4DAYA

Crystal structure of the rmi core complex with mm2 peptide from fancm
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
144
structure length
144
Chain Sequence
IAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
molecule keywords RecQ-mediated genome instability protein 1
total genus 35
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dayA01
4DAYA 3NBHA 3MXNA
chains in the Genus database with same CATH superfamily
1DM0B 3KBGA 1EIYB 4LNQA 4DR6Q 4MTKA 4JI2L 3OIPA 1I4XA 1G2SA 4Y52H 2RCNA 5A35A 1PDQA 1Q8KA 3W3AA 1SE3A 5FJ8G 1RCVD 4L5TA 4IOCA 1QZHA 1L1OC 5JJKA 1WCMH 5KNDA 5DM63 2K33A 1NE3A 4GZYC 1NJIC 4QIWB 2ZTCA 1NY4A 5JPNC 1LABA 3I90A 4XIGS 4M8AA 4DR5L 1YJNA 3U58A 3DEOA 2YTVA 1AN8A 2TMPA 2UU9L 3RD4A 4ME5A 3PO3G 1DYQA 1A3VA 1X32A 1V1OA 2PW5A 4OWWB 4WJWA 4KTAA 4K8IA 3OW7A 2PZUA 3T56B 1S72A 2ZT9C 3OTOQ 2I5MX 2WIIB 1ICWA 2VQEL 4DU9A 5M5WB 2N8NA 2WAQG 1C4QA 4RHRA 1CSQA 1RKNA 1G6ZA 3CMEA 1PTOH 4X3UA 2PNHA 3I7FA 4BWGB 5C0XG 3E6ZX 2E2HB 1TS4A 2H5XA 5DM73 1KLUD 5C4HA 2F1MA 1STBA 5D3IB 1JC7A 5AJ3L 4QIWE 2MPMA 2RCFA 5CORA 4NPSA 1LT3D 3VA5A 3J7YW 3JC66 2FINB 4JI2Q 1LM0A 4OWXB 3TMEA 4MHEA 3R8BA 3G4SA 5IYCG 5CV8A 1DJRD 3VYTA 5IY0A 1JJGA 1GXDC 4KY7A 3K5NA 3CC2A 1ET6A 1B8AA 1I50B 3EJIA 5A2QL 5JJZA 4V190 2MJ8A 3UDXA 5ELBA 4R4CA 4AYBB 2MO0A 1BDOA 5D65A 2I0QA 3QR8A 4DR5Q 4I65A 3MZ5A 1U4LA 4POGA 4Z9CB 1HR0Q 2AQ3B 4YCUA 1B50A 4DV5Q 1B2TA 2BA1A 3T51B 2NVTH 2B2TC 3CCVA 4A3KG 2ZXRA 2E2JB 1RDPD 4DK1A 4CJ1B 1HQRD 1Q90A 4DR7Q 1Q81C 2JE6I 4DR4Q 1PHJA 2HCCA 3M4QA 2C35B 3HZXA 1WOCA 4YHHL 1MSHA 1OXTA 2E2IB 3EQLC 1P16A 2K14A 5M9OA 1BBWA 2R93B 1IBKQ 1HCZA 1FJGQ 5KYIA 5LMUL 4H7BA 1B4OA 5AFWA 1HR0W 2XN9C 2IX3A 3HOZB 2CHBD 2F0FA 4X64Q 1E24A 2D0OA 3J81E 3NWTA 1W6JA 5K5PA 3QIAA 4AYBE 1SFOH 1E0BA 2E74C 4IZ8A 5C4JB 1YJWA 4C3JB 2LY7A 3D4DA 4GLXA 1HNXQ 1PH9A 1XNQQ 1HZAA 3F2DA 2B2VC 4PV1C 3BVZA 3VYUA 5I9PA 2N88A 1I4HA 2UXDL 1YVCA 3PGZA 1I3QH 1WD0A 2EY6A 1QVCA 3S24A 4LMQD 2MQHA 1ENFA 4ZQ3A 1AE3A 4DR6L 5D14A 4BS9A 3K57A 5DNFA 2HDLA 5J3BA 2QCPX 5IGCA 3ZYYX 1CI3M 5D3DA 2E2HH 3DWAA 3W1BA 4B3ML 1TWCH 1ENCA 3SK8A 2NZHA 4BY7H 3HOVG 4QMGA 1PMRA 2DNEA 2YTYA 4A3MH 3BVMA 2IWHA 2EXDA 3MC0B 1PFBA 1EY5A 3FKIB 4NW2A 2R92G 2BA0A 4YWKA 2NN6I 3OYYA 1VQEA 4A76A 1TWGB 4C3JG 2DY8A 4AYBG 1SMXA 2B3GA 1RIPA 4WJ3M 1VQAA 5EGTA 2WINB 4U68A 5IIFA 2PZWA 1VQPA 2EJFC 3BZDB 4X62L 1LTGD 1PFSA 1S40A 2BH2A 4R8NA 4A3BH 5C4ZA 3H15A 5FLXc 4PMBA 3PUZA 3FPUB 4POFA 5C3WA 1A0IA 2VW9A 2VQEQ 1PVOA 1F2YA 1LTTD 2OXPA 2JYOA 3RR5A 2B8GA 5HURA 1PRTC 1K8OA 3M4YA 2IY5B 4KHZA 1QVFA 1A2UA 2R7ZB 5EKKA 1JT8A 2LMCB 4JI0Q 2F0VA 4EQ5A 3ITPA 5JPMC 1A63A 2R7ZG 1KAAA 3GTMB 2F52A 4HAEA 1F77A 4A3EB 1ENAA 1JMCA 4DAVA 3CU7A 1DOKA 2ID0A 1ZYRC 2NUCA 1Q86C 2Q2HA 2F0PA 1SBBB 1Z7TA 4F88A 3NQTA 5FOBB 2NZ1D 1G91A 3CPFA 3RN2A 1VQ5A 1IW7D 3K0YA 2CH4W 4B08A 4A3KH 3K7AB 4IN3A 4A75A 3S16B 3MTSA 4TRDA 2Q2TA 1OO9B 3J81c 1KABA 5C4XG 3IL8A 1QUQA 2A68D 5EKLA 4C3HG 2B2YC 1JORA 4BXXH 3NXWA 4GKJQ 1B53A 4B3RL 2NN6H 5CMDA 3H0GG 1ESRA 2M2LA 3I55A 2CQAA 1E2ZA 1E2VA 1TWHB 3QJYA 3SK6A 4KY6A 4JI6L 2ICEC 3D6WA 4P2CB 2E8GA 3C3LA 3HKZE 4DV6L 5I6YA 2FFKB 3TDQA 3TP5A 1F9SA 1TWFH 3H91A 4LF8L 5FJ8H 4IPCA 2V1CC 1KNAA 3S2DH 1K83H 3GP7A 2GVBA 3KJOA 5GAHC 2JA7G 1CKOA 1WTOA 4CKBA 2YTXA 3KOJA 4DV7Q 1GHKA 1QG7A 4O2DA 3H3VH 4QUCA 1G51A 1MIUA 2UXCQ 5CBEE 4NXNQ 4GOPA 3SK5A 1PV4A 3BJUA 5LMNQ 4A4IA 3TZDA 2F0MA 2I46A 4JC0A 3A54A 4B9WA 5CV4A 2VQFL 3QOLA 3RZOB 1WTQA 1HRJA 1IBLL 3CC4A 5FLMG 4RAUC 5JAVA 2EOTA 1EWHA 1H9SA 3D4WA 4IFDI 4I7ZC 3HOUH 2R92B 1HR0L 3Q8DA 1KQSA 1PH3A 3IFDA 1RHPA 2PZTA 5HGQA 4GOPC 1JB7A 5IP7G 5JVG3 3CMAA 2ENBA 4QQBX 1WTPA 1HNWQ 1KAWA 3MVVA 1VQDA 3PMFA 1HA5A 1LT4D 1PA6A 2B63H 2LXJA 1LT6D 3H0GB 3VYSA 1BCPB 1V1PA 1NBWA 2B39A 4GN5A 5IT9L 1F9PA 4N9PA 1QNKA 1YNNC 2QKIC 2LXKA 3NENA 1C48A 1R9TH 1X9NA 1Y69U 2Z6KA 2WAQE 1F2MA 5HGTA 3NWSA 3S1RB 2ZXOA 1MJCA 2HHHL 2EYJA 1KRSA 1MKHA 4HCEA 1XTCD 3NEMA 1U4PA 1EZ8A 4A3FH 1EY8A 2F0OA 2B29A 5M3MH 1UUPA 4AQYQ 3O13A 4EQOA 3AU7A 3J81L 3HS0C 3S14B 1EQQA 1EIHA 1D5ZC 1YBYA 1SNMA 3PV0A 4A3JH 2AWOA 2A69D 4CBVA 2CVRA 1XPRA 5HY6A 3KK7A 4JI1L 4IUQA 1BXTA 1CK1A 1VQKA 3I3CA 4IFDH 1FNVA 3C1EA 3SEBA 5FLXL 1M90C 1HXYD 1J8IA 3M4OB 1MI2A 4OIJA 2VXWA 2O4XA 1ZKOA 3AFPA 1GUGA 5LL6S 2L4NA 4KKTA 4FF3A 4DUZL 2OWOA 4S3SA 1HNWL 2OTJA 1XTDA 1WVLA 3PUYA 1BVSA 3GTLB 4RKBA 2NN6G 1PH2A 3S1QB 4R4QA 2A69C 2K50A 3NTHA 2E5LL 4FF4A 1TWFB 1WTWA 4APVA 3RZDH 1VCIA 3FKIG 2KCCA 1JCKB 2IHEA 3M7NA 2K7VA 1FNUA 4K5XA 1R4QB 2F0WA 3IFTA 4KD4A 1NAPA 2F3WA 2L55A 3RLFA 3VA7A 3ULPA 1I6HH 3HOVH 3CC7A 4DV1L 4LF5L 5C3EH 5A2QE 1YJ9A 3S17B 2HCIA 2VUMH 3OWFA 3NSWA 1NMGA 3HOZH 1K8GA 4EQPA 3QWNA 2MFIA 3STBD 4DR4L 1T5EA 2HT1A 4A3DH 4LFAQ 2Z6KC 1LTRD 2WB1E 5JEAG 1VQ9A 1X3EA 4KHPL 5IYCH 3ERQA 4A93G 1ILQA 1S3OA 1C7YA 1Y1VH 3OPOA 5C4XB 1QVGA 1D5MC 4J6HA 4NXNL 2HIXA 3NE5B 3GDEA 3GTQH 1B7YB 2H1EA 3FMCA 2K04A 1PFNA 4FP5D 2BCOA 4R9WA 1HJPA 2IHFA 4AQYL 4ZAIA 1I4QA 2OT2A 1XYIA 3OHXC 5EJWA 3G7LA 3JAML 4A3LG 3U4ZA 4GS3A 4RCNA 3D31A 2XTIA 2C9OA 1MHWC 2YV5A 1S4ZA 4HJ7A 3HG9A 1NSNS 4C3JH 3A74A 4DAYB 3K5MA 1EZ6A 1RD9D 2R93G 1RJTA 4OONA 4UP7A 4DAMA 4WRDA 2XVSA 4H44C 4XXEA 1N8RC 4A3BG 1ONLA 3ONAB 1STEA 3HEJA 4LFAL 1E2WA 3J81j 1DD2A 2AMCB 4IPGA 2ZXPA 2VB2X 2N3SA 2BE5D 3FDTA 3LGJA 1G6PA 1DXMA 4BBSG 1XX8A 2JP1A 3I4MH 4N8X1 3TS2A 1X6OA 1H95A 5KEEA 3C46A 3CCUA 1H9JA 4FXGC 3NUCA 3CF5A 3H6MA 1VF7A 4JI3L 1L0YB 2CKZB 1FYCA 5M5XB 3S15B 4OELB 2JEAI 3KF8A 5C3EB 1BO0A 1X54A 2K75A 3FRPB 1TVXA 2X6GA 5CBAE 4A3IG 5CGKA 1VQLA 3M3YB 3GTJH 1WI5A 4WORA 2VUMB 1I4PA 1A2TA 2HHHQ 4JYAL 4A3EG 2HD3A 5EPKA 4KMUC 4JI6Q 3DWQA 5E3FA 1JOKA 2L5TA 1JWMD 5ISRA 4KN7C 5I2XA 1VQ7A 3K0XA 4DV3L 4OXPA 2PI2E 4K14A 3S1QH 2RBMA 4ZKBB 5TSSA 3ER0A 2GA4B 2V4DA 2ZJQA 1SNOA 3CCJA 1LLRD 2PW7A 3PO2B 2ZJPA 3A8JE 4MN3A 4P73A 4O1NA 2G5DA 1PTOF 5GAEC 2KJXA 1AEXA 3P20A 3CPWA 5I6WA 2N49A 2KECA 5IGFA 3PQIA 2KVMA 2N55A 2B2YA 4LK1C 1LTSD 2IX0A 4G57A 4QF4A 3HOVB 4UPAA 1OXSC 4DV1Q 4HR7B 4LJZC 3S14H 4DGZA 1X65A 3GTGH 2J4XA 1SLJA 1GHJA 1ZXTA 1O80A 4YHHQ 5J22A 5M3MB 3RZDB 3MA2B 4EGVA 1HTLD 1K28A 2XWBB 4DK3C 4LAAA 1SMYC 1EQTA 2F0KA 3T16A 3TEHB 1S5DD 2Z8LA 1Q46A 1GKHA 2R61A 4KLKA 1WD1A 4HJAA 1Y8OB 2B8FA 3D6CA 4KHPQ 1S5FD 1SE8A 2CH4A 2KCNA 4DFAA 4BBRG 3F8TA 5KRUA 4PQXA 2A5HA 4JOIC 3K7UC 2UUCQ 1I94L 1SROA 2IPKD 4IFDG 2K5QA 2MNAA 4LF6Q 2SEBD 4C3IB 3UI2A 5IWAL 4OHJA 4OX9Q 5IYDH 2M9VA 4QGUA 3PO2G 4N8FA 4CDDC 4IPHA 4DV4Q 3T1HQ 1M4VA 4JI7Q 1TWAH 1SYEA 3EIVA 2EYPA 4TVAB 2F3VA 4OX9L 4JBWA 2F0DA 5IYBH 3D3RA 4H0LC 2JN4A 2JA5H 4JI8Q 1QB5D 1U0LA 1X3QA 2K5VA 3K5LA 4CHTB 5ELNA 4GNXB 3HKSA 4GKJL 1EL0A 4J1MA 5C44B 5IT9c 1X3GA 3UE1A 4TKOB 1O78A 3DEPA 4RA8A 4Y7NH 4GKKL 1A8VA 3F2CA 3PSIA 1Q12A 3K80C 4K5VA 1EY0A 4ALPA 3FPPA 1Y1WG 1KD1C 3TRZA 2CW0C 2KEDA 4HN7A 3ULJA 3OW2A 2BE5C 4AH6A 2VL6A 1EYAA 2QEJC 5BN3A 4MZ9A 4BA1I 1CUKA 3ND8A 1WJJA 2OCEA 1O7YA 3QO2A 1CA5A 1O7LA 3OWEB 1IBKL 4IALA 3KLSX 2L9HA 3FHWA 4K2LA 1LYLA 2XRSD 1HFNA 2HQLA 1BCPF 1Q7YC 2NVQB 4GLAC 5CV7A 4KV6A 3HOUB 3HRZC 1BQQT 4OO1I 1TWHH 3E9IA 3FKIH 4HSPA 5FK9C 1YHQA 2NWGA 3IRBA 4LF7Q 1L1OA 1Q1BA 2Z9HA 3A8IE 3BDLA 1HZBA 4X64L 4YY3Q 3HOYH 5IP7H 4B3TL 4V0BA 1MGSA 1XNRQ 4OL7A 1AZPA 5CYUA 2K52A 2CFMA 3HFZB 3CAMA 1N32Q 4IUTA 2A6HD 1YNND 4X3KA 5M5YB 3Q23A 3I4NB 4O0AA 2B2UC 2PPBC 3I4MB 3R2IA 4PG3A 1MSGA 3URYA 4H02A 2EVBA 4CJ2C 4DAYA 5JEAH 4OO1G 2O2LD 2Q8TA 5LHY1 3C2PA 4C2MB 1SR3A 1V1PB 4DR3L 2WV6D 2J7ZA 2AQ2B 1EOVA 2LKVA 3H94A 2D0PA 4K6DA 2KA7A 4ZUJA 4K6LA 1YZ6A 4QL5A 2WB1G 3S2HH 3I4MG 3E3XA 4HJ8A 3I4NG 1KTKA 1HPCA 3R3OA 5DEHA 2ES2A 3ND9A 3CXCA 2XWJB 5IGDA 1VMCA 3NELA 2B2WA 5ELFA 1SXTA 3WWVA 5NUCA 1K73C 4K5WA 1QZGA 2R93H 3TREA 1L0XB 2PYKA 4P72A 3MXPA 1UNSA 1NMFA 3GTQB 1N32L 3G6JB 3SXHA 4BY7B 1S5CD 4FXDA 1EOTA 2NVXB 4DNIA 1EUJA 3V05A 3F2BA 1IKMA 2F0QA 4J15A 2MP1A 2K5NA 4A3EH 2RA4A 2UUBQ 2O5JC 5IGGA 4LF8Q 2EYLA 4KN4C 4GN3B 1YIJA 4JI5Q 3GTKB 4LFBQ 2Y0SE 