3BDCA

Crystal structure of staphylococcal nuclease variant delta+phs at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Molecular determinants of the pK(a) values of Asp and Glu residues in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bdcA00
4F8MA 4ODGA 1TT2A 2EYJA 4J1MA 1KAAA 2EYHA 1SNDA 1F2MA 1SYDA 1STAA 1EQVA 4ME5A 3BDLA 4RKBA 2OXPA 4OL7A 4ZUJA 1JOKA 1SYEA 4NMZA 3SXHA 5I9PA 2PW5A 3TMEA 2EXZA 4WORA 4KHVA 2M00A 4F7XA 2F0GA 3HZXA 3OMGA 4KY6A 4DFAA 3NP8A 1EY5A 1JOOA 3ITPA 2F0SA 5I6YA 4HTHA 2NUCA 4K8IA 5NUCA 4J6HA 4NKLA 4WRDA 4NP5A 5IGEA 1SNCA 4K5VA 5C5MA 5ISRA 3EJIA 4HMJA 4N9PA 3E5SA 1SNOA 4EQNA 1A2TA 3SK6A 2RBMA 4KY5A 5C3XA 2F0KA 5KGUA 1EY6A 5EKLA 4K6DA 2F0UA 3P1HA 1EYDA 3HEJA 4I65A 1EY8A 2EYLA 5CV6A 1TQOA 5IGGA 2F0PA 2F3VA 5C6AA 4DF7A 3SK5A 2F0FA 4KY7A 4ZQ3A 1EY7A 2EY5A 5IODA 5CV9A 4K14A 5E1FA 5KRUA 2F0HA 5CV8A 2EY1A 3T13A 2PW7A 3MHBA 4K5WA 2HQEA 1A3TA 1SNPA 1NSNS 3D6CA 4EQOA 4ZUIA 5JAVA 1STGA 2F3WA 2QDBA 1EYCA 2F0JA 2F0QA 5HURA 5I6WA 2RKSA 4RKLA 3P75A 2O4XA 4EQPA 1EY0A 1STNA 1KABA 2F0TA 5EKKA 3SHLA 4LAAA 5HGTA 2EY6A 2PQEA 4TRDA 1JORA 5IIFA 5M9OA 1ENCA 3LX0A 3QB3A 4K8JA 2OEOA 3TP7A 4PNYA 1STBA 4PMBA 5F2DA 1EY4A 3OSOA 5CC4A 2F0MA 5I9OA 4K2KA 4IUNA 4PMCA 3D4DA 1TR5A 1A3UA 2RDFA 3DMUA 3MEHA 3R3OA 3V2TA 3VA5A 4B9WA 2ENBA 3NXWA 3QOJA 2EYMA 1SYFA 5CV7A 3NQTA 1EY9A 2PZUA 4B9XA 1JOQA 5J1ZA 4G57A 2PZTA 2F0DA 2F0LA 5IOCA 3NHHA 5IGCA 4DU9A 1A2UA 1U9RA 5CV5A 3SR1A 4E6IA 5C4HA 5IGBA 4KV6A 1IHZA 2F0NA 3SK4A 3TP8A 1KDCA 4EVOA 4S3SA 5IGDA 4KD3A 2F0VA 3DHQA 1KDBA 4HMIA 2EYFA 1II3A 2F0IA 3ERQA 3EVQA 4IALA 4N9TA 4QMGA 1NUCA 5C5LA 4K5XA 5CV4A 3EROA 3MVVA 4IZ8A 3H6MA 3BDCA 5KEEA 3QOLA 5KIXA 3S9WA 5DEHA 3MXPA 2WACA 4ID6A 2EYPA 1A3VA 1EYAA 1SYCA 4KD4A 4NDXA 3RUZA 4R8NA 4MIUA 5J22A 4YIJA 5KYLA 3TP6A 3PMFA 3OWFA 5C3WA 1KDAA 1SNQA 1SYGA 1SYBA 3MZ5A 4KTAA 5C4ZA 4DGZA 3NK9A 5CGKA 2F0WA 4K2LA 2KQ3A 5E3FA 5KYIA 3OMCA 5K5PA 1EZ6A 3C1FA 4KJOA 1RKNA 4QB4A 2OF1A 5DAUA 5JOBA 2F0EA 2PZWA 3SK8A 3TP5A 4H7BA 1AEXA 4QF4A 5J39A 5CR3A 1F2YA 2PYKA 1SNMA 2SNSA 3D4WA 4KJNA 3NUCA 2KHSA 2LKVA 1ENAA 1STYA 5IGFA 2EYOA 2F0OA 1EZ8A 3C1EA 3D8GA 1STHA 2SNMA 3U9OA 1F2ZA 2EY2A 2SOBA 3T16A 5EGTA
chains in the Genus database with same CATH superfamily
3VYRA 3CW2C 4LFBQ 1G2TA 1MGSA 1MD2D 3MC0B 1EQVA 1PH5A 1GUOA 1GOZA 1TY0A 1JJGA 5EQ0A 1JWMD 4L5RC 3OWEB 4NXNL 3GP7A 5BN4A 4Z9CB 1R4QB 2K5WA 1SBBB 1TWGB 4XQNA 4LNQA 1JB7A 3FEWX 4IOAA 2UXBL 3K7AB 3CRLC 3M4OH 3EJIA 5ELNA 2F0KA 5EKLA 3STBD 3N6RA 4RFBA 3J7A5 2EYLA 1O7LA 1IYUA 4GLXA 3KF6B 3UDIA 1NY4A 2GVBA 4C3JH 4RHSA 2EY5A 2F0HA 1ZKOA 3NBHB 3BYTB 1IXRA 2WV6D 4X3TA 1NSNS 3W1GA 1EFWA 4ZUIA 3PUZA 3J81E 5K36H 3TZUA 1SE4A 4LAAA 3SHLA 2B63H 1RDPD 2KCCA 1KD1C 1FJGL 4JI7Q 3K5OA 2AMCB 4CDDC 3OSOA 3KLWA 1N33Q 2AKWB 2AWNA 4DAMA 3VA5A 1K0RA 3U50C 3KUPA 1SMXA 3IL8A 1T5XD 1Q82C 1PZJD 4LF4L 4QJFA 4FF3A 1SE3A 3CHBD 5K36G 5ELEA 2BA0A 3DEPA 5IGDA 4AIMA 4HIOA 4JBWA 2B63G 4KD3A 3I4NB 1LTID 2KBNA 2A74C 1S4ZA 4HCSA 4KK7A 4QMGA 2JN4A 5CV4A 2QA4A 5AFWA 3CC2A 3M4PA 5KIXA 3VA7A 3S1RH 1EYAA 3TS2A 5A35A 1EIHA 3BDOA 4A3CH 2WIIB 5IY0A 3TS0A 1T5EA 3NBIA 2YYZA 3ERSX 3GO5A 5E3FA 3OMCA 1Q1BA 1EWHA 4H7BA 4WJ3M 2GA4B 2KUMA 4YHHQ 3NUCA 1PFSA 1JE5A 4R8IA 5LL6S 1EUJA 1ESFA 4C3IH 1I4QA 1NE3A 3D8GA 4B08A 5LMUQ 1F2ZA 4J8QA 2E2IB 2EQSA 3E9IA 2B8GA 4HCEA 4DR1Q 2HT1A 5C3EB 5M5WB 1G8ZD 1RF2D 2DGYA 3DLLA 2BCOA 1ET6A 2R93B 3N52A 1HA5A 2LSSA 4RGNA 3DUZA 4GOPC 3NP8A 1QUQB 1I4HA 2ZTCA 4C3IG 1PRTC 3T1HL 1ET9A 1TS5A 2B2UC 4C1NK 3HOWG 1AN8A 4NXNQ 3TRZA 3QJYA 2DUDA 3IFDA 2NBFA 2UXBQ 1EU3A 2Z6KA 3AQQA 1TQOA 2F0PA 2UUAL 4R4CA 4ZLTF 4A3KG 4LWCA 2O2LD 5CV9A 5E1FA 3CXCA 5M3MB 4KN7C 4LF8L 1K0SA 2L55A 1L0WA 3HOVH 3ND8A 1DONA 5GADC 2LY7A 2VXWA 1YNND 1B3AA 2VUMG 2JXMB 1TS4A 1OTCA 5IWAL 1S5BD 1DM0B 1FL0A 2OEOA 3E9HA 4DAPA 1B70B 3OIPA 2EPBA 3GDEA 5I9OA 3R3OA 4CDEC 1PYWD 2Z4HA 2EYMA 4P75A 3U9SA 3H15A 2FMMA 3HOVG 2J7ZA 4QIWB 3J80c 2OWOA 2DJFC 1QILA 1Q46A 1WTOA 3JAME 4KMUC 1UE5A 3TQYA 1Y1WB 1HNWQ 1QNKA 5DM63 3MVVA 2BE5C 1X3EA 4DR4Q 5IT9L 3AEVA 2Z9HA 3I4NH 5D65A 2RCNA 1ASZA 2A6ED 1E0BA 2EOTA 3Q23A 2A68C 4GLVB 2B8FA 3OOCA 4A3JG 3GTJH 2KCMA 1B8AA 2NTSA 1FVIA 1DOKA 3HOZG 1IW7D 2ZXRA 1H9RA 4QB4A 4IO9A 1CTMA 3SK8A 3G6EA 4CJ0B 5CR3A 3EQLC 2JYOA 4GOPB 3A5UA 4JYAL 1STYA 2YTVA 1H9SA 1PRTB 5IGFA 4DAVA 3C1EA 2L4NA 3I4OA 4A3BB 1CUKA 1SNDA 1PH1A 2QF7A 3NWSA 3CC4A 1M1KC 4GKJQ 1TWAB 2G5DA 2R7ZB 4I7ZC 3IKJA 2B2YC 2IHFA 3HOXB 5C3EH 2GN5A 3F2CA 4NKLA 5IGEA 1GUNA 5ISRA 2R93H 1SN8A 1Z7TA 2RBMA 3MXGA 4C3HH 1J5EL 5KGUA 1JWUD 3KFUA 3JC66 4QUCA 1EOTA 4BXXG 3CF5A 3HEJA 1VQJA 3I70A 1U4MA 4DK3C 1F9PA 1HNXL 2WP8J 1VQ8A 3KBGA 1SRUA 4NPSA 3T1YQ 3S1NB 3A8JE 1Y1VB 2MPMA 3PUXA 4LF9L 5EBDA 3AYHB 5D3IB 2L0CA 3MXNB 1YHQA 2F0JA 4X62Q 1BVSA 4CKBA 1V9PA 4XQQA 3CC7A 4C3HG 5HGTA 5IIFA 5JJIA 5BN5A 4DV1L 1XTDA 5F2DA 3CMAA 1QB5D 5CC4A 1XNRL 3V2TA 1D5MC 1VQCA 2NN6G 1WTHA 2LS01 3PV0A 5IWAQ 2KVMA 3FKIG 3MTSA 4RGOS 2UUCQ 4FDBA 1N36L 1A2UA 5CV5A 4BBSB 2F52A 3IAYA 2B39A 4R4OA 2UXCQ 2K28A 4OX9L 1U5KA 2KA7A 3KOJA 4PG3A 4ZKBB 1BCPC 2FXQA 3S1MB 1TWFB 2I0QA 1D5XC 1K83H 1OXXK 3FRPB 1CSPA 3BVGA 4YCUA 1LACA 1Y1WH 2ZM6L 1SYGA 2J4XA 4R9WA 2F0WA 5FO7B 2UUBL 3PUWA 5EPLA 3KLRA 5I2XA 4DV0L 4P2CB 1BUVT 1BXTA 3EFXD 1EWCA 5GROA 1D8LA 1C7YA 1RL2A 4RHRA 1G51A 1EZ8A 3H09A 5JPMC 5I4DA 3F2BA 1XNQL 4ODGA 1NR4A 1EU4A 1F2MA 4ME5A 4JV5L 1QVCA 2NTTA 2JA8B 2PW5A 3U4VA 3FVQA 5IYBG 2F0GA 2EZVA 3OMGA 3A8IE 4HJAA 3SEBA 1PH3A 2Q2TA 1PRTD 2LMCB 4IUVA 3HOUB 3J7AF 2N3SA 4CDFC 5JEAG 1PH6A 1CM9A 4JI6L 2E2HB 2O5IC 2KHJA 1YHBA 3NQIA 3RN2A 5GAGC 1JWSD 4QUFA 4MN3A 4LMQD 2XVSA 2PI2A 4IFDG 4A75A 2NYZD 2L12A 3PIPA 4IPGA 2IX0A 5EAYA 1J5EQ 5IODA 2EY1A 1D2BA 4L5TA 1B3QA 4RG1A 4EQOA 2R7DA 2BA1A 2QILA 2KJXA 3Q24A 3S1NH 3I4MH 1STEA 1Y1VH 4OHJA 2K4KA 1X3QA 2PMZB 3J80L 4LF9Q 2E76C 1BCPB 3QB3A 5IYDG 2K5QA 4X65L 1EY4A 4YWKA 1MI2A 5GAHC 2VQEL 4IUNA 4B9WA 2BH8A 3IFTA 5FLXE 4IURA 3CMEA 3T4AC 3RR5A 3ND9A 4QCLA 1JCKB 1GJXA 2VZAA 2KHIA 4DV1Q 3G48A 1XPOA 1RCVD 3HRZC 1QJOA 3KDFB 4A3FH 1I4RA 1O80A 1S3OA 1XNRQ 5C0XH 2DNEA 3I4MG 2RDGA 5M5YB 1D6EC 3SK4A 4HJ5A 2E5LQ 4P71A 3AFQA 3E6ZX 3OHXC 1Z6HA 4U68A 4ZRZA 1K9MC 4LF6L 3SGIA 3WDNA 4IUTA 3EROA 4X6AH 3QOLA 1A15A 2A6HC 2A68D 1XYIA 1K28A 4A3FG 3NK9A 2B2TA 5C0XG 3M9BA 1Q81C 1YI2A 3GTLB 5DAUA 1NR2A 2A1AA 2ZM6Q 2CVRA 2K01A 2PQAA 3EN2A 3GTQB 2WB1G 1HCZA 2SNSA 3NTKA 3R2IA 4KKUA 4DR7L 1KHIA 2IHEA 4XT1B 5I2YA 4CJ2C 5C0XI 3U9OA 1HA6A 4ZYSA 3J7AV 2BOSA 4YWMA 1WD0A 2NZOA 1QNUA 4IPDA 2RCFA 5E7NA 1KNEA 1H95A 4LUZA 3RLOA 3ITPA 1WFQA 2ASBA 2JA8H 1L0XB 2Z1CA 3CCJA 1BBXC 3K0XA 1KLGD 2ZTDA 1CKNB 4RCNA 3I8ZA 2Z4IA 1EY6A 3C46A 4KHPL 1Y8PB 2R7FA 3NTIA 3E0JA 1HTLD 5KRUA 3L3OC 1YEZA 1LTRD 1QVGA 1SNPA 1OXSC 2YV5A 1X54A 1HR0L 2RKSA 1L1OA 4G4KA 4TRDA 1IL2A 1ENCA 4LF7Q 2JA6G 4N8X1 3TP7A 4POFA 4PNYA 1VDZA 1LUZA 4GN3B 2M2LA 2RSOA 4JBMA 5IE8A 4DV6L 1TS3A 3R2TA 1JOQA 1I5FA 1LTTD 2B2VA 2KEDA 2K6AA 1CHQD 1B2TA 4A3EG 4DAYA 3S1QB 2B63B 1F9QA 2Z8LA 2OQ0A 1YBYA 1X3GA 3RLFA 1Q8IA 3I7FA 2ZTEA 5M5YH 3F2DA 2AWOA 2K5DA 5DM73 2HUGA 1IBLQ 3CD6A 2ES2A 1MSHA 1KDAA 1IL8A 1SYBA 2JSOA 1BQQT 1A6XA 5K5PA 1HPCA 1VCIA 4B3TQ 1WCMG 1GKHA 1RHPA 3ULJA 2HHHL 2I5HA 4DXFA 1M90C 4BA1I 3GTLH 2HCIA 2N55A 3QR8A 3A56A 1VQOA 2JQOA 1EWIA 1E1OA 4B3ML 3HFZB 1G6PA 5EGTA 3PIO3 4F8MA 1DZ1A 1E1TA 3Q22A 3A8KE 1SYDA 4IQZA 2N88A 1STAA 1PTOD 1RODA 4BBRG 3NTHA 3CCRA 1VQBA 1CK1A 1K8MA 3K57A 4JI0L 2HDLA 1VQAA 1RTNA 2NVYB 4C3IB 1EQTA 4QY7A 4FF2A 1U4RA 1XMOL 3S2HB 3HOWB 3RD4A 3ULLA 3RNUA 3J81j 1GXDC 4N9PA 4LFAL 2K33A 1RJTA 3UE0A 2CH4A 5FLMH 4C1NI 5IT9E 3GV6A 2G9HD 2QGQA 1UE1A 4HSVA 2A69C 1M8AA 1GUTA 4X64L 1B53A 1A8VA 2NB0A 2PO4A 4X66L 2VUMB 1LT4D 1EY0A 3HKZG 4RA8A 1LT3D 2K1BA 5C44H 4GKKQ 1I94Q 2QDLA 3WOEA 1JMCA 5BR8L 1WTVA 1HR0Q 5FLMG 2EJMA 2RDFA 5GQOA 5D14A 1CZWA 4JI1L 3H3VC 1ZYRD 2ZXOA 4H13C 3CCEA 4UDUC 4A3IG 1EY9A 3HOVB 1VQ9A 3NHHA 2RHQB 3SR1A 4JI5L 4DV6Q 3QO2A 4KKTA 2QCPX 5C44G 1CA5A 1CZGA 1F9RA 2Z6KC 3GTOH 1ESRA 3S17B 1DGSA 1OXVA 1LTGD 1NAPA 4IALA 5LL6X 5KNBA 3S1QH 3HOYH 3M7NA 3H6MA 1IBML 1DOMA 1F77A 3NSWA 3ZYYX 4A3JB 4X3SA 3J81c 2FFKB 4F87A 1QE6A 1AFPA 1D5ZC 2IPKD 1IBKL 3HOZB 5CGKA 3PUVA 1BF4A 1WVLA 2P5ZX 3I72A 2OT2A 1SDFA 3DWAA 3DXJC 5E4WC 2F0EA 1J8IA 3MFYA 3TZDA 2E2JH 1HFGA 3NBHA 1JR0D 5M3FG 4KJNA 4C2MB 4DR5Q 1X32A 3HOYG 2LKVA 1EEFD 2IY5B 3D31A 3E3XA 5FK9C 1VF5C 4ZCKA 4FYDA 3GTJB 3RZDB 2UXDL 1VMCA 2DNCA 2WB1E 4J1MA 2NZ1D 1QG7A 1HUNA 3A7AB 2QKIC 3R8BA 1N34Q 4LF5Q 3D6WA 3CRKC 1ASYA 1VQFA 2WKDA 3QIAA 4K8IA 