3BDCA

Crystal structure of staphylococcal nuclease variant delta+phs at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants of the pK(a) values of Asp and Glu residues in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bdcA00
3TMEA 1EZ8A 4KY7A 5I9PA 1EQVA 5CV9A 1SYGA 3D4DA 1II3A 4G57A 1EYCA 3PMFA 5K5PA 2EY5A 1U9RA 2PZTA 3LX0A 5CV7A 1EY0A 5IGGA 1A2TA 1EY4A 2OXPA 1JORA 5IIFA 4QF4A 5J22A 1NUCA 2EYMA 2F0MA 1SYFA 2OF1A 5J1ZA 1EYDA 2F0KA 4NKLA 3RUZA 3MEHA 3NUCA 4OL7A 5E3FA 3U9OA 4K5XA 3SK6A 3T16A 2F0NA 3EVQA 1F2ZA 4QB4A 5EKKA 3MVVA 3TP6A 1KAAA 3VA5A 4ME5A 4HMIA 4IZ8A 4EQNA 5C6AA 3D6CA 2F0HA 3HZXA 4KD4A 1EY9A 2ENBA 3TP8A 2NUCA 3T13A 3MHBA 5CV4A 5I9OA 5C4ZA 5M9OA 4KV6A 4J6HA 4EVOA 2EYLA 3NP8A 4H7BA 3S9WA 3EROA 4K8JA 1F2YA 2F0IA 1KDCA 3TP5A 4F8MA 1SYCA 5HURA 4J1MA 4B9XA 4NP5A 3H6MA 4RKBA 5EKLA 3MXPA 3OMCA 2F0SA 4K5WA 1ENCA 2F3WA 3ERQA 1NSNS 3ITPA 2F0EA 1SNOA 4K14A 5C4HA 3NQTA 2WACA 4PMCA 5CGKA 5IGCA 3QOJA 4LAAA 4KJOA 1KDAA 4K5VA 4IALA 1STHA 3NHHA 4N9PA 2F0JA 3NK9A 1STBA 4N9TA 2RKSA 3SK5A 3SK8A 2HQEA 2SNMA 5IGFA 2PW5A 5F2DA 5CV5A 4B9WA 2SNSA 5C5MA 2F0WA 1F2MA 2EY2A 5CV8A 4IUNA 5E1FA 4I65A 4ZUJA 4DFAA 1ENAA 5KYLA 2PQEA 4EQPA 4HMJA 1JOQA 1STAA 1EY7A 2PZUA 3EJIA 1SNQA 2F0OA 5IGEA 1SNMA 3NXWA 3OWFA 4WRDA 1IHZA 3P75A 1JOKA 4ID6A 5JAVA 2F0TA 4QMGA 4WORA 5CV6A 4TRDA 2F3VA 1SYDA 2LKVA 3D8GA 2EYFA 4KJNA 3BDCA 2PYKA 4R8NA 5ISRA 4NMZA 2F0GA 3P1HA 3BDLA 5C5LA 1EY6A 2F0VA 1A2UA 2EYHA 5HGTA 3MZ5A 3V2TA 2F0LA 2KHSA 5DAUA 5KEEA 1JOOA 4K2LA 2EYPA 2F0FA 2RBMA 5C3WA 5I6YA 2OEOA 3HEJA 5NUCA 5C3XA 2EY1A 5I6WA 3C1EA 1RKNA 1KDBA 2SOBA 4K6DA 5CR3A 5DEHA 4EQOA 5IGBA 5EGTA 4KTAA 2M00A 2KQ3A 2O4XA 3OMGA 4RKLA 2F0UA 4ZUIA 4DGZA 2F0PA 1KABA 3C1FA 1EZ6A 4E6IA 4DF7A 1STNA 2PZWA 4KY6A 3DHQA 4KD3A 4PNYA 4PMBA 4S3SA 1SYBA 4KY5A 3QOLA 2F0DA 5KGUA 3SR1A 5KYIA 4ODGA 1TQOA 1A3VA 1SNPA 1A3UA 5KRUA 1TT2A 3SK4A 2RDFA 5JOBA 4F7XA 2EY6A 4NDXA 2EYOA 4ZQ3A 1SNDA 3D4WA 4KHVA 3SHLA 4DU9A 4K8IA 1A3TA 5J39A 2EXZA 2F0QA 3TP7A 3DMUA 5CC4A 4MIUA 2QDBA 1AEXA 1STYA 1SNCA 4HTHA 1EY8A 1STGA 5IOCA 5KIXA 3OSOA 2PW7A 4K2KA 1EYAA 3E5SA 1SYEA 2EYJA 3QB3A 3R3OA 1EY5A 3SXHA 4YIJA 5IODA 5IGDA 1TR5A
chains in the Genus database with same CATH superfamily
4JPBW 4FXGC 4RGMA 2EY5A 4WJ3M 4DXGA 4DR7Q 2C5CA 1D1KA 2RSNA 4LFBQ 4BA1I 5IWAL 2QEXA 3UDFA 1F2ZA 3HOYG 2R92B 1N32L 4RHSA 3HZXA 4XYQA 3S1RH 3CD6A 2JA6H 1S3OA 4Y7NB 1D1IA 1YNJC 4YWKA 4KV6A 5M5XB 4B3RL 2EYLA 4JI8L 4MTKA 2UXDL 4UY8C 2KEEA 1YEZA 1WTHA 2VY3A 4JOIA 3KF6B 2LSSA 1NTGA 2YTVA 1ZYRD 1NSNS 3GTJH 1DYQA 4B08A 3I90A 1D7QA 3S2DB 4HIOA 1DXMA 3I4NB 1NMGA 4JBJA 1PH5A 2Q2TA 1G291 2MQHA 2X69A 4L5SA 2A19A 5JJIA 4A75A 3TS0A 4LF6L 3EJIA 4RGTA 1X55A 3SGIA 1I3QH 1D6EC 4TRDA 3ULJA 4DAPA 3HP3A 1F2LA 4R8NA 1V1PB 1K0RA 2VZAA 2WP8J 2FJ2A 1EY6A 2EQSA 5AFWA 2CH4A 5HGTA 1H9SB 3A0JA 1RHPA 2Z6KA 3I4MH 1LTAD 2RQXA 2YU9H 3SVMA 4OWTB 4DUZQ 2KCTA 4WJWA 2JA8B 2R92G 2O4XA 3I91A 3MFYA 3KLRA 4R8IA 2EDGA 3FPPA 1MGSA 1YJ9A 2A74C 3EIVA 2HCIA 4HIKA 3HKSA 3SR1A 3T1YQ 5GAHC 2VUMB 4IUVA 1YIJA 1SFOH 1N8RC 2NB0A 1XNRL 3A55A 1PYBA 2K6AA 1SMYD 3D4RA 2L0CA 3W1GA 3UDXA 3CRKC 3PUXA 3STBD 4DR5L 1KC8C 3QB3A 1U4MA 3M3YB 1FNUA 3KDFA 1PRTD 2YTYA 4OWWB 5CV9A 2E2HB 2ZXOA 3D4DA 1N32Q 2LMCB 3D31A 1K3BC 4Q0FA 1PVOA 3PUVA 1O80A 4M1UB 2F3IA 5FLMG 4OIJA 4U673 1CA6A 3J81L 4BY7G 4IPCA 4BBRH 4GKKQ 2E2DC 4RAUC 2K5HA 3I2ZA 2R93B 4DK3C 4X65Q 1IYJB 4XT1B 4EVOA 2KECA 2AMCB 2A68D 3QIAA 4ABNA 1SXTA 4IUUA 2VB3X 3CW2C 1Q81C 4IUTA 2KA7A 3FRPB 4LF5L 1S40A 3FMCA 5M3FB 1Q46A 4KHZA 2JA6B 1PTOD 3E9IA 1STBA 2PQAA 1VQLA 1JB7A 4YCUA 5EQ0A 5L37A 2CW0D 1AH9A 5BN5A 1JOQA 1AW7A 3UDGA 4DUYL 1K83H 4QUCA 2KCMA 3CCSA 1HZBA 1KIXA 4BBRB 3V05A 4IOAA 2V1CC 1H9RA 1Q12A 5BR8Q 1J9OA 1YNJD 2C9OA 3CXCA 1CI3M 1EQTA 4HJ5A 2JA7G 1D5XC 4LWCA 3H15A 1O7IA 4RMFA 5ELEA 1MKHA 1HZAA 1PHJA 5C3EB 1B50A 3I7FA 3NENA 1HPCA 3IFDA 1WCMH 2QILA 1VQ4A 5IWAQ 3NTIA 1YNNC 3I4LA 4X3SA 1CHQD 2YYZA 3KLWA 1TQOA 1VQBA 1NR4A 2NN6G 2PI2E 1EWCA 1H9KA 1HTPA 1OO9B 1TWFH 3M4PA 1VQJA 5C0XG 3K5LA 4R4OA 5CC4A 4DV4Q 1FNVA 2J4XA 4U68A 4JYAQ 2NBFA 2E2JH 4FF1A 1TKWB 5GQOA 2ICEC 4ZRZA 1WTVA 4GOPC 2I5HA 1KTKA 1A6XA 1NE3A 3K58A 3K81C 5CYUA 3NEMA 1A2TA 3SDZA 4DR1Q 1NUCA 3PUYA 1VQKA 2ZJPA 1Y69U 3VR2A 2NN6H 3T16A 3S24A 1BBWA 2NVXB 1S4ZA 2AWNA 2NWGA 3PIPA 2B2WC 5IYCG 5FO7B 1G8ZD 2F1MA 4B3TQ 4A3IB 4QCLA 4C2MB 4LF5Q 1EY9A 4LK1C 1MBYA 3GTPH 4BBRG 4RWSC 4HR7B 1CT1D 3CC2A 1LO5D 4GN3B 1EIGA 4JCVE 3CAMA 3F2BA 5GROA 4LF7L 1LTID 1VCIA 4N9TA 1N33Q 1K73C 4DNTB 4A3KH 2HDLA 4Z9CB 4C3JH 2WKCA 4DR2Q 2ZT9C 1XMOQ 3NXWA 4FF3A 4ID6A 1GM5A 3WOEA 4A3JH 1EWHA 3VR4A 1SE8A 2B63B 1SYDA 3I55A 2DN8A 1JT8A 3W5OA 2OWOA 2UXBQ 3PQIA 4BWGB 1RTOA 3MZ5A 5IT9c 1PTOF 2KHSA 1LLRD 3I4NG 2XGTA 1Q1BA 3NWSA 2N78A 4QUFA 1RKNA 4GKJQ 5CR3A 4HSVA 5EGTA 2K5NA 4IPGA 1TWAH 4ZUIA 3Q24A 1Q7YC 4IFDH 1T9HA 3J80E 1GJXA 3E0JA 5FJ8G 2DUDA 5GAEC 1YHBA 1HA5A 2KHIA 3OW7A 2PCFB 3R2TA 4XQNA 1BCPC 1D5ZC 2IX1A 2EY6A 4TSSA 2HHHL 1A3TA 1VDZA 1EEFD 1STYA 5J3BA 1K3RA 1IBMQ 4QGUA 3A5UA 1CQFA 4OX9L 2UUBL 1I50H 4P71A 2K33A 5IODA 1QILA 2K1BA 4IPHA 3OPOA 3UDIA 3IRBA 1VQPA 4B3TL 3E3XA 4JI0Q 5C4JH 4QJFA 1X9NA 4OEMB 5LL6X 4FP5D 2R61A 1NJIC 5GAGC 3MEHA 4DUYQ 1HCZA 4K5XA 4MHEA 2PI2A 2R7FA 5FLXc 3HOVH 4YY3L 3PO2B 1XNQL 5JJKA 4IUPA 4RHRA 3K0XA 3MWYW 4KD4A 1HNXL 3CU7A 3I72A 4K8JA 3K7AH 3G7LA 4L6TB 1JJGA 1N33L 1I5FA 3QO2A 3KF6A 1WTXA 4WJ4A 2FXQA 2PPBC 1AE2A 2IJ0A 5FLXL 4YWMA 4A3MH 1XYIA 2BCOA 1TWHH 1X3EA 4N9PA 5IIFA 5ISRA 3SK8A 1KD1C 1X32A 4ME3A 4B3ML 4A3JG 1Y1WH 2EY2A 2OQ0A 3FP9A 5IP9H 2VXWA 1CKMA 1TS5A 4CHTB 3CCEA 1PYWD 1A63A 2EOTA 3PO2H 2R3ZA 5DNFA 4UP7A 1VQ7A 3VYTA 1GUWA 4X3KA 2XN9C 3KLSA 2YTXA 3K7UC 2XNAC 4PV1C 1IKLA 3SE0A 1WTQA 4MTNA 2F0FA 5M5YB 2MPMA 2R7DA 5EKIA 3DUZA 2A69D 2JJQA 3UE0A 3J7A5 4CDDC 1DD2A 3AFPA 2L4NA 2F0UA 4IJLA 4JI5L 5TSSA 1D8LA 4PZ7A 3DHQA 1AZQA 5JEAH 4R4QA 3U50C 4A3LH 4DAYB 2K32A 1A3UA 2CWPA 1X3GA 4DUZL 4FXKC 1GUOA 1EU3A 1Q1EA 1HNZL 5KIXA 1XMQL 2A5HA 1BO0A 4KK7A 2KJXA 4TVAB 1D2BA 2B39A 1IXRA 1C8CA 4QQBX 1E7ZA 2B2VC 1BBUA 1SYEA 2K7VA 2Z9HA 4A3CH 4BBSH 1MHWC 5EJWA 1EQVA 1IZ6A 3MXNA 1XPOA 2RVLA 1E2WA 4HCSA 2AKWB 2KVMA 2NVYH 3TZDA 4K0KQ 2ZJQA 1A8VA 1QZGA 2MP1A 1HNXQ 1NBWA 1GUTA 5J1ZA 2N88A 3U9OA 1JWSD 4ULLA 1XMOL 1I4GA 2LXJA 1E1OA 1PRTB 3E6ZX 1WJJA 3MVVA 4EQNA 4MZ9A 4FF4A 4NPSA 1Y1VH 1JMCA 1OTCA 4JV5L 1XTDA 4ZCKA 4A3IG 4PQXA 1I4PA 1KRTA 2BH8A 4JI4Q 4K5WA 5FJ8H 1Y1WG 4BBSB 3GTGB 1YJNA 1QCBD 2UXCL 1K8AC 3GTPB 1FYCA 3BZKA 4HIDA 4R1JA 3SK5A 3V2TA 4R4TA 1FR3A 4R9WA 5F2DA 1SFOB 1G2TA 3J7AF 3T1YL 4V0BA 5D65A 5FKAC 3H0GH 4DR3Q 2RHQB 4O42A 2DGYA 2Z6BA 4GLAC 1Y1VG 1CTMA 5CV6A 1WTPA 1TVXA 2F3VA 1PTOH 1Y1VB 4LUZA 3Q6SA 2Z4IA 1U4LA 2F0GA 4DN4M 4JI5Q 4C3JG 1DJRD 4FYDA 1Z47A 2XRSD 2JSOA 2XVSA 2JE6I 4AQYL 4LW1A 1KABA 5C0XI 3HOUG 4FF2A 1STNA 2PMZE 3HOYH 1X6OA 1SYBA 5KGUA 5KYIA 4YY3Q 1HR0W 1K28A 4ODGA 4QL5A 1PDQA 1V9PA 5JOBA 1MIUA 4F7XA 1TY2A 3S14B 2BA1A 1IYUA 2KOLA 2EJFC 2I5MX 3OIPA 1IKMA 1CFMA 3AMUA 1LUZA 1SBBB 4LFAL 3MFGA 1SEBD 1NMFA 4DV6L 2R6GA 1PRTF 4NXNQ 1X3FA 3RR5A 4YIJA 2X6LA 3GTLB 4DR6L 2CW0C 5M3FH 4UHVA 2WINB 2AQ1B 3FKIG 1W3SA 2PO4A 1PH3A 4PZ8A 2NZ1D 2AUJD 4C1NK 1K83B 5JVG3 1VQ5A 5IYBG 3NTKA 3F2UA 5JEAG 3TP6A 1IBKL 2A68C 3L0OA 1EIFA 3ZYYX 1L2FA 3S14H 4X62L 3ND8A 5C4ZA 4DV7Q 2F0IA 3DLLA 2AUKA 2J7ZA 3DM1A 3HOVG 3ICEA 1JQYD 4JW0A 1ET6A 1LABA 4HIMA 5CBAE 3BYTB 1EYGA 4GNXB 4ZYSA 2LY7A 2IX3A 2ASBA 2H5XA 1QNUA 3NK9A 1L0WA 4IQZA 2QEJC 2LS01 3TZUA 4XIGS 4JI6L 5E1FA 3I73A 4DV2Q 3PF5A 4A4IA 3NPPA 3GTGH 1KNAA 1XMQQ 1SJHD 3P20A 2G5DA 3S2DH 4DV4L 3STBC 1XNQQ 1ZYRC 4C56C 3T56B 4KI0A 3ULPA 2Q8IB 2LKVA 2CH4W 1ET9A 3BVMA 1EFID 2F0VA 2KCCA 1LTRD 2Z4HA 2AWOA 1DOMA 4LMQD 5C3WA 4AYBB 3CMEA 3GTOB 1JJCB 4RH6A 5C3XA 5I6WA 1KLUD 1DOLA 2KQ3A 3BJUA 3HOXB 1UEBA 4DKAC 2L12A 3R2IA 3I56A 1I4RA 4XQJA 2NVXH 4Y52H 2MNAA 4C2MH 2AQ3B 1SNPA 4C3IG 4HJ8A 3L9AX 1V1QA 4BXXG 1SNDA 4K8IA 4DXFA 4IJHA 5EPJA 1F9RA 3TP7A 4BY7B 5IOCA 4BY1B 1EY8A 1S5DD 4A3BH 2PW7A 1EIHA 1TIID 1LTTD 1GXDC 4RA8A 1BBXC 4G7OC 1L0XB 1RDPD 1VQFA 4QIWB 1IW7C 5A2QL 1VQAA 1BVSA 1EFWA 1UNSA 2OXPA 5M3FG 3ZJYC 4QF4A 3CMAA 1RTNA 1SYFA 3RMHA 2B8FA 1XPRA 1PYSB 4JVZA 2JA8G 1GUSA 2HCCA 4ME5A 3M4OB 5ELFA 3URYA 2A6ED 1HH2P 2IT1A 3OTOQ 4O0AA 4IFDJ 4IURA 4H7BA 1K8OA 1TWGH 1RIPA 1GHJA 2L11A 4B9XA 3M7NA 3H6MA 1J6QA 2Z1CA 2X6GA 4GKKL 5I2YA 2F0EA 3PF4A 1WCMG 2TMPA 4PG3A 4X65L 2WB1E 2F0JA 3VDYA 2FINB 4HJ9A 4A3GG 4ZUJA 2ALYB 3M4YA 2NZOA 2PQEA 3T51B 1I6VC 1EY7A 4RCNA 1SNQA 1PXUA 4LFCL 2F0TA 4N8FA 1G6PA 