2F0EA

Crystal structure of staphylococcal nuclease mutant v23l
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0eA00
4EQPA 5EKLA 3NK9A 3NHHA 5ISRA 1EZ8A 5J22A 1EY7A 1SYBA 3DMUA 4KV6A 3NP8A 4KY5A 5EGTA 4ZQ3A 2F0HA 1ENCA 3RUZA 2PW7A 1TQOA 5CC4A 1F2ZA 1KAAA 3D8GA 4KY6A 4EVOA 5IODA 4TRDA 4DU9A 1SYFA 1F2YA 2EYLA 3OMCA 4DFAA 5IGDA 4N9TA 2EXZA 2F0QA 2NUCA 5C3WA 3E5SA 4QF4A 3SHLA 5J1ZA 2LKVA 1RKNA 2OXPA 2WACA 4WORA 4J1MA 2F0VA 4NDXA 2F0TA 1SNMA 3OMGA 5F2DA 3S9WA 1TT2A 4K14A 3SK5A 2EY5A 5IGBA 2SNSA 2F3WA 4K6DA 3LX0A 4E6IA 1SNQA 1U9RA 1KABA 3BDCA 4ID6A 4N9PA 1EY0A 4EQNA 1EZ6A 2KQ3A 1AEXA 2M00A 3MEHA 4KJOA 2PZUA 2EY6A 1A2TA 4PNYA 1SNPA 2F0IA 4I65A 5I6YA 4DF7A 3HZXA 3D4WA 4K8JA 1STAA 2F0WA 2EYPA 4RKLA 3QOLA 2O4XA 3EROA 4ME5A 4ZUIA 4K5XA 5CR3A 5IGEA 5KYIA 1KDCA 2KHSA 3ERQA 3NXWA 4R8NA 4HMIA 5CV7A 2PW5A 1JOQA 1A3VA 3MHBA 5JOBA 1STYA 5E3FA 2F3VA 4K5VA 1IHZA 3SXHA 2F0FA 1STNA 3T13A 5IIFA 4J6HA 1STHA 4IZ8A 4K8IA 4ZUJA 1NSNS 4KY7A 5C5MA 5KYLA 2PZTA 5I9PA 1EYCA 2OEOA 3PMFA 3TP7A 1EYAA 1A3UA 3MVVA 3C1EA 2RDFA 5CV8A 2EYJA 5J39A 2EYHA 3SK8A 1EY5A 1SNOA 1STGA 3OWFA 3TP6A 3NQTA 5I9OA 2ENBA 1NUCA 2F0SA 4OL7A 2PZWA 1SYCA 3TP5A 3D6CA 3ITPA 4S3SA 1JORA 4H7BA 2F0MA 5KRUA 4KHVA 4K2KA 3DHQA 5CV5A 3C1FA 2F0KA 2EYFA 3EJIA 4DGZA 4YIJA 5C6AA 2EYMA 2OF1A 3QOJA 2RKSA 1EYDA 5KIXA 5DAUA 5IGFA 5IOCA 1SYGA 2F0LA 5C3XA 3SR1A 5HGTA 5KEEA 4IALA 1EQVA 2QDBA 2F0PA 1F2MA 2SNMA 1EY9A 2EY1A 3R3OA 5HURA 3T16A 2F0DA 4G57A 1STBA 1SYEA 5C4HA 2F0UA 4B9WA 5CV4A 3SK6A 2F0JA 2EYOA 4KJNA 3TP8A 3NUCA 5IGCA 5JAVA 2EY2A 4HMJA 4NKLA 4PMBA 1TR5A 5K5PA 2F0EA 5NUCA 4QMGA 5CV9A 5C4ZA 5M9OA 4EQOA 3OSOA 4K2LA 3V2TA 1II3A 4HTHA 5E1FA 3MXPA 3TMEA 1JOKA 4F7XA 2HQEA 1SYDA 2SOBA 4KD3A 4WRDA 1EY6A 1SNCA 5CV6A 2PYKA 1SNDA 3QB3A 2RBMA 4K5WA 5DEHA 5KGUA 2PQEA 5C5LA 4MIUA 1ENAA 5I6WA 3BDLA 4KTAA 4NP5A 5EKKA 1A2UA 1KDBA 3H6MA 4LAAA 4ODGA 4NMZA 3SK4A 4F8MA 5CGKA 1EY4A 4IUNA 3P1HA 3VA5A 3U9OA 1EY8A 3MZ5A 4PMCA 3P75A 4QB4A 3D4DA 4RKBA 5IGGA 1JOOA 1A3TA 1KDAA 2F0GA 2F0NA 4B9XA 4KD4A 3HEJA 2F0OA 3EVQA
chains in the Genus database with same CATH superfamily
2PQAA 2Q2UA 4FDBA 1H9RA 4L8JA 1XTCD 3DM3A 2UUAQ 1PRTB 2PW7A 4R1JA 2AQ1B 5LHY1 5FKAC 4DN4M 1IZ6A 4N9TA 3EIVA 2B2TA 1B4OA 2QW7A 2RDGA 5M5YH 3Q0AA 4IPHA 4GLXA 3CRKC 3ICEA 1UEBA 2R7FA 3JAME 2SNSA 1WTPA 4C3IG 1BOSA 4A3IH 2R92H 3S1NB 1BDOA 2K03A 5KNBA 3CXCA 2UU9L 3CQZH 3GD7A 5CYUA 2NN6H 4LF7L 1CZGA 1Y1VB 2WFWA 4EX5A 5I9PA 3TSSA 1IBMQ 4BS9A 1XMQQ 4FP5D 1STGA 1U4PA 4H44C 2D62A 3PO2G 3Q24A 3HOYB 1A8VA 1VQIA 1W6KA 4KI0A 5HY6A 4JI8Q 1K0RA 1EIHA 5IT9c 1LT6D 1PH4A 4C1NK 2N55A 3C1FA 2LMCB 1XX8A 2E5LQ 3F2BA 2FINB 1XJVA 1DGSA 1KAWA 3S14H 1PTOD 3WOEA 2F0LA 1PH1A 4B08A 2QDBA 1XNRL 1B53A 2L5TA 1CI3M 4B3SL 5C3EG 2KCMA 1B3QA 1EOTA 1WYDA 3PF5A 1AFPA 2Q2TA 2K6AA 3T1YQ 5C4ZA 2QKIC 4K2LA 1XTDA 2NBFA 1AE3A 2IHFA 1FNWA 2SOBA 1ZEQX 1TWAB 3D31A 2BCOA 4JVZA 1PZJD 3QB3A 3GO5A 4B3RQ 4X3SA 5CORA 4AQYL 1YNJD 3AQQA 3H0GG 4IUNA 2FFKB 3KF6B 3P1HA 3GTQH 4GKJQ 3PUXA 4XYQA 3G71A 4I7ZC 1HNXL 3HEJA 3OIPA 5AFWA 3CC4A 2VL6A 3MXNB 4MHEA 4Y7NB 2HHHL 3M4OH 1Q8KA 3I72A 2ZJRA 4DV5Q 1VQKA 1SMYD 3HS0C 3D8GA 3KF8A 2MPMA 5IODA 2K1BA 2ZJPA 4A3MB 3WDNA 1VQ4A 4IUVA 3TS0A 1J5EL 3S1MH 1D5XC 2XRQD 1XNQL 3G6JB 1G291 1Q3LA 5F2DA 4K14A 3M3YH 2C5CA 1PTOC 3UDGA 2K5HA 4K6DA 1H95A 4DUZL 3QO2A 4EQNA 3S1QH 1UEAB 4HJ7A 1I6HH 5BN5A 3I56A 2I0QA 4I65A 2G5DA 4GN3B 3BJUA 4DV3Q 3K81C 3RN5A 4XQQA 2Z4HA 4GOPB 3BYTB 5IIFA 2F0FA 2CWPA 1L1OC 1NR2A 2J0TD 1Y8PB 1EYCA 2NVQH 3CCJA 3MFYA 3W5OA 5J39A 1N8RC 2EIFA 2EYHA 4C1NI 2HCCA 1YNJC 3A8KE 2BA1A 4A3EG 2FMCA 2R7ZH 3HOUB 3X3MA 3TP5A 3DWQA 1K9MC 4OWXB 2LY7A 1VF7A 1QVCA 5C44H 4X64L 3DHQA 3E0EA 3PUZA 4JI4Q 3Q8DA 1SMYC 1EYDA 3ULJA 5HGTA 4JW0A 4MTNA 1HR0W 2F0PA 2L11A 1DZ1A 2CQAA 1HNWL 4IPGA 4G57A 1STBA 2IX3A 3S16H 4A3CG 2I07B 4FF1A 5K36H 1CQFA 2UUAL 3GTPB 1LO5D 3R8BA 2CW0D 1T9HA 1JMCA 5IYCG 4JK1C 1NMFA 3OSOA 3CPFA 3VYTA 4C3HH 3SGIA 1SYDA 1D1KA 3RLFA 1VQPA 2IL8A 4LNQA 3KLSX 4GLAC 4L63B 2E2JH 2VQFQ 2RCFA 2K4KA 2RF4A 4DXFA 1GUNA 2O5JC 1YHBA 1SEBD 4B9XA 2ZXRA 4OWWB 5EKLA 3NK9A 3GTGB 1EZ8A 5J22A 4YWKA 2IX1A 1JCKB 2JA5H 4QQBX 4F87A 2AUKA 4DXGA 2X6LA 4DK6C 4TRDA 5FOBB 1PLFA 1IBML 1VQFA 1Q86C 5C3WA 2FJ2A 2HIXA 1XMQL 3A7LA 1YJWA 4NDXA 2UXDQ 1PH9A 1SAPA 1D2BA 4NB3A 3V96A 3PUWA 3O13A 3A8IE 1YI2A 3ULLA 4LF8Q 4JI8L 4E6IA 3CP0A 1EY0A 2K5VA 5M5XH 1FNVA 4X3KA 1ENFA 2PI2E 1PFBA 3CCSA 2ZXOA 4K8JA 2E5LL 1ICWA 1HXYD 2X6GA 1CKNB 2PW5A 3E9IA 2CW0C 1QNKA 3Q23A 3KLSA 4DK1A 3GQBA 5KYLA 2DY8A 1X9NA 1TS3A 3TP7A 1MI2A 1Q7YC 3NWSA 2N88A 1HA6A 1RTNA 3N6RA 3T1YL 1BF4A 4DK3C 1NUCA 3A0JA 3OW7A 1MKHA 2NZHA 3B6YA 4P2CB 1EU4A 4OGQC 5C0XH 2NVTH 1YJNA 4GLVB 3EBEA 3I55A 2B2YA 3EJIA 3KF6A 4YWLA 4KN7C 1PMRA 1C0AA 2IY5B 3J80L 4GKJL 2YTXA 1YHQA 2PCFB 3W2DA 1CHQD 1EEID 1ML0D 1W3SA 2D2CC 1O7YA 1JQYD 2B2UC 3MXNA 3R3OA 2LS01 2I5HA 2F0DA 1X3QA 4A3BB 5FLMH 4A4IA 1BBXC 4MZ9A 3K57A 2R92G 2JQOA 4EGVA 3NUCA 2K28A 4DV5L 1U4LA 4DR7Q 2F0EA 4ME3A 4EQOA 2NN6G 5E1FA 4YWMA 4U68A 3VYSA 2ALYB 2PYKA 2R93B 3RMHA 3PIPA 2YU9B 1CQVA 3D4RA 3H6MA 1SFOB 3KFUA 3S17H 3HOWG 3FP9A 1EY8A 1SE2A 1G91A 4DV3L 1VQDA 4HR7B 1VQJA 4GOPA 2ZXPA 3GV6A 3W1GA 5D3DA 5M3FH 4C2MB 1AH9A 1CKMA 1WJJA 2QILA 3IL8A 3DMUA 4KV6A 5EGTA 4C3IH 2MP1A 2JA9A 1OXTA 1RF2D 2RVLA 3TQYA 2KVMA 2F0QA 2DUDA 2XVSA 1SRUA 5M3MB 4P73A 1QOHA 4JBKA 3Q6SA 2D5DA 1GUTA 3X3NA 2ZTDA 3CW2C 3GTKH 2EY5A 3M4PA 1N34Q 3QWNA 2AQ3B 3LWEA 4WJWA 1EU3A 4BWGB 4HIDA 3GDEA 2BDNA 3J7YW 1CKOA 1OXUA 2Z6KC 1SE4A 1WTXA 4ME5A 4JI4L 3LNNA 4K5XA 3PO2H 5IYBH 1YZ6A 5CV7A 3DM1A 1BQQT 3ONAB 1K0SA 1HUNA 5JPMC 2JK8A 4C3JH 3J7AV 2K32A 2PZTA 2NVYH 3PMFA 5LMNQ 4LK1C 1PH6A 3KBGA 4AIMA 4A3IB 3NQTA 5I9OA 1Q8IA 2ENBA 4JG2A 3FEWX 5ELOA 3CKIB 2F0KA 4R4TA 2EYFA 3S2HH 3G7LA 4IJHA 4UAIA 4P75A 5LL6X 2VQFL 1WTWA 4X65Q 1FJGQ 1UAPA 1HUMA 4IALA 2OQKA 4XIGS 1F2MA 1Q12A 2EY1A 3NBHB 5IWAQ 1Y1WG 5ELDA 5HGQA 1NY4A 2ZTEA 1RJTA 3PCOB 1VS0A 2LXKA 1Q81C 2Z9HA 3H0GH 3G48A 5JAVA 4NKLA 4A3KB 1TR5A 3PIP3 3CCMA 4DK0A 3V2TA 3TMEA 2NZ1D 3J81c 5JJLA 4ILWA 3HOXB 2UXDL 1MSHA 3A56A 1XWEA 1S3OA 4LF8L 4NP5A 3WOFA 1QILA 3I4NB 1S5CD 1L2FA 4YCVA 5A2QE 1KD1C 4PV1C 2B3GA 2K7VA 1VQ6A 2IHEA 4V190 1E24A 1WI5A 5JVH3 1BCPB 2A1AA 1CKNA 5C44G 2F0GA 1DCZA 4DA2A 3CHBD 1VMCA 1JWSD 4CDCC 4A3FB 1PH7A 1HR0Q 3C46A 1GUGA 1WFQA 1MSGA 3CC7A 1TWHH 3SE0A 2L1BA 3PF4A 1L0YB 2EXZA 1EYGA 1NTGA 1JC7A 3E5SA 3J80c 3G4SA 3BS1A 2NTTA 1EQRA 3PV0A 1IKMA 1IYJB 5C4JH 3NE5B 4JPBW 3HOVH 4JYAQ 4BY1B 1R9TB 3MEHA 1Q1EA 4GN5A 1C9OA 2L15A 1W2BA 5KYIA 4DV1Q 1DJRD 5JVG3 4A3EH 4FF2A 2NN6I 1I3QH 3S1MB 1A3VA 3KBXA 1I6VC 1H9SB 5FLXE 3M4YA 4IZ8A 2A6HD 4BA2I 3M3YB 2O5IC 1S5BD 2QCPX 2EYJA 4PZ8A 3S1QB 1B1ZA 2RSOA 4H13C 4IURA 4BBRG 3SK8A 1I6HB 4CJ2C 4DR7L 1V1OA 2F0SA 2I46A 3F8TA 4CKEA 5I4DA 3M7NA 1B44D 5KRUA 2NTSA 2MJ8A 5IT9E 3IAYA 1AW7A 2PNHA 2GN5A 4GKKL 3OWEB 2NVQB 2QA4A 2CFMA 2VZAA 5M5WH 2KA7A 2B29A 5G3LF 3MFGA 4RCNA 5EAYA 3OTOQ 1DM0B 4GS3A 3Q22A 5FK9C 4A3JH 2R7ZB 1XPUA 1X55A 1Z7TA 3BZDB 2BH8A 1B70B 4H02A 4JI7Q 3MA2B 4JI1Q 1D8LA 1F9RA 3R2IA 1GKHA 3F2CA 4ZAIA 4FXGC 2Q8RE 5CV6A 2IPKD 1N34L 4FF3A 4K5WA 3BDOA 1K28A 5FJ8H 5KGUA 1VF5C 2A6HC 1WD0A 3MZ5A 1BBWA 1VQMA 2QEJC 3GTJB 1WTRA 1H9JA 5C0XG 5DLQE 2TMPA 4J1MA 1G51A 4PZ6A 3HKZB 3STBD 4C3HB 4FVMA 1M90C 3K8AA 2J7ZA 1TQOA 1KAAA 1UE5A 2AHOB 1GVPA 1I4XA 3VYRA 5LMNL 3J81i 1VQGA 2Z6BA 2ICEC 5EQ0A 2V4DA 2ZT9C 2E2JB 2YTYA 3M4QA 2KEEA 4IUPA 4DR2Q 1AE2A 1A6XA 4ID6A 4RFBA 1D1IA 2KQ3A 4CKCA 4KJOA 2PZUA 1SNPA 1STAA 1HNWQ 4DUYL 1NE3A 4Q5VA 4R4QA 3HOZH 5A35A 3K58A 4JI0Q 1XPRA 5JOBA 2F3VA 4X65L 1FJGL 3NBHA 4LFBQ 2B2VA 5IWAL 4B3TQ 1X3GA 3J80i 3QG1A 3MVVA 4QY7A 2K5WA 1AZQA 4CDDC 2B2WA 2CHBD 1X3FA 5M5XB 2JXMB 4DV6Q 1PVOA 3OWFA 3VR5A 5M3FG 1SJHD 2E2IH 4MTKA 2F4VQ 1Q46A 1PFSA 2Y0SG 4V0BA 3CCQA 1I50H 1G6PA 3T53B 3HGBA 3STBC 3I4MH 1CTMA 2E2HB 3RZOH 1B9MA 3E6ZX 2RKSA 2GVBA 1WTOA 5IGFA 4TVAB 5GAHC 2AQ2B 2DNEA 2Z4IA 4IOCA 2L12A 4UP7A 3BG3A 3HKZE 4QGUA 3IKJA 1HR0L 2KOLA 5IYBG 3TP8A 3HOWH 2NVTB 3AEVA 2EY2A 4PMBA 2UUCQ 3GV3A 2OQ0A 1LTBD 1QJOA 2DN8A 4A3MG 4C3JG 3K80C 1WCMH 3FVQA 1PTOB 5D65A 1CA6A 5LMUQ 4JI5Q 1SNCA 3T1HQ 1PYBA 3L2PA 2QEXA 2OT2A 4KN4C 5IP7G 1X54A 5EPJA 3S9WA 4JYAL 1KDBA 2JSOA 2EJGC 4LF4Q 1U4RA 1E2WA 4DV1L 4OHJA 3KDFA 3KJPA 1H9SA 5COYA 1L1OB 4ABNA 1K3BC 4HIOA 3N52A 5C4XH 2WV6D 4HCEA 5C0XJ 4EVOA 2VB2X 4ZLTF 2JA7H 3OMCA 3UE1A 3S17B 2JA6B 4OONA 1TT2A 2JEAI 2EQSA 4A3LH 1CSQA 3BDCA 1QG7A 1KL9A 1SJED 2JA8B 3TRZA 4AH6A 3M7GA 4LF6Q 4C3IB 1PV4A 2BE5D 1HPCA 