3BDCA

Crystal structure of staphylococcal nuclease variant delta+phs at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Molecular determinants of the pK(a) values of Asp and Glu residues in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bdcA00
2F0DA 1EY5A 3ERQA 4DF7A 4LAAA 5C4ZA 1SNQA 1EYAA 4KY6A 2F0NA 4ZUIA 5KYLA 3SK6A 1KABA 4KJNA 5IGFA 4KJOA 2QDBA 1JOKA 5J39A 3OMGA 3SHLA 3P75A 1STBA 1NUCA 5C3WA 1SNCA 4K5VA 1EY6A 2F0GA 5JOBA 4PMBA 3V2TA 4PMCA 5F2DA 1KAAA 3C1FA 3QOJA 4R8NA 1ENCA 3HEJA 5JAVA 2WACA 3TP8A 5KEEA 5I9PA 3BDCA 3SK5A 5CGKA 1RKNA 2PQEA 4F7XA 1A3TA 4ME5A 5IIFA 3MZ5A 2EYHA 4F8MA 4IZ8A 5CV9A 1SNDA 2EYFA 1STHA 3NQTA 2F0TA 5CV4A 2PW5A 4K2KA 4KY7A 3D4WA 2HQEA 4KY5A 3TP5A 5C3XA 4RKBA 4B9XA 3D8GA 3S9WA 1A2TA 3NXWA 2OEOA 1SYGA 2F0HA 1F2YA 2EY5A 5IGDA 2F0JA 3QB3A 2OF1A 4ZQ3A 4WORA 5KYIA 2PZWA 2RKSA 3C1EA 3E5SA 3MXPA 1JORA 5J22A 1A3UA 2EY6A 2OXPA 5CV6A 5E3FA 5M9OA 1KDCA 1EZ6A 1EY4A 2SNSA 4DU9A 2F0UA 2KHSA 1SNOA 3MVVA 2NUCA 4K8IA 5I6YA 2F0QA 5IGEA 3VA5A 4I65A 3TP7A 2F0LA 2F0WA 4DFAA 5CV5A 1TR5A 3BDLA 4HTHA 5IOCA 4B9WA 1F2MA 1TT2A 2EYJA 3P1HA 1SNMA 1II3A 3NK9A 4K6DA 2SNMA 2PZUA 5C5LA 2F0EA 3H6MA 4KD3A 5CC4A 3U9OA 4NKLA 1SYDA 4NP5A 2ENBA 3OWFA 1EYDA 1AEXA 1KDAA 1EY7A 2EY2A 3ITPA 3MEHA 4ODGA 5DAUA 5C5MA 5C6AA 2EYPA 1KDBA 1SYBA 1STAA 2PZTA 4G57A 1STYA 4ID6A 2EYOA 4K8JA 4QF4A 1IHZA 5CV7A 3EROA 2SOBA 2F3WA 3RUZA 1F2ZA 4KTAA 4DGZA 1JOQA 4ZUJA 3EJIA 4J1MA 2F0FA 2PW7A 4HMJA 4NDXA 3D6CA 1EY0A 4EQOA 3DMUA 5IGBA 4K14A 5IODA 4IUNA 4QMGA 5ISRA 2F0OA 5CR3A 5KRUA 3HZXA 4RKLA 3SR1A 2F0VA 2F0IA 5EGTA 3SXHA 5IGCA 1NSNS 5K5PA 2F0SA 5HGTA 4K5WA 5I6WA 1A3VA 1STNA 3NUCA 5EKLA 3SK8A 4H7BA 1ENAA 3EVQA 2F0MA 2EYLA 1SYCA 4K2LA 4S3SA 4NMZA 3QOLA 5I9OA 2M00A 2RDFA 4OL7A 2EYMA 2O4XA 3LX0A 4YIJA 5E1FA 2LKVA 1STGA 5HURA 4EQNA 3OSOA 4N9TA 1U9RA 3T13A 3T16A 1EYCA 3D4DA 3MHBA 4EVOA 1JOOA 5DEHA 5IGGA 2F0KA 2F0PA 4MIUA 3DHQA 4KD4A 1SYEA 4N9PA 4QB4A 4PNYA 2RBMA 2KQ3A 2EY1A 4TRDA 2F3VA 4WRDA 3SK4A 1EQVA 5NUCA 1EZ8A 1TQOA 4HMIA 4KV6A 3PMFA 4IALA 3TMEA 4E6IA 5J1ZA 4K5XA 4KHVA 5KGUA 1SNPA 3NP8A 4EQPA 5C4HA 1A2UA 4J6HA 1SYFA 5KIXA 5EKKA 3R3OA 3TP6A 1EY9A 5CV8A 1EY8A 3OMCA 2EXZA 3NHHA 2PYKA
chains in the Genus database with same CATH superfamily
2KA7A 3HRZC 4LAAA 5JEAJ 3Q22A 1NR2A 4KKSA 1HA6A 2RHSB 1X54A 4JI6L 4J8QA 4Y52H 2UXDL 2PI2A 5ELOA 3K80C 4A3EH 4DXFA 4A3IH 1VMPA 5FO8B 3ICEA 1Z7TA 1VQBA 2B8FA 2PQEA 4LFBQ 1FYCA 4A3JH 4UDUC 3PCOB 2AMCB 4LF6Q 3K5NA 2E2HB 2HQEA 2TSSA 4B9XA 4C3IB 1IYUA 4NXNL 3U9SA 2KENA 4H13C 5I4DA 5C44G 4R4TA 4QIWB 3VYTA 4CDDC 3S2HB 3H3VH 4DV7Q 3PO3H 4K8IA 3CQZH 5D14A 1VF5C 1NR4A 4OO1G 1B8AA 2SNMA 2PZUA 2B8GA 1DONA 2Z6KA 2VL6A 1TS4A 4R9WA 1HNXQ 3ITPA 1D7QA 1NBWA 4C3JH 1SYBA 2B2TA 4G7HC 1TWGH 5GAGC 4ZUJA 2I5MX 3HOUB 1M4VA 2F0FA 2DNEA 4HMJA 2F4IA 4LF8Q 4QMGA 4OELB 1U0LA 1Q3LA 1V9PA 3HZXA 3M3YB 2GN5A 4YHHQ 1VQOA 2F0MA 2JA6B 4H44C 4IPHA 1EQQA 1JJGA 2EYMA 1KLUD 2RVLA 2BA0A 4HSPA 1CQVA 5DEHA 1T5XD 3DHQA 5CV4A 4FF1A 2E74C 1PZJD 3JAMc 2MHVA 3PMFA 3CC2A 2K5NA 5COYA 4C3IG 1HZBA 1TWAH 1EY9A 2F4VQ 4J6HA 4IPGA 2B29A 1HNZL 3S17B 2R92G 2Q8TA 2F0DA 5C3EH 1RF2D 3LWUA 5M5XB 4POFA 3KYHC 4I7AA 2BDNA 3CKIB 2KEEA 2ES2A 5BR8L 3TS0A 3H3VC 1CI3M 2BDOA 4K5VA 1NMGA 3J80c 1FL0A 4ZYSA 4PMCA 5F2DA 2E2IH 3C1FA 3QOJA 5JAVA 2PNHA 4M8AA 4MZ9A 4LF4L 4LNQA 3JAME 5CBEE 4F8MA 3JAML 4IQZA 3HOUG 2K05A 3TSSA 1LV9A 1O7ZA 4TKOB 4A3MB 2JA5G 1IZ6A 1AZQA 3PF5A 2EQSA 2GVBA 1W6KA 4JI5L 3BDOA 2RA4A 1QILA 3QB3A 1UE5A 1JWUD 4WORA 2JA6G 2HCCA 2QA4A 1UEAB 2CH4A 1PMRA 3HKSA 2OXPA 4R1JA 2SNSA 1CKOA 3TRZA 3TDQA 3UDFA 1SNOA 1EYGA 5I6YA 3J80E 1TXYA 4FF2A 1I4GA 1BCPC 1GUSA 4JC0A 3J80L 1W3SA 1YEZA 5IE8A 1QUQA 1S72A 3I4NH 3BDLA 5LMNW 4IUUA 2VUMB 3SVMA 2NN6H 3FVQA 3VR2A 4GOPB 1RD9D 3NSWA 2N55A 2AWOA 2EY2A 2PCFB 4BA2I 1KDBA 4PQXA 5C4HA 4JI0Q 1VS0A 4IURA 1AFPA 1R9TH 2CW0D 2HHHL 4B3RL 1O7IA 2I5LX 1B4OA 1Y1VH 1IL8A 2AUKA 1L0WA 4DA2A 2B2YA 4H02A 1IW7C 1P16A 3GTPH 5E1FA 2HIXA 3SEBA 4EQNA 1QNUA 1U9RA 4L6TB 3MHBA 2NVTH 1TY2A 5IGGA 4A3DH 1EEFD 3KOJA 1HHVA 1RIPA 3PUWA 2D5DA 3K59A 5NUCA 1I6VC 1VQIA 1BOSA 4DAPA 4HMIA 4A3MG 1JE4A 1K83H 4ALPA 4JI7Q 1UE1A 1J6QA 4X65Q 4DR3L 4L63B 1F9PA 1MKHA 1AE3A 1I50H 2NVXB 1EYAA 1I4RA 3FKIB 4FXGC 3SK6A 3HOYB 3V96A 2QDBA 1JCKB 4KHPQ 1Q46A 5C0XJ 5C3WA 2JYOA 1H9SB 1EWCA 4R8NA 3CC4A 3EN2A 1B2TA 1NAPA 5JJKA 1EWHA 3T1HQ 1I4HA 4ME5A 5IYCG 1ZXTA 2WB1E 3TQYA 1A6XA 1SSOA 2EYHA 1YNJC 1F2LA 1QVGA 4RA8A 2EYFA 4DAMA 3M4OH 2ZTEA 4DUZQ 4JBJA 1VQ5A 2I46A 3OW2A 2KCTA 4QGUA 1J5EL 1V8QA 5J22A 4AH6A 3CPWA 3X3MA 3PUYA 3MVVA 2A6HD 2NBFA 2F0LA 1ASZA 3WOEA 1T9HA 4OO1H 3KUPA 2L9HA 1PYBA 1UNSA 4DV6L 3M7GA 2SDFA 3G6EA 4NKLA 5KNBA 2UUAL 1RTOA 4LF9L 5BN4A 3GDEA 1IYVA 3BZCA 3N6RA 4X3SA 5D3IB 2EYPA 1SJHD 5EPKA 2EYOA 3L0OA 2SOBA 5M5YH 1MGSA 1CA5A 4J1MA 3FKIG 3JAMi 4BA1I 3HOYG 2F0OA 2HIVA 1DM0B 1L0XB 1PZID 4ZLTF 1NSNS 5HGTA 5I6WA 1STNA 2VQEL 4APVA 3D31A 3MXGA 3Q23A 2NVQB 4A3IB 1DOKA 1IKLA 2RF4A 2M00A 2RDFA 2CQAA 3A55A 4IO9A 3UDGA 4L5QA 5AFWA 5I2XA 4HSVA 2D2CC 1YHBA 5ELBA 1JOOA 5FOBB 1PRTD 1OXUA 3J80i 1PTOD 3D3RA 3IRBA 2E2HH 1KXLA 4JI2L 1BQQT 4C3IH 3ULJA 1SNPA 1F9QA 4HN7A 4EQPA 2V1CC 4DPGA 1XNQL 3R3OA 1WVLA 4C3HH 3EBEA 1KLGD 5JVH3 3E0JA 1KD1C 1X55A 2DY8A 1IBKL 2R92H 3S2HH 4FDBA 1GXDC 2F0NA 1N8RC 4HJ5A 1KABA 4LFAL 4RGOS 3S14H 5EPLA 1L1OC 3CU7A 4HIOA 4FO2A 1EY6A 2VS1A 4LW1A 5CBAE 1KAAA 2ZXOA 2Z1CA 3MXUA 4YWLA 1BNZA 1PV4A 1SE3A 2N88A 2K4KA 3PIO3 1JJCB 4C3JB 2ZJQA 1B3AA 3URYA 4JI4Q 3EIVA 3HOUH 3WWVA 4ZRZA 4HJ7A 1GHKA 3GTKH 1TWGB 4GNXC 3D4WA 3TP5A 1W6JA 4RKBA 2JA5H 3M3YH 4OWXB 3HG9A 1A2TA 1EWIA 3HP3A 1XMOQ 2DJGC 1K9MC 4V190 2Z4IA 3RR5A 2VQFQ 4A3IG 2EY6A 1B50A 1CKNA 1K0RA 5ELNA 3S1RH 1BCPB 1G8ZD 1YVCA 2UU9L 5AJ3L 2B39A 1C9OA 2K6AA 2N8NA 1E1OA 4JI3Q 4A3BB 1D8LA 1Z9FA 4B9WA 1F2MA 3K58A 5LMUL 1TY0A 3P1HA 4X6AH 1II3A 1I5FA 1S5CD 2QILA 4NP5A 4CGYB 1VQ8A 4JI8Q 4JG2A 1KDAA 4CJ2C 1N36L 4XT1B 3NBHB 3EROA 3RLNA 3I4OA 5M5XH 3K8AA 2JP1A 4DR1L 2MO1A 3G4SA 4DAVA 1U4LA 3NUCA 3CMAA 1SR3A 1JB7A 5IWAQ 3N52A 3ER0A 4NMZA 2WKCA 4OL7A 3LX0A 1D6EC 4YIJA 4DXGA 1HNWL 3OSOA 4X66Q 2JA8B 4LF9Q 4C3JG 2F0KA 4MIUA 1SYEA 2ZXRA 2NZOA 1LTRD 1G291 1HR0L 4A3MH 1EOTA 1CZWA 2JE6I 4CDCC 5IY0A 3M7NA 3M85A 1Z47A 1KNAA 4A4IA 1A2UA 2AQ1B 1OTCA 2MNAA 3AEVA 3DLLA 1N34Q 1CK1A 1H9JA 1S3OA 4HIMA 4ZKBB 1LTTD 1HPCA 5CORA 4A3BG 4IFDJ 2EJGC 1HA5A 3BVMA 4R4OA 3ULPA 2F0GA 3V2TA 3DXJC 1K0SA 3HOVG 2NZHA 1ASYA 1E24A 3SK5A 4LFBL 5C0XI 5IYCH 4JI2Q 1VQGA 4RGMA 1QVFA 3MZ5A 1SFOB 1VQLA 1WYDA 4IPDA 1SNDA 3H0GB 2A6ED 1KHIA 4LF6L 1EUJA 1D5MC 2ALYB 1Q12A 1R9TB 1EOVA 1C7YA 1U4RA 1WJJA 3S9WA 1ILPA 3OIQA 3MEFA 1XJVA 2OF1A 1LT3D 1UEBA 4JYAL 4A93G 2RKSA 2A68C 3BYTB 3BZDB 1A3UA 4DV7L 2VB2X 1EY4A 1PFBA 2F0UA 2JA8G 3K7AB 3CCQA 1SROA 3EA6A 1J8IA 1PFSA 3HS0C 2PI2E 2QF7A 4QUCA 2Q2TA 2B2UC 4A3DB 1EIGA 1JMCA 4LF5Q 3U9OA 1HNXL 1XMQQ 2A69D 1AEXA 3FDTA 4ODGA 3KFUA 5DAUA 3NWTA 3A7LA 1NE3A 3GV3A 5HGQA 3G6JB 1FVIA 2CWPA 3RUZA 2B63B 4HCSA 4KTAA 4X3TA 1D1KA 3S1MB 3DUZA 3BYYB 2Q8RE 4LF8L 1EY0A 3E0EA 3FKIH 3HOYH 4B3TQ 1U4PA 3NQIA 5T1GA 2KCMA 2JXMB 4YHHL 3CC7A 2A19A 4O1NA 2EZVA 5M5WB 2BH2A 1XWEA 2Q2UA 1UUPA 1QJOA 3U50C 4R4CA 2ZM6Q 3E9IA 2X69A 2VZAA 1FD7D 3H3VI 1QZGA 3H0GG 3SK4A 1PH8A 2CWAA 3ZJYC 1DXMA 3M4OB 2WAQE 3K5LA 1VQCA 2IX1A 1HCZA 2AKWB 4HIDA 1TWCH 2O5IC 1CKMA 1RDPD 4LUZA 2F4VL 3TP6A 1WFQA 2L55A 3CCVA 1X6OA 3W3AA 2OTJA 2R7DA 3S15H 2R93B 1N9WA 5C4ZA 4KY6A 1RL2A 2Z9HA 1QB5D 3I72A 3L3OC 1L1OB 2H1EA 3TEHB 4RGTA 1SJED 3T1YQ 1IBMQ 5FLMG 3AQQA 5KEEA 1VQHA 2WB1G 3KK7A 2RDHA 4OX9Q 4IPCA 2B2UA 4O2DA 2B63G 1A63A 1XXGA 3VR3A 5LMNQ 1EIYB 2QW7A 2DUDA 1YJWA 1DOLA 1WTRA 1O78A 2Q8IB 4F87A 1M90C 4ZCKA 2NVQH 1JORA 2HDMA 3S2DH 1UE6A 5EBDA 5FO9B 3VA5A 5E7NA 3BU2A 1LTID 4RHRA 2B2VA 4B3MQ 3C3LA 4GOPA 1XYIA 3ZYYX 5DM63 1XPRA 2RDGA 1LTGD 4JI0L 1PFMA 2J4XA 4JI1Q 1OXVA 4AYBG 3A5ZB 2DN8A 1DJRD 1MI2A 2R93G 4C3HB 3EJIA 1EFWA 3J7A5 4QUFA 5H1SE 5JPNC 2EOTA 5IP7G 4JYAQ 4P2CB 2R92B 2ZXPA 4JPBW 1G51A 4V0BA 5K5PA 4BBRB 3Q0AA 3S14B 4POGA 3R8BA 3W2DA 4EQ5A 4K2LA 2OT2A 2B2WC 2PMZE 5C4XB 3I4LA 1STGA 3HKZE 4GKJQ 3U4VA 4A3GG 4EVOA 3F2CA 3HOWB 3WOFA 4TQUS 4PNYA 2UXBQ 4WRDA 5HY6A 2QEXA 2L1BA 4Q5VA 2IX0A 1LTAD 4IALA 1WD1A 1KRTA 3LGJA 3GTKB 2BE5C 4JI7L 1LLRD 3A0JA 2NN6I 4X65L 2JA5B 1U4MA 1SYFA 1PH1A 3H09A 5CV8A 3ONAB 1VQ4A 1B9NA 3GO5A 3ERQA 3KLRA 2XTIA 2FHTA 1VQDA 5IGFA 3S1RB 4A3BH 4KHPL 1NY4A 1E22A 1YITA 3RLOA 1YHAA 2K5DA 1H9SA 4YWMA 3T53B 1E0BA 1EU3A 3HOVH 2RSOA 3HEJA 2WACA 5GROA 4IFDI 3T1HL 3NPPA 5ELCA 2K03A 1B53A 