2B8GA

Solution structure of bacillus subtilis blap biotinylated-form (energy minimized mean structure)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin/Lipoyl Attachment Protein
publication title solution structure of Bacillus subtilis BLAP biotinylated-form (energy minimized mean structure)
rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b8gA00
1FYCA 3T53B 1EWHA 4TKOB 2EJFC 1CI3M 2V4DA 1Z6HA 2EDGA 1IW7D 3GD7A 3PUVA 5C0XH 3KLRA 4OGQC 4XIGS 1GHKA 4KKTA 4DNTB 3D4RA 2CW0C 5BN4A 1VF5C 2D2CC 2KCCA 2PCFB 3PV0A 1Q1EA 4H13C 4DK0A 3M85A 1GUTA 3PUZA 4KMUC 2KA7A 3VR6A 3T51B 2O5IC 1H9MA 4KKUA 4GZYC 1IYVA 2K33A 2A68C 1GUNA 1H9SB 2IT1A 1O7LA 2A69D 1DD2A 1E2VA 3IKJA 3MFYA 3CRLC 3OPOA 4KKSA 3VR3A 4IFDG 4I7ZC 1V43A 3W3AA 2DNEA 2BA1A 1O78A 1Y8PB 3PUXA 1OXTA 1T5EA 3AB9A 3M4YA 4G7ZC 1Z7TA 2PPBC 1DXMA 4KN4C 2NN6H 3QIAA 1VDZA 2A6HD 3MXUA 3SDZA 1OXXK 1GJXA 4LK1C 1E2WA 1H9KA 2E76C 2D62A 2K32A 3A8IE 2PNRC 3OOCA 3FMCA 2BA0A 1Q12A 4RCNA 2YYZA 1GUSA 1PMRA 3VA7A 4DK1A 1SMYC 3BDOA 3PUWA 3TZUA 5K36G 3RLFA 5JEAH 2BE5C 2A6EC 3QJYA 3H94A 2Q8IB 1GUGA 3QG1A 1H9JA 2F1MA 5A35A 1LABA 1YNJC 1DCZA 1I6VC 1B9NA 1ONLA 1Q1BA 4JK1C 4PV1C 3SE0A 3A7LA 3I4LA 1BDOA 1VCIA 2B8FA 2JXMB 1HCZA 3I72A 1E2ZA 2E75C 1CTMA 4TQUS 3WDNA 4OO1H 2A68D 2DNCA 3VR4A 1OXVA 1TKWB 2JE6I 3ND9A 4H44C 3GQBA 3LNNA 1OXUA 2QF7A 1IYUA 2AWOA 3LWUA 4G7HC 3L7ZC 3PUYA 1H9RA 5BN5A 2EVBA 1K8OA 4L8JA 1G291 1IW7C 3EQLC 4JBWA 4KI0A 2R6GA 1TU2B 3P20A 1CFMA 1FR3A 2EJGC 1B9MA 1Y8NB 3HGBA 1GHJA 3A7AB 3CRKC 4IQZA 3A8KE 3U9SA 4OO1G 2E74C 2NN6G 2AUJD 4BA2I 1VF7A 3FPPA 2L5TA 3N6RA 5C0XG 3BG3A 3M7NA 1HQMC 2A69C 3D31A 1Y69U 2B8GA 2JEBI 3IFTA 5KNBA 4IFDH 2O5JC 2BE5D 2A6ED 4H0LC 4LJZC 3NE5B 1YNNC 2AUKA 4XTCS 5KNCA 2D5DA 1A6XA 1OXSC 3OW7A 4KN7C 5JEAG 2EJMA 1LACA 2ZT9C 1H9SA 4BA1I 1HTPA 4G7OC 2LMCB 1GUOA 1V8QA 1Q90A 1ZKOA 3VR2A 3I73A 1QJOA 2BDOA 2NN6I 3DXJC 1Y8OB 3VR5A 1ZYRC 2A6HC 5BN3A 5KNDA 1HPCA 1K8MA 4KHZA 4HR7B 3T56B 4DNRB 3ND8A 2DN8A 3A8JE 5K36H 2K7VA 2JEAI
chains in the Genus database with same CATH superfamily
2KBNA 2MGSA 1NE3A 2YTYA 2ZJRA 2KOLA 2UXCL 1Q86C 5CYUA 2UXBQ 5COYA 2JA9A 2KCCA 1I4QA 1QB5D 4DR6Q 4FXDA 1EIYB 3HOZB 2NTTA 2FHTA 5IOCA 4A3LH 2M2LA 3HKZB 5IGFA 4HIDA 2E2JH 3SXHA 1TIID 2UUAL 3IKJA 2VQFL 1P8LA 3CRLC 4YWMA 3T4AC 2C35B 4QQBX 3E9HA 1V43A 3W3AA 4HIMA 1IBKQ 4V190 2ATWA 4GLVB 4DV1Q 3K0XA 2B63B 1E24A 1VQDA 4JG2A 2BH8A 5I4DA 3LGJA 1Z9FA 1JJCB 1RD9D 4FF3A 3RZOH 3MZ5A 2HIVA 5CV5A 3TS0A 1SE2A 3FHWA 3E6ZX 4DV4L 4DR3L 1Y1WG 2XTIA 2DY8A 5G3LD 3U58A 1H9JA 3KF8B 4JOIC 2R93H 2VUMB 1ENFA 3SE0A 4A3JB 4DAPA 1VQ5A 1IBML 3CC7A 1DGSA 1LT3D 2Z0SA 2JA7H 5AJ3L 5GROA 4EGVA 3QOLA 1F9QA 4LFCL 3TSSA 4DUYL 4RWSC 2EVBA 2JN4A 1SYDA 1STNA 2IL8A 1VQ4A 2GN5A 4P72A 4JW0A 1NR4A 4EQOA 2EJGC 1FGUA 1XXGA 1Y8NB 5M5WH 1BF4A 3H91A 2LKVA 4IZ8A 2E74C 3S15H 4LUVA 4JV5Q 2SOBA 5E4WC 4OWWB 3PO3B 3WWVA 3DEOA 1WD1A 4BY7H 2JJQA 4LJZC 2EOTA 5FK9C 4O0AA 1A15A 3S1RH 3NQIA 1LUZA 3F1ZA 1XMOL 4ME5A 3BU2A 1A2UA 3I73A 2ZM6L 3DXJC 3S2HH 2F0TA 3S16H 4AQYQ 2Z4HA 3FDTA 3T56B 5C3EG 1LYLA 2V4DA 2WV6D 3PUVA 4XIGS 4B9WA 1N32Q 3K57A 1KD1C 2NVXH 1JWUD 2Z1CA 3GTJB 4C2MH 1V1QA 4I7AA 1ASZA 1II3A 4DR4Q 4N9TA 1IYJB 1I3QB 1EYGA 2KECA 1SLJA 4OO1I 3NWTA 4XXEA 3E9IA 2D9UA 1QVGA 1PYBA 1I94L 4F87A 3K59A 1A3VA 1LTSD 4PQXA 3M4OB 1YJWA 1TS4A 3CC2A 3U50C 4NW2A 1S3OA 2B29A 4KN4C 3LX0A 3D8GA 3I4OA 1OXXK 2UXCQ 1CUKA 4JI0L 2KVMA 1UEBA 3X3MA 1E7ZA 3TREA 1U4PA 1N36L 3G6JB 2UUAQ 3TN2A 1SEBD 3HFZB 2OEOA 2VQFQ 1BBWA 1QUQA 3URYA 1L0YB 1QOHA 1BDOA 4F7XA 1STYA 5C4JH 1BQQT 1BCPB 