3CRLC 4NP5A 1YI2A 4RMFA 2Z0SA 2F0TA 3RUZA 3TN2A 5C5LA 4IJLA 3GD7A 3GTOH 3CQZH 4KI0A 5ELDA 4ZYSA 3WOFA 3W2DA 3BS1A 4DUZQ 1STYA 1EU3A 4H13C 4DV4L 3M7GA 3Q24A 2F0JA 1E1OA 4B9XA 2DJFC 2SOBA 5L37A 1DCZA 1GVPA 2Q8IB 2JA8G 3K59A 2KCMA 1LTBD 3VYRA 3T53B 1IW7C 4G7ZC 2CWAA 5ELOA 1WFQA 4UP9A 4CDFC 1FNWA 1XNQL 3I72A 3GTJB 2IW3A 1VQHA 1EY7A 2KCTA 3J7ZC 4A3MB 2R7DA 1YNJC 1Q82C 1C9OA 1HUMA 2JA9A 4YIJA 3TP8A 1IYVA 1VQOA 4LUVA 5M5XH 3S15H 4A93H 2O5IC 3HOWB 4HCSA 2EIFA 1TKWB 4KD3A 1UAPA 3WDNA 2PQAB 2Y0SB 3MFGA 1TIID 1JWSD 2NVXH 3S1MH 1X3FA 1VDZA 1H9KA 4P74A 1LTID 4A3LH 3ICEA 1XPOA 5BR8L 1EIFA 1EYDA 3EROA 4G7HC 4EX5A 3I8ZA 5GAGC 3S17H 1TS2A 4R4OA 1QE6A 2IJ0A 1YITA 1HA6A 3CRKC 1L0WA 2UUAQ 2BDOA 1H9RA 1SNDA 3P75A 5LL6X 5E1FA 1WTVA 4JCVE 1P8LA 3CCQA 4X6AH 2DUDA 4K0KQ 3B6YA 1AFPA 2RDFA 5C44G 1W3SA 3C1FA 2F3IA 3KYHC 4FDBA 3KF8B 1NCVA 2JA6B 4C2MH 1H9MA 2D5DA 4ZKCB 3AQQA 1PFMA 1IBMQ 2B2TA 2LFNA 3E0EA 3SK4A 2E5LQ 2UXBQ 1HTPA 5M3FH 3KJPA 1KC8C 4XYQA 3I4NH 3KDFB 1YNJD 2OTLA 4C1NK 2ZTEA 2JA5B 3LWEA 2EE1A 4HJ9A 3L7ZC 1MJEA 5ELCA 4OGQC 3I70A 4IQZA 4LFCQ 1TS3A 1VQNA 2JA6G 2A1AA 4A3CH 2KBNA 4XQJA 4DAPA 1R4PB 3BYTB 1TS5A 2XIWA 2K32A 3MXNA 1GJXA 2NZOA 1PRTB 1JB3A 2JA8B 4O42A 3OMCA 2K6AA 4LF9L 3J7AV 1Y14B 4A3FB 4X3TA 1SYFA 1BKBA 2NVQH 1RL2A 3BYYB 4KJNA 3FVQA 4KJOA 1R9TB 1A15A 1V1QA 5K36H 5IYBG 1LV9A 4XQQA 3UDGA 3W1GA 3S1RH 1B3AA 2UUAL 2JQOA 1DZ1A 3TP7A 4L6TB 3J80i 2MHVA 2B2VA 5IODA 2B63B 3N52A 1ET9A 4A3IB 3S2DB 3L9AX 1FD7D 4L8JA 5C5MA 1CT1D 1D6EC 1S5BD 3U4VA 4EQNA 4GOPB 5FO8B 1WCMG 1VMPA 3ZJYC 1J5EQ 4XQNA 5KNBA 4L63B 4QJFA 1XNRL 4JVZA 1VQGA 4JV5L 4DPGA 1MD2D 2L12A 3P1HA 2EYOA 3MHBA 1Y1WB 1LO5D 4DXGA 2YU9H 2FMMA 1N33L 3HKZG 4LF7L 4PZ8A 4BY1G 1RODA 3KBXA 1DOMA 1VQCA 1XMOL 3HOYB 2EDGA 1QNUA 1UE1A 3WOEA 1D2BA 1B9NA 3F2UA 2F0GA 1T9HA 2EXZA 4YWMA 2B2UA 3RZOH 1NNXA 5E4WC 4JI4Q 3D4RA 1EY6A 2IL8A 4JBKA 2ZM6Q 1ASZA 3ERSX 3HOYG 2RKSA 1N34L 3TP6A 2HUGA 3NBHA 5C0XH 2I5HA 5FO9B 1K83B 2EZVA 1ILPA 4TQUS 1JQYD 1AP0A 1STGA 1AE2A 1Q8IA 1N9WA 3OMGA 4LF9Q 4LF5Q 4A3GB 1DOLA 2PI2A 3NPPA 1ZEQX 2E75C 4AIMA 4ZCKA 1FVIA 4YWLA 3S9WA 1V8QA 2K01A 3STBC 1PZKD 3NP8A 3HGBA 2KHIA 3L0OA 4ZUIA 3TBIB 1GOZA 1TT2A 5GADC 4KHVA 3I73A 5IP9G 5C44H 3MAQA 1WYDA 2E2DC 4GNXC 1SNQA 3AFQA 3KUPA 2ZJRA 3QOJA 3U9SA 1X56A 3K7AH 1SYBA 3S16H 4BY1B 4F7XA 5G3LD 3PUWA 4R1JA 3NBHB 4KKUA 1V43A 4DR2Q 4XDXA 1TWAB 1SJED 5E4XA 4DV3Q 4A3FG 1D8LA 1JWUD 4ID6A 5M3FG 1OTCA 1Y8PB 1SYCA 1G2TA 3GO5A 4CDEC 2PO4A 4DUYL 4FF1A 5KYLA 1IYUA 5JVH3 2UXDQ 1DGSA 1Z6HA 2J0TD 2NB0A 4JPBW 3I4OA 2YU9B 2ASBA 4K0KL 1Y1WH 3DHQA 4JOIA 1EEID 1RF2D 2BDNA 3DXJC 3X3MA 3HOXH 4JG2A 1JOOA 2JA7H 4ILWA 4JI1Q 2JA6H 3CKIB 3D8GA 3F1ZA 3KLRA 2DJGC 4B3RQ 4LWCA 3J80E 3A7AB 1IBML 3OTOL 5J39A 4K2KA 2RF4A 4NB3A 1SEBD 4XYOA 1IXRA 3VR2A 4N9TA 4IUPA 2MGSA 1VQJA 4DK6C 2KENA 5C4JH 3GTGB 3E5SA 1RTNA 2Z1CA 1D1IA 3BZCA 4X65Q 1BCPD 2A8VA 3M3YH 1FR3A 2OEOA 1LT5D 4DR1Q 4YCVA 3UDIA 2VY3A 1SE4A 1EU4A 1TWCB 3S1MB 1Y1VB 2KQ3A 3JAME 1UE6A 3OIQA 1V9PA 4HSVA 1F9RA 4UDUC 3HOWH 1XMQL 1QWYA 1PRTF 1K3RA 3R2TA 1PYWD 3G6EA 3D0FA 3DUZA 1ML0D 1VQBA 2RDGA 3VR5A 1K8MA 1E1TA 4NMZA 1PZJD 1STHA 5I4DA 4DV2L 1W2BA 2Y0SG 1G8ZD 2X6LA 4DUYQ 2NYZD 4RGMA 3X3NA 1HNXL 4ZLTF 2ZTDA 2ATWA 1CA6A 5IE8A 3GTMH 5M3FB 1Y1VG 2E76C 4Q0FA 2EY2A 2MO1A 1GO3E 4A3MG 2EJMA 3K6OA 2R7ZH 1CQFA 3CCLA 1JR0D 3RLOA 5T1GA 2VB3X 1D1KA 4PNYA 1HZ9A 4GN4B 1K0SA 2ZM6L 5H1SE 1SFOB 2K05A 2PCFB 1BUVT 4DV0L 3BZKA 4L5QA 4MTNA 2NTSA 1I50H 1KDAA 1LTAD 3A0JA 3GTKH 2XSCA 1KXLA 3GV3A 1CZWA 3TZUA 3QB3A 1IYJB 1OXVA 3SE0A 1XXGA 1J6QA 4C3IG 2NVYB 2BOSA 2UU9Q 2Z6BA 5C4XH 2WP8J 3J80L 4A3GG 2R3ZA 2F0IA 1JJ2A 3MXGA 1SNCA 2QA4A 4DV2Q 1PH5A 1I94Q 2L11A 2AQ1B 2JEBI 4A3JB 5EPLA 3M85A 1PXUA 1J5EL 1QJOA 2MUYA 1XPUA 1STAA 3A8KE 4RWSC 1TY2A 1JOQA 1PYBA 1SRUA 3E0JA 3JAMc 4C1NI 2NVTB 2R7FA 4GLVB 4B3TQ 3SHLA 4Q5VA 2F4VQ 3IKJA 4LF4Q 2A68C 1CSPA 3KFUA 4P75A 5C6AA 1KHIA 2LSSA 1AZQA 1D7QA 3KDFA 3S1NH 3S1NB 1X55A 2OQKA 5EPJA 2TSSA 3DM3A 4BXXG 3G48A 4IPDA 1PYSB 5J1ZA 2WACA 1HZCA 1FGUA 3N6RA 3BVGA 4RHSA 1BOSA 2Q2UA 3PO3H 2K5DA 4DV0Q 3PF5A 4JK1C 4KY5A 4NDXA 3CQZB 5T1IA 3GTOB 1YHAA 3RNUA 3GTPB 4BY7G 4CGYB 2PQAA 2AUJD 5COYA 2A73B 2YYZA 3NTKA 3R93A 2JK8A 4JI3Q 4GKKQ 4A3DB 1F9QA 1PRTD 1IKLA 4B3SQ 1N33Q 4ZRZA 1SMYD 5KNCA 4DF7A 3MEFA 5EAYA 1NR4A 1SAPA 3J7A5 2QW7A 4IUVA 1KL9A 3BDCA 3KF6A 1OXUA 1EFWA 4A3DG 1B9MA 2PNRC 4IFDJ 3BU2A 4E6IA 1I6HB 3PIO3 3G71A 4DR2L 3LWUA 3K58A 2AHOB 1PH8A 3EFXD 3MXNB 3UDFA 5DLQE 4XTCS 4LFBL 2UXCL 4OEMB 1N36Q 1F2LA 1WCMB 3P7JA 4PZ7A 3A5UA 1VQFA 4BBSH 2XRQD 1HUNA 1HQMC 1TXYA 3V2TA 1BBXC 4DN4M 2I07B 4CDCC 4GNXA 1PH1A 5FO7B 4BBRB 4FVMA 1GUOA 3NHHA 2Z4IA 3MFYA 1E22A 2L0CA 1B1ZA 1Q1EA 4CKCA 4QCLA 4R4IA 4B3SL 2UXBL 2DGYA 3U9OA 1O7ZA 2EYHA 4MIUA 5IGBA 1K8AC 1U9RA 1STNA 2A6ED 3Q6SA 3DLLA 2QDBA 5M5YH 1JJCB 5GROA 3BG3A 3CCSA 3I2ZA 5CV9A 5KGUA 4WJ4A 5DAUA 2K5WA 1KDBA 1A6XA 1PH4A 3EA6A 4LUOA 4C3IH 2VQFQ 4JBJA 1S5ED 4ABNA 5CC4A 5IYDG 2PMZE 1EWCA 4M1UB 1ICFB 2L1BA 1G291 2L15A 1JICA 5IOCA 4NXMQ 4XT1B 1VQ6A 3ULLA 3W5OA 3VDYA 2JA5G 3E9HA 4QUFA 1EQRA 1E3PA 1I4RA 1U4RA 1UE5A 3L3OC 1N36L 2F0NA 2SDFA 1TR5A 3K8AA 4ULLA 3M9BA 4TSSA 3MXUA 1Z47A 4X62Q 2A74C 4HEDA 4RH6A 5CV5A 4RG1A 5BR8Q 1VS0A 3CHBD 4A3IH 1SSOA 2FHTA 5CR3A 3J7AF 2AWNA 4DXFA 1KDCA 3HOZG 2F0EA 4K8JA 1VQ8A 1IBLQ 1L1OB 3L2PA 3HOXB 2VS1A 4LW1A 2D2CC 2EYMA 4JI5L 2X69A 2RQXA 5EKIA 4Y7NB 2F4VL 3MWYW 1KIXA 3T1HL 1PTOD 3HOUG 3KLWA 1I4GA 3NK9A 1A3UA 4JYAQ 2EJGC 4X3SA 4WFN3 1K0RA 1UEBA 4NXML 4A3KB 2FMCA 3AMUA 4IURA 3PCOB 4L5SA 1IL8A 5C0XJ 1NTGA 3GTPH 2RHQB 1MBYA 4YY3L 2DN8A 2RSOA 2B63G 1H9SB 1SYGA 1QOHA 2BH8A 3CP0A 1CTMA 3CW2C 5BN5A 1EY4A 2K5HA 2EY1A 3PUVA 2RDHA 4DR3Q 1J9OA 1KNEA 1I3QB 2KOLA 1K9MC 4BBSB 1CHQD 3A56A 3EVQA 1CKNB 4FO2A 2QEXA 3JAMi 1OXXK 5IGEA 1YNXA 3VR3A 4OO1H 2ALYB 2GVAA 1EQVA 4PMWA 3PIPA 4UY8C 3RMHA 1HNZQ 5FLXE 1B70B 1BF4A 4A3BB 5C0XI 2HIVA 4FNFA 1PLFA 3CCEA 4DV5L 2F4IA 1EIGA 3OSOA 4DV6Q 4OIKA 3I56A 4X66Q 3T1YQ 1AW7A 2OQ0A 1SE2A 3PIOA 4DR1L 2XGTA 5E7NA 4R8IA 1QILA 1L2FA 2OF1A 2F0HA 2NBFA 2SNSA 2D62A 3LX0A 2E2IH 4A3CG 4JI0L 3IAYA 2G9HD 4HJ5A 2WAQB 3K81C 1KLGD 4F87A 2F0SA 1GUWA 1IZ6A 1FGBD 2NVYH 3H09A 4MNOA 3CCMA 5LMUQ 3RN5A 2HDMA 4RGOS 3PO2H 3MEHA 4A93B 1HHVA 5LMNL 4FXKC 4DKAC 2Q2IA 1LUZA 5EBCA 2QGQA 3NTIA 4C3HH 3VR6A 2FXQA 3M4PA 2RVLA 2D9UA 3TQYA 1K3BC 3GQBA 2I5LX 2KHJA 4DA2A 3DM1A 4HMJA 1A62A 3LNNA 1Z9FA 1B44D 1WTHA 4JW0A 3VR4A 5C3EG 1Y8NB 4R4TA 2KEEA 4B3MQ 4UP8A 4LFCL 1TWGH 2A6EC 2DNCA 3SGIA 2VNUD 3I4LA 4RFBA 3HOWG 2JA8H 1I6VC 2R6GA 1T5XD 1VQIA 1VF5C 4PMCA 4L5RC 4RCOA 3AEVA 1ZYRD 2CCZA 4LUZA 1BR9A 4X66L 3T1YL 3H3VI 4HIDA 4OWTB 4BA2I 1EFID 4DNTB 1X3PA 5CV6A 4CJ0B 4JBMA 4IOAA 2N78A 1XJVA 1JE5A 3T13A 3CD6A 1BNZA 2AKWB 2K4KA 4FF2A 1HNZL 4X65L 1B3QA 4FYDA 3K5OA 1PTOB 2A6HC 1EY9A 4ODGA 4YCWA 3PO3B 5F2DA 1JE4A 1I5FA 2K03A 3QG1A 3HKZB 1HH2P 1TU2B 1IL2A 1SDFA 1QUQB 2GN5A 1IHZA 2H4OA 1CHPD 4EVOA 2K28A 4ME3A 2M00A 2QF7A 1E7ZA 4J8QA 4XT3B 3CCRA 3DMUA 4IJHA 4ZK9B 1CKNA 4G7OC 1C8CA 1PTOC 2QILA 2G9DA 4C3HB 1CKMA 1XWEA 4QY7A 3FEWX 3V96A 2VZAA 2DY7A 1UWVA 1M1KC 2Z4HA 3NQIA 1EYGA 1EWIA 2PMZB 3EBEA 2EPBA 1F2ZA 1XMOQ 2A19A 3BDOA 1SN8A 3Q22A 2Q8RE 5IT9E 5JJLA 4JV5Q 3FP9A 4IUNA 1VQ4A 2CW0D 4DK0A 1FL0A 2EYFA 1CZGA 5FKAC 1CFMA 3I91A 4NKLA 2EY5A 3HP3A 5ELEA 5M3MG 1GUTA 1SYDA 1EYCA 1FJGL 2AUKA 2WB1B 1RTOA 3HOXG 2E2JH 4A3JG 3DWPA 1D5XC 4HIOA 5JJIA 3NBIA 3TSSA 2IT1A 4U673 2WKDA 4G4KA 4RKLA 5M5WH 1ASYA 1YEZA 4IUUA 3TS0A 3PIP3 2C5CA 3KF6B 1U5KA 1Q3LA 4C56C 2UUCL 2IX1A 3H0GH 1GD7A 1PH6A 2QDLA 4DNRB 1C0AA 5AJ3Q 1GUSA 1NR2A 3T4AC 4I7AA 1QCBD 4DV7L 2UUBL 3UE0A 1U4MA 2RSNA 4UAIA 1LTLA 3GTLH 3SVMA 3OOCA 4QB4A 1GUNA 2WKCA 2F0UA 5BN4A 3PUXA 5GQOA 1KRTA 1TQOA 1VQMA 1TY0A 2R92H 3A7LA 1HFGA 2SNMA 5I9OA 4HIMA 3H3VC 1SNPA 5I2YA 2CQOA 4UHVA 3M4OH 1II3A 5IWAQ 1W6KA 4LF6L 2VUMG 3GV6A 2CWPA 2EQSA 4P71A 1AH9A 3AYHB 1WTXA 2F0LA 5JEAJ 1DONA 1PH7A 4IO9A 3A5ZB 2HQEA 1SJHD 4BY1H 1N34Q 4DR7L 5FLMH 2WFWA 3J80c 1NUCA 3Q0AA 2XNAC 2ICIA 3KLSA 1XMQQ 5EQ0A 5KIXA 5G3LF 2JXMB 1LACA 3RLNA 4KKSA 2B2WC 5C3XA 4KK7A 2KHSA 2K1BA 3S2HB 4BBRH 5LMNW 3A55A 3PF4A 3EN2A 2FJ2A 3U50C 1BBUA 4RGTA 3J81i 2JA7B 2F03A 3SR1A 1O7IA 2LS01 4RGNA 4A3GH 1M8AA 1UEAB 1UE7A 1YHBA 2JJQA 2RHSB 4F8MA 1EEFD 1BCPC 2NTTA 2PQEA 5IP9H 4PZ6A 4HIKA 4JI8L 3SDZA 3AB9A 1ESFA 2KUMA 4JI4L 5EBDA 4HTHA 1CM9A 1CQVA 5JOBA 1WTRA 1GM5A 4CKEA 4LF4L 1A3TA 2JSOA 5K36G 1PZID 2P5ZX 4HMIA 4JI7L
