2F0EA

Crystal structure of staphylococcal nuclease mutant v23l
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0eA00
1F2YA 1SYDA 2PQEA 4KHVA 5I6WA 2EYPA 3SHLA 1KAAA 4NP5A 5EGTA 3TP7A 1AEXA 5K5PA 4KY7A 1EQVA 3TP8A 1EY6A 2F0IA 1F2ZA 2NUCA 2RKSA 3OMGA 4EQPA 4KY5A 5IGCA 5C5MA 4MIUA 3TP5A 4J1MA 4QF4A 5KEEA 2ENBA 2F0MA 1EY9A 3SK6A 1JOKA 2EYOA 2F0WA 2EY6A 3H6MA 3OSOA 5EKKA 1SYCA 3RUZA 2EY1A 3SK4A 2F3VA 3MEHA 4J6HA 4KD3A 3TP6A 4K5VA 4B9WA 1STBA 5KYLA 1KABA 1EYDA 2SOBA 3MZ5A 3HEJA 1STAA 1JOOA 1EY4A 1F2MA 2EYLA 3OMCA 5CV7A 5J39A 2PZWA 1SYFA 5CC4A 3C1EA 3V2TA 1SYBA 4K14A 4PMBA 2RBMA 3NHHA 4H7BA 4ZUIA 5KIXA 1EY8A 2KHSA 3C1FA 3LX0A 5C3WA 1A3TA 1SNOA 3NXWA 2EY2A 1EZ8A 1KDCA 2F3WA 2M00A 3NUCA 4K8IA 4RKLA 1STGA 2F0TA 3D8GA 5DEHA 4DF7A 3SK5A 2EY5A 4HMJA 4HMIA 5IIFA 1EYAA 3OWFA 5JOBA 2PYKA 4I65A 4E6IA 1SNCA 2OEOA 4F7XA 5NUCA 1RKNA 3R3OA 2SNMA 2LKVA 3D6CA 1A3VA 2F0PA 3DMUA 3BDLA 5J22A 1A2TA 3P1HA 2PW7A 5E3FA 2RDFA 4B9XA 4NKLA 3EROA 5IGEA 5IODA 1IHZA 2F0GA 2F0QA 2EYMA 2KQ3A 4KV6A 3NP8A 5CV6A 1II3A 3MXPA 3BDCA 4ZQ3A 5C5LA 4EQNA 5IGGA 1STYA 2F0OA 2SNSA 4KY6A 4K2KA 1SYGA 3P75A 5CV9A 5KYIA 3ITPA 2F0HA 3NK9A 4ID6A 4K5XA 4F8MA 5M9OA 5IGBA 4TRDA 5C4ZA 2PZUA 4NDXA 2F0UA 4IZ8A 1EY0A 4QB4A 3HZXA 3MVVA 1KDAA 4DGZA 1EY7A 1STHA 2EYHA 3SXHA 5KRUA 1NUCA 5ISRA 3EVQA 2F0DA 1TT2A 4IUNA 4N9PA 5EKLA 4PNYA 2HQEA 3ERQA 1A3UA 2F0FA 1EZ6A 5I9OA 1KDBA 3D4WA 5IOCA 3MHBA 5E1FA 3U9OA 3QB3A 4WRDA 5CV8A 1A2UA 4RKBA 1SNMA 5F2DA 2F0LA 3SR1A 3DHQA 3PMFA 4HTHA 5C3XA 4IALA 2F0EA 2OXPA 4NMZA 4KJNA 5CV5A 5CV4A 1ENCA 4PMCA 2EYJA 4YIJA 5HURA 5IGDA 1ENAA 4KTAA 2QDBA 2O4XA 3NQTA 2F0KA 2EYFA 1EYCA 2PZTA 2F0SA 5I9PA 1JOQA 1SNDA 4KD4A 4S3SA 3T16A 4QMGA 4OL7A 5CGKA 4ZUJA 5C4HA 4EQOA 3D4DA 5HGTA 2F0NA 1STNA 4DU9A 1TQOA 1SNQA 1TR5A 2F0JA 4KJOA 5J1ZA 1JORA 4N9TA 3S9WA 1U9RA 5CR3A 4G57A 5JAVA 4ODGA 5IGFA 1SNPA 2EXZA 4K2LA 2F0VA 3QOJA 1NSNS 1SYEA 4R8NA 5I6YA 4K5WA 5C6AA 3E5SA 4WORA 4K6DA 3VA5A 4LAAA 2WACA 4EVOA 3EJIA 3QOLA 4DFAA 3T13A 2OF1A 3SK8A 4ME5A 1EY5A 5KGUA 3TMEA 5DAUA 2PW5A 4K8JA
chains in the Genus database with same CATH superfamily
2PQEA 1FR3A 3SHLA 1KAAA 3N6RA 4OWTB 1WTVA 3MC0B 1ENFA 1YHAA 1IZ6A 4KY7A 3SE0A 2L55A 3C2PA 1GD7A 2WKDA 2K32A 3GTLB 3CCQA 2MFIA 3OSOA 4POGA 3HOXH 3CF5A 3S17B 3CXCA 2B2TC 3S1MH 4B9WA 1KQSA 1YEZA 1JOOA 5JVH3 3HOVB 2QF7A 1IBML 3HP3A 2BOSA 5BN3A 3HOUH 1IYVA 2YU9B 3RLNA 2CVRA 2A6HD 3GP7A 3HFZB 2HCCA 3OIPA 1IBKL 4BY1H 4BBRH 1OTCA 2F3WA 1IL2A 1PDQA 2HUGA 3K5LA 3CHBD 1SNCA 4LF9L 2LXKA 3D6CA 4C1NK 3EIVA 4A3KG 1E0BA 4IOAA 2A6ED 3SEBA 4OO1I 4Y52H 1F9RA 2JK8A 3T1YL 2EDGA 3MXPA 1BCPD 1SE3A 1STYA 4DUZL 1Y1VB 2BE5C 2E2JH 4BY1B 4OXPA 2HCIA 2MPMA 2ASBA 2AKWB 4JI6Q 3SDZA 1O7ZA 2OQ0A 1TY2A 4XYQA 3PO3H 4BXXH 4IUQA 4KN4C 1A6XA 5LL6S 3G4SA 2A73B 1YBYA 4BS9A 4DR4Q 4IUPA 3GTMB 2I07B 4XYOA 1MJCA 5EPLA 2JA8B 2B2UC 3T4AC 2BA1A 2MO0A 1PH7A 4RHSA 1HHVA 1YJ9A 4WJ4A 1CA6A 2OXPA 5FKAC 4OX9L 4N8FA 4GN4B 1HZ9A 5JPNC 1PFMA 3MTSA 1HR0L 3X3MA 2K6AA 4LWCA 4X3UA 1STNA 1VQHA 4X64L 1O7IA 1PZKD 2QILA 1JWSD 2MGSA 1PMRA 1HH2P 3KLRA 5IE8A 5C0XG 1S40A 5D3DA 1N36L 4B3TQ 5KGUA 3CQZH 3HRZC 2ZJPA 1SYDA 2NN6I 3NELA 1XWEA 3NBIA 4RGNA 4B3MQ 3KF8B 3HOWH 4RHRA 3K81C 2F0IA 3KF6B 4IJLA 4B3RL 3PGZA 4J15A 2JA5H 1F2LA 3SK6A 3A0JA 1L2FA 1U4RA 3MFYA 4P2CB 1I50B 4LMQD 1J5EQ 1MI2A 4KD3A 3RNUA 5LL6X 2QA4A 2HHHL 1AE3A 2OQKA 4DV0L 3S1MB 5C3EB 1NR4A 4QIWB 1Q81C 1ZYRD 3VR3A 3NUCA 2EOTA 4KMUC 4AIMA 3TS2A 1LYLA 1K83B 1D5XC 4C3HG 2C35B 4WFN3 1SSOA 2NBFA 3DMUA 4DPGA 4IUTA 2OWOA 2TMPA 1C0AA 5FLXE 4NKLA 4A93G 4CKEA 2R7ZB 1JE5A 5IGDA 4IFDI 4EQNA 2I5MX 1EL0A 1VMCA 4DR7L 2F0HA 3CCVA 3CU7A 3ND9A 2E76C 4KKUA 1GUNA 3M85A 4JBKA 2IT1A 1PHJA 5D14A 5ISRA 1CKNB 1GJXA 5M3FB 3UE0A 4IUNA 1VQ5A 3S2DH 4ZLTF 4DV2Q 1WTHA 1CA5A 1WOCA 2D2CC 4RH6A 1VQNA 2JYOA 3F2CA 3DHQA 4HTHA 4NMZA 3RZOB 2X6GA 1NCVA 2RCNA 4DV3Q 1MGSA 1FL0A 2EYFA 1DOLA 4UP7A 1S5ED 4QY7A 3VDYA 1BCPB 4EQOA 3CCUA 1VQ4A 2F0NA 3Q0AA 4C3IB 2NN6H 1DOKA 3CPFA 3KF8A 2PMZB 2E5LL 4X62Q 3RZDH 1LTBD 1VQGA 1FJGQ 2EIFA 4A3DB 1N32Q 3IAYA 3BYTB 3QOLA 5ELDA 3CKIB 3GTKH 4APVA 2HT1A 3VYRA 1TKWB 2UUCQ 3DM1A 1PTOD 4CDDC 2J0TD 1EQVA 1H9JA 3IKJA 3OMGA 1VS0A 2RCFA 2CH4A 5A35A 4OO1H 1IW7D 3TP5A 4IFDG 2Z6KA 5C44H 1QNUA 2R61A 1M90C 1D5ZC 2JJQA 2XGTA 4RA8A 4CDCC 3TP6A 1YHQA 4YHHQ 3I4MG 4NXNQ 4AH6A 4DR1Q 1E24A 4RCNA 1GM5A 4RMFA 1H9SB 4JI4L 4LUVA 2DNEA 3C1FA 4DAYB 2EY2A 3S1QH 2M00A 1J5EL 1IBKQ 2NYZD 4RGMA 4J8QA 1VQOA 2B3GA 4HMIA 3GO5A 4H13C 1LTAD 1X56A 2F0PA 3DWAA 2ZJRA 1XMOL 1I5FA 2L5TA 2EE1A 5E3FA 4UHVA 4RGOS 1ML0D 2RDGA 1KNAA 4A3MG 2VNUD 5ELCA 4A3DH 3TN2A 3FEWX 1UNSA 2K75A 1I4XA 2SEBD 3PF5A 2ICEC 4IZ8A 1TWAH 3MVVA 3I2ZA 3D0FA 4X3TA 1DJRD 4EX5A 1NAPA 3CCMA 5L37A 1TT2A 1GHKA 2A69D 2O2LD 3K5NA 1JR0D 3S1RB 1SJHD 4JCVE 1Z47A 3CRLC 3I73A 3E0JA 5CBAE 2R7ZG 2F0EA 1QOHA 1XNRL 3MXNA 1TS2A 3GTJH 2WB1B 4YIJA 1A62A 5FO7B 2CHBD 3W3AA 4LUZA 3GV3A 4PMCA 5HURA 2IX1A 3NQTA 2IL8A 4HSVA 5KNCA 5FLXc 1U5KA 1NY4A 3FPUB 3S2HB 3BS1A 1G91A 3CCSA 4EQ5A 2L11A 3BZCA 2F1MA 1BCPC 5CR3A 4XQJA 4YY3Q 1DCZA 3PF4A 3M4OB 3TZDA 5K36H 4LUOA 1PLFA 1HNXL 3FHWA 4DK3C 1PH8A 4KHVA 2A68C 4O1NA 3F2UA 5EGTA 1SR3A 1VQFA 4U673 1LT4D 2K5QA 2NUCA 2R7DA 5BN5A 3T1HQ 1GVPA 2UXBQ 4K0KL 2Z4HA 2K50A 4A3GB 1PZID 3PUYA 1BNZA 1AN8A 4A3FH 3D3RA 3NWSA 1YJWA 4JK1C 5C3EH 2GA4B 2F3IA 1KABA 3STBD 4DNRB 2K03A 4YWMA 2N49A 4ZCKA 5E7NA 1JJ2A 4YCVA 1SYFA 1JWUD 2K28A 4G7OC 1H95A 1K73C 3JAMc 3K58A 4RKLA 1TS4A 3I7FA 3K7AH 2BH8A 3BZDB 3DXJC 1EYAA 2EJMA 1FGBD 2FINB 2Z6KC 1BBWA 5ELOA 1R4QB 3AYHB 2K5HA 5JOBA 3NBHB 1PTOH 2AHOB 4DUZQ 1SN8A 2B2TA 2LKVA 1CK1A 4O0AA 4V190 3JAME 2ZM6L 3H3VI 2J4XA 4FO2A 1C48A 1WCMH 1VQEA 5ELBA 2ZXOA 3I4MB 4A3LG 4HN7A 1XPRA 2F4IA 4K5XA 3MAQA 4LF5L 2L12A 2YYZA 1QVCA 4DUYQ 1WD1A 4DA2A 1JCKB 1ILPA 3PSIA 3CP0A 3V05A 3CMAA 5JJZA 1ASYA 3EQLC 2DJFC 2F0FA 5E4WC 1U0LA 4IOCA 4R4CA 2ID0A 5IP9H 5LMNL 1SNMA 3RLOA 3KBXA 3JC66 1BDOA 2CWAA 4KJNA 3ONAB 2G9DA 3TZUA 4DV3L 2F0KA 4YCWA 2F0SA 2V1CC 2IPKD 2GVAA 2N55A 2CW0C 4DR5Q 3SGIA 5HGTA 2R92B 4CKBA 1PH2A 4QL5A 1TR5A 4C3JG 1PTOF 5EBCA 1LT3D 3GTQH 1VQDA 1QG7A 4K2LA 2PPBC 4BBSG 4XTCS 1R9TB 1Z7TA 2EJGC 5GQOA 2BDOA 1PFBA 5DAUA 4JBWA 1Q86C 2QEJC 3MWYW 4HR7B 4NP5A 3TP7A 1EWCA 4KHPQ 2OT2A 2AMCB 2Q2HA 2L1BA 3NE5B 2HHHQ 2TSSA 3CD6A 2QCPX 3A7AB 5LMUL 4HAEA 3ULPA 1C9OA 1V1PB 4DNIA 4QF4A 1SMYC 3P20A 2F0MA 4PZ8A 1EY9A 2BE5D 2JP1A 3OWEB 1PVOA 1SBBB 2C5CA 2PNRC 2EY6A 3S16H 5BN4A 2AQ1B 3MEHA 4MN3A 5KYLA 3SVMA 2E2IH 2WINB 2UU9Q 2R93H 5GAEC 4JI8L 1ILQA 1TY0A 3C1EA 4R1JA 4DR1L 4H7BA 1X3QA 1L1OC 4GS3A 2KHJA 5IP7H 1MJEA 1Y1WB 1KLGD 2BCOA 2F0TA 1SXTA 3DM3A 2J7ZA 1KNEA 4DKAC 5A2QE 4XIGS 1RHPA 1RKNA 1L1OA 1TWHH 2SNMA 4FF2A 2R92G 3J81E 3HOVH 1KLUD 2KA7A 1I94Q 2G5DA 2F0GA 1X3EA 1I6HB 2NZ1D 1GUGA 3K7AB 3H0GG 4A3BB 4K2KA 2FFKB 4A3KB 3P75A 1CHQD 3OPOA 4UPAA 3NK9A 1CT1D 2KJXA 4A3GH 4TRDA 1X32A 5H1SE 1K0RA 1B8AA 1W6KA 3L9AX 2PQAA 3TDQA 4QUFA 4A3EB 1BXTA 2QKIC 5KRUA 1WTPA 1EQTA 1QJOA 4IPGA 4CGYB 3H94A 4JVZA 3PQIA 5E1FA 4DV6L 2K7VA 4K0KQ 2JXMB 5EQ0A 3M7NA 3CCJA 4DAVA 3S15B 1PYSB 2E2HH 3W5OA 4KTAA 3CCEA 2AUJD 1EWIA 3DEOA 3KK7A 2A5HA 3L7ZC 1GUTA 1RIPA 1V1PA 1LTLA 3T16A 1PYWD 4HJAA 1TWGB 1FNWA 3CC4A 3M3YH 3ERSX 4LFAQ 5LMUQ 1HQRD 4JYAQ 2KCMA 1MKHA 3FKIG 2UUAQ 3OTOL 4LF8L 4JI6L 4ODGA 3ZYYX 2MNAA 4ZYSA 4XT1B 4LF4Q 4K5WA 1GUOA 3HOYG 5IYDH 4ME5A 1EY5A 3GTKB 2PW5A 3NSWA 1AEXA 3VYUA 1LTRD 3HS0C 5IGCA 3H3VH 4FYDA 4KY5A 1PH1A 3UI2A 2JA7H 3R8BA 3DWPA 2EYOA 1CI3M 4C3IH 4HIDA 5JEAG 1V9PA 2L15A 1NJIC 4OONA 1HNWL 2NB0A 2B63G 1SDFA 5AJ3Q 4K14A 2E2HB 4UDUC 2WB1G 5HY6A 1KDCA 1EOVA 4K8IA 2IX3A 1X55A 1K8MA 4UP9A 2ZXPA 1S5DD 2B8FA 2PYKA 4I65A 1EOTA 3N52A 3S2DB 4HIKA 2QDLA 2IY5B 2YTVA 1NNXA 3VR5A 1WYDA 2XSCA 1PH4A 4IFDJ 1T9HA 3DEPA 3I72A 4A3CG 4IUVA 1XPOA 5TSSA 1UE1A 2I0QA 1O7YA 1X3GA 4F8MA 1C7YA 3B6YA 1XNQL 5C4ZA 2JA7B 1A63A 2NTTA 2UXCL 1KDAA 4DGZA 4A3EG 1Q82C 4JYAL 1GHJA 3A7LA 1G6ZA 1I4HA 2LFNA 4XDXA 2VUMH 1VDZA 2OTJA 3J7YW 3Q8DA 1LTSD 2Q8RE 4CBVA 1E1TA 2HD3A 3U4VA 4PV1C 1AE2A 4X65L 1LACA 1HTPA 1IW7C 4CJ1B 3BG3A 2PO4A 4DV1L 3TSSA 5I9PA 1M4VA 2KCCA 4KD4A 4QMGA 1SE4A 3J7AF 3TQYA 5FLMH 4BY7H 3T53B 4OGQC 2ZTEA 4KJOA 1Y8OB 4M8AA 1JORA 2YTYA 5BR8L 1I4GA 1QNKA 1L1OB 1T5XD 2F0VA 1D5MC 5M5XH 3GTOB 1F9PA 1EEFD 2IHFA 2XTIA 1PYBA 4HEDA 2MQHA 4K8JA 1STEA 4F88A 1I94L 3S15H 2KENA 1AZPA 1E2VA 3L3OC 1HZBA 1HCZA 4J1MA 2M2LA 2QEXA 3Q22A 3O13A 4LK1C 1SYCA 2EVBA 1K28A 4J6HA 1VCIA 1MD2D 2ES2A 1EY4A 1S5BD 3Q23A 2ALYB 2UU9L 2RBMA 3HOZH 3GTPH 5C3WA 3HOYB 