4FF4A 1JJGA 1UNSA 4O2DA 3AU7A 4HSVA 4ZUJA 3OTOL 2DJFC 3GTKB 4F88A 5FO8B 4NXMQ 2R3ZA 1QCBD 4DV4Q 1C48A 2HIVA 1GUSA 4HJ8A 5IYDH 2VQEQ 3NSWA 4JI7L 1QWYA 3PO3H 4JI1L 2IW3A 5C0XI 3PO2B 1Y1WH 4UP8A 4OEMB 3EFXD 4A93B 4ULLA 4POFA 2DJGC 1DOKA 1K8MA 1Y8NB 3VDYA 1FGBD 4CGYB 5C6AA 3K59A 4JBWA 4XTCS 2K5QA 2O2LD 1J8IA 1EUJA 5KEEA 3HOVG 1LTLA 5E4XA 1HRJA 1JICA 1WD1A 2I5MX 1EY9A 2A68D 1VQCA 2CKZB 1UUPA 4IQZA 2AWNA 3PSIA 3H94A 2EYOA 4DR4Q 1S4ZA 1T5EA 5C3EB 4XDXA 3CMAA 3CPWA 1EFID 2MFIA 3FMCA 1WVLA 3GTMB 1VQ9A 2ICIA 3NTHA 1G2TA 2BE5C 3NENA 2IT1A 3RZDB 1K73C 2Z8LA 2WB1G 3FHWA 4DR2L 4HN7A 3RNUA 3KK7A 5C5LA 1ENAA 5CGKA 5BN3A 3KYHC 4PQXA 1Q82C 1E7ZA 1XYIA 4XYOA 3MXUA 2ZJQA 5LL6S 2Y0SE 1JT8A 1D5ZC 2B2YC 1VQLA 4JI0L 2WAQG 1YHAA 1EY7A 1LTTD 2G9DA 4LFBL 2JN4A 4B3TL 1U0LA 2DNCA 1AP0A 1KTKA 4FXKC 5EPLA 4A3JG 1E0BA 4L5RC 4POGA 4DV6L 4UP9A 4UPAA 2I5LX 2B8FA 2K5DA 1BO0A 2F4VL 4TQUS 3ZJYC 3FKIG 2A68C 1HH2P 1X3PA 3C2PA 2E74C 4BBRH 1BUVT 4RKLA 4QJFA 3OHXC 1EOVA 3IFTA 4BY7B 4BBSG 1IBKQ 2UXCQ 4UDUC 1YEZA 4BA1I 5G3LD 3S2DB 2VUMG 5FJ8G 3CF5A 4N8X1 1X3EA 5JPNC 4LUVA 5C4JB 1CT1D 1A0IA 1PXUA 2KCNA 4A75A 3U50C 3C1EA 4GOPC 2QDLA 4A3DH 1E2VA 1K8AC 4NXNL 2UUCL 1XMOQ 1HQMC 2NVXH 1NCVA 2A6ED 1SYCA 1H9MA 3U9SA 3HRZC 3OPOA 4CHTB 4A3EB 2EJFC 2JJQA 1I4PA 3M9BA 1TS2A 3K0YA 5LMUL 4JI5L 1I4QA 3T1HL 3DWPA 1Y14B 1LTAD 4J8QA 3J81L 3GTLB 4IFDG 4U673 5IOCA 4GNXC 1SYGA 4LF4L 3CMEA 3PUVA 1EQVA 3J7AF 2H4OA 4JI2Q 5EPKA 1VDZA 2F0UA 3HOZG 4RAUC 4HMJA 1LYLA 5K5PA 3K5MA 3S1NH 2R7DA 2NB0A 1TWGB 3IFDA 4OWTB 3BVMA 2L9HA 4JOIA 3NELA 3P7JA 2N49A 5DEHA 4ZCKA 3BU2A 4L5QA 5ELEA 1FVIA 3K5LA 1OXSC 2GVAA 2MO0A 3AYHB 4LF6L 1HCZA 4MNOA 3EA6A 1A3TA 2KBNA 2OCEA 3S1RB 2CVRA 3HOYH 2F0OA 2KJXA 3I4LA 3AMUA 3I4MG 1OO9B 2A6EC 4UY8C 4TSSA 1Q1BA 3D0FA 3ER0A 1QUQB 1TU2B 4NXML 2KUMA 4DV4L 4QL5A 1C8CA 4DFAA 4DNRB 3SHLA 2VQEL 4XQNA 2KCTA 2F0VA 2EE1A 3J80E 4GKKQ 3QIAA 2CH4W 1ILPA 2F3WA 1PRTF 1F77A 4AYBG 2RCNA 4WJ3M 4DV2Q 3QR8A 2A19A 3QJYA 2AMCB 2QGQA 3OOCA 1WCMG 4OXPA 3I91A 4XXEA 1LT4D 1HZCA 4LMQD 1JOQA 2HUGA 5E4WC 2WB1E 4K5VA 2E75C 4OELB 3MTSA 1BXTA 2GA4B 1UE6A 2F4IA 1WOCA 5CV8A 4HAEA 4DR4L 2SDFA 4ZYSA 1WTQA 1CZWA 2PI2A 5I2XA 1S5ED 2WAQE 5EBDA 1R4PB 4R4CA 5C4XG 2EOTA 1G2SA 2JA7G 4FXDA 4KHVA 1LTRD 4IUUA 1PH2A 2Z0SA 4IO9A 1KNEA 1KQSA 5M5YB 4YHHQ 4A3LG 4LUOA 4A3MH 2FMMA 1EIYB 3R93A 2DGYA 5AJ3Q 1BNZA 3RLNA 2PMZE 1C7YA 3T16A 5IP7H 4R4OA 1B50A 4R4IA 4B9WA 2JE6I 2R92B 1DOMA 4KHZA 5NUCA 4RMFA 2E76C 2KECA 3CQZB 1KXLA 3FPPA 4DUYQ 3CCLA 2XWBB 1KIXA 2AKWB 2B39A 5IYDG 1DOLA 3SK4A 4A3GG 2K14A 4ODGA 3PO3G 4DPGA 3F1ZA 4QB4A 3P75A 3HOWB 1I94L 2HT1A 1KDAA 1Z47A 1IBKL 2UXCL 3EVQA 2H5XA 4ZQ3A 1U4MA 1ENCA 5CC4A 3EQLC 1EWIA 1GOZA 2K75A 1SYFA 3S14B 5IGCA 2XIWA 3PQIA 3U4VA 4IFDI 2B8GA 3L9AX 1RKNA 2OXPA 1MIUA 1VQEA 3NBIA 1UE1A 1ZKOA 1XMOL 5IE8A 1QZHA 2MQHA 2WINB 2B63G 1N9WA 4IOAA 1EIGA 4OO1H 2JYOA 3GP7A 4RGOS 1JR0D 5E7NA 1O80A 2EY6A 1A2TA 4IPCA 4OIJA 4Y52H 4A76A 2O4XA 1J9OA 3KLWA 3GTPH 5KNDA 2HDMA 4QIWE 4Q0FA 2Q2HA 2V1CC 5E3FA 1IHZA 4KY7A 2R6GA 1VQHA 2XRSD 1PZKD 4JI2L 4JV5Q 1B2TA 3GTQB 2YV5A 2Q8IB 3TP6A 2WKDA 2NWGA 3D6CA 3ITPA 1PH3A 1B3AA 3M4OB 1SN8A 3A74A 5CV5A 3GTGH 2F52A 1X32A 2N3SA 2MNAA 1SE3A 1Y69U 3V05A 1GUWA 3ND8A 2HCIA 2R61A 3SR1A 1JB7A 1O78A 3G6EA 1FR3A 5BR8Q 1Y1WB 3SK6A 1TXYA 2KHJA 1QUQA 4BXXG 1ZYRD 1G8ZD 1T5XD 4FO2A 2B2VC 3OW2A 2B2TC 1YITA 3JC66 2B2WC 2YTVA 1LV9A 3DWAA 4A3DG 1YNXA 2RBMA 5JEAH 2XTIA 2E2DC 2PQEA 3A54A 5EKKA 4OX9Q 2RA4A 1EY4A 1HZAA 4DR3Q 4DV2L 5GAEC 1F9QA 4M1UB 1FD7D 1K3RA 2X69A 5C44B 1SLJA 2RHQB 4EQPA 4R8IA 4K0KQ 3NHHA 3NEMA 3VA7A 3FKIH 4KY5A 3NP8A 4APVA 2L0CA 1RHPA 1MBYA 4DU9A 4BBSH 4RHSA 4F8MA 5T1IA 2F0TA 4X62Q 2VUMH 3TN2A 1I4RA 3S16B 4KKTA 2IJ0A 1Z9FA 1KNAA 2M00A 4RGMA 4A3BH 4QCLA 3L3OC 3RD4A 3S24A 3CCVA 3D4WA 3C3LA 1Z6HA 4YHHL 1ZYRC 1RDPD 4KHPQ 4X66Q 3K0XA 4DV7L 5AJ3L 1QNUA 1Y1VG 3VR4A 2IWHA 2JEBI 2E8GA 1F2LA 3AFPA 4JBMA 2R93H 1CUKA 4IFDH 2YU9H 3F2UA 1PFNA 2BOSA 1UE7A 3HOYG 4BBRB 1GO3E 5TSSA 3H15A 2YYZA 1E1OA 3PGZA 3UDFA 1GM5A 1G6ZA 2JA5B 4R9WA 3TZUA 3H3VC 4C2MH 3K7AH 5CMDA 3BVGA 2N8NA 1U5KA 1W6JA 1QVGA 4IPDA 3I70A 3QOJA 2Q8TA 2M2LA 4DAVA 1LT5D 3JAML 3DXJC 2K05A 4LFCQ 5M3MH 4KMUC 3H3VI 1JE5A 1SYEA 2A74C 5GQOA 1N33Q 1TWFH 1ET9A 1HZ9A 2EXDA 4DV0Q 2TSSA 1LLRD 1SSOA 1N36Q 1Q90A 2F03A 1VQ7A 4DNTB 2JA6G 1PRTD 4K6LA 5KNCA 1DYQA 2A73B 1TKWB 2ZM6Q 1H9KA 4LAAA 2H1EA 4PG3A 3HG9A 2PO4A 2JA8G 2K01A 3A7AB 4RKBA 3S15H 5L37A 1HFGA 1P8LA 4JC0A 3FRPB 4TKOB 4NXNQ 5EJWA 2ATWA 3F2DA 5FLXc 1KC8C 3ULPA 1D5MC 4DR6Q 2A8VA 2F1MA 4JV5L 4IJLA 5IGDA 1SR3A 3SVMA 5J1ZA 2NZOA 1SNMA 4DR5Q 1N32Q 3SK5A 1HHVA 3LX0A 4DKAC 2F3IA 4A93G 3I8ZA 2JP1A 1E3PA 3HZXA 2RQXA 1PHJA 3E9HA 1VQBA 1SDFA 1TS4A 4ZUIA 3VR6A 4A3KH 3ERQA 4R8NA 4RWSC 1EFWA 1ESRA 4K8IA 3R2TA 2MO1A 4OIKA 4C56C 3LGJA 3HOXH 1AN8A 3T51B 1PRTC 3J81j 5BR8L 1IBLQ 1A15A 1YBYA 3I4NH 1IXRA 5J3BA 3HOUG 3FDTA 3VR2A 3K6OA 1HA5A 2WIIB 4OL7A 5M3FB 1HJPA 1NR4A 1GJXA 1FNUA 5ELFA 3AB9A 3KLRA 3NTKA 2Y0SB 4O42A 1NNXA 4A3FH 1JWMD 1JWUD 1C4QA 2C35B 2OF1A 4P72A 4OX9L 1QE6A 2A69D 1L0WA 3RLOA 4DR3L 4OO1G 1XXGA 3DEPA 4JBJA 4RHRA 5HURA 3CD6A 1K8OA 1IL8A 4K0KL 1S5DD 1PH5A 3D3RA 4A3GH 4KJNA 1BKBA 4BY1H 1LM0A 1R9TH 3TEHB 4DAPA 1V1QA 5LMNW 3P20A 3U4ZA 5IY0A 1V9PA 2D0OA 1II3A 1YNND 4MN3A 2NYZD 2HQEA 4C3JB 4X62L 2RSNA 2NVYB 3TS2A 3A5UA 1TWCH 1IL2A 3BDLA 3CU7A 1LABA 2ID0A 1TY0A 2P5ZX 5IGGA 4G7HC 4B3MQ 4BY7G 3H3VH 1X6OA 4F7XA 1CA5A 2B63H 4KHPL 4X66L 1K83H 3NQIA 3S2HB 1F2ZA 2XGTA 4KY6A 4RGNA 2DY7A 1F2YA 2EYLA 3CAMA 3H91A 1BCPF 1MD2D 2D9UA 3E0JA 1B7YB 2LKVA 4WORA 3JAMc 2QF7A 1E2ZA 1ICFB 3TBIB 1KLUD 2A69C 1O7LA 2ZTCA 1O7IA 3URYA 3H0GB 4CDFC 4XQJA 5I6YA 1EQQA 4DF7A 3NPPA 1ET6A 3QOLA 4JOIC 3CC2A 3BYYB 4GNXB 4YCUA 4PZ7A 2WKCA 2UUBQ 4LFAQ 1RCVD 5JEAG 1DONA 1A62A 4KKUA 1YNNC 1STHA 2XN9C 4LFCL 1GHKA 4HCSA 1HFNA 5DNFA 3GTOH 1RD9D 1A3UA 3W3AA 4QUCA 2RDFA 1ASYA 1N33L 2CWAA 1EY5A 1IYUA 4IN3A 1HNZQ 1DXMA 3ERSX 4ZRZA 3MAQA 4DV0L 3GTJH 2KCCA 4LF5Q 4S3SA 4XT3B 1I94Q 1N36L 4LF9Q 4K2KA 2HQLA 1TWHB 3K7UC 4NPSA 4J15A 3MXGA 4BXXH 2ZM6L 4JI3Q 2EYMA 2XSCA 2OWOA 1TIID 3A55A 4N8FA 5C3XA 3EN2A 1B9NA 4A3BG 3HOVB 3OYYA 5JJZA 1A63A 3ND9A 3ZYYX 1B8AA 1AZPA 1HTPA 4L5TA 1J6QA 3TREA 4DR6L 5ELBA 1I3QB 4M8AA 1PYSB 1TS5A 4YY3Q 2R93G 4DR5L 1N32L 1SMXA 1TVXA 2WB1B 5C5MA 4KTAA 4FYDA 3DEOA 1EWHA 4G7OC 3K5NA 4DAMA 1RTOA 2MGSA 1FL0A 3VA5A 1L1OA 3BZCA 4G7ZC 2Z1CA 1JB3A 5BN4A 1V43A 2ASBA 1K8GA 5CBAE 2EDGA 3NWTA 3I3CA 1BR9A 1R4QB 2G9HD 1X56A 2WAQB 1VQAA 2LSSA 2PNRC 2HD3A 1L0XB 2RDHA 1YIJA 5M3MG 5M5WB 2E2HH 3J81E 1IBLL 1KRTA 1WTHA 4OO1I 4A3JB 1OXXK 1Y1VH 2C9OA 5IGBA 2VB3X 3PUYA 1EIFA 3DLLA 1SNQA 1LT3D 4HIKA 1EZ6A 2PMZB 2VXWA 1AEXA 2F0IA 3FKIB 2CH4A 1D7QA 2F0WA 4X6AH 1CM9A 1ESFA 3EROA 1EWCA 4YCWA 4LW1A 5IGEA 1IYVA 4CDEC 2KHSA 3NXWA 3A5ZB 4HMIA 3UDXA 1NJIC 4B3RL 4BBSB 1STYA 3T13A 1STNA 4J6HA 3HKSA 2VUMB 1PTOH 4WJ4A 1NSNS 4KKSA 4O1NA 3TDQA 5JEAJ 5IP9H 4RH6A 5FO7B 3JAMi 1BBUA 4A3IG 5T1GA 2CQOA 2VW9A 1HZBA 1F9PA 5GROA 1JORA 2F0MA 4WFN3 4JCVE 2KHIA 3MC0B 1HTLD 2FHTA 5KIXA 3K5OA 1TWAH 5DAUA 4PMWA 1CFMA 3T4AC 2OTJA 4ZKBB 1WTVA 3CRLC 2JA6H 2VNUD 2A5HA 5D3IB 4DR1Q 4B3ML 1V1PB 3MWYW 2EPBA 1S40A 2IX0A 2UXBQ 5CV4A 4A3KG 3U58A 1SXTA 2XWJB 1ASZA 2JA8H 3H09A 3K7AB 1EEFD 3BVZA 4KLKA 3HOZB 4QMGA 3CCUA 3PIOA 1I5FA 3HOXG 1LUZA 1YVCA 4Y7NH 1JOKA 1ZXTA 1EY6A 2EJMA 3A8JE 1SNDA 1GXDC 4QIWB 3I4NG 5I6WA 4ALPA 4CJ1B 1PA6A 2BH2A 3KUPA 4DV7Q 4JI6Q 4NMZA 4RGTA 1MJCA 1GHJA 1UWVA 4HJ5A 1KRSA 3J7ZC 2E2IB 4HJAA 4IFDJ 4GNXA 1M8AA 1TWFB 1PTOF 1M4VA 2RHSB 2F0NA 2KEDA 4I7AA 4A3FG 1CSPA 1I50B 2UUBL 4LFAL 3L0OA 4CKBA 3I4MB 1DD2A 4DAYB 4A93H 3CCEA 3RZOB 1P16A 1SE8A 1X65A 4QF4A 4RA8A 5H1SE 3RR5A 3E3XA 1HNZL 3S15B 4BY1G 1MJEA 1U9RA 1KABA 2OTLA 4N9PA 4LF5L 2J4XA 4HSPA 4LF9L 1OXVA 4AYBB 1BVSA 2EYPA 1FGUA 2B2UA 3HOUH 5C3EH 1ONLA 3SDZA 5CR3A 1KDCA 1WCMB 4JI3L 3GTMH 1MGSA 5GAGC 2PQAB 3KJOA 2EZVA 3RZDH 1STEA 1GUOA 2ES2A 2OEOA 4UHVA 5A2QL 1O7ZA 2L55A 1VQ8A 4IUQA 1SNOA 1SROA 3UDIA 2BDOA 2MUYA 4GN4B 2K04A 3UI2A 5C4XB 4G4KA 4YY3L 1S72A 4H7BA 2XNAC 2JA7B 1CHPD 2LFNA 3HFZB 2UU9Q 3I2ZA 5DM73 4CJ0B 1OTCA 1GD7A 1EL0A 3I90A 4LF7Q 2R7ZG 4L6TB 3J7A5 4O0AA 4XT1B 3PIO3 2LXJA 2AWOA 3NTIA 1S5FD 1NMGA 1ILQA 3IRBA 3I73A 1BCPD 4L5SA 3D6WA 4BY7H 1FYCA 2HDLA 4HTHA 1D6EC 5EBCA 5FLXL 2Z6KA 4LUZA 4KD3A 3S2DH 3AFQA 1VQNA 1PFMA 1PZID 3DUZA 1IW7D 2CCZA 4MIUA 5DM63 2PPBC 1M1KC 4X3UA 1VMPA 2M9VA 1VCIA 5K36G 2EVBA 4A3GB 3PO3B 4ZK9B 4AYBE 1KHIA 3D4DA 1JE4A 3W1BA 2KENA 1XNRQ 3HKZG 4C3HG 4B3SQ 1PDQA 1EQTA 5ISRA 1SYBA 2BA0A 5IT9L 2F0HA 3RUZA 3KDFB 1QVFA 5I2YA 5ELNA 1TWCB 4P71A 1CK1A 2NUCA 2WACA 3GTLH 5D14A 4DNIA 1I4GA 1HQRD 3BZKA 3OMGA 3MEFA 2VS1A 5ELCA 1Y8OB 2SEBD 4AQYQ 3UE0A 2B63B 3I4OA 4PNYA 5CBEE 2MHVA 5GADC 2JA5G 1K83B 1XPOA 1IKLA 4RG1A 4A3CH 1RODA 1V8QA 3CCRA 1HNXQ 2N78A 3LWUA 1BCPC 3MHBA 2FXQA 2K50A 3OIQA 1V1PA 4LWCA 1TWGH 3SXHA 4QUFA 5IYCH 4HJ9A 2HHHQ 5JJIA 4DR1L 3M85A 2Q2IA 1F9SA 2UXBL 3KF8B 1EYAA 1J5EQ 3KOJA 1IW7C 3I7FA 1NBWA 1XNQQ 3HP3A 5FO9B 2PZWA 2K5NA 4KK7A 3S1RH 1PYWD 4DUZQ 1VQOA 1KLGD 4NW2A 4IUTA 1E1TA 4HEDA 4DGZA 4YIJA 4P74A 4ZKCB 4JI6L 3RN2A 3TZDA 3VR3A 2WP8J 3GTOB 1LTSD 4LJZC 1NAPA 1QZGA 2SNMA 1E22A 1SFOH 1VQ5A 5C4HA 1RIPA 1RL2A 1JJCB 4DAYA 4EQ5A 2F0JA 3L7ZC 4Z9CB 1MHWC 4FNFA 4X3TA 5CV9A 5M9OA 1LTGD 4HIMA 3SEBA 3MXPA 5JJKA 2D0PA 4WRDA 1LACA 4X64Q 5EKIA 5IP9G 4GZYC 3VYUA 1JJ2A 1SBBB 4RCOA 2VY3A 3FPUB 1PH8A 1I4HA 4H0LC 5FLMG 4A3DB 1A2UA 4CBVA 1YJ9A 1LTID 2K33A 3U9OA 2NVXB 4PMCA 2K52A 3T56B 1JOOA 2AUJD 3WWVA 2L4NA 1TY2A 4KD4A 1QB5D
