4DAYA

Crystal structure of the rmi core complex with mm2 peptide from fancm
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
144
structure length
144
Chain Sequence
IAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/hydrolase
molecule keywords RecQ-mediated genome instability protein 1
publication title Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dayA01
3NBHA 4DAYA 3MXNA
chains in the Genus database with same CATH superfamily
3F8TA 2YTVA 4RGTA 4FF4A 1SROA 4P74A 1RIPA 2XN9C 4YY3Q 2IHEA 4K6DA 1WTRA 3FDTA 1KLUD 1I6HB 4DV3Q 1BXTA 3DEPA 2IWHA 1N33Q 4P2CB 1FNVA 1DGSA 2Q8TA 4KKUA 5FO7B 4A3IH 1EOTA 4ZK9B 4LF4L 3OTOQ 4C3HB 2NN6G 3UE0A 1CKOA 2ID0A 3UI2A 2F4VQ 2OXPA 1KC8C 3IFDA 3HKSA 1S5ED 4PZ7A 1VF7A 4M1UB 5A2QL 5DM63 3EIVA 2QA4A 1NAPA 4H44C 1OXUA 1EY8A 2K1BA 2KENA 1QB5D 3HOVG 1C4QA 4ALPA 2K5QA 1B53A 5CV8A 3KLWA 3I73A 3I56A 5C4XG 1EQRA 1STYA 2E76C 4RHSA 4GOPA 3HOWB 1D5ZC 4DAYA 3GTGH 4CDEC 1SNPA 1W3SA 5IWAQ 1IHZA 3HS0C 2BA1A 3VYSA 3G6JB 1Y1WB 2AKWB 1JOOA 4UDUC 4HJ7A 1PLFA 5JJKA 1H95A 1IL8A 3KF8A 5K36H 3K0XA 4XDXA 1VQPA 2R7ZH 2MP1A 1RJTA 2WINB 3M4PA 4XQNA 4BXXH 3CU7A 2Z4IA 2EYMA 3H3VH 4BY7H 1HJPA 1PH5A 1LT3D 2HQLA 1L0YB 3T16A 4HJ5A 5CORA 2RKSA 3HKZG 1LTBD 3A7LA 4DR2L 3F1ZA 5EAYA 3SVMA 5M3MB 2E75C 3QB3A 1XPRA 2PPBC 2PCFB 4F87A 1MHWC 4A3EG 1I94Q 1PDQA 2WIIB 5JPNC 1F2YA 2N78A 2PQEA 1PZJD 4UP9A 4WJ3M 1NY4A 1BNZA 2R6GA 1KIXA 2K03A 4HIDA 4OWTB 2MGSA 4RCOA 1E22A 1BDOA 2VXWA 3K8AA 4O0AA 1HH2P 1K83H 4IJLA 4DV2L 2B2UA 3I3CA 1JWMD 2JEAI 4XT1B 3GTMB 3JAMi 4AQYL 2PYKA 3BYTB 5FKAC 4M8AA 5BR8Q 4DXGA 3R3OA 2F0JA 4RA8A 2VB3X 3K7UC 4ZYSA 3T1YL 2OCEA 1GO3E 3L7ZC 5FJ8G 2P5ZX 4ZKBB 5M9OA 1I4QA 1EY9A 2LY7A 3J80L 3ER0A 1K8GA 3PO3B 1DYQA 2AQ2B 4OX9L 4B9WA 3WDNA 2PMZE 4AYBG 1ZYRC 4IURA 5IYCG 4LFAQ 4C56C 1ZKOA 1HR0L 3FPUB 1V43A 2B2TC 1SYEA 1BF4A 1H9KA 3CW2C 2B2YA 1CM9A 2E2IB 2NVYB 4JI0Q 3J81i 4A3LH 4A3MH 4GLAC 1Y8OB 4N9PA 2F0WA 1G6PA 3OW7A 1LV9A 2QW7A 2B8FA 2Z4HA 3FKIG 4DK6C 4A3DG 2EY6A 4DV5L 3CHBD 4KV6A 4KY7A 4DV1L 2R92B 3NP8A 1QZGA 2D5DA 2Z6KC 1TWFB 2N49A 2UXDL 3GV6A 3SEBA 1CI3M 5CGKA 2N8NA 3D8GA 1WCMG 4JI2L 5BN3A 1EQTA 3S15B 1R4QB 3K57A 2AUKA 4IUUA 5KIXA 4XYOA 1S5BD 2J7ZA 3C46A 3HOUB 1ET9A 1VQNA 3EROA 1MD2D 1AW7A 1CQFA 1HZCA 4POGA 4IPGA 3QO2A 5HGTA 4OIKA 4BBRH 2EZVA 1UWVA 2VQEQ 4YIJA 3ERQA 1CUKA 5T1IA 2EVBA 4A3FH 1GUGA 1NNXA 1KDAA 2RQXA 1RF2D 4IZ8A 5IIFA 4A93B 2DNEA 4QMGA 3KBGA 3M3YB 1FYCA 4CBVA 1FNUA 3O13A 1SRUA 5NUCA 2CFMA 1I6HH 2K52A 3E5SA 1Z7TA 3G71A 3C1EA 3DWPA 1YJWA 2OTJA 2I5MX 5C3EG 5IP7H 1OXSC 5JAVA 1JT8A 4K5WA 2Z6BA 5C0XJ 2J4XA 1HTPA 1UEBA 2Q2UA 1X9NA 1WTHA 4MTNA 2KCNA 1N8RC 4OO1G 1A3UA 3M7GA 3FMCA 2BOSA 4WRDA 5IYBG 2F0HA 4X3SA 4P75A 2SEBD 3DUZA 3P7JA 1MJCA 5I2XA 1KL9A 1N36Q 4QQBX 2K04A 1EY7A 4A3BB 3G6EA 4IALA 1G8ZD 5ELNA 1R9TB 3HOWH 3TSSA 2XWJB 2FXQA 5DNFA 4KY5A 3QIAA 3K7AB 2D62A 5IYDG 1JWUD 3ZJYC 1AN8A 3S16B 4F7XA 5J39A 2UUAL 5DAUA 2O2LD 1RCVD 2JJQA 1YJNA 4DF7A 3RLNA 4A4IA 3PUYA 5EPLA 4RHRA 1EYCA 1EUJA 3MWYW 1STNA 1O78A 1JB3A 3CQZB 1X3QA 1XTCD 5C44G 5D3IB 4QCLA 1EQVA 2PMZB 1S72A 2HUGA 5M3FB 1CK1A 3TDQA 3CAMA 3HOZG 4K5XA 1WTXA 3ULPA 2F0UA 5M3MH 2JA6B 4JBKA 1CHQD 5CC4A 3BDLA 3MEFA 3NBIA 4JI8Q 2MJ8A 3SHLA 2H5XA 1TVXA 3M7NA 4R4IA 1BCPD 2I0QA 2IX3A 3MZ5A 4LUOA 1BCPB 2AQ1B 2HQEA 2A6EC 2PI2A 4DUYL 1D6EC 1L1OC 4BBSH 1PZID 5IT9L 3NBHB 3F2BA 3ONAB 3TP5A 4RH6A 2F0EA 1EYGA 2R93H 1TWGH 1ASZA 4YHHL 3PO2G 1RDPD 1BQQT 3GTMH 1QNUA 2EPBA 2JN4A 5CBAE 1FVIA 5GAEC 5C4HA 1AFPA 2WV6D 4DV4Q 1NE3A 4A3IB 1U4PA 5M5WH 3WWVA 1ILPA 2K05A 4JBWA 4APVA 5JVH3 1PTOC 4YY3L 3WOEA 4NXNQ 3GP7A 1C0AA 4DV3L 1QOHA 4JBJA 4IFDJ 1N33L 3GO5A 2XTIA 3PO3H 1U9RA 2Y0SG 1L0XB 4JI1Q 3H0GG 2UXBQ 4IUVA 2C35B 3OTOL 1QJOA 3CCUA 3ULLA 1Y1VG 3PIPA 3CP0A 4KHPQ 2ZTDA 2F4VL 3NE5B 1EL0A 3RMHA 3KJPA 3GTGB 2ICEC 3LWUA 3P75A 3KFUA 3KOJA 4FXDA 1QNKA 1O7LA 2A19A 1UE5A 3I4MH 3RZDH 3CKIB 3NXWA 3T13A 2N3SA 5FLXE 1VCIA 1STEA 3LWEA 2L4NA 3S14B 3JAML 4DA2A 1OXXK 1NMFA 2R92H 4UP7A 2F0PA 2HT1A 5IWAL 1TWFH 1DOLA 4X62Q 1NJIC 5C4JH 1K3RA 4BS9A 3OW2A 2A68C 2QEJC 2A1AA 3ND9A 2CW0D 2CWPA 5EPKA 4LUZA 1LTGD 2JP1A 1F9SA 1GUOA 2ZXPA 3HOUH 2LXJA 3HOXG 1DCZA 1S3OA 4DNIA 2ZTEA 2NYZD 1KNEA 3J80i 1P16A 1XNQQ 3OWFA 3CCLA 4DR1Q 3TS0A 1STHA 4JI5Q 3UDGA 4DR3Q 4A3JH 4KD3A 1C8CA 1TWCH 1NCVA 3S9WA 4LNQA 4DU9A 5GAGC 4HTHA 3FVQA 3NPPA 4GKJQ 1PH8A 4R8IA 3D4RA 4ZCKA 4A93H 1S5DD 2V1CC 4R4QA 1Q8IA 1I94L 1A15A 4JBMA 4MIUA 3MA2B 3PQIA 4HSPA 1FNWA 3E9IA 1SLJA 2ICIA 3NHHA 5G3LF 3QOJA 1G91A 3DLLA 1TWAH 3PF5A 2KHIA 3SK8A 3OMCA 1VQEA 3Q23A 1MSHA 3CF5A 1JOQA 4BY1G 3I4NH 5C4ZA 1VQGA 4H02A 4ZLTF 3OOCA 1B44D 4DFAA 3EFXD 3PF4A 1EWIA 3G48A 1C7YA 1EU4A 4NP5A 1VQMA 1D2BA 2A8VA 2SOBA 1RKNA 1PH3A 4LF8Q 5J22A 2G9DA 1EYDA 1IKMA 3NBHA 1VQDA 3U4VA 3ITPA 1HQMC 3KF6B 2MO1A 3LNNA 1EIYB 2RHQB 1R9TH 2NB0A 3KDFB 3JC66 4J8QA 1N34Q 4G7ZC 2F0MA 2F0SA 1EOVA 1V9PA 4MN3A 4A3MB 1EY4A 2JYOA 3K7AH 3W1GA 1SEBD 2PZWA 4LFAL 2HDLA 3BU2A 1WTVA 4RAUC 1YVCA 3VYRA 2IPKD 4JI6Q 4JI0L 2O5JC 1JCKB 5LMNW 5LL6X 5FOBB 3TMEA 4G7HC 4EQ5A 2Q8IB 2BDNA 1G6ZA 4PZ6A 5IGDA 2QEXA 3AMUA 2KA7A 1PHJA 4JOIC 3FHWA 3I90A 4IUPA 3PUZA 3H15A 3A56A 5LL6S 4LF7Q 4P71A 1YNJD 2NN6H 2JA9A 2WAQE 2K33A 2D0OA 3BVGA 1E2VA 3UDXA 1V1QA 1XMQQ 3R2IA 5CBEE 4CKBA 2RF4A 1JJCB 1B3QA 1B8AA 2K50A 4L63B 3HOVH 4A3GG 5C4XH 2IY5B 1HUMA 4I7ZC 1VQ5A 1VQOA 3MFGA 2VQEL 1O7IA 5I6WA 2F0IA 1G51A 3UDIA 1LTTD 3RD4A 1NSNS 4C3JB 1E7ZA 3V2TA 3H09A 5JJZA 3RUZA 4POFA 3FPPA 3Q0AA 1HHVA 1D1KA 2PI2E 4FP5D 3UDFA 4J6HA 1A2UA 1E0BA 1B3AA 3BS1A 4GN4B 2JA5B 4Y52H 3W3AA 4K5VA 1ICFB 2ZM6Q 4ID6A 3KBXA 4OHJA 1SNOA 2DGYA 4IFDG 5E7NA 4BA1I 5FO9B 5FLMG 3D4WA 1X55A 3OWEB 3HOYG 1FR3A 1MJEA 4B3TQ 4Q5VA 4PNYA 1BBXC 2JA8G 4A3EH 1ZXTA 1ICWA 4Q0FA 4LFCL 1EWHA 4PV1C 5AJ3Q 1PH4A 2K5VA 2YTYA 1Q7YC 1M90C 2FMCA 1NBWA 4NMZA 5C5MA 1SE3A 3A8JE 3STBD 1YNJC 1N36L 1VMPA 3I7FA 4LMQD 3X3MA 2OEOA 4PQXA 3S14H 4XIGS 1LUZA 5AFWA 4XXEA 1ZYRD 2R7DA 2NTSA 3K81C 1SSOA 1BKBA 1A0IA 1KRSA 1L2FA 2K5DA 3KF6A 2K5HA 4FF3A 1U5KA 3AYHB 1UEAB 1PFSA 1YIJA 2PQAB 3SGIA 3E0JA 2F0QA 2R7FA 1X3FA 1IL2A 3KDFA 4R4OA 3TBIB 3CRLC 2B63B 3WOFA 5FJ8H 2EY1A 4R1JA 3ULJA 1PRTF 4X6AH 2Q2TA 1DONA 5A2QE 1PH9A 2B2WC 1GM5A 2F0KA 3BZDB 2KCCA 2ZJRA 4R9WA 5IYCH 4JI8L 4BBSB 4DV7Q 1HFGA 1SMYD 1PFMA 4JPBW 4UP8A 1JORA 1X65A 2R93B 1TWGB 1CKNB 5D14A 3OPOA 1D1IA 2HDMA 1E2WA 4DV0L 1TY0A 2OTLA 2WB1B 3NK9A 2VNUD 4A3DH 5L37A 2JEBI 2LFNA 5M5WB 2WAQB 3MXGA 1LTSD 5K36G 2C9OA 3NUCA 2R7ZG 2F3VA 1FJGQ 3STBC 1WCMH 2M9VA 3GV3A 2Q8RE 4KD4A 1ESRA 2EE1A 2VUMB 1CFMA 4BY7G 2NZ1D 4DV4L 2G9HD 2RCNA 3HZXA 3ZYYX 4EQPA 4CJ1B 1QILA 1MIUA 3KK7A 4NXNL 3RZOB 1ILQA 3K58A 4RWSC 2EOTA 2IT1A 4NXMQ 2HD3A 3L0OA 1TY2A 3OMGA 3I4OA 2ZT9C 4JI1L 2UXBL 4DR6Q 1I4RA 1LABA 1G2SA 2OQKA 2SNSA 2IX1A 3I4MB 1DOKA 3S2HB 3RZDB 2F0LA 3G4SA 4KHPL 2NBFA 4K8JA 5A35A 4HJ8A 1KHIA 2LS01 1EWCA 1AZQA 4C2MB 1HQRD 3GTQH 1GUTA 1EFWA 5CYUA 3D6CA 1DOMA 5BN5A 5C4JB 1LLRD 4Y7NH 2HHHQ 2D9UA 1J8IA 3BVMA 4OL7A 5F2DA 1SMYC 2ENBA 2PO4A 1UNSA 3T56B 5C3EH 2KCMA 1TQOA 2EY2A 4N8X1 4DNTB 1FGUA 1Z47A 2I07B 4X62L 4DV6Q 1YNND 1O80A 3N6RA 1CTMA 4O42A 4EQNA 1QCBD 2G5DA 3K6OA 3RN2A 1H9JA 1SJHD 4A3JB 1Q90A 1E24A 2VB2X 4IQZA 2XGTA 5IYBH 3J80E 1TWCB 1I4XA 1STGA 1EY0A 1XMOQ 2ATWA 1XNQL 2F03A 2NTTA 1WFQA 4DR1L 3BDCA 2F52A 4JYAQ 2NN6I 4JI5L 4DR3L 4LK1C 3K0YA 4C3IB 1X32A 2B2TA 3KLSA 4C3JH 5IYDH 4A3LG 4A3MG 1HNXQ 3L9AX 3NENA 4GKJL 2PQAA 2Q2IA 3N52A 3M4QA 1TWAB 1SYCA 4KMUC 5IE8A 1HR0W 2ES2A 4GLXA 2I5LX 2D2CC 3BYYB 3I4NB 3S1QH 2A6ED 4WJWA 5IP9H 4ZKCB 1JE5A 1X54A 2F0GA 3CCJA 1CQVA 1JJ2A 2JA5H 2CQOA 1L1OB 5IGBA 4A3KG 3B6YA 3S1RB 2JA7B 1B70B 2KOLA 3GTOB 3KUPA 5C44H 1AH9A 4LFCQ 2Z6KA 3V05A 4B9XA 3PIOA 3HOZH 1J5EQ 3QOLA 4H0LC 2ZXRA 4F8MA 2CCZA 3MXUA 5EBDA 2B2VC 4XYQA 1IYUA 3GTPB 1CKNA 1XNRQ 1MGSA 2RHSB 1A3VA 4LF8L 5GQOA 1PTOD 3PUWA 4BBRG 2A73B 1ENAA 4RGMA 2EDGA 4CHTB 2EYOA 2K32A 2BDOA 1PTOB 5C5LA 2EJGC 1IKLA 5I9PA 2CWAA 1YNNC 4A3FG 3E3XA 