4DAYA

Crystal structure of the rmi core complex with mm2 peptide from fancm
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
144
structure length
144
Chain Sequence
IAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RecQ-mediated genome instability protein 1
publication title Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
total genus 35
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dayA01
3NBHA 4DAYA 3MXNA
chains in the Genus database with same CATH superfamily
1ET9A 1EU3A 3KBXA 3RN2A 4KY7A 1CHPD 1I94L 1HZ9A 5IODA 4DV6Q 4OHJA 2F0IA 3G71A 3M7GA 1OXXK 2JA7G 1IBLL 1IYUA 5KEEA 3MVVA 2JA6G 2UUBQ 1VQPA 5CV7A 5HGQA 1SE2A 4HIDA 1XTCD 1IBKL 5LMNL 3KFUA 1BXTA 1JCKB 2XN9C 2NZ1D 5M3MG 2CKZB 1KAAA 1FVIA 1FGUA 5J22A 3A54A 2UXBL 4A3DB 1EWHA 1KDBA 1XXGA 4YY3Q 1SROA 1TY0A 5CGKA 4A3FB 2VY3A 3K5NA 4POGA 2XRQD 1CT1D 4WRDA 3GP7A 1HTPA 1SYGA 4XYQA 1QVGA 4IPGA 4MZ9A 3NENA 4A3EB 2EYPA 3EA6A 1XPUA 3R2TA 2YYZA 3EFXD 5DNFA 1AEXA 4A93B 2A6EC 4POFA 5GAGC 3I90A 4A3DH 4A3GG 4M8AA 4A3FH 1PVOA 2BOSA 3K0XA 4X66Q 2F0VA 2L12A 2FJ2A 4Z9CB 3DWQA 1PYBA 5IYDG 1SR3A 5C3EB 2I46A 5J3BA 5CBAE 4IJLA 1X56A 2WKDA 4DF7A 1YNXA 4LW1A 4A93H 3GTKB 1F2YA 4JI0Q 1PRTD 4L63B 3UE1A 1UE6A 2VZAA 1QILA 4GOPC 2F03A 1EWIA 2KHJA 4LFAQ 4BY1G 2MQHA 5ELNA 2QEXA 1EEID 3IFTA 1TWFB 5CV8A 4A3DG 3CCMA 1U4PA 2LY7A 4X64Q 4GLXA 3W3AA 2ZJRA 4O1NA 4RGTA 5C3EH 1C9OA 3GDEA 2SNMA 1YVCA 4DV3L 2CWPA 3GTKH 1VQDA 2A69C 3BZDB 4LUVA 3SXHA 3CRLC 5GROA 4A3EG 4DR1L 1ET6A 3TQYA 1PH7A 5TSSA 3A55A 5ISRA 2GVBA 3VR4A 3SR1A 5KYIA 5EGTA 1V1PB 4IUNA 1TWFH 2R61A 4ODGA 2R92G 1IZ6A 4JI4L 2PZWA 4U673 3SEBA 4A3BB 4ME3A 1F9PA 2KUMA 1XYIA 4A3CH 4CKCA 4B3SL 1YHBA 1VQJA 2V1CC 4IN3A 5I6YA 3OW7A 1EYAA 2MFIA 4DPGA 3BDLA 4QJFA 1ZYRC 1EQVA 3BDOA 5LMUL 3S2HB 2B2YC 2CVRA 3OYYA 5EKIA 2N78A 1L2FA 4IURA 1I3QB 3P75A 5CBEE 2AWOA 3NTIA 3KLSX 4A3BH 1B50A 3SDZA 2R6GA 4HR7B 2F0FA 4OIKA 2H5XA 2IHFA 3A5ZB 2O4XA 4HJ8A 2ZJQA 2DGYA 3H3VH 3R93A 1HQMC 3GQBA 2B8FA 1CK1A 4GKJL 3HOVB 3MXUA 1QZHA 2NTSA 4IUPA 2HHHL 1E2ZA 5M5XH 2L0CA 1I4PA 2JE6I 1KLGD 4IUVA 4ZCKA 4HJ9A 2VNUD 2E76C 4DV3Q 4GLAC 3Q6SA 1Q86C 1BCPF 1W3SA 3I2ZA 4NW2A 1P16A 2JA9A 1CI3M 3MZ5A 1O7ZA 1ENCA 4DR4L 4JI8L 2Y0SE 4N9PA 5M5YH 1O78A 2F0TA 3R3OA 3A7AB 2F0UA 1Q7YC 2KJXA 3G7LA 4ABNA 1X3GA 2IX0A 4ZUIA 1D6EC 1MD2D 2R7DA 1GUNA 4UPAA 4Q5VA 2CQOA 3P20A 1ONLA 3TZDA 1YHAA 3F2DA 1AH9A 3QOLA 4RCNA 1EQRA 1H9MA 2WB1G 1KC8C 3H15A 4OL7A 1U5KA 3Q24A 1B8AA 4GNXB 4DR2Q 3F2UA 1KTKA 4KHPQ 4OONA 4LF6Q 2KA7A 4N8FA 3WDNA 1T9HA 1U0LA 1ENAA 4RMFA 4EGVA 1G2TA 4IPDA 4FVMA 3S16H 5EKKA 1ICWA 4FYDA 2Q2IA 3EIVA 5IT9c 1HR0L 4QMGA 5K5PA 1S5DD 3HOVG 2TSSA 5JEAH 4KJOA 4L5QA 1YZ6A 5IT9E 2BCOA 1TQOA 1EY9A 2UXCL 2YTVA 4TVAB 1DXMA 3P7JA 1Z7TA 3J7AF 4LJZC 3T1HL 5KNDA 4PMCA 3RD4A 4NXML 1A15A 3R2IA 1SN8A 2F0SA 1NNXA 2RCFA 1NSNS 2VB2X 3VR5A 3KF8B 1TWGB 4HAEA 1PMRA 3LWUA 3W2DA 2VUMB 2QEJC 4LF5Q 2KECA 2EZVA 4DXFA 1TT2A 4XT1B 1Y14B 3OHXC 1C7YA 1HNXQ 2JYOA 4LAAA 3DEPA 3OMCA 1IYVA 4PV1C 3J7YW 3OWFA 1H95A 2LXJA 1DJRD 1R4PB 3KUPA 4IO9A 4HMIA 2M00A 3T56B 3N6RA 3S1RB 3H3VC 3NK9A 2Z4IA 1I50B 1MBYA 1SNQA 2C35B 3NBHB 3N52A 1PH6A 4GKKQ 1XTDA 5FLXc 5D3DA 3TBIB 1FJGL 3P1HA 2VUMH 3LWEA 2K52A 2CWAA 3HOXH 3SHLA 4WJWA 4RKBA 4ZRZA 1VQ9A 1E2WA 4FDBA 3IAYA 1VF5C 1WTPA 2MUYA 2E75C 2Q8RE 3BDCA 3S1RH 1WCMG 3I70A 1I50H 1TVXA 1HR0Q 2CFMA 4HIMA 2RVLA 2PQEA 3A74A 3NBIA 5IYBG 1S5BD 1A0IA 5CC4A 2UU9Q 1PXUA 1EEFD 1CFMA 4A3LH 2I5LX 2L15A 2ZM6Q 1X9NA 1V1OA 3HP3A 4JCVE 4HJ7A 1ESRA 3VA7A 4NXMQ 4BXXH 3I55A 3GTQB 5C5MA 2DY7A 3MEHA 4JI3Q 2F0DA 3T1YL 1YHQA 4CGYB 4UP9A 1I5FA 1LYLA 4DV1Q 3ITPA 1HZBA 3NWSA 2MP1A 2DJFC 2K5DA 5IWAQ 1VQKA 1NAPA 3AU7A 3FKIG 5EPKA 5ELEA 2Z0SA 3T51B 1D8LA 5IGEA 3E0JA 5GAEC 2IX1A 3TEHB 3ERQA 4LF7L 1HCZA 4EQNA 4JOIA 3FHWA 4UDUC 4WJ4A 4KHZA 4XIGS 4HTHA 2UXDQ 3KDFB 3UDXA 1LT4D 3I72A 4CKEA 3GTQH 4B9WA 2F0MA 2JA5B 4DUYQ 2E2HB 4A3LG 4UAIA 1NBWA 4GNXC 3KLRA 2B2UA 2K5VA 5C0XH 2A74C 2B2YA 5GQOA 1TWCH 4DR3L 1BVSA 4A3IB 2KCNA 1BCPB 2KHIA 1WD1A 5I9OA 5C44B 3AQQA 1JOOA 1VQ5A 3T13A 4QQBX 2MNAA 5G3LD 2D9UA 1YNNC 4DAMA 1PH8A 5DAUA 3K8AA 3HEJA 1O7IA 1VQIA 3I4LA 3L7ZC 3ER0A 1RHPA 2JA5H 1YIJA 4AQYQ 2E2HH 1SYEA 5JJKA 1DOLA 2F0EA 4R4OA 3NQIA 3BS1A 1KDAA 1TR5A 3F8TA 3KLSA 4JV5L 1XMOL 3H94A 1K8AC 3CRKC 2NN6G 3A56A 4GN3B 4RG1A 1Q12A 5FK9C 3E5SA 4R4IA 2A8VA 1F2MA 3D6CA 1WYDA 5C44H 3BU2A 1G91A 4P75A 1LTAD 3QO2A 2EJFC 4HSPA 5IE8A 2NBFA 4F88A 4A3KB 4LF4Q 4X3KA 2IL8A 4ZUJA 1HNZQ 1Q1BA 2KBNA 2NVTH 2YU9B 1OXVA 1LUZA 3CU7A 3TMEA 3TN2A 2RHQB 5CR3A 3SK8A 3J81E 4NDXA 3M4PA 5I2YA 1EOTA 4AYBE 5IP7G 1CHQD 1XMQQ 2FINB 4LF7Q 1ILPA 4OWXB 4OX9Q 2D5DA 2F3VA 3H09A 1C0AA 2JA5G 1E1OA 1AE2A 1CKNB 2L1BA 5IGGA 1FD7D 2B63H 3T53B 4A3KH 2UUAL 2QW7A 3TP7A 5ELCA 4EX5A 2AQ3B 1ASZA 3K81C 4A3IG 2PCFB 3AEVA 2YU9H 3JAML 2CQAA 3PIP3 3DMUA 1J8IA 4E6IA 4ZKBB 1SNPA 1LT3D 4JYAL 2Z6KA 4LFCL 1OO9B 1N32L 3H6MA 4ZQ3A 2F0GA 1YEZA 1Y1VB 4C3JB 5ELBA 5C3XA 1LTRD 3B6YA 4WJ3M 1LTLA 1IKMA 3O13A 1SE3A 3M9BA 2HIVA 1PH9A 1YNND 1B2TA 1LTTD 2RBMA 5JPMC 3BYYB 3HG9A 1XMOQ 1VQGA 4DV6L 3MTSA 2PMZB 3MFGA 2EXDA 1RJTA 1Q1EA 4H02A 1EQQA 2UUBL 5FLMH 1PZID 1QUQB 1Y8PB 1Y1VH 3STBD 2JA7B 4KD3A 4F8MA 4CBVA 3RLFA 1EYGA 2AWNA 4O0AA 5EPLA 4RH6A 3TP5A 2EY2A 1A62A 2F0QA 4IPCA 1VQFA 4K0KQ 3T16A 3LGJA 2CW0C 4OIJA 1DOKA 4YY3L 2WAQE 1F9SA 2H4OA 5HY6A 4A76A 1LTSD 1FNVA 3M4YA 4JI1Q 1K8MA 2A73B 3BVMA 1MGSA 1PTOD 3KLWA 3L0OA 3HOUH 3E0EA 4QUCA 1PH2A 3S1QB 1A6XA 3OTOQ 1SMXA 4UHVA 4DNRB 2VB3X 1Y8OB 2LFNA 3FDTA 4B3TQ 2C9OA 2XIWA 2JA7H 1HZCA 1WJJA 4DV2Q 2JA6H 1SLJA 1BCPC 4IZ8A 3U9OA 4K6LA 4IFDJ 2A19A 2XVSA 4XQJA 4R9WA 2EYHA 4C3JG 1KABA 1NJIC 5M3MH 3CPFA 3J81L 4O2DA 1FNUA 1JB3A 2RDHA 4RHSA 4X66L 1FYCA 1B70B 3DM1A 4A3GB 3S1QH 1VQ6A 2KHSA 5HURA 1EWCA 3CPWA 2X69A 4YWKA 2QILA 5JAVA 4OWTB 2QF7A 1V43A 1QZGA 1PDQA 1IL8A 2B2WC 5FO9B 1BBXC 1ASYA 2AUJD 1EZ6A 2XWJB 4QY7A 1FNWA 5FKAC 5A35A 4KK7A 4JI0L 2F0HA 3J80L 2F4IA 3HOYG 3OIQA 5DM73 4LFAL 2C5CA 4A3GH 2DUDA 2IJ0A 3S14B 1HFGA 4V0BA 1NR4A 2RSNA 5C4ZA 4X64L 1M4VA 2I5HA 5DM63 1LTGD 4YHHQ 4BY1B 3BVZA 1VF7A 3JAMi 1EL0A 3UI2A 4S3SA 1B9NA 4BY7G 3K58A 3I4NB 5IYDH 1Z9FA 3QB3A 2LSSA 1BDOA 2VL6A 5D14A 1DD2A 2JJQA 3D0FA 3A0JA 2LS01 1WTOA 3L3OC 1U9RA 4JI6Q 2VS1A 3HKZE 3E6ZX 5E3FA 1IW7C 1PYSB 1SE8A 1H9SB 1PH3A 3S14H 4BA1I 4BY1H 1RD9D 4GNXA 2E5LQ 2IW3A 3NPPA 4IFDG 2R92B 5IYCG 1PYWD 1KHIA 5FJ8G 1RKNA 2D62A 4XQNA 2HUGA 3MXNB 1X65A 3V96A 4KJNA 2F0NA 4KKTA 5C4XB 2SOBA 1YBYA 4A3EH 4KHVA 1X3EA 3I8ZA 1D1IA 3L9AX 2PQAA 3KF6B 1G51A 5LL6X 4DV7Q 2OTLA 2JA8G 1K3BC 3RMHA 2R92H 1SMYC 2AUKA 1KQSA 4ZLTF 3PO3G 1B7YB 2NB0A 2EY6A 1GUWA 5CORA 1Q8IA 4KV6A 1D5ZC 1D1KA 2OQKA 3KYHC 5NUCA 5F2DA 4FXDA 2VQFQ 3I4NG 1EY4A 3IRBA 2O2LD 5C4XH 3CCEA 1V8QA 1E2VA 1MKHA 1VMCA 2ID0A 3C1FA 3TP6A 1CQVA 1R9TB 3J7ZC 2R7ZG 3J81i 1Q82C 4P71A 5I6WA 4C3IG 3VYSA 3A8IE 4OEMB 4UY8C 3MC0B 4EQOA 1UAPA 2IPKD 2NYZD 1A63A 1B3AA 5GAHC 3SK6A 1HFNA 5CMDA 3PO2B 5IGDA 3PUVA 2DNCA 1W6KA 2K7VA 1LABA 3M85A 2LMCB 3SVMA 3J80i 1SNDA 1DONA 4CDCC 1C4QA 2FXQA 1R9TH 3J7A5 1EY5A 2A6ED 4ZYSA 4BBRG 1PHJA 5C4XG 4JBKA 5M9OA 2EPBA 5EQ0A 1VCIA 3GTGB 2BDOA 2K32A 1HR0W 2JXMB 1GUTA 3DWAA 2HQEA 1L0XB 3LNNA 2J4XA 2QA4A 4DR2L 2WB1B 4KHPL 4C1NI 2F1MA 2Y0SG 4LF6L 3GTMB 2PPBC 4MN3A 2B8GA 4N9TA 4Q0FA 3SGIA 2M9VA 1OXSC 2AHOB 3CCJA 1S5CD 3BJUA 1G6PA 2K6AA 3S2HH 2F0OA 5D3IB 3GTJB 1TIID 3CMAA 3GTGH 3IFDA 3K80C 3F1ZA 1I3QH 2EXZA 4ZAIA 4JI5Q 1LLRD 4ALPA 3ULJA 3C2PA 3GTMH 1NR2A 1YNJC 3CP0A 1E3PA 2EOTA 4B3MQ 1C48A 3K7UC 4DK1A 4JI7Q 4K2KA 1J6QA 4B3RQ 1XX8A 3EVQA 2O5IC 3PO2G 3FVQA 4LF5L 3ULLA 2A69D 2NTTA 4IPHA 2B2TC 4PMBA 1HNXL 1Y8NB 3NEMA 5E4WC 3GTJH 1I4RA 5J39A 2QCPX 3KJPA 1WTXA 3HOVH 3DUZA 1QJOA 4DGZA 1FL0A 4LF9Q 1GHKA 3I3CA 1I6VC 3PQIA 1JORA 1UNSA 4FXGC 1EYDA 2F0JA 5CV4A 1AZQA 2M2LA 2RHSB 2BDNA 4L8JA 2E74C 3CF5A 4DUZQ 4GKKL 4R4QA 5ELFA 1WVLA 2D0OA 3PUWA 2F4VQ 2B2VA 1GHJA 2Z9HA 4L6TB 5JEAJ 2F3WA 5D65A 1ZYRD 4OXPA 1NTGA 5AFWA 4H0LC 