2PZWA

Crystal structure of staphylococcal nuclease variant v66n/p117g/h124l/s128a at room temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMNENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 38
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pzwA00
1AEXA 3V2TA 5C6AA 3NQTA 3RUZA 4ODGA 4KY7A 3E5SA 5J22A 1IHZA 2EYFA 1SYFA 2F0DA 4F7XA 1JOKA 3NHHA 2EXZA 1KABA 4KJOA 3SR1A 4KTAA 3EROA 5KRUA 1SYGA 2F0IA 3TP6A 2SNMA 4K2LA 1ENCA 3QOLA 5NUCA 4K6DA 3SK4A 1SNMA 3EJIA 2PZTA 2LKVA 3PMFA 4K5VA 5CV8A 5J1ZA 1TQOA 4LAAA 2EY6A 1F2ZA 4NP5A 1SYCA 1EQVA 1STNA 2KQ3A 2WACA 3D8GA 4H7BA 5CV5A 3TP8A 3S9WA 2F0SA 4HMIA 5I9OA 3OMGA 5KEEA 3SHLA 3BDCA 5IGDA 5IGFA 2OF1A 1STHA 2PQEA 3OSOA 5CV6A 2F0VA 5C4HA 3NK9A 1A3VA 5F2DA 5I6WA 5CV7A 4ME5A 4IZ8A 2ENBA 5EKKA 5C5LA 5EKLA 5C4ZA 5IGGA 2HQEA 3MZ5A 1KAAA 2F3VA 2EY1A 4K8JA 4KD3A 5E1FA 2F0GA 5IGBA 2PYKA 2F0MA 3BDLA 3TP5A 3VA5A 5KGUA 1STGA 3P75A 2F0KA 1F2MA 2PZUA 4ZUJA 4RKBA 1RKNA 2F0HA 2F0QA 2RKSA 3MHBA 1TR5A 3OWFA 4I65A 3C1FA 4K5XA 5C3XA 5IODA 3D6CA 2NUCA 1EY5A 4K5WA 4EQPA 4EVOA 5HURA 2KHSA 4MIUA 5KYIA 1EY7A 1STYA 3D4DA 3DMUA 5ISRA 5E3FA 4QF4A 2F0EA 1SYDA 2OEOA 4KHVA 1A2UA 3ERQA 4J1MA 3NUCA 3MEHA 4DFAA 1SNQA 1SNOA 1JORA 4KV6A 1STAA 2EYOA 1EY9A 4WRDA 5CC4A 3MVVA 1SNCA 3LX0A 1II3A 1SYBA 1NUCA 3P1HA 4KY5A 2EYJA 2EYMA 3D4WA 4R8NA 1ENAA 5HGTA 5JAVA 1EZ8A 2SOBA 2F0LA 1KDAA 4B9XA 4PMCA 4G57A 2EYPA 3U9OA 3TP7A 2O4XA 4RKLA 4ID6A 1EY0A 3ITPA 2EY5A 2F0TA 1A3TA 1A2TA 2F3WA 1SNPA 2M00A 1EY4A 5I9PA 5IGCA 1EYCA 5K5PA 5M9OA 4NDXA 5J39A 2F0NA 4IUNA 3OMCA 4NKLA 5CV9A 5DAUA 2EY2A 3SK6A 3SXHA 1STBA 4B9WA 3EVQA 5C5MA 1TT2A 1JOOA 5I6YA 2F0OA 2F0WA 5CV4A 2EYLA 4K8IA 3T16A 2RDFA 4E6IA 4EQOA 2F0FA 3NXWA 5JOBA 5IIFA 2EYHA 5IGEA 4TRDA 1EYDA 4HTHA 3TMEA 4NMZA 4EQNA 2PZWA 4K14A 3QOJA 4DF7A 1KDBA 2QDBA 3SK5A 4J6HA 1U9RA 3HEJA 5C3WA 2F0UA 3QB3A 1A3UA 4KY6A 4HMJA 2F0PA 3C1EA 2PW7A 1EY6A 3R3OA 4N9PA 3T13A 4QB4A 2OXPA 5KIXA 5DEHA 1EY8A 1KDCA 4DU9A 4OL7A 3MXPA 1JOQA 4DGZA 5KYLA 1SYEA 4N9TA 4F8MA 1SNDA 1NSNS 3SK8A 4ZUIA 5CGKA 3HZXA 1EZ6A 2SNSA 3H6MA 1EYAA 2F0JA 4PNYA 3NP8A 5IOCA 4KJNA 4IALA 4K2KA 4KD4A 4YIJA 4ZQ3A 2RBMA 4S3SA 3DHQA 2PW5A 4QMGA 4WORA 1F2YA 5EGTA 4PMBA 5CR3A
chains in the Genus database with same CATH superfamily
2XWBB 1XJVA 3HOVH 3STBC 3PIO3 4BA1I 2KCMA 4JBMA 4DNIA 3K59A 4KTAA 1HA5A 3J81j 3S1RB 4GNXA 2EJMA 1KHIA 1SYGA 1HNWL 4A3EB 1ENCA 4UHVA 1F77A 4RFBA 3EJIA 1A0IA 1W6JA 2M9VA 3A74A 3N6RA 1ILPA 2B3GA 3K5MA 1EQVA 3ND9A 4DXGA 1H9KA 1VQ7A 5FO7B 3HOXB 5BN5A 4PZ6A 5FO8B 3K5NA 3FKIH 3KLSA 3H0GH 1A62A 1EQTA 4X62L 2A8VA 1SFOB 3MZ5A 4OELB 3CRLC 4CDFC 3CPWA 1ESFA 4PQXA 1ESRA 1EY5A 2KHSA 1VQ6A 2AWNA 2F52A 1G51A 5CYUA 4J8QA 5IP7G 3NE5B 2EIFA 5M3FB 4KV6A 4QUFA 3R8BA 2Q2IA 1SRUA 1D5MC 4BBSB 2ASBA 3S1RH 1WTVA 3GQBA 1NCVA 2EDGA 1CSPA 1Q3LA 2EYPA 3K7AB 1D6EC 3SEBA 2E75C 3GTPH 4LF8L 3KBGA 1JMCA 4LFAQ 1JJCB 3K0YA 2VQFQ 3HFZB 1PFNA 2LY7A 2MPMA 1EL0A 2NTSA 2RQXA 2WFWA 4TRDA 3KF6A 3CC2A 1FGUA 4H13C 3H15A 3HOZB 2A74C 5M5YB 3SK5A 3M3YH 1NE3A 1EWHA 3H3VH 1VQDA 2NVYH 4GKJL 1KDCA 1XPOA 3CPFA 2O2LD 4BY7G 1K0SA 4B3SL 1PFMA 4A3EH 4QUCA 1IBKL 4JBKA 4UY8C 4C3IH 3M7GA 5EPKA 1UE1A 3DWAA 1B1ZA 4UAIA 3OWEB 3GTGH 2VNUD 2NZOA 3J81E 3RLOA 5J22A 4A3MB 1JOKA 2RSOA 2NVQH 5LMNQ 4BA2I 3M3YB 1WVLA 3U4ZA 1VQ5A 4Z9CB 5EKIA 1B7YB 3F8TA 1YIJA 2TSSA 3TN2A 3KJPA 1QVFA 2JXMB 1JJGA 1K73C 1V43A 2Q2HA 5I9OA 3QG1A 4QIWB 3FRPB 1N36Q 2K6AA 4RHSA 1BUVT 3J80L 1G2SA 2ID0A 1A3VA 3VYUA 2DY8A 5CV7A 3UE0A 1L1OC 2QKIC 4DNRB 5IYBG 3CF5A 2I5HA 5LMUL 1RL2A 1L1OA 4LF7Q 3BDLA 3TP5A 2HIVA 2F0KA 1F2MA 1WD0A 1DOKA 1K0RA 3ND8A 4OX9Q 3PF5A 1H9SA 4I65A 1CQVA 2QA4A 1XNQQ 2F3IA 3ERSX 4MIUA 1GUOA 4GS3A 5AFWA 3EFXD 2X6GA 3UE1A 1Q1BA 1IKMA 3MEHA 2JA9A 1BBUA 1STAA 2CWPA 3O13A 5EQ0A 3U9SA 1PDQA 4LK1C 4EGVA 2E2JB 3NPPA 1R4PB 2ZJQA 4DR6Q 4DAYB 5M9OA 4C3HH 4FXGC 3PIP3 4C1NI 3FMCA 1AN8A 4GLXA 1N32Q 1F9RA 5LHY1 3RZDH 2A69D 2PI2A 1SDFA 4BWGB 3T16A 3H91A 2NBFA 3K5OA 3OHXC 2FFKB 3L7ZC 2AHOB 1U4MA 2YTYA 1SAPA 3I2ZA 4F88A 2DNCA 1VQMA 5C0XG 3CC7A 1QNUA 1PTOF 2AUKA 1N32L 1VQNA 1Y14B 1CHPD 2AQ3B 5IY0A 2E2HB 4RGOS 2WAQE 3D0FA 5FLXL 1VQFA 5HGQA 2KHJA 1ZEQX 1ET9A 4KJNA 1Q8KA 3KF6B 1EEID 4YIJA 4OO1G 3PUZA 3DHQA 4DV0L 1RCVD 1HZBA 1LLRD 3BDOA 2B2YC 3UI2A 3RMHA 3GP7A 1NBWA 4A3LH 4A93G 1Q8IA 5JVG3 3TS0A 3NELA 1SE3A 2PMZB 4A75A 3K8AA 3DEOA 1QCBD 1CKNA 4LF8Q 1B3QA 2K5QA 3TP6A 4QL5A 1WFQA 3SK4A 4A3BG 2Y0SB 3I7FA 4H44C 4DR3L 3S15B 4RA8A 5E4XA 3OMGA 1MSGA 3SHLA 3S1MH 2G5DA 2F0VA 1XTCD 5KNDA 5BR8L 5FLMH 4RCNA 4QIWE 5C0XI 3TRZA 2MUYA 4C3JB 1IBLL 4AH6A 2FINB 4K8JA 1HNZQ 4XQNA 1AP0A 2PZUA 1QILA 3HRZC 3J80E 3OYYA 4ODGA 1XX8A 2BOSA 3HOWH 3RR5A 1SMYC 5C44B 1SE2A 1I4XA 1E0BA 1JC7A 1DM0B 4QF4A 2F03A 3K7AH 1C48A 3IFTA 4N8X1 3NEMA 3VR4A 4DR6L 1SBBB 1AE3A 3MVVA 1YITA 4DV2L 2A6HC 1PRTC 4PMCA 4G57A 3A54A 3W2DA 4OIKA 3MFGA 4XYOA 4DAMA 2E2DC 1LM0A 1HTLD 3K5LA 2R92G 3RN5A 5J39A 3CCRA 3J7AF 1CKNB 2LMCB 4IUUA 1Q86C 1K83B 5CV4A 2EJFC 3GTJB 1DOMA 3NXWA 1CA6A 3HOYG 2Z6BA 5GAGC 1PXUA 3HGBA 4N9PA 3RNUA 2UU9Q 1PFBA 4QB4A 2N88A 4MTNA 1IBML 3STBD 1ASZA 4X6AH 2KBNA 3EA6A 2UUCL 2WAQB 1RDPD 4DAYA 4KD4A 3G71A 1I6HH 1F2YA 4I7ZC 1ET6A 3I55A 2UU9L 1HH2P 3CRKC 5FOBB 4O2DA 1D1KA 2IT1A 4G7HC 4POGA 1D1IA 3EROA 1WOCA 2IHFA 3E0JA 2I46A 3VR3A 2R7ZB 2LKVA 1C4QA 2QDLA 2IWHA 1DJRD 4H7BA 1EQQA 4DR3Q 1IBKQ 2F4VQ 2OTLA 1PHJA 2K32A 2Q8IB 1EU4A 2WB1B 1KC8C 1I94L 1EOTA 1LABA 2OQKA 3LWEA 5CV6A 1O7IA 4FP5D 3I56A 5I6WA 1PTOD 2EE1A 2VQFL 5C4ZA 1EFWA 4ZRZA 1LV9A 1VQCA 1BCPD 2PYKA 1V8QA 1X3GA 2L55A 3VA5A 1GO3E 4DUYQ 1B8AA 1STGA 5C4XB 1RD9D 1KAWA 3MHBA 2F0QA 1FL0A 3S17H 2ZTDA 3BZDB 4GZYC 1SSOA 4A93H 1TWFH 5KYIA 4A3LG 3HOVB 2ZXPA 4A3DG 1HZCA 1OXVA 3GV3A 2JYOA 1SNQA 1YNJD 4FDBA 1XMQQ 2Z6KA 1EY9A 1XXGA 1ZYRD 4DUYL 5JJIA 1NMFA 2UUBQ 3D4WA 1UE5A 1NR2A 3MXNA 1PTOH 1XPUA 2FJ2A 4B9XA 2CH4W 5H1SE 1PZID 2I5MX 2ZXOA 3J81L 5JVH3 2ICIA 2NVXH 4X3KA 1B53A 1L0YB 1BF4A 1DD2A 4A3KG 4EQOA 3UDGA 2RDFA 3UDXA 1FYCA 2AKWB 2Z6KC 1E24A 4JBJA 1LT6D 2HD3A 1UWVA 3VYTA 2VZAA 3CCQA 4JYAL 1Y1WH 1U9RA 4A3GG 1J5EL 2PW7A 3KF8A 4KI0A 4DXFA 2NVYB 1IW7D 2RHSB 3DWPA 2GVAA 4BY1G 3CC4A 1SNDA 4GNXB 4GKKQ 2RCNA 3PO3B 4FXDA 1STEA 3HOZH 3CMAA 1EYAA 1JE4A 3NP8A 1W3SA 1T9HA 4S3SA 3T1HQ 1K8MA 2BA0A 4BBRH 3J80c 1V9PA 3N52A 1VCIA 1WI5A 4X65L 2LS01 1MIUA 4OO1I 2BA1A 4F7XA 1HUMA 1VQAA 4LUZA 2B2TC 4BBSH 2IHEA 2IX3A 1OXSC 3K6OA 4JI6Q 2KCTA 4NP5A 1TS5A 4JV5L 3DM1A 4IPGA 1L2FA 3GTKB 2NVTH 3CCUA 1LTID 1IKLA 4LF6Q 1RJTA 4C3HB 3ONAB 2I07B 1S5BD 4IPHA 1LO5D 3GTOB 3EIVA 1X65A 2HQEA 4YCWA 1BVSA 1DONA 5HY6A 4B3SQ 1VQPA 2JA6G 1VF7A 2FHTA 5TSSA 1IXRA 2EXDA 5JEAH 3CAMA 4GOPA 2WINB 4BXXH 3C3LA 1Q12A 3GO5A 5JEAJ 5C3XA 3HOUH 2LXKA 4YHHQ 3CCVA 1M8AA 2VS1A 1SR3A 2JEAI 4NXML 2RHQB 5GAEC 2N3SA 3PCOB 4DFAA 1I6HB 4A3CG 2XTIA 1SNCA 3LX0A 1TWCB 4IPCA 1TWAH 5CBEE 3CMEA 3T1YQ 4JV5Q 5HGTA 2DJGC 5C3EG 1NNXA 2PNHA 1O80A 2C35B 1SLJA 4B3TQ 3SGIA 1N33Q 2CFMA 1BR9A 4R8IA 2M00A 1SNPA 3HOXG 3I4MH 3C46A 3K0XA 4IQZA 3SK6A 1CT1D 4YCVA 5FK9C 4ZCKA 4G7ZC 4DR4Q 2K28A 1YBYA 4TVAB 1I4PA 2EYLA 3BZCA 3T1YL 1E1OA 5IGEA 4JOIC 1PRTB 1GJXA 3FPPA 3I90A 3PSIA 2R93B 1YVCA 1WTXA 3S1NH 4KHZA 3KFUA 2SEBD 1HR0Q 2UXCL 1DYQA 1BBWA 4HJ8A 4DUZQ 1F9QA 4KKUA 1EQRA 2HUGA 4F8MA 3VDYA 1UNSA 3NTKA 4OIJA 1YNNC 3PIOA 5EBCA 1L0XB 2M2LA 5M3FG 1R9TH 4JI8Q 1D5ZC 1FNWA 2PW5A 3FKIG 4JI1Q 4NB3A 4C1NK 2IL8A 2B2UC 5LMNL 4C2MH 2UUBL 2BH8A 3TBIB 3CHBD 4K2LA 4OGQC 5NUCA 2L12A 1SNMA 3GTLB 3PMFA 2JA5B 1TVXA 5CV8A 4LFBL 2WACA 4WJ3M 4Q0FA 1ML0D 4ABNA 1HCZA 1OXTA 4WFN3 2H4OA 1I4HA 4OWXB 1HRJA 3P7JA 4KHPQ 1PZJD 4LF7L 2KUMA 4DR2Q 1VQIA 4DV7Q 1K8AC 4HR7B 4EX5A 5EKLA 2RDHA 3U50C 2E74C 2J4XA 1E2ZA 1VQLA 1DGSA 3K81C 1B50A 1KIXA 4QQBX 1B44D 5C4JB 2F0HA 3ZJYC 1BBXC 3PF4A 2CW0C 1TS2A 4DV7L 3H0GG 1EU3A 3HP3A 4X3SA 1V1OA 1A2UA 4J1MA 4YWMA 1SNOA 3KYHC 1PYSB 3JAMi 1AZPA 2K1BA 1EIGA 4RAUC 2EYMA 4A3GH 1UEBA 2CWAA 3U9OA 3TP7A 5L37A 5A2QL 2E5LQ 1G291 4R1JA 2G9DA 2MP1A 2D0OA 4C56C 4F87A 5JJZA 2EY2A 3EVQA 3L9AX 2AQ1B 2AQ2B 2F0WA 4JVZA 1FNVA 2RDGA 3J81c 5EBDA 4DV3L 2F0FA 1TS4A 2N8NA 1F2LA 1SJHD 4HTHA 3TMEA 4XQJA 1LT5D 3OIPA 3D3RA 1FR3A 4A3IG 1BQQT 3URYA 2L0CA 4DU9A 4IURA 2D5DA 1LTRD 4N9TA 3A56A 1V1QA 1A63A 5FKAC 3L2PA 1VMPA 2BCOA 5IOCA 2Y0SE 2OCEA 1QUQA 4ZQ3A 1H9SB 4U68A 1J6QA 5BN3A 3BS1A 3E5SA 4CBVA 2F4IA 2EQSA 3NHHA 1LTSD 3K58A 2NTTA 4YY3Q 2IX1A 2Q2UA 3GTGB 5FLXE 3FHWA 4HJ9A 1M4VA 3S1MB 1XPRA 5FJ8G 1T5EA 1PYBA 4K6DA 1EEFD 4A3IH 1TQOA 2KQ3A 4LF5Q 3C2PA 4DK1A 4CJ0B 1FD7D 1JT8A 1XYIA 3S2DH 5IGFA 2BDNA 