3BDCA

Crystal structure of staphylococcal nuclease variant delta+phs at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Molecular determinants of the pK(a) values of Asp and Glu residues in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bdcA00
4E6IA 5CV9A 2ENBA 4PMBA 5KRUA 2EY1A 3MEHA 2F0DA 1EY7A 2F0HA 1SYFA 2WACA 3C1FA 4HMJA 4N9PA 5CV4A 5C6AA 1SNCA 4I65A 4K2LA 5E1FA 5EGTA 5IGBA 5J1ZA 2F0KA 1SNMA 3SK6A 3T13A 1SYGA 1A3UA 1IHZA 1SYBA 1SYDA 5KYIA 1A2TA 4WORA 1STGA 4ZUJA 1JOQA 2F0UA 5J22A 2PW5A 4J6HA 2F0MA 5M9OA 3TP8A 2F0VA 3QOJA 5C3WA 2PYKA 3DMUA 4K8JA 2F0JA 2PZWA 3D4DA 1F2ZA 1EY6A 1II3A 2EYOA 2LKVA 5ISRA 5C5LA 1EYAA 3BDLA 1SYEA 1EYDA 4ID6A 3D8GA 4NMZA 3V2TA 4F8MA 3D6CA 4NP5A 3SR1A 5I9OA 5KYLA 3NP8A 4EQNA 4KHVA 2HQEA 4YIJA 1A2UA 3VA5A 5I6YA 4H7BA 4KY5A 4IZ8A 4DF7A 5KIXA 2SNMA 4IALA 5CV6A 2EYJA 5JAVA 2F0LA 1KDAA 2M00A 1ENCA 2QDBA 1EY9A 5HURA 4RKLA 2PZUA 3T16A 2EYHA 4J1MA 2EYPA 4B9XA 2F0OA 3P75A 1A3VA 4OL7A 4F7XA 4DU9A 5KGUA 2EY2A 1A3TA 1EY5A 4KJNA 3TP6A 5I6WA 1TQOA 3QOLA 3DHQA 3RUZA 3HZXA 2F3VA 3MXPA 5IOCA 3OWFA 2EYLA 3PMFA 3E5SA 2OXPA 3U9OA 5K5PA 2EY5A 3ITPA 4KD3A 1STNA 2F0SA 1EY0A 2EYMA 2O4XA 5CV7A 3SXHA 1STHA 2F0WA 4QMGA 1F2YA 5HGTA 5J39A 3ERQA 3OSOA 5CR3A 1KDCA 3SHLA 3HEJA 2F0IA 4TRDA 2OF1A 5EKLA 2KQ3A 4IUNA 4ZUIA 1EYCA 3TP5A 5I9PA 5IGDA 1EZ8A 4K8IA 4KY7A 1STBA 1SNDA 4EVOA 2RKSA 3TMEA 5IGGA 2F0EA 2RBMA 4K5VA 4WRDA 3TP7A 5C4ZA 3NQTA 3NHHA 2KHSA 1NSNS 5E3FA 4KTAA 2PQEA 1EY8A 1F2MA 3H6MA 4K5XA 5CV8A 1AEXA 4ZQ3A 4DGZA 4EQPA 5KEEA 2NUCA 1SNOA 4KD4A 3OMCA 3QB3A 5DEHA 3S9WA 4LAAA 1RKNA 1JOKA 4RKBA 5IODA 4HTHA 1STAA 1EQVA 1SNPA 2EY6A 2F0NA 3MZ5A 4QB4A 3SK8A 3OMGA 2SOBA 4ODGA 5IGEA 1JORA 1KAAA 3BDCA 3EVQA 5DAUA 1STYA 5NUCA 1KABA 4B9WA 1JOOA 2PZTA 2EXZA 4KV6A 2EYFA 3C1EA 3EROA 1U9RA 4ME5A 2F0QA 3MHBA 4S3SA 2F3WA 2RDFA 3LX0A 2PW7A 1KDBA 4K14A 3SK5A 5CGKA 4EQOA 2SNSA 4HMIA 2OEOA 2F0FA 1ENAA 1SYCA 3NK9A 3NXWA 4K6DA 4N9TA 1TR5A 4K5WA 5CV5A 4DFAA 5IIFA 1SNQA 4KY6A 3R3OA 5IGCA 5F2DA 4G57A 5JOBA 3P1HA 5IGFA 2F0PA 5CC4A 1NUCA 1EY4A 5C4HA 3D4WA 5C5MA 5C3XA 5EKKA 3NUCA 4PMCA 4MIUA 3EJIA 4KJOA 3MVVA 4K2KA 4NKLA 4R8NA 3SK4A 4NDXA 4QF4A 2F0TA 1TT2A 4PNYA 2F0GA 1EZ6A
chains in the Genus database with same CATH superfamily
4DUZL 2ENBA 4UY8C 3H3VC 2Q2IA 3NBHA 5T1GA 5J1ZA 1EFWA 2HDMA 1HR0Q 3V96A 1YHQA 2XWJB 1PH9A 3HOVH 4LJZC 3FEWX 2L55A 2JA9A 5E7NA 1SSOA 3RMHA 1G91A 1C48A 3NELA 3FKIB 3RN5A 1HH2P 1EY6A 4OX9L 4DV0Q 1D5XC 4NB3A 5C4XB 1P8LA 3T51B 3I70A 4HIKA 5IT9c 1H9JA 2WAQG 4RGNA 1F77A 1LTBD 3VA7A 1XMOL 4YCWA 5FOBB 1EFID 3E0JA 1O7ZA 1SMXA 3F1ZA 3NTHA 4RKLA 4ZYSA 2M2LA 4Y7NB 1LTAD 4MNOA 2EIFA 2F3VA 3G7LA 1FNUA 3Q6SA 5LMUL 5BN3A 2KJXA 2CWAA 1CZGA 2NZ1D 1B70B 2F0WA 3HOXH 4DKAC 1SMYD 2JA6H 2K05A 3VR6A 2KQ3A 2B63G 2FJ2A 1IYVA 2V4DA 2EJMA 1VQCA 2B2YA 2RVLA 3Q23A 4CJ2C 2QW7A 1I6HB 4DV5Q 4YWKA 1HNWQ 3T56B 1D1KA 1PRTF 5FLXc 3SK8A 1X3GA 5K36H 1STYA 4FP5D 2MUYA 3NWSA 1CFMA 1PH4A 1JOOA 1HNZL 2FXQA 2K14A 5CBAE 1Y1VG 1S5ED 2F52A 1FJGQ 3GD7A 2NN6G 3TRZA 4DUYQ 2RSOA 2E2IH 4C3IG 2A74C 3MXNB 5GADC 1WCMH 1U4LA 2VB2X 1OXTA 2JN4A 2K04A 1I5FA 4B3MQ 4MZ9A 1PV4A 2Z8LA 1YI2A 4BS9A 3GTPH 2GVAA 3E0EA 3WOEA 4KN7C 3OHXC 1M1KC 2I07B 1JB3A 4LF5L 1X3QA 3K5MA 1HJPA 4POGA 5IYBG 3BG3A 1SYBA 3D4RA 3NSWA 4FF3A 2ZTEA 1SDFA 4BY7G 2BE5D 5E4WC 3KF8B 4XTCS 2VQEQ 1WTPA 1B9NA 1M8AA 3GTGH 5KNCA 3D4DA 2R6GA 5FO9B 2B8FA 4WJWA 1EYDA 2UXCL 1CKNB 3I4OA 3KLSA 4HCSA 2CKZB 3PO3G 4IZ8A 2A6ED 5KIXA 2ZM6Q 1CQVA 1FVIA 2HQLA 2EYJA 5LHY1 1WD1A 4DR6L 1JJGA 1EY9A 2RDGA 4EGVA 3T1YQ 2RF4A 4A3BG 1HRJA 4G7OC 2CQAA 3H3VH 1KLUD 4LMQD 1PH8A 1TQOA 3QOLA 2NZHA 3CC4A 4BWGB 1GUOA 3CP0A 3S17H 4A93H 3D3RA 2CQOA 1EIGA 3HEJA 1GKHA 1E24A 1LLRD 1TWFB 3TS2A 3T1HQ 1MKHA 2RBMA 1C0AA 2AWNA 2B2VC 2L12A 3WOFA 2XSCA 1BBWA 2A68D 2JA5G 2E76C 3A56A 3S15B 3J81E 4UP8A 1SFOH 1AZQA 3S2DB 3QB3A 1ZKOA 4A3DH 4LFBL 5M5XB 1STAA 3H0GH 3JAML 4R8IA 2TMPA 4GN4B 1X56A 1B9MA 4JYAL 1L0XB 1YJ9A 4LFAQ 4F87A 1KNEA 2NVYH 1LTRD 1LTLA 2Z4HA 4HSVA 4KLKA 1Y1WG 4CKEA 2SNSA 3F8TA 2OEOA 3K6OA 4IFDJ 2BH2A 2FMMA 3HOZG 3IFTA 4G57A 5IYCG 2UU9L 3DWQA 3PUYA 5M5YH 4FNFA 4AH6A 3EJIA 2K28A 5IYDH 4A3MB 2N49A 3IRBA 1Q81C 2UUAL 3NQIA 2F0GA 1QVFA 4IFDI 2A8VA 5IP7G 1XPOA 2QKIC 1SYFA 2WACA 5AJ3L 2Z0SA 4NW2A 3SK6A 5IGBA 1BO0A 3J80c 2Y0SE 1JMCA 1F9QA 4QJFA 3K7AH 1D2BA 3CQZH 4FDBA 2K33A 2F3IA 2TSSA 1II3A 3QG1A 3HKZB 4A3IB 4A3CH 4DR5Q 1KRSA 5G3LF 2UUBL 2IHFA 1GUWA 1JWSD 3VA5A 2YTYA 3L2PA 2O5IC 1HFNA 5AFWA 4B9XA 2N55A 3S1MB 1I50H 3C46A 4OO1I 4KJNA 3E9HA 3DHQA 3K0XA 3KBXA 2GN5A 3FDTA 3KF8A 3STBC 1JC7A 3OWFA 4RWSC 1LT3D 2K1BA 2A19A 2BCOA 3SXHA 1M4VA 1O7YA 3Q0AA 5J39A 3M4OH 2YU9B 3LNNA 3DEOA 4CDFC 1CKNA 4CJ0B 2K6AA 1EZ8A 3I56A 2B2YC 2ALYB 4UP7A 2PQEA 4N8X1 2JA7B 3FPPA 5KEEA 1HHVA 1SNOA 1VQEA 1K73C 3KBGA 3GTKB 3J7A5 2AMCB 2LXJA 2LXKA 3G6EA 4DR1L 3S2HB 3S16H 1JORA 1Q1EA 3ICEA 3OTOL 2NVXB 5EAYA 1SRUA 1EQTA 1TWHB 1VQHA 4V190 2A6HC 4ZRZA 4POFA 1CZWA 4DV4Q 1QUQB 3AB9A 4K6DA 1ET6A 1I4PA 2Z1CA 4K5WA 4QIWB 1I3QH 2AUKA 1KIXA 2NTSA 1DD2A 3R3OA 3CCLA 4OIKA 5JVG3 4JI6L 1CKOA 4EQ5A 4R1JA 1EOTA 1GD7A 4R8NA 3SK4A 1F9SA 4DN4M 3BDOA 2EVBA 4AQYQ 3KF6A 1HQRD 1KQSA 3I73A 1Q7YC 2EY1A 2PI2A 2PNHA 3MEHA 1LTID 4F88A 4WFN3 1WFQA 3MEFA 1VQFA 4M8AA 5DLQE 1CQFA 4GLVB 2ZXPA 3I4NB 3W1GA 2L15A 1AN8A 3I7FA 2IHEA 4J6HA 2IX0A 1RDPD 1VQ7A 1PXUA 2D0PA 3QOJA 5M5WH 1Q82C 2F0JA 4LF7Q 3T53B 2R92B 1F2ZA 2RCFA 4YY3Q 3SVMA 1VS0A 5ISRA 2WB1B 3BDLA 1HA6A 3V2TA 4H44C 1UEBA 4EQNA 4XQNA 1TS2A 4C3HH 3PUWA 3K5OA 1KDAA 1SE2A 5HURA 2IPKD 4RCOA 3K59A 1TWGH 2ID0A 4A93G 4OL7A 1H9SB 1YJWA 3GTQH 3TP6A 1HNXQ 1IZ6A 1L1OA 3DM1A 4C2MB 5T1IA 4RGMA 4B3SQ 2JJQA 4OWXB 3ERSX 1N34L 2OXPA 2HD3A 5IT9L 4QGUA 5EBDA 1S5BD 1Q1BA 3C3LA 2F0IA 3I4MB 2OT2A 3P20A 5EKLA 3IAYA 1UAPA 3CCVA 2F03A 1LV9A 2B29A 1WTOA 3PSIA 2VQFQ 4L6TB 1UEAB 2R7ZB 1QJOA 2SEBD 4A76A 2PQAB 4KHZA 5E3FA 1HTPA 2D0OA 4UDUC 3H0GG 4K5XA 3FVQA 2NUCA 4HJ5A 4LAAA 1MSGA 2OQKA 3PF4A 3HS0C 2ICIA 1SNPA 3HG9A 3PIOA 3HOWG 4X6AH 2ZXOA 1PZJD 1K83B 1HXYD 3J7YW 2FFKB 4J15A 3PO2B 3MTSA 3E9IA 2K5NA 5C44B 4GS3A 1KD1C 4DR4Q 1JE4A 3SDZA 2HIXA 3UDFA 2RDFA 3EIVA 4HSPA 3HOUG 3LX0A 4K14A 3PQIA 1ENAA 5JEAG 4A3FB 4OIJA 2LS01 1SEBD 3J7AV 2RHSB 5C3EH 2R3ZA 1E22A 1UNSA 5M3MG 5EKKA 1X3EA 5BR8Q 5M3FG 2F0TA 3KDFA 2KEDA 1KL9A 1BR9A 3KLRA 4I7AA 3JAME 4RGOS 1NR4A 3H91A 3GTOB 1KNAA 3VYRA 4I65A 3NBHB 1NMGA 4K2LA 1Z6HA 4OONA 3BYTB 3RLFA 4FF2A 4XYOA 4JBKA 3OIPA 1TS3A 5IWAL 5FLMG 4JCVE 2PW5A 3I3CA 4RAUC 5J22A 3TP8A 4LNQA 2PZWA 3MC0B 2UUCL 1CA6A 1E1OA 1KLGD 4X66Q 4NMZA 5EKIA 3J7AF 1Z47A 5I9OA 3PIP3 1D6EC 3Q24A 4A3LG 2VUMG 4K0KQ 4L5SA 3ULPA 1Q90A 4DK6C 3QJYA 1GXDC 2NVTB 1OTCA 3RR5A 4DR7Q 4DXFA 4AYBE 1BVSA 4YHHL 1PA6A 2EE1A 5CC4A 1LUZA 3CU7A 2F0OA 3L3OC 4R9WA 3ONAB 1IW7D 1EY5A 2K03A 3RD4A 2K01A 2WAQB 3AQQA 1G6ZA 3H3VI 2K5QA 5IP9H 3CPWA 2KHIA 2EYMA 4DR2L 3GTLH 4Z9CB 3VR3A 1F2YA 3NTKA 5GAGC 4HAEA 4MTNA 2JA8H 4ZAIA 2CCZA 5I9PA 1EYCA 2QF7A 1PH6A 1IBLL 3D31A 1Y8OB 4R4TA 3IL8A 4OO1H 4KTAA 4DGZA 2N88A 4A3JG 1SJED 2I5HA 4PV1C 4P2CB 5EBCA 3KJOA 5HGQA 1H9SA 1I4HA 3PV0A 1L0YB 1ML0D 3GDEA 2B63B 5NUCA 5DAUA 1YNND 2LSSA 3FRPB 4U673 2MP1A 3DXJC 4CKBA 3GTJB 1VQ4A 4ME5A 2R93G 4YCUA 1EU4A 2PCFB 4JI8L 2HT1A 3S1NB 3FKIH 4KHPL 4IPDA 5ELBA 5D3DA 3HRZC 3M3YB 2PQAA 5C4XH 1YITA 3HFZB 2G5DA 2YYZA 5FJ8H 4P71A 1CA5A 1VF7A 1UE5A 3RZDB 1Y1VB 4A3EB 3EFXD 3A55A 1LTGD 2I46A 3HGBA 2IJ0A 4LUZA 2Y0SG 4C3IB 4DNIA 2ASBA 4Y7NH 4X64L 4Q5VA 1WTQA 2F0DA 5CORA 4I7ZC 3SE0A 2LMCB 1Z7TA 1SNMA 1A3UA 4K6LA 1HA5A 5KYIA 2MO0A 4HIMA 2Q2TA 4NXMQ 3SEBA 1R4PB 2UXBL 1ZYRC 4LF8Q 5GQOA 1G291 4DR3Q 1GHKA 4JI1L 3V05A 5C5LA 1I6HH 1A62A 1FGUA 3D8GA 3CC7A 1XNQQ 4YIJA 2WIIB 4M1UB 1PH3A 4BY7B 3I72A 3S1RB 2A69D 4DV6L 3QO2A 4NPSA 1XNRL 1XJVA 5C0XJ 1G6PA 4A3KH 3D6WA 3A8IE 4XDXA 1L1OC 3HZXA 2WKDA 2BH8A 2M9VA 3PMFA 2IT1A 5LMNQ 3PO3B 1TKWB 5KGUA 4G7HC 1EY0A 1DYQA 5HGTA 1GUTA 2G9HD 4WJ3M 1O7IA 4JI7Q 1QCBD 2BOSA 1MSHA 2RA4A 1PTOD 4A3BB 1CSQA 4UP9A 1ICWA 1WD0A 3CCRA 5C0XI 2UXDQ 1FGBD 2CW0D 3FPUB 4X62Q 4BXXG 4ZQ3A 1RODA 1AEXA 4JI4Q 4ULLA 3OMCA 1KAWA 3WWVA 1XPUA 2B2WA 1D1IA 2DY7A 2SOBA 4DAYA 1TU2B 3B6YA 4B9WA 2YTXA 4RCNA 1I4XA 3C1EA 4RH6A 3K58A 1QB5D 2JA5B 1S72A 5BN5A 4TKOB 4S3SA 4DNRB 4DAVA 5IT9E 1V1PA 5J3BA 1Q46A 4EQOA 1E3PA 3QR8A 2CWPA 2EQSA 3NEMA 4C3JG 3H94A 1S3OA 2IX3A 5C5MA 1A6XA 2CHBD 1CHPD 1PFNA 1LTTD 1B7YB 2KCMA 3M9BA 1Y1WB 5D14A 1V1OA 1I94Q 3I55A 1PH5A 2IWHA 3HOZB 2VS1A 4FXKC 4PG3A 1BCPD 2K7VA 1BBXC 1TS5A 3EQLC 3BVZA 1H9RA 5GROA 1DZ1A 3RN2A 1RTOA 4O0AA 2F0UA 