4DAYA

Crystal structure of the rmi core complex with mm2 peptide from fancm
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
144
structure length
144
Chain Sequence
IAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RecQ-mediated genome instability protein 1
publication title Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/hydrolase
total genus 35
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dayA01
4DAYA 3NBHA 3MXNA
chains in the Genus database with same CATH superfamily
2E74C 3CPFA 1HA6A 3I3CA 4X64L 3JAME 1NMGA 2JA8B 1KRSA 1D8LA 1PYSB 1VF5C 2K5VA 2VL6A 1NTGA 1I6HH 1SE3A 1BCPF 1PH9A 5IGBA 4BY7H 2ENBA 1M8AA 4IZ8A 3S1QB 2GA4B 4P75A 5C4ZA 3HKZB 5D14A 3TZDA 2HHHL 4KN4C 1CI3M 3KK7A 4HTHA 4XQNA 5EGTA 3MFGA 1CKOA 3AFQA 4YCWA 1YNNC 4A76A 4XYOA 1QZGA 3HOWG 1PH7A 4R1JA 3K5OA 2PZTA 1TWGB 3VDYA 1EZ6A 1CSQA 2CH4W 5C3WA 1LLRD 1EEID 5FOBB 3VR3A 2B2TA 1EWCA 3D4DA 2VY3A 1WTVA 4DA2A 4APVA 1QJOA 2AQ1B 5CV6A 4BBSB 2KHIA 4A3BB 2F0IA 5FJ8H 2ASBA 4HSVA 3S14H 3F1ZA 4G7OC 2R7ZH 1FJGL 1ASZA 4E6IA 1H95A 1SE2A 4QMGA 1X56A 1X65A 1Q1BA 2RHSB 2NVTH 4DFAA 4X6AH 3MFYA 4JBWA 1TS2A 1HQRD 1N32Q 1MIUA 3MEHA 3K5LA 4A3LG 1EEFD 3MXUA 1HA5A 1VQGA 1VMPA 4PG3A 2V4DA 3D4WA 1HFNA 1WYDA 4DAYA 1HZ9A 1K83H 2K7VA 3HOYH 3MEFA 4IURA 2UXDQ 1WTXA 3FKIH 1PRTF 1XPUA 3S16B 3LWUA 3ERSX 1LTBD 2HCIA 4CDEC 4LFAQ 1DGSA 1OXUA 2F0MA 1CKNA 1F9PA 5IYBG 1Y1WG 4LAAA 2B2YA 1B3AA 3J80c 1Q8KA 2NB0A 1EY7A 3J81i 5CV8A 3QB3A 1ML0D 1AE3A 4PZ7A 1ZYRC 3JAMi 3S1NB 2Q8IB 1UEBA 4ZQ3A 1J8IA 2VQEL 3P20A 3TDQA 4KJOA 3E9IA 1G291 2EYJA 1X3QA 2EJGC 2UUBQ 4HN7A 4JYAQ 1C0AA 1EQRA 2RF4A 4BY7B 1YVCA 3JC66 4A3DH 4AYBB 1PFNA 2FFKB 5BR8Q 4QGUA 5KRUA 3HOXG 2VW9A 3PO2G 1JWSD 1F9QA 3J7ZC 5LHY1 1QCBD 5E4XA 4Y7NH 1B53A 1XYIA 3M7GA 4GOPB 3U58A 3NWTA 4DXGA 1H9KA 1CZWA 4EVOA 3K6OA 5D3DA 2F4IA 2F0UA 2DUDA 2IY5B 5JJLA 2M00A 3IFDA 1TS3A 3B6YA 4DR1Q 2YU9H 2QDBA 4DK6C 2N55A 1N36L 2PCFB 5ELFA 2VNUD 1D5XC 4P72A 4A93G 3S14B 4ZUJA 1SROA 2PI2E 2R7ZB 4LMQD 1WTRA 4FF2A 2F0LA 3MAQA 2QA4A 2DY8A 4O1NA 2F0DA 1PXUA 2DJFC 3FDTA 4G4KA 2NVTB 1VDZA 1X55A 3NWSA 5IT9c 1SYCA 2ZXRA 5IP7G 5BN4A 2ES2A 1WTOA 4NXML 5M9OA 4CKEA 1Q81C 3I73A 3NUCA 1EU4A 1K83B 3HOYB 1U0LA 3X3MA 3BJUA 1CM9A 4ZYSA 3FKIB 4P2CB 4PV1C 4CDDC 3FPUB 2EY2A 1RIPA 4BBRB 4A3MH 1AFPA 2EDGA 2ZTEA 3A5ZB 2F52A 1R4QB 1T5EA 4MNOA 5G3LF 1FD7D 4R4QA 1BCPC 4JI6Q 3S1NH 1G6PA 3JAMc 3G6EA 2F0SA 3GQBA 5J39A 4DV6L 3Q0AA 2ZT9C 2XNAC 3F2UA 1XNRL 2K04A 1N33Q 2F3IA 2JA9A 3CCQA 3IL8A 1NBWA 3H3VC 2PQAB 5M5XH 2UUCL 2D5DA 4PMBA 4JBMA 3PIP3 2EYOA 4A3DB 1J5EL 3A8KE 4DUZQ 5C44G 3S1RH 2F0GA 2Z4HA 1G8ZD 5ELBA 1Y8OB 2VB3X 2R6GA 4Y7NB 3BVMA 4DV0L 1K9MC 2XSCA 3T51B 2CW0C 3H3VH 2J0TD 2PNRC 4R4TA 1DXMA 3N52A 4DR6L 1XPOA 1NAPA 4B3RL 4KD3A 2YU9B 4JI4L 4IPDA 2UXBQ 2YTXA 4J15A 4DUYL 5IGCA 1O80A 1YEZA 5IYCG 1HR0Q 4K2KA 4DAVA 4DV1Q 1TT2A 1SR3A 3UDFA 2IW3A 1I4GA 5COYA 4PMWA 5AJ3L 1TIID 1JWUD 1PRTC 2A69C 3M85A 1YJ9A 5LMUQ 2ZM6L 4CDFC 2EYHA 2CH4A 4Q5VA 1GUGA 5M3FH 1EY5A 4PZ8A 3QIAA 4JW0A 2EPBA 4GKJL 3T1HL 1K73C 1T5XD 5JEAG 3KF6A 3C46A 1XTCD 4EQOA 1EIHA 3QJYA 2HD3A 4K8IA 5IP9H 1SE8A 2K05A 3KOJA 4KLKA 4UDUC 4A3MB 1JICA 1DD2A 2SNSA 4OIKA 2UU9Q 1CFMA 4X62L 1V1PA 2X6LA 4OIJA 1SN8A 4QF4A 1HZBA 4A3JH 1DOLA 3K81C 4KHPQ 2F0KA 2K01A 3PV0A 3AFPA 1KDAA 3A0JA 4ZAIA 3HOVB 3EIVA 2NN6G 1VS0A 2K5QA 4JV5Q 1WTWA 2ICEC 4OX9L 1PZID 2E5LL 1ESRA 4BY1G 4CKBA 3GTQH 1RD9D 4ZK9B 4X65Q 5M5XB 4ZKCB 4OO1H 4C3HH 1YBYA 1E1OA 2KHJA 5EKIA 4L8JA 3OIQA 5HURA 1K28A 4RAUC 1X3PA 1XJVA 4JI2L 1S3OA 3MHBA 5C0XG 5J1ZA 2BE5D 5JVH3 1IBMQ 3T13A 4BS9A 1WVLA 5ELCA 3T1YQ 1XPRA 3A56A 1V43A 2D0OA 4IJHA 4K0KQ 1VMCA 4LF8L 1RHPA 4JK1C 3G48A 2WP8J 1PH8A 2JA5G 2B39A 4ZRZA 4RCOA 2L9HA 2RDFA 3GTGH 4OELB 2XRSD 4RKBA 3V05A 3BZDB 2ZJRA 1X54A 2K5HA 4B3ML 4XTCS 2RCFA 3M3YH 3O13A 1WTPA 1TS4A 2PW7A 3ULJA 4DR2L 3I90A 3TN2A 5GAEC 4HMJA 4NPSA 2Q2UA 1DM0B 3FHWA 2VXWA 5DEHA 1Q8IA 4X64Q 3KJPA 5M3FB 1O7LA 3IFTA 2B2WC 3IRBA 4IFDG 1WFQA 3FMCA 4IUVA 3J80L 1D7QA 2WIIB 5EKKA 2WAQG 1B70B 4DR4L 3NXWA 3PO3G 1MJCA 3BVGA 1PFSA 3URYA 4OO1I 4UHVA 2I0QA 4EQPA 1L1OA 3QO2A 2VQFL 1EYDA 2HCCA 3S15H 1CUKA 3C2PA 4A3JB 5IIFA 1IBLL 3QG1A 4A3LH 5CV4A 2NWGA 1F9SA 1SMXA 1DOKA 5FK9C 3M7NA 2RA4A 1Q90A 3R8BA 1A8VA 2HDMA 2MPMA 3J7AV 2VZAA 1EQQA 4NKLA 3HKSA 3GTQB 1I5FA 3PSIA 3QWNA 1Z7TA 2IJ0A 1Y1WH 1CKMA 3KLSX 5LMNW 4LW1A 4YCUA 2CQAA 3A8JE 1NE3A 3OMGA 5I9OA 3CCJA 1CHPD 4OGQC 1FJGQ 4ID6A 2L1BA 4K14A 1VQ7A 3PGZA 2JQOA 2QEXA 5T1IA 2DY7A 1PFMA 4LF4L 4KI0A 3J80E 1Q1EA 4KV6A 2BE5C 1OXVA 5BN3A 4BA1I 2NZOA 2X69A 2AUJD 4CJ2C 4R9WA 1JMCA 1A2TA 1P8LA 1S5CD 4GLXA 1PYWD 5JVG3 2LY7A 2OQ0A 2ZTDA 3TP7A 4DAYB 4EQNA 4M1UB 2K4KA 1W6KA 3HOXH 3NELA 3PO2H 3PUZA 5IT9L 1W3SA 3AMUA 3S1QH 2BDOA 1VCIA 1L0WA 5KIXA 1JOQA 3L3OC 4OWXB 1XWEA 4H44C 1CKNB 5IGDA 1Z6HA 1D1IA 1HZAA 3S24A 3E5SA 4C1NI 3CCUA 4HCSA 3HOWB 4F88A 2BDNA 4XQJA 1N34L 5DM73 1SYFA 2R7FA 1X32A 1KNAA 1FGBD 2WACA 3VR5A 1CSPA 1QG7A 2PMZE 1TWGH 1LT6D 2MUYA 2VQEQ 1HUMA 1WOCA 3K0YA 3KLRA 2Y0SE 4JI3L 5J22A 3K57A 5I9PA 4MZ9A 2MHVA 4A93H 3TQYA 2A6ED 1JCKB 1U4MA 1G6ZA 2AMCB 4JG2A 2NVYH 2PPBC 2WINB 1FNWA 5FLMH 1QE6A 4OHJA 1BNZA 3H6MA 1ENFA 4EQ5A 5J3BA 1I4PA 3S15B 2A6HD 1GUWA 3SK6A 1XMQQ 4OEMB 3CC4A 2BH8A 2CWAA 5D65A 2RHQB 1YNJD 1NCVA 3W1BA 2K33A 3H0GG 4FF4A 4UY8C 5IT9E 4WJWA 5GAHC 5CV5A 5IODA 2K6AA 3FVQA 4NB3A 4GLVB 4X3TA 1Y1WB 3W2DA 3S16H 4KY6A 1B7YB 1LYLA 2I46A 1BUVT 4V190 5CC4A 2CQOA 3J80i 1C8CA 5I4DA 1STNA 3R2IA 1E22A 3PUXA 3KBGA 3J7A5 3OIPA 1SLJA 3NENA 1L0XB 2KCMA 3K8AA 4J1MA 1MSHA 4XXEA 1HNWL 1E2ZA 4ME5A 4Z9CB 5IGGA 2KVMA 4NXMQ 3PUWA 5DLQE 2D9UA 3ONAB 1GHKA 3I4MG 3DEOA 4XT3B 2BOSA 3P7JA 3MC0B 4GOPC 4DV2Q 5KGUA 4JVZA 3CCLA 4LJZC 2Q2HA 4OL7A 5C4HA 3HOXB 1EL0A 3PO2B 1LT5D 2NVQH 3PQIA 1SE4A 4HIDA 1F2MA 4B9XA 1VQ9A 1GUOA 1B2TA 5GROA 4A3CG 3W3AA 3HP3A 3BVZA 5C3EG 4LUZA 1YJWA 3NTIA 1EQVA 3T53B 4ODGA 1EZ8A 2IHEA 4IUNA 5JOBA 4DV6Q 4H02A 3TP6A 1AW7A 3GP7A 3U9SA 1QB5D 2F0HA 3KBXA 4BXXH 2A68D 2EY5A 4UAIA 1NUCA 3V96A 2UUCQ 4QIWB 4A93B 2K14A 4JI8L 1H9SA 2L15A 3S9WA 2NVYB 3UE1A 1WTQA 2QDLA 1NNXA 3F8TA 3T16A 5NUCA 2OQKA 3MZ5A 4O2DA 4DV0Q 1EUJA 3GDEA 2R7DA 1LACA 2JA7G 3H09A 3OWEB 1SMYD 1SRUA 1D1KA 2WB1E 4ILWA 1PHJA 1IBKQ 2UUAL 4AIMA 1I4XA 4DR6Q 3UI2A 3J7AF 4B3RQ 1YNJC 5C3XA 4JI4Q 4DUYQ 2YV5A 1Y8PB 4KTAA 2NUCA 5ELDA 1A62A 3ULLA 4BBRH 3OHXC 1AZPA 4ABNA 1XXGA 4WRDA 3D6WA 1GXDC 5AJ3Q 1MSGA 2Z8LA 2DNCA 5EQ0A 3AU7A 4HEDA 3CMAA 3NSWA 4FF1A 3MXNA 3NTKA 1Q12A 3ND9A 4HJ9A 1IKLA 4GKJQ 4RHSA 3T1HQ 4BY1H 3R2TA 3L0OA 4XDXA 5LL6S 3P75A 5C44B 4FXDA 4K2LA 5IYDG 1UUPA 4GNXA 3KF6B 1TU2B 2NVQB 2B3GA 4QCLA 1HH2P 2QW7A 2EYFA 2E2IH 2IX1A 1GO3E 2R93G 2EYMA 1ENCA 2FMMA 2Z6KC 2OXPA 1I4HA 1YZ6A 1WCMG 3J81j 3P1HA 3HKZE 3RUZA 1MKHA 1V1PB 2JA8G 4HMIA 1GKHA 2JYOA 5JPMC 2AWOA 2JA5H 2KEEA 1BOSA 1KNEA 4N9PA 1B44D 2E2HH 4G7HC 1S72A 3QOJA 4LFCL 3ZJYC 1K0RA 1LTGD 3KJOA 1A3VA 4IQZA 4WFN3 4C2MH 3NP8A 1LTTD 3NBHA 4JI2Q 1AZQA 1FYCA 1GD7A 4F7XA 1IYUA 4C56C 2Z6BA 1S5BD 2EVBA 1U4PA 1EWHA 1EYAA 4L63B 4FNFA 2B63G 2NBFA 1JJGA 4LF8Q 3A5UA 5KNCA 3RLFA 1K3RA 4K5XA 5ELNA 3S17H 4KY5A 1KDCA 4B9WA 1OXSC 5KNDA 1GUNA 2M9VA 1JWMD 1HTLD 4JC0A 2B2UA 2A5HA 1S5DD 4JOIA 4DR2Q 2KENA 3TBIB 4NXNQ 2X6GA 3M4QA 1K0SA 2D2CC 4UP9A 3HOVH 2XVSA 2K28A 3ND8A 1IYVA 5K5PA 4BY1B 1KIXA 1OO9B 1A0IA 3SHLA 1H9JA 5EPJA 4ME3A 2CFMA 4DR4Q 1UWVA 2K1BA 2K5WA 2N78A 4RMFA 4YWMA 1QNUA 4A3IH 1JOOA 4JPBW 1FGUA 5K36G 2JP1A 4YWKA 2QEJC 1SBBB 2VQFQ 1SEBD 2E2IB 4YY3L 4ZUIA 3MTSA 1I4RA 3H94A 3CCEA 2PI2A 4MTKA 4YWLA 1WD0A 1IBLQ 1L1OB 4GN3B 4AYBE 1PZJD 4DPGA 3I55A 4RA8A 1VQMA 3SVMA 2AQ2B 4IFDI 4O42A 2F4VL 3CPWA 2ZJQA 1A15A 2GN5A 1VQHA 3HS0C 3WOEA 3F2CA 2JA5B 1PTOD 1YNXA 5D3IB 3CC2A 3R3OA 1GUSA 1F2LA 3I2ZA 3GTLH 4ZCKA 3MVVA 1VQEA 2R3ZA 4PZ6A 4A3GH 2E2HB 4Y52H 1ET6A 1PV4A 4BY7G 3FRPB 2F0PA 1QNKA 4AYBG 1MD2D 2I5LX 2QCPX 1E0BA 2K32A 3I4NH 4AQYL 3FPPA 1ESFA 1QVGA 2YTYA 2OWOA 4C2MB 3DWQA 2M2LA 3NTHA 1PH4A 1ENAA 5E1FA 4B3SL 