2F0EA

Crystal structure of staphylococcal nuclease mutant v23l
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0eA00
3MZ5A 3D6CA 2QDBA 3ERQA 1A2UA 5DEHA 1A3VA 5KYIA 3DHQA 1NUCA 3H6MA 2F0SA 1EY6A 3EVQA 3OWFA 5C4HA 3NHHA 3SR1A 5IGDA 4IZ8A 3S9WA 1EZ6A 2SNSA 2RKSA 4KJOA 1ENAA 2ENBA 4NMZA 4R8NA 2EYMA 1TQOA 3TP6A 1SYCA 5CV5A 5EKKA 3LX0A 4NKLA 4PMCA 3TP5A 3SK6A 2F0JA 2F0DA 4KJNA 5IGGA 3SHLA 2F0FA 2SNMA 4OL7A 2F0HA 4KY5A 4RKLA 3DMUA 4QF4A 3EROA 2EY2A 1TR5A 4EVOA 4KV6A 2OXPA 3C1FA 3HZXA 4J6HA 2PQEA 4QMGA 2PZUA 1EYAA 4IALA 5C5MA 2F0OA 4QB4A 5DAUA 5IGEA 3SK4A 1SNDA 3VA5A 3TP8A 3NUCA 3RUZA 1SNPA 4DGZA 4B9XA 1II3A 5HGTA 4RKBA 5J1ZA 4F7XA 5CR3A 5EGTA 3SXHA 5I6WA 4G57A 1SNMA 3NQTA 4K5XA 4KD3A 2O4XA 3C1EA 2EXZA 3R3OA 3OMGA 5CC4A 5IOCA 2PW7A 4ME5A 5JOBA 2F0EA 1EY8A 4K5WA 5CV7A 3SK5A 2F0TA 4K2LA 5M9OA 3P75A 2EY5A 5KYLA 4YIJA 1SNQA 2F0LA 1SYEA 2F0NA 1EY0A 4ZUIA 3TP7A 1EY5A 2F0GA 1SNCA 1STBA 1F2ZA 2PYKA 1SYFA 2F3WA 2M00A 3BDLA 2F0VA 4K6DA 2PW5A 4KD4A 4EQNA 3NK9A 1EY9A 2F0WA 2F0UA 1KAAA 1RKNA 3PMFA 5I9OA 4KY7A 1U9RA 5IODA 5C3WA 4K2KA 5NUCA 3T13A 1EYDA 1JOKA 2F0KA 3MXPA 5ISRA 1NSNS 1EY4A 3D4DA 3MVVA 4K5VA 4K8JA 4HMJA 2EY1A 4I65A 3HEJA 5CV4A 1SYBA 5F2DA 5CGKA 5I6YA 2RDFA 1KABA 4ZUJA 1SYGA 1STHA 1SYDA 1TT2A 1STAA 5IGCA 3EJIA 3QOJA 3SK8A 5I9PA 5CV9A 3U9OA 3NP8A 4B9WA 2F0QA 2EYJA 3MHBA 4NP5A 4WRDA 5E3FA 4NDXA 3OSOA 4KY6A 5CV8A 1F2YA 1SNOA 3MEHA 5K5PA 4HTHA 4HMIA 4ODGA 2EYPA 5IGBA 2PZTA 1A3UA 1ENCA 1IHZA 1STGA 1KDBA 3T16A 5KGUA 2KQ3A 4N9TA 1EZ8A 4K14A 3QB3A 4KTAA 4PNYA 5E1FA 3E5SA 1STYA 1STNA 1EQVA 3TMEA 4H7BA 2EYOA 2KHSA 4DFAA 1JORA 2WACA 3P1HA 2SOBA 2EYFA 4WORA 4E6IA 4DF7A 2NUCA 4TRDA 2OEOA 4LAAA 3ITPA 4N9PA 2EYHA 5CV6A 2F3VA 4S3SA 3OMCA 3D4WA 1EY7A 4EQPA 4KHVA 2EYLA 4IUNA 4F8MA 5JAVA 2RBMA 3BDCA 3QOLA 4EQOA 4J1MA 4ZQ3A 5C5LA 5C6AA 5KRUA 2F0IA 5HURA 1JOOA 3D8GA 1A2TA 5C3XA 2HQEA 3NXWA 5J39A 1KDCA 5EKLA 5KIXA 2F0PA 1F2MA 1KDAA 1A3TA 1JOQA 5KEEA 4MIUA 4PMBA 4K8IA 5J22A 5IIFA 1AEXA 4ID6A 2OF1A 4DU9A 2PZWA 2F0MA 1EYCA 5IGFA 2EY6A 2LKVA 3V2TA 5C4ZA
chains in the Genus database with same CATH superfamily
4EQ5A 2Q8TA 1A3VA 3G6JB 2IT1A 1CTMA 1VQIA 1AE3A 3TQYA 3NHHA 3SGIA 2ENBA 3LNNA 3QWNA 4IO9A 2AQ1B 5IYBH 5IGGA 2CH4W 2K1BA 2ZT9C 3U4VA 3BVZA 1XXGA 5C3EH 2V1CC 2L9HA 5JJKA 5FLMH 4GOPA 4DV0L 3NUCA 1Y1VH 3VA7A 4PMWA 3S2DB 4WFN3 1VCIA 2Z0SA 1HNWL 4KD3A 4IJLA 1BDOA 4KHZA 5BR8Q 3KF6A 3KDFB 1ZKOA 5C44B 3G4SA 1I4RA 5KYLA 2FHTA 3S1MH 4YY3Q 2D0PA 1J6QA 2EXDA 4TKOB 5LL6S 3AEVA 2NN6G 4KD4A 4EQNA 4QUFA 3M4OB 1NR2A 2TMPA 1NY4A 4DV7Q 1VF7A 3TS0A 3PO2G 5C0XG 2JP1A 1EOVA 1TWHH 2RDGA 4QL5A 1I4QA 5FK9C 3I7FA 1NR4A 2A6EC 3HOZH 3VR3A 2K7VA 3M3YB 4JW0A 5G3LD 5IT9E 2A19A 3I4NB 4V190 3K5NA 1Q12A 2MFIA 2EYPA 2E74C 4RCOA 4JI5Q 1R4QB 3HRZC 1EZ8A 3QR8A 2UXBQ 2DY8A 1X6OA 1IW7C 2EYOA 4JI6L 4JI2Q 2EOTA 4MZ9A 2SOBA 2A69D 1PA6A 3HOVG 3HOXG 1JWUD 1MKHA 4Q5VA 4C2MB 1O7IA 1F9RA 2UXCL 3PCOB 1YNNC 4A3CG 2XVSA 2KCCA 5C3XA 1R9TB 4C3IH 3GTMH 5EKLA 3S24A 1IBKQ 1I3QB 3ULLA 4BBRG 5KEEA 1PYWD 4DV5Q 2WB1G 5J22A 1UAPA 2AKWB 1AEXA 1BCPD 3U50C 2K32A 1WD0A 3TEHB 2HHHQ 4KHPQ 1YHAA 4CJ0B 3ERSX 2VQEQ 3J80c 2UUAQ 4DN4M 5LL6X 3OW2A 2EYMA 1U5KA 4CKEA 1QVFA 2VW9A 4PV1C 4FO2A 1SN8A 4KY5A 4Q0FA 3VR6A 1B53A 4HR7B 3HZXA 1A62A 4QMGA 4EGVA 1JB3A 2PZUA 3FMCA 4LFBL 2J0TD 1D7QA 2BA0A 2HCIA 4XQNA 2K14A 3OHXC 2IX0A 4X3KA 3SXHA 5I6WA 4YWMA 1VQ7A 2RF4A 2B63G 4JYAQ 2PW7A 2VUMB 1NMFA 4K5WA 1L0XB 4HJAA 4L8JA 4A3BB 3D31A 2FMCA 2K75A 1TWCB 2MO0A 4AQYL 2RHSB 4GKKL 4LF7Q 2F0WA 3DXJC 1U9RA 3EQLC 1EUJA 2VNUD 1CI3M 1MBYA 3D4DA 1ASZA 4DR2Q 1WTPA 4RWSC 4FXKC 2ID0A 2K52A 3EN2A 3W5OA 4R1JA 1AFPA 3CKIB 2E2IH 1A15A 3CCJA 1P16A 2RA4A 4X62Q 1TWAB 3NTIA 5K5PA 2NZHA 3K7AB 1VS0A 4UAIA 1XNRL 5JPMC 5KGUA 4DR6L 4ILWA 1O80A 4C3JG 5COYA 3PIO3 2UUBL 4WJ4A 1EYGA 1HQRD 2HUGA 2XSCA 1K0SA 3UE1A 3GV3A 2PQAA 1PZID 3BYTB 5CV6A 4C3HH 2EVBA 5M5WH 3K5LA 3F2DA 3RZOH 2R93B 1LLRD 3I4MB 3GV6A 1GVPA 1UNSA 4Y7NH 3PIP3 3PO3H 5DM73 1JOOA 4NXMQ 4DKAC 4IUUA 2Z6KA 2UU9Q 3TSSA 4B3MQ 5CBAE 3CRLC 1A3TA 1LTLA 3BVMA 4CJ1B 5C4XG 3CW2C 1C0AA 1RHPA 1Z6HA 5FO8B 1N33L 3GTGH 3H6MA 5KNBA 3W2DA 4IOAA 3S15H 1DOKA 1SYCA 2JA7G 1K28A 4G7HC 4JI0L 4TQUS 4DUZQ 1PXUA 2ZM6Q 2HIXA 2JN4A 3S1QH 1I4HA 1HA5A 4JI8Q 2E2JH 3TRZA 5JJLA 1EYAA 1X3PA 5LMNL 2ES2A 2EZVA 2KOLA 3WDNA 3S16B 1PH6A 1I94L 2Q8RE 4XQQA 2I5MX 3MC0B 4OWTB 1WD1A 4BA2I 1I4PA 4QJFA 2B2TA 2JJQA 3IKJA 4O2DA 1NCVA 1UE7A 1ICFB 1HNXQ 1B1ZA 4H02A 3CQZB 1TS4A 1EWIA 4LFAL 3I90A 2CKZB 3VYRA 1D6EC 2XNAC 1H9JA 3G6EA 2D2CC 5C3WA 4BA1I 2NZOA 3ER0A 3CXCA 1LTBD 3H0GG 2YU9H 1BBWA 2A69C 4JC0A 3HOUG 1WYDA 4X3SA 5EQ0A 1WTXA 1SMYD 2GVBA 1B4OA 5FJ8H 1DYQA 1MD2D 4EX5A 5IGCA 3QOJA 3Q23A 1YJWA 4A3JB 4R4IA 4YCVA 4LF6Q 2B2YC 4KY6A 4GLVB 2JA5G 4A3IH 4DR5L 5IGBA 4A3KG 1IHZA 5M3FB 1FJGL 1BCPC 2KQ3A 4K14A 4PNYA 5GADC 2X69A 2K33A 1VQEA 1YHBA 3E9IA 4E6IA 1FVIA 2VQFL 4TRDA 1HPCA 1IYVA 4DUYL 1J5EQ 5FOBB 4A3EH 2IWHA 1XX8A 4OO1H 2H1EA 5E4WC 3S14H 4BY7H 1J9OA 5HURA 2CW0D 4LUZA 3RD4A 1E1TA 1SFOB 4B3SQ 2N49A 3K59A 1KDCA 2L15A 5HGQA 1G2TA 4DA2A 4HJ8A 3CC7A 4K8IA 1FNWA 1Q86C 1B8AA 4HIOA 5C44G 4HIMA 2MJ8A 1TIID 4QQBX 1S40A 4WJWA 1K0RA 1WTQA 4DK1A 4KJOA 3T53B 2KJXA 4LF8Q 4YWKA 4LK1C 3TP5A 1E2ZA 2FJ2A 4LFCL 4MNOA 3MXNB 4LF4L 2EY2A 4HSPA 3S17H 4KV6A 4RMFA 4IALA 2RCNA 1EU4A 2MNAA 3VA5A 1S72A 4RKBA 1M90C 2L5TA 2IY5B 3I4NG 5IOCA 2A6HD 4APVA 3E6ZX 3FKIB 1BQQT 2XN9C 1FNVA 3OWEB 4UDUC 3DWQA 3HOVB 3HKZG 3PUVA 1ESFA 1BOSA 1EY9A 4B3RL 3PMFA 1K73C 3BZKA 1HNWQ 2VL6A 4K2KA 3VR4A 1S3OA 3PUYA 4DV6L 4DR1L 1TVXA 1OXSC 2N3SA 4P72A 3OTOQ 1X54A 2PI2A 4I65A 4DV1L 1YJNA 3PO2H 4BBRB 4ZUJA 4AH6A 3A8KE 3D0FA 3M85A 4LF5L 5CBEE 2RSNA 1B7YB 1GUOA 4NXNQ 3KLWA 5M3MH 4DR4L 3CCMA 4NDXA 1B2TA 3A5UA 4L63B 4GKJL 1JJCB 1H95A 1AE2A 3J7YW 2KHJA 2OTJA 1I50H 3J81c 3N6RA 5FLXL 4KKSA 1QZGA 5GQOA 2SDFA 1N9WA 2OWOA 2K6AA 2LSSA 2EJGC 2R7ZB 2K05A 4KN4C 5FLXE 2LXJA 1C9OA 2K01A 3HOXH 3I72A 4OX9L 3S2HH 1YNXA 1SE8A 1EOTA 1D8LA 1VQ5A 2I5LX 4A3CH 3UI2A 4UHVA 4GN3B 1VQCA 1GD7A 4K6LA 3A74A 3MXUA 4M8AA 4PMBA 3PGZA 2B3GA 1WVLA 2EY6A 5CV5A 1HZAA 3MZ5A 3W3AA 1A2UA 1JCKB 2ZJRA 4A3BG 3W1BA 2F0SA 3QG1A 1RJTA 3FPPA 4NMZA 3F2BA 3TN2A 4A75A 1VQFA 1KL9A 2TSSA 3CMAA 4FNFA 3EROA 1TR5A 3HKSA 1PTOB 1LT3D 2F03A 2KECA 1SMYC 3S1NH 1HCZA 3JC66 4A3MH 2QEJC 1HR0Q 1PYSB 5CR3A 4G57A 1UUPA 3GTQH 1XMQL 4LMQD 2Q2TA 1YI2A 4GOPB 2CCZA 1QVCA 1EY8A 2B2VC 2N88A 2B63H 5A35A 4RAUC 3LWEA 1IBML 4IFDG 1BXTA 1IXRA 3HKZE 3KF6B 4LFBQ 2BOSA 3JAMi 2G5DA 1RTNA 1O7YA 2NZ1D 2EQSA 2I46A 2R6GA 5TSSA 3GTKH 2YV5A 3EBEA 4UP8A 2JA8H 2E2HB 2WP8J 1EY4A 3DM3A 2HCCA 4K8JA 2R93G 5T1GA 2CWAA 3I4MG 1T9HA 4IUQA 1CZGA 2ATWA 1ICWA 2F1MA 3K5OA 4AQYQ 1FGUA 2CW0C 4A93H 1SE2A 2MP1A 4BWGB 2LY7A 4CKCA 1PRTB 1A63A 5ELDA 4FF4A 4WRDA 5CV8A 4BY1B 1HNZQ 4RHRA 3PIOA 3STBD 2JA7B 3A56A 1VQOA 2VY3A 4KTAA 4N9TA 4P71A 1SE4A 5EPLA 4JI1L 1EL0A 1NNXA 4C3JH 2EDGA 1L0YB 1STYA 1YITA 2KCTA 1ET9A 4DF7A 2MPMA 2N55A 1AZQA 4OO1I 2LMCB 3OMCA 1EY7A 3PF4A 1BUVT 2PNHA 3PIPA 3QOLA 4DR6Q 4EQOA 4YCUA 4FXGC 1K3RA 4A3GB 4OIKA 1K8AC 1MJEA 1SLJA 1BBXC 3GO5A 2NYZD 2VZAA 5IGFA 2A6HC 5C4XH 2R7DA 5C4ZA 1H9SA 2F4VL 3D6CA 1T5EA 2OQ0A 3RLFA 4XYOA 4R8NA 3QIAA 3I70A 4GN4B 5M5YH 5EPJA 4KLKA 4B3TQ 3C1FA 1GHKA 3FEWX 1N33Q 5DAUA 2JA5B 1VQBA 2BA1A 1N34L 3L3OC 1I6HH 4DGZA 1M8AA 3I2ZA 2WAQE 1C7YA 4A3JG 4JI0Q 1PFSA 1QCBD 3OIQA 4K2LA 2XRSD 1F9SA 1LT6D 1VQAA 3S1MB 5M3FG 2Z6BA 1NTGA 4K6DA 1IBLL 1CSQA 3CF5A 1PMRA 4ZYSA 4TVAB 3EIVA 3OW7A 4GLAC 4PG3A 1I94Q 1X55A 5IYCH 1KLUD 1XTCD 2XWBB 1AZPA 1EYDA 1VDZA 2I07B 4GN5A 3MEFA 2I5HA 2Q2HA 3AMUA 4K0KL 3A0JA 3FP9A 3Q0AA 4DV3L 4K5VA 3GTLH 2PMZE 2VB3X 4HMJA 2K28A 3H0GH 3HEJA 5CV4A 3ND9A 1UEBA 2XRQD 4NW2A 4ZK9B 1D5XC 1SYGA 1STHA 1TWHB 1X3QA 3HOUH 1HQMC 1HFNA 2PO4A 4HEDA 1SROA 2F0QA 3ZYYX 3DWAA 1GXDC 4DK3C 2B2UC 4X64Q 2Z4HA 2PNRC 4FDBA 2KENA 2DY7A 2NVQH 1MJCA 2ICIA 1G51A 1N8RC 4DV2Q 3A54A 2RVLA 2KVMA 1TS3A 1E2WA 3L0OA 5FO9B 1O7LA 4X66L 1D5MC 3KYHC 3CCVA 2E5LL 1CKNA 4DR5Q 3C3LA 4DR7Q 2KBNA 2EYLA 3T1YL 1C4QA 4DNIA 5C6AA 2R92H 4GS3A 4IJHA 2ZTDA 2PQAB 4IPDA 3Q8DA 1KHIA 1PYBA 2MHVA 3PUXA 4POFA 4DXGA 3I8ZA 1VF5C 4C3IB 5IP7H 1JMCA 3GTMB 4YHHQ 3Q24A 3HKZB 4MIUA 3TREA 2VQFQ 2JEAI 1HHVA 4ZCKA 2IPKD 4JI7L 3FKIG 1IYJB 3DLLA 4JI4L 1R4PB 4HCSA 2PI2E 1RD9D 4X3UA 4QIWB 5C44H 2WINB 3EVQA 5C4HA 2BE5D 1EZ6A 1JQYD 2I0QA 5IWAL 3CCSA 3M4OH 3W1GA 5FKAC 2F0FA 3T4AC 4KN7C 4QF4A 1JJ2A 2OXPA 2PQEA 2K4KA 3DWPA 3RUZA 1A0IA 1E2VA 4OGQC 3HOYG 1VQKA 4A76A 3DM1A 2MUYA 2QEXA 1DD2A 3T1HL 5C4JB 