1HQMC 2QDLA 1SXTA 1KIXA 2N78A 3GTOB 1X9NA 1VQNA 4OONA 4C3HG 4DUZL 1B7YB 1G6ZA 1SMYC 2IL8A 4CJ1B 4HJ9A 4BBRG 1C48A 4DK3C 2EY5A 3PIPA 4L5RC 4MTKA 3K0XA 3HOZH 1VDZA 1C4QA 4HAEA 4A93H 2PZWA 3VYUA 4NXMQ 3S16H 2YTVA 1V1OA 2XGTA 3KF6A 4YCWA 5C4XG 4DU9A 2KHSA 2JA8H 3HOWG 4WJ4A 1PH7A 1UWVA 5CV5A 2K28A 4RG1A 4HTHA 4UPAA 3NK9A 4RMFA 3SGIA 5JPMC 4XQQA 4BS9A 4L5SA 1STAA 1STYA 1VMCA 4R8IA 4IJLA 1JOQA 1HTLD 2JJQA 4FP5D 1K73C 5ISRA 1KL9A 1JWSD 4KKUA 4KK7A 1BBXC 1HUNA 1PH4A 3SR1A 1R4QB 2EXDA 1OXXK 3K57A 2CVRA 2YV5A 2NWGA 4A75A 4RHSA 3T16A 1B1ZA 4JBMA 3J7YW 1K8AC 1SFOH 2BCOA 3H0GH 2RBMA 2KQ3A 2NB0A 1GJXA 1CZGA 5KNCA 2KCNA 2K14A 3STBD 1X3FA 1ZYRD 3H91A 3QG1A 4OO1I 5E4WC 4RGNA 4YCUA 1E7ZA 4DNIA 5KGUA 2ICEC 3OMCA 4A76A 2PYKA 1FR3A 1LM0A 5EQ0A 1EY5A 1ONLA 4PV1C 1G2TA 5E4XA 3K7UC 3K7AH 1YZ6A 4KJNA 4XYOA 4P72A 4RCOA 4Y7NB 3SHLA 3NENA 2B3GA 1SNCA 1D1IA 1IXRA 4ME3A 3UE1A 4G7ZC 5FLMH 2JN4A 4O0AA 2K33A 1JWMD 4X3KA 5I2YA 2NTTA 3CRKC 2QKIC 2R6GA 2B63H 4JI4L 3S1MH 3AFPA 5CV9A 1RJTA 2PW5A 1VQEA 5D3DA 4X3UA 4G7OC 1XMOL 3D8GA 3K6OA 4RH6A 1C8CA 2XRSD 4I7ZC 4HJAA 2RCFA 1YI2A 5M5WH 2VQFL 1WCMH 4ULLA 1E2WA 2EJFC 5EAYA 2MQHA 1TIID 4YY3Q 1A15A 3J81c 2VNUD 1TS2A 3UDIA 1KDCA 5ELDA 4JI3L 1PHJA 4AQYL 2K7VA 4DV5Q 4DFAA 1ESFA 1HZ9A 1BUVT 3PUZA 4C2MH 4DAYB 5CC4A 3SE0A 4JI8L 5CMDA 2Y0SE 1OO9B 2PZTA 1A8VA 3NBHA 1YHQA 1TWCB 1B9MA 4WJWA 3J81j 1GUOA 2R93H 3FPUB 5IP7H 2PNRC 4OXPA 2EIFA 3S15B 4OHJA 2QCPX 3I7FA 1Q1EA 4K0KQ 5JVG3 2LMCB 3J81E 1S40A 3RLFA 3J81L 1I6HH 5IWAL 4R4QA 4A3FB 2M2LA 2R7ZH 2WKDA 3D0FA 3FPPA 1B3QA 1HRJA 1F9RA 4X66L 5HURA 1CM9A 4IN3A 4A3GH 1P8LA 3S24A 4GLAC 4N9PA 1MBYA 3RNUA 2F3VA 2WINB 5G3LF 2E2JB 1OXTA 2EVBA 2MO0A 1IBLQ 3ERSX 4F88A 1K8MA 3ULLA 1JICA 1MJEA 1N34L 3QJYA 4FNFA 1H9RA 3S2DB 1LTSD 2KOLA 4DR7Q 2KECA 1O7LA 3P75A 2BA1A 3W5OA 1NUCA 3QIAA 4DV2Q 4RAUC 1PZKD 3ND9A 4IOCA 1SE4A 5C4JB 1A3TA 2FFKB 2MJ8A 2E8GA 1STHA 2QGQA 1DCZA 5IYDG 4LMQD 3VR4A 4DR4Q 3CD6A 2ZJRA 3MWYW 4BY7H 2F03A 3KBGA 1ICWA 2OEOA 4BBRH 4GN3B 4A3FG 1WTHA 3RN2A 4ZQ3A 1BKBA 1RHPA 5KYIA 3VA7A 1HXYD 1KC8C 1N33Q 5C4XH 2CW0C 3CCRA 2UUCQ 4BWGB 1Y8PB 4JOIC 3HOWH 1CQFA 4GLVB 4P71A 3NELA 3F2DA 4DV1L 1SAPA 1SNMA 4LF5L 1VQFA 4MN3A 3CW2C 1XMQL 4CJ0B 2LFNA 4GS3A 1TS3A 1EYDA 3I90A 1I3QH 1KRSA 2K32A 3PV0A 4G57A 1IHZA 3CCMA 2F3WA 2L15A 1XX8A 3GV6A 2A74C 5M3MH 5EKIA 1G6PA 4DNTB 3I91A 4B3TL 1Y69U 1S5FD 4IUQA 1Q8IA 1YNND 3R93A 1H9MA 3PUXA 1EEID 4LJZC 1QWYA 1V1PB 4K5WA 1QCBD 1DZ1A 3SK8A 4H7BA 1Y14B 2L12A 1I4QA 4AQYQ 5K36G 1SYCA 4DR5Q 4DK0A 2ZM6L 3O13A 4QIWE 1AZPA 4B3SQ 3HOVB 4OWTB 3NTHA 3NBIA 3GTOH 2KHIA 4DR6Q 1E1TA 4GKKQ 1AP0A 2NYZD 4OWWB 1HZCA 1PTOH 3S1QB 1I94Q 2UXCQ 2JEBI 2JQOA 4DV4Q 3NHHA 3HOZB 1D2BA 4A93B 4JVZA 3S16B 1GHJA 1SNQA 4XIGS 4ZUIA 1DYQA 1L1OA 1S5BD 3G71A 1UE7A 4G4KA 5DM73 2UUBL 3OMGA 1EIHA 2FMCA 3T1YL 2JA7B 1HUMA 1LTLA 3KBXA 1IBML 2YU9H 1FNWA 1IKMA 1HJPA 3J81i 3A7AB 1F9SA 4OX9L 1PA6A 4HJ8A 2ID0A 2A6HC 3DM3A 4KKTA 4QCLA 2XSCA 4Q0FA 2IT1A 3IFDA 5LMNL 2E2DC 3QWNA 1VQKA 3CP0A 2RQXA 4O42A 4GNXA 2VXWA 3NQTA 4A3KG 1CFMA 4HCEA 3GTMB 5C3XA 4J15A 3NXWA 2F0HA 1LO5D 5IGDA 2ZTDA 1CSPA 4FXDA 1TWHB 2O2LD 5FK9C 3L2PA 1HFGA 1XNRQ 5IGEA 1I4PA 2VB3X 1D5ZC 2F0WA 3D4RA 4B3ML 1KQSA 1TT2A 4N8FA 3F2BA 3E3XA 2CFMA 1TWFH 2TMPA 2CQOA 3KLSX 4JI1L 4PZ7A 2G9HD 1I4XA 1PH9A 4JBKA 2R7FA 3HOZG 1PRTC 1PTOC 4XTCS 5IODA 2K5HA 3L7ZC 2AQ3B 5DNFA 4JW0A 4QL5A 3MAQA 2R61A 4L5TA 1PH6A 3X3NA 4Y7NH 4LFCQ 3KLSA 2IX3A 2DJFC 3SXHA 5FJ8G 2JA7G 2J0TD 2OWOA 3EVQA 3GTQH 2ASBA 1X3PA 3QOLA 4DV1Q 1O7YA 1ILQA 2N3SA 1GKHA 4GKJL 2WB1B 3MFGA 4OGQC 3D4DA 4X64Q 1Q82C 2WV6D 2AUJD 2SEBD 3OTOQ 2UXBL 3CXCA 3PIP3 2I0QA 3FEWX 4ZAIA 5JJIA 4CKEA 3K0YA 3H15A 1LUZA 3NP8A 1GO3E 3C46A 2C35B 2XIWA 3DM1A 2WIIB 2HDLA 1CT1D 1WCMB 2L11A 1MHWC 3I8ZA 2L4NA 2DNCA 4KI0A 2LXKA 5LL6X 3K5MA 1FJGQ 3BG3A 2I07B 1STBA 1QNKA 2KJXA 2VY3A 3FRPB 4C2MB 1YNNC 2ZT9C 1DOMA 1TU2B 1U5KA 2IPKD 2KVMA 3BVGA 5GQOA 4AYBB 2QEJC 1YIJA 5IYDH 3P7JA 3NE5B 2RHQB 3K5OA 1X3QA 4QQBX 2VW9A 4LUOA 4MTNA 1SYGA 2HCIA 3IKJA 4A3FH 4NXML 1K8GA 2UUBQ 3MXPA 1I6HB 1GOZA 4GZYC 3LWEA 2R7ZB 1N32Q 2YTXA 2NUCA 1LT5D 4DNRB 2ZJPA 3NTIA 1GVPA 3CHBD 4IFDG 3MXNB 5IOCA 3QR8A 2ICIA 4A3GB 3DEPA 4IUVA 2K5QA 5C0XH 2E2JH 1FGUA 3CCJA 2A73B 1CSQA 1SYDA 4DV0Q 3Q6SA 1D5XC 1AW7A 1EY7A 2PQAB 2Z6KC 4QF4A 1MSHA 3DEOA 3PO2B 1GUTA 4JV5Q 5ELFA 1X56A 1WCMG 2B2TC 3M4QA 1BCPF 1TS5A 3DMUA 4EQOA 4K14A 2HT1A 1ENFA 1LYLA 4TSSA 4GLXA 1BCPD 3BJUA 3UE0A 5FO7B 5K36H 1G91A 2R3ZA 1SN8A 1X3EA 4RFBA 3D6WA 5C4JH 4UP9A 4OEMB 4P75A 2L0CA 4XQNA 1WTOA 2F52A 4FVMA 4UHVA 1HH2P 2F0PA 3CRLC 4DN4M 4KD4A 5C6AA 2GA4B 2AHOB 2EY1A 4JK1C 1LT6D 4UP7A 3OW7A 4KV6A 3V05A 3SDZA 1YBYA 2LS01 2Z0SA 3CPFA 4KHVA 1PH2A 1NCVA 4BY7B 3E9HA 4DR2Q 1EIFA 2F1MA 1E2ZA 2A6EC 4NPSA 1K28A 2XN9C 2K01A 4DF7A 4DV3Q 3OIPA 2R7ZG 1QG7A 1X3GA 1IW7D 5GAEC 3I4MB 1Q86C 4BBSB 2D0PA 3BZKA 4EGVA 4FXKC 3JC66 1L2FA 1NJIC 1Y8OB 2DY7A 3S1NH 4NB3A 2EJMA 4DKAC 4PMWA 5FKAC 4XQJA 4CDEC 4F7XA 3PO2G 3CCLA 4NW2A 1I3QB 3OHXC 4OIKA 5EBCA 1K3RA 1X65A 2JEAI 4A3KH 4KY7A 5M3MB 2A69C 1AE2A 1XPOA 3HOXB 3I55A 2NTSA 3KF8B 3EFXD 2F0JA 1S5DD 4MHEA 4YY3L 1A62A 1Q90A 2KBNA 2A1AA 1QOHA 2ZTCA 5M9OA 1VQAA 2EDGA 3FHWA 3IFTA 3Q8DA 4DV5L 3IL8A 3RD4A 4BXXG 3PQIA 1BDOA 1YNJD 2F3IA 3HFZB 4DAYA 5IT9c 1Q81C 1ICFB 4KN7C 1V43A 1FNVA 1LT4D 3OWFA 4QY7A 3S1QH 4LF7L 4BY7G 1M1KC 1PRTB 1HZAA 4K8JA 4U673 4DUYQ 1PTOB 1C0AA 3I56A 2PW7A 3I4MG 3W1GA 5D65A 1FNUA 5IGBA 2LSSA 2L5TA 4K0KL 3L9AX 4CKCA 4BBSG 5JEAG 4LWCA 3KDFB 5FJ8H 2JA7H 2MFIA 3CCUA 1LABA 2Q2HA 2B2WA 2XNAC 2EYLA 3BVZA 3CCSA 5I9OA 2YU9B 3GTLB 2B2YC 2K52A 2E5LQ 1UAPA 2J7ZA 5IT9E 1A0IA 5IT9L 1G2SA 5JJZA 2P5ZX 2D62A 2JSOA 5M3MG 3GTMH 1IBLL 3HOXG 1H95A 5IP9H 2KUMA 4HR7B 3H94A 3RZDB 1EY8A 1TWHH 3GTJB 4A3LG 1VF7A 3A74A 4DR7L 2YYZA 2KHJA 2H5XA 2IW3A 2X6LA 2XRQD 4JI6Q 5J39A 1RTNA 3VYRA 2UXDQ 2XVSA 4DV2L 4BY1B 3TN2A 4FF4A 1HR0W 1PVOA 3CF5A 5CGKA 1RKNA 1CUKA 1TWFB 2V4DA 4P73A 2HUGA 2WP8J 3RZOB 1HQRD 3AU7A 4DR4L 2OQKA 3I3CA 4GN5A 1BF4A 2FJ2A 1YJ9A 1F2YA 4PG3A 4NXNQ 1N33L 3E5SA 3M4PA 1VQ9A 2K5WA 3CMEA 1WTVA 2NVYH 2MP1A 3GTQB 4L8JA 2UUCL 4LK1C 4GN4B 5DLQE 1BBWA 4OIJA 4IFDH 1Y8NB 2Q2IA 2XWBB 3PF4A 3H6MA 2WAQB 4ILWA 4KN4C 2K50A 3B6YA 5KRUA 3UDXA 4DK6C 4ID6A 5BN3A 1JE5A 4DGZA 5FLXc 2AWNA 1ZKOA 3PSIA 4IUNA 5CR3A 3VR5A 2F0IA 4P74A 1CA6A 1JT8A 1V1PA 2F0SA 1OXSC 4BY1G 4DR5L 1JJ2A 4B3SL 3NEMA 1JC7A 1R4PB 2LKVA 4TVAB 3DWPA 3WDNA 5L37A 4DR6L 5M3FB 3OOCA 1ESRA 2FMMA 3RMHA 3J7ZC 2VUMG 1MSGA 4CBVA 4QB4A 4LF7Q 4GKKL 4H0LC 3J7AF 5IYBG 1O80A 1ET6A 4K5XA 1I94L 3GTGB 2UXCL 4IUTA 5FLXE 1E2VA 5EKKA 4DV4L 1ZEQX 1QVCA 5FLXL 2OCEA 3DWQA 1HNZQ 4X62L 2K1BA 1GUWA 4ZK9B 1GD7A 4C1NK 1VQMA 5KYLA 2O5JC 4RWSC 2EPBA 2K5VA 1NNXA 1B44D 2G5DA 1EQRA 5BR8Q 1SE2A 1E3PA 3A54A 3PGZA 3T4AC 5C44H 3AFQA 4WFN3 3LNNA 2AQ2B 3KF6B 4YCVA 1W2BA 2WAQG 3TP8A 2A8VA 3F2UA 4WJ3M 3BDCA 5IIFA 3RN5A 3PO2H 5G3LD 1Z6HA 2RSNA 4LF4Q 3M9BA 3VYSA 1JQYD 3KJPA 4K2KA 4KY5A 4N8X1 5KNDA 3E6ZX 1Y1WB 4AIMA 5JJLA 2KEDA 4JI5Q 4AYBE 3A8JE 2A5HA 1SLJA 2PMZB 2YTYA 5CV6A 5E3FA 2IHFA 1EZ6A 1X32A 1XNRL 3IAYA 2LY7A 3HKZB 2FINB 5M3FG 4UP8A 2F0QA 1KTKA 3TP7A 2MGSA 1K3BC 1V1QA 3GQBA 1QUQB 3VDYA 4BXXH 1AN8A 1S4ZA 1FGBD 4A3EB 4KHZA 3I70A 4K6DA 5C5LA 2G9DA 3QO2A 3CCEA 3KLWA 1PRTF 4LUVA 1EU4A 4C56C 1KAWA 1PTOF 1CTMA 1S5ED 5CV7A 1F2ZA 5T1IA 4A3JB 3C2PA 3STBC 1CHPD 2A68D 4ZKCB 3I4MH 1ZYRC 4XT3B 4IOAA 4LFCL 5A35A 2Z4HA 1SDFA 4BBSH 2C9OA 2KCCA 5JEAH 2DGYA 2HHHQ 4B3RQ 1IL2A 5IGCA 1A3VA 1VQJA 5EKLA 3P20A 4FYDA 5BN5A 5C0XG 2D0OA 2C5CA 3S1NB 4A3CG 2BOSA 1K8OA 4HIKA 3PO3B 4X64L 2Z8LA 2XWJB 4UY8C 3CQZB 3T13A 5GADC 3OTOL 2CKZB 3I2ZA 3HGBA 4EX5A 3TBIB 1BR9A 1BXTA 1EQTA 1EQVA 5TSSA 1VQPA 1TQOA 3HOXH 4A3KB 4E6IA 1WOCA 1Y1WG 5J1ZA 4XXEA 3R2TA 4DR3Q 3FMCA 1STEA 1SEBD 4A3LH 1XTDA 3HKZG 1XTCD 2Z6BA 1FJGL 1TVXA 4XDXA 2CH4W 4KLKA 4A3EG 2JA6H 2WFWA 1HFNA 1VQ6A 1Q7YC 1ENCA 1ML0D 1SBBB 3MFYA 4CDFC 2FXQA 5EPJA 2K04A 1SRUA 3I73A 2IY5B 3A8KE 1MD2D 4A3JG 4IZ8A 5CYUA 1PLFA 2HQLA 2F0TA 3G7LA 1ET9A 3TS2A 2ATWA 1JR0D 4X62Q 1Q1BA 1YNXA 1WI5A 4B08A 3S17H 1TWAB 2PO4A 4CKBA 2X6GA 1DGSA 2OQ0A 3EQLC 1J5EQ 4YWKA 3GTLH 4HEDA 4JOIA 1N32L 3J7AV 5C3EB 1PXUA 4K6LA 3PO3G 5EJWA 1DD2A 3ND8A 4I65A 4KMUC 3MXNA 1BBUA 1AH9A 3GD7A 2E2IB 2F0EA 4DV0L 1EL0A 1SMXA 4DV6Q 1NMFA 2RCNA 2PQAA 3MEHA 2UUAQ 5C5MA 3OPOA 4UAIA 3TZUA 4JV5L 3RZDH 1WTQA 3GTJH 4CHTB 1GUGA 1Q8KA 2EE1A 4NDXA 3D6CA 3MA2B 2E75C 2CCZA 3M4YA 5LHY1 1PH3A 1GUNA 3U4ZA 1LTBD 2MUYA 4BY1H 4IJHA 4DK1A 2CHBD 2E76C 2VQEQ 1WTWA 4XYQA 2IWHA 3BS1A 2O4XA 4RCNA 1J9OA 4Z9CB 3MTSA 3Q24A 1TKWB 3RZOH 2VUMH 3W1BA 1PH5A 3I4NB 4TRDA 5LL6S 4ABNA 3UI2A 1EZ8A 4FF3A 5IYBH 4JBWA 3TMEA 1XPUA 3A8IE 4U68A 1M8AA 1VQ7A 2I5HA 4DR2L 1MIUA 5J3BA 1WTXA 1XNQQ 3K81C 4DV3L 3AB9A 4QJFA 5C3EG 2JK8A 4JCVE 1IBKQ 4MNOA 2NVYB 4KJOA 1JOKA 2PPBC 4LFAQ 1PDQA 1Y1VB 3MC0B 5JOBA 4PMBA 2NZ1D 1PFNA 3TZDA 5I9PA 3GTPB 2Y0SB 3F1ZA 2BE5D 4PZ8A 5IP9G 4PZ6A 1F77A 2NVTB 3NWSA 3T51B 3KJOA 1YJNA 1BO0A 1RODA 1NTGA 3KF8A 5ELEA 1K83B 3OYYA 1LACA 3FP9A 2IJ0A 3C1EA 2NVXH 2K75A 1WTPA 2H4OA 1QZHA 1CKNB 3OWEB 1I50B 2MPMA 3G48A 1EFID 5M3FH 2M9VA 3A5UA 2OTLA 1RCVD 2UU9Q 5AJ3Q 3AMUA 3I4NG 1TR5A 1QE6A 2GVAA 2EYJA 5GAHC 1GM5A 5LMUQ 5A2QE 1SE8A 1SMYD 2B2VC 1PYWD 4KD3A 2NN6G 3GP7A 5A2QL 2ENBA 3R2IA 4GOPC 1H9KA 1L0YB 3GTGH 2HD3A 2N49A 4DUYL 1WD0A 5KIXA 1N36Q 1MJCA 1JB3A 4R4IA 3CAMA 4M1UB 1BVSA 1VCIA 3PIOA 4RKLA 2F0VA 4DR1Q 3PUVA 3KDFA 5EGTA 1Y1VG 2IHEA 3NTKA 4C1NI 1ENAA 3F8TA 5C44B 4S3SA 1HTPA 1IYJB 2E5LL 2Y0SG 3T56B 3TREA 4A3CH 1HNWQ 3AYHB 4N9TA 1EYCA 4A3DG 1CHQD 3U58A 2JA9A 1B70B 1HR0Q 2D9UA 3A56A 1Y1WH 1T5EA 3DWAA 1KNEA 4IUPA 2LXJA 4GNXB 2EXZA 2BH8A 3VR6A 1PYSB 5M5YB
