2PZWA

Crystal structure of staphylococcal nuclease variant v66n/p117g/h124l/s128a at room temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
130
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMNENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pzwA00
1EQVA 4DF7A 2OEOA 5I9PA 3OSOA 5CGKA 5CR3A 4EQOA 4J6HA 5I9OA 4KV6A 3C1FA 2OF1A 5I6YA 3DMUA 5DAUA 3EROA 1EY7A 2F0KA 4DGZA 5NUCA 2F0EA 1SNDA 5CV8A 4I65A 3SK4A 1SNCA 2F0UA 2RBMA 3SR1A 4EQPA 2WACA 1AEXA 1EYCA 3NUCA 2RDFA 4B9WA 1TR5A 1SYDA 5KYIA 1JORA 4KY7A 5CC4A 2F0GA 2EY6A 3LX0A 4KD3A 1F2YA 4EVOA 3NP8A 4QMGA 2F0DA 4N9TA 4F8MA 1EYDA 3NXWA 5HGTA 3TP5A 5J22A 3SK5A 1STAA 3QOLA 2PZTA 4ME5A 3SK8A 3T16A 5JOBA 3NHHA 4WRDA 3TP6A 4F7XA 5KEEA 2RKSA 1TQOA 1A3UA 2EYOA 3MEHA 1II3A 2F0VA 5IGEA 2F0HA 4KJOA 5C4HA 3P1HA 4ZUJA 1SYEA 5IGFA 3S9WA 4HMJA 4K8JA 3EJIA 2KHSA 2EYHA 2PYKA 3BDLA 1IHZA 1NSNS 4R8NA 5EKKA 1JOQA 4DFAA 2F0SA 3BDCA 1ENCA 1EY0A 2F3VA 2O4XA 2SOBA 1STHA 3P75A 2SNSA 3D4WA 4KY5A 5E3FA 1TT2A 5M9OA 2F0LA 3D4DA 3HEJA 4PMBA 3TP7A 5KYLA 4K6DA 4ZUIA 5E1FA 2EY1A 5F2DA 3PMFA 3V2TA 3SXHA 2KQ3A 5IIFA 5EKLA 5J1ZA 4KD4A 2F0NA 2F0MA 4RKBA 2EYPA 3OMCA 3MZ5A 4KJNA 4H7BA 5CV4A 4LAAA 1A3TA 5KGUA 5KRUA 5C3XA 1EZ8A 2PZUA 4K5WA 2SNMA 4KHVA 5EGTA 3RUZA 3TP8A 3OWFA 1SYGA 1EY4A 3NK9A 5IGGA 3E5SA 5CV7A 5HURA 1EY9A 1KABA 3MXPA 1RKNA 1A3VA 2EYLA 1A2TA 1JOOA 2M00A 2QDBA 3MHBA 3SK6A 4E6IA 2F0IA 5C3WA 4J1MA 1F2MA 1STBA 4HMIA 4PNYA 5J39A 4K2KA 5IGBA 3EVQA 4IZ8A 5ISRA 1SNPA 4IUNA 3ERQA 3C1EA 2PZWA 4NMZA 3HZXA 3QB3A 5DEHA 3VA5A 4ZQ3A 3DHQA 2PW5A 5C4ZA 2EYJA 4K5VA 4ODGA 5C5MA 1JOKA 1SNMA 2PQEA 4KY6A 1EY5A 2F0PA 2OXPA 4EQNA 5IGDA 2F0FA 4YIJA 5IODA 1ENAA 4G57A 5C6AA 4QF4A 3U9OA 1STYA 1NUCA 3TMEA 4DU9A 4K8IA 5CV6A 4S3SA 1STNA 4IALA 5C5LA 1A2UA 3SHLA 4KTAA 4NDXA 1KDBA 2ENBA 3OMGA 4K5XA 4RKLA 5I6WA 2EY2A 2EY5A 4N9PA 2F0OA 5JAVA 4TRDA 2EYMA 5CV5A 2F0JA 4PMCA 3QOJA 2PW7A 4MIUA 4NP5A 3ITPA 2F0WA 1SYFA 4OL7A 1EY8A 3H6MA 4NKLA 5IOCA 4B9XA 1KDAA 1U9RA 1EY6A 5K5PA 1KAAA 3D8GA 2F0QA 4ID6A 2LKVA 2F3WA 4HTHA 2EYFA 3MVVA 1SYCA 1STGA 1F2ZA 3T13A 4K2LA 4QB4A 2NUCA 4WORA 1SNQA 5IGCA 3NQTA 1KDCA 2HQEA 4K14A 3R3OA 1SYBA 2F0TA 5CV9A 5KIXA 1EZ6A 2EXZA 1SNOA 1EYAA 3D6CA
chains in the Genus database with same CATH superfamily
1TS3A 1HR0Q 2JJQA 3L7ZC 1LT4D 1FJGQ 1PRTD 4DK3C 3HG9A 5EBDA 1PFNA 4PQXA 4IPDA 2NVTB 3Q8DA 4OX9Q 2QGQA 1E2WA 4X64Q 2N88A 1VF7A 4IOCA 4DUZL 5EPLA 3PUZA 3HKSA 5TSSA 3KOJA 4BWGB 4ZAIA 3GTLH 3JAME 3RLNA 3Q6SA 4RGMA 3D3RA 4FVMA 3M4PA 3T1HQ 1AP0A 4WRDA 3M4OB 3K81C 3GTQH 1TWHB 3OTOQ 3ZYYX 1X32A 4B3RL 5E4WC 1WTQA 2Z1CA 3TDQA 4A3KG 1FGBD 3AYHB 4X3SA 5BN5A 1NSNS 4A3JG 2ZJQA 1KRSA 2O4XA 1Y1WB 3P75A 2E2HB 1STHA 5T1GA 3S2HH 1L1OA 1C7YA 3TP7A 1TWCB 5E1FA 3N52A 1JB7A 1F2LA 4RCOA 3CCEA 1X54A 1LT6D 2QCPX 1I4XA 4JYAL 1A3TA 1RL2A 3UDGA 5IWAQ 3NK9A 1HNXL 3DXJC 1GUGA 4TQUS 1AE2A 2C35B 4OWTB 2F4IA 1PTOB 4C3IB 2X6GA 1CA6A 2JA6G 4IZ8A 2RSNA 4IUNA 5BN3A 1DCZA 2BA1A 2R7FA 4XT3B 2K04A 2N8NA 3H09A 4EX5A 2PQEA 1V1PA 2NBFA 4YY3L 2CCZA 2JA5G 4G57A 4JBJA 3MAQA 1MBYA 2NZOA 1FGUA 5C5LA 1OXTA 1Y1WH 2E2HH 3F8TA 2EY5A 2MO1A 4FO2A 4NP5A 1TWCH 3ITPA 4DV7Q 1RF2D 2KCNA 3BYYB 4CBVA 3WOFA 2JSOA 3STBC 2F03A 3TBIB 2YV5A 1VQGA 4LF6L 4DUYQ 4CJ1B 1VQEA 2F0TA 2SDFA 3E9HA 3HKZE 2EXZA 1SNOA 4UP9A 3J80c 1JJGA 1EQVA 1U5KA 3K0YA 3LGJA 4X3UA 2KHIA 2ZT9C 2NVQH 4C3IH 2B2TC 3EIVA 5E4XA 1N33Q 1HCZA 1HXYD 4BXXG 1LLRD 2XTIA 1EIYB 1TIID 4IPHA 3CQZB 1SROA 1QVCA 4B9WA 4A93G 2UUBQ 2Z0SA 2VQFL 1I5FA 3SVMA 1GUWA 1KHIA 4FXGC 1GKHA 3I4MH 3PV0A 5LMNQ 1GJXA 1PH2A 3SK8A 1PH7A 2AWNA 4LW1A 2VL6A 1TS2A 3K8AA 1EUJA 1Z47A 5EKIA 3GV6A 1OXXK 3MEHA 5I2XA 4LF9L 3CRKC 4DV4L 4A3IB 1I50B 2KHSA 3BVMA 3PUXA 1CHPD 1Q8KA 4UY8C 5KNBA 3M3YB 2F3VA 4A4IA 4DV5Q 1YNJC 1RTOA 3GDEA 3VYTA 5FLMH 4IUPA 1YJNA 4K0KL 2B8GA 4C3JB 4KK7A 4LJZC 3CW2C 5J1ZA 4XQJA 5KGUA 3CQZH 3RD4A 2PNRC 1FNWA 1SYGA 1X3PA 4UDUC 5FO9B 1VQAA 3STBD 1SBBB 4HR7B 1O7IA 1BCPC 1E2ZA 4A3BB 1JB3A 3C1EA 1PZKD 3VYSA 3KLSX 2KHJA 4NW2A 3HOYH 1YEZA 2R7ZB 1PYWD 5IODA 4KY6A 2K5DA 1U0LA 4RH6A 4A3IH 4A3EB 3CC4A 3O13A 1DD2A 2AQ2B 2EIFA 1LTSD 1Q1BA 2AQ3B 4FNFA 4UP7A 3F2DA 4RKLA 1QJOA 5JAVA 3D0FA 2F0OA 2JE6I 3H91A 2O2LD 2R92B 2NN6H 2AKWB 3KDFA 2FFKB 1SXTA 2ZTEA 2HDLA 4C3JH 3J80E 3HOXB 4FF1A 1FYCA 2I0QA 1M8AA 4JI3Q 4KHPQ 2L1BA 4JI7Q 1CT1D 3NQIA 3T13A 3GTPB 3DWAA 4WORA 4BY1H 4IPCA 4A3LG 1I4PA 5FO8B 1JWMD 4DF7A 5I9PA 1ZEQX 2N49A 2ID0A 2FXQA 4A3BH 1Q81C 1HNZL 1PLFA 2IX3A 1YNJD 4I65A 2R7ZH 5KYIA 5BR8L 2A6EC 1B53A 5CC4A 1O7ZA 4GN4B 2M2LA 4KD3A 1G2SA 5M3MB 5FJ8G 1BBXC 1EYDA 1PDQA 3KF8A 1QVFA 3A8JE 1VQNA 2Z8LA 4GN3B 3T16A 4FXDA 4A75A 2R92H 2XIWA 1VQHA 2A1AA 1H95A 1AZPA 3W5OA 2AMCB 4R4OA 5IGFA 1A62A 3S9WA 1XMQL 3UDIA 3IFTA 3KJOA 1U4RA 5EKKA 1JOQA 4F87A 1HTPA 3GTPH 4A3DH 1BDOA 2O5JC 2TSSA 4DK1A 3CCMA 1LTGD 4KY5A 2C9OA 5LHY1 2CHBD 1ONLA 2XNAC 2B2VA 3KF6B 2YYZA 3J81c 1F77A 3HOWH 2DNCA 1XNRL 2NYZD 1VS0A 2EYPA 1V1OA 3E3XA 3N6RA 4BY7B 1PTOC 2KBNA 3UE1A 3HGBA 4J1MA 1I4QA 3EVQA 4DV0L 4O1NA 2IWHA 1B2TA 4C2MB 4LF7L 4LFBQ 3HZXA 3VA5A 4BBRH 3CXCA 1B9NA 3S2DH 1JOKA 1WTXA 2UXBQ 1STYA 4OIKA 1YBYA 4AYBG 2OCEA 2L4NA 1CQFA 4LF6Q 3C3LA 1EWHA 1I3QB 5G3LD 4YHHQ 4BA1I 2A74C 3MTSA 1BO0A 4NXMQ 4C3HH 4HJ8A 2CWPA 5KNDA 2A6ED 3DLLA 5GAGC 1KDAA 1X65A 3ICEA 5ELOA 5I4DA 3CCLA 5K36G 3I4NG 1DOKA 1XMOL 2EYFA 1VQOA 2D0OA 1RHPA 1E1OA 4BY7H 3BZKA 3TS2A 2RHQB 1NCVA 1G91A 4PMWA 2E75C 5CV9A 1TS5A 1PFBA 5CV8A 3CU7A 2XRSD 5CR3A 3ONAB 4UPAA 3A55A 1TU2B 1EOVA 2CQAA 3PIP3 4YWLA 1MGSA 4FF2A 2LSSA 4P74A 4L5SA 3HOUG 4RMFA 2MNAA 4WJ4A 2WIIB 3LX0A 4N9TA 1N36Q 1I3QH 1VQJA 4FP5D 4APVA 1GM5A 5J22A 3SK5A 5M5WB 1PTOD 4F7XA 3PIO3 3TP6A 5E7NA 5IYDG 2NTSA 2RKSA 4K0KQ 4JG2A 5JPMC 3F2BA 5M5XB 3PUYA 4K8JA 3Q22A 2PO4A 4DAYB 4RFBA 2F4VL 2RHSB 4F88A 3IL8A 4PMBA 3QIAA 1XWEA 4O0AA 4GNXA 3PMFA 3EQLC 2K32A 4P73A 1HR0L 1PZJD 1FJGL 1HZCA 4LAAA 1Y1VB 4LUVA 3EBEA 3A0JA 4A3CH 1B70B 4ALPA 4LF5Q 5A2QL 1SE2A 1PZID 4X64L 1HH2P 3VR6A 2E2DC 3GTMB 2A19A 3D6WA 2BH8A 4HN7A 4KMUC 2D2CC 4ABNA 5M5WH 4JBMA 4HIDA 2DJFC 1VMPA 1W2BA 4RGTA 2NTTA 3T1HL 1IBKQ 2UUCQ 1EU4A 4MTNA 4DV2Q 3S24A 3A56A 3OTOL 3U50C 1WTHA 1VQ8A 4RCNA 1A15A 4A3FB 4L8JA 3OW7A 4IALA 3SHLA 3DM1A 4X62Q 2J7ZA 4N9PA 5I6WA 1GO3E 3S1QB 4C56C 3QOJA 1VQ7A 2NWGA 2K14A 5C4XB 3AU7A 2C5CA 5HGQA 3VDYA 2MO0A 1MD2D 5K5PA 2VQEQ 4OIJA 2D5DA 2AWOA 4XQQA 4CDCC 3PO3H 3Q24A 4IUQA 1HA6A 2IT1A 1STGA 1VQPA 4UAIA 1J5EQ 2KOLA 5BR8Q 4RHRA 1P8LA 1F9RA 1EZ6A 4MZ9A 5IWAL 1FL0A 4X3TA 2WV6D 1GD7A 5DAUA 3HOZB 2RDGA 5D65A 2WACA 1W6JA 3S15B 3FRPB 5FLXc 4TSSA 3W1BA 1PXUA 4BBSB 5IYBG 3NP8A 2GA4B 2RDHA 4CHTB 4CDDC 4DAVA 4A3FH 1G6ZA 1T5XD 3NWTA 3QOLA 5C3EH 1CUKA 3S1QH 3W2DA 2EYOA 5C4XH 1H9SB 1XPOA 5FK9C 3K5NA 3JAMi 1SMYC 4DV7L 1PH8A 2PI2E 2BE5C 2JA7G 4NXNQ 2EYHA 5EAYA 3GTJH 1K73C 3OPOA 5C4JB 1SFOB 4DR2Q 4KLKA 2H4OA 4JI6Q 2QW7A 1ASZA 5M3FB 2R3ZA 1ICFB 1IBMQ 2A6HC 4HIKA 2VY3A 4WFN3 3HOZH 3FEWX 3P20A 4M1UB 1N33L 3VYUA 2PZUA 1IW7C 4ZYSA 3A74A 3E5SA 4BBSH 5CV7A 2CQOA 1WTVA 1Z7TA 2RCFA 1PH4A 3SK6A 4E6IA 2UUBL 1SRUA 4A3KH 5C3WA 1WTPA 2XSCA 1OXVA 5IGBA 1H9JA 1EWCA 5LMNL 3M4YA 1PH6A 1ILPA 4CKEA 1E0BA 3M4QA 4PZ8A 1E3PA 5DLQE 3TEHB 1LACA 1ENFA 1NUCA 1QCBD 5M5YB 1L0YB 1U4PA 2L12A 5C4JH 1A2UA 1SFOH 1Y8PB 2AUKA 5FKAC 1KDBA 2NZ1D 2F1MA 4TRDA 1LT3D 3I8ZA 3JAML 3H3VH 2PW7A 1JCKB 4DV5L 1WOCA 5JJKA 2B2YC 1OXSC 1KAAA 4P2CB 5JEAH 1BNZA 1LABA 1WD0A 1SYCA 4NPSA 1SNQA 1A0IA 1I4HA 1XTDA 2BE5D 2K50A 5FLXE 3QWNA 1EYAA 5IP7G 1YJWA 1HHVA 2OEOA 1HQMC 2L5TA 3ER0A 3CHBD 1D5ZC 5IP9H 2Z6KC 1CKMA 1SE3A 3HOVB 4OO1G 1EY7A 4DR7L 4ZLTF 1DJRD 3I73A 2A6HD 1TR5A 4MTKA 2R93G 1JORA 1EQTA 2D9UA 1K83H 3K57A 1D5XC 1M1KC 4LUZA 2MP1A 2BA0A 2NVYB 3K0XA 1IYJB 5M5YH 1XPUA 1RDPD 3LWUA 3M7GA 1ET9A 3TN2A 1LTTD 2GN5A 5LMNW 1E7ZA 1IW7D 1O80A 2CH4W 1TQOA 2DUDA 3KK7A 3S2HB 3FKIG 3T51B 2EE1A 1QUQB 2F0HA 3FVQA 4DKAC 4JV5Q 4ZKBB 1ET6A 4DXGA 3VR3A 3KDFB 4GLXA 1NY4A 2PYKA 4B3MQ 1W3SA 4JI3L 3U4VA 4KHPL 1V43A 3G6JB 3A7AB 5ELEA 4JI7L 2ICIA 1VQ6A 3J81j 3PIPA 2EJMA 1S40A 4GLVB 4OGQC 1S72A 1BQQT 3FP9A 3GD7A 3X3NA 2K5HA 1D1KA 2Q2IA 3HOVH 4IJHA 2IPKD 3NPPA 3K7AH 3PIOA 4YWKA 1ICWA 1Q90A 1S5DD 5IGGA 3OWFA 5IT9c 4GOPA 2CVRA 3JC66 4OWWB 1A3VA 2M00A 3MHBA 3BZCA 2NVYH 1CI3M 1HNWQ 3RMHA 4HMIA 5ISRA 1D1IA 4OONA 1ZXTA 1SJHD 1SLJA 5C4ZA 1GUTA 2WB1G 2UUAQ 3L2PA 1QZHA 4DAPA 2G5DA 2MJ8A 4POFA 2ZM6Q 1L1OC 3UDFA 1EIFA 4KHZA 4K6LA 4JPBW 1BOSA 2CH4A 1SYFA 2CKZB 1TWFB 3BDOA 4LUOA 1AW7A 2NVQB 4WJ3M 2XGTA 1EEFD 4P71A 1NJIC 3H0GG 1Z9FA 2A69C 2DN8A 1QWYA 4OXPA 3J80i 1QG7A 4DNIA 