4C3JH

Structure of 14-subunit rna polymerase i at 3.35 a resolution, crystal form c2-90
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transcription
total genus 22
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4c3jH00
3S1NH 3CC7A 5GAHC 3HOWH 2I0QA 3K81C 1PA6A 1IBLQ 4B3RL 1PH7A 1K73C 1VQJA 2AWNA 4LF9Q 4FDBA 3E0EA 1AH9A 4LF6L 1I6HH 2VS1A 4YWLA 2Y0SE 3CCLA 4IPCA 4BXXH 1LM0A 2VY3A 4GNXA 4DR3L 2NVXH 5FJ8H 1XPUA 4GOPA 1JT8A 4ALPA 4YCVA 1EQQA 2UXCQ 3M4QA 3UDFA 2PI2A 1KC8C 2UXBQ 4YWMA 3PCOB 1VQAA 4LF5Q 1TXYA 4RMFA 4A3EG 2UU9L 4DV4L 3OW2A 1CKOA 5IT9c 1EIYB 4A3BG 5H1SE 4DV0Q 1YNXA 4R4CA 1MIUA 1LYLA 2MNAA 5FLMH 2F4VQ 4HIKA 5C0XI 1CSPA 1W2BA 2VNUD 3DM3A 1C9OA 1X54A 5C44G 4JC0A 1WCMG 3PUYA 1T9HA 4LUVA 4B3TQ 3PUZA 4J15A 1HR0L 3AFQA 2JE6I 1BBUA 2JA5G 3ULJA 4JI0L 2N8NA 1MJEA 4JV5L 2YTYA 4O0AA 4DR1Q 3PO2H 1HH2P 1WYDA 3PUVA 1VQFA 3PIOA 4GOPB 4LNQA 5GAEC 2DUDA 3E9HA 1NE3A 3GTLH 5JJKA 1KD1C 3W5OA 2GVBA 4MNOA 5BR8Q 2UXDL 4JI1Q 1HR0W 4LFAL 4YY3L 2D0OA 4X65L 3KFUA 3I7FA 4P74A 4R4OA 1Q86C 4QGUA 2JEBI 1UEBA 1NJIC 1ASZA 3U4ZA 5C0XG 1UE5A 3CCEA 1VQ7A 1I94Q 2UUBQ 1NMFA 5AJ3L 2BH2A 2MQHA 4JI3L 2VQEL 1Q8KA 4KHPQ 3BZKA 2Y0SG 2HHHL 1FVIA 2WFWA 3S15H 4R4QA 1Y1WG 1HNWL 3UDXA 1FGUA 3BJUA 3GTPH 1BBWA 3I4OA 5IP9H 4DUYL 2NVQH 4OO1I 1KRTA 2BA1A 1E24A 1X3EA 1CKMA 4Y52H 3CPWA 1P8LA 1TWGH 3HOXG 4L5RC 1Q1BA 1EYGA 1PH8A 4LFBQ 3K7UC 5IWAQ 1V43A 5E7NA 1B70B 1VQ9A 4OWTB 4LW1A 4Y7NH 2K50A 4BBRH 1PH4A 2ID0A 1TWCH 2JJQA 2A1AA 1SROA 2GVAA 4QY7A 4BY7G 3GTKH 3PF5A 1VQ5A 3L2PA 1XNRL 3RNUA 1IBKL 1IXRA 4JI4L 2K5HA 2ES2A 4DV3L 3I4NH 3OTOL 4OO1G 3I2ZA 4DV7L 2LXKA 1PH6A 4GKKQ 3FKIH 2R7FA 2OTJA 2YU9H 3GDEA 1Q82C 2HQLA 4PZ7A 3S14H 3TQYA 4JBKA 2UUCQ 4A3DG 1SR3A 4QJFA 3F8TA 1QZHA 2OWOA 4XTCS 4X62L 1Z47A 1GVPA 4K0KL 2WB1G 4DV2L 1PHJA 3J81j 4XIGS 2GN5A 4BY1H 4X66L 1VQMA 4HJ7A 4NXNL 4A3DH 4GKJL 1HNXQ 1PH5A 2Q2HA 3A74A 1N36L 2R93G 4A3MG 2KBNA 3KYHC 4AYBG 3M85A 1YBYA 3CW2C 3CCSA 2VUMG 1XMOQ 4R4IA 4EQ5A 3J80c 4JI8Q 5M3MG 3GTJH 2IY5B 4JI7L 1X56A 1D7QA 4YCUA 1S72A 1V9PA 1QVFA 2AMCB 2NZHA 3PUWA 1K9MC 3HOUH 4IPGA 1EQRA 4DUZL 1ASYA 2JA8G 2VUMH 1UE1A 5C4JH 4JYAL 2XTIA 5M3MH 5IYBG 4JI5Q 1CSQA 5IYCG 4JI6L 4X64Q 1NMGA 4OONA 2R7ZH 1VQLA 1XNQL 4AQYL 4LFCQ 3GTMH 5ELNA 1D8LA 1SLJA 4A3GG 4DK3C 3NBHB 5IYBH 1YZ6A 5LMNW 2XGTA 4PG3A 3HOWG 2CWPA 3CCMA 1EFWA 1KL9A 4DNIA 4DR5L 2CFMA 3KDFB 4C3JH 5JEAG 3J81c 4DR3Q 3I56A 2PQAB 2B3GA 3M4PA 2VL6A 4HIOA 1K3RA 4BXXG 5IP7H 3S1MH 4A3GH 1VQBA 4GS3A 4JOIC 5FJ8G 2A8VA 1QVCA 3S16H 2Z6KC 1HNZQ 5IYDH 1UWVA 2RHQB 3G71A 1JMCA 4PZ6A 2L15A 4KLKA 4C3IH 2UU9Q 3CD6A 3CAMA 3EIVA 2VQFL 2R7DA 4UPAA 4POFA 3UE0A 1A0IA 1PYBA 1XJVA 2R6GA 2QA4A 5ELOA 4IPDA 2RF4A 2D62A 2JA6G 2ATWA 2A19A 4TQUS 1Q81C 5FLMG 3RLOA 1HR0Q 2K4KA 1IL2A 3F1ZA 2NN6I 4JI0Q 1HZAA 3H0GH 4DK6C 3CCUA 4DV1L 3MXNB 3Q8DA 4DV6L 2JA6H 2WAQG 3TEHB 4DR7L 4HJ8A 3HOZH 5FLXc 4OWXB 4DR6L 3PO2G 2N3SA 5M3FH 2UXDQ 4POGA 3LGJA 4YY3Q 3CP0A 5C4XG 4UP8A 4X65Q 2E2IH 1SMXA 1TWFH 3OYYA 4DV5L 4HIMA 4B3ML 3GTGH 4IJHA 3E9IA 3HOVH 4IOAA 3F2BA 1KXLA 1B7YB 1OXUA 1CUKA 1UE6A 4JOIA 1JJGA 2YTXA 2Z6KA 3S1RH 1VQPA 3M9BA 3ERSX 2VQEQ 2IHEA 1GD7A 3HKSA 2LSSA 5C4XH 4LF8Q 1GM5A 1G51A 2NN6G 3CCVA 1X65A 1IBLL 3I4MG 4LF9L 1HNWQ 4LF4L 3U50C 3CF5A 1RL2A 2Q2IA 4OX9Q 1VS0A 3CXCA 4DUYQ 3PO3G 1SN8A 2IHFA 2ZTEA 1XMQQ 3CC4A 1N32L 1BVSA 2ZM6L 3KJOA 2RCNA 2KHJA 3AYHB 5K36G 3PUXA 1G291 5IP9G 1W3SA 2PMZE 5J3BA 3I4MH 4IFDI 2NVTH 3ULPA 2UXCL 2UXBL 4KHZA 4LUOA 3PO3H 1WOCA 3W1BA 3GD7A 4RG1A 4A3JH 2I5HA 1E3PA 2AKWB 2LXJA 3CMAA 1MJCA 3S2DH 5LMUL 3SGIA 1A8VA 4BBRG 4H02A 1Z9FA 4A3IG 2PNHA 4PZ8A 1A63A 1Y14B 1N33L 2EQSA 2MO1A 2CQOA 1Y1VG 4R4TA 4TVAB 5IE8A 4JBJA 1OXVA 2R92H 4DV3Q 1E7ZA 3OTOQ 4B3TL 1PVOA 4DV7Q 3A5UA 2QGQA 4BA1I 2V1CC 4A3IH 3I4NG 1VQ4A 2CCZA 3FKIG 1Y1VH 4X62Q 4YWKA 4IFDG 1VQNA 4X6AH 1J6QA 1KAWA 3TRZA 4DV2Q 3RR5A 4IO9A 2H5XA 5BR8L 4YHHQ 2D0PA 2K5NA 4YCWA 4A3KG 4NXNQ 4GKJQ 1Q1EA 2ALYB 3J80i 2UUAQ 4BY1G 4LF7Q 3H3VH 3STBC 3S17H 2E8GA 1JJCB 3FHWA 3T1HL 1N34Q 4C3HH 2RHSB 1R9TH 1RIPA 4A3KH 1A62A 1X9NA 1AE3A 1V1QA 2ZTCA 1O7IA 4DR4Q 1QVGA 4DUZQ 1VQ8A 1DGSA 4NXML 5LMNQ 3H15A 3PV0A 2OTLA 3J7A5 1K8AC 4JYAQ 3T1YQ 3K7AH 3CCJA 3HOUG 3S1QH 1PYSB 3HKZE 1JJ2A 4JI6Q 4GLVB 4LFBL 3KDFA 4A3LG 1H95A 5IWAL 2PQAA 1GKHA 1XNQQ 4AQYQ 4HJ9A 4OXPA 3TS2A 1C0AA 3M7NA 1YVCA 1L2FA 3J81i 1FJGQ 4NPSA 4DAMA 1IBMQ 3HOYG 2R7ZG 2OQ0A 1EOVA 1N9WA 4DR5Q 1K0RA 2IT1A 4A3LH 1X3FA 3FP9A 1YHBA 3CQZH 3HOYH 3AQQA 1BKBA 1JE5A 3KF6A 4GKKL 4B3RQ 2ZTDA 1VQKA 2NVYH 4DR2L 1X6OA 1X3GA 4IJLA 4O2DA 5IP7G 4LF6Q 2UUCL 4UP9A 1KIXA 2VQFQ 1KHIA 5IYDG 2NZOA 3BU2A 2HIVA 4KI0A 3U4VA 3G6EA 4QL5A 1U5KA 5M5XH 1E22A 3GO5A 1E1TA 4IPHA 3KLWA 1HNXL 2F3IA 3RN5A 4DV4Q 3PSIA 3H0GG 5EAYA 1XMOL 1SE8A 2I5LX 1X55A 4JI8L 4DR6Q 3ER0A 3GTOH 4A3CH 3KF6B 1EWIA 3I55A 2MO0A 3HKZG 3HOZG 1LUZA 3EN2A 4DV5Q 3ULLA 5M3FG 4B3MQ 4QQBX 1J5EL 1NTGA 2E5LL 3RLNA 4BA2I 4JV5Q 4MZ9A 5C0XJ 1K83H 2YV5A 1YITA 1CKNB 4X64L 1VQCA 1OTCA 1QUQB 2F52A 4P75A 3D31A 3HOVG 2IX1A 3EBEA 4LFCL 2K75A 1OXTA 5DLQE 2WP8J 2HT1A 4MTNA 4B3SL 4JI2L 4LFAQ 4LF4Q 5HGQA 3PF4A 1L0WA 3TS0A 3A5ZB 1M90C 1N32Q 1Q7YC 2JA7H 2ZM6Q 1GO3E 3MEFA 2C35B 2KENA 4JG2A 4IOCA 1EIFA 2PI2E 1WFQA 3JC66 3F2CA 5AJ3Q 3AFPA 1M1KC 4JI3Q 1XTDA 3WWVA 2HHHQ 2N49A 1OXSC 4GN3B 1KRSA 1TWAH 4A4IA 4AH6A 3A0JA 3JAMc 1HNZL 4L5SA 2JEAI 1G6PA 3TREA 1PH3A 4BBSG 3STBD 5JJLA 4AIMA 4LWCA 5LMUQ 3KJPA 4IFDJ 3VDYA 4A3JG 2JK8A 3DLLA 1E1OA 1L1OC 5IY0A 3G4SA 1N33Q 5JJIA 3NEMA 4UY8C 4BBSH 4A3EH 4JBMA 3S24A 3IRBA 1K8GA 3H3VI 4A3BH 2HIXA 2KCMA 4WJ3M 2R92G 4LF5L 2YYZA 1Q12A 3HFZB 4GNXB 2IX0A 4QIWE 4L5QA 5C44H 1TWHH 1WCMH 3RN2A 4DV0L 1VQEA 2F4VL 3K8AA 2JA5H 3D0FA 1XNRQ 3PIPA 1IBKQ 4JI4Q 1XPRA 1QZGA 1YJ9A 4GLXA 2I5MX 1YJNA 1S40A 3RZOH 1MKHA 1NY4A 2WB1E 1YI2A 4EX5A 4P72A 4OWWB 3PGZA 1OXXK 4P73A 3RLFA 4DR1L 3L0OA 3T1HQ 2OCEA 3BZCA 1HZBA 1PH1A 4LF8L 1LTLA 4K0KQ 4ME3A 4AYBE 5GAGC 4NB3A 1B8AA 4JI1L 1L1OA 2ASBA 1VQHA 4X66Q 1SFOH 2QEXA 4OX9L 3AEVA 4NXMQ 1NBWA 1XMQL 1N36Q 2VW9A 1HZCA 1WJJA 2Z0SA 4DKAC 4A3FG 2UUBL 1I94L 1Y1WH 5HY6A 1PH2A 2K14A 3KF8B 3ICEA 4KHPL 4JI7Q 2MFIA 2ZJPA 1YHQA 1HZ9A 1U0LA 1IZ6A 2AHOB 4C2MH 2KCTA 3L7ZC 3NENA 4JBWA 3HOXH 4HJ5A 4A75A 4A3FH 1PH9A 3RZDH 2Q2UA 4UP7A 5JEAJ 1VQGA 1PFSA 4A76A 2KHIA 4GLAC 1VCIA 5GADC 2VZAA 1L1OB 3CPFA 3K0XA 3J7ZC 1YIJA 1JB7A 3F2DA 4BY7H 5M5YH 4DR2Q 3UDGA 2ZJQA 2BH8A 4GN5A 1C7YA 2OQKA 5GROA 2CKZB 2JA9A 1SRUA 4HJAA 4P71A 2BA0A 4A93G 3UDIA 1PV4A 3NELA 2E2JH 1N8RC 4YHHL 2EIFA 2B29A 2JQOA 2YTVA 1Q46A 1I50H 2DGYA 3W1GA 5C3EG 2Q2TA 2N78A 1VQDA 3CCQA 3U58A 4A93H 1P16A 2UUAL 4LF7L 1HJPA 2FXQA 3GTQH 1WI5A 5GQOA 3UE1A 1N34L 4DPGA 3KOJA 3M3YH 2B63G 4PMWA 3CCRA 1CKNA 5C3EH 1FL0A 1QUQA 2EXDA 4A3MH 4DR4L 3K80C 2WAQE 2R93H 1VQ6A 4LUZA 4R1JA 4GNXC 2CWAA 2K5VA 4APVA 2K52A 3CC2A 3CMEA 5LMNL 3ZJYC 4DV1Q 4GOPC 1J5EQ 2E5LQ 4A3CG 1XPOA 3T1YL 2B63H 5M5WH 1VQOA 1I5FA 3B6YA 1IYJB 2AWOA 1I3QH 4DV6Q 3G48A 4DR7Q 4GN4B 1S3OA 2JA8H 4HIDA 1VQIA 1AE2A 1YEZA 2E2HH 4JI2Q 4B3SQ 1UE7A 1FJGL 4DAYB 1IBML 2ZJRA 1YJWA 5IYCH 4JCVE 3M4OH 1KQSA 4WJ4A 4L5TA 1YHAA 4JI5L 3S2HH 1EUJA 3JAMi 2JA7G
chains in the Genus database with same CATH superfamily
3CC7A 2I0QA 3K81C 1IBLQ 4B3RL 2WAQB 3E0EA 2B2TA 2O4XA 4O1NA 1GHKA 1LV9A 4BXXH 1WCMB 1RJTA 2NTSA 1XPUA 2C9OA 4K5VA 2UXBQ 3M4QA 2PI2A 1KC8C 3PCOB 2FFKB 4I65A 1VQAA 4I7ZC 5ELDA 4A3EG 4DV4L 2EJMA 1CKOA 1VF5C 5IT9c 4A3BG 1EQVA 1SDFA 4DV0Q 1YNXA 2F4VQ 3T4AC 5C0XI 1LACA 3H09A 3PUYA 4H0LC 4LUVA 4B3TQ 1HR0L 3AFQA 1DM0B 2FJ2A 3A54A 4J6HA 1MJEA 4C56C 4DR1Q 2F0EA 2XIWA 1WYDA 1KAAA 2NB0A 3GTLH 5GAEC 1PRTB 1SYFA 4FF4A 5BR8Q 4JI1Q 4RHSA 4LFAL 2B2WC 3D4DA 3KF8A 3DHQA 1LABA 2JXMB 3KFUA 1Q86C 1QNKA 1SBBB 3EQLC 1UE5A 2UUBQ 1I94Q 1NMFA 3HG9A 1FVIA 2WFWA 3A56A 4KY7A 5COYA 1FGUA 1E24A 1CKMA 3MVVA 1ENFA 3TZUA 3CPWA 1WD0A 1P8LA 4RWSC 1Q1BA 3E6ZX 4LFBQ 4B08A 5E4XA 1B70B 1VQ9A 4LW1A 4Y7NH 4BBRH 2C5CA 1R4PB 1TWCH 1W6KA 1STBA 1LTTD 2WB1B 1SROA 1D6EC 1HRJA 3PF5A 1VQ5A 2LFNA 2EPBA 4JI4L 3VR4A 3I4NH 4DV7L 2LXKA 4AYBB 4IFDH 1FNWA 1U4LA 1LTSD 2YU9H 1Q82C 4CGYB 2HQLA 3K59A 4RHRA 5M5WB 2PW7A 1F2LA 4K0KL 4OO1H 4DV2L 1JWSD 2GN5A 4BY1H 4WRDA 4X66L 1NAPA 4NXNL 1TS5A 1PH5A 2Q2HA 2R93G 1H9SA 2KBNA 4FO2A 1EWCA 2L11A 3CW2C 3OIPA 3U9SA 1CI3M 3CCSA 4TKOB 4EQ5A 1HA5A 5M3MG 2IY5B 2R61A 4ABNA 2F0FA 4C3IB 2JA8G 1UE1A 4JYAL 1RTOA 3HEJA 4K5WA 1AZQA 3RD4A 1ENAA 2E76C 3GTMH 1D5MC 1HHVA 4KJNA 1SLJA 4A3GG 5LMNW 4PG3A 2XNAC 1KL9A 3A8JE 4C3JH 2B3GA 3MZ5A 2XWBB 2VL6A 1K3RA 4BXXG 5IP7H 3H6MA 4GS3A 4IQZA 3S16H 1HNZQ 1TWFB 4L63B 5IGCA 5EGTA 1JMCA 3GTGB 2L15A 3EIVA 3JAML 4POFA 2K01A 5CV4A 1PYBA 1TT2A 3OOCA 2JA6G 4TQUS 3RLOA 1HR0Q 3F1ZA 2NN6I 4DK6C 3CCUA 3MXNB 4MTKA 4IUPA 3I4MB 4HJ8A 2NVTB 4U68A 1DZ1A 4A3JB 5C4XG 1EY9A 2JSOA 4IJHA 3E9IA 3HOVH 3F2BA 3NE5B 5EKKA 4FP5D 2TSSA 2J4XA 1TWGB 4U673 1GM5A 1LTAD 3C1FA 2OF1A 4X3SA 1EY8A 1JOKA 4I7AA 4LF4L 1PYWD 1RL2A 1PLFA 4OX9Q 4YIJA 1STHA 1SN8A 1XMQQ 1BVSA 3GTKB 4OGQC 1W3SA 3VA7A 4DNTB 4XYQA 1S4ZA 3ULPA 3D8GA 3PO3H 3W1BA 4RG1A 2R3ZA 2AKWB 3H91A 3BYTB 1EEFD 5E3FA 4ZLTF 4K8JA 1A8VA 4BBRG 1Z9FA 4GZYC 1R9TB 5NUCA 4K5XA 1EIHA 4R4TA 4TVAB 4DV7Q 5CR3A 4IUTA 1HFGA 4NP5A 3I4NG 1MSHA 4XQQA 1Y1VH 4IFDG 4X6AH 1VQNA 3I91A 1G6ZA 1J6QA 4JVZA 1DYQA 2H1EA 4DV2Q 4IO9A 2H5XA 3NUCA 3BYYB 4FXGC 2K5NA 4YCWA 4NXNQ 2D5DA 4DNRB 2UUAQ 4BY1G 3SR1A 2E8GA 3S17H 