4DAYA

Crystal structure of the rmi core complex with mm2 peptide from fancm
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
144
structure length
144
Chain Sequence
IAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
molecule keywords RecQ-mediated genome instability protein 1
total genus 35
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dayA01
3MXNA 3NBHA 4DAYA
chains in the Genus database with same CATH superfamily
5C4XH 1F9QA 1I3QH 4N9TA 3KDFA 1FVIA 3T51B 4JBWA 1PFNA 1BBXC 2JA8G 4JV5Q 1CFMA 1N32Q 1SBBB 2A5HA 4KKUA 1HNZL 1Y8OB 1TKWB 4O0AA 1Q81C 2JYOA 4YWKA 2VW9A 1VQNA 2ZJRA 1EWHA 1EWIA 4K6DA 2EJGC 1B7YB 1SNQA 1HZCA 1STYA 4A3IB 1Y1WH 1D6EC 5IWAQ 1EQQA 2JEAI 3K59A 4DU9A 5FK9C 1K8MA 1SNMA 3UDXA 4RKLA 1EIYB 1CK1A 3K80C 2FMMA 2VB2X 2WB1G 1G6PA 2WB1E 1LACA 1CKMA 1YJ9A 4JBKA 1D1IA 1XYIA 2E75C 4JI2Q 2L15A 3J7A5 5HGQA 4FP5D 3PUVA 4ZYSA 1ENAA 1SROA 1WVLA 3E0EA 3MHBA 2PW7A 4QUFA 3ERQA 4CKBA 4XQJA 5FLMG 3A5UA 2TSSA 3J7AV 3R93A 1PYWD 1WOCA 1CKOA 1P16A 3JAML 4A3IH 1I4PA 4CBVA 2EY5A 1ZEQX 3J7YW 1PH2A 1X6OA 4OONA 2ICIA 3GTKB 5FKAC 3STBC 1G2TA 1IXRA 2JN4A 4LF5Q 2JA6G 4O1NA 2XTIA 4ZRZA 1LTSD 1VQKA 1M4VA 1BR9A 2XSCA 4KV6A 1S5CD 2DY7A 3A8JE 5IGBA 5JOBA 1WI5A 1KABA 3SE0A 3JAME 2R7ZG 3ONAB 2RHQB 3H0GG 2E8GA 1YJWA 3H94A 5CGKA 2IX3A 5C0XH 4HIOA 4C3HG 3V2TA 4OWTB 4G7HC 2CH4W 2X69A 1GUOA 5I4DA 2F4VQ 1PLFA 1I50B 4DXFA 1ASZA 1TWGB 3RLNA 4GKJQ 1XXGA 4NW2A 3CD6A 2FINB 4WJ4A 5I2YA 1IBLQ 3MWYW 3E6ZX 2NVQB 1HR0W 3I4NB 1SYBA 3S1RB 4FF2A 4JI3Q 3PIOA 1Y1WG 3BYTB 1N33L 2BE5C 3OIPA 2UUCL 4BY7B 1SAPA 4LFCQ 2PQAA 5BN5A 4MIUA 3KFUA 1TWHB 2X6LA 4R9WA 5LMNL 5FO8B 4PMCA 1KL9A 5I9OA 2UXCQ 1I50H 1PTOB 1VQPA 4P75A 5M3MB 4OO1I 1X3PA 4GNXB 1PFSA 3GTGB 3QB3A 2F0UA 3T53B 2A1AA 2MO0A 4A3MB 1O80A 4UDUC 2N3SA 2YYZA 4UP7A 3EBEA 3FEWX 4HAEA 2KEEA 1C0AA 4BY1B 1KNAA 1MD2D 3OYYA 2PI2A 4YY3Q 1OXVA 2DNCA 3S2DH 2F0WA 2LFNA 2M2LA 3KK7A 5J22A 1N34Q 4GKJL 4Y7NH 4AH6A 2JA5G 1Y69U 2JA6H 4DR3Q 4HJ5A 3P1HA 1KQSA 2A68D 2WP8J 3D4DA 1VCIA 2KCCA 2CW0C 2R93G 2N8NA 3G48A 3QO2A 1CHQD 1BO0A 2Q2TA 2TMPA 3C46A 1SN8A 2BDNA 3T13A 1WTWA 1B8AA 2IT1A 5GAGC 3UE1A 1NY4A 2HIXA 3F2CA 1GD7A 2HQLA 5E3FA 1QOHA 1QUQA 2CKZB 5HGTA 1O7ZA 3IL8A 2UUCQ 2J0TD 2BA0A 2RQXA 4OIJA 4GZYC 2F4VL 1IZ6A 2ZTEA 1JB7A 1LYLA 2ZXRA 1VQMA 5JJZA 2MNAA 2EYHA 1D1KA 2DY8A 2KQ3A 3PCOB 2L1BA 1CSQA 1VF7A 5JEAH 1TWHH 4JK1C 1ICFB 1I4RA 3W1BA 1EIHA 1GO3E 4DAYA 1Z7TA 1PRTB 1JORA 3KDFB 4DR1Q 3Q23A 4N8FA 5DM73 1VQAA 1TR5A 2PMZB 2XRQD 4IURA 3KF8B 4K0KQ 3HOWB 1Z47A 2L5TA 3BVMA 2KHSA 3M4YA 4DXGA 4Z9CB 2B2UC 3HFZB 1SR3A 4A3JB 4GOPA 2JJQA 3M7NA 3RLOA 4LF5L 1HQRD 2YU9H 4RCNA 1SRUA 1A63A 5LL6X 1XX8A 2EVBA 3K5LA 1V9PA 1GUGA 2FFKB 2I5LX 1ZYRD 1KTKA 3SR1A 4X66Q 3PIO3 1CKNB 4DR4Q 3GV6A 4JI2L 5LMNW 4RGNA 1UEBA 3PIPA 1SE2A 1H9SB 3R3OA 2E2IB 1DONA 1A2UA 3HOUG 2JSOA 5CBAE 1S5BD 2F0VA 3GTJH 2CQAA 1IYJB 4QQBX 3BVGA 4H7BA 1KAWA 2CH4A 3ITPA 1PFBA 2B2UA 3FRPB 3HZXA 1LV9A 3M4OH 4B3SL 3CCMA 4KLKA 1PH7A 2NYZD 2OQ0A 4R8NA 1S72A 5IP9H 1C7YA 3S1RH 4OIKA 3OHXC 3OWFA 4JI8L 1R4QB 3FKIB 2NBFA 3HOXH 5IYBH 1NE3A 2PQAB 5IT9E 2K5NA 2KVMA 2ZM6L 2N49A 5E4XA 4CDDC 5CV4A 1LTRD 2A69D 1ZXTA 2UXDL 4HMJA 4N8X1 1K28A 4ZK9B 1MIUA 2XGTA 2SEBD 5C44G 3CCQA 1SLJA 2B2VC 4IUQA 2L11A 3DWPA 2MUYA 2K5HA 4WFN3 1GOZA 3Q8DA 3W3AA 5CC4A 5C44B 4DR5L 1YITA 4OELB 1XPRA 1MI2A 3A7AB 3NTKA 4ZAIA 2CCZA 3PF5A 4XXEA 1RCVD 3VR6A 1DCZA 5M5WH 4AQYL 1CUKA 5IT9c 4LFBL 5I6WA 1LTID 2ZJPA 1NCVA 2B39A 2VY3A 3S14H 3A54A 2Z6BA 4POFA 1X3EA 4NPSA 5KIXA 4RHRA 2QKIC 4I7ZC 1EOVA 1DYQA 1L1OA 5I6YA 5DNFA 3O13A 3HOZG 4JI5Q 3NENA 4IQZA 4EQ5A 3AEVA 3IKJA 3HOVB 4A3EB 1JQYD 4P74A 2N55A 4DV7L 2NVTH 4JI0L 2CWAA 2F0GA 2I5HA 1Q82C 1HQMC 4GLVB 2B2YC 1K8OA 1XPOA 4IOCA 1CZWA 1IKMA 2SNMA 4QUCA 4IALA 1HCZA 2F0OA 4A3FB 4IFDI 1QNKA 2XIWA 2F52A 3Q6SA 2E2JH 5ELDA 1RDPD 1YNXA 1U4MA 3GTKH 4R4TA 2G9DA 5BN4A 4DV0Q 4AYBG 2RA4A 2K4KA 4ZKBB 1QE6A 2DJFC 4APVA 3FVQA 3GTOB 4K5VA 2HDLA 4XQQA 4L6TB 4IUVA 4GLAC 4AYBE 4B3MQ 2MFIA 3QWNA 2KCNA 3ERSX 4FO2A 1E0BA 3CMAA 1B9MA 1N9WA 2VZAA 2XNAC 5M5XB 1D8LA 3I73A 3PUZA 3H91A 1EU4A 2D0OA 4KKTA 2K32A 4LUZA 1LTLA 4PMWA 5FO9B 1EY0A 2C9OA 2Y0SG 1AFPA 3E9IA 1WCMG 2HHHQ 1U4RA 1VDZA 4IPDA 5C4JH 1DOLA 1JWUD 1BCPF 4ZCKA 1YNJD 1A3TA 2EYMA 3NEMA 1HNZQ 2QF7A 3CCUA 3W2DA 2FMCA 1V1PA 1CSPA 4B08A 1N36L 1PZKD 1PVOA 3HKZG 1MGSA 1X3FA 4JI5L 2H5XA 1CQVA 2A19A 4X64Q 3HOVH 2IJ0A 1EWCA 4H44C 2IWHA 2EYJA 3DEPA 4QIWB 2AKWB 2FJ2A 4XQNA 2B8FA 3MXPA 1AW7A 3U4VA 1J8IA 5IT9L 4BA1I 4DR7Q 1JE4A 2WAQE 5CV9A 1TS2A 4X3SA 2L4NA 1PZJD 3PUYA 3UDGA 4IO9A 1LTGD 1SFOB 4GOPB 2B63G 1PMRA 2UXBQ 4YWLA 1H9SA 2VS1A 1B4OA 4DR2Q 1YJNA 2R7FA 1LTTD 4GN3B 1L0WA 2BOSA 1WCMB 3M9BA 4U673 3GTMB 2NN6H 5T1GA 1X3QA 1I5FA 1TY2A 1H95A 1EFID 4HN7A 5LMUQ 2HD3A 3PO2G 3VYUA 4LK1C 1NAPA 1B44D 3KLSX 1F2ZA 4A3DB 3JC66 2NVQH 3I55A 3RZDB 3K58A 3IFDA 2KHJA 3KF6A 3CPFA 1HZAA 4R4QA 4OX9Q 4DV3Q 2E2JB 2K5DA 4KY7A 4KY6A 4DR2L 4WJWA 1N36Q 3BDLA 4MZ9A 2VUMG 4KN7C 3S14B 2K75A 1LT6D 3R2TA 4B3TQ 3ND8A 3D4WA 4ZLTF 5FJ8G 2HUGA 5A35A 4G7OC 1U4PA 4TSSA 1C4QA 3HGBA 4JCVE 2JA7G 3PSIA 4FYDA 4EQPA 3VR5A 1C48A 5M5XH 1JCKB 1EY7A 1ESRA 1HR0Q 1ZKOA 3PO3B 1YBYA 4F8MA 4RA8A 3RD4A 4OO1H 5IGFA 4Y52H 2F0DA 4DV1Q 4DV2Q 5C3WA 1U9RA 1R9TB 1SMYC 3I4MB 5GAHC 2DNEA 3S2HB 2NVXB 1LTBD 3KJPA 4H13C 2VQEQ 1W2BA 4JI6Q 2O5JC 4HJ7A 1VQBA 3NWTA 4N9PA 1BBWA 1X65A 2K7VA 1NJIC 1SFOH 5FLXE 2GVBA 2LXKA 3DHQA 2F4IA 3D6CA 3IRBA 4A3KB 3CCJA 4LFAQ 1A3VA 2L0CA 3BYYB 1JWSD 4DN4M 1EFWA 2F1MA 3UDFA 4IPGA 2K33A 3W1GA 4K5XA 4FDBA 2QDBA 1MHWC 2CFMA 4OL7A 4PNYA 1Q90A 4C3JG 4K0KL 3I8ZA 5HY6A 1ML0D 3A5ZB 2F3WA 4HCSA 1D5MC 3RMHA 2C35B 2HT1A 1JJCB 2QDLA 3A8IE 2Y0SB 1SJED 2IHEA 1V1QA 4DKAC 2RF4A 1I94Q 3DWAA 1LLRD 4YIJA 5IYCG 1TWCB 5A2QL 1PYSB 3K7AH 4KJNA 1IBML 2YTVA 2JA8H 4JOIA 1IL2A 4A3CG 2BCOA 4RWSC 4G4KA 1PH1A 2KEDA 1PH5A 4DR1L 1JOKA 3H09A 1R4PB 4DV4L 5KYIA 3NTIA 1HNWQ 1B70B 3RLFA 1CI3M 5BR8L 2ALYB 3CHBD 4K14A 1SSOA 4OXPA 4AIMA 1FJGL 3DEOA 3EN2A 3FKIG 1VQ6A 1QNUA 5DAUA 4BY7G 3OTOQ 4XT3B 1Y8NB 1Z9FA 1H9KA 1UUPA 1JWMD 5CV7A 3G4SA 1RL2A 3K7UC 1I4XA 1SE8A 5C4XB 4NXMQ 3MC0B 4DAYB 4KI0A 4WRDA 1VQDA 3HS0C 2KBNA 3KJOA 3S1MH 1EYAA 3NE5B 3I4MG 2OWOA 1EZ8A 1ILPA 3FMCA 2XVSA 4LF7Q 1ET9A 3A0JA 4UP8A 3L2PA 3CC7A 1BCPD 1VQ7A 3KUPA 2NUCA 4A3EG 2QGQA 4UP9A 4DAPA 4BBSH 1JC7A 4RH6A 3S17B 4LFBQ 3U9SA 3E3XA 2Q8IB 3DM3A 3CCSA 5BN3A 1C9OA 4ODGA 3CC4A 4A3LH 5IY0A 2GN5A 3MAQA 2MHVA 4OEMB 1QB5D 4WORA 4KHPQ 1SNDA 2CQOA 1E1TA 5IP7G 3KLRA 3Q24A 2B2WA 4C3IB 1SDFA 5IODA 1GHJA 1K73C 2OF1A 2NTTA 3N52A 2YU9B 4HR7B 2R93H 1O7YA 1YVCA 1MBYA 1QJOA 4X3KA 4A75A 3I56A 2L9HA 1JMCA 4BXXG 2WACA 1RODA 3CW2C 1LTAD 2O2LD 1HPCA 3SXHA 4FF3A 1U5KA 2ZM6Q 3QIAA 3OW7A 4RG1A 2JXMB 4UAIA 3IAYA 4DV5L 3T1YL 2K28A 1F2LA 2EE1A 3BDCA 4LW1A 3JAMi 4A93H 5ELBA 3SVMA 5AJ3L 4HIMA 1F2MA 4ZQ3A 5KEEA 1TWFH 3NSWA 3FDTA 4BY1H 1JOOA 1ONLA 3T1HL 4KTAA 1YIJA 4JOIC 5JEAG 1S5ED 3DWQA 2QA4A 1A0IA 4K6LA 4QMGA 3HOVG 4YHHQ 5ELNA 4DV5Q 2PQEA 3C1FA 1XMQQ 1H9RA 4JVZA 2NB0A 1X55A 3DXJC 3HOWH 4V190 3TBIB 1X32A 2CHBD 1EY4A 4O2DA 4CDCC 5EKIA 4A4IA 2B8GA 2OQKA 3X3MA 1BQQT 1B3QA 3E0JA 1E1OA 1VQLA 4MNOA 4ABNA 4EQOA 4IFDG 4A3KH 4DK6C 3NTHA 1FNVA 2F0SA 4CDEC 4R8IA 1YNNC 3VA7A 1ET6A 1CM9A 3T4AC 2VL6A 1VQJA 1HA5A 3CMEA 1HH2P 1QVCA 3MXNA 4NKLA 5M5WB 2E76C 4DAMA 3GTJB 2G9HD 4FF1A 4IZ8A 2EJMA 3HOXB 1SYEA 2VUMB 1HNXQ 1HFNA 2P5ZX 5NUCA 1CZGA 3IFTA 3J80L 5JJLA 5ISRA 4DK1A 4YCVA 2F03A 1EOTA 1I4QA 1IW7C 5KYLA 3SK4A 3QJYA 2QILA 1J5EL 1BNZA 2AQ1B 1Q8KA 4CGYB 4DK3C 3H3VI 2M9VA 4IJLA 3HOZH 4C3IG 4A3JH 2Q2IA 5ELCA 3HG9A 2A74C 3A74A 1G291 4FXGC 1Y1WB 1QWYA 1E24A 2G5DA 5C5MA 1I4HA 3SEBA 4EX5A 4LF8L 3MA2B 1HUNA 1SNPA 2RCFA 3S9WA 1DZ1A 3NHHA 4DV4Q 1DJRD 3W5OA 3TP5A 2OXPA 5EGTA 3H15A 3BJUA 2ASBA 3F2DA 2F3VA 3RR5A 1JJ2A 2EY1A 5C3XA 2PZWA 1LABA 4H0LC 5LHY1 2CVRA 2UXCL 3U50C 2KOLA 1C8CA 1W6JA 3CC2A 3S16B 2R7ZB 2N88A 3I4OA 4TQUS 1CA5A 1ESFA 4JV5L 2A69C 2ES2A 4XYOA 3TEHB 