2B8GA

Solution structure of bacillus subtilis blap biotinylated-form (energy minimized mean structure)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Biotin/Lipoyl Attachment Protein
publication title solution structure of Bacillus subtilis BLAP biotinylated-form (energy minimized mean structure)
rcsb
source organism Bacillus subtilis
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b8gA00
1Y8NB 4JBWA 4KN7C 4XTCS 3MFYA 1GUNA 1QJOA 4G7HC 2NN6G 3BDOA 1LABA 4L8JA 3OW7A 2DN8A 1LACA 1VCIA 2B8GA 2KCCA 2O5IC 4IFDG 1FR3A 2BE5C 1HQMC 1ONLA 1B9NA 2A6EC 4BA1I 1Q90A 1YNNC 2D62A 1HCZA 5KNBA 2JEBI 5KNCA 2A69C 1O78A 5K36G 3VR6A 3A8KE 2EJMA 3M7NA 1IYUA 2PNRC 3VR3A 4OO1G 1BDOA 4DNTB 2B8FA 1Y8OB 2A6ED 4LK1C 4KMUC 2K32A 4G7ZC 4KKTA 3D4RA 4H44C 1E2WA 3VR5A 2A69D 5A35A 3PUWA 1PMRA 3PUYA 1TU2B 5C0XH 2BDOA 2PPBC 3PUVA 2KA7A 2NN6H 3OPOA 2JEAI 3FPPA 3A8JE 3QG1A 4HR7B 3NE5B 4IFDH 3BG3A 1K8MA 3M4YA 2L5TA 2EVBA 2AUKA 1OXVA 2D2CC 3IFTA 1V8QA 1GHKA 5K36H 1O7LA 2E75C 1Q1BA 2E76C 3T53B 1Y69U 2A6HC 3PUZA 1IW7C 2BE5D 3I4LA 2A68C 3A7AB 4BA2I 4DNRB 1HPCA 3RLFA 3QJYA 4XIGS 2JXMB 1CFMA 3D31A 3T51B 2ZT9C 1GJXA 1E2VA 3L7ZC 2A6HD 4KI0A 2F1MA 1IW7D 3CRKC 3KLRA 1Z6HA 2A68D 3W3AA 3GD7A 2QF7A 3N6RA 3A7LA 3MXUA 1OXTA 4DK1A 1Q12A 3DXJC 4KKUA 4PV1C 1A6XA 4KHZA 2LMCB 3LNNA 1GUGA 1Y8PB 3LWUA 4RCNA 2Q8IB 2CW0C 5BN4A 1H9SB 2BA1A 3A8IE 2DNEA 1H9RA 4IQZA 3TZUA 1OXSC 1CI3M 1VF7A 2NN6I 4I7ZC 3SE0A 3VR2A 3I72A 3WDNA 2PCFB 5BN5A 4KN4C 4OO1H 2EJFC 4DK0A 2D5DA 2EJGC 1YNJC 1EWHA 1T5EA 3FMCA 3PV0A 5JEAG 3HGBA 5BN3A 5C0XG 1IYVA 1HTPA 1CTMA 4OGQC 1H9JA 3OOCA 4TKOB 1ZYRC 2JE6I 1GUSA 1GUTA 3PUXA 1Q1EA 1TKWB 1DXMA 3EQLC 4LJZC 1H9MA 3ND9A 2O5JC 2K7VA 3ND8A 2DNCA 1VF5C 5KNDA 1OXUA 4KKSA 3T56B 1I6VC 1VDZA 4TQUS 1G291 2YYZA 1FYCA 3CRLC 3GQBA 3IKJA 1V43A 2K33A 2R6GA 3AB9A 1K8OA 3QIAA 2IT1A 1SMYC 3M85A 1GHJA 3SDZA 1E2ZA 1GUOA 1ZKOA 1DCZA 2BA0A 4H13C 3VR4A 2EDGA 1OXXK 2AWOA 4G7OC 3P20A 4H0LC 1DD2A 3VA7A 2E74C 1H9SA 1H9KA 4GZYC 2AUJD 1Z7TA 3I73A 3H94A 2V4DA 3U9SA 1B9MA 5JEAH 4JK1C
chains in the Genus database with same CATH superfamily
2QA4A 4XTCS 1TWCB 4G7HC 3D6CA 4FNFA 2PQEA 1TS4A 3BVGA 1LACA 1VCIA 5D14A 4NXNL 2JA5B 2RCNA 5G3LF 3Q22A 5JPMC 2ZTEA 2WB1B 3MXGA 3L3OC 4IOAA 1TWHB 4X3TA 2ZXPA 2A6ED 4KMUC 3CCMA 2RSNA 3D8GA 1CM9A 3PIOA 1O7ZA 4YWLA 5EKLA 2YTYA 1KDAA 4IUTA 2VW9A 1QVGA 3BVZA 4QIWE 4HJAA 4ZUJA 1WTOA 3B6YA 3EIVA 1PRTD 3OWFA 3GTGB 3L0OA 2X6LA 4WRDA 3K59A 4IFDJ 5I2YA 3R8BA 1FJGL 2EY6A 5COYA 4NKLA 2QGQA 1ESFA 3J80E 1I5FA 1EWIA 3E6ZX 1C0AA 5D3IB 2B2YC 3OHXC 3KF8B 2JXMB 5M9OA 3AQQA 5HGQA 5KGUA 2EPBA 1LV9A 1O80A 2A6HD 2BH8A 2HCCA 3CMEA 2C9OA 4WORA 3KFUA 3T1YQ 2PQAB 1Q3LA 3OSOA 3H91A 4HIKA 3MXNB 3NTKA 2WB1E 4DAVA 4BBRH 1SROA 5E7NA 2K6AA 2NZ1D 4K2LA 2NN6I 3RN5A 3RZDB 3IAYA 3D3RA 4BY7H 1I4QA 1A2UA 2NTSA 3G7LA 5IWAQ 1PLFA 4DK0A 3M7GA 4JI2Q 1E7ZA 2R3ZA 4GKJQ 5LL6X 4RGOS 4UAIA 1VQEA 4OIJA 4LW1A 2FINB 3K7AB 2B2VA 1C8CA 1VQAA 1YEZA 1D5XC 1VDZA 1PFSA 4OIKA 3S24A 3P75A 3T16A 4AQYQ 1YIJA 2VUMH 5M5YB 2E5LQ 3GTMB 4CHTB 4ID6A 1PTOF 2F0UA 5M3MH 3S14H 1JOQA 4DR4L 3K7UC 5JEAH 1KTKA 5C5LA 1A15A 3VYSA 3R2IA 3S16H 2NN6G 4FXKC 1WTXA 4A3IH 1OO9B 3TMEA 4GN5A 1T5XD 4J1MA 5CV7A 2J0TD 4PZ7A 4JI6L 2A69C 2UXDQ 4HTHA 1HFGA 2PNRC 3V2TA 1HNWQ 4KD3A 1AEXA 2VQEL 3ULPA 2VZAA 3TDQA 1YNND 1FNVA 1PDQA 3VR5A 4LMQD 3ULLA 5IGCA 3ITPA 2F0NA 3CPFA 3PIP3 1KAAA 1E1TA 2LKVA 5GAHC 3RN2A 1FNWA 2L1BA 4TRDA 3OPOA 4DAYA 4HJ9A 1GOZA 4YY3L 2A73B 1V1QA 1YJWA 3HOWG 1HZBA 2Q8RE 3K6OA 2EE1A 3HOVH 1JJ2A 3SHLA 5C0XI 1PVOA 1UE5A 1WJJA 2K50A 3A74A 1SYFA 1B4OA 2UUCQ 2NVQB 3UE0A 2XWJB 4IFDI 5J3BA 5IGGA 2EYHA 3MC0B 3OYYA 1FGBD 3MHBA 1KDCA 2JK8A 2JA6B 3GDEA 4A3LH 1I94L 1RF2D 3E5SA 4A3JG 4PMBA 4F87A 3W3AA 2R93B 3NSWA 3CCEA 3KK7A 1OXTA 1ET6A 1IYJB 1EY6A 1PYSB 1SNMA 3LNNA 4JI0L 1N8RC 3NHHA 3S1MB 4HCSA 1H9SB 2BA1A 5C4XB 1P16A 1VQPA 3NTHA 3HS0C 4POGA 2XGTA 4R4IA 3AMUA 2EJFC 2LXJA 2A19A 3NQIA 1N36Q 4IUNA 1C4QA 3CC2A 1WYDA 5C0XG 1XPRA 2PW5A 2Z4HA 1H9JA 2KENA 1WCMB 2JE6I 4J8QA 2Q2UA 2UU9L 1XMQL 1EQRA 1KLGD 1A8VA 5ELNA 3GTKB 4DN4M 3T56B 1BCPD 1SYBA 2PI2E 1LTID 2G9HD 5E4XA 1PXUA 4GKKL 2HHHL 3F1ZA 2Q2TA 4JC0A 1PHJA 2KOLA 2Y0SG 4H0LC 4R9WA 4X66Q 1H9KA 3I55A 3GTJH 1EU4A 2V4DA 1D5MC 4DV6Q 4X62Q 1BR9A 4KN7C 2NZHA 1QJOA 2F03A 4DR1L 1ET9A 3RLNA 4L8JA 1QOHA 3J7YW 3E9HA 4XT1B 4DV1L 1ONLA 3FKIH 3NBHA 2D62A 5KNBA 2FFKB 4HIMA 1EWCA 4IUVA 1G8ZD 1VQGA 3SK6A 4LFBL 4JCVE 3JAME 1L1OC 1AP0A 1IBKL 2K32A 3VYTA 4KKTA 5IYBH 5D65A 4HSVA 2QCPX 4OL7A 3BZKA 5LMNQ 1JCKB 1JICA 1R4PB 2ICEC 3F8TA 3QG1A 2IWHA 3J80c 1LTLA 2K4KA 4ZKBB 3T1HL 4HEDA 1YNXA 2CKZB 5J39A 3VDYA 2IJ0A 1GHKA 2GVAA 3M4OB 3H3VC 4K0KQ 1SJED 4RAUC 3HOZB 4DR7Q 4LF4Q 3URYA 3TP5A 2A68C 4BA2I 3S17B 1TWFH 2CWAA 1Y14B 3QJYA 2JA7G 1JWUD 4KLKA 1XPUA 1E2VA 2PW7A 3L7ZC 2RBMA 4BXXH 1MSHA 1GO3E 4C3HG 1VQ9A 3AYHB 2QF7A 1Y1VG 3MXUA 4KHZA 1DOKA 2L0CA 2MO0A 3GTPB 1ENCA 4EQ5A 4DA2A 4QQBX 2FMCA 3VR2A 4BY1H 1ILQA 4ZLTF 1Y1WB 4B3MQ 2NYZD 4DKAC 1D6EC 1F9RA 2CW0D 2WAQB 3PO3B 1TWGB 4X3SA 2BH2A 2R7ZB 1BBUA 3I8ZA 3OOCA 4ILWA 2XTIA 3I56A 1ZYRC 3SEBA 1IL2A 1TKWB 5IODA 2UXCL 2H5XA 2RHSB 1W3SA 5KNDA 4YWMA 1I6VC 3KOJA 4L63B 5HGTA 4Y7NH 3ZJYC 5IT9L 4LF5Q 1LYLA 1SE2A 2CFMA 2OT2A 4YCVA 4CKCA 2E74C 4LFAQ 2AWNA 3U9SA 1HHVA 1FNUA 2KEDA 4DPGA 3LWEA 2DY8A 4A93H 1VQ4A 2HIVA 4A3JH 2B63G 4YWKA 3TP8A 2QEJC 2BE5C 3FVQA 1VQKA 1HQMC 1KLUD 2A6EC 1B9NA 1CZGA 5BR8L 4AH6A 1TWCH 4B08A 1DZ1A 4MTNA 2JA5H 5C4HA 1RDPD 4TVAB 5ISRA 5IIFA 2P5ZX 4B3RQ 1GVPA 4PMCA 4K5VA 1QCBD 4ME3A 4XQNA 3D4RA 2LXKA 3R93A 2E2HH 1PRTC 2CWPA 3PUWA 1L1OB 2WAQE 4A3GG 4JI7L 1TWHH 5C0XH 2PZUA 3HOUG 4C3JG 2QEXA 5A2QL 1RTNA 2X69A 4IFDH 3BG3A 5I4DA 1KRSA 4DR6Q 1BQQT 3I4MG 1LTBD 1SNDA 1EYGA 1JT8A 2ZJPA 2A6HC 1JR0D 4S3SA 3GTGH 1QUQB 1KNAA 1SNQA 1ESRA 4DV3Q 1UE7A 1GKHA 1GD7A 1EQTA 2F0HA 3GV3A 4HIOA 4RHRA 4YCUA 4O0AA 2UUBQ 2GVBA 1HUMA 2OXPA 3KJOA 1YITA 3L9AX 2XNAC 4ZK9B 4DV2Q 5E4WC 3HOXG 1RL2A 3A8IE 3TZUA 3EA6A 3VYRA 3KDFA 4I7ZC 2R7FA 3I72A 1GUWA 2FHTA 4QCLA 1ENFA 4GS3A 1SNOA 2ZXOA 1NUCA 3RZDH 4IPHA 1N32Q 4C2MB 3U58A 1ASYA 3EQLC 1T9HA 5L37A 2K7VA 4WJ4A 5E3FA 1G2TA 5EPKA 1XX8A 3CXCA 2R92B 2LS01 1J5EQ 1D2BA 3K7AH 1CSQA 3BDCA 1QILA 3H15A 1WD0A 1DONA 3P20A 5IT9E 4B3SQ 4QMGA 1Z7TA 5IGFA 2N55A 2JA7H 5M5YH 1SMXA 1KC8C 2F0KA 1LTAD 3X3NA 5ELFA 4DU9A 2HCIA 3D6WA 2K1BA 3JAMc 5CGKA 3VA5A 4DV0Q 2VQFQ 3S2DB 1YNNC 3T1YL 2JEBI 5KNCA 2WKDA 4IJLA 3G6JB 4NXML 1A63A 3A8KE 2XRQD 4OHJA 1VS0A 4QUCA 2B2TC 2F0QA 2NBFA 5ELCA 1UAPA 4DV4Q 1RTOA 4FVMA 5A35A 1X9NA 5IWAL 5AJ3Q 2VNUD 3PUVA 2I07B 4HSPA 1HZAA 2JEAI 3HG9A 2EYJA 4MHEA 1NAPA 1X3EA 4IALA 4QUFA 1K8MA 2OTJA 3RZOB 1YVCA 2ENBA 2DGYA 5K36H 3K5OA 3S2HB 3IRBA 1WTPA 1HNZQ 1F2YA 1FD7D 4OX9Q 4BY7G 1I4HA 4QL5A 1Q86C 2B2UA 1F9SA 3RLFA 2E5LL 4GNXA 1CFMA 2ZT9C 4X6AH 3M4QA 4YHHQ 4V0BA 5IP7H 2B63H 4UPAA 2TSSA 2Z8LA 5EPJA 4XYOA 5FO8B 1MSGA 1KL9A 1RIPA 1HRJA 1S5BD 3OMGA 3IL8A 3TS0A 4KHPQ 4IQZA 3JC66 2UXDL 3S1MH 2SNMA 1YNJC 1T5EA 3FMCA 2Z0SA 5JEAG 1WI5A 1BCPC 4A3GH 2F3IA 4PNYA 1VQBA 3EFXD 5CV9A 2G5DA 1Q82C 4A3DG 2B2TA 2KCNA 1GM5A 2X6GA 1TIID 1VQIA 3W1BA 1I3QH 2B39A 5IYDG 3PO2B 1KIXA 2NB0A 3IKJA 4UDUC 2R6GA 2EXDA 3AB9A 2AQ2B 3E0JA 4DR3Q 3I4MH 1HZCA 4EGVA 2E2JB 3GTKH 3E3XA 2PZWA 3TRZA 3D4WA 4F88A 2XVSA 1NMGA 4P74A 2YU9H 1PH3A 3UI2A 2OEOA 3J7ZC 4R4QA 4Q0FA 4JBWA 2ZJRA 2I0QA 5IOCA 1J9OA 2IX3A 5KEEA 2Q8TA 2EYPA 4HMIA 1R4QB 4HIDA 3HOVG 2SEBD 2A5HA 4NDXA 3A54A 4DV7Q 4A76A 4DNTB 4LK1C 4G7ZC 3HKZG 1X56A 2N3SA 4O1NA 3C3LA 5CV5A 1E2WA 2B2WA 4KJOA 3P7JA 4DUYQ 1TU2B 5I2XA 3R3OA 5I9PA 4FF2A 5JVH3 3FPPA 1PYWD 3EVQA 1E3PA 3ERSX 1XPOA 1OXVA 1SFOB 2EOTA 1V8QA 1F2MA 3M4PA 2KCTA 3CC4A 4GN3B 2E75C 4R4OA 4K8JA 4A4IA 5CC4A 1BNZA 3PGZA 5EBCA 5M3FB 2BE5D 2B2VC 1TT2A 3K5NA 4CJ1B 5HURA 4U68A 2K5NA 2F0LA 3D31A 4FO2A 5CV8A 4X66L 3HOZH 4L5RC 4DV6L 2KCMA 2Z6BA 4C1NI 3KF8A 3CCSA 3S17H 4UHVA 1Z6HA 2LFNA 1WD1A 1RODA 4DUZQ 4R1JA 4P71A 4PV1C 4RHSA 2FJ2A 4NP5A 2CW0C 2QDLA 1UEAB 2F0JA 2PQAA 2UUAL 5IGBA 3RUZA 2MFIA 2PCFB 5CORA 2Z1CA 3JAMi 1X54A 1VMPA 5I6YA 2JN4A 1PH4A 2F4VL 4RH6A 4TKOB 1EYDA 1HZ9A 2IW3A 1X65A 4KD4A 1KNEA 1Y1WH 1BCPB 3GV6A 1H9MA 4HJ5A 3G4SA 1TWAH 3C46A 3PO3H 1TWGH 5IT9c 3CW2C 3FKIG 1ICWA 1G291 2YYZA 3S1NB 1D1IA 2K14A 1XWEA 3H6MA 4RGMA 2F0FA 5FKAC 4JI1Q 5H1SE 4OXPA 4MIUA 2Q2IA 4A3FG 4KJNA 1AE3A 4K0KL 2PNHA 1DD2A 5IYBG 4DR7L 4LF4L 5KYIA 5LMUQ 2NZOA 4RGNA 4BBSG 2OF1A 1EY0A 4EQOA 1JC7A 1BO0A 4JV5Q 3J7AF 1F9PA 3F2UA 3G6EA 1PH9A 