4ZRZA 3MFGA 4AIMA 3M3YH 3A7AB 4LFCQ 1EIHA 1RF2D 2H5XA 5CV7A 3I4NH 1GUGA 2YTXA 3P75A 3KLSX 3STBC 2F0NA 1CSPA 1SYFA 2F3WA 1L1OC 3NK9A 1RKNA 3HP3A 3F2UA 4R9WA 1MSGA 1M4VA 1NSNS 2R7ZG 2AWNA 1GUTA 5IT9c 5F2DA 3MTSA 4DV4Q 2NWGA 4CHTB 1AP0A 5DLQE 2JQOA 4C2MH 3J80i 3CD6A 4RG1A 1E0BA 2AQ3B 2EE1A 3SEBA 4JOIC 2E2IB 2NVYB 1PH9A 5H1SE 4ME3A 1EFID 2DGYA 4DAMA 2NVTB 4F87A 1DCZA 1N36Q 5BN3A 1STEA 3I4OA 3KFUA 5JJIA 1TY2A 1ENCA 2F52A 4OHJA 3K8AA 2Z1CA 3K0YA 2FXQA 2EPBA 1X65A 1WTWA 1Q81C 2KHSA 4N8FA 1JORA 3P1HA 4N9PA 3I56A 1HA6A 1PRTF 4S3SA 5M5WB 3P20A 4GKJQ 1W6JA 4PZ8A 1TWGB 2WAQB 2H4OA 4KKUA 1HZCA 4Y7NB 1TWFB 1CKOA 3URYA 2Y0SB 1SAPA 3ULPA 4DAYB 4DU9A 3LWUA 2PZWA 1EYCA 1RTOA 2LKVA 3V2TA 3CPWA 1WTRA 4OX9Q 1G6PA 1F9QA 4B08A 4DR3Q 2VUMH 1XPUA 1TU2B 2X6GA 4BXXG 2PMZB 3SR1A 3GTGB 4A3BH 2Q2IA 4DAVA 1VQNA 1S5ED 3NENA 2SNMA 3DEPA 4BBSB 3M7GA 1ONLA 3ND8A 4EVOA 1UEAB 1GUSA 2CFMA 4OEMB 4XT3B 2EJFC 1K3BC 1HH2P 3TBIB 3TP8A 3NPPA 1BO0A 3CAMA 2J4XA 5HGTA 1HUNA 1P8LA 5EJWA 1SNMA 2HD3A 2O4XA 1VQ8A 1TXYA 1SRUA 1EQRA 4BY1G 3K57A 4IN3A 1TWAH 2MGSA 4A3DB 4H0LC 1Y14B 1Y1WB 3K7AH 1B9NA 1F2ZA 4R4TA 1WTHA 2F0VA 1XMOQ 4IFDH 3NBHA 4R4QA 4A3FB 5M5XB 1PLFA 2QW7A 4CGYB 2O5JC 1LTTD 4QUCA 2G9DA 1XMQQ 3NWSA 4H44C 2K50A 5ELNA 4G4KA 3VYUA 2R7FA 4JK1C 5D3IB 4RGTA 1FD7D 2BH8A 4GNXB 1Q3LA 2UUCL 4G7OC 4JV5L 3UE0A 3SK8A 1PV4A 4A3GG 2CQAA 2CH4A 2XTIA 1F2YA 4I7ZC 2B2YA 3ONAB 2QA4A 4A3LG 2QKIC 4ODGA 5CORA 1SXTA 5IYDG 1V1PA 4P2CB 2AQ2B 1OXTA 1Q8IA 1WI5A 1WCMB 3UDGA 1QNUA 3U4ZA 1H9KA 1ASYA 1D5ZC 3SE0A 2BE5C 4XYQA 4MHEA 2A68D 3GTOB 1SJHD 5IYBG 4P75A 5JAVA 5BR8L 3BDCA 3GTPB 5C3EG 4RHSA 3I3CA 4LF9Q 4PQXA 5FLMG 2HQEA 4YY3L 4KI0A 3H3VC 1Y1VG 1LYLA 2F0PA 1HJPA 3S16H 4LUOA 2Q8IB 4R8IA 1DZ1A 5IIFA 1YHQA 4OWXB 4HIDA 4KKTA 2JA6B 1PH4A 1IZ6A 3G71A 3GTJB 3M4YA 3CQZH 5KYIA 1GM5A 1NUCA 3S9WA 1VQGA 3GQBA 3TP6A 4LW1A 4NKLA 4KJNA 1LM0A 3VYTA 3KJOA 3S1RB 1DONA 1OXUA 1EEID 2N78A 2O5IC 2F4VQ 1ILQA 2B8GA 2D62A 3NEMA 4QB4A 2NVXH 1XNQL 4HN7A 4RCNA 1II3A 2YTYA 1EIGA 2UXBL 4CDCC 2RQXA 3C1EA 3WOEA 3R3OA 3CMEA 5LMNW 3UDXA 1DOLA 1FYCA 2ICEC 1CQFA 1U4PA 4A3JH 1ZYRD 3CC4A 3AFPA 4ZUIA 5AJ3Q 2L0CA 3BDLA 3R8BA 1K8MA 1PFBA 1S4ZA 4H13C 1RCVD 5ELEA 1KAAA 4X6AH 5ELOA 3J81L 3J7AF 4X3TA 3MXPA 1KXLA 2JEBI 1CT1D 1AW7A 1K83H 2KA7A 1SYBA 1TY0A 4DV5L 1RL2A 2NTSA 3WWVA 3J81E 1IBLQ 1QVGA 2PPBC 2HHHL 4KHPL 1QWYA 2EYJA 2UUAL 4WJ3M 4C3IG 5M3MB 1SFOH 4NPSA 1Q46A 3HG9A 4HTHA 4DV0Q 3KLRA 1VMPA 3H3VI 1KDBA 2NN6H 5I2XA 1PFNA 3TZUA 1G6ZA 1EQVA 1H9MA 3V05A 1BR9A 2JSOA 5E7NA 4GZYC 5C0XH 1E7ZA 3HOYB 4KHVA 2ZTCA 4F8MA 4V0BA 3F1ZA 4JYAL 3S2HB 3JAML 1SSOA 2QILA 2IX3A 5J39A 5KIXA 1KTKA 4CDFC 3CC2A 2A1AA 4LF7L 3JAME 1BKBA 2YYZA 5JJZA 1K8OA 3HGBA 3FKIH 1JWMD 1T5XD 5EBCA 2IHEA 1EU3A 1X3EA 1W6KA 4IZ8A 2RKSA 1ENAA 5CYUA 3DEOA 3NTKA 1AH9A 3HOVH 1H9SB 1HXYD 4PMCA 2A8VA 2DNEA 1U4MA 2F0JA 2O2LD 2E76C 2BCOA 3EA6A 3ZJYC 5I4DA 4GLXA 4JI4Q 1QOHA 4A4IA 1MI2A 1CHPD 4JI6Q 4Y52H 3J81i 5GROA 4BBRH 3S1NB 4F7XA 4A3MB 2UXCQ 4HJ5A 4L5SA 3G48A 1HTLD 5JOBA 1IL2A 3PV0A 2B2VA 1JB7A 4OXPA 1SBBB 4IFDI 2EY5A 3OYYA 1EY0A 1Z7TA 3TP7A 4B9WA 1PH5A 1C8CA 1PTOD 5GAEC 3NTHA 1GUNA 2K5HA 4IQZA 3K81C 2CQOA 1PVOA 4KY7A 5IODA 5NUCA 1V9PA 3T13A 3T1HQ 4NXML 3GTKB 2D5DA 3UDFA 2A68C 2JA8B 4B3ML 2EY1A 4C3HG 5CGKA 3Q22A 3HOWB 1XJVA 1KD1C 2R7ZH 2BH2A 3FHWA 2WAQG 2C35B 1G2SA 3BZDB 1E3PA 3LGJA 2Y0SG 4A93B 3L9AX 1Q8KA 3DUZA 5E3FA 4L6TB 1AN8A 4TSSA 1MHWC 1SNOA 4HMIA 1YIJA 4NB3A 4DUZL 4ZKBB 4QIWE 3CRKC 3TMEA 1W3SA 1CM9A 1Q82C 1V8QA 3MXNA 3ITPA 1MSHA 1PRTD 2K5NA 4GKKQ 2HIVA 4CDEC 1VQLA 1LTSD 1U4RA 2JE6I 4BBSG 4IFDJ 1LV9A 1HNXL 3RNUA 1QJOA 2KCNA 4DK6C 1YVCA 1A2TA 3FVQA 3CCQA 4F88A 1CKNB 4JG2A 2KUMA 1JOQA 1Y8NB 4CDDC 4RH6A 1G291 2VB2X 2NTTA 4G7ZC 3NE5B 1UE1A 1A8VA 1F2LA 3PSIA 1ZYRC 2AMCB 4A3DG 1Y1WG 3K5MA 1PFMA 5IGDA 1U4LA 3T51B 1KAWA 1EWCA 5JEAG 4A3FG 3LX0A 1W2BA 1XNRQ 3SK6A 3ICEA 2L12A 3SHLA 2UUBQ 1E22A 1B3AA 3FRPB 1PDQA 3DMUA 1FR3A 4UP7A 5T1IA 4DK0A 1V1OA 1B9MA 4ZAIA 1N32L 4LF6L 4DAPA 3SK4A 5E4XA 2L1BA 1JJGA 2XWJB 3PQIA 1Y8PB 5FJ8G 2YTVA 2C5CA 2K5WA 3H15A 1WTVA 4ME5A 2CVRA 5BN4A 3CCEA 1GKHA 4QGUA 4YIJA 1J5EL 2WV6D 4FF3A 3BU2A 2IX1A 2JA7H 1ILPA 2F0UA 1WCMG 1S5FD 2DNCA 4MTNA 5C3EB 1EWHA 4C1NK 4B3SL 3TS2A 1DM0B 1Y1VB 1EQTA 3GTLB 2RDFA 2K03A 2EJMA 4C1NI 1YBYA 1BF4A 3VYSA 1MIUA 4IURA 1I5FA 3D3RA 2B2WA 2Y0SE 1QUQA 3CCRA 2NN6I 3MHBA 4A3GH 2B2UA 5LMNQ 1SR3A 3BZCA 4ZLTF 3OOCA 5D65A 5D14A 1Q1EA 4IPGA 4A3LH 1STGA 3PF5A 2VS1A 3IRBA 2JA6G 2UUCQ 5E1FA 3PUZA 4LWCA 5C0XI 1L2FA 1PHJA 1TS5A 5BN5A 1TKWB 1Z9FA 2N8NA 1NMGA 3R2TA 4LFAQ 2EYHA 1EIYB 4U673 1BVSA 5JPNC 2RBMA 2B2WC 3HOZB 4J1MA 5KRUA 3HS0C 4IPCA 3RZDH 1LT5D 4RGMA 3OPOA 2R92B 1B70B 3D8GA 4R4CA 4IUTA 1F2MA 2JA5H 3Q6SA 4A3KH 2DJGC 4ID6A 1VQDA 2LFNA 4XQJA 1DJRD 3ERQA 5DEHA 3KOJA 2R3ZA 1K9MC 3J80L 3A5ZB 4RGOS 3OTOL 2DUDA 1RODA 1PTOC 3IL8A 2SNSA 4L5QA 2M9VA 5EKKA 4KMUC 2F0DA 1FJGQ 4J8QA 4I7AA 3J80E 1UE6A 3KUPA 2OT2A 4FP5D 4NXNL 3IFDA 3F8TA 4J6HA 4GOPC 2AWOA 5C5MA 5IGEA 3I55A 5IT9L 3S2DH 4X65L 3K6OA 4DUYQ 5C0XJ 5EAYA 5J1ZA 3J81j 4BS9A 4N8X1 2UXDL 3CP0A 3T56B 5M3MG 3SK5A 5M9OA 1B44D 1D1KA 1ML0D 3I4LA 3I73A 2AUJD 4XDXA 1EY5A 2PYKA 1HFGA 1C48A 1XNQQ 1VQPA 1L1OA 4JBWA 5IY0A 1LTRD 3GD7A 4JI3L 5ISRA 2XIWA 2XGTA 1F77A 1PRTC 3NBHB 4RA8A 3AB9A 3KF8A 1KABA 5GAGC 1SYDA 1TT2A 3BVGA 4C56C 1B50A 1O78A 1HTPA 3EJIA 2MQHA 1E1OA 2JXMB 5LMUL 1QE6A 3M9BA 4LF4Q 1BBUA 1I6VC 4JOIA 4RFBA 4J15A 3OSOA 1E24A 1PTOF 4AYBE 2PZTA 3OIPA 1QZHA 3E5SA 1GUWA 5ELBA 4CKBA 3A7LA 4RGNA 1HRJA 3H91A 2A74C 1JC7A 3N52A 1V1PB 1BCPB 1JT8A 1CZWA 2LS01 1L0WA 4IPHA 4ULLA 1HR0L 1JWSD 3MWYW 5DM63 3SDZA 4IUNA 4B3RQ 4QY7A 1O7ZA 2QCPX 4ZKCB 4HJ9A 4DV6Q 5I2YA 4DR1Q 1R9TH 5L37A 2JYOA 1MGSA 5EBDA 1I3QH 2K5QA 1M1KC 1YZ6A 2KCMA 1Q1BA 3J7AV 4DV1Q 4A3MG 1CHQD 5K36G 1WFQA 2F0MA 2ZXOA 5C4JH 5IP9G 4LF5Q 3H3VH 3K7UC 2E2DC 2ASBA 4DR4Q 2SEBD 3OWFA 1EQQA 3R2IA 1XPOA 4C3HB 3RZOB 4PZ7A 3KBXA 1TQOA 4UY8C 2OTLA 1V43A 3CHBD 2G9HD 3PO3B 4XTCS 4FVMA 5ELCA 3VDYA 2JA8G 3E9HA 1VQ4A 1SMXA 4KK7A 3HOWG 1HNZL 2B8FA 2FMMA 3KDFA 1PZJD 2GA4B 3MXGA 4P74A 1SNPA 2BDOA 4IOCA 2KEEA 1JR0D 4Z9CB 5EGTA 3FDTA 1QNKA 4K5XA 4A93G 3KJPA 3OMGA 1S5DD 2B29A 2NVYH 3CCLA 1WJJA 3S15B 2NVTH 1I4GA 1TWCH 2ZJPA 5D3DA 1SNCA 1XYIA 4JBKA 2FINB 4O0AA 2RHQB 3HFZB 1HZBA 2D9UA 3J7ZC 1S5BD 3S1QB 1GOZA 4JCVE 1ZXTA 4R4OA 1NE3A 2E2JB 4DXFA 3K58A 2B39A 2L4NA 2Z9HA 1LTAD 2NB0A 1KC8C 2QDLA 2L11A 1FGBD 1TWGH 3NELA 3BG3A 4CJ2C 3KK7A 3U9OA 2OCEA 1TWFH 1JE4A 2D0OA 1HR0W 1PZKD 3M7NA 1XTDA 2ZXRA 1NBWA 3QB3A 1SEBD 2WB1E 3R93A 1HUMA 4HJ7A 2GN5A 4B3TL 3CCUA 4DFAA 4XIGS 2YU9B 2LXKA 2CHBD 5FO7B 2R93H 4HSVA 4FYDA 1Z47A 1IBMQ 3I4MH 2ZXPA 4FXDA 2P5ZX 1EIFA 3H09A 4BBSH 2MO1A 2Z6KC 3MA2B 3NXWA 1FL0A 4A3IB 4YCWA 2QGQA 4JPBW 5AFWA 2OF1A 2J7ZA 1PH8A 3DHQA 2CWPA 1GHJA 3G7LA 4A3DH 1Y1WH 1GJXA 1J8IA 1A6XA 2IHFA 4A3EB 1I4XA 5IYCG 4OL7A 5JEAH 2F0HA 3RR5A 4JI1Q 5M5XH 4A3FH 3S14B 4BY7B 4CBVA 4ABNA 1SE3A 3KBGA 3CU7A 4X64L 1K8GA 1Q7YC 1WTOA 2X6LA 4L5TA 4AYBB 2NVXB 4B9XA 2B2TC 4DV2L 3P7JA 1DOMA 4DV7L 2K5DA 2EXZA 1IKMA 1CA6A 4IUVA 4HAEA 1QILA 2F0TA 2KEDA 3RMHA 3AFQA 2F0LA 1N32Q 4DR7L 3C2PA 4O42A 1QG7A 1ENFA 1VQ6A 2C9OA 3NWTA 3S17B 2F0KA 1VQJA 1WCMH 5KNDA 1KQSA 5ELFA 1OTCA 3C46A 2BDNA 1G8ZD 1K83B 4JI5L 4YHHL 3GTOH 3HOZG 1X56A 2K04A 1Y69U 2R92G 3GTPH 1CFMA 1DGSA 4JI2L 5G3LF 1EEFD 3MAQA 3M4QA 4DAYA 1X9NA 1XWEA 5IP7G 1U0LA 5M3FH 1N34Q 1X32A 2V4DA 4MTKA 3T16A 1QB5D 1IL8A 4OONA 3BS1A 2WKCA 3KLSA 1LO5D 2JA6H 3TZDA 2Z8LA 3ULJA 3GTJH 4H7BA 1IBKL 4WORA 2EYFA 3GDEA 2NUCA 3QO2A 3PO2B 2A73B 2F3VA 3A8IE 2ALYB 2VQEL 3S1RH 4LNQA 1GO3E 1SJED 4DPGA 4K0KQ 5A2QL 4DV3Q 1YJ9A 1KDAA 2DN8A 1I50B 1BCPF 2WIIB 5A2QE 2QDBA 1UE5A 3RLOA 5CMDA 1OXXK 1X3GA 1NAPA 4JVZA 1EY6A 3E0EA 1ET6A 1Q90A 3U9SA 3RLNA 5JVH3 4DV4L 4OELB 3E0JA 3K80C 3NQIA 2QF7A 2L55A 3HOXB 1YNJD 5EPKA 4IUPA 1PH2A 1XPRA 1Y8OB 4GNXA 3M4PA 3VR5A 2F0OA 5EKIA 1G91A 1SNDA 1CK1A 1N36L 4X66Q 2HT1A 2F3IA 2E5LQ 1LTID 1LABA 4UP9A 3T1YQ 2WB1B 3I91A 5J3BA 4P73A 4PZ6A 2F0EA 3RN2A 1PH7A 1JICA 2WFWA 5JVG3 4DR2L 1SYEA 4JBMA 3X3MA 2M00A 1LTGD 4X65Q 3A55A 4GNXC 4JI7Q 4X62L 2UXDQ 1D2BA 1KRTA 1CKMA 3MVVA 5I6YA 5IWAQ 3HOYH 1LUZA 5DNFA 1STAA 3GTQB 2FFKB 1IYUA 4DR3L 2HQLA 3F2CA 2B63B 1VQMA 1PH3A 4JI3Q 4O1NA 1DXMA 1OO9B 1V1QA 1UWVA 3SVMA 3O13A 1KLGD 2PCFB 1A3UA 3PUWA 3NSWA 4UPAA 1EFWA 1QUQB 2IW3A 3NBIA 2VUMG 1STNA 4ALPA 4OWWB 5LMUQ 2UU9L 1YEZA 3B6YA 4FF2A 4LAAA 4XT1B 3U58A 3GP7A 4HIKA 2E8GA 4HCEA 3RN5A 3PO3G 2RCFA 2A6ED 1B3QA 2GVAA 2F0IA 3JAMc 2DJFC 1VQHA 5HY6A 4XXEA 1S5CD 3IAYA 1VQ9A 1XMOL 1D1IA 1NJIC 2ZJQA 2ZM6L 2E75C 5K36H 5FLXc 4QCLA 4C3JB 4JI8L 3AQQA 5IP9H 1HZ9A 4DNRB 1CA5A 1IW7D 1BNZA 4JBJA 2K5VA 4MN3A 3IFTA 2AHOB 2JA9A 2KHIA 4RKLA 1F9PA 1PTOH 4POGA 1YNND 2RSOA 3HOWH 1IKLA 2ZTEA 3D6WA 3NQTA 1PH1A 5C4XB 3TDQA 3EFXD 5GAHC 3K0XA 5IE8A 3BYYB 5KNCA 4LJZC 2Q2UA 1SNQA 3CPFA 4BXXH 5CC4A 3D4RA 1WOCA 2F0GA 2RDHA 1STBA 1JE5A 2PW5A 1CUKA 3X3NA 1TS2A 5M5YB 5I9OA 1FNUA 3BJUA 4YWLA 2VXWA 1KRSA 2EIFA 2Z4IA 2E2HH 1JOKA 1SDFA 4LF9L 1L1OB 1I6HB 1KIXA 3MFYA 1H9RA 3AYHB 2A5HA 4U68A 5I9PA 1RDPD 5CV9A 5JEAJ 3L2PA 3NP8A 3H94A 3KF8B 4OIJA 4BY1H 3E3XA 4NP5A 4A3IG 3MEHA 3BDOA 1KNAA 3FPUB 2JK8A 4DNTB 4L5RC 4LUVA 2AUKA 2WACA 1CQVA 1ZEQX 3H0GB 3WOFA 2OEOA 3A8JE 3L7ZC 4A3EG 4M1UB 3HOUB 3D4WA 4OO1G 3V96A 2F4IA 4EQPA 2M2LA 4BY7G 1RIPA 1YNJC 1LACA 2WKDA 4ZQ3A 5C5LA 3UDIA 3VR2A 2HDLA 3RZDB 1KNEA 1X3FA 5LHY1 3QJYA 2HDMA 1OXVA 4LF8L 2R61A 4AYBG 5AJ3L 3J7A5 2NVQB 2NBFA 2OQKA 1LT4D 4FF1A 1ESRA 2IL8A 3AU7A 4A3KB 5IYDH 2IJ0A 4JV5Q 1VMCA