1H9JA 4A3JG 3NK9A 2Q8TA 2P5ZX 5C44H 2UXBL 3TREA 1TWHH 5C4XG 5JJKA 4UP7A 3A0JA 5I2XA 3PO2G 4KMUC 3S16B 3KLSX 1X6OA 2R3ZA 2K75A 1S40A 3UDIA 2NUCA 3QWNA 5HURA 1DXMA 2B63G 3IKJA 3J81i 1Q1EA 1E2WA 1BCPF 1EUJA 1XWEA 3R93A 2VUMG 2YTVA 4MHEA 2EZVA 4LF6L 1FVIA 5CC4A 1VQGA 1SYBA 5IP9H 5AJ3L 3BVGA 1KDAA 2K5DA 4XDXA 4MN3A 1EY0A 2F3WA 5K5PA 2R7DA 3I73A 4Y7NH 2MO0A 3AEVA 4DR5Q 4RHRA 3MWYW 1PTOB 2Z4IA 2JA7G 3BVZA 4GKKL 3E3XA 1HQMC 1LYLA 2MQHA 4RH6A 2I0QA 4NXMQ 1JWMD 4CKBA 1O78A 2NZ1D 3E9HA 1E1TA 2SDFA 1WYDA 4UPAA 2E2HH 4KY6A 1B3AA 3M85A 4HIKA 3PUVA 3R3OA 5FLMG 1MD2D 4LF4Q 3I4MG 2VB2X 3I3CA 3HZXA 1SROA 3WOFA 4DK0A 4NXNL 2VXWA 2UUCQ 2RSNA 3ICEA 5G3LF 1IBMQ 1CHQD 5J1ZA 5BR8Q 1I4GA 5CR3A 4DV6Q 1HUNA 4XYQA 1IHZA 3W1GA 1SYFA 1Y1VG 2EOTA 1UEAB 3BVMA 2UXDL 4BBRB 1BO0A 4R4CA 1SJED 4XTCS 1ZXTA 1D5XC 4RG1A 3I4NG 2AWOA 4ZLTF 3S9WA 3HG9A 3S2HB 4FNFA 4ILWA 3MXNB 2K04A 3U4VA 5C4JH 3P20A 1QOHA 2ENBA 3HS0C 1LUZA 3NWTA 1DCZA 5E4WC 1EIFA 4IUQA 4JI7Q 2VQEL 2NWGA 3P75A 4OWTB 1CKMA 4ZUJA 2WAQG 5JPMC 2R92H 4PZ8A 1OXUA 2B2VA 4AYBG 3GTQH 1HQRD 2Z9HA 4DV4L 1WTRA 1K8OA 3S1NB 3P1HA 3V96A 4KK7A 2EYJA 1QZHA 1ENAA 3EQLC 1EZ8A 3MXUA 3GTMB 3FEWX 2JK8A 3G48A 2RF4A 2JN4A 4YCUA 4G7OC 1I50B 1CKOA 4L5QA 5E7NA 1Y1VH 1B4OA 1EYCA 1TS3A 2NVQB 4U673 2KVMA 3CW2C 4A3EG 1TT2A 4IFDJ 2F0OA 2E76C 4MZ9A 2L15A 5CBAE 4KLKA 1CI3M 2A5HA 2K01A 3NBIA 3SE0A 1YNXA 1PMRA 3OTOQ 1HXYD 3GV6A 2QEJC 4K14A 3VR6A 1LTAD 4JPBW 2NVXB 2O5JC 5JEAG 4BXXG 4ME3A 5K36G 1LTBD 1PA6A 1F9SA 2B2WC 2KHIA 2VUMH 1ICFB 1OXXK 3V05A 2KEDA 3BU2A 5G3LD 1XMOL 1P16A 1E3PA 1XNQL 3KJOA 3CCSA 2LFNA 1BXTA 3KDFB 5IGDA 1PH8A 2VB3X 4A3CH 4KY7A 1VQ4A 2KENA 2L1BA 2X69A 5IYBH 1OO9B 3BJUA 2EPBA 1TWAB 5KNBA 4A3KB 4K5VA 4LAAA 1F2ZA 1ZKOA 1HNXL 5IWAL 3TP8A 3F1ZA 1FJGL 2XGTA 2B63H 3BDCA 2PQEA 2CKZB 2ALYB 3Q22A 4Y52H 1KRTA 3FVQA 4ME5A 1NJIC 3F2BA 3RN2A 3S2HH 4OEMB 4OHJA 5EKKA 2V4DA 3Q0AA 5E1FA 4LF9L 3A5ZB 1PTOC 3HOZG 3PO3G 4IN3A 1CQFA 4RKBA 1JWSD 4OWWB 3C1FA 5IODA 3M4OH 2BE5D 3RLNA 4K5WA 4DR1Q 5GQOA 4RWSC 1SMYD 4PG3A 3J7A5 2ZXRA 4OX9L 4M1UB 4HIDA 3NUCA 5C0XH 2K33A 1N8RC 3OOCA 3AYHB 1II3A 4ULLA 2JP1A 1PH5A 3S24A 2K14A 3A5UA 2RCFA 5FJ8H 1X55A 4DK6C 1PRTD 2MHVA 1QUQB 4M8AA 4QCLA 1EY4A 1X3EA 3G6JB 2PCFB 5C5MA 4DR4L 1JOOA 2D2CC 1RF2D 1K28A 2HT1A 4DV5Q 1X3QA 4NMZA 4HIMA 2ATWA 3X3NA 4LUVA 2CQOA 1JWUD 1IYVA 1P8LA 3FDTA 1HTPA 1E22A 4RCOA 2X6LA 1PLFA 4TQUS 2CH4A 2FXQA 4DGZA 5C3EH 1HFNA 2NN6I 3SK8A 5CGKA 3HOWG 4G4KA 2WP8J 4PNYA 3Q24A 1HZ9A 3E0EA 3J7YW 4IO9A 3EBEA 3W1BA 1WCMB 4EQ5A 2Z8LA 5IYCG 3HOUG 1VS0A 4R4QA 3RUZA 1G6PA 1S72A 4HJ5A 3H94A 1S5FD 1G2TA 4IJHA 2EXZA 5M3MH 2ZJPA 3J7ZC 4AYBE 3JC66 3HKZB 1Z6HA 3LGJA 1YJNA 1EFID 5DLQE 1EWCA 1SYCA 5IYDH 2WIIB 2JA7H 1I4RA 1UAPA 4KHPL 3GTQB 2E2IB 5C4HA 2F1MA 5IE8A 5F2DA 5ELFA 2L5TA 1GXDC 1CUKA 5JJLA 1JJ2A 5C5LA 2QGQA 2F0GA 4A76A 1Z7TA 1TR5A 4JBWA 3CKIB 3I4OA 5J3BA 4YWKA 4HSPA 2XNAC 3W3AA 5LL6S 4LFAL 2AMCB 3A8KE 4KHVA 4A3MG 2A6HD 1GUGA 4WRDA 2EYOA 4DV0Q 2R7ZH 1NUCA 3M4YA 1QJOA 1D7QA 2SOBA 4A93B 4DR7L 2JA5G 4BBSG 1SE8A 2K5NA 4JOIA 3K57A 1U5KA 2EY5A 5I9PA 1I3QH 5IGCA 2HDLA 4DV6L 1TY0A 3ULLA 1HJPA 4NKLA 3OMCA 5CV9A 3SXHA 2ZT9C 4Y7NB 2L9HA 1SEBD 2WV6D 1TU2B 1NY4A 4K8IA 2IX0A 1R4QB 3WOEA 3NBHB 2VW9A 1RHPA 2F0UA 1X3PA 1NTGA 4GN3B 1F9PA 4C3JG 4DV5L 5ELCA 1XMQL 4RMFA 3KOJA 4R4TA 5D3IB 2QW7A 2WKDA 1PH9A 1HR0L 2F0JA 3H3VI 4BY7B 1I5FA 2JA8G 3IRBA 3S16H 1TWGB 3HKSA 2HHHQ 1A8VA 4A3DH 4PMBA 1WD1A 3TEHB 1XTDA 5D65A 3HOXH 2YU9H 2FMCA 3I72A 4IPDA 4DV2Q 1QVCA 3T56B 2XN9C 2A6ED 1SXTA 2G9HD 2A1AA 3DEPA 3A7AB 4GNXC 2ZM6Q 4IFDH 1STNA 2B2UA 4FXKC 2OT2A 3R2TA 3VYRA 1WTOA 1M90C 3KUPA 2O5IC 5D14A 4DV3Q 5IT9E 2VL6A 1B70B 4POFA 3WWVA 3RZOB 3HOYB 1Z9FA 1KAAA 3PUWA 4B08A 2DUDA 2B39A 1PZKD 4JYAQ 2F0MA 5KGUA 1EIHA 4C3JH 5IT9L 2R6GA 3KBXA 4AQYL 5KNCA 2RKSA 2LXJA 4IFDI 1MKHA 1TWFB 2XRQD 5IWAQ 2JJQA 4OXPA 1EY7A 1WTHA 3MC0B 3ERQA 3Q8DA 3X3MA 2B8GA 3TZDA 1JORA 4O1NA 1G6ZA 1KLGD 3NQIA 3NTIA 3H3VC 3W5OA 3G6EA 2J7ZA 5GADC 4Q5VA 4DR5L 4A3BB 4GN4B 2Y0SG 2K52A 3A8JE 3ITPA 4V190 4JI2L 2WB1E 1TIID 2YV5A 3I4NH 4NDXA 1CTMA 2UXCQ 4B9WA 5DAUA 1X9NA 1JB3A 1J8IA 1S5CD 2MGSA 1UE7A 5CORA 3GTMH 5I6YA 4QGUA 3M4PA 3JAME 4JI6L 3OPOA 3OW2A 1WJJA 2K50A 2QCPX 2PQAA 2ES2A 4ZAIA 4A3GB 1C9OA 3F2CA 4DF7A 4X64Q 3GD7A 5C3WA 3DLLA 3HEJA 4R4OA 3TSSA 5IP7H 3D6WA 3VR5A 1KQSA 4X66Q 3T13A 4LFCL 2VY3A 3R2IA 1PH6A 5C44G 1N36L 2ICEC 2NVTB 2KA7A 4ZUIA 2RVLA 5CMDA 4JI3Q 1O7YA 4P72A 3MFYA 4X62Q 3G4SA 1UE6A 1PRTF 5EJWA 4LJZC 1VDZA 4FVMA 4X66L 4DN4M 4JCVE 1FJGQ 1SN8A 4A3DB 2D0PA 4DR7Q 1Q90A 2GVBA 3TS2A 4CJ1B 1SMXA 1QZGA 4HSVA 1QNKA 1LTTD 4WJWA 3I8ZA 1Y1WG 2E2JH 2JA7B 4CKCA 4GN5A 1CSQA 4YY3L 1B9MA 2PO4A 1XNRL 3M9BA 2F0SA 1PH3A 3KK7A 1Z47A 3KF8B 3SDZA 3JAMc 1CFMA 4X3UA 2BE5C 2MNAA 1D2BA 3J80i 3SVMA 1VQ8A 1CK1A 5LMUQ 5EPLA 3M4QA 2A68D 2PQAB 3H09A 1WCMH 4MNOA 5BN4A 1HR0W 3S14B 3U58A 3M7NA 1HNWQ 1YI2A 1I3QB 4DV4Q 1XMOQ 1C7YA 2KECA 4EVOA 4B3MQ 4JI4L 2A73B 4K0KQ 4BY1B 3DMUA 1ENFA 2DY7A 4L5SA 5C0XJ 2A68C 1JB7A 2QILA 1I50H 3VA7A 4ZKBB 1U4LA 1GUTA 5ELDA 2D9UA 4X3TA 1PH2A 1MJCA 3FP9A 4YHHL 1GD7A 2HIXA 5JPNC 1XNRQ 2EJGC 2R93H 3GTLH 2F0LA 3DXJC 1U4PA 4TSSA 4IFDG 3A55A 5T1IA 3BYYB 5M3MB 3QJYA 3A8IE 2F0NA 1YHAA 2WB1G 1STBA 4IOAA 3CD6A 2NN6H 3GTPB 4H02A 1PVOA 4XQQA 1HFGA 5ELOA 5C4XH 4GLAC 3HKZE 5JOBA 4ZK9B 1WTQA 1N9WA 4V0BA 1R9TB 3PO2H 4CGYB 1VQOA 4C3IB 1WTWA 2B2YA 5IP9G 4A4IA 4B3ML 4JI4Q 2L11A 2PMZE 3QB3A 4HMJA 3CCEA 1IBLQ 2ZJRA 4DUZL 1JOQA 1YNND 3MTSA 1AFPA 1NSNS 1GHKA 3TZUA 5ELEA 5M5YH 1EZ6A 2EVBA 4IJLA 1TWGH 4A3FG 4CDEC 4JI3L 4C2MB 5EPJA 4A3MH 4GOPB 1VQJA 1E2VA 1T5XD 3V2TA 5ELNA 2JEBI 3AFPA 3I4LA 2EYFA 2N78A 2QEXA 1LT4D 3E6ZX 2D62A 3SR1A 2R61A 1A6XA 2K05A 4P73A 2Q8RE 1ONLA 1X32A 2SNMA 5M5XH 5DM73 2CHBD 2I5LX 4P74A 2EY6A 2A6EC 2GN5A 1TWCH 3D8GA 2R7ZG 3IL8A 4IUVA 5KEEA 2OF1A 2UUAL 1S3OA 3M4OB 4A3FH 1FNUA 1GUWA 5DM63 4LW1A 4BY7H 2UXBQ 4R4IA 5K36H 2R93G 1KXLA 1I6VC 3NSWA 2XRSD 3MAQA 5ELBA 3OWFA 3QR8A 4LMQD 1Q46A 2N49A 3KDFA 4K5XA 2BH2A 4LNQA 3H0GB 1GOZA 2E8GA 1HNZL 3AFQA 2ZM6L 3CCMA 3LNNA 5E3FA 4DA2A 3B6YA 5IT9c 3GTKH 3J7AV 1PH1A 2C9OA 3MXGA 1MBYA 2ZTEA 3HOVG 3PUXA 4K0KL 1V1PB 1H9RA 3L0OA 5M5XB 3CCJA 2NB0A 4XT1B 2F0TA 2Z4HA 2VQEQ 2HHHL 2A69C 2E2IH 1MI2A 4FF3A 3MA2B 2B8FA 1ILQA 1H95A 4L6TB 5LMNW 5I4DA 1NR4A 4QJFA 1OTCA 3ZYYX 1QG7A 3WDNA 1BCPB 2HCCA 1SFOH 1E7ZA 4OO1H 2Z0SA 3BG3A 1EYDA 5IYCH 2BDOA 2JA6H 2GA4B 1YJWA 2K5WA 2MJ8A 1J5EQ 3RZOH 1O7LA 1VQ9A 3CP0A 3VR2A 4OL7A 5KYLA 4DV1Q 1AE2A 1IYUA 2JA8B 4DK3C 3S15H 3H6MA 3ULJA 1TKWB 3PIPA 5I2YA 4MTKA 3BZKA 2JSOA 2RA4A 4QMGA 1KRSA 5C3EB 4L63B 5C6AA 3NQTA 3DUZA 3AMUA 4IUPA 4KJOA 4WJ4A 4R9WA 1QE6A 5KRUA 2JA5H 2V1CC 3PO3H 1GVPA 2NN6G 3CU7A 2H5XA 5EAYA 5CV5A 2XSCA 3RD4A 1B9NA 5T1GA 4LWCA 4DNTB 4HMIA 1JQYD 1PFSA 3A7LA 4BY1H 1W6KA 4TKOB 4LF4L 4FF4A 1J9OA 1S4ZA 4DV1L 1Y8OB 3PO2B 4YWLA 4KN7C 1YJ9A 1VQHA 4GKJQ 2CVRA 2LSSA 4H0LC 4C3HG 5IGGA 3S14H 4DKAC 4HJAA 1MSHA 2DNEA 2K7VA 5M3FH 1RKNA 1GUNA 1N33L 4DAPA 3FPUB 3D6CA 2WKCA 2NYZD 2DJFC 3HOUB 1STYA 1TY2A 1S5ED 3T53B 4HCEA 3NTHA 2Q2TA 2K03A 4KY5A 3D31A 5JAVA 3HKZG 1BNZA 4FYDA 2N55A 4HN7A 4P2CB 3PGZA 2IY5B 1A3TA 2HDMA 2Z1CA 4UP9A 1BKBA 4HIOA 4FF1A 4FO2A 2B2VC 1C0AA 4CDCC 4PMWA 1C8CA 1MGSA 1W2BA 4KKTA 2H1EA 2R7FA 5IIFA 2EYHA 1L1OB 4ALPA 5IYDG 1VQEA 4ZKCB 3PUYA 1HA6A 4JI8L 3BYTB 5DNFA 4J6HA 3RZDB 2IW3A 4JC0A 1A3UA 3D4RA 2IJ0A 3NWSA 2F0PA 3C1EA 1QB5D 3PQIA 5GAHC 1MJEA 1EY8A 2B2WA 4APVA 4B3RQ 2JQOA 2E5LL 1NAPA 5FLXc 1KD1C 1Q81C 1Y8NB 4J15A 4N8FA 2SNSA 1YEZA 2KCNA 1S5DD 2K5HA 4WORA 4XXEA 5EGTA 4QY7A 1K83H 1AEXA 3DM3A 3ER0A 1TWHB 1PH7A 1RODA 3FKIB 2L4NA 4AIMA 4L8JA 1Y1WB 1VF5C 2K4KA 5AJ3Q 4DR2L 2F0IA 3QOLA 2AUJD 2KJXA 1CM9A 2PZTA 3IAYA 1I94Q 2B2TA 1G91A 2XWJB 2KCCA 4LFBQ 5M5WH 5FO9B 3F2DA 1KTKA 3S1QB 4IOCA 1VMCA 2PI2E 3OTOL 4B3RL 3OSOA 3E9IA 4K6LA 1PH4A 1NMGA 3OW7A 2UXDQ 4IZ8A 2EY1A 1BDOA 4PV1C 1CZGA 3TDQA 1Y8PB 1AH9A 3L3OC 1KLUD 1EOVA 2CQAA 4I7AA 4LFCQ 3HOYH 2A19A 4EQPA 4GOPC 1M1KC 3PV0A 3I4MB 4FF2A 1YNJC 3D4DA 5ISRA 5M5WB 4NXNQ 4P71A 2F0EA 4CKEA 3S17B 1ZYRC 2CW0D 2XIWA 4JK1C 4JI0Q 1JICA 2UUAQ 1GKHA 4IUTA 1JE5A 4JI7L 1JR0D 3IFDA 1X56A 5GROA 5LL6X 1RTNA 1N34Q 3CQZB 1HPCA 3ULPA 4R8NA 3AQQA 5M3MG 1ASYA 2YU9B 1Q7YC 2QF7A 3Q23A 1V1PA 1Y1VB 4JI2Q 1A2TA 2C5CA 3AB9A 1IZ6A 2DGYA 1EYGA 2MFIA 2PNRC 1K9MC 1TXYA 4CHTB 2B29A 3K80C 4C3IG 1G8ZD 1HNXQ 1U4RA 1O7ZA 4JI5L 1MHWC 1GM5A 4XIGS 1KL9A 4O0AA 4DAVA 4B3TL 2KOLA 4EQNA 1LTGD 1H9MA 3QO2A 3QOJA 4DR1L 1KDBA 1IL2A 1IW7C 4RGNA 3F2UA 1EY6A 2OXPA 5DEHA 4A3FB 5COYA 4RGMA 4A3IB 1SYEA 1LTLA 4LF9Q 2B63B 2YTXA 1KNAA 2DN8A 4CDDC 2K5VA 4A3JH 4IALA 1K3BC 2XVSA 2RBMA 2YYZA 3UDFA 1RIPA 4JI1L 1EWIA 3CCLA 4AYBB 3VYSA 4KN4C 4NPSA 1YZ6A 2F0DA 4GLVB 2MO1A 1PV4A 1KABA 2OWOA 1D8LA 1PYWD 2OQ0A 4CJ2C 2JE6I 1RTOA 1GUSA 3T51B 3GTJH 1VQKA 3CXCA 3DWQA 1YHQA 1X54A 1AW7A 4OONA 2NZHA 1BCPC 4LF5L 3GTOH 4NW2A 1BOSA 1DZ1A 2HQLA 3NENA 1IL8A 2IPKD 1STHA 3AU7A 3T1HL 1VQBA 1QWYA 2CCZA 1LT3D 2F4VL 1HHVA 2TMPA 3EN2A 1Y69U 3JAML 2F3VA 4KD3A 1B2TA 4A3JB 1YHBA 3I91A 1HZAA 2OTJA 1LACA 3CQZH 5IGBA 1IYJB 4X64L 4UP8A 1Q82C 4A3KH 2ZTCA 1CZWA 3G7LA 4O42A 3TQYA 2JA8H 1I4QA 4HAEA 4HCSA 1N34L 4L5RC 4AQYQ 1SYDA 4X65Q 3KLRA 2OEOA 4JI0L 2HCIA 5A35A 2FMMA 4UDUC 3Q6SA 5D3DA 4KKSA 1SE4A 2VUMB 4BBRG 4HEDA 1K3RA 1GHJA 1U0LA 2O4XA 4RKLA 4ID6A 3I4NB 1K8GA 4JW0A 1FGBD 3S2DB 4IUNA 4A3BH 4HJ7A 4PZ7A 3T4AC 1JCKB 3OIQA 3S1QH 1EIYB 1X3FA 1L0WA 1DOLA 2R92B 3NBHA 4E6IA 4BS9A 4JI5Q 4XT3B 5A2QE 4L5TA 3I70A 2PZWA 4RGTA 2QDBA 4LUOA 3GDEA 1ICWA 1A15A 4DPGA 4P75A 5KIXA 1UUPA 3HOWB 3MXPA 3QIAA 1QVGA 2PPBC 3RLFA 2KEEA 1AZQA 2JA6B 1WCMG 2J0TD 3KLWA 3K7UC 4ZYSA 4K2KA 1KNEA 4JG2A 3LWUA 1CA5A 3MEFA 1WTPA