3NBIA 4IFDG 1GOZA 3MFYA 3BZKA 5JPNC 1TWFH 1AH9A 3DMUA 4K8JA 1E0BA 3OW7A 2PMZE 4ID6A 4DUZQ 3S15H 1BKBA 2KCCA 3LWEA 3OYYA 1Y8NB 5KYLA 1QVGA 3S2DH 2F4IA 1WTRA 1DGSA 2MQHA 3ND8A 1B50A 5M5XH 2A5HA 2C35B 4DA2A 4JK1C 1XMQQ 1TWAB 5JJLA 2M00A 2XTIA 4BY1G 3RZOB 4P73A 3R93A 3P75A 1CUKA 2Q2HA 2D2CC 4N8FA 1F9RA 4C56C 1JJCB 1B8AA 5C4JB 3E5SA 4OX9Q 1SROA 2F0SA 2E8GA 4ZKBB 4IURA 3VYTA 3ERQA 1ZXTA 4DV1L 2E2JB 2JQOA 1XMOQ 3J7ZC 1JCKB 1VQMA 1SNDA 1LT6D 2CH4A 1NCVA 3H15A 1I6VC 4DV7L 1VQDA 2KOLA 3HOYG 4HIOA 1XWEA 4RMFA 3L9AX 3EVQA 3TEHB 1KABA 2WP8J 1CM9A 1HZCA 2QGQA 4X65Q 3U50C 4A3GG 4Q0FA 1EQQA 2NBFA 4CDDC 4AIMA 2L0CA 3ZJYC 3TBIB 1XXGA 4DFAA 4Y52H 2D5DA 4A3IH 2FHTA 3UDGA 4J8QA 3MAQA 4CBVA 4BBRG 2DNCA 4DNTB 1X9NA 1C4QA 1YNJD 4NDXA 1LM0A 4X3SA 3S1MH 3OMGA 5DNFA 3KF6B 1CHQD 1SE8A 4BBSG 2HIVA 2CFMA 1J5EL 1BF4A 1SAPA 1AE2A 4O1NA 3MXUA 1Y14B 3GV3A 1SYGA 1NNXA 2YU9H 1IYJB 5COYA 1I4RA 1SMYC 1PLFA 1WVLA 1QOHA 3FMCA 3VR2A 2XGTA 5C3WA 4YWLA 4B08A 4AYBG 4O42A 1B1ZA 1O7LA 4KKSA 4XQJA 2VZAA 3TS0A 1W2BA 3GQBA 3PUVA 3PCOB 1EYAA 4F8MA 4GNXA 3D6CA 1NY4A 4LF5Q 1V9PA 3GTKH 2QEJC 4H7BA 1DOMA 4KY5A 4H13C 2JXMB 3S2HH 5JAVA 1ZEQX 2D62A 4A3KG 1EWHA 3HOVG 4GKKL 3H09A 2EYPA 2NVXH 2YV5A 4JI2L 1A3TA 1VQKA 1L1OB 1PYBA 2NN6I 1RTNA 4FYDA 3W5OA 4FXDA 1GO3E 2HHHL 3F2CA 1ET9A 4KKTA 4UPAA 1MJEA 2UXCQ 1C8CA 3DUZA 1YBYA 4DV3L 3CCMA 3TP5A 4JV5Q 2KENA 2B8GA 4A93B 1KHIA 5DM73 1K28A 1K8MA 3NQTA 4DR6Q 4NXNL 5JJZA 1PDQA 3A8JE 4JW0A 4LK1C 2F0NA 2B2WC 3HOXG 1ICFB 2JA6G 1WJJA 4KMUC 2F1MA 3I4NH 1A0IA 1U9RA 1T5XD 2BE5C 3VR5A 4JI3Q 3H0GB 5C0XH 1IXRA 1ILPA 2VB3X 4WJ4A 4LFCL 1CKMA 1HFGA 1KDBA 2R92H 2B39A 1PFBA 4N9TA 4KY6A 3HOWB 4LFBQ 2E5LL 1VQAA 2Q2UA 5K36G 1NUCA 5D65A 4LF4L 1FL0A 2A6EC 2KBNA 3NE5B 3LWUA 4LUOA 3HOUB 5BN4A 3KDFB 1IBML 4LF6L 1S5DD 3J80i 1QG7A 4FVMA 1K8OA 1E1TA 1WCMG 4PMBA 3RNUA 4XYQA 4N9PA 4C2MH 3C2PA 2E2DC 3S1QB 2PO4A 1A2TA 5M3MB 3T4AC 3F2DA 3I4MH 1JOQA 1NTGA 1CTMA 2DNEA 5M3FB 4GKJL 1MD2D 1EU3A 1QILA 2R7ZH 3VDYA 1BOSA 1C9OA 2A68C 3U4VA 1SYEA 1O78A 4PQXA 2R7FA 1F9PA 2XVSA 3GP7A 3GTMB 5CMDA 4FXGC 3FP9A 1N33L 1N32L 4LF9Q 1K83H 1HCZA 3PO2H 1AZPA 5C44H 2N3SA 2NYZD 2H4OA 2WINB 1PFMA 1D5MC 2E74C 5E4XA 5G3LD 3UDXA 2PPBC 1VQBA 1YJNA 1Q8IA 2VL6A 2VUMB 2D9UA 1K3BC 3PUZA 3K57A 2XRSD 2UUBQ 2NVQB 4A3FH 4IUNA 3QIAA 4QUCA 3MWYW 4K5VA 2EPBA 1K0SA 2AUJD 3SGIA 1RD9D 2E2HB 3I4LA 2GVBA 3F2BA 2B2TA 1UE6A 5ELNA 1BNZA 1E2WA 3GTOH 1W3SA 4BA2I 1N8RC 1K9MC 1YNXA 2Q8IB 3EROA 2MPMA 3L0OA 4A3JB 2L9HA 4A3IG 5JJKA 1SXTA 1FD7D 3SK5A 1HZBA 4HMIA 4A3DG 3VR4A 1UWVA 5IE8A 1VQLA 1SNQA 1PTOB 4PZ7A 1EEID 5F2DA 5JOBA 4DR1Q 1AW7A 1EY4A 3CHBD 2R93B 2HCCA 1I3QB 3MVVA 1EQRA 2NB0A 3OTOQ 2MFIA 2NVTH 1DOLA 3TQYA 1HPCA 1WYDA 4P75A 1E2ZA 1JJ2A 3KYHC 4MTKA 3TN2A 1X54A 3J81j 4KN4C 1U5KA 5FLXL 1N36L 4JI6Q 2Y0SB 5IYDG 1X3FA 3JAMc 1VQPA 4R4QA 4GNXC 1C7YA 1MJCA 1V43A 5I6YA 4DV2L 1HUNA 4JI0Q 4QCLA 2B63H 5GAHC 1JQYD 3S14B 1ENCA 1GUNA 4ZLTF 2PZUA 3T16A 2DGYA 2J0TD 4B3RL 3GTJH 3R2TA 4A3CG 1SR3A 3MXPA 3IFDA 2EYLA 3ITPA 3S1NH 3M3YH 2RHQB 1Q86C 3OWEB 5LL6X 3OW2A 2AHOB 3RZDH 2K5VA 2F0EA 3NWTA 1R9TB 2FINB 1Y1VH 4A3EH 1I4QA 2KUMA 4XT3B 4X3TA 1EOVA 3H6MA 2NN6H 1Y8PB 4BA1I 1UUPA 3E6ZX 4CKCA 1WTVA 3K5LA 4C3IH 2DN8A 4RKBA 2FMCA 2K4KA 4HTHA 4DK3C 1N34Q 1G8ZD 1V1QA 4DAYB 4LF8L 2RQXA 3K81C 4GOPA 2R61A 4V0BA 5C0XG 1TXYA 4A75A 1IBKL 3CXCA 5GAEC 1Q8KA 1EYGA 1XNQL 1STEA 3A5ZB 3ER0A 3TZDA 4QY7A 4HJ8A 1V1PB 4JBJA 1X55A 2DJGC 1RJTA 1OXVA 4HN7A 1S40A 4FF1A 1HR0L 3K0YA 2OQ0A 5IYBH 2HUGA 1PZID 2Q8RE 5C4HA 3D4WA 4BY7H 1N9WA 2N8NA 1H95A 5ELOA 3CCJA 4KJOA 3S1RH 1T5EA 4DV0L 1VQ9A 3IKJA 3AEVA 4PNYA 2AQ3B 1RHPA 1YEZA 1M90C 3ND9A 4DAMA 3PUXA 5KRUA 3R2IA 4C3JB 4HMJA 4GLAC 1QNUA 4C1NK 3WDNA 5EGTA 4DK0A 3PO3H 4X62L 1PTOF 1STGA 2QEXA 4ZUJA 4QUFA 3BU2A 1VMPA 2EXDA 2F0MA 4A3BH 3LGJA 2JE6I 1VF5C 3A7AB 1YHBA 2IX1A 2KECA 4XXEA 2MGSA 4G4KA 1TWCB 4ZKCB 2VXWA 4KHVA 1NAPA 1JR0D 3ULLA 4IJLA 1PYSB 1PFSA 2AQ1B 5IWAQ 1JWUD 4DV5L 4DU9A 2MNAA 1EL0A 1DCZA 1HNWL 2QILA 2K52A 5CYUA 2UUCQ 1X6OA 4IJHA 1Q3LA 2JSOA 3M85A 4B3TQ 2KVMA 3F2UA 4HCEA 4C3HG 5CR3A 4IUUA 1WTHA 1I94L 2K5WA 2NWGA 4PZ6A 4BY1B 4K8IA 3ULJA 1SE4A 2EDGA 3UDIA 1FJGL 1ASYA 5EPLA 5C4ZA 4DUYL 3NHHA 4YHHQ 3J80L 1V8QA 4RG1A 1Y1WH 1NBWA 1DOKA 1JOKA 2B2TC 2K32A 1ONLA 1BCPF 2XIWA 2B3GA 2Z9HA 4B3ML 3HOZH 1HUMA 3VYUA 2N78A 5IYCH 3BDCA 4FF4A 1IYUA 1F2LA 1AFPA 1A15A 2QDLA 2PI2E 3MA2B 1VQ5A 2A1AA 3MHBA 2MHVA 1XX8A 1IBLQ 3HOYB 4G7ZC 1DXMA 3TSSA 1YIJA 1XMQL 5IP7H 1SYCA 3W3AA 1TR5A 1SLJA 3I8ZA 3O13A 4IOAA 5IGFA 2B2UA 3X3NA 2VQEL 1HR0W 1NR2A 5KNBA 4YCVA 3M4QA 4K2KA 3AYHB 1TWAH 4A3GB 4JPBW 3RZOH 4JBWA 5FO7B 5LMNW 4E6IA 2ES2A 1IW7C 1X32A 1SBBB 1GUGA 4JI8Q 5C6AA 4KHPQ 5CV4A 5C4JH 4BBRB 2VY3A 2ZM6L 5E1FA 4RA8A 1GM5A 1D8LA 1ASZA 5C3EG 2F4VQ 1CSPA 3T1YL 1QZHA 2E2JH 1CK1A 3G4SA 1NJIC 2F0VA 4KI0A 1VQIA 3HKZE 3ZYYX 4RHSA 4BBSB 4R4IA 1VQGA 4QL5A 4GNXB 3S24A 4X64Q 1BUVT 4NP5A 4X65L 1BBUA 4OEMB 5H1SE 2HQEA 2KCNA 3CRKC 3DEPA 4ZCKA 3T1HL 2SNMA 4FO2A 4RHRA 1SN8A 1YNNC 3BS1A 1BXTA 5I2YA 4AYBB 1EWCA 2EY2A 2OWOA 2UXBQ 1E7ZA 4P74A 3KLSX 4JI5Q 2I0QA 1AE3A 2EY5A 4JI1Q 4KD3A 1XTDA 2O4XA 3URYA 4IOCA 1DONA 4LWCA 5FLXE 2EJFC 3BZDB 1MI2A 2C9OA 3G48A 4LFAL 4A3EG 4XQQA 4A3KB 3HOVB 3QWNA 2OF1A 5HY6A 1QWYA 3CKIB 4ILWA 4EVOA 2RKSA 3N52A 1VQJA 2I5LX 4WRDA 3CCUA 4XT1B 2KHSA 4DV6Q 2AKWB 4IO9A 3G6JB 3GO5A 1D7QA 1XNRQ 3PF5A 4EQPA 2C5CA 2NZOA 2IW3A 1Q12A 4JOIA 5EJWA 5IP9G 2K5DA 5IODA 3UE0A 1B2TA 1EQVA 2H1EA 3MZ5A 2JA8G 1AP0A 4H02A 1K8GA 4XIGS 3AFPA 4GOPC 3N6RA 2EXZA 3KLWA 3U4ZA 1B4OA 2NTTA 3I90A 1IKLA 3K80C 3KJPA 3STBD 4OO1G 2G9DA 4O2DA 1LYLA 4DPGA 2AQ2B 2O2LD 5D3IB 3HOXB 4QIWE 2J4XA 4JG2A 2CVRA 4KK7A 4HIDA 3P7JA 3A74A 2JA6B 3OPOA 4A3MH 4H0LC 1LO5D 2F0PA 1GJXA 1X3PA 2IY5B 5LMUQ 2ZJQA 4PMCA 4MIUA 1DM0B 2A69C 4GLXA 5A2QL 1UE7A 3NXWA 4HJ7A 4DR5L 3FKIG 1KXLA 4JV5L 5ELFA 1CT1D 1RF2D 2GA4B 3C1FA 5C4XG 3I91A 3J81c 4IN3A 1PRTD 5FJ8G 1QNKA 4DK1A 2F0KA 3KOJA 1SYDA 1NE3A 3A7LA 2QA4A 2A6HD 3VYSA 1PTOC 1GHJA 2PYKA 2E2IB 1JICA 3KK7A 4ABNA 1XTCD 2MJ8A 4IUPA 1WCMB 2WB1E 1EIHA 2CW0C 2EOTA 2RCNA 1HNZQ 2DUDA 4JI3L 2Q8TA 1VQNA 3GTPB 4OXPA 3K5NA 4RGTA 2JEAI 3DLLA 2X6GA 4IPGA 5FKAC 4J1MA 5M9OA 1YZ6A 1A3VA 2DJFC 1MGSA 2K5HA 5DM63 4ZK9B 1QE6A 1JWMD 1QVCA 1W6KA 3M7GA 3GV6A 4OGQC 1STNA 5CV7A 2JP1A 1LT5D 1PH2A 1STHA 1U4MA 3M7NA 1KDCA 2JA7H 3SHLA 3HOWH 5IGDA 1STBA 3GTGB 1KRTA 4GN3B 1SE3A 3CF5A 4DV4L 3HOUH 4KD4A 2HCIA 3S9WA 5DEHA 3Q22A 1TWHH 2L11A 4UHVA 5JEAH 4QQBX 1L2FA 1U4PA 1OXUA 4ODGA 5IGEA 3J81i 1VQ6A 4R4OA 1BCPC 4U68A 1EUJA 3S1QH 1B53A 4KV6A 4DV1Q 2DY8A 5A35A 5M3MH 1HZAA 5EPKA 1WTWA 1X65A 5M3FH 2VW9A 4AQYL 1J6QA 4JC0A 1J8IA 3S17B 2X69A 4MN3A 5CGKA 4DV7Q 3MXNA 2F0FA 2Z6KA 3UE1A 4LF9L 1J9OA 3JC66 5IGCA 2KEEA 1TIID 4KKUA 3GTMH 3J80E 2B2UC 4MHEA 4LF7L 1HTLD 5LL6S 4NKLA 1UE1A 5FLMH 5KNDA 4DAPA 2CH4W 4YY3L 1SFOB 1VQ8A 3NTIA 4A3DB 1BQQT 2YTVA 4IPHA 4IPCA 2KHJA 4R4CA 4A3LH 3U58A 2VUMH 3X3MA 1IHZA 1ENFA 2NVYB 2OTJA 1FYCA 1Y69U 2J7ZA 2NVQH 1VDZA 2VNUD 3UI2A 1XYIA 1HNXL 1K0RA 4YWMA 4B3SL 4JYAQ 2EYOA 2OCEA 2LKVA 1BDOA 2E2HH 2PMZB 3SR1A 3BVGA 3HKSA 5M5YB 1A2UA 3BJUA 4DF7A 1J5EQ 3R8BA 1YHAA 2VQFL 4IALA 1WOCA 3CD6A 3MXGA 1KC8C 1U4RA 2UU9Q 1K8AC 2BDOA 3CCSA 2WAQE 3RUZA 3A5UA 4A3JH 3A8KE 1MIUA 2O5JC 1TS4A 1PRTC 5K5PA 2ATWA 2A73B 4X3UA 2UUAQ 2KCTA 5FO8B 3CMAA 1PTOH 3K7AB 3CQZB 2PNRC 4IUTA 5I2XA 4DR4L 4TQUS 1EIYB 5AJ3Q 2QCPX 3TP7A 2R93H 1YNJC 4GKKQ 2L1BA 2H5XA 2XRQD 3K7UC 1S5FD 5CV8A 4L5RC 2EZVA 2Z6BA 1ESRA 4JI2Q 1Z9FA 3TREA 1JT8A 4JOIC 1VQOA 2EY6A 2HHHQ 2JK8A 4GOPB 1KAAA 3TDQA 2SDFA 3A0JA 1I50B 5BR8L 4DV3Q 4OWTB 1A8VA 2R7DA 3OIQA 1WI5A 3G71A 4A4IA 1OO9B 4A3MG 2ZTDA 4P72A 4JI0L 4NXNQ 2JEBI 3PIPA 3M4OB 1JE5A 2X6LA 5IIFA 4L63B 1TY0A 2K50A 1IL8A 1YVCA 4TSSA 5EPJA 2EJGC 1D5ZC 2IL8A 1I4GA 2L4NA 1GVPA 1TVXA 3S14H 4X66L 4UAIA 2ZXRA 3EA6A 5CV9A 3NPPA 1L0WA 1RIPA 4K0KL 2I5MX 4LFCQ 3HKZG 3S16B 2KA7A 2ZT9C 3KFUA 2ICEC 3T13A 1KTKA 4APVA 4DR7L 2E5LQ 3RLOA 2AWOA 2MO1A 4JVZA 4LF4Q 1S5CD 1T9HA 1G2TA 3EBEA 2LFNA 5ELCA 1R9TH 3CRLC 1IBMQ 3W1BA 4LF6Q 1HZ9A 1OXXK 1VCIA 3PGZA 1NMFA 3NP8A 5JPMC 2BA1A 5FK9C 3FHWA 2E75C 5A2QE 2F0LA 3CAMA 3BYYB 1P16A 4F7XA 5I6WA 4GKJQ 4BXXH 3DWPA 3M4PA 2JA7G 2ZJRA 1VMCA 1RL2A 4CDCC 1OXSC 3OSOA 1O80A 4ZUIA 3AMUA 1EIFA 1ZYRD 5I4DA 4IUQA 5M5WB 4PMWA 3TMEA 1U0LA 4TVAB 1N33Q 1WTXA 4HR7B 1NSNS 4OHJA 1N32Q 4GZYC 4JBMA 3CW2C 4OWWB 4C3HB 4C3JH 1BCPB 5CBEE 1TWGB 2K75A 2PZTA 4ALPA 1IKMA 2EYFA 3GTQB 1S4ZA 4DXGA 4IQZA 2F0QA 5JVH3 3BVMA 1LTSD 1B44D 2PW7A 1ILQA 2WKCA 1QUQA 1LT4D 4C1NI 3NK9A 4HJAA 1XPRA 1PHJA 2Z6KC 3DM3A 1TY2A 3KUPA 1HQMC 1TWCH 5EQ0A 3CMEA 3NENA 3P1HA 4NXML 1B3QA 1G51A 1FR3A 1R4QB 3I4NG 1H9KA 3AU7A 3NUCA 3MFGA 4EX5A 1PH1A 4IFDH 4DR3L 4B3TL 1RCVD 4HEDA 1TT2A 4X3KA 2RSNA 2WV6D 4OELB 1PMRA 5L37A 2R92G 4LW1A 1EY7A 1MHWC 1LABA 2F0HA 3TZUA 2WB1G 1SNCA 3K8AA 3CCEA 5ELDA 3JAMi 2L5TA 3OOCA 3M4YA 4WORA 5IY0A 2LY7A 3AFQA 3Q8DA 3CC2A 1EEFD 4BY1H 1A63A 2JYOA 3DWAA 2ZJPA 5LMNL 3CCQA 3E3XA 4PZ8A 5TSSA 2BDNA 1PYWD 2WFWA 4JI7L 1B3AA 1PVOA 3J81L 5C3EB 2OTLA 3RLNA 4CDEC 4CGYB 4L8JA 4RFBA 2HDLA 5CV6A 3I4MG 1G2SA 2UXDL 2QDBA 4ME3A 2EYHA 1N36Q 2BA0A 3PIO3 4JI4L 2R7ZG 3A54A 1GUSA 1W6JA 2XNAC 1PRTB 3HOYH 5IOCA 1LACA 2XN9C 3U9OA 1PZKD 3HP3A 4QMGA 3I2ZA 2P5ZX 3L7ZC 4TRDA 4DV2Q 1IL2A 1H9MA 4KY7A 4CJ1B 2RDHA 5JEAJ 5IGGA 2B2VA 3D0FA 3U9SA 1K3RA 1QZGA 3PO2G 1FNWA 5C44G 4L5TA 1EY8A 1F2MA 4A3GH 4B3RQ 2F4VL 1RKNA 1SJHD 2JA5H 4CHTB 4QB4A 4HJ9A 2V1CC 4A3FG 5ELEA 4BBRH 1PH7A 2ZTCA 4LUVA 2Z4IA 2F3WA 1DJRD 3GTLB 3EN2A 5CV5A 4L5QA 2JA8B 4BBSH 4IUVA 3W2DA 1ESFA 4JI5L 1CI3M 3BZCA 5C3XA 1E2VA 1IBKQ 4DR2Q 3CPFA 5JJIA 4QF4A 1FNVA 4GN5A 1EWIA 2XWBB 1MBYA 1JB7A 1EZ6A
