4C3JH

Structure of 14-subunit rna polymerase i at 3.35 a resolution, crystal form c2-90
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
total genus 22
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4c3jH00
5J3BA 3A74A 4X66Q 4DKAC 1E24A 3EIVA 2B63G 2F4VL 2R93G 3M7NA 1I6HH 4JYAL 4X66L 1KHIA 1X3FA 3D31A 3JC66 1X56A 2Q2HA 1B7YB 1D8LA 4YCWA 4A93G 2GVBA 1Q12A 4A3CH 1YJNA 5GAGC 4AYBG 3HKSA 2JA6G 4IFDG 1E1TA 4RG1A 4MNOA 3EBEA 1EFWA 2A8VA 3HOUG 3B6YA 4XTCS 5C3EG 3PIPA 4NXNQ 5IP9H 3T1YL 1PH7A 1WFQA 1C9OA 1VQ4A 1XMOQ 1WCMG 4A3DH 3CXCA 1SFOH 2KHJA 2ID0A 1Q7YC 2VQFQ 1PH3A 1IBLQ 2H5XA 1XMOL 1JB7A 2CFMA 4DV1L 3FKIH 1K83H 1KC8C 2EIFA 2PQAA 4QGUA 4OONA 1AE2A 1IBLL 1H95A 3STBC 3H0GG 1CUKA 1SLJA 5FLXc 2OWOA 4LF8Q 3F8TA 1A62A 1E7ZA 1Z9FA 4JI7Q 1MJCA 4JBJA 4HJ8A 2VUMH 1NE3A 3CP0A 3F1ZA 3S1NH 1PV4A 4X64Q 1KRTA 5C0XG 4DV2Q 4GNXA 1HNZQ 1SRUA 4LF8L 4JI7L 1IZ6A 2JEAI 3KDFB 4DR6Q 4GN3B 2XGTA 1YHAA 4X64L 4JI6L 4A3BH 3S17H 2QA4A 2VQEQ 1HNZL 4GOPA 2ES2A 5FLMG 5IY0A 4A75A 1T9HA 3CMEA 5IWAL 1LYLA 1YNXA 2E8GA 4IPDA 4LUZA 3MEFA 4GNXC 2VQEL 4A3JG 4BA2I 3U4ZA 1NY4A 4JI2Q 4BBRG 2F3IA 3RN5A 3L0OA 1XMQQ 4IFDJ 1VS0A 3PCOB 2ZTEA 4YCVA 1FJGQ 3E9IA 4A3FH 3NEMA 4GN5A 5AJ3Q 4DR2Q 3U50C 4GOPC 3A0JA 3A5ZB 5IYBG 1XTDA 1FJGL 4HJ7A 3E0EA 3PGZA 4L5TA 1PH9A 2D0OA 2NVTH 3DM3A 1HZAA 3PF5A 4UP7A 1QZGA 4IJLA 3S24A 5IYCH 3CCRA 4DV7Q 3S1RH 2ZTCA 3OYYA 1G291 4JCVE 2NN6I 4JI1Q 2BA1A 3HOXH 3J81i 1KIXA 2UXBQ 4J15A 5M3FH 5JJLA 1VQFA 4DV7L 2OQ0A 3PUWA 1VQMA 1EYGA 1N33L 2YV5A 2CKZB 4PMWA 2UXBL 4LF7Q 3PUXA 1U0LA 2N49A 1A0IA 2E5LQ 4AH6A 2ZJQA 3J81j 1JJ2A 1OTCA 1XNRQ 4NPSA 5C0XJ 2K52A 4LFAQ 2E5LL 2R7ZH 4HJAA 3G48A 4DR5Q 4UP9A 4JBKA 4UY8C 3RZDH 3AYHB 1XNRL 1RL2A 1R9TH 4LFAL 1IXRA 2HQLA 3HOVH 2RCNA 1V9PA 4RMFA 3RLOA 2E2JH 2JA8G 1EIYB 2UXCQ 1GKHA 5C4XH 2YTVA 1X6OA 2NN6G 2B63H 3IRBA 3DLLA 1VQ7A 1U5KA 2VS1A 3BU2A 2MFIA 1UE1A 1IBKL 4KHPQ 2UXCL 4YCUA 2L15A 3ULJA 1EIFA 2GVAA 3CC2A 4KHPL 1G51A 1W2BA 4OXPA 1HNWQ 1B8AA 1PH5A 3HOUH 1L1OA 4YWKA 3PIOA 3G4SA 1YJ9A 1QVGA 4XIGS 2JA7H 1PYSB 3J80i 4NXMQ 1V1QA 3CF5A 2HIVA 4DR1Q 3UDFA 4JI8L 1HNWL 1X55A 4HIKA 3GTMH 1PA6A 3HOZH 3NELA 1K3RA 2JA5H 2D62A 4AYBE 2MO0A 3TRZA 5IYDH 1YI2A 3CCQA 1XJVA 4IFDI 1L1OC 2YTXA 1J5EQ 2A1AA 5E7NA 4MZ9A 2NZHA 2HHHL 4YY3Q 4JOIA 4PZ7A 2CWPA 4TQUS 4A3KG 4LFCQ 3ERSX 1LUZA 1Y1VG 1YBYA 2WP8J 1XPOA 2UXDL 3RLFA 3PUVA 1OXUA 2Z0SA 1WI5A 3I4MH 4BBSG 1K9MC 1YIJA 4LFCL 1LTLA 2VL6A 4A3LH 4IPHA 3S2DH 1KL9A 3M3YH 1V43A 2AWOA 3CD6A 3KFUA 4BXXH 4A3GH 4JOIC 5GQOA 1A8VA 2KENA 5M5XH 2R92H 4HJ5A 3H15A 2UUCQ 4A3MG 1FVIA 3KF6A 4L5SA 3UDXA 1K73C 3AEVA 2UUCL 1J6QA 2UU9Q 4KLKA 3CCJA 4R4TA 4A3JH 1Q1EA 4JI5Q 3M4PA 3W1BA 4JI0Q 4QQBX 4DV6Q 1GO3E 4PZ8A 5C0XI 3AQQA 4AIMA 3JAMi 3CCMA 3VDYA 2WFWA 5FJ8G 2JE6I 4C3IH 2UU9L 1VQKA 1WYDA 4JI5L 2VNUD 2R6GA 5M5YH 4JI0L 4LF5Q 1TWCH 1E22A 1X3EA 4DV6L 3I4NH 5IYBH 4DV5Q 3RZOH 1HZBA 1VQDA 1Y1WG 4DR4Q 3JAMc 3KYHC 4QIWE 4NXNL 1VQLA 4LF5L 2ATWA 1VQBA 1CKMA 2AKWB 4DAMA 4ME3A 4DV5L 4A3EG 1M1KC 4HJ9A 2E2HH 3ULPA 2R7FA 3HKZE 3TREA 2VQFL 3CCVA 1UE5A 3T1HQ 3H3VI 3PO2G 1VQEA 4TVAB 4DK6C 1YHBA 3ZJYC 2CQOA 3CCLA 3PV0A 1Q8KA 4WJ3M 2WB1G 2K5NA 4P73A 3SGIA 2BH8A 1UWVA 4A3IH 3M4OH 3S1QH 5H1SE 1OXTA 2IHFA 2PI2A 3M9BA 3KJOA 4LF4Q 3L7ZC 1PH6A 5LMUQ 3KJPA 2GN5A 1N34Q 3HOWH 1AE3A 5IP7H 3PUYA 4OO1G 1O7IA 4LUOA 5GAEC 4HIDA 1MKHA 4DV2L 4BA1I 2YU9H 2Y0SG 4GKJQ 4APVA 5GAHC 3LGJA 4DR6L 5C44G 1K8GA 2PI2E 1N34L 1G6PA 1QUQB 1NBWA 3CCEA 4GKJL 1EWIA 2BA0A 1X54A 1HR0Q 1Q46A 3K7AH 4BY7H 1CKNB 2KCTA 3BZKA 3KOJA 3HKZG 4P72A 2K5VA 3PSIA 3HOYG 2A19A 4JI2L 1HR0W 4H02A 1XMQL 1PHJA 4LF6Q 3CW2C 3PO3G 1S3OA 2RHSB 4O2DA 3RLNA 1N36Q 1K8AC 1Y14B 1BBWA 5HY6A 3GD7A 4DNIA 5AJ3L 4DR2L 4LF6L 1HZCA 1N36L 3K0XA 3PUZA 3S2HH 1KRSA 4A3CG 1E3PA 4JI1L 1HH2P 3KDFA 4AQYQ 1C7YA 4DV3Q 2IX1A 2EXDA 4B3MQ 4GLVB 2N78A 3AFQA 1X65A 4AQYL 2YYZA 5IP9G 4DV3L 2UUAQ 4LF7L 3GTPH 1QUQA 1BVSA 4LWCA 1X9NA 4A3DG 1PVOA 4LW1A 4B3SQ 3ER0A 3UE0A 3RNUA 1YITA 5LMNQ 2BH2A 4BY1H 4QY7A 1I5FA 2DGYA 2RHQB 2ZTDA 3FKIG 4C2MH 5HGQA 5M3MH 4DR5L 4B3SL 3E9HA 5LMNW 4LNQA 5M5WH 4KHZA 4O0AA 2NVXH 4JI4Q 4GKKQ 3EN2A 3KLWA 2R93H 4DV4Q 2Q2TA 2LSSA 4LF9Q 1OXSC 4L5RC 3WWVA 4DUZQ 2VZAA 2VUMG 3CCUA 1DGSA 2V1CC 4JI4L 4A93H 4POFA 2MNAA 4DR7Q 4X62Q 4DV4L 4LF9L 1CSPA 1MIUA 4MTNA 2NZOA 2AWNA 4DUZL 2JA6H 4DR7L 1B70B 1UE6A 4OWXB 1IL2A 4A3BG 1QVCA 4X62L 1HJPA 3AFPA 1VQ5A 5C3EH 3ICEA 3TS2A 1WCMH 2OTLA 1EUJA 2KCMA 1VQGA 1A63A 4IPGA 1NTGA 3K80C 5IE8A 4NXML 3K81C 1PH4A 5JJKA 4DR1L 3CPFA 3BJUA 4A3FG 3Q8DA 3TQYA 2HIXA 4YHHQ 2KHIA 2IX0A 1PFSA 3GDEA 1J5EL 3H0GH 4WJ4A 4EQ5A 5JJIA 1N32Q 5IYCG 4YY3L 2VY3A 1E1OA 3W1GA 1Q82C 3HOXG 4YWMA 4A76A 4DAYB 5M3FG 3CMAA 3F2BA 1N32L 3FP9A 3I55A 1TWAH 3GTJH 4L5QA 1WJJA 2JJQA 1JJCB 2WAQE 2IHEA 4LUVA 1SMXA 2WB1E 5FLMH 3I2ZA 1FL0A 4UPAA 3NBHB 1OXXK 1PYBA 1YVCA 3F2CA 4BBRH 2R7ZG 3KF8B 4Y7NH 5EAYA 4GN4B 2K5HA 3S1MH 1K0RA 4OO1I 2Z6KA 1YZ6A 2JQOA 1P8LA 2Y0SE 2PMZE 3CC7A 3HOVG 3S15H 5ELOA 1C0AA 2F4VQ 3GTLH 4Y52H 4JG2A 1MJEA 2RF4A 1CSQA 2N3SA 3HFZB 4IOAA 5C4XG 4JBMA 2OCEA 2Z6KC 1KD1C 2N8NA 3U4VA 1VQIA 1VQHA 4DR4L 1FGUA 4GNXB 5IT9c 5C4JH 3CPWA 1Z47A 1VQJA 3NENA 4YWLA 4R4QA 4GLAC 2WAQG 3OTOQ 4JV5Q 1YEZA 2I5LX 3T1YQ 4LFBL 2ZM6Q 3T1HL 3RR5A 1ASZA 2CWAA 4GOPB 3GTKH 2PNHA 3I7FA 2JA7G 3UE1A 2I5HA 3OTOL 3OW2A 3GTQH 4JV5L 5JEAJ 2DUDA 2ZM6L 5K36G 5GADC 4DV1Q 4B3RQ 4C3JH 3HOZG 2I0QA 1JMCA 4LF4L 1VQ6A 2JA5G 5IYDG 5LMUL 4IOCA 2OQKA 4DK3C 3F2DA 1HZ9A 1TXYA 2C35B 2LXKA 4B3RL 1KXLA 4QJFA 2Q2UA 2JA8H 3J7A5 1VQAA 2F52A 4EX5A 4DV0Q 4HIOA 1N9WA 1L0WA 1RIPA 3RN2A 3I4MG 4DV0L 1HR0L 2JA9A 4JC0A 4DPGA 4JI6Q 4A3LG 4BXXG 2JEBI 4A3GG 1SR3A 2R92G 1GD7A 4IPCA 1QVFA 1VQCA 4R1JA 5IWAQ 3GTGH 1GM5A 2MO1A 3I4OA 4DR3Q 1S40A 1W3SA 1UE7A 1S72A 1NMGA 4POGA 1XPUA 4DR3L 1JT8A 2K14A 4QL5A 3A5UA 3PF4A 1VQ9A 1L2FA 1UEBA 3UDIA 4R4CA 1M90C 1I3QH 2KBNA 1KQSA 4GS3A 3I4NG 1SE8A 4GLXA 1I50H 4B3ML 4JI3Q 4DUYQ 4A3KH 3M4QA 1EQQA 1Q1BA 1Y1VH 2UUAL 3UDGA 2D0PA 1CKNA 1Q86C 4R4IA 3L2PA 4BBSH 4JI3L 4DUYL 2MQHA 1N33Q 4K0KQ 2Q2IA 2LXJA 4PG3A 1JE5A 5LMNL 3TS0A 1XPRA 2QEXA 1VQPA 3CAMA 4KI0A 3MXNB 4P75A 4A3MH 1Q81C 3TEHB 4K0KL 1L1OB 1TWFH 4A3IG 4GKKL 2AHOB 3M85A 4NB3A 3J81c 1IBMQ 4C3HH 2IY5B 4X6AH 2ASBA 2ZJPA 2IT1A 1JJGA 3STBD 4P74A 3S16H 3HOWG 1BKBA 3ULLA 5IP7G 1NJIC 1SROA 3D0FA 1IBML 5FJ8H 4LFBQ 1OXVA 2AMCB 2CCZA 3CC4A 2ALYB 2QGQA 2NVYH 4ALPA 2EQSA 1I94Q 2R7DA 2E2IH 3G6EA 1EOVA 4B3TQ 2YTYA 1CKOA 1BBUA 2NVQH 3GO5A 2FXQA 1TWHH 2VW9A 3GTOH 2ZJRA 2K75A 4A4IA 1Y1WH 1PH2A 1I94L 1IBKQ 1XNQQ 4B3TL 1YHQA 3W5OA 4A3EH 1TWGH 4X65Q 4BY7G 2UUBQ 3S14H 1VQOA 4OX9Q 1EQRA 1XNQL 3K7UC 4OWTB 1N8RC 4X65L 3PO2H 4PZ6A 2UUBL 4OX9L 1SN8A 4YHHL 3KF6B 3I56A 1D7QA 2B3GA 3K8AA 3FHWA 4JI8Q 5ELNA 3U58A 1WOCA 3CQZH 5JEAG 1HNXQ 3BZCA 1P16A 4R4OA 1VCIA 3J7ZC 1KAWA 1VQ8A 1X3GA 4IJHA 2OTJA 2HT1A 1YJWA 4UP8A 1HNXL 1VQNA 2I5MX 2HHHQ 1ASYA 1GVPA 2JK8A 5C44H 3G71A 3J80c 4HIMA 2UXDQ 5GROA 3CCSA 2K50A 1LM0A 5BR8Q 4FDBA 5DLQE 2K4KA 4OWWB 4P71A 2B29A 1AH9A 1PH8A 4JBWA 1IYJB 4BY1G 5BR8L 3H3VH 2PQAB 4IO9A 3HOYH 2XTIA 1NMFA 5M3MG 1QZHA 1PH1A 3PO3H 4JYAQ
chains in the Genus database with same CATH superfamily
4X66Q 1ESFA 1SXTA 4JPBW 3HP3A 1STBA 2F4VL 2CHBD 2NB0A 4JYAL 1B7YB 5J39A 3GTKB 2R3ZA 4KV6A 1Q12A 2PNRC 4A3CH 3A56A 1H9MA 2Q8IB 3HKSA 2JA6G 4IFDG 4KKUA 4O42A 2YU9B 5CV4A 2RCFA 3MA2B 1QB5D 2EYPA 1PH7A 3NBHA 1WCMG 5I9OA 5K5PA 2ID0A 2O4XA 3OOCA 1D6EC 3KF8A 2B2VC 2O5JC 2H5XA 5CV6A 2K5DA 1BF4A 1SEBD 2BCOA 3N52A 4QGUA 4OONA 2EVBA 3GP7A 4LF8Q 3F8TA 1Z9FA 5C6AA 4NDXA 3S1NH 1EY6A 5C0XG 1IZ6A 1EY4A 4DR6Q 4GN3B 5DM73 4N8FA 1F2ZA 4ZYSA 2QA4A 4GOPA 2LFNA 1T9HA 3CMEA 4IPDA 5FKAC 4BA2I 1HFGA 4BBRG 2F3IA 3NQIA 1XMQQ 2ZTEA 1FJGQ 3E9IA 1WTRA 3NEMA 5AJ3Q 3J80E 3PGZA 3SK8A 4TRDA 3K5NA 1HZAA 4UP7A 5EKKA 3OYYA 5M3FH 1H9KA 1XWEA 1H9JA 3PUWA 1VQMA 2C9OA 2YV5A 4PMWA 2RDFA 4LF7Q 1YNNC 2ZJQA 3EJIA 2NVYB 5DNFA 2M00A 3DWPA 2F0LA 4LFAQ 4G7OC 2R7ZH 3K57A 4DR5Q 4HTHA 1CI3M 4UP9A 4JBKA 4A3EB 2PW7A 1V9PA 4RMFA 3NTKA 1GXDC 3PO2B 2UXCQ 1GKHA 5C4XH 2YTVA 2NN6G 2B63H 1ML0D 2KUMA 3FPPA 3IRBA 3DLLA 3SHLA 1JOQA 2PZTA 2MFIA 1UE1A 4DN4M 2F0JA 4FF1A 2GVAA 3TZUA 2Z9HA 2L9HA 1G51A 3MXNA 4OXPA 1HNWQ 1PH5A 4YWKA 2PZWA 1PYSB 4G4KA 3D6WA 1BNZA 4H13C 4HIKA 1BCPB 3GTMH 3NELA 2JA5H 4AYBE 3BDCA 1L1OC 2OXPA 1D1KA 1SYDA 3NUCA 3GTLB 4PZ7A 4TQUS 2NZ1D 2WP8J 3RLFA 1OXUA 3OMCA 1WI5A 1CQVA 1YIJA 3G6JB 4A3LH 3GV3A 2AWOA 4JOIC 1EU4A 1A8VA 2F0OA 2R92H 3KF6A 4IUUA 1HTLD 1SNDA 1EY7A 3L9AX 1K73C 1BBXC 1DOLA 3GTQB 4C3HG 4R4TA 3QB3A 2KECA 4A3DB 1K8MA 3JAMi 5FJ8G 4QUFA 1VQKA 1CTMA 4JI5L 5EPJA 4LFBQ 1TU2B 2HQEA 4XYQA 4DV5Q 2EYHA 1HZBA 3MFGA 1Y1WG 2F03A 3KYHC 4LF5L 1VQBA 1CKMA 2I46A 4HJ9A 4DAVA 1DJRD 3HKZE 3TREA 3T1HQ 1YHBA 1QE6A 1Q8KA 2QEJC 2WB1G 4P73A 1PRTD 2ZXOA 1Y8NB 1UWVA 2BH8A 3SGIA 4A3IH 3M4OH 3S17B 4HMJA 4EVOA 3MXUA 4K5VA 5LL6S 5BN4A 3KJPA 1EOTA 1EYAA 4CDCC 1C48A 3HG9A 1KLGD 4OO1G 4GKJQ 5DEHA 4DR6L 1N34L 1VMCA 3EROA 2BA0A 3QWNA 1CKNB 2KCTA 3BZKA 3HKZG 1U4PA 4CBVA 1XMQL 1N36Q 1BBWA 1U4MA 3GD7A 4DNIA 5AJ3L 4IALA 5JJZA 4PV1C 1CZGA 3K0XA 1D2BA 1F2MA 1NCVA 4A3CG 2ZXPA 5IOCA 4RCOA 3KDFA 4F88A 1B9MA 3BG3A 1EEFD 2Z1CA 1PDQA 1X65A 1R9TB 2E2IB 2NVQB 4LF7L 5J22A 2EJFC 3ER0A 1V8QA 3UE0A 4C3JG 1YITA 2X69A 2LS01 4QY7A 1BXTA 4H0LC 5HGQA 1ET9A 4DR5L 5LMNW 4O0AA 5KGUA 4JI4Q 2R93H 4K8JA 1OXSC 3JAME 3WWVA 