4PMWA 4B3MQ 1BKBA 3A7LA 2DNCA 3BDCA 3H0GB 1F9SA 2XIWA 4G4KA 1PTOC 3K59A 4L5TA 3S1QH 3MAQA 3K0YA 1WTWA 4JBMA 1UE7A 2OEOA 2ES2A 4V190 2PNHA 5C4JB 2SOBA 1CHPD 4AH6A 2JQOA 5ELCA 1T5XD 3W2DA 4JI3Q 2XTIA 4P75A 3H91A 1EQQA 4E6IA 1NNXA 3C46A 5IYCH 2ZTCA 2VL6A 4UDUC 5IE8A 2I07B 3SK4A 1U5KA 4X62Q 3HOXH 2B2UA 3HGBA 3D3RA 1SNCA 4C3IH 1HHVA 4DAMA 2E74C 3PV0A 3FDTA 3N6RA 2OT2A 1G91A 4P73A 2RF4A 1X3PA 1FGBD 1GUNA 5IYDH 1TR5A 3X3NA 5C0XH 1VQ6A 2EIFA 1I94Q 1Q3LA 1D5MC 1Y14B 1EYCA 4B3SQ 3GTQB 3S1MH 4BY1H 4JI6Q 3KK7A 1C48A 4LF8Q 3GTKB 1HNWL 2GVBA 4NXMQ 3CPWA 1YNND 1B44D 2F0HA 4K0KL 3S2HB 3PSIA 1SLJA 2NUCA 1I6HB 5CORA 3NP8A 5M5YH 1N36Q 3Q22A 5IYDG 3FKIB 3A8JE 3LWUA 3BVGA 2NVQH 1E22A 2LXKA 2IL8A 5CGKA 1BXTA 1EL0A 4LFCQ 1STHA 1WVLA 2RKSA 1QUQB 5IGFA 1NR2A 1Q90A 1VQMA 4IUNA 5IY0A 2VQFL 1HFNA 3U9SA 4YWLA 1STAA 4X66L 1O7YA 1XWEA 2PZUA 2JA5B 2F0OA 1SMXA 4LF7Q 4A93G 3OYYA 2CVRA 4HAEA 2I0QA 4A93B 2GA4B 3J81E 1EIYB 1Q8KA 2K50A 3HOWG 1E3PA 1A2UA 4UAIA 4DV7L 1VQEA 1S5ED 3VA7A 2K01A 3M7GA 1V1OA 2ZTEA 1KRSA 4PZ6A 2NVQB 4YCVA 4A3EH 5ELNA 4DV3Q 3VYRA 5DEHA 3J7YW 4JG2A 3EQLC 1GO3E 2E8GA 2YV5A 1PFBA 1LTBD 1EZ6A 2PMZB 3S1QB 4KY6A 1E24A 3HG9A 4S3SA 3QOLA 1A3VA 4TQUS 3HOZG 5C44B 4UPAA 4DAVA 5ELBA 2ID0A 3JAMi 1AFPA 4ZQ3A 2IHFA 3LNNA 4JV5Q 3CC7A 4DU9A 3I70A 4AQYQ 3RZOB 1VMPA 2BDNA 2B8GA 4OO1I 4N8X1 3PIOA 5HY6A 3CC4A 1PH1A 5C4XG 2HUGA 3D6WA 3VR6A 1ASZA 5BN3A 2HD3A 2UXCQ 1VQOA 5EAYA 4A76A 3TMEA 1EZ8A 5I9PA 1LTGD 3O13A 1HNWQ 3HRZC 1AN8A 5JJLA 1BCPD 3C2PA 2D62A 4C3IB 2VQEL 1PH2A 1L1OC 4X3UA 3G6EA 3PCOB 4BBSG 1I50B 1UEAB 2F0KA 4DV0L 4BS9A 2N3SA 3BVZA 3KBGA 2IY5B 1ILQA 2A6HC 1STEA 5CBEE 2NTTA 2D2CC 3R93A 2I5LX 3TP5A 1F9PA 1H9JA 2IX0A 2HDMA 1B1ZA 3KUPA 5EKLA 2JA8H 1IBKQ 5FO8B 3I4MG 2MJ8A 1VQ9A 1SNOA 3NQTA 2FMMA 2B2TA 2JA7B 1TWGB 2CQOA 2CCZA 1C0AA 4A3FG 2XWJB 2ZJRA 1OXVA 3S1NH 4B9WA 1YZ6A 2ZTDA 4DR7L 5C5MA 1N34L 1T5EA 1ENAA 1UUPA 3HOWH 3CCVA 1KXLA 5D3DA 3OWFA 1IHZA 1HQRD 3RD4A 1JOKA 1WFQA 4H0LC 2M9VA 2IW3A 1BR9A 1KHIA 1C7YA 3M3YH 3OTOL 4IO9A 1ESRA 4A3CG 5EBCA 2UXDQ 2SEBD 3D0FA 1JOOA 3QWNA 3F2CA 2HIVA 2M2LA 1SAPA 3Q8DA 2M00A 3WDNA 1IL8A 4KN4C 4XYOA 4PMBA 2PZWA 1PV4A 4KD3A 2KENA 1GKHA 5I4DA 4NXML 4DR4L 3S17B 1TWAB 4A3EB 3S15H 2K52A 3H3VH 1DONA 4OO1H 3JAML 1R9TB 4DR1L 5EBDA 2HT1A 1QB5D 1BQQT 3AYHB 4DV0Q 4A3DG 3NSWA 1JE5A 1SE3A 3QJYA 5C0XJ 4G57A 3CCLA 5M5WH 4DPGA 1EY4A 4J8QA 5DM73 1IL2A 1PZJD 1GUGA 1RODA 4DV2L 2K04A 3K8AA 1EYDA 3A56A 5KNCA 1NY4A 3FPUB 2JA6G 4YCWA 3L3OC 5HGQA 3GP7A 3GTQH 3S1MB 1B70B 1M8AA 2H4OA 2WB1B 3M9BA 4LUVA 3VA5A 1N9WA 1K8MA 2HIXA 2VUMH 1KAWA 4C1NI 5H1SE 4G7HC 1BCPF 3HOZB 1N34Q 4AIMA 2F0SA 1QUQA 5JJZA 1IBLL 4PMCA 2B2YA 4J15A 3K7AB 5FK9C 4HEDA 1LTSD 1RL2A 4KJOA 2SDFA 1FJGL 4IALA 2OTJA 1MD2D 3GV3A 2F4VQ 5C4XB 2HQEA 1CK1A 1HR0Q 4H02A 1Q8IA 2JYOA 1EU4A 2R7ZB 3ER0A 3EBEA 2DY7A 4JC0A 3NBIA 4MNOA 4JBKA 2Q2UA 4CDEC 3HOUB 5IGEA 1SNMA 4YHHQ 3QG1A 4O2DA 5JAVA 3MA2B 3MTSA 4ILWA 1JWMD 3NQIA 1P16A 1ICWA 2E2IB 3HKZG 3B6YA 4UP9A 4A3BB 3VYSA 2Y0SE 1TS2A 3IL8A 1UE1A 1N36L 4XXEA 4C3HB 2A8VA 1B53A 4K6LA 3HOWB 2K5VA 2FFKB 1PMRA 1B8AA 4GS3A 2D0PA 4JI1L 1G2SA 1S5CD 4A3LG 2JXMB 3X3MA 2VQEQ 1WTOA 2E5LL 1J5EQ 2Y0SG 4CKEA 4DGZA 5LMNL 4GNXA 4X64L 4LUOA 1V1PA 3NELA 1YNXA 1LM0A 4RFBA 1DGSA 2KUMA 2WKDA 3RZDB 5DLQE 3A74A 4KN7C 4XDXA 3M4OH 1TWCB 1S5FD 2FHTA 1PLFA 1YBYA 5LHY1 4JI3L 3G71A 1BOSA 4DV5L 2NYZD 4AYBE 5J39A 3BZDB 1X65A 3ULLA 3JAMc 5C3EG 3NWTA 1STGA 1LT3D 3R3OA 1G51A 3RZOH 2UUCL 3PMFA 4RCOA 4EGVA 3NE5B 3KJPA 4DV3L 2KBNA 4C3JB 5IGGA 4O1NA 1R9TH 1H9SA 4HCEA 1WTRA 3RUZA 3S1RB 5JPMC 4OL7A 3RN5A 3GTLH 1YITA 2A69C 1YHQA 4P72A 2EPBA 4GOPB 4ZKCB 2DJFC 2B63H 4JOIC 1MI2A 4B3SL 1RJTA 1WI5A 4HSPA 3LWEA 3UE1A 1B9NA 3E0EA 5CV4A 5IYBH 5D3IB 1HUNA 2A6HD 2G9DA 1F2YA 4IFDG 1JWUD 1SYCA 3PUWA 4J1MA 1PH9A 2A73B 4HJAA 3I4NH 1H95A 1I4HA 4K14A 4OIKA 2UUAQ 5M3MB 1Q86C 4DK0A 3MEFA 3J7AV 5CV8A 1ZKOA 1R4QB 4I65A 3TREA 3V96A 4BXXH 1XJVA 2JEAI 1BNZA 3P7JA 1OXTA 1XPUA 1PRTC 4DAYA 3OIQA 5E4WC 1QZHA 2B2VA 3GD7A 4A3GH 4OX9Q 3JC66 2UUBQ 1PH4A 2Q2IA 4NMZA 5LMNQ 1LTLA 1E1TA 3GDEA 2MUYA 2F0LA 1HJPA 3J80L 1JICA 2CHBD 1PFNA 3MXGA 1TS3A 1KDBA 1OXSC 1YVCA 4K6DA 1VQCA 4KTAA 3BYYB 5JEAJ 3Q0AA 4DV5Q 3HKZE 3TS2A 4LF8L 3HOVB 2VUMG 4DF7A 4KY5A 4RGNA 4GZYC 3AQQA 1TT2A 4BA2I 1Y8NB 2RDFA 1I6HH 3N52A 2RSOA 3RLOA 2L15A 4OONA 2TSSA 3ND9A 4JK1C 1HRJA 1DZ1A 4A3KG 3HOYB 3T4AC 2BH2A 3S17H 1CZWA 3FKIH 1KLGD 4AYBG 2MO1A 1W2BA 3OHXC 2EYJA 3A5ZB 4A3MB 4L5QA 1VMCA 1TWCH 3HOXG 2R93G 3SEBA 4ZKBB 3TQYA 4FO2A 2R92H 1HZ9A 3HKZB 2IWHA 2F4VL 3I3CA 4A3BG 4JYAL 3VYUA 3PIO3 1ZXTA 2MHVA 2F4IA 1X3QA 5M5XH 2WAQE 1G6ZA 2V4DA 3NUCA 2Z8LA 3BU2A 2F0NA 3TN2A 1ML0D 2JN4A 5BN4A 5DM63 2Q8TA 4DR4Q 4HMIA 4BY1G 5C6AA 1VQ8A 3D6CA 4KHPL 2B29A 1WYDA 4FNFA 2K5DA 1QNKA 3HFZB 1GD7A 3MHBA 5FLMH 3AB9A 3EROA 3S9WA 1DOKA 2KEDA 3BS1A 1HA6A 3RLNA 4RKBA 3CHBD 4GN4B 4DK1A 1OXXK 2N8NA 4LF6Q 2EJMA 1VS0A 2WACA 1J5EL 3K6OA 1KDAA 1W6JA 3FEWX 1PA6A 3TRZA 3EFXD 1U0LA 1SJED 3RNUA 1F2MA 1QJOA 4TKOB 2B3GA 1M4VA 2IPKD 2K14A 4EQPA 5C44H 3Q23A 4Q5VA 2RHSB 2IHEA 5LL6S 2Q2HA 1ILPA 1BDOA 2Z0SA 2ZXRA 1X54A 3IKJA 5C3EH 1CA5A 2PYKA 3NTHA 2CKZB 2EYHA 5LMNW 1WCMB 3T53B 5AJ3Q 4X3TA 4POGA 1B2TA 2EYPA 1SR3A 2EVBA 1EQRA 4KMUC 2E2IH 4ZAIA 4IUQA 4A3MG 1EUJA 1SE4A 3J7ZC 5GADC 4IOCA 4HN7A 2EZVA 2UXBL 2LFNA 4MN3A 3VR3A 1TWFB 3GTOH 1WD0A 4IFDI 4LFAQ 3A54A 4LF4Q 1S5BD 1QE6A 1FNWA 3EN2A 1CUKA 1O7LA 2RCNA 4KLKA 2BE5D 3BZCA 4NDXA 2PNRC 2XWBB 1C9OA 1B3QA 1A15A 5E7NA 3A8IE 1GOZA 3F8TA 2RDHA 1Z6HA 4FVMA 3KF8A 5ELDA 1H9MA 2HHHQ 1A0IA 4JI7L 1SYGA 3CP0A 2ATWA 1IBML 2PZTA 3LX0A 3S16B 5CV7A 4GOPA 2R93H 4I7AA 1TXYA 3CKIB 4A3IH 2OF1A 1TS4A 3J80c 1I94L 3CQZH 2BOSA 2QF7A 2JA9A 1HXYD 4UP8A 2WAQG 1HNZQ 4CDCC 1PH7A 3T13A 4JI0L 3KOJA 1NCVA 5I9OA 4J6HA 1KDCA 2HQLA 1C4QA 4LF9L 4JBWA 1BUVT 4NP5A 3K57A 3DEOA 3J81i 5I2XA 3GTKH 3MXPA 2B2WA 3GO5A 2F3WA 4KKTA 4DV1L 4A3FB 2B2UC 4OELB 5C44G 3EA6A 3NHHA 1I4QA 2SNMA 2O5JC 5CV5A 1MSGA 2SNSA 1AP0A 1XTCD 3PO2G 5BR8L 1BCPB 1YI2A 1J8IA 3W3AA 2QW7A 1QOHA 4OXPA 3CQZB 4NB3A 1FJGQ 4OWXB 2XSCA 3GTMH 3D8GA 3CCUA 3JAME 3DXJC 3CCQA 3P1HA 5C5LA 2A1AA 2K5QA 4X66Q 5KEEA 2JA5H 1V8QA 1UE5A 4K2LA 3H09A 2VW9A 5LMUQ 1Z7TA 3DM3A 4JI4L 1RD9D 3GTJB 3CCMA 2QKIC 1EOTA 2CWAA 5ELOA 2NZHA 4EQOA 5IGBA 4IPDA 4RKLA 3W1BA 2N49A 4A3EG 3HS0C 1FL0A 5FOBB 2OQKA 4CJ1B 2CFMA 4CKCA 1NAPA 5D14A 3OWEB 2E5LQ 4DR3L 3T1HQ 2EJGC 4CJ0B 4KHVA 4JI7Q 2EXZA 1SSOA 2C35B 3KDFB 2K5WA 1LYLA 1AEXA 3HOZH 1Q82C 1EYAA 3E5SA 1LACA 2JA5G 1EEID 1HFGA 1PTOB 3K5MA 5IGDA 3LGJA 4IN3A 4HJ7A 4KY7A 4EX5A 2QA4A 3OW2A 5E4XA 5EPLA 1SDFA 5K5PA 1U9RA 3CPFA 1SROA 1EY0A 3BDOA 1YJWA 1BF4A 2GN5A 4R4CA 3E9HA 3HOUH 1L0YB 1ESFA 2UUCQ 4B3RQ 4NKLA 3MC0B 3SK6A 4YHHL 1XXGA 3AEVA 2GVAA 2L9HA 3H3VC 4QB4A 3PIP3 1KL9A 2A6EC 3R8BA 1QVCA 1A62A 4DV1Q 1XNRQ 2ENBA 3PUZA 1L1OB 4I7ZC 1VQNA 2ZM6L 3PO3G 3K5OA 4GLXA 1O7ZA 3G6JB 4JI1Q 3I8ZA 3L7ZC 3F1ZA 5C4HA 2KHJA 1K8GA 4G7ZC 3QOJA 3FHWA 4A3JB 4K5VA 3CF5A 2VNUD 2PW5A 3UI2A 2AQ2B 2CQAA 2MGSA 2NN6I 2UU9L 3KJOA 3TSSA 2UUAL 3DWQA 1QVFA 4A3FH 4GNXC 2B2YC 3CCJA 5LMUL 4WORA 4JI2L 4OO1G 1ICFB 4GKJL 4FDBA 2MO0A 2G9HD 3PO3H 1E0BA 3OOCA 4KJNA 2EE1A 1MJEA 1VF7A 3TBIB 1UAPA 3M85A 1GHKA 1TY0A 4DNIA 4F87A 1FVIA 4P74A 2WAQB 5NUCA 4RG1A 2JEBI 3C1EA 1MJCA 4LJZC 3GTMB 3J81j 2XRQD 1GVPA 3OMGA 4EQ5A 1CKNB 2H1EA 3C1FA 4DR5Q 1VQIA 2F0DA 3IAYA 1JC7A 4DA2A 3TDQA 2Z6KC 1JR0D 3M4QA 3SHLA 4CBVA 2D5DA 2F03A 1RCVD 2DNEA 5K36H 1EOVA 2NVYB 5IP7G 3H3VI 5M3MH 1O78A 1ONLA 4KKSA 5CMDA 1B7YB 1YHAA 1TU2B 5AJ3L 1CSQA 3S15B 5COYA 1II3A 3WOFA 3K5NA 3DWAA 1JJ2A 5JVH3 1JORA 3TEHB 4A3DH 3KF8B 2BE5C 5J22A 4Y7NH 1CM9A 4KKUA 1PZKD 2EXDA 3G4SA 3S16H 5EKKA 4M8AA 3FVQA 1KAAA 1DM0B 2F52A 4ZK9B 3DWPA 5G3LF 1Y8PB 2VS1A 1F9QA 5M9OA 3L2PA 1TWHB 1HZCA 1AE3A 1S72A 1P8LA 1JB3A 1IW7D 1SE2A 2BDOA 3OMCA 4NW2A 5T1GA 1ENCA 2UU9Q 3ERQA 4KHPQ 2DY8A 3NBHB 2I46A 5KNBA 4GN5A 1AZPA 3IFTA 4H13C 3U58A 2K75A 2QDLA 1SN8A 4XTCS 4P2CB 1WD1A 4DK6C 3PGZA 1VQHA 2ICIA 2F0WA 2WB1G 4A3DB 1PZID 2FMCA 1KQSA 4CKBA 4LFBL 4HMJA 1Z9FA 4ALPA 1CKOA 1IBLQ 3T1HL 2B2TC 1EWIA 4WRDA 3S1NB 3P75A 2D9UA 1HR0L 3I4MB 1PFSA 1I4XA 1WOCA 2EYFA 2P5ZX 2R7ZH 4ZLTF 3WWVA 4OHJA 3BDLA 4XQQA 2K28A 1SMYC 4APVA 4JI8Q 5DAUA 1M1KC 2MFIA 2K05A 3CRLC 4F88A 2RCFA 4QY7A 2BA0A 3HEJA 2JP1A 4CGYB 3KYHC 2EY1A 2L5TA 1ASYA 1UWVA 2L1BA 1PH6A 3A7AB 4RGOS 5EPKA 3J80i 3PO3B 2F0PA 4XT3B 3H94A 2L55A 2QGQA 4C3HH 4CDFC 2B63G 2D0OA 4GLVB 2RDGA 1XX8A 5KRUA 2E76C 3AU7A 4L8JA 4A3KB 2WFWA 4DR2L 2EYOA 3D4WA 4L5RC 2ZM6Q 4X64Q 1RF2D 2E75C 2F0QA 4MIUA 3C3LA 2QDBA 2O2LD 4HTHA 3J81c 2E2HH 1LV9A 4LF4L 3AFQA 2JK8A 4K2KA 3DEPA 3SXHA 1V43A 4DNRB 3CCRA 3U4VA 2NTSA 4R4IA 5K36G 4H44C 3BG3A 1QVGA 5JPNC 3GQBA 1LT5D 3VR5A 1HTLD 1K9MC 4C3HG 2VQFQ 2EYMA 1Y8OB 2F0MA 2K4KA 3GV6A 1PH8A 5E3FA 3K80C 5FO9B 1L1OA 5M5WB 1KNEA 2QCPX 2N55A 1QWYA 2WIIB 3EVQA 4FXDA 2Y0SB 4JI2Q 4IZ8A 3QR8A 1ENFA 2K03A 5IT9L 4OGQC 3TP8A 1CSPA 2DJGC 3RLFA 1VQGA 1B9MA 4F8MA 2AHOB 1UE6A 1VQDA 2Q8RE 1B3AA 1JE4A 5HURA 2NVTH 5IP7H 4L63B 3ITPA 1ZEQX 5IGCA 4LAAA 5IP9G 1I3QB 1CQVA 5KYLA 2RA4A 1JCKB 4LF9Q 1OXUA 1FGUA 3ONAB 1QG7A 1FD7D 4DFAA 3MXNB 5A2QE 2KCNA 5G3LD 2J0TD 2OCEA 3KBXA 5C4XH 2YU9B 4QMGA 4X6AH 1VF5C 2OTLA 3S2HH 3U4ZA 2ZXPA 2VB2X 3I4OA 5M3MG 1HUMA 3RN2A 4LNQA 2WV6D 1MSHA 1M90C 2NVTB 1IYVA 2RBMA 2R7ZG 5I6YA 1F77A 3KFUA 1LT6D 5FLXE 1W6KA 4A3GB 1CZGA 1U4PA 4QIWE 1R4PB 4CJ2C 5A35A 1PFMA 3MXUA 5KNDA 1Y1WB 4PNYA 1E2ZA 2PQAB 4BY7H 4NXNL 4DV6Q 1DCZA 1E2VA 3ERSX 1X56A 1LT4D 1CKNA 5IT9E 4DR6Q 2E2JB 3H0GG 1K0SA 2O5IC 5T1IA 1U4RA 3DMUA 4WFN3 3A8KE 3G48A 3RZDH 3OSOA 4POFA 1SRUA 1B4OA 4A93H 2JA7H 1EY5A 3F2DA 1HQMC 3NBHA 3KLSX