3RNUA 1BOSA 1JE5A 4PZ6A 5EJWA 2DJGC 2AKWB 3LGJA 5EAYA 1PFBA 1JOKA 2O4XA 2WP8J 3KBGA 1NCVA 2JJQA 3UDIA 4A3KB 1OTCA 1N33Q 4B3ML 4UP8A 1CQVA 4BXXG 2C5CA 5C44B 1B8AA 3G48A 4A3DH 1QZHA 5C3EB 4CDDC 5HY6A 5IYDH 1X55A 4KY5A 4A3MB 2PI2A 4ME5A 3JAML 4BY1G 4JI3L 1W2BA 1K8AC 3S15B 1R9TH 1EIFA 2I5MX 3H0GB 4LUOA 5G3LD 4RFBA 1HR0L 2F0OA 4XIGS 5JJLA 4DR2Q 4LFAL 1A62A 3QWNA 2NVYB 5ELBA 2CCZA 3KLSX 2EY5A 4BS9A 2HUGA 4XXEA 3S1RB 2EYFA 1I6HH 1TY2A 2ZTDA 2Q8IB 2MNAA 5BN4A 1K83B 3DLLA 1QWYA 4YCWA 4P2CB 5EQ0A 5C3WA 4DV5Q 4RA8A 1QVFA 5IP9H 2K03A 3HGBA 4RKBA 2ES2A 4B3RL 3TSSA 2OQKA 4A93G 3SR1A 1LTRD 1NNXA 3TZDA 2NVXB 2F0GA 1CHQD 1YJ9A 2BOSA 2DNCA 1LTGD 3OMCA 2ZXRA 4V190 3CRLC 1L0XB 3KF6A 4ZCKA 4DR6L 2JA5G 1E2ZA 1GUOA 4JBMA 2AWOA 2RCFA 2IY5B 1S5DD 2OWOA 1RHPA 2WB1G 4DAYB 2IX0A 3U4VA 2ZM6L 3H94A 3J7AV 4A3BB 4DV3L 3QO2A 3V05A 4DF7A 4OWTB 2Z4IA 4QY7A 2F0TA 4ABNA 4F8MA 1AZQA 4IFDG 1NE3A 2UUBL 5ELEA 3EBEA 4A3EB 2KQ3A 1YNJD 2JA8B 3I4OA 3EN2A 1Q46A 4RWSC 4DV2L 2EJMA 2RDHA 2SDFA 1BDOA 3TN2A 2WIIB 3S2DH 2UXBQ 1S4ZA 2F52A 4DK3C 1PZID 1VQ7A 5ELDA 1WTRA 1STYA 5J22A 4NXNQ 2WACA 2KA7A 2E2IB 3TP6A 1EY4A 1AW7A 5EPLA 3X3MA 1XYIA 1AN8A 1VQJA 1PTOD 4X65L 3RR5A 2A8VA 2EZVA 2DY7A 4DAMA 1J5EL 2CVRA 4Z9CB 4A75A 3BJUA 1E24A 3RZOH 4A3FH 4GOPA 3NELA 1X3GA 4B3SL 1IBMQ 1LT5D 3M3YB 2ASBA 1V9PA 3CP0A 5EGTA 1TS5A 4BBSH 1CKNB 3NENA 4JI8L 2EYMA 2N49A 1B50A 1F9QA 2D0OA 3NWTA 1A6XA 4UP9A 4CKBA 3LWUA 2C35B 1EQQA 5C6AA 4DV0L 2H1EA 3J81i 3PSIA 1EY8A 3ICEA 1A2TA 1PH8A 1NR2A 3STBD 1CT1D 3HOYB 3NBHB 3TS2A 4PG3A 3TEHB 1EL0A 1Q1EA 5AJ3L 2QW7A 4L5QA 5JJIA 2BCOA 4C3IB 3ULJA 4B3TQ 5FO9B 1V1OA 4JYAL 1VQCA 3AU7A 3NP8A 1XTDA 1V43A 2K33A 4R8IA 2IT1A 1SAPA 1NY4A 3G71A 2EY2A 3D4DA 4QGUA 1TS3A 4FXDA 1SNCA 1LTTD 1HNZL 2RA4A 1QB5D 4OX9L 3W2DA 1GXDC 5EKIA 2E2JH 1Y8NB 3CQZH 1B7YB 1VQDA 4POFA 1SE3A 2O5IC 1VQOA 3DUZA 1QG7A 3DM1A 3NBIA 2B3GA 5FOBB 3T13A 2MP1A 1UE1A 2K5DA 2J7ZA 4YHHL 1WOCA 5ELOA 5K36G 5CBEE 4LF8L 1LTSD 4KK7A 5CBAE 1K28A 2SNSA 1F2LA 3BDLA 1FGUA 4I7AA 3KLSA 4PZ8A 2VB3X 4K14A 1UEBA 2F0IA 4DK6C 3I2ZA 1K3BC 3A5ZB 4KV6A 5FLMG 1CKOA 1LT4D 3A8JE 4BBRB 1QNUA 2NUCA 5IP7G 2ALYB 1DOMA 1ENAA 3SVMA 2JA6G 3MA2B 3PMFA 4IO9A 3CAMA 4HN7A 2XSCA 4OONA 5D3DA 4QB4A 1HJPA 3J81L 1SDFA 2IHEA 2R93G 4Q5VA 2VQEQ 1NR4A 5C5MA 1CSPA 4DR3L 2HQLA 4GLVB 3UDFA 1N34L 1II3A 1TXYA 3AFQA 3DM3A 5C4XG 3OTOQ 3F2CA 2AHOB 1PH6A 1K0RA 3I4NB 1X6OA 3K5LA 1GJXA 5M3FH 3MVVA 1LUZA 2JSOA 3KLRA 5FK9C 3UE1A 1QE6A 2VUMB 3U50C 4ZYSA 1D5ZC 3U9OA 2KEEA 1M90C 1AE2A 1WCMG 1I4RA 3MEFA 5M3MB 3S14B 3UDGA 1S5CD 5F2DA 1HNXL 1QNKA 3OWEB 2N8NA 3SE0A 2VXWA 4OELB 3WDNA 1EEID 1I94Q 1L0WA 4A3IB 2KHIA 3C1FA 1L0YB 1PFNA 1KHIA 2RDFA 1BVSA 3BS1A 4DR5Q 1CA6A 2ZJQA 4OGQC 4GLAC 4ULLA 1EY5A 1EFID 2FXQA 1GUSA 2JA9A 4CKEA 3HZXA 4DUYL 1NBWA 4OO1I 2K5VA 4LF7Q 2A1AA 2ZTCA 1J6QA 1SYCA 1JE4A 2KJXA 1YI2A 4X3KA 1KABA 4X3UA 4H13C 1IHZA 5T1IA 1SE8A 4G7OC 3IFDA 1FL0A 3S1NH 4LUZA 1PH1A 3K8AA 1SLJA 3K57A 5JPNC 3MWYW 1K0SA 3CCVA 4GLXA 1GUNA 1CA5A 1U9RA 2A74C 2J4XA 2HT1A 4QF4A 4EVOA 4AYBB 4UP7A 1AZPA 2ATWA 2K52A 1FR3A 2B2UC 2HHHQ 4BA1I 5DLQE 4GNXC 5JOBA 5C4JB 1CHPD 4FXGC 3BU2A 2OTLA 4FDBA 4OO1G 2DJFC 3CCRA 5FJ8H 2NVTB 4JVZA 4NB3A 2B29A 3HOZG 1J8IA 3MTSA 1ASZA 2EY1A 4K6LA 4OWWB 3GTMH 4A3KH 4HR7B 4J15A 3QR8A 4CDCC 3KDFB 4IUUA 4O2DA 5IGDA 1BF4A 1IBLQ 5J1ZA 1XJVA 1M4VA 1A0IA 3J81E 2RDGA 1F2ZA 5AFWA 1Y69U 3C2PA 3PF4A 5DM73 1HXYD 1NTGA 4A3MH 4OWXB 3CCJA 5E1FA 3F2DA 5GQOA 1B3AA 3HP3A 3PIO3 4JI2L 5LMUL 2F1MA 4LFCQ 1Y1WG 3FPUB 3H0GH 4GKJL 1PRTB 2WAQG 4AYBE 3PO3G 1RKNA 3A7LA 2R7ZG 1LT6D 1GUGA 4RCOA 4RCNA 1K73C 1S5FD 4OEMB 5CR3A 4JI5Q 2PMZB 2MPMA 1O7YA 1CI3M 1VF7A 1G2SA 1PV4A 4HCEA 3TBIB 4A3CG 4AQYL 5KRUA 1K83H 1Q8KA 1JJCB 3CC7A 1VQHA 2NVQH 2WFWA 2XIWA 3CMAA 5CMDA 3PUXA 4O42A 5FLMH 2JA6H 1VQMA 4KY7A 2GN5A 3Q8DA 1OXUA 1IL8A 2B2WC 4WJ3M 1G51A 4G57A 5JAVA 3M85A 4MNOA 2R93H 2MO1A 3H3VI 1EY9A 2CHBD 1S72A 1JOOA 2E2DC 1SYGA 3WOEA 5C4XH 1STAA 5K5PA 1HNWL 4FF4A 1X3FA 1U4PA 4RKLA 1X3PA 3BZDB 1SYEA 4DR2L 1SYDA 1U0LA 1V1PB 4IZ8A 3Q6SA 2B8GA 2KUMA 4P75A 2OCEA 1AH9A 1TWFB 1HCZA 1WCMH 2Z6KA 2RQXA 3VR6A 1NJIC 4GNXB 1IYUA 2JA8H 1M1KC 2PMZE 1XTCD 2F0EA 1HH2P 2RF4A 4EQPA 1NSNS 2UUCL 4BWGB 1XMOQ 1XNQQ 3PUYA 3RMHA 5FLXL 1PTOC 1Z47A 2JP1A 4B9XA 5BR8Q 3NPPA 1PA6A 4HMJA 1W6JA 1JMCA 2I46A 5C4ZA 2E2IH 3EROA 2AQ1B 1JQYD 2YTVA 1HTLD 4HAEA 2K5WA 4U673 4JI7Q 4L6TB 5IP9G 3HOWB 4N8X1 1X3QA 1EFWA 1N36L 4WJWA 4H7BA 4N9TA 2RKSA 2EXZA 1YBYA 3M3YH 1QZGA 1Q12A 1MHWC 1C48A 1BBXC 3STBC 3W1GA 3AEVA 4IPDA 3MZ5A 4N8FA 4OO1H 1JWSD 2L55A 1D7QA 4A3JB 2R92G 1EOTA 4N9PA 5BN3A 3M4OH 2UXBL 1KDBA 1IYVA 1CTMA 1XNRQ 3S1QB 1KRTA 1A3VA 4LJZC 1D1KA 4X62L 1DGSA 3NK9A 2MJ8A 3U4ZA 3HOYH 1ZXTA 5M5WB 4DGZA 1A3TA 3E9IA 4AIMA 2K5QA 3GO5A 1K8OA 2E2HB 1BUVT 4G4KA 3Q24A 4C3IH 2K28A 4JOIA 2F0MA 1IZ6A 1MJEA 2EYLA 3MXNA 4RMFA 1MKHA 1PH7A 1C7YA 1MD2D 3GTPH 1TS2A 4X64Q 5GAEC 3PQIA 2HDLA 2M2LA 1P8LA 3MAQA 1YHQA 1IBML 5C3XA 1ILPA 4M1UB 5C0XJ 3OIPA 4LAAA 5LMNL 2N88A 2R7ZH 1YHBA 2Y0SB 3WOFA 1Q8IA 3CCUA 3KBXA 4LF6Q 4CDEC 3PCOB 4A3CH 2IL8A 3SXHA 4P72A 1ML0D 3FRPB 2TMPA 5FLXE 4K5XA 4XQQA 2VL6A 3J81c 2MQHA 5JVG3 3I70A 1PTOB 2QDBA 2PZTA 1TY0A 3M4YA 4NXMQ 2L5TA 3GTQB 1CKMA 4CDFC 3IFTA 4B3TL 2F0PA 3MEHA 1U5KA 4KTAA 3V96A 2AMCB 5IE8A 1KXLA 1STHA 1YJNA 1HA6A 3I4LA 5IYCH 1BCPF 1EZ6A 1U4RA 4DNRB 3CCLA 5LHY1 2I5HA 1LT3D 1BBWA 2GA4B 1SEBD 2KBNA 4KI0A 1IW7D 1KD1C 1N9WA 2F3WA 1UWVA 1MI2A 1U4LA 5T1GA 3CD6A 3I4NH 4KKUA 2ID0A 4IN3A 2Y0SE 3OIQA 3GP7A 1H9RA 2JA7B 1OXSC 3CF5A 3PO2G 3PF5A 5BN5A 2BDNA 2VS1A 4FF1A 3GTOB 2D5DA 2IPKD 4LF5L 4C3HB 1SRUA 1Y1VB 1VMCA 1S3OA 1CQFA 2K75A 1DOLA 3H3VH 1EZ8A 1IKMA 1SN8A 1PYBA 2M00A 3ND8A 1EQVA 2K5HA 2B2YA 5M5XB 4I65A 3L2PA 3UDXA 4RGTA 1ZKOA 2DUDA 3FP9A 3GTLB 3VA7A 1H9SA 4FP5D 4XDXA 1SMYD 3OTOL 1UNSA 1SXTA 4KHVA 5CV4A 3OW7A 3FEWX 3HEJA 4GOPC 3TQYA 1STEA 3P1HA 4C2MH 4JI4Q 3H09A 3BVMA 3M7NA 4IPCA 3BYYB 2B8FA 2Q2HA 4HJ8A 5C4JH 4LF9Q 2B63B 2R92H 3HFZB 3O13A 2JYOA 5M3FG 2PPBC 1KAWA 2NVTH 4DR5L 4K6DA 1E1OA 3DEPA 3NE5B 2XN9C 4DAPA 2D9UA 3ZYYX 2ICIA 3QOJA 4LF7L 3Q0AA 2R7DA 3NQTA 1IKLA 1O7LA 1WTHA 1I50B 1Q1BA 2E76C 1JWMD 4A3GB 4K2KA 3CCQA 3HOUB 4C3JB 1RCVD 1QVCA 3MFGA 4MN3A 1B53A 1I3QB 4P73A 3I4MB 4XYQA 3KF6B 1I4GA 1N32L 3DXJC 1SBBB 1VQFA 2YU9B 1CKNA 2E8GA 2M9VA 3A56A 2KHSA 2DNEA 4DFAA 5JJKA 1ICFB 2HQEA 5TSSA 3E0EA 1VQLA 2CH4W 1EY7A 4KN4C 2EJGC 3CHBD 3PV0A 1G6PA 3S2HH 4FYDA 1HFNA 3HOXB 1DXMA 3NEMA 3KUPA 2RHQB 1Z9FA 3DMUA 2O5JC 3DHQA 1VF5C 3LX0A 5EBDA 1FJGQ 1MJCA 2UUAQ 1O7IA 5GAGC 1IBLL 3QIAA 2F0WA 3SDZA 4ZKCB 1DCZA 2VQFL 1PFMA 2EDGA 5FJ8G 3SGIA 2F4VQ 3J7A5 2AUJD 3I73A 3Q23A 1B9MA 4QJFA 3TREA 4DV4L 1JB3A 1ZEQX 2G9DA 2RSOA 1EUJA 1LABA 4RG1A 4A3KG 1Q7YC 2DN8A 2AQ3B 3ONAB 4LFCL 1K3RA 1W6KA 1Q90A 2EQSA 5C44G 4GOPB 2YV5A 1B70B 5FLXc 5C3EG 4UY8C 2F0DA 2WV6D 4JG2A 4JI5L 3PO2H 4HJ7A 3I90A 3PIPA 4H44C 5GADC 4L5SA 4A3MG 4LUVA 1C9OA 3FHWA 2NN6H 2EYOA 3H0GG 1E22A 1JJGA 3DEOA 1I4PA 1SE4A 1STBA 3RLOA 3A5UA 2AUKA 2D2CC 4MZ9A 3OW2A 2HIXA 4JBJA 2V1CC 4K5WA 3J81j 2XWBB 1LLRD 1DJRD 3T53B 3CPWA 3PUZA 4DR4Q 1TR5A 4KHPL 3A7AB 3NWSA 1TWAB 3T51B 2NWGA 3T4AC 1VQ6A 1L1OA 2HD3A 3HOWH 4NPSA 4JI6Q 5KYLA 4K8IA 4BY7B 1Y8PB 1PH5A 2F3VA 4JI3Q 1KQSA 3C1EA 2WKCA 1PZKD 1RJTA 1HR0Q 1EIGA 2L9HA 4CJ0B 1EYAA 1SFOH 2K04A 4GN4B 2D0PA 2L11A 1EWHA 3A0JA 3QOLA 5I9OA 1MIUA 1F77A 1HTPA 3DWPA 1QUQA 1U4MA 4YY3Q 1XMOL 1YHAA 1DYQA 1XNQL 3SK4A 4APVA 4A3BG 3ND9A 1FVIA 4IJHA 1G6ZA 4IPGA 4Y52H 3MXPA 4KKSA 2L15A 3WWVA 3S1QH 1FYCA 1E0BA 3GQBA 1JB7A 2JQOA 4A3EG 5DNFA 2QKIC 3K80C 5CYUA 2JA8G 1OXXK 5M5WH 1EIHA 4XT3B 4NMZA 4DV7L 3S16B 3F2BA 2F4IA 1I4XA 4B9WA 4A3DB 4JK1C 1WTQA 4KY6A 4R4CA 4ZUIA 2F0SA 5JEAJ 1UE6A 3SK5A 3W5OA 1IXRA 4EQNA 5IGEA 4JI0Q 5DAUA 2K01A 3HKSA 1VQ8A 1R9TB 3NXWA 2IHFA 2KECA 3TP7A 3K0XA 2CQOA 2OQ0A 2ZM6Q 3A55A 3VR3A 4IOCA 1X32A 2RVLA 5CV6A 1TVXA 2A69D 1I6HB 5DEHA 2UU9Q 1XMQQ 3HOVB 4LNQA 4ZAIA 4L5TA 4TSSA 1XNRL 1STNA 1WFQA 3BZCA 2EVBA 5LL6S 4GKKQ 1H95A 3HKZB 5NUCA 4DUZL 1PTOH 3N52A 3K58A 1BKBA 3GTQH 1SJHD 4JPBW 5LMNW 1IW7C 3CKIB 5I6WA 4IUPA 2N78A 2KVMA 4DR1Q 1B44D 4LWCA 1LO5D 1UUPA 4X64L 4DV1Q 1AFPA 4JBKA 4X65Q 2KHJA 2HDMA 2R61A 3HOYG 2LMCB 1K9MC 4ZRZA 4JW0A 5JJZA 1HA5A 4LFBQ 1EYCA 1HQRD 4C3IG 5C44H 1IBKQ 1G91A 3CU7A 4H02A 1HUNA 1NMFA 5C3EH 4MTKA 1WVLA 2QILA 3J80i 1EIYB 4LF6L 4JI1L 3D0FA 2Z6KC 4JI8Q 4PQXA 4C1NK 1L2FA 3S15H 1VQNA 3GTOH 3T1HQ 4C3HH 1DM0B 1Y1VH 1YZ6A 3K5MA 1B3QA 2IX1A 4DXFA 4JV5L 4TQUS 2NVYH 2MHVA 1CK1A 3HKZE 3GTJB 1SMYC 1STGA 2BA0A 1SSOA 3S1RH 2CH4A 2LSSA 4ODGA 5M5XH 2SOBA 2NTTA 1WTVA 3AFPA 2VY3A 2YTXA 4FF3A 4F7XA 3FKIB 1S5ED 3MFYA 2L12A 3GTLH 4CGYB 3BDOA 4IUQA 1N33L 4JYAQ 5A2QE 3DWAA 5FO7B 5KIXA 1EOVA 2KCCA 1MGSA 5EKKA 2H4OA 1HR0W 4DNIA 3I91A 3K0YA 1V1PA 4M8AA 1S40A 4A3FB 4BBRG 1O78A 1B1ZA 2NVXH 1PH2A 3R2TA 1CZWA 5IYCG 1Y8OB 3K81C 3VYUA 1WTWA 4BBSB 1PRTF 1SR3A 2MGSA 1CUKA 3EJIA 3NTIA 3FDTA 2XRSD 4WFN3 1Q81C 2F0VA 4C56C 1PMRA 1B2TA 2UXCQ 2EIFA 2BDOA 3NUCA 3DWQA 1RD9D 2WINB 4ZQ3A 1JORA 3KYHC 3HRZC 3I4NG 1TQOA 4A3BH 3S9WA 4LF8Q 1D8LA 2PO4A 3KJPA 1K8GA 4CJ2C 2I5LX 3SK8A 2VUMG 4PMWA 4E6IA 2O2LD 3RD4A 3J80L 4A3EH 3BYTB 5M3MG 2K05A 2Z9HA 5GROA 1HPCA 1I50H 3QB3A 1M8AA 4EX5A 3KLWA 1SNPA 4DV5L 3HOUH 4C3JH 3CRKC 4JOIC 4R4TA 4A3IG 2A68D 4CBVA 3GD7A 3N6RA 4DK1A 4IURA 4BY1B 4DXGA 2FMMA 1MBYA 1N34Q 4J6HA 3CQZB 4JI4L 2PYKA 3M9BA 4ALPA 3ERQA 4QIWB 4LF9L 4NW2A 1BXTA 4YIJA 1PZJD 3I7FA 3I3CA 1GUTA 2CQAA 1EU3A 2VB2X 4R8NA 2LY7A 1XXGA 4Y7NB 4XQJA 1HNXQ 1EEFD 4AYBG 3HOXH 1ZYRD 1GHJA 2MUYA 5IY0A 3VR4A 1LM0A 1A3UA 5DM63 4A93B 1VQ5A 2L4NA 4GZYC 3ER0A 4A3LG