chains in the Genus database with same CATH topology
2Q8TA 1A3VA 3G6JB 2IT1A 1CTMA 3NHHA 2ENBA 3LNNA 3QWNA 2AQ1B 5IGGA 2K1BA 2ZT9C 3BVZA 1XXGA 2L9HA 3NUCA 3VA7A 4PMWA 3S2DB 4WFN3 1VCIA 4KD3A 1BDOA 4KHZA 1ZKOA 5C44B 1I4RA 5KYLA 2FHTA 4TKOB 5LL6S 2NN6G 4KD4A 4EQNA 4QUFA 3M4OB 1NR2A 2TMPA 1VF7A 5C0XG 2JP1A 2RDGA 5FK9C 1I4QA 1NR4A 2A6EC 3VR3A 2K7VA 3M3YB 5G3LD 5IT9E 3I4NB 4V190 3K5NA 1Q12A 2EYPA 2E74C 4RCOA 1R4QB 3HRZC 1EZ8A 2DY8A 1IW7C 2EYOA 2EOTA 2SOBA 2A69D 1JWUD 4Q5VA 4C2MB 1F9RA 1YNNC 2XVSA 2KCCA 5C3XA 1R9TB 5EKLA 1I3QB 5KEEA 1PYWD 5J22A 1UAPA 1AEXA 1BCPD 2K32A 1WD0A 4CJ0B 4DN4M 5LL6X 2EYMA 4CKEA 4PV1C 4FO2A 4KY5A 4Q0FA 3VR6A 1B53A 4HR7B 3HZXA 4QMGA 4EGVA 1JB3A 2PZUA 3FMCA 2J0TD 2BA0A 2HCIA 4XQNA 5I6WA 3OHXC 2IX0A 4X3KA 3SXHA 2PW7A 2VUMB 4K5WA 1L0XB 4L8JA 4A3BB 3D31A 2FMCA 1TWCB 2F0WA 3DXJC 1U9RA 3EQLC 2VNUD 1CI3M 1MBYA 3D4DA 1WTPA 4RWSC 4FXKC 2ID0A 1AFPA 3CKIB 1A15A 2RA4A 1TWAB 3NTIA 5K5PA 3K7AB 4UAIA 5JPMC 5KGUA 4ILWA 1O80A 4C3JG 5COYA 3PIO3 1HQRD 2HUGA 2XSCA 3GV3A 1PZID 3BYTB 5CV6A 2EVBA 3K5LA 2R93B 1LLRD 3I4MB 3GV6A 1UNSA 3PIP3 5DM73 1JOOA 4IUUA 3TSSA 5CBAE 3CRLC 1A3TA 3BVMA 4CJ1B 1RHPA 1Z6HA 5FO8B 3H6MA 5KNBA 3W2DA 1DOKA 1SYCA 4G7HC 4TQUS 1PXUA 1I4HA 1HA5A 1EYAA 1X3PA 2EZVA 2KOLA 3WDNA 3S16B 2Q8RE 4XQQA 3MC0B 1WD1A 4BA2I 1I4PA 2B2TA 3IKJA 1NCVA 1B1ZA 3CQZB 1TS4A 3I90A 3VYRA 1D6EC 2XNAC 1H9JA 2D2CC 5C3WA 4BA1I 1LTBD 2A69C 4X3SA 5EQ0A 1WTXA 1SMYD 1B4OA 1DYQA 1MD2D 5IGCA 3QOJA 3Q23A 4A3JB 2B2YC 4KY6A 5IGBA 1IHZA 5M3FB 1BCPC 2KQ3A 4K14A 4PNYA 2X69A 2K33A 4E6IA 4TRDA 1HPCA 1IYVA 5FOBB 2IWHA 1XX8A 4OO1H 2H1EA 5E4WC 1J9OA 5HURA 2CW0D 3RD4A 1SFOB 3K59A 1KDCA 1G2TA 4DA2A 4K8IA 1FNWA 2MJ8A 1TIID 4WJWA 1WTQA 4DK1A 4KJOA 3T53B 2KJXA 4LK1C 3TP5A 1E2ZA 2FJ2A 2EY2A 4HSPA 4KV6A 4IALA 1EU4A 3VA5A 4RKBA 2L5TA 5IOCA 2A6HD 3E6ZX 3FKIB 1BQQT 2XN9C 1FNVA 3OWEB 4UDUC 3DWQA 3HOVB 3PUVA 1ESFA 1BOSA 1EY9A 3PMFA 4K2KA 3VR4A 3PUYA 1TVXA 1OXSC 4I65A 4BBRB 4ZUJA 3A8KE 3M85A 5CBEE 2RSNA 1GUOA 4NDXA 1B2TA 4L63B 3J7YW 3N6RA 5FLXL 4KKSA 2SDFA 2K6AA 2EJGC 2R7ZB 2K05A 4KN4C 5FLXE 2K01A 3I72A 1EOTA 3UI2A 4K6LA 4M8AA 3MXUA 4PMBA 1WVLA 2EY6A 5CV5A 3MZ5A 3W3AA 1A2UA 1JCKB 2F0SA 3QG1A 1RJTA 3FPPA 4NMZA 3TN2A 2TSSA 4FNFA 3EROA 1TR5A 1PTOB 1LT3D 2F03A 2KECA 1SMYC 1HCZA 2QEJC 5CR3A 4G57A 1UUPA 4LMQD 1EY8A 2B2VC 2N88A 5A35A 4RAUC 3LWEA 4IFDG 1BXTA 2BOSA 1RTNA 1O7YA 2NZ1D 2I46A 2R6GA 5TSSA 2E2HB 2WP8J 1EY4A 2HCCA 4K8JA 5T1GA 4IUQA 1CZGA 1ICWA 2F1MA 3K5OA 2CW0C 1SE2A 2MP1A 4BWGB 2LY7A 4CKCA 1PRTB 5ELDA 4FF4A 4WRDA 5CV8A 4BY1B 4RHRA 2JA7B 3A56A 4N9TA 4KTAA 5EPLA 1EL0A 1SE4A 2EDGA 1L0YB 1STYA 1ET9A 4DF7A 2MPMA 2N55A 1AZQA 4OO1I 2LMCB 3OMCA 1EY7A 1BUVT 3QOLA 4EQOA 4FXGC 4A3GB 4OIKA 1BBXC 3GO5A 2NYZD 5IGFA 2A6HC 5C4ZA 1H9SA 3D6CA 1T5EA 3RLFA 4XYOA 4R8NA 3QIAA 3I70A 5EPJA 3C1FA 1GHKA 3FEWX 5DAUA 2JA5B 2BA1A 3L3OC 4DGZA 1M8AA 1QCBD 3OIQA 4K2LA 2XRSD 1F9SA 1LT6D 3S1MB 4K6DA 1PMRA 4ZYSA 3OW7A 1KLUD 1XTCD 2XWBB 1AZPA 1EYDA 1VDZA 2I07B 3AMUA 3Q0AA 4K5VA 2VB3X 4HMJA 2K28A 3HEJA 5CV4A 3ND9A 2XRQD 4NW2A 4ZK9B 1D5XC 1SYGA 1STHA 1TWHB 1X3QA 1HQMC 1HFNA 2PO4A 4HEDA 2F0QA 3ZYYX 3DWAA 1GXDC 2B2UC 2Z4HA 2PNRC 2DY7A 2ICIA 3A54A 2RVLA 2KVMA 1TS3A 1E2WA 5FO9B 1O7LA 1D5MC 3C3LA 2EYLA 1C4QA 5C6AA 2MHVA 3PUXA 4DXGA 3I8ZA 1VF5C 4C3IB 3GTMB 3Q24A 3HKZB 4MIUA 2JEAI 1HHVA 2IPKD 1R4PB 4HCSA 1RD9D 4X3UA 4QIWB 2WINB 3EVQA 5C4HA 2BE5D 1EZ6A 1JQYD 5FKAC 2F0FA 3T4AC 4KN7C 4QF4A 2OXPA 2PQEA 3DWPA 3RUZA 1E2VA 4OGQC 3DM1A 2MUYA 1DD2A 5C4JB 4ZRZA 3MFGA 3A7AB 1EIHA 1RF2D 5CV7A 1GUGA 3P75A 3KLSX 2F0NA 1SYFA 2F3WA 3NK9A 1RKNA 3HP3A 3F2UA 4R9WA 1MSGA 1M4VA 1NSNS 2AWNA 1GUTA 5F2DA 3MTSA 2NWGA 4CHTB 1AP0A 1E0BA 2AQ3B 2EE1A 3SEBA 2E2IB 2NVYB 1EFID 2NVTB 4F87A 1DCZA 5BN3A 1STEA 1TY2A 1ENCA 4OHJA 2Z1CA 3K0YA 2EPBA 1WTWA 2KHSA 1JORA 3P1HA 4N9PA 1HA6A 1PRTF 4S3SA 5M5WB 3P20A 1W6JA 1TWGB 2WAQB 2H4OA 4KKUA 4Y7NB 1TWFB 3URYA 2Y0SB 1SAPA 4DU9A 3LWUA 2PZWA 1EYCA 1RTOA 2LKVA 3V2TA 1WTRA 1F9QA 4B08A 1TU2B 2X6GA 2PMZB 3SR1A 3GTGB 4DAVA 1S5ED 2SNMA 3DEPA 4BBSB 3M7GA 1ONLA 3ND8A 4EVOA 1UEAB 1GUSA 4XT3B 2EJFC 3TBIB 3TP8A 3NPPA 1BO0A 2J4XA 5HGTA 1HUNA 5EJWA 1SNMA 2O4XA 3K57A 4IN3A 2MGSA 4A3DB 4H0LC 1Y1WB 1B9NA 1F2ZA 2F0VA 4IFDH 3NBHA 4A3FB 5M5XB 1PLFA 2O5JC 4CGYB 1LTTD 4QUCA 2G9DA 3NWSA 4H44C 4G4KA 3VYUA 4JK1C 5D3IB 4RGTA 1FD7D 1Q3LA 4G7OC 3SK8A 2CQAA 1F2YA 4I7ZC 2B2YA 3ONAB 2QKIC 4ODGA 5CORA 1SXTA 1V1PA 4P2CB 2AQ2B 1OXTA 1Q8IA 1WCMB 1QNUA 1H9KA 1D5ZC 3SE0A 2BE5C 4XYQA 4MHEA 2A68D 3GTOB 1SJHD 5JAVA 3BDCA 3GTPB 4RHSA 3I3CA 4PQXA 2HQEA 4KI0A 3H3VC 2F0PA 2Q8IB 4R8IA 1DZ1A 5IIFA 4KKTA 2JA6B 3GTJB 3M4YA 5KYIA 1NUCA 3S9WA 3GQBA 3TP6A 4NKLA 4KJNA 3VYTA 3S1RB 1DONA 1OXUA 1EEID 2O5IC 1ILQA 2B8GA 2D62A 4QB4A 4HN7A 4RCNA 1II3A 1EIGA 2RQXA 3C1EA 3WOEA 3R3OA 1DOLA 1FYCA 2ICEC 1CQFA 1U4PA 1ZYRD 4ZUIA 2L0CA 3BDLA 3R8BA 1K8MA 1PFBA 1S4ZA 4H13C 1RCVD 5ELEA 1KAAA 3J81L 3J7AF 4X3TA 3MXPA 2JEBI 1CT1D 1AW7A 2KA7A 1SYBA 1TY0A 2NTSA 3J81E 2PPBC 1QWYA 2EYJA 4C3IG 5M3MB 3HG9A 4HTHA 3KLRA 1VMPA 1KDBA 2NN6H 5I2XA 1PFNA 3TZUA 1G6ZA 1EQVA 1H9MA 3V05A 1BR9A 2JSOA 4GZYC 5C0XH 3HOYB 4KHVA 4F8MA 4V0BA 3S2HB 3JAML 1SSOA 2QILA 2IX3A 5J39A 5KIXA 1KTKA 3JAME 2YYZA 5JJZA 1K8OA 3HGBA 1JWMD 1T5XD 5EBCA 1EU3A 1W6KA 4IZ8A 2RKSA 1ENAA 5CYUA 3DEOA 3NTKA 1H9SB 1HXYD 4PMCA 2DNEA 1U4MA 2F0JA 2O2LD 2E76C 2BCOA 3EA6A 5I4DA 1QOHA 1MI2A 1CHPD 3S1NB 4F7XA 4A3MB 1HTLD 5JOBA 3PV0A 2B2VA 4IFDI 1SBBB 2EY5A 1EY0A 1Z7TA 3TP7A 4B9WA 1C8CA 1PTOD 3NTHA 1GUNA 4IQZA 4KY7A 5IODA 5NUCA 3T13A 3GTKB 2D5DA 2A68C 2JA8B 2EY1A 4C3HG 5CGKA 3Q22A 3HOWB 1G2SA 3BZDB 4A93B 3L9AX 3DUZA 5E3FA 4L6TB 1AN8A 4TSSA 1SNOA 4HMIA 4ZKBB 3CRKC 3TMEA 1CM9A 1V8QA 3MXNA 3ITPA 1MSHA 1PRTD 1LTSD 1U4RA 2JE6I 4IFDJ 1LV9A 1QJOA 2KCNA 3FVQA 1A2TA 4F88A 2KUMA 1JOQA 1Y8NB 4RH6A 1G291 2VB2X 2NTTA 4G7ZC 3NE5B 1F2LA 1ZYRC 3K5MA 1PFMA 5IGDA 1U4LA 3T51B 1EWCA 5JEAG 3LX0A 3SK6A 2L12A 3SHLA 1B3AA 3FRPB 1PDQA 3DMUA 1FR3A 5T1IA 4DK0A 1V1OA 1B9MA 4ZAIA 4DAPA 3SK4A 5E4XA 2L1BA 2XWJB 1Y8PB 2C5CA 2K5WA 1WTVA 4ME5A 2CVRA 5BN4A 4YIJA 2WV6D 4FF3A 2IX1A 1ILPA 2F0UA 1S5FD 2DNCA 5C3EB 1EWHA 4C1NK 1DM0B 1Y1VB 1EQTA 3GTLB 2RDFA 2K03A 2EJMA 4C1NI 1BF4A 3VYSA 4IURA 3D3RA 2B2WA 2NN6I 3MHBA 2B2UA 4ZLTF 3OOCA 5D65A 5D14A 1Q1EA 1STGA 5E1FA 3PUZA 5C0XI 1TS5A 5BN5A 1TKWB 3R2TA 2EYHA 4U673 5JPNC 2RBMA 2B2WC 3HOZB 5KRUA 4J1MA 3HS0C 1LT5D 4RGMA 3OPOA 2R92B 3D8GA 4IUTA 1F2MA 3Q6SA 4ID6A 2LFNA 4XQJA 1DJRD 3ERQA 5DEHA 2R3ZA 3J80L 4RGOS 1RODA 1PTOC 3IL8A 2SNSA 2M9VA 5EKKA 4KMUC 2F0DA 4J8QA 3J80E 3KUPA 2OT2A 4FP5D 3IFDA 4J6HA 2AWOA 5C5MA 5IGEA 5IT9L 3K6OA 5C0XJ 5J1ZA 4BS9A 3T56B 3SK5A 5M9OA 1B44D 1D1KA 1ML0D 3I4LA 3I73A 2AUJD 4XDXA 1EY5A 2PYKA 1HFGA 1C48A 4JBWA 1LTRD 3GD7A 5ISRA 2XIWA 1F77A 1PRTC 4RA8A 3AB9A 3KF8A 1KABA 1SYDA 1TT2A 3BVGA 4C56C 1B50A 1O78A 1HTPA 3EJIA 2JXMB 1QE6A 1I6VC 4RFBA 3OSOA 1PTOF 2PZTA 3OIPA 3E5SA 1GUWA 5ELBA 4CKBA 3A7LA 4RGNA 1HRJA 3H91A 2A74C 1JC7A 3N52A 1V1PB 1BCPB 1CZWA 2LS01 4ULLA 1JWSD 3MWYW 5DM63 3SDZA 4IUNA 1O7ZA 2QCPX 4ZKCB 5I2YA 2JYOA 1MGSA 5EBDA 2K5QA 1Q1BA 3J7AV 1CHQD 5K36G 2F0MA 2ZXOA 2E2DC 2SEBD 3OWFA 3R2IA 4C3HB 3RZOB 3KBXA 1TQOA 1V43A 3CHBD 2G9HD 3PO3B 4XTCS 4FVMA 5ELCA 4KK7A 2B8FA 2FMMA 1PZJD 2GA4B 3MXGA 1SNPA 2BDOA 2KEEA 1JR0D 4Z9CB 5EGTA 3FDTA 1QNKA 4K5XA 3OMGA 1S5DD 3S15B 1I4GA 5D3DA 1SNCA 1XYIA 2FINB 2D9UA 1S5BD 3S1QB 1GOZA 2E2JB 1ZXTA 4DXFA 3K58A 2B39A 2L4NA 1LTAD 2NB0A 2L11A 1FGBD 3BG3A 4CJ2C 3KK7A 3U9OA 1JE4A 1PZKD 3M7NA 