chains in the Genus database with same CATH topology
2XWBB 3PIO3 4BA1I 3K59A 4KTAA 1HA5A 3S1RB 2EJMA 1SYGA 4A3EB 1ENCA 1F77A 4RFBA 3EJIA 1W6JA 3N6RA 2M9VA 1ILPA 3K5MA 1EQVA 3ND9A 4DXGA 1H9KA 5FO7B 3HOXB 5BN5A 3K5NA 5FO8B 3KLSA 1EQTA 1SFOB 3MZ5A 3CRLC 1ESFA 4PQXA 1ESRA 1EY5A 2KHSA 2AWNA 5CYUA 4J8QA 3NE5B 5M3FB 4KV6A 4QUFA 3R8BA 1D5MC 4BBSB 1WTVA 3GQBA 1NCVA 2EDGA 1Q3LA 2EYPA 3K7AB 1D6EC 3SEBA 2E75C 3KBGA 3K0YA 1PFNA 2LY7A 2MPMA 1EL0A 2NTSA 2RQXA 4TRDA 4H13C 3HOZB 2A74C 5M5YB 3SK5A 1EWHA 1KDCA 2O2LD 1PFMA 4QUCA 3M7GA 5EPKA 3DWAA 1B1ZA 4UAIA 3OWEB 2VNUD 3J81E 5J22A 4A3MB 1JOKA 2RSOA 4BA2I 3M3YB 1WVLA 4Z9CB 5EKIA 2TSSA 3TN2A 2JXMB 1V43A 5I9OA 3QG1A 4QIWB 3FRPB 2K6AA 4RHSA 1BUVT 3J80L 1G2SA 2ID0A 1A3VA 3VYUA 2DY8A 5CV7A 2QKIC 4DNRB 3BDLA 3TP5A 2F0KA 1F2MA 1WD0A 1DOKA 3ND8A 1H9SA 4I65A 1CQVA 4MIUA 1GUOA 5AFWA 3EFXD 2X6GA 1Q1BA 1IKMA 3MEHA 1STAA 3O13A 5EQ0A 3U9SA 1PDQA 4LK1C 4EGVA 2E2JB 3NPPA 1R4PB 5M9OA 4FXGC 3PIP3 4C1NI 3FMCA 1AN8A 1F9RA 5LHY1 2A69D 1SDFA 4BWGB 3T16A 3H91A 2NBFA 3K5OA 3OHXC 2FFKB 3L7ZC 1U4MA 1SAPA 4F88A 2DNCA 5C0XG 1QNUA 1PTOF 2AUKA 1CHPD 2AQ3B 2E2HB 4RGOS 5FLXL 1ZEQX 1ET9A 4KJNA 1EEID 4YIJA 4OO1G 3PUZA 3DHQA 1RCVD 1LLRD 3BDOA 2B2YC 3UI2A 3RMHA 3GP7A 1Q8IA 5JVG3 1SE3A 2PMZB 3DEOA 1QCBD 2K5QA 3TP6A 3SK4A 2Y0SB 4H44C 3S15B 4RA8A 5E4XA 3OMGA 1MSGA 3SHLA 2F0VA 1XTCD 5KNDA 4RCNA 5C0XI 2MUYA 4C3JB 2FINB 4K8JA 4XQNA 1AP0A 2PZUA 1QILA 3HRZC 3J80E 1XX8A 4ODGA 2BOSA 1SMYC 5C44B 1SE2A 1I4XA 1E0BA 1JC7A 1DM0B 4QF4A 2F03A 1C48A 3IFTA 3VR4A 1SBBB 3MVVA 2A6HC 1PRTC 4PMCA 4G57A 3A54A 3W2DA 3MFGA 4OIKA 4XYOA 2E2DC 1HTLD 3K5LA 5J39A 3J7AF 2LMCB 4IUUA 1K83B 5CV4A 2EJFC 3GTJB 1DOMA 3NXWA 1CA6A 1PXUA 3HGBA 4N9PA 1PFBA 4QB4A 2N88A 3EA6A 2WAQB 1RDPD 4DAYA 4KD4A 1F2YA 4I7ZC 1ET6A 3CRKC 5FOBB 1D1KA 2IT1A 4G7HC 1D1IA 3EROA 3E0JA 2I46A 3VR3A 2R7ZB 2LKVA 1C4QA 2IWHA 1DJRD 4H7BA 2K32A 2Q8IB 1EU4A 2WB1B 1EOTA 1LABA 3LWEA 5CV6A 4FP5D 5I6WA 1PTOD 2EE1A 5C4ZA 4ZRZA 1LV9A 1BCPD 2PYKA 1V8QA 2L55A 3VA5A 1STGA 5C4XB 1RD9D 3MHBA 2F0QA 4GZYC 3BZDB 1SSOA 5KYIA 3HOVB 2ZXPA 1OXVA 3GV3A 2JYOA 1SNQA 1YNJD 1EY9A 1XXGA 1ZYRD 3D4WA 1NR2A 3MXNA 1PTOH 2FJ2A 4B9XA 1PZID 2ZXOA 3J81L 5JVH3 2ICIA 4X3KA 1B53A 1L0YB 1BF4A 1DD2A 4EQOA 2RDFA 1FYCA 1LT6D 3VYTA 1U9RA 2PW7A 3KF8A 4KI0A 4DXFA 2NVYB 1IW7D 3DWPA 1SNDA 3PO3B 4FXDA 1STEA 1EYAA 1JE4A 3NP8A 4S3SA 1K8MA 2BA0A 3N52A 1VCIA 2LS01 4OO1I 2BA1A 4F7XA 1HUMA 2B2TC 2IX3A 1OXSC 3K6OA 4NP5A 1TS5A 3DM1A 3GTKB 1LTID 1IKLA 1RJTA 4C3HB 3ONAB 2I07B 1S5BD 1LO5D 3GTOB 2HQEA 1DONA 1VF7A 2FHTA 5TSSA 5JEAH 2WINB 3C3LA 1Q12A 3GO5A 5JEAJ 5C3XA 1M8AA 2JEAI 4DFAA 1I6HB 1SNCA 3LX0A 1TWCB 5CBEE 5HGTA 1O80A 1BR9A 4R8IA 2M00A 1SNPA 3C46A 4IQZA 3SK6A 1CT1D 5FK9C 4G7ZC 2K28A 1I4PA 2EYLA 5IGEA 1PRTB 1GJXA 3FPPA 3I90A 2R93B 1WTXA 4KHZA 2SEBD 1DYQA 1F9QA 4KKUA 2HUGA 4F8MA 1UNSA 3NTKA 4OIJA 1YNNC 5EBCA 1L0XB 2M2LA 1D5ZC 1FNWA 2PW5A 4C1NK 2IL8A 2B2UC 3TBIB 3CHBD 4K2LA 4OGQC 5NUCA 2L12A 1SNMA 3GTLB 3PMFA 2JA5B 1TVXA 5CV8A 2WACA 4Q0FA 1ML0D 4ABNA 1HCZA 1OXTA 4WFN3 2H4OA 1I4HA 1HRJA 3P7JA 1PZJD 2KUMA 4HR7B 5EKLA 2RDHA 2E74C 2J4XA 1E2ZA 1B50A 1B44D 5C4JB 2F0HA 1BBXC 2CW0C 1TS2A 1EU3A 3HP3A 4X3SA 1V1OA 1A2UA 4J1MA 1SNOA 1AZPA 2K1BA 1EIGA 4RAUC 2EYMA 3U9OA 3TP7A 5A2QL 1G291 2G9DA 2MP1A 4C56C 4F87A 5JJZA 2EY2A 3EVQA 3L9AX 2AQ1B 2AQ2B 2F0WA 1FNVA 2RDGA 5EBDA 2F0FA 1TS4A 1F2LA 1SJHD 4HTHA 3TMEA 4XQJA 1LT5D 3OIPA 3D3RA 1FR3A 1BQQT 3URYA 2L0CA 4DU9A 4IURA 2D5DA 1LTRD 4N9TA 3A56A 5FKAC 1VMPA 2BCOA 5IOCA 4ZQ3A 1H9SB 4U68A 5BN3A 3BS1A 3E5SA 4CBVA 2F4IA 3NHHA 1LTSD 3K58A 2NTTA 2IX1A 3GTGB 5FLXE 1M4VA 3S1MB 1T5EA 4K6DA 1EEFD 1TQOA 2KQ3A 3C2PA 4DK1A 4CJ0B 1FD7D 1XYIA 5IGFA 2BDNA 1H9JA 3NK9A 2Q8TA 5I2XA 4KMUC 3S16B 3KLSX 2R3ZA 2NUCA 3QWNA 5HURA 1DXMA 3IKJA 1Q1EA 1E2WA 1BCPF 1XWEA 3R93A 4MHEA 2EZVA 5CC4A 1SYBA 3BVGA 1KDAA 2K5DA 4XDXA 4MN3A 1EY0A 2F3WA 5K5PA 3I73A 4RHRA 3MWYW 1PTOB 2Z4IA 3BVZA 1HQMC 4RH6A 1JWMD 4CKBA 1O78A 2NZ1D 2SDFA 4KY6A 1B3AA 3M85A 3PUVA 3R3OA 1MD2D 2VB2X 3I3CA 3HZXA 3WOFA 4DK0A 2VXWA 2RSNA 5G3LF 1CHQD 5J1ZA 1I4GA 5CR3A 1HUNA 4XYQA 1IHZA 1SYFA 2EOTA 1UEAB 3BVMA 4BBRB 1BO0A 1SJED 4XTCS 1ZXTA 1D5XC 2AWOA 4ZLTF 3S9WA 3HG9A 3S2HB 4FNFA 4ILWA 2K04A 3P20A 1QOHA 2ENBA 3HS0C 3NWTA 1DCZA 5E4WC 4IUQA 2NWGA 3P75A 4ZUJA 5JPMC 1OXUA 2B2VA 1HQRD 1WTRA 1K8OA 3S1NB 3P1HA 3V96A 4KK7A 2EYJA 1ENAA 3EQLC 3GTMB 1EZ8A 3MXUA 3FEWX 4G7OC 1I50B 1B4OA 1EYCA 1TS3A 2NVQB 4U673 2KVMA 1TT2A 4IFDJ 2F0OA 2E76C 5CBAE 1CI3M 2A5HA 2K01A 3NBIA 3SE0A 1PMRA 1HXYD 3GV6A 2QEJC 4K14A 3VR6A 1LTAD 2NVXB 2O5JC 5JEAG 5K36G 1LTBD 1F9SA 2B2WC 1OXXK 3V05A 2KEDA 5G3LD 2LFNA 1BXTA 5IGDA 2VB3X 4KY7A 2L1BA 2X69A 1OO9B 2EPBA 1TWAB 5KNBA 4A3KB 4K5VA 4LAAA 1F2ZA 1ZKOA 3TP8A 3BDCA 2PQEA 3Q22A 3FVQA 4ME5A 4OHJA 5EKKA 2V4DA 3Q0AA 5E1FA 1PTOC 4IN3A 1CQFA 4RKBA 1JWSD 3C1FA 5IODA 2BE5D 4K5WA 4RWSC 1SMYD 2ZXRA 4M1UB 3NUCA 5C0XH 2K33A 3OOCA 1II3A 4ULLA 2JP1A 1PRTD 2MHVA 4M8AA 4QCLA 1EY4A 3G6JB 2PCFB 5C5MA 1JOOA 2D2CC 1RF2D 1X3QA 4NMZA 3X3NA 1JWUD 1IYVA 3FDTA 1HTPA 4RCOA 2X6LA 1PLFA 4TQUS 4DGZA 1HFNA 2NN6I 3SK8A 5CGKA 4G4KA 2WP8J 4PNYA 3Q24A 3J7YW 1WCMB 2Z8LA 3RUZA 3H94A 1S5FD 1G2TA 2EXZA 3HKZB 1Z6HA 1EFID 1EWCA 1SYCA 2WIIB 1I4RA 1UAPA 3GTQB 2E2IB 5C4HA 2F1MA 5F2DA 5ELFA 2L5TA 1GXDC 5C5LA 2F0GA 1Z7TA 1TR5A 4JBWA 3CKIB 4HSPA 2XNAC 3W3AA 5LL6S 3A8KE 4KHVA 2A6HD 1GUGA 4WRDA 2EYOA 1NUCA 3M4YA 1QJOA 2SOBA 4A93B 3K57A 2EY5A 5I9PA 5IGCA 2HDLA 1TY0A 4NKLA 3OMCA 5CV9A 3SXHA 2ZT9C 4Y7NB 2L9HA 1SEBD 2WV6D 1TU2B 4K8IA 2IX0A 1R4QB 3WOEA 1RHPA 2F0UA 1X3PA 1F9PA 4C3JG 5ELCA 5D3IB 2WKDA 2F0JA 4BY7B 1TWGB 4PMBA 1WD1A 5D65A 2FMCA 3I72A 3T56B 2XN9C 2A6ED 1SXTA 2G9HD 3DEPA 3A7AB 4IFDH 1STNA 2B2UA 4FXKC 2OT2A 3R2TA 3VYRA 1WTOA 3KUPA 2O5IC 5D14A 5IT9E 3RZOB 3HOYB 1KAAA 3PUWA 4B08A 2B39A 1PZKD 2F0MA 5KGUA 1EIHA 5IT9L 2R6GA 3KBXA 5KNCA 2RKSA 4IFDI 1TWFB 2XRQD 1EY7A 3ERQA 3MC0B 3X3MA 2B8GA 3TZDA 1JORA 4O1NA 1G6ZA 1KLGD 3NQIA 3NTIA 3H3VC 2J7ZA 4Q5VA 4A3BB 3A8JE 3ITPA 4V190 1TIID 4NDXA 1CTMA 4B9WA 5DAUA 1JB3A 1J8IA 1S5CD 2MGSA 5CORA 5I6YA 3JAME 3OPOA 2QCPX 4ZAIA 4A3GB 4DF7A 3GD7A 5C3WA 3HEJA 3TSSA 3D6WA 3VR5A 3T13A 3R2IA 2ICEC 2NVTB 2KA7A 4ZUIA 2RVLA 5CMDA 1O7YA 3MFYA 1PRTF 5EJWA 4LJZC 1VDZA 4FVMA 4DN4M 4A3DB 1Q90A 4CJ1B 4HSVA 1QNKA 1LTTD 4WJWA 3I8ZA 2JA7B 4CKCA 1B9MA 2PO4A 2F0SA 3KK7A 1Z47A 3SDZA 1CFMA 4X3UA 2BE5C 1D2BA 3SVMA 1CK1A 5EPLA 2A68D 3H09A 5BN4A 3S14B 3M7NA 1I3QB 2KECA 4EVOA 2A73B 4BY1B 3DMUA 1ENFA 2DY7A 5C0XJ 2A68C 2QILA 3VA7A 4ZKBB 1U4LA 1GUTA 5ELDA 2D9UA 4X3TA 5JPNC 2EJGC 2F0LA 3DXJC 1U4PA 4TSSA 4IFDG 3A55A 5T1IA 3BYYB 5M3MB 3QJYA 3A8IE 2F0NA 1STBA 2NN6H 3GTPB 4XQQA 1HFGA 5JOBA 1WTQA 4ZK9B 1R9TB 4V0BA 4CGYB 1WTWA 4C3IB 2B2YA 2L11A 3QB3A 4HMJA 1JOQA 1YNND 3MTSA 1AFPA 1NSNS 1GHKA 3TZUA 5ELEA 1EZ6A 2EVBA 4C2MB 5EPJA 1E2VA 1T5XD 3V2TA 2JEBI 3I4LA 2EYFA 1LT4D 3E6ZX 2D62A 3SR1A 2R61A 1A6XA 2K05A 2Q8RE 1ONLA 1X32A 2SNMA 5DM73 2CHBD 2EY6A 2A6EC 3D8GA 3IL8A 4IUVA 5KEEA 2OF1A 3M4OB 1FNUA 1GUWA 5DM63 5K36H 1I6VC 3NSWA 2XRSD 3MAQA 5ELBA 3OWFA 4LMQD 4K5XA 3H0GB 1GOZA 3LNNA 5E3FA 4DA2A 3J7AV 2C9OA 3MXGA 1MBYA 3PUXA 1V1PB 1H9RA 5M5XB 2NB0A 4XT1B 2F0TA 2Z4HA 2A69C 1MI2A 4FF3A 3MA2B 2B8FA 1ILQA 4L6TB 5I4DA 1NR4A 3ZYYX 1QG7A 3WDNA 1BCPB 2HCCA 4OO1H 3BG3A 1EYDA 2BDOA 2GA4B 2K5WA 2MJ8A 1O7LA 3VR2A 4OL7A 5KYLA 1IYUA 2JA8B 3H6MA 1TKWB 5I2YA 2JSOA 2RA4A 4QMGA 5C3EB 