chains in the Genus database with same CATH topology
4FXGC 4RGMA 2EY5A 4DXGA 2C5CA 1D1KA 2RSNA 4BA1I 1F2ZA 2R92B 4RHSA 3HZXA 4XYQA 4Y7NB 1D1IA 1YNJC 4KV6A 5M5XB 2EYLA 2KEEA 1ZYRD 1NSNS 1DYQA 4B08A 3I90A 3S2DB 1DXMA 3I4NB 1G291 2X69A 3EJIA 4RGTA 1D6EC 4TRDA 4DAPA 3HP3A 1F2LA 4R8NA 1V1PB 2WP8J 2FJ2A 1EY6A 5AFWA 5HGTA 1H9SB 1RHPA 1LTAD 2RQXA 3SVMA 4WJWA 2JA8B 2O4XA 3I91A 3MFYA 3KLRA 4R8IA 2EDGA 3FPPA 1MGSA 2A74C 2HCIA 3SR1A 2VUMB 4IUVA 2NB0A 3A55A 2K6AA 1SMYD 3D4RA 2L0CA 3CRKC 3PUXA 3QB3A 1U4MA 3M3YB 1FNUA 1PRTD 5CV9A 2E2HB 2ZXOA 3D4DA 2LMCB 3D31A 4Q0FA 3PUVA 1O80A 4M1UB 4OIJA 4U673 1CA6A 3J81L 2E2DC 4RAUC 2R93B 4XT1B 4EVOA 2KECA 2A68D 3QIAA 4ABNA 1SXTA 4IUUA 2VB3X 4IUTA 2KA7A 3FRPB 3FMCA 5M3FB 4KHZA 2JA6B 1PTOD 1STBA 5EQ0A 2CW0D 5BN5A 1JOQA 1AW7A 4QUCA 4BBRB 3V05A 1H9RA 1Q12A 1J9OA 1YNJD 2C9OA 1CI3M 1EQTA 1D5XC 5ELEA 5C3EB 1B50A 1HPCA 3IFDA 2QILA 3NTIA 1YNNC 3I4LA 4X3SA 1CHQD 2YYZA 1TQOA 1NR4A 2NN6G 1EWCA 1H9KA 1HTPA 1OO9B 5C0XG 3K5LA 5CC4A 1FNVA 2J4XA 4U68A 2NBFA 4FF1A 1TKWB 2ICEC 4ZRZA 1WTVA 1KTKA 1A6XA 3K58A 5CYUA 1A2TA 3SDZA 1NUCA 3PUYA 1Y69U 3VR2A 2NN6H 3T16A 2NVXB 1S4ZA 2AWNA 2NWGA 2B2WC 5FO7B 1G8ZD 2F1MA 4QCLA 4A3IB 4C2MB 1EY9A 4LK1C 1MBYA 4RWSC 4HR7B 1CT1D 1LO5D 1EIGA 1LTID 1VCIA 4N9TA 4DNTB 2HDLA 4Z9CB 2WKCA 2ZT9C 3NXWA 4FF3A 4ID6A 3WOEA 1EWHA 3VR4A 2B63B 1SYDA 2DN8A 4BWGB 1RTOA 3MZ5A 1PTOF 2KHSA 1LLRD 1Q1BA 3NWSA 4QUFA 1RKNA 5CR3A 4HSVA 5EGTA 4IFDH 4ZUIA 3Q24A 3J80E 1GJXA 3E0JA 1HA5A 3OW7A 2PCFB 3R2TA 4XQNA 1BCPC 1D5ZC 2IX1A 2EY6A 4TSSA 1A3TA 1VDZA 1EEFD 1STYA 1CQFA 2K33A 5IODA 1QILA 2K1BA 3OPOA 5LL6X 2R61A 4FP5D 3MEHA 1HCZA 4K5XA 4MHEA 3PO2B 4IUPA 4RHRA 3MWYW 4KD4A 3CU7A 3I72A 4K8JA 3G7LA 4L6TB 3QO2A 1WTXA 2PPBC 2IJ0A 5FLXL 1XYIA 2BCOA 5ISRA 4N9PA 5IIFA 3SK8A 1X32A 2EY2A 2VXWA 1TS5A 4CHTB 1PYWD 2EOTA 2R3ZA 5DNFA 3VYTA 1GUWA 4X3KA 2XN9C 3KLSA 2XNAC 4PV1C 1IKLA 3SE0A 1WTQA 2F0FA 5M5YB 2MPMA 5EKIA 3DUZA 2A69D 1DD2A 2L4NA 2F0UA 5TSSA 3DHQA 1AZQA 5JEAH 2K32A 1A3UA 1GUOA 1Q1EA 1EU3A 4FXKC 5KIXA 2A5HA 1BO0A 4KK7A 2KJXA 1D2BA 2B39A 1C8CA 2B2VC 1SYEA 2K7VA 5EJWA 1EQVA 3MXNA 2RVLA 1E2WA 4HCSA 2KVMA 3TZDA 2MP1A 1GUTA 5J1ZA 2N88A 3U9OA 1JWSD 4ULLA 1I4GA 1PRTB 3E6ZX 3MVVA 4EQNA 4FF4A 4PQXA 1I4PA 4K5WA 4BBSB 3GTGB 1QCBD 3GTPB 1FYCA 3SK5A 3V2TA 1FR3A 4R9WA 5F2DA 1SFOB 1G2TA 3J7AF 4V0BA 5D65A 5FKAC 4O42A 1CTMA 5CV6A 1WTPA 1TVXA 2F3VA 1PTOH 1Y1VB 3Q6SA 2Z4IA 1U4LA 2F0GA 4DN4M 4C3JG 1DJRD 4FYDA 1Z47A 2XRSD 2JSOA 2XVSA 2JE6I 1KABA 5C0XI 4FF2A 1STNA 5KGUA 1SYBA 5KYIA 4ODGA 1PDQA 5JOBA 4F7XA 1TY2A 3S14B 2BA1A 1IYUA 2KOLA 2EJFC 1IKMA 3OIPA 1CFMA 3AMUA 1SBBB 3MFGA 1SEBD 2R6GA 1PRTF 4YIJA 2X6LA 3GTLB 2CW0C 2WINB 2AQ1B 2PO4A 2NZ1D 2AUJD 4C1NK 1K83B 5JVG3 3NTKA 3F2UA 5JEAG 3TP6A 2A68C 3ZYYX 3ND8A 5C4ZA 2F0IA 2AUKA 2J7ZA 3DM1A 1JQYD 1ET6A 1LABA 5CBAE 3BYTB 4ZYSA 2LY7A 2IX3A 1QNUA 3NK9A 4IQZA 2QEJC 2LS01 3TZUA 4XIGS 5E1FA 3I73A 3NPPA 1KNAA 1SJHD 3P20A 1ZYRC 4C56C 3T56B 4KI0A 2Q8IB 2LKVA 1ET9A 3BVMA 1EFID 2F0VA 2KCCA 1LTRD 2Z4HA 2AWOA 1DOMA 4LMQD 5C3WA 4AYBB 3GTOB 4RH6A 5C3XA 5I6WA 1KLUD 1DOLA 2KQ3A 3HOXB 2L12A 3R2IA 1I4RA 4XQJA 2AQ3B 1SNPA 4C3IG 3L9AX 1SNDA 4K8IA 4DXFA 5EPJA 1F9RA 3TP7A 4BY7B 5IOCA 4BY1B 1EY8A 1S5DD 2PW7A 1EIHA 1TIID 1LTTD 1GXDC 4RA8A 1BBXC 4G7OC 1L0XB 1RDPD 4QIWB 1IW7C 5A2QL 1UNSA 2OXPA 4QF4A 1RTNA 1SYFA 3RMHA 2B8FA 1GUSA 2HCCA 4ME5A 3M4OB 5ELFA 3URYA 2A6ED 2IT1A 4IFDJ 4IURA 4H7BA 1K8OA 1GHJA 3M7NA 2L11A 4B9XA 3H6MA 2Z1CA 2X6GA 5I2YA 2F0EA 2TMPA 2F0JA 2FINB 4ZUJA 3M4YA 2PQEA 3T51B 1I6VC 1EY7A 4RCNA 1SNQA 1PXUA 2F0TA 4PMWA 3A7LA 2DNCA 3BDCA 3H0GB 1F9SA 2XIWA 4G4KA 1PTOC 3K59A 3MAQA 3K0YA 1WTWA 2OEOA 4V190 5C4JB 2SOBA 1CHPD 5ELCA 1T5XD 3W2DA 3H91A 4E6IA 3C46A 4UDUC 2I07B 3SK4A 2B2UA 3HGBA 3D3RA 1SNCA 1HHVA 2E74C 3PV0A 3FDTA 3N6RA 2OT2A 1G91A 1X3PA 1FGBD 1GUNA 1TR5A 3X3NA 5C0XH 1Q3LA 1D5MC 1EYCA 3GTQB 3KK7A 1C48A 3GTKB 1YNND 1B44D 2F0HA 3S2HB 2NUCA 1I6HB 5CORA 3NP8A 3Q22A 3FKIB 3A8JE 3LWUA 3BVGA 2IL8A 5CGKA 1BXTA 1EL0A 1STHA 1WVLA 2RKSA 5IGFA 1NR2A 1Q90A 4IUNA 1HFNA 3U9SA 1STAA 1O7YA 1XWEA 2PZUA 2JA5B 2F0OA 2CVRA 4HAEA 4A93B 2GA4B 3J81E 1A2UA 4UAIA 1S5ED 3VA7A 2K01A 3M7GA 1V1OA 2NVQB 3VYRA 5DEHA 3J7YW 3EQLC 1PFBA 1LTBD 1EZ6A 2PMZB 3S1QB 4KY6A 3HG9A 4S3SA 3QOLA 1A3VA 4TQUS 5C44B 4DAVA 5ELBA 2ID0A 1AFPA 4ZQ3A 3LNNA 3RZOB 4DU9A 3I70A 1VMPA 2BDNA 2B8GA 4OO1I 2HUGA 3D6WA 3VR6A 5BN3A 3TMEA 1EZ8A 5I9PA 1LTGD 3O13A 3HRZC 1AN8A 1BCPD 3C2PA 2D62A 4C3IB 4X3UA 1I50B 1UEAB 2F0KA 4BS9A 3BVZA 3KBGA 1ILQA 2A6HC 1STEA 5CBEE 2NTTA 2D2CC 3R93A 3TP5A 1F9PA 1H9JA 2IX0A 2HDMA 1B1ZA 3KUPA 5EKLA 5FO8B 2MJ8A 1SNOA 3NQTA 2FMMA 2B2TA 2JA7B 1TWGB 2XWJB 1OXVA 4B9WA 5C5MA 1T5EA 1ENAA 1UUPA 5D3DA 3OWFA 1IHZA 1HQRD 3RD4A 1JOKA 4H0LC 2M9VA 2IW3A 1BR9A 1ESRA 5EBCA 2SEBD 1JOOA 3QWNA 2M2LA 1SAPA 2M00A 3WDNA 1IL8A 4KN4C 4XYOA 4PMBA 2PZWA 4KD3A 5I4DA 3S17B 1TWAB 4A3EB 1DONA 4OO1H 3JAML 1R9TB 5EBDA 1QB5D 1BQQT 3NSWA 1SE3A 3QJYA 5C0XJ 4G57A 1EY4A 4J8QA 5DM73 1PZJD 1GUGA 1RODA 2K04A 1EYDA 3A56A 5KNCA 3FPUB 3L3OC 3GP7A 3S1MB 1M8AA 2H4OA 2WB1B 3VA5A 1K8MA 4C1NI 4G7HC 1BCPF 3HOZB 2F0SA 5JJZA 4PMCA 2B2YA 3K7AB 5FK9C 4HEDA 1LTSD 4KJOA 2SDFA 4IALA 1MD2D 3GV3A 5C4XB 2HQEA 1CK1A 1Q8IA 2JYOA 1EU4A 2R7ZB 2DY7A 3NBIA 3HOUB 5IGEA 1SNMA 3QG1A 5JAVA 3MA2B 3MTSA 4ILWA 1JWMD 3NQIA 1ICWA 2E2IB 4A3BB 3VYSA 1TS2A 3IL8A 4XXEA 4C3HB 1B53A 4K6LA 3HOWB 2FFKB 1PMRA 1G2SA 1S5CD 2JXMB 3X3MA 1WTOA 4CKEA 4DGZA 1V1PA 4RFBA 2KUMA 2WKDA 3RZDB 4KN7C 4XDXA 1TWCB 1S5FD 2FHTA 1PLFA 5LHY1 1BOSA 2NYZD 5J39A 3BZDB 3NWTA 1STGA 1LT3D 3R3OA 3PMFA 4RCOA 4EGVA 3NE5B 4C3JB 5IGGA 4O1NA 1H9SA 1WTRA 4HCEA 3RUZA 3S1RB 5JPMC 4OL7A 2A69C 2EPBA 4ZKCB 1MI2A 1RJTA 4HSPA 3LWEA 1B9NA 5CV4A 1HUNA 5D3IB 2A6HD 2G9DA 1F2YA 4IFDG 1JWUD 1SYCA 3PUWA 4J1MA 2A73B 1I4HA 4K14A 4OIKA 5M3MB 4DK0A 3J7AV 5CV8A 1ZKOA 1R4QB 4I65A 3V96A 2JEAI 1BNZA 3P7JA 1OXTA 1PRTC 4DAYA 3OIQA 5E4WC 2B2VA 3GD7A 4NMZA 2MUYA 2F0LA 3J80L 1JICA 2CHBD 1PFNA 3MXGA 1TS3A 1KDBA 1OXSC 4K6DA 4KTAA 3BYYB 5JEAJ 3Q0AA 3HOVB 4DF7A 4KY5A 4RGNA 4GZYC 1TT2A 4BA2I 1Y8NB 2RDFA 3N52A 2RSOA 2TSSA 3ND9A 4JK1C 1HRJA 1DZ1A 3HOYB 3T4AC 1CZWA 1KLGD 3OHXC 2EYJA 4A3MB 1VMCA 3SEBA 4ZKBB 4FO2A 3HKZB 2IWHA 3I3CA 3VYUA 3PIO3 1ZXTA 2MHVA 2F4IA 1X3QA 1G6ZA 2V4DA 3NUCA 2Z8LA 2F0NA 3TN2A 1ML0D 5BN4A 5DM63 2Q8TA 4HMIA 5C6AA 3D6CA 4FNFA 2K5DA 1QNKA 3MHBA 3AB9A 3EROA 3S9WA 1DOKA 2KEDA 3BS1A 1HA6A 4RKBA 3CHBD 4DK1A 1OXXK 2EJMA 2WACA 3K6OA 1KDAA 1W6JA 3FEWX 3EFXD 1SJED 1F2MA 1QJOA 4TKOB 1M4VA 2IPKD 4EQPA 3Q23A 4Q5VA 5LL6S 1ILPA 1BDOA 2ZXRA 3IKJA 1CA5A 2PYKA 3NTHA 2EYHA 1WCMB 3T53B 1B2TA 4X3TA 2EYPA 2EVBA 4KMUC 4ZAIA 4IUQA 1SE4A 4HN7A 2EZVA 2LFNA 4MN3A 3VR3A 1TWFB 1WD0A 4IFDI 3A54A 1S5BD 1QE6A 1FNWA 1O7LA 2BE5D 4NDXA 2PNRC 2XWBB 1A15A 3A8IE 1GOZA 2RDHA 1Z6HA 4FVMA 3KF8A 5ELDA 1H9MA 1SYGA 2PZTA 3LX0A 3S16B 5CV7A 3CKIB 2OF1A 1TS4A 2BOSA 2QF7A 1HXYD 3T13A 1NCVA 5I9OA 4J6HA 1KDCA 1C4QA 4JBWA 1BUVT 4NP5A 3K57A 3DEOA 5I2XA 3MXPA 2B2WA 3GO5A 2F3WA 4KKTA 4A3FB 2B2UC 3EA6A 3NHHA 1I4QA 2SNMA 2O5JC 5CV5A 1MSGA 2SNSA 1AP0A 1XTCD 1BCPB 1J8IA 3W3AA 1QOHA 3CQZB 2XSCA 3D8GA 3JAME 3DXJC 3P1HA 5C5LA 2K5QA 5KEEA 1V8QA 4K2LA 3H09A 1Z7TA 1RD9D 3GTJB 2QKIC 1EOTA 4EQOA 5IGBA 4RKLA 3HS0C 5FOBB 4CJ1B 4CKCA 1NAPA 5D14A 3OWEB 2EJGC 4CJ0B 4KHVA 2EXZA 1SSOA 2K5WA 1AEXA 1EYAA 3E5SA 1LACA 1EEID 1HFGA 1PTOB 3K5MA 5IGDA 4IN3A 4KY7A 5E4XA 5EPLA 1SDFA 5K5PA 1U9RA 3BDOA 1EY0A 