chains in the Genus database with same CATH topology
2KA7A 3HRZC 4LAAA 5JEAJ 3Q22A 1NR2A 4KKSA 1HA6A 4J8QA 4DXFA 1VMPA 5FO8B 1Z7TA 2B8FA 2PQEA 1FYCA 4UDUC 3K5NA 2E2HB 2HQEA 2TSSA 4B9XA 4C3IB 1IYUA 3U9SA 4H13C 5I4DA 4QIWB 3VYTA 3S2HB 4K8IA 5D14A 1VF5C 1NR4A 4OO1G 2SNMA 2PZUA 2B8GA 1DONA 1TS4A 4R9WA 3ITPA 1SYBA 2B2TA 4G7HC 4ZUJA 3HOUB 1M4VA 2F0FA 2DNEA 4HMJA 2F4IA 4QMGA 1Q3LA 3HZXA 3M3YB 2F0MA 2JA6B 4H44C 2EYMA 1KLUD 2RVLA 2BA0A 4HSPA 1CQVA 5DEHA 1T5XD 3DHQA 5CV4A 4FF1A 2E74C 1PZJD 2MHVA 3PMFA 5COYA 4C3IG 1EY9A 4J6HA 3S17B 2Q8TA 2F0DA 1RF2D 3LWUA 5M5XB 2BDNA 3CKIB 2KEEA 3H3VC 1CI3M 2BDOA 4K5VA 4ZYSA 4PMCA 5F2DA 3C1FA 3QOJA 5JAVA 4M8AA 3JAME 5CBEE 4F8MA 3JAML 4IQZA 2K05A 3TSSA 1LV9A 1O7ZA 4TKOB 4A3MB 1AZQA 1W6KA 3BDOA 2RA4A 1QILA 3QB3A 1JWUD 4WORA 2HCCA 1UEAB 1PMRA 2OXPA 2SNSA 3TDQA 1SNOA 5I6YA 3J80E 4FF2A 1I4GA 1BCPC 1GUSA 3J80L 3BDLA 4IUUA 2VUMB 3SVMA 2NN6H 3FVQA 3VR2A 1RD9D 3NSWA 2N55A 2AWOA 2EY2A 2PCFB 4BA2I 1KDBA 4PQXA 5C4HA 4IURA 1AFPA 2CW0D 1B4OA 2AUKA 1IL8A 4DA2A 2B2YA 1IW7C 5E1FA 3SEBA 4EQNA 1QNUA 1U9RA 4L6TB 3MHBA 1TY2A 5IGGA 1EEFD 1HHVA 3PUWA 2D5DA 3K59A 5NUCA 1I6VC 4DAPA 1BOSA 4HMIA 1JE4A 4L63B 1F9PA 2NVXB 1EYAA 1I4RA 3FKIB 4FXGC 3SK6A 3HOYB 3V96A 2QDBA 1JCKB 5C0XJ 5C3WA 2JYOA 1H9SB 1EWCA 4R8NA 1B2TA 1NAPA 1EWHA 1I4HA 4ME5A 1ZXTA 1A6XA 1SSOA 2EYHA 1YNJC 1F2LA 4RA8A 2EYFA 2I46A 1V8QA 5J22A 3X3MA 3PUYA 3MVVA 2A6HD 2NBFA 2F0LA 3WOEA 4OO1H 3KUPA 2L9HA 1UNSA 3M7GA 2SDFA 4NKLA 5KNBA 1RTOA 1IYVA 5BN4A 3N6RA 4X3SA 5D3IB 2EYPA 1SJHD 5EPKA 2EYOA 2SOBA 1MGSA 1CA5A 4J1MA 4BA1I 2F0OA 1DM0B 1L0XB 1PZID 4ZLTF 1NSNS 5HGTA 5I6WA 1STNA 3D31A 3MXGA 3Q23A 2NVQB 4A3IB 1DOKA 1IKLA 2M00A 2RDFA 2CQAA 3A55A 5AFWA 5I2XA 4HSVA 2D2CC 5ELBA 1JOOA 5FOBB 1PRTD 1OXUA 1PTOD 3D3RA 1BQQT 1SNPA 1F9QA 4HN7A 4EQPA 3R3OA 1WVLA 5JVH3 1KLGD 3E0JA 2DY8A 1GXDC 2F0NA 1KABA 4RGOS 5EPLA 3CU7A 4FO2A 1EY6A 5CBAE 1KAAA 2ZXOA 2Z1CA 3MXUA 1BNZA 1SE3A 2N88A 3PIO3 4C3JB 1B3AA 3URYA 4ZRZA 1GHKA 1TWGB 3D4WA 3TP5A 1W6JA 4RKBA 3HG9A 1A2TA 3HP3A 4V190 2Z4IA 2EY6A 1B50A 1BCPB 1G8ZD 2B39A 4A3BB 2K6AA 4B9WA 1F2MA 3K58A 1TY0A 3P1HA 1II3A 1S5CD 2QILA 4NP5A 4CGYB 1KDAA 4CJ2C 4XT1B 3EROA 2JP1A 4DAVA 1U4LA 3NUCA 3N52A 4NMZA 2WKCA 4OL7A 3LX0A 1D6EC 4YIJA 4DXGA 3OSOA 2JA8B 4C3JG 2F0KA 4MIUA 1SYEA 2ZXRA 1LTRD 1G291 1EOTA 1CZWA 2JE6I 3M7NA 3M85A 1Z47A 1KNAA 1A2UA 2AQ1B 1CK1A 1H9JA 4ZKBB 1LTTD 1HPCA 5CORA 4IFDJ 2EJGC 1HA5A 3BVMA 2F0GA 3V2TA 3DXJC 3SK5A 5C0XI 4RGMA 3MZ5A 1SFOB 1SNDA 3H0GB 2A6ED 1D5MC 1Q12A 1R9TB 1U4RA 3S9WA 1ILPA 3OIQA 2OF1A 1LT3D 2RKSA 2A68C 3BYTB 3BZDB 1A3UA 2VB2X 1EY4A 1PFBA 2F0UA 3K7AB 3EA6A 1J8IA 3HS0C 2QF7A 4QUCA 2B2UC 4A3DB 1EIGA 3U9OA 2A69D 1AEXA 3FDTA 4ODGA 5DAUA 3NWTA 3A7LA 3GV3A 3G6JB 3RUZA 2B63B 4HCSA 4KTAA 4X3TA 1D1KA 3S1MB 3DUZA 3BYYB 2Q8RE 1EY0A 1U4PA 3NQIA 5T1GA 2JXMB 4O1NA 2EZVA 5M5WB 1XWEA 1UUPA 1QJOA 2X69A 1FD7D 3SK4A 1DXMA 3M4OB 3K5LA 2IX1A 1HCZA 2O5IC 1RDPD 3TP6A 2L55A 3W3AA 2R93B 5C4ZA 4KY6A 3I72A 1QB5D 3L3OC 2H1EA 4RGTA 1SJED 5KEEA 3KK7A 2RDHA 2B2UA 1XXGA 3VR3A 1DOLA 1WTRA 1O78A 2Q8IB 4F87A 1JORA 2HDMA 5EBDA 5FO9B 3VA5A 1LTID 4RHRA 2B2VA 3C3LA 1XYIA 3ZYYX 5DM63 2RDGA 1LTGD 1PFMA 2J4XA 1OXVA 2DN8A 1DJRD 1MI2A 4C3HB 3EJIA 4QUFA 5JPNC 2EOTA 4P2CB 2R92B 2ZXPA 4V0BA 5K5PA 4BBRB 3Q0AA 3S14B 3R8BA 3W2DA 4K2LA 2OT2A 2B2WC 5C4XB 3I4LA 1STGA 4EVOA 3HOWB 3WOFA 4TQUS 4PNYA 4WRDA 2L1BA 4Q5VA 2IX0A 1LTAD 4IALA 1WD1A 3GTKB 2BE5C 1LLRD 2NN6I 2JA5B 1U4MA 1SYFA 3H09A 5CV8A 3ONAB 1B9NA 3GO5A 3ERQA 3KLRA 2FHTA 5IGFA 3S1RB 2K5DA 1H9SA 3T53B 1E0BA 1EU3A 2RSOA 3HEJA 2WACA 4IFDI 3NPPA 5ELCA 2K03A 1B53A 1HQMC 1SXTA 3GTOB 4C3HG 1G6ZA 1SMYC 2IL8A 4CJ1B 1C48A 2EY5A 1VDZA 1C4QA 4HAEA 2PZWA 3VYUA 1V1OA 4DU9A 2KHSA 5CV5A 2K28A 4HTHA 3NK9A 5JPMC 4XQQA 4BS9A 1STAA 1STYA 1VMCA 4R8IA 1JOQA 1HTLD 4FP5D 5ISRA 1JWSD 4KKUA 4KK7A 1BBXC 1HUNA 3SR1A 1R4QB 1OXXK 3K57A 2CVRA 2NWGA 4RHSA 3T16A 1B1ZA 3J7YW 2BCOA 2RBMA 2KQ3A 2NB0A 1GJXA 5KNCA 1CZGA 2KCNA 1ZYRD 3H91A 3QG1A 4OO1I 5E4WC 4RGNA 5KGUA 2ICEC 3OMCA 2PYKA 1FR3A 5EQ0A 1EY5A 1ONLA 4PV1C 1G2TA 5E4XA 4KJNA 4XYOA 4RCOA 4Y7NB 3SHLA 1SNCA 1D1IA 4G7ZC 2K33A 1JWMD 4X3KA 5I2YA 2NTTA 3CRKC 2QKIC 2R6GA 5CV9A 1RJTA 2PW5A 5D3DA 4X3UA 4G7OC 3D8GA 3K6OA 4RH6A 1C8CA 2XRSD 4I7ZC 4ULLA 1E2WA 2EJFC 1TIID 1A15A 2VNUD 1TS2A 1KDCA 5ELDA 2K7VA 4DFAA 1ESFA 1BUVT 3PUZA 5CC4A 3SE0A 5CMDA 1OO9B 2PZTA 3NBHA 1TWCB 1B9MA 4WJWA 1GUOA 3FPUB 2PNRC 3S15B 4OHJA 2QCPX 1Q1EA 5JVG3 2LMCB 3J81E 3RLFA 3J81L 4A3FB 2M2LA 2WKDA 3FPPA 1HRJA 1F9RA 5HURA 1CM9A 4IN3A 4N9PA 1MBYA 2F3VA 2WINB 5G3LF 2E2JB 1OXTA 2EVBA 4F88A 1K8MA 1JICA 3QJYA 4FNFA 1H9RA 3S2DB 1LTSD 2KOLA 2KECA 1O7LA 3P75A 2BA1A 1NUCA 3QIAA 4RAUC 1PZKD 3ND9A 1SE4A 5C4JB 1A3TA 2FFKB 2MJ8A 1STHA 1DCZA 4LMQD 3VR4A 3MWYW 2F03A 3KBGA 1ICWA 2OEOA 4ZQ3A 1RHPA 3VA7A 5KYIA 1HXYD 2CW0C 4BWGB 1Y8PB 1CQFA 1SAPA 1SNMA 4MN3A 4CJ0B 2LFNA 1TS3A 1EYDA 3I90A 2K32A 3PV0A 4G57A 1IHZA 2F3WA 1XX8A 3GV6A 2A74C 5EKIA 4DNTB 3I91A 1Y69U 1S5FD 4IUQA 1Q8IA 1YNND 3R93A 1H9MA 3PUXA 1EEID 4LJZC 1QWYA 1V1PB 4K5WA 1QCBD 1DZ1A 3SK8A 4H7BA 5K36G 2L12A 1I4QA 1SYCA 4DK0A 3O13A 1AZPA 3HOVB 3NTHA 3NBIA 1AP0A 2NYZD 1PTOH 3S1QB 2JEBI 3NHHA 3HOZB 1D2BA 4A93B 3S16B 1GHJA 1SNQA 4XIGS 4ZUIA 1DYQA 1S5BD 4G4KA 5DM73 3OMGA 1EIHA 2FMCA 2JA7B 1HUMA 3KBXA 1FNWA 1IKMA 3A7AB 1F9SA 2ID0A 2A6HC 4KKTA 4QCLA 2XSCA 4Q0FA 2IT1A 3IFDA 2E2DC 3QWNA 2RQXA 4O42A 2VXWA 3NQTA 1CFMA 4HCEA 3GTMB 5C3XA 3NXWA 2F0HA 1LO5D 5IGDA 4FXDA 1TWHB 2O2LD 5FK9C 1HFGA 5IGEA 1I4PA 2VB3X 1D5ZC 2F0WA 3D4RA 1TT2A 2TMPA 3KLSX 2G9HD 1I4XA 1PRTC 1PTOC 4XTCS 5IODA 5DNFA 3L7ZC 2AQ3B 3MAQA 2R61A 3X3NA 3KLSA 2IX3A 3SXHA 2J0TD 3EVQA 1X3PA 3QOLA 1O7YA 1ILQA 2WB1B 3MFGA 4OGQC 3D4DA 2WV6D 2AUJD 2SEBD 3PIP3 3FEWX 4ZAIA 4CKEA 3K0YA 3NP8A 3C46A 2XIWA 3DM1A 2WIIB 2HDLA 1CT1D 1WCMB 2L11A 3I8ZA 2L4NA 2DNCA 4KI0A 5LL6X 3K5MA 3BG3A 2I07B 1STBA 1QNKA 2KJXA 3FRPB 4C2MB 1YNNC 2ZT9C 1DOMA 1TU2B 2IPKD 2KVMA 3BVGA 4AYBB 2QEJC 3P7JA 3NE5B 3K5OA 1X3QA 1SYGA 2HCIA 3IKJA 3MXPA 1I6HB 1GOZA 4GZYC 3LWEA 2R7ZB 2NUCA 1LT5D 4DNRB 3NTIA 3CHBD 4IFDG 5IOCA 4A3GB 2ICIA 3DEPA 4IUVA 2K5QA 5C0XH 2A73B 1SYDA 3Q6SA 1D5XC 1AW7A 1EY7A 4QF4A 1MSHA 3DEOA 3PO2B 1GUTA 5ELFA 2B2TC 1BCPF 1TS5A 3DMUA 4EQOA 4K14A 1ENFA 4TSSA 1BCPD 5FO7B 5K36H 1G91A 2R3ZA 4RFBA 3D6WA 2L0CA 4XQNA 1WTOA 4FVMA 3CRLC 2F0PA 5C6AA 4DN4M 4KD4A 2GA4B 2EY1A 4JK1C 1LT6D 3OW7A 4KV6A 3V05A 3SDZA 2LS01 4KHVA 1NCVA 4BY7B 2F1MA 1E2ZA 2A6EC 2XN9C 2K01A 4DF7A 3OIPA 1QG7A 1IW7D 3I4MB 4BBSB 4EGVA 4FXKC 1Y8OB 2DY7A 2EJMA 4PMWA 5FKAC 4XQJA 4F7XA 4NW2A 1I3QB 3OHXC 4OIKA 5EBCA 2JEAI 4KY7A 5M3MB 2A69C 3HOXB 2NTSA 3EFXD 2F0JA 1S5DD 4MHEA 1Q90A 1QOHA 5M9OA 2EDGA 3IFTA 3IL8A 3RD4A 1BDOA 1YNJD 4DAYA 4KN7C 1V43A 1FNVA 1LT4D 3OWFA 1PRTB 4K8JA 4U673 1PTOB 2PW7A 5D65A 1FNUA 5IGBA 2L5TA 3L9AX 4CKCA 5JEAG 1LABA 2B2WA 2XNAC 2EYLA 3BVZA 5I9OA 2YU9B 3GTLB 2B2YC 1UAPA 2J7ZA 5IT9E 5IT9L 1G2SA 5JJZA 2D62A 2JSOA 2KUMA 4HR7B 3H94A 3RZDB 1EY8A 3GTJB 1VF7A 2YYZA 2IW3A 2X6LA 2XRQD 5J39A 1RTNA 3VYRA 2XVSA 4BY1B 3TN2A 4FF4A 5CGKA 1RKNA 1TWFB 2V4DA 2HUGA 2WP8J 3RZOB 1HQRD 3AU7A 3I3CA 1BF4A 2FJ2A 1F2YA 3E5SA 2K5WA 1WTVA 3GTQB 2MP1A 4L8JA 4LK1C 4OIJA 4IFDH 1Y8NB 2XWBB 3H6MA 2WAQB 4ILWA 4KN4C 5KRUA 4ID6A 5BN3A 4DGZA 2AWNA 1ZKOA 4IUNA 5CR3A 3VR5A 2F0IA 1CA6A 1V1PA 2F0SA 1OXSC 1JC7A 1R4PB 2LKVA 3DWPA 3WDNA 5M3FB 3OOCA 1ESRA 2FMMA 3RMHA 1MSGA 4CBVA 4QB4A 