2PZWA

Crystal structure of staphylococcal nuclease variant v66n/p117g/h124l/s128a at room temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMNENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 38
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pzwA00
1F2ZA 4NMZA 3MHBA 2F0GA 5KYLA 1RKNA 4NKLA 1EQVA 1STAA 3OMCA 5C5MA 1STBA 3H6MA 2F0IA 1TQOA 5EGTA 1KDBA 3C1EA 3QOJA 3SXHA 5C3XA 1TT2A 3E5SA 4F7XA 1SNDA 4LAAA 2OXPA 1NUCA 4QB4A 2F0UA 4KY7A 1A3UA 3NUCA 4TRDA 5CV6A 4IZ8A 5IOCA 3DMUA 1JOOA 5I6WA 2EYMA 2SOBA 3QB3A 4NP5A 4EQPA 1EY0A 1JOKA 5C5LA 3BDLA 2PQEA 2F0HA 5CR3A 5J22A 1STHA 1F2YA 1SNOA 4OL7A 2F0NA 5IIFA 2F0FA 4K8IA 2F0OA 3P1HA 2F0JA 3TMEA 3D6CA 2ENBA 1KABA 5CC4A 2OF1A 3DHQA 1SYDA 4EQOA 2PZUA 4K5XA 5E1FA 3TP6A 3QOLA 2SNMA 1IHZA 2PYKA 1II3A 2KQ3A 3D4WA 4YIJA 5IGFA 2M00A 2EYJA 4ZUIA 4J6HA 1JOQA 4K14A 3OWFA 2F0KA 5KGUA 1EYDA 1EY6A 1STYA 1STNA 2KHSA 2HQEA 2WACA 1EY4A 5CV8A 5IGCA 3NK9A 3T16A 5NUCA 5HGTA 2EY5A 2F3WA 1A2UA 3OSOA 1SYEA 3P75A 1KDCA 4B9XA 4ODGA 4I65A 3MVVA 3SHLA 4IALA 1SNCA 3VA5A 4DGZA 2RDFA 4J1MA 1EY5A 3NHHA 1SNPA 4K2LA 4KTAA 2F0PA 3ERQA 3SK5A 1A2TA 1F2MA 3SK8A 3SR1A 2F0SA 4K5WA 4WRDA 3U9OA 4F8MA 3HZXA 2QDBA 5I9OA 4PNYA 4PMBA 1JORA 2F0QA 3SK4A 5CV9A 5CV4A 5KIXA 4QF4A 2O4XA 4ME5A 5EKLA 3TP8A 2NUCA 5KRUA 1SYGA 1A3VA 1STGA 2PZTA 1SNMA 4KY5A 2EXZA 1EYCA 4K2KA 5IODA 5KYIA 5EKKA 4N9PA 3NP8A 4S3SA 3T13A 4IUNA 4EQNA 5IGEA 5JAVA 3S9WA 5ISRA 2EYLA 4DF7A 1TR5A 3BDCA 3HEJA 3ITPA 3D4DA 4ZQ3A 4E6IA 5IGDA 2F0TA 2EY2A 5K5PA 3NXWA 4K6DA 4RKBA 5KEEA 3RUZA 4NDXA 5C3WA 4KJOA 3EVQA 4KD3A 2EY1A 1KAAA 5CV7A 3V2TA 5IGGA 2PW7A 3PMFA 4DFAA 2EYPA 2PZWA 3SK6A 4HMIA 4B9WA 1AEXA 5C4ZA 2F0DA 4G57A 5IGBA 5CV5A 3R3OA 5F2DA 5HURA 1SNQA 3EROA 4KY6A 2RBMA 1EZ8A 1SYFA 4MIUA 3MZ5A 1ENCA 5DAUA 1A3TA 2EYOA 3OMGA 4QMGA 5I6YA 4KV6A 1ENAA 2F0VA 5I9PA 4ZUJA 1EZ6A 2EY6A 1SYBA 2F0MA 2SNSA 4PMCA 5CGKA 2F0LA 1EY9A 3EJIA 5J1ZA 4H7BA 1EYAA 4K5VA 4HMJA 3TP5A 2F3VA 4WORA 2EYFA 4K8JA 5DEHA 5JOBA 1KDAA 2PW5A 4KD4A 3TP7A 1NSNS 5M9OA 2EYHA 1U9RA 1EY7A 3MXPA 4HTHA 3C1FA 4ID6A 3MEHA 4KHVA 5E3FA 5J39A 4DU9A 5C6AA 2LKVA 3NQTA 4N9TA 4KJNA 4RKLA 4EVOA 5C4HA 3D8GA 1SYCA 3LX0A 1EY8A 2OEOA 2F0WA 4R8NA 2RKSA 2F0EA
chains in the Genus database with same CATH superfamily
2VL6A 1Q3LA 1PRTC 1QZGA 3A7LA 3VYUA 2F0IA 3BYTB 1IW7C 4TKOB 1E24A 4PMWA 1RCVD 4BY7G 4A75A 4GS3A 4X66Q 2B2UC 4ME3A 1LTTD 5IOCA 4J8QA 3CCRA 2NVQB 5I6WA 1GM5A 4UAIA 1HR0L 1RODA 4UP8A 1RF2D 1HNWL 2Q2IA 1WI5A 1A6XA 5LL6X 3QG1A 2KA7A 2YYZA 3A8KE 4OIKA 1EFID 1NMGA 3DUZA 3JAMi 5CBAE 3TDQA 3DWPA 4B3SL 1IBKQ 3M4OH 2Y0SG 5IP9H 4GKJL 2K5QA 1IHZA 3D4WA 2R7DA 1ICFB 1TS2A 5IGFA 1PH2A 1SDFA 4ZUIA 2KHSA 3X3NA 5M3MG 4MTNA 4YHHQ 5JJKA 1JWSD 1JR0D 3NBHB 2Q2TA 2JA7B 1UE7A 1K83B 4GLXA 1M1KC 4CGYB 1X54A 4RGTA 1WFQA 3R2TA 2UUCL 3K7AB 2KHIA 4OIJA 2A6ED 1A63A 1RL2A 4GLAC 3BZDB 3NENA 1K9MC 4ME5A 3TP8A 4QL5A 3E3XA 2PZTA 5C3EB 3LNNA 4JI3L 1RJTA 5LMNW 1RHPA 3S24A 1GOZA 1JC7A 2KUMA 4IUNA 4EGVA 5IGDA 4JPBW 2R93B 3GP7A 3EVQA 3HOXG 2F3IA 2N88A 2HIXA 3LGJA 3Q8DA 4DR1L 1BBWA 4HIOA 2MQHA 4OEMB 1WTXA 3DXJC 4P75A 4GNXB 3HOUB 1A3TA 1XWEA 4KV6A 1VQBA 1I94L 3EJIA 1Y1WG 4H7BA 4JI0Q 3W5OA 4A3GB 2JA6G 1ZEQX 2EYFA 3TREA 1NE3A 3OTOQ 5CMDA 2YTYA 4CDEC 3CAMA 3NQTA 2SDFA 1BNZA 4UPAA 2HHHQ 3BZCA 2RA4A 1VMPA 3HKZG 3VYRA 4LFBL 4C3HB 2Q2UA 2XN9C 3SE0A 4X65L 1B3QA 5ELNA 2RDGA 3BVGA 4LUOA 3PO3G 1STBA 1CTMA 1VQ9A 3CMAA 3K7AH 3QOJA 3KLSA 3VYTA 3PCOB 4TRDA 5CV6A 4A3DB 1E1TA 5D65A 2EYMA 2JA7H 5C5LA 4DAYB 2IX3A 3GTMB 4M1UB 3TRZA 3A7AB 1U4RA 3NSWA 4KHPQ 2DN8A 2GA4B 3PUYA 2EJGC 1VQGA 1SYDA 3FPUB 5C44B 4KN7C 3M4OB 1KXLA 1RTOA 4A3FG 1II3A 1ZYRD 3E0EA 1LT6D 1HTPA 4OHJA 3NK9A 4LF5Q 4KKUA 3DWAA 5M3FH 3M7GA 1MKHA 4B9XA 5IE8A 5T1IA 1K8GA 4LF9L 2IW3A 4P72A 5IYBG 4JVZA 5ELEA 4BBRH 1LT3D 2K04A 1LTAD 3D4RA 3A5ZB 1Z47A 4A3MG 3J7AF 3G6EA 2B2TA 1HNZL 2HT1A 2WFWA 2UUAQ 1IL8A 1B9MA 1S5CD 1EQQA 1DZ1A 2NZ1D 1XPOA 4N9PA 2IWHA 5JAVA 1Y1WH 1X3EA 2B2UA 2IPKD 4POGA 4X3SA 2XRQD 3CCUA 5M5YH 1L0XB 2MGSA 1SXTA 4DR2Q 1D7QA 2PZWA 1J5EQ 5IGBA 2DNEA 1E2VA 3HOWH 1DJRD 4QMGA 1EEID 3CRLC 4LUVA 5I6YA 1AZPA 3CC2A 1WCMH 2R6GA 4RH6A 2CHBD 2R61A 1D5XC 4AYBG 4A3KH 1NSNS 1HA5A 3MXPA 4JOIC 1P16A 1GD7A 4IO9A 2E2HH 4ULLA 4IOAA 5IP9G 1JT8A 3SDZA 4A3IG 1PFBA 2O5JC 2HUGA 1KIXA 4KLKA 4JYAQ 4HSVA 3MHBA 2JE6I 2PI2E 1I50B 2LXJA 3CC4A 1YNNC 2B2TC 2OXPA 1NUCA 3MFYA 1EYGA 4WJWA 3J80i 3MXNB 2AWOA 3GTKB 2UU9Q 5FKAC 3IAYA 1ICWA 2F0NA 2E5LQ 2F4VQ 2BDNA 2EJMA 2MP1A 1BR9A 1FJGQ 1LTLA 2CQAA 1V8QA 3HRZC 4DR2L 1HZCA 4BBRG 1QCBD 1HNWQ 1VQ5A 2PYKA 3RLOA 1JB3A 2KENA 4A93G 1G91A 2K03A 5C4XH 2X69A 4DUYL 3S16B 1TWFH 1J9OA 2WACA 2IX0A 1B53A 3GTGH 2VZAA 3AQQA 2A1AA 5JEAJ 1ZKOA 2PNHA 3MTSA 1NAPA 4DK3C 1F77A 3ULJA 3NWTA 3FHWA 2WB1E 3H94A 2CWAA 1UE5A 3NPPA 2JA8G 1YITA 1Q82C 3SK4A 1UEAB 1GUTA 3PIPA 1HZAA 1CHPD 1WTRA 4YWMA 5A2QL 1V1QA 4S3SA 5ISRA 3AFQA 3MC0B 2Z6KA 4DV1L 2QGQA 2A69D 4UHVA 2MJ8A 1QVGA 1YEZA 1E2WA 2OWOA 1XNRQ 1KAAA 3I3CA 2VW9A 2KECA 1C48A 4A3JB 2A6EC 3PMFA 1G291 3KOJA 4OELB 5F2DA 5HURA 4GN4B 1H9JA 4CDCC 4I7ZC 3ER0A 3EN2A 1K73C 2NB0A 4Y52H 1MJEA 1EWCA 2EE1A 1WTOA 1VQ7A 1DOKA 5K36G 1W3SA 2K75A 4C1NK 4GNXC 3F1ZA 3ICEA 2PW5A 4QUFA 1U9RA 2C9OA 3G7LA 4C3JG 1QG7A 1E2ZA 4ALPA 5GAHC 3F8TA 3T56B 3TEHB 1HUNA 1I3QB 1D1IA 3I90A 1LABA 3VA7A 2A69C 1EQVA 1PV4A 5C5MA 2K4KA 2LMCB 3SXHA 1X56A 5IT9E 1K0RA 1G2SA 4JI3Q 4G4KA 2A74C 1O78A 4Y7NH 1D1KA 1KNAA 2XVSA 4IURA 5IP7H 2SOBA 1UAPA 3K80C 4DR4Q 1YJ9A 2A68C 3R8BA 4DV4L 4XDXA 2E74C 1VQLA 1WTWA 4A3EG 1JE5A 5JVG3 4JBJA 5C3EH 4RAUC 3DM1A 3FRPB 1IZ6A 2DY8A 3GTQB 1TS4A 1IBLL 5FOBB 4DV2Q 4LF5L 1DD2A 5KNDA 2Y0SE 2UXBL 5I2YA 1Q7YC 1BQQT 1VF7A 5CV8A 1NR2A 4B3TQ 1TIID 1MHWC 2UXCQ 3P75A 2BH8A 3JAME 1DCZA 4XIGS 1D2BA 2ES2A 1XMQQ 2JA8B 2R7ZB 3GD7A 2ZM6L 4DNRB 3S15B 2F0PA 1ILPA 3SGIA 2F52A 2ZTCA 1IXRA 1B7YB 2QDBA 5I9OA 3J7YW 4PMBA 2PQAB 4NPSA 1LTRD 3L2PA 2N78A 4TVAB 4AQYL 4NXMQ 2NUCA 2EDGA 2Z0SA 1YNXA 3P20A 4L5QA 5IODA 1VMCA 2A73B 4ZQ3A 3J7AV 4BBSH 5K36H 4CJ1B 3URYA 5M5XH 4RG1A 2WV6D 4L5SA 1VQ4A 1KHIA 3PIO3 2E2DC 4R4CA 1YNJD 3OHXC 3KUPA 4OWTB 5LL6S 1AE2A 3ONAB 3J81E 1V9PA 3A56A 2JYOA 3J80c 1NMFA 4ZCKA 1QNUA 1SJED 3H0GH 3I91A 1H9RA 2JSOA 3G6JB 1PYWD 3F2CA 5E4XA 1LUZA 3AB9A 4YCWA 3RLFA 1I6HB 4A3IH 1Y1VB 2WAQE 5IP7G 1VQFA 1FNWA 4JI8L 2CFMA 3LX0A 1GUOA 5FJ8H 2JK8A 5HY6A 1YVCA 4A4IA 3NE5B 1F2ZA 1VQJA 1CQVA 1QUQB 1RKNA 1HNZQ 1STAA 1VS0A 4JI6L 4LF4Q 4XYOA 1HJPA 2VNUD 4ZAIA 3W3AA 1XNQQ 1I50H 1Z6HA 3I4MB 2CW0C 2B2VC 3FKIG 4EQPA 4L8JA 2PQAA 4CJ0B 4IPCA 2KCNA 1KLUD 2E2HB 1TWHH 2ENBA 3FKIB 4A93H 4ZRZA 1PVOA 4K5XA 1YIJA 1SMXA 1B70B 1TWCH 1CHQD 4J6HA 1STNA 3FEWX 2NZHA 2YU9H 3JC66 2F3WA 4UY8C 4LF7Q 4DR5L 1KDCA 1LYLA 1S3OA 1XPUA 4G7OC 3WOEA 3DLLA 1YNJC 4JI7Q 4QGUA 5IWAQ 4K2LA 1J8IA 3G48A 4R4IA 1WTHA 2K14A 4GOPB 3R93A 4QF4A 1NBWA 1PZKD 4KY5A 1QE6A 2O2LD 1B2TA 1FGUA 1UUPA 4C3IB 2EQSA 2HHHL 2NVXH 4XT1B 3KLRA 1EWIA 1HTLD 4KMUC 3T4AC 4AQYQ 4HN7A 4DK1A 4DV5Q 1VQPA 1R9TB 3OW7A 2JA9A 1V1PB 3D31A 1GUNA 1QUQA 3CKIB 1VQKA 3EROA 3J80E 2HCCA 2CH4W 4LFAQ 3KDFB 4CDDC 4RGNA 1CKNA 1KTKA 2F0MA 1MD2D 2KJXA 2ATWA 1EYAA 3UDGA 3PO3B 4WORA 4HCSA 5DEHA 1KDAA 4KD4A 1OXSC 2UU9L 5FK9C 2RSNA 3RN5A 3K0YA 4ID6A 1G6ZA 4DU9A 1PFNA 2F4IA 1IYUA 1EOTA 4NB3A 2FFKB 1GJXA 1MIUA 2R92B 1PZJD 4JW0A 4DAMA 4OGQC 5FLXL 4EQ5A 2V4DA 1SMYC 5EKIA 4JBMA 4JOIA 1D5MC 1K28A 2KEDA 2D9UA 4KHPL 3DMUA 3C46A 3QB3A 4IUTA 4HJ5A 1TWAH 4IJLA 5C44H 3KK7A 4OL7A 4RHSA 1L1OC 4MTKA 3RR5A 1SSOA 1XXGA 2Z9HA 3NTKA 3NBIA 1J6QA 2D0PA 4JI5L 3TP6A 1CZGA 4YIJA 1JWMD 1PH5A 3SVMA 4B3RQ 4A3DH 1DOMA 2AKWB 1EY4A 2ID0A 1A2UA 1H95A 2C5CA 3J7A5 1ONLA 1ZXTA 3ND9A 1CA6A 3AMUA 1HXYD 3PO3H 2AQ2B 2Q2HA 1NTGA 2HCIA 4IPGA 3K0XA 1W6JA 4B08A 4C3HH 3X3MA 4ABNA 2EJFC 5CV4A 1UNSA 2OTLA 3U58A 2R92G 3AYHB 5EKKA 3RD4A 3T13A 1N33L 4QQBX 1R9TH 1TS5A 2EYLA 4FYDA 5FJ8G 5K5PA 3TZDA 3K5LA 1JICA 4KJOA 1MBYA 2EY1A 5CV7A 1GUGA 4DV6L 1QZHA 2KCMA 2LS01 1IYJB 1PFSA 2F0DA 1PH8A 2OTJA 3E6ZX 1WTQA 5DAUA 3I4NB 2DUDA 4KK7A 4XYQA 1T5EA 2AQ3B 1HNXQ 1GO3E 3I7FA 3K6OA 5C0XJ 1CT1D 1G2TA 1PHJA 3NELA 3BG3A 4POFA 1C4QA 1EY7A 4HTHA 5M9OA 1NJIC 5C6AA 4DV1Q 5C0XG 2E2JH 2PCFB 1VQ8A 2GN5A 1HPCA 1QVCA 4DV3L 4I7AA 3S1MB 1TWCB 4JV5Q 1IL2A 1VQDA 2K50A 2UXDQ 3OMCA 2B3GA 3C3LA 4IUUA 2I5HA 4RCOA 3CCEA 5EGTA 3GTPH 5JVH3 1SNDA 2Z8LA 1KLGD 2MHVA 1HNXL 3AEVA 1B50A 1WCMG 4PG3A 4LJZC 3Q22A 1XTDA 2GVAA 5CR3A 1NNXA 2ZTDA 4QJFA 5BN3A 3VYSA 2K5HA 4K8IA 4N8X1 1L2FA 4YWKA 3TMEA 3HOZB 3DHQA 4DV7L 2PZUA 2ZJPA 4DR6L 3CF5A 1SN8A 3UDIA 4K14A 1JOQA 