4ZRZA 3FHWA 3T1HL 4C3HH 1RIPA 4A3KH 1A62A 3HOYB 2R7ZB 1QVGA 3BZDB 3SHLA 4JYAQ 1EWHA 1I4GA 4PMCA 5JPNC 2KHSA 2TMPA 4KN7C 5CBEE 5IWAL 1I4HA 2F4IA 2A68C 1GOZA 1JOQA 4NPSA 2OQ0A 4ZUIA 2Q8RE 1U4PA 1YHBA 3URYA 1BKBA 2ZTDA 1VQKA 4IJLA 3F2UA 5IP7G 1HXYD 3CRKC 4LF6Q 4UP9A 1K83B 3U9OA 2MGSA 1A2TA 3PQIA 2B2YA 1TS4A 4LAAA 1U5KA 4QL5A 5M5XH 1XTCD 3R8BA 1HNXL 5EPLA 1F9RA 1DONA 5J39A 5EAYA 1Y69U 1F9SA 5KNBA 4FNFA 5IT9L 3KF6B 4A3CH 4DGZA 5C4HA 1S5BD 2MHVA 1S5FD 3I55A 1U4RA 3EFXD 4MN3A 4QCLA 3MFYA 4BA2I 3RLNA 1UNSA 4X64L 1VQCA 3V05A 1ZYRC 3SK5A 1GUWA 3HOVG 2IX1A 3EBEA 4BBSB 2K75A 1LTID 1OXTA 4LF4Q 2A5HA 1L0WA 4CBVA 3NBIA 1EY4A 3MXUA 1Q7YC 1C4QA 4JG2A 3CHBD 2B2UA 2PI2E 3QO2A 5AJ3Q 4JI3Q 5IIFA 1OXSC 3FPPA 4P2CB 1WVLA 3RZOB 1WTOA 5KNCA 5JJLA 2A69C 4CJ1B 2B8GA 4IZ8A 2HQEA 3G4SA 2HDMA 5JJIA 1D1IA 3NEMA 4UY8C 1LLRD 3VYSA 1EIGA 3H3VI 1GHJA 1I4QA 1ET6A 1Q12A 4QIWE 4L5QA 1TWHH 1WCMH 1Y1WB 3TDQA 2B2VA 2PNRC 1XNRQ 1A3VA 3PIPA 1BCPF 4GLXA 2I5MX 1LTBD 1ICWA 1MKHA 1YI2A 3TP5A 3RLFA 3T1HQ 2OCEA 1PH1A 5FOBB 2IPKD 2F0TA 1B44D 4C3HG 1SFOH 3AEVA 5G3LF 1NBWA 1N36Q 5FO9B 2VW9A 4QIWB 1HZCA 1WJJA 1O7YA 4RKLA 5KRUA 4A3FG 2KA7A 5CMDA 1PH2A 5EQ0A 3BDLA 3PIO3 3KF8B 1H9RA 4KHPL 1HCZA 4HMIA 4LJZC 4JBWA 1RCVD 1SNMA 1AN8A 3HP3A 5JVG3 3RZDH 1PH9A 1PFSA 3FDTA 1MHWC 1B50A 1YIJA 3EJIA 4BY7H 2EYFA 4GN5A 1C7YA 1SYGA 2JA9A 3DWAA 4HJAA 4CJ2C 1S5DD 2ZXPA 1EL0A 4KK7A 2Q8IB 4EQNA 3M4OB 4A93H 4LF7L 2XVSA 1HJPA 1WI5A 2KQ3A 2RSOA 4G7OC 3I4LA 4RAUC 1CKNA 5C3EH 1QUQA 4KV6A 3K80C 4LUZA 4R1JA 2A69D 1S5CD 2HUGA 4FVMA 5LMNL 3ZJYC 4DV1Q 4A3CG 3T1YL 2DJGC 2B63H 5M5WH 2XN9C 1VQIA 4KMUC 1FJGL 1H9SB 3A7LA 3LWUA 1IBML 3TSSA 3CU7A 1KQSA 4JI5L 1B9MA 1K73C 5JVH3 2I07B 3O13A 1DD2A 5CV7A 3WOEA 5GAHC 3HOWH 3I73A 1PA6A 1SYCA 4LF9Q 2KVMA 2Y0SE 3CCLA 3SK6A 4KY6A 5C44B 2M9VA 4DR3L 2ICEC 4GOPA 4ALPA 1EQQA 2RVLA 5IGBA 1XWEA 4HN7A 4YWMA 2IJ0A 1TXYA 3MFGA 1EIYB 5H1SE 4R4CA 3MWYW 1PTOB 1RF2D 1W2BA 3HRZC 1C9OA 1WCMG 1PZJD 3KK7A 3Q24A 4J15A 1KLGD 2JE6I 1H9JA 4JV5L 4O0AA 3PO2H 2Y0SB 1HH2P 4XT1B 1VQFA 2QKIC 1NE3A 5JJKA 2BE5C 1BR9A 2A74C 2D0OA 1AW7A 3I7FA 1IW7D 4ZQ3A 1NJIC 2DY7A 1OO9B 3IL8A 1A3TA 1RDPD 3D6WA 1BCPD 3CCEA 3L3OC 4KHPQ 4IUVA 3S15H 1SMYC 1L0YB 3CKIB 2SNMA 4PQXA 1HPCA 1QCBD 3UDXA 4CDCC 3BJUA 3GTPH 4OO1I 3IFDA 1AEXA 3I4OA 3NSWA 2NVQH 3Q6SA 1YNND 1X3EA 1TWGH 3GQBA 1U4MA 1PRTF 1PH8A 3K7UC 5G3LD 1V43A 1D2BA 4A3DB 4IUNA 4EVOA 4BY7G 3GTKH 3OSOA 3BS1A 3GTJB 1HTPA 1IBKL 4M8AA 1MI2A 3TBIB 2ES2A 3E3XA 4DV3L 3I2ZA 3HOUB 4GKKQ 2J7ZA 3MXGA 3GDEA 1H9MA 3WOFA 4PZ7A 3S14H 2VUMB 4FF2A 3P20A 1QZHA 2F0DA 1I3QB 1Z47A 1GVPA 3P75A 2WB1G 4LMQD 2RQXA 4K6LA 3OMCA 3GP7A 3MEHA 1TS3A 3KYHC 4HR7B 4AYBG 3M85A 2PYKA 4JI8Q 1GUGA 2HD3A 1K9MC 5IODA 4IPGA 5I9OA 1QG7A 5C4JH 2KCNA 5M3MH 4JI5Q 1PRTC 1CSQA 4JI6L 1NMGA 2R7ZH 1DCZA 1VQLA 3BVZA 2F0UA 4DK3C 2MUYA 3HOWG 2CWPA 4BS9A 2P5ZX 4DR5L 2CFMA 5JEAG 4DR3Q 3I56A 2L55A 4C3IG 2BE5D 3HOZB 3M4PA 5T1GA 3S1MH 4A3GH 1VQBA 4KKTA 1T5EA 2Z6KC 3CD6A 4KLKA 4RGNA 2D2CC 1JB3A 4K2LA 3S1RB 1A0IA 3RUZA 1SMYD 4RCOA 4OIJA 3I72A 5IT9E 2K5QA 1Q81C 2EE1A 1LT6D 1IL2A 1HZAA 3H0GH 3SVMA 1EFID 2A6HC 2OEOA 3Q8DA 4DV6L 2JA6H 3TEHB 1JR0D 4DR7L 4K14A 4CDFC 5FLXc 4DR6L 3PO2G 5M3FH 3LGJA 3M7GA 4KN4C 2E2IH 3EVQA 3OYYA 4DV5L 4HIMA 3S2DB 1LT3D 2K32A 1B7YB 1OXUA 3A8KE 4JOIA 1X3PA 1VQPA 2IW3A 2IHEA 1GD7A 5C4XH 4LF8Q 1M8AA 4QMGA 1ZXTA 1G51A 2DN8A 2KJXA 3FRPB 4TRDA 3I4MG 3U50C 1G8ZD 2Q2IA 4A3IB 1JQYD 4KTAA 4UHVA 3KJOA 4F7XA 3ND8A 5J3BA 3Q23A 3QWNA 2UXCL 1SE3A 1WOCA 2G9DA 2I5HA 2LXJA 5C3WA 1B1ZA 4UAIA 4H02A 2IWHA 5KYIA 2Z4IA 4PZ8A 1Y14B 2EQSA 2CQOA 2R92H 4CKCA 4DV3Q 1A15A 1HA6A 2QGQA 4R9WA 4BA1I 3MHBA 1PRTD 1VQ4A 2LS01 2L12A 1X32A 3TRZA 4KHVA 4YHHQ 1TU2B 5D3IB 5E1FA 2D0PA 1U9RA 3D6CA 1SAPA 1E2WA 1Q1EA 2F0JA 5ELCA 3UI2A 1EY7A 1IL8A 1KNAA 5KGUA 4CHTB 2RHSB 3CQZB 3K5MA 1X9NA 1AE3A 3KLSA 1V1QA 2SDFA 1ESFA 1WTQA 3AMUA 1PFBA 1DGSA 3H15A 2OTLA 3NBHA 1JWUD 3OIQA 2KCCA 3AU7A 4JI6Q 1K28A 1STYA 4GLVB 3KDFA 2PQAA 4QUFA 1C0AA 1KABA 1YVCA 4HMJA 5DM73 3HOYG 2A6HD 2R7ZG 4DR5Q 2IT1A 2RA4A 3FP9A 1SE2A 5IGFA 1TY2A 1JE5A 1QNUA 4B3RQ 2AQ1B 2NVYH 5C3XA 1X6OA 4O2DA 2UUCL 2F0MA 1KHIA 1A6XA 1HUNA 5ELBA 1SYEA 4KI0A 2F3WA 3K58A 4E6IA 4IPHA 3H3VC 4KD3A 1KTKA 1BOSA 4OEMB 4DV4Q 3RN5A 3H0GG 1XMOL 3ZYYX 1SE8A 2I5LX 4DR6Q 3GTOH 1CQFA 3IFTA 2MO0A 5CGKA 4DV5Q 1DOMA 5M3FG 4DK1A 1J5EL 2E5LL 5ELEA 1EOTA 1ZKOA 2YV5A 1CKNB 1C48A 1QUQB 2F52A 4P75A 5DNFA 4G4KA 1J8IA 4A3EB 4LFCL 4A3BB 5DLQE 2HT1A 4B3SL 3IAYA 4LFAQ 3A5ZB 4DA2A 2RBMA 2JA7H 2KENA 3J7YW 3JC66 2JN4A 1M1KC 2N49A 3TP7A 4A4IA 2K03A 4AH6A 4BBSG 1AFPA 4AIMA 4LWCA 4ZAIA 3MAQA 4Q0FA 3MC0B 2JK8A 3DLLA 1L1OC 4J1MA 3OPOA 1NSNS 3HGBA 4ZK9B 2RDFA 3G7LA 1VDZA 2WINB 1SNOA 2RDGA 2R92G 5LL6S 4LF5L 3HFZB 1II3A 5C44H 1RODA 3RN2A 1VQEA 3BVGA 4DU9A 3K8AA 5FO8B 2JA5H 4F8MA 4JI4Q 1ET9A 1XPRA 1QZGA 1YJNA 1S40A 1NR4A 2CH4W 3QIAA 4P73A 3K7AB 3S1QB 2GA4B 3BZCA 1HZBA 1JOOA 1VF7A 1LTLA 4K0KQ 1F2YA 4NKLA 1VQHA 2ASBA 4X66Q 5C0XH 2E75C 4RA8A 3DWPA 2FMMA 2EDGA 3QG1A 4XQJA 1V1PA 2E2JB 2K14A 3ICEA 2MFIA 1J9OA 2ZJPA 1U0LA 5HURA 3J80E 4A75A 4A3FH 3VYRA 2Q2UA 1V1OA 2BCOA 3FVQA 4UP7A 2CQAA 5JEAJ 2CW0C 1SYBA 1PZID 4GLAC 1L1OB 1D1KA 1JB7A 3F2DA 5M5YH 2ZJQA 2L1BA 4EQPA 5A2QL 1HTLD 1SRUA 2JP1A 1LT4D 2BA0A 1PV4A 4S3SA 2JA8B 4X3TA 1BF4A 3TMEA 2K1BA 3LWEA 1QOHA 3J81E 5LL6X 1WD1A 1I50H 2Q2TA 2N78A 1VQDA 3QOLA 1JC7A 1P16A 5DM63 3GTQH 1N34L 4DPGA 5A35A 4RH6A 3S9WA 2MJ8A 4PMWA 3CCRA 2B2TC 1GUSA 3KLRA 4DR4L 3DEPA 5CBAE 1J5EQ 5IOCA 2E5LQ 1I3QH 3TZDA 4GN4B 1S3OA 2E2HH 4B3SQ 2NUCA 2EY5A 1TWAB 2DY8A 5FLXL 1YJWA 5C4ZA 4FF1A 3I70A 1LT5D 4WJ4A 4L5TA 3NK9A 1CA6A 3BG3A 5TSSA 1GJXA 4X3UA 2PZWA 3S2HH 1K8OA 2JA7G 2G5DA 3T53B 3S1NH 1STNA 1UAPA 1PH7A 1VQJA 3VYUA 2FINB 3V2TA 1I6HH 4YWLA 4IPCA 1LM0A 2VY3A 3K6OA 3GTLB 4GNXA 3E0JA 2NVXH 3V96A 5FJ8H 1JT8A 4YCVA 3UDFA 3FPUB 1BDOA 4LF5Q 4DFAA 4RMFA 3OW2A 5EBCA 4PV1C 1I4RA 1LYLA 2MNAA 1BXTA 4HIKA 4N8FA 2PZUA 2VNUD 3ONAB 3DM3A 1X54A 5C44G 1T9HA 1XX8A 3DEOA 3PUZA 1EEID 2JA5G 1BBUA 3ULJA 4JI0L 2N8NA 5EPJA 3PUVA 3E9HA 1SEBD 1KD1C 4B9WA 2PW5A 4HSVA 1HR0W 2A68D 4Y7NB 3SDZA 1PFMA 4BBRB 4YY3L 1TWCB 4R4OA 4P74A 4QGUA 1UEBA 1ASZA 3HOXB 3TP8A 3U4ZA 3W3AA 5C0XG 2K6AA 1VQ7A 3NXWA 2BH2A 1PTOF 1Q8KA 2VQEL 1K3BC 2Y0SG 2HHHL 3I4NB 2EXZA 1HNWL 3NTKA 1IYVA 5K36H 2XWJB 3MTSA 2YU9B 3D4RA 4KKUA 1HFNA 4DUYL 2K04A 4Y52H 2PO4A 2F0IA 1CA5A 4L5RC 4EGVA 2O5IC 4K8IA 5IWAQ 5E7NA 4OWTB 2K50A 2L5TA 1PH4A 1SNDA 3ND9A 4N9PA 2F0PA 1Q90A 2B2WA 4QY7A 2DJFC 1GXDC 5D65A 1JORA 3W2DA 2K5HA 1WTHA 4ZCKA 4A3MB 2WKDA 2XSCA 1PH6A 1TS2A 1CK1A 3TQYA 4JBKA 4A3DG 4QJFA 1ZYRD 4XTCS 2QF7A 1YNJC 4XIGS 3KBXA 1VQMA 5J22A 4HJ7A 4GKJL 1HNXQ 3A74A 3VR3A 4C3JB 1PTOC 1YBYA 2A73B 2VUMG 4R4IA 3QR8A 4JI7L 1D7QA 1S72A 5CYUA 2X6GA 3S16B 1QVFA 2AMCB 2NZHA 3PUWA 3T51B 4JW0A 2G9HD 2K28A 3J7AF 2XTIA 5IYBG 4X64Q 3E5SA 1F9QA 4OONA 1ESRA 2AQ2B 4QUCA 2WV6D 4RGTA 2EYJA 4ZYSA 5C5MA 3NBHB 1YZ6A 5JPMC 2FHTA 1WTRA 3CCMA 3P1HA 3KDFB 2PQAB 2O2LD 2NTTA 4UDUC 5FJ8G 5IYDH 1ENCA 1O7ZA 5JEAH 4C3IH 5KNDA 3CAMA 2R7DA 1I6VC 3UE0A 3JAME 2QA4A 5ELOA 4IPDA 2F03A 2A19A 5AFWA 4JI0Q 1UEAB 4RFBA 1CT1D 2BDOA 5KEEA 2WAQG 1G91A 2V4DA 1HQMC 4OWXB 2EYLA 3R2IA 3PO3B 4POGA 4IUQA 4YY3Q 3CP0A 1UUPA 3N52A 4UP8A 2Z4HA 1TWFH 2Z8LA 3GTGH 1KXLA 2EJGC 3FMCA 2VQEQ 2LSSA 2NN6G 1IBLL 3X3MA 3CCVA 1HNWQ 1IKMA 1GUTA 2RKSA 1VS0A 4DUYQ 2IHFA 1S5ED 2L9HA 4DF7A 1Y1VB 1VMPA 5K36G 5DAUA 1G291 2PMZE 1YNJD 2Z1CA 3I4MH 3VR2A 4IFDI 2NVTH 3ERQA 2UXBL 4KHZA 4LUOA 3GD7A 3OWFA 4A3JH 3CMAA 1FNUA 1Y8NB 3FKIB 1XYIA 1PTOD 1SNQA 1MSGA 5EKLA 3SGIA 3S17B 3VR6A 3VR5A 2F0OA 4A3IG 4C3HB 2CH4A 1N33L 4A3KB 2MO1A 5I2XA 5IE8A 3DUZA 4JBJA 1OXVA 4R8IA 1E7ZA 4B3TL 1QWYA 2V1CC 1PZKD 2CCZA 5I9PA 4YWKA 4CJ0B 4FYDA 3RR5A 5BR8L 1MBYA 4ILWA 2LKVA 4GKJQ 4KD4A 3J80i 1JE4A 4LF7Q 3H3VH 1R9TH 5FO7B 4C1NI 1O7IA 2NWGA 3PIP3 2F1MA 4NXML 5LMNQ 3PV0A 2B2YC 3J7A5 1K8AC 1D5XC 3K7AH 3T1YQ 3S1QH 1PYSB 1Z7TA 3HKZE 1KLUD 1JJ2A 4DXGA 4LFBL 3T16A 4A3LG 1H95A 1GKHA 5M5XB 4HJ9A 4HTHA 1A3UA 2Q8TA 1L2FA 3J81i 1FJGQ 4L6TB 5A2QE 1IBMQ 3OMGA 1V1PB 1Y8OB 1EOVA 1N9WA 1K0RA 1X3FA 2N55A 2AUJD 3AQQA 3HOYH 3KF6A 5IGDA 5E4WC 1X3GA 4HCEA 4FXKC 5IYDG 2NZOA 5LHY1 2LY7A 3HKZB 2HIVA 3G6EA 1E22A 3GO5A 1E1TA 3KLWA 2B2UC 3Q22A 1QB5D 5KIXA 1BNZA 3PSIA 1PMRA 1X55A 1B4OA 1EWIA 3GV3A 1W6JA 2N88A 1LUZA 1Q3LA 3R93A 3K0YA 4QQBX 1NTGA 4JV5Q 1TQOA 1K83H 4DK0A 5C0XJ 1YITA 1SSOA 1OTCA 3FEWX 2L0CA 2WP8J 4MTNA 3KBGA 4JI2L 1AP0A 5HGQA 3PF4A 1LTRD 3TS0A 1QILA 2B2VC 1CFMA 3Q0AA 2EY6A 1TWHB 4K6DA 1GO3E 3MEFA 4IOCA 2CHBD 1WFQA 5IGGA 1XTDA 3C2PA 3WWVA 1E2ZA 4GN3B 1ML0D 1TWAH 3A0JA 1HNZL 1FNVA 1BO0A 2JEAI 2HDLA 3KJPA 5CC4A 4A3JG 3H94A 5IY0A 1N33Q 5CV6A 3SE0A 1CZWA 2KEDA 4BBSH 4JBMA 2HIXA 1SFOB 3NTIA 3PMFA 4WJ3M 2YYZA 4GNXB 1KDAA 3A8IE 3R2TA 2CVRA 3WDNA 3C46A 1DXMA 1IBKQ 3RZOH 1NY4A 2WB1E 2K5WA 4EX5A 1K0SA 1SJED 3RZDB 3PGZA 1O7LA 3BDCA 3L0OA 4XDXA 2OT2A 2OXPA 3VYTA 4AYBE 4FF3A 5K5PA 4BY7B 4R8NA 4OX9L 4NXMQ 1XMQL 1QE6A 1DOLA 2Z0SA 4DKAC 5ELFA 4OL7A 5HY6A 1Y1WH 1EQTA 1A2UA 4WFN3 2K33A 4XYOA 2PPBC 1YHQA 2AHOB 3L7ZC 3QJYA 4HJ5A 4A93B 3HOXH 4JK1C 2Z9HA 1ONLA 1Q8IA 4DAPA 1L0XB 1VQGA 4OHJA 1NNXA 1VCIA 5GADC 5C3EB 3CPFA 3J7ZC 4PNYA 2BH8A 4ID6A 3I90A 2OQKA 4RCNA 1HUMA 2B63B 3NPPA 4RGOS 2F3VA 3NELA 1TKWB 5D3DA 2EIFA 5JAVA 2SEBD 2B29A 2YTVA 3NP8A 1MD2D 1Q46A 4Z9CB 