3MFGA 4KHPL 3AFPA 1BBUA 1ZYRC 2QEJC 3P75A 3HKZB 1OO9B 4C3JH 4LFAL 3KBGA 3K5NA 4C2MH 4LF6Q 1JE5A 2X6GA 3D3RA 2Z0SA 1STGA 1V1PB 2KENA 4DPGA 1TWCH 5K36G 3TP8A 5I2XA 5CR3A 2HDMA 1Y1VB 5KGUA 2WINB 1NTGA 5KNDA 3VYSA 2E2DC 1LO5D 1V8QA 4KK7A 3AMUA 5EPJA 2EYPA 1X56A 1Q7YC 1SMYD 5AFWA 4A3MG 1I6HH 2WB1B 3ZJYC 3P20A 3GP7A 3AQQA 2C5CA 1EEFD 1HR0L 1TWFB 1PH4A 3L9AX 3GTPH 3DM1A 4ZUJA 4C3JB 1SYCA 3KYHC 3J81E 1MJCA 1IBLL 3PO3H 3GTMH 5G3LD 2B63B 1K83H 4FXDA 2K03A 1YEZA 3TS0A 1FJGQ 3D4RA 1PRTF 2Y0SE 4X6AH 4YCUA 4HTHA 2ENBA 5C5LA 1QILA 3BZDB 3LGJA 5C0XJ 4NDXA 1PXUA 3TMEA 3RZDH 1BXTA 3OIQA 4DV3L 4CJ0B 3SHLA 1WTOA 4JC0A 3G6JB 1T9HA 3I4NG 1BUVT 1IBMQ 5C4JB 2EQSA 3ULLA 5JJKA 3ND9A 2JP1A 4DUYQ 2JK8A 3SK5A 3TP6A 4TKOB 1PYBA 3CQZB 4HMIA 1O7LA 2B2YA 1A8VA 3NPPA 4IUPA 1MSHA 3WOFA 4A76A 3HEJA 3HOUB 3C1EA 5EBCA 5BR8Q 1TS5A 4P71A 4IOAA 4GNXC 2OTLA 5JEAJ 1PH6A 1WTRA 4LF9Q 3WDNA 2EXZA 5CBEE 2PW5A 2K50A 3BZKA 4L5QA 1ASYA 4GNXA 2WAQB 2F0QA 2RDHA 4BXXH 2R92G 3S24A 5FLXL 5K5PA 4CKEA 1FL0A 2KCTA 3F2BA 3SK6A 4GKKL 5FJ8H 1Q1BA 4J6HA 4LJZC 2BE5D 3Q0AA 1T5XD 3GTQH 3PO2B 1PTOD 2L12A 3U4ZA 1QVGA 5C4ZA 3B6YA 4L63B 1Q8IA 1PHJA 4FF4A 4A3BH 5FO7B 4OO1G 2B63H 3BZCA 4L5TA 4B3ML 3MVVA 2EXDA 2B2TC 2SNSA 2AQ3B 2ZXPA 4ALPA 1LT5D 2Z4HA 3BG3A 4MTNA 1WTXA 2MGSA 3SDZA 1KNEA 3I3CA 5IGDA 5A2QE 4HIKA 4DNRB 4PQXA 2EDGA 4RGOS 2AQ2B 3GV3A 3MXNB 3HRZC 2Z4IA 4G7ZC 1JOQA 1KLGD 3HOZB 4P2CB 3PO2H 5C4XG 4LAAA 3M4OB 3OMCA 4JYAL 1XNQQ 5E1FA 2LXJA 1OTCA 1VF5C 2QCPX 4JI0Q 4U68A 1PTOF 3TN2A 1WD0A 2PMZE 4QJFA 2JA8B 4LMQD 1DOMA 3NWSA 4DV1L 4DV2L 1FGUA 3GTLH 2NVYH 1HJPA 4DUYL 4A3GB 3Q22A 4DV0L 4J1MA 1PRTD 3NK9A 3K5MA 2HCIA 3BDOA 4XT1B 1B3AA 3M4QA 2A73B 3RN2A 4ILWA 2F0HA 3AYHB 1H9MA 1E22A 2JA7H 1VMPA 1W3SA 4DV6L 1XJVA 3EFXD 4I65A 3HOYH 3RZOH 2RKSA 5M5YH 3CKIB 1L1OC 1QG7A 4X65L 4B3TL 2EYOA 4BWGB 1KDCA 1EEID 4H02A 5LMUL 4A93B 1G91A 2QW7A 4NB3A 5TSSA 1I6HB 2L55A 2ZJQA 3L7ZC 1IHZA 1SEBD 1BDOA 5M3FB 5FLMH 1VQ4A 4KY5A 1M90C 1IKLA 1Y14B 3OSOA 4RAUC 4RHSA 4J15A 4R4IA 5HURA 4PMBA 4A3BB 1MSGA 4A3IG 4ULLA 1IYUA 2O4XA 3MFYA 2RBMA 3TDQA 5IIFA 3RN5A 1IW7D 2ICEC 2QEXA 1ENFA 4L5RC 3NELA 3E5SA 4RGTA 1EYCA 4DF7A 2B2WC 4X62Q 1QZHA 1NSNS 3URYA 2RHSB 2KJXA 4Q0FA 1G2SA 3RNUA 4JYAQ 4NP5A 2LSSA 4PV1C 4X64L 3LWUA 1S40A 3VYTA 2R7ZH 4IUUA 1BOSA 3M85A 4L5SA 3KF8A 3PIP3 1HUMA 2HCCA 1PH3A 1HTPA 1I4GA 3U9OA 2OCEA 3K8AA 3NQIA 1CA6A 2XRSD 1PV4A 1LUZA 2K5WA 2JA9A 2EZVA 5C44H 5D65A 4HJ8A 2K6AA 2E2HH 4KD3A 3H0GB 1RHPA 3PGZA 5D3IB 1RJTA 1HHVA 1SE4A 3KBXA 3ICEA 1E2WA 3J80E 2JA6B 2PNRC 3TP7A 4KKSA 4IN3A 5EBDA 2VUMH 4R4CA 3TREA 4JI7Q 3BVZA 1E2VA 1N8RC 2F0EA 4LF9L 2D62A 2JA5H 3MXUA 5IP9G 2DN8A 3EQLC 2RCNA 1Q86C 5CORA 5GQOA 1S4ZA 1NNXA 1SE3A 1WD1A 1II3A 4GKKQ 1AH9A 4V0BA 3SK8A 5C3EH 3G7LA 2H1EA 2Z9HA 1NR4A 3S1QB 4BBRG 4F88A 3S1NH 1H9JA 1VS0A 1KDAA 4GLXA 3T56B 4IUNA 1A2TA 3MXGA 3ER0A 1UE7A 3M3YB 2R3ZA 4IFDJ 3NUCA 1XWEA 2EY6A 4LF4Q 1HRJA 4E6IA 4K8JA 1L1OB 1B9NA 3F1ZA 1G51A 3F8TA 4M1UB 2R61A 2B2VA 3OWEB 1F77A 4RGMA 5C3EB 2CW0D 3CF5A 5KNCA 2YV5A 4UY8C 5EAYA 2R93B 1E2ZA 2I46A 3VA5A 2VQFL 3WOEA 4K2LA 4C1NI 3FPPA 4GS3A 5H1SE 4PZ6A 5CMDA 4QIWE 1OXTA 4XDXA 5IE8A 5EPKA 3C3LA 1XTDA 1G6ZA 1WJJA 4B3RL 2BH8A 1BCPB 4JBJA 4B9WA 4AQYQ 3NP8A 2I0QA 4BBSB 4DA2A 5F2DA 3NBHB 3RZOB 3V05A 2IL8A 5J39A 3CCLA 4YHHL 2IX1A 4K8IA 4C3HH 4JI8Q 3J81c 1NMFA 5EKLA 1YZ6A 2O5IC 4BY7H 2KCMA 3GTPB 4X3TA 3T1HQ 3R2IA 1RKNA 2K1BA 3UI2A 3I90A 1TWAH 1DOKA 2RDGA 3HOWG 4CDFC 3CAMA 4F87A 1TIID 3TSSA 5M3MH 3S17H 1TXYA 5DM63 1KRTA 2EY2A 3HOYB 1AEXA 3A55A 2JE6I 2EPBA 2MO1A 2PPBC 1KC8C 1TS3A 4I7AA 1EYGA 1EU3A 4NXNQ 3G6EA 4LF8Q 1WTVA 4DK0A 1JICA 1UNSA 1VQGA 1NUCA 2EOTA 3QOJA 3PV0A 1HFGA 1AE3A 1QZGA 2F3IA 2RSOA 1XNRL 4C3HB 5IYCH 3VR4A 4K2KA 5JVG3 1J5EQ 3HOUH 1UAPA 5J1ZA 1VQEA 2YTYA 5C4HA 5C0XI 4QY7A 1IYVA 3HP3A 3I7FA 1AZQA 1OXXK 2UUBL 3K57A 3EVQA 3K5OA 2NVYB 3M7GA 4UHVA 4PG3A 3K81C 4B3SQ 1HNXL 4QB4A 1WFQA 4DR4L 2A6HC 3C2PA 2RSNA 4X66L 3S15H 4QL5A 5LMNQ 3J80i 4IPCA 1AP0A 3J80c 1GUTA 1RF2D 1L0YB 3E9HA 4FNFA 2JA5B 2Q2HA 1N33Q 5DLQE 4TRDA 3CU7A 5D14A 1BVSA 3A7LA 2E2HB 4BY1G 1B2TA 3CP0A 2J4XA 5ELFA 1YHAA 2KA7A 3H3VH 1EY5A 2JQOA 5FLXc 2WAQG 3FP9A 3J7AF 3J81i 1L2FA 3I91A 2FXQA 3KLSA 5GAEC 1HTLD 1U0LA 3J7ZC 2Z6KC 3K7AB 2VNUD 2D2CC 3GD7A 3KF6B 4QCLA 1X9NA 5M3MG 1DD2A 4O42A 2DUDA 2GA4B 2F0KA 3OW2A 2UUBQ 3MTSA 2BH2A 3HKZE 3NBIA 5IYDG 2IX0A 3ZYYX 4C1NK 4A3KG 4LNQA 3BU2A 3S1QH 1FNUA 4ZUIA 1STHA 4AYBB 2PNHA 1RIPA 4DFAA 5LL6S 2ZXOA 4KMUC 1FYCA 3FPUB 5JAVA 1G8ZD 2RDFA 3PUWA 1TWAB 1M1KC 2K5VA 1U4LA 5GADC 4OWWB 4QF4A 1UEAB 3GTLB 2B29A 3S1MB 4RFBA 1XNRQ 5DEHA 1JR0D 2EYLA 5G3LF 3X3NA 3K0YA 1X54A 5E4WC 3AU7A 2A6ED 3F2UA 4HEDA 5JVH3 4DUZQ 4TVAB 2JA7B 3GTGH 1SYDA 1K8AC 3NQTA 1BCPC 4JI6L 1AZPA 4OHJA 1SJHD 4LUVA 4YY3L 3D6WA 3OOCA 4LF6L 1D5XC 1XMQL 3D31A 3L0OA 4C3IH 4A3JG 1AN8A 4MTKA 4KJOA 4BBRB 1STEA 1PH8A 3EROA 2N78A 5CV5A 1N34L 1S5DD 4C2MB 1D2BA 1IBKL 2SOBA 1RTNA 3NXWA 5AJ3Q 4S3SA 4ME5A 4DUZL 1WYDA 4IFDH 2Z1CA 4NXNL 2D5DA 1S5FD 2XWBB 1GUSA 3T1YQ 1LT3D 2ZTDA 3A56A 2NZOA 5CYUA 1STNA 3P7JA 4A3GH 4RMFA 2D0PA 2YTXA 1QCBD 4NXML 1EQTA 4JI3L 3BS1A 4OX9L 1VQCA 4HIDA 2VQFQ 1CKNA 1YNJC 1TT2A 1PA6A 1GHKA 3TZDA 1XMOQ 2IPKD 1ENCA 4JG2A 4DR6Q 4G57A 2IW3A 1K3BC 2E5LQ 4CJ1B 2UUAQ 4LFCL 4R4OA 4HJAA 4UPAA 4XTCS 2AWOA 3DLLA 2XWJB 3TS2A 1UE6A 1EY9A 1STBA 3H0GH 3QOLA 1XTCD 1A6XA 1VQ9A 4EQNA 1HZ9A 4ZKCB 2Z6KA 4FVMA 3EIVA 5M9OA 2K01A 1FNWA 1TS4A 2WFWA 5K36H 4DNTB 1JJGA 5IGGA 1M8AA 1DXMA 1SXTA 3GTQB 3PUXA 4B3RQ 3K0XA 3GO5A 1I6VC 1LM0A 4CJ2C 3MZ5A 1ILQA 3CCVA 4KHVA 1BF4A 4LF7L 2R6GA 1EYDA 1GXDC 2D9UA 4KN4C 2EIFA 2B3GA 2I07B 1HNWL 1SYFA 3UDIA 4A3MH 2BA1A 1YHQA 3HKSA 4K5WA 5JPMC 4A3BG 4JI1L 1I3QB 1VQ5A 2F0NA 2LKVA 2RVLA 1AE2A 1K9MC 2PZUA 2NVXH 2KUMA 3CXCA 1VQFA 1I94L 1EZ6A 2I5MX 3OTOL 1E7ZA 4MHEA 3LNNA 4WJ3M 3H6MA 1A3UA 4JBMA 3K6OA 3PF4A 2FHTA 4JPBW 4ME3A 1RD9D 1XPUA 2JEBI 4LF4L 1Q1EA 4B9XA 1NMGA 4Q5VA 4RCOA 3I4NH 3LWEA 1PZID 2OT2A 2K05A 1VMCA 4EGVA 4RKBA 1K8GA 3A8KE 5L37A 1J9OA 3AFQA 5IWAL 1O7IA 1KXLA 1BKBA 3TRZA 4IJHA 3KLWA 1QVFA 3D8GA 4A3FG 2MJ8A 2HQEA 1K83B 1J6QA 2VQEL 5KRUA 2KECA 1CHPD 1FD7D 1ICWA 1UE5A 2ID0A 1GUNA 2LY7A 4KHZA 1B53A 5IGCA 1KLUD 2UU9Q 1Q12A 4J8QA 1N32L 1F9RA 1O78A 1TQOA 3QR8A 5EKKA 3S2DB 4IUTA 2XN9C 3L3OC 4F7XA 3M4PA 4JI7L 1OXSC 2NTSA 3M3YH 1LT4D 1TVXA 1SNCA 5ELOA 5C6AA 2EJFC 1MKHA 1EIFA 4X62L 3DMUA 1WCMH 4LWCA 4JW0A 3S1NB 1V1OA 4YCWA 3GTOH 3JAMc 2PYKA 5CV8A 1A62A 2Z8LA 1UWVA 5JJIA 2AUKA 3CPWA 1VQHA 1CQFA 2BDOA 1DM0B 4HCEA 1Y8PB 2F0TA 1STAA 2AUJD 1E3PA 5EQ0A 1PRTC 3VR2A 2PZTA 4HSPA 1SNOA 2MPMA 1EUJA 2CWPA 2A68C 1CTMA 3STBD 2EYFA 1Y1VH 4MN3A 5JPNC 4EVOA 3AB9A 1VQIA 2K52A 5IYBG 2Q2UA 1GKHA 1YNND 1HXYD 5EPLA 3T16A 4POGA 3U58A 4GN4B 4OGQC 1PH9A 1XNQL 2VB3X 2NVTB 1F2YA 1Q46A 2ATWA 2UXBL 5FOBB 2F0FA 2PCFB 3UE0A 4A3EH 2ZTCA 2A6HD 3GDEA 2PI2E 1EL0A 1TY0A 1GJXA 3NBHA 4OWXB 3QG1A 1PTOH 3SGIA 4C56C 5D3DA 1HZBA 1WTQA 4BA2I 4A3FH 3GQBA 3CCRA 1P8LA 3KOJA 1WTHA 1KAAA 2IHFA 5C0XG 1R9TH 1PTOC 1TU2B 4XIGS 4JI4L 4DR7L 3MEFA 2E74C 3J81j 3EA6A 1WTPA 2AHOB 5CV6A 4X3UA 3WWVA 2UXDQ 1F9PA 1KDBA 3VDYA 2SDFA 1B50A 4DNIA 3HOYG 1GUWA 2KHIA 5C3EG 1EQRA 3VR3A 4YWMA 3J81L 2Q8TA 1GVPA 2UU9L 1PFMA 1Z6HA 1VQOA 2MQHA 1VQ8A 4R1JA 5I9PA 3I4MH 3TQYA 2V1CC 5M3FG 4XYQA 1EIGA 4P72A 1X3GA 2K5QA 3HOXG 1YHBA 1KD1C 4A93G 4A3DH 2H4OA 4L8JA 1FR3A 1DGSA 5COYA 1JT8A 4P73A 1NR2A 3I2ZA 3D0FA 1B1ZA 1L0XB 5GROA 1UE1A 3RUZA 1CT1D 5IP7H 2LMCB 2WV6D 1Y1VG 2DGYA 5M5YB 2VXWA 1NBWA 4JI4Q 2V4DA 2NN6G 4A3GG 5ELEA 1MJEA 2HHHL 3S15B 2PO4A 2OEOA 2F0JA 3TZUA 1EY8A 2WKDA 3I70A 1PDQA 3V96A 3S16H 2J7ZA 4HJ9A 2M00A 5EJWA 3CQZH 1K0SA 3OPOA 5T1IA 3H3VC 4NMZA 1S3OA 2F0MA 1JB3A 3VYRA 1OXUA 1Q3LA 4DV7Q 4CHTB 2IY5B 1KRSA 3PQIA 1RTOA 2B2TA 4X65Q 3EJIA 2E2IH 1F9SA 2F0PA 2K14A 4HSVA 4PZ7A 2WKCA 4IPHA 3I4LA 5J3BA 1HA6A 3PO3G 2K04A 2AMCB 4DAVA 1EY6A 4A3CH 2NZ1D 1SMXA 3I72A 3G71A 3ULJA 5IOCA 2F0IA 4GN5A 1K3RA 1YI2A 3MEHA 4DR5Q 3FHWA 3CRLC 1IL8A 5E7NA 4JI1Q 1K0RA 1EQVA 1D5ZC 2NWGA 4BBRH 2E5LL 2ZT9C 2UUAL 3R8BA 4PZ8A 3FKIH 5M3FH 3DUZA 4DV6Q 2WIIB 1KIXA 2HIVA 3PMFA 2R92B 4BS9A 5IGEA 5KNBA 4A3DG 4Y7NB 1W6KA 2NN6I 2DJGC 3CRKC 1V43A 1D7QA 2A6EC 4DR3L 1GM5A 2LS01 3N6RA 2R7DA 4KD4A 5IYDH 2MP1A 1SYGA 1TWGH 4GOPC 1QUQB 4ID6A 2AWNA 4DR6L 3ULPA 1IBKQ 4BBSG 4LUOA 1FGBD 3LX0A 2NZHA 1T5EA 3OMGA 1XMOL 2A8VA 2OTJA 4DGZA 2Q8RE 1KHIA 2F0LA 2GVAA 3CCEA 4QGUA 4CKCA 1A15A 4A3LG 4FXKC 2R92H 3S2HH 4M8AA