2Q2IA 4CJ0B 4G57A 4P73A 4LF4Q 2NYZD 4QUCA 1VQ6A 4ZLTF 1GUTA 4ZKBB 4J6HA 3GV6A 4RHRA 2XIWA 4M8AA 3H15A 4L5RC 2AUKA 2NTSA 1SYGA 4OONA 1Y1VG 2XGTA 4IUTA 2JEAI 2B2VA 1TXYA 3CD6A 2WAQB 4LFAL 4DR7L 1IZ6A 1BF4A 1L0YB 1TWCH 1IL8A 5GQOA 2LMCB 3U50C 2KJXA 3S17B 1JE5A 1HQMC 2R7ZG 1CQFA 5JJKA 2AQ3B 4KKSA 2WFWA 3KLWA 4QUFA 1X3EA 4JI7L 3LX0A 2F0WA 1TY0A 1Y8NB 2FINB 5M5YH 1SNDA 2SEBD 3CQZH 4WJ3M 1EY8A 3PF4A 1STGA 4IUPA 5EPLA 3E9HA 2B2TC 2XWBB 1N34Q 1UNSA 1GOZA 1VQ4A 3HZXA 1IL2A 2MJ8A 2IT1A 1U4LA 2L12A 1RCVD 5GADC 2OTJA 3HOYG 5CBEE 2KBNA 2O5IC 4CBVA 1PA6A 5ELEA 3NHHA 3F2BA 2QKIC 4JI3Q 4IPGA 4A3KH 3HOUG 1LTID 1SNPA 2YTVA 3KLSA 1CZGA 3CXCA 3PUYA 3U9OA 2VUMG 2F1MA 4A3IB 1OXTA 2RQXA 3CCVA 1HR0W 5FO8B 3S1MH 3SEBA 1J9OA 3EFXD 1QVFA 2CKZB 3GTMH 1STYA 3CRKC 3DHQA 4S3SA 4HAEA 4I65A 4JI1L 1EY4A 5FO7B 2TSSA 1MBYA 2C5CA 2F0JA 4L5QA 1SFOH 2B2YC 5KYIA 3T4AC 4XT1B 3GTLB 1BDOA 2LS01 4A3GB 3BZKA 3Q8DA 3A54A 3L9AX 4MIUA 4DV7L 1HNZL 4A3DG 1ZKOA 2EY1A 2IHFA 1YJNA 1SNMA 1BBXC 3I4NB 2AHOB 2ATWA 2F3WA 4KMUC 4N8FA 5BN5A 3K7UC 1O78A 4A3CH 1SDFA 1VQFA 5C3EH 2JA6G 5FLXc 2A73B 1NJIC 3I4OA 1QUQA 2EYLA 1TVXA 1Z9FA 3HOWH 2FJ2A 3RZDH 2DN8A 1XMOQ 1PTOH 2KA7A 2PNHA 3AYHB 3CRLC 4XYQA 1VQDA 1UAPA 1EYGA 3E0JA 2I5MX 4P74A 2R92G 1TWCB 3TS0A 5M3MG 2J4XA 4A3FG 2JN4A 2A74C 4IOAA 2AKWB 2EJMA 2PMZB 3M4OH 1VQAA 4X66L 1LTRD 2HHHQ 3RZOH 2L55A 1H9MA 1S5ED 5M5YB 2JA7H 3CQZB 4TRDA 4CJ1B 1HNXL 3A55A 4DR5L 4RCNA 3I56A 4B3TL 2F0TA 4HR7B 4RKLA 4R4OA 1G91A 4FVMA 1NMFA 3W1GA 3H0GB 2H5XA 4H13C 1P16A 3BDOA 2OCEA 2G9HD 4F8MA 3KFUA 1CA5A 1NSNS 1V9PA 2KEDA 1HJPA 1I50H 1UE5A 1FL0A 3RR5A 1CK1A 4MTNA 1X9NA 4DK0A 4CGYB 2Z1CA 3VYTA 4DUZL 4A3KB 1EWIA 1A63A 1XX8A 4KKUA 2B29A 1JJCB 5JJIA 2R61A 3CMEA 5IYBH 1ILQA 4JI0L 1LTSD 3I72A 2GVAA 2E2JH 1XNQL 1H9SB 3S1MB 2EQSA 3CC7A 1VF7A 1K8AC 1C4QA 4HJ8A 3GTMB 1Q86C 1LUZA 1Y69U 3SGIA 4FO2A 1V1OA 5FKAC 1E3PA 1JB3A 4DV3L 3HGBA 1GVPA 4HJ7A 4IPHA 3QR8A 4BWGB 5C4JH 1KABA 1SFOB 1M90C 1G2TA 5FO9B 3Q24A 4A3EG 5C5MA 3DXJC 5HY6A 4GN5A 2KCNA 4DV1L 4FDBA 2GVBA 3EVQA 1KLUD 1GJXA 3PUVA 1SXTA 3SK4A 1YIJA 4DAPA 1DYQA 1MI2A 3C3LA 1FNUA 1SSOA 3EJIA 4L5TA 3K5MA 3LNNA 1TWAH 5C3EB 1IXRA 1WCMH 2QGQA 4NMZA 1JC7A 4GN4B 4NW2A 5C5LA 3RZDB 4N8X1 2JEBI 1I4QA 1PTOB 2FHTA 2PW5A 4DV4L 2XWJB 3TMEA 3CHBD 2YYZA 3OTOL 3ER0A 1TWFH 5JJZA 3MXNB 3CCRA 3TZUA 1EY9A 1RTOA 2UU9L 1LT4D 3M4OB 1HFGA 2KQ3A 5CMDA 3RZOB 5M5WH 5L37A 4KHPL 4GNXB 1LO5D 2JA7B 1EOVA 3E3XA 5F2DA 3TP5A 2PZUA 2Y0SG 3BDLA 3UDIA 3SE0A 2EOTA 1IYJB 3TREA 3L7ZC 5IP7H 5M3FG 1S4ZA 2B63H 2L11A 2RBMA 2L4NA 3ULPA 4R8IA 3ERQA 2SDFA 2JXMB 1BVSA 1I50B 4YCVA 2OEOA 3E0EA 2EY6A 1PH3A 4X3UA 1XTDA 3SXHA 4LFCQ 1EFWA 3F2DA 3V2TA 3GV3A 1EY0A 1N36Q 3D3RA 3CCSA 2MGSA 1EIYB 1VQOA 3GTJH 1K3BC 4KY7A 2QILA 4GS3A 4FYDA 2E2JB 4IN3A 2VS1A 4OXPA 5EJWA 2F0NA 4DK3C 2ICIA 2Z9HA 3NBHB 4PNYA 1Q3LA 3HRZC 2E8GA 3EBEA 1STEA 5C4JB 5LMNL 1MHWC 3DWPA 4C3IG 1V8QA 5EAYA 1Q7YC 3UDXA 1SNQA 1U5KA 1J6QA 2KECA 3AQQA 3EQLC 1EQTA 4QY7A 4C3HG 5IE8A 5C44H 1ZYRD 2Q8RE 3S2HH 1Y14B 3CW2C 3R93A 2R93B 5EBCA 4DV5L 3KF8A 4K8JA 1TWAB 3KYHC 4A4IA 1WCMB 3GO5A 4KHZA 1PH2A 1VQ5A 5DNFA 1HCZA 1NR2A 4U673 4LUOA 5LL6X 1AEXA 2F0VA 3TEHB 3SK5A 1R4PB 2WKCA 1TWFB 1XNRQ 1KLGD 3GD7A 2IX3A 1KC8C 4QQBX 1D6EC 2ID0A 1IKMA 4J8QA 1AE2A 1W6JA 4QJFA 1F2YA 1I94L 3AB9A 5CV7A 1G2SA 5IYCH 4P71A 5I2YA 1DONA 2XTIA 4ULLA 2BA1A 3K80C 1IW7D 1E2VA 4RGOS 4MHEA 2DGYA 3D8GA 4LFBL 4UP7A 1J5EQ 2BH2A 2A6EC 3M4PA 2FXQA 5M5WB 3W5OA 2ZXOA 1O7IA 4YY3Q 2Z4IA 1SJHD 3OOCA 4GLAC 1II3A 3VYRA 3OWFA 4IUUA 1STBA 2B63B 3L2PA 1Y1VH 1VQKA 2I5HA 2A6HC 3DWAA 3SK8A 2F4VQ 3CP0A 1HRJA 4O0AA 2NZ1D 5JEAH 2CVRA 2RSNA 5IGFA 1TWHB 3D4RA 1RL2A 4RG1A 4DF7A 1YHBA 1VQLA 4OWWB 2HQEA 4LF7L 4KJNA 2J7ZA 2NTTA 5EPKA 4YHHL 2UXCL 1LV9A 4AQYQ 1ET9A 3GTJB 2WB1G 5IOCA 1AH9A 5TSSA 1FVIA 4FXKC 2B8FA 3TRZA 2K52A 3I4LA 4B3SQ 1C48A 4LF5L 5C4XG 5A2QL 3CF5A 4TVAB 2ALYB 2BCOA 3KDFA 4KKTA 4LWCA 3VYUA 2NN6H 2ZM6Q 5KNBA 5E3FA 4X3SA 1UEAB 3NE5B 1TR5A 3HOUH 4DR7Q 5T1GA 1L1OC 3NEMA 2VUMH 5FLXL 1V1QA 3HOZG 1BCPD 1NR4A 3ITPA 4C3JG 3S2HB 1C7YA 2AWNA 2PYKA 4LF6L 4JI7Q 2F3VA 4JI5L 3I7FA 2MO0A 5IY0A 2K75A 4IPCA 4OWTB 5C0XH 4X62Q 1TY2A 4K6LA 2KCCA 1KDBA 1YHAA 2HIVA 1Q46A 2MP1A 3VA5A 1PH1A 1K8OA 4LF9L 3AEVA 1PH6A 1I6HB 1LABA 1T9HA 3C1FA 3SR1A 1RDPD 1GM5A 4RH6A 4DR3L 3RLNA 2JK8A 1F9RA 2B2WA 1HXYD 2E5LQ 4OX9Q 3D31A 1BQQT 4DGZA 2A68C 4GKKL 4Q0FA 1B8AA 3N6RA 4I7AA 3HKZG 4I7ZC 5A2QE 4G7ZC 5A35A 2A19A 2HDLA 1JB7A 2PZWA 1IW7C 3DM1A 2CW0D 4V0BA 4UPAA 1XMQL 3G71A 3E6ZX 2JA6H 3K7AH 1ILPA 1R9TH 3DLLA 2OF1A 4QIWE 3PIO3 3TS2A 1DOMA 2F03A 4HJAA 2MFIA 4JBJA 2EIFA 1PTOF 3RLOA 2NN6I 4DNRB 1B9NA 1Y1VB 4JI1Q 4POGA 2MO1A 5FLXE 4QB4A 1EYCA 4IFDH 1JT8A 1SMYC 2R92H 1D2BA 5M3MH 3WOFA 3RN5A 4PQXA 4TKOB 1S5FD 4A3FH 3PO3H 4B08A 2HUGA 2EJFC 1HNZQ 1K8MA 4DV7Q 1LM0A 4BBSG 1PRTD 4A3BG 2A69D 3BG3A 2H4OA 4K5WA 5FLMG 3K5NA 1N8RC 3GTKH 1X3FA 5IWAL 1G51A 4RGNA 4B3MQ 3DM3A 3MXGA 2ZJPA 5C0XI 3RMHA 1CTMA 2JE6I 2CHBD 4GZYC 1FR3A 1E24A 1WJJA 1QUQB 3A7LA 3HG9A 3I70A 4DV2L 1SNOA 5DM63 2PO4A 4WJ4A 1WI5A 2MNAA 1EIGA 3NQTA 3HOUB 4LK1C 3C1EA 3U4VA 3EROA 3CKIB 2LXKA 2VUMB 3GTPH 1RTNA 3J81c 1U4RA 3U4ZA 1VQPA 2RSOA 4POFA 4X66Q 1SJED 4XIGS 4DU9A 1GHJA 1MGSA 5CGKA 5CORA 1HNXQ 2G9DA 4DR5Q 3OW7A 4B3TQ 3H91A 1UE7A 1EY6A 5GAGC 1B50A 2O2LD 4A3EH 3KUPA 2IL8A 3VR4A 4KN7C 2LXJA 1E1TA 2N49A 3OYYA 5HGTA 4X3KA 2Z0SA 2K5DA 3MA2B 5KEEA 3RNUA 1HUNA 3NPPA 3VR2A 5JEAJ 4LNQA 4JI0Q 4NDXA 4IUQA 2JA6B 1XNQQ 3K7AB 4C1NK 5E7NA 1FNVA 1IHZA 1R9TB 1YI2A 4K5VA 4IOCA 1IBKL 1N32L 1U9RA 2EE1A 1PH5A 2NZHA 4XQQA 2EXZA 4QL5A 2DNEA 2JSOA 4DV3Q 2KHSA 1HTPA 2SOBA 4L6TB 1BR9A 4BXXG 2UXDL 4IALA 2R92B 3WWVA 1CA6A 1ONLA 3I8ZA 5M3MB 3I91A 1LTLA 2CCZA 5I6YA 2E76C 4HCEA 4A3FB 3PO3B 1BO0A 1JE4A 3NK9A 4KK7A 2D0PA 5FJ8G 1ICWA 1A3UA 4IO9A 3GTKB 2RDGA 1BBUA 3BYTB 3Q22A 4HIMA 4RGMA 1D5MC 3EA6A 3D0FA 1ASYA 1VQIA 4DK1A 5G3LD 4CDCC 2G5DA 1KAWA 4FXGC 2CWPA 2DJGC 2F0FA 2HIXA 1SYDA 4U68A 4DAMA 2MQHA 1O7ZA 1QWYA 5IGEA 4DV4Q 4HIKA 1KRTA 1BXTA 3TP8A 1EU3A 3H0GH 5E4WC 3OTOQ 4F87A 2UUBL 5C0XJ 4JYAL 1B3QA 1WTHA 3HFZB 2K50A 2WV6D 1YHQA 4RWSC 4LUVA 3FKIG 4DN4M 5CBAE 5BR8L 4R4CA 1AP0A 3WDNA 3GTPB 1I3QH 4BBRG 3K58A 4GOPA 4BA2I 3PMFA 4WORA 5EBDA 4R8NA 1QILA 2F0EA 1KL9A 1SNCA 2BA0A 3Q23A 3J7YW 3H3VI 1KXLA 4YIJA 4N9TA 3ICEA 4K6DA 1JR0D 3DUZA 1JORA 3BYYB 2O4XA 4TSSA 3UE0A 4HIOA 4DR1L 3OSOA 4A3EB 3OPOA 4C3IH 1BKBA 2NVXH 3I4MH 4A75A 3VYSA 1Q82C 3EN2A 1BCPB 1RJTA 1PFBA 2L5TA 4TQUS 1PTOC 2N88A 3S1RB 1PMRA 2B8GA 3SDZA 4DNIA 1TKWB 4IFDJ 3MXPA 2I07B 1OTCA 4FP5D 1QZHA 1RODA 1QVCA 1A3TA 3NBIA 4PMCA 5JPNC 3BZCA 3CCMA 3A8IE 1CT1D 1EFID 3CAMA 1B1ZA 3STBD 2F0OA 2N8NA 1ZEQX 2VB2X 1HNWQ 5C6AA 1CHQD 1BBWA 2HQLA 2D62A 4GNXC 3VA7A 5LMNQ 2HT1A 1VQCA 1L2FA 1NY4A 4R4IA 1STAA 3RN2A 5H1SE 1M1KC 1VQ8A 1OXXK 2O5JC 3DMUA 2LKVA 1KD1C 5I2XA 4H0LC 5DAUA 2WAQE 1JQYD 2KCTA 1KHIA 4JI6L 4DV5Q 1X6OA 4NXNL 4EX5A 2Y0SB 4RFBA 3S2DH 1VQJA 2C9OA 1SYEA 3KF8B 5JAVA 3BS1A 1SYBA 2PQAA 3IKJA 2C35B 2F0QA 1N33L 5I6WA 2RCNA 1YITA 1S40A 2XN9C 3PCOB 3VR6A 2P5ZX 2N3SA 1VQNA 4CHTB 2E2DC 5ISRA 1PRTB 5CR3A 3UDGA 1E2WA 2K03A 1W2BA 5CV9A 2FMCA 1I94Q 3BDCA 1I3QB 1B9MA 4A3MG 3PF5A 2K5NA 4JI8Q 3T56B 3D6CA 4LFBQ 3GTOH 2IX0A 2A1AA 2QF7A 1DCZA 5C4XH 1RF2D 1PDQA 3LGJA 2L0CA 4AH6A 1VQBA 2XRQD 3HOVG 2Z6KA 4DXFA 1KTKA 4EGVA 2UUAQ 2TMPA 1E7ZA 4C3IB 2OTLA 3I4MB 2NVXB 2UXBL 1AN8A 3M9BA 1HR0L 3FEWX 3HOZH 4C3HB 5HGQA 1UE6A 1HZCA 2B2UC 2LFNA 4C3JH 5IYDH 1PZKD 4A3IG 4LF7Q 5EKLA 4YHHQ 4JOIC 2UXCQ 2RVLA 2EXDA 4L5SA 1ZXTA 2EYPA 5KYLA 3A74A 3BU2A 1TQOA 4CKCA 3HEJA 2KOLA 2R93H 2SNMA 1HHVA 2LSSA 5LMUL 1F2ZA 1TS5A 4KD4A 4LF5Q 1ICFB 1PYBA 1JJ2A 1H9RA 2V1CC 2JA8H 3K59A 3PIOA 2Q2TA 3MWYW 3OMCA 3STBC 3FP9A 1O7YA 3GTGB 4A3GG 2IPKD 3KDFB 3Q6SA 3NQIA 2A8VA 1HPCA 3M4YA 4KHVA 2IWHA 1STHA 3I4NG 3M3YB 4JBKA 3ZYYX 1KQSA 3DEPA 1LTAD 2WKDA 4LF6Q 1YNND 2ZXPA 4JI5Q 2PQEA 3RD4A 1C9OA 1Z47A 3CU7A 1B4OA 2E75C 3S2DB 5ELOA 1D5ZC 4LF9Q 1DJRD 1LT3D 4JV5L 4DNTB 3J81L 4ALPA 2RDHA 4HSPA 4IJLA 4X65L 3JAML 2OT2A 1TWHH 3G6JB 4DR3Q 4BBSH 1JOKA 4A3BH 5IP9G 4JCVE 3QOLA 4GKKQ 1RKNA 2WB1B 1PLFA 1QOHA 1A2UA 3GTOB 3K0XA 1SAPA 4DKAC 4HJ5A 4UP8A 1WD1A 3IAYA 1IBML 5C4XB 2JJQA 2B2VC 4A3JG 3G7LA 3T1YL 4H7BA 2H1EA 2KUMA 2Q8TA 3A7AB 3G4SA 4K0KL 2ZTCA 1A6XA 2EZVA 1MJEA 5CYUA 3OW2A 4A3KG 4RGTA 4FF3A 3X3NA 1UE1A 1EIFA 3HOZB 3LWEA 4MN3A 5AFWA 1X3GA 3TSSA 4C3JB 1DZ1A 4NP5A 3PIPA 4OO1G 1K8GA 1KAAA 2RKSA 1F77A 5K36H 5IWAQ 1PVOA 1CQVA 1N9WA 1XMOL 3J81E 1I6VC 1EOTA 1M4VA
