2PZWA

Crystal structure of staphylococcal nuclease variant v66n/p117g/h124l/s128a at room temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMNENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pzwA00
4I65A 2LKVA 3RUZA 4KY5A 5CV6A 3NK9A 5KYLA 1EQVA 2M00A 2RBMA 3ERQA 3OWFA 4HMIA 4B9XA 1STYA 4TRDA 2EYJA 1SYBA 4R8NA 4QF4A 4ZUJA 5C3WA 1JORA 1EYDA 1TR5A 2EY1A 3D4WA 3H6MA 4S3SA 2EYOA 4ZUIA 3MXPA 3OSOA 4RKLA 3NXWA 5JOBA 3LX0A 5I9OA 4K5VA 2F0EA 3T16A 4EQPA 1STNA 4PMBA 4YIJA 5E1FA 5I9PA 5M9OA 5CV7A 4J6HA 4DGZA 1KDBA 1EY6A 2F0GA 2F3WA 1KAAA 1SNOA 4KY7A 2SNMA 2RDFA 2F0DA 5J39A 5HGTA 5HURA 1SYCA 2ENBA 2OXPA 1SNPA 2F0KA 3OMCA 4IALA 3NHHA 1EYCA 5J22A 1U9RA 1JOKA 1STHA 2HQEA 4KHVA 4OL7A 4KD4A 5DEHA 3MHBA 2F0QA 5ISRA 2F0WA 1ENCA 5C5LA 5IOCA 1JOQA 3TP5A 4KJOA 2F0NA 3P1HA 3QB3A 1AEXA 3C1FA 4ZQ3A 1II3A 5NUCA 2EXZA 3TMEA 5IODA 4K5WA 4K8IA 4PNYA 3QOJA 2OF1A 2PW5A 1STBA 1A3UA 4N9TA 5IGEA 5IGCA 3SK6A 2PZWA 4G57A 3SK4A 5C3XA 1F2ZA 4WORA 5C6AA 4B9WA 3EROA 1EZ8A 2EYMA 5KGUA 2PQEA 2F0SA 3SK5A 4J1MA 4ODGA 2QDBA 2F0MA 5IGFA 4K2LA 4NP5A 2F0IA 3D6CA 4RKBA 1SYDA 2F0JA 1A3VA 3R3OA 2F0HA 4F7XA 4K5XA 2F0OA 3D4DA 4N9PA 5JAVA 2SOBA 2EY2A 1EYAA 3NUCA 3E5SA 4WRDA 4NDXA 1TT2A 4HTHA 4PMCA 1EY4A 2KHSA 2SNSA 3QOLA 4H7BA 5CC4A 5I6YA 1EY8A 2F0VA 3BDLA 3C1EA 2EYPA 5C5MA 4DFAA 1STGA 2F0TA 1SNMA 5EKKA 5CV9A 5CGKA 4EQNA 3T13A 1EY7A 3SXHA 4NKLA 3EJIA 3SHLA 3V2TA 1IHZA 1NSNS 2EYHA 4K2KA 3VA5A 4ID6A 1KABA 5KIXA 5IGBA 3S9WA 1EZ6A 2EYFA 2KQ3A 5CV5A 4EQOA 1SNDA 3HZXA 1EY9A 4NMZA 4IZ8A 3U9OA 5EGTA 3PMFA 2EYLA 4QB4A 5IGGA 5KYIA 2PYKA 1NUCA 3P75A 3EVQA 4KY6A 5CR3A 4K14A 5K5PA 1F2MA 1JOOA 2F0FA 4ME5A 4F8MA 1TQOA 5KEEA 2EY6A 1A2TA 1EY0A 3NP8A 5E3FA 5DAUA 4MIUA 5I6WA 3SK8A 1SYEA 2F0UA 2NUCA 5CV8A 1A3TA 4EVOA 5KRUA 2EY5A 3DMUA 3MVVA 5EKLA 4DF7A 4IUNA 1SYGA 2RKSA 4KTAA 5F2DA 5C4ZA 1SYFA 1SNQA 3OMGA 1RKNA 2WACA 2PZUA 4KV6A 2F3VA 3NQTA 2O4XA 4KJNA 3MZ5A 5CV4A 2F0LA 5J1ZA 1KDAA 3TP7A 3DHQA 2PW7A 2PZTA 4LAAA 5IGDA 1F2YA 3HEJA 3TP8A 1KDCA 3ITPA 5C4HA 4KD3A 4K6DA 4QMGA 2F0PA 1EY5A 4HMJA 3TP6A 4DU9A 1A2UA 3SR1A 3BDCA 1ENAA 3MEHA 1SNCA 4K8JA 3D8GA 1STAA 4E6IA 5IIFA 2OEOA
chains in the Genus database with same CATH superfamily
1RF2D 2BCOA 1S40A 3D4RA 4HSVA 2E2IH 5C4XG 3I4NG 2X6GA 1CTMA 1YHQA 2F52A 4ZUIA 1T5XD 5AJ3Q 3R2TA 1M1KC 5ELNA 1I4QA 2D62A 4H44C 4Q5VA 5I2YA 3M9BA 4TKOB 4FF4A 1B2TA 1E22A 1RHPA 3GTJB 3TDQA 1MKHA 3NPPA 4C3JH 3CPWA 4GN5A 2Y0SG 3OW2A 4IFDG 1KC8C 4AQYQ 4WJ3M 1K83H 1JE4A 3ULPA 3NHHA 1EYCA 3TZDA 1BBXC 3VR4A 4R4TA 2L15A 2F0WA 2VQEQ 1K8MA 5IOCA 1QCBD 2LS01 3G71A 5IODA 3O13A 1CKOA 2A68C 1ZYRD 2NTTA 2EVBA 3HGBA 3EIVA 4GLVB 3PGZA 1CUKA 1IKMA 4X3UA 3V05A 4FYDA 3R3OA 3FKIH 1QG7A 3BZCA 2NVTH 3HOVB 3I73A 1TT2A 5M5XB 4PMCA 1N34Q 4H7BA 4JVZA 1EY8A 1X9NA 1VF7A 1PRTB 4EQNA 3TN2A 4K0KQ 4A3KH 1PRTC 3QG1A 4DAYA 4NB3A 2H4OA 1NMGA 1VQ5A 4FVMA 1LACA 4IZ8A 2B39A 5C4XH 4A3CG 3I4NH 5AJ3L 3VYRA 2BE5D 1Q8KA 2A69D 2CCZA 1H9SB 1TQOA 4IJLA 4DV7Q 1PTOF 5CV8A 4FDBA 5JEAG 1ENFA 4IOCA 5EKLA 4KKSA 3VA7A 3GTKB 4AQYL 4KJNA 4GZYC 1X56A 2HUGA 4KK7A 1SE8A 2K5HA 2UUCQ 4IFDH 2R6GA 4DAMA 4L5RC 1IL2A 2VQEL 2F0PA 4XT3B 1K73C 4DU9A 1X3PA 2A8VA 5E7NA 3BU2A 4K8JA 2JEAI 5KYLA 2ZXPA 3H3VH 5DM73 3S17B 4TRDA 3RNUA 3OW7A 1YJNA 1FGBD 1ONLA 3BVZA 4WJ4A 1NCVA 3OIQA 4N8FA 3T16A 4HCEA 1V1PB 3C2PA 1Q46A 3FDTA 3K7AH 4BBSG 2L1BA 1DONA 1J5EQ 3VR2A 3FMCA 1I4XA 5M5WH 1KAAA 1LABA 3H0GB 2WFWA 4Y7NH 1N34L 2H5XA 2Q2IA 3OYYA 3NSWA 2KCNA 5IP9G 1WTPA 4DV0Q 4K0KL 5ELEA 3RR5A 3D0FA 3BZDB 1PTOH 2ZXOA 4KKTA 2E8GA 3LWUA 1WJJA 1X55A 2TSSA 4A3CH 4DV7L 2FXQA 4QY7A 3UE1A 3GTQH 1O7YA 1BR9A 3HOZB 1CK1A 2RHQB 3GTMH 2IJ0A 1OXTA 3S1NH 3VDYA 4PG3A 1IBMQ 5JEAH 2KHJA 4K5XA 1PZKD 2XIWA 1B70B 2A68D 2UUCL 4XQQA 4A3MG 1R4QB 1MD2D 1ZEQX 2MNAA 3PIOA 3N6RA 5EKKA 1EIHA 4Y52H 3N52A 4HAEA 4MNOA 4MN3A 3OPOA 1HXYD 2NZOA 4PQXA 2R7DA 2B2VC 1STEA 2JA5B 2JSOA 1SEBD 4EQOA 1B3QA 3S1QB 3HKZB 1EIGA 1LLRD 4QB4A 1VQDA 1YNJC 5ELOA 3W2DA 4CHTB 5FLXL 3URYA 3S14B 1Q1BA 1W2BA 3AEVA 1J5EL 4L63B 1A3TA 2R92B 3A56A 1PRTD 2EY5A 4DF7A 2Y0SE 4BBSH 4A3LG 1SYGA 3HS0C 3J81i 2IX0A 3NQTA 5G3LD 3K0YA 1IXRA 1D7QA 3MZ5A 3MWYW 1Y8OB 4DV0L 3IRBA 4JI0L 3HEJA 2UXBQ 4M1UB 1KDCA 4AYBG 5C4HA 2K5QA 5IP9H 2WB1G 3J80L 2DUDA 1S5FD 2PNHA 1NY4A 1YVCA 3BDCA 3CQZH 3NTHA 3PO2G 3FHWA 4I65A 1IBLQ 2VUMG 3H6MA 2EY1A 1EFWA 4X3SA 4S3SA 5IY0A 2IPKD 4IURA 3AQQA 1IBML 2IT1A 5TSSA 4IUTA 2HCIA 1IYVA 1HQMC 2B8GA 2F3WA 2QKIC 5JJKA 4GKJQ 2SNMA 4B3RQ 3M4YA 5JJIA 4JBMA 1E1OA 1O7LA 4A3MH 1E24A 5L37A 5J22A 3BJUA 4UPAA 1UUPA 2JJQA 1VQOA 4X6AH 3GTLB 1X3GA 4C3IG 1BBWA 1FYCA 2PI2A 1ICFB 1VF5C 4R4OA 1PFMA 1KD1C 4OO1I 1A3UA 3SK6A 4GN4B 1SDFA 1C4QA 1HCZA 1G6ZA 1YHAA 3CAMA 2XWJB 3BYYB 4O1NA 1F9SA 3S1RH 1LTID 1A6XA 1MHWC 3BYTB 4NP5A 3D6CA 1BQQT 5ELBA 2WAQB 4Q0FA 2R7FA 4A3LH 1XPRA 2AWNA 2KENA 1VQ9A 5EPLA 1I3QH 1N36Q 2UXBL 2XNAC 2VQFL 2JK8A 3EJIA 1IBLL 1DCZA 3PO2H 1JE5A 1CSPA 3JAML 2YU9B 3W3AA 5KNCA 3A54A 3F1ZA 1LTLA 4WJWA 1AZQA 1C9OA 2VUMH 2B2UC 3TREA 3S1MB 1VQCA 1VQ6A 1DM0B 1HJPA 2EDGA 3NP8A 2XVSA 3FVQA 1CT1D 5KNBA 5C3EB 3S24A 3MVVA 4IUNA 4GKJL 3CW2C 4B3RL 4CDEC 1GOZA 2PO4A 3VR3A 1YNJD 4OIJA 4JOIC 3PIO3 2N8NA 3CU7A 5I2XA 1KDAA 5ELDA 3CF5A 3ER0A 1WD1A 4CKBA 3PUVA 4C2MH 1CA6A 1YITA 4RHSA 4ZKCB 2MGSA 5IYBG 1BCPF 3PO3B 2L11A 4B9XA 4C3IH 1STYA 1IKLA 2SDFA 1TY2A 1EYDA 3HOYB 2Z6KA 3MXPA 1L0XB 3BVMA 3F2DA 4ZK9B 4LNQA 4JG2A 5E4XA 3H3VI 4V0BA 4L5TA 1JB7A 3I56A 4J6HA 3V96A 1QVCA 1TY0A 3IFDA 1K8GA 3MXNA 1N36L 1KNAA 3I4MB 2LXJA 1ZXTA 1B9MA 1STHA 1HPCA 1K8OA 1PA6A 1UAPA 3CCEA 3X3MA 3CCSA 4BXXG 4A4IA 2F0NA 1MI2A 4FXKC 1X32A 4RWSC 1PV4A 3QOJA 4N9TA 1UNSA 1W6KA 4NPSA 1TWHH 3U58A 1O80A 3I7FA 4XXEA 5FLXE 4A3BB 4OWXB 1R9TH 2HDLA 1A3VA 2P5ZX 4M8AA 2QW7A 2F0HA 4FXDA 3D4DA 2ES2A 3SGIA 1HNWQ 1EYAA 4KHZA 3B6YA 1Q81C 2SNSA 3KBXA 4AYBE 4ALPA 1GUSA 3BDLA 1I4PA 3C1EA 3K5LA 3J80E 4NXMQ 3I91A 3T4AC 1Q12A 4U68A 2EYHA 3NEMA 4RGTA 1VQHA 3G4SA 1Z7TA 5CV5A 5IYBH 2JA8B 5IP7G 5IGGA 1ICWA 4B3SQ 1W6JA 2NZHA 3P75A 5IE8A 5IT9E 4CJ1B 1Q7YC 1QILA 1D5ZC 4WFN3 4OIKA 1GVPA 3CCJA 3RZOH 3HOWB 5M5YB 2OTJA 2RSOA 1HRJA 2F1MA 1BBUA 4MTKA 1S5CD 1LTRD 2JYOA 1X6OA 5IGDA 5M3MG 3G6JB 3TP8A 4IFDJ 4KD3A 2D2CC 4PMWA 4QMGA 2K7VA 1EY5A 2TMPA 4HMJA 3TP6A 2ZJRA 1A2UA 5IIFA 3QO2A 5ELCA 1I50B 2I5MX 1TWCB 3S2HB 5A2QL 4BXXH 3R93A 4HMIA 1SAPA 1HZ9A 5CORA 3I72A 3K57A 4ZUJA 1ML0D 3BG3A 2EE1A 4FXGC 3I4LA 2NVYH 4RG1A 2ZTDA 1LUZA 1QVFA 4B08A 5EQ0A 3KFUA 1HNWL 4GS3A 2I5LX 2DY8A 3CMAA 2LY7A 4IALA 2YYZA 1LT3D 2UXCQ 1NMFA 4A3IB 2CWAA 2EJFC 4LJZC 3M4OB 1ILQA 4A3JG 1DXMA 2OF1A 4B3SL 1PZJD 5D3DA 3JAME 5IP7H 3DEPA 3VYTA 5C3XA 1F2ZA 2K4KA 1V9PA 5LL6X 1KLGD 4IPGA 3HG9A 4XYQA 1FL0A 5FJ8G 2QCPX 3GV6A 1VS0A 3NTKA 5JPNC 2F0JA 3K59A 2Z0SA 2E2DC 3GTGH 4F87A 5A35A 5JEAJ 3E5SA 4JI8Q 3QOLA 1A62A 1RCVD 4RAUC 5EPKA 5CC4A 5I6YA 1RODA 3J81E 1BXTA 1OTCA 1G91A 5M3MH 4DV4Q 1YIJA 5H1SE 3SHLA 3U50C 1HR0Q 4NXNQ 2V1CC 1I6HB 4MHEA 1GXDC 1HFGA 1Y1VG 3Q8DA 4LW1A 5KEEA 2J7ZA 5DAUA 1SYEA 4LFAQ 2K01A 3NWTA 1SN8A 2KUMA 4A3FG 4OO1G 2IX3A 1YJ9A 5EBDA 5C4ZA 5BN5A 1PYWD 1K28A 2X69A 3VYSA 4POFA 5FK9C 1RTNA 4XDXA 1Z6HA 1L2FA 2L9HA 1FNUA 3RN2A 2UUBQ 1KQSA 2UXCL 2Z4HA 3SR1A 2B2YC 1GUTA 3HOXB 2LKVA 1UE5A 2V4DA 1NAPA 4GNXA 4TSSA 4GOPC 4A3JH 3CPFA 4EX5A 4CKCA 5C3WA 2HIXA 4RA8A 1XMOQ 3T1YQ 1KRSA 1M4VA 1I94Q 2K14A 1QVGA 1VQ8A 3TS2A 5I4DA 4JK1C 5FJ8H 1NE3A 1B44D 1D2BA 1MSHA 3M7NA 5JVG3 4JI8L 2ZT9C 1W3SA 3EFXD 3PF4A 1LTAD 1S5DD 4DV4L 1MBYA 2E2JH 4OWTB 3PSIA 4P72A 2L55A 2L4NA 4O2DA 4NXNL 1HR0L 1GJXA 4KJOA 1TWAB 4R9WA 3GDEA 1A15A 5T1IA 4A3EB 1EIYB 4PNYA 3A8KE 5HY6A 1MIUA 2HQLA 1PTOC 2E2HB 1Y1VH 2ATWA 2PQEA 4LFAL 4AIMA 3S2DH 5C4JB 1J6QA 2YTVA 1RL2A 4A3FH 4OO1H 2RCFA 3TEHB 2PQAB 2R7ZB 3NUCA 3K6OA 2UUBL 5CGKA 5J3BA 1J8IA 1UEAB 3KJPA 3VA5A 2FJ2A 1YEZA 2XSCA 5A2QE 4IOAA 3PF5A 2HHHQ 4A3DB 2HDMA 2EYLA 1PZID 1XMOL 3RZDH 3T1YL 5KYIA 4OXPA 1I94L 1AE2A 3LGJA 2PPBC 3A7AB 3ICEA 1V1OA 1V43A 2EY6A 3NTIA 4IUVA 4CJ2C 1C48A 4QCLA 1LM0A 2KBNA 2EOTA 1JC7A 1X65A 2F3VA 1NBWA 4BY7G 2A73B 1UEBA 3PV0A 1CSQA 1F9RA 1KIXA 4UP8A 1RDPD 3R2IA 3FPPA 4L5QA 4DR7Q 2ICIA 1UWVA 2F4IA 4KY5A 1MGSA 2OQ0A 1PH6A 2AHOB 5GADC 2K75A 1JORA 3Q0AA 1RTOA 2XWBB 1KL9A 5EKIA 2JE6I 2ICEC 4UAIA 4YIJA 1NNXA 3J80i 4PV1C 5LL6S 3MFGA 2K50A 4IO9A 1SROA 1GHJA 2OXPA 3NBHB 2F0KA 3OMCA 3AFPA 4H13C 4DXGA 1KLUD 3J7A5 1H9KA 1CHQD 2A74C 1EL0A 1WYDA 1RD9D 4XQNA 2HHHL 1II3A 1SFOH 4I7AA 4K5WA 4BWGB 4QIWB 4KN7C 1VCIA 1GHKA 3CRKC 4C3HB 3MEFA 1E1TA 2DNEA 5GAGC 2K5NA 2NVXH 2F0SA 1LYLA 3S16B 4A93B 2EQSA 