5NUCA 3V96A 2MJ8A 4WRDA 4QGUA 3X3NA 1X65A 4RWSC 4G7ZC 2NVYH 1FGUA 3ONAB 1IKMA 2PNRC 2EXDA 2EE1A 4RGTA 3RMHA 1HTPA 2F0UA 3S2HH 3HOWH 1EY8A 5IGGA 1LABA 2ZT9C 2CW0C 4PZ8A 3BVMA 4DF7A 2VL6A 2NVTB 3W5OA 1SSOA 1KQSA 4A3KH 5FO8B 1GD7A 2CWPA 4C3HB 2JA7H 5ELDA 4P74A 1B4OA 1HRJA 1PXUA 1AP0A 2WKCA 4JI3L 1H9MA 1STBA 4UP8A 4GN4B 2VUMH 2H4OA 3FKIB 2PI2E 1ILQA 4N8FA 1B1ZA 2K5VA 4IUUA 2JA7G 4JI1Q 2L9HA 2KCNA 1YZ6A 1LTLA 2K5HA 2MP1A 1J6QA 2XTIA 3DHQA 2A19A 1QUQA 2RVLA 3HGBA 4AYBG 3GTPH 4CJ1B 4UHVA 4JI5Q 2WACA 4KD4A 3S17H 1KNAA 3Q6SA 5KYLA 4DV2L 1CA6A 3K58A 4DR3L 4EX5A 2L15A 1UAPA 1Q86C 1FJGQ 3ICEA 1IBMQ 4DA2A 4A3JH 1PRTF 1SMYD 4DR6L 3R93A 3HOZH 4A3GH 3PQIA 1YNJC 2R61A 1IBKQ 1LTBD 2VS1A 2KHSA 3BU2A 1K83B 4QQBX 1FNWA 4J15A 3D0FA 4LF4Q 3DM1A 1XWEA 2EY2A 1K3BC 4C2MH 3S24A 3VYTA 1S5CD 2VY3A 3KK7A 4OL7A 3JAMc 3RZDH 4H44C 3HS0C 1H9SB 4A3GG 5T1GA 3HZXA 1ML0D 1JQYD 5EPJA 1HNZL 3CCLA 1A63A 1Q3LA 2XIWA 4DV7L 4DUZL 1K8OA 3SK6A 1WJJA 4KY5A 1AE3A 4PZ7A 3Q0AA 3PO3G 4JBKA 2X6GA 3P1HA 4MHEA 2I5LX 1R9TH 4BXXH 4A3MG 4A3DH 1BBWA 1PFBA 2K7VA 2CHBD 4H0LC 5C4XH 4H02A 2R92H 4K5WA 2DJGC 4ABNA 3MAQA 3NENA 1PZKD 3H3VH 2F4IA 1EYCA 3K5NA 3VR3A 4G7HC 2NVTH 4BS9A 4EQPA 3CPWA 2K05A 1K3RA 4JI4L 4K0KL 4OWTB 3LX0A 1VQLA 3L7ZC 4PMBA 2XRSD 2FJ2A 3M85A 3LGJA 4A3DG 3QG1A 3T1HQ 3HKZE 5C4XG 1DOLA 2R92G 3PO2G 2F0DA 3I4MB 5IGCA 4A3LH 2NN6H 3J81L 1VMPA 3X3MA 5LMNL 1C48A 4XTCS 3U4ZA 1IHZA 3FKIH 2D5DA 1N8RC 1VQHA 2E8GA 4BWGB 2UUAQ 5EPKA 2F4VL 1KDBA 1L2FA 2JE6I 1II3A 2XNAC 3ERQA 3EVQA 2Q2UA 1ILPA 4JOIC 4LF8Q 3KJOA 4Y7NB 1FGBD 4MNOA 3H3VI 4DUYL 4A3FB 2K03A 1SROA 4DNIA 3OPOA 3OWFA 4TQUS 4CBVA 4A3LG 2AQ1B 3L2PA 1YHAA 2KQ3A 4WJ4A 1S5DD 2ICEC 2QEJC 2WB1B 2PZWA 2MFIA 3TP5A 2WINB 5CMDA 5J39A 1PDQA 2EJFC 1EQRA 1SXTA 4AQYL 3I91A 1OXTA 4OIJA 3MXNA 4XIGS 3J80i 4MZ9A 2NN6I 4L8JA 5D3DA 5IYCH 1XMQL 1G2SA 1MHWC 1LT5D 1GVPA 4XT3B 2WAQG 3RLNA 1SLJA 2AQ3B 2CCZA 1Z9FA 2Y0SG 2EXZA 5CBAE 2JJQA 2TMPA 1ZEQX 1I6HH 4OIKA 1QWYA 1W3SA 5ELOA 1CT1D 4HJ9A 5IYBH 1LM0A 4HTHA 4O42A 4DKAC 2KOLA 2ZJPA 4HMJA 5IYCG 1K8AC 3NE5B 4EQNA 2B2TC 3DM3A 5JEAH 4AH6A 3FHWA 4R1JA 1MSGA 4JYAQ 1GO3E 2B2WA 3GTGB 3VYUA 4IFDH 1LO5D 1SAPA 4LJZC 4KKSA 2I07B 4L5SA 1AE2A 1PV4A 1E2WA 4JPBW 2ZJQA 3KJPA 2A5HA 2F0QA 2L1BA 4HAEA 2JA6B 1D1KA 2CKZB 1VQDA 1BBUA 1NTGA 3I3CA 1A62A 3DEOA 5IYDH 2HQLA 2K50A 4JI4Q 1D1IA 1B9MA 2KECA 5J1ZA 1V1PA 4A3EB 3S16B 4JI8L 4DU9A 4GN5A 3FMCA 1VQ5A 5TSSA 1EIGA 3VR2A 4KV6A 3TP8A 1E7ZA 2I5MX 1HNXQ 4IFDI 3K5MA 4HIDA 3KLSX 4LW1A 1ZXTA 5LMNQ 3BDCA 5IP7H 1PTOF 3MXPA 4NB3A 1A3VA 2BDNA 1SYCA 2R6GA 4PMWA 5JJLA 3MZ5A 2QW7A 3DWPA 4O0AA 4Y7NH 1L1OC 4GLAC 5ELFA 3T53B 4AYBE 1FNUA 5DLQE 1F2LA 4IJHA 1WCMB 4KJOA 1PA6A 2OF1A 3JAML 5EBCA 4DV4L 3NPPA 4BY7G 3G71A 1O78A 4V0BA 5FLXc 3A74A 2K32A 2LFNA 5IP7G 4FO2A 1FD7D 1N36Q 3STBC 5KNDA 2BE5D 3OTOL 4OX9Q 4BBRB 1D7QA 1TT2A 4YCWA 2EYHA 1AW7A 1NJIC 3BDLA 4RKBA 4L63B 1E2ZA 4CKEA 2PQAB 4BY1G 3D4RA 2OTLA 1LV9A 4DK0A 4HEDA 2CFMA 2MUYA 2OCEA 4CDCC 1XMQQ 1SFOB 5GAEC 2EJGC 1Q1EA 4ILWA 1CI3M 1DD2A 1QOHA 2UUBQ 2VQFL 1V1OA 3F8TA 4DV0Q 5C3XA 3OIQA 1QZHA 3K80C 2TSSA 2RF4A 2F3VA 1PH4A 3CCQA 5J3BA 2PNHA 4KY7A 2E74C 1EY7A 1XNQQ 1WTQA 4A4IA 4JVZA 2O5JC 3O13A 3GTGH 3MFGA 3HKZB 5HURA 3P7JA 5I6WA 4JV5Q 1TWCB 1B7YB 1RTOA 4XYQA 3PIOA 3GTKH 3BVZA 2E2DC 2F0MA 2JA6H 3GV3A 4A3IB 1TIID 1ICFB 2ENBA 1TWHB 1UE6A 2XWBB 3A7LA 3PIP3 4JI6Q 2KCTA 2PZTA 1L1OB 5ELCA 5C4HA 5C44B 4A93H 1NMFA 2Q2IA 4EVOA 4S3SA 4A3EH 3S16H 1R4PB 3PUYA 2HIVA 4EQ5A 2EYFA 3K81C 2A8VA 1NUCA 2MO1A 3S9WA 3PCOB 3RUZA 4EGVA 5J22A 4HR7B 3S2DB 1X9NA 2M9VA 4LUVA 2ZJRA 4KTAA 5C4ZA 1J9OA 1H9KA 4XQJA 5KYIA 4A93G 3GTOB 1MJCA 3CU7A 4X65Q 2VQEQ 5M3FB 3OW2A 3W2DA 2WFWA 3HOYB 1O7ZA 3M3YH 2JK8A 4O1NA 4TSSA 4YCVA 1UUPA 3S15H 1KAWA 1WCMH 3HOUG 1BCPD 1AZPA 2F0OA 2PCFB 3PF4A 2ID0A 1PH9A 3OYYA 3T16A 4GNXA 1CFMA 1KLUD 1C0AA 4LF6Q 1JOKA 5IP9G 1VQPA 2E2JB 3RZOH 4BBRH 4WORA 4JI7L 3NWTA 1N33L 2DY8A 1JT8A 3NEMA 2RA4A 2WAQE 1NNXA 1YNNC 3CPFA 1SFOH 4UAIA 1JICA 2Y0SE 3HKSA 3E0EA 3KBXA 4ULLA 4R4TA 4OWWB 1OXUA 2KEEA 2JA5G 2JEAI 3C3LA 4IPCA 3KYHC 4DR7Q 3MEFA 3GTMB 1E3PA 5CV8A 3T13A 3MHBA 1WTXA 3KF8A 4YWLA 4FF4A 2MO0A 3K0YA 4QL5A 4DV3L 3P75A 2F0TA 3M4YA 1GHJA 2H5XA 2KENA 1T9HA 1WTWA 1XJVA 1EL0A 5A2QL 4QIWE 4RCOA 1TWCH 4PMCA 2A6EC 3J7ZC 1BR9A 2NZHA 1A3UA 3BS1A 3DMUA 1CKOA 1DCZA 4YHHL 2FHTA 3K5LA 3FP9A 4A3KB 4FXGC 2OTJA 1DXMA 2D2CC 2JA7B 1IW7C 1C8CA 4Y52H 5JVG3 5LMUL 4A3IH 3H0GG 4KHPQ 2Z0SA 1TWHH 3VR5A 1W2BA 4B3RL 4X3UA 5IT9c 4HIMA 4LFCL 1PFMA 1QCBD 1Y8NB 3FPUB 1K73C 4K6LA 3A54A 1CQVA 3WOFA 4UP9A 5C3WA 3LNNA 2C5CA 4DGZA 4K2LA 5G3LD 1EEID 4V190 1EZ6A 3I90A 2XN9C 2LXKA 1EIYB 3S2DH 4PZ6A 1AH9A 1TU2B 4LK1C 3GTPB 2CQAA 1MKHA 2YTXA 3ER0A 1PZID 1FNVA 1I4GA 5M3FH 3BG3A 1JJ2A 4OWXB 2SOBA 1VQIA 2VB2X 2XWJB 4HJ7A 2A6HD 3FPPA 4ZUJA 2SDFA 4NMZA 3SXHA 5I9PA 4A3GB 1YJWA 4GZYC 2FINB 3DWQA 3A55A 4KHVA 2M00A 4IPHA 2YTYA 5CYUA 4DFAA 3KF6A 2F0SA 1LT6D 3PO3B 1DYQA 4K5VA 2PPBC 1SNOA 2K5NA 1PH7A 5COYA 1LLRD 2NWGA 1TXYA 4X3KA 1Q8KA 2D62A 1AZQA 4C3JG 4M8AA 4I65A 4A3MB 4FF1A 1U0LA 2HHHQ 3K8AA 2Q8TA 5L37A 1HNWL 4B3MQ 4K14A 1G291 4TKOB 1HZAA 4IOCA 3EA6A 4DR4L 2K75A 2B29A 3GTMH 1TVXA 1C4QA 2Q8RE 1SJED 1KABA 2ICIA 1JE4A 4JI0Q 2FMCA 2F1MA 1R9TB 4A3DB 5JJKA 1MJEA 3A0JA 4DV3Q 4K2KA 1XMOQ 3MEHA 5C4XB 4OEMB 3I55A 2R92B 3PO2B 1WI5A 1GM5A 1SYFA 4LFAQ 2IWHA 1HQMC 3I56A 3Q8DA 2F0NA 3I73A 3K7UC 4JW0A 3T51B 2K52A 1UWVA 4N9TA 4GKJL 4A3CG 1Q90A 1UE7A 1GUGA 5DEHA 4B3RQ 2EYPA 4X64Q 4X66Q 1SEBD 3MWYW 1KRSA 2IT1A 3TP6A 4LFCQ 2XSCA 4DK6C 1XPRA 5JEAJ 3D3RA 3BJUA 2D0PA 4ZAIA 5BR8Q 1I3QB 3UDXA 3C1FA 1AEXA 4RGMA 4IFDJ 1S5FD 2CWAA 4OELB 4R4QA 1N9WA 2EYOA 2AUJD 1TWGH 3T1YL 1N32L 1FYCA 1STHA 2CQOA 2D0OA 3MXUA 4FP5D 4RH6A 4DNRB 3K7AH 3G7LA 4JG2A 2ALYB 2WAQB 4X62L 2Y0SB 4XYOA 3CCSA 4DR2L 3M4QA 1CHPD 4MTNA 1O7YA 1VQEA 1PYSB 3H91A 1QVFA 3J81i 1O7IA 1YJNA 1ONLA 1VQ7A 1B44D 4DN4M 1PMRA 3G6JB 1EQQA 1VQ6A 3WWVA 3L9AX 1I4XA 4M1UB 1HR0W 1HH2P 1QZGA 2UUCL 3FDTA 3J80E 3AMUA 3GQBA 1HZBA 3PO3H 2UXCL 1I6HB 4FXDA 4KHZA 2B3GA 3W3AA 4JC0A 4JBJA 3VDYA 2PMZE 4APVA 1Y14B 1VQ4A 3TBIB 4A3MH 3D6CA 2UXDQ 2F3WA 2H1EA 3SDZA 2O4XA 2V1CC 1E24A 4DK1A 2EY6A 2PQEA 5M9OA 5C0XJ 4K8JA 1UEBA 4OXPA 5T1IA 2YU9B 2G9DA 2RSNA 3QOJA 5CV7A 2PZUA 4Q0FA 4WJWA 3BZDB 2GVAA 2A69D 4E6IA 3PO2H 3TEHB 2V4DA 1KDCA 3PF5A 4PQXA 4UPAA 2F0VA 4ME3A 1PFNA 2B2WC 5C5LA 3I4NG 3F1ZA 5DNFA 4IZ8A 4GOPA 3F2UA 4KN4C 1MIUA 5HGQA 1CKMA 1LYLA 2UU9L 4A76A 3PMFA 2B2UA 1V43A 1SNQA 2IW3A 3CAMA 3EIVA 2HD3A 4JI3Q 2BH2A 2E2IH 3CKIB 1YJ9A 2CH4W 4R4IA 4FVMA 4P73A 1KXLA 1B9NA 4TVAB 1BO0A 1VQMA 4BY7B 5JOBA 2HCCA 5M5WH 1Y8OB 1Z47A 4WFN3 4P72A 1I3QH 1I4PA 4XXEA 3URYA 4MTKA 1Y69U 2EYJA 4BY1B 2RDHA 3TN2A 4JK1C 1N32Q 2SEBD 1WTPA 3GD7A 1RD9D 3B6YA 3RN5A 5C3EG 2IJ0A 4L5QA 4F7XA 4KY6A 2R93G 1EY5A 1JOOA 2AHOB 1VF7A 4DV2Q 5M3MH 2NUCA 4DR3Q 1YIJA 2N78A 4J6HA 5HY6A 2MHVA 4DR2Q 4NP5A 1HJPA 1TY2A 1P16A 5ELBA 1A2TA 3CP0A 1LTSD 2XGTA 3AU7A 4K6DA 4DR6Q 4FXKC 2E5LL 1V8QA 5CV6A 1F9SA 5EJWA 3SK5A 2F0FA 3KLSA 2RHSB 4IJLA 1WYDA 1RIPA 2IL8A 1DJRD 2I46A 4JCVE 5M3MG 5JJZA 2VNUD 1JB3A 1STGA 3JAMi 2XRQD 1HQRD 3TSSA 1A0IA 5KNCA 2F03A 2DY7A 4DV5L 1B50A 1VQKA 1YVCA 3UE1A 1S72A 5LHY1 1X3FA 3UI2A 1PLFA 5FKAC 1HFNA 1HNZQ 4CHTB 1L0YB 3NXWA 4U673 2CW0D 4DV7Q 4DUZQ 3G4SA 5AJ3L 2YU9H 4NXML 1S5ED 3OW7A 4KLKA 1NBWA 1PH2A 2NVXB 1SE8A 1U4LA 1BCPF 3GTKB 1BDOA 2LXJA 1GUSA 1ENFA 2B2YA 3S14B 1Y1WG 4ALPA 1PVOA 4ID6A 4NW2A 1V1PB 1I6VC 1CSQA 2JEBI 2C35B 4MIUA 1SR3A 4YIJA 1PTOC 3VYSA 3J7YW 2DN8A 3VR4A 4A93B 1NCVA 3W1BA 4K0KQ 1WTRA 1HXYD 4A3BH 2NVQB 1HHVA 1X3PA 2UU9Q 2AQ2B 4QF4A 1TWAH 5CORA 2PYKA 2R7ZH 2ZXPA 3BYYB 1VS0A 1X6OA 4UP7A 1XPUA 4ZK9B 1W6JA 4BY7H 1VQGA 3HOXH 1JJCB 4L6TB 3TREA 4F88A 2D9UA 3U58A 3ULPA 2RQXA 5JVH3 1KIXA 1H9JA 1WD1A 3C2PA 1KAAA 5A2QE 4O2DA 4JOIA 2F4VQ 4A3BG 4B3SL 3M3YB 4FNFA 2EVBA 1EFID 4LF7L 1LTAD 3S15B 1PH8A 5FOBB 5E4XA 2IX1A 4BY1H 4DUYQ 2R7ZG 4RMFA 1YNJD 3HOXG 1Q12A 3TDQA 1SNCA 4GS3A 5C5MA 2J0TD 2X69A 1G6ZA 3E5SA 2JA5B 4ZKCB 4YY3L 1P8LA 2B2VC 5BN3A 5M5XB 1XXGA 2E75C 1KC8C 3RZOB 4AQYQ 1ZYRC 4HJ8A 3AFPA 5C6AA 4ZQ3A 1VQNA 1I50B 2PW7A 1MBYA 2L5TA 4JI2L 5JAVA 1Y1VG 1A3TA 3MA2B 1XTCD 5FO9B 1HZ9A 4GNXC 1IBLL 4RKLA 3KDFA 4UY8C 1FR3A 3LWEA 5EKKA 4BBSH 1XX8A 1YITA 4DXGA 3UDGA 4HIKA 1GUWA 2Q2HA 4BA2I 3I2ZA 4B3TL 3D4DA 1TR5A 2OQKA 2MQHA 3SVMA 5C4JB 4DV5Q 3S1MH 5G3LF 1TWFH 1NMGA 3K6OA 1X55A 1IYJB 1PTOB 4LUOA 4I7AA 2QEXA 4G57A 1EIFA 3H0GB 5IOCA 1G91A 2C9OA 2EIFA 3I4LA 4PV1C 4BBSG 3VR6A 2HDMA 3L0OA 5AJ3Q 1S40A 2F0IA 4NXMQ 2N49A 2X6LA 4K5XA 1IKLA 3CQZB 2NVXH 5KEEA 5IGBA 4NDXA 1CQFA 4HN7A 4R8NA 2AUKA 1U4PA 4CKCA 3S14H 1TS2A 1X56A 3V05A 3UDFA 4RAUC 1PHJA 3D4WA 4IUQA 4LFBL 2R3ZA 2NVQH 1IYVA 1E2VA 3M7GA 4JI8Q 3IRBA 3PGZA 1ICWA 3HOUH 4DPGA 1GHKA 3A5ZB 2HIXA 4OGQC 3EBEA 3ZJYC 2E2HH 4OO1H 1CKNA 3LWUA 4DAYB 2OXPA 3BZKA 1M4VA 1SYEA 1EOVA 4C56C 1K8GA 2VB3X 3TMEA 4GKKL 3P20A 1I94L 3SE0A 3M4OB 2JA8G 5IP9H 4G7OC 4OONA 5I6YA 4CGYB 2Z6BA 4KI0A 3K59A 4B3SQ 4GNXB 2IX3A 2ATWA 5FJ8H 4C3JB 4OO1G 4DV4Q 1EYDA 1BNZA 2K04A 2JA5H 1JC7A 4YY3Q 5M5XH 1W6KA 3OTOQ 2HQEA 3CCMA 2F3IA 2QDBA 4XDXA 4OO1I 1IZ6A 1I50H 1PYBA 1UNSA 2JA9A 1KRTA 2K14A 1STNA 1WOCA 5LMNW 1JORA 5FJ8G 1HZCA 4JI2Q 2MNAA 3CCUA 1E22A 5EKIA 4Q5VA 3NELA 5JPNC 4IN3A 3KF8B 2MGSA 2EDGA 4DR5L 4DNTB 3NQTA 2VQFQ 1HUMA 4B9XA 5CBEE 3CCVA 3HG9A 1C9OA 2F0LA 1Q7YC 3HP3A 5C4JH 1SMYC 1U9RA 1KL9A 1BOSA 2VW9A 1PTOH 1KTKA 3S1RB 4POGA 3H0GH 4HMIA 2A73B 3T56B 5H1SE 1N34L 4LF5L 3GTQH 3AB9A 3H94A 4HSPA 3PSIA 2Q8IB 1V1QA 1EYGA 1SJHD 3CQZH 3BZCA 1BKBA 1TKWB 2JP1A 1RKNA 2BDOA 2N8NA 1UEAB 1YNXA 1F2YA 4IUPA 1SNMA 1OO9B 1ENAA 4AYBB 4DR1L 2L11A 2SNMA 1SE2A 5FLXL 3QWNA