chains in the Genus database with same CATH topology
4XTCS 1TWCB 4G7HC 3D6CA 4FNFA 2PQEA 1TS4A 3BVGA 1LACA 1VCIA 5D14A 2JA5B 5G3LF 3Q22A 5JPMC 2WB1B 3MXGA 3L3OC 1TWHB 4X3TA 2ZXPA 2A6ED 4KMUC 2RSNA 3D8GA 1CM9A 1O7ZA 5EKLA 1KDAA 4IUTA 3BVZA 4ZUJA 1WTOA 1PRTD 3OWFA 3GTGB 2X6LA 4WRDA 3K59A 4IFDJ 5I2YA 3R8BA 2EY6A 5COYA 4NKLA 1ESFA 3J80E 3E6ZX 5D3IB 2B2YC 3OHXC 2JXMB 5M9OA 5KGUA 2EPBA 1LV9A 1O80A 2A6HD 2HCCA 2C9OA 4WORA 1Q3LA 3H91A 3OSOA 3NTKA 4DAVA 2K6AA 2NZ1D 4K2LA 2NN6I 3RZDB 3IAYA 3D3RA 1I4QA 1A2UA 2NTSA 3G7LA 1PLFA 4DK0A 3M7GA 2R3ZA 5LL6X 4RGOS 4UAIA 4OIJA 2FINB 3K7AB 2B2VA 1C8CA 1D5XC 1VDZA 4OIKA 3P75A 3T16A 5M5YB 3GTMB 4CHTB 4ID6A 1PTOF 2F0UA 1JOQA 5JEAH 1KTKA 5C5LA 1A15A 3VYSA 3R2IA 2NN6G 4FXKC 1WTXA 1OO9B 3TMEA 4J1MA 1T5XD 5CV7A 2J0TD 2A69C 4HTHA 1HFGA 2PNRC 3V2TA 4KD3A 1AEXA 3TDQA 1YNND 1FNVA 1PDQA 3VR5A 4LMQD 5IGCA 3ITPA 2F0NA 3PIP3 1KAAA 2LKVA 1FNWA 2L1BA 4TRDA 3OPOA 4DAYA 1GOZA 2A73B 2Q8RE 3K6OA 2EE1A 3SHLA 5C0XI 1SYFA 1B4OA 2NVQB 2XWJB 4IFDI 5IGGA 2EYHA 3MC0B 1FGBD 3MHBA 1KDCA 2JA6B 1RF2D 3E5SA 4PMBA 4F87A 3W3AA 2R93B 3NSWA 3KK7A 1OXTA 1ET6A 1EY6A 1SNMA 3LNNA 3NHHA 3S1MB 4HCSA 1H9SB 2BA1A 5C4XB 3NTHA 3HS0C 3AMUA 2EJFC 3NQIA 4IUNA 1C4QA 5C0XG 2PW5A 2Z4HA 1H9JA 1WCMB 2JE6I 4J8QA 1KLGD 3GTKB 4DN4M 3T56B 1BCPD 1SYBA 1LTID 2G9HD 5E4XA 1PXUA 2KOLA 4H0LC 4R9WA 1H9KA 1EU4A 2V4DA 1D5MC 1BR9A 4KN7C 1QJOA 2F03A 1ET9A 4L8JA 1QOHA 3J7YW 4XT1B 1ONLA 3NBHA 2D62A 5KNBA 2FFKB 1EWCA 4IUVA 1G8ZD 3SK6A 3JAME 1AP0A 2K32A 3VYTA 4KKTA 5D65A 4HSVA 2QCPX 4OL7A 1JCKB 1JICA 1R4PB 2ICEC 3QG1A 2IWHA 4ZKBB 4HEDA 5J39A 2IJ0A 1GHKA 3M4OB 3H3VC 1SJED 4RAUC 3HOZB 3URYA 3TP5A 2A68C 4BA2I 3S17B 3QJYA 1JWUD 1E2VA 2PW7A 3L7ZC 2RBMA 1MSHA 4C3HG 2QF7A 3MXUA 4KHZA 1DOKA 2L0CA 3GTPB 1ENCA 4DA2A 2FMCA 3VR2A 1ILQA 4ZLTF 1Y1WB 2NYZD 1D6EC 1F9RA 2CW0D 2WAQB 3PO3B 1TWGB 4X3SA 2R7ZB 3I8ZA 3OOCA 4ILWA 1ZYRC 3SEBA 1TKWB 5IODA 5KNDA 1I6VC 4L63B 5HGTA 5IT9L 1SE2A 2OT2A 4CKCA 2E74C 2AWNA 3U9SA 1HHVA 1FNUA 2KEDA 3LWEA 2DY8A 3TP8A 2QEJC 2BE5C 3FVQA 1HQMC 1KLUD 2A6EC 1B9NA 1CZGA 4B08A 1DZ1A 5C4HA 1RDPD 5ISRA 5IIFA 4PMCA 4K5VA 1QCBD 4XQNA 3D4RA 3R93A 1PRTC 3PUWA 5C0XH 2PZUA 4C3JG 5A2QL 1RTNA 2X69A 4IFDH 3BG3A 5I4DA 1BQQT 1LTBD 1SNDA 2A6HC 1JR0D 4S3SA 1SNQA 1KNAA 1ESRA 1EQTA 2F0HA 3GV3A 4RHRA 1HUMA 2OXPA 3L9AX 2XNAC 4ZK9B 5E4WC 3A8IE 3TZUA 3EA6A 3VYRA 4I7ZC 3I72A 1GUWA 2FHTA 4QCLA 1ENFA 1SNOA 2ZXOA 1NUCA 4C2MB 3EQLC 2K7VA 5E3FA 1G2TA 5EPKA 1XX8A 2R92B 2LS01 1D2BA 3BDCA 1QILA 1WD0A 1DONA 3P20A 5IT9E 4QMGA 1Z7TA 5IGFA 2N55A 2F0KA 1LTAD 3X3NA 5ELFA 4DU9A 2HCIA 3D6WA 2K1BA 5CGKA 3VA5A 3S2DB 1YNNC 2JEBI 5KNCA 2WKDA 3G6JB 3A8KE 2XRQD 4OHJA 4QUCA 2B2TC 2F0QA 2NBFA 5ELCA 1UAPA 1RTOA 4FVMA 5A35A 2VNUD 3PUVA 2I07B 4HSPA 2JEAI 3HG9A 2EYJA 4MHEA 1NAPA 4IALA 4QUFA 1K8MA 3RZOB 2ENBA 5K36H 3K5OA 3S2HB 1WTPA 1F2YA 1FD7D 1I4HA 2B2UA 1F9SA 3RLFA 1CFMA 2ZT9C 4V0BA 2TSSA 2Z8LA 5EPJA 4XYOA 5FO8B 1MSGA 1HRJA 1S5BD 3OMGA 3IL8A 4IQZA 2SNMA 1YNJC 1T5EA 3FMCA 5JEAG 1BCPC 4PNYA 3EFXD 5CV9A 2B2TA 2KCNA 2X6GA 1TIID 2B39A 3PO2B 2NB0A 3IKJA 4UDUC 2R6GA 3AB9A 2AQ2B 3E0JA 4EGVA 2E2JB 2PZWA 3D4WA 4F88A 2XVSA 3UI2A 2OEOA 4Q0FA 4JBWA 5IOCA 1J9OA 2IX3A 5KEEA 2Q8TA 2EYPA 4HMIA 1R4QB 2SEBD 2A5HA 4NDXA 3A54A 4DNTB 4LK1C 4G7ZC 4O1NA 3C3LA 5CV5A 1E2WA 2B2WA 4KJOA 3P7JA 1TU2B 5I2XA 3R3OA 5I9PA 4FF2A 5JVH3 3FPPA 1PYWD 3EVQA 1OXVA 1SFOB 2EOTA 1V8QA 1F2MA 2E75C 4K8JA 5CC4A 1BNZA 5EBCA 5M3FB 2BE5D 2B2VC 1TT2A 3K5NA 4CJ1B 5HURA 4U68A 2F0LA 3D31A 4FO2A 5CV8A 4C1NI 3KF8A 1Z6HA 2LFNA 1WD1A 1RODA 4PV1C 4RHSA 2FJ2A 4NP5A 2CW0C 1UEAB 2F0JA 5IGBA 3RUZA 2PCFB 5CORA 2Z1CA 1VMPA 5I6YA 4RH6A 4TKOB 1EYDA 2IW3A 4KD4A 1KNEA 1BCPB 3GV6A 1H9MA 3C46A 1ICWA 1G291 2YYZA 3S1NB 1D1IA 1XWEA 3H6MA 4RGMA 2F0FA 5FKAC 4MIUA 4KJNA 1DD2A 5KYIA 4RGNA 2OF1A 1EY0A 4EQOA 1JC7A 1BO0A 3J7AF 1F9PA 3F2UA 1BOSA 5EJWA 1PFBA 1JOKA 2O4XA 2WP8J 3KBGA 1NCVA 4A3KB 1CQVA 2C5CA 5C44B 5C3EB 4KY5A 4A3MB 4ME5A 3JAML 3S15B 3H0GB 5G3LD 4RFBA 2F0OA 4XIGS 3QWNA 2NVYB 5ELBA 3KLSX 2EY5A 4BS9A 2HUGA 4XXEA 3S1RB 2EYFA 1TY2A 2Q8IB 5BN4A 1K83B 1QWYA 4P2CB 5EQ0A 5C3WA 4RA8A 2K03A 3HGBA 4RKBA 3TSSA 3SR1A 1LTRD 3TZDA 2NVXB 2F0GA 1CHQD 2BOSA 2DNCA 1LTGD 3OMCA 2ZXRA 4V190 3CRLC 1L0XB 1E2ZA 1GUOA 2AWOA 1S5DD 1RHPA 3J7AV 2IX0A 3H94A 4A3BB 3QO2A 3V05A 4DF7A 2Z4IA 2F0TA 4ABNA 4F8MA 1AZQA 4IFDG 5ELEA 4A3EB 2KQ3A 1YNJD 2JA8B 4RWSC 2EJMA 2RDHA 2SDFA 1BDOA 3TN2A 2WIIB 1S4ZA 1PZID 5ELDA 1WTRA 1STYA 5J22A 2WACA 2KA7A 2E2IB 3TP6A 1EY4A 1AW7A 5EPLA 3X3MA 1XYIA 1AN8A 1PTOD 2EZVA 2DY7A 2CVRA 4Z9CB 1LT5D 3M3YB 5EGTA 1TS5A 2EYMA 1B50A 1F9QA 3NWTA 1A6XA 4CKBA 3LWUA 5C6AA 2H1EA 1EY8A 1A2TA 1NR2A 1CT1D 3HOYB 1EL0A 1Q1EA 2BCOA 4C3IB 5FO9B 1V1OA 3AU7A 3NP8A 1V43A 2K33A 4R8IA 2IT1A 1SAPA 2EY2A 3D4DA 1TS3A 4FXDA 1SNCA 1LTTD 2RA4A 1QB5D 3W2DA 1GXDC 5EKIA 1Y8NB 1SE3A 2O5IC 3DUZA 1QG7A 3DM1A 3NBIA 5FOBB 3T13A 2MP1A 2K5DA 2J7ZA 5K36G 5CBEE 1LTSD 4KK7A 5CBAE 2SNSA 1F2LA 3BDLA 3KLSA 2VB3X 4K14A 2F0IA 4KV6A 1LT4D 3A8JE 4BBRB 1QNUA 2NUCA 1DOMA 1ENAA 3SVMA 3MA2B 3PMFA 4HN7A 2XSCA 5D3DA 4QB4A 3J81L 1SDFA 4Q5VA 1NR4A 5C5MA 1II3A 3I4NB 3K5LA 1GJXA 3MVVA 3KLRA 2JSOA 5FK9C 1QE6A 2VUMB 4ZYSA 1D5ZC 3U9OA 2KEEA 1I4RA 5M3MB 3S14B 1S5CD 5F2DA 1QNKA 3OWEB 3SE0A 2VXWA 3WDNA 1EEID 4A3IB 3C1FA 1L0YB 1PFNA 2RDFA 3BS1A 1CA6A 4OGQC 4ULLA 1EY5A 1EFID 1GUSA 4CKEA 3HZXA 4OO1I 1SYCA 1JE4A 2KJXA 4X3KA 1KABA 4X3UA 4H13C 1IHZA 5T1IA 4G7OC 3IFDA 3K57A 5JPNC 3MWYW 1GUNA 1CA5A 1U9RA 2A74C 2J4XA 4QF4A 4EVOA 4AYBB 1AZPA 1FR3A 2B2UC 4BA1I 5JOBA 5C4JB 1CHPD 4FXGC 4OO1G 2NVTB 1J8IA 3MTSA 2EY1A 4K6LA 4HR7B 4IUUA 5IGDA 1BF4A 5J1ZA 1M4VA 3J81E 2RDGA 1F2ZA 5AFWA 1Y69U 3C2PA 5DM73 1HXYD 5E1FA 3PIO3 1B3AA 3HP3A 2F1MA 3FPUB 1PRTB 1RKNA 3A7LA 1LT6D 1GUGA 4RCOA 4RCNA 1S5FD 5CR3A 2PMZB 2MPMA 1O7YA 1CI3M 1VF7A 1G2SA 4HCEA 3TBIB 5KRUA 2XIWA 5CMDA 3PUXA 4O42A 4KY7A 1OXUA 1IL8A 2B2WC 4G57A 5JAVA 3M85A 1EY9A 2CHBD 1JOOA 2E2DC 1SYGA 3WOEA 1STAA 5K5PA 4FF4A 1U4PA 4RKLA 1X3PA 3BZDB 1SYEA 1SYDA 1V1PB 4IZ8A 3Q6SA 2B8GA 2KUMA 1TWFB 1HCZA 2RQXA 3VR6A 1IYUA 1XTCD 2F0EA 4EQPA 1NSNS 4BWGB 3PUYA 3RMHA 5FLXL 1PTOC 1Z47A 2JP1A 4B9XA 3NPPA 4HMJA 1W6JA 2I46A 5C4ZA 3EROA 2AQ1B 1JQYD 1HTLD 4HAEA 2K5WA 4U673 4L6TB 3HOWB 1X3QA 4WJWA 4H7BA 4N9TA 2RKSA 2EXZA 1Q12A 1C48A 1BBXC 3MZ5A 4OO1H 1JWSD 2L55A 4A3JB 1EOTA 4N9PA 5BN3A 1KDBA 1IYVA 1CTMA 3S1QB 1A3VA 4LJZC 1D1KA 3NK9A 2MJ8A 1ZXTA 5M5WB 4DGZA 1A3TA 2K5QA 3GO5A 1K8OA 2E2HB 1BUVT 4G4KA 3Q24A 2K28A 2F0MA 2EYLA 3MXNA 1MD2D 1TS2A 2HDLA 2M2LA 3MAQA 5C3XA 1ILPA 4M1UB 5C0XJ 3OIPA 4LAAA 2N88A 2Y0SB 3WOFA 1Q8IA 3KBXA 2IL8A 3SXHA 1ML0D 3FRPB 2TMPA 5FLXE 4K5XA 4XQQA 5JVG3 3I70A 1PTOB 2QDBA 2PZTA 1TY0A 3M4YA 3GTQB 2L5TA 3IFTA 2F0PA 3MEHA 4KTAA 3V96A 1STHA 1HA6A 3I4LA 1BCPF 1EZ6A 1U4RA 4DNRB 5LHY1 1LT3D 2GA4B 1SEBD 4KI0A 1IW7D 2F3WA 1MI2A 1U4LA 5T1GA 4KKUA 2ID0A 4IN3A 3OIQA 3GP7A 1H9RA 2JA7B 1OXSC 5BN5A 2BDNA 4FF1A 3GTOB 2D5DA 2IPKD 4C3HB 1Y1VB 1VMCA 1CQFA 1DOLA 1EZ8A 1IKMA 2M00A 3ND8A 1EQVA 2B2YA 5M5XB 4I65A 4RGTA 1ZKOA 3GTLB 3VA7A 1H9SA 4FP5D 4XDXA 1SMYD 1UNSA 1SXTA 4KHVA 5CV4A 3OW7A 3FEWX 3HEJA 1STEA 3P1HA 3H09A 3BVMA 3M7NA 3BYYB 2B8FA 2B63B 3O13A 2JYOA 2PPBC 4K6DA 3DEPA 3NE5B 2XN9C 4DAPA 2D9UA 3ZYYX 2ICIA 3QOJA 3Q0AA 3NQTA 1IKLA 1O7LA 1I50B 1Q1BA 2E76C 1JWMD 4A3GB 4K2KA 3HOUB 4C3JB 1RCVD 3MFGA 