chains in the Genus database with same CATH topology
2E74C 1HA6A 3I3CA 3JAME 2JA8B 1VF5C 1SE3A 1BCPF 5IGBA 2ENBA 1M8AA 4IZ8A 3S1QB 2GA4B 5C4ZA 3HKZB 5D14A 3TZDA 4KN4C 1CI3M 3KK7A 4HTHA 4XQNA 5EGTA 3MFGA 1YNNC 4XYOA 3K5OA 2PZTA 1TWGB 1EZ6A 5C3WA 1LLRD 1EEID 5FOBB 3VR3A 2B2TA 1EWCA 3D4DA 1WTVA 4DA2A 1QJOA 2AQ1B 5CV6A 4BBSB 4A3BB 2F0IA 4HSVA 4G7OC 4E6IA 1SE2A 4QMGA 1Q1BA 4DFAA 3MFYA 4JBWA 1TS2A 1HQRD 3MEHA 3K5LA 1EEFD 3MXUA 1HA5A 1VMPA 2V4DA 3D4WA 1HFNA 4DAYA 2K7VA 4IURA 1WTXA 1PRTF 3S16B 3LWUA 1LTBD 2HCIA 1OXUA 2F0MA 1F9PA 4LAAA 2B2YA 1B3AA 2NB0A 1EY7A 5CV8A 3QB3A 1ML0D 1ZYRC 3S1NB 2Q8IB 4ZQ3A 1J8IA 3P20A 3TDQA 4KJOA 1G291 2EYJA 1X3QA 2EJGC 4HN7A 4BY7B 4AYBB 1PFNA 2FFKB 5KRUA 1JWSD 1F9QA 5LHY1 1QCBD 5E4XA 1B53A 1XYIA 3M7GA 3NWTA 4DXGA 1H9KA 1CZWA 4EVOA 3K6OA 5D3DA 2F4IA 2F0UA 2M00A 3IFDA 1TS3A 2QDBA 2N55A 2PCFB 5ELFA 2VNUD 1D5XC 3S14B 4ZUJA 2R7ZB 4LMQD 1WTRA 4FF2A 2F0LA 3MAQA 2DY8A 4O1NA 2F0DA 1PXUA 3FDTA 4G4KA 2NVTB 1VDZA 3NWSA 1SYCA 2ZXRA 5BN4A 1WTOA 5M9OA 4CKEA 3I73A 3NUCA 1EU4A 1K83B 3HOYB 3X3MA 4ZYSA 1CM9A 3FKIB 4P2CB 4PV1C 3FPUB 2EY2A 4BBRB 1AFPA 2EDGA 1R4QB 1T5EA 5G3LF 1FD7D 1BCPC 2F0SA 3GQBA 5J39A 3Q0AA 2ZT9C 2XNAC 3F2UA 2K04A 3IL8A 3H3VC 2D5DA 4PMBA 3PIP3 2EYOA 4A3DB 3A8KE 2F0GA 2Z4HA 1G8ZD 5ELBA 1Y8OB 2VB3X 2R6GA 4Y7NB 3BVMA 2XSCA 3T51B 2CW0C 2J0TD 2PNRC 1DXMA 3N52A 1NAPA 4KD3A 2YU9B 5IGCA 1O80A 4K2KA 4DAVA 1TT2A 2IW3A 1I4GA 5COYA 4PMWA 1TIID 1JWUD 1PRTC 2A69C 3M85A 2EYHA 4Q5VA 1GUGA 1EY5A 3QIAA 2EPBA 1T5XD 5JEAG 3C46A 1EIHA 1XTCD 4EQOA 3QJYA 4K8IA 2K05A 4UDUC 4A3MB 1JICA 1DD2A 2SNSA 4OIKA 1CFMA 1V1PA 2X6LA 4OIJA 4QF4A 1DOLA 2F0KA 2K01A 3PV0A 1KDAA 4ZAIA 3HOVB 2NN6G 2K5QA 1WTWA 2ICEC 1PZID 1ESRA 4CKBA 1RD9D 4ZK9B 5M5XB 4ZKCB 4OO1H 5EKIA 4L8JA 3OIQA 5HURA 4RAUC 1X3PA 3MHBA 5C0XG 5J1ZA 2BE5D 5JVH3 3T13A 4BS9A 1WVLA 5ELCA 3A56A 1V43A 1VMCA 1RHPA 4JK1C 2WP8J 2B39A 4ZRZA 4RCOA 2L9HA 2RDFA 2XRSD 4RKBA 3V05A 3BZDB 4XTCS 3O13A 1WTPA 1TS4A 2PW7A 3I90A 3TN2A 4HMJA 1DM0B 2VXWA 5DEHA 1Q8IA 5M3FB 1O7LA 3IFTA 2B2WC 4IFDG 3FMCA 4IUVA 3J80L 2WIIB 5EKKA 3NXWA 3BVGA 3URYA 4OO1I 4EQPA 3QO2A 1EYDA 2HCCA 3C2PA 4A3JB 5IIFA 3QG1A 5CV4A 2NWGA 1F9SA 1DOKA 5FK9C 3M7NA 2RA4A 1Q90A 3R8BA 2HDMA 2MPMA 3J7AV 4NKLA 3GTQB 3QWNA 1Z7TA 2IJ0A 3KLSX 2CQAA 3A8JE 3OMGA 5I9OA 1CHPD 4OGQC 4ID6A 2L1BA 4K14A 5T1IA 2DY7A 1PFMA 4KI0A 3J80E 1Q1EA 4KV6A 2BE5C 1OXVA 5BN3A 4BA1I 2X69A 2AUJD 4CJ2C 4R9WA 1A2TA 1S5CD 1PYWD 5JVG3 2LY7A 3TP7A 4EQNA 4M1UB 1W6KA 3PUZA 5IT9L 3AMUA 2BDOA 1VCIA 5KIXA 1JOQA 3L3OC 1XWEA 4H44C 5IGDA 4C1NI 1Z6HA 1D1IA 3E5SA 4HCSA 3HOWB 4F88A 2BDNA 4XQJA 5DM73 1SYFA 1X32A 1KNAA 1FGBD 2WACA 3VR5A 1QG7A 1LT6D 2MUYA 1HUMA 3K0YA 3KLRA 3K57A 5J22A 5I9PA 2MHVA 2A6ED 1JCKB 1U4MA 1G6ZA 2PPBC 2WINB 1FNWA 1QE6A 4OHJA 1BNZA 3H6MA 1ENFA 1I4PA 3S15B 2A6HD 1GUWA 3SK6A 5D65A 1YNJD 1NCVA 4FF4A 2K33A 5IT9E 4WJWA 5CV5A 5IODA 2K6AA 3FVQA 4X3TA 1Y1WB 3W2DA 4KY6A 2I46A 1BUVT 4V190 5CC4A 1C8CA 5I4DA 1STNA 3R2IA 3PUXA 3KBGA 3OIPA 1L0XB 4J1MA 1MSHA 4XXEA 1E2ZA 4ME5A 4Z9CB 5IGGA 2KVMA 3PUWA 2D9UA 3ONAB 1GHKA 3DEOA 4XT3B 2BOSA 3P7JA 3MC0B 5KGUA 4LJZC 4OL7A 5C4HA 3HOXB 1EL0A 3PO2B 1LT5D 1SE4A 1F2MA 4B9XA 1GUOA 1B2TA 3W3AA 3HP3A 3BVZA 3NTIA 1EQVA 3T53B 4ODGA 1EZ8A 4IUNA 5JOBA 3TP6A 1AW7A 3GP7A 3U9SA 1QB5D 2F0HA 3KBXA 2A68D 2EY5A 4UAIA 1NUCA 3V96A 4QIWB 4A93B 1H9SA 3S9WA 2NVYB 1WTQA 3T16A 5NUCA 3MZ5A 1LACA 3H09A 3OWEB 1SMYD 1D1KA 4ILWA 1I4XA 3UI2A 3J7AF 1YNJC 5C3XA 1Y8PB 4KTAA 2NUCA 5ELDA 3OHXC 1AZPA 4ABNA 1XXGA 4WRDA 3D6WA 1GXDC 1MSGA 2Z8LA 2DNCA 5EQ0A 3AU7A 4HEDA 3NSWA 4FF1A 3MXNA 3NTKA 1Q12A 3ND9A 1IKLA 4RHSA 3R2TA 4XDXA 5LL6S 3P75A 5C44B 4FXDA 4K2LA 1UUPA 1TU2B 2NVQB 4QCLA 2EYFA 2IX1A 2EYMA 1ENCA 2FMMA 2OXPA 1I4HA 3P1HA 3RUZA 1V1PB 4HMIA 2JYOA 5JPMC 2AWOA 2KEEA 1BOSA 1KNEA 4N9PA 1B44D 4G7HC 3QOJA 1LTGD 1A3VA 4IQZA 4WFN3 3NP8A 1LTTD 3NBHA 1AZQA 1FYCA 4F7XA 1IYUA 4C56C 1S5BD 2EVBA 1U4PA 1EWHA 1EYAA 4L63B 4FNFA 2NBFA 5KNCA 3RLFA 4K5XA 4KY5A 1KDCA 4B9WA 1OXSC 5KNDA 1GUNA 2M9VA 1JWMD 1HTLD 2B2UA 2A5HA 1S5DD 3TBIB 2X6GA 2D2CC 2XVSA 2K28A 3ND8A 1IYVA 5K5PA 4BY1B 1OO9B 3SHLA 1H9JA 5EPJA 2K1BA 2K5WA 1QNUA 1JOOA 5K36G 2JP1A 2QEJC 1SBBB 2E2IB 1SEBD 4ZUIA 3MTSA 1I4RA 3H94A 1WD0A 1PZJD 4RA8A 4IFDI 3SVMA 2AQ2B 4O42A 1A15A 3HS0C 3WOEA 2JA5B 1PTOD 5D3IB 1GUSA 3R3OA 1F2LA 3MVVA 2R3ZA 2E2HB 1ET6A 3FRPB 2F0PA 1QNKA 1MD2D 2QCPX 1E0BA 2K32A 3FPPA 1ESFA 4C2MB 3DWQA 2M2LA 3NTHA 1ENAA 5E1FA 4CJ0B 4G57A 2NYZD 4QUCA 4ZLTF 1GUTA 4ZKBB 4J6HA 3GV6A 4RHRA 2XIWA 4M8AA 2AUKA 2NTSA 1SYGA 4IUTA 2JEAI 2B2VA 2WAQB 1BF4A 1L0YB 1IL8A 2LMCB 3S17B 2KJXA 1HQMC 1CQFA 2AQ3B 4KKSA 4QUFA 3LX0A 2F0WA 1TY0A 1Y8NB 2FINB 1SNDA 2SEBD 1EY8A 1STGA 4IUPA 5EPLA 2B2TC 2XWBB 1UNSA 1GOZA 3HZXA 2MJ8A 2IT1A 1U4LA 2L12A 1RCVD 5CBEE 2O5IC 4CBVA 5ELEA 3NHHA 2QKIC 1LTID 1SNPA 3KLSA 1CZGA 3PUYA 3U9OA 2F1MA 4A3IB 1OXTA 2RQXA 5FO8B 3SEBA 1J9OA 3EFXD 1STYA 3CRKC 3DHQA 4S3SA 4HAEA 4I65A 1EY4A 5FO7B 2TSSA 1MBYA 2C5CA 2F0JA 2B2YC 5KYIA 3T4AC 4XT1B 3GTLB 1BDOA 2LS01 4A3GB 3A54A 4MIUA 3L9AX 1ZKOA 2EY1A 1SNMA 1BBXC 3I4NB 2F3WA 4KMUC 5BN5A 1O78A 1SDFA 2A73B 2EYLA 1TVXA 2FJ2A 2DN8A 1PTOH 2KA7A 3CRLC 4XYQA 1UAPA 3E0JA 1TWCB 2J4XA 2A74C 2EJMA 2PMZB 1LTRD 2L55A 1H9MA 1S5ED 5M5YB 3CQZB 4TRDA 4CJ1B 3A55A 4RCNA 2F0TA 4HR7B 4RKLA 1G91A 4FVMA 3H0GB 4H13C 3BDOA 2G9HD 4F8MA 1CA5A 1NSNS 2KEDA 1CK1A 4DK0A 4CGYB 2Z1CA 3VYTA 4A3KB 1XX8A 4KKUA 2R61A 1ILQA 1LTSD 3I72A 1H9SB 3S1MB 1VF7A 1C4QA 3GTMB 1Y69U 4FO2A 1V1OA 5FKAC 1JB3A 3HGBA 4BWGB 1SFOB 1KABA 1G2TA 5FO9B 3Q24A 5C5MA 3DXJC 2KCNA 3EVQA 1KLUD 1GJXA 3PUVA 1SXTA 3SK4A 4DAPA 1DYQA 1MI2A 3C3LA 1FNUA 1SSOA 3EJIA 3K5MA 3LNNA 5C3EB 4NMZA 1JC7A 4NW2A 5C5LA 3RZDB 2JEBI 1I4QA 1PTOB 2FHTA 2PW5A 2XWJB 3TMEA 3CHBD 2YYZA 5JJZA 3TZUA 1EY9A 1RTOA 1LT4D 3M4OB 1HFGA 2KQ3A 5CMDA 3RZOB 1LO5D 2JA7B 5F2DA 3TP5A 2PZUA 3BDLA 3SE0A 2EOTA 3L7ZC 1S4ZA 2L11A 2RBMA 2L4NA 4R8IA 3ERQA 2SDFA 2JXMB 1I50B 2OEOA 2EY6A 4X3UA 3SXHA 3V2TA 3GV3A 1EY0A 3D3RA 2MGSA 4KY7A 2QILA 4FYDA 2E2JB 4IN3A 5EJWA 2F0NA 2ICIA 4PNYA 1Q3LA 3HRZC 1STEA 5C4JB 3DWPA 4C3IG 1V8QA 1SNQA 2KECA 3EQLC 4C3HG 1EQTA 1ZYRD 2Q8RE 3R93A 2R93B 5EBCA 3KF8A 4K8JA 1TWAB 1WCMB 3GO5A 4KHZA 5DNFA 1HCZA 1NR2A 4U673 5LL6X 1AEXA 2F0VA 3SK5A 1R4PB 2WKCA 1TWFB 1KLGD 3GD7A 2IX3A 1D6EC 2ID0A 1IKMA 4J8QA 1W6JA 1F2YA 3AB9A 5CV7A 1G2SA 1DONA 5I2YA 4ULLA 2BA1A 1IW7D 1E2VA 4RGOS 4MHEA 3D8GA 2A6EC 5M5WB 2ZXOA 2Z4IA 1SJHD 3OOCA 1II3A 3VYRA 3OWFA 4IUUA 1STBA 2B63B 3DWAA 2A6HC 3SK8A 1HRJA 2NZ1D 5JEAH 2CVRA 2RSNA 5IGFA 1TWHB 3D4RA 4DF7A 2HQEA 4KJNA 2J7ZA 2NTTA 5EPKA 1LV9A 1ET9A 3GTJB 5IOCA 5TSSA 4FXKC 2B8FA 3I4LA 1C48A 5A2QL 2BCOA 4KKTA 3VYUA 2NN6H 5KNBA 5E3FA 4X3SA 1UEAB 3NE5B 1TR5A 5T1GA 5FLXL 1BCPD 1NR4A 3ITPA 4C3JG 3S2HB 2AWNA 2PYKA 2F3VA 5C0XH 1TY2A 4K6LA 2KCCA 1KDBA 2MP1A 3VA5A 1K8OA 1I6HB 1LABA 3SR1A 3C1FA 1RDPD 4RH6A 1F9RA 2B2WA 1HXYD 3D31A 1BQQT 4DGZA 2A68C 4Q0FA 3N6RA 4I7ZC 4G7ZC 5A2QE 5A35A 2HDLA 2PZWA 1IW7C 3DM1A 2CW0D 4V0BA 1ILPA 3E6ZX 2OF1A 3PIO3 1DOMA 2F03A 1PTOF 2NN6I 4DNRB 1B9NA 1Y1VB 4IFDH 5FLXE 4QB4A 1EYCA 1SMYC 1D2BA 3WOFA 4PQXA 4TKOB 1S5FD 4B08A 2HUGA 2EJFC 1K8MA 1PRTD 2A69D 3BG3A 2H4OA 4K5WA 3K5NA 4RGNA 3MXGA 5C0XI 3RMHA 1CTMA 2JE6I 2CHBD 4GZYC 1FR3A 3A7LA 3HG9A 3I70A 1SNOA 5DM63 2PO4A 1EIGA 3NQTA 3HOUB 4LK1C 3C1EA 3EROA 3CKIB 2VUMB 1RTNA 1U4RA 2RSOA 1SJED 4XIGS 4DU9A 1GHJA 1MGSA 5CGKA 5CORA 2G9DA 3OW7A 3H91A 1EY6A 