2FMCA 2XNAC 1JJGA 3FEWX 4X65Q 1O7LA 1QB5D 2A5HA 1VQOA 1MJCA 5JJLA 1SXTA 2CH4A 2K03A 3PIPA 4UP8A 5ELDA 1LM0A 1LO5D 2IX3A 3SE0A 2SEBD 1WCMB 1G8ZD 2KOLA 3RUZA 1JWMD 1NCVA 3GTOB 2UU9L 4NB3A 1DM0B 5CV9A 3HRZC 2ZM6L 3UDFA 1HPCA 1N9WA 1SEBD 5BN5A 1EIGA 3S15B 1JE4A 4JG2A 2Q2HA 2EYLA 1HJPA 4JI2Q 4JI3L 1JT8A 3BZKA 1VQHA 3CCUA 1JWSD 4QIWB 1I6HB 2DY8A 2I5MX 4DV1L 2NZOA 1E1TA 2J0TD 1X3PA 4K6DA 5IWAL 2NVXB 4YCUA 1M1KC 5IIFA 1KLUD 3HGBA 1WCMH 4N8X1 1DYQA 3EQLC 3D3RA 4H44C 3FKIB 2VQEQ 3GTOH 3S24A 1K3RA 1W2BA 4HJAA 4CHTB 2UXDL 5IYBH 1QNUA 3FMCA 2QDLA 3S15H 4DUYL 1S5ED 4GLVB 2E2DC 1F77A 1J5EQ 4X6AH 1SFOB 4CJ0B 1TWGH 1F2ZA 4KKUA 4KI0A 4JW0A 3UDGA 3AMUA 3MHBA 1N34Q 3PIO3 2NVXH 4JBWA 1JMCA 1RIPA 3M4QA 4A75A 5FLXE 1G291 1CZGA 2OXPA 3K0YA 1BNZA 1XNRQ 1SJED 3FKIH 3DHQA 2J7ZA 1A3VA 1UUPA 2IWHA 4KY5A 3CHBD 5JJZA 1J9OA 2V4DA 1RTNA 1TWAB 3RLNA 4DR5Q 2EYJA 4AQYL 3TDQA 4GOPA 4XDXA 1SFOH 1GJXA 4TQUS 4DV5Q 4AH6A 1CSQA 4K2LA 3QWNA 3J7AV 3PGZA 3MAQA 4B08A 4DK6C 3D4RA 4HN7A 2D2CC 4LF4L 1HNZL 2ZXOA 3K57A 4L5SA 3DWPA 2Z8LA 4LF8Q 1ILQA 4LFBQ 3CXCA 3U58A 3FRPB 4IOAA 1XPRA 2ZXPA 1D5MC 5E1FA 3KK7A 5C0XJ 4H13C 4DK3C 1XMQL 3HS0C 4OX9L 1YITA 3SK5A 2R93B 3G48A 5IT9L 1KRSA 2A1AA 5EBCA 5BR8L 4ID6A 3AFPA 4KKSA 2UUCQ 4A4IA 2NN6H 1UE1A 4Y7NB 2FFKB 3ICEA 3M3YB 3Q22A 3CMEA 1P8LA 1SDFA 1JWUD 3I7FA 4FF1A 3AB9A 4KLKA 4G57A 3MA2B 4K8JA 5E7NA 3M4OB 2HQLA 1EIYB 1VS0A 1H9KA 1KL9A 4LUOA 2KCCA 2NN6I 1HNWQ 3F2BA 3S1MB 1K28A 1UE7A 4ZKCB 5IP7H 3AFQA 4DN4M 4IOCA 1BOSA 5LL6S 2K5QA 2JSOA 4Y7NH 2EYOA 1K0RA 2XTIA 3D6WA 1NMFA 1HXYD 2HT1A 4A3IH 2K33A 1GUSA 4DR7Q 4BA2I 1UEAB 3M4OH 3DXJC 1EUJA 1TU2B 3RZDB 5FLXL 4A3JB 2HCIA 3G6JB 4F7XA 2D0PA 1IYJB 2IY5B 3I91A 4R4TA 4RHRA 2NVYB 4DV0Q 2ZTCA 4NXNL 3VR2A 1XNQQ 1QE6A 1NUCA 3D8GA 4GS3A 2XRSD 4K0KL 3V2TA 5FOBB 2R93G 1HA6A 1H9SA 1L0YB 4XQQA 1VQNA 1I4XA 3A8KE 2B2TA 3OWEB 4JI1L 3W1GA 3CQZB 1N36Q 1N33Q 1EY6A 3I56A 3OTOL 5BR8Q 1G2SA 1VQ7A 2RDGA 4B3TL 5A2QE 4JVZA 3X3NA 1VQEA 2WP8J 3KOJA 3UE0A 4DV2L 2NVYH 2MPMA 2ZTDA 1GOZA 2DNEA 4HSVA 4DAYB 3OMGA 1STEA 4K14A 1WTRA 5EPJA 4HJ5A 2NWGA 4P72A 1Y69U 3KF6A 3QIAA 1JQYD 4C3HG 5KYLA 3CQZH 4AIMA 2OWOA 5K36G 3PUYA 2WAQG 3OPOA 1U4RA 3HFZB 1XWEA 2ENBA 4DR6Q 2YTXA 2EQSA 1VMPA 4RFBA 5IGFA 4R8IA 1MI2A 1I4HA 4J1MA 1WTQA 3MWYW 3OIPA 4A3JG 2EYFA 3GTPB 3VYUA 4J8QA 4FP5D 2PW5A 3S2DB 5ELOA 1HZAA 1T5XD 5EAYA 4YCWA 2L9HA 3NTHA 3HOYB 4C3JH 4JK1C 3C1EA 2QGQA 4FF3A 4A3MB 4NXNQ 1SE4A 3S9WA 4YHHL 2X6LA 1B1ZA 1V1PA 2F0PA 3S17B 1RCVD 4ILWA 1EQTA 1CUKA 3GTLB 4NKLA 4DAVA 1WTWA 2I0QA 2YV5A 4DV4Q 3VR3A 2OEOA 3S2DH 4BY7B 4ME5A 4PZ8A 1CKOA 1IHZA 1IL2A 2A68C 1BF4A 4JI6L 3HOYH 2BH2A 3EJIA 2ALYB 4ZK9B 1Y1WB 5E4XA 4FF2A 2F0KA 3ONAB 2GA4B 1A8VA 1L0WA 4HMJA 2DJGC 2PNHA 1QWYA 5CV6A 2E5LL 2QDBA 2QKIC 1WTVA 1YJWA 3HZXA 3NQTA 4DK0A 2IT1A 3S17H 5G3LF 3GTLH 2AKWB 2N8NA 4QCLA 4CDDC 1TS4A 4X62Q 3L2PA 1QVFA 3PF4A 2VXWA 4OO1I 4BY7H 2E2JH 1YJNA 2CCZA 1L1OB 2B39A 1JE5A 2WV6D 1VQ8A 1IBMQ 4LNQA 4R1JA 3ULPA 5IP9G 3KBGA 3EN2A 5JVG3 3ND9A 3K5LA 1Y1WH 2SDFA 4FO2A 1KIXA 3HKZG 2WIIB 3BG3A 2G9DA 4DV7L 1O7YA 3Q0AA 3CC4A 4OO1G 4A3MG 1Q46A 3VR6A 5DEHA 1S4ZA 1B9MA 2JA8B 4IFDH 1TS5A 2R7FA 1MJEA 5IYCH 3PO3B 5FJ8H 1X3QA 4G7HC 2AMCB 2VQFL 2RQXA 1PZJD 3IL8A 3VYRA 2P5ZX 3H0GG 2JP1A 2BA0A 4I65A 3D31A 4IFDI 4PNYA 5IOCA 3GV6A 4J15A 1EOVA 1Y1WG 1KNAA 2CW0D 3K5OA 1JB7A 2R7ZB 4KMUC 3OW2A 5C6AA 4C3IB 3TZUA 2JA8H 1PFSA 2F0WA 5M3FG 2KENA 2RCNA 3PO3H 1M90C 3HOZG 4O42A 4RGNA 1DCZA 4XXEA 4DNIA 2A68D 4R8NA 1A3UA 2N88A 1XPOA 3HKSA 2K50A 2HD3A 2LXKA 3I4NH 3CD6A 2PMZE 2ICEC 1BCPD 3X3MA 2JN4A 1Q81C 4MTKA 2Q8IB 2WINB 4MHEA 4WORA 3MFYA 2R7ZH 1IKLA 2K05A 1KD1C 4JBMA 4BBRB 1UEBA 4C3IH 4G7ZC 5JPNC 2VW9A 4QB4A 2BA1A 1AFPA 1CKMA 1EY7A 1ICFB 2F52A 1JJ2A 5EJWA 3GV3A 1RODA 2Y0SB 3E9IA 3A7LA 3BVGA 4RKLA 1PH5A 1RL2A 1TXYA 3RN5A 3PIOA 3ERSX 3U4VA 1KDCA 3KF8A 4RAUC 1CSPA 2EE1A 5KIXA 1I4GA 4OWWB 1NY4A 1UWVA 4BBRH 1Q8KA 2RDFA 1I94Q 2ASBA 1SBBB 2OQ0A 4JI5L 2PO4A 5KGUA 1IBLQ 5IGBA 1PTOF 2H1EA 5DLQE 1CTMA 2MJ8A 1D5XC 4B3ML 4JI7L 1HRJA 1IBKQ 4H7BA 4RWSC 4B3RL 5LMNQ 1M8AA 4TSSA 3NBHA 2Q2TA 1EY8A 1GUOA 4A3FG 2UXBQ 1K83B 2NZHA 2O5JC 1KXLA 2AQ1B 2L11A 1QG7A 3BZCA 4EQPA 2EJMA 3C3LA 1WTHA 4LF9L 1IW7D 3PMFA 5COYA 3TSSA 5T1IA 1L1OC 2PNRC 1SYFA 4A93G 3V05A 4DUZL 1YI2A 4Y52H 2N3SA 4JOIC 1JR0D 2F4VL 2FMMA 1X55A 4EVOA 4TRDA 5GADC 1DZ1A 2DN8A 3DLLA 2LKVA 4K5WA 1K83H 2A6HC 2ZJPA 2RSOA 4V190 4MNOA 3PO2H 1KNEA 2HCCA 2N55A 1BBWA 1AN8A 4X65L 4GZYC 2B2UC 3U50C 1Z47A 1STAA 5C3EG 1A2TA 3I73A 1SNCA 2K5NA 1HH2P 4YCVA 4DU9A 3MXPA 5M5XB 4L5RC 1SAPA 1SMYD 1BUVT 1K8OA 1QCBD 2I07B 1SSOA 5C3WA 1UE5A 1KAWA 3GO5A 3PV0A 1LTID 3TS2A 2FHTA 1GXDC 2K1BA 4APVA 1MSHA 4JI2L 3KDFA 2KCTA 4A3CG 1XJVA 4CDEC 1K8GA 5M5YB 2PZTA 2ZT9C 3NUCA 1GO3E 1PH1A 1A3TA 1JJCB 5J1ZA 1E7ZA 2K4KA 4R4CA 2JQOA 3IKJA 3NTKA 5KNCA 4OELB 3UDIA 1VQMA 3MXGA 2VQEL 4PQXA 4IUTA 3MEFA 2K5WA 2E2IB 3CC7A 3W5OA 1Q90A 5EKLA 4KTAA 1JICA 4TKOB 3H3VI 4RGOS 3WWVA 4DR1Q 1LTBD 3NP8A 2BE5C 1CQFA 2RF4A 3PUXA 3QR8A 1ESFA 4KN7C 4DKAC 5I2XA 4A3BG 1WI5A 2EIFA 1V1QA 1VQCA 1GM5A 1J5EL 3TRZA 1JOQA 1W6JA 3K5MA 1K9MC 1N34L 4JI4Q 3E9HA 2JK8A 2Z1CA 4MIUA 3CCQA 2GVAA 1EFID 4B3SQ 1BQQT 3NE5B 4I7ZC 3WOEA 3S16B 1PRTF 1XNRL 2B2WA 3Q8DA 2E2IH 5LMUQ 2JEBI 1X6OA 2A6HD 2PI2E 2Z6BA 2ES2A 5KNBA 4XTCS 5IGCA 4DR5L 4NMZA 1EIHA 4QGUA 1CM9A 2K14A 2Z6KC 4NP5A 5CV5A 3NXWA 4B9XA 1SYBA 4XT3B 1QNKA 4XYOA 2XGTA 4KN4C 4DV5L 4U68A 3RZOB 1X3FA 4DFAA 3PSIA 4RA8A 4DNTB 5BN3A 4HEDA 1VQBA 3RR5A 3DEOA 1CKNA 3PF5A 1PZKD 4HIOA 1ENFA 2WFWA 1ZEQX 5JOBA 1EFWA 2KCMA 4LF8L 5I9PA 4LFBL 1DOMA 1TY2A 4GKJQ 1PFBA 1YNJD 5HGTA 2PQAB 3TP8A 5AJ3L 1OXUA 2HHHQ 2L4NA 4P73A 4DAYA 2K04A 3QOJA 2WB1E 3RZOH 1BO0A 3F2CA 2WACA 4IUQA 1LT5D 1VQLA 1AE3A 2Q2UA 2UUCL 4DR4Q 4JI8Q 5LHY1 2MO1A 4FNFA 3HOXB 2Z4HA 1I6HH 1WFQA 3T4AC 4CJ2C 1PTOB 2MO0A 2XWBB 1EIFA 1TWHB 2RA4A 2EJGC 2BE5D 1G6ZA 4J6HA 3AYHB 1HA5A 3VDYA 3CCRA 1D2BA 5JEAG 4L5TA 1JOKA 3NWTA 5L37A 1PLFA 4PG3A 4CDFC 3KJOA 1HNWL 4RCOA 1QOHA 1QUQA 4AYBB 5FO7B 2EY5A 1OTCA 4KY6A 4BS9A 1A2UA 1B4OA 1PTOH 4C56C 1TWHH 4DR7L 3NSWA 1AW7A 1FR3A 2Q8TA 1HUNA 1NMGA 4YIJA 3CCLA 1I4QA 1CZWA 1IXRA 2B3GA 2GN5A 1TWAH 2HDMA 4DV0L 3ND8A 3JC66 1XNQL 4LUZA 4FF4A 2UXCQ 5AJ3Q 3G6EA 1EYCA 3JAMc 5KRUA 3T1HQ 3VA5A 1N36L 2ZXRA 1GVPA 1C8CA 4HCEA 4EQ5A 2VUMG 1VQ4A 1N33L 2PW7A 2JEAI 3JAME 4YWMA 5C4JB 3HOXG 1HTLD 1B3QA 1SJHD 3VYTA 4IUUA 1TWCB 1BBUA 5C5LA 3U4ZA 1STGA 5JVH3 3S1NB 1L1OA 3DM3A 4JPBW 3QJYA 4IALA 2X6GA 1RDPD 3PCOB 2ATWA 1E0BA 1LT6D 5I4DA 3ZYYX 2K5HA 2KEDA 1U4MA 2R93H 4AYBG 4X3TA 3ZJYC 2PYKA 3H91A 1T5EA 1K73C 3NHHA 5C4JH 2K01A 1YJ9A 2KVMA 1ZXTA 4C3HB 1FGBD 1CA6A 4C2MB 1FJGQ 4DR6L 1D7QA 2R3ZA 4HCSA 3CCVA 4BXXG 4QIWE 3TS0A 2WAQB 4X3SA 3M3YH 3K6OA 3S1NH 2N49A 4G7OC 1NE3A 2HIXA 4PZ7A 1PV4A 4RGMA 1PFMA 1F9QA 2IHEA 2SNSA 4GN5A 1STNA 4QL5A 3E3XA 3OOCA 1STYA 2NVTB 5C0XI 3S1MH 4M1UB 1KRTA 2NVQB 2CHBD 5M5WB 3QG1A 1B44D 3LX0A 1E22A 3EROA 3R8BA 4JBJA 1PRTB 4C3HH 2BH8A 4C2MH 2L5TA 3SK4A 5K36H 3STBC 3G4SA 3CC2A 5T1GA 1K0SA 2HDLA 1AZPA 1PA6A 4IJHA 1PH4A 3M7NA 2AQ2B 2WKCA 5EBDA 4C1NK 2OTJA 1TS2A 5C0XG 2OCEA 4PZ6A 2B63B 4DV4L 3CKIB 2G5DA 5BN4A 1Q3LA 3J81c 4HIKA 3T1YQ 5H1SE 3RNUA 3RZDH 4LMQD 5FO8B 4A3JH 1LACA 2E8GA 3MXNA 1II3A 4K8IA 3I4MB 4P74A 2NVQH 1PTOC 4FXKC 1H9RA 1TS3A 2EY1A 5M5WH 3FPPA 4UP7A 2G9HD 3URYA 1LV9A 2ZTEA 4LK1C 1B53A 4ULLA 2B29A 3K7AB 2YTYA 2MHVA 2K28A 2L55A 5CYUA 3EBEA 1HHVA 1O80A 3CAMA 3J80c 1ML0D 4P2CB 3OSOA 4MTNA 4X62L 4DAPA 4BBSB 4CKBA 1EZ8A 3C46A 2KEEA 1F2LA 3J80E 5C44G 2PZUA 3W1BA 4DR3Q 1IBML 3I4MH 1SYCA 2OT2A 1GD7A 3TREA 3A5UA 1SNMA 1AP0A 1GUGA 4WFN3 4IQZA 1WD0A 2K75A 3K7AH 2XSCA 1RTOA 3HKZB 2PI2A 1STBA 4LWCA 4BBSH 1JC7A 1X32A 4JC0A 1SRUA 1F9RA 1U4LA 5LMNW 2KQ3A 5IY0A 2RKSA 5JJIA 4JV5Q 2F3IA 3FPUB 1CA5A 2B63G 3HOWB 3J81j 4A3KG 2ICIA 4F87A 3HOUB 3NELA 2EDGA 1GKHA 3Q23A 1N8RC 3WOFA 3GTPH 5IP9H 3I4MG 3H0GB 3FP9A 1S3OA 4QUFA 1S72A 2JA6B 4GOPB 1HUMA 1S40A 4G4KA 4K5VA 4OO1H 3RLOA 1QVCA 2MGSA 1DGSA 4A3MH 4KD4A 4I7AA 4OGQC 2EYMA 4X3UA 5M3MB 4BWGB 1EY0A 1MHWC 2TMPA 3HOWH 1OXTA 5M3FB 3HOZB 4CJ1B 4BBSG 1HQRD 1EU4A 1WOCA 2UUAQ 1STHA 1V9PA 4DA2A 3H0GH 1VQAA 1S5FD 4QF4A 2E2JB 3A8JE 1SYDA 2EVBA 3CW2C 1TKWB 3PUZA 4K5XA 5FLMG 2OF1A 1X54A 1Y1VG 3BYTB 5A2QL 4JYAQ 4LFCQ 1MSGA 3K59A 1MIUA 1N32Q 2CH4W 1BR9A 3U9SA 1ZKOA 5M3FH 4YWLA 1VDZA 1R4QB 2B2VC 3HOZH 1H9JA 1Z6HA 1BKBA 4DXGA 4GN4B 3I4OA 1SNOA 5C4HA 4PMWA 1PRTC 3D4DA 4NPSA 1E24A 1PFNA 3HOWG 3D4WA 1RF2D 3HOUG 3GD7A 2F0LA 2NUCA 3CCSA