4K2LA 3CCMA 1Q1EA 2CH4W 2K33A 2VL6A 2QF7A 4BY7H 1PTOD 2NZ1D 1QUQA 1YZ6A 1TWGB 3K8AA 3IAYA 1L1OA 1EYGA 4LF7Q 4DR7L 3H91A 1BOSA 3W5OA 4K2KA 1TS3A 2EPBA 1YNXA 4OELB 4AYBB 1HQRD 3HZXA 4RGOS 3U9OA 2IY5B 2D9UA 4A3GB 4R1JA 2H1EA 2CVRA 3EVQA 5K5PA 1EY0A 1HHVA 2HCCA 5I6WA 2B2WC 1SLJA 1PHJA 4EVOA 3PIPA 5KRUA 3WOFA 1AP0A 3MXGA 4IPHA 3CKIB 3S15B 1EQRA 3IL8A 3GTJH 2XN9C 3MFYA 4HIOA 3W1BA 1VQ7A 2O4XA 3QWNA 1QJOA 1CHPD 1LO5D 4UHVA 1B4OA 3DHQA 3JAMi 1SRUA 1EWIA 1DOMA 1S5ED 5M3FB 4DV2Q 1F9PA 4JI2Q 1D1KA 2EJGC 1HH2P 3A5UA 1Y8NB 4DAPA 4E6IA 1U4PA 1AZPA 5CV6A 1GM5A 1PFNA 1HUMA 2EYJA 4QF4A 2VNUD 5BR8Q 2QEXA 4G7HC 2MJ8A 1DOLA 4C3IB 1EU3A 1HZCA 5JOBA 4CJ0B 1VMPA 1SE2A 1XX8A 1O78A 1OXSC 4H02A 2K05A 1E2WA 3CCVA 1U4MA 1EY6A 4BBRB 3H0GG 4LF8Q 2PQAA 2RDFA 3M3YB 3KYHC 1B1ZA 5M5XH 4X3TA 1GKHA 1Y14B 4DV3Q 3FRPB 4L5SA 4LF7L 2Q2TA 1GUGA 1PYBA 4KD4A 2F0QA 5FLMG 3CXCA 4IPDA 3TP5A 1IYUA 2EXZA 1JQYD 1KTKA 3H94A 3L0OA 2OWOA 3TS0A 5CBAE 5IWAQ 3OIPA 2D0PA 4G57A 1A0IA 2F4VQ 3HOZG 3SK5A 1U4RA 3CCQA 4XT1B 1KRTA 4LK1C 1B53A 4RKBA 1BNZA 1ESRA 3PUXA 1WFQA 1G6PA 2EY2A 3GTKH 4LF9Q 4HTHA 2ZTEA 5E4WC 1G291 1YBYA 4QGUA 2R93B 4DV2L 3GTOB 4JI2L 1BCPB 3CHBD 3AB9A 2A5HA 4JYAQ 4FF3A 2E75C 4R8IA 1BCPC 1QE6A 2JA5G 5KIXA 1KABA 5IGBA 1H95A 1H9SA 1EZ6A 4YCWA 1PXUA 3HKZG 2EJMA 1EY9A 5BR8L 3S17H 1TWFB 5IYDG 5EJWA 4C1NK 1Z9FA 1VQAA 2QEJC 1KNEA 1PMRA 2R92G 1Q82C 1XPUA 4PZ7A 2JN4A 1HNXQ 4LF8L 3NE5B 1J9OA 4IN3A 4OGQC 5F2DA 2KOLA 2NTSA 1RKNA 3RLNA 3H0GH 1VQLA 1AN8A 2B63B 5CV4A 3NBHA 1JCKB 4DV3L 2IL8A 1UE6A 5GAHC 4JBKA 2QILA 1F2YA 2NBFA 1S72A 3ERSX 2MPMA 4HN7A 2L12A 5FLMH 1STAA 4XQJA 1JWUD 4DA2A 3DWPA 5IWAL 1K8AC 1JWSD 1V1PA 2F4VL 1TR5A 4RGMA 4XTCS 3LX0A 4DUYQ 3HOZH 3PIP3 3EBEA 5CMDA 3A8JE 2KJXA 1LTSD 1CFMA 1TU2B 2KCCA 1E2ZA 1EUJA 2RDGA 1QZGA 1IW7C 4LF9L 1SJED 1SNOA 1S3OA 3TZUA 4DNIA 1SYCA 1BVSA 2Z8LA 2JA7B 4DK3C 4IUUA 4RHRA 1U9RA 4JYAL 2XTIA 2K6AA 2PMZB 4KHVA 1WTHA 1VQNA 1FVIA 3PQIA 5C5LA 3K5MA 2PI2E 2OQKA 3KDFB 3CD6A 1MJCA 5LMNW 2JA5H 2LMCB 1STBA 5C0XI 3K7UC 4YCVA 5JVH3 3S1QH 1ESFA 3VR5A 2MP1A 3X3NA 2AUJD 5IYDH 5EPJA 1Y1WB 1Q86C 3S14H 1V1QA 5IGFA 2I46A 1HNXL 2F0IA 4ZCKA 1JR0D 2R92H 2WAQG 2K5DA 3Q22A 1GUWA 4N9PA 1GD7A 2YV5A 2KEDA 2B2VA 3SDZA 3J7YW 2YTYA 1YJWA 1ET9A 1VQIA 4JBWA 4MTNA 4TQUS 1STGA 2F0TA 4QQBX 1DOKA 3T13A 4JI5Q 4RCOA 1IHZA 3NWSA 3J7AF 4ID6A 1WTQA 5C44B 1UE7A 1B50A 2UUAQ 2CW0C 1AW7A 4DUYL 3F8TA 4ME5A 1Q8IA 3GD7A 4BY1B 2NUCA 2BH2A 5C3EG 2NVQB 2MQHA 2KVMA 1EOVA 1BCPD 3M7GA 4DK6C 3U4ZA 1WVLA 2WB1E 3OHXC 1I6VC 2KHIA 1PH5A 2GVAA 4KV6A 2J0TD 1MJEA 2PW7A 3TSSA 3I3CA 4IPCA 3GTPB 2RDHA 2C9OA 3GTLH 1PFSA 3G7LA 3PO3G 1PFBA 3CC2A 1SYBA 4EGVA 2JQOA 3HOYG 3CCUA 1VQ4A 1T9HA 1WCMB 4X64Q 2RHSB 4K5VA 2F0EA 4FO2A 4XIGS 3ZJYC 3KBGA 5D3IB 4C1NI 1KDBA 1VQBA 3HOUB 2F0GA 2WV6D 1SMYC 4L6TB 4J15A 2ENBA 3STBC 3I4MG 2DN8A 3DWQA 3E0JA 1LTBD 3WDNA 2O5IC 4JI5L 1JJCB 1U0LA 3C3LA 5K36G 1JOQA 1E7ZA 4UDUC 1KXLA 1IW7D 1AEXA 4ZQ3A 2UUAL 1WD0A 2E2IB 1G2TA 4YWLA 2R61A 3S1MH 2EYMA 4A3BG 2F0MA 4KHPQ 1N32Q 3GV3A 5C3EH 2KCTA 4C3JB 3OOCA 2XRQD 4NXML 4EQ5A 2HIVA 4JPBW 4WRDA 1K83B 1SR3A 4LUVA 2F0VA 3E3XA 3BVGA 1H9JA 1ASZA 4PZ6A 1DJRD 5CV9A 2B2UA 3KOJA 2PCFB 3D3RA 4ULLA 2VXWA 3DWAA 1NSNS 4JI4Q 3I8ZA 1TIID 2JA8G 2N78A 3IKJA 3PO3H 2XGTA 2DJFC 1JJ2A 4BA2I 5FO9B 1R4PB 1ZKOA 4X64L 3HOYH 1I4HA 2F0FA 4LF5Q 1LT4D 2Q8TA 4JOIA 3ZYYX 3HOWG 4C56C 3HRZC 1K0RA 4OHJA 2C35B 1OO9B 3FKIB 1SYFA 2NVTB 2DNCA 5EBCA 2CW0D 2RVLA 2I07B 4JI3Q 3SVMA 4CDCC 4CBVA 3I4MH 2PZTA 1PYSB 4YY3Q 4HJ9A 4A3KB 1SMXA 1XWEA 5K36H 1TKWB 4CDDC 1KHIA 5IT9c 3OWFA 5C4XB 1EWCA 3I4NB 4QL5A 2EYOA 3NXWA 3KJOA 4KHPL 1N32L 2SEBD 2WAQE 1E3PA 4A3BH 2D0OA 1QOHA 2Q2UA 4DR5Q 2VS1A 5CV7A 1PH2A 2FMCA 1FR3A 4MZ9A 4Z9CB 2ZTCA 2F0DA 5J39A 4DXFA 3UDIA 2Y0SB 3KF6B 5HGTA 2MO1A 3T56B 5HURA 4DR6Q 1I5FA 5LHY1 2Z4IA 4GOPB 4J8QA 4LUZA 3KLWA 4RCNA 5ISRA 2G9DA 2G9HD 3UDXA 5DLQE 1D8LA 3Q24A 4JI4L 4A3IG 3I55A 2K1BA 3L7ZC 4H0LC 4DAVA 1SMYD 1AE3A 2JA8H 1CA5A 3H3VC 3AYHB 1KAWA 2XRSD 3STBD 1XYIA 4LF5L 4JCVE 1VQGA 3M85A 3H15A 4QUFA 3KLRA 4ZYSA 4HIKA 1Y69U 3KF8B 3HOWH 1JJGA 3K7AB 2ZXRA 1IL8A 1SYDA 5M5YH 5M5WB 3DLLA 2NN6I 4Y7NB 4JI3L 3G6EA 1N8RC 1I4GA 4FF1A 4CDFC 3R8BA 3EN2A 4LF4Q 4YY3L 1I4RA 1EQQA 3I2ZA 3KK7A 1PTOB 2N88A 2AKWB 1XPOA 1G8ZD 2IWHA 2O2LD 1Q3LA 2CQAA 1I50H 1TWCH 3A74A 3S2HH 3S9WA 3TRZA 3I90A 3ND8A 4FP5D 2PYKA 4ZAIA 3GTQB 5KNDA 4YWMA 2WKCA 2Z6BA 3GTMB 5E3FA 3J7ZC 3CCRA 4DR5L 2F0UA 3S1NB 2KA7A 5C0XG 3J81c 1SNQA 2CFMA 3OMGA 4DR6L 2JA6G 3ONAB 4ME3A 3CC4A 1FGUA 4OX9Q 1LT5D 1U5KA 1YI2A 1E0BA 3CC7A 1NTGA 2FHTA 4HR7B 2VW9A 3H09A 2CH4A 3HOXG 3D8GA 2AQ3B 2M2LA 1IBKQ 3RUZA 4A3IH 3M4OH 3I4OA 3RMHA 3L2PA 2G5DA 1SXTA 1PH7A 4UP7A 2EXDA 2LSSA 4HSPA 3OSOA 4RKLA 5I9OA 3E6ZX 3ND9A 2A6EC 4QUCA 1PDQA 5M9OA 1SJHD 3HKSA 4BBSB 1YNNC 1D6EC 2KECA 5LMNQ 4LF4L 5D14A 4R4IA 3KUPA 2MUYA 2IW3A 4DV6Q 3BS1A 3TBIB 3RD4A 1C0AA 1M90C 4OL7A 4GN3B 5DEHA 3CQZB 3M4PA 1Y8PB 5ELFA 2VZAA 4RH6A 3K0XA 4G7ZC 2DJGC 2N55A 2CHBD 3NBIA 2ALYB 2FMMA 2KEEA 4A3EG 4GKKQ 1TS4A 2ZJPA 2PW5A 1CKNB 1A8VA 3NQIA 1BF4A 1I6HH 5IGCA 1VQKA 3SK4A 2A6HC 5KGUA 1O7ZA 2F3IA 2A1AA 1HA6A 1XXGA 2BH8A 4UY8C 3AMUA 2NB0A 2BDNA 4KKUA 1DYQA 2K52A 4A75A 2E74C 2F0OA 5C0XH 3A0JA 2NWGA 4BS9A 2R7ZG 4OX9L 2LXKA 2JA6H 1WOCA 1YHBA 4A3MB 3NENA 5D65A 2ZM6Q 2R3ZA 1X3FA 5JPMC 4LFBQ 1IBKL 2LFNA 1C8CA 3HOXH 2DY7A 2OCEA 2EYFA 4DR2Q 1PH3A 4A3DG 2CWPA 2B2TA 5FKAC 1JMCA 3E9HA 4DPGA 1F2MA 3S1RB 4KMUC 2QGQA 4R4QA 4HCSA 3VYUA 3HOVG 2NYZD 2B3GA 3DMUA 1WTXA 5LMNL 4CGYB 1VDZA 2B2YA 3KF6A 1OXVA 4JW0A 4DV6L 1I3QB 4OONA 5J1ZA 1SBBB 3TP7A 4GOPA 3GQBA 1EOTA 1EEID 4KI0A 2WB1B 3MEHA 1SNCA 3PO2B 4GKKL 4DV5Q 1TWAH 4JI0Q 2RBMA 3BZKA 4A3EH 1AH9A 1PRTF 1WI5A 2VUMB 4HJAA 4G7OC 2RCNA 4ZKBB 1TS5A 1EFID 5G3LF 1T5EA 2OT2A 3QIAA 2RSNA 2RA4A 2E2HH 3KF8A 1FD7D 2UU9Q 5I9PA 5C4JH 3K5OA 4KY7A 1CZGA 1BDOA 2KCMA 2Z6KC 2R7ZH 2ZM6L 1S4ZA 2ID0A 2BA1A 1K0SA 2IHFA 3T51B 2ZJQA 4C2MB 4JV5Q 4LFBL 2RF4A 3MXNB 4LWCA 3UI2A 1H9RA 2A6ED 2M9VA 4JC0A 1YNND 2JP1A 3P1HA 3QB3A 3TMEA 4DR2L 1TS2A 2O5JC 4LUOA 4JI6Q 1X3QA 4A3DH 3A55A 3CP0A 3RN5A 2GA4B 4C3HG 5FO8B 1QB5D 4B9WA 1EZ8A 4DR3Q 4YWKA 1LTGD 4ODGA 1Z47A 4A93G 1LV9A 3CCLA 4HIMA 2A19A 1A63A 3HOVH 3C46A 3AU7A 3DM1A 1SE4A 3F2BA 4F7XA 3BDOA 2ASBA 2MHVA 1HR0W 1BO0A 2KHSA 3U9SA 1FNWA 1PLFA 3T53B 3VR6A 5DNFA 2A6HD 1HNZQ 2I5HA 4X65Q 3K81C 1S5BD 2EYPA 3T1HQ 4IJHA 4K6LA 4UP9A 3ULJA 1EY7A 3ULLA 1VQPA 4DV5L 4P75A 1TVXA 1EU4A 1CQVA 1P8LA 2KQ3A 1SNDA 2C5CA 4A3GG 2VQFQ 1JB3A 3OWEB 1TWHB 2X6LA 4K14A 2HD3A 1H9MA 2L5TA 1PH8A 2UU9L 1BKBA 4MIUA 1R9TB 1G2SA 2N3SA 5IT9L 3RLFA 5COYA 1HTPA 3Q23A 3MTSA 4LAAA 2Q8IB 4JV5L 1PH4A 3ITPA 1IYJB 1HZAA 5M3FG 4K6DA 1D5XC 2K03A 1IZ6A 2NN6G 1ENAA 3DUZA 3PCOB 2OEOA 1D5MC 3NK9A 1EQVA 2M00A 4JI6L 3HFZB 1CKNA 1VQEA 4R8NA 4F88A 2FFKB 4DR3L 2AQ2B 2FINB 3P20A 4C3HH 3I70A 3RZOB 1STNA 4PMBA 3S16H 2VY3A 1HZBA 4A93H 4N8X1 4DKAC 2JA9A 3K58A 4DGZA 1CM9A 1JICA 4BBRG 4HEDA 3CMEA 2IHEA 4JI1Q 1QZHA 4NW2A 2YTXA 2E5LQ 4B3MQ 4ABNA 2VB2X 1CQFA 1HNZL 2HT1A 4X65L 1SNPA 3U4VA 3KLSA 3T1HL 1TWGH 1JOKA 1DD2A 1QNUA 3UE0A 2Q2HA 3J81j 1PVOA 5T1GA 1ENCA 4APVA 3UDGA 4DR1Q 2EZVA 2Z1CA 5NUCA 4U673 1JWMD 1F9QA 5IGEA 4A3GH 3DM3A 2NVYB 5IYCG 1OXXK 1VQMA 1X54A 1HA5A 2QDBA 4O42A 1E2VA 3E9IA 1P16A 2MO0A 3JC66 3HP3A 2BOSA 3S15H 2SOBA 5EAYA 4LFCQ 2R93G 3PUYA 3E0EA 1SNMA 5M3FH 2GN5A 4DK0A 3J81L 3CRLC 4KN4C 1G51A 2NN6H 3G48A 2B2WA 2JEBI 1N9WA 4DV1Q 4HIDA 2IX1A 5LMUQ 2UXDQ 1QNKA 5CR3A 3WOEA 1N33Q 4FF2A 1JOOA 4P74A 4IFDI 1A2TA 1K3BC 2K5VA 1NR2A 4X3KA 1RJTA 4JBJA 1XTDA 1B7YB 2EIFA 1Q90A 3GTGB 1CI3M 3D6WA 4JI1L 4KTAA 2K28A 2E5LL 4BBRH 4CKEA 4B3ML 1XNQQ 2PZUA 2B63G 5DM63 3M3YH 1QWYA 2PNRC 2AMCB 5M3MB 3QR8A 1XNRQ 4DR1L 2WACA 4QIWE 3F2CA 3LNNA 3ERQA 1WTRA 3DXJC 2DGYA 4JI7Q 3D4WA 5JJZA 3RLOA 3FP9A 1O7IA 3MAQA 4GNXB 2WKDA 3EA6A 5GROA 4EQPA 3A7LA 3L9AX 5IYCH 4I7ZC 4DR4Q 4GNXC 4LF6Q 3FEWX 3FPUB 1MSGA 4RFBA 4RMFA 5HGQA 1DGSA 4GLXA 2WIIB 4LFCL 1BUVT 2JA7G 3K5NA 3MC0B 2R93H 2HQEA 4DN4M 3GTOH 1LT6D 1XJVA 1HUNA 3TQYA 4DV1L 2Q8RE 5LMUL 1M8AA 1SE3A 1EWHA 4P71A 2UXDL 4A3JB 4X62Q 1TWFH 3SEBA 1N33L 3J7AV 5FO7B 4WORA 3EROA 1Y1WG 4HJ7A 5CYUA 4GLAC 5BN3A 2BA0A 1VQFA 1XNQL 1ASYA 2D5DA 2WP8J 4R4CA 2K04A 4KLKA 2J4XA 3GO5A 4NDXA 4X66Q 1L0YB 3A5ZB 5C0XJ 1EY4A 3D31A 3OTOQ 2B63H 3P7JA 4O0AA 2VB3X 3HKZE 5C5MA 4DFAA 1XNRL 3W1GA 2E2JB 2AUKA 1XMQQ 5GQOA 4NKLA 3SXHA 5CBEE 3WWVA 2YU9H 5C44G 4JI7L 1FJGQ 1GUOA 4NMZA 3AFQA 5EGTA 4ZLTF 1K3RA 1OXUA 5JJLA 1TXYA 4KY6A 2Z9HA 3Q6SA 1Y1VB 1L0WA 4DR4L 1EEFD 3S2DB 1B9NA 4BY1G 4LF6L 1F77A 4B3TQ 1XTCD 1ILPA 4DK1A 4A3FB 2RKSA 1X3EA 1VMCA 5FOBB 4RGNA 1CKMA 4HJ5A 4TVAB 2F0LA 2QDLA 4OEMB 2JA7H 3LWEA 2CKZB 5AFWA 2E76C 4A76A 1WTVA 1LTTD 3M4QA 5FLXc 4POGA 4YHHQ 2L0CA 4ILWA 4DAYB 4X62L 2K5WA 2CQOA 3RZDB 1WCMG 4HJ8A 1Y1WH 1PH9A 1GO3E 1JT8A 1SSOA 5E1FA 2N49A 3J80c 4PZ8A 1F2LA 3HOUG 3GP7A 4X66L 3DEOA 4IQZA 3OTOL 1K9MC 2MFIA 2F03A 1ZYRC 1NJIC 2QA4A 1WTWA 3KDFA 1XMQL 1C7YA 3MHBA 4DUZQ 4ZRZA 2GVBA 3UDFA 4IUQA 3C1FA 3NELA 1FJGL 5C44H 4K8IA 1D1IA 2B29A 2BDOA 2PZWA 4G4KA 5C6AA 1V8QA 4XYOA 4B3TL 4J1MA 2JXMB 1HTLD 1AFPA 4BY1H 2NVQH 4C3JG 1RIPA 3F2UA 5JAVA 1B8AA 3IFTA 2B8FA 3KLSX 2B2TC 4OWWB 3QJYA 2BE5C 4FNFA 3MXUA 2A69C 1NR4A 2JA6B 4YHHL 3V2TA 1CZWA 1FNVA 1WTOA 2I0QA 1QUQB 4V190 3GTPH 1SFOB 1L1OB 1UE1A 3K80C 1VQJA 3PMFA 1L1OC 3L3OC 4IUPA 3SE0A 1NUCA 1U4LA 3PUWA 4LMQD 2NVXB 2AWOA 4F8MA 3MA2B 1WCMH 4QJFA 1B3AA 2WINB 3SK8A 1EIFA 1ET6A 4L8JA 4DNTB 3FKIG 4BA1I 3EQLC 4P2CB 3HOUH 2RQXA 4BY7B 2PMZE 1EQTA 5GAEC 2K32A 3JAMc 2AQ1B 1GUNA 3PUZA 4DNRB 3A8IE 4P73A 4DUZL 4A3KG 1HFNA 5BN4A 1DZ1A 1PH1A 4YCUA 4AH6A 2OTLA