2DGYA 3W1GA 2UUAL 5L37A 2FXQA 4Q5VA 5BN3A 2MP1A 2M2LA 2MPMA 3HOWB 4ZKCB 1FL0A 2EXDA 4A3MH 1FYCA 1VQ6A 2EYHA 2ICIA 2CWAA 5FK9C 4APVA 2K52A 3CMEA 4GOPC 4ME5A 1XPOA 5HGTA 2X69A 4X3KA 1I5FA 2B8FA 1IYJB 3A55A 4DV6Q 3R3OA 3G48A 2E2DC 4DR7Q 3IKJA 2IX3A 4HIDA 1AE2A 4JI2Q 2RSNA 2K5DA 1UE7A 5BN5A 2F0GA 2ZJRA 1EU4A 5IYCH 3AB9A 4JCVE 1SYDA 3M4OH 1PXUA 1EUJA 3DM1A 3JAMi 2FMCA 1E2VA 4M1UB 4G7ZC 3NWTA 1SJHD 2VB2X 2AWNA 4FDBA 1AH9A 1D5ZC 4LF6L 2VS1A 3PO2B 2EYMA 5I4DA 2K05A 1RTNA 2UXCQ 1FD7D 4DN4M 5I6YA 2ZT9C 3RMHA 4HSPA 1AZPA 2KEEA 2UU9L 4ODGA 4RKBA 1MIUA 4OIKA 5FLMH 2NYZD 1CSPA 3S15B 4JC0A 4XT3B 2ENBA 4C1NK 3GTPB 2NVQB 1EZ6A 2EOTA 2YTYA 5T1IA 3SK4A 4GOPB 4LNQA 3PIOA 2DUDA 3KUPA 5BN4A 2IL8A 3W5OA 2GVBA 4MNOA 2UXDL 2EYOA 1EYAA 4C2MB 4X65L 2JEBI 3DMUA 5AJ3L 2MQHA 4JI3L 4N9TA 1PTOH 3BZKA 1R4QB 4MHEA 4R4QA 2EY2A 1Y1WG 1KNEA 3S14B 4G7HC 1BBWA 4JPBW 2XRQD 5IP9H 1KRTA 2BA1A 1XXGA 2RDHA 1EZ8A 1STGA 4RGMA 3HOXG 1EYGA 1SNCA 3NQTA 1F77A 2QEJC 2M00A 2D9UA 4G57A 2ID0A 3K57A 2JJQA 1CHQD 2A1AA 2GVAA 4TSSA 5CV5A 1IYUA 3L2PA 1O80A 1EY0A 5CV9A 1XNRL 1CZGA 3RNUA 1IXRA 3GV6A 1ILQA 3M3YB 4ZKBB 2R93B 3OTOL 4OO1G 3FKIH 5D14A 2R7FA 3K5LA 2OTJA 5C4JB 3D3RA 4NDXA 4NMZA 5M3MB 2BDNA 2UUCQ 1SR3A 3F8TA 2OWOA 4X62L 1M4VA 1BQQT 5DEHA 1PHJA 3J81j 4A3DH 1HQRD 2O5JC 4IN3A 5EKIA 1N36L 1PFNA 4A3MG 4DAYA 3M4YA 2F0HA 1XMOQ 2QDLA 3J80c 3GTJH 3QOJA 2J0TD 1X56A 3S1MB 4A3GB 4YCUA 5JJZA 1V9PA 4WORA 3HOUH 1EQRA 5F2DA 4DUZL 1ASYA 2VUMH 4WJWA 5IYCG 1NR2A 4C3JG 3EA6A 1XNQL 4AQYL 4LFCQ 5ELNA 4KY5A 1ILPA 1D8LA 3H0GB 3BVMA 5IYBH 2XGTA 1EFWA 1KDBA 4DNIA 3KLSX 2JA6B 3J81c 5CORA 4HIOA 5M3FB 2SNSA 4DXFA 2E2IB 4JOIC 2A8VA 5I6WA 1QVCA 2KUMA 1UWVA 2RHQB 3G71A 4PZ6A 2UU9Q 1DOKA 1WTXA 2XRSD 2VQFL 4UPAA 1XJVA 3I8ZA 2R6GA 5C4XB 4CKEA 2RF4A 2D62A 3T56B 3A7AB 2ATWA 3N6RA 2DNEA 5FLMG 2K4KA 1MGSA 4DV1L 4IALA 3HOZH 3X3NA 1G2TA 2N3SA 2UXDQ 1EY5A 1GUNA 2VB3X 2NBFA 4CDEC 4X65Q 1SMXA 1VMCA 3SK8A 4B3ML 4HAEA 4IOAA 2CW0D 1UE6A 1JJGA 1CUKA 2YTXA 2Z6KA 3S1RH 1WTVA 2AUKA 2X6LA 3ERSX 3M9BA 3HKSA 2R92B 3D4WA 4DAVA 1X65A 4LF9L 2WACA 3CF5A 4XQNA 3CXCA 3PO3G 2ZTEA 3CC4A 1F2MA 1N32L 2ZM6L 2RCNA 2KHJA 3AYHB 3PUXA 5IP9G 2NN6H 4QB4A 4N8X1 5C5LA 2L4NA 1X3QA 4ZUJA 1E3PA 3VA5A 1MJCA 3S2DH 5LMUL 3SXHA 2PQEA 3NTHA 2HCCA 2PNHA 5C6AA 1A63A 2F0VA 4K2KA 1Y1VG 1IHZA 3OTOQ 1PVOA 3A5UA 4BY1B 1CHPD 2QCPX 2EYPA 4A3IH 1CQVA 3FKIG 2A6EC 4X62Q 3CRLC 2E74C 1KAWA 1K8MA 3EROA 4A3KG 1H9KA 4H13C 1G2SA 2ALYB 3J7AV 3NWSA 2EJFC 2F0QA 3STBC 3QB3A 5EBDA 1JJCB 1N34Q 1LTGD 1WTPA 2ZTCA 3GTMB 4DR4Q 2NVYB 4DUZQ 1VQ8A 2PCFB 1QJOA 3CCJA 1STEA 3HOUG 2F0NA 3HS0C 1XNQQ 4AQYQ 3TS2A 4OXPA 4F87A 1RKNA 3M7NA 2B39A 4DAMA 1E0BA 1IW7C 2QDBA 4A3LH 3HZXA 1BCPC 4O42A 4H44C 1NCVA 3GTOB 2SOBA 2EZVA 3CQZH 2KOLA 1V8QA 5FKAC 1I4PA 2JYOA 4H7BA 4GKKL 3NHHA 4HEDA 4DR2L 4IURA 1B2TA 1EY6A 3DXJC 3OHXC 1KIXA 2VQFQ 1Y8PB 1YNNC 3BU2A 1Z6HA 1LO5D 3MXNA 4ULLA 5ISRA 3U4VA 2PZTA 1F9PA 3NQIA 2F3IA 4HCSA 2JA7B 3HOVB 2KECA 2DNCA 3K5NA 3OWEB 4JI8L 3ER0A 1ICFB 4BWGB 1TY0A 3HKZG 3I3CA 3HOZG 4V190 3EN2A 4CKBA 3SEBA 3ULLA 4B3MQ 4MZ9A 1JCKB 1B9NA 1PDQA 2ZXRA 1FGBD 1TVXA 4NW2A 2NZ1D 3D31A 1SXTA 5EJWA 1EYDA 1DJRD 4FXDA 1RD9D 1M90C 2A6ED 1N32Q 2ZM6Q 4PMBA 2C35B 2HCIA 1EIFA 5J1ZA 5JOBA 1O78A 3F2CA 2JA5B 4KJOA 4OELB 3AFPA 2Z6BA 1BCPB 2HHHQ 1KDCA 1KRSA 1G6PA 4B9XA 3JAMc 4L5SA 3TREA 1PH3A 5CV8A 3STBD 1BUVT 2EVBA 5LMUQ 4IFDJ 3VDYA 1C8CA 1E1OA 4A3EH 3S24A 3IRBA 5KYLA 1K8GA 4A3BH 2KCMA 1T5XD 2IX0A 3TP6A 4DV0L 2WKCA 2F4VL 1STAA 2QILA 3D0FA 1YJ9A 1TIID 1F2ZA 4A3FB 4F88A 4P72A 4OWWB 1OXXK 4DR1L 1WTWA 3T13A 4LF8L 4L8JA 2BOSA 4ME3A 2PMZB 5GAGC 4NB3A 1B8AA 1CTMA 2AQ3B 1L1OA 2EY1A 4JI1L 5M5YB 4J8QA 1SE4A 1I4XA 3K5OA 2QEXA 1BBXC 4XXEA 5EPKA 2UUBL 1I94L 1FR3A 1JWMD 3MA2B 4JI7Q 1HZ9A 1I50B 2H4OA 1IZ6A 1TR5A 3LX0A 4C2MH 1IKLA 3J80L 2KCTA 3NENA 5I2YA 4MIUA 2VXWA 3GTQB 1EYCA 4KKSA 4LK1C 2LMCB 4A76A 1EU3A 2KHIA 3C1EA 2F0LA 2VZAA 3K0XA 5IGEA 3MXPA 4DR2Q 3UDGA 1B3QA 5GROA 2CKZB 3P7JA 4P71A 1CM9A 3UDIA 4A93G 2E2JH 4IUUA 1NUCA 4YHHL 1N8RC 2E2HB 3C3LA 2K7VA 1B53A 3LNNA 3J81L 2JQOA 3BDOA 5C3EG 3U58A 1B3AA 3CCQA 2WIIB 2I46A 3S2HB 5GQOA 3UE1A 3L9AX 2F0WA 3KOJA 4EQOA 3M3YH 2RCFA 2B63G 3S1NB 2R93H 2WAQE 3TN2A 2ZXOA 5M9OA 2K5VA 4GNXC 3CC2A 1I6HB 1ZEQX 1VQOA 3B6YA 2NVXB 2AWOA 2QW7A 3DWQA 1RHPA 3G6JB 2JA8H 2F0SA 1YEZA 4V0BA 1SNPA 4DAYB 5FLXE 4CDDC 1JICA 2F0KA 1YHAA 4QF4A 3OW7A 1GUOA 3ITPA
chains in the Genus database with same CATH topology
3S1NH 3CC7A 5GAHC 3HOWH 2I0QA 3K81C 1PA6A 1IBLQ 4B3RL 1PH7A 1K73C 1VQJA 2AWNA 4LF9Q 4FDBA 3E0EA 1AH9A 4LF6L 1I6HH 2VS1A 4YWLA 2Y0SE 3CCLA 4IPCA 4BXXH 1LM0A 2VY3A 4GNXA 4DR3L 2NVXH 5FJ8H 1XPUA 4GOPA 1JT8A 4ALPA 4YCVA 1EQQA 2UXCQ 3M4QA 3UDFA 2PI2A 1KC8C 2UXBQ 4YWMA 3PCOB 1VQAA 4LF5Q 1TXYA 4RMFA 4A3EG 2UU9L 4DV4L 3OW2A 1CKOA 5IT9c 1EIYB 4A3BG 5H1SE 4DV0Q 1YNXA 4R4CA 1MIUA 1LYLA 2MNAA 5FLMH 2F4VQ 4HIKA 5C0XI 1CSPA 1W2BA 2VNUD 3DM3A 1C9OA 1X54A 5C44G 4JC0A 1WCMG 3PUYA 1T9HA 4LUVA 4B3TQ 3PUZA 4J15A 1HR0L 3AFQA 2JE6I 1BBUA 2JA5G 3ULJA 4JI0L 2N8NA 1MJEA 4JV5L 2YTYA 4O0AA 4DR1Q 3PO2H 1HH2P 1WYDA 3PUVA 1VQFA 3PIOA 4GOPB 4LNQA 5GAEC 2DUDA 3E9HA 1NE3A 3GTLH 5JJKA 1KD1C 3W5OA 2GVBA 4MNOA 5BR8Q 2UXDL 4JI1Q 1HR0W 4LFAL 4YY3L 2D0OA 4X65L 3KFUA 3I7FA 4P74A 4R4OA 1Q86C 4QGUA 2JEBI 1UEBA 1NJIC 1ASZA 3U4ZA 5C0XG 1UE5A 3CCEA 1VQ7A 1I94Q 2UUBQ 1NMFA 5AJ3L 2BH2A 2MQHA 4JI3L 2VQEL 1Q8KA 4KHPQ 3BZKA 2Y0SG 2HHHL 1FVIA 2WFWA 3S15H 4R4QA 1Y1WG 1HNWL 3UDXA 1FGUA 3BJUA 3GTPH 1BBWA 3I4OA 5IP9H 4DUYL 2NVQH 4OO1I 1KRTA 2BA1A 1E24A 1X3EA 1CKMA 4Y52H 3CPWA 1P8LA 1TWGH 3HOXG 4L5RC 1Q1BA 1EYGA 1PH8A 4LFBQ 3K7UC 5IWAQ 1V43A 5E7NA 1B70B 1VQ9A 4OWTB 4LW1A 4Y7NH 2K50A 4BBRH 1PH4A 2ID0A 1TWCH 2JJQA 2A1AA 1SROA 2GVAA 4QY7A 4BY7G 3GTKH 3PF5A 1VQ5A 3L2PA 1XNRL 3RNUA 1IBKL 1IXRA 4JI4L 2K5HA 2ES2A 4DV3L 3I4NH 3OTOL 4OO1G 3I2ZA 4DV7L 2LXKA 1PH6A 4GKKQ 3FKIH 2R7FA 2OTJA 2YU9H 3GDEA 1Q82C 2HQLA 4PZ7A 3S14H 3TQYA 4JBKA 2UUCQ 4A3DG 1SR3A 4QJFA 3F8TA 1QZHA 2OWOA 4XTCS 4X62L 1Z47A 1GVPA 4K0KL 2WB1G 4DV2L 1PHJA 3J81j 4XIGS 2GN5A 4BY1H 4X66L 1VQMA 4HJ7A 4NXNL 4A3DH 4GKJL 1HNXQ 1PH5A 2Q2HA 3A74A 1N36L 2R93G 4A3MG 2KBNA 3KYHC 4AYBG 3M85A 1YBYA 3CW2C 3CCSA 2VUMG 1XMOQ 4R4IA 4EQ5A 3J80c 4JI8Q 5M3MG 3GTJH 2IY5B 4JI7L 1X56A 1D7QA 4YCUA 1S72A 1V9PA 1QVFA 2AMCB 2NZHA 3PUWA 1K9MC 3HOUH 4IPGA 1EQRA 4DUZL 1ASYA 2JA8G 2VUMH 1UE1A 5C4JH 4JYAL 2XTIA 5M3MH 5IYBG 4JI5Q 1CSQA 5IYCG 4JI6L 4X64Q 1NMGA 4OONA 2R7ZH 1VQLA 1XNQL 4AQYL 4LFCQ 3GTMH 5ELNA 1D8LA 1SLJA 4A3GG 4DK3C 3NBHB 5IYBH 1YZ6A 5LMNW 2XGTA 4PG3A 3HOWG 2CWPA 3CCMA 1EFWA 1KL9A 4DNIA 4DR5L 2CFMA 3KDFB 4C3JH 5JEAG 3J81c 4DR3Q 3I56A 2PQAB 2B3GA 3M4PA 2VL6A 4HIOA 1K3RA 4BXXG 5IP7H 3S1MH 4A3GH 1VQBA 4GS3A 4JOIC 5FJ8G 2A8VA 1QVCA 3S16H 2Z6KC 1HNZQ 5IYDH 1UWVA 2RHQB 3G71A 1JMCA 4PZ6A 2L15A 4KLKA 4C3IH 2UU9Q 3CD6A 3CAMA 3EIVA 2VQFL 2R7DA 4UPAA 4POFA 3UE0A 1A0IA 1PYBA 1XJVA 2R6GA 2QA4A 5ELOA 4IPDA 2RF4A 2D62A 2JA6G 2ATWA 2A19A 4TQUS 1Q81C 5FLMG 3RLOA 1HR0Q 2K4KA 1IL2A 3F1ZA 2NN6I 4JI0Q 1HZAA 3H0GH 4DK6C 3CCUA 4DV1L 3MXNB 3Q8DA 4DV6L 2JA6H 2WAQG 3TEHB 4DR7L 4HJ8A 3HOZH 5FLXc 4OWXB 4DR6L 3PO2G 2N3SA 5M3FH 2UXDQ 4POGA 3LGJA 4YY3Q 3CP0A 5C4XG 4UP8A 4X65Q 2E2IH 1SMXA 1TWFH 3OYYA 4DV5L 4HIMA 4B3ML 3GTGH 4IJHA 3E9IA 3HOVH 4IOAA 3F2BA 1KXLA 1B7YB 1OXUA 1CUKA 1UE6A 4JOIA 1JJGA 2YTXA 2Z6KA 3S1RH 1VQPA 3M9BA 3ERSX 2VQEQ 2IHEA 1GD7A 3HKSA 2LSSA 5C4XH 4LF8Q 1GM5A 1G51A 2NN6G 3CCVA 1X65A 1IBLL 3I4MG 4LF9L 1HNWQ 4LF4L 3U50C 3CF5A 1RL2A 2Q2IA 4OX9Q 1VS0A 3CXCA 4DUYQ 3PO3G 1SN8A 2IHFA 2ZTEA 1XMQQ 3CC4A 1N32L 1BVSA 2ZM6L 3KJOA 2RCNA 2KHJA 3AYHB 5K36G 3PUXA 1G291 5IP9G 1W3SA 2PMZE 5J3BA 3I4MH 4IFDI 2NVTH 3ULPA 2UXCL 2UXBL 4KHZA 4LUOA 3PO3H 1WOCA 3W1BA 3GD7A 4RG1A 4A3JH 2I5HA 1E3PA 2AKWB 2LXJA 3CMAA 1MJCA 3S2DH 5LMUL 3SGIA 1A8VA 4BBRG 4H02A 1Z9FA 4A3IG 2PNHA 4PZ8A 1A63A 1Y14B 1N33L 2EQSA 2MO1A 2CQOA 1Y1VG 4R4TA 4TVAB 5IE8A 4JBJA 1OXVA 2R92H 4DV3Q 1E7ZA 3OTOQ 4B3TL 1PVOA 4DV7Q 3A5UA 2QGQA 4BA1I 2V1CC 4A3IH 3I4NG 1VQ4A 2CCZA 3FKIG 1Y1VH 4X62Q 4YWKA 4IFDG 1VQNA 4X6AH 1J6QA 1KAWA 3TRZA 4DV2Q 3RR5A 4IO9A 2H5XA 5BR8L 4YHHQ 2D0PA 2K5NA 4YCWA 4A3KG 4NXNQ 4GKJQ 1Q1EA 2ALYB 3J80i 2UUAQ 4BY1G 4LF7Q 3H3VH 3STBC 3S17H 2E8GA 1JJCB 3FHWA 3T1HL 1N34Q 4C3HH 2RHSB 1R9TH 1RIPA 4A3KH 1A62A 1X9NA 1AE3A 1V1QA 2ZTCA 1O7IA 4DR4Q 1QVGA 4DUZQ 1VQ8A 1DGSA 4NXML 5LMNQ 3H15A 3PV0A 2OTLA 3J7A5 1K8AC 4JYAQ 3T1YQ 3K7AH 3CCJA 3HOUG 3S1QH 1PYSB 3HKZE 1JJ2A 4JI6Q 4GLVB 4LFBL 3KDFA 4A3LG 1H95A 5IWAL 2PQAA 1GKHA 1XNQQ 4AQYQ 4HJ9A 4OXPA 3TS2A 1C0AA 3M7NA 1YVCA 1L2FA 3J81i 1FJGQ 4NPSA 4DAMA 1IBMQ 3HOYG 2R7ZG 2OQ0A 1EOVA 1N9WA 4DR5Q 1K0RA 2IT1A 4A3LH 1X3FA 3FP9A 1YHBA 3CQZH 3HOYH 3AQQA 1BKBA 1JE5A 3KF6A 4GKKL 4B3RQ 2ZTDA 1VQKA 2NVYH 4DR2L 1X6OA 1X3GA 4IJLA 4O2DA 5IP7G 4LF6Q 2UUCL 4UP9A 1KIXA 2VQFQ 1KHIA 5IYDG 2NZOA 3BU2A 2HIVA 4KI0A 3U4VA 3G6EA 4QL5A 1U5KA 5M5XH 1E22A 3GO5A 1E1TA 4IPHA 3KLWA 1HNXL 2F3IA 3RN5A 4DV4Q 3PSIA 3H0GG 5EAYA 1XMOL 1SE8A 2I5LX 1X55A 4JI8L 4DR6Q 3ER0A 3GTOH 4A3CH 3KF6B 1EWIA 3I55A 2MO0A 3HKZG 3HOZG 1LUZA 3EN2A 4DV5Q 3ULLA 5M3FG 4B3MQ 4QQBX 1J5EL 1NTGA 2E5LL 3RLNA 4BA2I 4JV5Q 4MZ9A 5C0XJ 1K83H 2YV5A 1YITA 1CKNB 4X64L 1VQCA 1OTCA 1QUQB 2F52A 4P75A 3D31A 3HOVG 2IX1A 3EBEA 4LFCL 2K75A 1OXTA 5DLQE 2WP8J 2HT1A 4MTNA 4B3SL 4JI2L 4LFAQ 4LF4Q 5HGQA 3PF4A 1L0WA 3TS0A 3A5ZB 