chains in the Genus database with same CATH topology
1ET9A 1EU3A 3KBXA 4KY7A 1CHPD 5IODA 4OHJA 2F0IA 3M7GA 1OXXK 1IYUA 5KEEA 3MVVA 5CV7A 1SE2A 1XTCD 1BXTA 1JCKB 2XN9C 2NZ1D 1KAAA 5J22A 3A54A 4A3DB 1EWHA 1KDBA 1XXGA 1TY0A 5CGKA 4A3FB 3K5NA 2XRQD 1CT1D 4WRDA 3GP7A 1HTPA 1SYGA 4XYQA 4A3EB 2EYPA 3EA6A 3R2TA 2YYZA 3EFXD 5DNFA 1AEXA 4A93B 2A6EC 3I90A 4M8AA 2BOSA 2F0VA 2L12A 2FJ2A 4Z9CB 3DWQA 5C3EB 2I46A 5CBAE 2WKDA 4DF7A 3GTKB 1F2YA 1PRTD 4L63B 1QILA 2F03A 1EEID 3IFTA 1TWFB 5CV8A 1U4PA 2LY7A 3W3AA 4O1NA 4RGTA 2SNMA 2A69C 3BZDB 3SXHA 3CRLC 1ET6A 5TSSA 3A55A 5ISRA 3VR4A 3SR1A 5KYIA 5EGTA 1V1PB 4IUNA 2R61A 4ODGA 2PZWA 4U673 3SEBA 4A3BB 1F9PA 2KUMA 1XYIA 4CKCA 4IN3A 5I6YA 3OW7A 1EYAA 3BDLA 1ZYRC 1EQVA 3BDOA 3S2HB 2B2YC 2CVRA 5EKIA 4IURA 1I3QB 3P75A 5CBEE 2AWOA 3NTIA 3KLSX 1B50A 3SDZA 2R6GA 4HR7B 2F0FA 4OIKA 2O4XA 3R93A 1HQMC 3GQBA 2B8FA 1CK1A 3HOVB 3MXUA 2NTSA 4IUPA 1E2ZA 2L0CA 1I4PA 2JE6I 1KLGD 4IUVA 2VNUD 2E76C 3Q6SA 1BCPF 4NW2A 1CI3M 3MZ5A 1O7ZA 1ENCA 4N9PA 1O78A 2F0TA 3R3OA 3A7AB 2F0UA 2KJXA 3G7LA 4ABNA 2IX0A 4ZUIA 1D6EC 1MD2D 1GUNA 4Q5VA 3P20A 1ONLA 3TZDA 3QOLA 4RCNA 1H9MA 4OL7A 3Q24A 3F2UA 1KTKA 2KA7A 3WDNA 1ENAA 4EGVA 1G2TA 4FVMA 5EKKA 1ICWA 4FYDA 4QMGA 5K5PA 1S5DD 2TSSA 5JEAH 4KJOA 5IT9E 2BCOA 1TQOA 1EY9A 1DXMA 3P7JA 1Z7TA 3J7AF 4LJZC 5KNDA 4PMCA 3RD4A 1A15A 3R2IA 2F0SA 1NSNS 2VB2X 3VR5A 4HAEA 1TWGB 1PMRA 3LWUA 3W2DA 2VUMB 2QEJC 2KECA 2EZVA 4DXFA 1TT2A 4XT1B 3OHXC 2JYOA 4LAAA 3DEPA 3OMCA 1IYVA 4PV1C 3J7YW 3OWFA 1DJRD 1R4PB 3KUPA 4HMIA 2M00A 3T56B 3N6RA 3S1RB 3H3VC 3NK9A 2Z4IA 1I50B 1MBYA 1SNQA 3N52A 5D3DA 3TBIB 3P1HA 3LWEA 3SHLA 4WJWA 4RKBA 4ZRZA 1E2WA 3IAYA 1VF5C 1WTPA 2MUYA 2E75C 2Q8RE 3BDCA 3I70A 1TVXA 2RVLA 2PQEA 3NBIA 1S5BD 5CC4A 1PXUA 1EEFD 1CFMA 1V1OA 3HP3A 1ESRA 3VA7A 3GTQB 5C5MA 2DY7A 3MEHA 2F0DA 4CGYB 3ITPA 3NWSA 2MP1A 2K5DA 1NAPA 3AU7A 5EPKA 5ELEA 3T51B 5IGEA 3E0JA 2IX1A 3ERQA 1HCZA 4EQNA 4UDUC 4KHZA 4XIGS 4HTHA 1LT4D 3I72A 4CKEA 4B9WA 2F0MA 2JA5B 2E2HB 4UAIA 3KLRA 2B2UA 5C0XH 2A74C 2B2YA 4A3IB 2KCNA 1BCPB 1WD1A 5I9OA 5C44B 1JOOA 3T13A 5G3LD 2D9UA 1YNNC 5DAUA 3HEJA 3I4LA 3L7ZC 1RHPA 1SYEA 1DOLA 2F0EA 3NQIA 3BS1A 1KDAA 1TR5A 3KLSA 3H94A 3CRKC 2NN6G 3A56A 1Q12A 5FK9C 3E5SA 1F2MA 3D6CA 1G91A 1LTAD 3QO2A 2EJFC 4HSPA 4F88A 2NBFA 4A3KB 4X3KA 2IL8A 4ZUJA 1Q1BA 2YU9B 1OXVA 3CU7A 3TMEA 3TN2A 5CR3A 3SK8A 3J81E 4NDXA 5I2YA 1EOTA 1CHQD 2FINB 1ILPA 2D5DA 2F3VA 3H09A 2L1BA 5IGGA 1FD7D 3T53B 3TP7A 5ELCA 2AQ3B 2PCFB 3JAML 2CQAA 3PIP3 3DMUA 1J8IA 4E6IA 4ZKBB 1SNPA 1LT3D 1OO9B 3H6MA 4ZQ3A 2F0GA 1Y1VB 4C3JB 5ELBA 5C3XA 1LTRD 1IKMA 3O13A 1SE3A 1B2TA 1YNND 1LTTD 2RBMA 5JPMC 3BYYB 3HG9A 3MTSA 2PMZB 3MFGA 1RJTA 1Q1EA 1PZID 1Y8PB 2JA7B 4KD3A 4F8MA 4CBVA 3RLFA 2AWNA 5EPLA 4RH6A 3TP5A 2EY2A 2F0QA 3T16A 2CW0C 4OIJA 1DOKA 1F9SA 2H4OA 1LTSD 1FNVA 3M4YA 1K8MA 2A73B 3BVMA 1MGSA 1PTOD 4QUCA 3S1QB 1A6XA 4DNRB 2VB3X 1Y8OB 2LFNA 3FDTA 2C9OA 2XIWA 1BCPC 4IZ8A 3U9OA 4K6LA 4IFDJ 2XVSA 4XQJA 4R9WA 2EYHA 4C3JG 1KABA 3J81L 1FNUA 1JB3A 2RDHA 4RHSA 1FYCA 3DM1A 4A3GB 2KHSA 5HURA 1EWCA 2X69A 5JAVA 2QILA 2QF7A 1V43A 1PDQA 1IL8A 2B2WC 5FO9B 1BBXC 2AUJD 1EZ6A 2XWJB 1FNWA 5FKAC 5A35A 4KK7A 2F0HA 3J80L 2F4IA 3OIQA 5DM73 2C5CA 2IJ0A 3S14B 1HFGA 5C4ZA 1NR4A 2RSNA 4V0BA 5DM63 1M4VA 1LTGD 4BY1B 3BVZA 1VF7A 1EL0A 3UI2A 4S3SA 1B9NA 3K58A 3I4NB 3QB3A 1BDOA 5D14A 1DD2A 2LS01 1WTOA 3L3OC 1U9RA 3E6ZX 5E3FA 1IW7C 1H9SB 4BA1I 1RD9D 2IW3A 3NPPA 4IFDG 2R92B 1PYWD 1RKNA 2D62A 4XQNA 2HUGA 3V96A 4KJNA 2F0NA 4KKTA 5C4XB 2SOBA 4KHVA 3I8ZA 1D1IA 3L9AX 5LL6X 3RMHA 1SMYC 2AUKA 4ZLTF 2NB0A 2EY6A 1GUWA 5CORA 1Q8IA 4KV6A 1D5ZC 1D1KA 5NUCA 5F2DA 4FXDA 1EY4A 2O2LD 1V8QA 1E2VA 1VMCA 2ID0A 3C1FA 3TP6A 1CQVA 1R9TB 5I6WA 4C3IG 3VYSA 3A8IE 3MC0B 4EQOA 1UAPA 2IPKD 2NYZD 1B3AA 3SK6A 1HFNA 5CMDA 3PO2B 5IGDA 3PUVA 2DNCA 1W6KA 2K7VA 1LABA 3M85A 2LMCB 3SVMA 1SNDA 1DONA 1C4QA 1EY5A 2A6ED 4ZYSA 5M9OA 2EPBA 5EQ0A 1VCIA 3GTGB 2BDOA 2K32A 2JXMB 1GUTA 3DWAA 2HQEA 1L0XB 3LNNA 2J4XA 2WB1B 4C1NI 2F1MA 3GTMB 2PPBC 4MN3A 2B8GA 4N9TA 4Q0FA 2M9VA 1OXSC 1S5CD 2K6AA 2F0OA 5D3IB 3GTJB 1TIID 3IFDA 2EXZA 4ZAIA 1LLRD 3C2PA 1NR2A 1YNJC 2EOTA 1C48A 4DK1A 4K2KA 1XX8A 3EVQA 2O5IC 3FVQA 2A69D 2NTTA 2B2TC 4PMBA 1Y8NB 5E4WC 1I4RA 5J39A 2QCPX 1WTXA 3DUZA 1QJOA 4DGZA 1GHKA 3I3CA 1I6VC 1JORA 1UNSA 4FXGC 1EYDA 2F0JA 5CV4A 1AZQA 2M2LA 2BDNA 4L8JA 2E74C 5ELFA 1WVLA 3PUWA 2B2VA 1GHJA 4L6TB 5JEAJ 2F3WA 5D65A 1ZYRD 5AFWA 4H0LC 2FMCA 2XNAC 3FEWX 1O7LA 1QB5D 2A5HA 1SXTA 2K03A 5ELDA 1LO5D 2IX3A 3SE0A 2SEBD 1WCMB 1G8ZD 2KOLA 3RUZA 1JWMD 1NCVA 3GTOB 1DM0B 5CV9A 3HRZC 1HPCA 5BN5A 1SEBD 1EIGA 3S15B 1JE4A 2EYLA 1JWSD 4QIWB 1I6HB 2DY8A 2J0TD 1X3PA 4K6DA 2NVXB 5IIFA 1KLUD 3HGBA 4H44C 1DYQA 3D3RA 3EQLC 3FKIB 4CHTB 1QNUA 3FMCA 1S5ED 2E2DC 1F77A 1SFOB 4CJ0B 1F2ZA 4KKUA 4KI0A 3AMUA 3MHBA 3PIO3 4JBWA 5FLXE 1G291 1CZGA 2OXPA 3K0YA 1BNZA 1SJED 3DHQA 2J7ZA 1A3VA 1UUPA 2IWHA 4KY5A 3CHBD 5JJZA 1J9OA 2V4DA 1RTNA 1TWAB 2EYJA 3TDQA 4XDXA 1GJXA 4TQUS 4K2LA 3QWNA 3J7AV 3MAQA 4B08A 3D4RA 4HN7A 2D2CC 2ZXOA 3K57A 3DWPA 2Z8LA 1ILQA 3FRPB 2ZXPA 1D5MC 5E1FA 3KK7A 5C0XJ 4H13C 3HS0C 3SK5A 2R93B 5IT9L 5EBCA 4ID6A 4KKSA 2NN6H 4Y7NB 2FFKB 3M3YB 3Q22A 1SDFA 1JWUD 4FF1A 3AB9A 4G57A 3MA2B 4K8JA 3M4OB 1H9KA 2KCCA 2NN6I 3S1MB 4ZKCB 4DN4M 1BOSA 5LL6S 2K5QA 2JSOA 2EYOA 3D6WA 1HXYD 2K33A 1GUSA 4BA2I 1UEAB 3DXJC 1TU2B 3RZDB 5FLXL 4A3JB 2HCIA 3G6JB 4F7XA 3I91A 4RHRA 2NVYB 3VR2A 1QE6A 1NUCA 3D8GA 2XRSD 3V2TA 5FOBB 1HA6A 1H9SA 1L0YB 4XQQA 1I4XA 3A8KE 2B2TA 3OWEB 3CQZB 1EY6A 1G2SA 2RDGA 5A2QE 3X3NA 2WP8J 2MPMA 1GOZA 2DNEA 4HSVA 3OMGA 1STEA 4K14A 1WTRA 5EPJA 2NWGA 1Y69U 3QIAA 1JQYD 4C3HG 5KYLA 5K36G 3PUYA 3OPOA 1U4RA 1XWEA 2ENBA 1VMPA 4RFBA 5IGFA 4R8IA 1MI2A 1I4HA 4J1MA 1WTQA 3MWYW 3OIPA 2EYFA 3GTPB 3VYUA 4J8QA 4FP5D 2PW5A 3S2DB 1T5XD 2L9HA 3NTHA 3HOYB 4JK1C 3C1EA 4FF3A 4A3MB 1SE4A 3S9WA 2X6LA 1B1ZA 1V1PA 2F0PA 3S17B 1RCVD 4ILWA 1EQTA 3GTLB 4NKLA 4DAVA 1WTWA 3VR3A 2OEOA 4BY7B 4ME5A 1IHZA 2A68C 1BF4A 3EJIA 4ZK9B 1Y1WB 5E4XA 4FF2A 2F0KA 3ONAB 2GA4B 4HMJA 1QWYA 5CV6A 2QDBA 2QKIC 1WTVA 3HZXA 3NQTA 4DK0A 2IT1A 5G3LF 4QCLA 1TS4A 2VXWA 4OO1I 2B39A 2WV6D 3KBGA 5JVG3 3ND9A 3K5LA 2SDFA 4FO2A 2WIIB 3BG3A 2G9DA 1O7YA 3Q0AA 4OO1G 3VR6A 5DEHA 1S4ZA 1B9MA 2JA8B 4IFDH 1TS5A 3PO3B 1X3QA 4G7HC 2RQXA 1PZJD 3IL8A 3VYRA 2JP1A 2BA0A 4I65A 3D31A 4IFDI 4PNYA 5IOCA 3GV6A 1KNAA 2CW0D 3K5OA 2R7ZB 4KMUC 5C6AA 4C3IB 3TZUA 2F0WA 4O42A 4RGNA 1DCZA 4XXEA 2A68D 4R8NA 1A3UA 2N88A 2ICEC 1BCPD 3X3MA 2Q8IB 2WINB 4MHEA 4WORA 3MFYA 1IKLA 2K05A 4BBRB 4G7ZC 5JPNC 4QB4A 2BA1A 1AFPA 1EY7A 5EJWA 3GV3A 1RODA 2Y0SB 3A7LA 3BVGA 4RKLA 1KDCA 3KF8A 4RAUC 2EE1A 5KIXA 1I4GA 2RDFA 1SBBB 2PO4A 5KGUA 5IGBA 1PTOF 2H1EA 1CTMA 2MJ8A 1D5XC 1HRJA 4H7BA 4RWSC 1M8AA 4TSSA 3NBHA 1EY8A 1GUOA 1K83B 2O5JC 2AQ1B 2L11A 1QG7A 4EQPA 2EJMA 3C3LA 1IW7D 3PMFA 5COYA 3TSSA 5T1IA 2PNRC 1SYFA 3V05A 1JR0D 2FMMA 4EVOA 4TRDA 1DZ1A 2DN8A 2LKVA 4K5WA 2A6HC 4V190 2RSOA 1KNEA 2HCCA 2N55A 1AN8A 4GZYC 2B2UC 1Z47A 1STAA 1A2TA 3I73A 1SNCA 4DU9A 3MXPA 5M5XB 1SAPA 1SMYD 1BUVT 1K8OA 1QCBD 2I07B 1SSOA 5C3WA 3GO5A 3PV0A 1LTID 2FHTA 1GXDC 2K1BA 1MSHA 5M5YB 2PZTA 2ZT9C 3NUCA 1A3TA 5J1ZA 3IKJA 3NTKA 5KNCA 3MXGA 4PQXA 4IUTA 2K5WA 2E2IB 1Q90A 5EKLA 4KTAA 1JICA 4TKOB 4RGOS 1LTBD 3NP8A 2BE5C 1CQFA 3PUXA 1ESFA 4KN7C 5I2XA 1JOQA 1W6JA 3K5MA 4MIUA 2Z1CA 1EFID 1BQQT 3NE5B 4I7ZC 3WOEA 3S16B 1PRTF 2B2WA 2JEBI 2A6HD 5KNBA 4XTCS 5IGCA 