chains in the Genus database with same CATH topology
1F9QA 4N9TA 3T51B 4JBWA 1PFNA 1BBXC 1CFMA 1SBBB 2A5HA 4KKUA 1Y8OB 1TKWB 2JYOA 1EWHA 4K6DA 2EJGC 1SNQA 1STYA 4A3IB 1D6EC 2JEAI 3K59A 4DU9A 5FK9C 1K8MA 1SNMA 4RKLA 1CK1A 2FMMA 2VB2X 1LACA 1D1IA 1XYIA 2E75C 4FP5D 3PUVA 4ZYSA 1ENAA 1WVLA 3MHBA 2PW7A 4QUFA 3ERQA 4CKBA 4XQJA 2TSSA 3J7AV 3R93A 1PYWD 3JAML 1I4PA 4CBVA 2EY5A 1ZEQX 3J7YW 2ICIA 3GTKB 5FKAC 1G2TA 4O1NA 4ZRZA 1LTSD 1M4VA 1BR9A 2XSCA 4KV6A 1S5CD 2DY7A 3A8JE 5IGBA 5JOBA 1KABA 3SE0A 3JAME 3ONAB 3H94A 5CGKA 2IX3A 5C0XH 4C3HG 3V2TA 4G7HC 2X69A 1GUOA 5I4DA 1PLFA 1I50B 4DXFA 1TWGB 1XXGA 4NW2A 2FINB 5I2YA 3MWYW 3E6ZX 2NVQB 3I4NB 1SYBA 3S1RB 4FF2A 3BYTB 2BE5C 3OIPA 4BY7B 1SAPA 5BN5A 4MIUA 1TWHB 2X6LA 4R9WA 5FO8B 4PMCA 5I9OA 1PTOB 5M3MB 4OO1I 1X3PA 3GTGB 3QB3A 2F0UA 3T53B 4A3MB 1O80A 4UDUC 2YYZA 3FEWX 4HAEA 2KEEA 4BY1B 1KNAA 1MD2D 1OXVA 2DNCA 2F0WA 2LFNA 2M2LA 3KK7A 5J22A 1Y69U 3P1HA 2A68D 2WP8J 3D4DA 1VCIA 2KCCA 2CW0C 3QO2A 1CHQD 1BO0A 2TMPA 3C46A 2BDNA 3T13A 1WTWA 2IT1A 5E3FA 1QOHA 5HGTA 1O7ZA 3IL8A 2J0TD 2BA0A 2RQXA 4OIJA 4GZYC 2ZXRA 5JJZA 2EYHA 1D1KA 2DY8A 2KQ3A 2L1BA 1VF7A 5JEAH 4JK1C 1I4RA 1EIHA 4DAYA 1Z7TA 1PRTB 1JORA 3Q23A 5DM73 1TR5A 2PMZB 2XRQD 4IURA 3HOWB 1Z47A 2L5TA 3BVMA 2KHSA 3M4YA 4DXGA 4Z9CB 2B2UC 4A3JB 3M7NA 1HQRD 4RCNA 5LL6X 1XX8A 2EVBA 3K5LA 1GUGA 2FFKB 1ZYRD 1KTKA 3SR1A 3PIO3 3GV6A 4RGNA 1SE2A 1H9SB 3R3OA 2E2IB 1DONA 1A2UA 2JSOA 5CBAE 1S5BD 2F0VA 2CQAA 3BVGA 4H7BA 3ITPA 1PFBA 2B2UA 3FRPB 3HZXA 1LV9A 2NYZD 4R8NA 4OIKA 3OHXC 3OWFA 1R4QB 3FKIB 2NBFA 5IT9E 2KVMA 5E4XA 5CV4A 1LTRD 2A69D 1ZXTA 4HMJA 4ZK9B 2SEBD 2B2VC 4IUQA 2L11A 3DWPA 2MUYA 4WFN3 1GOZA 3W3AA 5CC4A 5C44B 1MI2A 3A7AB 3NTKA 4ZAIA 4XXEA 1RCVD 3VR6A 1DCZA 5I6WA 1LTID 1NCVA 2B39A 3A54A 5KIXA 4RHRA 2QKIC 4I7ZC 1DYQA 5I6YA 5DNFA 3O13A 4IQZA 3IKJA 3HOVB 4A3EB 1JQYD 2N55A 2F0GA 1HQMC 2B2YC 1K8OA 1CZWA 1IKMA 2SNMA 4QUCA 4IALA 1HCZA 2F0OA 4A3FB 4IFDI 1QNKA 2XIWA 3Q6SA 5ELDA 1RDPD 1U4MA 2G9DA 5BN4A 2RA4A 4ZKBB 1QE6A 3FVQA 3GTOB 4K5VA 2HDLA 4XQQA 4L6TB 4IUVA 3QWNA 2KCNA 4FO2A 1E0BA 1B9MA 2XNAC 5M5XB 3I73A 3PUZA 3H91A 1EU4A 4KKTA 2K32A 4PMWA 5FO9B 1EY0A 2C9OA 1AFPA 1U4RA 1VDZA 1DOLA 1JWUD 1BCPF 1YNJD 1A3TA 2EYMA 2QF7A 3W2DA 2FMCA 1V1PA 4B08A 1PZKD 1MGSA 1CQVA 2IJ0A 1EWCA 4H44C 2IWHA 2EYJA 3DEPA 4QIWB 2FJ2A 4XQNA 2B8FA 3MXPA 1AW7A 1J8IA 5IT9L 4BA1I 1JE4A 5CV9A 1TS2A 4X3SA 2L4NA 1PZJD 3PUYA 1SFOB 1LTGD 1PMRA 1H9SA 1B4OA 1LTTD 2BOSA 1WCMB 4U673 3GTMB 2NN6H 5T1GA 1X3QA 1TY2A 1EFID 4HN7A 3VYUA 4LK1C 1NAPA 1B44D 3KLSX 1F2ZA 4A3DB 3RZDB 3K58A 3IFDA 2E2JB 2K5DA 4KY7A 4KY6A 4WJWA 3BDLA 3S14B 4KN7C 1LT6D 3R2TA 3ND8A 3D4WA 4ZLTF 2HUGA 5A35A 4G7OC 1U4PA 4TSSA 1C4QA 3HGBA 4FYDA 4EQPA 3VR5A 1C48A 1JCKB 1EY7A 1ESRA 1ZKOA 3PO3B 4F8MA 4RA8A 3RD4A 4OO1H 5IGFA 2F0DA 5C3WA 1U9RA 1R9TB 1SMYC 3I4MB 2DNEA 3S2HB 2NVXB 1LTBD 4H13C 2O5JC 3NWTA 4N9PA 2K7VA 5FLXE 3DHQA 2F4IA 3D6CA 4A3KB 1A3VA 2L0CA 3BYYB 1JWSD 4DN4M 2F1MA 2K33A 4K5XA 2QDBA 4OL7A 4PNYA 1Q90A 4C3JG 3I8ZA 1ML0D 4HCSA 2F3WA 1D5MC 3RMHA 3A8IE 2Y0SB 1SJED 3DWAA 1LLRD 4YIJA 1TWCB 5A2QL 4KJNA 2BCOA 4RWSC 4G4KA 2KEDA 1JOKA 3H09A 1R4PB 5KYIA 3NTIA 3RLFA 1CI3M 3CHBD 4K14A 1SSOA 3DEOA 1QNUA 5DAUA 4XT3B 1Y8NB 1H9KA 1UUPA 1JWMD 5CV7A 1I4XA 5C4XB 3MC0B 4KI0A 4WRDA 3HS0C 1EYAA 3NE5B 1EZ8A 1ILPA 3FMCA 2XVSA 1ET9A 1BCPD 3KUPA 2NUCA 4DAPA 1JC7A 4RH6A 3S17B 3U9SA 2Q8IB 5BN3A 4ODGA 3MAQA 2MHVA 1QB5D 4WORA 1SNDA 3KLRA 3Q24A 2B2WA 4C3IB 1SDFA 5IODA 1GHJA 2OF1A 2NTTA 3N52A 2YU9B 4HR7B 1O7YA 1MBYA 1QJOA 4X3KA 2L9HA 2WACA 1RODA 1LTAD 2O2LD 1HPCA 3SXHA 4FF3A 3QIAA 3OW7A 2JXMB 4UAIA 3IAYA 2K28A 1F2LA 2EE1A 3BDCA 5ELBA 3SVMA 1F2MA 4ZQ3A 5KEEA 3NSWA 3FDTA 1JOOA 1ONLA 4KTAA 5JEAG 1S5ED 3DWQA 4K6LA 4QMGA 2PQEA 3C1FA 1H9RA 2NB0A 3DXJC 4V190 3TBIB 1X32A 2CHBD 1EY4A 5EKIA 2B8GA 3X3MA 1BQQT 3E0JA 4EQOA 4ABNA 4IFDG 3NTHA 1FNVA 2F0SA 4R8IA 1YNNC 3VA7A 1ET6A 1CM9A 3T4AC 1HA5A 3MXNA 4NKLA 5M5WB 2E76C 3GTJB 2G9HD 4FF1A 4IZ8A 2EJMA 3HOXB 1SYEA 2VUMB 1HFNA 5NUCA 1CZGA 3IFTA 3J80L 5ISRA 4DK1A 2F03A 1EOTA 1I4QA 1IW7C 5KYLA 3SK4A 3QJYA 2QILA 1BNZA 2AQ1B 4CGYB 2M9VA 4C3IG 5ELCA 3HG9A 2A74C 1G291 4FXGC 1Y1WB 1QWYA 5C5MA 1I4HA 3SEBA 3MA2B 1HUNA 1SNPA 3S9WA 1DZ1A 3NHHA 1DJRD 3TP5A 2OXPA 5EGTA 2F3VA 2EY1A 5C3XA 2PZWA 1LABA 4H0LC 5LHY1 2CVRA 2KOLA 1C8CA 1W6JA 3S16B 2R7ZB 2N88A 4TQUS 1CA5A 1ESFA 2A69C 4XYOA 3MFGA 1ZYRC 2QEJC 3P75A 3HKZB 1OO9B 3KBGA 3K5NA 2X6GA 3D3RA 1STGA 1V1PB 5K36G 3TP8A 5I2XA 5CR3A 2HDMA 1Y1VB 5KGUA 2WINB 5KNDA 3VYSA 2E2DC 1LO5D 1V8QA 4KK7A 3AMUA 5EPJA 2EYPA 1SMYD 5AFWA 2WB1B 3P20A 3GP7A 2C5CA 1EEFD 1TWFB 3L9AX 3DM1A 4ZUJA 4C3JB 1SYCA 3J81E 5G3LD 2B63B 4FXDA 2K03A 3D4RA 1PRTF 4HTHA 2ENBA 5C5LA 1QILA 3BZDB 5C0XJ 4NDXA 1PXUA 3TMEA 1BXTA 3OIQA 4CJ0B 3SHLA 1WTOA 3G6JB 1BUVT 5C4JB 3ND9A 2JP1A 3SK5A 3TP6A 4TKOB 3CQZB 4HMIA 1O7LA 2B2YA 3NPPA 4IUPA 1MSHA 3WOFA 3HEJA 3HOUB 3C1EA 5EBCA 1TS5A 5JEAJ 1WTRA 3WDNA 2EXZA 5CBEE 2PW5A 2WAQB 2F0QA 2RDHA 5FLXL 5K5PA 4CKEA 3SK6A 1Q1BA 4J6HA 4LJZC 2BE5D 3Q0AA 1T5XD 3PO2B 1PTOD 2L12A 5C4ZA 4L63B 1Q8IA 4FF4A 5FO7B 4OO1G 3MVVA 2B2TC 2SNSA 2AQ3B 2ZXPA 1LT5D 2Z4HA 3BG3A 1WTXA 2MGSA 3SDZA 1KNEA 3I3CA 5IGDA 5A2QE 4DNRB 4PQXA 2EDGA 4RGOS 2AQ2B 3GV3A 3HRZC 2Z4IA 4G7ZC 1JOQA 1KLGD 3HOZB 4P2CB 4LAAA 3M4OB 3OMCA 5E1FA 1VF5C 2QCPX 4U68A 1PTOF 3TN2A 1WD0A 2JA8B 4LMQD 1DOMA 3NWSA 4A3GB 3Q22A 4J1MA 1PRTD 3NK9A 3K5MA 2HCIA 3BDOA 4XT1B 1B3AA 2A73B 4ILWA 2F0HA 1H9MA 1VMPA 3EFXD 4I65A 2RKSA 3CKIB 1QG7A 2EYOA 4BWGB 1KDCA 1EEID 4A93B 1G91A 5TSSA 1I6HB 2L55A 3L7ZC 1IHZA 1SEBD 1BDOA 5M3FB 4KY5A 1IKLA 3OSOA 4RAUC 4RHSA 5HURA 4PMBA 4A3BB 1MSGA 4ULLA 1IYUA 2O4XA 3MFYA 2RBMA 3TDQA 5IIFA 1IW7D 2ICEC 1ENFA 3E5SA 4RGTA 1EYCA 4DF7A 2B2WC 1NSNS 3URYA 2KJXA 4Q0FA 1G2SA 4NP5A 4PV1C 3LWUA 3VYTA 4IUUA 1BOSA 3M85A 3KF8A 3PIP3 1HUMA 2HCCA 1HTPA 1I4GA 3U9OA 3NQIA 1CA6A 2XRSD 2K5WA 2EZVA 5D65A 2K6AA 4KD3A 3H0GB 1RHPA 1HHVA 5D3IB 1RJTA 1SE4A 3KBXA 1E2WA 3J80E 2JA6B 2PNRC 3TP7A 4KKSA 4IN3A 5EBDA 3BVZA 1E2VA 2F0EA 2D62A 3MXUA 2DN8A 3EQLC 5CORA 1S4ZA 1SE3A 1WD1A 1II3A 4V0BA 3SK8A 3G7LA 2H1EA 3S1QB 1NR4A 4F88A 1H9JA 1KDAA 3T56B 4IUNA 1A2TA 3MXGA 3M3YB 2R3ZA 4IFDJ 3NUCA 1XWEA 2EY6A 1HRJA 4E6IA 4K8JA 1B9NA 4M1UB 2R61A 2B2VA 3OWEB 1F77A 5C3EB 4RGMA 2CW0D 5KNCA 2R93B 1E2ZA 2I46A 3VA5A 3WOEA 4K2LA 4C1NI 3FPPA 5CMDA 1OXTA 4XDXA 5EPKA 3C3LA 1G6ZA 1BCPB 4B9WA 4BBSB 3NP8A 4DA2A 5F2DA 3RZOB 3V05A 2IL8A 5J39A 2IX1A 4K8IA 5EKLA 2O5IC 3GTPB 4X3TA 3R2IA 1RKNA 2K1BA 3UI2A 3I90A 1DOKA 2RDGA 4F87A 1TIID 3TSSA 5DM63 2EY2A 3HOYB 1AEXA 3A55A 2JE6I 2EPBA 2PPBC 1TS3A 1EU3A 1WTVA 4DK0A 1JICA 1UNSA 1NUCA 2EOTA 3QOJA 3PV0A 1HFGA 2RSOA 4C3HB 3VR4A 4K2KA 5JVG3 1UAPA 5J1ZA 5C4HA 5C0XI 1IYVA 3HP3A 1AZQA 1OXXK 3K57A 3EVQA 3K5OA 2NVYB 3M7GA 4QB4A 2A6HC 3C2PA 2RSNA 1AP0A 1GUTA 1RF2D 1L0YB 4FNFA 2JA5B 4TRDA 3CU7A 5D14A 3A7LA 2E2HB 1B2TA 2J4XA 5ELFA 2KA7A 1EY5A 3J7AF 3I91A 3KLSA 1HTLD 3K7AB 2VNUD 2D2CC 3GD7A 4QCLA 1DD2A 4O42A 2GA4B 2F0KA 3MTSA 3NBIA 2IX0A 3ZYYX 4C1NK 1FNUA 4ZUIA 1STHA 4AYBB 4DFAA 5LL6S 2ZXOA 4KMUC 1FYCA 3FPUB 5JAVA 1G8ZD 2RDFA 3PUWA 1TWAB 1U4LA 4QF4A 1UEAB 3GTLB 3S1MB 4RFBA 5DEHA 1JR0D 2EYLA 5G3LF 3X3NA 3K0YA 5E4WC 3AU7A 2A6ED 3F2UA 4HEDA 5JVH3 2JA7B 1SYDA 3NQTA 1BCPC 1AZPA 4OHJA 1SJHD 3D6WA 3OOCA 1D5XC 3D31A 1AN8A 4KJOA 4BBRB 1STEA 3EROA 5CV5A 1S5DD 4C2MB 1D2BA 2SOBA 1RTNA 3NXWA 4S3SA 4ME5A 4IFDH 2Z1CA 2D5DA 1S5FD 2XWBB 1GUSA 1LT3D 3A56A 5CYUA 1STNA 3P7JA 1QCBD 