1B50A 2O2LD 3KUPA 2IL8A 3VR4A 4KN7C 5HGTA 4X3KA 2K5DA 3MA2B 5KEEA 1HUNA 3NPPA 3VR2A 5JEAJ 4NDXA 4IUQA 2JA6B 3K7AB 4C1NK 1FNVA 1IHZA 1R9TB 4K5VA 1U9RA 2EE1A 4XQQA 2EXZA 2DNEA 2JSOA 2KHSA 1HTPA 2SOBA 4L6TB 1BR9A 4IALA 2R92B 1CA6A 1ONLA 3I8ZA 5M3MB 3I91A 5I6YA 2E76C 4HCEA 4A3FB 3PO3B 1BO0A 1JE4A 3NK9A 4KK7A 1ICWA 1A3UA 3GTKB 2RDGA 3Q22A 3BYTB 4RGMA 1D5MC 3EA6A 4DK1A 5G3LD 4FXGC 2F0FA 1SYDA 4U68A 1O7ZA 1QWYA 5IGEA 1BXTA 3TP8A 1EU3A 5E4WC 4F87A 5C0XJ 2WV6D 4RWSC 4DN4M 5CBAE 1AP0A 3WDNA 3GTPB 3K58A 4BA2I 3PMFA 4WORA 5EBDA 4R8NA 1QILA 2F0EA 3Q23A 1SNCA 2BA0A 3J7YW 4YIJA 4N9TA 4K6DA 1JR0D 3DUZA 1JORA 3BYYB 2O4XA 4TSSA 3OSOA 4A3EB 3OPOA 3VYSA 1RJTA 1BCPB 1PFBA 2L5TA 4TQUS 1PTOC 2N88A 3S1RB 1PMRA 2B8GA 3SDZA 1TKWB 4IFDJ 3MXPA 2I07B 4FP5D 1RODA 1A3TA 3NBIA 4PMCA 5JPNC 3A8IE 1CT1D 1EFID 1B1ZA 2F0OA 1ZEQX 2VB2X 5C6AA 1CHQD 2D62A 3VA7A 1STAA 1OXXK 2O5JC 3DMUA 2LKVA 5I2XA 4H0LC 5DAUA 1JQYD 2Y0SB 4RFBA 2C9OA 1SYEA 5JAVA 3BS1A 1SYBA 3IKJA 2F0QA 5I6WA 2XN9C 3VR6A 4CHTB 2E2DC 5ISRA 1PRTB 5CR3A 1E2WA 2K03A 5CV9A 2FMCA 3BDCA 1I3QB 1B9MA 3T56B 3D6CA 2IX0A 2QF7A 1DCZA 1RF2D 1PDQA 2L0CA 2XRQD 4DXFA 1KTKA 4EGVA 3I4MB 2TMPA 2NVXB 4C3IB 1AN8A 3FEWX 4C3HB 2B2UC 2LFNA 1PZKD 5EKLA 2RVLA 1ZXTA 2EYPA 5KYLA 4CKCA 1TQOA 3HEJA 2KOLA 2SNMA 1HHVA 1F2ZA 1TS5A 4KD4A 1H9RA 3K59A 3MWYW 3OMCA 1O7YA 3GTGB 2IPKD 3Q6SA 3NQIA 1HPCA 3M4YA 4KHVA 2IWHA 1STHA 3M3YB 3ZYYX 3DEPA 1LTAD 2WKDA 1YNND 2ZXPA 2PQEA 3RD4A 1Z47A 3CU7A 1B4OA 2E75C 3S2DB 1D5ZC 1DJRD 1LT3D 4DNTB 3J81L 2RDHA 4HSPA 3JAML 2OT2A 3G6JB 1JOKA 3QOLA 1RKNA 2WB1B 1PLFA 1QOHA 1A2UA 3GTOB 1SAPA 1WD1A 3IAYA 5C4XB 2B2VC 3G7LA 4H7BA 2H1EA 2KUMA 2Q8TA 3A7AB 1A6XA 2EZVA 5CYUA 4RGTA 4FF3A 3X3NA 3HOZB 3LWEA 4MN3A 5AFWA 3TSSA 4C3JB 1DZ1A 4NP5A 4OO1G 1KAAA 2RKSA 1F77A 5K36H 1CQVA 3J81E 1I6VC 1EOTA 1M4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DAY A;  3NBH A;  3MXN A; 
#chains in the Genus database with same CATH topology
 2E74 C;  3CPF A;  1HA6 A;  3I3C A;  4X64 L;  3JAM E;  1NMG A;  2JA8 B;  1KRS A;  1D8L A;  1PYS B;  1VF5 C;  2K5V A;  2VL6 A;  1NTG A;  1I6H H;  1SE3 A;  1BCP F;  1PH9 A;  5IGB A;  4BY7 H;  2ENB A;  1M8A A;  4IZ8 A;  3S1Q B;  2GA4 B;  4P75 A;  5C4Z A;  3HKZ B;  5D14 A;  3TZD A;  2HHH L;  4KN4 C;  1CI3 M;  3KK7 A;  4HTH A;  4XQN A;  5EGT A;  3MFG A;  1CKO A;  3AFQ A;  4YCW A;  1YNN C;  4A76 A;  4XYO A;  1QZG A;  3HOW G;  1PH7 A;  4R1J A;  3K5O A;  2PZT A;  1TWG B;  3VDY A;  1EZ6 A;  1CSQ A;  2CH4 W;  5C3W A;  1LLR D;  1EEI D;  5FOB B;  3VR3 A;  2B2T A;  1EWC A;  3D4D A;  2VY3 A;  1WTV A;  4DA2 A;  4APV A;  1QJO A;  2AQ1 B;  5CV6 A;  4BBS B;  2KHI A;  4A3B B;  2F0I A;  5FJ8 H;  2ASB A;  4HSV A;  3S14 H;  3F1Z A;  4G7O C;  2R7Z H;  1FJG L;  1ASZ A;  4E6I A;  1H95 A;  1SE2 A;  4QMG A;  1X56 A;  1X65 A;  1Q1B A;  2RHS B;  2NVT H;  4DFA A;  4X6A H;  3MFY A;  4JBW A;  1TS2 A;  1HQR D;  1N32 Q;  1MIU A;  3MEH A;  3K5L A;  4A3L G;  1EEF D;  3MXU A;  1HA5 A;  1VQG A;  1VMP A;  4PG3 A;  2V4D A;  3D4W A;  1HFN A;  1WYD A;  4DAY A;  1HZ9 A;  1K83 H;  2K7V A;  3HOY H;  3MEF A;  4IUR A;  2UXD Q;  1WTX A;  3FKI H;  1PRT F;  1XPU A;  3S16 B;  3LWU A;  3ERS X;  1LTB D;  2HCI A;  4CDE C;  4LFA Q;  1DGS A;  1OXU A;  2F0M A;  1CKN A;  1F9P A;  5IYB G;  1Y1W G;  4LAA A;  2B2Y A;  1B3A A;  3J80 c;  1Q8K A;  2NB0 A;  1EY7 A;  3J81 i;  5CV8 A;  3QB3 A;  1ML0 D;  1AE3 A;  4PZ7 A;  1ZYR C;  3JAM i;  3S1N B;  2Q8I B;  1UEB A;  4ZQ3 A;  1J8I A;  2VQE L;  3P20 A;  3TDQ A;  4KJO A;  3E9I A;  1G29 1;  2EYJ A;  1X3Q A;  2EJG C;  2UUB Q;  4HN7 A;  4JYA Q;  1C0A A;  1EQR A;  2RF4 A;  4BY7 B;  1YVC A;  3JC6 6;  4A3D H;  4AYB B;  1PFN A;  2FFK B;  5BR8 Q;  4QGU A;  5KRU A;  3HOX G;  2VW9 A;  3PO2 G;  1JWS D;  1F9Q A;  3J7Z C;  5LHY 1;  1QCB D;  5E4X A;  4Y7N H;  1B53 A;  1XYI A;  3M7G A;  4GOP B;  3U58 A;  3NWT A;  4DXG A;  1H9K A;  1CZW A;  4EVO A;  3K6O A;  5D3D A;  2F4I A;  2F0U A;  2DUD A;  2IY5 B;  5JJL A;  2M00 A;  3IFD A;  1TS3 A;  3B6Y A;  4DR1 Q;  2YU9 H;  2QDB A;  4DK6 C;  2N55 A;  1N36 L;  2PCF B;  5ELF A;  2VNU D;  1D5X C;  4P72 A;  4A93 G;  3S14 B;  4ZUJ A;  1SRO A;  2PI2 E;  2R7Z B;  4LMQ D;  1WTR A;  4FF2 A;  2F0L A;  3MAQ A;  2QA4 A;  2DY8 A;  4O1N A;  2F0D A;  1PXU A;  2DJF C;  3FDT A;  4G4K A;  2NVT B;  1VDZ A;  1X55 A;  3NWS A;  5IT9 c;  1SYC A;  2ZXR A;  5IP7 G;  5BN4 A;  2ES2 A;  1WTO A;  4NXM L;  5M9O A;  4CKE A;  1Q81 C;  3I73 A;  3NUC A;  1EU4 A;  1K83 B;  3HOY B;  1U0L A;  3X3M A;  3BJU A;  1CM9 A;  4ZYS A;  3FKI B;  4P2C B;  4PV1 C;  4CDD C;  3FPU B;  2EY2 A;  1RIP A;  4BBR B;  4A3M H;  1AFP A;  2EDG A;  2ZTE A;  3A5Z B;  2F52 A;  1R4Q B;  1T5E A;  4MNO A;  5G3L F;  1FD7 D;  4R4Q A;  1BCP C;  4JI6 Q;  3S1N H;  1G6P A;  3JAM c;  3G6E A;  2F0S A;  3GQB A;  5J39 A;  4DV6 L;  3Q0A A;  2ZT9 C;  2XNA C;  3F2U A;  1XNR L;  2K04 A;  1N33 Q;  2F3I A;  2JA9 A;  3CCQ A;  3IL8 A;  1NBW A;  3H3V C;  2PQA B;  5M5X H;  2UUC L;  2D5D A;  4PMB A;  4JBM A;  3PIP 3;  2EYO A;  4A3D B;  1J5E L;  3A8K E;  4DUZ Q;  5C44 G;  3S1R H;  2F0G A;  2Z4H A;  1G8Z D;  5ELB A;  1Y8O B;  2VB3 X;  2R6G A;  4Y7N B;  3BVM A;  4DV0 L;  1K9M C;  2XSC A;  3T51 B;  2CW0 C;  3H3V H;  2J0T D;  2PNR C;  4R4T A;  1DXM A;  3N52 A;  4DR6 L;  1XPO A;  1NAP A;  4B3R L;  4KD3 A;  2YU9 B;  4JI4 L;  4IPD A;  2UXB Q;  2YTX A;  4J15 A;  4DUY L;  5IGC A;  1O80 A;  1YEZ A;  5IYC G;  1HR0 Q;  4K2K A;  4DAV A;  4DV1 Q;  1TT2 A;  1SR3 A;  3UDF A;  2IW3 A;  1I4G A;  5COY A;  4PMW A;  5AJ3 L;  1TII D;  1JWU D;  1PRT C;  2A69 C;  3M85 A;  1YJ9 A;  5LMU Q;  2ZM6 L;  4CDF C;  2EYH A;  2CH4 A;  4Q5V A;  1GUG A;  5M3F H;  1EY5 A;  4PZ8 A;  3QIA A;  4JW0 A;  2EPB A;  4GKJ L;  3T1H L;  1K73 C;  1T5X D;  5JEA G;  3KF6 A;  3C46 A;  1XTC D;  4EQO A;  1EIH A;  3QJY A;  2HD3 A;  4K8I A;  5IP9 H;  1SE8 A;  2K05 A;  3KOJ A;  4KLK A;  4UDU C;  4A3M B;  1JIC A;  1DD2 A;  2SNS A;  4OIK A;  2UU9 Q;  1CFM A;  4X62 L;  1V1P A;  2X6L A;  4OIJ A;  1SN8 A;  4QF4 A;  1HZB A;  4A3J H;  1DOL A;  3K81 C;  4KHP Q;  2F0K A;  2K01 A;  3PV0 A;  3AFP A;  1KDA A;  3A0J A;  4ZAI A;  3HOV B;  3EIV A;  2NN6 G;  1VS0 A;  2K5Q A;  4JV5 Q;  1WTW A;  2ICE C;  4OX9 L;  1PZI D;  2E5L L;  1ESR A;  4BY1 G;  4CKB A;  3GTQ H;  1RD9 D;  4ZK9 B;  4X65 Q;  5M5X B;  4ZKC B;  4OO1 H;  4C3H H;  1YBY A;  1E1O A;  2KHJ A;  5EKI A;  4L8J A;  3OIQ A;  5HUR A;  1K28 A;  4RAU C;  1X3P A;  1XJV A;  4JI2 L;  1S3O A;  3MHB A;  5C0X G;  5J1Z A;  2BE5 D;  5JVH 3;  1IBM Q;  3T13 A;  4BS9 A;  1WVL A;  5ELC A;  3T1Y Q;  1XPR A;  3A56 A;  1V43 A;  2D0O A;  4IJH A;  4K0K Q;  1VMC A;  4LF8 L;  1RHP A;  4JK1 C;  3G48 A;  2WP8 J;  1PH8 A;  2JA5 G;  2B39 A;  4ZRZ A;  4RCO A;  2L9H A;  2RDF A;  3GTG H;  4OEL B;  2XRS D;  4RKB A;  3V05 A;  3BZD B;  2ZJR A;  1X54 A;  2K5H A;  4B3M L;  4XTC S;  2RCF A;  3M3Y H;  3O13 A;  1WTP A;  1TS4 A;  2PW7 A;  3ULJ A;  4DR2 L;  3I90 A;  3TN2 A;  5GAE C;  4HMJ A;  4NPS A;  2Q2U A;  1DM0 B;  3FHW A;  2VXW A;  5DEH A;  1Q8I A;  4X64 Q;  3KJP A;  5M3F B;  1O7L A;  3IFT A;  2B2W C;  3IRB A;  4IFD G;  1WFQ A;  3FMC A;  4IUV A;  3J80 L;  1D7Q A;  2WII B;  5EKK A;  2WAQ G;  1B70 B;  4DR4 L;  3NXW A;  3PO3 G;  1MJC A;  3BVG A;  1PFS A;  3URY A;  4OO1 I;  4UHV A;  2I0Q A;  4EQP A;  1L1O A;  3QO2 A;  2VQF L;  1EYD A;  2HCC A;  3S15 H;  1CUK A;  3C2P A;  4A3J B;  5IIF A;  1IBL L;  3QG1 A;  4A3L H;  5CV4 A;  2NWG A;  1F9S A;  1SMX A;  1DOK A;  5FK9 C;  3M7N A;  2RA4 A;  1Q90 A;  3R8B A;  1A8V A;  2HDM A;  2MPM A;  3J7A V;  2VZA A;  1EQQ A;  4NKL A;  3HKS A;  3GTQ B;  1I5F A;  3PSI A;  3QWN A;  1Z7T A;  2IJ0 A;  1Y1W H;  1CKM A;  3KLS X;  5LMN W;  4LW1 A;  4YCU A;  2CQA A;  3A8J E;  1NE3 A;  3OMG A;  5I9O A;  3CCJ A;  1CHP D;  4OGQ C;  1FJG Q;  4ID6 A;  2L1B A;  4K14 A;  1VQ7 A;  3PGZ A;  2JQO A;  2QEX A;  5T1I A;  2DY7 A;  1PFM A;  4LF4 L;  4KI0 