chains in the Genus database with same CATH topology
1H9RA 4L8JA 1XTCD 1PRTB 2PW7A 2AQ1B 5LHY1 5FKAC 4DN4M 4N9TA 2B2TA 1B4OA 2RDGA 3Q0AA 3CRKC 3JAME 2SNSA 1WTPA 4C3IG 1BOSA 3S1NB 1BDOA 2K03A 5KNBA 3GD7A 5CYUA 2NN6H 1CZGA 1Y1VB 5I9PA 3TSSA 4BS9A 4FP5D 1STGA 1U4PA 4H44C 2D62A 3Q24A 3HOYB 1W6KA 4KI0A 1EIHA 1LT6D 4C1NK 2N55A 3C1FA 2LMCB 1XX8A 2FINB 1PTOD 3WOEA 2F0LA 4B08A 2QDBA 1B53A 2L5TA 1CI3M 1EOTA 1AFPA 2K6AA 5C4ZA 2QKIC 4K2LA 2NBFA 1FNWA 2SOBA 1ZEQX 1TWAB 3D31A 2BCOA 1PZJD 3QB3A 3GO5A 4X3SA 5CORA 1YNJD 4IUNA 2FFKB 3P1HA 3PUXA 4XYQA 4I7ZC 3HEJA 3OIPA 5AFWA 4MHEA 4Y7NB 3I72A 1SMYD 3HS0C 3D8GA 3KF8A 2MPMA 5IODA 2K1BA 4A3MB 3WDNA 4IUVA 1D5XC 2XRQD 3G6JB 1G291 1Q3LA 5F2DA 4K14A 2C5CA 1PTOC 4K6DA 3QO2A 4EQNA 1UEAB 5BN5A 4I65A 4XQQA 2Z4HA 3BYTB 5IIFA 2F0FA 1NR2A 2J0TD 1Y8PB 1EYCA 3MFYA 5J39A 2EYHA 4C1NI 2HCCA 1YNJC 3A8KE 2BA1A 2FMCA 3HOUB 3X3MA 3TP5A 3DWQA 2LY7A 1VF7A 3DHQA 3PUZA 1SMYC 1EYDA 5HGTA 2F0PA 2L11A 1DZ1A 2CQAA 4G57A 1STBA 2IX3A 2I07B 4FF1A 5K36H 1CQFA 3GTPB 1LO5D 3R8BA 2CW0D 4JK1C 3OSOA 3VYTA 1SYDA 1D1KA 3RLFA 2IL8A 3KLSX 4L63B 4DXFA 1GUNA 2O5JC 1SEBD 4B9XA 2ZXRA 5EKLA 3NK9A 3GTGB 1EZ8A 5J22A 2IX1A 1JCKB 4F87A 2AUKA 4DXGA 2X6LA 4TRDA 5FOBB 1PLFA 5C3WA 2FJ2A 3A7LA 4NDXA 1SAPA 1D2BA 3V96A 3PUWA 3O13A 3A8IE 4E6IA 1EY0A 1FNVA 4X3KA 1ENFA 1PFBA 2ZXOA 4K8JA 1ICWA 1HXYD 2X6GA 2PW5A 2CW0C 1QNKA 3Q23A 3KLSA 4DK1A 3GQBA 5KYLA 2DY8A 1TS3A 3TP7A 1MI2A 3NWSA 2N88A 1HA6A 1RTNA 3N6RA 1BF4A 1NUCA 3OW7A 4P2CB 1EU4A 4OGQC 5C0XH 2B2YA 3EJIA 4KN7C 1PMRA 3J80L 2PCFB 3W2DA 1CHQD 1EEID 1ML0D 2D2CC 1O7YA 1JQYD 2B2UC 3MXNA 3R3OA 2LS01 2F0DA 1X3QA 4A3BB 1BBXC 3K57A 4EGVA 3NUCA 2K28A 1U4LA 2F0EA 4EQOA 2NN6G 5E1FA 4U68A 3VYSA 2PYKA 2R93B 3RMHA 2YU9B 1CQVA 3D4RA 3H6MA 1SFOB 1EY8A 1SE2A 1G91A 4HR7B 2ZXPA 3GV6A 5D3DA 4C2MB 2QILA 3IL8A 3DMUA 4KV6A 5EGTA 2MP1A 1OXTA 1RF2D 2RVLA 2KVMA 2F0QA 2XVSA 5M3MB 1QOHA 2D5DA 3Q6SA 1GUTA 3X3NA 2EY5A 3QWNA 2AQ3B 3LWEA 4WJWA 1EU3A 4BWGB 2BDNA 3J7YW 1OXUA 1SE4A 1WTXA 4ME5A 3LNNA 4K5XA 5CV7A 3DM1A 1BQQT 3ONAB 1HUNA 5JPMC 3J7AV 2K32A 2PZTA 3PMFA 4LK1C 3KBGA 4A3IB 3NQTA 5I9OA 1Q8IA 2ENBA 3FEWX 3CKIB 2F0KA 2EYFA 3G7LA 4UAIA 5LL6X 1WTWA 1UAPA 1HUMA 4IALA 4XIGS 1F2MA 1Q12A 2EY1A 5ELDA 1RJTA 5JAVA 4NKLA 4A3KB 1TR5A 3PIP3 4DK0A 3V2TA 3TMEA 2NZ1D 4ILWA 3HOXB 1MSHA 3A56A 1XWEA 4NP5A 3WOFA 1QILA 3I4NB 1S5CD 5A2QE 4PV1C 2K7VA 4V190 5JVH3 1BCPB 2F0GA 4DA2A 1DCZA 3CHBD 1VMCA 1JWSD 4A3FB 3C46A 1GUGA 1MSGA 3SE0A 2L1BA 1L0YB 2EXZA 3E5SA 1JC7A 3BS1A 2NTTA 3PV0A 1IKMA 3NE5B 4BY1B 1R9TB 3MEHA 1Q1EA 5KYIA 1DJRD 5JVG3 4FF2A 2NN6I 3S1MB 1A3VA 3KBXA 1I6VC 1H9SB 5FLXE 3M4YA 4IZ8A 2A6HD 4BA2I 3M3YB 2O5IC 1S5BD 2QCPX 2EYJA 3S1QB 1B1ZA 2RSOA 4H13C 4IURA 1I6HB 3SK8A 4CJ2C 1V1OA 2F0SA 2I46A 4CKEA 5I4DA 3M7NA 1B44D 5KRUA 2NTSA 2MJ8A 5IT9E 3IAYA 1AW7A 3OWEB 2NVQB 2KA7A 5G3LF 3MFGA 4RCNA 1DM0B 3Q22A 5FK9C 2R7ZB 1Z7TA 3BZDB 3MA2B 1F9RA 3R2IA 4ZAIA 4FXGC 2Q8RE 5CV6A 2IPKD 4FF3A 4K5WA 3BDOA 5KGUA 1VF5C 2A6HC 1WD0A 3MZ5A 2QEJC 3GTJB 1WTRA 1H9JA 5C0XG 2TMPA 4J1MA 3HKZB 4C3HB 4FVMA 2J7ZA 1TQOA 1KAAA 1I4XA 3VYRA 5EQ0A 2ICEC 2V4DA 2ZT9C 2E2JB 2KEEA 4IUPA 1A6XA 4ID6A 4RFBA 1D1IA 2KQ3A 4CKCA 4KJOA 2PZUA 1SNPA 1STAA 4Q5VA 5A35A 3K58A 5JOBA 2F3VA 3NBHA 2B2VA 3QG1A 3MVVA 2K5WA 1AZQA 2B2WA 2CHBD 5M5XB 2JXMB 3OWFA 3VR5A 1SJHD 4V0BA 3T53B 3HGBA 1CTMA 2E2HB 1B9MA 3E6ZX 2RKSA 1WTOA 5IGFA 2AQ2B 2DNEA 2Z4IA 2L12A 3BG3A 3IKJA 2KOLA 3TP8A 2NVTB 2EY2A 4PMBA 3GV3A 1LTBD 1QJOA 2DN8A 4C3JG 3FVQA 1PTOB 5D65A 1CA6A 1SNCA 2OT2A 4KN4C 5EPJA 3S9WA 1KDBA 2JSOA 2EJGC 1U4RA 1E2WA 4OHJA 1H9SA 5COYA 4ABNA 3N52A 2WV6D 4HCEA 5C0XJ 4EVOA 2VB2X 4ZLTF 3OMCA 3S17B 2JA6B 1TT2A 2JEAI 3BDCA 1QG7A 1SJED 2JA8B 3M7GA 4C3IB 2BE5D 1HPCA 4FF4A 1UNSA 3AU7A 4HSVA 4ZUJA 3GTKB 4F88A 5FO8B 2R3ZA 1QCBD 1C48A 1GUSA 3NSWA 1QWYA 2IW3A 5C0XI 3PO2B 3EFXD 4A93B 4ULLA 1DOKA 1K8MA 1Y8NB 1FGBD 4CGYB 5C6AA 3K59A 4JBWA 4XTCS 2K5QA 2O2LD 1J8IA 5KEEA 5E4XA 1HRJA 1JICA 1WD1A 1EY9A 2A68D 1UUPA 4IQZA 2AWNA 3H94A 2EYOA 1S4ZA 1T5EA 5C3EB 4XDXA 1EFID 3FMCA 1WVLA 3GTMB 2ICIA 3NTHA 1G2TA 2BE5C 2IT1A 3RZDB 2Z8LA 4HN7A 3KK7A 5C5LA 1ENAA 5CGKA 5BN3A 4PQXA 1XYIA 4XYOA 3MXUA 5LL6S 1D5ZC 2B2YC 1EY7A 1LTTD 2G9DA 2DNCA 1AP0A 1KTKA 4FXKC 5EPLA 1E0BA 2B8FA 2K5DA 1BO0A 4TQUS 2A68C 1X3PA 3C2PA 2E74C 1BUVT 4RKLA 4BY7B 3OHXC 3IFTA 4UDUC 4BA1I 5G3LD 3S2DB 5JPNC 5C4JB 1CT1D 1PXUA 2KCNA 3C1EA 1E2VA 1HQMC 1NCVA 2A6ED 1SYCA 1H9MA 3U9SA 3HRZC 3OPOA 4CHTB 4A3EB 2EJFC 1I4PA 1TS2A 3K0YA 1I4QA 3DWPA 1LTAD 4J8QA 3J81L 3GTLB 4IFDG 4U673 5IOCA 1SYGA 3PUVA 1EQVA 3J7AF 2H4OA 5EPKA 1VDZA 2F0UA 4RAUC 4HMJA 5K5PA 3K5MA 2NB0A 1TWGB 3IFDA 3BVMA 2L9HA 3P7JA 5DEHA 5ELEA 3K5LA 1OXSC 1HCZA 3EA6A 1A3TA 3S1RB 2CVRA 2F0OA 2KJXA 3I4LA 3AMUA 1OO9B 2A6EC 4TSSA 1Q1BA 1TU2B 2KUMA 1C8CA 4DFAA 4DNRB 3SHLA 4XQNA 2F0VA 2EE1A 3J80E 3QIAA 1ILPA 2F3WA 1PRTF 1F77A 3QJYA 3OOCA 3I91A 4XXEA 1LT4D 4LMQD 1JOQA 2HUGA 5E4WC 4K5VA 2E75C 3MTSA 1BXTA 2GA4B 2F4IA 5CV8A 4HAEA 2SDFA 4ZYSA 1WTQA 1CZWA 5I2XA 1S5ED 5EBDA 1R4PB 2EOTA 1G2SA 4FXDA 4KHVA 1LTRD 4IUUA 1KNEA 5M5YB 2FMMA 3R93A 1BNZA 3T16A 1B50A 4B9WA 2JE6I 2R92B 1DOMA 4KHZA 5NUCA 2E76C 2KECA 3CQZB 3FPPA 2XWBB 2B39A 1DOLA 3SK4A 4ODGA 4QB4A 3P75A 3HOWB 1KDAA 1Z47A 3EVQA 4ZQ3A 1U4MA 1ENCA 5CC4A 3EQLC 1GOZA 1SYFA 3S14B 5IGCA 2XIWA 4IFDI 2B8GA 3L9AX 1RKNA 2OXPA 3NBIA 1ZKOA 2WINB 4OO1H 1EIGA 2JYOA 3GP7A 4RGOS 1JR0D 1O80A 2EY6A 1A2TA 4OIJA 2O4XA 1J9OA 5KNDA 2HDMA 4Q0FA 5E3FA 1IHZA 4KY7A 2R6GA 2XRSD 1PZKD 1B2TA 3GTQB 2Q8IB 3TP6A 2WKDA 2NWGA 3D6CA 3ITPA 1B3AA 3M4OB 5CV5A 1X32A 1SE3A 1Y69U 3V05A 1GUWA 3ND8A 2HCIA 2R61A 3SR1A 1O78A 1FR3A 1Y1WB 3SK6A 1ZYRD 1G8ZD 1T5XD 4FO2A 2B2VC 2B2TC 2B2WC 1LV9A 3DWAA 2RBMA 5JEAH 2E2DC 2PQEA 3A54A 5EKKA 2RA4A 1EY4A 1F9QA 4M1UB 1FD7D 2X69A 5C44B 4EQPA 4R8IA 3NHHA 3VA7A 4KY5A 3NP8A 2L0CA 1RHPA 1MBYA 4DU9A 4RHSA 4F8MA 5T1IA 2F0TA 3TN2A 1I4RA 3S16B 4KKTA 2IJ0A 1KNAA 2M00A 4RGMA 4QCLA 3L3OC 3RD4A 3D4WA 3C3LA 1Z6HA 1ZYRC 1RDPD 1QNUA 3VR4A 2IWHA 2JEBI 1F2LA 4IFDH 3F2UA 1PFNA 2BOSA 4BBRB 5TSSA 2YYZA 1G6ZA 2JA5B 4R9WA 3TZUA 3H3VC 5CMDA 3BVGA 1W6JA 3I70A 3QOJA 2Q8TA 2M2LA 4DAVA 1LT5D 3JAML 3DXJC 2K05A 4KMUC 1SYEA 2A74C 1ET9A 2TSSA 1LLRD 1SSOA 1Q90A 2F03A 4DNTB 1PRTD 4K6LA 5KNCA 1DYQA 2A73B 1TKWB 1H9KA 4LAAA 2H1EA 3HG9A 2PO4A 2K01A 3A7AB 4RKBA 1HFGA 3FRPB 4TKOB 5EJWA 1D5MC 2F1MA 5IGDA 3SVMA 5J1ZA 1SNMA 3SK5A 1HHVA 3LX0A 3I8ZA 2JP1A 3HZXA 2RQXA 1SDFA 1TS4A 4ZUIA 3VR6A 3ERQA 4R8NA 4RWSC 1ESRA 4K8IA 3R2TA 4OIKA 4C56C 1AN8A 3T51B 1PRTC 1A15A 3VR2A 3FDTA 3K6OA 1HA5A 2WIIB 4OL7A 5M3FB 1NR4A 1GJXA 1FNUA 5ELFA 3AB9A 3KLRA 3NTKA 2Y0SB 4O42A 1JWMD 1JWUD 1C4QA 2OF1A 1QE6A 2A69D 4OO1G 1XXGA 3DEPA 4RHRA 5HURA 1K8OA 1IL8A 1S5DD 3D3RA 4KJNA 4DAPA 3P20A 1II3A 1YNND 4MN3A 2NYZD 2HQEA 4C3JB 2RSNA 2NVYB 3BDLA 3CU7A 1LABA 2ID0A 1TY0A 5IGGA 4G7HC 4F7XA 1CA5A 3NQIA 3S2HB 1F2ZA 4KY6A 4RGNA 2DY7A 1F2YA 2EYLA 3H91A 1BCPF 1MD2D 2D9UA 3E0JA 2LKVA 4WORA 2QF7A 1E2ZA 3TBIB 1KLUD 2A69C 1O7LA 3URYA 3H0GB 4XQJA 5I6YA 4DF7A 3NPPA 1ET6A 3QOLA 3BYYB 2WKCA 1RCVD 5JEAG 1DONA 4KKUA 1YNNC 1STHA 2XN9C 1GHKA 4HCSA 1HFNA 5DNFA 1RD9D 1A3UA 3W3AA 4QUCA 2RDFA 1EY5A 1IYUA 4IN3A 1DXMA 4ZRZA 3MAQA 2KCCA 4S3SA 4XT3B 4K2KA 1TWHB 3MXGA 2EYMA 2XSCA 1TIID 3A55A 5C3XA 1B9NA 3HOVB 5JJZA 3ND9A 3ZYYX 1AZPA 1HTPA 5ELBA 1I3QB 4M8AA 1TS5A 1TVXA 2WB1B 5C5MA 4KTAA 4FYDA 3DEOA 1EWHA 4G7OC 3K5NA 1RTOA 2MGSA 3VA5A 4G7ZC 2Z1CA 1JB3A 5BN4A 1V43A 5CBAE 2EDGA 3NWTA 3I3CA 1BR9A 1R4QB 2G9HD 2WAQB 2PNRC 