2PZWA

Crystal structure of staphylococcal nuclease variant v66n/p117g/h124l/s128a at room temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMNENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pzwA00
1EY6A 2PW7A 5JAVA 2SNSA 4ZUIA 3QB3A 5IGFA 5KIXA 5KRUA 4NKLA 3U9OA 1STNA 5KYLA 5IOCA 4ODGA 3MZ5A 2RBMA 3MXPA 4KJOA 3SK5A 2F3VA 3SK8A 5M9OA 3NK9A 2F3WA 3HEJA 2PZWA 1KABA 1EQVA 3MHBA 1F2YA 2OEOA 3ERQA 3MEHA 3NUCA 3D8GA 5CV7A 3VA5A 3S9WA 5ISRA 5NUCA 1U9RA 2PZUA 4LAAA 2EYLA 2F0DA 3ITPA 1EY7A 2WACA 4KHVA 2F0QA 2EXZA 2KHSA 1EY8A 5J1ZA 4K5VA 4S3SA 1JOQA 1F2ZA 3LX0A 2F0TA 2EY2A 1EY9A 2F0FA 2SOBA 1KDBA 3DHQA 4KY6A 5CR3A 4E6IA 1NSNS 5DEHA 2RKSA 5IGCA 1EY0A 3EROA 3T16A 4I65A 5DAUA 1SYDA 3QOJA 3C1EA 4WRDA 3SXHA 2OXPA 5EGTA 4B9XA 4RKLA 3NXWA 4NDXA 5I6YA 5IGEA 3MVVA 2F0KA 3PMFA 3SHLA 5E1FA 5C3XA 2F0UA 3TP8A 3EJIA 4ID6A 4DFAA 2F0JA 4J6HA 1A3VA 3D6CA 4K5XA 5JOBA 4DF7A 5I6WA 4G57A 5F2DA 5C5LA 3H6MA 1TR5A 1EY5A 4NP5A 5C4HA 5HGTA 1JOKA 4R8NA 1EYCA 1SYGA 2F0GA 3NP8A 1SNCA 2F0WA 2PQEA 1SYBA 4ZQ3A 1KAAA 4HMJA 3R3OA 1JOOA 2F0IA 3DMUA 2F0OA 4K8IA 2O4XA 4MIUA 4F7XA 2F0HA 2HQEA 1F2MA 3NQTA 3TP5A 5EKKA 5I9PA 2EYPA 1A2TA 2LKVA 2F0MA 1AEXA 2M00A 5KGUA 1EYDA 3P75A 1A3TA 3C1FA 4J1MA 1EY4A 5C3WA 5I9OA 3TP7A 2RDFA 4PMBA 4EQNA 4IUNA 5IGBA 1A2UA 5CV4A 4QB4A 1A3UA 1ENAA 1SNPA 4K2LA 2QDBA 1KDCA 4QF4A 5C6AA 1STAA 3HZXA 3D4WA 1IHZA 2OF1A 1JORA 3OSOA 5IGGA 4EQOA 2EY5A 5C5MA 1SNOA 4IZ8A 1SYFA 4K2KA 2EYHA 5EKLA 2F0SA 5CC4A 3QOLA 2F0PA 2EYMA 4KY7A 5CV6A 1II3A 4ME5A 4N9PA 4PNYA 3E5SA 4EVOA 5KEEA 5IIFA 4NMZA 4DGZA 1TT2A 2PZTA 3SK6A 4WORA 2EY1A 4K6DA 3RUZA 5HURA 3BDLA 2EYFA 1SNDA 2EYOA 4KD4A 5CV8A 1TQOA 5K5PA 1SNMA 1STYA 1EYAA 5CV9A 5E3FA 3SR1A 4ZUJA 4IALA 4K8JA 5IGDA 4TRDA 3D4DA 3OMGA 3V2TA 2F0NA 3TP6A 4EQPA 4K14A 1SYCA 2EYJA 4H7BA 1ENCA 1STHA 4KJNA 1STGA 2PYKA 3TMEA 1EZ6A 4KD3A 5C4ZA 3NHHA 4B9WA 3OWFA 4PMCA 2F0LA 4HTHA 3T13A 2F0EA 2EY6A 3EVQA 1SNQA 4K5WA 4OL7A 5CGKA 1STBA 4YIJA 2PW5A 4KV6A 1KDAA 2SNMA 1RKNA 5J22A 4KTAA 4QMGA 5CV5A 3OMCA 4KY5A 1NUCA 2NUCA 4F8MA 1EZ8A 1SYEA 2ENBA 4RKBA 2F0VA 4N9TA 3SK4A 4DU9A 3P1HA 5IODA 5KYIA 2KQ3A 3BDCA 5J39A 4HMIA
chains in the Genus database with same CATH superfamily
1EU4A 4IFDH 3PUYA 2K32A 4NKLA 4DV1L 3I73A 2WAQB 3OYYA 3K5NA 2AWNA 1HTPA 3HOYH 3VYUA 3UDGA 2VQFQ 4N8X1 3ERQA 3FKIG 5NUCA 4H44C 1S5CD 5CBAE 1YJNA 3L7ZC 3K7AB 4A3GG 4WFN3 4OXPA 5J1ZA 1TWAB 3T56B 2E5LQ 1RD9D 2JA5B 3M4OB 3C2PA 2DNEA 2L12A 3EROA 4UDUC 4DV5L 3K7AH 4ULLA 5GAGC 1D1IA 4Y7NB 1TWAH 3Q0AA 4R9WA 2K75A 5FK9C 2JA5H 1N33Q 3M4OH 1CQVA 2PPBC 2CH4W 1TVXA 1RCVD 3HRZC 3SHLA 1W6JA 2Z4IA 5C3XA 1WD0A 1MD2D 1FGBD 1QNKA 4Q0FA 4G57A 4UPAA 1HHVA 1JJCB 2Z1CA 1JORA 1G291 1K3RA 1LTAD 5EKKA 4CJ0B 1PYSB 3E6ZX 4A3FB 1LT3D 2O5IC 1PYBA 4P72A 1W2BA 1A3TA 2AKWB 4OGQC 1SFOB 4A3FH 4B3TQ 1A3UA 2AUKA 4PQXA 3HZXA 3J80L 5T1IA 1SFOH 1LT6D 2IW3A 4K2KA 4R4QA 3WOEA 1VQ6A 1IBKQ 1QVFA 1X3GA 2R3ZA 1P8LA 4DGZA 3T53B 4B08A 2CW0D 1UE7A 2EY1A 2JJQA 1E0BA 2RHSB 3KF6A 4IPDA 1MSHA 2K14A 4IALA 4K8JA 2K01A 1LABA 4JI8L 2A68D 2L5TA 4HTHA 4LF5Q 1CKNB 3HOZG 1AE2A 1BBXC 3UE0A 4X64L 2VL6A 2ENBA 5EPJA 3SK4A 4GLXA 4FVMA 1TWFB 2PQAB 4A3KG 3I3CA 4RCOA 1LTID 1ILPA 2K5WA 1H9SA 1PRTF 2UXDL 5JVG3 1XPOA 1KD1C 2DY8A 4XTCS 1TWFH 2PCFB 3NEMA 2R7DA 1FNUA 4DK1A 4A3LG 2RQXA 1TY2A 1I4RA 2XIWA 2EXZA 4KHPL 4P71A 4UP8A 1PH5A 3EFXD 1PRTC 2F0FA 2QW7A 5DEHA 4DR5Q 2KEDA 3M7GA 1BCPF 5DM63 3F2CA 2MO0A 4JV5Q 3A54A 4H02A 4LUVA 3DM1A 2VQEQ 2R93G 3HOVB 3J81L 2F0UA 4ZKCB 5GADC 4OELB 1E22A 1WYDA 4RA8A 1IBMQ 5KGUA 5HGTA 4R8NA 1SYGA 2BH2A 1BCPC 2F0WA 4LF7L 2NWGA 1WTRA 1VQMA 1I4XA 1RTNA 2B2UC 2UUAL 4QUCA 3K59A 3HP3A 2JA8G 3JC66 4CKEA 4DAYB 4EQNA 3J7A5 3CCLA 4RAUC 3SGIA 2LXJA 2Y0SB 4HN7A 3IRBA 2A69C 4DA2A 1CKMA 5FLXL 1PFBA 3CKIB 4H13C 4RFBA 3FEWX 1C9OA 1II3A 2KUMA 3CMEA 2PZTA 2UUBL 2Z6KC 3SK6A 1YNXA 2GA4B 4K6DA 3S2DB 2MP1A 1C4QA 3A8JE 4C1NK 3CU7A 1EL0A 4EGVA 4R8IA 3KFUA 2EQSA 4TSSA 1GOZA 5K36H 1CHPD 1D8LA 3S2DH 2QEJC 1SYCA 2B2WC 3P7JA 5ELBA 2PYKA 2GN5A 2F4VQ 1F9SA 3QR8A 2CFMA 1SE4A 4IO9A 4HSVA 1PTOF 3L9AX 4KMUC 5HY6A 3G48A 1XNQL 1V9PA 1S5DD 3EQLC 5J22A 2VS1A 3AQQA 3BDCA 1E7ZA 2K04A 1KTKA 1S5ED 3I4MB 4ZAIA 1PTOC 2M2LA 4RGOS 2BDOA 3HKZG 1HR0W 1HZAA 4X6AH 2XSCA 1JE5A 2PZWA 2HIXA 4JYAL 3I4MH 3D8GA 3BU2A 1EUJA 3JAML 2B2UA 5FLMG 1PZID 2ZXOA 4A93G 1GD7A 1X55A 5EBCA 3CPWA 1WCMB 1YHBA 2PNRC 1L0XB 3KK7A 4QQBX 4C3HG 5IY0A 5JJIA 1O7YA 3CCJA 1UE1A 2NVXB 2JA6B 2H1EA 2VW9A 4HIOA 2A6HD 2MGSA 1NMGA 5M3MB 1VQ4A 2DJGC 4FXGC 4A3EB 5LMNL 2NVXH 2JA6H 2EVBA 1A3VA 2Z6KA 4LF9L 5I6WA 1I3QB 1PH6A 5M3MH 2F0GA 4HJ7A 2PQEA 4A3EH 1SYBA 1IZ6A 3DMUA 2Q8TA 4K8IA 4F7XA 1CUKA 2F4IA 3NBHA 4ILWA 2OQ0A 1I3QH 1BF4A 1S72A 1HH2P 1X9NA 2B2WA 4R1JA 1J9OA 3IKJA 4A3JG 1K83B 4FF3A 2N3SA 2ALYB 1YEZA 3MFGA 1XMQQ 4IUNA 1LTGD 4DR3L 4QF4A 1KDCA 4O2DA 4OHJA 1JWSD 1K83H 3FVQA 1Z9FA 3O13A 3Q24A 1B3AA 4POGA 2AQ3B 4YCUA 3CP0A 2EYHA 1K8MA 4PNYA 1B7YB 1TS3A 1HCZA 5CORA 1N36L 4DR6Q 1H9RA 1X3EA 2VZAA 1K8GA 1DJRD 2JP1A 3MXGA 2B2YC 4AYBG 1DOKA 4MTNA 1VQ5A 3PUWA 2HHHL 2XWJB 3ICEA 3NHHA 5C3EB 1YNND 3DWQA 4IN3A 1X32A 1B1ZA 2EY6A 3ULPA 1I6HB 4OL7A 4DR7L 3H0GB 4KV6A 5C3EH 1QVGA 4OWTB 1I6HH 2Q8IB 2KQ3A 3VYRA 2TMPA 3A5ZB 2I5HA 1GUWA 3H0GH 5KRUA 3VR4A 1VQ7A 3PSIA 2FFKB 3MZ5A 4JI7L 3MXPA 4XT3B 5I2XA 3S16H 2LSSA 1EQVA 4BBRB 4DV2Q 1SR3A 3G6EA 4K5VA 1VQBA 2H4OA 1JOQA 3SK5A 4A3DB 1SN8A 3DHQA 4BBRH 2UU9L 4HJ5A 3KF6B 4LF8Q 2Q8RE 4P75A 1YHAA 2GVBA 1GXDC 4HJAA 2KEEA 4JI3Q 4A3DH 4O42A 3NXWA 4XQNA 3A8KE 4CJ1B 3CCEA 3G71A 4A3GH 2JQOA 3J7YW 5D3DA 4IPCA 4K5XA 1V1QA 5L37A 5C4HA 4NB3A 1GKHA 1VQDA 2RHQB 2O4XA 2B2YA 1H9SB 1A0IA 5I9PA 4F88A 4P74A 4DNIA 5M3FG 4QCLA 3K57A 1PFSA 4PMBA 5CV4A 2PMZE 1TS4A 2R92B 3KOJA 2OF1A 2XRSD 3FMCA 1Q1EA 1M8AA 1AN8A 4QY7A 3DLLA 2Q2IA 2YTVA 4LUOA 1YZ6A 5IYBH 1BBWA 3TZUA 4IPGA 5JEAJ 1Y1WG 1K8OA 5EKIA 2EXDA 1D5ZC 3SDZA 1PH9A 2F03A 1KNEA 5EAYA 5JEAG 2NVTB 3V96A 1I4QA 4I7ZC 4X3TA 2BOSA 1Y1VG 1PH4A 2X6LA 1HNZQ 3STBD 3U9SA 2NN6I 2F0LA 3TREA 2NVTH 1F9QA 1SNQA 5CMDA 3K5MA 3U4VA 1GHKA 3BG3A 1CQFA 2ATWA 1V1OA 2N78A 1AH9A 2K4KA 5D14A 2F0VA 5IODA 4IPHA 1CZGA 5M5WB 1X6OA 5J39A 5AJ3Q 4DV6L 2AMCB 1I94Q 2CW0C 2HDMA 3IL8A 1LUZA 4B3SQ 1H95A 1MI2A 3RNUA 1G51A 1LACA 3UI2A 5M5WH 2WFWA 4IUQA 1YIJA 5A2QE 3Q22A 2ZXPA 3F8TA 1C48A 2K50A 3RZDB 3NSWA 1EY7A 1OO9B 1GUSA 2NZHA 3I4NB 2A68C 1EY8A 4CDCC 1F2ZA 4IUTA 3KJPA 1EQRA 1VMCA 4HEDA 3RZDH 2HCCA 2RF4A 4DUYL 1MIUA 2UUCQ 3I4NH 3OIQA 3J7ZC 2N49A 5ELNA 1PRTB 3HOXG 3GTPB 2IJ0A 3K58A 3HOUB 3TP8A 3CCQA 1AZPA 2PMZB 5IYCH 1FL0A 1V1PA 1G6ZA 5JOBA 3R2IA 5F2DA 3GTPH 1U4LA 2WKDA 1Q7YC 3B6YA 1KLGD 1NTGA 2RCFA 3SE0A 1DONA 3KYHC 4QJFA 1BCPB 2F0MA 3W3AA 3DEOA 1PHJA 1EY4A 4A3CH 2WB1G 2UXCL 4LWCA 5BN4A 1HFGA 1A15A 1RODA 3SVMA 2JA8B 1XX8A 4YWKA 2R7ZB 2NZOA 1SNOA 2J7ZA 2IL8A 4IZ8A 1ILQA 2F0SA 4K6LA 3Q23A 2EZVA 1B50A 2JA8H 1S4ZA 4NMZA 2R7ZH 1S40A 4IFDI 2EYOA 2EJGC 1SNMA 1J8IA 4X3KA 5E3FA 4IQZA 5DM73 4CDEC 2A8VA 4ABNA 4DAMA 3MXNA 1ENCA 4XQQA 1VQFA 4DK3C 4KD3A 5C4ZA 4PMCA 4ZK9B 4HAEA 3T13A 2IX3A 4L5RC 5ELEA 3NBHB 1OXUA 2E5LL 1XMOQ 3S14B 4XT1B 5ELFA 1RF2D 2XN9C 4C3IG 3GTOB 1QB5D 2SNMA 4YWMA 2RDHA 4QMGA 1EIFA 5CV5A 1B53A 3RLOA 3E0EA 5D3IB 2I07B 3QIAA 1FJGQ 3P1HA 4HMIA 3S14H 3TEHB 2Z6BA 4CBVA 3GTOH 3QB3A 1R4QB 1L2FA 5HGQA 2E2IB 2K7VA 1LTLA 2UXBQ 3BZKA 1YI2A 4RMFA 2R61A 3VA5A 1KC8C 4RG1A 2E2IH 1DCZA 1VQPA 3ITPA 4B3MQ 1E2ZA 1PTOB 3FHWA 3PIO3 1U5KA 4C3JB 3PV0A 2ICIA 1PH7A 5IYDG 1MKHA 3URYA 2LY7A 1PTOH 3BVGA 4JBKA 2NTTA 4WRDA 4A3IB 2DUDA 1X56A 4C3JH 3D31A 3HOWB 1HNXL 3S1MB 4FYDA 1FYCA 2F0KA 2OWOA 3F2DA 4XQJA 2IHEA 5KNCA 3I4LA 3I56A 2AQ1B 2ZTDA 4A3IH 4YHHQ 5KIXA 3HOWH 4GKJQ 3S1MH 3A7AB 1EYCA 3PO3G 3NP8A 5EPKA 4JBJA 1B9NA 3OOCA 3CRLC 4JI5L 5BR8Q 1VQLA 2ID0A 1CT1D 2B63G 2EYPA 3G6JB 2LKVA 3P75A 4LF4L 2N88A 1OXVA 3RLNA 1IBLQ 1Q3LA 3RR5A 4AIMA 4X66L 4NXML 1ENAA 4MN3A 2B39A 1STAA 1SROA 2AWOA 2WP8J 5EKLA 2CVRA 3M3YB 4A3JH 3ND9A 5LL6S 2ZM6L 4X62L 3M4YA 3RUZA 1PH2A 1JC7A 3M3YH 1XPUA 3GTQB 2BE5D 3U50C 1V43A 1TWGB 3PO2B 3BZDB 3EBEA 1DOMA 3ER0A 2L4NA 4RHSA 4JOIC 1X3FA 4YY3Q 4DUZL 2JA9A 4P73A 4CKCA 1VQGA 3GTQH 4B9WA 1TXYA 2NBFA 1L0YB 2NVQB 1TWGH 3PO2H 1R9TB 5CGKA 2Z0SA 4ALPA 1VF5C 2NVQH 1EZ8A 1XXGA 4N9TA 2OTJA 1G8ZD 1R9TH 2FINB 1G91A 1T5EA 4NXNQ 1YITA 4ZUIA 2MHVA 4ODGA 1HZBA 1EOVA 4XIGS 4DV1Q 4DR1L 3SK8A 3U58A 2L55A 3WWVA 4DK0A 5C4XG 5CV7A 2QKIC 2KJXA 4LFBL 1M4VA 4BY1B 4DV7L 3TBIB 4ZKBB 1F9PA 1YNNC 4J8QA 2P5ZX 2F52A 4BY1H 1Q82C 1KLUD 1CA5A 5G3LD 4DV5Q 1F9RA 2CCZA 1QE6A 4YWLA 3A0JA 3TN2A 4N8FA 