5EPKA 2K5VA 5LL6S 5D3IB 1K8MA 1ZKOA 5CGKA 3NTHA 2BOSA 4RA8A 3I4MB 1CKOA 3DMUA 4JCVE 5I6YA 1J8IA 2UXDQ 5D14A 3MXNA 5NUCA 2H5XA 4IURA 4QUCA 4LFBL 2DNEA 1K3BC 3DUZA 5C0XG 3DM3A 2QEXA 1A6XA 4IFDG 2UXBL 2QEJC 4HCEA 4G7ZC 2JEAI 1B3QA 5KEEA 2F3IA 4A3MB 1VQCA 5C44G 4YHHL 4NXML 1JJ2A 1TWFH 3LNNA 3I4LA 5C4HA 2QF7A 4ZUJA 1VMCA 3EJIA 4J8QA 3BDLA 3H3VC 1JQYD 1DZ1A 3I70A 3SEBA 4ME3A 1Q3LA 1GHKA 3RR5A 4GS3A 2IL8A 1EU3A 1FR3A 1A63A 2AQ1B 1CKNA 1CTMA 3HKZG 1TT2A 2I5LX 2K75A 5M9OA 4JBKA 5IT9E 3I3CA 2MQHA 1SMXA 2EY1A 5F2DA 5FJ8H 4FF3A 2CW0C 2B2WA 3M9BA 4H44C 1IL8A 2JA8B 5CV4A 3J80L 4I7ZC 3CF5A 3HOYB 3S14B 3RUZA 4KKSA 2N55A 1EY9A 1UEBA 3MA2B 3NSWA 1LYLA 1VQ5A 3GTKB 1ILQA 4JI4L 3C46A 1K8OA 1YZ6A 1N36L 4A3MH 1IL2A 1N32Q 2HIVA 3CPWA 5GAHC 2I07B 2F0FA 3I4OA 1Q8IA 3SE0A 1KQSA 3MEFA 2HD3A 3OHXC 3J7A5 3BZDB 3ZJYC 4IPGA 4BY1B 2RSOA 2NZHA 3CCSA 4DAMA 2R61A 4DV3Q 1CFMA 4R4TA 4DR7Q 2PMZB 3VA7A 2JA8H 1BBUA 2JYOA 1HUNA 2IJ0A 3S14H 3K6OA 4XYOA 1H9RA 1UAPA 1HZBA 3L3OC 3D4RA 4C1NI 4CJ0B 5KIXA 3T4AC 5AJ3Q 3S16B 2UXCQ 3D6CA 4GKKQ 4LF5L 3BS1A 1U4MA 3GTKH 5I9OA 1DM0B 1CM9A 3C1FA 4XDXA 3AFPA 2Q2TA 1MSGA 3GP7A 4A3GB 2PCFB 3BYTB 1IBKL 2UUCL 4DV2L 1NMGA 3DWQA 1S4ZA 4EVOA 3G6EA 2Z4IA 3F2UA 3I4NH 1W6KA 2G9DA 4A3DB 3TP5A 2A8VA 3NHHA 2HIXA 3E6ZX 2XN9C 5I2YA 4X62L 1Y1WG 4WJWA 4LF8L 2IHFA 2K52A 1EFWA 4LMQD 1TWGB 3A8KE 2VQEL 1B9MA 3HOWB 1L0WA 2Q2HA 3D4WA 4QIWE 1J5EL 2B63B 1K0RA 3S16H 3L0OA 3H15A 3RNUA 5L37A 4NB3A 4XQNA 3J81i 3QG1A 1WTOA 2E76C 2JQOA 1CHQD 4C3IG 4BS9A 4A3GH 1MJCA 2IX0A 3P7JA 4JOIA 4BBRB 1B50A 3S2DB 1VQBA 3U4ZA 5DM63 1BCPD 2E2IH 4RHSA 1KNEA 1STBA 5J39A 2MFIA 3ULJA 1SNPA 1YJ9A 2Q8TA 2EPBA 4C3HB 1F9QA 3MFYA 4NMZA 1PH9A 4LF4Q 2Y0SB 1HQRD 3I72A 1G2TA 1R4PB 3CCQA 2OXPA 3CC2A 4FXKC 1TWGH 1N34Q 1EQRA 4NXNL 3TZUA 4GKJQ 1STNA 3A54A 3NELA 2B63H 4H0LC 4DR2L 4JI6L 5EJWA 1X55A 5D3DA 2WKCA 1TWAB 1PVOA 5FLMG 1Q12A 1IBML 3A5ZB 1K8GA 4IUTA 2JK8A 5FOBB 4DR3Q 4M8AA 3ERSX 2H1EA 2MUYA 4ZCKA 3G71A 5DEHA 3J81L 1JC7A 2LMCB 2K1BA 4L6TB 3Q0AA 4X6AH 3AFQA 4J6HA 3PSIA 2TMPA 4QJFA 2CFMA 5LL6X 1HPCA 4AYBE 1DOLA 4R8IA 4HIMA 5COYA 4IN3A 4DR4Q 1O7LA 2K33A 1EYCA 3NUCA 3BG3A 4YCWA 1D2BA 3PO2B 5CMDA 4A3IG 1SE8A 2I5MX 2A5HA 2WAQB 4CGYB 1PV4A 2HHHQ 5BN4A 1KXLA 1PYBA 1TWAH 2NN6G 1HUMA 1XNQL 3OOCA 5HY6A 4C3JG 5GADC 2LS01 1PRTF 2PMZE 1XYIA 1KLGD 3KYHC 1BF4A 2F0LA 4YWMA 4JI4Q 2N78A 2VUMB 5IYBH 4JBWA 1KIXA 1B44D 3F1ZA 4A3BG 4B08A 5C3XA 4K5WA 1RCVD 4V0BA 1N9WA 3TP8A 4TKOB 1AZQA 2PNHA 1YITA 2JA7H 2R7ZG 1A2TA 4A3EG 3PO2H 2WKDA 5ELFA 3S17B 3J81E 4IUUA 5C0XJ 4IFDJ 1LTLA 1WJJA 3A8IE 1BUVT 3DHQA 5J3BA 1WD1A 3OYYA 2R92G 1EY5A 5FO7B 1PYSB 4HCSA 1SR3A 4U673 1V1QA 3I91A 4JV5L 3TRZA 3HOXG 1JJCB 5CV6A 5IYCH 3PO3B 2L9HA 4B3ML 2OQKA 3AQQA 4N8FA 4CKBA 2K4KA 3CAMA 1MSHA 1D8LA 3DEPA 1LTAD 4LFCQ 1X3QA 1X9NA 2EQSA 4PMCA 2KVMA 4X65L 5JVH3 4LFAL 3H6MA 4NKLA 2VUMH 1QVGA 1QNUA 1U9RA 3D8GA 1WCMB 3HRZC 4XXEA 1U4LA 4L5TA 4DV1Q 1IYUA 4DR6Q 4OO1I 4K2LA 2B39A 4AQYQ 4POGA 1QE6A 1EYGA 4GN5A 1ENAA 2YTVA 1JR0D 4GOPB 1TY0A 3FHWA 3S17H 3MXUA 3MXGA 2FHTA 1AE3A 5M3MG 1HNWL 3NEMA 5C3EB 4DR1Q 1KRTA 4LF8Q 1SNCA 1QILA 2EVBA 2LXKA 3NTKA 1X3EA 1L1OB 4MN3A 5JPNC 2F0GA 2EY6A 2A73B 4PZ6A 2Y0SE 2UUAL 3GTJB 3KLRA 4HEDA 3NXWA 1DONA 3PF5A 4EGVA 4ME5A 4JI5L 2ZM6L 1RODA 1X56A 3T56B 1F9PA 1JMCA 3GTGB 3RZDB 1WCMH 1K0SA 1HR0W 3J7AV 4R8NA 4OO1H 4JC0A 4H13C 2F0SA 4CKCA 3F2CA 2SOBA 2K6AA 4BY7G 1YHAA 4K6DA 1JT8A 3GO5A 1V1PB 4A3KB 1WI5A 2XVSA 4A3JB 2F52A 4G7OC 1PA6A 3KFUA 1KTKA 2F0MA 2UXDL 2A68C 1HZ9A 1UNSA 1Y8OB 4Y7NH 3FKIH 5JVG3 3BVGA 4R9WA 4DNRB 1NNXA 3ULPA 3R2IA 5HURA 1RKNA 2KCMA 2Z4HA 1D7QA 5FLXL 1EWIA 1A8VA 4Q0FA 2B2UA 2WAQE 4ZQ3A 3FMCA 5C5MA 1PH3A 3CD6A 3GTGH 3RZDH 2F0PA 1GXDC 5IGDA 3K59A 3KLSA 1EQQA 2JA6B 4K8IA 4S3SA 1SSOA 3PGZA 4R4IA 2ENBA 4JI0Q 1KC8C 3EN2A 3U58A 5GQOA 4HJ9A 4B3SL 2F0WA 1CKNB 2JA5B 4A3JH 2E8GA 1PMRA 3CMAA 4IO9A 1AFPA 2WINB 4CJ2C 1WFQA 1ZYRC 3S1RB 4G4KA 2Q8IB 4J15A 5ELCA 2HQEA 4XIGS 1BVSA 3VR4A 2VNUD 2O5IC 2KECA 4DN4M 1K83B 4JW0A 5C0XI 4A3CG 4O2DA 2JN4A 4IFDI 1JE4A 2EJFC 1GUNA 2KA7A 1OXUA 4RG1A 2ZJRA 2F0UA 1XX8A 4CDFC 1XNQQ 1N32L 2KEEA 1NR4A 3TQYA 1O7YA 3CCJA 2JA6H 2ATWA 3A7LA 3HFZB 4QMGA 2F0DA 2OT2A 3V96A 1V8QA 1SMYD 5JJZA 1KL9A 5KNCA 4A93B 1II3A 1F9SA 2JA5H 1VQFA 4KJOA 3T1YQ 3UDXA 4JI2Q 2MHVA 3T53B 2E5LQ 1S5BD 5GROA 3MFGA 4DV3L 2KENA 4ULLA 2K5NA 3S1RH 3K7AB 1VQMA 3EFXD 1VQ4A 2Z9HA 1UEAB 1LTRD 1E22A 1Y1VG 1G8ZD 4DV6Q 4ZUIA 5AJ3L 2I5HA 2UXCL 1D5MC 4GKKL 3CKIB 2HCCA 1CSQA 2HCIA 2K5WA 5IIFA 1FVIA 2E74C 2JP1A 2XWBB 4KJNA 1LUZA 4H7BA 4JK1C 4HJ7A 1R9TH 5KRUA 4I7AA 1EY4A 1Q82C 4DAYA 1V9PA 2DY7A 2ASBA 5JJLA 1ZYRD 2VZAA 4BXXH 1F2MA 4A3FG 4X65Q 3VYRA 4LFAQ 4A93H 2G9HD 1HJPA 3QB3A 1MJEA 4EQ5A 2PPBC 2RQXA 5C4XG 3E9IA 1IBLQ 2RVLA 4DU9A 1J9OA 2NVXB 1IKMA 4G7HC 3C2PA 2BDNA 2WP8J 3VR5A 4JI8Q 3OMGA 2KCCA 4MIUA 3SXHA 1EY8A 1QNKA 1ML0D 1Y14B 1CZGA 1WTRA 3W1GA 5A35A 1B8AA 2DGYA 5AFWA 4GOPC 2ZTCA 3KF8B 2ICEC 4DR5Q 2ES2A 4ZK9B 3HOZG 3NQTA 4K14A 1D6EC 4AIMA 1VQKA 2EXDA 5CYUA 3K58A 3BU2A 1LTBD 1MHWC 4JI1Q 4BBSG 4KV6A 2WB1E 1QOHA 2VXWA 4JI5Q 5IT9L 2RBMA 2JEBI 5G3LF 4EQPA 2KCTA 1AH9A 1JWSD 2RDFA 4FF4A 4LF4L 1SYDA 3NBHA 3DEOA 1G6PA 2KJXA 2NVXH 4QIWB 3CMEA 1N34L 1B7YB 2YTXA 4F8MA 4GKJL 2PZTA 5EBCA 2OTLA 2NVTH 3D31A 1A3UA 3K7UC 4HIOA 3NBIA 1I94Q 1HFNA 5M3FG 2HQLA 1LV9A 5EPJA 2FJ2A 1HFGA 5JEAG 1NBWA 4DR3L 5LMUQ 3R2TA 1EIHA 3M4OH 5E3FA 1TWHH 1DOMA 1B4OA 3OWEB 1X6OA 3GQBA 3WWVA 5T1IA 3CRLC 5EKLA 2IHEA 4UP8A 5IP9G 4A3LH 3AMUA 1PTOF 2VB3X 2OTJA 4DR4L 1H9SA 2B3GA 4IJLA 4DNTB 4LWCA 2BH2A 1JOOA 1K8AC 4L63B 2DY8A 3TREA 4XT1B 4B3SQ 2FINB 2PZWA 2B2TA 3SDZA 2K5QA 4BA2I 1XPRA 4MNOA 4ODGA 5ELNA 4X66Q 2HHHL 3K5LA 1NE3A 2QKIC 4YIJA 4B3TQ 1C8CA 3U9OA 4R1JA 2Z6BA 1OTCA 1JE5A 2B29A 1PTOH 3UE0A 3CP0A 3CCRA 1I4RA 2AHOB 4Y52H 2EYMA 2L11A 4OL7A 5DNFA 2B2WC 1G51A 2KUMA 3RLFA 4AYBB 3AEVA 1C0AA 3KUPA 1PFSA 1OO9B 2B8FA 4ID6A 2A69D 1X3GA 3J7ZC 4X3KA 1F2ZA 1AN8A 3HOVG 4QB4A 3PF4A 3R3OA 1R4QB 4HAEA 5CV5A 3Q23A 1YNNC 1YHBA 3OSOA 4KN7C 3CCUA 3MC0B 3I4NB 1PH1A 3PUVA 1H9KA 4R4CA 1RD9D 1UE1A 3HS0C 1VQLA 1SNDA 4RAUC 2QA4A 1UE6A 2CWAA 3TS0A 3PUWA 1P16A 3K5MA 3SGIA 2UU9Q 3URYA 2NN6I 4GNXB 1Q46A 4GZYC 1STAA 1DYQA 4L5QA 1JWUD 1WVLA 3HOUB 5JJIA 4LFCL 2RF4A 2DJGC 2F0VA 3P1HA 2V1CC 3KBXA 1IHZA 1LTID 2K28A 3VR2A 4DV1L 1FNUA 4DR6L 3MWYW 2PQAA 1H9MA 3OIQA 4AQYL 2CW0D 1VQIA 4PZ7A 1Q1EA 2GVBA 2E2IB 5K36H 4OWXB 1EL0A 1KAWA 2ZXPA 5DM73 1I50H 3K80C 2KQ3A 1HRJA 3BJUA 3M3YH 1CQVA 4DR1L 4HSPA 5EGTA 1QUQA 3S1NB 3X3MA 1YVCA 2QDBA 1B1ZA 2EYLA 2K7VA 1VDZA 3FDTA 1SAPA 2M9VA 1SDFA 4KKUA 1EIGA 4HJAA 1FD7D 3HOUH 1GUSA 1YNND 4DUZQ 1PHJA 1S5ED 3NWSA 1B3AA 5C6AA 2L0CA 2ZTDA 4DK0A 2GVAA 5IYDH 1VQ9A 3J7AF 1WTWA 4B3RQ 1LM0A 2L55A 3R8BA 4A3EH 3KLWA 1I6VC 4H02A 4JOIC 2LKVA 1HTLD 3I4MG 1L2FA 1DXMA 1KNAA 3QJYA 1LT5D 1IKLA 3S1NH 1T5EA 3HOXH 3L9AX 4EQOA 4JYAQ 4DGZA 4A76A 2F0EA 4TVAB 1NMFA 3SR1A 1UE5A 1HNXQ 2P5ZX 4A3MG 2B2VC 1Y69U 3I7FA 1EOTA 2XRQD 1F2YA 3IKJA 3IAYA 4JVZA 5HGTA 1CSPA 3IFDA 4ZRZA 1QB5D 3J7YW 4RWSC 1TY2A 4JI0L 5IGEA 4YY3Q 3HP3A 1SYEA 3GV3A 5GAEC 4DPGA 3G4SA 5M3MH 2JXMB 4XTCS 4DFAA 4KN4C 2JA8G 1ENCA 3AB9A 1QZGA 2LY7A 2SNSA 3HOYG 3RZOB 1VQDA 3D4DA 5KYLA 2JA7B 4DA2A 2OWOA 1XXGA 1PRTB 1CK1A 1J6QA 5IE8A 1HZAA 2LFNA 2WFWA 1XJVA 1NR2A 3OMCA 3I90A 1EZ8A 3KBGA 4KHVA 2SNMA 3EA6A 2ZXOA 4L5RC 3E0EA 1ESFA 3PQIA 5H1SE 4QUFA 4PNYA 1VF5C 3R93A 1PH5A 1MI2A 3U9SA 2RCNA 4BY1G 2PW5A 2EYJA 4K5VA 1X3FA 2VQFQ 1SNMA 3T1YL 4N8X1 4QF4A 3CCVA 4JI2L 2E5LL 1YI2A 2EJGC 4RGNA 2JA9A 4KTAA 4NDXA 1C4QA 2EY2A 4C2MH 4LF9Q 3RZOH 1K9MC 4DV4Q 1GOZA 1EEID 3IRBA 4AH6A 4DV6L 3H94A 5JEAJ 1NTGA 3ND9A 1TS4A 2F0QA 1VCIA 1KLUD 3FPUB 2ZJPA 2F3WA 2QDLA 2E2JB 4PV1C 1Y8NB 5IGCA 1SN8A 4A3GG 4V190 3PCOB 3ND8A 2OF1A 4P72A 1XTCD 3BVZA 4LNQA 4Z9CB 4GNXC 3GTOB 1T9HA 4A3DG 2IX1A 1AEXA 2FMMA 2BDOA 5CBEE 2X69A 3OW2A 3S1MB 3G48A 1DGSA 1IBLL 1RTNA 1CA5A 1KD1C 3HOWG 2D62A 4JI8L 1STEA 5ELDA 2R93B 3WDNA 2B63G 4OX9L 1S5CD 1I4GA 1SE4A 4HMJA 2K01A 4C1NK 3G7LA 2E2JH 2Q8RE 3NENA 4Y7NB 1EY0A 2N3SA 1UUPA 3FKIB 1NAPA 4DR5L 2EDGA 4BBRG 3HEJA 4R4QA 5M5XH 2I46A 3V2TA 1O78A 4JI1L 4KD4A 2F0NA 2VS1A 3GTOH 1BKBA 2YTYA 4RKBA 1L0XB 4RGOS 3RLOA 3I56A 5IP7H 4C3HG 3QR8A 2Y0SG 4HSVA 3MXPA 3I55A 1SEBD 2IY5B 3S1MH 4O42A 3NBHB 1HNZQ 1YHQA 4K2KA 1TVXA 3V05A 4P75A 1TKWB 1Y1VH 3M85A 3K5OA 2R93H 2KEDA 1FNVA 1JICA 2QILA 1LO5D 4GLAC 4EQNA 4LK1C 1I94L 3ULLA 2RA4A 1UE7A 1MIUA 3LWEA 3GTMH 1GUOA 1M90C 2EOTA 1K28A 4K5XA 1Q86C 3MXNB 2YU9B 4IOAA 5LMUL 2WB1B 3TSSA 4B9XA 1XMQQ 1EY6A 1RIPA 4HJ5A 3I2ZA 5A2QE 4MHEA 3MVVA 2ZXRA 2VB2X 1SJED 4IUVA 1ESRA 1SYBA 2ALYB 2J4XA 2L15A 1BBWA 3KF6A 1C9OA 1ASYA 3PO2G 1I6HB 1XNRQ 1HA5A 3H0GB 2B2UC 3EROA 2F0KA 3SK4A 3W3AA 2WAQG 2NB0A 1YNXA 1Z6HA 4Q5VA 1E24A 3FPPA 4KY7A 4X66L 4DK6C 2HT1A 4DUYL 4IQZA 4YCVA 3H3VI 5EQ0A 2X6LA 4B3TL 4DV0Q 1E1TA 4FDBA 5CORA 1UWVA 4LF7Q 5IYCG 2YU9H 2XWJB 1TXYA 5JOBA 1WYDA 2FMCA 2R6GA 3S15H 1IXRA 2HUGA 4OELB 3OIPA 1K3RA 2R7DA 1BXTA 1IZ6A 3CPFA 3JAMc 2VUMG 3WOEA 4OEMB 1G291 4CDEC 1S5FD 2PI2A 1PRTC 5C44B 1MKHA 2SEBD 1R9TB 3BDCA 3KJPA 1PFMA 3CC7A 2LXJA 2EZVA 2OQ0A 4QCLA 4QY7A 2K05A 4QQBX 1GVPA 4KKTA 1I6HH 4UHVA 2A68D 1XMOQ 3H0GH 5CBAE 2B2YA 1GHJA 2VW9A 3MZ5A 3HKZB 1E2VA 2D0PA 3RN2A 4XYQA 5M3FH 4ILWA 1KABA 4YCUA 4QL5A 2Q2UA 2UU9L 2F0IA 4OHJA 3TZDA 2BCOA 2MGSA 3PO3G 4PG3A 3ERQA 1EFID 2Z6KA 3E0JA 3RN5A 5C0XH 1CZWA 4KI0A 4IFDH 2MPMA 1YIJA 5IY0A 1BCPB 3TMEA 1WCMG 3GTLB 5C44H 1S3OA 3M7NA 1IYVA 4FYDA 3NTIA 2V4DA 4DXFA 1M4VA 2F0JA 1RJTA 3GTQB 5ELBA 3B6YA 5IOCA 2PQAB 4ZKCB 3A5UA 1BCPF 2HDMA 2K03A 1N8RC 4HTHA 2F4VQ 3NE5B 1BR9A 1C48A 2IW3A 3UI2A 2AUJD 2J0TD 2NUCA 4QGUA 5C3EG 1KDCA 4U68A 3QO2A 1Q7YC 3DWPA