1M90C 1N32Q 1Q7YC 2JA7H 2ZM6Q 1GO3E 3MEFA 2C35B 2KENA 4JG2A 4IOCA 1EIFA 2PI2E 1WFQA 3JC66 3F2CA 5AJ3Q 3AFPA 1M1KC 4JI3Q 1XTDA 3WWVA 2HHHQ 2N49A 1OXSC 4GN3B 1KRSA 1TWAH 4A4IA 4AH6A 3A0JA 3JAMc 1HNZL 4L5SA 2JEAI 1G6PA 3TREA 1PH3A 4BBSG 3STBD 5JJLA 4AIMA 4LWCA 5LMUQ 3KJPA 4IFDJ 3VDYA 4A3JG 2JK8A 3DLLA 1E1OA 1L1OC 5IY0A 3G4SA 1N33Q 5JJIA 3NEMA 4UY8C 4BBSH 4A3EH 4JBMA 3S24A 3IRBA 1K8GA 3H3VI 4A3BH 2HIXA 2KCMA 4WJ3M 2R92G 4LF5L 2YYZA 1Q12A 3HFZB 4GNXB 2IX0A 4QIWE 4L5QA 5C44H 1TWHH 1WCMH 3RN2A 4DV0L 1VQEA 2F4VL 3K8AA 2JA5H 3D0FA 1XNRQ 3PIPA 1IBKQ 4JI4Q 1XPRA 1QZGA 1YJ9A 4GLXA 2I5MX 1YJNA 1S40A 3RZOH 1MKHA 1NY4A 2WB1E 1YI2A 4EX5A 4P72A 4OWWB 3PGZA 1OXXK 4P73A 3RLFA 4DR1L 3L0OA 3T1HQ 2OCEA 3BZCA 1HZBA 1PH1A 4LF8L 1LTLA 4K0KQ 4ME3A 4AYBE 5GAGC 4NB3A 1B8AA 4JI1L 1L1OA 2ASBA 1VQHA 4X66Q 1SFOH 2QEXA 4OX9L 3AEVA 4NXMQ 1NBWA 1XMQL 1N36Q 2VW9A 1HZCA 1WJJA 2Z0SA 4DKAC 4A3FG 2UUBL 1I94L 1Y1WH 5HY6A 1PH2A 2K14A 3KF8B 3ICEA 4KHPL 4JI7Q 2MFIA 2ZJPA 1YHQA 1HZ9A 1U0LA 1IZ6A 2AHOB 4C2MH 2KCTA 3L7ZC 3NENA 4JBWA 3HOXH 4HJ5A 4A75A 4A3FH 1PH9A 3RZDH 2Q2UA 4UP7A 5JEAJ 1VQGA 1PFSA 4A76A 2KHIA 4GLAC 1VCIA 5GADC 2VZAA 1L1OB 3CPFA 3K0XA 3J7ZC 1YIJA 1JB7A 3F2DA 4BY7H 5M5YH 4DR2Q 3UDGA 2ZJQA 2BH8A 4GN5A 1C7YA 2OQKA 5GROA 2CKZB 2JA9A 1SRUA 4HJAA 4P71A 2BA0A 4A93G 3UDIA 1PV4A 3NELA 2E2JH 1N8RC 4YHHL 2EIFA 2B29A 2JQOA 2YTVA 1Q46A 1I50H 2DGYA 3W1GA 5C3EG 2Q2TA 2N78A 1VQDA 3CCQA 3U58A 4A93H 1P16A 2UUAL 4LF7L 1HJPA 2FXQA 3GTQH 1WI5A 5GQOA 3UE1A 1N34L 4DPGA 3KOJA 3M3YH 2B63G 4PMWA 3CCRA 1CKNA 5C3EH 1FL0A 1QUQA 2EXDA 4A3MH 4DR4L 3K80C 2WAQE 2R93H 1VQ6A 4LUZA 4R1JA 4GNXC 2CWAA 2K5VA 4APVA 2K52A 3CC2A 3CMEA 5LMNL 3ZJYC 4DV1Q 4GOPC 1J5EQ 2E5LQ 4A3CG 1XPOA 3T1YL 2B63H 5M5WH 1VQOA 1I5FA 3B6YA 1IYJB 2AWOA 1I3QH 4DV6Q 3G48A 4DR7Q 4GN4B 1S3OA 2JA8H 4HIDA 1VQIA 1AE2A 1YEZA 2E2HH 4JI2Q 4B3SQ 1UE7A 1FJGL 4DAYB 1IBML 2ZJRA 1YJWA 5IYCH 4JCVE 3M4OH 1KQSA 4WJ4A 4L5TA 1YHAA 4JI5L 3S2HH 1EUJA 3JAMi 2JA7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1N H;  3CC7 A;  5GAH C;  3HOW H;  2I0Q A;  3K81 C;  1PA6 A;  1IBL Q;  4B3R L;  1PH7 A;  1K73 C;  1VQJ A;  2AWN A;  4LF9 Q;  4FDB A;  3E0E A;  1AH9 A;  4LF6 L;  1I6H H;  2VS1 A;  4YWL A;  2Y0S E;  3CCL A;  4IPC A;  4BXX H;  1LM0 A;  2VY3 A;  4GNX A;  4DR3 L;  2NVX H;  5FJ8 H;  1XPU A;  4GOP A;  1JT8 A;  4ALP A;  4YCV A;  1EQQ A;  2UXC Q;  3M4Q A;  3UDF A;  2PI2 A;  1KC8 C;  2UXB Q;  4YWM A;  3PCO B;  1VQA A;  4LF5 Q;  1TXY A;  4RMF A;  4A3E G;  2UU9 L;  4DV4 L;  3OW2 A;  1CKO A;  5IT9 c;  1EIY B;  4A3B G;  5H1S E;  4DV0 Q;  1YNX A;  4R4C A;  1MIU A;  1LYL A;  2MNA A;  5FLM H;  2F4V Q;  4HIK A;  5C0X I;  1CSP A;  1W2B A;  2VNU D;  3DM3 A;  1C9O A;  1X54 A;  5C44 G;  4JC0 A;  1WCM G;  3PUY A;  1T9H A;  4LUV A;  4B3T Q;  3PUZ A;  4J15 A;  1HR0 L;  3AFQ A;  2JE6 I;  1BBU A;  2JA5 G;  3ULJ A;  4JI0 L;  2N8N A;  1MJE A;  4JV5 L;  2YTY A;  4O0A A;  4DR1 Q;  3PO2 H;  1HH2 P;  1WYD A;  3PUV A;  1VQF A;  3PIO A;  4GOP B;  4LNQ A;  5GAE C;  2DUD A;  3E9H A;  1NE3 A;  3GTL H;  5JJK A;  1KD1 C;  3W5O A;  2GVB A;  4MNO A;  5BR8 Q;  2UXD L;  4JI1 Q;  1HR0 W;  4LFA L;  4YY3 L;  2D0O A;  4X65 L;  3KFU A;  3I7F A;  4P74 A;  4R4O A;  1Q86 C;  4QGU A;  2JEB I;  1UEB A;  1NJI C;  1ASZ A;  3U4Z A;  5C0X G;  1UE5 A;  3CCE A;  1VQ7 A;  1I94 Q;  2UUB Q;  1NMF A;  5AJ3 L;  2BH2 A;  2MQH A;  4JI3 L;  2VQE L;  1Q8K A;  4KHP Q;  3BZK A;  2Y0S G;  2HHH L;  1FVI A;  2WFW A;  3S15 H;  4R4Q A;  1Y1W G;  1HNW L;  3UDX A;  1FGU A;  3BJU A;  3GTP H;  1BBW A;  3I4O A;  5IP9 H;  4DUY L;  2NVQ H;  4OO1 I;  1KRT A;  2BA1 A;  1E24 A;  1X3E A;  1CKM A;  4Y52 H;  3CPW A;  1P8L A;  1TWG H;  3HOX G;  4L5R C;  1Q1B A;  1EYG A;  1PH8 A;  4LFB Q;  3K7U C;  5IWA Q;  1V43 A;  5E7N A;  1B70 B;  1VQ9 A;  4OWT B;  4LW1 A;  4Y7N H;  2K50 A;  4BBR H;  1PH4 A;  2ID0 A;  1TWC H;  2JJQ A;  2A1A A;  1SRO A;  2GVA A;  4QY7 A;  4BY7 G;  3GTK H;  3PF5 A;  1VQ5 A;  3L2P A;  1XNR L;  3RNU A;  1IBK L;  1IXR A;  4JI4 L;  2K5H A;  2ES2 A;  4DV3 L;  3I4N H;  3OTO L;  4OO1 G;  3I2Z A;  4DV7 L;  2LXK A;  1PH6 A;  4GKK Q;  3FKI H;  2R7F A;  2OTJ A;  2YU9 H;  3GDE A;  1Q82 C;  2HQL A;  4PZ7 A;  3S14 H;  3TQY A;  4JBK A;  2UUC Q;  4A3D G;  1SR3 A;  4QJF A;  3F8T A;  1QZH A;  2OWO A;  4XTC S;  4X62 L;  1Z47 A;  1GVP A;  4K0K L;  2WB1 G;  4DV2 L;  1PHJ A;  3J81 j;  4XIG S;  2GN5 A;  4BY1 H;  4X66 L;  1VQM A;  4HJ7 A;  4NXN L;  4A3D H;  4GKJ L;  1HNX Q;  1PH5 A;  2Q2H A;  3A74 A;  1N36 L;  2R93 G;  4A3M G;  2KBN A;  3KYH C;  4AYB G;  3M85 A;  1YBY A;  3CW2 C;  3CCS A;  2VUM G;  1XMO Q;  4R4I A;  4EQ5 A;  3J80 c;  4JI8 Q;  5M3M G;  3GTJ H;  2IY5 B;  4JI7 L;  1X56 A;  1D7Q A;  4YCU A;  1S72 A;  1V9P A;  1QVF A;  2AMC B;  2NZH A;  3PUW A;  1K9M C;  3HOU H;  4IPG A;  1EQR A;  4DUZ L;  1ASY A;  2JA8 G;  2VUM H;  1UE1 A;  5C4J H;  4JYA L;  2XTI A;  5M3M H;  5IYB G;  4JI5 Q;  1CSQ A;  5IYC G;  4JI6 L;  4X64 Q;  1NMG A;  4OON A;  2R7Z H;  1VQL A;  1XNQ L;  4AQY L;  4LFC Q;  3GTM H;  5ELN A;  1D8L A;  1SLJ A;  4A3G G;  4DK3 C;  3NBH B;  5IYB H;  1YZ6 A;  5LMN W;  2XGT A;  4PG3 A;  3HOW G;  2CWP A;  3CCM A;  1EFW A;  1KL9 A;  4DNI A;  4DR5 L;  2CFM A;  3KDF B;  4C3J H;  5JEA G;  3J81 c;  4DR3 Q;  3I56 A;  2PQA B;  2B3G A;  3M4P A;  2VL6 A;  4HIO A;  1K3R A;  4BXX G;  5IP7 H;  3S1M H;  4A3G H;  1VQB A;  4GS3 A;  4JOI C;  5FJ8 G;  2A8V A;  1QVC A;  3S16 H;  2Z6K C;  1HNZ Q;  5IYD H;  1UWV A;  2RHQ B;  3G71 A;  1JMC A;  4PZ6 A;  2L15 A;  4KLK A;  4C3I H;  2UU9 Q;  3CD6 A;  3CAM A;  3EIV A;  2VQF L;  2R7D A;  4UPA A;  4POF A;  3UE0 A;  1A0I A;  1PYB A;  1XJV A;  2R6G A;  2QA4 A;  5ELO A;  4IPD A;  2RF4 A;  2D62 A;  2JA6 G;  2ATW A;  2A19 A;  4TQU S;  1Q81 C;  5FLM G;  3RLO A;  1HR0 Q;  2K4K A;  1IL2 A;  3F1Z A;  2NN6 I;  4JI0 Q;  1HZA A;  3H0G H;  4DK6 C;  3CCU A;  4DV1 L;  3MXN B;  3Q8D A;  4DV6 L;  2JA6 H;  2WAQ G;  3TEH B;  4DR7 L;  4HJ8 A;  3HOZ H;  5FLX c;  4OWX B;  4DR6 L;  3PO2 G;  2N3S A;  5M3F H;  2UXD Q;  4POG A;  3LGJ A;  4YY3 Q;  3CP0 A;  5C4X G;  4UP8 A;  4X65 Q;  2E2I H;  1SMX A;  1TWF H;  3OYY A;  4DV5 L;  4HIM A;  4B3M L;  3GTG H;  4IJH A;  3E9I A;  3HOV H;  4IOA A;  3F2B A;  1KXL A;  1B7Y B;  1OXU A;  1CUK A;  1UE6 A;  4JOI A;  1JJG A;  2YTX A;  2Z6K A;  3S1R H;  1VQP A;  3M9B A;  3ERS X;  2VQE Q;  2IHE A;  1GD7 A;  3HKS A;  2LSS A;  5C4X H;  4LF8 Q;  1GM5 A;  1G51 A;  2NN6 G;  3CCV A;  1X65 A;  1IBL L;  3I4M G;  4LF9 L;  1HNW Q;  4LF4 L;  3U50 C;  3CF5 A;  1RL2 A;  2Q2I A;  4OX9 Q;  1VS0 A;  3CXC A;  4DUY Q;  3PO3 G;  1SN8 A;  2IHF A;  2ZTE A;  1XMQ Q;  3CC4 A;  1N32 L;  1BVS A;  2ZM6 L;  3KJO A;  2RCN A;  2KHJ A;  3AYH B;  5K36 G;  3PUX A;  1G29 1;  5IP9 G;  1W3S A;  2PMZ E;  5J3B A;  3I4M H;  4IFD I;  2NVT H;  3ULP A;  2UXC L;  2UXB L;  4KHZ A;  4LUO A;  3PO3 H;  1WOC A;  3W1B A;  3GD7 A;  4RG1 A;  4A3J H;  2I5H A;  1E3P A;  2AKW B;  2LXJ A;  3CMA A;  1MJC A;  3S2D H;  5LMU L;  3SGI A;  1A8V A;  4BBR G;  4H02 A;  1Z9F A;  4A3I G;  2PNH A;  4PZ8 A;  1A63 A;  1Y14 B;  1N33 L;  2EQS A;  2MO1 A;  2CQO A;  1Y1V G;  4R4T A;  4TVA B;  5IE8 A;  4JBJ A;  1OXV A;  2R92 H;  4DV3 Q;  1E7Z A;  3OTO Q;  4B3T L;  1PVO A;  4DV7 Q;  3A5U A;  2QGQ A;  4BA1 I;  2V1C C;  4A3I H;  3I4N G;  1VQ4 A;  2CCZ A;  3FKI G;  1Y1V H;  4X62 Q;  4YWK A;  4IFD G;  1VQN A;  4X6A H;  1J6Q A;  1KAW A;  3TRZ A;  4DV2 Q;  3RR5 A;  4IO9 A;  2H5X A;  5BR8 L;  4YHH Q;  2D0P A;  2K5N A;  4YCW A;  4A3K G;  4NXN Q;  4GKJ Q;  1Q1E A;  2ALY B;  3J80 i;  2UUA Q;  4BY1 G;  4LF7 Q;  3H3V H;  3STB C;  3S17 H;  2E8G A;  1JJC B;  3FHW A;  3T1H L;  1N34 Q;  4C3H H;  2RHS B;  1R9T H;  1RIP A;  4A3K H;  1A62 A;  1X9N A;  1AE3 A;  1V1Q A;  2ZTC A;  1O7I A;  4DR4 Q;  1QVG A;  4DUZ Q;  1VQ8 A;  1DGS A;  4NXM L;  5LMN Q;  3H15 A;  3PV0 A;  2OTL A;  3J7A 5;  1K8A C;  4JYA Q;  3T1Y Q;  3K7A H;  3CCJ A;  3HOU G;  3S1Q H;  1PYS B;  3HKZ E;  1JJ2 A;  4JI6 Q;  4GLV B;  4LFB L;  3KDF A;  4A3L G;  1H95 A;  5IWA L;  2PQA A;  1GKH A;  1XNQ Q;  4AQY Q;  4HJ9 A;  4OXP A;  3TS2 A;  1C0A A;  3M7N A;  1YVC A;  1L2F A;  3J81 i;  1FJG Q;  4NPS A;  4DAM A;  1IBM Q;  3HOY G;  2R7Z G;  2OQ0 A;  1EOV A;  1N9W A;  4DR5 Q;  1K0R A;  2IT1 A;  4A3L H;  1X3F A;  3FP9 A;  1YHB A;  3CQZ H;  3HOY H;  3AQQ A;  1BKB A;  1JE5 A;  3KF6 A;  4GKK L;  4B3R Q;  2ZTD A;  1VQK A;  2NVY H;  4DR2 L;  1X6O A;  1X3G A;  4IJL A;  4O2D A;  5IP7 G;  4LF6 Q;  2UUC L;  4UP9 A;  1KIX A;  2VQF Q;  1KHI A;  5IYD G;  2NZO A;  3BU2 A;  2HIV A;  4KI0 A;  3U4V A;  3G6E A;  4QL5 A;  1U5K A;  5M5X H;  1E22 A;  3GO5 A;  1E1T A;  4IPH A;  3KLW A;  1HNX L;  2F3I A;  3RN5 A;  4DV4 Q;  3PSI A;  3H0G G;  5EAY A;  1XMO L;  1SE8 A;  2I5L X;  1X55 A;  4JI8 L;  4DR6 Q;  3ER0 A;  3GTO H;  4A3C H;  3KF6 B;  1EWI A;  3I55 A;  2MO0 A;  3HKZ G;  3HOZ G;  1LUZ A;  3EN2 A;  4DV5 Q;  3ULL A;  5M3F G;  4B3M Q;  4QQB X;  1J5E L;  1NTG A;  2E5L L;  3RLN A;  4BA2 I;  4JV5 Q;  4MZ9 A;  5C0X J;  1K83 H;  2YV5 A;  1YIT A;  1CKN B;  4X64 L;  1VQC A;  1OTC A;  1QUQ B;  2F52 A;  4P75 A;  3D31 A;  3HOV G;  2IX1 A;  3EBE A;  4LFC L;  2K75 A;  1OXT A;  5DLQ E;  2WP8 J;  2HT1 A;  4MTN A;  4B3S L;  4JI2 L;  4LFA Q;  4LF4 Q;  5HGQ A;  3PF4 A;  1L0W A;  3TS0 