3MVVA 3PMFA 4NW2A 5E1FA 4BXXH 2DNCA 4MHEA 3KLSA 4LF6Q 1PVOA 3K80C 2VXWA 3J80i 5M5XB 3GTMB 3PQIA 1ML0D 2JA7G 1SEBD 3H6MA 4NP5A 1X65A 2L9HA 3MEFA 2K5HA 3R3OA 3LWUA 1T9HA 3VR3A 1BQQT 4KKUA 3ULJA 5M5XH 3GTMH 2AHOB 4JOIA 1W6KA 2JEBI 5FJ8G 4EQ5A 5I9OA 4CDFC 1YNJD 5C6AA 3MWYW 5M3FB 4JI0L 4EQOA 3ONAB 1XNRQ 3BYYB 2K1BA 5C5MA 2Z4HA 2MQHA 2A73B 3QOLA 1E1TA 2NN6G 4EVOA 1D5XC 5KEEA 5M3FH 5IIFA 1N34L 2IX1A 4DV0Q 2FJ2A 1VQJA 4KHZA 1B2TA 1IYJB 1VF7A 3PCOB 1WTOA 1HNWL 1KRTA 1Q8KA 1V1PB 3GTKB 3W1GA 3TP6A 5GQOA 4A3MG 2WB1E 1STGA 3KLWA 5H1SE 5A2QL 3GTKH 1SE3A 2A6ED 5EBDA 4DKAC 4PG3A 2K03A 4OIKA 4L5QA 5JEAH 4X64Q 2JSOA 1NNXA 1EU3A 3DXJC 5C44B 2CWAA 2KCMA 4OEMB 5ELOA 4DNTB 3T1HL 2RBMA 4A3BB 4GLAC 4DR4L 2UXDQ 3J81i 4DV3L 4JI6L 3MHBA 3PGZA 3MEHA 4PZ7A 3S9WA 1ENFA 5C44H 3G4SA 1WTQA 1PA6A 3IAYA 3STBC 2A5HA 4HCSA 4V0BA 4A3BH 2VUMB 2NTSA 4HJ9A 2PI2A 4KY6A 1A8VA 4KHPQ 1EY9A 1BUVT 4DXFA 3T16A 1KXLA 4ZYSA 4HIDA 3QOJA 1ICFB 1Q1BA 2VUMH 3MXNB 1PZKD 1CM9A 3IFDA 4XDXA 5I6YA 5BN3A 2A74C 3EJIA 3I90A 2B2TC 1D5MC 4QUFA 3K5LA 3W2DA 1UUPA 4DR6L 1O7LA 3I7FA 1A63A 2HQEA 3AYHB 1CHQD 4LF7Q 4IFDJ 3RLFA 2JEAI 1L1OC 4JI2L 2UUAQ 3NENA 3TP7A 4DR2L 2C35B 5FOBB 4F87A 4BA2I 4IFDG 1ZEQX 1OXXK 3OIPA 1K8AC 4JCVE 2XRQD 3X3MA 1OXSC 3RD4A 3HOYG 1E1OA 4GLVB 2OTLA 1Q86C 1NE3A 1SE2A 3QJYA 5CV6A 4N9PA 1S5BD 2WAQG 1TT2A 1SSOA 2UUBQ 1EIGA 3DWPA 1BKBA 3H3VC 1K3BC 1KNAA 4CDDC 1ZKOA 1IL8A 2YV5A 1ZYRD 3MC0B 4APVA 3K6OA 4LFCL 3MAQA 2A1AA 1DYQA 1LTRD 2JA5G 3CPFA 3FPPA 1VQKA 4YCWA 3EVQA 1YJWA 3I72A 4H0LC 3JAMi 4QGUA 4LF8L 1R4PB 2CKZB 2NUCA 1XNQQ 4BY7G 1SYEA 3E0JA 3GV3A 2L1BA 4AH6A 5C4JH 4JI3L 4QL5A 2FMCA 2B2TA 4FF4A 1N32L 3CCRA 1ONLA 4QIWE 4LFAL 1S5FD 1LTSD 4U68A 3T4AC 2CQOA 2F3WA 3BS1A 3M4PA 4A3FG 1GM5A 1OXTA 2MO1A 4LAAA 4JYAQ 1K0RA 4A4IA 1L1OA 2LXKA 2I46A 5EPLA 5IGCA 2E75C 2EY2A 4BBSG 2GVAA 1QUQA 1K28A 2RKSA 2QF7A 1EY0A 3TZDA 1Q81C 2ASBA 4R4CA 3S16B 1WTVA 1CSQA 2DGYA 4B9XA 3LGJA 4NDXA 1EFID 2M9VA 4HIKA 2IY5B 5M5YB 2XTIA 4FF2A 1SMYD 1Z47A 3BVZA 1LLRD 4RGMA 4JC0A 3LWEA 1DXMA 1VDZA 2AUJD 3CCUA 4OO1H 2IHFA 5M5YH 2K5VA 3P20A 2MJ8A 4BA1I 2HCIA 2LS01 2YU9H 4MTKA 3CCSA 3M9BA 4BWGB 4WJ4A 3FKIB 1V8QA 4PV1C 4GKKQ 2M00A 4A3GB 1EYDA 1J5EL 1OTCA 4J1MA 2Z8LA 1HUMA 2D2CC 1YVCA 2BH8A 2BDNA 4L6TB 1NY4A 3FKIH 3MXUA 2QDBA 1W3SA 2KOLA 3DUZA 1IHZA 1DGSA 1TKWB 3OSOA 4JVZA 1EIHA 2CH4A 5CBEE 1E2VA 3F2UA 1JJGA 1PFNA 2B63H 4JK1C 3AMUA 5AJ3L 4WORA 2B3GA 2K28A 5HURA 1N36Q 1EEFD 1EYAA 3A7LA 4OX9Q 3K7UC 3C46A 4K14A 2PI2E 4KJNA 1BCPD 3GTLB 4QIWB 2HHHQ 2FHTA 2WIIB 4K5WA 5AFWA 2L11A 3S15B 4KN7C 4DR7Q 2PW5A 1KDAA 4FXKC 4GS3A 1KQSA 4ZCKA 3GTLH 3X3NA 1LYLA 3HOVG 3N52A 1LTBD 4JI1L 3S15H 2BCOA 5JAVA 1SAPA 5LMUL 1UAPA 1STNA 1WI5A 1Y8PB 2RDGA 2YTXA 3GQBA 2O2LD 1HJPA 1ZXTA 3I2ZA 4XYQA 5COYA 1K73C 2F3VA 5C0XI 4RCNA 4JI7Q 4CJ2C 2ZJPA 2YTYA 3K0XA 4JG2A 1NCVA 2KHSA 1PFMA 1X54A 1H9KA 2F0TA 3OTOL 4E6IA 5C4XB 4DV4L 3RN2A 1NSNS 2Y0SG 3HOZB 2UU9Q 3Q8DA 5DAUA 1FVIA 1DD2A 3FRPB 4B3RL 5C4XH 5EGTA 3PIOA 1VQ8A 2E8GA 1XJVA 1FGUA 3ZYYX 2MUYA 2G5DA 3HOZH 1B4OA 4C56C 4PZ6A 2SEBD 4A3KB 4L8JA 3CMAA 2LFNA 1WD1A 1TR5A 1EY5A 2CHBD 5A35A 1MSGA 4YCVA 1JB3A 4ZQ3A 5G3LF 4P2CB 2F0OA 4A3KH 1F2MA 3HOYB 1C0AA 3GD7A 3W5OA 1HR0L 1VCIA 1GO3E 1HQMC 2L15A 2RDFA 3D4RA 1VQNA 3AFQA 3CF5A 3L2PA 4JBMA 4L63B 4A3LH 2K5NA 1I50B 1D7QA 3HKZE 4KLKA 4OWXB 5CC4A 3I4MG 2R93B 4A76A 5FJ8H 1I50H 2C9OA 5JVH3 3VYTA 1QWYA 4X65L 3QWNA 2EYFA 4FXDA 1SNDA 3V05A 1LV9A 3KLSX 4RWSC 2R93H 2HIVA 2UXBL 3F1ZA 3RMHA 3KBXA 4JI4L 1WCMG 3QO2A 5IWAL 1YBYA 1Y69U 1KAWA 1EZ6A 2ZJQA 1YNJC 3OWFA 3A56A 2F0EA 1UE5A 1STBA 1YJ9A 2JA6G 3CAMA 2QDLA 3BZCA 3NWTA 4NPSA 1XPRA 5M3MG 3OMCA 1K0SA 4A3EG 4MZ9A 1SDFA 1EY6A 1PLFA 4A3MH 2IT1A 4X3UA 5IGFA 4RHRA 4LUZA 4DV6Q 1UE6A 4DN4M 1B3QA 2VQFL 1BXTA 5DLQE 5M9OA 2RSOA 2EPBA 5KNBA 2KBNA 1MBYA 1VQAA 3I55A 4HCEA 2WACA 2X6GA 2OCEA 1HPCA 3LX0A 2HUGA 3HGBA 4LMQD 2A6EC 1EQQA 2IX0A 1N33L 4DUYQ 2ICEC 3T1YQ 1SRUA 4GN3B 1PH8A 1IL2A 5T1GA 3K0YA 2QA4A 1QG7A 3GTGB 1P16A 2F0JA 2VB2X 4CKBA 5IE8A 1CSPA 4AYBE 2MPMA 4XYOA 3WOFA 4POFA 2K6AA 2I5LX 2XWBB 1RDPD 4JW0A 4TVAB 2E76C 1CZWA 3HKZB 4HMJA 3S17B 3GTGH 4RGTA 1WTXA 1VQHA 1EFWA 4HR7B 2KCTA 5C3EG 1A62A 1AEXA 3HS0C 1GUTA 3S17H 4A93B 4B3TL 4L5TA 2HDLA 3TS0A 2UXCQ 1Y8NB 3H0GG 4LK1C 3IFTA 3S1RB 3MFYA 4C3HB 1MJCA 5FLMH 1L1OB 1IXRA 2JXMB 4A93H 1IBKL 1O80A 1STEA 1JWUD 1QUQB 2F0PA 3S1RH 3FPUB 4C3HH 4C2MB 4FO2A 5EQ0A 3G7LA 1NMFA 2DJFC 3R93A 4BBRG 4C2MH 1CTMA 2NZ1D 3HFZB 2ZJRA 2I0QA 3D4DA 1EOTA 3UDFA 4IUPA 3V2TA 2EYJA 1QZHA 4A3DG 4LF5L 2A6HC 2G9DA 5JJZA 4A3JB 4LJZC 1EYGA 5BN5A 5LMNW 5KNDA 3ERSX 2QCPX 1HA6A 1HXYD 2OQKA 3H3VH 1LT4D 3L0OA 1JQYD 2Q2TA 4DU9A 4RGNA 5KYIA 4GZYC 4DNRB 1AFPA 1I4PA 2KHJA 2PW7A 2D9UA 2VNUD 1BO0A 3U9OA 5KYLA 4AQYQ 1M1KC 1IYUA 4BY7B 3CXCA 4LF6L 4Y7NH 1ZYRC 5IP7G 3J81j 2HT1A 4FDBA 1F2YA 3PUVA 4K0KQ 4BY7H 1JCKB 3CC7A 2F0QA 4AYBB 4IOCA 1WTHA 1TY0A 2A19A 4DR5L 1KRSA 2R92G 1RHPA 3CD6A 5IYBG 1U4RA 1SYDA 5I2YA 4JV5L 3K81C 4IURA 1JMCA 1Q12A 2F3IA 1TWHB 2VQEL 3KUPA 4BBSB 4GN5A 1I4GA 1JR0D 1HNXQ 1XNRL 4ID6A 1IBML 1D1KA 4KI0A 1B8AA 2R6GA 4GNXC 1TWHH 1JICA 3A55A 2N55A 4BBSH 1QJOA 3PF5A 3C3LA 4DV0L 1SNCA 3CHBD 1F2LA 1GUGA 1IW7D 1GUOA 1QOHA 4FP5D 4JI5Q 1A2TA 4RH6A 3UE1A 1HA5A 2Y0SE 3NTHA 1E3PA 4LF4Q 1AE3A 4UHVA 3PIP3 4QB4A 3BYTB 3KDFA 4G7OC 4X66Q 4NXMQ 3D4WA 1G2SA 1WTWA 4A75A 2D62A 1O7IA 2EE1A 2EY5A 1SYFA 4KN4C 1SMYC 3OW2A 1H9JA 2EYMA 4ME3A 2F1MA 4O0AA 2D0PA 4L5SA 2ZM6Q 3SEBA 4X62Q 1H9MA 1TQOA 3H91A 1QVCA 5IT9c 3VR6A 4PZ8A 5JPNC 4G7ZC 2QGQA 5DNFA 4DXGA 2DN8A 4TRDA 3I4NG 1JWMD 3OMGA 2F4VL 1UWVA 5C0XJ 4H7BA 1STHA 2VY3A 5JJLA 1HUNA 4DUZQ 4TKOB 1GJXA 1MHWC 3ZJYC 3BJUA 2TSSA 2KCNA 1Y8OB 5C0XG 1M90C 3EA6A 5IYCG 4YIJA 2G9HD 1RKNA 1JT8A 1I5FA 4F8MA 1NUCA 2XGTA 1N9WA 1J6QA 3HOUG 2E74C 1UEAB 2JK8A 3K8AA 2SNSA 4GNXA 1TIID 5IOCA 4DK6C 4R4TA 4KJOA 1Y1WB 1QILA 3CC2A 2V4DA 4A3CG 3NK9A 4IOAA 4DR1Q 1LTTD 3ND8A 1KABA 1VQEA 2LMCB 3BDOA 1GHJA 4CGYB 1SJHD 3MA2B 1U9RA 1NR4A 4JI8Q 1ICWA 3HOVH 1Y1WH 4LFBQ 4DV7Q 4IUUA 1Y1VB 2XNAC 1CA6A 4LNQA 2SOBA 1YHQA 3VA7A 1ASYA 2NVYB 3H09A 1LT5D 3C1EA 1SBBB 1Y1VH 2R7ZG 2KA7A 4R4OA 3HKSA 4KK7A 2NVYH 1T5XD 3I70A 1ESFA 3AB9A 1L0WA 4IUVA 5FO7B 3D6CA 4Q5VA 2SDFA 3M7NA 3FP9A 2CQAA 1JOKA 2VB3X 1VQOA 1TS2A 1KAAA 1JOOA 1PDQA 3A5UA 3E9HA 5GAEC 2NB0A 1IKMA 4M8AA 3AU7A 2B8GA 1BDOA 1XMQL 1VS0A 2Q2UA 5C3WA 4GOPC 3C1FA 3A8IE 3NTIA 1G2TA 4GN4B 2J4XA 1SNPA 4K2LA 2KECA 3DM3A 5IP9G 4JI0Q 2E2JB 3J80c 3HOXB 4ZLTF 4I7AA 1C7YA 1D2BA 5GROA 1O78A 3CW2C 4X3SA 1N34Q 4ZRZA 5EJWA 2E2JH 5JPMC 3HOXH 4M1UB 5CV8A 1LO5D 5CV9A 1O7ZA 1NR2A 3NPPA 1B44D 4G7HC 4ZUJA 3CC4A 1HNWQ 2C5CA 3OW7A 3M85A 4OWWB 4C3JG 1Y14B 2WKCA 5FKAC 1SLJA 3KF8A 2WB1B 4A3IG 3HOWG 1IYVA 3PUXA 3S2HB 3NBIA 2H5XA 5IT9E 2BA0A 4PMWA 5C5LA 3I91A 2IWHA 3NTKA 4KKTA 1WCMH 1CKOA 1XWEA 3GTJB 3S2HH 1BVSA 2PO4A 3T1HQ 1BNZA 1NBWA 1GVPA 4OONA 4C1NI 4DR4Q 4DV2L 2OEOA 3NUCA 4DV3Q 3GTJH 4JI6Q 4UAIA 3DWAA 4OO1I 5C4JB 3UDIA 4GOPA 4V190 1DM0B 4Y52H 3LNNA 1NAPA 1SXTA 4GKKL 2FMMA 2WINB 3GP7A 4KKSA 4C3IB 3KJOA 1XTCD 1A6XA 1E24A 4DFAA 3UDXA 1LM0A 1EWHA 3J81c 4C3IH 2RVLA 1TU2B 1G6PA 2MNAA 2K5QA 2QEXA 4R4IA 3PO2G 3S1QB 1CI3M 2DY7A 1HFNA 1HQRD 4OX9L 4FNFA 1PMRA 3VYSA 3S1QH 2OT2A 4JI2Q 3Q6SA 3KLRA 3W1BA 2JE6I 4DR2Q 1JE4A 3BVMA 1RJTA 3CCMA 3S1NB 3AEVA 2YU9B 5LMNQ 3E3XA 1Z7TA 1RL2A 5IYDH 1U4PA 4KY7A 4LF9Q 4ME5A 2IPKD 5FLXc 3S1NH 1QNUA 3BDLA 1B9MA 2KVMA 1CK1A 1AZQA 3KBGA 5K5PA 1STYA 3SR1A 3PO3B 3DEPA 4BY1G 3K5OA 1PH1A 3NQIA 5E4XA 3TSSA 3HG9A 1HNZL 4LFCQ 1DOLA 2R7FA 3J80E 3PO3H 4DR3Q 2B63B 4BXXG 1PRTD 1EQTA 1S3OA 1HZ9A 1QZGA 3ULLA 4KY5A 5JJKA 2D0OA 1VQ9A 2B29A 1HTLD 1I94L 4UY8C 3OHXC 3VR5A 4B3SL 2K05A 3KDFB 1JB7A 1RIPA 2V1CC 4EX5A 1C8CA 1N32Q 1Z6HA 1I4HA 3NE5B 3HEJA 4LFAQ 1AP0A 2ZT9C 2HD3A 2PZUA 2F0DA 2RCNA 5TSSA 2KENA 4HSPA 4S3SA 3JAMc 5CR3A 2EDGA 4DPGA 2AQ2B 2UUCL 3J7AF 4I65A 1UEBA 2EJMA 4FF1A 2PNHA 5IP7H 1D6EC 3SXHA 2OXPA 3TRZA 2WV6D 2A69D 2K5DA 4RKLA 1QCBD 1FNVA 3OWEB 5IGEA 1Q90A 3D6WA 2BE5C 4WJ3M 3D3RA 2R92H 2ZTCA 1TS5A 1ASZA 2ES2A 2BA1A 3QG1A 1CKNA 5I4DA 4LW1A 1CFMA 1FR3A 3TP5A 1ESRA 4GNXB 1UNSA 2B2VC 2NYZD 4G4KA 1SJED 3RZOB 1BR9A 1WVLA 5J3BA 4J15A 3T51B 1JJ2A 5IGBA 2PQAA 1J5EQ 3J81E 2K33A 3E9IA 3H94A 3RZOH 4U673 1VQCA 5E7NA 1PZJD 5K36G 5IGGA 1VQIA 1BOSA 3R2TA 1B70B 1PYWD 4WJWA 1EWIA 4BS9A 5C44G 2N8NA 5E4WC 3GO5A 2J0TD 3A74A 3M4QA 3TDQA 5ELCA 4A3BG 2E2DC 4UP7A 5FO9B 1IW7C 1PH3A 2JA7B 1PTOD 1WFQA 4CHTB 4HJ8A 4KD4A 4Z9CB 1U0LA 3PF4A 2E2HB 3CQZB 2X69A 4TQUS 3D0FA 2VUMG 4EQPA 1RTOA 2JA7H 2JN4A 1XTDA 1PV4A 4MNOA 5FLXE 2E2HH 3CQZH 4JPBW 2I5MX 1XMOL 1X3PA 2B8FA 2EOTA 4XXEA 4OIJA 1WTPA 3CRKC 3NELA 2YYZA 2CWPA 2JYOA 1FJGL 4KTAA 5CYUA 2Z9HA 4RKBA 1K9MC 1BBUA 2KHIA 1PXUA 3T1YL 3RN5A 2RA4A 4JI1Q 3R8BA 1KHIA 2XVSA 5LMUQ 3WDNA 4DAYA 5C0XH 4JBWA 3EN2A 1FD7D 1TWCB 5ISRA 2NN6H 4B3ML 1EEID 2B2VA 3S24A 2RSNA 2EYLA 1VMPA 5FO8B 4IJHA 3HOUH 4KHVA 5LL6X 1TWCH 4A3MB 1EIYB 1MJEA 1KDBA 5D65A 3AFPA 3TS2A 5LHY1 1AW7A 3OTOQ 2ZTEA 3I4OA 4DV4Q 2WAQE 3N6RA 4B3RQ 3KF8B 2O5JC 4YHHL 4GKJL 1U4MA 1SMXA 4J6HA 1GUNA 4DF7A 3JAME 4UP9A 3GV6A 3VDYA 1IKLA 3F2BA 4DAVA 1ET6A 2F0IA 2MFIA 5BR8L 4MIUA 2F0HA 3NQTA 5GAHC 1KIXA 1Q46A 1IBLL 2K52A 1N8RC 3J7AV 5ELDA 1HR0Q 1A2UA 3CCVA 2D5DA 1HRJA 3L3OC 2L0CA 2QILA 4IJLA 4DAPA 4GOPB 3MTSA 3FDTA 1FNWA 4HIMA 3PIPA 2ZXRA 3E5SA 3H3VI 1HZCA 5IT9L 2EJFC 4O1NA 3VR2A 4AQYL 2Q2HA 4X65Q 3H15A 3EIVA 2KCCA 1ET9A 1I6VC 1MGSA 1WOCA 5IGDA 5IP9H 1EWCA 4YY3L 1F77A 2F0NA 1DZ1A 3NWSA 4K0KL 1SE8A 3TMEA 1XYIA 1WJJA 2FXQA 4JI4Q 1Q8IA 5IWAQ 1KL9A 3I8ZA 3U4ZA 1NJIC 3PUZA 2EIFA 1X3QA 1E2WA 2HQLA 4OO1G 4NXNL 3GDEA 3OPOA 3TQYA