4L63B 5C6AA 3NQTA 3DUZA 3AMUA 4IUPA 4KJOA 4R9WA 1QE6A 5KRUA 2NN6G 3CU7A 5CV5A 2XSCA 3RD4A 1B9NA 5T1GA 4DNTB 4HMIA 1JQYD 3A7LA 1W6KA 4TKOB 4FF4A 1J9OA 1S4ZA 1Y8OB 3PO2B 4KN7C 2CVRA 4H0LC 4C3HG 5IGGA 1MSHA 2DNEA 2K7VA 1RKNA 1GUNA 4DAPA 3FPUB 3D6CA 2WKCA 2NYZD 3HOUB 1STYA 1TY2A 1S5ED 3T53B 4HCEA 3NTHA 2K03A 4KY5A 3D31A 5JAVA 1BNZA 4FYDA 2N55A 4HN7A 4P2CB 1A3TA 2HDMA 2Z1CA 4FF1A 4FO2A 2B2VC 4PMWA 1C8CA 1MGSA 4KKTA 2H1EA 5IIFA 2EYHA 4ZKCB 3PUYA 1HA6A 3BYTB 5DNFA 4J6HA 3RZDB 2IW3A 1A3UA 3D4RA 2IJ0A 3NWSA 2F0PA 3C1EA 1QB5D 1EY8A 2B2WA 1NAPA 1Y8NB 2SNSA 2KCNA 1S5DD 4WORA 4XXEA 5EGTA 1AEXA 1TWHB 1RODA 3FKIB 2L4NA 4L8JA 1Y1WB 1VF5C 2F0IA 3QOLA 2AUJD 2KJXA 1CM9A 2PZTA 3IAYA 2B2TA 1G91A 2XWJB 2KCCA 5FO9B 1KTKA 3S1QB 1VMCA 3OSOA 4K6LA 3OW7A 4IZ8A 2EY1A 1BDOA 4PV1C 1CZGA 3TDQA 1Y8PB 3L3OC 1KLUD 2CQAA 4EQPA 3PV0A 3I4MB 4FF2A 1YNJC 3D4DA 5ISRA 5M5WB 2F0EA 4CKEA 3S17B 1ZYRC 2CW0D 2XIWA 4JK1C 1JICA 4IUTA 1JR0D 3IFDA 5LL6X 1RTNA 3CQZB 1HPCA 4R8NA 2YU9B 2QF7A 3Q23A 1V1PA 1Y1VB 1A2TA 2C5CA 3AB9A 2PNRC 4CHTB 4C3IG 1G8ZD 1U4RA 1O7ZA 4XIGS 4DAVA 2KOLA 4EQNA 1LTGD 1H9MA 3QO2A 3QOJA 1KDBA 1IW7C 4RGNA 3F2UA 1EY6A 2OXPA 5DEHA 4A3FB 5COYA 4RGMA 4A3IB 1SYEA 2B63B 1KNAA 2DN8A 4IALA 2XVSA 2RBMA 2YYZA 4AYBB 3VYSA 4KN4C 2F0DA 1KABA 1PYWD 4CJ2C 2JE6I 1RTOA 1GUSA 3T51B 3DWQA 1AW7A 1BCPC 4NW2A 1BOSA 1DZ1A 1IL8A 2IPKD 1STHA 3AU7A 1QWYA 1LT3D 1HHVA 2TMPA 1Y69U 3JAML 2F3VA 4KD3A 1B2TA 4A3JB 3I91A 1LACA 5IGBA 1CZWA 3G7LA 4O42A 1I4QA 4HAEA 4HCSA 1SYDA 2OEOA 3KLRA 2HCIA 5A35A 2FMMA 4UDUC 3Q6SA 5D3DA 4KKSA 1SE4A 2VUMB 4HEDA 1GHJA 2O4XA 4RKLA 3I4NB 4ID6A 1FGBD 3S2DB 4IUNA 3T4AC 1JCKB 3OIQA 2R92B 1DOLA 3NBHA 4E6IA 4BS9A 4XT3B 5A2QE 3I70A 2PZWA 4RGTA 2QDBA 1ICWA 1A15A 5KIXA 1UUPA 3HOWB 3MXPA 3QIAA 2PPBC 3RLFA 2KEEA 1AZQA 2JA6B 2J0TD 4ZYSA 4K2KA 1KNEA 3LWUA 1CA5A 1WTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEX A;  3V2T A;  5C6A A;  3NQT A;  3RUZ A;  4ODG A;  4KY7 A;  3E5S A;  5J22 A;  1IHZ A;  2EYF A;  1SYF A;  2F0D A;  4F7X A;  1JOK A;  3NHH A;  2EXZ A;  1KAB A;  4KJO A;  3SR1 A;  4KTA A;  3ERO A;  5KRU A;  1SYG A;  2F0I A;  3TP6 A;  2SNM A;  4K2L A;  1ENC A;  3QOL A;  5NUC A;  4K6D A;  3SK4 A;  1SNM A;  3EJI A;  2PZT A;  2LKV A;  3PMF A;  4K5V A;  5CV8 A;  5J1Z A;  1TQO A;  4LAA A;  2EY6 A;  1F2Z A;  4NP5 A;  1SYC A;  1EQV A;  1STN A;  2KQ3 A;  2WAC A;  3D8G A;  4H7B A;  5CV5 A;  3TP8 A;  3S9W A;  2F0S A;  4HMI A;  5I9O A;  3OMG A;  5KEE A;  3SHL A;  3BDC A;  5IGD A;  5IGF A;  2OF1 A;  1STH A;  2PQE A;  3OSO A;  5CV6 A;  2F0V A;  5C4H A;  3NK9 A;  1A3V A;  5F2D A;  5I6W A;  5CV7 A;  4ME5 A;  4IZ8 A;  2ENB A;  5EKK A;  5C5L A;  5EKL A;  5C4Z A;  5IGG A;  2HQE A;  3MZ5 A;  1KAA A;  2F3V A;  2EY1 A;  4K8J A;  4KD3 A;  5E1F A;  2F0G A;  5IGB A;  2PYK A;  2F0M A;  3BDL A;  3TP5 A;  3VA5 A;  5KGU A;  1STG A;  3P75 A;  2F0K A;  1F2M A;  2PZU A;  4ZUJ A;  4RKB A;  1RKN A;  2F0H A;  2F0Q A;  2RKS A;  3MHB A;  1TR5 A;  3OWF A;  4I65 A;  3C1F A;  4K5X A;  5C3X A;  5IOD A;  3D6C A;  2NUC A;  1EY5 A;  4K5W A;  4EQP A;  4EVO A;  5HUR A;  2KHS A;  4MIU A;  5KYI A;  1EY7 A;  1STY A;  3D4D A;  3DMU A;  5ISR A;  5E3F A;  4QF4 A;  2F0E A;  1SYD A;  2OEO A;  4KHV A;  1A2U A;  3ERQ A;  4J1M A;  3NUC A;  3MEH A;  4DFA A;  1SNQ A;  1SNO A;  1JOR A;  4KV6 A;  1STA A;  2EYO A;  1EY9 A;  4WRD A;  5CC4 A;  3MVV A;  1SNC A;  3LX0 A;  1II3 A;  1SYB A;  1NUC A;  3P1H A;  4KY5 A;  2EYJ A;  2EYM A;  3D4W A;  4R8N A;  1ENA A;  5HGT A;  5JAV A;  1EZ8 A;  2SOB A;  2F0L A;  1KDA A;  4B9X A;  4PMC A;  4G57 A;  2EYP A;  3U9O A;  3TP7 A;  2O4X A;  4RKL A;  4ID6 A;  1EY0 A;  3ITP A;  2EY5 A;  2F0T A;  1A3T A;  1A2T A;  2F3W A;  1SNP A;  2M00 A;  1EY4 A;  5I9P A;  5IGC A;  1EYC A;  5K5P A;  5M9O A;  4NDX A;  5J39 A;  2F0N A;  4IUN A;  3OMC A;  4NKL A;  5CV9 A;  5DAU A;  2EY2 A;  3SK6 A;  3SXH A;  1STB A;  4B9W A;  3EVQ A;  5C5M A;  1TT2 A;  1JOO A;  5I6Y A;  2F0O A;  2F0W A;  5CV4 A;  2EYL A;  4K8I A;  3T16 A;  2RDF A;  4E6I A;  4EQO A;  2F0F A;  3NXW A;  5JOB A;  5IIF A;  2EYH A;  5IGE A;  4TRD A;  1EYD A;  4HTH A;  3TME A;  4NMZ A;  4EQN A;  2PZW A;  4K14 A;  3QOJ A;  4DF7 A;  1KDB A;  2QDB A;  3SK5 A;  4J6H A;  1U9R A;  3HEJ A;  5C3W A;  2F0U A;  3QB3 A;  1A3U A;  4KY6 A;  4HMJ A;  2F0P A;  3C1E A;  2PW7 A;  1EY6 A;  3R3O A;  4N9P A;  3T13 A;  4QB4 A;  2OXP A;  5KIX A;  5DEH A;  1EY8 A;  1KDC A;  4DU9 A;  4OL7 A;  3MXP A;  1JOQ A;  4DGZ A;  5KYL A;  1SYE A;  4N9T A;  4F8M A;  1SND A;  1NSN S;  3SK8 A;  4ZUI A;  5CGK A;  3HZX A;  1EZ6 A;  2SNS A;  3H6M A;  1EYA A;  2F0J A;  4PNY A;  3NP8 A;  5IOC A;  4KJN A;  4IAL A;  4K2K A;  4KD4 A;  4YIJ A;  4ZQ3 A;  2RBM A;  4S3S A;  3DHQ A;  2PW5 A;  4QMG A;  4WOR A;  1F2Y A;  5EGT A;  4PMB A;  5CR3 A; 
#chains in the Genus database with same CATH topology
 2XWB B;  1XJV A;  3HOV H;  3STB C;  3PIO 3;  4BA1 I;  2KCM A;  4JBM A;  4DNI A;  3K59 A;  4KTA A;  1HA5 A;  3J81 j;  3S1R B;  4GNX A;  2EJM A;  1KHI A;  1SYG A;  1HNW L;  4A3E B;  1ENC A;  4UHV A;  1F77 A;  4RFB A;  3EJI A;  1A0I A;  1W6J A;  2M9V A;  3A74 A;  3N6R A;  1ILP A;  2B3G A;  3K5M A;  1EQV A;  3ND9 A;  4DXG A;  1H9K A;  1VQ7 A;  5FO7 B;  3HOX B;  5BN5 A;  4PZ6 A;  5FO8 B;  3K5N A;  3FKI H;  3KLS A;  3H0G H;  1A62 A;  1EQT A;  4X62 L;  2A8V A;  1SFO B;  3MZ5 A;  4OEL B;  3CRL C;  4CDF C;  3CPW A;  1ESF A;  4PQX A;  1ESR A;  1EY5 A;  2KHS A;  1VQ6 A;  2AWN A;  2F52 A;  1G51 A;  5CYU A;  4J8Q A;  5IP7 G;  3NE5 B;  2EIF A;  5M3F B;  4KV6 A;  4QUF A;  3R8B A;  2Q2I A;  1SRU A;  1D5M C;  4BBS B;  2ASB A;  3S1R H;  1WTV A;  3GQB A;  1NCV A;  2EDG A;  1CSP A;  1Q3L A;  2EYP A;  3K7A B;  1D6E C;  3SEB A;  2E75 C;  3GTP H;  4LF8 L;  3KBG A;  1JMC A;  4LFA Q;  1JJC B;  3K0Y A;  2VQF Q;  3HFZ B;  1PFN A;  2LY7 A;  2MPM A;  1EL0 A;  2NTS A;  2RQX A;  2WFW A;  4TRD A;  3KF6 A;  3CC2 A;  1FGU A;  4H13 C;  3H15 A;  3HOZ B;  2A74 C;  5M5Y B;  3SK5 A;  3M3Y H;  1NE3 A;  1EWH A;  3H3V H;  1VQD A;  2NVY H;  4GKJ L;  1KDC A;  1XPO A;  3CPF A;  2O2L D;  4BY7 G;  1K0S A;  4B3S L;  1PFM A;  4A3E H;  4QUC A;  1IBK L;  4JBK A;  4UY8 C;  4C3I H;  3M7G A;  5EPK A;  1UE1 A;  3DWA A;  1B1Z A;  4UAI A;  3OWE B;  3GTG H;  2VNU D;  2NZO A;  3J81 E;  3RLO A;  5J22 A;  4A3M B;  1JOK A;  2RSO A;  2NVQ H;  5LMN Q;  4BA2 I;  3M3Y B;  1WVL A;  3U4Z A;  1VQ5 A;  4Z9C B;  5EKI A;  1B7Y B;  3F8T A;  1YIJ A;  2TSS A;  3TN2 A;  3KJP A;  1QVF A;  2JXM B;  1JJG A;  1K73 C;  1V43 A;  2Q2H A;  5I9O A;  3QG1 A;  4QIW B;  3FRP B;  1N36 Q;  2K6A A;  4RHS A;  1BUV T;  3J80 L;  1G2S A;  2ID0 A;  1A3V A;  3VYU A;  2DY8 A;  5CV7 A;  3UE0 A;  1L1O C;  2QKI C;  4DNR B;  5IYB G;  3CF5 A;  2I5H A;  5LMU L;  1RL2 A;  1L1O A;  4LF7 Q;  3BDL A;  3TP5 A;  2HIV A;  2F0K A;  1F2M A;  1WD0 A;  1DOK A;  1K0R A;  3ND8 A;  4OX9 Q;  3PF5 A;  1H9S A;  4I65 A;  1CQV A;  2QA4 A;  1XNQ Q;  2F3I A;  3ERS X;  4MIU A;  1GUO A;  4GS3 A;  5AFW A;  3EFX D;  2X6G A;  3UE1 A;  1Q1B A;  1IKM A;  3MEH A;  2JA9 A;  1BBU A;  1STA A;  2CWP A;  3O13 A;  5EQ0 A;  3U9S A;  1PDQ A;  4LK1 C;  4EGV A;  2E2J B;  3NPP A;  1R4P B;  2ZJQ A;  4DR6 Q;  4DAY B;  5M9O A;  4C3H H;  4FXG C;  3PIP 3;  4C1N I;  3FMC A;  1AN8 A;  4GLX A;  1N32 Q;  1F9R A;  5LHY 1;  3RZD H;  2A69 D;  2PI2 A;  1SDF A;  4BWG B;  3T16 A;  3H91 A;  2NBF A;  3K5O A;  3OHX C;  2FFK B;  3L7Z C;  2AHO B;  1U4M A;  2YTY A;  1SAP A;  3I2Z A;  4F88 A;  2DNC A;  1VQM A;  5C0X G;  3CC7 A;  1QNU A;  1PTO F;  2AUK A;  1N32 L;  1VQN A;  1Y14 B;  1CHP D;  2AQ3 B;  5IY0 A;  2E2H B;  4RGO S;  2WAQ E;  3D0F A;  5FLX L;  1VQF A;  5HGQ A;  2KHJ A;  1ZEQ X;  1ET9 A;  4KJN A;  1Q8K A;  3KF6 B;  1EEI D;  4YIJ A;  4OO1 G;  3PUZ A;  3DHQ A;  4DV0 L;  1RCV D;  1HZB A;  1LLR D;  3BDO A;  2B2Y C;  3UI2 A;  3RMH A;  3GP7 A;  1NBW A;  4A3L H;  4A93 G;  1Q8I A;  5JVG 3;  3TS0 A;  3NEL A;  1SE3 A;  2PMZ B;  4A75 A;  3K8A A;  3DEO A;  1QCB D;  1CKN A;  4LF8 Q;  1B3Q A;  2K5Q A;  3TP6 A;  4QL5 A;  1WFQ A;  3SK4 A;  4A3B G;  2Y0S B;  3I7F A;  4H44 C;  4DR3 L;  3S15 B;  4RA8 A;  5E4X A;  3OMG A;  1MSG A;  3SHL A;  3S1M H;  2G5D A;  2F0V A;  1XTC D;  5KND A;  5BR8 L;  5FLM H;  4RCN A;  4QIW E;  5C0X I;  3TRZ A;  2MUY A;  4C3J B;  1IBL L;  4AH6 A;  2FIN B;  4K8J A;  1HNZ Q;  4XQN A;  1AP0 A;  2PZU A;  1QIL A;  3HRZ C;  3J80 E;  3OYY A;  4ODG A;  1XX8 A;  2BOS A;  3HOW H;  3RR5 A;  1SMY C;  5C44 B;  1SE2 A;  1I4X A;  1E0B A;  