 2OTJA 3S24A 2XRQD 4X65Q 4KV6A 4JI7L 3VYSA 3Q23A 3S14H 1K28A 1UE6A 4FDBA 4UPAA 1STYA 1PZKD 1W3SA 2KCCA 2F3WA 2MP1A 3BDCA 5CV7A 2R7ZG 1SYCA 4FVMA 2LKVA 1PH7A 1K3BC 3BDLA 4I7ZC 4OXPA 4XYQA 4OGQC 4WJ4A 1EL0A 1ET9A 4ME5A 1GUTA 1ILQA 3OYYA 4PMWA 1TKWB 4POFA 4N9TA 1J9OA 5A2QE 3DM3A 4A3IH 3TSSA 4IUVA 4BBSG 3AMUA 4C3IH 2IX3A 3FKIG 2EJGC 1RL2A 4X3SA 3PUXA 1LT4D 1I4RA 2FJ2A 5IYBG 2K5DA 4K5WA 1JMCA 2E5LQ 5M5WH 1QE6A 3KF6A 4X3UA 1EZ6A 3M85A 4OIKA 3HRZC 2EY1A 3T4AC 4IUPA 3CCMA 4DV2L 4PZ7A 1CKOA 4KJOA 2WV6D 2Z4IA 4DV6L 3M4YA 1EIGA 5AJ3Q 2A74C 3HOUG 2KENA 4R4OA 1JJCB 2PZUA 1QVFA 1TWHB 4MTNA 1IL2A 2L1BA 4KHZA 4DV4L 3NBHB 4IURA 1BBXC 1UE1A 3L3OC 4B3SL 1K8GA 4R4QA 2CKZB 4DU9A 2JA7H 2VUMB 1IYVA 1EOTA 4XIGS 5HGQA 2NN6H 5CV8A 1VQPA 1IZ6A 5I9PA 4HTHA 2JA5H 1H9RA 3E3XA 3PCOB 3KDFA 4XQJA 2B8GA 2PMZE 4DAYA 3HOYH 1TWFH 1B50A 2WACA 1DZ1A 5FJ8H 1HR0L 1IKMA 2KCMA 1VQAA 2E2JB 1HZ9A 3S1NB 2AUKA 2BDOA 1NBWA 1MJEA 1G6PA 5CGKA 2N88A 1A8VA 3K6OA 4H02A 3OOCA 4JI4Q 2RDGA 1V43A 1KHIA 4GNXB 1PV4A 3K5LA 4RH6A 3URYA 5M5WB 3GDEA 1C8CA 4FF1A 5JEAJ 3A8IE 2N78A 3IL8A 3JAML 1YZ6A 1QNUA 1IW7C 4KD3A 1E3PA 3LGJA 3M3YB 5CC4A 1YNJC 2MO1A 4DA2A 1ZYRC 3PUWA 1G51A 4JC0A 4JG2A 3TS0A 1SFOB 1S5BD 4IPDA 5C3EH 1RDPD 4DV5Q 3GTLH 2PQEA 4K2KA 3I8ZA 4XXEA 1EY4A 3H09A 4K5XA 1RIPA 1JOQA 2B63G 3P7JA 2UXDQ 2EYLA 1OXUA 3D4WA 5EBDA 2E2IB 3CCUA 2VQEQ 3HG9A 1YBYA 2B2VA 3FPUB 1Y1WH 1JQYD 1E1OA 3D0FA 4YCVA 4IUNA 1SYDA 1JB7A 5ISRA 4U673 1BOSA 2KEEA 5JPMC 3VYTA 2B2YA 4DUZL 1LT6D 4JI0Q 3W3AA 1CA5A 2BH8A 3FP9A 4L6TB 1KD1C 2HQLA 2BOSA 2O5IC 2DY7A 2IT1A 3Q6SA 1N32L 2HDMA 2WB1E 2EY5A 3GTPH 3W1GA 4A3BB 4ZLTF 3SK4A 1EFWA 1AH9A 5C5LA 2CHBD 4H0LC 3P20A 1RD9D 4UP9A 1AFPA 4A3KG 1QVGA 4EQNA 3CXCA 1PRTD 3OSOA 4RCOA 3BZDB 3TP7A 1XMQQ 5EJWA 1SN8A 4CKEA 3AFQA 4GOPC 1FGBD 3PO3H 2IJ0A 2WAQB 1L0WA 3PIP3 5T1IA 4IJHA 3RN5A 4JI5Q 4PV1C 1N34L 5T1GA 3G6JB 2JA8B 3KBGA 1C4QA 5ELDA 4ID6A 3R93A 5C4HA 2KHSA 1AZQA 1QOHA 3VR6A 4KTAA 4A3CH 3VR2A 1KRSA 4BXXG 2AMCB 4JI7Q 4RGMA 2N55A 5IGBA 1SXTA 2F4VL 1XX8A 1A3TA 1S4ZA 3ULPA 3ULJA 1AN8A 1WTWA 4LK1C 5J3BA 2MJ8A 4KKSA 4BY7B 4UHVA 1FYCA 5K36G 1YNXA 1DONA 2UXBL 3I90A 1WTVA 2JA9A 1Y1WB 2E2DC 5JJIA 1GUSA 3B6YA 2KBNA 3HOWG 2F3IA 3DLLA 4FF4A 5EAYA 1K83B 4JBMA 4GLVB 2Z0SA 5CYUA 1EYAA 1D6EC 2RCFA 4TVAB 4R4CA 5D3DA 4LF6Q 2UUBL 1SMYC 3TP6A 2A69D 1OXXK 3BU2A 3DMUA 3BJUA 3WOFA 3H0GB 2M9VA 1PZID 3CU7A 2MO0A 1WD0A 2D9UA 3J81c 2KHIA 3CRKC 1JE5A 3ONAB 2EE1A 1XNRQ 3NE5B 1M1KC 1CKNA 1H9JA 1Y8NB 2LY7A 4DV6Q 1SBBB 3KLRA 1K3RA 3FEWX 4M1UB 2I5HA 4K6DA 4B08A 3I91A 1VQMA 4DAVA 4DPGA 1M4VA 2YYZA 5LMUQ 4IZ8A 2ZM6Q 3VA7A 4DR5L 3GTMB 1IKLA 5AFWA 4DV4Q 1IL8A 4Y7NB 1WTHA 1VQHA 3PIO3 2WINB 5C4JH 3KJPA 1M90C 1KXLA 4TSSA 1VQ6A 4HEDA 4BY1B 1NJIC 3E0EA 5IWAL 1L0XB 4IUUA 2NVQB 1CHQD 1ESFA 1EY0A 4X66L 3KUPA 2Q2HA 5E4XA 1PFSA 1AE2A 4JOIC 2F0NA 2Q8RE 4L5QA 2CQAA 1HR0Q 1U4LA 4C2MB 5GADC 1JCKB 2F1MA 2K33A 4E6IA 1PHJA 4DV3L 1EQRA 2E8GA 3S2HH 3SK8A 3NUCA 4KY6A 1TR5A 4R9WA 2QEXA 2NZ1D 4I7AA 2EXDA 5ELCA 3OIQA 3E9IA 4DFAA 2E2HB 3KLSX 1X32A 1LTGD 4ABNA 2IWHA 4ZKCB 2F4IA 3GTQH 1STEA 1I3QB 1FNVA 2Z6KC 2B63H 2TSSA 1E7ZA 2VL6A 3AYHB 5E7NA 1K9MC 1TXYA 2F0MA 4DR4L 1BBUA 1GOZA 4IPGA 1GHKA 3V96A 2KUMA 1SJED 5IODA 1JOOA 1B1ZA 2B2WC 4POGA 3TQYA 5M3MB 3EJIA 3K5OA 3H15A 1E22A 4ZUJA 4GKKL 2A6ED 1KQSA 2F0QA 1G2SA 2CVRA 3CP0A 3HOXB 2L12A 2ATWA 4WJWA 4ZK9B 4C3HH 2AWOA 3PQIA 5KYIA 2Z8LA 4RA8A 3IFTA 3PUYA 2D2CC 2CW0C 4DUZQ 5DAUA 2K50A 3Q0AA 1FGUA 4RGNA 4A3IG 1PH8A 4GN3B 2PZTA 4C3IG 2KHJA 1N32Q 2K4KA 2A68C 1OXTA 1SJHD 1FL0A 4FO2A 1RTOA 5AJ3L 1GD7A 3K7AH 1CM9A 4A3LH 2HCIA 1PTOD 1HA6A 2K1BA 1VQGA 1HPCA 4JI2L 2L11A 3DEOA 2R61A 4IO9A 2NVYH 4DN4M 2B39A 3CPFA 1EY5A 3F8TA 1HQRD 2XSCA 2F0OA 1NR4A 4B3TL 4BXXH 3CQZH 4OO1I 2L55A 2Q2TA 2X69A 4LFCQ 2DJGC 3D4DA 1DM0B 2A68D 3NK9A 5GAGC 4IFDI 1ENFA 1HNXL 3CCVA 3UE1A 3TP8A 5FO9B 3PF5A 4O2DA 2RSOA 1B2TA 5JOBA 3PGZA 5K36H 1X3GA 1H9SA 1GUNA 5C4XB 4XT3B 1CQFA 4YY3L 1D8LA 5C0XI 1OXSC 1EQVA 5HY6A 3TDQA 2JA7G 5NUCA 3WWVA 3KJOA 2F4VQ 4HJAA 2NVTB 1SNMA 1Q1EA 4DK0A 2JA5G 1KLGD 4QL5A 4X6AH 4LF5Q 3J80E 4QIWE 3UDXA 3FPPA 2UXBQ 1S40A 1FD7D 5IT9E 4DK3C 3G48A 1B44D 4JI4L 5I9OA 2JXMB 3HKZB 2ALYB 1U4PA 3QJYA 1JWMD 1EWHA 2A1AA 4DR7L 1HZBA 1AE3A 1EEFD 1OO9B 2B8FA 1D2BA 2EPBA 2G5DA 2L9HA 4B9WA 4EGVA 4LWCA 1X54A 1HXYD 1S5ED 2EXZA 2RVLA 4X3TA 1U0LA 3I4MH 4FYDA 2WKCA 5DM73 2R3ZA 4JI6L 3K7AB 2UU9L 2WAQG 3VDYA 3OW2A 2K5HA 4FXKC 3S15B 5J39A 3LNNA 5CV5A 2PQAA 1B3QA 4KHVA 5CV4A 2JA8G 3CW2C 3TEHB 2E75C 3EFXD 1ICWA 2IL8A 3CQZB 4DR5Q 1X55A 5IP7G 1MSGA 4RGTA 1LM0A 2QCPX 3A74A 2ZXPA 3ITPA 3T53B 1J6QA 4RCNA 5FO8B 1PH2A 2EYPA 3J7AV 1K8MA 1WTPA 2M00A 1NAPA 1A3UA 3NXWA 1PVOA 3T1YQ 5IWAQ 4P2CB 1Y1WG 4ZYSA 4QUCA 3JC66 5JJLA 1HRJA 3TP5A 3V2TA 4X66Q 1CQVA 1Q3LA 1S3OA 3H94A 1VQIA 4YIJA 2ZXRA 4IQZA 4HIDA 2K5NA 1JJGA 4QMGA 3U4ZA 3U9OA 3M7NA 4N8FA 4ODGA 4ILWA 1NY4A 2JK8A 5E1FA 4ZAIA 1TWHH 4GOPA 3DWPA 2AHOB
chains in the Genus database with same CATH topology
4RGOS 2LFNA 2EYHA 4HCEA 4A3DB 4NW2A 3VR3A 3CHBD 3SK5A 5CBAE 3C3LA 2YU9B 1Q90A 1KLUD 1JWSD 4DXFA 2K28A 4A3FB 4DK1A 4RHSA 3I4MB 3FVQA 3BDOA 4QUFA 3C1EA 2ZT9C 4A3GB 1STBA 1BCPF 2B2TA 3EQLC 2F0TA 5C3XA 3I3CA 4MN3A 4KI0A 5BN4A 5KEEA 1NCVA 3BVZA 1ENCA 2PPBC 4N9PA 4F7XA 1Z6HA 2I46A 1DD2A 4G7OC 3AU7A 1K8OA 5CORA 3RLFA 2PZWA 1EY8A 4WORA 1TY2A 2ENBA 1JC7A 5EGTA 1BF4A 2LS01 4QF4A 3DUZA 3R3OA 1CHPD 2OXPA 2I07B 2XWBB 4B9XA 1DOLA 2XVSA 2H1EA 5KGUA 1A3VA 4ZQ3A 3BS1A 1F9PA 3S16B 4HN7A 5EPJA 5G3LD 4H44C 3NWTA 5FLXL 5EBCA 1ZXTA 3L7ZC 2RSNA 4NMZA 3WOEA 2F0GA 1HTPA 2K05A 3GV6A 2ZXOA 4K2LA 3EROA 1EU4A 1HA5A 2F0DA 4KKTA 4J8QA 1GXDC 3MEHA 1PTOB 1E2VA 3BYTB 4DGZA 4ULLA 3E6ZX 4L63B 1AW7A 1LTBD 2EYOA 1SE4A 3A7LA 1LTAD 3NBHA 2ICIA 2RDHA 2F0SA 4OO1G 3D3RA 4BBRB 1KDCA 1IYUA 1PZJD 5K5PA 3S1MB 1I6HB 5BN5A 5C0XG 1A15A 3NTIA 5EKIA 1BNZA 5E4WC 2FMMA 3CRLC 1STGA 1WVLA 4KJNA 3H91A 2VB3X 3SEBA 2VNUD 1PRTC 2RQXA 3E0JA 2JEBI 1PYWD 2NTSA 3MWYW 1EY9A 2RDFA 4C3HG 1LO5D 4O1NA 1KABA 3HZXA 3J81L 3TZUA 1GJXA 5FK9C 4F87A 4PMCA 1TWAB 1X3QA 3GTOB 1UAPA 1VCIA 5A35A 4LJZC 4CKBA 5JPNC 3VR5A 3RD4A 1D1IA 2L4NA 2SNSA 4KN4C 1NR2A 1ZKOA 1QJOA 1YNND 2DN8A 2FMCA 3GTGB 1DXMA 1FNUA 1OXVA 5D3IB 4F8MA 5M3FB 3TZDA 5BN3A 1PFNA 1PMRA 3G7LA 1EZ8A 4A3EB 4CBVA 1SSOA 2PCFB 3S2DB 1I50B 2NTTA 5IIFA 1CZGA 1RODA 2JSOA 2KJXA 1H9KA 1SNCA 1EQTA 2A69C 2B2UC 1EFID 1O7LA 5TSSA 3OW7A 3SE0A 3JAME 5HGTA 5M5XB 1H9MA 1TU2B 3ND9A 1EYCA 1V1OA 1VMPA 2MUYA 3OWFA 4R8IA 2KECA 4HR7B 5CV9A 2O5JC 2K5QA 