4H0LC 3J7AF 1O80A 1ET6A 4K5XA 3GTGB 4IUTA 5FLXE 1E2VA 5EKKA 1ZEQX 5FLXL 3DWQA 2K1BA 1GUWA 4ZK9B 4C1NK 5KYLA 2O5JC 4RWSC 2EPBA 1B44D 1SE2A 3A54A 3T4AC 4WFN3 3LNNA 2AQ2B 3TP8A 3F2UA 3BDCA 5IIFA 5G3LD 1Z6HA 2RSNA 3VYSA 1JQYD 4K2KA 4KY5A 5KNDA 3E6ZX 1Y1WB 2KEDA 3A8JE 2A5HA 2PMZB 5CV6A 5E3FA 1EZ6A 1X32A 3IAYA 2LY7A 3HKZB 2FINB 2F0QA 1KTKA 3TP7A 2MGSA 3GQBA 1AN8A 1S4ZA 1FGBD 4A3EB 4KHZA 3I70A 4K6DA 5C5LA 2G9DA 3QO2A 1PRTF 1EU4A 4C56C 1PTOF 1CTMA 1S5ED 5CV7A 1F2ZA 5T1IA 4A3JB 3C2PA 1CHPD 2A68D 4ZKCB 1ZYRC 4XT3B 5A35A 2Z4HA 1SDFA 2C9OA 2KCCA 5JEAH 5IGCA 1A3VA 5EKLA 3P20A 4FYDA 5BN5A 5C0XG 2C5CA 3S1NB 2BOSA 1K8OA 3PO3B 2Z8LA 2XWJB 3CQZB 3T13A 3HGBA 3TBIB 1BR9A 1BXTA 1EQTA 1EQVA 5TSSA 1TQOA 4A3KB 4E6IA 5J1ZA 4XXEA 3R2TA 3FMCA 1STEA 1SEBD 1XTCD 1TVXA 4XDXA 1HFNA 1ENCA 1ML0D 1SBBB 3MFYA 5EPJA 2K04A 3I73A 3A8KE 1MD2D 4IZ8A 5CYUA 1PLFA 2F0TA 3G7LA 1ET9A 1JR0D 1Q1BA 4B08A 1TWAB 2PO4A 4CKBA 2X6GA 3EQLC 4HEDA 3J7AV 5C3EB 1PXUA 4K6LA 5EJWA 1DD2A 3ND8A 4I65A 4KMUC 3MXNA 3GD7A 2E2IB 2F0EA 1EL0A 3MEHA 5C5MA 3OPOA 4UAIA 3TZUA 1WTQA 4CHTB 1GUGA 2EE1A 4NDXA 3D6CA 3MA2B 2E75C 3M4YA 5LHY1 1GUNA 1LTBD 2MUYA 4DK1A 2CHBD 2E76C 1WTWA 4XYQA 2IWHA 3BS1A 2O4XA 4RCNA 1J9OA 4Z9CB 3MTSA 3Q24A 1TKWB 3I4NB 4TRDA 5LL6S 4ABNA 3UI2A 1EZ8A 4FF3A 4JBWA 3TMEA 3A8IE 4U68A 1M8AA 1WTXA 3AB9A 2NVYB 4KJOA 1JOKA 2PPBC 1PDQA 1Y1VB 3MC0B 5JOBA 4PMBA 2NZ1D 1PFNA 3TZDA 5I9PA 3GTPB 2Y0SB 2BE5D 1F77A 2NVTB 3NWSA 3T51B 1BO0A 1RODA 3KF8A 5ELEA 1K83B 1LACA 2IJ0A 3C1EA 1WTPA 2H4OA 3OWEB 1I50B 2MPMA 1EFID 2M9VA 1RCVD 3AMUA 1TR5A 1QE6A 2EYJA 5A2QE 1SMYD 2B2VC 1PYWD 4KD3A 2NN6G 3GP7A 5A2QL 2ENBA 3R2IA 1H9KA 1L0YB 1WD0A 5KIXA 1JB3A 4M1UB 1VCIA 4RKLA 2F0VA 3PUVA 5EGTA 3NTKA 4C1NI 1ENAA 5C44B 4S3SA 1HTPA 3T56B 4N9TA 1EYCA 1CHQD 2D9UA 3A56A 1T5EA 3DWAA 1KNEA 4IUPA 2EXZA 3VR6A 5M5YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0D A;  1EY5 A;  3ERQ A;  4DF7 A;  4LAA A;  5C4Z A;  1SNQ A;  1EYA A;  4KY6 A;  2F0N A;  4ZUI A;  5KYL A;  3SK6 A;  1KAB A;  4KJN A;  5IGF A;  4KJO A;  2QDB A;  1JOK A;  5J39 A;  3OMG A;  3SHL A;  3P75 A;  1STB A;  1NUC A;  5C3W A;  1SNC A;  4K5V A;  1EY6 A;  2F0G A;  5JOB A;  4PMB A;  3V2T A;  4PMC A;  5F2D A;  1KAA A;  3C1F A;  3QOJ A;  4R8N A;  1ENC A;  3HEJ A;  5JAV A;  2WAC A;  3TP8 A;  5KEE A;  5I9P A;  3BDC A;  3SK5 A;  5CGK A;  1RKN A;  2PQE A;  4F7X A;  1A3T A;  4ME5 A;  5IIF A;  3MZ5 A;  2EYH A;  4F8M A;  4IZ8 A;  5CV9 A;  1SND A;  2EYF A;  1STH A;  3NQT A;  2F0T A;  5CV4 A;  2PW5 A;  4K2K A;  4KY7 A;  3D4W A;  2HQE A;  4KY5 A;  3TP5 A;  5C3X A;  4RKB A;  4B9X A;  3D8G A;  3S9W A;  1A2T A;  3NXW A;  2OEO A;  1SYG A;  2F0H A;  1F2Y A;  2EY5 A;  5IGD A;  2F0J A;  3QB3 A;  2OF1 A;  4ZQ3 A;  4WOR A;  5KYI A;  2PZW A;  2RKS A;  3C1E A;  3E5S A;  3MXP A;  1JOR A;  5J22 A;  1A3U A;  2EY6 A;  2OXP A;  5CV6 A;  5E3F A;  5M9O A;  1KDC A;  1EZ6 A;  1EY4 A;  2SNS A;  4DU9 A;  2F0U A;  2KHS A;  1SNO A;  3MVV A;  2NUC A;  4K8I A;  5I6Y A;  2F0Q A;  5IGE A;  3VA5 A;  4I65 A;  3TP7 A;  2F0L A;  2F0W A;  4DFA A;  5CV5 A;  1TR5 A;  3BDL A;  4HTH A;  5IOC A;  4B9W A;  1F2M A;  1TT2 A;  2EYJ A;  3P1H A;  1SNM A;  1II3 A;  3NK9 A;  4K6D A;  2SNM A;  2PZU A;  5C5L A;  2F0E A;  3H6M A;  4KD3 A;  5CC4 A;  3U9O A;  4NKL A;  1SYD A;  4NP5 A;  2ENB A;  3OWF A;  1EYD A;  1AEX A;  1KDA A;  1EY7 A;  2EY2 A;  3ITP A;  3MEH A;  4ODG A;  5DAU A;  5C5M A;  5C6A A;  2EYP A;  1KDB A;  1SYB A;  1STA A;  2PZT A;  4G57 A;  1STY A;  4ID6 A;  2EYO A;  4K8J A;  4QF4 A;  1IHZ A;  5CV7 A;  3ERO A;  2SOB A;  2F3W A;  3RUZ A;  1F2Z A;  4KTA A;  4DGZ A;  1JOQ A;  4ZUJ A;  3EJI A;  4J1M A;  2F0F A;  2PW7 A;  4HMJ A;  4NDX A;  3D6C A;  1EY0 A;  4EQO A;  3DMU A;  5IGB A;  4K14 A;  5IOD A;  4IUN A;  4QMG A;  5ISR A;  2F0O A;  5CR3 A;  5KRU A;  3HZX A;  4RKL A;  3SR1 A;  2F0V A;  2F0I A;  5EGT A;  3SXH A;  5IGC A;  1NSN S;  5K5P A;  2F0S A;  5HGT A;  4K5W A;  5I6W A;  1A3V A;  1STN A;  3NUC A;  5EKL A;  3SK8 A;  4H7B A;  1ENA A;  3EVQ A;  2F0M A;  2EYL A;  1SYC A;  4K2L A;  4S3S A;  4NMZ A;  3QOL A;  5I9O A;  2M00 A;  2RDF A;  4OL7 A;  2EYM A;  2O4X A;  3LX0 A;  4YIJ A;  5E1F A;  2LKV A;  1STG A;  5HUR A;  4EQN A;  3OSO A;  4N9T A;  1U9R A;  3T13 A;  3T16 A;  1EYC A;  3D4D A;  3MHB A;  4EVO A;  1JOO A;  5DEH A;  5IGG A;  2F0K A;  2F0P A;  4MIU A;  3DHQ A;  4KD4 A;  1SYE A;  4N9P A;  4QB4 A;  4PNY A;  2RBM A;  2KQ3 A;  2EY1 A;  4TRD A;  2F3V A;  4WRD A;  3SK4 A;  1EQV A;  5NUC A;  1EZ8 A;  1TQO A;  4HMI A;  4KV6 A;  3PMF A;  4IAL A;  3TME A;  4E6I A;  5J1Z A;  4K5X A;  4KHV A;  5KGU A;  1SNP A;  3NP8 A;  4EQP A;  5C4H A;  1A2U A;  4J6H A;  1SYF A;  5KIX A;  5EKK A;  3R3O A;  3TP6 A;  1EY9 A;  5CV8 A;  1EY8 A;  3OMC A;  2EXZ A;  3NHH A;  2PYK A; 
#chains in the Genus database with same CATH topology
 2KA7 A;  3HRZ C;  4LAA A;  5JEA J;  3Q22 A;  1NR2 A;  4KKS A;  1HA6 A;  2RHS B;  1X54 A;  4JI6 L;  4J8Q A;  4Y52 H;  2UXD L;  2PI2 A;  5ELO A;  3K80 C;  4A3E H;  4DXF A;  4A3I H;  1VMP A;  5FO8 B;  3ICE A;  1Z7T A;  1VQB A;  2B8F A;  2PQE A;  4LFB Q;  1FYC A;  4A3J H;  4UDU C;  3PCO B;  2AMC B;  4LF6 Q;  3K5N A;  2E2H B;  2HQE A;  2TSS A;  4B9X A;  4C3I B;  1IYU A;  4NXN L;  3U9S A;  2KEN A;  4H13 C;  5I4D A;  5C44 G;  4R4T A;  4QIW B;  3VYT A;  4CDD C;  3S2H B;  3H3V H;  4DV7 Q;  3PO3 H;  4K8I A;  3CQZ H;  5D14 A;  1VF5 C;  1NR4 A;  4OO1 G;  1B8A A;  2SNM A;  2PZU A;  2B8G A;  1DON A;  2Z6K A;  2VL6 A;  1TS4 A;  4R9W A;  1HNX Q;  3ITP A;  1D7Q A;  1NBW A;  4C3J H;  1SYB A;  2B2T A;  4G7H C;  1TWG H;  5GAG C;  4ZUJ A;  2I5M X;  3HOU B;  1M4V A;  2F0F A;  2DNE A;  4HMJ A;  2F4I A;  4LF8 Q;  4QMG A;  4OEL B;  1U0L A;  1Q3L A;  1V9P A;  3HZX A;  3M3Y B;  2GN5 A;  4YHH Q;  1VQO A;  2F0M A;  2JA6 B;  4H44 C;  4IPH A;  1EQQ A;  1JJG A;  2EYM A;  1KLU D;  2RVL A;  2BA0 A;  4HSP A;  1CQV A;  5DEH A;  1T5X D;  3DHQ A;  5CV4 A;  4FF1 A;  2E74 C;  1PZJ D;  3JAM c;  2MHV A;  3PMF A;  3CC2 A;  2K5N A;  5COY A;  4C3I G;  1HZB A;  1TWA H;  1EY9 A;  2F4V Q;  4J6H A;  4IPG A;  2B29 A;  1HNZ L;  3S17 B;  2R92 G;  2Q8T A;  2F0D A;  5C3E H;  1RF2 D;  3LWU A;  5M5X B;  4POF A;  3KYH C;  4I7A A;  2BDN A;  3CKI B;  2KEE A;  2ES2 A;  5BR8 L;  3TS0 A;  3H3V C;  1CI3 M;  2BDO A;  4K5V A;  1NMG A;  3J80 c;  1FL0 A;  4ZYS A;  4PMC A;  5F2D A;  2E2I H;  3C1F A;  3QOJ A;  5JAV A;  2PNH A;  4M8A A;  4MZ9 A;  4LF4 L;  4LNQ A;  3JAM E;  5CBE E;  4F8M A;  3JAM L;  4IQZ A;  3HOU G;  2K05 A;  3TSS A;  1LV9 A;  1O7Z A;  4TKO B;  4A3M B;  2JA5 G;  1IZ6 A;  1AZQ A;  3PF5 A;  2EQS A;  2GVB A;  1W6K A;  4JI5 L;  3BDO A;  2RA4 A;  1QIL A;  3QB3 A;  1UE5 A;  1JWU D;  4WOR A;  2JA6 G;  2HCC A;  2QA4 A;  1UEA B;  2CH4 A;  1PMR A;  3HKS A;  2OXP A;  4R1J A;  2SNS A;  1CKO A;  3TRZ A;  3TDQ A;  3UDF A;  1SNO A;  1EYG A;  5I6Y A;  3J80 E;  1TXY A;  4FF2 A;  1I4G A;  1BCP C;  1GUS A;  4JC0 A;  3J80 L;  1W3S A;  1YEZ A;  5IE8 A;  1QUQ A;  1S72 A;  3I4N H;  3BDL A;  5LMN W;  4IUU A;  2VUM B;  3SVM A;  2NN6 H;  3FVQ A;  3VR2 A;  4GOP B;  1RD9 D;  3NSW A;  2N55 A;  2AWO A;  2EY2 A;  2PCF B;  4BA2 I;  1KDB A;  4PQX A;  5C4H A;  4JI0 Q;  1VS0 A;  4IUR A;  1AFP A;  1R9T H;  2CW0 D;  2HHH L;  4B3R L;  1O7I A;  2I5L X;  1B4O A;  1Y1V H;  1IL8 A;  2AUK A;  1L0W A;  4DA2 A;  2B2Y A;  4H02 A;  1IW7 C;  1P16 A;  3GTP H;  5E1F A;  2HIX A;  3SEB A;  4EQN A;  1QNU A;  1U9R A;  4L6T B;  3MHB A;  2NVT H;  1TY2 A;  5IGG A;  4A3D H;  1EEF D;  3KOJ A;  1HHV A;  1RIP A;  3PUW A;  2D5D A;  3K59 A;  5NUC A;  1I6V C;  1VQI A;  1BOS A;  4DAP A;  4HMI A;  4A3M G;  1JE4 A;  1K83 H;  4ALP A;  4JI7 Q;  1UE1 A;  1J6Q A;  4X65 Q;  4DR3 L;  4L63 B;  1F9P A;  1MKH A;  1AE3 A;  1I50 H;  2NVX B;  1EYA A;  1I4R A;  3FKI B;  4FXG C;  3SK6 A;  3HOY B;  3V96 A;  2QDB A;  1JCK B;  4KHP Q;  1Q46 A;  5C0X J;  5C3W A;  2JYO A;  1H9S B;  1EWC A;  4R8N A;  3CC4 A;  3EN2 A;  1B2T A;  1NAP A;  5JJK A;  1EWH A;  3T1H Q;  1I4H A;  4ME5 A;  5IYC G;  1ZXT A;  2WB1 E;  3TQY A;  1A6X A;  1SSO A;  2EYH A;  1YNJ C;  1F2L A;  1QVG A;  4RA8 A;  2EYF A;  4DAM A;  3M4O H;  2ZTE A;  4DUZ Q;  4JBJ A;  1VQ5 A;  2I46 A;  3OW2 A;  2KCT A;  4QGU A;  1J5E L;  1V8Q A;  5J22 A;  4AH6 A;  3CPW A;  3X3M A;  3PUY A;  3MVV A;  2A6H D;  2NBF A;  2F0L A;  1ASZ A;  3WOE A;  1T9H A;  4OO1 H;  3KUP A;  2L9H A;  1PYB A;  1UNS A;  4DV6 L;  3M7G A;  2SDF A;  3G6E A;  4NKL A;  5KNB A;  2UUA L;  1RTO A;  4LF9 