4KY6A 3BS1A 4POFA 4QUCA 3CQZB 1KDAA 4DUZL 1I4RA 1PFMA 4DR7L 4RWSC 2PMZB 3M4YA 1VQ5A 5C3EH 5C44B 3SK5A 2KQ3A 2ICEC 3FMCA 4RGTA 1PH4A 1PRTC 1TT2A 3CPFA 1KDCA 3BJUA 4E6IA 3AU7A 1A15A 2B8FA 2HIXA 2IX0A 4WJ4A 1JORA 1X3QA 1ICFB 2FMCA 3SDZA 1I6HB 2MHVA 2VY3A 3I70A 4A76A 5M3FG 1PTOH 1LT6D 3I55A 1TWAH 3GTJH 4L5QA 1JJCB 2WAQE 2E75C 3C1FA 2PZUA 4UPAA 4FXKC 3I4NB 3RZOB 3QOJA 1YVCA 3C46A 3F2CA 3V05A 2R7ZG 4GN4B 1KNEA 3MXGA 5EPLA 3S1MH 2O5IC 2Z6KA 1SDFA 2X6GA 1PLFA 5ELOA 4DNRB 3L3OC 1T5EA 1CSQA 3QIAA 2RSNA 4IOAA 3R2TA 2EJMA 5C4XG 2SOBA 1S5CD 2FJ2A 1B3QA 1LO5D 2Z6BA 1VQIA 2G9HD 4DAYA 1TR5A 1VQJA 4IUNA 4R4QA 2WAQG 3HOWB 1IHZA 3T1YQ 1SE2A 2HCIA 3T1HL 1EWCA 2F0FA 3I7FA 3DHQA 5JEAJ 2DUDA 2B2UC 2I0QA 1SNQA 1VQ6A 2JA5G 2F0PA 4EQOA 4IOCA 3F2DA 2F52A 4QB4A 5FOBB 2RSOA 3BDLA 5KYLA 4M1UB 3IL8A 3RN2A 3K5LA 1IKMA 1H9SA 2JA9A 3E6ZX 5M9OA 3HOXB 4A3LG 2SNSA 3RUZA 3VR3A 1TVXA 2R92G 4IPCA 2L12A 1VQCA 1GM5A 2MO1A 1EQVA 1SYEA 1LT3D 4UAIA 1HQMC 3DWQA 1T5XD 3PIP3 3SK6A 1GUOA 2RKSA 4QL5A 4RGMA 1VQ9A 1L2FA 1M90C 3T53B 1I3QH 2KBNA 5IGDA 4GS3A 5M3MB 4JI3Q 4A3KH 3QG1A 4V0BA 1EEID 1H9RA 1Q1BA 1Y1VH 1QOHA 4BBSH 4XDXA 2K01A 1SMYD 5EQ0A 2LXJA 3VA7A 1JE5A 3TS0A 1XPRA 2K1BA 4B08A 3CAMA 1VQPA 4A3MH 1L1OB 1TWFH 1PFBA 4CJ1B 4F8MA 4A3IG 5HGTA 3J80L 2JA7B 3NSWA 5EBDA 3EA6A 1JJGA 2VXWA 4P74A 2NTTA 3STBD 3S16H 1AZPA 1SROA 2G9DA 3MWYW 1FGBD 1OXVA 2A6HD 2R7DA 1A3TA 5T1IA 2YTYA 3BYTB 3GTOH 2K75A 4A4IA 1I94L 1IBKQ 1WD0A 1PMRA 3S14H 1VQOA 4OX9Q 1XNQL 2JSOA 3K7UC 1LT4D 4OWTB 4DK1A 4PZ6A 1ILQA 3E0JA 5M5XB 3I56A 2QW7A 1ZYRC 1BO0A 1KNAA 1O7LA 1P16A 1PZKD 3BVMA 4BBRB 4HSVA 2HT1A 4Y7NB 1HNXL 1ENAA 4ULLA 2JK8A 3J80c 3E3XA 1TWCB 4MTKA 2UXDQ 3ONAB 1SJHD 1DYQA 1XTCD 2K4KA 4OWWB 4P71A 1PH8A 4LAAA 2E2HB 3H3VH 3HOYH 2DNCA 1PH1A 2WKDA 3PO3H 4JYAQ 5J3BA 4RFBA 5C4JB 2B2TA 5CBEE 2FFKB 3EIVA 1B4OA 2PQEA 2F1MA 2R93G 3M7NA 3T56B 1VDZA 1X56A 3NE5B 5BN5A 3KUPA 3TZDA 3TSSA 5GAGC 3PIO3 4KMUC 1CHQD 1LLRD 1Y8PB 3HOUG 5J1ZA 3B6YA 4RGOS 4XTCS 5C3EG 1MD2D 1TIID 4NXNQ 3T1YL 1WFQA 3J81E 3CXCA 1SFOH 2KHJA 4IUTA 2VQFQ 4CKEA 1GOZA 3K58A 2SNMA 2F0IA 2Q8RE 3FKIH 3E5SA 2EIFA 2PQAA 1O7YA 1IBLL 4PMCA 3STBC 1SLJA 2A69C 1E7ZA 1MJCA 4HJ8A 2VUMH 5A35A 3CP0A 3F1ZA 3QR8A 1KRTA 4GNXA 1I4QA 1YHAA 4A3BH 1HNZL 2PPBC 1AEXA 4A75A 2NUCA 4KD4A 1EQTA 1D5XC 1CQFA 5ELFA 1YNXA 2E8GA 1AP0A 4LUZA 3I73A 5EPKA 4XQJA 1NY4A 3RN5A 3L0OA 2F0WA 2KA7A 4A3FH 4GN5A 4DR2Q 4GOPC 4K6LA 1WTPA 1WTVA 4FF2A 3E0EA 2D0OA 3DM3A 3SEBA 1QZGA 3I4LA 1WTQA 3S24A 5IYCH 1RTOA 2L4NA 4J6HA 2DNEA 5BN3A 4JI1Q 2A68D 3RD4A 2BA1A 4A93B 4IQZA 1E2VA 4C3HB 1VQFA 5FK9C 4DV7L 1G91A 2CKZB 4F87A 1PRTB 2UXBL 1J9OA 1U0LA 1A0IA 3Q23A 3QOLA 4HEDA 4AH6A 1AW7A 2LMCB 1DONA 4NPSA 2JXMB 1TWHB 4MHEA 2E5LL 4ZCKA 2EY2A 4HJAA 4ODGA 4OIJA 1TWGB 2EYJA 3P1HA 3RZDH 1XNRL 3HOVH 2RCNA 2E2JH 1X6OA 1LACA 4X3SA 5KEEA 1VQ7A 1OO9B 1U5KA 2VS1A 5KNBA 3BU2A 4JK1C 2NWGA 1IBKL 4YCUA 2L15A 1SE3A 2HDMA 1JOKA 1MSHA 4CGYB 3NQTA 4KHPL 1W2BA 1NAPA 1SNCA 5D65A 2IX3A 5FLXE 1QVGA 1ENFA 1YJ9A 2HDLA 3J80i 1HUMA 1VF7A 1V1QA 2HIVA 5CR3A 3UDFA 4DXFA 4K14A 3JAML 1K3RA 2K5WA 2D62A 3T13A 3HKZB 2YTXA 1XJVA 2H1EA 1CA5A 4RHRA 1SJED 4K2KA 2NZHA 4A3KG 2NTSA 3ERSX 1YBYA 1Y1VG 2UXDL 1XPOA 1PYWD 2Z0SA 4BBSG 2FINB 3BZDB 3K5OA 2VL6A 3S2DH 1KL9A 3M3YH 1PRTF 3CD6A 4A3GH 2KENA 4IUVA 4NKLA 1BQQT 4A3MG 3AB9A 4EGVA 4L5SA 4TSSA 2UUCL 1J6QA 4ZUIA 4KLKA 3CCJA 3G7LA 4A3JH 4JI5Q 3IFDA 3AQQA 3VYSA 4C3JB 1A2UA 3CCMA 3VDYA 1O80A 1Y69U 2VNUD 2A68C 5M5YH 4LF5Q 1E22A 1X3EA 5IYBH 1VQDA 3F2UA 2JA8B 4ZKBB 1LTAD 1QG7A 4DR4Q 1G2SA 4QIWE 4NXNL 3JAMc 1K28A 3MXPA 2ATWA 2AKWB 1M1KC 1NUCA 2XNAC 3ULPA 1WTXA 2VQFL 3S1NB 1UE5A 4DK6C 5D14A 1S5BD 3K5MA 4ID6A 3ZJYC 1OXTA 2PI2A 2MGSA 2RBMA 5KRUA 1N34Q 5IP7H 1O7IA 5C4ZA 4HIDA 2YU9H 2Y0SG 1B2TA 1HA6A 1K8GA 2IL8A 1DM0B 4HAEA 1NBWA 3KBXA 1I50B 1S5DD 1EWIA 4RHSA 1X54A 2B8GA 3KOJA 4P72A 1STGA 3PSIA 5ELCA 3HOYG 2A19A 1HR0W 4H02A 1PHJA 3CW2C 3PO3G 4XYOA 2RHSB 5M3FB 1UAPA 1K8AC 4XQQA 1Y14B 3NK9A 4DR2L 1LTTD 4LF6L 3MAQA 1MSGA 3FDTA 3PUZA 4WFN3 3W2DA 5IODA 4JI1L 1STAA 1HH2P 3GQBA 3DWAA 1C4QA 4U68A 2F0DA 4B9XA 2UUAQ 4DV3L 3N6RA 1X9NA 1FR3A 4LW1A 5LMNQ 2BH2A 2IW3A 3CKIB 3OHXC 4B3SL 3FKIG 3QJYA 3E9HA 2NVXH 4KHZA 4GKKQ 1EY0A 3VYRA 1E0BA 4ZQ3A 3EN2A 2WAQB 4KK7A 3URYA 4DUZQ 2VZAA 2VUMG 1EIGA 1DGSA 2V1CC 1HTPA 4NW2A 4DR7Q 4DV4L 3NTHA 2BDOA 4OWXB 5C3WA 1SNMA 1IL2A 4A3BG 1QVCA 4X62L 5IGEA 3ICEA 1TS3A 3TS2A 1SNPA 2OTLA 1QJOA 1VQGA 4OHJA 3K81C 4A3FG 3TQYA 1D5MC 1VMPA 4YHHQ 2KHIA 2IWHA 1HA5A 4KY5A 1PFSA 2KOLA 4EQ5A 5JJIA 1G2TA 3SXHA 5IYCG 1F77A 3W1GA 4KY7A 2EYMA 4XT3B 4YWMA 1GUGA 3FP9A 4FXDA 1TS5A 1RCVD 2Q8TA 4LK1C 1L0XB 1WJJA 1EFID 1K8OA 1SMXA 2WB1E 5FLMH 3NBHB 1J8IA 3OIQA 1TS2A 3KF8B 5EAYA 2JQOA 1P8LA 3S15H 3HOVG 1K83B 1C0AA 3GTLH 5C5LA 2RF4A 2N3SA 2EY5A 4JBMA 4FXGC 4A3IB 2Z6KC 1KD1C 3M4OB 3LX0A 4J1MA 4DR4L 3H3VC 3VA5A 4OELB 2OEOA 1B44D 4YWLA 4R8IA 1JQYD 3S9WA 1Q3LA 2B2VA 2CQAA 1ASZA 2CWAA 4GOPB 3UI2A 4FO2A 3OTOL 2I5HA 3R93A 3GTQH 1BOSA 2F3VA 1ET6A 2ZM6L 2CH4A 1EZ8A 2XIWA 4DXGA 4DK3C 1HZ9A 1TXYA 2LXKA 1ILPA 1KXLA 2Q2UA 3J7A5 4EX5A 4DAPA 3A7LA 4EQNA 1B50A 2AUKA 4DV0L 4U673 4DPGA 5CV9A 4R8NA 3J81L 3MC0B 1CFMA 4JI6Q 2JEBI 4A3GG 4FF4A 3HZXA 5DAUA 1QVFA 3GTGH 2RDHA 1EL0A 2NBFA 1S40A 2PW5A 2F0QA 1S72A 1GUWA 1BDOA 4DR3L 2K14A 3UDIA 2HD3A 1KQSA 3T16A 5IGFA 4GLXA 1EQQA 3M4QA 1ZEQX 5D3IB 1DZ1A 2UUAL 2R93B 2J7ZA 2M9VA 1K3BC 4DUYL 3FRPB 1N33Q 5LMNL 1AFPA 1HXYD 1Q81C 1DOMA 3Q6SA 3MXNB 4KI0A 4P75A 5G3LF 1EIHA 4K0KL 4MIUA 1II3A 3HOUB 2AHOB 4GKKL 3M85A 3J81c 4WJWA 4N9PA 2IY5B 4X6AH 2ASBA 5IT9E 2L11A 5IP7G 4G7HC 3D0FA 1IBML 3HOZB 3KK7A 2P5ZX 1I94Q 2E2IH 4DU9A 2NVQH 2JN4A 2FXQA 3GO5A 2VW9A 1PH2A 1XNQQ 2QDLA 5I9PA 3D6CA 1YHQA 3W5OA 2O2LD 2D5DA 4CDFC 5FO8B 4ZAIA 2UUBL 1UEAB 1SN8A 4YHHL 3KF6B 2F4IA 1TWAB 1RD9D 1WOCA 2EZVA 2BE5D 3CQZH 1PZID 3A54A 1HNXQ 5CBAE 3C3LA 1EY9A 3X3NA 4KHVA 5E3FA 1X3GA 4IJHA 3K59A 1FYCA 1STNA 2HHHQ 1VQNA 4C3IB 5C44H 3G71A 4QF4A 2FHTA 4HIMA 5JAVA 1EY5A 4HCSA 5GROA 3CCSA 5FLXL 1B53A 4JBWA 4JW0A 5BR8L 1STHA 4DNTB 3A74A 3LNNA 4DKAC 3HRZC 2B63G 4IUQA 1I6HH 4XQNA 3D31A 3JC66 2KCNA 2Q2HA 2X6LA 2XRQD 4YCWA 1YJNA 2B2TC 4QCLA 4RG1A 4MNOA 5KIXA 4KTAA 2CW0D 4IN3A 3PIPA 2K6AA 5IP9H 1SNOA 1C9OA 1HCZA 5E1FA 1PH3A 3K7AB 1IBLQ 5JVG3 1XMOL 2KHSA 2CFMA 1V1PB 1PTOF 5E4XA 2QKIC 1AE2A 3MTSA 1H95A 1LTRD 1CUKA 5FLXc 1A62A 5CV8A 4JBJA 4IZ8A 1LTID 1PV4A 2EYLA 3TBIB 4DV2Q 1M4VA 1HNZQ 3S2HB 4JI7L 2JEAI 3KDFB 1FNWA 1PXUA 2XGTA 4X64L 4JI6L 2ENBA 3DEOA 5FLMG 5F2DA 1HRJA 3VYUA 4GNXC 3GTPB 2B2WC 2VQEL 3U4ZA 4JI2Q 4IFDJ 1VS0A 3PCOB 4YCVA 4V190 4BY1B 4BBSB 3U50C 3A0JA 3A5ZB 4C2MB 4HJ7A 1PH9A 2NVTH 4DV7Q 3S1RH 2ZTCA 1G291 2NN6I 2F0EA 3HOXH 3J81i 1KIXA 1DOKA 4J15A 2UXBQ 2K5QA 4L6TB 1N33L 3NHHA 2JA6B 3VR6A 2E5LQ 2JYOA 3EFXD 3J81j 4OL7A 1JJ2A 1OTCA 1XNRQ 5C0XJ 1WCMB 1R4PB 4UHVA 3GTOB 1RTNA 3G48A 3D3RA 5I6YA 5LHY1 5COYA 4UY8C 1RL2A 1U4LA 4KKTA 4X3UA 2EXZA 2HQLA 3NWTA 4J8QA 1EIYB 4CKBA 4H7BA 4KHPQ 1F2YA 5IGBA 3ULJA 3CC2A 1U4RA 2F0NA 2K04A 1Y8OB 3ND8A 3PIOA 2JA7H 4XIGS 5G3LD 3DEPA 1LTBD 4K6DA 3P75A 1TY0A 4NMZA 4QIWB 1PA6A 2MO0A 1B3AA 2A1AA 5E7NA 4L8JA 2HHHL 3TMEA 1NR2A 1LUZA 2EDGA 1SYGA 3PUVA 3I4MH 4LFCL 1QCBD 5T1GA 4IPHA 3C2PA 4BXXH 3KFUA 2E2DC 5M5XH 1SYCA 2UUCQ 3H15A 3I90A 1FVIA 3UDXA 3AEVA 4DA2A 5DM63 3SR1A 4QQBX 3M4PA 3I72A 3W1BA 1SFOB 4AIMA 2QF7A 2UU9L 3EVQA 1SMYC 4JI0L 1TWCH 4DV6L 3FKIB 4ZLTF 1KLUD 4BWGB 2E2HH 2EY6A 1H9SB 2R7FA 1RF2D 2VUMB 3CCVA 2WIIB 5I2YA 4K5XA 1VQEA 3P20A 1JB3A 4KD3A 2B2UA 3NWSA 3CCLA 5A2QE 4WJ3M 1W6KA 2K5NA 2A6HC 3S1QH 3KJOA 2OT2A 4ILWA 3Q22A 1AE3A 3PUYA 4LUOA 5GAEC 1MKHA 4DV2L 4BA1I 1GHKA 4APVA 3H6MA 5GAHC 3LGJA 1G6PA 5C4HA 5C44G 1QUQB 4KN7C 2MPMA 3BYYB 1HR0Q 1Q46A 5IGGA 3P7JA 1I4XA 4BY7H 1NNXA 2A73B 2K5VA 1SE4A 5KNDA 2RVLA 1IYUA 4MN3A 4JI2L 4LF6Q 1PTOD 1ESRA 3K6OA 3ERQA 1HZCA 1KAAA 2IJ0A 1E3PA 5ELEA 4DV3Q 5ELDA 2IX1A 1QNKA 4K2LA 4B3MQ 3RZDB 4AQYL 3HOVB 2YYZA 5IP9G 2LKVA 1BVSA 2E2JB 4DK0A 4B3SQ 5KNCA 1Y1WB 1SSOA 1I5FA 2RHQB 2ZTDA 4OEMB 4LNQA 5M5WH 4YIJA 1Q8IA 1GUNA 3D4DA 4DV4Q 2LSSA 2Q2TA 2WB1B 4L5RC 3A8IE 4A93H 5HURA 2MNAA 4X62Q 4LF9L 3HGBA 2Z8LA 2L0CA 1HJPA 1LTSD 2DY7A 3R3OA 3TP5A 1EUJA 5CC4A 1A63A 2RDGA 1NTGA 1CK1A 5IE8A 1SYBA 4N8X1 1IKLA 3OPOA 2KEEA 1O78A 5IT9L 2QDBA 1GUTA 4RKBA 3M3YB 2IPKD 2R61A 3H0GH 4A3GB 3H91A 3HOXG 1Q82C 1IYVA 1N32L 3Q24A 1HFNA 1FNVA 2JJQA 5IGCA 3A7AB 2IHEA 3PMFA 4CJ2C 1PFNA 3I2ZA 1FL0A 5M5YB 1K0SA 1F9RA 1PTOC 3DXJC 4I7ZC 2ZXRA 2K5HA 1K0RA 3CC7A 1YZ6A 2RA4A 2Y0SE 1LT5D 4PNYA 3ZYYX 3NPPA 3HFZB 5CMDA 3CRLC 2N8NA 1FGUA 4GNXB 5IT9c 3CPWA 1Z47A 3NENA 1A2TA 3OTOQ 4K8IA 1YEZA 1Q90A 2ZM6Q 2KEDA 2AQ1B 3GTKH 2PNHA 2JA7G 4JV5L 3UE1A 1ENCA 4ZRZA 3TN2A 3I3CA 1F9PA 4DF7A 4ZKCB 5GADC 1SBBB 3OW7A 4DV1Q 4C3JH 1JMCA 1RHPA 2JP1A 3NXWA 2C35B 4B3RL 3IFTA 5L37A 1ZKOA 4QJFA 2JA8H 4DV0Q 3W3AA 1C8CA 1L0WA 1NR4A 3I4MG 1HR0L 4CJ0B 4BXXG 2F0GA 1SR3A 1I4GA 4R1JA 2EPBA 5IWAQ 4DR3Q 1MI2A 4CKCA 4POGA 2R7ZB 2E76C 4HCEA 3A5UA 3PF4A 1O7ZA 4R4CA 1JWSD 3ITPA 1SE8A 3WOEA 1I50H 4B3ML 4DUYQ 2D9UA 2NVXB 1W6JA 5C4XB 3FVQA 2B63B 1LV9A 1CKNA 2D0PA 1UNSA 1Q86C 4R4IA 3X3MA 4K0KQ 2Q2IA 4PG3A 2QILA 1WD1A 2QEXA 2F0VA 4XXEA 2AUJD 3TEHB 3V2TA 3LWUA 2PCFB 1SAPA 4NB3A 1IBMQ 4DGZA 2ZJPA 2IT1A 2WINB 3GTMB 3ULLA 4CHTB 2EE1A 2AMCB 2CCZA 2JA5B 2ALYB 3D8GA 2QGQA 2NVYH 2EQSA 3NTIA 1EOVA 