1BF4A 1L0YB 1ESFA 4NKLA 3MC0B 3SK6A 1XXGA 2L9HA 3H3VC 4QB4A 3PIP3 2A6EC 3R8BA 2ENBA 3PUZA 4I7ZC 3K5OA 1O7ZA 3G6JB 3I8ZA 3L7ZC 5C4HA 4G7ZC 3QOJA 4A3JB 4K5VA 2VNUD 2PW5A 3UI2A 2AQ2B 2CQAA 2MGSA 2NN6I 3TSSA 3DWQA 2B2YC 4WORA 4OO1G 2G9HD 1E0BA 3OOCA 4KJNA 2EE1A 1VF7A 3TBIB 1UAPA 3M85A 1GHKA 1TY0A 4F87A 2WAQB 5NUCA 2JEBI 3C1EA 4LJZC 3GTMB 2XRQD 3OMGA 2H1EA 3C1FA 2F0DA 3IAYA 1JC7A 4DA2A 3TDQA 1JR0D 3SHLA 4CBVA 2D5DA 2F03A 1RCVD 2DNEA 5K36H 2NVYB 1O78A 1ONLA 4KKSA 5CMDA 1TU2B 3S15B 5COYA 1II3A 3WOFA 3K5NA 3DWAA 5JVH3 1JORA 5J22A 2BE5C 1CM9A 4KKUA 1PZKD 5EKKA 4M8AA 3FVQA 1KAAA 1DM0B 4ZK9B 3DWPA 5G3LF 1Y8PB 1F9QA 5M9OA 1TWHB 1JB3A 1IW7D 1SE2A 2BDOA 3OMCA 4NW2A 5T1GA 1ENCA 3ERQA 2DY8A 2I46A 5KNBA 1AZPA 3IFTA 4H13C 4XTCS 4P2CB 1WD1A 2ICIA 2F0WA 4A3DB 1PZID 2FMCA 4CKBA 4HMJA 2B2TC 4WRDA 3S1NB 3P75A 2D9UA 3I4MB 1I4XA 2EYFA 4ZLTF 4OHJA 3BDLA 4XQQA 2K28A 1SMYC 5DAUA 2K05A 3CRLC 4F88A 2BA0A 3HEJA 2JP1A 4CGYB 2EY1A 2L5TA 2L1BA 3A7AB 4RGOS 5EPKA 3PO3B 2F0PA 4XT3B 3H94A 2L55A 2RDGA 1XX8A 5KRUA 2E76C 3AU7A 4L8JA 4A3KB 2EYOA 3D4WA 1RF2D 2E75C 2F0QA 4MIUA 3C3LA 2QDBA 2O2LD 4HTHA 1LV9A 4K2KA 3DEPA 3SXHA 1V43A 4DNRB 2NTSA 5K36G 4H44C 3BG3A 5JPNC 3GQBA 1LT5D 3VR5A 1HTLD 4C3HG 2EYMA 1Y8OB 2F0MA 3GV6A 5E3FA 5FO9B 5M5WB 1KNEA 2QCPX 2N55A 1QWYA 2WIIB 3EVQA 4FXDA 2Y0SB 4IZ8A 1ENFA 2K03A 5IT9L 4OGQC 3TP8A 3RLFA 1B9MA 4F8MA 2Q8RE 1B3AA 1JE4A 5HURA 4L63B 3ITPA 1ZEQX 5IGCA 4LAAA 1I3QB 5KYLA 1CQVA 2RA4A 1JCKB 1OXUA 3ONAB 1QG7A 1FD7D 4DFAA 5A2QE 2KCNA 5G3LD 2J0TD 3KBXA 2YU9B 4QMGA 1VF5C 2ZXPA 2VB2X 1HUMA 2WV6D 1MSHA 2NVTB 1IYVA 2RBMA 5I6YA 1F77A 1LT6D 5FLXE 1W6KA 4A3GB 1CZGA 1U4PA 1R4PB 4CJ2C 5A35A 1PFMA 3MXUA 5KNDA 1Y1WB 4PNYA 1E2ZA 1DCZA 1E2VA 2E2JB 1LT4D 5IT9E 2O5IC 5T1IA 1U4RA 3DMUA 4WFN3 3A8KE 3OSOA 1B4OA 1EY5A 1HQMC 3NBHA 3KLSX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TME A;  1EZ8 A;  4KY7 A;  5I9P A;  1EQV A;  5CV9 A;  1SYG A;  3D4D A;  1II3 A;  4G57 A;  1EYC A;  3PMF A;  5K5P A;  2EY5 A;  1U9R A;  2PZT A;  3LX0 A;  5CV7 A;  1EY0 A;  5IGG A;  1A2T A;  1EY4 A;  2OXP A;  1JOR A;  5IIF A;  4QF4 A;  5J22 A;  1NUC A;  2EYM A;  2F0M A;  1SYF A;  2OF1 A;  5J1Z A;  1EYD A;  2F0K A;  4NKL A;  3RUZ A;  3MEH A;  3NUC A;  4OL7 A;  5E3F A;  3U9O A;  4K5X A;  3SK6 A;  3T16 A;  2F0N A;  3EVQ A;  1F2Z A;  4QB4 A;  5EKK A;  3MVV A;  3TP6 A;  1KAA A;  3VA5 A;  4ME5 A;  4HMI A;  4IZ8 A;  4EQN A;  5C6A A;  3D6C A;  2F0H A;  3HZX A;  4KD4 A;  1EY9 A;  2ENB A;  3TP8 A;  2NUC A;  3T13 A;  3MHB A;  5CV4 A;  5I9O A;  5C4Z A;  5M9O A;  4KV6 A;  4J6H A;  4EVO A;  2EYL A;  3NP8 A;  4H7B A;  3S9W A;  3ERO A;  4K8J A;  1F2Y A;  2F0I A;  1KDC A;  3TP5 A;  4F8M A;  1SYC A;  5HUR A;  4J1M A;  4B9X A;  4NP5 A;  3H6M A;  4RKB A;  5EKL A;  3MXP A;  3OMC A;  2F0S A;  4K5W A;  1ENC A;  2F3W A;  3ERQ A;  1NSN S;  3ITP A;  2F0E A;  1SNO A;  4K14 A;  5C4H A;  3NQT A;  2WAC A;  4PMC A;  5CGK A;  5IGC A;  3QOJ A;  4LAA A;  4KJO A;  1KDA A;  4K5V A;  4IAL A;  1STH A;  3NHH A;  4N9P A;  2F0J A;  3NK9 A;  1STB A;  4N9T A;  2RKS A;  3SK5 A;  3SK8 A;  2HQE A;  2SNM A;  5IGF A;  2PW5 A;  5F2D A;  5CV5 A;  4B9W A;  2SNS A;  5C5M A;  2F0W A;  1F2M A;  2EY2 A;  5CV8 A;  4IUN A;  5E1F A;  4I65 A;  4ZUJ A;  4DFA A;  1ENA A;  5KYL A;  2PQE A;  4EQP A;  4HMJ A;  1JOQ A;  1STA A;  1EY7 A;  2PZU A;  3EJI A;  1SNQ A;  2F0O A;  5IGE A;  1SNM A;  3NXW A;  3OWF A;  4WRD A;  1IHZ A;  3P75 A;  1JOK A;  4ID6 A;  5JAV A;  2F0T A;  4QMG A;  4WOR A;  5CV6 A;  4TRD A;  2F3V A;  1SYD A;  2LKV A;  3D8G A;  2EYF A;  4KJN A;  3BDC A;  2PYK A;  4R8N A;  5ISR A;  4NMZ A;  2F0G A;  3P1H A;  3BDL A;  5C5L A;  1EY6 A;  2F0V A;  1A2U A;  2EYH A;  5HGT A;  3MZ5 A;  3V2T A;  2F0L A;  2KHS A;  5DAU A;  5KEE A;  1JOO A;  4K2L A;  2EYP A;  2F0F A;  2RBM A;  5C3W A;  5I6Y A;  2OEO A;  3HEJ A;  5NUC A;  5C3X A;  2EY1 A;  5I6W A;  3C1E A;  1RKN A;  1KDB A;  2SOB A;  4K6D A;  5CR3 A;  5DEH A;  4EQO A;  5IGB A;  5EGT A;  4KTA A;  2M00 A;  2KQ3 A;  2O4X A;  3OMG A;  4RKL A;  2F0U A;  4ZUI A;  4DGZ A;  2F0P A;  1KAB A;  3C1F A;  1EZ6 A;  4E6I A;  4DF7 A;  1STN A;  2PZW A;  4KY6 A;  3DHQ A;  4KD3 A;  4PNY A;  4PMB A;  4S3S A;  1SYB A;  4KY5 A;  3QOL A;  2F0D A;  5KGU A;  3SR1 A;  5KYI A;  4ODG A;  1TQO A;  1A3V A;  1SNP A;  1A3U A;  5KRU A;  1TT2 A;  3SK4 A;  2RDF A;  5JOB A;  4F7X A;  2EY6 A;  4NDX A;  2EYO A;  4ZQ3 A;  1SND A;  3D4W A;  4KHV A;  3SHL A;  4DU9 A;  4K8I A;  1A3T A;  5J39 A;  2EXZ A;  2F0Q A;  3TP7 A;  3DMU A;  5CC4 A;  4MIU A;  2QDB A;  1AEX A;  1STY A;  1SNC A;  4HTH A;  1EY8 A;  1STG A;  5IOC A;  5KIX A;  3OSO A;  2PW7 A;  4K2K A;  1EYA A;  3E5S A;  1SYE A;  2EYJ A;  3QB3 A;  3R3O A;  1EY5 A;  3SXH A;  4YIJ A;  5IOD A;  5IGD A;  1TR5 A; 
#chains in the Genus database with same CATH topology
 4JPB W;  4FXG C;  4RGM A;  2EY5 A;  4WJ3 M;  4DXG A;  4DR7 Q;  2C5C A;  1D1K A;  2RSN A;  4LFB Q;  4BA1 I;  5IWA L;  2QEX A;  3UDF A;  1F2Z A;  3HOY G;  2R92 B;  1N32 L;  4RHS A;  3HZX A;  4XYQ A;  3S1R H;  3CD6 A;  2JA6 H;  1S3O A;  4Y7N B;  1D1I A;  1YNJ C;  4YWK A;  4KV6 A;  5M5X B;  4B3R L;  2EYL A;  4JI8 L;  4MTK A;  2UXD L;  4UY8 C;  2KEE A;  1YEZ A;  1WTH A;  2VY3 A;  4JOI A;  3KF6 B;  2LSS A;  1NTG A;  2YTV A;  1ZYR D;  1NSN S;  3GTJ H;  1DYQ A;  4B08 A;  3I90 A;  1D7Q A;  3S2D B;  4HIO A;  1DXM A;  3I4N B;  1NMG A;  4JBJ A;  1PH5 A;  2Q2T A;  1G29 1;  2MQH A;  2X69 A;  4L5S A;  2A19 A;  5JJI A;  4A75 A;  3TS0 A;  4LF6 L;  3EJI A;  4RGT A;  1X55 A;  3SGI A;  1I3Q H;  1D6E C;  4TRD A;  3ULJ A;  4DAP A;  3HP3 A;  1F2L A;  4R8N A;  1V1P B;  1K0R A;  2VZA A;  2WP8 J;  2FJ2 A;  1EY6 A;  2EQS A;  5AFW A;  2CH4 A;  5HGT A;  1H9S B;  3A0J A;  1RHP A;  2Z6K A;  3I4M H;  1LTA D;  2RQX A;  2YU9 H;  3SVM A;  4OWT B;  4DUZ Q;  2KCT A;  4WJW A;  2JA8 B;  2R92 G;  2O4X A;  3I91 A;  3MFY A;  3KLR A;  4R8I A;  2EDG A;  3FPP A;  1MGS A;  1YJ9 A;  2A74 C;  3EIV A;  2HCI A;  4HIK A;  3HKS A;  3SR1 A;  3T1Y Q;  5GAH C;  2VUM B;  4IUV A;  1YIJ A;  1SFO H;  1N8R C;  2NB0 A;  1XNR L;  3A55 A;  1PYB A;  2K6A A;  1SMY D;  3D4R A;  2L0C A;  3W1G A;  3UDX A;  3CRK C;  3PUX A;  3STB D;  4DR5 L;  1KC8 C;  3QB3 A;  1U4M A;  3M3Y B;  1FNU A;  3KDF A;  1PRT D;  2YTY A;  4OWW B;  5CV9 A;  2E2H B;  2ZXO A;  3D4D A;  1N32 Q;  2LMC B;  3D31 A;  1K3B C;  4Q0F A;  1PVO A;  3PUV A;  1O80 A;  4M1U B;  2F3I A;  5FLM G;  4OIJ A;  4U67 3;  1CA6 A;  3J81 L;  4BY7 G;  4IPC A;  4BBR H;  4GKK Q;  2E2D C;  4RAU C;  2K5H A;  3I2Z A;  2R93 B;  4DK3 C;  4X65 Q;  1IYJ B;  4XT1 B;  4EVO A;  2KEC A;  2AMC B;  2A68 D;  3QIA A;  4ABN A;  1SXT A;  4IUU A;  2VB3 X;  3CW2 C;  1Q81 C;  4IUT A;  2KA7 A;  3FRP B;  4LF5 L;  1S40 A;  3FMC A;  5M3F B;  1Q46 A;  4KHZ A;  2JA6 B;  1PTO D;  3E9I A;  1STB A;  2PQA A;  1VQL A;  1JB7 A;  4YCU A;  5EQ0 A;  5L37 A;  2CW0 D;  1AH9 A;  5BN5 A;  1JOQ A;  1AW7 A;  3UDG A;  4DUY L;  1K83 H;  4QUC A;  2KCM A;  3CCS A;  1HZB A;  1KIX A;  4BBR B;  3V05 A;  4IOA A;  2V1C C;  1H9R A;  1Q12 A;  5BR8 Q;  1J9O A;  1YNJ D;  2C9O A;  3CXC A;  1CI3 M;  1EQT A;  4HJ5 A;  2JA7 G;  1D5X C;  4LWC A;  3H15 A;  1O7I A;  4RMF A;  5ELE A;  1MKH A;  1HZA A;  1PHJ A;  5C3E B;  1B50 A;  3I7F A;  3NEN A;  1HPC A;  3IFD A;  1WCM H;  2QIL A;  1VQ4 A;  5IWA Q;  3NTI A;  1YNN C;  3I4L A;  4X3S A;  1CHQ D;  2YYZ A;  3KLW A;  1TQO A;  1VQB A;  1NR4 A;  2NN6 G;  2PI2 E;  1EWC A;  1H9K A;  1HTP A;  1OO9 B;  1TWF H;  3M4P A;  1VQJ A;  5C0X G;  3K5L A;  4R4O A;  5CC4 A;  4DV4 Q;  1FNV A;  2J4X A;  4U68 A;  4JYA Q;  2NBF A;  2E2J H;  4FF1 A;  1TKW B;  5GQO A;  2ICE C;  4ZRZ A;  1WTV A;  4GOP C;  2I5H A;  1KTK A;  1A6X A;  1NE3 A;  3K58 A;  3K81 C;  5CYU A;  3NEM A;  1A2T A;  3SDZ A;  4DR1 Q;  1NUC A;  3PUY A;  1VQK A;  2ZJP A;  1Y69 U;  3VR2 A;  2NN6 H;  3T16 A;  3S24 A;  1BBW A;  2NVX B;  1S4Z A;  2AWN A;  2NWG A;  3PIP A;  2B2W C;  5IYC G;  5FO7 B;  1G8Z D;  2F1M A;  4B3T Q;  4A3I B;  4QCL A;  4C2M B;  4LF5 Q;  1EY9 A;  4LK1 C;  1MBY A;  3GTP H;  4BBR G;  4RWS C;  4HR7 B;  1CT1 D;  3CC2 A;  1LO5 D;  4GN3 B;  1EIG A;  4JCV E;  3CAM A;  3F2B A;  5GRO A;  4LF7 L;  1LTI D;  1VCI A;  4N9T A;  1N33 Q;  1K73 C;  4DNT B;  4A3K H;  2HDL A;  4Z9C B;  4C3J H;  2WKC A;  4DR2 Q;  2ZT9 C;  1XMO Q;  3NXW A;  4FF3 A;  4ID6 A;  1GM5 A;  3WOE A;  4A3J H;  1EWH A;  3VR4 A;  1SE8 A;  2B63 B;  1SYD A;  3I55 A;  2DN8 A;  1JT8 A;  3W5O A;  2OWO A;  2UXB Q;  3PQI