chains in the Genus database with same CATH topology
1DM0B 3KBGA 3OIPA 1I4XA 1G2SA 5A35A 1PDQA 3W3AA 1SE3A 1RCVD 5KNDA 5DM63 2K33A 4GZYC 4QIWB 5JPNC 1LABA 3I90A 4XIGS 4M8AA 3DEOA 1AN8A 2TMPA 3RD4A 4ME5A 1DYQA 1A3VA 1X32A 1V1OA 2PW5A 4WJWA 4KTAA 4K8IA 3OW7A 2PZUA 3T56B 2ZT9C 2WIIB 1ICWA 4DU9A 5M5WB 1C4QA 4RHRA 1RKNA 1G6ZA 1PTOH 4X3UA 4BWGB 5C0XG 3E6ZX 2E2HB 1TS4A 5DM73 1KLUD 5C4HA 2F1MA 1STBA 5D3IB 1JC7A 2MPMA 5CORA 1LT3D 3VA5A 3J7YW 2FINB 3TMEA 4MHEA 3R8BA 5CV8A 1DJRD 3VYTA 1GXDC 4KY7A 3K5NA 1ET6A 1I50B 3EJIA 5A2QL 5JJZA 4V190 2MJ8A 5ELBA 4AYBB 1BDOA 5D65A 4I65A 3MZ5A 1U4LA 4Z9CB 2AQ3B 1B50A 1B2TA 2BA1A 3T51B 2B2TC 2ZXRA 2E2JB 1RDPD 4DK1A 4CJ1B 1HQRD 1Q90A 2JE6I 2HCCA 3HZXA 1MSHA 1OXTA 2E2IB 3EQLC 5M9OA 2R93B 1HCZA 5KYIA 4H7BA 1B4OA 5AFWA 2XN9C 2IX3A 3HOZB 2CHBD 2F0FA 3J81E 3NWTA 1W6JA 5K5PA 3QIAA 1E0BA 2E74C 4IZ8A 5C4JB 4C3JB 2LY7A 3D4DA 2B2VC 4PV1C 3BVZA 3VYUA 5I9PA 2N88A 1I4HA 1WD0A 2EY6A 4LMQD 1ENFA 4ZQ3A 5D14A 4BS9A 3K57A 5DNFA 2HDLA 2QCPX 5IGCA 3ZYYX 1CI3M 5D3DA 3DWAA 1ENCA 3SK8A 4QMGA 1PMRA 2DNEA 3BVMA 2IWHA 3MC0B 1PFBA 1EY5A 3FKIB 4NW2A 2BA0A 2NN6I 1TWGB 4C3JG 2DY8A 5EGTA 2WINB 4U68A 5IIFA 2PZWA 2EJFC 3BZDB 1LTGD 4R8NA 5C4ZA 4PMBA 3PUZA 3FPUB 5C3WA 1F2YA 1LTTD 2OXPA 2JYOA 2B8GA 5HURA 1PRTC 1K8OA 3M4YA 4KHZA 1A2UA 2R7ZB 5EKKA 2LMCB 2F0VA 3ITPA 5JPMC 1KAAA 3GTMB 4HAEA 1F77A 4A3EB 1ENAA 4DAVA 3CU7A 1DOKA 2ID0A 1ZYRC 2NUCA 2F0PA 1SBBB 1Z7TA 4F88A 3NQTA 5FOBB 2NZ1D 1G91A 1IW7D 3K0YA 4B08A 3K7AB 4IN3A 3S16B 3MTSA 4TRDA 1OO9B 1KABA 3IL8A 2A68D 5EKLA 4C3HG 2B2YC 1JORA 3NXWA 1B53A 2NN6H 5CMDA 1ESRA 2M2LA 2CQAA 1E2ZA 1E2VA 1TWHB 3QJYA 3SK6A 4KY6A 2ICEC 3D6WA 4P2CB 3C3LA 5I6YA 2FFKB 3TDQA 3TP5A 1F9SA 3H91A 1KNAA 3GP7A 1WTOA 4CKBA 1GHKA 1QG7A 4QUCA 5CBEE 3SK5A 3TZDA 2F0MA 2I46A 3A54A 4B9WA 5CV4A 3QOLA 3RZOB 1WTQA 1HRJA 4RAUC 5JAVA 2EOTA 1EWHA 1H9SA 3D4WA 4IFDI 4I7ZC 2R92B 3IFDA 1RHPA 2PZTA 5JVG3 2ENBA 1WTPA 3MVVA 3PMFA 1HA5A 1LT4D 1LT6D 3H0GB 3VYSA 1BCPB 1V1PA 2B39A 5IT9L 1F9PA 4N9PA 1QNKA 1YNNC 2QKIC 1C48A 1Y69U 1F2MA 5HGTA 3NWSA 3S1RB 2ZXOA 2EYJA 4HCEA 1XTCD 1U4PA 1EZ8A 1EY8A 2F0OA 1UUPA 4EQOA 3O13A 3AU7A 3J81L 3HS0C 3S14B 1EIHA 1D5ZC 1SNMA 3PV0A 2AWOA 2A69D 4CBVA 2CVRA 3KK7A 4IUQA 1BXTA 1CK1A 3I3CA 4IFDH 1FNVA 3C1EA 3SEBA 5FLXL 1HXYD 1J8IA 3M4OB 1MI2A 4OIJA 2VXWA 2O4XA 1ZKOA 1GUGA 5LL6S 2L4NA 4KKTA 4FF3A 4S3SA 1WVLA 3PUYA 3GTLB 4RKBA 2NN6G 3S1QB 2A69C 3NTHA 4FF4A 1TWFB 1WTWA 1VCIA 2KCCA 1JCKB 3M7NA 2K7VA 1FNUA 4K5XA 1R4QB 2F0WA 3IFTA 4KD4A 1NAPA 2F3WA 2L55A 3RLFA 3VA7A 5A2QE 3S17B 2HCIA 3OWFA 3NSWA 4EQPA 3QWNA 1T5EA 1LTRD 5JEAG 3ERQA 1ILQA 3OPOA 5C4XB 1D5MC 4J6HA 3NE5B 2H1EA 3FMCA 2K04A 1PFNA 4FP5D 2BCOA 4R9WA 4ZAIA 1I4QA 2OT2A 1XYIA 3OHXC 5EJWA 3G7LA 3JAML 4RCNA 3D31A 2C9OA 1S4ZA 3HG9A 1NSNS 3K5MA 1EZ6A 1RD9D 1RJTA 4WRDA 2XVSA 4H44C 4XXEA 1ONLA 3ONAB 1STEA 3HEJA 1E2WA 1DD2A 2ZXPA 2VB2X 2BE5D 3FDTA 1DXMA 1XX8A 2JP1A 5KEEA 3C46A 1H9JA 4FXGC 3NUCA 3H6MA 1VF7A 1L0YB 1FYCA 5M5XB 3S15B 2JEAI 3KF8A 5C3EB 1BO0A 3FRPB 5CBAE 1TVXA 2X6GA 3M3YB 5CGKA 4WORA 2VUMB 1I4PA 1A2TA 5EPKA 4KMUC 3DWQA 5E3FA 1JOKA 2L5TA 1JWMD 5ISRA 4KN7C 5I2XA 4K14A 2RBMA 4ZKBB 5TSSA 2GA4B 2V4DA 1SNOA 1LLRD 2PW7A 3PO2B 3A8JE 4MN3A 4O1NA 1PTOF 2KJXA 1AEXA 3P20A 5I6WA 2KECA 5IGFA 2KVMA 2N55A 2B2YA 4LK1C 1LTSD 2IX0A 4G57A 4QF4A 3HOVB 1OXSC 4HR7B 4LJZC 4DGZA 2J4XA 1GHJA 1ZXTA 1O80A 5J22A 5M3MB 3RZDB 3MA2B 4EGVA 1HTLD 2XWBB 4LAAA 1SMYC 1EQTA 2F0KA 3T16A 1S5DD 2Z8LA 2R61A 1WD1A 1Y8OB 2B8FA 3D6CA 1S5FD 4DFAA 2KCNA 5KRUA 4PQXA 2A5HA 2IPKD 4IFDG 2K5QA 2SEBD 4C3IB 3UI2A 4OHJA 2M9VA 1M4VA 1SYEA 2EYPA 2F3VA 4JBWA 2F0DA 3D3RA 4H0LC 1QB5D 1X3QA 3K5LA 4CHTB 1EL0A 4J1MA 5C44B 4TKOB 1O78A 3DEPA 4RA8A 1Q12A 4K5VA 1EY0A 3FPPA 2CW0C 2KEDA 4HN7A 2BE5C 1EYAA 2QEJC 5BN3A 4BA1I 3ND8A 1O7YA 3QO2A 1CA5A 1O7LA 3OWEB 4IALA 3KLSX 2L9HA 4K2LA 1HFNA 2XRSD 1BCPF 2NVQB 5CV7A 4KV6A 3HOUB 3HRZC 1BQQT 4OO1I 4HSPA 5FK9C 2NWGA 1Q1BA 3A8IE 3BDLA 4V0BA 1MGSA 4OL7A 1AZPA 5CYUA 4IUTA 2A6HD 1YNND 4X3KA 5M5YB 3Q23A 3I4NB 2B2UC 2PPBC 3I4MB 3R2IA 1MSGA 3URYA 4DAYA 5JEAH 2EVBA 4CJ2C 4OO1G 2O2LD 2Q8TA 5LHY1 3C2PA 4C2MB 1V1PB 2WV6D 2J7ZA 2AQ2B 2LKVA 3H94A 4K6DA 2KA7A 4ZUJA 4K6LA 1KTKA 1HPCA 3R3OA 5DEHA 3ND9A 2XWJB 5IGDA 1VMCA 2B2WA 5ELFA 1SXTA 5NUCA 4K5WA 1L0XB 2PYKA 3MXPA 1UNSA 3GTQB 3G6JB 3SXHA 4BY7B 1S5CD 4FXDA 1EOTA 2NVXB 3V05A 1IKMA 2F0QA 2MP1A 2RA4A 2O5JC 5IGGA 2EYLA 4KN4C 3GTKB 3CRLC 4NP5A 2F0TA 3RUZA 3TN2A 5C5LA 3GD7A 4KI0A 5ELDA 4ZYSA 3WOFA 3BS1A 3W2DA 1STYA 1EU3A 4H13C 3M7GA 3Q24A 2F0JA 4B9XA 2SOBA 1DCZA 2Q8IB 3K59A 1LTBD 3VYRA 3T53B 1IW7C 4G7ZC 1FNWA 3I72A 3GTJB 2IW3A 1EY7A 4A3MB 1YNJC 4YIJA 1HUMA 1IYVA 3TP8A 2O5IC 3HOWB 4HCSA 1TKWB 4KD3A 1UAPA 3WDNA 2Y0SB 3MFGA 1TIID 1JWSD 1VDZA 1H9KA 1LTID 1EYDA 3EROA 4G7HC 3I8ZA 1TS2A 1QE6A 2IJ0A 1HA6A 3CRKC 2BDOA 1H9RA 1SNDA 3P75A 5LL6X 5E1FA 1WTVA 1AFPA 2RDFA 3C1FA 1NCVA 2JA6B 1H9MA 2D5DA 4ZKCB 1PFMA 2B2TA 2LFNA 3SK4A 1HTPA 4XYQA 1YNJD 4C1NK 2JA5B 3LWEA 2EE1A 3L7ZC 5ELCA 4OGQC 3I70A 4IQZA 1TS3A 4XQJA 4DAPA 1R4PB 3BYTB 1TS5A 2XIWA 2K32A 3MXNA 1GJXA 1PRTB 1JB3A 2JA8B 4O42A 3OMCA 2K6AA 3J7AV 4A3FB 4X3TA 1SYFA 4KJNA 3BYYB 3FVQA 4KJOA 1R9TB 1A15A 5K36H 1LV9A 4XQQA 1B3AA 1DZ1A 3TP7A 4L6TB 2MHVA 2B2VA 5IODA 2B63B 3N52A 1ET9A 4A3IB 3S2DB 3L9AX 1FD7D 4L8JA 5C5MA 1CT1D 1D6EC 1S5BD 4EQNA 5FO8B 1VMPA 4XQNA 5KNBA 4L63B 1MD2D 2L12A 3P1HA 2EYOA 3MHBA 1Y1WB 1LO5D 4DXGA 2FMMA 1RODA 3KBXA 1DOMA 3HOYB 2EDGA 1QNUA 3WOEA 1D2BA 1B9NA 3F2UA 2F0GA 2EXZA 2B2UA 5E4WC 3D4RA 1EY6A 2IL8A 2RKSA 3TP6A 2HUGA 3NBHA 5C0XH 5FO9B 1K83B 2EZVA 1ILPA 4TQUS 1JQYD 1AP0A 1STGA 1Q8IA 3OMGA 4A3GB 1DOLA 3NPPA 1ZEQX 2E75C 3S9WA 1V8QA 2K01A 1PZKD 3NP8A 3HGBA 4ZUIA 3TBIB 1GOZA 1TT2A 4KHVA 3I73A 3MAQA 2E2DC 1SNQA 3KUPA 3QOJA 3U9SA 1SYBA 4BY1B 4F7XA 5G3LD 3PUWA 4KKUA 1V43A 4XDXA 1TWAB 1SJED 5E4XA 1JWUD 4ID6A 1Y8PB 1SYCA 1G2TA 3GO5A 2PO4A 4FF1A 5KYLA 1IYUA 5JVH3 1Z6HA 2J0TD 2NB0A 2YU9B 3DHQA 1EEID 1RF2D 2BDNA 3DXJC 3X3MA 1JOOA 4ILWA 3CKIB 3D8GA 3KLRA 3J80E 3A7AB 5J39A 4K2KA 1SEBD 4XYOA 3VR2A 4N9TA 4IUPA 2MGSA 3GTGB 3E5SA 1RTNA 2Z1CA 1D1IA 1BCPD 1FR3A 2OEOA 1LT5D 1SE4A 1EU4A 1TWCB 3S1MB 1Y1VB 2KQ3A 3JAME 3OIQA 4HSVA 1F9RA 4UDUC 1QWYA 1PRTF 3R2TA 1PYWD 3DUZA 1ML0D 2RDGA 3VR5A 1K8MA 4NMZA 1PZJD 1STHA 5I4DA 1G8ZD 2X6LA 2NYZD 4RGMA 3X3NA 4ZLTF 1CA6A 5M3FB 2E76C 4Q0FA 2EY2A 2EJMA 3K6OA 1CQFA 1JR0D 5T1GA 2VB3X 1D1KA 4PNYA 1SFOB 2K05A 2PCFB 1BUVT 2NTSA 1KDAA 1LTAD 2XSCA 3GV3A 1CZWA 3TZUA 3QB3A 1OXVA 3SE0A 1XXGA 4C3IG 2NVYB 2BOSA 2WP8J 3J80L 2R3ZA 2F0IA 3MXGA 1SNCA 2L11A 2AQ1B 2JEBI 4A3JB 5EPLA 3M85A 1PXUA 1QJOA 2MUYA 1STAA 3A8KE 4RWSC 1TY2A 1JOQA 3E0JA 4C1NI 2NVTB 3SHLA 4Q5VA 3IKJA 2A68C 5C6AA 1AZQA 3S1NB 5EPJA 2TSSA 5J1ZA 2WACA 3N6RA 3BVGA 4RHSA 1BOSA 2K5DA 4JK1C 4KY5A 4NDXA 3CQZB 5T1IA 3GTOB 3GTPB 4CGYB 2AUJD 5COYA 2A73B 2YYZA 3NTKA 3R93A 4A3DB 1F9QA 1PRTD 1IKLA 4ZRZA 1SMYD 5KNCA 4DF7A 1NR4A 1SAPA 4IUVA 3BDCA 1OXUA 1B9MA 2PNRC 4IFDJ 1I6HB 4E6IA 3PIO3 3LWUA 3K58A 3EFXD 4XTCS 1F2LA 1WCMB 3P7JA 2XRQD 1HUNA 1HQMC 3V2TA 1BBXC 4DN4M 2I07B 5FO7B 4BBRB 4FVMA 1GUOA 3NHHA 2Z4IA 3MFYA 2L0CA 1B1ZA 1Q1EA 4CKCA 4QCLA 3U9OA 1O7ZA 2EYHA 4MIUA 5IGBA 1U9RA 1STNA 2A6ED 3Q6SA 2QDBA 3BG3A 5CV9A 5KGUA 5DAUA 2K5WA 1KDBA 1A6XA 3EA6A 1S5ED 4ABNA 5CC4A 1EWCA 4M1UB 2L1BA 1G291 1JICA 5IOCA 4XT1B 4QUFA 1I4RA 1U4RA 3L3OC 2F0NA 2SDFA 1TR5A 4ULLA 4TSSA 3MXUA 1Z47A 2A74C 4HEDA 4RH6A 5CV5A 3CHBD 1SSOA 2FHTA 5CR3A 3J7AF 2AWNA 