2X6GA 5EPJA 3S2DH 2FINB 1IW7D 3TQYA 1N34L 2MQHA 3V96A 1I3QH 4K0KQ 1B50A 2UU9Q 5CMDA 3DWQA 3PO2H 3QJYA 1AP0A 2PZTA 2CKZB 5E3FA 3DMUA 3NTIA 2K5WA 1MBYA 4DAVA 4YWKA 3PUVA 4L6TB 2SDFA 4I7AA 3RLFA 4HMJA 1JB7A 4K2KA 2RCFA 2AQ3B 4B3RQ 1YI2A 4JI6L 5J3BA 3QR8A 3EA6A 4ZAIA 3NTHA 2I5HA 2YTXA 2B63H 4QB4A 4C3HG 1LTLA 3RLOA 1XJVA 2A6HC 4DV0Q 2ZJPA 2AUJD 2TSSA 3TEHB 3HOVB 4LF7L 2ZJQA 3SK4A 3M4YA 2A68D 5C4XB 2DJFC 1WJJA 4X66L 4LUVA 1XMQL 1KLGD 3NQTA 1YEZA 1YHBA 2IW3A 1RL2A 3HOWG 1NMGA 3J7YW 1KRTA 1VQKA 4L5QA 1K8AC 4KN7C 3ERSX 4ZRZA 3DWAA 3TRZA 1JOKA 2Q2HA 1IBMQ 1JWSD 1Y1WG 2B39A 1XTDA 4B08A 3R8BA 3M85A 2BH8A 3A7AB 2AWOA 3D3RA 3RN5A 4DAPA 5EQ0A 3U4ZA 1RHPA 5ELBA 4GNXC 2A74C 1Z6HA 2EYJA 1PV4A 4AIMA 2J0TD 4L5SA 1HRJA 4YWLA 2K6AA 2K75A 1A6XA 1L0WA 1WTOA 2VUMH 4F88A 2M2LA 3HKZB 1IW7C 1V8QA 3CCVA 3MVVA 3HOXH 3S17H 1BBUA 1HNZL 3E9HA 2ZXOA 2UUCQ 2LXKA 2MPMA 1JC7A 5M3MG 5EKIA 3RZOH 3HRZC 3IAYA 1IXRA 4QUFA 2ZM6L 3DXJC 1A62A 1AE2A 2N88A 4A3EB 1I5FA 2KQ3A 4JV5Q 2F3WA 2XIWA 3A8KE 2NUCA 5HGQA 4KJNA 1UE1A 2E74C 2F0FA 1SNDA 2K4KA 1A8VA 3VR4A 3S2HH 3PSIA 1U4RA 1D5XC 3KJOA 3M9BA 3Q8DA 4B3TL 4LF5L 4X64Q 3LGJA 4PG3A 3S24A 2N55A 4C2MH 1E1OA 3TZDA 3VR2A 5AJ3L 3GTJB 1L1OA 1F9PA 2B29A 1LTID 4JCVE 1HTLD 2SNMA 2WKDA 4R4TA 2EJMA 4YCUA 5E1FA 4CJ0B 5E4XA 1IBKQ 1F2LA 3C1FA 1SE2A 1YITA 3VDYA 1VQCA 4HEDA 3I72A 5LMUQ 5C6AA 3SK6A 3GTLB 5KNDA 3HP3A 1DD2A 5KYIA 3CRKC 4X65Q 4UY8C 1XYIA 2NVQH 4CKEA 1J9OA 5JEAH 5ELDA 4KK7A 3PO3G 2BA0A 2L55A 2BCOA 4IOCA 4E6IA 1PYWD 4AYBB 4WORA 1V1PB 1PH1A 3Q6SA 2OF1A 1BCPF 2EQSA 3IFTA 3CC7A 3QWNA 2OT2A 3OIQA 2F3IA 4G4KA 1SYFA 2OWOA 2DY7A 4C3IH 2M00A 4OO1I 4FYDA 4TRDA 3FKIB 4DV7L 1JQYD 2L15A 4A3DB 3I4MG 1Q12A 5K5PA 1EZ6A 4NW2A 1HZ9A 1B1ZA 3JAME 1WVLA 2R92G 3D6WA 4HJAA 1GHJA 1MSGA 3KLRA 1I50B 3EBEA 1WCMB 3S1RH 5C0XG 2JA7H 1N32Q 3GTOH 1X3EA 1EIGA 3U50C 4GS3A 5E4WC 2K7VA 1CHPD 1Q3LA 4FVMA 3HOUG 3KYHC 3PMFA 3GTPH 1FJGL 1T9HA 3I2ZA 2K28A 3Q24A 4ODGA 3I55A 4TQUS 2WP8J 2X6LA 2BE5D 5FLXc 4A3GH 2KEEA 1PTOH 5C3XA 4OIJA 3TZUA 3H3VC 2EIFA 3J81E 2Z0SA 4U673 1SDFA 1E3PA 2XNAC 4NXML 3GTQB 1KAWA 1CZWA 2E2JH 4A93G 2WACA 5DM73 1B9NA 4IUTA 4DR6L 1PXUA 4DR7Q 3S1NH 4GKKQ 3HGBA 4Y7NB 3A0JA 1OXTA 3UE1A 4NKLA 3VR6A 2WB1E 3OHXC 1LACA 1SFOB 3NWTA 1M4VA 2NVXH 3A5ZB 5C3EB 1WTQA 4A3CG 4U68A 3DHQA 4FF1A 4JI7Q 2DNCA 2RDHA 4X66Q 4RGNA 2HHHL 1IBLQ 5IOCA 4CGYB 3AFPA 1ESFA 2RA4A 3MAQA 3CD6A 4LF6Q 4DXFA 1SBBB 3NTKA 4EVOA 5FK9C 1OXVA 4RG1A 4GOPC 1PRTD 1WYDA 5EKLA 5CV6A 3HOYH 2IX0A 4IJHA 4OGQC 4DV6L 1BBWA 1NTGA 4HN7A 4YCVA 2EYHA 1PYBA 1GVPA 1K0RA 2JA8H 1Y8NB 4A3BG 3T4AC 3EN2A 3GTKB 3SK5A 4RCNA 2L0CA 1K28A 4DK1A 4ZUJA 3T51B 4IOAA 1XMOL 1GUSA 1K9MC 4DR5Q 2NZOA 1TT2A 3JAMc 3L3OC 1KNAA 3TS2A 1GXDC 4JYAL 2KCTA 1ENFA 2YU9H 3S1QB 3G7LA 1LYLA 2AHOB 1HNZQ 3D4DA 1B7YB 3NEMA 2BE5C 4LJZC 1A63A 4CJ2C 3NELA 2VY3A 1XPUA 1K0SA 1HNXL 1SNCA 3IRBA 5C44B 1SXTA 4H7BA 2JXMB 1S5FD 3HOZB 5M5YH 2Z9HA 1F2ZA 4IPDA 1Y14B 1V1PA 2LSSA 4XQJA 5M3FG 3BZCA 3I91A 4CDDC 2JA6G 1X56A 4JOIA 5HURA 1Z9FA 3K5NA 2GA4B 1VF5C 2RSNA 3TREA 1HZAA 4J1MA 3SXHA 1J5EL 4WJ4A 2CVRA 1TWHB 1TS4A 2QGQA 3J81c 4YWMA 1EY5A 2F0OA 3L2PA 3I70A 1T5EA 3F2DA 2C5CA 2QCPX 2B2UC 2XWBB 1XNRL 4B3SQ 3S2DB 3EJIA 1I3QB 3GTJH 2EYFA 3W5OA 3PO2B 3H94A 4CKCA 2QDLA 1H9SB 1TKWB 1PRTC 1YHAA 1D7QA 2IL8A 4J15A 1O7ZA 5IY0A 1ENCA 2VQFQ 3CCSA 4PMBA 3W2DA 4IO9A 2KUMA 1SYGA 3CCEA 5T1GA 5ELEA 1PH7A 4K0KL 2UU9L 2MFIA 1RODA 4A3IG 4FNFA 3F2CA 3GTLH 1B4OA 1H9RA 3GD7A 2VZAA 1SE8A 4C1NI 1SN8A 2ZTCA 1EZ8A 4JI3Q 1BVSA 1DJRD 1YJ9A 2Y0SB 2PW7A 3H0GB 4UPAA 5LMNQ 5JJLA 2F1MA 4G7OC 4B3RL 3FEWX 2BH2A 3GDEA 2FJ2A 4OXPA 1Y1VB 3AFQA 3T1HQ 2B2YC 2GVAA 1FL0A 4L8JA 4DNRB 4RGOS 2CH4A 3AQQA 4XTCS 2EY5A 1VQ8A 2QDBA 1O7YA 1HXYD 4DN4M 2YYZA 3K80C 5C0XI 1GD7A 1K8MA 3S1MH 3D0FA 1Q46A 2DJGC 4RFBA 3HEJA 3P1HA 2E5LQ 1AZPA 3TP7A 3FKIH 3IKJA 5CV9A 1LT6D 4HR7B 2L11A 2F0NA 4XQQA 1NUCA 3HFZB 2E8GA 2DUDA 4HAEA 4IUNA 2F4IA 1D5MC 1G2TA 1I50H 4BXXG 3A55A 1WOCA 2NWGA 3P20A 1X3PA 1IBML 1BUVT 1RD9D 4P73A 4ZQ3A 4FDBA 3QG1A 5CV4A 1KAAA 3MEHA 3E6ZX 4LF9Q 3HOXB 3S17B 5LHY1 5IODA 1Q82C 1EYAA 1JICA 1LTRD 4IPHA 4I65A 2UUBQ 3AEVA 1MI2A 3A54A 3MTSA 3X3NA 3PIO3 5J1ZA 2VL6A 1WD1A 1QZHA 5ELOA 1LT4D 1F9QA 4QF4A 4DPGA 1Q86C 4BA2I 2VW9A 2UUCL 2H1EA 2Z1CA 2UXCQ 4KKSA 2A69D 4A75A 1DZ1A 1YZ6A 2B2WA 3SDZA 2HCIA 4ABNA 1ASYA 4JV5L 3K59A 1E2ZA 3NQIA 1I4HA 3DM1A 4ZUIA 4BWGB 1YNXA 4HCEA 4FXGC 1Q81C 2KHSA 1PZKD 5JPMC 4DR4Q 3M4OB 1CSPA 4X64L 5EKKA 1SFOH 4B3MQ 1DM0B 3GQBA 3BDOA 2ALYB 4BY1B 5KNBA 4LFBQ 1S5CD 4MNOA 1HFNA 4DKAC 3PV0A 3MXNB 2VS1A 2A5HA 1VQIA 4A3KH 1HA5A 2MO0A 2R61A 5JOBA 4X3TA 1IBKL 1RTNA 2B8GA 4KTAA 4KJOA 4DUZQ 2LKVA 4OO1H 2NVQB 2NVTB 1G291 3TP6A 2DN8A 4ME3A 5LMUL 5H1SE 2DY8A 3HKZE 1F77A 1HNWQ 2XVSA 4QUCA 1X6OA 1B2TA 1QVFA 1EY6A 1CT1D 1JJGA 1QUQB 2KVMA 1H9SA 4X65L 4JI4Q 1HPCA 3OYYA 2O5IC 3GTKH 1GUWA 1EIFA 4PMCA 3R93A 4DAMA 5EBCA 2FHTA 4LF5Q 4IFDI 2RDFA 4KY6A 3J7A5 1SR3A 5KYLA 1VQLA 1T5XD 1NR2A 2A6HD 1CA5A 1VQ7A 3C3LA 4HIKA 3ICEA 1ET6A 3CC4A 4DK0A 2PNHA 1C48A 1F2MA 3U9SA 2L12A 4OWWB 4TSSA 4LF4Q 3C2PA 2I46A 3PUXA 1VMCA 1A2TA 1QVCA 3BG3A 2A69C 3PGZA 4R4CA 4IUQA 5KGUA 1QE6A 1Q8KA 2ASBA 4JC0A 1EU3A 4JVZA 1V1OA 1XWEA 4NDXA 3J81j 5I4DA 4K2LA 5IGFA 1VQ9A 4O1NA 1VQBA 3CXCA 4C3HH 1GJXA 1N32L 5IGGA 4FXKC 4PMWA 1VQ6A 3CCRA 3KLSX 3DEOA 4C1NK 5I6YA 1Q1BA 4KI0A 4QY7A 5JEAJ 1TWHH 3BVZA 4A3GB 3U9OA 1KTKA 3EQLC 4IN3A 5I2YA 3PIP3 2WKCA 4GNXB 2NZHA 3MHBA 4AYBE 3RNUA 4GLVB 1STAA 1I6VC 3E0EA 2E2JB 4K8IA 1DXMA 2XRQD 3TN2A 2MNAA 3A74A 2KJXA 3S1NB 1XXGA 1PA6A 1SYBA 4C3JG 1Y1WH 3PCOB 2KBNA 1WTWA 2NVXB 4ILWA 4L5RC 2JSOA 4DR2Q 3T53B 3CC2A 3F2UA 4DR7L 4GKKL 1OTCA 3LX0A 5IP7G 2XRSD 2E2DC 2RSOA 5IP9G 3J80c 2E2HB 2JA5G 3SR1A 5IGEA 3H0GH 5CR3A 1TS3A 3FP9A 4L5TA 4OELB 1Y1VH 3VYUA 4JI7L 5M5XB 3HOYB 5FO8B 1D8LA 4RKBA 1VQJA 1TS5A 3VA7A 1TXYA 2JA8B 1IBLL 1P8LA 2L5TA 1EIHA 2QILA 4LF6L 2CHBD 2MHVA 5EJWA 2B2VA 1VQAA 5DLQE 1ONLA 4DV2Q 1KD1C 3H3VI 1CA6A 1Y8PB 1CZGA 4V0BA 2JK8A 3VYTA 1XPOA 1JE4A 5FLXL 4QIWE 4P72A 5KNCA 1PFNA 4TVAB 4AQYQ 3MXNA 1RTOA 2YU9B 1II3A 2IHFA 5G3LD 2HIXA 3BJUA 1KDBA 1A3TA 3CPWA 1KDCA 2Z8LA 3MXPA 3T1YQ 3D31A 3K5OA 4DR5L 1M1KC 3MFYA 1H9MA 4OEMB 4UHVA 4NB3A 5M5YB 3J7AF 3H91A 1YHQA 1VQ4A 1AE3A 1QUQA 1W6KA 4OX9Q 4DK3C 3URYA 2CH4W 2O4XA 4CDCC 1EEFD 2RDGA 1HR0Q 2B63G 3K5MA 2LMCB 3AU7A 1N9WA 4OWXB 2AMCB 2GN5A 2X69A 1JMCA 5GADC 1M8AA 1VQHA 1HCZA 1HZBA 2F0DA 4N9TA 3TP8A 1GUNA 3AB9A 4BBSG 5GAHC 3R2TA 5IT9E 3CCQA 1PTOF 4ME5A 2RBMA 4DV5Q 1SYDA 3RR5A 4DV1Q 1K73C 2E2IH 1IZ6A 2R93G 1K3BC 2JE6I 2NVYH 4MZ9A 1W6JA 1WD0A 4A76A 1BR9A 1EQQA 3M4OH 1VS0A 2UXDQ 2WB1G 1PYSB 1XX8A 4FO2A 4PZ8A 1E1TA 4R8NA 4JI2Q 4B3SL 1S4ZA 1LM0A 1U4LA 4NPSA 1WI5A 3HG9A 1U4MA 4RKLA 4BY1H 2QF7A 3U58A 4TKOB 1AEXA 3MC0B 4LWCA 1BCPC 2WAQG 2FMMA 2R7ZB 3BZKA 4GZYC 5C0XH 5KEEA 4GN5A 2VQFL 4EX5A 3VR5A 1YBYA 1GOZA 2NVTH 4BY7B 2OQ0A 5HY6A 4GNXA 3S15H 2PNRC 2VUMG 1HA6A 2EXDA 2KECA 1SMXA 2FFKB 4HSVA 2R3ZA 2EXZA 1KXLA 3J7ZC 4XT3B 4JI3L 4YCWA 2D0PA 1QVGA 4OONA 4EGVA 1OO9B 5LMNL 2QKIC 3I8ZA 3S1MB 2V4DA 1I4GA 3H6MA 1SNQA 3T1HL 2B3GA 3ND8A 1KABA 5JVG3 2F0TA 4H13C 4JG2A 1VQFA 3J81L 1CKMA 1EFID 4V190 1VDZA 4EQOA 2K01A 2L9HA 3M3YH 5I9OA 1K83B 4GOPB 4HIMA 3DM3A 5BN4A 1LTAD 3CPFA 3IL8A 5COYA 4LAAA 2E5LL 4DAYB 1I4PA 4X3KA 1IYVA 4GN3B 4HJ9A 1R4PB 4CDFC 2GVBA 1TR5A 1Q1EA 2AWNA 1GKHA 4RMFA 1SJED 4MHEA 4A3CH 4AH6A 3FRPB 5ISRA 1PH2A 3CMEA 3KF8B 1QG7A 3VR3A 1ZEQX 4MTKA 1S40A 1NR4A 4UAIA 2TMPA 4KLKA 4Z9CB 5GROA 4LF9L 3K5LA 4FF2A 4QIWB 4A3JG 4JK1C 2Y0SE 5JEAG 5BR8L 5IT9c 2YV5A 1SNMA 1BO0A 4QJFA 2UUBL 1LT5D 1PVOA 4QL5A 4A3BH 2IJ0A 1X3GA 4ULLA 2KEDA 2UUAQ 4O2DA 5DEHA 2PZUA 2CW0C 2KHJA 4IPCA 5ELFA 5ELCA 5JJIA 1QWYA 3A8IE 1B9MA 4KHVA 4C3IG 2HCCA 3OSOA 1UAPA 2WFWA 1IYJB 5D65A 2UXCL 2EJFC 3NSWA 5KRUA 5C3WA 2CQAA 4HMIA 1J6QA 1HUNA 3S16H 1TS2A 1BOSA 4KHZA 1SE4A 1TU2B 3I4LA 4K6LA 1W2BA 2H4OA 3Q22A 3A5UA 2MUYA 1SAPA 3I4NG 5CV7A 3J7AV 1U0LA 4DR4L 4A3KB 3CCMA 4K14A 2E2HH 3NWSA 3SE0A 5D3DA 3W1BA 4IFDH 4B3ML 2JQOA 3CQZH 4HCSA 4WFN3 1Y69U 2JA7G 1TIID 4N8FA 4QGUA 4LFBL 2K14A 5FLMH 5M3FH 4KKTA 1GHKA 5IGCA 3CMAA 1LO5D 2L1BA 5M5XH 2JA6H 2EYPA 1PRTB 1UE6A 2HIVA 1MKHA 4DUYQ 1F9RA 1UE7A 2PW5A 1EEID 4KN4C 4X3UA 1UUPA 4S3SA 4DUZL 2RVLA 1PMRA 4BBRB 1FD7D 1CSQA 5TSSA 1PH6A 4YHHQ 2K5NA 1C9OA 3EVQA 2XSCA 1ML0D 1HNWL 2EYLA 5CV5A 1JR0D 2F0VA 4LW1A 4A3FB 1KQSA 1STBA 4G57A 4JW0A 1WTPA 1PFBA 4DGZA 4JI4L 1FGBD 5EGTA 4HIOA 3VA5A 1K8OA 3OIPA