4GN5A 1OXUA 1RF2D 3R2TA 1G2SA 2JA6H 1O7IA 3S1QB 3OIPA 5J39A 1IZ6A 4KK7A 4AYBB 2IHFA 4DV6L 4ZKCB 5M3FB 4R8NA 3HGBA 1EY0A 3TBIB 3L0OA 3A7AB 1QVFA 2E2IB 5F2DA 2CHBD 1K83B 4FP5D 2WB1G 2PZTA 3OIQA 1HZ9A 1JOKA 4DUYQ 1LACA 2CCZA 1HTPA 4DAYB 5IGGA 1ESRA 4S3SA 2BDOA 1DONA 3S14B 2K1BA 2UUCL 2P5ZX 3HOYB 5FOBB 2OTLA 2YU9H 3P75A 4DNRB 4GOPB 4YCWA 5T1GA 5FJ8G 2WFWA 4TSSA 1I4GA 3WOFA 1TWHH 2Z6KA 1KDBA 3U4VA 1AEXA 4IJHA 1G6ZA 1C0AA 5IIFA 1I5FA 3R2IA 4LAAA 1QE6A 1EYDA 1VQKA 1S5BD 4GN3B 3KJPA 4C3HB 3VR6A 4X66L 4A3GG 4FXKC 4CGYB 1IL2A 4KKUA 4DN4M 1VQJA 3NTIA 2ZM6Q 4WJ4A 1F9SA 4P2CB 4DR7Q 3K0YA 4IFDG 5CV4A 3G6EA 2R92H 2PI2A 3HOWH 2HQEA 2DJGC 3S1NH 1KAWA 1A63A 2A6HD 1WOCA 1CK1A 4LNQA 3A8IE 3GTKB 3DWPA 4KLKA 4C1NK 2F0HA 2RKSA 3MA2B 5G3LF 3W2DA 1K28A 3QJYA 1S5DD 4LF5Q 2RBMA 4K6LA 2Q2UA 4IFDJ 5GAHC 1KTKA 2CH4W 1I94Q 4BY1G 3CP0A 3I4MH 1EYAA 3ONAB 1E2ZA 5C44B 4C3JB 1WVLA 1SXTA 4TVAB 1CA6A 3BZCA 4DR5Q 1OXVA 1B70B 4EQNA 4POGA 4PNYA 2QDBA 3J80E 3HOVH 3L7ZC 4FO2A 1Q3LA 1F9RA 1JB7A 1D5MC 1WCMH 4OEMB 1H9RA 2RA4A 2UUBL 1HNXL 4IO9A 2XWBB 4IUQA 3V2TA 4CJ1B 1N36Q 3I55A 4QF4A 3J7ZC 3HRZC 1UE7A 4FVMA 4FDBA 4UAIA 3CAMA 1PV4A 2IX1A 4B3RL 3GTGH 4HCSA 1NUCA 2LY7A 3DWQA 2F0FA 3H3VC 1G51A 1NSNS 3IFTA 4H0LC 2AUKA 5IYDH 1HRJA 1L1OA 3HOZH 2DUDA 4KN7C 3IL8A 3SEBA 4OWXB 3EBEA 4F88A 3Q23A 1MIUA 5M3MB 3TDQA 1JICA 5C4XG 3HEJA 3C2PA 2WINB 2A6HC 2N8NA 1VQGA 4CKBA 3PIOA 5CV6A 3I90A 3BJUA 4IN3A 2CWAA 1ET9A 4MTNA 1VQBA 4JYAQ 3GTMB 2B63H 3PSIA 3GD7A 3PCOB 4JI1Q 2I07B 4XYOA 4QJFA 3TZDA 1G2TA 2NZ1D 3D4WA 2VY3A 2I0QA 4C3IH 5BN4A 3VYRA 2F4VL 4ZAIA 3M3YB 1SYGA 2MQHA 1GUTA 2KHIA 1PH4A 1VMPA 4L5QA 2A69D 2XRQD 4IUTA 2EYLA 2UUCQ 2F4IA 4J1MA 2VB2X 2VUMH 4A3JH 2O4XA 5IYCH 3JAMi 2F0OA 2YTVA 3S15B 1NAPA 1PXUA 1TWFB 4DFAA 3D0FA 1KQSA 1VDZA 3MXUA 1GJXA 1SROA 1CZWA 2QILA 5ELCA 4ZLTF 4G4KA 2F0GA 1GD7A 3G48A 4LF9L 1A0IA 1CSPA 1RODA 2NVYB 5HURA 2SDFA 3T13A 5JEAH 1D7QA 1HHVA 5T1IA 1RCVD 3UE1A 1L0XB 2PZWA 1XJVA 2JA8B 4QUFA 3A7LA 4JI8Q 4DAMA 5EBCA 5I9OA 3K5MA 2F0KA 4IUVA 1EY5A 4GKJL 2K05A 1CKMA 1SYBA 3HZXA 1RDPD 1X32A 3GQBA 2IX0A 3A56A 4A3BB 3I7FA 3VDYA 3CKIB 1U4RA 4MZ9A 3NPPA 2NYZD 1VS0A 1KHIA 4JBWA 4KHPL 2HDLA 1SDFA 1PH1A 1UEAB 3PO3G 3AMUA 2G5DA 4KV6A 1GHJA 5IGDA 4X64L 3EN2A 3HOUG 4JOIA 1UWVA 3J80L 5IYBG 1PLFA 1Y14B 3KDFB 2QDLA 1Q46A 4JVZA 1YJNA 2A69C 3DHQA 4R4TA 3Q22A 1Y69U 2O5JC 1SYFA 3GTJH 5JEAJ 2Y0SG 4XTCS 1VQMA 5ELDA 5IP9G 2PNHA 4YHHL 1I3QH 4BA1I 2TMPA 1FJGL 3M9BA 2WACA 1B7YB 1HNXQ 2Q8RE 2IPKD 4YWKA 4WJ3M 1TS5A 4OIKA 4NXNL 4YWLA 3M4OH 3HKZE 3A8JE 1EWHA 4NDXA 2Z6KC 3FKIH 2EDGA 5EAYA 3RR5A 4OGQC 1HR0L 2K03A 1EQRA 2MP1A 4MTKA 3M85A 1TWCB 3EVQA 2IJ0A 5KYLA 3D6WA 3KUPA 1FVIA 3X3NA 3AFPA 5IE8A 1YHQA 1KAAA 2RVLA 1WD0A 3W5OA 1A3UA 1JQYD 4PZ7A 2F0IA 1Y8PB 1EUJA 4Q5VA 5LMNL 3CC4A 1F2YA 1MSHA 4LK1C 3PIO3 3A5UA 3K6OA 2MO1A 2F4VQ 2F0SA 4QL5A 4A3IG 3S1QH 4QCLA 1PMRA 2C9OA 2ID0A 4K6DA 4CKEA 1ENAA 3OMCA 1J6QA 5BR8L 4J15A 2G9DA 5ELFA 3CCUA 1LABA 2VQEL 3PF5A 4N9PA 1K83H 2YU9B 1B2TA 2PMZB 2E75C 4FNFA 4OO1H 1K8GA 2R7DA 2Z6BA 5M3FG 3UDIA 5BN5A 4L8JA 2ZTDA 3S14H 5EJWA 2NVTB 3HOYH 1WTRA 3RZDH 2J0TD 3CRKC 3I4NB 4R4QA 1HXYD 4V0BA 3BS1A 1VQ8A 2Y0SE 4RGNA 2LS01 4KTAA 4NXML 2JEBI 5KNBA 3NEMA 1L1OC 1M90C 3PO2H 2R7ZH 1PH9A 2E2HB 4LUZA 4C3HH 4PMWA 1H9SA 3EROA 4L63B 5EKKA 1KLUD 2XNAC 2FINB 2KUMA 1EL0A 2HIXA 3ULJA 1ML0D 5C4ZA 1Y8OB 1SNPA 3GP7A 2L11A 3HOXB 1SBBB 4POFA 2EXZA 3J81E 2DN8A 1U9RA 4A3CH 4L5SA 3OYYA 3MAQA 1SJED 1YEZA 4YCVA 1TT2A 3EFXD 2I5MX 4RGTA 4DPGA 1KABA 3D4RA 3GTKH 3MXPA 4ZQ3A 1UE1A 2H1EA 1MD2D 4ZUJA 2N49A 1D5XC 