3BS1A 1EQTA 1YNJC 1TT2A 1GHKA 3TZDA 2IPKD 1ENCA 4G57A 2IW3A 4CJ1B 4XTCS 2AWOA 2XWJB 1EY9A 1STBA 3QOLA 1A6XA 1XTCD 4EQNA 4ZKCB 4FVMA 5M9OA 2K01A 1FNWA 1TS4A 5K36H 4DNTB 5IGGA 1M8AA 1DXMA 1SXTA 3GTQB 3PUXA 3GO5A 1I6VC 4CJ2C 3MZ5A 1ILQA 1BF4A 4KHVA 2R6GA 1EYDA 1GXDC 2D9UA 4KN4C 2I07B 1SYFA 2BA1A 4K5WA 5JPMC 1I3QB 2F0NA 2LKVA 2RVLA 2PZUA 2KUMA 1EZ6A 4MHEA 3LNNA 3H6MA 1A3UA 3K6OA 2FHTA 1RD9D 2JEBI 1Q1EA 4B9XA 4Q5VA 4RCOA 3LWEA 1PZID 2OT2A 2K05A 1VMCA 4EGVA 4RKBA 3A8KE 1J9OA 3D8GA 2MJ8A 2HQEA 1K83B 5KRUA 2KECA 1CHPD 1FD7D 1ICWA 2ID0A 1GUNA 2LY7A 4KHZA 1B53A 5IGCA 1KLUD 1Q12A 4J8QA 1F9RA 1O78A 1TQOA 5EKKA 3S2DB 4IUTA 2XN9C 3L3OC 4F7XA 1OXSC 2NTSA 1LT4D 1TVXA 1SNCA 5C6AA 2EJFC 3DMUA 3S1NB 1V1OA 2PYKA 5CV8A 2Z8LA 2AUKA 1CQFA 2BDOA 1DM0B 4HCEA 1Y8PB 2F0TA 1STAA 2AUJD 5EQ0A 1PRTC 3VR2A 2PZTA 4HSPA 1SNOA 2MPMA 2A68C 1CTMA 2EYFA 4MN3A 5JPNC 4EVOA 3AB9A 1YNND 1HXYD 5EPLA 3T16A 4OGQC 2VB3X 2NVTB 1F2YA 5FOBB 2F0FA 2PCFB 2A6HD 1EL0A 1TY0A 1GJXA 3NBHA 3QG1A 1PTOH 4C56C 4BA2I 5D3DA 1WTQA 3GQBA 1KAAA 5C0XG 1PTOC 1TU2B 4XIGS 2E74C 3EA6A 1WTPA 5CV6A 4X3UA 1F9PA 1KDBA 2SDFA 1B50A 1GUWA 3VR3A 3J81L 2Q8TA 1PFMA 1Z6HA 5I9PA 4XYQA 1EIGA 2K5QA 2H4OA 4L8JA 1FR3A 5COYA 1NR2A 1B1ZA 1L0XB 3RUZA 1CT1D 2LMCB 2WV6D 5M5YB 2VXWA 2V4DA 2NN6G 5ELEA 3S15B 2PO4A 2OEOA 2F0JA 3TZUA 1EY8A 2WKDA 3I70A 1PDQA 3V96A 2J7ZA 2M00A 5EJWA 3OPOA 5T1IA 3H3VC 4NMZA 2F0MA 1JB3A 3VYRA 1OXUA 1Q3LA 4CHTB 1RTOA 2B2TA 3EJIA 1F9SA 2F0PA 4HSVA 2WKCA 3I4LA 1HA6A 2K04A 4DAVA 1EY6A 2NZ1D 3I72A 5IOCA 2F0IA 3MEHA 3CRLC 1IL8A 1EQVA 1D5ZC 2NWGA 2ZT9C 3R8BA 3DUZA 2WIIB 3PMFA 2R92B 4BS9A 5IGEA 5KNBA 4Y7NB 1W6KA 2NN6I 3CRKC 1V43A 2A6EC 2LS01 3N6RA 4KD4A 2MP1A 1SYGA 4ID6A 2AWNA 1FGBD 3LX0A 1T5EA 3OMGA 4DGZA 2Q8RE 2F0LA 4CKCA 1A15A 4FXKC 4M8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXN A;  3NBH A;  4DAY A; 
#chains in the Genus database with same CATH topology
 5C4X H;  1F9Q A;  1I3Q H;  4N9T A;  3KDF A;  1FVI A;  3T51 B;  4JBW A;  1PFN A;  1BBX C;  2JA8 G;  4JV5 Q;  1CFM A;  1N32 Q;  1SBB B;  2A5H A;  4KKU A;  1HNZ L;  1Y8O B;  1TKW B;  4O0A A;  1Q81 C;  2JYO A;  4YWK A;  2VW9 A;  1VQN A;  2ZJR A;  1EWH A;  1EWI A;  4K6D A;  2EJG C;  1B7Y B;  1SNQ A;  1HZC A;  1STY A;  4A3I B;  1Y1W H;  1D6E C;  5IWA Q;  1EQQ A;  2JEA I;  3K59 A;  4DU9 A;  5FK9 C;  1K8M A;  1SNM A;  3UDX A;  4RKL A;  1EIY B;  1CK1 A;  3K80 C;  2FMM A;  2VB2 X;  2WB1 G;  1G6P A;  2WB1 E;  1LAC A;  1CKM A;  1YJ9 A;  4JBK A;  1D1I A;  1XYI A;  2E75 C;  4JI2 Q;  2L15 A;  3J7A 5;  5HGQ A;  4FP5 D;  3PUV A;  4ZYS A;  1ENA A;  1SRO A;  1WVL A;  3E0E A;  3MHB A;  2PW7 A;  4QUF A;  3ERQ A;  4CKB A;  4XQJ A;  5FLM G;  3A5U A;  2TSS A;  3J7A V;  3R93 A;  1PYW D;  1WOC A;  1CKO A;  1P16 A;  3JAM L;  4A3I H;  1I4P A;  4CBV A;  2EY5 A;  1ZEQ X;  3J7Y W;  1PH2 A;  1X6O A;  4OON A;  2ICI A;  3GTK B;  5FKA C;  3STB C;  1G2T A;  1IXR A;  2JN4 A;  4LF5 Q;  2JA6 G;  4O1N A;  2XTI A;  4ZRZ A;  1LTS D;  1VQK A;  1M4V A;  1BR9 A;  2XSC A;  4KV6 A;  1S5C D;  2DY7 A;  3A8J E;  5IGB A;  5JOB A;  1WI5 A;  1KAB A;  3SE0 A;  3JAM E;  2R7Z G;  3ONA B;  2RHQ B;  3H0G G;  2E8G A;  1YJW A;  3H94 A;  5CGK A;  2IX3 A;  5C0X H;  4HIO A;  4C3H G;  3V2T A;  4OWT B;  4G7H C;  2CH4 W;  2X69 A;  1GUO A;  5I4D A;  2F4V Q;  1PLF A;  1I50 B;  4DXF A;  1ASZ A;  1TWG B;  3RLN A;  4GKJ Q;  1XXG A;  4NW2 A;  3CD6 A;  2FIN B;  4WJ4 A;  5I2Y A;  1IBL Q;  3MWY W;  3E6Z X;  2NVQ B;  1HR0 W;  3I4N B;  1SYB A;  3S1R B;  4FF2 A;  4JI3 Q;  3PIO A;  1Y1W G;  3BYT B;  1N33 L;  2BE5 C;  3OIP A;  2UUC L;  4BY7 B;  1SAP A;  4LFC Q;  2PQA A;  5BN5 A;  4MIU A;  3KFU A;  1TWH B;  2X6L A;  4R9W A;  5LMN L;  5FO8 B;  4PMC A;  1KL9 A;  5I9O A;  2UXC Q;  1I50 H;  1PTO B;  1VQP A;  4P75 A;  5M3M B;  4OO1 I;  1X3P A;  4GNX B;  1PFS A;  3GTG B;  3QB3 A;  2F0U A;  3T53 B;  2A1A A;  2MO0 A;  4A3M B;  1O80 A;  4UDU C;  2N3S A;  2YYZ A;  4UP7 A;  3EBE A;  3FEW X;  4HAE A;  2KEE A;  1C0A A;  4BY1 B;  1KNA A;  1MD2 D;  3OYY A;  2PI2 A;  4YY3 Q;  1OXV A;  2DNC A;  3S2D H;  2F0W A;  2LFN A;  2M2L A;  3KK7 A;  5J22 A;  1N34 Q;  4GKJ L;  4Y7N H;  4AH6 A;  2JA5 G;  1Y69 U;  2JA6 H;  4DR3 Q;  4HJ5 A;  3P1H A;  1KQS A;  2A68 D;  2WP8 J;  3D4D A;  1VCI A;  2KCC A;  2CW0 C;  2R93 G;  2N8N A;  3G48 A;  3QO2 A;  1CHQ D;  1BO0 A;  2Q2T A;  2TMP A;  3C46 A;  1SN8 A;  2BDN A;  3T13 A;  1WTW A;  1B8A A;  2IT1 A;  5GAG C;  3UE1 A;  1NY4 A;  2HIX A;  3F2C A;  1GD7 A;  2HQL A;  5E3F A;  1QOH A;  1QUQ A;  2CKZ B;  5HGT A;  1O7Z A;  3IL8 A;  2UUC Q;  2J0T D;  2BA0 A;  2RQX A;  4OIJ A;  4GZY C;  2F4V L;  1IZ6 A;  2ZTE A;  1JB7 A;  1LYL A;  2ZXR A;  1VQM A;  5JJZ A;  2MNA A;  2EYH A;  1D1K A;  2DY8 A;  2KQ3 A;  3PCO B;  2L1B A;  1CSQ A;  1VF7 A;  5JEA H;  1TWH H;  4JK1 C;  1ICF B;  1I4R A;  3W1B A;  1EIH A;  1GO3 E;  4DAY A;  1Z7T A;  1PRT B;  1JOR A;  3KDF B;  4DR1 Q;  3Q23 A;  4N8F A;  5DM7 3;  1VQA A;  1TR5 A;  2PMZ B;  2XRQ D;  4IUR A;  3KF8 B;  4K0K Q;  3HOW B;  1Z47 A;  2L5T A;  3BVM A;  2KHS A;  3M4Y A;  4DXG A;  4Z9C B;  2B2U C;  3HFZ B;  1SR3 A;  4A3J B;  4GOP A;  2JJQ A;  3M7N A;  3RLO A;  4LF5 L;  1HQR D;  2YU9 H;  4RCN A;  1SRU A;  1A63 A;  5LL6 X;  1XX8 A;  2EVB A;  3K5L A;  1V9P A;  1GUG A;  2FFK B;  2I5L X;  1ZYR D;  1KTK A;  3SR1 A;  4X66 Q;  3PIO 3;  1CKN B;  4DR4 Q;  3GV6 A;  4JI2 L;  5LMN W;  4RGN A;  1UEB A;  3PIP A;  1SE2 A;  1H9S B;  3R3O A;  2E2I B;  1DON A;  1A2U A;  3HOU G;  2JSO A;  5CBA E;  1S5B D;  2F0V A;  3GTJ H;  2CQA A;  1IYJ B;  4QQB X;  3BVG A;  4H7B A;  1KAW A;  2CH4 A;  3ITP A;  1PFB A;  2B2U A;  3FRP B;  3HZX A;  1LV9 A;  3M4O H;  4B3S L;  3CCM A;  4KLK A;  1PH7 A;  2NYZ D;  2OQ0 A;  4R8N A;  1S72 A;  5IP9 H;  1C7Y A;  3S1R H;  4OIK A;  3OHX C;  3OWF A;  4JI8 L;  1R4Q B;  3FKI B;  2NBF A;  3HOX H;  5IYB H;  1NE3 A;  2PQA B;  5IT9 E;  2K5N A;  2KVM A;  2ZM6 L;  2N49 A;  5E4X A;  4CDD C;  5CV4 A;  1LTR D;  2A69 D;  1ZXT A;  2UXD L;  4HMJ A;  4N8X 1;  1K28 A;  4ZK9 B;  1MIU A;  2XGT A;  2SEB D;  5C44 G;  3CCQ A;  1SLJ A;  2B2V C;  4IUQ A;  2L11 A;  3DWP A;  2MUY A;  2K5H A;  4WFN 3;  1GOZ A;  3Q8D A;  3W3A A;  5CC4 A;  5C44 B;  4DR5 L;  1YIT A;  4OEL B;  1XPR A;  1MI2 A;  3A7A B;  3NTK A;  4ZAI A;  2CCZ A;  3PF5 A;  4XXE A;  1RCV D;  3VR6 A;  1DCZ A;  5M5W H;  4AQY L;  1CUK A;  5IT9 c;  4LFB L;  5I6W A;  1LTI D;  2ZJP A;  1NCV A;  2B39 A;  2VY3 A;  3S14 H;  3A54 A;  2Z6B A;  4POF A;  1X3E A;  4NPS A;  5KIX A;  4RHR A;  2QKI C;  4I7Z C;  1EOV A;  1DYQ A;  1L1O A;  5I6Y A;  5DNF A;  3O13 A;  3HOZ G;  4JI5 Q;  3NEN A;  4IQZ A;  4EQ5 A;  3AEV A;  3IKJ A;  3HOV B;  4A3E B;  1JQY D;  4P74 A;  2N55 A;  4DV7 L;  2NVT H;  4JI0 L;  2CWA A;  2F0G A;  2I5H A;  1Q82 C;  1HQM C;  4GLV B;  2B2Y C;  1K8O A;  1XPO A;  4IOC A;  1CZW A;  1IKM A;  2SNM A;  4QUC A;  4IAL A;  1HCZ A;  2F0O A;  4A3F B;  4IFD I;  1QNK A;  2XIW A;  2F52 A;  3Q6S A;  2E2J H;  5ELD A;  1RDP D;  1YNX A;  1U4M A;  3GTK H;  4R4T A;  2G9D A;  5BN4 A;  4DV0 Q;  4AYB G;  2RA4 A;  2K4K A;  4ZKB B;  1QE6 A;  2DJF C;  4APV A;  3FVQ A;  3GTO B;  4K5V A;  2HDL A;  4XQQ A;  4L6T B;  4IUV A;  4GLA C;  4AYB E;  4B3M Q;  2MFI A;  3QWN A;  2KCN A;  3ERS X;  4FO2 A;  1E0B A;  3CMA A;  1B9M A;  1N9W A;  2VZA A;  2XNA C;  5M5X B;  1D8L A;  3I73 A;  3PUZ A;  3H91 A;  1EU4 A;  2D0O A;  4KKT A;  2K32 A;  4LUZ A;  1LTL A;  4PMW A;  5FO9 B;  1EY0 A;  2C9O A;  2Y0S G;  1AFP A;  3E9I A;  1WCM G;  2HHH Q;  1U4R A;  1VDZ A;  4IPD A;  5C4J H;  1DOL A;  1JWU D;  1BCP F;  4ZCK A;  1YNJ D;  1A3T A;  2EYM A;  3NEM A;  1HNZ Q;  2QF7 A;  3CCU A;  3W2D A;  2FMC A;  1V1P A;  1CSP A;  4B08 A;  1N36 L;  1PZK D;  1PVO A;  3HKZ G;  1MGS A;  1X3F A;  4JI5 L;  2H5X A;  1CQV A;  2A19 A;  4X64 Q;  3HOV H;  2IJ0 A;  1EWC A;  4H44 C;  2IWH A;  2EYJ A;  3DEP A;  4QIW B;  2AKW B;  2FJ2 A;  4XQN A;  