chains in the Genus database with same CATH topology
1EU4A 4IFDH 3PUYA 2K32A 4NKLA 3I73A 2WAQB 3K5NA 2AWNA 1HTPA 3VYUA 3ERQA 5NUCA 4H44C 1S5CD 5CBAE 3L7ZC 3K7AB 4WFN3 5J1ZA 1TWAB 3T56B 1RD9D 2JA5B 3M4OB 3C2PA 2DNEA 2L12A 3EROA 4UDUC 4ULLA 1D1IA 4Y7NB 3Q0AA 4R9WA 5FK9C 1CQVA 2PPBC 1TVXA 1RCVD 3HRZC 3SHLA 1W6JA 2Z4IA 5C3XA 1WD0A 1MD2D 1FGBD 1QNKA 4Q0FA 4G57A 1HHVA 2Z1CA 1JORA 1G291 1LTAD 5EKKA 4CJ0B 3E6ZX 4A3FB 1LT3D 2O5IC 1A3TA 4OGQC 1SFOB 1A3UA 2AUKA 4PQXA 3HZXA 3J80L 5T1IA 1LT6D 2IW3A 4K2KA 3WOEA 2R3ZA 4DGZA 3T53B 4B08A 2CW0D 2EY1A 1E0BA 1MSHA 4IALA 4K8JA 2K01A 1LABA 2A68D 2L5TA 4HTHA 1BBXC 2ENBA 5EPJA 3SK4A 4FVMA 1TWFB 3I3CA 4RCOA 1LTID 1ILPA 2K5WA 1H9SA 1PRTF 5JVG3 2DY8A 4XTCS 2PCFB 1FNUA 4DK1A 2RQXA 1TY2A 1I4RA 2XIWA 2EXZA 3EFXD 1PRTC 2F0FA 5DEHA 2KEDA 3M7GA 1BCPF 5DM63 3A54A 3DM1A 3HOVB 3J81L 2F0UA 4ZKCB 4RA8A 5KGUA 5HGTA 4R8NA 1SYGA 1BCPC 2F0WA 2NWGA 1WTRA 1I4XA 1RTNA 2B2UC 4QUCA 3K59A 3HP3A 4CKEA 4EQNA 4RAUC 2Y0SB 4HN7A 2A69C 4DA2A 5FLXL 1PFBA 3CKIB 4H13C 4RFBA 3FEWX 1II3A 2KUMA 2PZTA 3SK6A 2GA4B 4K6DA 3S2DB 2MP1A 1C4QA 3A8JE 4C1NK 3CU7A 1EL0A 4EGVA 4R8IA 5K36H 4TSSA 1GOZA 1CHPD 2QEJC 1SYCA 2B2WC 3P7JA 5ELBA 2PYKA 1F9SA 1SE4A 4HSVA 1PTOF 3L9AX 4KMUC 3EQLC 1S5DD 5J22A 3BDCA 2K04A 1KTKA 1S5ED 3I4MB 4ZAIA 1PTOC 2M2LA 4RGOS 2BDOA 2XSCA 2PZWA 3D8GA 3JAML 2B2UA 1PZID 2ZXOA 5EBCA 1WCMB 2PNRC 1L0XB 3KK7A 4C3HG 1O7YA 2NVXB 2JA6B 2H1EA 2A6HD 2MGSA 5M3MB 4FXGC 4A3EB 2EVBA 1A3VA 5I6WA 1I3QB 2F0GA 2PQEA 1SYBA 3DMUA 2Q8TA 4K8IA 4F7XA 2F4IA 3NBHA 4ILWA 1BF4A 2B2WA 1J9OA 3IKJA 1K83B 4FF3A 3MFGA 4IUNA 1LTGD 4QF4A 1KDCA 4OHJA 1JWSD 3FVQA 3O13A 3Q24A 1B3AA 2AQ3B 2EYHA 1K8MA 4PNYA 1TS3A 1HCZA 5CORA 1H9RA 1DJRD 2JP1A 3MXGA 2B2YC 1DOKA 3PUWA 2XWJB 3NHHA 5C3EB 1YNND 3DWQA 4IN3A 1X32A 1B1ZA 2EY6A 1I6HB 4OL7A 3H0GB 4KV6A 2Q8IB 2KQ3A 3VYRA 2TMPA 1GUWA 5KRUA 3VR4A 2FFKB 3MZ5A 3MXPA 4XT3B 5I2XA 1EQVA 4BBRB 4K5VA 2H4OA 1JOQA 3SK5A 4A3DB 3DHQA 2Q8RE 1GXDC 2KEEA 4O42A 3NXWA 4XQNA 3A8KE 4CJ1B 3J7YW 5D3DA 4K5XA 5C4HA 2O4XA 2B2YA 1H9SB 5I9PA 4F88A 4QCLA 3K57A 4PMBA 5CV4A 1TS4A 2R92B 2OF1A 2XRSD 3FMCA 1Q1EA 1M8AA 1AN8A 3TZUA 1K8OA 5JEAJ 5EKIA 1D5ZC 3SDZA 2F03A 1KNEA 5JEAG 2NVTB 3V96A 1I4QA 4I7ZC 4X3TA 2BOSA 2X6LA 3U9SA 2NN6I 2F0LA 1F9QA 1SNQA 5CMDA 3K5MA 1GHKA 3BG3A 1CQFA 1V1OA 5D14A 2F0VA 5IODA 5M5WB 1CZGA 5J39A 2CW0C 2HDMA 3IL8A 1MI2A 1LACA 3UI2A 4IUQA 5A2QE 3Q22A 2ZXPA 1C48A 3RZDB 3NSWA 1EY7A 1OO9B 1GUSA 3I4NB 2A68C 1EY8A 1F2ZA 4IUTA 1VMCA 4HEDA 2HCCA 3OIQA 1PRTB 3GTPB 2IJ0A 3K58A 3HOUB 3TP8A 1AZPA 2PMZB 1V1PA 1G6ZA 5JOBA 3R2IA 5F2DA 1U4LA 2WKDA 1KLGD 3SE0A 1DONA 1BCPB 2F0MA 3W3AA 3DEOA 1EY4A 5BN4A 1HFGA 1A15A 1RODA 3SVMA 2JA8B 1XX8A 2R7ZB 1SNOA 2J7ZA 2IL8A 4IZ8A 1ILQA 2F0SA 4K6LA 3Q23A 2EZVA 1B50A 1S4ZA 4NMZA 4IFDI 2EYOA 2EJGC 1SNMA 1J8IA 4X3KA 5E3FA 4IQZA 5DM73 4ABNA 3MXNA 1ENCA 4XQQA 5C4ZA 4KD3A 4PMCA 4ZK9B 4HAEA 3T13A 2IX3A 5ELEA 1OXUA 3S14B 4XT1B 5ELFA 1RF2D 2XN9C 4C3IG 3GTOB 1QB5D 2SNMA 2RDHA 4QMGA 5CV5A 1B53A 5D3IB 2I07B 3QIAA 3P1HA 4HMIA 4CBVA 3QB3A 1R4QB 2E2IB 2K7VA 2R61A 3VA5A 1DCZA 3ITPA 1E2ZA 1PTOB 3PIO3 4C3JB 3PV0A 2ICIA 3URYA 2LY7A 1PTOH 3BVGA 2NTTA 4WRDA 4A3IB 3D31A 3HOWB 3S1MB 4FYDA 1FYCA 2F0KA 4XQJA 5KNCA 3I4LA 2AQ1B 5KIXA 3A7AB 1EYCA 3NP8A 5EPKA 1B9NA 3OOCA 3CRLC 2ID0A 1CT1D 2EYPA 3G6JB 2LKVA 3P75A 2N88A 1OXVA 1Q3LA 1ENAA 4MN3A 2B39A 1STAA 2AWOA 2WP8J 5EKLA 2CVRA 3M3YB 3ND9A 5LL6S 3M4YA 3RUZA 1JC7A 3GTQB 2BE5D 1V43A 1TWGB 3PO2B 3BZDB 1DOMA 2L4NA 4RHSA 4CKCA 4B9WA 2NBFA 1L0YB 2NVQB 1R9TB 5CGKA 1VF5C 1EZ8A 1XXGA 4N9TA 1G8ZD 2FINB 1G91A 1T5EA 4ZUIA 2MHVA 4ODGA 4XIGS 3SK8A 2L55A 4DK0A 5CV7A 2QKIC 2KJXA 1M4VA 4BY1B 3TBIB 4ZKBB 1F9PA 1YNNC 4J8QA 1KLUD 1CA5A 5G3LD 1F9RA 1QE6A 3TN2A 3MVVA 3PMFA 4NW2A 5E1FA 2DNCA 4MHEA 3KLSA 2VXWA 5M5XB 3GTMB 1ML0D 1SEBD 3H6MA 4NP5A 2L9HA 3R3OA 3LWUA 3VR3A 1BQQT 4KKUA 1W6KA 2JEBI 5I9OA 1YNJD 5C6AA 3MWYW 5M3FB 4EQOA 3ONAB 3BYYB 2K1BA 5C5MA 2Z4HA 2A73B 3QOLA 2NN6G 4EVOA 1D5XC 5KEEA 5IIFA 2IX1A 2FJ2A 4KHZA 1B2TA 1VF7A 1WTOA 1V1PB 3GTKB 3TP6A 1STGA 5A2QL 1SE3A 2A6ED 5EBDA 2K03A 4OIKA 5JEAH 2JSOA 1EU3A 3DXJC 5C44B 4DNTB 2RBMA 4A3BB 3MHBA 3MEHA 3S9WA 1ENFA 1WTQA 3IAYA 2A5HA 4HCSA 4V0BA 2VUMB 2NTSA 4KY6A 1EY9A 1BUVT 4DXFA 3T16A 4ZYSA 3QOJA 1Q1BA 1PZKD 1CM9A 3IFDA 4XDXA 5I6YA 5BN3A 2A74C 3EJIA 3I90A 2B2TC 1D5MC 4QUFA 3K5LA 3W2DA 1UUPA 1O7LA 2HQEA 1CHQD 4IFDJ 3RLFA 2JEAI 3TP7A 5FOBB 4F87A 4BA2I 4IFDG 1ZEQX 1OXXK 3OIPA 2XRQD 3X3MA 1OXSC 3RD4A 1SE2A 3QJYA 5CV6A 4N9PA 1S5BD 1TT2A 1SSOA 1EIGA 3DWPA 3H3VC 1KNAA 1ZKOA 1IL8A 1ZYRD 3MC0B 3K6OA 3MAQA 1DYQA 1LTRD 3FPPA 3EVQA 3I72A 4H0LC 1R4PB 2NUCA 1SYEA 3E0JA 3GV3A 2L1BA 2FMCA 2B2TA 4FF4A 1ONLA 1S5FD 1LTSD 4U68A 3T4AC 2F3WA 3BS1A 1OXTA 4LAAA 2I46A 5EPLA 5IGCA 2E75C 2EY2A 2RKSA 2QF7A 1EY0A 3TZDA 3S16B 1WTVA 4B9XA 4NDXA 1EFID 2M9VA 5M5YB 4FF2A 1SMYD 1Z47A 3BVZA 1LLRD 4RGMA 3LWEA 1DXMA 1VDZA 2AUJD 4OO1H 3P20A 2MJ8A 4BA1I 2HCIA 2LS01 4BWGB 3FKIB 1V8QA 4PV1C 2M00A 4A3GB 1EYDA 4J1MA 2Z8LA 1HUMA 2D2CC 2BDNA 4L6TB 3MXUA 2QDBA 2KOLA 3DUZA 1IHZA 1TKWB 1EIHA 3OSOA 5CBEE 1E2VA 3F2UA 1PFNA 4JK1C 3AMUA 4WORA 2K28A 5HURA 1EEFD 1EYAA 3A7LA 3C46A 4K14A 4KJNA 1BCPD 3GTLB 4QIWB 2FHTA 2WIIB 4K5WA 5AFWA 2L11A 3S15B 4KN7C 2PW5A 1KDAA 4FXKC 3X3NA 3N52A 1LTBD 2BCOA 5JAVA 1SAPA 1UAPA 1STNA 1Y8PB 2RDGA 3GQBA 2O2LD 1ZXTA 4XYQA 5COYA 2F3VA 5C0XI 4RCNA 4CJ2C 1NCVA 2KHSA 1PFMA 1H9KA 2F0TA 4E6IA 5C4XB 1NSNS 3HOZB 5DAUA 1DD2A 3FRPB 5EGTA 3ZYYX 2MUYA 1B4OA 4C56C 2SEBD 4A3KB 4L8JA 2LFNA 1WD1A 1TR5A 1EY5A 2CHBD 5A35A 1MSGA 1JB3A 4ZQ3A 5G3LF 4P2CB 2F0OA 1F2MA 3HOYB 3GD7A 1VCIA 1HQMC 2RDFA 3D4RA 4L63B 1I50B 5CC4A 2R93B 2C9OA 5JVH3 3VYTA 1QWYA 3QWNA 2EYFA 4FXDA 1SNDA 3V05A 1LV9A 3KLSX 4RWSC 3RMHA 3KBXA 3QO2A 1Y69U 1EZ6A 1YNJC 3OWFA 3A56A 2F0EA 1STBA 3NWTA 3OMCA 1SDFA 1EY6A 1PLFA 2IT1A 4X3UA 5IGFA 4RHRA 4DN4M 1BXTA 5M9OA 2RSOA 2EPBA 5KNBA 1MBYA 4HCEA 2WACA 2X6GA 1HPCA 3LX0A 2HUGA 3HGBA 4LMQD 2A6EC 2IX0A 2ICEC 5T1GA 3K0YA 1QG7A 3GTGB 2F0JA 2VB2X 4CKBA 2MPMA 4XYOA 3WOFA 2K6AA 2XWBB 1RDPD 2E76C 1CZWA 3HKZB 4HMJA 3S17B 4RGTA 1WTXA 4HR7B 1AEXA 3HS0C 1GUTA 4A93B 2HDLA 1Y8NB 4LK1C 3IFTA 3S1RB 3MFYA 4C3HB 2JXMB 1O80A 1STEA 1JWUD 2F0PA 3FPUB 4C2MB 4FO2A 5EQ0A 3G7LA 3R93A 1CTMA 2NZ1D 3D4DA 1EOTA 4IUPA 3V2TA 2EYJA 2A6HC 2G9DA 5JJZA 4A3JB 4LJZC 5BN5A 5KNDA 2QCPX 1HA6A 1HXYD 1LT4D 1JQYD 4DU9A 4RGNA 5KYIA 4GZYC 4DNRB 1AFPA 1I4PA 2PW7A 2D9UA 2VNUD 1BO0A 3U9OA 5KYLA 1IYUA 4BY7B 1ZYRC 1F2YA 3PUVA 1JCKB 2F0QA 4AYBB 1TY0A 1RHPA 1U4RA 1SYDA 5I2YA 4IURA 1Q12A 1TWHB 3KUPA 4BBSB 1I4GA 1JR0D 4ID6A 1D1KA 4KI0A 2R6GA 1JICA 3A55A 2N55A 1QJOA 3C3LA 1SNCA 3CHBD 1F2LA 1GUGA 1IW7D 1GUOA 1QOHA 4FP5D 1A2TA 4RH6A 1HA5A 3NTHA 3PIP3 4QB4A 3BYTB 4G7OC 3D4WA 1G2SA 1WTWA 2D62A 2EE1A 2EY5A 1SYFA 4KN4C 1SMYC 1H9JA 2EYMA 2F1MA 3SEBA 1H9MA 1TQOA 3H91A 4G7ZC 3VR6A 5JPNC 5DNFA 4DXGA 2DN8A 4TRDA 1JWMD 3OMGA 5C0XJ 4H7BA 1STHA 1HUNA 4TKOB 1GJXA 2TSSA 2KCNA 1Y8OB 5C0XG 3EA6A 4YIJA 2G9HD 1RKNA 4F8MA 1NUCA 2E74C 1UEAB 2SNSA 1TIID 5IOCA 4KJOA 1Y1WB 1QILA 2V4DA 3NK9A 1LTTD 3ND8A 1KABA 2LMCB 3BDOA 1GHJA 4CGYB 1SJHD 3MA2B 1U9RA 1NR4A 1ICWA 4IUUA 1Y1VB 2XNAC 1CA6A 2SOBA 3VA7A 2NVYB 3H09A 1LT5D 3C1EA 1SBBB 2KA7A 4KK7A 1T5XD 3I70A 1ESFA 3AB9A 4IUVA 5FO7B 3D6CA 4Q5VA 2SDFA 3M7NA 2CQAA 1JOKA 2VB3X 1TS2A 1KAAA 1JOOA 1PDQA 2NB0A 1IKMA 4M8AA 3AU7A 2B8GA 1BDOA 5C3WA 3C1FA 3A8IE 3NTIA 1G2TA 2J4XA 1SNPA 4K2LA 2KECA 2E2JB 3HOXB 4ZLTF 