2F3IA 1XNRL 2ALYB 4LF7Q 3O13A 4A3KG 1X3EA 2OQKA 1CKNB 3PQIA 4A3MB 1KLGD 3F2DA 2KQ3A 3QO2A 1YNND 2LXKA 1EIFA 1HJPA 5FLMH 4ID6A 1K8AC 1LM0A 1LTRD 2DNEA 5C44H 2CWPA 4C3JH 3GTGB 4G7ZC 1YBYA 1PTOB 2M9VA 3CXCA 4A3DH 2F0QA 1E2WA 3J7YW 1JMCA 2ZJPA 4LFBL 2BA0A 1X55A 5CV8A 4PMBA 1HNZL 3DM1A 1JOOA 5K36G 5FKAC 5C6AA 3OHXC 2MPMA 3I8ZA 1EWCA 2E5LL 2I5LX 3SGIA 4FYDA 1I6VC 3BYTB 4ZCKA 4AYBE 1EOTA 1C9OA 1CTMA 1LLRD 3T1HL 1SNQA 5LMNQ 3ND9A 4A3LG 4K5VA 3TP6A 3LWUA 1AW7A 5M3MH 4PG3A 4C3IB 3RN5A 3NBHB 4YCUA 4X62Q 5JVH3 5JJKA 3A0JA 1VQ7A 1ESFA 1SE3A 4DU9A 1QILA 3P20A 1PVOA 4H7BA 1SMXA 4APVA 1HNWL 4BBRH 4RA8A 5E3FA 3GTMH 1H95A 1MKHA 3V05A 1E0BA 4CDEC 1ICWA 4LF8L 2B8GA 3J7AV 1YNNC 3M3YH 1JJGA 1V1PB 3MEHA 3QR8A 1YVCA 3H15A 1B8AA 4DV2L 2R93G 2K5DA 3CCMA 1IXRA 2L0CA 4IPGA 1R4QB 4ZYSA 4OX9L 4UPAA 1T9HA 3VA5A 2F3WA 2NZOA 2JA7G 5CV9A 3TMEA 5E1FA 1TS2A 4TKOB 4O42A 3H0GB 1TWFH 1XMQL 3QB3A 1CM9A 1VQ6A 5CV7A 2L4NA 1Q7YC 4NXMQ 1Q8KA 3STBD 3D3RA 1HQRD 1PZJD 4A93B 1ET6A 1EIGA 3K81C 4H13C 2NVYH 1JJ2A 1V9PA 3J81L 1U0LA 2QW7A 4EQPA 1X3FA 2RF4A 2JA8H 4P75A 1PRTB 1YHAA 2SEBD 1KIXA 3VR3A 4BY7G 3OTOL 2GVAA 4I7ZC 1JE5A 3P1HA 1J9OA 4KY7A 2BA1A 2UXDQ 3PUXA 1YI2A 1KL9A 3W1GA 4A3BH 1BCPF 3KF6B 4LWCA 2TSSA 1SFOB 1MJEA 2PYKA 4K2KA 1GUSA 3VA7A 3UDXA 5IY0A 5KRUA 3IFDA 4IJLA 4EVOA 3PUWA 3UI2A 3ICEA 2X69A 2Q8IB 1GUGA 4IUPA 5EPKA 1KRTA 4JPBW 1K3BC 2CW0D 4JK1C 1HH2P 4BBSB 2E8GA 4XQJA 1LTID 3AU7A 2QEJC 3W1BA 3FKIB 1WJJA 1L2FA 2WKCA 3GDEA 4A3EG 1VQHA 3NXWA 1D1KA 4DAVA 4DR2L 4LFBQ 1CKNA 1VMCA 2K14A 1HNZQ 2MJ8A 1EQQA 2K4KA 4YY3L 3STBC 2EZVA 2DGYA 1C8CA 3M4PA 2K5HA 4R1JA 4BA2I 3MXNB 2JA5B 3N6RA 4IURA 4K5WA 2KHJA 5FLXc 1HA5A 1HFNA 3A5ZB 4JI6L 3T1HQ 4JI2L 3K7UC 1TWCH 4JI5L 2ASBA 5JOBA 4DV5L 4AH6A 3GTLB 2AQ1B 2NN6I 1ILPA 2F0LA 3ITPA 1CQFA 4DV4Q 1Y1VB 2GA4B 4DR3Q 3R3OA 2J4XA 2Z8LA 1HNWQ 4A76A 3C1FA 3T53B 3T1YL 2XIWA 5IP7G 2K5VA 2JA6G 1DZ1A 3ER0A 3CCJA 1TWAH 2Q2IA 5C0XH 4X3UA 1IBMQ 2GVBA 3JAME 3JAMc 3NBHA 5AJ3Q 2CW0C 4EQ5A 1VF5C 5ISRA 4FXGC 3PV0A 4LFCQ 1EY8A 4OIJA 1TY2A 1SE8A 3K58A 1MBYA 2KA7A 2O5IC 3KF8A 4IOCA 1KXLA 4UDUC 1IYVA 3OWEB 5JPNC 1G6PA 2RDHA 4ABNA 4KKSA 4XT1B 3K5OA 3RZDB 4ULLA 4RKBA 3OSOA 2IWHA 3Q0AA 1OO9B 4K0KL 1WTPA 2K50A 1Z7TA 3CCEA 1C48A 3BZDB 2B2YA 1JE4A 3FMCA 3PO2B 3K7AB 3ZYYX 2R7ZB 4RG1A 2HCIA 1JB3A 1ICFB 3FPUB 2UU9L 2NVTH 1XMOQ 3BDOA 4L6TB 5C0XJ 2LFNA 2N88A 3I4NH 2KEDA 1ONLA 2K04A 5I2XA 1D5ZC 1ILQA 3OTOQ 2VB3X 3ULPA 1YHBA 1EU4A 3CCSA 2RSNA 1PFNA 2OT2A 2E2HH 1B3QA 1KDCA 3EA6A 1XTCD 2LXJA 2RCFA 3NENA 3G4SA 4HMJA 4XYQA 3HOXH 2KENA 2R92G 3KFUA 2BOSA 3HOWG 1HZBA 4I65A 5H1SE 2B2WA 3NK9A 5C5LA 3RLNA 1F2ZA 5CGKA 4DV0L 5IGBA 4J6HA 2WAQB 2EY6A 5GADC 2F0DA 3OW7A 2MHVA 4A3DB 4DR2Q 4JI0Q 1GUOA 4KD4A 4DXGA 4RKLA 1AE2A 1QJOA 2A74C 4A3MH 3I4MG 4YY3Q 4XQQA 1HPCA 1EEID 1FYCA 2XGTA 4J8QA 3HOVG 3KK7A 1PTOH 3KLRA 1RTNA 1WCMG 5LL6S 2EY5A 3K80C 1PZKD 1JWMD 4GLAC 3D4DA 2D2CC 1B1ZA 2PCFB 1BKBA 1QG7A 5LMUL 1PTOD 2RHQB 1BBUA 1F9PA 1YNXA 1DOLA 4DK6C 5EBDA 2J7ZA 4RFBA 4EX5A 2K33A 1GUNA 1MHWC 2YV5A 3LWEA 4GNXB 3L2PA 2MFIA 1HFGA 4DV6Q 3JAML 1SYEA 3K5LA 4JCVE 3NQTA 1D8LA 1RTOA 4K8JA 1MJCA 4BBRB 5IYDG 3T1YQ 1Y1WB 3HOZG 1B3AA 1T5EA 4C1NI 1OTCA 1N34L 3HKZG 5HY6A 1MSGA 2PMZE 2EYOA 3D6CA 2ZXOA 3AYHB 2EE1A 2Z9HA 1HZAA 4Y7NH 1E1TA 2B63G 5C3WA 5DLQE 1ZXTA 2ZXRA 3TRZA 1HZCA 2FMCA 4NPSA 1FNWA 4QGUA 1XNQL 3E5SA 1HCZA 1EFWA 1X65A 3EIVA 3R93A 4DAYA 2K5NA 3MFGA 4G7HC 4A3FH 1Q8IA 4HIOA 2VUMG 4A3JG 1KNEA 2B2UA 4QB4A 3C3LA 1X54A 3HKSA 5IYCG 5FO9B 4IUNA 4X66Q 1D2BA 3C1EA 1CFMA 4GOPA 1K0RA 1YZ6A 2FFKB 2I5HA 3SK6A 3N52A 