chains in the Genus database with same CATH topology
2ENBA 3H3VC 3NBHA 5T1GA 5J1ZA 2HDMA 3V96A 2XWJB 4LJZC 3FEWX 2L55A 1SSOA 3RMHA 1G91A 1C48A 3FKIB 1EY6A 1D5XC 5C4XB 3T51B 3I70A 1H9JA 4RGNA 1F77A 1LTBD 3VA7A 5FOBB 1EFID 3E0JA 1O7ZA 3NTHA 4RKLA 4ZYSA 2M2LA 4Y7NB 1LTAD 2F3VA 3G7LA 1FNUA 3Q6SA 5BN3A 2KJXA 1CZGA 2NZ1D 2F0WA 1SMYD 2K05A 3VR6A 2KQ3A 2FJ2A 1IYVA 2V4DA 2EJMA 2B2YA 2RVLA 3Q23A 4CJ2C 1I6HB 3T56B 1D1KA 1PRTF 3SK8A 5K36H 1STYA 4FP5D 2MUYA 1CFMA 3NWSA 1JOOA 5CBAE 1S5ED 3GD7A 2NN6G 2RSOA 4C3IG 2A74C 1U4LA 2VB2X 1OXTA 2K04A 2Z8LA 4BS9A 3WOEA 4KN7C 3OHXC 2I07B 1JB3A 1X3QA 3K5MA 3BG3A 1SYBA 3D4RA 3NSWA 4FF3A 1SDFA 2BE5D 5E4WC 4XTCS 1WTPA 1B9NA 1M8AA 5KNCA 3D4DA 2R6GA 5FO9B 2B8FA 4WJWA 1EYDA 3KLSA 4HCSA 4IZ8A 2A6ED 5KIXA 1CQVA 2EYJA 5LHY1 1WD1A 1EY9A 2RDGA 4EGVA 1HRJA 4G7OC 2CQAA 1KLUD 4LMQD 1TQOA 3QOLA 4BWGB 1GUOA 3D3RA 1EIGA 3HEJA 1LLRD 1TWFB 2RBMA 2AWNA 2B2VC 2L12A 3WOFA 2XSCA 2A68D 2E76C 3A56A 3S15B 3J81E 1AZQA 3S2DB 3QB3A 1ZKOA 5M5XB 1STAA 3JAML 4R8IA 2TMPA 1B9MA 1L0XB 4F87A 1KNEA 1LTRD 2Z4HA 4HSVA 4CKEA 2SNSA 2OEOA 3K6OA 4IFDJ 2FMMA 3IFTA 4G57A 3DWQA 3PUYA 4FNFA 3EJIA 2K28A 4A3MB 3NQIA 2F0GA 4IFDI 2QKIC 1SYFA 2WACA 4NW2A 3SK6A 5IGBA 1BO0A 1F9QA 1D2BA 2K33A 2TSSA 1II3A 3QG1A 3HKZB 4A3IB 5G3LF 1GUWA 1JWSD 3VA5A 2O5IC 1HFNA 5AFWA 4B9XA 2N55A 3S1MB 3C46A 4OO1I 4KJNA 3DHQA 3KBXA 3FDTA 3KF8A 1JC7A 3OWFA 4RWSC 1LT3D 2K1BA 2BCOA 3SXHA 1M4VA 1O7YA 3Q0AA 5J39A 2YU9B 3LNNA 3DEOA 4CJ0B 2K6AA 1EZ8A 2B2YC 2PQEA 2JA7B 3FPPA 5KEEA 1HHVA 1SNOA 3KBGA 3GTKB 3S2HB 1JORA 1Q1EA 2NVXB 1EQTA 1TWHB 4V190 2A6HC 4ZRZA 1CZWA 3AB9A 4K6DA 1ET6A 4K5WA 1I4PA 2Z1CA 4QIWB 2AUKA 1DD2A 2NTSA 3R3OA 4OIKA 5JVG3 1EOTA 4R8NA 3SK4A 1F9SA 4DN4M 3BDOA 2EVBA 1HQRD 3I73A 2EY1A 3MEHA 1LTID 4F88A 4WFN3 4M8AA 1CQFA 2ZXPA 3I4NB 1AN8A 4J6HA 2IX0A 1RDPD 1PXUA 3QOJA 2F0JA 3T53B 2R92B 1F2ZA 3SVMA 5ISRA 2WB1B 3BDLA 1HA6A 3V2TA 4H44C 4EQNA 4XQNA 1TS2A 3PUWA 3K5OA 1KDAA 1SE2A 5HURA 2IPKD 4RCOA 3K59A 2ID0A 4OL7A 1H9SB 3TP6A 3DM1A 4C2MB 5T1IA 4RGMA 2OXPA 5IT9L 5EBDA 1S5BD 1Q1BA 3C3LA 2F0IA 3I4MB 2OT2A 3P20A 5EKLA 3IAYA 1UAPA 2F03A 1LV9A 1WTOA 4L6TB 1UEAB 2R7ZB 1QJOA 2SEBD 4KHZA 5E3FA 1HTPA 4UDUC 4K5XA 3FVQA 2NUCA 4LAAA 1MSGA 3HS0C 2ICIA 1SNPA 3HG9A 2ZXOA 1PZJD 1K83B 1HXYD 3J7YW 2FFKB 3PO2B 3MTSA 5C44B 1JE4A 3SDZA 2RDFA 4HSPA 3LX0A 4K14A 1ENAA 5JEAG 4A3FB 4OIJA 2LS01 1SEBD 3J7AV 2R3ZA 1UNSA 5EKKA 2F0TA 2KEDA 1BR9A 3KLRA 3JAME 4RGOS 1NR4A 3H91A 3GTOB 1KNAA 3VYRA 4I65A 4K2LA 1Z6HA 3BYTB 3RLFA 4FF2A 4XYOA 3OIPA 1TS3A 5J22A 2PW5A 3I3CA 4RAUC 3TP8A 2PZWA 3MC0B 1CA6A 1KLGD 4NMZA 5EKIA 3J7AF 1Z47A 5I9OA 3PIP3 1D6EC 3Q24A 1Q90A 3QJYA 1GXDC 2NVTB 4DXFA 2EE1A 5CC4A 3CU7A 2F0OA 3L3OC 4R9WA 3ONAB 1IW7D 1EY5A 2K03A 3RD4A 2K01A 2WAQB 1G6ZA 2K5QA 2EYMA 4Z9CB 3VR3A 1F2YA 3NTKA 4HAEA 4ZAIA 5I9PA 1EYCA 2QF7A 3D31A 1Y8OB 3IL8A 4OO1H 4KTAA 4DGZA 2N88A 1SJED 4PV1C 4P2CB 5EBCA 1H9SA 1I4HA 3PV0A 1L0YB 1ML0D 2B63B 5NUCA 5DAUA 1YNND 3FRPB 4U673 2MP1A 3DXJC 4CKBA 3GTJB 4ME5A 1EU4A 2PCFB 3S1NB 5ELBA 5D3DA 3HRZC 3M3YB 2YYZA 1CA5A 1VF7A 3RZDB 1Y1VB 4A3EB 3EFXD 3A55A 1LTGD 2I46A 3HGBA 2IJ0A 4C3IB 4Q5VA 1WTQA 2F0DA 5CORA 4I7ZC 3SE0A 2LMCB 1Z7TA 1SNMA 1A3UA 4K6LA 1HA5A 5KYIA 3SEBA 1R4PB 1ZYRC 1G291 1GHKA 3V05A 5C5LA 3D8GA 4YIJA 2WIIB 4M1UB 4BY7B 3I72A 3S1RB 2A69D 3QO2A 5C0XJ 3D6WA 3A8IE 4XDXA 3HZXA 2WKDA 2M9VA 3PMFA 2IT1A 3PO3B 1TKWB 5KGUA 4G7HC 1EY0A 1DYQA 5HGTA 1GUTA 2G9HD 1QCBD 2BOSA 1MSHA 2RA4A 1PTOD 4A3BB 1ICWA 1WD0A 5C0XI 1FGBD 2CW0D 3FPUB 4ZQ3A 1RODA 1AEXA 4ULLA 3OMCA 2B2WA 1D1IA 2DY7A 2SOBA 4DAYA 1TU2B 4B9WA 4RCNA 1I4XA 3C1EA 4RH6A 3K58A 1QB5D 2JA5B 5BN5A 4TKOB 4S3SA 4DNRB 4DAVA 5IT9E 1V1PA 4EQOA 4C3JG 3H94A 2IX3A 5C5MA 1A6XA 2CHBD 1CHPD 1PFNA 1LTTD 1Y1WB 5D14A 1V1OA 2IWHA 3HOZB 4FXKC 1BCPD 2K7VA 1BBXC 1TS5A 3EQLC 3BVZA 1H9RA 1DZ1A 1RTOA 2F0UA 3NBIA 4IFDG 1GOZA 3MFYA 5JPNC 3DMUA 4K8JA 1E0BA 3OW7A 4ID6A 2KCCA 3LWEA 1Y8NB 5KYLA 2F4IA 1WTRA 3ND8A 1B50A 2A5HA 4DA2A 4JK1C 1TWAB 2M00A 3RZOB 3R93A 3P75A 2D2CC 1F9RA 4C56C 5C4JB 3E5SA 2F0SA 4ZKBB 4IURA 3VYTA 3ERQA 1ZXTA 2E2JB 1JCKB 1SNDA 1LT6D 1NCVA 1I6VC 2KOLA 1XWEA 3L9AX 3EVQA 1KABA 2WP8J 1CM9A 4Q0FA 2NBFA 2L0CA 3TBIB 1XXGA 4DFAA 2D5DA 2FHTA 4J8QA 3MAQA 4CBVA 2DNCA 4DNTB 1C4QA 1YNJD 4NDXA 4X3SA 3OMGA 5DNFA 1CHQD 1BF4A 1SAPA 4O1NA 3MXUA 3GV3A 1SYGA 5COYA 1I4RA 1SMYC 1PLFA 1WVLA 1QOHA 3FMCA 3VR2A 5C3WA 4B08A 4O42A 1B1ZA 1O7LA 4KKSA 4XQJA 3GQBA 3PUVA 1EYAA 4F8MA 3D6CA 2QEJC 4H7BA 1DOMA 4KY5A 4H13C 2JXMB 5JAVA 1ZEQX 2D62A 1EWHA 3H09A 2EYPA 1A3TA 2NN6I 1RTNA 4FYDA 4FXDA 1ET9A 4KKTA 1C8CA 3DUZA 3TP5A 2B8GA 4A93B 5DM73 1K8MA 3NQTA 5JJZA 1PDQA 3A8JE 4LK1C 2F0NA 2B2WC 4KMUC 2F1MA 1U9RA 1T5XD 2BE5C 3VR5A 3H0GB 5C0XH 1ILPA 2VB3X 1KDBA 1HFGA 2B39A 1PFBA 4N9TA 4KY6A 3HOWB 5K36G 1NUCA 5D65A 2A6EC 3NE5B 3LWUA 3HOUB 5BN4A 1S5DD 1QG7A 4FVMA 1K8OA 4PMBA 4XYQA 4N9PA 3C2PA 2E2DC 3S1QB 2PO4A 1A2TA 5M3MB 3T4AC 1JOQA 2DNEA 1CTMA 5M3FB 1MD2D 1EU3A 1QILA 1BOSA 2A68C 1SYEA 1O78A 4PQXA 2XVSA 1F9PA 3GP7A 3GTMB 5CMDA 4FXGC 1HCZA 1AZPA 2NYZD 2H4OA 2WINB 1PFMA 1D5MC 2E74C 5E4XA 5G3LD 2PPBC 1Q8IA 2VUMB 2D9UA 3PUZA 3K57A 2XRSD 2NVQB 4IUNA 3QIAA 4QUCA 3MWYW 4K5VA 2EPBA 2AUJD 1RD9D 2E2HB 3I4LA 2B2TA 1BNZA 1E2WA 4BA2I 2Q8IB 3EROA 2MPMA 4A3JB 2L9HA 1SXTA 1FD7D 3SK5A 4HMIA 3VR4A 1SNQA 1PTOB 1EEID 5F2DA 5JOBA 1AW7A 1EY4A 3CHBD 2R93B 2HCCA 1I3QB 3MVVA 2NB0A 1DOLA 1HPCA 1E2ZA 3TN2A 4KN4C 5FLXL 2Y0SB 5I6YA 1V43A 1HUNA 4QCLA 1JQYD 3S14B 1ENCA 1GUNA 4ZLTF 2PZUA 3T16A 2J0TD 3R2TA 3MXPA 3IFDA 2EYLA 3ITPA 3OWEB 5LL6X 2F0EA 3NWTA 1R9TB 2FINB 1I4QA 2KUMA 4XT3B 4X3TA 3H6MA 4CKCA 2NN6H 1Y8PB 1UUPA 3E6ZX 4BA1I 1WTVA 3K5LA 2DN8A 4RKBA 2FMCA 4HTHA 1G8ZD 2RQXA 2R61A 4V0BA 5C0XG 1STEA 3TZDA 1V1PB 1RJTA 1OXVA 4HN7A 4FF1A 3K0YA 2HUGA 1PZID 2Q8RE 5C4HA 3D4WA 4KJOA 1T5EA 3IKJA 4PNYA 2AQ3B 1RHPA 3ND9A 3PUXA 5KRUA 3R2IA 4C3JB 4HMJA 1QNUA 4C1NK 3WDNA 5EGTA 4DK0A 1PTOF 1STGA 4ZUJA 4QUFA 1VMPA 2F0MA 2JE6I 1VF5C 3A7AB 2IX1A 2KECA 4XXEA 2MGSA 4G4KA 1TWCB 4ZKCB 2VXWA 4KHVA 1NAPA 1JR0D 2AQ1B 1JWUD 4DU9A 1EL0A 1DCZA 2QILA 5CYUA 1Q3LA 2JSOA 3M85A 2KVMA 3F2UA 4HCEA 4C3HG 5CR3A 4IUUA 2K5WA 2NWGA 4BY1B 4K8IA 1SE4A 2EDGA 5EPLA 5C4ZA 3NHHA 3J80L 1V8QA 1DOKA 1JOKA 2B2TC 2K32A 1ONLA 1BCPF 2XIWA 1HUMA 3VYUA 3BDCA 4FF4A 1IYUA 1F2LA 1AFPA 1A15A 3MA2B 3MHBA 2MHVA 1XX8A 3HOYB 4G7ZC 1DXMA 3TSSA 1SYCA 3W3AA 1TR5A 3I8ZA 3O13A 5IGFA 2B2UA 3X3NA 1NR2A 5KNBA 4K2KA 4A3GB 4JBWA 5FO7B 4E6IA 1IW7C 1X32A 1SBBB 1GUGA 5C6AA 5CV4A 4BBRB 5E1FA 4RA8A 1CK1A 2F0VA 4KI0A 3ZYYX 4RHSA 4BBSB 1BUVT 4NP5A 2HQEA 2KCNA 3CRKC 3DEPA 2SNMA 4FO2A 4RHRA 1YNNC 3BS1A 1BXTA 5I2YA 4AYBB 1EWCA 2EY2A 3KLSX 2EY5A 4KD3A 2O4XA 3URYA 1DONA 5FLXE 2EJFC 3BZDB 1MI2A 2C9OA 4XQQA 4A3KB 3HOVB 3QWNA 2OF1A 1QWYA 3CKIB 4ILWA 4EVOA 2RKSA 3N52A 4WRDA 4XT1B 2KHSA 3G6JB 3GO5A 4EQPA 2C5CA 2IW3A 1Q12A 5EJWA 5IODA 2K5DA 1B2TA 1EQVA 2H1EA 3MZ5A 1AP0A 4XIGS 3N6RA 2EXZA 1B4OA 2NTTA 3I90A 1IKLA 4OO1G 2G9DA 2AQ2B 2O2LD 5D3IB 3HOXB 2J4XA 2CVRA 4KK7A 3P7JA 2JA6B 3OPOA 4H0LC 1LO5D 2F0PA 1GJXA 1X3PA 4PMCA 4MIUA 1DM0B 2A69C 5A2QL 3NXWA 5ELFA 1CT1D 1RF2D 2GA4B 3C1FA 3I91A 4IN3A 1PRTD 1QNKA 4DK1A 2F0KA 1SYDA 3A7LA 2A6HD 3VYSA 1PTOC 1GHJA 2PYKA 2E2IB 1JICA 3KK7A 4ABNA 1XTCD 2MJ8A 4IUPA 1WCMB 1EIHA 2CW0C 2EOTA 2Q8TA 3GTPB 3K5NA 4RGTA 2JEAI 2X6GA 5FKAC 4J1MA 5M9OA 1A3VA 1MGSA 5DM63 4ZK9B 1QE6A 1JWMD 1W6KA 3M7GA 3GV6A 4OGQC 1STNA 5CV7A 