4NDXA 3HOZB 3OMCA 3GQBA 5IGCA 2Z4HA 1Y1VB 2XN9C 3E5SA 4X3KA 1DCZA 1D5XC 2DNEA 1EY7A 4IUTA 5EPKA 1SYBA 3DHQA 3X3NA 1CT1D 5FO7B 3HOVB 1MSHA 2HQEA 4MIUA 3I4LA 3MXPA 1WCMB 2K04A 4HSVA 3HGBA 1F2ZA 3NQIA 3QB3A 2FFKB 2RKSA 3MXUA 3H3VC 4KN7C 1E2ZA 1DOMA 2WIIB 2R7ZB 1RKNA 1JR0D 3X3MA 2QF7A 1PLFA 3PUZA 1X3PA 5C4ZA 1D5MC 2KCNA 2R93B 4OO1H 2F0FA 3FKIB 4IFDH 1SYGA 2Y0SB 3D6CA 2A6EC 5ELBA 3GTJB 3TBIB 3OPOA 5C5MA 5KNBA 2C5CA 2AQ2B 4C1NI 5C0XH 1WTOA 3A8KE 4HAEA 4L8JA 1HFNA 2ID0A 5C44B 1RHPA 2KQ3A 5I6WA 3QG1A 2RA4A 1LACA 1KDBA 4K8IA 1ONLA 1CA6A 2V4DA 4UAIA 1S5DD 3EVQA 3GO5A 2NUCA 5JAVA 2MGSA 4FXGC 1PTOC 1QG7A 4DXGA 1KAAA 4BA2I 3FRPB 5IOCA 3DEPA 1DYQA 5C3WA 3K59A 2B2VC 2EY6A 2XWJB 3S17B 2E76C 3DM1A 2B2YC 4IUQA 1G6ZA 1UEAB 5FKAC 3L9AX 2WP8J 1TWGB 1Y8PB 4DNTB 5KNCA 1ZEQX 2QKIC 2K6AA 3NP8A 2MPMA 1JORA 2X6LA 3MVVA 1F9QA 2F0EA 4V190 1BCPD 4Z9CB 4DF7A 1SNOA 3A54A 1GUWA 2IW3A 1GUGA 2FHTA 3NWSA 4RAUC 2EY2A 1W6JA 4WRDA 2VXWA 5E3FA 1PRTB 4C3JB 3DXJC 2NB0A 1LLRD 2OT2A 3NTKA 1XTCD 2PW7A 1U4RA 1WTXA 3BG3A 2AQ3B 2BA1A 2FINB 1HHVA 1W6KA 1RJTA 5D65A 4PQXA 4HMJA 1TY0A 4OIJA 4UDUC 1J8IA 2JE6I 4HSPA 4M8AA 4R8NA 4IFDJ 2J7ZA 3QO2A 1LV9A 5A2QL 4A3KB 2NVXB 4A3JB 5C0XJ 3LWEA 1EY6A 4A93B 1R4PB 4EQPA 1LTSD 2K03A 2C9OA 2O2LD 3N52A 1QB5D 1F9RA 2F0HA 4F88A 1D1KA 3MTSA 3C1FA 3VYRA 1XWEA 3QWNA 3M4OB 3GTKB 1AZPA 5IGGA 5DEHA 4PNYA 4CGYB 1I4PA 4MHEA 3HOWB 3S1QB 4A3MB 3R2TA 1TIID 2D62A 1EWCA 1Q12A 4K14A 1JOKA 3S1RB 1PFBA 1LTID 3QOLA 1CZWA 2IX1A 3SDZA 1R9TB 1DOKA 2BE5D 3BYYB 3D31A 2F0VA 3C46A 2JYOA 3V05A 3HEJA 4ZUIA 1PFMA 1NSNS 3PO2B 3CKIB 1KTKA 3LWUA 4JBWA 3KK7A 2R92B 1PTOH 1SAPA 3K57A 2KA7A 1JB3A 4BA1I 1SDFA 3FDTA 3OMGA 4XYOA 1GUOA 2K5WA 2JA6B 2DNCA 1SYFA 2F0PA 2DY8A 2A6HD 3J7AF 1B9MA 2Q8IB 3I73A 5F2DA 1AEXA 2RBMA 4BWGB 2Z1CA 1QNKA 4FF3A 2HUGA 3QIAA 2J0TD 3T16A 1VF5C 4AYBB 1Q1BA 1I4XA 1SE2A 3KBXA 1Y69U 1EIHA 3Q22A 4WFN3 1O78A 2HCCA 5LL6S 1LTRD 1F9SA 5C6AA 4KK7A 4KMUC 5DNFA 3MXGA 5KYLA 1Z7TA 3A55A 3D4RA 2XRSD 1HQMC 5M5YB 3NHHA 2F0IA 3I70A 3S14B 2D5DA 1O7YA 2F0KA 2F0WA 4XT1B 3ZYYX 3T56B 3K58A 4Q5VA 1BCPB 1SNDA 2JP1A 1TS5A 4KY5A 4A3IB 2G9DA 1G91A 5CBEE 1PXUA 4C3IB 3K5NA 3OIPA 4IFDG 3GV3A 4DNRB 2B2WA 1EEID 3ERQA 1SYEA 3IFDA 3K0YA 3OHXC 1VMCA 4J6HA 1IHZA 1BDOA 2K01A 2F0UA 1I4QA 1HFGA 2EDGA 5IGDA 2PNRC 3I4NB 4PMBA 5HURA 3VA5A 3I72A 2JEAI 1YNNC 4FXDA 4RKBA 4C3JG 5JVG3 2KEDA 1IW7D 3RZDB 5CR3A 5EPLA 1I6VC 2JA7B 1I4HA 2EYFA 3PUVA 1MI2A 1YNJD 5FOBB 1BQQT 2JA5B 3SXHA 4XDXA 1ZYRD 4RHRA 2NN6I 4EVOA 3EA6A 2SNMA 3P75A 3HOYB 1TWFB 1A6XA 1FNWA 4G4KA 1TS4A 1ENAA 2PYKA 1F2LA 5FLXE 2VB2X 2EJMA 2PMZB 3C2PA 4KKUA 4IN3A 3SK6A 3U9SA 1GHJA 5EKLA 1F2YA 1STNA 1VF7A 4LAAA 1G2TA 4TQUS 5CV6A 2BA0A 2PO4A 3HS0C 1JICA 1R4QB 3RZOB 1JE4A 1C48A 2O4XA 4K6LA 5ELFA 3T13A 2EOTA 1MGSA 2AWNA 5C3EB 1ML0D 3R2IA 3GTLB 4G57A 1A2UA 2X6GA 5M9OA 5G3LF 1TVXA 1XYIA 2B2TC 1QCBD 3MFYA 1TQOA 1S5FD 2GA4B 3GD7A 5IGEA 5JVH3 1S5CD 5DM63 3MXNA 3SVMA 3J7YW 3VYUA 5CMDA 4V0BA 1II3A 3SHLA 3MAQA 4NKLA 3NTHA 2ICEC 2QDBA 4ZRZA 2EVBA 3GTPB 4CKCA 1SE3A 3T51B 1MD2D 2NBFA 1I4GA 2G9HD 2WB1B 3GP7A 3J81E 1B4OA 3MFGA 2MHVA 5LHY1 3PO3B 1SMYD 2EYMA 5EQ0A 1HUMA 2L0CA 1HUNA 1U9RA 5EKKA 5J22A 3MC0B 2QILA 1E2WA 4HMIA 1KDAA 1M8AA 4BBSB 4GZYC 1AP0A 3NQTA 4C56C 3OWEB 1O7ZA 1KNEA 2XNAC 3BVMA 1LT5D 1TT2A 1B3AA 1STHA 2XIWA 4J1MA 3J80L 3A56A 2OF1A 3N6RA 3DWQA 2F0JA 5JEAG 5IT9L 1PRTF 3TN2A 2A73B 3HOUB 2IPKD 3FMCA 1VDZA 3R8BA 1LABA 4TRDA 1O80A 2K32A 5COYA 1A2TA 1LTTD 1RCVD 1WTRA 2SOBA 3MZ5A 5LL6X 5IGFA 2EJFC 2IX0A 1E0BA 3KLSA 1F2MA 2K7VA 5ELEA 1HTLD 4CHTB 4QCLA 1EU3A 1L0YB 1BUVT 3QOJA 3WDNA 4LMQD 4RFBA 1HCZA 1H9SB 4CJ0B 4IALA 1BCPC 5KRUA 5C4JB 2NWGA 4TKOB 4FNFA 2PW5A 2F0LA 1BXTA 1BR9A 5I4DA 4KD4A 3D8GA 1V1PB 4I65A 1CTMA 4CJ2C 1F77A 2LMCB 2BCOA 4FF2A 4FP5D 1Y8OB 1G8ZD 1D5ZC 2CW0D 2OEOA 3S2HB 5D14A 4CJ1B 1FR3A 1U4MA 3K5MA 4C1NK 4Q0FA 5J1ZA 3A8JE 3ND8A 4QB4A 2WKDA 2SDFA 1CI3M 3GTQB 2B63B 5I6YA 2AQ1B 3D6WA 1TWCB 3A7AB 3F2UA 3M7GA 4DAPA 1WTQA 1NUCA 3LX0A 3TMEA 2R6GA 1EYDA 2EZVA 2F03A 2SEBD 1V8QA 2NN6G 1LT3D 5KIXA 1QILA 1ESRA 5I2YA 3S9WA 3NBIA 4RKLA 4O42A 2QEJC 1CFMA 1SEBD 3IAYA 1V1PA 1UNSA 5I2XA 1STAA 2J4XA 1T5XD 4G7ZC 1ILPA 4K5VA 4C3HB 3NSWA 4G7HC 1TS3A 1CK1A 2AUJD 3BVGA 1Q8IA 1WD1A 2NYZD 3O13A 3PV0A 4U68A 1TS2A 1PDQA 1XXGA 2HDLA 1B9NA 3SR1A 1KNAA 3W2DA 1G291 3MHBA 3RMHA 3NPPA 1T5EA 2E74C 4OHJA 3Q24A 1BO0A 4RWSC 4H13C 4XQQA 4EQOA 3H6MA 3HP3A 2NVYB 3MA2B 4HCSA 4NP5A 4OL7A 1QWYA 3PMFA 3VR4A 2A5HA 3RUZA 3IKJA 3DWAA 3AB9A 1SNPA 1B53A 3KF8A 2BE5C 2TMPA 1DJRD 5KNDA 3UI2A 4K8JA 5JJZA 1Z47A 3P1HA 4JK1C 1ET6A 4H7BA 2BDNA 5JEAH 2Q8TA 2M2LA 2KVMA 1UUPA 2EYJA 4QIWB 1JWUD 2KOLA 1RF2D 4BS9A 1MBYA 1SNQA 1PTOF 4XQNA 2A6HC 2B2UA 4ZKBB 1RTNA 4KY7A 2H4OA 4S3SA 2F3VA 2L5TA 4XTCS 2XRQD 4KV6A 3VYSA 3Q23A 1STYA 1PZKD 2KCCA 2F3WA 2MP1A 3BDCA 5CV7A 1SYCA 4FVMA 2LKVA 3BDLA 4I7ZC 4XYQA 4OGQC 1EL0A 1ET9A 4ME5A 1GUTA 1ILQA 4PMWA 1TKWB 4N9TA 1J9OA 5A2QE 3TSSA 4IUVA 3AMUA 2IX3A 2EJGC 4X3SA 3PUXA 1LT4D 1I4RA 2FJ2A 2K5DA 4K5WA 1QE6A 4X3UA 1EZ6A 3M85A 4OIKA 3HRZC 2EY1A 3T4AC 4IUPA 4KJOA 2WV6D 2Z4IA 3M4YA 1EIGA 2A74C 2PZUA 1TWHB 2L1BA 4KHZA 4IURA 1BBXC 3L3OC 4DU9A 1IYVA 2VUMB 1EOTA 4XIGS 2NN6H 5CV8A 5I9PA 4HTHA 1H9RA 4XQJA 2B8GA 4DAYA 1B50A 2WACA 1DZ1A 1IKMA 2E2JB 3S1NB 2AUKA 2BDOA 5CGKA 2N88A 3K6OA 3OOCA 2RDGA 1V43A 3K5LA 3URYA 4RH6A 5M5WB 1C8CA 4FF1A 5JEAJ 3A8IE 3IL8A 3JAML 1QNUA 1IW7C 4KD3A 3M3YB 5CC4A 1YNJC 4DA2A 1ZYRC 3PUWA 1SFOB 1S5BD 1RDPD 2PQEA 4K2KA 3I8ZA 4XXEA 1EY4A 3H09A 4K5XA 1JOQA 3P7JA 2EYLA 1OXUA 3D4WA 5EBDA 2E2IB 3HG9A 2B2VA 3FPUB 1JQYD 4IUNA 1SYDA 5ISRA 4U673 1BOSA 2KEEA 5JPMC 3VYTA 2B2YA 1LT6D 3W3AA 1CA5A 4L6TB 2BOSA 2O5IC 2DY7A 2IT1A 3Q6SA 2HDMA 2EY5A 4A3BB 4ZLTF 3SK4A 5C5LA 2CHBD 4H0LC 3P20A 1RD9D 1AFPA 4EQNA 1PRTD 3OSOA 4RCOA 3BZDB 3TP7A 5EJWA 4CKEA 1FGBD 2IJ0A 2WAQB 3PIP3 5T1IA 4PV1C 5T1GA 3G6JB 2JA8B 3KBGA 1C4QA 5ELDA 4ID6A 3R93A 5C4HA 2KHSA 1AZQA 1QOHA 3VR6A 4KTAA 3VR2A 4RGMA 2N55A 5IGBA 1SXTA 1XX8A 1A3TA 1S4ZA 1AN8A 1WTWA 4LK1C 2MJ8A 4KKSA 4BY7B 1FYCA 5K36G 1DONA 3I90A 1WTVA 1Y1WB 2E2DC 1GUSA 4FF4A 1K83B 5CYUA 1EYAA 1D6EC 5D3DA 1SMYC 3TP6A 2A69D 1OXXK 3WOFA 3DMUA 3H0GB 2M9VA 1PZID 3CU7A 1WD0A 2D9UA 3CRKC 3ONAB 2EE1A 3NE5B 1H9JA 1Y8NB 2LY7A 1SBBB 3KLRA 3FEWX 4M1UB 4K6DA 4B08A 3I91A 4DAVA 1M4VA 2YYZA 4IZ8A 3VA7A 3GTMB 1IKLA 5AFWA 1IL8A 4Y7NB 3PIO3 2WINB 4TSSA 4HEDA 4BY1B 1L0XB 4IUUA 2NVQB 1CHQD 1ESFA 1EY0A 3KUPA 5E4XA 2F0NA 2Q8RE 2CQAA 1U4LA 4C2MB 1JCKB 2F1MA 2K33A 4E6IA 3SK8A 3NUCA 