4K8IA 1LT5D 3NELA 3H0GH 3S17B 3F2UA 2OQ0A 1EWIA 1SMYD 1Z47A 5EPLA 4KHVA 2A6ED 3U9OA 5C3EB 3NE5B 3BVMA 3A74A 4A93H 2D5DA 1OXSC 5JEAG 1HUMA 1I4PA 1X3PA 4DF7A 1GOZA 1AZQA 4XDXA 2PW5A 2Q8TA 1QZHA 3UE0A 2K7VA 1PRTD 4JBMA 5I6WA 5CC4A 1SYCA 1STBA 2F52A 1SFOH 1RHPA 4R4OA 1SNMA 2EY2A 1FNVA 3NTHA 4OONA 5EGTA 4RH6A 2IHEA 4HIKA 5IT9c 4UHVA 2UUBQ 4X3TA 4WFN3 1DD2A 2N3SA 2OCEA 1WFQA 1TWGB 1C4QA 2JSOA 4B3ML 4BBSH 4U68A 1F2LA 1WTHA 4B3RQ 3ERQA 3L3OC 3QOJA 3C46A 3A54A 3HG9A 1DXMA 5CMDA 3M4QA 4QUCA 3B6YA 2B2YC 4B3TL 1J5EL 5LMUQ 4DNIA 1B53A 1KC8C 1PDQA 1SMYC 4IFDI 2NWGA 3RLFA 3H3VI 2A6EC 3QG1A 2VNUD 3TS2A 5IWAL 1DCZA 4PV1C 1S72A 2JA5H 4HJ7A 1IBLL 4L5TA 4R9WA 2L9HA 2DY7A 2K28A 3WDNA 1TWAB 1N34Q 2HHHL 3RLOA 1BCPD 1PRTC 4ILWA 3I56A 2WB1B 3GTQH 3BZKA 3GTLH 2D0OA 5JVG3 1TU2B 4DV3L 3NWSA 1MGSA 4LFAL 1Y1VH 2JQOA 1FL0A 1B9MA 4RMFA 3NP8A 2OF1A 2NUCA 2K52A 3FVQA 2B2WC 1IBKL 4PMCA 4LW1A 1VF7A 2XSCA 2EYHA 3CHBD 5KIXA 1XNQQ 1U4LA 1X9NA 4A75A 4MHEA 3A55A 1K73C 4AYBG 1SE4A 2QCPX 2HUGA 4HAEA 5KYIA 4OXPA 3FRPB 4LF9Q 3G7LA 5FO7B 4UP9A 1I50B 1JR0D 5D3DA 1JORA 4KHZA 1K8MA 4M8AA 4RHRA 2F0JA 4HR7B 4P71A 3DWAA 3ND8A 4OO1G 4A3GB 3CMAA 2JEAI 1EFID 4H02A 2EYJA 4HCEA 1CI3M 1S5ED 1ENCA 4ME3A 2PQEA 3MHBA 5EKLA 5J22A 4DNTB 4GKJQ 1BXTA 1PTOF 1GXDC 4BXXH 3K7AH 3HOYG 1Q1EA 4X3KA 3PUZA 2RDGA 1H9MA 1SJHD 3V96A 2NVQB 3I3CA 3H6MA 2HDMA 4KHPQ 4JBJA 1W3SA 1QNKA 4JV5L 1BCPC 5C3XA 4TRDA 4X64Q 4BWGB 2EIFA 4G57A 1LTAD 1QWYA 2F0UA 5CBEE 1W2BA 3SK8A 2R7ZG 2A73B 5JJLA 3NUCA 4C3HG 4CDFC 3DMUA 2PQAB 2NN6H 1ZYRD 2ENBA 4IPDA 4BY1B 4F8MA 1VQ9A 2K32A 4CDCC 4IPHA 4RCNA 5KGUA 1E22A 1PYWD 4YHHQ 1FJGQ 4ZRZA 4A3CG 1W6KA 5EPJA 3L9AX 4HSVA 5JJIA 5A35A 3KDFA 1GO3E 1SNDA 1XYIA 4NXNQ 3MWYW 4DGZA 4DXFA 4B3MQ 5K5PA 1GM5A 3IRBA 2VS1A 2B8FA 1XX8A 3AFQA 3CF5A 3NTKA 2B2VA 3LNNA 5E4XA 1HR0Q 3NSWA 3PUYA 1YITA 4B3TQ 1NY4A 5KEEA 2B2UC 2HQLA 4GOPC 1TVXA 2Q2HA 5FLMG 4M1UB 5C44G 4C3JG 1G8ZD 2RHSB 4R4IA 5IWAQ 3A8KE 2R7FA 5C4XB 4A3DG 1SSOA 1EYCA 3R8BA 1IBLQ 1EY7A 5IGCA 5M5XB 1QUQB 4LUOA 4G7OC 3KBGA 3I70A 3K5NA 2F03A 4QIWB 1JCKB 1EY9A 2H5XA 2HHHQ 1FNUA 3SK4A 2EJMA 4K2LA 1XPUA 2LMCB 3GTPB 4Y52H 4DV3Q 3RMHA 1I4XA 1ZYRC 2F0EA 1DOKA 4LFAQ 3RN2A 3PGZA 5KNDA 3JC66 2EXDA 4Y7NB 5BR8Q 1PRTF 2BDNA 3BVZA 1Y1WH 4AIMA 2VQEQ 1Z6HA 1EY4A 1V1OA 2AKWB 5M3MG 4KY5A 4JI7L 4DV7L 1NR2A 1RKNA 4CHTB 3I91A 4PZ6A 1SNCA 3G71A 4A3FB 1KDAA 4KMUC 1S4ZA 1NBWA 4YIJA 4GLXA 4MNOA 3KJOA 1O7ZA 3TQYA 4BBRG 5M5YB 4HJAA 3NHHA 2N78A 3CW2C 4U673 2NTSA 4RCOA 2FXQA 4OHJA 4PZ8A 1PFBA 5ELNA 2X6GA 1SAPA 3M4YA 5J1ZA 1H9KA 2D62A 2F0MA 3OOCA 3GV3A 4HJ8A 2KCMA 3BDLA 3BYYB 1MI2A 2OTJA 3RUZA 3UDGA 1HR0W 4Z9CB 2A19A 2ZXPA 4ALPA 3BDCA 5TSSA 4FF2A 1Q1BA 3S17H 2HD3A 5DNFA 1AE3A 1VQAA 1VCIA 2L15A 3I2ZA 5IGEA 3J81j 3CQZB 4TQUS 5C3EH 3HOUB 5DM63 2BCOA 1CHPD 2XRSD 4CJ0B 2ZTCA 2CQAA 2K5WA 3E0JA 2JA8G 4GNXC 2CVRA 1WTWA 2WAQE 1WTQA 3VYUA 5LMNW 1XNRQ 1Q82C 2Y0SB 1SR3A 2XN9C 2A1AA 4DR7L 3J7A5 2K75A 2PQAA 2AUJD 4UP8A 3FPPA 4A3BG 3M7NA 1YIJA 3D31A 1PH2A 4P74A 2Z4IA 4DR1L 1YNJD 1A2TA 3EJIA 2L12A 4CJ2C 2XWJB 3J81i 5I6YA 1J8IA 4ZKBB 1ZKOA 4A3EH 1FGBD 2EPBA 1TY0A 4ODGA 4LF5L 5ELEA 1TWGH 1NNXA 1KNAA 1VQEA 3PIPA 2E5LQ 1EQVA 2HT1A 1NMFA 3HP3A 1AP0A 1LTLA 2F0WA 2SNSA 4DR5L 5FLXE 2WP8J 1QNUA 3S2DB 4DK0A 4LF4L 3GV6A 1L1OB 3T51B 1EIHA 1K0SA 1WYDA 4HSPA 3GTQB 4R8IA 2EQSA 1A3TA 5HGQA 4A3IB 3GTOB 1LT6D 5ELOA 1PFSA 3QWNA 1B44D 3OPOA 2RCNA 1XPRA 1N33L 1A8VA 1SNOA 1JOQA 3DLLA 2PPBC 4JI7Q 4JC0A 4LF8Q 5IP7H 4DV7Q 3HS0C 1PFMA 4O2DA 1IKLA 5HGTA 2QEXA 2PNRC 4NKLA 1AN8A 5E7NA 1JWSD 5NUCA 2IY5B 3U4ZA 