4ABNA 1HFNA 1EZ8A 1D1KA 2DGYA 3DUZA 4HJ8A 2VL6A 1EIHA 1BQQT 1CZGA 3BVZA 3T56B 5CORA 5M3MG 2AQ3B 3GD7A 4GLAC 2R3ZA 5J22A 4FF1A 4LFAL 2B29A 4F7XA 1I50H 2CQAA 2UUBL 2JA8G 1HNZL 1OXXK 4A75A 3S24A 1Y1VH 4WJWA 3P7JA 3A8JE 2E8GA 4X64Q 5EAYA 1IBMQ 3I4NG 4RGTA 1PFNA 3J80i 1TWGH 3UDFA 2K01A 1W2BA 1CSQA 1JWMD 1SMYD 2WAQE 4CDFC 2VB2X 2O5JC 3D4WA 5E4XA 3D4RA 1DZ1A 3LNNA 3QB3A 3S14B 5FJ8G 1SJED 4X6AH 2WFWA 4R4IA 2QGQA 1A15A 2EYJA 1EFWA 2D9UA 1SLJA 2UUCL 2KCTA 1TWFB 1CM9A 3I4NB 2KBNA 5CGKA 3QWNA 1EU4A 4ZUJA 3S17H 3J80E 1IKMA 3U50C 3K7UC 1SE2A 4TVAB 2DUDA 1YITA 2EXDA 2YTXA 3R2TA 4A3IH 4FP5D 3WWVA 3NBHA 4JPBW 5JJIA 1J9OA 3E5SA 4TKOB 4WORA 5EPJA 2D0PA 3T51B 2P5ZX 3WDNA 5IYCG 4FVMA 4AQYQ 2AWNA 4R4OA 3ULJA 3PUVA 3HKSA 5M3FG 2JEAI 4EQPA 4B3ML 3S14H 5IWAQ 1KRTA 3PO2B 5T1IA 3A55A 1Y1WH 5KEEA 3PV0A 3G6EA 2D0OA 2HDMA 2GVBA 4A3BG 3ULLA 3S2HH 5LMNW 2A6EC 4A93B 4OX9Q 4H0LC 2L9HA 2V4DA 1K8GA 3HG9A 2RSNA 1I4QA 3J80c 2Q2IA 3GQBA 4GLVB 4HCSA 3GTGH 4DV4L 3PO2H 1GKHA 2EY5A 4XQQA 4GZYC 2NVQB 3K5MA 1HZCA 2K5NA 2OEOA 1QCBD 2WAQB 1KAWA 1R9TH 3QIAA 5CV6A 3W1BA 1LV9A 3F1ZA 3LGJA 1JJCB 1NBWA 1H9RA 1VQCA 4A3FB 3RN2A 2E74C 1AP0A 1UEAB 1RDPD 3DLLA 3HOZB 4RWSC 4BBRG 1EY0A 2KVMA 4AYBG 1FJGL 4P75A 1I3QH 4EGVA 3SXHA 2UUAL 4DR2Q 3QR8A 1HNZQ 4N9PA 4C1NI 2MUYA 2HQEA 1ICWA 4UY8C 1JB3A 3E3XA 4GN5A 5D3IB 2VQFQ 3K0YA 4IPHA 1VF7A 2NVXB 1HXYD 1PRTC 3K57A 4CJ2C 3VYTA 5C4XH 4X3SA 1VQIA 5EBDA 3I91A 1EIYB 4LFCQ 4JOIC 2ZTCA 3PO3G 4BXXG 1UAPA 3NTIA 2JA6H 3KFUA 3FPPA 2GN5A 4B3RQ 4C2MB 4YHHL 3D4DA 1EU3A 2NWGA 4G7ZC 1VQPA 3MFGA 2BA0A 1QZHA 3NTKA 4DUYL 1XNQQ 2K5DA 4R8NA 4Y7NH 3KDFB 2VQEL 4GOPC 2AQ2B 2JEBI 1TVXA 2WACA 3CRKC 1TIID 3H09A 4DV7Q 4DR6L 1N34Q 1HTLD 1VQJA 1FYCA 1N9WA 1YI2A 2DY8A 1V1OA 1XMOQ 1AFPA 2L0CA 1HPCA 4CJ0B 1LLRD 3RZDB 3MXGA 3WOFA 1SEBD 3H6MA 1PV4A 1RTNA 1EIFA 4C3HB 1DXMA 5CBEE 4IJHA 4K5VA 5DM73 1EYDA 3Q24A 5C0XH 1F2MA 1Y69U 5J39A 3NQIA 4X65Q 2IW3A 3NHHA 5KIXA 1PA6A 3LX0A 4ZAIA 4JI4Q 2UXCQ 1E2ZA 3A8KE 3SK5A 3K5OA 1CFMA 3OWFA 1CKOA 2R6GA 1B9MA 1LABA 1MHWC 5COYA 1NE3A 3CC2A 3F2BA 2JA5G 1JICA 2UXDQ 3P1HA 1YZ6A 4LW1A 4HJ7A 5EKIA 3NP8A 2DNCA 2K5WA 4DXFA 4IO9A 2RF4A 1ICFB 1Z9FA 2K33A 4DV1Q 4YCUA 5M9OA 2HDLA 2CQOA 2PZUA 5FLXL 3BVMA 3J7AV 4KLKA 4YY3L 1EEID 4BY7B 1ZKOA 2C9OA 5IT9c 1CZWA 1I6VC 2F4VQ 1V8QA 4C3HH 4JI7Q 4X62L 3K8AA 3ERQA 3KDFA 5IYBG 2Z0SA 4A3JB 4DAMA 5IOCA 4FXDA 2CKZB 3GTJB 2ZTDA 4C56C 3E9IA 1BCPF 4CKCA 4BA2I 4NW2A 1VQLA 2ZXRA 1DYQA 2K5VA 2XNAC 2UXBL 4A3JH 4F87A 1J6QA 1WTXA 1JB7A 2PZTA 2G9HD 3TS0A 2RHQB 1K0SA 4LFBQ 4B08A 1PTOC 4S3SA 4KHZA 1WTOA 1FD7D 4AYBB 4DU9A 2XRSD 3E6ZX 4C3JB 1G6PA 3FMCA 1VQ8A 2IJ0A 3HOXG 2EXZA 3CMEA 1XTCD 1TS5A 4C2MH 2D5DA 1Q1EA 4JW0A 1Y14B 2PMZE 1OO9B 2Y0SG 3HOUG 4JI1Q 3TMEA 3E9HA 4BY1G 3I56A 3BZKA 1AW7A 4LF6L 4PG3A 1VQ6A 1H9SA 3PIP3 4DAYA 1KXLA 4A3KH 4HIOA 3EFXD 1STBA 3V96A 1STAA 1SYBA 4MZ9A 4LF4L 3AEVA 3AFQA 1A3TA 1DM0B 3RD4A 1JMCA 1WD0A 2R7FA 1LTTD 4LF7Q 1GOZA 1X9NA 4MTKA 3TBIB 1XJVA 5I4DA 1B7YB 5C4JH 5C44G 1KTKA 2VB3X 4GN3B 3A5ZB 1TWHB 1YNJD 4DV6Q 4B9XA 2XWJB 1CTMA 4ME3A 2NZHA 1D8LA 1HRJA 3M7GA 2SNSA 4KY6A 4LJZC 3ITPA 1L0WA 1AH9A 1UUPA 4NDXA 4LFBL 4TSSA 3FRPB 1Q3LA 2Z9HA 3HOWB 2RSOA 2JA6B 2IX0A 3TREA 3HKZG 2JA5B 2NVYH 2ATWA 4GKJL 1Y8PB 1NTGA 4A3MH 2NVXH 5JJKA 3W2DA 5CV5A 1B50A 2LMCB 4OIJA 1QUQB 2O4XA 4WJ3M 4HJ5A 1JC7A 4LF6Q 5I2XA 3T1HL 3HOWG 1EWHA 4FNFA 3RMHA 3W1GA 4JI5L 3OHXC 3OW2A 3GTQB 1GUSA 3HKZB 4IUUA 4DK6C 3CPWA 2K05A 3IFDA 1QWYA 3JAML 4L5SA 1HFGA 1WTQA 2R7ZH 4G7HC 1EQQA 3AU7A 3VA7A 3UE1A 3FKIB 2KEDA 4ALPA 2EYPA 4DN4M 1K83H 4DAPA 1EY6A 1TS3A 3G6JB 3K80C 2B2WA 4H44C 1HR0Q 1L0XB 3ND8A 2JSOA 1MSGA 5IT9E 2BDNA 2JN4A 5EKKA 1RF2D 4O42A 4A93H 1V1QA 1D7QA 1SAPA 2FHTA 1IYJB 3I4OA 4JI3Q 4JI8Q 3S16B 2EQSA 4L6TB 4ZUIA 4DR4L 1EFID 1SNOA 3RR5A 4HMJA 3MEFA 2RQXA 4DV7L 4P74A 4BWGB 3J81i 1A3VA 1PZJD 1S5FD 3BDLA 1A2TA 4JG2A 5C3EG 3M4YA 3EROA 1CSPA 5M5WB 1OXSC 2CCZA 2KEEA 4LNQA 1NR2A 4ZQ3A 1PRTB 5IT9L 1WVLA 1XYIA 4A3IB 1B2TA 1I4PA 4FDBA 3KYHC 3R2IA 1IXRA 5IGBA 1ZYRC 1LM0A 4JI0L 1N8RC 3H91A 2H1EA 2B8GA 1D1IA 4NXNL 1EY7A 1KIXA 1TWFH 2EJFC 3PUXA 2NN6G 2F0DA 3OOCA 2I46A 1A3UA 1TWCH 3U9OA 3VR6A 4GKKL 1K3RA 1JE4A 3SR1A 1WCMG 3R93A 5C3XA 4DV0Q 1Q8KA 2VZAA 2OTLA 2A6HC 4A3LH 2HQLA 1ENCA 3JAMi 4N8X1 2WIIB 1E22A 1V43A 1YNXA 3IL8A 3S1NH 4JOIA 3KBGA 1SMXA 2RA4A 3MXUA 1O7LA 1YJNA 1BO0A 1R4PB 4DV5L 1KHIA 4OO1G 3L0OA 4IFDH 4OWXB 2IWHA 5M3MB 1F77A 1CHPD 5I6YA 3I4MH 1EQRA 4B3SQ 3UDGA 5C6AA 3PIO3 1WTRA 4K6DA 4LAAA 3CCLA 2NVYB 3BDOA 2N3SA 1HQMC 4PZ7A 4JI7L 1F2YA 1WI5A 5GADC 1GO3E 1KC8C 1S3OA 1TWAB 3K6OA 2HIXA 2ZT9C 1RD9D 2ENBA 4C3JH 4R4TA 4PZ6A 4DV2L 1ESRA 1CKNA 1M1KC 1EYGA 4DNTB 5GROA 3K0XA 2NTSA 3HEJA 2B2YA 2RDHA 2HIVA 2N78A 4A3DG 3H3VC 3GV6A 4X3KA 3GTLH 3NXWA 3H0GB 4GKJQ 2B63B 3BU2A 3CW2C 1Z6HA 3S1QB 4E6IA 5JVG3 1K3BC 4K6LA 3R3OA 1OXUA 4JI1L 1SE8A 2EZVA 4XT3B 5IODA 4A3JG 4RG1A 3AFPA 2KQ3A 1EIGA 3BDCA 4JI5Q 2PI2A 3QO2A 3M4OH 5C44B 1SYGA 4ZK9B 4GNXB 2A1AA 3CC7A 2Q2TA 2N88A 5IP7G 3AMUA 3H15A 2E5LQ 5BR8Q 4DV5Q 1PH5A 2EYHA 1N32L 5AJ3L 1LUZA 3CCRA 1W6JA 3KJPA 3A5UA 1PH3A 3GDEA 2FJ2A 1BBUA 5J3BA 4JV5L 1FNVA 4FF3A 1IL8A 3F8TA 1YNND 5ELEA 3HOVG 4WRDA 2LSSA 1DGSA 5K36G 4IN3A 1N33L 3H0GH 2BH2A 1ENAA 2QDBA 4JBJA 4A3GG 3OW7A 2XWBB 1B9NA 1SNDA 3ER0A 1FGUA 1D2BA 1E2WA 2JQOA 1WJJA 2CWPA 4TQUS 1F9QA 1TQOA 3KLSA 4A3FG 1IBLQ 1BKBA 1M8AA 5JAVA 5IGFA 3G71A 5IY0A 3A8IE 1KL9A 2RHSB 4EVOA 3MA2B 5CYUA 4DFAA 2NVTH 1KD1C 1MBYA 2XN9C 1HJPA 1NMGA 3EN2A 1ET6A 2MO1A 4P71A 5C5MA 3C3LA 2B2UA 2H5XA 2UUBQ 1HUNA 1JOKA 1HA5A 3M3YB 1X65A 3QG1A 2SOBA 2AWOA 2X6LA 5CC4A 3V2TA 4R9WA 4PMBA 4JI3L 1U4PA 4FXGC 1EY8A 5C4XB 1YVCA 4QCLA 1D6EC 1H9MA 5DEHA 1K8OA 3D8GA 2L4NA 2I5HA 2I5LX 5T1GA 4DR2L 2N8NA 2JA7G 5I2YA 2XVSA 4IPCA 4CDEC 2B2YC 4C3IG 5JEAH 1I3QB 5IP9G 1N33Q 1P16A 2EYMA 3TP8A 2Z1CA 2X69A 1Q46A 1HNXQ 1B70B 4Y7NB 2B63H 1VQAA 2WP8J 1U4MA 4LF8Q 1A8VA 1OXVA 1HR0W 2F0UA 2IHEA 3HZXA 1C4QA 4NXMQ 1GXDC 5KNDA 1S4ZA 1G291 2KOLA 3HKZE 1SROA 4OIKA 2NVQH 4A76A 2ZM6Q 1G8ZD 1O78A 5CV8A 1X3PA 2ICIA 5JPMC 4Q5VA 4A3CH 3M9BA 4BBSH 1X54A 4PMWA 2NZOA 1B4OA 5CV4A 4QJFA 3TRZA 1KRSA 3CQZB 1EYCA 3VYSA 4Q0FA 2VW9A 4R8IA 3NEMA 3NENA 1C8CA 3TEHB 4OL7A 1SFOB 4GLXA 5FO8B 3PCOB 5C4HA 4A3EH 2KHIA 5FOBB 4CHTB 4L5QA 2VUMG 4KK7A 2EPBA 1MIUA 1HUMA 2PCFB 2B39A 4DR3L 1JT8A 1SYEA 3M4PA 1XTDA 5LHY1 1RTOA 1XPUA 3VA5A 2R93G 4B3SL 4KI0A 3EJIA 3KLWA 1XMQL 3L2PA 1B1ZA 3S1NB 3J81j 5DLQE 1Q90A 3EBEA 3F2DA 1YNJC 1S72A 1VQ9A 4BY7G 5FLMG 3PO3B 1XXGA 1ZEQX 2A69C 4DR5L 1TXYA 3QJYA 4BA1I 4UP8A 4JI2Q 2E2JB 2A74C 3GTMH 2R92H 2F0WA 1G2SA 1RL2A 3RUZA 2KUMA 3J80L 2EY1A 1BR9A 4X66L 3MZ5A 1L0YB 5G3LD 2E2IB 2EYLA 3BVGA 4QIWE 5ELFA 3OTOQ 3J7A5 3NPPA 1P8LA 1TU2B 2Q8TA 3J81L 4DF7A 4A3MB 2VQFL 2B2VA 5M5WH 5LMNQ 4AQYL 4BBRB 1K8AC 5M5YB 3KOJA 5NUCA 4NB3A 4ZRZA 4QGUA 2LY7A 2YU9H 4FXKC 1B3AA 1PTOB 4JI0Q 5IGEA 3FDTA 2F0QA 2LS01 2FMCA 5C5LA 1II3A 3HOXB 2AUKA 4L5TA 5CV9A 5KYIA 4LF5Q 4ID6A 2A68D 4ZKCB 3I3CA 4POFA 2Y0SB 5FO9B 3HOUB 4KHPL 1WCMB 3MXNB 1YNNC 1SRUA 3UDXA 1VQKA 1DONA 1STHA 2ZJQA 2SDFA 3FKIH 2WAQG 5C4JB 4HIMA 3VR4A 2K04A 1EZ6A 1QILA 3MHBA 3STBC 3CAMA 1A2UA 1J8IA 5F2DA 2F0LA 1F9SA 1FNUA 4IALA 4NXML 1IKLA 1BF4A 5IYDG 2JA8H 3HOYH 3GTPB 1G2TA 3PIPA 1VQMA 1Y1VG 1H9KA 5IWAL 1ZXTA 1QUQA 3I4NH 1BVSA 4ZKBB 3J7ZC 5J1ZA 4V0BA 1CQVA 4JBMA 4IPDA 3T1YQ 1CKMA 1SFOH 1RODA 3T13A 1B53A 2RVLA 3D6WA 5A2QL 1Q7YC 4ILWA 2F03A 4DV4Q 3BYYB 4OEMB 5DNFA 4DR3Q 5M5XB 5M5YH 4BBSB 1BBXC 2UXDL 1F2ZA 2KCNA 2RKSA 4YWKA 1ESFA 1ASZA 3WOEA 2K4KA 3S1RH 4JV5Q 2YV5A 2KECA 4FF4A 1PXUA 4Z9CB 1LTID 3BJUA 5CV7A 2Z4IA 3OMCA 3E0EA 5IYCH 1E3PA 3UDIA 2H4OA 1PRTF 2QW7A 2KHSA 3URYA 5DM63 3J81c 2Z6BA 3A54A 1ET9A 1Q8IA 1STGA 2WKCA 3RN5A 1Y8NB 4DR6Q 4X66Q 1CUKA 1HZAA 3C46A 3IFTA 1QZGA 1XNRQ 1Y1WG 4A4IA 2DY7A 1UE7A 4OELB 4XXEA 5FK9C 2DJGC 4OHJA 4O2DA 2OCEA 2PW7A 2RDFA 3NWTA 4UAIA 2E75C 5AFWA 5GAHC 2VQEQ 1PRTD 3D31A 1WFQA 3RLFA 4LFCL 1RJTA 3LWEA 4YWLA 4AYBE 4GOPA 1B3QA 1I4RA 2VS1A 4L5RC 2A8VA 3PO2G 4M1UB 2WV6D 4MTNA 1N36Q 1NUCA 3ICEA 1QVGA 1HA6A 1A0IA 3EVQA 5EKLA 4ULLA 1IBLL 4PNYA 5ELNA 4DR7Q 5C0XI 1FVIA 2JE6I 3OYYA 1PH9A 3KF6A 2PQAB 4JC0A 5I9OA 1KDBA 1DOMA 3GTOH 4KKTA 4RKBA 4L8JA 4KN7C 5G3LF 1QVFA 5EPKA 4RCOA 1AZQA 2Z8LA 3I8ZA 4LF9Q 1EUJA 4I7ZC 3LWUA 1MSHA 2VUMB 2NVTB 1XX8A 1JOQA 2D62A 4HSPA 1JJGA 3I4LA 1LO5D 3KLSX 5JEAJ 4DK0A 4KKSA 4R4QA 1UE6A 3G48A 2XIWA 4N9TA 4IQZA 3PIOA 3QOJA 2B2VC 3Q6SA 1K9MC 4LF7L 4B3TL 5C4XG 3SK8A 2CFMA 3KUPA 2DN8A 4RFBA 1VF5C 3HOZG 1VQ7A 5I6WA 1WTWA 4NPSA 4L63B 2JA6G 3FVQA 1Q12A 3DWQA 4IURA 5K5PA 2B2WC 3A56A 1GUWA 4H02A 4MIUA 1W3SA 3U9SA 5M3MH 1PFSA 2K52A 2O5IC 3SK4A 2F3VA 1HNWQ 1JQYD 2FMMA 2VXWA 5JJLA 2Y0SE 1U4LA 1VQBA 4HJ9A 5D65A 4P73A 2PZWA 4GOPB 4U68A 1BUVT 5C0XJ 3HGBA 2K14A 2XRQD 2Q8IB 1VMPA 2M9VA 3I70A 2F4VL 1ONLA 2F52A 4I7AA 5IIFA 1TWCB 3KJOA 2PI2E 1DD2A 1X6OA 1RCVD 4XQNA 5HGQA 4RAUC 4OWWB 4GKKQ 3IRBA 1IHZA 4KV6A 5FJ8H 5IGGA 5EJWA 2F0OA 2CW0D 2K1BA 1XMQQ 2WB1E 1PH6A 1NMFA 2MJ8A 3I90A 2A19A 5CMDA 2CH4W 4PQXA 4QB4A 3FP9A 1B44D 1LT6D 4QUCA 3U58A 4MNOA 4DK1A 3VR2A 3AQQA 1BOSA 3EA6A 1N34L 3OIQA 2LXJA 1YIJA 4JI2L 2MHVA 4A3IG 3RZOH 4DXGA 2VY3A 3GTGB 3PMFA 1E1OA 1T5EA 2Q2UA 4GNXC 3K59A 1LT5D 3AB9A 3PUZA 1S5CD 4MHEA 1UWVA 3U4ZA 1X3FA 1LTGD 1QE6A 1CQFA 1QB5D 2E2DC 2R93B 5M3FH 1G51A 4GNXA 4G4KA 4QQBX 2FXQA 3M4QA 1IYUA 2MP1A 1O80A 1SNQA 2F0JA 3S9WA 1U9RA 5IYBH 2PNHA 3PUWA 4G57A 3I55A 1SNPA 1UE5A 3A74A 1UEBA 3X3NA 1NSNS 4A3BH 4HCEA 5KNBA 1Q1BA 1I6HH 1YHBA 3ZJYC 3NTHA 3G7LA 2OF1A 2JA9A 5GAGC 4P72A 1E7ZA 1OXTA