4KY6A 1TR5A 4R9WA 2NZ1D 5ELCA 3OIQA 4DFAA 2E2HB 3KLSX 1X32A 1LTGD 4ABNA 2IWHA 4ZKCB 2F4IA 1STEA 1I3QB 1FNVA 2TSSA 2F0MA 1GOZA 1GHKA 3V96A 2KUMA 1SJED 5IODA 1JOOA 1B1ZA 2B2WC 5M3MB 3EJIA 3K5OA 4ZUJA 2A6ED 2F0QA 1G2SA 2CVRA 3HOXB 2L12A 4WJWA 4ZK9B 2AWOA 5KYIA 2Z8LA 4RA8A 3IFTA 3PUYA 2D2CC 2CW0C 5DAUA 3Q0AA 4RGNA 2PZTA 4C3IG 2A68C 1OXTA 1SJHD 4FO2A 1RTOA 1CM9A 2HCIA 1PTOD 1HA6A 2K1BA 1HPCA 2L11A 3DEOA 2R61A 4DN4M 2B39A 1EY5A 1HQRD 2XSCA 2F0OA 1NR4A 4OO1I 2L55A 2X69A 3D4DA 1DM0B 2A68D 3NK9A 4IFDI 1ENFA 3TP8A 5FO9B 2RSOA 1B2TA 5JOBA 5K36H 5C4XB 1H9SA 1GUNA 4XT3B 1CQFA 5C0XI 1OXSC 1EQVA 3TDQA 5NUCA 2NVTB 1SNMA 1Q1EA 4DK0A 1KLGD 3J80E 3FPPA 1FD7D 5IT9E 1B44D 5I9OA 2JXMB 3HKZB 3QJYA 1U4PA 1JWMD 1EWHA 1EEFD 1OO9B 2B8FA 1D2BA 2EPBA 2L9HA 4B9WA 4EGVA 1HXYD 1S5ED 2EXZA 2RVLA 4X3TA 4FYDA 2WKCA 5DM73 2R3ZA 3K7AB 4FXKC 3S15B 5J39A 3LNNA 5CV5A 4KHVA 5CV4A 2E75C 3EFXD 1ICWA 2IL8A 3CQZB 1MSGA 4RGTA 2QCPX 2ZXPA 3ITPA 3T53B 4RCNA 5FO8B 2EYPA 3J7AV 1K8MA 1WTPA 2M00A 1A3UA 1NAPA 3NXWA 4P2CB 4ZYSA 4QUCA 1HRJA 3TP5A 3V2TA 1CQVA 1Q3LA 3H94A 4YIJA 2ZXRA 4IQZA 4QMGA 3U9OA 3M7NA 4ODGA 4ILWA 5E1FA 4ZAIA 3DWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBH A;  4DAY A;  3MXN A; 
#chains in the Genus database with same CATH topology
 4RGO S;  2LFN A;  2RF4 A;  2EYH A;  4HCE A;  4A3D B;  4NW2 A;  3VR3 A;  3CHB D;  3SK5 A;  5CBA E;  2VUM H;  3L0O A;  3C3L A;  2YU9 B;  1YHA A;  1BBW A;  4JI5 L;  1Q90 A;  1KLU D;  1JWS D;  2D0P A;  4DXF A;  2K28 A;  3J81 i;  4A3F B;  4DK1 A;  4RHS A;  3I4M B;  3FVQ A;  4WJ3 M;  3BDO A;  1NTG A;  4QUF A;  3C1E A;  2ZT9 C;  3PO3 G;  4A3G B;  1STB A;  3W1B A;  4DR4 Q;  1BCP F;  2B2T A;  3EQL C;  4AH6 A;  4UP8 A;  1WYD A;  1HR0 W;  1VQF A;  2F0T A;  2E2J H;  4BY1 G;  1NE3 A;  4A3C G;  5C3X A;  3I3C A;  4MN3 A;  3S1N H;  4KI0 A;  4GKK Q;  5BN4 A;  5KEE A;  1NCV A;  1IXR A;  3BVZ A;  4LF7 Q;  4JW0 A;  1ENC A;  2PPB C;  4N9P A;  4Y52 H;  4F7X A;  1Z6H A;  3PIP A;  2HHH Q;  2I46 A;  1Q8K A;  1DD2 A;  4G7O C;  4O0A A;  3AU7 A;  4LF6 L;  3H3V I;  1K8O A;  5COR A;  4NXN L;  3RLF A;  1PH3 A;  3U58 A;  1SE8 A;  5DLQ E;  2PZW A;  1EY8 A;  3M3Y H;  4WOR A;  1EOV A;  1TY2 A;  3G4S A;  3OTO L;  2ENB A;  1JC7 A;  5EGT A;  4AQY L;  2HIX A;  1XNR L;  3TRZ A;  1UEB A;  1BF4 A;  2XGT A;  4LW1 A;  4OEL B;  3CAM A;  1SFO H;  1YJ9 A;  2LS0 1;  4QF4 A;  3DUZ A;  5FLM G;  3R3O A;  1CHP D;  2OXP A;  4OON A;  5LMU L;  2I07 B;  2ZM6 L;  2XWB B;  4B9X A;  1PH9 A;  1DOL A;  4JI2 Q;  5ELN A;  2E2I H;  2XVS A;  1YVC A;  4DR2 L;  3UDF A;  1C7Y A;  2H1E A;  4UY8 C;  3RR5 A;  5KGU A;  4B3T Q;  1A3V A;  4ZQ3 A;  3BS1 A;  2YTX A;  1F9P A;  4OX9 L;  3S16 B;  5M3M G;  4HN7 A;  2ZTC A;  5EPJ A;  5G3L D;  1HNX Q;  2JQO A;  5IE8 A;  4H44 C;  4LFB L;  3NWT A;  1X6O A;  5FLX L;  5EBC A;  1ZXT A;  3L7Z C;  2RSN A;  4NMZ A;  3WOE A;  2F0G A;  3W5O A;  4YY3 Q;  1HTP A;  3HOX G;  2K05 A;  4YHH L;  3GV6 A;  2VQF L;  2ZXO A;  1CSP A;  4K2L A;  2B29 A;  3ERO A;  1EU4 A;  4A3B H;  4J15 A;  1HA5 A;  2F0D A;  4KKT A;  4J8Q A;  1GXD C;  2B3G A;  3MEH A;  1PTO B;  1E2V A;  3QR8 A;  3BYT B;  4DGZ A;  4ULL A;  4JV5 L;  2WAQ E;  3E6Z X;  4L63 B;  1AW7 A;  1LTB D;  2QW7 A;  2IHE A;  2EYO A;  1SE4 A;  4HJ9 A;  4QQB X;  1VQ5 A;  3PIO A;  3A7L A;  1LTA D;  4DR7 Q;  2ES2 A;  3SGI A;  3NBH A;  2ICI A;  1KC8 C;  1NMF A;  2VY3 A;  2RDH A;  3K8A A;  2F0S A;  4OO1 G;  1FJG L;  2JA8 H;  3D3R A;  4BBR B;  1KDC A;  1QUQ B;  2V1C C;  4JI6 Q;  5IP7 H;  1IYU A;  2FXQ A;  3EBE A;  2UU9 Q;  1PZJ D;  5K5P A;  2ZTD A;  5IP9 G;  3S1M B;  1I6H B;  3G6E A;  5BN5 A;  5C0X G;  4A75 A;  4BY7 H;  1A15 A;  3NTI A;  1YJN A;  5C4X G;  5EKI A;  1BNZ A;  1VQO A;  5E4W C;  2FMM A;  3CRL C;  1STG A;  4MTK A;  4IPH A;  1XPR A;  1WVL A;  4KJN A;  3H91 A;  2VB3 X;  4JBJ A;  3SEB A;  2VNU D;  1PRT C;  2RQX A;  3E0J A;  2JEB I;  2CQO A;  3Q8D A;  1PYW D;  2NTS A;  1K83 H;  3MWY W;  1EY9 A;  1ICF B;  1VQ9 A;  2RDF A;  3J80 i;  4MZ9 A;  4GNX A;  4GLX A;  3RLO A;  4ZCK A;  1XJV A;  4C3H G;  1LO5 D;  4O1N A;  1KAB A;  3HZX A;  3J81 L;  3TZU A;  1GJX A;  1X3E A;  3H0G H;  5FK9 C;  4F87 A;  4PMC A;  1B7Y B;  1TWA B;  1X3Q A;  3GTO B;  1UAP A;  1VCI A;  5A35 A;  4LJZ C;  4CKB A;  1V1Q A;  5JPN C;  3VR5 A;  3RD4 A;  1D1I A;  2L4N A;  2SNS A;  4KN4 C;  3EIV A;  1NR2 A;  1ZKO A;  1QJO A;  1YNN D;  2DN8 A;  2FMC A;  3ERS X;  1DXM A;  3GTG B;  1W2B A;  3GTM H;  1FNU A;  1OXV A;  2OWO A;  5D3I B;  4LFC L;  4F8M A;  5M3F B;  4JCV E;  3TZD A;  4Y7N H;  4A3L G;  5BN3 A;  1PFN A;  1PMR A;  3G7L A;  1OTC A;  2PNH A;  2QA4 A;  2VS1 A;  1EZ8 A;  4A3E B;  4CBV A;  1SSO A;  3MXN B;  2PCF B;  1EIF A;  4LF8 L;  1L1O B;  1WCM H;  4BY1 H;  3S2D B;  3CF5 A;  1I50 B;  2NTT A;  4DV0 L;  2NVQ H;  5IIF A;  4JI3 L;  1CZG A;  1ROD A;  2JSO A;  2KJX A;  1H9K A;  4LF5 L;  1SNC A;  1EQT A;  2A69 C;  2CCZ A;  4C2M H;  4R4T A;  4NB3 A;  2B2U C;  1EFI D;  1QVC A;  4DUY L;  1O7L A;  5TSS A;  3OW7 A;  3SE0 A;  3JAM E;  1L2F A;  5HGT A;  5M5X B;  3F2B A;  4HJ7 A;  1H9M A;  1TU2 B;  4X64 L;  3ND9 A;  1EYC A;  1V1O A;  3BZC A;  1VMP A;  4B3R L;  2MUY A;  3OWF A;  2EIF A;  4R8I A;  4RG1 A;  2KEC A;  1VQN A;  4HR7 B;  5CV9 A;  2O5J C;  2K5Q A;  4NDX A;  2E2H H;  5FLM H;  3HOZ B;  3OMC A;  4LFA L;  4NXN Q;  3GQB A;  5IGC A;  2Z4H A;  1IBL Q;  1I3Q H;  4GN4 B;  4JI1 L;  1Y1V B;  3OTO Q;  4AQY Q;  2XN9 C;  4DV1 L;  4A3D G;  3E5S A;  4X3K A;  4UP7 A;  1DCZ A;  1D5X C;  5M3M H;  4A3F G;  2DNE A;  1EY7 A;  4IUT A;  5EPK A;  1SYB A;  3DHQ A;  3I4M G;  5IYD G;  2R7F A;  1XPO A;  3K7U C;  3X3N A;  4DR2 Q;  1CT1 D;  5FO7 B;  3HOX H;  3HOV B;  2R7D A;  1MSH A;  2HQE A;  4OX9 Q;  4MIU A;  3I4L A;  3MXP A;  2YV5 A;  1WCM B;  2MNA A;  2K04 A;  3NEM A;  4HSV A;  3HGB A;  1F2Z A;  3T1Y L;  4LFB Q;  2WFW A;  3NQI A;  2CWA A;  1EIY B;  3QB3 A;  2FFK B;  2RKS A;  3MXU A;  2RCN A;  3H3V C;  4KN7 C;  1E2Z A;  4YHH Q;  1DOM A;  4DV7 L;  2VQF Q;  2WII B;  3K80 C;  3KYH C;  2R7Z B;  1KL9 A;  1RKN A;  2Z9H A;  1JR0 D;  3PF4 A;  3X3M A;  4DNI A;  3T1H L;  2QF7 A;  1PLF A;  3PUZ A;  4DR3 L;  1X3P A;  5C4Z A;  3PSI A;  2Q2I A;  1D5M C;  1HZA A;  1N8R C;  1ASZ A;  1XPU A;  4JV5 Q;  1EWI A;  2KCN A;  3CCE A;  2R93 B;  4OO1 H;  2K52 A;  2F0F A;  3FKI B;  4IFD H;  1SYG A;  3F2D A;  2Y0S B;  3A5U A;  3D6C A;  2A6E C;  5ELB A;  3GTJ B;  3TBI B;  2P5Z X;  3OPO A;  5C5M A;  5IP9 H;  5KNB A;  2C5C A;  