2IW3A 5I2YA 3KBXA 4DV2Q 5CBAE 1VQIA 2ES2A 1DOMA 4N8X1 3ULLA 1YNJC 5C0XG 2YTXA 1B9NA 2KJXA 4OX9Q 4JYAL 3CPFA 4JI1L 1STHA 1CA5A 4MIUA 1V1PA 1R9TB 1XMQQ 2A68D 2DNCA 5I9PA 2B2VC 5FJ8H 5LHY1 3E3XA 5GAGC 2RQXA 2NZHA 3KLSA 4K5XA 2PZUA 4GS3A 2BH2A 4K14A 3T16A 1ZEQX 4KI0A 2R6GA 4B3SL 4X6AH 1I50H 1I6HB 1X3GA 3F2BA 3WOEA 4A3GH 1BUVT 2AWNA 4KJNA 4UP7A 3U9SA 1JT8A 3BG3A 2F0NA 1HQMC 2QA4A 4IFDH 3H3VH 1CQVA 4NMZA 5KNCA 2CH4A 1A6XA 2B2TA 3KLWA 1BVSA 1LTBD 1LTGD 1V8QA 1UE6A 2NVQH 3I4NG 5M9OA 4CKCA 4HEDA 1UE5A 1EY6A 2VZAA 1VQOA 4JI8L 1ASYA 3CCLA 3DUZA 4A3KB 1EQTA 3P7JA 2EJFC 4JI3L 4OL7A 3KF6A 1XWEA 2PO4A 4BY1H 1VQCA 2IX3A 2CKZB 4DR1Q 3PF4A 1AFPA 4QY7A 1E1OA 3HOXG 1R4PB 2WIIB 1DM0B 4WRDA 3H09A 1F77A 2AHOB 4Q0FA 3UDFA 2A68C 4UY8C 3F2CA 2G9HD 4RGMA 1E3PA 5FLXL 1C7YA 5CR3A 1BNZA 3E0EA 2EYFA 2F0VA 3S1MB 3CD6A 4C56C 1VQPA 3AB9A 1TS3A 3Q6SA 3FEWX 2FMMA 2MUYA 2QGQA 3TP7A 2VXWA 5DM73 1VQLA 1D1IA 3QIAA 3SR1A 2AQ3B 3MXGA 5LL6X 3J80c 2R3ZA 3S9WA 4JI6Q 4JI2Q 4A3MG 4HMIA 3PIP3 1NMGA 4JI5Q 5CORA 4LF4Q 4HJ5A 1VQFA 4DV5Q 3NBIA 2O2LD 4R4CA 2EYPA 2E2JB 2JK8A 2WB1E 3MXNA 1IHZA 2F1MA 5GQOA 3CCQA 4RAUC 4IPCA 3CPWA 5C4XH 1Q81C 1BBXC 1UUPA 3I4LA 4LMQD 4BS9A 5M5XH 1O80A 2JXMB 1N33Q 3I72A 3VR4A 1TKWB 1L0WA 1B50A 1STAA 2QF7A 2AWOA 3K8AA 3MVVA 3GTPH 3RZOB 1K8OA 4FF1A 4XQNA 2A8VA 2VL6A 3DM3A 1DJRD 3VYSA 2R93B 2F0PA 4X65L 2EYMA 3FP9A 4WORA 1PH6A 2DJFC 4C3IG 1BOSA 2JA7B 4K0KQ 1RL2A 4O1NA 3OWFA 2R61A 1STEA 2RSOA 3SVMA 4WJWA 1QCBD 4DUZL 5A2QE 5M5YH 3RNUA 4JBKA 1K3RA 1KRSA 2XVSA 4B3SQ 2UU9Q 2RDFA 4JI4L 1RJTA 5M5WB 5D3IB 1PTOC 2I46A 1GVPA 5D65A 4E6IA 1AH9A 1F2MA 2LSSA 1IW7D 2PW7A 5JPMC 4A3FG 2OXPA 3SK5A 1QVCA 4X3SA 1GHKA 5JJZA 4BY7B 4DA2A 4DKAC 1CSQA 4FF4A 3S1RB 1LV9A 1M4VA 2ICIA 1PH8A 3VYTA 1H9SB 2IT1A 3H0GG 3S2HB 2F3VA 3S16B 2A5HA 5J3BA 4LF6L 2C5CA 3BVGA 3PO3H 4CBVA 2AMCB 4A93G 1PZID 1O78A 1LT4D 5JAVA 3CQZH 1OXTA 1AZPA 2Q2TA 4JI3Q 1IL8A 3HOUH 1T5XD 4DV0Q 3SDZA 5IYBH 1XTDA 2NVXB 2E76C 1U5KA 1SRUA 4C2MB 1Q12A 1N8RC 5C0XI 1LTTD 4DK1A 5IT9E 5IP9H 1PYSB 2NBFA 1GKHA 4A3EB 1PHJA 2KEEA 1WTXA 4CDDC 2MO0A 1CHQD 1O7YA 1IKMA 2CFMA 2KCNA 4IOAA 2ZTEA 5C5MA 2NB0A 5D14A 2JE6I 4MN3A 1EZ8A 1IYUA 4GKKL 2HCCA 3J7AF 1XPOA 3Q8DA 4A4IA 4LF7L 4QMGA 1G291 1IW7C 2H4OA 3EQLC 1STGA 3CCVA 3F8TA 4QIWE 3OW2A 4BBSG 4ZK9B 1FR3A 3KOJA 2FJ2A 3FKIG 3MTSA 2VW9A 1I4RA 1X6OA 3TEHB 3KLSX 2MNAA 1WTVA 4NB3A 4L5RC 3J80i 3MC0B 3TP5A 1CT1D 2JP1A 5FO8B 5C4JB 2K01A 1D6EC 2QKIC 3CU7A 2BE5D 2UXBL 3CMEA 2B2TC 4OWTB 4DR6L 3S2DH 4N8FA 2N55A 4IUUA 2K5QA 2JA6B 2L55A 1DYQA 3VR2A 1Q90A 2K6AA 4GNXA 4HN7A 2KCTA 2JA5G 4A3IH 4HTHA 3GTOH 5BN3A 1QZGA 1M1KC 4KD3A 5C4HA 4DV1L 1U4MA 4X65Q 1UAPA 5ELBA 2V1CC 4KKTA 1SN8A 5A2QL 1K9MC 3KYHC 1TXYA 1P16A 4X62L 1WTOA 1G91A 1Y1VG 1N9WA 1TR5A 3IAYA 5EKIA 1EOVA 4DUZQ 5M3FH 4GZYC 1GUWA 1O7LA 1E2VA 1M8AA 1TQOA 3ZJYC 3OMGA 1HA6A 1EU3A 4JI4Q 2E2IH 3AQQA 3MFYA 3MEFA 4RHSA 5IODA 2JYOA 1I4HA 4B08A 3M7GA 4HJ9A 1R9TH 1TWHB 4RGOS 3SHLA 1HTLD 1YJ9A 1PH3A 5DEHA 1BO0A 3GO5A 2AQ2B 3ERSX 1NTGA 1A62A 2YYZA 2PI2E 1W6JA 1I6HH 1S5FD 3TZUA 1NJIC 2BE5C 5GAEC 3DEPA 3H94A 1NCVA 3PMFA 3S24A 2E2DC 2M00A 4LF6Q 4BXXG 5L37A 3AEVA 3PO2G 2R92B 3HOWB 3S1NB 1EEFD 4H44C 5IT9L 4OELB 5DAUA 4KJOA 4KY6A 2CQOA 3CCRA 1PA6A 2B39A 1VQNA 4XT3B 1BR9A 1RIPA 1UNSA 4AQYL 2KHSA 3TP8A 2D0PA 2ZJQA 4GN4B 1LO5D 2ICEC 4ZUIA 2SNMA 3J81c 1CZGA 4IQZA 4A3KH 1WI5A 1PH7A 2EY1A 2NN6G 1X3QA 2UXDL 2L5TA 3I4MB 4IALA 5AFWA 1N32L 3RD4A 3Q24A 1HUNA 1FD7D 2WKDA 2B3GA 4DK3C 4DR4L 1S5CD 3HOVB 4GKKQ 1B4OA 4P73A 5EQ0A 2OWOA 2ZT9C 1S40A 1J5EQ 1WCMB 1PH5A 3VR5A 2X6LA 1EZ6A 4NP5A 2L1BA 1CKOA 2WAQG 1X56A 4B9XA 5K36H 1JC7A 3S1MH