2F0KA 4DA2A 1EYDA 3HP3A 1Q46A 2JA5G 2UXDL 1Y1VH 4RHRA 4IUPA 3J7ZC 3SHLA 4FXGC 5EAYA 1IKLA 3NHHA 2E5LL 3GV3A 3SK5A 3S17B 4A3LG 3K5OA 3LWUA 4AH6A 4DV4Q 1YI2A 4LF8L 3VR5A 4DR5Q 3E0JA 3L3OC 1E7ZA 3ULLA 1STGA 3D0FA 1I4GA 3BJUA 1YZ6A 5LMNL 3W1BA 1PTOH 1N36Q 2WIIB 4LK1C 3I2ZA 4AIMA 5M5XB 4DR3Q 1E1OA 4KD3A 2UXCL 4HJ8A 2JA5B 1TXYA 2YU9B 1AH9A 3I8ZA 2X6LA 5KNCA 3V2TA 1AEXA 1PRTB 2AUKA 3T53B 4FF2A 2XWJB 4GKJQ 1PYBA 2EY6A 3UE1A 5GAGC 2PPBC 2XIWA 4HR7B 3S1NB 1HHVA 2JA8H 4LUZA 3TP5A 2K33A 1XX8A 1KD1C 3UE0A 3FVQA 4DPGA 4GNXA 5IYDH 5JPNC 2AUJD 4KJNA 1WD0A 5DNFA 5EBCA 4HIMA 3BS1A 1TU2B 3CRKC 1CKOA 4L5TA 2B63B 5M3FG 3RZOB 1JCKB 4KHZA 5KYLA 4JI2L 1EL0A 4DV0L 2JEAI 1TQOA 4BXXG 1T5XD 1TT2A 3HFZB 4H13C 1C0AA 2D0OA 4PV1C 3U4VA 4K6LA 3RZDH 3ULPA 2NVTH 1SBBB 2PMZE 5M3MH 4LF9Q 1G51A 2ICEC 1R4PB 4QCLA 4R4TA 3S14H 1XNQL 2MO1A 5IYCH 3H0GB 5ELCA 5EQ0A 4MNOA 4ZYSA 2F0OA 4YY3L 2F0JA 1LM0A 1PYSB 4LNQA 2O5IC 1U4MA 1RD9D 1KRTA 3CPFA 2NTSA 1WVLA 4I65A 2AWNA 4L5RC 1SNCA 5JJLA 4BBSB 1TKWB 1X65A 2N55A 5G3LD 2OQKA 1FGBD 3EQLC 3CPWA 2G9DA 3JAMc 4A3EB 2A8VA 4X64Q 2EXZA 2UXBQ 1HQMC 3GTJH 4F88A 2JJQA 3W1GA 2R7ZH 4TSSA 4A3EH 2RCNA 2WAQG 1BXTA 2K05A 2BCOA 3EIVA 1MSGA 1HA6A 3G71A 3J81i 5J3BA 3I4MG 3H3VI 1A62A 5C4ZA 1P8LA 2N3SA 3PQIA 5CV5A 2R93G 1SNQA 3AFPA 3GTQH 1CKNB 3HGBA 5C4JH 3A74A 3I56A 4IUVA 4WJ3M 2Q8RE 1HCZA 4BWGB 4BY1H 4HMJA 3HOZG 3MXGA 1BCPF 1SEBD 1WTVA 5C4XG 1K3BC 3M85A 2LSSA 3RZOH 2LKVA 4EVOA 2E8GA 5D3DA 2VUMH 2F4VL 1TWFB 1EY8A 3IL8A 3HOYH 1AW7A 4Z9CB 3S16H 5C4XB 1PH7A 1VQMA 3K59A 2XSCA 4WJ4A 3M9BA 4GOPA 2K7VA 2B2VA 1A3UA 1PRTD 1XTCD 4A3FB 3RN2A 4C2MB 3N52A 5KNBA 1DM0B 3G4SA 1LT5D 3F2UA 5I4DA 2WAQB 4B3RL 3P1HA 2MUYA 4H02A 4UP7A 3PIP3 3P7JA 2XNAC 4ZLTF 3QWNA 3TSSA 4DNIA 3QOLA 1ET9A 1PRTF 1PH4A 1PLFA 1BO0A 4X65Q 2QCPX 2JEBI 3KJOA 4IOCA 4IUQA 1Y8OB 3QO2A 1CK1A 3BYYB 2M9VA 3MXUA 2KBNA 1N32L 5NUCA 1IBKL 1W6KA 3MAQA 1D8LA 4OX9Q 4FDBA 4A3BH 4A3LH 2RDFA 5GQOA 3S17H 4JBKA 3S2DH 1R4QB 3EA6A 1BCPD 1A2TA 2M2LA 4PZ7A 4FO2A 2PNRC 2EVBA 3HOWB 3PUXA 1G8ZD 2K6AA 3RLNA 1SYGA 1A3VA 4NW2A 4BA2I 4K2KA 4R8IA 1YHAA 3TS0A 3BDCA 4E6IA 3HEJA 3VR2A 2B29A 4O1NA 1F2LA 4JC0A 2C35B 1Y1WB 4CBVA 4AYBB 2EYPA 1AN8A 2DGYA 1VQ6A 4DUZL 4OWWB 1V1OA 3BVMA 2L55A 2L12A 2ALYB 2H4OA 1BF4A 2F0LA 5G3LF 2CVRA 1CSPA 4K0KL 3KDFA 5IYDG 1FVIA 5M3FB 3MEHA 2CW0D 1XMOL 3GTKH 2BDOA 1DONA 4N9TA 4RKLA 1V1PA 4JI4L 3MFGA 5D14A 4FF3A 2Z6KC 3H3VC 1RIPA 3DWQA 4BS9A 1A0IA 1GVPA 3PIOA 2WKDA 2F0EA 3M4YA 2QA4A 1B8AA 2B2YA 1GHJA 3K7UC 3CQZB 1F9QA 1YJNA 2E2IB 3QJYA 4A3MB 3E5SA 4F7XA 3S2DB 2HQLA 3GTOB 2F0UA 4LFBQ 1HRJA 3GTMH 2QW7A 4NXNL 3LWEA 3GTLB 4IZ8A 1JOOA 2Y0SB 1BCPB 4RGMA 2QEXA 3GTPB 2JXMB 4XT3B 3KBGA 4CKCA 2B8GA 3D6WA 4YCVA 4GN5A 3M7NA 1WCMB 4O42A 1XMOQ 4CDFC 2N8NA 5A2QE 5C0XI 2E2JB 2HD3A 4DUZQ 2I46A 1EIGA 1MJCA 1FL0A 1X3QA 2VQFQ 3WOFA 3FP9A 3H09A 4U68A 4QUCA 5IGCA 4DV6Q 1VQOA 2EOTA 2CCZA 2VQEQ 1PDQA 3CCSA 2NN6I 3V96A 2IHEA 4IALA 1Q90A 5BN4A 1EIFA 4J1MA 1TY2A 1EFWA 4RMFA 1JJCB 4BA1I 3J81L 1ILQA 4F8MA 2K5DA 2Z4IA 1FR3A 2FJ2A 3OOCA 2XGTA 4O0AA 4RA8A 4RWSC 5CORA 4X3UA 1EYCA 2R7ZG 1LTID 5C44G 4BBRB 1CKMA 1DGSA 1H9MA 2F0TA 3MWYW 5FO8B 4J15A 1JB7A 4NDXA 3DEOA 2P5ZX 3K81C 4JK1C 3I4NG 4BY1B 2PW7A 4DR7L 2JA6B 2HIVA 2I07B 2NN6H 4MZ9A 3T1YL 1L1OB 5DM63 4A3DG 1WYDA 2L9HA 4YCUA 1EZ8A 1SYFA 1I5FA 3CCMA 1SRUA 4B3TL 1AZQA 2MPMA 4BY1G 1VQAA 4LFCQ 3HKZB 1LACA 4DN4M 2JN4A 1F9PA 1BDOA 5JOBA 3BU2A 4C3HG 3KJPA 1K83H 3CW2C 2R92H 2RHQB 4A3KG 1N36L 1PH1A 2PMZB 2G5DA 2L1BA 3WWVA 1SR3A 2WP8J 1SYCA 1DYQA 1CZWA 3CCQA 4HJ7A 1Q8IA 2OCEA 3BZKA 4NXML 1JJ2A 4UP9A 1L0WA 3L0OA 1HR0W 3M3YB 5EJWA 4A3GG 4NKLA 3UI2A 1ENFA 3H6MA 1B9NA 2ZTEA 3HOVB 1VQIA 4HIKA 4YHHL 4FXKC 2ZJRA 5EPKA 1PMRA 5AJ3L 2RHSB 2QKIC 3KLSX 2J4XA 5E4WC 4IFDH 3S2HB 4ZKCB 4UDUC 3D6CA 2TSSA 2IL8A 2OF1A 5I2XA 4APVA 1Y8NB 4RFBA 3MA2B 2KQ3A 2AQ1B 1YHBA 3K8AA 4C3IH 1VQHA 2EPBA 2ZXRA 5JEAH 3AU7A 4PZ6A 1U4LA 2JP1A 5HGTA 4CHTB 2ASBA 1I94Q 1PTOC 2IX1A 3SEBA 3EFXD 3O13A 4CKBA 3PF4A 3HOVG 2BE5D 3OTOL 1U5KA 3CD6A 1NY4A 3RZDB 4KTAA 5LMUL 4BY7B 2LFNA 3H3VH 1RDPD 1HFGA 4PNYA 1E3PA 3ZYYX 2F0QA 1YBYA 5EKLA 1VCIA 1SNMA 2NVXB 1S72A 2CWPA 2K1BA 2UUBQ 1NCVA 1N34L 1TR5A 3QIAA 4KKTA 4OXPA 1EWHA 3H0GG 1LTSD 1WJJA 3PO2B 4DKAC 4OONA 5AJ3Q 3W2DA 2G9HD 2JQOA 1TWGB 1K3RA 3GTLH 2DJGC 3S1NH 3GTOH 4B9WA 5FLXE 1XYIA 3R3OA 2E2IH 5COYA 1IKMA 1HZBA 3MEFA 5ELDA 3CQZH 1CA5A 1PH9A 5I9PA 1ENAA 5CGKA 3F2DA 1O80A 1SROA 2A5HA 3VR6A 2UUBL 4C1NI 2I0QA 4K8JA 5ELFA 5ELOA 5J39A 1X55A 1QJOA 1PTOB 2NVQH 1SE3A 3FKIH 3KYHC 1ET6A 4A93B 1OXTA 4C3JH 2FHTA 2QF7A 1IW7D 2NBFA 1F9SA 1KQSA 2F0GA 4GKKL 4LFAL 2LY7A 3TQYA 3M4PA 2IHFA 4JBWA 2GVBA 2D5DA 3C1EA 1I4QA 5CBEE 1X3PA 4G7ZC 4KY7A 4JI0L 3K5MA 4NP5A 1OXXK 2YV5A 2F0FA 2CKZB 3OWEB 5ELBA 4HJ9A 4GOPC 3DEPA 3A0JA 4R4OA 2L5TA 2PI2A 3HOXB 4A3IB 1OTCA 2M00A 3KF8B 1X9NA 5KGUA 5L37A 1MSHA 1STYA 1IBML 3T16A 2EY5A 3TBIB 3OSOA 1K0SA 3OIPA 4HJAA 2BA1A 3J80L 1FD7D 1T9HA 4JI1Q 5JJIA 5BN5A 3A8JE 1TY0A 2VXWA 1PZID 3S15H 1ZYRC 3SK8A 3HG9A 1VQCA 4C3JB 1DOLA 3PO2H 1N8RC 2VS1A 1JORA 3MXNA 5KRUA 3ERSX 4JYAL 3FMCA 3VR3A 4R1JA 5KYIA 3S9WA 1HH2P 3IRBA 5EBDA 3GQBA 4EX5A 1EQRA 4B3ML 4BY7H 4GLVB 4A3FH 1N34Q 4DFAA 1VDZA 1C9OA 4LFCL 5EPLA 2QILA 5GAEC 1TWGH 4JCVE 5JPMC 3MZ5A 3KF6B 1QB5D 1SYBA 2SNSA 1LTBD 2TMPA 4DR7Q 1CSQA 5J1ZA 5IYBH 4X66L 1GXDC 1MI2A 4Q0FA 3OYYA 2L4NA 1M90C 2EYHA 3STBC 2IT1A 1ESFA 3C1FA 1HFNA 1MGSA 3KF6A 1EOVA 1HZ9A 2A6HC 2E75C 5TSSA 3I72A 2B39A 4HCEA 1HUMA 4QIWB 2ZXOA 4K0KQ 4C3IG 1Y8PB 4R8NA 4ZK9B 3CCLA 2KHJA 3EBEA 2UUAL 1Y69U 2B2WA 4NMZA 4DNTB 3ND8A 5C3XA 1KDBA 4LW1A 2L15A 3U4ZA 3HOVH 2HDLA 4Y7NB 4RCNA 3NUCA 1A8VA 1VQEA 1WOCA 3OPOA 3M3YH 2YTVA 1EY0A 1JOKA 1LV9A 5JJZA 1SJHD 1LTGD 3GTJB 3S2HH 3NBHA 5HGQA 4YWLA 1YHQA 2DNCA 3UDXA 1Q1BA 5LHY1 2NZOA 2YTXA 4XTCS 3Q24A 3NEMA 1HR0Q 3I4OA 3UDFA 4PQXA 4L63B 4OX9L 2WB1G 1FNVA 3CCJA 2EYJA 2NYZD 5T1GA 3T51B 3CHBD 4QIWE 4WFN3 4HSPA 1I6VC 2VUMG 1TWAB 2QEJC 3HOYG 1HQRD 3I73A 4KKSA 2K5WA 2V1CC 1ESRA 2JA6H 5C3EG 1IBMQ 2NVYB 1BKBA 3BDOA 4K5WA 2L0CA 4FNFA 5KIXA 1L0YB 2ZT9C 4ILWA 2O4XA 1JWUD 1EIYB 2Z4HA 1D6EC 3S1QH 4L6TB 5LMUQ 4EQNA 1WD1A 4JI4Q 1AP0A 1VF5C 3S1RH 2BE5C 3D4DA 2EXDA 3J81c 1QWYA 4DR4L 3NXWA 5KEEA 3T1HQ 2K28A 3A8IE 3RUZA 5M3MB 1QVFA 1SE2A 4RGOS 1Z9FA 5LMNQ 5GADC 3QR8A 3GDEA 5M5WB 5AFWA 4DUYQ 5CYUA 2RBMA 4IPDA 3Q6SA 3OMGA 3WDNA 1XPRA 1KNEA 4ZUJA 1EZ6A 4AYBE 1Q81C 4PMCA 5GROA 1EY9A 4A3BG 4DR1Q 1B1ZA 2MFIA 5E7NA 3TP7A 3CMEA 2FMCA 2K01A 1QOHA 1SFOH 2BH2A 4O2DA 1I4XA 1QILA 2K5NA 1M4VA 4IJHA 1I4PA 2NTTA 4HEDA 2UUCQ 2KVMA 4X3TA 2OQ0A 4A3KB 1TS3A 4MN3A 2ZJQA 2Q8TA 3KLWA 1DXMA 2BOSA 4A3MH 4LAAA 4DXGA 1IYVA 2B8FA 1XMQL 1EU4A 2ZM6Q 1WTPA 3KBXA 2JA5H 3IFTA 4LWCA 4G7HC 5J22A 2F0HA 1KRSA 1STHA 2WB1B 1O7ZA 3HS0C 4X64L 1ML0D 1UEBA 1JQYD 3N6RA 3I4LA 4CJ2C 3VR4A 3T1YQ 1I4RA 3E9HA 3OWFA 2J7ZA 1H9SA 4JI6Q 1PXUA 3HOWG 1KAWA 1SYEA 4P2CB 1PFMA 3RMHA 4ODGA 2L11A 4H0LC 3MVVA 4DGZA 4LF6Q 1GUWA 3CP0A 4Q5VA 3KF8A 1SNPA 4X6AH 2ICIA 1O7IA 1Q1EA 4KN4C 4C56C 3PO2G 3PGZA 4LF6L 3U9OA 3A55A 1V43A 5M5YB 3NWSA 2VB2X 2KOLA 2X6GA 1BVSA 2H1EA 4FF4A 2KCTA 4U673 3M4QA 4GKKQ 4YY3Q 1XJVA 5EPJA 3Q23A 5FLXc 4A3CH 4DAVA 4X3KA 3HOUG 1A15A 4DV2L 4M8AA 2FXQA 2QDLA 3PUZA 2XWBB 1BCPC 4LF7L 4XQJA 3H91A 5IGGA 2HDMA 3K58A 4A3BB 1U4PA 2RCFA 2R7FA 4DV0Q 4DAYA 1ENCA 1PH3A 1S5BD 2EYOA 2DJFC 2RSOA 1OXUA 2B63G 1JE4A 2FMMA 1JMCA 3S1MH 5FO7B 1TVXA 4K5VA 2RVLA 4ZKBB 3A5UA 2WINB 2D2CC 5E3FA 4KHVA 2I5LX 1PTOD 5C4HA 1PA6A 3D8GA 1K8OA 1JJGA 2N49A 4P71A 3NQIA 3PUWA 1RTNA 1X6OA 2RKSA 5IYCG 1CUKA 5IWAL 4C2MH 3HKZE 3CU7A 3I4NH 1Q12A 3D3RA 3IKJA 4BBSG 2I5MX 1UE1A 3H15A 2J0TD 2NN6G 1GUSA 1G6PA 2VY3A 1NR4A 3J81j 4QB4A 3A54A 1X3FA 1S5DD 1W2BA 1GKHA 1AFPA 4JI2Q 4DV7Q 4XQNA 2XTIA 4V190 1SFOB 1D5ZC 3PV0A 3BDLA 2PQEA 3DM3A 1F2YA 4IFDI 5IIFA 2VUMB 3FDTA 1EQTA 4DV5L 2R3ZA 3GO5A 1KABA 4EQOA 3C2PA 1STEA 5E1FA 4OO1H 1PTOF 2SNMA 5DM73 5M5WH 1S40A 1I4HA 3RNUA 1EEFD 2HQEA 1FJGL 3TS2A 4A3GH 3HKSA 5C4JB 4A3CG 4LF4L 2A6HD 5D3IB 4LMQD 1SAPA 4DR6Q 4R4QA 3HOUH 3VA5A 1VQNA 3S1RB 1SE8A 1EY5A 1BOSA 1BUVT 3ERQA 2RDHA 2A68D 3SR1A 1F2MA 3HOYB 4IFDJ 4IPHA 3I70A 2PO4A 4WRDA 3S1QB 3HZXA 3B6YA 1Q86C 1EUJA 4CKEA 2DY7A 2R93H 1O7YA 4IFDG 4XXEA 5BR8L 1BBUA 1PH6A 1I3QH 2NVYH 3NP8A 4GZYC 1EIHA 5IY0A 3ITPA 3CXCA 1CFMA 4P73A 2MNAA 4RKBA 1FYCA 5JEAG 5C3WA 4OO1I 3CCVA 1YNND 3PSIA 1Z7TA 2B2WC 1N32Q 2EIFA 1OXVA 1N9WA 4DAPA 4N8FA 4QY7A 4JI1L 3SK6A 4HMIA 4HAEA 2A19A 4KY6A 2RF4A 3BVZA 4DR3L 1K8MA 2H5XA 2AMCB 1CM9A 1KL9A 2F1MA 1ASYA 4A3JH 2AHOB 2F3VA 4JI7L 5IT9L 4TQUS 1ASZA 3Q0AA 4F87A 4DK0A 1O7LA 3VDYA 2IJ0A 2CQOA 3E9IA 5A35A 3L7ZC 3S14B 2F0WA 2OT2A 1OO9B 1SE4A 1C8CA 3K5NA 4FXDA 5BR8Q 1L1OA 1AE3A 3HOXH 1KC8C 5FLMH 3PUVA 2SEBD 2NVTB 2KEEA 3TN2A 4JG2A 2FINB 3FPPA 1E0BA 1LLRD 3R2IA 4BXXH 4XQQA 2F03A 2MO0A 5IT9c 5C0XH 1K8AC 4MHEA 4JI5Q 2VQEL 3PF5A 1X32A 3V05A 3STBD 3U9SA 1SNOA 3JAML 3GTGB 3TZUA 1J5EL 3KFUA 2B2YC 4B3MQ 4IQZA 5DLQE 1H9SB 5CC4A 2K52A 2RQXA 4GN3B 3ZJYC 1YJWA 1S4ZA 1LO5D 2IY5B 1EY6A 1E22A 1F9RA 2CH4A 1S5ED 4H44C 4DXFA 1XNRL 2ZXPA 1B44D 3IFDA 3NTHA 1X3GA 4KI0A 4HIDA 2B63H 4IN3A 2Z6BA 3U50C 2F0SA 1M8AA 2JA7G 2E76C 2K32A 4X62L 3NTIA 4DV3Q 4FF1A 4P74A 1SLJA 2WKCA 1SMYD 5CV9A 4NXNQ 4JV5L 4DK6C 1BBXC 1B3AA 1UWVA 1TWHB 4X62Q 1Q8KA 4A76A 1QNKA 1Y1VG 2K5VA 2EZVA 1U0LA 4DF7A 5IGEA 4A3JG 2VQFL 2EY2A 4OWXB 4K6DA 1CI3M 1GHKA 3L9AX 3I4MH 3CC7A 4FVMA 4JI8Q 5H1SE 3K57A 4G57A 2NWGA 1EU3A 3T1HL 4MIUA 1Y14B 1S5FD 3GV6A 4LF8Q 2F0VA 2BA0A 1FNUA 5FLMG 1H9KA 2Z1CA 1N33Q 1C7YA 2Q8IB 4V0BA 1LT4D 2D62A 2VB3X 2LXKA 4R9WA 3I55A 3HOZH 1I6HH 1UE6A 3OW2A 3OIQA 4FP5D 4B3SQ 4OO1G 4PZ8A 5FO9B 2KCCA 2XRSD 1CQFA 2OEOA 3F2BA 1B4OA 1IBLQ