1BBUA 4FNFA 3A55A 4B3TL 2EOTA 2N55A 4A3EH 4BY7G 2B2YA 4KJNA 1EYDA 2UUBQ 1AN8A 1EQRA 1N8RC 3KLSA 4X65L 3V96A 3PO2H 5CV7A 1XYIA 3RMHA 2R92B 2TSSA 3K8AA 3FHWA 4JI8Q 5ELNA 3U58A 1EY8A 3KBGA 4IUPA 5KYIA 4R4OA 3J7ZC 1KAWA 1M8AA 1CHPD 2OTJA 3VR2A 4UP8A 2ICIA 1KTKA 1ASYA 3CU7A 1KDBA 3S15B 4G57A 3U9SA 5BR8Q 4FDBA 5DLQE 1B1ZA 1AH9A 1XX8A 4RGNA 1EU3A 1IYJB 4C56C 2F0TA 2A74C 2XTIA 1QZHA 3R2IA 1E24A 4X66L 1KHIA 1X3FA 2ZT9C 1D8LA 4A93G 2GVBA 1CT1D 3MFYA 4AYBG 2F0UA 3M7GA 1TS4A 1E1TA 1EFWA 3EBEA 2A8VA 5EKIA 1WTWA 1VQ4A 1XMOQ 4A3DH 4X3KA 1B9NA 4ZUJA 1EYCA 2C5CA 2L1BA 1Q7YC 3GV6A 3U9OA 1JB7A 3I8ZA 4WRDA 4JVZA 1TY2A 1WTHA 4DV1L 1K83H 1KC8C 2DN8A 2TMPA 4DFAA 2Z4IA 4LJZC 3H0GG 3C1EA 2OWOA 5CORA 4HR7B 4JI7Q 3GTGB 1NE3A 1BCPF 4X64Q 4LF8L 1SRUA 1CM9A 2EYFA 1D5ZC 2G5DA 3S17H 2MJ8A 2VQEQ 2ES2A 2M2LA 5IY0A 5IWAL 1LYLA 4A3JG 2XN9C 3MEFA 1Z6HA 5A2QL 2KCCA 4I65A 2N88A 2DY8A 1DXMA 1JOOA 1V1PA 3SK4A 1VF5C 1XTDA 4CDEC 2MUYA 5IYBG 4Q0FA 1FJGL 1QWYA 4L5TA 3PF5A 1JE4A 4IJLA 3CCRA 4P2CB 4JCVE 2SDFA 1S5FD 5JJLA 1QILA 2CH4W 2OQ0A 1EYGA 1F9SA 2F0SA 4FVMA 3PUXA 2N49A 5C5MA 5C3EB 2EJGC 2VB2X 2K52A 3NBIA 1HUNA 4QMGA 2F0KA 2A6ED 3AYHB 3OWFA 1R9TH 4LFAL 1IXRA 1LTGD 2VB3X 3RLOA 2JA8G 1MBYA 2BOSA 1WTOA 1STYA 4KKSA 1G8ZD 1Z7TA 2UXCL 5IIFA 4R9WA 1X32A 1PTOB 1F9QA 1SYFA 1EIFA 1EWHA 3GTJB 1JC7A 1B8AA 4KN4C 3AMUA 1L1OA 3HOUH 3G4SA 2EY1A 5JVH3 1RKNA 4NXMQ 3CF5A 4GZYC 4DR1Q 5K36H 4JI8L 1HNWL 1X55A 4B9WA 3HOZH 3HEJA 3TRZA 4F7XA 5IYDH 1YI2A 3CCQA 2GA4B 4IFDI 1J5EQ 3S1MB 3J7YW 2SEBD 4MZ9A 4YY3Q 3A8JE 4JOIA 4LFCQ 2CWPA 2DJGC 3HS0C 1STEA 1K9MC 1LTLA 1V43A 4ME5A 1JWUD 5GQOA 3ND9A 4HJ5A 2MP1A 1HQRD 2UU9Q 1Q1EA 2K7VA 3O13A 4JI0Q 4DV6Q 1GO3E 4PZ8A 5C0XI 1PZJD 2WFWA 2JE6I 4C3IH 1WYDA 3R8BA 2R6GA 3I4NH 3RZOH 5I6WA 1XXGA 2WV6D 3MZ5A 3TP7A 3FEWX 3A8KE 2F0HA 4LFBL 3T51B 1VQLA 3I91A 3IAYA 4DAMA 4DV5L 4A3EG 4ME3A 4EQPA 3WOFA 1QNUA 3KLRA 3TP6A 3H3VI 4UDUC 3PO2G 4TVAB 3H09A 5CYUA 2CQOA 3D4WA 3PV0A 1X3PA 1DCZA 2A6EC 3WDNA 2NYZD 5H1SE 2IHFA 3M9BA 4LF4Q 2OF1A 1E2WA 3L7ZC 1PH6A 1I6VC 5LMUQ 3OSOA 2F3WA 2GN5A 3HOWH 3MVVA 3IKJA 4IURA 1ZYRD 2PI2E 1I3QB 3CRKC 3CCEA 4GKJL 4A3KB 1BR9A 1HHVA 3K7AH 2NVTB 1Y1VB 4M8AA 5NUCA 3S1RB 4PQXA 2BE5C 2XWBB 1JCKB 1S3OA 4O2DA 3RLNA 3QO2A 5HY6A 4O1NA 4A3MB 4TKOB 1TWFB 4S3SA 1N36L 1I4PA 1R4QB 4OGQC 5JEAH 3S2HH 1KRSA 2L5TA 3D4RA 4OIKA 5D3DA 1JWMD 3S16B 1C7YA 2BDNA 1BCPD 4AQYQ 5EGTA 2EXDA 5LL6X 4GLVB 4C1NK 2N78A 3AFQA 1ONLA 4RH6A 1NSNS 3GTPH 1QUQA 4LWCA 3OMGA 4A3DG 1FD7D 1PVOA 2XSCA 3RNUA 1S4ZA 4BY1H 5JOBA 3S14B 1MGSA 5M3MH 2DGYA 2I07B 4C2MH 4K5WA 3KLWA 5EKLA 4LF9Q 4BS9A 2CW0C 2B39A 3Q0AA 3CCUA 4JI4L 1KABA 1CSPA 1MIUA 4MTNA 2NZOA 2AWNA 3T4AC 3VYTA 2JA6H 4IFDH 1B70B 1UE6A 2A69D 4G7ZC 2Y0SB 1ZXTA 3AFPA 2D2CC 1WCMH 2KCMA 1GUSA 2L55A 4IPGA 3K80C 5JJKA 4NXML 4RA8A 1HPCA 4DR1L 1IL8A 5I2XA 2HCCA 3Q8DA 1S5ED 3I4MB 3HOYB 1I4HA 4LMQD 1YNJD 3PO3B 2A5HA 3GDEA 1J5EL 4H44C 2RQXA 1N32Q 5CGKA 5E4WC 3BVGA 4YY3L 5EBCA 3OIPA 1LABA 1E1OA 2V4DA 1A6XA 5C3XA 4DAYB 5C0XH 3DM1A 3CMAA 3F2BA 3J7AF 1L0YB 4LUVA 1OXXK 1PYBA 1TKWB 4KJOA 4BBRH 3NP8A 5ISRA 1V1OA 4Y7NH 2E74C 4OO1I 2J4XA 2PMZE 3FPUB 2F4VQ 4Y52H 4JG2A 1MJEA 1BCPC 1EZ6A 3DUZA 2LY7A 5FO7B 2OCEA 3U4VA 3S1QB 1WVLA 1VQHA 4FYDA 3LWEA 5C4JH 2XVSA 4JV5Q 4GLAC 3MHBA 2I5LX 4Z9CB 4A3BB 1D1IA 3RR5A 3TP8A 3OW2A 4RCNA 3J7AV 2AQ3B 2KJXA 5K36G 4WORA 4HMIA 3HOZG 4LF4L 4B3RQ 4I7AA 5IYDG 4BY7B 5FO9B 5LMUL 1TQOA 4A3FB 2OQKA 2XRSD 5TSSA 5I4DA 1VQAA 1DD2A 5CV5A 2NN6H 2Z4HA 4HIOA 1N9WA 1RIPA 4JC0A 4RKLA 1ICWA 4X3TA 1U9RA 2CVRA 3EQLC 1UUPA 2B2WA 2J0TD 2K28A 1GD7A 3DMUA 1CZWA 2H4OA 1IW7D 3I4OA 3OWEB 1W3SA 4C1NI 1UE7A 2K32A 1BUVT 1YNJC 1NMGA 1XPUA 4ABNA 1JT8A 4C3IG 1UEBA 1RDPD 2K33A 5JPNC 3I4NG 4CDDC 3CHBD 2WACA 3KLSX 5M5WB 5JPMC 3UDGA 1F2LA 2KVMA 3L2PA 4JI3L 2HUGA 2MQHA 2PYKA 3SVMA 4AYBB 1CA6A 4FF3A 1G6ZA 4XT1B 1JR0D 5AFWA 4C3HH 3PQIA 3HOWG 1BKBA 1NJIC 5FJ8H 3CC4A 1RODA 4ALPA 3G6EA 2K05A 4B3TQ 1CKOA 3VR5A 1E2ZA 2DJFC 4Q5VA 1TWHH 3BDOA 1GJXA 2ZJRA 1Y1WH 4RAUC 3H0GB 4L63B 1FNUA 3SE0A 1A3VA 1TWGH 4X65Q 3VR4A 4N9TA 3H94A 3S2DB 2FMMA 4OX9L 4NP5A 4HN7A 2WKCA 2PO4A 2B3GA 1D7QA 2EYOA 2F0MA 2B2YC 1AZQA 5ELBA 5JEAG 1MHWC 2AQ2B 3BZCA 3BVZA 4A3JB 1VCIA 3TDQA 1VQ8A 4FP5D 4OO1H 1YJWA 1JICA 2I5MX 1GVPA 2K50A 1LM0A 5EJWA 2XWJB 3K0YA 2B29A 3MEHA 4PMBA 1GHJA 1A3UA 1IW7C 4BY1G 2PQAB 1YNND 1RJTA 2K03A 4IO9A 5M3MG 1NMFA 4ZK9B 2QCPX 4HSPA
chains in the Genus database with same CATH topology
5J3BA 3A74A 4X66Q 4DKAC 1E24A 3EIVA 2B63G 2F4VL 2R93G 3M7NA 1I6HH 4JYAL 4X66L 1KHIA 1X3FA 3D31A 3JC66 1X56A 2Q2HA 1B7YB 1D8LA 4YCWA 4A93G 2GVBA 1Q12A 4A3CH 1YJNA 5GAGC 4AYBG 3HKSA 2JA6G 4IFDG 1E1TA 4RG1A 4MNOA 3EBEA 1EFWA 2A8VA 3HOUG 3B6YA 4XTCS 5C3EG 3PIPA 4NXNQ 5IP9H 3T1YL 1PH7A 1WFQA 1C9OA 1VQ4A 1XMOQ 1WCMG 4A3DH 3CXCA 1SFOH 2KHJA 2ID0A 1Q7YC 2VQFQ 1PH3A 1IBLQ 2H5XA 1XMOL 1JB7A 2CFMA 4DV1L 3FKIH 1K83H 1KC8C 2EIFA 2PQAA 4QGUA 4OONA 1AE2A 1IBLL 1H95A 3STBC 3H0GG 1CUKA 1SLJA 5FLXc 2OWOA 4LF8Q 3F8TA 1A62A 1E7ZA 1Z9FA 4JI7Q 1MJCA 4JBJA 4HJ8A 2VUMH 1NE3A 3CP0A 3F1ZA 3S1NH 1PV4A 4X64Q 1KRTA 5C0XG 4DV2Q 4GNXA 1HNZQ 1SRUA 4LF8L 4JI7L 1IZ6A 2JEAI 3KDFB 4DR6Q 4GN3B 2XGTA 1YHAA 4X64L 4JI6L 4A3BH 3S17H 2QA4A 2VQEQ 1HNZL 4GOPA 2ES2A 5FLMG 5IY0A 4A75A 1T9HA 3CMEA 5IWAL 1LYLA 1YNXA 2E8GA 4IPDA 4LUZA 3MEFA 4GNXC 2VQEL 4A3JG 4BA2I 3U4ZA 1NY4A 4JI2Q 4BBRG 2F3IA 3RN5A 3L0OA 1XMQQ 4IFDJ 1VS0A 3PCOB 2ZTEA 4YCVA 1FJGQ 3E9IA 4A3FH 3NEMA 4GN5A 5AJ3Q 4DR2Q 3U50C 4GOPC 3A0JA 3A5ZB 5IYBG 1XTDA 1FJGL 4HJ7A 3E0EA 3PGZA 4L5TA 1PH9A 2D0OA 2NVTH 3DM3A 1HZAA 3PF5A 4UP7A 1QZGA 4IJLA 3S24A 5IYCH 3CCRA 4DV7Q 3S1RH 2ZTCA 3OYYA 1G291 4JCVE 2NN6I 4JI1Q 2BA1A 3HOXH 3J81i 1KIXA 2UXBQ 4J15A 5M3FH 5JJLA 1VQFA 4DV7L 2OQ0A 3PUWA 1VQMA 1EYGA 1N33L 2YV5A 2CKZB 4PMWA 2UXBL 4LF7Q 3PUXA 1U0LA 2N49A 1A0IA 2E5LQ 4AH6A 2ZJQA 3J81j 1JJ2A 1OTCA 1XNRQ 4NPSA 5C0XJ 2K52A 4LFAQ 2E5LL 2R7ZH 4HJAA 3G48A 4DR5Q 4UP9A 4JBKA 4UY8C 3RZDH 3AYHB 1XNRL 1RL2A 1R9TH 4LFAL 1IXRA 2HQLA 3HOVH 2RCNA 1V9PA 4RMFA 3RLOA 2E2JH 2JA8G 1EIYB 2UXCQ 1GKHA 5C4XH 2YTVA 1X6OA 2NN6G 2B63H 3IRBA 3DLLA 1VQ7A 1U5KA 2VS1A 3BU2A 2MFIA 1UE1A 1IBKL 4KHPQ 2UXCL 4YCUA 2L15A 3ULJA 1EIFA 2GVAA 3CC2A 4KHPL 1G51A 1W2BA 4OXPA 1HNWQ 1B8AA 1PH5A 3HOUH 1L1OA 4YWKA 3PIOA 3G4SA 1YJ9A 1QVGA 4XIGS 2JA7H 1PYSB 3J80i 4NXMQ 1V1QA 3CF5A 2HIVA 4DR1Q 3UDFA 4JI8L 1HNWL 1X55A 4HIKA 3GTMH 1PA6A 3HOZH 3NELA 1K3RA 2JA5H 2D62A 4AYBE 2MO0A 3TRZA 5IYDH 1YI2A 3CCQA 1XJVA 4IFDI 1L1OC 2YTXA 1J5EQ 2A1AA 5E7NA 4MZ9A 2NZHA 2HHHL 4YY3Q 4JOIA 4PZ7A 2CWPA 4TQUS 4A3KG 4LFCQ 3ERSX 1LUZA 1Y1VG 1YBYA 2WP8J 1XPOA 2UXDL 3RLFA 3PUVA 1OXUA 2Z0SA 1WI5A 3I4MH 4BBSG 1K9MC 1YIJA 4LFCL 1LTLA 2VL6A 4A3LH 4IPHA 3S2DH 1KL9A 3M3YH 1V43A 2AWOA 3CD6A 3KFUA 4BXXH 4A3GH 4JOIC 5GQOA 1A8VA 2KENA 5M5XH 2R92H 4HJ5A 3H15A 2UUCQ 4A3MG 1FVIA 3KF6A 4L5SA 3UDXA 1K73C 3AEVA 2UUCL 1J6QA 2UU9Q 4KLKA 3CCJA 4R4TA 4A3JH 1Q1EA 4JI5Q 3M4PA 3W1BA 4JI0Q 4QQBX 4DV6Q 1GO3E 4PZ8A 5C0XI 3AQQA 4AIMA 3JAMi 3CCMA 3VDYA 2WFWA 5FJ8G 2JE6I 4C3IH 2UU9L 1VQKA 1WYDA 4JI5L 2VNUD 2R6GA 5M5YH 4JI0L 4LF5Q 1TWCH 1E22A 1X3EA 4DV6L 3I4NH 5IYBH 4DV5Q 3RZOH 1HZBA 1VQDA 1Y1WG 4DR4Q 3JAMc 3KYHC 4QIWE 4NXNL 1VQLA 4LF5L 2ATWA 1VQBA 1CKMA 2AKWB 4DAMA 4ME3A 4DV5L 4A3EG 1M1KC 4HJ9A 2E2HH 3ULPA 2R7FA 3HKZE 3TREA 2VQFL 3CCVA 1UE5A 3T1HQ 3H3VI 3PO2G 1VQEA 4TVAB 4DK6C 1YHBA 3ZJYC 2CQOA 3CCLA 3PV0A 1Q8KA 4WJ3M 2WB1G 2K5NA 4P73A 3SGIA 2BH8A 1UWVA 4A3IH 3M4OH 3S1QH 5H1SE 1OXTA 2IHFA 2PI2A 3M9BA 3KJOA 4LF4Q 3L7ZC 1PH6A 5LMUQ 3KJPA 2GN5A 1N34Q 3HOWH 1AE3A 5IP7H 3PUYA 4OO1G 1O7IA 4LUOA 5GAEC 4HIDA 1MKHA 4DV2L 4BA1I 2YU9H 2Y0SG 4GKJQ 4APVA 5GAHC 3LGJA 4DR6L 5C44G 1K8GA 2PI2E 1N34L 1G6PA 1QUQB 1NBWA 3CCEA 4GKJL 1EWIA 2BA0A 1X54A 1HR0Q 1Q46A 3K7AH 4BY7H 1CKNB 2KCTA 3BZKA 3KOJA 3HKZG 4P72A 2K5VA 3PSIA 3HOYG 2A19A 4JI2L 1HR0W 4H02A 1XMQL 1PHJA 4LF6Q 3CW2C 3PO3G 1S3OA 2RHSB 4O2DA 3RLNA 1N36Q 1K8AC 1Y14B 1BBWA 5HY6A 3GD7A 4DNIA 5AJ3L 4DR2L 4LF6L 1HZCA 1N36L 3K0XA 3PUZA 3S2HH 1KRSA 4A3CG 1E3PA 4JI1L 1HH2P 3KDFA 4AQYQ 1C7YA 4DV3Q 2IX1A 2EXDA 4B3MQ 4GLVB 2N78A 3AFQA 1X65A 4AQYL 2YYZA 5IP9G 4DV3L 2UUAQ 4LF7L 3GTPH 1QUQA 1BVSA 4LWCA 1X9NA 4A3DG 1PVOA 4LW1A 4B3SQ 3ER0A 3UE0A 3RNUA 1YITA 5LMNQ 2BH2A 4BY1H 4QY7A 1I5FA 2DGYA 2RHQB 2ZTDA 3FKIG 4C2MH 5HGQA 5M3MH 4DR5L 4B3SL 3E9HA 5LMNW 4LNQA 5M5WH 4KHZA 4O0AA 2NVXH 4JI4Q 4GKKQ 3EN2A 3KLWA 2R93H 4DV4Q 2Q2TA 2LSSA 4LF9Q 1OXSC 4L5RC 3WWVA 4DUZQ 2VZAA 2VUMG 3CCUA 1DGSA 2V1CC 4JI4L 4A93H 4POFA 2MNAA 4DR7Q 4X62Q 4DV4L 4LF9L 1CSPA 1MIUA 4MTNA 2NZOA 2AWNA 4DUZL 2JA6H 4DR7L 1B70B 1UE6A 4OWXB 1IL2A 4A3BG 1QVCA 4X62L 1HJPA 3AFPA 1VQ5A 5C3EH 3ICEA 3TS2A 1WCMH 2OTLA 1EUJA 2KCMA 1VQGA 1A63A 4IPGA 1NTGA 3K80C 5IE8A 4NXML 3K81C 1PH4A 5JJKA 4DR1L 3CPFA 3BJUA 4A3FG 3Q8DA 3TQYA 2HIXA 4YHHQ 2KHIA 2IX0A 1PFSA 3GDEA 1J5EL 3H0GH 4WJ4A 4EQ5A 5JJIA 1N32Q 5IYCG 4YY3L 2VY3A 1E1OA 3W1GA 1Q82C 3HOXG 4YWMA 4A76A 4DAYB 5M3FG 3CMAA 3F2BA 1N32L 3FP9A 3I55A 1TWAH 3GTJH 4L5QA 1WJJA 2JJQA 1JJCB 2WAQE 2IHEA 4LUVA 1SMXA 2WB1E 5FLMH 3I2ZA 1FL0A 4UPAA 3NBHB 1OXXK 1PYBA 1YVCA 3F2CA 4BBRH 2R7ZG 3KF8B 4Y7NH 5EAYA 4GN4B 2K5HA 3S1MH 1K0RA 4OO1I 2Z6KA 1YZ6A 2JQOA 1P8LA 2Y0SE 2PMZE 3CC7A 3HOVG 3S15H 5ELOA 1C0AA 2F4VQ 3GTLH 4Y52H 4JG2A 1MJEA 2RF4A 1CSQA 2N3SA 3HFZB 4IOAA 5C4XG 4JBMA 2OCEA 2Z6KC 1KD1C 2N8NA 3U4VA 1VQIA 1VQHA 4DR4L 