2AQ2 B;  4C1N I;  5C0X H;  1WTO A;  3CCQ A;  2NZO A;  5C4X H;  4QJF A;  1FJG Q;  1VQC A;  3A8K E;  1SR3 A;  4HAE A;  2OTL A;  4L8J A;  4GS3 A;  1HFN A;  2ID0 A;  2VUM G;  5C44 B;  1RHP A;  2NVT H;  2KQ3 A;  5I6W A;  3QG1 A;  2RA4 A;  1LAC A;  1KDB A;  4K8I A;  2ZJR A;  1ONL A;  1CA6 A;  2V4D A;  1HNZ Q;  3FHW A;  4LF7 L;  2N8N A;  4UAI A;  1S5D D;  3EVQ A;  4RMF A;  4C3J H;  3GO5 A;  2NUC A;  5JAV A;  2MGS A;  4FXG C;  2CWP A;  2K75 A;  2HHH L;  1PTO C;  1QG7 A;  1E1T A;  4DXG A;  1KAA A;  4BA2 I;  3FRP B;  5IOC A;  1NNX A;  3DEP A;  3J81 j;  3I56 A;  1DYQ A;  2C35 B;  5C3W A;  2HT1 A;  3K59 A;  2B2V C;  3KLW A;  3K81 C;  2EY6 A;  2YTY A;  1I5F A;  2ZJQ A;  4YWL A;  2XWJ B;  3S17 B;  2E76 C;  3DM1 A;  2B2Y C;  4IUQ A;  3I7F A;  1G6Z A;  1ASY A;  3S15 H;  1UEA B;  5FKA C;  3L9A X;  2WP8 J;  1TWG B;  1Y8P B;  4DNT B;  1GVP A;  3STB D;  5KNC A;  1PH4 A;  1ZEQ X;  4KHP L;  4BBR G;  2QKI C;  2K6A A;  3NP8 A;  2MPM A;  4A93 H;  4JYA Q;  1JOR A;  2X6L A;  1VQK A;  3MVV A;  1F9Q A;  2F0E A;  4V19 0;  1BCP D;  4Z9C B;  4DF7 A;  1K0S A;  4LF9 L;  3M4Q A;  1SNO A;  3A54 A;  1GUW A;  2IW3 A;  1GUG A;  1Q81 C;  4LF8 Q;  4OWT B;  3AEV A;  4DV0 Q;  1SLJ A;  1EUJ A;  1E24 A;  3J80 c;  2FHT A;  3NWS A;  4JI3 Q;  4RAU C;  2EY2 A;  2VW9 A;  1W6J A;  5IT9 c;  2OQK A;  4WRD A;  2BH2 A;  1VQJ A;  2DUD A;  1UE7 A;  3A5Z B;  2VXW A;  5E3F A;  3IRB A;  1A63 A;  1PRT B;  1WFQ A;  2YTV A;  1Q7Y C;  1SRO A;  2Z6B A;  4DUY Q;  1YI2 A;  4C3J B;  3DXJ C;  4YWK A;  3G71 A;  2NB0 A;  1LLR D;  2OT2 A;  3NTK A;  1N36 Q;  1XTC D;  2PW7 A;  1U4R A;  4A3B G;  1C0A A;  1WTX A;  3BG3 A;  5H1S E;  4A3M H;  2AQ3 B;  2BA1 A;  2FIN B;  4X64 Q;  1HHV A;  1W6K A;  1FVI A;  1CSQ A;  1RJT A;  4A3D H;  4B3R Q;  5D65 A;  2YU9 H;  4PQX A;  4HMJ A;  1TY0 A;  4LFA Q;  2RHQ B;  4A3F H;  4OIJ A;  5GRO A;  4UDU C;  3KF8 B;  1J8I A;  2JE6 I;  1XNQ L;  4JI1 Q;  4P74 A;  5IYD H;  1R9T H;  4HSP A;  4M8A A;  4R8N A;  5M3F G;  4IFD J;  4A3G H;  2J7Z A;  4DV1 Q;  1VS0 A;  3QO2 A;  1LV9 A;  5A2Q L;  1L1O C;  4A3K B;  2NVX B;  4A3E G;  1CKM A;  4A3J B;  3PO2 H;  5C0X J;  3LWE A;  1EY6 A;  5LMN Q;  4IJL A;  4A93 B;  1R4P B;  4EQP A;  4QGU A;  2R92 H;  3U50 C;  4IOC A;  1Q86 C;  3I55 A;  1X3F A;  1LTS D;  4BY7 G;  2K03 A;  4CDE C;  4IOA A;  1CUK A;  3H3V H;  2OCE A;  2I5L X;  2C9O A;  2O2L D;  1B70 B;  3N52 A;  1QB5 D;  1F9R A;  2F0H A;  3KFU A;  4F88 A;  1D1K A;  3MTS A;  1XMO L;  3C1F A;  1MHW C;  3VYR A;  1XWE A;  3QWN A;  3M4O B;  3JAM i;  4DV7 Q;  3GTK B;  1AZP A;  2MQH A;  5IGG A;  5DEH A;  3T1H Q;  4PNY A;  4CGY B;  4DR3 Q;  1I4P A;  5L37 A;  3H0G G;  4MHE A;  3HOW B;  3S1Q B;  4A3M B;  4YCW A;  4JBK A;  1Y1V G;  1PH6 A;  3R2T A;  4P75 A;  1TII D;  2D62 A;  1EWC A;  1Q12 A;  4K14 A;  1JOK A;  1MIU A;  3S1R B;  1PFB A;  3S16 H;  1BKB A;  1LTI D;  1PYS B;  3QOL A;  1CZW A;  2IX1 A;  3SDZ A;  1R9T B;  1DOK A;  2BE5 D;  3I2Z A;  3KF6 B;  3BYY B;  3D31 A;  1UWV A;  2F0V A;  3C46 A;  2JYO A;  4K0K L;  3V05 A;  4CDD C;  3HEJ A;  4ZUI A;  1PFM A;  1NSN S;  3PO2 B;  1NMG A;  1WCM G;  3ICE A;  3CKI B;  1KTK A;  4LUV A;  3LWU A;  4JBW A;  1DGS A;  3KK7 A;  2R92 B;  1PTO H;  1SAP A;  3K57 A;  1IYJ B;  3ULL A;  2KA7 A;  1JB3 A;  4BA1 I;  1N33 L;  3HFZ B;  3ER0 A;  1SDF A;  3FDT A;  3M4P A;  3OMG A;  4XYO A;  1GUO A;  1MKH A;  2K5W A;  4DKA C;  2JA6 B;  2DNC A;  1EYG A;  1SYF A;  2F0P A;  4NPS A;  3CCJ A;  2DY8 A;  2A6H D;  1IBL L;  1PH1 A;  4OWX B;  1X56 A;  3J7A F;  2R93 G;  1Q82 C;  1B9M A;  2L15 A;  2Q8I B;  3I73 A;  1GM5 A;  4BBR H;  5F2D A;  2KCT A;  3KDF B;  1AEX A;  2Y0S G;  2RBM A;  4DAY B;  4BWG B;  2Z1C A;  1KIX A;  1QNK A;  1I94 L;  2K14 A;  4CDF C;  2PI2 E;  3S1M H;  1I6H H;  4B3M Q;  3CC2 A;  4FF3 A;  2HUG A;  3QIA A;  2J0T D;  3T16 A;  4DR1 Q;  4PG3 A;  4HJ5 A;  1PYB A;  1VF5 C;  2A8V A;  4KHP Q;  4AYB B;  1Q1B A;  1I4X A;  1SE2 A;  2UUA Q;  2QGQ A;  4OWW B;  3A0J A;  3KBX A;  3I4N H;  5C44 G;  3NEN A;  1Y69 U;  1EIH A;  3Q22 A;  4X62 L;  4WFN 3;  1O78 A;  4LF9 Q;  4OEM B;  2HCC A;  5LL6 S;  4DR6 L;  1PA6 A;  1LTR D;  1F9S A;  5C6A A;  4KK7 A;  4JOI A;  4KMU C;  5DNF A;  3MXG A;  5KYL A;  1O7I A;  3RZD H;  1Z7T A;  3A55 A;  3D4R A;  4DK6 C;  2XRS D;  3CC4 A;  1PH5 A;  1LTL A;  1HQM C;  1WI5 A;  3CCS A;  5ELO A;  4L5S A;  4JVZ A;  1TWA H;  3GTO H;  5M5Y B;  3F1Z A;  3NHH A;  2F0I A;  3I70 A;  1K0R A;  3S14 B;  2D5D A;  2D0O A;  1O7Y A;  2F0K A;  2F0W A;  4XT1 B;  3GTG H;  3ZYY X;  1JT8 A;  3T56 B;  3K58 A;  4Q5V A;  1BCP B;  5M3F H;  1SND A;  2JP1 A;  2UUC L;  1TS5 A;  2I0Q A;  4KY5 A;  2Z6K A;  4A3I B;  2G9D A;  1D7Q A;  1HH2 P;  1G91 A;  4A3E H;  5CBE E;  1PXU A;  4C3I B;  5GAE C;  3K5N A;  1IBM Q;  3OIP A;  3S2D H;  3GV3 A;  4IFD G;  1I50 H;  1XNQ Q;  4DNR B;  3TRE A;  2B2W A;  1EEI D;  1VQE A;  1VQD A;  3ERQ A;  3IFD A;  1SYE A;  3K0Y A;  3OHX C;  1VQ8 A;  1VMC A;  4N8X 1;  1YHQ A;  4J6H A;  3RZO H;  1IHZ A;  1YHB A;  2DJF C;  1BDO A;  2K01 A;  1HNZ L;  2F0U A;  1I4Q A;  1HFG A;  2EDG A;  5IGD A;  2ASB A;  4AIM A;  2PNR C;  3I4N B;  5M5X H;  3MEF A;  4PMB A;  3VA5 A;  5HUR A;  3I72 A;  3CCR A;  2JEA I;  1YNN C;  3CD6 A;  1GO3 E;  3UDG A;  4FXD A;  4RKB A;  4C3J G;  4PZ8 A;  5JVG 3;  3CME A;  2KED A;  1IW7 D;  3RZD B;  1X65 A;  1XMO Q;  5CR3 A;  5EPL A;  1I6V C;  3RLN A;  3HOZ H;  2JA7 B;  2RHS B;  2EQS A;  1I4H A;  2EYF A;  3PUV A;  1MI2 A;  3HKZ G;  1YNJ D;  3AQQ A;  5FOB B;  4QY7 A;  1IBK Q;  1BQQ T;  2JA5 B;  3SXH A;  4XDX A;  1Y1V H;  1ZYR D;  4RHR A;  2NN6 I;  5IYC H;  4EVO A;  4JI8 L;  1QUQ A;  3EA6 A;  2SNM A;  4R4I A;  3P75 A;  3HOY B;  1TWF B;  1A6X A;  5FLX c;  2A19 A;  1FNW A;  5BR8 L;  1VQ7 A;  4G4K A;  1TS4 A;  1ENA A;  2PYK A;  4A4I A;  5LMN W;  4JYA L;  1F2L A;  3J7A 5;  5FLX E;  1B8A A;  2VB2 X;  2EJM A;  2PMZ B;  3C2P A;  4KKU A;  4LUZ A;  3HOV H;  4IN3 A;  4YCU A;  4LUO A;  3SK6 A;  3U9S A;  2PI2 A;  1GHJ A;  4JPB W;  5EKL A;  1F2Y A;  1STN A;  1U5K A;  1VF7 A;  4LAA A;  1G2T A;  2LSS A;  2MFI A;  4A3J G;  1YEZ A;  1T9H A;  4TQU S;  5CV6 A;  1WOC A;  2BA0 A;  2PO4 A;  3HS0 C;  4A93 G;  2CH4 W;  4L5T A;  1JIC A;  1R4Q B;  4K0K Q;  3RZO B;  1JE4 A;  3KOJ A;  1C48 A;  2R7Z H;  2O4X A;  4K6L A;  5ELF A;  4GKJ Q;  3JAM c;  1CKN B;  1GKH A;  3T13 A;  2EOT A;  3M9B A;  1MGS A;  1N36 L;  2AWN A;  2Y0S E;  5C3E B;  1ML0 D;  5GQO A;  2I5M X;  3R2I A;  1VQL A;  4G57 A;  1X9N