chains in the Genus database with same CATH topology
2MGSA 2KOLA 5CYUA 5COYA 2KCCA 1I4QA 1QB5D 4FXDA 3HOZB 2NTTA 2FHTA 5IOCA 2M2LA 3HKZB 5IGFA 3SXHA 1TIID 3IKJA 3CRLC 3T4AC 1V43A 3W3AA 4V190 2B63B 5I4DA 1RD9D 4FF3A 3MZ5A 5CV5A 1SE2A 3E6ZX 2DY8A 5G3LD 1H9JA 2VUMB 1ENFA 3SE0A 4A3JB 4DAPA 1LT3D 4EGVA 3QOLA 1F9QA 3TSSA 4RWSC 2EVBA 1SYDA 1STNA 2IL8A 4EQOA 1NR4A 2EJGC 1XXGA 1Y8NB 1BF4A 3H91A 2LKVA 4IZ8A 2E74C 2SOBA 5E4WC 3PO3B 3DEOA 1WD1A 4LJZC 2EOTA 5FK9C 1A15A 3NQIA 4ME5A 3I73A 1A2UA 3DXJC 2F0TA 2Z4HA 3FDTA 3T56B 2V4DA 2WV6D 3PUVA 4XIGS 4B9WA 3K57A 1JWUD 2Z1CA 3GTJB 1II3A 4N9TA 1I3QB 2KECA 4OO1I 3NWTA 4XXEA 2D9UA 4F87A 3K59A 1A3VA 1LTSD 4PQXA 3M4OB 1TS4A 4NW2A 4KN4C 3LX0A 3D8GA 1OXXK 2KVMA 3X3MA 1U4PA 3G6JB 3TN2A 1SEBD 2OEOA 3URYA 1L0YB 1QOHA 1BDOA 4F7XA 1STYA 1BQQT 1BCPB 1OXUA 1RF2D 3R2TA 1G2SA 3S1QB 3OIPA 5J39A 4KK7A 4AYBB 4ZKCB 5M3FB 4R8NA 3HGBA 1EY0A 3TBIB 3A7AB 2E2IB 5F2DA 2CHBD 1K83B 4FP5D 2PZTA 3OIQA 1JOKA 1LACA 1HTPA 5IGGA 1ESRA 4S3SA 2BDOA 1DONA 3S14B 2K1BA 3HOYB 5FOBB 3P75A 4DNRB 5T1GA 4TSSA 1I4GA 3WOFA 1KDBA 1AEXA 1G6ZA 5IIFA 3R2IA 4LAAA 1QE6A 1EYDA 1S5BD 4C3HB 3VR6A 4FXKC 4CGYB 4KKUA 4DN4M 3NTIA 1F9SA 4P2CB 3K0YA 4IFDG 5CV4A 2HQEA 2A6HD 1CK1A 3A8IE 3GTKB 3DWPA 4C1NK 2F0HA 2RKSA 3MA2B 5G3LF 3W2DA 3QJYA 1S5DD 2RBMA 4K6LA 4IFDJ 1KTKA 1EYAA 3ONAB 1E2ZA 5C44B 4C3JB 1WVLA 1SXTA 1CA6A 1OXVA 4EQNA 4PNYA 2QDBA 3J80E 3L7ZC 4FO2A 1Q3LA 1F9RA 1D5MC 1H9RA 2RA4A 2XWBB 4IUQA 3V2TA 4CJ1B 4QF4A 3HRZC 4FVMA 4UAIA 2IX1A 4HCSA 1NUCA 2LY7A 3DWQA 2F0FA 3H3VC 1NSNS 3IFTA 4H0LC 2AUKA 1HRJA 4KN7C 3IL8A 3SEBA 3Q23A 4F88A 5M3MB 3TDQA 1JICA 3HEJA 3C2PA 2WINB 2A6HC 4CKBA 5CV6A 3I90A 4IN3A 1ET9A 3GTMB 3GD7A 2I07B 4XYOA 3TZDA 1G2TA 2NZ1D 3D4WA 5BN4A 3VYRA 4ZAIA 3M3YB 1SYGA 1GUTA 1VMPA 2A69D 2XRQD 4IUTA 2EYLA 2F4IA 4J1MA 2VB2X 2O4XA 2F0OA 3S15B 1NAPA 1PXUA 1TWFB 4DFAA 1VDZA 3MXUA 1GJXA 1CZWA 2QILA 4ZLTF 5ELCA 4G4KA 2F0GA 1RODA 2NVYB 5HURA 2SDFA 3T13A 5JEAH 1HHVA 5T1IA 1RCVD 1L0XB 2PZWA 2JA8B 4QUFA 3A7LA 5EBCA 5I9OA 3K5MA 2F0KA 4IUVA 1EY5A 2K05A 1SYBA 3HZXA 1RDPD 1X32A 3GQBA 2IX0A 3A56A 4A3BB 3CKIB 1U4RA 3NPPA 2NYZD 4JBWA 2HDLA 1SDFA 1UEAB 3AMUA 4KV6A 1GHJA 5IGDA 3J80L 1PLFA 2A69C 3DHQA 3Q22A 1Y69U 2O5JC 1SYFA 5JEAJ 4XTCS 5ELDA 4BA1I 2TMPA 2WACA 2Q8RE 2IPKD 1TS5A 4OIKA 3A8JE 1EWHA 4NDXA 2EDGA 4OGQC 2K03A 2MP1A 3M85A 1TWCB 3EVQA 2IJ0A 5KYLA 3D6WA 3KUPA 3X3NA 1KAAA 2RVLA 1WD0A 1A3UA 1JQYD 2F0IA 1Y8PB 4Q5VA 1F2YA 1MSHA 4LK1C 3PIO3 3K6OA 2F0SA 4QCLA 1PMRA 2C9OA 2ID0A 4K6DA 4CKEA 1ENAA 3OMCA 2G9DA 5ELFA 1LABA 4N9PA 2YU9B 1B2TA 2PMZB 2E75C 4FNFA 4OO1H 5BN5A 4L8JA 5EJWA 2NVTB 1WTRA 2J0TD 3CRKC 3I4NB 1HXYD 4V0BA 3BS1A 4RGNA 2LS01 4KTAA 2JEBI 5KNBA 2E2HB 4PMWA 1H9SA 3EROA 4L63B 5EKKA 1KLUD 2XNAC 2FINB 2KUMA 1EL0A 1ML0D 5C4ZA 1Y8OB 1SNPA 3GP7A 2L11A 3HOXB 1SBBB 2EXZA 3J81E 2DN8A 1U9RA 3MAQA 1SJED 1TT2A 3EFXD 4RGTA 1KABA 3D4RA 3MXPA 4ZQ3A 2H1EA 1MD2D 4ZUJA 1D5XC 3O13A 4A3MB 1KLGD 2KQ3A 3QO2A 1YNND 4ID6A 2DNEA 1LTRD 3GTGB 4G7ZC 1PTOB 2M9VA 2F0QA 1E2WA 3J7YW 2BA0A 5CV8A 4PMBA 3DM1A 1JOOA 5K36G 5FKAC 5C6AA 3OHXC 2MPMA 3I8ZA 1EWCA 4FYDA 1I6VC 3BYTB 1EOTA 1CTMA 1LLRD 1SNQA 3ND9A 4K5VA 3TP6A 3LWUA 1AW7A 4C3IB 5JVH3 1ESFA 1SE3A 4DU9A 1QILA 3P20A 4H7BA 4RA8A 5E3FA 3V05A 1E0BA 1ICWA 2B8GA 3J7AV 1YNNC 1V1PB 3MEHA 2K5DA 2L0CA 1R4QB 4ZYSA 3VA5A 2F3WA 5CV9A 3TMEA 5E1FA 1TS2A 4TKOB 4O42A 3H0GB 3QB3A 1CM9A 5CV7A 2L4NA 3D3RA 1HQRD 1PZJD 4A93B 1ET6A 1EIGA 4H13C 3J81L 4EQPA 1PRTB 2SEBD 3VR3A 4I7ZC 3P1HA 1J9OA 4KY7A 