2B8F A;  3MXP A;  1AW7 A;  3U4V A;  1J8I A;  5IT9 L;  4BA1 I;  4DR7 Q;  1JE4 A;  2WAQ E;  5CV9 A;  1TS2 A;  4X3S A;  2L4N A;  1PZJ D;  3PUY A;  3UDG A;  4IO9 A;  1LTG D;  1SFO B;  4GOP B;  2B63 G;  1PMR A;  2UXB Q;  4YWL A;  1H9S A;  2VS1 A;  1B4O A;  4DR2 Q;  1YJN A;  2R7F A;  1LTT D;  4GN3 B;  1L0W A;  2BOS A;  1WCM B;  3M9B A;  4U67 3;  3GTM B;  2NN6 H;  5T1G A;  1X3Q A;  1I5F A;  1TY2 A;  1H95 A;  1EFI D;  4HN7 A;  5LMU Q;  2HD3 A;  3PO2 G;  3VYU A;  4LK1 C;  1NAP A;  1B44 D;  3KLS X;  1F2Z A;  4A3D B;  3JC6 6;  2NVQ H;  3I55 A;  3RZD B;  3K58 A;  3IFD A;  2KHJ A;  3KF6 A;  3CPF A;  1HZA A;  4R4Q A;  4OX9 Q;  4DV3 Q;  2E2J B;  2K5D A;  4KY7 A;  4KY6 A;  4DR2 L;  4WJW A;  1N36 Q;  3BDL A;  4MZ9 A;  2VUM G;  4KN7 C;  3S14 B;  2K75 A;  1LT6 D;  3R2T A;  4B3T Q;  3ND8 A;  3D4W A;  4ZLT F;  5FJ8 G;  2HUG A;  5A35 A;  4G7O C;  1U4P A;  4TSS A;  1C4Q A;  3HGB A;  4JCV E;  2JA7 G;  3PSI A;  4FYD A;  4EQP A;  3VR5 A;  1C48 A;  5M5X H;  1JCK B;  1EY7 A;  1ESR A;  1HR0 Q;  1ZKO A;  3PO3 B;  1YBY A;  4F8M A;  4RA8 A;  3RD4 A;  4OO1 H;  5IGF A;  4Y52 H;  2F0D A;  4DV1 Q;  4DV2 Q;  5C3W A;  1U9R A;  1R9T B;  1SMY C;  3I4M B;  5GAH C;  2DNE A;  3S2H B;  2NVX B;  1LTB D;  3KJP A;  4H13 C;  2VQE Q;  1W2B A;  4JI6 Q;  2O5J C;  4HJ7 A;  1VQB A;  3NWT A;  4N9P A;  1BBW A;  1X65 A;  2K7V A;  1NJI C;  1SFO H;  5FLX E;  2GVB A;  2LXK A;  3DHQ A;  2F4I A;  3D6C A;  3IRB A;  4A3K B;  3CCJ A;  4LFA Q;  1A3V A;  2L0C A;  3BYY B;  1JWS D;  4DN4 M;  1EFW A;  2F1M A;  3UDF A;  4IPG A;  2K33 A;  3W1G A;  4K5X A;  4FDB A;  2QDB A;  1MHW C;  2CFM A;  4OL7 A;  4PNY A;  1Q90 A;  4C3J G;  4K0K L;  3I8Z A;  5HY6 A;  1ML0 D;  3A5Z B;  2F3W A;  4HCS A;  1D5M C;  3RMH A;  2C35 B;  2HT1 A;  1JJC B;  2QDL A;  3A8I E;  2Y0S B;  1SJE D;  2IHE A;  1V1Q A;  4DKA C;  2RF4 A;  1I94 Q;  3DWA A;  1LLR D;  4YIJ A;  5IYC G;  1TWC B;  5A2Q L;  1PYS B;  3K7A H;  4KJN A;  1IBM L;  2YTV A;  2JA8 H;  4JOI A;  1IL2 A;  4A3C G;  2BCO A;  4RWS C;  4G4K A;  1PH1 A;  2KED A;  1PH5 A;  4DR1 L;  1JOK A;  3H09 A;  1R4P B;  4DV4 L;  5KYI A;  3NTI A;  1HNW Q;  1B70 B;  3RLF A;  1CI3 M;  5BR8 L;  2ALY B;  3CHB D;  4K14 A;  1SSO A;  4OXP A;  4AIM A;  1FJG L;  3DEO A;  3EN2 A;  3FKI G;  1VQ6 A;  1QNU A;  5DAU A;  4BY7 G;  3OTO Q;  4XT3 B;  1Y8N B;  1Z9F A;  1H9K A;  1UUP A;  1JWM D;  5CV7 A;  3G4S A;  1RL2 A;  3K7U C;  1I4X A;  1SE8 A;  5C4X B;  4NXM Q;  3MC0 B;  4DAY B;  4KI0 A;  4WRD A;  1VQD A;  3HS0 C;  2KBN A;  3KJO A;  3S1M H;  1EYA A;  3NE5 B;  3I4M G;  2OWO A;  1EZ8 A;  1ILP A;  3FMC A;  2XVS A;  4LF7 Q;  1ET9 A;  3A0J A;  4UP8 A;  3L2P A;  3CC7 A;  1BCP D;  1VQ7 A;  3KUP A;  2NUC A;  4A3E G;  2QGQ A;  4UP9 A;  4DAP A;  4BBS H;  1JC7 A;  4RH6 A;  3S17 B;  4LFB Q;  3U9S A;  3E3X A;  2Q8I B;  3DM3 A;  3CCS A;  5BN3 A;  1C9O A;  4ODG A;  3CC4 A;  4A3L H;  5IY0 A;  2GN5 A;  3MAQ A;  2MHV A;  4OEM B;  1QB5 D;  4WOR A;  4KHP Q;  1SND A;  2CQO A;  1E1T A;  5IP7 G;  3KLR A;  3Q24 A;  2B2W A;  4C3I B;  1SDF A;  5IOD A;  1GHJ A;  1K73 C;  2OF1 A;  2NTT A;  3N52 A;  2YU9 B;  4HR7 B;  2R93 H;  1O7Y A;  1YVC A;  1MBY A;  1QJO A;  4X3K A;  4A75 A;  3I56 A;  2L9H A;  1JMC A;  4BXX G;  2WAC A;  1ROD A;  3CW2 C;  1LTA D;  2O2L D;  1HPC A;  3SXH A;  4FF3 A;  1U5K A;  2ZM6 Q;  3QIA A;  3OW7 A;  4RG1 A;  2JXM B;  4UAI A;  3IAY A;  4DV5 L;  3T1Y L;  2K28 A;  1F2L A;  2EE1 A;  3BDC A;  4LW1 A;  3JAM i;  4A93 H;  5ELB A;  3SVM A;  5AJ3 L;  4HIM A;  1F2M A;  4ZQ3 A;  5KEE A;  1TWF H;  3NSW A;  3FDT A;  4BY1 H;  1JOO A;  1ONL A;  3T1H L;  4KTA A;  1YIJ A;  4JOI C;  5JEA G;  1S5E D;  3DWQ A;  2QA4 A;  1A0I A;  4K6L A;  4QMG A;  3HOV G;  4YHH Q;  5ELN A;  4DV5 Q;  2PQE A;  3C1F A;  1XMQ Q;  1H9R A;  4JVZ A;  2NB0 A;  1X55 A;  3DXJ C;  3HOW H;  4V19 0;  3TBI B;  1X32 A;  2CHB D;  1EY4 A;  4O2D A;  4CDC C;  5EKI A;  4A4I A;  2B8G A;  2OQK A;  3X3M A;  1BQQ T;  1B3Q A;  3E0J A;  1E1O A;  1VQL A;  4MNO A;  4ABN A;  4EQO A;  4IFD G;  4A3K H;  4DK6 C;  3NTH A;  1FNV A;  2F0S A;  4CDE C;  4R8I A;  1YNN C;  3VA7 A;  1ET6 A;  1CM9 A;  3T4A C;  2VL6 A;  1VQJ A;  1HA5 A;  3CME A;  1HH2 P;  1QVC A;  3MXN A;  4NKL A;  5M5W B;  2E76 C;  4DAM A;  3GTJ B;  2G9H D;  4FF1 A;  4IZ8 A;  2EJM A;  3HOX B;  1SYE A;  2VUM B;  1HNX Q;  1HFN A;  2P5Z X;  5NUC A;  1CZG A;  3IFT A;  3J80 L;  5JJL A;  5ISR A;  4DK1 A;  4YCV A;  2F03 A;  1EOT A;  1I4Q A;  1IW7 C;  5KYL A;  3SK4 A;  3QJY A;  2QIL A;  1J5E L;  1BNZ A;  2AQ1 B;  1Q8K A;  4CGY B;  4DK3 C;  3H3V I;  2M9V A;  4IJL A;  3HOZ H;  4C3I G;  4A3J H;  2Q2I A;  5ELC A;  3HG9 A;  2A74 C;  3A74 A;  1G29 1;  4FXG C;  1Y1W B;  1QWY A;  1E24 A;  2G5D A;  5C5M A;  1I4H A;  3SEB A;  4EX5 A;  4LF8 L;  3MA2 B;  1HUN A;  1SNP A;  2RCF A;  3S9W A;  1DZ1 A;  3NHH A;  4DV4 Q;  1DJR D;  3W5O A;  3TP5 A;  2OXP A;  5EGT A;  3H15 A;  3BJU A;  2ASB A;  3F2D A;  2F3V A;  3RR5 A;  1JJ2 A;  2EY1 A;  5C3X A;  2PZW A;  1LAB A;  4H0L C;  5LHY 1;  2CVR A;  2UXC L;  3U50 C;  2KOL A;  1C8C A;  1W6J A;  3CC2 A;  3S16 B;  2R7Z B;  2N88 A;  3I4O A;  4TQU S;  1CA5 A;  1ESF A;  4JV5 L;  2A69 C;  2ES2 A;  4XYO A;  3TEH B;  3MFG A;  4KHP L;  3AFP A;  1BBU A;  1ZYR C;  2QEJ C;  3P75 A;  3HKZ B;  1OO9 B;  4C3J H;  4LFA L;  3KBG A;  3K5N A;  4C2M H;  4LF6 Q;  1JE5 A;  2X6G A;  3D3R A;  2Z0S A;  1STG A;  1V1P B;  2KEN A;  4DPG A;  1TWC H;  5K36 G;  3TP8 A;  5I2X A;  5CR3 A;  2HDM A;  1Y1V B;  5KGU A;  2WIN B;  1NTG A;  5KND A;  3VYS A;  2E2D C;  1LO5 D;  1V8Q A;  4KK7 A;  3AMU A;  5EPJ A;  2EYP A;  1X56 A;  1Q7Y C;  1SMY D;  5AFW A;  4A3M G;  1I6H H;  2WB1 B;  3ZJY C;  3P20 A;  3GP7 A;  3AQQ A;  2C5C A;  1EEF D;  1HR0 L;  1TWF B;  1PH4 A;  3L9A X;  3GTP H;  3DM1 A;  4ZUJ A;  4C3J B;  1SYC A;  3KYH C;  3J81 E;  1MJC A;  1IBL L;  3PO3 H;  3GTM H;  5G3L D;  2B63 B;  1K83 H;  4FXD A;  2K03 A;  1YEZ A;  3TS0 A;  1FJG Q;  3D4R A;  1PRT F;  2Y0S E;  4X6A H;  4YCU A;  4HTH A;  2ENB A;  5C5L A;  1QIL A;  3BZD B;  3LGJ A;  5C0X J;  4NDX A;  1PXU A;  3TME A;  3RZD H;  1BXT A;  3OIQ A;  4DV3 L;  4CJ0 B;  3SHL A;  1WTO A;  4JC0 A;  3G6J B;  1T9H A;  3I4N G;  1BUV T;  1IBM Q;  5C4J B;  2EQS A;  3ULL A;  5JJK A;  3ND9 A;  2JP1 A;  4DUY Q;  2JK8 A;  3SK5 A;  3TP6 A;  4TKO B;  1PYB A;  3CQZ B;  4HMI A;  1O7L A;  2B2Y A;  1A8V A;  3NPP A;  4IUP A;  1MSH A;  3WOF A;  4A76 A;  3HEJ A;  3HOU B;  3C1E A;  5EBC A;  5BR8 Q;  1TS5 A;  4P71 A;  4IOA A;  4GNX C;  2OTL A;  5JEA J;  1PH6 A;  1WTR A;  4LF9 Q;  3WDN A;  2EXZ A;  5CBE E;  2PW5 A;  2K50 A;  3BZK A;  4L5Q A;  1ASY A;  4GNX A;  2WAQ B;  2F0Q A;  2RDH A;  4BXX H;  2R92 G;  3S24 A;  5FLX L;  5K5P A;  4CKE A;  1FL0 A;  2KCT A;  3F2B A;  3SK6 A;  4GKK L;  5FJ8 H;  1Q1B A;  4J6H A;  4LJZ C;  2BE5 D;  3Q0A A;  1T5X D;  3GTQ H;  3PO2 B;  1PTO D;  2L12 A;  3U4Z A;  1QVG A;  5C4Z A;  3B6Y A;  4L63 B;  1Q8I A;  1PHJ A;  4FF4 A;  4A3B H;  5FO7 B;  4OO1 G;  2B63 H;  3BZC A;  4L5T A;  4B3M L;  3MVV A;  2EXD A;  2B2T C;  2SNS A;  2AQ3 B;  2ZXP A;  4ALP A;  1LT5 D;  2Z4H A;  3BG3 A;  4MTN A;  1WTX A;  2MGS A;  3SDZ A;  1KNE A;  3I3C A;  5IGD A;  5A2Q E;  4HIK A;  4DNR B;  4PQX A;  2EDG A;  4RGO S;  2AQ2 B;  3GV3 A;  3MXN B;  3HRZ C;  2Z4I A;  4G7Z C;  1JOQ A;  1KLG D;  3HOZ B;  4P2C B;  3PO2 H;  5C4X G;  4LAA A;  3M4O B;  3OMC A;  4JYA L;  1XNQ Q;  5E1F A;  2LXJ A;  1OTC A;  1VF5 C;  2QCP X;  4JI0 Q;  4U68 A;  1PTO F;  3TN2 A;  1WD0 A;  2PMZ E;  4QJF A;  2JA8 B;  4LMQ D;  1DOM A;  3NWS A;  4DV1 L;  4DV2 L;  1FGU A;  3GTL H;  2NVY H;  1HJP A;  4DUY L;  4A3G B;  3Q22 A;  4DV0 L;  4J1M A;  1PRT D;  3NK9 A;  3K5M A;  2HCI A;  3BDO A;  4XT1 B;  1B3A A;  3M4Q A;  2A73 B;  3RN2 A;  4ILW A;  2F0H A;  3AYH B;  1H9M A;  1E22 A;  2JA7 H;  1VMP A;  1W3S A;  4DV6 L;  1XJV A;  3EFX D;  4I65 A;  3HOY H;  3RZO H;  2RKS A;  5M5Y H;  3CKI B;  1L1O