A;  3J80 E;  1Q1E A;  4KV6 A;  2BE5 C;  1OXV A;  5BN3 A;  4BA1 I;  2NZO A;  2X69 A;  2AUJ D;  4CJ2 C;  4R9W A;  1JMC A;  1A2T A;  1P8L A;  1S5C D;  4GLX A;  1PYW D;  5JVG 3;  2LY7 A;  2OQ0 A;  2ZTD A;  3TP7 A;  4DAY B;  4EQN A;  4M1U B;  2K4K A;  1W6K A;  3HOX H;  3NEL A;  3PO2 H;  3PUZ A;  5IT9 L;  1W3S A;  3AMU A;  3S1Q H;  2BDO A;  1VCI A;  1L0W A;  5KIX A;  1JOQ A;  3L3O C;  4OWX B;  1XWE A;  4H44 C;  1CKN B;  5IGD A;  1Z6H A;  1D1I A;  1HZA A;  3S24 A;  3E5S A;  4C1N I;  3CCU A;  4HCS A;  3HOW B;  4F88 A;  2BDN A;  4XQJ A;  1N34 L;  5DM7 3;  1SYF A;  2R7F A;  1X32 A;  1KNA A;  1FGB D;  2WAC A;  3VR5 A;  1CSP A;  1QG7 A;  2PMZ E;  1TWG H;  1LT6 D;  2MUY A;  2VQE Q;  1HUM A;  1WOC A;  3K0Y A;  3KLR A;  2Y0S E;  4JI3 L;  5J22 A;  3K57 A;  5I9P A;  4MZ9 A;  2MHV A;  4A93 H;  3TQY A;  2A6E D;  1JCK B;  1U4M A;  1G6Z A;  2AMC B;  4JG2 A;  2NVY H;  2PPB C;  2WIN B;  1FNW A;  5FLM H;  1QE6 A;  4OHJ A;  1BNZ A;  3H6M A;  1ENF A;  4EQ5 A;  5J3B A;  1I4P A;  3S15 B;  2A6H D;  1GUW A;  3SK6 A;  1XMQ Q;  4OEM B;  3CC4 A;  2BH8 A;  2CWA A;  5D65 A;  2RHQ B;  1YNJ D;  1NCV A;  3W1B A;  2K33 A;  3H0G G;  4FF4 A;  4UY8 C;  5IT9 E;  4WJW A;  5GAH C;  5CV5 A;  5IOD A;  2K6A A;  3FVQ A;  4NB3 A;  4GLV B;  4X3T A;  1Y1W B;  3W2D A;  3S16 H;  4KY6 A;  1B7Y B;  1LYL A;  2I46 A;  1BUV T;  4V19 0;  5CC4 A;  2CQO A;  3J80 i;  1C8C A;  5I4D A;  1STN A;  3R2I A;  1E22 A;  3PUX A;  3KBG A;  3J7A 5;  3OIP A;  1SLJ A;  3NEN A;  1L0X B;  2KCM A;  3K8A A;  4J1M A;  1MSH A;  4XXE A;  1HNW L;  1E2Z A;  4ME5 A;  4Z9C B;  5IGG A;  2KVM A;  4NXM Q;  3PUW A;  5DLQ E;  2D9U A;  3ONA B;  1GHK A;  3I4M G;  3DEO A;  4XT3 B;  2BOS A;  3P7J A;  3MC0 B;  4GOP C;  4DV2 Q;  5KGU A;  4JVZ A;  3CCL A;  4LJZ C;  2Q2H A;  4OL7 A;  5C4H A;  3HOX B;  1EL0 A;  3PO2 B;  1LT5 D;  2NVQ H;  3PQI A;  1SE4 A;  4HID A;  1F2M A;  4B9X A;  1VQ9 A;  1GUO A;  1B2T A;  5GRO A;  4A3C G;  3W3A A;  3HP3 A;  3BVZ A;  5C3E G;  4LUZ A;  1YJW A;  3NTI A;  1EQV A;  3T53 B;  4ODG A;  1EZ8 A;  2IHE A;  4IUN A;  5JOB A;  4DV6 Q;  4H02 A;  3TP6 A;  1AW7 A;  3GP7 A;  3U9S A;  1QB5 D;  2F0H A;  3KBX A;  4BXX H;  2A68 D;  2EY5 A;  4UAI A;  1NUC A;  3V96 A;  2UUC Q;  4QIW B;  4A93 B;  2K14 A;  4JI8 L;  1H9S A;  2L15 A;  3S9W A;  2NVY B;  3UE1 A;  1WTQ A;  2QDL A;  1NNX A;  3F8T A;  3T16 A;  5NUC A;  2OQK A;  3MZ5 A;  4O2D A;  4DV0 Q;  1EUJ A;  3GDE A;  2R7D A;  1LAC A;  2JA7 G;  3H09 A;  3OWE B;  1SMY D;  1SRU A;  1D1K A;  2WB1 E;  4ILW A;  1PHJ A;  1IBK Q;  2UUA L;  4AIM A;  1I4X A;  4DR6 Q;  3UI2 A;  3J7A F;  4B3R Q;  1YNJ C;  5C3X A;  4JI4 Q;  4DUY Q;  2YV5 A;  1Y8P B;  4KTA A;  2NUC A;  5ELD A;  1A62 A;  3ULL A;  4BBR H;  3OHX C;  1AZP A;  4ABN A;  1XXG A;  4WRD A;  3D6W A;  1GXD C;  5AJ3 Q;  1MSG A;  2Z8L A;  2DNC A;  5EQ0 A;  3AU7 A;  4HED A;  3CMA A;  3NSW A;  4FF1 A;  3MXN A;  3NTK A;  1Q12 A;  3ND9 A;  4HJ9 A;  1IKL A;  4GKJ Q;  4RHS A;  3T1H Q;  4BY1 H;  3R2T A;  3L0O A;  4XDX A;  5LL6 S;  3P75 A;  5C44 B;  4FXD A;  4K2L A;  5IYD G;  1UUP A;  4GNX A;  3KF6 B;  1TU2 B;  2NVQ B;  2B3G A;  4QCL A;  1HH2 P;  2QW7 A;  2EYF A;  2E2I H;  2IX1 A;  1GO3 E;  2R93 G;  2EYM A;  1ENC A;  2FMM A;  2Z6K C;  2OXP A;  1I4H A;  1YZ6 A;  1WCM G;  3J81 j;  3P1H A;  3HKZ E;  3RUZ A;  1MKH A;  1V1P B;  2JA8 G;  4HMI A;  1GKH A;  2JYO A;  5JPM C;  2AWO A;  2JA5 H;  2KEE A;  1BOS A;  1KNE A;  4N9P A;  1B44 D;  2E2H H;  4G7H C;  1S72 A;  3QOJ A;  4LFC L;  3ZJY C;  1K0R A;  1LTG D;  3KJO A;  1A3V A;  4IQZ A;  4WFN 3;  4C2M H;  3NP8 A;  1LTT D;  3NBH A;  4JI2 Q;  1AZQ A;  1FYC A;  1GD7 A;  4F7X A;  1IYU A;  4C56 C;  2Z6B A;  1S5B D;  2EVB A;  1U4P A;  1EWH A;  1EYA A;  4L63 B;  4FNF A;  2B63 G;  2NBF A;  1JJG A;  4LF8 Q;  3A5U A;  5KNC A;  3RLF A;  1K3R A;  4K5X A;  5ELN A;  3S17 H;  4KY5 A;  1KDC A;  4B9W A;  1OXS C;  5KND A;  1GUN A;  2M9V A;  1JWM D;  1HTL D;  4JC0 A;  2B2U A;  2A5H A;  1S5D D;  4JOI A;  4DR2 Q;  2KEN A;  3TBI B;  4NXN Q;  2X6G A;  3M4Q A;  1K0S A;  2D2C C;  4UP9 A;  3HOV H;  2XVS A;  2K28 A;  3ND8 A;  1IYV A;  5K5P A;  4BY1 B;  1KIX A;  1OO9 B;  1A0I A;  3SHL A;  1H9J A;  5EPJ A;  4ME3 A;  2CFM A;  4DR4 Q;  1UWV A;  2K1B A;  2K5W A;  2N78 A;  4RMF A;  4YWM A;  1QNU A;  4A3I H;  1JOO A;  4JPB W;  1FGU A;  5K36 G;  2JP1 A;  4YWK A;  2QEJ C;  1SBB B;  2VQF Q;  1SEB D;  2E2I B;  4YY3 L;  4ZUI A;  3MTS A;  1I4R A;  3H94 A;  3CCE A;  2PI2 A;  4MTK A;  4YWL A;  1WD0 A;  1IBL Q;  1L1O B;  4GN3 B;  4AYB E;  1PZJ D;  4DPG A;  3I55 A;  4RA8 A;  1VQM A;  3SVM A;  2AQ2 B;  4IFD I;  4O42 A;  2F4V L;  3CPW A;  2ZJQ A;  1A15 A;  2GN5 A;  1VQH A;  3HS0 C;  3WOE A;  3F2C A;  2JA5 B;  1PTO D;  1YNX A;  5D3I B;  3CC2 A;  3R3O A;  1GUS A;  1F2L A;  3I2Z A;  3GTL H;  4ZCK A;  3MVV A;  1VQE A;  2R3Z A;  4PZ6 A;  4A3G H;  2E2H B;  4Y52 H;  1ET6 A;  1PV4 A;  4BY7 G;  3FRP B;  2F0P A;  1QNK A;  4AYB G;  1MD2 D;  2I5L X;  2QCP X;  1E0B A;  2K32 A;  3I4N H;  4AQY L;  3FPP A;  1ESF A;  1QVG A;  2YTY A;  2OWO A;  4C2M B;  3DWQ A;  2M2L A;  3NTH A;  1PH4 A;  1ENA A;  5E1F A;  4B3S L;  2Q2I A;  4CJ0 B;  4G57 A;  4P73 A;  4LF4 Q;  2NYZ D;  4QUC A;  1VQ6 A;  4ZLT F;  1GUT A;  4ZKB B;  4J6H A;  3GV6 A;  4RHR A;  2XIW A;  4M8A A;  3H15 A;  4L5R C;  2AUK A;  2NTS A;  1SYG A;  4OON A;  1Y1V G;  2XGT A;  4IUT A;  2JEA I;  2B2V A;  1TXY A;  3CD6 A;  2WAQ B;  4LFA L;  4DR7 L;  1IZ6 A;  1BF4 A;  1L0Y B;  1TWC H;  1IL8 A;  5GQO A;  2LMC B;  3U50 C;  2KJX A;  3S17 B;  1JE5 A;  1HQM C;  2R7Z G;  1CQF A;  5JJK A;  2AQ3 B;  4KKS A;  2WFW A;  3KLW A;  4QUF A;  1X3E A;  4JI7 L;  3LX0 A;  2F0W A;  1TY0 A;  1Y8N B;  2FIN B;  5M5Y H;  1SND A;  2SEB D;  3CQZ H;  4WJ3 M;  1EY8 A;  3PF4 A;  1STG A;  4IUP A;  5EPL A;  3E9H A;  2B2T C;  2XWB B;  1N34 Q;  1UNS A;  1GOZ A;  1VQ4 A;  3HZX A;  1IL2 A;  2MJ8 A;  2IT1 A;  1U4L A;  2L12 A;  1RCV D;  5GAD C;  2OTJ A;  3HOY G;  5CBE E;  2KBN A;  2O5I C;  4CBV A;  1PA6 A;  5ELE A;  3NHH A;  3F2B A;  2QKI C;  4JI3 Q;  4IPG A;  4A3K H;  3HOU G;  1LTI D;  1SNP A;  2YTV A;  3KLS A;  1CZG A;  3CXC A;  3PUY A;  3U9O A;  2VUM G;  2F1M A;  4A3I B;  1OXT A;  2RQX A;  3CCV A;  1HR0 W;  5FO8 B;  3S1M H;  3SEB A;  1J9O A;  3EFX D;  1QVF A;  2CKZ B;  3GTM H;  1STY A;  3CRK C;  3DHQ A;  4S3S A;  4HAE A;  4I65 A;  4JI1 L;  1EY4 A;  5FO7 B;  2TSS A;  1MBY A;  2C5C A;  2F0J A;  4L5Q A;  1SFO H;  2B2Y C;  5KYI A;  3T4A C;  4XT1 B;  3GTL B;  1BDO A;  2LS0 1;  4A3G B;  3BZK A;  3Q8D A;  3A54 A;  3L9A X;  4MIU A;  4DV7 L;  1HNZ L;  4A3D G;  1ZKO A;  2EY1 A;  2IHF A;  1YJN A;  1SNM A;  1BBX C;  3I4N B;  2AHO B;  2ATW A;  2F3W A;  4KMU C;  4N8F A;  5BN5 A;  3K7U C;  1O78 A;  4A3C H;  1SDF A;  1VQF A;  5C3E H;  2JA6 G;  5FLX c;  2A73 B;  1NJI C;  3I4O A;  1QUQ A;  2EYL A;  1TVX A;  1Z9F A;  3HOW H;  2FJ2 A;  3RZD H;  2DN8 A;  1XMO Q;  1PTO H;  2KA7 A;  2PNH A;  3AYH B;  3CRL C;  4XYQ A;  1VQD A;  1UAP A;  1EYG A;  3E0J A;  2I5M X;  4P74 A;  2R92 G;  1TWC B;  3TS0 A;  5M3M G;  2J4X A;  4A3F G;  2JN4 A;  2A74 C;  4IOA A;  2AKW B;  2EJM A;  2PMZ B;  3M4O H;  1VQA A;  4X66 L;  1LTR D;  2HHH Q;  3RZO H;  2L55 A;  1H9M A;  1S5E D;  5M5Y B;  2JA7 H;  3CQZ B;  4TRD A;  4CJ1 B;  1HNX L;  3A55 A;  4DR5 L;  4RCN A;  3I56 A;  4B3T L;  2F0T A;  4HR7 B;  4RKL A;  4R4O A;  1G91 A;  4FVM A;  1NMF A;  3W1G A;  3H0G B;  2H5X A;  4H13 C;  1P16 A;  3BDO A;  2OCE A;  2G9H D;  4F8M A;  3KFU A;  1CA5 A;  1NSN S;  1V9P A;  2KED A;  1HJP A;  1I50 H;  1UE5 A;  1FL0 A;  3RR5 A;  1CK1 A;  4MTN A;  1X9N A;  4DK0 A;  4CGY B;  2Z1C A;  3VYT A;  4DUZ L;  4A3K B;  1EWI A;  1A63 A;  1XX8 A;  4KKU A;  2B29 A;  1JJC B;  5JJI A;  2R61 A;  3CME A;  5IYB H;  1ILQ A;  4JI0 L;  1LTS D;  3I72 A;  2GVA A;  2E2J H;  1XNQ L;  1H9S B;  3S1M B;  2EQS A;  3CC7 A;  1VF7 A;  1K8A C;  1C4Q A;  4HJ8 A;  3GTM B;  1Q86 C;  