1L0XB 2RDHA 5M5WB 3J81E 4OO1I 4A3JB 1OXXK 2C9OA 5IGBA 2VB3X 3PUYA 1SNQA 1LT3D 1EZ6A 2PMZB 2VXWA 1AEXA 2F0IA 3FKIB 2F0WA 1CM9A 1ESFA 3EROA 1EWCA 5IGEA 1IYVA 2KHSA 3NXWA 4HMIA 4BBSB 1STYA 3T13A 1STNA 4J6HA 2VUMB 1PTOH 1NSNS 4KKSA 4O1NA 3TDQA 5JEAJ 4RH6A 5FO7B 5T1GA 1F9PA 1JORA 2F0MA 4WFN3 3MC0B 1HTLD 2FHTA 5KIXA 3K5OA 5DAUA 4PMWA 1CFMA 3T4AC 4ZKBB 1WTVA 3CRLC 2VNUD 2A5HA 5D3IB 1V1PB 3MWYW 2EPBA 2IX0A 5CV4A 1SXTA 2XWJB 3H09A 3K7AB 1EEFD 3BVZA 3HOZB 4QMGA 1JOKA 1ZXTA 1EY6A 2EJMA 3A8JE 1SNDA 1GXDC 4QIWB 5I6WA 4CJ1B 3KUPA 4NMZA 4RGTA 1GHJA 2E2IB 4IFDJ 1M8AA 1TWFB 1PTOF 1M4VA 2F0NA 2KEDA 1I50B 4CKBA 3I4MB 1DD2A 3RZOB 4QF4A 4RA8A 3S15B 1U9RA 1KABA 4N9PA 2J4XA 4HSPA 1OXVA 4AYBB 2EYPA 2B2UA 1ONLA 3SDZA 5CR3A 1KDCA 1WCMB 1MGSA 2EZVA 1STEA 1GUOA 2OEOA 5A2QL 1O7ZA 2L55A 4IUQA 1SNOA 2BDOA 2MUYA 2K04A 3UI2A 5C4XB 4G4KA 4H7BA 2XNAC 2JA7B 1CHPD 2LFNA 5DM73 4CJ0B 1EL0A 3I90A 4L6TB 4XT1B 3PIO3 2AWOA 3NTIA 1S5FD 1ILQA 3I73A 1BCPD 3D6WA 1FYCA 2HDLA 4HTHA 1D6EC 5EBCA 5FLXL 4KD3A 1PFMA 1PZID 3DUZA 1IW7D 4MIUA 5DM63 2PPBC 4X3UA 1VMPA 2M9VA 1VCIA 5K36G 2EVBA 4A3GB 3PO3B 4ZK9B 3D4DA 1JE4A 4C3HG 1PDQA 1EQTA 5ISRA 1SYBA 2BA0A 5IT9L 2F0HA 3RUZA 5I2YA 1TWCB 1CK1A 2NUCA 2WACA 5D14A 1I4GA 1HQRD 3OMGA 5ELCA 1Y8OB 2SEBD 2B63B 4PNYA 5CBEE 2MHVA 1K83B 1IKLA 1RODA 1V8QA 3LWUA 1BCPC 3MHBA 3OIQA 3SXHA 4QUFA 1V1PA 3M85A 1F9SA 1EYAA 1IW7C 3HP3A 5FO9B 2PZWA 4KK7A 1PYWD 1KLGD 4NW2A 4IUTA 4HEDA 4DGZA 4YIJA 4ZKCB 3TZDA 3VR3A 2WP8J 3GTOB 1LTSD 4LJZC 1NAPA 2SNMA 5C4HA 4DAYA 2F0JA 3L7ZC 4Z9CB 4FNFA 4X3TA 5CV9A 5M9OA 1LTGD 3SEBA 3MXPA 4WRDA 1LACA 5EKIA 4GZYC 3VYUA 1SBBB 4RCOA 3FPUB 1I4HA 4H0LC 4A3DB 1A2UA 4CBVA 1LTID 2K33A 3U9OA 2NVXB 4PMCA 3T56B 1JOOA 2AUJD 2L4NA 1TY2A 4KD4A 1QB5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQP A;  5EKL A;  3NK9 A;  3NHH A;  5ISR A;  1EZ8 A;  5J22 A;  1EY7 A;  1SYB A;  3DMU A;  4KV6 A;  3NP8 A;  4KY5 A;  5EGT A;  4ZQ3 A;  2F0H A;  1ENC A;  3RUZ A;  2PW7 A;  1TQO A;  5CC4 A;  1F2Z A;  1KAA A;  3D8G A;  4KY6 A;  4EVO A;  5IOD A;  4TRD A;  4DU9 A;  1SYF A;  1F2Y A;  2EYL A;  3OMC A;  4DFA A;  5IGD A;  4N9T A;  2EXZ A;  2F0Q A;  2NUC A;  5C3W A;  3E5S A;  4QF4 A;  3SHL A;  5J1Z A;  2LKV A;  1RKN A;  2OXP A;  2WAC A;  4WOR A;  4J1M A;  2F0V A;  4NDX A;  2F0T A;  1SNM A;  3OMG A;  5F2D A;  3S9W A;  1TT2 A;  4K14 A;  3SK5 A;  2EY5 A;  5IGB A;  2SNS A;  2F3W A;  4K6D A;  3LX0 A;  4E6I A;  1SNQ A;  1U9R A;  1KAB A;  3BDC A;  4ID6 A;  4N9P A;  1EY0 A;  4EQN A;  1EZ6 A;  2KQ3 A;  1AEX A;  2M00 A;  3MEH A;  4KJO A;  2PZU A;  2EY6 A;  1A2T A;  4PNY A;  1SNP A;  2F0I A;  4I65 A;  5I6Y A;  4DF7 A;  3HZX A;  3D4W A;  4K8J A;  1STA A;  2F0W A;  2EYP A;  4RKL A;  3QOL A;  2O4X A;  3ERO A;  4ME5 A;  4ZUI A;  4K5X A;  5CR3 A;  5IGE A;  5KYI A;  1KDC A;  2KHS A;  3ERQ A;  3NXW A;  4R8N A;  4HMI A;  5CV7 A;  2PW5 A;  1JOQ A;  1A3V A;  3MHB A;  5JOB A;  1STY A;  5E3F A;  2F3V A;  4K5V A;  1IHZ A;  3SXH A;  2F0F A;  1STN A;  3T13 A;  5IIF A;  4J6H A;  1STH A;  4IZ8 A;  4K8I A;  4ZUJ A;  1NSN S;  4KY7 A;  5C5M A;  5KYL A;  2PZT A;  5I9P A;  1EYC A;  2OEO A;  3PMF A;  3TP7 A;  1EYA A;  1A3U A;  3MVV A;  3C1E A;  2RDF A;  5CV8 A;  2EYJ A;  5J39 A;  2EYH A;  3SK8 A;  1EY5 A;  1SNO A;  1STG A;  3OWF A;  3TP6 A;  3NQT A;  5I9O A;  2ENB A;  1NUC A;  2F0S A;  4OL7 A;  2PZW A;  1SYC A;  3TP5 A;  3D6C A;  3ITP A;  4S3S A;  1JOR A;  4H7B A;  2F0M A;  5KRU A;  4KHV A;  4K2K A;  3DHQ A;  5CV5 A;  3C1F A;  2F0K A;  2EYF A;  3EJI A;  4DGZ A;  4YIJ A;  5C6A A;  2EYM A;  2OF1 A;  3QOJ A;  2RKS A;  1EYD A;  5KIX A;  5DAU A;  5IGF A;  5IOC A;  1SYG A;  2F0L A;  5C3X A;  3SR1 A;  5HGT A;  5KEE A;  4IAL A;  1EQV A;  2QDB A;  2F0P A;  1F2M A;  2SNM A;  1EY9 A;  2EY1 A;  3R3O A;  5HUR A;  3T16 A;  2F0D A;  4G57 A;  1STB A;  1SYE A;  5C4H A;  2F0U A;  4B9W A;  5CV4 A;  3SK6 A;  2F0J A;  2EYO A;  4KJN A;  3TP8 A;  3NUC A;  5IGC A;  5JAV A;  2EY2 A;  4HMJ A;  4NKL A;  4PMB A;  1TR5 A;  5K5P A;  2F0E A;  5NUC A;  4QMG A;  5CV9 A;  5C4Z A;  5M9O A;  4EQO A;  3OSO A;  4K2L A;  3V2T A;  1II3 A;  4HTH A;  5E1F A;  3MXP A;  3TME A;  1JOK A;  4F7X A;  2HQE A;  1SYD A;  2SOB A;  4KD3 A;  4WRD A;  1EY6 A;  1SNC A;  5CV6 A;  2PYK A;  1SND A;  3QB3 A;  2RBM A;  4K5W A;  5DEH A;  5KGU A;  2PQE A;  5C5L A;  4MIU A;  1ENA A;  5I6W A;  3BDL A;  4KTA A;  4NP5 A;  5EKK A;  1A2U A;  1KDB A;  3H6M A;  4LAA A;  4ODG A;  4NMZ A;  3SK4 A;  4F8M A;  5CGK A;  1EY4 A;  4IUN A;  3P1H A;  3VA5 A;  3U9O A;  1EY8 A;  3MZ5 A;  4PMC A;  3P75 A;  4QB4 A;  3D4D A;  4RKB A;  5IGG A;  1JOO A;  1A3T A;  1KDA A;  2F0G A;  2F0N A;  4B9X A;  4KD4 A;  3HEJ A;  2F0O A;  3EVQ A; 
#chains in the Genus database with same CATH topology
 2PQA A;  2Q2U A;  4FDB A;  1H9R A;  4L8J A;  1XTC D;  3DM3 A;  2UUA Q;  1PRT B;  2PW7 A;  4R1J A;  2AQ1 B;  5LHY 1;  5FKA C;  4DN4 M;  1IZ6 A;  4N9T A;  3EIV A;  2B2T A;  1B4O A;  2QW7 A;  2RDG A;  5M5Y H;  3Q0A A;  4IPH A;  4GLX A;  3CRK C;  3ICE A;  1UEB A;  2R7F A;  3JAM E;  2SNS A;  1WTP A;  4C3I G;  1BOS A;  4A3I H;  2R92 H;  3S1N B;  1BDO A;  2K03 A;  5KNB A;  3CXC A;  2UU9 L;  3CQZ H;  3GD7 A;  5CYU A;  2NN6 H;  4LF7 L;  1CZG A;  1Y1V B;  2WFW A;  4EX5 A;  5I9P A;  3TSS A;  1IBM Q;  4BS9 A;  1XMQ Q;  4FP5 D;  1STG A;  1U4P A;  4H44 C;  2D62 A;  3PO2 G;  3Q24 A;  3HOY B;  1A8V A;  1VQI A;  1W6K A;  4KI0 A;  5HY6 A;  4JI8 Q;  1K0R A;  1EIH A;  5IT9 c;  1LT6 D;  1PH4 A;  4C1N K;  2N55 A;  3C1F A;  2LMC B;  1XX8 A;  2E5L Q;  3F2B A;  2FIN B;  1XJV A;  1DGS A;  1KAW A;  3S14 H;  1PTO D;  3WOE A;  2F0L A;  1PH1 A;  4B08 A;  2QDB A;  1XNR L;  1B53 A;  2L5T A;  1CI3 M;  4B3S L;  5C3E G;  2KCM A;  1B3Q A;  1EOT A;  1WYD A;  3PF5 A;  1AFP A;  2Q2T A;  2K6A A;  3T1Y Q;  5C4Z A;  2QKI C;  4K2L A;  1XTD A;  2NBF A;  1AE3 A;  2IHF A;  1FNW A;  2SOB A;  1ZEQ X;  1TWA B;  3D31 A;  2BCO A;  4JVZ A;  1PZJ D;  3QB3 A;  3GO5 A;  4B3R Q;  4X3S A;  5COR A;  4AQY L;  1YNJ D;  3AQQ A;  3H0G G;  4IUN A;  2FFK B;  3KF6 B;  3P1H A;  3GTQ H;  4GKJ Q;  3PUX A;  4XYQ A;  3G71 A;  4I7Z C;  1HNX L;  3HEJ A;  3OIP A;  5AFW A;  3CC4 A;  2VL6 A;  3MXN B;  4MHE A;  4Y7N B;  2HHH L;  3M4O H;  1Q8K A;  3I72 A;  2ZJR A;  4DV5 Q;  1VQK A;  1SMY D;  3HS0 C;  3D8G A;  3KF8 A;  2MPM A;  5IOD A;  2K1B A;  2ZJP A;  4A3M B;  3WDN A;  1VQ4 A;  4IUV A;  3TS0 A;  1J5E L;  3S1M H;  1D5X C;  2XRQ D;  1XNQ L;  3G6J B;  1G29 1;  1Q3L A;  5F2D A;  4K14 A;  3M3Y H;  2C5C A;  1PTO C;  3UDG A;  2K5H A;  4K6D A;  1H95 A;  4DUZ L;  3QO2 A;  4EQN A;  3S1Q H;  1UEA B;  4HJ7 A;  1I6H H;  5BN5 A;  3I56 A;  2I0Q A;  4I65 A;  2G5D A;  4GN3 B;  3BJU A;  4DV3 Q;  3K81 C;  3RN5 A;  4XQQ A;  2Z4H A;  4GOP B;  3BYT B;  5IIF A;  2F0F A;  2CWP A;  1L1O C;  1NR2 A;  2J0T D;  1Y8P B;  1EYC A;  2NVQ H;  3CCJ A;  3MFY A;  3W5O A;  5J39 A;  1N8R C;  2EIF A;  2EYH A;  4C1N I;  2HCC A;  1YNJ C;  3A8K E;  2BA1 A;  4A3E G;  2FMC A;  2R7Z H;  3HOU B;  3X3M A;  3TP5 A;  3DWQ A;  1K9M C;  4OWX B;  2LY7 A;  1VF7 A;  1QVC A;  5C44 H;  4X64 L;  3DHQ A;  3E0E A;  3PUZ A;  4JI4 Q;  3Q8D A;  1SMY C;  1EYD A;  3ULJ A;  5HGT A;  4JW0 A;  4MTN A;  1HR0 W;  2F0P A;  2L11 A;  1DZ1 A;  2CQA A;  1HNW L;  4IPG A;  4G57 A;  1STB A;  2IX3 A;  3S16 H;  4A3C G;  2I07 B;  4FF1 A;  5K36 H;  1CQF A;  2UUA L;  3GTP B;  1LO5 D;  3R8B A;  2CW0 D;  1T9H A;  1JMC A;  5IYC G;  4JK1 C;  1NMF A;  3OSO A;  3CPF A;  3VYT A;  4C3H H;  3SGI A;  1SYD A;  1D1K A;  3RLF A;  1VQP A;  2IL8 A;  4LNQ A;  3KLS X;  4GLA C;  4L63 B;  2E2J H;  2VQF Q;  2RCF A;  2K4K A;  2RF4 A;  4DXF A;  1GUN A;  2O5J C;  1YHB A;  1SEB D;  4B9X A;  2ZXR A;  4OWW B;  5EKL A;  3NK9 A;  3GTG B;  1EZ8 A;  5J22 A;  4YWK A;  2IX1 A;  1JCK B;  2JA5 H;  4QQB X;  4F87 A;  2AUK A;  4DXG A;  2X6L A;  4DK6 C;  4TRD A;  5FOB B;  1PLF A;  1IBM L;  1VQF A;  1Q86 C;  5C3W A;  2FJ2 A;  2HIX A;  1XMQ L;  3A7L A;  1YJW A;  4NDX A;  2UXD Q;  1PH9 A;  1SAP A;  1D2B A;  4NB3 A;  3V96 A;  3PUW A;  3O13 A;  3A8I E;  1YI2 A;  3ULL A;  4LF8 Q;  4JI8 L;  4E6I A;  3CP0 A;  1EY0 A;  2K5V A;  5M5X H;  1FNV A;  4X3K A;  1ENF A;  2PI2 E;  1PFB A;  3CCS A;  2ZXO A;  4K8J A;  2E5L L;  1ICW A;  1HXY D;  2X6G A;  1CKN B;  2PW5 A;  3E9I A;  2CW0 C;  1QNK A;  3Q23 A;  3KLS A;  4DK1 A;  3GQB A;  5KYL A;  2DY8 A;  1X9N A;  1TS3 A;  3TP7 A;  1MI2 A;  1Q7Y C;  3NWS A;  2N88 A;  1HA6 A;  1RTN A;  3N6R A;  3T1Y L;  1BF4 A;  