1JC7 A;  1DM0 B;  4QF4 A;  2F03 A;  3K7A H;  1C48 A;  3IFT A;  4N8X 1;  3NEM A;  3VR4 A;  4DR6 L;  1SBB B;  1AE3 A;  3MVV A;  1YIT A;  4DV2 L;  2A6H C;  1PRT C;  4PMC A;  4G57 A;  3A54 A;  3W2D A;  4OIK A;  3MFG A;  4XYO A;  4DAM A;  2E2D C;  1LM0 A;  1HTL D;  3K5L A;  2R92 G;  3RN5 A;  5J39 A;  3CCR A;  3J7A F;  1CKN B;  2LMC B;  4IUU A;  1Q86 C;  1K83 B;  5CV4 A;  2EJF C;  3GTJ B;  1DOM A;  3NXW A;  1CA6 A;  3HOY G;  2Z6B A;  5GAG C;  1PXU A;  3HGB A;  4N9P A;  3RNU A;  2UU9 Q;  1PFB A;  4QB4 A;  2N88 A;  4MTN A;  1IBM L;  3STB D;  1ASZ A;  4X6A H;  2KBN A;  3EA6 A;  2UUC L;  2WAQ B;  1RDP D;  4DAY A;  4KD4 A;  3G71 A;  1I6H H;  1F2Y A;  4I7Z C;  1ET6 A;  3I55 A;  2UU9 L;  1HH2 P;  3CRK C;  5FOB B;  4O2D A;  1D1K A;  2IT1 A;  4G7H C;  4POG A;  1D1I A;  3ERO A;  1WOC A;  2IHF A;  3E0J A;  2I46 A;  3VR3 A;  2R7Z B;  2LKV A;  1C4Q A;  2QDL A;  2IWH A;  1DJR D;  4H7B A;  1EQQ A;  4DR3 Q;  1IBK Q;  2F4V Q;  2OTL A;  1PHJ A;  2K32 A;  2Q8I B;  1EU4 A;  2WB1 B;  1KC8 C;  1I94 L;  1EOT A;  1LAB A;  2OQK A;  3LWE A;  5CV6 A;  1O7I A;  4FP5 D;  3I56 A;  5I6W A;  1PTO D;  2EE1 A;  2VQF L;  5C4Z A;  1EFW A;  4ZRZ A;  1LV9 A;  1VQC A;  1BCP D;  2PYK A;  1V8Q A;  1X3G A;  2L55 A;  3VA5 A;  1GO3 E;  4DUY Q;  1B8A A;  1STG A;  5C4X B;  1RD9 D;  1KAW A;  3MHB A;  2F0Q A;  1FL0 A;  3S17 H;  2ZTD A;  3BZD B;  4GZY C;  1SSO A;  4A93 H;  1TWF H;  5KYI A;  4A3L G;  3HOV B;  2ZXP A;  4A3D G;  1HZC A;  1OXV A;  3GV3 A;  2JYO A;  1SNQ A;  1YNJ D;  4FDB A;  1XMQ Q;  2Z6K A;  1EY9 A;  1XXG A;  1ZYR D;  4DUY L;  5JJI A;  1NMF A;  2UUB Q;  3D4W A;  1UE5 A;  1NR2 A;  3MXN A;  1PTO H;  1XPU A;  2FJ2 A;  4B9X A;  2CH4 W;  5H1S E;  1PZI D;  2I5M X;  2ZXO A;  3J81 L;  5JVH 3;  2ICI A;  2NVX H;  4X3K A;  1B53 A;  1L0Y B;  1BF4 A;  1DD2 A;  4A3K G;  4EQO A;  3UDG A;  2RDF A;  3UDX A;  1FYC A;  2AKW B;  2Z6K C;  1E24 A;  4JBJ A;  1LT6 D;  2HD3 A;  1UWV A;  3VYT A;  2VZA A;  3CCQ A;  4JYA L;  1Y1W H;  1U9R A;  4A3G G;  1J5E L;  2PW7 A;  3KF8 A;  4KI0 A;  4DXF A;  2NVY B;  1IW7 D;  2RHS B;  3DWP A;  2GVA A;  4BY1 G;  3CC4 A;  1SND A;  4GNX B;  4GKK Q;  2RCN A;  3PO3 B;  4FXD A;  1STE A;  3HOZ H;  3CMA A;  1EYA A;  1JE4 A;  3NP8 A;  1W3S A;  1T9H A;  4S3S A;  3T1H Q;  1K8M A;  2BA0 A;  4BBR H;  3J80 c;  1V9P A;  3N52 A;  1VCI A;  1WI5 A;  4X65 L;  2LS0 1;  1MIU A;  4OO1 I;  2BA1 A;  4F7X A;  1HUM A;  1VQA A;  4LUZ A;  2B2T C;  4BBS H;  2IHE A;  2IX3 A;  1OXS C;  3K6O A;  4JI6 Q;  2KCT A;  4NP5 A;  1TS5 A;  4JV5 L;  3DM1 A;  4IPG A;  1L2F A;  3GTK B;  2NVT H;  3CCU A;  1LTI D;  1IKL A;  4LF6 Q;  1RJT A;  4C3H B;  3ONA B;  2I07 B;  1S5B D;  4IPH A;  1LO5 D;  3GTO B;  3EIV A;  1X65 A;  2HQE A;  4YCW A;  1BVS A;  1DON A;  5HY6 A;  4B3S Q;  1VQP A;  2JA6 G;  1VF7 A;  2FHT A;  5TSS A;  1IXR A;  2EXD A;  5JEA H;  3CAM A;  4GOP A;  2WIN B;  4BXX H;  3C3L A;  1Q12 A;  3GO5 A;  5JEA J;  5C3X A;  3HOU H;  2LXK A;  4YHH Q;  3CCV A;  1M8A A;  2VS1 A;  1SR3 A;  2JEA I;  4NXM L;  2RHQ B;  5GAE C;  2N3S A;  3PCO B;  4DFA A;  1I6H B;  4A3C G;  2XTI A;  1SNC A;  3LX0 A;  1TWC B;  4IPC A;  1TWA H;  5CBE E;  3CME A;  3T1Y Q;  4JV5 Q;  5HGT A;  2DJG C;  5C3E G;  1NNX A;  2PNH A;  1O80 A;  2C35 B;  1SLJ A;  4B3T Q;  3SGI A;  1N33 Q;  2CFM A;  1BR9 A;  4R8I A;  2M00 A;  1SNP A;  3HOX G;  3I4M H;  3C46 A;  3K0X A;  4IQZ A;  3SK6 A;  1CT1 D;  4YCV A;  5FK9 C;  4ZCK A;  4G7Z C;  4DR4 Q;  2K28 A;  1YBY A;  4TVA B;  1I4P A;  2EYL A;  3BZC A;  3T1Y L;  1E1O A;  5IGE A;  4JOI C;  1PRT B;  1GJX A;  3FPP A;  3I90 A;  3PSI A;  2R93 B;  1YVC A;  1WTX A;  3S1N H;  4KHZ A;  3KFU A;  2SEB D;  1HR0 Q;  2UXC L;  1DYQ A;  1BBW A;  4HJ8 A;  4DUZ Q;  1F9Q A;  4KKU A;  1EQR A;  2HUG A;  4F8M A;  3VDY A;  1UNS A;  3NTK A;  4OIJ A;  1YNN C;  3PIO A;  5EBC A;  1L0X B;  2M2L A;  5M3F G;  1R9T H;  4JI8 Q;  1D5Z C;  1FNW A;  2PW5 A;  3FKI G;  4JI1 Q;  4NB3 A;  4C1N K;  2IL8 A;  2B2U C;  5LMN L;  4C2M H;  2UUB L;  2BH8 A;  3TBI B;  3CHB D;  4K2L A;  4OGQ C;  5NUC A;  2L12 A;  1SNM A;  3GTL B;  3PMF A;  2JA5 B;  1TVX A;  5CV8 A;  4LFB L;  2WAC A;  4WJ3 M;  4Q0F A;  1ML0 D;  4ABN A;  1HCZ A;  1OXT A;  4WFN 3;  2H4O A;  1I4H A;  4OWX B;  1HRJ A;  3P7J A;  4KHP Q;  1PZJ D;  4LF7 L;  2KUM A;  4DR2 Q;  1VQI A;  4DV7 Q;  1K8A C;  4HR7 B;  4EX5 A;  5EKL A;  2RDH A;  3U50 C;  2E74 C;  2J4X A;  1E2Z A;  1VQL A;  1DGS A;  3K81 C;  1B50 A;  1KIX A;  4QQB X;  1B44 D;  5C4J B;  2F0H A;  3ZJY C;  1BBX C;  3PF4 A;  2CW0 C;  1TS2 A;  4DV7 L;  3H0G G;  1EU3 A;  3HP3 A;  4X3S A;  1V1O A;  1A2U A;  4J1M A;  4YWM A;  1SNO A;  3KYH C;  1PYS B;  3JAM i;  1AZP A;  2K1B A;  1EIG A;  4RAU C;  2EYM A;  4A3G H;  1UEB A;  2CWA A;  3U9O A;  3TP7 A;  5L37 A;  5A2Q L;  2E5L Q;  1G29 1;  4R1J A;  2G9D A;  2MP1 A;  2D0O A;  4C56 C;  4F87 A;  5JJZ A;  2EY2 A;  3EVQ A;  3L9A X;  2AQ1 B;  2AQ2 B;  2F0W A;  4JVZ A;  1FNV A;  2RDG A;  3J81 c;  5EBD A;  4DV3 L;  2F0F A;  1TS4 A;  2N8N A;  1F2L A;  1SJH D;  4HTH A;  3TME A;  4XQJ A;  1LT5 D;  3OIP A;  3D3R A;  1FR3 A;  4A3I G;  1BQQ T;  3URY A;  2L0C A;  4DU9 A;  4IUR A;  2D5D A;  1LTR D;  4N9T A;  3A56 A;  1V1Q A;  1A63 A;  5FKA C;  3L2P A;  1VMP A;  2BCO A;  5IOC A;  2Y0S E;  2OCE A;  1QUQ A;  4ZQ3 A;  1H9S B;  4U68 A;  1J6Q A;  5BN3 A;  3BS1 A;  3E5S A;  4CBV A;  2F4I A;  2EQS A;  3NHH A;  1LTS D;  3K58 A;  2NTT A;  4YY3 Q;  2IX1 A;  2Q2U A;  3GTG B;  5FLX E;  3FHW A;  4HJ9 A;  1M4V A;  3S1M B;  1XPR A;  5FJ8 G;  1T5E A;  1PYB A;  4K6D A;  1EEF D;  4A3I H;  1TQO A;  2KQ3 A;  4LF5 Q;  3C2P A;  4DK1 A;  4CJ0 B;  1FD7 D;  1JT8 A;  1XYI A;  3S2D H;  5IGF A;  2BDN A;  1H9J A;  4A3J G;  3NK9 A;  2Q8T A;  2P5Z X;  5C44 H;  2UXB L;  3TRE A;  1TWH H;  5C4X G;  5JJK A;  4UP7 A;  3A0J A;  5I2X A;  3PO2 G;  4KMU C;  3S16 B;  3KLS X;  1X6O A;  2R3Z A;  2K75 A;  1S40 A;  3UDI A;  2NUC A;  3QWN A;  5HUR A;  1DXM A;  2B63 G;  3IKJ A;  3J81 i;  1Q1E A;  1E2W A;  1BCP F;  1EUJ A;  1XWE A;  3R93 A;  2VUM G;  2YTV A;  4MHE A;  2EZV A;  4LF6 L;  1FVI A;  5CC4 A;  1VQG A;  1SYB A;  5IP9 H;  5AJ3 L;  3BVG A;  1KDA A;  2K5D A;  4XDX A;  4MN3 A;  1EY0 A;  2F3W A;  5K5P A;  2R7D A;  3I73 A;  4Y7N H;  2MO0 A;  3AEV A;  4DR5 Q;  4RHR A;  3MWY W;  1PTO B;  2Z4I A;  2JA7 G;  3BVZ A;  4GKK L;  3E3X A;  1HQM C;  1LYL A;  2MQH A;  4RH6 A;  2I0Q A;  4NXM Q;  1JWM D;  4CKB A;  1O78 A;  2NZ1 D;  3E9H A;  1E1T A;  2SDF A;  1WYD A;  4UPA A;  2E2H H;  4KY6 A;  1B3A A;  3M85 A;  4HIK A;  3PUV A;  3R3O A;  5FLM G;  1MD2 D;  4LF4 Q;  3I4M G;  2VB2 X;  3I3C A;  3HZX A;  1SRO A;  3WOF A;  4DK0 A;  4NXN L;  2VXW A;  2UUC Q;  2RSN A;  3ICE A;  5G3L F;  1IBM Q;  1CHQ D;  5J1Z A;  5BR8 Q;  1I4G A;  5CR3 A;  4DV6 Q;  1HUN A;  4XYQ A;  1IHZ A;  3W1G A;  1SYF A;  1Y1V G;  2EOT A;  1UEA B;  3BVM A;  2UXD L;  4BBR B;  1BO0 A;  4R4C A;  1SJE D;  4XTC S;  1ZXT A;  1D5X C;  4RG1 A;  3I4N G;  2AWO A;  4ZLT F;  3S9W A;  3HG9 A;  3S2H B;  4FNF A;  4ILW A;  3MXN B;  2K04 A;  3U4V A;  5C4J H;  3P20 A;  1QOH A;  2ENB A;  3HS0 C;  1LUZ A;  3NWT A;  1DCZ A;  5E4W C;  1EIF A;  4IUQ A;  4JI7 Q;  2VQE L;  2NWG A;  3P75 A;  4OWT B;  1CKM A;  4ZUJ A;  2WAQ G;  5JPM C;  2R92 H;  4PZ8 A;  1OXU A;  2B2V A;  4AYB G;  3GTQ H;  1HQR D;  2Z9H A;  4DV4 L;  1WTR A;  1K8O A;  3S1N B;  3P1H A;  3V96 A;  4KK7 A;  2EYJ A;  1QZH A;  1ENA A;  3EQL C;  1EZ8 A;  3MXU A;  3GTM B;  3FEW X;  2JK8 A;  3G48 A;  2RF4 A;  2JN4 A;  4YCU A;  4G7O C;  1I50 B;  1CKO A;  4L5Q A;  5E7N A;  1Y1V H;  1B4O A;  1EYC A;  1TS3 A;  2NVQ B;  4U67 3;  2KVM A;  3CW2 C;  4A3E G;  1TT2 A;  4IFD J;  2F0O A;  2E76 C;  4MZ9 A;  2L15 A;  5CBA E;  4KLK A;  1CI3 M;  2A5H A;  2K01 A;  3NBI A;  3SE0 A;  1YNX A;  1PMR A;  3OTO Q;  1HXY D;  3GV6 A;  2QEJ C;  4K14 A;  3VR6 A;  1LTA D;  4JPB W;  2NVX B;  2O5J C;  5JEA G;  4BXX G;  4ME3 A;  5K36 G;  1LTB D;  1PA6 A;  1F9S A;  2B2W C;  2KHI A;  2VUM H;  1ICF B;  1OXX K;  3V05 A;  2KED A;  3BU2 A;  5G3L D;  1XMO L;  1P16 A;  1E3P A;  1XNQ L;  3KJO A;  3CCS A;  2LFN A;  1BXT A;  3KDF B;  5IGD A;  1PH8 A;  2VB3 X;  4A3C H;  4KY7 A;  1VQ4 A;  2KEN A;  2L1B A;  2X69 A;  5IYB H;  1OO9 B;  3BJU A;  2EPB A;  1TWA B;  5KNB A;  4A3K B;  4K5V A;  4LAA A;  1F2Z A;  1ZKO A;  1HNX L;  5IWA L;  3TP8 A;  3F1Z A;  1FJG L;  2XGT A;  2B63 H;  3BDC A;  2PQE A;  2CKZ B;  2ALY B;  3Q22 A;  4Y52 H;  1KRT A;  3FVQ A;  4ME5 A;  1NJI C;  3F2B A;  3RN2 A;  3S2H H;  