chains in the Genus database with same CATH topology
1TS3A 3L7ZC 1LT4D 1PRTD 3HG9A 5EBDA 1PFNA 4PQXA 2NVTB 1E2WA 2N88A 1VF7A 5EPLA 3PUZA 5TSSA 4BWGB 4ZAIA 3JAME 3Q6SA 4RGMA 3D3RA 4FVMA 1AP0A 4WRDA 3M4OB 1TWHB 3ZYYX 1X32A 5E4WC 1WTQA 2Z1CA 3TDQA 1FGBD 4X3SA 5BN5A 1NSNS 2O4XA 1Y1WB 3P75A 2E2HB 1STHA 5T1GA 3TP7A 1TWCB 5E1FA 3N52A 1F2LA 4RCOA 1LT6D 2QCPX 1I4XA 1A3TA 3NK9A 3DXJC 1GUGA 4TQUS 2F4IA 1PTOB 4C3IB 2X6GA 1CA6A 4IZ8A 2RSNA 4IUNA 5BN3A 1DCZA 2BA1A 4XT3B 2K04A 3H09A 2PQEA 1V1PA 2NBFA 4G57A 3MAQA 1MBYA 5C5LA 1OXTA 2EY5A 4FO2A 4NP5A 3ITPA 1RF2D 2KCNA 3BYYB 4CBVA 3WOFA 2JSOA 2F03A 3TBIB 4CJ1B 2F0TA 2SDFA 2EXZA 1SNOA 1EQVA 3K0YA 4X3UA 2ZT9C 2B2TC 5E4XA 1HCZA 1HXYD 1LLRD 1TIID 3CQZB 4B9WA 3SVMA 1GUWA 4FXGC 3PV0A 1GJXA 3SK8A 2AWNA 1TS2A 1Z47A 5EKIA 3GV6A 1OXXK 3MEHA 5I2XA 3CRKC 4A3IB 1I50B 2KHSA 3BVMA 3PUXA 1CHPD 5KNBA 3M3YB 2F3VA 1YNJC 1RTOA 3VYTA 4IUPA 2B8GA 4C3JB 4KK7A 4LJZC 5J1ZA 4XQJA 5KGUA 3RD4A 2PNRC 1FNWA 1SYGA 1X3PA 4UDUC 5FO9B 1SBBB 4HR7B 1BCPC 1E2ZA 4A3BB 1JB3A 3C1EA 1PZKD 3VYSA 3KLSX 4NW2A 2R7ZB 1PYWD 5IODA 4KY6A 2K5DA 4RH6A 4A3EB 3O13A 1DD2A 2AQ2B 1LTSD 1Q1BA 2AQ3B 4FNFA 4RKLA 1QJOA 5JAVA 2F0OA 2JE6I 3H91A 2O2LD 2R92B 2NN6H 2FFKB 1SXTA 4FF1A 2HDLA 3J80E 3HOXB 1FYCA 1M8AA 2L1BA 1CT1D 3NQIA 3T13A 3GTPB 3DWAA 4WORA 1I4PA 5FO8B 1JWMD 4DF7A 5I9PA 1ZEQX 2ID0A 1PLFA 2IX3A 1YNJD 4I65A 5KYIA 2A6EC 1B53A 5CC4A 1O7ZA 2M2LA 4KD3A 1G2SA 5M3MB 1BBXC 1EYDA 1PDQA 3KF8A 3A8JE 2Z8LA 3T16A 4FXDA 2XIWA 1AZPA 5IGFA 3S9WA 3IFTA 1U4RA 5EKKA 1JOQA 4F87A 1HTPA 1BDOA 2O5JC 2TSSA 4DK1A 1LTGD 4KY5A 2C9OA 5LHY1 2CHBD 1ONLA 2XNAC 2B2VA 2YYZA 1F77A 2DNCA 2NYZD 2EYPA 1V1OA 3N6RA 4BY7B 1PTOC 3HGBA 4J1MA 1I4QA 3EVQA 4O1NA 2IWHA 1B2TA 4C2MB 3HZXA 3VA5A 1B9NA 1JOKA 1WTXA 1STYA 4OIKA 2L4NA 1CQFA 3C3LA 1EWHA 1I3QB 5G3LD 4BA1I 2A74C 3MTSA 1BO0A 5KNDA 2A6ED 1KDAA 5I4DA 5K36G 1DOKA 2EYFA 1RHPA 1NCVA 1G91A 4PMWA 2E75C 5CV9A 1TS5A 1PFBA 5CV8A 3CU7A 2XRSD 5CR3A 3ONAB 3A55A 1TU2B 2CQAA 3PIP3 4FF2A 1MGSA 2WIIB 3LX0A 4N9TA 4FP5D 5J22A 3SK5A 5M5WB 1PTOD 4F7XA 3PIO3 3TP6A 2NTSA 2RKSA 5JPMC 5M5XB 3PUYA 4K8JA 3Q22A 2PO4A 4RFBA 4F88A 3IL8A 4PMBA 3QIAA 1XWEA 3PMFA 3EQLC 2K32A 1PZJD 4LAAA 1Y1VB 5A2QL 1SE2A 1PZID 3VR6A 2E2DC 3GTMB 3D6WA 4HN7A 4KMUC 2D2CC 4ABNA 1VMPA 4RGTA 2NTTA 1EU4A 3A56A 4RCNA 1A15A 4A3FB 4L8JA 3OW7A 4IALA 3SHLA 3DM1A 2J7ZA 4N9PA 5I6WA 3S1QB 4C56C 3QOJA 2NWGA 5C4XB 3AU7A 2C5CA 1MD2D 5K5PA 4OIJA 2D5DA 2AWOA 4XQQA 3Q24A 4IUQA 1HA6A 2IT1A 1STGA 4UAIA 2KOLA 4RHRA 1F9RA 1EZ6A 4X3TA 2WV6D 5DAUA 3HOZB 2RDGA 5D65A 2WACA 1W6JA 3S15B 3FRPB 4TSSA 1PXUA 4BBSB 3NP8A 2GA4B 2RDHA 4CHTB 4DAVA 1G6ZA 1T5XD 3NWTA 3QOLA 3W2DA 2EYOA 1H9SB 5FK9C 3K5NA 1SMYC 2BE5C 2EYHA 3OPOA 5C4JB 1SFOB 2H4OA 5M3FB 2R3ZA 2A6HC 4WFN3 3FEWX 3P20A 4M1UB 3VYUA 2PZUA 1IW7C 4ZYSA 3E5SA 5CV7A 1WTVA 1Z7TA 3SK6A 4E6IA 5C3WA 1WTPA 2XSCA 1OXVA 5IGBA 1H9JA 1EWCA 3M4YA 1ILPA 4CKEA 1E0BA 1LACA 1ENFA 1NUCA 1QCBD 5M5YB 1L0YB 1U4PA 2L12A 1A2UA 1Y8PB 2AUKA 5FKAC 1KDBA 2NZ1D 2F1MA 4TRDA 1LT3D 3I8ZA 3JAML 2PW7A 1JCKB 2B2YC 1OXSC 1KAAA 4P2CB 5JEAH 1BNZA 1LABA 1WD0A 1SYCA 1SNQA 1I4HA 2BE5D 5FLXE 3QWNA 1EYAA 1HHVA 2OEOA 1HQMC 2L5TA 3CHBD 1D5ZC 1SE3A 3HOVB 4OO1G 1EY7A 4ZLTF 1DJRD 3I73A 2A6HD 1TR5A 1JORA 1EQTA 2D9UA 3K57A 1D5XC 2MP1A 2BA0A 2NVYB 1RDPD 3LWUA 3M7GA 1ET9A 3TN2A 1LTTD 1IW7D 1O80A 3KK7A 1TQOA 3S2HB 3T51B 2EE1A 2F0HA 3FVQA 4ZKBB 1ET6A 4DXGA 3VR3A 2PYKA 1V43A 3G6JB 3A7AB 5ELEA 2ICIA 2EJMA 4OGQC 1BQQT 3GD7A 3X3NA 1D1KA 2IPKD 3NPPA 1ICWA 1Q90A 1S5DD 5IGGA 3OWFA 2CVRA 1A3VA 2M00A 3MHBA 1CI3M 3RMHA 4HMIA 5ISRA 1D1IA 1ZXTA 1SJHD 5C4ZA 1GUTA 4DAPA 2MJ8A 4KHZA 4K6LA 1BOSA 1SYFA 1TWFB 3BDOA 1AW7A 2NVQB 1EEFD 2A69C 2DN8A 1QWYA 1QG7A 5EPKA 5LL6S 5D3IB 1K8MA 1ZKOA 5CGKA 3NTHA 2BOSA 4RA8A 3I4MB 5I6YA 3DMUA 1J8IA 5D14A 3MXNA 5NUCA 4IURA 4QUCA 2DNEA 5C0XG 3DUZA 1A6XA 4IFDG 2QEJC 4HCEA 4G7ZC 2JEAI 5KEEA 4A3MB 3LNNA 3I4LA 5C4HA 2QF7A 4ZUJA 1VMCA 3EJIA 4J8QA 3BDLA 3H3VC 1JQYD 1DZ1A 3I70A 3SEBA 1GHKA 1Q3LA 2IL8A 1EU3A 1FR3A 2AQ1B 1CTMA 1TT2A 5M9OA 5IT9E 3I3CA 2EY1A 5F2DA 4FF3A 2CW0C 2B2WA 4H44C 1IL8A 2JA8B 5CV4A 3J80L 4I7ZC 3HOYB 3S14B 3RUZA 4KKSA 2N55A 1EY9A 3MA2B 3NSWA 3GTKB 1ILQA 3C46A 1K8OA 2I07B 2F0FA 1Q8IA 3SE0A 3OHXC 3BZDB 4BY1B 2RSOA 2R61A 1CFMA 2PMZB 3VA7A 2JYOA 1HUNA 2IJ0A 3K6OA 4XYOA 1H9RA 1UAPA 4CJ0B 3L3OC 3D4RA 4C1NI 5KIXA 3T4AC 3S16B 3D6CA 3BS1A 1U4MA 5I9OA 1DM0B 1CM9A 3C1FA 4XDXA 1MSGA 3GP7A 4A3GB 2PCFB 3BYTB 3DWQA 1S4ZA 4EVOA 2Z4IA 3F2UA 1W6KA 2G9DA 4A3DB 3TP5A 3NHHA 3E6ZX 2XN9C 5I2YA 4WJWA 4LMQD 1TWGB 3A8KE 1B9MA 3HOWB 3D4WA 2B63B 4XQNA 3QG1A 1WTOA 2E76C 1CHQD 4C3IG 4BS9A 2IX0A 3P7JA 4BBRB 1B50A 3S2DB 5DM63 1BCPD 4RHSA 1KNEA 1STBA 5J39A 1SNPA 2Q8TA 2EPBA 4C3HB 1F9QA 3MFYA 4NMZA 2Y0SB 1HQRD 3I72A 1G2TA 1R4PB 2OXPA 4FXKC 3TZUA 1STNA 3A54A 4H0LC 5EJWA 5D3DA 2WKCA 1TWAB 1Q12A 4IUTA 5FOBB 4M8AA 2H1EA 2MUYA 5DEHA 3J81L 1JC7A 2LMCB 2K1BA 4L6TB 3Q0AA 4J6HA 2TMPA 5LL6X 1HPCA 1DOLA 4R8IA 5COYA 4IN3A 1O7LA 2K33A 1EYCA 3NUCA 3BG3A 1D2BA 3PO2B 5CMDA 2A5HA 2WAQB 4CGYB 5BN4A 2NN6G 1HUMA 3OOCA 4C3JG 2LS01 1PRTF 1XYIA 1KLGD 1BF4A 2F0LA 2VUMB 4JBWA 1B44D 4B08A 5C3XA 4K5WA 1RCVD 4V0BA 3TP8A 4TKOB 1AZQA 1A2TA 2WKDA 5ELFA 3S17B 3J81E 4IUUA 5C0XJ 4IFDJ 3A8IE 3DHQA 1BUVT 1WD1A 1EY5A 5FO7B 4HCSA 4U673 3I91A 5CV6A 3PO3B 2L9HA 4CKBA 1MSHA 3DEPA 1LTAD 1X3QA 4PMCA 5JVH3 2KVMA 3H6MA 4NKLA 1QNUA 1U9RA 3D8GA 1WCMB 3HRZC 4XXEA 1U4LA 1IYUA 4OO1I 4K2LA 2B39A 1QE6A 1ENAA 1JR0D 1TY0A 3MXUA 3MXGA 2FHTA 5C3EB 1SNCA 1QILA 2EVBA 3NTKA 4MN3A 5JPNC 2F0GA 2EY6A 2A73B 3GTJB 3KLRA 4HEDA 3NXWA 1DONA 4EGVA 4ME5A 1RODA 3T56B 3GTGB 1F9PA 3RZDB 3J7AV 4R8NA 4OO1H 4H13C 2F0SA 4CKCA 2SOBA 2K6AA 4K6DA 3GO5A 1V1PB 4A3KB 2XVSA 4A3JB 4G7OC 1KTKA 2F0MA 2A68C 1UNSA 1Y8OB 5JVG3 3BVGA 4R9WA 4DNRB 3R2IA 5HURA 1RKNA 2Z4HA 5FLXL 4Q0FA 2B2UA 4ZQ3A 3FMCA 5C5MA 2F0PA 1GXDC 5IGDA 3K59A 3KLSA 2JA6B 4K8IA 4S3SA 1SSOA 2ENBA 2F0WA 2JA5B 1PMRA 1AFPA 2WINB 4CJ2C 1ZYRC 3S1RB 4G4KA 2Q8IB 5ELCA 2HQEA 4XIGS 3VR4A 2VNUD 2O5IC 2KECA 4DN4M 1K83B 5C0XI 4IFDI 1JE4A 2EJFC 1GUNA 2KA7A 1OXUA 2F0UA 1XX8A 2KEEA 1NR4A 1O7YA 3A7LA 4QMGA 2F0DA 2OT2A 3V96A 1V8QA 1SMYD 5JJZA 5KNCA 4A93B 1II3A 1F9SA 4KJOA 2MHVA 3T53B 1S5BD 3MFGA 4ULLA 3K7AB 3EFXD 1UEAB 1LTRD 1G8ZD 4ZUIA 1D5MC 3CKIB 2HCCA 2HCIA 2K5WA 5IIFA 2E74C 2JP1A 2XWBB 4KJNA 4H7BA 4JK1C 5KRUA 1EY4A 4DAYA 2DY7A 1ZYRD 1F2MA 3VYRA 2G9HD 3QB3A 2PPBC 2RQXA 2RVLA 4DU9A 1J9OA 2NVXB 1IKMA 4G7HC 3C2PA 2BDNA 2WP8J 3VR5A 3OMGA 2KCCA 4MIUA 3SXHA 1EY8A 1QNKA 1ML0D 1CZGA 1WTRA 5A35A 5AFWA 2ICEC 4ZK9B 3NQTA 4K14A 1D6EC 5CYUA 3K58A 1LTBD 4KV6A 1QOHA 2VXWA 5IT9L 2RBMA 2JEBI 5G3LF 4EQPA 1JWSD 2RDFA 4FF4A 1SYDA 3NBHA 3DEOA 2KJXA 4QIWB 4F8MA 2PZTA 5EBCA 3D31A 1A3UA 3NBIA 1HFNA 1LV9A 5EPJA 2FJ2A 1HFGA 5JEAG 3R2TA 1EIHA 5E3FA 1DOMA 1B4OA 3OWEB 3GQBA 5T1IA 3CRLC 5EKLA 3AMUA 1PTOF 2VB3X 1H9SA 4DNTB 1JOOA 4L63B 2DY8A 4XT1B 2FINB 2PZWA 2B2TA 3SDZA 2K5QA 4BA2I 4ODGA 3K5LA 2QKIC 4YIJA 1C8CA 3U9OA 1PTOH 1I4RA 2EYMA 2L11A 4OL7A 5DNFA 2B2WC 2KUMA 3RLFA 4AYBB 3KUPA 1OO9B 2B8FA 4ID6A 2A69D 4X3KA 1F2ZA 1AN8A 4QB4A 3R3OA 1R4QB 4HAEA 5CV5A 3Q23A 1YNNC 3OSOA 4KN7C 3MC0B 3I4NB 3PUVA 1H9KA 1RD9D 3HS0C 1SNDA 4RAUC 3PUWA 3K5MA 3URYA 2NN6I 4GZYC 1STAA 1DYQA 1JWUD 1WVLA 3HOUB 2F0VA 3P1HA 3KBXA 1IHZA 1LTID 2K28A 3VR2A 1FNUA 3MWYW 3OIQA 1H9MA 2CW0D 1Q1EA 2E2IB 5K36H 1EL0A 2ZXPA 5DM73 2KQ3A 1HRJA 1CQVA 4HSPA 