A;  3A5Z B;  1M90 C;  1N32 Q;  1Q7Y C;  2JA7 H;  2ZM6 Q;  1GO3 E;  3MEF A;  2C35 B;  2KEN A;  4JG2 A;  4IOC A;  1EIF A;  2PI2 E;  1WFQ A;  3JC6 6;  3F2C A;  5AJ3 Q;  3AFP A;  1M1K C;  4JI3 Q;  1XTD A;  3WWV A;  2HHH Q;  2N49 A;  1OXS C;  4GN3 B;  1KRS A;  1TWA H;  4A4I A;  4AH6 A;  3A0J A;  3JAM c;  1HNZ L;  4L5S A;  2JEA I;  1G6P A;  3TRE A;  1PH3 A;  4BBS G;  3STB D;  5JJL A;  4AIM A;  4LWC A;  5LMU Q;  3KJP A;  4IFD J;  3VDY A;  4A3J G;  2JK8 A;  3DLL A;  1E1O A;  1L1O C;  5IY0 A;  3G4S A;  1N33 Q;  5JJI A;  3NEM A;  4UY8 C;  4BBS H;  4A3E H;  4JBM A;  3S24 A;  3IRB A;  1K8G A;  3H3V I;  4A3B H;  2HIX A;  2KCM A;  4WJ3 M;  2R92 G;  4LF5 L;  2YYZ A;  1Q12 A;  3HFZ B;  4GNX B;  2IX0 A;  4QIW E;  4L5Q A;  5C44 H;  1TWH H;  1WCM H;  3RN2 A;  4DV0 L;  1VQE A;  2F4V L;  3K8A A;  2JA5 H;  3D0F A;  1XNR Q;  3PIP A;  1IBK Q;  4JI4 Q;  1XPR A;  1QZG A;  1YJ9 A;  4GLX A;  2I5M X;  1YJN A;  1S40 A;  3RZO H;  1MKH A;  1NY4 A;  2WB1 E;  1YI2 A;  4EX5 A;  4P72 A;  4OWW B;  3PGZ A;  1OXX K;  4P73 A;  3RLF A;  4DR1 L;  3L0O A;  3T1H Q;  2OCE A;  3BZC A;  1HZB A;  1PH1 A;  4LF8 L;  1LTL A;  4K0K Q;  4ME3 A;  4AYB E;  5GAG C;  4NB3 A;  1B8A A;  4JI1 L;  1L1O A;  2ASB A;  1VQH A;  4X66 Q;  1SFO H;  2QEX A;  4OX9 L;  3AEV A;  4NXM Q;  1NBW A;  1XMQ L;  1N36 Q;  2VW9 A;  1HZC A;  1WJJ A;  2Z0S A;  4DKA C;  4A3F G;  2UUB L;  1I94 L;  1Y1W H;  5HY6 A;  1PH2 A;  2K14 A;  3KF8 B;  3ICE A;  4KHP L;  4JI7 Q;  2MFI A;  2ZJP A;  1YHQ A;  1HZ9 A;  1U0L A;  1IZ6 A;  2AHO B;  4C2M H;  2KCT A;  3L7Z C;  3NEN A;  4JBW A;  3HOX H;  4HJ5 A;  4A75 A;  4A3F H;  1PH9 A;  3RZD H;  2Q2U A;  4UP7 A;  5JEA J;  1VQG A;  1PFS A;  4A76 A;  2KHI A;  4GLA C;  1VCI A;  5GAD C;  2VZA A;  1L1O B;  3CPF A;  3K0X A;  3J7Z C;  1YIJ A;  1JB7 A;  3F2D A;  4BY7 H;  5M5Y H;  4DR2 Q;  3UDG A;  2ZJQ A;  2BH8 A;  4GN5 A;  1C7Y A;  2OQK A;  5GRO A;  2CKZ B;  2JA9 A;  1SRU A;  4HJA A;  4P71 A;  2BA0 A;  4A93 G;  3UDI A;  1PV4 A;  3NEL A;  2E2J H;  1N8R C;  4YHH L;  2EIF A;  2B29 A;  2JQO A;  2YTV A;  1Q46 A;  1I50 H;  2DGY A;  3W1G A;  5C3E G;  2Q2T A;  2N78 A;  1VQD A;  3CCQ A;  3U58 A;  4A93 H;  1P16 A;  2UUA L;  4LF7 L;  1HJP A;  2FXQ A;  3GTQ H;  1WI5 A;  5GQO A;  3UE1 A;  1N34 L;  4DPG A;  3KOJ A;  3M3Y H;  2B63 G;  4PMW A;  3CCR A;  1CKN A;  5C3E H;  1FL0 A;  1QUQ A;  2EXD A;  4A3M H;  4DR4 L;  3K80 C;  2WAQ E;  2R93 H;  1VQ6 A;  4LUZ A;  4R1J A;  4GNX C;  2CWA A;  2K5V A;  4APV A;  2K52 A;  3CC2 A;  3CME A;  5LMN L;  3ZJY C;  4DV1 Q;  4GOP C;  1J5E Q;  2E5L Q;  4A3C G;  1XPO A;  3T1Y L;  2B63 H;  5M5W H;  1VQO A;  1I5F A;  3B6Y A;  1IYJ B;  2AWO A;  1I3Q H;  4DV6 Q;  3G48 A;  4DR7 Q;  4GN4 B;  1S3O A;  2JA8 H;  4HID A;  1VQI A;  1AE2 A;  1YEZ A;  2E2H H;  4JI2 Q;  4B3S Q;  1UE7 A;  1FJG L;  4DAY B;  1IBM L;  2ZJR A;  1YJW A;  5IYC H;  4JCV E;  3M4O H;  1KQS A;  4WJ4 A;  4L5T A;  1YHA A;  4JI5 L;  3S2H H;  1EUJ A;  3JAM i;  2JA7 G; 
#chains in the Genus database with same CATH topology
 3CC7 A;  2I0Q A;  3K81 C;  1IBL Q;  4B3R L;  2WAQ B;  3E0E A;  2B2T A;  2O4X A;  4O1N A;  1GHK A;  1LV9 A;  4BXX H;  1WCM B;  1RJT A;  2NTS A;  1XPU A;  2C9O A;  4K5V A;  2UXB Q;  3M4Q A;  2PI2 A;  1KC8 C;  3PCO B;  2FFK B;  4I65 A;  1VQA A;  4I7Z C;  5ELD A;  4A3E G;  4DV4 L;  2EJM A;  1CKO A;  1VF5 C;  5IT9 c;  4A3B G;  1EQV A;  1SDF A;  4DV0 Q;  1YNX A;  2F4V Q;  3T4A C;  5C0X I;  1LAC A;  3H09 A;  3PUY A;  4H0L C;  4LUV A;  4B3T Q;  1HR0 L;  3AFQ A;  1DM0 B;  2FJ2 A;  3A54 A;  4J6H A;  1MJE A;  4C56 C;  4DR1 Q;  2F0E A;  2XIW A;  1WYD A;  1KAA A;  2NB0 A;  3GTL H;  5GAE C;  1PRT B;  1SYF A;  4FF4 A;  5BR8 Q;  4JI1 Q;  4RHS A;  4LFA L;  2B2W C;  3D4D A;  3KF8 A;  3DHQ A;  1LAB A;  2JXM B;  3KFU A;  1Q86 C;  1QNK A;  1SBB B;  3EQL C;  1UE5 A;  2UUB Q;  1I94 Q;  1NMF A;  3HG9 A;  1FVI A;  2WFW A;  3A56 A;  4KY7 A;  5COY A;  1FGU A;  1E24 A;  1CKM A;  3MVV A;  1ENF A;  3TZU A;  3CPW A;  1WD0 A;  1P8L A;  4RWS C;  1Q1B A;  3E6Z X;  4LFB Q;  4B08 A;  5E4X A;  1B70 B;  1VQ9 A;  4LW1 A;  4Y7N H;  4BBR H;  2C5C A;  1R4P B;  1TWC H;  1W6K A;  1STB A;  1LTT D;  2WB1 B;  1SRO A;  1D6E C;  1HRJ A;  3PF5 A;  1VQ5 A;  2LFN A;  2EPB A;  4JI4 L;  3VR4 A;  3I4N H;  4DV7 L;  2LXK A;  4AYB B;  4IFD H;  1FNW A;  1U4L A;  1LTS D;  2YU9 H;  1Q82 C;  4CGY B;  2HQL A;  3K59 A;  4RHR A;  5M5W B;  2PW7 A;  1F2L A;  4K0K L;  4OO1 H;  4DV2 L;  1JWS D;  2GN5 A;  4BY1 H;  4WRD A;  4X66 L;  1NAP A;  4NXN L;  1TS5 A;  1PH5 A;  2Q2H A;  2R93 G;  1H9S A;  2KBN A;  4FO2 A;  1EWC A;  2L11 A;  3CW2 C;  3OIP A;  3U9S A;  1CI3 M;  3CCS A;  4TKO B;  4EQ5 A;  1HA5 A;  5M3M G;  2IY5 B;  2R61 A;  4ABN A;  2F0F A;  4C3I B;  2JA8 G;  1UE1 A;  4JYA L;  1RTO A;  3HEJ A;  4K5W A;  1AZQ A;  3RD4 A;  1ENA A;  2E76 C;  3GTM H;  1D5M C;  1HHV A;  4KJN A;  1SLJ A;  4A3G G;  5LMN W;  4PG3 A;  2XNA C;  1KL9 A;  3A8J E;  4C3J H;  2B3G A;  3MZ5 A;  2XWB B;  2VL6 A;  1K3R A;  4BXX G;  5IP7 H;  3H6M A;  4GS3 A;  4IQZ A;  3S16 H;  1HNZ Q;  1TWF B;  4L63 B;  5IGC A;  5EGT A;  1JMC A;  3GTG B;  2L15 A;  3EIV A;  3JAM L;  4POF A;  2K01 A;  5CV4 A;  1PYB A;  1TT2 A;  3OOC A;  2JA6 G;  4TQU S;  3RLO A;  1HR0 Q;  3F1Z A;  2NN6 I;  4DK6 C;  3CCU A;  3MXN B;  4MTK A;  4IUP A;  3I4M B;  4HJ8 A;  2NVT B;  4U68 A;  1DZ1 A;  4A3J B;  5C4X G;  1EY9 A;  2JSO A;  4IJH A;  3E9I A;  3HOV H;  3F2B A;  3NE5 B;  5EKK A;  4FP5 D;  2TSS A;  2J4X A;  1TWG B;  4U67 3;  1GM5 A;  1LTA D;  3C1F A;  2OF1 A;  4X3S A;  1EY8 A;  1JOK A;  4I7A A;  4LF4 L;  1PYW D;  1RL2 A;  1PLF A;  4OX9 Q;  4YIJ A;  1STH A;  1SN8 A;  1XMQ Q;  1BVS A;  3GTK B;  4OGQ C;  1W3S A;  3VA7 A;  4DNT B;  4XYQ A;  1S4Z A;  3ULP A;  3D8G A;  3PO3 H;  3W1B A;  4RG1 A;  2R3Z A;  2AKW B;  3H91 A;  3BYT B;  1EEF D;  5E3F A;  4ZLT F;  4K8J A;  1A8V A;  4BBR G;  1Z9F A;  4GZY C;  1R9T B;  5NUC A;  4K5X A;  1EIH A;  4R4T A;  4TVA B;  4DV7 Q;  5CR3 A;  4IUT A;  1HFG A;  4NP5 A;  3I4N G;  1MSH A;  4XQQ A;  1Y1V H;  4IFD G;  4X6A H;  1VQN A;  3I91 A;  1G6Z A;  1J6Q A;  4JVZ A;  1DYQ A;  2H1E A;  4DV2 Q;  4IO9 A;  2H5X A;  3NUC A;  3BYY B;  4FXG C;  2K5N A;  4YCW A;  4NXN Q;  2D5D A;  4DNR B;  2UUA Q;  4BY1 G;  3SR1 A;  2E8G A;  3S17 H;  4ZRZ A;  3FHW A;  3T1H L;  4C3H H;  1RIP A;  4A3K H;  1A62 A;  3HOY B;  2R7Z B;  1QVG A;  3BZD B;  3SHL A;  4JYA Q;  1EWH A;  1I4G A;  4PMC A;  5JPN C;  2KHS A;  2TMP A;  4KN7 C;  5CBE E;  5IWA L;  1I4H A;  2F4I A;  2A68 C;  1GOZ A;  1JOQ A;  4NPS A;  2OQ0 A;  4ZUI A;  2Q8R E;  1U4P A;  1YHB A;  3URY A;  1BKB A;  2ZTD A;  1VQK A;  4IJL A;  3F2U A;  5IP7 G;  1HXY D;  3CRK C;  4LF6 Q;  4UP9 A;  1K83 B;  3U9O A;  2MGS A;  1A2T A;  3PQI A;  2B2Y A;  1TS4 A;  4LAA A;  1U5K A;  4QL5 A;  5M5X H;  1XTC D;  3R8B A;  1HNX L;  5EPL A;  1F9R A;  1DON A;  5J39 A;  5EAY A;  1Y69 U;  1F9S A;  5KNB A;  4FNF A;  5IT9 L;  3KF6 B;  4A3C H;  4DGZ A;  5C4H A;  1S5B D;  2MHV A;  1S5F D;  3I55 A;  1U4R A;  3EFX D;  4MN3 A;  4QCL A;  3MFY A;  4BA2 I;  3RLN A;  1UNS A;  4X64 L;  1VQC A;  3V05 A;  1ZYR C;  3SK5 A;  1GUW A;  3HOV G;  2IX1 A;  3EBE A;  4BBS B;  2K75 A;  1LTI D;  1OXT A;  4LF4 Q;  2A5H A;  1L0W A;  4CBV A;  3NBI A;  1EY4 A;  3MXU A;  1Q7Y C;  1C4Q A;  4JG2 A;  3CHB D;  2B2U A;  2PI2 E;  3QO2 A;  5AJ3 Q;  4JI3 Q;  5IIF A;  1OXS C;  3FPP A;  4P2C B;  1WVL A;  3RZO B;  1WTO A;  5KNC A;  5JJL A;  2A69 C;  4CJ1 B;  2B8G A;  4IZ8 A;  2HQE A;  3G4S A;  2HDM A;  5JJI A;  1D1I A;  3NEM A;  4UY8 C;  1LLR D;  3VYS A;  1EIG A;  3H3V I;  1GHJ A;  1I4Q A;  1ET6 A;  1Q12 A;  4QIW E;  4L5Q A;  1TWH H;  1WCM H;  1Y1W B;  3TDQ A;  2B2V A;  2PNR C;  1XNR Q;  1A3V A;  3PIP A;  1BCP F;  4GLX A;  2I5M X;  1LTB D;  1ICW A;  1MKH A;  1YI2 A;  3TP5 A;  3RLF A;  3T1H Q;  2OCE A;  1PH1 A;  5FOB B;  2IPK D;  2F0T A;  1B44 D;  4C3H G;  1SFO H;  3AEV A;  5G3L F;  1NBW A;  1N36 Q;  5FO9 B;  2VW9 A;  4QIW B;  1HZC A;  1WJJ A;  1O7Y A;  4RKL A;  5KRU A;  4A3F G;  2KA7 A;  5CMD A;  1PH2 A;  5EQ0 A;  3BDL A;  3PIO 3;  3KF8 B;  1H9R A;  4KHP L;  1HCZ A;  4HMI A;  4LJZ C;  4JBW A;  1RCV D;  1SNM A;  1AN8 A;  3HP3 A;  5JVG 3;  3RZD H;  1PH9 A;  1PFS A;  3FDT A;  1MHW C;  1B50 A;  1YIJ A;  3EJI A;  4BY7 H;  2EYF A;  4GN5 A;  1C7Y A;  1SYG A;  2JA9 A;  3DWA A;  4HJA A;  4CJ2 C;  1S5D D;  2ZXP A;  1EL0 A;  4KK7 A;  2Q8I B;  4EQN A;  3M4O B;  4A93 H;  4LF7 L;  2XVS A;  1HJP A;  1WI5 A;  2KQ3 A;  2RSO A;  4G7O C;  3I4L A;  4RAU C;  1CKN A;  5C3E H;  1QUQ A;  4KV6 A;  3K80 C;  4LUZ A;  4R1J A;  2A69 D;  1S5C D;  2HUG A;  4FVM A;  5LMN L;  3ZJY C;  4DV1 Q;  4A3C G;  3T1Y L;  2DJG C;  2B63 H;  5M5W H;  2XN9 C;  1VQI A;  4KMU C;  1FJG L;  1H9S B;  3A7L A;  3LWU A;  1IBM L;  3TSS A;  3CU7 A;  1KQS A;  4JI5 L;  1B9M A;  1K73 C;  5JVH 3;  2I07 B;  3O13 A;  1DD2 A;  5CV7 A;  3WOE A;  5GAH C;  3HOW H;  3I73 A;  1PA6 A;  1SYC A;  4LF9 Q;  2KVM A;  2Y0S E;  3CCL A;  3SK6 A;  4KY6 A;  5C44 B;  2M9V A;  4DR3 L;  2ICE C;  4GOP A;  4ALP A;  1EQQ A;  2RVL A;  5IGB A;  1XWE A;  4HN7 A;  4YWM A;  2IJ0 A;  1TXY A;  3MFG A;  1EIY B;  5H1S E;  4R4C A;  3MWY W;  1PTO B;  1RF2 D;  1W2B A;  3HRZ C;  1C9O A;  1WCM G;  1PZJ D;  3KK7 A;  3Q24 A;  4J15 A;  1KLG D;  2JE6 I;  