L;  5BN4 A;  3GDE A;  1IYV A;  3BZC A;  3N6R A;  4X3S A;  5D3I B;  2EYP A;  1SJH D;  5EPK A;  2EYO A;  3L0O A;  2SOB A;  5M5Y H;  1MGS A;  1CA5 A;  4J1M A;  3FKI G;  3JAM i;  4BA1 I;  3HOY G;  2F0O A;  2HIV A;  1DM0 B;  1L0X B;  1PZI D;  4ZLT F;  1NSN S;  5HGT A;  5I6W A;  1STN A;  2VQE L;  4APV A;  3D31 A;  3MXG A;  3Q23 A;  2NVQ B;  4A3I B;  1DOK A;  1IKL A;  2RF4 A;  2M00 A;  2RDF A;  2CQA A;  3A55 A;  4IO9 A;  3UDG A;  4L5Q A;  5AFW A;  5I2X A;  4HSV A;  2D2C C;  1YHB A;  5ELB A;  1JOO A;  5FOB B;  1PRT D;  1OXU A;  3J80 i;  1PTO D;  3D3R A;  3IRB A;  2E2H H;  1KXL A;  4JI2 L;  1BQQ T;  4C3I H;  3ULJ A;  1SNP A;  1F9Q A;  4HN7 A;  4EQP A;  2V1C C;  4DPG A;  1XNQ L;  3R3O A;  1WVL A;  4C3H H;  3EBE A;  1KLG D;  5JVH 3;  3E0J A;  1KD1 C;  1X55 A;  2DY8 A;  1IBK L;  2R92 H;  3S2H H;  4FDB A;  1GXD C;  2F0N A;  1N8R C;  4HJ5 A;  1KAB A;  4LFA L;  4RGO S;  3S14 H;  5EPL A;  1L1O C;  3CU7 A;  4HIO A;  4FO2 A;  1EY6 A;  2VS1 A;  4LW1 A;  5CBA E;  1KAA A;  2ZXO A;  2Z1C A;  3MXU A;  4YWL A;  1BNZ A;  1PV4 A;  1SE3 A;  2N88 A;  2K4K A;  3PIO 3;  1JJC B;  4C3J B;  2ZJQ A;  1B3A A;  3URY A;  4JI4 Q;  3EIV A;  3HOU H;  3WWV A;  4ZRZ A;  4HJ7 A;  1GHK A;  3GTK H;  1TWG B;  4GNX C;  3D4W A;  3TP5 A;  1W6J A;  4RKB A;  2JA5 H;  3M3Y H;  4OWX B;  3HG9 A;  1A2T A;  1EWI A;  3HP3 A;  1XMO Q;  2DJG C;  1K9M C;  4V19 0;  2Z4I A;  3RR5 A;  2VQF Q;  4A3I G;  2EY6 A;  1B50 A;  1CKN A;  1K0R A;  5ELN A;  3S1R H;  1BCP B;  1G8Z D;  1YVC A;  2UU9 L;  5AJ3 L;  2B39 A;  1C9O A;  2K6A A;  2N8N A;  1E1O A;  4JI3 Q;  4A3B B;  1D8L A;  1Z9F A;  4B9W A;  1F2M A;  3K58 A;  5LMU L;  1TY0 A;  3P1H A;  4X6A H;  1II3 A;  1I5F A;  1S5C D;  2QIL A;  4NP5 A;  4CGY B;  1VQ8 A;  4JI8 Q;  4JG2 A;  1KDA A;  4CJ2 C;  1N36 L;  4XT1 B;  3NBH B;  3ERO A;  3RLN A;  3I4O A;  5M5X H;  3K8A A;  2JP1 A;  4DR1 L;  2MO1 A;  3G4S A;  4DAV A;  1U4L A;  3NUC A;  3CMA A;  1SR3 A;  1JB7 A;  5IWA Q;  3N52 A;  3ER0 A;  4NMZ A;  2WKC A;  4OL7 A;  3LX0 A;  1D6E C;  4YIJ A;  4DXG A;  1HNW L;  3OSO A;  4X66 Q;  2JA8 B;  4LF9 Q;  4C3J G;  2F0K A;  4MIU A;  1SYE A;  2ZXR A;  2NZO A;  1LTR D;  1G29 1;  1HR0 L;  4A3M H;  1EOT A;  1CZW A;  2JE6 I;  4CDC C;  5IY0 A;  3M7N A;  3M85 A;  1Z47 A;  1KNA A;  4A4I A;  1A2U A;  2AQ1 B;  1OTC A;  2MNA A;  3AEV A;  3DLL A;  1N34 Q;  1CK1 A;  1H9J A;  1S3O A;  4HIM A;  4ZKB B;  1LTT D;  1HPC A;  5COR A;  4A3B G;  4IFD J;  2EJG C;  1HA5 A;  3BVM A;  4R4O A;  3ULP A;  2F0G A;  3V2T A;  3DXJ C;  1K0S A;  3HOV G;  2NZH A;  1ASY A;  1E24 A;  3SK5 A;  4LFB L;  5C0X I;  5IYC H;  4JI2 Q;  1VQG A;  4RGM A;  1QVF A;  3MZ5 A;  1SFO B;  1VQL A;  1WYD A;  4IPD A;  1SND A;  3H0G B;  2A6E D;  1KHI A;  4LF6 L;  1EUJ A;  1D5M C;  2ALY B;  1Q12 A;  1R9T B;  1EOV A;  1C7Y A;  1U4R A;  1WJJ A;  3S9W A;  1ILP A;  3OIQ A;  3MEF A;  1XJV A;  2OF1 A;  1LT3 D;  1UEB A;  4JYA L;  4A93 G;  2RKS A;  2A68 C;  3BYT B;  3BZD B;  1A3U A;  4DV7 L;  2VB2 X;  1EY4 A;  1PFB A;  2F0U A;  2JA8 G;  3K7A B;  3CCQ A;  1SRO A;  3EA6 A;  1J8I A;  1PFS A;  3HS0 C;  2PI2 E;  2QF7 A;  4QUC A;  2Q2T A;  2B2U C;  4A3D B;  1EIG A;  1JMC A;  4LF5 Q;  3U9O A;  1HNX L;  1XMQ Q;  2A69 D;  1AEX A;  3FDT A;  4ODG A;  3KFU A;  5DAU A;  3NWT A;  3A7L A;  1NE3 A;  3GV3 A;  5HGQ A;  3G6J B;  1FVI A;  2CWP A;  3RUZ A;  2B63 B;  4HCS A;  4KTA A;  4X3T A;  1D1K A;  3S1M B;  3DUZ A;  3BYY B;  2Q8R E;  4LF8 L;  1EY0 A;  3E0E A;  3FKI H;  3HOY H;  4B3T Q;  1U4P A;  3NQI A;  5T1G A;  2KCM A;  2JXM B;  4YHH L;  3CC7 A;  2A19 A;  4O1N A;  2EZV A;  5M5W B;  2BH2 A;  1XWE A;  2Q2U A;  1UUP A;  1QJO A;  3U50 C;  4R4C A;  2ZM6 Q;  3E9I A;  2X69 A;  2VZA A;  1FD7 D;  3H3V I;  1QZG A;  3H0G G;  3SK4 A;  1PH8 A;  2CWA A;  3ZJY C;  1DXM A;  3M4O B;  2WAQ E;  3K5L A;  1VQC A;  2IX1 A;  1HCZ A;  2AKW B;  4HID A;  1TWC H;  2O5I C;  1CKM A;  1RDP D;  4LUZ A;  2F4V L;  3TP6 A;  1WFQ A;  2L55 A;  3CCV A;  1X6O A;  3W3A A;  2OTJ A;  2R7D A;  3S15 H;  2R93 B;  1N9W A;  5C4Z A;  4KY6 A;  1RL2 A;  2Z9H A;  1QB5 D;  3I72 A;  3L3O C;  1L1O B;  2H1E A;  3TEH B;  4RGT A;  1SJE D;  3T1Y Q;  1IBM Q;  5FLM G;  3AQQ A;  5KEE A;  1VQH A;  2WB1 G;  3KK7 A;  2RDH A;  4OX9 Q;  4IPC A;  2B2U A;  4O2D A;  2B63 G;  1A63 A;  1XXG A;  3VR3 A;  5LMN Q;  1EIY B;  2QW7 A;  2DUD A;  1YJW A;  1DOL A;  1WTR A;  1O78 A;  2Q8I B;  4F87 A;  1M90 C;  4ZCK A;  2NVQ H;  1JOR A;  2HDM A;  3S2D H;  1UE6 A;  5EBD A;  5FO9 B;  3VA5 A;  5E7N A;  3BU2 A;  1LTI D;  4RHR A;  2B2V A;  4B3M Q;  3C3L A;  4GOP A;  1XYI A;  3ZYY X;  5DM6 3;  1XPR A;  2RDG A;  1LTG D;  4JI0 L;  1PFM A;  2J4X A;  4JI1 Q;  1OXV A;  4AYB G;  3A5Z B;  2DN8 A;  1DJR D;  1MI2 A;  2R93 G;  4C3H B;  3EJI A;  1EFW A;  3J7A 5;  4QUF A;  5H1S E;  5JPN C;  2EOT A;  5IP7 G;  4JYA Q;  4P2C B;  2R92 B;  2ZXP A;  4JPB W;  1G51 A;  4V0B A;  5K5P A;  4BBR B;  3Q0A A;  3S14 B;  4POG A;  3R8B A;  3W2D A;  4EQ5 A;  4K2L A;  2OT2 A;  2B2W C;  2PMZ E;  5C4X B;  3I4L A;  1STG A;  3HKZ E;  4GKJ Q;  3U4V A;  4A3G G;  4EVO A;  3F2C A;  3HOW B;  3WOF A;  4TQU S;  4PNY A;  2UXB Q;  4WRD A;  5HY6 A;  2QEX A;  2L1B A;  4Q5V A;  2IX0 A;  1LTA D;  4IAL A;  1WD1 A;  1KRT A;  3LGJ A;  3GTK B;  2BE5 C;  4JI7 L;  1LLR D;  3A0J A;  2NN6 I;  4X65 L;  2JA5 B;  1U4M A;  1SYF A;  1PH1 A;  3H09 A;  5CV8 A;  3ONA B;  1VQ4 A;  1B9N A;  3GO5 A;  3ERQ A;  3KLR A;  2XTI A;  2FHT A;  1VQD A;  5IGF A;  3S1R B;  4A3B H;  4KHP L;  1NY4 A;  1E22 A;  1YIT A;  3RLO A;  1YHA A;  2K5D A;  1H9S A;  4YWM A;  3T53 B;  1E0B A;  1EU3 A;  3HOV H;  2RSO A;  3HEJ A;  2WAC A;  5GRO A;  4IFD I;  3T1H L;  3NPP A;  5ELC A;  2K03 A;  1B53 A;  1HQM C;  2QDL A;  1SXT A;  1KIX A;  2N78 A;  3GTO B;  1X9N A;  1VQN A;  4OON A;  4C3H G;  4DUZ L;  1B7Y B;  1G6Z A;  1SMY C;  2IL8 A;  4CJ1 B;  4HJ9 A;  4BBR G;  1C48 A;  4DK3 C;  2EY5 A;  3PIP A;  4L5R C;  4MTK A;  3K0X A;  3HOZ H;  1VDZ A;  1C4Q A;  4HAE A;  4A93 H;  2PZW A;  3VYU A;  4NXM Q;  3S16 H;  2YTV A;  1V1O A;  2XGT A;  3KF6 A;  4YCW A;  5C4X G;  4DU9 A;  2KHS A;  2JA8 H;  3HOW G;  4WJ4 A;  1PH7 A;  1UWV A;  5CV5 A;  2K28 A;  4RG1 A;  4HTH A;  4UPA A;  3NK9 A;  4RMF A;  3SGI A;  5JPM C;  4XQQ A;  4BS9 A;  4L5S A;  1STA A;  1STY A;  1VMC A;  4R8I A;  4IJL A;  1JOQ A;  1HTL D;  2JJQ A;  4FP5 D;  1K73 C;  5ISR A;  1KL9 A;  1JWS D;  4KKU A;  4KK7 A;  1BBX C;  1HUN A;  1PH4 A;  3SR1 A;  1R4Q B;  2EXD A;  1OXX K;  3K57 A;  2CVR A;  2YV5 A;  2NWG A;  4A75 A;  4RHS A;  3T16 A;  1B1Z A;  4JBM A;  3J7Y W;  1K8A C;  1SFO H;  2BCO A;  3H0G H;  2RBM A;  2KQ3 A;  2NB0 A;  1GJX A;  1CZG A;  5KNC A;  2KCN A;  2K14 A;  3STB D;  1X3F A;  1ZYR D;  3H91 A;  3QG1 A;  4OO1 I;  5E4W C;  4RGN A;  4YCU A;  1E7Z A;  4DNI A;  5KGU A;  2ICE C;  3OMC A;  4A76 A;  2PYK A;  1FR3 A;  1LM0 A;  5EQ0 A;  1EY5 A;  1ONL A;  4PV1 C;  1G2T A;  5E4X A;  3K7U C;  3K7A H;  1YZ6 A;  4KJN A;  4XYO A;  4P72 A;  4RCO A;  4Y7N B;  3SHL A;  3NEN A;  2B3G A;  1SNC A;  1D1I A;  1IXR A;  4ME3 A;  3UE1 A;  4G7Z C;  5FLM H;  2JN4 A;  4O0A A;  2K33 A;  1JWM D;  4X3K A;  5I2Y A;  2NTT A;  3CRK C;  2QKI C;  2R6G A;  2B63 H;  4JI4 L;  3S1M H;  3AFP A;  5CV9 A;  1RJT A;  2PW5 A;  1VQE A;  5D3D A;  4X3U A;  4G7O C;  1XMO L;  3D8G A;  3K6O A;  4RH6 A;  1C8C A;  2XRS D;  4I7Z C;  4HJA A;  2RCF A;  1YI2 A;  5M5W H;  2VQF L;  1WCM H;  4ULL A;  1E2W A;  2EJF C;  5EAY A;  2MQH A;  1TII D;  4YY3 Q;  1A15 A;  3J81 c;  2VNU D;  1TS2 A;  3UDI A;  1KDC A;  5ELD A;  4JI3 L;  1PHJ A;  4AQY L;  2K7V A;  4DV5 Q;  4DFA A;  1ESF A;  1HZ9 A;  1BUV T;  3PUZ A;  4C2M H;  4DAY B;  5CC4 A;  3SE0 A;  4JI8 L;  5CMD A;  2Y0S E;  1OO9 B;  2PZT A;  1A8V A;  3NBH A;  1YHQ A;  1TWC B;  1B9M A;  4WJW A;  3J81 j;  1GUO A;  2R93 H;  3FPU B;  5IP7 H;  2PNR C;  4OXP A;  2EIF A;  3S15 B;  4OHJ A;  2QCP X;  3I7F A;  1Q1E A;  4K0K Q;  5JVG 3;  2LMC B;  3J81 E;  1S40 A;  3RLF A;  3J81 L;  1I6H H;  5IWA L;  4R4Q A;  4A3F B;  2M2L A;  2R7Z H;  2WKD A;  3D0F A;  3FPP A;  1B3Q A;  1HRJ A;  1F9R A;  4X66 L;  5HUR A;  1CM9 A;  4IN3 A;  4A3G H;  1P8L A;  3S24 A;  4GLA C;  4N9P A;  1MBY A;  3RNU A;  2F3V A;  2WIN B;  5G3L F;  2E2J B;  1OXT A;  2EVB A;  2MO0 A;  1IBL Q;  3ERS X;  4F88 A;  1K8M A;  3ULL A;  1JIC A;  1MJE A;  1N34 L;  3QJY A;  4FNF A;  1H9R A;  3S2D B;  1LTS D;  2KOL A;  4DR7 Q;  2KEC A;  1O7L A;  3P75 A;  2BA1 A;  3W5O A;  1NUC A;  3QIA A;  4DV2 Q;  4RAU C;  1PZK D;  3ND9 