4NMZA 1EIHA 1CM9A 4NP5A 5CV5A 3NXWA 4B9XA 1SYBA 4XT3B 1QNKA 4XYOA 4KN4C 4U68A 3RZOB 4DFAA 4RA8A 4DNTB 5BN3A 4HEDA 3DEOA 1PZKD 1ENFA 1ZEQX 5JOBA 5I9PA 1DOMA 1TY2A 1PFBA 1YNJD 5HGTA 3TP8A 1OXUA 2L4NA 4DAYA 2K04A 3QOJA 1BO0A 2WACA 4IUQA 1LT5D 5LHY1 4FNFA 3HOXB 2Z4HA 3T4AC 4CJ2C 1PTOB 2XWBB 1TWHB 2RA4A 1G6ZA 2EJGC 2BE5D 4J6HA 1HA5A 1D2BA 5JEAG 1JOKA 3NWTA 1PLFA 4RCOA 1QOHA 4AYBB 5FO7B 2EY5A 4KY6A 4BS9A 1A2UA 1B4OA 1PTOH 4C56C 3NSWA 1AW7A 1FR3A 2Q8TA 1HUNA 4YIJA 1I4QA 1CZWA 2HDMA 3ND8A 4FF4A 1EYCA 5KRUA 3VA5A 2ZXRA 1C8CA 4HCEA 2PW7A 2JEAI 3JAME 5C4JB 1HTLD 1SJHD 3VYTA 4IUUA 1TWCB 5C5LA 1STGA 5JVH3 3S1NB 3QJYA 4IALA 2X6GA 1RDPD 1E0BA 1LT6D 5I4DA 3ZYYX 2KEDA 1U4MA 4X3TA 2PYKA 3H91A 1T5EA 3NHHA 2K01A 2KVMA 1ZXTA 4C3HB 1FGBD 1CA6A 4C2MB 2R3ZA 4HCSA 2WAQB 4X3SA 3K6OA 4G7OC 4RGMA 1PFMA 1F9QA 2SNSA 1STNA 3OOCA 1STYA 2NVTB 5C0XI 4M1UB 2NVQB 2CHBD 5M5WB 3QG1A 1B44D 3LX0A 3EROA 3R8BA 1PRTB 2L5TA 3SK4A 5K36H 5T1GA 2HDLA 1AZPA 3M7NA 2AQ2B 2WKCA 5EBDA 4C1NK 1TS2A 5C0XG 2B63B 3CKIB 5BN4A 1Q3LA 4LMQD 5FO8B 1LACA 3MXNA 1II3A 4K8IA 3I4MB 1PTOC 4FXKC 1H9RA 1TS3A 2EY1A 3FPPA 2G9HD 3URYA 1LV9A 4LK1C 1B53A 4ULLA 3K7AB 2MHVA 2K28A 2L55A 5CYUA 1HHVA 1O80A 1ML0D 4P2CB 3OSOA 4BBSB 4DAPA 4CKBA 1EZ8A 3C46A 2KEEA 1F2LA 3J80E 2PZUA 1SYCA 2OT2A 1SNMA 1AP0A 1GUGA 4WFN3 4IQZA 1WD0A 2XSCA 1RTOA 3HKZB 1STBA 1JC7A 1X32A 1F9RA 1U4LA 2KQ3A 2RKSA 3FPUB 1CA5A 3HOWB 2ICIA 4F87A 3HOUB 2EDGA 3Q23A 3WOFA 3H0GB 4QUFA 2JA6B 1HUMA 4G4KA 4K5VA 4OO1H 2MGSA 4KD4A 4OGQC 2EYMA 4X3UA 5M3MB 4BWGB 1EY0A 2TMPA 1OXTA 5M3FB 3HOZB 4CJ1B 1HQRD 1EU4A 1STHA 4DA2A 1S5FD 4QF4A 2E2JB 3A8JE 1SYDA 2EVBA 1TKWB 3PUZA 4K5XA 2OF1A 3BYTB 5A2QL 1MSGA 3K59A 1BR9A 3U9SA 1ZKOA 1VDZA 1R4QB 2B2VC 1H9JA 1Z6HA 4DXGA 5C4HA 1SNOA 4PMWA 1PRTC 3D4DA 1PFNA 3D4WA 1RF2D 3GD7A 2F0LA 2NUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBH A;  4DAY A;  3MXN A; 
#chains in the Genus database with same CATH topology
 1ET9 A;  1EU3 A;  3KBX A;  3RN2 A;  4KY7 A;  1CHP D;  1I94 L;  1HZ9 A;  5IOD A;  4DV6 Q;  4OHJ A;  2F0I A;  3G71 A;  3M7G A;  1OXX K;  2JA7 G;  1IBL L;  1IYU A;  5KEE A;  3MVV A;  2JA6 G;  2UUB Q;  1VQP A;  5CV7 A;  5HGQ A;  1SE2 A;  4HID A;  1XTC D;  1IBK L;  5LMN L;  3KFU A;  1BXT A;  1JCK B;  2XN9 C;  2NZ1 D;  5M3M G;  2CKZ B;  1KAA A;  1FVI A;  1FGU A;  5J22 A;  3A54 A;  2UXB L;  4A3D B;  1EWH A;  1KDB A;  1XXG A;  4YY3 Q;  1SRO A;  1TY0 A;  5CGK A;  4A3F B;  2VY3 A;  3K5N A;  4POG A;  2XRQ D;  1CT1 D;  4WRD A;  3GP7 A;  1HTP A;  1SYG A;  4XYQ A;  1QVG A;  4IPG A;  4MZ9 A;  3NEN A;  4A3E B;  2EYP A;  3EA6 A;  1XPU A;  3R2T A;  2YYZ A;  3EFX D;  5DNF A;  1AEX A;  4A93 B;  2A6E C;  4POF A;  5GAG C;  3I90 A;  4A3D H;  4A3G G;  4M8A A;  4A3F H;  1PVO A;  2BOS A;  3K0X A;  4X66 Q;  2F0V A;  2L12 A;  2FJ2 A;  4Z9C B;  3DWQ A;  1PYB A;  5IYD G;  1SR3 A;  5C3E B;  2I46 A;  5J3B A;  5CBA E;  4IJL A;  1X56 A;  2WKD A;  4DF7 A;  1YNX A;  4LW1 A;  4A93 H;  3GTK B;  1F2Y A;  4JI0 Q;  1PRT D;  4L63 B;  3UE1 A;  1UE6 A;  2VZA A;  1QIL A;  4GOP C;  2F03 A;  1EWI A;  2KHJ A;  4LFA Q;  4BY1 G;  2MQH A;  5ELN A;  2QEX A;  1EEI D;  3IFT A;  1TWF B;  5CV8 A;  4A3D G;  3CCM A;  1U4P A;  2LY7 A;  4X64 Q;  4GLX A;  3W3A A;  2ZJR A;  4O1N A;  4RGT A;  5C3E H;  1C9O A;  3GDE A;  2SNM A;  1YVC A;  4DV3 L;  2CWP A;  3GTK H;  1VQD A;  2A69 C;  3BZD B;  4LUV A;  3SXH A;  3CRL C;  5GRO A;  4A3E G;  4DR1 L;  1ET6 A;  3TQY A;  1PH7 A;  5TSS A;  3A55 A;  5ISR A;  2GVB A;  3VR4 A;  3SR1 A;  5KYI A;  5EGT A;  1V1P B;  4IUN A;  1TWF H;  2R61 A;  4ODG A;  2R92 G;  1IZ6 A;  4JI4 L;  2PZW A;  4U67 3;  3SEB A;  4A3B B;  4ME3 A;  1F9P A;  2KUM A;  1XYI A;  4A3C H;  4CKC A;  4B3S L;  1YHB A;  1VQJ A;  2V1C C;  4IN3 A;  5I6Y A;  3OW7 A;  1EYA A;  2MFI A;  4DPG A;  3BDL A;  4QJF A;  1ZYR C;  1EQV A;  3BDO A;  5LMU L;  3S2H B;  2B2Y C;  2CVR A;  3OYY A;  5EKI A;  2N78 A;  1L2F A;  4IUR A;  1I3Q B;  3P75 A;  5CBE E;  2AWO A;  3NTI A;  3KLS X;  4A3B H;  1B50 A;  3SDZ A;  2R6G A;  4HR7 B;  2F0F A;  4OIK A;  2H5X A;  2IHF A;  3A5Z B;  2O4X A;  4HJ8 A;  2ZJQ A;  2DGY A;  3H3V H;  3R93 A;  1HQM C;  3GQB A;  2B8F A;  1CK1 A;  4GKJ L;  3HOV B;  3MXU A;  1QZH A;  2NTS A;  4IUP A;  2HHH L;  1E2Z A;  5M5X H;  2L0C A;  1I4P A;  2JE6 I;  1KLG D;  4IUV A;  4ZCK A;  4HJ9 A;  2VNU D;  2E76 C;  4DV3 Q;  4GLA C;  3Q6S A;  1Q86 C;  1BCP F;  1W3S A;  3I2Z A;  4NW2 A;  1P16 A;  2JA9 A;  1CI3 M;  3MZ5 A;  1O7Z A;  1ENC A;  4DR4 L;  4JI8 L;  2Y0S E;  4N9P A;  5M5Y H;  1O78 A;  2F0T A;  3R3O A;  3A7A B;  2F0U A;  1Q7Y C;  2KJX A;  3G7L A;  4ABN A;  1X3G A;  2IX0 A;  4ZUI A;  1D6E C;  1MD2 D;  2R7D A;  1GUN A;  4UPA A;  4Q5V A;  2CQO A;  3P20 A;  1ONL A;  3TZD A;  1YHA A;  3F2D A;  1AH9 A;  3QOL A;  4RCN A;  1EQR A;  1H9M A;  2WB1 G;  1KC8 C;  3H15 A;  4OL7 A;  1U5K A;  3Q24 A;  1B8A A;  4GNX B;  4DR2 Q;  3F2U A;  1KTK A;  4KHP Q;  4OON A;  4LF6 Q;  2KA7 A;  4N8F A;  3WDN A;  1T9H A;  1U0L A;  1ENA A;  4RMF A;  4EGV A;  1G2T A;  4IPD A;  4FVM A;  3S16 H;  5EKK A;  1ICW A;  4FYD A;  2Q2I A;  3EIV A;  5IT9 c;  1HR0 L;  4QMG A;  5K5P A;  1S5D D;  3HOV G;  2TSS A;  5JEA H;  4KJO A;  4L5Q A;  1YZ6 A;  5IT9 E;  2BCO A;  1TQO A;  1EY9 A;  2UXC L;  2YTV A;  4TVA B;  1DXM A;  3P7J A;  1Z7T A;  3J7A F;  4LJZ C;  3T1H L;  5KND A;  4PMC A;  3RD4 A;  4NXM L;  1A15 A;  3R2I A;  1SN8 A;  2F0S A;  1NNX A;  2RCF A;  1NSN S;  2VB2 X;  3VR5 A;  3KF8 B;  1TWG B;  4HAE A;  1PMR A;  3LWU A;  3W2D A;  2VUM B;  2QEJ C;  4LF5 Q;  2KEC A;  2EZV A;  4DXF A;  1TT2 A;  4XT1 B;  1Y14 B;  3OHX C;  1C7Y A;  1HNX Q;  2JYO A;  4LAA A;  3DEP A;  3OMC A;  1IYV A;  4PV1 C;  3J7Y W;  3OWF A;  1H95 A;  2LXJ A;  1DJR D;  1R4P B;  3KUP A;  4IO9 A;  4HMI A;  2M00 A;  3T56 B;  3N6R A;  3S1R B;  3H3V C;  3NK9 A;  2Z4I A;  1I50 B;  1MBY A;  1SNQ A;  2C35 B;  3NBH B;  3N52 A;  1PH6 A;  4GKK Q;  1XTD A;  5FLX c;  5D3D A;  3TBI B;  1FJG L;  3P1H A;  2VUM H;  3LWE A;  2K52 A;  2CWA A;  3HOX H;  3SHL A;  4WJW A;  4RKB A;  4ZRZ A;  1VQ9 A;  1E2W A;  4FDB A;  3IAY A;  1VF5 C;  1WTP A;  2MUY A;  2E75 C;  2Q8R E;  3BDC A;  3S1R H;  1WCM G;  3I70 A;  1I50 H;  1TVX A;  1HR0 Q;  2CFM A;  4HIM A;  2RVL A;  2PQE A;  3A74 A;  3NBI A;  5IYB G;  1S5B D;  1A0I A;  5CC4 A;  2UU9 Q;  1PXU A;  1EEF D;  1CFM A;  4A3L H;  2I5L X;  2L15 A;  2ZM6 Q;  1X9N A;  1V1O A;  3HP3 A;  4JCV E;  4HJ7 A;  1ESR A;  3VA7 A;  4NXM Q;  4BXX H;  3I55 A;  3GTQ B;  5C5M A;  2DY7 A;  3MEH A;  4JI3 Q;  2F0D A;  3T1Y L;  1YHQ A;  4CGY B;  4UP9 A;  1I5F A;  1LYL A;  4DV1 Q;  3ITP A;  1HZB A;  3NWS A;  2MP1 A;  2DJF C;  2K5D A;  5IWA Q;  1VQK A;  1NAP A;  3AU7 A;  3FKI G;  5EPK A;  5ELE A;  2Z0S A;  3T51 B;  1D8L A;  5IGE A;  3E0J A;  5GAE C;  2IX1 A;  3TEH B;  3ERQ A;  4LF7 L;  1HCZ A;  4EQN A;  4JOI A;  3FHW A;  4UDU C;  4WJ4 A;  4KHZ A;  4XIG S;  4HTH A;  2UXD Q;  3KDF B;  3UDX A;  1LT4 D;  3I72 A;  4CKE A;  3GTQ H;  4B9W A;  2F0M A;  2JA5 B;  4DUY Q;  2E2H B;  4A3L G;  4UAI A;  1NBW A;  4GNX C;  3KLR A;  2B2U A;  2K5V A;  5C0X H;  2A74 C;  2B2Y A;  5GQO A;  1TWC H;  4DR3 L;  1BVS A;  4A3I B;  2KCN A;  1BCP B;  2KHI A;  1WD1 A;  5I9O A;  5C44 B;  3AQQ A;  1JOO A;  1VQ5 A;  3T13 A;  4QQB X;  2MNA A;  5G3L D;  2D9U A;  1YNN C;  4DAM A;  1PH8 A;  5DAU A;  3K8A A;  3HEJ A;  1O7I A;  1VQI A;  3I4L A;  3L7Z C;  3ER0 A;  1RHP A;  2JA5 H;  1YIJ A;  4AQY Q;  2E2H H;  1SYE A;  5JJK A;  1DOL A;  2F0E A;  4R4O A;  3NQI A;  3BS1 A;  1KDA A;  1TR5 A;  3F8T A;  3KLS A;  4JV5 L;  1XMO L;  3H94 A;  1K8A C;  3CRK C;  2NN6 G;  3A56 A;  4GN3 B;  4RG1 A;  1Q12 A;  5FK9 C;  3E5S A;  4R4I A;  2A8V A;  1F2M A;  3D6C A;  1WYD A;  5C44 H;  3BU2 A;  1G91 A;  4P75 A;  1LTA D;  3QO2 A;  2EJF C;  4HSP A;  5IE8 A;  2NBF A;  4F88 A;  4A3K B;  4LF4 Q;  4X3K A;  2IL8 A;  4ZUJ A;  1HNZ Q;  1Q1B A;  2KBN A;  2NVT H;  2YU9 