5EGTA 3S1NB 3X3MA 2QDBA 1B1ZA 2EYLA 2K7VA 1VDZA 3FDTA 1SAPA 2M9VA 1SDFA 4KKUA 1EIGA 1FD7D 1GUSA 1YNND 1S5ED 3NWSA 1B3AA 5C6AA 2L0CA 4DK0A 3J7AF 1WTWA 2L55A 3R8BA 1I6VC 2LKVA 1HTLD 1DXMA 1KNAA 3QJYA 1LT5D 1IKLA 1T5EA 3L9AX 4EQOA 4DGZA 2F0EA 3SR1A 2B2VC 1Y69U 1EOTA 2XRQD 1F2YA 3IKJA 3IAYA 5HGTA 3IFDA 4ZRZA 1QB5D 3J7YW 4RWSC 1TY2A 5IGEA 3HP3A 1SYEA 3GV3A 2JXMB 4XTCS 4DFAA 4KN4C 1ENCA 3AB9A 2LY7A 2SNSA 3RZOB 3D4DA 5KYLA 2JA7B 4DA2A 1XXGA 1PRTB 1CK1A 2LFNA 1NR2A 3OMCA 3I90A 1EZ8A 3KBGA 4KHVA 2SNMA 3EA6A 2ZXOA 1ESFA 4QUFA 4PNYA 1VF5C 3R93A 1MI2A 3U9SA 2PW5A 2EYJA 4K5VA 1SNMA 4QF4A 2EJGC 4RGNA 4KTAA 4NDXA 1C4QA 2EY2A 1GOZA 1EEID 3H94A 5JEAJ 3ND9A 1TS4A 2F0QA 1VCIA 1KLUD 3FPUB 2E2JB 2F3WA 4PV1C 1Y8NB 5IGCA 4V190 3ND8A 2OF1A 1XTCD 3BVZA 4Z9CB 3GTOB 2IX1A 1AEXA 2FMMA 2BDOA 5CBEE 2X69A 3S1MB 1RTNA 1CA5A 2D62A 1STEA 5ELDA 2R93B 3WDNA 1S5CD 1I4GA 1SE4A 4HMJA 2K01A 4C1NK 3G7LA 2Q8RE 4Y7NB 1EY0A 1UUPA 3FKIB 1NAPA 2EDGA 3HEJA 2I46A 3V2TA 1O78A 4KD4A 2F0NA 4RKBA 1L0XB 4RGOS 4C3HG 4HSVA 3MXPA 1SEBD 4O42A 4K2KA 1TVXA 3V05A 1TKWB 3M85A 3K5OA 2KEDA 1FNVA 1JICA 2QILA 1LO5D 4EQNA 4LK1C 2RA4A 3LWEA 1GUOA 2EOTA 4K5XA 2YU9B 2WB1B 3TSSA 4B9XA 1EY6A 5A2QE 4MHEA 3MVVA 2ZXRA 2VB2X 1SJED 4IUVA 1ESRA 1SYBA 2J4XA 1I6HB 1HA5A 3H0GB 2B2UC 3EROA 2F0KA 3SK4A 3W3AA 2NB0A 1Z6HA 4Q5VA 3FPPA 4KY7A 4IQZA 5EQ0A 2X6LA 5CORA 2XWJB 5JOBA 2FMCA 2R6GA 2HUGA 3OIPA 1BXTA 3WOEA 1G291 1S5FD 5C44B 1PRTC 1R9TB 2SEBD 3BDCA 1PFMA 2EZVA 4QCLA 2K05A 4KKTA 2A68D 5CBAE 2B2YA 1GHJA 3MZ5A 3HKZB 1E2VA 4XYQA 4ILWA 1KABA 2F0IA 4OHJA 3TZDA 2BCOA 2MGSA 3ERQA 1EFID 3E0JA 5C0XH 1CZWA 4KI0A 4IFDH 2MPMA 1BCPB 3TMEA 3GTLB 3M7NA 1IYVA 4FYDA 3NTIA 2V4DA 4DXFA 1M4VA 2F0JA 1RJTA 3GTQB 5ELBA 5IOCA 4ZKCB 1BCPF 2HDMA 2K03A 4HTHA 3NE5B 1BR9A 1C48A 2IW3A 3UI2A 2AUJD 2J0TD 2NUCA 1KDCA 4U68A 3QO2A 3DWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQV A;  4DF7 A;  2OEO A;  5I9P A;  3OSO A;  5CGK A;  5CR3 A;  4EQO A;  4J6H A;  5I9O A;  4KV6 A;  3C1F A;  2OF1 A;  5I6Y A;  3DMU A;  5DAU A;  3ERO A;  1EY7 A;  2F0K A;  4DGZ A;  5NUC A;  2F0E A;  1SND A;  5CV8 A;  4I65 A;  3SK4 A;  1SNC A;  2F0U A;  2RBM A;  3SR1 A;  4EQP A;  2WAC A;  1AEX A;  1EYC A;  3NUC A;  2RDF A;  4B9W A;  1TR5 A;  1SYD A;  5KYI A;  1JOR A;  4KY7 A;  5CC4 A;  2F0G A;  2EY6 A;  3LX0 A;  4KD3 A;  1F2Y A;  4EVO A;  3NP8 A;  4QMG A;  2F0D A;  4N9T A;  4F8M A;  1EYD A;  3NXW A;  5HGT A;  3TP5 A;  5J22 A;  3SK5 A;  1STA A;  3QOL A;  2PZT A;  4ME5 A;  3SK8 A;  3T16 A;  5JOB A;  3NHH A;  4WRD A;  3TP6 A;  4F7X A;  5KEE A;  2RKS A;  1TQO A;  1A3U A;  2EYO A;  3MEH A;  1II3 A;  2F0V A;  5IGE A;  2F0H A;  4KJO A;  5C4H A;  3P1H A;  4ZUJ A;  1SYE A;  5IGF A;  3S9W A;  4HMJ A;  4K8J A;  3EJI A;  2KHS A;  2EYH A;  2PYK A;  3BDL A;  1IHZ A;  1NSN S;  4R8N A;  5EKK A;  1JOQ A;  4DFA A;  2F0S A;  3BDC A;  1ENC A;  1EY0 A;  2F3V A;  2O4X A;  2SOB A;  1STH A;  3P75 A;  2SNS A;  3D4W A;  4KY5 A;  5E3F A;  1TT2 A;  5M9O A;  2F0L A;  3D4D A;  3HEJ A;  4PMB A;  3TP7 A;  5KYL A;  4K6D A;  4ZUI A;  5E1F A;  2EY1 A;  5F2D A;  3PMF A;  3V2T A;  3SXH A;  2KQ3 A;  5IIF A;  5EKL A;  5J1Z A;  4KD4 A;  2F0N A;  2F0M A;  4RKB A;  2EYP A;  3OMC A;  3MZ5 A;  4KJN A;  4H7B A;  5CV4 A;  4LAA A;  1A3T A;  5KGU A;  5KRU A;  5C3X A;  1EZ8 A;  2PZU A;  4K5W A;  2SNM A;  4KHV A;  5EGT A;  3RUZ A;  3TP8 A;  3OWF A;  1SYG A;  1EY4 A;  3NK9 A;  5IGG A;  3E5S A;  5CV7 A;  5HUR A;  1EY9 A;  1KAB A;  3MXP A;  1RKN A;  1A3V A;  2EYL A;  1A2T A;  1JOO A;  2M00 A;  2QDB A;  3MHB A;  3SK6 A;  4E6I A;  2F0I A;  5C3W A;  4J1M A;  1F2M A;  1STB A;  4HMI A;  4PNY A;  5J39 A;  4K2K A;  5IGB A;  3EVQ A;  4IZ8 A;  5ISR A;  1SNP A;  4IUN A;  3ERQ A;  3C1E A;  2PZW A;  4NMZ A;  3HZX A;  3QB3 A;  5DEH A;  3VA5 A;  4ZQ3 A;  3DHQ A;  2PW5 A;  5C4Z A;  2EYJ A;  4K5V A;  4ODG A;  5C5M A;  1JOK A;  1SNM A;  2PQE A;  4KY6 A;  1EY5 A;  2F0P A;  2OXP A;  4EQN A;  5IGD A;  2F0F A;  4YIJ A;  5IOD A;  1ENA A;  4G57 A;  5C6A A;  4QF4 A;  3U9O A;  1STY A;  1NUC A;  3TME A;  4DU9 A;  4K8I A;  5CV6 A;  4S3S A;  1STN A;  4IAL A;  5C5L A;  1A2U A;  3SHL A;  4KTA A;  4NDX A;  1KDB A;  2ENB A;  3OMG A;  4K5X A;  4RKL A;  5I6W A;  2EY2 A;  2EY5 A;  4N9P A;  2F0O A;  5JAV A;  4TRD A;  2EYM A;  5CV5 A;  2F0J A;  4PMC A;  3QOJ A;  2PW7 A;  4MIU A;  4NP5 A;  3ITP A;  2F0W A;  1SYF A;  4OL7 A;  1EY8 A;  3H6M A;  4NKL A;  5IOC A;  4B9X A;  1KDA A;  1U9R A;  1EY6 A;  5K5P A;  1KAA A;  3D8G A;  2F0Q A;  4ID6 A;  2LKV A;  2F3W A;  4HTH A;  2EYF A;  3MVV A;  1SYC A;  1STG A;  1F2Z A;  3T13 A;  4K2L A;  4QB4 A;  2NUC A;  4WOR A;  1SNQ A;  5IGC A;  3NQT A;  1KDC A;  2HQE A;  4K14 A;  3R3O A;  1SYB A;  2F0T A;  5CV9 A;  5KIX A;  1EZ6 A;  2EXZ A;  1SNO A;  1EYA A;  3D6C A; 
#chains in the Genus database with same CATH topology
 1TS3 A;  1HR0 Q;  2JJQ A;  3L7Z C;  1LT4 D;  1FJG Q;  1PRT D;  4DK3 C;  3HG9 A;  5EBD A;  1PFN A;  4PQX A;  4IPD A;  2NVT B;  3Q8D A;  4OX9 Q;  2QGQ A;  1E2W A;  4X64 Q;  2N88 A;  1VF7 A;  4IOC A;  4DUZ L;  5EPL A;  3PUZ A;  3HKS A;  5TSS A;  3KOJ A;  4BWG B;  4ZAI A;  3GTL H;  3JAM E;  3RLN A;  3Q6S A;  4RGM A;  3D3R A;  4FVM A;  3M4P A;  3T1H Q;  1AP0 A;  4WRD A;  3M4O B;  3K81 C;  3GTQ H;  1TWH B;  3OTO Q;  3ZYY X;  1X32 A;  4B3R L;  5E4W C;  1WTQ A;  2Z1C A;  3TDQ A;  4A3K G;  1FGB D;  3AYH B;  4X3S A;  5BN5 A;  1NSN S;  4A3J G;  2ZJQ A;  1KRS A;  2O4X A;  1Y1W B;  3P75 A;  2E2H B;  1STH A;  5T1G A;  3S2H H;  1L1O A;  1C7Y A;  3TP7 A;  1TWC B;  5E1F A;  3N52 A;  1JB7 A;  1F2L A;  4RCO A;  3CCE A;  1X54 A;  1LT6 D;  2QCP X;  1I4X A;  4JYA L;  1A3T A;  1RL2 A;  3UDG A;  5IWA Q;  3NK9 A;  1HNX L;  3DXJ C;  1GUG A;  4TQU S;  1AE2 A;  2C35 B;  4OWT B;  2F4I A;  1PTO B;  4C3I B;  2X6G A;  1CA6 A;  2JA6 G;  4IZ8 A;  2RSN A;  4IUN A;  5BN3 A;  1DCZ A;  2BA1 A;  2R7F A;  4XT3 B;  2K04 A;  2N8N A;  3H09 A;  4EX5 A;  2PQE A;  1V1P A;  2NBF A;  4YY3 L;  2CCZ A;  2JA5 G;  4G57 A;  4JBJ A;  3MAQ A;  1MBY A;  2NZO A;  1FGU A;  5C5L A;  1OXT A;  1Y1W H;  2E2H H;  3F8T A;  2EY5 A;  2MO1 A;  4FO2 A;  4NP5 A;  1TWC H;  3ITP A;  4DV7 Q;  1RF2 D;  2KCN A;  3BYY B;  4CBV A;  3WOF A;  2JSO A;  3STB C;  2F03 A;  3TBI B;  2YV5 A;  1VQG A;  4LF6 L;  4DUY Q;  4CJ1 B;  1VQE A;  2F0T A;  2SDF A;  3E9H A;  3HKZ E;  2EXZ A;  1SNO A;  4UP9 A;  3J80 c;  1JJG A;  1EQV A;  1U5K A;  3K0Y A;  3LGJ A;  4X3U A;  2KHI A;  2ZT9 C;  2NVQ H;  4C3I H;  2B2T C;  3EIV A;  5E4X A;  1N33 Q;  1HCZ A;  1HXY D;  4BXX G;  1LLR D;  2XTI A;  1EIY B;  1TII D;  4IPH A;  3CQZ B;  1SRO A;  1QVC A;  4B9W A;  4A93 G;  2UUB Q;  2Z0S A;  2VQF L;  1I5F A;  3SVM A;  1GUW A;  1KHI A;  4FXG C;  1GKH A;  3I4M H;  3PV0 A;  5LMN Q;  1GJX A;  1PH2 A;  3SK8 A;  1PH7 A;  2AWN A;  4LW1 A;  2VL6 A;  1TS2 A;  3K8A A;  1EUJ A;  1Z47 A;  5EKI A;  3GV6 A;  1OXX K;  3MEH A;  5I2X A;  4LF9 L;  3CRK C;  4DV4 L;  4A3I B;  1I50 B;  2KHS A;  3BVM A;  3PUX A;  1CHP D;  1Q8K A;  4UY8 C;  5KNB A;  3M3Y B;  2F3V A;  4A4I A;  4DV5 Q;  1YNJ C;  1RTO A;  3GDE A;  3VYT A;  5FLM H;  4IUP A;  1YJN A;  4K0K L;  2B8G A;  4C3J B;  4KK7 A;  4LJZ C;  3CW2 C;  5J1Z A;  4XQJ A;  5KGU A;  3CQZ H;  3RD4 A;  2PNR C;  1FNW A;  1SYG A;  1X3P A;  4UDU C;  5FO9 B;  1VQA A;  3STB D;  1SBB B;  4HR7 B;  1O7I A;  1BCP C;  1E2Z A;  4A3B B;  1JB3 A;  3C1E A;  1PZK D;  3VYS A;  3KLS X;  2KHJ A;  4NW2 A;  3HOY H;  1YEZ A;  2R7Z B;  1PYW D;  5IOD A;  4KY6 A;  2K5D A;  1U0L A;  4RH6 A;  4A3I H;  4A3E B;  3CC4 A;  3O13 A;  1DD2 A;  2AQ2 B;  2EIF A;  1LTS D;  1Q1B A;  2AQ3 B;  4FNF A;  4UP7 A;  3F2D A;  4RKL A;  1QJO A;  5JAV A;  3D0F A;  2F0O A;  2JE6 I;  3H91 A;  2O2L D;  2R92 B;  2NN6 H;  2AKW B;  3KDF A;  2FFK B;  1SXT A;  2ZTE A;  2HDL A;  4C3J H;  3J80 E;  3HOX B;  4FF1 A;  1FYC A;  2I0Q A;  1M8A A;  4JI3 Q;  4KHP Q;  2L1B A;  4JI7 Q;  1CT1 D;  3NQI A;  3T13 A;  3GTP B;  3DWA A;  4WOR A;  4BY1 H;  4IPC A;  4A3L G;  1I4P A;  5FO8 B;  1JWM D;  4DF7 A;  5I9P A;  1ZEQ X;  2N49 A;  2ID0 A;  2FXQ A;  4A3B H;  1Q81 C;  1HNZ L;  1PLF A;  2IX3 A;  1YNJ D;  4I65 A;  2R7Z H;  5KYI A;  5BR8 L;  2A6E C;  1B53 A;  5CC4 A;  1O7Z A;  4GN4 B;  2M2L A;  4KD3 A;  1G2S A;  5M3M B;  5FJ8 G;  1BBX C;  1EYD A;  1PDQ A;  3KF8 A;  1QVF A;  3A8J E;  1VQN A;  2Z8L A;  4GN3 B;  3T16 A;  4FXD A;  4A75 A;  2R92 H;  2XIW A;  1VQH A;  2A1A A;  1H95 A;  1AZP A;  3W5O A;  2AMC B;  4R4O A;  5IGF A;  1A62 A;  3S9W A;  