C;  1QG7 A;  4X65 L;  4B3T L;  2EYO A;  4BWG B;  1KDC A;  1EEI D;  4H02 A;  5LMU L;  4A93 B;  1G91 A;  2QW7 A;  4NB3 A;  5TSS A;  1I6H B;  2L55 A;  2ZJQ A;  3L7Z C;  1IHZ A;  1SEB D;  1BDO A;  5M3F B;  5FLM H;  1VQ4 A;  4KY5 A;  1M90 C;  1IKL A;  1Y14 B;  3OSO A;  4RAU C;  4RHS A;  4J15 A;  4R4I A;  5HUR A;  4PMB A;  4A3B B;  1MSG A;  4A3I G;  4ULL A;  1IYU A;  2O4X A;  3MFY A;  2RBM A;  3TDQ A;  5IIF A;  3RN5 A;  1IW7 D;  2ICE C;  2QEX A;  1ENF A;  4L5R C;  3NEL A;  3E5S A;  4RGT A;  1EYC A;  4DF7 A;  2B2W C;  4X62 Q;  1QZH A;  1NSN S;  3URY A;  2RHS B;  2KJX A;  4Q0F A;  1G2S A;  3RNU A;  4JYA Q;  4NP5 A;  2LSS A;  4PV1 C;  4X64 L;  3LWU A;  1S40 A;  3VYT A;  2R7Z H;  4IUU A;  1BOS A;  3M85 A;  4L5S A;  3KF8 A;  3PIP 3;  1HUM A;  2HCC A;  1PH3 A;  1HTP A;  1I4G A;  3U9O A;  2OCE A;  3K8A A;  3NQI A;  1CA6 A;  2XRS D;  1PV4 A;  1LUZ A;  2K5W A;  2JA9 A;  2EZV A;  5C44 H;  5D65 A;  4HJ8 A;  2K6A A;  2E2H H;  4KD3 A;  3H0G B;  1RHP A;  3PGZ A;  5D3I B;  1RJT A;  1HHV A;  1SE4 A;  3KBX A;  3ICE A;  1E2W A;  3J80 E;  2JA6 B;  2PNR C;  3TP7 A;  4KKS A;  4IN3 A;  5EBD A;  2VUM H;  4R4C A;  3TRE A;  4JI7 Q;  3BVZ A;  1E2V A;  1N8R C;  2F0E A;  4LF9 L;  2D62 A;  2JA5 H;  3MXU A;  5IP9 G;  2DN8 A;  3EQL C;  2RCN A;  1Q86 C;  5COR A;  5GQO A;  1S4Z A;  1NNX A;  1SE3 A;  1WD1 A;  1II3 A;  4GKK Q;  1AH9 A;  4V0B A;  3SK8 A;  5C3E H;  3G7L A;  2H1E A;  2Z9H A;  1NR4 A;  3S1Q B;  4BBR G;  4F88 A;  3S1N H;  1H9J A;  1VS0 A;  1KDA A;  4GLX A;  3T56 B;  4IUN A;  1A2T A;  3MXG A;  3ER0 A;  1UE7 A;  3M3Y B;  2R3Z A;  4IFD J;  3NUC A;  1XWE A;  2EY6 A;  4LF4 Q;  1HRJ A;  4E6I A;  4K8J A;  1L1O B;  1B9N A;  3F1Z A;  1G51 A;  3F8T A;  4M1U B;  2R61 A;  2B2V A;  3OWE B;  1F77 A;  4RGM A;  5C3E B;  2CW0 D;  3CF5 A;  5KNC A;  2YV5 A;  4UY8 C;  5EAY A;  2R93 B;  1E2Z A;  2I46 A;  3VA5 A;  2VQF L;  3WOE A;  4K2L A;  4C1N I;  3FPP A;  4GS3 A;  5H1S E;  4PZ6 A;  5CMD A;  4QIW E;  1OXT A;  4XDX A;  5IE8 A;  5EPK A;  3C3L A;  1XTD A;  1G6Z A;  1WJJ A;  4B3R L;  2BH8 A;  1BCP B;  4JBJ A;  4B9W A;  4AQY Q;  3NP8 A;  2I0Q A;  4BBS B;  4DA2 A;  5F2D A;  3NBH B;  3RZO B;  3V05 A;  2IL8 A;  5J39 A;  3CCL A;  4YHH L;  2IX1 A;  4K8I A;  4C3H H;  4JI8 Q;  3J81 c;  1NMF A;  5EKL A;  1YZ6 A;  2O5I C;  4BY7 H;  2KCM A;  3GTP B;  4X3T A;  3T1H Q;  3R2I A;  1RKN A;  2K1B A;  3UI2 A;  3I90 A;  1TWA H;  1DOK A;  2RDG A;  3HOW G;  4CDF C;  3CAM A;  4F87 A;  1TII D;  3TSS A;  5M3M H;  3S17 H;  1TXY A;  5DM6 3;  1KRT A;  2EY2 A;  3HOY B;  1AEX A;  3A55 A;  2JE6 I;  2EPB A;  2MO1 A;  2PPB C;  1KC8 C;  1TS3 A;  4I7A A;  1EYG A;  1EU3 A;  4NXN Q;  3G6E A;  4LF8 Q;  1WTV A;  4DK0 A;  1JIC A;  1UNS A;  1VQG A;  1NUC A;  2EOT A;  3QOJ A;  3PV0 A;  1HFG A;  1AE3 A;  1QZG A;  2F3I A;  2RSO A;  1XNR L;  4C3H B;  5IYC H;  3VR4 A;  4K2K A;  5JVG 3;  1J5E Q;  3HOU H;  1UAP A;  5J1Z A;  1VQE A;  2YTY A;  5C4H A;  5C0X I;  4QY7 A;  1IYV A;  3HP3 A;  3I7F A;  1AZQ A;  1OXX K;  2UUB L;  3K57 A;  3EVQ A;  3K5O A;  2NVY B;  3M7G A;  4UHV A;  4PG3 A;  3K81 C;  4B3S Q;  1HNX L;  4QB4 A;  1WFQ A;  4DR4 L;  2A6H C;  3C2P A;  2RSN A;  4X66 L;  3S15 H;  4QL5 A;  5LMN Q;  3J80 i;  4IPC A;  1AP0 A;  3J80 c;  1GUT A;  1RF2 D;  1L0Y B;  3E9H A;  4FNF A;  2JA5 B;  2Q2H A;  1N33 Q;  5DLQ E;  4TRD A;  3CU7 A;  5D14 A;  1BVS A;  3A7L A;  2E2H B;  4BY1 G;  1B2T A;  3CP0 A;  2J4X A;  5ELF A;  1YHA A;  2KA7 A;  3H3V H;  1EY5 A;  2JQO A;  5FLX c;  2WAQ G;  3FP9 A;  3J7A F;  3J81 i;  1L2F A;  3I91 A;  2FXQ A;  3KLS A;  5GAE C;  1HTL D;  1U0L A;  3J7Z C;  2Z6K C;  3K7A B;  2VNU D;  2D2C C;  3GD7 A;  3KF6 B;  4QCL A;  1X9N A;  5M3M G;  1DD2 A;  4O42 A;  2DUD A;  2GA4 B;  2F0K A;  3OW2 A;  2UUB Q;  3MTS A;  2BH2 A;  3HKZ E;  3NBI A;  5IYD G;  2IX0 A;  3ZYY X;  4C1N K;  4A3K G;  4LNQ A;  3BU2 A;  3S1Q H;  1FNU A;  4ZUI A;  1STH A;  4AYB B;  2PNH A;  1RIP A;  4DFA A;  5LL6 S;  2ZXO A;  4KMU C;  1FYC A;  3FPU B;  5JAV A;  1G8Z D;  2RDF A;  3PUW A;  1TWA B;  1M1K C;  2K5V A;  1U4L A;  5GAD C;  4OWW B;  4QF4 A;  1UEA B;  3GTL B;  2B29 A;  3S1M B;  4RFB A;  1XNR Q;  5DEH A;  1JR0 D;  2EYL A;  5G3L F;  3X3N A;  3K0Y A;  1X54 A;  5E4W C;  3AU7 A;  2A6E D;  3F2U A;  4HED A;  5JVH 3;  4DUZ Q;  4TVA B;  2JA7 B;  3GTG H;  1SYD A;  1K8A C;  3NQT A;  1BCP C;  4JI6 L;  1AZP A;  4OHJ A;  1SJH D;  4LUV A;  4YY3 L;  3D6W A;  3OOC A;  4LF6 L;  1D5X C;  1XMQ L;  3D31 A;  3L0O A;  4C3I H;  4A3J G;  1AN8 A;  4MTK A;  4KJO A;  4BBR B;  1STE A;  1PH8 A;  3ERO A;  2N78 A;  5CV5 A;  1N34 L;  1S5D D;  4C2M B;  1D2B A;  1IBK L;  2SOB A;  1RTN A;  3NXW A;  5AJ3 Q;  4S3S A;  4ME5 A;  4DUZ L;  1WYD A;  4IFD H;  2Z1C A;  4NXN L;  2D5D A;  1S5F D;  2XWB B;  1GUS A;  3T1Y Q;  1LT3 D;  2ZTD A;  3A56 A;  2NZO A;  5CYU A;  1STN A;  3P7J A;  4A3G H;  4RMF A;  2D0P A;  2YTX A;  1QCB D;  4NXM L;  1EQT A;  4JI3 L;  3BS1 A;  4OX9 L;  1VQC A;  4HID A;  2VQF Q;  1CKN A;  1YNJ C;  1TT2 A;  1PA6 A;  1GHK A;  3TZD A;  1XMO Q;  2IPK D;  1ENC A;  4JG2 A;  4DR6 Q;  4G57 A;  2IW3 A;  1K3B C;  2E5L Q;  4CJ1 B;  2UUA Q;  4LFC L;  4R4O A;  4HJA A;  4UPA A;  4XTC S;  2AWO A;  3DLL A;  2XWJ B;  3TS2 A;  1UE6 A;  1EY9 A;  1STB A;  3H0G H;  3QOL A;  1XTC D;  1A6X A;  1VQ9 A;  4EQN A;  1HZ9 A;  4ZKC B;  2Z6K A;  4FVM A;  3EIV A;  5M9O A;  2K01 A;  1FNW A;  1TS4 A;  2WFW A;  5K36 H;  4DNT B;  1JJG A;  5IGG A;  1M8A A;  1DXM A;  1SXT A;  3GTQ B;  3PUX A;  4B3R Q;  3K0X A;  3GO5 A;  1I6V C;  1LM0 A;  4CJ2 C;  3MZ5 A;  1ILQ A;  3CCV A;  4KHV A;  1BF4 A;  4LF7 L;  2R6G A;  1EYD A;  1GXD C;  2D9U A;  4KN4 C;  2EIF A;  2B3G A;  2I07 B;  1HNW L;  1SYF A;  3UDI A;  4A3M H;  2BA1 A;  1YHQ A;  3HKS A;  4K5W A;  5JPM C;  4A3B G;  4JI1 L;  1I3Q B;  1VQ5 A;  2F0N A;  2LKV A;  2RVL A;  1AE2 A;  1K9M C;  2PZU A;  2NVX H;  2KUM A;  3CXC A;  1VQF A;  1I94 L;  1EZ6 A;  2I5M X;  3OTO L;  1E7Z A;  4MHE A;  3LNN A;  4WJ3 M;  3H6M A;  1A3U A;  4JBM A;  3K6O A;  3PF4 A;  2FHT A;  4JPB W;  4ME3 A;  1RD9 D;  1XPU A;  2JEB I;  4LF4 L;  1Q1E A;  4B9X A;  1NMG A;  4Q5V A;  4RCO A;  3I4N H;  3LWE A;  1PZI D;  2OT2 A;  2K05 A;  1VMC A;  4EGV A;  4RKB A;  1K8G A;  3A8K E;  5L37 A;  1J9O A;  3AFQ A;  5IWA L;  1O7I A;  1KXL A;  1BKB A;  3TRZ A;  4IJH A;  3KLW A;  1QVF A;  3D8G A;  4A3F G;  2MJ8 A;  2HQE A;  1K83 B;  1J6Q A;  2VQE L;  5KRU A;  2KEC A;  1CHP D;  1FD7 D;  1ICW A;  1UE5 A;  2ID0 A;  1GUN A;  2LY7 A;  4KHZ A;  1B53 A;  5IGC A;  1KLU D;  2UU9 Q;  1Q12 A;  4J8Q A;  1N32 L;  1F9R A;  1O78 A;  1TQO A;  3QR8 A;  5EKK A;  3S2D B;  4IUT A;  2XN9 C;  3L3O C;  4F7X A;  3M4P A;  4JI7 L;  1OXS C;  2NTS A;  3M3Y H;  1LT4 D;  1TVX A;  1SNC A;  5ELO A;  5C6A A;  2EJF C;  1MKH A;  1EIF A;  4X62 L;  3DMU A;  1WCM H;  4LWC A;  4JW0 A;  3S1N B;  1V1O A;  4YCW A;  3GTO H;  3JAM c;  2PYK A;  5CV8 A;  1A62 A;  2Z8L A;  1UWV A;  5JJI A;  2AUK A;  3CPW A;  1VQH A;  1CQF A;  2BDO A;  1DM0 B;  4HCE A;  1Y8P B;  2F0T A;  1STA A;  2AUJ D;  1E3P A;  5EQ0 A;  1PRT C;  3VR2 A;  2PZT A;  4HSP A;  1SNO A;  2MPM A;  1EUJ A;  2CWP A;  2A68 C;  1CTM A;  3STB D;  2EYF A;  1Y1V H;  4MN3 A;  5JPN C;  4EVO A;  3AB9 A;  1VQI A;  2K52 A;  5IYB G;  2Q2U A;  1GKH A;  1YNN D;  1HXY D;  5EPL A;  3T16 A;  4POG A;  3U58 A;  4GN4 B;  4OGQ C;  1PH9 A;  1XNQ L;  2VB3 X;  2NVT B;  1F2Y A;  1Q46 A;  2ATW A;  2UXB L;  5FOB B;  2F0F A;  2PCF B;  3UE0 A;  4A3E H;  2ZTC A;  2A6H D;  3GDE A;  2PI2 E;  1EL0 A;  1TY0 A;  1GJX A;  3NBH A;  4OWX B;  3QG1 A;  1PTO H;  3SGI A;  4C56 C;  5D3D A;  1HZB A;  1WTQ A;  4BA2 I;  4A3F H;  3GQB A;  3CCR A;  1P8L A;  3KOJ A;  1WTH A;  1KAA A;  2IHF A;  5C0X G;  1R9T H;  1PTO C;  1TU2 B;  4XIG S;  4JI4 L;  4DR7 L;  3MEF A;  2E74 C;  3J81 j;  3EA6 A;  1WTP A;  2AHO B;  5CV6 A;  4X3U A;  3WWV A;  2UXD Q;  1F9P A;  1KDB A;  3VDY A;  2SDF A;  