A;  4IOC A;  1SE4 A;  5C4J B;  1A3T A;  2FFK B;  2MJ8 A;  2E8G A;  1STH A;  2QGQ A;  1DCZ A;  5IYD G;  4LMQ D;  3VR4 A;  4DR4 Q;  3CD6 A;  2ZJR A;  3MWY W;  4BY7 H;  2F03 A;  3KBG A;  1ICW A;  2OEO A;  4BBR H;  4GN3 B;  4A3F G;  1WTH A;  3RN2 A;  4ZQ3 A;  1BKB A;  1RHP A;  5KYI A;  3VA7 A;  1HXY D;  1KC8 C;  1N33 Q;  5C4X H;  2CW0 C;  3CCR A;  2UUC Q;  4BWG B;  1Y8P B;  4JOI C;  3HOW H;  1CQF A;  4GLV B;  4P71 A;  3NEL A;  3F2D A;  4DV1 L;  1SAP A;  1SNM A;  4LF5 L;  1VQF A;  4MN3 A;  3CW2 C;  1XMQ L;  4CJ0 B;  2LFN A;  4GS3 A;  1TS3 A;  1EYD A;  3I90 A;  1I3Q H;  1KRS A;  2K32 A;  3PV0 A;  4G57 A;  1IHZ A;  3CCM A;  2F3W A;  2L15 A;  1XX8 A;  3GV6 A;  2A74 C;  5M3M H;  5EKI A;  1G6P A;  4DNT B;  3I91 A;  4B3T L;  1Y69 U;  1S5F D;  4IUQ A;  1Q8I A;  1YNN D;  3R93 A;  1H9M A;  3PUX A;  1EEI D;  4LJZ C;  1QWY A;  1V1P B;  4K5W A;  1QCB D;  1DZ1 A;  3SK8 A;  4H7B A;  1Y14 B;  2L12 A;  1I4Q A;  4AQY Q;  5K36 G;  1SYC A;  4DR5 Q;  4DK0 A;  2ZM6 L;  3O13 A;  4QIW E;  1AZP A;  4B3S Q;  3HOV B;  4OWT B;  3NTH A;  3NBI A;  3GTO H;  2KHI A;  4DR6 Q;  1E1T A;  4GKK Q;  1AP0 A;  2NYZ D;  4OWW B;  1HZC A;  1PTO H;  3S1Q B;  1I94 Q;  2UXC Q;  2JEB I;  2JQO A;  4DV4 Q;  3NHH A;  3HOZ B;  1D2B A;  4A93 B;  4JVZ A;  3S16 B;  1GHJ A;  1SNQ A;  4XIG S;  4ZUI A;  1DYQ A;  1L1O A;  1S5B D;  3G71 A;  1UE7 A;  4G4K A;  5DM7 3;  2UUB L;  3OMG A;  1EIH A;  2FMC A;  3T1Y L;  2JA7 B;  1HUM A;  1LTL A;  3KBX A;  1IBM L;  2YU9 H;  1FNW A;  1IKM A;  1HJP A;  3J81 i;  3A7A B;  1F9S A;  4OX9 L;  1PA6 A;  4HJ8 A;  2ID0 A;  2A6H C;  3DM3 A;  4KKT A;  4QCL A;  2XSC A;  4Q0F A;  2IT1 A;  3IFD A;  5LMN L;  2E2D C;  3QWN A;  1VQK A;  3CP0 A;  2RQX A;  4O42 A;  4GNX A;  2VXW A;  3NQT A;  4A3K G;  1CFM A;  4HCE A;  3GTM B;  5C3X A;  4J15 A;  3NXW A;  2F0H A;  1LO5 D;  5IGD A;  2ZTD A;  1CSP A;  4FXD A;  1TWH B;  2O2L D;  5FK9 C;  3L2P A;  1HFG A;  1XNR Q;  5IGE A;  1I4P A;  2VB3 X;  1D5Z C;  2F0W A;  3D4R A;  4B3M L;  1KQS A;  1TT2 A;  4N8F A;  3F2B A;  3E3X A;  2CFM A;  1TWF H;  2TMP A;  2CQO A;  3KLS X;  4JI1 L;  4PZ7 A;  2G9H D;  1I4X A;  1PH9 A;  4JBK A;  2R7F A;  3HOZ G;  1PRT C;  1PTO C;  4XTC S;  5IOD A;  2K5H A;  3L7Z C;  2AQ3 B;  5DNF A;  4JW0 A;  4QL5 A;  3MAQ A;  2R61 A;  4L5T A;  1PH6 A;  3X3N A;  4Y7N H;  4LFC Q;  3KLS A;  2IX3 A;  2DJF C;  3SXH A;  5FJ8 G;  2JA7 G;  2J0T D;  2OWO A;  3EVQ A;  3GTQ H;  2ASB A;  1X3P A;  3QOL A;  4DV1 Q;  1O7Y A;  1ILQ A;  2N3S A;  1GKH A;  4GKJ L;  2WB1 B;  3MFG A;  4OGQ C;  3D4D A;  4X64 Q;  1Q82 C;  2WV6 D;  2AUJ D;  2SEB D;  3OTO Q;  2UXB L;  3CXC A;  3PIP 3;  2I0Q A;  3FEW X;  4ZAI A;  5JJI A;  4CKE A;  3K0Y A;  3H15 A;  1LUZ A;  3NP8 A;  1GO3 E;  3C46 A;  2C35 B;  2XIW A;  3DM1 A;  2WII B;  2HDL A;  1CT1 D;  1WCM B;  2L11 A;  1MHW C;  3I8Z A;  2L4N A;  2DNC A;  4KI0 A;  2LXK A;  5LL6 X;  3K5M A;  1FJG Q;  3BG3 A;  2I07 B;  1STB A;  1QNK A;  2KJX A;  2VY3 A;  3FRP B;  4C2M B;  1YNN C;  2ZT9 C;  1DOM A;  1TU2 B;  1U5K A;  2IPK D;  2KVM A;  3BVG A;  5GQO A;  4AYB B;  2QEJ C;  1YIJ A;  5IYD H;  3P7J A;  3NE5 B;  2RHQ B;  3K5O A;  1X3Q A;  4QQB X;  2VW9 A;  4LUO A;  4MTN A;  1SYG A;  2HCI A;  3IKJ A;  4A3F H;  4NXM L;  1K8G A;  2UUB Q;  3MXP A;  1I6H B;  1GOZ A;  4GZY C;  3LWE A;  2R7Z B;  1N32 Q;  2YTX A;  2NUC A;  1LT5 D;  4DNR B;  2ZJP A;  3NTI A;  1GVP A;  3CHB D;  4IFD G;  3MXN B;  5IOC A;  3QR8 A;  2ICI A;  4A3G B;  3DEP A;  4IUV A;  2K5Q A;  5C0X H;  2E2J H;  1FGU A;  3CCJ A;  2A73 B;  1CSQ A;  1SYD A;  4DV0 Q;  3Q6S A;  1D5X C;  1AW7 A;  1EY7 A;  2PQA B;  2Z6K C;  4QF4 A;  1MSH A;  3DEO A;  3PO2 B;  1GUT A;  4JV5 Q;  5ELF A;  1X56 A;  1WCM G;  2B2T C;  3M4Q A;  1BCP F;  1TS5 A;  3DMU A;  4EQO A;  4K14 A;  2HT1 A;  1ENF A;  1LYL A;  4TSS A;  4GLX A;  1BCP D;  3BJU A;  3UE0 A;  5FO7 B;  5K36 H;  1G91 A;  2R3Z A;  1SN8 A;  1X3E A;  4RFB A;  3D6W A;  5C4J H;  4UP9 A;  4OEM B;  4P75 A;  2L0C A;  4XQN A;  1WTO A;  2F52 A;  4FVM A;  4UHV A;  1HH2 P;  2F0P A;  3CRL C;  4DN4 M;  4KD4 A;  5C6A A;  2GA4 B;  2AHO B;  2EY1 A;  4JK1 C;  1LT6 D;  4UP7 A;  3OW7 A;  4KV6 A;  3V05 A;  3SDZ A;  1YBY A;  2LS0 1;  2Z0S A;  3CPF A;  4KHV A;  1PH2 A;  1NCV A;  4BY7 B;  3E9H A;  4DR2 Q;  1EIF A;  2F1M A;  1E2Z A;  2A6E C;  4NPS A;  1K28 A;  2XN9 C;  2K01 A;  4DF7 A;  4DV3 Q;  3OIP A;  2R7Z G;  1QG7 A;  1X3G A;  1IW7 D;  5GAE C;  3I4M B;  1Q86 C;  4BBS B;  2D0P A;  3BZK A;  4EGV A;  4FXK C;  3JC6 6;  1L2F A;  1NJI C;  1Y8O B;  2DY7 A;  3S1N H;  4NB3 A;  2EJM A;  4DKA C;  4PMW A;  5FKA C;  4XQJ A;  4CDE C;  4F7X A;  3PO2 G;  3CCL A;  4NW2 A;  1I3Q B;  3OHX C;  4OIK A;  5EBC A;  1K3R A;  1X65 A;  2JEA I;  4A3K H;  4KY7 A;  5M3M B;  2A69 C;  1AE2 A;  1XPO A;  3HOX B;  3I55 A;  2NTS A;  3KF8 B;  3EFX D;  2F0J A;  1S5D D;  4MHE A;  4YY3 L;  1A62 A;  1Q90 A;  2KBN A;  2A1A A;  1QOH A;  2ZTC A;  5M9O A;  1VQA A;  2EDG A;  3FHW A;  3IFT A;  3Q8D A;  4DV5 L;  3IL8 A;  3RD4 A;  4BXX G;  3PQI A;  1BDO A;  1YNJ D;  2F3I A;  3HFZ B;  4DAY A;  5IT9 c;  1Q81 C;  1ICF B;  4KN7 C;  1V43 A;  1FNV A;  1LT4 D;  3OWF A;  4QY7 A;  3S1Q H;  4LF7 L;  4BY7 G;  1M1K C;  1PRT B;  1HZA A;  4K8J A;  4U67 3;  4DUY Q;  1PTO B;  1C0A A;  3I56 A;  2PW7 A;  3I4M G;  3W1G A;  5D65 A;  1FNU A;  5IGB A;  2LSS A;  2L5T A;  4K0K L;  3L9A X;  4CKC A;  4BBS G;  5JEA G;  4LWC A;  3KDF B;  5FJ8 H;  2JA7 H;  2MFI A;  3CCU A;  1LAB A;  2Q2H A;  2B2W A;  2XNA C;  2EYL A;  3BVZ A;  3CCS A;  5I9O A;  2YU9 B;  3GTL B;  2B2Y C;  2K52 A;  2E5L Q;  1UAP A;  2J7Z A;  5IT9 E;  1A0I A;  5IT9 L;  1G2S A;  5JJZ A;  2P5Z X;  2D62 A;  2JSO A;  5M3M G;  3GTM H;  1IBL L;  3HOX G;  1H95 A;  5IP9 H;  2KUM A;  4HR7 B;  3H94 A;  3RZD B;  1EY8 A;  1TWH H;  3GTJ B;  4A3L G;  1VF7 A;  3A74 A;  4DR7 L;  2YYZ A;  2KHJ A;  2H5X A;  2IW3 A;  2X6L A;  2XRQ D;  4JI6 Q;  5J39 A;  1RTN A;  3VYR A;  2UXD Q;  2XVS A;  4DV2 L;  4BY1 B;  3TN2 A;  4FF4 A;  1HR0 W;  1PVO A;  3CF5 A;  5CGK A;  1RKN A;  1CUK A;  1TWF B;  2V4D A;  4P73 A;  2HUG A;  2WP8 J;  3RZO B;  1HQR D;  3AU7 A;  4DR4 L;  2OQK A;  3I3C A;  4GN5 A;  1BF4 A;  2FJ2 A;  1YJ9 A;  1F2Y A;  4PG3 A;  4NXN Q;  1N33 L;  3E5S A;  3M4P A;  1VQ9 A;  2K5W A;  3CME A;  1WTV A;  2NVY H;  2MP1 A;  3GTQ B;  4L8J A;  2UUC L;  4LK1 C;  4GN4 B;  5DLQ E;  1BBW A;  4OIJ A;  4IFD H;  1Y8N B;  2Q2I A;  2XWB B;  3PF4 A;  3H6M A;  2WAQ B;  4ILW A;  4KN4 C;  2K50 A;  3B6Y A;  5KRU A;  3UDX A;  4DK6 C;  4ID6 A;  5BN3 A;  1JE5 A;  4DGZ A;  5FLX c;  2AWN A;  1ZKO A;  3PSI A;  4IUN A;  5CR3 A;  3VR5 A;  2F0I A;  4P74 A;  1CA6 A;  1JT8 A;  1V1P A;  2F0S A;  1OXS C;  4BY1 G;  4DR5 L;  1JJ2 A;  4B3S L;  3NEM A;  1JC7 A;  1R4P B;  2LKV A;  4TVA B;  3DWP A;  3WDN A;  5L37 A;  4DR6 L;  5M3F B;  3OOC A;  1ESR A;  2FMM A;  3RMH A;  3J7Z C;  2VUM G;  1MSG A;  4CBV A;  4QB4 A;  4LF7 Q;  4GKK L;  4H0L C;  3J7A F;  5IYB G;  1O80 A;  1ET6 A;  4K5X A;  1I94 L;  3GTG B;  2UXC L;  4IUT A;  5FLX E;  1E2V A;  5EKK A;  4DV4 L;  1ZEQ X;  1QVC A;  5FLX L;  2OCE A;  3DWQ A;  1HNZ Q;  4X62 L;  2K1B A;  1GUW A;  4ZK9 B;  1GD7 A;  4C1N K;  1VQM A;  5KYL A;  2O5J C;  4RWS C;  2EPB A;  2K5V A;  1NNX A;  1B44 D;  2G5D A;  1EQR A;  5BR8 Q;  1SE2 A;  1E3P A;  3A54 A;  3PGZ A;  3T4A C;  5C44 H;  3AFQ A;  4WFN 3;  3LNN A;  2AQ2 B;  3KF6 B;  4YCV A;  1W2B A;  2WAQ G;  3TP8 A;  2A8V A;  3F2U A;  4WJ3 M;  3BDC A;  5IIF A;  3RN5 A;  3PO2 H;  5G3L D;  1Z6H A;  2RSN A;  4LF4 Q;  3M9B A;  3VYS A;  1JQY D;  3KJP A;  4K2K A;  4KY5 A;  4N8X 1;  5KND A;  3E6Z X;  1Y1W B;  4AIM A;  5JJL A;  2KED A;  4JI5 Q;  4AYB E;  3A8J E;  2A5H A;  1SLJ A;  2PMZ B;  2YTY A;  5CV6 A;  5E3F A;  2IHF A;  1EZ6 A;  1X32 A;  1XNR L;  3IAY A;  2LY7 A;  3HKZ B;  2FIN B;  5M3F G;  4UP8 A;  2F0Q A;  1KTK A;  3TP7 A;  2MGS A;  1K3B C;  1V1Q A;  3GQB A;  1QUQ B;  3VDY A;  4BXX H;  1AN8 A;  1S4Z A;  1FGB D;  4A3E B;  4KHZ A;  3I70 A;  4K6D A;  5C5L A;  2G9D A;  3QO2 A;  3CCE A;  3KLW A;  1PRT F;  4LUV A;  1EU4 A;  4C56 C;  1KAW A;  1PTO F;  1CTM A;  1S5E D;  5CV7 A;  1F2Z A;  5T1I A;  4A3J B;  3C2P A;  3STB C;  1CHP D;  2A68 D;  4ZKC B;  3I4M H;  1ZYR C;  4XT3 B;  4IOA A;  4LFC L;  5A35 A;  2Z4H A;  1SDF A;  4BBS H;  2C9O A;  2KCC A;  5JEA H;  2DGY A;  2HHH Q;  4B3R Q;  1IL2 A;  5IGC A;  1A3V A;  1VQJ A;  5EKL A;  3P20 A;  4FYD A;  5BN5 A;  5C0X G;  2D0O A;  2C5C A;  3S1N B;  4A3C G;  2BOS A;  1K8O A;  4HIK A;  3PO3 