4OEM B;  4OHJ A;  5EKK A;  2V4D A;  3Q0A A;  5E1F A;  4LF9 L;  3A5Z B;  1PTO C;  3HOZ G;  3PO3 G;  4IN3 A;  1CQF A;  4RKB A;  1JWS D;  4OWW B;  3C1F A;  5IOD A;  3M4O H;  2BE5 D;  3RLN A;  4K5W A;  4DR1 Q;  5GQO A;  4RWS C;  1SMY D;  4PG3 A;  3J7A 5;  2ZXR A;  4OX9 L;  4M1U B;  4HID A;  3NUC A;  5C0X H;  2K33 A;  1N8R C;  3OOC A;  3AYH B;  1II3 A;  4ULL A;  2JP1 A;  1PH5 A;  3S24 A;  2K14 A;  3A5U A;  2RCF A;  5FJ8 H;  1X55 A;  4DK6 C;  1PRT D;  2MHV A;  1QUQ B;  4M8A A;  4QCL A;  1EY4 A;  1X3E A;  3G6J B;  2PCF B;  5C5M A;  4DR4 L;  1JOO A;  2D2C C;  1RF2 D;  1K28 A;  2HT1 A;  4DV5 Q;  1X3Q A;  4NMZ A;  4HIM A;  2ATW A;  3X3N A;  4LUV A;  2CQO A;  1JWU D;  1IYV A;  1P8L A;  3FDT A;  1HTP A;  1E22 A;  4RCO A;  2X6L A;  1PLF A;  4TQU S;  2CH4 A;  2FXQ A;  4DGZ A;  5C3E H;  1HFN A;  2NN6 I;  3SK8 A;  5CGK A;  3HOW G;  4G4K A;  2WP8 J;  4PNY A;  3Q24 A;  1HZ9 A;  3E0E A;  3J7Y W;  4IO9 A;  3EBE A;  3W1B A;  1WCM B;  4EQ5 A;  2Z8L A;  5IYC G;  3HOU G;  1VS0 A;  4R4Q A;  3RUZ A;  1G6P A;  1S72 A;  4HJ5 A;  3H94 A;  1S5F D;  1G2T A;  4IJH A;  2EXZ A;  5M3M H;  2ZJP A;  3J7Z C;  4AYB E;  3JC6 6;  3HKZ B;  1Z6H A;  3LGJ A;  1YJN A;  1EFI D;  5DLQ E;  1EWC A;  1SYC A;  5IYD H;  2WII B;  2JA7 H;  1I4R A;  1UAP A;  4KHP L;  3GTQ B;  2E2I B;  5C4H A;  2F1M A;  5IE8 A;  5F2D A;  5ELF A;  2L5T A;  1GXD C;  1CUK A;  5JJL A;  1JJ2 A;  5C5L A;  2QGQ A;  2F0G A;  4A76 A;  1Z7T A;  1TR5 A;  4JBW A;  3CKI B;  3I4O A;  5J3B A;  4YWK A;  4HSP A;  2XNA C;  3W3A A;  5LL6 S;  4LFA L;  2AMC B;  3A8K E;  4KHV A;  4A3M G;  2A6H D;  1GUG A;  4WRD A;  2EYO A;  4DV0 Q;  2R7Z H;  1NUC A;  3M4Y A;  1QJO A;  1D7Q A;  2SOB A;  4A93 B;  4DR7 L;  2JA5 G;  4BBS G;  1SE8 A;  2K5N A;  4JOI A;  3K57 A;  1U5K A;  2EY5 A;  5I9P A;  1I3Q H;  5IGC A;  2HDL A;  4DV6 L;  1TY0 A;  3ULL A;  1HJP A;  4NKL A;  3OMC A;  5CV9 A;  3SXH A;  2ZT9 C;  4Y7N B;  2L9H A;  1SEB D;  2WV6 D;  1TU2 B;  1NY4 A;  4K8I A;  2IX0 A;  1R4Q B;  3WOE A;  3NBH B;  2VW9 A;  1RHP A;  2F0U A;  1X3P A;  1NTG A;  4GN3 B;  1F9P A;  4C3J G;  4DV5 L;  5ELC A;  1XMQ L;  4RMF A;  3KOJ A;  4R4T A;  5D3I B;  2QW7 A;  2WKD A;  1PH9 A;  1HR0 L;  2F0J A;  3H3V I;  4BY7 B;  1I5F A;  2JA8 G;  3IRB A;  3S16 H;  1TWG B;  3HKS A;  2HHH Q;  1A8V A;  4A3D H;  4PMB A;  1WD1 A;  3TEH B;  1XTD A;  5D65 A;  3HOX H;  2YU9 H;  2FMC A;  3I72 A;  4IPD A;  4DV2 Q;  1QVC A;  3T56 B;  2XN9 C;  2A6E D;  1SXT A;  2G9H D;  2A1A A;  3DEP A;  3A7A B;  4GNX C;  2ZM6 Q;  4IFD H;  1STN A;  2B2U A;  4FXK C;  2OT2 A;  3R2T A;  3VYR A;  1WTO A;  1M90 C;  3KUP A;  2O5I C;  5D14 A;  4DV3 Q;  5IT9 E;  2VL6 A;  1B70 B;  4POF A;  3WWV A;  3RZO B;  3HOY B;  1Z9F A;  1KAA A;  3PUW A;  4B08 A;  2DUD A;  2B39 A;  1PZK D;  4JYA Q;  2F0M A;  5KGU A;  1EIH A;  4C3J H;  5IT9 L;  2R6G A;  3KBX A;  4AQY L;  5KNC A;  2RKS A;  2LXJ A;  4IFD I;  1MKH A;  1TWF B;  2XRQ D;  5IWA Q;  2JJQ A;  4OXP A;  1EY7 A;  1WTH A;  3MC0 B;  3ERQ A;  3Q8D A;  3X3M A;  2B8G A;  3TZD A;  1JOR A;  4O1N A;  1G6Z A;  1KLG D;  3NQI A;  3NTI A;  3H3V C;  3W5O A;  3G6E A;  2J7Z A;  5GAD C;  4Q5V A;  4DR5 L;  4A3B B;  4GN4 B;  2Y0S G;  2K52 A;  3A8J E;  3ITP A;  4V19 0;  4JI2 L;  2WB1 E;  1TII D;  2YV5 A;  3I4N H;  4NDX A;  1CTM A;  2UXC Q;  4B9W A;  5DAU A;  1X9N A;  1JB3 A;  1J8I A;  1S5C D;  2MGS A;  1UE7 A;  5COR A;  3GTM H;  5I6Y A;  4QGU A;  3M4P A;  3JAM E;  4JI6 L;  3OPO A;  3OW2 A;  1WJJ A;  2K50 A;  2QCP X;  2PQA A;  2ES2 A;  4ZAI A;  4A3G B;  1C9O A;  3F2C A;  4DF7 A;  4X64 Q;  3GD7 A;  5C3W A;  3DLL A;  3HEJ A;  4R4O A;  3TSS A;  5IP7 H;  3D6W A;  3VR5 A;  1KQS A;  4X66 Q;  3T13 A;  4LFC L;  2VY3 A;  3R2I A;  1PH6 A;  5C44 G;  1N36 L;  2ICE C;  2NVT B;  2KA7 A;  4ZUI A;  2RVL A;  5CMD A;  4JI3 Q;  1O7Y A;  4P72 A;  3MFY A;  4X62 Q;  3G4S A;  1UE6 A;  1PRT F;  5EJW A;  4LJZ C;  1VDZ A;  4FVM A;  4X66 L;  4DN4 M;  4JCV E;  1FJG Q;  1SN8 A;  4A3D B;  2D0P A;  4DR7 Q;  1Q90 A;  2GVB A;  3TS2 A;  4CJ1 B;  1SMX A;  1QZG A;  4HSV A;  1QNK A;  1LTT D;  4WJW A;  3I8Z A;  1Y1W G;  2E2J H;  2JA7 B;  4CKC A;  4GN5 A;  1CSQ A;  4YY3 L;  1B9M A;  2PO4 A;  1XNR L;  3M9B A;  2F0S A;  1PH3 A;  3KK7 A;  1Z47 A;  3KF8 B;  3SDZ A;  3JAM c;  1CFM A;  4X3U A;  2BE5 C;  2MNA A;  1D2B A;  3J80 i;  3SVM A;  1VQ8 A;  1CK1 A;  5LMU Q;  5EPL A;  3M4Q A;  2A68 D;  2PQA B;  3H09 A;  1WCM H;  4MNO A;  5BN4 A;  1HR0 W;  3S14 B;  3U58 A;  3M7N A;  1HNW Q;  1YI2 A;  1I3Q B;  4DV4 Q;  1XMO Q;  1C7Y A;  2KEC A;  4EVO A;  4B3M Q;  4JI4 L;  2A73 B;  4K0K Q;  4BY1 B;  3DMU A;  1ENF A;  2DY7 A;  4L5S A;  5C0X J;  2A68 C;  1JB7 A;  2QIL A;  1I50 H;  3VA7 A;  4ZKB B;  1U4L A;  1GUT A;  5ELD A;  2D9U A;  4X3T A;  1PH2 A;  1MJC A;  3FP9 A;  4YHH L;  1GD7 A;  2HIX A;  5JPN C;  1XNR Q;  2EJG C;  2R93 H;  3GTL H;  2F0L A;  3DXJ C;  1U4P A;  4TSS A;  4IFD G;  3A55 A;  5T1I A;  3BYY B;  5M3M B;  3QJY A;  3A8I E;  2F0N A;  1YHA A;  2WB1 G;  1STB A;  4IOA A;  3CD6 A;  2NN6 H;  3GTP B;  4H02 A;  1PVO A;  4XQQ A;  1HFG A;  5ELO A;  5C4X H;  4GLA C;  3HKZ E;  5JOB A;  4ZK9 B;  1WTQ A;  1N9W A;  4V0B A;  1R9T B;  3PO2 H;  4CGY B;  1VQO A;  4C3I B;  1WTW A;  2B2Y A;  5IP9 G;  4A4I A;  4B3M L;  4JI4 Q;  2L11 A;  2PMZ E;  3QB3 A;  4HMJ A;  3CCE A;  1IBL Q;  2ZJR A;  4DUZ L;  1JOQ A;  1YNN D;  3MTS A;  1AFP A;  1NSN S;  1GHK A;  3TZU A;  5ELE A;  5M5Y H;  1EZ6 A;  2EVB A;  4IJL A;  1TWG H;  4A3F G;  4CDE C;  4JI3 L;  4C2M B;  5EPJ A;  4A3M H;  4GOP B;  1VQJ A;  1E2V A;  1T5X D;  3V2T A;  5ELN A;  2JEB I;  3AFP A;  3I4L A;  2EYF A;  2N78 A;  2QEX A;  1LT4 D;  3E6Z X;  2D62 A;  3SR1 A;  2R61 A;  1A6X A;  2K05 A;  4P73 A;  2Q8R E;  1ONL A;  1X32 A;  2SNM A;  5M5X H;  5DM7 3;  2CHB D;  2I5L X;  4P74 A;  2EY6 A;  2A6E C;  2GN5 A;  1TWC H;  3D8G A;  2R7Z G;  3IL8 A;  4IUV A;  5KEE A;  2OF1 A;  2UUA L;  1S3O A;  3M4O B;  4A3F H;  1FNU A;  1GUW A;  5DM6 3;  4LW1 A;  4BY7 H;  2UXB Q;  4R4I A;  5K36 H;  2R93 G;  1KXL A;  1I6V C;  3NSW A;  2XRS D;  3MAQ A;  5ELB A;  3OWF A;  3QR8 A;  4LMQ D;  1Q46 A;  2N49 A;  3KDF A;  4K5X A;  2BH2 A;  4LNQ A;  3H0G B;  1GOZ A;  2E8G A;  1HNZ L;  3AFQ A;  2ZM6 L;  3CCM A;  3LNN A;  5E3F A;  4DA2 A;  3B6Y A;  5IT9 c;  3GTK H;  3J7A V;  1PH1 A;  2C9O A;  3MXG A;  1MBY A;  2ZTE A;  3HOV G;  3PUX A;  4K0K L;  1V1P B;  1H9R A;  3L0O A;  5M5X B;  3CCJ A;  2NB0 A;  4XT1 B;  2F0T A;  2Z4H A;  2VQE Q;  2HHH L;  2A69 C;  2E2I H;  1MI2 A;  4FF3 A;  3MA2 B;  2B8F A;  1ILQ A;  1H95 A;  4L6T B;  5LMN W;  5I4D A;  1NR4 A;  4QJF A;  1OTC A;  3ZYY X;  1QG7 A;  3WDN A;  1BCP B;  2HCC A;  1SFO H;  1E7Z A;  4OO1 H;  2Z0S A;  3BG3 A;  1EYD A;  5IYC H;  2BDO A;  2JA6 H;  2GA4 B;  1YJW A;  2K5W A;  2MJ8 A;  1J5E Q;  3RZO H;  1O7L A;  1VQ9 A;  3CP0 A;  3VR2 A;  4OL7 A;  5KYL A;  4DV1 Q;  1AE2 A;  1IYU A;  2JA8 B;  4DK3 C;  3S15 H;  3H6M A;  3ULJ A;  1TKW B;  3PIP A;  5I2Y A;  4MTK A;  3BZK A;  2JSO A;  2RA4 A;  4QMG A;  1KRS A;  5C3E B;  4L63 B;  5C6A A;  3NQT A;  3DUZ A;  3AMU A;  4IUP A;  4KJO A;  4WJ4 A;  4R9W A;  1QE6 A;  5KRU A;  2JA5 H;  2V1C C;  3PO3 H;  1GVP A;  2NN6 G;  3CU7 A;  2H5X A;  5EAY A;  5CV5 A;  2XSC A;  3RD4 A;  1B9N A;  5T1G A;  4LWC A;  4DNT B;  4HMI A;  1JQY D;  1PFS A;  3A7L A;  4BY1 H;  1W6K A;  4TKO B;  4LF4 L;  4FF4 A;  1J9O A;  1S4Z A;  4DV1 L;  1Y8O B;  3PO2 B;  4YWL A;  4KN7 C;  1YJ9 A;  1VQH A;  4GKJ Q;  2CVR A;  2LSS A;  4H0L C;  4C3H G;  5IGG A;  3S14 H;  4DKA C;  4HJA A;  1MSH A;  2DNE A;  2K7V A;  5M3F H;  1RKN A;  1GUN A;  1N33 L;  4DAP A;  3FPU B;  3D6C A;  2WKC A;  2NYZ D;  2DJF C;  3HOU B;  1STY A;  1TY2 A;  1S5E D;  3T53 B;  4HCE A;  3NTH A;  2Q2T A;  2K03 A;  4KY5 A;  3D31 A;  5JAV A;  3HKZ G;  1BNZ A;  4FYD A;  2N55 A;  4HN7 A;  4P2C B;  3PGZ A;  2IY5 B;  1A3T A;  2HDM A;  2Z1C A;  4UP9 A;  1BKB A;  4HIO A;  4FF1 A;  4FO2 A;  2B2V C;  1C0A A;  4CDC C;  4PMW A;  1C8C A;  1MGS A;  1W2B A;  4KKT A;  2H1E A;  2R7F A;  5IIF A;  2EYH A;  1L1O B;  4ALP A;  5IYD G;  1VQE A;  4ZKC B;  3PUY A;  1HA6 A;  4JI8 L;  3BYT B;  5DNF A;  4J6H A;  3RZD B;  2IW3 A;  4JC0 A;  1A3U A;  3D4R A;  2IJ0 A;  3NWS A;  2F0P A;  3C1E A;  1QB5 D;  3PQI A;  5GAH C;  1MJE A;  1EY8 A;  2B2W A;  4APV A;  4B3R Q;  2JQO A;  2E5L L;  1NAP A;  5FLX c;  1KD1 C;  1Q81 C;  1Y8N B;  4J15 A;  4N8F A;  2SNS A;  1YEZ A;  2KCN A;  1S5D D;  2K5H A;  4WOR A;  4XXE A;  5EGT A;  4QY7 A;  1K83 H;  1AEX A;  3DM3 