2ZXRA 3QB3A 1SEBD 3R93A 1HUMA 4DFAA 4XIGS 2YU9B 2CHBD 5FO7B 4HSVA 4FYDA 1Z47A 2ZXPA 4FXDA 3H09A 3MA2B 3NXWA 4A3IB 5AFWA 2OF1A 2J7ZA 3DHQA 1GHJA 3G7LA 1GJXA 1J8IA 1A6XA 4A3EB 1I4XA 4OL7A 5JEAH 2F0HA 3S14B 4BY7B 4CBVA 4ABNA 1SE3A 3KBGA 3CU7A 1WTOA 2X6LA 4AYBB 2NVXB 4B9XA 2B2TC 3P7JA 1DOMA 2K5DA 2EXZA 1IKMA 1CA6A 4IUVA 4HAEA 1QILA 2F0TA 2KEDA 3RMHA 2F0LA 3C2PA 4O42A 1QG7A 1ENFA 2C9OA 3NWTA 3S17B 2F0KA 5KNDA 5ELFA 3C46A 2BDNA 1G8ZD 1K83B 2K04A 1Y69U 1CFMA 5G3LF 1EEFD 3MAQA 4DAYA 1XWEA 1X32A 2V4DA 3T16A 1QB5D 1IL8A 3BS1A 2WKCA 3KLSA 1LO5D 3TZDA 2Z8LA 4H7BA 4WORA 2EYFA 2NUCA 3QO2A 3PO2B 2A73B 2F3VA 3A8IE 1SJED 5A2QL 1KDAA 2DN8A 1I50B 1BCPF 2WIIB 5A2QE 2QDBA 5CMDA 1OXXK 1NAPA 1EY6A 1ET6A 1Q90A 3U9SA 5JVH3 3E0JA 3NQIA 2QF7A 2L55A 3HOXB 1YNJD 5EPKA 4IUPA 1Y8OB 3VR5A 2F0OA 5EKIA 1G91A 1SNDA 1CK1A 1LTID 1LABA 2WB1B 3I91A 2F0EA 1JICA 5JVG3 1SYEA 3X3MA 2M00A 1LTGD 3A55A 1D2BA 3MVVA 5I6YA 5DNFA 1STAA 3GTQB 2FFKB 1IYUA 2B63B 4O1NA 1DXMA 1OO9B 3SVMA 3O13A 1KLGD 2PCFB 1A3UA 3PUWA 3NSWA 2IW3A 3NBIA 1STNA 4FF2A 4LAAA 4XT1B 3GP7A 4HCEA 2A6ED 2F0IA 4XXEA 1S5CD 3IAYA 1D1IA 2E75C 5K36H 4QCLA 4C3JB 4DNRB 1CA5A 1IW7D 1BNZA 4MN3A 3IFTA 4RKLA 1F9PA 1PTOH 1YNND 2RSOA 1IKLA 3D6WA 3NQTA 5C4XB 3TDQA 3EFXD 3BYYB 5KNCA 4LJZC 1SNQA 5CC4A 3D4RA 2F0GA 1STBA 2RDHA 2PW5A 3X3NA 1TS2A 5M5YB 5I9OA 1FNUA 2VXWA 2Z4IA 1JOKA 1SDFA 1I6HB 3MFYA 1H9RA 2A5HA 4U68A 5I9PA 1RDPD 5CV9A 5JEAJ 3NP8A 3H94A 4OIJA 4NP5A 3MEHA 3BDOA 1KNAA 3FPUB 4DNTB 2AUKA 2WACA 1CQVA 1ZEQX 3H0GB 3WOFA 2OEOA 3A8JE 3L7ZC 4M1UB 3HOUB 3D4WA 4OO1G 3V96A 2F4IA 4EQPA 2M2LA 1YNJC 1LACA 2WKDA 4ZQ3A 5C5LA 3VR2A 2HDLA 3RZDB 1KNEA 5LHY1 2HDMA 1OXVA 3QJYA 2R61A 2NVQB 2NBFA 1LT4D 4FF1A 1ESRA 2IL8A 3AU7A 4A3KB 2IJ0A 1VMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ5 A;  3D6C A;  2QDB A;  3ERQ A;  1A2U A;  5DEH A;  1A3V A;  5KYI A;  3DHQ A;  1NUC A;  3H6M A;  2F0S A;  1EY6 A;  3EVQ A;  3OWF A;  5C4H A;  3NHH A;  3SR1 A;  5IGD A;  4IZ8 A;  3S9W A;  1EZ6 A;  2SNS A;  2RKS A;  4KJO A;  1ENA A;  2ENB A;  4NMZ A;  4R8N A;  2EYM A;  1TQO A;  3TP6 A;  1SYC A;  5CV5 A;  5EKK A;  3LX0 A;  4NKL A;  4PMC A;  3TP5 A;  3SK6 A;  2F0J A;  2F0D A;  4KJN A;  5IGG A;  3SHL A;  2F0F A;  2SNM A;  4OL7 A;  2F0H A;  4KY5 A;  4RKL A;  3DMU A;  4QF4 A;  3ERO A;  2EY2 A;  1TR5 A;  4EVO A;  4KV6 A;  2OXP A;  3C1F A;  3HZX A;  4J6H A;  2PQE A;  4QMG A;  2PZU A;  1EYA A;  4IAL A;  5C5M A;  2F0O A;  4QB4 A;  5DAU A;  5IGE A;  3SK4 A;  1SND A;  3VA5 A;  3TP8 A;  3NUC A;  3RUZ A;  1SNP A;  4DGZ A;  4B9X A;  1II3 A;  5HGT A;  4RKB A;  5J1Z A;  4F7X A;  5CR3 A;  5EGT A;  3SXH A;  5I6W A;  4G57 A;  1SNM A;  3NQT A;  4K5X A;  4KD3 A;  2O4X A;  3C1E A;  2EXZ A;  3R3O A;  3OMG A;  5CC4 A;  5IOC A;  2PW7 A;  4ME5 A;  5JOB A;  2F0E A;  1EY8 A;  4K5W A;  5CV7 A;  3SK5 A;  2F0T A;  4K2L A;  5M9O A;  3P75 A;  2EY5 A;  5KYL A;  4YIJ A;  1SNQ A;  2F0L A;  1SYE A;  2F0N A;  1EY0 A;  4ZUI A;  3TP7 A;  1EY5 A;  2F0G A;  1SNC A;  1STB A;  1F2Z A;  2PYK A;  1SYF A;  2F3W A;  2M00 A;  3BDL A;  2F0V A;  4K6D A;  2PW5 A;  4KD4 A;  4EQN A;  3NK9 A;  1EY9 A;  2F0W A;  2F0U A;  1KAA A;  1RKN A;  3PMF A;  5I9O A;  4KY7 A;  1U9R A;  5IOD A;  5C3W A;  4K2K A;  5NUC A;  3T13 A;  1EYD A;  1JOK A;  2F0K A;  3MXP A;  5ISR A;  1NSN S;  1EY4 A;  3D4D A;  3MVV A;  4K5V A;  4K8J A;  4HMJ A;  2EY1 A;  4I65 A;  3HEJ A;  5CV4 A;  1SYB A;  5F2D A;  5CGK A;  5I6Y A;  2RDF A;  1KAB A;  4ZUJ A;  1SYG A;  1STH A;  1SYD A;  1TT2 A;  1STA A;  5IGC A;  3EJI A;  3QOJ A;  3SK8 A;  5I9P A;  5CV9 A;  3U9O A;  3NP8 A;  4B9W A;  2F0Q A;  2EYJ A;  3MHB A;  4NP5 A;  4WRD A;  5E3F A;  4NDX A;  3OSO A;  4KY6 A;  5CV8 A;  1F2Y A;  1SNO A;  3MEH A;  5K5P A;  4HTH A;  4HMI A;  4ODG A;  2EYP A;  5IGB A;  2PZT A;  1A3U A;  1ENC A;  1IHZ A;  1STG A;  1KDB A;  3T16 A;  5KGU A;  2KQ3 A;  4N9T A;  1EZ8 A;  4K14 A;  3QB3 A;  4KTA A;  4PNY A;  5E1F A;  3E5S A;  1STY A;  1STN A;  1EQV A;  3TME A;  4H7B A;  2EYO A;  2KHS A;  4DFA A;  1JOR A;  2WAC A;  3P1H A;  2SOB A;  2EYF A;  4WOR A;  4E6I A;  4DF7 A;  2NUC A;  4TRD A;  2OEO A;  4LAA A;  3ITP A;  4N9P A;  2EYH A;  5CV6 A;  2F3V A;  4S3S A;  3OMC A;  3D4W A;  1EY7 A;  4EQP A;  4KHV A;  2EYL A;  4IUN A;  4F8M A;  5JAV A;  2RBM A;  3BDC A;  3QOL A;  4EQO A;  4J1M A;  4ZQ3 A;  5C5L A;  5C6A A;  5KRU A;  2F0I A;  5HUR A;  1JOO A;  3D8G A;  1A2T A;  5C3X A;  2HQE A;  3NXW A;  5J39 A;  1KDC A;  5EKL A;  5KIX A;  2F0P A;  1F2M A;  1KDA A;  1A3T A;  1JOQ A;  5KEE A;  4MIU A;  4PMB A;  4K8I A;  5J22 A;  5IIF A;  1AEX A;  4ID6 A;  2OF1 A;  4DU9 A;  2PZW A;  2F0M A;  1EYC A;  5IGF A;  2EY6 A;  2LKV A;  3V2T A;  5C4Z A; 
#chains in the Genus database with same CATH topology
 4EQ5 A;  2Q8T A;  1A3V A;  3G6J B;  2IT1 A;  1CTM A;  1VQI A;  1AE3 A;  3TQY A;  3NHH A;  3SGI A;  2ENB A;  3LNN A;  3QWN A;  4IO9 A;  2AQ1 B;  5IYB H;  5IGG A;  2CH4 W;  2K1B A;  2ZT9 C;  3U4V A;  3BVZ A;  1XXG A;  5C3E H;  2V1C C;  2L9H A;  5JJK A;  5FLM H;  4GOP A;  4DV0 L;  3NUC A;  1Y1V H;  3VA7 A;  4PMW A;  3S2D B;  4WFN 3;  1VCI A;  2Z0S A;  1HNW L;  4KD3 A;  4IJL A;  1BDO A;  4KHZ A;  5BR8 Q;  3KF6 A;  3KDF B;  1ZKO A;  5C44 B;  3G4S A;  1I4R A;  5KYL A;  2FHT A;  3S1M H;  4YY3 Q;  2D0P A;  1J6Q A;  2EXD A;  4TKO B;  5LL6 S;  3AEV A;  2NN6 G;  4KD4 A;  4EQN A;  4QUF A;  3M4O B;  1NR2 A;  2TMP A;  1NY4 A;  4DV7 Q;  1VF7 A;  3TS0 A;  3PO2 G;  5C0X G;  2JP1 A;  1EOV A;  1TWH H;  2RDG A;  4QL5 A;  1I4Q A;  5FK9 C;  3I7F A;  1NR4 A;  2A6E C;  3HOZ H;  3VR3 A;  2K7V A;  3M3Y B;  4JW0 A;  5G3L D;  5IT9 E;  2A19 A;  3I4N B;  4V19 0;  3K5N A;  1Q12 A;  2MFI A;  2EYP A;  2E74 C;  4RCO A;  4JI5 Q;  1R4Q B;  3HRZ C;  1EZ8 A;  3QR8 A;  2UXB Q;  2DY8 A;  1X6O A;  1IW7 C;  2EYO A;  4JI6 L;  4JI2 Q;  2EOT A;  4MZ9 A;  2SOB A;  2A69 D;  1PA6 A;  3HOV G;  3HOX G;  1JWU D;  1MKH A;  4Q5V A;  4C2M B;  1O7I A;  1F9R A;  2UXC L;  3PCO B;  1YNN C;  4A3C G;  2XVS A;  2KCC A;  5C3X A;  1R9T B;  4C3I H;  3GTM H;  5EKL A;  3S24 A;  1IBK Q;  1I3Q B;  3ULL A;  4BBR G;  5KEE A;  1PYW D;  4DV5 Q;  2WB1 G;  5J22 A;  1UAP A;  2AKW B;  1AEX A;  1BCP D;  3U50 C;  2K32 A;  1WD0 A;  3TEH B;  2HHH Q;  4KHP Q;  1YHA A;  4CJ0 B;  3ERS X;  2VQE Q;  3J80 c;  2UUA Q;  4DN4 M;  5LL6 X;  3OW2 A;  2EYM A;  1U5K A;  4CKE A;  1QVF A;  2VW9 A;  4PV1 C;  4FO2 A;  1SN8 A;  4KY5 A;  4Q0F A;  3VR6 A;  1B53 A;  4HR7 B;  3HZX A;  1A62 A;  4QMG A;  4EGV A;  1JB3 A;  2PZU A;  3FMC A;  4LFB L;  2J0T D;  1D7Q A;  2BA0 A;  2HCI A;  4XQN A;  2K14 A;  3OHX C;  2IX0 A;  4X3K A;  3SXH A;  5I6W A;  4YWM A;  1VQ7 A;  2RF4 A;  2B63 G;  4JYA Q;  2PW7 A;  2VUM B;  1NMF A;  4K5W A;  1L0X B;  4HJA A;  4L8J A;  4A3B B;  3D31 A;  2FMC A;  2K75 A;  1TWC B;  2MO0 A;  4AQY L;  2RHS B;  4GKK L;  4LF7 Q;  2F0W A;  3DXJ C;  1U9R A;  3EQL C;  1EUJ A;  2VNU D;  1CI3 M;  1MBY A;  3D4D A;  1ASZ A;  4DR2 Q;  1WTP A;  4RWS C;  4FXK C;  2ID0 A;  2K52 A;  3EN2 A;  3W5O A;  4R1J A;  1AFP A;  3CKI B;  2E2I H;  1A15 A;  3CCJ A;  1P16 A;  2RA4 A;  4X62 Q;  1TWA B;  3NTI A;  5K5P A;  2NZH A;  3K7A B;  1VS0 A;  4UAI A;  1XNR L;  5JPM C;  5KGU A;  4DR6 L;  4ILW A;  1O80 A;  4C3J G;  5COY A;  3PIO 3;  2UUB L;  4WJ4 A;  1EYG A;  1HQR D;  2HUG A;  2XSC A;  1K0S A;  3UE1 A;  3GV3 A;  2PQA A;  1PZI D;  3BYT B;  5CV6 A;  4C3H H;  2EVB A;  5M5W H;  3K5L A;  3F2D A;  3RZO H;  2R93 B;  1LLR D;  3I4M B;  3GV6 A;  1GVP A;  1UNS A;  4Y7N H;  3PIP 3;  3PO3 H;  5DM7 3;  1JOO A;  4NXM Q;  4DKA C;  4IUU A;  2Z6K A;  2UU9 Q;  3TSS A;  4B3M Q;  5CBA E;  3CRL C;  1A3T A;  1LTL A;  3BVM A;  4CJ1 B;  5C4X G;  3CW2 C;  1C0A A;  1RHP A;  1Z6H A;  5FO8 B;  1N33 L;  3GTG H;  3H6M A;  5KNB A;  3W2D A;  4IOA A;  3S15 H;  1DOK A;  1SYC A;  2JA7 G;  1K28 A;  4G7H C;  4JI0 L;  4TQU S;  4DUZ Q;  1PXU A;  2ZM6 Q;  2HIX A;  2JN4 A;  3S1Q H;  1I4H A;  1HA5 A;  4JI8 Q;  2E2J H;  3TRZ A;  5JJL A;  1EYA A;  1X3P A;  5LMN L;  2ES2 A;  2EZV A;  2KOL A;  3WDN A;  3S16 B;  1PH6 A;  1I94 L;  2Q8R E;  4XQQ A;  2I5M X;  3MC0 B;  4OWT B;  1WD1 A;  4BA2 I;  1I4P A;  4QJF A;  2B2T A;  2JJQ A;  3IKJ A;  4O2D A;  1NCV A;  1UE7 A;  1ICF B;  1HNX Q;  1B1Z A;  4H02 A;  3CQZ B;  1TS4 A;  1EWI A;  4LFA L;  3I90 A;  2CKZ B;  3VYR A;  1D6E C;  2XNA C;  1H9J A;  3G6E A;  2D2C C;  5C3W A;  4BA1 I;  2NZO A;  3ER0 A;  3CXC A;  1LTB D;  3H0G G;  2YU9 H;  1BBW A;  2A69 C;  4JC0 A;  3HOU G;  