4DXFA 1KDCA 2F0EA 4K8JA 3HOXB 2D2CC 2EYMA 2X69A 2RQXA 5EKIA 4Y7NB 3MWYW 1PTOD 1I4GA 3NK9A 1A3UA 2EJGC 4X3SA 4WFN3 4A3KB 2FMCA 3AMUA 4IURA 1IL8A 5C0XJ 1MBYA 2DN8A 2RSOA 1H9SB 1SYGA 1QOHA 1CTMA 5BN5A 1EY4A 3PUVA 2EY1A 2RDHA 1J9OA 1KNEA 1I3QB 2KOLA 4BBSB 1CHQD 3A56A 3EVQA 4FO2A 1OXXK 5IGEA 3VR3A 4OO1H 1EQVA 4PMWA 3RMHA 5FLXE 1BF4A 4A3BB 5C0XI 4FNFA 1PLFA 2F4IA 1EIGA 3OSOA 4OIKA 1AW7A 1SE2A 4R8IA 1QILA 2OF1A 2F0HA 2NBFA 2SNSA 2D62A 3LX0A 3IAYA 2G9HD 2WAQB 1KLGD 4F87A 2F0SA 1GUWA 1FGBD 3H09A 2HDMA 4RGOS 3MEHA 4A93B 1HHVA 4FXKC 5EBCA 3NTIA 3VR6A 2RVLA 2D9UA 3GQBA 4DA2A 3DM1A 4HMJA 3LNNA 1B44D 3VR4A 1Y8NB 2KEEA 2DNCA 2A6EC 2VNUD 3I4LA 4RFBA 1I6VC 2R6GA 1T5XD 1VF5C 4PMCA 4RCOA 1ZYRD 1BR9A 4BA2I 1EFID 4DNTB 1X3PA 5CV6A 4CJ0B 3T13A 1BNZA 4FF2A 4FYDA 3K5OA 1PTOB 2A6HC 1EY9A 4ODGA 3PO3B 5F2DA 1JE4A 2K03A 3QG1A 3HKZB 1TU2B 1SDFA 1IHZA 2H4OA 1CHPD 4EVOA 2K28A 2M00A 2QF7A 4J8QA 4XT3B 3DMUA 4ZK9B 4G7OC 1C8CA 1PTOC 2QILA 2G9DA 4C3HB 1XWEA 3FEWX 3V96A 2DY7A 2Z4HA 3NQIA 2PMZB 2EPBA 1F2ZA 3BDOA 3Q22A 2Q8RE 5IT9E 4IUNA 2CW0D 4DK0A 2EYFA 1CZGA 5FKAC 1CFMA 3I91A 4NKLA 2EY5A 3HP3A 5ELEA 1GUTA 1SYDA 1EYCA 2AUKA 2WB1B 1RTOA 3DWPA 1D5XC 3NBIA 3TSSA 2IT1A 4U673 2WKDA 4G4KA 4RKLA 4IUUA 3PIP3 2C5CA 1Q3LA 4C56C 2IX1A 4DNRB 1GUSA 1NR2A 3T4AC 1QCBD 1U4MA 2RSNA 4UAIA 3SVMA 3OOCA 4QB4A 1GUNA 2WKCA 2F0UA 5BN4A 3PUXA 1TQOA 1TY0A 3A7LA 1HFGA 2SNMA 5I9OA 3H3VC 1SNPA 5I2YA 1II3A 1W6KA 3GV6A 1WTXA 2F0LA 5JEAJ 1DONA 2HQEA 1SJHD 1NUCA 3Q0AA 2XNAC 2ICIA 3KLSA 5EQ0A 5KIXA 5G3LF 2JXMB 1LACA 4KKSA 2B2WC 5C3XA 4KK7A 2KHSA 2K1BA 3S2HB 3A55A 2FJ2A 4RGTA 2JA7B 2F03A 3SR1A 2LS01 4RGNA 1M8AA 1UEAB 4F8MA 1EEFD 1BCPC 2NTTA 2PQEA 3SDZA 3AB9A 1ESFA 2KUMA 5EBDA 4HTHA 1CM9A 1CQVA 5JOBA 1WTRA 5K36G 4CKEA 1A3TA 2JSOA 1PZID 4HMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DAY A;  3NBH A;  3MXN A; 
#chains in the Genus database with same CATH topology
 1DM0 B;  3KBG A;  1EIY B;  4LNQ A;  4DR6 Q;  4MTK A;  4JI2 L;  3OIP A;  1I4X A;  1G2S A;  4Y52 H;  2RCN A;  5A35 A;  1PDQ A;  1Q8K A;  3W3A A;  1SE3 A;  5FJ8 G;  1RCV D;  4L5T A;  4IOC A;  1QZH A;  1L1O C;  5JJK A;  1WCM H;  5KND A;  5DM6 3;  2K33 A;  1NE3 A;  4GZY C;  1NJI C;  4QIW B;  2ZTC A;  1NY4 A;  5JPN C;  1LAB A;  3I90 A;  4XIG S;  4M8A A;  4DR5 L;  1YJN A;  3U58 A;  3DEO A;  2YTV A;  1AN8 A;  2TMP A;  2UU9 L;  3RD4 A;  4ME5 A;  3PO3 G;  1DYQ A;  1A3V A;  1X32 A;  1V1O A;  2PW5 A;  4OWW B;  4WJW A;  4KTA A;  4K8I A;  3OW7 A;  2PZU A;  3T56 B;  1S72 A;  2ZT9 C;  3OTO Q;  2I5M X;  2WII B;  1ICW A;  2VQE L;  4DU9 A;  5M5W B;  2N8N A;  2WAQ G;  1C4Q A;  4RHR A;  1CSQ A;  1RKN A;  1G6Z A;  3CME A;  1PTO H;  4X3U A;  2PNH A;  3I7F A;  4BWG B;  5C0X G;  3E6Z X;  2E2H B;  1TS4 A;  2H5X A;  5DM7 3;  1KLU D;  5C4H A;  2F1M A;  1STB A;  5D3I B;  1JC7 A;  5AJ3 L;  4QIW E;  2MPM A;  2RCF A;  5COR A;  4NPS A;  1LT3 D;  3VA5 A;  3J7Y W;  3JC6 6;  2FIN B;  4JI2 Q;  1LM0 A;  4OWX B;  3TME A;  4MHE A;  3R8B A;  3G4S A;  5IYC G;  5CV8 A;  1DJR D;  3VYT A;  5IY0 A;  1JJG A;  1GXD C;  4KY7 A;  3K5N A;  3CC2 A;  1ET6 A;  1B8A A;  1I50 B;  3EJI A;  5A2Q L;  5JJZ A;  4V19 0;  2MJ8 A;  3UDX A;  5ELB A;  4R4C A;  4AYB B;  2MO0 A;  1BDO A;  5D65 A;  2I0Q A;  3QR8 A;  4DR5 Q;  4I65 A;  3MZ5 A;  1U4L A;  4POG A;  4Z9C B;  1HR0 Q;  2AQ3 B;  4YCU A;  1B50 A;  4DV5 Q;  1B2T A;  2BA1 A;  3T51 B;  2NVT H;  2B2T C;  3CCV A;  4A3K G;  2ZXR A;  2E2J B;  1RDP D;  4DK1 A;  4CJ1 B;  1HQR D;  1Q90 A;  4DR7 Q;  1Q81 C;  2JE6 I;  4DR4 Q;  1PHJ A;  2HCC A;  3M4Q A;  2C35 B;  3HZX A;  1WOC A;  4YHH L;  1MSH A;  1OXT A;  2E2I B;  3EQL C;  1P16 A;  2K14 A;  5M9O A;  1BBW A;  2R93 B;  1IBK Q;  1HCZ A;  1FJG Q;  5KYI A;  5LMU L;  4H7B A;  1B4O A;  5AFW A;  1HR0 W;  2XN9 C;  2IX3 A;  3HOZ B;  2CHB D;  2F0F A;  4X64 Q;  1E24 A;  2D0O A;  3J81 E;  3NWT A;  1W6J A;  5K5P A;  3QIA A;  4AYB E;  1SFO H;  1E0B A;  2E74 C;  4IZ8 A;  5C4J B;  1YJW A;  4C3J B;  2LY7 A;  3D4D A;  4GLX A;  1HNX Q;  1PH9 A;  1XNQ Q;  1HZA A;  3F2D A;  2B2V C;  4PV1 C;  3BVZ A;  3VYU A;  5I9P A;  2N88 A;  1I4H A;  2UXD L;  1YVC A;  3PGZ A;  1I3Q H;  1WD0 A;  2EY6 A;  1QVC A;  3S24 A;  4LMQ D;  2MQH A;  1ENF A;  4ZQ3 A;  1AE3 A;  4DR6 L;  5D14 A;  4BS9 A;  3K57 A;  5DNF A;  2HDL A;  5J3B A;  2QCP X;  5IGC A;  3ZYY X;  1CI3 M;  5D3D A;  2E2H H;  3DWA A;  3W1B A;  4B3M L;  1TWC H;  1ENC A;  3SK8 A;  2NZH A;  4BY7 H;  3HOV G;  4QMG A;  1PMR A;  2DNE A;  2YTY A;  4A3M H;  3BVM A;  2IWH A;  2EXD A;  3MC0 B;  1PFB A;  1EY5 A;  3FKI B;  4NW2 A;  2R92 G;  2BA0 A;  4YWK A;  2NN6 I;  3OYY A;  1VQE A;  4A76 A;  1TWG B;  4C3J G;  2DY8 A;  4AYB G;  1SMX A;  2B3G A;  1RIP A;  4WJ3 M;  1VQA A;  5EGT A;  2WIN B;  4U68 A;  5IIF A;  2PZW A;  1VQP A;  2EJF C;  3BZD B;  4X62 L;  1LTG D;  1PFS A;  1S40 A;  2BH2 A;  4R8N A;  4A3B H;  5C4Z A;  3H15 A;  5FLX c;  4PMB A;  3PUZ A;  3FPU B;  4POF A;  5C3W A;  1A0I A;  2VW9 A;  2VQE Q;  1PVO A;  1F2Y A;  1LTT D;  2OXP A;  2JYO A;  3RR5 A;  2B8G A;  5HUR A;  1PRT C;  1K8O A;  3M4Y A;  2IY5 B;  4KHZ A;  1QVF A;  1A2U A;  2R7Z B;  5EKK A;  1JT8 A;  2LMC B;  4JI0 Q;  2F0V A;  4EQ5 A;  3ITP A;  5JPM C;  1A63 A;  2R7Z G;  1KAA A;  3GTM B;  2F52 A;  4HAE A;  1F77 A;  4A3E B;  1ENA A;  1JMC A;  4DAV A;  3CU7 A;  1DOK A;  2ID0 A;  1ZYR C;  2NUC A;  1Q86 C;  2Q2H A;  2F0P A;  1SBB B;  1Z7T A;  4F88 A;  3NQT A;  5FOB B;  2NZ1 D;  1G91 A;  3CPF A;  3RN2 A;  1VQ5 A;  1IW7 D;  3K0Y A;  2CH4 W;  4B08 A;  4A3K H;  3K7A B;  4IN3 A;  4A75 A;  3S16 B;  3MTS A;  4TRD A;  2Q2T A;  1OO9 B;  3J81 c;  1KAB A;  5C4X G;  3IL8 A;  1QUQ A;  2A68 D;  5EKL A;  4C3H G;  2B2Y C;  1JOR A;  4BXX H;  3NXW A;  4GKJ Q;  1B53 A;  4B3R L;  2NN6 H;  5CMD A;  3H0G G;  1ESR A;  2M2L A;  3I55 A;  2CQA A;  1E2Z A;  1E2V A;  1TWH B;  3QJY A;  3SK6 A;  4KY6 A;  4JI6 L;  2ICE C;  3D6W A;  4P2C B;  2E8G A;  3C3L A;  3HKZ E;  4DV6 L;  5I6Y A;  2FFK B;  3TDQ A;  3TP5 A;  1F9S A;  1TWF H;  3H91 A;  4LF8 L;  5FJ8 H;  4IPC A;  2V1C C;  1KNA A;  3S2D H;  1K83 H;  3GP7 A;  2GVB A;  3KJO A;  5GAH C;  2JA7 G;  1CKO A;  1WTO A;  4CKB A;  2YTX A;  3KOJ A;  4DV7 Q;  1GHK A;  1QG7 A;  4O2D A;  3H3V H;  4QUC A;  1G51 A;  1MIU A;  2UXC Q;  5CBE E;  4NXN Q;  4GOP A;  3SK5 A;  1PV4 A;  3BJU A;  5LMN Q;  4A4I A;  3TZD A;  2F0M A;  2I46 A;  4JC0 A;  3A54 A;  4B9W A;  5CV4 A;  2VQF L;  3QOL A;  3RZO B;  1WTQ A;  1HRJ A;  1IBL L;  3CC4 A;  5FLM G;  4RAU C;  5JAV A;  2EOT A;  1EWH A;  1H9S A;  3D4W A;  4IFD I;  4I7Z C;  3HOU H;  2R92 B;  1HR0 L;  3Q8D A;  1KQS A;  1PH3 A;  3IFD A;  1RHP A;  2PZT A;  5HGQ A;  4GOP C;  1JB7 A;  5IP7 G;  5JVG 3;  3CMA A;  2ENB A;  4QQB X;  1WTP A;  1HNW Q;  1KAW A;  3MVV A;  1VQD A;  3PMF A;  1HA5 A;  1LT4 D;  1PA6 A;  2B63 H;  2LXJ A;  1LT6 D;  3H0G B;  3VYS A;  1BCP B;  1V1P A;  1NBW A;  2B39 A;  4GN5 A;  5IT9 L;  1F9P A;  4N9P A;  1QNK A;  1YNN C;  2QKI C;  2LXK A;  3NEN A;  1C48 A;  1R9T H;  1X9N A;  1Y69 U;  2Z6K A;  2WAQ E;  1F2M A;  5HGT A;  3NWS A;  3S1R B;  2ZXO A;  1MJC A;  2HHH L;  2EYJ A;  1KRS A;  1MKH A;  4HCE A;  1XTC D;  3NEM A;  1U4P A;  1EZ8 A;  4A3F H;  1EY8 A;  2F0O A;  2B29 A;  5M3M H;  1UUP A;  4AQY Q;  3O13 A;  4EQO A;  3AU7 A;  3J81 L;  3HS0 C;  3S14 B;  1EQQ A;  1EIH A;  1D5Z C;  1YBY A;  1SNM A;  3PV0 A;  4A3J H;  2AWO A;  2A69 D;  4CBV A;  2CVR A;  1XPR A;  5HY6 A;  3KK7 A;  4JI1 L;  4IUQ A;  1BXT A;  1CK1 A;  1VQK A;  3I3C A;  4IFD H;  1FNV A;  3C1E A;  3SEB A;  5FLX L;  1M90 C;  1HXY D;  1J8I A;  3M4O B;  1MI2 A;  4OIJ A;  2VXW A;  2O4X A;  1ZKO A;  3AFP A;  1GUG A;  5LL6 S;  2L4N A;  4KKT A;  4FF3 A;  4DUZ L;  2OWO A;  4S3S A;  1HNW L;  2OTJ A;  1XTD A;  1WVL A;  3PUY A;  1BVS A;  3GTL B;  4RKB A;  2NN6 G;  1PH2 A;  3S1Q B;  4R4Q A;  2A69 C;  2K50 A;  3NTH A;  2E5L L;  4FF4 A;  1TWF B;  1WTW A;  4APV A;  3RZD H;  