A;  3ER0 A;  1TWH B;  1PH7 A;  1ROD A;  3FKI B;  2L4N A;  4AIM A;  4L8J A;  1Y1W B;  1VF5 C;  2K4K A;  5AJ3 Q;  4DR2 L;  2F0I A;  3QOL A;  2AUJ D;  2KJX A;  1CM9 A;  2PZT A;  3IAY A;  1I94 Q;  2B2T A;  1G91 A;  2XWJ B;  2KCC A;  4LFB Q;  5M5W H;  5FO9 B;  3F2D A;  1KTK A;  3S1Q B;  4IOC A;  1VMC A;  2PI2 E;  3OTO L;  4B3R L;  3OSO A;  3E9I A;  4K6L A;  1PH4 A;  1NMG A;  3OW7 A;  2UXD Q;  4IZ8 A;  2EY1 A;  1BDO A;  4PV1 C;  1CZG A;  3TDQ A;  1Y8P B;  1AH9 A;  3L3O C;  1KLU D;  1EOV A;  2CQA A;  4I7A A;  4LFC Q;  3HOY H;  2A19 A;  4EQP A;  4GOP C;  1M1K C;  3PV0 A;  3I4M B;  4FF2 A;  1YNJ C;  3D4D A;  5ISR A;  5M5W B;  4NXN Q;  4P71 A;  2F0E A;  4CKE A;  3S17 B;  1ZYR C;  2CW0 D;  2XIW A;  4JK1 C;  4JI0 Q;  1JIC A;  2UUA Q;  1GKH A;  4IUT A;  1JE5 A;  4JI7 L;  1JR0 D;  3IFD A;  1X56 A;  5GRO A;  5LL6 X;  1RTN A;  1N34 Q;  3CQZ B;  1HPC A;  3ULP A;  4R8N A;  3AQQ A;  5M3M G;  1ASY A;  2YU9 B;  1Q7Y C;  2QF7 A;  3Q23 A;  1V1P A;  1Y1V B;  4JI2 Q;  1A2T A;  2C5C A;  3AB9 A;  1IZ6 A;  2DGY A;  1EYG A;  2MFI A;  2PNR C;  1K9M C;  1TXY A;  4CHT B;  2B29 A;  3K80 C;  4C3I G;  1G8Z D;  1HNX Q;  1U4R A;  1O7Z A;  4JI5 L;  1MHW C;  1GM5 A;  4XIG S;  1KL9 A;  4O0A A;  4DAV A;  4B3T L;  2KOL A;  4EQN A;  1LTG D;  1H9M A;  3QO2 A;  3QOJ A;  4DR1 L;  1KDB A;  1IL2 A;  1IW7 C;  4RGN A;  3F2U A;  1EY6 A;  2OXP A;  5DEH A;  4A3F B;  5COY A;  4RGM A;  4A3I B;  1SYE A;  1LTL A;  4LF9 Q;  2B63 B;  2YTX A;  1KNA A;  2DN8 A;  4CDD C;  2K5V A;  4A3J H;  4IAL A;  1K3B C;  2XVS A;  2RBM A;  2YYZ A;  3UDF A;  1RIP A;  4JI1 L;  1EWI A;  3CCL A;  4AYB B;  3VYS A;  4KN4 C;  4NPS A;  1YZ6 A;  2F0D A;  4GLV B;  2MO1 A;  1PV4 A;  1KAB A;  2OWO A;  1D8L A;  1PYW D;  2OQ0 A;  4CJ2 C;  2JE6 I;  1RTO A;  1GUS A;  3T51 B;  3GTJ H;  1VQK A;  3CXC A;  3DWQ A;  1YHQ A;  1X54 A;  1AW7 A;  4OON A;  2NZH A;  1BCP C;  4LF5 L;  3GTO H;  4NW2 A;  1BOS A;  1DZ1 A;  2HQL A;  3NEN A;  1IL8 A;  2IPK D;  1STH A;  3AU7 A;  3T1H L;  1VQB A;  1QWY A;  2CCZ A;  1LT3 D;  2F4V L;  1HHV A;  2TMP A;  3EN2 A;  1Y69 U;  3JAM L;  2F3V A;  4KD3 A;  1B2T A;  4A3J B;  1YHB A;  3I91 A;  1HZA A;  2OTJ A;  1LAC A;  3CQZ H;  5IGB A;  1IYJ B;  4X64 L;  4UP8 A;  1Q82 C;  4A3K H;  2ZTC A;  1CZW A;  3G7L A;  4O42 A;  3TQY A;  2JA8 H;  1I4Q A;  4HAE A;  4HCS A;  1N34 L;  4L5R C;  4AQY Q;  1SYD A;  4X65 Q;  3KLR A;  2OEO A;  4JI0 L;  2HCI A;  5A35 A;  2FMM A;  4UDU C;  3Q6S A;  5D3D A;  4KKS A;  1SE4 A;  2VUM B;  4BBR G;  4HED A;  1K3R A;  1GHJ A;  1U0L A;  2O4X A;  4RKL A;  4ID6 A;  3I4N B;  1K8G A;  4JW0 A;  1FGB D;  3S2D B;  4IUN A;  4A3B H;  4HJ7 A;  4PZ7 A;  3T4A C;  1JCK B;  3OIQ A;  3S1Q H;  1EIY B;  1X3F A;  1L0W A;  1DOL A;  2R92 B;  3NBH A;  4E6I A;  4BS9 A;  4JI5 Q;  4XT3 B;  5A2Q E;  4L5T A;  3I70 A;  2PZW A;  4RGT A;  2QDB A;  4LUO A;  3GDE A;  1ICW A;  1A15 A;  4DPG A;  4P75 A;  5KIX A;  1UUP A;  3HOW B;  3MXP A;  3QIA A;  1QVG A;  2PPB C;  3RLF A;  2KEE A;  1AZQ A;  2JA6 B;  1WCM G;  2J0T D;  3KLW A;  3K7U C;  4ZYS A;  4K2K A;  1KNE A;  4JG2 A;  3LWU A;  1CA5 A;  3MEF A;  1WTP A; 
#chains in the Genus database with same CATH homology
 2XWB B;  3PIO 3;  4BA1 I;  3K59 A;  4KTA A;  1HA5 A;  3S1R B;  2EJM A;  1SYG A;  4A3E B;  1ENC A;  1F77 A;  4RFB A;  3EJI A;  1W6J A;  3N6R A;  2M9V A;  1ILP A;  3K5M A;  1EQV A;  3ND9 A;  4DXG A;  1H9K A;  5FO7 B;  3HOX B;  5BN5 A;  3K5N A;  5FO8 B;  3KLS A;  1EQT A;  1SFO B;  3MZ5 A;  3CRL C;  1ESF A;  4PQX A;  1ESR A;  1EY5 A;  2KHS A;  2AWN A;  5CYU A;  4J8Q A;  3NE5 B;  5M3F B;  4KV6 A;  4QUF A;  3R8B A;  1D5M C;  4BBS B;  1WTV A;  3GQB A;  1NCV A;  2EDG A;  1Q3L A;  2EYP A;  3K7A B;  1D6E C;  3SEB A;  2E75 C;  3KBG A;  3K0Y A;  1PFN A;  2LY7 A;  2MPM A;  1EL0 A;  2NTS A;  2RQX A;  4TRD A;  4H13 C;  3HOZ B;  2A74 C;  5M5Y B;  3SK5 A;  1EWH A;  1KDC A;  2O2L D;  1PFM A;  4QUC A;  3M7G A;  5EPK A;  3DWA A;  1B1Z A;  4UAI A;  3OWE B;  2VNU D;  3J81 E;  5J22 A;  4A3M B;  1JOK A;  2RSO A;  4BA2 I;  3M3Y B;  1WVL A;  4Z9C B;  5EKI A;  2TSS A;  3TN2 A;  2JXM B;  1V43 A;  5I9O A;  3QG1 A;  4QIW B;  3FRP B;  2K6A A;  4RHS A;  1BUV T;  3J80 L;  1G2S A;  2ID0 A;  1A3V A;  3VYU A;  2DY8 A;  5CV7 A;  2QKI C;  4DNR B;  3BDL A;  3TP5 A;  2F0K A;  1F2M A;  1WD0 A;  1DOK A;  3ND8 A;  1H9S A;  4I65 A;  1CQV A;  4MIU A;  1GUO A;  5AFW A;  3EFX D;  2X6G A;  1Q1B A;  1IKM A;  3MEH A;  1STA A;  3O13 A;  5EQ0 A;  3U9S A;  1PDQ A;  4LK1 C;  4EGV A;  2E2J B;  3NPP A;  1R4P B;  5M9O A;  4FXG C;  3PIP 3;  4C1N I;  3FMC A;  1AN8 A;  1F9R A;  5LHY 1;  2A69 D;  1SDF A;  4BWG B;  3T16 A;  3H91 A;  2NBF A;  3K5O A;  3OHX C;  2FFK B;  3L7Z C;  1U4M A;  1SAP A;  4F88 A;  2DNC A;  5C0X G;  1QNU A;  1PTO F;  2AUK A;  1CHP D;  2AQ3 B;  2E2H B;  4RGO S;  5FLX L;  1ZEQ X;  1ET9 A;  4KJN A;  1EEI D;  4YIJ A;  4OO1 G;  3PUZ A;  3DHQ A;  1RCV D;  1LLR D;  3BDO A;  2B2Y C;  3UI2 A;  3RMH A;  3GP7 A;  1Q8I A;  5JVG 3;  1SE3 A;  2PMZ B;  3DEO A;  1QCB D;  2K5Q A;  3TP6 A;  3SK4 A;  2Y0S B;  4H44 C;  3S15 B;  4RA8 A;  5E4X A;  3OMG A;  1MSG A;  3SHL A;  2F0V A;  1XTC D;  5KND A;  4RCN A;  5C0X I;  2MUY A;  4C3J B;  2FIN B;  4K8J A;  4XQN A;  1AP0 A;  2PZU A;  1QIL A;  3HRZ C;  3J80 E;  1XX8 A;  4ODG A;  2BOS A;  1SMY C;  5C44 B;  1SE2 A;  1I4X A;  1E0B A;  1JC7 A;  1DM0 B;  4QF4 A;  2F03 A;  1C48 A;  3IFT A;  3VR4 A;  1SBB B;  3MVV A;  2A6H C;  1PRT C;  4PMC A;  4G57 A;  3A54 A;  3W2D A;  3MFG A;  4OIK A;  4XYO A;  2E2D C;  1HTL D;  3K5L A;  5J39 A;  3J7A F;  2LMC B;  4IUU A;  1K83 B;  5CV4 A;  2EJF C;  3GTJ B;  1DOM A;  3NXW A;  1CA6 A;  1PXU A;  3HGB A;  4N9P A;  1PFB A;  4QB4 A;  2N88 A;  3EA6 A;  2WAQ B;  1RDP D;  4DAY A;  4KD4 A;  1F2Y A;  4I7Z C;  1ET6 A;  3CRK C;  5FOB B;  1D1K A;  2IT1 A;  4G7H C;  1D1I A;  3ERO A;  3E0J A;  2I46 A;  3VR3 A;  2R7Z B;  2LKV A;  1C4Q A;  2IWH A;  1DJR D;  4H7B A;  2K32 A;  2Q8I B;  1EU4 A;  2WB1 B;  1EOT A;  1LAB A;  3LWE A;  5CV6 A;  4FP5 D;  5I6W A;  1PTO D;  2EE1 A;  5C4Z A;  4ZRZ A;  1LV9 A;  1BCP D;  2PYK A;  1V8Q A;  2L55 A;  3VA5 A;  1STG A;  5C4X B;  1RD9 D;  3MHB A;  2F0Q A;  4GZY C;  3BZD B;  1SSO A;  5KYI A;  3HOV B;  2ZXP A;  1OXV A;  3GV3 A;  2JYO A;  1SNQ A;  1YNJ D;  1EY9 A;  1XXG A;  1ZYR D;  3D4W A;  1NR2 A;  3MXN A;  1PTO H;  2FJ2 A;  4B9X A;  1PZI D;  2ZXO A;  3J81 L;  5JVH 3;  2ICI A;  4X3K A;  1B53 A;  1L0Y B;  1BF4 A;  1DD2 A;  4EQO A;  2RDF A;  1FYC A;  1LT6 D;  3VYT A;  1U9R A;  2PW7 A;  3KF8 A;  4KI0 A;  4DXF A;  2NVY B;  1IW7 D;  3DWP A;  1SND A;  3PO3 B;  4FXD A;  1STE A;  1EYA A;  1JE4 A;  3NP8 A;  4S3S A;  1K8M A;  2BA0 A;  3N52 A;  1VCI A;  2LS0 1;  4OO1 I;  2BA1 A;  4F7X A;  1HUM A;  2B2T C;  2IX3 A;  1OXS C;  3K6O A;  4NP5 A;  1TS5 A;  3DM1 A;  3GTK B;  1LTI D;  1IKL A;  1RJT A;  4C3H B;  3ONA B;  2I07 B;  1S5B D;  1LO5 D;  3GTO B;  2HQE A;  1DON A;  1VF7 A;  2FHT A;  5TSS A;  5JEA H;  2WIN B;  3C3L A;  1Q12 A;  3GO5 A;  5JEA J;  5C3X A;  1M8A A;  2JEA I;  4DFA A;  1I6H B;  1SNC A;  3LX0 A;  1TWC B;  5CBE E;  5HGT A;  1O80 A;  1BR9 A;  4R8I A;  2M00 A;  1SNP A;  3C46 A;  4IQZ A;  3SK6 A;  1CT1 D;  5FK9 C;  4G7Z C;  2K28 A;  1I4P A;  2EYL A;  5IGE A;  1PRT B;  1GJX A;  3FPP A;  3I90 A;  2R93 B;  1WTX A;  4KHZ A;  2SEB D;  1DYQ A;  1F9Q A;  4KKU A;  2HUG A;  4F8M A;  1UNS A;  3NTK A;  4OIJ A;  1YNN C;  5EBC A;  1L0X B;  2M2L A;  1D5Z C;  1FNW A;  2PW5 A;  4C1N K;  2IL8 A;  2B2U C;  3TBI B;  3CHB D;  4K2L A;  4OGQ C;  5NUC A;  2L12 A;  1SNM A;  3GTL B;  3PMF A;  2JA5 B;  1TVX A;  5CV8 A;  2WAC A;  4Q0F A;  1ML0 D;  4ABN A;  1HCZ A;  1OXT A;  4WFN 3;  2H4O A;  1I4H A;  1HRJ A;  3P7J A;  1PZJ D;  2KUM A;  4HR7 B;  5EKL A;  2RDH A;  2E74 C;  2J4X A;  1E2Z A;  1B50 A;  1B44 D;  5C4J B;  2F0H A;  1BBX C;  2CW0 C;  1TS2 A;  1EU3 A;  3HP3 A;  4X3S A;  1V1O A;  1A2U A;  4J1M A;  1SNO A;  1AZP A;  2K1B A;  1EIG A;  4RAU C;  2EYM A;  3U9O A;  3TP7 A;  5A2Q L;  1G29 1;  2G9D A;  2MP1 A;  4C56 C;  4F87 A;  5JJZ A;  2EY2 A;  3EVQ A;  3L9A X;  2AQ1 B;  2AQ2 B;  2F0W A;  1FNV A;  2RDG A;  5EBD A;  2F0F A;  1TS4 A;  1F2L A;  1SJH D;  4HTH A;  3TME A;  4XQJ A;  1LT5 D;  3OIP A;  3D3R A;  1FR3 A;  1BQQ T;  3URY A;  2L0C A;  4DU9 A;  4IUR A;  2D5D A;  1LTR D;  4N9T A;  3A56 A;  5FKA C;  1VMP A;  2BCO A;  5IOC A;  4ZQ3 A;  1H9S B;  4U68 A;  5BN3 A;  3BS1 A;  3E5S A;  4CBV A;  2F4I A;  3NHH A;  1LTS D;  3K58 A;  2NTT