1WYD A;  4X3S A;  5EQ0 A;  1WTX A;  1SMY D;  2GVB A;  1B4O A;  5FJ8 H;  1DYQ A;  1MD2 D;  4EX5 A;  5IGC A;  3QOJ A;  3Q23 A;  1YJW A;  4A3J B;  4R4I A;  4YCV A;  4LF6 Q;  2B2Y C;  4KY6 A;  4GLV B;  2JA5 G;  4A3I H;  4DR5 L;  5IGB A;  4A3K G;  1IHZ A;  5M3F B;  1FJG L;  1BCP C;  2KQ3 A;  4K14 A;  4PNY A;  5GAD C;  2X69 A;  2K33 A;  1VQE A;  1YHB A;  3E9I A;  4E6I A;  1FVI A;  2VQF L;  4TRD A;  1HPC A;  1IYV A;  4DUY L;  1J5E Q;  5FOB B;  4A3E H;  2IWH A;  1XX8 A;  4OO1 H;  2H1E A;  5E4W C;  3S14 H;  4BY7 H;  1J9O A;  5HUR A;  2CW0 D;  4LUZ A;  3RD4 A;  1E1T A;  1SFO B;  4B3S Q;  2N49 A;  3K59 A;  1KDC A;  2L15 A;  5HGQ A;  1G2T A;  4DA2 A;  4HJ8 A;  3CC7 A;  4K8I A;  1FNW A;  1Q86 C;  1B8A A;  4HIO A;  5C44 G;  4HIM A;  2MJ8 A;  1TII D;  4QQB X;  1S40 A;  4WJW A;  1K0R A;  1WTQ A;  4DK1 A;  4KJO A;  3T53 B;  2KJX A;  4LF8 Q;  4YWK A;  4LK1 C;  3TP5 A;  1E2Z A;  2FJ2 A;  4LFC L;  4MNO A;  3MXN B;  4LF4 L;  2EY2 A;  4HSP A;  3S17 H;  4KV6 A;  4RMF A;  4IAL A;  2RCN A;  1EU4 A;  2MNA A;  3VA5 A;  1S72 A;  4RKB A;  1M90 C;  2L5T A;  2IY5 B;  3I4N G;  5IOC A;  2A6H D;  4APV A;  3E6Z X;  3FKI B;  1BQQ T;  2XN9 C;  1FNV A;  3OWE B;  4UDU C;  3DWQ A;  3HOV B;  3HKZ G;  3PUV A;  1ESF A;  1BOS A;  1EY9 A;  4B3R L;  3PMF A;  1K73 C;  3BZK A;  1HNW Q;  2VL6 A;  4K2K A;  3VR4 A;  1S3O A;  3PUY A;  4DV6 L;  4DR1 L;  1TVX A;  1OXS C;  2N3S A;  4P72 A;  3OTO Q;  1X54 A;  2PI2 A;  4I65 A;  4DV1 L;  1YJN A;  3PO2 H;  4BBR B;  4ZUJ A;  4AH6 A;  3A8K E;  3D0F A;  3M85 A;  4LF5 L;  5CBE E;  2RSN A;  1B7Y B;  1GUO A;  4NXN Q;  3KLW A;  5M3M H;  4DR4 L;  3CCM A;  4NDX A;  1B2T A;  3A5U A;  4L63 B;  4GKJ L;  1JJC B;  1H95 A;  1AE2 A;  3J7Y W;  2KHJ A;  2OTJ A;  1I50 H;  3J81 c;  3N6R A;  5FLX L;  4KKS A;  1QZG A;  5GQO A;  2SDF A;  1N9W A;  2OWO A;  2K6A A;  2LSS A;  2EJG C;  2R7Z B;  2K05 A;  4KN4 C;  5FLX E;  2LXJ A;  1C9O A;  2K01 A;  3HOX H;  3I72 A;  4OX9 L;  3S2H H;  1YNX A;  1SE8 A;  1EOT A;  1D8L A;  1VQ5 A;  2I5L X;  4A3C H;  3UI2 A;  4UHV A;  4GN3 B;  1VQC A;  1GD7 A;  4K6L A;  3A74 A;  3MXU A;  4M8A A;  4PMB A;  3PGZ A;  2B3G A;  1WVL A;  2EY6 A;  5CV5 A;  1HZA A;  3MZ5 A;  3W3A A;  1A2U A;  1JCK B;  2ZJR A;  4A3B G;  3W1B A;  2F0S A;  3QG1 A;  1RJT A;  3FPP A;  4NMZ A;  3F2B A;  3TN2 A;  4A75 A;  1VQF A;  1KL9 A;  2TSS A;  3CMA A;  4FNF A;  3ERO A;  1TR5 A;  3HKS A;  1PTO B;  1LT3 D;  2F03 A;  2KEC A;  1SMY C;  3S1N H;  1HCZ A;  3JC6 6;  4A3M H;  2QEJ C;  1HR0 Q;  1PYS B;  5CR3 A;  4G57 A;  1UUP A;  3GTQ H;  1XMQ L;  4LMQ D;  2Q2T A;  1YI2 A;  4GOP B;  2CCZ A;  1QVC A;  1EY8 A;  2B2V C;  2N88 A;  2B63 H;  5A35 A;  4RAU C;  3LWE A;  1IBM L;  4IFD G;  1BXT A;  1IXR A;  3HKZ E;  3KF6 B;  4LFB Q;  2BOS A;  3JAM i;  2G5D A;  1RTN A;  1O7Y A;  2NZ1 D;  2EQS A;  2I46 A;  2R6G A;  5TSS A;  3GTK H;  2YV5 A;  3EBE A;  4UP8 A;  2JA8 H;  2E2H B;  2WP8 J;  1EY4 A;  3DM3 A;  2HCC A;  4K8J A;  2R93 G;  5T1G A;  2CWA A;  3I4M G;  1T9H A;  4IUQ A;  1CZG A;  2ATW A;  1ICW A;  2F1M A;  3K5O A;  4AQY Q;  1FGU A;  2CW0 C;  4A93 H;  1SE2 A;  2MP1 A;  4BWG B;  2LY7 A;  4CKC A;  1PRT B;  1A63 A;  5ELD A;  4FF4 A;  4WRD A;  5CV8 A;  4BY1 B;  1HNZ Q;  4RHR A;  3PIO A;  3STB D;  2JA7 B;  3A56 A;  1VQO A;  2VY3 A;  4KTA A;  4N9T A;  4P71 A;  1SE4 A;  5EPL A;  4JI1 L;  1EL0 A;  1NNX A;  4C3J H;  2EDG A;  1L0Y B;  1STY A;  1YIT A;  2KCT A;  1ET9 A;  4DF7 A;  2MPM A;  2N55 A;  1AZQ A;  4OO1 I;  2LMC B;  3OMC A;  1EY7 A;  3PF4 A;  1BUV T;  2PNH A;  3PIP A;  3QOL A;  4DR6 Q;  4EQO A;  4YCU A;  4FXG C;  1K3R A;  4A3G B;  4OIK A;  1K8A C;  1MJE A;  1SLJ A;  1BBX C;  3GO5 A;  2NYZ D;  2VZA A;  5IGF A;  2A6H C;  5C4X H;  2R7D A;  5C4Z A;  1H9S A;  2F4V L;  3D6C A;  1T5E A;  2OQ0 A;  3RLF A;  4XYO A;  4R8N A;  3QIA A;  3I70 A;  4GN4 B;  5M5Y H;  5EPJ A;  4KLK A;  4B3T Q;  3C1F A;  1GHK A;  3FEW X;  1N33 Q;  5DAU A;  2JA5 B;  1VQB A;  2BA1 A;  1N34 L;  3L3O C;  1I6H H;  4DGZ A;  1M8A A;  3I2Z A;  2WAQ E;  1C7Y A;  4A3J G;  4JI0 Q;  1PFS A;  1QCB D;  3OIQ A;  4K2L A;  2XRS D;  1F9S A;  1LT6 D;  1VQA A;  3S1M B;  5M3F G;  2Z6B A;  1NTG A;  4K6D A;  1IBL L;  1CSQ A;  3CF5 A;  1PMR A;  4ZYS A;  4TVA B;  3EIV A;  3OW7 A;  4GLA C;  4PG3 A;  1I94 Q;  1X55 A;  5IYC H;  1KLU D;  1XTC D;  2XWB B;  1AZP A;  1EYD A;  1VDZ A;  2I07 B;  4GN5 A;  3MEF A;  2I5H A;  2Q2H A;  3AMU A;  4K0K L;  3A0J A;  3FP9 A;  3Q0A A;  4DV3 L;  4K5V A;  3GTL H;  2PMZ E;  2VB3 X;  4HMJ A;  2K28 A;  3H0G H;  3HEJ A;  5CV4 A;  3ND9 A;  1UEB A;  2XRQ D;  4NW2 A;  4ZK9 B;  1D5X C;  1SYG A;  1STH A;  1TWH B;  1X3Q A;  3HOU H;  1HQM C;  1HFN A;  2PO4 A;  4HED A;  1SRO A;  2F0Q A;  3ZYY X;  3DWA A;  1GXD C;  4DK3 C;  2B2U C;  4X64 Q;  2Z4H A;  2PNR C;  4FDB A;  2KEN A;  2DY7 A;  2NVQ H;  1MJC A;  2ICI A;  1G51 A;  1N8R C;  4DV2 Q;  3A54 A;  2RVL A;  2KVM A;  1TS3 A;  1E2W A;  3L0O A;  5FO9 B;  1O7L A;  4X66 L;  1D5M C;  3KYH C;  3CCV A;  2E5L L;  1CKN A;  4DR5 Q;  3C3L A;  4DR7 Q;  2KBN A;  2EYL A;  3T1Y L;  1C4Q A;  4DNI A;  5C6A A;  2R92 H;  4GS3 A;  4IJH A;  2ZTD A;  2PQA B;  4IPD A;  3Q8D A;  1KHI A;  1PYB A;  2MHV A;  3PUX A;  4POF A;  4DXG A;  3I8Z A;  1VF5 C;  4C3I B;  5IP7 H;  1JMC A;  3GTM B;  4YHH Q;  3Q24 A;  3HKZ B;  4MIU A;  3TRE A;  2VQF Q;  2JEA I;  1HHV A;  4ZCK A;  2IPK D;  4JI7 L;  3FKI G;  1IYJ B;  3DLL A;  4JI4 L;  1R4P B;  4HCS A;  2PI2 E;  1RD9 D;  4X3U A;  4QIW B;  5C44 H;  2WIN B;  3EVQ A;  5C4H A;  2BE5 D;  1EZ6 A;  1JQY D;  2I0Q A;  5IWA L;  3CCS A;  3M4O H;  3W1G A;  5FKA C;  2F0F A;  3T4A C;  4KN7 C;  4QF4 A;  1JJ2 A;  2OXP A;  2PQE A;  2K4K A;  3DWP A;  3RUZ A;  1A0I A;  1E2V A;  4OGQ C;  3HOY G;  1VQK A;  4A76 A;  3DM1 A;  2MUY A;  2QEX A;  1DD2 A;  3T1H L;  5C4J B;  4ZRZ A;  3MFG A;  4AIM A;  3M3Y H;  3A7A B;  4LFC Q;  1EIH A;  1RF2 D;  2H5X A;  5CV7 A;  3I4N H;  1GUG A;  2YTX A;  3P75 A;  3KLS X;  3STB C;  2F0N A;  1CSP A;  1SYF A;  2F3W A;  1L1O C;  3NK9 A;  1RKN A;  3HP3 A;  3F2U A;  4R9W A;  1MSG A;  1M4V A;  1NSN S;  2R7Z G;  2AWN A;  1GUT A;  5IT9 c;  5F2D A;  3MTS A;  4DV4 Q;  2NWG A;  4CHT B;  1AP0 A;  5DLQ E;  2JQO A;  4C2M H;  3J80 i;  3CD6 A;  4RG1 A;  1E0B A;  2AQ3 B;  2EE1 A;  3SEB A;  4JOI C;  2E2I B;  2NVY B;  1PH9 A;  5H1S E;  4ME3 A;  1EFI D;  2DGY A;  4DAM A;  2NVT B;  4F87 A;  1DCZ A;  1N36 Q;  5BN3 A;  1STE A;  3I4O A;  3KFU A;  5JJI A;  1TY2 A;  1ENC A;  2F52 A;  4OHJ A;  3K8A A;  2Z1C A;  3K0Y A;  2FXQ A;  2EPB A;  1X65 A;  1WTW A;  1Q81 C;  2KHS A;  4N8F A;  1JOR A;  3P1H A;  4N9P A;  3I56 A;  1HA6 A;  1PRT F;  4S3S A;  5M5W B;  3P20 A;  4GKJ Q;  1W6J A;  4PZ8 A;  1TWG B;  2WAQ B;  2H4O A;  4KKU A;  1HZC A;  4Y7N B;  1TWF B;  1CKO A;  3URY A;  2Y0S B;  1SAP A;  3ULP A;  4DAY B;  4DU9 A;  3LWU A;  2PZW A;  1EYC A;  1RTO A;  2LKV A;  3V2T A;  3CPW A;  1WTR A;  4OX9 Q;  1G6P A;  1F9Q A;  4B08 A;  4DR3 Q;  2VUM H;  1XPU A;  1TU2 B;  2X6G A;  4BXX G;  2PMZ B;  3SR1 A;  3GTG B;  4A3B H;  2Q2I A;  4DAV A;  1VQN A;  1S5E D;  3NEN A;  2SNM A;  3DEP A;  4BBS B;  3M7G A;  1ONL A;  3ND8 A;  4EVO A;  1UEA B;  1GUS A;  2CFM A;  4OEM B;  4XT3 B;  2EJF C;  1K3B C;  1HH2 P;  3TBI B;  3TP8 A;  3NPP A;  1BO0 A;  3CAM A;  2J4X A;  5HGT A;  1HUN A;  1P8L A;  5EJW A;  1SNM A;  2HD3 A;  2O4X A;  1VQ8 A;  1TXY A;  1SRU A;  1EQR A;  4BY1 G;  3K57 A;  4IN3 A;  1TWA H;  2MGS A;  4A3D B;  4H0L C;  1Y14 B;  1Y1W B;  3K7A H;  1B9N A;  1F2Z A;  4R4T A;  1WTH A;  2F0V A;  1XMO Q;  4IFD H;  3NBH A;  4R4Q A;  4A3F B;  5M5X B;  1PLF A;  2QW7 A;  4CGY B;  2O5J C;  1LTT D;  4QUC A;  2G9D A;  1XMQ Q;  3NWS A;  4H44 C;  2K50 A;  5ELN A;  4G4K A;  3VYU A;  2R7F A;  4JK1 C;  5D3I B;  4RGT A;  1FD7 D;  2BH8 A;  4GNX B;  1Q3L A;  2UUC L;  4G7O C;  4JV5 L;  3UE0 A;  3SK8 A;  1PV4 A;  4A3G G;  2CQA A;  2CH4 A;  2XTI A;  1F2Y A;  4I7Z C;  2B2Y A;  3ONA B;  2QA4 A;  4A3L G;  2QKI C;  4ODG A;  5COR A;  1SXT A;  5IYD G;  1V1P A;  4P2C B;  2AQ2 B;  1OXT A;  1Q8I A;  1WI5 A;  1WCM B;  3UDG A;  1QNU A;  3U4Z A;  1H9K A;  1ASY A;  1D5Z C;  3SE0 A;  2BE5 C;  4XYQ A;  4MHE A;  2A68 D;  3GTO B;  1SJH D;  5IYB G;  4P75 A;  5JAV A;  5BR8 L;  3BDC A;  3GTP B;  5C3E G;  4RHS A;  3I3C A;  4LF9 Q;  4PQX A;  5FLM G;  2HQE A;  4YY3 L;  4KI0 A;  3H3V C;  1Y1V G;  1LYL A;  2F0P A;  1HJP A;  3S16 H;  4LUO A;  2Q8I B;  4R8I A;  1DZ1 A;  5IIF A;  1YHQ A;  4OWX B;  4HID A;  4KKT A;  