4MN3A 1B53A 1I3QB 3I4MB 4XYQA 1I4GA 3DXJC 1SBBB 2YU9B 2M9VA 3A56A 2KHSA 2DNEA 4DFAA 2HQEA 5TSSA 1EY7A 4KN4C 2EJGC 3CHBD 3PV0A 4FYDA 1HFNA 3HOXB 1DXMA 3KUPA 3DMUA 2O5JC 3DHQA 1VF5C 3LX0A 5EBDA 3QIAA 2F0WA 3SDZA 4ZKCB 1DCZA 1PFMA 2EDGA 2AUJD 3I73A 3Q23A 1B9MA 1JB3A 1ZEQX 2G9DA 2RSOA 1LABA 2DN8A 2AQ3B 3ONAB 1W6KA 1Q90A 2F0DA 2WV6D 3I90A 4H44C 2NN6H 2EYOA 3DEOA 1I4PA 1SE4A 1STBA 2AUKA 2D2CC 4K5WA 2XWBB 1LLRD 1DJRD 3T53B 3PUZA 1TR5A 3A7AB 3NWSA 1TWAB 3T51B 2NWGA 3T4AC 5KYLA 4K8IA 4BY7B 1Y8PB 2F3VA 3C1EA 2WKCA 1PZKD 1RJTA 1EIGA 2L9HA 4CJ0B 1EYAA 2K04A 2L11A 1EWHA 3QOLA 5I9OA 1F77A 1HTPA 3DWPA 1U4MA 1DYQA 3SK4A 3ND9A 1G6ZA 3MXPA 4KKSA 1FYCA 1E0BA 3GQBA 5DNFA 2QKIC 5CYUA 1OXXK 1EIHA 4XT3B 4NMZA 3S16B 2F4IA 1I4XA 4B9WA 4A3DB 4JK1C 1WTQA 4KY6A 4ZUIA 2F0SA 5JEAJ 3SK5A 4EQNA 5IGEA 5DAUA 2K01A 1R9TB 3NXWA 2KECA 3TP7A 3A55A 3VR3A 1X32A 2RVLA 5CV6A 1TVXA 2A69D 1I6HB 5DEHA 3HOVB 4ZAIA 4TSSA 1STNA 2EVBA 5LL6S 3HKZB 5NUCA 1PTOH 3N52A 3K58A 1SJHD 1IW7C 3CKIB 5I6WA 4IUPA 2KVMA 1B44D 1LO5D 1UUPA 1AFPA 2HDMA 2R61A 2LMCB 4ZRZA 5JJZA 1HA5A 1EYCA 1HQRD 4C3IG 1G91A 3CU7A 1HUNA 1WVLA 2QILA 4PQXA 4C1NK 1DM0B 3K5MA 2IX1A 4DXFA 4TQUS 2MHVA 1CK1A 3GTJB 1SMYC 1STGA 2BA0A 1SSOA 4ODGA 2SOBA 2NTTA 1WTVA 4FF3A 4F7XA 3FKIB 1S5ED 3MFYA 2L12A 4CGYB 3BDOA 4IUQA 5A2QE 3DWAA 5FO7B 5KIXA 2KCCA 1MGSA 5EKKA 2H4OA 3I91A 3K0YA 1V1PA 4M8AA 4A3FB 1O78A 1B1ZA 3R2TA 1CZWA 1WTWA 1Y8OB 3VYUA 4BBSB 1PRTF 2MGSA 3EJIA 3NTIA 3FDTA 2XRSD 4WFN3 1B2TA 2F0VA 4C56C 1PMRA 2BDOA 3NUCA 3DWQA 1RD9D 2WINB 4ZQ3A 1JORA 3HRZC 1TQOA 3S9WA 2PO4A 4CJ2C 3SK8A 4PMWA 4E6IA 2O2LD 3RD4A 3J80L 3BYTB 2K05A 1HPCA 3QB3A 1M8AA 1SNPA 3CRKC 2A68D 4CBVA 3GD7A 3N6RA 4DK1A 4IURA 4BY1B 4DXGA 2FMMA 1MBYA 4J6HA 3CQZB 2PYKA 3ERQA 4QIWB 4NW2A 1BXTA 4YIJA 1PZJD 3I3CA 1GUTA 2CQAA 1EU3A 2VB2X 4R8NA 2LY7A 1XXGA 4Y7NB 4XQJA 1EEFD 1ZYRD 1GHJA 2MUYA 3VR4A 1A3UA 5DM63 4A93B 2L4NA 4GZYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8N B;  4JBW A;  4KN7 C;  4XTC S;  3MFY A;  1GUN A;  1QJO A;  4G7H C;  2NN6 G;  3BDO A;  1LAB A;  4L8J A;  3OW7 A;  2DN8 A;  1LAC A;  1VCI A;  2B8G A;  2KCC A;  2O5I C;  4IFD G;  1FR3 A;  2BE5 C;  1HQM C;  1ONL A;  1B9N A;  2A6E C;  4BA1 I;  1Q90 A;  1YNN C;  2D62 A;  1HCZ A;  5KNB A;  2JEB I;  5KNC A;  2A69 C;  1O78 A;  5K36 G;  3VR6 A;  3A8K E;  2EJM A;  3M7N A;  1IYU A;  2PNR C;  3VR3 A;  4OO1 G;  1BDO A;  4DNT B;  2B8F A;  1Y8O B;  2A6E D;  4LK1 C;  4KMU C;  2K32 A;  4G7Z C;  4KKT A;  3D4R A;  4H44 C;  1E2W A;  3VR5 A;  2A69 D;  5A35 A;  3PUW A;  1PMR A;  3PUY A;  1TU2 B;  5C0X H;  2BDO A;  2PPB C;  3PUV A;  2KA7 A;  2NN6 H;  3OPO A;  2JEA I;  3FPP A;  3A8J E;  3QG1 A;  4HR7 B;  3NE5 B;  4IFD H;  3BG3 A;  1K8M A;  3M4Y A;  2L5T A;  2EVB A;  2AUK A;  1OXV A;  2D2C C;  3IFT A;  1V8Q A;  1GHK A;  5K36 H;  1O7L A;  2E75 C;  1Q1B A;  2E76 C;  3T53 B;  1Y69 U;  2A6H C;  3PUZ A;  1IW7 C;  2BE5 D;  3I4L A;  2A68 C;  3A7A B;  4BA2 I;  4DNR B;  1HPC A;  3RLF A;  3QJY A;  4XIG S;  2JXM B;  1CFM A;  3D31 A;  3T51 B;  2ZT9 C;  1GJX A;  1E2V A;  3L7Z C;  2A6H D;  4KI0 A;  2F1M A;  1IW7 D;  3CRK C;  3KLR A;  1Z6H A;  2A68 D;  3W3A A;  3GD7 A;  2QF7 A;  3N6R A;  3A7L A;  3MXU A;  1OXT A;  4DK1 A;  1Q12 A;  3DXJ C;  4KKU A;  4PV1 C;  1A6X A;  4KHZ A;  2LMC B;  3LNN A;  1GUG A;  1Y8P B;  3LWU A;  4RCN A;  2Q8I B;  2CW0 C;  5BN4 A;  1H9S B;  2BA1 A;  3A8I E;  2DNE A;  1H9R A;  4IQZ A;  3TZU A;  1OXS C;  1CI3 M;  1VF7 A;  2NN6 I;  4I7Z C;  3SE0 A;  3VR2 A;  3I72 A;  3WDN A;  2PCF B;  5BN5 A;  4KN4 C;  4OO1 H;  2EJF C;  4DK0 A;  2D5D A;  2EJG C;  1YNJ C;  1EWH A;  1T5E A;  3FMC A;  3PV0 A;  5JEA G;  3HGB A;  5BN3 A;  5C0X G;  1IYV A;  1HTP A;  1CTM A;  4OGQ C;  1H9J A;  3OOC A;  4TKO B;  1ZYR C;  2JE6 I;  1GUS A;  1GUT A;  3PUX A;  1Q1E A;  1TKW B;  1DXM A;  3EQL C;  4LJZ C;  1H9M A;  3ND9 A;  2O5J C;  2K7V A;  3ND8 A;  2DNC A;  1VF5 C;  5KND A;  1OXU A;  4KKS A;  3T56 B;  1I6V C;  1VDZ A;  4TQU S;  1G29 1;  2YYZ A;  1FYC A;  3CRL C;  3GQB A;  3IKJ A;  1V43 A;  2K33 A;  2R6G A;  3AB9 A;  1K8O A;  3QIA A;  2IT1 A;  1SMY C;  3M85 A;  1GHJ A;  3SDZ A;  1E2Z A;  1GUO A;  1ZKO A;  1DCZ A;  2BA0 A;  4H13 C;  3VR4 A;  2EDG A;  1OXX K;  2AWO A;  4G7O C;  3P20 A;  4H0L C;  1DD2 A;  3VA7 A;  2E74 C;  1H9S A;  1H9K A;  4GZY C;  2AUJ D;  1Z7T A;  3I73 A;  3H94 A;  2V4D A;  3U9S A;  1B9M A;  5JEA H;  4JK1 C; 
#chains in the Genus database with same CATH topology
 2QA4 A;  4XTC S;  1TWC B;  4G7H C;  3D6C A;  4FNF A;  2PQE A;  1TS4 A;  3BVG A;  1LAC A;  1VCI A;  5D14 A;  4NXN L;  2JA5 B;  2RCN A;  5G3L F;  3Q22 A;  5JPM C;  2ZTE A;  2WB1 B;  3MXG A;  3L3O C;  4IOA A;  1TWH B;  4X3T A;  2ZXP A;  2A6E D;  4KMU C;  3CCM A;  2RSN A;  3D8G A;  1CM9 A;  3PIO A;  1O7Z A;  4YWL A;  5EKL A;  2YTY A;  1KDA A;  4IUT A;  2VW9 A;  1QVG A;  3BVZ A;  4QIW E;  4HJA A;  4ZUJ A;  1WTO A;  3B6Y A;  3EIV A;  1PRT D;  3OWF A;  3GTG B;  3L0O A;  2X6L A;  4WRD A;  3K59 A;  4IFD J;  5I2Y A;  3R8B A;  1FJG L;  2EY6 A;  5COY A;  4NKL A;  2QGQ A;  1ESF A;  3J80 E;  1I5F A;  1EWI A;  3E6Z X;  1C0A A;  5D3I B;  2B2Y C;  3OHX C;  3KF8 B;  2JXM B;  5M9O A;  3AQQ A;  5HGQ A;  5KGU A;  2EPB A;  1LV9 A;  1O80 A;  2A6H D;  2BH8 A;  2HCC A;  3CME A;  2C9O A;  4WOR A;  3KFU A;  3T1Y Q;  2PQA B;  1Q3L A;  3OSO A;  3H91 A;  4HIK A;  3MXN B;  3NTK A;  2WB1 E;  4DAV A;  4BBR H;  1SRO A;  5E7N A;  2K6A A;  2NZ1 D;  4K2L A;  2NN6 I;  3RN5 A;  3RZD B;  3IAY A;  3D3R A;  4BY7 H;  1I4Q A;  1A2U A;  2NTS A;  3G7L A;  5IWA Q;  1PLF A;  4DK0 A;  3M7G A;  4JI2 Q;  1E7Z A;  2R3Z A;  4GKJ Q;  5LL6 X;  4RGO S;  4UAI A;  1VQE A;  4OIJ A;  4LW1 A;  2FIN B;  3K7A B;  2B2V A;  1C8C A;  1VQA A;  1YEZ A;  1D5X C;  1VDZ A;  1PFS A;  4OIK A;  3S24 A;  3P75 A;  3T16 A;  4AQY Q;  1YIJ A;  2VUM H;  5M5Y B;  2E5L Q;  3GTM B;  4CHT B;  4ID6 A;  1PTO F;  2F0U A;  5M3M H;  3S14 H;  1JOQ A;  4DR4 L;  3K7U C;  5JEA H;  1KTK A;  5C5L A;  1A15 A;  3VYS A;  3R2I A;  3S16 H;  2NN6 G;  4FXK C;  1WTX A;  4A3I H;  1OO9 B;  3TME A;  4GN5 A;  1T5X D;  4J1M A;  5CV7 A;  2J0T D;  4PZ7 A;  4JI6 L;  2A69 C;  2UXD Q;  4HTH A;  1HFG A;  2PNR C;  3V2T A;  1HNW Q;  4KD3 A;  1AEX A;  2VQE L;  3ULP A;  2VZA A;  3TDQ A;  1YNN D;  1FNV A;  1PDQ A;  3VR5 A;  4LMQ D;  3ULL A;  5IGC A;  3ITP A;  2F0N A;  3CPF A;  3PIP 3;  1KAA A;  1E1T A;  2LKV A;  5GAH C;  3RN2 A;  1FNW A;  2L1B A;  4TRD A;  3OPO A;  4DAY A;  4HJ9 A;  1GOZ A;  4YY3 L;  2A73 B;  1V1Q A;  1YJW A;  3HOW G;  1HZB A;  2Q8R E;  3K6O A;  2EE1 A;  3HOV H;  1JJ2 A;  3SHL A;  5C0X I;  1PVO A;  1UE5 A;  1WJJ A;  2K50 A;  3A74 A;  1SYF A;  1B4O A;  2UUC Q;  2NVQ B;  3UE0 A;  2XWJ B;  4IFD I;  5J3B A;  5IGG A;  2EYH A;  3MC0 B;  3OYY A;  1FGB D;  3MHB A;  1KDC A;  2JK8 A;  2JA6 B;  3GDE A;  4A3L H;  1I94 L;  1RF2 D;  3E5S A;  4A3J G;  4PMB A;  4F87 A;  3W3A A;  2R93 B;  3NSW A;  3CCE A;  3KK7 A;  1OXT A;  1ET6 A;  1IYJ B;  1EY6 A;  1PYS B;  1SNM A;  3LNN A;  4JI0 L;  1N8R C;  3NHH A;  3S1M B;  4HCS A;  1H9S B;  2BA1 A;  5C4X B;  1P16 A;  1VQP A;  3NTH A;  3HS0 C;  4POG A;  2XGT A;  4R4I A;  3AMU A;  2EJF C;  2LXJ A;  2A19 A;  3NQI A;  1N36 Q;  4IUN A;  1C4Q A;  3CC2 A;  1WYD A;  5C0X G;  1XPR A;  2PW5 A;  2Z4H A;  1H9J A;  2KEN A;  1WCM B;  2JE6 I;  4J8Q A;  2Q2U A;  2UU9 L;  1XMQ L;  1EQR A;  1KLG D;  1A8V A;  5ELN A;  3GTK B;  4DN4 M;  3T56 B;  1BCP D;  1SYB A;  2PI2 E;  1LTI D;  2G9H D;  5E4X A;  1PXU A;  4GKK L;  2HHH L;  3F1Z A;  2Q2T A;  4JC0 A;  1PHJ A;  2KOL A;  2Y0S G;  4H0L C;  4R9W A;  4X66 Q;  1H9K A;  3I55 A;  3GTJ H;  1EU4 A;  2V4D A;  1D5M C;  4DV6 Q;  4X62 Q;  1BR9 A;  4KN7 C;  2NZH A;  1QJO A;  2F03 A;  4DR1 L;  1ET9 A;  3RLN A;  4L8J A;  1QOH A;  3J7Y W;  3E9H A;  4XT1 B;  4DV1 L;  1ONL A;  3FKI H;  3NBH A;  2D62 A;  5KNB A;  2FFK B;  4HIM A;  1EWC A;  4IUV A;  1G8Z D;  1VQG A;  3SK6 A;  4LFB L;  4JCV E;  3JAM E;  1L1O C;  1AP0 A;  1IBK L;  2K32 A;  3VYT A;  4KKT A;  5IYB H;  5D65 A;  4HSV A;  2QCP X;  4OL7 A;  3BZK A;  5LMN Q;  1JCK B;  1JIC A;  1R4P B;  2ICE C;  3F8T A;  3QG1 A;  2IWH A;  3J80 c;  1LTL A;  2K4K A;  4ZKB B;  3T1H L;  4HED A;  1YNX A;  2CKZ B;  5J39 A;  3VDY A;  2IJ0 A;  1GHK A;  2GVA A;  3M4O B;  3H3V C;  4K0K Q;  1SJE D;  4RAU C;  3HOZ B;  4DR7 Q;  4LF4 Q;  3URY A;  3TP5 A;  2A68 C;  4BA2 I;  3S17 B;  1TWF H;  2CWA A;  1Y14 