1XMQ L;  3UDI A;  3IFT A;  3KJO A;  1U4R A;  5EKK A;  1JOQ A;  4F87 A;  1HTP A;  3GTP H;  4A3D H;  1BDO A;  2O5J C;  2TSS A;  4DK1 A;  3CCM A;  1LTG D;  4KY5 A;  2C9O A;  5LHY 1;  2CHB D;  1ONL A;  2XNA C;  2B2V A;  3KF6 B;  2YYZ A;  3J81 c;  1F77 A;  3HOW H;  2DNC A;  1XNR L;  2NYZ D;  1VS0 A;  2EYP A;  1V1O A;  3E3X A;  3N6R A;  4BY7 B;  1PTO C;  2KBN A;  3UE1 A;  3HGB A;  4J1M A;  1I4Q A;  3EVQ A;  4DV0 L;  4O1N A;  2IWH A;  1B2T A;  4C2M B;  4LF7 L;  4LFB Q;  3HZX A;  3VA5 A;  4BBR H;  3CXC A;  1B9N A;  3S2D H;  1JOK A;  1WTX A;  2UXB Q;  1STY A;  4OIK A;  1YBY A;  4AYB G;  2OCE A;  2L4N A;  1CQF A;  4LF6 Q;  3C3L A;  1EWH A;  1I3Q B;  5G3L D;  4YHH Q;  4BA1 I;  2A74 C;  3MTS A;  1BO0 A;  4NXM Q;  4C3H H;  4HJ8 A;  2CWP A;  5KND A;  2A6E D;  3DLL A;  5GAG C;  1KDA A;  1X65 A;  3ICE A;  5ELO A;  5I4D A;  3CCL A;  5K36 G;  3I4N G;  1DOK A;  1XMO L;  2EYF A;  1VQO A;  2D0O A;  1RHP A;  1E1O A;  4BY7 H;  3BZK A;  3TS2 A;  2RHQ B;  1NCV A;  1G91 A;  4PMW A;  2E75 C;  5CV9 A;  1TS5 A;  1PFB A;  5CV8 A;  3CU7 A;  2XRS D;  5CR3 A;  3ONA B;  4UPA A;  3A55 A;  1TU2 B;  1EOV A;  2CQA A;  3PIP 3;  4YWL A;  1MGS A;  4FF2 A;  2LSS A;  4P74 A;  4L5S A;  3HOU G;  4RMF A;  2MNA A;  4WJ4 A;  2WII B;  3LX0 A;  4N9T A;  1N36 Q;  1I3Q H;  1VQJ A;  4FP5 D;  4APV A;  1GM5 A;  5J22 A;  3SK5 A;  5M5W B;  1PTO D;  4F7X A;  3PIO 3;  3TP6 A;  5E7N A;  5IYD G;  2NTS A;  2RKS A;  4K0K Q;  4JG2 A;  5JPM C;  3F2B A;  5M5X B;  3PUY A;  4K8J A;  3Q22 A;  2PO4 A;  4DAY B;  4RFB A;  2F4V L;  2RHS B;  4F88 A;  3IL8 A;  4PMB A;  3QIA A;  1XWE A;  4O0A A;  4GNX A;  3PMF A;  3EQL C;  2K32 A;  4P73 A;  1HR0 L;  1PZJ D;  1FJG L;  1HZC A;  4LAA A;  1Y1V B;  4LUV A;  3EBE A;  3A0J A;  4A3C H;  1B70 B;  4ALP A;  4LF5 Q;  5A2Q L;  1SE2 A;  1PZI D;  4X64 L;  1HH2 P;  3VR6 A;  2E2D C;  3GTM B;  2A19 A;  3D6W A;  2BH8 A;  4HN7 A;  4KMU C;  2D2C C;  4ABN A;  5M5W H;  4JBM A;  4HID A;  2DJF C;  1VMP A;  1W2B A;  4RGT A;  2NTT A;  3T1H L;  1IBK Q;  2UUC Q;  1EU4 A;  4MTN A;  4DV2 Q;  3S24 A;  3A56 A;  3OTO L;  3U50 C;  1WTH A;  1VQ8 A;  4RCN A;  1A15 A;  4A3F B;  4L8J A;  3OW7 A;  4IAL A;  3SHL A;  3DM1 A;  4X62 Q;  2J7Z A;  4N9P A;  5I6W A;  1GO3 E;  3S1Q B;  4C56 C;  3QOJ A;  1VQ7 A;  2NWG A;  2K14 A;  5C4X B;  3AU7 A;  2C5C A;  5HGQ A;  3VDY A;  2MO0 A;  1MD2 D;  5K5P A;  2VQE Q;  4OIJ A;  2D5D A;  2AWO A;  4XQQ A;  4CDC C;  3PO3 H;  3Q24 A;  4IUQ A;  1HA6 A;  2IT1 A;  1STG A;  1VQP A;  4UAI A;  1J5E Q;  2KOL A;  5BR8 Q;  4RHR A;  1P8L A;  1F9R A;  1EZ6 A;  4MZ9 A;  5IWA L;  1FL0 A;  4X3T A;  2WV6 D;  1GD7 A;  5DAU A;  3HOZ B;  2RDG A;  5D65 A;  2WAC A;  1W6J A;  3S15 B;  3FRP B;  5FLX c;  4TSS A;  3W1B A;  1PXU A;  4BBS B;  5IYB G;  3NP8 A;  2GA4 B;  2RDH A;  4CHT B;  4CDD C;  4DAV A;  4A3F H;  1G6Z A;  1T5X D;  3NWT A;  3QOL A;  5C3E H;  1CUK A;  3S1Q H;  3W2D A;  2EYO A;  5C4X H;  1H9S B;  1XPO A;  5FK9 C;  3K5N A;  3JAM i;  1SMY C;  4DV7 L;  1PH8 A;  2PI2 E;  2BE5 C;  2JA7 G;  4NXN Q;  2EYH A;  5EAY A;  3GTJ H;  1K73 C;  3OPO A;  5C4J B;  1SFO B;  4DR2 Q;  4KLK A;  2H4O A;  4JI6 Q;  2QW7 A;  1ASZ A;  5M3F B;  2R3Z A;  1ICF B;  1IBM Q;  2A6H C;  4HIK A;  2VY3 A;  4WFN 3;  3HOZ H;  3FEW X;  3P20 A;  4M1U B;  1N33 L;  3VYU A;  2PZU A;  1IW7 C;  4ZYS A;  3A74 A;  3E5S A;  4BBS H;  5CV7 A;  2CQO A;  1WTV A;  1Z7T A;  2RCF A;  1PH4 A;  3SK6 A;  4E6I A;  2UUB L;  1SRU A;  4A3K H;  5C3W A;  1WTP A;  2XSC A;  1OXV A;  5IGB A;  1H9J A;  1EWC A;  5LMN L;  3M4Y A;  1PH6 A;  1ILP A;  4CKE A;  1E0B A;  3M4Q A;  4PZ8 A;  1E3P A;  5DLQ E;  3TEH B;  1LAC A;  1ENF A;  1NUC A;  1QCB D;  5M5Y B;  1L0Y B;  1U4P A;  2L12 A;  5C4J H;  1A2U A;  1SFO H;  1Y8P B;  2AUK A;  5FKA C;  1KDB A;  2NZ1 D;  2F1M A;  4TRD A;  1LT3 D;  3I8Z A;  3JAM L;  3H3V H;  2PW7 A;  1JCK B;  4DV5 L;  1WOC A;  5JJK A;  2B2Y C;  1OXS C;  1KAA A;  4P2C B;  5JEA H;  1BNZ A;  1LAB A;  1WD0 A;  1SYC A;  4NPS A;  1SNQ A;  1A0I A;  1I4H A;  1XTD A;  2BE5 D;  2K50 A;  5FLX E;  3QWN A;  1EYA A;  5IP7 G;  1YJW A;  1HHV A;  2OEO A;  1HQM C;  2L5T A;  3ER0 A;  3CHB D;  1D5Z C;  5IP9 H;  2Z6K C;  1CKM A;  1SE3 A;  3HOV B;  4OO1 G;  1EY7 A;  4DR7 L;  4ZLT F;  1DJR D;  3I73 A;  2A6H D;  1TR5 A;  4MTK A;  2R93 G;  1JOR A;  1EQT A;  2D9U A;  1K83 H;  3K57 A;  1D5X C;  1M1K C;  4LUZ A;  2MP1 A;  2BA0 A;  2NVY B;  3K0X A;  1IYJ B;  5M5Y H;  1XPU A;  1RDP D;  3LWU A;  3M7G A;  1ET9 A;  3TN2 A;  1LTT D;  2GN5 A;  5LMN W;  1E7Z A;  1IW7 D;  1O80 A;  2CH4 W;  1TQO A;  2DUD A;  3KK7 A;  3S2H B;  3FKI G;  3T51 B;  2EE1 A;  1QUQ B;  2F0H A;  3FVQ A;  4DKA C;  4JV5 Q;  4ZKB B;  1ET6 A;  4DXG A;  3VR3 A;  3KDF B;  4GLX A;  1NY4 A;  2PYK A;  4B3M Q;  1W3S A;  4JI3 L;  3U4V A;  4KHP L;  1V43 A;  3G6J B;  3A7A B;  5ELE A;  4JI7 L;  2ICI A;  1VQ6 A;  3J81 j;  3PIP A;  2EJM A;  1S40 A;  4GLV B;  4OGQ C;  1S72 A;  1BQQ T;  3FP9 A;  3GD7 A;  3X3N A;  2K5H A;  1D1K A;  2Q2I A;  3HOV H;  4IJH A;  2IPK D;  3NPP A;  3K7A H;  3PIO A;  4YWK A;  1ICW A;  1Q90 A;  1S5D D;  5IGG A;  3OWF A;  5IT9 c;  4GOP A;  2CVR A;  3JC6 6;  4OWW B;  1A3V A;  2M00 A;  3MHB A;  3BZC A;  2NVY H;  1CI3 M;  1HNW Q;  3RMH A;  4HMI A;  5ISR A;  1D1I A;  4OON A;  1ZXT A;  1SJH D;  1SLJ A;  5C4Z A;  1GUT A;  2WB1 G;  2UUA Q;  3L2P A;  1QZH A;  4DAP A;  2G5D A;  2MJ8 A;  4POF A;  2ZM6 Q;  1L1O C;  3UDF A;  1EIF A;  4KHZ A;  4K6L A;  4JPB W;  1BOS A;  2CH4 A;  1SYF A;  2CKZ B;  1TWF B;  3BDO A;  4LUO A;  1AW7 A;  2NVQ B;  4WJ3 M;  2XGT A;  1EEF D;  4P71 A;  1NJI C;  3H0G G;  1Z9F A;  2A69 C;  2DN8 A;  1QWY A;  4OXP A;  3J80 i;  1QG7 A;  4DNI A;  5EPK A;  2K5V A;  5LL6 S;  5D3I B;  1K8M A;  1ZKO A;  5CGK A;  3NTH A;  2BOS A;  4RA8 A;  3I4M B;  1CKO A;  3DMU A;  4JCV E;  5I6Y A;  1J8I A;  2UXD Q;  5D14 A;  3MXN A;  5NUC A;  2H5X A;  4IUR A;  4QUC A;  4LFB L;  2DNE A;  1K3B C;  3DUZ A;  5C0X G;  3DM3 A;  2QEX A;  1A6X A;  4IFD G;  2UXB L;  2QEJ C;  4HCE A;  4G7Z C;  2JEA I;  1B3Q A;  5KEE A;  2F3I A;  4A3M B;  1VQC A;  5C44 G;  4YHH L;  4NXM L;  1JJ2 A;  1TWF H;  3LNN A;  3I4L A;  5C4H A;  2QF7 A;  4ZUJ A;  1VMC A;  3EJI A;  4J8Q A;  3BDL A;  3H3V C;  1JQY D;  1DZ1 A;  3I70 A;  3SEB A;  4ME3 A;  1Q3L A;  1GHK A;  3RR5 A;  4GS3 A;  2IL8 A;  1EU3 A;  1FR3 A;  1A63 A;  2AQ1 B;  1CKN A;  1CTM A;  3HKZ G;  1TT2 A;  2I5L X;  2K75 A;  5M9O A;  4JBK A;  5IT9 E;  3I3C A;  2MQH A;  1SMX A;  2EY1 A;  5F2D A;  5FJ8 H;  4FF3 A;  2CW0 C;  2B2W A;  3M9B A;  4H44 C;  1IL8 A;  2JA8 B;  5CV4 A;  3J80 L;  4I7Z C;  3CF5 A;  3HOY B;  3S14 B;  3RUZ A;  4KKS A;  2N55 A;  1EY9 A;  1UEB A;  3MA2 B;  3NSW A;  1LYL A;  1VQ5 A;  3GTK B;  1ILQ A;  4JI4 L;  3C46 A;  1K8O A;  1YZ6 A;  1N36 L;  4A3M H;  1IL2 A;  1N32 Q;  2HIV A;  3CPW A;  5GAH C;  2I07 B;  2F0F A;  3I4O A;  1Q8I A;  3SE0 A;  1KQS A;  3MEF A;  2HD3 A;  3OHX C;  3J7A 5;  3BZD B;  3ZJY C;  4IPG A;  4BY1 B;  2RSO A;  2NZH A;  3CCS A;  4DAM A;  2R61 A;  4DV3 Q;  1CFM A;  4R4T A;  4DR7 Q;  2PMZ B;  3VA7 A;  2JA8 H;  1BBU A;  2JYO A;  1HUN A;  2IJ0 A;  3S14 H;  3K6O A;  4XYO A;  1H9R A;  1UAP A;  1HZB A;  3L3O C;  3D4R A;  4C1N I;  4CJ0 B;  5KIX A;  3T4A C;  5AJ3 Q;  3S16 B;  2UXC Q;  3D6C A;  4GKK Q;  4LF5 L;  3BS1 A;  1U4M A;  3GTK H;  5I9O A;  1DM0 B;  1CM9 A;  3C1F A;  4XDX A;  3AFP A;  2Q2T A;  1MSG A;  3GP7 A;  4A3G B;  2PCF B;  3BYT B;  1IBK L;  2UUC L;  4DV2 L;  1NMG A;  3DWQ A;  1S4Z A;  4EVO A;  3G6E A;  2Z4I A;  3F2U A;  3I4N H;  1W6K A;  2G9D A;  4A3D B;  3TP5 A;  2A8V A;  3NHH A;  2HIX A;  3E6Z X;  2XN9 C;  5I2Y A;  4X62 L;  1Y1W G;  4WJW A;  4LF8 L;  2IHF A;  2K52 A;  1EFW A;  4LMQ D;  1TWG B;  3A8K E;  2VQE L;  1B9M A;  3HOW B;  1L0W A;  2Q2H A;  3D4W A;  4QIW E;  1J5E L;  2B63 B;  1K0R A;  3S16 H;  3L0O A;  3H15 A;  3RNU A;  5L37 A;  4NB3 A;  4XQN A;  3J81 i;  3QG1 A;  1WTO A;  2E76 C;  2JQO A;  1CHQ D;  4C3I G;  4BS9 A;  4A3G H;  1MJC A;  2IX0 A;  3P7J A;  4JOI A;  4BBR B;  1B50 A;  3S2D B;  1VQB A;  3U4Z A;  5DM6 3;  1BCP D;  2E2I H;  4RHS A;  1KNE A;  1STB A;  5J39 A;  2MFI A;  3ULJ A;  1SNP A;  1YJ9 A;  2Q8T A;  2EPB A;  4C3H B;  1F9Q A;  3MFY A;  4NMZ A;  1PH9 A;  4LF4 Q;  2Y0S B;  1HQR D;  3I72 A;  1G2T A;  1R4P B;  3CCQ A;  2OXP A;  3CC2 A;  4FXK C;  1TWG H;  1N34 Q;  1EQR A;  4NXN L;  3TZU A;  4GKJ Q;  1STN A;  3A54 A;  3NEL A;  2B63 H;  4H0L C;  4DR2 L;  4JI6 L;  5EJW A;  1X55 A;  5D3D A;  2WKC A;  