1VCI A;  3FKI G;  2KCC A;  1JCK B;  2IHE A;  3M7N A;  2K7V A;  1FNU A;  4K5X A;  1R4Q B;  2F0W A;  3IFT A;  4KD4 A;  1NAP A;  2F3W A;  2L55 A;  3RLF A;  3VA7 A;  3ULP A;  1I6H H;  3HOV H;  3CC7 A;  4DV1 L;  4LF5 L;  5C3E H;  5A2Q E;  1YJ9 A;  3S17 B;  2HCI A;  2VUM H;  3OWF A;  3NSW A;  1NMG A;  3HOZ H;  1K8G A;  4EQP A;  3QWN A;  2MFI A;  3STB D;  4DR4 L;  1T5E A;  2HT1 A;  4A3D H;  4LFA Q;  2Z6K C;  1LTR D;  2WB1 E;  5JEA G;  1VQ9 A;  1X3E A;  4KHP L;  5IYC H;  3ERQ A;  4A93 G;  1ILQ A;  1S3O A;  1C7Y A;  1Y1V H;  3OPO A;  5C4X B;  1QVG A;  1D5M C;  4J6H A;  4NXN L;  2HIX A;  3NE5 B;  3GDE A;  3GTQ H;  1B7Y B;  2H1E A;  3FMC A;  2K04 A;  1PFN A;  4FP5 D;  2BCO A;  4R9W A;  1HJP A;  2IHF A;  4AQY L;  4ZAI A;  1I4Q A;  2OT2 A;  1XYI A;  3OHX C;  5EJW A;  3G7L A;  3JAM L;  4A3L G;  3U4Z A;  4GS3 A;  4RCN A;  3D31 A;  2XTI A;  2C9O A;  1MHW C;  2YV5 A;  1S4Z A;  4HJ7 A;  3HG9 A;  1NSN S;  4C3J H;  3A74 A;  4DAY B;  3K5M A;  1EZ6 A;  1RD9 D;  2R93 G;  1RJT A;  4OON A;  4UP7 A;  4DAM A;  4WRD A;  2XVS A;  4H44 C;  4XXE A;  1N8R C;  4A3B G;  1ONL A;  3ONA B;  1STE A;  3HEJ A;  4LFA L;  1E2W A;  3J81 j;  1DD2 A;  2AMC B;  4IPG A;  2ZXP A;  2VB2 X;  2N3S A;  2BE5 D;  3FDT A;  3LGJ A;  1G6P A;  1DXM A;  4BBS G;  1XX8 A;  2JP1 A;  3I4M H;  4N8X 1;  3TS2 A;  1X6O A;  1H95 A;  5KEE A;  3C46 A;  3CCU A;  1H9J A;  4FXG C;  3NUC A;  3CF5 A;  3H6M A;  1VF7 A;  4JI3 L;  1L0Y B;  2CKZ B;  1FYC A;  5M5X B;  3S15 B;  4OEL B;  2JEA I;  3KF8 A;  5C3E B;  1BO0 A;  1X54 A;  2K75 A;  3FRP B;  1TVX A;  2X6G A;  5CBA E;  4A3I G;  5CGK A;  1VQL A;  3M3Y B;  3GTJ H;  1WI5 A;  4WOR A;  2VUM B;  1I4P A;  1A2T A;  2HHH Q;  4JYA L;  4A3E G;  2HD3 A;  5EPK A;  4KMU C;  4JI6 Q;  3DWQ A;  5E3F A;  1JOK A;  2L5T A;  1JWM D;  5ISR A;  4KN7 C;  5I2X A;  1VQ7 A;  3K0X A;  4DV3 L;  4OXP A;  2PI2 E;  4K14 A;  3S1Q H;  2RBM A;  4ZKB B;  5TSS A;  3ER0 A;  2GA4 B;  2V4D A;  2ZJQ A;  1SNO A;  3CCJ A;  1LLR D;  2PW7 A;  3PO2 B;  2ZJP A;  3A8J E;  4MN3 A;  4P73 A;  4O1N A;  2G5D A;  1PTO F;  5GAE C;  2KJX A;  1AEX A;  3P20 A;  3CPW A;  5I6W A;  2N49 A;  2KEC A;  5IGF A;  3PQI A;  2KVM A;  2N55 A;  2B2Y A;  4LK1 C;  1LTS D;  2IX0 A;  4G57 A;  4QF4 A;  3HOV B;  4UPA A;  1OXS C;  4DV1 Q;  4HR7 B;  4LJZ C;  3S14 H;  4DGZ A;  1X65 A;  3GTG H;  2J4X A;  1SLJ A;  1GHJ A;  1ZXT A;  1O80 A;  4YHH Q;  5J22 A;  5M3M B;  3RZD B;  3MA2 B;  4EGV A;  1HTL D;  1K28 A;  2XWB B;  4DK3 C;  4LAA A;  1SMY C;  1EQT A;  2F0K A;  3T16 A;  3TEH B;  1S5D D;  2Z8L A;  1Q46 A;  1GKH A;  2R61 A;  4KLK A;  1WD1 A;  4HJA A;  1Y8O B;  2B8F A;  3D6C A;  4KHP Q;  1S5F D;  1SE8 A;  2CH4 A;  2KCN A;  4DFA A;  4BBR G;  3F8T A;  5KRU A;  4PQX A;  2A5H A;  4JOI C;  3K7U C;  2UUC Q;  1I94 L;  1SRO A;  2IPK D;  4IFD G;  2K5Q A;  2MNA A;  4LF6 Q;  2SEB D;  4C3I B;  3UI2 A;  5IWA L;  4OHJ A;  4OX9 Q;  5IYD H;  2M9V A;  4QGU A;  3PO2 G;  4N8F A;  4CDD C;  4IPH A;  4DV4 Q;  3T1H Q;  1M4V A;  4JI7 Q;  1TWA H;  1SYE A;  3EIV A;  2EYP A;  4TVA B;  2F3V A;  4OX9 L;  4JBW A;  2F0D A;  5IYB H;  3D3R A;  4H0L C;  2JN4 A;  2JA5 H;  4JI8 Q;  1QB5 D;  1U0L A;  1X3Q A;  2K5V A;  3K5L A;  4CHT B;  5ELN A;  4GNX B;  3HKS A;  4GKJ L;  1EL0 A;  4J1M A;  5C44 B;  5IT9 c;  1X3G A;  3UE1 A;  4TKO B;  1O78 A;  3DEP A;  4RA8 A;  4Y7N H;  4GKK L;  1A8V A;  3F2C A;  3PSI A;  1Q12 A;  3K80 C;  4K5V A;  1EY0 A;  4ALP A;  3FPP A;  1Y1W G;  1KD1 C;  3TRZ A;  2CW0 C;  2KED A;  4HN7 A;  3ULJ A;  3OW2 A;  2BE5 C;  4AH6 A;  2VL6 A;  1EYA A;  2QEJ C;  5BN3 A;  4MZ9 A;  4BA1 I;  1CUK A;  3ND8 A;  1WJJ A;  2OCE A;  1O7Y A;  3QO2 A;  1CA5 A;  1O7L A;  3OWE B;  1IBK L;  4IAL A;  3KLS X;  2L9H A;  3FHW A;  4K2L A;  1LYL A;  2XRS D;  1HFN A;  2HQL A;  1BCP F;  1Q7Y C;  2NVQ B;  4GLA C;  5CV7 A;  4KV6 A;  3HOU B;  3HRZ C;  1BQQ T;  4OO1 I;  1TWH H;  3E9I A;  3FKI H;  4HSP A;  5FK9 C;  1YHQ A;  2NWG A;  3IRB A;  4LF7 Q;  1L1O A;  1Q1B A;  2Z9H A;  3A8I E;  3BDL A;  1HZB A;  4X64 L;  4YY3 Q;  3HOY H;  5IP7 H;  4B3T L;  4V0B A;  1MGS A;  1XNR Q;  4OL7 A;  1AZP A;  5CYU A;  2K52 A;  2CFM A;  3HFZ B;  3CAM A;  1N32 Q;  4IUT A;  2A6H D;  1YNN D;  4X3K A;  5M5Y B;  3Q23 A;  3I4N B;  4O0A A;  2B2U C;  2PPB C;  3I4M B;  3R2I A;  4PG3 A;  1MSG A;  3URY A;  4H02 A;  2EVB A;  4CJ2 C;  4DAY A;  5JEA H;  4OO1 G;  2O2L D;  2Q8T A;  5LHY 1;  3C2P A;  4C2M B;  1SR3 A;  1V1P B;  4DR3 L;  2WV6 D;  2J7Z A;  2AQ2 B;  1EOV A;  2LKV A;  3H94 A;  2D0P A;  4K6D A;  2KA7 A;  4ZUJ A;  4K6L A;  1YZ6 A;  4QL5 A;  2WB1 G;  3S2H H;  3I4M G;  3E3X A;  4HJ8 A;  3I4N G;  1KTK A;  1HPC A;  3R3O A;  5DEH A;  2ES2 A;  3ND9 A;  3CXC A;  2XWJ B;  5IGD A;  1VMC A;  3NEL A;  2B2W A;  5ELF A;  1SXT A;  3WWV A;  5NUC A;  1K73 C;  4K5W A;  1QZG A;  2R93 H;  3TRE A;  1L0X B;  2PYK A;  4P72 A;  3MXP A;  1UNS A;  1NMF A;  3GTQ B;  1N32 L;  3G6J B;  3SXH A;  4BY7 B;  1S5C D;  4FXD A;  1EOT A;  2NVX B;  4DNI A;  1EUJ A;  3V05 A;  3F2B A;  1IKM A;  2F0Q A;  4J15 A;  2MP1 A;  2K5N A;  4A3E H;  2RA4 A;  2UUB Q;  2O5J C;  5IGG A;  4LF8 Q;  2EYL A;  4KN4 C;  4GN3 B;  1YIJ A;  4JI5 Q;  3GTK B;  4LFB Q;  2Y0S E;  3CRL C;  4NP5 A;  1YI2 A;  4RMF A;  2Z0S A;  2F0T A;  3RUZ A;  3TN2 A;  5C5L A;  4IJL A;  3GD7 A;  3GTO H;  3CQZ H;  4KI0 A;  5ELD A;  4ZYS A;  3WOF A;  3W2D A;  3BS1 A;  4DUZ Q;  1STY A;  1EU3 A;  4H13 C;  4DV4 L;  3M7G A;  3Q24 A;  2F0J A;  1E1O A;  4B9X A;  2DJF C;  2SOB A;  5L37 A;  1DCZ A;  1GVP A;  2Q8I B;  2JA8 G;  3K59 A;  2KCM A;  1LTB D;  3VYR A;  3T53 B;  1IW7 C;  4G7Z C;  2CWA A;  5ELO A;  1WFQ A;  4UP9 A;  4CDF C;  1FNW A;  1XNQ L;  3I72 A;  3GTJ B;  2IW3 A;  1VQH A;  1EY7 A;  2KCT A;  3J7Z C;  4A3M B;  2R7D A;  1YNJ C;  1Q82 C;  1C9O A;  1HUM A;  2JA9 A;  4YIJ A;  3TP8 A;  1IYV A;  1VQO A;  4LUV A;  5M5X H;  3S15 H;  4A93 H;  2O5I C;  3HOW B;  4HCS A;  2EIF A;  1TKW B;  4KD3 A;  1UAP A;  3WDN A;  2PQA B;  2Y0S B;  3MFG A;  1TII D;  1JWS D;  2NVX H;  3S1M H;  1X3F A;  1VDZ A;  1H9K A;  4P74 A;  1LTI D;  4A3L H;  3ICE A;  1XPO A;  5BR8 L;  1EIF A;  1EYD A;  3ERO A;  4G7H C;  4EX5 A;  3I8Z A;  5GAG C;  3S17 H;  1TS2 A;  4R4O A;  1QE6 A;  2IJ0 A;  1YIT A;  1HA6 A;  3CRK C;  1L0W A;  2UUA Q;  2BDO A;  1H9R A;  1SND A;  3P75 A;  5LL6 X;  5E1F A;  1WTV A;  4JCV E;  1P8L A;  3CCQ A;  4X6A H;  2DUD A;  4K0K Q;  3B6Y A;  1AFP A;  2RDF A;  5C44 G;  1W3S A;  3C1F A;  2F3I A;  3KYH C;  4FDB A;  3KF8 B;  1NCV A;  2JA6 B;  4C2M H;  1H9M A;  2D5D A;  4ZKC B;  3AQQ A;  1PFM A;  1IBM Q;  2B2T A;  2LFN A;  3E0E A;  3SK4 A;  2E5L Q;  2UXB Q;  1HTP A;  5M3F H;  3KJP A;  1KC8 C;  4XYQ A;  3I4N H;  3KDF B;  1YNJ D;  2OTL A;  4C1N K;  2ZTE A;  2JA5 B;  3LWE A;  2EE1 A;  4HJ9 A;  3L7Z C;  1MJE A;  5ELC A;  4OGQ C;  3I70 A;  4IQZ A;  4LFC Q;  1TS3 A;  1VQN A;  2JA6 G;  2A1A A;  4A3C H;  2KBN A;  4XQJ A;  4DAP A;  1R4P B;  3BYT B;  1TS5 A;  2XIW A;  2K32 A;  3MXN A;  1GJX A;  2NZO A;  1PRT B;  1JB3 A;  2JA8 B;  4O42 A;  3OMC A;  2K6A A;  4LF9 L;  3J7A V;  1Y14 B;  4A3F B;  4X3T A;  1SYF A;  1BKB A;  2NVQ H;  1RL2 A;  3BYY B;  4KJN A;  3FVQ A;  4KJO A;  1R9T B;  1A15 A;  1V1Q A;  5K36 H;  5IYB G;  1LV9 A;  4XQQ A;  3UDG A;  3W1G A;  3S1R H;  1B3A A;  2UUA L;  2JQO A;  1DZ1 A;  3TP7 A;  4L6T B;  3J80 i;  2MHV A;  2B2V A;  5IOD A;  2B63 B;  3N52 A;  1ET9 A;  4A3I B;  3S2D B;  3L9A X;  1FD7 D;  4L8J A;  5C5M A;  1CT1 D;  1D6E C;  1S5B D;  3U4V A;  4EQN A;  4GOP B;  5FO8 B;  1WCM G;  1VMP A;  3ZJY C;  1J5E Q;  4XQN A;  5KNB A;  4L63 B;  4QJF A;  1XNR L;  4JVZ A;  1VQG A;  4JV5 L;  4DPG A;  1MD2 D;  2L12 A;  3P1H A;  2EYO A;  3MHB A;  1Y1W B;  1LO5 D;  4DXG A;  2YU9 H;  2FMM A;  1N33 L;  3HKZ G;  4LF7 L;  4PZ8 A;  4BY1 G;  1ROD A;  3KBX A;  1DOM A;  1VQC A;  1XMO L;  3HOY B;  2EDG A;  1QNU A;  1UE1 A;  3WOE A;  1D2B A;  1B9N A;  3F2U A;  2F0G