1B50 A;  4DNI A;  3HOY G;  1GUW A;  2KHI A;  5C3E G;  1EQR A;  3VR3 A;  4YWM A;  3J81 L;  2Q8T A;  1GVP A;  2UU9 L;  1PFM A;  1Z6H A;  1VQO A;  2MQH A;  1VQ8 A;  4R1J A;  5I9P A;  3I4M H;  3TQY A;  2V1C C;  5M3F G;  4XYQ A;  1EIG A;  4P72 A;  1X3G A;  2K5Q A;  3HOX G;  1YHB A;  1KD1 C;  4A93 G;  4A3D H;  2H4O A;  4L8J A;  1FR3 A;  1DGS A;  5COY A;  1JT8 A;  4P73 A;  1NR2 A;  3I2Z A;  3D0F A;  1B1Z A;  1L0X B;  5GRO A;  1UE1 A;  3RUZ A;  1CT1 D;  5IP7 H;  2LMC B;  2WV6 D;  1Y1V G;  2DGY A;  5M5Y B;  2VXW A;  1NBW A;  4JI4 Q;  2V4D A;  2NN6 G;  4A3G G;  5ELE A;  1MJE A;  2HHH L;  3S15 B;  2PO4 A;  2OEO A;  2F0J A;  3TZU A;  1EY8 A;  2WKD A;  3I70 A;  1PDQ A;  3V96 A;  3S16 H;  2J7Z A;  4HJ9 A;  2M00 A;  5EJW A;  3CQZ H;  1K0S A;  3OPO A;  5T1I A;  3H3V C;  4NMZ A;  1S3O A;  2F0M A;  1JB3 A;  3VYR A;  1OXU A;  1Q3L A;  4DV7 Q;  4CHT B;  2IY5 B;  1KRS A;  3PQI A;  1RTO A;  2B2T A;  4X65 Q;  3EJI A;  2E2I H;  1F9S A;  2F0P A;  2K14 A;  4HSV A;  4PZ7 A;  2WKC A;  4IPH A;  3I4L A;  5J3B A;  1HA6 A;  3PO3 G;  2K04 A;  2AMC B;  4DAV A;  1EY6 A;  4A3C H;  2NZ1 D;  1SMX A;  3I72 A;  3G71 A;  3ULJ A;  5IOC A;  2F0I A;  4GN5 A;  1K3R A;  1YI2 A;  3MEH A;  4DR5 Q;  3FHW A;  3CRL C;  1IL8 A;  5E7N A;  4JI1 Q;  1K0R A;  1EQV A;  1D5Z C;  2NWG A;  4BBR H;  2E5L L;  2ZT9 C;  2UUA L;  3R8B A;  4PZ8 A;  3FKI H;  5M3F H;  3DUZ A;  4DV6 Q;  2WII B;  1KIX A;  2HIV A;  3PMF A;  2R92 B;  4BS9 A;  5IGE A;  5KNB A;  4A3D G;  4Y7N B;  1W6K A;  2NN6 I;  2DJG C;  3CRK C;  1V43 A;  1D7Q A;  2A6E C;  4DR3 L;  1GM5 A;  2LS0 1;  3N6R A;  2R7D A;  4KD4 A;  5IYD H;  2MP1 A;  1SYG A;  1TWG H;  4GOP C;  1QUQ B;  4ID6 A;  2AWN A;  4DR6 L;  3ULP A;  1IBK Q;  4BBS G;  4LUO A;  1FGB D;  3LX0 A;  2NZH A;  1T5E A;  3OMG A;  1XMO L;  2A8V A;  2OTJ A;  4DGZ A;  2Q8R E;  1KHI A;  2F0L A;  2GVA A;  3CCE A;  4QGU A;  4CKC A;  1A15 A;  4A3L G;  4FXK C;  2R92 H;  3S2H H;  4M8A A; 
#chains in the Genus database with same CATH homology
 1F9Q A;  4N9T A;  3T51 B;  4JBW A;  1PFN A;  1BBX C;  1CFM A;  1SBB B;  2A5H A;  4KKU A;  1Y8O B;  1TKW B;  2JYO A;  1EWH A;  4K6D A;  2EJG C;  1SNQ A;  1STY A;  4A3I B;  1D6E C;  2JEA I;  3K59 A;  4DU9 A;  5FK9 C;  1K8M A;  1SNM A;  4RKL A;  1CK1 A;  2FMM A;  2VB2 X;  1LAC A;  1D1I A;  1XYI A;  2E75 C;  4FP5 D;  3PUV A;  4ZYS A;  1ENA A;  1WVL A;  3MHB A;  2PW7 A;  4QUF A;  3ERQ A;  4CKB A;  4XQJ A;  2TSS A;  3J7A V;  3R93 A;  1PYW D;  3JAM L;  1I4P A;  4CBV A;  2EY5 A;  1ZEQ X;  3J7Y W;  2ICI A;  3GTK B;  5FKA C;  1G2T A;  4O1N A;  4ZRZ A;  1LTS D;  1M4V A;  1BR9 A;  2XSC A;  4KV6 A;  1S5C D;  2DY7 A;  3A8J E;  5IGB A;  5JOB A;  1KAB A;  3SE0 A;  3JAM E;  3ONA B;  3H94 A;  5CGK A;  2IX3 A;  5C0X H;  4C3H G;  3V2T A;  4G7H C;  2X69 A;  1GUO A;  5I4D A;  1PLF A;  1I50 B;  4DXF A;  1TWG B;  1XXG A;  4NW2 A;  2FIN B;  5I2Y A;  3MWY W;  3E6Z X;  2NVQ B;  3I4N B;  1SYB A;  3S1R B;  4FF2 A;  3BYT B;  2BE5 C;  3OIP A;  4BY7 B;  1SAP A;  5BN5 A;  4MIU A;  1TWH B;  2X6L A;  4R9W A;  5FO8 B;  4PMC A;  5I9O A;  1PTO B;  5M3M B;  4OO1 I;  1X3P A;  3GTG B;  3QB3 A;  2F0U A;  3T53 B;  4A3M B;  1O80 A;  4UDU C;  2YYZ A;  3FEW X;  4HAE A;  2KEE A;  4BY1 B;  1KNA A;  1MD2 D;  1OXV A;  2DNC A;  2F0W A;  2LFN A;  2M2L A;  3KK7 A;  5J22 A;  1Y69 U;  3P1H A;  2A68 D;  2WP8 J;  3D4D A;  1VCI A;  2KCC A;  2CW0 C;  3QO2 A;  1CHQ D;  1BO0 A;  2TMP A;  3C46 A;  2BDN A;  3T13 A;  1WTW A;  2IT1 A;  5E3F A;  1QOH A;  5HGT A;  1O7Z A;  3IL8 A;  2J0T D;  2BA0 A;  2RQX A;  4OIJ A;  4GZY C;  2ZXR A;  5JJZ A;  2EYH A;  1D1K A;  2DY8 A;  2KQ3 A;  2L1B A;  1VF7 A;  5JEA H;  4JK1 C;  1I4R A;  1EIH A;  4DAY A;  1Z7T A;  1PRT B;  1JOR A;  3Q23 A;  5DM7 3;  1TR5 A;  2PMZ B;  2XRQ D;  4IUR A;  3HOW B;  1Z47 A;  2L5T A;  3BVM A;  2KHS A;  3M4Y A;  4DXG A;  4Z9C B;  2B2U C;  4A3J B;  3M7N A;  1HQR D;  4RCN A;  5LL6 X;  1XX8 A;  2EVB A;  3K5L A;  1GUG A;  2FFK B;  1ZYR D;  1KTK A;  3SR1 A;  3PIO 3;  3GV6 A;  4RGN A;  1SE2 A;  1H9S B;  3R3O A;  2E2I B;  1DON A;  1A2U A;  2JSO A;  5CBA E;  1S5B D;  2F0V A;  2CQA A;  3BVG A;  4H7B A;  3ITP A;  1PFB A;  2B2U A;  3FRP B;  3HZX A;  1LV9 A;  2NYZ D;  4R8N A;  4OIK A;  3OHX C;  3OWF A;  1R4Q B;  3FKI B;  2NBF A;  5IT9 E;  2KVM A;  5E4X A;  5CV4 A;  1LTR D;  2A69 D;  1ZXT A;  4HMJ A;  4ZK9 B;  2SEB D;  2B2V C;  4IUQ A;  2L11 A;  3DWP A;  2MUY A;  4WFN 3;  1GOZ A;  3W3A A;  5CC4 A;  5C44 B;  1MI2 A;  3A7A B;  3NTK A;  4ZAI A;  4XXE A;  1RCV D;  3VR6 A;  1DCZ A;  5I6W A;  1LTI D;  1NCV A;  2B39 A;  3A54 A;  5KIX A;  4RHR A;  2QKI C;  4I7Z C;  1DYQ A;  5I6Y A;  5DNF A;  3O13 A;  4IQZ A;  3IKJ A;  3HOV B;  4A3E B;  1JQY D;  2N55 A;  2F0G A;  1HQM C;  2B2Y C;  1K8O A;  1CZW A;  1IKM A;  2SNM A;  4QUC A;  4IAL A;  1HCZ A;  2F0O A;  4A3F B;  4IFD I;  1QNK A;  2XIW A;  3Q6S A;  5ELD A;  1RDP D;  1U4M A;  2G9D A;  5BN4 A;  2RA4 A;  4ZKB B;  1QE6 A;  3FVQ A;  3GTO B;  4K5V A;  2HDL A;  4XQQ A;  4L6T B;  4IUV A;  3QWN A;  2KCN A;  4FO2 A;  1E0B A;  1B9M A;  2XNA C;  5M5X B;  3I73 A;  3PUZ A;  3H91 A;  1EU4 A;  4KKT A;  2K32 A;  4PMW A;  5FO9 B;  1EY0 A;  2C9O A;  1AFP A;  1U4R A;  1VDZ A;  1DOL A;  1JWU D;  1BCP F;  1YNJ D;  1A3T A;  2EYM A;  2QF7 A;  3W2D A;  2FMC A;  1V1P A;  4B08 A;  1PZK D;  1MGS A;  1CQV A;  2IJ0 A;  1EWC A;  4H44 C;  2IWH A;  2EYJ A;  3DEP A;  4QIW B;  2FJ2 A;  4XQN A;  2B8F A;  3MXP A;  1AW7 A;  1J8I A;  5IT9 L;  4BA1 I;  1JE4 A;  5CV9 A;  1TS2 A;  4X3S A;  2L4N A;  1PZJ D;  3PUY A;  1SFO B;  1LTG D;  1PMR A;  1H9S A;  1B4O A;  1LTT D;  2BOS A;  1WCM B;  4U67 3;  3GTM B;  2NN6 H;  5T1G A;  1X3Q A;  1TY2 A;  1EFI D;  4HN7 A;  3VYU A;  4LK1 C;  1NAP A;  1B44 D;  3KLS X;  1F2Z A;  4A3D B;  3RZD B;  3K58 A;  3IFD A;  2E2J B;  2K5D A;  4KY7 A;  4KY6 A;  4WJW A;  3BDL A;  3S14 B;  4KN7 C;  1LT6 D;  3R2T A;  3ND8 A;  3D4W A;  4ZLT F;  2HUG A;  5A35 A;  4G7O C;  1U4P A;  4TSS A;  1C4Q A;  3HGB A;  4FYD A;  4EQP A;  3VR5 A;  1C48 A;  1JCK B;  1EY7 A;  1ESR A;  1ZKO A;  3PO3 B;  4F8M A;  4RA8 A;  3RD4 A;  4OO1 H;  5IGF A;  2F0D A;  5C3W A;  1U9R A;  1R9T B;  1SMY C;  3I4M B;  2DNE A;  3S2H B;  2NVX B;  1LTB D;  4H13 C;  2O5J C;  3NWT A;  4N9P A;  2K7V A;  5FLX E;  3DHQ A;  2F4I A;  3D6C A;  4A3K B;  1A3V A;  2L0C A;  3BYY B;  1JWS D;  4DN4 M;  2F1M A;  2K33 A;  4K5X A;  2QDB A;  4OL7 A;  4PNY A;  1Q90 A;  4C3J G;  3I8Z A;  1ML0 D;  4HCS A;  2F3W A;  1D5M C;  3RMH A;  3A8I E;  2Y0S B;  1SJE D;  3DWA A;  1LLR D;  4YIJ A;  1TWC B;  5A2Q L;  4KJN A;  2BCO A;  4RWS C;  4G4K A;  2KED A;  1JOK A;  3H09 A;  1R4P B;  5KYI A;  3NTI A;  3RLF A;  1CI3 M;  3CHB D;  4K14 A;  1SSO A;  3DEO A;  1QNU A;  5DAU A;  4XT3 B;  1Y8N B;  1H9K A;  1UUP A;  1JWM D;  5CV7 A;  1I4X A;  5C4X B;  3MC0 B;  4KI0 A;  4WRD A;  3HS0 C;  1EYA A;  3NE5 B;  1EZ8 A;  1ILP A;  3FMC A;  2XVS A;  1ET9 A;  1BCP D;  3KUP A;  2NUC A;  4DAP A;  1JC7 A;  4RH6 A;  3S17 B;  3U9S A;  2Q8I B;  5BN3 A;  4ODG A;  3MAQ A;  2MHV A;  1QB5 D;  4WOR A;  1SND A;  3KLR A;  3Q24 A;  2B2W A;  4C3I B;  1SDF A;  5IOD A;  1GHJ A;  2OF1 A;  2NTT A;  3N52 A;  2YU9 B;  4HR7 B;  1O7Y A;  1MBY A;  1QJO A;  4X3K A;  2L9H A;  2WAC A;  1ROD A;  1LTA D;  2O2L D;  1HPC A;  3SXH A;  4FF3 A;  3QIA A;  3OW7 A;  2JXM B;  4UAI A;  3IAY A;  2K28 A;  1F2L A;  2EE1 A;  3BDC A;  5ELB A;  3SVM A;  1F2M A;  4ZQ3 A;  5KEE A;  3NSW A;  3FDT A;  1JOO A;  1ONL A;  4KTA A;  5JEA G;  1S5E D;  3DWQ A;  4K6L A;  4QMG A;  2PQE A;  3C1F A;  1H9R A;  2NB0 A;  3DXJ C;  4V19 0;  3TBI B;  1X32 A;  2CHB D;  1EY4 A;  5EKI A;  2B8G A;  3X3M A;  1BQQ T;  3E0J A;  4EQO A;  4ABN A;  4IFD G;  3NTH A;  1FNV A;  2F0S A;  4R8I A;  1YNN C;  3VA7 A;  1ET6 A;  1CM9 A;  3T4A C;  1HA5 A;  3MXN A;  4NKL A;  5M5W B;  2E76 C;  3GTJ B;  2G9H D;  4FF1 A;  4IZ8 A;  2EJM A;  3HOX B;  