chains in the Genus database with same CATH topology
1Q3LA 1PRTC 3A7LA 3VYUA 2F0IA 3BYTB 1IW7C 4TKOB 4PMWA 1RCVD 2B2UC 1LTTD 5IOCA 4J8QA 2NVQB 5I6WA 4UAIA 1RODA 1RF2D 1A6XA 5LL6X 3QG1A 2KA7A 2YYZA 3A8KE 4OIKA 1EFID 3DUZA 5CBAE 3TDQA 3DWPA 2K5QA 1IHZA 3D4WA 1TS2A 5IGFA 1SDFA 4ZUIA 2KHSA 3X3NA 1JWSD 1JR0D 2JA7B 1K83B 4CGYB 4RGTA 3R2TA 3K7AB 4OIJA 2A6ED 3BZDB 4ME5A 3TP8A 2PZTA 5C3EB 3LNNA 1RJTA 1RHPA 1GOZA 1JC7A 2KUMA 4IUNA 4EGVA 5IGDA 2R93B 3GP7A 3EVQA 2N88A 1WTXA 3DXJC 3HOUB 1A3TA 1XWEA 4KV6A 3EJIA 4H7BA 4A3GB 1ZEQX 2EYFA 5CMDA 3NQTA 2SDFA 1BNZA 2RA4A 1VMPA 3VYRA 4C3HB 2XN9C 3SE0A 2RDGA 3BVGA 1STBA 1CTMA 3QOJA 3KLSA 3VYTA 4TRDA 5CV6A 4A3DB 5D65A 2EYMA 5C5LA 2IX3A 3GTMB 4M1UB 3A7AB 1U4RA 3NSWA 2DN8A 2GA4B 3PUYA 2EJGC 1SYDA 3FPUB 5C44B 4KN7C 3M4OB 1RTOA 1II3A 1ZYRD 1LT6D 1HTPA 4OHJA 3NK9A 4KKUA 3DWAA 3M7GA 4B9XA 5T1IA 2IW3A 5ELEA 1LT3D 2K04A 1LTAD 3D4RA 1Z47A 3J7AF 2B2TA 1IL8A 1B9MA 1S5CD 1DZ1A 2NZ1D 4N9PA 2IWHA 5JAVA 2B2UA 2IPKD 4X3SA 2XRQD 1L0XB 2MGSA 1SXTA 2PZWA 5IGBA 2DNEA 1E2VA 1DJRD 4QMGA 1EEID 3CRLC 5I6YA 1AZPA 2R6GA 4RH6A 2CHBD 2R61A 1D5XC 1NSNS 1HA5A 3MXPA 4ULLA 3SDZA 1PFBA 2O5JC 2HUGA 4HSVA 3MHBA 2JE6I 1I50B 1YNNC 2B2TC 2OXPA 1NUCA 3MFYA 4WJWA 2AWOA 3GTKB 5FKAC 3IAYA 1ICWA 2F0NA 2BDNA 2EJMA 2MP1A 1BR9A 2CQAA 1V8QA 3HRZC 1QCBD 2PYKA 1G91A 1JB3A 2K03A 3S16B 2X69A 1J9OA 2WACA 2IX0A 1B53A 5JEAJ 1ZKOA 3MTSA 1NAPA 1F77A 3NWTA 3H94A 3NPPA 3SK4A 1UEAB 1GUTA 1CHPD 1WTRA 5A2QL 4S3SA 5ISRA 3MC0B 2A69D 2MJ8A 1E2WA 1KAAA 3I3CA 2KECA 1C48A 4A3JB 2A6EC 3PMFA 1G291 5F2DA 5HURA 1H9JA 4I7ZC 2NB0A 1EWCA 2EE1A 1WTOA 1DOKA 5K36G 4C1NK 2PW5A 4QUFA 1U9RA 2C9OA 3G7LA 4C3JG 1QG7A 1E2ZA 3T56B 1HUNA 1I3QB 1D1IA 3I90A 1LABA 3VA7A 2A69C 1EQVA 5C5MA 2LMCB 3SXHA 5IT9E 1G2SA 4G4KA 2A74C 1O78A 1D1KA 1KNAA 2XVSA 4IURA 2SOBA 1UAPA 2A68C 3R8BA 4XDXA 2E74C 1WTWA 5JVG3 4RAUC 3DM1A 3FRPB 2DY8A 3GTQB 1TS4A 5FOBB 1DD2A 5KNDA 5I2YA 1BQQT 1VF7A 5CV8A 1NR2A 1TIID 3P75A 3JAME 1DCZA 4XIGS 1D2BA 2JA8B 2R7ZB 3GD7A 4DNRB 3S15B 2F0PA 1ILPA 2QDBA 5I9OA 3J7YW 4PMBA 1LTRD 2NUCA 2EDGA 3P20A 5IODA 1VMCA 2A73B 4ZQ3A 3J7AV 5K36H 4CJ1B 3URYA 2WV6D 3PIO3 2E2DC 1YNJD 3OHXC 3KUPA 5LL6S 3ONAB 3J81E 3A56A 2JYOA 1QNUA 1SJED 3I91A 1H9RA 2JSOA 3G6JB 1PYWD 5E4XA 3AB9A 3RLFA 1I6HB 1Y1VB 1FNWA 3LX0A 1GUOA 3NE5B 1F2ZA 1CQVA 1RKNA 1STAA 4XYOA 2VNUD 4ZAIA 3W3AA 1Z6HA 3I4MB 2CW0C 2B2VC 4EQPA 4L8JA 4CJ0B 2KCNA 1KLUD 2E2HB 2ENBA 3FKIB 4ZRZA 4K5XA 1CHQD 4J6HA 1STNA 3FEWX 2F3WA 1KDCA 4G7OC 3WOEA 1YNJC 4K2LA 1J8IA 3R93A 4QF4A 1PZKD 4KY5A 1QE6A 2O2LD 1B2TA 1UUPA 4C3IB 4XT1B 3KLRA 1HTLD 4KMUC 3T4AC 4HN7A 4DK1A 1R9TB 3OW7A 1V1PB 3D31A 1GUNA 3CKIB 3EROA 3J80E 2HCCA 4RGNA 1KTKA 2F0MA 1MD2D 2KJXA 1EYAA 3PO3B 4WORA 4HCSA 5DEHA 1KDAA 4KD4A 1OXSC 5FK9C 2RSNA 3K0YA 4ID6A 1G6ZA 4DU9A 1PFNA 2F4IA 1IYUA 1EOTA 2FFKB 1GJXA 2R92B 1PZJD 4OGQC 5FLXL 2V4DA 1SMYC 5EKIA 1D5MC 2KEDA 2D9UA 3DMUA 3C46A 3QB3A 4IUTA 3KK7A 4OL7A 4RHSA 1SSOA 1XXGA 3NTKA 3NBIA 3TP6A 1CZGA 4YIJA 1JWMD 3SVMA 1DOMA 1EY4A 2ID0A 1A2UA 2C5CA 1ONLA 1CA6A 1ZXTA 3ND9A 3AMUA 1HXYD 2AQ2B 2HCIA 1W6JA 4B08A 3X3MA 4ABNA 2EJFC 5CV4A 1UNSA 5EKKA 3RD4A 3T13A 1TS5A 2EYLA 4FYDA 5K5PA 3TZDA 3K5LA 1JICA 4KJOA 1MBYA 2EY1A 5CV7A 1GUGA 2LS01 2F0DA 3E6ZX 1WTQA 5DAUA 3I4NB 4KK7A 4XYQA 1T5EA 2AQ3B 3K6OA 5C0XJ 1CT1D 1G2TA 3BG3A 5M9OA 1C4QA 1EY7A 4HTHA 5C6AA 5C0XG 2PCFB 1HPCA 3S1MB 1TWCB 3OMCA 3C3LA 4IUUA 4RCOA 5EGTA 5JVH3 1SNDA 2Z8LA 1KLGD 2MHVA 1B50A 4LJZC 3Q22A 5CR3A 5BN3A 3VYSA 4K8IA 3TMEA 3HOZB 3DHQA 2PZUA 4K14A 1JOQA 2F0KA 4DA2A 1EYDA 3HP3A 4RHRA 4IUPA 3SHLA 4FXGC 1IKLA 3NHHA 3S17B 3GV3A 3SK5A 3K5OA 3LWUA 3VR5A 3E0JA 3L3OC 1STGA 1I4GA 1PTOH 2WIIB 4LK1C 5M5XB 2JA5B 4KD3A 2YU9B 3I8ZA 2X6LA 5KNCA 3V2TA 1AEXA 1PRTB 2AUKA 3T53B 4FF2A 2XWJB 2EY6A 2PPBC 2XIWA 4HR7B 3S1NB 1HHVA 3TP5A 2K33A 1XX8A 3FVQA 5JPNC 2AUJD 4KJNA 1WD0A 5DNFA 5EBCA 3BS1A 1TU2B 3CRKC 2B63B 3RZOB 1JCKB 4KHZA 5KYLA 1EL0A 2JEAI 1TQOA 1T5XD 1TT2A 4H13C 4PV1C 4K6LA 1SBBB 2ICEC 1R4PB 4QCLA 3H0GB 5ELCA 5EQ0A 4ZYSA 2F0OA 2F0JA 2O5IC 1U4MA 1RD9D 2NTSA 1WVLA 4I65A 2AWNA 1SNCA 4BBSB 1TKWB 2N55A 5G3LD 1FGBD 3EQLC 2G9DA 4A3EB 2EXZA 1HQMC 4F88A 4TSSA 1BXTA 2K05A 2BCOA 1MSGA 1HA6A 5C4ZA 5CV5A 1SNQA 3HGBA 4IUVA 2Q8RE 1HCZA 4BWGB 4HMJA 3MXGA 1BCPF 1SEBD 1WTVA 3M85A 2LKVA 4EVOA 5D3DA 1TWFB 1EY8A 3IL8A 1AW7A 4Z9CB 5C4XB 3K59A 2XSCA 2K7VA 2B2VA 1A3UA 1PRTD 1XTCD 4A3FB 4C2MB 3N52A 5KNBA 1DM0B 1LT5D 3F2UA 5I4DA 2WAQB 3P1HA 2MUYA 3PIP3 3P7JA 2XNAC 4ZLTF 3QWNA 3TSSA 3QOLA 1ET9A 1PRTF 1PLFA 1BO0A 2QCPX 2JEBI 4IUQA 1Y8OB 3QO2A 1CK1A 3BYYB 2M9VA 3MXUA 5NUCA 1W6KA 3MAQA 2RDFA 1R4QB 3EA6A 1BCPD 1A2TA 2M2LA 4FO2A 2PNRC 2EVBA 3HOWB 3PUXA 1G8ZD 2K6AA 1SYGA 1A3VA 4NW2A 4BA2I 4K2KA 4R8IA 3BDCA 4E6IA 3HEJA 3VR2A 4O1NA 1F2LA 1Y1WB 4CBVA 4AYBB 2EYPA 1AN8A 1V1OA 3BVMA 2L55A 2L12A 2H4OA 1BF4A 2F0LA 5G3LF 2CVRA 5M3FB 3MEHA 2CW0D 2BDOA 1DONA 4N9TA 4RKLA 1V1PA 3MFGA 5D14A 4FF3A 3H3VC 3DWQA 4BS9A 2WKDA 2F0EA 3M4YA 2B2YA 1GHJA 3CQZB 1F9QA 2E2IB 3QJYA 4A3MB 3E5SA 4F7XA 3S2DB 3GTOB 2F0UA 1HRJA 3LWEA 3GTLB 4IZ8A 1JOOA 2Y0SB 1BCPB 4RGMA 3GTPB 2JXMB 4XT3B 3KBGA 4CKCA 2B8GA 3D6WA 3M7NA 1WCMB 4O42A 5A2QE 5C0XI 2E2JB 2I46A 1EIGA 1X3QA 3WOFA 3H09A 4U68A 4QUCA 5IGCA 2EOTA 1PDQA 2NN6I 3V96A 5BN4A 1Q90A 4IALA 4J1MA 1TY2A 4BA1I 3J81L 1ILQA 4F8MA 2K5DA 2Z4IA 1FR3A 2FJ2A 3OOCA 4RA8A 4RWSC 5CORA 4X3UA 1EYCA 1LTID 4BBRB 1H9MA 2F0TA 3MWYW 5FO8B 4NDXA 3DEOA 4JK1C 4BY1B 2PW7A 2JA6B 2I07B 2NN6H 5DM63 2L9HA 1EZ8A 1SYFA 1AZQA 2MPMA 3HKZB 1LACA 4DN4M 1F9PA 1BDOA 5JOBA 4C3HG 2PMZB 2L1BA 2WP8J 1SYCA 1DYQA 1CZWA 1Q8IA 3M3YB 5EJWA 4NKLA 3UI2A 1ENFA 3H6MA 1B9NA 3HOVB 4FXKC 5EPKA 1PMRA 2QKIC 3KLSX 2J4XA 5E4WC 4IFDH 3S2HB 4ZKCB 4UDUC 3D6CA 2TSSA 2IL8A 2OF1A 5I2XA 1Y8NB 4RFBA 3MA2B 2KQ3A 2AQ1B 2EPBA 2ZXRA 5JEAH 3AU7A 1U4LA 2JP1A 5HGTA 4CHTB 1PTOC 2IX1A 3SEBA 3EFXD 3O13A 4CKBA 2BE5D 3RZDB 4KTAA 4BY7B 2LFNA 1RDPD 1HFGA 4PNYA 3ZYYX 2F0QA 5EKLA 1VCIA 1SNMA 2NVXB 2K1BA 1NCVA 1TR5A 3QIAA 4KKTA 1EWHA 1LTSD 3PO2B 3W2DA 2G9HD 1TWGB 4B9WA 5FLXE 1XYIA 3R3OA 5COYA 1IKMA 5ELDA 1CA5A 5I9PA 1ENAA 5CGKA 1O80A 2A5HA 3VR6A 4C1NI 4K8JA 5ELFA 5J39A 1QJOA 1PTOB 1SE3A 4A93B 1ET6A 1OXTA 2FHTA 2QF7A 1IW7D 2NBFA 1F9SA 2F0GA 2LY7A 4JBWA 2D5DA 3C1EA 1I4QA 5CBEE 1X3PA 4G7ZC 4KY7A 3K5MA 4NP5A 1OXXK 2F0FA 3OWEB 5ELBA 3DEPA 2L5TA 3HOXB 4A3IB 2M00A 5KGUA 1MSHA 1STYA 3T16A 2EY5A 3TBIB 3OSOA 3OIPA 2BA1A 3J80L 1FD7D 5BN5A 3A8JE 1TY0A 2VXWA 1PZID 1ZYRC 3SK8A 3HG9A 4C3JB 1DOLA 1JORA 3MXNA 5KRUA 3FMCA 3VR3A 5KYIA 3S9WA 5EBDA 3GQBA 4DFAA 1VDZA 5EPLA 2QILA 5JPMC 3MZ5A 1QB5D 1SYBA 2SNSA 1LTBD 2TMPA 5J1ZA 1GXDC 1MI2A 4Q0FA 2L4NA 2EYHA 2IT1A 1ESFA 3C1FA 1HFNA 1MGSA 2A6HC 5TSSA 2E75C 3I72A 2B39A 4HCEA 1HUMA 4QIWB 2ZXOA 4C3IG 1Y8PB 4R8NA 4ZK9B 1Y69U 2B2WA 4NMZA 4DNTB 3ND8A 5C3XA 1KDBA 2HDLA 4Y7NB 4RCNA 3NUCA 3OPOA 1EY0A 1JOKA 1LV9A 5JJZA 1SJHD 1LTGD 3GTJB 3NBHA 2DNCA 1Q1BA 5LHY1 4XTCS 3Q24A 4PQXA 4L63B 1FNVA 2EYJA 2NYZD 5T1GA 3T51B 3CHBD 4WFN3 4HSPA 1I6VC 1TWAB 2QEJC 1HQRD 3I73A 4KKSA 2K5WA 1ESRA 2NVYB 3BDOA 4K5WA 2L0CA 4FNFA 5KIXA 1L0YB 2ZT9C 4ILWA 2O4XA 1JWUD 2Z4HA 1D6EC 4L6TB 4EQNA 1WD1A 1AP0A 1VF5C 2BE5C 3D4DA 1QWYA 3NXWA 5KEEA 2K28A 3A8IE 3RUZA 5M3MB 1SE2A 4RGOS 5M5WB 5AFWA 5CYUA 2RBMA 3Q6SA 3OMGA 3WDNA 1KNEA 4ZUJA 1EZ6A 4PMCA 1EY9A 1B1ZA 3TP7A 2FMCA 2K01A 1QOHA 1I4XA 1QILA 1M4VA 1I4PA 2NTTA 4HEDA 2KVMA 4X3TA 4A3KB 1TS3A 4MN3A 2Q8TA 