chains in the Genus database with same CATH topology
1RF2D 2BCOA 3D4RA 4HSVA 2X6GA 1CTMA 4ZUIA 1T5XD 3R2TA 1I4QA 2D62A 4H44C 4Q5VA 5I2YA 4TKOB 4FF4A 1B2TA 1RHPA 3GTJB 3TDQA 3NPPA 4IFDG 1JE4A 3NHHA 1EYCA 3TZDA 1BBXC 3VR4A 2F0WA 1K8MA 5IOCA 1QCBD 2LS01 5IODA 3O13A 2A68C 1ZYRD 2NTTA 2EVBA 3HGBA 1IKMA 4X3UA 3V05A 4FYDA 3R3OA 1QG7A 3HOVB 3I73A 1TT2A 5M5XB 4PMCA 4H7BA 1EY8A 1VF7A 1PRTB 4EQNA 3TN2A 1PRTC 3QG1A 4DAYA 2H4OA 4FVMA 1LACA 4IZ8A 2B39A 3VYRA 2BE5D 2A69D 1H9SB 1TQOA 1PTOF 5CV8A 5JEAG 1ENFA 5EKLA 4KKSA 3VA7A 3GTKB 4KJNA 4GZYC 2HUGA 4KK7A 4IFDH 2R6GA 2F0PA 4XT3B 4DU9A 1X3PA 4K8JA 2JEAI 5KYLA 2ZXPA 5DM73 3S17B 4TRDA 3OW7A 1FGBD 1ONLA 3BVZA 1NCVA 3OIQA 3T16A 4HCEA 1V1PB 3C2PA 3FDTA 2L1BA 1DONA 3VR2A 3FMCA 1I4XA 1KAAA 1LABA 3H0GB 3NSWA 2KCNA 1WTPA 5ELEA 3BZDB 1PTOH 2ZXOA 4KKTA 3LWUA 2TSSA 1O7YA 1BR9A 3HOZB 1CK1A 2IJ0A 1OXTA 5JEAH 4K5XA 1PZKD 2XIWA 2A68D 4XQQA 1R4QB 1MD2D 1ZEQX 3N6RA 5EKKA 1EIHA 3N52A 4HAEA 4MN3A 3OPOA 1HXYD 4PQXA 2B2VC 1STEA 2JA5B 2JSOA 1SEBD 4EQOA 3S1QB 3HKZB 1EIGA 1LLRD 4QB4A 1YNJC 3W2DA 4CHTB 5FLXL 3URYA 3S14B 1Q1BA 4L63B 1A3TA 2R92B 3A56A 1PRTD 2EY5A 4DF7A 1SYGA 3HS0C 2IX0A 3NQTA 5G3LD 3K0YA 3MZ5A 3MWYW 1Y8OB 3HEJA 4M1UB 1KDCA 5C4HA 2K5QA 3J80L 1S5FD 3BDCA 3NTHA 4I65A 3H6MA 2EY1A 4X3SA 4S3SA 2IPKD 4IURA 2IT1A 5TSSA 4IUTA 2HCIA 1IYVA 1HQMC 2B8GA 2F3WA 2QKIC 2SNMA 3M4YA 1O7LA 5J22A 1UUPA 3GTLB 4C3IG 1FYCA 1VF5C 1PFMA 4OO1I 1A3UA 3SK6A 1SDFA 1C4QA 1HCZA 1G6ZA 2XWJB 3BYYB 4O1NA 1F9SA 1A6XA 1LTID 3BYTB 4NP5A 3D6CA 1BQQT 5ELBA 2WAQB 4Q0FA 2AWNA 5EPLA 2XNAC 3EJIA 1DCZA 3JAML 2YU9B 3W3AA 5KNCA 3A54A 4WJWA 1AZQA 2B2UC 3S1MB 1DM0B 2EDGA 3NP8A 2XVSA 3FVQA 1CT1D 5KNBA 5C3EB 3MVVA 4IUNA 1GOZA 2PO4A 3VR3A 1YNJD 4OIJA 3PIO3 3CU7A 5I2XA 1KDAA 5ELDA 1WD1A 4CKBA 3PUVA 1CA6A 4RHSA 4ZKCB 2MGSA 1BCPF 3PO3B 2L11A 4B9XA 1STYA 1IKLA 2SDFA 1TY2A 1EYDA 3HOYB 3MXPA 1L0XB 3BVMA 4ZK9B 5E4XA 4V0BA 4J6HA 3V96A 1TY0A 3IFDA 3MXNA 1KNAA 3I4MB 1ZXTA 1B9MA 1STHA 1HPCA 1K8OA 1UAPA 3X3MA 2F0NA 1MI2A 4FXKC 1X32A 4RWSC 3QOJA 4N9TA 1UNSA 1W6KA 1O80A 4XXEA 5FLXE 4A3BB 2HDLA 1A3VA 4M8AA 4FXDA 2F0HA 3D4DA 1EYAA 4KHZA 2SNSA 3KBXA 1GUSA 3BDLA 1I4PA 3C1EA 3K5LA 3J80E 3I91A 3T4AC 1Q12A 4U68A 2EYHA 4RGTA 1Z7TA 5CV5A 2JA8B 5IGGA 1ICWA 1W6JA 3P75A 5IT9E 4CJ1B 1QILA 1D5ZC 4WFN3 4OIKA 3HOWB 5M5YB 2RSOA 1HRJA 2F1MA 1S5CD 1LTRD 2JYOA 5IGDA 3G6JB 3TP8A 4IFDJ 4KD3A 2D2CC 4PMWA 4QMGA 2K7VA 1EY5A 2TMPA 4HMJA 3TP6A 1A2UA 5IIFA 3QO2A 5ELCA 1I50B 1TWCB 3S2HB 5A2QL 3R93A 4HMIA 1SAPA 5CORA 3I72A 3K57A 4ZUJA 1ML0D 3BG3A 2EE1A 4FXGC 3I4LA 4B08A 5EQ0A 2DY8A 2LY7A 4IALA 2YYZA 1LT3D 4A3IB 2EJFC 3M4OB 4LJZC 1ILQA 1DXMA 2OF1A 1PZJD 5D3DA 3JAME 3DEPA 3VYTA 5C3XA 1F2ZA 5LL6X 1KLGD 3HG9A 4XYQA 2QCPX 3GV6A 3NTKA 5JPNC 2F0JA 3K59A 2E2DC 4F87A 5A35A 5JEAJ 3E5SA 3QOLA 1RCVD 4RAUC 5EPKA 5CC4A 5I6YA 1RODA 3J81E 1BXTA 1G91A 3SHLA 1I6HB 4MHEA 1GXDC 1HFGA 5KEEA 2J7ZA 5DAUA 1SYEA 2K01A 3NWTA 2KUMA 4OO1G 2IX3A 5EBDA 5C4ZA 5BN5A 1PYWD 2X69A 3VYSA 5FK9C 1RTNA 4XDXA 1Z6HA 2L9HA 1FNUA 2Z4HA 3SR1A 2B2YC 1GUTA 3HOXB 2LKVA 2V4DA 1NAPA 4TSSA 4CKCA 5C3WA 4RA8A 1M4VA 5I4DA 4JK1C 1B44D 1D2BA 1MSHA 3M7NA 5JVG3 2ZT9C 3EFXD 1LTAD 1S5DD 1MBYA 2L55A 2L4NA 1GJXA 4KJOA 1TWAB 4R9WA 1A15A 5T1IA 4A3EB 4PNYA 3A8KE 1PTOC 2E2HB 2PQEA 5C4JB 4OO1H 2R7ZB 3NUCA 3K6OA 5CGKA 1J8IA 1UEAB 3VA5A 2FJ2A 2XSCA 5A2QE 4A3DB 2HDMA 2EYLA 1PZID 5KYIA 2PPBC 3A7AB 1V1OA 1V43A 2EY6A 3NTIA 4IUVA 4CJ2C 1C48A 4QCLA 2EOTA 1JC7A 2F3VA 2A73B 3PV0A 1F9RA 1RDPD 3R2IA 3FPPA 2ICIA 2F4IA 4KY5A 1MGSA 1JORA 3Q0AA 1RTOA 2XWBB 5EKIA 2JE6I 2ICEC 4UAIA 4YIJA 4PV1C 5LL6S 3MFGA 1GHJA 2OXPA 2F0KA 3OMCA 4H13C 4DXGA 1KLUD 1H9KA 1CHQD 2A74C 1EL0A 1RD9D 4XQNA 1II3A 4K5WA 4BWGB 4QIWB 4KN7C 1VCIA 1GHKA 3CRKC 4C3HB 2DNEA 2F0SA 3S16B 4A93B 4K2LA 1Q1EA 2K33A 2QF7A 1PTOD 2NZ1D 1TWGB 3IAYA 3H91A 1BOSA 4K2KA 1TS3A 2EPBA 4AYBB 1HQRD 3HZXA 4RGOS 3U9OA 2D9UA 4A3GB 2H1EA 2CVRA 3EVQA 5K5PA 1EY0A 1HHVA 2HCCA 5I6WA 2B2WC 4EVOA 5KRUA 3WOFA 1AP0A 3MXGA 3CKIB 3S15B 3IL8A 2XN9C 3MFYA 2O4XA 3QWNA 1QJOA 1CHPD 1LO5D 1B4OA 3DHQA 1DOMA 1S5ED 5M3FB 1F9PA 1D1KA 2EJGC 1Y8NB 4DAPA 4E6IA 1U4PA 1AZPA 5CV6A 1PFNA 1HUMA 2EYJA 4QF4A 2VNUD 4G7HC 2MJ8A 1DOLA 4C3IB 1EU3A 5JOBA 4CJ0B 1VMPA 1SE2A 1XX8A 1O78A 1OXSC 2K05A 1E2WA 1U4MA 1EY6A 4BBRB 2RDFA 3M3YB 1B1ZA 4X3TA 3FRPB 1GUGA 4KD4A 2F0QA 3TP5A 1IYUA 2EXZA 1JQYD 1KTKA 3H94A 5CBAE 3OIPA 4G57A 3SK5A 1U4RA 4XT1B 4LK1C 1B53A 4RKBA 1BNZA 1ESRA 3PUXA 2EY2A 4HTHA 5E4WC 1G291 2R93B 3GTOB 1BCPB 3CHBD 3AB9A 2A5HA 4FF3A 2E75C 4R8IA 1BCPC 1QE6A 5KIXA 1KABA 5IGBA 1H9SA 1EZ6A 1PXUA 2EJMA 1EY9A 1TWFB 5EJWA 4C1NK 2QEJC 1KNEA 1PMRA 3NE5B 1J9OA 4IN3A 4OGQC 5F2DA 2KOLA 2NTSA 1RKNA 1AN8A 2B63B 5CV4A 3NBHA 1JCKB 2IL8A 2QILA 1F2YA 2NBFA 2MPMA 4HN7A 2L12A 1STAA 4XQJA 1JWUD 4DA2A 3DWPA 1JWSD 1V1PA 1TR5A 4RGMA 4XTCS 3LX0A 3PIP3 5CMDA 3A8JE 2KJXA 1LTSD 1CFMA 1TU2B 2KCCA 1E2ZA 2RDGA 1IW7C 1SJED 1SNOA 3TZUA 1SYCA 2Z8LA 2JA7B 4IUUA 4RHRA 1U9RA 2K6AA 2PMZB 4KHVA 5C5LA 3K5MA 2LMCB 1STBA 5C0XI 5JVH3 1ESFA 3VR5A 2MP1A 3X3NA 2AUJD 5EPJA 1Y1WB 5IGFA 2I46A 2F0IA 1JR0D 2K5DA 3Q22A 1GUWA 4N9PA 2KEDA 2B2VA 3SDZA 3J7YW 1ET9A 4JBWA 4TQUS 1STGA 2F0TA 1DOKA 3T13A 4RCOA 1IHZA 3NWSA 3J7AF 4ID6A 1WTQA 5C44B 1B50A 2CW0C 1AW7A 4ME5A 1Q8IA 3GD7A 4BY1B 2NUCA 2NVQB 2KVMA 3M7GA 1BCPD 1WVLA 3OHXC 1I6VC 4KV6A 2J0TD 2PW7A 3TSSA 3I3CA 3GTPB 2RDHA 2C9OA 3G7LA 1PFBA 1SYBA 4EGVA 1WCMB 4K5VA 2F0EA 4FO2A 4XIGS 3KBGA 5D3IB 4C1NI 1KDBA 3HOUB 2F0GA 2WV6D 1SMYC 4L6TB 2ENBA 2DN8A 3DWQA 3E0JA 1LTBD 3WDNA 2O5IC 3C3LA 5K36G 1JOQA 4UDUC 1IW7D 1AEXA 4ZQ3A 2E2IB 1WD0A 1G2TA 2R61A 2EYMA 2F0MA 3GV3A 4C3JB 3OOCA 2XRQD 4WRDA 1K83B 2F0VA 3BVGA 1H9JA 1DJRD 5CV9A 2B2UA 2PCFB 3D3RA 4ULLA 2VXWA 3DWAA 1NSNS 3I8ZA 1TIID 3IKJA 4BA2I 5FO9B 1R4PB 1ZKOA 1I4HA 2F0FA 1LT4D 2Q8TA 3ZYYX 4C56C 3HRZC 4OHJA 1OO9B 3FKIB 1SYFA 2NVTB 2DNCA 5EBCA 2CW0D 2RVLA 2I07B 3SVMA 4CBVA 2PZTA 4A3KB 1XWEA 5K36H 1TKWB 3OWFA 5C4XB 1EWCA 3I4NB 2EYOA 3NXWA 2SEBD 1QOHA 5CV7A 2FMCA 1FR3A 4Z9CB 2F0DA 5J39A 4DXFA 2Y0SB 5HGTA 3T56B 5HURA 5LHY1 2Z4IA 4J8QA 4RCNA 5ISRA 2G9DA 2G9HD 3Q24A 2K1BA 3L7ZC 4H0LC 4DAVA 1SMYD 1CA5A 3H3VC 2XRSD 1XYIA 3M85A 4QUFA 3KLRA 4ZYSA 1Y69U 3K7AB 2ZXRA 1IL8A 1SYDA 5M5WB 2NN6I 4Y7NB 1I4GA 4FF1A 3R8BA 1I4RA 3KK7A 1PTOB 2N88A 1G8ZD 2IWHA 2O2LD 1Q3LA 2CQAA 3S9WA 3I90A 3ND8A 2PYKA 4FP5D 4ZAIA 3GTQB 5KNDA 2WKCA 3GTMB 5E3FA 2F0UA 3S1NB 2KA7A 5C0XG 1SNQA 3OMGA 3ONAB 1LT5D 1E0BA 2FHTA 4HR7B 3H09A 3D8GA 2AQ3B 2M2LA 3RUZA 3RMHA 1SXTA 4HSPA 3OSOA 4RKLA 5I9OA 3E6ZX 3ND9A 2A6EC 4QUCA 1PDQA 5M9OA 1SJHD 4BBSB 1YNNC 1D6EC 2KECA 5D14A 3KUPA 2MUYA 2IW3A 3BS1A 3TBIB 3RD4A 4OL7A 5DEHA 3CQZB 1Y8PB 5ELFA 4G7ZC 4RH6A 2N55A 2CHBD 3NBIA 2FMMA 2KEEA 1TS4A 2PW5A 3NQIA 1BF4A 5IGCA 3SK4A 2A6HC 5KGUA 1O7ZA 1HA6A 1XXGA 3AMUA 2NB0A 2BDNA 4KKUA 1DYQA 2E74C 2F0OA 5C0XH 2NWGA 4BS9A 4A3MB 5D65A 2R3ZA 5JPMC 2LFNA 1C8CA 2DY7A 2EYFA 2B2TA 5FKAC 1F2MA 3S1RB 4KMUC 4HCSA 3VYUA 2NYZD 3DMUA 1WTXA 4CGYB 1VDZA 2B2YA 1OXVA 1I3QB 5J1ZA 1SBBB 3TP7A 3GQBA 1EOTA 1EEID 4KI0A 2WB1B 3MEHA 1SNCA 3PO2B 2RBMA 1PRTF 2VUMB 4G7OC 4ZKBB 1TS5A 1EFID 5G3LF 1T5EA 2OT2A 3QIAA 2RSNA 2RA4A 3KF8A 1FD7D 5I9PA 3K5OA 4KY7A 1CZGA 1BDOA 1S4ZA 2ID0A 2BA1A 3T51B 4C2MB 3UI2A 1H9RA 2A6ED 2M9VA 1YNND 2JP1A 3P1HA 3QB3A 3TMEA 1TS2A 2O5JC 1X3QA 3A55A 2GA4B 4C3HG 5FO8B 1QB5D 4B9WA 1EZ8A 1LTGD 4ODGA 1Z47A 1LV9A 3C46A 3AU7A 3DM1A 1SE4A 4F7XA 3BDOA 2MHVA 1BO0A 2KHSA 3U9SA 