A;  1T9H A;  2EXZ A;  4YWM A;  2B2U A;  3RZO H;  1NNX A;  5E4W C;  4JI4 Q;  3D4R A;  1EY6 A;  2IL8 A;  4JBK A;  2ZM6 Q;  1ASZ A;  3ERS X;  3HOY G;  2RKS A;  1N34 L;  3TP6 A;  2HUG A;  3NBH A;  5C0X H;  2I5H A;  5FO9 B;  1K83 B;  2EZV A;  1ILP A;  4TQU S;  1JQY D;  1AP0 A;  1STG A;  1AE2 A;  1Q8I A;  1N9W A;  3OMG A;  4LF9 Q;  4LF5 Q;  4A3G B;  1DOL A;  2PI2 A;  3NPP A;  1ZEQ X;  2E75 C;  4AIM A;  4ZCK A;  1FVI A;  4YWL A;  3S9W A;  1V8Q A;  2K01 A;  3STB C;  1PZK D;  3NP8 A;  3HGB A;  2KHI A;  3L0O A;  4ZUI A;  3TBI B;  1GOZ A;  1TT2 A;  5GAD C;  4KHV A;  3I73 A;  5IP9 G;  5C44 H;  3MAQ A;  1WYD A;  2E2D C;  4GNX C;  1SNQ A;  3AFQ A;  3KUP A;  2ZJR A;  3QOJ A;  3U9S A;  1X56 A;  3K7A H;  1SYB A;  3S16 H;  4BY1 B;  4F7X A;  5G3L D;  3PUW A;  4R1J A;  3NBH B;  4KKU A;  1V43 A;  4DR2 Q;  4XDX A;  1TWA B;  1SJE D;  5E4X A;  4DV3 Q;  4A3F G;  1D8L A;  1JWU D;  4ID6 A;  5M3F G;  1OTC A;  1Y8P B;  1SYC A;  1G2T A;  3GO5 A;  4CDE C;  2PO4 A;  4DUY L;  4FF1 A;  5KYL A;  1IYU A;  5JVH 3;  2UXD Q;  1DGS A;  1Z6H A;  2J0T D;  2NB0 A;  4JPB W;  3I4O A;  2YU9 B;  2ASB A;  4K0K L;  1Y1W H;  3DHQ A;  4JOI A;  1EEI D;  1RF2 D;  2BDN A;  3DXJ C;  3X3M A;  3HOX H;  4JG2 A;  1JOO A;  2JA7 H;  4ILW A;  4JI1 Q;  2JA6 H;  3CKI B;  3D8G A;  3F1Z A;  3KLR A;  2DJG C;  4B3R Q;  4LWC A;  3J80 E;  3A7A B;  1IBM L;  3OTO L;  5J39 A;  4K2K A;  2RF4 A;  4NB3 A;  1SEB D;  4XYO A;  1IXR A;  3VR2 A;  4N9T A;  4IUP A;  2MGS A;  1VQJ A;  4DK6 C;  2KEN A;  5C4J H;  3GTG B;  3E5S A;  1RTN A;  2Z1C A;  1D1I A;  3BZC A;  4X65 Q;  1BCP D;  2A8V A;  3M3Y H;  1FR3 A;  2OEO A;  1LT5 D;  4DR1 Q;  4YCV A;  3UDI A;  2VY3 A;  1SE4 A;  1EU4 A;  1TWC B;  3S1M B;  1Y1V B;  2KQ3 A;  3JAM E;  1UE6 A;  3OIQ A;  1V9P A;  4HSV A;  1F9R A;  4UDU C;  3HOW H;  1XMQ L;  1QWY A;  1PRT F;  1K3R A;  3R2T A;  1PYW D;  3G6E A;  3D0F A;  3DUZ A;  1ML0 D;  1VQB A;  2RDG A;  3VR5 A;  1K8M A;  1E1T A;  4NMZ A;  1PZJ D;  1STH A;  5I4D A;  4DV2 L;  1W2B A;  2Y0S G;  1G8Z D;  2X6L A;  4DUY Q;  2NYZ D;  4RGM A;  3X3N A;  1HNX L;  4ZLT F;  2ZTD A;  2ATW A;  1CA6 A;  5IE8 A;  3GTM H;  5M3F B;  1Y1V G;  2E76 C;  4Q0F A;  2EY2 A;  2MO1 A;  1GO3 E;  4A3M G;  2EJM A;  3K6O A;  2R7Z H;  1CQF A;  3CCL A;  1JR0 D;  3RLO A;  5T1G A;  2VB3 X;  1D1K A;  4PNY A;  1HZ9 A;  4GN4 B;  1K0S A;  2ZM6 L;  5H1S E;  1SFO B;  2K05 A;  2PCF B;  1BUV T;  4DV0 L;  3BZK A;  4L5Q A;  4MTN A;  2NTS A;  1I50 H;  1KDA A;  1LTA D;  3A0J A;  3GTK H;  2XSC A;  1KXL A;  3GV3 A;  1CZW A;  3TZU A;  3QB3 A;  1IYJ B;  1OXV A;  3SE0 A;  1XXG A;  1J6Q A;  4C3I G;  2NVY B;  2BOS A;  2UU9 Q;  2Z6B A;  5C4X H;  2WP8 J;  3J80 L;  4A3G G;  2R3Z A;  2F0I A;  1JJ2 A;  3MXG A;  1SNC A;  2QA4 A;  4DV2 Q;  1PH5 A;  1I94 Q;  2L11 A;  2AQ1 B;  2JEB I;  4A3J B;  5EPL A;  3M85 A;  1PXU A;  1J5E L;  1QJO A;  2MUY A;  1XPU A;  1STA A;  3A8K E;  4RWS C;  1TY2 A;  1JOQ A;  1PYB A;  1SRU A;  3E0J A;  3JAM c;  4C1N I;  2NVT B;  2R7F A;  4GLV B;  4B3T Q;  3SHL A;  4Q5V A;  2F4V Q;  3IKJ A;  4LF4 Q;  2A68 C;  1CSP A;  3KFU A;  4P75 A;  5C6A A;  1KHI A;  2LSS A;  1AZQ A;  1D7Q A;  3KDF A;  3S1N H;  3S1N B;  1X55 A;  2OQK A;  5EPJ A;  2TSS A;  3DM3 A;  4BXX G;  3G48 A;  4IPD A;  1PYS B;  5J1Z A;  2WAC A;  1HZC A;  1FGU A;  3N6R A;  3BVG A;  4RHS A;  1BOS A;  2Q2U A;  3PO3 H;  2K5D A;  4DV0 Q;  3PF5 A;  4JK1 C;  4KY5 A;  4NDX A;  3CQZ B;  5T1I A;  3GTO B;  1YHA A;  3RNU A;  3GTP B;  4BY7 G;  4CGY B;  2PQA A;  2AUJ D;  5COY A;  2A73 B;  2YYZ A;  3NTK A;  3R93 A;  2JK8 A;  4JI3 Q;  4GKK Q;  4A3D B;  1F9Q A;  1PRT D;  1IKL A;  4B3S Q;  1N33 Q;  4ZRZ A;  1SMY D;  5KNC A;  4DF7 A;  3MEF A;  5EAY A;  1NR4 A;  1SAP A;  3J7A 5;  2QW7 A;  4IUV A;  1KL9 A;  3BDC A;  3KF6 A;  1OXU A;  1EFW A;  4A3D G;  1B9M A;  2PNR C;  4IFD J;  3BU2 A;  4E6I A;  1I6H B;  3PIO 3;  3G71 A;  4DR2 L;  3LWU A;  3K58 A;  2AHO B;  1PH8 A;  3EFX D;  3MXN B;  3UDF A;  5DLQ E;  4XTC S;  4LFB L;  2UXC L;  4OEM B;  1N36 Q;  1F2L A;  1WCM B;  3P7J A;  4PZ7 A;  3A5U A;  1VQF A;  4BBS H;  2XRQ D;  1HUN A;  1HQM C;  1TXY A;  3V2T A;  1BBX C;  4DN4 M;  2I07 B;  4CDC C;  4GNX A;  1PH1 A;  5FO7 B;  4BBR B;  4FVM A;  1GUO A;  3NHH A;  2Z4I A;  3MFY A;  1E22 A;  2L0C A;  1B1Z A;  1Q1E A;  4CKC A;  4QCL A;  4R4I A;  4B3S L;  2UXB L;  2DGY A;  3U9O A;  1O7Z A;  2EYH A;  4MIU A;  5IGB A;  1K8A C;  1U9R A;  1STN A;  2A6E D;  3Q6S A;  3DLL A;  2QDB A;  5M5Y H;  1JJC B;  5GRO A;  3BG3 A;  3CCS A;  3I2Z A;  5CV9 A;  5KGU A;  4WJ4 A;  5DAU A;  2K5W A;  1KDB A;  1A6X A;  1PH4 A;  3EA6 A;  4LUO A;  4C3I H;  2VQF Q;  4JBJ A;  1S5E D;  4ABN A;  5CC4 A;  5IYD G;  2PMZ E;  1EWC A;  4M1U B;  1ICF B;  2L1B A;  1G29 1;  2L15 A;  1JIC A;  5IOC A;  4NXM Q;  4XT1 B;  1VQ6 A;  3ULL A;  3W5O A;  3VDY A;  2JA5 G;  3E9H A;  4QUF A;  1EQR A;  1E3P A;  1I4R A;  1U4R A;  1UE5 A;  3L3O C;  1N36 L;  2F0N A;  2SDF A;  1TR5 A;  3K8A A;  4ULL A;  3M9B A;  4TSS A;  3MXU A;  1Z47 A;  4X62 Q;  2A74 C;  4HED A;  4RH6 A;  5CV5 A;  4RG1 A;  5BR8 Q;  1VS0 A;  3CHB D;  4A3I H;  1SSO A;  2FHT A;  5CR3 A;  3J7A F;  2AWN A;  4DXF A;  1KDC A;  3HOZ G;  2F0E A;  4K8J A;  1VQ8 A;  1IBL Q;  1L1O B;  3L2P A;  3HOX B;  2VS1 A;  4LW1 A;  2D2C C;  2EYM A;  4JI5 L;  2X69 A;  2RQX A;  5EKI A;  4Y7N B;  2F4V L;  3MWY W;  1KIX A;  3T1H L;  1PTO D;  3HOU G;  3KLW A;  1I4G A;  3NK9 A;  1A3U A;  4JYA Q;  2EJG C;  4X3S A;  4WFN 3;  1K0R A;  1UEB A;  4NXM L;  4A3K B;  2FMC A;  3AMU A;  4IUR A;  3PCO B;  4L5S A;  1IL8 A;  5C0X J;  1NTG A;  3GTP H;  2RHQ B;  1MBY A;  4YY3 L;  2DN8 A;  2RSO A;  2B63 G;  1H9S B;  1SYG A;  1QOH A;  2BH8 A;  3CP0 A;  1CTM A;  3CW2 C;  5BN5 A;  1EY4 A;  2K5H A;  2EY1 A;  3PUV A;  2RDH A;  4DR3 Q;  1J9O A;  1KNE A;  1I3Q B;  2KOL A;  1K9M C;  4BBS B;  1CHQ D;  3A56 A;  3EVQ A;  1CKN B;  4FO2 A;  2QEX A;  3JAM i;  1OXX K;  5IGE A;  1YNX A;  3VR3 A;  4OO1 H;  2ALY B;  2GVA A;  1EQV A;  4PMW A;  3PIP A;  4UY8 C;  3RMH A;  1HNZ Q;  5FLX E;  1B70 B;  1BF4 A;  4A3B B;  5C0X I;  2HIV A;  4FNF A;  1PLF A;  3CCE A;  4DV5 L;  2F4I A;  1EIG A;  3OSO A;  4DV6 Q;  4OIK A;  3I56 A;  4X66 Q;  3T1Y Q;  1AW7 A;  2OQ0 A;  1SE2 A;  3PIO A;  4DR1 L;  2XGT A;  5E7N A;  4R8I A;  1QIL A;  1L2F A;  2OF1 A;  2F0H A;  2NBF A;  2SNS A;  2D62 A;  3LX0 A;  2E2I H;  4A3C G;  4JI0 L;  3IAY A;  2G9H D;  4HJ5 A;  2WAQ B;  3K81 C;  1KLG D;  4F87 A;  2F0S A;  1GUW A;  1IZ6 A;  1FGB D;  2NVY H;  3H09 A;  4MNO A;  3CCM A;  5LMU Q;  3RN5 A;  2HDM A;  4RGO S;  3PO2 H;  3MEH A;  4A93 B;  1HHV A;  5LMN L;  4FXK C;  4DKA C;  2Q2I A;  1LUZ A;  5EBC A;  2QGQ A;  3NTI A;  4C3H H;  3VR6 A;  2FXQ A;  3M4P A;  2RVL A;  2D9U A;  3TQY A;  1K3B C;  3GQB A;  2I5L X;  2KHJ A;  4DA2 A;  3DM1 A;  4HMJ A;  1A62 A;  3LNN A;  1Z9F A;  1B44 D;  1WTH A;  4JW0 A;  3VR4 A;  5C3E G;  1Y8N B;  4R4T A;  2KEE A;  4B3M Q;  4UP8 A;  4LFC L;  1TWG H;  2A6E C;  2DNC A;  3SGI A;  2VNU D;  3I4L A;  4RFB A;  3HOW G;  2JA8 H;  1I6V C;  2R6G A;  1T5X D;  1VQI A;  1VF5 C;  4PMC A;  4L5R C;  4RCO A;  3AEV A;  1ZYR D;  2CCZ A;  4LUZ A;  1BR9 A;  4X66 L;  3T1Y L;  3H3V I;  4HID A;  4OWT B;  4BA2 I;  1EFI D;  4DNT B;  1X3P A;  5CV6 A;  4CJ0 B;  4JBM A;  4IOA A;  2N78 A;  1XJV A;  1JE5 A;  3T13 A;  3CD6 A;  1BNZ A;  2AKW B;  2K4K A;  4FF2 A;  1HNZ L;  4X65 L;  1B3Q A;  4FYD A;  3K5O A;  1PTO B;  2A6H C;  1EY9 A;  4ODG A;  4YCW A;  3PO3 B;  5F2D A;  1JE4 A;  1I5F A;  2K03 A;  3QG1 A;  3HKZ B;  1HH2 P;  1TU2 B;  1IL2 A;  1SDF A;  1QUQ B;  2GN5 A;  1IHZ A;  2H4O A;  1CHP D;  4EVO A;  2K28 A;  4ME3 A;  2M00 A;  2QF7 A;  1E7Z A;  4J8Q A;  4XT3 B;  3CCR A;  3DMU A;  4IJH A;  4ZK9 B;  1CKN A;  4G7O C;  1C8C A;  1PTO C;  2QIL A;  2G9D A;  4C3H B;  1CKM A;  1XWE A;  4QY7 A;  3FEW X;  3V96 A;  2VZA A;  2DY7 A;  1UWV A;  1M1K C;  2Z4H A;  3NQI A;  1EYG A;  