4DK3 C;  1NUC A;  3A0J A;  3OW7 A;  1MKH A;  2NZH A;  3B6Y A;  4P2C B;  1EU4 A;  4OGQ C;  5C0X H;  2NVT H;  1YJN A;  4GLV B;  3EBE A;  3I55 A;  2B2Y A;  3EJI A;  3KF6 A;  4YWL A;  4KN7 C;  1PMR A;  1C0A A;  2IY5 B;  3J80 L;  4GKJ L;  2YTX A;  1YHQ A;  2PCF B;  3W2D A;  1CHQ D;  1EEI D;  1ML0 D;  1W3S A;  2D2C C;  1O7Y A;  1JQY D;  2B2U C;  3MXN A;  3R3O A;  2LS0 1;  2I5H A;  2F0D A;  1X3Q A;  4A3B B;  5FLM H;  4A4I A;  1BBX C;  4MZ9 A;  3K57 A;  2R92 G;  2JQO A;  4EGV A;  3NUC A;  2K28 A;  4DV5 L;  1U4L A;  4DR7 Q;  2F0E A;  4ME3 A;  4EQO A;  2NN6 G;  5E1F A;  4YWM A;  4U68 A;  3VYS A;  2ALY B;  2PYK A;  2R93 B;  3RMH A;  3PIP A;  2YU9 B;  1CQV A;  3D4R A;  3H6M A;  1SFO B;  3KFU A;  3S17 H;  3HOW G;  3FP9 A;  1EY8 A;  1SE2 A;  1G91 A;  4DV3 L;  1VQD A;  4HR7 B;  1VQJ A;  4GOP A;  2ZXP A;  3GV6 A;  3W1G A;  5D3D A;  5M3F H;  4C2M B;  1AH9 A;  1CKM A;  1WJJ A;  2QIL A;  3IL8 A;  3DMU A;  4KV6 A;  5EGT A;  4C3I H;  2MP1 A;  2JA9 A;  1OXT A;  1RF2 D;  2RVL A;  3TQY A;  2KVM A;  2F0Q A;  2DUD A;  2XVS A;  1SRU A;  5M3M B;  4P73 A;  1QOH A;  4JBK A;  3Q6S A;  2D5D A;  1GUT A;  3X3N A;  2ZTD A;  3CW2 C;  3GTK H;  2EY5 A;  3M4P A;  1N34 Q;  3QWN A;  2AQ3 B;  3LWE A;  4WJW A;  1EU3 A;  4BWG B;  4HID A;  3GDE A;  2BDN A;  3J7Y W;  1CKO A;  1OXU A;  2Z6K C;  1SE4 A;  1WTX A;  4ME5 A;  4JI4 L;  3LNN A;  4K5X A;  3PO2 H;  5IYB H;  1YZ6 A;  5CV7 A;  3DM1 A;  1BQQ T;  3ONA B;  1K0S A;  1HUN A;  5JPM C;  2JK8 A;  4C3J H;  3J7A V;  2K32 A;  2PZT A;  2NVY H;  3PMF A;  5LMN Q;  4LK1 C;  1PH6 A;  3KBG A;  4AIM A;  4A3I B;  3NQT A;  5I9O A;  1Q8I A;  2ENB A;  4JG2 A;  3FEW X;  5ELO A;  3CKI B;  2F0K A;  4R4T A;  2EYF A;  3S2H H;  3G7L A;  4IJH A;  4UAI A;  4P75 A;  5LL6 X;  2VQF L;  1WTW A;  4X65 Q;  1FJG Q;  1UAP A;  1HUM A;  4IAL A;  2OQK A;  4XIG S;  1F2M A;  1Q12 A;  2EY1 A;  3NBH B;  5IWA Q;  1Y1W G;  5ELD A;  5HGQ A;  1NY4 A;  2ZTE A;  1RJT A;  3PCO B;  1VS0 A;  2LXK A;  1Q81 C;  2Z9H A;  3H0G H;  3G48 A;  5JAV A;  4NKL A;  4A3K B;  1TR5 A;  3PIP 3;  3CCM A;  4DK0 A;  3V2T A;  3TME A;  2NZ1 D;  3J81 c;  5JJL A;  4ILW A;  3HOX B;  2UXD L;  1MSH A;  3A56 A;  1XWE A;  1S3O A;  4LF8 L;  4NP5 A;  3WOF A;  1QIL A;  3I4N B;  1S5C D;  1L2F A;  4YCV A;  5A2Q E;  1KD1 C;  4PV1 C;  2B3G A;  2K7V A;  1VQ6 A;  2IHE A;  4V19 0;  1E24 A;  1WI5 A;  5JVH 3;  1BCP B;  2A1A A;  1CKN A;  5C44 G;  2F0G A;  1DCZ A;  4DA2 A;  3CHB D;  1VMC A;  1JWS D;  4CDC C;  4A3F B;  1PH7 A;  1HR0 Q;  3C46 A;  1GUG A;  1WFQ A;  1MSG A;  3CC7 A;  1TWH H;  3SE0 A;  2L1B A;  3PF4 A;  1L0Y B;  2EXZ A;  1EYG A;  1NTG A;  1JC7 A;  3E5S A;  3J80 c;  3G4S A;  3BS1 A;  2NTT A;  1EQR A;  3PV0 A;  1IKM A;  1IYJ B;  5C4J H;  3NE5 B;  4JPB W;  3HOV H;  4JYA Q;  4BY1 B;  1R9T B;  3MEH A;  1Q1E A;  4GN5 A;  1C9O A;  2L15 A;  1W2B A;  5KYI A;  4DV1 Q;  1DJR D;  5JVG 3;  4A3E H;  4FF2 A;  2NN6 I;  1I3Q H;  3S1M B;  1A3V A;  3KBX A;  1I6V C;  1H9S B;  5FLX E;  3M4Y A;  4IZ8 A;  2A6H D;  4BA2 I;  3M3Y B;  2O5I C;  1S5B D;  2QCP X;  2EYJ A;  4PZ8 A;  3S1Q B;  1B1Z A;  2RSO A;  4H13 C;  4IUR A;  4BBR G;  3SK8 A;  1I6H B;  4CJ2 C;  4DR7 L;  1V1O A;  2F0S A;  2I46 A;  3F8T A;  4CKE A;  5I4D A;  3M7N A;  1B44 D;  5KRU A;  2NTS A;  2MJ8 A;  5IT9 E;  3IAY A;  1AW7 A;  2PNH A;  2GN5 A;  4GKK L;  3OWE B;  2NVQ B;  2QA4 A;  2CFM A;  2VZA A;  5M5W H;  2KA7 A;  2B29 A;  5G3L F;  3MFG A;  4RCN A;  5EAY A;  3OTO Q;  1DM0 B;  4GS3 A;  3Q22 A;  5FK9 C;  4A3J H;  2R7Z B;  1XPU A;  1X55 A;  1Z7T A;  3BZD B;  2BH8 A;  1B70 B;  4H02 A;  4JI7 Q;  3MA2 B;  4JI1 Q;  1D8L A;  1F9R A;  3R2I A;  1GKH A;  3F2C A;  4ZAI A;  4FXG C;  2Q8R E;  5CV6 A;  2IPK D;  1N34 L;  4FF3 A;  4K5W A;  3BDO A;  1K28 A;  5FJ8 H;  5KGU A;  1VF5 C;  2A6H C;  1WD0 A;  3MZ5 A;  1BBW A;  1VQM A;  2QEJ C;  3GTJ B;  1WTR A;  1H9J A;  5C0X G;  5DLQ E;  2TMP A;  4J1M A;  1G51 A;  4PZ6 A;  3HKZ B;  3STB D;  4C3H B;  4FVM A;  1M90 C;  3K8A A;  2J7Z A;  1TQO A;  1KAA A;  1UE5 A;  2AHO B;  1GVP A;  1I4X A;  3VYR A;  5LMN L;  3J81 i;  1VQG A;  2Z6B A;  2ICE C;  5EQ0 A;  2V4D A;  2ZT9 C;  2E2J B;  2YTY A;  3M4Q A;  2KEE A;  4IUP A;  4DR2 Q;  1AE2 A;  1A6X A;  4ID6 A;  4RFB A;  1D1I A;  2KQ3 A;  4CKC A;  4KJO A;  2PZU A;  1SNP A;  1STA A;  1HNW Q;  4DUY L;  1NE3 A;  4Q5V A;  4R4Q A;  3HOZ H;  5A35 A;  3K58 A;  4JI0 Q;  1XPR A;  5JOB A;  2F3V A;  4X65 L;  1FJG L;  3NBH A;  4LFB Q;  2B2V A;  5IWA L;  4B3T Q;  1X3G A;  3J80 i;  3QG1 A;  3MVV A;  4QY7 A;  2K5W A;  1AZQ A;  4CDD C;  2B2W A;  2CHB D;  1X3F A;  5M5X B;  2JXM B;  4DV6 Q;  1PVO A;  3OWF A;  3VR5 A;  5M3F G;  1SJH D;  2E2I H;  4MTK A;  2F4V Q;  1Q46 A;  1PFS A;  2Y0S G;  4V0B A;  3CCQ A;  1I50 H;  1G6P A;  3T53 B;  3HGB A;  3STB C;  3I4M H;  1CTM A;  2E2H B;  3RZO H;  1B9M A;  3E6Z X;  2RKS A;  2GVB A;  1WTO A;  5IGF A;  4TVA B;  5GAH C;  2AQ2 B;  2DNE A;  2Z4I A;  4IOC A;  2L12 A;  4UP7 A;  3BG3 A;  3HKZ E;  4QGU A;  3IKJ A;  1HR0 L;  2KOL A;  5IYB G;  3TP8 A;  3HOW H;  2NVT B;  3AEV A;  2EY2 A;  4PMB A;  2UUC Q;  3GV3 A;  2OQ0 A;  1LTB D;  1QJO A;  2DN8 A;  4A3M G;  4C3J G;  3K80 C;  1WCM H;  3FVQ A;  1PTO B;  5D65 A;  1CA6 A;  5LMU Q;  4JI5 Q;  1SNC A;  3T1H Q;  1PYB A;  3L2P A;  2QEX A;  2OT2 A;  4KN4 C;  5IP7 G;  1X54 A;  5EPJ A;  3S9W A;  4JYA L;  1KDB A;  2JSO A;  2EJG C;  4LF4 Q;  1U4R A;  1E2W A;  4DV1 L;  4OHJ A;  3KDF A;  3KJP A;  1H9S A;  5COY A;  1L1O B;  4ABN A;  1K3B C;  4HIO A;  3N52 A;  5C4X H;  2WV6 D;  4HCE A;  5C0X J;  4EVO A;  2VB2 X;  4ZLT F;  2JA7 H;  3OMC A;  3UE1 A;  3S17 B;  2JA6 B;  4OON A;  1TT2 A;  2JEA I;  2EQS A;  4A3L H;  1CSQ A;  3BDC A;  1QG7 A;  1KL9 A;  1SJE D;  2JA8 B;  3TRZ A;  4AH6 A;  3M7G A;  4LF6 Q;  4C3I B;  1PV4 A;  2BE5 D;  1HPC A;  4FF4 A;  1JJG A;  1UNS A;  4O2D A;  3AU7 A;  4HSV A;  4ZUJ A;  3OTO L;  2DJF C;  3GTK B;  4F88 A;  5FO8 B;  4NXM Q;  2R3Z A;  1QCB D;  4DV4 Q;  1C48 A;  2HIV A;  1GUS A;  4HJ8 A;  5IYD H;  2VQE Q;  3NSW A;  4JI7 L;  1QWY A;  3PO3 H;  4JI1 L;  2IW3 A;  5C0X I;  3PO2 B;  1Y1W H;  4UP8 A;  4OEM B;  3EFX D;  4A93 B;  4ULL A;  4POF A;  2DJG C;  1DOK A;  1K8M A;  1Y8N B;  3VDY A;  1FGB D;  4CGY B;  5C6A A;  3K59 A;  4JBW A;  4XTC S;  2K5Q A;  2O2L D;  1J8I A;  1EUJ A;  5KEE A;  3HOV G;  1LTL A;  5E4X A;  1HRJ A;  1JIC A;  1WD1 A;  2I5M X;  1EY9 A;  2A68 D;  1VQC A;  2CKZ B;  1UUP A;  4IQZ A;  2AWN A;  3PSI A;  3H94 A;  2EYO A;  4DR4 Q;  1S4Z A;  1T5E A;  5C3E B;  4XDX A;  3CMA A;  3CPW A;  1EFI D;  2MFI A;  3FMC A;  1WVL A;  3GTM B;  1VQ9 A;  2ICI A;  3NTH A;  1G2T A;  2BE5 C;  3NEN A;  2IT1 A;  3RZD B;  1K73 C;  2Z8L A;  2WB1 G;  3FHW A;  4DR2 L;  4HN7 A;  3RNU A;  3KK7 A;  5C5L A;  1ENA A;  5CGK A;  5BN3 A;  3KYH C;  4PQX A;  1Q82 C;  1E7Z A;  1XYI A;  4XYO A;  3MXU A;  2ZJQ A;  5LL6 S;  2Y0S E;  1JT8 A;  1D5Z C;  2B2Y C;  1VQL A;  4JI0 L;  2WAQ G;  1YHA A;  1EY7 A;  1LTT D;  2G9D A;  4LFB L;  2JN4 A;  4B3T L;  1U0L A;  2DNC A;  1AP0 A;  1KTK A;  4FXK C;  5EPL A;  4A3J G;  1E0B A;  4L5R C;  4POG A;  4DV6 L;  4UP9 A;  4UPA A;  2I5L X;  2B8F A;  2K5D A;  1BO0 A;  2F4V L;  4TQU S;  3ZJY C;  3FKI G;  2A68 C;  1HH2 P;  1X3P A;  3C2P A;  2E74 C;  4BBR H;  1BUV T;  4RKL A;  4QJF A;  3OHX C;  1EOV A;  3IFT A;  4BY7 B;  4BBS G;  1IBK Q;  2UXC Q;  4UDU C;  1YEZ A;  4BA1 I;  5G3L D;  3S2D B;  2VUM G;  5FJ8 G;  3CF5 A;  4N8X 1;  1X3E A;  5JPN C;  4LUV A;  5C4J B;  1CT1 D;  1A0I A;  1PXU A;  2KCN A;  4A75 A;  3U50 C;  3C1E A;  4GOP C;  2QDL A;  4A3D H;  1E2V A;  1K8A C;  4NXN L;  2UUC L;  1XMO Q;  1HQM C;  2NVX H;  1NCV A;  2A6E D;  1SYC A;  1H9M A;  3U9S A;  3HRZ C;  3OPO A;  4CHT B;  4A3E B;  2EJF C;  2JJQ A;  1I4P A;  3M9B A;  1TS2 A;  3K0Y A;  5LMU L;  4JI5 L;  1I4Q A;  3T1H L;  3DWP A;  1Y14 B;  1LTA D;  4J8Q A;  3J81 L;  3GTL B;  4IFD G;  4U67 3;  5IOC A;  4GNX C;  1SYG A;  4LF4 L;  3CME A;  3PUV A;  1EQV A;  3J7A F;  2H4O A;  4JI2 Q;  5EPK A;  1VDZ A;  2F0U A;  3HOZ G;  4RAU C;  4HMJ A;  1LYL A;  5K5P A;  3K5M A;  3S1N H;  2R7D A;  2NB0 A;  1TWG B;  3IFD A;  4OWT B;  3BVM A;  2L9H A;  4JOI A;  3NEL A;  3P7J A;  2N49 A;  5DEH A;  4ZCK A;  3BU2 A;  4L5Q A;  5ELE A;  1FVI A;  3K5L A;  1OXS C;  2GVA A;  2MO0 A;  3AYH B;  4LF6 L;  1HCZ A;  4MNO A;  3EA6 A;  1A3T A;  2KBN A;  2OCE A;  3S1R B;  2CVR A;  3HOY H;  2F0O A;  2KJX A;  3I4L A;  3AMU A;  3I4M G;  1OO9 B;  2A6E C;  4UY8 C;  4TSS A;  