1FNWA 1PLFA 3T53B 3VR6A 5DNFA 2A6HD 1S5BD 2EYPA 4K6LA 1EY7A 1TVXA 1EU4A 1CQVA 2KQ3A 1SNDA 2C5CA 1JB3A 3OWEB 1TWHB 2X6LA 4K14A 1H9MA 2L5TA 4MIUA 1R9TB 1G2SA 5IT9L 3RLFA 5COYA 1HTPA 3Q23A 3MTSA 4LAAA 2Q8IB 3ITPA 4K6DA 1D5XC 2K03A 2NN6G 1ENAA 3DUZA 2OEOA 1D5MC 3NK9A 1EQVA 2M00A 4F88A 4R8NA 2FFKB 2AQ2B 2FINB 3P20A 3I70A 3RZOB 1STNA 4PMBA 3K58A 4DGZA 1CM9A 1JICA 4HEDA 4NW2A 4ABNA 2VB2X 1CQFA 1SNPA 3KLSA 1JOKA 1DD2A 1QNUA 5T1GA 1ENCA 2EZVA 2Z1CA 5NUCA 4U673 1JWMD 1F9QA 5IGEA 2NVYB 1OXXK 1HA5A 2QDBA 4O42A 1E2VA 3HP3A 2BOSA 2SOBA 3PUYA 1SNMA 4DK0A 3J81L 3CRLC 4KN4C 2NN6H 2B2WA 2JEBI 2IX1A 1QNKA 5CR3A 3WOEA 4FF2A 1JOOA 4IFDI 1A2TA 1NR2A 4X3KA 1RJTA 1Q90A 3GTGB 1CI3M 3D6WA 4KTAA 2K28A 4CKEA 2PZUA 5DM63 1QWYA 2PNRC 5M3MB 2WACA 3LNNA 3ERQA 1WTRA 3DXJC 3D4WA 5JJZA 3MAQA 2WKDA 3EA6A 4EQPA 3A7LA 3L9AX 4I7ZC 3FEWX 3FPUB 1MSGA 4RFBA 2WIIB 1BUVT 3K5NA 3MC0B 2HQEA 4DN4M 1LT6D 1HUNA 2Q8RE 1M8AA 1SE3A 1EWHA 4A3JB 3SEBA 3J7AV 5FO7B 4WORA 3EROA 5CYUA 5BN3A 2BA0A 2D5DA 2WP8J 2K04A 2J4XA 3GO5A 4NDXA 5C0XJ 1L0YB 1EY4A 3D31A 3P7JA 2VB3X 5C5MA 4DFAA 2E2JB 2AUKA 3SXHA 4NKLA 5CBEE 1GUOA 4NMZA 5EGTA 4ZLTF 1OXUA 4KY6A 3Q6SA 1Y1VB 1EEFD 3S2DB 1B9NA 1F77A 1XTCD 1ILPA 4DK1A 4A3FB 2RKSA 5FOBB 1VMCA 4RGNA 2F0LA 3LWEA 5AFWA 2E76C 1WTVA 1LTTD 2L0CA 4ILWA 2K5WA 3RZDB 1SSOA 5E1FA 1F2LA 3GP7A 3DEOA 4IQZA 2F03A 1ZYRC 1WTWA 3MHBA 4ZRZA 4IUQA 3C1FA 4K8IA 1D1IA 2BDOA 2PZWA 4G4KA 5C6AA 1V8QA 4XYOA 4J1MA 2JXMB 1HTLD 1AFPA 4C3JG 3F2UA 5JAVA 3IFTA 2B8FA 3KLSX 2B2TC 3QJYA 2BE5C 4FNFA 3MXUA 2A69C 1NR4A 2JA6B 3V2TA 1CZWA 1FNVA 1WTOA 4V190 1SFOB 3PMFA 4IUPA 3L3OC 3SE0A 1NUCA 1U4LA 3PUWA 4LMQD 2NVXB 2AWOA 4F8MA 3MA2B 1B3AA 2WINB 3SK8A 1ET6A 4L8JA 4DNTB 4BA1I 3EQLC 4P2CB 2RQXA 4BY7B 1EQTA 2K32A 2AQ1B 1GUNA 3PUZA 4DNRB 3A8IE 1HFNA 5BN4A 1DZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I65 A;  2LKV A;  3RUZ A;  4KY5 A;  5CV6 A;  3NK9 A;  5KYL A;  1EQV A;  2M00 A;  2RBM A;  3ERQ A;  3OWF A;  4HMI A;  4B9X A;  1STY A;  4TRD A;  2EYJ A;  1SYB A;  4R8N A;  4QF4 A;  4ZUJ A;  5C3W A;  1JOR A;  1EYD A;  1TR5 A;  2EY1 A;  3D4W A;  3H6M A;  4S3S A;  2EYO A;  4ZUI A;  3MXP A;  3OSO A;  4RKL A;  3NXW A;  5JOB A;  3LX0 A;  5I9O A;  4K5V A;  2F0E A;  3T16 A;  4EQP A;  1STN A;  4PMB A;  4YIJ A;  5E1F A;  5I9P A;  5M9O A;  5CV7 A;  4J6H A;  4DGZ A;  1KDB A;  1EY6 A;  2F0G A;  2F3W A;  1KAA A;  1SNO A;  4KY7 A;  2SNM A;  2RDF A;  2F0D A;  5J39 A;  5HGT A;  5HUR A;  1SYC A;  2ENB A;  2OXP A;  1SNP A;  2F0K A;  3OMC A;  4IAL A;  3NHH A;  1EYC A;  5J22 A;  1U9R A;  1JOK A;  1STH A;  2HQE A;  4KHV A;  4OL7 A;  4KD4 A;  5DEH A;  3MHB A;  2F0Q A;  5ISR A;  2F0W A;  1ENC A;  5C5L A;  5IOC A;  1JOQ A;  3TP5 A;  4KJO A;  2F0N A;  3P1H A;  3QB3 A;  1AEX A;  3C1F A;  4ZQ3 A;  1II3 A;  5NUC A;  2EXZ A;  3TME A;  5IOD A;  4K5W A;  4K8I A;  4PNY A;  3QOJ A;  2OF1 A;  2PW5 A;  1STB A;  1A3U A;  4N9T A;  5IGE A;  5IGC A;  3SK6 A;  2PZW A;  4G57 A;  3SK4 A;  5C3X A;  1F2Z A;  4WOR A;  5C6A A;  4B9W A;  3ERO A;  1EZ8 A;  2EYM A;  5KGU A;  2PQE A;  2F0S A;  3SK5 A;  4J1M A;  4ODG A;  2QDB A;  2F0M A;  5IGF A;  4K2L A;  4NP5 A;  2F0I A;  3D6C A;  4RKB A;  1SYD A;  2F0J A;  1A3V A;  3R3O A;  2F0H A;  4F7X A;  4K5X A;  2F0O A;  3D4D A;  4N9P A;  5JAV A;  2SOB A;  2EY2 A;  1EYA A;  3NUC A;  3E5S A;  4WRD A;  4NDX A;  1TT2 A;  4HTH A;  4PMC A;  1EY4 A;  2KHS A;  2SNS A;  3QOL A;  4H7B A;  5CC4 A;  5I6Y A;  1EY8 A;  2F0V A;  3BDL A;  3C1E A;  2EYP A;  5C5M A;  4DFA A;  1STG A;  2F0T A;  1SNM A;  5EKK A;  5CV9 A;  5CGK A;  4EQN A;  3T13 A;  1EY7 A;  3SXH A;  4NKL A;  3EJI A;  3SHL A;  3V2T A;  1IHZ A;  1NSN S;  2EYH A;  4K2K A;  3VA5 A;  4ID6 A;  1KAB A;  5KIX A;  5IGB A;  3S9W A;  1EZ6 A;  2EYF A;  2KQ3 A;  5CV5 A;  4EQO A;  1SND A;  3HZX A;  1EY9 A;  4NMZ A;  4IZ8 A;  3U9O A;  5EGT A;  3PMF A;  2EYL A;  4QB4 A;  5IGG A;  5KYI A;  2PYK A;  1NUC A;  3P75 A;  3EVQ A;  4KY6 A;  5CR3 A;  4K14 A;  5K5P A;  1F2M A;  1JOO A;  2F0F A;  4ME5 A;  4F8M A;  1TQO A;  5KEE A;  2EY6 A;  1A2T A;  1EY0 A;  3NP8 A;  5E3F A;  5DAU A;  4MIU A;  5I6W A;  3SK8 A;  1SYE A;  2F0U A;  2NUC A;  5CV8 A;  1A3T A;  4EVO A;  5KRU A;  2EY5 A;  3DMU A;  3MVV A;  5EKL A;  4DF7 A;  4IUN A;  1SYG A;  2RKS A;  4KTA A;  5F2D A;  5C4Z A;  1SYF A;  1SNQ A;  3OMG A;  1RKN A;  2WAC A;  2PZU A;  4KV6 A;  2F3V A;  3NQT A;  2O4X A;  4KJN A;  3MZ5 A;  5CV4 A;  2F0L A;  5J1Z A;  1KDA A;  3TP7 A;  3DHQ A;  2PW7 A;  2PZT A;  4LAA A;  5IGD A;  1F2Y A;  3HEJ A;  3TP8 A;  1KDC A;  3ITP A;  5C4H A;  4KD3 A;  4K6D A;  4QMG A;  2F0P A;  1EY5 A;  4HMJ A;  3TP6 A;  4DU9 A;  1A2U A;  3SR1 A;  3BDC A;  1ENA A;  3MEH A;  1SNC A;  4K8J A;  3D8G A;  1STA A;  4E6I A;  5IIF A;  2OEO A; 
#chains in the Genus database with same CATH topology
 1RF2 D;  2BCO A;  1S40 A;  3D4R A;  4HSV A;  2E2I H;  5C4X G;  3I4N G;  2X6G A;  1CTM A;  1YHQ A;  2F52 A;  4ZUI A;  1T5X D;  5AJ3 Q;  3R2T A;  1M1K C;  5ELN A;  1I4Q A;  2D62 A;  4H44 C;  4Q5V A;  5I2Y A;  3M9B A;  4TKO B;  4FF4 A;  1B2T A;  1E22 A;  1RHP A;  3GTJ B;  3TDQ A;  1MKH A;  3NPP A;  4C3J H;  3CPW A;  4GN5 A;  2Y0S G;  3OW2 A;  4IFD G;  1KC8 C;  4AQY Q;  4WJ3 M;  1K83 H;  1JE4 A;  3ULP A;  3NHH A;  1EYC A;  3TZD A;  1BBX C;  3VR4 A;  4R4T A;  2L15 A;  2F0W A;  2VQE Q;  1K8M A;  5IOC A;  1QCB D;  2LS0 1;  3G71 A;  5IOD A;  3O13 A;  1CKO A;  2A68 C;  1ZYR D;  2NTT A;  2EVB A;  3HGB A;  3EIV A;  4GLV B;  3PGZ A;  1CUK A;  1IKM A;  4X3U A;  3V05 A;  4FYD A;  3R3O A;  3FKI H;  1QG7 A;  3BZC A;  2NVT H;  3HOV B;  3I73 A;  1TT2 A;  5M5X B;  4PMC A;  1N34 Q;  4H7B A;  4JVZ A;  1EY8 A;  1X9N A;  1VF7 A;  1PRT B;  4EQN A;  3TN2 A;  4K0K Q;  4A3K H;  1PRT C;  3QG1 A;  4DAY A;  4NB3 A;  2H4O A;  1NMG A;  1VQ5 A;  4FVM A;  1LAC A;  4IZ8 A;  2B39 A;  5C4X H;  4A3C G;  3I4N H;  5AJ3 L;  3VYR A;  2BE5 D;  1Q8K A;  2A69 D;  2CCZ A;  1H9S B;  1TQO A;  4IJL A;  4DV7 Q;  1PTO F;  5CV8 A;  4FDB A;  5JEA G;  1ENF A;  4IOC A;  5EKL A;  4KKS A;  3VA7 A;  3GTK B;  4AQY L;  4KJN A;  4GZY C;  1X56 A;  2HUG A;  4KK7 A;  1SE8 A;  2K5H A;  2UUC Q;  4IFD H;  2R6G A;  4DAM A;  4L5R C;  1IL2 A;  2VQE L;  2F0P A;  4XT3 B;  1K73 C;  4DU9 A;  1X3P A;  2A8V A;  5E7N A;  3BU2 A;  4K8J A;  2JEA I;  5KYL A;  2ZXP A;  3H3V H;  5DM7 3;  3S17 B;  4TRD A;  3RNU A;  3OW7 A;  1YJN A;  1FGB D;  1ONL A;  3BVZ A;  4WJ4 A;  1NCV A;  3OIQ A;  4N8F A;  3T16 A;  4HCE A;  1V1P B;  3C2P A;  1Q46 A;  3FDT A;  3K7A H;  4BBS G;  2L1B A;  1DON A;  1J5E Q;  3VR2 A;  3FMC A;  1I4X A;  5M5W H;  1KAA A;  1LAB A;  3H0G B;  2WFW A;  4Y7N H;  1N34 L;  2H5X A;  2Q2I A;  3OYY A;  3NSW A;  2KCN A;  5IP9 G;  1WTP A;  4DV0 Q;  4K0K L;  5ELE A;  3RR5 A;  3D0F A;  3BZD B;  1PTO H;  2ZXO A;  4KKT A;  2E8G A;  3LWU A;  1WJJ A;  1X55 A;  2TSS A;  4A3C H;  4DV7 L;  2FXQ A;  4QY7 A;  3UE1 A;  3GTQ H;  1O7Y A;  1BR9 A;  3HOZ B;  1CK1 A;  2RHQ B;  3GTM H;  2IJ0 A;  1OXT A;  3S1N H;  3VDY A;  4PG3 A;  1IBM Q;  5JEA H;  2KHJ A;  4K5X A;  1PZK D;  2XIW A;  1B70 B;  2A68 D;  2UUC L;  4XQQ A;  4A3M G;  1R4Q B;  1MD2 D;  1ZEQ X;  2MNA A;  3PIO A;  3N6R A;  5EKK A;  1EIH A;  4Y52 H;  3N52 A;  4HAE A;  4MNO A;  4MN3 A;  3OPO A;  1HXY D;  2NZO A;  4PQX A;  2R7D A;  2B2V C;  1STE A;  2JA5 B;  2JSO A;  1SEB D;  4EQO A;  1B3Q A;  3S1Q B;  3HKZ B;  1EIG A;  1LLR D;  4QB4 A;  1VQD A;  1YNJ C;  5ELO A;  3W2D A;  4CHT B;  5FLX L;  3URY A;  3S14 B;  1Q1B A;  1W2B A;  3AEV A;  1J5E L;  4L63 B;  1A3T A;  2R92 B;  3A56 A;  1PRT D;  2EY5 A;  4DF7 A;  2Y0S E;  4BBS H;  4A3L G;  1SYG A;  3HS0 C;  3J81 i;  2IX0 A;  3NQT A;  5G3L D;  3K0Y A;  1IXR A;  1D7Q A;  3MZ5 A;  3MWY W;  1Y8O B;  4DV0 L;  3IRB A;  4JI0 L;  3HEJ A;  2UXB Q;  4M1U B;  1KDC A;  4AYB G;  5C4H A;  2K5Q A;  5IP9 H;  2WB1 G;  3J80 L;  2DUD A;  1S5F D;  2PNH A;  1NY4 A;  1YVC A;  3BDC A;  3CQZ H;  3NTH A;  3PO2 G;  3FHW A;  4I65 A;  1IBL Q;  2VUM G;  3H6M A;  2EY1 A;  1EFW A;  4X3S A;  4S3S A;  5IY0 A;  2IPK D;  4IUR A;  3AQQ A;  1IBM L;  2IT1 A;  5TSS A;  4IUT A;  2HCI A;  1IYV A;  1HQM C;  2B8G A;  2F3W A;  2QKI C;  5JJK A;  4GKJ Q;  2SNM A;  4B3R Q;  3M4Y A;  5JJI A;  4JBM A;  1E1O A;  1O7L A;  4A3M H;  1E24 A;  5L37 A;  5J22 A;  3BJU A;  4UPA A;  1UUP A;  2JJQ A;  1VQO A;  4X6A H;  3GTL B;  1X3G A;  4C3I G;  1BBW A;  1FYC A;  2PI2 A;  1ICF B;  1VF5 C;  4R4O A;  1PFM A;  1KD1 C;  4OO1 I;  1A3U A;  3SK6 A;  4GN4 B;  1SDF A;  