1D2BA 1O78A 4X3SA 4ZRZA 5EJWA 5JPMC 4M1UB 5CV8A 1LO5D 5CV9A 1O7ZA 1NR2A 3NPPA 1B44D 4G7HC 4ZUJA 2C5CA 3OW7A 3M85A 4C3JG 2WKCA 5FKAC 3KF8A 2WB1B 1IYVA 3PUXA 3S2HB 3NBIA 5IT9E 2BA0A 4PMWA 5C5LA 3I91A 2IWHA 3NTKA 4KKTA 1XWEA 3GTJB 2PO4A 1BNZA 4C1NI 2OEOA 3NUCA 4UAIA 3DWAA 4OO1I 5C4JB 4V190 1DM0B 3LNNA 1NAPA 1SXTA 2FMMA 2WINB 3GP7A 4KKSA 4C3IB 1XTCD 1A6XA 4DFAA 1EWHA 2RVLA 1TU2B 2K5QA 3S1QB 1CI3M 2DY7A 1HFNA 1HQRD 4FNFA 1PMRA 3VYSA 2OT2A 3Q6SA 3KLRA 2JE6I 1JE4A 3BVMA 1RJTA 3S1NB 2YU9B 1Z7TA 1U4PA 4KY7A 4ME5A 2IPKD 1QNUA 3BDLA 1B9MA 2KVMA 1CK1A 1AZQA 5K5PA 3KBGA 1STYA 3SR1A 3PO3B 3DEPA 3K5OA 3NQIA 5E4XA 3TSSA 3HG9A 1DOLA 3J80E 2B63B 1PRTD 1EQTA 4KY5A 1HTLD 3OHXC 3VR5A 2K05A 1C8CA 1Z6HA 1I4HA 3NE5B 3HEJA 1AP0A 2ZT9C 2PZUA 2F0DA 5TSSA 4HSPA 4S3SA 5CR3A 2EDGA 2AQ2B 3J7AF 4I65A 2EJMA 4FF1A 1D6EC 3SXHA 2OXPA 2WV6D 2A69D 2K5DA 4RKLA 1QCBD 1FNVA 3OWEB 5IGEA 1Q90A 3D6WA 2BE5C 3D3RA 1TS5A 2BA1A 3QG1A 5I4DA 1CFMA 1FR3A 3TP5A 1ESRA 1UNSA 2B2VC 2NYZD 4G4KA 1SJED 3RZOB 1BR9A 1WVLA 3T51B 5IGBA 3J81E 2K33A 3H94A 4U673 1PZJD 5K36G 5IGGA 1BOSA 3R2TA 1PYWD 4WJWA 4BS9A 5E4WC 3GO5A 2J0TD 3TDQA 5ELCA 2E2DC 5FO9B 1IW7C 2JA7B 1PTOD 4CHTB 4KD4A 4Z9CB 2E2HB 3CQZB 2X69A 4TQUS 4EQPA 1RTOA 5FLXE 1X3PA 2B8FA 2EOTA 4XXEA 4OIJA 1WTPA 3CRKC 2YYZA 2JYOA 4KTAA 5CYUA 4RKBA 1PXUA 2RA4A 3R8BA 2XVSA 3WDNA 4DAYA 5C0XH 4JBWA 1FD7D 1TWCB 5ISRA 2NN6H 1EEID 2B2VA 2RSNA 2EYLA 1VMPA 5FO8B 4KHVA 5LL6X 4A3MB 1KDBA 5D65A 5LHY1 1AW7A 3N6RA 2O5JC 1U4MA 4J6HA 1GUNA 4DF7A 3JAME 3GV6A 1IKLA 4DAVA 1ET6A 2F0IA 4MIUA 2F0HA 3NQTA 3J7AV 5ELDA 1A2UA 2D5DA 1HRJA 3L3OC 2L0CA 2QILA 4DAPA 3MTSA 3FDTA 1FNWA 2ZXRA 3E5SA 5IT9L 2EJFC 4O1NA 3VR2A 2KCCA 1ET9A 1I6VC 1MGSA 5IGDA 1EWCA 1F77A 2F0NA 1DZ1A 3NWSA 3TMEA 1XYIA 1Q8IA 3I8ZA 3PUZA 1X3QA 1E2WA 4OO1G 3OPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY6 A;  2PW7 A;  5JAV A;  2SNS A;  4ZUI A;  3QB3 A;  5IGF A;  5KIX A;  5KRU A;  4NKL A;  3U9O A;  1STN A;  5KYL A;  5IOC A;  4ODG A;  3MZ5 A;  2RBM A;  3MXP A;  4KJO A;  3SK5 A;  2F3V A;  3SK8 A;  5M9O A;  3NK9 A;  2F3W A;  3HEJ A;  2PZW A;  1KAB A;  1EQV A;  3MHB A;  1F2Y A;  2OEO A;  3ERQ A;  3MEH A;  3NUC A;  3D8G A;  5CV7 A;  3VA5 A;  3S9W A;  5ISR A;  5NUC A;  1U9R A;  2PZU A;  4LAA A;  2EYL A;  2F0D A;  3ITP A;  1EY7 A;  2WAC A;  4KHV A;  2F0Q A;  2EXZ A;  2KHS A;  1EY8 A;  5J1Z A;  4K5V A;  4S3S A;  1JOQ A;  1F2Z A;  3LX0 A;  2F0T A;  2EY2 A;  1EY9 A;  2F0F A;  2SOB A;  1KDB A;  3DHQ A;  4KY6 A;  5CR3 A;  4E6I A;  1NSN S;  5DEH A;  2RKS A;  5IGC A;  1EY0 A;  3ERO A;  3T16 A;  4I65 A;  5DAU A;  1SYD A;  3QOJ A;  3C1E A;  4WRD A;  3SXH A;  2OXP A;  5EGT A;  4B9X A;  4RKL A;  3NXW A;  4NDX A;  5I6Y A;  5IGE A;  3MVV A;  2F0K A;  3PMF A;  3SHL A;  5E1F A;  5C3X A;  2F0U A;  3TP8 A;  3EJI A;  4ID6 A;  4DFA A;  2F0J A;  4J6H A;  1A3V A;  3D6C A;  4K5X A;  5JOB A;  4DF7 A;  5I6W A;  4G57 A;  5F2D A;  5C5L A;  3H6M A;  1TR5 A;  1EY5 A;  4NP5 A;  5C4H A;  5HGT A;  1JOK A;  4R8N A;  1EYC A;  1SYG A;  2F0G A;  3NP8 A;  1SNC A;  2F0W A;  2PQE A;  1SYB A;  4ZQ3 A;  1KAA A;  4HMJ A;  3R3O A;  1JOO A;  2F0I A;  3DMU A;  2F0O A;  4K8I A;  2O4X A;  4MIU A;  4F7X A;  2F0H A;  2HQE A;  1F2M A;  3NQT A;  3TP5 A;  5EKK A;  5I9P A;  2EYP A;  1A2T A;  2LKV A;  2F0M A;  1AEX A;  2M00 A;  5KGU A;  1EYD A;  3P75 A;  1A3T A;  3C1F A;  4J1M A;  1EY4 A;  5C3W A;  5I9O A;  3TP7 A;  2RDF A;  4PMB A;  4EQN A;  4IUN A;  5IGB A;  1A2U A;  5CV4 A;  4QB4 A;  1A3U A;  1ENA A;  1SNP A;  4K2L A;  2QDB A;  1KDC A;  4QF4 A;  5C6A A;  1STA A;  3HZX A;  3D4W A;  1IHZ A;  2OF1 A;  1JOR A;  3OSO A;  5IGG A;  4EQO A;  2EY5 A;  5C5M A;  1SNO A;  4IZ8 A;  1SYF A;  4K2K A;  2EYH A;  5EKL A;  2F0S A;  5CC4 A;  3QOL A;  2F0P A;  2EYM A;  4KY7 A;  5CV6 A;  1II3 A;  4ME5 A;  4N9P A;  4PNY A;  3E5S A;  4EVO A;  5KEE A;  5IIF A;  4NMZ A;  4DGZ A;  1TT2 A;  2PZT A;  3SK6 A;  4WOR A;  2EY1 A;  4K6D A;  3RUZ A;  5HUR A;  3BDL A;  2EYF A;  1SND A;  2EYO A;  4KD4 A;  5CV8 A;  1TQO A;  5K5P A;  1SNM A;  1STY A;  1EYA A;  5CV9 A;  5E3F A;  3SR1 A;  4ZUJ A;  4IAL A;  4K8J A;  5IGD A;  4TRD A;  3D4D A;  3OMG A;  3V2T A;  2F0N A;  3TP6 A;  4EQP A;  4K14 A;  1SYC A;  2EYJ A;  4H7B A;  1ENC A;  1STH A;  4KJN A;  1STG A;  2PYK A;  3TME A;  1EZ6 A;  4KD3 A;  5C4Z A;  3NHH A;  4B9W A;  3OWF A;  4PMC A;  2F0L A;  4HTH A;  3T13 A;  2F0E A;  2EY6 A;  3EVQ A;  1SNQ A;  4K5W A;  4OL7 A;  5CGK A;  1STB A;  4YIJ A;  2PW5 A;  4KV6 A;  1KDA A;  2SNM A;  1RKN A;  5J22 A;  4KTA A;  4QMG A;  5CV5 A;  3OMC A;  4KY5 A;  1NUC A;  2NUC A;  4F8M A;  1EZ8 A;  1SYE A;  2ENB A;  4RKB A;  2F0V A;  4N9T A;  3SK4 A;  4DU9 A;  3P1H A;  5IOD A;  5KYI A;  2KQ3 A;  3BDC A;  5J39 A;  4HMI A; 
#chains in the Genus database with same CATH topology
 1EU4 A;  4IFD H;  3PUY A;  2K32 A;  4NKL A;  4DV1 L;  3I73 A;  2WAQ B;  3OYY A;  3K5N A;  2AWN A;  1HTP A;  3HOY H;  3VYU A;  3UDG A;  2VQF Q;  4N8X 1;  3ERQ A;  3FKI G;  5NUC A;  4H44 C;  1S5C D;  5CBA E;  1YJN A;  3L7Z C;  3K7A B;  4A3G G;  4WFN 3;  4OXP A;  5J1Z A;  1TWA B;  3T56 B;  2E5L Q;  1RD9 D;  2JA5 B;  3M4O B;  3C2P A;  2DNE A;  2L12 A;  3ERO A;  4UDU C;  4DV5 L;  3K7A H;  4ULL A;  5GAG C;  1D1I A;  4Y7N B;  1TWA H;  3Q0A A;  4R9W A;  2K75 A;  5FK9 C;  2JA5 H;  1N33 Q;  3M4O H;  1CQV A;  2PPB C;  2CH4 W;  1TVX A;  1RCV D;  3HRZ C;  3SHL A;  1W6J A;  2Z4I A;  5C3X A;  1WD0 A;  1MD2 D;  1FGB D;  1QNK A;  4Q0F A;  4G57 A;  4UPA A;  1HHV A;  1JJC B;  2Z1C A;  1JOR A;  1G29 1;  1K3R A;  1LTA D;  5EKK A;  4CJ0 B;  1PYS B;  3E6Z X;  4A3F B;  1LT3 D;  2O5I C;  1PYB A;  4P72 A;  1W2B A;  1A3T A;  2AKW B;  4OGQ C;  1SFO B;  4A3F H;  4B3T Q;  1A3U A;  2AUK A;  4PQX A;  3HZX A;  3J80 L;  5T1I A;  1SFO H;  1LT6 D;  2IW3 A;  4K2K A;  4R4Q A;  3WOE A;  1VQ6 A;  1IBK Q;  1QVF A;  1X3G A;  2R3Z A;  1P8L A;  4DGZ A;  3T53 B;  4B08 A;  2CW0 D;  1UE7 A;  2EY1 A;  2JJQ A;  1E0B A;  2RHS B;  3KF6 A;  4IPD A;  1MSH A;  2K14 A;  4IAL A;  4K8J A;  2K01 A;  1LAB A;  4JI8 L;  2A68 D;  2L5T A;  4HTH A;  4LF5 Q;  1CKN B;  3HOZ G;  1AE2 A;  1BBX C;  3UE0 A;  4X64 L;  2VL6 A;  2ENB A;  5EPJ A;  3SK4 A;  4GLX A;  4FVM A;  1TWF B;  2PQA B;  4A3K G;  3I3C A;  4RCO A;  1LTI D;  1ILP A;  2K5W A;  1H9S A;  1PRT F;  2UXD L;  5JVG 3;  1XPO A;  1KD1 C;  2DY8 A;  4XTC S;  1TWF H;  2PCF B;  3NEM A;  2R7D A;  1FNU A;  4DK1 A;  4A3L G;  2RQX A;  1TY2 A;  1I4R A;  2XIW A;  2EXZ A;  4KHP L;  4P71 A;  4UP8 A;  1PH5 A;  3EFX D;  1PRT C;  2F0F A;  2QW7 A;  5DEH A;  4DR5 Q;  2KED A;  3M7G A;  1BCP F;  5DM6 3;  3F2C A;  2MO0 A;  4JV5 Q;  3A54 A;  4H02 A;  4LUV A;  3DM1 A;  2VQE Q;  2R93 G;  3HOV B;  3J81 L;  2F0U A;  4ZKC B;  5GAD C;  4OEL B;  1E22 A;  1WYD A;  4RA8 A;  1IBM Q;  5KGU A;  5HGT A;  4R8N A;  1SYG A;  2BH2 A;  1BCP C;  2F0W A;  4LF7 L;  2NWG A;  1WTR A;  1VQM A;  1I4X A;  1RTN A;  2B2U C;  2UUA L;  4QUC A;  3K59 A;  3HP3 A;  2JA8 G;  3JC6 6;  4CKE A;  4DAY B;  4EQN A;  3J7A 5;  3CCL A;  4RAU C;  3SGI A;  2LXJ A;  2Y0S B;  4HN7 A;  3IRB A;  2A69 C;  4DA2 A;  1CKM A;  5FLX L;  1PFB A;  3CKI B;  4H13 C;  4RFB A;  3FEW X;  1C9O A;  1II3 A;  2KUM A;  3CME A;  2PZT A;  2UUB L;  2Z6K C;  3SK6 A;  1YNX A;  2GA4 B;  4K6D A;  3S2D B;  2MP1 A;  1C4Q A;  3A8J E;  4C1N K;  3CU7 A;  1EL0 A;  4EGV A;  4R8I A;  3KFU A;  2EQS A;  4TSS A;  1GOZ A;  5K36 H;  1CHP D;  1D8L A;  3S2D H;  2QEJ C;  1SYC A;  2B2W C;  3P7J A;  5ELB A;  2PYK A;  2GN5 A;  2F4V Q;  1F9S A;  3QR8 A;  2CFM A;  1SE4 A;  4IO9 A;  4HSV A;  1PTO F;  3L9A X;  4KMU C;  5HY6 A;  3G48 A;  1XNQ L;  1V9P A;  1S5D D;  3EQL C;  5J22 A;  2VS1 A;  3AQQ A;  3BDC A;  1E7Z A;  2K04 A;  1KTK A;  1S5E D;  3I4M B;  4ZAI A;  1PTO C;  2M2L A;  4RGO S;  2BDO A;  3HKZ G;  1HR0 W;  1HZA A;  4X6A H;  2XSC A;  1JE5 A;  2PZW A;  2HIX A;  4JYA L;  3I4M H;  3D8G A;  3BU2 A;  1EUJ A;  3JAM L;  2B2U A;  5FLM G;  1PZI D;  2ZXO A;  4A93 G;  1GD7 A;  1X55 A;  5EBC A;  3CPW A;  1WCM B;  1YHB A;  2PNR C;  1L0X B;  3KK7 A;  4QQB X;  4C3H G;  5IY0 A;  5JJI A;  1O7Y A;  3CCJ A;  1UE1 A;  2NVX B;  2JA6 B;  2H1E A;  2VW9 A;  4HIO A;  2A6H D;  2MGS A;  1NMG A;  5M3M B;  1VQ4 A;  2DJG C;  4FXG C;  4A3E B;  5LMN L;  2NVX H;  2JA6 H;  2EVB A;  1A3V A;  2Z6K A;  4LF9 L;  5I6W A;  1I3Q B;  1PH6 A;  5M3M H;  2F0G A;  4HJ7 A;  2PQE A;  4A3E H;  1SYB A;  1IZ6 A;  3DMU A;  2Q8T A;  4K8I A;  4F7X A;  1CUK A;  2F4I A;  3NBH A;  