1Q1B A;  3D0F A;  3ER0 A;  1QUQ B;  1TU2 B;  4NXM L;  2KUM A;  4DV4 L;  4QL5 A;  1C8C A;  4DFA A;  4DNR B;  3SHL A;  2VQE L;  4XQN A;  2KCT A;  2F0V A;  2EE1 A;  3J80 E;  4GKK Q;  3QIA A;  2CH4 W;  1ILP A;  2F3W A;  1PRT F;  1F77 A;  4AYB G;  2RCN A;  4WJ3 M;  4DV2 Q;  3QR8 A;  2A19 A;  3QJY A;  2AMC B;  2QGQ A;  3OOC A;  1WCM G;  4OXP A;  3I91 A;  4XXE A;  1LT4 D;  1HZC A;  4LMQ D;  1JOQ A;  2HUG A;  5E4W C;  2WB1 E;  4K5V A;  2E75 C;  4OEL B;  3MTS A;  1BXT A;  2GA4 B;  1UE6 A;  2F4I A;  1WOC A;  5CV8 A;  4HAE A;  4DR4 L;  2SDF A;  4ZYS A;  1WTQ A;  1CZW A;  2PI2 A;  5I2X A;  1S5E D;  2WAQ E;  5EBD A;  1R4P B;  4R4C A;  5C4X G;  2EOT A;  1G2S A;  2JA7 G;  4FXD A;  4KHV A;  1LTR D;  4IUU A;  1PH2 A;  2Z0S A;  4IO9 A;  1KNE A;  1KQS A;  5M5Y B;  4YHH Q;  4A3L G;  4LUO A;  4A3M H;  2FMM A;  1EIY B;  3R93 A;  2DGY A;  5AJ3 Q;  1BNZ A;  3RLN A;  2PMZ E;  1C7Y A;  3T16 A;  5IP7 H;  4R4O A;  1B50 A;  4R4I A;  4B9W A;  2JE6 I;  2R92 B;  1DOM A;  4KHZ A;  5NUC A;  4RMF A;  2E76 C;  2KEC A;  3CQZ B;  1KXL A;  3FPP A;  4DUY Q;  3CCL A;  2XWB B;  1KIX A;  2AKW B;  2B39 A;  5IYD G;  1DOL A;  3SK4 A;  4A3G G;  2K14 A;  4ODG A;  3PO3 G;  4DPG A;  3F1Z A;  4QB4 A;  3P75 A;  3HOW B;  1I94 L;  2HT1 A;  1KDA A;  1Z47 A;  1IBK L;  2UXC L;  3EVQ A;  2H5X A;  4ZQ3 A;  1U4M A;  1ENC A;  5CC4 A;  3EQL C;  1EWI A;  1GOZ A;  2K75 A;  1SYF A;  3S14 B;  5IGC A;  2XIW A;  3PQI A;  3U4V A;  4IFD I;  2B8G A;  3L9A X;  1RKN A;  2OXP A;  1MIU A;  1VQE A;  3NBI A;  1UE1 A;  1ZKO A;  1XMO L;  5IE8 A;  1QZH A;  2MQH A;  2WIN B;  2B63 G;  1N9W A;  4IOA A;  1EIG A;  4OO1 H;  2JYO A;  3GP7 A;  4RGO S;  1JR0 D;  5E7N A;  1O80 A;  2EY6 A;  1A2T A;  4IPC A;  4OIJ A;  4Y52 H;  4A76 A;  2O4X A;  1J9O A;  3KLW A;  3GTP H;  5KND A;  2HDM A;  4QIW E;  4Q0F A;  2Q2H A;  2V1C C;  5E3F A;  1IHZ A;  4KY7 A;  2R6G A;  1VQH A;  2XRS D;  1PZK D;  4JI2 L;  4JV5 Q;  1B2T A;  3GTQ B;  2YV5 A;  2Q8I B;  3TP6 A;  2WKD A;  2NWG A;  3D6C A;  3ITP A;  1PH3 A;  1B3A A;  3M4O B;  1SN8 A;  3A74 A;  5CV5 A;  3GTG H;  2F52 A;  1X32 A;  2N3S A;  2MNA A;  1SE3 A;  1Y69 U;  3V05 A;  1GUW A;  3ND8 A;  2HCI A;  2R61 A;  3SR1 A;  1JB7 A;  1O78 A;  3G6E A;  1FR3 A;  5BR8 Q;  1Y1W B;  3SK6 A;  1TXY A;  2KHJ A;  1QUQ A;  4BXX G;  1ZYR D;  1G8Z D;  1T5X D;  4FO2 A;  2B2V C;  3OW2 A;  2B2T C;  1YIT A;  3JC6 6;  2B2W C;  2YTV A;  1LV9 A;  3DWA A;  4A3D G;  1YNX A;  2RBM A;  5JEA H;  2XTI A;  2E2D C;  2PQE A;  3A54 A;  5EKK A;  4OX9 Q;  2RA4 A;  1EY4 A;  1HZA A;  4DR3 Q;  4DV2 L;  5GAE C;  1F9Q A;  4M1U B;  1FD7 D;  1K3R A;  2X69 A;  5C44 B;  1SLJ A;  2RHQ B;  4EQP A;  4R8I A;  4K0K Q;  3NHH A;  3NEM A;  3VA7 A;  3FKI H;  4KY5 A;  3NP8 A;  4APV A;  2L0C A;  1RHP A;  1MBY A;  4DU9 A;  4BBS H;  4RHS A;  4F8M A;  5T1I A;  2F0T A;  4X62 Q;  2VUM H;  3TN2 A;  1I4R A;  3S16 B;  4KKT A;  2IJ0 A;  1Z9F A;  1KNA A;  2M00 A;  4RGM A;  4A3B H;  4QCL A;  3L3O C;  3RD4 A;  3S24 A;  3CCV A;  3D4W A;  3C3L A;  1Z6H A;  4YHH L;  1ZYR C;  1RDP D;  4KHP Q;  4X66 Q;  3K0X A;  4DV7 L;  5AJ3 L;  1QNU A;  1Y1V G;  3VR4 A;  2IWH A;  2JEB I;  2E8G A;  1F2L A;  3AFP A;  4JBM A;  2R93 H;  1CUK A;  4IFD H;  2YU9 H;  3F2U A;  1PFN A;  2BOS A;  1UE7 A;  3HOY G;  4BBR B;  1GO3 E;  5TSS A;  3H15 A;  2YYZ A;  1E1O A;  3PGZ A;  3UDF A;  1GM5 A;  1G6Z A;  2JA5 B;  4R9W A;  3TZU A;  3H3V C;  4C2M H;  3K7A H;  5CMD A;  3BVG A;  2N8N A;  1U5K A;  1W6J A;  1QVG A;  4IPD A;  3I70 A;  3QOJ A;  2Q8T A;  2M2L A;  4DAV A;  1LT5 D;  3JAM L;  3DXJ C;  2K05 A;  4LFC Q;  5M3M H;  4KMU C;  3H3V I;  1JE5 A;  1SYE A;  2A74 C;  5GQO A;  1N33 Q;  1TWF H;  1ET9 A;  1HZ9 A;  2EXD A;  4DV0 Q;  2TSS A;  1LLR D;  1SSO A;  1N36 Q;  1Q90 A;  2F03 A;  1VQ7 A;  4DNT B;  2JA6 G;  1PRT D;  4K6L A;  5KNC A;  1DYQ A;  2A73 B;  1TKW B;  2ZM6 Q;  1H9K A;  4LAA A;  2H1E A;  4PG3 A;  3HG9 A;  2PO4 A;  2JA8 G;  2K01 A;  3A7A B;  4RKB A;  3S15 H;  5L37 A;  1HFG A;  1P8L A;  4JC0 A;  3FRP B;  4TKO B;  4NXN Q;  5EJW A;  2ATW A;  3F2D A;  5FLX c;  1KC8 C;  3ULP A;  1D5M C;  4DR6 Q;  2A8V A;  2F1M A;  4JV5 L;  4IJL A;  5IGD A;  1SR3 A;  3SVM A;  5J1Z A;  2NZO A;  1SNM A;  4DR5 Q;  1N32 Q;  3SK5 A;  1HHV A;  3LX0 A;  4DKA C;  2F3I A;  4A93 G;  3I8Z A;  2JP1 A;  1E3P A;  3HZX A;  2RQX A;  1PHJ A;  3E9H A;  1VQB A;  1SDF A;  1TS4 A;  4ZUI A;  3VR6 A;  4A3K H;  3ERQ A;  4R8N A;  4RWS C;  1EFW A;  1ESR A;  4K8I A;  3R2T A;  2MO1 A;  4OIK A;  4C56 C;  3LGJ A;  3HOX H;  1AN8 A;  3T51 B;  1PRT C;  3J81 j;  5BR8 L;  1IBL Q;  1A15 A;  1YBY A;  3I4N H;  1IXR A;  5J3B A;  3HOU G;  3FDT A;  3VR2 A;  3K6O A;  1HA5 A;  2WII B;  4OL7 A;  5M3F B;  1HJP A;  1NR4 A;  1GJX A;  1FNU A;  5ELF A;  3AB9 A;  3KLR A;  3NTK A;  2Y0S B;  4O42 A;  1NNX A;  4A3F H;  1JWM D;  1JWU D;  1C4Q A;  2C35 B;  2OF1 A;  4P72 A;  4OX9 L;  1QE6 A;  2A69 D;  1L0W A;  3RLO A;  4DR3 L;  4OO1 G;  1XXG A;  3DEP A;  4JBJ A;  4RHR A;  5HUR A;  3CD6 A;  1K8O A;  1IL8 A;  4K0K L;  1S5D D;  1PH5 A;  3D3R A;  4A3G H;  4KJN A;  1BKB A;  4BY1 H;  1LM0 A;  1R9T H;  3TEH B;  4DAP A;  1V1Q A;  5LMN W;  3P20 A;  3U4Z A;  5IY0 A;  1V9P A;  2D0O A;  1II3 A;  1YNN D;  4MN3 A;  2NYZ D;  2HQE A;  4C3J B;  4X62 L;  2RSN A;  2NVY B;  3TS2 A;  3A5U A;  1TWC H;  1IL2 A;  3BDL A;  3CU7 A;  1LAB A;  2ID0 A;  1TY0 A;  2P5Z X;  5IGG A;  4G7H C;  4B3M Q;  4BY7 G;  3H3V H;  1X6O A;  4F7X A;  1CA5 A;  2B63 H;  4KHP L;  4X66 L;  1K83 H;  3NQI A;  3S2H B;  1F2Z A;  2XGT A;  4KY6 A;  4RGN A;  2DY7 A;  1F2Y A;  2EYL A;  3CAM A;  3H91 A;  1BCP F;  1MD2 D;  2D9U A;  3E0J A;  1B7Y B;  2LKV A;  4WOR A;  3JAM c;  2QF7 A;  1E2Z A;  1ICF B;  3TBI B;  1KLU D;  2A69 C;  1O7L A;  2ZTC A;  1O7I A;  3URY A;  3H0G B;  4CDF C;  4XQJ A;  5I6Y A;  1EQQ A;  4DF7 A;  3NPP A;  1ET6 A;  3QOL A;  4JOI C;  3CC2 A;  3BYY B;  4GNX B;  4YCU A;  4PZ7 A;  2WKC A;  2UUB Q;  4LFA Q;  1RCV D;  5JEA G;  1DON A;  1A62 A;  4KKU A;  1YNN C;  1STH A;  2XN9 C;  4LFC L;  1GHK A;  4HCS A;  1HFN A;  5DNF A;  3GTO H;  1RD9 D;  1A3U A;  3W3A A;  4QUC A;  2RDF A;  1ASY A;  1N33 L;  2CWA A;  1EY5 A;  1IYU A;  4IN3 A;  1HNZ Q;  1DXM A;  3ERS X;  4ZRZ A;  3MAQ A;  4DV0 L;  3GTJ H;  2KCC A;  4LF5 Q;  4S3S A;  4XT3 B;  1I94 Q;  1N36 L;  4LF9 Q;  4K2K A;  2HQL A;  1TWH B;  3K7U C;  4NPS A;  4J15 A;  3MXG A;  4BXX H;  2ZM6 L;  4JI3 Q;  2EYM A;  2XSC A;  2OWO A;  1TII D;  3A55 A;  4N8F A;  5C3X A;  3EN2 A;  1B9N A;  4A3B G;  3HOV B;  3OYY A;  5JJZ A;  1A63 A;  3ND9 A;  3ZYY X;  1B8A A;  1AZP A;  1HTP A;  4L5T A;  1J6Q A;  3TRE A;  4DR6 L;  5ELB A;  1I3Q B;  4M8A A;  1PYS B;  1TS5 A;  4YY3 Q;  2R93 G;  4DR5 L;  1N32 L;  1SMX A;  1TVX A;  2WB1 B;  5C5M A;  4KTA A;  4FYD A;  3DEO A;  1EWH A;  4G7O C;  3K5N A;  4DAM A;  1RTO A;  2MGS A;  1FL0 A;  3VA5 A;  1L1O A;  3BZC A;  4G7Z C;  2Z1C A;  1JB3 A;  5BN4 A;  1V43 A;  2ASB A;  1K8G A;  5CBA E;  2EDG A;  3NWT A;  3I3C A;  1BR9 A;  1R4Q B;  2G9H D;  1X56 A;  2WAQ B;  1VQA A;  2LSS A;  2PNR C;  2HD3 A;  1L0X B;  2RDH A;  1YIJ A;  5M3M G;  5M5W B;  2E2H H;  3J81 E;  1IBL L;  1KRT A;  1WTH A;  4OO1 I;  4A3J B;  1OXX K;  1Y1V H;  2C9O A;  5IGB A;  2VB3 X;  3PUY A;  1EIF A;  3DLL A;  1SNQ A;  1LT3 D;  4HIK A;  1EZ6 A;  2PMZ B;  2VXW A;  1AEX A;  2F0I A;  3FKI B;  2CH4 A;  1D7Q A;  2F0W A;  4X6A H;  1CM9 A;  1ESF A;  3ERO A;  1EWC A;  4YCW A;  4LW1 A;  5IGE A;  1IYV A;  4CDE C;  2KHS A;  3NXW A;  3A5Z B;  4HMI A;  3UDX A;  1NJI C;  4B3R L;  4BBS B;  1STY A;  3T13 A;  1STN A;  4J6H A;  3HKS A;  2VUM B;  1PTO H;  4WJ4 A;  1NSN S;  4KKS A;  4O1N A;  3TDQ A;  5JEA J;  5IP9 H;  4RH6 A;  5FO7 B;  3JAM i;  1BBU A;  4A3I G;  5T1G A;  2CQO A;  2VW9 A;  1HZB A;  1F9P A;  5GRO A;  1JOR A;  2F0M A;  4WFN 3;  4JCV E;  2KHI A;  3MC0 B;  1HTL D;  2FHT A;  5KIX A;  3K5O A;  1TWA H;  5DAU A;  4PMW A;  1CFM A;  3T4A C;  2OTJ A;  4ZKB B;  1WTV A;  3CRL C;  2JA6 H;  2VNU D;  2A5H A;  5D3I B;  4DR1 Q;  4B3M L;  1V1P B;  3MWY W;  2EPB A;  1S40 A;  2IX0 A;  2UXB Q;  5CV4 A;  4A3K G;  3U58 A;  1SXT A;  2XWJ B;  1ASZ A;  2JA8 H;  3H09 A;  3K7A B;  1EEF D;  3BVZ A;  4KLK A;  3HOZ B;  4QMG A;  3CCU A;  3PIO A;  1I5F A;  3HOX G;  1LUZ A;  1YVC A;  4Y7N H;  1JOK A;  1ZXT A;  1EY6 A;  2EJM A;  3A8J E;  1SND A;  1GXD C;  4QIW B;  3I4N G;  5I6W A;  4ALP A;  4CJ1 B;  1PA6 A;  2BH2 A;  3KUP A;  4DV7 Q;  4JI6 Q;  4NMZ A;  4RGT A;  1MJC A;  1GHJ A;  1UWV