A;  4BWG B;  1RTO A;  3MZ5 A;  5IT9 c;  1PTO F;  2KHS A;  1LLR D;  3I4N G;  2XGT A;  1Q1B A;  3NWS A;  2N78 A;  4QUF A;  1RKN A;  4GKJ Q;  5CR3 A;  4HSV A;  5EGT A;  2K5N A;  4IPG A;  1TWA H;  4ZUI A;  3Q24 A;  1Q7Y C;  4IFD H;  1T9H A;  3J80 E;  1GJX A;  3E0J A;  5FJ8 G;  2DUD A;  5GAE C;  1YHB A;  1HA5 A;  2KHI A;  3OW7 A;  2PCF B;  3R2T A;  4XQN A;  1BCP C;  1D5Z C;  2IX1 A;  2EY6 A;  4TSS A;  2HHH L;  1A3T A;  1VDZ A;  1EEF D;  1STY A;  5J3B A;  1K3R A;  1IBM Q;  4QGU A;  3A5U A;  1CQF A;  4OX9 L;  2UUB L;  1I50 H;  4P71 A;  2K33 A;  5IOD A;  1QIL A;  2K1B A;  4IPH A;  3OPO A;  3UDI A;  3IRB A;  1VQP A;  4B3T L;  3E3X A;  4JI0 Q;  5C4J H;  4QJF A;  1X9N A;  4OEM B;  5LL6 X;  4FP5 D;  2R61 A;  1NJI C;  5GAG C;  3MEH A;  4DUY Q;  1HCZ A;  4K5X A;  4MHE A;  2PI2 A;  2R7F A;  5FLX c;  3HOV H;  4YY3 L;  3PO2 B;  1XNQ L;  5JJK A;  4IUP A;  4RHR A;  3K0X A;  3MWY W;  4KD4 A;  1HNX L;  3CU7 A;  3I72 A;  4K8J A;  3K7A H;  3G7L A;  4L6T B;  1JJG A;  1N33 L;  1I5F A;  3QO2 A;  3KF6 A;  1WTX A;  4WJ4 A;  2FXQ A;  2PPB C;  1AE2 A;  2IJ0 A;  5FLX L;  4YWM A;  4A3M H;  1XYI A;  2BCO A;  1TWH H;  1X3E A;  4N9P A;  5IIF A;  5ISR A;  3SK8 A;  1KD1 C;  1X32 A;  4ME3 A;  4B3M L;  4A3J G;  1Y1W H;  2EY2 A;  2OQ0 A;  3FP9 A;  5IP9 H;  2VXW A;  1CKM A;  1TS5 A;  4CHT B;  3CCE A;  1PYW D;  1A63 A;  2EOT A;  3PO2 H;  2R3Z A;  5DNF A;  4UP7 A;  1VQ7 A;  3VYT A;  1GUW A;  4X3K A;  2XN9 C;  3KLS A;  2YTX A;  3K7U C;  2XNA C;  4PV1 C;  1IKL A;  3SE0 A;  1WTQ A;  4MTN A;  2F0F A;  5M5Y B;  2MPM A;  2R7D A;  5EKI A;  3DUZ A;  2A69 D;  2JJQ A;  3UE0 A;  3J7A 5;  4CDD C;  1DD2 A;  3AFP A;  2L4N A;  2F0U A;  4IJL A;  4JI5 L;  5TSS A;  1D8L A;  4PZ7 A;  3DHQ A;  1AZQ A;  5JEA H;  4R4Q A;  3U50 C;  4A3L H;  4DAY B;  2K32 A;  1A3U A;  2CWP A;  1X3G A;  4DUZ L;  4FXK C;  1GUO A;  1EU3 A;  1Q1E A;  1HNZ L;  5KIX A;  1XMQ L;  2A5H A;  1BO0 A;  4KK7 A;  2KJX A;  4TVA B;  1D2B A;  2B39 A;  1IXR A;  1C8C A;  4QQB X;  1E7Z A;  2B2V C;  1BBU A;  1SYE A;  2K7V A;  2Z9H A;  4A3C H;  4BBS H;  1MHW C;  5EJW A;  1EQV A;  1IZ6 A;  3MXN A;  1XPO A;  2RVL A;  1E2W A;  4HCS A;  2AKW B;  2KVM A;  2NVY H;  3TZD A;  4K0K Q;  2ZJQ A;  1A8V A;  1QZG A;  2MP1 A;  1HNX Q;  1NBW A;  1GUT A;  5J1Z A;  2N88 A;  3U9O A;  1JWS D;  4ULL A;  1XMO L;  1I4G A;  2LXJ A;  1E1O A;  1PRT B;  3E6Z X;  1WJJ A;  3MVV A;  4EQN A;  4MZ9 A;  4FF4 A;  4NPS A;  1Y1V H;  1JMC A;  1OTC A;  4JV5 L;  1XTD A;  4ZCK A;  4A3I G;  4PQX A;  1I4P A;  1KRT A;  2BH8 A;  4JI4 Q;  4K5W A;  5FJ8 H;  1Y1W G;  4BBS B;  3GTG B;  1YJN A;  1QCB D;  2UXC L;  1K8A C;  3GTP B;  1FYC A;  3BZK A;  4HID A;  4R1J A;  3SK5 A;  3V2T A;  4R4T A;  1FR3 A;  4R9W A;  5F2D A;  1SFO B;  1G2T A;  3J7A F;  3T1Y L;  4V0B A;  5D65 A;  5FKA C;  3H0G H;  4DR3 Q;  2RHQ B;  4O42 A;  2DGY A;  2Z6B A;  4GLA C;  1Y1V G;  1CTM A;  5CV6 A;  1WTP A;  1TVX A;  2F3V A;  1PTO H;  1Y1V B;  4LUZ A;  3Q6S A;  2Z4I A;  1U4L A;  2F0G A;  4DN4 M;  4JI5 Q;  4C3J G;  1DJR D;  4FYD A;  1Z47 A;  2XRS D;  2JSO A;  2XVS A;  2JE6 I;  4AQY L;  4LW1 A;  1KAB A;  5C0X I;  3HOU G;  4FF2 A;  1STN A;  2PMZ E;  3HOY H;  1X6O A;  1SYB A;  5KGU A;  5KYI A;  4YY3 Q;  1HR0 W;  1K28 A;  4ODG A;  4QL5 A;  1PDQ A;  1V9P A;  5JOB A;  1MIU A;  4F7X A;  1TY2 A;  3S14 B;  2BA1 A;  1IYU A;  2KOL A;  2EJF C;  2I5M X;  3OIP A;  1IKM A;  1CFM A;  3AMU A;  1LUZ A;  1SBB B;  4LFA L;  3MFG A;  1SEB D;  1NMF A;  4DV6 L;  2R6G A;  1PRT F;  4NXN Q;  1X3F A;  3RR5 A;  4YIJ A;  2X6L A;  3GTL B;  4DR6 L;  2CW0 C;  5M3F H;  4UHV A;  2WIN B;  2AQ1 B;  3FKI G;  1W3S A;  2PO4 A;  1PH3 A;  4PZ8 A;  2NZ1 D;  2AUJ D;  4C1N K;  1K83 B;  5JVG 3;  1VQ5 A;  5IYB G;  3NTK A;  3F2U A;  5JEA G;  3TP6 A;  1IBK L;  2A68 C;  3L0O A;  1EIF A;  3ZYY X;  1L2F A;  3S14 H;  4X62 L;  3ND8 A;  5C4Z A;  4DV7 Q;  2F0I A;  3DLL A;  2AUK A;  2J7Z A;  3DM1 A;  3HOV G;  3ICE A;  1JQY D;  4JW0 A;  1ET6 A;  1LAB A;  4HIM A;  5CBA E;  3BYT B;  1EYG A;  4GNX B;  4ZYS A;  2LY7 A;  2IX3 A;  2ASB A;  2H5X A;  1QNU A;  3NK9 A;  1L0W A;  4IQZ A;  2QEJ C;  2LS0 1;  3TZU A;  4XIG S;  4JI6 L;  5E1F A;  3I73 A;  4DV2 Q;  3PF5 A;  4A4I A;  3NPP A;  3GTG H;  1KNA A;  1XMQ Q;  1SJH D;  3P20 A;  2G5D A;  3S2D H;  4DV4 L;  3STB C;  1XNQ Q;  1ZYR C;  4C56 C;  3T56 B;  4KI0 A;  3ULP A;  2Q8I B;  2LKV A;  2CH4 W;  1ET9 A;  3BVM A;  1EFI D;  2F0V A;  2KCC A;  1LTR D;  2Z4H A;  2AWO A;  1DOM A;  4LMQ D;  5C3W A;  4AYB B;  3CME A;  3GTO B;  1JJC B;  4RH6 A;  5C3X A;  5I6W A;  1KLU D;  1DOL A;  2KQ3 A;  3BJU A;  3HOX B;  1UEB A;  4DKA C;  2L12 A;  3R2I A;  3I56 A;  1I4R A;  4XQJ A;  2NVX H;  4Y52 H;  2MNA A;  4C2M H;  2AQ3 B;  1SNP A;  4C3I G;  4HJ8 A;  3L9A X;  1V1Q A;  4BXX G;  1SND A;  4K8I A;  4DXF A;  4IJH A;  5EPJ A;  1F9R A;  3TP7 A;  4BY7 B;  5IOC A;  4BY1 B;  1EY8 A;  1S5D D;  4A3B H;  2PW7 A;  1EIH A;  1TII D;  1LTT D;  1GXD C;  4RA8 A;  1BBX C;  4G7O C;  1L0X B;  1RDP D;  1VQF A;  4QIW B;  1IW7 C;  5A2Q L;  1VQA A;  1BVS A;  1EFW A;  1UNS A;  2OXP A;  5M3F G;  3ZJY C;  4QF4 A;  3CMA A;  1RTN A;  1SYF A;  3RMH A;  2B8F A;  1XPR A;  1PYS B;  4JVZ A;  2JA8 G;  1GUS A;  2HCC A;  4ME5 A;  3M4O B;  5ELF A;  3URY A;  2A6E D;  1HH2 P;  2IT1 A;  3OTO Q;  4O0A A;  4IFD J;  4IUR A;  4H7B A;  1K8O A;  1TWG H;  1RIP A;  1GHJ A;  2L11 A;  4B9X A;  3M7N A;  3H6M A;  1J6Q A;  2Z1C A;  2X6G A;  4GKK L;  5I2Y A;  2F0E A;  3PF4 A;  1WCM G;  2TMP A;  4PG3 A;  4X65 L;  2WB1 E;  2F0J A;  3VDY A;  2FIN B;  4HJ9 A;  4A3G G;  4ZUJ A;  2ALY B;  3M4Y A;  2NZO A;  2PQE A;  3T51 B;  1I6V C;  1EY7 A;  4RCN A;  1SNQ A;  1PXU A;  4LFC L;  2F0T A;  4N8F A;  1G6P A;  4PMW A;  4B3M Q;  1BKB A;  3A7L A;  2DNC A;  3BDC A;  3H0G B;  1F9S A;  2XIW A;  4G4K A;  1PTO C;  3K59 A;  4L5T A;  3S1Q H;  3MAQ A;  3K0Y A;  1WTW A;  4JBM A;  1UE7 A;  2OEO A;  2ES2 A;  4V19 0;  2PNH A;  5C4J B;  2SOB A;  1CHP D;  4AH6 A;  2JQO A;  5ELC A;  1T5X D;  3W2D A;  4JI3 Q;  2XTI A;  4P75 A;  3H91 A;  1EQQ A;  4E6I A;  1NNX A;  3C46 A;  5IYC H;  2ZTC A;  2VL6 A;  4UDU C;  5IE8 A;  2I07 B;  3SK4 A;  1U5K A;  4X62 Q;  3HOX H;  2B2U A;  3HGB A;  3D3R A;  1SNC A;  4C3I H;  1HHV A;  4DAM A;  2E74 C;  3PV0 A;  3FDT A;  3N6R A;  2OT2 A;  1G91 A;  4P73 A;  2RF4 A;  1X3P A;  1FGB D;  1GUN A;  5IYD H;  1TR5 A;  3X3N A;  5C0X H;  1VQ6 A;  2EIF A;  1I94 Q;  1Q3L A;  1D5M C;  1Y14 B;  1EYC A;  4B3S Q;  3GTQ B;  3S1M H;  4BY1 H;  4JI6 Q;  3KK7 A;  1C48 A;  4LF8 Q;  3GTK B;  1HNW L;  2GVB A;  4NXM Q;  3CPW A;  1YNN D;  1B44 D;  2F0H A;  4K0K L;  3S2H B;  3PSI A;  1SLJ A;  2NUC A;  1I6H B;  5COR A;  3NP8 A;  5M5Y H;  1N36 Q;  3Q22 A;  5IYD G;  3FKI B;  3A8J E;  3LWU A;  3BVG A;  2NVQ H;  1E22 A;  2LXK A;  2IL8 A;  5CGK A;  1BXT A;  1EL0 A;  4LFC Q;  1STH A;  1WVL A;  2RKS A;  1QUQ B;  5IGF A;  1NR2 A;  1Q90 A;  1VQM A;  4IUN A;  5IY0 A;  2VQF L;  1HFN A;  3U9S A;  4YWL A;  1STA A;  4X66 L;  1O7Y A;  1XWE A;  2PZU A;  2JA5 B;  2F0O A;  1SMX A;  4LF7 Q;  4A93 G;  3OYY A;  2CVR A;  4HAE A;  2I0Q A;  4A93 B;  2GA4 B;  3J81 E;  1EIY B;  1Q8K A;  2K50 A;  3HOW G;  1E3P A;  1A2U A;  4UAI A;  4DV7 L;  1VQE A;  1S5E D;  3VA7 A;  2K01 A;  3M7G A;  1V1O A;  2ZTE A;  1KRS A;  4PZ6 A;  2NVQ B;  4YCV A;  4A3E H;  5ELN A;  4DV3 Q;  3VYR A;  5DEH A;  3J7Y W;  4JG2 A;  3EQL C;  1GO3 E;  2E8G A;  2YV5 A;  1PFB A;  1LTB D;  1EZ6 A;  2PMZ B;  3S1Q B;  4KY6 A;  1E24 A;  3HG9 A;  4S3S A;  3QOL A;  1A3V A;  4TQU S;  3HOZ G;  5C44 B;  4UPA A;  4DAV A;  5ELB A;  2ID0 A;  3JAM i;  1AFP A;  4ZQ3 A;  2IHF A;  3LNN A;  4JV5 Q;  3CC7 A;  4DU9 A;  3I70 A;  4AQY Q;  3RZO B;  1VMP A;  2BDN A;  2B8G A;  4OO1 I;  4N8X 1;  3PIO A;  5HY6 A;  3CC4 A;  1PH1 A;  5C4X G;  2HUG A;  3D6W A;  3VR6 A;  1ASZ A;  5BN3 A;  2HD3 A;  2UXC Q;  1VQO A;  5EAY A;  4A76 A;  3TME A;  1EZ8 A;  5I9P A;  1LTG D;  3O13 A;  1HNW Q;  3HRZ C;  1AN8 A;  5JJL A;  1BCP D;  3C2P A;  2D62 A;  4C3I B;  2VQE L;  1PH2 A;  1L1O C;  4X3U A;  3G6E A;  3PCO B;  4BBS G;  1I50 B;  1UEA B;  2F0K A;  4DV0 L;  4BS9 A;  2N3S A;  3BVZ A;  3KBG A;  2IY5 B;  1ILQ A;  2A6H C;  1STE A;  5CBE E;  2NTT A;  2D2C C;  3R93 A;  2I5L X;  3TP5 A;  1F9P A;  1H9J A;  2IX0 A;  2HDM A;  1B1Z A;  3KUP A;  5EKL A;  2JA8 H;  1IBK Q;  5FO8 B;  3I4M G;  2MJ8 A;  1VQ9 A;  1SNO A;  3NQT A;  2FMM A;  2B2T A;  2JA7 B;  1TWG B;  2CQO A;  2CCZ A;  1C0A A;  4A3F G;  2XWJ B;  2ZJR A;  1OXV