1LUZ A;  1Y69 U;  3SGI A;  4FO2 A;  1V1O A;  5FKA C;  1E3P A;  1JB3 A;  4DV3 L;  3HGB A;  1GVP A;  4HJ7 A;  4IPH A;  3QR8 A;  4BWG B;  5C4J H;  1KAB A;  1SFO B;  1M90 C;  1G2T A;  5FO9 B;  3Q24 A;  4A3E G;  5C5M A;  3DXJ C;  5HY6 A;  4GN5 A;  2KCN A;  4DV1 L;  4FDB A;  2GVB A;  3EVQ A;  1KLU D;  1GJX A;  3PUV A;  1SXT A;  3SK4 A;  1YIJ A;  4DAP A;  1DYQ A;  1MI2 A;  3C3L A;  1FNU A;  1SSO A;  3EJI A;  4L5T A;  3K5M A;  3LNN A;  1TWA H;  5C3E B;  1IXR A;  1WCM H;  2QGQ A;  4NMZ A;  1JC7 A;  4GN4 B;  4NW2 A;  5C5L A;  3RZD B;  4N8X 1;  2JEB I;  1I4Q A;  1PTO B;  2FHT A;  2PW5 A;  4DV4 L;  2XWJ B;  3TME A;  3CHB D;  2YYZ A;  3OTO L;  3ER0 A;  1TWF H;  5JJZ A;  3MXN B;  3CCR A;  3TZU A;  1EY9 A;  1RTO A;  2UU9 L;  1LT4 D;  3M4O B;  1HFG A;  2KQ3 A;  5CMD A;  3RZO B;  5M5W H;  5L37 A;  4KHP L;  4GNX B;  1LO5 D;  2JA7 B;  1EOV A;  3E3X A;  5F2D A;  3TP5 A;  2PZU A;  2Y0S G;  3BDL A;  3UDI A;  3SE0 A;  2EOT A;  1IYJ B;  3TRE A;  3L7Z C;  5IP7 H;  5M3F G;  1S4Z A;  2B63 H;  2L11 A;  2RBM A;  2L4N A;  3ULP A;  4R8I A;  3ERQ A;  2SDF A;  2JXM B;  1BVS A;  1I50 B;  4YCV A;  2OEO A;  3E0E A;  2EY6 A;  1PH3 A;  4X3U A;  1XTD A;  3SXH A;  4LFC Q;  1EFW A;  3F2D A;  3V2T A;  3GV3 A;  1EY0 A;  1N36 Q;  3D3R A;  3CCS A;  2MGS A;  1EIY B;  1VQO A;  3GTJ H;  1K3B C;  4KY7 A;  2QIL A;  4GS3 A;  4FYD A;  2E2J B;  4IN3 A;  2VS1 A;  4OXP A;  5EJW A;  2F0N A;  4DK3 C;  2ICI A;  2Z9H A;  3NBH B;  4PNY A;  1Q3L A;  3HRZ C;  2E8G A;  3EBE A;  1STE A;  5C4J B;  5LMN L;  1MHW C;  3DWP A;  4C3I G;  1V8Q A;  5EAY A;  1Q7Y C;  3UDX A;  1SNQ A;  1U5K A;  1J6Q A;  2KEC A;  3AQQ A;  3EQL C;  1EQT A;  4QY7 A;  4C3H G;  5IE8 A;  5C44 H;  1ZYR D;  2Q8R E;  3S2H H;  1Y14 B;  3CW2 C;  3R93 A;  2R93 B;  5EBC A;  4DV5 L;  3KF8 A;  4K8J A;  1TWA B;  3KYH C;  4A4I A;  1WCM B;  3GO5 A;  4KHZ A;  1PH2 A;  1VQ5 A;  5DNF A;  1HCZ A;  1NR2 A;  4U67 3;  4LUO A;  5LL6 X;  1AEX A;  2F0V A;  3TEH B;  3SK5 A;  1R4P B;  2WKC A;  1TWF B;  1XNR Q;  1KLG D;  3GD7 A;  2IX3 A;  1KC8 C;  4QQB X;  1D6E C;  2ID0 A;  1IKM A;  4J8Q A;  1AE2 A;  1W6J A;  4QJF A;  1F2Y A;  1I94 L;  3AB9 A;  5CV7 A;  1G2S A;  5IYC H;  4P71 A;  5I2Y A;  1DON A;  2XTI A;  4ULL A;  2BA1 A;  3K80 C;  1IW7 D;  1E2V A;  4RGO S;  4MHE A;  2DGY A;  3D8G A;  4LFB L;  4UP7 A;  1J5E Q;  2BH2 A;  2A6E C;  3M4P A;  2FXQ A;  5M5W B;  3W5O A;  2ZXO A;  1O7I A;  4YY3 Q;  2Z4I A;  1SJH D;  3OOC A;  4GLA C;  1II3 A;  3VYR A;  3OWF A;  4IUU A;  1STB A;  2B63 B;  3L2P A;  1Y1V H;  1VQK A;  2I5H A;  2A6H C;  3DWA A;  3SK8 A;  2F4V Q;  3CP0 A;  1HRJ A;  4O0A A;  2NZ1 D;  5JEA H;  2CVR A;  2RSN A;  5IGF A;  1TWH B;  3D4R A;  1RL2 A;  4RG1 A;  4DF7 A;  1YHB A;  1VQL A;  4OWW B;  2HQE A;  4LF7 L;  4KJN A;  2J7Z A;  2NTT A;  5EPK A;  4YHH L;  2UXC L;  1LV9 A;  4AQY Q;  1ET9 A;  3GTJ B;  2WB1 G;  5IOC A;  1AH9 A;  5TSS A;  1FVI A;  4FXK C;  2B8F A;  3TRZ A;  2K52 A;  3I4L A;  4B3S Q;  1C48 A;  4LF5 L;  5C4X G;  5A2Q L;  3CF5 A;  4TVA B;  2ALY B;  2BCO A;  3KDF A;  4KKT A;  4LWC A;  3VYU A;  2NN6 H;  2ZM6 Q;  5KNB A;  5E3F A;  4X3S A;  1UEA B;  3NE5 B;  1TR5 A;  3HOU H;  4DR7 Q;  5T1G A;  1L1O C;  3NEM A;  2VUM H;  5FLX L;  1V1Q A;  3HOZ G;  1BCP D;  1NR4 A;  3ITP A;  4C3J G;  3S2H B;  1C7Y A;  2AWN A;  2PYK A;  4LF6 L;  4JI7 Q;  2F3V A;  4JI5 L;  3I7F A;  2MO0 A;  5IY0 A;  2K75 A;  4IPC A;  4OWT B;  5C0X H;  4X62 Q;  1TY2 A;  4K6L A;  2KCC A;  1KDB A;  1YHA A;  2HIV A;  1Q46 A;  2MP1 A;  3VA5 A;  1PH1 A;  1K8O A;  4LF9 L;  3AEV A;  1PH6 A;  1I6H B;  1LAB A;  1T9H A;  3C1F A;  3SR1 A;  1RDP D;  1GM5 A;  4RH6 A;  4DR3 L;  3RLN A;  2JK8 A;  1F9R A;  2B2W A;  1HXY D;  2E5L Q;  4OX9 Q;  3D31 A;  1BQQ T;  4DGZ A;  2A68 C;  4GKK L;  4Q0F A;  1B8A A;  3N6R A;  4I7A A;  3HKZ G;  4I7Z C;  5A2Q E;  4G7Z C;  5A35 A;  2A19 A;  2HDL A;  1JB7 A;  2PZW A;  1IW7 C;  3DM1 A;  2CW0 D;  4V0B A;  4UPA A;  1XMQ L;  3G71 A;  3E6Z X;  2JA6 H;  3K7A H;  1ILP A;  1R9T H;  3DLL A;  2OF1 A;  4QIW E;  3PIO 3;  3TS2 A;  1DOM A;  2F03 A;  4HJA A;  2MFI A;  4JBJ A;  2EIF A;  1PTO F;  3RLO A;  2NN6 I;  4DNR B;  1B9N A;  1Y1V B;  4JI1 Q;  4POG A;  2MO1 A;  5FLX E;  4QB4 A;  1EYC A;  4IFD H;  1JT8 A;  1SMY C;  2R92 H;  1D2B A;  5M3M H;  3WOF A;  3RN5 A;  4PQX A;  4TKO B;  1S5F D;  4A3F H;  3PO3 H;  4B08 A;  2HUG A;  2EJF C;  1HNZ Q;  1K8M A;  4DV7 Q;  1LM0 A;  4BBS G;  1PRT D;  4A3B G;  2A69 D;  3BG3 A;  2H4O A;  4K5W A;  5FLM G;  3K5N A;  1N8R C;  3GTK H;  1X3F A;  5IWA L;  1G51 A;  4RGN A;  4B3M Q;  3DM3 A;  3MXG A;  2ZJP A;  5C0X I;  3RMH A;  1CTM A;  2JE6 I;  2CHB D;  4GZY C;  1FR3 A;  1E24 A;  1WJJ A;  1QUQ B;  3A7L A;  3HG9 A;  3I70 A;  4DV2 L;  1SNO A;  5DM6 3;  2PO4 A;  4WJ4 A;  1WI5 A;  2MNA A;  1EIG A;  3NQT A;  3HOU B;  4LK1 C;  3C1E A;  3U4V A;  3ERO A;  3CKI B;  2LXK A;  2VUM B;  3GTP H;  1RTN A;  3J81 c;  1U4R A;  3U4Z A;  1VQP A;  2RSO A;  4POF A;  4X66 Q;  1SJE D;  4XIG S;  4DU9 A;  1GHJ A;  1MGS A;  5CGK A;  5COR A;  1HNX Q;  2G9D A;  4DR5 Q;  3OW7 A;  4B3T Q;  3H91 A;  1UE7 A;  1EY6 A;  5GAG C;  1B50 A;  2O2L D;  4A3E H;  3KUP A;  2IL8 A;  3VR4 A;  4KN7 C;  2LXJ A;  1E1T A;  2N49 A;  3OYY A;  5HGT A;  4X3K A;  2Z0S A;  2K5D A;  3MA2 B;  5KEE A;  3RNU A;  1HUN A;  3NPP A;  3VR2 A;  5JEA J;  4LNQ A;  4JI0 Q;  4NDX A;  4IUQ A;  2JA6 B;  1XNQ Q;  3K7A B;  4C1N K;  5E7N A;  1FNV A;  1IHZ A;  1R9T B;  1YI2 A;  4K5V A;  4IOC A;  1IBK L;  1N32 L;  1U9R A;  2EE1 A;  1PH5 A;  2NZH A;  4XQQ A;  2EXZ A;  4QL5 A;  2DNE A;  2JSO A;  4DV3 Q;  2KHS A;  1HTP A;  2SOB A;  4L6T B;  1BR9 A;  4BXX G;  2UXD L;  4IAL A;  2R92 B;  3WWV A;  1CA6 A;  1ONL A;  3I8Z A;  5M3M B;  3I91 A;  1LTL A;  2CCZ A;  5I6Y A;  2E76 C;  4HCE A;  4A3F B;  3PO3 B;  1BO0 A;  1JE4 A;  3NK9 A;  4KK7 A;  2D0P A;  5FJ8 G;  1ICW A;  1A3U A;  4IO9 A;  3GTK B;  2RDG A;  1BBU A;  3BYT B;  3Q22 A;  4HIM A;  4RGM A;  1D5M C;  3EA6 A;  3D0F A;  1ASY A;  1VQI A;  4DK1 A;  5G3L D;  4CDC C;  2G5D A;  1KAW A;  4FXG C;  2CWP A;  2DJG C;  2F0F A;  2HIX A;  1SYD A;  4U68 A;  4DAM A;  2MQH A;  1O7Z A;  1QWY A;  5IGE A;  4DV4 Q;  4HIK A;  1KRT A;  1BXT A;  3TP8 A;  1EU3 A;  3H0G H;  5E4W C;  3OTO Q;  4F87 A;  2UUB L;  5C0X J;  4JYA L;  1B3Q A;  1WTH A;  3HFZ B;  2K50 A;  2WV6 D;  1YHQ A;  4RWS C;  4LUV A;  3FKI G;  4DN4 M;  5CBA E;  5BR8 L;  4R4C A;  1AP0 A;  3WDN A;  3GTP B;  1I3Q H;  4BBR G;  3K58 A;  4GOP A;  4BA2 I;  3PMF A;  4WOR A;  5EBD A;  4R8N A;  1QIL A;  2F0E A;  1KL9 A;  1SNC A;  2BA0 A;  3Q23 A;  3J7Y W;  3H3V I;  1KXL A;  4YIJ A;  4N9T A;  3ICE A;  4K6D A;  1JR0 D;  3DUZ A;  1JOR A;  3BYY B;  2O4X A;  4TSS A;  3UE0 A;  4HIO A;  4DR1 L;  3OSO A;  4A3E B;  3OPO A;  4C3I H;  1BKB A;  2NVX H;  3I4M H;  4A75 A;  3VYS A;  1Q82 C;  3EN2 A;  1BCP B;  1RJT A;  1PFB A;  2L5T A;  4TQU S;  1PTO C;  2N88 A;  3S1R B;  1PMR A;  2B8G A;  3SDZ A;  4DNI A;  1TKW B;  4IFD J;  3MXP A;  2I07 B;  1OTC A;  4FP5 D;  1QZH A;  1ROD A;  1QVC A;  1A3T A;  3NBI A;  4PMC A;  5JPN C;  3BZC A;  3CCM A;  3A8I E;  1CT1 D;  1EFI D;  3CAM A;  1B1Z A;  3STB D;  2F0O A;  2N8N A;  1ZEQ X;  2VB2 X;  1HNW Q;  5C6A A;  1CHQ D;  1BBW A;  2HQL A;  2D62 A;  4GNX C;  3VA7 A;  5LMN Q;  2HT1 A;  1VQC A;  1L2F A;  1NY4 A;  4R4I A;  1STA A;  3RN2 A;  5H1S E;  1M1K C;  1VQ8 A;  1OXX K;  2O5J C;  3DMU A;  2LKV A;  1KD1 C;  5I2X A;  4H0L C;  5DAU A;  2WAQ E;  1JQY D;  2KCT A;  1KHI A;  4JI6 L;  4DV5 Q;  1X6O A;  4NXN L;  4EX5 A;  2Y0S B;  4RFB A;  3S2D H;  1VQJ A;  2C9O A;  1SYE A;  3KF8 B;  5JAV A;  3BS1 A;  1SYB A;  2PQA A;  3IKJ A;  2C35 B;  2F0Q A;  1N33 L;  5I6W A;  2RCN A;  1YIT A;  1S40 A;  2XN9 C;  3PCO B;  3VR6 A;  2P5Z X;  2N3S A;  1VQN A;  4CHT B;  2E2D C;  5ISR A;  1PRT B;  5CR3 A;  3UDG A;  1E2W A;  2K03 A;  1W2B A;  5CV9 A;  2FMC A;  1I94 Q;  3BDC A;  1I3Q B;  1B9M A;  