B;  1OXV A;  1LUZ A;  3CU7 A;  3TME A;  3TN2 A;  2RHQ B;  5CR3 A;  3SK8 A;  3J81 E;  4NDX A;  3M4P A;  5I2Y A;  1EOT A;  4AYB E;  5IP7 G;  1CHQ D;  1XMQ Q;  2FIN B;  4LF7 Q;  1ILP A;  4OWX B;  4OX9 Q;  2D5D A;  2F3V A;  3H09 A;  1C0A A;  2JA5 G;  1E1O A;  1AE2 A;  1CKN B;  2L1B A;  5IGG A;  1FD7 D;  2B63 H;  3T53 B;  4A3K H;  2UUA L;  2QW7 A;  3TP7 A;  5ELC A;  4EX5 A;  2AQ3 B;  1ASZ A;  3K81 C;  4A3I G;  2PCF B;  3AEV A;  2YU9 H;  3JAM L;  2CQA A;  3PIP 3;  3DMU A;  1J8I A;  4E6I A;  4ZKB B;  1SNP A;  1LT3 D;  4JYA L;  2Z6K A;  4LFC L;  1OO9 B;  1N32 L;  3H6M A;  4ZQ3 A;  2F0G A;  1YEZ A;  1Y1V B;  4C3J B;  5ELB A;  5C3X A;  1LTR D;  3B6Y A;  4WJ3 M;  1LTL A;  1IKM A;  3O13 A;  1SE3 A;  3M9B A;  2HIV A;  1PH9 A;  1YNN D;  1B2T A;  1LTT D;  2RBM A;  5JPM C;  3BYY B;  3HG9 A;  1XMO Q;  1VQG A;  4DV6 L;  3MTS A;  2PMZ B;  3MFG A;  2EXD A;  1RJT A;  1Q1E A;  4H02 A;  1EQQ A;  2UUB L;  5FLM H;  1PZI D;  1QUQ B;  1Y8P B;  1Y1V H;  3STB D;  2JA7 B;  4KD3 A;  4F8M A;  4CBV A;  3RLF A;  1EYG A;  2AWN A;  4O0A A;  5EPL A;  4RH6 A;  3TP5 A;  2EY2 A;  1A62 A;  2F0Q A;  4IPC A;  1VQF A;  4K0K Q;  3T16 A;  3LGJ A;  2CW0 C;  4OIJ A;  1DOK A;  4YY3 L;  2WAQ E;  1F9S A;  2H4O A;  5HY6 A;  4A76 A;  1LTS D;  1FNV A;  3M4Y A;  4JI1 Q;  1K8M A;  2A73 B;  3BVM A;  1MGS A;  1PTO D;  3KLW A;  3L0O A;  3HOU H;  3E0E A;  4QUC A;  1PH2 A;  3S1Q B;  1A6X A;  3OTO Q;  1SMX A;  4UHV A;  4DNR B;  2VB3 X;  1Y8O B;  2LFN A;  3FDT A;  4B3T Q;  2C9O A;  2XIW A;  2JA7 H;  1HZC A;  1WJJ A;  4DV2 Q;  2JA6 H;  1SLJ A;  1BCP C;  4IZ8 A;  3U9O A;  4K6L A;  4IFD J;  2A19 A;  2XVS A;  4XQJ A;  4R9W A;  2EYH A;  4C3J G;  1KAB A;  1NJI C;  5M3M H;  3CPF A;  3J81 L;  4O2D A;  1FNU A;  1JB3 A;  2RDH A;  4RHS A;  4X66 L;  1FYC A;  1B70 B;  3DM1 A;  4A3G B;  3S1Q H;  1VQ6 A;  2KHS A;  5HUR A;  1EWC A;  3CPW A;  2X69 A;  4YWK A;  2QIL A;  5JAV A;  4OWT B;  2QF7 A;  1V43 A;  1QZG A;  1PDQ A;  1IL8 A;  2B2W C;  5FO9 B;  1BBX C;  1ASY A;  2AUJ D;  1EZ6 A;  2XWJ B;  4QY7 A;  1FNW A;  5FKA C;  5A35 A;  4KK7 A;  4JI0 L;  2F0H A;  3J80 L;  2F4I A;  3HOY G;  3OIQ A;  5DM7 3;  4LFA L;  2C5C A;  4A3G H;  2DUD A;  2IJ0 A;  3S14 B;  1HFG A;  4V0B A;  1NR4 A;  2RSN A;  5C4Z A;  4X64 L;  1M4V A;  2I5H A;  5DM6 3;  1LTG D;  4YHH Q;  4BY1 B;  3BVZ A;  1VF7 A;  3JAM i;  1EL0 A;  3UI2 A;  4S3S A;  1B9N A;  4BY7 G;  3K58 A;  3I4N B;  5IYD H;  1Z9F A;  3QB3 A;  2LSS A;  1BDO A;  2VL6 A;  5D14 A;  1DD2 A;  2JJQ A;  3D0F A;  3A0J A;  2LS0 1;  1WTO A;  3L3O C;  1U9R A;  4JI6 Q;  2VS1 A;  3HKZ E;  3E6Z X;  5E3F A;  1IW7 C;  1PYS B;  1SE8 A;  1H9S B;  1PH3 A;  3S14 H;  4BA1 I;  4BY1 H;  1RD9 D;  4GNX A;  2E5L Q;  2IW3 A;  3NPP A;  4IFD G;  2R92 B;  5IYC G;  1PYW D;  1KHI A;  5FJ8 G;  1RKN A;  2D62 A;  4XQN A;  2HUG A;  3MXN B;  1X65 A;  3V96 A;  4KJN A;  2F0N A;  4KKT A;  5C4X B;  2SOB A;  1YBY A;  4A3E H;  4KHV A;  1X3E A;  3I8Z A;  1D1I A;  3L9A X;  2PQA A;  3KF6 B;  1G51 A;  5LL6 X;  4DV7 Q;  2OTL A;  2JA8 G;  1K3B C;  3RMH A;  2R92 H;  1SMY C;  2AUK A;  1KQS A;  4ZLT F;  3PO3 G;  1B7Y B;  2NB0 A;  2EY6 A;  1GUW A;  5COR A;  1Q8I A;  4KV6 A;  1D5Z C;  1D1K A;  2OQK A;  3KYH C;  5NUC A;  5F2D A;  4FXD A;  2VQF Q;  3I4N G;  1EY4 A;  3IRB A;  2O2L D;  5C4X H;  3CCE A;  1V8Q A;  1E2V A;  1MKH A;  1VMC A;  2ID0 A;  3C1F A;  3TP6 A;  1CQV A;  1R9T B;  3J7Z C;  2R7Z G;  3J81 i;  1Q82 C;  4P71 A;  5I6W A;  4C3I G;  3VYS A;  3A8I E;  4OEM B;  4UY8 C;  3MC0 B;  4EQO A;  1UAP A;  2IPK D;  2NYZ D;  1A63 A;  1B3A A;  5GAH C;  3SK6 A;  1HFN A;  5CMD A;  3PO2 B;  5IGD A;  3PUV A;  2DNC A;  1W6K A;  2K7V A;  1LAB A;  3M85 A;  2LMC B;  3SVM A;  3J80 i;  1SND A;  1DON A;  4CDC C;  1C4Q A;  2FXQ A;  1R9T H;  3J7A 5;  1EY5 A;  2A6E D;  4ZYS A;  4BBR G;  1PHJ A;  5C4X G;  4JBK A;  5M9O A;  2EPB A;  5EQ0 A;  1VCI A;  3GTG B;  2BDO A;  2K32 A;  1HR0 W;  2JXM B;  1GUT A;  3DWA A;  2HQE A;  1L0X B;  3LNN A;  2J4X A;  2QA4 A;  4DR2 L;  2WB1 B;  4KHP L;  4C1N I;  2F1M A;  2Y0S G;  4LF6 L;  3GTM B;  2PPB C;  4MN3 A;  2B8G A;  4N9T A;  4Q0F A;  3SGI A;  2M9V A;  1OXS C;  2AHO B;  3CCJ A;  1S5C D;  3BJU A;  1G6P A;  2K6A A;  3S2H H;  2F0O A;  5D3I B;  3GTJ B;  1TII D;  3CMA A;  3GTG H;  3IFD A;  3K80 C;  3F1Z A;  1I3Q H;  2EXZ A;  4ZAI A;  4JI5 Q;  1LLR D;  4ALP A;  3ULJ A;  3C2P A;  3GTM H;  1NR2 A;  1YNJ C;  3CP0 A;  1E3P A;  2EOT A;  4B3M Q;  1C48 A;  3K7U C;  4DK1 A;  4JI7 Q;  4K2K A;  1J6Q A;  4B3R Q;  1XX8 A;  3EVQ A;  2O5I C;  3PO2 G;  3FVQ A;  4LF5 L;  3ULL A;  2A69 D;  2NTT A;  4IPH A;  2B2T C;  4PMB A;  1HNX L;  1Y8N B;  3NEM A;  5E4W C;  3GTJ H;  1I4R A;  5J39 A;  2QCP X;  3KJP A;  1WTX A;  3HOV H;  3DUZ A;  1QJO A;  4DGZ A;  1FL0 A;  4LF9 Q;  1GHK A;  3I3C A;  1I6V C;  3PQI A;  1JOR A;  1UNS A;  4FXG C;  1EYD A;  2F0J A;  5CV4 A;  1AZQ A;  2M2L A;  2RHS B;  2BDN A;  4L8J A;  2E74 C;  3CF5 A;  4DUZ Q;  4GKK L;  4R4Q A;  5ELF A;  1WVL A;  2D0O A;  3PUW A;  2F4V Q;  2B2V A;  1GHJ A;  2Z9H A;  4L6T B;  5JEA J;  2F3W A;  5D65 A;  1ZYR D;  4OXP A;  1NTG A;  5AFW A;  4H0L C;  2FMC A;  2XNA C;  1JJG A;  3FEW X;  4X65 Q;  1O7L A;  1QB5 D;  2A5H A;  1VQO A;  1MJC A;  5JJL A;  1SXT A;  2CH4 A;  2K03 A;  3PIP A;  4UP8 A;  5ELD A;  1LM0 A;  1LO5 D;  2IX3 A;  3SE0 A;  2SEB D;  1WCM B;  1G8Z D;  2KOL A;  3RUZ A;  1JWM D;  1NCV A;  3GTO B;  2UU9 L;  4NB3 A;  1DM0 B;  5CV9 A;  3HRZ C;  2ZM6 L;  3UDF A;  1HPC A;  1N9W A;  1SEB D;  5BN5 A;  1EIG A;  3S15 B;  1JE4 A;  4JG2 A;  2Q2H A;  2EYL A;  1HJP A;  4JI2 Q;  4JI3 L;  1JT8 A;  3BZK A;  1VQH A;  3CCU A;  1JWS D;  4QIW B;  1I6H B;  2DY8 A;  2I5M X;  4DV1 L;  2NZO A;  1E1T A;  2J0T D;  1X3P A;  4K6D A;  5IWA L;  2NVX B;  4YCU A;  1M1K C;  5IIF A;  1KLU D;  3HGB A;  1WCM H;  4N8X 1;  1DYQ A;  3EQL C;  3D3R A;  4H44 C;  3FKI B;  2VQE Q;  3GTO H;  3S24 A;  1K3R A;  1W2B A;  4HJA A;  4CHT B;  2UXD L;  5IYB H;  1QNU A;  3FMC A;  2QDL A;  3S15 H;  4DUY L;  1S5E D;  4GLV B;  2E2D C;  1F77 A;  1J5E Q;  4X6A H;  1SFO B;  4CJ0 B;  1TWG H;  1F2Z A;  4KKU A;  4KI0 A;  4JW0 A;  3UDG A;  3AMU A;  3MHB A;  1N34 Q;  3PIO 3;  2NVX H;  4JBW A;  1JMC A;  1RIP A;  3M4Q A;  4A75 A;  5FLX E;  1G29 1;  1CZG A;  2OXP A;  3K0Y A;  1BNZ A;  1XNR Q;  1SJE D;  3FKI H;  3DHQ A;  2J7Z A;  1A3V A;  1UUP A;  2IWH A;  4KY5 A;  3CHB D;  5JJZ A;  1J9O A;  2V4D A;  1RTN A;  1TWA B;  3RLN A;  4DR5 Q;  2EYJ A;  4AQY L;  3TDQ A;  4GOP A;  4XDX A;  1SFO H;  1GJX A;  4TQU S;  4DV5 Q;  4AH6 A;  1CSQ A;  4K2L A;  3QWN A;  3J7A V;  3PGZ A;  3MAQ A;  4B08 A;  4DK6 C;  3D4R A;  4HN7 A;  2D2C C;  4LF4 L;  1HNZ L;  2ZXO A;  3K57 A;  4L5S A;  3DWP A;  2Z8L A;  4LF8 Q;  1ILQ A;  4LFB Q;  3CXC A;  3U58 A;  3FRP B;  4IOA A;  1XPR A;  2ZXP A;  1D5M C;  5E1F A;  3KK7 A;  5C0X J;  4H13 C;  4DK3 C;  1XMQ L;  3HS0 C;  4OX9 L;  1YIT A;  3SK5 A;  2R93 B;  3G48 A;  5IT9 L;  1KRS A;  2A1A A;  5EBC A;  5BR8 L;  4ID6 A;  3AFP A;  4KKS A;  2UUC Q;  4A4I A;  2NN6 H;  1UE1 A;  4Y7N B;  2FFK B;  3ICE A;  3M3Y B;  3Q22 A;  3CME A;  1P8L A;  1SDF A;  1JWU D;  3I7F A;  4FF1 A;  3AB9 A;  4KLK A;  4G57 A;  3MA2 B;  4K8J A;  5E7N A;  3M4O B;  2HQL A;  1EIY B;  1VS0 A;  1H9K A;  1KL9 A;  4LUO A;  2KCC A;  2NN6 I;  1HNW Q;  3F2B A;  3S1M B;  1K28 A;  1UE7 A;  4ZKC B;  5IP7 H;  3AFQ A;  4DN4 M;  4IOC A;  1BOS A;  5LL6 S;  2K5Q A;  2JSO A;  4Y7N H;  2EYO A;  1K0R A;  2XTI A;  3D6W A;  1NMF A;  1HXY D;  2HT1 A;  4A3I H;  2K33 A;  1GUS A;  4DR7 Q;  4BA2 I;  1UEA B;  3M4O H;  3DXJ C;  1EUJ A;  1TU2 B;  3RZD B;  5FLX L;  4A3J B;  2HCI A;  3G6J B;  4F7X A;  2D0P A;  1IYJ B;  2IY5 B;  3I91 A;  4R4T A;  4RHR A;  2NVY B;  4DV0 Q;  2ZTC A;  4NXN L;  3VR2 A;  1XNQ Q;  1QE6 A;  1NUC A;  3D8G A;  4GS3 A;  2XRS D;  4K0K L;  3V2T A;  5FOB B;  2R93 G;  1HA6 A;  1H9S A;  1L0Y B;  4XQQ A;  1VQN A;  1I4X