1DXMA 2BOSA 4LAAA 4DXGA 1IYVA 2B8FA 1EU4A 1WTPA 3KBXA 3IFTA 4G7HC 5J22A 2F0HA 1STHA 2WB1B 1O7ZA 3HS0C 1ML0D 1JQYD 3N6RA 3I4LA 4CJ2C 3VR4A 1I4RA 3OWFA 2J7ZA 1H9SA 1PXUA 1SYEA 4P2CB 1PFMA 3RMHA 4ODGA 2L11A 4H0LC 3MVVA 4DGZA 1GUWA 4Q5VA 3KF8A 1SNPA 2ICIA 1Q1EA 4KN4C 4C56C 3U9OA 3A55A 1V43A 5M5YB 3NWSA 2VB2X 2KOLA 2X6GA 4FF4A 2H1EA 4U673 5EPJA 3Q23A 4DAVA 4X3KA 1A15A 4M8AA 3PUZA 2XWBB 1BCPC 4XQJA 3H91A 5IGGA 2HDMA 3K58A 4A3BB 1U4PA 4DAYA 1ENCA 1S5BD 2EYOA 2RSOA 1OXUA 1JE4A 2FMMA 5FO7B 1TVXA 4K5VA 2RVLA 4ZKBB 2WINB 2D2CC 5E3FA 4KHVA 1PTOD 5C4HA 3D8GA 1K8OA 3NQIA 3PUWA 1RTNA 2RKSA 3CU7A 1Q12A 3D3RA 3IKJA 2J0TD 2NN6G 1GUSA 1NR4A 4QB4A 3A54A 1S5DD 1AFPA 4XQNA 4V190 1SFOB 1D5ZC 3PV0A 3BDLA 2PQEA 1F2YA 4IFDI 5IIFA 2VUMB 3FDTA 1EQTA 2R3ZA 3GO5A 1KABA 3C2PA 4EQOA 1STEA 5E1FA 4OO1H 1PTOF 2SNMA 5DM73 1I4HA 1EEFD 2HQEA 5C4JB 2A6HD 5D3IB 4LMQD 1SAPA 3VA5A 3S1RB 1EY5A 1BOSA 1BUVT 3ERQA 2RDHA 2A68D 3SR1A 1F2MA 3HOYB 4IFDJ 3I70A 2PO4A 4WRDA 3S1QB 3HZXA 4CKEA 2DY7A 1O7YA 4IFDG 4XXEA 3NP8A 4GZYC 1EIHA 3ITPA 1CFMA 4RKBA 1FYCA 5JEAG 5C3WA 4OO1I 1YNND 1Z7TA 2B2WC 1OXVA 4DAPA 3SK6A 4HMIA 4HAEA 4KY6A 3BVZA 1K8MA 1CM9A 2F1MA 2F3VA 5IT9L 4TQUS 3Q0AA 4F87A 4DK0A 1O7LA 2IJ0A 5A35A 3L7ZC 3S14B 2F0WA 2OT2A 1SE4A 1OO9B 1C8CA 3K5NA 4FXDA 3PUVA 2SEBD 2NVTB 2KEEA 3TN2A 2FINB 3FPPA 1E0BA 1LLRD 3R2IA 4XQQA 2F03A 5C0XH 4MHEA 1X32A 3V05A 3U9SA 1SNOA 3JAML 3GTGB 3TZUA 2B2YC 4IQZA 1H9SB 5CC4A 2RQXA 1S4ZA 1LO5D 1EY6A 1F9RA 1S5ED 4H44C 4DXFA 2ZXPA 1B44D 3IFDA 3NTHA 4KI0A 4IN3A 2F0SA 1M8AA 2E76C 2K32A 3NTIA 4FF1A 2WKCA 1SMYD 5CV9A 1BBXC 1B3AA 1TWHB 1QNKA 2EZVA 4DF7A 5IGEA 2EY2A 4K6DA 1CI3M 1GHKA 3L9AX 4FVMA 3K57A 4G57A 2NWGA 1EU3A 4MIUA 1S5FD 3GV6A 2F0VA 2BA0A 1FNUA 1H9KA 2Z1CA 2Q8IB 4V0BA 1LT4D 2D62A 2VB3X 4R9WA 3OIQA 4FP5D 4OO1G 5FO9B 2KCCA 2XRSD 1CQFA 2OEOA 1B4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2Z A;  4NMZ A;  3MHB A;  2F0G A;  5KYL A;  1RKN A;  4NKL A;  1EQV A;  1STA A;  3OMC A;  5C5M A;  1STB A;  3H6M A;  2F0I A;  1TQO A;  5EGT A;  1KDB A;  3C1E A;  3QOJ A;  3SXH A;  5C3X A;  1TT2 A;  3E5S A;  4F7X A;  1SND A;  4LAA A;  2OXP A;  1NUC A;  4QB4 A;  2F0U A;  4KY7 A;  1A3U A;  3NUC A;  4TRD A;  5CV6 A;  4IZ8 A;  5IOC A;  3DMU A;  1JOO A;  5I6W A;  2EYM A;  2SOB A;  3QB3 A;  4NP5 A;  4EQP A;  1EY0 A;  1JOK A;  5C5L A;  3BDL A;  2PQE A;  2F0H A;  5CR3 A;  5J22 A;  1STH A;  1F2Y A;  1SNO A;  4OL7 A;  2F0N A;  5IIF A;  2F0F A;  4K8I A;  2F0O A;  3P1H A;  2F0J A;  3TME A;  3D6C A;  2ENB A;  1KAB A;  5CC4 A;  2OF1 A;  3DHQ A;  1SYD A;  4EQO A;  2PZU A;  4K5X A;  5E1F A;  3TP6 A;  3QOL A;  2SNM A;  1IHZ A;  2PYK A;  1II3 A;  2KQ3 A;  3D4W A;  4YIJ A;  5IGF A;  2M00 A;  2EYJ A;  4ZUI A;  4J6H A;  1JOQ A;  4K14 A;  3OWF A;  2F0K A;  5KGU A;  1EYD A;  1EY6 A;  1STY A;  1STN A;  2KHS A;  2HQE A;  2WAC A;  1EY4 A;  5CV8 A;  5IGC A;  3NK9 A;  3T16 A;  5NUC A;  5HGT A;  2EY5 A;  2F3W A;  1A2U A;  3OSO A;  1SYE A;  3P75 A;  1KDC A;  4B9X A;  4ODG A;  4I65 A;  3MVV A;  3SHL A;  4IAL A;  1SNC A;  3VA5 A;  4DGZ A;  2RDF A;  4J1M A;  1EY5 A;  3NHH A;  1SNP A;  4K2L A;  4KTA A;  2F0P A;  3ERQ A;  3SK5 A;  1A2T A;  1F2M A;  3SK8 A;  3SR1 A;  2F0S A;  4K5W A;  4WRD A;  3U9O A;  4F8M A;  3HZX A;  2QDB A;  5I9O A;  4PNY A;  4PMB A;  1JOR A;  2F0Q A;  3SK4 A;  5CV9 A;  5CV4 A;  5KIX A;  4QF4 A;  2O4X A;  4ME5 A;  5EKL A;  3TP8 A;  2NUC A;  5KRU A;  1SYG A;  1A3V A;  1STG A;  2PZT A;  1SNM A;  4KY5 A;  2EXZ A;  1EYC A;  4K2K A;  5IOD A;  5KYI A;  5EKK A;  4N9P A;  3NP8 A;  4S3S A;  3T13 A;  4IUN A;  4EQN A;  5IGE A;  5JAV A;  3S9W A;  5ISR A;  2EYL A;  4DF7 A;  1TR5 A;  3BDC A;  3HEJ A;  3ITP A;  3D4D A;  4ZQ3 A;  4E6I A;  5IGD A;  2F0T A;  2EY2 A;  5K5P A;  3NXW A;  4K6D A;  4RKB A;  5KEE A;  3RUZ A;  4NDX A;  5C3W A;  4KJO A;  3EVQ A;  4KD3 A;  2EY1 A;  1KAA A;  5CV7 A;  3V2T A;  5IGG A;  2PW7 A;  3PMF A;  4DFA A;  2EYP A;  2PZW A;  3SK6 A;  4HMI A;  4B9W A;  1AEX A;  5C4Z A;  2F0D A;  4G57 A;  5IGB A;  5CV5 A;  3R3O A;  5F2D A;  5HUR A;  1SNQ A;  3ERO A;  4KY6 A;  2RBM A;  1EZ8 A;  1SYF A;  4MIU A;  3MZ5 A;  1ENC A;  5DAU A;  1A3T A;  2EYO A;  3OMG A;  4QMG A;  5I6Y A;  4KV6 A;  1ENA A;  2F0V A;  5I9P A;  4ZUJ A;  1EZ6 A;  2EY6 A;  1SYB A;  2F0M A;  2SNS A;  4PMC A;  5CGK A;  2F0L A;  1EY9 A;  3EJI A;  5J1Z A;  4H7B A;  1EYA A;  4K5V A;  4HMJ A;  3TP5 A;  2F3V A;  4WOR A;  2EYF A;  4K8J A;  5DEH A;  5JOB A;  1KDA A;  2PW5 A;  4KD4 A;  3TP7 A;  1NSN S;  5M9O A;  2EYH A;  1U9R A;  1EY7 A;  3MXP A;  4HTH A;  3C1F A;  4ID6 A;  3MEH A;  4KHV A;  5E3F A;  5J39 A;  4DU9 A;  5C6A A;  2LKV A;  3NQT A;  4N9T A;  4KJN A;  4RKL A;  4EVO A;  5C4H A;  3D8G A;  1SYC A;  3LX0 A;  1EY8 A;  2OEO A;  2F0W A;  4R8N A;  2RKS A;  2F0E A; 
#chains in the Genus database with same CATH topology
 2VL6 A;  1Q3L A;  1PRT C;  1QZG A;  3A7L A;  3VYU A;  2F0I A;  3BYT B;  1IW7 C;  4TKO B;  1E24 A;  4PMW A;  1RCV D;  4BY7 G;  4A75 A;  4GS3 A;  4X66 Q;  2B2U C;  4ME3 A;  1LTT D;  5IOC A;  4J8Q A;  3CCR A;  2NVQ B;  5I6W A;  1GM5 A;  4UAI A;  1HR0 L;  1ROD A;  4UP8 A;  1RF2 D;  1HNW L;  2Q2I A;  1WI5 A;  1A6X A;  5LL6 X;  3QG1 A;  2KA7 A;  2YYZ A;  3A8K E;  4OIK A;  1EFI D;  1NMG A;  3DUZ A;  3JAM i;  5CBA E;  3TDQ A;  3DWP A;  4B3S L;  1IBK Q;  3M4O H;  2Y0S G;  5IP9 H;  4GKJ L;  2K5Q A;  1IHZ A;  3D4W A;  2R7D A;  1ICF B;  1TS2 A;  5IGF A;  1PH2 A;  1SDF A;  4ZUI A;  2KHS A;  3X3N A;  5M3M G;  4MTN A;  4YHH Q;  5JJK A;  1JWS D;  1JR0 D;  3NBH B;  2Q2T A;  2JA7 B;  1UE7 A;  1K83 B;  4GLX A;  1M1K C;  4CGY B;  1X54 A;  4RGT A;  1WFQ A;  3R2T A;  2UUC L;  3K7A B;  2KHI A;  4OIJ A;  2A6E D;  1A63 A;  1RL2 A;  4GLA C;  3BZD B;  3NEN A;  1K9M C;  4ME5 A;  3TP8 A;  4QL5 A;  3E3X A;  2PZT A;  5C3E B;  3LNN A;  4JI3 L;  1RJT A;  5LMN W;  1RHP A;  3S24 A;  1GOZ A;  1JC7 A;  2KUM A;  4IUN A;  4EGV A;  5IGD A;  4JPB W;  2R93 B;  3GP7 A;  3EVQ A;  3HOX G;  2F3I A;  2N88 A;  2HIX A;  3LGJ A;  3Q8D A;  4DR1 L;  1BBW A;  4HIO A;  2MQH A;  4OEM B;  1WTX A;  3DXJ C;  4P75 A;  4GNX B;  3HOU B;  1A3T A;  1XWE A;  4KV6 A;  1VQB A;  1I94 L;  3EJI A;  1Y1W G;  4H7B A;  4JI0 Q;  3W5O A;  4A3G B;  2JA6 G;  1ZEQ X;  2EYF A;  3TRE A;  1NE3 A;  3OTO Q;  5CMD A;  2YTY A;  4CDE C;  3CAM A;  3NQT A;  2SDF A;  1BNZ A;  4UPA A;  2HHH Q;  3BZC A;  2RA4 A;  1VMP A;  3HKZ G;  3VYR A;  4LFB L;  4C3H B;  2Q2U A;  2XN9 C;  3SE0 A;  4X65 L;  1B3Q A;  5ELN A;  2RDG A;  3BVG A;  4LUO A;  3PO3 G;  1STB A;  1CTM A;  1VQ9 A;  3CMA A;  3K7A H;  3QOJ A;  3KLS A;  3VYT A;  3PCO B;  4TRD A;  5CV6 A;  4A3D B;  1E1T A;  5D65 A;  2EYM A;  2JA7 H;  5C5L A;  4DAY B;  2IX3 A;  3GTM B;  4M1U B;  3TRZ A;  3A7A B;  1U4R A;  3NSW A;  4KHP Q;  2DN8 A;  2GA4 B;  3PUY A;  2EJG C;  1VQG A;  1SYD A;  3FPU B;  5C44 B;  4KN7 C;  3M4O B;  1KXL A;  1RTO A;  4A3F G;  1II3 A;  1ZYR D;  3E0E A;  1LT6 D;  1HTP A;  4OHJ A;  3NK9 A;  4LF5 Q;  4KKU A;  3DWA A;  5M3F H;  3M7G A;  1MKH A;  4B9X A;  5IE8 A;  5T1I A;  1K8G A;  4LF9 L;  2IW3 A;  4P72 A;  5IYB G;  4JVZ A;  5ELE A;  4BBR H;  1LT3 D;  2K04 A;  1LTA D;  3D4R A;  3A5Z B;  1Z47 A;  4A3M G;  3J7A F;  3G6E A;  2B2T A;  1HNZ L;  2HT1 A;  2WFW A;  2UUA Q;  1IL8 A;  1B9M A;  1S5C D;  1EQQ A;  1DZ1 A;  2NZ1 D;  1XPO A;  4N9P A;  2IWH A;  5JAV A;  1Y1W H;  1X3E A;  2B2U A;  2IPK D;  4POG A;  4X3S A;  2XRQ D;  3CCU A;  5M5Y H;  1L0X B;  2MGS A;  1SXT A;  4DR2 Q;  1D7Q A;  2PZW A;  1J5E Q;  5IGB A;  2DNE A;  1E2V A;  3HOW H;  1DJR D;  4QMG A;  1EEI D;  3CRL C;  4LUV A;  5I6Y A;  1AZP A;  3CC2 A;  1WCM H;  2R6G A;  4RH6 A;  2CHB D;  2R61 A;  1D5X C;  4AYB G;  4A3K H;  1NSN S;  1HA5 A;  3MXP A;  4JOI C;  1P16 A;  1GD7 A;  4IO9 A;  2E2H H;  4ULL A;  4IOA A;  5IP9 G;  1JT8 A;  3SDZ A;  4A3I G;  1PFB A;  2O5J C;  2HUG A;  1KIX A;  4KLK A;  4JYA Q;  4HSV A;  3MHB A;  2JE6 I;  2PI2 E;  1I50 B;  2LXJ A;  3CC4 A;  1YNN C;  2B2T C;  2OXP A;  1NUC A;  3MFY A;  1EYG A;  4WJW A;  3J80 i;  3MXN B;  2AWO A;  3GTK B;  2UU9 Q;  5FKA C;  3IAY A;  1ICW A;  2F0N A;  2E5L Q;  2F4V Q;  2BDN A;  2EJM A;  2MP1 A;  1BR9 A;  1FJG Q;  1LTL A;  2CQA A;  1V8Q A;  3HRZ C;  4DR2 L;  1HZC A;  4BBR G;  1QCB D;  1HNW Q;  1VQ5 A;  2PYK A;  3RLO A;  1JB3 A;  2KEN A;  4A93 G;  1G91 A;  2K03 A;  5C4X H;  2X69 A;  4DUY L;  3S16 B;  1TWF H;  1J9O A;  2WAC A;  2IX0 A;  1B53 A;  3GTG H;  2VZA A;  3AQQ A;  2A1A A;  5JEA J;  1ZKO A;  2PNH A;  