4A3M G;  3PF5 A;  2K5N A;  4JI8 Q;  3T56 B;  3D6C A;  4LFB Q;  3GTO H;  2IX0 A;  2A1A A;  2QF7 A;  1DCZ A;  5C4X H;  1RF2 D;  1PDQ A;  3LGJ A;  2L0C A;  4AH6 A;  1VQB A;  2XRQ D;  3HOV G;  2Z6K A;  4DXF A;  1KTK A;  4EGV A;  2UUA Q;  2TMP A;  1E7Z A;  4C3I B;  2OTL A;  3I4M B;  2NVX B;  2UXB L;  1AN8 A;  3M9B A;  1HR0 L;  3FEW X;  3HOZ H;  4C3H B;  5HGQ A;  1UE6 A;  1HZC A;  2B2U C;  2LFN A;  4C3J H;  5IYD H;  1PZK D;  4A3I G;  4LF7 Q;  5EKL A;  4YHH Q;  4JOI C;  2UXC Q;  2RVL A;  2EXD A;  4L5S A;  1ZXT A;  2EYP A;  5KYL A;  3A74 A;  3BU2 A;  1TQO A;  4CKC A;  3HEJ A;  2KOL A;  2R93 H;  2SNM A;  1HHV A;  2LSS A;  5LMU L;  1F2Z A;  1TS5 A;  4KD4 A;  4LF5 Q;  1ICF B;  1PYB A;  1JJ2 A;  1H9R A;  2V1C C;  2JA8 H;  3K59 A;  3PIO A;  2Q2T A;  3MWY W;  3OMC A;  3STB C;  3FP9 A;  1O7Y A;  3GTG B;  4A3G G;  2IPK D;  3KDF B;  3Q6S A;  3NQI A;  2A8V A;  1HPC A;  3M4Y A;  4KHV A;  2IWH A;  1STH A;  3I4N G;  3M3Y B;  4JBK A;  3ZYY X;  1KQS A;  3DEP A;  1LTA D;  2WKD A;  4LF6 Q;  1YNN D;  2ZXP A;  4JI5 Q;  2PQE A;  3RD4 A;  1C9O A;  1Z47 A;  3CU7 A;  1B4O A;  2E75 C;  3S2D B;  5ELO A;  1D5Z C;  4LF9 Q;  1DJR D;  1LT3 D;  4JV5 L;  4DNT B;  3J81 L;  4ALP A;  2RDH A;  4HSP A;  4IJL A;  4X65 L;  3JAM L;  2OT2 A;  1TWH H;  3G6J B;  4DR3 Q;  4BBS H;  1JOK A;  4A3B H;  5IP9 G;  4JCV E;  3QOL A;  4GKK Q;  1RKN A;  2WB1 B;  1PLF A;  1QOH A;  1A2U A;  3GTO B;  3K0X A;  1SAP A;  4DKA C;  4HJ5 A;  4UP8 A;  1WD1 A;  3IAY A;  1IBM L;  5C4X B;  2JJQ A;  2B2V C;  4A3J G;  3G7L A;  3T1Y L;  4H7B A;  2H1E A;  2KUM A;  2Q8T A;  3A7A B;  3G4S A;  4K0K L;  2ZTC A;  1A6X A;  2EZV A;  1MJE A;  5CYU A;  3OW2 A;  4A3K G;  4RGT A;  4FF3 A;  3X3N A;  1UE1 A;  1EIF A;  3HOZ B;  3LWE A;  4MN3 A;  5AFW A;  1X3G A;  3TSS A;  4C3J B;  1DZ1 A;  4NP5 A;  3PIP A;  4OO1 G;  1K8G A;  1KAA A;  2RKS A;  1F77 A;  5K36 H;  5IWA Q;  1PVO A;  1CQV A;  1N9W A;  1XMO L;  3J81 E;  1I6V C;  1EOT A;  1M4V A; 
#chains in the Genus database with same CATH homology
 2E74 C;  1HA6 A;  3I3C A;  3JAM E;  2JA8 B;  1VF5 C;  1SE3 A;  1BCP F;  5IGB A;  2ENB A;  1M8A A;  4IZ8 A;  3S1Q B;  2GA4 B;  5C4Z A;  3HKZ B;  5D14 A;  3TZD A;  4KN4 C;  1CI3 M;  3KK7 A;  4HTH A;  4XQN A;  5EGT A;  3MFG A;  1YNN C;  4XYO A;  3K5O A;  2PZT A;  1TWG B;  1EZ6 A;  5C3W A;  1LLR D;  1EEI D;  5FOB B;  3VR3 A;  2B2T A;  1EWC A;  3D4D A;  1WTV A;  4DA2 A;  1QJO A;  2AQ1 B;  5CV6 A;  4BBS B;  4A3B B;  2F0I A;  4HSV A;  4G7O C;  4E6I A;  1SE2 A;  4QMG A;  1Q1B A;  4DFA A;  3MFY A;  4JBW A;  1TS2 A;  1HQR D;  3MEH A;  3K5L A;  1EEF D;  3MXU A;  1HA5 A;  1VMP A;  2V4D A;  3D4W A;  1HFN A;  4DAY A;  2K7V A;  4IUR A;  1WTX A;  1PRT F;  3S16 B;  3LWU A;  1LTB D;  2HCI A;  1OXU A;  2F0M A;  1F9P A;  4LAA A;  2B2Y A;  1B3A A;  2NB0 A;  1EY7 A;  5CV8 A;  3QB3 A;  1ML0 D;  1ZYR C;  3S1N B;  2Q8I B;  4ZQ3 A;  1J8I A;  3P20 A;  3TDQ A;  4KJO A;  1G29 1;  2EYJ A;  1X3Q A;  2EJG C;  4HN7 A;  4BY7 B;  4AYB B;  1PFN A;  2FFK B;  5KRU A;  1JWS D;  1F9Q A;  5LHY 1;  1QCB D;  5E4X A;  1B53 A;  1XYI A;  3M7G A;  3NWT A;  4DXG A;  1H9K A;  1CZW A;  4EVO A;  3K6O A;  5D3D A;  2F4I A;  2F0U A;  2M00 A;  3IFD A;  1TS3 A;  2QDB A;  2N55 A;  2PCF B;  5ELF A;  2VNU D;  1D5X C;  3S14 B;  4ZUJ A;  2R7Z B;  4LMQ D;  1WTR A;  4FF2 A;  2F0L A;  3MAQ A;  2DY8 A;  4O1N A;  2F0D A;  1PXU A;  3FDT A;  4G4K A;  2NVT B;  1VDZ A;  3NWS A;  1SYC A;  2ZXR A;  5BN4 A;  1WTO A;  5M9O A;  4CKE A;  3I73 A;  3NUC A;  1EU4 A;  1K83 B;  3HOY B;  3X3M A;  4ZYS A;  1CM9 A;  3FKI B;  4P2C B;  4PV1 C;  3FPU B;  2EY2 A;  4BBR B;  1AFP A;  2EDG A;  1R4Q B;  1T5E A;  5G3L F;  1FD7 D;  1BCP C;  2F0S A;  3GQB A;  5J39 A;  3Q0A A;  2ZT9 C;  2XNA C;  3F2U A;  2K04 A;  3IL8 A;  3H3V C;  2D5D A;  4PMB A;  3PIP 3;  2EYO A;  4A3D B;  3A8K E;  2F0G A;  2Z4H A;  1G8Z D;  5ELB A;  1Y8O B;  2VB3 X;  2R6G A;  4Y7N B;  3BVM A;  2XSC A;  3T51 B;  2CW0 C;  2J0T D;  2PNR C;  1DXM A;  3N52 A;  1NAP A;  4KD3 A;  2YU9 B;  5IGC A;  1O80 A;  4K2K A;  4DAV A;  1TT2 A;  2IW3 A;  1I4G A;  5COY A;  4PMW A;  1TII D;  1JWU D;  1PRT C;  2A69 C;  3M85 A;  2EYH A;  4Q5V A;  1GUG A;  1EY5 A;  3QIA A;  2EPB A;  1T5X D;  5JEA G;  3C46 A;  1EIH A;  1XTC D;  4EQO A;  3QJY A;  4K8I A;  2K05 A;  4UDU C;  4A3M B;  1JIC A;  1DD2 A;  2SNS A;  4OIK A;  1CFM A;  1V1P A;  2X6L A;  4OIJ A;  4QF4 A;  1DOL A;  2F0K A;  2K01 A;  3PV0 A;  1KDA A;  4ZAI A;  3HOV B;  2NN6 G;  2K5Q A;  1WTW A;  2ICE C;  1PZI D;  1ESR A;  4CKB A;  1RD9 D;  4ZK9 B;  5M5X B;  4ZKC B;  4OO1 H;  5EKI A;  4L8J A;  3OIQ A;  5HUR A;  4RAU C;  1X3P A;  3MHB A;  5C0X G;  5J1Z A;  2BE5 D;  5JVH 3;  3T13 A;  4BS9 A;  1WVL A;  5ELC A;  3A56 A;  1V43 A;  1VMC A;  1RHP A;  4JK1 C;  2WP8 J;  2B39 A;  4ZRZ A;  4RCO A;  2L9H A;  2RDF A;  2XRS D;  4RKB A;  3V05 A;  3BZD B;  4XTC S;  3O13 A;  1WTP A;  1TS4 A;  2PW7 A;  3I90 A;  3TN2 A;  4HMJ A;  1DM0 B;  2VXW A;  5DEH A;  1Q8I A;  5M3F B;  1O7L A;  3IFT A;  2B2W C;  4IFD G;  3FMC A;  4IUV A;  3J80 L;  2WII B;  5EKK A;  3NXW A;  3BVG A;  3URY A;  4OO1 I;  4EQP A;  3QO2 A;  1EYD A;  2HCC A;  3C2P A;  4A3J B;  5IIF A;  3QG1 A;  5CV4 A;  2NWG A;  1F9S A;  1DOK A;  5FK9 C;  3M7N A;  2RA4 A;  1Q90 A;  3R8B A;  2HDM A;  2MPM A;  3J7A V;  4NKL A;  3GTQ B;  3QWN A;  1Z7T A;  2IJ0 A;  3KLS X;  2CQA A;  3A8J E;  3OMG A;  5I9O A;  1CHP D;  4OGQ C;  4ID6 A;  2L1B A;  4K14 A;  5T1I A;  2DY7 A;  1PFM A;  4KI0 A;  3J80 E;  1Q1E A;  4KV6 A;  2BE5 C;  1OXV A;  5BN3 A;  4BA1 I;  2X69 A;  2AUJ D;  4CJ2 C;  4R9W A;  1A2T A;  1S5C D;  1PYW D;  5JVG 3;  2LY7 A;  3TP7 A;  4EQN A;  4M1U B;  1W6K A;  3PUZ A;  5IT9 L;  3AMU A;  2BDO A;  1VCI A;  5KIX A;  1JOQ A;  3L3O C;  1XWE A;  4H44 C;  5IGD A;  4C1N I;  1Z6H A;  1D1I A;  3E5S A;  4HCS A;  3HOW B;  4F88 A;  2BDN A;  4XQJ A;  5DM7 3;  1SYF A;  1X32 A;  1KNA A;  1FGB D;  2WAC A;  3VR5 A;  1QG7 A;  1LT6 D;  2MUY A;  1HUM A;  3K0Y A;  3KLR A;  3K57 A;  5J22 A;  5I9P A;  2MHV A;  2A6E D;  1JCK B;  1U4M A;  1G6Z A;  2PPB C;  2WIN B;  1FNW A;  1QE6 A;  4OHJ A;  1BNZ A;  3H6M A;  1ENF A;  1I4P A;  3S15 B;  2A6H D;  1GUW A;  3SK6 A;  5D65 A;  1YNJ D;  1NCV A;  4FF4 A;  2K33 A;  5IT9 E;  4WJW A;  5CV5 A;  5IOD A;  2K6A A;  3FVQ A;  4X3T A;  1Y1W B;  3W2D A;  4KY6 A;  2I46 A;  1BUV T;  4V19 0;  5CC4 A;  1C8C A;  5I4D A;  1STN A;  3R2I A;  3PUX A;  3KBG A;  3OIP A;  1L0X B;  4J1M A;  1MSH A;  4XXE A;  1E2Z A;  4ME5 A;  4Z9C B;  5IGG A;  2KVM A;  3PUW A;  2D9U A;  3ONA B;  1GHK A;  3DEO A;  4XT3 B;  2BOS A;  3P7J A;  3MC0 B;  5KGU A;  4LJZ C;  4OL7 A;  5C4H A;  3HOX B;  1EL0 A;  3PO2 B;  1LT5 D;  1SE4 A;  1F2M A;  4B9X A;  1GUO A;  1B2T A;  3W3A A;  3HP3 A;  3BVZ A;  3NTI A;  1EQV A;  3T53 B;  4ODG A;  1EZ8 A;  4IUN A;  5JOB A;  3TP6 A;  1AW7 A;  3GP7 A;  3U9S A;  1QB5 D;  2F0H A;  3KBX A;  2A68 D;  2EY5 A;  4UAI A;  1NUC A;  3V96 A;  4QIW B;  4A93 B;  1H9S A;  3S9W A;  2NVY B;  1WTQ A;  3T16 A;  5NUC A;  3MZ5 A;  1LAC A;  3H09 A;  3OWE B;  1SMY D;  1D1K A;  4ILW A;  1I4X A;  3UI2 A;  3J7A F;  1YNJ C;  5C3X A;  1Y8P B;  4KTA A;  2NUC A;  5ELD A;  3OHX C;  1AZP A;  4ABN A;  1XXG A;  4WRD A;  3D6W A;  1GXD C;  1MSG A;  2Z8L A;  2DNC A;  5EQ0 A;  3AU7 A;  4HED A;  3NSW A;  4FF1 A;  3MXN A;  3NTK A;  1Q12 A;  3ND9 A;  1IKL A;  4RHS A;  3R2T A;  4XDX A;  5LL6 S;  3P75 A;  5C44 B;  4FXD A;  4K2L A;  1UUP A;  1TU2 B;  2NVQ B;  4QCL A;  2EYF A;  2IX1 A;  2EYM A;  1ENC A;  2FMM A;  2OXP A;  1I4H A;  3P1H A;  3RUZ A;  1V1P B;  4HMI A;  2JYO A;  5JPM C;  2AWO A;  2KEE A;  1BOS A;  1KNE A;  4N9P A;  1B44 D;  4G7H C;  3QOJ A;  1LTG D;  1A3V A;  4IQZ A;  4WFN 3;  3NP8 A;  1LTT D;  3NBH A;  1AZQ A;  1FYC A;  4F7X A;  1IYU A;  4C56 C;  1S5B D;  2EVB A;  1U4P A;  1EWH A;  1EYA A;  4L63 B;  4FNF A;  2NBF A;  5KNC A;  3RLF A;  4K5X A;  4KY5 A;  1KDC