A;  1A2U A;  2X6G A;  1J5E L;  3GTL B;  5M9O A;  5G3L F;  2R93 H;  1N33 Q;  4BBS H;  1TVX A;  4YWM A;  1XYI A;  2B2T C;  1QCB D;  1A0I A;  3FKI H;  3MFY A;  1TQO A;  1VQ4 A;  1S5F D;  2GA4 B;  5IYB H;  4CDC C;  3GTJ H;  3GD7 A;  4EX5 A;  5IGE A;  4HIM A;  1KRT A;  3CC7 A;  5JVH 3;  1S5C D;  2GVA A;  4A3M G;  3CMA A;  5DM6 3;  4P72 A;  3MXN A;  3SVM A;  1L1O A;  3J7Y W;  3VYU A;  1P8L A;  5CMD A;  4V0B A;  5C44 H;  1I94 Q;  1II3 A;  3SHL A;  3MAQ A;  3HOU H;  3RN2 A;  4NKL A;  3NTH A;  2ICE C;  2JN4 A;  5LMN L;  2QDB A;  4ZRZ A;  2EVB A;  3GTP B;  4CKC A;  1SE3 A;  1UE5 A;  3T51 B;  4A3G G;  4NXM L;  1MD2 D;  4DV2 Q;  2NBF A;  3TS2 A;  1I4G A;  1HNW L;  2G9H D;  2WB1 B;  3GP7 A;  3J81 E;  1B4O A;  3PO2 G;  3MFG A;  4X62 Q;  1N9W A;  2MHV A;  4P73 A;  4DR6 Q;  3I4O A;  5LHY 1;  2R92 G;  3F2C A;  3PO3 B;  1SMY D;  2EYM A;  5EQ0 A;  1JJ2 A;  1HUM A;  4GN5 A;  4B3S Q;  2L0C A;  1HUN A;  1U9R A;  4IPC A;  1VQB A;  5EKK A;  5IY0 A;  5J22 A;  2JA6 G;  3MC0 B;  4ME3 A;  3S17 H;  2QIL A;  1E2W A;  1K73 C;  4HMI A;  1KDA A;  1M8A A;  1TWG H;  1YIT A;  4BBS B;  4GZY C;  1AP0 A;  4DAM A;  1V9P A;  3NQT A;  4C56 C;  1LUZ A;  3OWE B;  2NZH A;  1O7Z A;  1KNE A;  2XNA C;  3RNU A;  1YJW A;  4LNQ A;  2UUC Q;  2DGY A;  3BVM A;  1S72 A;  1LT5 D;  1TT2 A;  2QDL A;  1B3A A;  1STH A;  2XIW A;  4J1M A;  3J80 L;  4AYB G;  3A56 A;  2OF1 A;  3N6R A;  1C9O A;  1HJP A;  1XTD A;  3DWQ A;  2F0J A;  5JEA G;  2OQ0 A;  5IT9 L;  1PRT F;  3TN2 A;  3EN2 A;  2A73 B;  3HOU B;  1BVS A;  2IPK D;  3FMC A;  4L5R C;  1VDZ A;  3R8B A;  2UXC L;  1LAB A;  4TRD A;  2LXJ A;  1O80 A;  2K32 A;  4LF4 L;  5COY A;  4APV A;  1A2T A;  1LTT D;  3HKZ E;  1H95 A;  1RCV D;  4X65 L;  1TWC H;  1WTR A;  2SOB A;  3MZ5 A;  5LL6 X;  5IGF A;  4R1J A;  2EJF C;  2IX0 A;  4EQ5 A;  1E0B A;  3KLS A;  1F2M A;  2K7V A;  5ELE A;  3STB C;  1HTL D;  4CHT B;  4QCL A;  4HJ8 A;  1EU3 A;  1L0Y B;  5JJK A;  1BUV T;  3QOJ A;  3E9H A;  3WDN A;  2GN5 A;  4LMQ D;  3HKS A;  4RFB A;  3J7Z C;  1HCZ A;  2Q2U A;  1H9S B;  4CJ0 B;  4IAL A;  1BCP C;  3ZJY C;  5KRU A;  5C4J B;  1QZG A;  3U4V A;  4A76 A;  2NWG A;  4TKO B;  4FNF A;  1SMX A;  2E5L L;  2PW5 A;  2F0L A;  4GLA C;  1BXT A;  1BR9 A;  4JI8 Q;  4B3M L;  5I4D A;  4DR1 L;  4A3K H;  2NVX H;  4GNX C;  4KD4 A;  4MNO A;  3D8G A;  4A3J H;  1V1P B;  2F52 A;  4I65 A;  1CTM A;  5BR8 Q;  4CJ2 C;  2UUA L;  1F77 A;  2LMC B;  2BCO A;  4KLK A;  1QZH A;  4HIK A;  4FF2 A;  4ALP A;  4FP5 D;  1Y8O B;  1G8Z D;  2ZTE A;  1D5Z C;  2CW0 D;  2OEO A;  3S2H B;  5D14 A;  4CJ1 B;  1FR3 A;  3UE0 A;  1U4M A;  3K5M A;  4C1N K;  4Q0F A;  5J1Z A;  3A8J E;  3ND8 A;  3I4N G;  1Z9F A;  2WKD A;  4QB4 A;  2ZJP A;  2SDF A;  1CI3 M;  3M4O H;  3GTQ B;  3GTK H;  2B63 B;  5I6Y A;  2AQ1 B;  3D6W A;  1TWC B;  1N34 Q;  3A7A B;  3F2U A;  3M7G A;  4DAP A;  1WTQ A;  1NUC A;  3LX0 A;  3TME A;  2PQA B;  2R6G A;  1EYD A;  2EZV A;  2F03 A;  2VZA A;  2SEB D;  1V8Q A;  2NN6 G;  1J5E Q;  1LT3 D;  3HOW H;  5KIX A;  3S1Q H;  1QIL A;  3CCL A;  1ESR A;  5I2Y A;  3S9W A;  3NBI A;  4O42 A;  4RKL A;  2QEJ C;  2LXK A;  1CFM A;  1SEB D;  1Q46 A;  3IAY A;  1V1P A;  1LYL A;  1UNS A;  5I2X A;  1STA A;  2J4X A;  1T5X D;  4G7Z C;  5GAH C;  3S1R H;  1ILP A;  2H5X A;  3HOY G;  4K5V A;  4C3H B;  2JJQ A;  3NSW A;  5FJ8 G;  4G7H C;  3AFP A;  1IBM L;  1TS3 A;  1CK1 A;  4HIO A;  2AUJ D;  3BVG A;  1Q8I A;  3UDI A;  1WD1 A;  2NYZ D;  3O13 A;  1KAW A;  3PV0 A;  4U68 A;  2IY5 B;  1TS2 A;  1PDQ A;  1XXG A;  1A62 A;  2HDL A;  1YIJ A;  2UUB Q;  3L2P A;  1B9N A;  3SR1 A;  1KNA A;  3W2D A;  1G29 1;  4NXM Q;  2GVB A;  2XTI A;  3MHB A;  4DV5 L;  3RMH A;  3NPP A;  1T5E A;  2E74 C;  2N3S A;  4OHJ A;  4GOP B;  1HNW Q;  3Q24 A;  1BO0 A;  4RWS C;  2IHF A;  4P71 A;  4H13 C;  2UXD L;  2K5V A;  4XQQ A;  4EQO A;  3H6M A;  3HP3 A;  2NVY B;  3MA2 B;  3NEL A;  2VQE L;  2JA6 H;  4HCS A;  3BZK A;  4NP5 A;  2CFM A;  2N49 A;  4OL7 A;  2HIV A;  1MJC A;  1QWY A;  5C3E G;  3PMF A;  3VR4 A;  2A5H A;  3RUZ A;  1IBK L;  3IKJ A;  3K0X A;  2AKW B;  3DWA A;  2HD3 A;  3AB9 A;  4JI0 L;  1P16 A;  3CPW A;  1SNP A;  1B53 A;  3KF8 A;  2BE5 C;  4AYB E;  1WJJ A;  2TMP A;  1DJR D;  5KND A;  3HOZ G;  3UI2 A;  4K8J A;  5JJZ A;  1Z47 A;  3P1H A;  4JK1 C;  5IYC G;  4PZ6 A;  1K8A C;  1ET6 A;  4H7B A;  1SRU A;  2BDN A;  5JEA H;  2Q8T A;  2M2L A;  2KVM A;  4DV3 Q;  1UUP A;  1XMQ L;  2EYJ A;  4QIW B;  1JWU D;  2KOL A;  1RF2 D;  1EQQ A;  4BS9 A;  2CH4 A;  1MBY A;  3HOV G;  1SNQ A;  1PTO F;  4XQN A;  2A6H C;  2WB1 G;  4GKJ L;  2B2U A;  4ZKB B;  1RTN A;  4KY7 A;  1Y14 B;  2H4O A;  4S3S A;  4LF4 Q;  2F3V A;  2L5T A;  2UXC Q;  1HZC A;  4XTC S;  5M5Y H;  2OTJ A;  3S24 A;  2XRQ D;  4X65 Q;  4KV6 A;  4JI7 L;  3VYS A;  3Q23 A;  3S14 H;  1K28 A;  1UE6 A;  4FDB A;  4UPA A;  1STY A;  1PZK D;  1W3S A;  2KCC A;  2F3W A;  2MP1 A;  3BDC A;  5CV7 A;  2R7Z G;  1SYC A;  4FVM A;  2LKV A;  1PH7 A;  1K3B C;  3BDL A;  4I7Z C;  4OXP A;  4XYQ A;  4OGQ C;  4WJ4 A;  1EL0 A;  1ET9 A;  4ME5 A;  1GUT A;  1ILQ A;  3OYY A;  4PMW A;  1TKW B;  4POF A;  4N9T A;  1J9O A;  5A2Q E;  3DM3 A;  4A3I H;  3TSS A;  4IUV A;  4BBS G;  3AMU A;  4C3I H;  2IX3 A;  3FKI G;  2EJG C;  1RL2 A;  4X3S A;  3PUX A;  1LT4 D;  1I4R A;  2FJ2 A;  5IYB G;  2K5D A;  4K5W A;  1JMC A;  2E5L Q;  5M5W H;  1QE6 A;  3KF6 A;  4X3U A;  1EZ6 A;  3M85 A;  4OIK A;  3HRZ C;  2EY1 A;  3T4A C;  4IUP A;  3CCM A;  4DV2 L;  4PZ7 A;  1CKO A;  4KJO A;  2WV6 D;  2Z4I A;  4DV6 L;  3M4Y A;  1EIG A;  5AJ3 Q;  2A74 C;  3HOU G;  2KEN A;  4R4O A;  1JJC B;  2PZU A;  1QVF A;  1TWH B;  4MTN A;  1IL2 A;  2L1B A;  4KHZ A;  4DV4 L;  3NBH B;  4IUR A;  1BBX C;  1UE1 A;  3L3O C;  4B3S L;  1K8G A;  4R4Q A;  2CKZ B;  4DU9 A;  2JA7 H;  2VUM B;  1IYV A;  1EOT A;  4XIG S;  5HGQ A;  2NN6 H;  5CV8 A;  1VQP A;  1IZ6 A;  5I9P A;  4HTH A;  2JA5 H;  1H9R A;  3E3X A;  3PCO B;  3KDF A;  4XQJ A;  2B8G A;  2PMZ E;  4DAY A;  3HOY H;  1TWF H;  1B50 A;  2WAC A;  1DZ1 A;  5FJ8 H;  1HR0 L;  1IKM A;  2KCM A;  1VQA A;  2E2J B;  1HZ9 A;  3S1N B;  2AUK A;  2BDO A;  1NBW A;  1MJE A;  1G6P A;  5CGK A;  2N88 A;  1A8V A;  3K6O A;  4H02 A;  3OOC A;  4JI4 Q;  2RDG A;  1V43 A;  1KHI A;  4GNX B;  1PV4 A;  3K5L A;  4RH6 A;  3URY A;  5M5W B;  3GDE A;  1C8C A;  4FF1 A;  5JEA J;  3A8I E;  2N78 A;  3IL8 A;  3JAM L;  1YZ6 A;  1QNU A;  1IW7 C;  4KD3 A;  1E3P A;  3LGJ A;  3M3Y B;  5CC4 A;  1YNJ C;  2MO1 A;  4DA2 A;  1ZYR C;  