2JP1A 1LT5D 1STHA 1U4MA 3M7NA 1KDCA 3SHLA 5IGDA 1STBA 3GTGB 1SE3A 4KD4A 2HCIA 3S9WA 5DEHA 3Q22A 2L11A 5JEAH 1U4PA 1OXUA 4ODGA 5IGEA 1BCPC 4U68A 1B53A 4KV6A 2DY8A 5A35A 5EPKA 1WTWA 1J8IA 3S17B 2X69A 4MN3A 5CGKA 3MXNA 2F0FA 1J9OA 5IGCA 2KEEA 1TIID 4KKUA 3J80E 2B2UC 4MHEA 1HTLD 5LL6S 4NKLA 5KNDA 4DAPA 1SFOB 3NTIA 4A3DB 1BQQT 3X3MA 1IHZA 1ENFA 2NVYB 1FYCA 1Y69U 2J7ZA 1VDZA 2VNUD 3UI2A 1XYIA 2EYOA 2LKVA 1BDOA 2PMZB 3SR1A 3BVGA 5M5YB 1A2UA 4DF7A 3R8BA 4IALA 3MXGA 1U4RA 2BDOA 3RUZA 3A8KE 2O5JC 1TS4A 1PRTC 5K5PA 2A73B 4X3UA 5FO8B 1PTOH 3K7AB 3CQZB 2PNRC 4IUTA 5I2XA 4TQUS 2QCPX 3TP7A 1YNJC 2L1BA 2XRQD 1S5FD 5CV8A 2EZVA 1ESRA 2EY6A 1KAAA 3TDQA 2SDFA 1I50B 3OIQA 1OO9B 2JEBI 3M4OB 2X6LA 5IIFA 4L63B 1TY0A 1IL8A 4TSSA 5EPJA 2EJGC 1D5ZC 2IL8A 1I4GA 2L4NA 1TVXA 4UAIA 2ZXRA 3EA6A 5CV9A 3NPPA 3S16B 2KA7A 2ZT9C 2ICEC 3T13A 1KTKA 2AWOA 1S5CD 1G2TA 2LFNA 5ELCA 3CRLC 1OXXK 1VCIA 3NP8A 5JPMC 2BA1A 5FK9C 2E75C 5A2QE 2F0LA 3BYYB 4F7XA 5I6WA 3DWPA 1VMCA 1OXSC 3OSOA 1O80A 4ZUIA 3AMUA 1ZYRD 5I4DA 4IUQA 5M5WB 4PMWA 3TMEA 1WTXA 4HR7B 1NSNS 4OHJA 4GZYC 4C3HB 1BCPB 5CBEE 1TWGB 2PZTA 1IKMA 2EYFA 3GTQB 1S4ZA 4DXGA 4IQZA 2F0QA 5JVH3 3BVMA 1LTSD 1B44D 2PW7A 1ILQA 2WKCA 1LT4D 4C1NI 3NK9A 3KUPA 1TY2A 1HQMC 5EQ0A 3P1HA 1FR3A 1R4QB 1H9KA 3AU7A 3NUCA 3MFGA 4IFDH 1RCVD 4HEDA 1TT2A 4X3KA 2RSNA 2WV6D 1PMRA 1EY7A 2F0HA 1LABA 3TZUA 1SNCA 5ELDA 2L5TA 3OOCA 3M4YA 4WORA 2LY7A 1EEFD 2JYOA 3DWAA 5TSSA 2BDNA 1PYWD 1B3AA 3J81L 5C3EB 4CGYB 4L8JA 4RFBA 2HDLA 5CV6A 1G2SA 2QDBA 2EYHA 2BA0A 3PIO3 3A54A 1GUSA 1W6JA 2XNAC 1PRTB 5IOCA 1LACA 2XN9C 3U9OA 1PZKD 3HP3A 4QMGA 3L7ZC 4TRDA 1H9MA 4KY7A 4CJ1B 2RDHA 5JEAJ 5IGGA 2B2VA 3U9SA 1FNWA 1EY8A 1F2MA 1RKNA 1SJHD 4CHTB 4QB4A 5ELEA 2Z4IA 2F3WA 1DJRD 3GTLB 5CV5A 2JA8B 4IUVA 3W2DA 1ESFA 1CI3M 5C3XA 1E2VA 4QF4A 1FNVA 2XWBB 1MBYA 1EZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6I A;  5CV9 A;  2ENB A;  4PMB A;  5KRU A;  2EY1 A;  3MEH A;  2F0D A;  1EY7 A;  2F0H A;  1SYF A;  2WAC A;  3C1F A;  4HMJ A;  4N9P A;  5CV4 A;  5C6A A;  1SNC A;  4I65 A;  4K2L A;  5E1F A;  5EGT A;  5IGB A;  5J1Z A;  2F0K A;  1SNM A;  3SK6 A;  3T13 A;  1SYG A;  1A3U A;  1IHZ A;  1SYB A;  1SYD A;  5KYI A;  1A2T A;  4WOR A;  1STG A;  4ZUJ A;  1JOQ A;  2F0U A;  5J22 A;  2PW5 A;  4J6H A;  2F0M A;  5M9O A;  3TP8 A;  2F0V A;  3QOJ A;  5C3W A;  2PYK A;  3DMU A;  4K8J A;  2F0J A;  2PZW A;  3D4D A;  1F2Z A;  1EY6 A;  1II3 A;  2EYO A;  2LKV A;  5ISR A;  5C5L A;  1EYA A;  3BDL A;  1SYE A;  1EYD A;  4ID6 A;  3D8G A;  4NMZ A;  3V2T A;  4F8M A;  3D6C A;  4NP5 A;  3SR1 A;  5I9O A;  5KYL A;  3NP8 A;  4EQN A;  4KHV A;  2HQE A;  4YIJ A;  1A2U A;  3VA5 A;  5I6Y A;  4H7B A;  4KY5 A;  4IZ8 A;  4DF7 A;  5KIX A;  2SNM A;  4IAL A;  5CV6 A;  2EYJ A;  5JAV A;  2F0L A;  1KDA A;  2M00 A;  1ENC A;  2QDB A;  1EY9 A;  5HUR A;  4RKL A;  2PZU A;  3T16 A;  2EYH A;  4J1M A;  2EYP A;  4B9X A;  2F0O A;  3P75 A;  1A3V A;  4OL7 A;  4F7X A;  4DU9 A;  5KGU A;  2EY2 A;  1A3T A;  1EY5 A;  4KJN A;  3TP6 A;  5I6W A;  1TQO A;  3QOL A;  3DHQ A;  3RUZ A;  3HZX A;  2F3V A;  3MXP A;  5IOC A;  3OWF A;  2EYL A;  3PMF A;  3E5S A;  2OXP A;  3U9O A;  5K5P A;  2EY5 A;  3ITP A;  4KD3 A;  1STN A;  2F0S A;  1EY0 A;  2EYM A;  2O4X A;  5CV7 A;  3SXH A;  1STH A;  2F0W A;  4QMG A;  1F2Y A;  5HGT A;  5J39 A;  3ERQ A;  3OSO A;  5CR3 A;  1KDC A;  3SHL A;  3HEJ A;  2F0I A;  4TRD A;  2OF1 A;  5EKL A;  2KQ3 A;  4IUN A;  4ZUI A;  1EYC A;  3TP5 A;  5I9P A;  5IGD A;  1EZ8 A;  4K8I A;  4KY7 A;  1STB A;  1SND A;  4EVO A;  2RKS A;  3TME A;  5IGG A;  2F0E A;  2RBM A;  4K5V A;  4WRD A;  3TP7 A;  5C4Z A;  3NQT A;  3NHH A;  2KHS A;  1NSN S;  5E3F A;  4KTA A;  2PQE A;  1EY8 A;  1F2M A;  3H6M A;  4K5X A;  5CV8 A;  1AEX A;  4ZQ3 A;  4DGZ A;  4EQP A;  5KEE A;  2NUC A;  1SNO A;  4KD4 A;  3OMC A;  3QB3 A;  5DEH A;  3S9W A;  4LAA A;  1RKN A;  1JOK A;  4RKB A;  5IOD A;  4HTH A;  1STA A;  1EQV A;  1SNP A;  2EY6 A;  2F0N A;  3MZ5 A;  4QB4 A;  3SK8 A;  3OMG A;  2SOB A;  4ODG A;  5IGE A;  1JOR A;  1KAA A;  3BDC A;  3EVQ A;  5DAU A;  1STY A;  5NUC A;  1KAB A;  4B9W A;  1JOO A;  2PZT A;  2EXZ A;  4KV6 A;  2EYF A;  3C1E A;  3ERO A;  1U9R A;  4ME5 A;  2F0Q A;  3MHB A;  4S3S A;  2F3W A;  2RDF A;  3LX0 A;  2PW7 A;  1KDB A;  4K14 A;  3SK5 A;  5CGK A;  4EQO A;  2SNS A;  4HMI A;  2OEO A;  2F0F A;  1ENA A;  1SYC A;  3NK9 A;  3NXW A;  4K6D A;  4N9T A;  1TR5 A;  4K5W A;  5CV5 A;  4DFA A;  5IIF A;  1SNQ A;  4KY6 A;  3R3O A;  5IGC A;  5F2D A;  4G57 A;  5JOB A;  3P1H A;  5IGF A;  2F0P A;  5CC4 A;  1NUC A;  1EY4 A;  5C4H A;  3D4W A;  5C5M A;  5C3X A;  5EKK A;  3NUC A;  4PMC A;  4MIU A;  3EJI A;  4KJO A;  3MVV A;  4K2K A;  4NKL A;  4R8N A;  3SK4 A;  4NDX A;  4QF4 A;  2F0T A;  1TT2 A;  4PNY A;  2F0G A;  1EZ6 A; 
#chains in the Genus database with same CATH topology
 4DUZ L;  2ENB A;  4UY8 C;  3H3V C;  2Q2I A;  3NBH A;  5T1G A;  5J1Z A;  1EFW A;  2HDM A;  1HR0 Q;  3V96 A;  1YHQ A;  2XWJ B;  1PH9 A;  3HOV H;  4LJZ C;  3FEW X;  2L55 A;  2JA9 A;  5E7N A;  1SSO A;  3RMH A;  1G91 A;  1C48 A;  3NEL A;  3FKI B;  3RN5 A;  1HH2 P;  1EY6 A;  4OX9 L;  4DV0 Q;  1D5X C;  4NB3 A;  5C4X B;  1P8L A;  3T51 B;  3I70 A;  4HIK A;  5IT9 c;  1H9J A;  2WAQ G;  4RGN A;  1F77 A;  1LTB D;  3VA7 A;  1XMO L;  4YCW A;  5FOB B;  1EFI D;  3E0J A;  1O7Z A;  1SMX A;  3F1Z A;  3NTH A;  4RKL A;  4ZYS A;  2M2L A;  4Y7N B;  1LTA D;  4MNO A;  2EIF A;  2F3V A;  3G7L A;  1FNU A;  3Q6S A;  5LMU L;  5BN3 A;  2KJX A;  2CWA A;  1CZG A;  2NZ1 D;  1B70 B;  2F0W A;  3HOX H;  4DKA C;  1SMY D;  2JA6 H;  2K05 A;  3VR6 A;  2KQ3 A;  2B63 G;  2FJ2 A;  1IYV A;  2V4D A;  2EJM A;  1VQC A;  2B2Y A;  2RVL A;  3Q23 A;  4CJ2 C;  2QW7 A;  1I6H B;  4DV5 Q;  4YWK A;  1HNW Q;  3T56 B;  1D1K A;  1PRT F;  5FLX c;  3SK8 A;  1X3G A;  5K36 H;  1STY A;  4FP5 D;  2MUY A;  3NWS A;  1CFM A;  1PH4 A;  1JOO A;  1HNZ L;  2FXQ A;  2K14 A;  5CBA E;  1Y1V G;  1S5E D;  2F52 A;  1FJG Q;  3GD7 A;  2NN6 G;  3TRZ A;  4DUY Q;  2RSO A;  2E2I H;  4C3I G;  2A74 C;  3MXN B;  5GAD C;  1WCM H;  1U4L A;  2VB2 X;  1OXT A;  2JN4 A;  2K04 A;  1I5F A;  4B3M Q;  4MZ9 A;  1PV4 A;  2Z8L A;  1YI2 A;  4BS9 A;  3GTP H;  2GVA A;  3E0E A;  3WOE A;  4KN7 C;  3OHX C;  1M1K C;  2I07 B;  1JB3 A;  4LF5 L;  1X3Q A;  3K5M A;  1HJP A;  4POG A;  5IYB G;  3BG3 A;  1SYB A;  3D4R A;  3NSW A;  4FF3 A;  2ZTE A;  1SDF A;  4BY7 G;  2BE5 D;  5E4W C;  3KF8 B;  4XTC S;  2VQE Q;  1WTP A;  1B9N A;  1M8A A;  3GTG H;  5KNC A;  3D4D A;  2R6G A;  5FO9 B;  2B8F A;  4WJW A;  1EYD A;  2UXC L;  1CKN B;  3I4O A;  3KLS A;  4HCS A;  2CKZ B;  3PO3 G;  4IZ8 A;  2A6E D;  5KIX A;  2ZM6 Q;  1CQV A;  1FVI A;  2HQL A;  2EYJ A;  5LHY 1;  1WD1 A;  4DR6 L;  1JJG A;  1EY9 A;  2RDG A;  4EGV A;  3T1Y Q;  2RF4 A;  4A3B G;  1HRJ A;  4G7O C;  2CQA A;  3H3V H;  1KLU D;  4LMQ D;  1PH8 A;  1TQO A;  3QOL A;  2NZH A;  3CC4 A;  4BWG B;  1GUO A;  3CP0 A;  3S17 H;  4A93 H;  3D3R A;  2CQO A;  1EIG A;  3HEJ A;  1GKH A;  1E24 A;  1LLR D;  1TWF B;  3TS2 A;  3T1H Q;  1MKH A;  2RBM A;  1C0A A;  2AWN A;  2B2V C;  2L12 A;  3WOF A;  2XSC A;  1BBW A;  2A68 D;  2JA5 G;  2E76 C;  3A56 A;  3S15 B;  3J81 E;  4UP8 A;  1SFO H;  1AZQ A;  3S2D B;  3QB3 A;  1ZKO A;  4A3D H;  4LFB L;  5M5X B;  1STA A;  3H0G H;  3JAM L;  4R8I A;  2TMP A;  4GN4 B;  1X56 A;  1B9M A;  4JYA L;  1L0X B;  1YJ9 A;  4LFA Q;  4F87 A;  1KNE A;  2NVY H;  1LTR D;  1LTL A;  2Z4H A;  4HSV A;  4KLK A;  1Y1W G;  4CKE A;  2SNS A;  3F8T A;  2OEO A;  3K6O A;  4IFD J;  2BH2 A;  2FMM A;  3HOZ G;  3IFT A;  4G57 A;  5IYC G;  2UU9 L;  3DWQ A;  3PUY A;  5M5Y H;  4FNF A;  4AH6 A;  3EJI A;  2K28 A;  5IYD H;  4A3M B;  2N49 A;  3IRB A;  1Q81 C;  2UUA L;  3NQI A;  2F0G A;  1QVF A;  4IFD I;  2A8V A;  5IP7 G;  1XPO A;  2QKI C;  1SYF A;  2WAC A;  5AJ3 L;  2Z0S A;  4NW2 A;  3SK6 A;  5IGB A;  1BO0 A;  3J80 c;  2Y0S E;  1JMC A;  1F9Q A;  4QJF A;  3K7A H;  1D2B A;  3CQZ H;  4FDB A;  2K33 A;  2F3I A;  2TSS A;  1II3 A;  3QG1 A;  3HKZ B;  4A3I B;  4A3C H;  4DR5 Q;  1KRS A;  5G3L F;  2UUB L;  2IHF A;  1GUW A;  1JWS D;  3VA5 A;  2YTY A;  3L2P A;  2O5I C;  1HFN A;  5AFW A;  4B9X A;  2N55 A;  3S1M B;  1I50 H;  3C46 A;  4OO1 I;  4KJN A;  3E9H A;  3DHQ A;  3K0X A;  3KBX A;  2GN5 A;  3FDT A;  3KF8 A;  3STB C;  1JC7 A;  3OWF A;  4RWS C;  1LT3 D;  2K1B A;  2A19 A;  2BCO A;  3SXH A;  1M4V A;  1O7Y A;  3Q0A A;  5J39 A;  3M4O H;  2YU9 B;  3LNN A;  3DEO A;  4CDF C;  1CKN A;  4CJ0 B;  2K6A