A;  3A8K E;  2B2T A;  3OWE B;  4JI1 L;  3W1G A;  3CQZ B;  1N36 Q;  1N33 Q;  1EY6 A;  3I56 A;  3OTO L;  5BR8 Q;  1G2S A;  1VQ7 A;  2RDG A;  4B3T L;  5A2Q E;  4JVZ A;  3X3N A;  1VQE A;  2WP8 J;  3KOJ A;  3UE0 A;  4DV2 L;  2NVY H;  2MPM A;  2ZTD A;  1GOZ A;  2DNE A;  4HSV A;  4DAY B;  3OMG A;  1STE A;  4K14 A;  1WTR A;  5EPJ A;  4HJ5 A;  2NWG A;  4P72 A;  1Y69 U;  3KF6 A;  3QIA A;  1JQY D;  4C3H G;  5KYL A;  3CQZ H;  4AIM A;  2OWO A;  5K36 G;  3PUY A;  2WAQ G;  3OPO A;  1U4R A;  3HFZ B;  1XWE A;  2ENB A;  4DR6 Q;  2YTX A;  2EQS A;  1VMP A;  4RFB A;  5IGF A;  4R8I A;  1MI2 A;  1I4H A;  4J1M A;  1WTQ A;  3MWY W;  3OIP A;  4A3J G;  2EYF A;  3GTP B;  3VYU A;  4J8Q A;  4FP5 D;  2PW5 A;  3S2D B;  5ELO A;  1HZA A;  1T5X D;  5EAY A;  4YCW A;  2L9H A;  3NTH A;  3HOY B;  4C3J H;  4JK1 C;  3C1E A;  2QGQ A;  4FF3 A;  4A3M B;  4NXN Q;  1SE4 A;  3S9W A;  4YHH L;  2X6L A;  1B1Z A;  1V1P A;  2F0P A;  3S17 B;  1RCV D;  4ILW A;  1EQT A;  1CUK A;  3GTL B;  4NKL A;  4DAV A;  1WTW A;  2I0Q A;  2YV5 A;  4DV4 Q;  3VR3 A;  2OEO A;  3S2D H;  4BY7 B;  4ME5 A;  4PZ8 A;  1CKO A;  1IHZ A;  1IL2 A;  2A68 C;  1BF4 A;  4JI6 L;  3HOY H;  2BH2 A;  3EJI A;  2ALY B;  4ZK9 B;  1Y1W B;  5E4X A;  4FF2 A;  2F0K A;  3ONA B;  2GA4 B;  1A8V A;  1L0W A;  4HMJ A;  2DJG C;  2PNH A;  1QWY A;  5CV6 A;  2E5L L;  2QDB A;  2QKI C;  1WTV A;  1YJW A;  3HZX A;  3NQT A;  4DK0 A;  2IT1 A;  3S17 H;  5G3L F;  3GTL H;  2AKW B;  2N8N A;  4QCL A;  4CDD C;  1TS4 A;  4X62 Q;  3L2P A;  1QVF A;  3PF4 A;  2VXW A;  4OO1 I;  4BY7 H;  2E2J H;  1YJN A;  2CCZ A;  1L1O B;  2B39 A;  1JE5 A;  2WV6 D;  1VQ8 A;  1IBM Q;  4LNQ A;  4R1J A;  3ULP A;  5IP9 G;  3KBG A;  3EN2 A;  5JVG 3;  3ND9 A;  3K5L A;  1Y1W H;  2SDF A;  4FO2 A;  1KIX A;  3HKZ G;  2WII B;  3BG3 A;  2G9D A;  4DV7 L;  1O7Y A;  3Q0A A;  3CC4 A;  4OO1 G;  4A3M G;  1Q46 A;  3VR6 A;  5DEH A;  1S4Z A;  1B9M A;  2JA8 B;  4IFD H;  1TS5 A;  2R7F A;  1MJE A;  5IYC H;  3PO3 B;  5FJ8 H;  1X3Q A;  4G7H C;  2AMC B;  2VQF L;  2RQX A;  1PZJ D;  3IL8 A;  3VYR A;  2P5Z X;  3H0G G;  2JP1 A;  2BA0 A;  4I65 A;  3D31 A;  4IFD I;  4PNY A;  5IOC A;  3GV6 A;  4J15 A;  1EOV A;  1Y1W G;  1KNA A;  2CW0 D;  3K5O A;  1JB7 A;  2R7Z B;  4KMU C;  3OW2 A;  5C6A A;  4C3I B;  3TZU A;  2JA8 H;  1PFS A;  2F0W A;  5M3F G;  2KEN A;  2RCN A;  3PO3 H;  1M90 C;  3HOZ G;  4O42 A;  4RGN A;  1DCZ A;  4XXE A;  4DNI A;  2A68 D;  4R8N A;  1A3U A;  2N88 A;  1XPO A;  3HKS A;  2K50 A;  2HD3 A;  2LXK A;  3I4N H;  3CD6 A;  2PMZ E;  2ICE C;  1BCP D;  3X3M A;  2JN4 A;  1Q81 C;  4MTK A;  2Q8I B;  2WIN B;  4MHE A;  4WOR A;  3MFY A;  2R7Z H;  1IKL A;  2K05 A;  1KD1 C;  4JBM A;  4BBR B;  1UEB A;  4C3I H;  4G7Z C;  5JPN C;  2VW9 A;  4QB4 A;  2BA1 A;  1AFP A;  1CKM A;  1EY7 A;  1ICF B;  2F52 A;  1JJ2 A;  5EJW A;  3GV3 A;  1ROD A;  2Y0S B;  3E9I A;  3A7L A;  3BVG A;  4RKL A;  1PH5 A;  1RL2 A;  1TXY A;  3RN5 A;  3PIO A;  3ERS X;  3U4V A;  1KDC A;  3KF8 A;  4RAU C;  1CSP A;  2EE1 A;  5KIX A;  1I4G A;  4OWW B;  1NY4 A;  1UWV A;  4BBR H;  1Q8K A;  2RDF A;  1I94 Q;  2ASB A;  1SBB B;  2OQ0 A;  4JI5 L;  2PO4 A;  5KGU A;  1IBL Q;  5IGB A;  1PTO F;  2H1E A;  5DLQ E;  1CTM A;  2MJ8 A;  1D5X C;  4B3M L;  4JI7 L;  1HRJ A;  1IBK Q;  4H7B A;  4RWS C;  4B3R L;  5LMN Q;  1M8A A;  4TSS A;  3NBH A;  2Q2T A;  1EY8 A;  1GUO A;  4A3F G;  2UXB Q;  1K83 B;  2NZH A;  2O5J C;  1KXL A;  2AQ1 B;  2L11 A;  1QG7 A;  3BZC A;  4EQP A;  2EJM A;  3C3L A;  1WTH A;  4LF9 L;  1IW7 D;  3PMF A;  5COY A;  3TSS A;  5T1I A;  1L1O C;  2PNR C;  1SYF A;  4A93 G;  3V05 A;  4DUZ L;  1YI2 A;  4Y52 H;  2N3S A;  4JOI C;  1JR0 D;  2F4V L;  2FMM A;  1X55 A;  4EVO A;  4TRD A;  5GAD C;  1DZ1 A;  2DN8 A;  3DLL A;  2LKV A;  4K5W A;  1K83 H;  2A6H C;  2ZJP A;  2RSO A;  4V19 0;  4MNO A;  3PO2 H;  1KNE A;  2HCC A;  2N55 A;  1BBW A;  1AN8 A;  4X65 L;  4GZY C;  2B2U C;  3U50 C;  1Z47 A;  1STA A;  5C3E G;  1A2T A;  3I73 A;  1SNC A;  2K5N A;  1HH2 P;  4YCV A;  4DU9 A;  3MXP A;  5M5X B;  4L5R C;  1SAP A;  1SMY D;  1BUV T;  1K8O A;  1QCB D;  2I07 B;  1SSO A;  5C3W A;  1UE5 A;  1KAW A;  3GO5 A;  3PV0 A;  1LTI D;  3TS2 A;  2FHT A;  1GXD C;  2K1B A;  4APV A;  1MSH A;  4JI2 L;  3KDF A;  2KCT A;  4A3C G;  1XJV A;  4CDE C;  1K8G A;  5M5Y B;  2PZT A;  2ZT9 C;  3NUC A;  1GO3 E;  1PH1 A;  1A3T A;  1JJC B;  5J1Z A;  1E7Z A;  2K4K A;  4R4C A;  2JQO A;  3IKJ A;  3NTK A;  5KNC A;  4OEL B;  3UDI A;  1VQM A;  3MXG A;  2VQE L;  4PQX A;  4IUT A;  3MEF A;  2K5W A;  2E2I B;  3CC7 A;  3W5O A;  1Q90 A;  5EKL A;  4KTA A;  1JIC A;  4TKO B;  3H3V I;  4RGO S;  3WWV A;  4DR1 Q;  1LTB D;  3NP8 A;  2BE5 C;  1CQF A;  2RF4 A;  3PUX A;  3QR8 A;  1ESF A;  4KN7 C;  4DKA C;  5I2X A;  4A3B G;  1WI5 A;  2EIF A;  1V1Q A;  1VQC A;  1GM5 A;  1J5E L;  3TRZ A;  1JOQ A;  1W6J A;  3K5M A;  1K9M C;  1N34 L;  4JI4 Q;  3E9H A;  2JK8 A;  2Z1C A;  4MIU A;  3CCQ A;  2GVA A;  1EFI D;  4B3S Q;  1BQQ T;  3NE5 B;  4I7Z C;  3WOE A;  3S16 B;  1PRT F;  1XNR L;  2B2W A;  3Q8D A;  2E2I H;  5LMU Q;  2JEB I;  1X6O A;  2A6H D;  2PI2 E;  2Z6B A;  2ES2 A;  5KNB A;  4XTC S;  5IGC A;  4DR5 L;  4NMZ A;  1EIH A;  4QGU A;  1CM9 A;  2K14 A;  2Z6K C;  4NP5 A;  5CV5 A;  3NXW A;  4B9X A;  1SYB A;  4XT3 B;  1QNK A;  4XYO A;  2XGT A;  4KN4 C;  4DV5 L;  4U68 A;  3RZO B;  1X3F A;  4DFA A;  3PSI A;  4RA8 A;  4DNT B;  5BN3 A;  4HED A;  1VQB A;  3RR5 A;  3DEO A;  1CKN A;  3PF5 A;  1PZK D;  4HIO A;  1ENF A;  2WFW A;  1ZEQ X;  5JOB A;  1EFW A;  2KCM A;  4LF8 L;  5I9P A;  4LFB L;  1DOM A;  1TY2 A;  4GKJ Q;  1PFB A;  1YNJ D;  5HGT A;  2PQA B;  3TP8 A;  5AJ3 L;  1OXU A;  2HHH Q;  2L4N A;  4P73 A;  4DAY A;  2K04 A;  3QOJ A;  2WB1 E;  3RZO H;  1BO0 A;  3F2C A;  2WAC A;  4IUQ A;  1LT5 D;  1VQL A;  1AE3 A;  2Q2U A;  2UUC L;  4DR4 Q;  4JI8 Q;  5LHY 1;  2MO1 A;  4FNF A;  3HOX B;  2Z4H A;  1I6H H;  1WFQ A;  3T4A C;  4CJ2 C;  1PTO B;  2MO0 A;  2XWB B;  1EIF A;  1TWH B;  2RA4 A;  2EJG C;  2BE5 D;  1G6Z A;  4J6H A;  3AYH B;  1HA5 A;  3VDY A;  3CCR A;  1D2B A;  5JEA G;  4L5T A;  1JOK A;  3NWT A;  5L37 A;  1PLF A;  4PG3 A;  4CDF C;  3KJO A;  1HNW L;  4RCO A;  1QOH A;  1QUQ A;  4AYB B;  5FO7 B;  2EY5 A;  1OTC A;  4KY6 A;  4BS9 A;  1A2U A;  1B4O A;  1PTO H;  4C56 C;  1TWH H;  4DR7 L;  3NSW A;  1AW7 A;  1FR3 A;  2Q8T A;  1HUN A;  1NMG A;  4YIJ A;  3CCL A;  1I4Q A;  1CZW A;  1IXR A;  2B3G A;  2GN5 A;  1TWA H;  2HDM A;  4DV0 L;  3ND8 A;  3JC6 6;  1XNQ L;  4LUZ A;  4FF4 A;  2UXC Q;  5AJ3 Q;  3G6E A;  1EYC A;  3JAM c;  5KRU A;  3T1H Q;  3VA5 A;  1N36 L;  2ZXR A;  1GVP A;  1C8C A;  4HCE A;  4EQ5 A;  2VUM G;  1VQ4 A;  1N33 L;  2PW7 A;  2JEA I;  3JAM E;  4YWM A;  5C4J B;  3HOX G;  1HTL D;  1B3Q A;  1SJH D;  3VYT A;  4IUU A;  1TWC B;  1BBU A;  5C5L A;  3U4Z A;  1STG A;  5JVH 3;  3S1N B;  1L1O A;  3DM3 A;  4JPB W;  3QJY A;  4IAL A;  2X6G A;  1RDP D;  3PCO B;  2ATW A;  1E0B A;  1LT6 D;  5I4D A;  3ZYY X;  2K5H A;  2KED A;  1U4M A;  2R93 H;  4AYB G;  4X3T A;  3ZJY C;  2PYK A;  3H91 A;  1T5E A;  1K73 C;  3NHH A;  5C4J H;  2K01 A;  1YJ9 A;  2KVM A;  1ZXT A;  4C3H B;  1FGB D;  1CA6 A;  4C2M B;  1FJG Q;  4DR6 L;  1D7Q A;  2R3Z A;  4HCS A;  3CCV A;  4BXX G;  4QIW E;  3TS0 A;  2WAQ B;  4X3S A;  3M3Y H;  3K6O A;  3S1N H;  2N49 A;  4G7O C;  1NE3 A;  2HIX A;  4PZ7 A;  1PV4 A;  4RGM A;  1PFM A;  1F9Q A;  2IHE A;  2SNS A;  4GN5 A;  1STN A;  4QL5 A;  3E3X A;  3OOC A;  1STY A;  2NVT B;  5C0X I;  3S1M H;  4M1U B;  1KRT A;  2NVQ B;  2CHB D;  5M5W B;  3QG1 A;  1B44 D;  3LX0 A;  1E22 A;  3ERO A;  3R8B A;  4JBJ A;  1PRT B;  4C3H H;  2BH8 A;  4C2M H;  2L5T A;  3SK4 A;  5K36 H;  3STB C;  3G4S A;  3CC2 A;  5T1G A;  1K0S A;  2HDL A;  1AZP A;  1PA6 A;  4IJH A;  1PH4 A;  3M7N A;  2AQ2 B;  2WKC A;  5EBD A;  4C1N K;  2OTJ A;  1TS2 A;  5C0X G;  2OCE A;  4PZ6 A;  2B63 B;  4DV4 L;  3CKI B;  2G5D A;  5BN4 A;  1Q3L A;  3J81 c;  4HIK