1C4Q A;  1HCZ A;  1G6Z A;  1YHA A;  3CAM A;  2XWJ B;  3BYY B;  4O1N A;  1F9S A;  3S1R H;  1LTI D;  1A6X A;  1MHW C;  3BYT B;  4NP5 A;  3D6C A;  1BQQ T;  5ELB A;  2WAQ B;  4Q0F A;  2R7F A;  4A3L H;  1XPR A;  2AWN A;  2KEN A;  1VQ9 A;  5EPL A;  1I3Q H;  1N36 Q;  2UXB L;  2XNA C;  2VQF L;  2JK8 A;  3EJI A;  1IBL L;  1DCZ A;  3PO2 H;  1JE5 A;  1CSP A;  3JAM L;  2YU9 B;  3W3A A;  5KNC A;  3A54 A;  3F1Z A;  1LTL A;  4WJW A;  1AZQ A;  1C9O A;  2VUM H;  2B2U C;  3TRE A;  3S1M B;  1VQC A;  1VQ6 A;  1DM0 B;  1HJP A;  2EDG A;  3NP8 A;  2XVS A;  3FVQ A;  1CT1 D;  5KNB A;  5C3E B;  3S24 A;  3MVV A;  4IUN A;  4GKJ L;  3CW2 C;  4B3R L;  4CDE C;  1GOZ A;  2PO4 A;  3VR3 A;  1YNJ D;  4OIJ A;  4JOI C;  3PIO 3;  2N8N A;  3CU7 A;  5I2X A;  1KDA A;  5ELD A;  3CF5 A;  3ER0 A;  1WD1 A;  4CKB A;  3PUV A;  4C2M H;  1CA6 A;  1YIT A;  4RHS A;  4ZKC B;  2MGS A;  5IYB G;  1BCP F;  3PO3 B;  2L11 A;  4B9X A;  4C3I H;  1STY A;  1IKL A;  2SDF A;  1TY2 A;  1EYD A;  3HOY B;  2Z6K A;  3MXP A;  1L0X B;  3BVM A;  3F2D A;  4ZK9 B;  4LNQ A;  4JG2 A;  5E4X A;  3H3V I;  4V0B A;  4L5T A;  1JB7 A;  3I56 A;  4J6H A;  3V96 A;  1QVC A;  1TY0 A;  3IFD A;  1K8G A;  3MXN A;  1N36 L;  1KNA A;  3I4M B;  2LXJ A;  1ZXT A;  1B9M A;  1STH A;  1HPC A;  1K8O A;  1PA6 A;  1UAP A;  3CCE A;  3X3M A;  3CCS A;  4BXX G;  4A4I A;  2F0N A;  1MI2 A;  4FXK C;  1X32 A;  4RWS C;  1PV4 A;  3QOJ A;  4N9T A;  1UNS A;  1W6K A;  4NPS A;  1TWH H;  3U58 A;  1O80 A;  3I7F A;  4XXE A;  5FLX E;  4A3B B;  4OWX B;  1R9T H;  2HDL A;  1A3V A;  2P5Z X;  4M8A A;  2QW7 A;  2F0H A;  4FXD A;  3D4D A;  2ES2 A;  3SGI A;  1HNW Q;  1EYA A;  4KHZ A;  3B6Y A;  1Q81 C;  2SNS A;  3KBX A;  4AYB E;  4ALP A;  1GUS A;  3BDL A;  1I4P A;  3C1E A;  3K5L A;  3J80 E;  4NXM Q;  3I91 A;  3T4A C;  1Q12 A;  4U68 A;  2EYH A;  3NEM A;  4RGT A;  1VQH A;  3G4S A;  1Z7T A;  5CV5 A;  5IYB H;  2JA8 B;  5IP7 G;  5IGG A;  1ICW A;  4B3S Q;  1W6J A;  2NZH A;  3P75 A;  5IE8 A;  5IT9 E;  4CJ1 B;  1Q7Y C;  1QIL A;  1D5Z C;  4WFN 3;  4OIK A;  1GVP A;  3CCJ A;  3RZO H;  3HOW B;  5M5Y B;  2OTJ A;  2RSO A;  1HRJ A;  2F1M A;  1BBU A;  4MTK A;  1S5C D;  1LTR D;  2JYO A;  1X6O A;  5IGD A;  5M3M G;  3G6J B;  3TP8 A;  4IFD J;  4KD3 A;  2D2C C;  4PMW A;  4QMG A;  2K7V A;  1EY5 A;  2TMP A;  4HMJ A;  3TP6 A;  2ZJR A;  1A2U A;  5IIF A;  3QO2 A;  5ELC A;  1I50 B;  2I5M X;  1TWC B;  3S2H B;  5A2Q L;  4BXX H;  3R93 A;  4HMI A;  1SAP A;  1HZ9 A;  5COR A;  3I72 A;  3K57 A;  4ZUJ A;  1ML0 D;  3BG3 A;  2EE1 A;  4FXG C;  3I4L A;  2NVY H;  4RG1 A;  2ZTD A;  1LUZ A;  1QVF A;  4B08 A;  5EQ0 A;  3KFU A;  1HNW L;  4GS3 A;  2I5L X;  2DY8 A;  3CMA A;  2LY7 A;  4IAL A;  2YYZ A;  1LT3 D;  2UXC Q;  1NMF A;  4A3I B;  2CWA A;  2EJF C;  4LJZ C;  3M4O B;  1ILQ A;  4A3J G;  1DXM A;  2OF1 A;  4B3S L;  1PZJ D;  5D3D A;  3JAM E;  5IP7 H;  3DEP A;  3VYT A;  5C3X A;  1F2Z A;  2K4K A;  1V9P A;  5LL6 X;  1KLG D;  4IPG A;  3HG9 A;  4XYQ A;  1FL0 A;  5FJ8 G;  2QCP X;  3GV6 A;  1VS0 A;  3NTK A;  5JPN C;  2F0J A;  3K59 A;  2Z0S A;  2E2D C;  3GTG H;  4F87 A;  5A35 A;  5JEA J;  3E5S A;  4JI8 Q;  3QOL A;  1A62 A;  1RCV D;  4RAU C;  5EPK A;  5CC4 A;  5I6Y A;  1ROD A;  3J81 E;  1BXT A;  1OTC A;  1G91 A;  5M3M H;  4DV4 Q;  1YIJ A;  5H1S E;  3SHL A;  3U50 C;  1HR0 Q;  4NXN Q;  2V1C C;  1I6H B;  4MHE A;  1GXD C;  1HFG A;  1Y1V G;  3Q8D A;  4LW1 A;  5KEE A;  2J7Z A;  5DAU A;  1SYE A;  4LFA Q;  2K01 A;  3NWT A;  1SN8 A;  2KUM A;  4A3F G;  4OO1 G;  2IX3 A;  1YJ9 A;  5EBD A;  5C4Z A;  5BN5 A;  1PYW D;  1K28 A;  2X69 A;  3VYS A;  4POF A;  5FK9 C;  1RTN A;  4XDX A;  1Z6H A;  1L2F A;  2L9H A;  1FNU A;  3RN2 A;  2UUB Q;  1KQS A;  2UXC L;  2Z4H A;  3SR1 A;  2B2Y C;  1GUT A;  3HOX B;  2LKV A;  1UE5 A;  2V4D A;  1NAP A;  4GNX A;  4TSS A;  4GOP C;  4A3J H;  3CPF A;  4EX5 A;  4CKC A;  5C3W A;  2HIX A;  4RA8 A;  1XMO Q;  3T1Y Q;  1KRS A;  1M4V A;  1I94 Q;  2K14 A;  1QVG A;  1VQ8 A;  3TS2 A;  5I4D A;  4JK1 C;  5FJ8 H;  1NE3 A;  1B44 D;  1D2B A;  1MSH A;  3M7N A;  5JVG 3;  4JI8 L;  2ZT9 C;  1W3S A;  3EFX D;  3PF4 A;  1LTA D;  1S5D D;  4DV4 L;  1MBY A;  2E2J H;  4OWT B;  3PSI A;  4P72 A;  2L55 A;  2L4N A;  4O2D A;  4NXN L;  1HR0 L;  1GJX A;  4KJO A;  1TWA B;  4R9W A;  3GDE A;  1A15 A;  5T1I A;  4A3E B;  1EIY B;  4PNY A;  3A8K E;  5HY6 A;  1MIU A;  2HQL A;  1PTO C;  2E2H B;  1Y1V H;  2ATW A;  2PQE A;  4LFA L;  4AIM A;  3S2D H;  5C4J B;  1J6Q A;  2YTV A;  1RL2 A;  4A3F H;  4OO1 H;  2RCF A;  3TEH B;  2PQA B;  2R7Z B;  3NUC A;  3K6O A;  2UUB L;  5CGK A;  5J3B A;  1J8I A;  1UEA B;  3KJP A;  3VA5 A;  2FJ2 A;  1YEZ A;  2XSC A;  5A2Q E;  4IOA A;  3PF5 A;  2HHH Q;  4A3D B;  2HDM A;  2EYL A;  1PZI D;  1XMO L;  3RZD H;  3T1Y L;  5KYI A;  4OXP A;  1I94 L;  1AE2 A;  3LGJ A;  2PPB C;  3A7A B;  3ICE A;  1V1O A;  1V43 A;  2EY6 A;  3NTI A;  4IUV A;  4CJ2 C;  1C48 A;  4QCL A;  1LM0 A;  2KBN A;  2EOT A;  1JC7 A;  1X65 A;  2F3V A;  1NBW A;  4BY7 G;  2A73 B;  1UEB A;  3PV0 A;  1CSQ A;  1F9R A;  1KIX A;  4UP8 A;  1RDP D;  3R2I A;  3FPP A;  4L5Q A;  4DR7 Q;  2ICI A;  1UWV A;  2F4I A;  4KY5 A;  1MGS A;  2OQ0 A;  1PH6 A;  2AHO B;  5GAD C;  2K75 A;  1JOR A;  3Q0A A;  1RTO A;  2XWB B;  1KL9 A;  5EKI A;  2JE6 I;  2ICE C;  4UAI A;  4YIJ A;  1NNX A;  3J80 i;  4PV1 C;  5LL6 S;  3MFG A;  2K50 A;  4IO9 A;  1SRO A;  1GHJ A;  2OXP A;  3NBH B;  2F0K A;  3OMC A;  3AFP A;  4H13 C;  4DXG A;  1KLU D;  3J7A 5;  1H9K A;  1CHQ D;  2A74 C;  1EL0 A;  1WYD A;  1RD9 D;  4XQN A;  2HHH L;  1II3 A;  1SFO H;  4I7A A;  4K5W A;  4BWG B;  4QIW B;  4KN7 C;  1VCI A;  1GHK A;  3CRK C;  4C3H B;  3MEF A;  1E1T A;  2DNE A;  5GAG C;  2K5N A;  2NVX H;  2F0S A;  1LYL A;  3S16 B;  4A93 B;  2EQS A;  4K2L A;  3CCM A;  1Q1E A;  2CH4 W;  2K33 A;  2VL6 A;  2QF7 A;  4BY7 H;  1PTO D;  2NZ1 D;  1QUQ A;  1YZ6 A;  1TWG B;  3K8A A;  3IAY A;  1L1O A;  1EYG A;  4LF7 Q;  4DR7 L;  3H91 A;  1BOS A;  3W5O A;  4K2K A;  1TS3 A;  2EPB A;  1YNX A;  4OEL B;  4AYB B;  1HQR D;  3HZX A;  4RGO S;  3U9O A;  2IY5 B;  2D9U A;  4A3G B;  4R1J A;  2H1E A;  2CVR A;  3EVQ A;  5K5P A;  1EY0 A;  1HHV A;  2HCC A;  5I6W A;  2B2W C;  1SLJ A;  1PHJ A;  4EVO A;  3PIP A;  5KRU A;  3WOF A;  1AP0 A;  3MXG A;  4IPH A;  3CKI B;  3S15 B;  1EQR A;  3IL8 A;  3GTJ H;  2XN9 C;  3MFY A;  4HIO A;  3W1B A;  1VQ7 A;  2O4X A;  3QWN A;  1QJO A;  1CHP D;  1LO5 D;  4UHV A;  1B4O A;  3DHQ A;  3JAM i;  1SRU A;  1EWI A;  1DOM A;  1S5E D;  5M3F B;  4DV2 Q;  1F9P A;  4JI2 Q;  1D1K A;  2EJG C;  1HH2 P;  3A5U A;  1Y8N B;  4DAP A;  4E6I A;  1U4P A;  1AZP A;  5CV6 A;  1GM5 A;  1PFN A;  1HUM A;  2EYJ A;  4QF4 A;  2VNU D;  5BR8 Q;  2QEX A;  4G7H C;  2MJ8 A;  1DOL A;  4C3I B;  1EU3 A;  1HZC A;  5JOB A;  4CJ0 B;  1VMP A;  1SE2 A;  1XX8 A;  1O78 A;  1OXS C;  4H02 A;  2K05 A;  1E2W A;  3CCV A;  1U4M A;  1EY6 A;  4BBR B;  3H0G G;  4LF8 Q;  2PQA A;  2RDF A;  3M3Y B;  3KYH C;  1B1Z A;  5M5X H;  4X3T A;  1GKH A;  1Y14 B;  4DV3 Q;  3FRP B;  4L5S A;  4LF7 L;  2Q2T A;  1GUG A;  1PYB A;  4KD4 A;  2F0Q A;  5FLM G;  3CXC A;  4IPD A;  3TP5 A;  1IYU A;  2EXZ A;  1JQY D;  1KTK A;  3H94 A;  3L0O A;  2OWO A;  3TS0 A;  5CBA E;  5IWA Q;  3OIP A;  2D0P A;  4G57 A;  1A0I A;  2F4V Q;  3HOZ G;  3SK5 A;  1U4R A;  3CCQ A;  4XT1 B;  1KRT A;  4LK1 C;  1B53 A;  4RKB A;  1BNZ A;  1ESR A;  3PUX A;  1WFQ A;  1G6P A;  2EY2 A;  3GTK H;  4LF9 Q;  4HTH A;  2ZTE A;  5E4W C;  1G29 1;  1YBY A;  4QGU A;  2R93 B;  4DV2 L;  3GTO B;  4JI2 L;  1BCP B;  3CHB D;  3AB9 A;  2A5H A;  4JYA Q;  4FF3 A;  2E75 C;  4R8I A;  1BCP C;  1QE6 A;  2JA5 G;  5KIX A;  1KAB A;  5IGB A;  1H95 A;  1H9S A;  1EZ6 A;  4YCW A;  1PXU A;  3HKZ G;  2EJM A;  1EY9 A;  5BR8 L;  3S17 H;  1TWF B;  5IYD G;  5EJW A;  4C1N K;  1Z9F A;  1VQA A;  2QEJ C;  1KNE A;  1PMR A;  2R92 G;  1Q82 C;  1XPU A;  4PZ7 A;  2JN4 A;  1HNX Q;  4LF8 L;  3NE5 B;  1J9O A;  4IN3 A;  4OGQ C;  5F2D A;  2KOL A;  2NTS A;  1RKN A;  3RLN A;  3H0G H;  1VQL A;  1AN8 A;  2B63 B;  5CV4 A;  3NBH A;  1JCK B;  4DV3 L;  2IL8 A;  1UE6 A;  5GAH C;  4JBK A;  2QIL A;  1F2Y A;  2NBF A;  1S72 A;  3ERS X;  2MPM A;  4HN7 A;  2L12 A;  5FLM H;  1STA A;  4XQJ A;  1JWU D;  4DA2 A;  3DWP A;  5IWA L;  1K8A C;  1JWS D;  1V1P A;  2F4V L;  1TR5 A;  4RGM A;  4XTC S;  3LX0 A;  4DUY Q;  3HOZ H;  3PIP 3;  3EBE A;  5CMD A;  3A8J E;  2KJX A;  1LTS D;  1CFM A;  1TU2 B;  2KCC A;  1E2Z A;  1EUJ A;  2RDG A;  1QZG A;  1IW7 C;  4LF9 L;  1SJE D;  1SNO A;  1S3O