1EWI A;  2PMZ B;  3EBE A;  2EPB A;  1F2Z A;  1XMO Q;  2A19 A;  3BDO A;  1SN8 A;  3Q22 A;  2Q8R E;  5IT9 E;  5JJL A;  4JV5 Q;  3FP9 A;  4IUN A;  1VQ4 A;  2CW0 D;  4DK0 A;  1FL0 A;  2EYF A;  1CZG A;  5FKA C;  1CFM A;  3I91 A;  4NKL A;  2EY5 A;  3HP3 A;  5ELE A;  5M3M G;  1GUT A;  1SYD A;  1EYC A;  1FJG L;  2AUK A;  2WB1 B;  1RTO A;  3HOX G;  2E2J H;  4A3J G;  3DWP A;  1D5X C;  4HIO A;  5JJI A;  3NBI A;  3TSS A;  2IT1 A;  4U67 3;  2WKD A;  4G4K A;  4RKL A;  5M5W H;  1ASY A;  1YEZ A;  4IUU A;  3TS0 A;  3PIP 3;  2C5C A;  3KF6 B;  1U5K A;  1Q3L A;  4C56 C;  2UUC L;  2IX1 A;  3H0G H;  1GD7 A;  1PH6 A;  2QDL A;  4DNR B;  1C0A A;  5AJ3 Q;  1GUS A;  1NR2 A;  3T4A C;  4I7A A;  1QCB D;  4DV7 L;  2UUB L;  3UE0 A;  1U4M A;  2RSN A;  4UAI A;  1LTL A;  3GTL H;  3SVM A;  3OOC A;  4QB4 A;  1GUN A;  2WKC A;  2F0U A;  5BN4 A;  3PUX A;  5GQO A;  1KRT A;  1TQO A;  1VQM A;  1TY0 A;  2R92 H;  3A7L A;  1HFG A;  2SNM A;  5I9O A;  4HIM A;  3H3V C;  1SNP A;  5I2Y A;  2CQO A;  4UHV A;  3M4O H;  1II3 A;  5IWA Q;  1W6K A;  4LF6 L;  2VUM G;  3GV6 A;  2CWP A;  2EQS A;  4P71 A;  1AH9 A;  3AYH B;  1WTX A;  2F0L A;  5JEA J;  1DON A;  1PH7 A;  4IO9 A;  3A5Z B;  2HQE A;  1SJH D;  4BY1 H;  1N34 Q;  4DR7 L;  5FLM H;  2WFW A;  3J80 c;  1NUC A;  3Q0A A;  2XNA C;  2ICI A;  3KLS A;  1XMQ Q;  5EQ0 A;  5KIX A;  5G3L F;  2JXM B;  1LAC A;  3RLN A;  4KKS A;  2B2W C;  5C3X A;  4KK7 A;  2KHS A;  2K1B A;  3S2H B;  4BBR H;  5LMN W;  3A55 A;  3PF4 A;  3EN2 A;  2FJ2 A;  3U50 C;  1BBU A;  4RGT A;  3J81 i;  2JA7 B;  2F03 A;  3SR1 A;  1O7I A;  2LS0 1;  4RGN A;  4A3G H;  1M8A A;  1UEA B;  1UE7 A;  1YHB A;  2JJQ A;  2RHS B;  4F8M A;  1EEF D;  1BCP C;  2NTT A;  2PQE A;  5IP9 H;  4PZ6 A;  4HIK A;  4JI8 L;  3SDZ A;  3AB9 A;  1ESF A;  2KUM A;  4JI4 L;  5EBD A;  4HTH A;  1CM9 A;  1CQV A;  5JOB A;  1WTR A;  1GM5 A;  4CKE A;  4LF4 L;  1A3T A;  2JSO A;  5K36 G;  1PZI D;  2P5Z X;  4HMI A;  4JI7 L; 
#chains in the Genus database with same CATH homology
 1DM0 B;  3KBG A;  3OIP A;  1I4X A;  1G2S A;  5A35 A;  1PDQ A;  3W3A A;  1SE3 A;  1RCV D;  5KND A;  5DM6 3;  2K33 A;  4GZY C;  4QIW B;  5JPN C;  1LAB A;  3I90 A;  4XIG S;  4M8A A;  3DEO A;  1AN8 A;  2TMP A;  3RD4 A;  4ME5 A;  1DYQ A;  1A3V A;  1X32 A;  1V1O A;  2PW5 A;  4WJW A;  4KTA A;  4K8I A;  3OW7 A;  2PZU A;  3T56 B;  2ZT9 C;  2WII B;  1ICW A;  4DU9 A;  5M5W B;  1C4Q A;  4RHR A;  1RKN A;  1G6Z A;  1PTO H;  4X3U A;  4BWG B;  5C0X G;  3E6Z X;  2E2H B;  1TS4 A;  5DM7 3;  1KLU D;  5C4H A;  2F1M A;  1STB A;  5D3I B;  1JC7 A;  2MPM A;  5COR A;  1LT3 D;  3VA5 A;  3J7Y W;  2FIN B;  3TME A;  4MHE A;  3R8B A;  5CV8 A;  1DJR D;  3VYT A;  1GXD C;  4KY7 A;  3K5N A;  1ET6 A;  1I50 B;  3EJI A;  5A2Q L;  5JJZ A;  4V19 0;  2MJ8 A;  5ELB A;  4AYB B;  1BDO A;  5D65 A;  4I65 A;  3MZ5 A;  1U4L A;  4Z9C B;  2AQ3 B;  1B50 A;  1B2T A;  2BA1 A;  3T51 B;  2B2T C;  2ZXR A;  2E2J B;  1RDP D;  4DK1 A;  4CJ1 B;  1HQR D;  1Q90 A;  2JE6 I;  2HCC A;  3HZX A;  1MSH A;  1OXT A;  2E2I B;  3EQL C;  5M9O A;  2R93 B;  1HCZ A;  5KYI A;  4H7B A;  1B4O A;  5AFW A;  2XN9 C;  2IX3 A;  3HOZ B;  2CHB D;  2F0F A;  3J81 E;  3NWT A;  1W6J A;  5K5P A;  3QIA A;  1E0B A;  2E74 C;  4IZ8 A;  5C4J B;  4C3J B;  2LY7 A;  3D4D A;  2B2V C;  4PV1 C;  3BVZ A;  3VYU A;  5I9P A;  2N88 A;  1I4H A;  1WD0 A;  2EY6 A;  4LMQ D;  1ENF A;  4ZQ3 A;  5D14 A;  4BS9 A;  3K57 A;  5DNF A;  2HDL A;  2QCP X;  5IGC A;  3ZYY X;  1CI3 M;  5D3D A;  3DWA A;  1ENC A;  3SK8 A;  4QMG A;  1PMR A;  2DNE A;  3BVM A;  2IWH A;  3MC0 B;  1PFB A;  1EY5 A;  3FKI B;  4NW2 A;  2BA0 A;  2NN6 I;  1TWG B;  4C3J G;  2DY8 A;  5EGT A;  2WIN B;  4U68 A;  5IIF A;  2PZW A;  2EJF C;  3BZD B;  1LTG D;  4R8N A;  5C4Z A;  4PMB A;  3PUZ A;  3FPU B;  5C3W A;  1F2Y A;  1LTT D;  2OXP A;  2JYO A;  2B8G A;  5HUR A;  1PRT C;  1K8O A;  3M4Y A;  4KHZ A;  1A2U A;  2R7Z B;  5EKK A;  2LMC B;  2F0V A;  3ITP A;  5JPM C;  1KAA A;  3GTM B;  4HAE A;  1F77 A;  4A3E B;  1ENA A;  4DAV A;  3CU7 A;  1DOK A;  2ID0 A;  1ZYR C;  2NUC A;  2F0P A;  1SBB B;  1Z7T A;  4F88 A;  3NQT A;  5FOB B;  2NZ1 D;  1G91 A;  1IW7 D;  3K0Y A;  4B08 A;  3K7A B;  4IN3 A;  3S16 B;  3MTS A;  4TRD A;  1OO9 B;  1KAB A;  3IL8 A;  2A68 D;  5EKL A;  4C3H G;  2B2Y C;  1JOR A;  3NXW A;  1B53 A;  2NN6 H;  5CMD A;  1ESR A;  2M2L A;  2CQA A;  1E2Z A;  1E2V A;  1TWH B;  3QJY A;  3SK6 A;  4KY6 A;  2ICE C;  3D6W A;  4P2C B;  3C3L A;  5I6Y A;  2FFK B;  3TDQ A;  3TP5 A;  1F9S A;  3H91 A;  1KNA A;  3GP7 A;  1WTO A;  4CKB A;  1GHK A;  1QG7 A;  4QUC A;  5CBE E;  3SK5 A;  3TZD A;  2F0M A;  2I46 A;  3A54 A;  4B9W A;  5CV4 A;  3QOL A;  3RZO B;  1WTQ A;  1HRJ A;  4RAU C;  5JAV A;  2EOT A;  1EWH A;  1H9S A;  3D4W A;  4IFD I;  4I7Z C;  2R92 B;  3IFD A;  1RHP A;  2PZT A;  5JVG 3;  2ENB A;  1WTP A;  3MVV A;  3PMF A;  1HA5 A;  1LT4 D;  1LT6 D;  3H0G B;  3VYS A;  1BCP B;  1V1P A;  2B39 A;  5IT9 L;  1F9P A;  4N9P A;  1QNK A;  1YNN C;  2QKI C;  1C48 A;  1Y69 U;  1F2M A;  5HGT A;  3NWS A;  3S1R B;  2ZXO A;  2EYJ A;  4HCE A;  1XTC D;  1U4P A;  1EZ8 A;  1EY8 A;  2F0O A;  1UUP A;  4EQO A;  3O13 A;  3AU7 A;  3J81 L;  3HS0 C;  3S14 B;  1EIH A;  1D5Z C;  1SNM A;  3PV0 A;  2AWO A;  2A69 D;  4CBV A;  2CVR A;  3KK7 A;  4IUQ A;  1BXT A;  1CK1 A;  3I3C A;  4IFD H;  1FNV A;  3C1E A;  3SEB A;  5FLX L;  1HXY D;  1J8I A;  3M4O B;  1MI2 A;  4OIJ A;  2VXW A;  2O4X A;  1ZKO A;  1GUG A;  5LL6 S;  2L4N A;  4KKT A;  4FF3 A;  4S3S A;  1WVL A;  3PUY A;  3GTL B;  4RKB A;  2NN6 G;  3S1Q B;  2A69 C;  3NTH A;  4FF4 A;  1TWF B;  1WTW A;  1VCI A;  2KCC A;  1JCK B;  3M7N A;  2K7V A;  1FNU A;  4K5X A;  1R4Q B;  2F0W A;  3IFT A;  4KD4 A;  1NAP A;  2F3W A;  2L55 A;  3RLF A;  3VA7 A;  5A2Q E;  3S17 B;  2HCI A;  3OWF A;  3NSW A;  4EQP A;  3QWN A;  1T5E A;  1LTR D;  5JEA G;  3ERQ A;  1ILQ A;  3OPO A;  5C4X B;  1D5M C;  4J6H A;  3NE5 B;  2H1E A;  3FMC A;  2K04 A;  1PFN A;  4FP5 D;  2BCO A;  4R9W A;  4ZAI A;  1I4Q A;  2OT2 A;  1XYI A;  3OHX C;  5EJW A;  3G7L A;  3JAM L;  4RCN A;  3D31 A;  2C9O A;  1S4Z A;  3HG9 A;  1NSN S;  3K5M A;  1EZ6 A;  1RD9 D;  1RJT A;  4WRD A;  2XVS A;  4H44 C;  4XXE A;  1ONL A;  3ONA B;  1STE A;  3HEJ A;  1E2W A;  1DD2 A;  2ZXP A;  2VB2 X;  2BE5 D;  3FDT A;  1DXM A;  1XX8 A;  2JP1 A;  5KEE A;  3C46 A;  1H9J A;  4FXG C;  3NUC A;  3H6M A;  1VF7 A;  1L0Y B;  1FYC A;  5M5X B;  3S15 B;  2JEA I;  3KF8 A;  5C3E B;  1BO0 A;  3FRP B;  5CBA E;  1TVX A;  2X6G A;  3M3Y B;  5CGK A;  4WOR A;  2VUM B;  1I4P A;  1A2T A;  5EPK A;  4KMU C;  3DWQ A;  5E3F A;  1JOK A;  2L5T A;  1JWM D;  5ISR A;  4KN7 C;  5I2X A;  4K14 A;  2RBM A;  4ZKB B;  5TSS A;  2GA4 B;  2V4D A;  1SNO A;  1LLR D;  2PW7 A;  3PO2 B;  3A8J E;  4MN3 A;  4O1N A;  1PTO F;  2KJX A;  1AEX A;  3P20 A;  5I6W A;  2KEC A;  5IGF A;  2KVM A;  2N55 A;  2B2Y A;  4LK1 C;  1LTS D;  2IX0 A;  4G57 A;  4QF4 A;  3HOV B;  1OXS C;  4HR7 B;  4LJZ C;  4DGZ A;  2J4X A;  1GHJ A;  1ZXT A;  1O80 A;  5J22 A;  5M3M B;  3RZD B;  3MA2 B;  4EGV A;  1HTL D;  2XWB B;  4LAA A;  1SMY C;  1EQT A;  2F0K A;  3T16 A;  1S5D D;  2Z8L A;  2R61 A;  1WD1 A;  1Y8O B;  2B8F A;  3D6C A;  1S5F D;  4DFA A;  2KCN A;  5KRU A;  4PQX A;  2A5H A;  2IPK D;  4IFD G;  2K5Q A;  2SEB D;  4C3I B;  3UI2 A;  4OHJ A;  2M9V A;  1M4V A;  1SYE A;  2EYP A;  2F3V A;  4JBW A;  2F0D A;  3D3R A;  4H0L C;  1QB5 D;  1X3Q A;  3K5L A;  4CHT B;  1EL0 A;  4J1M A;  5C44 B;  4TKO B;  1O78 A;  3DEP A;  4RA8 A;  1Q12 A;  4K5V A;  1EY0 A;  3FPP A;  2CW0 C;  2KED A;  4HN7 A;  2BE5 C;  1EYA A;  2QEJ C;  5BN3 A;  4BA1 I;  3ND8 A;  1O7Y A;  3QO2 A;  1CA5 A;  1O7L A;  3OWE B;  4IAL A;  3KLS X;  2L9H A;  4K2L A;  1HFN A;  2XRS D;  1BCP F;  2NVQ B;  5CV7 A;  4KV6 A;  3HOU B;  3HRZ C;  1BQQ T;  4OO1 I;  4HSP A;  5FK9 C;  2NWG A;  1Q1B A;  3A8I E;  3BDL A;  4V0B A;  1MGS A;  4OL7 A;  1AZP A;  5CYU A;  