2JA6 B;  1PH4 A;  1IZ6 A;  3G71 A;  3GTJ B;  3M4Y A;  3CQZ H;  5KYI A;  1GM5 A;  1NUC A;  3S9W A;  1VQG A;  3GQB A;  3TP6 A;  4LW1 A;  4NKL A;  4KJN A;  1LM0 A;  3VYT A;  3KJO A;  3S1R B;  1DON A;  1OXU A;  1EEI D;  2N78 A;  2O5I C;  2F4V Q;  1ILQ A;  2B8G A;  2D62 A;  3NEM A;  4QB4 A;  2NVX H;  1XNQ L;  4HN7 A;  4RCN A;  1II3 A;  2YTY A;  1EIG A;  2UXB L;  4CDC C;  2RQX A;  3C1E A;  3WOE A;  3R3O A;  3CME A;  5LMN W;  3UDX A;  1DOL A;  1FYC A;  2ICE C;  1CQF A;  1U4P A;  4A3J H;  1ZYR D;  3CC4 A;  3AFP A;  4ZUI A;  5AJ3 Q;  2L0C A;  3BDL A;  3R8B A;  1K8M A;  1PFB A;  1S4Z A;  4H13 C;  1RCV D;  5ELE A;  1KAA A;  4X6A H;  5ELO A;  3J81 L;  3J7A F;  4X3T A;  3MXP A;  1KXL A;  2JEB I;  1CT1 D;  1AW7 A;  1K83 H;  2KA7 A;  1SYB A;  1TY0 A;  4DV5 L;  1RL2 A;  2NTS A;  3WWV A;  3J81 E;  1IBL Q;  1QVG A;  2PPB C;  2HHH L;  4KHP L;  1QWY A;  2EYJ A;  2UUA L;  4WJ3 M;  4C3I G;  5M3M B;  1SFO H;  4NPS A;  1Q46 A;  3HG9 A;  4HTH A;  4DV0 Q;  3KLR A;  1VMP A;  3H3V I;  1KDB A;  2NN6 H;  5I2X A;  1PFN A;  3TZU A;  1G6Z A;  1EQV A;  1H9M A;  3V05 A;  1BR9 A;  2JSO A;  5E7N A;  4GZY C;  5C0X H;  1E7Z A;  3HOY B;  4KHV A;  2ZTC A;  4F8M A;  4V0B A;  3F1Z A;  4JYA L;  3S2H B;  3JAM L;  1SSO A;  2QIL A;  2IX3 A;  5J39 A;  5KIX A;  1KTK A;  4CDF C;  3CC2 A;  2A1A A;  4LF7 L;  3JAM E;  1BKB A;  2YYZ A;  5JJZ A;  1K8O A;  3HGB A;  3FKI H;  1JWM D;  1T5X D;  5EBC A;  2IHE A;  1EU3 A;  1X3E A;  1W6K A;  4IZ8 A;  2RKS A;  1ENA A;  5CYU A;  3DEO A;  3NTK A;  1AH9 A;  3HOV H;  1H9S B;  1HXY D;  4PMC A;  2A8V A;  2DNE A;  1U4M A;  2F0J A;  2O2L D;  2E76 C;  2BCO A;  3EA6 A;  3ZJY C;  5I4D A;  4GLX A;  4JI4 Q;  1QOH A;  4A4I A;  1MI2 A;  1CHP D;  4JI6 Q;  4Y52 H;  3J81 i;  5GRO A;  4BBR H;  3S1N B;  4F7X A;  4A3M B;  2UXC Q;  4HJ5 A;  4L5S A;  3G48 A;  1HTL D;  5JOB A;  1IL2 A;  3PV0 A;  2B2V A;  1JB7 A;  4OXP A;  1SBB B;  4IFD I;  2EY5 A;  3OYY A;  1EY0 A;  1Z7T A;  3TP7 A;  4B9W A;  1PH5 A;  1C8C A;  1PTO D;  5GAE C;  3NTH A;  1GUN A;  2K5H A;  4IQZ A;  3K81 C;  2CQO A;  1PVO A;  4KY7 A;  5IOD A;  5NUC A;  1V9P A;  3T13 A;  3T1H Q;  4NXM L;  3GTK B;  2D5D A;  3UDF A;  2A68 C;  2JA8 B;  4B3M L;  2EY1 A;  4C3H G;  5CGK A;  3Q22 A;  3HOW B;  1XJV A;  1KD1 C;  2R7Z H;  2BH2 A;  3FHW A;  2WAQ G;  2C35 B;  1G2S A;  3BZD B;  1E3P A;  3LGJ A;  2Y0S G;  4A93 B;  3L9A X;  1Q8K A;  3DUZ A;  5E3F A;  4L6T B;  1AN8 A;  4TSS A;  1MHW C;  1SNO A;  4HMI A;  1YIJ A;  4NB3 A;  4DUZ L;  4ZKB B;  4QIW E;  3CRK C;  3TME A;  1W3S A;  1CM9 A;  1Q82 C;  1V8Q A;  3MXN A;  3ITP A;  1MSH A;  1PRT D;  2K5N A;  4GKK Q;  2HIV A;  4CDE C;  1VQL A;  1LTS D;  1U4R A;  2JE6 I;  4BBS G;  4IFD J;  1LV9 A;  1HNX L;  3RNU A;  1QJO A;  2KCN A;  4DK6 C;  1YVC A;  1A2T A;  3FVQ A;  3CCQ A;  4F88 A;  1CKN B;  4JG2 A;  2KUM A;  1JOQ A;  1Y8N B;  4CDD C;  4RH6 A;  1G29 1;  2VB2 X;  2NTT A;  4G7Z C;  3NE5 B;  1UE1 A;  1A8V A;  1F2L A;  3PSI A;  1ZYR C;  2AMC B;  4A3D G;  1Y1W G;  3K5M A;  1PFM A;  5IGD A;  1U4L A;  3T51 B;  1KAW A;  1EWC A;  5JEA G;  4A3F G;  3LX0 A;  1W2B A;  1XNR Q;  3SK6 A;  3ICE A;  2L12 A;  3SHL A;  2UUB Q;  1E22 A;  1B3A A;  3FRP B;  1PDQ A;  3DMU A;  1FR3 A;  4UP7 A;  5T1I A;  4DK0 A;  1V1O A;  1B9M A;  4ZAI A;  1N32 L;  4LF6 L;  4DAP A;  3SK4 A;  5E4X A;  2L1B A;  1JJG A;  2XWJ B;  3PQI A;  1Y8P B;  5FJ8 G;  2YTV A;  2C5C A;  2K5W A;  3H15 A;  1WTV A;  4ME5 A;  2CVR A;  5BN4 A;  3CCE A;  1GKH A;  4QGU A;  4YIJ A;  1J5E L;  2WV6 D;  4FF3 A;  3BU2 A;  2IX1 A;  2JA7 H;  1ILP A;  2F0U A;  1WCM G;  1S5F D;  2DNC A;  4MTN A;  5C3E B;  1EWH A;  4C1N K;  4B3S L;  3TS2 A;  1DM0 B;  1Y1V B;  1EQT A;  3GTL B;  2RDF A;  2K03 A;  2EJM A;  4C1N I;  1YBY A;  1BF4 A;  3VYS A;  1MIU A;  4IUR A;  1I5F A;  3D3R A;  2B2W A;  2Y0S E;  1QUQ A;  3CCR A;  2NN6 I;  3MHB A;  4A3G H;  2B2U A;  5LMN Q;  1SR3 A;  3BZC A;  4ZLT F;  3OOC A;  5D65 A;  5D14 A;  1Q1E A;  4IPG A;  4A3L H;  1STG A;  3PF5 A;  2VS1 A;  3IRB A;  2JA6 G;  2UUC Q;  5E1F A;  3PUZ A;  4LWC A;  5C0X I;  1L2F A;  1PHJ A;  1TS5 A;  5BN5 A;  1TKW B;  1Z9F A;  2N8N A;  1NMG A;  3R2T A;  4LFA Q;  2EYH A;  1EIY B;  4U67 3;  1BVS A;  5JPN C;  2RBM A;  2B2W C;  3HOZ B;  4J1M A;  5KRU A;  3HS0 C;  4IPC A;  3RZD H;  1LT5 D;  4RGM A;  3OPO A;  2R92 B;  1B70 B;  3D8G A;  4R4C A;  4IUT A;  1F2M A;  2JA5 H;  3Q6S A;  4A3K H;  2DJG C;  4ID6 A;  1VQD A;  2LFN A;  4XQJ A;  1DJR D;  3ERQ A;  5DEH A;  3KOJ A;  2R3Z A;  1K9M C;  3J80 L;  3A5Z B;  4RGO S;  3OTO L;  2DUD A;  1ROD A;  1PTO C;  3IL8 A;  2SNS A;  4L5Q A;  2M9V A;  5EKK A;  4KMU C;  2F0D A;  1FJG Q;  4J8Q A;  4I7A A;  3J80 E;  1UE6 A;  3KUP A;  2OT2 A;  4FP5 D;  4NXN L;  3IFD A;  3F8T A;  4J6H A;  4GOP C;  2AWO A;  5C5M A;  5IGE A;  3I55 A;  5IT9 L;  3S2D H;  4X65 L;  3K6O A;  4DUY Q;  5C0X J;  5EAY A;  5J1Z A;  3J81 j;  4BS9 A;  4N8X 1;  2UXD L;  3CP0 A;  3T56 B;  5M3M G;  3SK5 A;  5M9O A;  1B44 D;  1D1K A;  1ML0 D;  3I4L A;  3I73 A;  2AUJ D;  4XDX A;  1EY5 A;  2PYK A;  1HFG A;  1C48 A;  1XNQ Q;  1VQP A;  1L1O A;  4JBW A;  5IY0 A;  1LTR D;  3GD7 A;  4JI3 L;  5ISR A;  2XIW A;  2XGT A;  1F77 A;  1PRT C;  3NBH B;  4RA8 A;  3AB9 A;  3KF8 A;  1KAB A;  5GAG C;  1SYD A;  1TT2 A;  3BVG A;  4C56 C;  1B50 A;  1O78 A;  1HTP A;  3EJI A;  2MQH A;  1E1O A;  2JXM B;  5LMU L;  1QE6 A;  3M9B A;  4LF4 Q;  1BBU A;  1I6V C;  4JOI A;  4RFB A;  4J15 A;  3OSO A;  1E24 A;  1PTO F;  4AYB E;  2PZT A;  3OIP A;  1QZH A;  3E5S A;  1GUW A;  5ELB A;  4CKB A;  3A7L A;  4RGN A;  1HRJ A;  3H91 A;  2A74 C;  1JC7 A;  3N52 A;  1V1P B;  1BCP B;  1JT8 A;  1CZW A;  2LS0 1;  1L0W A;  4IPH A;  4ULL A;  1HR0 L;  1JWS D;  3MWY W;  5DM6 3;  3SDZ A;  4IUN A;  4B3R Q;  4QY7 A;  1O7Z A;  2QCP X;  4ZKC B;  4HJ9 A;  4DV6 Q;  5I2Y A;  4DR1 Q;  1R9T H;  5L37 A;  2JYO A;  1MGS A;  5EBD A;  1I3Q H;  2K5Q A;  1M1K C;  1YZ6 A;  2KCM A;  1Q1B A;  3J7A V;  4DV1 Q;  4A3M G;  1CHQ D;  5K36 G;  1WFQ A;  2F0M A;  2ZXO A;  5C4J H;  5IP9 G;  4LF5 Q;  3H3V H;  3K7U C;  2E2D C;  2ASB A;  4DR4 Q;  2SEB D;  3OWF A;  1EQQ A;  3R2I A;  1XPO A;  4C3H B;  3RZO B;  4PZ7 A;  3KBX A;  1TQO A;  4UY8 C;  2OTL A;  1V43 A;  3CHB D;  2G9H D;  3PO3 B;  4XTC S;  4FVM A;  5ELC A;  3VDY A;  2JA8 G;  3E9H A;  1VQ4 A;  1SMX A;  4KK7 A;  3HOW G;  1HNZ L;  2B8F A;  2FMM A;  3KDF A;  1PZJ D;  2GA4 B;  3MXG A;  4P74 A;  1SNP A;  2BDO A;  4IOC A;  2KEE A;  1JR0 D;  4Z9C B;  5EGT A;  3FDT A;  1QNK A;  4K5X A;  4A93 G;  3KJP A;  3OMG A;  1S5D D;  2B29 A;  2NVY H;  3CCL A;  1WJJ A;  3S15 B;  2NVT H;  1I4G A;  1TWC H;  2ZJP A;  5D3D A;  1SNC A;  1XYI A;  4JBK A;  2FIN B;  4O0A A;  2RHQ B;  3HFZ B;  1HZB A;  2D9U A;  3J7Z C;  1S5B D;  3S1Q B;  1GOZ A;  4JCV E;  1ZXT A;  4R4O A;  1NE3 A;  2E2J B;  4DXF A;  3K58 A;  2B39 A;  2L4N A;  2Z9H A;  1LTA D;  2NB0 A;  1KC8 C;  2QDL A;  2L11 A;  1FGB D;  1TWG H;  3NEL A;  3BG3 A;  4CJ2 C;  3KK7 A;  3U9O A;  2OCE A;  1TWF H;  1JE4 A;  2D0O A;  1HR0 W;  1PZK D;  3M7N A;  1XTD A;  2ZXR A;  1NBW A;  3QB3 A;  1SEB D;  2WB1 E;  3R93 A;  1HUM A;  4HJ7 A;  2GN5 A;  4B3T L;  3CCU A;  4DFA A;  4XIG S;  2YU9 B;  2LXK A;  2CHB D;  5FO7 B;  2R93 H;  4HSV A;  4FYD A;  1Z47 A;  1IBM Q;  3I4M H;  2ZXP A;  4FXD A;  2P5Z X;  1EIF A;  3H09 A;  4BBS H;  2MO1 A;  2Z6K C;  3MA2 B;  3NXW A;  1FL0 A;  4A3I B;  4YCW A;  2QGQ A;  4JPB W;  5AFW A;  2OF1 A;  2J7Z A;  1PH8 A;  3DHQ A;  2CWP A;  1GHJ A;  3G7L A;  4A3D H;  1Y1W H;  1GJX A;  1J8I A;  1A6X A;  2IHF A;  4A3E B;  1I4X A;  5IYC G;  4OL7 A;  5JEA H;  2F0H A;  3RR5 A;  4JI1 Q;  5M5X H;  4A3F H;  3S14 B;  4BY7 B;  4CBV A;  4ABN A;  1SE3 A;  3KBG A;  3CU7 A;  4X64 L;  1K8G A;  1Q7Y C;  1WTO A;  2X6L A;  4L5T A;  4AYB B;  2NVX B;  4B9X A;  2B2T C;  4DV2 L;  3P7J A;  1DOM A;  4DV7 L;  2K5D A;  2EXZ A;  1IKM A;  1CA6 A;  4IUV A;  4HAE A;  1QIL A;  2F0T A;  2KED A;  3RMH A;  3AFQ A;  2F0L A;  1N32 Q;  4DR7 L;  3C2P A;  4O42 A;  1QG7 A;  1ENF A;  1VQ6 A;  2C9O A;  3NWT A;  3S17 B;  2F0K A;  1VQJ A;  1WCM H;  5KND A;  1KQS A;  5ELF A;  1OTC A;  3C46 A;  2BDN A;  1G8Z D;  1K83 B;  4JI5 L;  4YHH L;  3GTO H;  3HOZ G;  1X56 A;  2K04 A;  1Y69 U;  2R92 G;  3GTP H;  1CFM A;  1DGS A;  4JI2 L;  5G3L F;  1EEF D;  3MAQ A;  3M4Q A;  4DAY A;  1X9N A;  1XWE A;  5IP7 G;  1U0L A;  5M3F H;  1N34 Q;  1X32 A;  2V4D A;  4MTK A;  3T16 A;  1QB5 D;  1IL8 A;  4OON A;  3BS1 A;  2WKC A;  3KLS A;  1LO5 