4ILW A;  2OQ0 A;  1I3Q H;  1BF4 A;  1S72 A;  1HH2 P;  1X9N A;  2B2W A;  4R1J A;  1J9O A;  3IKJ A;  4A3J G;  1K83 B;  4FF3 A;  2N3S A;  2ALY B;  1YEZ A;  3MFG A;  1XMQ Q;  4IUN A;  1LTG D;  4DR3 L;  4QF4 A;  1KDC A;  4O2D A;  4OHJ A;  1JWS D;  1K83 H;  3FVQ A;  1Z9F A;  3O13 A;  3Q24 A;  1B3A A;  4POG A;  2AQ3 B;  4YCU A;  3CP0 A;  2EYH A;  1K8M A;  4PNY A;  1B7Y B;  1TS3 A;  1HCZ A;  5COR A;  1N36 L;  4DR6 Q;  1H9R A;  1X3E A;  2VZA A;  1K8G A;  1DJR D;  2JP1 A;  3MXG A;  2B2Y C;  4AYB G;  1DOK A;  4MTN A;  1VQ5 A;  3PUW A;  2HHH L;  2XWJ B;  3ICE A;  3NHH A;  5C3E B;  1YNN D;  3DWQ A;  4IN3 A;  1X32 A;  1B1Z A;  2EY6 A;  3ULP A;  1I6H B;  4OL7 A;  4DR7 L;  3H0G B;  4KV6 A;  5C3E H;  1QVG A;  4OWT B;  1I6H H;  2Q8I B;  2KQ3 A;  3VYR A;  2TMP A;  3A5Z B;  2I5H A;  1GUW A;  3H0G H;  5KRU A;  3VR4 A;  1VQ7 A;  3PSI A;  2FFK B;  3MZ5 A;  4JI7 L;  3MXP A;  4XT3 B;  5I2X A;  3S16 H;  2LSS A;  1EQV A;  4BBR B;  4DV2 Q;  1SR3 A;  3G6E A;  4K5V A;  1VQB A;  2H4O A;  1JOQ A;  3SK5 A;  4A3D B;  1SN8 A;  3DHQ A;  4BBR H;  2UU9 L;  4HJ5 A;  3KF6 B;  4LF8 Q;  2Q8R E;  4P75 A;  1YHA A;  2GVB A;  1GXD C;  4HJA A;  2KEE A;  4JI3 Q;  4A3D H;  4O42 A;  3NXW A;  4XQN A;  3A8K E;  4CJ1 B;  3CCE A;  3G71 A;  4A3G H;  2JQO A;  3J7Y W;  5D3D A;  4IPC A;  4K5X A;  1V1Q A;  5L37 A;  5C4H A;  4NB3 A;  1GKH A;  1VQD A;  2RHQ B;  2O4X A;  2B2Y A;  1H9S B;  1A0I A;  5I9P A;  4F88 A;  4P74 A;  4DNI A;  5M3F G;  4QCL A;  3K57 A;  1PFS A;  4PMB A;  5CV4 A;  2PMZ E;  1TS4 A;  2R92 B;  3KOJ A;  2OF1 A;  2XRS D;  3FMC A;  1Q1E A;  1M8A A;  1AN8 A;  4QY7 A;  3DLL A;  2Q2I A;  2YTV A;  4LUO A;  1YZ6 A;  5IYB H;  1BBW A;  3TZU A;  4IPG A;  5JEA J;  1Y1W G;  1K8O A;  5EKI A;  2EXD A;  1D5Z C;  3SDZ A;  1PH9 A;  2F03 A;  1KNE A;  5EAY A;  5JEA G;  2NVT B;  3V96 A;  1I4Q A;  4I7Z C;  4X3T A;  2BOS A;  1Y1V G;  1PH4 A;  2X6L A;  1HNZ Q;  3STB D;  3U9S A;  2NN6 I;  2F0L A;  3TRE A;  2NVT H;  1F9Q A;  1SNQ A;  5CMD A;  3K5M A;  3U4V A;  1GHK A;  3BG3 A;  1CQF A;  2ATW A;  1V1O A;  2N78 A;  1AH9 A;  2K4K A;  5D14 A;  2F0V A;  5IOD A;  4IPH A;  1CZG A;  5M5W B;  1X6O A;  5J39 A;  5AJ3 Q;  4DV6 L;  2AMC B;  1I94 Q;  2CW0 C;  2HDM A;  3IL8 A;  1LUZ A;  4B3S Q;  1H95 A;  1MI2 A;  3RNU A;  1G51 A;  1LAC A;  3UI2 A;  5M5W H;  2WFW A;  4IUQ A;  1YIJ A;  5A2Q E;  3Q22 A;  2ZXP A;  3F8T A;  1C48 A;  2K50 A;  3RZD B;  3NSW A;  1EY7 A;  1OO9 B;  1GUS A;  2NZH A;  3I4N B;  2A68 C;  1EY8 A;  4CDC C;  1F2Z A;  4IUT A;  3KJP A;  1EQR A;  1VMC A;  4HED A;  3RZD H;  2HCC A;  2RF4 A;  4DUY L;  1MIU A;  2UUC Q;  3I4N H;  3OIQ A;  3J7Z C;  2N49 A;  5ELN A;  1PRT B;  3HOX G;  3GTP B;  2IJ0 A;  3K58 A;  3HOU B;  3TP8 A;  3CCQ A;  1AZP A;  2PMZ B;  5IYC H;  1FL0 A;  1V1P A;  1G6Z A;  5JOB A;  3R2I A;  5F2D A;  3GTP H;  1U4L A;  2WKD A;  1Q7Y C;  3B6Y A;  1KLG D;  1NTG A;  2RCF A;  3SE0 A;  1DON A;  3KYH C;  4QJF A;  1BCP B;  2F0M A;  3W3A A;  3DEO A;  1PHJ A;  1EY4 A;  4A3C H;  2WB1 G;  2UXC L;  4LWC A;  5BN4 A;  1HFG A;  1A15 A;  1ROD A;  3SVM A;  2JA8 B;  1XX8 A;  4YWK A;  2R7Z B;  2NZO A;  1SNO A;  2J7Z A;  2IL8 A;  4IZ8 A;  1ILQ A;  2F0S A;  4K6L A;  3Q23 A;  2EZV A;  1B50 A;  2JA8 H;  1S4Z A;  4NMZ A;  2R7Z H;  1S40 A;  4IFD I;  2EYO A;  2EJG C;  1SNM A;  1J8I A;  4X3K A;  5E3F A;  4IQZ A;  5DM7 3;  4CDE C;  2A8V A;  4ABN A;  4DAM A;  3MXN A;  1ENC A;  4XQQ A;  1VQF A;  4DK3 C;  4KD3 A;  5C4Z A;  4PMC A;  4ZK9 B;  4HAE A;  3T13 A;  2IX3 A;  4L5R C;  5ELE A;  3NBH B;  1OXU A;  2E5L L;  1XMO Q;  3S14 B;  4XT1 B;  5ELF A;  1RF2 D;  2XN9 C;  4C3I G;  3GTO B;  1QB5 D;  2SNM A;  4YWM A;  2RDH A;  4QMG A;  1EIF A;  5CV5 A;  1B53 A;  3RLO A;  3E0E A;  5D3I B;  2I07 B;  3QIA A;  1FJG Q;  3P1H A;  4HMI A;  3S14 H;  3TEH B;  2Z6B A;  4CBV A;  3GTO H;  3QB3 A;  1R4Q B;  1L2F A;  5HGQ A;  2E2I B;  2K7V A;  1LTL A;  2UXB Q;  3BZK A;  1YI2 A;  4RMF A;  2R61 A;  3VA5 A;  1KC8 C;  4RG1 A;  2E2I H;  1DCZ A;  1VQP A;  3ITP A;  4B3M Q;  1E2Z A;  1PTO B;  3FHW A;  3PIO 3;  1U5K A;  4C3J B;  3PV0 A;  2ICI A;  1PH7 A;  5IYD G;  1MKH A;  3URY A;  2LY7 A;  1PTO H;  3BVG A;  4JBK A;  2NTT A;  4WRD A;  4A3I B;  2DUD A;  1X56 A;  4C3J H;  3D31 A;  3HOW B;  1HNX L;  3S1M B;  4FYD A;  1FYC A;  2F0K A;  2OWO A;  3F2D A;  4XQJ A;  2IHE A;  5KNC A;  3I4L A;  3I56 A;  2AQ1 B;  2ZTD A;  4A3I H;  4YHH Q;  5KIX A;  3HOW H;  4GKJ Q;  3S1M H;  3A7A B;  1EYC A;  3PO3 G;  3NP8 A;  5EPK A;  4JBJ A;  1B9N A;  3OOC A;  3CRL C;  4JI5 L;  5BR8 Q;  1VQL A;  2ID0 A;  1CT1 D;  2B63 G;  2EYP A;  3G6J B;  2LKV A;  3P75 A;  4LF4 L;  2N88 A;  1OXV A;  3RLN A;  1IBL Q;  1Q3L A;  3RR5 A;  4AIM A;  4X66 L;  4NXM L;  1ENA A;  4MN3 A;  2B39 A;  1STA A;  1SRO A;  2AWO A;  2WP8 J;  5EKL A;  2CVR A;  3M3Y B;  4A3J H;  3ND9 A;  5LL6 S;  2ZM6 L;  4X62 L;  3M4Y A;  3RUZ A;  1PH2 A;  1JC7 A;  3M3Y H;  1XPU A;  3GTQ B;  2BE5 D;  3U50 C;  1V43 A;  1TWG B;  3PO2 B;  3BZD B;  3EBE A;  1DOM A;  3ER0 A;  2L4N A;  4RHS A;  4JOI C;  1X3F A;  4YY3 Q;  4DUZ L;  2JA9 A;  4P73 A;  4CKC A;  1VQG A;  3GTQ H;  4B9W A;  1TXY A;  2NBF A;  1L0Y B;  2NVQ B;  1TWG H;  3PO2 H;  1R9T B;  5CGK A;  2Z0S A;  4ALP A;  1VF5 C;  2NVQ H;  1EZ8 A;  1XXG A;  4N9T A;  2OTJ A;  1G8Z D;  1R9T H;  2FIN B;  1G91 A;  1T5E A;  4NXN Q;  1YIT A;  4ZUI A;  2MHV A;  4ODG A;  1HZB A;  1EOV A;  4XIG S;  4DV1 Q;  4DR1 L;  3SK8 A;  3U58 A;  2L55 A;  3WWV A;  4DK0 A;  5C4X G;  5CV7 A;  2QKI C;  2KJX A;  4LFB L;  1M4V A;  4BY1 B;  4DV7 L;  3TBI B;  4ZKB B;  1F9P A;  1YNN C;  4J8Q A;  2P5Z X;  2F52 A;  4BY1 H;  1Q82 C;  1KLU D;  1CA5 A;  5G3L D;  4DV5 Q;  1F9R A;  2CCZ A;  1QE6 A;  4YWL A;  3A0J A;  3TN2 A;  4N8F A;  3MVV A;  3PMF A;  4NW2 A;  5E1F A;  4BXX H;  2DNC A;  4MHE A;  3KLS A;  4LF6 Q;  1PVO A;  3K80 C;  2VXW A;  3J80 i;  5M5X B;  3GTM B;  3PQI A;  1ML0 D;  2JA7 G;  1SEB D;  3H6M A;  4NP5 A;  1X65 A;  2L9H A;  3MEF A;  2K5H A;  3R3O A;  3LWU A;  1T9H A;  3VR3 A;  1BQQ T;  4KKU A;  3ULJ A;  5M5X H;  3GTM H;  2AHO B;  4JOI A;  1W6K A;  2JEB I;  5FJ8 G;  4EQ5 A;  5I9O A;  4CDF C;  1YNJ D;  5C6A A;  3MWY W;  5M3F B;  4JI0 L;  4EQO A;  3ONA B;  1XNR Q;  3BYY B;  2K1B A;  5C5M A;  2Z4H A;  2MQH A;  2A73 B;  3QOL A;  1E1T A;  2NN6 G;  4EVO A;  1D5X C;  5KEE A;  5M3F H;  5IIF A;  1N34 L;  2IX1 A;  4DV0 Q;  2FJ2 A;  1VQJ A;  4KHZ A;  1B2T A;  1IYJ B;  1VF7 A;  3PCO B;  1WTO A;  1HNW L;  1KRT A;  1Q8K A;  1V1P B;  3GTK B;  3W1G A;  3TP6 A;  5GQO A;  4A3M G;  2WB1 E;  1STG A;  3KLW A;  5H1S E;  5A2Q L;  3GTK H;  1SE3 A;  2A6E D;  5EBD A;  4DKA C;  4PG3 A;  2K03 A;  4OIK A;  4L5Q A;  5JEA H;  4X64 Q;  2JSO A;  1NNX A;  1EU3 A;  3DXJ C;  5C44 B;  2CWA A;  2KCM A;  4OEM B;  5ELO A;  4DNT B;  3T1H L;  2RBM A;  4A3B B;  4GLA C;  4DR4 L;  2UXD Q;  3J81 i;  4DV3 L;  4JI6 L;  3MHB A;  3PGZ A;  3MEH A;  4PZ7 A;  3S9W A;  1ENF A;  5C44 H;  3G4S A;  1WTQ A;  1PA6 A;  3IAY A;  3STB C;  2A5H A;  4HCS A;  4V0B A;  4A3B H;  2VUM B;  2NTS A;  4HJ9 A;  2PI2 A;  4KY6 A;  1A8V A;  4KHP Q;  1EY9 A;  1BUV T;  4DXF A;  3T16 A;  1KXL A;  4ZYS A;  4HID A;  3QOJ A;  1ICF B;  1Q1B A;  2VUM H;  3MXN B;  1PZK D;  1CM9 A;  3IFD A;  4XDX A;  5I6Y A;  5BN3 A;  2A74 C;  3EJI A;  3I90 A;  2B2T C;  1D5M C;  4QUF A;  3K5L A;  3W2D A;  1UUP A;  4DR6 L;  1O7L A;  3I7F A;  1A63 A;  2HQE A;  3AYH B;  1CHQ D;  4LF7 Q;  4IFD J;  3RLF A;  2JEA I;  1L1O C;  4JI2 L;  2UUA Q;  3NEN A;  3TP7 A;  4DR2 L;  2C35 B;  5FOB B;  4F87 A;  4BA2 I;  4IFD G;  1ZEQ X;  1OXX K;  3OIP A;  1K8A C;  4JCV E;  2XRQ D;  3X3M A;  1OXS C;  3RD4 A;  3HOY G;  1E1O A;  4GLV B;  2OTL A;  1Q86 C;  1NE3 A;  1SE2 A;  3QJY A;  5CV6 A;  4N9P A;  1S5B D;  2WAQ G;  1TT2 A;  1SSO A;  2UUB Q;  1EIG A;  3DWP A;  1BKB A;  3H3V C;  1K3B C;  1KNA A;  4CDD C;  1ZKO A;  1IL8 A;  2YV5 A;  1ZYR D;  3MC0 B;  4APV A;  3K6O A;  4LFC L;  3MAQ A;  2A1A A;  1DYQ A;  1LTR D;  2JA5 G;  3CPF A;  3FPP A;  1VQK A;  4YCW A;  3EVQ A;  1YJW A;  3I72 A;  4H0L C;  3JAM i;  4QGU A;  4LF8 L;  1R4P B;  2CKZ B;  2NUC A;  1XNQ Q;  4BY7 G;  1SYE A;  3E0J A;  3GV3 A;  2L1B A;  4AH6 A;  5C4J H;  4JI3 L;  4QL5 A;  2FMC A;  2B2T A;  4FF4 A;  1N32 L;  3CCR A;  1ONL A;  4QIW E;  4LFA L;  1S5F D;  1LTS D;  4U68 A;  3T4A C;  2CQO A;  2F3W A;  3BS1 A;  3M4P A;  4A3F G;  1GM5 A;  1OXT A;  2MO1 A;  4LAA A;  4JYA Q;  1K0R A;  4A4I A;  1L1O A;  2LXK A;  2I46 A;  5EPL A;  5IGC A;  2E75 