1FGUA 4GNXB 5IT9c 5C4JH 3CPWA 1Z47A 1VQJA 3NENA 4YWLA 4R4QA 4GLAC 2WAQG 3OTOQ 4JV5Q 1YEZA 2I5LX 3T1YQ 4LFBL 2ZM6Q 3T1HL 3RR5A 1ASZA 2CWAA 4GOPB 3GTKH 2PNHA 3I7FA 2JA7G 3UE1A 2I5HA 3OTOL 3OW2A 3GTQH 4JV5L 5JEAJ 2DUDA 2ZM6L 5K36G 5GADC 4DV1Q 4B3RQ 4C3JH 3HOZG 2I0QA 1JMCA 4LF4L 1VQ6A 2JA5G 5IYDG 5LMUL 4IOCA 2OQKA 4DK3C 3F2DA 1HZ9A 1TXYA 2C35B 2LXKA 4B3RL 1KXLA 4QJFA 2Q2UA 2JA8H 3J7A5 1VQAA 2F52A 4EX5A 4DV0Q 4HIOA 1N9WA 1L0WA 1RIPA 3RN2A 3I4MG 4DV0L 1HR0L 2JA9A 4JC0A 4DPGA 4JI6Q 4A3LG 4BXXG 2JEBI 4A3GG 1SR3A 2R92G 1GD7A 4IPCA 1QVFA 1VQCA 4R1JA 5IWAQ 3GTGH 1GM5A 2MO1A 3I4OA 4DR3Q 1S40A 1W3SA 1UE7A 1S72A 1NMGA 4POGA 1XPUA 4DR3L 1JT8A 2K14A 4QL5A 3A5UA 3PF4A 1VQ9A 1L2FA 1UEBA 3UDIA 4R4CA 1M90C 1I3QH 2KBNA 1KQSA 4GS3A 3I4NG 1SE8A 4GLXA 1I50H 4B3ML 4JI3Q 4DUYQ 4A3KH 3M4QA 1EQQA 1Q1BA 1Y1VH 2UUAL 3UDGA 2D0PA 1CKNA 1Q86C 4R4IA 3L2PA 4BBSH 4JI3L 4DUYL 2MQHA 1N33Q 4K0KQ 2Q2IA 2LXJA 4PG3A 1JE5A 5LMNL 3TS0A 1XPRA 2QEXA 1VQPA 3CAMA 4KI0A 3MXNB 4P75A 4A3MH 1Q81C 3TEHB 4K0KL 1L1OB 1TWFH 4A3IG 4GKKL 2AHOB 3M85A 4NB3A 3J81c 1IBMQ 4C3HH 2IY5B 4X6AH 2ASBA 2ZJPA 2IT1A 1JJGA 3STBD 4P74A 3S16H 3HOWG 1BKBA 3ULLA 5IP7G 1NJIC 1SROA 3D0FA 1IBML 5FJ8H 4LFBQ 1OXVA 2AMCB 2CCZA 3CC4A 2ALYB 2QGQA 2NVYH 4ALPA 2EQSA 1I94Q 2R7DA 2E2IH 3G6EA 1EOVA 4B3TQ 2YTYA 1CKOA 1BBUA 2NVQH 3GO5A 2FXQA 1TWHH 2VW9A 3GTOH 2ZJRA 2K75A 4A4IA 1Y1WH 1PH2A 1I94L 1IBKQ 1XNQQ 4B3TL 1YHQA 3W5OA 4A3EH 1TWGH 4X65Q 4BY7G 2UUBQ 3S14H 1VQOA 4OX9Q 1EQRA 1XNQL 3K7UC 4OWTB 1N8RC 4X65L 3PO2H 4PZ6A 2UUBL 4OX9L 1SN8A 4YHHL 3KF6B 3I56A 1D7QA 2B3GA 3K8AA 3FHWA 4JI8Q 5ELNA 3U58A 1WOCA 3CQZH 5JEAG 1HNXQ 3BZCA 1P16A 4R4OA 1VCIA 3J7ZC 1KAWA 1VQ8A 1X3GA 4IJHA 2OTJA 2HT1A 1YJWA 4UP8A 1HNXL 1VQNA 2I5MX 2HHHQ 1ASYA 1GVPA 2JK8A 5C44H 3G71A 3J80c 4HIMA 2UXDQ 5GROA 3CCSA 2K50A 1LM0A 5BR8Q 4FDBA 5DLQE 2K4KA 4OWWB 4P71A 2B29A 1AH9A 1PH8A 4JBWA 1IYJB 4BY1G 5BR8L 3H3VH 2PQAB 4IO9A 3HOYH 2XTIA 1NMFA 5M3MG 1QZHA 1PH1A 3PO3H 4JYAQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3B A;  3A74 A;  4X66 Q;  4DKA C;  1E24 A;  3EIV A;  2B63 G;  2F4V L;  2R93 G;  3M7N A;  1I6H H;  4JYA L;  4X66 L;  1KHI A;  1X3F A;  3D31 A;  3JC6 6;  1X56 A;  2Q2H A;  1B7Y B;  1D8L A;  4YCW A;  4A93 G;  2GVB A;  1Q12 A;  4A3C H;  1YJN A;  5GAG C;  4AYB G;  3HKS A;  2JA6 G;  4IFD G;  1E1T A;  4RG1 A;  4MNO A;  3EBE A;  1EFW A;  2A8V A;  3HOU G;  3B6Y A;  4XTC S;  5C3E G;  3PIP A;  4NXN Q;  5IP9 H;  3T1Y L;  1PH7 A;  1WFQ A;  1C9O A;  1VQ4 A;  1XMO Q;  1WCM G;  4A3D H;  3CXC A;  1SFO H;  2KHJ A;  2ID0 A;  1Q7Y C;  2VQF Q;  1PH3 A;  1IBL Q;  2H5X A;  1XMO L;  1JB7 A;  2CFM A;  4DV1 L;  3FKI H;  1K83 H;  1KC8 C;  2EIF A;  2PQA A;  4QGU A;  4OON A;  1AE2 A;  1IBL L;  1H95 A;  3STB C;  3H0G G;  1CUK A;  1SLJ A;  5FLX c;  2OWO A;  4LF8 Q;  3F8T A;  1A62 A;  1E7Z A;  1Z9F A;  4JI7 Q;  1MJC A;  4JBJ A;  4HJ8 A;  2VUM H;  1NE3 A;  3CP0 A;  3F1Z A;  3S1N H;  1PV4 A;  4X64 Q;  1KRT A;  5C0X G;  4DV2 Q;  4GNX A;  1HNZ Q;  1SRU A;  4LF8 L;  4JI7 L;  1IZ6 A;  2JEA I;  3KDF B;  4DR6 Q;  4GN3 B;  2XGT A;  1YHA A;  4X64 L;  4JI6 L;  4A3B H;  3S17 H;  2QA4 A;  2VQE Q;  1HNZ L;  4GOP A;  2ES2 A;  5FLM G;  5IY0 A;  4A75 A;  1T9H A;  3CME A;  5IWA L;  1LYL A;  1YNX A;  2E8G A;  4IPD A;  4LUZ A;  3MEF A;  4GNX C;  2VQE L;  4A3J G;  4BA2 I;  3U4Z A;  1NY4 A;  4JI2 Q;  4BBR G;  2F3I A;  3RN5 A;  3L0O A;  1XMQ Q;  4IFD J;  1VS0 A;  3PCO B;  2ZTE A;  4YCV A;  1FJG Q;  3E9I A;  4A3F H;  3NEM A;  4GN5 A;  5AJ3 Q;  4DR2 Q;  3U50 C;  4GOP C;  3A0J A;  3A5Z B;  5IYB G;  1XTD A;  1FJG L;  4HJ7 A;  3E0E A;  3PGZ A;  4L5T A;  1PH9 A;  2D0O A;  2NVT H;  3DM3 A;  1HZA A;  3PF5 A;  4UP7 A;  1QZG A;  4IJL A;  3S24 A;  5IYC H;  3CCR A;  4DV7 Q;  3S1R H;  2ZTC A;  3OYY A;  1G29 1;  4JCV E;  2NN6 I;  4JI1 Q;  2BA1 A;  3HOX H;  3J81 i;  1KIX A;  2UXB Q;  4J15 A;  5M3F H;  5JJL A;  1VQF A;  4DV7 L;  2OQ0 A;  3PUW A;  1VQM A;  1EYG A;  1N33 L;  2YV5 A;  2CKZ B;  4PMW A;  2UXB L;  4LF7 Q;  3PUX A;  1U0L A;  2N49 A;  1A0I A;  2E5L Q;  4AH6 A;  2ZJQ A;  3J81 j;  1JJ2 A;  1OTC A;  1XNR Q;  4NPS A;  5C0X J;  2K52 A;  4LFA Q;  2E5L L;  2R7Z H;  4HJA A;  3G48 A;  4DR5 Q;  4UP9 A;  4JBK A;  4UY8 C;  3RZD H;  3AYH B;  1XNR L;  1RL2 A;  1R9T H;  4LFA L;  1IXR A;  2HQL A;  3HOV H;  2RCN A;  1V9P A;  4RMF A;  3RLO A;  2E2J H;  2JA8 G;  1EIY B;  2UXC Q;  1GKH A;  5C4X H;  2YTV A;  1X6O A;  2NN6 G;  2B63 H;  3IRB A;  3DLL A;  1VQ7 A;  1U5K A;  2VS1 A;  3BU2 A;  2MFI A;  1UE1 A;  1IBK L;  4KHP Q;  2UXC L;  4YCU A;  2L15 A;  3ULJ A;  1EIF A;  2GVA A;  3CC2 A;  4KHP L;  1G51 A;  1W2B A;  4OXP A;  1HNW Q;  1B8A A;  1PH5 A;  3HOU H;  1L1O A;  4YWK A;  3PIO A;  3G4S A;  1YJ9 A;  1QVG A;  4XIG S;  2JA7 H;  1PYS B;  3J80 i;  4NXM Q;  1V1Q A;  3CF5 A;  2HIV A;  4DR1 Q;  3UDF A;  4JI8 L;  1HNW L;  1X55 A;  4HIK A;  3GTM H;  1PA6 A;  3HOZ H;  3NEL A;  1K3R A;  2JA5 H;  2D62 A;  4AYB E;  2MO0 A;  3TRZ A;  5IYD H;  1YI2 A;  3CCQ A;  1XJV A;  4IFD I;  1L1O C;  2YTX A;  1J5E Q;  2A1A A;  5E7N A;  4MZ9 A;  2NZH A;  2HHH L;  4YY3 Q;  4JOI A;  4PZ7 A;  2CWP A;  4TQU S;  4A3K G;  4LFC Q;  3ERS X;  1LUZ A;  1Y1V G;  1YBY A;  2WP8 J;  1XPO A;  2UXD L;  3RLF A;  3PUV A;  1OXU A;  2Z0S A;  1WI5 A;  3I4M H;  4BBS G;  1K9M C;  1YIJ A;  4LFC L;  1LTL A;  2VL6 A;  4A3L H;  4IPH A;  3S2D H;  1KL9 A;  3M3Y H;  1V43 A;  2AWO A;  3CD6 A;  3KFU A;  4BXX H;  4A3G H;  4JOI C;  5GQO A;  1A8V A;  2KEN A;  5M5X H;  2R92 H;  4HJ5 A;  3H15 A;  2UUC Q;  4A3M G;  1FVI A;  3KF6 A;  4L5S A;  3UDX A;  1K73 C;  3AEV A;  2UUC L;  1J6Q A;  2UU9 Q;  4KLK A;  3CCJ A;  4R4T A;  4A3J H;  1Q1E A;  4JI5 Q;  3M4P A;  3W1B A;  4JI0 Q;  4QQB X;  4DV6 Q;  1GO3 E;  4PZ8 A;  5C0X I;  3AQQ A;  4AIM A;  3JAM i;  3CCM A;  3VDY A;  2WFW A;  5FJ8 G;  2JE6 I;  4C3I H;  2UU9 L;  1VQK A;  1WYD A;  4JI5 L;  2VNU D;  2R6G A;  5M5Y H;  4JI0 L;  4LF5 Q;  1TWC H;  1E22 A;  1X3E A;  4DV6 L;  3I4N H;  5IYB H;  4DV5 Q;  3RZO H;  1HZB A;  1VQD A;  1Y1W G;  4DR4 Q;  3JAM c;  3KYH C;  4QIW E;  4NXN L;  1VQL A;  4LF5 L;  2ATW A;  1VQB A;  1CKM A;  2AKW B;  4DAM A;  4ME3 A;  4DV5 L;  4A3E G;  1M1K C;  4HJ9 A;  2E2H H;  3ULP A;  2R7F A;  3HKZ E;  3TRE A;  2VQF L;  3CCV A;  1UE5 A;  3T1H Q;  3H3V I;  3PO2 G;  1VQE A;  4TVA B;  4DK6 C;  1YHB A;  3ZJY C;  2CQO A;  3CCL A;  3PV0 A;  1Q8K A;  4WJ3 M;  2WB1 G;  2K5N A;  4P73 A;  3SGI A;  2BH8 A;  1UWV A;  4A3I H;  3M4O H;  3S1Q H;  5H1S E;  1OXT A;  2IHF A;  2PI2 A;  3M9B A;  3KJO A;  4LF4 Q;  3L7Z C;  1PH6 A;  5LMU Q;  3KJP A;  2GN5 A;  1N34 Q;  3HOW H;  1AE3 A;  5IP7 H;  3PUY A;  4OO1 G;  1O7I A;  4LUO A;  5GAE C;  4HID A;  1MKH A;  4DV2 L;  4BA1 I;  2YU9 H;  2Y0S G;  4GKJ Q;  4APV A;  5GAH C;  3LGJ A;  4DR6 L;  5C44 G;  1K8G A;  2PI2 E;  1N34 L;  1G6P A;  1QUQ B;  1NBW A;  3CCE A;  4GKJ L;  1EWI A;  2BA0 A;  1X54 A;  1HR0 Q;  1Q46 A;  3K7A H;  4BY7 H;  1CKN B;  2KCT A;  3BZK A;  3KOJ A;  3HKZ G;  4P72 A;  2K5V A;  3PSI A;  3HOY G;  2A19 A;  4JI2 L;  1HR0 W;  4H02 A;  1XMQ L;  1PHJ A;  4LF6 Q;  3CW2 C;  3PO3 G;  1S3O A;  2RHS B;  4O2D A;  3RLN A;  1N36 Q;  1K8A C;  1Y14 B;  1BBW A;  5HY6 A;  3GD7 A;  4DNI A;  5AJ3 L;  4DR2 L;  4LF6 L;  1HZC A;  1N36 L;  3K0X A;  3PUZ A;  3S2H H;  1KRS A;  4A3C G;  1E3P A;  4JI1 L;  1HH2 P;  3KDF A;  4AQY Q;  1C7Y A;  4DV3 Q;  2IX1 A;  2EXD A;  4B3M Q;  4GLV B;  2N78 A;  3AFQ A;  1X65 A;  4AQY L;  2YYZ A;  5IP9 G;  4DV3 L;  2UUA Q;  4LF7 L;  3GTP H;  1QUQ A;  1BVS A;  4LWC A;  1X9N A;  4A3D G;  1PVO A;  4LW1 A;  4B3S Q;  3ER0 A;  3UE0 A;  3RNU A;  1YIT A;  5LMN Q;  2BH2 A;  4BY1 H;  4QY7 A;  1I5F A;  2DGY A;  2RHQ B;  2ZTD A;  3FKI G;  4C2M H;  5HGQ A;  5M3M H;  4DR5 L;  4B3S L;  3E9H A;  5LMN W;  4LNQ A;  5M5W H;  4KHZ A;  4O0A A;  2NVX H;  4JI4 Q;  4GKK Q;  3EN2 A;  3KLW A;  2R93 H;  4DV4 Q;  2Q2T A;  2LSS A;  4LF9 Q;  1OXS C;  4L5R C;  3WWV A;  4DUZ Q;  2VZA A;  2VUM G;  3CCU A;  1DGS A;  2V1C C;  4JI4 L;  4A93 H;  4POF A;  2MNA A;  4DR7 Q;  4X62 Q;  4DV4 L;  4LF9 L;  1CSP A;  1MIU A;  4MTN A;  2NZO A;  2AWN A;  4DUZ L;  2JA6 H;  4DR7 L;  1B70 B;  1UE6 A;  4OWX B;  1IL2 A;  4A3B G;  1QVC A;  4X62 L;  1HJP A;  3AFP A;  1VQ5 A;  5C3E H;  3ICE A;  3TS2 A;  1WCM H;  2OTL A;  1EUJ A;  2KCM A;  1VQG A;  1A63 A;  4IPG A;  1NTG A;  3K80 C;  5IE8 A;  4NXM L;  3K81 C;  1PH4 A;  5JJK A;  4DR1 L;  3CPF A;  3BJU A;  4A3F G;  3Q8D A;  3TQY A;  2HIX A;  4YHH Q;  2KHI A;  2IX0 A;  1PFS A;  3GDE A;  1J5E L;  3H0G H;  4WJ4 A;  4EQ5 A;  5JJI A;  1N32 Q;  5IYC G;  4YY3 L;  2VY3 A;  1E1O A;  3W1G A;  1Q82 C;  3HOX G;  4YWM A;  4A76 A;  4DAY B;  5M3F G;  3CMA A;  3F2B A;  1N32 L;  3FP9 A;  3I55 A;  1TWA H;  3GTJ H;  4L5Q A;  1WJJ A;  2JJQ A;  1JJC B;  2WAQ E;  2IHE A;  4LUV A;  1SMX A;  2WB1 E;  5FLM H;  3I2Z A;  1FL0 A;  4UPA A;  3NBH B;  1OXX K;  1PYB A;  1YVC A;  3F2C A;  4BBR H;  2R7Z G;  3KF8 B;  4Y7N H;  5EAY A;  4GN4 B;  2K5H A;  3S1M H;  1K0R A;  4OO1 I;  2Z6K A;  1YZ6 A;  2JQO A;  1P8L A;  2Y0S E;  2PMZ E;  3CC7 A;  3HOV G;  3S15 H;  5ELO A;  1C0A A;  2F4V Q;  3GTL H;  4Y52 H;  4JG2 A;  1MJE A;  2RF4 A;  1CSQ A;  2N3S A;  3HFZ B;  4IOA A;  5C4X G;  4JBM A;  2OCE A;  2Z6K C;  1KD1 C;  2N8N A;  3U4V A;  1VQI A;  