A;  3TZU A;  4DNI A;  1SYC A;  1BVS A;  2Z8L A;  2JA7 B;  4DK3 C;  4IUU A;  4RHR A;  1U9R A;  4JYA L;  2XTI A;  2K6A A;  2PMZ B;  4KHV A;  1WTH A;  1VQN A;  1FVI A;  3PQI A;  5C5L A;  3K5M A;  2PI2 E;  2OQK A;  3KDF B;  3CD6 A;  1MJC A;  5LMN W;  2JA5 H;  2LMC B;  1STB A;  5C0X I;  3K7U C;  4YCV A;  5JVH 3;  3S1Q H;  1ESF A;  3VR5 A;  2MP1 A;  3X3N A;  2AUJ D;  5IYD H;  5EPJ A;  1Y1W B;  1Q86 C;  3S14 H;  1V1Q A;  5IGF A;  2I46 A;  1HNX L;  2F0I A;  4ZCK A;  1JR0 D;  2R92 H;  2WAQ G;  2K5D A;  3Q22 A;  1GUW A;  4N9P A;  1GD7 A;  2YV5 A;  2KED A;  2B2V A;  3SDZ A;  3J7Y W;  2YTY A;  1YJW A;  1ET9 A;  1VQI A;  4JBW A;  4MTN A;  4TQU S;  1STG A;  2F0T A;  4QQB X;  1DOK A;  3T13 A;  4JI5 Q;  4RCO A;  1IHZ A;  3NWS A;  3J7A F;  4ID6 A;  1WTQ A;  5C44 B;  1UE7 A;  1B50 A;  2UUA Q;  2CW0 C;  1AW7 A;  4DUY L;  3F8T A;  4ME5 A;  1Q8I A;  3GD7 A;  4BY1 B;  2NUC A;  2BH2 A;  5C3E G;  2NVQ B;  2MQH A;  2KVM A;  1EOV A;  1BCP D;  3M7G A;  4DK6 C;  3U4Z A;  1WVL A;  2WB1 E;  3OHX C;  1I6V C;  2KHI A;  1PH5 A;  2GVA A;  4KV6 A;  2J0T D;  1MJE A;  2PW7 A;  3TSS A;  3I3C A;  4IPC A;  3GTP B;  2RDH A;  2C9O A;  3GTL H;  1PFS A;  3G7L A;  3PO3 G;  1PFB A;  3CC2 A;  1SYB A;  4EGV A;  2JQO A;  3HOY G;  3CCU A;  1VQ4 A;  1T9H A;  1WCM B;  4X64 Q;  2RHS B;  4K5V A;  2F0E A;  4FO2 A;  4XIG S;  3ZJY C;  3KBG A;  5D3I B;  4C1N I;  1KDB A;  1VQB A;  3HOU B;  2F0G A;  2WV6 D;  1SMY C;  4L6T B;  4J15 A;  2ENB A;  3STB C;  3I4M G;  2DN8 A;  3DWQ A;  3E0J A;  1LTB D;  3WDN A;  2O5I C;  4JI5 L;  1JJC B;  1U0L A;  3C3L A;  5K36 G;  1JOQ A;  1E7Z A;  4UDU C;  1KXL A;  1IW7 D;  1AEX A;  4ZQ3 A;  2UUA L;  1WD0 A;  2E2I B;  1G2T A;  4YWL A;  2R61 A;  3S1M H;  2EYM A;  4A3B G;  2F0M A;  4KHP Q;  1N32 Q;  3GV3 A;  5C3E H;  2KCT A;  4C3J B;  3OOC A;  2XRQ D;  4NXM L;  4EQ5 A;  2HIV A;  4JPB W;  4WRD A;  1K83 B;  1SR3 A;  4LUV A;  2F0V A;  3E3X A;  3BVG A;  1H9J A;  1ASZ A;  4PZ6 A;  1DJR D;  5CV9 A;  2B2U A;  3KOJ A;  2PCF B;  3D3R A;  4ULL A;  2VXW A;  3DWA A;  1NSN S;  4JI4 Q;  3I8Z A;  1TII D;  2JA8 G;  2N78 A;  3IKJ A;  3PO3 H;  2XGT A;  2DJF C;  1JJ2 A;  4BA2 I;  5FO9 B;  1R4P B;  1ZKO A;  4X64 L;  3HOY H;  1I4H A;  2F0F A;  4LF5 Q;  1LT4 D;  2Q8T A;  4JOI A;  3ZYY X;  3HOW G;  4C56 C;  3HRZ C;  1K0R A;  4OHJ A;  2C35 B;  1OO9 B;  3FKI B;  1SYF A;  2NVT B;  2DNC A;  5EBC A;  2CW0 D;  2RVL A;  2I07 B;  4JI3 Q;  3SVM A;  4CDC C;  4CBV A;  3I4M H;  2PZT A;  1PYS B;  4YY3 Q;  4HJ9 A;  4A3K B;  1SMX A;  1XWE A;  5K36 H;  1TKW B;  4CDD C;  1KHI A;  5IT9 c;  3OWF A;  5C4X B;  1EWC A;  3I4N B;  4QL5 A;  2EYO A;  3NXW A;  3KJO A;  4KHP L;  1N32 L;  2SEB D;  2WAQ E;  1E3P A;  4A3B H;  2D0O A;  1QOH A;  2Q2U A;  4DR5 Q;  2VS1 A;  5CV7 A;  1PH2 A;  2FMC A;  1FR3 A;  4MZ9 A;  4Z9C B;  2ZTC A;  2F0D A;  5J39 A;  4DXF A;  3UDI A;  2Y0S B;  3KF6 B;  5HGT A;  2MO1 A;  3T56 B;  5HUR A;  4DR6 Q;  1I5F A;  5LHY 1;  2Z4I A;  4GOP B;  4J8Q A;  4LUZ A;  3KLW A;  4RCN A;  5ISR A;  2G9D A;  2G9H D;  3UDX A;  5DLQ E;  1D8L A;  3Q24 A;  4JI4 L;  4A3I G;  3I55 A;  2K1B A;  3L7Z C;  4H0L C;  4DAV A;  1SMY D;  1AE3 A;  2JA8 H;  1CA5 A;  3H3V C;  3AYH B;  1KAW A;  2XRS D;  3STB D;  1XYI A;  4LF5 L;  4JCV E;  1VQG A;  3M85 A;  3H15 A;  4QUF A;  3KLR A;  4ZYS A;  4HIK A;  1Y69 U;  3KF8 B;  3HOW H;  1JJG A;  3K7A B;  2ZXR A;  1IL8 A;  1SYD A;  5M5Y H;  5M5W B;  3DLL A;  2NN6 I;  4Y7N B;  4JI3 L;  3G6E A;  1N8R C;  1I4G A;  4FF1 A;  4CDF C;  3R8B A;  3EN2 A;  4LF4 Q;  4YY3 L;  1I4R A;  1EQQ A;  3I2Z A;  3KK7 A;  1PTO B;  2N88 A;  2AKW B;  1XPO A;  1G8Z D;  2IWH A;  2O2L D;  1Q3L A;  2CQA A;  1I50 H;  1TWC H;  3A74 A;  3S2H H;  3S9W A;  3TRZ A;  3I90 A;  3ND8 A;  4FP5 D;  2PYK A;  4ZAI A;  3GTQ B;  5KND A;  4YWM A;  2WKC A;  2Z6B A;  3GTM B;  5E3F A;  3J7Z C;  3CCR A;  4DR5 L;  2F0U A;  3S1N B;  2KA7 A;  5C0X G;  3J81 c;  1SNQ A;  2CFM A;  3OMG A;  4DR6 L;  2JA6 G;  3ONA B;  4ME3 A;  3CC4 A;  1FGU A;  4OX9 Q;  1LT5 D;  1U5K A;  1YI2 A;  1E0B A;  3CC7 A;  1NTG A;  2FHT A;  4HR7 B;  2VW9 A;  3H09 A;  2CH4 A;  3HOX G;  3D8G A;  2AQ3 B;  2M2L A;  1IBK Q;  3RUZ A;  4A3I H;  3M4O H;  3I4O A;  3RMH A;  3L2P A;  2G5D A;  1SXT A;  1PH7 A;  4UP7 A;  2EXD A;  2LSS A;  4HSP A;  3OSO A;  4RKL A;  5I9O A;  3E6Z X;  3ND9 A;  2A6E C;  4QUC A;  1PDQ A;  5M9O A;  1SJH D;  3HKS A;  4BBS B;  1YNN C;  1D6E C;  2KEC A;  5LMN Q;  4LF4 L;  5D14 A;  4R4I A;  3KUP A;  2MUY A;  2IW3 A;  4DV6 Q;  3BS1 A;  3TBI B;  3RD4 A;  1C0A A;  1M90 C;  4OL7 A;  4GN3 B;  5DEH A;  3CQZ B;  3M4P A;  1Y8P B;  5ELF A;  2VZA A;  4RH6 A;  3K0X A;  4G7Z C;  2DJG C;  2N55 A;  2CHB D;  3NBI A;  2ALY B;  2FMM A;  2KEE A;  4A3E G;  4GKK Q;  1TS4 A;  2ZJP A;  2PW5 A;  1CKN B;  1A8V A;  3NQI A;  1BF4 A;  1I6H H;  5IGC A;  1VQK A;  3SK4 A;  2A6H C;  5KGU A;  1O7Z A;  2F3I A;  2A1A A;  1HA6 A;  1XXG A;  2BH8 A;  4UY8 C;  3AMU A;  2NB0 A;  2BDN A;  4KKU A;  1DYQ A;  2K52 A;  4A75 A;  2E74 C;  2F0O A;  5C0X H;  3A0J A;  2NWG A;  4BS9 A;  2R7Z G;  4OX9 L;  2LXK A;  2JA6 H;  1WOC A;  1YHB A;  4A3M B;  3NEN A;  5D65 A;  2ZM6 Q;  2R3Z A;  1X3F A;  5JPM C;  4LFB Q;  1IBK L;  2LFN A;  1C8C A;  3HOX H;  2DY7 A;  2OCE A;  2EYF A;  4DR2 Q;  1PH3 A;  4A3D G;  2CWP A;  2B2T A;  5FKA C;  1JMC A;  3E9H A;  4DPG A;  1F2M A;  3S1R B;  4KMU C;  2QGQ A;  4R4Q A;  4HCS A;  3VYU A;  3HOV G;  2NYZ D;  2B3G A;  3DMU A;  1WTX A;  5LMN L;  4CGY B;  1VDZ A;  2B2Y A;  3KF6 A;  1OXV A;  4JW0 A;  4DV6 L;  1I3Q B;  4OON A;  5J1Z A;  1SBB B;  3TP7 A;  4GOP A;  3GQB A;  1EOT A;  1EEI D;  4KI0 A;  2WB1 B;  3MEH A;  1SNC A;  3PO2 B;  4GKK L;  4DV5 Q;  1TWA H;  4JI0 Q;  2RBM A;  3BZK A;  4A3E H;  1AH9 A;  1PRT F;  1WI5 A;  2VUM B;  4HJA A;  4G7O C;  2RCN A;  4ZKB B;  1TS5 A;  1EFI D;  5G3L F;  1T5E A;  2OT2 A;  3QIA A;  2RSN A;  2RA4 A;  2E2H H;  3KF8 A;  1FD7 D;  2UU9 Q;  5I9P A;  5C4J H;  3K5O A;  4KY7 A;  1CZG A;  1BDO A;  2KCM A;  2Z6K C;  2R7Z H;  2ZM6 L;  1S4Z A;  2ID0 A;  2BA1 A;  1K0S A;  2IHF A;  3T51 B;  2ZJQ A;  4C2M B;  4JV5 Q;  4LFB L;  2RF4 A;  3MXN B;  4LWC A;  3UI2 A;  1H9R A;  2A6E D;  2M9V A;  4JC0 A;  1YNN D;  2JP1 A;  3P1H A;  3QB3 A;  3TME A;  4DR2 L;  1TS2 A;  2O5J C;  4LUO A;  4JI6 Q;  1X3Q A;  4A3D H;  3A55 A;  3CP0 A;  3RN5 A;  2GA4 B;  4C3H G;  5FO8 B;  1QB5 D;  4B9W A;  1EZ8 A;  4DR3 Q;  4YWK A;  1LTG D;  4ODG A;  1Z47 A;  4A93 G;  1LV9 A;  3CCL A;  4HIM A;  2A19 A;  1A63 A;  3HOV H;  3C46 A;  3AU7 A;  3DM1 A;  1SE4 A;  3F2B A;  4F7X A;  3BDO A;  2ASB A;  2MHV A;  1HR0 W;  1BO0 A;  2KHS A;  3U9S A;  1FNW A;  1PLF A;  3T53 B;  3VR6 A;  5DNF A;  2A6H D;  1HNZ Q;  2I5H A;  4X65 Q;  3K81 C;  1S5B D;  2EYP A;  3T1H Q;  4IJH A;  4K6L A;  4UP9 A;  3ULJ A;  1EY7 A;  3ULL A;  1VQP A;  4DV5 L;  4P75 A;  1TVX A;  1EU4 A;  1CQV A;  1P8L A;  2KQ3 A;  1SND A;  2C5C A;  4A3G G;  2VQF Q;  1JB3 A;  3OWE B;  1TWH B;  2X6L A;  4K14 A;  2HD3 A;  1H9M A;  2L5T A;  1PH8 A;  2UU9 L;  1BKB A;  4MIU A;  1R9T B;  1G2S A;  2N3S A;  5IT9 L;  3RLF A;  5COY A;  1HTP A;  3Q23 A;  3MTS A;  4LAA A;  2Q8I B;  4JV5 L;  1PH4 A;  3ITP A;  1IYJ B;  1HZA A;  5M3F G;  4K6D A;  1D5X C;  2K03 A;  1IZ6 A;  2NN6 G;  1ENA A;  3DUZ A;  3PCO B;  2OEO A;  1D5M C;  3NK9 A;  1EQV A;  2M00 A;  4JI6 L;  3HFZ B;  1CKN A;  1VQE A;  4R8N A;  4F88 A;  2FFK B;  4DR3 L;  2AQ2 B;  2FIN B;  3P20 A;  4C3H H;  3I70 A;  3RZO B;  1STN A;  4PMB A;  3S16 H;  2VY3 A;  1HZB A;  4A93 H;  4N8X 1;  4DKA C;  2JA9 A;  3K58 A;  4DGZ A;  1CM9 A;  1JIC A;  4BBR G;  4HED A;  3CME A;  2IHE A;  4JI1 Q;  1QZH A;  4NW2 A;  2YTX A;  2E5L Q;  4B3M Q;  4ABN A;  2VB2 X;  1CQF A;  1HNZ L;  2HT1 A;  4X65 L;  1SNP A;  3U4V A;  3KLS A;  3T1H L;  1TWG H;  1JOK A;  1DD2 A;  1QNU A;  3UE0 A;  2Q2H A;  3J81 j;  1PVO A;  5T1G A;  1ENC A;  4APV A;  3UDG A;  4DR1 Q;  2EZV A;  2Z1C A;  5NUC A;  4U67 3;  1JWM D;  1F9Q A;  5IGE A;  4A3G H;  3DM3 A;  2NVY B;  5IYC G;  1OXX K;  1VQM A;  1X54 A;  1HA5 A;  2QDB A;  4O42 A;  1E2V A;  3E9I A;  1P16 A;  2MO0 A;  3JC6 6;  3HP3 A;  2BOS A;  3S15 H;  2SOB A;  5EAY A;  4LFC Q;  2R93 G;  3PUY A;  3E0E A;  1SNM A;  5M3F H;  2GN5 A;  4DK0 A;  3J81 L;  3CRL C;  4KN4 C;  1G51 A;  2NN6 H;  3G48 A;  2B2W A;  2JEB I;  1N9W A;  4DV1 Q;  4HID A;  2IX1 A;  5LMU Q;  2UXD Q;  1QNK A;  5CR3 A;  3WOE A;  1N33 Q;  4FF2 A;  1JOO A;  4P74 A;  4IFD I;  1A2T A;  1K3B C;  2K5V A;  1NR2 A;  4X3K A;  