A;  3S1N H;  4B9W A;  1YZ6 A;  2ZTD A;  4DR7 L;  5C5M A;  1N34 L;  1T5E A;  1ENA A;  1UUP A;  3HOW H;  3CCV A;  1KXL A;  5D3D A;  3OWF A;  1IHZ A;  1HQR D;  3RD4 A;  1JOK A;  1WFQ A;  4H0L C;  2M9V A;  2IW3 A;  1BR9 A;  1KHI A;  1C7Y A;  3M3Y H;  3OTO L;  4IO9 A;  1ESR A;  4A3C G;  5EBC A;  2UXD Q;  2SEB D;  3D0F A;  1JOO A;  3QWN A;  3F2C A;  2HIV A;  2M2L A;  1SAP A;  3Q8D A;  2M00 A;  3WDN A;  1IL8 A;  4KN4 C;  4XYO A;  4PMB A;  2PZW A;  1PV4 A;  4KD3 A;  2KEN A;  1GKH A;  5I4D A;  4NXM L;  4DR4 L;  3S17 B;  1TWA B;  4A3E B;  3S15 H;  2K52 A;  3H3V H;  1DON A;  4OO1 H;  3JAM L;  1R9T B;  4DR1 L;  5EBD A;  2HT1 A;  1QB5 D;  1BQQ T;  3AYH B;  4DV0 Q;  4A3D G;  3NSW A;  1JE5 A;  1SE3 A;  3QJY A;  5C0X J;  4G57 A;  3CCL A;  5M5W H;  4DPG A;  1EY4 A;  4J8Q A;  5DM7 3;  1IL2 A;  1PZJ D;  1GUG A;  1ROD A;  4DV2 L;  2K04 A;  3K8A A;  1EYD A;  3A56 A;  5KNC A;  1NY4 A;  3FPU B;  2JA6 G;  4YCW A;  3L3O C;  5HGQ A;  3GP7 A;  3GTQ H;  3S1M B;  1B70 B;  1M8A A;  2H4O A;  2WB1 B;  3M9B A;  4LUV A;  3VA5 A;  1N9W A;  1K8M A;  2HIX A;  2VUM H;  1KAW A;  4C1N I;  5H1S E;  4G7H C;  1BCP F;  3HOZ B;  1N34 Q;  4AIM A;  2F0S A;  1QUQ A;  5JJZ A;  1IBL L;  4PMC A;  2B2Y A;  4J15 A;  3K7A B;  5FK9 C;  4HED A;  1LTS D;  1RL2 A;  4KJO A;  2SDF A;  1FJG L;  4IAL A;  2OTJ A;  1MD2 D;  3GV3 A;  2F4V Q;  5C4X B;  2HQE A;  1CK1 A;  1HR0 Q;  4H02 A;  1Q8I A;  2JYO A;  1EU4 A;  2R7Z B;  3ER0 A;  3EBE A;  2DY7 A;  4JC0 A;  3NBI A;  4MNO A;  4JBK A;  2Q2U A;  4CDE C;  3HOU B;  5IGE A;  1SNM A;  4YHH Q;  3QG1 A;  4O2D A;  5JAV A;  3MA2 B;  3MTS A;  4ILW A;  1JWM D;  3NQI A;  1P16 A;  1ICW A;  2E2I B;  3HKZ G;  3B6Y A;  4UP9 A;  4A3B B;  3VYS A;  2Y0S E;  1TS2 A;  3IL8 A;  1UE1 A;  1N36 L;  4XXE A;  4C3H B;  2A8V A;  1B53 A;  4K6L A;  3HOW B;  2K5V A;  2FFK B;  1PMR A;  1B8A A;  4GS3 A;  2D0P A;  4JI1 L;  1G2S A;  1S5C D;  4A3L G;  2JXM B;  3X3M A;  2VQE Q;  1WTO A;  2E5L L;  1J5E Q;  2Y0S G;  4CKE A;  4DGZ A;  5LMN L;  4GNX A;  4X64 L;  4LUO A;  1V1P A;  3NEL A;  1YNX A;  1LM0 A;  4RFB A;  1DGS A;  2KUM A;  2WKD A;  3RZD B;  5DLQ E;  3A74 A;  4KN7 C;  4XDX A;  3M4O H;  1TWC B;  1S5F D;  2FHT A;  1PLF A;  1YBY A;  5LHY 1;  4JI3 L;  3G71 A;  1BOS A;  4DV5 L;  2NYZ D;  4AYB E;  5J39 A;  3BZD B;  1X65 A;  3ULL A;  3JAM c;  5C3E G;  3NWT A;  1STG A;  1LT3 D;  3R3O A;  1G51 A;  3RZO H;  2UUC L;  3PMF A;  4RCO A;  4EGV A;  3NE5 B;  3KJP A;  4DV3 L;  2KBN A;  4C3J B;  5IGG A;  4O1N A;  1R9T H;  1H9S A;  4HCE A;  1WTR A;  3RUZ A;  3S1R B;  5JPM C;  4OL7 A;  3RN5 A;  3GTL H;  1YIT A;  2A69 C;  1YHQ A;  4P72 A;  2EPB A;  4GOP B;  4ZKC B;  2DJF C;  2B63 H;  4JOI C;  1MI2 A;  4B3S L;  1RJT A;  1WI5 A;  4HSP A;  3LWE A;  3UE1 A;  1B9N A;  3E0E A;  5CV4 A;  5IYB H;  5D3I B;  1HUN A;  2A6H D;  2G9D A;  1F2Y A;  4IFD G;  1JWU D;  1SYC A;  3PUW A;  4J1M A;  1PH9 A;  2A73 B;  4HJA A;  3I4N H;  1H95 A;  1I4H A;  4K14 A;  4OIK A;  2UUA Q;  5M3M B;  1Q86 C;  4DK0 A;  3MEF A;  3J7A V;  5CV8 A;  1ZKO A;  1R4Q B;  4I65 A;  3TRE A;  3V96 A;  4BXX H;  1XJV A;  2JEA I;  1BNZ A;  3P7J A;  1OXT A;  1XPU A;  1PRT C;  4DAY A;  3OIQ A;  5E4W C;  1QZH A;  2B2V A;  3GD7 A;  4A3G H;  4OX9 Q;  3JC6 6;  2UUB Q;  1PH4 A;  2Q2I A;  4NMZ A;  5LMN Q;  1LTL A;  1E1T A;  3GDE A;  2MUY A;  2F0L A;  1HJP A;  3J80 L;  1JIC A;  2CHB D;  1PFN A;  3MXG A;  1TS3 A;  1KDB A;  1OXS C;  1YVC A;  4K6D A;  1VQC A;  4KTA A;  3BYY B;  5JEA J;  3Q0A A;  4DV5 Q;  3HKZ E;  3TS2 A;  4LF8 L;  3HOV B;  2VUM G;  4DF7 A;  4KY5 A;  4RGN A;  4GZY C;  3AQQ A;  1TT2 A;  4BA2 I;  1Y8N B;  2RDF A;  1I6H H;  3N52 A;  2RSO A;  3RLO A;  2L15 A;  4OON A;  2TSS A;  3ND9 A;  4JK1 C;  1HRJ A;  1DZ1 A;  4A3K G;  3HOY B;  3T4A C;  2BH2 A;  3S17 H;  1CZW A;  3FKI H;  1KLG D;  4AYB G;  2MO1 A;  1W2B A;  3OHX C;  2EYJ A;  3A5Z B;  4A3M B;  4L5Q A;  1VMC A;  1TWC H;  3HOX G;  2R93 G;  3SEB A;  4ZKB B;  3TQY A;  4FO2 A;  2R92 H;  1HZ9 A;  3HKZ B;  2IWH A;  2F4V L;  3I3C A;  4A3B G;  4JYA L;  3VYU A;  3PIO 3;  1ZXT A;  2MHV A;  2F4I A;  1X3Q A;  5M5X H;  2WAQ E;  1G6Z A;  2V4D A;  3NUC A;  2Z8L A;  3BU2 A;  2F0N A;  3TN2 A;  1ML0 D;  2JN4 A;  5BN4 A;  5DM6 3;  2Q8T A;  4DR4 Q;  4HMI A;  4BY1 G;  5C6A A;  1VQ8 A;  3D6C A;  4KHP L;  2B29 A;  1WYD A;  4FNF A;  2K5D A;  1QNK A;  3HFZ B;  1GD7 A;  3MHB A;  5FLM H;  3AB9 A;  3ERO A;  3S9W A;  1DOK A;  2KED A;  3BS1 A;  1HA6 A;  3RLN A;  4RKB A;  3CHB D;  4GN4 B;  4DK1 A;  1OXX K;  2N8N A;  4LF6 Q;  2EJM A;  1VS0 A;  2WAC A;  1J5E L;  3K6O A;  1KDA A;  1W6J A;  3FEW X;  1PA6 A;  3TRZ A;  3EFX D;  1U0L A;  1SJE D;  3RNU A;  1F2M A;  1QJO A;  4TKO B;  2B3G A;  1M4V A;  2IPK D;  2K14 A;  4EQP A;  5C44 H;  3Q23 A;  4Q5V A;  2RHS B;  2IHE A;  5LL6 S;  2Q2H A;  1ILP A;  1BDO A;  2Z0S A;  2ZXR A;  1X54 A;  3IKJ A;  5C3E H;  1CA5 A;  2PYK A;  3NTH A;  2CKZ B;  2EYH A;  5LMN W;  1WCM B;  3T53 B;  5AJ3 Q;  4X3T A;  4POG A;  1B2T A;  2EYP A;  1SR3 A;  2EVB A;  1EQR A;  4KMU C;  2E2I H;  4ZAI A;  4IUQ A;  4A3M G;  1EUJ A;  1SE4 A;  3J7Z C;  5GAD C;  4IOC A;  4HN7 A;  2EZV A;  2UXB L;  2LFN A;  4MN3 A;  3VR3 A;  1TWF B;  3GTO H;  1WD0 A;  4IFD I;  4LFA Q;  3A54 A;  4LF4 Q;  1S5B D;  1QE6 A;  1FNW A;  3EN2 A;  1CUK A;  1O7L A;  2RCN A;  4KLK A;  2BE5 D;  3BZC A;  4NDX A;  2PNR C;  2XWB B;  1C9O A;  1B3Q A;  1A15 A;  5E7N A;  3A8I E;  1GOZ A;  3F8T A;  2RDH A;  1Z6H A;  4FVM A;  3KF8 A;  5ELD A;  1H9M A;  2HHH Q;  1A0I A;  4JI7 L;  1SYG A;  3CP0 A;  2ATW A;  1IBM L;  2PZT A;  3LX0 A;  3S16 B;  5CV7 A;  4GOP A;  2R93 H;  4I7A A;  1TXY A;  3CKI B;  4A3I H;  2OF1 A;  1TS4 A;  3J80 c;  1I94 L;  3CQZ H;  2BOS A;  2QF7 A;  2JA9 A;  1HXY D;  4UP8 A;  2WAQ G;  1HNZ Q;  4CDC C;  1PH7 A;  3T13 A;  4JI0 L;  3KOJ A;  1NCV A;  5I9O A;  4J6H A;  1KDC A;  2HQL A;  1C4Q A;  4LF9 L;  4JBW A;  1BUV T;  4NP5 A;  3K57 A;  3DEO A;  3J81 i;  5I2X A;  3GTK H;  3MXP A;  2B2W A;  3GO5 A;  2F3W A;  4KKT A;  4DV1 L;  4A3F B;  2B2U C;  4OEL B;  5C44 G;  3EA6 A;  3NHH A;  1I4Q A;  2SNM A;  2O5J C;  5CV5 A;  1MSG A;  2SNS A;  1AP0 A;  1XTC D;  3PO2 G;  5BR8 L;  1BCP B;  1YI2 A;  1J8I A;  3W3A A;  2QW7 A;  1QOH A;  4OXP A;  3CQZ B;  4NB3 A;  1FJG Q;  4OWX B;  2XSC A;  3GTM H;  3D8G A;  3CCU A;  3JAM E;  3DXJ C;  3CCQ A;  3P1H A;  5C5L A;  2A1A A;  2K5Q A;  4X66 Q;  5KEE A;  2JA5 H;  1V8Q A;  1UE5 A;  4K2L A;  3H09 A;  2VW9 A;  5LMU Q;  1Z7T A;  3DM3 A;  4JI4 L;  1RD9 D;  3GTJ B;  3CCM A;  2QKI C;  1EOT A;  2CWA A;  5ELO A;  2NZH A;  4EQO A;  5IGB A;  4IPD A;  4RKL A;  3W1B A;  2N49 A;  4A3E G;  3HS0 C;  1FL0 A;  5FOB B;  2OQK A;  4CJ1 B;  2CFM A;  4CKC A;  1NAP A;  5D14 A;  3OWE B;  2E5L Q;  4DR3 L;  3T1H Q;  2EJG C;  4CJ0 B;  4KHV A;  4JI7 Q;  2EXZ A;  1SSO A;  2C35 B;  3KDF B;  2K5W A;  1LYL A;  1AEX A;  3HOZ H;  1Q82 C;  1EYA A;  3E5S A;  1LAC A;  2JA5 G;  1EEI D;  1HFG A;  1PTO B;  3K5M A;  5IGD A;  3LGJ A;  4IN3 A;  4HJ7 A;  4KY7 A;  4EX5 A;  2QA4 A;  3OW2 A;  5E4X A;  5EPL A;  1SDF A;  5K5P A;  1U9R A;  3CPF A;  1SRO A;  1EY0 A;  3BDO A;  1YJW A;  1BF4 A;  2GN5 A;  4R4C A;  3E9H A;  3HOU H;  1L0Y B;  1ESF A;  2UUC Q;  4B3R Q;  4NKL A;  3MC0 B;  3SK6 A;  4YHH L;  1XXG A;  3AEV A;  2GVA A;  2L9H A;  3H3V C;  4QB4 A;  3PIP 3;  1KL9 A;  2A6E C;  3R8B A;  1QVC A;  1A62 A;  4DV1 Q;  1XNR Q;  2ENB A;  3PUZ A;  1L1O B;  4I7Z C;  1VQN A;  2ZM6 L;  3PO3 G;  3K5O A;  4GLX A;  1O7Z A;  3G6J B;  4JI1 Q;  3I8Z A;  3L7Z C;  3F1Z A;  5C4H A;  2KHJ A;  1K8G A;  4G7Z C;  3QOJ A;  3FHW A;  4A3J B;  4K5V A;  3CF5 A;  2VNU D;  2PW5 A;  3UI2 A;  2AQ2 B;  2CQA A;  2MGS A;  2NN6 I;  2UU9 L;  3KJO A;  3TSS A;  2UUA L;  3DWQ A;  1QVF A;  4A3F H;  4GNX C;  2B2Y C;  3CCJ A;  5LMU L;  4WOR A;  4JI2 L;  4OO1 G;  1ICF B;  4GKJ L;  4FDB A;  2MO0 A;  2G9H D;  3PO3 H;  1E0B A;  3OOC A;  4KJN A;  2EE1 A;  1MJE A;  1VF7 A;  3TBI B;  1UAP A;  3M85 A;  1GHK A;  1TY0 A;  4DNI A;  4F87 A;  1FVI A;  4P74 A;  2WAQ B;  5NUC A;  4RG1 A;  2JEB I;  3C1E A;  1MJC A;  4LJZ C;  3GTM B;  3J81 j;  2XRQ D;  1GVP A;  3OMG A;  4EQ5 A;  1CKN B;  2H1E A;  3C1F A;  4DR5 Q;  1VQI A;  2F0D A;  3IAY A;  1JC7 A;  4DA2 A;  3TDQ A;  2Z6K C;  1JR0 D;  3M4Q A;  3SHL A;  4CBV A;  2D5D A;  2F03 A;  1RCV D;  2DNE A;  5K36 H;  1EOV A;  2NVY B;  5IP7 G;  3H3V I;  5M3M H;  1O78 A;  1ONL A;  4KKS A;  5CMD A;  1B7Y B;  1YHA A;  1TU2 B;  5AJ3 L;  1CSQ A;  3S15 B;  5COY A;  1II3 