3MTS A;  1NAP A;  4DK3 C;  1F77 A;  3ULJ A;  3NWT A;  3FHW A;  2WB1 E;  3H94 A;  2CWA A;  1UE5 A;  3NPP A;  2JA8 G;  1YIT A;  1Q82 C;  3SK4 A;  1UEA B;  1GUT A;  3PIP A;  1HZA A;  1CHP D;  1WTR A;  4YWM A;  5A2Q L;  1V1Q A;  4S3S A;  5ISR A;  3AFQ A;  3MC0 B;  2Z6K A;  4DV1 L;  2QGQ A;  2A69 D;  4UHV A;  2MJ8 A;  1QVG A;  1YEZ A;  1E2W A;  2OWO A;  1XNR Q;  1KAA A;  3I3C A;  2VW9 A;  2KEC A;  1C48 A;  4A3J B;  2A6E C;  3PMF A;  1G29 1;  3KOJ A;  4OEL B;  5F2D A;  5HUR A;  4GN4 B;  1H9J A;  4CDC C;  4I7Z C;  3ER0 A;  3EN2 A;  1K73 C;  2NB0 A;  4Y52 H;  1MJE A;  1EWC A;  2EE1 A;  1WTO A;  1VQ7 A;  1DOK A;  5K36 G;  1W3S A;  2K75 A;  4C1N K;  4GNX C;  3F1Z A;  3ICE A;  2PW5 A;  4QUF A;  1U9R A;  2C9O A;  3G7L A;  4C3J G;  1QG7 A;  1E2Z A;  4ALP A;  5GAH C;  3F8T A;  3T56 B;  3TEH B;  1HUN A;  1I3Q B;  1D1I A;  3I90 A;  1LAB A;  3VA7 A;  2A69 C;  1EQV A;  1PV4 A;  5C5M A;  2K4K A;  2LMC B;  3SXH A;  1X56 A;  5IT9 E;  1K0R A;  1G2S A;  4JI3 Q;  4G4K A;  2A74 C;  1O78 A;  4Y7N H;  1D1K A;  1KNA A;  2XVS A;  4IUR A;  5IP7 H;  2SOB A;  1UAP A;  3K80 C;  4DR4 Q;  1YJ9 A;  2A68 C;  3R8B A;  4DV4 L;  4XDX A;  2E74 C;  1VQL A;  1WTW A;  4A3E G;  1JE5 A;  5JVG 3;  4JBJ A;  5C3E H;  4RAU C;  3DM1 A;  3FRP B;  1IZ6 A;  2DY8 A;  3GTQ B;  1TS4 A;  1IBL L;  5FOB B;  4DV2 Q;  4LF5 L;  1DD2 A;  5KND A;  2Y0S E;  2UXB L;  5I2Y A;  1Q7Y C;  1BQQ T;  1VF7 A;  5CV8 A;  1NR2 A;  4B3T Q;  1TII D;  1MHW C;  2UXC Q;  3P75 A;  2BH8 A;  3JAM E;  1DCZ A;  4XIG S;  1D2B A;  2ES2 A;  1XMQ Q;  2JA8 B;  2R7Z B;  3GD7 A;  2ZM6 L;  4DNR B;  3S15 B;  2F0P A;  1ILP A;  3SGI A;  2F52 A;  2ZTC A;  1IXR A;  1B7Y B;  2QDB A;  5I9O A;  3J7Y W;  4PMB A;  2PQA B;  4NPS A;  1LTR D;  3L2P A;  2N78 A;  4TVA B;  4AQY L;  4NXM Q;  2NUC A;  2EDG A;  2Z0S A;  1YNX A;  3P20 A;  4L5Q A;  5IOD A;  1VMC A;  2A73 B;  4ZQ3 A;  3J7A V;  4BBS H;  5K36 H;  4CJ1 B;  3URY A;  5M5X H;  4RG1 A;  2WV6 D;  4L5S A;  1VQ4 A;  1KHI A;  3PIO 3;  2E2D C;  4R4C A;  1YNJ D;  3OHX C;  3KUP A;  4OWT B;  5LL6 S;  1AE2 A;  3ONA B;  3J81 E;  1V9P A;  3A56 A;  2JYO A;  3J80 c;  1NMF A;  4ZCK A;  1QNU A;  1SJE D;  3H0G H;  3I91 A;  1H9R A;  2JSO A;  3G6J B;  1PYW D;  3F2C A;  5E4X A;  1LUZ A;  3AB9 A;  4YCW A;  3RLF A;  1I6H B;  4A3I H;  1Y1V B;  2WAQ E;  5IP7 G;  1VQF A;  1FNW A;  4JI8 L;  2CFM A;  3LX0 A;  1GUO A;  5FJ8 H;  2JK8 A;  5HY6 A;  1YVC A;  4A4I A;  3NE5 B;  1F2Z A;  1VQJ A;  1CQV A;  1QUQ B;  1RKN A;  1HNZ Q;  1STA A;  1VS0 A;  4JI6 L;  4LF4 Q;  4XYO A;  1HJP A;  2VNU D;  4ZAI A;  3W3A A;  1XNQ Q;  1I50 H;  1Z6H A;  3I4M B;  2CW0 C;  2B2V C;  3FKI G;  4EQP A;  4L8J A;  2PQA A;  4CJ0 B;  4IPC A;  2KCN A;  1KLU D;  2E2H B;  1TWH H;  2ENB A;  3FKI B;  4A93 H;  4ZRZ A;  1PVO A;  4K5X A;  1YIJ A;  1SMX A;  1B70 B;  1TWC H;  1CHQ D;  4J6H A;  1STN A;  3FEW X;  2NZH A;  2YU9 H;  3JC6 6;  2F3W A;  4UY8 C;  4LF7 Q;  4DR5 L;  1KDC A;  1LYL A;  1S3O A;  1XPU A;  4G7O C;  3WOE A;  3DLL A;  1YNJ C;  4JI7 Q;  4QGU A;  5IWA Q;  4K2L A;  1J8I A;  3G48 A;  4R4I A;  1WTH A;  2K14 A;  4GOP B;  3R93 A;  4QF4 A;  1NBW A;  1PZK D;  4KY5 A;  1QE6 A;  2O2L D;  1B2T A;  1FGU A;  1UUP A;  4C3I B;  2EQS A;  2HHH L;  2NVX H;  4XT1 B;  3KLR A;  1EWI A;  1HTL D;  4KMU C;  3T4A C;  4AQY Q;  4HN7 A;  4DK1 A;  4DV5 Q;  1VQP A;  1R9T B;  3OW7 A;  2JA9 A;  1V1P B;  3D31 A;  1GUN A;  1QUQ A;  3CKI B;  1VQK A;  3ERO A;  3J80 E;  2HCC A;  2CH4 W;  4LFA Q;  3KDF B;  4CDD C;  4RGN A;  1CKN A;  1KTK A;  2F0M A;  1MD2 D;  2KJX A;  2ATW A;  1EYA A;  3UDG A;  3PO3 B;  4WOR A;  4HCS A;  5DEH A;  1KDA A;  4KD4 A;  1OXS C;  2UU9 L;  5FK9 C;  2RSN A;  3RN5 A;  3K0Y A;  4ID6 A;  1G6Z A;  4DU9 A;  1PFN A;  2F4I A;  1IYU A;  1EOT A;  4NB3 A;  2FFK B;  1GJX A;  1MIU A;  2R92 B;  1PZJ D;  4JW0 A;  4DAM A;  4OGQ C;  5FLX L;  4EQ5 A;  2V4D A;  1SMY C;  5EKI A;  4JBM A;  4JOI A;  1D5M C;  1K28 A;  2KED A;  2D9U A;  4KHP L;  3DMU A;  3C46 A;  3QB3 A;  4IUT A;  4HJ5 A;  1TWA H;  4IJL A;  5C44 H;  3KK7 A;  4OL7 A;  4RHS A;  1L1O C;  4MTK A;  3RR5 A;  1SSO A;  1XXG A;  2Z9H A;  3NTK A;  3NBI A;  1J6Q A;  2D0P A;  4JI5 L;  3TP6 A;  1CZG A;  4YIJ A;  1JWM D;  1PH5 A;  3SVM A;  4B3R Q;  4A3D H;  1DOM A;  2AKW B;  1EY4 A;  2ID0 A;  1A2U A;  1H95 A;  2C5C A;  3J7A 5;  1ONL A;  1ZXT A;  3ND9 A;  1CA6 A;  3AMU A;  1HXY D;  3PO3 H;  2AQ2 B;  2Q2H A;  1NTG A;  2HCI A;  4IPG A;  3K0X A;  1W6J A;  4B08 A;  4C3H H;  3X3M A;  4ABN A;  2EJF C;  5CV4 A;  1UNS A;  2OTL A;  3U58 A;  2R92 G;  3AYH B;  5EKK A;  3RD4 A;  3T13 A;  1N33 L;  4QQB X;  1R9T H;  1TS5 A;  2EYL A;  4FYD A;  5FJ8 G;  5K5P A;  3TZD A;  3K5L A;  1JIC A;  4KJO A;  1MBY A;  2EY1 A;  5CV7 A;  1GUG A;  4DV6 L;  1QZH A;  2KCM A;  2LS0 1;  1IYJ B;  1PFS A;  2F0D A;  1PH8 A;  2OTJ A;  3E6Z X;  1WTQ A;  5DAU A;  3I4N B;  2DUD A;  4KK7 A;  4XYQ A;  1T5E A;  2AQ3 B;  1HNX Q;  1GO3 E;  3I7F A;  3K6O A;  5C0X J;  1CT1 D;  1G2T A;  1PHJ A;  3NEL A;  3BG3 A;  4POF A;  1C4Q A;  1EY7 A;  4HTH A;  5M9O A;  1NJI C;  5C6A A;  4DV1 Q;  5C0X G;  2E2J H;  2PCF B;  1VQ8 A;  2GN5 A;  1HPC A;  1QVC A;  4DV3 L;  4I7A A;  3S1M B;  1TWC B;  4JV5 Q;  1IL2 A;  1VQD A;  2K50 A;  2UXD Q;  3OMC A;  2B3G A;  3C3L A;  4IUU A;  2I5H A;  4RCO A;  3CCE A;  5EGT A;  3GTP H;  5JVH 3;  1SND A;  2Z8L A;  1KLG D;  2MHV A;  1HNX L;  3AEV A;  1B50 A;  1WCM G;  4PG3 A;  4LJZ C;  3Q22 A;  1XTD A;  2GVA A;  5CR3 A;  1NNX A;  2ZTD A;  4QJF A;  5BN3 A;  3VYS A;  2K5H A;  4K8I A;  4N8X 1;  1L2F A;  4YWK A;  3TME A;  3HOZ B;  3DHQ A;  4DV7 L;  2PZU A;  2ZJP A;  4DR6 L;  3CF5 A;  1SN8 A;  3UDI A;  4K14 A;  1JOQ A;  2F0K A;  4DA2 A;  1EYD A;  3HP3 A;  1Q46 A;  2JA5 G;  2UXD L;  1Y1V H;  4RHR A;  4IUP A;  3J7Z C;  3SHL A;  4FXG C;  5EAY A;  1IKL A;  3NHH A;  2E5L L;  3GV3 A;  3SK5 A;  3S17 B;  4A3L G;  3K5O A;  3LWU A;  4AH6 A;  4DV4 Q;  1YI2 A;  4LF8 L;  3VR5 A;  4DR5 Q;  3E0J A;  3L3O C;  1E7Z A;  3ULL A;  1STG A;  3D0F A;  1I4G A;  3BJU A;  1YZ6 A;  5LMN L;  3W1B A;  1PTO H;  1N36 Q;  2WII B;  4LK1 C;  3I2Z A;  4AIM A;  5M5X B;  4DR3 Q;  1E1O A;  4KD3 A;  2UXC L;  4HJ8 A;  2JA5 B;  1TXY A;  2YU9 B;  1AH9 A;  3I8Z A;  2X6L A;  5KNC A;  3V2T A;  1AEX A;  1PRT B;  2AUK A;  3T53 B;  4FF2 A;  2XWJ B;  4GKJ Q;  1PYB A;  2EY6 A;  3UE1 A;  5GAG C;  2PPB C;  2XIW A;  4HR7 B;  3S1N B;  1HHV A;  2JA8 H;  4LUZ A;  3TP5 A;  2K33 A;  1XX8 A;  1KD1 C;  3UE0 A;  3FVQ A;  4DPG A;  4GNX A;  5IYD H;  5JPN C;  2AUJ D;  4KJN A;  1WD0 A;  5DNF A;  5EBC A;  4HIM A;  3BS1 A;  1TU2 B;  3CRK C;  1CKO A;  4L5T A;  2B63 B;  5M3F G;  3RZO B;  1JCK B;  4KHZ A;  5KYL A;  4JI2 L;  1EL0 A;  4DV0 L;  2JEA I;  1TQO A;  4BXX G;  1T5X D;  1TT2 A;  3HFZ B;  4H13 C;  1C0A A;  2D0O A;  4PV1 C;  3U4V A;  4K6L A;  3RZD H;  3ULP A;  2NVT H;  1SBB B;  2PMZ E;  5M3M H;  4LF9 Q;  1G51 A;  2ICE C;  1R4P B;  4QCL A;  4R4T A;  3S14 H;  1XNQ L;  2MO1 A;  5IYC H;  3H0G B;  5ELC A;  5EQ0 A;  4MNO A;  4ZYS A;  2F0O A;  4YY3 L;  2F0J A;  1LM0 A;  1PYS B;  4LNQ A;  2O5I C;  1U4M A;  1RD9 D;  1KRT A;  3CPF A;  2NTS A;  1WVL A;  4I65 A;  2AWN A;  4L5R C;  1SNC A;  5JJL A;  4BBS B;  1TKW B;  1X65 A;  2N55 A;  5G3L D;  2OQK A;  1FGB D;  3EQL C;  3CPW A;  2G9D A;  3JAM c;  4A3E B;  2A8V A;  4X64 Q;  2EXZ A;  2UXB Q;  1HQM C;  3GTJ H;  4F88 A;  2JJQ A;  3W1G A;  2R7Z H;  4TSS A;  4A3E H;  2RCN A;  2WAQ G;  1BXT A;  2K05 A;  2BCO A;  3EIV A;  1MSG A;  1HA6 A;  3G71 A;  3J81 i;  5J3B A;  3I4M G;  3H3V I;  1A62 A;  5C4Z A;  1P8L A;  2N3S A;  3PQI A;  5CV5 A;  2R93 G;  1SNQ A;  3AFP A;  3GTQ H;  1CKN B;  3HGB A;  5C4J H;  3A74 A;  3I56 A;  4IUV A;  4WJ3 M;  2Q8R E;  1HCZ A;  4BWG B;  4BY1 H;  4HMJ A;  3HOZ G;  3MXG A;  1BCP F;  1SEB D;  1WTV A;  5C4X G;  1K3B C;  3M85 A;  2LSS A;  3RZO H;  2LKV A;  4EVO A;  2E8G A;  5D3D A;  2VUM H;  2F4V L;  1TWF B;  1EY8 A;  3IL8 A;  3HOY H;  1AW7 A;  4Z9C B;  3S16 H;  5C4X B;  1PH7 A;  1VQM A;  3K59 A;  2XSC A;  4WJ4 A;  3M9B A;  4GOP A;  2K7V A;  2B2V A;  1A3U A;  1PRT D;  1XTC D;  4A3F B;  3RN2 A;  4C2M B;  3N52 A;  5KNB A;  1DM0 B;  3G4S A;  1LT5 D;  3F2U A;  5I4D A;  2WAQ B;  4B3R L;  3P1H A;  2MUY A;  4H02 A;  4UP7 A;  3PIP 3;  3P7J A;  2XNA C;  4ZLT F;  3QWN A;  3TSS A;  4DNI A;  3QOL A;  1ET9 A;  1PRT F;  1PH4 A;  1PLF A;  1BO0 A;  4X65 Q;  2QCP X;  2JEB I;  3KJO A;  4IOC A;  4IUQ A;  1Y8O B;  3QO2 A;  1CK1 A;  3BYY B;  2M9V A;  3MXU A;  