1TWA B;  1PVO A;  5FLM G;  1Q12 A;  1IBM L;  3A5Z B;  1K8G A;  4IUT A;  2JK8 A;  5FOB B;  4DR3 Q;  4M8A A;  3ERS X;  2H1E A;  2MUY A;  4ZCK A;  3G71 A;  5DEH A;  3J81 L;  1JC7 A;  2LMC B;  2K1B A;  4L6T B;  3Q0A A;  4X6A H;  3AFQ A;  4J6H A;  3PSI A;  2TMP A;  4QJF A;  2CFM A;  5LL6 X;  1HPC A;  4AYB E;  1DOL A;  4R8I A;  4HIM A;  5COY A;  4IN3 A;  4DR4 Q;  1O7L A;  2K33 A;  1EYC A;  3NUC A;  3BG3 A;  4YCW A;  1D2B A;  3PO2 B;  5CMD A;  4A3I G;  1SE8 A;  2I5M X;  2A5H A;  2WAQ B;  4CGY B;  1PV4 A;  2HHH Q;  5BN4 A;  1KXL A;  1PYB A;  1TWA H;  2NN6 G;  1HUM A;  1XNQ L;  3OOC A;  5HY6 A;  4C3J G;  5GAD C;  2LS0 1;  1PRT F;  2PMZ E;  1XYI A;  1KLG D;  3KYH C;  1BF4 A;  2F0L A;  4YWM A;  4JI4 Q;  2N78 A;  2VUM B;  5IYB H;  4JBW A;  1KIX A;  1B44 D;  3F1Z A;  4A3B G;  4B08 A;  5C3X A;  4K5W A;  1RCV D;  4V0B A;  1N9W A;  3TP8 A;  4TKO B;  1AZQ A;  2PNH A;  1YIT A;  2JA7 H;  2R7Z G;  1A2T A;  4A3E G;  3PO2 H;  2WKD A;  5ELF A;  3S17 B;  3J81 E;  4IUU A;  5C0X J;  4IFD J;  1LTL A;  1WJJ A;  3A8I E;  1BUV T;  3DHQ A;  5J3B A;  1WD1 A;  3OYY A;  2R92 G;  1EY5 A;  5FO7 B;  1PYS B;  4HCS A;  1SR3 A;  4U67 3;  1V1Q A;  3I91 A;  4JV5 L;  3TRZ A;  3HOX G;  1JJC B;  5CV6 A;  5IYC H;  3PO3 B;  2L9H A;  4B3M L;  2OQK A;  3AQQ A;  4N8F A;  4CKB A;  2K4K A;  3CAM A;  1MSH A;  1D8L A;  3DEP A;  1LTA D;  4LFC Q;  1X3Q A;  1X9N A;  2EQS A;  4PMC A;  2KVM A;  4X65 L;  5JVH 3;  4LFA L;  3H6M A;  4NKL A;  2VUM H;  1QVG A;  1QNU A;  1U9R A;  3D8G A;  1WCM B;  3HRZ C;  4XXE A;  1U4L A;  4L5T A;  4DV1 Q;  1IYU A;  4DR6 Q;  4OO1 I;  4K2L A;  2B39 A;  4AQY Q;  4POG A;  1QE6 A;  1EYG A;  4GN5 A;  1ENA A;  2YTV A;  1JR0 D;  4GOP B;  1TY0 A;  3FHW A;  3S17 H;  3MXU A;  3MXG A;  2FHT A;  1AE3 A;  5M3M G;  1HNW L;  3NEM A;  5C3E B;  4DR1 Q;  1KRT A;  4LF8 Q;  1SNC A;  1QIL A;  2EVB A;  2LXK A;  3NTK A;  1X3E A;  1L1O B;  4MN3 A;  5JPN C;  2F0G A;  2EY6 A;  2A73 B;  4PZ6 A;  2Y0S E;  2UUA L;  3GTJ B;  3KLR A;  4HED A;  3NXW A;  1DON A;  3PF5 A;  4EGV A;  4ME5 A;  4JI5 L;  2ZM6 L;  1ROD A;  1X56 A;  3T56 B;  1F9P A;  1JMC A;  3GTG B;  3RZD B;  1WCM H;  1K0S A;  1HR0 W;  3J7A V;  4R8N A;  4OO1 H;  4JC0 A;  4H13 C;  2F0S A;  4CKC A;  3F2C A;  2SOB A;  2K6A A;  4BY7 G;  1YHA A;  4K6D A;  1JT8 A;  3GO5 A;  1V1P B;  4A3K B;  1WI5 A;  2XVS A;  4A3J B;  2F52 A;  4G7O C;  1PA6 A;  3KFU A;  1KTK A;  2F0M A;  2UXD L;  2A68 C;  1HZ9 A;  1UNS A;  1Y8O B;  4Y7N H;  3FKI H;  5JVG 3;  3BVG A;  4R9W A;  4DNR B;  1NNX A;  3ULP A;  3R2I A;  5HUR A;  1RKN A;  2KCM A;  2Z4H A;  1D7Q A;  5FLX L;  1EWI A;  1A8V A;  4Q0F A;  2B2U A;  2WAQ E;  4ZQ3 A;  3FMC A;  5C5M A;  1PH3 A;  3CD6 A;  3GTG H;  3RZD H;  2F0P A;  1GXD C;  5IGD A;  3K59 A;  3KLS A;  1EQQ A;  2JA6 B;  4K8I A;  4S3S A;  1SSO A;  3PGZ A;  4R4I A;  2ENB A;  4JI0 Q;  1KC8 C;  3EN2 A;  3U58 A;  5GQO A;  4HJ9 A;  4B3S L;  2F0W A;  1CKN B;  2JA5 B;  4A3J H;  2E8G A;  1PMR A;  3CMA A;  4IO9 A;  1AFP A;  2WIN B;  4CJ2 C;  1WFQ A;  1ZYR C;  3S1R B;  4G4K A;  2Q8I B;  4J15 A;  5ELC A;  2HQE A;  4XIG S;  1BVS A;  3VR4 A;  2VNU D;  2O5I C;  2KEC A;  4DN4 M;  1K83 B;  4JW0 A;  5C0X I;  4A3C G;  4O2D A;  2JN4 A;  4IFD I;  1JE4 A;  2EJF C;  1GUN A;  2KA7 A;  1OXU A;  4RG1 A;  2ZJR A;  2F0U A;  1XX8 A;  4CDF C;  1XNQ Q;  1N32 L;  2KEE A;  1NR4 A;  3TQY A;  1O7Y A;  3CCJ A;  2JA6 H;  2ATW A;  3A7L A;  3HFZ B;  4QMG A;  2F0D A;  2OT2 A;  3V96 A;  1V8Q A;  1SMY D;  5JJZ A;  1KL9 A;  5KNC A;  4A93 B;  1II3 A;  1F9S A;  2JA5 H;  1VQF A;  4KJO A;  3T1Y Q;  3UDX A;  4JI2 Q;  2MHV A;  3T53 B;  2E5L Q;  1S5B D;  5GRO A;  3MFG A;  4DV3 L;  2KEN A;  4ULL A;  2K5N A;  3S1R H;  3K7A B;  1VQM A;  3EFX D;  1VQ4 A;  2Z9H A;  1UEA B;  1LTR D;  1E22 A;  1Y1V G;  1G8Z D;  4DV6 Q;  4ZUI A;  5AJ3 L;  2I5H A;  2UXC L;  1D5M C;  4GKK L;  3CKI B;  2HCC A;  1CSQ A;  2HCI A;  2K5W A;  5IIF A;  1FVI A;  2E74 C;  2JP1 A;  2XWB B;  4KJN A;  1LUZ A;  4H7B A;  4JK1 C;  4HJ7 A;  1R9T H;  5KRU A;  4I7A A;  1EY4 A;  1Q82 C;  4DAY A;  1V9P A;  2DY7 A;  2ASB A;  5JJL A;  1ZYR D;  2VZA A;  4BXX H;  1F2M A;  4A3F G;  4X65 Q;  3VYR A;  4LFA Q;  4A93 H;  2G9H D;  1HJP A;  3QB3 A;  1MJE A;  4EQ5 A;  2PPB C;  2RQX A;  5C4X G;  3E9I A;  1IBL Q;  2RVL A;  4DU9 A;  1J9O A;  2NVX B;  1IKM A;  4G7H C;  3C2P A;  2BDN A;  2WP8 J;  3VR5 A;  4JI8 Q;  3OMG A;  2KCC A;  4MIU A;  3SXH A;  1EY8 A;  1QNK A;  1ML0 D;  1Y14 B;  1CZG A;  1WTR A;  3W1G A;  5A35 A;  1B8A A;  2DGY A;  5AFW A;  4GOP C;  2ZTC A;  3KF8 B;  2ICE C;  4DR5 Q;  2ES2 A;  4ZK9 B;  3HOZ G;  3NQT A;  4K14 A;  1D6E C;  4AIM A;  1VQK A;  2EXD A;  5CYU A;  3K58 A;  3BU2 A;  1LTB D;  1MHW C;  4JI1 Q;  4BBS G;  4KV6 A;  2WB1 E;  1QOH A;  2VXW A;  4JI5 Q;  5IT9 L;  2RBM A;  2JEB I;  5G3L F;  4EQP A;  2KCT A;  1AH9 A;  1JWS D;  2RDF A;  4FF4 A;  4LF4 L;  1SYD A;  3NBH A;  3DEO A;  1G6P A;  2KJX A;  2NVX H;  4QIW B;  3CME A;  1N34 L;  1B7Y B;  2YTX A;  4F8M A;  4GKJ L;  2PZT A;  5EBC A;  2OTL A;  2NVT H;  3D31 A;  1A3U A;  3K7U C;  4HIO A;  3NBI A;  1I94 Q;  1HFN A;  5M3F G;  2HQL A;  1LV9 A;  5EPJ A;  2FJ2 A;  1HFG A;  5JEA G;  1NBW A;  4DR3 L;  5LMU Q;  3R2T A;  1EIH A;  3M4O H;  5E3F A;  1TWH H;  1DOM A;  1B4O A;  3OWE B;  1X6O A;  3GQB A;  3WWV A;  5T1I A;  3CRL C;  5EKL A;  2IHE A;  4UP8 A;  5IP9 G;  4A3L H;  3AMU A;  1PTO F;  2VB3 X;  2OTJ A;  4DR4 L;  1H9S A;  2B3G A;  4IJL A;  4DNT B;  4LWC A;  2BH2 A;  1JOO A;  1K8A C;  4L63 B;  2DY8 A;  3TRE A;  4XT1 B;  4B3S Q;  2FIN B;  2PZW A;  2B2T A;  3SDZ A;  2K5Q A;  4BA2 I;  1XPR A;  4MNO A;  4ODG A;  5ELN A;  4X66 Q;  2HHH L;  3K5L A;  1NE3 A;  2QKI C;  4YIJ A;  4B3T Q;  1C8C A;  3U9O A;  4R1J A;  2Z6B A;  1OTC A;  1JE5 A;  2B29 A;  1PTO H;  3UE0 A;  3CP0 A;  3CCR A;  1I4R A;  2AHO B;  4Y52 H;  2EYM A;  2L11 A;  4OL7 A;  5DNF A;  2B2W C;  1G51 A;  2KUM A;  3RLF A;  4AYB B;  3AEV A;  1C0A A;  3KUP A;  1PFS A;  1OO9 B;  2B8F A;  4ID6 A;  2A69 D;  1X3G A;  3J7Z C;  4X3K A;  1F2Z A;  1AN8 A;  3HOV G;  4QB4 A;  3PF4 A;  3R3O A;  1R4Q B;  4HAE A;  5CV5 A;  3Q23 A;  1YNN C;  1YHB A;  3OSO A;  4KN7 C;  3CCU A;  3MC0 B;  3I4N B;  1PH1 A;  3PUV A;  1H9K A;  4R4C A;  1RD9 D;  1UE1 A;  3HS0 C;  1VQL A;  1SND A;  4RAU C;  2QA4 A;  1UE6 A;  2CWA A;  3TS0 A;  3PUW A;  1P16 A;  3K5M A;  3SGI A;  2UU9 Q;  3URY A;  2NN6 I;  4GNX B;  1Q46 A;  4GZY C;  1STA A;  1DYQ A;  4L5Q A;  1JWU D;  1WVL A;  3HOU B;  5JJI A;  4LFC L;  2RF4 A;  2DJG C;  2F0V A;  3P1H A;  2V1C C;  3KBX A;  1IHZ A;  1LTI D;  2K28 A;  3VR2 A;  4DV1 L;  1FNU A;  4DR6 L;  3MWY W;  2PQA A;  1H9M A;  3OIQ A;  4AQY L;  2CW0 D;  1VQI A;  4PZ7 A;  1Q1E A;  2GVB A;  2E2I B;  5K36 H;  4OWX B;  1EL0 A;  1KAW A;  2ZXP A;  5DM7 3;  1I50 H;  3K80 C;  2KQ3 A;  1HRJ A;  3BJU A;  3M3Y H;  1CQV A;  4DR1 L;  4HSP A;  5EGT A;  1QUQ A;  3S1N B;  3X3M A;  1YVC A;  2QDB A;  1B1Z A;  2EYL A;  2K7V A;  1VDZ A;  3FDT A;  1SAP A;  2M9V A;  1SDF A;  4KKU A;  1EIG A;  4HJA A;  1FD7 D;  3HOU H;  1GUS A;  1YNN D;  4DUZ Q;  1PHJ A;  1S5E D;  3NWS A;  1B3A A;  5C6A A;  2L0C A;  2ZTD A;  4DK0 A;  2GVA A;  5IYD H;  1VQ9 A;  3J7A F;  1WTW A;  4B3R Q;  1LM0 A;  2L55 A;  3R8B A;  4A3E H;  3KLW A;  1I6V C;  4H02 A;  4JOI C;  2LKV A;  1HTL D;  3I4M G;  1L2F A;  1DXM A;  1KNA A;  3QJY A;  1LT5 D;  1IKL A;  3S1N H;  1T5E A;  3HOX H;  3L9A X;  4EQO A;  4JYA Q;  4DGZ A;  4A76 A;  2F0E A;  4TVA B;  1NMF A;  3SR1 A;  1UE5 A;  1HNX Q;  2P5Z X;  4A3M G;  2B2V C;  1Y69 U;  3I7F A;  1EOT A;  2XRQ D;  1F2Y A;  3IKJ A;  3IAY A;  4JVZ A;  5HGT A;  1CSP A;  3IFD A;  4ZRZ A;  1QB5 D;  3J7Y W;  4RWS C;  1TY2 A;  4JI0 L;  5IGE A;  4YY3 Q;  3HP3 A;  1SYE A;  3GV3 A;  5GAE C;  4DPG A;  3G4S A;  5M3M H;  2JXM B;  4XTC S;  4DFA A;  4KN4 C;  2JA8 G;  1ENC A;  3AB9 A;  1QZG A;  2LY7 A;  2SNS A;  3HOY G;  3RZO B;  1VQD A;  3D4D A;  5KYL A;  2JA7 B;  4DA2 A;  2OWO A;  1XXG A;  1PRT B;  1CK1 A;  1J6Q A;  5IE8 A;  1HZA A;  2LFN A;  2WFW A;  1XJV A;  1NR2 A;  3OMC A;  3I90 A;  1EZ8 A;  3KBG A;  4KHV A;  2SNM A;  3EA6 A;  2ZXO A;  4L5R C;  3E0E A;  1ESF A;  3PQI A;  5H1S E;  4QUF A;  4PNY A;  1VF5 C;  3R93 A;  1PH5 A;  1MI2 A;  3U9S A;  2RCN A;  4BY1 G;  2PW5 A;  2EYJ A;  4K5V A;  1X3F A;  2VQF Q;  1SNM A;  3T1Y L;  4N8X 1;  4QF4 A;  3CCV A;  4JI2 L;  2E5L L;  1YI2 A;  2EJG C;  4RGN A;  2JA9 A;  4KTA A;  4NDX A;  1C4Q A;  2EY2 A;  4C2M H;  4LF9 Q;  3RZO H;  1K9M C;  4DV4 