chains in the Genus database with same CATH topology
4FF4A 4RGTA 2XN9C 4K6DA 1WTRA 3FDTA 1KLUD 1I6HB 1BXTA 3DEPA 2IWHA 4P2CB 1FNVA 2Q8TA 4KKUA 5FO7B 1EOTA 4ZK9B 4C3HB 2NN6G 2ID0A 3UI2A 2OXPA 3IFDA 1S5ED 1VF7A 4M1UB 5A2QL 5DM63 1NAPA 4H44C 1OXUA 1EY8A 2K1BA 1QB5D 1C4QA 2K5QA 1B53A 5CV8A 3I73A 1STYA 2E76C 4RHSA 3HOWB 1D5ZC 4DAYA 1SNPA 1IHZA 3HS0C 2BA1A 3VYSA 3G6JB 1Y1WB 1JOOA 4UDUC 1PLFA 1IL8A 3KF8A 5K36H 4XDXA 2MP1A 1RJTA 2WINB 4XQNA 3CU7A 2Z4IA 2EYMA 1LT3D 1L0YB 3T16A 5CORA 2RKSA 1LTBD 3A7LA 3SVMA 5M3MB 2E75C 3QB3A 2PPBC 2PCFB 4F87A 1PDQA 2WIIB 5JPNC 1F2YA 2PQEA 1PZJD 1BNZA 2R6GA 2K03A 2MGSA 4RCOA 2VXWA 1BDOA 2B2UA 3I3CA 1JWMD 2JEAI 4XT1B 3GTMB 2PYKA 3BYTB 5FKAC 4M8AA 4DXGA 3R3OA 2F0JA 4RA8A 2VB3X 4ZYSA 3L7ZC 4ZKBB 5M9OA 1I4QA 1EY9A 2LY7A 3J80L 3PO3B 1DYQA 2AQ2B 4B9WA 3WDNA 1ZYRC 4IURA 4C56C 1ZKOA 3FPUB 1V43A 2B2TC 1SYEA 1BF4A 1H9KA 2B2YA 1CM9A 2E2IB 2NVYB 1Y8OB 4N9PA 2F0WA 3OW7A 1LV9A 2B8FA 2Z4HA 2EY6A 3CHBD 4KV6A 4KY7A 2R92B 3NP8A 2D5DA 1TWFB 3GV6A 3SEBA 1CI3M 5CGKA 3D8GA 5BN3A 1EQTA 3S15B 1R4QB 3K57A 2AUKA 4IUUA 5KIXA 4XYOA 1S5BD 2J7ZA 3C46A 3HOUB 1ET9A 3EROA 1MD2D 1AW7A 1CQFA 3QO2A 5HGTA 4OIKA 2EZVA 4YIJA 3ERQA 5T1IA 2EVBA 1GUGA 1KDAA 2RQXA 1RF2D 4IZ8A 5IIFA 4A93B 2DNEA 4QMGA 3KBGA 3M3YB 1FYCA 4CBVA 1FNUA 3O13A 5NUCA 3E5SA 1Z7TA 3C1EA 3DWPA 5JAVA 1OXSC 4K5WA 5C0XJ 2J4XA 1HTPA 2KCNA 4OO1G 1A3UA 3M7GA 3FMCA 2BOSA 4WRDA 2F0HA 4X3SA 2SEBD 3DUZA 3P7JA 5I2XA 2K04A 1EY7A 4A3BB 4IALA 1G8ZD 1R9TB 3TSSA 2XWJB 5DNFA 4KY5A 3QIAA 3K7AB 2D62A 1JWUD 1AN8A 3S16B 4F7XA 5J39A 5DAUA 2O2LD 1RCVD 4DF7A 3PUYA 5EPLA 4RHRA 1EYCA 3MWYW 1STNA 1O78A 1JB3A 3CQZB 1X3QA 1XTCD 5D3IB 4QCLA 1EQVA 2PMZB 2HUGA 5M3FB 1CK1A 3TDQA 4K5XA 1WTXA 2F0UA 2JA6B 1CHQD 5CC4A 3BDLA 3NBIA 2MJ8A 3SHLA 1TVXA 3M7NA 1BCPD 2IX3A 3MZ5A 1BCPB 2AQ1B 2HQEA 2A6EC 1D6EC 1PZID 5IT9L 3ONAB 3TP5A 4RH6A 2F0EA 1RDPD 1BQQT 1QNUA 2EPBA 5CBAE 5C4HA 1AFPA 2WV6D 4A3IB 1U4PA 1ILPA 2K05A 4JBWA 5JVH3 1PTOC 3WOEA 3GP7A 4IFDJ 1QOHA 3GO5A 1U9RA 1L0XB 4IUVA 1QJOA 3NE5B 1EL0A 3RMHA 3GTGB 2ICEC 3LWUA 3P75A 4FXDA 1QNKA 1O7LA 3CKIB 3NXWA 3T13A 5FLXE 1VCIA 1STEA 3LWEA 2L4NA 3S14B 3JAML 4DA2A 1OXXK 2F0PA 1DOLA 4BS9A 2A68C 2QEJC 3ND9A 2CW0D 5EPKA 1LTGD 2JP1A 1F9SA 1GUOA 2ZXPA 1DCZA 2NYZD 1KNEA 3OWFA 1STHA 4KD3A 1C8CA 1NCVA 3S9WA 4DU9A 4HTHA 3FVQA 3NPPA 4R8IA 3D4RA 1S5DD 1Q8IA 1A15A 4MIUA 3MA2B 4HSPA 1FNWA 2ICIA 3NHHA 5G3LF 3QOJA 1G91A 3SK8A 3OMCA 3Q23A 1MSHA 1JOQA 5C4ZA 4ZLTF 3OOCA 1B44D 4DFAA 3EFXD 1EU4A 4NP5A 1D2BA 2SOBA 1RKNA 5J22A 2G9DA 1EYDA 1IKMA 3NBHA 3ITPA 1HQMC 3LNNA 2NB0A 4J8QA 4G7ZC 2F0MA 2F0SA 4MN3A 4A3MB 1EY4A 2JYOA 1SEBD 2PZWA 2HDLA 1WTVA 4RAUC 3VYRA 2IPKD 2O5JC 1JCKB 5LL6X 5FOBB 3TMEA 4G7HC 2Q8IB 2BDNA 1G6ZA 5IGDA 3AMUA 2KA7A 3I90A 4IUPA 3PUZA 3A56A 5LL6S 1YNJD 2NN6H 2K33A 3BVGA 1E2VA 3R2IA 5CBEE 4CKBA 4L63B 1HUMA 4I7ZC 3MFGA 5I6WA 2F0IA 1LTTD 3RD4A 1NSNS 4C3JB 3V2TA 3H09A 5JJZA 3RUZA 3FPPA 3Q0AA 1HHVA 1D1KA 4FP5D 4J6HA 1A2UA 1E0BA 1B3AA 3BS1A 2JA5B 3W3AA 4K5VA 4ID6A 3KBXA 4OHJA 1SNOA 4IFDG 4BA1I 5FO9B 3D4WA 3OWEB 1FR3A 4Q5VA 4PNYA 1BBXC 1ZXTA 1ICWA 4Q0FA 1EWHA 4PV1C 2FMCA 4NMZA 5C5MA 1SE3A 3A8JE 1YNJC 1VMPA 4LMQD 3X3MA 2OEOA 4PQXA 4XIGS 5AFWA 4XXEA 1ZYRD 2NTSA 1SSOA 2K5DA 4FF3A 1UEAB 3E0JA 2F0QA 3TBIB 3CRLC 2B63B 3WOFA 2EY1A 1PRTF 1DONA 5A2QE 2B2WC 2F0KA 3BZDB 2KCCA 4R9WA 4BBSB 1HFGA 1SMYD 1PFMA 1JORA 2R93B 1TWGB 5D14A 1D1IA 2HDMA 3OPOA 1E2WA 1TY0A 2WB1B 3NK9A 2VNUD 2JEBI 2LFNA 5M5WB 2WAQB 3MXGA 1LTSD 5K36G 2C9OA 3NUCA 2F3VA 2M9VA 3GV3A 2Q8RE 4KD4A 1ESRA 2EE1A 2VUMB 1CFMA 2NZ1D 2G9HD 3ZYYX 3HZXA 4EQPA 4CJ1B 1QILA 3KK7A 3RZOB 1ILQA 3K58A 4RWSC 2EOTA 2IT1A 1TY2A 3OMGA 2ZT9C 1I4RA 1LABA 1G2SA 2SNSA 2IX1A 3I4MB 1DOKA 3S2HB 3RZDB 2F0LA 2NBFA 4K8JA 5A35A 2LS01 1EWCA 1AZQA 4C2MB 1HQRD 1GUTA 5CYUA 3D6CA 1DOMA 5BN5A 5C4JB 1LLRD 2D9UA 1J8IA 3BVMA 4OL7A 5F2DA 1SMYC 2ENBA 2PO4A 1UNSA 3T56B 1TQOA 2EY2A 4DNTB 1Z47A 2I07B 1YNND 1O80A 3N6RA 1CTMA 4O42A 4EQNA 1QCBD 3K6OA 1H9JA 1SJHD 4A3JB 1Q90A 2VB2X 4IQZA 3J80E 1TWCB 1I4XA 1STGA 1EY0A 2F03A 2NTTA 3BDCA 2NN6I 4LK1C 3K0YA 4C3IB 1X32A 2B2TA 3KLSA 3L9AX 3N52A 1TWAB 1SYCA 4KMUC 2D2CC 3BYYB 3I4NB 2A6ED 4WJWA 4ZKCB 2F0GA 1CQVA 5IGBA 3S1RB 2JA7B 2KOLA 3GTOB 3KUPA 3V05A 4B9XA 3QOLA 4H0LC 2ZXRA 4F8MA 3MXUA 5EBDA 2B2VC 4XYQA 1IYUA 3GTPB 1MGSA 1A3VA 1PTOD 3PUWA 2A73B 1ENAA 4RGMA 4CHTB 2EDGA 2EYOA 2K32A 2BDOA 1PTOB 5C5LA 2EJGC 1IKLA 5I9PA 1YNNC 2X6GA 5EPJA 2FINB 1IW7D 3V96A 1B50A 5CMDA 3DWQA 3QJYA 1AP0A 2PZTA 5E3FA 3DMUA 3NTIA 2K5WA 1MBYA 4DAVA 3PUVA 4L6TB 2SDFA 3RLFA 4HMJA 4K2KA 2AQ3B 3EA6A 4ZAIA 3NTHA 4QB4A 4C3HG 2A6HC 2AUJD 2TSSA 3HOVB 3SK4A 3M4YA 2A68D 5C4XB 1KLGD 3NQTA 2IW3A 3J7YW 4KN7C 4ZRZA 3DWAA 1JOKA 1JWSD 2B39A 4B08A 3R8BA 3M85A 3A7AB 2AWOA 3D3RA 4DAPA 5EQ0A 1RHPA 5ELBA 2A74C 1Z6HA 2EYJA 2J0TD 1HRJA 2K6AA 1A6XA 1WTOA 4F88A 2M2LA 3HKZB 1IW7C 1V8QA 3MVVA 2ZXOA 2MPMA 1JC7A 5EKIA 3HRZC 3IAYA 4QUFA 3DXJC 4A3EB 2N88A 2KQ3A 2F3WA 2XIWA 3A8KE 2NUCA 4KJNA 2E74C 2F0FA 1SNDA 3VR4A 1U4RA 1D5XC 2N55A 3TZDA 3VR2A 3GTJB 1F9PA 1LTID 1HTLD 2SNMA 2WKDA 2EJMA 5E1FA 4CJ0B 5E4XA 1F2LA 3C1FA 1SE2A 4HEDA 3I72A 5C6AA 3SK6A 3GTLB 5KNDA 3HP3A 1DD2A 5KYIA 3CRKC 1XYIA 4CKEA 1J9OA 5JEAH 5ELDA 4KK7A 2BA0A 2L55A 2BCOA 4E6IA 1PYWD 4AYBB 4WORA 1V1PB 3Q6SA 2OF1A 1BCPF 3IFTA 3QWNA 2OT2A 3OIQA 4G4KA 1SYFA 2DY7A 2M00A 4OO1I 4FYDA 4TRDA 3FKIB 1JQYD 4A3DB 1Q12A 5K5PA 1EZ6A 4NW2A 1B1ZA 3JAME 1WVLA 3D6WA 1GHJA 1MSGA 3KLRA 1I50B 1WCMB 5C0XG 1EIGA 5E4WC 2K7VA 1CHPD 1Q3LA 4FVMA 3PMFA 2K28A 3Q24A 4ODGA 4TQUS 2WP8J 2X6LA 2BE5D 2KEEA 1PTOH 5C3XA 4OIJA 3TZUA 3H3VC 3J81E 4U673 1SDFA 2XNAC 3GTQB 1CZWA 2WACA 5DM73 1B9NA 4IUTA 1PXUA 3HGBA 4Y7NB 1OXTA 4NKLA 3VR6A 3OHXC 1SFOB 1LACA 3NWTA 1M4VA 5C3EB 1WTQA 4U68A 3DHQA 4FF1A 2DNCA 2RDHA 4RGNA 5IOCA 4CGYB 1ESFA 2RA4A 3MAQA 4DXFA 1SBBB 3NTKA 4EVOA 5FK9C 1OXVA 1PRTD 5EKLA 5CV6A 2IX0A 4OGQC 4HN7A 2EYHA 1Y8NB 3T4AC 3GTKB 3SK5A 4RCNA 2L0CA 4DK1A 4ZUJA 3T51B 1GUSA 1TT2A 3L3OC 1KNAA 1GXDC 1ENFA 3S1QB 3G7LA 3D4DA 2BE5C 4LJZC 4CJ2C 1SNCA 5C44B 1SXTA 4H7BA 2JXMB 1S5FD 3HOZB 1F2ZA 1V1PA 4XQJA 3I91A 5HURA 3K5NA 2GA4B 1VF5C 2RSNA 4J1MA 3SXHA 2CVRA 1TWHB 1TS4A 1EY5A 2F0OA 3I70A 1T5EA 2C5CA 2QCPX 2B2UC 2XWBB 3S2DB 3EJIA 1I3QB 2EYFA 3PO2B 3H94A 4CKCA 1H9SB 1TKWB 1PRTC 2IL8A 1O7ZA 1ENCA 4PMBA 3W2DA 2KUMA 1SYGA 5T1GA 5ELEA 1RODA 4FNFA 1B4OA 1H9RA 3GD7A 4C1NI 1EZ8A 1DJRD 2Y0SB 2PW7A 3H0GB 2F1MA 4G7OC 3FEWX 2FJ2A 1Y1VB 2B2YC 4L8JA 4DNRB 4RGOS 4XTCS 2EY5A 2QDBA 1O7YA 1HXYD 4DN4M 2YYZA 5C0XI 1K8MA 4RFBA 3HEJA 3P1HA 1AZPA 3TP7A 3IKJA 5CV9A 1LT6D 4HR7B 2L11A 2F0NA 4XQQA 1NUCA 4HAEA 4IUNA 2F4IA 1D5MC 1G2TA 3A55A 2NWGA 3P20A 1X3PA 1BUVT 1RD9D 4ZQ3A 3QG1A 5CV4A 1KAAA 3MEHA 3E6ZX 3HOXB 3S17B 5LHY1 5IODA 1EYAA 1JICA 1LTRD 4I65A 1MI2A 3A54A 3MTSA 3X3NA 3PIO3 5J1ZA 1WD1A 1LT4D 1F9QA 4QF4A 4BA2I 2H1EA 2Z1CA 4KKSA 2A69D 1DZ1A 2B2WA 3SDZA 2HCIA 4ABNA 3K59A 1E2ZA 3NQIA 1I4HA 3DM1A 4ZUIA 4BWGB 4HCEA 4FXGC 2KHSA 1PZKD 5JPMC 3M4OB 5EKKA 1DM0B 3GQBA 3BDOA 4BY1B 5KNBA 1S5CD 1HFNA 3PV0A 2A5HA 1HA5A 2R61A 5JOBA 4X3TA 4OO1H 1RTNA 2B8GA 4KTAA 4KJOA 2LKVA 2NVQB 2NVTB 1G291 3TP6A 2DN8A 2DY8A 1F77A 2XVSA 4QUCA 1B2TA 1EY6A 1CT1D 2KVMA 1H9SA 1HPCA 2O5IC 1GUWA 4PMCA 3R93A 5EBCA 2FHTA 4IFDI 2RDFA 4KY6A 5KYLA 1T5XD 1NR2A 2A6HD 1CA5A 3C3LA 1ET6A 4DK0A 1C48A 1F2MA 3U9SA 2L12A 4TSSA 3C2PA 2I46A 3PUXA 1VMCA 1A2TA 3BG3A 2A69C 4IUQA 5KGUA 1QE6A 1EU3A 1V1OA 1XWEA 4NDXA 5I4DA 4K2LA 5IGFA 