2KBN A;  1N32 L;  5NUC A;  1IBK L;  1W6K A;  3MAQ A;  1D8L A;  4OX9 Q;  4FDB A;  4A3B H;  4A3L H;  2RDF A;  5GQO A;  3S17 H;  4JBK A;  3S2D H;  1R4Q B;  3EA6 A;  1BCP D;  1A2T A;  2M2L A;  4PZ7 A;  4FO2 A;  2PNR C;  2EVB A;  3HOW B;  3PUX A;  1G8Z D;  2K6A A;  3RLN A;  1SYG A;  1A3V A;  4NW2 A;  4BA2 I;  4K2K A;  4R8I A;  1YHA A;  3TS0 A;  3BDC A;  4E6I A;  3HEJ A;  3VR2 A;  2B29 A;  4O1N A;  1F2L A;  4JC0 A;  2C35 B;  1Y1W B;  4CBV A;  4AYB B;  2EYP A;  1AN8 A;  2DGY A;  1VQ6 A;  4DUZ L;  4OWW B;  1V1O A;  3BVM A;  2L55 A;  2L12 A;  2ALY B;  2H4O A;  1BF4 A;  2F0L A;  5G3L F;  2CVR A;  1CSP A;  4K0K L;  3KDF A;  5IYD G;  1FVI A;  5M3F B;  3MEH A;  2CW0 D;  1XMO L;  3GTK H;  2BDO A;  1DON A;  4N9T A;  4RKL A;  1V1P A;  4JI4 L;  3MFG A;  5D14 A;  4FF3 A;  2Z6K C;  3H3V C;  1RIP A;  3DWQ A;  4BS9 A;  1A0I A;  1GVP A;  3PIO A;  2WKD A;  2F0E A;  3M4Y A;  2QA4 A;  1B8A A;  2B2Y A;  1GHJ A;  3K7U C;  3CQZ B;  1F9Q A;  1YJN A;  2E2I B;  3QJY A;  4A3M B;  3E5S A;  4F7X A;  3S2D B;  2HQL A;  3GTO B;  2F0U A;  4LFB Q;  1HRJ A;  3GTM H;  2QW7 A;  4NXN L;  3LWE A;  3GTL B;  4IZ8 A;  1JOO A;  2Y0S B;  1BCP B;  4RGM A;  2QEX A;  3GTP B;  2JXM B;  4XT3 B;  3KBG A;  4CKC A;  2B8G A;  3D6W A;  4YCV A;  4GN5 A;  3M7N A;  1WCM B;  4O42 A;  1XMO Q;  4CDF C;  2N8N A;  5A2Q E;  5C0X I;  2E2J B;  2HD3 A;  4DUZ Q;  2I46 A;  1EIG A;  1MJC A;  1FL0 A;  1X3Q A;  2VQF Q;  3WOF A;  3FP9 A;  3H09 A;  4U68 A;  4QUC A;  5IGC A;  4DV6 Q;  1VQO A;  2EOT A;  2CCZ A;  2VQE Q;  1PDQ A;  3CCS A;  2NN6 I;  3V96 A;  2IHE A;  4IAL A;  1Q90 A;  5BN4 A;  1EIF A;  4J1M A;  1TY2 A;  1EFW A;  4RMF A;  1JJC B;  4BA1 I;  3J81 L;  1ILQ A;  4F8M A;  2K5D A;  2Z4I A;  1FR3 A;  2FJ2 A;  3OOC A;  2XGT A;  4O0A A;  4RA8 A;  4RWS C;  5COR A;  4X3U A;  1EYC A;  2R7Z G;  1LTI D;  5C44 G;  4BBR B;  1CKM A;  1DGS A;  1H9M A;  2F0T A;  3MWY W;  5FO8 B;  4J15 A;  1JB7 A;  4NDX A;  3DEO A;  2P5Z X;  3K81 C;  4JK1 C;  3I4N G;  4BY1 B;  2PW7 A;  4DR7 L;  2JA6 B;  2HIV A;  2I07 B;  2NN6 H;  4MZ9 A;  3T1Y L;  1L1O B;  5DM6 3;  4A3D G;  1WYD A;  2L9H A;  4YCU A;  1EZ8 A;  1SYF A;  1I5F A;  3CCM A;  1SRU A;  4B3T L;  1AZQ A;  2MPM A;  4BY1 G;  1VQA A;  4LFC Q;  3HKZ B;  1LAC A;  4DN4 M;  2JN4 A;  1F9P A;  1BDO A;  5JOB A;  3BU2 A;  4C3H G;  3KJP A;  1K83 H;  3CW2 C;  2R92 H;  2RHQ B;  4A3K G;  1N36 L;  1PH1 A;  2PMZ B;  2G5D A;  2L1B A;  3WWV A;  1SR3 A;  2WP8 J;  1SYC A;  1DYQ A;  1CZW A;  3CCQ A;  4HJ7 A;  1Q8I A;  2OCE A;  3BZK A;  4NXM L;  1JJ2 A;  4UP9 A;  1L0W A;  3L0O A;  1HR0 W;  3M3Y B;  5EJW A;  4A3G G;  4NKL A;  3UI2 A;  1ENF A;  3H6M A;  1B9N A;  2ZTE A;  3HOV B;  1VQI A;  4HIK A;  4YHH L;  4FXK C;  2ZJR A;  5EPK A;  1PMR A;  5AJ3 L;  2RHS B;  2QKI C;  3KLS X;  2J4X A;  5E4W C;  4IFD H;  3S2H B;  4ZKC B;  4UDU C;  3D6C A;  2TSS A;  2IL8 A;  2OF1 A;  5I2X A;  4APV A;  1Y8N B;  4RFB A;  3MA2 B;  2KQ3 A;  2AQ1 B;  1YHB A;  3K8A A;  4C3I H;  1VQH A;  2EPB A;  2ZXR A;  5JEA H;  3AU7 A;  4PZ6 A;  1U4L A;  2JP1 A;  5HGT A;  4CHT B;  2ASB A;  1I94 Q;  1PTO C;  2IX1 A;  3SEB A;  3EFX D;  3O13 A;  4CKB A;  3PF4 A;  3HOV G;  2BE5 D;  3OTO L;  1U5K A;  3CD6 A;  1NY4 A;  3RZD B;  4KTA A;  5LMU L;  4BY7 B;  2LFN A;  3H3V H;  1RDP D;  1HFG A;  4PNY A;  1E3P A;  3ZYY X;  2F0Q A;  1YBY A;  5EKL A;  1VCI A;  1SNM A;  2NVX B;  1S72 A;  2CWP A;  2K1B A;  2UUB Q;  1NCV A;  1N34 L;  1TR5 A;  3QIA A;  4KKT A;  4OXP A;  1EWH A;  3H0G G;  1LTS D;  1WJJ A;  3PO2 B;  4DKA C;  4OON A;  5AJ3 Q;  3W2D A;  2G9H D;  2JQO A;  1TWG B;  1K3R A;  3GTL H;  2DJG C;  3S1N H;  3GTO H;  4B9W A;  5FLX E;  1XYI A;  3R3O A;  2E2I H;  5COY A;  1IKM A;  1HZB A;  3MEF A;  5ELD A;  3CQZ H;  1CA5 A;  1PH9 A;  5I9P A;  1ENA A;  5CGK A;  3F2D A;  1O80 A;  1SRO A;  2A5H A;  3VR6 A;  2UUB L;  4C1N I;  2I0Q A;  4K8J A;  5ELF A;  5ELO A;  5J39 A;  1X55 A;  1QJO A;  1PTO B;  2NVQ H;  1SE3 A;  3FKI H;  3KYH C;  1ET6 A;  4A93 B;  1OXT A;  4C3J H;  2FHT A;  2QF7 A;  1IW7 D;  2NBF A;  1F9S A;  1KQS A;  2F0G A;  4GKK L;  4LFA L;  2LY7 A;  3TQY A;  3M4P A;  2IHF A;  4JBW A;  2GVB A;  2D5D A;  3C1E A;  1I4Q A;  5CBE E;  1X3P A;  4G7Z C;  4KY7 A;  4JI0 L;  3K5M A;  4NP5 A;  1OXX K;  2YV5 A;  2F0F A;  2CKZ B;  3OWE B;  5ELB A;  4HJ9 A;  4GOP C;  3DEP A;  3A0J A;  4R4O A;  2L5T A;  2PI2 A;  3HOX B;  4A3I B;  1OTC A;  2M00 A;  3KF8 B;  1X9N A;  5KGU A;  5L37 A;  1MSH A;  1STY A;  1IBM L;  3T16 A;  2EY5 A;  3TBI B;  3OSO A;  1K0S A;  3OIP A;  4HJA A;  2BA1 A;  3J80 L;  1FD7 D;  1T9H A;  4JI1 Q;  5JJI A;  5BN5 A;  3A8J E;  1TY0 A;  2VXW A;  1PZI D;  3S15 H;  1ZYR C;  3SK8 A;  3HG9 A;  1VQC A;  4C3J B;  1DOL A;  3PO2 H;  1N8R C;  2VS1 A;  1JOR A;  3MXN A;  5KRU A;  3ERS X;  4JYA L;  3FMC A;  3VR3 A;  4R1J A;  5KYI A;  3S9W A;  1HH2 P;  3IRB A;  5EBD A;  3GQB A;  4EX5 A;  1EQR A;  4B3M L;  4BY7 H;  4GLV B;  4A3F H;  1N34 Q;  4DFA A;  1VDZ A;  1C9O A;  4LFC L;  5EPL A;  2QIL A;  5GAE C;  1TWG H;  4JCV E;  5JPM C;  3MZ5 A;  3KF6 B;  1QB5 D;  1SYB A;  2SNS A;  1LTB D;  2TMP A;  4DR7 Q;  1CSQ A;  5J1Z A;  5IYB H;  4X66 L;  1GXD C;  1MI2 A;  4Q0F A;  3OYY A;  2L4N A;  1M90 C;  2EYH A;  3STB C;  2IT1 A;  1ESF A;  3C1F A;  1HFN A;  1MGS A;  3KF6 A;  1EOV A;  1HZ9 A;  2A6H C;  2E75 C;  5TSS A;  3I72 A;  2B39 A;  4HCE A;  1HUM A;  4QIW B;  2ZXO A;  4K0K Q;  4C3I G;  1Y8P B;  4R8N A;  4ZK9 B;  3CCL A;  2KHJ A;  3EBE A;  2UUA L;  1Y69 U;  2B2W A;  4NMZ A;  4DNT B;  3ND8 A;  5C3X A;  1KDB A;  4LW1 A;  2L15 A;  3U4Z A;  3HOV H;  2HDL A;  4Y7N B;  4RCN A;  3NUC A;  1A8V A;  1VQE A;  1WOC A;  3OPO A;  3M3Y H;  2YTV A;  1EY0 A;  1JOK A;  1LV9 A;  5JJZ A;  1SJH D;  1LTG D;  3GTJ B;  3S2H H;  3NBH A;  5HGQ A;  4YWL A;  1YHQ A;  2DNC A;  3UDX A;  1Q1B A;  5LHY 1;  2NZO A;  2YTX A;  4XTC S;  3Q24 A;  3NEM A;  1HR0 Q;  3I4O A;  3UDF A;  4PQX A;  4L63 B;  4OX9 L;  2WB1 G;  1FNV A;  3CCJ A;  2EYJ A;  2NYZ D;  5T1G A;  3T51 B;  3CHB D;  4QIW E;  4WFN 3;  4HSP A;  1I6V C;  2VUM G;  1TWA B;  2QEJ C;  3HOY G;  1HQR D;  3I73 A;  4KKS A;  2K5W A;  2V1C C;  1ESR A;  2JA6 H;  5C3E G;  1IBM Q;  2NVY B;  1BKB A;  3BDO A;  4K5W A;  2L0C A;  4FNF A;  5KIX A;  1L0Y B;  2ZT9 C;  4ILW A;  2O4X A;  1JWU D;  1EIY B;  2Z4H A;  1D6E C;  3S1Q H;  4L6T B;  5LMU Q;  4EQN A;  1WD1 A;  4JI4 Q;  1AP0 A;  1VF5 C;  3S1R H;  2BE5 C;  3D4D A;  2EXD A;  3J81 c;  1QWY A;  4DR4 L;  3NXW A;  5KEE A;  3T1H Q;  2K28 A;  3A8I E;  3RUZ A;  5M3M B;  1QVF A;  1SE2 A;  4RGO S;  1Z9F A;  5LMN Q;  5GAD C;  3QR8 A;  3GDE A;  5M5W B;  5AFW A;  4DUY Q;  5CYU A;  2RBM A;  4IPD A;  3Q6S A;  3OMG A;  3WDN A;  1XPR A;  1KNE A;  4ZUJ A;  1EZ6 A;  4AYB E;  1Q81 C;  4PMC A;  5GRO A;  1EY9 A;  4A3B G;  4DR1 Q;  1B1Z A;  2MFI A;  5E7N A;  3TP7 A;  3CME A;  2FMC A;  2K01 A;  1QOH A;  1SFO H;  2BH2 A;  4O2D A;  1I4X A;  1QIL A;  2K5N A;  1M4V A;  4IJH A;  1I4P A;  2NTT A;  4HED A;  2UUC Q;  2KVM A;  4X3T A;  2OQ0 A;  4A3K B;  1TS3 A;  4MN3 A;  2ZJQ A;  2Q8T A;  3KLW A;  1DXM A;  2BOS A;  4A3M H;  4LAA A;  4DXG A;  1IYV A;  2B8F A;  1XMQ L;  1EU4 A;  2ZM6 Q;  1WTP A;  3KBX A;  2JA5 H;  3IFT A;  4LWC A;  4G7H C;  5J22 A;  2F0H A;  1KRS A;  1STH A;  2WB1 B;  1O7Z A;  3HS0 C;  4X64 L;  1ML0 D;  1UEB A;  1JQY D;  3N6R A;  3I4L A;  4CJ2 C;  3VR4 A;  3T1Y Q;  1I4R A;  3E9H A;  3OWF A;  2J7Z A;  1H9S A;  4JI6 Q;  1PXU A;  3HOW G;  1KAW A;  1SYE A;  4P2C B;  1PFM A;  3RMH A;  4ODG A;  2L11 A;  4H0L C;  3MVV A;  4DGZ A;  4LF6 Q;  1GUW A;  3CP0 A;  4Q5V A;  3KF8 A;  1SNP A;  4X6A H;  2ICI A;  1O7I A;  1Q1E A;  4KN4 C;  4C56 C;  3PO2 G;  3PGZ A;  4LF6 L;  3U9O A;  3A55 A;  1V43 A;  5M5Y B;  3NWS A;  2VB2 X;  2KOL A;  2X6G A;  1BVS A;  2H1E A;  4FF4 A;  2KCT A;  4U67 3;  3M4Q A;  4GKK Q;  4YY3 Q;  1XJV A;  5EPJ A;  3Q23 A;  5FLX c;  4A3C H;  4DAV A;  4X3K A;  3HOU G;  1A15 A;  4DV2 L;  4M8A A;  2FXQ A;  2QDL A;  3PUZ A;  2XWB B;  1BCP C;  4LF7 L;  4XQJ A;  3H91 A;  5IGG A;  2HDM A;  3K58 A;  4A3B B;  1U4P A;  2RCF A;  2R7F A;  4DV0 Q;  4DAY A;  1ENC A;  1PH3 A;  1S5B D;  2EYO A;  2DJF C;  2RSO A;  1OXU A;  2B63 G;  1JE4 A;  2FMM A;  1JMC A;  3S1M H;  5FO7 B;  1TVX A;  4K5V A;  2RVL A;  4ZKB B;  3A5U A;  2WIN B;  2D2C C;  5E3F A;  4KHV A;  2I5L X;  1PTO D;  5C4H A;  1PA6 A;  3D8G A;  1K8O A;  1JJG A;  2N49 A;  4P71 A;  3NQI A;  3PUW A;  1RTN A;  1X6O A;  2RKS A;  5IYC G;  1CUK A;  5IWA L;  4C2M H;  3HKZ E;  3CU7 