A;  3WOF A;  3K5N A;  3DWA A;  1JJ2 A;  5JVH 3;  1JOR A;  3TEH B;  4A3D H;  3KF8 B;  2BE5 C;  5J22 A;  4Y7N H;  1CM9 A;  4KKU A;  1PZK D;  2EXD A;  3G4S A;  3S16 H;  5EKK A;  4M8A A;  3FVQ A;  1KAA A;  1DM0 B;  2F52 A;  4ZK9 B;  3DWP A;  5G3L F;  1Y8P B;  2VS1 A;  1F9Q A;  5M9O A;  3L2P A;  1TWH B;  1HZC A;  1AE3 A;  1S72 A;  1P8L A;  1JB3 A;  1IW7 D;  1SE2 A;  2BDO A;  3OMC A;  4NW2 A;  5T1G A;  1ENC A;  2UU9 Q;  3ERQ A;  4KHP Q;  2DY8 A;  3NBH B;  2I46 A;  5KNB A;  4GN5 A;  1AZP A;  3IFT A;  4H13 C;  3U58 A;  2K75 A;  2QDL A;  1SN8 A;  4XTC S;  4P2C B;  1WD1 A;  4DK6 C;  3PGZ A;  1VQH A;  2ICI A;  2F0W A;  2WB1 G;  4A3D B;  1PZI D;  2FMC A;  1KQS A;  4CKB A;  4LFB L;  4HMJ A;  1Z9F A;  4ALP A;  1CKO A;  1IBL Q;  3T1H L;  2B2T C;  1EWI A;  4WRD A;  3S1N B;  3P75 A;  2D9U A;  1HR0 L;  3I4M B;  1PFS A;  1I4X A;  1WOC A;  2EYF A;  2P5Z X;  2R7Z H;  4ZLT F;  3WWV A;  4OHJ A;  3BDL A;  4XQQ A;  2K28 A;  1SMY C;  4APV A;  4JI8 Q;  5DAU A;  1M1K C;  2MFI A;  2K05 A;  3CRL C;  4F88 A;  2RCF A;  4QY7 A;  2BA0 A;  3HEJ A;  2JP1 A;  4CGY B;  3KYH C;  2EY1 A;  2L5T A;  1ASY A;  1UWV A;  2L1B A;  1PH6 A;  3A7A B;  4RGO S;  5EPK A;  3J80 i;  3PO3 B;  2F0P A;  4XT3 B;  3H94 A;  2L55 A;  2QGQ A;  4C3H H;  4CDF C;  2B63 G;  2D0O A;  4GLV B;  2RDG A;  1XX8 A;  5KRU A;  2E76 C;  3AU7 A;  4L8J A;  4A3K B;  2WFW A;  4DR2 L;  2EYO A;  3D4W A;  4L5R C;  2ZM6 Q;  4X64 Q;  1RF2 D;  2E75 C;  2F0Q A;  4MIU A;  3C3L A;  2QDB A;  2O2L D;  4HTH A;  3J81 c;  2E2H H;  1LV9 A;  4LF4 L;  3AFQ A;  2JK8 A;  4K2K A;  3DEP A;  3SXH A;  1V43 A;  4DNR B;  3CCR A;  3U4V A;  2NTS A;  4R4I A;  5K36 G;  4H44 C;  3BG3 A;  1QVG A;  5JPN C;  3GQB A;  1LT5 D;  3VR5 A;  1HTL D;  1K9M C;  4C3H G;  2VQF Q;  2EYM A;  1Y8O B;  2F0M A;  2K4K A;  3GV6 A;  1PH8 A;  5E3F A;  3K80 C;  5FO9 B;  1L1O A;  5M5W B;  1KNE A;  2QCP X;  2N55 A;  1QWY A;  2WII B;  3EVQ A;  4FXD A;  2Y0S B;  4JI2 Q;  4IZ8 A;  3QR8 A;  1ENF A;  2K03 A;  5IT9 L;  4OGQ C;  3TP8 A;  1CSP A;  2DJG C;  3RLF A;  1VQG A;  1B9M A;  4F8M A;  2AHO B;  1UE6 A;  1VQD A;  2Q8R E;  1B3A A;  1JE4 A;  5HUR A;  2NVT H;  5IP7 H;  4L63 B;  3ITP A;  1ZEQ X;  5IGC A;  4LAA A;  5IP9 G;  1I3Q B;  1CQV A;  5KYL A;  2RA4 A;  1JCK B;  4LF9 Q;  1OXU A;  1FGU A;  3ONA B;  1QG7 A;  1FD7 D;  4DFA A;  3MXN B;  5A2Q E;  2KCN A;  5G3L D;  2J0T D;  2OCE A;  3KBX A;  5C4X H;  2YU9 B;  4QMG A;  4X6A H;  1VF5 C;  2OTL A;  3S2H H;  3U4Z A;  2ZXP A;  2VB2 X;  3I4O A;  5M3M G;  1HUM A;  3RN2 A;  4LNQ A;  2WV6 D;  1MSH A;  1M90 C;  2NVT B;  1IYV A;  2RBM A;  2R7Z G;  5I6Y A;  1F77 A;  3KFU A;  1LT6 D;  5FLX E;  1W6K A;  4A3G B;  1CZG A;  1U4P A;  4QIW E;  1R4P B;  4CJ2 C;  5A35 A;  1PFM A;  3MXU A;  5KND A;  1Y1W B;  4PNY A;  1E2Z A;  2PQA B;  4BY7 H;  4NXN L;  4DV6 Q;  1DCZ A;  1E2V A;  3ERS X;  1X56 A;  1LT4 D;  1CKN A;  5IT9 E;  4DR6 Q;  2E2J B;  3H0G G;  1K0S A;  2O5I C;  5T1I A;  1U4R A;  3DMU A;  4WFN 3;  3A8K E;  3G48 A;  3RZD H;  3OSO A;  4POF A;  1SRU A;  1B4O A;  4A93 H;  2JA7 H;  1EY5 A;  3F2D A;  1HQM C;  3NBH A;  3KLS X; 
#chains in the Genus database with same CATH homology
 4FXG C;  4RGM A;  2EY5 A;  4DXG A;  2C5C A;  1D1K A;  2RSN A;  4BA1 I;  1F2Z A;  2R92 B;  4RHS A;  3HZX A;  4XYQ A;  4Y7N B;  1D1I A;  1YNJ C;  4KV6 A;  5M5X B;  2EYL A;  2KEE A;  1ZYR D;  1NSN S;  1DYQ A;  4B08 A;  3I90 A;  3S2D B;  1DXM A;  3I4N B;  1G29 1;  2X69 A;  3EJI A;  4RGT A;  1D6E C;  4TRD A;  4DAP A;  3HP3 A;  1F2L A;  4R8N A;  1V1P B;  2WP8 J;  2FJ2 A;  1EY6 A;  5AFW A;  5HGT A;  1H9S B;  1RHP A;  1LTA D;  2RQX A;  3SVM A;  4WJW A;  2JA8 B;  2O4X A;  3I91 A;  3MFY A;  3KLR A;  4R8I A;  2EDG A;  3FPP A;  1MGS A;  2A74 C;  2HCI A;  3SR1 A;  2VUM B;  4IUV A;  2NB0 A;  3A55 A;  2K6A A;  1SMY D;  3D4R A;  2L0C A;  3CRK C;  3PUX A;  3QB3 A;  1U4M A;  3M3Y B;  1FNU A;  1PRT D;  5CV9 A;  2E2H B;  2ZXO A;  3D4D A;  2LMC B;  3D31 A;  4Q0F A;  3PUV A;  1O80 A;  4M1U B;  4OIJ A;  4U67 3;  1CA6 A;  3J81 L;  2E2D C;  4RAU C;  2R93 B;  4XT1 B;  4EVO A;  2KEC A;  2A68 D;  3QIA A;  4ABN A;  1SXT A;  4IUU A;  2VB3 X;  4IUT A;  2KA7 A;  3FRP B;  3FMC A;  5M3F B;  4KHZ A;  2JA6 B;  1PTO D;  1STB A;  5EQ0 A;  2CW0 D;  5BN5 A;  1JOQ A;  1AW7 A;  4QUC A;  4BBR B;  3V05 A;  1H9R A;  1Q12 A;  1J9O A;  1YNJ D;  2C9O A;  1CI3 M;  1EQT A;  1D5X C;  5ELE A;  5C3E B;  1B50 A;  1HPC A;  3IFD A;  2QIL A;  3NTI A;  1YNN C;  3I4L A;  4X3S A;  1CHQ D;  2YYZ A;  1TQO A;  1NR4 A;  2NN6 G;  1EWC A;  1H9K A;  1HTP A;  1OO9 B;  5C0X G;  3K5L A;  5CC4 A;  1FNV A;  2J4X A;  4U68 A;  2NBF A;  4FF1 A;  1TKW B;  2ICE C;  4ZRZ A;  1WTV A;  1KTK A;  1A6X A;  3K58 A;  5CYU A;  1A2T A;  3SDZ A;  1NUC A;  3PUY A;  1Y69 U;  3VR2 A;  2NN6 H;  3T16 A;  2NVX B;  1S4Z A;  2AWN A;  2NWG A;  2B2W C;  5FO7 B;  1G8Z D;  2F1M A;  4QCL A;  4A3I B;  4C2M B;  1EY9 A;  4LK1 C;  1MBY A;  4RWS C;  4HR7 B;  1CT1 D;  1LO5 D;  1EIG A;  1LTI D;  1VCI A;  4N9T A;  4DNT B;  2HDL A;  4Z9C B;  2WKC A;  2ZT9 C;  3NXW A;  4FF3 A;  4ID6 A;  3WOE A;  1EWH A;  3VR4 A;  2B63 B;  1SYD A;  2DN8 A;  4BWG B;  1RTO A;  3MZ5 A;  1PTO F;  2KHS A;  1LLR D;  1Q1B A;  3NWS A;  4QUF A;  1RKN A;  5CR3 A;  4HSV A;  5EGT A;  4IFD H;  4ZUI A;  3Q24 A;  3J80 E;  1GJX A;  3E0J A;  1HA5 A;  3OW7 A;  2PCF B;  3R2T A;  4XQN A;  1BCP C;  1D5Z C;  2IX1 A;  2EY6 A;  4TSS A;  1A3T A;  1VDZ A;  1EEF D;  1STY A;  1CQF A;  2K33 A;  5IOD A;  1QIL A;  2K1B A;  3OPO A;  5LL6 X;  2R61 A;  4FP5 D;  3MEH A;  1HCZ A;  4K5X A;  4MHE A;  3PO2 B;  4IUP A;  4RHR A;  3MWY W;  4KD4 A;  3CU7 A;  3I72 A;  4K8J A;  3G7L A;  4L6T B;  3QO2 A;  1WTX A;  2PPB C;  2IJ0 A;  5FLX L;  1XYI A;  2BCO A;  5ISR A;  4N9P A;  5IIF A;  3SK8 A;  1X32 A;  2EY2 A;  2VXW A;  1TS5 A;  4CHT B;  1PYW D;  2EOT A;  2R3Z A;  5DNF A;  3VYT A;  1GUW A;  4X3K A;  2XN9 C;  3KLS A;  2XNA C;  4PV1 C;  1IKL A;  3SE0 A;  1WTQ A;  2F0F A;  5M5Y B;  2MPM A;  5EKI A;  3DUZ A;  2A69 D;  1DD2 A;  2L4N A;  2F0U A;  5TSS A;  3DHQ A;  1AZQ A;  5JEA H;  2K32 A;  1A3U A;  1GUO A;  1Q1E A;  1EU3 A;  4FXK C;  5KIX A;  2A5H A;  1BO0 A;  4KK7 A;  2KJX A;  1D2B A;  2B39 A;  1C8C A;  2B2V C;  1SYE A;  2K7V A;  5EJW A;  1EQV A;  3MXN A;  2RVL A;  1E2W A;  4HCS A;  2KVM A;  3TZD A;  2MP1 A;  1GUT A;  5J1Z A;  2N88 A;  3U9O A;  1JWS D;  4ULL A;  1I4G A;  1PRT B;  3E6Z X;  3MVV A;  4EQN A;  4FF4 A;  4PQX A;  1I4P A;  4K5W A;  4BBS B;  3GTG B;  1QCB D;  3GTP B;  1FYC A;  3SK5 A;  3V2T A;  1FR3 A;  4R9W A;  5F2D A;  1SFO B;  1G2T A;  3J7A F;  4V0B A;  5D65 A;  5FKA C;  4O42 A;  1CTM A;  5CV6 A;  1WTP A;  1TVX A;  2F3V A;  1PTO H;  1Y1V B;  3Q6S A;  2Z4I A;  1U4L A;  2F0G A;  4DN4 M;  4C3J G;  1DJR D;  4FYD A;  1Z47 A;  2XRS D;  2JSO A;  2XVS A;  2JE6 I;  1KAB A;  5C0X I;  4FF2 A;  1STN A;  5KGU A;  1SYB A;  5KYI A;  4ODG A;  1PDQ A;  5JOB A;  4F7X A;  1TY2 A;  3S14 B;  2BA1 A;  1IYU A;  2KOL A;  2EJF C;  1IKM A;  3OIP A;  1CFM A;  3AMU A;  1SBB B;  3MFG A;  1SEB D;  2R6G A;  1PRT F;  4YIJ A;  2X6L A;  3GTL B;  2CW0 C;  2WIN B;  2AQ1 B;  2PO4 A;  2NZ1 D;  2AUJ D;  4C1N K;  1K83 B;  5JVG 3;  3NTK A;  3F2U A;  5JEA G;  3TP6 A;  2A68 C;  3ZYY X;  3ND8 A;  5C4Z A;  2F0I A;  2AUK A;  2J7Z A;  3DM1 A;  1JQY D;  1ET6 A;  1LAB A;  5CBA E;  3BYT B;  4ZYS A;  2LY7 A;  2IX3 A;  1QNU A;  3NK9 A;  4IQZ A;  2QEJ C;  2LS0 1;  3TZU A;  4XIG S;  5E1F A;  3I73 A;  3NPP A;  1KNA A;  1SJH D;  3P20 A;  1ZYR C;  4C56 C;  3T56 B;  4KI0 A;  2Q8I B;  2LKV A;  1ET9 A;  3BVM A;  1EFI D;  2F0V A;  2KCC A;  1LTR D;  2Z4H A;  2AWO A;  1DOM A;  4LMQ D;  5C3W A;  4AYB B;  3GTO B;  4RH6 A;  5C3X A;  5I6W A;  1KLU D;  1DOL A;  2KQ3 A;  3HOX B;  2L12 A;  3R2I A;  1I4R A;  4XQJ A;  2AQ3 B;  1SNP A;  4C3I G;  3L9A X;  1SND A;  4K8I A;  4DXF A;  5EPJ A;  1F9R A;  3TP7 A;  4BY7 B;  5IOC A;  4BY1 B;  1EY8 A;  1S5D D;  2PW7 A;  1EIH A;  1TII D;  1LTT D;  1GXD C;  4RA8 A;  1BBX C;  4G7O C;  1L0X B;  1RDP D;  4QIW B;  1IW7 C;  5A2Q L;  1UNS A;  2OXP A;  4QF4 A;  1RTN A;  1SYF A;  3RMH A;  2B8F A;  1GUS A;  2HCC A;  4ME5 A;  3M4O B;  5ELF A;  3URY A;  2A6E D;  2IT1 A;  4IFD J;  4IUR A;  4H7B A;  1K8O A;  1GHJ A;  3M7N A;  2L11 A;  4B9X A;  3H6M A;  2Z1C A;  2X6G A;  5I2Y A;  2F0E A;  2TMP A;  2F0J A;  2FIN B;  4ZUJ A;  3M4Y A;  2PQE A;  3T51 B;  1I6V C;  1EY7 A;  4RCN A;  1SNQ A;  1PXU A;  2F0T A;  4PMW A;  3A7L A;  2DNC A;  3BDC A;  