4O1NA 1GJXA 5IGGA 4FXKC 4PMWA 3KLSX 3DEOA 4C1NK 5I6YA 1Q1BA 4KI0A 5JEAJ 3BVZA 4A3GB 3U9OA 1KTKA 3EQLC 4IN3A 5I2YA 3PIP3 2WKCA 3MHBA 1STAA 1I6VC 2E2JB 4K8IA 1DXMA 2XRQD 3TN2A 2KJXA 3S1NB 1XXGA 1SYBA 4C3JG 1WTWA 2NVXB 4ILWA 2JSOA 3T53B 3F2UA 3LX0A 2XRSD 2E2DC 2RSOA 2E2HB 3SR1A 5IGEA 5CR3A 1TS3A 3VYUA 5M5XB 3HOYB 5FO8B 4RKBA 1TS5A 3VA7A 2JA8B 2L5TA 1EIHA 2QILA 2CHBD 2MHVA 5EJWA 2B2VA 1ONLA 1CA6A 1Y8PB 1CZGA 4V0BA 3VYTA 1JE4A 5FLXL 5KNCA 1PFNA 3MXNA 1RTOA 2YU9B 1II3A 5G3LD 1KDBA 1A3TA 1KDCA 2Z8LA 3MXPA 3D31A 3K5OA 3MFYA 1H9MA 5M5YB 3J7AF 3H91A 1W6KA 3URYA 2O4XA 1EEFD 2RDGA 3K5MA 2LMCB 3AU7A 2X69A 1M8AA 1HCZA 2F0DA 4N9TA 3TP8A 1GUNA 3AB9A 3R2TA 5IT9E 1PTOF 4ME5A 2RBMA 1SYDA 1WD0A 2JE6I 1W6JA 1BR9A 1XX8A 4FO2A 4R8NA 1S4ZA 1U4LA 3HG9A 1U4MA 4RKLA 2QF7A 4TKOB 1AEXA 3MC0B 1BCPC 2FMMA 2R7ZB 4GZYC 5C0XH 5KEEA 3VR5A 1GOZA 4BY7B 2PNRC 1HA6A 2KECA 2FFKB 4HSVA 2R3ZA 2EXZA 4XT3B 4EGVA 1OO9B 2QKIC 3I8ZA 3S1MB 2V4DA 1I4GA 3H6MA 1SNQA 3ND8A 1KABA 5JVG3 2F0TA 4H13C 3J81L 1EFID 4V190 1VDZA 4EQOA 2K01A 2L9HA 5I9OA 1K83B 5BN4A 1LTAD 3IL8A 5COYA 4LAAA 1I4PA 4X3KA 1IYVA 1R4PB 1TR5A 1Q1EA 2AWNA 1SJED 4MHEA 3FRPB 5ISRA 1QG7A 3VR3A 1ZEQX 1NR4A 4UAIA 2TMPA 4Z9CB 3K5LA 4FF2A 4QIWB 4JK1C 5JEAG 1SNMA 1BO0A 1LT5D 2IJ0A 4ULLA 2KEDA 5DEHA 2PZUA 2CW0C 5ELFA 5ELCA 1QWYA 3A8IE 1B9MA 4KHVA 4C3IG 2HCCA 3OSOA 1UAPA 5D65A 2EJFC 3NSWA 5KRUA 5C3WA 2CQAA 4HMIA 1HUNA 1TS2A 1BOSA 4KHZA 1SE4A 1TU2B 3I4LA 4K6LA 2H4OA 3Q22A 2MUYA 1SAPA 5CV7A 3J7AV 4A3KB 4K14A 3NWSA 3SE0A 5D3DA 4IFDH 4HCSA 4WFN3 1Y69U 1TIID 4KKTA 1GHKA 5IGCA 1LO5D 2L1BA 2EYPA 1PRTB 1F9RA 4KN4C 2PW5A 1EEID 4X3UA 1UUPA 4S3SA 2RVLA 1PMRA 4BBRB 1FD7D 5TSSA 3EVQA 2XSCA 1ML0D 5CV5A 2EYLA 1JR0D 2F0VA 4A3FB 1STBA 4G57A 1WTPA 1PFBA 4DGZA 1FGBD 5EGTA 3VA5A 1K8OA 3OIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBH A;  4DAY A;  3MXN A; 
#chains in the Genus database with same CATH topology
 3F8T A;  2YTV A;  4RGT A;  4FF4 A;  1SRO A;  4P74 A;  1RIP A;  2XN9 C;  4YY3 Q;  2IHE A;  4K6D A;  1WTR A;  3FDT A;  1KLU D;  1I6H B;  4DV3 Q;  1BXT A;  3DEP A;  2IWH A;  1N33 Q;  4P2C B;  1FNV A;  1DGS A;  2Q8T A;  4KKU A;  5FO7 B;  4A3I H;  1EOT A;  4ZK9 B;  4LF4 L;  3OTO Q;  4C3H B;  2NN6 G;  3UE0 A;  1CKO A;  2ID0 A;  3UI2 A;  2F4V Q;  2OXP A;  1KC8 C;  3IFD A;  3HKS A;  1S5E D;  4PZ7 A;  1VF7 A;  4M1U B;  5A2Q L;  5DM6 3;  3EIV A;  2QA4 A;  1NAP A;  4H44 C;  1OXU A;  1EY8 A;  2K1B A;  2KEN A;  1QB5 D;  3HOV G;  1C4Q A;  4ALP A;  2K5Q A;  1B53 A;  5CV8 A;  3KLW A;  3I73 A;  3I56 A;  5C4X G;  1EQR A;  1STY A;  2E76 C;  4RHS A;  4GOP A;  3HOW B;  1D5Z C;  4DAY A;  3GTG H;  4CDE C;  1SNP A;  1W3S A;  5IWA Q;  1IHZ A;  3HS0 C;  2BA1 A;  3VYS A;  3G6J B;  1Y1W B;  2AKW B;  1JOO A;  4UDU C;  4HJ7 A;  1PLF A;  5JJK A;  1H95 A;  1IL8 A;  3KF8 A;  5K36 H;  3K0X A;  4XDX A;  1VQP A;  2R7Z H;  2MP1 A;  1RJT A;  2WIN B;  3M4P A;  4XQN A;  4BXX H;  3CU7 A;  2Z4I A;  2EYM A;  3H3V H;  4BY7 H;  1HJP A;  1PH5 A;  1LT3 D;  2HQL A;  1L0Y B;  3T16 A;  4HJ5 A;  5COR A;  2RKS A;  3HKZ G;  1LTB D;  3A7L A;  4DR2 L;  3F1Z A;  5EAY A;  3SVM A;  5M3M B;  2E75 C;  3QB3 A;  1XPR A;  2PPB C;  2PCF B;  4F87 A;  1MHW C;  4A3E G;  1I94 Q;  1PDQ A;  2WII B;  5JPN C;  1F2Y A;  2N78 A;  2PQE A;  1PZJ D;  4UP9 A;  4WJ3 M;  1NY4 A;  1BNZ A;  2R6G A;  1KIX A;  2K03 A;  4HID A;  4OWT B;  2MGS A;  4RCO A;  1E22 A;  1BDO A;  2VXW A;  3K8A A;  4O0A A;  1HH2 P;  1K83 H;  4IJL A;  4DV2 L;  2B2U A;  3I3C A;  1JWM D;  2JEA I;  4XT1 B;  3GTM B;  3JAM i;  4AQY L;  2PYK A;  3BYT B;  5FKA C;  4M8A A;  5BR8 Q;  4DXG A;  3R3O A;  2F0J A;  4RA8 A;  2VB3 X;  3K7U C;  4ZYS A;  3T1Y L;  2OCE A;  1GO3 E;  3L7Z C;  5FJ8 G;  2P5Z X;  4ZKB B;  5M9O A;  1I4Q A;  1EY9 A;  2LY7 A;  3J80 L;  3ER0 A;  1K8G A;  3PO3 B;  1DYQ A;  2AQ2 B;  4OX9 L;  4B9W A;  3WDN A;  2PMZ E;  4AYB G;  1ZYR C;  4IUR A;  5IYC G;  4LFA Q;  4C56 C;  1ZKO A;  1HR0 L;  3FPU B;  1V43 A;  2B2T C;  1SYE A;  1BF4 A;  1H9K A;  3CW2 C;  2B2Y A;  1CM9 A;  2E2I B;  2NVY B;  4JI0 Q;  3J81 i;  4A3L H;  4A3M H;  4GLA C;  1Y8O B;  4N9P A;  2F0W A;  1G6P A;  3OW7 A;  1LV9 A;  2QW7 A;  2B8F A;  2Z4H A;  3FKI G;  4DK6 C;  4A3D G;  2EY6 A;  4DV5 L;  3CHB D;  4KV6 A;  4KY7 A;  4DV1 L;  2R92 B;  3NP8 A;  1QZG A;  2D5D A;  2Z6K C;  1TWF B;  2N49 A;  2UXD L;  3GV6 A;  3SEB A;  1CI3 M;  5CGK A;  2N8N A;  3D8G A;  1WCM G;  4JI2 L;  5BN3 A;  1EQT A;  3S15 B;  1R4Q B;  3K57 A;  2AUK A;  4IUU A;  5KIX A;  4XYO A;  1S5B D;  2J7Z A;  3C46 A;  3HOU B;  1ET9 A;  1VQN A;  3ERO A;  1MD2 D;  1AW7 A;  1CQF A;  1HZC A;  4POG A;  4IPG A;  3QO2 A;  5HGT A;  4OIK A;  4BBR H;  2EZV A;  1UWV A;  2VQE Q;  4YIJ A;  3ERQ A;  1CUK A;  5T1I A;  2EVB A;  4A3F H;  1GUG A;  1NNX A;  1KDA A;  2RQX A;  1RF2 D;  4IZ8 A;  5IIF A;  4A93 B;  2DNE A;  4QMG A;  3KBG A;  3M3Y B;  1FYC A;  4CBV A;  1FNU A;  3O13 A;  1SRU A;  5NUC A;  2CFM A;  1I6H H;  2K52 A;  3E5S A;  1Z7T A;  3G71 A;  3C1E A;  3DWP A;  1YJW A;  2OTJ A;  2I5M X;  5C3E G;  5IP7 H;  1OXS C;  5JAV A;  1JT8 A;  4K5W A;  2Z6B A;  5C0X J;  2J4X A;  1HTP A;  1UEB A;  2Q2U A;  1X9N A;  1WTH A;  4MTN A;  2KCN A;  1N8R C;  4OO1 G;  1A3U A;  3M7G A;  3FMC A;  2BOS A;  4WRD A;  5IYB G;  2F0H A;  4X3S A;  4P75 A;  2SEB D;  3DUZ A;  3P7J A;  1MJC A;  5I2X A;  1KL9 A;  1N36 Q;  4QQB X;  2K04 A;  1EY7 A;  4A3B B;  3G6E A;  4IAL A;  1G8Z D;  5ELN A;  1R9T B;  3HOW H;  3TSS A;  2XWJ B;  2FXQ A;  5DNF A;  4KY5 A;  3QIA A;  3K7A B;  2D62 A;  5IYD G;  1JWU D;  3ZJY C;  1AN8 A;  3S16 B;  4F7X A;  5J39 A;  2UUA L;  5DAU A;  2O2L D;  1RCV D;  2JJQ A;  1YJN A;  4DF7 A;  3RLN A;  4A4I A;  3PUY A;  5EPL A;  4RHR A;  1EYC A;  1EUJ A;  3MWY W;  1STN A;  1O78 A;  1JB3 A;  3CQZ B;  1X3Q A;  1XTC D;  5C44 G;  5D3I B;  4QCL A;  1EQV A;  2PMZ B;  1S72 A;  2HUG A;  5M3F B;  1CK1 A;  3TDQ A;  3CAM A;  3HOZ G;  4K5X A;  1WTX A;  3ULP A;  2F0U A;  5M3M H;  2JA6 B;  4JBK A;  1CHQ D;  5CC4 A;  3BDL A;  3MEF A;  3NBI A;  4JI8 Q;  2MJ8 A;  3SHL A;  2H5X A;  1TVX A;  3M7N A;  4R4I A;  1BCP D;  2I0Q A;  2IX3 A;  3MZ5 A;  4LUO A;  1BCP B;  2AQ1 B;  2HQE A;  2A6E C;  2PI2 A;  4DUY L;  1D6E C;  1L1O C;  4BBS H;  1PZI D;  5IT9 L;  3NBH B;  3F2B A;  3ONA B;  3TP5 A;  4RH6 A;  2F0E A;  1EYG A;  2R93 H;  1TWG H;  1ASZ A;  4YHH L;  3PO2 G;  1RDP D;  1BQQ T;  3GTM H;  1QNU A;  2EPB A;  2JN4 A;  5CBA E;  1FVI A;  5GAE C;  5C4H A;  1AFP A;  2WV6 D;  4DV4 Q;  1NE3 A;  4A3I B;  1U4P A;  5M5W H;  3WWV A;  1ILP A;  2K05 A;  4JBW A;  4APV A;  5JVH 3;  1PTO C;  4YY3 L;  3WOE A;  4NXN Q;  3GP7 A;  1C0A A;  4DV3 L;  1QOH A;  4JBJ A;  4IFD J;  1N33 L;  3GO5 A;  2XTI A;  3PO3 H;  1U9R A;  2Y0S G;  1L0X B;  4JI1 Q;  3H0G G;  2UXB Q;  4IUV A;  2C35 B;  3OTO L;  1QJO A;  3CCU A;  3ULL A;  1Y1V G;  3PIP A;  3CP0 A;  4KHP Q;  2ZTD A;  2F4V L;  3NE5 B;  1EL0 A;  3RMH A;  3KJP A;  3GTG B;  2ICE C;  3LWU A;  3P75 A;  3KFU A;  3KOJ A;  4FXD A;  1QNK A;  1O7L A;  2A19 A;  1UE5 A;  3I4M H;  3RZD H;  3CKI B;  3NXW A;  3T13 A;  2N3S A;  5FLX E;  1VCI A;  1STE A;  3LWE A;  2L4N A;  3S14 B;  3JAM L;  4DA2 A;  1OXX K;  1NMF A;  2R92 H;  4UP7 A;  2F0P A;  2HT1 A;  5IWA L;  1TWF H;  1DOL A;  4X62 Q;  1NJI C;  5C4J H;  1K3R A;  4BS9 A;  3OW2 A;  2A68 C;  2QEJ C;  2A1A A;  3ND9 A;  2CW0 D;  2CWP A;  5EPK A;  4LUZ A;  1LTG D;  2JP1 A;  1F9S A;  1GUO A;  2ZXP A;  3HOU H;  2LXJ A;  3HOX G;  1DCZ A;  1S3O A;  4DNI A;  2ZTE A;  2NYZ D;  1KNE A;  3J80 i;  1P16 A;  1XNQ Q;  3OWF A;  3CCL A;  4DR1 Q;  3TS0 A;  1STH A;  4JI5 Q;  3UDG A;  4DR3 Q;  4A3J H;  4KD3 A;  1C8C A;  1TWC H;  1NCV A;  3S9W A;  4LNQ A;  4DU9 A;  5GAG C;  4HTH A;  3FVQ A;  3NPP A;  4GKJ Q;  1PH8 A;  4R8I A;  3D4R A;  4ZCK A;  4A93 H;  1S5D D;  2V1C C;  4R4Q A;  1Q8I A;  1I94 L;  1A15 A;  4JBM A;  4MIU A;  3MA2 B;  3PQI A;  4HSP A;  1FNW A;  3E9I