A;  4HJ5 A;  1KRS A;  3J7Z C;  2E2I B;  4HJA A;  4IFD J;  4GNX A;  1M8A A;  1TWF B;  1PTO F;  1M4V A;  2RHS B;  2F0N A;  2KED A;  4I7A A;  4A3F G;  1CSP A;  1I50 B;  2UUB L;  4LFA L;  3L0O A;  4CKB A;  3I4M B;  1DD2 A;  4DAY B;  4A93 H;  3CCE A;  3RZO B;  1P16 A;  1SE8 A;  1X65 A;  4QF4 A;  4RA8 A;  5H1S E;  3RR5 A;  3E3X A;  1HNZ L;  3S15 B;  4BY1 G;  1MJE A;  1U9R A;  1KAB A;  2OTL A;  4N9P A;  4LF5 L;  2J4X A;  4HSP A;  4LF9 L;  1OXV A;  4AYB B;  1BVS A;  2EYP A;  1FGU A;  2B2U A;  3HOU H;  5C3E H;  1ONL A;  3SDZ A;  5CR3 A;  1KDC A;  1WCM B;  4JI3 L;  3GTM H;  1MGS A;  5GAG C;  2PQA B;  3KJO A;  2EZV A;  3RZD H;  1STE A;  1GUO A;  2ES2 A;  2OEO A;  4UHV A;  5A2Q L;  1O7Z A;  2L55 A;  1VQ8 A;  4IUQ A;  1SNO A;  1SRO A;  3UDI A;  2BDO A;  2MUY A;  4GN4 B;  2K04 A;  3UI2 A;  5C4X B;  4G4K A;  4YY3 L;  1S72 A;  4H7B A;  2XNA C;  2JA7 B;  1CHP D;  2LFN A;  3HFZ B;  2UU9 Q;  3I2Z A;  5DM7 3;  4CJ0 B;  1OTC A;  1GD7 A;  1EL0 A;  3I90 A;  4LF7 Q;  2R7Z G;  4L6T B;  3J7A 5;  4O0A A;  4XT1 B;  3PIO 3;  2LXJ A;  2AWO A;  3NTI A;  1S5F D;  1NMG A;  1ILQ A;  3IRB A;  3I73 A;  1BCP D;  4L5S A;  3D6W A;  4BY7 H;  1FYC A;  2HDL A;  4HTH A;  1D6E C;  5EBC A;  5FLX L;  2Z6K A;  4LUZ A;  4KD3 A;  3S2D H;  3AFQ A;  1VQN A;  1PFM A;  1PZI D;  3DUZ A;  1IW7 D;  2CCZ A;  4MIU A;  5DM6 3;  2PPB C;  1M1K C;  4X3U A;  1VMP A;  2M9V A;  1VCI A;  5K36 G;  2EVB A;  4A3G B;  3PO3 B;  4ZK9 B;  4AYB E;  1KHI A;  3D4D A;  1JE4 A;  3W1B A;  2KEN A;  1XNR Q;  3HKZ G;  4C3H G;  4B3S Q;  1PDQ A;  1EQT A;  5ISR A;  1SYB A;  2BA0 A;  5IT9 L;  2F0H A;  3RUZ A;  3KDF B;  1QVF A;  5I2Y A;  5ELN A;  1TWC B;  4P71 A;  1CK1 A;  2NUC A;  2WAC A;  3GTL H;  5D14 A;  4DNI A;  1I4G A;  1HQR D;  3BZK A;  3OMG A;  3MEF A;  2VS1 A;  5ELC A;  1Y8O B;  2SEB D;  4AQY Q;  3UE0 A;  2B63 B;  3I4O A;  4PNY A;  5CBE E;  2MHV A;  5GAD C;  2JA5 G;  1K83 B;  1XPO A;  1IKL A;  4RG1 A;  4A3C H;  1ROD A;  1V8Q A;  3CCR A;  1HNX Q;  2N78 A;  3LWU A;  1BCP C;  3MHB A;  2FXQ A;  2K50 A;  3OIQ A;  1V1P A;  4LWC A;  1TWG H;  3SXH A;  4QUF A;  5IYC H;  4HJ9 A;  2HHH Q;  5JJI A;  4DR1 L;  3M85 A;  2Q2I A;  1F9S A;  2UXB L;  3KF8 B;  1EYA A;  1J5E Q;  3KOJ A;  1IW7 C;  3I7F A;  1NBW A;  1XNQ Q;  3HP3 A;  5FO9 B;  2PZW A;  2K5N A;  4KK7 A;  3S1R H;  1PYW D;  4DUZ Q;  1VQO A;  1KLG D;  4NW2 A;  4IUT A;  1E1T A;  4HED A;  4DGZ A;  4YIJ A;  4P74 A;  4ZKC B;  4JI6 L;  3RN2 A;  3TZD A;  3VR3 A;  2WP8 J;  3GTO B;  1LTS D;  4LJZ C;  1NAP A;  1QZG A;  2SNM A;  1E22 A;  1SFO H;  1VQ5 A;  5C4H A;  1RIP A;  1RL2 A;  1JJC B;  4DAY A;  4EQ5 A;  2F0J A;  3L7Z C;  4Z9C B;  1MHW C;  4FNF A;  4X3T A;  5CV9 A;  5M9O A;  1LTG D;  4HIM A;  3SEB A;  3MXP A;  5JJK A;  2D0P A;  4WRD A;  1LAC A;  4X64 Q;  5EKI A;  5IP9 G;  4GZY C;  3VYU A;  1JJ2 A;  1SBB B;  4RCO A;  2VY3 A;  3FPU B;  1PH8 A;  1I4H A;  4H0L C;  5FLM G;  4A3D B;  1A2U A;  4CBV A;  1YJ9 A;  1LTI D;  2K33 A;  3U9O A;  2NVX B;  4PMC A;  2K52 A;  3T56 B;  1JOO A;  2AUJ D;  3WWV A;  2L4N A;  1TY2 A;  4KD4 A;  1QB5 D; 
#chains in the Genus database with same CATH homology
 1H9R A;  4L8J A;  1XTC D;  1PRT B;  2PW7 A;  2AQ1 B;  5LHY 1;  5FKA C;  4DN4 M;  4N9T A;  2B2T A;  1B4O A;  2RDG A;  3Q0A A;  3CRK C;  3JAM E;  2SNS A;  1WTP A;  4C3I G;  1BOS A;  3S1N B;  1BDO A;  2K03 A;  5KNB A;  3GD7 A;  5CYU A;  2NN6 H;  1CZG A;  1Y1V B;  5I9P A;  3TSS A;  4BS9 A;  4FP5 D;  1STG A;  1U4P A;  4H44 C;  2D62 A;  3Q24 A;  3HOY B;  1W6K A;  4KI0 A;  1EIH A;  1LT6 D;  4C1N K;  2N55 A;  3C1F A;  2LMC B;  1XX8 A;  2FIN B;  1PTO D;  3WOE A;  2F0L A;  4B08 A;  2QDB A;  1B53 A;  2L5T A;  1CI3 M;  1EOT A;  1AFP A;  2K6A A;  5C4Z A;  2QKI C;  4K2L A;  2NBF A;  1FNW A;  2SOB A;  1ZEQ X;  1TWA B;  3D31 A;  2BCO A;  1PZJ D;  3QB3 A;  3GO5 A;  4X3S A;  5COR A;  1YNJ D;  4IUN A;  2FFK B;  3P1H A;  3PUX A;  4XYQ A;  4I7Z C;  3HEJ A;  3OIP A;  5AFW A;  4MHE A;  4Y7N B;  3I72 A;  1SMY D;  3HS0 C;  3D8G A;  3KF8 A;  2MPM A;  5IOD A;  2K1B A;  4A3M B;  3WDN A;  4IUV A;  1D5X C;  2XRQ D;  3G6J B;  1G29 1;  1Q3L A;  5F2D A;  4K14 A;  2C5C A;  1PTO C;  4K6D A;  3QO2 A;  4EQN A;  1UEA B;  5BN5 A;  4I65 A;  4XQQ A;  2Z4H A;  3BYT B;  5IIF A;  2F0F A;  1NR2 A;  2J0T D;  1Y8P B;  1EYC A;  3MFY A;  5J39 A;  2EYH A;  4C1N I;  2HCC A;  1YNJ C;  3A8K E;  2BA1 A;  2FMC A;  3HOU B;  3X3M A;  3TP5 A;  3DWQ A;  2LY7 A;  1VF7 A;  3DHQ A;  3PUZ A;  1SMY C;  1EYD A;  5HGT A;  2F0P A;  2L11 A;  1DZ1 A;  2CQA A;  4G57 A;  1STB A;  2IX3 A;  2I07 B;  4FF1 A;  5K36 H;  1CQF A;  3GTP B;  1LO5 D;  3R8B A;  2CW0 D;  4JK1 C;  3OSO A;  3VYT A;  1SYD A;  1D1K A;  3RLF A;  2IL8 A;  3KLS X;  4L63 B;  4DXF A;  1GUN A;  2O5J C;  1SEB D;  4B9X A;  2ZXR A;  5EKL A;  3NK9 A;  3GTG B;  1EZ8 A;  5J22 A;  2IX1 A;  1JCK B;  4F87 A;  2AUK A;  4DXG A;  2X6L A;  4TRD A;  5FOB B;  1PLF A;  5C3W A;  2FJ2 A;  3A7L A;  4NDX A;  1SAP A;  1D2B A;  3V96 A;  3PUW A;  3O13 A;  3A8I E;  4E6I A;  1EY0 A;  1FNV A;  4X3K A;  1ENF A;  1PFB A;  2ZXO A;  4K8J A;  1ICW A;  1HXY D;  2X6G A;  2PW5 A;  2CW0 C;  1QNK A;  3Q23 A;  3KLS A;  4DK1 A;  3GQB A;  5KYL A;  2DY8 A;  1TS3 A;  3TP7 A;  1MI2 A;  3NWS A;  2N88 A;  1HA6 A;  1RTN A;  3N6R A;  1BF4 A;  1NUC A;  3OW7 A;  4P2C B;  1EU4 A;  4OGQ C;  5C0X H;  2B2Y A;  3EJI A;  4KN7 C;  1PMR A;  3J80 L;  2PCF B;  3W2D A;  1CHQ D;  1EEI D;  1ML0 D;  2D2C C;  1O7Y A;  1JQY D;  2B2U C;  3MXN A;  3R3O A;  2LS0 1;  2F0D A;  1X3Q A;  4A3B B;  1BBX C;  3K57 A;  4EGV A;  3NUC A;  2K28 A;  1U4L A;  2F0E A;  4EQO A;  2NN6 G;  5E1F A;  4U68 A;  3VYS A;  2PYK A;  2R93 B;  3RMH A;  2YU9 B;  1CQV A;  3D4R A;  3H6M A;  1SFO B;  1EY8 A;  1SE2 A;  1G91 A;  4HR7 B;  2ZXP A;  3GV6 A;  5D3D A;  4C2M B;  2QIL A;  3IL8 A;  3DMU A;  4KV6 A;  5EGT A;  2MP1 A;  1OXT A;  1RF2 D;  2RVL A;  2KVM A;  2F0Q A;  2XVS A;  5M3M B;  1QOH A;  2D5D A;  3Q6S A;  1GUT A;  3X3N A;  2EY5 A;  3QWN A;  2AQ3 B;  3LWE A;  4WJW A;  1EU3 A;  4BWG B;  2BDN A;  3J7Y W;  1OXU A;  1SE4 A;  1WTX A;  4ME5 A;  3LNN A;  4K5X A;  5CV7 A;  3DM1 A;  1BQQ T;  3ONA B;  1HUN A;  5JPM C;  3J7A V;  2K32 A;  2PZT A;  3PMF A;  4LK1 C;  3KBG A;  4A3I B;  3NQT A;  5I9O A;  1Q8I A;  2ENB A;  3FEW X;  3CKI B;  2F0K A;  2EYF A;  3G7L A;  4UAI A;  5LL6 X;  1WTW A;  1UAP A;  1HUM A;  4IAL A;  4XIG S;  1F2M A;  1Q12 A;  2EY1 A;  5ELD A;  1RJT A;  5JAV A;  4NKL A;  4A3K B;  1TR5 A;  3PIP 3;  4DK0 A;  3V2T A;  3TME A;  2NZ1 D;  4ILW A;  3HOX B;  1MSH A;  3A56 A;  1XWE A;  4NP5 A;  3WOF A;  1QIL A;  3I4N B;  1S5C D;  5A2Q E;  4PV1 C;  2K7V A;  4V19 0;  5JVH 3;  1BCP B;  2F0G A;  4DA2 A;  1DCZ A;  3CHB D;  1VMC A;  1JWS D;  4A3F B;  3C46 A;  1GUG A;  1MSG A;  3SE0 A;  2L1B A;  1L0Y B;  2EXZ A;  3E5S A;  1JC7 A;  3BS1 A;  2NTT A;  3PV0 A;  1IKM A;  3NE5 B;  4BY1 B;  1R9T B;  3MEH A;  1Q1E A;  5KYI A;  1DJR D;  5JVG 3;  4FF2 A;  2NN6 I;  3S1M B;  1A3V A;  3KBX A;  1I6V C;  1H9S B;  5FLX E;  3M4Y A;  4IZ8 A;  2A6H D;  4BA2 I;  3M3Y B;  2O5I C;  1S5B D;  2QCP X;  2EYJ A;  3S1Q B;  1B1Z A;  2RSO A;  4H13 C;  4IUR A;  1I6H B;  3SK8 A;  4CJ2 C;  1V1O A;  2F0S A;  2I46 A;  4CKE A;  5I4D A;  3M7N A;  1B44 D;  5KRU A;  2NTS A;  2MJ8 A;  5IT9 E;  3IAY A;  1AW7 A;  3OWE B;  2NVQ B;  2KA7 A;  5G3L F;  3MFG A;  4RCN A;  1DM0 B;  3Q22 A;  5FK9 C;  2R7Z B;  1Z7T A;  3BZD B;  3MA2 B;  1F9R A;  3R2I A;  4ZAI A;  4FXG C;  2Q8R E;  5CV6 A;  2IPK D;  4FF3 A;  4K5W A;  3BDO A;  5KGU A;  1VF5 C;  2A6H C;  1WD0 A;  3MZ5 A;  2QEJ C;  3GTJ B;  1WTR A;  1H9J A;  5C0X G;  2TMP A;  4J1M A;  3HKZ B;  4C3H B;  4FVM A;  2J7Z A;  1TQO A;  1KAA A;  1I4X A;  3VYR A;  5EQ0 A;  2ICE C;  2V4D A;  2ZT9 C;  2E2J B;  2KEE A;  4IUP A;  1A6X A;  4ID6 A;  4RFB A;  1D1I A;  2KQ3 A;  4CKC A;  4KJO A;  2PZU A;  1SNP A;  1STA A;  4Q5V A;  5A35 A;  3K58 A;  5JOB A;  2F3V A;  3NBH A;  2B2V A;  3QG1 A;  3MVV A;  2K5W A;  1AZQ A;  2B2W A;  2CHB D;  5M5X B;  2JXM B;  3OWF A;  3VR5 A;  1SJH D;  4V0B A;  3T53 B;  3HGB A;  1CTM A;  2E2H B;  1B9M A;  3E6Z X;  2RKS A;  1WTO A;  5IGF A;  2AQ2 B;  2DNE A;  2Z4I A;  2L12 A;  3BG3 A;  3IKJ A;  2KOL A;  3TP8 A;  2NVT B;  2EY2 A;  4PMB A;  3GV3 A;  1LTB D;  1QJO A;  2DN8 A;  4C3J G;  3FVQ A;  1PTO B;  5D65 A;  1CA6 A;  1SNC A;  2OT2 A;  4KN4 C;  5EPJ A;  3S9W A;  1KDB A;  2JSO A;  2EJG C;  1U4R A;  1E2W A;  4OHJ A;  1H9S A;  5COY A;  4ABN A;  3N52 