3H0G B;  1F9S A;  2XIW A;  4G4K A;  1PTO C;  3K59 A;  3MAQ A;  3K0Y A;  1WTW A;  2OEO A;  4V19 0;  5C4J B;  2SOB A;  1CHP D;  5ELC A;  1T5X D;  3W2D A;  3H91 A;  4E6I A;  3C46 A;  4UDU C;  2I07 B;  3SK4 A;  2B2U A;  3HGB A;  3D3R A;  1SNC A;  1HHV A;  2E74 C;  3PV0 A;  3FDT A;  3N6R A;  2OT2 A;  1G91 A;  1X3P A;  1FGB D;  1GUN A;  1TR5 A;  3X3N A;  5C0X H;  1Q3L A;  1D5M C;  1EYC A;  3GTQ B;  3KK7 A;  1C48 A;  3GTK B;  1YNN D;  1B44 D;  2F0H A;  3S2H B;  2NUC A;  1I6H B;  5COR A;  3NP8 A;  3Q22 A;  3FKI B;  3A8J E;  3LWU A;  3BVG A;  2IL8 A;  5CGK A;  1BXT A;  1EL0 A;  1STH A;  1WVL A;  2RKS A;  5IGF A;  1NR2 A;  1Q90 A;  4IUN A;  1HFN A;  3U9S A;  1STA A;  1O7Y A;  1XWE A;  2PZU A;  2JA5 B;  2F0O A;  2CVR A;  4HAE A;  4A93 B;  2GA4 B;  3J81 E;  1A2U A;  4UAI A;  1S5E D;  3VA7 A;  2K01 A;  3M7G A;  1V1O A;  2NVQ B;  3VYR A;  5DEH A;  3J7Y W;  3EQL C;  1PFB A;  1LTB D;  1EZ6 A;  2PMZ B;  3S1Q B;  4KY6 A;  3HG9 A;  4S3S A;  3QOL A;  1A3V A;  4TQU S;  5C44 B;  4DAV A;  5ELB A;  2ID0 A;  1AFP A;  4ZQ3 A;  3LNN A;  3RZO B;  4DU9 A;  3I70 A;  1VMP A;  2BDN A;  2B8G A;  4OO1 I;  2HUG A;  3D6W A;  3VR6 A;  5BN3 A;  3TME A;  1EZ8 A;  5I9P A;  1LTG D;  3O13 A;  3HRZ C;  1AN8 A;  1BCP D;  3C2P A;  2D62 A;  4C3I B;  4X3U A;  1I50 B;  1UEA B;  2F0K A;  4BS9 A;  3BVZ A;  3KBG A;  1ILQ A;  2A6H C;  1STE A;  5CBE E;  2NTT A;  2D2C C;  3R93 A;  3TP5 A;  1F9P A;  1H9J A;  2IX0 A;  2HDM A;  1B1Z A;  3KUP A;  5EKL A;  5FO8 B;  2MJ8 A;  1SNO A;  3NQT A;  2FMM A;  2B2T A;  2JA7 B;  1TWG B;  2XWJ B;  1OXV A;  4B9W A;  5C5M A;  1T5E A;  1ENA A;  1UUP A;  5D3D A;  3OWF A;  1IHZ A;  1HQR D;  3RD4 A;  1JOK A;  4H0L C;  2M9V A;  2IW3 A;  1BR9 A;  1ESR A;  5EBC A;  2SEB D;  1JOO A;  3QWN A;  2M2L A;  1SAP A;  2M00 A;  3WDN A;  1IL8 A;  4KN4 C;  4XYO A;  4PMB A;  2PZW A;  4KD3 A;  5I4D A;  3S17 B;  1TWA B;  4A3E B;  1DON A;  4OO1 H;  3JAM L;  1R9T B;  5EBD A;  1QB5 D;  1BQQ T;  3NSW A;  1SE3 A;  3QJY A;  5C0X J;  4G57 A;  1EY4 A;  4J8Q A;  5DM7 3;  1PZJ D;  1GUG A;  1ROD A;  2K04 A;  1EYD A;  3A56 A;  5KNC A;  3FPU B;  3L3O C;  3GP7 A;  3S1M B;  1M8A A;  2H4O A;  2WB1 B;  3VA5 A;  1K8M A;  4C1N I;  4G7H C;  1BCP F;  3HOZ B;  2F0S A;  5JJZ A;  4PMC A;  2B2Y A;  3K7A B;  5FK9 C;  4HED A;  1LTS D;  4KJO A;  2SDF A;  4IAL A;  1MD2 D;  3GV3 A;  5C4X B;  2HQE A;  1CK1 A;  1Q8I A;  2JYO A;  1EU4 A;  2R7Z B;  2DY7 A;  3NBI A;  3HOU B;  5IGE A;  1SNM A;  3QG1 A;  5JAV A;  3MA2 B;  3MTS A;  4ILW A;  1JWM D;  3NQI A;  1ICW A;  2E2I B;  4A3B B;  3VYS A;  1TS2 A;  3IL8 A;  4XXE A;  4C3H B;  1B53 A;  4K6L A;  3HOW B;  2FFK B;  1PMR A;  1G2S A;  1S5C D;  2JXM B;  3X3M A;  1WTO A;  4CKE A;  4DGZ A;  1V1P A;  4RFB A;  2KUM A;  2WKD A;  3RZD B;  4KN7 C;  4XDX A;  1TWC B;  1S5F D;  2FHT A;  1PLF A;  5LHY 1;  1BOS A;  2NYZ D;  5J39 A;  3BZD B;  3NWT A;  1STG A;  1LT3 D;  3R3O A;  3PMF A;  4RCO A;  4EGV A;  3NE5 B;  4C3J B;  5IGG A;  4O1N A;  1H9S A;  1WTR A;  4HCE A;  3RUZ A;  3S1R B;  5JPM C;  4OL7 A;  2A69 C;  2EPB A;  4ZKC B;  1MI2 A;  1RJT A;  4HSP A;  3LWE A;  1B9N A;  5CV4 A;  1HUN A;  5D3I B;  2A6H D;  2G9D A;  1F2Y A;  4IFD G;  1JWU D;  1SYC A;  3PUW A;  4J1M A;  2A73 B;  1I4H A;  4K14 A;  4OIK A;  5M3M B;  4DK0 A;  3J7A V;  5CV8 A;  1ZKO A;  1R4Q B;  4I65 A;  3V96 A;  2JEA I;  1BNZ A;  3P7J A;  1OXT A;  1PRT C;  4DAY A;  3OIQ A;  5E4W C;  2B2V A;  3GD7 A;  4NMZ A;  2MUY A;  2F0L A;  3J80 L;  1JIC A;  2CHB D;  1PFN A;  3MXG A;  1TS3 A;  1KDB A;  1OXS C;  4K6D A;  4KTA A;  3BYY B;  5JEA J;  3Q0A A;  3HOV B;  4DF7 A;  4KY5 A;  4RGN A;  4GZY C;  1TT2 A;  4BA2 I;  1Y8N B;  2RDF A;  3N52 A;  2RSO A;  2TSS A;  3ND9 A;  4JK1 C;  1HRJ A;  1DZ1 A;  3HOY B;  3T4A C;  1CZW A;  1KLG D;  3OHX C;  2EYJ A;  4A3M B;  1VMC A;  3SEB A;  4ZKB B;  4FO2 A;  3HKZ B;  2IWH A;  3I3C A;  3VYU A;  3PIO 3;  1ZXT A;  2MHV A;  2F4I A;  1X3Q A;  1G6Z A;  2V4D A;  3NUC A;  2Z8L A;  2F0N A;  3TN2 A;  1ML0 D;  5BN4 A;  5DM6 3;  2Q8T A;  4HMI A;  5C6A A;  3D6C A;  4FNF A;  2K5D A;  1QNK A;  3MHB A;  3AB9 A;  3ERO A;  3S9W A;  1DOK A;  2KED A;  3BS1 A;  1HA6 A;  4RKB A;  3CHB D;  4DK1 A;  1OXX K;  2EJM A;  2WAC A;  3K6O A;  1KDA A;  1W6J A;  3FEW X;  3EFX D;  1SJE D;  1F2M A;  1QJO A;  4TKO B;  1M4V A;  2IPK D;  4EQP A;  3Q23 A;  4Q5V A;  5LL6 S;  1ILP A;  1BDO A;  2ZXR A;  3IKJ A;  1CA5 A;  2PYK A;  3NTH A;  2EYH A;  1WCM B;  3T53 B;  1B2T A;  4X3T A;  2EYP A;  2EVB A;  4KMU C;  4ZAI A;  4IUQ A;  1SE4 A;  4HN7 A;  2EZV A;  2LFN A;  4MN3 A;  3VR3 A;  1TWF B;  1WD0 A;  4IFD I;  3A54 A;  1S5B D;  1QE6 A;  1FNW A;  1O7L A;  2BE5 D;  4NDX A;  2PNR C;  2XWB B;  1A15 A;  3A8I E;  1GOZ A;  2RDH A;  1Z6H A;  4FVM A;  3KF8 A;  5ELD A;  1H9M A;  1SYG A;  2PZT A;  3LX0 A;  3S16 B;  5CV7 A;  3CKI B;  2OF1 A;  1TS4 A;  2BOS A;  2QF7 A;  1HXY D;  3T13 A;  1NCV A;  5I9O A;  4J6H A;  1KDC A;  1C4Q A;  4JBW A;  1BUV T;  4NP5 A;  3K57 A;  3DEO A;  5I2X A;  3MXP A;  2B2W A;  3GO5 A;  2F3W A;  4KKT A;  4A3F B;  2B2U C;  3EA6 A;  3NHH A;  1I4Q A;  2SNM A;  2O5J C;  5CV5 A;  1MSG A;  2SNS A;  1AP0 A;  1XTC D;  1BCP B;  1J8I A;  3W3A A;  1QOH A;  3CQZ B;  2XSC A;  3D8G A;  3JAM E;  3DXJ C;  3P1H A;  5C5L A;  2K5Q A;  5KEE A;  1V8Q A;  4K2L A;  3H09 A;  1Z7T A;  1RD9 D;  3GTJ B;  2QKI C;  1EOT A;  4EQO A;  5IGB A;  4RKL A;  3HS0 C;  5FOB B;  4CJ1 B;  4CKC A;  1NAP A;  5D14 A;  3OWE B;  2EJG C;  4CJ0 B;  4KHV A;  2EXZ A;  1SSO A;  2K5W A;  1AEX A;  1EYA A;  3E5S A;  1LAC A;  1EEI D;  1HFG A;  1PTO B;  3K5M A;  5IGD A;  4IN3 A;  4KY7 A;  5E4X A;  5EPL A;  1SDF A;  5K5P A;  1U9R A;  3BDO A;  1EY0 A;  1BF4 A;  1L0Y B;  1ESF A;  4NKL A;  3MC0 B;  3SK6 A;  1XXG A;  2L9H A;  3H3V C;  4QB4 A;  3PIP 3;  2A6E C;  3R8B A;  2ENB A;  3PUZ A;  4I7Z C;  3K5O A;  1O7Z A;  3G6J B;  3I8Z A;  3L7Z C;  5C4H A;  4G7Z C;  3QOJ A;  4A3J B;  4K5V A;  2VNU D;  2PW5 A;  3UI2 A;  2AQ2 B;  2CQA A;  2MGS A;  2NN6 I;  3TSS A;  3DWQ A;  2B2Y C;  4WOR A;  4OO1 G;  2G9H D;  1E0B A;  3OOC A;  4KJN A;  2EE1 A;  1VF7 A;  3TBI B;  1UAP A;  3M85 A;  1GHK A;  1TY0 A;  4F87 A;  2WAQ B;  5NUC A;  2JEB I;  3C1E A;  4LJZ C;  3GTM B;  2XRQ D;  3OMG A;  2H1E A;  3C1F A;  2F0D A;  3IAY A;  1JC7 A;  4DA2 A;  3TDQ A;  1JR0 D;  3SHL A;  4CBV A;  2D5D A;  2F03 A;  1RCV D;  2DNE A;  5K36 H;  2NVY B;  1O78 A;  1ONL A;  4KKS A;  5CMD A;  1TU2 B;  3S15 B;  5COY A;  1II3 A;  3WOF A;  3K5N A;  3DWA A;  5JVH 3;  1JOR A;  5J22 A;  2BE5 C;  1CM9 A;  4KKU A;  1PZK D;  5EKK A;  4M8A A;  3FVQ A;  1KAA A;  1DM0 B;  4ZK9 B;  3DWP A;  5G3L F;  1Y8P B;  1F9Q A;  5M9O A;  1TWH B;  1JB3 A;  1IW7 D;  1SE2 A;  2BDO A;  3OMC A;  4NW2 A;  5T1G A;  1ENC A;  3ERQ A;  2DY8 A;  2I46 A;  5KNB A;  1AZP A;  3IFT A;  4H13 C;  4XTC S;  4P2C B;  1WD1 A;  2ICI A;  2F0W A;  4A3D B;  1PZI D;  2FMC A;  4CKB A;  4HMJ A;  2B2T C;  4WRD A;  3S1N B;  3P75 A;  2D9U A;  3I4M B;  1I4X A;  2EYF A;  4ZLT F;  4OHJ A;  3BDL A;  4XQQ A;  2K28 A;  1SMY C;  5DAU A;  2K05 A;  3CRL C;  4F88 A;  2BA0 A;  3HEJ A;  2JP1 A;  4CGY B;  2EY1 A;  2L5T A;  2L1B A;  3A7A B;  4RGO S;  5EPK A;  3PO3 B;  2F0P A;  4XT3 B;  3H94 A;  2L55 A;  2RDG A;  1XX8 A;  5KRU A;  2E76 C;  3AU7 A;  4L8J A;  4A3K B;  2EYO A;  3D4W A;  1RF2 D;  2E75 C;  2F0Q A;  4MIU A;  3C3L A;  2QDB A;  2O2L D;  4HTH A;  1LV9 A;  4K2K A;  3DEP A;  3SXH A;  1V43 A;  4DNR B;  2NTS A;  5K36 G;  4H44 C;  3BG3 A;  5JPN C;  3GQB A;  1LT5 D;  3VR5 A;  1HTL D;  4C3H G;  2EYM A;  1Y8O B;  2F0M A;  3GV6 A;  5E3F A;  5FO9 B;  5M5W B;  1KNE A;  2QCP X;  2N55 A;  1QWY A;  2WII B;  3EVQ A;  4FXD A;  2Y0S B;  4IZ8 A;  1ENF A;  2K03 A;  5IT9 L;  4OGQ C;  3TP8 A;  3RLF A;  1B9M A;  4F8M A;  2Q8R E;  1B3A A;  1JE4 A;  5HUR A;  4L63 B;  3ITP A;  1ZEQ X;  5IGC A;  4LAA A;  1I3Q B;  5KYL A;  1CQV A;  2RA4 A;  1JCK B;  1OXU A;  3ONA B;  1QG7 A;  1FD7 D;  4DFA A;  5A2Q E;  2KCN A;  5G3L D;  2J0T D;  3KBX A;  2YU9 B;  4QMG A;  1VF5 C;  2ZXP A;  2VB2 X;  1HUM A;  2WV6 D;  1MSH A;  2NVT B;  1IYV A;  2RBM A;  5I6Y A;  1F77 A;  1LT6 D;  5FLX E;  1W6K A;  4A3G B;  1CZG A;  1U4P A;  1R4P B;  4CJ2 C;  5A35 A;  1PFM A;  3MXU A;  5KND A;  1Y1W B;  4PNY A;  1E2Z A;  1DCZ A;  1E2V A;  2E2J B;  1LT4 D;  5IT9 E;  2O5I C;  5T1I A;  1U4R A;  3DMU A;  4WFN 3;  3A8K E;  3OSO A;  1B4O A;  1EY5 A;  1HQM C;  3NBH A;  3KLS X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...