chains in the Genus database with same CATH topology
3VYRA 1G2TA 1MGSA 1MD2D 3MC0B 1EQVA 1GUOA 1GOZA 1TY0A 5EQ0A 1JWMD 3OWEB 3GP7A 5BN4A 4Z9CB 1R4QB 2K5WA 1SBBB 1TWGB 4XQNA 3FEWX 3K7AB 3CRLC 3EJIA 2F0KA 5EKLA 3N6RA 4RFBA 2EYLA 1O7LA 1IYUA 4RHSA 2EY5A 2F0HA 1ZKOA 3BYTB 2WV6D 4X3TA 1NSNS 4ZUIA 3PUZA 3J81E 5K36H 3TZUA 1SE4A 4LAAA 3SHLA 1RDPD 2KCCA 3K5OA 3OSOA 2AWNA 3VA5A 3KUPA 3IL8A 1T5XD 1PZJD 4FF3A 1SE3A 3CHBD 5K36G 5ELEA 2BA0A 3DEPA 5IGDA 4JBWA 4KD3A 3I4NB 1LTID 2A74C 1S4ZA 4HCSA 4KK7A 4QMGA 5CV4A 5AFWA 5KIXA 3VA7A 1EYAA 5A35A 1EIHA 3BDOA 2WIIB 1T5EA 3NBIA 2YYZA 3GO5A 5E3FA 3OMCA 1Q1BA 1EWHA 4H7BA 2GA4B 2KUMA 3NUCA 4R8IA 5LL6S 1ESFA 1I4QA 3D8GA 4B08A 1F2ZA 4J8QA 2E2IB 2B8GA 4HCEA 5C3EB 5M5WB 1G8ZD 1RF2D 2BCOA 1ET6A 2R93B 3N52A 1HA5A 4RGNA 3DUZA 3NP8A 1I4HA 4C3IG 1PRTC 1ET9A 1TS5A 2B2UC 4C1NK 1AN8A 3QJYA 3IFDA 2NBFA 1EU3A 1TQOA 2F0PA 4ZLTF 2O2LD 5CV9A 5E1FA 5M3MB 4KN7C 2L55A 3ND8A 1DONA 2LY7A 2VXWA 1YNND 1B3AA 2JXMB 1TS4A 1S5BD 1DM0B 2OEOA 4DAPA 3OIPA 2EPBA 5I9OA 3R3OA 1PYWD 2Z4HA 2EYMA 3U9SA 2FMMA 2J7ZA 4QIWB 1QILA 1WTOA 3JAME 4KMUC 1Y1WB 1QNKA 5DM63 3MVVA 2BE5C 5IT9L 5D65A 2A6ED 1E0BA 2EOTA 3Q23A 2A68C 2B8FA 3OOCA 2NTSA 1DOKA 1IW7D 2ZXRA 1H9RA 4QB4A 1CTMA 3SK8A 4CJ0B 5CR3A 3EQLC 2JYOA 1STYA 1H9SA 1PRTB 5IGFA 4DAVA 3C1EA 2L4NA 4A3BB 1SNDA 2QF7A 3NWSA 1TWAB 2R7ZB 4I7ZC 3IKJA 2B2YC 3HOXB 4NKLA 5IGEA 1GUNA 5ISRA 1Z7TA 2RBMA 3MXGA 5KGUA 1JWUD 4QUCA 1EOTA 3HEJA 3I70A 1U4MA 1F9PA 2WP8J 3KBGA 3S1NB 3A8JE 1Y1VB 2MPMA 3PUXA 5EBDA 5D3IB 2L0CA 2F0JA 4CKBA 4XQQA 4C3HG 5HGTA 5IIFA 5BN5A 5F2DA 1QB5D 5CC4A 3V2TA 1D5MC 2NN6G 2LS01 3PV0A 2KVMA 3MTSA 4RGOS 1A2UA 5CV5A 4BBSB 3IAYA 2B39A 2K28A 2KA7A 4ZKBB 1BCPC 3S1MB 1TWFB 1D5XC 1OXXK 3FRPB 3BVGA 1LACA 1SYGA 2J4XA 4R9WA 2F0WA 5FO7B 3PUWA 5EPLA 3KLRA 5I2XA 4P2CB 1BUVT 1BXTA 3EFXD 1EWCA 4RHRA 1EZ8A 3H09A 5JPMC 5I4DA 4ODGA 1NR4A 1EU4A 1F2MA 4ME5A 2NTTA 2JA8B 2PW5A 3FVQA 2F0GA 2EZVA 3OMGA 3A8IE 3SEBA 3HOUB 1PRTD 2LMCB 4IUVA 3J7AF 5JEAG 1CM9A 2E2HB 2O5IC 3NQIA 1JWSD 4QUFA 4MN3A 4LMQD 2XVSA 4IFDG 2NYZD 2L12A 2IX0A 5IODA 2EY1A 1D2BA 4EQOA 2BA1A 2QILA 2KJXA 3Q24A 1STEA 4OHJA 1X3QA 2PMZB 3J80L 2E76C 1BCPB 3QB3A 2K5QA 1EY4A 1MI2A 4IUNA 4B9WA 3IFTA 5FLXE 4IURA 3T4AC 4QCLA 3ND9A 1JCKB 1GJXA 1RCVD 3HRZC 1QJOA 1I4RA 1O80A 5C0XH 2DNEA 2RDGA 5M5YB 1D6EC 3SK4A 3E6ZX 3OHXC 1Z6HA 4U68A 4ZRZA 3WDNA 4IUTA 3EROA 3QOLA 1A15A 2A6HC 2A68D 1XYIA 3NK9A 2B2TA 5C0XG 3GTLB 5DAUA 1NR2A 2CVRA 2K01A 3GTQB 1HCZA 2SNSA 3NTKA 3R2IA 4KKUA 4XT1B 5I2YA 4CJ2C 5C0XI 3U9OA 1HA6A 4ZYSA 3J7AV 2BOSA 1WD0A 1QNUA 1KNEA 3ITPA 1L0XB 2Z1CA 1BBXC 1KLGD 4RCNA 3I8ZA 2Z4IA 1EY6A 3C46A 1Y8PB 3NTIA 3E0JA 1HTLD 5KRUA 3L3OC 1LTRD 1SNPA 1OXSC 2RKSA 4G4KA 4TRDA 1ENCA 3TP7A 4PNYA 1VDZA 2M2LA 2RSOA 1TS3A 3R2TA 1JOQA 1LTTD 2B2VA 2KEDA 2K6AA 1CHQD 1B2TA 4DAYA 3S1QB 2B63B 1F9QA 2Z8LA 3RLFA 1Q8IA 2AWOA 2K5DA 5DM73 2HUGA 1MSHA 1KDAA 1IL8A 1SYBA 2JSOA 1BQQT 1A6XA 5K5PA 1HPCA 1VCIA 1RHPA 4DXFA 4BA1I 2HCIA 2N55A 3A56A 5EGTA 3PIO3 4F8MA 1DZ1A 3Q22A 3A8KE 1SYDA 4IQZA 2N88A 1STAA 1PTOD 1RODA 3NTHA 1CK1A 1K8MA 3K57A 2HDLA 1RTNA 2NVYB 4C3IB 1EQTA 4FF2A 1U4RA 3S2HB 3HOWB 3RD4A 1GXDC 4N9PA 2K33A 1RJTA 4C1NI 5IT9E 3GV6A 2G9HD 4HSVA 2A69C 1M8AA 1GUTA 1B53A 2PO4A 2NB0A 2VUMB 1LT4D 1EY0A 4RA8A 1LT3D 2K1BA 3WOEA 1WTVA 2EJMA 2RDFA 5D14A 1CZWA 3H3VC 1ZYRD 2ZXOA 4H13C 4UDUC 1EY9A 3HOVB 3NHHA 3SR1A 3QO2A 4KKTA 2QCPX 1CA5A 1CZGA 1F9RA 1ESRA 3S17B 1OXVA 1LTGD 1NAPA 4IALA 5LL6X 5KNBA 3M7NA 3H6MA 1DOMA 1F77A 3NSWA 3ZYYX 4A3JB 4X3SA 2FFKB 4F87A 1QE6A 1AFPA 1D5ZC 2IPKD 3HOZB 5CGKA 3PUVA 1BF4A 1WVLA 3I72A 2OT2A 1SDFA 3DWAA 3DXJC 5E4WC 2F0EA 1J8IA 3MFYA 3TZDA 1HFGA 3NBHA 1JR0D 4KJNA 4C2MB 1X32A 2LKVA 1EEFD 3D31A 5FK9C 1VF5C 4FYDA 3GTJB 3RZDB 1VMCA 2DNCA 4J1MA 2NZ1D 1QG7A 1HUNA 3A7AB 2QKIC 3R8BA 3D6WA 3CRKC 2WKDA 3QIAA 4K8IA 5NUCA 3V96A 2MJ8A 4WRDA 3X3NA 4RWSC 4G7ZC 3ONAB 1IKMA 2PNRC 2EE1A 4RGTA 3RMHA 1HTPA 2F0UA 1EY8A 5IGGA 1LABA 2ZT9C 2CW0C 4DF7A 3BVMA 2NVTB 1SSOA 5FO8B 4C3HB 5ELDA 1B4OA 1HRJA 1PXUA 1AP0A 2WKCA 1H9MA 1STBA 2H4OA 3FKIB 1ILQA 1B1ZA 4IUUA 2L9HA 2KCNA 2MP1A 3DHQA 2RVLA 3HGBA 4CJ1B 2WACA 4KD4A 1KNAA 3Q6SA 5KYLA 1CA6A 3K58A 1UAPA 4DA2A 1PRTF 1SMYD 3R93A 1YNJC 2R61A 1LTBD 2KHSA 1K83B 1FNWA 3DM1A 1XWEA 2EY2A 3VYTA 1S5CD 3KK7A 4OL7A 4H44C 3HS0C 1H9SB 5T1GA 3HZXA 1ML0D 1JQYD 5EPJA 1Q3LA 2XIWA 1K8OA 3SK6A 4KY5A 3Q0AA 2X6GA 3P1HA 4MHEA 1PFBA 2K7VA 2CHBD 4H0LC 4K5WA 4ABNA 3MAQA 1PZKD 2F4IA 1EYCA 3K5NA 3VR3A 4G7HC 4BS9A 4EQPA 2K05A 3LX0A 3L7ZC 4PMBA 2XRSD 2FJ2A 3M85A 3QG1A 1DOLA 2F0DA 3I4MB 5IGCA 2NN6H 3J81L 1VMPA 3X3MA 1C48A 4XTCS 1IHZA 2D5DA 4BWGB 5EPKA 1KDBA 2JE6I 1II3A 2XNAC 3ERQA 3EVQA 1ILPA 4Y7NB 1FGBD 4A3FB 2K03A 3OPOA 3OWFA 4TQUS 4CBVA 2AQ1B 2KQ3A 1S5DD 2ICEC 2QEJC 2WB1B 2PZWA 3TP5A 2WINB 5CMDA 5J39A 1PDQA 2EJFC 1SXTA 3I91A 1OXTA 4OIJA 3MXNA 4XIGS 2NN6I 4L8JA 5D3DA 1G2SA 1LT5D 4XT3B 2AQ3B 2EXZA 5CBAE 2TMPA 1ZEQX 4OIKA 1QWYA 1CT1D 4HTHA 4O42A 2KOLA 4HMJA 3NE5B 4EQNA 2B2TC 5JEAH 1MSGA 2B2WA 3GTGB 3VYUA 4IFDH 1LO5D 1SAPA 4LJZC 4KKSA 2I07B 1E2WA 2A5HA 2F0QA 2L1BA 4HAEA 2JA6B 1D1KA 3I3CA 3DEOA 1D1IA 1B9MA 2KECA 5J1ZA 1V1PA 4A3EB 3S16B 4DU9A 3FMCA 5TSSA 1EIGA 3VR2A 4KV6A 3TP8A 4IFDI 3K5MA 3KLSX 1ZXTA 3BDCA 1PTOF 3MXPA 1A3VA 2BDNA 1SYCA 2R6GA 4PMWA 3MZ5A 3DWPA 5ELFA 3T53B 1FNUA 1F2LA 1WCMB 4KJOA 2OF1A 3JAML 5EBCA 3NPPA 1O78A 4V0BA 2K32A 2LFNA 4FO2A 1FD7D 5KNDA 2BE5D 4BBRB 1TT2A 2EYHA 1AW7A 3BDLA 4RKBA 4L63B 1E2ZA 4CKEA 3D4RA 1LV9A 4DK0A 4HEDA 2MUYA 1SFOB 2EJGC 1Q1EA 4ILWA 1CI3M 1DD2A 1QOHA 1V1OA 5C3XA 3OIQA 2TSSA 2F3VA 4KY7A 2E74C 1EY7A 1WTQA 2O5JC 3O13A 3MFGA 3HKZB 5HURA 3P7JA 5I6WA 1TWCB 1RTOA 4XYQA 3BVZA 2E2DC 2F0MA 3GV3A 4A3IB 1TIID 2ENBA 1TWHB 2XWBB 3A7LA 3PIP3 2PZTA 5ELCA 5C4HA 5C44B 4EVOA 4S3SA 1R4PB 3PUYA 2EYFA 1NUCA 3S9WA 3RUZA 4EGVA 5J22A 4HR7B 3S2DB 2M9VA 4KTAA 5C4ZA 1J9OA 1H9KA 4XQJA 5KYIA 3GTOB 3CU7A 5M3FB 3W2DA 3HOYB 1O7ZA 4TSSA 4O1NA 1UUPA 1BCPD 1AZPA 2F0OA 2PCFB 2ID0A 3T16A 1CFMA 1KLUD 1JOKA 2E2JB 4WORA 3NWTA 2DY8A 2RA4A 1YNNC 4UAIA 1JICA 3KBXA 4ULLA 1OXUA 2KEEA 2JEAI 3C3LA 3GTMB 5CV8A 3T13A 3MHBA 1WTXA 3KF8A 4FF4A 3K0YA 3P75A 2F0TA 3M4YA 1GHJA 1WTWA 1EL0A 5A2QL 4RCOA 4PMCA 2A6EC 3BS1A 1BR9A 1A3UA 3DMUA 1DCZA 3K5LA 2FHTA 4A3KB 4FXGC 1DXMA 2D2CC 2JA7B 1IW7C 1C8CA 5JVG3 3VR5A 4X3UA 1PFMA 1QCBD 1Y8NB 3FPUB 4K6LA 3A54A 1CQVA 3WOFA 5C3WA 3LNNA 2C5CA 4DGZA 4K2LA 5G3LD 1EEID 4V190 1EZ6A 3I90A 2XN9C 1TU2B 4LK1C 3GTPB 2CQAA 1PZID 1FNVA 1I4GA 3BG3A 2SOBA 2VB2X 2XWJB 2A6HD 3FPPA 4ZUJA 2SDFA 4NMZA 3SXHA 5I9PA 4A3GB 4GZYC 2FINB 3DWQA 3A55A 4KHVA 2M00A 5CYUA 4DFAA 2F0SA 1LT6D 3PO3B 1DYQA 4K5VA 2PPBC 1SNOA 5COYA 1LLRD 2NWGA 4X3KA 2D62A 1AZQA 4C3JG 4M8AA 4I65A 4A3MB 4FF1A 2Q8TA 4K14A 1G291 4TKOB 3EA6A 1TVXA 1C4QA 2Q8RE 1SJED 1KABA 2ICIA 1JE4A 2FMCA 2F1MA 1R9TB 4A3DB 4K2KA 3MEHA 5C4XB 2R92B 3PO2B 1SYFA 2IWHA 1HQMC 2F0NA 3I73A 3T51B 4N9TA 1Q90A 1GUGA 5DEHA 2EYPA 1SEBD 3MWYW 3TP6A 2IT1A 2XSCA 5JEAJ 3D3RA 4ZAIA 1I3QB 3C1FA 1AEXA 4RGMA 4IFDJ 1S5FD 2EYOA 2AUJD 1FYCA 1STHA 3MXUA 4FP5D 4RH6A 4DNRB 3G7LA 2WAQB 2Y0SB 4XYOA 1CHPD 1O7YA 3H91A 1ONLA 1B44D 4DN4M 1PMRA 3G6JB 3L9AX 1I4XA 4M1UB 3FDTA 3J80E 3AMUA 3GQBA 1I6HB 4FXDA 4KHZA 3W3AA 3TBIB 3D6CA 2F3WA 2H1EA 3SDZA 2O4XA 4DK1A 2EY6A 2PQEA 5M9OA 5C0XJ 4K8JA 5T1IA 2YU9B 2G9DA 2RSNA 3QOJA 5CV7A 2PZUA 4Q0FA 4WJWA 3BZDB 2A69D 4E6IA 2V4DA 1KDCA 4PQXA 2F0VA 1PFNA 2B2WC 5C5LA 