D;  2JA6 H;  3TZD A;  2Z8L A;  3ULJ A;  3GTJ H;  4H7B A;  1IBK L;  4WOR A;  2EYF A;  3GDE A;  2NUC A;  3QO2 A;  3PO2 B;  2A73 B;  2F3V A;  3A8I E;  2ALY B;  2VQE L;  3S1R H;  4LNQ A;  1GO3 E;  1SJE D;  4DPG A;  4K0K Q;  5A2Q L;  4DV3 Q;  1YJ9 A;  1KDA A;  2DN8 A;  1I50 B;  1BCP F;  2WII B;  5A2Q E;  2QDB A;  1UE5 A;  3RLO A;  5CMD A;  1OXX K;  1X3G A;  1NAP A;  4JVZ A;  1EY6 A;  3E0E A;  1ET6 A;  1Q90 A;  3U9S A;  3RLN A;  5JVH 3;  4DV4 L;  4OEL B;  3E0J A;  3K80 C;  3NQI A;  2QF7 A;  2L55 A;  3HOX B;  1YNJ D;  5EPK A;  4IUP A;  1PH2 A;  1XPR A;  1Y8O B;  4GNX A;  3M4P A;  3VR5 A;  2F0O A;  5EKI A;  1G91 A;  1SND A;  1CK1 A;  1N36 L;  4X66 Q;  2HT1 A;  2F3I A;  2E5L Q;  1LTI D;  1LAB A;  4UP9 A;  3T1Y Q;  2WB1 B;  3I91 A;  5J3B A;  4P73 A;  4PZ6 A;  2F0E A;  3RN2 A;  1PH7 A;  1JIC A;  2WFW A;  5JVG 3;  4DR2 L;  1SYE A;  4JBM A;  3X3M A;  2M00 A;  1LTG D;  4X65 Q;  3A55 A;  4GNX C;  4JI7 Q;  4X62 L;  2UXD Q;  1D2B A;  1KRT A;  1CKM A;  3MVV A;  5I6Y A;  5IWA Q;  3HOY H;  1LUZ A;  5DNF A;  1STA A;  3GTQ B;  2FFK B;  1IYU A;  4DR3 L;  2HQL A;  3F2C A;  2B63 B;  1VQM A;  1PH3 A;  4JI3 Q;  4O1N A;  1DXM A;  1OO9 B;  1V1Q A;  1UWV A;  3SVM A;  3O13 A;  1KLG D;  2PCF B;  1A3U A;  3PUW A;  3NSW A;  4UPA A;  1EFW A;  1QUQ B;  2IW3 A;  3NBI A;  2VUM G;  1STN A;  4ALP A;  4OWW B;  5LMU Q;  2UU9 L;  1YEZ A;  3B6Y A;  4FF2 A;  4LAA A;  4XT1 B;  3U58 A;  3GP7 A;  4HIK A;  2E8G A;  4HCE A;  3RN5 A;  3PO3 G;  2RCF A;  2A6E D;  1B3Q A;  2GVA A;  2F0I A;  3JAM c;  2DJF C;  1VQH A;  5HY6 A;  4XXE A;  1S5C D;  3IAY A;  1VQ9 A;  1XMO L;  1D1I A;  1NJI C;  2ZJQ A;  2ZM6 L;  2E75 C;  5K36 H;  5FLX c;  4QCL A;  4C3J B;  4JI8 L;  3AQQ A;  5IP9 H;  1HZ9 A;  4DNR B;  1CA5 A;  1IW7 D;  1BNZ A;  4JBJ A;  2K5V A;  4MN3 A;  3IFT A;  2AHO B;  2JA9 A;  2KHI A;  4RKL A;  1F9P A;  1PTO H;  4POG A;  1YNN D;  2RSO A;  3HOW H;  1IKL A;  2ZTE A;  3D6W A;  3NQT A;  1PH1 A;  5C4X B;  3TDQ A;  3EFX D;  5GAH C;  3K0X A;  5IE8 A;  3BYY B;  5KNC A;  4LJZ C;  2Q2U A;  1SNQ A;  3CPF A;  4BXX H;  5CC4 A;  3D4R A;  1WOC A;  2F0G A;  2RDH A;  1STB A;  1JE5 A;  2PW5 A;  1CUK A;  3X3N A;  1TS2 A;  5M5Y B;  5I9O A;  1FNU A;  3BJU A;  4YWL A;  2VXW A;  1KRS A;  2EIF A;  2Z4I A;  2E2H H;  1JOK A;  1SDF A;  4LF9 L;  1L1O B;  1I6H B;  1KIX A;  3MFY A;  1H9R A;  3AYH B;  2A5H A;  4U68 A;  5I9P A;  1RDP D;  5CV9 A;  5JEA J;  3L2P A;  3NP8 A;  3H94 A;  3KF8 B;  4OIJ A;  4BY1 H;  3E3X A;  4NP5 A;  4A3I G;  3MEH A;  3BDO A;  1KNA A;  3FPU B;  2JK8 A;  4DNT B;  4L5R C;  4LUV A;  2AUK A;  2WAC A;  1CQV A;  1ZEQ X;  3H0G B;  3WOF A;  2OEO A;  3A8J E;  3L7Z C;  4A3E G;  4M1U B;  3HOU B;  3D4W A;  4OO1 G;  3V96 A;  2F4I A;  4EQP A;  2M2L A;  4BY7 G;  1RIP A;  1YNJ C;  1LAC A;  2WKD A;  4ZQ3 A;  5C5L A;  3UDI A;  3VR2 A;  2HDL A;  3RZD B;  1KNE A;  1X3F A;  5LHY 1;  3QJY A;  2HDM A;  1OXV A;  4LF8 L;  2R61 A;  4AYB G;  5AJ3 L;  3J7A 5;  2NVQ B;  2NBF A;  2OQK A;  1LT4 D;  4FF1 A;  1ESR A;  2IL8 A;  3AU7 A;  4A3K B;  5IYD H;  2IJ0 A;  4JV5 Q;  1VMC A; 
#chains in the Genus database with same CATH homology
 2Q8T A;  1A3V A;  3G6J B;  2IT1 A;  1CTM A;  3NHH A;  2ENB A;  3LNN A;  3QWN A;  2AQ1 B;  5IGG A;  2K1B A;  2ZT9 C;  3BVZ A;  1XXG A;  2L9H A;  3NUC A;  3VA7 A;  4PMW A;  3S2D B;  4WFN 3;  1VCI A;  4KD3 A;  1BDO A;  4KHZ A;  1ZKO A;  5C44 B;  1I4R A;  5KYL A;  2FHT A;  4TKO B;  5LL6 S;  2NN6 G;  4KD4 A;  4EQN A;  4QUF A;  3M4O B;  1NR2 A;  2TMP A;  1VF7 A;  5C0X G;  2JP1 A;  2RDG A;  5FK9 C;  1I4Q A;  1NR4 A;  2A6E C;  3VR3 A;  2K7V A;  3M3Y B;  5G3L D;  5IT9 E;  3I4N B;  4V19 0;  3K5N A;  1Q12 A;  2EYP A;  2E74 C;  4RCO A;  1R4Q B;  3HRZ C;  1EZ8 A;  2DY8 A;  1IW7 C;  2EYO A;  2EOT A;  2SOB A;  2A69 D;  1JWU D;  4Q5V A;  4C2M B;  1F9R A;  1YNN C;  2XVS A;  2KCC A;  5C3X A;  1R9T B;  5EKL A;  1I3Q B;  5KEE A;  1PYW D;  5J22 A;  1UAP A;  1AEX A;  1BCP D;  2K32 A;  1WD0 A;  4CJ0 B;  4DN4 M;  5LL6 X;  2EYM A;  4CKE A;  4PV1 C;  4FO2 A;  4KY5 A;  4Q0F A;  3VR6 A;  1B53 A;  4HR7 B;  3HZX A;  4QMG A;  4EGV A;  1JB3 A;  2PZU A;  3FMC A;  2J0T D;  2BA0 A;  2HCI A;  4XQN A;  5I6W A;  3OHX C;  2IX0 A;  4X3K A;  3SXH A;  2PW7 A;  2VUM B;  4K5W A;  1L0X B;  4L8J A;  4A3B B;  3D31 A;  2FMC A;  1TWC B;  2F0W A;  3DXJ C;  1U9R A;  3EQL C;  2VNU D;  1CI3 M;  1MBY A;  3D4D A;  1WTP A;  4RWS C;  4FXK C;  2ID0 A;  1AFP A;  3CKI B;  1A15 A;  2RA4 A;  1TWA B;  3NTI A;  5K5P A;  3K7A B;  4UAI A;  5JPM C;  5KGU A;  4ILW A;  1O80 A;  4C3J G;  5COY A;  3PIO 3;  1HQR D;  2HUG A;  2XSC A;  3GV3 A;  1PZI D;  3BYT B;  5CV6 A;  2EVB A;  3K5L A;  2R93 B;  1LLR D;  3I4M B;  3GV6 A;  1UNS A;  3PIP 3;  5DM7 3;  1JOO A;  4IUU A;  3TSS A;  5CBA E;  3CRL C;  1A3T A;  3BVM A;  4CJ1 B;  1RHP A;  1Z6H A;  5FO8 B;  3H6M A;  5KNB A;  3W2D A;  1DOK A;  1SYC A;  4G7H C;  4TQU S;  1PXU A;  1I4H A;  1HA5 A;  1EYA A;  1X3P A;  2EZV A;  2KOL A;  3WDN A;  3S16 B;  2Q8R E;  4XQQ A;  3MC0 B;  1WD1 A;  4BA2 I;  1I4P A;  2B2T A;  3IKJ A;  1NCV A;  1B1Z A;  3CQZ B;  1TS4 A;  3I90 A;  3VYR A;  1D6E C;  2XNA C;  1H9J A;  2D2C C;  5C3W A;  4BA1 I;  1LTB D;  2A69 C;  4X3S A;  5EQ0 A;  1WTX A;  1SMY D;  1B4O A;  1DYQ A;  1MD2 D;  5IGC A;  3QOJ A;  3Q23 A;  4A3J B;  2B2Y C;  4KY6 A;  5IGB A;  1IHZ A;  5M3F B;  1BCP C;  2KQ3 A;  4K14 A;  4PNY A;  2X69 A;  2K33 A;  4E6I A;  4TRD A;  1HPC A;  1IYV A;  5FOB B;  2IWH A;  1XX8 A;  4OO1 H;  2H1E A;  5E4W C;  1J9O A;  5HUR A;  2CW0 D;  3RD4 A;  1SFO B;  3K59 A;  1KDC A;  1G2T A;  4DA2 A;  4K8I A;  1FNW A;  2MJ8 A;  1TII D;  4WJW A;  1WTQ A;  4DK1 A;  4KJO A;  3T53 B;  2KJX A;  4LK1 C;  3TP5 A;  1E2Z A;  2FJ2 A;  2EY2 A;  4HSP A;  4KV6 A;  4IAL A;  1EU4 A;  3VA5 A;  4RKB A;  2L5T A;  5IOC A;  2A6H D;  3E6Z X;  3FKI B;  1BQQ T;  2XN9 C;  1FNV A;  3OWE B;  4UDU C;  3DWQ A;  3HOV B;  3PUV A;  1ESF A;  1BOS A;  1EY9 A;  3PMF A;  4K2K A;  3VR4 A;  3PUY A;  1TVX A;  1OXS C;  4I65 A;  4BBR B;  4ZUJ A;  3A8K E;  3M85 A;  5CBE E;  2RSN A;  1GUO A;  4NDX A;  1B2T A;  4L63 B;  3J7Y W;  3N6R A;  5FLX L;  4KKS A;  2SDF A;  2K6A A;  2EJG C;  2R7Z B;  2K05 A;  4KN4 C;  5FLX E;  2K01 A;  3I72 A;  1EOT A;  3UI2 A;  4K6L A;  4M8A A;  3MXU A;  4PMB A;  1WVL A;  2EY6 A;  5CV5 A;  3MZ5 A;  3W3A A;  1A2U A;  1JCK B;  2F0S A;  3QG1 A;  1RJT A;  3FPP A;  4NMZ A;  3TN2 A;  2TSS A;  4FNF A;  3ERO A;  1TR5 A;  1PTO B;  1LT3 D;  2F03 A;  2KEC A;  1SMY C;  1HCZ A;  2QEJ C;  5CR3 A;  4G57 A;  1UUP A;  4LMQ D;  1EY8 A;  2B2V C;  2N88 A;  5A35 A;  4RAU C;  3LWE A;  4IFD G;  1BXT A;  2BOS A;  1RTN A;  1O7Y A;  2NZ1 D;  2I46 A;  2R6G A;  5TSS A;  2E2H B;  2WP8 J;  1EY4 A;  2HCC A;  4K8J A;  5T1G A;  4IUQ A;  1CZG A;  1ICW A;  2F1M A;  3K5O A;  2CW0 C;  1SE2 A;  2MP1 A;  4BWG B;  2LY7 A;  4CKC A;  1PRT B;  5ELD A;  4FF4 A;  4WRD A;  5CV8 A;  4BY1 B;  4RHR A;  2JA7 B;  3A56 A;  4N9T A;  4KTA A;  5EPL A;  1EL0 A;  1SE4 A;  2EDG A;  1L0Y B;  1STY A;  1ET9 A;  4DF7 A;  2MPM A;  2N55 A;  1AZQ A;  4OO1 I;  2LMC B;  3OMC A;  1EY7 A;  1BUV T;  3QOL A;  4EQO A;  4FXG C;  4A3G B;  4OIK A;  1BBX C;  3GO5 A;  2NYZ D;  5IGF A;  2A6H C;  5C4Z A;  1H9S A;  3D6C A;  1T5E A;  3RLF A;  4XYO A;  4R8N A;  3QIA A;  3I70 A;  5EPJ A;  3C1F A;  1GHK A;  3FEW X;  5DAU A;  2JA5 B;  2BA1 A;  3L3O C;  4DGZ A;  1M8A A;  1QCB D;  3OIQ A;  4K2L A;  2XRS D;  1F9S A;  1LT6 D;  3S1M B;  4K6D A;  1PMR A;  4ZYS A;  3OW7 A;  1KLU D;  1XTC D;  2XWB B;  1AZP A;  1EYD A;  1VDZ A;  2I07 B;  3AMU A;  3Q0A A;  4K5V A;  2VB3 X;  4HMJ A;  2K28 A;  3HEJ A;  5CV4 A;  3ND9 A;  2XRQ D;  4NW2 A;  4ZK9 B;  1D5X C;  1SYG A;  1STH A;  1TWH B;  1X3Q A;  1HQM C;  1HFN A;  2PO4 A;  4HED A;  2F0Q A;  3ZYY X;  3DWA A;  1GXD C;  2B2U C;  2Z4H A;  2PNR C;  2DY7 A;  2ICI A;  3A54 A;  2RVL A;  2KVM A;  1TS3 A;  1E2W A;  5FO9 B;  1O7L A;  1D5M C;  3C3L A;  2EYL A;  1C4Q A;  5C6A A;  2MHV A;  3PUX A;  4DXG A;  3I8Z A;  1VF5 C;  4C3I B;  3GTM B;  3Q24 A;  3HKZ B;  4MIU A;  2JEA I;  1HHV A;  2IPK D;  1R4P B;  4HCS A;  1RD9 D;  4X3U A;  4QIW B;  2WIN B;  3EVQ A;  5C4H A;  2BE5 D;  1EZ6 A;  1JQY D;  5FKA C;  2F0F A;  3T4A C;  4KN7 C;  4QF4 A;  2OXP A;  2PQE A;  3DWP A;  3RUZ A;  1E2V A;  4OGQ C;  3DM1 A;  2MUY A;  1DD2 A;  5C4J B;  4ZRZ A;  3MFG A;  3A7A B;  1EIH A;  1RF2 D;  5CV7 A;  1GUG A;  3P75 A;  3KLS X;  2F0N A;  1SYF A;  2F3W A;  3NK9 A;  1RKN A;  3HP3 