1RJT A;  4JBJ A;  1XTD A;  1B7Y B;  2EIF A;  1Q90 A;  3GTG B;  1CI3 M;  3D6W A;  4JI1 L;  4KTA A;  2K28 A;  2E5L L;  4BBR H;  4CKE A;  4B3M L;  1XNQ Q;  2PZU A;  2B63 G;  5DM6 3;  3M3Y H;  1QWY A;  2PNR C;  2AMC B;  5M3M B;  3QR8 A;  1XNR Q;  4DR1 L;  2WAC A;  4QIW E;  3F2C A;  3LNN A;  3ERQ A;  1WTR A;  3DXJ C;  2DGY A;  4JI7 Q;  3D4W A;  5JJZ A;  3RLO A;  3FP9 A;  1O7I A;  3MAQ A;  4GNX B;  2WKD A;  3EA6 A;  5GRO A;  4EQP A;  3A7L A;  3L9A X;  5IYC H;  4I7Z C;  4DR4 Q;  4GNX C;  4LF6 Q;  3FEW X;  3FPU B;  1MSG A;  4RFB A;  4RMF A;  5HGQ A;  1DGS A;  4GLX A;  2WII B;  4LFC L;  1BUV T;  2JA7 G;  3K5N A;  3MC0 B;  2R93 H;  2HQE A;  4DN4 M;  3GTO H;  1LT6 D;  1XJV A;  1HUN A;  3TQY A;  4DV1 L;  2Q8R E;  5LMU L;  1M8A A;  1SE3 A;  1EWH A;  4P71 A;  2UXD L;  4A3J B;  4X62 Q;  1TWF H;  3SEB A;  1N33 L;  3J7A V;  5FO7 B;  4WOR A;  3ERO A;  1Y1W G;  4HJ7 A;  5CYU A;  4GLA C;  5BN3 A;  2BA0 A;  1VQF A;  1XNQ L;  1ASY A;  2D5D A;  2WP8 J;  4R4C A;  2K04 A;  4KLK A;  2J4X A;  3GO5 A;  4NDX A;  4X66 Q;  1L0Y B;  3A5Z B;  5C0X J;  1EY4 A;  3D31 A;  3OTO Q;  2B63 H;  3P7J A;  4O0A A;  2VB3 X;  3HKZ E;  5C5M A;  4DFA A;  1XNR L;  3W1G A;  2E2J B;  2AUK A;  1XMQ Q;  5GQO A;  4NKL A;  3SXH A;  5CBE E;  3WWV A;  2YU9 H;  5C44 G;  4JI7 L;  1FJG Q;  1GUO A;  4NMZ A;  3AFQ A;  5EGT A;  4ZLT F;  1K3R A;  1OXU A;  5JJL A;  1TXY A;  4KY6 A;  2Z9H A;  3Q6S A;  1Y1V B;  1L0W A;  4DR4 L;  1EEF D;  3S2D B;  1B9N A;  4BY1 G;  4LF6 L;  1F77 A;  4B3T Q;  1XTC D;  1ILP A;  4DK1 A;  4A3F B;  2RKS A;  1X3E A;  1VMC A;  5FOB B;  4RGN A;  1CKM A;  4HJ5 A;  4TVA B;  2F0L A;  2QDL A;  4OEM B;  2JA7 H;  3LWE A;  2CKZ B;  5AFW A;  2E76 C;  4A76 A;  1WTV A;  1LTT D;  3M4Q A;  5FLX c;  4POG A;  4YHH Q;  2L0C A;  4ILW A;  4DAY B;  4X62 L;  2K5W A;  2CQO A;  3RZD B;  1WCM G;  4HJ8 A;  1Y1W H;  1PH9 A;  1GO3 E;  1JT8 A;  1SSO A;  5E1F A;  2N49 A;  3J80 c;  4PZ8 A;  1F2L A;  3HOU G;  3GP7 A;  4X66 L;  3DEO A;  4IQZ A;  3OTO L;  1K9M C;  2MFI A;  2F03 A;  1ZYR C;  1NJI C;  2QA4 A;  1WTW A;  3KDF A;  1XMQ L;  1C7Y A;  3MHB A;  4DUZ Q;  4ZRZ A;  2GVB A;  3UDF A;  4IUQ A;  3C1F A;  3NEL A;  1FJG L;  5C44 H;  4K8I A;  1D1I A;  2B29 A;  2BDO A;  2PZW A;  4G4K A;  5C6A A;  1V8Q A;  4XYO A;  4B3T L;  4J1M A;  2JXM B;  1HTL D;  1AFP A;  4BY1 H;  2NVQ H;  4C3J G;  1RIP A;  3F2U A;  5JAV A;  1B8A A;  3IFT A;  2B8F A;  3KLS X;  2B2T C;  4OWW B;  3QJY A;  2BE5 C;  4FNF A;  3MXU A;  2A69 C;  1NR4 A;  2JA6 B;  4YHH L;  3V2T A;  1CZW A;  1FNV A;  1WTO A;  2I0Q A;  1QUQ B;  4V19 0;  3GTP H;  1SFO B;  1L1O B;  1UE1 A;  3K80 C;  1VQJ A;  3PMF A;  1L1O C;  3L3O C;  4IUP A;  3SE0 A;  1NUC A;  1U4L A;  3PUW A;  4LMQ D;  2NVX B;  2AWO A;  4F8M A;  3MA2 B;  1WCM H;  4QJF A;  1B3A A;  2WIN B;  3SK8 A;  1EIF A;  1ET6 A;  4L8J A;  4DNT B;  3FKI G;  4BA1 I;  3EQL C;  4P2C B;  3HOU H;  2RQX A;  4BY7 B;  2PMZ E;  1EQT A;  5GAE C;  2K32 A;  3JAM c;  2AQ1 B;  1GUN A;  3PUZ A;  4DNR B;  3A8I E;  4P73 A;  4DUZ L;  4A3K G;  1HFN A;  5BN4 A;  1DZ1 A;  1PH1 A;  4YCU A;  4AH6 A;  2OTL A; 
#chains in the Genus database with same CATH homology
 1RF2 D;  2BCO A;  3D4R A;  4HSV A;  2X6G A;  1CTM A;  4ZUI A;  1T5X D;  3R2T A;  1I4Q A;  2D62 A;  4H44 C;  4Q5V A;  5I2Y A;  4TKO B;  4FF4 A;  1B2T A;  1RHP A;  3GTJ B;  3TDQ A;  3NPP A;  4IFD G;  1JE4 A;  3NHH A;  1EYC A;  3TZD A;  1BBX C;  3VR4 A;  2F0W A;  1K8M A;  5IOC A;  1QCB D;  2LS0 1;  5IOD A;  3O13 A;  2A68 C;  1ZYR D;  2NTT A;  2EVB A;  3HGB A;  1IKM A;  4X3U A;  3V05 A;  4FYD A;  3R3O A;  1QG7 A;  3HOV B;  3I73 A;  1TT2 A;  5M5X B;  4PMC A;  4H7B A;  1EY8 A;  1VF7 A;  1PRT B;  4EQN A;  3TN2 A;  1PRT C;  3QG1 A;  4DAY A;  2H4O A;  4FVM A;  1LAC A;  4IZ8 A;  2B39 A;  3VYR A;  2BE5 D;  2A69 D;  1H9S B;  1TQO A;  1PTO F;  5CV8 A;  5JEA G;  1ENF A;  5EKL A;  4KKS A;  3VA7 A;  3GTK B;  4KJN A;  4GZY C;  2HUG A;  4KK7 A;  4IFD H;  2R6G A;  2F0P A;  4XT3 B;  4DU9 A;  1X3P A;  4K8J A;  2JEA I;  5KYL A;  2ZXP A;  5DM7 3;  3S17 B;  4TRD A;  3OW7 A;  1FGB D;  1ONL A;  3BVZ A;  1NCV A;  3OIQ A;  3T16 A;  4HCE A;  1V1P B;  3C2P A;  3FDT A;  2L1B A;  1DON A;  3VR2 A;  3FMC A;  1I4X A;  1KAA A;  1LAB A;  3H0G B;  3NSW A;  2KCN A;  1WTP A;  5ELE A;  3BZD B;  1PTO H;  2ZXO A;  4KKT A;  3LWU A;  2TSS A;  1O7Y A;  1BR9 A;  3HOZ B;  1CK1 A;  2IJ0 A;  1OXT A;  5JEA H;  4K5X A;  1PZK D;  2XIW A;  2A68 D;  4XQQ A;  1R4Q B;  1MD2 D;  1ZEQ X;  3N6R A;  5EKK A;  1EIH A;  3N52 A;  4HAE A;  4MN3 A;  3OPO A;  1HXY D;  4PQX A;  2B2V C;  1STE A;  2JA5 B;  2JSO A;  1SEB D;  4EQO A;  3S1Q B;  3HKZ B;  1EIG A;  1LLR D;  4QB4 A;  1YNJ C;  3W2D A;  4CHT B;  5FLX L;  3URY A;  3S14 B;  1Q1B A;  4L63 B;  1A3T A;  2R92 B;  3A56 A;  1PRT D;  2EY5 A;  4DF7 A;  1SYG A;  3HS0 C;  2IX0 A;  3NQT A;  5G3L D;  3K0Y A;  3MZ5 A;  3MWY W;  1Y8O B;  3HEJ A;  4M1U B;  1KDC A;  5C4H A;  2K5Q A;  3J80 L;  1S5F D;  3BDC A;  3NTH A;  4I65 A;  3H6M A;  2EY1 A;  4X3S A;  4S3S A;  2IPK D;  4IUR A;  2IT1 A;  5TSS A;  4IUT A;  2HCI A;  1IYV A;  1HQM C;  2B8G A;  2F3W A;  2QKI C;  2SNM A;  3M4Y A;  1O7L A;  5J22 A;  1UUP A;  3GTL B;  4C3I G;  1FYC A;  1VF5 C;  1PFM A;  4OO1 I;  1A3U A;  3SK6 A;  1SDF A;  1C4Q A;  1HCZ A;  1G6Z A;  2XWJ B;  3BYY B;  4O1N A;  1F9S A;  1A6X A;  1LTI D;  3BYT B;  4NP5 A;  3D6C A;  1BQQ T;  5ELB A;  2WAQ B;  4Q0F A;  2AWN A;  5EPL A;  2XNA C;  3EJI A;  1DCZ A;  3JAM L;  2YU9 B;  3W3A A;  5KNC A;  3A54 A;  4WJW A;  1AZQ A;  2B2U C;  3S1M B;  1DM0 B;  2EDG A;  3NP8 A;  2XVS A;  3FVQ A;  1CT1 D;  5KNB A;  5C3E B;  3MVV A;  4IUN A;  1GOZ A;  2PO4 A;  3VR3 A;  1YNJ D;  4OIJ A;  3PIO 3;  3CU7 A;  5I2X A;  1KDA A;  5ELD A;  1WD1 A;  4CKB A;  3PUV A;  1CA6 A;  4RHS A;  4ZKC B;  2MGS A;  1BCP F;  3PO3 B;  2L11 A;  4B9X A;  1STY A;  1IKL A;  2SDF A;  1TY2 A;  1EYD A;  3HOY B;  3MXP A;  1L0X B;  3BVM A;  4ZK9 B;  5E4X A;  4V0B A;  4J6H A;  3V96 A;  1TY0 A;  3IFD A;  3MXN A;  1KNA A;  3I4M B;  1ZXT A;  1B9M A;  1STH A;  1HPC A;  1K8O A;  1UAP A;  3X3M A;  2F0N A;  1MI2 A;  4FXK C;  1X32 A;  4RWS C;  3QOJ A;  4N9T A;  1UNS A;  1W6K A;  1O80 A;  4XXE A;  5FLX E;  4A3B B;  2HDL A;  1A3V A;  4M8A A;  4FXD A;  2F0H A;  3D4D A;  1EYA A;  4KHZ A;  2SNS A;  3KBX A;  1GUS A;  3BDL A;  1I4P A;  3C1E A;  3K5L A;  3J80 E;  3I91 A;  3T4A C;  1Q12 A;  4U68 A;  2EYH A;  4RGT A;  1Z7T A;  5CV5 A;  2JA8 B;  5IGG A;  1ICW A;  1W6J A;  3P75 A;  5IT9 E;  4CJ1 B;  1QIL A;  1D5Z C;  4WFN 3;  4OIK A;  3HOW B;  5M5Y B;  2RSO A;  1HRJ A;  2F1M A;  1S5C D;  1LTR D;  2JYO A;  5IGD A;  3G6J B;  3TP8 A;  4IFD J;  4KD3 A;  2D2C C;  4PMW A;  4QMG A;  2K7V A;  1EY5 A;  2TMP A;  4HMJ A;  3TP6 A;  1A2U A;  5IIF A;  3QO2 A;  5ELC A;  1I50 B;  1TWC B;  3S2H B;  5A2Q L;  3R93 A;  4HMI A;  1SAP A;  5COR A;  3I72 A;  3K57 A;  4ZUJ A;  1ML0 D;  3BG3 A;  2EE1 A;  4FXG C;  3I4L A;  4B08 A;  5EQ0 A;  2DY8 A;  2LY7 A;  4IAL A;  2YYZ A;  1LT3 D;  4A3I B;  2EJF C;  3M4O B;  4LJZ C;  1ILQ A;  1DXM A;  2OF1 A;  1PZJ D;  5D3D A;  3JAM E;  3DEP A;  3VYT A;  5C3X A;  1F2Z A;  5LL6 X;  1KLG D;  3HG9 A;  4XYQ A;  2QCP X;  3GV6 A;  3NTK A;  5JPN C;  2F0J A;  3K59 A;  2E2D C;  4F87 A;  5A35 A;  5JEA J;  3E5S A;  3QOL A;  1RCV D;  4RAU C;  5EPK A;  5CC4 A;  5I6Y A;  1ROD A;  3J81 E;  1BXT A;  1G91 A;  3SHL A;  1I6H B;  4MHE A;  1GXD C;  1HFG A;  5KEE A;  2J7Z A;  5DAU A;  1SYE A;  2K01 A;  3NWT A;  2KUM A;  4OO1 G;  2IX3 A;  5EBD A;  5C4Z A;  5BN5 A;  1PYW D;  2X69 A;  3VYS A;  5FK9 C;  1RTN A;  4XDX A;  1Z6H A;  2L9H A;  1FNU A;  2Z4H A;  3SR1 A;  2B2Y C;  1GUT A;  3HOX B;  2LKV A;  2V4D A;  1NAP A;  4TSS A;  4CKC A;  5C3W A;  4RA8 A;  1M4V A;  5I4D A;  4JK1 C;  1B44 D;  1D2B A;  1MSH A;  3M7N A;  5JVG 3;  2ZT9 C;  3EFX D;  1LTA D;  1S5D D;  1MBY A;  2L55 A;  2L4N A;  1GJX A;  4KJO A;  1TWA B;  4R9W A;  1A15 A;  5T1I A;  4A3E B;  4PNY A;  3A8K E;  1PTO C;  2E2H B;  2PQE A;  5C4J B;  4OO1 H;  2R7Z B;  3NUC A;  3K6O A;  5CGK A;  1J8I A;  1UEA B;  3VA5 A;  2FJ2 A;  2XSC A;  5A2Q E;  4A3D B;  2HDM A;  2EYL A;  1PZI D;  5KYI A;  2PPB C;  3A7A B;  1V1O A;  1V43 A;  2EY6 A;  3NTI A;  4IUV A;  4CJ2 C;  1C48 A;  4QCL A;  2EOT A;  1JC7 A;  2F3V A;  2A73 B;  3PV0 A;  1F9R A;  1RDP D;  3R2I A;  3FPP A;  2ICI A;  2F4I A;  4KY5 A;  1MGS A;  1JOR A;  3Q0A A;  1RTO A;  2XWB B;  5EKI A;  2JE6 I;  2ICE C;  4UAI A;  4YIJ A;  4PV1 C;  