A;  3I4N H;  1Q12 A;  3D3R A;  3IKJ A;  4BBS G;  2I5M X;  1UE1 A;  3H15 A;  2J0T D;  2NN6 G;  1GUS A;  1G6P A;  2VY3 A;  1NR4 A;  3J81 j;  4QB4 A;  3A54 A;  1X3F A;  1S5D D;  1W2B A;  1GKH A;  1AFP A;  4JI2 Q;  4DV7 Q;  4XQN A;  2XTI A;  4V19 0;  1SFO B;  1D5Z C;  3PV0 A;  3BDL A;  2PQE A;  3DM3 A;  1F2Y A;  4IFD I;  5IIF A;  2VUM B;  3FDT A;  1EQT A;  4DV5 L;  2R3Z A;  3GO5 A;  1KAB A;  4EQO A;  3C2P A;  1STE A;  5E1F A;  4OO1 H;  1PTO F;  2SNM A;  5DM7 3;  5M5W H;  1S40 A;  1I4H A;  3RNU A;  1EEF D;  2HQE A;  1FJG L;  3TS2 A;  4A3G H;  3HKS A;  5C4J B;  4A3C G;  4LF4 L;  2A6H D;  5D3I B;  4LMQ D;  1SAP A;  4DR6 Q;  4R4Q A;  3HOU H;  3VA5 A;  1VQN A;  3S1R B;  1SE8 A;  1EY5 A;  1BOS A;  1BUV T;  3ERQ A;  2RDH A;  2A68 D;  3SR1 A;  1F2M A;  3HOY B;  4IFD J;  4IPH A;  3I70 A;  2PO4 A;  4WRD A;  3S1Q B;  3HZX A;  3B6Y A;  1Q86 C;  1EUJ A;  4CKE A;  2DY7 A;  2R93 H;  1O7Y A;  4IFD G;  4XXE A;  5BR8 L;  1BBU A;  1PH6 A;  1I3Q H;  2NVY H;  3NP8 A;  4GZY C;  1EIH A;  5IY0 A;  3ITP A;  3CXC A;  1CFM A;  4P73 A;  2MNA A;  4RKB A;  1FYC A;  5JEA G;  5C3W A;  4OO1 I;  3CCV A;  1YNN D;  3PSI A;  1Z7T A;  2B2W C;  1N32 Q;  2EIF A;  1OXV A;  1N9W A;  4DAP A;  4N8F A;  4QY7 A;  4JI1 L;  3SK6 A;  4HMI A;  4HAE A;  2A19 A;  4KY6 A;  2RF4 A;  3BVZ A;  4DR3 L;  1K8M A;  2H5X A;  2AMC B;  1CM9 A;  1KL9 A;  2F1M A;  1ASY A;  4A3J H;  2AHO B;  2F3V A;  4JI7 L;  5IT9 L;  4TQU S;  1ASZ A;  3Q0A A;  4F87 A;  4DK0 A;  1O7L A;  3VDY A;  2IJ0 A;  2CQO A;  3E9I A;  5A35 A;  3L7Z C;  3S14 B;  2F0W A;  2OT2 A;  1OO9 B;  1SE4 A;  1C8C A;  3K5N A;  4FXD A;  5BR8 Q;  1L1O A;  1AE3 A;  3HOX H;  1KC8 C;  5FLM H;  3PUV A;  2SEB D;  2NVT B;  2KEE A;  3TN2 A;  4JG2 A;  2FIN B;  3FPP A;  1E0B A;  1LLR D;  3R2I A;  4BXX H;  4XQQ A;  2F03 A;  2MO0 A;  5IT9 c;  5C0X H;  1K8A C;  4MHE A;  4JI5 Q;  2VQE L;  3PF5 A;  1X32 A;  3V05 A;  3STB D;  3U9S A;  1SNO A;  3JAM L;  3GTG B;  3TZU A;  1J5E L;  3KFU A;  2B2Y C;  4B3M Q;  4IQZ A;  5DLQ E;  1H9S B;  5CC4 A;  2K52 A;  2RQX A;  4GN3 B;  3ZJY C;  1YJW A;  1S4Z A;  1LO5 D;  2IY5 B;  1EY6 A;  1E22 A;  1F9R A;  2CH4 A;  1S5E D;  4H44 C;  4DXF A;  1XNR L;  2ZXP A;  1B44 D;  3IFD A;  3NTH A;  1X3G A;  4KI0 A;  4HID A;  2B63 H;  4IN3 A;  2Z6B A;  3U50 C;  2F0S A;  1M8A A;  2JA7 G;  2E76 C;  2K32 A;  4X62 L;  3NTI A;  4DV3 Q;  4FF1 A;  4P74 A;  1SLJ A;  2WKC A;  1SMY D;  5CV9 A;  4NXN Q;  4JV5 L;  4DK6 C;  1BBX C;  1B3A A;  1UWV A;  1TWH B;  4X62 Q;  1Q8K A;  4A76 A;  1QNK A;  1Y1V G;  2K5V A;  2EZV A;  1U0L A;  4DF7 A;  5IGE A;  4A3J G;  2VQF L;  2EY2 A;  4OWX B;  4K6D A;  1CI3 M;  1GHK A;  3L9A X;  3I4M H;  3CC7 A;  4FVM A;  4JI8 Q;  5H1S E;  3K57 A;  4G57 A;  2NWG A;  1EU3 A;  3T1H L;  4MIU A;  1Y14 B;  1S5F D;  3GV6 A;  4LF8 Q;  2F0V A;  2BA0 A;  1FNU A;  5FLM G;  1H9K A;  2Z1C A;  1N33 Q;  1C7Y A;  2Q8I B;  4V0B A;  1LT4 D;  2D62 A;  2VB3 X;  2LXK A;  4R9W A;  3I55 A;  3HOZ H;  1I6H H;  1UE6 A;  3OW2 A;  3OIQ A;  4FP5 D;  4B3S Q;  4OO1 G;  4PZ8 A;  5FO9 B;  2KCC A;  2XRS D;  1CQF A;  2OEO A;  3F2B A;  1B4O A;  1IBL Q; 
#chains in the Genus database with same CATH homology
 1Q3L A;  1PRT C;  3A7L A;  3VYU A;  2F0I A;  3BYT B;  1IW7 C;  4TKO B;  4PMW A;  1RCV D;  2B2U C;  1LTT D;  5IOC A;  4J8Q A;  2NVQ B;  5I6W A;  4UAI A;  1ROD A;  1RF2 D;  1A6X A;  5LL6 X;  3QG1 A;  2KA7 A;  2YYZ A;  3A8K E;  4OIK A;  1EFI D;  3DUZ A;  5CBA E;  3TDQ A;  3DWP A;  2K5Q A;  1IHZ A;  3D4W A;  1TS2 A;  5IGF A;  1SDF A;  4ZUI A;  2KHS A;  3X3N A;  1JWS D;  1JR0 D;  2JA7 B;  1K83 B;  4CGY B;  4RGT A;  3R2T A;  3K7A B;  4OIJ A;  2A6E D;  3BZD B;  4ME5 A;  3TP8 A;  2PZT A;  5C3E B;  3LNN A;  1RJT A;  1RHP A;  1GOZ A;  1JC7 A;  2KUM A;  4IUN A;  4EGV A;  5IGD A;  2R93 B;  3GP7 A;  3EVQ A;  2N88 A;  1WTX A;  3DXJ C;  3HOU B;  1A3T A;  1XWE A;  4KV6 A;  3EJI A;  4H7B A;  4A3G B;  1ZEQ X;  2EYF A;  5CMD A;  3NQT A;  2SDF A;  1BNZ A;  2RA4 A;  1VMP A;  3VYR A;  4C3H B;  2XN9 C;  3SE0 A;  2RDG A;  3BVG A;  1STB A;  1CTM A;  3QOJ A;  3KLS A;  3VYT A;  4TRD A;  5CV6 A;  4A3D B;  5D65 A;  2EYM A;  5C5L A;  2IX3 A;  3GTM B;  4M1U B;  3A7A B;  1U4R A;  3NSW A;  2DN8 A;  2GA4 B;  3PUY A;  2EJG C;  1SYD A;  3FPU B;  5C44 B;  4KN7 C;  3M4O B;  1RTO A;  1II3 A;  1ZYR D;  1LT6 D;  1HTP A;  4OHJ A;  3NK9 A;  4KKU A;  3DWA A;  3M7G A;  4B9X A;  5T1I A;  2IW3 A;  5ELE A;  1LT3 D;  2K04 A;  1LTA D;  3D4R A;  1Z47 A;  3J7A F;  2B2T A;  1IL8 A;  1B9M A;  1S5C D;  1DZ1 A;  2NZ1 D;  4N9P A;  2IWH A;  5JAV A;  2B2U A;  2IPK D;  4X3S A;  2XRQ D;  1L0X B;  2MGS A;  1SXT A;  2PZW A;  5IGB A;  2DNE A;  1E2V A;  1DJR D;  4QMG A;  1EEI D;  3CRL C;  5I6Y A;  1AZP A;  2R6G A;  4RH6 A;  2CHB D;  2R61 A;  1D5X C;  1NSN S;  1HA5 A;  3MXP A;  4ULL A;  3SDZ A;  1PFB A;  2O5J C;  2HUG A;  4HSV A;  3MHB A;  2JE6 I;  1I50 B;  1YNN C;  2B2T C;  2OXP A;  1NUC A;  3MFY A;  4WJW A;  2AWO A;  3GTK B;  5FKA C;  3IAY A;  1ICW A;  2F0N A;  2BDN A;  2EJM A;  2MP1 A;  1BR9 A;  2CQA A;  1V8Q A;  3HRZ C;  1QCB D;  2PYK A;  1G91 A;  1JB3 A;  2K03 A;  3S16 B;  2X69 A;  1J9O A;  2WAC A;  2IX0 A;  1B53 A;  5JEA J;  1ZKO A;  3MTS A;  1NAP A;  1F77 A;  3NWT A;  3H94 A;  3NPP A;  3SK4 A;  1UEA B;  1GUT A;  1CHP D;  1WTR A;  5A2Q L;  4S3S A;  5ISR A;  3MC0 B;  2A69 D;  2MJ8 A;  1E2W A;  1KAA A;  3I3C A;  2KEC A;  1C48 A;  4A3J B;  2A6E C;  3PMF A;  1G29 1;  5F2D A;  5HUR A;  1H9J A;  4I7Z C;  2NB0 A;  1EWC A;  2EE1 A;  1WTO A;  1DOK A;  5K36 G;  4C1N K;  2PW5 A;  4QUF A;  1U9R A;  2C9O A;  3G7L A;  4C3J G;  1QG7 A;  1E2Z A;  3T56 B;  1HUN A;  1I3Q B;  1D1I A;  3I90 A;  1LAB A;  3VA7 A;  2A69 C;  1EQV A;  5C5M A;  2LMC B;  3SXH A;  5IT9 E;  1G2S A;  4G4K A;  2A74 C;  1O78 A;  1D1K A;  1KNA A;  2XVS A;  4IUR A;  2SOB A;  1UAP A;  2A68 C;  3R8B A;  4XDX A;  2E74 C;  1WTW A;  5JVG 3;  4RAU C;  3DM1 A;  3FRP B;  2DY8 A;  3GTQ B;  1TS4 A;  5FOB B;  1DD2 A;  5KND A;  5I2Y A;  1BQQ T;  1VF7 A;  5CV8 A;  1NR2 A;  1TII D;  3P75 A;  3JAM E;  1DCZ A;  4XIG S;  1D2B A;  2JA8 B;  2R7Z B;  3GD7 A;  4DNR B;  3S15 B;  2F0P A;  1ILP A;  2QDB A;  5I9O A;  3J7Y W;  4PMB A;  1LTR D;  2NUC A;  2EDG A;  3P20 A;  5IOD A;  1VMC A;  2A73 B;  4ZQ3 A;  3J7A V;  5K36 H;  4CJ1 B;  3URY A;  2WV6 D;  3PIO 3;  2E2D C;  1YNJ D;  3OHX C;  3KUP A;  5LL6 S;  3ONA B;  3J81 E;  3A56 A;  2JYO A;  1QNU A;  1SJE D;  3I91 A;  1H9R A;  2JSO A;  3G6J B;  1PYW D;  5E4X A;  3AB9 A;  3RLF A;  1I6H B;  1Y1V B;  1FNW A;  3LX0 A;  1GUO A;  3NE5 B;  1F2Z A;  1CQV A;  1RKN A;  1STA A;  4XYO A;  2VNU D;  4ZAI A;  3W3A A;  1Z6H A;  3I4M B;  2CW0 C;  2B2V C;  4EQP A;  4L8J A;  4CJ0 B;  2KCN A;  1KLU D;  2E2H B;  2ENB A;  3FKI B;  4ZRZ A;  4K5X A;  1CHQ D;  4J6H A;  1STN A;  3FEW X;  2F3W A;  1KDC A;  4G7O C;  3WOE A;  1YNJ C;  4K2L A;  1J8I A;  3R93 A;  4QF4 A;  1PZK D;  4KY5 A;  1QE6 A;  2O2L D;  1B2T A;  1UUP A;  4C3I B;  4XT1 B;  3KLR A;  1HTL D;  4KMU C;  3T4A C;  4HN7 A;  4DK1 A;  1R9T B;  3OW7 A;  1V1P B;  3D31 A;  1GUN A;  3CKI B;  3ERO A;  3J80 E;  2HCC A;  4RGN A;  1KTK A;  2F0M A;  1MD2 D;  2KJX A;  1EYA A;  3PO3 B;  4WOR A;  4HCS A;  5DEH A;  1KDA A;  4KD4 A;  1OXS C;  5FK9 C;  2RSN A;  3K0Y A;  4ID6 A;  1G6Z A;  4DU9 A;  1PFN A;  2F4I A;  1IYU A;  1EOT A;  2FFK B;  1GJX A;  2R92 B;  1PZJ D;  4OGQ C;  5FLX L;  2V4D A;  1SMY C;  5EKI A;  1D5M C;  2KED A;  2D9U A;  3DMU A;  3C46 A;  3QB3 A;  4IUT A;  3KK7 A;  4OL7 A;  4RHS A;  1SSO A;  1XXG A;  3NTK A;  3NBI A;  3TP6 A;  1CZG A;  4YIJ A;  1JWM D;  3SVM A;  1DOM A;  1EY4 A;  2ID0 A;  1A2U A;  2C5C A;  1ONL A;  1CA6 A;  1ZXT A;  3ND9 A;  3AMU A;  1HXY D;  2AQ2 B;  2HCI A;  1W6J A;  4B08 A;  3X3M A;  4ABN A;  2EJF C;  5CV4 A;  1UNS A;  5EKK A;  3RD4 A;  3T13 A;  1TS5 A;  2EYL A;  4FYD A;  5K5P A;  3TZD A;  3K5L A;  1JIC A;  4KJO A;  1MBY A;  2EY1 A;  5CV7 A;  1GUG A;  2LS0 1;  2F0D A;  3E6Z X;  1WTQ A;  5DAU A;  3I4N B;  4KK7 A;  4XYQ A;  1T5E A;  2AQ3 B;  3K6O A;  5C0X J;  1CT1 D;  1G2T A;  3BG3 A;  5M9O A;  1C4Q A;  1EY7 A;  4HTH A;  5C6A A;  5C0X G;  2PCF B;  1HPC A;  3S1M B;  1TWC B;  3OMC A;  3C3L A;  4IUU A;  4RCO A;  5EGT A;  5JVH 3;  1SND A;  2Z8L A;  1KLG D;  2MHV A;  1B50 A;  4LJZ C;  3Q22 A;  5CR3 A;  5BN3 A;  3VYS A;  4K8I A;  3TME A;  3HOZ B;  3DHQ A;  2PZU A;  4K14 A;  1JOQ A;  2F0K A;  4DA2 A;  1EYD A;  3HP3 A;  4RHR A;  4IUP A;  3SHL A;  4FXG C;  1IKL A;  3NHH