A;  2WV6 D;  4HCE A;  5C0X J;  4EVO A;  2VB2 X;  4ZLT F;  3OMC A;  3S17 B;  2JA6 B;  1TT2 A;  2JEA I;  3BDC A;  1QG7 A;  1SJE D;  2JA8 B;  3M7G A;  4C3I B;  2BE5 D;  1HPC A;  4FF4 A;  1UNS A;  3AU7 A;  4HSV A;  4ZUJ A;  3GTK B;  4F88 A;  5FO8 B;  2R3Z A;  1QCB D;  1C48 A;  1GUS A;  3NSW A;  1QWY A;  2IW3 A;  5C0X I;  3PO2 B;  3EFX D;  4A93 B;  4ULL A;  1DOK A;  1K8M A;  1Y8N B;  1FGB D;  4CGY B;  5C6A A;  3K59 A;  4JBW A;  4XTC S;  2K5Q A;  2O2L D;  1J8I A;  5KEE A;  5E4X A;  1HRJ A;  1JIC A;  1WD1 A;  1EY9 A;  2A68 D;  1UUP A;  4IQZ A;  2AWN A;  3H94 A;  2EYO A;  1S4Z A;  1T5E A;  5C3E B;  4XDX A;  1EFI D;  3FMC A;  1WVL A;  3GTM B;  2ICI A;  3NTH A;  1G2T A;  2BE5 C;  2IT1 A;  3RZD B;  2Z8L A;  4HN7 A;  3KK7 A;  5C5L A;  1ENA A;  5CGK A;  5BN3 A;  4PQX A;  1XYI A;  4XYO A;  3MXU A;  5LL6 S;  1D5Z C;  2B2Y C;  1EY7 A;  1LTT D;  2G9D A;  2DNC A;  1AP0 A;  1KTK A;  4FXK C;  5EPL A;  1E0B A;  2B8F A;  2K5D A;  1BO0 A;  4TQU S;  2A68 C;  1X3P A;  3C2P A;  2E74 C;  1BUV T;  4RKL A;  4BY7 B;  3OHX C;  3IFT A;  4UDU C;  4BA1 I;  5G3L D;  3S2D B;  5JPN C;  5C4J B;  1CT1 D;  1PXU A;  2KCN A;  3C1E A;  1E2V A;  1HQM C;  1NCV A;  2A6E D;  1SYC A;  1H9M A;  3U9S A;  3HRZ C;  3OPO A;  4CHT B;  4A3E B;  2EJF C;  1I4P A;  1TS2 A;  3K0Y A;  1I4Q A;  3DWP A;  1LTA D;  4J8Q A;  3J81 L;  3GTL B;  4IFD G;  4U67 3;  5IOC A;  1SYG A;  3PUV A;  1EQV A;  3J7A F;  2H4O A;  5EPK A;  1VDZ A;  2F0U A;  4RAU C;  4HMJ A;  5K5P A;  3K5M A;  2NB0 A;  1TWG B;  3IFD A;  3BVM A;  2L9H A;  3P7J A;  5DEH A;  5ELE A;  3K5L A;  1OXS C;  1HCZ A;  3EA6 A;  1A3T A;  3S1R B;  2CVR A;  2F0O A;  2KJX A;  3I4L A;  3AMU A;  1OO9 B;  2A6E C;  4TSS A;  1Q1B A;  1TU2 B;  2KUM A;  1C8C A;  4DFA A;  4DNR B;  3SHL A;  4XQN A;  2F0V A;  2EE1 A;  3J80 E;  3QIA A;  1ILP A;  2F3W A;  1PRT F;  1F77 A;  3QJY A;  3OOC A;  3I91 A;  4XXE A;  1LT4 D;  4LMQ D;  1JOQ A;  2HUG A;  5E4W C;  4K5V A;  2E75 C;  3MTS A;  1BXT A;  2GA4 B;  2F4I A;  5CV8 A;  4HAE A;  2SDF A;  4ZYS A;  1WTQ A;  1CZW A;  5I2X A;  1S5E D;  5EBD A;  1R4P B;  2EOT A;  1G2S A;  4FXD A;  4KHV A;  1LTR D;  4IUU A;  1KNE A;  5M5Y B;  2FMM A;  3R93 A;  1BNZ A;  3T16 A;  1B50 A;  4B9W A;  2JE6 I;  2R92 B;  1DOM A;  4KHZ A;  5NUC A;  2E76 C;  2KEC A;  3CQZ B;  3FPP A;  2XWB B;  2B39 A;  1DOL A;  3SK4 A;  4ODG A;  4QB4 A;  3P75 A;  3HOW B;  1KDA A;  1Z47 A;  3EVQ A;  4ZQ3 A;  1U4M A;  1ENC A;  5CC4 A;  3EQL C;  1GOZ A;  1SYF A;  3S14 B;  5IGC A;  2XIW A;  4IFD I;  2B8G A;  3L9A X;  1RKN A;  2OXP A;  3NBI A;  1ZKO A;  2WIN B;  4OO1 H;  1EIG A;  2JYO A;  3GP7 A;  4RGO S;  1JR0 D;  1O80 A;  2EY6 A;  1A2T A;  4OIJ A;  2O4X A;  1J9O A;  5KND A;  2HDM A;  4Q0F A;  5E3F A;  1IHZ A;  4KY7 A;  2R6G A;  2XRS D;  1PZK D;  1B2T A;  3GTQ B;  2Q8I B;  3TP6 A;  2WKD A;  2NWG A;  3D6C A;  3ITP A;  1B3A A;  3M4O B;  5CV5 A;  1X32 A;  1SE3 A;  1Y69 U;  3V05 A;  1GUW A;  3ND8 A;  2HCI A;  2R61 A;  3SR1 A;  1O78 A;  1FR3 A;  1Y1W B;  3SK6 A;  1ZYR D;  1G8Z D;  1T5X D;  4FO2 A;  2B2V C;  2B2T C;  2B2W C;  1LV9 A;  3DWA A;  2RBM A;  5JEA H;  2E2D C;  2PQE A;  3A54 A;  5EKK A;  2RA4 A;  1EY4 A;  1F9Q A;  4M1U B;  1FD7 D;  2X69 A;  5C44 B;  4EQP A;  4R8I A;  3NHH A;  3VA7 A;  4KY5 A;  3NP8 A;  2L0C A;  1RHP A;  1MBY A;  4DU9 A;  4RHS A;  4F8M A;  5T1I A;  2F0T A;  3TN2 A;  1I4R A;  3S16 B;  4KKT A;  2IJ0 A;  1KNA A;  2M00 A;  4RGM A;  4QCL A;  3L3O C;  3RD4 A;  3D4W A;  3C3L A;  1Z6H A;  1ZYR C;  1RDP D;  1QNU A;  3VR4 A;  2IWH A;  2JEB I;  1F2L A;  4IFD H;  3F2U A;  1PFN A;  2BOS A;  4BBR B;  5TSS A;  2YYZ A;  1G6Z A;  2JA5 B;  4R9W A;  3TZU A;  3H3V C;  5CMD A;  3BVG A;  1W6J A;  3I70 A;  3QOJ A;  2Q8T A;  2M2L A;  4DAV A;  1LT5 D;  3JAM L;  3DXJ C;  2K05 A;  4KMU C;  1SYE A;  2A74 C;  1ET9 A;  2TSS A;  1LLR D;  1SSO A;  1Q90 A;  2F03 A;  4DNT B;  1PRT D;  4K6L A;  5KNC A;  1DYQ A;  2A73 B;  1TKW B;  1H9K A;  4LAA A;  2H1E A;  3HG9 A;  2PO4 A;  2K01 A;  3A7A B;  4RKB A;  1HFG A;  3FRP B;  4TKO B;  5EJW A;  1D5M C;  2F1M A;  5IGD A;  3SVM A;  5J1Z A;  1SNM A;  3SK5 A;  1HHV A;  3LX0 A;  3I8Z A;  2JP1 A;  3HZX A;  2RQX A;  1SDF A;  1TS4 A;  4ZUI A;  3VR6 A;  3ERQ A;  4R8N A;  4RWS C;  1ESR A;  4K8I A;  3R2T A;  4OIK A;  4C56 C;  1AN8 A;  3T51 B;  1PRT C;  1A15 A;  3VR2 A;  3FDT A;  3K6O A;  1HA5 A;  2WII B;  4OL7 A;  5M3F B;  1NR4 A;  1GJX A;  1FNU A;  5ELF A;  3AB9 A;  3KLR A;  3NTK A;  2Y0S B;  4O42 A;  1JWM D;  1JWU D;  1C4Q A;  2OF1 A;  1QE6 A;  2A69 D;  4OO1 G;  1XXG A;  3DEP A;  4RHR A;  5HUR A;  1K8O A;  1IL8 A;  1S5D D;  3D3R A;  4KJN A;  4DAP A;  3P20 A;  1II3 A;  1YNN D;  4MN3 A;  2NYZ D;  2HQE A;  4C3J B;  2RSN A;  2NVY B;  3BDL A;  3CU7 A;  1LAB A;  2ID0 A;  1TY0 A;  5IGG A;  4G7H C;  4F7X A;  1CA5 A;  3NQI A;  3S2H B;  1F2Z A;  4KY6 A;  4RGN A;  2DY7 A;  1F2Y A;  2EYL A;  3H91 A;  1BCP F;  1MD2 D;  2D9U A;  3E0J A;  2LKV A;  4WOR A;  2QF7 A;  1E2Z A;  3TBI B;  1KLU D;  2A69 C;  1O7L A;  3URY A;  3H0G B;  4XQJ A;  5I6Y A;  4DF7 A;  3NPP A;  1ET6 A;  3QOL A;  3BYY B;  2WKC A;  1RCV D;  5JEA G;  1DON A;  4KKU A;  1YNN C;  1STH A;  2XN9 C;  1GHK A;  4HCS A;  1HFN A;  5DNF A;  1RD9 D;  1A3U A;  3W3A A;  4QUC A;  2RDF A;  1EY5 A;  1IYU A;  4IN3 A;  1DXM A;  4ZRZ A;  3MAQ A;  2KCC A;  4S3S A;  4XT3 B;  4K2K A;  1TWH B;  3MXG A;  2EYM A;  2XSC A;  1TII D;  3A55 A;  5C3X A;  1B9N A;  3HOV B;  5JJZ A;  3ND9 A;  3ZYY X;  1AZP A;  1HTP A;  5ELB A;  1I3Q B;  4M8A A;  1TS5 A;  1TVX A;  2WB1 B;  5C5M A;  4KTA A;  4FYD A;  3DEO A;  1EWH A;  4G7O C;  3K5N A;  1RTO A;  2MGS A;  3VA5 A;  4G7Z C;  2Z1C A;  1JB3 A;  5BN4 A;  1V43 A;  5CBA E;  2EDG A;  3NWT A;  3I3C A;  1BR9 A;  1R4Q B;  2G9H D;  2WAQ B;  2PNR C;  1L0X B;  2RDH A;  5M5W B;  3J81 E;  4OO1 I;  4A3J B;  1OXX K;  2C9O A;  5IGB A;  2VB3 X;  3PUY A;  1SNQ A;  1LT3 D;  1EZ6 A;  2PMZ B;  2VXW A;  1AEX A;  2F0I A;  3FKI B;  2F0W A;  1CM9 A;  1ESF A;  3ERO A;  1EWC A;  5IGE A;  1IYV A;  2KHS A;  3NXW A;  4HMI A;  4BBS B;  1STY A;  3T13 A;  1STN A;  4J6H A;  2VUM B;  1PTO H;  1NSN S;  4KKS A;  4O1N A;  3TDQ A;  5JEA J;  4RH6 A;  5FO7 B;  5T1G A;  1F9P A;  1JOR A;  2F0M A;  4WFN 3;  3MC0 B;  1HTL D;  2FHT A;  5KIX A;  3K5O A;  5DAU A;  4PMW A;  1CFM A;  3T4A C;  4ZKB B;  1WTV A;  3CRL C;  2VNU D;  2A5H A;  5D3I B;  1V1P B;  3MWY W;  2EPB A;  2IX0 A;  5CV4 A;  1SXT A;  2XWJ B;  3H09 A;  3K7A B;  1EEF D;  3BVZ A;  3HOZ B;  4QMG A;  1JOK A;  1ZXT A;  1EY6 A;  2EJM A;  3A8J E;  1SND A;  1GXD C;  4QIW B;  5I6W A;  4CJ1 B;  3KUP A;  4NMZ A;  4RGT A;  1GHJ A;  2E2I B;  4IFD J;  1M8A A;  1TWF B;  1PTO F;  1M4V A;  2F0N A;  2KED A;  1I50 B;  4CKB A;  3I4M B;  1DD2 A;  3RZO B;  4QF4 A;  4RA8 A;  3S15 B;  1U9R A;  1KAB A;  4N9P A;  2J4X A;  4HSP A;  1OXV A;  4AYB B;  2EYP A;  2B2U A;  1ONL A;  3SDZ A;  5CR3 A;  1KDC A;  1WCM B;  1MGS A;  2EZV A;  1STE A;  1GUO A;  2OEO A;  5A2Q L;  1O7Z A;  2L55 A;  4IUQ A;  1SNO A;  2BDO A;  2MUY A;  2K04 A;  3UI2 A;  5C4X B;  4G4K A;  4H7B A;  2XNA C;  2JA7 B;  1CHP D;  2LFN A;  5DM7 3;  4CJ0 B;  1EL0 A;  3I90 A;  4L6T B;  4XT1 B;  3PIO 3;  2AWO A;  3NTI A;  1S5F D;  1ILQ A;  3I73 A;  1BCP D;  3D6W A;  1FYC A;  2HDL A;  4HTH A;  1D6E C;  5EBC A;  5FLX L;  4KD3 A;  1PFM A;  1PZI D;  3DUZ A;  1IW7 D;  4MIU A;  5DM6 3;  2PPB C;  4X3U A;  1VMP A;  2M9V A;  1VCI A;  5K36 G;  2EVB A;  4A3G B;  3PO3 B;  4ZK9 B;  3D4D A;  1JE4 A;  4C3H G;  1PDQ A;  1EQT A;  5ISR A;  1SYB A;  2BA0 A;  5IT9 L;  2F0H A;  3RUZ A;  5I2Y A;  1TWC B;  1CK1 A;  2NUC A;  2WAC A;  5D14 A;  1I4G A;  1HQR D;  3OMG A;  5ELC A;  1Y8O B;  2SEB D;  2B63 B;  4PNY A;  5CBE E;  2MHV A;  1K83 B;  1IKL A;  1ROD A;  1V8Q A;  3LWU A;  1BCP C;  3MHB A;  3OIQ A;  3SXH A;  4QUF A;  1V1P A;  3M85 A;  1F9S A;  1EYA A;  1IW7 C;  3HP3 A;  5FO9 B;  2PZW A;  4KK7 A;  1PYW D;  1KLG D;  4NW2 A;  4IUT A;  4HED A;  4DGZ A;  4YIJ A;  4ZKC B;  3TZD A;  3VR3 A;  2WP8 J;  3GTO B;  1LTS D;  4LJZ C;  1NAP A;  2SNM A;  5C4H A;  4DAY A;  2F0J A;  3L7Z C;  4Z9C B;  4FNF A;  4X3T A;  5CV9 A;  5M9O A;  1LTG D;  3SEB A;  3MXP A;  4WRD A;  1LAC A;  5EKI A;  4GZY C;  3VYU A;  1SBB B;  4RCO A;  3FPU B;  1I4H A;  4H0L C;  4A3D B;  1A2U A;  4CBV A;  1LTI D;  2K33 A;  3U9O A;  2NVX B;  4PMC A;  3T56 B;  1JOO A;  2AUJ D;  2L4N A;  1TY2 A;  4KD4 A;  1QB5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...