1VQH A;  4DR4 L;  1FGU A;  4GNX B;  5IT9 c;  5C4J H;  3CPW A;  1Z47 A;  1VQJ A;  3NEN A;  4YWL A;  4R4Q A;  4GLA C;  2WAQ G;  3OTO Q;  4JV5 Q;  1YEZ A;  2I5L X;  3T1Y Q;  4LFB L;  2ZM6 Q;  3T1H L;  3RR5 A;  1ASZ A;  2CWA A;  4GOP B;  3GTK H;  2PNH A;  3I7F A;  2JA7 G;  3UE1 A;  2I5H A;  3OTO L;  3OW2 A;  3GTQ H;  4JV5 L;  5JEA J;  2DUD A;  2ZM6 L;  5K36 G;  5GAD C;  4DV1 Q;  4B3R Q;  4C3J H;  3HOZ G;  2I0Q A;  1JMC A;  4LF4 L;  1VQ6 A;  2JA5 G;  5IYD G;  5LMU L;  4IOC A;  2OQK A;  4DK3 C;  3F2D A;  1HZ9 A;  1TXY A;  2C35 B;  2LXK A;  4B3R L;  1KXL A;  4QJF A;  2Q2U A;  2JA8 H;  3J7A 5;  1VQA A;  2F52 A;  4EX5 A;  4DV0 Q;  4HIO A;  1N9W A;  1L0W A;  1RIP A;  3RN2 A;  3I4M G;  4DV0 L;  1HR0 L;  2JA9 A;  4JC0 A;  4DPG A;  4JI6 Q;  4A3L G;  4BXX G;  2JEB I;  4A3G G;  1SR3 A;  2R92 G;  1GD7 A;  4IPC A;  1QVF A;  1VQC A;  4R1J A;  5IWA Q;  3GTG H;  1GM5 A;  2MO1 A;  3I4O A;  4DR3 Q;  1S40 A;  1W3S A;  1UE7 A;  1S72 A;  1NMG A;  4POG A;  1XPU A;  4DR3 L;  1JT8 A;  2K14 A;  4QL5 A;  3A5U A;  3PF4 A;  1VQ9 A;  1L2F A;  1UEB A;  3UDI A;  4R4C A;  1M90 C;  1I3Q H;  2KBN A;  1KQS A;  4GS3 A;  3I4N G;  1SE8 A;  4GLX A;  1I50 H;  4B3M L;  4JI3 Q;  4DUY Q;  4A3K H;  3M4Q A;  1EQQ A;  1Q1B A;  1Y1V H;  2UUA L;  3UDG A;  2D0P A;  1CKN A;  1Q86 C;  4R4I A;  3L2P A;  4BBS H;  4JI3 L;  4DUY L;  2MQH A;  1N33 Q;  4K0K Q;  2Q2I A;  2LXJ A;  4PG3 A;  1JE5 A;  5LMN L;  3TS0 A;  1XPR A;  2QEX A;  1VQP A;  3CAM A;  4KI0 A;  3MXN B;  4P75 A;  4A3M H;  1Q81 C;  3TEH B;  4K0K L;  1L1O B;  1TWF H;  4A3I G;  4GKK L;  2AHO B;  3M85 A;  4NB3 A;  3J81 c;  1IBM Q;  4C3H H;  2IY5 B;  4X6A H;  2ASB A;  2ZJP A;  2IT1 A;  1JJG A;  3STB D;  4P74 A;  3S16 H;  3HOW G;  1BKB A;  3ULL A;  5IP7 G;  1NJI C;  1SRO A;  3D0F A;  1IBM L;  5FJ8 H;  4LFB Q;  1OXV A;  2AMC B;  2CCZ A;  3CC4 A;  2ALY B;  2QGQ A;  2NVY H;  4ALP A;  2EQS A;  1I94 Q;  2R7D A;  2E2I H;  3G6E A;  1EOV A;  4B3T Q;  2YTY A;  1CKO A;  1BBU A;  2NVQ H;  3GO5 A;  2FXQ A;  1TWH H;  2VW9 A;  3GTO H;  2ZJR A;  2K75 A;  4A4I A;  1Y1W H;  1PH2 A;  1I94 L;  1IBK Q;  1XNQ Q;  4B3T L;  1YHQ A;  3W5O A;  4A3E H;  1TWG H;  4X65 Q;  4BY7 G;  2UUB Q;  3S14 H;  1VQO A;  4OX9 Q;  1EQR A;  1XNQ L;  3K7U C;  4OWT B;  1N8R C;  4X65 L;  3PO2 H;  4PZ6 A;  2UUB L;  4OX9 L;  1SN8 A;  4YHH L;  3KF6 B;  3I56 A;  1D7Q A;  2B3G A;  3K8A A;  3FHW A;  4JI8 Q;  5ELN A;  3U58 A;  1WOC A;  3CQZ H;  5JEA G;  1HNX Q;  3BZC A;  1P16 A;  4R4O A;  1VCI A;  3J7Z C;  1KAW A;  1VQ8 A;  1X3G A;  4IJH A;  2OTJ A;  2HT1 A;  1YJW A;  4UP8 A;  1HNX L;  1VQN A;  2I5M X;  2HHH Q;  1ASY A;  1GVP A;  2JK8 A;  5C44 H;  3G71 A;  3J80 c;  4HIM A;  2UXD Q;  5GRO A;  3CCS A;  2K50 A;  1LM0 A;  5BR8 Q;  4FDB A;  5DLQ E;  2K4K A;  4OWW B;  4P71 A;  2B29 A;  1AH9 A;  1PH8 A;  4JBW A;  1IYJ B;  4BY1 G;  5BR8 L;  3H3V H;  2PQA B;  4IO9 A;  3HOY H;  2XTI A;  1NMF A;  5M3M G;  1QZH A;  1PH1 A;  3PO3 H;  4JYA Q; 
#chains in the Genus database with same CATH topology
 4X66 Q;  1ESF A;  1SXT A;  4JPB W;  3HP3 A;  1STB A;  2F4V L;  2CHB D;  2NB0 A;  4JYA L;  1B7Y B;  5J39 A;  3GTK B;  2R3Z A;  4KV6 A;  1Q12 A;  2PNR C;  4A3C H;  3A56 A;  1H9M A;  2Q8I B;  3HKS A;  2JA6 G;  4IFD G;  4KKU A;  4O42 A;  2YU9 B;  5CV4 A;  2RCF A;  3MA2 B;  1QB5 D;  2EYP A;  1PH7 A;  3NBH A;  1WCM G;  5I9O A;  5K5P A;  2ID0 A;  2O4X A;  3OOC A;  1D6E C;  3KF8 A;  2B2V C;  2O5J C;  2H5X A;  5CV6 A;  2K5D A;  1BF4 A;  1SEB D;  2BCO A;  3N52 A;  4QGU A;  4OON A;  2EVB A;  3GP7 A;  4LF8 Q;  3F8T A;  1Z9F A;  5C6A A;  4NDX A;  3S1N H;  1EY6 A;  5C0X G;  1IZ6 A;  1EY4 A;  4DR6 Q;  4GN3 B;  5DM7 3;  4N8F A;  1F2Z A;  4ZYS A;  2QA4 A;  4GOP A;  2LFN A;  1T9H A;  3CME A;  4IPD A;  5FKA C;  4BA2 I;  1HFG A;  4BBR G;  2F3I A;  3NQI A;  1XMQ Q;  2ZTE A;  1FJG Q;  3E9I A;  1WTR A;  3NEM A;  5AJ3 Q;  3J80 E;  3PGZ A;  3SK8 A;  4TRD A;  3K5N A;  1HZA A;  4UP7 A;  5EKK A;  3OYY A;  5M3F H;  1H9K A;  1XWE A;  1H9J A;  3PUW A;  1VQM A;  2C9O A;  2YV5 A;  4PMW A;  2RDF A;  4LF7 Q;  1YNN C;  2ZJQ A;  3EJI A;  2NVY B;  5DNF A;  2M00 A;  3DWP A;  2F0L A;  4LFA Q;  4G7O C;  2R7Z H;  3K57 A;  4DR5 Q;  4HTH A;  1CI3 M;  4UP9 A;  4JBK A;  4A3E B;  2PW7 A;  1V9P A;  4RMF A;  3NTK A;  1GXD C;  3PO2 B;  2UXC Q;  1GKH A;  5C4X H;  2YTV A;  2NN6 G;  2B63 H;  1ML0 D;  2KUM A;  3FPP A;  3IRB A;  3DLL A;  3SHL A;  1JOQ A;  2PZT A;  2MFI A;  1UE1 A;  4DN4 M;  2F0J A;  4FF1 A;  2GVA A;  3TZU A;  2Z9H A;  2L9H A;  1G51 A;  3MXN A;  4OXP A;  1HNW Q;  1PH5 A;  4YWK A;  2PZW A;  1PYS B;  4G4K A;  3D6W A;  1BNZ A;  4H13 C;  4HIK A;  1BCP B;  3GTM H;  3NEL A;  2JA5 H;  4AYB E;  3BDC A;  1L1O C;  2OXP A;  1D1K A;  1SYD A;  3NUC A;  3GTL B;  4PZ7 A;  4TQU S;  2NZ1 D;  2WP8 J;  3RLF A;  1OXU A;  3OMC A;  1WI5 A;  1CQV A;  1YIJ A;  3G6J B;  4A3L H;  3GV3 A;  2AWO A;  4JOI C;  1EU4 A;  1A8V A;  2F0O A;  2R92 H;  3KF6 A;  4IUU A;  1HTL D;  1SND A;  1EY7 A;  3L9A X;  1K73 C;  1BBX C;  1DOL A;  3GTQ B;  4C3H G;  4R4T A;  3QB3 A;  2KEC A;  4A3D B;  1K8M A;  3JAM i;  5FJ8 G;  4QUF A;  1VQK A;  1CTM A;  4JI5 L;  5EPJ A;  4LFB Q;  1TU2 B;  2HQE A;  4XYQ A;  4DV5 Q;  2EYH A;  1HZB A;  3MFG A;  1Y1W G;  2F03 A;  3KYH C;  4LF5 L;  1VQB A;  1CKM A;  2I46 A;  4HJ9 A;  4DAV A;  1DJR D;  3HKZ E;  3TRE A;  3T1H Q;  1YHB A;  1QE6 A;  1Q8K A;  2QEJ C;  2WB1 G;  4P73 A;  1PRT D;  2ZXO A;  1Y8N B;  1UWV A;  2BH8 A;  3SGI A;  4A3I H;  3M4O H;  3S17 B;  4HMJ A;  4EVO A;  3MXU A;  4K5V A;  5LL6 S;  5BN4 A;  3KJP A;  1EOT A;  1EYA A;  4CDC C;  1C48 A;  3HG9 A;  1KLG D;  4OO1 G;  4GKJ Q;  5DEH A;  4DR6 L;  1N34 L;  1VMC A;  3ERO A;  2BA0 A;  3QWN A;  1CKN B;  2KCT A;  3BZK A;  3HKZ G;  1U4P A;  4CBV A;  1XMQ L;  1N36 Q;  1BBW A;  1U4M A;  3GD7 A;  4DNI A;  5AJ3 L;  4IAL A;  5JJZ A;  4PV1 C;  1CZG A;  3K0X A;  1D2B A;  1F2M A;  1NCV A;  4A3C G;  2ZXP A;  5IOC A;  4RCO A;  3KDF A;  4F88 A;  1B9M A;  3BG3 A;  1EEF D;  2Z1C A;  1PDQ A;  1X65 A;  1R9T B;  2E2I B;  2NVQ B;  4LF7 L;  5J22 A;  2EJF C;  3ER0 A;  1V8Q A;  3UE0 A;  4C3J G;  1YIT A;  2X69 A;  2LS0 1;  4QY7 A;  1BXT A;  4H0L C;  5HGQ A;  1ET9 A;  4DR5 L;  5LMN W;  4O0A A;  5KGU A;  4JI4 Q;  2R93 H;  4K8J A;  1OXS C;  3JAM E;  3WWV A;  4KY6 A;  3BS1 A;  4POF A;  4QUC A;  3CQZ B;  1KDA A;  4DUZ L;  1I4R A;  1PFM A;  4DR7 L;  4RWS C;  2PMZ B;  3M4Y A;  1VQ5 A;  5C3E H;  5C44 B;  3SK5 A;  2KQ3 A;  2ICE C;  3FMC A;  4RGT A;  1PH4 A;  1PRT C;  1TT2 A;  3CPF A;  1KDC A;  3BJU A;  4E6I A;  3AU7 A;  1A15 A;  2B8F A;  2HIX A;  2IX0 A;  4WJ4 A;  1JOR A;  1X3Q A;  1ICF B;  2FMC A;  3SDZ A;  1I6H B;  2MHV A;  2VY3 A;  3I70 A;  4A76 A;  5M3F G;  1PTO H;  1LT6 D;  3I55 A;  1TWA H;  3GTJ H;  4L5Q A;  1JJC B;  2WAQ E;  2E75 C;  3C1F A;  2PZU A;  4UPA A;  4FXK C;  3I4N B;  3RZO B;  3QOJ A;  1YVC A;  3C46 A;  3F2C A;  3V05 A;  2R7Z G;  4GN4 B;  1KNE A;  3MXG A;  5EPL A;  3S1M H;  2O5I C;  2Z6K A;  1SDF A;  2X6G A;  1PLF A;  5ELO A;  4DNR B;  3L3O C;  1T5E A;  1CSQ A;  3QIA A;  2RSN A;  4IOA A;  3R2T A;  2EJM A;  5C4X G;  2SOB A;  1S5C D;  2FJ2 A;  1B3Q A;  1LO5 D;  2Z6B A;  1VQI A;  2G9H D;  4DAY A;  1TR5 A;  1VQJ A;  4IUN A;  4R4Q A;  2WAQ G;  3HOW B;  1IHZ A;  3T1Y Q;  1SE2 A;  2HCI A;  3T1H L;  1EWC A;  2F0F A;  3I7F A;  3DHQ A;  5JEA J;  2DUD A;  2B2U C;  2I0Q A;  1SNQ A;  1VQ6 A;  2JA5 G;  2F0P A;  4EQO A;  4IOC A;  3F2D A;  2F52 A;  4QB4 A;  5FOB B;  2RSO A;  3BDL A;  5KYL A;  4M1U B;  3IL8 A;  3RN2 A;  3K5L A;  1IKM A;  1H9S A;  2JA9 A;  3E6Z X;  5M9O A;  3HOX B;  4A3L G;  2SNS A;  3RUZ A;  3VR3 A;  1TVX A;  2R92 G;  4IPC A;  2L12 A;  1VQC A;  1GM5 A;  2MO1 A;  1EQV A;  1SYE A;  1LT3 D;  4UAI A;  1HQM C;  3DWQ A;  1T5X D;  3PIP 3;  3SK6 A;  1GUO A;  2RKS A;  4QL5 A;  4RGM A;  1VQ9 A;  1L2F A;  1M90 C;  3T53 B;  1I3Q H;  2KBN A;  5IGD A;  4GS3 A;  5M3M B;  4JI3 Q;  4A3K H;  3QG1 A;  4V0B A;  1EEI D;  1H9R A;  1Q1B A;  1Y1V H;  1QOH A;  4BBS H;  4XDX A;  2K01 A;  1SMY D;  5EQ0 A;  2LXJ A;  3VA7 A;  1JE5 A;  3TS0 A;  1XPR A;  2K1B A;  4B08 A;  3CAM A;  1VQP A;  4A3M H;  1L1O B;  1TWF H;  1PFB A;  4CJ1 B;  4F8M A;  4A3I G;  5HGT A;  3J80 L;  2JA7 B;  3NSW A;  5EBD A;  3EA6 A;  1JJG A;  2VXW A;  4P74 A;  2NTT A;  3STB D;  3S16 H;  1AZP A;  1SRO A;  2G9D A;  3MWY W;  1FGB D;  1OXV A;  2A6H D;  2R7D A;  1A3T A;  5T1I A;  2YTY A;  3BYT B;  3GTO H;  2K75 A;  4A4I A;  1I94 L;  1IBK Q;  1WD0 A;  1PMR A;  3S14 H;  1VQO A;  4OX9 Q;  1XNQ L;  2JSO A;  3K7U C;  1LT4 D;  4OWT B;  4DK1 A;  4PZ6 A;  1ILQ A;  3E0J A;  5M5X B;  3I56 A;  2QW7 A;  1ZYR C;  1BO0 A;  1KNA A;  1O7L A;  1P16 A;  1PZK D;  3BVM A;  4BBR B;  4HSV A;  2HT1 A;  4Y7N B;  1HNX L;  1ENA A;  4ULL A;  2JK8 A;  3J80 c;  3E3X A;  1TWC B;  4MTK A;  2UXD Q;  3ONA B;  1SJH D;  1DYQ A;  1XTC D;  2K4K A;  4OWW B;  4P71 A;  1PH8 A;  4LAA A;  2E2H B;  3H3V H;  3HOY H;  2DNC A;  1PH1 A;  2WKD A;  3PO3 H;  4JYA Q;  5J3B A;  4RFB A;  5C4J B;  2B2T A;  5CBE E;  2FFK B;  3EIV A;  1B4O A;  2PQE A;  2F1M A;  2R93 G;  3M7N A;  3T56 B;  1VDZ A;  1X56 A;  3NE5 B;  5BN5 A;  3KUP A;  3TZD A;  3TSS A;  5GAG C;  3PIO 3;  4KMU C;  1CHQ D;  1LLR D;  1Y8P B;  3HOU G;  5J1Z A;  3B6Y A;  4RGO S;  4XTC