C;  2EY2 A;  4BBS G;  2GVA A;  1QUQ A;  1K28 A;  2RKS A;  2QF7 A;  1EY0 A;  3TZD A;  1Q81 C;  2ASB A;  4R4C A;  3S16 B;  1WTV A;  1CSQ A;  2DGY A;  4B9X A;  3LGJ A;  4NDX A;  1EFI D;  2M9V A;  4HIK A;  2IY5 B;  5M5Y B;  2XTI A;  4FF2 A;  1SMY D;  1Z47 A;  3BVZ A;  1LLR D;  4RGM A;  4JC0 A;  3LWE A;  1DXM A;  1VDZ A;  2AUJ D;  3CCU A;  4OO1 H;  2IHF A;  5M5Y H;  2K5V A;  3P20 A;  2MJ8 A;  4BA1 I;  2HCI A;  2LS0 1;  2YU9 H;  4MTK A;  3CCS A;  3M9B A;  4BWG B;  4WJ4 A;  3FKI B;  1V8Q A;  4PV1 C;  4GKK Q;  2M00 A;  4A3G B;  1EYD A;  1J5E L;  1OTC A;  4J1M A;  2Z8L A;  1HUM A;  2D2C C;  1YVC A;  2BH8 A;  2BDN A;  4L6T B;  1NY4 A;  3FKI H;  3MXU A;  2QDB A;  1W3S A;  2KOL A;  3DUZ A;  1IHZ A;  1DGS A;  1TKW B;  3OSO A;  4JVZ A;  1EIH A;  2CH4 A;  5CBE E;  1E2V A;  3F2U A;  1JJG A;  1PFN A;  2B63 H;  4JK1 C;  3AMU A;  5AJ3 L;  4WOR A;  2B3G A;  2K28 A;  5HUR A;  1N36 Q;  1EEF D;  1EYA A;  3A7L A;  4OX9 Q;  3K7U C;  3C46 A;  4K14 A;  2PI2 E;  4KJN A;  1BCP D;  3GTL B;  4QIW B;  2HHH Q;  2FHT A;  2WII B;  4K5W A;  5AFW A;  2L11 A;  3S15 B;  4KN7 C;  4DR7 Q;  2PW5 A;  1KDA A;  4FXK C;  4GS3 A;  1KQS A;  4ZCK A;  3GTL H;  3X3N A;  1LYL A;  3HOV G;  3N52 A;  1LTB D;  4JI1 L;  3S15 H;  2BCO A;  5JAV A;  1SAP A;  5LMU L;  1UAP A;  1STN A;  1WI5 A;  1Y8P B;  2RDG A;  2YTX A;  3GQB A;  2O2L D;  1HJP A;  1ZXT A;  3I2Z A;  4XYQ A;  5COY A;  1K73 C;  2F3V A;  5C0X I;  4RCN A;  4JI7 Q;  4CJ2 C;  2ZJP A;  2YTY A;  3K0X A;  4JG2 A;  1NCV A;  2KHS A;  1PFM A;  1X54 A;  1H9K A;  2F0T A;  3OTO L;  4E6I A;  5C4X B;  4DV4 L;  3RN2 A;  1NSN S;  2Y0S G;  3HOZ B;  2UU9 Q;  3Q8D A;  5DAU A;  1FVI A;  1DD2 A;  3FRP B;  4B3R L;  5C4X H;  5EGT A;  3PIO A;  1VQ8 A;  2E8G A;  1XJV A;  1FGU A;  3ZYY X;  2MUY A;  2G5D A;  3HOZ H;  1B4O A;  4C56 C;  4PZ6 A;  2SEB D;  4A3K B;  4L8J A;  3CMA A;  2LFN A;  1WD1 A;  1TR5 A;  1EY5 A;  2CHB D;  5A35 A;  1MSG A;  4YCV A;  1JB3 A;  4ZQ3 A;  5G3L F;  4P2C B;  2F0O A;  4A3K H;  1F2M A;  3HOY B;  1C0A A;  3GD7 A;  3W5O A;  1HR0 L;  1VCI A;  1GO3 E;  1HQM C;  2L15 A;  2RDF A;  3D4R A;  1VQN A;  3AFQ A;  3CF5 A;  3L2P A;  4JBM A;  4L63 B;  4A3L H;  2K5N A;  1I50 B;  1D7Q A;  3HKZ E;  4KLK A;  4OWX B;  5CC4 A;  3I4M G;  2R93 B;  4A76 A;  5FJ8 H;  1I50 H;  2C9O A;  5JVH 3;  3VYT A;  1QWY A;  4X65 L;  3QWN A;  2EYF A;  4FXD A;  1SND A;  3V05 A;  1LV9 A;  3KLS X;  4RWS C;  2R93 H;  2HIV A;  2UXB L;  3F1Z A;  3RMH A;  3KBX A;  4JI4 L;  1WCM G;  3QO2 A;  5IWA L;  1YBY A;  1Y69 U;  1KAW A;  1EZ6 A;  2ZJQ A;  1YNJ C;  3OWF A;  3A56 A;  2F0E A;  1UE5 A;  1STB A;  1YJ9 A;  2JA6 G;  3CAM A;  2QDL A;  3BZC A;  3NWT A;  4NPS A;  1XPR A;  5M3M G;  3OMC A;  1K0S A;  4A3E G;  4MZ9 A;  1SDF A;  1EY6 A;  1PLF A;  4A3M H;  2IT1 A;  4X3U A;  5IGF A;  4RHR A;  4LUZ A;  4DV6 Q;  1UE6 A;  4DN4 M;  1B3Q A;  2VQF L;  1BXT A;  5DLQ E;  5M9O A;  2RSO A;  2EPB A;  5KNB A;  2KBN A;  1MBY A;  1VQA A;  3I55 A;  4HCE A;  2WAC A;  2X6G A;  2OCE A;  1HPC A;  3LX0 A;  2HUG A;  3HGB A;  4LMQ D;  2A6E C;  1EQQ A;  2IX0 A;  1N33 L;  4DUY Q;  2ICE C;  3T1Y Q;  1SRU A;  4GN3 B;  1PH8 A;  1IL2 A;  5T1G A;  3K0Y A;  2QA4 A;  1QG7 A;  3GTG B;  1P16 A;  2F0J A;  2VB2 X;  4CKB A;  5IE8 A;  1CSP A;  4AYB E;  2MPM A;  4XYO A;  3WOF A;  4POF A;  2K6A A;  2I5L X;  2XWB B;  1RDP D;  4JW0 A;  4TVA B;  2E76 C;  1CZW A;  3HKZ B;  4HMJ A;  3S17 B;  3GTG H;  4RGT A;  1WTX A;  1VQH A;  1EFW A;  4HR7 B;  2KCT A;  5C3E G;  1A62 A;  1AEX A;  3HS0 C;  1GUT A;  3S17 H;  4A93 B;  4B3T L;  4L5T A;  2HDL A;  3TS0 A;  2UXC Q;  1Y8N B;  3H0G G;  4LK1 C;  3IFT A;  3S1R B;  3MFY A;  4C3H B;  1MJC A;  5FLM H;  1L1O B;  1IXR A;  2JXM B;  4A93 H;  1IBK L;  1O80 A;  1STE A;  1JWU D;  1QUQ B;  2F0P A;  3S1R H;  3FPU B;  4C3H H;  4C2M B;  4FO2 A;  5EQ0 A;  3G7L A;  1NMF A;  2DJF C;  3R93 A;  4BBR G;  4C2M H;  1CTM A;  2NZ1 D;  3HFZ B;  2ZJR A;  2I0Q A;  3D4D A;  1EOT A;  3UDF A;  4IUP A;  3V2T A;  2EYJ A;  1QZH A;  4A3D G;  4LF5 L;  2A6H C;  2G9D A;  5JJZ A;  4A3J B;  4LJZ C;  1EYG A;  5BN5 A;  5LMN W;  5KND A;  3ERS X;  2QCP X;  1HA6 A;  1HXY D;  2OQK A;  3H3V H;  1LT4 D;  3L0O A;  1JQY D;  2Q2T A;  4DU9 A;  4RGN A;  5KYI A;  4GZY C;  4DNR B;  1AFP A;  1I4P A;  2KHJ A;  2PW7 A;  2D9U A;  2VNU D;  1BO0 A;  3U9O A;  5KYL A;  4AQY Q;  1M1K C;  1IYU A;  4BY7 B;  3CXC A;  4LF6 L;  4Y7N H;  1ZYR C;  5IP7 G;  3J81 j;  2HT1 A;  4FDB A;  1F2Y A;  3PUV A;  4K0K Q;  4BY7 H;  1JCK B;  3CC7 A;  2F0Q A;  4AYB B;  4IOC A;  1WTH A;  1TY0 A;  2A19 A;  4DR5 L;  1KRS A;  2R92 G;  1RHP A;  3CD6 A;  5IYB G;  1U4R A;  1SYD A;  5I2Y A;  4JV5 L;  3K81 C;  4IUR A;  1JMC A;  1Q12 A;  2F3I A;  1TWH B;  2VQE L;  3KUP A;  4BBS B;  4GN5 A;  1I4G A;  1JR0 D;  1HNX Q;  1XNR L;  4ID6 A;  1IBM L;  1D1K A;  4KI0 A;  1B8A A;  2R6G A;  4GNX C;  1TWH H;  1JIC A;  3A55 A;  2N55 A;  4BBS H;  1QJO A;  3PF5 A;  3C3L A;  4DV0 L;  1SNC A;  3CHB D;  1F2L A;  1GUG A;  1IW7 D;  1GUO A;  1QOH A;  4FP5 D;  4JI5 Q;  1A2T A;  4RH6 A;  3UE1 A;  1HA5 A;  2Y0S E;  3NTH A;  1E3P A;  4LF4 Q;  1AE3 A;  4UHV A;  3PIP 3;  4QB4 A;  3BYT B;  3KDF A;  4G7O C;  4X66 Q;  4NXM Q;  3D4W A;  1G2S A;  1WTW A;  4A75 A;  2D62 A;  1O7I A;  2EE1 A;  2EY5 A;  1SYF A;  4KN4 C;  1SMY C;  3OW2 A;  1H9J A;  2EYM A;  4ME3 A;  2F1M A;  4O0A A;  2D0P A;  4L5S A;  2ZM6 Q;  3SEB A;  4X62 Q;  1H9M A;  1TQO A;  3H91 A;  1QVC A;  5IT9 c;  3VR6 A;  4PZ8 A;  5JPN C;  4G7Z C;  2QGQ A;  5DNF A;  4DXG A;  2DN8 A;  4TRD A;  3I4N G;  1JWM D;  3OMG A;  2F4V L;  1UWV A;  5C0X J;  4H7B A;  1STH A;  2VY3 A;  5JJL A;  1HUN A;  4DUZ Q;  4TKO B;  1GJX A;  1MHW C;  3ZJY C;  3BJU A;  2TSS A;  2KCN A;  1Y8O B;  5C0X G;  1M90 C;  3EA6 A;  5IYC G;  4YIJ A;  2G9H D;  1RKN A;  1JT8 A;  1I5F A;  4F8M A;  1NUC A;  2XGT A;  1N9W A;  1J6Q A;  3HOU G;  2E74 C;  1UEA B;  2JK8 A;  3K8A A;  2SNS A;  4GNX A;  1TII D;  5IOC A;  4DK6 C;  4R4T A;  4KJO A;  1Y1W B;  1QIL A;  3CC2 A;  2V4D A;  4A3C G;  3NK9 A;  4IOA A;  4DR1 Q;  1LTT D;  3ND8 A;  1KAB A;  1VQE A;  2LMC B;  3BDO A;  1GHJ A;  4CGY B;  1SJH D;  3MA2 B;  1U9R A;  1NR4 A;  4JI8 Q;  1ICW A;  3HOV H;  1Y1W H;  4LFB Q;  4DV7 Q;  4IUU A;  1Y1V B;  2XNA C;  1CA6 A;  4LNQ A;  2SOB A;  1YHQ A;  3VA7 A;  1ASY A;  2NVY B;  3H09 A;  1LT5 D;  3C1E A;  1SBB B;  1Y1V H;  2R7Z G;  2KA7 A;  4R4O A;  3HKS A;  4KK7 A;  2NVY H;  1T5X D;  3I70 A;  1ESF A;  3AB9 A;  1L0W A;  4IUV A;  5FO7 B;  3D6C A;  4Q5V A;  2SDF A;  3M7N A;  3FP9 A;  2CQA A;  1JOK A;  2VB3 X;  1VQO A;  1TS2 A;  1KAA A;  1JOO A;  1PDQ A;  3A5U A;  3E9H A;  5GAE C;  2NB0 A;  1IKM A;  4M8A A;  3AU7 A;  2B8G A;  1BDO A;  1XMQ L;  1VS0 A;  2Q2U A;  5C3W A;  4GOP C;  3C1F A;  3A8I E;  3NTI A;  1G2T A;  4GN4 B;  2J4X A;  1SNP A;  4K2L A;  2KEC A;  3DM3 A;  5IP9 G;  4JI0 Q;  2E2J B;  3J80 c;  3HOX B;  4ZLT F;  4I7A A;  1C7Y A;  1D2B A;  5GRO A;  1O78 A;  3CW2 C;  4X3S A;  1N34 Q;  4ZRZ A;  5EJW A;  2E2J H;  5JPM C;  3HOX H;  4M1U B;  5CV8 A;  1LO5 D;  5CV9 A;  1O7Z A;  1NR2 A;  3NPP A;  1B44 D;  4G7H C;  4ZUJ A;  3CC4 A;  1HNW Q;  2C5C A;  3OW7 A;  3M85 A;  4OWW B;  4C3J G;  1Y14 B;  2WKC A;  5FKA C;  1SLJ A;  3KF8 A;  2WB1 B;  4A3I G;  3HOW G;  1IYV A;  3PUX A;  3S2H B;  3NBI A;  2H5X A;  5IT9 E;  2BA0 A;  4PMW A;  5C5L A;  3I91 A;  2IWH A;  3NTK A;  4KKT A;  1WCM H;  1CKO A;  1XWE A;  3GTJ B;  3S2H H;  1BVS A;  2PO4 A;  3T1H Q;  1BNZ A;  1NBW A;  1GVP A;  4OON A;  4C1N I;  4DR4 Q;  4DV2 L;  2OEO A;  3NUC A;  4DV3 Q;  3GTJ H;  4JI6 Q;  4UAI A;  3DWA A;  4OO1 I;  5C4J B;  3UDI A;  4GOP A;  4V19 0;  1DM0 B;  4Y52 H;  3LNN A;  1NAP A;  1SXT A;  4GKK L;  2FMM A;  2WIN B;  3GP7 A;  4KKS A;  4C3I B;  3KJO A;  1XTC D;  1A6X A;  1E24 A;  4DFA A;  3UDX A;  1LM0 A;  1EWH A;  3J81 c;  4C3I H;  2RVL A;  1TU2 B;  1G6P A;  2MNA A;  2K5Q A;  2QEX A;  4R4I A;  3PO2 G;  3S1Q B;  1CI3 M;  2DY7 A;  1HFN A;  1HQR D;  4OX9 L;  4FNF A;  1PMR A;  3VYS A;  3S1Q H;  2OT2 A;  4JI2 Q;  3Q6S A;  3KLR A;  3W1B A;  2JE6 I;  4DR2 Q;  1JE4 A;  3BVM A;  1RJT A;  3CCM A;  3S1N B;  3AEV A;  2YU9 B;  5LMN Q;  3E3X A;  1Z7T A;  1RL2 A;  5IYD H;  1U4P A;  4KY7 A;  4LF9 Q;  4ME5 A;  2IPK D;  5FLX c;  3S1N H;  1QNU A;  3BDL A;  1B9M A;  2KVM A;  1CK1 A;  1AZQ A;  3KBG A;  5K5P A;  1STY A;  3SR1 A;  3PO3 B;  3DEP A;  4BY1 G;  3K5O A;  1PH1 A;  3NQI A;  5E4X A;  3TSS A;  3HG9 A;  1HNZ L;  4LFC Q;  1DOL A;  2R7F A;  