1H9J A;  4JV5 L;  4O0A A;  3PO2 H;  2Y0S B;  1HH2 P;  4XT1 B;  1VQF A;  2QKI C;  1NE3 A;  5JJK A;  2BE5 C;  1BR9 A;  2A74 C;  2D0O A;  1AW7 A;  3I7F A;  1IW7 D;  4ZQ3 A;  1NJI C;  2DY7 A;  1OO9 B;  3IL8 A;  1A3T A;  1RDP D;  3D6W A;  1BCP D;  3CCE A;  3L3O C;  4KHP Q;  4IUV A;  3S15 H;  1SMY C;  1L0Y B;  3CKI B;  2SNM A;  4PQX A;  1HPC A;  1QCB D;  3UDX A;  4CDC C;  3BJU A;  3GTP H;  4OO1 I;  3IFD A;  1AEX A;  3I4O A;  3NSW A;  2NVQ H;  3Q6S A;  1YNN D;  1X3E A;  1TWG H;  3GQB A;  1U4M A;  1PRT F;  1PH8 A;  3K7U C;  5G3L D;  1V43 A;  1D2B A;  4A3D B;  4IUN A;  4EVO A;  4BY7 G;  3GTK H;  3OSO A;  3BS1 A;  3GTJ B;  1HTP A;  1IBK L;  4M8A A;  1MI2 A;  3TBI B;  2ES2 A;  3E3X A;  4DV3 L;  3I2Z A;  3HOU B;  4GKK Q;  2J7Z A;  3MXG A;  3GDE A;  1H9M A;  3WOF A;  4PZ7 A;  3S14 H;  2VUM B;  4FF2 A;  3P20 A;  1QZH A;  2F0D A;  1I3Q B;  1Z47 A;  1GVP A;  3P75 A;  2WB1 G;  4LMQ D;  2RQX A;  4K6L A;  3OMC A;  3GP7 A;  3MEH A;  1TS3 A;  3KYH C;  4HR7 B;  4AYB G;  3M85 A;  2PYK A;  4JI8 Q;  1GUG A;  2HD3 A;  1K9M C;  5IOD A;  4IPG A;  5I9O A;  1QG7 A;  5C4J H;  2KCN A;  5M3M H;  4JI5 Q;  1PRT C;  1CSQ A;  4JI6 L;  1NMG A;  2R7Z H;  1DCZ A;  1VQL A;  3BVZ A;  2F0U A;  4DK3 C;  2MUY A;  3HOW G;  2CWP A;  4BS9 A;  2P5Z X;  4DR5 L;  2CFM A;  5JEA G;  4DR3 Q;  3I56 A;  2L55 A;  4C3I G;  2BE5 D;  3HOZ B;  3M4P A;  5T1G A;  3S1M H;  4A3G H;  1VQB A;  4KKT A;  1T5E A;  2Z6K C;  3CD6 A;  4KLK A;  4RGN A;  2D2C C;  1JB3 A;  4K2L A;  3S1R B;  1A0I A;  3RUZ A;  1SMY D;  4RCO A;  4OIJ A;  3I72 A;  5IT9 E;  2K5Q A;  1Q81 C;  2EE1 A;  1LT6 D;  1IL2 A;  1HZA A;  3H0G H;  3SVM A;  1EFI D;  2A6H C;  2OEO A;  3Q8D A;  4DV6 L;  2JA6 H;  3TEH B;  1JR0 D;  4DR7 L;  4K14 A;  4CDF C;  5FLX c;  4DR6 L;  3PO2 G;  5M3F H;  3LGJ A;  3M7G A;  4KN4 C;  2E2I H;  3EVQ A;  3OYY A;  4DV5 L;  4HIM A;  3S2D B;  1LT3 D;  2K32 A;  1B7Y B;  1OXU A;  3A8K E;  4JOI A;  1X3P A;  1VQP A;  2IW3 A;  2IHE A;  1GD7 A;  5C4X H;  4LF8 Q;  1M8A A;  4QMG A;  1ZXT A;  1G51 A;  2DN8 A;  2KJX A;  3FRP B;  4TRD A;  3I4M G;  3U50 C;  1G8Z D;  2Q2I A;  4A3I B;  1JQY D;  4KTA A;  4UHV A;  3KJO A;  4F7X A;  3ND8 A;  5J3B A;  3Q23 A;  3QWN A;  2UXC L;  1SE3 A;  1WOC A;  2G9D A;  2I5H A;  2LXJ A;  5C3W A;  1B1Z A;  4UAI A;  4H02 A;  2IWH A;  5KYI A;  2Z4I A;  4PZ8 A;  1Y14 B;  2EQS A;  2CQO A;  2R92 H;  4CKC A;  4DV3 Q;  1A15 A;  1HA6 A;  2QGQ A;  4R9W A;  4BA1 I;  3MHB A;  1PRT D;  1VQ4 A;  2LS0 1;  2L12 A;  1X32 A;  3TRZ A;  4KHV A;  4YHH Q;  1TU2 B;  5D3I B;  5E1F A;  2D0P A;  1U9R A;  3D6C A;  1SAP A;  1E2W A;  1Q1E A;  2F0J A;  5ELC A;  3UI2 A;  1EY7 A;  1IL8 A;  1KNA A;  5KGU A;  4CHT B;  2RHS B;  3CQZ B;  3K5M A;  1X9N A;  1AE3 A;  3KLS A;  1V1Q A;  2SDF A;  1ESF A;  1WTQ A;  3AMU A;  1PFB A;  1DGS A;  3H15 A;  2OTL A;  3NBH A;  1JWU D;  3OIQ A;  2KCC A;  3AU7 A;  4JI6 Q;  1K28 A;  1STY A;  4GLV B;  3KDF A;  2PQA A;  4QUF A;  1C0A A;  1KAB A;  1YVC A;  4HMJ A;  5DM7 3;  3HOY G;  2A6H D;  2R7Z G;  4DR5 Q;  2IT1 A;  2RA4 A;  3FP9 A;  1SE2 A;  5IGF A;  1TY2 A;  1JE5 A;  1QNU A;  4B3R Q;  2AQ1 B;  2NVY H;  5C3X A;  1X6O A;  4O2D A;  2UUC L;  2F0M A;  1KHI A;  1A6X A;  1HUN A;  5ELB A;  1SYE A;  4KI0 A;  2F3W A;  3K58 A;  4E6I A;  4IPH A;  3H3V C;  4KD3 A;  1KTK A;  1BOS A;  4OEM B;  4DV4 Q;  3RN5 A;  3H0G G;  1XMO L;  3ZYY X;  1SE8 A;  2I5L X;  4DR6 Q;  3GTO H;  1CQF A;  3IFT A;  2MO0 A;  5CGK A;  4DV5 Q;  1DOM A;  5M3F G;  4DK1 A;  1J5E L;  2E5L L;  5ELE A;  1EOT A;  1ZKO A;  2YV5 A;  1CKN B;  1C48 A;  1QUQ B;  2F52 A;  4P75 A;  5DNF A;  4G4K A;  1J8I A;  4A3E B;  4LFC L;  4A3B B;  5DLQ E;  2HT1 A;  4B3S L;  3IAY A;  4LFA Q;  3A5Z B;  4DA2 A;  2RBM A;  2JA7 H;  2KEN A;  3J7Y W;  3JC6 6;  2JN4 A;  1M1K C;  2N49 A;  3TP7 A;  4A4I A;  2K03 A;  4AH6 A;  4BBS G;  1AFP A;  4AIM A;  4LWC A;  4ZAI A;  3MAQ A;  4Q0F A;  3MC0 B;  2JK8 A;  3DLL A;  1L1O C;  4J1M A;  3OPO A;  1NSN S;  3HGB A;  4ZK9 B;  2RDF A;  3G7L A;  1VDZ A;  2WIN B;  1SNO A;  2RDG A;  2R92 G;  5LL6 S;  4LF5 L;  3HFZ B;  1II3 A;  5C44 H;  1ROD A;  3RN2 A;  1VQE A;  3BVG A;  4DU9 A;  3K8A A;  5FO8 B;  2JA5 H;  4F8M A;  4JI4 Q;  1ET9 A;  1XPR A;  1QZG A;  1YJN A;  1S40 A;  1NR4 A;  2CH4 W;  3QIA A;  4P73 A;  3K7A B;  3S1Q B;  2GA4 B;  3BZC A;  1HZB A;  1JOO A;  1VF7 A;  1LTL A;  4K0K Q;  1F2Y A;  4NKL A;  1VQH A;  2ASB A;  4X66 Q;  5C0X H;  2E75 C;  4RA8 A;  3DWP A;  2FMM A;  2EDG A;  3QG1 A;  4XQJ A;  1V1P A;  2E2J B;  2K14 A;  3ICE A;  2MFI A;  1J9O A;  2ZJP A;  1U0L A;  5HUR A;  3J80 E;  4A75 A;  4A3F H;  3VYR A;  2Q2U A;  1V1O A;  2BCO A;  3FVQ A;  4UP7 A;  2CQA A;  5JEA J;  2CW0 C;  1SYB A;  1PZI D;  4GLA C;  1L1O B;  1D1K A;  1JB7 A;  3F2D A;  5M5Y H;  2ZJQ A;  2L1B A;  4EQP A;  5A2Q L;  1HTL D;  1SRU A;  2JP1 A;  1LT4 D;  2BA0 A;  1PV4 A;  4S3S A;  2JA8 B;  4X3T A;  1BF4 A;  3TME A;  2K1B A;  3LWE A;  1QOH A;  3J81 E;  5LL6 X;  1WD1 A;  1I50 H;  2Q2T A;  2N78 A;  1VQD A;  3QOL A;  1JC7 A;  1P16 A;  5DM6 3;  3GTQ H;  1N34 L;  4DPG A;  5A35 A;  4RH6 A;  3S9W A;  2MJ8 A;  4PMW A;  3CCR A;  2B2T C;  1GUS A;  3KLR A;  4DR4 L;  3DEP A;  5CBA E;  1J5E Q;  5IOC A;  2E5L Q;  1I3Q H;  3TZD A;  4GN4 B;  1S3O A;  2E2H H;  4B3S Q;  2NUC A;  2EY5 A;  1TWA B;  2DY8 A;  5FLX L;  1YJW A;  5C4Z A;  4FF1 A;  3I70 A;  1LT5 D;  4WJ4 A;  4L5T A;  3NK9 A;  1CA6 A;  3BG3 A;  5TSS A;  1GJX A;  4X3U A;  2PZW A;  3S2H H;  1K8O A;  2JA7 G;  2G5D A;  3T53 B;  3S1N H;  1STN A;  1UAP A;  1PH7 A;  1VQJ A;  3VYU A;  2FIN B;  3V2T A;  1I6H H;  4YWL A;  4IPC A;  1LM0 A;  2VY3 A;  3K6O A;  3GTL B;  4GNX A;  3E0J A;  2NVX H;  3V96 A;  5FJ8 H;  1JT8 A;  4YCV A;  3UDF A;  3FPU B;  1BDO A;  4LF5 Q;  4DFA A;  4RMF A;  3OW2 A;  5EBC A;  4PV1 C;  1I4R A;  1LYL A;  2MNA A;  1BXT A;  4HIK A;  4N8F A;  2PZU A;  2VNU D;  3ONA B;  3DM3 A;  1X54 A;  5C44 G;  1T9H A;  1XX8 A;  3DEO A;  3PUZ A;  1EEI D;  2JA5 G;  1BBU A;  3ULJ A;  4JI0 L;  2N8N A;  5EPJ A;  3PUV A;  3E9H A;  1SEB D;  1KD1 C;  4B9W A;  2PW5 A;  4HSV A;  1HR0 W;  2A68 D;  4Y7N B;  3SDZ A;  1PFM A;  4BBR B;  4YY3 L;  1TWC B;  4R4O A;  4P74 A;  4QGU A;  1UEB A;  1ASZ A;  3HOX B;  3TP8 A;  3U4Z A;  3W3A A;  5C0X G;  2K6A A;  1VQ7 A;  3NXW A;  2BH2 A;  1PTO F;  1Q8K A;  2VQE L;  1K3B C;  2Y0S G;  2HHH L;  3I4N B;  2EXZ A;  1HNW L;  3NTK A;  1IYV A;  5K36 H;  2XWJ B;  3MTS A;  2YU9 B;  3D4R A;  4KKU A;  1HFN A;  4DUY L;  2K04 A;  4Y52 H;  2PO4 A;  2F0I A;  1CA5 A;  4L5R C;  4EGV A;  2O5I C;  4K8I A;  5IWA Q;  5E7N A;  4OWT B;  2K50 A;  2L5T A;  1PH4 A;  1SND A;  3ND9 A;  4N9P A;  2F0P A;  1Q90 A;  2B2W A;  4QY7 A;  2DJF C;  1GXD C;  5D65 A;  1JOR A;  3W2D A;  2K5H A;  1WTH A;  4ZCK A;  4A3M B;  2WKD A;  2XSC A;  1PH6 A;  1TS2 A;  1CK1 A;  3TQY A;  4JBK A;  4A3D G;  4QJF A;  1ZYR D;  4XTC S;  2QF7 A;  1YNJ C;  4XIG S;  3KBX A;  1VQM A;  5J22 A;  4HJ7 A;  4GKJ L;  1HNX Q;  3A74 A;  3VR3 A;  4C3J B;  1PTO C;  1YBY A;  2A73 B;  2VUM G;  4R4I A;  3QR8 A;  4JI7 L;  1D7Q A;  1S72 A;  5CYU A;  2X6G A;  3S16 B;  1QVF A;  2AMC B;  2NZH A;  3PUW A;  3T51 B;  4JW0 A;  2G9H D;  2K28 A;  3J7A F;  2XTI A;  5IYB G;  4X64 Q;  3E5S A;  1F9Q A;  4OON A;  1ESR A;  2AQ2 B;  4QUC A;  2WV6 D;  4RGT A;  2EYJ A;  4ZYS A;  5C5M A;  3NBH B;  1YZ6 A;  5JPM C;  2FHT A;  1WTR A;  3CCM A;  3P1H A;  3KDF B;  2PQA B;  2O2L D;  2NTT A;  4UDU C;  5FJ8 G;  5IYD H;  1ENC A;  1O7Z A;  5JEA H;  4C3I H;  5KND A;  3CAM A;  2R7D A;  1I6V C;  3UE0 A;  3JAM E;  2QA4 A;  5ELO A;  4IPD A;  2F03 A;  2A19 A;  5AFW A;  4JI0 Q;  1UEA B;  4RFB A;  1CT1 D;  2BDO A;  5KEE A;  2WAQ G;  1G91 A;  2V4D A;  1HQM C;  4OWX B;  2EYL A;  3R2I A;  3PO3 B;  4POG A;  4IUQ A;  4YY3 Q;  3CP0 A;  1UUP A;  3N52 A;  4UP8 A;  2Z4H A;  1TWF H;  2Z8L A;  3GTG H;  1KXL A;  2EJG C;  3FMC A;  2VQE Q;  2LSS A;  2NN6 G;  1IBL L;  3X3M A;  3CCV A;  1HNW Q;  1IKM A;  1GUT A;  2RKS A;  1VS0 A;  4DUY Q;  2IHF A;  1S5E D;  2L9H A;  4DF7 A;  1Y1V B;  1VMP A;  5K36 G;  5DAU A;  1G29 1;  2PMZ E;  1YNJ D;  2Z1C A;  3I4M H;  3VR2 A;  4IFD I;  2NVT H;  3ERQ A;  2UXB L;  4KHZ A;  4LUO A;  3GD7 A;  3OWF A;  4A3J H;  3CMA A;  1FNU A;  1Y8N B;  3FKI B;  1XYI A;  1PTO D;  1SNQ A;  1MSG A;  5EKL A;  3SGI A;  3S17 B;  3VR6 A;  3VR5 A;  2F0O A;  4A3I G;  4C3H B;  2CH4 A;  1N33 L;  4A3K B;  2MO1 A;  5I2X A;  5IE8 A;  3DUZ A;  4JBJ A;  1OXV A;  4R8I A;  1E7Z A;  4B3T L;  1QWY A;  2V1C C;  1PZK D;  2CCZ A;  5I9P A;  4YWK A;  4CJ0 B;  4FYD A;  3RR5 A;  5BR8 L;  1MBY A;  4ILW A;  2LKV A;  4GKJ Q;  4KD4 A;  3J80 i;  1JE4 A;  4LF7 Q;  3H3V H;  1R9T H;  5FO7 B;  4C1N I;  1O7I A;  2NWG A;  3PIP 3;  2F1M A;  4NXM L;  5LMN Q;  3PV0 A;  2B2Y C;  3J7A 5;  1K8A C;  1D5X C;  3K7A H;  3T1Y Q;  3S1Q H;  1PYS B;  1Z7T A;  3HKZ E;  1KLU D;  1JJ2 A;  4DXG A;  4LFB L;  3T16 A;  4A3L G;  1H95 A;  1GKH A;  5M5X B;  4HJ9 A;  4HTH A;  1A3U A;  2Q8T A;  1L2F A;  3J81 i;  1FJG Q;  4L6T B;  5A2Q E;  1IBM Q;  3OMG A;  1V1P B;  1Y8O B;  1EOV A;  1N9W A;  1K0R A;  1X3F A;  2N55 A;  2AUJ D;  3AQQ A;  3HOY H;  3KF6 A;  5IGD A;  5E4W C;  1X3G A;  4HCE A;  4FXK C;  5IYD G;  2NZO A;  5LHY 1;  2LY7 A;  3HKZ B;  2HIV A;  3G6E A;  1E22 A;  3GO5 A;  1E1T A;  3KLW A;  