A;  1SLJ A;  2ICI A;  3NHH A;  5G3L F;  3QOJ A;  1G91 A;  3DLL A;  1TWA H;  3PF5 A;  2KHI A;  3SK8 A;  3OMC A;  1VQE A;  3Q23 A;  1MSH A;  3CF5 A;  1JOQ A;  4BY1 G;  3I4N H;  5C4Z A;  1VQG A;  4H02 A;  4ZLT F;  3OOC A;  1B44 D;  4DFA A;  3EFX D;  3PF4 A;  1EWI A;  3G48 A;  1C7Y A;  1EU4 A;  4NP5 A;  1VQM A;  1D2B A;  2A8V A;  2SOB A;  1RKN A;  1PH3 A;  4LF8 Q;  5J22 A;  2G9D A;  1EYD A;  1IKM A;  3NBH A;  1VQD A;  3U4V A;  3ITP A;  1HQM C;  3KF6 B;  2MO1 A;  3LNN A;  1EIY B;  2RHQ B;  1R9T H;  2NB0 A;  3KDF B;  3JC6 6;  4J8Q A;  1N34 Q;  4G7Z C;  2F0M A;  2F0S A;  1EOV A;  1V9P A;  4MN3 A;  4A3M B;  1EY4 A;  2JYO A;  3K7A H;  3W1G A;  1SEB D;  2PZW A;  4LFA L;  2HDL A;  3BU2 A;  1WTV A;  4RAU C;  1YVC A;  3VYR A;  2IPK D;  4JI6 Q;  4JI0 L;  2O5J C;  1JCK B;  5LMN W;  5LL6 X;  5FOB B;  3TME A;  4G7H C;  4EQ5 A;  2Q8I B;  2BDN A;  1G6Z A;  4PZ6 A;  5IGD A;  2QEX A;  3AMU A;  2KA7 A;  1PHJ A;  4JOI C;  3FHW A;  3I90 A;  4IUP A;  3PUZ A;  3H15 A;  3A56 A;  5LL6 S;  4LF7 Q;  4P71 A;  1YNJ D;  2NN6 H;  2JA9 A;  2WAQ E;  2K33 A;  2D0O A;  3BVG A;  1E2V A;  3UDX A;  1V1Q A;  1XMQ Q;  3R2I A;  5CBE E;  4CKB A;  2RF4 A;  1JJC B;  1B3Q A;  1B8A A;  2K50 A;  4L63 B;  3HOV H;  4A3G G;  5C4X H;  2IY5 B;  1HUM A;  4I7Z C;  1VQ5 A;  1VQO A;  3MFG A;  2VQE L;  1O7I A;  5I6W A;  2F0I A;  1G51 A;  3UDI A;  1LTT D;  3RD4 A;  1NSN S;  4C3J B;  1E7Z A;  3V2T A;  3H09 A;  5JJZ A;  3RUZ A;  4POF A;  3FPP A;  3Q0A A;  1HHV A;  1D1K A;  2PI2 E;  4FP5 D;  3UDF A;  4J6H A;  1A2U A;  1E0B A;  1B3A A;  3BS1 A;  4GN4 B;  2JA5 B;  4Y52 H;  3W3A A;  4K5V A;  1ICF B;  2ZM6 Q;  4ID6 A;  3KBX A;  4OHJ A;  1SNO A;  2DGY A;  4IFD G;  5E7N A;  4BA1 I;  5FO9 B;  5FLM G;  3D4W A;  1X55 A;  3OWE B;  3HOY G;  1FR3 A;  1MJE A;  4B3T Q;  4Q5V A;  4PNY A;  1BBX C;  2JA8 G;  4A3E H;  1ZXT A;  1ICW A;  4Q0F A;  4LFC L;  1EWH A;  4PV1 C;  5AJ3 Q;  1PH4 A;  2K5V A;  2YTY A;  1Q7Y C;  1M90 C;  2FMC A;  1NBW A;  4NMZ A;  5C5M A;  1SE3 A;  3A8J E;  3STB D;  1YNJ C;  1N36 L;  1VMP A;  3I7F A;  4LMQ D;  3X3M A;  2OEO A;  4PQX A;  3S14 H;  4XIG S;  1LUZ A;  5AFW A;  4XXE A;  1ZYR D;  2R7D A;  2NTS A;  3K81 C;  1SSO A;  1BKB A;  1A0I A;  1KRS A;  1L2F A;  2K5D A;  3KF6 A;  2K5H A;  4FF3 A;  1U5K A;  3AYH B;  1UEA B;  1PFS A;  1YIJ A;  2PQA B;  3SGI A;  3E0J A;  2F0Q A;  2R7F A;  1X3F A;  1IL2 A;  3KDF A;  4R4O A;  3TBI B;  3CRL C;  2B63 B;  3WOF A;  5FJ8 H;  2EY1 A;  4R1J A;  3ULJ A;  1PRT F;  4X6A H;  2Q2T A;  1DON A;  5A2Q E;  1PH9 A;  2B2W C;  1GM5 A;  2F0K A;  3BZD B;  2KCC A;  2ZJR A;  4R9W A;  5IYC H;  4JI8 L;  4BBS B;  4DV7 Q;  1HFG A;  1SMY D;  1PFM A;  4JPB W;  4UP8 A;  1JOR A;  1X65 A;  2R93 B;  1TWG B;  1CKN B;  5D14 A;  3OPO A;  1D1I A;  2HDM A;  1E2W A;  4DV0 L;  1TY0 A;  2OTL A;  2WB1 B;  3NK9 A;  2VNU D;  4A3D H;  5L37 A;  2JEB I;  2LFN A;  5M5W B;  2WAQ B;  3MXG A;  1LTS D;  5K36 G;  2C9O A;  3NUC A;  2R7Z G;  2F3V A;  1FJG Q;  3STB C;  1WCM H;  2M9V A;  3GV3 A;  2Q8R E;  4KD4 A;  1ESR A;  2EE1 A;  2VUM B;  1CFM A;  4BY7 G;  2NZ1 D;  4DV4 L;  2G9H D;  2RCN A;  3HZX A;  3ZYY X;  4EQP A;  4CJ1 B;  1QIL A;  1MIU A;  3KK7 A;  4NXN L;  3RZO B;  1ILQ A;  3K58 A;  4RWS C;  2EOT A;  2IT1 A;  4NXM Q;  2HD3 A;  3L0O A;  1TY2 A;  3OMG A;  3I4O A;  2ZT9 C;  4JI1 L;  2UXB L;  4DR6 Q;  1I4R A;  1LAB A;  1G2S A;  2OQK A;  2SNS A;  2IX1 A;  3I4M B;  1DOK A;  3S2H B;  3RZD B;  2F0L A;  3G4S A;  4KHP L;  2NBF A;  4K8J A;  5A35 A;  4HJ8 A;  1KHI A;  2LS0 1;  1EWC A;  1AZQ A;  4C2M B;  1HQR D;  3GTQ H;  1GUT A;  1EFW A;  5CYU A;  3D6C A;  1DOM A;  5BN5 A;  5C4J B;  1LLR D;  4Y7N H;  2HHH Q;  2D9U A;  1J8I A;  3BVM A;  4OL7 A;  5F2D A;  1SMY C;  2ENB A;  2PO4 A;  1UNS A;  3T56 B;  5C3E H;  2KCM A;  1TQO A;  2EY2 A;  4N8X 1;  4DNT B;  1FGU A;  1Z47 A;  2I07 B;  4X62 L;  4DV6 Q;  1YNN D;  1O80 A;  3N6R A;  1CTM A;  4O42 A;  4EQN A;  1QCB D;  2G5D A;  3K6O A;  3RN2 A;  1H9J A;  1SJH D;  4A3J B;  1Q90 A;  1E24 A;  2VB2 X;  4IQZ A;  2XGT A;  5IYB H;  3J80 E;  1TWC B;  1I4X A;  1STG A;  1EY0 A;  1XMO Q;  2ATW A;  1XNQ L;  2F03 A;  2NTT A;  1WFQ A;  4DR1 L;  3BDC A;  2F52 A;  4JYA Q;  2NN6 I;  4JI5 L;  4DR3 L;  4LK1 C;  3K0Y A;  4C3I B;  1X32 A;  2B2T A;  3KLS A;  4C3J H;  5IYD H;  4A3L G;  4A3M G;  1HNX Q;  3L9A X;  3NEN A;  4GKJ L;  2PQA A;  2Q2I A;  3N52 A;  3M4Q A;  1TWA B;  1SYC A;  4KMU C;  5IE8 A;  1HR0 W;  2ES2 A;  4GLX A;  2I5L X;  2D2C C;  3BYY B;  3I4N B;  3S1Q H;  2A6E D;  4WJW A;  5IP9 H;  4ZKC B;  1JE5 A;  1X54 A;  2F0G A;  3CCJ A;  1CQV A;  1JJ2 A;  2JA5 H;  2CQO A;  1L1O B;  5IGB A;  4A3K G;  3B6Y A;  3S1R B;  2JA7 B;  1B70 B;  2KOL A;  3GTO B;  3KUP A;  5C44 H;  1AH9 A;  4LFC Q;  2Z6K A;  3V05 A;  4B9X A;  3PIO A;  3HOZ H;  1J5E Q;  3QOL A;  4H0L C;  2ZXR A;  4F8M A;  2CCZ A;  3MXU A;  5EBD A;  2B2V C;  4XYQ A;  1IYU A;  3GTP B;  1CKN A;  1XNR Q;  1MGS A;  2RHS B;  1A3V A;  4LF8 L;  5GQO A;  1PTO D;  3PUW A;  4BBR G;  2A73 B;  1ENA A;  4RGM A;  2EDG A;  4CHT B;  2EYO A;  2K32 A;  2BDO A;  1PTO B;  5C5L A;  2EJG C;  1IKL A;  5I9P A;  2CWA A;  1YNN C;  4A3F G;  3E3X A;  2X6G A;  5EPJ A;  3S2D H;  2FIN B;  1IW7 D;  3TQY A;  1N34 L;  2MQH A;  3V96 A;  1I3Q H;  4K0K Q;  1B50 A;  2UU9 Q;  5CMD A;  3DWQ A;  3PO2 H;  3QJY A;  1AP0 A;  2PZT A;  2CKZ B;  5E3F A;  3DMU A;  3NTI A;  2K5W A;  1MBY A;  4DAV A;  4YWK A;  3PUV A;  4L6T B;  2SDF A;  4I7A A;  3RLF A;  4HMJ A;  1JB7 A;  4K2K A;  2RCF A;  2AQ3 B;  4B3R Q;  1YI2 A;  4JI6 L;  5J3B A;  3QR8 A;  3EA6 A;  4ZAI A;  3NTH A;  2I5H A;  2YTX A;  2B63 H;  4QB4 A;  4C3H G;  1LTL A;  3RLO A;  1XJV A;  2A6H C;  4DV0 Q;  2ZJP A;  2AUJ D;  2TSS A;  3TEH B;  3HOV B;  4LF7 L;  2ZJQ A;  3SK4 A;  3M4Y A;  2A68 D;  5C4X B;  2DJF C;  1WJJ A;  4X66 L;  4LUV A;  1XMQ L;  1KLG D;  3NQT A;  1YEZ A;  1YHB A;  2IW3 A;  1RL2 A;  3HOW G;  1NMG A;  3J7Y W;  1KRT A;  1VQK A;  4L5Q A;  1K8A C;  4KN7 C;  3ERS X;  4ZRZ A;  3DWA A;  3TRZ A;  1JOK A;  2Q2H A;  1IBM Q;  1JWS D;  1Y1W G;  2B39 A;  1XTD A;  4B08 A;  3R8B A;  3M85 A;  2BH8 A;  3A7A B;  2AWO A;  3D3R A;  3RN5 A;  4DAP A;  5EQ0 A;  3U4Z A;  1RHP A;  5ELB A;  4GNX C;  2A74 C;  1Z6H A;  2EYJ A;  1PV4 A;  4AIM A;  2J0T D;  4L5S A;  1HRJ A;  4YWL A;  2K6A A;  2K75 A;  1A6X A;  1L0W A;  1WTO A;  2VUM H;  4F88 A;  2M2L A;  3HKZ B;  1IW7 C;  1V8Q A;  3CCV A;  3MVV A;  3HOX H;  3S17 H;  1BBU A;  1HNZ L;  3E9H A;  2ZXO A;  2UUC Q;  2LXK A;  2MPM A;  1JC7 A;  5M3M G;  5EKI A;  3RZO H;  3HRZ C;  3IAY A;  1IXR A;  4QUF A;  2ZM6 L;  3DXJ C;  1A62 A;  1AE2 A;  2N88 A;  4A3E B;  1I5F A;  2KQ3 A;  4JV5 Q;  2F3W A;  2XIW A;  3A8K E;  2NUC A;  5HGQ A;  4KJN A;  1UE1 A;  2E74 C;  2F0F A;  1SND A;  2K4K A;  1A8V A;  3VR4 A;  3S2H H;  3PSI A;  1U4R A;  1D5X C;  3KJO A;  3M9B A;  3Q8D A;  4B3T L;  4LF5 L;  4X64 Q;  3LGJ A;  4PG3 A;  3S24 A;  2N55 A;  4C2M H;  1E1O A;  3TZD A;  3VR2 A;  5AJ3 L;  3GTJ B;  1L1O A;  1F9P A;  2B29 A;  1LTI D;  4JCV E;  1HTL D;  2SNM A;  2WKD A;  4R4T A;  2EJM A;  4YCU A;  5E1F A;  4CJ0 B;  5E4X A;  1IBK Q;  1F2L A;  3C1F A;  1SE2 A;  1YIT A;  3VDY A;  1VQC A;  4HED A;  3I72 A;  5LMU Q;  5C6A A;  3SK6 A;  3GTL B;  5KND A;  3HP3 A;  1DD2 A;  5KYI A;  3CRK C;  4X65 Q;  4UY8 C;  1XYI A;  2NVQ H;  4CKE A;  1J9O A;  5JEA H;  5ELD A;  4KK7 A;  3PO3 G;  2BA0 A;  2L55 A;  2BCO A;  4IOC A;  4E6I A;  1PYW D;  4AYB B;  4WOR A;  1V1P B;  1PH1 A;  3Q6S A;  2OF1 A;  1BCP F;  2EQS A;  3IFT A;  3CC7 A;  3QWN A;  2OT2 A;  3OIQ A;  2F3I A;  4G4K A;  1SYF A;  2OWO A;  2DY7 A;  4C3I H;  2M00 A;  4OO1 I;  4FYD A;  4TRD A;  3FKI B;  4DV7 L;  1JQY D;  2L15 A;  4A3D B;  3I4M G;  1Q12 A;  5K5P A;  1EZ6 A;  4NW2 A;  1HZ9 A;  1B1Z A;  3JAM E;  1WVL A;  2R92 G;  3D6W A;  4HJA A;  1GHJ A;  1MSG A;  3KLR A;  1I50 B;  3EBE A;  1WCM B;  3S1R H;  5C0X G;  