chains in the Genus database with same CATH topology
2PQEA 1FR3A 3SHLA 1KAAA 3N6RA 1WTVA 3MC0B 1ENFA 4KY7A 3SE0A 2L55A 3C2PA 2WKDA 2K32A 3GTLB 3OSOA 3S17B 2B2TC 4B9WA 1JOOA 5JVH3 3HOVB 2QF7A 3HP3A 2BOSA 5BN3A 1IYVA 2YU9B 2CVRA 2A6HD 3GP7A 3OIPA 2HCCA 2F3WA 1PDQA 2HUGA 3K5LA 3CHBD 1SNCA 3D6CA 4C1NK 1E0BA 2A6ED 3SEBA 4OO1I 1F9RA 2EDGA 3MXPA 1BCPD 1SE3A 1STYA 1Y1VB 2BE5C 4BY1B 2HCIA 2MPMA 3SDZA 1O7ZA 4XYQA 1TY2A 4IUQA 4KN4C 1A6XA 5LL6S 2A73B 4BS9A 4IUPA 3GTMB 2I07B 4XYOA 5EPLA 2JA8B 2B2UC 3T4AC 2BA1A 4RHSA 1HHVA 1CA6A 2OXPA 5FKAC 5JPNC 1PFMA 3MTSA 3X3MA 2K6AA 4X3UA 1STNA 1PZKD 2QILA 1JWSD 2MGSA 1PMRA 3KLRA 5C0XG 5D3DA 5KGUA 3HRZC 1SYDA 2NN6I 1XWEA 3NBIA 4RGNA 4RHRA 2F0IA 1F2LA 3SK6A 1U4RA 3MFYA 4P2CB 1I50B 4LMQD 1MI2A 4KD3A 5LL6X 3S1MB 5C3EB 1NR4A 4QIWB 1ZYRD 3VR3A 3NUCA 2EOTA 4KMUC 1K83B 1D5XC 4C3HG 4WFN3 1SSOA 2NBFA 3DMUA 4IUTA 2TMPA 5FLXE 4NKLA 4CKEA 2R7ZB 5IGDA 4IFDI 4EQNA 1EL0A 1VMCA 2F0HA 3CU7A 3ND9A 2E76C 4KKUA 1GUNA 3M85A 2IT1A 5D14A 5ISRA 1GJXA 5M3FB 4IUNA 4ZLTF 1CA5A 2D2CC 4RH6A 2JYOA 3DHQA 4HTHA 4NMZA 3RZOB 2X6GA 1NCVA 1MGSA 2EYFA 1DOLA 1S5ED 1BCPB 4EQOA 2F0NA 3Q0AA 4C3IB 2NN6H 1DOKA 3KF8A 2PMZB 1LTBD 4A3DB 3IAYA 3BYTB 3QOLA 5ELDA 3CKIB 3VYRA 1TKWB 3DM1A 1PTOD 2J0TD 1EQVA 1H9JA 3IKJA 3OMGA 5A35A 4OO1H 1IW7D 3TP5A 4IFDG 1QNUA 2R61A 1D5ZC 4RA8A 3TP6A 4RCNA 1H9SB 2DNEA 3C1FA 2EY2A 2M00A 2NYZD 4RGMA 4J8QA 4HMIA 3GO5A 4H13C 1LTAD 2F0PA 3DWAA 2L5TA 2EE1A 5E3FA 4RGOS 1ML0D 2RDGA 1KNAA 2VNUD 5ELCA 3TN2A 3FEWX 1UNSA 1I4XA 2SEBD 2ICEC 4IZ8A 3MVVA 4X3TA 1DJRD 1NAPA 1TT2A 1GHKA 2A69D 2O2LD 3K5NA 1JR0D 3S1RB 1SJHD 1Z47A 3CRLC 3I73A 3E0JA 5CBAE 2F0EA 1QOHA 3MXNA 1TS2A 2WB1B 5FO7B 2IX1A 4YIJA 5HURA 2CHBD 3GV3A 3W3AA 4PMCA 3NQTA 2IL8A 4HSVA 5KNCA 3FPUB 3S2HB 3BS1A 1G91A 2L11A 2F1MA 1BCPC 5CR3A 4XQJA 1DCZA 3M4OB 3TZDA 5K36H 1PLFA 4KHVA 2A68C 4O1NA 3F2UA 5EGTA 4U673 1LT4D 2K5QA 2NUCA 5BN5A 2Z4HA 4A3GB 1PZID 3PUYA 1BNZA 1AN8A 3D3RA 3NWSA 4JK1C 2GA4B 1KABA 4DNRB 2K03A 1SYFA 1JWUD 2K28A 4G7OC 3K58A 4RKLA 1TS4A 3BZDB 3DXJC 1EYAA 2EJMA 1FGBD 2FINB 5JOBA 1R4QB 1PTOH 2B2TA 2LKVA 1CK1A 4V190 3JAME 2J4XA 4FO2A 1C48A 5ELBA 2ZXOA 3I4MB 4HN7A 2F4IA 4K5XA 3MAQA 2L12A 2YYZA 1WD1A 4DA2A 1JCKB 1ILPA 3V05A 5JJZA 3EQLC 2F0FA 5E4WC 2ID0A 1SNMA 3KBXA 1BDOA 4KJNA 3ONAB 2G9DA 3TZUA 2F0KA 2F0SA 2IPKD 2N55A 2CW0C 5HGTA 2R92B 4CKBA 1TR5A 4C3JG 1PTOF 5EBCA 1LT3D 4K2LA 1QG7A 2PPBC 4XTCS 1R9TB 1Z7TA 2EJGC 2BDOA 5DAUA 1PFBA 4JBWA 2QEJC 3MWYW 4HR7B 4NP5A 3TP7A 1EWCA 2OT2A 2L1BA 3NE5B 2TSSA 2QCPX 3A7AB 4HAEA 1V1PB 4QF4A 1SMYC 3P20A 2F0MA 1EY9A 2BE5D 2JP1A 3OWEB 1SBBB 2C5CA 2PNRC 2EY6A 5BN4A 2AQ1B 3MEHA 4MN3A 5KYLA 3SVMA 2WINB 1ILQA 1TY0A 3C1EA 4H7BA 1X3QA 1Y1WB 1KLGD 2BCOA 2F0TA 1SXTA 2J7ZA 1KNEA 5A2QE 4XIGS 1RHPA 1RKNA 2SNMA 4FF2A 3J81E 1KLUD 2KA7A 2F0GA 1I6HB 2NZ1D 1GUGA 3K7AB 4A3BB 4K2KA 2FFKB 4A3KB 3P75A 1CHQD 3OPOA 3NK9A 1CT1D 2KJXA 4TRDA 1X32A 1W6KA 3L9AX 4QUFA 3TDQA 4A3EB 1BXTA 2QKIC 5KRUA 1WTPA 1EQTA 1QJOA 4CGYB 3H94A 5E1FA 2K7VA 2JXMB 5EQ0A 3M7NA 4DAVA 3S15B 4KTAA 2AUJD 3DEOA 3KK7A 2A5HA 3L7ZC 1GUTA 3T16A 1V1PA 1PYWD 1TWGB 1FNWA 1HQRD 4ODGA 3ZYYX 4ZYSA 4XT1B 4K5WA 1GUOA 4ME5A 1EY5A 3GTKB 2PW5A 3NSWA 1AEXA 3VYUA 1LTRD 3HS0C 5IGCA 4FYDA 4KY5A 3UI2A 3R8BA 3DWPA 2EYOA 1CI3M 5JEAG 2NB0A 1SDFA 4K14A 2E2HB 4UDUC 1KDCA 4K8IA 2IX3A 1K8MA 2ZXPA 1S5DD 2B8FA 2PYKA 4I65A 1EOTA 3N52A 3S2DB 3VR5A 2XSCA 4IFDJ 3DEPA 3I72A 4IUVA 5TSSA 1O7YA 4F8MA 2JA7B 5C4ZA 2NTTA 1KDAA 4DGZA 1GHJA 3A7LA 1G6ZA 1I4HA 2LFNA 4XDXA 1VDZA 3J7YW 1LTSD 2Q8RE 4CBVA 4PV1C 1LACA 1HTPA 1IW7C 4CJ1B 3BG3A 2PO4A 3TSSA 5I9PA 1M4VA 2KCCA 4KD4A 4QMGA 1SE4A 3J7AF 3T53B 4OGQC 4KJOA 1Y8OB 4M8AA 1JORA 1I4GA 1QNKA 1T5XD 2F0VA 1D5MC 3GTOB 1F9PA 1EEFD 4HEDA 4K8JA 1STEA 4F88A 1AZPA 1E2VA 3L3OC 1HCZA 4J1MA 2M2LA 3Q22A 3O13A 4LK1C 1SYCA 2EVBA 4J6HA 1VCIA 1MD2D 1EY4A 1S5BD 3Q23A 2RBMA 5C3WA 3HOYB 4ABNA 1HFNA 1EZ8A 1D1KA 3DUZA 1EIHA 1BQQT 1CZGA 3BVZA 3T56B 5CORA 2AQ3B 3GD7A 2R3ZA 5J22A 4FF1A 4F7XA 2CQAA 1OXXK 4WJWA 3P7JA 3A8JE 4RGTA 1PFNA 2K01A 1JWMD 1SMYD 2VB2X 2O5JC 3D4WA 5E4XA 3D4RA 1DZ1A 3LNNA 3QB3A 3S14B 1SJED 1A15A 2EYJA 2D9UA 1TWFB 1CM9A 3I4NB 5CGKA 3QWNA 1EU4A 4ZUJA 3J80E 1IKMA 1SE2A 3R2TA 4FP5D 3NBHA 1J9OA 3E5SA 4TKOB 4WORA 5EPJA 3T51B 3WDNA 4FVMA 2AWNA 3PUVA 2JEAI 4EQPA 3PO2B 5T1IA 3A55A 5KEEA 3PV0A 2HDMA 2A6EC 4A93B 4H0LC 2L9HA 2V4DA 3HG9A 2RSNA 1I4QA 3GQBA 4HCSA 2EY5A 4XQQA 4GZYC 2NVQB 3K5MA 2OEOA 1QCBD 2WAQB 3QIAA 5CV6A 1LV9A 4A3FB 1H9RA 2E74C 1AP0A 1UEAB 1RDPD 3HOZB 4RWSC 1EY0A 2KVMA 4EGVA 3SXHA 4N9PA 4C1NI 2MUYA 2HQEA 1ICWA 1JB3A 5D3IB 3K0YA 2NVXB 1VF7A 1HXYD 1PRTC 3K57A 4CJ2C 3VYTA 4X3SA 5EBDA 3I91A 1UAPA 3NTIA 3FPPA 4C2MB 3D4DA 1EU3A 2NWGA 4G7ZC 3MFGA 2BA0A 3NTKA 2K5DA 4R8NA 2AQ2B 2JEBI 1TVXA 2WACA 3CRKC 1TIID 3H09A 1HTLD 1FYCA 2DY8A 1V1OA 1AFPA 2L0CA 1HPCA 4CJ0B 1LLRD 3RZDB 3MXGA 3WOFA 1SEBD 3H6MA 1RTNA 4C3HB 1DXMA 5CBEE 4K5VA 5DM73 1EYDA 3Q24A 5C0XH 1F2MA 1Y69U 5J39A 3NQIA 2IW3A 3NHHA 5KIXA 3LX0A 4ZAIA 1E2ZA 3A8KE 3SK5A 3K5OA 1CFMA 3OWFA 2R6GA 1B9MA 1LABA 5COYA 1JICA 3P1HA 5EKIA 3NP8A 2DNCA 2K5WA 4DXFA 2K33A 5M9OA 2HDLA 2PZUA 5FLXL 3BVMA 3J7AV 1EEID 4BY7B 1ZKOA 2C9OA 1CZWA 1I6VC 1V8QA 3ERQA 4A3JB 5IOCA 4FXDA 3GTJB 4C56C 1BCPF 4CKCA 4BA2I 4NW2A 2ZXRA 1DYQA 2XNAC 4F87A 1WTXA 2PZTA 2G9HD 4B08A 1PTOC 4S3SA 4KHZA 1WTOA 1FD7D 4AYBB 4DU9A 2XRSD 3E6ZX 4C3JB 3FMCA 2IJ0A 2EXZA 1XTCD 1TS5A 2D5DA 1Q1EA 1OO9B 3TMEA 1AW7A 1H9SA 3PIP3 4DAYA 3EFXD 1STBA 3V96A 1STAA 1SYBA 1A3TA 1DM0B 3RD4A 1WD0A 1LTTD 1GOZA 3TBIB 5I4DA 1KTKA 2VB3X 1TWHB 1YNJD 4B9XA 2XWJB 1CTMA 1HRJA 3M7GA 2SNSA 4KY6A 4LJZC 3ITPA 1UUPA 4NDXA 4TSSA 3FRPB 1Q3LA 3HOWB 2RSOA 2JA6B 2IX0A 2JA5B 1Y8PB 3W2DA 5CV5A 1B50A 2LMCB 4OIJA 2O4XA 1JC7A 5I2XA 1EWHA 4FNFA 3RMHA 3OHXC 3GTQB 1GUSA 3HKZB 4IUUA 2K05A 3IFDA 1QWYA 3JAML 1HFGA 1WTQA 4G7HC 3AU7A 3VA7A 3FKIB 2KEDA 2EYPA 4DN4M 4DAPA 1EY6A 1TS3A 3G6JB 4H44C 2B2WA 1L0XB 3ND8A 2JSOA 1MSGA 5IT9E 2BDNA 5EKKA 1RF2D 4O42A 1SAPA 2FHTA 3S16B 4L6TB 4ZUIA 1EFID 1SNOA 4HMJA 2RQXA 4BWGB 1A3VA 1PZJD 1S5FD 3BDLA 1A2TA 3M4YA 3EROA 5M5WB 1OXSC 2KEEA 1NR2A 4ZQ3A 1PRTB 5IT9L 1WVLA 1XYIA 4A3IB 1B2TA 1I4PA 3R2IA 5IGBA 1ZYRC 3H91A 2H1EA 2B8GA 1D1IA 1EY7A 2EJFC 3PUXA 2NN6G 2F0DA 3OOCA 2I46A 1A3UA 3U9OA 3VR6A 1JE4A 3SR1A 3R93A 5C3XA 2A6HC 1ENCA 2WIIB 1V43A 3IL8A 3KBGA 2RA4A 3MXUA 1O7LA 1BO0A 1R4PB 4OO1G 4IFDH 2IWHA 5M3MB 1F77A 1CHPD 5I6YA 5C6AA 3PIO3 1WTRA 4K6DA 4LAAA 2NVYB 3BDOA 1HQMC 1F2YA 1TWAB 3K6OA 2ZT9C 1RD9D 2ENBA 1ESRA 4DNTB 2NTSA 3HEJA 2B2YA 2RDHA 3H3VC 3GV6A 4X3KA 3NXWA 3H0GB 2B63B 1Z6HA 3S1QB 4E6IA 5JVG3 4K6LA 3R3OA 1OXUA 2EZVA 4XT3B 5IODA 2KQ3A 1EIGA 3BDCA 3QO2A 5C44B 1SYGA 4ZK9B 2N88A 3AMUA 2EYHA 1W6JA 2FJ2A 1FNVA 4FF3A 1IL8A 1YNND 5ELEA 4WRDA 5K36G 4IN3A 1ENAA 2QDBA 3OW7A 2XWBB 1B9NA 1SNDA 1D2BA 1E2WA 4TQUS 1F9QA 1TQOA 3KLSA 1M8AA 5JAVA 5IGFA 3A8IE 4EVOA 3MA2B 5CYUA 4DFAA 1MBYA 2XN9C 1ET6A 3C3LA 5C5MA 2B2UA 1HUNA 1JOKA 1HA5A 3M3YB 3QG1A 2SOBA 2AWOA 2X6LA 5CC4A 3V2TA 4R9WA 4PMBA 1U4PA 4FXGC 1EY8A 5C4XB 4QCLA 1D6EC 1H9MA 5DEHA 1K8OA 3D8GA 2L4NA 5T1GA 5I2YA 2XVSA 2B2YC 4C3IG 5JEAH 1I3QB 2EYMA 3TP8A 2Z1CA 2X69A 4Y7NB 2WP8J 1U4MA 1OXVA 2F0UA 3HZXA 1C4QA 1GXDC 5KNDA 1S4ZA 1G291 2KOLA 4OIKA 1G8ZD 1O78A 5CV8A 1X3PA 2ICIA 5JPMC 4Q5VA 4PMWA 1B4OA 5CV4A 3CQZB 1EYCA 3VYSA 4Q0FA 4R8IA 1C8CA 4OL7A 1SFOB 5FO8B 5C4HA 5FOBB 4CHTB 4KK7A 2EPBA 1HUMA 2PCFB 2B39A 1SYEA 5LHY1 1RTOA 3VA5A 4KI0A 3EJIA 1B1ZA 3S1NB 1Q90A 1YNJC 3PO3B 1XXGA 1ZEQX 2A69C 3QJYA 