A;  1EZ8 A;  3I56 A;  2B2Y C;  2ALY B;  4UP7 A;  2PQE A;  4N8X 1;  2JA7 B;  3FPP A;  5KEE A;  1HHV A;  1SNO A;  1VQE A;  1K73 C;  3KBG A;  3GTK B;  3J7A 5;  2AMC B;  2LXJ A;  2LXK A;  3G6E A;  4DR1 L;  3S2H B;  3S16 H;  1JOR A;  1Q1E A;  3ICE A;  3OTO L;  2NVX B;  5EAY A;  1SRU A;  1EQT A;  1TWH B;  1VQH A;  4V19 0;  2A6H C;  4ZRZ A;  4POF A;  1CZW A;  4DV4 Q;  1QUQ B;  3AB9 A;  4K6D A;  1ET6 A;  1I4P A;  2Z1C A;  4K5W A;  4QIW B;  1I3Q H;  2AUK A;  1KIX A;  2NTS A;  1DD2 A;  3R3O A;  3CCL A;  4OIK A;  5JVG 3;  4JI6 L;  1CKO A;  4EQ5 A;  4R1J A;  1EOT A;  1GD7 A;  4R8N A;  3SK4 A;  1F9S A;  4DN4 M;  3BDO A;  2EVB A;  4AQY Q;  3KF6 A;  1HQR D;  1KQS A;  3I73 A;  1Q7Y C;  2EY1 A;  2PI2 A;  2PNH A;  3MEH A;  1LTI D;  4F88 A;  4WFN 3;  1WFQ A;  3MEF A;  1VQF A;  4M8A A;  5DLQ E;  1CQF A;  4GLV B;  2ZXP A;  3I4N B;  3W1G A;  2L15 A;  1AN8 A;  3I7F A;  2IHE A;  4J6H A;  2IX0 A;  1RDP D;  1VQ7 A;  1PXU A;  2D0P A;  3QOJ A;  5M5W H;  1Q82 C;  2F0J A;  4LF7 Q;  3T53 B;  2R92 B;  1F2Z A;  2RCF A;  4YY3 Q;  3SVM A;  1VS0 A;  5ISR A;  2WB1 B;  3BDL A;  1HA6 A;  3V2T A;  4H44 C;  1UEB A;  4EQN A;  4XQN A;  1TS2 A;  4C3H H;  3PUW A;  3K5O A;  1KDA A;  1SE2 A;  5HUR A;  2IPK D;  4RCO A;  3K59 A;  1TWG H;  2ID0 A;  4A93 G;  4OL7 A;  1H9S B;  1YJW A;  3GTQ H;  3TP6 A;  1HNX Q;  1IZ6 A;  1L1O A;  3DM1 A;  4C2M B;  5T1I A;  4RGM A;  4B3S Q;  2JJQ A;  4OWX B;  3ERS X;  1N34 L;  2OXP A;  2HD3 A;  5IT9 L;  4QGU A;  5EBD A;  1S5B D;  1Q1B A;  3C3L A;  2F0I A;  3I4M B;  2OT2 A;  3P20 A;  5EKL A;  3IAY A;  1UAP A;  3CCV A;  2F03 A;  1LV9 A;  2B29 A;  1WTO A;  3PSI A;  2VQF Q;  4L6T B;  1UEA B;  2R7Z B;  1QJO A;  2SEB D;  4A76 A;  2PQA B;  4KHZ A;  5E3F A;  1HTP A;  2D0O A;  4UDU C;  3H0G G;  4K5X A;  3FVQ A;  2NUC A;  4HJ5 A;  4LAA A;  1MSG A;  2OQK A;  3PF4 A;  3HS0 C;  2ICI A;  1SNP A;  3HG9 A;  3PIO A;  3HOW G;  4X6A H;  2ZXO A;  1PZJ D;  1K83 B;  1HXY D;  3J7Y W;  2FFK B;  4J15 A;  3PO2 B;  3MTS A;  3E9I A;  2K5N A;  5C44 B;  4GS3 A;  1KD1 C;  4DR4 Q;  1JE4 A;  3SDZ A;  2HIX A;  3UDF A;  2RDF A;  3EIV A;  4HSP A;  3HOU G;  3LX0 A;  4K14 A;  3PQI A;  1ENA A;  5JEA G;  4A3F B;  4OIJ A;  2LS0 1;  1SEB D;  3J7A V;  2RHS B;  5C3E H;  2R3Z A;  1E22 A;  1UNS A;  5M3M G;  5EKK A;  1X3E A;  5BR8 Q;  5M3F G;  2F0T A;  3KDF A;  2KED A;  1KL9 A;  1BR9 A;  3KLR A;  4I7A A;  3JAM E;  4RGO S;  1NR4 A;  3H91 A;  3GTO B;  1KNA A;  3VYR A;  4I65 A;  3NBH B;  1NMG A;  4K2L A;  1Z6H A;  4OON A;  3BYT B;  3RLF A;  4FF2 A;  4XYO A;  4JBK A;  3OIP A;  1TS3 A;  5IWA L;  5FLM G;  4JCV E;  2PW5 A;  3I3C A;  4RAU C;  5J22 A;  3TP8 A;  4LNQ A;  2PZW A;  3MC0 B;  2UUC L;  1CA6 A;  1E1O A;  1KLG D;  4X66 Q;  4NMZ A;  5EKI A;  3J7A F;  1Z47 A;  5I9O A;  3PIP 3;  1D6E C;  3Q24 A;  4A3L G;  2VUM G;  4K0K Q;  4L5S A;  3ULP A;  1Q90 A;  4DK6 C;  3QJY A;  1GXD C;  2NVT B;  1OTC A;  3RR5 A;  4DR7 Q;  4DXF A;  4AYB E;  1BVS A;  4YHH L;  1PA6 A;  2EE1 A;  5CC4 A;  1LUZ A;  3CU7 A;  2F0O A;  3L3O C;  4R9W A;  3ONA B;  1IW7 D;  1EY5 A;  2K03 A;  3RD4 A;  2K01 A;  2WAQ B;  3AQQ A;  1G6Z A;  3H3V I;  2K5Q A;  5IP9 H;  3CPW A;  2KHI A;  2EYM A;  4DR2 L;  3GTL H;  4Z9C B;  3VR3 A;  1F2Y A;  3NTK A;  5GAG C;  4HAE A;  4MTN A;  2JA8 H;  4ZAI A;  2CCZ A;  5I9P A;  1EYC A;  2QF7 A;  1PH6 A;  1IBL L;  3D31 A;  1Y8O B;  4R4T A;  3IL8 A;  4OO1 H;  4KTA A;  4DGZ A;  2N88 A;  4A3J G;  1SJE D;  2I5H A;  4PV1 C;  4P2C B;  5EBC A;  3KJO A;  5HGQ A;  1H9S A;  1I4H A;  3PV0 A;  1L0Y B;  1ML0 D;  3GDE A;  2B63 B;  5NUC A;  5DAU A;  1YNN D;  2LSS A;  3FRP B;  4U67 3;  2MP1 A;  3DXJ C;  4CKB A;  3GTJ B;  1VQ4 A;  4ME5 A;  2R93 G;  4YCU A;  1EU4 A;  2PCF B;  4JI8 L;  2HT1 A;  3S1N B;  3FKI H;  4KHP L;  4IPD A;  5ELB A;  5D3D A;  3HRZ C;  3M3Y B;  2PQA A;  5C4X H;  1YIT A;  3HFZ B;  2G5D A;  2YYZ A;  5FJ8 H;  4P71 A;  1CA5 A;  1VF7 A;  1UE5 A;  3RZD B;  1Y1V B;  4A3E B;  3EFX D;  3A55 A;  1LTG D;  2I46 A;  3HGB A;  2IJ0 A;  4LUZ A;  2Y0S G;  4C3I B;  4DNI A;  2ASB A;  4Y7N H;  4X64 L;  4Q5V A;  1WTQ A;  2F0D A;  5COR A;  4I7Z C;  3SE0 A;  2LMC B;  1Z7T A;  1SNM A;  1A3U A;  4K6L A;  1HA5 A;  5KYI A;  2MO0 A;  4HIM A;  2Q2T A;  4NXM Q;  3SEB A;  1R4P B;  2UXB L;  1ZYR C;  4LF8 Q;  5GQO A;  1G29 1;  4DR3 Q;  1GHK A;  4JI1 L;  3V05 A;  5C5L A;  1I6H H;  1A62 A;  1FGU A;  3D8G A;  3CC7 A;  1XNQ Q;  4YIJ A;  2WII B;  4M1U B;  1PH3 A;  4BY7 B;  3I72 A;  3S1R B;  2A69 D;  4DV6 L;  3QO2 A;  4NPS A;  1XNR L;  1XJV A;  5C0X J;  1G6P A;  4A3K H;  3D6W A;  3A8I E;  4XDX A;  1L1O C;  3HZX A;  2WKD A;  2BH8 A;  2M9V A;  3PMF A;  2IT1 A;  5LMN Q;  3PO3 B;  1TKW B;  5KGU A;  4G7H C;  1EY0 A;  1DYQ A;  5HGT A;  1GUT A;  2G9H D;  4WJ3 M;  1O7I A;  4JI7 Q;  1QCB D;  2BOS A;  1MSH A;  2RA4 A;  1PTO D;  4A3B B;  1CSQ A;  4UP9 A;  1ICW A;  1WD0 A;  3CCR A;  5C0X I;  2UXD Q;  1FGB D;  2CW0 D;  3FPU B;  4X62 Q;  4BXX G;  4ZQ3 A;  1ROD A;  1AEX A;  4JI4 Q;  4ULL A;  3OMC A;  1KAW A;  3WWV A;  1XPU A;  2B2W A;  1D1I A;  2DY7 A;  2SOB A;  4DAY A;  1TU2 B;  3B6Y A;  4B9W A;  2YTX A;  4RCN A;  1I4X A;  3C1E A;  4RH6 A;  3K58 A;  1QB5 D;  2JA5 B;  1S72 A;  5BN5 A;  4TKO B;  4S3S A;  4DNR B;  4DAV A;  5IT9 E;  1V1P A;  5J3B A;  1Q46 A;  4EQO A;  1E3P A;  3QR8 A;  2CWP A;  2EQS A;  3NEM A;  4C3J G;  3H94 A;  1S3O A;  2IX3 A;  5C5M A;  1A6X A;  2CHB D;  1CHP D;  1PFN A;  1LTT D;  1B7Y B;  2KCM A;  3M9B A;  1Y1W B;  5D14 A;  1V1O A;  1I94 Q;  3I55 A;  1PH5 A;  2IWH A;  3HOZ B;  2VS1 A;  4FXK C;  4PG3 A;  1BCP D;  2K7V A;  1BBX C;  1TS5 A;  3EQL C;  3BVZ A;  1H9R A;  5GRO A;  1DZ1 A;  3RN2 A;  1RTO A;  4O0A A;  2F0U A;  3NBI A;  4IFD G;  1GOZ A;  3MFY A;  3BZK A;  5JPN C;  1TWF H;  1AH9 A;  3DMU A;  4K8J A;  1E0B A;  3OW7 A;  2PMZ E;  4ID6 A;  4DUZ Q;  3S15 H;  1BKB A;  2KCC A;  3LWE A;  3OYY A;  1Y8N B;  5KYL A;  1QVG A;  3S2D H;  2F4I A;  1WTR A;  1DGS A;  2MQH A;  3ND8 A;  1B50 A;  5M5X H;  2A5H A;  2C35 B;  4DA2 A;  4JK1 C;  1XMQ Q;  1TWA B;  5JJL A;  2M00 A;  2XTI A;  4BY1 G;  3RZO B;  4P73 A;  3R93 A;  3P75 A;  1CUK A;  2Q2H A;  2D2C C;  4N8F A;  1F9R A;  4C56 C;  1JJC B;  1B8A A;  5C4J B;  3E5S A;  4OX9 Q;  1SRO A;  2F0S A;  2E8G A;  4ZKB B;  4IUR A;  3VYT A;  3ERQ A;  1ZXT A;  4DV1 L;  2E2J B;  2JQO A;  1XMO Q;  3J7Z C;  1JCK B;  1VQM A;  1SND A;  1LT6 D;  2CH4 A;  1NCV A;  3H15 A;  1I6V C;  4DV7 L;  1VQD A;  2KOL A;  3HOY G;  4HIO A;  1XWE A;  4RMF A;  3L9A X;  3EVQ A;  3TEH B;  1KAB A;  2WP8 J;  1CM9 A;  1HZC A;  2QGQ A;  4X65 Q;  3U50 C;  4A3G G;  4Q0F A;  1EQQ A;  2NBF A;  4CDD C;  4AIM A;  2L0C A;  3ZJY C;  3TBI B;  1XXG A;  4DFA A;  4Y52 H;  2D5D A;  4A3I H;  2FHT A;  3UDG A;  4J8Q A;  3MAQ A;  4CBV A;  4BBR G;  2DNC A;  4DNT B;  1X9N A;  1C4Q A;  1YNJ D;  4NDX A;  1LM0 A;  4X3S A;  3S1M H;  3OMG A;  5DNF A;  3KF6 B;  1CHQ D;  1SE8 A;  4BBS G;  2HIV A;  2CFM A;  1J5E L;  1BF4 A;  1SAP A;  1AE2 A;  4O1N A;  3MXU A;  1Y14 B;  3GV3 A;  1SYG A;  1NNX A;  2YU9 H;  1IYJ B;  5COY A;  1I4R A;  1SMY C;  1PLF A;  1WVL A;  1QOH A;  3FMC A;  3VR2 A;  2XGT A;  5C3W A;  4YWL A;  4B08 A;  4AYB G;  4O42 A;  1B1Z A;  1O7L A;  4KKS A;  4XQJ A;  2VZA A;  3TS0 A;  1W2B A;  3GQB A;  3PUV A;  3PCO B;  1EYA A;  4F8M A;  4GNX A;  3D6C A;  1NY4 A;  4LF5 Q;  1V9P A;  3GTK H;  2QEJ C;  4H7B A;  1DOM A;  4KY5 A;  4H13 C;  2JXM B;  3S2H H;  5JAV A;  1ZEQ X;  2D62 A;  4A3K G;  1EWH A;  3HOV G;  4GKK L;  3H09 A;  2EYP A;  2NVX H;  2YV5 A;  4JI2 L;  1A3T A;  1VQK A;  1L1O B;  1PYB A;  2NN6 I;  1RTN A;  4FYD A;  3W5O A;  4FXD A;  1GO3 E;  2HHH L;  3F2C A;  1ET9 A;  4KKT A;  4UPA A;  1MJE A;  2UXC Q;  1C8C A;  3DUZ A;  1YBY A;  4DV3 L;  3CCM A;  3TP5 A;  4JV5 Q;  2KEN A;  2B8G A;  4A93 B;  1KHI A;  5DM7 3;  1K28 A;  1K8M A;  3NQT A;  4DR6 Q;  4NXN L;  5JJZ A;  1PDQ A;  3A8J E;  4JW0 A;  4LK1 C;  2F0N A;  2B2W C;  3HOX G;  1ICF B;  2JA6 G;  1WJJ A;  4KMU C;  2F1M A;  3I4N H;  1A0I A;  1U9R A;  1T5X D;  2BE5 C;  3VR5 A;  4JI3 Q;  3H0G B;  5C0X H;  1IXR A;  1ILP A;  2VB3 X;  4WJ4 A;  4LFC L;  1CKM A;  1HFG A;  1KDB A;  2R92 H;  2B39 A;  1PFB A;  4N9T A;  4KY6 A;  3HOW B;  4LFB Q;  2E5L L;  1VQA A;  2Q2U A;  5K36 G;  1NUC A;  5D65 A;  4LF4 L;  1FL0 A;  2A6E C;  2KBN A;  3NE5 B;  3LWU A;  4LUO A;  3HOU B;  5BN4 A;  3KDF B;  1IBM L;  4LF6 L;  1S5D D;  3J80 i;  1QG7 A;  4FVM A;  1K8O A;  1E1T A;  1WCM G;  4PMB A;  3RNU A;  4XYQ A;  4N9P