A;  2IX1 A;  3GTG B;  5FLX E;  1M4V A;  3S1M B;  1T5E A;  4K6D A;  1EEF D;  1TQO A;  2KQ3 A;  3C2P A;  4DK1 A;  4CJ0 B;  1FD7 D;  1XYI A;  5IGF A;  2BDN A;  1H9J A;  3NK9 A;  2Q8T A;  5I2X A;  4KMU C;  3S16 B;  3KLS X;  2R3Z A;  2NUC A;  3QWN A;  5HUR A;  1DXM A;  3IKJ A;  1Q1E A;  1E2W A;  1BCP F;  1XWE A;  3R93 A;  4MHE A;  2EZV A;  5CC4 A;  1SYB A;  3BVG A;  1KDA A;  2K5D A;  4XDX A;  4MN3 A;  1EY0 A;  2F3W A;  5K5P A;  3I73 A;  4RHR A;  3MWY W;  1PTO B;  2Z4I A;  3BVZ A;  1HQM C;  4RH6 A;  1JWM D;  4CKB A;  1O78 A;  2NZ1 D;  2SDF A;  4KY6 A;  1B3A A;  3M85 A;  3PUV A;  3R3O A;  1MD2 D;  2VB2 X;  3I3C A;  3HZX A;  3WOF A;  4DK0 A;  2VXW A;  2RSN A;  5G3L F;  1CHQ D;  5J1Z A;  1I4G A;  5CR3 A;  1HUN A;  4XYQ A;  1IHZ A;  1SYF A;  2EOT A;  1UEA B;  3BVM A;  4BBR B;  1BO0 A;  1SJE D;  4XTC S;  1ZXT A;  1D5X C;  2AWO A;  4ZLT F;  3S9W A;  3HG9 A;  3S2H B;  4FNF A;  4ILW A;  2K04 A;  3P20 A;  1QOH A;  2ENB A;  3HS0 C;  3NWT A;  1DCZ A;  5E4W C;  4IUQ A;  2NWG A;  3P75 A;  4ZUJ A;  5JPM C;  1OXU A;  2B2V A;  1HQR D;  1WTR A;  1K8O A;  3S1N B;  3P1H A;  3V96 A;  4KK7 A;  2EYJ A;  1ENA A;  3EQL C;  3GTM B;  1EZ8 A;  3MXU A;  3FEW X;  4G7O C;  1I50 B;  1B4O A;  1EYC A;  1TS3 A;  2NVQ B;  4U67 3;  2KVM A;  1TT2 A;  4IFD J;  2F0O A;  2E76 C;  5CBA E;  1CI3 M;  2A5H A;  2K01 A;  3NBI A;  3SE0 A;  1PMR A;  1HXY D;  3GV6 A;  2QEJ C;  4K14 A;  3VR6 A;  1LTA D;  2NVX B;  2O5J C;  5JEA G;  5K36 G;  1LTB D;  1F9S A;  2B2W C;  1OXX K;  3V05 A;  2KED A;  5G3L D;  2LFN A;  1BXT A;  5IGD A;  2VB3 X;  4KY7 A;  2L1B A;  2X69 A;  1OO9 B;  2EPB A;  1TWA B;  5KNB A;  4A3K B;  4K5V A;  4LAA A;  1F2Z A;  1ZKO A;  3TP8 A;  3BDC A;  2PQE A;  3Q22 A;  3FVQ A;  4ME5 A;  4OHJ A;  5EKK A;  2V4D A;  3Q0A A;  5E1F A;  1PTO C;  4IN3 A;  1CQF A;  4RKB A;  1JWS D;  3C1F A;  5IOD A;  2BE5 D;  4K5W A;  4RWS C;  1SMY D;  2ZXR A;  4M1U B;  3NUC A;  5C0X H;  2K33 A;  3OOC A;  1II3 A;  4ULL A;  2JP1 A;  1PRT D;  2MHV A;  4M8A A;  4QCL A;  1EY4 A;  3G6J B;  2PCF B;  5C5M A;  1JOO A;  2D2C C;  1RF2 D;  1X3Q A;  4NMZ A;  3X3N A;  1JWU D;  1IYV A;  3FDT A;  1HTP A;  4RCO A;  2X6L A;  1PLF A;  4TQU S;  4DGZ A;  1HFN A;  2NN6 I;  3SK8 A;  5CGK A;  4G4K A;  2WP8 J;  4PNY A;  3Q24 A;  3J7Y W;  1WCM B;  2Z8L A;  3RUZ A;  3H94 A;  1S5F D;  1G2T A;  2EXZ A;  3HKZ B;  1Z6H A;  1EFI D;  1EWC A;  1SYC A;  2WII B;  1I4R A;  1UAP A;  3GTQ B;  2E2I B;  5C4H A;  2F1M A;  5F2D A;  5ELF A;  2L5T A;  1GXD C;  5C5L A;  2F0G A;  1Z7T A;  1TR5 A;  4JBW A;  3CKI B;  4HSP A;  2XNA C;  3W3A A;  5LL6 S;  3A8K E;  4KHV A;  2A6H D;  1GUG A;  4WRD A;  2EYO A;  1NUC A;  3M4Y A;  1QJO A;  2SOB A;  4A93 B;  3K57 A;  2EY5 A;  5I9P A;  5IGC A;  2HDL A;  1TY0 A;  4NKL A;  3OMC A;  5CV9 A;  3SXH A;  2ZT9 C;  4Y7N B;  2L9H A;  1SEB D;  2WV6 D;  1TU2 B;  4K8I A;  2IX0 A;  1R4Q B;  3WOE A;  1RHP A;  2F0U A;  1X3P A;  1F9P A;  4C3J G;  5ELC A;  5D3I B;  2WKD A;  2F0J A;  4BY7 B;  1TWG B;  4PMB A;  1WD1 A;  5D65 A;  2FMC A;  3I72 A;  3T56 B;  2XN9 C;  2A6E D;  1SXT A;  2G9H D;  3DEP A;  3A7A B;  4IFD H;  1STN A;  2B2U A;  4FXK C;  2OT2 A;  3R2T A;  3VYR A;  1WTO A;  3KUP A;  2O5I C;  5D14 A;  5IT9 E;  3RZO B;  3HOY B;  1KAA A;  3PUW A;  4B08 A;  2B39 A;  1PZK D;  2F0M A;  5KGU A;  1EIH A;  5IT9 L;  2R6G A;  3KBX A;  5KNC A;  2RKS A;  4IFD I;  1TWF B;  2XRQ D;  1EY7 A;  3ERQ A;  3MC0 B;  3X3M A;  2B8G A;  3TZD A;  1JOR A;  4O1N A;  1G6Z A;  1KLG D;  3NQI A;  3NTI A;  3H3V C;  2J7Z A;  4Q5V A;  4A3B B;  3A8J E;  3ITP A;  4V19 0;  1TII D;  4NDX A;  1CTM A;  4B9W A;  5DAU A;  1JB3 A;  1J8I A;  1S5C D;  2MGS A;  5COR A;  5I6Y A;  3JAM E;  3OPO A;  2QCP X;  4ZAI A;  4A3G B;  4DF7 A;  3GD7 A;  5C3W A;  3HEJ A;  3TSS A;  3D6W A;  3VR5 A;  3T13 A;  3R2I A;  2ICE C;  2NVT B;  2KA7 A;  4ZUI A;  2RVL A;  5CMD A;  1O7Y A;  3MFY A;  1PRT F;  5EJW A;  4LJZ C;  1VDZ A;  4FVM A;  4DN4 M;  4A3D B;  1Q90 A;  4CJ1 B;  4HSV A;  1QNK A;  1LTT D;  4WJW A;  3I8Z A;  2JA7 B;  4CKC A;  1B9M A;  2PO4 A;  2F0S A;  3KK7 A;  1Z47 A;  3SDZ A;  1CFM A;  4X3U A;  2BE5 C;  1D2B A;  3SVM A;  1CK1 A;  5EPL A;  2A68 D;  3H09 A;  5BN4 A;  3S14 B;  3M7N A;  1I3Q B;  2KEC A;  4EVO A;  2A73 B;  4BY1 B;  3DMU A;  1ENF A;  2DY7 A;  5C0X J;  2A68 C;  2QIL A;  3VA7 A;  4ZKB B;  1U4L A;  1GUT A;  5ELD A;  2D9U A;  4X3T A;  5JPN C;  2EJG C;  2F0L A;  3DXJ C;  1U4P A;  4TSS A;  4IFD G;  3A55 A;  5T1I A;  3BYY B;  5M3M B;  3QJY A;  3A8I E;  2F0N A;  1STB A;  2NN6 H;  3GTP B;  4XQQ A;  1HFG A;  5JOB A;  1WTQ A;  4ZK9 B;  1R9T B;  4V0B A;  4CGY B;  1WTW A;  4C3I B;  2B2Y A;  2L11 A;  3QB3 A;  4HMJ A;  1JOQ A;  1YNN D;  3MTS A;  1AFP A;  1NSN S;  1GHK A;  3TZU A;  5ELE A;  1EZ6 A;  2EVB A;  4C2M B;  5EPJ A;  1E2V A;  1T5X D;  3V2T A;  2JEB I;  3I4L A;  2EYF A;  1LT4 D;  3E6Z X;  2D62 A;  3SR1 A;  2R61 A;  1A6X A;  2K05 A;  2Q8R E;  1ONL A;  1X32 A;  2SNM A;  5DM7 3;  2CHB D;  2EY6 A;  2A6E C;  3D8G A;  3IL8 A;  4IUV A;  5KEE A;  2OF1 A;  3M4O B;  1FNU A;  1GUW A;  5DM6 3;  5K36 H;  1I6V C;  3NSW A;  2XRS D;  3MAQ A;  5ELB A;  3OWF A;  4LMQ D;  4K5X A;  3H0G B;  1GOZ A;  3LNN A;  5E3F A;  4DA2 A;  3J7A V;  2C9O A;  3MXG A;  1MBY A;  3PUX A;  1V1P B;  1H9R A;  5M5X B;  2NB0 A;  4XT1 B;  2F0T A;  2Z4H A;  2A69 C;  1MI2 A;  4FF3 A;  3MA2 B;  2B8F A;  1ILQ A;  4L6T B;  5I4D A;  1NR4 A;  3ZYY X;  1QG7 A;  3WDN A;  1BCP B;  2HCC A;  4OO1 H;  3BG3 A;  1EYD A;  2BDO A;  2GA4 B;  2K5W A;  2MJ8 A;  1O7L A;  3VR2 A;  4OL7 A;  5KYL A;  1IYU A;  2JA8 B;  3H6M A;  1TKW B;  5I2Y A;  2JSO A;  2RA4 A;  4QMG A;  5C3E B;  4L63 B;  5C6A A;  3NQT A;  3DUZ A;  3AMU A;  4IUP A;  4KJO A;  4R9W A;  1QE6 A;  5KRU A;  2NN6 G;  3CU7 A;  5CV5 A;  2XSC A;  3RD4 A;  1B9N A;  5T1G A;  4DNT B;  4HMI A;  1JQY D;  3A7L A;  1W6K A;  4TKO B;  4FF4 A;  1J9O A;  1S4Z A;  1Y8O B;  3PO2 B;  4KN7 C;  2CVR A;  4H0L C;  4C3H G;  5IGG A;  1MSH A;  2DNE A;  2K7V A;  1RKN A;  1GUN A;  4DAP A;  3FPU B;  3D6C A;  2WKC A;  2NYZ D;  3HOU B;  1STY A;  1TY2 A;  1S5E D;  3T53 B;  4HCE A;  3NTH A;  2K03 A;  4KY5 A;  3D31 A;  5JAV A;  1BNZ A;  4FYD A;  2N55 A;  4HN7 A;  4P2C B;  1A3T A;  2HDM A;  2Z1C A;  4FF1 A;  4FO2 A;  2B2V C;  4PMW A;  1C8C A;  1MGS A;  4KKT A;  2H1E A;  5IIF A;  2EYH A;  4ZKC B;  3PUY A;  1HA6 A;  3BYT B;  5DNF A;  4J6H A;  3RZD B;  2IW3 A;  1A3U A;  3D4R A;  2IJ0 A;  3NWS A;  2F0P A;  3C1E A;  1QB5 D;  1EY8 A;  2B2W A;  1NAP A;  1Y8N B;  2SNS A;  2KCN A;  1S5D D;  4WOR A;  4XXE A;  5EGT A;  1AEX A;  1TWH B;  1ROD A;  3FKI B;  2L4N A;  4L8J A;  1Y1W B;  1VF5 C;  2F0I A;  3QOL A;  2AUJ D;  2KJX A;  1CM9 A;  2PZT A;  3IAY A;  2B2T A;  1G91 A;  2XWJ B;  2KCC A;  5FO9 B;  1KTK A;  3S1Q B;  1VMC A;  3OSO A;  4K6L A;  3OW7 A;  4IZ8 A;  2EY1 A;  1BDO A;  4PV1 C;  1CZG A;  3TDQ A;  1Y8P B;  3L3O C;  1KLU D;  2CQA A;  4EQP A;  3PV0 A;  3I4M B;  4FF2 A;  1YNJ C;  3D4D A;  5ISR A;  5M5W B;  2F0E A;  4CKE A;  3S17 B;  1ZYR C;  2CW0 D;  2XIW A;  4JK1 C;  1JIC A;  4IUT A;  1JR0 D;  3IFD A;  5LL6 X;  1RTN A;  3CQZ B;  1HPC A;  4R8N A;  2YU9 B;  2QF7 A;  3Q23 A;  1V1P A;  1Y1V B;  1A2T A;  2C5C A;  3AB9 A;  2PNR C;  4CHT B;  4C3I G;  1G8Z D;  1U4R A;  1O7Z A;  4XIG S;  4DAV A;  2KOL A;  4EQN A;  1LTG D;  1H9M A;  3QO2 A;  3QOJ A;  1KDB A;  1IW7 C;  4RGN A;  3F2U A;  1EY6 A;  2OXP A;  5DEH A;  4A3F B;  5COY A;  4RGM A;  4A3I B;  1SYE A;  2B63 B;  1KNA A;  2DN8 A;  4IAL A;  2XVS A;  2RBM A;  2YYZ A;  4AYB B;  3VYS A;  4KN4 C;  2F0D A;  1KAB A;  1PYW D;  4CJ2 C;  2JE6 I;  1RTO A;  1GUS A;  3T51 B;  3DWQ A;  1AW7 A;  1BCP C;  4NW2 A;  1BOS A;  1DZ1 A;  1IL8 A;  2IPK D;  1STH A;  3AU7 A;  1QWY A;  1LT3 D;  1HHV A;  2TMP A;  1Y69 U;  3JAM L;  2F3V A;  4KD3 A;  1B2T A;  4A3J B;  3I91 A;  1LAC A;  5IGB A;  1CZW A;  3G7L A;  4O42 A;  1I4Q A;  4HAE A;  4HCS A;  1SYD A;  2OEO A;  3KLR A;  2HCI A;  5A35 A;  2FMM A;  4UDU C;  3Q6S A;  5D3D A;  4KKS A;  1SE4 A;  2VUM B;  4HED A;  1GHJ A;  2O4X A;  4RKL A;  3I4N B;  4ID6 A;  1FGB D;  3S2D B;  4IUN A;  3T4A C;  1JCK B;  3OIQ A;  2R92 B;  1DOL A;  3NBH A;  4E6I A;  4BS9 A;  4XT3 B;  5A2Q E;  3I70 A;  2PZW A;  4RGT A;  2QDB A;  1ICW A;  1A15 A;  5KIX A;  1UUP A;  3HOW B;  3MXP A;  3QIA A;  2PPB C;  3RLF A;  2KEE A;  1AZQ A;  2JA6 B;  2J0T D;  4ZYS A;  4K2K A;  1KNE A;  3LWU A;  1CA5 A;  1WTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...