3J80 E;  3PO3 H;  4DR3 Q;  2B63 B;  4BXX G;  1PRT D;  1EQT A;  1S3O A;  1HZ9 A;  1QZG A;  3ULL A;  4KY5 A;  5JJK A;  2D0O A;  1VQ9 A;  2B29 A;  1HTL D;  1I94 L;  4UY8 C;  3OHX C;  3VR5 A;  4B3S L;  2K05 A;  3KDF B;  1JB7 A;  1RIP A;  2V1C C;  4EX5 A;  1C8C A;  1N32 Q;  1Z6H A;  1I4H A;  3NE5 B;  3HEJ A;  4LFA Q;  1AP0 A;  2ZT9 C;  2HD3 A;  2PZU A;  2F0D A;  2RCN A;  5TSS A;  2KEN A;  4HSP A;  4S3S A;  3JAM c;  5CR3 A;  2EDG A;  4DPG A;  2AQ2 B;  2UUC L;  3J7A F;  4I65 A;  1UEB A;  2EJM A;  4FF1 A;  2PNH A;  5IP7 H;  1D6E C;  3SXH A;  2OXP A;  3TRZ A;  2WV6 D;  2A69 D;  2K5D A;  4RKL A;  1QCB D;  1FNV A;  3OWE B;  5IGE A;  1Q90 A;  3D6W A;  2BE5 C;  4WJ3 M;  3D3R A;  2R92 H;  2ZTC A;  1TS5 A;  1ASZ A;  2ES2 A;  2BA1 A;  3QG1 A;  1CKN A;  5I4D A;  4LW1 A;  1CFM A;  1FR3 A;  3TP5 A;  1ESR A;  4GNX B;  1UNS A;  2B2V C;  2NYZ D;  4G4K A;  1SJE D;  3RZO B;  1BR9 A;  1WVL A;  5J3B A;  4J15 A;  3T51 B;  1JJ2 A;  5IGB A;  2PQA A;  1J5E Q;  3J81 E;  2K33 A;  3E9I A;  3H94 A;  3RZO H;  4U67 3;  1VQC A;  5E7N A;  1PZJ D;  5K36 G;  5IGG A;  1VQI A;  1BOS A;  3R2T A;  1B70 B;  1PYW D;  4WJW A;  1EWI A;  4BS9 A;  5C44 G;  2N8N A;  5E4W C;  3GO5 A;  2J0T D;  3A74 A;  3M4Q A;  3TDQ A;  5ELC A;  4A3B G;  2E2D C;  4UP7 A;  5FO9 B;  1IW7 C;  1PH3 A;  2JA7 B;  1PTO D;  1WFQ A;  4CHT B;  4HJ8 A;  4KD4 A;  4Z9C B;  1U0L A;  3PF4 A;  2E2H B;  3CQZ B;  2X69 A;  4TQU S;  3D0F A;  2VUM G;  4EQP A;  1RTO A;  2JA7 H;  2JN4 A;  1XTD A;  1PV4 A;  4MNO A;  5FLX E;  2E2H H;  3CQZ H;  4JPB W;  2I5M X;  1XMO L;  1X3P A;  2B8F A;  2EOT A;  4XXE A;  4OIJ A;  1WTP A;  3CRK C;  3NEL A;  2YYZ A;  2CWP A;  2JYO A;  1FJG L;  4KTA A;  5CYU A;  2Z9H A;  4RKB A;  1K9M C;  1BBU A;  2KHI A;  1PXU A;  3T1Y L;  3RN5 A;  2RA4 A;  4JI1 Q;  3R8B A;  1KHI A;  2XVS A;  5LMU Q;  3WDN A;  4DAY A;  5C0X H;  4JBW A;  3EN2 A;  1FD7 D;  1TWC B;  5ISR A;  2NN6 H;  4B3M L;  1EEI D;  2B2V A;  3S24 A;  2RSN A;  2EYL A;  1VMP A;  5FO8 B;  4IJH A;  3HOU H;  4KHV A;  5LL6 X;  1TWC H;  4A3M B;  1EIY B;  1MJE A;  1KDB A;  5D65 A;  3AFP A;  3TS2 A;  5LHY 1;  1AW7 A;  3OTO Q;  2ZTE A;  3I4O A;  4DV4 Q;  2WAQ E;  3N6R A;  4B3R Q;  3KF8 B;  2O5J C;  4YHH L;  4GKJ L;  1U4M A;  1SMX A;  4J6H A;  1GUN A;  4DF7 A;  3JAM E;  4UP9 A;  3GV6 A;  3VDY A;  1IKL A;  3F2B A;  4DAV A;  1ET6 A;  2F0I A;  2MFI A;  5BR8 L;  4MIU A;  2F0H A;  3NQT A;  5GAH C;  1KIX A;  1Q46 A;  1IBL L;  2K52 A;  1N8R C;  3J7A V;  5ELD A;  1HR0 Q;  1A2U A;  3CCV A;  2D5D A;  1HRJ A;  3L3O C;  2L0C A;  2QIL A;  4IJL A;  4DAP A;  4GOP B;  3MTS A;  3FDT A;  1FNW A;  4HIM A;  3PIP A;  2ZXR A;  3E5S A;  3H3V I;  1HZC A;  5IT9 L;  2EJF C;  4O1N A;  3VR2 A;  4AQY L;  2Q2H A;  4X65 Q;  3H15 A;  3EIV A;  2KCC A;  1ET9 A;  1I6V C;  1MGS A;  1WOC A;  5IGD A;  5IP9 H;  1EWC A;  4YY3 L;  1F77 A;  2F0N A;  1DZ1 A;  3NWS A;  4K0K L;  1SE8 A;  3TME A;  1XYI A;  1WJJ A;  2FXQ A;  4JI4 Q;  1Q8I A;  5IWA Q;  1KL9 A;  3I8Z A;  3U4Z A;  1NJI C;  3PUZ A;  2EIF A;  1X3Q A;  1E2W A;  2HQL A;  4OO1 G;  4NXN L;  3GDE A;  3OPO A;  3TQY A; 
#chains in the Genus database with same CATH homology
 1EU4 A;  4IFD H;  3PUY A;  2K32 A;  4NKL A;  3I73 A;  2WAQ B;  3K5N A;  2AWN A;  1HTP A;  3VYU A;  3ERQ A;  5NUC A;  4H44 C;  1S5C D;  5CBA E;  3L7Z C;  3K7A B;  4WFN 3;  5J1Z A;  1TWA B;  3T56 B;  1RD9 D;  2JA5 B;  3M4O B;  3C2P A;  2DNE A;  2L12 A;  3ERO A;  4UDU C;  4ULL A;  1D1I A;  4Y7N B;  3Q0A A;  4R9W A;  5FK9 C;  1CQV A;  2PPB C;  1TVX A;  1RCV D;  3HRZ C;  3SHL A;  1W6J A;  2Z4I A;  5C3X A;  1WD0 A;  1MD2 D;  1FGB D;  1QNK A;  4Q0F A;  4G57 A;  1HHV A;  2Z1C A;  1JOR A;  1G29 1;  1LTA D;  5EKK A;  4CJ0 B;  3E6Z X;  4A3F B;  1LT3 D;  2O5I C;  1A3T A;  4OGQ C;  1SFO B;  1A3U A;  2AUK A;  4PQX A;  3HZX A;  3J80 L;  5T1I A;  1LT6 D;  2IW3 A;  4K2K A;  3WOE A;  2R3Z A;  4DGZ A;  3T53 B;  4B08 A;  2CW0 D;  2EY1 A;  1E0B A;  1MSH A;  4IAL A;  4K8J A;  2K01 A;  1LAB A;  2A68 D;  2L5T A;  4HTH A;  1BBX C;  2ENB A;  5EPJ A;  3SK4 A;  4FVM A;  1TWF B;  3I3C A;  4RCO A;  1LTI D;  1ILP A;  2K5W A;  1H9S A;  1PRT F;  5JVG 3;  2DY8 A;  4XTC S;  2PCF B;  1FNU A;  4DK1 A;  2RQX A;  1TY2 A;  1I4R A;  2XIW A;  2EXZ A;  3EFX D;  1PRT C;  2F0F A;  5DEH A;  2KED A;  3M7G A;  1BCP F;  5DM6 3;  3A54 A;  3DM1 A;  3HOV B;  3J81 L;  2F0U A;  4ZKC B;  4RA8 A;  5KGU A;  5HGT A;  4R8N A;  1SYG A;  1BCP C;  2F0W A;  2NWG A;  1WTR A;  1I4X A;  1RTN A;  2B2U C;  4QUC A;  3K59 A;  3HP3 A;  4CKE A;  4EQN A;  4RAU C;  2Y0S B;  4HN7 A;  2A69 C;  4DA2 A;  5FLX L;  1PFB A;  3CKI B;  4H13 C;  4RFB A;  3FEW X;  1II3 A;  2KUM A;  2PZT A;  3SK6 A;  2GA4 B;  4K6D A;  3S2D B;  2MP1 A;  1C4Q A;  3A8J E;  4C1N K;  3CU7 A;  1EL0 A;  4EGV A;  4R8I A;  5K36 H;  4TSS A;  1GOZ A;  1CHP D;  2QEJ C;  1SYC A;  2B2W C;  3P7J A;  5ELB A;  2PYK A;  1F9S A;  1SE4 A;  4HSV A;  1PTO F;  3L9A X;  4KMU C;  3EQL C;  1S5D D;  5J22 A;  3BDC A;  2K04 A;  1KTK A;  1S5E D;  3I4M B;  4ZAI A;  1PTO C;  2M2L A;  4RGO S;  2BDO A;  2XSC A;  2PZW A;  3D8G A;  3JAM L;  2B2U A;  1PZI D;  2ZXO A;  5EBC A;  1WCM B;  2PNR C;  1L0X B;  3KK7 A;  4C3H G;  1O7Y A;  2NVX B;  2JA6 B;  2H1E A;  2A6H D;  2MGS A;  5M3M B;  4FXG C;  4A3E B;  2EVB A;  1A3V A;  5I6W A;  1I3Q B;  2F0G A;  2PQE A;  1SYB A;  3DMU A;  2Q8T A;  4K8I A;  4F7X A;  2F4I A;  3NBH A;  4ILW A;  1BF4 A;  2B2W A;  1J9O A;  3IKJ A;  1K83 B;  4FF3 A;  3MFG A;  4IUN A;  1LTG D;  4QF4 A;  1KDC A;  4OHJ A;  1JWS D;  3FVQ A;  3O13 A;  3Q24 A;  1B3A A;  2AQ3 B;  2EYH A;  1K8M A;  4PNY A;  1TS3 A;  1HCZ A;  5COR A;  1H9R A;  1DJR D;  2JP1 A;  3MXG A;  2B2Y C;  1DOK A;  3PUW A;  2XWJ B;  3NHH A;  5C3E B;  1YNN D;  3DWQ A;  4IN3 A;  1X32 A;  1B1Z A;  2EY6 A;  1I6H B;  4OL7 A;  3H0G B;  4KV6 A;  2Q8I B;  2KQ3 A;  3VYR A;  2TMP A;  1GUW A;  5KRU A;  3VR4 A;  2FFK B;  3MZ5 A;  3MXP A;  4XT3 B;  5I2X A;  1EQV A;  4BBR B;  4K5V A;  2H4O A;  1JOQ A;  3SK5 A;  4A3D B;  3DHQ A;  2Q8R E;  1GXD C;  2KEE A;  4O42 A;  3NXW A;  4XQN A;  3A8K E;  4CJ1 B;  3J7Y W;  5D3D A;  4K5X A;  5C4H A;  2O4X A;  2B2Y A;  1H9S B;  5I9P A;  4F88 A;  4QCL A;  3K57 A;  4PMB A;  5CV4 A;  1TS4 A;  2R92 B;  2OF1 A;  2XRS D;  3FMC A;  1Q1E A;  1M8A A;  1AN8 A;  3TZU A;  1K8O A;  5JEA J;  5EKI A;  1D5Z C;  3SDZ A;  2F03 A;  1KNE A;  5JEA G;  2NVT B;  3V96 A;  1I4Q A;  4I7Z C;  4X3T A;  2BOS A;  2X6L A;  3U9S A;  2NN6 I;  2F0L A;  1F9Q A;  1SNQ A;  5CMD A;  3K5M A;  1GHK A;  3BG3 A;  1CQF A;  1V1O A;  5D14 A;  2F0V A;  5IOD A;  5M5W B;  1CZG A;  5J39 A;  2CW0 C;  2HDM A;  3IL8 A;  1MI2 A;  1LAC A;  3UI2 A;  4IUQ A;  5A2Q E;  3Q22 A;  2ZXP A;  1C48 A;  3RZD B;  3NSW A;  1EY7 A;  1OO9 B;  1GUS A;  3I4N B;  2A68 C;  1EY8 A;  1F2Z A;  4IUT A;  1VMC A;  4HED A;  2HCC A;  3OIQ A;  1PRT B;  3GTP B;  2IJ0 A;  3K58 A;  3HOU B;  3TP8 A;  1AZP A;  2PMZ B;  1V1P A;  1G6Z A;  5JOB A;  3R2I A;  5F2D A;  1U4L A;  2WKD A;  1KLG D;  3SE0 A;  1DON A;  1BCP B;  2F0M A;  3W3A A;  3DEO A;  1EY4 A;  5BN4 A;  1HFG A;  1A15 A;  1ROD A;  3SVM A;  2JA8 B;  1XX8 A;  2R7Z B;  1SNO A;  2J7Z A;  2IL8 A;  4IZ8 A;  1ILQ A;  2F0S A;  4K6L A;  3Q23 A;  2EZV A;  1B50 A;  1S4Z A;  4NMZ A;  4IFD I;  2EYO A;  2EJG C;  1SNM A;  1J8I A;  4X3K A;  5E3F A;  4IQZ A;  5DM7 3;  4ABN A;  3MXN A;  1ENC A;  4XQQ A;  5C4Z A;  4KD3 A;  4PMC A;  4ZK9 B;  4HAE A;  3T13 A;  2IX3 A;  5ELE A;  1OXU A;  3S14 B;  4XT1 B;  5ELF A;  1RF2 D;  2XN9 C;  4C3I G;  3GTO B;  1QB5 D;  2SNM A;  2RDH A;  4QMG A;  5CV5 A;  1B53 A;  5D3I B;  2I07 B;  3QIA A;  3P1H A;  4HMI A;  4CBV A;  3QB3 A;  1R4Q B;  2E2I B;  2K7V A;  2R61 A;  3VA5 A;  1DCZ A;  3ITP A;  1E2Z A;  1PTO B;  3PIO 3;  4C3J B;  3PV0 A;  2ICI A;  3URY A;  2LY7 A;  1PTO H;  3BVG A;  2NTT A;  4WRD A;  4A3I B;  3D31 A;  3HOW B;  3S1M B;  4FYD A;  1FYC A;  2F0K A;  4XQJ A;  5KNC A;  3I4L A;  2AQ1 B;  5KIX A;  3A7A B;  1EYC A;  3NP8 A;  5EPK A;  1B9N A;  3OOC A;  3CRL C;  2ID0 A;  1CT1 D;  2EYP A;  3G6J B;  2LKV A;  3P75 A;  2N88 A;  1OXV A;  1Q3L A;  1ENA A;  4MN3 A;  2B39 A;  1STA A;  2AWO A;  2WP8 J;  5EKL A;  2CVR A;  3M3Y B;  3ND9 A;  5LL6 S;  3M4Y A;  3RUZ A;  1JC7 A;  3GTQ B;  2BE5 D;  1V43 A;  1TWG B;  3PO2 B;  3BZD B;  1DOM A;  2L4N A;  4RHS A;  4CKC A;  4B9W A;  2NBF A;  1L0Y B;  2NVQ B;  1R9T B;  5CGK A;  1VF5 C;  1EZ8 A;  1XXG A;  4N9T A;  1G8Z D;  2FIN B;  1G91 A;  1T5E A;  4ZUI A;  