3PUW A;  1G51 A;  4JC0 A;  4JG2 A;  3TS0 A;  1SFO B;  1S5B D;  4IPD A;  5C3E H;  1RDP D;  4DV5 Q;  3GTL H;  2PQE A;  4K2K A;  3I8Z A;  4XXE A;  1EY4 A;  3H09 A;  4K5X A;  1RIP A;  1JOQ A;  2B63 G;  3P7J A;  2UXD Q;  2EYL A;  1OXU A;  3D4W A;  5EBD A;  2E2I B;  3CCU A;  2VQE Q;  3HG9 A;  1YBY A;  2B2V A;  3FPU B;  1Y1W H;  1JQY D;  1E1O A;  3D0F A;  4YCV A;  4IUN A;  1SYD A;  1JB7 A;  5ISR A;  4U67 3;  1BOS A;  2KEE A;  5JPM C;  3VYT A;  2B2Y A;  4DUZ L;  1LT6 D;  4JI0 Q;  3W3A A;  1CA5 A;  2BH8 A;  3FP9 A;  4L6T B;  1KD1 C;  2HQL A;  2BOS A;  2O5I C;  2DY7 A;  2IT1 A;  3Q6S A;  1N32 L;  2HDM A;  2WB1 E;  2EY5 A;  3GTP H;  3W1G A;  4A3B B;  4ZLT F;  3SK4 A;  1EFW A;  1AH9 A;  5C5L A;  2CHB D;  4H0L C;  3P20 A;  1RD9 D;  4UP9 A;  1AFP A;  4A3K G;  1QVG A;  4EQN A;  3CXC A;  1PRT D;  3OSO A;  4RCO A;  3BZD B;  3TP7 A;  1XMQ Q;  5EJW A;  1SN8 A;  4CKE A;  3AFQ A;  4GOP C;  1FGB D;  3PO3 H;  2IJ0 A;  2WAQ B;  1L0W A;  3PIP 3;  5T1I A;  4IJH A;  3RN5 A;  4JI5 Q;  4PV1 C;  1N34 L;  5T1G A;  3G6J B;  2JA8 B;  3KBG A;  1C4Q A;  5ELD A;  4ID6 A;  3R93 A;  5C4H A;  2KHS A;  1AZQ A;  1QOH A;  3VR6 A;  4KTA A;  4A3C H;  3VR2 A;  1KRS A;  4BXX G;  2AMC B;  4JI7 Q;  4RGM A;  2N55 A;  5IGB A;  1SXT A;  2F4V L;  1XX8 A;  1A3T A;  1S4Z A;  3ULP A;  3ULJ A;  1AN8 A;  1WTW A;  4LK1 C;  5J3B A;  2MJ8 A;  4KKS A;  4BY7 B;  4UHV A;  1FYC A;  5K36 G;  1YNX A;  1DON A;  2UXB L;  3I90 A;  1WTV A;  2JA9 A;  1Y1W B;  2E2D C;  5JJI A;  1GUS A;  3B6Y A;  2KBN A;  3HOW G;  2F3I A;  3DLL A;  4FF4 A;  5EAY A;  1K83 B;  4JBM A;  4GLV B;  2Z0S A;  5CYU A;  1EYA A;  1D6E C;  2RCF A;  4TVA B;  4R4C A;  5D3D A;  4LF6 Q;  2UUB L;  1SMY C;  3TP6 A;  2A69 D;  1OXX K;  3BU2 A;  3DMU A;  3BJU A;  3WOF A;  3H0G B;  2M9V A;  1PZI D;  3CU7 A;  2MO0 A;  1WD0 A;  2D9U A;  3J81 c;  2KHI A;  3CRK C;  1JE5 A;  3ONA B;  2EE1 A;  1XNR Q;  3NE5 B;  1M1K C;  1CKN A;  1H9J A;  1Y8N B;  2LY7 A;  4DV6 Q;  1SBB B;  3KLR A;  1K3R A;  3FEW X;  4M1U B;  2I5H A;  4K6D A;  4B08 A;  3I91 A;  1VQM A;  4DAV A;  4DPG A;  1M4V A;  2YYZ A;  5LMU Q;  4IZ8 A;  2ZM6 Q;  3VA7 A;  4DR5 L;  3GTM B;  1IKL A;  5AFW A;  4DV4 Q;  1IL8 A;  4Y7N B;  1WTH A;  1VQH A;  3PIO 3;  2WIN B;  5C4J H;  3KJP A;  1M90 C;  1KXL A;  4TSS A;  1VQ6 A;  4HED A;  4BY1 B;  1NJI C;  3E0E A;  5IWA L;  1L0X B;  4IUU A;  2NVQ B;  1CHQ D;  1ESF A;  1EY0 A;  4X66 L;  3KUP A;  2Q2H A;  5E4X A;  1PFS A;  1AE2 A;  4JOI C;  2F0N A;  2Q8R E;  4L5Q A;  2CQA A;  1HR0 Q;  1U4L A;  4C2M B;  5GAD C;  1JCK B;  2F1M A;  2K33 A;  4E6I A;  1PHJ A;  4DV3 L;  1EQR A;  2E8G A;  3S2H H;  3SK8 A;  3NUC A;  4KY6 A;  1TR5 A;  4R9W A;  2QEX A;  2NZ1 D;  4I7A A;  2EXD A;  5ELC A;  3OIQ A;  3E9I A;  4DFA A;  2E2H B;  3KLS X;  1X32 A;  1LTG D;  4ABN A;  2IWH A;  4ZKC B;  2F4I A;  3GTQ H;  1STE A;  1I3Q B;  1FNV A;  2Z6K C;  2B63 H;  2TSS A;  1E7Z A;  2VL6 A;  3AYH B;  5E7N A;  1K9M C;  1TXY A;  2F0M A;  4DR4 L;  1BBU A;  1GOZ A;  4IPG A;  1GHK A;  3V96 A;  2KUM A;  1SJE D;  5IOD A;  1JOO A;  1B1Z A;  2B2W C;  4POG A;  3TQY A;  5M3M B;  3EJI A;  3K5O A;  3H15 A;  1E22 A;  4ZUJ A;  4GKK L;  2A6E D;  1KQS A;  2F0Q A;  1G2S A;  2CVR A;  3CP0 A;  3HOX B;  2L12 A;  2ATW A;  4WJW A;  4ZK9 B;  4C3H H;  2AWO A;  3PQI A;  5KYI A;  2Z8L A;  4RA8 A;  3IFT A;  3PUY A;  2D2C C;  2CW0 C;  4DUZ Q;  5DAU A;  2K50 A;  3Q0A A;  1FGU A;  4RGN A;  4A3I G;  1PH8 A;  4GN3 B;  2PZT A;  4C3I G;  2KHJ A;  1N32 Q;  2K4K A;  2A68 C;  1OXT A;  1SJH D;  1FL0 A;  4FO2 A;  1RTO A;  5AJ3 L;  1GD7 A;  3K7A H;  1CM9 A;  4A3L H;  2HCI A;  1PTO D;  1HA6 A;  2K1B A;  1VQG A;  1HPC A;  4JI2 L;  2L11 A;  3DEO A;  2R61 A;  4IO9 A;  2NVY H;  4DN4 M;  2B39 A;  3CPF A;  1EY5 A;  3F8T A;  1HQR D;  2XSC A;  2F0O A;  1NR4 A;  4B3T L;  4BXX H;  3CQZ H;  4OO1 I;  2L55 A;  2Q2T A;  2X69 A;  4LFC Q;  2DJG C;  3D4D A;  1DM0 B;  2A68 D;  3NK9 A;  5GAG C;  4IFD I;  1ENF A;  1HNX L;  3CCV A;  3UE1 A;  3TP8 A;  5FO9 B;  3PF5 A;  4O2D A;  2RSO A;  1B2T A;  5JOB A;  3PGZ A;  5K36 H;  1X3G A;  1H9S A;  1GUN A;  5C4X B;  4XT3 B;  1CQF A;  4YY3 L;  1D8L A;  5C0X I;  1OXS C;  1EQV A;  5HY6 A;  3TDQ A;  2JA7 G;  5NUC A;  3WWV A;  3KJO A;  2F4V Q;  4HJA A;  2NVT B;  1SNM A;  1Q1E A;  4DK0 A;  2JA5 G;  1KLG D;  4QL5 A;  4X6A H;  4LF5 Q;  3J80 E;  4QIW E;  3UDX A;  3FPP A;  2UXB Q;  1S40 A;  1FD7 D;  5IT9 E;  4DK3 C;  3G48 A;  1B44 D;  4JI4 L;  5I9O A;  2JXM B;  3HKZ B;  2ALY B;  1U4P A;  3QJY A;  1JWM D;  1EWH A;  2A1A A;  4DR7 L;  1HZB A;  1AE3 A;  1EEF D;  1OO9 B;  2B8F A;  1D2B A;  2EPB A;  2G5D A;  2L9H A;  4B9W A;  4EGV A;  4LWC A;  1X54 A;  1HXY D;  1S5E D;  2EXZ A;  2RVL A;  4X3T A;  1U0L A;  3I4M H;  4FYD A;  2WKC A;  5DM7 3;  2R3Z A;  4JI6 L;  3K7A B;  2UU9 L;  2WAQ G;  3VDY A;  3OW2 A;  2K5H A;  4FXK C;  3S15 B;  5J39 A;  3LNN A;  5CV5 A;  2PQA A;  1B3Q A;  4KHV A;  5CV4 A;  2JA8 G;  3CW2 C;  3TEH B;  2E75 C;  3EFX D;  1ICW A;  2IL8 A;  3CQZ B;  4DR5 Q;  1X55 A;  5IP7 G;  1MSG A;  4RGT A;  1LM0 A;  2QCP X;  3A74 A;  2ZXP A;  3ITP A;  3T53 B;  1J6Q A;  4RCN A;  5FO8 B;  1PH2 A;  2EYP A;  3J7A V;  1K8M A;  1WTP A;  2M00 A;  1NAP A;  1A3U A;  3NXW A;  1PVO A;  3T1Y Q;  5IWA Q;  4P2C B;  1Y1W G;  4ZYS A;  4QUC A;  3JC6 6;  5JJL A;  1HRJ A;  3TP5 A;  3V2T A;  4X66 Q;  1CQV A;  1Q3L A;  1S3O A;  3H94 A;  1VQI A;  4YIJ A;  2ZXR A;  4IQZ A;  4HID A;  2K5N A;  1JJG A;  4QMG A;  3U4Z A;  3U9O A;  3M7N A;  4N8F A;  4ODG A;  4ILW A;  1NY4 A;  2JK8 A;  5E1F A;  4ZAI A;  1TWH H;  4GOP A;  3DWP A;  2AHO B; 
#chains in the Genus database with same CATH homology