5DNFA 4IZ8A 3F2UA 4KN4C 3PMFA 2B2UA 1V43A 1SNQA 2IW3A 3CKIB 4FVMA 1B9NA 1BO0A 4BY7B 5JOBA 2HCCA 1Y8OB 1Z47A 4WFN3 1I4PA 4XXEA 3URYA 1Y69U 2EYJA 4BY1B 2RDHA 3TN2A 4JK1C 2SEBD 1WTPA 3GD7A 1RD9D 2IJ0A 4F7XA 4KY6A 1EY5A 1JOOA 1VF7A 2NUCA 4J6HA 2MHVA 4NP5A 1TY2A 5ELBA 1A2TA 1LTSD 3AU7A 4K6DA 4FXKC 1V8QA 5CV6A 1F9SA 5EJWA 3SK5A 2F0FA 3KLSA 2IL8A 1DJRD 2I46A 2VNUD 5JJZA 1JB3A 1STGA 2XRQD 1HQRD 3TSSA 5KNCA 2F03A 2DY7A 1B50A 5LHY1 3UI2A 1PLFA 5FKAC 1HFNA 4CHTB 1L0YB 3NXWA 4U673 2CW0D 1S5ED 3OW7A 2NVXB 1U4LA 1BCPF 3GTKB 1BDOA 1GUSA 1ENFA 2B2YA 3S14B 4ID6A 4NW2A 1V1PB 1I6VC 2JEBI 4MIUA 4YIJA 1PTOC 3VYSA 3J7YW 2DN8A 3VR4A 4A93B 1NCVA 1WTRA 1HXYD 2NVQB 1HHVA 1X3PA 2AQ2B 4QF4A 5CORA 2PYKA 2ZXPA 3BYYB 4ZK9B 1W6JA 4L6TB 4F88A 2D9UA 2RQXA 5JVH3 1H9JA 1WD1A 3C2PA 1KAAA 5A2QE 3M3YB 4FNFA 2EVBA 1EFID 1LTAD 3S15B 5FOBB 5E4XA 2IX1A 1YNJD 1Q12A 3TDQA 1SNCA 5C5MA 2J0TD 2X69A 1G6ZA 3E5SA 2JA5B 4ZKCB 5BN3A 2B2VC 5M5XB 1XXGA 2E75C 3RZOB 1ZYRC 5C6AA 4ZQ3A 1I50B 2PW7A 1MBYA 2L5TA 5JAVA 3MA2B 1A3TA 1XTCD 5FO9B 4RKLA 1FR3A 3LWEA 5EKKA 1XX8A 4DXGA 1GUWA 4BA2I 3D4DA 1TR5A 3SVMA 5C4JB 5G3LF 3K6OA 1PTOB 4G57A 3H0GB 5IOCA 1G91A 2C9OA 3I4LA 4PV1C 3VR6A 2HDMA 2F0IA 2X6LA 4K5XA 1IKLA 3CQZB 5KEEA 5IGBA 4NDXA 1CQFA 4HN7A 4R8NA 2AUKA 1U4PA 4CKCA 1TS2A 3V05A 4RAUC 3D4WA 4IUQA 2R3ZA 1IYVA 1E2VA 3M7GA 1ICWA 1GHKA 4OGQC 4OO1H 3LWUA 2OXPA 1M4VA 1SYEA 4C56C 2VB3X 3TMEA 3P20A 3SE0A 3M4OB 4G7OC 5I6YA 4CGYB 4KI0A 3K59A 2IX3A 4C3JB 4OO1G 1EYDA 1BNZA 2K04A 1JC7A 1W6KA 2HQEA 2QDBA 4XDXA 4OO1I 1UNSA 1STNA 1JORA 5EKIA 4Q5VA 5JPNC 4IN3A 2MGSA 2EDGA 4DNTB 3NQTA 1HUMA 4B9XA 5CBEE 3HG9A 2F0LA 3HP3A 1SMYC 1U9RA 1BOSA 1PTOH 1KTKA 3S1RB 4HMIA 2A73B 3T56B 3AB9A 3H94A 4HSPA 2Q8IB 1SJHD 1TKWB 2JP1A 1RKNA 2BDOA 1UEAB 1F2YA 4IUPA 1SNMA 1ENAA 1OO9B 4AYBB 2L11A 2SNMA 1SE2A 5FLXL 3QWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F8M A;  4ODG A;  1TT2 A;  2EYJ A;  4J1M A;  1KAA A;  2EYH A;  1SND A;  1F2M A;  1SYD A;  1STA A;  1EQV A;  4ME5 A;  3BDL A;  4RKB A;  2OXP A;  4OL7 A;  4ZUJ A;  1JOK A;  1SYE A;  4NMZ A;  3SXH A;  5I9P A;  2PW5 A;  3TME A;  2EXZ A;  4WOR A;  4KHV A;  2M00 A;  4F7X A;  2F0G A;  3HZX A;  3OMG A;  4KY6 A;  4DFA A;  3NP8 A;  1EY5 A;  1JOO A;  3ITP A;  2F0S A;  5I6Y A;  4HTH A;  2NUC A;  4K8I A;  5NUC A;  4J6H A;  4NKL A;  4WRD A;  4NP5 A;  5IGE A;  1SNC A;  4K5V A;  5C5M A;  5ISR A;  3EJI A;  4HMJ A;  4N9P A;  3E5S A;  1SNO A;  4EQN A;  1A2T A;  3SK6 A;  2RBM A;  4KY5 A;  5C3X A;  2F0K A;  5KGU A;  1EY6 A;  5EKL A;  4K6D A;  2F0U A;  3P1H A;  1EYD A;  3HEJ A;  4I65 A;  1EY8 A;  2EYL A;  5CV6 A;  1TQO A;  5IGG A;  2F0P A;  2F3V A;  5C6A A;  4DF7 A;  3SK5 A;  2F0F A;  4KY7 A;  4ZQ3 A;  1EY7 A;  2EY5 A;  5IOD A;  5CV9 A;  4K14 A;  5E1F A;  5KRU A;  2F0H A;  5CV8 A;  2EY1 A;  3T13 A;  2PW7 A;  3MHB A;  4K5W A;  2HQE A;  1A3T A;  1SNP A;  1NSN S;  3D6C A;  4EQO A;  4ZUI A;  5JAV A;  1STG A;  2F3W A;  2QDB A;  1EYC A;  2F0J A;  2F0Q A;  5HUR A;  5I6W A;  2RKS A;  4RKL A;  3P75 A;  2O4X A;  4EQP A;  1EY0 A;  1STN A;  1KAB A;  2F0T A;  5EKK A;  3SHL A;  4LAA A;  5HGT A;  2EY6 A;  2PQE A;  4TRD A;  1JOR A;  5IIF A;  5M9O A;  1ENC A;  3LX0 A;  3QB3 A;  4K8J A;  2OEO A;  3TP7 A;  4PNY A;  1STB A;  4PMB A;  5F2D A;  1EY4 A;  3OSO A;  5CC4 A;  2F0M A;  5I9O A;  4K2K A;  4IUN A;  4PMC A;  3D4D A;  1TR5 A;  1A3U A;  2RDF A;  3DMU A;  3MEH A;  3R3O A;  3V2T A;  3VA5 A;  4B9W A;  2ENB A;  3NXW A;  3QOJ A;  2EYM A;  1SYF A;  5CV7 A;  3NQT A;  1EY9 A;  2PZU A;  4B9X A;  1JOQ A;  5J1Z A;  4G57 A;  2PZT A;  2F0D A;  2F0L A;  5IOC A;  3NHH A;  5IGC A;  4DU9 A;  1A2U A;  1U9R A;  5CV5 A;  3SR1 A;  4E6I A;  5C4H A;  5IGB A;  4KV6 A;  1IHZ A;  2F0N A;  3SK4 A;  3TP8 A;  1KDC A;  4EVO A;  4S3S A;  5IGD A;  4KD3 A;  2F0V A;  3DHQ A;  1KDB A;  4HMI A;  2EYF A;  1II3 A;  2F0I A;  3ERQ A;  3EVQ A;  4IAL A;  4N9T A;  4QMG A;  1NUC A;  5C5L A;  4K5X A;  5CV4 A;  3ERO A;  3MVV A;  4IZ8 A;  3H6M A;  3BDC A;  5KEE A;  3QOL A;  5KIX A;  3S9W A;  5DEH A;  3MXP A;  2WAC A;  4ID6 A;  2EYP A;  1A3V A;  1EYA A;  1SYC A;  4KD4 A;  4NDX A;  3RUZ A;  4R8N A;  4MIU A;  5J22 A;  4YIJ A;  5KYL A;  3TP6 A;  3PMF A;  3OWF A;  5C3W A;  1KDA A;  1SNQ A;  1SYG A;  1SYB A;  3MZ5 A;  4KTA A;  5C4Z A;  4DGZ A;  3NK9 A;  5CGK A;  2F0W A;  4K2L A;  2KQ3 A;  5E3F A;  5KYI A;  3OMC A;  5K5P A;  1EZ6 A;  3C1F A;  4KJO A;  1RKN A;  4QB4 A;  2OF1 A;  5DAU A;  5JOB A;  2F0E A;  2PZW A;  3SK8 A;  3TP5 A;  4H7B A;  1AEX A;  4QF4 A;  5J39 A;  5CR3 A;  1F2Y A;  2PYK A;  1SNM A;  2SNS A;  3D4W A;  4KJN A;  3NUC A;  2KHS A;  2LKV A;  1ENA A;  1STY A;  5IGF A;  2EYO A;  2F0O A;  1EZ8 A;  3C1E A;  3D8G A;  1STH A;  2SNM A;  3U9O A;  1F2Z A;  2EY2 A;  2SOB A;  3T16 A;  5EGT A; 
#chains in the Genus database with same CATH topology
 3VYR A;  3CW2 C;  4LFB Q;  1G2T A;  1MGS A;  1MD2 D;  3MC0 B;  1EQV A;  1PH5 A;  1GUO A;  1GOZ A;  1TY0 A;  1JJG A;  5EQ0 A;  1JWM D;  4L5R C;  3OWE B;  4NXN L;  3GP7 A;  5BN4 A;  4Z9C B;  1R4Q B;  2K5W A;  1SBB B;  1TWG B;  4XQN A;  4LNQ A;  1JB7 A;  3FEW X;  4IOA A;  2UXB L;  3K7A B;  3CRL C;  3M4O H;  3EJI A;  5ELN A;  2F0K A;  5EKL A;  3STB D;  3N6R A;  4RFB A;  3J7A 5;  2EYL A;  1O7L A;  1IYU A;  4GLX A;  3KF6 B;  3UDI A;  1NY4 A;  2GVB A;  4C3J H;  4RHS A;  2EY5 A;  2F0H A;  1ZKO A;  3NBH B;  3BYT B;  1IXR A;  2WV6 D;  4X3T A;  1NSN S;  3W1G A;  1EFW A;  4ZUI A;  3PUZ A;  3J81 E;  5K36 H;  3TZU A;  1SE4 A;  4LAA A;  3SHL A;  2B63 H;  1RDP D;  2KCC A;  1KD1 C;  1FJG L;  4JI7 Q;  3K5O A;  2AMC B;  4CDD C;  3OSO A;  3KLW A;  1N33 Q;  2AKW B;  2AWN A;  4DAM A;  3VA5 A;  1K0R A;  3U50 C;  3KUP A;  1SMX A;  3IL8 A;  1T5X D;  1Q82 C;  1PZJ D;  4LF4 L;  4QJF A;  4FF3 A;  1SE3 A;  3CHB D;  5K36 G;  5ELE A;  2BA0 A;  3DEP A;  5IGD A;  4AIM A;  4HIO A;  4JBW A;  2B63 G;  4KD3 A;  3I4N B;  1LTI D;  2KBN A;  2A74 C;  1S4Z A;  4HCS A;  4KK7 A;  4QMG A;  2JN4 A;  5CV4 A;  2QA4 A;  5AFW A;  3CC2 A;  3M4P A;  5KIX A;  3VA7 A;  3S1R H;  1EYA A;  3TS2 A;  5A35 A;  1EIH A;  3BDO A;  4A3C H;  2WII B;  5IY0 A;  3TS0 A;  1T5E A;  3NBI A;  2YYZ A;  3ERS X;  3GO5 A;  5E3F A;  3OMC A;  1Q1B A;  1EWH A;  4H7B A;  4WJ3 M;  2GA4 B;  2KUM A;  4YHH Q;  3NUC A;  1PFS A;  1JE5 A;  4R8I A;  5LL6 S;  1EUJ A;  1ESF A;  4C3I H;  1I4Q A;  1NE3 A;  3D8G A;  4B08 A;  5LMU Q;  1F2Z A;  4J8Q A;  2E2I B;  2EQS A;  3E9I A;  2B8G A;  4HCE A;  4DR1 Q;  2HT1 A;  5C3E B;  5M5W B;  1G8Z D;  1RF2 D;  2DGY A;  3DLL A;  2BCO A;  1ET6 A;  2R93 B;  3N52 A;  1HA5 A;  2LSS A;  4RGN A;  3DUZ A;  4GOP C;  3NP8 A;  1QUQ B;  1I4H A;  2ZTC A;  4C3I G;  1PRT C;  3T1H L;  1ET9 A;  1TS5 A;  2B2U C;  4C1N K;  3HOW G;  1AN8 A;  4NXN Q;  3TRZ A;  3QJY A;  2DUD A;  3IFD A;  2NBF A;  2UXB Q;  1EU3 A;  2Z6K A;  3AQQ A;  1TQO A;  2F0P A;  2UUA L;  4R4C A;  4ZLT F;  4A3K G;  4LWC A;  2O2L D;  5CV9 A;  5E1F A;  3CXC A;  5M3M B;  4KN7 C;  4LF8 L;  1K0S A;  2L55 A;  1L0W A;  3HOV H;  3ND8 A;  1DON A;  5GAD C;  2LY7 A;  2VXW A;  1YNN D;  1B3A A;  2VUM G;  2JXM B;  1TS4 A;  1OTC A;  5IWA L;  1S5B D;  1DM0 B;  1FL0 A;  2OEO A;  3E9H A;  4DAP A;  1B70 B;  3OIP A;  2EPB A;  3GDE A;  5I9O A;  3R3O A;  4CDE C;  1PYW D;  2Z4H A;  2EYM A;  4P75 A;  3U9S A;  3H15 A;  2FMM A;  3HOV G;  2J7Z A;  4QIW B;  3J80 c;  2OWO A;  2DJF C;  1QIL A;  1Q46 A;  1WTO A;  3JAM E;  4KMU C;  1UE5 A;  3TQY A;  1Y1W B;  1HNW Q;  1QNK A;  5DM6 3;  3MVV A;  2BE5 C;  1X3E A;  4DR4 Q;  5IT9 L;  3AEV A;  2Z9H A;  3I4N H;  5D65 A;  2RCN A;  1ASZ A;  2A6E D;  1E0B A;  2EOT A;  3Q23 A;  2A68 C;  4GLV B;  2B8F A;  3OOC A;  4A3J G;  3GTJ H;  2KCM A;  1B8A A;  2NTS A;  1FVI A;  1DOK A;  3HOZ G;  1IW7 D;  2ZXR A;  1H9R A;  4QB4 A;  4IO9 A;  1CTM A;  3SK8 A;  3G6E A;  4CJ0 B;  5CR3 A;  3EQL C;  2JYO A;  4GOP B;  3A5U A;  4JYA L;  1STY A;  2YTV A;  1H9S A;  1PRT B;  5IGF A;  4DAV A;  3C1E A;  2L4N A;  3I4O A;  4A3B B;  1CUK A;  1SND A;  1PH1 A;  2QF7 A;  3NWS A;  3CC4 A;  1M1K C;  4GKJ Q;  1TWA B;  2G5D A;  2R7Z B;  4I7Z C;  3IKJ A;  2B2Y C;  2IHF A;  3HOX B;  5C3E H;  2GN5 A;  3F2C A;  4NKL A;  5IGE A;  1GUN A;  5ISR A;  2R93 H;  1SN8 A;  1Z7T A;  2RBM A;  3MXG A;  4C3H H;  1J5E L;  5KGU A;  1JWU D;  3KFU A;  3JC6 6;  4QUC A;  1EOT A;  4BXX G;  3CF5 A;  3HEJ A;  1VQJ A;  3I70 A;  1U4M A;  4DK3 C;  1F9P A;  1HNX L;  2WP8 J;  1VQ8 A;  3KBG A;  1SRU A;  4NPS A;  3T1Y Q;  3S1N B;  3A8J E;  1Y1V