1SYE A;  2VUM B;  1HFN A;  5NUC A;  1CZG A;  3IFT A;  3J80 L;  5ISR A;  4DK1 A;  2F03 A;  1EOT A;  1I4Q A;  1IW7 C;  5KYL A;  3SK4 A;  3QJY A;  2QIL A;  1BNZ A;  2AQ1 B;  4CGY B;  2M9V A;  4C3I G;  5ELC A;  3HG9 A;  2A74 C;  1G29 1;  4FXG C;  1Y1W B;  1QWY A;  5C5M A;  1I4H A;  3SEB A;  3MA2 B;  1HUN A;  1SNP A;  3S9W A;  1DZ1 A;  3NHH A;  1DJR D;  3TP5 A;  2OXP A;  5EGT A;  2F3V A;  2EY1 A;  5C3X A;  2PZW A;  1LAB A;  4H0L C;  5LHY 1;  2CVR A;  2KOL A;  1C8C A;  1W6J A;  3S16 B;  2R7Z B;  2N88 A;  4TQU S;  1CA5 A;  1ESF A;  2A69 C;  4XYO A;  3MFG A;  1ZYR C;  2QEJ C;  3P75 A;  3HKZ B;  1OO9 B;  3KBG A;  3K5N A;  2X6G A;  3D3R A;  1STG A;  1V1P B;  5K36 G;  3TP8 A;  5I2X A;  5CR3 A;  2HDM A;  1Y1V B;  5KGU A;  2WIN B;  5KND A;  3VYS A;  2E2D C;  1LO5 D;  1V8Q A;  4KK7 A;  3AMU A;  5EPJ A;  2EYP A;  1SMY D;  5AFW A;  2WB1 B;  3P20 A;  3GP7 A;  2C5C A;  1EEF D;  1TWF B;  3L9A X;  3DM1 A;  4ZUJ A;  4C3J B;  1SYC A;  3J81 E;  5G3L D;  2B63 B;  4FXD A;  2K03 A;  3D4R A;  1PRT F;  4HTH A;  2ENB A;  5C5L A;  1QIL A;  3BZD B;  5C0X J;  4NDX A;  1PXU A;  3TME A;  1BXT A;  3OIQ A;  4CJ0 B;  3SHL A;  1WTO A;  3G6J B;  1BUV T;  5C4J B;  3ND9 A;  2JP1 A;  3SK5 A;  3TP6 A;  4TKO B;  3CQZ B;  4HMI A;  1O7L A;  2B2Y A;  3NPP A;  4IUP A;  1MSH A;  3WOF A;  3HEJ A;  3HOU B;  3C1E A;  5EBC A;  1TS5 A;  5JEA J;  1WTR A;  3WDN A;  2EXZ A;  5CBE E;  2PW5 A;  2WAQ B;  2F0Q A;  2RDH A;  5FLX L;  5K5P A;  4CKE A;  3SK6 A;  1Q1B A;  4J6H A;  4LJZ C;  2BE5 D;  3Q0A A;  1T5X D;  3PO2 B;  1PTO D;  2L12 A;  5C4Z A;  4L63 B;  1Q8I A;  4FF4 A;  5FO7 B;  4OO1 G;  3MVV A;  2B2T C;  2SNS A;  2AQ3 B;  2ZXP A;  1LT5 D;  2Z4H A;  3BG3 A;  1WTX A;  2MGS A;  3SDZ A;  1KNE A;  3I3C A;  5IGD A;  5A2Q E;  4DNR B;  4PQX A;  2EDG A;  4RGO S;  2AQ2 B;  3GV3 A;  3HRZ C;  2Z4I A;  4G7Z C;  1JOQ A;  1KLG D;  3HOZ B;  4P2C B;  4LAA A;  3M4O B;  3OMC A;  5E1F A;  1VF5 C;  2QCP X;  4U68 A;  1PTO F;  3TN2 A;  1WD0 A;  2JA8 B;  4LMQ D;  1DOM A;  3NWS A;  4A3G B;  3Q22 A;  4J1M A;  1PRT D;  3NK9 A;  3K5M A;  2HCI A;  3BDO A;  4XT1 B;  1B3A A;  2A73 B;  4ILW A;  2F0H A;  1H9M A;  1VMP A;  3EFX D;  4I65 A;  2RKS A;  3CKI B;  1QG7 A;  2EYO A;  4BWG B;  1KDC A;  1EEI D;  4A93 B;  1G91 A;  5TSS A;  1I6H B;  2L55 A;  3L7Z C;  1IHZ A;  1SEB D;  1BDO A;  5M3F B;  4KY5 A;  1IKL A;  3OSO A;  4RAU C;  4RHS A;  5HUR A;  4PMB A;  4A3B B;  1MSG A;  4ULL A;  1IYU A;  2O4X A;  3MFY A;  2RBM A;  3TDQ A;  5IIF A;  1IW7 D;  2ICE C;  1ENF A;  3E5S A;  4RGT A;  1EYC A;  4DF7 A;  2B2W C;  1NSN S;  3URY A;  2KJX A;  4Q0F A;  1G2S A;  4NP5 A;  4PV1 C;  3LWU A;  3VYT A;  4IUU A;  1BOS A;  3M85 A;  3KF8 A;  3PIP 3;  1HUM A;  2HCC A;  1HTP A;  1I4G A;  3U9O A;  3NQI A;  1CA6 A;  2XRS D;  2K5W A;  2EZV A;  5D65 A;  2K6A A;  4KD3 A;  3H0G B;  1RHP A;  1HHV A;  5D3I B;  1RJT A;  1SE4 A;  3KBX A;  1E2W A;  3J80 E;  2JA6 B;  2PNR C;  3TP7 A;  4KKS A;  4IN3 A;  5EBD A;  3BVZ A;  1E2V A;  2F0E A;  2D62 A;  3MXU A;  2DN8 A;  3EQL C;  5COR A;  1S4Z A;  1SE3 A;  1WD1 A;  1II3 A;  4V0B A;  3SK8 A;  3G7L A;  2H1E A;  3S1Q B;  1NR4 A;  4F88 A;  1H9J A;  1KDA A;  3T56 B;  4IUN A;  1A2T A;  3MXG A;  3M3Y B;  2R3Z A;  4IFD J;  3NUC A;  1XWE A;  2EY6 A;  1HRJ A;  4E6I A;  4K8J A;  1B9N A;  4M1U B;  2R61 A;  2B2V A;  3OWE B;  1F77 A;  5C3E B;  4RGM A;  2CW0 D;  5KNC A;  2R93 B;  1E2Z A;  2I46 A;  3VA5 A;  3WOE A;  4K2L A;  4C1N I;  3FPP A;  5CMD A;  1OXT A;  4XDX A;  5EPK A;  3C3L A;  1G6Z A;  1BCP B;  4B9W A;  4BBS B;  3NP8 A;  4DA2 A;  5F2D A;  3RZO B;  3V05 A;  2IL8 A;  5J39 A;  2IX1 A;  4K8I A;  5EKL A;  2O5I C;  3GTP B;  4X3T A;  3R2I A;  1RKN A;  2K1B A;  3UI2 A;  3I90 A;  1DOK A;  2RDG A;  4F87 A;  1TII D;  3TSS A;  5DM6 3;  2EY2 A;  3HOY B;  1AEX A;  3A55 A;  2JE6 I;  2EPB A;  2PPB C;  1TS3 A;  1EU3 A;  1WTV A;  4DK0 A;  1JIC A;  1UNS A;  1NUC A;  2EOT A;  3QOJ A;  3PV0 A;  1HFG A;  2RSO A;  4C3H B;  3VR4 A;  4K2K A;  5JVG 3;  1UAP A;  5J1Z A;  5C4H A;  5C0X I;  1IYV A;  3HP3 A;  1AZQ A;  1OXX K;  3K57 A;  3EVQ A;  3K5O A;  2NVY B;  3M7G A;  4QB4 A;  2A6H C;  3C2P A;  2RSN A;  1AP0 A;  1GUT A;  1RF2 D;  1L0Y B;  4FNF A;  2JA5 B;  4TRD A;  3CU7 A;  5D14 A;  3A7L A;  2E2H B;  1B2T A;  2J4X A;  5ELF A;  2KA7 A;  1EY5 A;  3J7A F;  3I91 A;  3KLS A;  1HTL D;  3K7A B;  2VNU D;  2D2C C;  3GD7 A;  4QCL A;  1DD2 A;  4O42 A;  2GA4 B;  2F0K A;  3MTS A;  3NBI A;  2IX0 A;  3ZYY X;  4C1N K;  1FNU A;  4ZUI A;  1STH A;  4AYB B;  4DFA A;  5LL6 S;  2ZXO A;  4KMU C;  1FYC A;  3FPU B;  5JAV A;  1G8Z D;  2RDF A;  3PUW A;  1TWA B;  1U4L A;  4QF4 A;  1UEA B;  3GTL B;  3S1M B;  4RFB A;  5DEH A;  1JR0 D;  2EYL A;  5G3L F;  3X3N A;  3K0Y A;  5E4W C;  3AU7 A;  2A6E D;  3F2U A;  4HED A;  5JVH 3;  2JA7 B;  1SYD A;  3NQT A;  1BCP C;  1AZP A;  4OHJ A;  1SJH D;  3D6W A;  3OOC A;  1D5X C;  3D31 A;  1AN8 A;  4KJO A;  4BBR B;  1STE A;  3ERO A;  5CV5 A;  1S5D D;  4C2M B;  1D2B A;  2SOB A;  1RTN A;  3NXW A;  4S3S A;  4ME5 A;  4IFD H;  2Z1C A;  2D5D A;  1S5F D;  2XWB B;  1GUS A;  1LT3 D;  3A56 A;  5CYU A;  1STN A;  3P7J A;  1QCB D;  3BS1 A;  1EQT A;  1YNJ C;  1TT2 A;  1GHK A;  3TZD A;  2IPK D;  1ENC A;  4G57 A;  2IW3 A;  4CJ1 B;  4XTC S;  2AWO A;  2XWJ B;  1EY9 A;  1STB A;  3QOL A;  1A6X A;  1XTC D;  4EQN A;  4ZKC B;  4FVM A;  5M9O A;  2K01 A;  1FNW A;  1TS4 A;  5K36 H;  4DNT B;  5IGG A;  1M8A A;  1DXM A;  1SXT A;  3GTQ B;  3PUX A;  3GO5 A;  1I6V C;  4CJ2 C;  3MZ5 A;  1ILQ A;  1BF4 A;  4KHV A;  2R6G A;  1EYD A;  1GXD C;  2D9U A;  4KN4 C;  2I07 B;  1SYF A;  2BA1 A;  4K5W A;  5JPM C;  1I3Q B;  2F0N A;  2LKV A;  2RVL A;  2PZU A;  2KUM A;  1EZ6 A;  4MHE A;  3LNN A;  3H6M A;  1A3U A;  3K6O A;  2FHT A;  1RD9 D;  2JEB I;  1Q1E A;  4B9X A;  4Q5V A;  4RCO A;  3LWE A;  1PZI D;  2OT2 A;  2K05 A;  1VMC A;  4EGV A;  4RKB A;  3A8K E;  1J9O A;  3D8G A;  2MJ8 A;  2HQE A;  1K83 B;  5KRU A;  2KEC A;  1CHP D;  1FD7 D;  1ICW A;  2ID0 A;  1GUN A;  2LY7 A;  4KHZ A;  1B53 A;  5IGC A;  1KLU D;  1Q12 A;  4J8Q A;  1F9R A;  1O78 A;  1TQO A;  5EKK A;  3S2D B;  4IUT A;  2XN9 C;  3L3O C;  4F7X A;  1OXS C;  2NTS A;  1LT4 D;  1TVX A;  1SNC A;  5C6A A;  2EJF C;  3DMU A;  3S1N B;  1V1O A;  2PYK A;  5CV8 A;  2Z8L A;  2AUK A;  1CQF A;  2BDO A;  1DM0 B;  4HCE A;  1Y8P B;  2F0T A;  1STA A;  2AUJ D;  5EQ0 A;  1PRT C;  3VR2 A;  2PZT A;  4HSP A;  1SNO A;  2MPM A;  2A68 C;  1CTM A;  2EYF A;  4MN3 A;  5JPN C;  4EVO A;  3AB9 A;  1YNN D;  1HXY D;  5EPL A;  3T16 A;  4OGQ C;  2VB3 X;  2NVT B;  1F2Y A;  5FOB B;  2F0F A;  2PCF B;  2A6H D;  1EL0 A;  1TY0 A;  1GJX A;  3NBH A;  3QG1 A;  1PTO H;  4C56 C;  4BA2 I;  5D3D A;  1WTQ A;  3GQB A;  1KAA A;  5C0X G;  1PTO C;  1TU2 B;  4XIG S;  2E74 C;  3EA6 A;  1WTP A;  5CV6 A;  4X3U A;  1F9P A;  1KDB A;  2SDF A;  1B50 A;  1GUW A;  3VR3 A;  3J81 L;  2Q8T A;  1PFM A;  1Z6H A;  5I9P A;  4XYQ A;  1EIG A;  2K5Q A;  2H4O A;  4L8J A;  1FR3 A;  5COY A;  1NR2 A;  1B1Z A;  1L0X B;  3RUZ A;  1CT1 D;  2LMC B;  2WV6 D;  5M5Y B;  2VXW A;  2V4D A;  2NN6 G;  5ELE A;  3S15 B;  2PO4 A;  2OEO A;  2F0J A;  3TZU A;  1EY8 A;  2WKD A;  3I70 A;  1PDQ A;  3V96 A;  2J7Z A;  2M00 A;  5EJW A;  3OPO A;  5T1I A;  3H3V C;  4NMZ A;  2F0M A;  1JB3 A;  3VYR A;  1OXU A;  1Q3L A;  4CHT B;  1RTO A;  2B2T A;  3EJI A;  1F9S A;  2F0P A;  4HSV A;  2WKC A;  3I4L A;  1HA6 A;  2K04 A;  4DAV A;  1EY6 A;  2NZ1 D;  3I72 A;  5IOC A;  2F0I A;  3MEH A;  3CRL C;  1IL8 A;  1EQV A;  1D5Z C;  2NWG A;  2ZT9 C;  3R8B A;  3DUZ A;  2WII B;  3PMF A;  2R92 B;  4BS9 A;  5IGE A;  5KNB A;  4Y7N B;  1W6K A;  2NN6 I;  3CRK C;  1V43 A;  2A6E C;  2LS0 1;  3N6R A;  4KD4 A;  2MP1 A;  1SYG A;  4ID6 A;  2AWN A;  1FGB D;  3LX0 A;  1T5E A;  3OMG A;  4DGZ A;  2Q8R E;  2F0L A;  4CKC A;  1A15 A;  4FXK C;  4M8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...