4BA1I 2E2JB 2A74C 2F0WA 1G2SA 3RUZA 2KUMA 3J80L 2EY1A 1BR9A 3MZ5A 1L0YB 5G3LD 2E2IB 2EYLA 3BVGA 5ELFA 3NPPA 1TU2B 2Q8TA 3J81L 4DF7A 4A3MB 2B2VA 4BBRB 5M5YB 5NUCA 4ZRZA 2LY7A 4FXKC 1B3AA 1PTOB 5IGEA 3FDTA 2F0QA 2LS01 2FMCA 5C5LA 1II3A 3HOXB 2AUKA 5CV9A 5KYIA 4ID6A 2A68D 4ZKCB 3I3CA 5FO9B 2Y0SB 3HOUB 1WCMB 1YNNC 1DONA 1STHA 2SDFA 5C4JB 3VR4A 2K04A 1EZ6A 1QILA 3MHBA 1A2UA 1J8IA 5F2DA 2F0LA 1F9SA 1FNUA 4IALA 1IKLA 1BF4A 3GTPB 1G2TA 1H9KA 1ZXTA 4ZKBB 5J1ZA 4V0BA 1CQVA 1RODA 3T13A 1B53A 2RVLA 3D6WA 5A2QL 4ILWA 2F03A 3BYYB 5DNFA 5M5XB 4BBSB 1BBXC 1F2ZA 2KCNA 2RKSA 1ESFA 3WOEA 2KECA 4FF4A 1PXUA 4Z9CB 1LTID 5CV7A 2Z4IA 3OMCA 2H4OA 1PRTF 2KHSA 3URYA 5DM63 3A54A 1ET9A 1Q8IA 1STGA 2WKCA 1Y8NB 3C46A 3IFTA 2DY7A 4XXEA 5FK9C 4OHJA 2PW7A 2RDFA 3NWTA 4UAIA 2E75C 5AFWA 1PRTD 3D31A 3RLFA 1RJTA 3LWEA 1I4RA 4M1UB 2WV6D 1NUCA 1HA6A 3EVQA 5EKLA 4ULLA 4PNYA 5C0XI 2JE6I 5I9OA 1KDBA 1DOMA 4KKTA 4RKBA 4L8JA 4KN7C 5G3LF 5EPKA 4RCOA 1AZQA 2Z8LA 3I8ZA 4I7ZC 3LWUA 1MSHA 2VUMB 2NVTB 1XX8A 1JOQA 2D62A 4HSPA 3I4LA 1LO5D 3KLSX 5JEAJ 4DK0A 4KKSA 2XIWA 4N9TA 4IQZA 3QOJA 2B2VC 3Q6SA 3SK8A 3KUPA 2DN8A 4RFBA 1VF5C 5I6WA 1WTWA 4L63B 3FVQA 1Q12A 3DWQA 4IURA 5K5PA 2B2WC 3A56A 1GUWA 4MIUA 3U9SA 2O5IC 3SK4A 2F3VA 1JQYD 2FMMA 2VXWA 1U4LA 5D65A 2PZWA 4U68A 1BUVT 5C0XJ 3HGBA 2XRQD 2Q8IB 1VMPA 2M9VA 3I70A 1ONLA 5IIFA 1TWCB 1DD2A 1RCVD 4XQNA 4RAUC 1IHZA 4KV6A 5IGGA 5EJWA 2F0OA 2CW0D 2K1BA 5CMDA 2MJ8A 3I90A 4PQXA 4QB4A 1B44D 1LT6D 4QUCA 4DK1A 3VR2A 1BOSA 3EA6A 3OIQA 2MHVA 4DXGA 3GTGB 3PMFA 1T5EA 3K59A 1LT5D 3AB9A 3PUZA 1S5CD 4MHEA 1LTGD 1QE6A 1CQFA 1QB5D 2E2DC 2R93B 4G4KA 1IYUA 2MP1A 1O80A 1SNQA 2F0JA 3S9WA 1U9RA 3PUWA 4G57A 1SNPA 3X3NA 1NSNS 4HCEA 5KNBA 1Q1BA 3NTHA 3G7LA 2OF1A 1OXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2Y A;  1SYD A;  2PQE A;  4KHV A;  5I6W A;  2EYP A;  3SHL A;  1KAA A;  4NP5 A;  5EGT A;  3TP7 A;  1AEX A;  5K5P A;  4KY7 A;  1EQV A;  3TP8 A;  1EY6 A;  2F0I A;  1F2Z A;  2NUC A;  2RKS A;  3OMG A;  4EQP A;  4KY5 A;  5IGC A;  5C5M A;  4MIU A;  3TP5 A;  4J1M A;  4QF4 A;  5KEE A;  2ENB A;  2F0M A;  1EY9 A;  3SK6 A;  1JOK A;  2EYO A;  2F0W A;  2EY6 A;  3H6M A;  3OSO A;  5EKK A;  1SYC A;  3RUZ A;  2EY1 A;  3SK4 A;  2F3V A;  3MEH A;  4J6H A;  4KD3 A;  3TP6 A;  4K5V A;  4B9W A;  1STB A;  5KYL A;  1KAB A;  1EYD A;  2SOB A;  3MZ5 A;  3HEJ A;  1STA A;  1JOO A;  1EY4 A;  1F2M A;  2EYL A;  3OMC A;  5CV7 A;  5J39 A;  2PZW A;  1SYF A;  5CC4 A;  3C1E A;  3V2T A;  1SYB A;  4K14 A;  4PMB A;  2RBM A;  3NHH A;  4H7B A;  4ZUI A;  5KIX A;  1EY8 A;  2KHS A;  3C1F A;  3LX0 A;  5C3W A;  1A3T A;  1SNO A;  3NXW A;  2EY2 A;  1EZ8 A;  1KDC A;  2F3W A;  2M00 A;  3NUC A;  4K8I A;  4RKL A;  1STG A;  2F0T A;  3D8G A;  5DEH A;  4DF7 A;  3SK5 A;  2EY5 A;  4HMJ A;  4HMI A;  5IIF A;  1EYA A;  3OWF A;  5JOB A;  2PYK A;  4I65 A;  4E6I A;  1SNC A;  2OEO A;  4F7X A;  5NUC A;  1RKN A;  3R3O A;  2SNM A;  2LKV A;  3D6C A;  1A3V A;  2F0P A;  3DMU A;  3BDL A;  5J22 A;  1A2T A;  3P1H A;  2PW7 A;  5E3F A;  2RDF A;  4B9X A;  4NKL A;  3ERO A;  5IGE A;  5IOD A;  1IHZ A;  2F0G A;  2F0Q A;  2EYM A;  2KQ3 A;  4KV6 A;  3NP8 A;  5CV6 A;  1II3 A;  3MXP A;  3BDC A;  4ZQ3 A;  5C5L A;  4EQN A;  5IGG A;  1STY A;  2F0O A;  2SNS A;  4KY6 A;  4K2K A;  1SYG A;  3P75 A;  5CV9 A;  5KYI A;  3ITP A;  2F0H A;  3NK9 A;  4ID6 A;  4K5X A;  4F8M A;  5M9O A;  5IGB A;  4TRD A;  5C4Z A;  2PZU A;  4NDX A;  2F0U A;  4IZ8 A;  1EY0 A;  4QB4 A;  3HZX A;  3MVV A;  1KDA A;  4DGZ A;  1EY7 A;  1STH A;  2EYH A;  3SXH A;  5KRU A;  1NUC A;  5ISR A;  3EVQ A;  2F0D A;  1TT2 A;  4IUN A;  4N9P A;  5EKL A;  4PNY A;  2HQE A;  3ERQ A;  1A3U A;  2F0F A;  1EZ6 A;  5I9O A;  1KDB A;  3D4W A;  5IOC A;  3MHB A;  5E1F A;  3U9O A;  3QB3 A;  4WRD A;  5CV8 A;  1A2U A;  4RKB A;  1SNM A;  5F2D A;  2F0L A;  3SR1 A;  3DHQ A;  3PMF A;  4HTH A;  5C3X A;  4IAL A;  2F0E A;  2OXP A;  4NMZ A;  4KJN A;  5CV5 A;  5CV4 A;  1ENC A;  4PMC A;  2EYJ A;  4YIJ A;  5HUR A;  5IGD A;  1ENA A;  4KTA A;  2QDB A;  2O4X A;  3NQT A;  2F0K A;  2EYF A;  1EYC A;  2PZT A;  2F0S A;  5I9P A;  1JOQ A;  1SND A;  4KD4 A;  4S3S A;  3T16 A;  4QMG A;  4OL7 A;  5CGK A;  4ZUJ A;  5C4H A;  4EQO A;  3D4D A;  5HGT A;  2F0N A;  1STN A;  4DU9 A;  1TQO A;  1SNQ A;  1TR5 A;  2F0J A;  4KJO A;  5J1Z A;  1JOR A;  4N9T A;  3S9W A;  1U9R A;  5CR3 A;  4G57 A;  5JAV A;  4ODG A;  5IGF A;  1SNP A;  2EXZ A;  4K2L A;  2F0V A;  3QOJ A;  1NSN S;  1SYE A;  4R8N A;  5I6Y A;  4K5W A;  5C6A A;  3E5S A;  4WOR A;  4K6D A;  3VA5 A;  4LAA A;  2WAC A;  4EVO A;  3EJI A;  3QOL A;  4DFA A;  3T13 A;  2OF1 A;  3SK8 A;  4ME5 A;  1EY5 A;  5KGU A;  3TME A;  5DAU A;  2PW5 A;  4K8J A; 
#chains in the Genus database with same CATH topology
 2PQE A;  1FR3 A;  3SHL A;  1KAA A;  3N6R A;  4OWT B;  1WTV A;  3MC0 B;  1ENF A;  1YHA A;  1IZ6 A;  4KY7 A;  3SE0 A;  2L55 A;  3C2P A;  1GD7 A;  2WKD A;  2K32 A;  3GTL B;  3CCQ A;  2MFI A;  3OSO A;  4POG A;  3HOX H;  3CF5 A;  3S17 B;  3CXC A;  2B2T C;  3S1M H;  4B9W A;  1KQS A;  1YEZ A;  1JOO A;  5JVH 3;  3HOV B;  2QF7 A;  1IBM L;  3HP3 A;  2BOS A;  5BN3 A;  3HOU H;  1IYV A;  2YU9 B;  3RLN A;  2CVR A;  2A6H D;  3GP7 A;  3HFZ B;  2HCC A;  3OIP A;  1IBK L;  4BY1 H;  4BBR H;  1OTC A;  2F3W A;  1IL2 A;  1PDQ A;  2HUG A;  3K5L A;  3CHB D;  1SNC A;  4LF9 L;  2LXK A;  3D6C A;  4C1N K;  3EIV A;  4A3K G;  1E0B A;  4IOA A;  2A6E D;  3SEB A;  4OO1 I;  4Y52 H;  1F9R A;  2JK8 A;  3T1Y L;  2EDG A;  3MXP A;  1BCP D;  1SE3 A;  1STY A;  4DUZ L;  1Y1V B;  2BE5 C;  2E2J H;  4BY1 B;  4OXP A;  2HCI A;  2MPM A;  2ASB A;  2AKW B;  4JI6 Q;  3SDZ A;  1O7Z A;  2OQ0 A;  1TY2 A;  4XYQ A;  3PO3 H;  4BXX H;  4IUQ A;  4KN4 C;  1A6X A;  5LL6 S;  3G4S A;  2A73 B;  1YBY A;  4BS9 A;  4DR4 Q;  4IUP A;  3GTM B;  2I07 B;  4XYO A;  1MJC A;  5EPL A;  2JA8 B;  2B2U C;  3T4A C;  2BA1 A;  2MO0 A;  1PH7 A;  4RHS A;  1HHV A;  1YJ9 A;  4WJ4 A;  1CA6 A;  2OXP A;  5FKA C;  4OX9 L;  4N8F A;  4GN4 B;  1HZ9 A;  5JPN C;  1PFM A;  3MTS A;  1HR0 L;  3X3M A;  2K6A A;  4LWC A;  4X3U A;  1STN A;  1VQH A;  4X64 L;  1O7I A;  1PZK D;  2QIL A;  1JWS D;  2MGS A;  1PMR A;  1HH2 P;  3KLR A;  5IE8 A;  5C0X G;  1S40 A;  5D3D A;  1N36 L;  4B3T Q;  5KGU A;  3CQZ H;  3HRZ C;  2ZJP A;  1SYD A;  2NN6 I;  3NEL A;  1XWE A;  3NBI A;  4RGN A;  4B3M Q;  3KF8 B;  3HOW H;  4RHR A;  3K81 C;  2F0I A;  3KF6 B;  4IJL A;  4B3R L;  3PGZ A;  4J15 A;  2JA5 H;  1F2L A;  3SK6 A;  3A0J A;  1L2F A;  1U4R A;  3MFY A;  4P2C B;  1I50 B;  4LMQ D;  1J5E Q;  1MI2 A;  4KD3 A;  3RNU A;  5LL6 X;  2QA4 A;  2HHH L;  1AE3 A;  2OQK A;  4DV0 L;  3S1M B;  5C3E B;  1NR4 A;  4QIW B;  1Q81 C;  1ZYR D;  3VR3 A;  3NUC A;  2EOT A;  4KMU C;  4AIM A;  3TS2 A;  1LYL A;  1K83 B;  1D5X C;  4C3H G;  2C35 B;  4WFN 3;  1SSO A;  2NBF A;  3DMU A;  4DPG A;  4IUT A;  2OWO A;  2TMP A;  1C0A A;  5FLX E;  4NKL A;  4A93 G;  4CKE A;  2R7Z B;  1JE5 A;  5IGD A;  4IFD I;  4EQN A;  2I5M X;  1EL0 A;  1VMC A;  4DR7 L;  2F0H A;  3CCV A;  3CU7 A;  3ND9 A;  2E76 C;  4KKU A;  1GUN A;  3M85 A;  4JBK A;  2IT1 A;  1PHJ A;  5D14 A;  5ISR A;  1CKN B;  1GJX A;  5M3F B;  3UE0 A;  4IUN A;  1VQ5 A;  3S2D H;  4ZLT F;  4DV2 Q;  1WTH A;  1CA5 A;  1WOC A;  2D2C C;  4RH6 A;  1VQN A;  2JYO A;  3F2C A;  3DHQ A;  4HTH A;  4NMZ A;  3RZO B;  2X6G A;  1NCV A;  2RCN A;  4DV3 Q;  1MGS A;  1FL0 A;  2EYF A;  1DOL A;  4UP7 A;  1S5E D;  4QY7 A;  3VDY A;  1BCP B;  4EQO A;  3CCU A;  1VQ4 A;  2F0N A;  3Q0A A;  4C3I B;  2NN6 H;  1DOK A;  3CPF A;  3KF8 A;  2PMZ B;  2E5L L;  4X62 Q;  3RZD H;  1LTB D;  1VQG A;  1FJG Q;  2EIF A;  4A3D B;  1N32 Q;  3IAY A;  3BYT B;  3QOL A;  5ELD A;  3CKI B;  3GTK H;  4APV A;  2HT1 A;  3VYR A;  1TKW B;  2UUC Q;  3DM1 A;  1PTO D;  4CDD C;  2J0T D;  1EQV A;  1H9J A;  3IKJ A;  3OMG A;  1VS0 A;  2RCF A;  2CH4 A;  5A35 A;  4OO1 H;  1IW7 D;  3TP5 A;  4IFD G;  2Z6K A;  5C44 H;  1QNU A;  2R61 A;  1M90 C;  1D5Z C;  2JJQ A;  2XGT A;  4RA8 A;  4CDC C;  3TP6 A;  1YHQ A;  4YHH Q;  3I4M G;  4NXN Q;  4AH6 A;  4DR1 Q;  1E24 A;  4RCN A;  1GM5 A;  4RMF A;  1H9S B;  4JI4 L;  4LUV A;  2DNE A;  3C1F A;  4DAY B;  2EY2 A;  3S1Q H;  2M00 A;  1J5E L;  1IBK Q;  2NYZ D;  4RGM A;  4J8Q A;  1VQO A;  2B3G A;  4HMI A;  3GO5 A;  4H13 C;  1LTA D;  1X56 A;  2F0P A;  3DWA A;  2ZJR A;  1XMO L;  1I5F A;  2L5T A;  2EE1 A;  5E3F A;  4UHV A;  4RGO S;  1ML0 D;  2RDG A;  1KNA A;  4A3M G;  2VNU D;  5ELC A;  4A3D H;  3TN2 A;  