B;  2MPM A;  3PUX A;  4LF9 L;  5EBD A;  3AYH B;  5D3I B;  2L0C A;  3MXN B;  1YHQ A;  2F0J A;  4X62 Q;  1BVS A;  4CKB A;  1V9P A;  4XQQ A;  3CC7 A;  4C3H G;  5HGT A;  5IIF A;  5JJI A;  5BN5 A;  4DV1 L;  1XTD A;  5F2D A;  3CMA A;  1QB5 D;  5CC4 A;  1XNR L;  3V2T A;  1D5M C;  1VQC A;  2NN6 G;  1WTH A;  2LS0 1;  3PV0 A;  5IWA Q;  2KVM A;  3FKI G;  3MTS A;  4RGO S;  2UUC Q;  4FDB A;  1N36 L;  1A2U A;  5CV5 A;  4BBS B;  2F52 A;  3IAY A;  2B39 A;  4R4O A;  2UXC Q;  2K28 A;  4OX9 L;  1U5K A;  2KA7 A;  3KOJ A;  4PG3 A;  4ZKB B;  1BCP C;  2FXQ A;  3S1M B;  1TWF B;  2I0Q A;  1D5X C;  1K83 H;  1OXX K;  3FRP B;  1CSP A;  3BVG A;  4YCU A;  1LAC A;  1Y1W H;  2ZM6 L;  1SYG A;  2J4X A;  4R9W A;  2F0W A;  5FO7 B;  2UUB L;  3PUW A;  5EPL A;  3KLR A;  5I2X A;  4DV0 L;  4P2C B;  1BUV T;  1BXT A;  3EFX D;  1EWC A;  5GRO A;  1D8L A;  1C7Y A;  1RL2 A;  4RHR A;  1G51 A;  1EZ8 A;  3H09 A;  5JPM C;  5I4D A;  3F2B A;  1XNQ L;  4ODG A;  1NR4 A;  1EU4 A;  1F2M A;  4ME5 A;  4JV5 L;  1QVC A;  2NTT A;  2JA8 B;  2PW5 A;  3U4V A;  3FVQ A;  5IYB G;  2F0G A;  2EZV A;  3OMG A;  3A8I E;  4HJA A;  3SEB A;  1PH3 A;  2Q2T A;  1PRT D;  2LMC B;  4IUV A;  3HOU B;  3J7A F;  2N3S A;  4CDF C;  5JEA G;  1PH6 A;  1CM9 A;  4JI6 L;  2E2H B;  2O5I C;  2KHJ A;  1YHB A;  3NQI A;  3RN2 A;  5GAG C;  1JWS D;  4QUF A;  4MN3 A;  4LMQ D;  2XVS A;  2PI2 A;  4IFD G;  4A75 A;  2NYZ D;  2L12 A;  3PIP A;  4IPG A;  2IX0 A;  5EAY A;  1J5E Q;  5IOD A;  2EY1 A;  1D2B A;  4L5T A;  1B3Q A;  4RG1 A;  4EQO A;  2R7D A;  2BA1 A;  2QIL A;  2KJX A;  3Q24 A;  3S1N H;  3I4M H;  1STE A;  1Y1V H;  4OHJ A;  2K4K A;  1X3Q A;  2PMZ B;  3J80 L;  4LF9 Q;  2E76 C;  1BCP B;  3QB3 A;  5IYD G;  2K5Q A;  4X65 L;  1EY4 A;  4YWK A;  1MI2 A;  5GAH C;  2VQE L;  4IUN A;  4B9W A;  2BH8 A;  3IFT A;  5FLX E;  4IUR A;  3CME A;  3T4A C;  3RR5 A;  3ND9 A;  4QCL A;  1JCK B;  1GJX A;  2VZA A;  2KHI A;  4DV1 Q;  3G48 A;  1XPO A;  1RCV D;  3HRZ C;  1QJO A;  3KDF B;  4A3F H;  1I4R A;  1O80 A;  1S3O A;  1XNR Q;  5C0X H;  2DNE A;  3I4M G;  2RDG A;  5M5Y B;  1D6E C;  3SK4 A;  4HJ5 A;  2E5L Q;  4P71 A;  3AFQ A;  3E6Z X;  3OHX C;  1Z6H A;  4U68 A;  4ZRZ A;  1K9M C;  4LF6 L;  3SGI A;  3WDN A;  4IUT A;  3ERO A;  4X6A H;  3QOL A;  1A15 A;  2A6H C;  2A68 D;  1XYI A;  1K28 A;  4A3F G;  3NK9 A;  2B2T A;  5C0X G;  3M9B A;  1Q81 C;  1YI2 A;  3GTL B;  5DAU A;  1NR2 A;  2A1A A;  2ZM6 Q;  2CVR A;  2K01 A;  2PQA A;  3EN2 A;  3GTQ B;  2WB1 G;  1HCZ A;  2SNS A;  3NTK A;  3R2I A;  4KKU A;  4DR7 L;  1KHI A;  2IHE A;  4XT1 B;  5I2Y A;  4CJ2 C;  5C0X I;  3U9O A;  1HA6 A;  4ZYS A;  3J7A V;  2BOS A;  4YWM A;  1WD0 A;  2NZO A;  1QNU A;  4IPD A;  2RCF A;  5E7N A;  1KNE A;  1H95 A;  4LUZ A;  3RLO A;  3ITP A;  1WFQ A;  2ASB A;  2JA8 H;  1L0X B;  2Z1C A;  3CCJ A;  1BBX C;  3K0X A;  1KLG D;  2ZTD A;  1CKN B;  4RCN A;  3I8Z A;  2Z4I A;  1EY6 A;  3C46 A;  4KHP L;  1Y8P B;  2R7F A;  3NTI A;  3E0J A;  1HTL D;  5KRU A;  3L3O C;  1YEZ A;  1LTR D;  1QVG A;  1SNP A;  1OXS C;  2YV5 A;  1X54 A;  1HR0 L;  2RKS A;  1L1O A;  4G4K A;  4TRD A;  1IL2 A;  1ENC A;  4LF7 Q;  2JA6 G;  4N8X 1;  3TP7 A;  4POF A;  4PNY A;  1VDZ A;  1LUZ A;  4GN3 B;  2M2L A;  2RSO A;  4JBM A;  5IE8 A;  4DV6 L;  1TS3 A;  3R2T A;  1JOQ A;  1I5F A;  1LTT D;  2B2V A;  2KED A;  2K6A A;  1CHQ D;  1B2T A;  4A3E G;  4DAY A;  3S1Q B;  2B63 B;  1F9Q A;  2Z8L A;  2OQ0 A;  1YBY A;  1X3G A;  3RLF A;  1Q8I A;  3I7F A;  2ZTE A;  5M5Y H;  3F2D A;  2AWO A;  2K5D A;  5DM7 3;  2HUG A;  1IBL Q;  3CD6 A;  2ES2 A;  1MSH A;  1KDA A;  1IL8 A;  1SYB A;  2JSO A;  1BQQ T;  1A6X A;  5K5P A;  1HPC A;  1VCI A;  4B3T Q;  1WCM G;  1GKH A;  1RHP A;  3ULJ A;  2HHH L;  2I5H A;  4DXF A;  1M90 C;  4BA1 I;  3GTL H;  2HCI A;  2N55 A;  3QR8 A;  3A56 A;  1VQO A;  2JQO A;  1EWI A;  1E1O A;  4B3M L;  3HFZ B;  1G6P A;  5EGT A;  3PIO 3;  4F8M A;  1DZ1 A;  1E1T A;  3Q22 A;  3A8K E;  1SYD A;  4IQZ A;  2N88 A;  1STA A;  1PTO D;  1ROD A;  4BBR G;  3NTH A;  3CCR A;  1VQB A;  1CK1 A;  1K8M A;  3K57 A;  4JI0 L;  2HDL A;  1VQA A;  1RTN A;  2NVY B;  4C3I B;  1EQT A;  4QY7 A;  4FF2 A;  1U4R A;  1XMO L;  3S2H B;  3HOW B;  3RD4 A;  3ULL A;  3RNU A;  3J81 j;  1GXD C;  4N9P A;  4LFA L;  2K33 A;  1RJT A;  3UE0 A;  2CH4 A;  5FLM H;  4C1N I;  5IT9 E;  3GV6 A;  2G9H D;  2QGQ A;  1UE1 A;  4HSV A;  2A69 C;  1M8A A;  1GUT A;  4X64 L;  1B53 A;  1A8V A;  2NB0 A;  2PO4 A;  4X66 L;  2VUM B;  1LT4 D;  1EY0 A;  3HKZ G;  4RA8 A;  1LT3 D;  2K1B A;  5C44 H;  4GKK Q;  1I94 Q;  2QDL A;  3WOE A;  1JMC A;  5BR8 L;  1WTV A;  1HR0 Q;  5FLM G;  2EJM A;  2RDF A;  5GQO A;  5D14 A;  1CZW A;  4JI1 L;  3H3V C;  1ZYR D;  2ZXO A;  4H13 C;  3CCE A;  4UDU C;  4A3I G;  1EY9 A;  3HOV B;  1VQ9 A;  3NHH A;  2RHQ B;  3SR1 A;  4JI5 L;  4DV6 Q;  3QO2 A;  4KKT A;  2QCP X;  5C44 G;  1CA5 A;  1CZG A;  1F9R A;  2Z6K C;  3GTO H;  1ESR A;  3S17 B;  1DGS A;  1OXV A;  1LTG D;  1NAP A;  4IAL A;  5LL6 X;  5KNB A;  3S1Q H;  3HOY H;  3M7N A;  3H6M A;  1IBM L;  1DOM A;  1F77 A;  3NSW A;  3ZYY X;  4A3J B;  4X3S A;  3J81 c;  2FFK B;  4F87 A;  1QE6 A;  1AFP A;  1D5Z C;  2IPK D;  1IBK L;  3HOZ B;  5CGK A;  3PUV A;  1BF4 A;  1WVL A;  2P5Z X;  3I72 A;  2OT2 A;  1SDF A;  3DWA A;  3DXJ C;  5E4W C;  2F0E A;  1J8I A;  3MFY A;  3TZD A;  2E2J H;  1HFG A;  3NBH A;  1JR0 D;  5M3F G;  4KJN A;  4C2M B;  4DR5 Q;  1X32 A;  3HOY G;  2LKV A;  1EEF D;  2IY5 B;  3D31 A;  3E3X A;  5FK9 C;  1VF5 C;  4ZCK A;  4FYD A;  3GTJ B;  3RZD B;  2UXD L;  1VMC A;  2DNC A;  2WB1 E;  4J1M A;  2NZ1 D;  1QG7 A;  1HUN A;  3A7A B;  2QKI C;  3R8B A;  1N34 Q;  4LF5 Q;  3D6W A;  3CRK C;  1ASY A;  1VQF A;  2WKD A;  3QIA A;  4K8I A;  5NUC A;  3V96 A;  2MJ8 A;  4WRD A;  4QGU A;  3X3N A;  1X65 A;  4RWS C;  4G7Z C;  2NVY H;  1FGU A;  3ONA B;  1IKM A;  2PNR C;  2EXD A;  2EE1 A;  4RGT A;  3RMH A;  1HTP A;  2F0U A;  3S2H H;  3HOW H;  1EY8 A;  5IGG A;  1LAB A;  2ZT9 C;  2CW0 C;  4PZ8 A;  3BVM A;  4DF7 A;  2VL6 A;  2NVT B;  3W5O A;  1SSO A;  1KQS A;  4A3K H;  5FO8 B;  1GD7 A;  2CWP A;  4C3H B;  2JA7 H;  5ELD A;  4P74 A;  1B4O A;  1HRJ A;  1PXU A;  1AP0 A;  2WKC A;  4JI3 L;  1H9M A;  1STB A;  4UP8 A;  4GN4 B;  2VUM H;  2H4O A;  3FKI B;  2PI2 E;  1ILQ A;  4N8F A;  1B1Z A;  2K5V A;  4IUU A;  2JA7 G;  4JI1 Q;  2L9H A;  2KCN A;  1YZ6 A;  1LTL A;  2K5H A;  2MP1 A;  1J6Q A;  2XTI A;  3DHQ A;  2A19 A;  1QUQ A;  2RVL A;  3HGB A;  4AYB G;  3GTP H;  4CJ1 B;  4UHV A;  4JI5 Q;  2WAC A;  4KD4 A;  3S17 H;  1KNA A;  3Q6S A;  5KYL A;  4DV2 L;  1CA6 A;  3K58 A;  4DR3 L;  4EX5 A;  2L15 A;  1UAP A;  1Q86 C;  1FJG Q;  3ICE A;  1IBM Q;  4DA2 A;  4A3J H;  1PRT F;  1SMY D;  4DR6 L;  3R93 A;  3HOZ H;  4A3G H;  3PQI A;  1YNJ C;  2R61 A;  1IBK Q;  1LTB D;  2VS1 A;  2KHS A;  3BU2 A;  1K83 B;  4QQB X;  1FNW A;  4J15 A;  3D0F A;  4LF4 Q;  3DM1 A;  1XWE A;  2EY2 A;  1K3B C;  4C2M H;  3S24 A;  3VYT A;  1S5C D;  2VY3 A;  3KK7 A;  4OL7 A;  3JAM c;  3RZD H;  4H44 C;  3HS0 C;  1H9S B;  4A3G G;  5T1G A;  3HZX A;  1ML0 D;  1JQY D;  5EPJ A;  1HNZ L;  3CCL A;  1A63 A;  1Q3L A;  2XIW A;  4DV7 L;  4DUZ L;  1K8O A;  3SK6 A;  1WJJ A;  4KY5 A;  1AE3 A;  4PZ7 A;  3Q0A A;  3PO3 G;  4JBK A;  2X6G A;  3P1H A;  4MHE A;  2I5L X;  1R9T H;  4BXX H;  4A3M G;  4A3D H;  1BBW A;  1PFB A;  2K7V A;  2CHB D;  4H0L C;  5C4X H;  4H02 A;  2R92 H;  4K5W A;  2DJG C;  4ABN A;  3MAQ A;  3NEN A;  1PZK D;  3H3V H;  2F4I A;  1EYC A;  3K5N A;  3VR3 A;  4G7H C;  2NVT H;  4BS9 A;  4EQP A;  3CPW A;  2K05 A;  1K3R A;  4JI4 L;  4K0K L;  4OWT B;  3LX0 A;  1VQL A;  3L7Z C;  4PMB A;  2XRS D;  2FJ2 A;  3M85 A;  3LGJ A;  4A3D G;  3QG1 A;  3T1H Q;  3HKZ E;  5C4X G;  1DOL A;  2R92 G;  3PO2 G;  2F0D A;  3I4M B;  5IGC A;  4A3L H;  2NN6 H;  3J81 L;  1VMP A;  3X3M A;  5LMN L;  1C48 A;  4XTC S;  3U4Z A;  1IHZ A;  3FKI H;  2D5D A;  1N8R C;  1VQH A;  2E8G A;  4BWG B;  2UUA Q;  5EPK A;  2F4V L;  1KDB A;  1L2F A;  2JE6 I;  1II3 A;  2XNA C;  3ERQ A;  3EVQ A;  2Q2U A;  1ILP A;  4JOI C;  4LF8 Q;  3KJO A;  4Y7N B;  1FGB D;  4MNO A;  3H3V I;  4DUY L;  4A3F B;  2K03 A;  1SRO A;  4DNI A;  3OPO A;  3OWF A;  4TQU S;  4CBV A;  4A3L G;  2AQ1 B;  3L2P A;  1YHA A;  2KQ3 A;  4WJ4 A;  1S5D D;  2ICE C;  2QEJ C;  2WB1 B;  2PZW A;  2MFI A;  3TP5 A;  2WIN B;  5CMD A;  5J39 A;  1PDQ A;  2EJF C;  1EQR A;  1SXT A;  4AQY L;  3I91 A;  1OXT A;  4OIJ A;  3MXN A;  4XIG S;  3J80 i;  4MZ9 A;  2NN6 I;  4L8J A;  5D3D A;  5IYC H;  1XMQ L;  1G2S A;  1MHW