S;  5C3E G;  1MD2 D;  1TII D;  4NXN Q;  3T1Y L;  1WFQ A;  3J81 E;  3CXC A;  1SFO H;  2KHJ A;  4IUT A;  2VQF Q;  4CKE A;  1GOZ A;  3K58 A;  2SNM A;  2F0I A;  2Q8R E;  3FKI H;  3E5S A;  2EIF A;  2PQA A;  1O7Y A;  1IBL L;  4PMC A;  3STB C;  1SLJ A;  2A69 C;  1E7Z A;  1MJC A;  4HJ8 A;  2VUM H;  5A35 A;  3CP0 A;  3F1Z A;  3QR8 A;  1KRT A;  4GNX A;  1I4Q A;  1YHA A;  4A3B H;  1HNZ L;  2PPB C;  1AEX A;  4A75 A;  2NUC A;  4KD4 A;  1EQT A;  1D5X C;  1CQF A;  5ELF A;  1YNX A;  2E8G A;  1AP0 A;  4LUZ A;  3I73 A;  5EPK A;  4XQJ A;  1NY4 A;  3RN5 A;  3L0O A;  2F0W A;  2KA7 A;  4A3F H;  4GN5 A;  4DR2 Q;  4GOP C;  4K6L A;  1WTP A;  1WTV A;  4FF2 A;  3E0E A;  2D0O A;  3DM3 A;  3SEB A;  1QZG A;  3I4L A;  1WTQ A;  3S24 A;  5IYC H;  1RTO A;  2L4N A;  4J6H A;  2DNE A;  5BN3 A;  4JI1 Q;  2A68 D;  3RD4 A;  2BA1 A;  4A93 B;  4IQZ A;  1E2V A;  4C3H B;  1VQF A;  5FK9 C;  4DV7 L;  1G91 A;  2CKZ B;  4F87 A;  1PRT B;  2UXB L;  1J9O A;  1U0L A;  1A0I A;  3Q23 A;  3QOL A;  4HED A;  4AH6 A;  1AW7 A;  2LMC B;  1DON A;  4NPS A;  2JXM B;  1TWH B;  4MHE A;  2E5L L;  4ZCK A;  2EY2 A;  4HJA A;  4ODG A;  4OIJ A;  1TWG B;  2EYJ A;  3P1H A;  3RZD H;  1XNR L;  3HOV H;  2RCN A;  2E2J H;  1X6O A;  1LAC A;  4X3S A;  5KEE A;  1VQ7 A;  1OO9 B;  1U5K A;  2VS1 A;  5KNB A;  3BU2 A;  4JK1 C;  2NWG A;  1IBK L;  4YCU A;  2L15 A;  1SE3 A;  2HDM A;  1JOK A;  1MSH A;  4CGY B;  3NQT A;  4KHP L;  1W2B A;  1NAP A;  1SNC A;  5D65 A;  2IX3 A;  5FLX E;  1QVG A;  1ENF A;  1YJ9 A;  2HDL A;  3J80 i;  1HUM A;  1VF7 A;  1V1Q A;  2HIV A;  5CR3 A;  3UDF A;  4DXF A;  4K14 A;  3JAM L;  1K3R A;  2K5W A;  2D62 A;  3T13 A;  3HKZ B;  2YTX A;  1XJV A;  2H1E A;  1CA5 A;  4RHR A;  1SJE D;  4K2K A;  2NZH A;  4A3K G;  2NTS A;  3ERS X;  1YBY A;  1Y1V G;  2UXD L;  1XPO A;  1PYW D;  2Z0S A;  4BBS G;  2FIN B;  3BZD B;  3K5O A;  2VL6 A;  3S2D H;  1KL9 A;  3M3Y H;  1PRT F;  3CD6 A;  4A3G H;  2KEN A;  4IUV A;  4NKL A;  1BQQ T;  4A3M G;  3AB9 A;  4EGV A;  4L5S A;  4TSS A;  2UUC L;  1J6Q A;  4ZUI A;  4KLK A;  3CCJ A;  3G7L A;  4A3J H;  4JI5 Q;  3IFD A;  3AQQ A;  3VYS A;  4C3J B;  1A2U A;  3CCM A;  3VDY A;  1O80 A;  1Y69 U;  2VNU D;  2A68 C;  5M5Y H;  4LF5 Q;  1E22 A;  1X3E A;  5IYB H;  1VQD A;  3F2U A;  2JA8 B;  4ZKB B;  1LTA D;  1QG7 A;  4DR4 Q;  1G2S A;  4QIW E;  4NXN L;  3JAM c;  1K28 A;  3MXP A;  2ATW A;  2AKW B;  1M1K C;  1NUC A;  2XNA C;  3ULP A;  1WTX A;  2VQF L;  3S1N B;  1UE5 A;  4DK6 C;  5D14 A;  1S5B D;  3K5M A;  4ID6 A;  3ZJY C;  1OXT A;  2PI2 A;  2MGS A;  2RBM A;  5KRU A;  1N34 Q;  5IP7 H;  1O7I A;  5C4Z A;  4HID A;  2YU9 H;  2Y0S G;  1B2T A;  1HA6 A;  1K8G A;  2IL8 A;  1DM0 B;  4HAE A;  1NBW A;  3KBX A;  1I50 B;  1S5D D;  1EWI A;  4RHS A;  1X54 A;  2B8G A;  3KOJ A;  4P72 A;  1STG A;  3PSI A;  5ELC A;  3HOY G;  2A19 A;  1HR0 W;  4H02 A;  1PHJ A;  3CW2 C;  3PO3 G;  4XYO A;  2RHS B;  5M3F B;  1UAP A;  1K8A C;  4XQQ A;  1Y14 B;  3NK9 A;  4DR2 L;  1LTT D;  4LF6 L;  3MAQ A;  1MSG A;  3FDT A;  3PUZ A;  4WFN 3;  3W2D A;  5IOD A;  4JI1 L;  1STA A;  1HH2 P;  3GQB A;  3DWA A;  1C4Q A;  4U68 A;  2F0D A;  4B9X A;  2UUA Q;  4DV3 L;  3N6R A;  1X9N A;  1FR3 A;  4LW1 A;  5LMN Q;  2BH2 A;  2IW3 A;  3CKI B;  3OHX C;  4B3S L;  3FKI G;  3QJY A;  3E9H A;  2NVX H;  4KHZ A;  4GKK Q;  1EY0 A;  3VYR A;  1E0B A;  4ZQ3 A;  3EN2 A;  2WAQ B;  4KK7 A;  3URY A;  4DUZ Q;  2VZA A;  2VUM G;  1EIG A;  1DGS A;  2V1C C;  1HTP A;  4NW2 A;  4DR7 Q;  4DV4 L;  3NTH A;  2BDO A;  4OWX B;  5C3W A;  1SNM A;  1IL2 A;  4A3B G;  1QVC A;  4X62 L;  5IGE A;  3ICE A;  1TS3 A;  3TS2 A;  1SNP A;  2OTL A;  1QJO A;  1VQG A;  4OHJ A;  3K81 C;  4A3F G;  3TQY A;  1D5M C;  1VMP A;  4YHH Q;  2KHI A;  2IWH A;  1HA5 A;  4KY5 A;  1PFS A;  2KOL A;  4EQ5 A;  5JJI A;  1G2T A;  3SXH A;  5IYC G;  1F77 A;  3W1G A;  4KY7 A;  2EYM A;  4XT3 B;  4YWM A;  1GUG A;  3FP9 A;  4FXD A;  1TS5 A;  1RCV D;  2Q8T A;  4LK1 C;  1L0X B;  1WJJ A;  1EFI D;  1K8O A;  1SMX A;  2WB1 E;  5FLM H;  3NBH B;  1J8I A;  3OIQ A;  1TS2 A;  3KF8 B;  5EAY A;  2JQO A;  1P8L A;  3S15 H;  3HOV G;  1K83 B;  1C0A A;  3GTL H;  5C5L A;  2RF4 A;  2N3S A;  2EY5 A;  4JBM A;  4FXG C;  4A3I B;  2Z6K C;  1KD1 C;  3M4O B;  3LX0 A;  4J1M A;  4DR4 L;  3H3V C;  3VA5 A;  4OEL B;  2OEO A;  1B44 D;  4YWL A;  4R8I A;  1JQY D;  3S9W A;  1Q3L A;  2B2V A;  2CQA A;  1ASZ A;  2CWA A;  4GOP B;  3UI2 A;  4FO2 A;  3OTO L;  2I5H A;  3R93 A;  3GTQ H;  1BOS A;  2F3V A;  1ET6 A;  2ZM6 L;  2CH4 A;  1EZ8 A;  2XIW A;  4DXG A;  4DK3 C;  1HZ9 A;  1TXY A;  2LXK A;  1ILP A;  1KXL A;  2Q2U A;  3J7A 5;  4EX5 A;  4DAP A;  3A7L A;  4EQN A;  1B50 A;  2AUK A;  4DV0 L;  4U67 3;  4DPG A;  5CV9 A;  4R8N A;  3J81 L;  3MC0 B;  1CFM A;  4JI6 Q;  2JEB I;  4A3G G;  4FF4 A;  3HZX A;  5DAU A;  1QVF A;  3GTG H;  2RDH A;  1EL0 A;  2NBF A;  1S40 A;  2PW5 A;  2F0Q A;  1S72 A;  1GUW A;  1BDO A;  4DR3 L;  2K14 A;  3UDI A;  2HD3 A;  1KQS A;  3T16 A;  5IGF A;  4GLX A;  1EQQ A;  3M4Q A;  1ZEQ X;  5D3I B;  1DZ1 A;  2UUA L;  2R93 B;  2J7Z A;  2M9V A;  1K3B C;  4DUY L;  3FRP B;  1N33 Q;  5LMN L;  1AFP A;  1HXY D;  1Q81 C;  1DOM A;  3Q6S A;  3MXN B;  4KI0 A;  4P75 A;  5G3L F;  1EIH A;  4K0K L;  4MIU A;  1II3 A;  3HOU B;  2AHO B;  4GKK L;  3M85 A;  3J81 c;  4WJW A;  4N9P A;  2IY5 B;  4X6A H;  2ASB A;  5IT9 E;  2L11 A;  5IP7 G;  4G7H C;  3D0F A;  1IBM L;  3HOZ B;  3KK7 A;  2P5Z X;  1I94 Q;  2E2I H;  4DU9 A;  2NVQ H;  2JN4 A;  2FXQ A;  3GO5 A;  2VW9 A;  1PH2 A;  1XNQ Q;  2QDL A;  5I9P A;  3D6C A;  1YHQ A;  3W5O A;  2O2L D;  2D5D A;  4CDF C;  5FO8 B;  4ZAI A;  2UUB L;  1UEA B;  1SN8 A;  4YHH L;  3KF6 B;  2F4I A;  1TWA B;  1RD9 D;  1WOC A;  2EZV A;  2BE5 D;  3CQZ H;  1PZI D;  3A54 A;  1HNX Q;  5CBA E;  3C3L A;  1EY9 A;  3X3N A;  4KHV A;  5E3F A;  1X3G A;  4IJH A;  3K59 A;  1FYC A;  1STN A;  2HHH Q;  1VQN A;  4C3I B;  5C44 H;  3G71 A;  4QF4 A;  2FHT A;  4HIM A;  5JAV A;  1EY5 A;  4HCS A;  5GRO A;  3CCS A;  5FLX L;  1B53 A;  4JBW A;  4JW0 A;  5BR8 L;  1STH A;  4DNT B;  3A74 A;  3LNN A;  4DKA C;  3HRZ C;  2B63 G;  4IUQ A;  1I6H H;  4XQN A;  3D31 A;  3JC6 6;  2KCN A;  2Q2H A;  2X6L A;  2XRQ D;  4YCW A;  1YJN A;  2B2T C;  4QCL A;  4RG1 A;  4MNO A;  5KIX A;  4KTA A;  2CW0 D;  4IN3 A;  3PIP A;  2K6A A;  5IP9 H;  1SNO A;  1C9O A;  1HCZ A;  5E1F A;  1PH3 A;  3K7A B;  1IBL Q;  5JVG 3;  1XMO L;  2KHS A;  2CFM A;  1V1P B;  1PTO F;  5E4X A;  2QKI C;  1AE2 A;  3MTS A;  1H95 A;  1LTR D;  1CUK A;  5FLX c;  1A62 A;  5CV8 A;  4JBJ A;  4IZ8 A;  1LTI D;  1PV4 A;  2EYL A;  3TBI B;  4DV2 Q;  1M4V A;  1HNZ Q;  3S2H B;  4JI7 L;  2JEA I;  3KDF B;  1FNW A;  1PXU A;  2XGT A;  4X64 L;  4JI6 L;  2ENB A;  3DEO A;  5FLM G;  5F2D A;  1HRJ A;  3VYU A;  4GNX C;  3GTP B;  2B2W C;  2VQE L;  3U4Z A;  4JI2 Q;  4IFD J;  1VS0 A;  3PCO B;  4YCV A;  4V19 0;  4BY1 B;  4BBS B;  3U50 C;  3A0J A;  3A5Z B;  4C2M B;  4HJ7 A;  1PH9 A;  2NVT H;  4DV7 Q;  3S1R H;  2ZTC A;  1G29 1;  2NN6 I;  2F0E A;  3HOX H;  3J81 i;  1KIX A;  1DOK A;  4J15 A;  2UXB Q;  2K5Q A;  4L6T B;  1N33 L;  3NHH A;  2JA6 B;  3VR6 A;  2E5L Q;  2JYO A;  3EFX D;  3J81 j;  4OL7 A;  1JJ2 A;  1OTC A;  1XNR Q;  5C0X J;  1WCM B;  1R4P B;  4UHV A;  3GTO B;  1RTN A;  3G48 A;  3D3R A;  5I6Y A;  5LHY 1;  5COY A;  4UY8 C;  1RL2 A;  1U4L A;  4KKT A;  4X3U A;  2EXZ A;  2HQL A;  3NWT A;  4J8Q A;  1EIY B;  4CKB A;  4H7B A;  4KHP Q;  1F2Y A;  5IGB A;  3ULJ A;  3CC2 A;  1U4R A;  2F0N A;  2K04 A;  1Y8O B;  3ND8 A;  3PIO A;  2JA7 H;  4XIG S;  5G3L D;  3DEP A;  1LTB D;  4K6D A;  3P75 A;  1TY0 A;  4NMZ A;  4QIW B;  1PA6 A;  2MO0 A;  1B3A A;  2A1A A;  5E7N A;  4L8J A;  2HHH L;  3TME A;  1NR2 A;  1LUZ A;  2EDG A;  1SYG A;  3PUV A;  3I4M H;  4LFC L;  1QCB D;  5T1G A;  4IPH A;  3C2P A;  4BXX H;  3KFU A;  2E2D C;  5M5X H;  1SYC A;  2UUC Q;  3H15 A;  3I90 A;  1FVI A;  3UDX A;  3AEV A;  4DA2 A;  5DM6 3;  3SR1 A;  4QQB X;  3M4P A;  3I72 A;  3W1B A;  1SFO B;  4AIM A;  2QF7 A;  2UU9 L;  3EVQ A;  1SMY C;  4JI0 L;  1TWC H;  4DV6 L;  3FKI B;  4ZLT F;  1KLU D;  4BWG B;  2E2H H;  2EY6 A;  1H9S B;  2R7F A;  1RF2 D;  2VUM B;  3CCV A;  2WII B;  5I2Y A;  4K5X A;  1VQE A;  3P20 A;  1JB3 A;  4KD3 A;  2B2U A;  3NWS A;  3CCL A;  5A2Q E;  4WJ3 M;  1W6K A;  2K5N A;  2A6H C;  3S1Q H;  3KJO A;  2OT2 A;  4ILW A;  3Q22 A;  1AE3 A;  3PUY A;  4LUO A;  5GAE C;  1MKH A;  4DV2 L;  4BA1 I;  1GHK A;  4APV A;  3H6M A;  5GAH C;  3LGJ A;  1G6P A;  5C4H A;  5C44 G;  1QUQ B;  4KN7 C;  2MPM A;  3BYY B;  1HR0 Q;  1Q46 A;  5IGG A;  3P7J A;  1I4X A;  4BY7 H;  1NNX A;  2A73 B;  2K5V A;  1SE4 A;  5KND A;  2RVL A;  1IYU A;  4MN3 A;  4JI2 L;  4LF6 Q;  1PTO D;  1ESR A;  3K6O A;  3ERQ A;  1HZC A;  1KAA A;  2IJ0 A;  1E3P A;  5ELE A;  4DV3 Q;  5ELD A;  2IX1 A;  1QNK A;  4K2L A;  4B3M Q;  3RZD B;  4AQY L;  3HOV B;  2YYZ A;  5IP9 G;  2LKV A;  1BVS A;  2E2J B;  4DK0 A;  4B3S Q;  5KNC A;  1Y1W B;  1SSO A;  1I5F A;  2RHQ B;  2ZTD A;  4OEM B;  4LNQ A;  5M5W H;  4YIJ A;  1Q8I A;  1GUN A;  3D4D A;  4DV4 Q;  2LSS A;  2Q2T A;  2WB1 B;  4L5R C;  3A8I E;  4A93 H;  5HUR A;  2MNA A;  4X62 Q;  4LF9 L;  3HGB A;  2Z8L A;  2L0C A;  1HJP A;  1LTS D;  2DY7 A;  3R3O A;  3TP5 A;  1EUJ A;  5CC4 A;  1A63 A;  2RDG A;  1NTG A;  1CK1 A;  5IE8 A;  1SYB A;  4N8X 