3FEW X;  1UNS A;  2K75 A;  1I4X A;  2SEB D;  3PF5 A;  2ICE C;  4IZ8 A;  1TWA H;  3MVV A;  3I2Z A;  3D0F A;  4X3T A;  1DJR D;  4EX5 A;  1NAP A;  3CCM A;  5L37 A;  1TT2 A;  1GHK A;  2A69 D;  2O2L D;  3K5N A;  1JR0 D;  3S1R B;  1SJH D;  4JCV E;  1Z47 A;  3CRL C;  3I73 A;  3E0J A;  5CBA E;  2R7Z G;  2F0E A;  1QOH A;  1XNR L;  3MXN A;  1TS2 A;  3GTJ H;  2WB1 B;  4YIJ A;  1A62 A;  5FO7 B;  2CHB D;  3W3A A;  4LUZ A;  3GV3 A;  4PMC A;  5HUR A;  2IX1 A;  3NQT A;  2IL8 A;  4HSV A;  5KNC A;  5FLX c;  1U5K A;  1NY4 A;  3FPU B;  3S2H B;  3BS1 A;  1G91 A;  3CCS A;  4EQ5 A;  2L11 A;  3BZC A;  2F1M A;  1BCP C;  5CR3 A;  4XQJ A;  4YY3 Q;  1DCZ A;  3PF4 A;  3M4O B;  3TZD A;  5K36 H;  4LUO A;  1PLF A;  1HNX L;  3FHW A;  4DK3 C;  1PH8 A;  4KHV A;  2A68 C;  4O1N A;  3F2U A;  5EGT A;  1SR3 A;  1VQF A;  4U67 3;  1LT4 D;  2K5Q A;  2NUC A;  2R7D A;  5BN5 A;  3T1H Q;  1GVP A;  2UXB Q;  4K0K L;  2Z4H A;  2K50 A;  4A3G B;  1PZI D;  3PUY A;  1BNZ A;  1AN8 A;  4A3F H;  3D3R A;  3NWS A;  1YJW A;  4JK1 C;  5C3E H;  2GA4 B;  2F3I A;  1KAB A;  3STB D;  4DNR B;  2K03 A;  4YWM A;  2N49 A;  4ZCK A;  5E7N A;  1JJ2 A;  4YCV A;  1SYF A;  1JWU D;  2K28 A;  4G7O C;  1H95 A;  1K73 C;  3JAM c;  3K58 A;  4RKL A;  1TS4 A;  3I7F A;  3K7A H;  2BH8 A;  3BZD B;  3DXJ C;  1EYA A;  2EJM A;  1FGB D;  2FIN B;  2Z6K C;  1BBW A;  5ELO A;  1R4Q B;  3AYH B;  2K5H A;  5JOB A;  3NBH B;  1PTO H;  2AHO B;  4DUZ Q;  1SN8 A;  2B2T A;  2LKV A;  1CK1 A;  4O0A A;  4V19 0;  3JAM E;  2ZM6 L;  3H3V I;  2J4X A;  4FO2 A;  1C48 A;  1WCM H;  1VQE A;  5ELB A;  2ZXO A;  3I4M B;  4A3L G;  4HN7 A;  1XPR A;  2F4I A;  4K5X A;  3MAQ A;  4LF5 L;  2L12 A;  2YYZ A;  1QVC A;  4DUY Q;  1WD1 A;  4DA2 A;  1JCK B;  1ILP A;  3PSI A;  3CP0 A;  3V05 A;  3CMA A;  5JJZ A;  1ASY A;  3EQL C;  2DJF C;  2F0F A;  5E4W C;  1U0L A;  4IOC A;  4R4C A;  2ID0 A;  5IP9 H;  5LMN L;  1SNM A;  3RLO A;  3KBX A;  3JC6 6;  1BDO A;  2CWA A;  4KJN A;  3ONA B;  2G9D A;  3TZU A;  4DV3 L;  2F0K A;  4YCW A;  2F0S A;  2V1C C;  2IPK D;  2GVA A;  2N55 A;  2CW0 C;  4DR5 Q;  3SGI A;  5HGT A;  2R92 B;  4CKB A;  1PH2 A;  4QL5 A;  1TR5 A;  4C3J G;  1PTO F;  5EBC A;  1LT3 D;  3GTQ H;  1VQD A;  1QG7 A;  4K2L A;  2PPB C;  4BBS G;  4XTC S;  1R9T B;  1Z7T A;  2EJG C;  5GQO A;  2BDO A;  1PFB A;  5DAU A;  4JBW A;  1Q86 C;  2QEJ C;  3MWY W;  4HR7 B;  4NP5 A;  3TP7 A;  1EWC A;  4KHP Q;  2OT2 A;  2AMC B;  2Q2H A;  2L1B A;  3NE5 B;  2HHH Q;  2TSS A;  3CD6 A;  2QCP X;  3A7A B;  5LMU L;  4HAE A;  3ULP A;  1C9O A;  1V1P B;  4DNI A;  4QF4 A;  1SMY C;  3P20 A;  2F0M A;  4PZ8 A;  1EY9 A;  2BE5 D;  2JP1 A;  3OWE B;  1PVO A;  1SBB B;  2C5C A;  2PNR C;  2EY6 A;  3S16 H;  5BN4 A;  2AQ1 B;  3MEH A;  4MN3 A;  5KYL A;  3SVM A;  2E2I H;  2WIN B;  2UU9 Q;  2R93 H;  5GAE C;  4JI8 L;  1ILQ A;  1TY0 A;  3C1E A;  4R1J A;  4DR1 L;  4H7B A;  1X3Q A;  1L1O C;  4GS3 A;  2KHJ A;  5IP7 H;  1MJE A;  1Y1W B;  1KLG D;  2BCO A;  2F0T A;  1SXT A;  3DM3 A;  2J7Z A;  1KNE A;  4DKA C;  5A2Q E;  4XIG S;  1RHP A;  1RKN A;  1L1O A;  1TWH H;  2SNM A;  4FF2 A;  2R92 G;  3J81 E;  3HOV H;  1KLU D;  2KA7 A;  1I94 Q;  2G5D A;  2F0G A;  1X3E A;  1I6H B;  2NZ1 D;  1GUG A;  3K7A B;  3H0G G;  4A3B B;  4K2K A;  2FFK B;  4A3K B;  3P75 A;  1CHQ D;  3OPO A;  4UPA A;  3NK9 A;  1CT1 D;  2KJX A;  4A3G H;  4TRD A;  1X32 A;  5H1S E;  1K0R A;  1B8A A;  1W6K A;  3L9A X;  2PQA A;  3TDQ A;  4QUF A;  4A3E B;  1BXT A;  2QKI C;  5KRU A;  1WTP A;  1EQT A;  1QJO A;  4IPG A;  4CGY B;  3H94 A;  4JVZ A;  3PQI A;  5E1F A;  4DV6 L;  2K7V A;  4K0K Q;  2JXM B;  5EQ0 A;  3M7N A;  3CCJ A;  4DAV A;  3S15 B;  1PYS B;  2E2H H;  3W5O A;  4KTA A;  3CCE A;  2AUJ D;  1EWI A;  3DEO A;  3KK7 A;  2A5H A;  3L7Z C;  1GUT A;  1RIP A;  1V1P A;  1LTL A;  3T16 A;  1PYW D;  4HJA A;  1TWG B;  1FNW A;  3CC4 A;  3M3Y H;  3ERS X;  4LFA Q;  5LMU Q;  1HQR D;  4JYA Q;  2KCM A;  1MKH A;  3FKI G;  2UUA Q;  3OTO L;  4LF8 L;  4JI6 L;  4ODG A;  3ZYY X;  2MNA A;  4ZYS A;  4XT1 B;  4LF4 Q;  4K5W A;  1GUO A;  3HOY G;  5IYD H;  4ME5 A;  1EY5 A;  3GTK B;  2PW5 A;  3NSW A;  1AEX A;  3VYU A;  1LTR D;  3HS0 C;  5IGC A;  3H3V H;  4FYD A;  4KY5 A;  1PH1 A;  3UI2 A;  2JA7 H;  3R8B A;  3DWP A;  2EYO A;  1CI3 M;  4C3I H;  4HID A;  5JEA G;  1V9P A;  2L15 A;  1NJI C;  4OON A;  1HNW L;  2NB0 A;  2B63 G;  1SDF A;  5AJ3 Q;  4K14 A;  2E2H B;  4UDU C;  2WB1 G;  5HY6 A;  1KDC A;  1EOV A;  4K8I A;  2IX3 A;  1X55 A;  1K8M A;  4UP9 A;  2ZXP A;  1S5D D;  2B8F A;  2PYK A;  4I65 A;  1EOT A;  3N52 A;  3S2D B;  4HIK A;  2QDL A;  2IY5 B;  2YTV A;  1NNX A;  3VR5 A;  1WYD A;  2XSC A;  1PH4 A;  4IFD J;  1T9H A;  3DEP A;  3I72 A;  4A3C G;  4IUV A;  1XPO A;  5TSS A;  1UE1 A;  2I0Q A;  1O7Y A;  1X3G A;  4F8M A;  1C7Y A;  3B6Y A;  1XNQ L;  5C4Z A;  2JA7 B;  1A63 A;  2NTT A;  2UXC L;  1KDA A;  4DGZ A;  4A3E G;  1Q82 C;  4JYA L;  1GHJ A;  3A7L A;  1G6Z A;  1I4H A;  2LFN A;  4XDX A;  2VUM H;  1VDZ A;  2OTJ A;  3J7Y W;  3Q8D A;  1LTS D;  2Q8R E;  4CBV A;  1E1T A;  2HD3 A;  3U4V A;  4PV1 C;  1AE2 A;  4X65 L;  1LAC A;  1HTP A;  1IW7 C;  4CJ1 B;  3BG3 A;  2PO4 A;  4DV1 L;  3TSS A;  5I9P A;  1M4V A;  2KCC A;  4KD4 A;  4QMG A;  1SE4 A;  3J7A F;  3TQY A;  5FLM H;  4BY7 H;  3T53 B;  4OGQ C;  2ZTE A;  4KJO A;  1Y8O B;  4M8A A;  1JOR A;  2YTY A;  5BR8 L;  1I4G A;  1QNK A;  1L1O B;  1T5X D;  2F0V A;  1D5M C;  5M5X H;  3GTO B;  1F9P A;  1EEF D;  2IHF A;  2XTI A;  1PYB A;  4HED A;  2MQH A;  4K8J A;  1STE A;  4F88 A;  1I94 L;  3S15 H;  2KEN A;  1AZP A;  1E2V A;  3L3O C;  1HZB A;  1HCZ A;  4J1M A;  2M2L A;  2QEX A;  3Q22 A;  3O13 A;  4LK1 C;  1SYC A;  2EVB A;  1K28 A;  4J6H A;  1VCI A;  1MD2 D;  2ES2 A;  1EY4 A;  1S5B D;  3Q23 A;  2ALY B;  2UU9 L;  2RBM A;  3HOZ H;  3GTP H;  5C3W A;  3HOY B;  4ABN A;  1HFN A;  1EZ8 A;  1D1K A;  2DGY A;  3DUZ A;  4HJ8 A;  2VL6 A;  1EIH A;  1BQQ T;  1CZG A;  3BVZ A;  3T56 B;  5COR A;  5M3M G;  2AQ3 B;  3GD7 A;  4GLA C;  2R3Z A;  5J22 A;  4FF1 A;  4LFA L;  2B29 A;  4F7X A;  1I50 H;  2CQA A;  2UUB L;  2JA8 G;  1HNZ L;  1OXX K;  4A75 A;  3S24 A;  1Y1V H;  4WJW A;  3P7J A;  3A8J E;  2E8G A;  4X64 Q;  5EAY A;  1IBM Q;  3I4N G;  4RGT A;  1PFN A;  3J80 i;  1TWG H;  3UDF A;  2K01 A;  1W2B A;  1CSQ A;  1JWM D;  1SMY D;  2WAQ E;  4CDF C;  2VB2 X;  2O5J C;  3D4W A;  5E4X A;  3D4R A;  1DZ1 A;  3LNN A;  3QB3 A;  3S14 B;  5FJ8 G;  1SJE D;  4X6A H;  2WFW A;  4R4I A;  2QGQ A;  1A15 A;  2EYJ A;  1EFW A;  2D9U A;  1SLJ A;  2UUC L;  2KCT A;  1TWF B;  1CM9 A;  3I4N B;  2KBN A;  5CGK A;  3QWN A;  1EU4 A;  4ZUJ A;  3S17 H;  3J80 E;  1IKM A;  3U50 C;  3K7U C;  1SE2 A;  4TVA B;  2DUD A;  1YIT A;  2EXD A;  2YTX A;  3R2T A;  4A3I H;  4FP5 D;  3WWV A;  3NBH A;  4JPB W;  5JJI A;  1J9O A;  3E5S A;  4TKO B;  4WOR A;  5EPJ A;  2D0P A;  3T51 B;  2P5Z X;  3WDN A;  5IYC G;  4FVM A;  4AQY Q;  2AWN A;  4R4O A;  3ULJ A;  3PUV A;  3HKS A;  5M3F G;  2JEA I;  4EQP A;  4B3M L;  3S14 H;  5IWA Q;  1KRT A;  3PO2 B;  5T1I A;  3A55 A;  1Y1W H;  5KEE A;  3PV0 A;  3G6E A;  2D0O A;  2HDM A;  2GVB A;  4A3B G;  3ULL A;  3S2H H;  5LMN W;  2A6E C;  4A93 B;  4OX9 Q;  4H0L C;  2L9H A;  2V4D A;  1K8G A;  3HG9 A;  2RSN A;  1I4Q A;  3J80 c;  2Q2I A;  3GQB A;  4GLV B;  4HCS A;  3GTG H;  4DV4 L;  3PO2 H;  1GKH A;  2EY5 A;  4XQQ A;  4GZY C;  2NVQ B;  3K5M A;  1HZC A;  2K5N A;  2OEO A;  1QCB D;  2WAQ B;  1KAW A;  1R9T H;  3QIA A;  5CV6 A;  3W1B A;  1LV9 A;  3F1Z A;  3LGJ A;  1JJC B;  1NBW A;  1H9R A;  1VQC A;  4A3F B;  3RN2 A;  2E74 C;  1AP0 A;  1UEA B;  1RDP D;  3DLL A;  3HOZ B;  4RWS C;  4BBR G;  1EY0 A;  2KVM A;  4AYB G;  1FJG L;  4P75 A;  1I3Q H;  4EGV A;  3SXH A;  2UUA L;  4DR2 Q;  3QR8 A;  1HNZ Q;  4N9P A;  4C1N I;  2MUY A;  2HQE A;  1ICW A;  4UY8 C;  1JB3 A;  3E3X A;  4GN5 A;  5D3I B;  2VQF Q;  3K0Y A;  4IPH A;  1VF7 A;  2NVX B;  1HXY D;  1PRT C;  3K57 A;  4CJ2 C;  3VYT A;  5C4X H;  4X3S A;  1VQI A;  5EBD A;  3I91 A;  1EIY B;  4LFC Q;  4JOI C;  2ZTC A;  3PO3 G;  4BXX G;  1UAP A;  3NTI A;  2JA6 H;  3KFU A;  3FPP A;  2GN5 A;  4B3R Q;  4C2M B;  4YHH L;  3D4D A;  1EU3 A;  2NWG A;  4G7Z C;  1VQP A;  3MFG A;  2BA0 A;  1QZH A;  3NTK A;  4DUY L;  1XNQ Q;  2K5D A;  4R8N A;  4Y7N H;  3KDF B;  2VQE L;  4GOP C;  2AQ2 B;  2JEB I;  1TVX A;  2WAC A;  3CRK C;  1TII D;  3H09 A;  4DV7 Q;  4DR6 L;  1N34 Q;  1HTL D;  1VQJ A;  1FYC A;  1N9W A;  1YI2 A;  2DY8 A;  1V1O A;  1XMO Q;  1AFP A;  2L0C A;  1HPC A;  