Q;  1GOZ A;  1EEI D;  3IRB A;  4AH6 A;  4DV6 L;  3H94 A;  5JEA J;  1NTG A;  3ND9 A;  1TS4 A;  2F0Q A;  1VCI A;  1KLU D;  3FPU B;  2ZJP A;  2F3W A;  2QDL A;  2E2J B;  4PV1 C;  1Y8N B;  5IGC A;  1SN8 A;  4A3G G;  4V19 0;  3PCO B;  3ND8 A;  2OF1 A;  4P72 A;  1XTC D;  3BVZ A;  4LNQ A;  4Z9C B;  4GNX C;  3GTO B;  1T9H A;  4A3D G;  2IX1 A;  1AEX A;  2FMM A;  2BDO A;  5CBE E;  2X69 A;  3OW2 A;  3S1M B;  3G48 A;  1DGS A;  1IBL L;  1RTN A;  1CA5 A;  1KD1 C;  3HOW G;  2D62 A;  4JI8 L;  1STE A;  5ELD A;  2R93 B;  3WDN A;  2B63 G;  4OX9 L;  1S5C D;  1I4G A;  1SE4 A;  4HMJ A;  2K01 A;  4C1N K;  3G7L A;  2E2J H;  2Q8R E;  3NEN A;  4Y7N B;  1EY0 A;  2N3S A;  1UUP A;  3FKI B;  1NAP A;  4DR5 L;  2EDG A;  4BBR G;  3HEJ A;  4R4Q A;  5M5X H;  2I46 A;  3V2T A;  1O78 A;  4JI1 L;  4KD4 A;  2F0N A;  2VS1 A;  3GTO H;  1BKB A;  2YTY A;  4RKB A;  1L0X B;  4RGO S;  3RLO A;  3I56 A;  5IP7 H;  4C3H G;  3QR8 A;  2Y0S G;  4HSV A;  3MXP A;  3I55 A;  1SEB D;  2IY5 B;  3S1M H;  4O42 A;  3NBH B;  1HNZ Q;  1YHQ A;  4K2K A;  1TVX A;  3V05 A;  4P75 A;  1TKW B;  1Y1V H;  3M85 A;  3K5O A;  2R93 H;  2KED A;  1FNV A;  1JIC A;  2QIL A;  1LO5 D;  4GLA C;  4EQN A;  4LK1 C;  1I94 L;  3ULL A;  2RA4 A;  1UE7 A;  1MIU A;  3LWE A;  3GTM H;  1GUO A;  1M90 C;  2EOT A;  1K28 A;  4K5X A;  1Q86 C;  3MXN B;  2YU9 B;  4IOA A;  5LMU L;  2WB1 B;  3TSS A;  4B9X A;  1XMQ Q;  1EY6 A;  1RIP A;  4HJ5 A;  3I2Z A;  5A2Q E;  4MHE A;  3MVV A;  2ZXR A;  2VB2 X;  1SJE D;  4IUV A;  1ESR A;  1SYB A;  2ALY B;  2J4X A;  2L15 A;  1BBW A;  3KF6 A;  1C9O A;  1ASY A;  3PO2 G;  1I6H B;  1XNR Q;  1HA5 A;  3H0G B;  2B2U C;  3ERO A;  2F0K A;  3SK4 A;  3W3A A;  2WAQ G;  2NB0 A;  1YNX A;  1Z6H A;  4Q5V A;  1E24 A;  3FPP A;  4KY7 A;  4X66 L;  4DK6 C;  2HT1 A;  4DUY L;  4IQZ A;  4YCV A;  3H3V I;  5EQ0 A;  2X6L A;  4B3T L;  4DV0 Q;  1E1T A;  4FDB A;  5COR A;  1UWV A;  4LF7 Q;  5IYC G;  2YU9 H;  2XWJ B;  1TXY A;  5JOB A;  1WYD A;  2FMC A;  2R6G A;  3S15 H;  1IXR A;  2HUG A;  4OEL B;  3OIP A;  1K3R A;  2R7D A;  1BXT A;  1IZ6 A;  3CPF A;  3JAM c;  2VUM G;  3WOE A;  4OEM B;  1G29 1;  4CDE C;  1S5F D;  2PI2 A;  1PRT C;  5C44 B;  1MKH A;  2SEB D;  1R9T B;  3BDC A;  3KJP A;  1PFM A;  3CC7 A;  2LXJ A;  2EZV A;  2OQ0 A;  4QCL A;  4QY7 A;  2K05 A;  4QQB X;  1GVP A;  4KKT A;  1I6H H;  4UHV A;  2A68 D;  1XMO Q;  3H0G H;  5CBA E;  2B2Y A;  1GHJ A;  2VW9 A;  3MZ5 A;  3HKZ B;  1E2V A;  2D0P A;  3RN2 A;  4XYQ A;  5M3F H;  4ILW A;  1KAB A;  4YCU A;  4QL5 A;  2Q2U A;  2UU9 L;  2F0I A;  4OHJ A;  3TZD A;  2BCO A;  2MGS A;  3PO3 G;  4PG3 A;  3ERQ A;  1EFI D;  2Z6K A;  3E0J A;  3RN5 A;  5C0X H;  1CZW A;  4KI0 A;  4IFD H;  2MPM A;  1YIJ A;  5IY0 A;  1BCP B;  3TME A;  1WCM G;  3GTL B;  5C44 H;  1S3O A;  3M7N A;  1IYV A;  4FYD A;  3NTI A;  2V4D A;  4DXF A;  1M4V A;  2F0J A;  1RJT A;  3GTQ B;  5ELB A;  3B6Y A;  5IOC A;  2PQA B;  4ZKC B;  3A5U A;  1BCP F;  2HDM A;  2K03 A;  1N8R C;  4HTH A;  2F4V Q;  3NE5 B;  1BR9 A;  1C48 A;  2IW3 A;  3UI2 A;  2AUJ D;  2J0T D;  2NUC A;  4QGU A;  5C3E G;  1KDC A;  4U68 A;  3QO2 A;  1Q7Y C;  3DWP A; 
#chains in the Genus database with same CATH homology
 1TS3 A;  3L7Z C;  1LT4 D;  1PRT D;  3HG9 A;  5EBD A;  1PFN A;  4PQX A;  2NVT B;  1E2W A;  2N88 A;  1VF7 A;  5EPL A;  3PUZ A;  5TSS A;  4BWG B;  4ZAI A;  3JAM E;  3Q6S A;  4RGM A;  3D3R A;  4FVM A;  1AP0 A;  4WRD A;  3M4O B;  1TWH B;  3ZYY X;  1X32 A;  5E4W C;  1WTQ A;  2Z1C A;  3TDQ A;  1FGB D;  4X3S A;  5BN5 A;  1NSN S;  2O4X A;  1Y1W B;  3P75 A;  2E2H B;  1STH A;  5T1G A;  3TP7 A;  1TWC B;  5E1F A;  3N52 A;  1F2L A;  4RCO A;  1LT6 D;  2QCP X;  1I4X A;  1A3T A;  3NK9 A;  3DXJ C;  1GUG A;  4TQU S;  2F4I A;  1PTO B;  4C3I B;  2X6G A;  1CA6 A;  4IZ8 A;  2RSN A;  4IUN A;  5BN3 A;  1DCZ A;  2BA1 A;  4XT3 B;  2K04 A;  3H09 A;  2PQE A;  1V1P A;  2NBF A;  4G57 A;  3MAQ A;  1MBY A;  5C5L A;  1OXT A;  2EY5 A;  4FO2 A;  4NP5 A;  3ITP A;  1RF2 D;  2KCN A;  3BYY B;  4CBV A;  3WOF A;  2JSO A;  2F03 A;  3TBI B;  4CJ1 B;  2F0T A;  2SDF A;  2EXZ A;  1SNO A;  1EQV A;  3K0Y A;  4X3U A;  2ZT9 C;  2B2T C;  5E4X A;  1HCZ A;  1HXY D;  1LLR D;  1TII D;  3CQZ B;  4B9W A;  3SVM A;  1GUW A;  4FXG C;  3PV0 A;  1GJX A;  3SK8 A;  2AWN A;  1TS2 A;  1Z47 A;  5EKI A;  3GV6 A;  1OXX K;  3MEH A;  5I2X A;  3CRK C;  4A3I B;  1I50 B;  2KHS A;  3BVM A;  3PUX A;  1CHP D;  5KNB A;  3M3Y B;  2F3V A;  1YNJ C;  1RTO A;  3VYT A;  4IUP A;  2B8G A;  4C3J B;  4KK7 A;  4LJZ C;  5J1Z A;  4XQJ A;  5KGU A;  3RD4 A;  2PNR C;  1FNW A;  1SYG A;  1X3P A;  4UDU C;  5FO9 B;  1SBB B;  4HR7 B;  1BCP C;  1E2Z A;  4A3B B;  1JB3 A;  3C1E A;  1PZK D;  3VYS A;  3KLS X;  4NW2 A;  2R7Z B;  1PYW D;  5IOD A;  4KY6 A;  2K5D A;  4RH6 A;  4A3E B;  3O13 A;  1DD2 A;  2AQ2 B;  1LTS D;  1Q1B A;  2AQ3 B;  4FNF A;  4RKL A;  1QJO A;  5JAV A;  2F0O A;  2JE6 I;  3H91 A;  2O2L D;  2R92 B;  2NN6 H;  2FFK B;  1SXT A;  4FF1 A;  2HDL A;  3J80 E;  3HOX B;  1FYC A;  1M8A A;  2L1B A;  1CT1 D;  3NQI A;  3T13 A;  3GTP B;  3DWA A;  4WOR A;  1I4P A;  5FO8 B;  1JWM D;  4DF7 A;  5I9P A;  1ZEQ X;  2ID0 A;  1PLF A;  2IX3 A;  1YNJ D;  4I65 A;  5KYI A;  2A6E C;  1B53 A;  5CC4 A;  1O7Z A;  2M2L A;  4KD3 A;  1G2S A;  5M3M B;  1BBX C;  1EYD A;  1PDQ A;  3KF8 A;  3A8J E;  2Z8L A;  3T16 A;  4FXD A;  2XIW A;  1AZP A;  5IGF A;  3S9W A;  3IFT A;  1U4R A;  5EKK A;  1JOQ A;  4F87 A;  1HTP A;  1BDO A;  2O5J C;  2TSS A;  4DK1 A;  1LTG D;  4KY5 A;  2C9O A;  5LHY 1;  2CHB D;  1ONL A;  2XNA C;  2B2V A;  2YYZ A;  1F77 A;  2DNC A;  2NYZ D;  2EYP A;  1V1O A;  3N6R A;  4BY7 B;  1PTO C;  3HGB A;  4J1M A;  1I4Q A;  3EVQ A;  4O1N A;  2IWH A;  1B2T A;  4C2M B;  3HZX A;  3VA5 A;  1B9N A;  1JOK A;  1WTX A;  1STY A;  4OIK A;  2L4N A;  1CQF A;  3C3L A;  1EWH A;  1I3Q B;  5G3L D;  4BA1 I;  2A74 C;  3MTS A;  1BO0 A;  5KND A;  2A6E D;  1KDA A;  5I4D A;  5K36 G;  1DOK A;  2EYF A;  1RHP A;  1NCV A;  1G91 A;  4PMW A;  2E75 C;  5CV9 A;  1TS5 A;  1PFB A;  5CV8 A;  3CU7 A;  2XRS D;  5CR3 A;  3ONA B;  3A55 A;  1TU2 B;  2CQA A;  3PIP 3;  4FF2 A;  1MGS A;  2WII B;  3LX0 A;  4N9T A;  4FP5 D;  5J22 A;  3SK5 A;  5M5W B;  1PTO D;  4F7X A;  3PIO 3;  3TP6 A;  2NTS A;  2RKS A;  5JPM C;  5M5X B;  3PUY A;  4K8J A;  3Q22 A;  2PO4 A;  4RFB A;  4F88 A;  3IL8 A;  4PMB A;  3QIA A;  1XWE A;  3PMF A;  3EQL C;  2K32 A;  1PZJ D;  4LAA A;  1Y1V B;  5A2Q L;  1SE2 A;  1PZI D;  3VR6 A;  2E2D C;  3GTM B;  3D6W A;  4HN7 A;  4KMU C;  2D2C C;  4ABN A;  1VMP A;  4RGT A;  2NTT A;  1EU4 A;  3A56 A;  4RCN A;  1A15 A;  4A3F B;  4L8J A;  3OW7 A;  4IAL A;  3SHL A;  3DM1 A;  2J7Z A;  4N9P A;  5I6W A;  3S1Q B;  4C56 C;  3QOJ A;  2NWG A;  5C4X B;  3AU7 A;  2C5C A;  1MD2 D;  5K5P A;  4OIJ A;  2D5D A;  2AWO A;  4XQQ A;  3Q24 A;  4IUQ A;  1HA6 A;  2IT1 A;  1STG A;  4UAI A;  2KOL A;  4RHR A;  1F9R A;  1EZ6 A;  4X3T A;  2WV6 D;  5DAU A;  3HOZ B;  2RDG A;  5D65 A;  2WAC A;  1W6J A;  3S15 B;  3FRP B;  4TSS A;  1PXU A;  4BBS B;  3NP8 A;  2GA4 B;  2RDH A;  4CHT B;  4DAV A;  1G6Z A;  1T5X D;  3NWT A;  3QOL A;  3W2D A;  2EYO A;  1H9S B;  5FK9 C;  3K5N A;  1SMY C;  2BE5 C;  2EYH A;  3OPO A;  5C4J B;  1SFO B;  2H4O A;  5M3F B;  2R3Z A;  2A6H C;  4WFN 3;  3FEW X;  3P20 A;  4M1U B;  3VYU A;  2PZU A;  1IW7 C;  4ZYS A;  3E5S A;  5CV7 A;  1WTV A;  1Z7T A;  3SK6 A;  4E6I A;  5C3W A;  1WTP A;  2XSC A;  1OXV A;  5IGB A;  1H9J A;  1EWC A;  3M4Y A;  1ILP A;  4CKE A;  1E0B A;  1LAC A;  1ENF A;  1NUC A;  1QCB D;  5M5Y B;  1L0Y B;  1U4P A;  2L12 A;  1A2U A;  1Y8P B;  2AUK A;  5FKA C;  1KDB A;  2NZ1 D;  2F1M A;  4TRD A;  1LT3 D;  3I8Z A;  3JAM L;  2PW7 A;  1JCK B;  2B2Y C;  1OXS C;  1KAA A;  4P2C B;  5JEA H;  1BNZ A;  1LAB A;  1WD0 A;  1SYC A;  1SNQ A;  1I4H A;  2BE5 D;  5FLX E;  3QWN A;  1EYA A;  1HHV A;  2OEO A;  1HQM C;  2L5T A;  3CHB D;  1D5Z C;  1SE3 A;  3HOV B;  4OO1 G;  1EY7 A;  4ZLT F;  1DJR D;  3I73 A;  2A6H D;  1TR5 A;  1JOR A;  1EQT A;  2D9U A;  3K57 A;  1D5X C;  2MP1 A;  2BA0 A;  2NVY B;  1RDP D;  3LWU A;  3M7G A;  1ET9 A;  3TN2 A;  1LTT D;  1IW7 D;  1O80 A;  3KK7 A;  1TQO A;  3S2H B;  3T51 B;  2EE1 A;  2F0H A;  3FVQ A;  4ZKB B;  1ET6 A;  4DXG A;  3VR3 A;  2PYK A;  1V43 A;  3G6J B;  3A7A B;  5ELE A;  2ICI A;  2EJM A;  4OGQ C;  1BQQ T;  3GD7 A;  3X3N A;  1D1K A;  2IPK D;  3NPP A;  1ICW A;  1Q90 A;  1S5D D;  5IGG A;  3OWF A;  2CVR A;  1A3V A;  2M00 A;  3MHB A;  1CI3 M;  3RMH A;  4HMI A;  5ISR A;  1D1I A;  1ZXT