B;  3QJY A;  2JA7 G;  1JWU D;  4KLK A;  1XPU A;  1E2V A;  2PW7 A;  3L7Z C;  2RBM A;  4BXX H;  1MSH A;  1GO3 E;  4C3H G;  1VQ9 A;  3AYH B;  2QF7 A;  1Y1V G;  3MXU A;  4KHZ A;  1DOK A;  2L0C A;  2MO0 A;  3GTP B;  1ENC A;  4EQ5 A;  4DA2 A;  4QQB X;  2FMC A;  3VR2 A;  4BY1 H;  1ILQ A;  4ZLT F;  1Y1W B;  4B3M Q;  2NYZ D;  4DKA C;  1D6E C;  1F9R A;  2CW0 D;  2WAQ B;  3PO3 B;  1TWG B;  4X3S A;  2BH2 A;  2R7Z B;  1BBU A;  3I8Z A;  3OOC A;  4ILW A;  2XTI A;  3I56 A;  1ZYR C;  3SEB A;  1IL2 A;  1TKW B;  5IOD A;  2UXC L;  2H5X A;  2RHS B;  1W3S A;  5KND A;  4YWM A;  1I6V C;  3KOJ A;  4L63 B;  5HGT A;  4Y7N H;  3ZJY C;  5IT9 L;  4LF5 Q;  1LYL A;  1SE2 A;  2CFM A;  2OT2 A;  4YCV A;  4CKC A;  2E74 C;  4LFA Q;  2AWN A;  3U9S A;  1HHV A;  1FNU A;  2KED A;  4DPG A;  3LWE A;  2DY8 A;  4A93 H;  1VQ4 A;  2HIV A;  4A3J H;  2B63 G;  4YWK A;  3TP8 A;  2QEJ C;  2BE5 C;  3FVQ A;  1VQK A;  1HQM C;  1KLU D;  2A6E C;  1B9N A;  1CZG A;  5BR8 L;  4AH6 A;  1TWC H;  4B08 A;  1DZ1 A;  4MTN A;  2JA5 H;  5C4H A;  1RDP D;  4TVA B;  5ISR A;  5IIF A;  2P5Z X;  4B3R Q;  1GVP A;  4PMC A;  4K5V A;  1QCB D;  4ME3 A;  4XQN A;  3D4R A;  2LXK A;  3R93 A;  2E2H H;  1PRT C;  2CWP A;  3PUW A;  1L1O B;  2WAQ E;  4A3G G;  4JI7 L;  1TWH H;  5C0X H;  2PZU A;  3HOU G;  4C3J G;  2QEX A;  5A2Q L;  1RTN A;  2X69 A;  4IFD H;  3BG3 A;  5I4D A;  1KRS A;  4DR6 Q;  1BQQ T;  3I4M G;  1LTB D;  1SND A;  1EYG A;  1JT8 A;  2ZJP A;  2A6H C;  1JR0 D;  4S3S A;  3GTG H;  1QUQ B;  1KNA A;  1SNQ A;  1ESR A;  4DV3 Q;  1UE7 A;  1GKH A;  1GD7 A;  1EQT A;  2F0H A;  3GV3 A;  4HIO A;  4RHR A;  4YCU A;  4O0A A;  2UUB Q;  2GVB A;  1HUM A;  2OXP A;  3KJO A;  1YIT A;  3L9A X;  2XNA C;  4ZK9 B;  4DV2 Q;  5E4W C;  3HOX G;  1RL2 A;  3A8I E;  3TZU A;  3EA6 A;  3VYR A;  3KDF A;  4I7Z C;  2R7F A;  3I72 A;  1GUW A;  2FHT A;  4QCL A;  1ENF A;  4GS3 A;  1SNO A;  2ZXO A;  1NUC A;  3RZD H;  4IPH A;  1N32 Q;  4C2M B;  3U58 A;  1ASY A;  3EQL C;  1T9H A;  5L37 A;  2K7V A;  4WJ4 A;  5E3F A;  1G2T A;  5EPK A;  1XX8 A;  3CXC A;  2R92 B;  2LS0 1;  1J5E Q;  1D2B A;  3K7A H;  1CSQ A;  3BDC A;  1QIL A;  3H15 A;  1WD0 A;  1DON A;  3P20 A;  5IT9 E;  4B3S Q;  4QMG A;  1Z7T A;  5IGF A;  2N55 A;  2JA7 H;  5M5Y H;  1SMX A;  1KC8 C;  2F0K A;  1LTA D;  3X3N A;  5ELF A;  4DU9 A;  2HCI A;  3D6W A;  2K1B A;  3JAM c;  5CGK A;  3VA5 A;  4DV0 Q;  2VQF Q;  3S2D B;  1YNN C;  3T1Y L;  2JEB I;  5KNC A;  2WKD A;  4IJL A;  3G6J B;  4NXM L;  1A63 A;  3A8K E;  2XRQ D;  4OHJ A;  1VS0 A;  4QUC A;  2B2T C;  2F0Q A;  2NBF A;  5ELC A;  1UAP A;  4DV4 Q;  1RTO A;  4FVM A;  5A35 A;  1X9N A;  5IWA L;  5AJ3 Q;  2VNU D;  3PUV A;  2I07 B;  4HSP A;  1HZA A;  2JEA I;  3HG9 A;  2EYJ A;  4MHE A;  1NAP A;  1X3E A;  4IAL A;  4QUF A;  1K8M A;  2OTJ A;  3RZO B;  1YVC A;  2ENB A;  2DGY A;  5K36 H;  3K5O A;  3S2H B;  3IRB A;  1WTP A;  1HNZ Q;  1F2Y A;  1FD7 D;  4OX9 Q;  4BY7 G;  1I4H A;  4QL5 A;  1Q86 C;  2B2U A;  1F9S A;  3RLF A;  2E5L L;  4GNX A;  1CFM A;  2ZT9 C;  4X6A H;  3M4Q A;  4YHH Q;  4V0B A;  5IP7 H;  2B63 H;  4UPA A;  2TSS A;  2Z8L A;  5EPJ A;  4XYO A;  5FO8 B;  1MSG A;  1KL9 A;  1RIP A;  1HRJ A;  1S5B D;  3OMG A;  3IL8 A;  3TS0 A;  4KHP Q;  4IQZ A;  3JC6 6;  2UXD L;  3S1M H;  2SNM A;  1YNJ C;  1T5E A;  3FMC A;  2Z0S A;  5JEA G;  1WI5 A;  1BCP C;  4A3G H;  2F3I A;  4PNY A;  1VQB A;  3EFX D;  5CV9 A;  2G5D A;  1Q82 C;  4A3D G;  2B2T A;  2KCN A;  1GM5 A;  2X6G A;  1TII D;  1VQI A;  3W1B A;  1I3Q H;  2B39 A;  5IYD G;  3PO2 B;  1KIX A;  2NB0 A;  3IKJ A;  4UDU C;  2R6G A;  2EXD A;  3AB9 A;  2AQ2 B;  3E0J A;  4DR3 Q;  3I4M H;  1HZC A;  4EGV A;  2E2J B;  3GTK H;  3E3X A;  2PZW A;  3TRZ A;  3D4W A;  4F88 A;  2XVS A;  1NMG A;  4P74 A;  2YU9 H;  1PH3 A;  3UI2 A;  2OEO A;  3J7Z C;  4R4Q A;  4Q0F A;  4JBW A;  2ZJR A;  2I0Q A;  5IOC A;  1J9O A;  2IX3 A;  5KEE A;  2Q8T A;  2EYP A;  4HMI A;  1R4Q B;  4HID A;  3HOV G;  2SEB D;  2A5H A;  4NDX A;  3A54 A;  4DV7 Q;  4A76 A;  4DNT B;  4LK1 C;  4G7Z C;  3HKZ G;  1X56 A;  2N3S A;  4O1N A;  3C3L A;  5CV5 A;  1E2W A;  2B2W A;  4KJO A;  3P7J A;  4DUY Q;  1TU2 B;  5I2X A;  3R3O A;  5I9P A;  4FF2 A;  5JVH 3;  3FPP A;  1PYW D;  3EVQ A;  1E3P A;  3ERS X;  1XPO A;  1OXV A;  1SFO B;  2EOT A;  1V8Q A;  1F2M A;  3M4P A;  2KCT A;  3CC4 A;  4GN3 B;  2E75 C;  4R4O A;  4K8J A;  4A4I A;  5CC4 A;  1BNZ A;  3PGZ A;  5EBC A;  5M3F B;  2BE5 D;  2B2V C;  1TT2 A;  3K5N A;  4CJ1 B;  5HUR A;  4U68 A;  2K5N A;  2F0L A;  3D31 A;  4FO2 A;  5CV8 A;  4X66 L;  3HOZ H;  4L5R C;  4DV6 L;  2KCM A;  2Z6B A;  4C1N I;  3KF8 A;  3CCS A;  3S17 H;  4UHV A;  1Z6H A;  2LFN A;  1WD1 A;  1ROD A;  4DUZ Q;  4R1J A;  4P71 A;  4PV1 C;  4RHS A;  2FJ2 A;  4NP5 A;  2CW0 C;  2QDL A;  1UEA B;  2F0J A;  2PQA A;  2UUA L;  5IGB A;  3RUZ A;  2MFI A;  2PCF B;  5COR A;  2Z1C A;  3JAM i;  1X54 A;  1VMP A;  5I6Y A;  2JN4 A;  1PH4 A;  2F4V L;  4RH6 A;  4TKO B;  1EYD A;  1HZ9 A;  2IW3 A;  1X65 A;  4KD4 A;  1KNE A;  1Y1W H;  1BCP B;  3GV6 A;  1H9M A;  4HJ5 A;  3G4S A;  1TWA H;  3C46 A;  3PO3 H;  1TWG H;  5IT9 c;  3CW2 C;  3FKI G;  1ICW A;  1G29 1;  2YYZ A;  3S1N B;  1D1I A;  2K14 A;  1XWE A;  3H6M A;  4RGM A;  2F0F A;  5FKA C;  4JI1 Q;  5H1S E;  4OXP A;  4MIU A;  2Q2I A;  4A3F G;  4KJN A;  1AE3 A;  4K0K L;  2PNH A;  1DD2 A;  5IYB G;  4DR7 L;  4LF4 L;  5KYI A;  5LMU Q;  2NZO A;  4RGN A;  4BBS G;  2OF1 A;  1EY0 A;  4EQO A;  1JC7 A;  1BO0 A;  4JV5 Q;  3J7A F;  1F9P A;  3F2U A;  3G6E A;  1PH9 A;  3RNU A;  1BOS A;  1JE5 A;  4PZ6 A;  5EJW A;  2DJG C;  2AKW B;  3LGJ A;  5EAY A;  1PFB A;  1JOK A;  2O4X A;  2WP8 J;  3KBG A;  1NCV A;  2JJQ A;  3UDI A;  4A3K B;  1OTC A;  1N33 Q;  4B3M L;  4UP8 A;  1CQV A;  4BXX G;  2C5C A;  5C44 B;  1B8A A;  3G48 A;  4A3D H;  1QZH A;  5C3E B;  4CDD C;  5HY6 A;  5IYD H;  1X55 A;  4KY5 A;  4A3M B;  2PI2 A;  4ME5 A;  3JAM L;  4BY1 G;  4JI3 L;  1W2B A;  1K8A C;  3S15 B;  1R9T H;  1EIF A;  2I5M X;  3H0G B;  4LUO A;  5G3L D;  4RFB A;  1HR0 L;  2F0O A;  4XIG S;  5JJL A;  4DR2 Q;  4LFA L;  1A62 A;  3QWN A;  2NVY B;  5ELB A;  2CCZ A;  3KLS X;  2EY5 A;  4BS9 A;  2HUG A;  4XXE A;  3S1R B;  2EYF A;  1I6H H;  1TY2 A;  2ZTD A;  2Q8I B;  2MNA A;  5BN4 A;  1K83 B;  3DLL A;  1QWY A;  4YCW A;  4P2C B;  5EQ0 A;  5C3W A;  4DV5 Q;  4RA8 A;  1QVF A;  5IP9 H;  2K03 A;  3HGB A;  4RKB A;  2ES2 A;  4B3R L;  3TSS A;  2OQK A;  4A93 G;  3SR1 A;  1LTR D;  1NNX A;  3TZD A;  2NVX B;  2F0G A;  1CHQ D;  1YJ9 A;  2BOS A;  2DNC A;  1LTG D;  3OMC A;  2ZXR A;  4V19 0;  3CRL C;  1L0X B;  3KF6 A;  4ZCK A;  4DR6 L;  2JA5 G;  1E2Z A;  1GUO A;  4JBM A;  2AWO A;  2RCF A;  2IY5 B;  1S5D D;  2OWO A;  1RHP A;  2WB1 G;  4DAY B;  2IX0 A;  3U4V A;  2ZM6 L;  3H94 A;  3J7A V;  4A3B B;  4DV3 L;  3QO2 A;  3V05 A;  4DF7 A;  4OWT B;  2Z4I A;  4QY7 A;  2F0T A;  4ABN A;  4F8M A;  1AZQ A;  4IFD G;  1NE3 A;  2UUB L;  5ELE A;  3EBE A;  4A3E B;  2KQ3 A;  1YNJ D;  2JA8 B;  3I4O A;  3EN2 A;  1Q46 A;  4RWS C;  4DV2 L;  2EJM A;  2RDH A;  2SDF A;  1BDO A;  3TN2 A;  2WII B;  3S2D H;  2UXB Q;  1S4Z A;  2F52 A;  4DK3 C;  1PZI D;  1VQ7 A;  5ELD A;  1WTR A;  1STY A;  5J22 A;  4NXN Q;  2WAC A;  2KA7 A;  2E2I B;  3TP6 A;  1EY4 A;  1AW7 A;  5EPL A;  3X3M A;  1XYI A;  1AN8 A;  1VQJ A;  1PTO D;  4X65 L;  3RR5 A;  2A8V A;  2EZV A;  2DY7 A;  4DAM A;  1J5E L;  2CVR A;  4Z9C B;  4A75 A;  3BJU A;  1E24 A;  3RZO H;  4A3F H;  4GOP A;  3NEL A;  1X3G A;  4B3S L;  1IBM Q;  1LT5 D;  3M3Y B;  2ASB A;  1V9P A;  3CP0 A;  5EGT A;  1TS5 A;  4BBS H;  1CKN B;  3NEN A;  4JI8 L;  2EYM A;  2N49 A;  1B50 A;  1F9Q A;  2D0O A;  3NWT A;  1A6X A;  4UP9 A;  4CKB A;  3LWU A;  2C35 B;  1EQQ A;  5C6A A;  4DV0 L;  2H1E A;  3J81 i;  3PSI A;  1EY8 A;  3ICE A;  1A2T A;  1PH8 A;  1NR2 A;  3STB D;  1CT1 D;  3HOY B;  3NBH B;  3TS2 A;  4PG3 A;  3TEH B;  1EL0 A;  1Q1E A;  5AJ3 L;  2QW7 A;  4L5Q A;  5JJI A;  2BCO A;  4C3I B;  3ULJ A;  4B3T Q;  5FO9 B;  1V1O A;  4JYA L;  1VQC A;  3AU7 A;  3NP8 A;  1XTD A;  1V43 A;  2K33 A;  4R8I A;  2IT1 A;  1SAP A;  1NY4 A;  3G71 A;  2EY2 A;  3D4D A;  4QGU A;  1TS3 A;  4FXD A;  1SNC A;  1LTT D;  1HNZ L;  2RA4 A;  1QB5 D;  4OX9 L;  3W2D A;  1GXD C;  5EKI A;  2E2J H;  1Y8N B;  3CQZ H;  1B7Y B;  1VQD A;  4POF A;  1SE3 A;  2O5I C;  1VQO A;  3DUZ A;  1QG7 A;  3DM1 A;  3NBI A;  2B3G A;  5FOB B;  3T13 A;  2MP1 A;  1UE1 A;  2K5D A;  2J7Z A;  4YHH L;  1WOC