4CJ0 B;  1LLR D;  3RZD B;  3MXG A;  3WOF A;  1SEB D;  3H6M A;  1PV4 A;  1RTN A;  1EIF A;  4C3H B;  1DXM A;  5CBE E;  4IJH A;  4K5V A;  5DM7 3;  1EYD A;  3Q24 A;  5C0X H;  1F2M A;  1Y69 U;  5J39 A;  3NQI A;  4X65 Q;  2IW3 A;  3NHH A;  5KIX A;  1PA6 A;  3LX0 A;  4ZAI A;  4JI4 Q;  2UXC Q;  1E2Z A;  3A8K E;  3SK5 A;  3K5O A;  1CFM A;  3OWF A;  1CKO A;  2R6G A;  1B9M A;  1LAB A;  1MHW C;  5COY A;  1NE3 A;  3CC2 A;  3F2B A;  2JA5 G;  1JIC A;  2UXD Q;  3P1H A;  1YZ6 A;  4LW1 A;  4HJ7 A;  5EKI A;  3NP8 A;  2DNC A;  2K5W A;  4DXF A;  4IO9 A;  2RF4 A;  1ICF B;  1Z9F A;  2K33 A;  4DV1 Q;  4YCU A;  5M9O A;  2HDL A;  2CQO A;  2PZU A;  5FLX L;  3BVM A;  3J7A V;  4KLK A;  4YY3 L;  1EEI D;  4BY7 B;  1ZKO A;  2C9O A;  5IT9 c;  1CZW A;  1I6V C;  2F4V Q;  1V8Q A;  4C3H H;  4JI7 Q;  4X62 L;  3K8A A;  3ERQ A;  3KDF A;  5IYB G;  2Z0S A;  4A3J B;  4DAM A;  5IOC A;  4FXD A;  2CKZ B;  3GTJ B;  2ZTD A;  4C56 C;  3E9I A;  1BCP F;  4CKC A;  4BA2 I;  4NW2 A;  1VQL A;  2ZXR A;  1DYQ A;  2K5V A;  2XNA C;  2UXB L;  4A3J H;  4F87 A;  1J6Q A;  1WTX A;  1JB7 A;  2PZT A;  2G9H D;  3TS0 A;  2RHQ B;  1K0S A;  4LFB Q;  4B08 A;  1PTO C;  4S3S A;  4KHZ A;  1WTO A;  1FD7 D;  4AYB B;  4DU9 A;  2XRS D;  3E6Z X;  4C3J B;  1G6P A;  3FMC A;  1VQ8 A;  2IJ0 A;  3HOX G;  2EXZ A;  3CME A;  1XTC D;  1TS5 A;  4C2M H;  2D5D A;  1Q1E A;  4JW0 A;  1Y14 B;  2PMZ E;  1OO9 B;  2Y0S G;  3HOU G;  4JI1 Q;  3TME A;  3E9H A;  4BY1 G;  3I56 A;  3BZK A;  1AW7 A;  4LF6 L;  4PG3 A;  1VQ6 A;  1H9S A;  3PIP 3;  4DAY A;  1KXL A;  4A3K H;  4HIO A;  3EFX D;  1STB A;  3V96 A;  1STA A;  1SYB A;  4MZ9 A;  4LF4 L;  3AEV A;  3AFQ A;  1A3T A;  1DM0 B;  3RD4 A;  1JMC A;  1WD0 A;  2R7F A;  1LTT D;  4LF7 Q;  1GOZ A;  1X9N A;  4MTK A;  3TBI B;  1XJV A;  5I4D A;  1B7Y B;  5C4J H;  5C44 G;  1KTK A;  2VB3 X;  4GN3 B;  3A5Z B;  1TWH B;  1YNJ D;  4DV6 Q;  4B9X A;  2XWJ B;  1CTM A;  4ME3 A;  2NZH A;  1D8L A;  1HRJ A;  3M7G A;  2SNS A;  4KY6 A;  4LJZ C;  3ITP A;  1L0W A;  1AH9 A;  1UUP A;  4NDX A;  4LFB L;  4TSS A;  3FRP B;  1Q3L A;  2Z9H A;  3HOW B;  2RSO A;  2JA6 B;  2IX0 A;  3TRE A;  3HKZ G;  2JA5 B;  2NVY H;  2ATW A;  4GKJ L;  1Y8P B;  1NTG A;  4A3M H;  2NVX H;  5JJK A;  3W2D A;  5CV5 A;  1B50 A;  2LMC B;  4OIJ A;  1QUQ B;  2O4X A;  4WJ3 M;  4HJ5 A;  1JC7 A;  4LF6 Q;  5I2X A;  3T1H L;  3HOW G;  1EWH A;  4FNF A;  3RMH A;  3W1G A;  4JI5 L;  3OHX C;  3OW2 A;  3GTQ B;  1GUS A;  3HKZ B;  4IUU A;  4DK6 C;  3CPW A;  2K05 A;  3IFD A;  1QWY A;  3JAM L;  4L5S A;  1HFG A;  1WTQ A;  2R7Z H;  4G7H C;  1EQQ A;  3AU7 A;  3VA7 A;  3UE1 A;  3FKI B;  2KED A;  4ALP A;  2EYP A;  4DN4 M;  1K83 H;  4DAP A;  1EY6 A;  1TS3 A;  3G6J B;  3K80 C;  2B2W A;  4H44 C;  1HR0 Q;  1L0X B;  3ND8 A;  2JSO A;  1MSG A;  5IT9 E;  2BDN A;  2JN4 A;  5EKK A;  1RF2 D;  4O42 A;  4A93 H;  1V1Q A;  1D7Q A;  1SAP A;  2FHT A;  1IYJ B;  3I4O A;  4JI3 Q;  4JI8 Q;  3S16 B;  2EQS A;  4L6T B;  4ZUI A;  4DR4 L;  1EFI D;  1SNO A;  3RR5 A;  4HMJ A;  3MEF A;  2RQX A;  4DV7 L;  4P74 A;  4BWG B;  3J81 i;  1A3V A;  1PZJ D;  1S5F D;  3BDL A;  1A2T A;  4JG2 A;  5C3E G;  3M4Y A;  3ERO A;  1CSP A;  5M5W B;  1OXS C;  2CCZ A;  2KEE A;  4LNQ A;  1NR2 A;  4ZQ3 A;  1PRT B;  5IT9 L;  1WVL A;  1XYI A;  4A3I B;  1B2T A;  1I4P A;  4FDB A;  3KYH C;  3R2I A;  1IXR A;  5IGB A;  1ZYR C;  1LM0 A;  4JI0 L;  1N8R C;  3H91 A;  2H1E A;  2B8G A;  1D1I A;  4NXN L;  1EY7 A;  1KIX A;  1TWF H;  2EJF C;  3PUX A;  2NN6 G;  2F0D A;  3OOC A;  2I46 A;  1A3U A;  1TWC H;  3U9O A;  3VR6 A;  4GKK L;  1K3R A;  1JE4 A;  3SR1 A;  1WCM G;  3R93 A;  5C3X A;  4DV0 Q;  1Q8K A;  2VZA A;  2OTL A;  2A6H C;  4A3L H;  2HQL A;  1ENC A;  3JAM i;  4N8X 1;  2WII B;  1E22 A;  1V43 A;  1YNX A;  3IL8 A;  3S1N H;  4JOI A;  3KBG A;  1SMX A;  2RA4 A;  3MXU A;  1O7L A;  1YJN A;  1BO0 A;  1R4P B;  4DV5 L;  1KHI A;  4OO1 G;  3L0O A;  4IFD H;  4OWX B;  2IWH A;  5M3M B;  1F77 A;  1CHP D;  5I6Y A;  3I4M H;  1EQR A;  4B3S Q;  3UDG A;  5C6A A;  3PIO 3;  1WTR A;  4K6D A;  4LAA A;  3CCL A;  2NVY B;  3BDO A;  2N3S A;  1HQM C;  4PZ7 A;  4JI7 L;  1F2Y A;  1WI5 A;  5GAD C;  1GO3 E;  1KC8 C;  1S3O A;  1TWA B;  3K6O A;  2HIX A;  2ZT9 C;  1RD9 D;  2ENB A;  4C3J H;  4R4T A;  4PZ6 A;  4DV2 L;  1ESR A;  1CKN A;  1M1K C;  1EYG A;  4DNT B;  5GRO A;  3K0X A;  2NTS A;  3HEJ A;  2B2Y A;  2RDH A;  2HIV A;  2N78 A;  4A3D G;  3H3V C;  3GV6 A;  4X3K A;  3GTL H;  3NXW A;  3H0G B;  4GKJ Q;  2B63 B;  3BU2 A;  3CW2 C;  1Z6H A;  3S1Q B;  4E6I A;  5JVG 3;  1K3B C;  4K6L A;  3R3O A;  1OXU A;  4JI1 L;  1SE8 A;  2EZV A;  4XT3 B;  5IOD A;  4A3J G;  4RG1 A;  3AFP A;  2KQ3 A;  1EIG A;  3BDC A;  4JI5 Q;  2PI2 A;  3QO2 A;  3M4O H;  5C44 B;  1SYG A;  4ZK9 B;  4GNX B;  2A1A A;  3CC7 A;  2Q2T A;  2N88 A;  5IP7 G;  3AMU A;  3H15 A;  2E5L Q;  5BR8 Q;  4DV5 Q;  1PH5 A;  2EYH A;  1N32 L;  5AJ3 L;  1LUZ A;  3CCR A;  1W6J A;  3KJP A;  3A5U A;  1PH3 A;  3GDE A;  2FJ2 A;  1BBU A;  5J3B A;  4JV5 L;  1FNV A;  4FF3 A;  1IL8 A;  3F8T A;  1YNN D;  5ELE A;  3HOV G;  4WRD A;  2LSS A;  1DGS A;  5K36 G;  4IN3 A;  1N33 L;  3H0G H;  2BH2 A;  1ENA A;  2QDB A;  4JBJ A;  4A3G G;  3OW7 A;  2XWB B;  1B9N A;  1SND A;  3ER0 A;  1FGU A;  1D2B A;  1E2W A;  2JQO A;  1WJJ A;  2CWP A;  4TQU S;  1F9Q A;  1TQO A;  3KLS A;  4A3F G;  1IBL Q;  1BKB A;  1M8A A;  5JAV A;  5IGF A;  3G71 A;  5IY0 A;  3A8I E;  1KL9 A;  2RHS B;  4EVO A;  3MA2 B;  5CYU A;  4DFA A;  2NVT H;  1KD1 C;  1MBY A;  2XN9 C;  1HJP A;  1NMG A;  3EN2 A;  1ET6 A;  2MO1 A;  4P71 A;  5C5M A;  3C3L A;  2B2U A;  2H5X A;  2UUB Q;  1HUN A;  1JOK A;  1HA5 A;  3M3Y B;  1X65 A;  3QG1 A;  2SOB A;  2AWO A;  2X6L A;  5CC4 A;  3V2T A;  4R9W A;  4PMB A;  4JI3 L;  1U4P A;  4FXG C;  1EY8 A;  5C4X B;  1YVC A;  4QCL A;  1D6E C;  1H9M A;  5DEH A;  1K8O A;  3D8G A;  2L4N A;  2I5H A;  2I5L X;  5T1G A;  4DR2 L;  2N8N A;  2JA7 G;  5I2Y A;  2XVS A;  4IPC A;  4CDE C;  2B2Y C;  4C3I G;  5JEA H;  1I3Q B;  5IP9 G;  1N33 Q;  1P16 A;  2EYM A;  3TP8 A;  2Z1C A;  2X69 A;  1Q46 A;  1HNX Q;  1B70 B;  4Y7N B;  2B63 H;  1VQA A;  2WP8 J;  1U4M A;  4LF8 Q;  1A8V A;  1OXV A;  1HR0 W;  2F0U A;  2IHE A;  3HZX A;  1C4Q A;  4NXM Q;  1GXD C;  5KND A;  1S4Z A;  1G29 1;  2KOL A;  3HKZ E;  1SRO A;  4OIK A;  2NVQ H;  4A76 A;  2ZM6 Q;  1G8Z D;  1O78 A;  5CV8 A;  1X3P A;  2ICI A;  5JPM C;  4Q5V A;  4A3C H;  3M9B A;  4BBS H;  1X54 A;  4PMW A;  2NZO A;  1B4O A;  5CV4 A;  4QJF A;  3TRZ A;  1KRS A;  3CQZ B;  1EYC A;  3VYS A;  4Q0F A;  2VW9 A;  4R8I A;  3NEM A;  3NEN A;  1C8C A;  3TEH B;  4OL7 A;  1SFO B;  4GLX A;  5FO8 B;  3PCO B;  5C4H A;  4A3E H;  2KHI A;  5FOB B;  4CHT B;  4L5Q A;  2VUM G;  4KK7 A;  2EPB A;  1MIU A;  1HUM A;  2PCF B;  2B39 A;  4DR3 L;  1JT8 A;  1SYE A;  3M4P A;  1XTD A;  5LHY 1;  1RTO A;  1XPU A;  3VA5 A;  2R93 G;  4B3S L;  4KI0 A;  3EJI A;  3KLW A;  1XMQ L;  3L2P A;  1B1Z A;  3S1N B;  3J81 j;  5DLQ E;  1Q90 A;  3EBE A;  3F2D A;  1YNJ C;  1S72 A;  1VQ9 A;  4BY7 G;  5FLM G;  3PO3 B;  1XXG A;  1ZEQ X;  2A69 C;  4DR5 L;  1TXY A;  3QJY A;  4BA1 I;  4UP8 A;  4JI2 Q;  2E2J B;  2A74 C;  3GTM H;  2R92 H;  2F0W A;  1G2S A;  1RL2 A;  3RUZ A;  2KUM A;  3J80 L;  2EY1 A;  1BR9 A;  4X66 L;  3MZ5 A;  1L0Y B;  5G3L D;  2E2I B;  2EYL A;  3BVG A;  4QIW E;  5ELF A;  3OTO Q;  3J7A 5;  3NPP A;  1P8L A;  1TU2 B;  2Q8T A;  3J81 L;  4DF7 A;  4A3M B;  2VQF L;  2B2V A;  5M5W H;  5LMN Q;  4AQY L;  4BBR B;  1K8A C;  5M5Y B;  3KOJ A;  5NUC A;  4NB3 A;  4ZRZ A;  4QGU A;  2LY7 A;  2YU9 H;  4FXK C;  1B3A A;  1PTO B;  4JI0 Q;  5IGE A;  3FDT A;  2F0Q A;  2LS0 1;  2FMC A;  5C5L A;  1II3 A;  3HOX B;  2AUK A;  4L5T A;  5CV9 A;  5KYI A;  4LF5 Q;  4ID6 A;  2A68 D;  4ZKC B;  3I3C A;  4POF A;  2Y0S B;  5FO9 B;  3HOU B;  4KHP L;  1WCM B;  3MXN B;  1YNN C;  1SRU A;  3UDX A;  1VQK A;  1DON A;  1STH A;  2ZJQ A;  2SDF A;  3FKI H;  2WAQ G;  5C4J B;  4HIM A;  3VR4 A;  2K04 A;  1EZ6 A;  1QIL A;  3MHB A;  3STB C;  3CAM A;  1A2U A;  1J8I A;  5F2D A;  2F0L A;  1F9S A;  1FNU A;  4IAL A;  4NXM L;  1IKL A;  1BF4 A;  5IYD G;  2JA8 H;  3HOY H;  3GTP B;  1G2T A;  3PIP A;  1VQM A;  1Y1V G;  1H9K A;  5IWA L;  1ZXT A;  1QUQ A;  3I4N H;  1BVS A;  4ZKB B;  3J7Z C;  5J1Z A;  4V0B A;  1CQV A;  4JBM A;  4IPD A;  3T1Y Q;  1CKM A;  1SFO H;  1ROD A;  3T13 A;  1B53 A;  2RVL A;  3D6W A;  5A2Q L;  1Q7Y C;  4ILW A;  2F03 A;  4DV4 Q;  3BYY B;  4OEM B;  5DNF A;  4DR3 Q;  5M5X B;  5M5Y H;  4BBS B;  1BBX