C;  1LT5 D;  1GVP A;  4XT3 B;  2WAQ G;  3RLN A;  1SLJ A;  2AQ3 B;  2CCZ A;  1Z9F A;  2Y0S G;  2EXZ A;  5CBA E;  2JJQ A;  2TMP A;  1ZEQ X;  1I6H H;  4OIK A;  1QWY A;  1W3S A;  5ELO A;  1CT1 D;  4HJ9 A;  5IYB H;  1LM0 A;  4HTH A;  4O42 A;  4DKA C;  2KOL A;  2ZJP A;  4HMJ A;  5IYC G;  1K8A C;  3NE5 B;  4EQN A;  2B2T C;  3DM3 A;  5JEA H;  4AH6 A;  3FHW A;  4R1J A;  1MSG A;  4JYA Q;  1GO3 E;  2B2W A;  3GTG B;  3VYU A;  4IFD H;  1LO5 D;  1SAP A;  4LJZ C;  4KKS A;  2I07 B;  4L5S A;  1AE2 A;  1PV4 A;  1E2W A;  4JPB W;  2ZJQ A;  3KJP A;  2A5H A;  2F0Q A;  2L1B A;  4HAE A;  2JA6 B;  1D1K A;  2CKZ B;  1VQD A;  1BBU A;  1NTG A;  3I3C A;  1A62 A;  3DEO A;  5IYD H;  2HQL A;  2K50 A;  4JI4 Q;  1D1I A;  1B9M A;  2KEC A;  5J1Z A;  1V1P A;  4A3E B;  3S16 B;  4JI8 L;  4DU9 A;  4GN5 A;  3FMC A;  1VQ5 A;  5TSS A;  1EIG A;  3VR2 A;  4KV6 A;  3TP8 A;  1E7Z A;  2I5M X;  1HNX Q;  4IFD I;  3K5M A;  4HID A;  3KLS X;  4LW1 A;  1ZXT A;  5LMN Q;  3BDC A;  5IP7 H;  1PTO F;  3MXP A;  4NB3 A;  1A3V A;  2BDN A;  1SYC A;  2R6G A;  4PMW A;  5JJL A;  3MZ5 A;  2QW7 A;  3DWP A;  4O0A A;  4Y7N H;  1L1O C;  4GLA C;  5ELF A;  3T53 B;  4AYB E;  1FNU A;  5DLQ E;  1F2L A;  4IJH A;  1WCM B;  4KJO A;  1PA6 A;  2OF1 A;  3JAM L;  5EBC A;  4DV4 L;  3NPP A;  4BY7 G;  3G71 A;  1O78 A;  4V0B A;  5FLX c;  3A74 A;  2K32 A;  2LFN A;  5IP7 G;  4FO2 A;  1FD7 D;  1N36 Q;  3STB C;  5KND A;  2BE5 D;  3OTO L;  4OX9 Q;  4BBR B;  1D7Q A;  1TT2 A;  4YCW A;  2EYH A;  1AW7 A;  1NJI C;  3BDL A;  4RKB A;  4L63 B;  1E2Z A;  4CKE A;  2PQA B;  4BY1 G;  3D4R A;  2OTL A;  1LV9 A;  4DK0 A;  4HED A;  2CFM A;  2MUY A;  2OCE A;  4CDC C;  1XMQ Q;  1SFO B;  5GAE C;  2EJG C;  1Q1E A;  4ILW A;  1CI3 M;  1DD2 A;  1QOH A;  2UUB Q;  2VQF L;  1V1O A;  3F8T A;  4DV0 Q;  5C3X A;  3OIQ A;  1QZH A;  3K80 C;  2TSS A;  2RF4 A;  2F3V A;  1PH4 A;  3CCQ A;  5J3B A;  2PNH A;  4KY7 A;  2E74 C;  1EY7 A;  1XNQ Q;  1WTQ A;  4A4I A;  4JVZ A;  2O5J C;  3O13 A;  3GTG H;  3MFG A;  3HKZ B;  5HUR A;  3P7J A;  5I6W A;  4JV5 Q;  1TWC B;  1B7Y B;  1RTO A;  4XYQ A;  3PIO A;  3GTK H;  3BVZ A;  2E2D C;  2F0M A;  2JA6 H;  3GV3 A;  4A3I B;  1TII D;  1ICF B;  2ENB A;  1TWH B;  1UE6 A;  2XWB B;  3A7L A;  3PIP 3;  4JI6 Q;  2KCT A;  2PZT A;  1L1O B;  5ELC A;  5C4H A;  5C44 B;  4A93 H;  1NMF A;  2Q2I A;  4EVO A;  4S3S A;  4A3E H;  3S16 H;  1R4P B;  3PUY A;  2HIV A;  4EQ5 A;  2EYF A;  3K81 C;  2A8V A;  1NUC A;  2MO1 A;  3S9W A;  3PCO B;  3RUZ A;  4EGV A;  5J22 A;  4HR7 B;  3S2D B;  1X9N A;  2M9V A;  4LUV A;  2ZJR A;  4KTA A;  5C4Z A;  1J9O A;  1H9K A;  4XQJ A;  5KYI A;  4A93 G;  3GTO B;  1MJC A;  3CU7 A;  4X65 Q;  2VQE Q;  5M3F B;  3OW2 A;  3W2D A;  2WFW A;  3HOY B;  1O7Z A;  3M3Y H;  2JK8 A;  4O1N A;  4TSS A;  4YCV A;  1UUP A;  3S15 H;  1KAW A;  1WCM H;  3HOU G;  1BCP D;  1AZP A;  2F0O A;  2PCF B;  3PF4 A;  2ID0 A;  1PH9 A;  3OYY A;  3T16 A;  4GNX A;  1CFM A;  1KLU D;  1C0A A;  4LF6 Q;  1JOK A;  5IP9 G;  1VQP A;  2E2J B;  3RZO H;  4BBR H;  4WOR A;  4JI7 L;  3NWT A;  1N33 L;  2DY8 A;  1JT8 A;  3NEM A;  2RA4 A;  2WAQ E;  1NNX A;  1YNN C;  3CPF A;  1SFO H;  4UAI A;  1JIC A;  2Y0S E;  3HKS A;  3E0E A;  3KBX A;  4ULL A;  4R4T A;  4OWW B;  1OXU A;  2KEE A;  2JA5 G;  2JEA I;  3C3L A;  4IPC A;  3KYH C;  4DR7 Q;  3MEF A;  3GTM B;  1E3P A;  5CV8 A;  3T13 A;  3MHB A;  1WTX A;  3KF8 A;  4YWL A;  4FF4 A;  2MO0 A;  3K0Y A;  4QL5 A;  4DV3 L;  3P75 A;  2F0T A;  3M4Y A;  1GHJ A;  2H5X A;  2KEN A;  1T9H A;  1WTW A;  1XJV A;  1EL0 A;  5A2Q L;  4QIW E;  4RCO A;  1TWC H;  4PMC A;  2A6E C;  3J7Z C;  1BR9 A;  2NZH A;  1A3U A;  3BS1 A;  3DMU A;  1CKO A;  1DCZ A;  4YHH L;  2FHT A;  3K5L A;  3FP9 A;  4A3K B;  4FXG C;  2OTJ A;  1DXM A;  2D2C C;  2JA7 B;  1IW7 C;  1C8C A;  4Y52 H;  5JVG 3;  5LMU L;  4A3I H;  3H0G G;  4KHP Q;  2Z0S A;  1TWH H;  3VR5 A;  1W2B A;  4B3R L;  4X3U A;  5IT9 c;  4HIM A;  4LFC L;  1PFM A;  1QCB D;  1Y8N B;  3FPU B;  1K73 C;  4K6L A;  3A54 A;  1CQV A;  3WOF A;  4UP9 A;  5C3W A;  3LNN A;  2C5C A;  4DGZ A;  4K2L A;  5G3L D;  1EEI D;  4V19 0;  1EZ6 A;  3I90 A;  2XN9 C;  2LXK A;  1EIY B;  3S2D H;  4PZ6 A;  1AH9 A;  1TU2 B;  4LK1 C;  3GTP B;  2CQA A;  1MKH A;  2YTX A;  3ER0 A;  1PZI D;  1FNV A;  1I4G A;  5M3F H;  3BG3 A;  1JJ2 A;  4OWX B;  2SOB A;  1VQI A;  2VB2 X;  2XWJ B;  4HJ7 A;  2A6H D;  3FPP A;  4ZUJ A;  2SDF A;  4NMZ A;  3SXH A;  5I9P A;  4A3G B;  1YJW A;  4GZY C;  2FIN B;  3DWQ A;  3A55 A;  4KHV A;  2M00 A;  4IPH A;  2YTY A;  5CYU A;  4DFA A;  3KF6 A;  2F0S A;  1LT6 D;  3PO3 B;  1DYQ A;  4K5V A;  2PPB C;  1SNO A;  2K5N A;  1PH7 A;  5COY A;  1LLR D;  2NWG A;  1TXY A;  4X3K A;  1Q8K A;  2D62 A;  1AZQ A;  4C3J G;  4M8A A;  4I65 A;  4A3M B;  4FF1 A;  1U0L A;  2HHH Q;  3K8A A;  2Q8T A;  5L37 A;  1HNW L;  4B3M Q;  4K14 A;  1G29 1;  4TKO B;  1HZA A;  4IOC A;  3EA6 A;  4DR4 L;  2K75 A;  2B29 A;  3GTM H;  1TVX A;  1C4Q A;  2Q8R E;  1SJE D;  1KAB A;  2ICI A;  1JE4 A;  4JI0 Q;  2FMC A;  2F1M A;  1R9T B;  4A3D B;  5JJK A;  1MJE A;  3A0J A;  4DV3 Q;  4K2K A;  1XMO Q;  3MEH A;  5C4X B;  4OEM B;  3I55 A;  2R92 B;  3PO2 B;  1WI5 A;  1GM5 A;  1SYF A;  4LFA Q;  2IWH A;  1HQM C;  3I56 A;  3Q8D A;  2F0N A;  3I73 A;  3K7U C;  4JW0 A;  3T51 B;  2K52 A;  1UWV A;  4N9T A;  4GKJ L;  4A3C G;  1Q90 A;  1UE7 A;  1GUG A;  5DEH A;  4B3R Q;  2EYP A;  4X64 Q;  4X66 Q;  1SEB D;  3MWY W;  1KRS A;  2IT1 A;  3TP6 A;  4LFC Q;  2XSC A;  4DK6 C;  1XPR A;  5JEA J;  3D3R A;  3BJU A;  2D0P A;  4ZAI A;  5BR8 Q;  1I3Q B;  3UDX A;  3C1F A;  1AEX A;  4RGM A;  4IFD J;  1S5F D;  2CWA A;  4OEL B;  4R4Q A;  1N9W A;  2EYO A;  2AUJ D;  1TWG H;  3T1Y L;  1N32 L;  1FYC A;  1STH A;  2CQO A;  2D0O A;  3MXU A;  4FP5 D;  4RH6 A;  4DNR B;  3K7A H;  3G7L A;  4JG2 A;  2ALY B;  2WAQ B;  4X62 L;  2Y0S B;  4XYO A;  3CCS A;  4DR2 L;  3M4Q A;  1CHP D;  4MTN A;  1O7Y A;  1VQE A;  1PYS B;  3H91 A;  1QVF A;  3J81 i;  1O7I A;  1YJN A;  1ONL A;  1VQ7 A;  1B44 D;  4DN4 M;  1PMR A;  3G6J B;  1EQQ A;  1VQ6 A;  3WWV A;  3L9A X;  1I4X A;  4M1U B;  1HR0 W;  1HH2 P;  1QZG A;  2UUC L;  3FDT A;  3J80 E;  3AMU A;  3GQB A;  1HZB A;  3PO3 H;  2UXC L;  1I6H B;  4FXD A;  4KHZ A;  2B3G A;  3W3A A;  4JC0 A;  4JBJ A;  3VDY A;  2PMZ E;  4APV A;  1Y14 B;  1VQ4 A;  3TBI B;  4A3M H;  3D6C A;  2UXD Q;  2F3W A;  2H1E A;  3SDZ A;  2O4X A;  2V1C C;  1E24 A;  4DK1 A;  2EY6 A;  2PQE A;  5M9O A;  5C0X J;  4K8J A;  1UEB A;  4OXP A;  5T1I A;  2YU9 B;  2G9D A;  2RSN A;  3QOJ A;  5CV7 A;  2PZU A;  4Q0F A;  4WJW A;  3BZD B;  2GVA A;  2A69 D;  4E6I A;  3PO2 H;  3TEH B;  2V4D A;  1KDC A;  3PF5 A;  4PQX A;  4UPA A;  2F0V A;  4ME3 A;  1PFN A;  2B2W C;  5C5L A;  3I4N G;  3F1Z A;  5DNF A;  4IZ8 A;  4GOP A;  3F2U A;  4KN4 C;  1MIU A;  5HGQ A;  1CKM A;  1LYL A;  2UU9 L;  4A76 A;  3PMF A;  2B2U A;  1V43 A;  1SNQ A;  2IW3 A;  3CAM A;  3EIV A;  2HD3 A;  4JI3 Q;  2BH2 A;  2E2I H;  3CKI B;  1YJ9 A;  2CH4 W;  4R4I A;  4FVM A;  4P73 A;  1KXL A;  1B9N A;  4TVA B;  1BO0 A;  1VQM A;  4BY7 B;  5JOB A;  2HCC A;  5M5W H;  1Y8O B;  1Z47 A;  4WFN 3;  4P72 A;  1I3Q H;  1I4P A;  4XXE A;  3URY A;  4MTK A;  1Y69 U;  2EYJ A;  4BY1 B;  2RDH A;  3TN2 A;  4JK1 C;  1N32 Q;  2SEB D;  1WTP A;  3GD7 A;  1RD9 D;  3B6Y A;  3RN5 A;  5C3E G;  2IJ0 A;  4L5Q A;  4F7X A;  4KY6 A;  2R93 G;  1EY5 A;  1JOO A;  2AHO B;  1VF7 A;  4DV2 Q;  5M3M H;  2NUC A;  4DR3 Q;  1YIJ A;  2N78 A;  4J6H A;  5HY6 A;  2MHV A;  4DR2 Q;  4NP5 A;  1HJP A;  1TY2 A;  1P16 A;  5ELB A;  1A2T A;  3CP0 A;  1LTS D;  2XGT A;  3AU7 A;  4K6D A;  4DR6 Q;  4FXK C;  2E5L L;  1V8Q A;  5CV6 A;  1F9S A;  5EJW A;  3SK5 A;  2F0F A;  3KLS A;  2RHS B;  4IJL A;  1WYD A;  1RIP A;  2IL8 A;  1DJR D;  2I46 A;  4JCV E;  5M3M G;  5JJZ A;  2VNU D;  1JB3 A;  1STG A;  3JAM i;  2XRQ D;  1HQR D;  3TSS A;  1A0I A;  5KNC A;  2F03 A;  2DY7 A;  4DV5 L;  1B50 A;  1VQK A;  1YVC A;  3UE1 A;  1S72 A;  5LHY 1;  1X3F A;  3UI2 A;  1PLF A;  5FKA C;  1HFN A;  1HNZ Q;  4CHT B;  1L0Y B;  3NXW A;  4U67 3;  2CW0 D;  4DV7 Q;  4DUZ Q;  3G4S A;  5AJ3 L;  2YU9 H;  4NXM L;  1S5E D;  3OW7 A;  4KLK A;  1NBW A;  1PH2 A;  2NVX B;  1SE8 A;  1U4L A;  1BCP F;  3GTK B;  1BDO A;  2LXJ A;  1GUS A;  1ENF A;  2B2Y A;  3S14 B;  1Y1W G;  4ALP A;  1PVO A;  4ID6 A;  4NW2 A;  1V1P B;  1I6V C;  1CSQ A;  2JEB I;  2C35 B;  4MIU A;  1SR3 A;  4YIJ A;  1PTO C;  3VYS A;  3J7Y W;  2DN8 A;  3VR4 A;  4A93 B;  1NCV A;  3W1B A;  4K0K Q;  1WTR A;  1HXY D;  4A3B