B;  4X64 L;  2Z8L A;  2XWJ B;  4UY8 C;  3CQZ B;  3T13 A;  5GAD C;  3OTO L;  2CKZ B;  3I2Z A;  3HGB A;  4EX5 A;  3TBI B;  1BR9 A;  1BXT A;  1EQT A;  1EQV A;  5TSS A;  1VQP A;  1TQO A;  3HOX H;  4A3K B;  4E6I A;  1WOC A;  1Y1W G;  5J1Z A;  4XXE A;  3R2T A;  4DR3 Q;  3FMC A;  1STE A;  1SEB D;  4A3L H;  1XTD A;  3HKZ G;  1XTC D;  2Z6B A;  1FJG L;  1TVX A;  4XDX A;  2CH4 W;  4KLK A;  4A3E G;  2JA6 H;  2WFW A;  1HFN A;  1VQ6 A;  1Q7Y C;  1ENC A;  1ML0 D;  1SBB B;  3MFY A;  4CDF C;  2FXQ A;  5EPJ A;  2K04 A;  1SRU A;  3I73 A;  2IY5 B;  3A8K E;  1MD2 D;  4A3J G;  4IZ8 A;  5CYU A;  1PLF A;  2HQL A;  2F0T A;  3G7L A;  1ET9 A;  3TS2 A;  2ATW A;  1JR0 D;  4X62 Q;  1Q1B A;  1YNX A;  1WI5 A;  4B08 A;  3S17 H;  1TWA B;  2PO4 A;  4CKB A;  2X6G A;  1DGS A;  2OQ0 A;  3EQL C;  1J5E Q;  4YWK A;  3GTL H;  4HED A;  4JOI A;  1N32 L;  3J7A V;  5C3E B;  1PXU A;  4K6L A;  3PO3 G;  5EJW A;  1DD2 A;  3ND8 A;  4I65 A;  4KMU C;  3MXN A;  1BBU A;  1AH9 A;  3GD7 A;  2E2I B;  2F0E A;  4DV0 L;  1EL0 A;  1SMX A;  4DV6 Q;  1NMF A;  2RCN A;  2PQA A;  3MEH A;  2UUA Q;  5C5M A;  3OPO A;  4UAI A;  3TZU A;  4JV5 L;  3RZD H;  1WTQ A;  3GTJ H;  4CHT B;  1GUG A;  1Q8K A;  2EE1 A;  4NDX A;  3D6C A;  3MA2 B;  2E75 C;  2CCZ A;  3M4Y A;  5LHY 1;  1PH3 A;  1GUN A;  3U4Z A;  1LTB D;  2MUY A;  4BY1 H;  4IJH A;  4DK1 A;  2CHB D;  2E76 C;  2VQE Q;  1WTW A;  4XYQ A;  2IWH A;  3BS1 A;  2O4X A;  4RCN A;  1J9O A;  4Z9C B;  3MTS A;  3Q24 A;  1TKW B;  3RZO H;  2VUM H;  3W1B A;  1PH5 A;  3I4N B;  4TRD A;  5LL6 S;  4ABN A;  3UI2 A;  1EZ8 A;  4FF3 A;  5IYB H;  4JBW A;  3TME A;  1XPU A;  3A8I E;  4U68 A;  1M8A A;  1VQ7 A;  2I5H A;  4DR2 L;  1MIU A;  5J3B A;  1WTX A;  1XNQ Q;  3K81 C;  4DV3 L;  3AB9 A;  4QJF A;  5C3E G;  2JK8 A;  4JCV E;  1IBK Q;  4MNO A;  2NVY B;  4KJO A;  1JOK A;  2PPB C;  4LFA Q;  1PDQ A;  1Y1V B;  3MC0 B;  5JOB A;  4PMB A;  2NZ1 D;  1PFN A;  3TZD A;  5I9P A;  3GTP B;  2Y0S B;  3F1Z A;  2BE5 D;  4PZ8 A;  5IP9 G;  4PZ6 A;  1F77 A;  2NVT B;  3NWS A;  3T51 B;  3KJO A;  1YJN A;  1BO0 A;  1ROD A;  1NTG A;  3KF8 A;  5ELE A;  1K83 B;  3OYY A;  1LAC A;  3FP9 A;  2IJ0 A;  3C1E A;  2NVX H;  2K75 A;  1WTP A;  2H4O A;  1QZH A;  1CKN B;  3OWE B;  1I50 B;  2MPM A;  3G48 A;  1EFI D;  5M3F H;  2M9V A;  3A5U A;  2OTL A;  1RCV D;  2UU9 Q;  5AJ3 Q;  3AMU A;  3I4N G;  1TR5 A;  1QE6 A;  2GVA A;  2EYJ A;  5GAH C;  1GM5 A;  5LMU Q;  5A2Q E;  1SE8 A;  1SMY D;  2B2V C;  1PYW D;  4KD3 A;  2NN6 G;  3GP7 A;  5A2Q L;  2ENB A;  3R2I A;  4GOP C;  1H9K A;  1L0Y B;  3GTG H;  2HD3 A;  2N49 A;  4DUY L;  1WD0 A;  5KIX A;  1N36 Q;  1MJC A;  1JB3 A;  4R4I A;  3CAM A;  4M1U B;  1BVS A;  1VCI A;  3PIO A;  4RKL A;  2F0V A;  4DR1 Q;  3PUV A;  3KDF A;  5EGT A;  1Y1V G;  2IHE A;  3NTK A;  4C1N I;  1ENA A;  3F8T A;  5C44 B;  4S3S A;  1HTP A;  1IYJ B;  2E5L L;  2Y0S G;  3T56 B;  3TRE A;  4A3C H;  1HNW Q;  3AYH B;  4N9T A;  1EYC A;  4A3D G;  1CHQ D;  3U58 A;  2JA9 A;  1B70 B;  1HR0 Q;  2D9U A;  3A56 A;  1Y1W H;  1T5E A;  3DWA A;  1KNE A;  4IUP A;  2LXJ A;  4GNX B;  2EXZ A;  2BH8 A;  3VR6 A;  1PYS B;  5M5Y B; 
#chains in the Genus database with same CATH homology
 2KA7 A;  3HRZ C;  4LAA A;  5JEA J;  3Q22 A;  1NR2 A;  4KKS A;  1HA6 A;  4J8Q A;  4DXF A;  1VMP A;  5FO8 B;  1Z7T A;  2B8F A;  2PQE A;  1FYC A;  4UDU C;  3K5N A;  2E2H B;  2HQE A;  2TSS A;  4B9X A;  4C3I B;  1IYU A;  3U9S A;  4H13 C;  5I4D A;  4QIW B;  3VYT A;  3S2H B;  4K8I A;  5D14 A;  1VF5 C;  1NR4 A;  4OO1 G;  2SNM A;  2PZU A;  2B8G A;  1DON A;  1TS4 A;  4R9W A;  3ITP A;  1SYB A;  2B2T A;  4G7H C;  4ZUJ A;  3HOU B;  1M4V A;  2F0F A;  2DNE A;  4HMJ A;  2F4I A;  4QMG A;  1Q3L A;  3HZX A;  3M3Y B;  2F0M A;  2JA6 B;  4H44 C;  2EYM A;  1KLU D;  2RVL A;  2BA0 A;  4HSP A;  1CQV A;  5DEH A;  1T5X D;  3DHQ A;  5CV4 A;  4FF1 A;  2E74 C;  1PZJ D;  2MHV A;  3PMF A;  5COY A;  4C3I G;  1EY9 A;  4J6H A;  3S17 B;  2Q8T A;  2F0D A;  1RF2 D;  3LWU A;  5M5X B;  2BDN A;  3CKI B;  2KEE A;  3H3V C;  1CI3 M;  2BDO A;  4K5V A;  4ZYS A;  4PMC A;  5F2D A;  3C1F A;  3QOJ A;  5JAV A;  4M8A A;  3JAM E;  5CBE E;  4F8M A;  3JAM L;  4IQZ A;  2K05 A;  3TSS A;  1LV9 A;  1O7Z A;  4TKO B;  4A3M B;  1AZQ A;  1W6K A;  3BDO A;  2RA4 A;  1QIL A;  3QB3 A;  1JWU D;  4WOR A;  2HCC A;  1UEA B;  1PMR A;  2OXP A;  2SNS A;  3TDQ A;  1SNO A;  5I6Y A;  3J80 E;  4FF2 A;  1I4G A;  1BCP C;  1GUS A;  3J80 L;  3BDL A;  4IUU A;  2VUM B;  3SVM A;  2NN6 H;  3FVQ A;  3VR2 A;  1RD9 D;  3NSW A;  2N55 A;  2AWO A;  2EY2 A;  2PCF B;  4BA2 I;  1KDB A;  4PQX A;  5C4H A;  4IUR A;  1AFP A;  2CW0 D;  1B4O A;  2AUK A;  1IL8 A;  4DA2 A;  2B2Y A;  1IW7 C;  5E1F A;  3SEB A;  4EQN A;  1QNU A;  1U9R A;  4L6T B;  3MHB A;  1TY2 A;  5IGG A;  1EEF D;  1HHV A;  3PUW A;  2D5D A;  3K59 A;  5NUC A;  1I6V C;  4DAP A;  1BOS A;  4HMI A;  1JE4 A;  4L63 B;  1F9P A;  2NVX B;  1EYA A;  1I4R A;  3FKI B;  4FXG C;  3SK6 A;  3HOY B;  3V96 A;  2QDB A;  1JCK B;  5C0X J;  5C3W A;  2JYO A;  1H9S B;  1EWC A;  4R8N A;  1B2T A;  1NAP A;  1EWH A;  1I4H A;  4ME5 A;  1ZXT A;  1A6X A;  1SSO A;  2EYH A;  1YNJ C;  1F2L A;  4RA8 A;  2EYF A;  2I46 A;  1V8Q A;  5J22 A;  3X3M A;  3PUY A;  3MVV A;  2A6H D;  2NBF A;  2F0L A;  3WOE A;  4OO1 H;  3KUP A;  2L9H A;  1UNS A;  3M7G A;  2SDF A;  4NKL A;  5KNB A;  1RTO A;  1IYV A;  5BN4 A;  3N6R A;  4X3S A;  5D3I B;  2EYP A;  1SJH D;  5EPK A;  2EYO A;  2SOB A;  1MGS A;  1CA5 A;  4J1M A;  4BA1 I;  2F0O A;  1DM0 B;  1L0X B;  1PZI D;  4ZLT F;  1NSN S;  5HGT A;  5I6W A;  1STN A;  3D31 A;  3MXG A;  3Q23 A;  2NVQ B;  4A3I B;  1DOK A;  1IKL A;  2M00 A;  2RDF A;  2CQA A;  3A55 A;  5AFW A;  5I2X A;  4HSV A;  2D2C C;  5ELB A;  1JOO A;  5FOB B;  1PRT D;  1OXU A;  1PTO D;  3D3R A;  1BQQ T;  1SNP A;  1F9Q A;  4HN7 A;  4EQP A;  3R3O A;  1WVL A;  5JVH 3;  1KLG D;  3E0J A;  2DY8 A;  1GXD C;  2F0N A;  1KAB A;  4RGO S;  5EPL A;  3CU7 A;  4FO2 A;  1EY6 A;  5CBA E;  1KAA A;  2ZXO A;  2Z1C A;  3MXU A;  1BNZ A;  1SE3 A;  2N88 A;  3PIO 3;  4C3J B;  1B3A A;  3URY A;  4ZRZ A;  1GHK A;  1TWG B;  3D4W A;  3TP5 A;  1W6J A;  4RKB A;  3HG9 A;  1A2T A;  3HP3 A;  4V19 0;  2Z4I A;  2EY6 A;  1B50 A;  1BCP B;  1G8Z D;  2B39 A;  4A3B B;  2K6A A;  4B9W A;  1F2M A;  3K58 A;  1TY0 A;  3P1H A;  1II3 A;  1S5C D;  2QIL A;  4NP5 A;  4CGY B;  1KDA A;  4CJ2 C;  4XT1 B;  3ERO A;  2JP1 A;  4DAV A;  1U4L A;  3NUC A;  3N52 A;  4NMZ A;  2WKC A;  4OL7 A;  3LX0 A;  1D6E C;  4YIJ A;  4DXG A;  3OSO A;  2JA8 B;  4C3J G;  2F0K A;  4MIU A;  1SYE A;  2ZXR A;  1LTR D;  1G29 1;  1EOT A;  1CZW A;  2JE6 I;  3M7N A;  3M85 A;  1Z47 A;  1KNA A;  1A2U A;  2AQ1 B;  1CK1 A;  1H9J A;  4ZKB B;  1LTT D;  1HPC A;  5COR A;  4IFD J;  2EJG C;  1HA5 A;  3BVM A;  2F0G A;  3V2T A;  3DXJ C;  3SK5 A;  5C0X I;  4RGM A;  3MZ5 A;  1SFO B;  1SND A;  3H0G B;  2A6E D;  1D5M C;  1Q12 A;  1R9T B;  1U4R A;  3S9W A;  1ILP A;  3OIQ A;  2OF1 A;  1LT3 D;  2RKS A;  2A68 C;  3BYT B;  3BZD B;  1A3U A;  2VB2 X;  1EY4 A;  1PFB A;  2F0U A;  3K7A B;  3EA6 A;  1J8I A;  3HS0 C;  2QF7 A;  4QUC A;  2B2U C;  4A3D B;  1EIG A;  3U9O A;  2A69 D;  1AEX A;  3FDT A;  4ODG A;  5DAU A;  3NWT A;  3A7L A;  3GV3 A;  3G6J B;  3RUZ A;  2B63 B;  4HCS A;  4KTA A;  4X3T A;  1D1K A;  3S1M B;  3DUZ A;  3BYY B;  2Q8R E;  1EY0 A;  1U4P A;  3NQI A;  5T1G A;  2JXM B;  4O1N A;  2EZV A;  5M5W B;  1XWE A;  1UUP A;  1QJO A;  2X69 A;  1FD7 D;  3SK4 A;  1DXM A;  3M4O B;  3K5L A;  2IX1 A;  1HCZ A;  2O5I C;  1RDP D;  3TP6 A;  2L55 A;  3W3A A;  2R93 B;  5C4Z A;  4KY6 A;  3I72 A;  1QB5 D;  3L3O C;  2H1E A;  4RGT A;  1SJE D;  5KEE A;  3KK7 A;  2RDH A;  2B2U A;  1XXG A;  3VR3 A;  1DOL A;  1WTR A;  1O78 A;  2Q8I B;  4F87 A;  1JOR A;  2HDM A;  5EBD A;  5FO9 B;  3VA5 A;  1LTI D;  4RHR A;  2B2V A;  3C3L A;  1XYI A;  3ZYY X;  5DM6 3;  2RDG A;  1LTG D;  1PFM A;  2J4X A;  1OXV A;  2DN8 A;  1DJR D;  1MI2 A;  4C3H B;  3EJI A;  4QUF A;  5JPN C;  2EOT A;  4P2C B;  2R92 B;  2ZXP A;  4V0B A;  5K5P A;  4BBR B;  3Q0A A;  3S14 B;  3R8B A;  3W2D A;  4K2L A;  2OT2 A;  2B2W C;  5C4X B;  3I4L A;  1STG A;  4EVO A;  3HOW B;  3WOF A;  4TQU S;  4PNY A;  4WRD A;  2L1B A;  4Q5V A;  2IX0 A;  1LTA D;  4IAL A;  1WD1 A;  3GTK B;  2BE5 C;  1LLR D;  2NN6 I;  2JA5 B;  1U4M A;  1SYF A;  3H09 A;  5CV8 A;  3ONA B;  1B9N A;  3GO5 A;  3ERQ A;  3KLR A;  2FHT A;  5IGF A;  3S1R B;  2K5D A;  1H9S A;  3T53 B;  1E0B A;  1EU3 A;  2RSO A;  3HEJ A;  2WAC A;  4IFD I;  3NPP