 4RGO S;  2LFN A;  2EYH A;  4HCE A;  4A3D B;  4NW2 A;  3VR3 A;  3CHB D;  3SK5 A;  5CBA E;  3C3L A;  2YU9 B;  1Q90 A;  1KLU D;  1JWS D;  4DXF A;  2K28 A;  4A3F B;  4DK1 A;  4RHS A;  3I4M B;  3FVQ A;  3BDO A;  4QUF A;  3C1E A;  2ZT9 C;  4A3G B;  1STB A;  1BCP F;  2B2T A;  3EQL C;  2F0T A;  5C3X A;  3I3C A;  4MN3 A;  4KI0 A;  5BN4 A;  5KEE A;  1NCV A;  3BVZ A;  1ENC A;  2PPB C;  4N9P A;  4F7X A;  1Z6H A;  2I46 A;  1DD2 A;  4G7O C;  3AU7 A;  1K8O A;  5COR A;  3RLF A;  2PZW A;  1EY8 A;  4WOR A;  1TY2 A;  2ENB A;  1JC7 A;  5EGT A;  1BF4 A;  2LS0 1;  4QF4 A;  3DUZ A;  3R3O A;  1CHP D;  2OXP A;  2I07 B;  2XWB B;  4B9X A;  1DOL A;  2XVS A;  2H1E A;  5KGU A;  1A3V A;  4ZQ3 A;  3BS1 A;  1F9P A;  3S16 B;  4HN7 A;  5EPJ A;  5G3L D;  4H44 C;  3NWT A;  5FLX L;  5EBC A;  1ZXT A;  3L7Z C;  2RSN A;  4NMZ A;  3WOE A;  2F0G A;  1HTP A;  2K05 A;  3GV6 A;  2ZXO A;  4K2L A;  3ERO A;  1EU4 A;  1HA5 A;  2F0D A;  4KKT A;  4J8Q A;  1GXD C;  3MEH A;  1PTO B;  1E2V A;  3BYT B;  4DGZ A;  4ULL A;  3E6Z X;  4L63 B;  1AW7 A;  1LTB D;  2EYO A;  1SE4 A;  3A7L A;  1LTA D;  3NBH A;  2ICI A;  2RDH A;  2F0S A;  4OO1 G;  3D3R A;  4BBR B;  1KDC A;  1IYU A;  1PZJ D;  5K5P A;  3S1M B;  1I6H B;  5BN5 A;  5C0X G;  1A15 A;  3NTI A;  5EKI A;  1BNZ A;  5E4W C;  2FMM A;  3CRL C;  1STG A;  1WVL A;  4KJN A;  3H91 A;  2VB3 X;  3SEB A;  2VNU D;  1PRT C;  2RQX A;  3E0J A;  2JEB I;  1PYW D;  2NTS A;  3MWY W;  1EY9 A;  2RDF A;  4C3H G;  1LO5 D;  4O1N A;  1KAB A;  3HZX A;  3J81 L;  3TZU A;  1GJX A;  5FK9 C;  4F87 A;  4PMC A;  1TWA B;  1X3Q A;  3GTO B;  1UAP A;  1VCI A;  5A35 A;  4LJZ C;  4CKB A;  5JPN C;  3VR5 A;  3RD4 A;  1D1I A;  2L4N A;  2SNS A;  4KN4 C;  1NR2 A;  1ZKO A;  1QJO A;  1YNN D;  2DN8 A;  2FMC A;  3GTG B;  1DXM A;  1FNU A;  1OXV A;  5D3I B;  4F8M A;  5M3F B;  3TZD A;  5BN3 A;  1PFN A;  1PMR A;  3G7L A;  1EZ8 A;  4A3E B;  4CBV A;  1SSO A;  2PCF B;  3S2D B;  1I50 B;  2NTT A;  5IIF A;  1CZG A;  1ROD A;  2JSO A;  2KJX A;  1H9K A;  1SNC A;  1EQT A;  2A69 C;  2B2U C;  1EFI D;  1O7L A;  5TSS A;  3OW7 A;  3SE0 A;  3JAM E;  5HGT A;  5M5X B;  1H9M A;  1TU2 B;  3ND9 A;  1EYC A;  1V1O A;  1VMP A;  2MUY A;  3OWF A;  4R8I A;  2KEC A;  4HR7 B;  5CV9 A;  2O5J C;  2K5Q A;  4NDX A;  3HOZ B;  3OMC A;  3GQB A;  5IGC A;  2Z4H A;  1Y1V B;  2XN9 C;  3E5S A;  4X3K A;  1DCZ A;  1D5X C;  2DNE A;  1EY7 A;  4IUT A;  5EPK A;  1SYB A;  3DHQ A;  3X3N A;  1CT1 D;  5FO7 B;  3HOV B;  1MSH A;  2HQE A;  4MIU A;  3I4L A;  3MXP A;  1WCM B;  2K04 A;  4HSV A;  3HGB A;  1F2Z A;  3NQI A;  3QB3 A;  2FFK B;  2RKS A;  3MXU A;  3H3V C;  4KN7 C;  1E2Z A;  1DOM A;  2WII B;  2R7Z B;  1RKN A;  1JR0 D;  3X3M A;  2QF7 A;  1PLF A;  3PUZ A;  1X3P A;  5C4Z A;  1D5M C;  2KCN A;  2R93 B;  4OO1 H;  2F0F A;  3FKI B;  4IFD H;  1SYG A;  2Y0S B;  3D6C A;  2A6E C;  5ELB A;  3GTJ B;  3TBI B;  3OPO A;  5C5M A;  5KNB A;  2C5C A;  2AQ2 B;  4C1N I;  5C0X H;  1WTO A;  3A8K E;  4HAE A;  4L8J A;  1HFN A;  2ID0 A;  5C44 B;  1RHP A;  2KQ3 A;  5I6W A;  3QG1 A;  2RA4 A;  1LAC A;  1KDB A;  4K8I A;  1ONL A;  1CA6 A;  2V4D A;  4UAI A;  1S5D D;  3EVQ A;  3GO5 A;  2NUC A;  5JAV A;  2MGS A;  4FXG C;  1PTO C;  1QG7 A;  4DXG A;  1KAA A;  4BA2 I;  3FRP B;  5IOC A;  3DEP A;  1DYQ A;  5C3W A;  3K59 A;  2B2V C;  2EY6 A;  2XWJ B;  3S17 B;  2E76 C;  3DM1 A;  2B2Y C;  4IUQ A;  1G6Z A;  1UEA B;  5FKA C;  3L9A X;  2WP8 J;  1TWG B;  1Y8P B;  4DNT B;  5KNC A;  1ZEQ X;  2QKI C;  2K6A A;  3NP8 A;  2MPM A;  1JOR A;  2X6L A;  3MVV A;  1F9Q A;  2F0E A;  4V19 0;  1BCP D;  4Z9C B;  4DF7 A;  1SNO A;  3A54 A;  1GUW A;  2IW3 A;  1GUG A;  2FHT A;  3NWS A;  4RAU C;  2EY2 A;  1W6J A;  4WRD A;  2VXW A;  5E3F A;  1PRT B;  4C3J B;  3DXJ C;  2NB0 A;  1LLR D;  2OT2 A;  3NTK A;  1XTC D;  2PW7 A;  1U4R A;  1WTX A;  3BG3 A;  2AQ3 B;  2BA1 A;  2FIN B;  1HHV A;  1W6K A;  1RJT A;  5D65 A;  4PQX A;  4HMJ A;  1TY0 A;  4OIJ A;  4UDU C;  1J8I A;  2JE6 I;  4HSP A;  4M8A A;  4R8N A;  4IFD J;  2J7Z A;  3QO2 A;  1LV9 A;  5A2Q L;  4A3K B;  2NVX B;  4A3J B;  5C0X J;  3LWE A;  1EY6 A;  4A93 B;  1R4P B;  4EQP A;  1LTS D;  2K03 A;  2C9O A;  2O2L D;  3N52 A;  1QB5 D;  1F9R A;  2F0H A;  4F88 A;  1D1K A;  3MTS A;  3C1F A;  3VYR A;  1XWE A;  3QWN A;  3M4O B;  3GTK B;  1AZP A;  5IGG A;  5DEH A;  4PNY A;  4CGY B;  1I4P A;  4MHE A;  3HOW B;  3S1Q B;  4A3M B;  3R2T A;  1TII D;  2D62 A;  1EWC A;  1Q12 A;  4K14 A;  1JOK A;  3S1R B;  1PFB A;  1LTI D;  3QOL A;  1CZW A;  2IX1 A;  3SDZ A;  1R9T B;  1DOK A;  2BE5 D;  3BYY B;  3D31 A;  2F0V A;  3C46 A;  2JYO A;  3V05 A;  3HEJ A;  4ZUI A;  1PFM A;  1NSN S;  3PO2 B;  3CKI B;  1KTK A;  3LWU A;  4JBW A;  3KK7 A;  2R92 B;  1PTO H;  1SAP A;  3K57 A;  2KA7 A;  1JB3 A;  4BA1 I;  1SDF A;  3FDT A;  3OMG A;  4XYO A;  1GUO A;  2K5W A;  2JA6 B;  2DNC A;  1SYF A;  2F0P A;  2DY8 A;  2A6H D;  3J7A F;  1B9M A;  2Q8I B;  3I73 A;  5F2D A;  1AEX A;  2RBM A;  4BWG B;  2Z1C A;  1QNK A;  4FF3 A;  2HUG A;  3QIA A;  2J0T D;  3T16 A;  1VF5 C;  4AYB B;  1Q1B A;  1I4X A;  1SE2 A;  3KBX A;  1Y69 U;  1EIH A;  3Q22 A;  4WFN 3;  1O78 A;  2HCC A;  5LL6 S;  1LTR D;  1F9S A;  5C6A A;  4KK7 A;  4KMU C;  5DNF A;  3MXG A;  5KYL A;  1Z7T A;  3A55 A;  3D4R A;  2XRS D;  1HQM C;  5M5Y B;  3NHH A;  2F0I A;  3I70 A;  3S14 B;  2D5D A;  1O7Y A;  2F0K A;  2F0W A;  4XT1 B;  3ZYY X;  3T56 B;  3K58 A;  4Q5V A;  1BCP B;  1SND A;  2JP1 A;  1TS5 A;  4KY5 A;  4A3I B;  2G9D A;  1G91 A;  5CBE E;  1PXU A;  4C3I B;  3K5N A;  3OIP A;  4IFD G;  3GV3 A;  4DNR B;  2B2W A;  1EEI D;  3ERQ A;  1SYE A;  3IFD A;  3K0Y A;  3OHX C;  1VMC A;  4J6H A;  1IHZ A;  1BDO A;  2K01 A;  2F0U A;  1I4Q A;  1HFG A;  2EDG A;  5IGD A;  2PNR C;  3I4N B;  4PMB A;  5HUR A;  3VA5 A;  3I72 A;  2JEA I;  1YNN C;  4FXD A;  4RKB A;  4C3J G;  5JVG 3;  2KED A;  1IW7 D;  3RZD B;  5CR3 A;  5EPL A;  1I6V C;  2JA7 B;  1I4H A;  2EYF A;  3PUV A;  1MI2 A;  1YNJ D;  5FOB B;  1BQQ T;  2JA5 B;  3SXH A;  4XDX A;  1ZYR D;  4RHR A;  2NN6 I;  4EVO A;  3EA6 A;  2SNM A;  3P75 A;  3HOY B;  1TWF B;  1A6X A;  1FNW A;  4G4K A;  1TS4 A;  1ENA A;  2PYK A;  1F2L A;  5FLX E;  2VB2 X;  2EJM A;  2PMZ B;  3C2P A;  4KKU A;  4IN3 A;  3SK6 A;  3U9S A;  1GHJ A;  5EKL A;  1F2Y A;  1STN A;  1VF7 A;  4LAA A;  1G2T A;  4TQU S;  5CV6 A;  2BA0 A;  2PO4 A;  3HS0 C;  1JIC A;  1R4Q B;  3RZO B;  1JE4 A;  1C48 A;  2O4X A;  4K6L A;  5ELF A;  3T13 A;  2EOT A;  1MGS A;  2AWN A;  5C3E B;  1ML0 D;  3R2I A;  3GTL B;  4G57 A;  1A2U A;  2X6G A;  5M9O A;  5G3L F;  1TVX A;  1XYI A;  2B2T C;  1QCB D;  3MFY A;  1TQO A;  1S5F D;  2GA4 B;  3GD7 A;  5IGE A;  5JVH 3;  1S5C D;  5DM6 3;  3MXN A;  3SVM A;  3J7Y W;  3VYU A;  5CMD A;  4V0B A;  1II3 A;  3SHL A;  3MAQ A;  4NKL A;  3NTH A;  2ICE C;  2QDB A;  4ZRZ A;  2EVB A;  3GTP B;  4CKC A;  1SE3 A;  3T51 B;  1MD2 D;  2NBF A;  1I4G A;  2G9H D;  2WB1 B;  3GP7 A;  3J81 E;  1B4O A;  3MFG A;  2MHV A;  5LHY 1;  3PO3 B;  1SMY D;  2EYM A;  5EQ0 A;  1HUM A;  2L0C A;  1HUN A;  1U9R A;  5EKK A;  5J22 A;  3MC0 B;  2QIL A;  1E2W A;  4HMI A;  1KDA A;  1M8A A;  4BBS B;  4GZY C;  1AP0 A;  3NQT A;  4C56 C;  3OWE B;  1O7Z A;  1KNE A;  2XNA C;  3BVM A;  1LT5 D;  1TT2 A;  1B3A A;  1STH A;  2XIW A;  4J1M A;  3J80 L;  3A56 A;  2OF1 A;  3N6R A;  3DWQ A;  