A;  5ELO A;  5K36 G;  5CBE E;  4LF8 L;  1LTS D;  4KK7 A;  5CBA E;  1K28 A;  2SNS A;  1F2L A;  3BDL A;  1FGU A;  4I7A A;  3KLS A;  4PZ8 A;  2VB3 X;  4K14 A;  1UEB A;  2F0I A;  4DK6 C;  3I2Z A;  1K3B C;  3A5Z B;  4KV6 A;  5FLM G;  1CKO A;  1LT4 D;  3A8J E;  4BBR B;  1QNU A;  2NUC A;  5IP7 G;  2ALY B;  1DOM A;  1ENA A;  3SVM A;  2JA6 G;  3MA2 B;  3PMF A;  4IO9 A;  3CAM A;  4HN7 A;  2XSC A;  4OON A;  5D3D A;  4QB4 A;  1HJP A;  3J81 L;  1SDF A;  2IHE A;  2R93 G;  4Q5V A;  2VQE Q;  1NR4 A;  5C5M A;  1CSP A;  4DR3 L;  2HQL A;  4GLV B;  3UDF A;  1N34 L;  1II3 A;  1TXY A;  3AFQ A;  3DM3 A;  5C4X G;  3OTO Q;  3F2C A;  2AHO B;  1PH6 A;  1K0R A;  3I4N B;  1X6O A;  3K5L A;  1GJX A;  5M3F H;  3MVV A;  1LUZ A;  2JSO A;  3KLR A;  5FK9 C;  3UE1 A;  1QE6 A;  2VUM B;  3U50 C;  4ZYS A;  1D5Z C;  3U9O A;  2KEE A;  1M90 C;  1AE2 A;  1WCM G;  1I4R A;  3MEF A;  5M3M B;  3S14 B;  3UDG A;  1S5C D;  5F2D A;  1HNX L;  1QNK A;  3OWE B;  2N8N A;  3SE0 A;  2VXW A;  4OEL B;  3WDN A;  1EEI D;  1I94 Q;  1L0W A;  4A3I B;  2KHI A;  3C1F A;  1L0Y B;  1PFN A;  1KHI A;  2RDF A;  1BVS A;  3BS1 A;  4DR5 Q;  1CA6 A;  2ZJQ A;  4OGQ C;  4GLA C;  4ULL A;  1EY5 A;  1EFI D;  2FXQ A;  1GUS A;  2JA9 A;  4CKE A;  3HZX A;  4DUY L;  1NBW A;  4OO1 I;  2K5V A;  4LF7 Q;  2A1A A;  2ZTC A;  1J6Q A;  1SYC A;  1JE4 A;  2KJX A;  1YI2 A;  4X3K A;  1KAB A;  4X3U A;  4H13 C;  1IHZ A;  5T1I A;  1SE8 A;  4G7O C;  3IFD A;  1FL0 A;  3S1N H;  4LUZ A;  1PH1 A;  3K8A A;  1SLJ A;  3K57 A;  5JPN C;  3MWY W;  1K0S A;  3CCV A;  4GLX A;  1GUN A;  1CA5 A;  1U9R A;  2A74 C;  2J4X A;  2HT1 A;  4QF4 A;  4EVO A;  4AYB B;  4UP7 A;  1AZP A;  2ATW A;  2K52 A;  1FR3 A;  2B2U C;  2HHH Q;  4BA1 I;  5DLQ E;  4GNX C;  5JOB A;  5C4J B;  1CHP D;  4FXG C;  3BU2 A;  2OTL A;  4FDB A;  4OO1 G;  2DJF C;  3CCR A;  5FJ8 H;  2NVT B;  4JVZ A;  4NB3 A;  2B29 A;  3HOZ G;  1J8I A;  3MTS A;  1ASZ A;  2EY1 A;  4K6L A;  4OWW B;  3GTM H;  4A3K H;  4HR7 B;  4J15 A;  3QR8 A;  4CDC C;  3KDF B;  4IUU A;  4O2D A;  5IGD A;  1BF4 A;  1IBL Q;  5J1Z A;  1XJV A;  1M4V A;  1A0I A;  3J81 E;  2RDG A;  1F2Z A;  5AFW A;  1Y69 U;  3C2P A;  3PF4 A;  5DM7 3;  1HXY D;  1NTG A;  4A3M H;  4OWX B;  3CCJ A;  5E1F A;  3F2D A;  5GQO A;  1B3A A;  3HP3 A;  3PIO 3;  4JI2 L;  5LMU L;  2F1M A;  4LFC Q;  1Y1W G;  3FPU B;  3H0G H;  4GKJ L;  1PRT B;  2WAQ G;  4AYB E;  3PO3 G;  1RKN A;  3A7L A;  2R7Z G;  1LT6 D;  1GUG A;  4RCO A;  4RCN A;  1K73 C;  1S5F D;  4OEM B;  5CR3 A;  4JI5 Q;  2PMZ B;  2MPM A;  1O7Y A;  1CI3 M;  1VF7 A;  1G2S A;  1PV4 A;  4HCE A;  3TBI B;  4A3C G;  4AQY L;  5KRU A;  1K83 H;  1Q8K A;  1JJC B;  3CC7 A;  1VQH A;  2NVQ H;  2WFW A;  2XIW A;  3CMA A;  5CMD A;  3PUX A;  4O42 A;  5FLM H;  2JA6 H;  1VQM A;  4KY7 A;  2GN5 A;  3Q8D A;  1OXU A;  1IL8 A;  2B2W C;  4WJ3 M;  1G51 A;  4G57 A;  5JAV A;  3M85 A;  4MNO A;  2R93 H;  2MO1 A;  3H3V I;  1EY9 A;  2CHB D;  1S72 A;  1JOO A;  2E2D C;  1SYG A;  3WOE A;  5C4X H;  1STA A;  5K5P A;  1HNW L;  4FF4 A;  1X3F A;  1U4P A;  4RKL A;  1X3P A;  3BZD B;  1SYE A;  4DR2 L;  1SYD A;  1U0L A;  1V1P B;  4IZ8 A;  3Q6S A;  2B8G A;  2KUM A;  4P75 A;  2OCE A;  1AH9 A;  1TWF B;  1HCZ A;  1WCM H;  2Z6K A;  2RQX A;  3VR6 A;  1NJI C;  4GNX B;  1IYU A;  2JA8 H;  1M1K C;  2PMZ E;  1XTC D;  2F0E A;  1HH2 P;  2RF4 A;  4EQP A;  1NSN S;  2UUC L;  4BWG B;  1XMO Q;  1XNQ Q;  3PUY A;  3RMH A;  5FLX L;  1PTO C;  1Z47 A;  2JP1 A;  4B9X A;  5BR8 Q;  3NPP A;  1PA6 A;  4HMJ A;  1W6J A;  1JMC A;  2I46 A;  5C4Z A;  2E2I H;  3ERO A;  2AQ1 B;  1JQY D;  2YTV A;  1HTL D;  4HAE A;  2K5W A;  4U67 3;  4JI7 Q;  4L6T B;  5IP9 G;  3HOW B;  4N8X 1;  1X3Q A;  1EFW A;  1N36 L;  4WJW A;  4H7B A;  4N9T A;  2RKS A;  2EXZ A;  1YBY A;  3M3Y H;  1QZG A;  1Q12 A;  1MHW C;  1C48 A;  1BBX C;  3STB C;  3W1G A;  3AEV A;  4IPD A;  3MZ5 A;  4N8F A;  4OO1 H;  1JWS D;  2L55 A;  1D7Q A;  4A3J B;  2R92 G;  1EOT A;  4N9P A;  5BN3 A;  3M4O H;  2UXB L;  1KDB A;  1IYV A;  1CTM A;  1XNR Q;  3S1Q B;  1KRT A;  1A3V A;  4LJZ C;  1D1K A;  4X62 L;  1DGS A;  3NK9 A;  2MJ8 A;  3U4Z A;  3HOY H;  1ZXT A;  5M5W B;  4DGZ A;  1A3T A;  3E9I A;  4AIM A;  2K5Q A;  3GO5 A;  1K8O A;  2E2H B;  1BUV T;  4G4K A;  3Q24 A;  4C3I H;  2K28 A;  4JOI A;  2F0M A;  1IZ6 A;  1MJE A;  2EYL A;  3MXN A;  4RMF A;  1MKH A;  1PH7 A;  1C7Y A;  1MD2 D;  3GTP H;  1TS2 A;  4X64 Q;  5GAE C;  3PQI A;  2HDL A;  2M2L A;  1P8L A;  3MAQ A;  1YHQ A;  1IBM L;  5C3X A;  1ILP A;  4M1U B;  5C0X J;  3OIP A;  4LAA A;  5LMN L;  2N88 A;  2R7Z H;  1YHB A;  2Y0S B;  3WOF A;  1Q8I A;  3CCU A;  3KBX A;  4LF6 Q;  4CDE C;  3PCO B;  4A3C H;  2IL8 A;  3SXH A;  4P72 A;  1ML0 D;  3FRP B;  2TMP A;  5FLX E;  4K5X A;  4XQQ A;  2VL6 A;  3J81 c;  2MQH A;  5JVG 3;  3I70 A;  1PTO B;  2QDB A;  2PZT A;  1TY0 A;  3M4Y A;  4NXM Q;  2L5T A;  3GTQ B;  1CKM A;  4CDF C;  3IFT A;  4B3T L;  2F0P A;  3MEH A;  1U5K A;  4KTA A;  3V96 A;  2AMC B;  5IE8 A;  1KXL A;  1STH A;  1YJN A;  1HA6 A;  3I4L A;  5IYC H;  1BCP F;  1EZ6 A;  1U4R A;  4DNR B;  3CCL A;  5LHY 1;  2I5H A;  1LT3 D;  1BBW A;  2GA4 B;  1SEB D;  2KBN A;  4KI0 A;  1IW7 D;  1KD1 C;  1N9W A;  2F3W A;  1UWV A;  1MI2 A;  1U4L A;  5T1G A;  3CD6 A;  3I4N H;  4KKU A;  2ID0 A;  4IN3 A;  2Y0S E;  3OIQ A;  3GP7 A;  1H9R A;  2JA7 B;  1OXS C;  3CF5 A;  3PO2 G;  3PF5 A;  5BN5 A;  2BDN A;  2VS1 A;  4FF1 A;  3GTO B;  2D5D A;  2IPK D;  4LF5 L;  4C3H B;  1SRU A;  1Y1V B;  1VMC A;  1S3O A;  1CQF A;  2K75 A;  1DOL A;  3H3V H;  1EZ8 A;  1IKM A;  1SN8 A;  1PYB A;  2M00 A;  3ND8 A;  1EQV A;  2K5H A;  2B2Y A;  5M5X B;  4I65 A;  3L2P A;  3UDX A;  4RGT A;  1ZKO A;  2DUD A;  3FP9 A;  3GTL B;  3VA7 A;  1H9S A;  4FP5 D;  4XDX A;  1SMY D;  3OTO L;  1UNS A;  1SXT A;  4KHV A;  5CV4 A;  3OW7 A;  3FEW X;  3HEJ A;  4GOP C;  3TQY A;  1STE A;  3P1H A;  4C2M H;  4JI4 Q;  3H09 A;  3BVM A;  3M7N A;  4IPC A;  3BYY B;  2B8F A;  2Q2H A;  4HJ8 A;  5C4J H;  4LF9 Q;  2B63 B;  2R92 H;  3HFZ B;  3O13 A;  2JYO A;  5M3F G;  2PPB C;  1KAW A;  2NVT H;  4DR5 L;  4K6D A;  1E1O A;  3DEP A;  3NE5 B;  2XN9 C;  4DAP A;  2D9U A;  3ZYY X;  2ICI A;  3QOJ A;  4LF7 L;  3Q0A A;  2R7D A;  3NQT A;  1IKL A;  1O7L A;  1WTH A;  1I50 B;  1Q1B A;  2E76 C;  1JWM D;  4A3G B;  4K2K A;  3CCQ A;  3HOU B;  4C3J B;  1RCV D;  1QVC A;  3MFG A;  4MN3 A;  1B53 A;  1I3Q B;  4P73 A;  3I4M B;  4XYQ A;  3KF6 B;  1I4G A;  1N32 L;  3DXJ C;  1SBB B;  1VQF A;  2YU9 B;  1CKN A;  2E8G A;  2M9V A;  3A56 A;  2KHS A;  2DNE A;  4DFA A;  5JJK A;  1ICF B;  2HQE A;  5TSS A;  3E0E A;  1VQL A;  2CH4 W;  1EY7 A;  4KN4 C;  2EJG C;  3CHB D;  3PV0 A;  1G6P A;  3S2H H;  4FYD A;  1HFN A;  3HOX B;  1DXM A;  3NEM A;  3KUP A;  2RHQ B;  1Z9F A;  3DMU A;  2O5J C;  3DHQ A;  1VF5 C;  3LX0 A;  5EBD A;  1FJG Q;  1MJC A;  2UUA Q;  1O7I A;  5GAG C;  1IBL L;  3QIA A;  2F0W A;  3SDZ A;  4ZKC B;  1DCZ A;  2VQF L;  1PFM A;  2EDG A;  5FJ8 G;  3SGI A;  2F4V Q;  3J7A 5;  2AUJ D;  3I73 A;  3Q23 A;  1B9M A;  4QJF A;  3TRE A;  4DV4 L;  1JB3 A;  1ZEQ X;  2G9D A;  2RSO A;  1EUJ A;  1LAB A;  4RG1 A;  4A3K G;  1Q7Y C;  2DN8 A;  2AQ3 B;  3ONA B;  4LFC L;  1K3R A;  1W6K A;  1Q90 A;  2EQS A;  5C44 G;  4GOP B;  2YV5 A;  1B70 B;  5FLX c;  5C3E G;  4UY8 C;  2F0D A;  2WV6 D;  4JG2 A;  4JI5 L;  3PO2 H;  4HJ7 A;  3I90 A;  3PIP A;  4H44 C;  5GAD C;  4L5S A;  4A3M G;  4LUV A;  1C9O A;  3FHW A;  2NN6 H;  2EYO A;  3H0G G;  1E22 A;  1JJG A;  3DEO A;  1I4P A;  1SE4 A;  1STB A;  3RLO A;  3A5U A;  2AUK A;  2D2C C;  4MZ9 A;  3OW2 A;  2HIX A;  4JBJ A;  2V1C C;  4K5W A;  3J81 j;  2XWB B;  1LLR D;  1DJR D;  3T53 B;  3CPW A;  3PUZ A;  4DR4 Q;  1TR5 A;  4KHP L;  3A7A B;  3NWS A;  1TWA B;  3T51 B;  2NWG A;  3T4A C;  1VQ6 A;  1L1O A;  2HD3 A;  3HOW H;  4NPS A;  4JI6 Q;  5KYL A;  4K8I A;  4BY7 B;  1Y8P B;  1PH5 A;  2F3V A;  4JI3 Q;  1KQS A;  3C1E A;  2WKC A;  1PZK D;  1RJT A;  1HR0 Q;  1EIG A;  2L9H A;  4CJ0 B;  1EYA A;  1SFO H;  2K04 A;  4GN4 B;  2D0P A;  2L11 A;  1EWH A;  3A0J A;  3QOL A;  5I9O A;  1MIU A;  1F77 A;  1HTP A;  3DWP A;  1QUQ A;  1U4M A;  4YY3 Q;  1XMO L;  1YHA A;  1DYQ A;  1XNQ L;  3SK4 A;  4APV A;  4A3B G;  3ND9 A;  1FVI A;  4IJH A;  1G6Z A;  4IPG A;  4Y52 H;  3MXP A;  4KKS A;  2L15 A;  3WWV A;  3S1Q H;  1FYC A;  1E0B A;  3GQB A;  1JB7 A;  2JQO A;  4A3E G;  5DNF A;  2QKI C;  3K80 C;  5CYU A;  2JA8 G;  1OXX K;  5M5W H;  1EIH A;  4XT3 