C;  2UXD L;  1F2Z A;  2KCN A;  2RKS A;  4YWK A;  1ESF A;  1ASZ A;  3WOE A;  2K4K A;  3S1R H;  4JV5 Q;  2YV5 A;  2KEC A;  4FF4 A;  1PXU A;  4Z9C B;  1LTI D;  3BJU A;  5CV7 A;  2Z4I A;  3OMC A;  3E0E A;  5IYC H;  1E3P A;  3UDI A;  2H4O A;  1PRT F;  2QW7 A;  2KHS A;  3URY A;  5DM6 3;  3J81 c;  2Z6B A;  3A54 A;  1ET9 A;  1Q8I A;  1STG A;  2WKC A;  3RN5 A;  1Y8N B;  4DR6 Q;  4X66 Q;  1CUK A;  1HZA A;  3C46 A;  3IFT A;  1QZG A;  1XNR Q;  1Y1W G;  4A4I A;  2DY7 A;  1UE7 A;  4OEL B;  4XXE A;  5FK9 C;  2DJG C;  4OHJ A;  4O2D A;  2OCE A;  2PW7 A;  2RDF A;  3NWT A;  4UAI A;  2E75 C;  5AFW A;  5GAH C;  2VQE Q;  1PRT D;  3D31 A;  1WFQ A;  3RLF A;  4LFC L;  1RJT A;  3LWE A;  4YWL A;  4AYB E;  4GOP A;  1B3Q A;  1I4R A;  2VS1 A;  4L5R C;  2A8V A;  3PO2 G;  4M1U B;  2WV6 D;  4MTN A;  1N36 Q;  1NUC A;  3ICE A;  1QVG A;  1HA6 A;  1A0I A;  3EVQ A;  5EKL A;  4ULL A;  1IBL L;  4PNY A;  5ELN A;  4DR7 Q;  5C0X I;  1FVI A;  2JE6 I;  3OYY A;  1PH9 A;  3KF6 A;  2PQA B;  4JC0 A;  5I9O A;  1KDB A;  1DOM A;  3GTO H;  4KKT A;  4RKB A;  4L8J A;  4KN7 C;  5G3L F;  1QVF A;  5EPK A;  4RCO A;  1AZQ A;  2Z8L A;  3I8Z A;  4LF9 Q;  1EUJ A;  4I7Z C;  3LWU A;  1MSH A;  2VUM B;  2NVT B;  1XX8 A;  1JOQ A;  2D62 A;  4HSP A;  1JJG A;  3I4L A;  1LO5 D;  3KLS X;  5JEA J;  4DK0 A;  4KKS A;  4R4Q A;  1UE6 A;  3G48 A;  2XIW A;  4N9T A;  4IQZ A;  3PIO A;  3QOJ A;  2B2V C;  3Q6S A;  1K9M C;  4LF7 L;  4B3T L;  5C4X G;  3SK8 A;  2CFM A;  3KUP A;  2DN8 A;  4RFB A;  1VF5 C;  3HOZ G;  1VQ7 A;  5I6W A;  1WTW A;  4NPS A;  4L63 B;  2JA6 G;  3FVQ A;  1Q12 A;  3DWQ A;  4IUR A;  5K5P A;  2B2W C;  3A56 A;  1GUW A;  4H02 A;  4MIU A;  1W3S A;  3U9S A;  5M3M H;  1PFS A;  2K52 A;  2O5I C;  3SK4 A;  2F3V A;  1HNW Q;  1JQY D;  2FMM A;  2VXW A;  5JJL A;  2Y0S E;  1U4L A;  1VQB A;  4HJ9 A;  5D65 A;  4P73 A;  2PZW A;  4GOP B;  4U68 A;  1BUV T;  5C0X J;  3HGB A;  2K14 A;  2XRQ D;  2Q8I B;  1VMP A;  2M9V A;  3I70 A;  2F4V L;  1ONL A;  2F52 A;  4I7A A;  5IIF A;  1TWC B;  3KJO A;  2PI2 E;  1DD2 A;  1X6O A;  1RCV D;  4XQN A;  5HGQ A;  4RAU C;  4OWW B;  4GKK Q;  3IRB A;  1IHZ A;  4KV6 A;  5FJ8 H;  5IGG A;  5EJW A;  2F0O A;  2CW0 D;  2K1B A;  1XMQ Q;  2WB1 E;  1PH6 A;  1NMF A;  2MJ8 A;  3I90 A;  2A19 A;  5CMD A;  2CH4 W;  4PQX A;  4QB4 A;  3FP9 A;  1B44 D;  1LT6 D;  4QUC A;  3U58 A;  4MNO A;  4DK1 A;  3VR2 A;  3AQQ A;  1BOS A;  3EA6 A;  1N34 L;  3OIQ A;  2LXJ A;  1YIJ A;  4JI2 L;  2MHV A;  4A3I G;  3RZO H;  4DXG A;  2VY3 A;  3GTG B;  3PMF A;  1E1O A;  1T5E A;  2Q2U A;  4GNX C;  3K59 A;  1LT5 D;  3AB9 A;  3PUZ A;  1S5C D;  4MHE A;  1UWV A;  3U4Z A;  1X3F A;  1LTG D;  1QE6 A;  1CQF A;  1QB5 D;  2E2D C;  2R93 B;  5M3F H;  1G51 A;  4GNX A;  4G4K A;  4QQB X;  2FXQ A;  3M4Q A;  1IYU A;  2MP1 A;  1O80 A;  1SNQ A;  2F0J A;  3S9W A;  1U9R A;  5IYB H;  2PNH A;  3PUW A;  4G57 A;  3I55 A;  1SNP A;  1UE5 A;  3A74 A;  1UEB A;  3X3N A;  1NSN S;  4A3B H;  4HCE A;  5KNB A;  1Q1B A;  1I6H H;  1YHB A;  3ZJY C;  3NTH A;  3G7L A;  2OF1 A;  2JA9 A;  5GAG C;  4P72 A;  1E7Z A;  1OXT A; 
#chains in the Genus database with same CATH homology
 2PQE A;  1FR3 A;  3SHL A;  1KAA A;  3N6R A;  1WTV A;  3MC0 B;  1ENF A;  4KY7 A;  3SE0 A;  2L55 A;  3C2P A;  2WKD A;  2K32 A;  3GTL B;  3OSO A;  3S17 B;  2B2T C;  4B9W A;  1JOO A;  5JVH 3;  3HOV B;  2QF7 A;  3HP3 A;  2BOS A;  5BN3 A;  1IYV A;  2YU9 B;  2CVR A;  2A6H D;  3GP7 A;  3OIP A;  2HCC A;  2F3W A;  1PDQ A;  2HUG A;  3K5L A;  3CHB D;  1SNC A;  3D6C A;  4C1N K;  1E0B A;  2A6E D;  3SEB A;  4OO1 I;  1F9R A;  2EDG A;  3MXP A;  1BCP D;  1SE3 A;  1STY A;  1Y1V B;  2BE5 C;  4BY1 B;  2HCI A;  2MPM A;  3SDZ A;  1O7Z A;  4XYQ A;  1TY2 A;  4IUQ A;  4KN4 C;  1A6X A;  5LL6 S;  2A73 B;  4BS9 A;  4IUP A;  3GTM B;  2I07 B;  4XYO A;  5EPL A;  2JA8 B;  2B2U C;  3T4A C;  2BA1 A;  4RHS A;  1HHV A;  1CA6 A;  2OXP A;  5FKA C;  5JPN C;  1PFM A;  3MTS A;  3X3M A;  2K6A A;  4X3U A;  1STN A;  1PZK D;  2QIL A;  1JWS D;  2MGS A;  1PMR A;  3KLR A;  5C0X G;  5D3D A;  5KGU A;  3HRZ C;  1SYD A;  2NN6 I;  1XWE A;  3NBI A;  4RGN A;  4RHR A;  2F0I A;  1F2L A;  3SK6 A;  1U4R A;  3MFY A;  4P2C B;  1I50 B;  4LMQ D;  1MI2 A;  4KD3 A;  5LL6 X;  3S1M B;  5C3E B;  1NR4 A;  4QIW B;  1ZYR D;  3VR3 A;  3NUC A;  2EOT A;  4KMU C;  1K83 B;  1D5X C;  4C3H G;  4WFN 3;  1SSO A;  2NBF A;  3DMU A;  4IUT A;  2TMP A;  5FLX E;  4NKL A;  4CKE A;  2R7Z B;  5IGD A;  4IFD I;  4EQN A;  1EL0 A;  1VMC A;  2F0H A;  3CU7 A;  3ND9 A;  2E76 C;  4KKU A;  1GUN A;  3M85 A;  2IT1 A;  5D14 A;  5ISR A;  1GJX A;  5M3F B;  4IUN A;  4ZLT F;  1CA5 A;  2D2C C;  4RH6 A;  2JYO A;  3DHQ A;  4HTH A;  4NMZ A;  3RZO B;  2X6G A;  1NCV A;  1MGS A;  2EYF A;  1DOL A;  1S5E D;  1BCP B;  4EQO A;  2F0N A;  3Q0A A;  4C3I B;  2NN6 H;  1DOK A;  3KF8 A;  2PMZ B;  1LTB D;  4A3D B;  3IAY A;  3BYT B;  3QOL A;  5ELD A;  3CKI B;  3VYR A;  1TKW B;  3DM1 A;  1PTO D;  2J0T D;  1EQV A;  1H9J A;  3IKJ A;  3OMG A;  5A35 A;  4OO1 H;  1IW7 D;  3TP5 A;  4IFD G;  1QNU A;  2R61 A;  1D5Z C;  4RA8 A;  3TP6 A;  4RCN A;  1H9S B;  2DNE A;  3C1F A;  2EY2 A;  2M00 A;  2NYZ D;  4RGM A;  4J8Q A;  4HMI A;  3GO5 A;  4H13 C;  1LTA D;  2F0P A;  3DWA A;  2L5T A;  2EE1 A;  5E3F A;  4RGO S;  1ML0 D;  2RDG A;  1KNA A;  2VNU D;  5ELC A;  3TN2 A;  3FEW X;  1UNS A;  1I4X A;  2SEB D;  2ICE C;  4IZ8 A;  3MVV A;  4X3T A;  1DJR D;  1NAP A;  1TT2 A;  1GHK A;  2A69 D;  2O2L D;  3K5N A;  1JR0 D;  3S1R B;  1SJH D;  1Z47 A;  3CRL C;  3I73 A;  3E0J A;  5CBA E;  2F0E A;  1QOH A;  3MXN A;  1TS2 A;  2WB1 B;  5FO7 B;  2IX1 A;  4YIJ A;  5HUR A;  2CHB D;  3GV3 A;  3W3A A;  4PMC A;  3NQT A;  2IL8 A;  4HSV A;  5KNC A;  3FPU B;  3S2H B;  3BS1 A;  1G91 A;  2L11 A;  2F1M A;  1BCP C;  5CR3 A;  4XQJ A;  1DCZ A;  3M4O B;  3TZD A;  5K36 H;  1PLF A;  4KHV A;  2A68 C;  4O1N A;  3F2U A;  5EGT A;  4U67 3;  1LT4 D;  2K5Q A;  2NUC A;  5BN5 A;  2Z4H A;  4A3G B;  1PZI D;  3PUY A;  1BNZ A;  1AN8 A;  3D3R A;  3NWS A;  4JK1 C;  2GA4 B;  1KAB A;  4DNR B;  2K03 A;  1SYF A;  1JWU D;  2K28 A;  4G7O C;  3K58 A;  4RKL A;  1TS4 A;  3BZD B;  3DXJ C;  1EYA A;  2EJM A;  1FGB D;  2FIN B;  5JOB A;  1R4Q B;  1PTO H;  2B2T A;  2LKV A;  1CK1 A;  4V19 0;  3JAM E;  2J4X A;  4FO2 A;  1C48 A;  5ELB A;  2ZXO A;  3I4M B;  4HN7 A;  2F4I A;  4K5X A;  3MAQ A;  2L12 A;  2YYZ A;  1WD1 A;  4DA2 A;  1JCK B;  1ILP A;  3V05 A;  5JJZ A;  3EQL C;  2F0F A;  5E4W C;  2ID0 A;  1SNM A;  3KBX A;  1BDO A;  4KJN A;  3ONA B;  2G9D A;  3TZU A;  2F0K A;  2F0S A;  2IPK D;  2N55 A;  2CW0 C;  5HGT A;  2R92 B;  4CKB A;  1TR5 A;  4C3J G;  1PTO F;  5EBC A;  1LT3 D;  4K2L A;  1QG7 A;  2PPB C;  4XTC S;  1R9T B;  1Z7T A;  2EJG C;  2BDO A;  5DAU A;  1PFB A;  4JBW A;  2QEJ C;  3MWY W;  4HR7 B;  4NP5 A;  3TP7 A;  1EWC A;  2OT2 A;  2L1B A;  3NE5 B;  2TSS A;  2QCP X;  3A7A B;  4HAE A;  1V1P B;  4QF4 A;  1SMY C;  3P20 A;  2F0M A;  1EY9 A;  2BE5 D;  2JP1 A;  3OWE B;  1SBB B;  2C5C A;  2PNR C;  2EY6 A;  5BN4 A;  2AQ1 B;  3MEH A;  4MN3 A;  5KYL A;  3SVM A;  2WIN B;  1ILQ A;  1TY0 A;  3C1E A;  4H7B A;  1X3Q A;  1Y1W B;  1KLG D;  2BCO A;  2F0T A;  1SXT A;  2J7Z A;  1KNE A;  5A2Q E;  4XIG S;  1RHP A;  1RKN A;  2SNM A;  4FF2 A;  3J81 E;  1KLU D;  2KA7 A;  2F0G A;  1I6H B;  2NZ1 D;  1GUG A;  3K7A B;  4A3B B;  4K2K A;  2FFK B;  4A3K B;  3P75 A;  1CHQ D;  3OPO A;  3NK9 A;  1CT1 D;  2KJX A;  4TRD A;  1X32 A;  1W6K A;  3L9A X;  4QUF A;  3TDQ A;  4A3E B;  1BXT A;  2QKI C;  5KRU A;  1WTP A;  1EQT A;  1QJO A;  4CGY B;  3H94 A;  5E1F A;  2K7V A;  2JXM B;  5EQ0 A;  3M7N A;  4DAV A;  3S15 B;  4KTA A;  2AUJ D;  3DEO A;  3KK7 A;  2A5H A;  3L7Z C;  1GUT A;  3T16 A;  1V1P A;  1PYW D;  1TWG B;  1FNW A;  1HQR D;  4ODG A;  3ZYY X;  4ZYS A;  4XT1 B;  4K5W A;  1GUO A;  4ME5 A;  1EY5 A;  3GTK B;  2PW5 A;  3NSW A;  1AEX A;  3VYU A;  1LTR D;  3HS0 C;  5IGC A;  4FYD A;  4KY5 A;  3UI2 A;  3R8B A;  3DWP A;  2EYO A;  1CI3 M;  5JEA G;  2NB0 A;  1SDF A;  4K14 A;  2E2H B;  4UDU C;  1KDC A;  4K8I A;  2IX3 A;  1K8M A;  2ZXP A;  1S5D D;  2B8F A;  2PYK A;  4I65 A;  1EOT A;  3N52 A;  3S2D B;  3VR5 A;  2XSC A;  4IFD J;  3DEP A;  3I72 A;  4IUV A;  5TSS A;  1O7Y A;  4F8M A;  2JA7 B;  5C4Z A;  2NTT A;  1KDA A;  4DGZ A;  1GHJ A;  3A7L A;  1G6Z A;  1I4H A;  2LFN A;  4XDX A;  1VDZ A;  3J7Y W;  1LTS D;  2Q8R E;  4CBV A;  4PV1 C;  1LAC A;  1HTP A;  1IW7 C;  4CJ1 B;  3BG3 A;  2PO4 A;  3TSS A;  5I9P A;  1M4V