5LL6 S;  3MFG A;  1GHJ A;  2OXP A;  2F0K A;  3OMC A;  4H13 C;  4DXG A;  1KLU D;  1H9K A;  1CHQ D;  2A74 C;  1EL0 A;  1RD9 D;  4XQN A;  1II3 A;  4K5W A;  4BWG B;  4QIW B;  4KN7 C;  1VCI A;  1GHK A;  3CRK C;  4C3H B;  2DNE A;  2F0S A;  3S16 B;  4A93 B;  4K2L A;  1Q1E A;  2K33 A;  2QF7 A;  1PTO D;  2NZ1 D;  1TWG B;  3IAY A;  3H91 A;  1BOS A;  4K2K A;  1TS3 A;  2EPB A;  4AYB B;  1HQR D;  3HZX A;  4RGO S;  3U9O A;  2D9U A;  4A3G B;  2H1E A;  2CVR A;  3EVQ A;  5K5P A;  1EY0 A;  1HHV A;  2HCC A;  5I6W A;  2B2W C;  4EVO A;  5KRU A;  3WOF A;  1AP0 A;  3MXG A;  3CKI B;  3S15 B;  3IL8 A;  2XN9 C;  3MFY A;  2O4X A;  3QWN A;  1QJO A;  1CHP D;  1LO5 D;  1B4O A;  3DHQ A;  1DOM A;  1S5E D;  5M3F B;  1F9P A;  1D1K A;  2EJG C;  1Y8N B;  4DAP A;  4E6I A;  1U4P A;  1AZP A;  5CV6 A;  1PFN A;  1HUM A;  2EYJ A;  4QF4 A;  2VNU D;  4G7H C;  2MJ8 A;  1DOL A;  4C3I B;  1EU3 A;  5JOB A;  4CJ0 B;  1VMP A;  1SE2 A;  1XX8 A;  1O78 A;  1OXS C;  2K05 A;  1E2W A;  1U4M A;  1EY6 A;  4BBR B;  2RDF A;  3M3Y B;  1B1Z A;  4X3T A;  3FRP B;  1GUG A;  4KD4 A;  2F0Q A;  3TP5 A;  1IYU A;  2EXZ A;  1JQY D;  1KTK A;  3H94 A;  5CBA E;  3OIP A;  4G57 A;  3SK5 A;  1U4R A;  4XT1 B;  4LK1 C;  1B53 A;  4RKB A;  1BNZ A;  1ESR A;  3PUX A;  2EY2 A;  4HTH A;  5E4W C;  1G29 1;  2R93 B;  3GTO B;  1BCP B;  3CHB D;  3AB9 A;  2A5H A;  4FF3 A;  2E75 C;  4R8I A;  1BCP C;  1QE6 A;  5KIX A;  1KAB A;  5IGB A;  1H9S A;  1EZ6 A;  1PXU A;  2EJM A;  1EY9 A;  1TWF B;  5EJW A;  4C1N K;  2QEJ C;  1KNE A;  1PMR A;  3NE5 B;  1J9O A;  4IN3 A;  4OGQ C;  5F2D A;  2KOL A;  2NTS A;  1RKN A;  1AN8 A;  2B63 B;  5CV4 A;  3NBH A;  1JCK B;  2IL8 A;  2QIL A;  1F2Y A;  2NBF A;  2MPM A;  4HN7 A;  2L12 A;  1STA A;  4XQJ A;  1JWU D;  4DA2 A;  3DWP A;  1JWS D;  1V1P A;  1TR5 A;  4RGM A;  4XTC S;  3LX0 A;  3PIP 3;  5CMD A;  3A8J E;  2KJX A;  1LTS D;  1CFM A;  1TU2 B;  2KCC A;  1E2Z A;  2RDG A;  1IW7 C;  1SJE D;  1SNO A;  3TZU A;  1SYC A;  2Z8L A;  2JA7 B;  4IUU A;  4RHR A;  1U9R A;  2K6A A;  2PMZ B;  4KHV A;  5C5L A;  3K5M A;  2LMC B;  1STB A;  5C0X I;  5JVH 3;  1ESF A;  3VR5 A;  2MP1 A;  3X3N A;  2AUJ D;  5EPJ A;  1Y1W B;  5IGF A;  2I46 A;  2F0I A;  1JR0 D;  2K5D A;  3Q22 A;  1GUW A;  4N9P A;  2KED A;  2B2V A;  3SDZ A;  3J7Y W;  1ET9 A;  4JBW A;  4TQU S;  1STG A;  2F0T A;  1DOK A;  3T13 A;  4RCO A;  1IHZ A;  3NWS A;  3J7A F;  4ID6 A;  1WTQ A;  5C44 B;  1B50 A;  2CW0 C;  1AW7 A;  4ME5 A;  1Q8I A;  3GD7 A;  4BY1 B;  2NUC A;  2NVQ B;  2KVM A;  3M7G A;  1BCP D;  1WVL A;  3OHX C;  1I6V C;  4KV6 A;  2J0T D;  2PW7 A;  3TSS A;  3I3C A;  3GTP B;  2RDH A;  2C9O A;  3G7L A;  1PFB A;  1SYB A;  4EGV A;  1WCM B;  4K5V A;  2F0E A;  4FO2 A;  4XIG S;  3KBG A;  5D3I B;  4C1N I;  1KDB A;  3HOU B;  2F0G A;  2WV6 D;  1SMY C;  4L6T B;  2ENB A;  2DN8 A;  3DWQ A;  3E0J A;  1LTB D;  3WDN A;  2O5I C;  3C3L A;  5K36 G;  1JOQ A;  4UDU C;  1IW7 D;  1AEX A;  4ZQ3 A;  2E2I B;  1WD0 A;  1G2T A;  2R61 A;  2EYM A;  2F0M A;  3GV3 A;  4C3J B;  3OOC A;  2XRQ D;  4WRD A;  1K83 B;  2F0V A;  3BVG A;  1H9J A;  1DJR D;  5CV9 A;  2B2U A;  2PCF B;  3D3R A;  4ULL A;  2VXW A;  3DWA A;  1NSN S;  3I8Z A;  1TII D;  3IKJ A;  4BA2 I;  5FO9 B;  1R4P B;  1ZKO A;  1I4H A;  2F0F A;  1LT4 D;  2Q8T A;  3ZYY X;  4C56 C;  3HRZ C;  4OHJ A;  1OO9 B;  3FKI B;  1SYF A;  2NVT B;  2DNC A;  5EBC A;  2CW0 D;  2RVL A;  2I07 B;  3SVM A;  4CBV A;  2PZT A;  4A3K B;  1XWE A;  5K36 H;  1TKW B;  3OWF A;  5C4X B;  1EWC A;  3I4N B;  2EYO A;  3NXW A;  2SEB D;  1QOH A;  5CV7 A;  2FMC A;  1FR3 A;  4Z9C B;  2F0D A;  5J39 A;  4DXF A;  2Y0S B;  5HGT A;  3T56 B;  5HUR A;  5LHY 1;  2Z4I A;  4J8Q A;  4RCN A;  5ISR A;  2G9D A;  2G9H D;  3Q24 A;  2K1B A;  3L7Z C;  4H0L C;  4DAV A;  1SMY D;  1CA5 A;  3H3V C;  2XRS D;  1XYI A;  3M85 A;  4QUF A;  3KLR A;  4ZYS A;  1Y69 U;  3K7A B;  2ZXR A;  1IL8 A;  1SYD A;  5M5W B;  2NN6 I;  4Y7N B;  1I4G A;  4FF1 A;  3R8B A;  1I4R A;  3KK7 A;  1PTO B;  2N88 A;  1G8Z D;  2IWH A;  2O2L D;  1Q3L A;  2CQA A;  3S9W A;  3I90 A;  3ND8 A;  2PYK A;  4FP5 D;  4ZAI A;  3GTQ B;  5KND A;  2WKC A;  3GTM B;  5E3F A;  2F0U A;  3S1N B;  2KA7 A;  5C0X G;  1SNQ A;  3OMG A;  3ONA B;  1LT5 D;  1E0B A;  2FHT A;  4HR7 B;  3H09 A;  3D8G A;  2AQ3 B;  2M2L A;  3RUZ A;  3RMH A;  1SXT A;  4HSP A;  3OSO A;  4RKL A;  5I9O A;  3E6Z X;  3ND9 A;  2A6E C;  4QUC A;  1PDQ A;  5M9O A;  1SJH D;  4BBS B;  1YNN C;  1D6E C;  2KEC A;  5D14 A;  3KUP A;  2MUY A;  2IW3 A;  3BS1 A;  3TBI B;  3RD4 A;  4OL7 A;  5DEH A;  3CQZ B;  1Y8P B;  5ELF A;  4G7Z C;  4RH6 A;  2N55 A;  2CHB D;  3NBI A;  2FMM A;  2KEE A;  1TS4 A;  2PW5 A;  3NQI A;  1BF4 A;  5IGC A;  3SK4 A;  2A6H C;  5KGU A;  1O7Z A;  1HA6 A;  1XXG A;  3AMU A;  2NB0 A;  2BDN A;  4KKU A;  1DYQ A;  2E74 C;  2F0O A;  5C0X H;  2NWG A;  4BS9 A;  4A3M B;  5D65 A;  2R3Z A;  5JPM C;  2LFN A;  1C8C A;  2DY7 A;  2EYF A;  2B2T A;  5FKA C;  1F2M A;  3S1R B;  4KMU C;  4HCS A;  3VYU A;  2NYZ D;  3DMU A;  1WTX A;  4CGY B;  1VDZ A;  2B2Y A;  1OXV A;  1I3Q B;  5J1Z A;  1SBB B;  3TP7 A;  3GQB A;  1EOT A;  1EEI D;  4KI0 A;  2WB1 B;  3MEH A;  1SNC A;  3PO2 B;  2RBM A;  1PRT F;  2VUM B;  4G7O C;  4ZKB B;  1TS5 A;  1EFI D;  5G3L F;  1T5E A;  2OT2 A;  3QIA A;  2RSN A;  2RA4 A;  3KF8 A;  1FD7 D;  5I9P A;  3K5O A;  4KY7 A;  1CZG A;  1BDO A;  1S4Z A;  2ID0 A;  2BA1 A;  3T51 B;  4C2M B;  3UI2 A;  1H9R A;  2A6E D;  2M9V A;  1YNN D;  2JP1 A;  3P1H A;  3QB3 A;  3TME A;  1TS2 A;  2O5J C;  1X3Q A;  3A55 A;  2GA4 B;  4C3H G;  5FO8 B;  1QB5 D;  4B9W A;  1EZ8 A;  1LTG D;  4ODG A;  1Z47 A;  1LV9 A;  3C46 A;  3AU7 A;  3DM1 A;  1SE4 A;  4F7X A;  3BDO A;  2MHV A;  1BO0 A;  2KHS A;  3U9S A;  1FNW A;  1PLF A;  3T53 B;  3VR6 A;  5DNF A;  2A6H D;  1S5B D;  2EYP A;  4K6L A;  1EY7 A;  1TVX A;  1EU4 A;  1CQV A;  2KQ3 A;  1SND A;  2C5C A;  1JB3 A;  3OWE B;  1TWH B;  2X6L A;  4K14 A;  1H9M A;  2L5T A;  4MIU A;  1R9T B;  1G2S A;  5IT9 L;  3RLF A;  5COY A;  1HTP A;  3Q23 A;  3MTS A;  4LAA A;  2Q8I B;  3ITP A;  4K6D A;  1D5X C;  2K03 A;  2NN6 G;  1ENA A;  3DUZ A;  2OEO A;  1D5M C;  3NK9 A;  1EQV A;  2M00 A;  4F88 A;  4R8N A;  2FFK B;  2AQ2 B;  2FIN B;  3P20 A;  3I70 A;  3RZO B;  1STN A;  4PMB A;  3K58 A;  4DGZ A;  1CM9 A;  1JIC A;  4HED A;  4NW2 A;  4ABN A;  2VB2 X;  1CQF A;  1SNP A;  3KLS A;  1JOK A;  1DD2 A;  1QNU A;  5T1G A;  1ENC A;  2EZV A;  2Z1C A;  5NUC A;  4U67 3;  1JWM D;  1F9Q A;  5IGE A;  2NVY B;  1OXX K;  1HA5 A;  2QDB A;  4O42 A;  1E2V A;  3HP3 A;  2BOS A;  2SOB A;  3PUY A;  1SNM A;  4DK0 A;  3J81 L;  3CRL C;  4KN4 C;  2NN6 H;  2B2W A;  2JEB I;  2IX1 A;  1QNK A;  5CR3 A;  3WOE A;  4FF2 A;  1JOO A;  4IFD I;  1A2T A;  1NR2 A;  4X3K A;  1RJT A;  1Q90 A;  3GTG B;  1CI3 M;  3D6W A;  4KTA A;  2K28 A;  4CKE A;  2PZU A;  5DM6 3;  1QWY A;  2PNR C;  5M3M B;  2WAC A;  3LNN A;  3ERQ A;  1WTR A;  3DXJ C;  3D4W A;  5JJZ A;  3MAQ A;  2WKD A;  3EA6 A;  4EQP A;  3A7L A;  3L9A X;  4I7Z C;  3FEW X;  3FPU B;  1MSG A;  4RFB A;  2WII B;  1BUV T;  3K5N A;  3MC0 B;  2HQE A;  4DN4 M;  1LT6 D;  1HUN A;  2Q8R E;  1M8A A;  1SE3 A;  1EWH A;  4A3J B;  3SEB A;  3J7A V;  5FO7 B;  4WOR A;  3ERO A;  5CYU A;  5BN3 A;  2BA0 A;  2D5D A;  2WP8 J;  2K04 A;  2J4X A;  3GO5 A;  4NDX A;  5C0X J;  1L0Y B;  1EY4 A;  3D31 A;  3P7J A;  2VB3 X;  5C5M A;  4DFA A;  2E2J B;  2AUK A;  3SXH A;  4NKL A;  5CBE E;  1GUO A;  4NMZ A;  5EGT A;  4ZLT F;  1OXU A;  4KY6 A;  3Q6S A;  1Y1V B;  1EEF D;  3S2D B;  1B9N A;  1F77 A;  1XTC D;  1ILP A;  4DK1 A;  4A3F B;  2RKS A;  5FOB B;  1VMC A;  4RGN A;  2F0L A;  3LWE A;  5AFW A;  2E76 C;  1WTV A;  1LTT D;  2L0C A;  4ILW A;  2K5W A;  3RZD B;  1SSO A;  5E1F A;  1F2L A;  3GP7 A;  3DEO A;  4IQZ A;  2F03 A;  1ZYR C;  1WTW A;  3MHB A;  4ZRZ A;  4IUQ A;  3C1F A;  4K8I A;  1D1I A;  2BDO A;  2PZW A;  4G4K A;  5C6A A;  1V8Q A;  4XYO A;  4J1M A;  2JXM B;  1HTL D;  1AFP A;  4C3J G;  3F2U A;  5JAV A;  3IFT A;  2B8F A;  3KLS X;  2B2T C;  3QJY A;  2BE5 C;  4FNF A;  3MXU A;  2A69 C;  1NR4 A;  2JA6 B;  3V2T A;  1CZW A;  1FNV A;  1WTO A;  4V19 0;  1SFO B;  3PMF A;  4IUP A;  3L3O C;  3SE0 A;  1NUC A;  1U4L A;  3PUW A;  4LMQ D;  2NVX B;  2AWO A;  4F8M A;  3MA2 B;  1B3A A;  2WIN B;  3SK8 A;  1ET6 A;  4L8J A;  4DNT B;  4BA1 I;  3EQL C;  4P2C B;  2RQX A;  4BY7 B;  1EQT A;  2K32 A;  2AQ1 B;  1GUN A;  3PUZ A;  4DNR B;  3A8I E;  1HFN A;  5BN4 A;  1DZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...