B;  4NMZ A;  4DV7 L;  3S16 B;  3F2B A;  2F4I A;  1I4X A;  4B9W A;  4A3D B;  4JK1 C;  1WTQ A;  4KY6 A;  4R4C A;  4ZUI A;  2F0S A;  5JEA J;  1UE6 A;  3SK5 A;  3W5O A;  1IXR A;  4EQN A;  5IGE A;  4JI0 Q;  5DAU A;  2K01 A;  3HKS A;  1VQ8 A;  1R9T B;  3NXW A;  2IHF A;  2KEC A;  3TP7 A;  3K0X A;  2CQO A;  2OQ0 A;  2ZM6 Q;  3A55 A;  3VR3 A;  4IOC A;  1X32 A;  2RVL A;  5CV6 A;  1TVX A;  2A69 D;  1I6H B;  5DEH A;  2UU9 Q;  1XMQ Q;  3HOV B;  4LNQ A;  4ZAI A;  4L5T A;  4TSS A;  1XNR L;  1STN A;  1WFQ A;  3BZC A;  2EVB A;  5LL6 S;  4GKK Q;  1H95 A;  3HKZ B;  5NUC A;  4DUZ L;  1PTO H;  3N52 A;  3K58 A;  1BKB A;  3GTQ H;  1SJH D;  4JPB W;  5LMN W;  1IW7 C;  3CKI B;  5I6W A;  4IUP A;  2N78 A;  2KVM A;  4DR1 Q;  1B44 D;  4LWC A;  1LO5 D;  1UUP A;  4X64 L;  4DV1 Q;  1AFP A;  4JBK A;  4X65 Q;  2KHJ A;  2HDM A;  2R61 A;  3HOY G;  2LMC B;  1K9M C;  4ZRZ A;  4JW0 A;  5JJZ A;  1HA5 A;  4LFB Q;  1EYC A;  1HQR D;  4C3I G;  5C44 H;  1IBK Q;  1G91 A;  3CU7 A;  4H02 A;  1HUN A;  1NMF A;  5C3E H;  4MTK A;  1WVL A;  2QIL A;  3J80 i;  1EIY B;  4LF6 L;  4JI1 L;  3D0F A;  2Z6K C;  4JI8 Q;  4PQX A;  4C1N K;  1L2F A;  3S15 H;  1VQN A;  3GTO H;  3T1H Q;  4C3H H;  1DM0 B;  1Y1V H;  1YZ6 A;  3K5M A;  1B3Q A;  2IX1 A;  4DXF A;  4JV5 L;  4TQU S;  2NVY H;  2MHV A;  1CK1 A;  3HKZ E;  3GTJ B;  1SMY C;  1STG A;  2BA0 A;  1SSO A;  3S1R H;  2CH4 A;  2LSS A;  4ODG A;  5M5X H;  2SOB A;  2NTT A;  1WTV A;  3AFP A;  2VY3 A;  2YTX A;  4FF3 A;  4F7X A;  3FKI B;  1S5E D;  3MFY A;  2L12 A;  3GTL H;  4CGY B;  3BDO A;  4IUQ A;  1N33 L;  4JYA Q;  5A2Q E;  3DWA A;  5FO7 B;  5KIX A;  1EOV A;  2KCC A;  1MGS A;  5EKK A;  2H4O A;  1HR0 W;  4DNI A;  3I91 A;  3K0Y A;  1V1P A;  4M8A A;  1S40 A;  4A3F B;  4BBR G;  1O78 A;  1B1Z A;  2NVX H;  1PH2 A;  3R2T A;  1CZW A;  5IYC G;  1Y8O B;  3K81 C;  3VYU A;  1WTW A;  4BBS B;  1PRT F;  1SR3 A;  2MGS A;  1CUK A;  3EJI A;  3NTI A;  3FDT A;  2XRS D;  4WFN 3;  1Q81 C;  2F0V A;  4C56 C;  1PMR A;  1B2T A;  2UXC Q;  2EIF A;  2BDO A;  3NUC A;  3DWQ A;  1RD9 D;  2WIN B;  4ZQ3 A;  1JOR A;  3KYH C;  3HRZ C;  3I4N G;  1TQO A;  4A3B H;  3S9W A;  4LF8 Q;  1D8L A;  2PO4 A;  3KJP A;  1K8G A;  4CJ2 C;  2I5L X;  3SK8 A;  2VUM G;  4PMW A;  4E6I A;  2O2L D;  3RD4 A;  3J80 L;  4A3E H;  3BYT B;  5M3M G;  2K05 A;  2Z9H A;  5GRO A;  1HPC A;  1I50 H;  3QB3 A;  1M8A A;  4EX5 A;  3KLW A;  1SNP A;  4DV5 L;  3HOU H;  4C3J H;  3CRK C;  4JOI C;  4R4T A;  4A3I G;  2A68 D;  4CBV A;  3GD7 A;  3N6R A;  4DK1 A;  4IUR A;  4BY1 B;  4DXG A;  2FMM A;  1MBY A;  1N34 Q;  4J6H A;  3CQZ B;  4JI4 L;  2PYK A;  3M9B A;  4ALP A;  3ERQ A;  4QIW B;  4LF9 L;  4NW2 A;  1BXT A;  4YIJ A;  1PZJ D;  3I7F A;  3I3C A;  1GUT A;  2CQA A;  1EU3 A;  2VB2 X;  4R8N A;  2LY7 A;  1XXG A;  4Y7N B;  4XQJ A;  1HNX Q;  1EEF D;  4AYB G;  3HOX H;  1ZYR D;  1GHJ A;  2MUY A;  5IY0 A;  3VR4 A;  1LM0 A;  1A3U A;  5DM6 3;  4A93 B;  1VQ5 A;  2L4N A;  4GZY C;  3ER0 A;  4A3L G; 
#chains in the Genus database with same CATH homology
 4XTC S;  1TWC B;  4G7H C;  3D6C A;  4FNF A;  2PQE A;  1TS4 A;  3BVG A;  1LAC A;  1VCI A;  5D14 A;  2JA5 B;  5G3L F;  3Q22 A;  5JPM C;  2WB1 B;  3MXG A;  3L3O C;  1TWH B;  4X3T A;  2ZXP A;  2A6E D;  4KMU C;  2RSN A;  3D8G A;  1CM9 A;  1O7Z A;  5EKL A;  1KDA A;  4IUT A;  3BVZ A;  4ZUJ A;  1WTO A;  1PRT D;  3OWF A;  3GTG B;  2X6L A;  4WRD A;  3K59 A;  4IFD J;  5I2Y A;  3R8B A;  2EY6 A;  5COY A;  4NKL A;  1ESF A;  3J80 E;  3E6Z X;  5D3I B;  2B2Y C;  3OHX C;  2JXM B;  5M9O A;  5KGU A;  2EPB A;  1LV9 A;  1O80 A;  2A6H D;  2HCC A;  2C9O A;  4WOR A;  1Q3L A;  3H91 A;  3OSO A;  3NTK A;  4DAV A;  2K6A A;  2NZ1 D;  4K2L A;  2NN6 I;  3RZD B;  3IAY A;  3D3R A;  1I4Q A;  1A2U A;  2NTS A;  3G7L A;  1PLF A;  4DK0 A;  3M7G A;  2R3Z A;  5LL6 X;  4RGO S;  4UAI A;  4OIJ A;  2FIN B;  3K7A B;  2B2V A;  1C8C A;  1D5X C;  1VDZ A;  4OIK A;  3P75 A;  3T16 A;  5M5Y B;  3GTM B;  4CHT B;  4ID6 A;  1PTO F;  2F0U A;  1JOQ A;  5JEA H;  1KTK A;  5C5L A;  1A15 A;  3VYS A;  3R2I A;  2NN6 G;  4FXK C;  1WTX A;  1OO9 B;  3TME A;  4J1M A;  1T5X D;  5CV7 A;  2J0T D;  2A69 C;  4HTH A;  1HFG A;  2PNR C;  3V2T A;  4KD3 A;  1AEX A;  3TDQ A;  1YNN D;  1FNV A;  1PDQ A;  3VR5 A;  4LMQ D;  5IGC A;  3ITP A;  2F0N A;  3PIP 3;  1KAA A;  2LKV A;  1FNW A;  2L1B A;  4TRD A;  3OPO A;  4DAY A;  1GOZ A;  2A73 B;  2Q8R E;  3K6O A;  2EE1 A;  3SHL A;  5C0X I;  1SYF A;  1B4O A;  2NVQ B;  2XWJ B;  4IFD I;  5IGG A;  2EYH A;  3MC0 B;  1FGB D;  3MHB A;  1KDC A;  2JA6 B;  1RF2 D;  3E5S A;  4PMB A;  4F87 A;  3W3A A;  2R93 B;  3NSW A;  3KK7 A;  1OXT A;  1ET6 A;  1EY6 A;  1SNM A;  3LNN A;  3NHH A;  3S1M B;  4HCS A;  1H9S B;  2BA1 A;  5C4X B;  3NTH A;  3HS0 C;  3AMU A;  2EJF C;  3NQI A;  4IUN A;  1C4Q A;  5C0X G;  2PW5 A;  2Z4H A;  1H9J A;  1WCM B;  2JE6 I;  4J8Q A;  1KLG D;  3GTK B;  4DN4 M;  3T56 B;  1BCP D;  1SYB A;  1LTI D;  2G9H D;  5E4X A;  1PXU A;  2KOL A;  4H0L C;  4R9W A;  1H9K A;  1EU4 A;  2V4D A;  1D5M C;  1BR9 A;  4KN7 C;  1QJO A;  2F03 A;  1ET9 A;  4L8J A;  1QOH A;  3J7Y W;  4XT1 B;  1ONL A;  3NBH A;  2D62 A;  5KNB A;  2FFK B;  1EWC A;  4IUV A;  1G8Z D;  3SK6 A;  3JAM E;  1AP0 A;  2K32 A;  3VYT A;  4KKT A;  5D65 A;  4HSV A;  2QCP X;  4OL7 A;  1JCK B;  1JIC A;  1R4P B;  2ICE C;  3QG1 A;  2IWH A;  4ZKB B;  4HED A;  5J39 A;  2IJ0 A;  1GHK A;  3M4O B;  3H3V C;  1SJE D;  4RAU C;  3HOZ B;  3URY A;  3TP5 A;  2A68 C;  4BA2 I;  3S17 B;  3QJY A;  1JWU D;  1E2V A;  2PW7 A;  3L7Z C;  2RBM A;  1MSH A;  4C3H G;  2QF7 A;  3MXU A;  4KHZ A;  1DOK A;  2L0C A;  3GTP B;  1ENC A;  4DA2 A;  2FMC A;  3VR2 A;  1ILQ A;  4ZLT F;  1Y1W B;  2NYZ D;  1D6E C;  1F9R A;  2CW0 D;  2WAQ B;  3PO3 B;  1TWG B;  4X3S A;  2R7Z B;  3I8Z A;  3OOC A;  4ILW A;  1ZYR C;  3SEB A;  1TKW B;  5IOD A;  5KND A;  1I6V C;  4L63 B;  5HGT A;  5IT9 L;  1SE2 A;  2OT2 A;  4CKC A;  2E74 C;  2AWN A;  3U9S A;  1HHV A;  1FNU A;  2KED A;  3LWE A;  2DY8 A;  3TP8 A;  2QEJ C;  2BE5 C;  3FVQ A;  1HQM C;  1KLU D;  2A6E C;  1B9N A;  1CZG A;  4B08 A;  1DZ1 A;  5C4H A;  1RDP D;  5ISR A;  5IIF A;  4PMC A;  4K5V A;  1QCB D;  4XQN A;  3D4R A;  3R93 A;  1PRT C;  3PUW A;  5C0X H;  2PZU A;  4C3J G;  5A2Q L;  1RTN A;  2X69 A;  4IFD H;  3BG3 A;  5I4D A;  1BQQ T;  1LTB D;  1SND A;  2A6H C;  1JR0 D;  4S3S A;  1SNQ A;  1KNA A;  1ESR A;  1EQT A;  2F0H A;  3GV3 A;  4RHR A;  1HUM A;  2OXP A;  3L9A X;  2XNA C;  4ZK9 B;  5E4W C;  3A8I E;  3TZU A;  3EA6 A;  3VYR A;  4I7Z C;  3I72 A;  1GUW A;  2FHT A;  4QCL A;  1ENF A;  1SNO A;  2ZXO A;  1NUC A;  4C2M B;  3EQL C;  2K7V A;  5E3F A;  1G2T A;  5EPK A;  1XX8 A;  2R92 B;  2LS0 1;  1D2B A;  3BDC A;  1QIL A;  1WD0 A;  1DON A;  3P20 A;  5IT9 E;  4QMG A;  1Z7T A;  5IGF A;  2N55 A;  2F0K A;  1LTA D;  3X3N A;  5ELF A;  4DU9 A;  2HCI A;  3D6W A;  2K1B A;  5CGK A;  3VA5 A;  3S2D B;  1YNN C;  2JEB I;  5KNC A;  2WKD A;  3G6J B;  3A8K E;  2XRQ D;  4OHJ A;  4QUC A;  2B2T C;  2F0Q A;  2NBF A;  5ELC A;  1UAP A;  1RTO A;  4FVM A;  5A35 A;  2VNU D;  3PUV A;  2I07 B;  4HSP A;  2JEA I;  3HG9 A;  2EYJ A;  4MHE A;  1NAP A;  4IAL A;  4QUF A;  1K8M A;  3RZO B;  2ENB A;  5K36 H;  3K5O A;  3S2H B;  1WTP A;  1F2Y A;  1FD7 D;  1I4H A;  2B2U A;  1F9S A;  3RLF A;  1CFM A;  2ZT9 C;  4V0B A;  2TSS A;  2Z8L A;  5EPJ A;  4XYO A;  5FO8 B;  1MSG A;  1HRJ A;  1S5B D;  3OMG A;  3IL8 A;  4IQZ A;  2SNM A;  1YNJ C;  1T5E A;  3FMC A;  5JEA G;  1BCP C;  4PNY A;  3EFX D;  5CV9 A;  2B2T A;  2KCN A;  2X6G A;  1TII D;  2B39 A;  3PO2 B;  2NB0 A;  3IKJ A;  4UDU C;  2R6G A;  3AB9 A;  2AQ2 B;  3E0J A;  4EGV A;  2E2J B;  2PZW A;  3D4W A;  4F88 A;  2XVS A;  3UI2 A;  2OEO A;  4Q0F A;  4JBW A;  5IOC A;  1J9O A;  2IX3 A;  5KEE A;  2Q8T A;  2EYP A;  4HMI A;  1R4Q B;  2SEB D;  2A5H A;  4NDX A;  3A54 A;  4DNT B;  4LK1 C;  4G7Z C;  4O1N A;  3C3L A;  5CV5 A;  1E2W A;  2B2W A;  4KJO A;  3P7J A;  1TU2 B;  5I2X A;  3R3O A;  5I9P A;  4FF2 A;  5JVH 3;  3FPP A;  1PYW D;  3EVQ A;  1OXV A;  1SFO B;  2EOT A;  1V8Q A;  1F2M A;  2E75 C;  4K8J A;  5CC4 A;  1BNZ A;  5EBC A;  5M3F B;  2BE5 D;  2B2V C;  1TT2 A;  3K5N A;  4CJ1 B;  5HUR A;  4U68 A;  2F0L A;  3D31 A;  4FO2 A;  5CV8 A;  4C1N I;  3KF8 A;  1Z6H A;  2LFN A;  1WD1 A;  1ROD A;  4PV1 C;  4RHS A;  2FJ2 A;  4NP5 A;  2CW0 C;  1UEA B;  2F0J A;  5IGB A;  3RUZ A;  2PCF B;  5COR A;  2Z1C A;  1VMP A;  5I6Y A;  4RH6 