A;  2KCC A;  4KD4 A;  4QMG A;  1SE4 A;  3J7A F;  3T53 B;  4OGQ C;  4KJO A;  1Y8O B;  4M8A A;  1JOR A;  1I4G A;  1QNK A;  1T5X D;  2F0V A;  1D5M C;  3GTO B;  1F9P A;  1EEF D;  4HED A;  4K8J A;  1STE A;  4F88 A;  1AZP A;  1E2V A;  3L3O C;  1HCZ A;  4J1M A;  2M2L A;  3Q22 A;  3O13 A;  4LK1 C;  1SYC A;  2EVB A;  4J6H A;  1VCI A;  1MD2 D;  1EY4 A;  1S5B D;  3Q23 A;  2RBM A;  5C3W A;  3HOY B;  4ABN A;  1HFN A;  1EZ8 A;  1D1K A;  3DUZ A;  1EIH A;  1BQQ T;  1CZG A;  3BVZ A;  3T56 B;  5COR A;  2AQ3 B;  3GD7 A;  2R3Z A;  5J22 A;  4FF1 A;  4F7X A;  2CQA A;  1OXX K;  4WJW A;  3P7J A;  3A8J E;  4RGT A;  1PFN A;  2K01 A;  1JWM D;  1SMY D;  2VB2 X;  2O5J C;  3D4W A;  5E4X A;  3D4R A;  1DZ1 A;  3LNN A;  3QB3 A;  3S14 B;  1SJE D;  1A15 A;  2EYJ A;  2D9U A;  1TWF B;  1CM9 A;  3I4N B;  5CGK A;  3QWN A;  1EU4 A;  4ZUJ A;  3J80 E;  1IKM A;  1SE2 A;  3R2T A;  4FP5 D;  3NBH A;  1J9O A;  3E5S A;  4TKO B;  4WOR A;  5EPJ A;  3T51 B;  3WDN A;  4FVM A;  2AWN A;  3PUV A;  2JEA I;  4EQP A;  3PO2 B;  5T1I A;  3A55 A;  5KEE A;  3PV0 A;  2HDM A;  2A6E C;  4A93 B;  4H0L C;  2L9H A;  2V4D A;  3HG9 A;  2RSN A;  1I4Q A;  3GQB A;  4HCS A;  2EY5 A;  4XQQ A;  4GZY C;  2NVQ B;  3K5M A;  2OEO A;  1QCB D;  2WAQ B;  3QIA A;  5CV6 A;  1LV9 A;  4A3F B;  1H9R A;  2E74 C;  1AP0 A;  1UEA B;  1RDP D;  3HOZ B;  4RWS C;  1EY0 A;  2KVM A;  4EGV A;  3SXH A;  4N9P A;  4C1N I;  2MUY A;  2HQE A;  1ICW A;  1JB3 A;  5D3I B;  3K0Y A;  2NVX B;  1VF7 A;  1HXY D;  1PRT C;  3K57 A;  4CJ2 C;  3VYT A;  4X3S A;  5EBD A;  3I91 A;  1UAP A;  3NTI A;  3FPP A;  4C2M B;  3D4D A;  1EU3 A;  2NWG A;  4G7Z C;  3MFG A;  2BA0 A;  3NTK A;  2K5D A;  4R8N A;  2AQ2 B;  2JEB I;  1TVX A;  2WAC A;  3CRK C;  1TII D;  3H09 A;  1HTL D;  1FYC A;  2DY8 A;  1V1O A;  1AFP A;  2L0C A;  1HPC A;  4CJ0 B;  1LLR D;  3RZD B;  3MXG A;  3WOF A;  1SEB D;  3H6M A;  1RTN A;  4C3H B;  1DXM A;  5CBE E;  4K5V A;  5DM7 3;  1EYD A;  3Q24 A;  5C0X H;  1F2M A;  1Y69 U;  5J39 A;  3NQI A;  2IW3 A;  3NHH A;  5KIX A;  3LX0 A;  4ZAI A;  1E2Z A;  3A8K E;  3SK5 A;  3K5O A;  1CFM A;  3OWF A;  2R6G A;  1B9M A;  1LAB A;  5COY A;  1JIC A;  3P1H A;  5EKI A;  3NP8 A;  2DNC A;  2K5W A;  4DXF A;  2K33 A;  5M9O A;  2HDL A;  2PZU A;  5FLX L;  3BVM A;  3J7A V;  1EEI D;  4BY7 B;  1ZKO A;  2C9O A;  1CZW A;  1I6V C;  1V8Q A;  3ERQ A;  4A3J B;  5IOC A;  4FXD A;  3GTJ B;  4C56 C;  1BCP F;  4CKC A;  4BA2 I;  4NW2 A;  2ZXR A;  1DYQ A;  2XNA C;  4F87 A;  1WTX A;  2PZT A;  2G9H D;  4B08 A;  1PTO C;  4S3S A;  4KHZ A;  1WTO A;  1FD7 D;  4AYB B;  4DU9 A;  2XRS D;  3E6Z X;  4C3J B;  3FMC A;  2IJ0 A;  2EXZ A;  1XTC D;  1TS5 A;  2D5D A;  1Q1E A;  1OO9 B;  3TME A;  1AW7 A;  1H9S A;  3PIP 3;  4DAY A;  3EFX D;  1STB A;  3V96 A;  1STA A;  1SYB A;  1A3T A;  1DM0 B;  3RD4 A;  1WD0 A;  1LTT D;  1GOZ A;  3TBI B;  5I4D A;  1KTK A;  2VB3 X;  1TWH B;  1YNJ D;  4B9X A;  2XWJ B;  1CTM A;  1HRJ A;  3M7G A;  2SNS A;  4KY6 A;  4LJZ C;  3ITP A;  1UUP A;  4NDX A;  4TSS A;  3FRP B;  1Q3L A;  3HOW B;  2RSO A;  2JA6 B;  2IX0 A;  2JA5 B;  1Y8P B;  3W2D A;  5CV5 A;  1B50 A;  2LMC B;  4OIJ A;  2O4X A;  1JC7 A;  5I2X A;  1EWH A;  4FNF A;  3RMH A;  3OHX C;  3GTQ B;  1GUS A;  3HKZ B;  4IUU A;  2K05 A;  3IFD A;  1QWY A;  3JAM L;  1HFG A;  1WTQ A;  4G7H C;  3AU7 A;  3VA7 A;  3FKI B;  2KED A;  2EYP A;  4DN4 M;  4DAP A;  1EY6 A;  1TS3 A;  3G6J B;  4H44 C;  2B2W A;  1L0X B;  3ND8 A;  2JSO A;  1MSG A;  5IT9 E;  2BDN A;  5EKK A;  1RF2 D;  4O42 A;  1SAP A;  2FHT A;  3S16 B;  4L6T B;  4ZUI A;  1EFI D;  1SNO A;  4HMJ A;  2RQX A;  4BWG B;  1A3V A;  1PZJ D;  1S5F D;  3BDL A;  1A2T A;  3M4Y A;  3ERO A;  5M5W B;  1OXS C;  2KEE A;  1NR2 A;  4ZQ3 A;  1PRT B;  5IT9 L;  1WVL A;  1XYI A;  4A3I B;  1B2T A;  1I4P A;  3R2I A;  5IGB A;  1ZYR C;  3H91 A;  2H1E A;  2B8G A;  1D1I A;  1EY7 A;  2EJF C;  3PUX A;  2NN6 G;  2F0D A;  3OOC A;  2I46 A;  1A3U A;  3U9O A;  3VR6 A;  1JE4 A;  3SR1 A;  3R93 A;  5C3X A;  2A6H C;  1ENC A;  2WII B;  1V43 A;  3IL8 A;  3KBG A;  2RA4 A;  3MXU A;  1O7L A;  1BO0 A;  1R4P B;  4OO1 G;  4IFD H;  2IWH A;  5M3M B;  1F77 A;  1CHP D;  5I6Y A;  5C6A A;  3PIO 3;  1WTR A;  4K6D A;  4LAA A;  2NVY B;  3BDO A;  1HQM C;  1F2Y A;  1TWA B;  3K6O A;  2ZT9 C;  1RD9 D;  2ENB A;  1ESR A;  4DNT B;  2NTS A;  3HEJ A;  2B2Y A;  2RDH A;  3H3V C;  3GV6 A;  4X3K A;  3NXW A;  3H0G B;  2B63 B;  1Z6H A;  3S1Q B;  4E6I A;  5JVG 3;  4K6L A;  3R3O A;  1OXU A;  2EZV A;  4XT3 B;  5IOD A;  2KQ3 A;  1EIG A;  3BDC A;  3QO2 A;  5C44 B;  1SYG A;  4ZK9 B;  2N88 A;  3AMU A;  2EYH A;  1W6J A;  2FJ2 A;  1FNV A;  4FF3 A;  1IL8 A;  1YNN D;  5ELE A;  4WRD A;  5K36 G;  4IN3 A;  1ENA A;  2QDB A;  3OW7 A;  2XWB B;  1B9N A;  1SND A;  1D2B A;  1E2W A;  4TQU S;  1F9Q A;  1TQO A;  3KLS A;  1M8A A;  5JAV A;  5IGF A;  3A8I E;  4EVO A;  3MA2 B;  5CYU A;  4DFA A;  1MBY A;  2XN9 C;  1ET6 A;  3C3L A;  5C5M A;  2B2U A;  1HUN A;  1JOK A;  1HA5 A;  3M3Y B;  3QG1 A;  2SOB A;  2AWO A;  2X6L A;  5CC4 A;  3V2T A;  4R9W A;  4PMB A;  1U4P A;  4FXG C;  1EY8 A;  5C4X B;  4QCL A;  1D6E C;  1H9M A;  5DEH A;  1K8O A;  3D8G A;  2L4N A;  5T1G A;  5I2Y A;  2XVS A;  2B2Y C;  4C3I G;  5JEA H;  1I3Q B;  2EYM A;  3TP8 A;  2Z1C A;  2X69 A;  4Y7N B;  2WP8 J;  1U4M A;  1OXV A;  2F0U A;  3HZX A;  1C4Q A;  1GXD C;  5KND A;  1S4Z A;  1G29 1;  2KOL A;  4OIK A;  1G8Z D;  1O78 A;  5CV8 A;  1X3P A;  2ICI A;  5JPM C;  4Q5V A;  4PMW A;  1B4O A;  5CV4 A;  3CQZ B;  1EYC A;  3VYS A;  4Q0F A;  4R8I A;  1C8C A;  4OL7 A;  1SFO B;  5FO8 B;  5C4H A;  5FOB B;  4CHT B;  4KK7 A;  2EPB A;  1HUM A;  2PCF B;  2B39 A;  1SYE A;  5LHY 1;  1RTO A;  3VA5 A;  4KI0 A;  3EJI A;  1B1Z A;  3S1N B;  1Q90 A;  1YNJ C;  3PO3 B;  1XXG A;  1ZEQ X;  2A69 C;  3QJY A;  4BA1 I;  2E2J B;  2A74 C;  2F0W A;  1G2S A;  3RUZ A;  2KUM A;  3J80 L;  2EY1 A;  1BR9 A;  3MZ5 A;  1L0Y B;  5G3L D;  2E2I B;  2EYL A;  3BVG A;  5ELF A;  3NPP A;  1TU2 B;  2Q8T A;  3J81 L;  4DF7 A;  4A3M B;  2B2V A;  4BBR B;  5M5Y B;  5NUC A;  4ZRZ A;  2LY7 A;  4FXK C;  1B3A A;  1PTO B;  5IGE A;  3FDT A;  2F0Q A;  2LS0 1;  2FMC A;  5C5L A;  1II3 A;  3HOX B;  2AUK A;  5CV9 A;  5KYI A;  4ID6 A;  2A68 D;  4ZKC B;  3I3C A;  5FO9 B;  2Y0S B;  3HOU B;  1WCM B;  1YNN C;  1DON A;  1STH A;  2SDF A;  5C4J B;  3VR4 A;  2K04 A;  1EZ6 A;  1QIL A;  3MHB A;  1A2U A;  1J8I A;  5F2D A;  2F0L A;  1F9S A;  1FNU A;  4IAL A;  1IKL A;  1BF4 A;  3GTP B;  1G2T A;  1H9K A;  1ZXT A;  4ZKB B;  5J1Z A;  4V0B A;  1CQV A;  1ROD A;  3T13 A;  1B53 A;  2RVL A;  3D6W A;  5A2Q L;  4ILW A;  2F03 A;  3BYY B;  5DNF A;  5M5X B;  4BBS B;  1BBX C;  1F2Z A;  2KCN A;  2RKS A;  1ESF A;  3WOE A;  2KEC A;  4FF4 A;  1PXU A;  4Z9C B;  1LTI D;  5CV7 A;  2Z4I A;  3OMC A;  2H4O A;  1PRT F;  2KHS A;  3URY A;  5DM6 3;  3A54 A;  1ET9 A;  1Q8I A;  1STG A;  2WKC A;  1Y8N B;  3C46 A;  3IFT A;  2DY7 A;  4XXE A;  5FK9 C;  4OHJ A;  2PW7 A;  2RDF A;  3NWT A;  4UAI A;  2E75 C;  5AFW A;  1PRT D;  3D31 A;  3RLF A;  1RJT A;  3LWE A;  1I4R A;  4M1U B;  2WV6 D;  1NUC A;  1HA6 A;  3EVQ A;  5EKL A;  4ULL A;  4PNY A;  5C0X I;  2JE6 I;  5I9O A;  1KDB A;  1DOM A;  4KKT A;  4RKB A;  4L8J A;  4KN7 C;  5G3L F;  5EPK A;  4RCO A;  1AZQ A;  2Z8L A;  3I8Z A;  4I7Z C;  3LWU A;  1MSH A;  2VUM B;  2NVT B;  1XX8 A;  1JOQ A;  2D62 A;  4HSP A;  3I4L A;  1LO5 D;  3KLS X;  5JEA J;  4DK0 A;  4KKS A;  2XIW A;  4N9T A;  4IQZ A;  3QOJ A;  2B2V C;  3Q6S A;  3SK8 A;  3KUP A;  2DN8 A;  4RFB A;  1VF5 C;  5I6W A;  1WTW A;  4L63 B;  3FVQ A;  1Q12 A;  3DWQ A;  4IUR A;  5K5P A;  2B2W C;  3A56 A;  1GUW A;  4MIU A;  3U9S A;  2O5I C;  3SK4 A;  2F3V A;  1JQY D;  2FMM A;  2VXW A;  1U4L A;  5D65 A;  2PZW A;  4U68 A;  1BUV T;  5C0X J;  3HGB A;  2XRQ D;  2Q8I B;  1VMP A;  2M9V A;  3I70 A;  1ONL A;  5IIF A;  1TWC B;  1DD2 A;  1RCV D;  4XQN A;  4RAU C;  1IHZ A;  4KV6 A;  5IGG A;  5EJW A;  2F0O A;  2CW0 D;  2K1B A;  5CMD A;  2MJ8 A;  3I90 A;  4PQX A;  4QB4 A;  1B44 D;  1LT6 D;  4QUC A;  4DK1 A;  3VR2 A;  1BOS A;  3EA6 A;  3OIQ A;  2MHV A;  4DXG A;  3GTG B;  3PMF A;  1T5E A;  3K59 A;  1LT5 D;  3AB9 A;  3PUZ A;  1S5C D;  4MHE A;  1LTG D;  1QE6 A;  1CQF A;  1QB5 D;  2E2D C;  2R93 B;  4G4K A;  1IYU A;  2MP1 A;  1O80 A;  1SNQ A;  2F0J A;  3S9W A;  1U9R A;  3PUW A;  4G57 A;  1SNP A;  3X3N A;  1NSN S;  4HCE A;  5KNB A;  1Q1B A;  3NTH A;  3G7L A;  2OF1 A;  1OXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...