A;  3F2U A;  4R9W A;  1MSG A;  1M4V A;  1NSN S;  2AWN A;  1GUT A;  5F2D A;  3MTS A;  2NWG A;  4CHT B;  1AP0 A;  1E0B A;  2AQ3 B;  2EE1 A;  3SEB A;  2E2I B;  2NVY B;  1EFI D;  2NVT B;  4F87 A;  1DCZ A;  5BN3 A;  1STE A;  1TY2 A;  1ENC A;  4OHJ A;  2Z1C A;  3K0Y A;  2EPB A;  1WTW A;  2KHS A;  1JOR A;  3P1H A;  4N9P A;  1HA6 A;  1PRT F;  4S3S A;  5M5W B;  3P20 A;  1W6J A;  1TWG B;  2WAQ B;  2H4O A;  4KKU A;  4Y7N B;  1TWF B;  3URY A;  2Y0S B;  1SAP A;  4DU9 A;  3LWU A;  2PZW A;  1EYC A;  1RTO A;  2LKV A;  3V2T A;  1WTR A;  1F9Q A;  4B08 A;  1TU2 B;  2X6G A;  2PMZ B;  3SR1 A;  3GTG B;  4DAV A;  1S5E D;  2SNM A;  3DEP A;  4BBS B;  3M7G A;  1ONL A;  3ND8 A;  4EVO A;  1UEA B;  1GUS A;  4XT3 B;  2EJF C;  3TBI B;  3TP8 A;  3NPP A;  1BO0 A;  2J4X A;  5HGT A;  1HUN A;  5EJW A;  1SNM A;  2O4X A;  3K57 A;  4IN3 A;  2MGS A;  4A3D B;  4H0L C;  1Y1W B;  1B9N A;  1F2Z A;  2F0V A;  4IFD H;  3NBH A;  4A3F B;  5M5X B;  1PLF A;  2O5J C;  4CGY B;  1LTT D;  4QUC A;  2G9D A;  3NWS A;  4H44 C;  4G4K A;  3VYU A;  4JK1 C;  5D3I B;  4RGT A;  1FD7 D;  1Q3L A;  4G7O C;  3SK8 A;  2CQA A;  1F2Y A;  4I7Z C;  2B2Y A;  3ONA B;  2QKI C;  4ODG A;  5COR A;  1SXT A;  1V1P A;  4P2C B;  2AQ2 B;  1OXT A;  1Q8I A;  1WCM B;  1QNU A;  1H9K A;  1D5Z C;  3SE0 A;  2BE5 C;  4XYQ A;  4MHE A;  2A68 D;  3GTO B;  1SJH D;  5JAV A;  3BDC A;  3GTP B;  4RHS A;  3I3C A;  4PQX A;  2HQE A;  4KI0 A;  3H3V C;  2F0P A;  2Q8I B;  4R8I A;  1DZ1 A;  5IIF A;  4KKT A;  2JA6 B;  3GTJ B;  3M4Y A;  5KYI A;  1NUC A;  3S9W A;  3GQB A;  3TP6 A;  4NKL A;  4KJN A;  3VYT A;  3S1R B;  1DON A;  1OXU A;  1EEI D;  2O5I C;  1ILQ A;  2B8G A;  2D62 A;  4QB4 A;  4HN7 A;  4RCN A;  1II3 A;  1EIG A;  2RQX A;  3C1E A;  3WOE A;  3R3O A;  1DOL A;  1FYC A;  2ICE C;  1CQF A;  1U4P A;  1ZYR D;  4ZUI A;  2L0C A;  3BDL A;  3R8B A;  1K8M A;  1PFB A;  1S4Z A;  4H13 C;  1RCV D;  5ELE A;  1KAA A;  3J81 L;  3J7A F;  4X3T A;  3MXP A;  2JEB I;  1CT1 D;  1AW7 A;  2KA7 A;  1SYB A;  1TY0 A;  2NTS A;  3J81 E;  2PPB C;  1QWY A;  2EYJ A;  4C3I G;  5M3M B;  3HG9 A;  4HTH A;  3KLR A;  1VMP A;  1KDB A;  2NN6 H;  5I2X A;  1PFN A;  3TZU A;  1G6Z A;  1EQV A;  1H9M A;  3V05 A;  1BR9 A;  2JSO A;  4GZY C;  5C0X H;  3HOY B;  4KHV A;  4F8M A;  4V0B A;  3S2H B;  3JAM L;  1SSO A;  2QIL A;  2IX3 A;  5J39 A;  5KIX A;  1KTK A;  3JAM E;  2YYZ A;  5JJZ A;  1K8O A;  3HGB A;  1JWM D;  1T5X D;  5EBC A;  1EU3 A;  1W6K A;  4IZ8 A;  2RKS A;  1ENA A;  5CYU A;  3DEO A;  3NTK A;  1H9S B;  1HXY D;  4PMC A;  2DNE A;  1U4M A;  2F0J A;  2O2L D;  2E76 C;  2BCO A;  3EA6 A;  5I4D A;  1QOH A;  1MI2 A;  1CHP D;  3S1N B;  4F7X A;  4A3M B;  1HTL D;  5JOB A;  3PV0 A;  2B2V A;  4IFD I;  1SBB B;  2EY5 A;  1EY0 A;  1Z7T A;  3TP7 A;  4B9W A;  1C8C A;  1PTO D;  3NTH A;  1GUN A;  4IQZ A;  4KY7 A;  5IOD A;  5NUC A;  3T13 A;  3GTK B;  2D5D A;  2A68 C;  2JA8 B;  2EY1 A;  4C3H G;  5CGK A;  3Q22 A;  3HOW B;  1G2S A;  3BZD B;  4A93 B;  3L9A X;  3DUZ A;  5E3F A;  4L6T B;  1AN8 A;  4TSS A;  1SNO A;  4HMI A;  4ZKB B;  3CRK C;  3TME A;  1CM9 A;  1V8Q A;  3MXN A;  3ITP A;  1MSH A;  1PRT D;  1LTS D;  1U4R A;  2JE6 I;  4IFD J;  1LV9 A;  1QJO A;  2KCN A;  3FVQ A;  1A2T A;  4F88 A;  2KUM A;  1JOQ A;  1Y8N B;  4RH6 A;  1G29 1;  2VB2 X;  2NTT A;  4G7Z C;  3NE5 B;  1F2L A;  1ZYR C;  3K5M A;  1PFM A;  5IGD A;  1U4L A;  3T51 B;  1EWC A;  5JEA G;  3LX0 A;  3SK6 A;  2L12 A;  3SHL A;  1B3A A;  3FRP B;  1PDQ A;  3DMU A;  1FR3 A;  5T1I A;  4DK0 A;  1V1O A;  1B9M A;  4ZAI A;  4DAP A;  3SK4 A;  5E4X A;  2L1B A;  2XWJ B;  1Y8P B;  2C5C A;  2K5W A;  1WTV A;  4ME5 A;  2CVR A;  5BN4 A;  4YIJ A;  2WV6 D;  4FF3 A;  2IX1 A;  1ILP A;  2F0U A;  1S5F D;  2DNC A;  5C3E B;  1EWH A;  4C1N K;  1DM0 B;  1Y1V B;  1EQT A;  3GTL B;  2RDF A;  2K03 A;  2EJM A;  4C1N I;  1BF4 A;  3VYS A;  4IUR A;  3D3R A;  2B2W A;  2NN6 I;  3MHB A;  2B2U A;  4ZLT F;  3OOC A;  5D65 A;  5D14 A;  1Q1E A;  1STG A;  5E1F A;  3PUZ A;  5C0X I;  1TS5 A;  5BN5 A;  1TKW B;  3R2T A;  2EYH A;  4U67 3;  5JPN C;  2RBM A;  2B2W C;  3HOZ B;  5KRU A;  4J1M A;  3HS0 C;  1LT5 D;  4RGM A;  3OPO A;  2R92 B;  3D8G A;  4IUT A;  1F2M A;  3Q6S A;  4ID6 A;  2LFN A;  4XQJ A;  1DJR D;  3ERQ A;  5DEH A;  2R3Z A;  3J80 L;  4RGO S;  1ROD A;  1PTO C;  3IL8 A;  2SNS A;  2M9V A;  5EKK A;  4KMU C;  2F0D A;  4J8Q A;  3J80 E;  3KUP A;  2OT2 A;  4FP5 D;  3IFD A;  4J6H A;  2AWO A;  5C5M A;  5IGE A;  5IT9 L;  3K6O A;  5C0X J;  5J1Z A;  4BS9 A;  3T56 B;  3SK5 A;  5M9O A;  1B44 D;  1D1K A;  1ML0 D;  3I4L A;  3I73 A;  2AUJ D;  4XDX A;  1EY5 A;  2PYK A;  1HFG A;  1C48 A;  4JBW A;  1LTR D;  3GD7 A;  5ISR A;  2XIW A;  1F77 A;  1PRT C;  4RA8 A;  3AB9 A;  3KF8 A;  1KAB A;  1SYD A;  1TT2 A;  3BVG A;  4C56 C;  1B50 A;  1O78 A;  1HTP A;  3EJI A;  2JXM B;  1QE6 A;  1I6V C;  4RFB A;  3OSO A;  1PTO F;  2PZT A;  3OIP A;  3E5S A;  1GUW A;  5ELB A;  4CKB A;  3A7L A;  4RGN A;  1HRJ A;  3H91 A;  2A74 C;  1JC7 A;  3N52 A;  1V1P B;  1BCP B;  1CZW A;  2LS0 1;  4ULL A;  1JWS D;  3MWY W;  5DM6 3;  3SDZ A;  4IUN A;  1O7Z A;  2QCP X;  4ZKC B;  5I2Y A;  2JYO A;  1MGS A;  5EBD A;  2K5Q A;  1Q1B A;  3J7A V;  1CHQ D;  5K36 G;  2F0M A;  2ZXO A;  2E2D C;  2SEB D;  3OWF A;  3R2I A;  4C3H B;  3RZO B;  3KBX A;  1TQO A;  1V43 A;  3CHB D;  2G9H D;  3PO3 B;  4XTC S;  4FVM A;  5ELC A;  4KK7 A;  2B8F A;  2FMM A;  1PZJ D;  2GA4 B;  3MXG A;  1SNP A;  2BDO A;  2KEE A;  1JR0 D;  4Z9C B;  5EGT A;  3FDT A;  1QNK A;  4K5X A;  3OMG A;  1S5D D;  3S15 B;  1I4G A;  5D3D A;  1SNC A;  1XYI A;  2FIN B;  2D9U A;  1S5B D;  3S1Q B;  1GOZ A;  2E2J B;  1ZXT A;  4DXF A;  3K58 A;  2B39 A;  2L4N A;  1LTA D;  2NB0 A;  2L11 A;  1FGB D;  3BG3 A;  4CJ2 C;  3KK7 A;  3U9O A;  1JE4 A;  1PZK D;  3M7N A;  2ZXR A;  3QB3 A;  1SEB D;  3R93 A;  1HUM A;  4DFA A;  4XIG S;  2YU9 B;  2CHB D;  5FO7 B;  4HSV A;  4FYD A;  1Z47 A;  2ZXP A;  4FXD A;  3H09 A;  3MA2 B;  3NXW A;  4A3I B;  5AFW A;  2OF1 A;  2J7Z A;  3DHQ A;  1GHJ A;  3G7L A;  1GJX A;  1J8I A;  1A6X A;  4A3E B;  1I4X A;  4OL7 A;  5JEA H;  2F0H A;  3S14 B;  4BY7 B;  4CBV A;  4ABN A;  1SE3 A;  3KBG A;  3CU7 A;  1WTO A;  2X6L A;  4AYB B;  2NVX B;  4B9X A;  2B2T C;  3P7J A;  1DOM A;  2K5D A;  2EXZ A;  1IKM A;  1CA6 A;  4IUV A;  4HAE A;  1QIL A;  2F0T A;  2KED A;  3RMH A;  2F0L A;  3C2P A;  4O42 A;  1QG7 A;  1ENF A;  2C9O A;  3NWT A;  3S17 B;  2F0K A;  5KND A;  5ELF A;  3C46 A;  2BDN A;  1G8Z D;  1K83 B;  2K04 A;  1Y69 U;  1CFM A;  5G3L F;  1EEF D;  3MAQ A;  4DAY A;  1XWE A;  1X32 A;  2V4D A;  3T16 A;  1QB5 D;  1IL8 A;  3BS1 A;  2WKC A;  3KLS A;  1LO5 D;  3TZD A;  2Z8L A;  4H7B A;  4WOR A;  2EYF A;  2NUC A;  3QO2 A;  3PO2 B;  2A73 B;  2F3V A;  3A8I E;  1SJE D;  5A2Q L;  1KDA A;  2DN8 A;  1I50 B;  1BCP F;  2WII B;  5A2Q E;  2QDB A;  5CMD A;  1OXX K;  1NAP A;  1EY6 A;  1ET6 A;  1Q90 A;  3U9S A;  5JVH 3;  3E0J A;  3NQI A;  2QF7 A;  2L55 A;  3HOX B;  1YNJ D;  5EPK A;  4IUP A;  1Y8O B;  3VR5 A;  2F0O A;  5EKI A;  1G91 A;  1SND A;  1CK1 A;  1LTI D;  1LAB A;  2WB1 B;  3I91 A;  2F0E A;  1JIC A;  5JVG 3;  1SYE A;  3X3M A;  2M00 A;  1LTG D;  3A55 A;  1D2B A;  3MVV A;  5I6Y A;  5DNF A;  1STA A;  3GTQ B;  2FFK B;  1IYU A;  2B63 B;  4O1N A;  1DXM A;  1OO9 B;  3SVM A;  3O13 A;  1KLG D;  2PCF B;  1A3U A;  3PUW A;  3NSW A;  2IW3 A;  3NBI A;  1STN A;  4FF2 A;  4LAA A;  4XT1 B;  3GP7 A;  4HCE A;  2A6E D;  2F0I A;  4XXE A;  1S5C D;  3IAY A;  1D1I A;  2E75 C;  5K36 H;  4QCL A;  4C3J B;  4DNR B;  1CA5 A;  1IW7 D;  1BNZ A;  4MN3 A;  3IFT A;  4RKL A;  1F9P A;  1PTO H;  1YNN D;  2RSO A;  1IKL A;  3D6W A;  3NQT A;  5C4X B;  3TDQ A;  3EFX D;  3BYY B;  5KNC A;  4LJZ C;  1SNQ A;  5CC4 A;  3D4R A;  2F0G A;  1STB A;  2RDH A;  2PW5 A;  3X3N A;  1TS2 A;  5M5Y B;  5I9O A;  1FNU A;  2VXW A;  2Z4I A;  1JOK A;  1SDF A;  1I6H B;  3MFY A;  1H9R A;  2A5H A;  4U68 A;  5I9P A;  1RDP D;  5CV9 A;  5JEA J;  3NP8 A;  3H94 A;  4OIJ A;  4NP5 A;  3MEH A;  3BDO A;  1KNA A;  3FPU B;  4DNT B;  2AUK A;  2WAC A;  1CQV A;  1ZEQ X;  3H0G B;  3WOF A;  2OEO A;  3A8J E;  3L7Z C;  4M1U B;  3HOU B;  3D4W A;  4OO1 G;  3V96 A;  2F4I A;  4EQP A;  2M2L A;  1YNJ C;  1LAC A;  2WKD A;  4ZQ3 A;  5C5L A;  3VR2 A;  2HDL A;  3RZD B;  1KNE A;  5LHY 1;  2HDM A;  1OXV A;  3QJY A;  2R61 A;  2NVQ B;  2NBF A;  1LT4 D;  4FF1 A;  1ESR A;  2IL8 A;  3AU7 A;  4A3K B;  2IJ0 A;  1VMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...