A;  3T1Y Q;  5H1S E;  3RNU A;  3RZD H;  4LMQ D;  5FO8 B;  4A3J H;  1LAC A;  2E8G A;  3MXN A;  1II3 A;  4K8I A;  3I4M B;  4P74 A;  2NVQ H;  1PTO C;  4FXK C;  1H9R A;  1TS3 A;  2EY1 A;  5M5W H;  3FPP A;  4UP7 A;  2G9H D;  3URY A;  1LV9 A;  2ZTE A;  4LK1 C;  1B53 A;  4ULL A;  2B29 A;  3K7A B;  2YTY A;  2MHV A;  2K28 A;  2L55 A;  5CYU A;  3EBE A;  1HHV A;  1O80 A;  3CAM A;  3J80 c;  1ML0 D;  4P2C B;  3OSO A;  4MTN A;  4X62 L;  4DAP A;  4BBS B;  4CKB A;  1EZ8 A;  3C46 A;  2KEE A;  1F2L A;  3J80 E;  5C44 G;  2PZU A;  3W1B A;  4DR3 Q;  1IBM L;  3I4M H;  1SYC A;  2OT2 A;  1GD7 A;  3TRE A;  3A5U A;  1SNM A;  1AP0 A;  1GUG A;  4WFN 3;  4IQZ A;  1WD0 A;  2K75 A;  3K7A H;  2XSC A;  1RTO A;  3HKZ B;  2PI2 A;  1STB A;  4LWC A;  4BBS H;  1JC7 A;  1X32 A;  4JC0 A;  1SRU A;  1F9R A;  1U4L A;  5LMN W;  2KQ3 A;  5IY0 A;  2RKS A;  5JJI A;  4JV5 Q;  2F3I A;  3FPU B;  1CA5 A;  2B63 G;  3HOW B;  3J81 j;  4A3K G;  2ICI A;  4F87 A;  3HOU B;  3NEL A;  2EDG A;  1GKH A;  3Q23 A;  1N8R C;  3WOF A;  3GTP H;  5IP9 H;  3I4M G;  3H0G B;  3FP9 A;  1S3O A;  4QUF A;  1S72 A;  2JA6 B;  4GOP B;  1HUM A;  1S40 A;  4G4K A;  4K5V A;  4OO1 H;  3RLO A;  1QVC A;  2MGS A;  1DGS A;  4A3M H;  4KD4 A;  4I7A A;  4OGQ C;  2EYM A;  4X3U A;  5M3M B;  4BWG B;  1EY0 A;  1MHW C;  2TMP A;  3HOW H;  1OXT A;  5M3F B;  3HOZ B;  4CJ1 B;  4BBS G;  1HQR D;  1EU4 A;  1WOC A;  2UUA Q;  1STH A;  1V9P A;  4DA2 A;  3H0G H;  1VQA A;  1S5F D;  4QF4 A;  2E2J B;  3A8J E;  1SYD A;  2EVB A;  3CW2 C;  1TKW B;  3PUZ A;  4K5X A;  5FLM G;  2OF1 A;  1X54 A;  1Y1V G;  3BYT B;  5A2Q L;  4JYA Q;  4LFC Q;  1MSG A;  3K59 A;  1MIU A;  1N32 Q;  2CH4 W;  1BR9 A;  3U9S A;  1ZKO A;  5M3F H;  4YWL A;  1VDZ A;  1R4Q B;  2B2V C;  3HOZ H;  1H9J A;  1Z6H A;  1BKB A;  4DXG A;  4GN4 B;  3I4O A;  1SNO A;  5C4H A;  4PMW A;  1PRT C;  3D4D A;  4NPS A;  1E24 A;  1PFN A;  3HOW G;  3D4W A;  1RF2 D;  3HOU G;  3GD7 A;  2F0L A;  2NUC A;  3CCS A; 
#chains in the Genus database with same CATH homology
 1ET9 A;  1EU3 A;  3KBX A;  4KY7 A;  1CHP D;  5IOD A;  4OHJ A;  2F0I A;  3M7G A;  1OXX K;  1IYU A;  5KEE A;  3MVV A;  5CV7 A;  1SE2 A;  1XTC D;  1BXT A;  1JCK B;  2XN9 C;  2NZ1 D;  1KAA A;  5J22 A;  3A54 A;  4A3D B;  1EWH A;  1KDB A;  1XXG A;  1TY0 A;  5CGK A;  4A3F B;  3K5N A;  2XRQ D;  1CT1 D;  4WRD A;  3GP7 A;  1HTP A;  1SYG A;  4XYQ A;  4A3E B;  2EYP A;  3EA6 A;  3R2T A;  2YYZ A;  3EFX D;  5DNF A;  1AEX A;  4A93 B;  2A6E C;  3I90 A;  4M8A A;  2BOS A;  2F0V A;  2L12 A;  2FJ2 A;  4Z9C B;  3DWQ A;  5C3E B;  2I46 A;  5CBA E;  2WKD A;  4DF7 A;  3GTK B;  1F2Y A;  1PRT D;  4L63 B;  1QIL A;  2F03 A;  1EEI D;  3IFT A;  1TWF B;  5CV8 A;  1U4P A;  2LY7 A;  3W3A A;  4O1N A;  4RGT A;  2SNM A;  2A69 C;  3BZD B;  3SXH A;  3CRL C;  1ET6 A;  5TSS A;  3A55 A;  5ISR A;  3VR4 A;  3SR1 A;  5KYI A;  5EGT A;  1V1P B;  4IUN A;  2R61 A;  4ODG A;  2PZW A;  4U67 3;  3SEB A;  4A3B B;  1F9P A;  2KUM A;  1XYI A;  4CKC A;  4IN3 A;  5I6Y A;  3OW7 A;  1EYA A;  3BDL A;  1ZYR C;  1EQV A;  3BDO A;  3S2H B;  2B2Y C;  2CVR A;  5EKI A;  4IUR A;  1I3Q B;  3P75 A;  5CBE E;  2AWO A;  3NTI A;  3KLS X;  1B50 A;  3SDZ A;  2R6G A;  4HR7 B;  2F0F A;  4OIK A;  2O4X A;  3R93 A;  1HQM C;  3GQB A;  2B8F A;  1CK1 A;  3HOV B;  3MXU A;  2NTS A;  4IUP A;  1E2Z A;  2L0C A;  1I4P A;  2JE6 I;  1KLG D;  4IUV A;  2VNU D;  2E76 C;  3Q6S A;  1BCP F;  4NW2 A;  1CI3 M;  3MZ5 A;  1O7Z A;  1ENC A;  4N9P A;  1O78 A;  2F0T A;  3R3O A;  3A7A B;  2F0U A;  2KJX A;  3G7L A;  4ABN A;  2IX0 A;  4ZUI A;  1D6E C;  1MD2 D;  1GUN A;  4Q5V A;  3P20 A;  1ONL A;  3TZD A;  3QOL A;  4RCN A;  1H9M A;  4OL7 A;  3Q24 A;  3F2U A;  1KTK A;  2KA7 A;  3WDN A;  1ENA A;  4EGV A;  1G2T A;  4FVM A;  5EKK A;  1ICW A;  4FYD A;  4QMG A;  5K5P A;  1S5D D;  2TSS A;  5JEA H;  4KJO A;  5IT9 E;  2BCO A;  1TQO A;  1EY9 A;  1DXM A;  3P7J A;  1Z7T A;  3J7A F;  4LJZ C;  5KND A;  4PMC A;  3RD4 A;  1A15 A;  3R2I A;  2F0S A;  1NSN S;  2VB2 X;  3VR5 A;  4HAE A;  1TWG B;  1PMR A;  3LWU A;  3W2D A;  2VUM B;  2QEJ C;  2KEC A;  2EZV A;  4DXF A;  1TT2 A;  4XT1 B;  3OHX C;  2JYO A;  4LAA A;  3DEP A;  3OMC A;  1IYV A;  4PV1 C;  3J7Y W;  3OWF A;  1DJR D;  1R4P B;  3KUP A;  4HMI A;  2M00 A;  3T56 B;  3N6R A;  3S1R B;  3H3V C;  3NK9 A;  2Z4I A;  1I50 B;  1MBY A;  1SNQ A;  3N52 A;  5D3D A;  3TBI B;  3P1H A;  3LWE A;  3SHL A;  4WJW A;  4RKB A;  4ZRZ A;  1E2W A;  3IAY A;  1VF5 C;  1WTP A;  2MUY A;  2E75 C;  2Q8R E;  3BDC A;  3I70 A;  1TVX A;  2RVL A;  2PQE A;  3NBI A;  1S5B D;  5CC4 A;  1PXU A;  1EEF D;  1CFM A;  1V1O A;  3HP3 A;  1ESR A;  3VA7 A;  3GTQ B;  5C5M A;  2DY7 A;  3MEH A;  2F0D A;  4CGY B;  3ITP A;  3NWS A;  2MP1 A;  2K5D A;  1NAP A;  3AU7 A;  5EPK A;  5ELE A;  3T51 B;  5IGE A;  3E0J A;  2IX1 A;  3ERQ A;  1HCZ A;  4EQN A;  4UDU C;  4KHZ A;  4XIG S;  4HTH A;  1LT4 D;  3I72 A;  4CKE A;  4B9W A;  2F0M A;  2JA5 B;  2E2H B;  4UAI A;  3KLR A;  2B2U A;  5C0X H;  2A74 C;  2B2Y A;  4A3I B;  2KCN A;  1BCP B;  1WD1 A;  5I9O A;  5C44 B;  1JOO A;  3T13 A;  5G3L D;  2D9U A;  1YNN C;  5DAU A;  3HEJ A;  3I4L A;  3L7Z C;  1RHP A;  1SYE A;  1DOL A;  2F0E A;  3NQI A;  3BS1 A;  1KDA A;  1TR5 A;  3KLS A;  3H94 A;  3CRK C;  2NN6 G;  3A56 A;  1Q12 A;  5FK9 C;  3E5S A;  1F2M A;  3D6C A;  1G91 A;  1LTA D;  3QO2 A;  2EJF C;  4HSP A;  4F88 A;  2NBF A;  4A3K B;  4X3K A;  2IL8 A;  4ZUJ A;  1Q1B A;  2YU9 B;  1OXV A;  3CU7 A;  3TME A;  3TN2 A;  5CR3 A;  3SK8 A;  3J81 E;  4NDX A;  5I2Y A;  1EOT A;  1CHQ D;  2FIN B;  1ILP A;  2D5D A;  2F3V A;  3H09 A;  2L1B A;  5IGG A;  1FD7 D;  3T53 B;  3TP7 A;  5ELC A;  2AQ3 B;  2PCF B;  3JAM L;  2CQA A;  3PIP 3;  3DMU A;  1J8I A;  4E6I A;  4ZKB B;  1SNP A;  1LT3 D;  1OO9 B;  3H6M A;  4ZQ3 A;  2F0G A;  1Y1V B;  4C3J B;  5ELB A;  5C3X A;  1LTR D;  1IKM A;  3O13 A;  1SE3 A;  1B2T A;  1YNN D;  1LTT D;  2RBM A;  5JPM C;  3BYY B;  3HG9 A;  3MTS A;  2PMZ B;  3MFG A;  1RJT A;  1Q1E A;  1PZI D;  1Y8P B;  2JA7 B;  4KD3 A;  4F8M A;  4CBV A;  3RLF A;  2AWN A;  5EPL A;  4RH6 A;  3TP5 A;  2EY2 A;  2F0Q A;  3T16 A;  2CW0 C;  4OIJ A;  1DOK A;  1F9S A;  2H4O A;  1LTS D;  1FNV A;  3M4Y A;  1K8M A;  2A73 B;  3BVM A;  1MGS A;  1PTO D;  4QUC A;  3S1Q B;  1A6X A;  4DNR B;  2VB3 X;  1Y8O B;  2LFN A;  3FDT A;  2C9O A;  2XIW A;  1BCP C;  4IZ8 A;  3U9O A;  4K6L A;  4IFD J;  2XVS A;  4XQJ A;  4R9W A;  2EYH A;  4C3J G;  1KAB A;  3J81 L;  1FNU A;  1JB3 A;  2RDH A;  4RHS A;  1FYC A;  3DM1 A;  4A3G B;  2KHS A;  5HUR A;  1EWC A;  2X69 A;  5JAV A;  2QIL A;  2QF7 A;  1V43 A;  1PDQ A;  1IL8 A;  2B2W C;  5FO9 B;  1BBX C;  2AUJ D;  1EZ6 A;  2XWJ B;  1FNW A;  5FKA C;  5A35 A;  4KK7 A;  2F0H A;  3J80 L;  2F4I A;  3OIQ A;  5DM7 3;  2C5C A;  2IJ0 A;  3S14 B;  1HFG A;  5C4Z A;  1NR4 A;  2RSN A;  4V0B A;  5DM6 3;  1M4V A;  1LTG D;  4BY1 B;  3BVZ A;  1VF7 A;  1EL0 A;  3UI2 A;  4S3S A;  1B9N A;  3K58 A;  3I4N B;  3QB3 A;  1BDO A;  5D14 A;  1DD2 A;  2LS0 1;  1WTO A;  3L3O C;  1U9R A;  3E6Z X;  5E3F A;  1IW7 C;  1H9S B;  4BA1 I;  1RD9 D;  2IW3 A;  3NPP A;  4IFD G;  2R92 B;  1PYW D;  1RKN A;  2D62 A;  4XQN A;  2HUG A;  3V96 A;  4KJN A;  2F0N A;  4KKT A;  5C4X B;  2SOB A;  4KHV A;  3I8Z A;  1D1I A;  3L9A X;  5LL6 X;  3RMH A;  1SMY C;  2AUK A;  4ZLT F;  2NB0 A;  2EY6 A;  1GUW A;  5COR A;  1Q8I A;  4KV6 A;  1D5Z C;  1D1K A;  5NUC A;  5F2D A;  4FXD A;  1EY4 A;  2O2L D;  1V8Q A;  1E2V A;  1VMC A;  2ID0 A;  3C1F A;  3TP6 A;  1CQV A;  1R9T B;  5I6W A;  4C3I G;  3VYS A;  3A8I E;  3MC0 B;  4EQO A;  1UAP A;  2IPK D;  2NYZ D;  1B3A A;  3SK6 A;  1HFN A;  5CMD A;  3PO2 B;  5IGD A;  3PUV A;  2DNC A;  1W6K A;  2K7V A;  1LAB A;  3M85 A;  2LMC B;  3SVM A;  1SND A;  1DON A;  1C4Q A;  1EY5 A;  2A6E D;  4ZYS A;  5M9O A;  2EPB A;  5EQ0 A;  1VCI A;  3GTG B;  2BDO A;  2K32 A;  2JXM B;  1GUT A;  3DWA A;  2HQE A;  1L0X B;  3LNN A;  2J4X