4IUT A;  2A6H D;  1YNN D;  4X3K A;  5M5Y B;  3Q23 A;  3I4N B;  2B2U C;  2PPB C;  3I4M B;  3R2I A;  1MSG A;  3URY A;  4DAY A;  5JEA H;  2EVB A;  4CJ2 C;  4OO1 G;  2O2L D;  2Q8T A;  5LHY 1;  3C2P A;  4C2M B;  1V1P B;  2WV6 D;  2J7Z A;  2AQ2 B;  2LKV A;  3H94 A;  4K6D A;  2KA7 A;  4ZUJ A;  4K6L A;  1KTK A;  1HPC A;  3R3O A;  5DEH A;  3ND9 A;  2XWJ B;  5IGD A;  1VMC A;  2B2W A;  5ELF A;  1SXT A;  5NUC A;  4K5W A;  1L0X B;  2PYK A;  3MXP A;  1UNS A;  3GTQ B;  3G6J B;  3SXH A;  4BY7 B;  1S5C D;  4FXD A;  1EOT A;  2NVX B;  3V05 A;  1IKM A;  2F0Q A;  2MP1 A;  2RA4 A;  2O5J C;  5IGG A;  2EYL A;  4KN4 C;  3GTK B;  3CRL C;  4NP5 A;  2F0T A;  3RUZ A;  3TN2 A;  5C5L A;  3GD7 A;  4KI0 A;  5ELD A;  4ZYS A;  3WOF A;  3BS1 A;  3W2D A;  1STY A;  1EU3 A;  4H13 C;  3M7G A;  3Q24 A;  2F0J A;  4B9X A;  2SOB A;  1DCZ A;  2Q8I B;  3K59 A;  1LTB D;  3VYR A;  3T53 B;  1IW7 C;  4G7Z C;  1FNW A;  3I72 A;  3GTJ B;  2IW3 A;  1EY7 A;  4A3M B;  1YNJ C;  4YIJ A;  1HUM A;  1IYV A;  3TP8 A;  2O5I C;  3HOW B;  4HCS A;  1TKW B;  4KD3 A;  1UAP A;  3WDN A;  2Y0S B;  3MFG A;  1TII D;  1JWS D;  1VDZ A;  1H9K A;  1LTI D;  1EYD A;  3ERO A;  4G7H C;  3I8Z A;  1TS2 A;  1QE6 A;  2IJ0 A;  1HA6 A;  3CRK C;  2BDO A;  1H9R A;  1SND A;  3P75 A;  5LL6 X;  5E1F A;  1WTV A;  1AFP A;  2RDF A;  3C1F A;  1NCV A;  2JA6 B;  1H9M A;  2D5D A;  4ZKC B;  1PFM A;  2B2T A;  2LFN A;  3SK4 A;  1HTP A;  4XYQ A;  1YNJ D;  4C1N K;  2JA5 B;  3LWE A;  2EE1 A;  3L7Z C;  5ELC A;  4OGQ C;  3I70 A;  4IQZ A;  1TS3 A;  4XQJ A;  4DAP A;  1R4P B;  3BYT B;  1TS5 A;  2XIW A;  2K32 A;  3MXN A;  1GJX A;  1PRT B;  1JB3 A;  2JA8 B;  4O42 A;  3OMC A;  2K6A A;  3J7A V;  4A3F B;  4X3T A;  1SYF A;  4KJN A;  3BYY B;  3FVQ A;  4KJO A;  1R9T B;  1A15 A;  5K36 H;  1LV9 A;  4XQQ A;  1B3A A;  1DZ1 A;  3TP7 A;  4L6T B;  2MHV A;  2B2V A;  5IOD A;  2B63 B;  3N52 A;  1ET9 A;  4A3I B;  3S2D B;  3L9A X;  1FD7 D;  4L8J A;  5C5M A;  1CT1 D;  1D6E C;  1S5B D;  4EQN A;  5FO8 B;  1VMP A;  4XQN A;  5KNB A;  4L63 B;  1MD2 D;  2L12 A;  3P1H A;  2EYO A;  3MHB A;  1Y1W B;  1LO5 D;  4DXG A;  2FMM A;  1ROD A;  3KBX A;  1DOM A;  3HOY B;  2EDG A;  1QNU A;  3WOE A;  1D2B A;  1B9N A;  3F2U A;  2F0G A;  2EXZ A;  2B2U A;  5E4W C;  3D4R A;  1EY6 A;  2IL8 A;  2RKS A;  3TP6 A;  2HUG A;  3NBH A;  5C0X H;  5FO9 B;  1K83 B;  2EZV A;  1ILP A;  4TQU S;  1JQY D;  1AP0 A;  1STG A;  1Q8I A;  3OMG A;  4A3G B;  1DOL A;  3NPP A;  1ZEQ X;  2E75 C;  3S9W A;  1V8Q A;  2K01 A;  1PZK D;  3NP8 A;  3HGB A;  4ZUI A;  3TBI B;  1GOZ A;  1TT2 A;  4KHV A;  3I73 A;  3MAQ A;  2E2D C;  1SNQ A;  3KUP A;  3QOJ A;  3U9S A;  1SYB A;  4BY1 B;  4F7X A;  5G3L D;  3PUW A;  4KKU A;  1V43 A;  4XDX A;  1TWA B;  1SJE D;  5E4X A;  1JWU D;  4ID6 A;  1Y8P B;  1SYC A;  1G2T A;  3GO5 A;  2PO4 A;  4FF1 A;  5KYL A;  1IYU A;  5JVH 3;  1Z6H A;  2J0T D;  2NB0 A;  2YU9 B;  3DHQ A;  1EEI D;  1RF2 D;  2BDN A;  3DXJ C;  3X3M A;  1JOO A;  4ILW A;  3CKI B;  3D8G A;  3KLR A;  3J80 E;  3A7A B;  5J39 A;  4K2K A;  1SEB D;  4XYO A;  3VR2 A;  4N9T A;  4IUP A;  2MGS A;  3GTG B;  3E5S A;  1RTN A;  2Z1C A;  1D1I A;  1BCP D;  1FR3 A;  2OEO A;  1LT5 D;  1SE4 A;  1EU4 A;  1TWC B;  3S1M B;  1Y1V B;  2KQ3 A;  3JAM E;  3OIQ A;  4HSV A;  1F9R A;  4UDU C;  1QWY A;  1PRT F;  3R2T A;  1PYW D;  3DUZ A;  1ML0 D;  2RDG A;  3VR5 A;  1K8M A;  4NMZ A;  1PZJ D;  1STH A;  5I4D A;  1G8Z D;  2X6L A;  2NYZ D;  4RGM A;  3X3N A;  4ZLT F;  1CA6 A;  5M3F B;  2E76 C;  4Q0F A;  2EY2 A;  2EJM A;  3K6O A;  1CQF A;  1JR0 D;  5T1G A;  2VB3 X;  1D1K A;  4PNY A;  1SFO B;  2K05 A;  2PCF B;  1BUV T;  2NTS A;  1KDA A;  1LTA D;  2XSC A;  3GV3 A;  1CZW A;  3TZU A;  3QB3 A;  1OXV A;  3SE0 A;  1XXG A;  4C3I G;  2NVY B;  2BOS A;  2WP8 J;  3J80 L;  2R3Z A;  2F0I A;  3MXG A;  1SNC A;  2L11 A;  2AQ1 B;  2JEB I;  4A3J B;  5EPL A;  3M85 A;  1PXU A;  1QJO A;  2MUY A;  1STA A;  3A8K E;  4RWS C;  1TY2 A;  1JOQ A;  3E0J A;  4C1N I;  2NVT B;  3SHL A;  4Q5V A;  3IKJ A;  2A68 C;  5C6A A;  1AZQ A;  3S1N B;  5EPJ A;  2TSS A;  5J1Z A;  2WAC A;  3N6R A;  3BVG A;  4RHS A;  1BOS A;  2K5D A;  4JK1 C;  4KY5 A;  4NDX A;  3CQZ B;  5T1I A;  3GTO B;  3GTP B;  4CGY B;  2AUJ D;  5COY A;  2A73 B;  2YYZ A;  3NTK A;  3R93 A;  4A3D B;  1F9Q A;  1PRT D;  1IKL A;  4ZRZ A;  1SMY D;  5KNC A;  4DF7 A;  1NR4 A;  1SAP A;  4IUV A;  3BDC A;  1OXU A;  1B9M A;  2PNR C;  4IFD J;  1I6H B;  4E6I A;  3PIO 3;  3LWU A;  3K58 A;  3EFX D;  4XTC S;  1F2L A;  1WCM B;  3P7J A;  2XRQ D;  1HUN A;  1HQM C;  3V2T A;  1BBX C;  4DN4 M;  2I07 B;  5FO7 B;  4BBR B;  4FVM A;  1GUO A;  3NHH A;  2Z4I A;  3MFY A;  2L0C A;  1B1Z A;  1Q1E A;  4CKC A;  4QCL A;  3U9O A;  1O7Z A;  2EYH A;  4MIU A;  5IGB A;  1U9R A;  1STN A;  2A6E D;  3Q6S A;  2QDB A;  3BG3 A;  5CV9 A;  5KGU A;  5DAU A;  2K5W A;  1KDB A;  1A6X A;  3EA6 A;  1S5E D;  4ABN A;  5CC4 A;  1EWC A;  4M1U B;  2L1B A;  1G29 1;  1JIC A;  5IOC A;  4XT1 B;  4QUF A;  1I4R A;  1U4R A;  3L3O C;  2F0N A;  2SDF A;  1TR5 A;  4ULL A;  4TSS A;  3MXU A;  1Z47 A;  2A74 C;  4HED A;  4RH6 A;  5CV5 A;  3CHB D;  1SSO A;  2FHT A;  5CR3 A;  3J7A F;  2AWN A;  4DXF A;  1KDC A;  2F0E A;  4K8J A;  3HOX B;  2D2C C;  2EYM A;  2X69 A;  2RQX A;  5EKI A;  4Y7N B;  3MWY W;  1PTO D;  1I4G A;  3NK9 A;  1A3U A;  2EJG C;  4X3S A;  4WFN 3;  4A3K B;  2FMC A;  3AMU A;  4IUR A;  1IL8 A;  5C0X J;  1MBY A;  2DN8 A;  2RSO A;  1H9S B;  1SYG A;  1QOH A;  1CTM A;  5BN5 A;  1EY4 A;  3PUV A;  2EY1 A;  2RDH A;  1J9O A;  1KNE A;  1I3Q B;  2KOL A;  4BBS B;  1CHQ D;  3A56 A;  3EVQ A;  4FO2 A;  1OXX K;  5IGE A;  3VR3 A;  4OO1 H;  1EQV A;  4PMW A;  3RMH A;  5FLX E;  1BF4 A;  4A3B B;  5C0X I;  4FNF A;  1PLF A;  2F4I A;  1EIG A;  3OSO A;  4OIK A;  1AW7 A;  1SE2 A;  4R8I A;  1QIL A;  2OF1 A;  2F0H A;  2NBF A;  2SNS A;  2D62 A;  3LX0 A;  3IAY A;  2G9H D;  2WAQ B;  1KLG D;  4F87 A;  2F0S A;  1GUW A;  1FGB D;  3H09 A;  2HDM A;  4RGO S;  3MEH A;  4A93 B;  1HHV A;  4FXK C;  5EBC A;  3NTI A;  3VR6 A;  2RVL A;  2D9U A;  3GQB A;  4DA2 A;  3DM1 A;  4HMJ A;  3LNN A;  1B44 D;  3VR4 A;  1Y8N B;  2KEE A;  2DNC A;  2A6E C;  2VNU D;  3I4L A;  4RFB A;  1I6V C;  2R6G A;  1T5X D;  1VF5 C;  4PMC A;  4RCO A;  1ZYR D;  1BR9 A;  4BA2 I;  1EFI D;  4DNT B;  1X3P A;  5CV6 A;  4CJ0 B;  3T13 A;  1BNZ A;  4FF2 A;  4FYD A;  3K5O A;  1PTO B;  2A6H C;  1EY9 A;  4ODG A;  3PO3 B;  5F2D A;  1JE4 A;  2K03 A;  3QG1 A;  3HKZ B;  1TU2 B;  1SDF A;  1IHZ A;  2H4O A;  1CHP D;  4EVO A;  2K28 A;  2M00 A;  2QF7 A;  4J8Q A;  4XT3 B;  3DMU A;  4ZK9 B;  4G7O C;  1C8C A;  1PTO C;  2QIL A;  2G9D A;  4C3H B;  1XWE A;  3FEW X;  3V96 A;  2DY7 A;  2Z4H A;  3NQI A;  2PMZ B;  2EPB A;  1F2Z A;  3BDO A;  3Q22 A;  2Q8R E;  5IT9 E;  4IUN A;  2CW0 D;  4DK0 A;  2EYF A;  1CZG A;  5FKA C;  1CFM A;  3I91 A;  4NKL A;  2EY5 A;  3HP3 A;  5ELE A;  1GUT A;  1SYD A;  1EYC A;  2AUK A;  2WB1 B;  1RTO A;  3DWP A;  1D5X C;  3NBI A;  3TSS A;  2IT1 A;  4U67 3;  2WKD A;  4G4K A;  4RKL A;  4IUU A;  3PIP 3;  2C5C A;  1Q3L A;  4C56 C;  2IX1 A;  4DNR B;  1GUS A;  1NR2 A;  3T4A C;  1QCB D;  1U4M A;  2RSN A;  4UAI A;  3SVM A;  3OOC A;  4QB4 A;  1GUN A;  2WKC A;  2F0U A;  5BN4 A;  3PUX A;  1TQO A;  1TY0 A;  3A7L A;  1HFG A;  2SNM A;  5I9O A;  3H3V C;  1SNP A;  5I2Y A;  1II3 A;  1W6K A;  3GV6 A;  1WTX A;  2F0L A;  5JEA J;  1DON A;  2HQE A;  1SJH D;  1NUC A;  3Q0A A;  2XNA C;  2ICI A;  3KLS A;  5EQ0 A;  5KIX A;  5G3L F;  2JXM B;  1LAC A;  4KKS A;  2B2W C;  5C3X A;  4KK7 A;  2KHS A;  2K1B A;  3S2H B;  3A55 A;  2FJ2 A;  4RGT A;  2JA7 B;  2F03 A;  3SR1 A;  2LS0 1;  4RGN A;  1M8A A;  1UEA B;  4F8M A;  1EEF D;  1BCP C;  2NTT A;  2PQE A;  3SDZ A;  3AB9 A;  1ESF A;  2KUM A;  5EBD A;  4HTH A;  1CM9 A;  1CQV A;  5JOB A;  1WTR A;  5K36 G;  4CKE A;  1A3T A;  2JSO A;  1PZI D;  4HMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...