2F0J A;  5JEA G;  5IT9 L;  1PRT F;  3TN2 A;  2A73 B;  3HOU B;  2IPK D;  3FMC A;  1VDZ A;  3R8B A;  1LAB A;  4TRD A;  1O80 A;  2K32 A;  5COY A;  1A2T A;  1LTT D;  1RCV D;  1WTR A;  2SOB A;  3MZ5 A;  5LL6 X;  5IGF A;  2EJF C;  2IX0 A;  1E0B A;  3KLS A;  1F2M A;  2K7V A;  5ELE A;  1HTL D;  4CHT B;  4QCL A;  1EU3 A;  1L0Y B;  1BUV T;  3QOJ A;  3WDN A;  4LMQ D;  4RFB A;  1HCZ A;  1H9S B;  4CJ0 B;  4IAL A;  1BCP C;  5KRU A;  5C4J B;  2NWG A;  4TKO B;  4FNF A;  2PW5 A;  2F0L A;  1BXT A;  1BR9 A;  5I4D A;  4KD4 A;  3D8G A;  1V1P B;  4I65 A;  1CTM A;  4CJ2 C;  1F77 A;  2LMC B;  2BCO A;  4FF2 A;  4FP5 D;  1Y8O B;  1G8Z D;  1D5Z C;  2CW0 D;  2OEO A;  3S2H B;  5D14 A;  4CJ1 B;  1FR3 A;  1U4M A;  3K5M A;  4C1N K;  4Q0F A;  5J1Z A;  3A8J E;  3ND8 A;  4QB4 A;  2WKD A;  2SDF A;  1CI3 M;  3GTQ B;  2B63 B;  5I6Y A;  2AQ1 B;  3D6W A;  1TWC B;  3A7A B;  3F2U A;  3M7G A;  4DAP A;  1WTQ A;  1NUC A;  3LX0 A;  3TME A;  2R6G A;  1EYD A;  2EZV A;  2F03 A;  2SEB D;  1V8Q A;  2NN6 G;  1LT3 D;  5KIX A;  1QIL A;  1ESR A;  5I2Y A;  3S9W A;  3NBI A;  4RKL A;  4O42 A;  2QEJ C;  1CFM A;  1SEB D;  3IAY A;  1V1P A;  1UNS A;  5I2X A;  1STA A;  2J4X A;  1T5X D;  4G7Z C;  1ILP A;  4K5V A;  4C3H B;  3NSW A;  4G7H C;  1TS3 A;  1CK1 A;  2AUJ D;  3BVG A;  1Q8I A;  1WD1 A;  2NYZ D;  3O13 A;  3PV0 A;  4U68 A;  1TS2 A;  1PDQ A;  1XXG A;  2HDL A;  1B9N A;  3SR1 A;  1KNA A;  3W2D A;  1G29 1;  3MHB A;  3RMH A;  3NPP A;  1T5E A;  2E74 C;  4OHJ A;  3Q24 A;  1BO0 A;  4RWS C;  4H13 C;  4XQQ A;  4EQO A;  3H6M A;  3HP3 A;  2NVY B;  3MA2 B;  4HCS A;  4NP5 A;  4OL7 A;  1QWY A;  3PMF A;  3VR4 A;  2A5H A;  3RUZ A;  3IKJ A;  3DWA A;  3AB9 A;  1SNP A;  1B53 A;  3KF8 A;  2BE5 C;  2TMP A;  1DJR D;  5KND A;  3UI2 A;  4K8J A;  5JJZ A;  1Z47 A;  3P1H A;  4JK1 C;  1ET6 A;  4H7B A;  2BDN A;  5JEA H;  2Q8T A;  2M2L A;  2KVM A;  1UUP A;  2EYJ A;  4QIW B;  1JWU D;  2KOL A;  1RF2 D;  4BS9 A;  1MBY A;  1SNQ A;  1PTO F;  4XQN A;  2A6H C;  2B2U A;  4ZKB B;  1RTN A;  4KY7 A;  2H4O A;  4S3S A;  2F3V A;  2L5T A;  4XTC S;  2XRQ D;  4KV6 A;  3VYS A;  3Q23 A;  1STY A;  1PZK D;  2KCC A;  2F3W A;  2MP1 A;  3BDC A;  5CV7 A;  1SYC A;  4FVM A;  2LKV A;  3BDL A;  4I7Z C;  4XYQ A;  4OGQ C;  1EL0 A;  1ET9 A;  4ME5 A;  1GUT A;  1ILQ A;  4PMW A;  1TKW B;  4N9T A;  1J9O A;  5A2Q E;  3TSS A;  4IUV A;  3AMU A;  2IX3 A;  2EJG C;  4X3S A;  3PUX A;  1LT4 D;  1I4R A;  2FJ2 A;  2K5D A;  4K5W A;  1QE6 A;  4X3U A;  1EZ6 A;  3M85 A;  4OIK A;  3HRZ C;  2EY1 A;  3T4A C;  4IUP A;  4KJO A;  2WV6 D;  2Z4I A;  3M4Y A;  1EIG A;  2A74 C;  2PZU A;  1TWH B;  2L1B A;  4KHZ A;  4IUR A;  1BBX C;  3L3O C;  4DU9 A;  1IYV A;  2VUM B;  1EOT A;  4XIG S;  2NN6 H;  5CV8 A;  5I9P A;  4HTH A;  1H9R A;  4XQJ A;  2B8G A;  4DAY A;  1B50 A;  2WAC A;  1DZ1 A;  1IKM A;  2E2J B;  3S1N B;  2AUK A;  2BDO A;  5CGK A;  2N88 A;  3K6O A;  3OOC A;  2RDG A;  1V43 A;  3K5L A;  3URY A;  4RH6 A;  5M5W B;  1C8C A;  4FF1 A;  5JEA J;  3A8I E;  3IL8 A;  3JAM L;  1QNU A;  1IW7 C;  4KD3 A;  3M3Y B;  5CC4 A;  1YNJ C;  4DA2 A;  1ZYR C;  3PUW A;  1SFO B;  1S5B D;  1RDP D;  2PQE A;  4K2K A;  3I8Z A;  4XXE A;  1EY4 A;  3H09 A;  4K5X A;  1JOQ A;  3P7J A;  2EYL A;  1OXU A;  3D4W A;  5EBD A;  2E2I B;  3HG9 A;  2B2V A;  3FPU B;  1JQY D;  4IUN A;  1SYD A;  5ISR A;  4U67 3;  1BOS A;  2KEE A;  5JPM C;  3VYT A;  2B2Y A;  1LT6 D;  3W3A A;  1CA5 A;  4L6T B;  2BOS A;  2O5I C;  2DY7 A;  2IT1 A;  3Q6S A;  2HDM A;  2EY5 A;  4A3B B;  4ZLT F;  3SK4 A;  5C5L A;  2CHB D;  4H0L C;  3P20 A;  1RD9 D;  1AFP A;  4EQN A;  1PRT D;  3OSO A;  4RCO A;  3BZD B;  3TP7 A;  5EJW A;  4CKE A;  1FGB D;  2IJ0 A;  2WAQ B;  3PIP 3;  5T1I A;  4PV1 C;  5T1G A;  3G6J B;  2JA8 B;  3KBG A;  1C4Q A;  5ELD A;  4ID6 A;  3R93 A;  5C4H A;  2KHS A;  1AZQ A;  1QOH A;  3VR6 A;  4KTA A;  3VR2 A;  4RGM A;  2N55 A;  5IGB A;  1SXT A;  1XX8 A;  1A3T A;  1S4Z A;  1AN8 A;  1WTW A;  4LK1 C;  2MJ8 A;  4KKS A;  4BY7 B;  1FYC A;  5K36 G;  1DON A;  3I90 A;  1WTV A;  1Y1W B;  2E2D C;  1GUS A;  4FF4 A;  1K83 B;  5CYU A;  1EYA A;  1D6E C;  5D3D A;  1SMY C;  3TP6 A;  2A69 D;  1OXX K;  3WOF A;  3DMU A;  3H0G B;  2M9V A;  1PZI D;  3CU7 A;  1WD0 A;  2D9U A;  3CRK C;  3ONA B;  2EE1 A;  3NE5 B;  1H9J A;  1Y8N B;  2LY7 A;  1SBB B;  3KLR A;  3FEW X;  4M1U B;  4K6D A;  4B08 A;  3I91 A;  4DAV A;  1M4V A;  2YYZ A;  4IZ8 A;  3VA7 A;  3GTM B;  1IKL A;  5AFW A;  1IL8 A;  4Y7N B;  3PIO 3;  2WIN B;  4TSS A;  4HED A;  4BY1 B;  1L0X B;  4IUU A;  2NVQ B;  1CHQ D;  1ESF A;  1EY0 A;  3KUP A;  5E4X A;  2F0N A;  2Q8R E;  2CQA A;  1U4L A;  4C2M B;  1JCK B;  2F1M A;  2K33 A;  4E6I A;  3SK8 A;  3NUC A;  4KY6 A;  1TR5 A;  4R9W A;  2NZ1 D;  5ELC A;  3OIQ A;  4DFA A;  2E2H B;  3KLS X;  1X32 A;  1LTG D;  4ABN A;  2IWH A;  4ZKC B;  2F4I A;  1STE A;  1I3Q B;  1FNV A;  2TSS A;  2F0M A;  1GOZ A;  1GHK A;  3V96 A;  2KUM A;  1SJE D;  5IOD A;  1JOO A;  1B1Z A;  2B2W C;  5M3M B;  3EJI A;  3K5O A;  4ZUJ A;  2A6E D;  2F0Q A;  1G2S A;  2CVR A;  3HOX B;  2L12 A;  4WJW A;  4ZK9 B;  2AWO A;  5KYI A;  2Z8L A;  4RA8 A;  3IFT A;  3PUY A;  2D2C C;  2CW0 C;  5DAU A;  3Q0A A;  4RGN A;  2PZT A;  4C3I G;  2A68 C;  1OXT A;  1SJH D;  4FO2 A;  1RTO A;  1CM9 A;  2HCI A;  1PTO D;  1HA6 A;  2K1B A;  1HPC A;  2L11 A;  3DEO A;  2R61 A;  4DN4 M;  2B39 A;  1EY5 A;  1HQR D;  2XSC A;  2F0O A;  1NR4 A;  4OO1 I;  2L55 A;  2X69 A;  3D4D A;  1DM0 B;  2A68 D;  3NK9 A;  4IFD I;  1ENF A;  3TP8 A;  5FO9 B;  2RSO A;  1B2T A;  5JOB A;  5K36 H;  5C4X B;  1H9S A;  1GUN A;  4XT3 B;  1CQF A;  5C0X I;  1OXS C;  1EQV A;  3TDQ A;  5NUC A;  2NVT B;  1SNM A;  1Q1E A;  4DK0 A;  1KLG D;  3J80 E;  3FPP A;  1FD7 D;  5IT9 E;  1B44 D;  5I9O A;  2JXM B;  3HKZ B;  3QJY A;  1U4P A;  1JWM D;  1EWH A;  1EEF D;  1OO9 B;  2B8F A;  1D2B A;  2EPB A;  2L9H A;  4B9W A;  4EGV A;  1HXY D;  1S5E D;  2EXZ A;  2RVL A;  4X3T A;  4FYD A;  2WKC A;  5DM7 3;  2R3Z A;  3K7A B;  4FXK C;  3S15 B;  5J39 A;  3LNN A;  5CV5 A;  4KHV A;  5CV4 A;  2E75 C;  3EFX D;  1ICW A;  2IL8 A;  3CQZ B;  1MSG A;  4RGT A;  2QCP X;  2ZXP A;  3ITP A;  3T53 B;  4RCN A;  5FO8 B;  2EYP A;  3J7A V;  1K8M A;  1WTP A;  2M00 A;  1A3U A;  1NAP A;  3NXW A;  4P2C B;  4ZYS A;  4QUC A;  1HRJ A;  3TP5 A;  3V2T A;  1CQV A;  1Q3L A;  3H94 A;  4YIJ A;  2ZXR A;  4IQZ A;  4QMG A;  3U9O A;  3M7N A;  4ODG A;  4ILW A;  5E1F A;  4ZAI A;  3DWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...