2JA7 H;  1N32 Q;  3GTO H;  1X3E A;  1EIG A;  3U50 C;  4GS3 A;  5E4W C;  2K7V A;  1CHP D;  1Q3L A;  4FVM A;  3HOU G;  3KYH C;  3PMF A;  3GTP H;  1FJG L;  1T9H A;  3I2Z A;  2K28 A;  3Q24 A;  4ODG A;  3I55 A;  4TQU S;  2WP8 J;  2X6L A;  2BE5 D;  5FLX c;  4A3G H;  2KEE A;  1PTO H;  5C3X A;  4OIJ A;  3TZU A;  3H3V C;  2EIF A;  3J81 E;  2Z0S A;  4U67 3;  1SDF A;  1E3P A;  2XNA C;  4NXM L;  3GTQ B;  1KAW A;  1CZW A;  2E2J H;  4A93 G;  2WAC A;  5DM7 3;  1B9N A;  4IUT A;  4DR6 L;  1PXU A;  4DR7 Q;  3S1N H;  4GKK Q;  3HGB A;  4Y7N B;  3A0J A;  1OXT A;  3UE1 A;  4NKL A;  3VR6 A;  2WB1 E;  3OHX C;  1LAC A;  1SFO B;  3NWT A;  1M4V A;  2NVX H;  3A5Z B;  5C3E B;  1WTQ A;  4A3C G;  4U68 A;  3DHQ A;  4FF1 A;  4JI7 Q;  2DNC A;  2RDH A;  4X66 Q;  4RGN A;  2HHH L;  1IBL Q;  5IOC A;  4CGY B;  3AFP A;  1ESF A;  2RA4 A;  3MAQ A;  3CD6 A;  4LF6 Q;  4DXF A;  1SBB B;  3NTK A;  4EVO A;  5FK9 C;  1OXV A;  4RG1 A;  4GOP C;  1PRT D;  1WYD A;  5EKL A;  5CV6 A;  3HOY H;  2IX0 A;  4IJH A;  4OGQ C;  4DV6 L;  1BBW A;  1NTG A;  4HN7 A;  4YCV A;  2EYH A;  1PYB A;  1GVP A;  1K0R A;  2JA8 H;  1Y8N B;  4A3B G;  3T4A C;  3EN2 A;  3GTK B;  3SK5 A;  4RCN A;  2L0C A;  1K28 A;  4DK1 A;  4ZUJ A;  3T51 B;  4IOA A;  1XMO L;  1GUS A;  1K9M C;  4DR5 Q;  2NZO A;  1TT2 A;  3JAM c;  3L3O C;  1KNA A;  3TS2 A;  1GXD C;  4JYA L;  2KCT A;  1ENF A;  2YU9 H;  3S1Q B;  3G7L A;  1LYL A;  2AHO B;  1HNZ Q;  3D4D A;  1B7Y B;  3NEM A;  2BE5 C;  4LJZ C;  1A63 A;  4CJ2 C;  3NEL A;  2VY3 A;  1XPU A;  1K0S A;  1HNX L;  1SNC A;  3IRB A;  5C44 B;  1SXT A;  4H7B A;  2JXM B;  1S5F D;  3HOZ B;  5M5Y H;  2Z9H A;  1F2Z A;  4IPD A;  1Y14 B;  1V1P A;  2LSS A;  4XQJ A;  5M3F G;  3BZC A;  3I91 A;  4CDD C;  2JA6 G;  1X56 A;  4JOI A;  5HUR A;  1Z9F A;  3K5N A;  2GA4 B;  1VF5 C;  2RSN A;  3TRE A;  1HZA A;  4J1M A;  3SXH A;  1J5E L;  4WJ4 A;  2CVR A;  1TWH B;  1TS4 A;  2QGQ A;  3J81 c;  4YWM A;  1EY5 A;  2F0O A;  3L2P A;  3I70 A;  1T5E A;  3F2D A;  2C5C A;  2QCP X;  2B2U C;  2XWB B;  1XNR L;  4B3S Q;  3S2D B;  3EJI A;  1I3Q B;  3GTJ H;  2EYF A;  3W5O A;  3PO2 B;  3H94 A;  4CKC A;  2QDL A;  1H9S B;  1TKW B;  1PRT C;  1YHA A;  1D7Q A;  2IL8 A;  4J15 A;  1O7Z A;  5IY0 A;  1ENC A;  2VQF Q;  3CCS A;  4PMB A;  3W2D A;  4IO9 A;  2KUM A;  1SYG A;  3CCE A;  5T1G A;  5ELE A;  1PH7 A;  4K0K L;  2UU9 L;  2MFI A;  1ROD A;  4A3I G;  4FNF A;  3F2C A;  3GTL H;  1B4O A;  1H9R A;  3GD7 A;  2VZA A;  1SE8 A;  4C1N I;  1SN8 A;  2ZTC A;  1EZ8 A;  4JI3 Q;  1BVS A;  1DJR D;  1YJ9 A;  2Y0S B;  2PW7 A;  3H0G B;  4UPA A;  5LMN Q;  5JJL A;  2F1M A;  4G7O C;  4B3R L;  3FEW X;  2BH2 A;  3GDE A;  2FJ2 A;  4OXP A;  1Y1V B;  3AFQ A;  3T1H Q;  2B2Y C;  2GVA A;  1FL0 A;  4L8J A;  4DNR B;  4RGO S;  2CH4 A;  3AQQ A;  4XTC S;  2EY5 A;  1VQ8 A;  2QDB A;  1O7Y A;  1HXY D;  4DN4 M;  2YYZ A;  3K80 C;  5C0X I;  1GD7 A;  1K8M A;  3S1M H;  3D0F A;  1Q46 A;  2DJG C;  4RFB A;  3HEJ A;  3P1H A;  2E5L Q;  1AZP A;  3TP7 A;  3FKI H;  3IKJ A;  5CV9 A;  1LT6 D;  4HR7 B;  2L11 A;  2F0N A;  4XQQ A;  1NUC A;  3HFZ B;  2E8G A;  2DUD A;  4HAE A;  4IUN A;  2F4I A;  1D5M C;  1G2T A;  1I50 H;  4BXX G;  3A55 A;  1WOC A;  2NWG A;  3P20 A;  1X3P A;  1IBM L;  1BUV T;  1RD9 D;  4P73 A;  4ZQ3 A;  4FDB A;  3QG1 A;  5CV4 A;  1KAA A;  3MEH A;  3E6Z X;  4LF9 Q;  3HOX B;  3S17 B;  5LHY 1;  5IOD A;  1Q82 C;  1EYA A;  1JIC A;  1LTR D;  4IPH A;  4I65 A;  2UUB Q;  3AEV A;  1MI2 A;  3A54 A;  3MTS A;  3X3N A;  3PIO 3;  5J1Z A;  2VL6 A;  1WD1 A;  1QZH A;  5ELO A;  1LT4 D;  1F9Q A;  4QF4 A;  4DPG A;  1Q86 C;  4BA2 I;  2VW9 A;  2UUC L;  2H1E A;  2Z1C A;  2UXC Q;  4KKS A;  2A69 D;  4A75 A;  1DZ1 A;  1YZ6 A;  2B2W A;  3SDZ A;  2HCI A;  4ABN A;  1ASY A;  4JV5 L;  3K59 A;  1E2Z A;  3NQI A;  1I4H A;  3DM1 A;  4ZUI A;  4BWG B;  1YNX A;  4HCE A;  4FXG C;  1Q81 C;  2KHS A;  1PZK D;  5JPM C;  4DR4 Q;  3M4O B;  1CSP A;  4X64 L;  5EKK A;  1SFO H;  4B3M Q;  1DM0 B;  3GQB A;  3BDO A;  2ALY B;  4BY1 B;  5KNB A;  4LFB Q;  1S5C D;  4MNO A;  1HFN A;  4DKA C;  3PV0 A;  3MXN B;  2VS1 A;  2A5H A;  1VQI A;  4A3K H;  1HA5 A;  2MO0 A;  2R61 A;  5JOB A;  4X3T A;  1IBK L;  1RTN A;  2B8G A;  4KTA A;  4KJO A;  4DUZ Q;  2LKV A;  4OO1 H;  2NVQ B;  2NVT B;  1G29 1;  3TP6 A;  2DN8 A;  4ME3 A;  5LMU L;  5H1S E;  2DY8 A;  3HKZ E;  1F77 A;  1HNW Q;  2XVS A;  4QUC A;  1X6O A;  1B2T A;  1QVF A;  1EY6 A;  1CT1 D;  1JJG A;  1QUQ B;  2KVM A;  1H9S A;  4X65 L;  4JI4 Q;  1HPC A;  3OYY A;  2O5I C;  3GTK H;  1GUW A;  1EIF A;  4PMC A;  3R93 A;  4DAM A;  5EBC A;  2FHT A;  4LF5 Q;  4IFD I;  2RDF A;  4KY6 A;  3J7A 5;  1SR3 A;  5KYL A;  1VQL A;  1T5X D;  1NR2 A;  2A6H D;  1CA5 A;  1VQ7 A;  3C3L A;  4HIK A;  3ICE A;  1ET6 A;  3CC4 A;  4DK0 A;  2PNH A;  1C48 A;  1F2M A;  3U9S A;  2L12 A;  4OWW B;  4TSS A;  4LF4 Q;  3C2P A;  2I46 A;  3PUX A;  1VMC A;  1A2T A;  1QVC A;  3BG3 A;  2A69 C;  3PGZ A;  4R4C A;  4IUQ A;  5KGU A;  1QE6 A;  1Q8K A;  2ASB A;  4JC0 A;  1EU3 A;  4JVZ A;  1V1O A;  1XWE A;  4NDX A;  3J81 j;  5I4D A;  4K2L A;  5IGF A;  1VQ9 A;  4O1N A;  1VQB A;  3CXC A;  4C3H H;  1GJX A;  1N32 L;  5IGG A;  4FXK C;  4PMW A;  1VQ6 A;  3CCR A;  3KLS X;  3DEO A;  4C1N K;  5I6Y A;  1Q1B A;  4KI0 A;  4QY7 A;  5JEA J;  1TWH H;  3BVZ A;  4A3G B;  3U9O A;  1KTK A;  3EQL C;  4IN3 A;  5I2Y A;  3PIP 3;  2WKC A;  4GNX B;  2NZH A;  3MHB A;  4AYB E;  3RNU A;  4GLV B;  1STA A;  1I6V C;  3E0E A;  2E2J B;  4K8I A;  1DXM A;  2XRQ D;  3TN2 A;  2MNA A;  3A74 A;  2KJX A;  3S1N B;  1XXG A;  1PA6 A;  1SYB A;  4C3J G;  1Y1W H;  3PCO B;  2KBN A;  1WTW A;  2NVX B;  4ILW A;  4L5R C;  2JSO A;  4DR2 Q;  3T53 B;  3CC2 A;  3F2U A;  4DR7 L;  4GKK L;  1OTC A;  3LX0 A;  5IP7 G;  2XRS D;  2E2D C;  2RSO A;  5IP9 G;  3J80 c;  2E2H B;  2JA5 G;  3SR1 A;  5IGE A;  3H0G H;  5CR3 A;  1TS3 A;  3FP9 A;  4L5T A;  4OEL B;  1Y1V H;  3VYU A;  4JI7 L;  5M5X B;  3HOY B;  5FO8 B;  1D8L A;  4RKB A;  1VQJ A;  1TS5 A;  3VA7 A;  1TXY A;  2JA8 B;  1IBL L;  1P8L A;  2L5T A;  1EIH A;  2QIL A;  4LF6 L;  2CHB D;  2MHV A;  5EJW A;  2B2V A;  1VQA A;  5DLQ E;  1ONL A;  4DV2 Q;  1KD1 C;  3H3V I;  1CA6 A;  1Y8P B;  1CZG A;  4V0B A;  2JK8 A;  3VYT A;  1XPO A;  1JE4 A;  5FLX L;  4QIW E;  4P72 A;  5KNC A;  1PFN A;  4TVA B;  4AQY Q;  3MXN A;  1RTO A;  2YU9 B;  1II3 A;  2IHF A;  5G3L D;  2HIX A;  3BJU A;  1KDB A;  1A3T A;  3CPW A;  1KDC A;  2Z8L A;  3MXP A;  3T1Y Q;  3D31 A;  3K5O A;  4DR5 L;  1M1K C;  3MFY A;  1H9M A;  4OEM B;  4UHV A;  4NB3 A;  5M5Y B;  3J7A F;  3H91 A;  1YHQ A;  1VQ4 A;  1AE3 A;  1QUQ A;  1W6K A;  4OX9 Q;  4DK3 C;  3URY A;  2CH4 W;  2O4X A;  4CDC C;  1EEF D;  2RDG A;  1HR0 Q;  2B63 G;  3K5M A;  2LMC B;  3AU7 A;  1N9W A;  4OWX B;  2AMC B;  2GN5 A;  2X69 A;  1JMC A;  5GAD C;  1M8A A;  1VQH A;  1HCZ A;  1HZB A;  2F0D A;  4N9T A;  3TP8 A;  1GUN A;  3AB9 A;  4BBS G;  5GAH C;  3R2T A;  5IT9 E;  3CCQ A;  1PTO F;  4ME5 A;  2RBM A;  4DV5 Q;  1SYD A;  3RR5 A;  4DV1 Q;  1K73 C;  2E2I H;  1IZ6 A;  2R93 G;  1K3B C;  2JE6 I;  2NVY H;  4MZ9 A;  1W6J A;  1WD0 A;  4A76 A;  1BR9 A;  1EQQ A;  3M4O H;  1VS0 A;  2UXD Q;  2WB1 G;  1PYS B;  1XX8 A;  4FO2 A;  4PZ8 A;  1E1T A;  4R8N A;  4JI2 Q;  4B3S L;  1S4Z A;  1LM0 A;  1U4L A;  4NPS A;  1WI5 A;  3HG9 A;  1U4M A;  4RKL A;  4BY1 H;  2QF7 A;  3U58 A;  4TKO B;  1AEX A;  3MC0 B;  4LWC A;  1BCP C;  2WAQ G;  2FMM A;  2R7Z B;  3BZK A;  4GZY C;  5C0X H;  5KEE A;  4GN5 A;  2VQF L;  4EX5 A;  3VR5 A;  1YBY A;  1GOZ A;  2NVT H;  4BY7 B;  2OQ0 A;  5HY6 A;  4GNX A;  3S15 H;  2PNR C;  2VUM G;  1HA6 A;  2EXD A;  2KEC A;  1SMX A;  2FFK B;  4HSV A;  2R3Z A;  2EXZ A;  1KXL A;  3J7Z C;  4XT3 B;  4JI3 L;  4YCW A;  2D0P A;  1QVG A;  4OON A;  4EGV A;  1OO9 B;  5LMN L;  2QKI C;  3I8Z A;  3S1M B;  2V4D A;  1I4G A;  3H6M A;  1SNQ A;  3T1H L;  2B3G A;  3ND8 A;  1KAB A;  5JVG 3;  2F0T A;  4H13 C;  4JG2 A;  1VQF