1;  1IKL A;  3OPO A;  2KEE A;  1O78 A;  5IT9 L;  2QDB A;  1GUT A;  4RKB A;  3M3Y B;  2IPK D;  2R61 A;  3H0G H;  4A3G B;  3H91 A;  3HOX G;  1Q82 C;  1IYV A;  1N32 L;  3Q24 A;  1HFN A;  1FNV A;  2JJQ A;  5IGC A;  3A7A B;  2IHE A;  3PMF A;  4CJ2 C;  1PFN A;  3I2Z A;  1FL0 A;  5M5Y B;  1K0S A;  1F9R A;  1PTO C;  3DXJ C;  4I7Z C;  2ZXR A;  2K5H A;  1K0R A;  3CC7 A;  1YZ6 A;  2RA4 A;  2Y0S E;  1LT5 D;  4PNY A;  3ZYY X;  3NPP A;  3HFZ B;  5CMD A;  3CRL C;  2N8N A;  1FGU A;  4GNX B;  5IT9 c;  3CPW A;  1Z47 A;  3NEN A;  1A2T A;  3OTO Q;  4K8I A;  1YEZ A;  1Q90 A;  2ZM6 Q;  2KED A;  2AQ1 B;  3GTK H;  2PNH A;  2JA7 G;  4JV5 L;  3UE1 A;  1ENC A;  4ZRZ A;  3TN2 A;  3I3C A;  1F9P A;  4DF7 A;  4ZKC B;  5GAD C;  1SBB B;  3OW7 A;  4DV1 Q;  4C3J H;  1JMC A;  1RHP A;  2JP1 A;  3NXW A;  2C35 B;  4B3R L;  3IFT A;  5L37 A;  1ZKO A;  4QJF A;  2JA8 H;  4DV0 Q;  3W3A A;  1C8C A;  1L0W A;  1NR4 A;  3I4M G;  1HR0 L;  4CJ0 B;  4BXX G;  2F0G A;  1SR3 A;  1I4G A;  4R1J A;  2EPB A;  5IWA Q;  4DR3 Q;  1MI2 A;  4CKC A;  4POG A;  2R7Z B;  2E76 C;  4HCE A;  3A5U A;  3PF4 A;  1O7Z A;  4R4C A;  1JWS D;  3ITP A;  1SE8 A;  3WOE A;  1I50 H;  4B3M L;  4DUY Q;  2D9U A;  2NVX B;  1W6J A;  5C4X B;  3FVQ A;  2B63 B;  1LV9 A;  1CKN A;  2D0P A;  1UNS A;  1Q86 C;  4R4I A;  3X3M A;  4K0K Q;  2Q2I A;  4PG3 A;  2QIL A;  1WD1 A;  2QEX A;  2F0V A;  4XXE A;  2AUJ D;  3TEH B;  3V2T A;  3LWU A;  2PCF B;  1SAP A;  4NB3 A;  1IBM Q;  4DGZ A;  2ZJP A;  2IT1 A;  2WIN B;  3GTM B;  3ULL A;  4CHT B;  2EE1 A;  2AMC B;  2CCZ A;  2JA5 B;  2ALY B;  3D8G A;  2QGQ A;  2NVY H;  2EQS A;  3NTI A;  1EOV A;  1BBU A;  4FNF A;  3A55 A;  4B3T L;  2EOT A;  2N55 A;  4A3E H;  4BY7 G;  2B2Y A;  4KJN A;  1EYD A;  2UUB Q;  1AN8 A;  1EQR A;  1N8R C;  3KLS A;  4X65 L;  3V96 A;  3PO2 H;  5CV7 A;  1XYI A;  3RMH A;  2R92 B;  2TSS A;  3K8A A;  3FHW A;  4JI8 Q;  5ELN A;  3U58 A;  1EY8 A;  3KBG A;  4IUP A;  5KYI A;  4R4O A;  3J7Z C;  1KAW A;  1M8A A;  1CHP D;  2OTJ A;  3VR2 A;  4UP8 A;  2ICI A;  1KTK A;  1ASY A;  3CU7 A;  1KDB A;  3S15 B;  4G57 A;  3U9S A;  5BR8 Q;  4FDB A;  5DLQ E;  1B1Z A;  1AH9 A;  1XX8 A;  4RGN A;  1EU3 A;  1IYJ B;  4C56 C;  2F0T A;  2A74 C;  2XTI A;  1QZH A;  3R2I A;  1E24 A;  4X66 L;  1KHI A;  1X3F A;  2ZT9 C;  1D8L A;  4A93 G;  2GVB A;  1CT1 D;  3MFY A;  4AYB G;  2F0U A;  3M7G A;  1TS4 A;  1E1T A;  1EFW A;  3EBE A;  2A8V A;  5EKI A;  1WTW A;  1VQ4 A;  1XMO Q;  4A3D H;  4X3K A;  1B9N A;  4ZUJ A;  1EYC A;  2C5C A;  2L1B A;  1Q7Y C;  3GV6 A;  3U9O A;  1JB7 A;  3I8Z A;  4WRD A;  4JVZ A;  1TY2 A;  1WTH A;  4DV1 L;  1K83 H;  1KC8 C;  2DN8 A;  2TMP A;  4DFA A;  2Z4I A;  4LJZ C;  3H0G G;  3C1E A;  2OWO A;  5COR A;  4HR7 B;  4JI7 Q;  3GTG B;  1NE3 A;  1BCP F;  4X64 Q;  4LF8 L;  1SRU A;  1CM9 A;  2EYF A;  1D5Z C;  2G5D A;  3S17 H;  2MJ8 A;  2VQE Q;  2ES2 A;  2M2L A;  5IY0 A;  5IWA L;  1LYL A;  4A3J G;  2XN9 C;  3MEF A;  1Z6H A;  5A2Q L;  2KCC A;  4I65 A;  2N88 A;  2DY8 A;  1DXM A;  1JOO A;  1V1P A;  3SK4 A;  1VF5 C;  1XTD A;  4CDE C;  2MUY A;  5IYB G;  4Q0F A;  1FJG L;  1QWY A;  4L5T A;  3PF5 A;  1JE4 A;  4IJL A;  3CCR A;  4P2C B;  4JCV E;  2SDF A;  1S5F D;  5JJL A;  1QIL A;  2CH4 W;  2OQ0 A;  1EYG A;  1F9S A;  2F0S A;  4FVM A;  3PUX A;  2N49 A;  5C5M A;  5C3E B;  2EJG C;  2VB2 X;  2K52 A;  3NBI A;  1HUN A;  4QMG A;  2F0K A;  2A6E D;  3AYH B;  3OWF A;  1R9T H;  4LFA L;  1IXR A;  1LTG D;  2VB3 X;  3RLO A;  2JA8 G;  1MBY A;  2BOS A;  1WTO A;  1STY A;  4KKS A;  1G8Z D;  1Z7T A;  2UXC L;  5IIF A;  4R9W A;  1X32 A;  1PTO B;  1F9Q A;  1SYF A;  1EIF A;  1EWH A;  3GTJ B;  1JC7 A;  1B8A A;  4KN4 C;  3AMU A;  1L1O A;  3HOU H;  3G4S A;  2EY1 A;  5JVH 3;  1RKN A;  4NXM Q;  3CF5 A;  4GZY C;  4DR1 Q;  5K36 H;  4JI8 L;  1HNW L;  1X55 A;  4B9W A;  3HOZ H;  3HEJ A;  3TRZ A;  4F7X A;  5IYD H;  1YI2 A;  3CCQ A;  2GA4 B;  4IFD I;  1J5E Q;  3S1M B;  3J7Y W;  2SEB D;  4MZ9 A;  4YY3 Q;  3A8J E;  4JOI A;  4LFC Q;  2CWP A;  2DJG C;  3HS0 C;  1STE A;  1K9M C;  1LTL A;  1V43 A;  4ME5 A;  1JWU D;  5GQO A;  3ND9 A;  4HJ5 A;  2MP1 A;  1HQR D;  2UU9 Q;  1Q1E A;  2K7V A;  3O13 A;  4JI0 Q;  4DV6 Q;  1GO3 E;  4PZ8 A;  5C0X I;  1PZJ D;  2WFW A;  2JE6 I;  4C3I H;  1WYD A;  3R8B A;  2R6G A;  3I4N H;  3RZO H;  5I6W A;  1XXG A;  2WV6 D;  3MZ5 A;  3TP7 A;  3FEW X;  3A8K E;  2F0H A;  4LFB L;  3T51 B;  1VQL A;  3I91 A;  3IAY A;  4DAM A;  4DV5 L;  4A3E G;  4ME3 A;  4EQP A;  3WOF A;  1QNU A;  3KLR A;  3TP6 A;  3H3V I;  4UDU C;  3PO2 G;  4TVA B;  3H09 A;  5CYU A;  2CQO A;  3D4W A;  3PV0 A;  1X3P A;  1DCZ A;  2A6E C;  3WDN A;  2NYZ D;  5H1S E;  2IHF A;  3M9B A;  4LF4 Q;  2OF1 A;  1E2W A;  3L7Z C;  1PH6 A;  1I6V C;  5LMU Q;  3OSO A;  2F3W A;  2GN5 A;  3HOW H;  3MVV A;  3IKJ A;  4IUR A;  1ZYR D;  2PI2 E;  1I3Q B;  3CRK C;  3CCE A;  4GKJ L;  4A3K B;  1BR9 A;  1HHV A;  3K7A H;  2NVT B;  1Y1V B;  4M8A A;  5NUC A;  3S1R B;  4PQX A;  2BE5 C;  2XWB B;  1JCK B;  1S3O A;  4O2D A;  3RLN A;  3QO2 A;  5HY6 A;  4O1N A;  4A3M B;  4TKO B;  1TWF B;  4S3S A;  1N36 L;  1I4P A;  1R4Q B;  4OGQ C;  5JEA H;  3S2H H;  1KRS A;  2L5T A;  3D4R A;  4OIK A;  5D3D A;  1JWM D;  3S16 B;  1C7Y A;  2BDN A;  1BCP D;  4AQY Q;  5EGT A;  2EXD A;  5LL6 X;  4GLV B;  4C1N K;  2N78 A;  3AFQ A;  1ONL A;  4RH6 A;  1NSN S;  3GTP H;  1QUQ A;  4LWC A;  3OMG A;  4A3D G;  1FD7 D;  1PVO A;  2XSC A;  3RNU A;  1S4Z A;  4BY1 H;  5JOB A;  3S14 B;  1MGS A;  5M3M H;  2DGY A;  2I07 B;  4C2M H;  4K5W A;  3KLW A;  5EKL A;  4LF9 Q;  4BS9 A;  2CW0 C;  2B39 A;  3Q0A A;  3CCU A;  4JI4 L;  1KAB A;  1CSP A;  1MIU A;  4MTN A;  2NZO A;  2AWN A;  3T4A C;  3VYT A;  2JA6 H;  4IFD H;  1B70 B;  1UE6 A;  2A69 D;  4G7Z C;  2Y0S B;  1ZXT A;  3AFP A;  2D2C C;  1WCM H;  2KCM A;  1GUS A;  2L55 A;  4IPG A;  3K80 C;  5JJK A;  4NXM L;  4RA8 A;  1HPC A;  4DR1 L;  1IL8 A;  5I2X A;  2HCC A;  3Q8D A;  1S5E D;  3I4M B;  3HOY B;  1I4H A;  4LMQ D;  1YNJ D;  3PO3 B;  2A5H A;  3GDE A;  1J5E L;  4H44 C;  2RQX A;  1N32 Q;  5CGK A;  5E4W C;  3BVG A;  4YY3 L;  5EBC A;  3OIP A;  1LAB A;  1E1O A;  2V4D A;  1A6X A;  5C3X A;  4DAY B;  5C0X H;  3DM1 A;  3CMA A;  3F2B A;  3J7A F;  1L0Y B;  4LUV A;  1OXX K;  1PYB A;  1TKW B;  4KJO A;  4BBR H;  3NP8 A;  5ISR A;  1V1O A;  4Y7N H;  2E74 C;  4OO1 I;  2J4X A;  2PMZ E;  3FPU B;  2F4V Q;  4Y52 H;  4JG2 A;  1MJE A;  1BCP C;  1EZ6 A;  3DUZ A;  2LY7 A;  5FO7 B;  2OCE A;  3U4V A;  3S1Q B;  1WVL A;  1VQH A;  4FYD A;  3LWE A;  5C4J H;  2XVS A;  4JV5 Q;  4GLA C;  3MHB A;  2I5L X;  4Z9C B;  4A3B B;  1D1I A;  3RR5 A;  3TP8 A;  3OW2 A;  4RCN A;  3J7A V;  2AQ3 B;  2KJX A;  5K36 G;  4WOR A;  4HMI A;  3HOZ G;  4LF4 L;  4B3R Q;  4I7A A;  5IYD G;  4BY7 B;  5FO9 B;  5LMU L;  1TQO A;  4A3F B;  2OQK A;  2XRS D;  5TSS A;  5I4D A;  1VQA A;  1DD2 A;  5CV5 A;  2NN6 H;  2Z4H A;  4HIO A;  1N9W A;  1RIP A;  4JC0 A;  4RKL A;  1ICW A;  4X3T A;  1U9R A;  2CVR A;  3EQL C;  1UUP A;  2B2W A;  2J0T D;  2K28 A;  1GD7 A;  3DMU A;  1CZW A;  2H4O A;  1IW7 D;  3I4O A;  3OWE B;  1W3S A;  4C1N I;  1UE7 A;  2K32 A;  1BUV T;  1YNJ C;  1NMG A;  1XPU A;  4ABN A;  1JT8 A;  4C3I G;  1UEB A;  1RDP D;  2K33 A;  5JPN C;  3I4N G;  4CDD C;  3CHB D;  2WAC A;  3KLS X;  5M5W B;  5JPM C;  3UDG A;  1F2L A;  2KVM A;  3L2P A;  4JI3 L;  2HUG A;  2MQH A;  2PYK A;  3SVM A;  4AYB B;  1CA6 A;  4FF3 A;  1G6Z A;  4XT1 B;  1JR0 D;  5AFW A;  4C3H H;  3PQI A;  3HOW G;  1BKB A;  1NJI C;  5FJ8 H;  3CC4 A;  1ROD A;  4ALP A;  3G6E A;  2K05 A;  4B3T Q;  1CKO A;  3VR5 A;  1E2Z A;  2DJF C;  4Q5V A;  1TWH H;  3BDO A;  1GJX A;  2ZJR A;  1Y1W H;  4RAU C;  3H0G B;  4L63 B;  1FNU A;  3SE0 A;  1A3V A;  1TWG H;  4X65 Q;  3VR4 A;  4N9T A;  3H94 A;  3S2D B;  2FMM A;  4OX9 L;  4NP5 A;  4HN7 A;  2WKC A;  2PO4 A;  2B3G A;  1D7Q A;  2EYO A;  2F0M A;  2B2Y C;  1AZQ A;  5ELB A;  5JEA G;  1MHW C;  2AQ2 B;  3BZC A;  3BVZ A;  4A3J B;  1VCI A;  3TDQ A;  1VQ8 A;  4FP5 D;  4OO1 H;  1YJW A;  1JIC A;  2I5M X;  1GVP A;  2K50 A;  1LM0 A;  5EJW A;  2XWJ B;  3K0Y A;  2B29 A;  3MEH A;  4PMB A;  1GHJ A;  1A3U A;  1IW7 C;  4BY1 G;  2PQA B;  1YNN D;  1RJT A;  2K03 A;  4IO9 A;  5M3M G;  1NMF A;  4ZK9 B;  2QCP X;  4HSP A; 
#chains in the Genus database with same CATH homology