2MHV A;  4ODG A;  4XIG S;  3SK8 A;  2L55 A;  4DK0 A;  5CV7 A;  2QKI C;  2KJX A;  1M4V A;  4BY1 B;  3TBI B;  4ZKB B;  1F9P A;  1YNN C;  4J8Q A;  1KLU D;  1CA5 A;  5G3L D;  1F9R A;  1QE6 A;  3TN2 A;  3MVV A;  3PMF A;  4NW2 A;  5E1F A;  2DNC A;  4MHE A;  3KLS A;  2VXW A;  5M5X B;  3GTM B;  1ML0 D;  1SEB D;  3H6M A;  4NP5 A;  2L9H A;  3R3O A;  3LWU A;  3VR3 A;  1BQQ T;  4KKU A;  1W6K A;  2JEB I;  5I9O A;  1YNJ D;  5C6A A;  3MWY W;  5M3F B;  4EQO A;  3ONA B;  3BYY B;  2K1B A;  5C5M A;  2Z4H A;  2A73 B;  3QOL A;  2NN6 G;  4EVO A;  1D5X C;  5KEE A;  5IIF A;  2IX1 A;  2FJ2 A;  4KHZ A;  1B2T A;  1VF7 A;  1WTO A;  1V1P B;  3GTK B;  3TP6 A;  1STG A;  5A2Q L;  1SE3 A;  2A6E D;  5EBD A;  2K03 A;  4OIK A;  5JEA H;  2JSO A;  1EU3 A;  3DXJ C;  5C44 B;  4DNT B;  2RBM A;  4A3B B;  3MHB A;  3MEH A;  3S9W A;  1ENF A;  1WTQ A;  3IAY A;  2A5H A;  4HCS A;  4V0B A;  2VUM B;  2NTS A;  4KY6 A;  1EY9 A;  1BUV T;  4DXF A;  3T16 A;  4ZYS A;  3QOJ A;  1Q1B A;  1PZK D;  1CM9 A;  3IFD A;  4XDX A;  5I6Y A;  5BN3 A;  2A74 C;  3EJI A;  3I90 A;  2B2T C;  1D5M C;  4QUF A;  3K5L A;  3W2D A;  1UUP A;  1O7L A;  2HQE A;  1CHQ D;  4IFD J;  3RLF A;  2JEA I;  3TP7 A;  5FOB B;  4F87 A;  4BA2 I;  4IFD G;  1ZEQ X;  1OXX K;  3OIP A;  2XRQ D;  3X3M A;  1OXS C;  3RD4 A;  1SE2 A;  3QJY A;  5CV6 A;  4N9P A;  1S5B D;  1TT2 A;  1SSO A;  1EIG A;  3DWP A;  3H3V C;  1KNA A;  1ZKO A;  1IL8 A;  1ZYR D;  3MC0 B;  3K6O A;  3MAQ A;  1DYQ A;  1LTR D;  3FPP A;  3EVQ A;  3I72 A;  4H0L C;  1R4P B;  2NUC A;  1SYE A;  3E0J A;  3GV3 A;  2L1B A;  2FMC A;  2B2T A;  4FF4 A;  1ONL A;  1S5F D;  1LTS D;  4U68 A;  3T4A C;  2F3W A;  3BS1 A;  1OXT A;  4LAA A;  2I46 A;  5EPL A;  5IGC A;  2E75 C;  2EY2 A;  2RKS A;  2QF7 A;  1EY0 A;  3TZD A;  3S16 B;  1WTV A;  4B9X A;  4NDX A;  1EFI D;  2M9V A;  5M5Y B;  4FF2 A;  1SMY D;  1Z47 A;  3BVZ A;  1LLR D;  4RGM A;  3LWE A;  1DXM A;  1VDZ A;  2AUJ D;  4OO1 H;  3P20 A;  2MJ8 A;  4BA1 I;  2HCI A;  2LS0 1;  4BWG B;  3FKI B;  1V8Q A;  4PV1 C;  2M00 A;  4A3G B;  1EYD A;  4J1M A;  2Z8L A;  1HUM A;  2D2C C;  2BDN A;  4L6T B;  3MXU A;  2QDB A;  2KOL A;  3DUZ A;  1IHZ A;  1TKW B;  1EIH A;  3OSO A;  5CBE E;  1E2V A;  3F2U A;  1PFN A;  4JK1 C;  3AMU A;  4WOR A;  2K28 A;  5HUR A;  1EEF D;  1EYA A;  3A7L A;  3C46 A;  4K14 A;  4KJN A;  1BCP D;  3GTL B;  4QIW B;  2FHT A;  2WII B;  4K5W A;  5AFW A;  2L11 A;  3S15 B;  4KN7 C;  2PW5 A;  1KDA A;  4FXK C;  3X3N A;  3N52 A;  1LTB D;  2BCO A;  5JAV A;  1SAP A;  1UAP A;  1STN A;  1Y8P B;  2RDG A;  3GQB A;  2O2L D;  1ZXT A;  4XYQ A;  5COY A;  2F3V A;  5C0X I;  4RCN A;  4CJ2 C;  1NCV A;  2KHS A;  1PFM A;  1H9K A;  2F0T A;  4E6I A;  5C4X B;  1NSN S;  3HOZ B;  5DAU A;  1DD2 A;  3FRP B;  5EGT A;  3ZYY X;  2MUY A;  1B4O A;  4C56 C;  2SEB D;  4A3K B;  4L8J A;  2LFN A;  1WD1 A;  1TR5 A;  1EY5 A;  2CHB D;  5A35 A;  1MSG A;  1JB3 A;  4ZQ3 A;  5G3L F;  4P2C B;  2F0O A;  1F2M A;  3HOY B;  3GD7 A;  1VCI A;  1HQM C;  2RDF A;  3D4R A;  4L63 B;  1I50 B;  5CC4 A;  2R93 B;  2C9O A;  5JVH 3;  3VYT A;  1QWY A;  3QWN A;  2EYF A;  4FXD A;  1SND A;  3V05 A;  1LV9 A;  3KLS X;  4RWS C;  3RMH A;  3KBX A;  3QO2 A;  1Y69 U;  1EZ6 A;  1YNJ C;  3OWF A;  3A56 A;  2F0E A;  1STB A;  3NWT A;  3OMC A;  1SDF A;  1EY6 A;  1PLF A;  2IT1 A;  4X3U A;  5IGF A;  4RHR A;  4DN4 M;  1BXT A;  5M9O A;  2RSO A;  2EPB A;  5KNB A;  1MBY A;  4HCE A;  2WAC A;  2X6G A;  1HPC A;  3LX0 A;  2HUG A;  3HGB A;  4LMQ D;  2A6E C;  2IX0 A;  2ICE C;  5T1G A;  3K0Y A;  1QG7 A;  3GTG B;  2F0J A;  2VB2 X;  4CKB A;  2MPM A;  4XYO A;  3WOF A;  2K6A A;  2XWB B;  1RDP D;  2E76 C;  1CZW A;  3HKZ B;  4HMJ A;  3S17 B;  4RGT A;  1WTX A;  4HR7 B;  1AEX A;  3HS0 C;  1GUT A;  4A93 B;  2HDL A;  1Y8N B;  4LK1 C;  3IFT A;  3S1R B;  3MFY A;  4C3H B;  2JXM B;  1O80 A;  1STE A;  1JWU D;  2F0P A;  3FPU B;  4C2M B;  4FO2 A;  5EQ0 A;  3G7L A;  3R93 A;  1CTM A;  2NZ1 D;  3D4D A;  1EOT A;  4IUP A;  3V2T A;  2EYJ A;  2A6H C;  2G9D A;  5JJZ A;  4A3J B;  4LJZ C;  5BN5 A;  5KND A;  2QCP X;  1HA6 A;  1HXY D;  1LT4 D;  1JQY D;  4DU9 A;  4RGN A;  5KYI A;  4GZY C;  4DNR B;  1AFP A;  1I4P A;  2PW7 A;  2D9U A;  2VNU D;  1BO0 A;  3U9O A;  5KYL A;  1IYU A;  4BY7 B;  1ZYR C;  1F2Y A;  3PUV A;  1JCK B;  2F0Q A;  4AYB B;  1TY0 A;  1RHP A;  1U4R A;  1SYD A;  5I2Y A;  4IUR A;  1Q12 A;  1TWH B;  3KUP A;  4BBS B;  1I4G A;  1JR0 D;  4ID6 A;  1D1K A;  4KI0 A;  2R6G A;  1JIC A;  3A55 A;  2N55 A;  1QJO A;  3C3L A;  1SNC A;  3CHB D;  1F2L A;  1GUG A;  1IW7 D;  1GUO A;  1QOH A;  4FP5 D;  1A2T A;  4RH6 A;  1HA5 A;  3NTH A;  3PIP 3;  4QB4 A;  3BYT B;  4G7O C;  3D4W A;  1G2S A;  1WTW A;  2D62 A;  2EE1 A;  2EY5 A;  1SYF A;  4KN4 C;  1SMY C;  1H9J A;  2EYM A;  2F1M A;  3SEB A;  1H9M A;  1TQO A;  3H91 A;  4G7Z C;  3VR6 A;  5JPN C;  5DNF A;  4DXG A;  2DN8 A;  4TRD A;  1JWM D;  3OMG A;  5C0X J;  4H7B A;  1STH A;  1HUN A;  4TKO B;  1GJX A;  2TSS A;  2KCN A;  1Y8O B;  5C0X G;  3EA6 A;  4YIJ A;  2G9H D;  1RKN A;  4F8M A;  1NUC A;  2E74 C;  1UEA B;  2SNS A;  1TII D;  5IOC A;  4KJO A;  1Y1W B;  1QIL A;  2V4D A;  3NK9 A;  1LTT D;  3ND8 A;  1KAB A;  2LMC B;  3BDO A;  1GHJ A;  4CGY B;  1SJH D;  3MA2 B;  1U9R A;  1NR4 A;  1ICW A;  4IUU A;  1Y1V B;  2XNA C;  1CA6 A;  2SOB A;  3VA7 A;  2NVY B;  3H09 A;  1LT5 D;  3C1E A;  1SBB B;  2KA7 A;  4KK7 A;  1T5X D;  3I70 A;  1ESF A;  3AB9 A;  4IUV A;  5FO7 B;  3D6C A;  4Q5V A;  2SDF A;  3M7N A;  2CQA A;  1JOK A;  2VB3 X;  1TS2 A;  1KAA A;  1JOO A;  1PDQ A;  2NB0 A;  1IKM A;  4M8A A;  3AU7 A;  2B8G A;  1BDO A;  5C3W A;  3C1F A;  3A8I E;  3NTI A;  1G2T A;  2J4X A;  1SNP A;  4K2L A;  2KEC A;  2E2J B;  3HOX B;  4ZLT F;  1D2B A;  1O78 A;  4X3S A;  4ZRZ A;  5EJW A;  5JPM C;  4M1U B;  5CV8 A;  1LO5 D;  5CV9 A;  1O7Z A;  1NR2 A;  3NPP A;  1B44 D;  4G7H C;  4ZUJ A;  2C5C A;  3OW7 A;  3M85 A;  4C3J G;  2WKC A;  5FKA C;  3KF8 A;  2WB1 B;  1IYV A;  3PUX A;  3S2H B;  3NBI A;  5IT9 E;  2BA0 A;  4PMW A;  5C5L A;  3I91 A;  2IWH A;  3NTK A;  4KKT A;  1XWE A;  3GTJ B;  2PO4 A;  1BNZ A;  4C1N I;  2OEO A;  3NUC A;  4UAI A;  3DWA A;  4OO1 I;  5C4J B;  4V19 0;  1DM0 B;  3LNN A;  1NAP A;  1SXT A;  2FMM A;  2WIN B;  3GP7 A;  4KKS A;  4C3I B;  1XTC D;  1A6X A;  4DFA A;  1EWH A;  2RVL A;  1TU2 B;  2K5Q A;  3S1Q B;  1CI3 M;  2DY7 A;  1HFN A;  1HQR D;  4FNF A;  1PMR A;  3VYS A;  2OT2 A;  3Q6S A;  3KLR A;  2JE6 I;  1JE4 A;  3BVM A;  1RJT A;  3S1N B;  2YU9 B;  1Z7T A;  1U4P A;  4KY7 A;  4ME5 A;  2IPK D;  1QNU A;  3BDL A;  1B9M A;  2KVM A;  1CK1 A;  1AZQ A;  5K5P A;  3KBG A;  1STY A;  3SR1 A;  3PO3 B;  3DEP A;  3K5O A;  3NQI A;  5E4X A;  3TSS A;  3HG9 A;  1DOL A;  3J80 E;  2B63 B;  1PRT D;  1EQT A;  4KY5 A;  1HTL D;  3OHX C;  3VR5 A;  2K05 A;  1C8C A;  1Z6H A;  1I4H A;  3NE5 B;  3HEJ A;  1AP0 A;  2ZT9 C;  2PZU A;  2F0D A;  5TSS A;  4HSP A;  4S3S A;  5CR3 A;  2EDG A;  2AQ2 B;  3J7A F;  4I65 A;  2EJM A;  4FF1 A;  1D6E C;  3SXH A;  2OXP A;  2WV6 D;  2A69 D;  2K5D A;  4RKL A;  1QCB D;  1FNV A;  3OWE B;  5IGE A;  1Q90 A;  3D6W A;  2BE5 C;  3D3R A;  1TS5 A;  2BA1 A;  3QG1 A;  5I4D A;  1CFM A;  1FR3 A;  3TP5 A;  1ESR A;  1UNS A;  2B2V C;  2NYZ D;  4G4K A;  1SJE D;  3RZO B;  1BR9 A;  1WVL A;  3T51 B;  5IGB A;  3J81 E;  2K33 A;  3H94 A;  4U67 3;  1PZJ D;  5K36 G;  5IGG A;  1BOS A;  3R2T A;  1PYW D;  4WJW A;  4BS9 A;  5E4W C;  3GO5 A;  2J0T D;  3TDQ A;  5ELC A;  2E2D C;  5FO9 B;  1IW7 C;  2JA7 B;  1PTO D;  4CHT B;  4KD4 A;  4Z9C B;  2E2H B;  3CQZ B;  2X69 A;  4TQU S;  4EQP A;  1RTO A;  5FLX E;  1X3P A;  2B8F A;  2EOT A;  4XXE A;  4OIJ A;  1WTP A;  3CRK C;  2YYZ A;  2JYO A;  4KTA A;  5CYU A;  4RKB A;  1PXU A;  2RA4 A;  3R8B A;  2XVS A;  3WDN A;  4DAY A;  5C0X H;  4JBW A;  1FD7 D;  1TWC B;  5ISR A;  2NN6 H;  1EEI D;  2B2V A;  2RSN A;  2EYL A;  1VMP A;  5FO8 B;  4KHV A;  5LL6 X;  4A3M B;  1KDB A;  5D65 A;  5LHY 1;  1AW7 A;  3N6R A;  2O5J C;  1U4M A;  4J6H A;  1GUN A;  4DF7 A;  3JAM E;  3GV6 A;  1IKL A;  4DAV A;  1ET6 A;  2F0I A;  4MIU A;  2F0H A;  3NQT A;  3J7A V;  5ELD A;  1A2U A;  2D5D A;  1HRJ A;  3L3O C;  2L0C A;  2QIL A;  4DAP A;  3MTS A;  3FDT A;  1FNW A;  2ZXR A;  3E5S A;  5IT9 L;  2EJF C;  4O1N A;  3VR2 A;  2KCC A;  1ET9 A;  1I6V C;  1MGS A;  5IGD A;  1EWC A;  1F77 A;  2F0N A;  1DZ1 A;  3NWS A;  3TME A;  1XYI A;  1Q8I A;  3I8Z A;  3PUZ A;  1X3Q A;  1E2W A;  4OO1 G;  3OPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...