A;  1SJH D;  5C4Z A;  1GUT A;  4DAP A;  2MJ8 A;  4KHZ A;  4K6L A;  1BOS A;  1SYF A;  1TWF B;  3BDO A;  1AW7 A;  2NVQ B;  1EEF D;  2A69 C;  2DN8 A;  1QWY A;  1QG7 A;  5EPK A;  5LL6 S;  5D3I B;  1K8M A;  1ZKO A;  5CGK A;  3NTH A;  2BOS A;  4RA8 A;  3I4M B;  5I6Y A;  3DMU A;  1J8I A;  5D14 A;  3MXN A;  5NUC A;  4IUR A;  4QUC A;  2DNE A;  5C0X G;  3DUZ A;  1A6X A;  4IFD G;  2QEJ C;  4HCE A;  4G7Z C;  2JEA I;  5KEE A;  4A3M B;  3LNN A;  3I4L A;  5C4H A;  2QF7 A;  4ZUJ A;  1VMC A;  3EJI A;  4J8Q A;  3BDL A;  3H3V C;  1JQY D;  1DZ1 A;  3I70 A;  3SEB A;  1GHK A;  1Q3L A;  2IL8 A;  1EU3 A;  1FR3 A;  2AQ1 B;  1CTM A;  1TT2 A;  5M9O A;  5IT9 E;  3I3C A;  2EY1 A;  5F2D A;  4FF3 A;  2CW0 C;  2B2W A;  4H44 C;  1IL8 A;  2JA8 B;  5CV4 A;  3J80 L;  4I7Z C;  3HOY B;  3S14 B;  3RUZ A;  4KKS A;  2N55 A;  1EY9 A;  3MA2 B;  3NSW A;  3GTK B;  1ILQ A;  3C46 A;  1K8O A;  2I07 B;  2F0F A;  1Q8I A;  3SE0 A;  3OHX C;  3BZD B;  4BY1 B;  2RSO A;  2R61 A;  1CFM A;  2PMZ B;  3VA7 A;  2JYO A;  1HUN A;  2IJ0 A;  3K6O A;  4XYO A;  1H9R A;  1UAP A;  4CJ0 B;  3L3O C;  3D4R A;  4C1N I;  5KIX A;  3T4A C;  3S16 B;  3D6C A;  3BS1 A;  1U4M A;  5I9O A;  1DM0 B;  1CM9 A;  3C1F A;  4XDX A;  1MSG A;  3GP7 A;  4A3G B;  2PCF B;  3BYT B;  3DWQ A;  1S4Z A;  4EVO A;  2Z4I A;  3F2U A;  1W6K A;  2G9D A;  4A3D B;  3TP5 A;  3NHH A;  3E6Z X;  2XN9 C;  5I2Y A;  4WJW A;  4LMQ D;  1TWG B;  3A8K E;  1B9M A;  3HOW B;  3D4W A;  2B63 B;  4XQN A;  3QG1 A;  1WTO A;  2E76 C;  1CHQ D;  4C3I G;  4BS9 A;  2IX0 A;  3P7J A;  4BBR B;  1B50 A;  3S2D B;  5DM6 3;  1BCP D;  4RHS A;  1KNE A;  1STB A;  5J39 A;  1SNP A;  2Q8T A;  2EPB A;  4C3H B;  1F9Q A;  3MFY A;  4NMZ A;  2Y0S B;  1HQR D;  3I72 A;  1G2T A;  1R4P B;  2OXP A;  4FXK C;  3TZU A;  1STN A;  3A54 A;  4H0L C;  5EJW A;  5D3D A;  2WKC A;  1TWA B;  1Q12 A;  4IUT A;  5FOB B;  4M8A A;  2H1E A;  2MUY A;  5DEH A;  3J81 L;  1JC7 A;  2LMC B;  2K1B A;  4L6T B;  3Q0A A;  4J6H A;  2TMP A;  5LL6 X;  1HPC A;  1DOL A;  4R8I A;  5COY A;  4IN3 A;  1O7L A;  2K33 A;  1EYC A;  3NUC A;  3BG3 A;  1D2B A;  3PO2 B;  5CMD A;  2A5H A;  2WAQ B;  4CGY B;  5BN4 A;  2NN6 G;  1HUM A;  3OOC A;  4C3J G;  2LS0 1;  1PRT F;  1XYI A;  1KLG D;  1BF4 A;  2F0L A;  2VUM B;  4JBW A;  1B44 D;  4B08 A;  5C3X A;  4K5W A;  1RCV D;  4V0B A;  3TP8 A;  4TKO B;  1AZQ A;  1A2T A;  2WKD A;  5ELF A;  3S17 B;  3J81 E;  4IUU A;  5C0X J;  4IFD J;  3A8I E;  3DHQ A;  1BUV T;  1WD1 A;  1EY5 A;  5FO7 B;  4HCS A;  4U67 3;  3I91 A;  5CV6 A;  3PO3 B;  2L9H A;  4CKB A;  1MSH A;  3DEP A;  1LTA D;  1X3Q A;  4PMC A;  5JVH 3;  2KVM A;  3H6M A;  4NKL A;  1QNU A;  1U9R A;  3D8G A;  1WCM B;  3HRZ C;  4XXE A;  1U4L A;  1IYU A;  4OO1 I;  4K2L A;  2B39 A;  1QE6 A;  1ENA A;  1JR0 D;  1TY0 A;  3MXU A;  3MXG A;  2FHT A;  5C3E B;  1SNC A;  1QIL A;  2EVB A;  3NTK A;  4MN3 A;  5JPN C;  2F0G A;  2EY6 A;  2A73 B;  3GTJ B;  3KLR A;  4HED A;  3NXW A;  1DON A;  4EGV A;  4ME5 A;  1ROD A;  3T56 B;  3GTG B;  1F9P A;  3RZD B;  3J7A V;  4R8N A;  4OO1 H;  4H13 C;  2F0S A;  4CKC A;  2SOB A;  2K6A A;  4K6D A;  3GO5 A;  1V1P B;  4A3K B;  2XVS A;  4A3J B;  4G7O C;  1KTK A;  2F0M A;  2A68 C;  1UNS A;  1Y8O B;  5JVG 3;  3BVG A;  4R9W A;  4DNR B;  3R2I A;  5HUR A;  1RKN A;  2Z4H A;  5FLX L;  4Q0F A;  2B2U A;  4ZQ3 A;  3FMC A;  5C5M A;  2F0P A;  1GXD C;  5IGD A;  3K59 A;  3KLS A;  2JA6 B;  4K8I A;  4S3S A;  1SSO A;  2ENB A;  2F0W A;  2JA5 B;  1PMR A;  1AFP A;  2WIN B;  4CJ2 C;  1ZYR C;  3S1R B;  4G4K A;  2Q8I B;  5ELC A;  2HQE A;  4XIG S;  3VR4 A;  2VNU D;  2O5I C;  2KEC A;  4DN4 M;  1K83 B;  5C0X I;  4IFD I;  1JE4 A;  2EJF C;  1GUN A;  2KA7 A;  1OXU A;  2F0U A;  1XX8 A;  2KEE A;  1NR4 A;  1O7Y A;  3A7L A;  4QMG A;  2F0D A;  2OT2 A;  3V96 A;  1V8Q A;  1SMY D;  5JJZ A;  5KNC A;  4A93 B;  1II3 A;  1F9S A;  4KJO A;  2MHV A;  3T53 B;  1S5B D;  3MFG A;  4ULL A;  3K7A B;  3EFX D;  1UEA B;  1LTR D;  1G8Z D;  4ZUI A;  1D5M C;  3CKI B;  2HCC A;  2HCI A;  2K5W A;  5IIF A;  2E74 C;  2JP1 A;  2XWB B;  4KJN A;  4H7B A;  4JK1 C;  5KRU A;  1EY4 A;  4DAY A;  2DY7 A;  1ZYR D;  1F2M A;  3VYR A;  2G9H D;  3QB3 A;  2PPB C;  2RQX A;  2RVL A;  4DU9 A;  1J9O A;  2NVX B;  1IKM A;  4G7H C;  3C2P A;  2BDN A;  2WP8 J;  3VR5 A;  3OMG A;  2KCC A;  4MIU A;  3SXH A;  1EY8 A;  1QNK A;  1ML0 D;  1CZG A;  1WTR A;  5A35 A;  5AFW A;  2ICE C;  4ZK9 B;  3NQT A;  4K14 A;  1D6E C;  5CYU A;  3K58 A;  1LTB D;  4KV6 A;  1QOH A;  2VXW A;  5IT9 L;  2RBM A;  2JEB I;  5G3L F;  4EQP A;  1JWS D;  2RDF A;  4FF4 A;  1SYD A;  3NBH A;  3DEO A;  2KJX A;  4QIW B;  4F8M A;  2PZT A;  5EBC A;  3D31 A;  1A3U A;  3NBI A;  1HFN A;  1LV9 A;  5EPJ A;  2FJ2 A;  1HFG A;  5JEA G;  3R2T A;  1EIH A;  5E3F A;  1DOM A;  1B4O A;  3OWE B;  3GQB A;  5T1I A;  3CRL C;  5EKL A;  3AMU A;  1PTO F;  2VB3 X;  1H9S A;  4DNT B;  1JOO A;  4L63 B;  2DY8 A;  4XT1 B;  2FIN B;  2PZW A;  2B2T A;  3SDZ A;  2K5Q A;  4BA2 I;  4ODG A;  3K5L A;  2QKI C;  4YIJ A;  1C8C A;  3U9O A;  1PTO H;  1I4R A;  2EYM A;  2L11 A;  4OL7 A;  5DNF A;  2B2W C;  2KUM A;  3RLF A;  4AYB B;  3KUP A;  1OO9 B;  2B8F A;  4ID6 A;  2A69 D;  4X3K A;  1F2Z A;  1AN8 A;  4QB4 A;  3R3O A;  1R4Q B;  4HAE A;  5CV5 A;  3Q23 A;  1YNN C;  3OSO A;  4KN7 C;  3MC0 B;  3I4N B;  3PUV A;  1H9K A;  1RD9 D;  3HS0 C;  1SND A;  4RAU C;  3PUW A;  3K5M A;  3URY A;  2NN6 I;  4GZY C;  1STA A;  1DYQ A;  1JWU D;  1WVL A;  3HOU B;  2F0V A;  3P1H A;  3KBX A;  1IHZ A;  1LTI D;  2K28 A;  3VR2 A;  1FNU A;  3MWY W;  3OIQ A;  1H9M A;  2CW0 D;  1Q1E A;  2E2I B;  5K36 H;  1EL0 A;  2ZXP A;  5DM7 3;  2KQ3 A;  1HRJ A;  1CQV A;  4HSP A;  5EGT A;  3S1N B;  3X3M A;  2QDB A;  1B1Z A;  2EYL A;  2K7V A;  1VDZ A;  3FDT A;  1SAP A;  2M9V A;  1SDF A;  4KKU A;  1EIG A;  1FD7 D;  1GUS A;  1YNN D;  1S5E D;  3NWS A;  1B3A A;  5C6A A;  2L0C A;  4DK0 A;  3J7A F;  1WTW A;  2L55 A;  3R8B A;  1I6V C;  2LKV A;  1HTL D;  1DXM A;  1KNA A;  3QJY A;  1LT5 D;  1IKL A;  1T5E A;  3L9A X;  4EQO A;  4DGZ A;  2F0E A;  3SR1 A;  2B2V C;  1Y69 U;  1EOT A;  2XRQ D;  1F2Y A;  3IKJ A;  3IAY A;  5HGT A;  3IFD A;  4ZRZ A;  1QB5 D;  3J7Y W;  4RWS C;  1TY2 A;  5IGE A;  3HP3 A;  1SYE A;  3GV3 A;  2JXM B;  4XTC S;  4DFA A;  4KN4 C;  1ENC A;  3AB9 A;  2LY7 A;  2SNS A;  3RZO B;  3D4D A;  5KYL A;  2JA7 B;  4DA2 A;  1XXG A;  1PRT B;  1CK1 A;  2LFN A;  1NR2 A;  3OMC A;  3I90 A;  1EZ8 A;  3KBG A;  4KHV A;  2SNM A;  3EA6 A;  2ZXO A;  1ESF A;  4QUF A;  4PNY A;  1VF5 C;  3R93 A;  1MI2 A;  3U9S A;  2PW5 A;  2EYJ A;  4K5V A;  1SNM A;  4QF4 A;  2EJG C;  4RGN A;  4KTA A;  4NDX A;  1C4Q A;  2EY2 A;  1GOZ A;  1EEI D;  3H94 A;  5JEA J;  3ND9 A;  1TS4 A;  2F0Q A;  1VCI A;  1KLU D;  3FPU B;  2E2J B;  2F3W A;  4PV1 C;  1Y8N B;  5IGC A;  4V19 0;  3ND8 A;  2OF1 A;  1XTC D;  3BVZ A;  4Z9C B;  3GTO B;  2IX1 A;  1AEX A;  2FMM A;  2BDO A;  5CBE E;  2X69 A;  3S1M B;  1RTN A;  1CA5 A;  2D62 A;  1STE A;  5ELD A;  2R93 B;  3WDN A;  1S5C D;  1I4G A;  1SE4 A;  4HMJ A;  2K01 A;  4C1N K;  3G7L A;  2Q8R E;  4Y7N B;  1EY0 A;  1UUP A;  3FKI B;  1NAP A;  2EDG A;  3HEJ A;  2I46 A;  3V2T A;  1O78 A;  4KD4 A;  2F0N A;  4RKB A;  1L0X B;  4RGO S;  4C3H G;  4HSV A;  3MXP A;  1SEB D;  4O42 A;  4K2K A;  1TVX A;  3V05 A;  1TKW B;  3M85 A;  3K5O A;  2KED A;  1FNV A;  1JIC A;  2QIL A;  1LO5 D;  4EQN A;  4LK1 C;  2RA4 A;  3LWE A;  1GUO A;  2EOT A;  4K5X A;  2YU9 B;  2WB1 B;  3TSS A;  4B9X A;  1EY6 A;  5A2Q E;  4MHE A;  3MVV A;  2ZXR A;  2VB2 X;  1SJE D;  4IUV A;  1ESR A;  1SYB A;  2J4X A;  1I6H B;  1HA5 A;  3H0G B;  2B2U C;  3ERO A;  2F0K A;  3SK4 A;  3W3A A;  2NB0 A;  1Z6H A;  4Q5V A;  3FPP A;  4KY7 A;  4IQZ A;  5EQ0 A;  2X6L A;  5COR A;  2XWJ B;  5JOB A;  2FMC A;  2R6G A;  2HUG A;  3OIP A;  1BXT A;  3WOE A;  1G29 1;  1S5F D;  5C44 B;  1PRT C;  1R9T B;  2SEB D;  3BDC A;  1PFM A;  2EZV A;  4QCL A;  2K05 A;  4KKT A;  2A68 D;  5CBA E;  2B2Y A;  1GHJ A;  3MZ5 A;  3HKZ B;  1E2V A;  4XYQ A;  4ILW A;  1KAB A;  2F0I A;  4OHJ A;  3TZD A;  2BCO A;  2MGS A;  3ERQ A;  1EFI D;  3E0J A;  5C0X H;  1CZW A;  4KI0 A;  4IFD H;  2MPM A;  1BCP B;  3TME A;  3GTL B;  3M7N A;  1IYV A;  4FYD A;  3NTI A;  2V4D A;  4DXF A;  1M4V A;  2F0J A;  1RJT A;  3GTQ B;  5ELB A;  5IOC A;  4ZKC B;  1BCP F;  2HDM A;  2K03 A;  4HTH A;  3NE5 B;  1BR9 A;  1C48 A;  2IW3 A;  3UI2 A;  2AUJ D;  2J0T D;  2NUC A;  1KDC A;  4U68 A;  3QO2 A;  3DWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...