A;  4C2M H;  3C2P A;  2E2D C;  3S1Q B;  2PO4 A;  1A2T A;  5M3M B;  3T4A C;  3F2D A;  3I4M H;  1JOQ A;  1NTG A;  1CTM A;  2DNE A;  5M3F B;  4GKJ L;  1MD2 D;  1EU3 A;  1QIL A;  2R7Z H;  3VDY A;  1BOS A;  1C9O A;  2A68 C;  3U4V A;  1SYE A;  1O78 A;  4PQX A;  2R7F A;  1F9P A;  2XVS A;  3GP7 A;  3GTM B;  5CMD A;  4FXG C;  3FP9 A;  1N33 L;  1N32 L;  4LF9 Q;  1K83 H;  1HCZ A;  3PO2 H;  1AZP A;  5C44 H;  2N3S A;  2NYZ D;  2H4O A;  2WIN B;  1PFM A;  1D5M C;  2E74 C;  5E4X A;  5G3L D;  3UDX A;  2PPB C;  1VQB A;  1YJN A;  1Q8I A;  2VL6 A;  2VUM B;  2D9U A;  1K3B C;  3PUZ A;  3K57 A;  2XRS D;  2UUB Q;  2NVQ B;  4A3F H;  4IUN A;  3QIA A;  4QUC A;  3MWY W;  4K5V A;  2EPB A;  1K0S A;  2AUJ D;  3SGI A;  1RD9 D;  2E2H B;  3I4L A;  2GVB A;  3F2B A;  2B2T A;  1UE6 A;  5ELN A;  1BNZ A;  1E2W A;  3GTO H;  1W3S A;  4BA2 I;  1N8R C;  1K9M C;  1YNX A;  2Q8I B;  3ERO A;  2MPM A;  3L0O A;  4A3J B;  2L9H A;  4A3I G;  5JJK A;  1SXT A;  1FD7 D;  3SK5 A;  1HZB A;  4HMI A;  4A3D G;  3VR4 A;  1UWV A;  5IE8 A;  1VQL A;  1SNQ A;  1PTO B;  4PZ7 A;  1EEI D;  5F2D A;  5JOB A;  4DR1 Q;  1AW7 A;  1EY4 A;  3CHB D;  2R93 B;  2HCC A;  1I3Q B;  3MVV A;  1EQR A;  2NB0 A;  3OTO Q;  2MFI A;  2NVT H;  1DOL A;  3TQY A;  1HPC A;  1WYD A;  4P75 A;  1E2Z A;  1JJ2 A;  3KYH C;  4MTK A;  3TN2 A;  1X54 A;  3J81 j;  4KN4 C;  1U5K A;  5FLX L;  1N36 L;  4JI6 Q;  2Y0S B;  5IYD G;  1X3F A;  3JAM c;  1VQP A;  4R4Q A;  4GNX C;  1C7Y A;  1MJC A;  1V43 A;  5I6Y A;  4DV2 L;  1HUN A;  4JI0 Q;  4QCL A;  2B63 H;  5GAH C;  1JQY D;  3S14 B;  1ENC A;  1GUN A;  4ZLT F;  2PZU A;  3T16 A;  2DGY A;  2J0T D;  4B3R L;  3GTJ H;  3R2T A;  4A3C G;  1SR3 A;  3MXP A;  3IFD A;  2EYL A;  3ITP A;  3S1N H;  3M3Y H;  2RHQ B;  1Q86 C;  3OWE B;  5LL6 X;  3OW2 A;  2AHO B;  3RZD H;  2K5V A;  2F0E A;  3NWT A;  1R9T B;  2FIN B;  1Y1V H;  4A3E H;  1I4Q A;  2KUM A;  4XT3 B;  4X3T A;  1EOV A;  3H6M A;  2NN6 H;  1Y8P B;  4BA1 I;  1UUP A;  3E6Z X;  4CKC A;  1WTV A;  3K5L A;  4C3I H;  2DN8 A;  4RKB A;  2FMC A;  2K4K A;  4HTH A;  4DK3 C;  1N34 Q;  1G8Z D;  1V1Q A;  4DAY B;  4LF8 L;  2RQX A;  3K81 C;  4GOP A;  2R61 A;  4V0B A;  5C0X G;  1TXY A;  4A75 A;  1IBK L;  3CXC A;  5GAE C;  1Q8K A;  1EYG A;  1XNQ L;  1STE A;  3A5Z B;  3ER0 A;  3TZD A;  4QY7 A;  4HJ8 A;  1V1P B;  4JBJ A;  1X55 A;  2DJG C;  1RJT A;  1OXV A;  4HN7 A;  1S40 A;  4FF1 A;  1HR0 L;  3K0Y A;  2OQ0 A;  5IYB H;  2HUG A;  1PZI D;  2Q8R E;  5C4H A;  3D4W A;  4BY7 H;  1N9W A;  2N8N A;  1H95 A;  5ELO A;  3CCJ A;  4KJO A;  3S1R H;  1T5E A;  4DV0 L;  1VQ9 A;  3IKJ A;  3AEV A;  4PNY A;  2AQ3 B;  1RHP A;  1YEZ A;  1M90 C;  3ND9 A;  4DAM A;  3PUX A;  5KRU A;  3R2I A;  4C3J B;  4HMJ A;  4GLA C;  1QNU A;  4C1N K;  3WDN A;  5EGT A;  4DK0 A;  3PO3 H;  4X62 L;  1PTO F;  1STG A;  2QEX A;  4ZUJ A;  4QUF A;  3BU2 A;  1VMP A;  2EXD A;  2F0M A;  4A3B H;  3LGJ A;  2JE6 I;  1VF5 C;  3A7A B;  1YHB A;  2IX1 A;  2KEC A;  4XXE A;  2MGS A;  4G4K A;  1TWC B;  4ZKC B;  2VXW A;  4KHV A;  1NAP A;  1JR0 D;  3ULL A;  4IJL A;  1PYS B;  1PFS A;  2AQ1 B;  5IWA Q;  1JWU D;  4DV5 L;  4DU9 A;  2MNA A;  1EL0 A;  1DCZ A;  1HNW L;  2QIL A;  2K52 A;  5CYU A;  2UUC Q;  1X6O A;  4IJH A;  1Q3L A;  2JSO A;  3M85 A;  4B3T Q;  2KVM A;  3F2U A;  4HCE A;  4C3H G;  5CR3 A;  4IUU A;  1WTH A;  1I94 L;  2K5W A;  2NWG A;  4PZ6 A;  4BY1 B;  4K8I A;  3ULJ A;  1SE4 A;  2EDG A;  3UDI A;  1FJG L;  1ASY A;  5EPL A;  5C4Z A;  4DUY L;  3NHH A;  4YHH Q;  3J80 L;  1V8Q A;  4RG1 A;  1Y1W H;  1NBW A;  1DOK A;  1JOK A;  2B2T C;  2K32 A;  1ONL A;  1BCP F;  2XIW A;  2B3G A;  2Z9H A;  4B3M L;  3HOZ H;  1HUM A;  3VYU A;  2N78 A;  5IYC H;  3BDC A;  4FF4 A;  1IYU A;  1F2L A;  1AFP A;  1A15 A;  2QDL A;  2PI2 E;  3MA2 B;  1VQ5 A;  2A1A A;  3MHB A;  2MHV A;  1XX8 A;  1IBL Q;  3HOY B;  4G7Z C;  1DXM A;  3TSS A;  1YIJ A;  1XMQ L;  5IP7 H;  1SYC A;  3W3A A;  1TR5 A;  1SLJ A;  3I8Z A;  3O13 A;  4IOA A;  5IGF A;  2B2U A;  3X3N A;  2VQE L;  1HR0 W;  1NR2 A;  5KNB A;  4YCV A;  3M4Q A;  4K2K A;  3AYH B;  1TWA H;  4A3G B;  4JPB W;  3RZO H;  4JBW A;  5FO7 B;  5LMN W;  4E6I A;  2ES2 A;  1IW7 C;  1X32 A;  1SBB B;  1GUG A;  4JI8 Q;  5C6A A;  4KHP Q;  5CV4 A;  5C4J H;  4BBR B;  2VY3 A;  2ZM6 L;  5E1F A;  4RA8 A;  1GM5 A;  1D8L A;  1ASZ A;  5C3E G;  2F4V Q;  1CSP A;  3T1Y L;  1QZH A;  2E2J H;  1CK1 A;  3G4S A;  1NJI C;  2F0V A;  4KI0 A;  1VQI A;  3HKZ E;  3ZYY X;  4RHS A;  4BBS B;  4R4I A;  1VQG A;  4QL5 A;  4GNX B;  3S24 A;  4X64 Q;  1BUV T;  4NP5 A;  4X65 L;  1BBU A;  4OEM B;  5H1S E;  2HQE A;  2KCN A;  3CRK C;  3DEP A;  4ZCK A;  3T1H L;  2SNM A;  4FO2 A;  4RHR A;  1SN8 A;  1YNN C;  3BS1 A;  1BXT A;  5I2Y A;  4AYB B;  1EWC A;  2EY2 A;  2OWO A;  2UXB Q;  1E7Z A;  4P74 A;  3KLS X;  4JI5 Q;  2I0Q A;  1AE3 A;  2EY5 A;  4JI1 Q;  4KD3 A;  1XTD A;  2O4X A;  3URY A;  4IOC A;  1DON A;  4LWC A;  5FLX E;  2EJF C;  3BZD B;  1MI2 A;  2C9O A;  3G48 A;  4LFA L;  4A3E G;  4XQQ A;  4A3K B;  3HOV B;  3QWN A;  2OF1 A;  5HY6 A;  1QWY A;  3CKI B;  4ILW A;  4EVO A;  2RKS A;  3N52 A;  1VQJ A;  2I5L X;  4WRD A;  3CCU A;  4XT1 B;  2KHS A;  4DV6 Q;  2AKW B;  4IO9 A;  3G6J B;  3GO5 A;  1D7Q A;  1XNR Q;  3PF5 A;  4EQP A;  2C5C A;  2NZO A;  2IW3 A;  1Q12 A;  4JOI A;  5EJW A;  5IP9 G;  2K5D A;  5IOD A;  3UE0 A;  1B2T A;  1EQV A;  2H1E A;  3MZ5 A;  2JA8 G;  1AP0 A;  4H02 A;  1K8G A;  4XIG S;  3AFP A;  4GOP C;  3N6R A;  2EXZ A;  3KLW A;  3U4Z A;  1B4O A;  2NTT A;  3I90 A;  1IKL A;  3K80 C;  3KJP A;  3STB D;  4OO1 G;  2G9D A;  4O2D A;  1LYL A;  4DPG A;  2AQ2 B;  2O2L D;  5D3I B;  3HOX B;  4QIW E;  2J4X A;  4JG2 A;  2CVR A;  4KK7 A;  4HID A;  3P7J A;  3A74 A;  2JA6 B;  3OPO A;  4A3M H;  4H0L C;  1LO5 D;  2F0P A;  1GJX A;  1X3P A;  2IY5 B;  5LMU Q;  2ZJQ A;  4PMC A;  4MIU A;  1DM0 B;  2A69 C;  4GLX A;  5A2Q L;  1UE7 A;  3NXW A;  4HJ7 A;  4DR5 L;  3FKI G;  1KXL A;  4JV5 L;  5ELF A;  1CT1 D;  1RF2 D;  2GA4 B;  3C1F A;  5C4X G;  3I91 A;  3J81 c;  4IN3 A;  1PRT D;  5FJ8 G;  1QNK A;  4DK1 A;  2F0K A;  3KOJ A;  1SYD A;  1NE3 A;  3A7L A;  2QA4 A;  2A6H D;  3VYS A;  1PTO C;  1GHJ A;  2PYK A;  2E2I B;  1JIC A;  3KK7 A;  4ABN A;  1XTC D;  2MJ8 A;  4IUP A;  1WCM B;  2WB1 E;  1EIH A;  2CW0 C;  2EOT A;  2RCN A;  1HNZ Q;  2DUD A;  4JI3 L;  2Q8T A;  1VQN A;  3GTP B;  4OXP A;  3K5N A;  4RGT A;  2JEA I;  3DLL A;  2X6G A;  4IPG A;  5FKA C;  4J1M A;  5M9O A;  1YZ6 A;  1A3V A;  2DJF C;  1MGS A;  2K5H A;  5DM6 3;  4ZK9 B;  1QE6 A;  1JWM D;  1QVC A;  1W6K A;  3M7G A;  3GV6 A;  4OGQ C;  1STN A;  5CV7 A;  2JP1 A;  1LT5 D;  1PH2 A;  1STH A;  1U4M A;  3M7N A;  1KDC A;  2JA7 H;  3SHL A;  3HOW H;  5IGD A;  1STB A;  3GTG B;  1KRT A;  4GN3 B;  1SE3 A;  3CF5 A;  4DV4 L;  3HOU H;  4KD4 A;  2HCI A;  3S9W A;  5DEH A;  3Q22 A;  1TWH H;  2L11 A;  4UHV A;  5JEA H;  4QQB X;  1L2F A;  1U4P A;  1OXU A;  4ODG A;  5IGE A;  3J81 i;  1VQ6 A;  4R4O A;  1BCP C;  4U68 A;  1EUJ A;  3S1Q H;  1B53 A;  4KV6 A;  4DV1 Q;  2DY8 A;  5A35 A;  5M3M H;  1HZA A;  5EPK A;  1WTW A;  1X65 A;  5M3F H;  2VW9 A;  4AQY L;  1J6Q A;  4JC0 A;  1J8I A;  3S17 B;  2X69 A;  4MN3 A;  5CGK A;  4DV7 Q;  3MXN A;  2F0F A;  2Z6K A;  3UE1 A;  4LF9 L;  1J9O A;  3JC6 6;  5IGC A;  2KEE A;  1TII D;  4KKU A;  3GTM H;  3J80 E;  2B2U C;  4MHE A;  4LF7 L;  1HTL D;  5LL6 S;  4NKL A;  1UE1 A;  5FLM H;  5KND A;  4DAP A;  2CH4 W;  4YY3 L;  1SFO B;  1VQ8 A;  3NTI A;  4A3D B;  1BQQ T;  2YTV A;  4IPH A;  4IPC A;  2KHJ A;  4R4C A;  4A3L H;  3U58 A;  2VUM H;  3X3M A;  1IHZ A;  1ENF A;  2NVY B;  2OTJ A;  1FYC A;  1Y69 U;  2J7Z A;  2NVQ H;  1VDZ A;  2VNU D;  3UI2 A;  1XYI A;  1HNX L;  1K0R A;  4YWM A;  4B3S L;  4JYA Q;  2EYO A;  2OCE A;  2LKV A;  1BDO A;  2E2H H;  2PMZ B;  3SR1 A;  3BVG A;  3HKS A;  5M5Y B;  1A2U A;  3BJU A;  4DF7 A;  1J5E Q;  3R8B A;  1YHA A;  2VQF L;  4IAL A;  1WOC A;  3CD6 A;  3MXG A;  1KC8 C;  1U4R A;  2UU9 Q;  1K8A C;  2BDO A;  3CCS A;  2WAQ E;  3RUZ A;  3A5U A;  4A3J H;  3A8K E;  1MIU A;  2O5J C;  1TS4 A;  1PRT C;  5K5P A;  2ATW A;  2A73 B;  4X3U A;  2UUA Q;  2KCT A;  5FO8 B;  3CMA A;  1PTO H;  3K7A B;  3CQZ B;  2PNR C;  4IUT A;  5I2X A;  4DR4 L;  4TQU S;  1EIY B;  5AJ3 Q;  2QCP X;  3TP7 A;  2R93 H;  1YNJ C;  4GKK Q;  2L1B A;  2H5X A;  2XRQ D;  3K7U C;  1S5F D;  5CV8 A;  4L5R C;  2EZV A;  2Z6B A;  1ESR A;  4JI2 Q;  1Z9F A;  3TRE A;  1JT8 A;  4JOI C;  1VQO A;  2EY6 A;  2HHH Q;  2JK8 A;  4GOP B;  1KAA A;  3TDQ A;  2SDF A;  3A0J