H;  2NVQ B;  1HHV A;  1X3P A;  2UU9 Q;  2AQ2 B;  4QF4 A;  1TWA H;  5COR A;  2PYK A;  2R7Z H;  2ZXP A;  3BYY B;  1VS0 A;  1X6O A;  4UP7 A;  1XPU A;  4ZK9 B;  1W6J A;  4BY7 H;  1VQG A;  3HOX H;  1JJC B;  4L6T B;  3TRE A;  4F88 A;  2D9U A;  3U58 A;  3ULP A;  2RQX A;  5JVH 3;  1KIX A;  1H9J A;  1WD1 A;  3C2P A;  1KAA A;  5A2Q E;  4O2D A;  4JOI A;  2F4V Q;  4A3B G;  4B3S L;  3M3Y B;  4FNF A;  2EVB A;  1EFI D;  4LF7 L;  1LTA D;  3S15 B;  1PH8 A;  5FOB B;  5E4X A;  2IX1 A;  4BY1 H;  4DUY Q;  2R7Z G;  4RMF A;  1YNJ D;  3HOX G;  1Q12 A;  3TDQ A;  1SNC A;  4GS3 A;  5C5M A;  2J0T D;  2X69 A;  1G6Z A;  3E5S A;  2JA5 B;  4ZKC B;  4YY3 L;  1P8L A;  2B2V C;  5BN3 A;  5M5X B;  1XXG A;  2E75 C;  1KC8 C;  3RZO B;  4AQY Q;  1ZYR C;  4HJ8 A;  3AFP A;  5C6A A;  4ZQ3 A;  1VQN A;  1I50 B;  2PW7 A;  1MBY A;  2L5T A;  4JI2 L;  5JAV A;  1Y1V G;  1A3T A;  3MA2 B;  1XTC D;  5FO9 B;  1HZ9 A;  4GNX C;  1IBL L;  4RKL A;  3KDF A;  4UY8 C;  1FR3 A;  3LWE A;  5EKK A;  4BBS H;  1XX8 A;  1YIT A;  4DXG A;  3UDG A;  4HIK A;  1GUW A;  2Q2H A;  4BA2 I;  3I2Z A;  4B3T L;  3D4D A;  1TR5 A;  2OQK A;  2MQH A;  3SVM A;  5C4J B;  4DV5 Q;  3S1M H;  5G3L F;  1TWF H;  1NMG A;  3K6O A;  1X55 A;  1IYJ B;  1PTO B;  4LUO A;  4I7A A;  2QEX A;  4G57 A;  1EIF A;  3H0G B;  5IOC A;  1G91 A;  2C9O A;  2EIF A;  3I4L A;  4PV1 C;  4BBS G;  3VR6 A;  2HDM A;  3L0O A;  5AJ3 Q;  1S40 A;  2F0I A;  4NXM Q;  2N49 A;  2X6L A;  4K5X A;  1IKL A;  3CQZ B;  2NVX H;  5KEE A;  5IGB A;  4NDX A;  1CQF A;  4HN7 A;  4R8N A;  2AUK A;  1U4P A;  4CKC A;  3S14 H;  1TS2 A;  1X56 A;  3V05 A;  3UDF A;  4RAU C;  1PHJ A;  3D4W A;  4IUQ A;  4LFB L;  2R3Z A;  2NVQ H;  1IYV A;  1E2V A;  3M7G A;  4JI8 Q;  3IRB A;  3PGZ A;  1ICW A;  3HOU H;  4DPG A;  1GHK A;  3A5Z B;  2HIX A;  4OGQ C;  3EBE A;  3ZJY C;  2E2H H;  4OO1 H;  1CKN A;  3LWU A;  4DAY B;  2OXP A;  3BZK A;  1M4V A;  1SYE A;  1EOV A;  4C56 C;  1K8G A;  2VB3 X;  3TME A;  4GKK L;  3P20 A;  1I94 L;  3SE0 A;  3M4O B;  2JA8 G;  5IP9 H;  4G7O C;  4OON A;  5I6Y A;  4CGY B;  2Z6B A;  4KI0 A;  3K59 A;  4B3S Q;  4GNX B;  2IX3 A;  2ATW A;  5FJ8 H;  4C3J B;  4OO1 G;  4DV4 Q;  1EYD A;  1BNZ A;  2K04 A;  2JA5 H;  1JC7 A;  4YY3 Q;  5M5X H;  1W6K A;  3OTO Q;  2HQE A;  3CCM A;  2F3I A;  2QDB A;  4XDX A;  4OO1 I;  1IZ6 A;  1I50 H;  1PYB A;  1UNS A;  2JA9 A;  1KRT A;  2K14 A;  1STN A;  1WOC A;  5LMN W;  1JOR A;  5FJ8 G;  1HZC A;  4JI2 Q;  2MNA A;  3CCU A;  1E22 A;  5EKI A;  4Q5V A;  3NEL A;  5JPN C;  4IN3 A;  3KF8 B;  2MGS A;  2EDG A;  4DR5 L;  4DNT B;  3NQT A;  2VQF Q;  1HUM A;  4B9X A;  5CBE E;  3CCV A;  3HG9 A;  1C9O A;  2F0L A;  1Q7Y C;  3HP3 A;  5C4J H;  1SMY C;  1U9R A;  1KL9 A;  1BOS A;  2VW9 A;  1PTO H;  1KTK A;  3S1R B;  4POG A;  3H0G H;  4HMI A;  2A73 B;  3T56 B;  5H1S E;  1N34 L;  4LF5 L;  3GTQ H;  3AB9 A;  3H94 A;  4HSP A;  3PSI A;  2Q8I B;  1V1Q A;  1EYG A;  1SJH D;  3CQZ H;  3BZC A;  1BKB A;  1TKW B;  2JP1 A;  1RKN A;  2BDO A;  2N8N A;  1UEA B;  1YNX A;  1F2Y A;  4IUP A;  1SNM A;  1OO9 B;  1ENA A;  4AYB B;  4DR1 L;  2L11 A;  2SNM A;  1SE2 A;  5FLX L;  3QWN A; 
#chains in the Genus database with same CATH homology
 3VYR A;  1G2T A;  1MGS A;  1MD2 D;  3MC0 B;  1EQV A;  1GUO A;  1GOZ A;  1TY0 A;  5EQ0 A;  1JWM D;  3OWE B;  3GP7 A;  5BN4 A;  4Z9C B;  1R4Q B;  2K5W A;  1SBB B;  1TWG B;  4XQN A;  3FEW X;  3K7A B;  3CRL C;  3EJI A;  2F0K A;  5EKL A;  3N6R A;  4RFB A;  2EYL A;  1O7L A;  1IYU A;  4RHS A;  2EY5 A;  2F0H A;  1ZKO A;  3BYT B;  2WV6 D;  4X3T A;  1NSN S;  4ZUI A;  3PUZ A;  3J81 E;  5K36 H;  3TZU A;  1SE4 A;  4LAA A;  3SHL A;  1RDP D;  2KCC A;  3K5O A;  3OSO A;  2AWN A;  3VA5 A;  3KUP A;  3IL8 A;  1T5X D;  1PZJ D;  4FF3 A;  1SE3 A;  3CHB D;  5K36 G;  5ELE A;  2BA0 A;  3DEP A;  5IGD A;  4JBW A;  4KD3 A;  3I4N B;  1LTI D;  2A74 C;  1S4Z A;  4HCS A;  4KK7 A;  4QMG A;  5CV4 A;  5AFW A;  5KIX A;  3VA7 A;  1EYA A;  5A35 A;  1EIH A;  3BDO A;  2WII B;  1T5E A;  3NBI A;  2YYZ A;  3GO5 A;  5E3F A;  3OMC A;  1Q1B A;  1EWH A;  4H7B A;  2GA4 B;  2KUM A;  3NUC A;  4R8I A;  5LL6 S;  1ESF A;  1I4Q A;  3D8G A;  4B08 A;  1F2Z A;  4J8Q A;  2E2I B;  2B8G A;  4HCE A;  5C3E B;  5M5W B;  1G8Z D;  1RF2 D;  2BCO A;  1ET6 A;  2R93 B;  3N52 A;  1HA5 A;  4RGN A;  3DUZ A;  3NP8 A;  1I4H A;  4C3I G;  1PRT C;  1ET9 A;  1TS5 A;  2B2U C;  4C1N K;  1AN8 A;  3QJY A;  3IFD A;  2NBF A;  1EU3 A;  1TQO A;  2F0P A;  4ZLT F;  2O2L D;  5CV9 A;  5E1F A;  5M3M B;  4KN7 C;  2L55 A;  3ND8 A;  1DON A;  2LY7 A;  2VXW A;  1YNN D;  1B3A A;  2JXM B;  1TS4 A;  1S5B D;  1DM0 B;  2OEO A;  4DAP A;  3OIP A;  2EPB A;  5I9O A;  3R3O A;  1PYW D;  2Z4H A;  2EYM A;  3U9S A;  2FMM A;  2J7Z A;  4QIW B;  1QIL A;  1WTO A;  3JAM E;  4KMU C;  1Y1W B;  1QNK A;  5DM6 3;  3MVV A;  2BE5 C;  5IT9 L;  5D65 A;  2A6E D;  1E0B A;  2EOT A;  3Q23 A;  2A68 C;  2B8F A;  3OOC A;  2NTS A;  1DOK A;  1IW7 D;  2ZXR A;  1H9R A;  4QB4 A;  1CTM A;  3SK8 A;  4CJ0 B;  5CR3 A;  3EQL C;  2JYO A;  1STY A;  1H9S A;  1PRT B;  5IGF A;  4DAV A;  3C1E A;  2L4N A;  4A3B B;  1SND A;  2QF7 A;  3NWS A;  1TWA B;  2R7Z B;  4I7Z C;  3IKJ A;  2B2Y C;  3HOX B;  4NKL A;  5IGE A;  1GUN A;  5ISR A;  1Z7T A;  2RBM A;  3MXG A;  5KGU A;  1JWU D;  4QUC A;  1EOT A;  3HEJ A;  3I70 A;  1U4M A;  1F9P A;  2WP8 J;  3KBG A;  3S1N B;  3A8J E;  1Y1V B;  2MPM A;  3PUX A;  5EBD A;  5D3I B;  2L0C A;  2F0J A;  4CKB A;  4XQQ A;  4C3H G;  5HGT A;  5IIF A;  5BN5 A;  5F2D A;  1QB5 D;  5CC4 A;  3V2T A;  1D5M C;  2NN6 G;  2LS0 1;  3PV0 A;  2KVM A;  3MTS A;  4RGO S;  1A2U A;  5CV5 A;  4BBS B;  3IAY A;  2B39 A;  2K28 A;  2KA7 A;  4ZKB B;  1BCP C;  3S1M B;  1TWF B;  1D5X C;  1OXX K;  3FRP B;  3BVG A;  1LAC A;  1SYG A;  2J4X A;  4R9W A;  2F0W A;  5FO7 B;  3PUW A;  5EPL A;  3KLR A;  5I2X A;  4P2C B;  1BUV T;  1BXT A;  3EFX D;  1EWC A;  4RHR A;  1EZ8 A;  3H09 A;  5JPM C;  5I4D A;  4ODG A;  1NR4 A;  1EU4 A;  1F2M A;  4ME5 A;  2NTT A;  2JA8 B;  2PW5 A;  3FVQ A;  2F0G A;  2EZV A;  3OMG A;  3A8I E;  3SEB A;  3HOU B;  1PRT D;  2LMC B;  4IUV A;  3J7A F;  5JEA G;  1CM9 A;  2E2H B;  2O5I C;  3NQI A;  1JWS D;  4QUF A;  4MN3 A;  4LMQ D;  2XVS A;  4IFD G;  2NYZ D;  2L12 A;  2IX0 A;  5IOD A;  2EY1 A;  1D2B A;  4EQO A;  2BA1 A;  2QIL A;  2KJX A;  3Q24 A;  1STE A;  4OHJ A;  1X3Q A;  2PMZ B;  3J80 L;  2E76 C;  1BCP B;  3QB3 A;  2K5Q A;  1EY4 A;  1MI2 A;  4IUN A;  4B9W A;  3IFT A;  5FLX E;  4IUR A;  3T4A C;  4QCL A;  3ND9 A;  1JCK B;  1GJX A;  1RCV D;  3HRZ C;  1QJO A;  1I4R A;  1O80 A;  5C0X H;  2DNE A;  2RDG A;  5M5Y B;  1D6E C;  3SK4 A;  3E6Z X;  3OHX C;  1Z6H A;  4U68 A;  4ZRZ A;  3WDN A;  4IUT A;  3ERO A;  3QOL A;  1A15 A;  2A6H C;  2A68 D;  1XYI A;  3NK9 A;  2B2T A;  5C0X G;  3GTL B;  5DAU A;  1NR2 A;  2CVR A;  2K01 A;  3GTQ B;  1HCZ A;  2SNS A;  3NTK A;  3R2I A;  4KKU A;  4XT1 B;  5I2Y A;  4CJ2 C;  5C0X I;  3U9O A;  1HA6 A;  4ZYS A;  3J7A V;  2BOS A;  1WD0 A;  1QNU A;  1KNE A;  3ITP A;  1L0X B;  2Z1C A;  1BBX C;  1KLG D;  4RCN A;  3I8Z A;  2Z4I A;  1EY6 A;  3C46 A;  1Y8P B;  3NTI A;  3E0J A;  1HTL D;  5KRU A;  3L3O C;  1LTR D;  1SNP A;  1OXS C;  2RKS A;  4G4K A;  4TRD A;  1ENC A;  3TP7 A;  4PNY A;  1VDZ A;  2M2L A;  2RSO A;  1TS3 A;  3R2T A;  1JOQ A;  1LTT D;  2B2V A;  2KED A;  2K6A A;  1CHQ D;  1B2T A;  4DAY A;  3S1Q B;  2B63 B;  1F9Q A;  2Z8L A;  3RLF A;  1Q8I A;  2AWO A;  2K5D A;  5DM7 3;  2HUG A;  1MSH A;  1KDA A;  1IL8 A;  1SYB A;  2JSO A;  1BQQ T;  1A6X A;  5K5P A;  1HPC A;  1VCI A;  1RHP A;  4DXF A;  4BA1 I;  2HCI A;  2N55 A;  3A56 A;  5EGT A;  3PIO 3;  4F8M A;  1DZ1 A;  3Q22 A;  3A8K E;  1SYD A;  4IQZ A;  2N88 A;  1STA A;  1PTO D;  1ROD A;  3NTH A;  1CK1 A;  1K8M A;  3K57 A;  2HDL A;  1RTN A;  2NVY B;  4C3I B;  1EQT A;  4FF2 A;  1U4R A;  3S2H B;  3HOW B;  3RD4 A;  1GXD C;  4N9P A;  2K33 A;  1RJT A;  4C1N I;  5IT9 E;  3GV6 A;  2G9H D;  4HSV A;  2A69 C;  1M8A A;  1GUT A;  1B53 A;  2PO4 A;  2NB0 A;  2VUM B;  1LT4 D;  1EY0 A;  4RA8 A;  1LT3 D;  2K1B A;  3WOE A;  1WTV A;  2EJM A;  2RDF A;  5D14 A;  1CZW A;  3H3V C;  1ZYR D;  2ZXO A;  4H13 C;  4UDU C;  1EY9 A;  3HOV B;  3NHH A;  3SR1 A;  3QO2 A;  4KKT A;  2QCP X;  1CA5 A;  1CZG A;  1F9R A;  1ESR A;  3S17 B;  1OXV A;  1LTG D;  1NAP A;  4IAL A;  5LL6 X;  5KNB A;  3M7N A;  3H6M A;  1DOM A;  1F77 A;  3NSW A;  3ZYY X;  4A3J B;  4X3S A;  2FFK B;  4F87 A;  1QE6 A;  1AFP A;  1D5Z C;  2IPK D;  3HOZ B;  5CGK A;  3PUV A;  1BF4 A;  1WVL