A;  2WB1 B;  4C1N I;  2F1M A;  3GTM B;  2PPB C;  4MN3 A;  2B8G A;  4N9T A;  4Q0F A;  2M9V A;  1OXS C;  1S5C D;  2K6A A;  2F0O A;  5D3I B;  3GTJ B;  1TII D;  3IFD A;  2EXZ A;  4ZAI A;  1LLR D;  3C2P A;  1NR2 A;  1YNJ C;  2EOT A;  1C48 A;  4DK1 A;  4K2K A;  1XX8 A;  3EVQ A;  2O5I C;  3FVQ A;  2A69 D;  2NTT A;  2B2T C;  4PMB A;  1Y8N B;  5E4W C;  1I4R A;  5J39 A;  2QCP X;  1WTX A;  3DUZ A;  1QJO A;  4DGZ A;  1GHK A;  3I3C A;  1I6V C;  1JOR A;  1UNS A;  4FXG C;  1EYD A;  2F0J A;  5CV4 A;  1AZQ A;  2M2L A;  2BDN A;  4L8J A;  2E74 C;  5ELF A;  1WVL A;  3PUW A;  2B2V A;  1GHJ A;  4L6T B;  5JEA J;  2F3W A;  5D65 A;  1ZYR D;  5AFW A;  4H0L C;  2FMC A;  2XNA C;  3FEW X;  1O7L A;  1QB5 D;  2A5H A;  1SXT A;  2K03 A;  5ELD A;  1LO5 D;  2IX3 A;  3SE0 A;  2SEB D;  1WCM B;  1G8Z D;  2KOL A;  3RUZ A;  1JWM D;  1NCV A;  3GTO B;  1DM0 B;  5CV9 A;  3HRZ C;  1HPC A;  5BN5 A;  1SEB D;  1EIG A;  3S15 B;  1JE4 A;  2EYL A;  1JWS D;  4QIW B;  1I6H B;  2DY8 A;  2J0T D;  1X3P A;  4K6D A;  2NVX B;  5IIF A;  1KLU D;  3HGB A;  4H44 C;  1DYQ A;  3D3R A;  3EQL C;  3FKI B;  4CHT B;  1QNU A;  3FMC A;  1S5E D;  2E2D C;  1F77 A;  1SFO B;  4CJ0 B;  1F2Z A;  4KKU A;  4KI0 A;  3AMU A;  3MHB A;  3PIO 3;  4JBW A;  5FLX E;  1G29 1;  1CZG A;  2OXP A;  3K0Y A;  1BNZ A;  1SJE D;  3DHQ A;  2J7Z A;  1A3V A;  1UUP A;  2IWH A;  4KY5 A;  3CHB D;  5JJZ A;  1J9O A;  2V4D A;  1RTN A;  1TWA B;  2EYJ A;  3TDQ A;  4XDX A;  1GJX A;  4TQU S;  4K2L A;  3QWN A;  3J7A V;  3MAQ A;  4B08 A;  3D4R A;  4HN7 A;  2D2C C;  2ZXO A;  3K57 A;  3DWP A;  2Z8L A;  1ILQ A;  3FRP B;  2ZXP A;  1D5M C;  5E1F A;  3KK7 A;  5C0X J;  4H13 C;  3HS0 C;  3SK5 A;  2R93 B;  5IT9 L;  5EBC A;  4ID6 A;  4KKS A;  2NN6 H;  4Y7N B;  2FFK B;  3M3Y B;  3Q22 A;  1SDF A;  1JWU D;  4FF1 A;  3AB9 A;  4G57 A;  3MA2 B;  4K8J A;  3M4O B;  1H9K A;  2KCC A;  2NN6 I;  3S1M B;  4ZKC B;  4DN4 M;  1BOS A;  5LL6 S;  2K5Q A;  2JSO A;  2EYO A;  3D6W A;  1HXY D;  2K33 A;  1GUS A;  4BA2 I;  1UEA B;  3DXJ C;  1TU2 B;  3RZD B;  5FLX L;  4A3J B;  2HCI A;  3G6J B;  4F7X A;  3I91 A;  4RHR A;  2NVY B;  3VR2 A;  1QE6 A;  1NUC A;  3D8G A;  2XRS D;  3V2T A;  5FOB B;  1HA6 A;  1H9S A;  1L0Y B;  4XQQ A;  1I4X A;  3A8K E;  2B2T A;  3OWE B;  3CQZ B;  1EY6 A;  1G2S A;  2RDG A;  5A2Q E;  3X3N A;  2WP8 J;  2MPM A;  1GOZ A;  2DNE A;  4HSV A;  3OMG A;  1STE A;  4K14 A;  1WTR A;  5EPJ A;  2NWG A;  1Y69 U;  3QIA A;  1JQY D;  4C3H G;  5KYL A;  5K36 G;  3PUY A;  3OPO A;  1U4R A;  1XWE A;  2ENB A;  1VMP A;  4RFB A;  5IGF A;  4R8I A;  1MI2 A;  1I4H A;  4J1M A;  1WTQ A;  3MWY W;  3OIP A;  2EYF A;  3GTP B;  3VYU A;  4J8Q A;  4FP5 D;  2PW5 A;  3S2D B;  1T5X D;  2L9H A;  3NTH A;  3HOY B;  4JK1 C;  3C1E A;  4FF3 A;  4A3M B;  1SE4 A;  3S9W A;  2X6L A;  1B1Z A;  1V1P A;  2F0P A;  3S17 B;  1RCV D;  4ILW A;  1EQT A;  3GTL B;  4NKL A;  4DAV A;  1WTW A;  3VR3 A;  2OEO A;  4BY7 B;  4ME5 A;  1IHZ A;  2A68 C;  1BF4 A;  3EJI A;  4ZK9 B;  1Y1W B;  5E4X A;  4FF2 A;  2F0K A;  3ONA B;  2GA4 B;  4HMJ A;  1QWY A;  5CV6 A;  2QDB A;  2QKI C;  1WTV A;  3HZX A;  3NQT A;  4DK0 A;  2IT1 A;  5G3L F;  4QCL A;  1TS4 A;  2VXW A;  4OO1 I;  2B39 A;  2WV6 D;  3KBG A;  5JVG 3;  3ND9 A;  3K5L A;  2SDF A;  4FO2 A;  2WII B;  3BG3 A;  2G9D A;  1O7Y A;  3Q0A A;  4OO1 G;  3VR6 A;  5DEH A;  1S4Z A;  1B9M A;  2JA8 B;  4IFD H;  1TS5 A;  3PO3 B;  1X3Q A;  4G7H C;  2RQX A;  1PZJ D;  3IL8 A;  3VYR A;  2JP1 A;  2BA0 A;  4I65 A;  3D31 A;  4IFD I;  4PNY A;  5IOC A;  3GV6 A;  1KNA A;  2CW0 D;  3K5O A;  2R7Z B;  4KMU C;  5C6A A;  4C3I B;  3TZU A;  2F0W A;  4O42 A;  4RGN A;  1DCZ A;  4XXE A;  2A68 D;  4R8N A;  1A3U A;  2N88 A;  2ICE C;  1BCP D;  3X3M A;  2Q8I B;  2WIN B;  4MHE A;  4WOR A;  3MFY A;  1IKL A;  2K05 A;  4BBR B;  4G7Z C;  5JPN C;  4QB4 A;  2BA1 A;  1AFP A;  1EY7 A;  5EJW A;  3GV3 A;  1ROD A;  2Y0S B;  3A7L A;  3BVG A;  4RKL A;  1KDC A;  3KF8 A;  4RAU C;  2EE1 A;  5KIX A;  1I4G A;  2RDF A;  1SBB B;  2PO4 A;  5KGU A;  5IGB A;  1PTO F;  2H1E A;  1CTM A;  2MJ8 A;  1D5X C;  1HRJ A;  4H7B A;  4RWS C;  1M8A A;  4TSS A;  3NBH A;  1EY8 A;  1GUO A;  1K83 B;  2O5J C;  2AQ1 B;  2L11 A;  1QG7 A;  4EQP A;  2EJM A;  3C3L A;  1IW7 D;  3PMF A;  5COY A;  3TSS A;  5T1I A;  2PNR C;  1SYF A;  3V05 A;  1JR0 D;  2FMM A;  4EVO A;  4TRD A;  1DZ1 A;  2DN8 A;  2LKV A;  4K5W A;  2A6H C;  4V19 0;  2RSO A;  1KNE A;  2HCC A;  2N55 A;  1AN8 A;  4GZY C;  2B2U C;  1Z47 A;  1STA A;  1A2T A;  3I73 A;  1SNC A;  4DU9 A;  3MXP A;  5M5X B;  1SAP A;  1SMY D;  1BUV T;  1K8O A;  1QCB D;  2I07 B;  1SSO A;  5C3W A;  3GO5 A;  3PV0 A;  1LTI D;  2FHT A;  1GXD C;  2K1B A;  1MSH A;  5M5Y B;  2PZT A;  2ZT9 C;  3NUC A;  1A3T A;  5J1Z A;  3IKJ A;  3NTK A;  5KNC A;  3MXG A;  4PQX A;  4IUT A;  2K5W A;  2E2I B;  1Q90 A;  5EKL A;  4KTA A;  1JIC A;  4TKO B;  4RGO S;  1LTB D;  3NP8 A;  2BE5 C;  1CQF A;  3PUX A;  1ESF A;  4KN7 C;  5I2X A;  1JOQ A;  1W6J A;  3K5M A;  4MIU A;  2Z1C A;  1EFI D;  1BQQ T;  3NE5 B;  4I7Z C;  3WOE A;  3S16 B;  1PRT F;  2B2W A;  2JEB I;  2A6H D;  5KNB A;  4XTC S;  5IGC A;  4NMZ A;  1EIH A;  1CM9 A;  4NP5 A;  5CV5 A;  3NXW A;  4B9X A;  1SYB A;  4XT3 B;  1QNK A;  4XYO A;  4KN4 C;  4U68 A;  3RZO B;  4DFA A;  4RA8 A;  4DNT B;  5BN3 A;  4HED A;  3DEO A;  1PZK D;  1ENF A;  1ZEQ X;  5JOB A;  5I9P A;  1DOM A;  1TY2 A;  1PFB A;  1YNJ D;  5HGT A;  3TP8 A;  1OXU A;  2L4N A;  4DAY A;  2K04 A;  3QOJ A;  1BO0 A;  2WAC A;  4IUQ A;  1LT5 D;  5LHY 1;  4FNF A;  3HOX B;  2Z4H A;  3T4A C;  4CJ2 C;  1PTO B;  2XWB B;  1TWH B;  2RA4 A;  1G6Z A;  2EJG C;  2BE5 D;  4J6H A;  1HA5 A;  1D2B A;  5JEA G;  1JOK A;  3NWT A;  1PLF A;  4RCO A;  1QOH A;  4AYB B;  5FO7 B;  2EY5 A;  4KY6 A;  4BS9 A;  1A2U A;  1B4O A;  1PTO H;  4C56 C;  3NSW A;  1AW7 A;  1FR3 A;  2Q8T A;  1HUN A;  4YIJ A;  1I4Q A;  1CZW A;  2HDM A;  3ND8 A;  4FF4 A;  1EYC A;  5KRU A;  3VA5 A;  2ZXR A;  1C8C A;  4HCE A;  2PW7 A;  2JEA I;  3JAM E;  5C4J B;  1HTL D;  1SJH D;  3VYT A;  4IUU A;  1TWC B;  5C5L A;  1STG A;  5JVH 3;  3S1N B;  3QJY A;  4IAL A;  2X6G A;  1RDP D;  1E0B A;  1LT6 D;  5I4D A;  3ZYY X;  2KED A;  1U4M A;  4X3T A;  2PYK A;  3H91 A;  1T5E A;  3NHH A;  2K01 A;  2KVM A;  1ZXT A;  4C3H B;  1FGB D;  1CA6 A;  4C2M B;  2R3Z A;  4HCS A;  2WAQ B;  4X3S A;  3K6O A;  4G7O C;  4RGM A;  1PFM A;  1F9Q A;  2SNS A;  1STN A;  3OOC A;  1STY A;  2NVT B;  5C0X I;  4M1U B;  2NVQ B;  2CHB D;  5M5W B;  3QG1 A;  1B44 D;  3LX0 A;  3ERO A;  3R8B A;  1PRT B;  2L5T A;  3SK4 A;  5K36 H;  5T1G A;  2HDL A;  1AZP A;  3M7N A;  2AQ2 B;  2WKC A;  5EBD A;  4C1N K;  1TS2 A;  5C0X G;  2B63 B;  3CKI B;  5BN4 A;  1Q3L A;  4LMQ D;  5FO8 B;  1LAC A;  3MXN A;  1II3 A;  4K8I A;  3I4M B;  1PTO C;  4FXK C;  1H9R A;  1TS3 A;  2EY1 A;  3FPP A;  2G9H D;  3URY A;  1LV9 A;  4LK1 C;  1B53 A;  4ULL A;  3K7A B;  2MHV A;  2K28 A;  2L55 A;  5CYU A;  1HHV A;  1O80 A;  1ML0 D;  4P2C B;  3OSO A;  4BBS B;  4DAP A;  4CKB A;  1EZ8 A;  3C46 A;  2KEE A;  1F2L A;  3J80 E;  2PZU A;  1SYC A;  2OT2 A;  1SNM A;  1AP0 A;  1GUG A;  4WFN 3;  4IQZ A;  1WD0 A;  2XSC A;  1RTO A;  3HKZ B;  1STB A;  1JC7 A;  1X32 A;  1F9R A;  1U4L A;  2KQ3 A;  2RKS A;  3FPU B;  1CA5 A;  3HOW B;  2ICI A;  4F87 A;  3HOU B;  2EDG A;  3Q23 A;  3WOF A;  3H0G B;  4QUF A;  2JA6 B;  1HUM A;  4G4K A;  4K5V A;  4OO1 H;  2MGS A;  4KD4 A;  4OGQ C;  2EYM A;  4X3U A;  5M3M B;  4BWG B;  1EY0 A;  2TMP A;  1OXT A;  5M3F B;  3HOZ B;  4CJ1 B;  1HQR D;  1EU4 A;  1STH A;  4DA2 A;  1S5F D;  4QF4 A;  2E2J B;  3A8J E;  1SYD A;  2EVB A;  1TKW B;  3PUZ A;  4K5X A;  2OF1 A;  3BYT B;  5A2Q L;  1MSG A;  3K59 A;  1BR9 A;  3U9S A;  1ZKO A;  1VDZ A;  1R4Q B;  2B2V C;  1H9J A;  1Z6H A;  4DXG A;  5C4H A;  1SNO A;  4PMW A;  1PRT C;  3D4D A;  1PFN A;  3D4W A;  1RF2 D;  3GD7 A;  2F0L A;  2NUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...