 5J3B A;  3A74 A;  4X66 Q;  4DKA C;  1E24 A;  3EIV A;  2B63 G;  2F4V L;  2R93 G;  3M7N A;  1I6H H;  4JYA L;  4X66 L;  1KHI A;  1X3F A;  3D31 A;  3JC6 6;  1X56 A;  2Q2H A;  1B7Y B;  1D8L A;  4YCW A;  4A93 G;  2GVB A;  1Q12 A;  4A3C H;  1YJN A;  5GAG C;  4AYB G;  3HKS A;  2JA6 G;  4IFD G;  1E1T A;  4RG1 A;  4MNO A;  3EBE A;  1EFW A;  2A8V A;  3HOU G;  3B6Y A;  4XTC S;  5C3E G;  3PIP A;  4NXN Q;  5IP9 H;  3T1Y L;  1PH7 A;  1WFQ A;  1C9O A;  1VQ4 A;  1XMO Q;  1WCM G;  4A3D H;  3CXC A;  1SFO H;  2KHJ A;  2ID0 A;  1Q7Y C;  2VQF Q;  1PH3 A;  1IBL Q;  2H5X A;  1XMO L;  1JB7 A;  2CFM A;  4DV1 L;  3FKI H;  1K83 H;  1KC8 C;  2EIF A;  2PQA A;  4QGU A;  4OON A;  1AE2 A;  1IBL L;  1H95 A;  3STB C;  3H0G G;  1CUK A;  1SLJ A;  5FLX c;  2OWO A;  4LF8 Q;  3F8T A;  1A62 A;  1E7Z A;  1Z9F A;  4JI7 Q;  1MJC A;  4JBJ A;  4HJ8 A;  2VUM H;  1NE3 A;  3CP0 A;  3F1Z A;  3S1N H;  1PV4 A;  4X64 Q;  1KRT A;  5C0X G;  4DV2 Q;  4GNX A;  1HNZ Q;  1SRU A;  4LF8 L;  4JI7 L;  1IZ6 A;  2JEA I;  3KDF B;  4DR6 Q;  4GN3 B;  2XGT A;  1YHA A;  4X64 L;  4JI6 L;  4A3B H;  3S17 H;  2QA4 A;  2VQE Q;  1HNZ L;  4GOP A;  2ES2 A;  5FLM G;  5IY0 A;  4A75 A;  1T9H A;  3CME A;  5IWA L;  1LYL A;  1YNX A;  2E8G A;  4IPD A;  4LUZ A;  3MEF A;  4GNX C;  2VQE L;  4A3J G;  4BA2 I;  3U4Z A;  1NY4 A;  4JI2 Q;  4BBR G;  2F3I A;  3RN5 A;  3L0O A;  1XMQ Q;  4IFD J;  1VS0 A;  3PCO B;  2ZTE A;  4YCV A;  1FJG Q;  3E9I A;  4A3F H;  3NEM A;  4GN5 A;  5AJ3 Q;  4DR2 Q;  3U50 C;  4GOP C;  3A0J A;  3A5Z B;  5IYB G;  1XTD A;  1FJG L;  4HJ7 A;  3E0E A;  3PGZ A;  4L5T A;  1PH9 A;  2D0O A;  2NVT H;  3DM3 A;  1HZA A;  3PF5 A;  4UP7 A;  1QZG A;  4IJL A;  3S24 A;  5IYC H;  3CCR A;  4DV7 Q;  3S1R H;  2ZTC A;  3OYY A;  1G29 1;  4JCV E;  2NN6 I;  4JI1 Q;  2BA1 A;  3HOX H;  3J81 i;  1KIX A;  2UXB Q;  4J15 A;  5M3F H;  5JJL A;  1VQF A;  4DV7 L;  2OQ0 A;  3PUW A;  1VQM A;  1EYG A;  1N33 L;  2YV5 A;  2CKZ B;  4PMW A;  2UXB L;  4LF7 Q;  3PUX A;  1U0L A;  2N49 A;  1A0I A;  2E5L Q;  4AH6 A;  2ZJQ A;  3J81 j;  1JJ2 A;  1OTC A;  1XNR Q;  4NPS A;  5C0X J;  2K52 A;  4LFA Q;  2E5L L;  2R7Z H;  4HJA A;  3G48 A;  4DR5 Q;  4UP9 A;  4JBK A;  4UY8 C;  3RZD H;  3AYH B;  1XNR L;  1RL2 A;  1R9T H;  4LFA L;  1IXR A;  2HQL A;  3HOV H;  2RCN A;  1V9P A;  4RMF A;  3RLO A;  2E2J H;  2JA8 G;  1EIY B;  2UXC Q;  1GKH A;  5C4X H;  2YTV A;  1X6O A;  2NN6 G;  2B63 H;  3IRB A;  3DLL A;  1VQ7 A;  1U5K A;  2VS1 A;  3BU2 A;  2MFI A;  1UE1 A;  1IBK L;  4KHP Q;  2UXC L;  4YCU A;  2L15 A;  3ULJ A;  1EIF A;  2GVA A;  3CC2 A;  4KHP L;  1G51 A;  1W2B A;  4OXP A;  1HNW Q;  1B8A A;  1PH5 A;  3HOU H;  1L1O A;  4YWK A;  3PIO A;  3G4S A;  1YJ9 A;  1QVG A;  4XIG S;  2JA7 H;  1PYS B;  3J80 i;  4NXM Q;  1V1Q A;  3CF5 A;  2HIV A;  4DR1 Q;  3UDF A;  4JI8 L;  1HNW L;  1X55 A;  4HIK A;  3GTM H;  1PA6 A;  3HOZ H;  3NEL A;  1K3R A;  2JA5 H;  2D62 A;  4AYB E;  2MO0 A;  3TRZ A;  5IYD H;  1YI2 A;  3CCQ A;  1XJV A;  4IFD I;  1L1O C;  2YTX A;  1J5E Q;  2A1A A;  5E7N A;  4MZ9 A;  2NZH A;  2HHH L;  4YY3 Q;  4JOI A;  4PZ7 A;  2CWP A;  4TQU S;  4A3K G;  4LFC Q;  3ERS X;  1LUZ A;  1Y1V G;  1YBY A;  2WP8 J;  1XPO A;  2UXD L;  3RLF A;  3PUV A;  1OXU A;  2Z0S A;  1WI5 A;  3I4M H;  4BBS G;  1K9M C;  1YIJ A;  4LFC L;  1LTL A;  2VL6 A;  4A3L H;  4IPH A;  3S2D H;  1KL9 A;  3M3Y H;  1V43 A;  2AWO A;  3CD6 A;  3KFU A;  4BXX H;  4A3G H;  4JOI C;  5GQO A;  1A8V A;  2KEN A;  5M5X H;  2R92 H;  4HJ5 A;  3H15 A;  2UUC Q;  4A3M G;  1FVI A;  3KF6 A;  4L5S A;  3UDX A;  1K73 C;  3AEV A;  2UUC L;  1J6Q A;  2UU9 Q;  4KLK A;  3CCJ A;  4R4T A;  4A3J H;  1Q1E A;  4JI5 Q;  3M4P A;  3W1B A;  4JI0 Q;  4QQB X;  4DV6 Q;  1GO3 E;  4PZ8 A;  5C0X I;  3AQQ A;  4AIM A;  3JAM i;  3CCM A;  3VDY A;  2WFW A;  5FJ8 G;  2JE6 I;  4C3I H;  2UU9 L;  1VQK A;  1WYD A;  4JI5 L;  2VNU D;  2R6G A;  5M5Y H;  4JI0 L;  4LF5 Q;  1TWC H;  1E22 A;  1X3E A;  4DV6 L;  3I4N H;  5IYB H;  4DV5 Q;  3RZO H;  1HZB A;  1VQD A;  1Y1W G;  4DR4 Q;  3JAM c;  3KYH C;  4QIW E;  4NXN L;  1VQL A;  4LF5 L;  2ATW A;  1VQB A;  1CKM A;  2AKW B;  4DAM A;  4ME3 A;  4DV5 L;  4A3E G;  1M1K C;  4HJ9 A;  2E2H H;  3ULP A;  2R7F A;  3HKZ E;  3TRE A;  2VQF L;  3CCV A;  1UE5 A;  3T1H Q;  3H3V I;  3PO2 G;  1VQE A;  4TVA B;  4DK6 C;  1YHB A;  3ZJY C;  2CQO A;  3CCL A;  3PV0 A;  1Q8K A;  4WJ3 M;  2WB1 G;  2K5N A;  4P73 A;  3SGI A;  2BH8 A;  1UWV A;  4A3I H;  3M4O H;  3S1Q H;  5H1S E;  1OXT A;  2IHF A;  2PI2 A;  3M9B A;  3KJO A;  4LF4 Q;  3L7Z C;  1PH6 A;  5LMU Q;  3KJP A;  2GN5 A;  1N34 Q;  3HOW H;  1AE3 A;  5IP7 H;  3PUY A;  4OO1 G;  1O7I A;  4LUO A;  5GAE C;  4HID A;  1MKH A;  4DV2 L;  4BA1 I;  2YU9 H;  2Y0S G;  4GKJ Q;  4APV A;  5GAH C;  3LGJ A;  4DR6 L;  5C44 G;  1K8G A;  2PI2 E;  1N34 L;  1G6P A;  1QUQ B;  1NBW A;  3CCE A;  4GKJ L;  1EWI A;  2BA0 A;  1X54 A;  1HR0 Q;  1Q46 A;  3K7A H;  4BY7 H;  1CKN B;  2KCT A;  3BZK A;  3KOJ A;  3HKZ G;  4P72 A;  2K5V A;  3PSI A;  3HOY G;  2A19 A;  4JI2 L;  1HR0 W;  4H02 A;  1XMQ L;  1PHJ A;  4LF6 Q;  3CW2 C;  3PO3 G;  1S3O A;  2RHS B;  4O2D A;  3RLN A;  1N36 Q;  1K8A C;  1Y14 B;  1BBW A;  5HY6 A;  3GD7 A;  4DNI A;  5AJ3 L;  4DR2 L;  4LF6 L;  1HZC A;  1N36 L;  3K0X A;  3PUZ A;  3S2H H;  1KRS A;  4A3C G;  1E3P A;  4JI1 L;  1HH2 P;  3KDF A;  4AQY Q;  1C7Y A;  4DV3 Q;  2IX1 A;  2EXD A;  4B3M Q;  4GLV B;  2N78 A;  3AFQ A;  1X65 A;  4AQY L;  2YYZ A;  5IP9 G;  4DV3 L;  2UUA Q;  4LF7 L;  3GTP H;  1QUQ A;  1BVS A;  4LWC A;  1X9N A;  4A3D G;  1PVO A;  4LW1 A;  4B3S Q;  3ER0 A;  3UE0 A;  3RNU A;  1YIT A;  5LMN Q;  2BH2 A;  4BY1 H;  4QY7 A;  1I5F A;  2DGY A;  2RHQ B;  2ZTD A;  3FKI G;  4C2M H;  5HGQ A;  5M3M H;  4DR5 L;  4B3S L;  3E9H A;  5LMN W;  4LNQ A;  5M5W H;  4KHZ A;  4O0A A;  2NVX H;  4JI4 Q;  4GKK Q;  3EN2 A;  3KLW A;  2R93 H;  4DV4 Q;  2Q2T A;  2LSS A;  4LF9 Q;  1OXS C;  4L5R C;  3WWV A;  4DUZ Q;  2VZA A;  2VUM G;  3CCU A;  1DGS A;  2V1C C;  4JI4 L;  4A93 H;  4POF A;  2MNA A;  4DR7 Q;  4X62 Q;  4DV4 L;  4LF9 L;  1CSP A;  1MIU A;  4MTN A;  2NZO A;  2AWN A;  4DUZ L;  2JA6 H;  4DR7 L;  1B70 B;  1UE6 A;  4OWX B;  1IL2 A;  4A3B G;  1QVC A;  4X62 L;  1HJP A;  3AFP A;  1VQ5 A;  5C3E H;  3ICE A;  3TS2 A;  1WCM H;  2OTL A;  1EUJ A;  2KCM A;  1VQG A;  1A63 A;  4IPG A;  1NTG A;  3K80 C;  5IE8 A;  4NXM L;  3K81 C;  1PH4 A;  5JJK A;  4DR1 L;  3CPF A;  3BJU A;  4A3F G;  3Q8D A;  3TQY A;  2HIX A;  4YHH Q;  2KHI A;  2IX0 A;  1PFS A;  3GDE A;  1J5E L;  3H0G H;  4WJ4 A;  4EQ5 A;  5JJI A;  1N32 Q;  5IYC G;  4YY3 L;  2VY3 A;  1E1O A;  3W1G A;  1Q82 C;  3HOX G;  4YWM A;  4A76 A;  4DAY B;  5M3F G;  3CMA A;  3F2B A;  1N32 L;  3FP9 A;  3I55 A;  1TWA H;  3GTJ H;  4L5Q A;  1WJJ A;  2JJQ A;  1JJC B;  2WAQ E;  2IHE A;  4LUV A;  1SMX A;  2WB1 E;  5FLM H;  3I2Z A;  1FL0 A;  4UPA A;  3NBH B;  1OXX K;  1PYB A;  1YVC A;  3F2C A;  4BBR H;  2R7Z G;  3KF8 B;  4Y7N H;  5EAY A;  4GN4 B;  2K5H A;  3S1M H;  1K0R A;  4OO1 I;  2Z6K A;  1YZ6 A;  2JQO A;  1P8L A;  2Y0S E;  2PMZ E;  3CC7 A;  3HOV G;  3S15 H;  5ELO A;  1C0A A;  2F4V Q;  3GTL H;  4Y52 H;  4JG2 A;  1MJE A;  2RF4 A;  1CSQ A;  2N3S A;  3HFZ B;  4IOA A;  5C4X G;  4JBM A;  2OCE A;  2Z6K C;  1KD1 C;  2N8N A;  3U4V A;  1VQI A;  1VQH A;  4DR4 L;  1FGU A;  4GNX B;  5IT9 c;  5C4J H;  3CPW A;  1Z47 A;  1VQJ A;  3NEN A;  4YWL A;  4R4Q A;  4GLA C;  2WAQ G;  3OTO Q;  4JV5 Q;  1YEZ A;  2I5L X;  3T1Y Q;  4LFB L;  2ZM6 Q;  3T1H L;  3RR5 A;  1ASZ A;  2CWA A;  4GOP B;  3GTK H;  2PNH A;  3I7F A;  2JA7 G;  3UE1 A;  2I5H A;  3OTO L;  3OW2 A;  3GTQ H;  4JV5 L;  5JEA J;  2DUD A;  2ZM6 L;  5K36 G;  5GAD C;  4DV1 Q;  4B3R Q;  4C3J H;  3HOZ G;  2I0Q A;  1JMC A;  4LF4 L;  1VQ6 A;  2JA5 G;  5IYD G;  5LMU L;  4IOC A;  2OQK A;  4DK3 C;  3F2D A;  1HZ9 A;  1TXY A;  2C35 B;  2LXK A;  4B3R L;  1KXL A;  4QJF A;  2Q2U A;  2JA8 H;  3J7A 5;  1VQA A;  2F52 A;  4EX5 A;  4DV0 Q;  4HIO A;  1N9W A;  1L0W A;  1RIP A;  3RN2 A;  3I4M G;  4DV0 L;  1HR0 L;  2JA9 A;  4JC0 A;  4DPG A;  4JI6 Q;  4A3L G;  4BXX G;  2JEB I;  4A3G G;  1SR3 A;  2R92 G;  1GD7 A;  4IPC A;  1QVF A;  1VQC A;  4R1J A;  5IWA Q;  3GTG H;  1GM5 A;  2MO1 A;  3I4O A;  4DR3 Q;  1S40 A;  1W3S A;  1UE7 A;  1S72 A;  1NMG A;  4POG A;  1XPU A;  4DR3 L;  1JT8 A;  2K14 A;  4QL5 A;  3A5U A;  3PF4 A;  1VQ9 A;  1L2F A;  1UEB A;  3UDI A;  4R4C A;  1M90 C;  1I3Q H;  2KBN A;  1KQS A;  4GS3 A;  3I4N G;  1SE8 A;  4GLX A;  1I50 H;  4B3M L;  4JI3 Q;  4DUY Q;  4A3K H;  3M4Q A;  1EQQ A;  1Q1B A;  1Y1V H;  2UUA L;  3UDG A;  2D0P A;  1CKN A;  1Q86 C;  4R4I A;  3L2P A;  4BBS H;  4JI3 L;  4DUY L;  2MQH A;  1N33 Q;  4K0K Q;  2Q2I A;  2LXJ A;  4PG3 A;  1JE5 A;  5LMN L;  3TS0 A;  1XPR A;  2QEX A;  1VQP A;  3CAM A;  4KI0 A;  3MXN B;  4P75 A;  4A3M H;  1Q81 C;  3TEH B;  4K0K L;  1L1O B;  1TWF H;  4A3I G;  4GKK L;  2AHO B;  3M85 A;  4NB3 A;  3J81 c;  1IBM Q;  4C3H H;  2IY5 B;  4X6A H;  2ASB A;  2ZJP A;  2IT1 A;  1JJG A;  3STB D;  4P74 A;  3S16 H;  3HOW G;  1BKB A;  3ULL A;  5IP7 G;  1NJI C;  1SRO A;  3D0F A;  1IBM L;  5FJ8 H;  4LFB Q;  1OXV A;  2AMC B;  2CCZ A;  3CC4 A;  2ALY B;  2QGQ A;  2NVY H;  4ALP A;  2EQS A;  1I94 Q;  2R7D A;  2E2I H;  3G6E A;  1EOV A;  4B3T Q;  2YTY A;  1CKO A;  1BBU A;  2NVQ H;  3GO5 A;  2FXQ A;  1TWH H;  2VW9 A;  3GTO H;  2ZJR A;  2K75 A;  4A4I A;  1Y1W H;  1PH2 A;  1I94 L;  1IBK Q;  1XNQ Q;  4B3T L;  1YHQ A;  3W5O A;  4A3E H;  1TWG H;  4X65 Q;  4BY7 G;  2UUB Q;  3S14 H;  1VQO A;  4OX9 Q;  1EQR A;  1XNQ L;  3K7U C;  4OWT B;  1N8R C;  4X65 L;  3PO2 H;  4PZ6 A;  2UUB L;  4OX9 L;  1SN8 A;  4YHH L;  3KF6 B;  3I56 A;  1D7Q A;  2B3G A;  3K8A A;  3FHW A;  4JI8 Q;  5ELN A;  3U58 A;  1WOC A;  3CQZ H;  5JEA G;  1HNX Q;  3BZC A;  1P16 A;  4R4O A;  1VCI A;  3J7Z C;  1KAW A;  1VQ8 A;  1X3G A;  4IJH A;  2OTJ A;  2HT1 A;  1YJW A;  4UP8 A;  1HNX L;  1VQN A;  2I5M X;  2HHH Q;  1ASY A;  1GVP A;  2JK8 A;  5C44 H;  3G71 A;  3J80 c;  4HIM A;  2UXD Q;  5GRO A;  3CCS A;  2K50 A;  1LM0 A;  5BR8 Q;  4FDB A;  5DLQ E;  2K4K A;  4OWW B;  4P71 A;  2B29 A;  1AH9 A;  1PH8 A;  4JBW A;  1IYJ B;  4BY1 G;  5BR8 L;  3H3V H;  2PQA B;  4IO9 A;  3HOY H;  2XTI A;  1NMF A;  5M3M G;  1QZH A;  1PH1 A;  3PO3 H;  4JYA Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...