A;  4TKO B;  1EYD A;  2IW3 A;  4KD4 A;  1KNE A;  1BCP B;  3GV6 A;  1H9M A;  3C46 A;  1ICW A;  1G29 1;  2YYZ A;  3S1N B;  1D1I A;  1XWE A;  3H6M A;  4RGM A;  2F0F A;  5FKA C;  4MIU A;  4KJN A;  1DD2 A;  5KYI A;  4RGN A;  2OF1 A;  1EY0 A;  4EQO A;  1JC7 A;  1BO0 A;  3J7A F;  1F9P A;  3F2U A;  1BOS A;  5EJW A;  1PFB A;  1JOK A;  2O4X A;  2WP8 J;  3KBG A;  1NCV A;  4A3K B;  1CQV A;  2C5C A;  5C44 B;  5C3E B;  4KY5 A;  4A3M B;  4ME5 A;  3JAM L;  3S15 B;  3H0G B;  5G3L D;  4RFB A;  2F0O A;  4XIG S;  3QWN A;  2NVY B;  5ELB A;  3KLS X;  2EY5 A;  4BS9 A;  2HUG A;  4XXE A;  3S1R B;  2EYF A;  1TY2 A;  2Q8I B;  5BN4 A;  1K83 B;  1QWY A;  4P2C B;  5EQ0 A;  5C3W A;  4RA8 A;  2K03 A;  3HGB A;  4RKB A;  3TSS A;  3SR1 A;  1LTR D;  3TZD A;  2NVX B;  2F0G A;  1CHQ D;  2BOS A;  2DNC A;  1LTG D;  3OMC A;  2ZXR A;  4V19 0;  3CRL C;  1L0X B;  1E2Z A;  1GUO A;  2AWO A;  1S5D D;  1RHP A;  3J7A V;  2IX0 A;  3H94 A;  4A3B B;  3QO2 A;  3V05 A;  4DF7 A;  2Z4I A;  2F0T A;  4ABN A;  4F8M A;  1AZQ A;  4IFD G;  5ELE A;  4A3E B;  2KQ3 A;  1YNJ D;  2JA8 B;  4RWS C;  2EJM A;  2RDH A;  2SDF A;  1BDO A;  3TN2 A;  2WII B;  1S4Z A;  1PZI D;  5ELD A;  1WTR A;  1STY A;  5J22 A;  2WAC A;  2KA7 A;  2E2I B;  3TP6 A;  1EY4 A;  1AW7 A;  5EPL A;  3X3M A;  1XYI A;  1AN8 A;  1PTO D;  2EZV A;  2DY7 A;  2CVR A;  4Z9C B;  1LT5 D;  3M3Y B;  5EGT A;  1TS5 A;  2EYM A;  1B50 A;  1F9Q A;  3NWT A;  1A6X A;  4CKB A;  3LWU A;  5C6A A;  2H1E A;  1EY8 A;  1A2T A;  1NR2 A;  1CT1 D;  3HOY B;  1EL0 A;  1Q1E A;  2BCO A;  4C3I B;  5FO9 B;  1V1O A;  3AU7 A;  3NP8 A;  1V43 A;  2K33 A;  4R8I A;  2IT1 A;  1SAP A;  2EY2 A;  3D4D A;  1TS3 A;  4FXD A;  1SNC A;  1LTT D;  2RA4 A;  1QB5 D;  3W2D A;  1GXD C;  5EKI A;  1Y8N B;  1SE3 A;  2O5I C;  3DUZ A;  1QG7 A;  3DM1 A;  3NBI A;  5FOB B;  3T13 A;  2MP1 A;  2K5D A;  2J7Z A;  5K36 G;  5CBE E;  1LTS D;  4KK7 A;  5CBA E;  2SNS A;  1F2L A;  3BDL A;  3KLS A;  2VB3 X;  4K14 A;  2F0I A;  4KV6 A;  1LT4 D;  3A8J E;  4BBR B;  1QNU A;  2NUC A;  1DOM A;  1ENA A;  3SVM A;  3MA2 B;  3PMF A;  4HN7 A;  2XSC A;  5D3D A;  4QB4 A;  3J81 L;  1SDF A;  4Q5V A;  1NR4 A;  5C5M A;  1II3 A;  3I4N B;  3K5L A;  1GJX A;  3MVV A;  3KLR A;  2JSO A;  5FK9 C;  1QE6 A;  2VUM B;  4ZYS A;  1D5Z C;  3U9O A;  2KEE A;  1I4R A;  5M3M B;  3S14 B;  1S5C D;  5F2D A;  1QNK A;  3OWE B;  3SE0 A;  2VXW A;  3WDN A;  1EEI D;  4A3I B;  3C1F A;  1L0Y B;  1PFN A;  2RDF A;  3BS1 A;  1CA6 A;  4OGQ C;  4ULL A;  1EY5 A;  1EFI D;  1GUS A;  4CKE A;  3HZX A;  4OO1 I;  1SYC A;  1JE4 A;  2KJX A;  4X3K A;  1KAB A;  4X3U A;  4H13 C;  1IHZ A;  5T1I A;  4G7O C;  3IFD A;  3K57 A;  5JPN C;  3MWY W;  1GUN A;  1CA5 A;  1U9R A;  2A74 C;  2J4X A;  4QF4 A;  4EVO A;  4AYB B;  1AZP A;  1FR3 A;  2B2U C;  4BA1 I;  5JOB A;  5C4J B;  1CHP D;  4FXG C;  4OO1 G;  2NVT B;  1J8I A;  3MTS A;  2EY1 A;  4K6L A;  4HR7 B;  4IUU A;  5IGD A;  1BF4 A;  5J1Z A;  1M4V A;  3J81 E;  2RDG A;  1F2Z A;  5AFW A;  1Y69 U;  3C2P A;  5DM7 3;  1HXY D;  5E1F A;  3PIO 3;  1B3A A;  3HP3 A;  2F1M A;  3FPU B;  1PRT B;  1RKN A;  3A7L A;  1LT6 D;  1GUG A;  4RCO A;  4RCN A;  1S5F D;  5CR3 A;  2PMZ B;  2MPM A;  1O7Y A;  1CI3 M;  1VF7 A;  1G2S A;  4HCE A;  3TBI B;  5KRU A;  2XIW A;  5CMD A;  3PUX A;  4O42 A;  4KY7 A;  1OXU A;  1IL8 A;  2B2W C;  4G57 A;  5JAV A;  3M85 A;  1EY9 A;  2CHB D;  1JOO A;  2E2D C;  1SYG A;  3WOE A;  1STA A;  5K5P A;  4FF4 A;  1U4P A;  4RKL A;  1X3P A;  3BZD B;  1SYE A;  1SYD A;  1V1P B;  4IZ8 A;  3Q6S A;  2B8G A;  2KUM A;  1TWF B;  1HCZ A;  2RQX A;  3VR6 A;  1IYU A;  1XTC D;  2F0E A;  4EQP A;  1NSN S;  4BWG B;  3PUY A;  3RMH A;  5FLX L;  1PTO C;  1Z47 A;  2JP1 A;  4B9X A;  3NPP A;  4HMJ A;  1W6J A;  2I46 A;  5C4Z A;  3ERO A;  2AQ1 B;  1JQY D;  1HTL D;  4HAE A;  2K5W A;  4U67 3;  4L6T B;  3HOW B;  1X3Q A;  4WJW A;  4H7B A;  4N9T A;  2RKS A;  2EXZ A;  1Q12 A;  1C48 A;  1BBX C;  3MZ5 A;  4OO1 H;  1JWS D;  2L55 A;  4A3J B;  1EOT A;  4N9P A;  5BN3 A;  1KDB A;  1IYV A;  1CTM A;  3S1Q B;  1A3V A;  4LJZ C;  1D1K A;  3NK9 A;  2MJ8 A;  1ZXT A;  5M5W B;  4DGZ A;  1A3T A;  2K5Q A;  3GO5 A;  1K8O A;  2E2H B;  1BUV T;  4G4K A;  3Q24 A;  2K28 A;  2F0M A;  2EYL A;  3MXN A;  1MD2 D;  1TS2 A;  2HDL A;  2M2L A;  3MAQ A;  5C3X A;  1ILP A;  4M1U B;  5C0X J;  3OIP A;  4LAA A;  2N88 A;  2Y0S B;  3WOF A;  1Q8I A;  3KBX A;  2IL8 A;  3SXH A;  1ML0 D;  3FRP B;  2TMP A;  5FLX E;  4K5X A;  4XQQ A;  5JVG 3;  3I70 A;  1PTO B;  2QDB A;  2PZT A;  1TY0 A;  3M4Y A;  3GTQ B;  2L5T A;  3IFT A;  2F0P A;  3MEH A;  4KTA A;  3V96 A;  1STH A;  1HA6 A;  3I4L A;  1BCP F;  1EZ6 A;  1U4R A;  4DNR B;  5LHY 1;  1LT3 D;  2GA4 B;  1SEB D;  4KI0 A;  1IW7 D;  2F3W A;  1MI2 A;  1U4L A;  5T1G A;  4KKU A;  2ID0 A;  4IN3 A;  3OIQ A;  3GP7 A;  1H9R A;  2JA7 B;  1OXS C;  5BN5 A;  2BDN A;  4FF1 A;  3GTO B;  2D5D A;  2IPK D;  4C3H B;  1Y1V B;  1VMC A;  1CQF A;  1DOL A;  1EZ8 A;  1IKM A;  2M00 A;  3ND8 A;  1EQV A;  2B2Y A;  5M5X B;  4I65 A;  4RGT A;  1ZKO A;  3GTL B;  3VA7 A;  1H9S A;  4FP5 D;  4XDX A;  1SMY D;  1UNS A;  1SXT A;  4KHV A;  5CV4 A;  3OW7 A;  3FEW X;  3HEJ A;  1STE A;  3P1H A;  3H09 A;  3BVM A;  3M7N A;  3BYY B;  2B8F A;  2B63 B;  3O13 A;  2JYO A;  2PPB C;  4K6D A;  3DEP A;  3NE5 B;  2XN9 C;  4DAP A;  2D9U A;  3ZYY X;  2ICI A;  3QOJ A;  3Q0A A;  3NQT A;  1IKL A;  1O7L A;  1I50 B;  1Q1B A;  2E76 C;  1JWM D;  4A3G B;  4K2K A;  3HOU B;  4C3J B;  1RCV D;  3MFG A;  4MN3 A;  1B53 A;  1I3Q B;  3I4M B;  4XYQ A;  1I4G A;  3DXJ C;  1SBB B;  2YU9 B;  2M9V A;  3A56 A;  2KHS A;  2DNE A;  4DFA A;  2HQE A;  5TSS A;  1EY7 A;  4KN4 C;  2EJG C;  3CHB D;  3PV0 A;  4FYD A;  1HFN A;  3HOX B;  1DXM A;  3KUP A;  3DMU A;  2O5J C;  3DHQ A;  1VF5 C;  3LX0 A;  5EBD A;  3QIA A;  2F0W A;  3SDZ A;  4ZKC B;  1DCZ A;  1PFM A;  2EDG A;  2AUJ D;  3I73 A;  3Q23 A;  1B9M A;  1JB3 A;  1ZEQ X;  2G9D A;  2RSO A;  1LAB A;  2DN8 A;  2AQ3 B;  3ONA B;  1W6K A;  1Q90 A;  2F0D A;  2WV6 D;  3I90 A;  4H44 C;  2NN6 H;  2EYO A;  3DEO A;  1I4P A;  1SE4 A;  1STB A;  2AUK A;  2D2C C;  4K5W A;  2XWB B;  1LLR D;  1DJR D;  3T53 B;  3PUZ A;  1TR5 A;  3A7A B;  3NWS A;  1TWA B;  3T51 B;  2NWG A;  3T4A C;  5KYL A;  4K8I A;  4BY7 B;  1Y8P B;  2F3V A;  3C1E A;  2WKC A;  1PZK D;  1RJT A;  1EIG A;  2L9H A;  4CJ0 B;  1EYA A;  2K04 A;  2L11 A;  1EWH A;  3QOL A;  5I9O A;  1F77 A;  1HTP A;  3DWP A;  1U4M A;  1DYQ A;  3SK4 A;  3ND9 A;  1G6Z A;  3MXP A;  4KKS A;  1FYC A;  1E0B A;  3GQB A;  5DNF A;  2QKI C;  5CYU A;  1OXX K;  1EIH A;  4XT3 B;  4NMZ A;  3S16 B;  2F4I A;  1I4X A;  4B9W A;  4A3D B;  4JK1 C;  1WTQ A;  4KY6 A;  4ZUI A;  2F0S A;  5JEA J;  3SK5 A;  4EQN A;  5IGE A;  5DAU A;  2K01 A;  1R9T B;  3NXW A;  2KEC A;  3TP7 A;  3A55 A;  3VR3 A;  1X32 A;  2RVL A;  5CV6 A;  1TVX A;  2A69 D;  1I6H B;  5DEH A;  3HOV B;  4ZAI A;  4TSS A;  1STN A;  2EVB A;  5LL6 S;  3HKZ B;  5NUC A;  1PTO H;  3N52 A;  3K58 A;  1SJH D;  1IW7 C;  3CKI B;  5I6W A;  4IUP A;  2KVM A;  1B44 D;  1LO5 D;  1UUP A;  1AFP A;  2HDM A;  2R61 A;  2LMC B;  4ZRZ A;  5JJZ A;  1HA5 A;  1EYC A;  1HQR D;  4C3I G;  1G91 A;  3CU7 A;  1HUN A;  1WVL A;  2QIL A;  4PQX A;  4C1N K;  1DM0 B;  3K5M A;  2IX1 A;  4DXF A;  4TQU S;  2MHV A;  1CK1 A;  3GTJ B;  1SMY C;  1STG A;  2BA0 A;  1SSO A;  4ODG A;  2SOB A;  2NTT A;  1WTV A;  4FF3 A;  4F7X A;  3FKI B;  1S5E D;  3MFY A;  2L12 A;  4CGY B;  3BDO A;  4IUQ A;  5A2Q E;  3DWA A;  5FO7 B;  5KIX A;  2KCC A;  1MGS A;  5EKK A;  2H4O A;  3I91 A;  3K0Y A;  1V1P A;  4M8A A;  4A3F B;  1O78 A;  1B1Z A;  3R2T A;  1CZW A;  1WTW A;  1Y8O B;  3VYU A;  4BBS B;  1PRT F;  2MGS A;  3EJI A;  3NTI A;  3FDT A;  2XRS D;  4WFN 3;  1B2T A;  2F0V A;  4C56 C;  1PMR A;  2BDO A;  3NUC A;  3DWQ A;  1RD9 D;  2WIN B;  4ZQ3 A;  1JOR A;  3HRZ C;  1TQO A;  3S9W A;  2PO4 A;  4CJ2 C;  3SK8 A;  4PMW A;  4E6I A;  2O2L D;  3RD4 A;  3J80 L;  3BYT B;  2K05 A;  1HPC A;  3QB3 A;  1M8A A;  1SNP A;  3CRK C;  2A68 D;  4CBV A;  3GD7 A;  3N6R A;  4DK1 A;  4IUR A;  4BY1 B;  4DXG A;  2FMM A;  1MBY A;  4J6H A;  3CQZ B;  2PYK A;  3ERQ A;  4QIW B;  4NW2 A;  1BXT A;  4YIJ A;  1PZJ D;  3I3C A;  1GUT A;  2CQA A;  1EU3 A;  2VB2 X;  4R8N A;  2LY7 A;  1XXG A;  4Y7N B;  4XQJ A;  1EEF D;  1ZYR D;  1GHJ A;  2MUY A;  3VR4 A;  1A3U A;  5DM6 3;  4A93 B;  2L4N A;  4GZY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...