A;  1I50 B;  5BR8 L;  4DV3 Q;  4OWT B;  1A8V A;  2R7D A;  3OIQ A;  1WI5 A;  3G71 A;  4A4I A;  1OO9 B;  4A3M G;  2ZTD A;  4P72 A;  4JI0 L;  4NXN Q;  2JEB I;  3PIP A;  3M4O B;  1JE5 A;  2X6L A;  5IIF A;  4L63 B;  1TY0 A;  2K50 A;  1IL8 A;  1YVC A;  4TSS A;  5EPJ A;  2EJG C;  1D5Z C;  2IL8 A;  1I4G A;  2L4N A;  1GVP A;  1TVX A;  3S14 H;  4X66 L;  4UAI A;  2ZXR A;  3EA6 A;  5CV9 A;  3NPP A;  1L0W A;  1RIP A;  4K0K L;  2I5M X;  4LFC Q;  3HKZ G;  3S16 B;  2KA7 A;  2ZT9 C;  3KFU A;  2ICE C;  3T13 A;  1KTK A;  4APV A;  4DR7 L;  2E5L Q;  3RLO A;  2AWO A;  2MO1 A;  4JVZ A;  4LF4 Q;  1S5C D;  1T9H A;  1G2T A;  3EBE A;  2LFN A;  5ELC A;  1R9T H;  3CRL C;  1IBM Q;  3W1B A;  4LF6 Q;  1HZ9 A;  1OXX K;  1VCI A;  3PGZ A;  1NMF A;  3NP8 A;  5JPM C;  2BA1 A;  5FK9 C;  3FHW A;  2E75 C;  5A2Q E;  2F0L A;  3CAM A;  3BYY B;  1P16 A;  4F7X A;  5I6W A;  4GKJ Q;  4BXX H;  3DWP A;  3M4P A;  2JA7 G;  2ZJR A;  1VMC A;  1RL2 A;  4CDC C;  1OXS C;  3OSO A;  1O80 A;  4ZUI A;  3AMU A;  1EIF A;  1ZYR D;  5I4D A;  4IUQ A;  5M5W B;  4PMW A;  3TME A;  1U0L A;  4TVA B;  1N33 Q;  1WTX A;  4HR7 B;  1NSN S;  4OHJ A;  1N32 Q;  4GZY C;  4JBM A;  3CW2 C;  4OWW B;  4C3H B;  4C3J H;  1BCP B;  5CBE E;  1TWG B;  2K75 A;  2PZT A;  4ALP A;  1IKM A;  2EYF A;  3GTQ B;  1S4Z A;  4DXG A;  4IQZ A;  2F0Q A;  5JVH 3;  3BVM A;  1LTS D;  1B44 D;  2PW7 A;  1ILQ A;  2WKC A;  1QUQ A;  1LT4 D;  4C1N I;  3NK9 A;  4HJA A;  1XPR A;  1PHJ A;  2Z6K C;  3DM3 A;  1TY2 A;  3KUP A;  1HQM C;  1TWC H;  5EQ0 A;  3CME A;  3NEN A;  3P1H A;  4NXM L;  1B3Q A;  1G51 A;  1FR3 A;  1R4Q B;  3I4N G;  1H9K A;  3AU7 A;  3NUC A;  3MFG A;  4EX5 A;  1PH1 A;  4IFD H;  4DR3 L;  4B3T L;  1RCV D;  4HED A;  1TT2 A;  4X3K A;  2RSN A;  2WV6 D;  4OEL B;  1PMR A;  5L37 A;  2R92 G;  4LW1 A;  1EY7 A;  1MHW C;  1LAB A;  2F0H A;  3TZU A;  2WB1 G;  1SNC A;  3K8A A;  3CCE A;  5ELD A;  3JAM i;  2L5T A;  3OOC A;  3M4Y A;  4WOR A;  5IY0 A;  2LY7 A;  3AFQ A;  3Q8D A;  3CC2 A;  1EEF D;  4BY1 H;  1A63 A;  2JYO A;  3DWA A;  2ZJP A;  5LMN L;  3CCQ A;  3E3X A;  4PZ8 A;  5TSS A;  2BDN A;  1PYW D;  2WFW A;  4JI7 L;  1B3A A;  1PVO A;  3J81 L;  5C3E B;  2OTL A;  3RLN A;  4CDE C;  4CGY B;  4L8J A;  4RFB A;  2HDL A;  5CV6 A;  3I4M G;  1G2S A;  2UXD L;  2QDB A;  4ME3 A;  2EYH A;  1N36 Q;  2BA0 A;  3PIO 3;  4JI4 L;  2R7Z G;  3A54 A;  1GUS A;  1W6J A;  2XNA C;  1PRT B;  3HOY H;  5IOC A;  1LAC A;  2XN9 C;  3U9O A;  1PZK D;  3HP3 A;  4QMG A;  3I2Z A;  2P5Z X;  3L7Z C;  4TRD A;  4DV2 Q;  1IL2 A;  1H9M A;  4KY7 A;  4CJ1 B;  2RDH A;  5JEA J;  5IGG A;  2B2V A;  3D0F A;  3U9S A;  1K3R A;  1QZG A;  3PO2 G;  1FNW A;  5C44 G;  4L5T A;  1EY8 A;  1F2M A;  4A3G H;  4B3R Q;  2F4V L;  1RKN A;  1SJH D;  2JA5 H;  4CHT B;  4QB4 A;  4HJ9 A;  2V1C C;  4A3F G;  5ELE A;  4BBR H;  1PH7 A;  2ZTC A;  4LUV A;  2Z4I A;  2F3W A;  1DJR D;  3GTL B;  3EN2 A;  5CV5 A;  4L5Q A;  2JA8 B;  4BBS H;  4IUV A;  3W2D A;  1ESF A;  4JI5 L;  1CI3 M;  3BZC A;  5C3X A;  1E2V A;  1IBK Q;  4DR2 Q;  3CPF A;  5JJI A;  4QF4 A;  1FNV A;  4GN5 A;  1EWI A;  2XWB B;  1MBY A;  1JB7 A;  1EZ6 A; 
#chains in the Genus database with same CATH homology
 2ENB A;  3H3V C;  3NBH A;  5T1G A;  5J1Z A;  2HDM A;  3V96 A;  2XWJ B;  4LJZ C;  3FEW X;  2L55 A;  1SSO A;  3RMH A;  1G91 A;  1C48 A;  3FKI B;  1EY6 A;  1D5X C;  5C4X B;  3T51 B;  3I70 A;  1H9J A;  4RGN A;  1F77 A;  1LTB D;  3VA7 A;  5FOB B;  1EFI D;  3E0J A;  1O7Z A;  3NTH A;  4RKL A;  4ZYS A;  2M2L A;  4Y7N B;  1LTA D;  2F3V A;  3G7L A;  1FNU A;  3Q6S A;  5BN3 A;  2KJX A;  1CZG A;  2NZ1 D;  2F0W A;  1SMY D;  2K05 A;  3VR6 A;  2KQ3 A;  2FJ2 A;  1IYV A;  2V4D A;  2EJM A;  2B2Y A;  2RVL A;  3Q23 A;  4CJ2 C;  1I6H B;  3T56 B;  1D1K A;  1PRT F;  3SK8 A;  5K36 H;  1STY A;  4FP5 D;  2MUY A;  1CFM A;  3NWS A;  1JOO A;  5CBA E;  1S5E D;  3GD7 A;  2NN6 G;  2RSO A;  4C3I G;  2A74 C;  1U4L A;  2VB2 X;  1OXT A;  2K04 A;  2Z8L A;  4BS9 A;  3WOE A;  4KN7 C;  3OHX C;  2I07 B;  1JB3 A;  1X3Q A;  3K5M A;  3BG3 A;  1SYB A;  3D4R A;  3NSW A;  4FF3 A;  1SDF A;  2BE5 D;  5E4W C;  4XTC S;  1WTP A;  1B9N A;  1M8A A;  5KNC A;  3D4D A;  2R6G A;  5FO9 B;  2B8F A;  4WJW A;  1EYD A;  3KLS A;  4HCS A;  4IZ8 A;  2A6E D;  5KIX A;  1CQV A;  2EYJ A;  5LHY 1;  1WD1 A;  1EY9 A;  2RDG A;  4EGV A;  1HRJ A;  4G7O C;  2CQA A;  1KLU D;  4LMQ D;  1TQO A;  3QOL A;  4BWG B;  1GUO A;  3D3R A;  1EIG A;  3HEJ A;  1LLR D;  1TWF B;  2RBM A;  2AWN A;  2B2V C;  2L12 A;  3WOF A;  2XSC A;  2A68 D;  2E76 C;  3A56 A;  3S15 B;  3J81 E;  1AZQ A;  3S2D B;  3QB3 A;  1ZKO A;  5M5X B;  1STA A;  3JAM L;  4R8I A;  2TMP A;  1B9M A;  1L0X B;  4F87 A;  1KNE A;  1LTR D;  2Z4H A;  4HSV A;  4CKE A;  2SNS A;  2OEO A;  3K6O A;  4IFD J;  2FMM A;  3IFT A;  4G57 A;  3DWQ A;  3PUY A;  4FNF A;  3EJI A;  2K28 A;  4A3M B;  3NQI A;  2F0G A;  4IFD I;  2QKI C;  1SYF A;  2WAC A;  4NW2 A;  3SK6 A;  5IGB A;  1BO0 A;  1F9Q A;  1D2B A;  2K33 A;  2TSS A;  1II3 A;  3QG1 A;  3HKZ B;  4A3I B;  5G3L F;  1GUW A;  1JWS D;  3VA5 A;  2O5I C;  1HFN A;  5AFW A;  4B9X A;  2N55 A;  3S1M B;  3C46 A;  4OO1 I;  4KJN A;  3DHQ A;  3KBX A;  3FDT A;  3KF8 A;  1JC7 A;  3OWF A;  4RWS C;  1LT3 D;  2K1B A;  2BCO A;  3SXH A;  1M4V A;  1O7Y A;  3Q0A A;  5J39 A;  2YU9 B;  3LNN A;  3DEO A;  4CJ0 B;  2K6A A;  1EZ8 A;  2B2Y C;  2PQE A;  2JA7 B;  3FPP A;  5KEE A;  1HHV A;  1SNO A;  3KBG A;  3GTK B;  3S2H B;  1JOR A;  1Q1E A;  2NVX B;  1EQT A;  1TWH B;  4V19 0;  2A6H C;  4ZRZ A;  1CZW A;  3AB9 A;  4K6D A;  1ET6 A;  4K5W A;  1I4P A;  2Z1C A;  4QIW B;  2AUK A;  1DD2 A;  2NTS A;  3R3O A;  4OIK A;  5JVG 3;  1EOT A;  4R8N A;  3SK4 A;  1F9S A;  4DN4 M;  3BDO A;  2EVB A;  1HQR D;  3I73 A;  2EY1 A;  3MEH A;  1LTI D;  4F88 A;  4WFN 3;  4M8A A;  1CQF A;  2ZXP A;  3I4N B;  1AN8 A;  4J6H A;  2IX0 A;  1RDP D;  1PXU A;  3QOJ A;  2F0J A;  3T53 B;  2R92 B;  1F2Z A;  3SVM A;  5ISR A;  2WB1 B;  3BDL A;  1HA6 A;  3V2T A;  4H44 C;  4EQN A;  4XQN A;  1TS2 A;  3PUW A;  3K5O A;  1KDA A;  1SE2 A;  5HUR A;  2IPK D;  4RCO A;  3K59 A;  2ID0 A;  4OL7 A;  1H9S B;  3TP6 A;  3DM1 A;  4C2M B;  5T1I A;  4RGM A;  2OXP A;  5IT9 L;  5EBD A;  1S5B D;  1Q1B A;  3C3L A;  2F0I A;  3I4M B;  2OT2 A;  3P20 A;  5EKL A;  3IAY A;  1UAP A;  2F03 A;  1LV9 A;  1WTO A;  4L6T B;  1UEA B;  2R7Z B;  1QJO A;  2SEB D;  4KHZ A;  5E3F A;  1HTP A;  4UDU C;  4K5X A;  3FVQ A;  2NUC A;  4LAA A;  1MSG A;  3HS0 C;  2ICI A;  1SNP A;  3HG9 A;  2ZXO A;  1PZJ D;  1K83 B;  1HXY D;  3J7Y W;  2FFK B;  3PO2 B;  3MTS A;  5C44 B;  1JE4 A;  3SDZ A;  2RDF A;  4HSP A;  3LX0 A;  4K14 A;  1ENA A;  5JEA G;  4A3F B;  4OIJ A;  2LS0 1;  1SEB D;  3J7A V;  2R3Z A;  1UNS A;  5EKK A;  2F0T A;  2KED A;  1BR9 A;  3KLR A;  3JAM E;  4RGO S;  1NR4 A;  3H91 A;  3GTO B;  1KNA A;  3VYR A;  4I65 A;  4K2L A;  1Z6H A;  3BYT B;  3RLF A;  4FF2 A;  4XYO A;  3OIP A;  1TS3 A;  5J22 A;  2PW5 A;  3I3C A;  4RAU C;  3TP8 A;  2PZW A;  3MC0 B;  1CA6 A;  1KLG D;  4NMZ A;  5EKI A;  3J7A F;  1Z47 A;  5I9O A;  3PIP 3;  1D6E C;  3Q24 A;  1Q90 A;  3QJY A;  1GXD C;  2NVT B;  4DXF A;  2EE1 A;  5CC4 A;  3CU7 A;  2F0O A;  3L3O C;  4R9W A;  3ONA B;  1IW7 D;  1EY5 A;  2K03 A;  3RD4 A;  2K01 A;  2WAQ B;  1G6Z A;  2K5Q A;  2EYM A;  4Z9C B;  3VR3 A;  1F2Y A;  3NTK A;  4HAE A;  4ZAI A;  5I9P A;  1EYC A;  2QF7 A;  3D31 A;  1Y8O B;  3IL8 A;  4OO1 H;  4KTA A;  4DGZ A;  2N88 A;  1SJE D;  4PV1 C;  4P2C B;  5EBC A;  1H9S A;  1I4H A;  3PV0 A;  1L0Y B;  1ML0 D;  2B63 B;  5NUC A;  5DAU A;  1YNN D;  3FRP B;  4U67 3;  2MP1 A;  3DXJ C;  4CKB A;  3GTJ B;  4ME5 A;  1EU4 A;  2PCF B;  3S1N B;  5ELB A;  5D3D A;  3HRZ C;  3M3Y B;  2YYZ A;  1CA5 A;  1VF7 A;  3RZD B;  1Y1V B;  4A3E B;  3EFX D;  3A55 A;  1LTG D;  2I46 A;  3HGB A;  2IJ0 A;  4C3I B;  4Q5V A;  1WTQ A;  2F0D A;  5COR A;  4I7Z C;  3SE0 A;  2LMC B;  1Z7T A;  1SNM A;  1A3U A;  4K6L A;  1HA5 A;  5KYI A;  3SEB A;  1R4P B;  1ZYR C;  1G29 1;  1GHK A;  3V05 A;  5C5L A;  3D8G A;  4YIJ A;  2WII B;  4M1U B;  4BY7 B;  3I72 A;  3S1R B;  2A69 D;  3QO2 A;  5C0X J;  3D6W A;  3A8I E;  4XDX A;  3HZX A;  2WKD A;  2M9V A;  3PMF A;  2IT1 A;  3PO3 B;  1TKW B;  5KGU A;  4G7H C;  1EY0 A;  1DYQ A;  5HGT A;  1GUT A;  2G9H D;  1QCB D;  2BOS A;  1MSH A;  2RA4 A;  1PTO D;  4A3B B;  1ICW A;  1WD0 A;  5C0X I;  1FGB D;  2CW0 D;  3FPU B;  4ZQ3 A;  1ROD A;  1AEX A;  4ULL A;  3OMC A;  2B2W A;  1D1I A;  2DY7 A;  2SOB A;  4DAY A;  1TU2 B;  4B9W A;  4RCN