A;  3J81 L;  1CKM A;  1EFI D;  4V19 0;  1VDZ A;  4EQO A;  2K01 A;  2L9H A;  3M3Y H;  5I9O A;  1K83 B;  4GOP B;  4HIM A;  3DM3 A;  5BN4 A;  1LTA D;  3CPF A;  3IL8 A;  5COY A;  4LAA A;  2E5L L;  4DAY B;  1I4P A;  4X3K A;  1IYV A;  4GN3 B;  4HJ9 A;  1R4P B;  4CDF C;  2GVB A;  1TR5 A;  1Q1E A;  2AWN A;  1GKH A;  4RMF A;  1SJE D;  4MHE A;  4A3C H;  4AH6 A;  3FRP B;  5ISR A;  1PH2 A;  3CME A;  3KF8 B;  1QG7 A;  3VR3 A;  1ZEQ X;  4MTK A;  1S40 A;  1NR4 A;  4UAI A;  2TMP A;  4KLK A;  4Z9C B;  5GRO A;  4LF9 L;  3K5L A;  4FF2 A;  4QIW B;  4A3J G;  4JK1 C;  2Y0S E;  5JEA G;  5BR8 L;  5IT9 c;  2YV5 A;  1SNM A;  1BO0 A;  4QJF A;  2UUB L;  1LT5 D;  1PVO A;  4QL5 A;  4A3B H;  2IJ0 A;  1X3G A;  4ULL A;  2KED A;  2UUA Q;  4O2D A;  5DEH A;  2PZU A;  2CW0 C;  2KHJ A;  4IPC A;  5ELF A;  5ELC A;  5JJI A;  1QWY A;  3A8I E;  1B9M A;  4KHV A;  4C3I G;  2HCC A;  3OSO A;  1UAP A;  2WFW A;  1IYJ B;  5D65 A;  2UXC L;  2EJF C;  3NSW A;  5KRU A;  5C3W A;  2CQA A;  4HMI A;  1J6Q A;  1HUN A;  3S16 H;  1TS2 A;  1BOS A;  4KHZ A;  1SE4 A;  1TU2 B;  3I4L A;  4K6L A;  1W2B A;  2H4O A;  3Q22 A;  3A5U A;  2MUY A;  1SAP A;  3I4N G;  5CV7 A;  3J7A V;  1U0L A;  4DR4 L;  4A3K B;  3CCM A;  4K14 A;  2E2H H;  3NWS A;  3SE0 A;  5D3D A;  3W1B A;  4IFD H;  4B3M L;  2JQO A;  3CQZ H;  4HCS A;  4WFN 3;  1Y69 U;  2JA7 G;  1TII D;  4N8F A;  4QGU A;  4LFB L;  2K14 A;  5FLM H;  5M3F H;  4KKT A;  1GHK A;  5IGC A;  3CMA A;  1LO5 D;  2L1B A;  5M5X H;  2JA6 H;  2EYP A;  1PRT B;  1UE6 A;  2HIV A;  1MKH A;  4DUY Q;  1F9R A;  1UE7 A;  2PW5 A;  1EEI D;  4KN4 C;  4X3U A;  1UUP A;  4S3S A;  4DUZ L;  2RVL A;  1PMR A;  4BBR B;  1FD7 D;  1CSQ A;  5TSS A;  1PH6 A;  4YHH Q;  2K5N A;  1C9O A;  3EVQ A;  2XSC A;  1ML0 D;  1HNW L;  2EYL A;  5CV5 A;  1JR0 D;  2F0V A;  4LW1 A;  4A3F B;  1KQS A;  1STB A;  4G57 A;  4JW0 A;  1WTP A;  1PFB A;  4DGZ A;  4JI4 L;  1FGB D;  5EGT A;  4HIO A;  3VA5 A;  1K8O A;  3OIP A; 
#chains in the Genus database with same CATH homology
 4FF4 A;  4RGT A;  2XN9 C;  4K6D A;  1WTR A;  3FDT A;  1KLU D;  1I6H B;  1BXT A;  3DEP A;  2IWH A;  4P2C B;  1FNV A;  2Q8T A;  4KKU A;  5FO7 B;  1EOT A;  4ZK9 B;  4C3H B;  2NN6 G;  2ID0 A;  3UI2 A;  2OXP A;  3IFD A;  1S5E D;  1VF7 A;  4M1U B;  5A2Q L;  5DM6 3;  1NAP A;  4H44 C;  1OXU A;  1EY8 A;  2K1B A;  1QB5 D;  1C4Q A;  2K5Q A;  1B53 A;  5CV8 A;  3I73 A;  1STY A;  2E76 C;  4RHS A;  3HOW B;  1D5Z C;  4DAY A;  1SNP A;  1IHZ A;  3HS0 C;  2BA1 A;  3VYS A;  3G6J B;  1Y1W B;  1JOO A;  4UDU C;  1PLF A;  1IL8 A;  3KF8 A;  5K36 H;  4XDX A;  2MP1 A;  1RJT A;  2WIN B;  4XQN A;  3CU7 A;  2Z4I A;  2EYM A;  1LT3 D;  1L0Y B;  3T16 A;  5COR A;  2RKS A;  1LTB D;  3A7L A;  3SVM A;  5M3M B;  2E75 C;  3QB3 A;  2PPB C;  2PCF B;  4F87 A;  1PDQ A;  2WII B;  5JPN C;  1F2Y A;  2PQE A;  1PZJ D;  1BNZ A;  2R6G A;  2K03 A;  2MGS A;  4RCO A;  2VXW A;  1BDO A;  2B2U A;  3I3C A;  1JWM D;  2JEA I;  4XT1 B;  3GTM B;  2PYK A;  3BYT B;  5FKA C;  4M8A A;  4DXG A;  3R3O A;  2F0J A;  4RA8 A;  2VB3 X;  4ZYS A;  3L7Z C;  4ZKB B;  5M9O A;  1I4Q A;  1EY9 A;  2LY7 A;  3J80 L;  3PO3 B;  1DYQ A;  2AQ2 B;  4B9W A;  3WDN A;  1ZYR C;  4IUR A;  4C56 C;  1ZKO A;  3FPU B;  1V43 A;  2B2T C;  1SYE A;  1BF4 A;  1H9K A;  2B2Y A;  1CM9 A;  2E2I B;  2NVY B;  1Y8O B;  4N9P A;  2F0W A;  3OW7 A;  1LV9 A;  2B8F A;  2Z4H A;  2EY6 A;  3CHB D;  4KV6 A;  4KY7 A;  2R92 B;  3NP8 A;  2D5D A;  1TWF B;  3GV6 A;  3SEB A;  1CI3 M;  5CGK A;  3D8G A;  5BN3 A;  1EQT A;  3S15 B;  1R4Q B;  3K57 A;  2AUK A;  4IUU A;  5KIX A;  4XYO A;  1S5B D;  2J7Z A;  3C46 A;  3HOU B;  1ET9 A;  3ERO A;  1MD2 D;  1AW7 A;  1CQF A;  3QO2 A;  5HGT A;  4OIK A;  2EZV A;  4YIJ A;  3ERQ A;  5T1I A;  2EVB A;  1GUG A;  1KDA A;  2RQX A;  1RF2 D;  4IZ8 A;  5IIF A;  4A93 B;  2DNE A;  4QMG A;  3KBG A;  3M3Y B;  1FYC A;  4CBV A;  1FNU A;  3O13 A;  5NUC A;  3E5S A;  1Z7T A;  3C1E A;  3DWP A;  5JAV A;  1OXS C;  4K5W A;  5C0X J;  2J4X A;  1HTP A;  2KCN A;  4OO1 G;  1A3U A;  3M7G A;  3FMC A;  2BOS A;  4WRD A;  2F0H A;  4X3S A;  2SEB D;  3DUZ A;  3P7J A;  5I2X A;  2K04 A;  1EY7 A;  4A3B B;  4IAL A;  1G8Z D;  1R9T B;  3TSS A;  2XWJ B;  5DNF A;  4KY5 A;  3QIA A;  3K7A B;  2D62 A;  1JWU D;  1AN8 A;  3S16 B;  4F7X A;  5J39 A;  5DAU A;  2O2L D;  1RCV D;  4DF7 A;  3PUY A;  5EPL A;  4RHR A;  1EYC A;  3MWY W;  1STN A;  1O78 A;  1JB3 A;  3CQZ B;  1X3Q A;  1XTC D;  5D3I B;  4QCL A;  1EQV A;  2PMZ B;  2HUG A;  5M3F B;  1CK1 A;  3TDQ A;  4K5X A;  1WTX A;  2F0U A;  2JA6 B;  1CHQ D;  5CC4 A;  3BDL A;  3NBI A;  2MJ8 A;  3SHL A;  1TVX A;  3M7N A;  1BCP D;  2IX3 A;  3MZ5 A;  1BCP B;  2AQ1 B;  2HQE A;  2A6E C;  1D6E C;  1PZI D;  5IT9 L;  3ONA B;  3TP5 A;  4RH6 A;  2F0E A;  1RDP D;  1BQQ T;  1QNU A;  2EPB A;  5CBA E;  5C4H A;  1AFP A;  2WV6 D;  4A3I B;  1U4P A;  1ILP A;  2K05 A;  4JBW A;  5JVH 3;  1PTO C;  3WOE A;  3GP7 A;  4IFD J;  1QOH A;  3GO5 A;  1U9R A;  1L0X B;  4IUV A;  1QJO A;  3NE5 B;  1EL0 A;  3RMH A;  3GTG B;  2ICE C;  3LWU A;  3P75 A;  4FXD A;  1QNK A;  1O7L A;  3CKI B;  3NXW A;  3T13 A;  5FLX E;  1VCI A;  1STE A;  3LWE A;  2L4N A;  3S14 B;  3JAM L;  4DA2 A;  1OXX K;  2F0P A;  1DOL A;  4BS9 A;  2A68 C;  2QEJ C;  3ND9 A;  2CW0 D;  5EPK A;  1LTG D;  2JP1 A;  1F9S A;  1GUO A;  2ZXP A;  1DCZ A;  2NYZ D;  1KNE A;  3OWF A;  1STH A;  4KD3 A;  1C8C A;  1NCV A;  3S9W A;  4DU9 A;  4HTH A;  3FVQ A;  3NPP A;  4R8I A;  3D4R A;  1S5D D;  1Q8I A;  1A15 A;  4MIU A;  3MA2 B;  4HSP A;  1FNW A;  2ICI A;  3NHH A;  5G3L F;  3QOJ A;  1G91 A;  3SK8 A;  3OMC A;  3Q23 A;  1MSH A;  1JOQ A;  5C4Z A;  4ZLT F;  3OOC A;  1B44 D;  4DFA A;  3EFX D;  1EU4 A;  4NP5 A;  1D2B A;  2SOB A;  1RKN A;  5J22 A;  2G9D A;  1EYD A;  1IKM A;  3NBH A;  3ITP A;  1HQM C;  3LNN A;  2NB0 A;  4J8Q A;  4G7Z C;  2F0M A;  2F0S A;  4MN3 A;  4A3M B;  1EY4 A;  2JYO A;  1SEB D;  2PZW A;  2HDL A;  1WTV A;  4RAU C;  3VYR A;  2IPK D;  2O5J C;  1JCK B;  5LL6 X;  5FOB B;  3TME A;  4G7H C;  2Q8I B;  2BDN A;  1G6Z A;  5IGD A;  3AMU A;  2KA7 A;  3I90 A;  4IUP A;  3PUZ A;  3A56 A;  5LL6 S;  1YNJ D;  2NN6 H;  2K33 A;  3BVG A;  1E2V A;  3R2I A;  5CBE E;  4CKB A;  4L63 B;  1HUM A;  4I7Z C;  3MFG A;  5I6W A;  2F0I A;  1LTT D;  3RD4 A;  1NSN S;  4C3J B;  3V2T A;  3H09 A;  5JJZ A;  3RUZ A;  3FPP A;  3Q0A A;  1HHV A;  1D1K A;  4FP5 D;  4J6H A;  1A2U A;  1E0B A;  1B3A A;  3BS1 A;  2JA5 B;  3W3A A;  4K5V A;  4ID6 A;  3KBX A;  4OHJ A;  1SNO A;  4IFD G;  4BA1 I;  5FO9 B;  3D4W A;  3OWE B;  1FR3 A;  4Q5V A;  4PNY A;  1BBX C;  1ZXT A;  1ICW A;  4Q0F A;  1EWH A;  4PV1 C;  2FMC A;  4NMZ A;  5C5M A;  1SE3 A;  3A8J E;  1YNJ C;  1VMP A;  4LMQ D;  3X3M A;  2OEO A;  4PQX A;  4XIG S;  5AFW A;  4XXE A;  1ZYR D;  2NTS A;  1SSO A;  2K5D A;  4FF3 A;  1UEA B;  3E0J A;  2F0Q A;  3TBI B;  3CRL C;  2B63 B;  3WOF A;  2EY1 A;  1PRT F;  1DON A;  5A2Q E;  2B2W C;  2F0K A;  3BZD B;  2KCC A;  4R9W A;  4BBS B;  1HFG A;  1SMY D;  1PFM A;  1JOR A;  2R93 B;  1TWG B;  5D14 A;  1D1I A;  2HDM A;  3OPO A;  1E2W A;  1TY0 A;  2WB1 B;  3NK9 A;  2VNU D;  2JEB I;  2LFN A;  5M5W B;  2WAQ B;  3MXG A;  1LTS D;  5K36 G;  2C9O A;  3NUC A;  2F3V A;  2M9V A;  3GV3 A;  2Q8R E;  4KD4 A;  1ESR A;  2EE1 A;  2VUM B;  1CFM A;  2NZ1 D;  2G9H D;  3ZYY X;  3HZX A;  4EQP A;  4CJ1 B;  1QIL A;  3KK7 A;  3RZO B;  1ILQ A;  3K58 A;  4RWS C;  2EOT A;  2IT1 A;  1TY2 A;  3OMG A;  2ZT9 C;  1I4R A;  1LAB A;  1G2S A;  2SNS A;  2IX1 A;  3I4M B;  1DOK A;  3S2H B;  3RZD B;  2F0L A;  2NBF A;  4K8J A;  5A35 A;  2LS0 1;  1EWC A;  1AZQ A;  4C2M B;  1HQR D;  1GUT A;  5CYU A;  3D6C A;  1DOM A;  5BN5 A;  5C4J B;  1LLR D;  2D9U A;  1J8I A;  3BVM A;  4OL7 A;  5F2D A;  1SMY C;  2ENB A;  2PO4 A;  1UNS A;  3T56 B;  1TQO A;  2EY2 A;  4DNT B;  1Z47 A;  2I07 B;  1YNN D;  1O80 A;  3N6R A;  1CTM A;  4O42 A;  4EQN A;  1QCB D;  3K6O A;  1H9J A;  