2BA1A 3PUXA 1BCPF 1SFOB 2TSSA 2PYKA 4K2KA 1GUSA 3VA7A 5KRUA 3IFDA 4EVOA 3PUWA 3UI2A 2X69A 2Q8IB 1GUGA 4IUPA 5EPKA 2CW0D 4JK1C 4BBSB 4XQJA 1LTID 3AU7A 2QEJC 3FKIB 2WKCA 3NXWA 1D1KA 4DAVA 1VMCA 2MJ8A 2EZVA 1C8CA 4BA2I 2JA5B 3N6RA 4IURA 4K5WA 1HFNA 1HA5A 5JOBA 3GTLB 2AQ1B 2NN6I 1ILPA 2F0LA 3ITPA 1CQFA 1Y1VB 2GA4B 3R3OA 2J4XA 2Z8LA 3C1FA 3T53B 2XIWA 1DZ1A 5C0XH 4X3UA 3JAME 3NBHA 2CW0C 1VF5C 5ISRA 4FXGC 3PV0A 1EY8A 4OIJA 1TY2A 3K58A 1MBYA 2KA7A 2O5IC 3KF8A 4UDUC 1IYVA 3OWEB 5JPNC 2RDHA 4ABNA 4KKSA 4XT1B 3K5OA 3RZDB 4ULLA 4RKBA 3OSOA 2IWHA 3Q0AA 1OO9B 1WTPA 1Z7TA 1C48A 3BZDB 2B2YA 1JE4A 3FMCA 3PO2B 3K7AB 3ZYYX 2R7ZB 2HCIA 1JB3A 3FPUB 3BDOA 4L6TB 5C0XJ 2LFNA 2N88A 2KEDA 1ONLA 2K04A 5I2XA 1D5ZC 1ILQA 2VB3X 1EU4A 2RSNA 1PFNA 2OT2A 1KDCA 3EA6A 1XTCD 4HMJA 4XYQA 2BOSA 4I65A 2B2WA 3NK9A 5C5LA 1F2ZA 5CGKA 5IGBA 4J6HA 2WAQB 2EY6A 2F0DA 3OW7A 2MHVA 4A3DB 1GUOA 4KD4A 4DXGA 4RKLA 1QJOA 2A74C 4XQQA 1HPCA 1EEID 1FYCA 4J8QA 3KK7A 1PTOH 3KLRA 1RTNA 5LL6S 2EY5A 1PZKD 1JWMD 3D4DA 2D2CC 1B1ZA 2PCFB 1QG7A 1PTOD 1F9PA 1DOLA 5EBDA 2J7ZA 4RFBA 2K33A 1GUNA 3LWEA 1HFGA 3JAML 1SYEA 3K5LA 3NQTA 1RTOA 4K8JA 4BBRB 1Y1WB 1B3AA 1T5EA 4C1NI 1MSGA 2EYOA 3D6CA 2ZXOA 2EE1A 5C3WA 1ZXTA 2ZXRA 2FMCA 1FNWA 3E5SA 1HCZA 3R93A 4DAYA 3MFGA 4G7HC 1Q8IA 1KNEA 2B2UA 4QB4A 3C3LA 5FO9B 4IUNA 1D2BA 3C1EA 1CFMA 2FFKB 3SK6A 3N52A 4K8IA 1LT5D 3S17B 3F2UA 1SMYD 1Z47A 5EPLA 4KHVA 2A6ED 3U9OA 5C3EB 3NE5B 3BVMA 2D5DA 1OXSC 5JEAG 1HUMA 1I4PA 1X3PA 4DF7A 1GOZA 1AZQA 4XDXA 2PW5A 2Q8TA 2K7VA 1PRTD 5I6WA 5CC4A 1SYCA 1STBA 1RHPA 1SNMA 2EY2A 1FNVA 3NTHA 5EGTA 4RH6A 4X3TA 4WFN3 1DD2A 1TWGB 1C4QA 2JSOA 4U68A 1F2LA 3ERQA 3L3OC 3QOJA 3C46A 3A54A 3HG9A 1DXMA 5CMDA 4QUCA 2B2YC 1B53A 1PDQA 1SMYC 4IFDI 2NWGA 3RLFA 2A6EC 3QG1A 2VNUD 1DCZA 4PV1C 4R9WA 2L9HA 2DY7A 2K28A 3WDNA 1TWAB 1BCPD 1PRTC 4ILWA 2WB1B 5JVG3 1TU2B 3NWSA 1MGSA 1B9MA 3NP8A 2OF1A 2NUCA 3FVQA 2B2WC 4PMCA 1VF7A 2XSCA 2EYHA 3CHBD 5KIXA 1U4LA 4MHEA 3A55A 1SE4A 2QCPX 2HUGA 4HAEA 5KYIA 3FRPB 3G7LA 5FO7B 1I50B 1JR0D 5D3DA 1JORA 4KHZA 1K8MA 4M8AA 4RHRA 2F0JA 4HR7B 3DWAA 3ND8A 4OO1G 4A3GB 2JEAI 1EFID 2EYJA 4HCEA 1CI3M 1S5ED 1ENCA 2PQEA 3MHBA 5EKLA 5J22A 4DNTB 1BXTA 1PTOF 1GXDC 1Q1EA 4X3KA 3PUZA 2RDGA 1H9MA 1SJHD 3V96A 2NVQB 3I3CA 3H6MA 2HDMA 1QNKA 1BCPC 5C3XA 4TRDA 4BWGB 1LTAD 4G57A 1QWYA 2F0UA 5CBEE 3SK8A 2A73B 3NUCA 4C3HG 3DMUA 2NN6H 1ZYRD 2ENBA 4BY1B 4F8MA 2K32A 4RCNA 5KGUA 1PYWD 4ZRZA 1W6KA 5EPJA 3L9AX 4HSVA 5A35A 1SNDA 1XYIA 3MWYW 4DGZA 4DXFA 5K5PA 2B8FA 1XX8A 3NTKA 2B2VA 3LNNA 5E4XA 3NSWA 3PUYA 5KEEA 2B2UC 1TVXA 4M1UB 4C3JG 1G8ZD 3A8KE 5C4XB 1SSOA 1EYCA 3R8BA 1EY7A 5IGCA 5M5XB 4G7OC 3KBGA 3I70A 3K5NA 2F03A 4QIWB 1JCKB 1EY9A 1FNUA 3SK4A 2EJMA 4K2LA 2LMCB 3GTPB 3RMHA 1I4XA 1ZYRC 2F0EA 1DOKA 5KNDA 4Y7NB 1PRTF 2BDNA 3BVZA 1Z6HA 1EY4A 1V1OA 4KY5A 1NR2A 1RKNA 4CHTB 3I91A 1SNCA 4A3FB 1KDAA 4KMUC 1S4ZA 4YIJA 1O7ZA 5M5YB 3NHHA 4U673 2NTSA 4RCOA 4OHJA 1PFBA 2X6GA 1SAPA 3M4YA 5J1ZA 1H9KA 2D62A 2F0MA 3OOCA 3GV3A 3BDLA 3BYYB 1MI2A 3RUZA 4Z9CB 2ZXPA 3BDCA 5TSSA 4FF2A 1Q1BA 5DNFA 1VCIA 5IGEA 3CQZB 4TQUS 3HOUB 5DM63 2BCOA 1CHPD 2XRSD 4CJ0B 2CQAA 2K5WA 3E0JA 2CVRA 1WTWA 1WTQA 3VYUA 2Y0SB 2XN9C 2AUJD 3FPPA 3M7NA 3D31A 2Z4IA 1YNJD 1A2TA 3EJIA 2L12A 4CJ2C 2XWJB 5I6YA 1J8IA 4ZKBB 1ZKOA 1FGBD 2EPBA 1TY0A 4ODGA 5ELEA 1KNAA 1EQVA 1AP0A 3HP3A 2F0WA 2SNSA 5FLXE 2WP8J 1QNUA 3S2DB 4DK0A 3GV6A 3T51B 1EIHA 3GTQB 4HSPA 4R8IA 1A3TA 4A3IB 3GTOB 1LT6D 3QWNA 1B44D 3OPOA 1SNOA 1JOQA 2PPBC 3HS0C 1PFMA 1IKLA 5HGTA 2PNRC 4NKLA 1AN8A 1JWSD 5NUCA 2IW3A 5I2YA 3KBXA 5CBAE 1DOMA 