A;  1I4X A;  3C1E A;  4RH6 A;  3K58 A;  1QB5 D;  2JA5 B;  5BN5 A;  4TKO B;  4S3S A;  4DNR B;  4DAV A;  5IT9 E;  1V1P A;  4EQO A;  4C3J G;  3H94 A;  2IX3 A;  5C5M A;  1A6X A;  2CHB D;  1CHP D;  1PFN A;  1LTT D;  1Y1W B;  5D14 A;  1V1O A;  2IWH A;  3HOZ B;  4FXK C;  1BCP D;  2K7V A;  1BBX C;  1TS5 A;  3EQL C;  3BVZ A;  1H9R A;  1DZ1 A;  1RTO A;  2F0U A;  3NBI A;  4IFD G;  1GOZ A;  3MFY A;  5JPN C;  3DMU A;  4K8J A;  1E0B A;  3OW7 A;  4ID6 A;  2KCC A;  3LWE A;  1Y8N B;  5KYL A;  2F4I A;  1WTR A;  3ND8 A;  1B50 A;  2A5H A;  4DA2 A;  4JK1 C;  1TWA B;  2M00 A;  3RZO B;  3R93 A;  3P75 A;  2D2C C;  1F9R A;  4C56 C;  5C4J B;  3E5S A;  2F0S A;  4ZKB B;  4IUR A;  3VYT A;  3ERQ A;  1ZXT A;  2E2J B;  1JCK B;  1SND A;  1LT6 D;  1NCV A;  1I6V C;  2KOL A;  1XWE A;  3L9A X;  3EVQ A;  1KAB A;  2WP8 J;  1CM9 A;  4Q0F A;  2NBF A;  2L0C A;  3TBI B;  1XXG A;  4DFA A;  2D5D A;  2FHT A;  4J8Q A;  3MAQ A;  4CBV A;  2DNC A;  4DNT B;  1C4Q A;  1YNJ D;  4NDX A;  4X3S A;  3OMG A;  5DNF A;  1CHQ D;  1BF4 A;  1SAP A;  4O1N A;  3MXU A;  3GV3 A;  1SYG A;  5COY A;  1I4R A;  1SMY C;  1PLF A;  1WVL A;  1QOH A;  3FMC A;  3VR2 A;  5C3W A;  4B08 A;  4O42 A;  1B1Z A;  1O7L A;  4KKS A;  4XQJ A;  3GQB A;  3PUV A;  1EYA A;  4F8M A;  3D6C A;  2QEJ C;  4H7B A;  1DOM A;  4KY5 A;  4H13 C;  2JXM B;  5JAV A;  1ZEQ X;  2D62 A;  1EWH A;  3H09 A;  2EYP A;  1A3T A;  2NN6 I;  1RTN A;  4FYD A;  4FXD A;  1ET9 A;  4KKT A;  1C8C A;  3DUZ A;  3TP5 A;  2B8G A;  4A93 B;  5DM7 3;  1K8M A;  3NQT A;  5JJZ A;  1PDQ A;  3A8J E;  4LK1 C;  2F0N A;  2B2W C;  4KMU C;  2F1M A;  1U9R A;  1T5X D;  2BE5 C;  3VR5 A;  3H0G B;  5C0X H;  1ILP A;  2VB3 X;  1KDB A;  1HFG A;  2B39 A;  1PFB A;  4N9T A;  4KY6 A;  3HOW B;  5K36 G;  1NUC A;  5D65 A;  2A6E C;  3NE5 B;  3LWU A;  3HOU B;  5BN4 A;  1S5D D;  1QG7 A;  4FVM A;  1K8O A;  4PMB A;  4XYQ A;  4N9P A;  3C2P A;  2E2D C;  3S1Q B;  2PO4 A;  1A2T A;  5M3M B;  3T4A C;  1JOQ A;  2DNE A;  1CTM A;  5M3F B;  1MD2 D;  1EU3 A;  1QIL A;  1BOS A;  2A68 C;  1SYE A;  1O78 A;  4PQX A;  2XVS A;  1F9P A;  3GP7 A;  3GTM B;  5CMD A;  4FXG C;  1HCZ A;  1AZP A;  2NYZ D;  2H4O A;  2WIN B;  1PFM A;  1D5M C;  2E74 C;  5E4X A;  5G3L D;  2PPB C;  1Q8I A;  2VUM B;  2D9U A;  3PUZ A;  3K57 A;  2XRS D;  2NVQ B;  4IUN A;  3QIA A;  4QUC A;  3MWY W;  4K5V A;  2EPB A;  2AUJ D;  1RD9 D;  2E2H B;  3I4L A;  2B2T A;  1BNZ A;  1E2W A;  4BA2 I;  2Q8I B;  3ERO A;  2MPM A;  4A3J B;  2L9H A;  1SXT A;  1FD7 D;  3SK5 A;  4HMI A;  3VR4 A;  1SNQ A;  1PTO B;  1EEI D;  5F2D A;  5JOB A;  1AW7 A;  1EY4 A;  3CHB D;  2R93 B;  2HCC A;  1I3Q B;  3MVV A;  2NB0 A;  1DOL A;  1HPC A;  1E2Z A;  3TN2 A;  4KN4 C;  5FLX L;  2Y0S B;  5I6Y A;  1V43 A;  1HUN A;  4QCL A;  1JQY D;  3S14 B;  1ENC A;  1GUN A;  4ZLT F;  2PZU A;  3T16 A;  2J0T D;  3R2T A;  3MXP A;  3IFD A;  2EYL A;  3ITP A;  3OWE B;  5LL6 X;  2F0E A;  3NWT A;  1R9T B;  2FIN B;  1I4Q A;  2KUM A;  4XT3 B;  4X3T A;  3H6M A;  4CKC A;  2NN6 H;  1Y8P B;  1UUP A;  3E6Z X;  4BA1 I;  1WTV A;  3K5L A;  2DN8 A;  4RKB A;  2FMC A;  4HTH A;  1G8Z D;  2RQX A;  2R61 A;  4V0B A;  5C0X G;  1STE A;  3TZD A;  1V1P B;  1RJT A;  1OXV A;  4HN7 A;  4FF1 A;  3K0Y A;  2HUG A;  1PZI D;  2Q8R E;  5C4H A;  3D4W A;  4KJO A;  1T5E A;  3IKJ A;  4PNY A;  2AQ3 B;  1RHP A;  3ND9 A;  3PUX A;  5KRU A;  3R2I A;  4C3J B;  4HMJ A;  1QNU A;  4C1N K;  3WDN A;  5EGT A;  4DK0 A;  1PTO F;  1STG A;  4ZUJ A;  4QUF A;  1VMP A;  2F0M A;  2JE6 I;  1VF5 C;  3A7A B;  2IX1 A;  2KEC A;  4XXE A;  2MGS A;  4G4K A;  1TWC B;  4ZKC B;  2VXW A;  4KHV A;  1NAP A;  1JR0 D;  2AQ1 B;  1JWU D;  4DU9 A;  1EL0 A;  1DCZ A;  2QIL A;  5CYU A;  1Q3L A;  2JSO A;  3M85 A;  2KVM A;  3F2U A;  4HCE A;  4C3H G;  5CR3 A;  4IUU A;  2K5W A;  2NWG A;  4BY1 B;  4K8I A;  1SE4 A;  2EDG A;  5EPL A;  5C4Z A;  3NHH A;  3J80 L;  1V8Q A;  1DOK A;  1JOK A;  2B2T C;  2K32 A;  1ONL A;  1BCP F;  2XIW A;  1HUM A;  3VYU A;  3BDC A;  4FF4 A;  1IYU A;  1F2L A;  1AFP A;  1A15 A;  3MA2 B;  3MHB A;  2MHV A;  1XX8 A;  3HOY B;  4G7Z C;  1DXM A;  3TSS A;  1SYC A;  3W3A A;  1TR5 A;  3I8Z A;  3O13 A;  5IGF A;  2B2U A;  3X3N A;  1NR2 A;  5KNB A;  4K2K A;  4A3G B;  4JBW A;  5FO7 B;  4E6I A;  1IW7 C;  1X32 A;  1SBB B;  1GUG A;  5C6A A;  5CV4 A;  4BBR B;  5E1F A;  4RA8 A;  1CK1 A;  2F0V A;  4KI0 A;  3ZYY X;  4RHS A;  4BBS B;  1BUV T;  4NP5 A;  2HQE A;  2KCN A;  3CRK C;  3DEP A;  2SNM A;  4FO2 A;  4RHR A;  1YNN C;  3BS1 A;  1BXT A;  5I2Y A;  4AYB B;  1EWC A;  2EY2 A;  3KLS X;  2EY5 A;  4KD3 A;  2O4X A;  3URY A;  1DON A;  5FLX E;  2EJF C;  3BZD B;  1MI2 A;  2C9O A;  4XQQ A;  4A3K B;  3HOV B;  3QWN A;  2OF1 A;  1QWY A;  3CKI B;  4ILW A;  4EVO A;  2RKS A;  3N52 A;  4WRD A;  4XT1 B;  2KHS A;  3G6J B;  3GO5 A;  4EQP A;  2C5C A;  2IW3 A;  1Q12 A;  5EJW A;  5IOD A;  2K5D A;  1B2T A;  1EQV A;  2H1E A;  3MZ5 A;  1AP0 A;  4XIG S;  3N6R A;  2EXZ A;  1B4O A;  2NTT A;  3I90 A;  1IKL A;  4OO1 G;  2G9D A;  2AQ2 B;  2O2L D;  5D3I B;  3HOX B;  2J4X A;  2CVR A;  4KK7 A;  3P7J A;  2JA6 B;  3OPO A;  4H0L C;  1LO5 D;  2F0P A;  1GJX A;  1X3P A;  4PMC A;  4MIU A;  1DM0 B;  2A69 C;  5A2Q L;  3NXW A;  5ELF A;  1CT1 D;  1RF2 D;  2GA4 B;  3C1F A;  3I91 A;  4IN3 A;  1PRT D;  1QNK A;  4DK1 A;  2F0K A;  1SYD A;  3A7L A;  2A6H D;  3VYS A;  1PTO C;  1GHJ A;  2PYK A;  2E2I B;  1JIC A;  3KK7 A;  4ABN A;  1XTC D;  2MJ8 A;  4IUP A;  1WCM B;  1EIH A;  2CW0 C;  2EOT A;  2Q8T A;  3GTP B;  3K5N A;  4RGT A;  2JEA I;  2X6G A;  5FKA C;  4J1M A;  5M9O A;  1A3V A;  1MGS A;  5DM6 3;  4ZK9 B;  1QE6 A;  1JWM D;  1W6K A;  3M7G A;  3GV6 A;  4OGQ C;  1STN A;  5CV7 A;  2JP1 A;  1LT5 D;  1STH A;  1U4M A;  3M7N A;  1KDC A;  3SHL A;  5IGD A;  1STB A;  3GTG B;  1SE3 A;  4KD4 A;  2HCI A;  3S9W A;  5DEH A;  3Q22 A;  2L11 A;  5JEA H;  1U4P A;  1OXU A;  4ODG A;  5IGE A;  1BCP C;  4U68 A;  1B53 A;  4KV6 A;  2DY8 A;  5A35 A;  5EPK A;  1WTW A;  1J8I A;  3S17 B;  2X69 A;  4MN3 A;  5CGK A;  3MXN A;  2F0F A;  1J9O A;  5IGC A;  2KEE A;  1TII D;  4KKU A;  3J80 E;  2B2U C;  4MHE A;  1HTL D;  5LL6 S;  4NKL A;  5KND A;  4DAP A;  1SFO B;  3NTI A;  4A3D B;  1BQQ T;  3X3M A;  1IHZ A;  1ENF A;  2NVY B;  1FYC A;  1Y69 U;  2J7Z A;  1VDZ A;  2VNU D;  3UI2 A;  1XYI A;  2EYO A;  2LKV A;  1BDO A;  2PMZ B;  3SR1 A;  3BVG A;  5M5Y B;  1A2U A;  4DF7 A;  3R8B A;  4IAL A;  3MXG A;  1U4R A;  2BDO A;  3RUZ A;  3A8K E;  2O5J C;  1TS4 A;  1PRT C;  5K5P A;  2A73 B;  4X3U A;  5FO8 B;  1PTO H;  3K7A B;  3CQZ B;  2PNR C;  4IUT A;  5I2X A;  4TQU S;  2QCP X;  3TP7 A;  1YNJ C;  2L1B A;  2XRQ D;  1S5F D;  5CV8 A;  2EZV A;  1ESR A;  2EY6 A;  1KAA A;  3TDQ A;  2SDF A;  1I50 B;  3OIQ A;  1OO9 B;  2JEB I;  3M4O B;  2X6L A;  5IIF A;  4L63 B;  1TY0 A;  1IL8 A;  4TSS A;  5EPJ A;  2EJG C;  1D5Z C;  2IL8 A;  1I4G A;  2L4N A;  1TVX A;  4UAI A;  2ZXR A;  3EA6 A;  5CV9 A;  3NPP A;  3S16 B;  2KA7 A;  2ZT9 C;  2ICE C;  3T13 A;  1KTK A;  2AWO A;  1S5C D;  1G2T A;  2LFN A;  5ELC A;  3CRL C;  1OXX K;  1VCI A;  3NP8 A;  5JPM C;  2BA1 A;  5FK9 C;  2E75 C;  5A2Q E;  2F0L A;  3BYY B;  4F7X A;  5I6W A;  3DWP A;  1VMC A;  1OXS C;  3OSO A;  1O80 A;  4ZUI A;  3AMU A;  1ZYR D;  5I4D A;  4IUQ A;  5M5W B;  4PMW A;  3TME A;  1WTX A;  4HR7 B;  1NSN S;  4OHJ A;  4GZY C;  4C3H B;  1BCP B;  5CBE E;  1TWG B;  2PZT A;  1IKM A;  2EYF A;  3GTQ B;  1S4Z A;  4DXG A;  4IQZ A;  2F0Q A;  5JVH 3;  3BVM A;  1LTS D;  1B44 D;  2PW7 A;  1ILQ A;  2WKC A;  1LT4 D;  4C1N I;  3NK9 A;  3KUP A;  1TY2 A;  1HQM C;  5EQ0 A;  3P1H A;  1FR3 A;  1R4Q B;  1H9K A;  3AU7 A;  3NUC A;  3MFG A;  4IFD H;  1RCV D;  4HED A;  1TT2 A;  4X3K A;  2RSN A;  2WV6 D;  1PMR A;  1EY7 A;  2F0H A;  1LAB A;  3TZU A;  1SNC A;  5ELD A;  2L5T A;  3OOC A;  3M4Y A;  4WOR A;  2LY7 A;  1EEF D;  2JYO A;  3DWA A;  5TSS A;  2BDN A;  1PYW D;  1B3A A;  3J81 L;  5C3E B;  4CGY B;  4L8J A;  4RFB A;  2HDL A;  5CV6 A;  1G2S A;  2QDB A;  2EYH A;  2BA0 A;  3PIO 3;  3A54 A;  1GUS A;  1W6J A;  2XNA C;  1PRT B;  5IOC A;  1LAC A;  2XN9 C;  3U9O A;  1PZK D;  3HP3 A;  4QMG A;  3L7Z C;  4TRD A;  1H9M A;  4KY7 A;  4CJ1 B;  2RDH A;  5JEA J;  5IGG A;  2B2V A;  3U9S A;  1FNW A;  1EY8 A;  1F2M A;  1RKN A;  1SJH D;  4CHT B;  4QB4 A;  5ELE A;  2Z4I A;  2F3W A;  1DJR D;  3GTL B;  5CV5 A;  2JA8 B;  4IUV A;  3W2D A;  1ESF A;  1CI3 M;  5C3X A;  1E2V A;  4QF4 A;  1FNV A;  2XWB B;  1MBY A;  1EZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...