A;  4B9W A;  1OXS C;  5KND A;  1GUN A;  2M9V A;  1JWM D;  1HTL D;  2B2U A;  2A5H A;  1S5D D;  3TBI B;  2X6G A;  2D2C C;  2XVS A;  2K28 A;  3ND8 A;  1IYV A;  5K5P A;  4BY1 B;  1OO9 B;  3SHL A;  1H9J A;  5EPJ A;  2K1B A;  2K5W A;  1QNU A;  1JOO A;  5K36 G;  2JP1 A;  2QEJ C;  1SBB B;  2E2I B;  1SEB D;  4ZUI A;  3MTS A;  1I4R A;  3H94 A;  1WD0 A;  1PZJ D;  4RA8 A;  4IFD I;  3SVM A;  2AQ2 B;  4O42 A;  1A15 A;  3HS0 C;  3WOE A;  2JA5 B;  1PTO D;  5D3I B;  1GUS A;  3R3O A;  1F2L A;  3MVV A;  2R3Z A;  2E2H B;  1ET6 A;  3FRP B;  2F0P A;  1QNK A;  1MD2 D;  2QCP X;  1E0B A;  2K32 A;  3FPP A;  1ESF A;  4C2M B;  3DWQ A;  2M2L A;  3NTH A;  1ENA A;  5E1F A;  4CJ0 B;  4G57 A;  2NYZ D;  4QUC A;  4ZLT F;  1GUT A;  4ZKB B;  4J6H A;  3GV6 A;  4RHR A;  2XIW A;  4M8A A;  2AUK A;  2NTS A;  1SYG A;  4IUT A;  2JEA I;  2B2V A;  2WAQ B;  1BF4 A;  1L0Y B;  1IL8 A;  2LMC B;  3S17 B;  2KJX A;  1HQM C;  1CQF A;  2AQ3 B;  4KKS A;  4QUF A;  3LX0 A;  2F0W A;  1TY0 A;  1Y8N B;  2FIN B;  1SND A;  2SEB D;  1EY8 A;  1STG A;  4IUP A;  5EPL A;  2B2T C;  2XWB B;  1UNS A;  1GOZ A;  3HZX A;  2MJ8 A;  2IT1 A;  1U4L A;  2L12 A;  1RCV D;  5CBE E;  2O5I C;  4CBV A;  5ELE A;  3NHH A;  2QKI C;  1LTI D;  1SNP A;  3KLS A;  1CZG A;  3PUY A;  3U9O A;  2F1M A;  4A3I B;  1OXT A;  2RQX A;  5FO8 B;  3SEB A;  1J9O A;  3EFX D;  1STY A;  3CRK C;  3DHQ A;  4S3S A;  4HAE A;  4I65 A;  1EY4 A;  5FO7 B;  2TSS A;  1MBY A;  2C5C A;  2F0J A;  2B2Y C;  5KYI A;  3T4A C;  4XT1 B;  3GTL B;  1BDO A;  2LS0 1;  4A3G B;  3A54 A;  4MIU A;  3L9A X;  1ZKO A;  2EY1 A;  1SNM A;  1BBX C;  3I4N B;  2F3W A;  4KMU C;  5BN5 A;  1O78 A;  1SDF A;  2A73 B;  2EYL A;  1TVX A;  2FJ2 A;  2DN8 A;  1PTO H;  2KA7 A;  3CRL C;  4XYQ A;  1UAP A;  3E0J A;  1TWC B;  2J4X A;  2A74 C;  2EJM A;  2PMZ B;  1LTR D;  2L55 A;  1H9M A;  1S5E D;  5M5Y B;  3CQZ B;  4TRD A;  4CJ1 B;  3A55 A;  4RCN A;  2F0T A;  4HR7 B;  4RKL A;  1G91 A;  4FVM A;  3H0G B;  4H13 C;  3BDO A;  2G9H D;  4F8M A;  1CA5 A;  1NSN S;  2KED A;  1CK1 A;  4DK0 A;  4CGY B;  2Z1C A;  3VYT A;  4A3K B;  1XX8 A;  4KKU A;  2R61 A;  1ILQ A;  1LTS D;  3I72 A;  1H9S B;  3S1M B;  1VF7 A;  1C4Q A;  3GTM B;  1Y69 U;  4FO2 A;  1V1O A;  5FKA C;  1JB3 A;  3HGB A;  4BWG B;  1SFO B;  1KAB A;  1G2T A;  5FO9 B;  3Q24 A;  5C5M A;  3DXJ C;  2KCN A;  3EVQ A;  1KLU D;  1GJX A;  3PUV A;  1SXT A;  3SK4 A;  4DAP A;  1DYQ A;  1MI2 A;  3C3L A;  1FNU A;  1SSO A;  3EJI A;  3K5M A;  3LNN A;  5C3E B;  4NMZ A;  1JC7 A;  4NW2 A;  5C5L A;  3RZD B;  2JEB I;  1I4Q A;  1PTO B;  2FHT A;  2PW5 A;  2XWJ B;  3TME A;  3CHB D;  2YYZ A;  5JJZ A;  3TZU A;  1EY9 A;  1RTO A;  1LT4 D;  3M4O B;  1HFG A;  2KQ3 A;  5CMD A;  3RZO B;  1LO5 D;  2JA7 B;  5F2D A;  3TP5 A;  2PZU A;  3BDL A;  3SE0 A;  2EOT A;  3L7Z C;  1S4Z A;  2L11 A;  2RBM A;  2L4N A;  4R8I A;  3ERQ A;  2SDF A;  2JXM B;  1I50 B;  2OEO A;  2EY6 A;  4X3U A;  3SXH A;  3V2T A;  3GV3 A;  1EY0 A;  3D3R A;  2MGS A;  4KY7 A;  2QIL A;  4FYD A;  2E2J B;  4IN3 A;  5EJW A;  2F0N A;  2ICI A;  4PNY A;  1Q3L A;  3HRZ C;  1STE A;  5C4J B;  3DWP A;  4C3I G;  1V8Q A;  1SNQ A;  2KEC A;  3EQL C;  4C3H G;  1EQT A;  1ZYR D;  2Q8R E;  3R93 A;  2R93 B;  5EBC A;  3KF8 A;  4K8J A;  1TWA B;  1WCM B;  3GO5 A;  4KHZ A;  5DNF A;  1HCZ A;  1NR2 A;  4U67 3;  5LL6 X;  1AEX A;  2F0V A;  3SK5 A;  1R4P B;  2WKC A;  1TWF B;  1KLG D;  3GD7 A;  2IX3 A;  1D6E C;  2ID0 A;  1IKM A;  4J8Q A;  1W6J A;  1F2Y A;  3AB9 A;  5CV7 A;  1G2S A;  1DON A;  5I2Y A;  4ULL A;  2BA1 A;  1IW7 D;  1E2V A;  4RGO S;  4MHE A;  3D8G A;  2A6E C;  5M5W B;  2ZXO A;  2Z4I A;  1SJH D;  3OOC A;  1II3 A;  3VYR A;  3OWF A;  4IUU A;  1STB A;  2B63 B;  3DWA A;  2A6H C;  3SK8 A;  1HRJ A;  2NZ1 D;  5JEA H;  2CVR A;  2RSN A;  5IGF A;  1TWH B;  3D4R A;  4DF7 A;  2HQE A;  4KJN A;  2J7Z A;  2NTT A;  5EPK A;  1LV9 A;  1ET9 A;  3GTJ B;  5IOC A;  5TSS A;  4FXK C;  2B8F A;  3I4L A;  1C48 A;  5A2Q L;  2BCO A;  4KKT A;  3VYU A;  2NN6 H;  5KNB A;  5E3F A;  4X3S A;  1UEA B;  3NE5 B;  1TR5 A;  5T1G A;  5FLX L;  1BCP D;  1NR4 A;  3ITP A;  4C3J G;  3S2H B;  2AWN A;  2PYK A;  2F3V A;  5C0X H;  1TY2 A;  4K6L A;  2KCC A;  1KDB A;  2MP1 A;  3VA5 A;  1K8O A;  1I6H B;  1LAB A;  3SR1 A;  3C1F A;  1RDP D;  4RH6 A;  1F9R A;  2B2W A;  1HXY D;  3D31 A;  1BQQ T;  4DGZ A;  2A68 C;  4Q0F A;  3N6R A;  4I7Z C;  4G7Z C;  5A2Q E;  5A35 A;  2HDL A;  2PZW A;  1IW7 C;  3DM1 A;  2CW0 D;  4V0B A;  1ILP A;  3E6Z X;  2OF1 A;  3PIO 3;  1DOM A;  2F03 A;  1PTO F;  2NN6 I;  4DNR B;  1B9N A;  1Y1V B;  4IFD H;  5FLX E;  4QB4 A;  1EYC A;  1SMY C;  1D2B A;  3WOF A;  4PQX A;  4TKO B;  1S5F D;  4B08 A;  2HUG A;  2EJF C;  1K8M A;  1PRT D;  2A69 D;  3BG3 A;  2H4O A;  4K5W A;  3K5N A;  4RGN A;  3MXG A;  5C0X I;  3RMH A;  1CTM A;  2JE6 I;  2CHB D;  4GZY C;  1FR3 A;  3A7L A;  3HG9 A;  3I70 A;  1SNO A;  5DM6 3;  2PO4 A;  1EIG A;  3NQT A;  3HOU B;  4LK1 C;  3C1E A;  3ERO A;  3CKI B;  2VUM B;  1RTN A;  1U4R A;  2RSO A;  1SJE D;  4XIG S;  4DU9 A;  1GHJ A;  1MGS A;  5CGK A;  5COR A;  2G9D A;  3OW7 A;  3H91 A;  1EY6 A;  1B50 A;  2O2L D;  3KUP A;  2IL8 A;  3VR4 A;  4KN7 C;  5HGT A;  4X3K A;  2K5D A;  3MA2 B;  5KEE A;  1HUN A;  3NPP A;  3VR2 A;  5JEA J;  4NDX A;  4IUQ A;  2JA6 B;  3K7A B;  4C1N K;  1FNV A;  1IHZ A;  1R9T B;  4K5V A;  1U9R A;  2EE1 A;  4XQQ A;  2EXZ A;  2DNE A;  2JSO A;  2KHS A;  1HTP A;  2SOB A;  4L6T B;  1BR9 A;  4IAL A;  2R92 B;  1CA6 A;  1ONL A;  3I8Z A;  5M3M B;  3I91 A;  5I6Y A;  2E76 C;  4HCE A;  4A3F B;  3PO3 B;  1BO0 A;  1JE4 A;  3NK9 A;  4KK7 A;  1ICW A;  1A3U A;  3GTK B;  2RDG A;  3Q22 A;  3BYT B;  4RGM A;  1D5M C;  3EA6 A;  4DK1 A;  5G3L D;  4FXG C;  2F0F A;  1SYD A;  4U68 A;  1O7Z A;  1QWY A;  5IGE A;  1BXT A;  3TP8 A;  1EU3 A;  5E4W C;  4F87 A;  5C0X J;  2WV6 D;  4RWS C;  4DN4 M;  5CBA E;  1AP0 A;  3WDN A;  3GTP B;  3K58 A;  4BA2 I;  3PMF A;  4WOR A;  5EBD A;  4R8N A;  1QIL A;  2F0E A;  3Q23 A;  1SNC A;  2BA0 A;  3J7Y W;  4YIJ A;  4N9T A;  4K6D A;  1JR0 D;  3DUZ A;  1JOR A;  3BYY B;  2O4X A;  4TSS A;  3OSO A;  4A3E B;  3OPO A;  3VYS A;  1RJT A;  1BCP B;  1PFB A;  2L5T A;  4TQU S;  1PTO C;  2N88 A;  3S1R B;  1PMR A;  2B8G A;  3SDZ A;  1TKW B;  4IFD J;  3MXP A;  2I07 B;  4FP5 D;  1ROD A;  1A3T A;  3NBI A;  4PMC A;  5JPN C;  3A8I E;  1CT1 D;  1EFI D;  1B1Z A;  2F0O A;  1ZEQ X;  2VB2 X;  5C6A A;  1CHQ D;  2D62 A;  3VA7 A;  1STA A;  1OXX K;  2O5J C;  3DMU A;  2LKV A;  5I2X A;  4H0L C;  5DAU A;  1JQY D;  2Y0S B;  4RFB A;  2C9O A;  1SYE A;  5JAV A;  3BS1 A;  1SYB A;  3IKJ A;  2F0Q A;  5I6W A;  2XN9 C;  3VR6 A;  4CHT B;  2E2D C;  5ISR A;  1PRT B;  5CR3 A;  1E2W A;  2K03 A;  5CV9 A;  2FMC A;  3BDC A;  1I3Q B;  1B9M A;  3T56 B;  3D6C A;  2IX0 A;  2QF7 A;  1DCZ A;  1RF2 D;  1PDQ A;  2L0C A;  2XRQ D;  4DXF A;  1KTK A;  4EGV A;  3I4M B;  2TMP A;  2NVX B;  4C3I B;  1AN8 A;  3FEW X;  4C3H B;  2B2U C;  2LFN A;  1PZK D;  5EKL A;  2RVL A;  1ZXT A;  2EYP A;  5KYL A;  4CKC A;  1TQO A;  3HEJ A;  2KOL A;  2SNM A;  1HHV A;  1F2Z A;  1TS5 A;  4KD4 A;  1H9R A;  3K59 A;  3MWY W;  3OMC A;  1O7Y A;  3GTG B;  2IPK D;  3Q6S A;  3NQI A;  1HPC A;  3M4Y A;  4KHV A;  2IWH A;  1STH A;  3M3Y B;  3ZYY X;  3DEP A;  1LTA D;  2WKD A;  1YNN D;  2ZXP A;  2PQE A;  3RD4 A;  1Z47 A;  3CU7 A;  1B4O A;  2E75 C;  3S2D B;  1D5Z C;  1DJR D;  1LT3 D;  4DNT B;  3J81 L;  2RDH A;  4HSP A;  3JAM L;  2OT2 A;  3G6J B;  1JOK A;  3QOL A;  1RKN A;  2WB1 B;  1PLF A;  1QOH A;  1A2U A;  3GTO B;  1SAP A;  1WD1 A;  3IAY A;  5C4X B;  2B2V C;  3G7L A;  4H7B A;  2H1E A;  2KUM A;  2Q8T A;  3A7A B;  1A6X A;  2EZV A;  5CYU A;  4RGT A;  4FF3 A;  3X3N A;  3HOZ B;  3LWE A;  4MN3 A;  5AFW A;  3TSS A;  4C3J B;  1DZ1 A;  4NP5 A;  4OO1 G;  1KAA A;  2RKS A;  1F77 A;  5K36 H;  1CQV A;  3J81 E;  1I6V C;  1EOT A;  1M4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...