A;  3I72 A;  2OT2 A;  1SDF A;  3DWA A;  3DXJ C;  5E4W C;  2F0E A;  1J8I A;  3MFY A;  3TZD A;  1HFG A;  3NBH A;  1JR0 D;  4KJN A;  4C2M B;  1X32 A;  2LKV A;  1EEF D;  3D31 A;  5FK9 C;  1VF5 C;  4FYD A;  3GTJ B;  3RZD B;  1VMC A;  2DNC A;  4J1M A;  2NZ1 D;  1QG7 A;  1HUN A;  3A7A B;  2QKI C;  3R8B A;  3D6W A;  3CRK C;  2WKD A;  3QIA A;  4K8I A;  5NUC A;  3V96 A;  2MJ8 A;  4WRD A;  3X3N A;  4RWS C;  4G7Z C;  3ONA B;  1IKM A;  2PNR C;  2EE1 A;  4RGT A;  3RMH A;  1HTP A;  2F0U A;  1EY8 A;  5IGG A;  1LAB A;  2ZT9 C;  2CW0 C;  4DF7 A;  3BVM A;  2NVT B;  1SSO A;  5FO8 B;  4C3H B;  5ELD A;  1B4O A;  1HRJ A;  1PXU A;  1AP0 A;  2WKC A;  1H9M A;  1STB A;  2H4O A;  3FKI B;  1ILQ A;  1B1Z A;  4IUU A;  2L9H A;  2KCN A;  2MP1 A;  3DHQ A;  2RVL A;  3HGB A;  4CJ1 B;  2WAC A;  4KD4 A;  1KNA A;  3Q6S A;  5KYL A;  1CA6 A;  3K58 A;  1UAP A;  4DA2 A;  1PRT F;  1SMY D;  3R93 A;  1YNJ C;  2R61 A;  1LTB D;  2KHS A;  1K83 B;  1FNW A;  3DM1 A;  1XWE A;  2EY2 A;  3VYT A;  1S5C D;  3KK7 A;  4OL7 A;  4H44 C;  3HS0 C;  1H9S B;  5T1G A;  3HZX A;  1ML0 D;  1JQY D;  5EPJ A;  1Q3L A;  2XIW A;  1K8O A;  3SK6 A;  4KY5 A;  3Q0A A;  2X6G A;  3P1H A;  4MHE A;  1PFB A;  2K7V A;  2CHB D;  4H0L C;  4K5W A;  4ABN A;  3MAQ A;  1PZK D;  2F4I A;  1EYC A;  3K5N A;  3VR3 A;  4G7H C;  4BS9 A;  4EQP A;  2K05 A;  3LX0 A;  3L7Z C;  4PMB A;  2XRS D;  2FJ2 A;  3M85 A;  3QG1 A;  1DOL A;  2F0D A;  3I4M B;  5IGC A;  2NN6 H;  3J81 L;  1VMP A;  3X3M A;  1C48 A;  4XTC S;  1IHZ A;  2D5D A;  4BWG B;  5EPK A;  1KDB A;  2JE6 I;  1II3 A;  2XNA C;  3ERQ A;  3EVQ A;  1ILP A;  4Y7N B;  1FGB D;  4A3F B;  2K03 A;  3OPO A;  3OWF A;  4TQU S;  4CBV A;  2AQ1 B;  2KQ3 A;  1S5D D;  2ICE C;  2QEJ C;  2WB1 B;  2PZW A;  3TP5 A;  2WIN B;  5CMD A;  5J39 A;  1PDQ A;  2EJF C;  1SXT A;  3I91 A;  1OXT A;  4OIJ A;  3MXN A;  4XIG S;  2NN6 I;  4L8J A;  5D3D A;  1G2S A;  1LT5 D;  4XT3 B;  2AQ3 B;  2EXZ A;  5CBA E;  2TMP A;  1ZEQ X;  4OIK A;  1QWY A;  1CT1 D;  4HTH A;  4O42 A;  2KOL A;  4HMJ A;  3NE5 B;  4EQN A;  2B2T C;  5JEA H;  1MSG A;  2B2W A;  3GTG B;  3VYU A;  4IFD H;  1LO5 D;  1SAP A;  4LJZ C;  4KKS A;  2I07 B;  1E2W A;  2A5H A;  2F0Q A;  2L1B A;  4HAE A;  2JA6 B;  1D1K A;  3I3C A;  3DEO A;  1D1I A;  1B9M A;  2KEC A;  5J1Z A;  1V1P A;  4A3E B;  3S16 B;  4DU9 A;  3FMC A;  5TSS A;  1EIG A;  3VR2 A;  4KV6 A;  3TP8 A;  4IFD I;  3K5M A;  3KLS X;  1ZXT A;  3BDC A;  1PTO F;  3MXP A;  1A3V A;  2BDN A;  1SYC A;  2R6G A;  4PMW A;  3MZ5 A;  3DWP A;  5ELF A;  3T53 B;  1FNU A;  1F2L A;  1WCM B;  4KJO A;  2OF1 A;  3JAM L;  5EBC A;  3NPP A;  1O78 A;  4V0B A;  2K32 A;  2LFN A;  4FO2 A;  1FD7 D;  5KND A;  2BE5 D;  4BBR B;  1TT2 A;  2EYH A;  1AW7 A;  3BDL A;  4RKB A;  4L63 B;  1E2Z A;  4CKE A;  3D4R A;  1LV9 A;  4DK0 A;  4HED A;  2MUY A;  1SFO B;  2EJG C;  1Q1E A;  4ILW A;  1CI3 M;  1DD2 A;  1QOH A;  1V1O A;  5C3X A;  3OIQ A;  2TSS A;  2F3V A;  4KY7 A;  2E74 C;  1EY7 A;  1WTQ A;  2O5J C;  3O13 A;  3MFG A;  3HKZ B;  5HUR A;  3P7J A;  5I6W A;  1TWC B;  1RTO A;  4XYQ A;  3BVZ A;  2E2D C;  2F0M A;  3GV3 A;  4A3I B;  1TII D;  2ENB A;  1TWH B;  2XWB B;  3A7L A;  3PIP 3;  2PZT A;  5ELC A;  5C4H A;  5C44 B;  4EVO A;  4S3S A;  1R4P B;  3PUY A;  2EYF A;  1NUC A;  3S9W A;  3RUZ A;  4EGV A;  5J22 A;  4HR7 B;  3S2D B;  2M9V A;  4KTA A;  5C4Z A;  1J9O A;  1H9K A;  4XQJ A;  5KYI A;  3GTO B;  3CU7 A;  5M3F B;  3W2D A;  3HOY B;  1O7Z A;  4TSS A;  4O1N A;  1UUP A;  1BCP D;  1AZP A;  2F0O A;  2PCF B;  2ID0 A;  3T16 A;  1CFM A;  1KLU D;  1JOK A;  2E2J B;  4WOR A;  3NWT A;  2DY8 A;  2RA4 A;  1YNN C;  4UAI A;  1JIC A;  3KBX A;  4ULL A;  1OXU A;  2KEE A;  2JEA I;  3C3L A;  3GTM B;  5CV8 A;  3T13 A;  3MHB A;  1WTX A;  3KF8 A;  4FF4 A;  3K0Y A;  3P75 A;  2F0T A;  3M4Y A;  1GHJ A;  1WTW A;  1EL0 A;  5A2Q L;  4RCO A;  4PMC A;  2A6E C;  3BS1 A;  1BR9 A;  1A3U A;  3DMU A;  1DCZ A;  3K5L A;  2FHT A;  4A3K B;  4FXG C;  1DXM A;  2D2C C;  2JA7 B;  1IW7 C;  1C8C A;  5JVG 3;  3VR5 A;  4X3U A;  1PFM A;  1QCB D;  1Y8N B;  3FPU B;  4K6L A;  3A54 A;  1CQV A;  3WOF A;  5C3W A;  3LNN A;  2C5C A;  4DGZ A;  4K2L A;  5G3L D;  1EEI D;  4V19 0;  1EZ6 A;  3I90 A;  2XN9 C;  1TU2 B;  4LK1 C;  3GTP B;  2CQA A;  1PZI D;  1FNV A;  1I4G A;  3BG3 A;  2SOB A;  2VB2 X;  2XWJ B;  2A6H D;  3FPP A;  4ZUJ A;  2SDF A;  4NMZ A;  3SXH A;  5I9P A;  4A3G B;  4GZY C;  2FIN B;  3DWQ A;  3A55 A;  4KHV A;  2M00 A;  5CYU A;  4DFA A;  2F0S A;  1LT6 D;  3PO3 B;  1DYQ A;  4K5V A;  2PPB C;  1SNO A;  5COY A;  1LLR D;  2NWG A;  4X3K A;  2D62 A;  1AZQ A;  4C3J G;  4M8A A;  4I65 A;  4A3M B;  4FF1 A;  2Q8T A;  4K14 A;  1G29 1;  4TKO B;  3EA6 A;  1TVX A;  1C4Q A;  2Q8R E;  1SJE D;  1KAB A;  2ICI A;  1JE4 A;  2FMC A;  2F1M A;  1R9T B;  4A3D B;  4K2K A;  3MEH A;  5C4X B;  2R92 B;  3PO2 B;  1SYF A;  2IWH A;  1HQM C;  2F0N A;  3I73 A;  3T51 B;  4N9T A;  1Q90 A;  1GUG A;  5DEH A;  2EYP A;  1SEB D;  3MWY W;  3TP6 A;  2IT1 A;  2XSC A;  5JEA J;  3D3R A;  4ZAI A;  1I3Q B;  3C1F A;  1AEX A;  4RGM A;  4IFD J;  1S5F D;  2EYO A;  2AUJ D;  1FYC A;  1STH A;  3MXU A;  4FP5 D;  4RH6 A;  4DNR B;  3G7L A;  2WAQ B;  2Y0S B;  4XYO A;  1CHP D;  1O7Y A;  3H91 A;  1ONL A;  1B44 D;  4DN4 M;  1PMR A;  3G6J B;  3L9A X;  1I4X A;  4M1U B;  3FDT A;  3J80 E;  3AMU A;  3GQB A;  1I6H B;  4FXD A;  4KHZ A;  3W3A A;  3TBI B;  3D6C A;  2F3W A;  2H1E A;  3SDZ A;  2O4X A;  4DK1 A;  2EY6 A;  2PQE A;  5M9O A;  5C0X J;  4K8J A;  5T1I A;  2YU9 B;  2G9D A;  2RSN A;  3QOJ A;  5CV7 A;  2PZU A;  4Q0F A;  4WJW A;  3BZD B;  2A69 D;  4E6I A;  2V4D A;  1KDC A;  4PQX A;  2F0V A;  1PFN A;  2B2W C;  5C5L A;  5DNF A;  4IZ8 A;  3F2U A;  4KN4 C;  3PMF A;  2B2U A;  1V43 A;  1SNQ A;  2IW3 A;  3CKI B;  4FVM A;  1B9N A;  1BO0 A;  4BY7 B;  5JOB A;  2HCC A;  1Y8O B;  1Z47 A;  4WFN 3;  1I4P A;  4XXE A;  3URY A;  1Y69 U;  2EYJ A;  4BY1 B;  2RDH A;  3TN2 A;  4JK1 C;  2SEB D;  1WTP A;  3GD7 A;  1RD9 D;  2IJ0 A;  4F7X A;  4KY6 A;  1EY5 A;  1JOO A;  1VF7 A;  2NUC A;  4J6H A;  2MHV A;  4NP5 A;  1TY2 A;  5ELB A;  1A2T A;  1LTS D;  3AU7 A;  4K6D A;  4FXK C;  1V8Q A;  5CV6 A;  1F9S A;  5EJW A;  3SK5 A;  2F0F A;  3KLS A;  2IL8 A;  1DJR D;  2I46 A;  2VNU D;  5JJZ A;  1JB3 A;  1STG A;  2XRQ D;  1HQR D;  3TSS A;  5KNC A;  2F03 A;  2DY7 A;  1B50 A;  5LHY 1;  3UI2 A;  1PLF A;  5FKA C;  1HFN A;  4CHT B;  1L0Y B;  3NXW A;  4U67 3;  2CW0 D;  1S5E D;  3OW7 A;  2NVX B;  1U4L A;  1BCP F;  3GTK B;  1BDO A;  1GUS A;  1ENF A;  2B2Y A;  3S14 B;  4ID6 A;  4NW2 A;  1V1P B;  1I6V C;  2JEB I;  4MIU A;  4YIJ A;  1PTO C;  3VYS A;  3J7Y W;  2DN8 A;  3VR4 A;  4A93 B;  1NCV A;  1WTR A;  1HXY D;  2NVQ B;  1HHV A;  1X3P A;  2AQ2 B;  4QF4 A;  5COR A;  2PYK A;  2ZXP A;  3BYY B;  4ZK9 B;  1W6J A;  4L6T B;  4F88 A;  2D9U A;  2RQX A;  5JVH 3;  1H9J A;  1WD1 A;  3C2P A;  1KAA A;  5A2Q E;  3M3Y B;  4FNF A;  2EVB A;  1EFI D;  1LTA D;  3S15 B;  5FOB B;  5E4X A;  2IX1 A;  1YNJ D;  1Q12 A;  3TDQ A;  1SNC A;  5C5M A;  2J0T D;  2X69 A;  1G6Z A;  3E5S A;  2JA5 B;  4ZKC B;  5BN3 A;  2B2V C;  5M5X B;  1XXG A;  2E75 C;  3RZO B;  1ZYR C;  5C6A A;  4ZQ3 A;  1I50 B;  2PW7 A;  1MBY A;  2L5T A;  5JAV A;  3MA2 B;  1A3T A;  1XTC D;  5FO9 B;  4RKL A;  1FR3 A;  3LWE A;  5EKK A;  1XX8 A;  4DXG A;  1GUW A;  4BA2 I;  3D4D A;  1TR5 A;  3SVM A;  5C4J B;  5G3L F;  3K6O A;  1PTO B;  4G57 A;  3H0G B;  5IOC A;  1G91 A;  2C9O A;  3I4L A;  4PV1 C;  3VR6 A;  2HDM A;  2F0I A;  2X6L A;  4K5X A;  1IKL A;  3CQZ B;  5KEE A;  5IGB A;  4NDX A;  1CQF A;  4HN7 A;  4R8N A;  2AUK A;  1U4P A;  4CKC A;  1TS2 A;  3V05 A;  4RAU C;  3D4W A;  4IUQ A;  2R3Z A;  1IYV A;  1E2V A;  3M7G A;  1ICW A;  1GHK A;  4OGQ C;  4OO1 H;  3LWU A;  2OXP A;  1M4V A;  1SYE A;  4C56 C;  2VB3 X;  3TME A;  3P20 A;  3SE0 A;  3M4O B;  4G7O C;  5I6Y A;  4CGY B;  4KI0 A;  3K59 A;  2IX3 A;  4C3J B;  4OO1 G;  1EYD A;  1BNZ A;  2K04 A;  1JC7 A;  1W6K A;  2HQE A;  2QDB A;  4XDX A;  4OO1 I;  1UNS A;  1STN A;  1JOR A;  5EKI A;  4Q5V A;  5JPN C;  4IN3 A;  2MGS A;  2EDG A;  4DNT B;  3NQT A;  1HUM A;  4B9X A;  5CBE E;  3HG9 A;  2F0L A;  3HP3 A;  1SMY C;  1U9R A;  1BOS A;  1PTO H;  1KTK A;  3S1R B;  4HMI A;  2A73 B;  3T56 B;  3AB9 A;  3H94 A;  4HSP A;  2Q8I B;  1SJH D;  1TKW B;  2JP1 A;  1RKN A;  2BDO A;  1UEA B;  1F2Y A;  4IUP A;  1SNM A;  1ENA A;  1OO9 B;  4AYB B;  2L11 A;  2SNM A;  1SE2 A;  5FLX L;  3QWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...