A;  5ELC A;  2K03 A;  1B53 A;  1HQM C;  1SXT A;  3GTO B;  4C3H G;  1G6Z A;  1SMY C;  2IL8 A;  4CJ1 B;  1C48 A;  2EY5 A;  1VDZ A;  1C4Q A;  4HAE A;  2PZW A;  3VYU A;  1V1O A;  4DU9 A;  2KHS A;  5CV5 A;  2K28 A;  4HTH A;  3NK9 A;  5JPM C;  4XQQ A;  4BS9 A;  1STA A;  1STY A;  1VMC A;  4R8I A;  1JOQ A;  1HTL D;  4FP5 D;  5ISR A;  1JWS D;  4KKU A;  4KK7 A;  1BBX C;  1HUN A;  3SR1 A;  1R4Q B;  1OXX K;  3K57 A;  2CVR A;  2NWG A;  4RHS A;  3T16 A;  1B1Z A;  3J7Y W;  2BCO A;  2RBM A;  2KQ3 A;  2NB0 A;  1GJX A;  5KNC A;  1CZG A;  2KCN A;  1ZYR D;  3H91 A;  3QG1 A;  4OO1 I;  5E4W C;  4RGN A;  5KGU A;  2ICE C;  3OMC A;  2PYK A;  1FR3 A;  5EQ0 A;  1EY5 A;  1ONL A;  4PV1 C;  1G2T A;  5E4X A;  4KJN A;  4XYO A;  4RCO A;  4Y7N B;  3SHL A;  1SNC A;  1D1I A;  4G7Z C;  2K33 A;  1JWM D;  4X3K A;  5I2Y A;  2NTT A;  3CRK C;  2QKI C;  2R6G A;  5CV9 A;  1RJT A;  2PW5 A;  5D3D A;  4X3U A;  4G7O C;  3D8G A;  3K6O A;  4RH6 A;  1C8C A;  2XRS D;  4I7Z C;  4ULL A;  1E2W A;  2EJF C;  1TII D;  1A15 A;  2VNU D;  1TS2 A;  1KDC A;  5ELD A;  2K7V A;  4DFA A;  1ESF A;  1BUV T;  3PUZ A;  5CC4 A;  3SE0 A;  5CMD A;  1OO9 B;  2PZT A;  3NBH A;  1TWC B;  1B9M A;  4WJW A;  1GUO A;  3FPU B;  2PNR C;  3S15 B;  4OHJ A;  2QCP X;  1Q1E A;  5JVG 3;  2LMC B;  3J81 E;  3RLF A;  3J81 L;  4A3F B;  2M2L A;  2WKD A;  3FPP A;  1HRJ A;  1F9R A;  5HUR A;  1CM9 A;  4IN3 A;  4N9P A;  1MBY A;  2F3V A;  2WIN B;  5G3L F;  2E2J B;  1OXT A;  2EVB A;  4F88 A;  1K8M A;  1JIC A;  3QJY A;  4FNF A;  1H9R A;  3S2D B;  1LTS D;  2KOL A;  2KEC A;  1O7L A;  3P75 A;  2BA1 A;  1NUC A;  3QIA A;  4RAU C;  1PZK D;  3ND9 A;  1SE4 A;  5C4J B;  1A3T A;  2FFK B;  2MJ8 A;  1STH A;  1DCZ A;  4LMQ D;  3VR4 A;  3MWY W;  2F03 A;  3KBG A;  1ICW A;  2OEO A;  4ZQ3 A;  1RHP A;  3VA7 A;  5KYI A;  1HXY D;  2CW0 C;  4BWG B;  1Y8P B;  1CQF A;  1SAP A;  1SNM A;  4MN3 A;  4CJ0 B;  2LFN A;  1TS3 A;  1EYD A;  3I90 A;  2K32 A;  3PV0 A;  4G57 A;  1IHZ A;  2F3W A;  1XX8 A;  3GV6 A;  2A74 C;  5EKI A;  4DNT B;  3I91 A;  1Y69 U;  1S5F D;  4IUQ A;  1Q8I A;  1YNN D;  3R93 A;  1H9M A;  3PUX A;  1EEI D;  4LJZ C;  1QWY A;  1V1P B;  4K5W A;  1QCB D;  1DZ1 A;  3SK8 A;  4H7B A;  5K36 G;  2L12 A;  1I4Q A;  1SYC A;  4DK0 A;  3O13 A;  1AZP A;  3HOV B;  3NTH A;  3NBI A;  1AP0 A;  2NYZ D;  1PTO H;  3S1Q B;  2JEB I;  3NHH A;  3HOZ B;  1D2B A;  4A93 B;  3S16 B;  1GHJ A;  1SNQ A;  4XIG S;  4ZUI A;  1DYQ A;  1S5B D;  4G4K A;  5DM7 3;  3OMG A;  1EIH A;  2FMC A;  2JA7 B;  1HUM A;  3KBX A;  1FNW A;  1IKM A;  3A7A B;  1F9S A;  2ID0 A;  2A6H C;  4KKT A;  4QCL A;  2XSC A;  4Q0F A;  2IT1 A;  3IFD A;  2E2D C;  3QWN A;  2RQX A;  4O42 A;  2VXW A;  3NQT A;  1CFM A;  4HCE A;  3GTM B;  5C3X A;  3NXW A;  2F0H A;  1LO5 D;  5IGD A;  4FXD A;  1TWH B;  2O2L D;  5FK9 C;  1HFG A;  5IGE A;  1I4P A;  2VB3 X;  1D5Z C;  2F0W A;  3D4R A;  1TT2 A;  2TMP A;  3KLS X;  2G9H D;  1I4X A;  1PRT C;  1PTO C;  4XTC S;  5IOD A;  5DNF A;  3L7Z C;  2AQ3 B;  3MAQ A;  2R61 A;  3X3N A;  3KLS A;  2IX3 A;  3SXH A;  2J0T D;  3EVQ A;  1X3P A;  3QOL A;  1O7Y A;  1ILQ A;  2WB1 B;  3MFG A;  4OGQ C;  3D4D A;  2WV6 D;  2AUJ D;  2SEB D;  3PIP 3;  3FEW X;  4ZAI A;  4CKE A;  3K0Y A;  3NP8 A;  3C46 A;  2XIW A;  3DM1 A;  2WII B;  2HDL A;  1CT1 D;  1WCM B;  2L11 A;  3I8Z A;  2L4N A;  2DNC A;  4KI0 A;  5LL6 X;  3K5M A;  3BG3 A;  2I07 B;  1STB A;  1QNK A;  2KJX A;  3FRP B;  4C2M B;  1YNN C;  2ZT9 C;  1DOM A;  1TU2 B;  2IPK D;  2KVM A;  3BVG A;  4AYB B;  2QEJ C;  3P7J A;  3NE5 B;  3K5O A;  1X3Q A;  1SYG A;  2HCI A;  3IKJ A;  3MXP A;  1I6H B;  1GOZ A;  4GZY C;  3LWE A;  2R7Z B;  2NUC A;  1LT5 D;  4DNR B;  3NTI A;  3CHB D;  4IFD G;  5IOC A;  4A3G B;  2ICI A;  3DEP A;  4IUV A;  2K5Q A;  5C0X H;  2A73 B;  1SYD A;  3Q6S A;  1D5X C;  1AW7 A;  1EY7 A;  4QF4 A;  1MSH A;  3DEO A;  3PO2 B;  1GUT A;  5ELF A;  2B2T C;  1BCP F;  1TS5 A;  3DMU A;  4EQO A;  4K14 A;  1ENF A;  4TSS A;  1BCP D;  5FO7 B;  5K36 H;  1G91 A;  2R3Z A;  4RFB A;  3D6W A;  2L0C A;  4XQN A;  1WTO A;  4FVM A;  3CRL C;  2F0P A;  5C6A A;  4DN4 M;  4KD4 A;  2GA4 B;  2EY1 A;  4JK1 C;  1LT6 D;  3OW7 A;  4KV6 A;  3V05 A;  3SDZ A;  2LS0 1;  4KHV A;  1NCV A;  4BY7 B;  2F1M A;  1E2Z A;  2A6E C;  2XN9 C;  2K01 A;  4DF7 A;  3OIP A;  1QG7 A;  1IW7 D;  3I4M B;  4BBS B;  4EGV A;  4FXK C;  1Y8O B;  2DY7 A;  2EJM A;  4PMW A;  5FKA C;  4XQJ A;  4F7X A;  4NW2 A;  1I3Q B;  3OHX C;  4OIK A;  5EBC A;  2JEA I;  4KY7 A;  5M3M B;  2A69 C;  3HOX B;  2NTS A;  3EFX D;  2F0J A;  1S5D D;  4MHE A;  1Q90 A;  1QOH A;  5M9O A;  2EDG A;  3IFT A;  3IL8 A;  3RD4 A;  1BDO A;  1YNJ D;  4DAY A;  4KN7 C;  1V43 A;  1FNV A;  1LT4 D;  3OWF A;  1PRT B;  4K8J A;  4U67 3;  1PTO B;  2PW7 A;  5D65 A;  1FNU A;  5IGB A;  2L5T A;  3L9A X;  4CKC A;  5JEA G;  1LAB A;  2B2W A;  2XNA C;  2EYL A;  3BVZ A;  5I9O A;  2YU9 B;  3GTL B;  2B2Y C;  1UAP A;  2J7Z A;  5IT9 E;  5IT9 L;  1G2S A;  5JJZ A;  2D62 A;  2JSO A;  2KUM A;  4HR7 B;  3H94 A;  3RZD B;  1EY8 A;  3GTJ B;  1VF7 A;  2YYZ A;  2IW3 A;  2X6L A;  2XRQ D;  5J39 A;  1RTN A;  3VYR A;  2XVS A;  4BY1 B;  3TN2 A;  4FF4 A;  5CGK A;  1RKN A;  1TWF B;  2V4D A;  2HUG A;  2WP8 J;  3RZO B;  1HQR D;  3AU7 A;  3I3C A;  1BF4 A;  2FJ2 A;  1F2Y A;  3E5S A;  2K5W A;  1WTV A;  3GTQ B;  2MP1 A;  4L8J A;  4LK1 C;  4OIJ A;  4IFD H;  1Y8N B;  2XWB B;  3H6M A;  2WAQ B;  4ILW A;  4KN4 C;  5KRU A;  4ID6 A;  5BN3 A;  4DGZ A;  2AWN A;  1ZKO A;  4IUN A;  5CR3 A;  3VR5 A;  2F0I A;  1CA6 A;  1V1P A;  2F0S A;  1OXS C;  1JC7 A;  1R4P B;  2LKV A;  3DWP A;  3WDN A;  5M3F B;  3OOC A;  1ESR A;  2FMM A;  3RMH A;  1MSG A;  4CBV A;  4QB4 A;  4H0L C;  3J7A F;  1O80 A;  1ET6 A;  4K5X A;  3GTG B;  4IUT A;  5FLX E;  1E2V A;  5EKK A;  1ZEQ X;  5FLX L;  3DWQ A;  2K1B A;  1GUW A;  4ZK9 B;  4C1N K;  5KYL A;  2O5J C;  4RWS C;  2EPB A;  1B44 D;  1SE2 A;  3A54 A;  3T4A C;  4WFN 3;  3LNN A;  2AQ2 B;  3TP8 A;  3F2U A;  3BDC A;  5IIF A;  5G3L D;  1Z6H A;  2RSN A;  3VYS A;  1JQY D;  4K2K A;  4KY5 A;  5KND A;  3E6Z X;  1Y1W B;  2KED A;  3A8J E;  2A5H A;  2PMZ B;  5CV6 A;  5E3F A;  1EZ6 A;  1X32 A;  3IAY A;  2LY7 A;  3HKZ B;  2FIN B;  2F0Q A;  1KTK A;  3TP7 A;  2MGS A;  3GQB A;  1AN8 A;  1S4Z A;  1FGB D;  4A3E B;  4KHZ A;  3I70 A;  4K6D A;  5C5L A;  2G9D A;  3QO2 A;  1PRT F;  1EU4 A;  4C56 C;  1PTO F;  1CTM A;  1S5E D;  5CV7 A;  1F2Z A;  5T1I A;  4A3J B;  3C2P A;  1CHP D;  2A68 D;  4ZKC B;  1ZYR C;  4XT3 B;  5A35 A;  2Z4H A;  1SDF A;  2C9O A;  2KCC A;  5JEA H;  5IGC A;  1A3V A;  5EKL A;  3P20 A;  4FYD A;  5BN5 A;  5C0X G;  2C5C A;  3S1N B;  2BOS A;  1K8O A;  3PO3 B;  2Z8L A;  2XWJ B;  3CQZ B;  3T13 A;  3HGB A;  3TBI B;  1BR9 A;  1BXT A;  1EQT A;  1EQV A;  5TSS A;  1TQO A;  4A3K B;  4E6I A;  5J1Z A;  4XXE A;  3R2T A;  3FMC A;  1STE A;  1SEB D;  1XTC D;  1TVX A;  4XDX A;  1HFN A;  1ENC A;  1ML0 D;  1SBB B;  3MFY A;  5EPJ A;  2K04 A;  3I73 A;  3A8K E;  1MD2 D;  4IZ8 A;  5CYU A;  1PLF A;  2F0T A;  3G7L A;  1ET9 A;  1JR0 D;  1Q1B A;  4B08 A;  1TWA B;  2PO4 A;  4CKB A;  2X6G A;  3EQL C;  4HED A;  3J7A V;  5C3E B;  1PXU A;  4K6L A;  5EJW A;  1DD2 A;  3ND8 A;  4I65 A;  4KMU C;  3MXN A;  3GD7 A;  2E2I B;  2F0E A;  1EL0 A;  3MEH A;  5C5M A;  3OPO A;  4UAI A;  3TZU A;  1WTQ A;  4CHT B;  1GUG A;  2EE1 A;  4NDX A;  3D6C A;  3MA2 B;  2E75 C;  3M4Y A;  5LHY 1;  1GUN A;  1LTB D;  2MUY A;  4DK1 A;  2CHB D;  2E76 C;  1WTW A;  4XYQ A;  2IWH A;  3BS1 A;  2O4X A;  4RCN A;  1J9O A;  4Z9C B;  3MTS A;  3Q24 A;  1TKW B;  3I4N B;  4TRD A;  5LL6 S;  4ABN A;  3UI2 A;  1EZ8 A;  4FF3 A;  4JBW A;  3TME A;  3A8I E;  4U68 A;  1M8A A;  1WTX A;  3AB9 A;  2NVY B;  4KJO A;  1JOK A;  2PPB C;  1PDQ A;  1Y1V B;  3MC0 B;  5JOB A;  4PMB A;  2NZ1 D;  1PFN A;  3TZD A;  5I9P A;  3GTP B;  2Y0S B;  2BE5 D;  1F77 A;  2NVT B;  3NWS A;  3T51 B;  1BO0 A;  1ROD A;  3KF8 A;  5ELE A;  1K83 B;  1LAC A;  2IJ0 A;  3C1E A;  1WTP A;  2H4O A;  3OWE B;  1I50 B;  2MPM A;  1EFI D;  2M9V A;  1RCV D;  3AMU A;  1TR5 A;  1QE6 A;  2EYJ A;  5A2Q E;  1SMY D;  2B2V C;  1PYW D;  4KD3 A;  2NN6 G;  3GP7 A;  5A2Q L;  2ENB A;  3R2I A;  1H9K A;  1L0Y B;  1WD0 A;  5KIX A;  1JB3 A;  4M1U B;  1VCI A;  4RKL A;  2F0V A;  3PUV A;  5EGT A;  3NTK A;  4C1N I;  1ENA A;  5C44 B;  4S3S A;  1HTP A;  3T56 B;  4N9T A;  1EYC A;  1CHQ D;  2D9U A;  3A56 A;  1T5E A;  3DWA A;  1KNE A;  4IUP A;  2EXZ A;  3VR6 A;  5M5Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...