2B2U C;  3Q22 A;  1QB5 D;  5KIX A;  1BNZ A;  3PSI A;  1PMR A;  1X55 A;  1B4O A;  1EWI A;  3GV3 A;  1W6J A;  2N88 A;  1LUZ A;  1Q3L A;  3R93 A;  3K0Y A;  4QQB X;  1NTG A;  4JV5 Q;  1TQO A;  1K83 H;  4DK0 A;  5C0X J;  1YIT A;  1SSO A;  1OTC A;  3FEW X;  2L0C A;  2WP8 J;  4MTN A;  3KBG A;  4JI2 L;  1AP0 A;  5HGQ A;  3PF4 A;  1LTR D;  3TS0 A;  1QIL A;  2B2V C;  1CFM A;  3Q0A A;  2EY6 A;  1TWH B;  4K6D A;  1GO3 E;  3MEF A;  4IOC A;  2CHB D;  1WFQ A;  5IGG A;  1XTD A;  3C2P A;  3WWV A;  1E2Z A;  4GN3 B;  1ML0 D;  1TWA H;  3A0J A;  1HNZ L;  1FNV A;  1BO0 A;  2JEA I;  2HDL A;  3KJP A;  5CC4 A;  4A3J G;  3H94 A;  5IY0 A;  1N33 Q;  5CV6 A;  3SE0 A;  1CZW A;  2KED A;  4BBS H;  4JBM A;  2HIX A;  1SFO B;  3NTI A;  3PMF A;  4WJ3 M;  2YYZ A;  4GNX B;  1KDA A;  3A8I E;  3R2T A;  2CVR A;  3WDN A;  3C46 A;  1DXM A;  1IBK Q;  3RZO H;  1NY4 A;  2WB1 E;  2K5W A;  4EX5 A;  1K0S A;  1SJE D;  3RZD B;  3PGZ A;  1O7L A;  3BDC A;  3L0O A;  4XDX A;  2OT2 A;  2OXP A;  3VYT A;  4AYB E;  4FF3 A;  5K5P A;  4BY7 B;  4R8N A;  4OX9 L;  4NXM Q;  1XMQ L;  1QE6 A;  1DOL A;  2Z0S A;  4DKA C;  5ELF A;  4OL7 A;  5HY6 A;  1Y1W H;  1EQT A;  1A2U A;  4WFN 3;  2K33 A;  4XYO A;  2PPB C;  1YHQ A;  2AHO B;  3L7Z C;  3QJY A;  4HJ5 A;  4A93 B;  3HOX H;  4JK1 C;  2Z9H A;  1ONL A;  1Q8I A;  4DAP A;  1L0X B;  1VQG A;  4OHJ A;  1NNX A;  1VCI A;  5GAD C;  5C3E B;  3CPF A;  3J7Z C;  4PNY A;  2BH8 A;  4ID6 A;  3I90 A;  2OQK A;  4RCN A;  1HUM A;  2B63 B;  3NPP A;  4RGO S;  2F3V A;  3NEL A;  1TKW B;  5D3D A;  2EIF A;  5JAV A;  2SEB D;  2B29 A;  2YTV A;  3NP8 A;  1MD2 D;  1Q46 A;  4Z9C B;  2DGY A;  3W1G A;  2UUA L;  5L37 A;  2FXQ A;  4Q5V A;  5BN3 A;  2MP1 A;  2M2L A;  2MPM A;  3HOW B;  4ZKC B;  1FL0 A;  2EXD A;  4A3M H;  1FYC A;  1VQ6 A;  2EYH A;  2ICI A;  2CWA A;  5FK9 C;  4APV A;  2K52 A;  3CME A;  4GOP C;  4ME5 A;  1XPO A;  5HGT A;  2X69 A;  4X3K A;  1I5F A;  2B8F A;  1IYJ B;  3A55 A;  4DV6 Q;  3R3O A;  3G48 A;  2E2D C;  4DR7 Q;  3IKJ A;  2IX3 A;  4HID A;  1AE2 A;  4JI2 Q;  2RSN A;  2K5D A;  1UE7 A;  5BN5 A;  2F0G A;  2ZJR A;  1EU4 A;  5IYC H;  3AB9 A;  4JCV E;  1SYD A;  3M4O H;  1PXU A;  1EUJ A;  3DM1 A;  3JAM i;  2FMC A;  1E2V A;  4M1U B;  4G7Z C;  3NWT A;  1SJH D;  2VB2 X;  2AWN A;  4FDB A;  1AH9 A;  1D5Z C;  4LF6 L;  2VS1 A;  3PO2 B;  2EYM A;  5I4D A;  2K05 A;  1RTN A;  2UXC Q;  1FD7 D;  4DN4 M;  5I6Y A;  2ZT9 C;  3RMH A;  4HSP A;  1AZP A;  2KEE A;  2UU9 L;  4ODG A;  4RKB A;  1MIU A;  4OIK A;  5FLM H;  2NYZ D;  1CSP A;  3S15 B;  4JC0 A;  4XT3 B;  2ENB A;  4C1N K;  3GTP B;  2NVQ B;  1EZ6 A;  2EOT A;  2YTY A;  5T1I A;  3SK4 A;  4GOP B;  4LNQ A;  3PIO A;  2DUD A;  3KUP A;  5BN4 A;  2IL8 A;  3W5O A;  2GVB A;  4MNO A;  2UXD L;  2EYO A;  1EYA A;  4C2M B;  4X65 L;  2JEB I;  3DMU A;  5AJ3 L;  2MQH A;  4JI3 L;  4N9T A;  1PTO H;  3BZK A;  1R4Q B;  4MHE A;  4R4Q A;  2EY2 A;  1Y1W G;  1KNE A;  3S14 B;  4G7H C;  1BBW A;  4JPB W;  2XRQ D;  5IP9 H;  1KRT A;  2BA1 A;  1XXG A;  2RDH A;  1EZ8 A;  1STG A;  4RGM A;  3HOX G;  1EYG A;  1SNC A;  3NQT A;  1F77 A;  2QEJ C;  2M00 A;  2D9U A;  4G57 A;  2ID0 A;  3K57 A;  2JJQ A;  1CHQ D;  2A1A A;  2GVA A;  4TSS A;  5CV5 A;  1IYU A;  3L2P A;  1O80 A;  1EY0 A;  5CV9 A;  1XNR L;  1CZG A;  3RNU A;  1IXR A;  3GV6 A;  1ILQ A;  3M3Y B;  4ZKB B;  2R93 B;  3OTO L;  4OO1 G;  3FKI H;  5D14 A;  2R7F A;  3K5L A;  2OTJ A;  5C4J B;  3D3R A;  4NDX A;  4NMZ A;  5M3M B;  2BDN A;  2UUC Q;  1SR3 A;  3F8T A;  2OWO A;  4X62 L;  1M4V A;  1BQQ T;  5DEH A;  1PHJ A;  3J81 j;  4A3D H;  1HQR D;  2O5J C;  4IN3 A;  5EKI A;  1N36 L;  1PFN A;  4A3M G;  4DAY A;  3M4Y A;  2F0H A;  1XMO Q;  2QDL A;  3J80 c;  3GTJ H;  3QOJ A;  2J0T D;  1X56 A;  3S1M B;  4A3G B;  4YCU A;  5JJZ A;  1V9P A;  4WOR A;  3HOU H;  1EQR A;  5F2D A;  4DUZ L;  1ASY A;  2VUM H;  4WJW A;  5IYC G;  1NR2 A;  4C3J G;  3EA6 A;  1XNQ L;  4AQY L;  4LFC Q;  5ELN A;  4KY5 A;  1ILP A;  1D8L A;  3H0G B;  3BVM A;  5IYB H;  2XGT A;  1EFW A;  1KDB A;  4DNI A;  3KLS X;  2JA6 B;  3J81 c;  5COR A;  4HIO A;  5M3F B;  2SNS A;  4DXF A;  2E2I B;  4JOI C;  2A8V A;  5I6W A;  1QVC A;  2KUM A;  1UWV A;  2RHQ B;  3G71 A;  4PZ6 A;  2UU9 Q;  1DOK A;  1WTX A;  2XRS D;  2VQF L;  4UPA A;  1XJV A;  3I8Z A;  2R6G A;  5C4X B;  4CKE A;  2RF4 A;  2D62 A;  3T56 B;  3A7A B;  2ATW A;  3N6R A;  2DNE A;  5FLM G;  2K4K A;  1MGS A;  4DV1 L;  4IAL A;  3HOZ H;  3X3N A;  1G2T A;  2N3S A;  2UXD Q;  1EY5 A;  1GUN A;  2VB3 X;  2NBF A;  4CDE C;  4X65 Q;  1SMX A;  1VMC A;  3SK8 A;  4B3M L;  4HAE A;  4IOA A;  2CW0 D;  1UE6 A;  1JJG A;  1CUK A;  2YTX A;  2Z6K A;  3S1R H;  1WTV A;  2AUK A;  2X6L A;  3ERS X;  3M9B A;  3HKS A;  2R92 B;  3D4W A;  4DAV A;  1X65 A;  4LF9 L;  2WAC A;  3CF5 A;  4XQN A;  3CXC A;  3PO3 G;  2ZTE A;  3CC4 A;  1F2M A;  1N32 L;  2ZM6 L;  2RCN A;  2KHJ A;  3AYH B;  3PUX A;  5IP9 G;  2NN6 H;  4QB4 A;  4N8X 1;  5C5L A;  2L4N A;  1X3Q A;  4ZUJ A;  1E3P A;  3VA5 A;  1MJC A;  3S2D H;  5LMU L;  3SXH A;  2PQE A;  3NTH A;  2HCC A;  2PNH A;  5C6A A;  1A63 A;  2F0V A;  4K2K A;  1Y1V G;  1IHZ A;  3OTO Q;  1PVO A;  3A5U A;  4BY1 B;  1CHP D;  2QCP X;  2EYP A;  4A3I H;  1CQV A;  3FKI G;  2A6E C;  4X62 Q;  3CRL C;  2E74 C;  1KAW A;  1K8M A;  3ERO A;  4A3K G;  1H9K A;  4H13 C;  1G2S A;  2ALY B;  3J7A V;  3NWS A;  2EJF C;  2F0Q A;  3STB C;  3QB3 A;  5EBD A;  1JJC B;  1N34 Q;  1LTG D;  1WTP A;  2ZTC A;  3GTM B;  4DR4 Q;  2NVY B;  4DUZ Q;  1VQ8 A;  2PCF B;  1QJO A;  3CCJ A;  1STE A;  3HOU G;  2F0N A;  3HS0 C;  1XNQ Q;  4AQY Q;  3TS2 A;  4OXP A;  4F87 A;  1RKN A;  3M7N A;  2B39 A;  4DAM A;  1E0B A;  1IW7 C;  2QDB A;  4A3L H;  3HZX A;  1BCP C;  4O42 A;  4H44 C;  1NCV A;  3GTO B;  2SOB A;  2EZV A;  3CQZ H;  2KOL A;  1V8Q A;  5FKA C;  1I4P A;  2JYO A;  4H7B A;  4GKK L;  3NHH A;  4HED A;  4DR2 L;  4IUR A;  1B2T A;  1EY6 A;  3DXJ C;  3OHX C;  1KIX A;  2VQF Q;  1Y8P B;  1YNN C;  3BU2 A;  1Z6H A;  1LO5 D;  3MXN A;  4ULL A;  5ISR A;  3U4V A;  2PZT A;  1F9P A;  3NQI A;  2F3I A;  4HCS A;  2JA7 B;  3HOV B;  2KEC A;  2DNC A;  3K5N A;  3OWE B;  4JI8 L;  3ER0 A;  1ICF B;  4BWG B;  1TY0 A;  3HKZ G;  3I3C A;  3HOZ G;  4V19 0;  3EN2 A;  4CKB A;  3SEB A;  3ULL A;  4B3M Q;  4MZ9 A;  1JCK B;  1B9N A;  1PDQ A;  2ZXR A;  1FGB D;  1TVX A;  4NW2 A;  2NZ1 D;  3D31 A;  1SXT A;  5EJW A;  1EYD A;  1DJR D;  4FXD A;  1RD9 D;  1M90 C;  2A6E D;  1N32 Q;  2ZM6 Q;  4PMB A;  2C35 B;  2HCI A;  1EIF A;  5J1Z A;  5JOB A;  1O78 A;  3F2C A;  2JA5 B;  4KJO A;  4OEL B;  3AFP A;  2Z6B A;  1BCP B;  2HHH Q;  1KDC A;  1KRS A;  1G6P A;  4B9X A;  3JAM c;  4L5S A;  3TRE A;  1PH3 A;  5CV8 A;  3STB D;  1BUV T;  2EVB A;  5LMU Q;  4IFD J;  3VDY A;  1C8C A;  1E1O A;  4A3E H;  3S24 A;  3IRB A;  5KYL A;  1K8G A;  4A3B H;  2KCM A;  1T5X D;  2IX0 A;  3TP6 A;  4DV0 L;  2WKC A;  2F4V L;  1STA A;  2QIL A;  3D0F A;  1YJ9 A;  1TII D;  1F2Z A;  4A3F B;  4F88 A;  4P72 A;  4OWW B;  1OXX K;  4DR1 L;  1WTW A;  3T13 A;  4LF8 L;  4L8J A;  2BOS A;  4ME3 A;  2PMZ B;  5GAG C;  4NB3 A;  1B8A A;  1CTM A;  2AQ3 B;  1L1O A;  2EY1 A;  4JI1 L;  5M5Y B;  4J8Q A;  1SE4 A;  1I4X A;  3K5O A;  2QEX A;  1BBX C;  4XXE A;  5EPK A;  2UUB L;  1I94 L;  1FR3 A;  1JWM D;  3MA2 B;  4JI7 Q;  1HZ9 A;  1I50 B;  2H4O A;  1IZ6 A;  1TR5 A;  3LX0 A;  4C2M H;  1IKL A;  3J80 L;  2KCT A;  3NEN A;  5I2Y A;  4MIU A;  2VXW A;  3GTQ B;  1EYC A;  4KKS A;  4LK1 C;  2LMC B;  4A76 A;  1EU3 A;  2KHI A;  3C1E A;  2F0L A;  2VZA A;  3K0X A;  5IGE A;  3MXP A;  4DR2 Q;  3UDG A;  1B3Q A;  5GRO A;  2CKZ B;  3P7J A;  4P71 A;  1CM9 A;  3UDI A;  4A93 G;  2E2J H;  4IUU A;  1NUC A;  4YHH L;  1N8R C;  2E2H B;  3C3L A;  2K7V A;  1B53 A;  3LNN A;  3J81 L;  2JQO A;  3BDO A;  5C3E G;  3U58 A;  1B3A A;  3CCQ A;  2WII B;  2I46 A;  3S2H B;  5GQO A;  3UE1 A;  3L9A X;  2F0W A;  3KOJ A;  4EQO A;  3M3Y H;  2RCF A;  2B63 G;  3S1N B;  2R93 H;  2WAQ E;  3TN2 A;  2ZXO A;  5M9O A;  2K5V A;  4GNX C;  3CC2 A;  1I6H B;  1ZEQ X;  1VQO A;  3B6Y A;  2NVX B;  2AWO A;  2QW7 A;  3DWQ A;  1RHP A;  3G6J B;  2JA8 H;  2F0S A;  1YEZ A;  4V0B A;  1SNP A;  4DAY B;  5FLX E;  4CDD C;  1JIC A;  2F0K A;  1YHA A;  4QF4 A;  3OW7 A;  1GUO A;  3ITP A; 
#chains in the Genus database with same CATH homology