A;  3S17 B;  3GV3 A;  3SK5 A;  3K5O A;  3LWU A;  3VR5 A;  3E0J A;  3L3O C;  1STG A;  1I4G A;  1PTO H;  2WII B;  4LK1 C;  5M5X B;  2JA5 B;  4KD3 A;  2YU9 B;  3I8Z A;  2X6L A;  5KNC A;  3V2T A;  1AEX A;  1PRT B;  2AUK A;  3T53 B;  4FF2 A;  2XWJ B;  2EY6 A;  2PPB C;  2XIW A;  4HR7 B;  3S1N B;  1HHV A;  3TP5 A;  2K33 A;  1XX8 A;  3FVQ A;  5JPN C;  2AUJ D;  4KJN A;  1WD0 A;  5DNF A;  5EBC A;  3BS1 A;  1TU2 B;  3CRK C;  2B63 B;  3RZO B;  1JCK B;  4KHZ A;  5KYL A;  1EL0 A;  2JEA I;  1TQO A;  1T5X D;  1TT2 A;  4H13 C;  4PV1 C;  4K6L A;  1SBB B;  2ICE C;  1R4P B;  4QCL A;  3H0G B;  5ELC A;  5EQ0 A;  4ZYS A;  2F0O A;  2F0J A;  2O5I C;  1U4M A;  1RD9 D;  2NTS A;  1WVL A;  4I65 A;  2AWN A;  1SNC A;  4BBS B;  1TKW B;  2N55 A;  5G3L D;  1FGB D;  3EQL C;  2G9D A;  4A3E B;  2EXZ A;  1HQM C;  4F88 A;  4TSS A;  1BXT A;  2K05 A;  2BCO A;  1MSG A;  1HA6 A;  5C4Z A;  5CV5 A;  1SNQ A;  3HGB A;  4IUV A;  2Q8R E;  1HCZ A;  4BWG B;  4HMJ A;  3MXG A;  1BCP F;  1SEB D;  1WTV A;  3M85 A;  2LKV A;  4EVO A;  5D3D A;  1TWF B;  1EY8 A;  3IL8 A;  1AW7 A;  4Z9C B;  5C4X B;  3K59 A;  2XSC A;  2K7V A;  2B2V A;  1A3U A;  1PRT D;  1XTC D;  4A3F B;  4C2M B;  3N52 A;  5KNB A;  1DM0 B;  1LT5 D;  3F2U A;  5I4D A;  2WAQ B;  3P1H A;  2MUY A;  3PIP 3;  3P7J A;  2XNA C;  4ZLT F;  3QWN A;  3TSS A;  3QOL A;  1ET9 A;  1PRT F;  1PLF A;  1BO0 A;  2QCP X;  2JEB I;  4IUQ A;  1Y8O B;  3QO2 A;  1CK1 A;  3BYY B;  2M9V A;  3MXU A;  5NUC A;  1W6K A;  3MAQ A;  2RDF A;  1R4Q B;  3EA6 A;  1BCP D;  1A2T A;  2M2L A;  4FO2 A;  2PNR C;  2EVB A;  3HOW B;  3PUX A;  1G8Z D;  2K6A A;  1SYG A;  1A3V A;  4NW2 A;  4BA2 I;  4K2K A;  4R8I A;  3BDC A;  4E6I A;  3HEJ A;  3VR2 A;  4O1N A;  1F2L A;  1Y1W B;  4CBV A;  4AYB B;  2EYP A;  1AN8 A;  1V1O A;  3BVM A;  2L55 A;  2L12 A;  2H4O A;  1BF4 A;  2F0L A;  5G3L F;  2CVR A;  5M3F B;  3MEH A;  2CW0 D;  2BDO A;  1DON A;  4N9T A;  4RKL A;  1V1P A;  3MFG A;  5D14 A;  4FF3 A;  3H3V C;  3DWQ A;  4BS9 A;  2WKD A;  2F0E A;  3M4Y A;  2B2Y A;  1GHJ A;  3CQZ B;  1F9Q A;  2E2I B;  3QJY A;  4A3M B;  3E5S A;  4F7X A;  3S2D B;  3GTO B;  2F0U A;  1HRJ A;  3LWE A;  3GTL B;  4IZ8 A;  1JOO A;  2Y0S B;  1BCP B;  4RGM A;  3GTP B;  2JXM B;  4XT3 B;  3KBG A;  4CKC A;  2B8G A;  3D6W A;  3M7N A;  1WCM B;  4O42 A;  5A2Q E;  5C0X I;  2E2J B;  2I46 A;  1EIG A;  1X3Q A;  3WOF A;  3H09 A;  4U68 A;  4QUC A;  5IGC A;  2EOT A;  1PDQ A;  2NN6 I;  3V96 A;  5BN4 A;  1Q90 A;  4IAL A;  4J1M A;  1TY2 A;  4BA1 I;  3J81 L;  1ILQ A;  4F8M A;  2K5D A;  2Z4I A;  1FR3 A;  2FJ2 A;  3OOC A;  4RA8 A;  4RWS C;  5COR A;  4X3U A;  1EYC A;  1LTI D;  4BBR B;  1H9M A;  2F0T A;  3MWY W;  5FO8 B;  4NDX A;  3DEO A;  4JK1 C;  4BY1 B;  2PW7 A;  2JA6 B;  2I07 B;  2NN6 H;  5DM6 3;  2L9H A;  1EZ8 A;  1SYF A;  1AZQ A;  2MPM A;  3HKZ B;  1LAC A;  4DN4 M;  1F9P A;  1BDO A;  5JOB A;  4C3H G;  2PMZ B;  2L1B A;  2WP8 J;  1SYC A;  1DYQ A;  1CZW A;  1Q8I A;  3M3Y B;  5EJW A;  4NKL A;  3UI2 A;  1ENF A;  3H6M A;  1B9N A;  3HOV B;  4FXK C;  5EPK A;  1PMR A;  2QKI C;  3KLS X;  2J4X A;  5E4W C;  4IFD H;  3S2H B;  4ZKC B;  4UDU C;  3D6C A;  2TSS A;  2IL8 A;  2OF1 A;  5I2X A;  1Y8N B;  4RFB A;  3MA2 B;  2KQ3 A;  2AQ1 B;  2EPB A;  2ZXR A;  5JEA H;  3AU7 A;  1U4L A;  2JP1 A;  5HGT A;  4CHT B;  1PTO C;  2IX1 A;  3SEB A;  3EFX D;  3O13 A;  4CKB A;  2BE5 D;  3RZD B;  4KTA A;  4BY7 B;  2LFN A;  1RDP D;  1HFG A;  4PNY A;  3ZYY X;  2F0Q A;  5EKL A;  1VCI A;  1SNM A;  2NVX B;  2K1B A;  1NCV A;  1TR5 A;  3QIA A;  4KKT A;  1EWH A;  1LTS D;  3PO2 B;  3W2D A;  2G9H D;  1TWG B;  4B9W A;  5FLX E;  1XYI A;  3R3O A;  5COY A;  1IKM A;  5ELD A;  1CA5 A;  5I9P A;  1ENA A;  5CGK A;  1O80 A;  2A5H A;  3VR6 A;  4C1N I;  4K8J A;  5ELF A;  5J39 A;  1QJO A;  1PTO B;  1SE3 A;  4A93 B;  1ET6 A;  1OXT A;  2FHT A;  2QF7 A;  1IW7 D;  2NBF A;  1F9S A;  2F0G A;  2LY7 A;  4JBW A;  2D5D A;  3C1E A;  1I4Q A;  5CBE E;  1X3P A;  4G7Z C;  4KY7 A;  3K5M A;  4NP5 A;  1OXX K;  2F0F A;  3OWE B;  5ELB A;  3DEP A;  2L5T A;  3HOX B;  4A3I B;  2M00 A;  5KGU A;  1MSH A;  1STY A;  3T16 A;  2EY5 A;  3TBI B;  3OSO A;  3OIP A;  2BA1 A;  3J80 L;  1FD7 D;  5BN5 A;  3A8J E;  1TY0 A;  2VXW A;  1PZI D;  1ZYR C;  3SK8 A;  3HG9 A;  4C3J B;  1DOL A;  1JOR A;  3MXN A;  5KRU A;  3FMC A;  3VR3 A;  5KYI A;  3S9W A;  5EBD A;  3GQB A;  4DFA A;  1VDZ A;  5EPL A;  2QIL A;  5JPM C;  3MZ5 A;  1QB5 D;  1SYB A;  2SNS A;  1LTB D;  2TMP A;  5J1Z A;  1GXD C;  1MI2 A;  4Q0F A;  2L4N A;  2EYH A;  2IT1 A;  1ESF A;  3C1F A;  1HFN A;  1MGS A;  2A6H C;  5TSS A;  2E75 C;  3I72 A;  2B39 A;  4HCE A;  1HUM A;  4QIW B;  2ZXO A;  4C3I G;  1Y8P B;  4R8N A;  4ZK9 B;  1Y69 U;  2B2W A;  4NMZ A;  4DNT B;  3ND8 A;  5C3X A;  1KDB A;  2HDL A;  4Y7N B;  4RCN A;  3NUC A;  3OPO A;  1EY0 A;  1JOK A;  1LV9 A;  5JJZ A;  1SJH D;  1LTG D;  3GTJ B;  3NBH A;  2DNC A;  1Q1B A;  5LHY 1;  4XTC S;  3Q24 A;  4PQX A;  4L63 B;  1FNV A;  2EYJ A;  2NYZ D;  5T1G A;  3T51 B;  3CHB D;  4WFN 3;  4HSP A;  1I6V C;  1TWA B;  2QEJ C;  1HQR D;  3I73 A;  4KKS A;  2K5W A;  1ESR A;  2NVY B;  3BDO A;  4K5W A;  2L0C A;  4FNF A;  5KIX A;  1L0Y B;  2ZT9 C;  4ILW A;  2O4X A;  1JWU D;  2Z4H A;  1D6E C;  4L6T B;  4EQN A;  1WD1 A;  1AP0 A;  1VF5 C;  2BE5 C;  3D4D A;  1QWY A;  3NXW A;  5KEE A;  2K28 A;  3A8I E;  3RUZ A;  5M3M B;  1SE2 A;  4RGO S;  5M5W B;  5AFW A;  5CYU A;  2RBM A;  3Q6S A;  3OMG A;  3WDN A;  1KNE A;  4ZUJ A;  1EZ6 A;  4PMC A;  1EY9 A;  1B1Z A;  3TP7 A;  2FMC A;  2K01 A;  1QOH A;  1I4X A;  1QIL A;  1M4V A;  1I4P A;  2NTT A;  4HED A;  2KVM A;  4X3T A;  4A3K B;  1TS3 A;  4MN3 A;  2Q8T A;  1DXM A;  2BOS A;  4LAA A;  4DXG A;  1IYV A;  2B8F A;  1EU4 A;  1WTP A;  3KBX A;  3IFT A;  4G7H C;  5J22 A;  2F0H A;  1STH A;  2WB1 B;  1O7Z A;  3HS0 C;  1ML0 D;  1JQY D;  3N6R A;  3I4L A;  4CJ2 C;  3VR4 A;  1I4R A;  3OWF A;  2J7Z A;  1H9S A;  1PXU A;  1SYE A;  4P2C B;  1PFM A;  3RMH A;  4ODG A;  2L11 A;  4H0L C;  3MVV A;  4DGZ A;  1GUW A;  4Q5V A;  3KF8 A;  1SNP A;  2ICI A;  1Q1E A;  4KN4 C;  4C56 C;  3U9O A;  3A55 A;  1V43 A;  5M5Y B;  3NWS A;  2VB2 X;  2KOL A;  2X6G A;  4FF4 A;  2H1E A;  4U67 3;  5EPJ A;  3Q23 A;  4DAV A;  4X3K A;  1A15 A;  4M8A A;  3PUZ A;  2XWB B;  1BCP C;  4XQJ A;  3H91 A;  5IGG A;  2HDM A;  3K58 A;  4A3B B;  1U4P A;  4DAY A;  1ENC A;  1S5B D;  2EYO A;  2RSO A;  1OXU A;  1JE4 A;  2FMM A;  5FO7 B;  1TVX A;  4K5V A;  2RVL A;  4ZKB B;  2WIN B;  2D2C C;  5E3F A;  4KHV A;  1PTO D;  5C4H A;  3D8G A;  1K8O A;  3NQI A;  3PUW A;  1RTN A;  2RKS A;  3CU7 A;  1Q12 A;  3D3R A;  3IKJ A;  2J0T D;  2NN6 G;  1GUS A;  1NR4 A;  4QB4 A;  3A54 A;  1S5D D;  1AFP A;  4XQN A;  4V19 0;  1SFO B;  1D5Z C;  3PV0 A;  3BDL A;  2PQE A;  1F2Y A;  4IFD I;  5IIF A;  2VUM B;  3FDT A;  1EQT A;  2R3Z A;  3GO5 A;  1KAB A;  3C2P A;  4EQO A;  1STE A;  5E1F A;  4OO1 H;  1PTO F;  2SNM A;  5DM7 3;  1I4H A;  1EEF D;  2HQE A;  5C4J B;  2A6H D;  5D3I B;  4LMQ D;  1SAP A;  3VA5 A;  3S1R B;  1EY5 A;  1BOS A;  1BUV T;  3ERQ A;  2RDH A;  2A68 D;  3SR1 A;  1F2M A;  3HOY B;  4IFD J;  3I70 A;  2PO4 A;  4WRD A;  3S1Q B;  3HZX A;  4CKE A;  2DY7 A;  1O7Y A;  4IFD G;  4XXE A;  3NP8 A;  4GZY C;  1EIH A;  3ITP A;  1CFM A;  4RKB A;  1FYC A;  5JEA G;  5C3W A;  4OO1 I;  1YNN D;  1Z7T A;  2B2W C;  1OXV A;  4DAP A;  3SK6 A;  4HMI A;  4HAE A;  4KY6 A;  3BVZ A;  1K8M A;  1CM9 A;  2F1M A;  2F3V A;  5IT9 L;  4TQU S;  3Q0A A;  4F87 A;  4DK0 A;  1O7L A;  2IJ0 A;  5A35 A;  3L7Z C;  3S14 B;  2F0W A;  2OT2 A;  1SE4 A;  1OO9 B;  1C8C A;  3K5N A;  4FXD A;  3PUV A;  2SEB D;  2NVT B;  2KEE A;  3TN2 A;  2FIN B;  3FPP A;  1E0B A;  1LLR D;  3R2I A;  4XQQ A;  2F03 A;  5C0X H;  4MHE A;  1X32 A;  3V05 A;  3U9S A;  1SNO A;  3JAM L;  3GTG B;  3TZU A;  2B2Y C;  4IQZ A;  1H9S B;  5CC4 A;  2RQX A;  1S4Z A;  1LO5 D;  1EY6 A;  1F9R A;  1S5E D;  4H44 C;  4DXF A;  2ZXP A;  1B44 D;  3IFD A;  3NTH A;  4KI0 A;  4IN3 A;  2F0S A;  1M8A A;  2E76 C;  2K32 A;  3NTI A;  4FF1 A;  2WKC A;  1SMY D;  5CV9 A;  1BBX C;  1B3A A;  1TWH B;  1QNK A;  2EZV A;  4DF7 A;  5IGE A;  2EY2 A;  4K6D A;  1CI3 M;  1GHK A;  3L9A X;  4FVM A;  3K57 A;  4G57 A;  2NWG A;  1EU3 A;  4MIU A;  1S5F D;  3GV6 A;  2F0V A;  2BA0 A;  1FNU A;  1H9K A;  2Z1C A;  2Q8I B;  4V0B A;  1LT4 D;  2D62 A;  2VB3 X;  4R9W A;  3OIQ A;  4FP5 D;  4OO1 G;  5FO9 B;  2KCC A;  2XRS D;  1CQF A;  2OEO A;  1B4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...