1SJH D;  4A3J B;  1Q90 A;  2VB2 X;  4IQZ A;  3J80 E;  1TWC B;  1I4X A;  1STG A;  1EY0 A;  2F03 A;  2NTT A;  3BDC A;  2NN6 I;  4LK1 C;  3K0Y A;  4C3I B;  1X32 A;  2B2T A;  3KLS A;  3L9A X;  3N52 A;  1TWA B;  1SYC A;  4KMU C;  2D2C C;  3BYY B;  3I4N B;  2A6E D;  4WJW A;  4ZKC B;  2F0G A;  1CQV A;  5IGB A;  3S1R B;  2JA7 B;  2KOL A;  3GTO B;  3KUP A;  3V05 A;  4B9X A;  3QOL A;  4H0L C;  2ZXR A;  4F8M A;  3MXU A;  5EBD A;  2B2V C;  4XYQ A;  1IYU A;  3GTP B;  1MGS A;  1A3V A;  1PTO D;  3PUW A;  2A73 B;  1ENA A;  4RGM A;  4CHT B;  2EDG A;  2EYO A;  2K32 A;  2BDO A;  1PTO B;  5C5L A;  2EJG C;  1IKL A;  5I9P A;  1YNN C;  2X6G A;  5EPJ A;  2FIN B;  1IW7 D;  3V96 A;  1B50 A;  5CMD A;  3DWQ A;  3QJY A;  1AP0 A;  2PZT A;  5E3F A;  3DMU A;  3NTI A;  2K5W A;  1MBY A;  4DAV A;  3PUV A;  4L6T B;  2SDF A;  3RLF A;  4HMJ A;  4K2K A;  2AQ3 B;  3EA6 A;  4ZAI A;  3NTH A;  4QB4 A;  4C3H G;  2A6H C;  2AUJ D;  2TSS A;  3HOV B;  3SK4 A;  3M4Y A;  2A68 D;  5C4X B;  1KLG D;  3NQT A;  2IW3 A;  3J7Y W;  4KN7 C;  4ZRZ A;  3DWA A;  1JOK A;  1JWS D;  2B39 A;  4B08 A;  3R8B A;  3M85 A;  3A7A B;  2AWO A;  3D3R A;  4DAP A;  5EQ0 A;  1RHP A;  5ELB A;  2A74 C;  1Z6H A;  2EYJ A;  2J0T D;  1HRJ A;  2K6A A;  1A6X A;  1WTO A;  4F88 A;  2M2L A;  3HKZ B;  1IW7 C;  1V8Q A;  3MVV A;  2ZXO A;  2MPM A;  1JC7 A;  5EKI A;  3HRZ C;  3IAY A;  4QUF A;  3DXJ C;  4A3E B;  2N88 A;  2KQ3 A;  2F3W A;  2XIW A;  3A8K E;  2NUC A;  4KJN A;  2E74 C;  2F0F A;  1SND A;  3VR4 A;  1U4R A;  1D5X C;  2N55 A;  3TZD A;  3VR2 A;  3GTJ B;  1F9P A;  1LTI D;  1HTL D;  2SNM A;  2WKD A;  2EJM A;  5E1F A;  4CJ0 B;  5E4X A;  1F2L A;  3C1F A;  1SE2 A;  4HED A;  3I72 A;  5C6A A;  3SK6 A;  3GTL B;  5KND A;  3HP3 A;  1DD2 A;  5KYI A;  3CRK C;  1XYI A;  4CKE A;  1J9O A;  5JEA H;  5ELD A;  4KK7 A;  2BA0 A;  2L55 A;  2BCO A;  4E6I A;  1PYW D;  4AYB B;  4WOR A;  1V1P B;  3Q6S A;  2OF1 A;  1BCP F;  3IFT A;  3QWN A;  2OT2 A;  3OIQ A;  4G4K A;  1SYF A;  2DY7 A;  2M00 A;  4OO1 I;  4FYD A;  4TRD A;  3FKI B;  1JQY D;  4A3D B;  1Q12 A;  5K5P A;  1EZ6 A;  4NW2 A;  1B1Z A;  3JAM E;  1WVL A;  3D6W A;  1GHJ A;  1MSG A;  3KLR A;  1I50 B;  1WCM B;  5C0X G;  1EIG A;  5E4W C;  2K7V A;  1CHP D;  1Q3L A;  4FVM A;  3PMF A;  2K28 A;  3Q24 A;  4ODG A;  4TQU S;  2WP8 J;  2X6L A;  2BE5 D;  2KEE A;  1PTO H;  5C3X A;  4OIJ A;  3TZU A;  3H3V C;  3J81 E;  4U67 3;  1SDF A;  2XNA C;  3GTQ B;  1CZW A;  2WAC A;  5DM7 3;  1B9N A;  4IUT A;  1PXU A;  3HGB A;  4Y7N B;  1OXT A;  4NKL A;  3VR6 A;  3OHX C;  1SFO B;  1LAC A;  3NWT A;  1M4V A;  5C3E B;  1WTQ A;  4U68 A;  3DHQ A;  4FF1 A;  2DNC A;  2RDH A;  4RGN A;  5IOC A;  4CGY B;  1ESF A;  2RA4 A;  3MAQ A;  4DXF A;  1SBB B;  3NTK A;  4EVO A;  5FK9 C;  1OXV A;  1PRT D;  5EKL A;  5CV6 A;  2IX0 A;  4OGQ C;  4HN7 A;  2EYH A;  1Y8N B;  3T4A C;  3GTK B;  3SK5 A;  4RCN A;  2L0C A;  4DK1 A;  4ZUJ A;  3T51 B;  1GUS A;  1TT2 A;  3L3O C;  1KNA A;  1GXD C;  1ENF A;  3S1Q B;  3G7L A;  3D4D A;  2BE5 C;  4LJZ C;  4CJ2 C;  1SNC A;  5C44 B;  1SXT A;  4H7B A;  2JXM B;  1S5F D;  3HOZ B;  1F2Z A;  1V1P A;  4XQJ A;  3I91 A;  5HUR A;  3K5N A;  2GA4 B;  1VF5 C;  2RSN A;  4J1M A;  3SXH A;  2CVR A;  1TWH B;  1TS4 A;  1EY5 A;  2F0O A;  3I70 A;  1T5E A;  2C5C A;  2QCP X;  2B2U C;  2XWB B;  3S2D B;  3EJI A;  1I3Q B;  2EYF A;  3PO2 B;  3H94 A;  4CKC A;  1H9S B;  1TKW B;  1PRT C;  2IL8 A;  1O7Z A;  1ENC A;  4PMB A;  3W2D A;  2KUM A;  1SYG A;  5T1G A;  5ELE A;  1ROD A;  4FNF A;  1B4O A;  1H9R A;  3GD7 A;  4C1N I;  1EZ8 A;  1DJR D;  2Y0S B;  2PW7 A;  3H0G B;  2F1M A;  4G7O C;  3FEW X;  2FJ2 A;  1Y1V B;  2B2Y C;  4L8J A;  4DNR B;  4RGO S;  4XTC S;  2EY5 A;  2QDB A;  1O7Y A;  1HXY D;  4DN4 M;  2YYZ A;  5C0X I;  1K8M A;  4RFB A;  3HEJ A;  3P1H A;  1AZP A;  3TP7 A;  3IKJ A;  5CV9 A;  1LT6 D;  4HR7 B;  2L11 A;  2F0N A;  4XQQ A;  1NUC A;  4HAE A;  4IUN A;  2F4I A;  1D5M C;  1G2T A;  3A55 A;  2NWG A;  3P20 A;  1X3P A;  1BUV T;  1RD9 D;  4ZQ3 A;  3QG1 A;  5CV4 A;  1KAA A;  3MEH A;  3E6Z X;  3HOX B;  3S17 B;  5LHY 1;  5IOD A;  1EYA A;  1JIC A;  1LTR D;  4I65 A;  1MI2 A;  3A54 A;  3MTS A;  3X3N A;  3PIO 3;  5J1Z A;  1WD1 A;  1LT4 D;  1F9Q A;  4QF4 A;  4BA2 I;  2H1E A;  2Z1C A;  4KKS A;  2A69 D;  1DZ1 A;  2B2W A;  3SDZ A;  2HCI A;  4ABN A;  3K59 A;  1E2Z A;  3NQI A;  1I4H A;  3DM1 A;  4ZUI A;  4BWG B;  4HCE A;  4FXG C;  2KHS A;  1PZK D;  5JPM C;  3M4O B;  5EKK A;  1DM0 B;  3GQB A;  3BDO A;  4BY1 B;  5KNB A;  1S5C D;  1HFN A;  3PV0 A;  2A5H A;  1HA5 A;  2R61 A;  5JOB A;  4X3T A;  4OO1 H;  1RTN A;  2B8G A;  4KTA A;  4KJO A;  2LKV A;  2NVQ B;  2NVT B;  1G29 1;  3TP6 A;  2DN8 A;  2DY8 A;  1F77 A;  2XVS A;  4QUC A;  1B2T A;  1EY6 A;  1CT1 D;  2KVM A;  1H9S A;  1HPC A;  2O5I C;  1GUW A;  4PMC A;  3R93 A;  5EBC A;  2FHT A;  4IFD I;  2RDF A;  4KY6 A;  5KYL A;  1T5X D;  1NR2 A;  2A6H D;  1CA5 A;  3C3L A;  1ET6 A;  4DK0 A;  1C48 A;  1F2M A;  3U9S A;  2L12 A;  4TSS A;  3C2P A;  2I46 A;  3PUX A;  1VMC A;  1A2T A;  3BG3 A;  2A69 C;  4IUQ A;  5KGU A;  1QE6 A;  1EU3 A;  1V1O A;  1XWE A;  4NDX A;  5I4D A;  4K2L A;  5IGF A;  4O1N A;  1GJX A;  5IGG A;  4FXK C;  4PMW A;  3KLS X;  3DEO A;  4C1N K;  5I6Y A;  1Q1B A;  4KI0 A;  5JEA J;  3BVZ A;  4A3G B;  3U9O A;  1KTK A;  3EQL C;  4IN3 A;  5I2Y A;  3PIP 3;  2WKC A;  3MHB A;  1STA A;  1I6V C;  2E2J B;  4K8I A;  1DXM A;  2XRQ D;  3TN2 A;  2KJX A;  3S1N B;  1XXG A;  1SYB A;  4C3J G;  1WTW A;  2NVX B;  4ILW A;  2JSO A;  3T53 B;  3F2U A;  3LX0 A;  2XRS D;  2E2D C;  2RSO A;  2E2H B;  3SR1 A;  5IGE A;  5CR3 A;  1TS3 A;  3VYU A;  5M5X B;  3HOY B;  5FO8 B;  4RKB A;  1TS5 A;  3VA7 A;  2JA8 B;  2L5T A;  1EIH A;  2QIL A;  2CHB D;  2MHV A;  5EJW A;  2B2V A;  1ONL A;  1CA6 A;  1Y8P B;  1CZG A;  4V0B A;  3VYT A;  1JE4 A;  5FLX L;  5KNC A;  1PFN A;  3MXN A;  1RTO A;  2YU9 B;  1II3 A;  5G3L D;  1KDB A;  1A3T A;  1KDC A;  2Z8L A;  3MXP A;  3D31 A;  3K5O A;  3MFY A;  1H9M A;  5M5Y B;  3J7A F;  3H91 A;  1W6K A;  3URY A;  2O4X A;  1EEF D;  2RDG A;  3K5M A;  2LMC B;  3AU7 A;  2X69 A;  1M8A A;  1HCZ A;  2F0D A;  4N9T A;  3TP8 A;  1GUN A;  3AB9 A;  3R2T A;  5IT9 E;  1PTO F;  4ME5 A;  2RBM A;  1SYD A;  1WD0 A;  2JE6 I;  1W6J A;  1BR9 A;  1XX8 A;  4FO2 A;  4R8N A;  1S4Z A;  1U4L A;  3HG9 A;  1U4M A;  4RKL A;  2QF7 A;  4TKO B;  1AEX A;  3MC0 B;  1BCP C;  2FMM A;  2R7Z B;  4GZY C;  5C0X H;  5KEE A;  3VR5 A;  1GOZ A;  4BY7 B;  2PNR C;  1HA6 A;  2KEC A;  2FFK B;  4HSV A;  2R3Z A;  2EXZ A;  4XT3 B;  4EGV A;  1OO9 B;  2QKI C;  3I8Z A;  3S1M B;  2V4D A;  1I4G A;  3H6M A;  1SNQ A;  3ND8 A;  1KAB A;  5JVG 3;  2F0T A;  4H13 C;  3J81 L;  1EFI D;  4V19 0;  1VDZ A;  4EQO A;  2K01 A;  2L9H A;  5I9O A;  1K83 B;  5BN4 A;  1LTA D;  3IL8 A;  5COY A;  4LAA A;  1I4P A;  4X3K A;  1IYV A;  1R4P B;  1TR5 A;  1Q1E A;  2AWN A;  1SJE D;  4MHE A;  3FRP B;  5ISR A;  1QG7 A;  3VR3 A;  1ZEQ X;  1NR4 A;  4UAI A;  2TMP A;  4Z9C B;  3K5L A;  4FF2 A;  4QIW B;  4JK1 C;  5JEA G;  1SNM A;  1BO0 A;  1LT5 D;  2IJ0 A;  4ULL A;  2KED A;  5DEH A;  2PZU A;  2CW0 C;  5ELF A;  5ELC A;  1QWY A;  3A8I E;  1B9M A;  4KHV A;  4C3I G;  2HCC A;  3OSO A;  1UAP A;  5D65 A;  2EJF C;  3NSW A;  5KRU A;  5C3W A;  2CQA A;  4HMI A;  1HUN A;  1TS2 A;  1BOS A;  4KHZ A;  1SE4 A;  1TU2 B;  3I4L A;  4K6L A;  2H4O A;  3Q22 A;  2MUY A;  1SAP A;  5CV7 A;  3J7A V;  4A3K B;  4K14 A;  3NWS A;  3SE0 A;  5D3D A;  4IFD H;  4HCS A;  4WFN 3;  1Y69 U;  1TII D;  4KKT A;  1GHK A;  5IGC A;  1LO5 D;  2L1B A;  2EYP A;  1PRT B;  1F9R A;  4KN4 C;  2PW5 A;  1EEI D;  4X3U A;  1UUP A;  4S3S A;  2RVL A;  1PMR A;  4BBR B;  1FD7 D;  5TSS A;  3EVQ A;  2XSC A;  1ML0 D;  5CV5 A;  2EYL A;  1JR0 D;  2F0V A;  4A3F B;  1STB A;  4G57 A;  1WTP A;  1PFB A;  4DGZ A;  1FGB D;  5EGT A;  3VA5 A;  1K8O A;  3OIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...