 3S1N H;  3CC7 A;  5GAH C;  3HOW H;  2I0Q A;  3K81 C;  1PA6 A;  1IBL Q;  4B3R L;  1PH7 A;  1K73 C;  1VQJ A;  2AWN A;  4LF9 Q;  4FDB A;  3E0E A;  1AH9 A;  4LF6 L;  1I6H H;  2VS1 A;  4YWL A;  2Y0S E;  3CCL A;  4IPC A;  4BXX H;  1LM0 A;  2VY3 A;  4GNX A;  4DR3 L;  2NVX H;  5FJ8 H;  1XPU A;  4GOP A;  1JT8 A;  4ALP A;  4YCV A;  1EQQ A;  2UXC Q;  3M4Q A;  3UDF A;  2PI2 A;  1KC8 C;  2UXB Q;  4YWM A;  3PCO B;  1VQA A;  4LF5 Q;  1TXY A;  4RMF A;  4A3E G;  2UU9 L;  4DV4 L;  3OW2 A;  1CKO A;  5IT9 c;  1EIY B;  4A3B G;  5H1S E;  4DV0 Q;  1YNX A;  4R4C A;  1MIU A;  1LYL A;  2MNA A;  5FLM H;  2F4V Q;  4HIK A;  5C0X I;  1CSP A;  1W2B A;  2VNU D;  3DM3 A;  1C9O A;  1X54 A;  5C44 G;  4JC0 A;  1WCM G;  3PUY A;  1T9H A;  4LUV A;  4B3T Q;  3PUZ A;  4J15 A;  1HR0 L;  3AFQ A;  2JE6 I;  1BBU A;  2JA5 G;  3ULJ A;  4JI0 L;  2N8N A;  1MJE A;  4JV5 L;  2YTY A;  4O0A A;  4DR1 Q;  3PO2 H;  1HH2 P;  1WYD A;  3PUV A;  1VQF A;  3PIO A;  4GOP B;  4LNQ A;  5GAE C;  2DUD A;  3E9H A;  1NE3 A;  3GTL H;  5JJK A;  1KD1 C;  3W5O A;  2GVB A;  4MNO A;  5BR8 Q;  2UXD L;  4JI1 Q;  1HR0 W;  4LFA L;  4YY3 L;  2D0O A;  4X65 L;  3KFU A;  3I7F A;  4P74 A;  4R4O A;  1Q86 C;  4QGU A;  2JEB I;  1UEB A;  1NJI C;  1ASZ A;  3U4Z A;  5C0X G;  1UE5 A;  3CCE A;  1VQ7 A;  1I94 Q;  2UUB Q;  1NMF A;  5AJ3 L;  2BH2 A;  2MQH A;  4JI3 L;  2VQE L;  1Q8K A;  4KHP Q;  3BZK A;  2Y0S G;  2HHH L;  1FVI A;  2WFW A;  3S15 H;  4R4Q A;  1Y1W G;  1HNW L;  3UDX A;  1FGU A;  3BJU A;  3GTP H;  1BBW A;  3I4O A;  5IP9 H;  4DUY L;  2NVQ H;  4OO1 I;  1KRT A;  2BA1 A;  1E24 A;  1X3E A;  1CKM A;  4Y52 H;  3CPW A;  1P8L A;  1TWG H;  3HOX G;  4L5R C;  1Q1B A;  1EYG A;  1PH8 A;  4LFB Q;  3K7U C;  5IWA Q;  1V43 A;  5E7N A;  1B70 B;  1VQ9 A;  4OWT B;  4LW1 A;  4Y7N H;  2K50 A;  4BBR H;  1PH4 A;  2ID0 A;  1TWC H;  2JJQ A;  2A1A A;  1SRO A;  2GVA A;  4QY7 A;  4BY7 G;  3GTK H;  3PF5 A;  1VQ5 A;  3L2P A;  1XNR L;  3RNU A;  1IBK L;  1IXR A;  4JI4 L;  2K5H A;  2ES2 A;  4DV3 L;  3I4N H;  3OTO L;  4OO1 G;  3I2Z A;  4DV7 L;  2LXK A;  1PH6 A;  4GKK Q;  3FKI H;  2R7F A;  2OTJ A;  2YU9 H;  3GDE A;  1Q82 C;  2HQL A;  4PZ7 A;  3S14 H;  3TQY A;  4JBK A;  2UUC Q;  4A3D G;  1SR3 A;  4QJF A;  3F8T A;  1QZH A;  2OWO A;  4XTC S;  4X62 L;  1Z47 A;  1GVP A;  4K0K L;  2WB1 G;  4DV2 L;  1PHJ A;  3J81 j;  4XIG S;  2GN5 A;  4BY1 H;  4X66 L;  1VQM A;  4HJ7 A;  4NXN L;  4A3D H;  4GKJ L;  1HNX Q;  1PH5 A;  2Q2H A;  3A74 A;  1N36 L;  2R93 G;  4A3M G;  2KBN A;  3KYH C;  4AYB G;  3M85 A;  1YBY A;  3CW2 C;  3CCS A;  2VUM G;  1XMO Q;  4R4I A;  4EQ5 A;  3J80 c;  4JI8 Q;  5M3M G;  3GTJ H;  2IY5 B;  4JI7 L;  1X56 A;  1D7Q A;  4YCU A;  1S72 A;  1V9P A;  1QVF A;  2AMC B;  2NZH A;  3PUW A;  1K9M C;  3HOU H;  4IPG A;  1EQR A;  4DUZ L;  1ASY A;  2JA8 G;  2VUM H;  1UE1 A;  5C4J H;  4JYA L;  2XTI A;  5M3M H;  5IYB G;  4JI5 Q;  1CSQ A;  5IYC G;  4JI6 L;  4X64 Q;  1NMG A;  4OON A;  2R7Z H;  1VQL A;  1XNQ L;  4AQY L;  4LFC Q;  3GTM H;  5ELN A;  1D8L A;  1SLJ A;  4A3G G;  4DK3 C;  3NBH B;  5IYB H;  1YZ6 A;  5LMN W;  2XGT A;  4PG3 A;  3HOW G;  2CWP A;  3CCM A;  1EFW A;  1KL9 A;  4DNI A;  4DR5 L;  2CFM A;  3KDF B;  4C3J H;  5JEA G;  3J81 c;  4DR3 Q;  3I56 A;  2PQA B;  2B3G A;  3M4P A;  2VL6 A;  4HIO A;  1K3R A;  4BXX G;  5IP7 H;  3S1M H;  4A3G H;  1VQB A;  4GS3 A;  4JOI C;  5FJ8 G;  2A8V A;  1QVC A;  3S16 H;  2Z6K C;  1HNZ Q;  5IYD H;  1UWV A;  2RHQ B;  3G71 A;  1JMC A;  4PZ6 A;  2L15 A;  4KLK A;  4C3I H;  2UU9 Q;  3CD6 A;  3CAM A;  3EIV A;  2VQF L;  2R7D A;  4UPA A;  4POF A;  3UE0 A;  1A0I A;  1PYB A;  1XJV A;  2R6G A;  2QA4 A;  5ELO A;  4IPD A;  2RF4 A;  2D62 A;  2JA6 G;  2ATW A;  2A19 A;  4TQU S;  1Q81 C;  5FLM G;  3RLO A;  1HR0 Q;  2K4K A;  1IL2 A;  3F1Z A;  2NN6 I;  4JI0 Q;  1HZA A;  3H0G H;  4DK6 C;  3CCU A;  4DV1 L;  3MXN B;  3Q8D A;  4DV6 L;  2JA6 H;  2WAQ G;  3TEH B;  4DR7 L;  4HJ8 A;  3HOZ H;  5FLX c;  4OWX B;  4DR6 L;  3PO2 G;  2N3S A;  5M3F H;  2UXD Q;  4POG A;  3LGJ A;  4YY3 Q;  3CP0 A;  5C4X G;  4UP8 A;  4X65 Q;  2E2I H;  1SMX A;  1TWF H;  3OYY A;  4DV5 L;  4HIM A;  4B3M L;  3GTG H;  4IJH A;  3E9I A;  3HOV H;  4IOA A;  3F2B A;  1KXL A;  1B7Y B;  1OXU A;  1CUK A;  1UE6 A;  4JOI A;  1JJG A;  2YTX A;  2Z6K A;  3S1R H;  1VQP A;  3M9B A;  3ERS X;  2VQE Q;  2IHE A;  1GD7 A;  3HKS A;  2LSS A;  5C4X H;  4LF8 Q;  1GM5 A;  1G51 A;  2NN6 G;  3CCV A;  1X65 A;  1IBL L;  3I4M G;  4LF9 L;  1HNW Q;  4LF4 L;  3U50 C;  3CF5 A;  1RL2 A;  2Q2I A;  4OX9 Q;  1VS0 A;  3CXC A;  4DUY Q;  3PO3 G;  1SN8 A;  2IHF A;  2ZTE A;  1XMQ Q;  3CC4 A;  1N32 L;  1BVS A;  2ZM6 L;  3KJO A;  2RCN A;  2KHJ A;  3AYH B;  5K36 G;  3PUX A;  1G29 1;  5IP9 G;  1W3S A;  2PMZ E;  5J3B A;  3I4M H;  4IFD I;  2NVT H;  3ULP A;  2UXC L;  2UXB L;  4KHZ A;  4LUO A;  3PO3 H;  1WOC A;  3W1B A;  3GD7 A;  4RG1 A;  4A3J H;  2I5H A;  1E3P A;  2AKW B;  2LXJ A;  3CMA A;  1MJC A;  3S2D H;  5LMU L;  3SGI A;  1A8V A;  4BBR G;  4H02 A;  1Z9F A;  4A3I G;  2PNH A;  4PZ8 A;  1A63 A;  1Y14 B;  1N33 L;  2EQS A;  2MO1 A;  2CQO A;  1Y1V G;  4R4T A;  4TVA B;  5IE8 A;  4JBJ A;  1OXV A;  2R92 H;  4DV3 Q;  1E7Z A;  3OTO Q;  4B3T L;  1PVO A;  4DV7 Q;  3A5U A;  2QGQ A;  4BA1 I;  2V1C C;  4A3I H;  3I4N G;  1VQ4 A;  2CCZ A;  3FKI G;  1Y1V H;  4X62 Q;  4YWK A;  4IFD G;  1VQN A;  4X6A H;  1J6Q A;  1KAW A;  3TRZ A;  4DV2 Q;  3RR5 A;  4IO9 A;  2H5X A;  5BR8 L;  4YHH Q;  2D0P A;  2K5N A;  4YCW A;  4A3K G;  4NXN Q;  4GKJ Q;  1Q1E A;  2ALY B;  3J80 i;  2UUA Q;  4BY1 G;  4LF7 Q;  3H3V H;  3STB C;  3S17 H;  2E8G A;  1JJC B;  3FHW A;  3T1H L;  1N34 Q;  4C3H H;  2RHS B;  1R9T H;  1RIP A;  4A3K H;  1A62 A;  1X9N A;  1AE3 A;  1V1Q A;  2ZTC A;  1O7I A;  4DR4 Q;  1QVG A;  4DUZ Q;  1VQ8 A;  1DGS A;  4NXM L;  5LMN Q;  3H15 A;  3PV0 A;  2OTL A;  3J7A 5;  1K8A C;  4JYA Q;  3T1Y Q;  3K7A H;  3CCJ A;  3HOU G;  3S1Q H;  1PYS B;  3HKZ E;  1JJ2 A;  4JI6 Q;  4GLV B;  4LFB L;  3KDF A;  4A3L G;  1H95 A;  5IWA L;  2PQA A;  1GKH A;  1XNQ Q;  4AQY Q;  4HJ9 A;  4OXP A;  3TS2 A;  1C0A A;  3M7N A;  1YVC A;  1L2F A;  3J81 i;  1FJG Q;  4NPS A;  4DAM A;  1IBM Q;  3HOY G;  2R7Z G;  2OQ0 A;  1EOV A;  1N9W A;  4DR5 Q;  1K0R A;  2IT1 A;  4A3L H;  1X3F A;  3FP9 A;  1YHB A;  3CQZ H;  3HOY H;  3AQQ A;  1BKB A;  1JE5 A;  3KF6 A;  4GKK L;  4B3R Q;  2ZTD A;  1VQK A;  2NVY H;  4DR2 L;  1X6O A;  1X3G A;  4IJL A;  4O2D A;  5IP7 G;  4LF6 Q;  2UUC L;  4UP9 A;  1KIX A;  2VQF Q;  1KHI A;  5IYD G;  2NZO A;  3BU2 A;  2HIV A;  4KI0 A;  3U4V A;  3G6E A;  4QL5 A;  1U5K A;  5M5X H;  1E22 A;  3GO5 A;  1E1T A;  4IPH A;  3KLW A;  1HNX L;  2F3I A;  3RN5 A;  4DV4 Q;  3PSI A;  3H0G G;  5EAY A;  1XMO L;  1SE8 A;  2I5L X;  1X55 A;  4JI8 L;  4DR6 Q;  3ER0 A;  3GTO H;  4A3C H;  3KF6 B;  1EWI A;  3I55 A;  2MO0 A;  3HKZ G;  3HOZ G;  1LUZ A;  3EN2 A;  4DV5 Q;  3ULL A;  5M3F G;  4B3M Q;  4QQB X;  1J5E L;  1NTG A;  2E5L L;  3RLN A;  4BA2 I;  4JV5 Q;  4MZ9 A;  5C0X J;  1K83 H;  2YV5 A;  1YIT A;  1CKN B;  4X64 L;  1VQC A;  1OTC A;  1QUQ B;  2F52 A;  4P75 A;  3D31 A;  3HOV G;  2IX1 A;  3EBE A;  4LFC L;  2K75 A;  1OXT A;  5DLQ E;  2WP8 J;  2HT1 A;  4MTN A;  4B3S L;  4JI2 L;  4LFA Q;  4LF4 Q;  5HGQ A;  3PF4 A;  1L0W A;  3TS0 A;  3A5Z B;  1M90 C;  1N32 Q;  1Q7Y C;  2JA7 H;  2ZM6 Q;  1GO3 E;  3MEF A;  2C35 B;  2KEN A;  4JG2 A;  4IOC A;  1EIF A;  2PI2 E;  1WFQ A;  3JC6 6;  3F2C A;  5AJ3 Q;  3AFP A;  1M1K C;  4JI3 Q;  1XTD A;  3WWV A;  2HHH Q;  2N49 A;  1OXS C;  4GN3 B;  1KRS A;  1TWA H;  4A4I A;  4AH6 A;  3A0J A;  3JAM c;  1HNZ L;  4L5S A;  2JEA I;  1G6P A;  3TRE A;  1PH3 A;  4BBS G;  3STB D;  5JJL A;  4AIM A;  4LWC A;  5LMU Q;  3KJP A;  4IFD J;  3VDY A;  4A3J G;  2JK8 A;  3DLL A;  1E1O A;  1L1O C;  5IY0 A;  3G4S A;  1N33 Q;  5JJI A;  3NEM A;  4UY8 C;  4BBS H;  4A3E H;  4JBM A;  3S24 A;  3IRB A;  1K8G A;  3H3V I;  4A3B H;  2HIX A;  2KCM A;  4WJ3 M;  2R92 G;  4LF5 L;  2YYZ A;  1Q12 A;  3HFZ B;  4GNX B;  2IX0 A;  4QIW E;  4L5Q A;  5C44 H;  1TWH H;  1WCM H;  3RN2 A;  4DV0 L;  1VQE A;  2F4V L;  3K8A A;  2JA5 H;  3D0F A;  1XNR Q;  3PIP A;  1IBK Q;  4JI4 Q;  1XPR A;  1QZG A;  1YJ9 A;  4GLX A;  2I5M X;  1YJN A;  1S40 A;  3RZO H;  1MKH A;  1NY4 A;  2WB1 E;  1YI2 A;  4EX5 A;  4P72 A;  4OWW B;  3PGZ A;  1OXX K;  4P73 A;  3RLF A;  4DR1 L;  3L0O A;  3T1H Q;  2OCE A;  3BZC A;  1HZB A;  1PH1 A;  4LF8 L;  1LTL A;  4K0K Q;  4ME3 A;  4AYB E;  5GAG C;  4NB3 A;  1B8A A;  4JI1 L;  1L1O A;  2ASB A;  1VQH A;  4X66 Q;  1SFO H;  2QEX A;  4OX9 L;  3AEV A;  4NXM Q;  1NBW A;  1XMQ L;  1N36 Q;  2VW9 A;  1HZC A;  1WJJ A;  2Z0S A;  4DKA C;  4A3F G;  2UUB L;  1I94 L;  1Y1W H;  5HY6 A;  1PH2 A;  2K14 A;  3KF8 B;  3ICE A;  4KHP L;  4JI7 Q;  2MFI A;  2ZJP A;  1YHQ A;  1HZ9 A;  1U0L A;  1IZ6 A;  2AHO B;  4C2M H;  2KCT A;  3L7Z C;  3NEN A;  4JBW A;  3HOX H;  4HJ5 A;  4A75 A;  4A3F H;  1PH9 A;  3RZD H;  2Q2U A;  4UP7 A;  5JEA J;  1VQG A;  1PFS A;  4A76 A;  2KHI A;  4GLA C;  1VCI A;  5GAD C;  2VZA A;  1L1O B;  3CPF A;  3K0X A;  3J7Z C;  1YIJ A;  1JB7 A;  3F2D A;  4BY7 H;  5M5Y H;  4DR2 Q;  3UDG A;  2ZJQ A;  2BH8 A;  4GN5 A;  1C7Y A;  2OQK A;  5GRO A;  2CKZ B;  2JA9 A;  1SRU A;  4HJA A;  4P71 A;  2BA0 A;  4A93 G;  3UDI A;  1PV4 A;  3NEL A;  2E2J H;  1N8R C;  4YHH L;  2EIF A;  2B29 A;  2JQO A;  2YTV A;  1Q46 A;  1I50 H;  2DGY A;  3W1G A;  5C3E G;  2Q2T A;  2N78 A;  1VQD A;  3CCQ A;  3U58 A;  4A93 H;  1P16 A;  2UUA L;  4LF7 L;  1HJP A;  2FXQ A;  3GTQ H;  1WI5 A;  5GQO A;  3UE1 A;  1N34 L;  4DPG A;  3KOJ A;  3M3Y H;  2B63 G;  4PMW A;  3CCR A;  1CKN A;  5C3E H;  1FL0 A;  1QUQ A;  2EXD A;  4A3M H;  4DR4 L;  3K80 C;  2WAQ E;  2R93 H;  1VQ6 A;  4LUZ A;  4R1J A;  4GNX C;  2CWA A;  2K5V A;  4APV A;  2K52 A;  3CC2 A;  3CME A;  5LMN L;  3ZJY C;  4DV1 Q;  4GOP C;  1J5E Q;  2E5L Q;  4A3C G;  1XPO A;  3T1Y L;  2B63 H;  5M5W H;  1VQO A;  1I5F A;  3B6Y A;  1IYJ B;  2AWO A;  1I3Q H;  4DV6 Q;  3G48 A;  4DR7 Q;  4GN4 B;  1S3O A;  2JA8 H;  4HID A;  1VQI A;  1AE2 A;  1YEZ A;  2E2H H;  4JI2 Q;  4B3S Q;  1UE7 A;  1FJG L;  4DAY B;  1IBM L;  2ZJR A;  1YJW A;  5IYC H;  4JCV E;  3M4O H;  1KQS A;  4WJ4 A;  4L5T A;  1YHA A;  4JI5 L;  3S2H H;  1EUJ A;  3JAM i;  2JA7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...