1YNJC 5C0XG 1B9NA 2KJXA 1STHA 1CA5A 4MIUA 1V1PA 1R9TB 2A68D 2DNCA 5I9PA 2B2VC 5LHY1 2RQXA 4K5XA 3KLSA 2PZUA 4K14A 3T16A 1ZEQX 4KI0A 2R6GA 1I6HB 3WOEA 1BUVT 2AWNA 4KJNA 3U9SA 3BG3A 2F0NA 1HQMC 4IFDH 1CQVA 4NMZA 5KNCA 1A6XA 2B2TA 1LTBD 1LTGD 1V8QA 5M9OA 4CKCA 4HEDA 1EY6A 3DUZA 4A3KB 1EQTA 3P7JA 2EJFC 4OL7A 1XWEA 2PO4A 2IX3A 1AFPA 1R4PB 2WIIB 1DM0B 4WRDA 3H09A 1F77A 4Q0FA 2A68C 2G9HD 4RGMA 5FLXL 5CR3A 1BNZA 2EYFA 2F0VA 3S1MB 4C56C 3AB9A 1TS3A 3Q6SA 3FEWX 2FMMA 2MUYA 3TP7A 5DM73 2VXWA 1D1IA 3QIAA 3SR1A 2AQ3B 3MXGA 5LL6X 2R3ZA 3S9WA 4HMIA 3PIP3 5CORA 3NBIA 2O2LD 2EYPA 2E2JB 3MXNA 1IHZA 2F1MA 4RAUC 1BBXC 1UUPA 3I4LA 4LMQD 4BS9A 1O80A 2JXMB 3I72A 3VR4A 1TKWB 1B50A 1STAA 2QF7A 2AWOA 3MVVA 3RZOB 1K8OA 4FF1A 4XQNA 3VYSA 1DJRD 2R93B 2F0PA 2EYMA 4WORA 4C3IG 1BOSA 2JA7B 4O1NA 3OWFA 2R61A 1STEA 2RSOA 3SVMA 4WJWA 1QCBD 5A2QE 2XVSA 2RDFA 1RJTA 5M5WB 5D3IB 1PTOC 2I46A 5D65A 4E6IA 1F2MA 5JPMC 1IW7D 2PW7A 2OXPA 3SK5A 4X3SA 1GHKA 5JJZA 4BY7B 4DA2A 4FF4A 3S1RB 1LV9A 1M4VA 2ICIA 3VYTA 1H9SB 2IT1A 3S2HB 2F3VA 3S16B 2A5HA 2C5CA 3BVGA 4CBVA 1PZID 1O78A 1LT4D 5JAVA 1AZPA 1OXTA 1IL8A 1T5XD 3SDZA 2NVXB 2E76C 4C2MB 1Q12A 5C0XI 1LTTD 4DK1A 5IT9E 2NBFA 4A3EB 2KEEA 1WTXA 1CHQD 1O7YA 1IKMA 2KCNA 5C5MA 2NB0A 5D14A 2JE6I 4MN3A 1EZ8A 1IYUA 2HCCA 3J7AF 4QMGA 1G291 1IW7C 2H4OA 3EQLC 1STGA 4ZK9B 1FR3A 2FJ2A 3MTSA 1I4RA 3KLSX 1WTVA 3MC0B 3TP5A 1CT1D 2JP1A 5FO8B 5C4JB 2K01A 1D6EC 2QKIC 3CU7A 2BE5D 2B2TC 2N55A 4IUUA 2K5QA 2JA6B 2L55A 1DYQA 3VR2A 1Q90A 2K6AA 4HN7A 4HTHA 5BN3A 4KD3A 5C4HA 1U4MA 1UAPA 5ELBA 4KKTA 5A2QL 1G91A 1WTOA 1TR5A 3IAYA 5EKIA 4GZYC 1GUWA 1O7LA 1E2VA 1M8AA 1TQOA 3OMGA 1HA6A 1EU3A 3MFYA 4RHSA 5IODA 2JYOA 1I4HA 4B08A 3M7GA 1TWHB 4RGOS 3SHLA 1HTLD 5DEHA 1BO0A 3GO5A 2AQ2B 2YYZA 1W6JA 1S5FD 3TZUA 2BE5C 3DEPA 3H94A 1NCVA 3PMFA 2E2DC 2M00A 2R92B 3HOWB 3S1NB 1EEFD 4H44C 5IT9L 5DAUA 4KJOA 4KY6A 2B39A 4XT3B 1BR9A 1UNSA 2KHSA 3TP8A 1LO5D 2ICEC 4ZUIA 2SNMA 1CZGA 4IQZA 2EY1A 2NN6G 1X3QA 2L5TA 3I4MB 4IALA 5AFWA 3RD4A 3Q24A 1HUNA 1FD7D 2WKDA 1S5CD 3HOVB 1B4OA 5EQ0A 2ZT9C 1WCMB 3VR5A 2X6LA 1EZ6A 4NP5A 2L1BA 4B9XA 5K36H 1JC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYC A;  3T53 B;  1EWH A;  4TKO B;  2EJF C;  1CI3 M;  2V4D A;  1Z6H A;  2EDG A;  1IW7 D;  3GD7 A;  3PUV A;  5C0X H;  3KLR A;  4OGQ C;  4XIG S;  1GHK A;  4KKT A;  4DNT B;  3D4R A;  2CW0 C;  5BN4 A;  1VF5 C;  2D2C C;  2KCC A;  2PCF B;  3PV0 A;  1Q1E A;  4H13 C;  4DK0 A;  3M85 A;  1GUT A;  3PUZ A;  4KMU C;  2KA7 A;  3VR6 A;  3T51 B;  2O5I C;  1H9M A;  4KKU A;  4GZY C;  1IYV A;  2K33 A;  2A68 C;  1GUN A;  1H9S B;  2IT1 A;  1O7L A;  2A69 D;  1DD2 A;  1E2V A;  3IKJ A;  3MFY A;  3CRL C;  3OPO A;  4KKS A;  3VR3 A;  4IFD G;  4I7Z C;  1V43 A;  3W3A A;  2DNE A;  2BA1 A;  1O78 A;  1Y8P B;  3PUX A;  1OXT A;  1T5E A;  3AB9 A;  3M4Y A;  4G7Z C;  1Z7T A;  2PPB C;  1DXM A;  4KN4 C;  2NN6 H;  3QIA A;  1VDZ A;  2A6H D;  3MXU A;  3SDZ A;  1OXX K;  1GJX A;  4LK1 C;  1E2W A;  1H9K A;  2E76 C;  2D62 A;  2K32 A;  3A8I E;  2PNR C;  3OOC A;  3FMC A;  2BA0 A;  1Q12 A;  4RCN A;  2YYZ A;  1GUS A;  1PMR A;  3VA7 A;  4DK1 A;  1SMY C;  3BDO A;  3PUW A;  3TZU A;  5K36 G;  3RLF A;  5JEA H;  2BE5 C;  2A6E C;  3QJY A;  3H94 A;  2Q8I B;  1GUG A;  3QG1 A;  1H9J A;  2F1M A;  5A35 A;  1LAB A;  1YNJ C;  1DCZ A;  1I6V C;  1B9N A;  1ONL A;  1Q1B A;  4JK1 C;  4PV1 C;  3SE0 A;  3A7L A;  3I4L A;  1BDO A;  1VCI A;  2B8F A;  2JXM B;  1HCZ A;  3I72 A;  1E2Z A;  2E75 C;  1CTM A;  4TQU S;  3WDN A;  4OO1 H;  2A68 D;  2DNC A;  3VR4 A;  1OXV A;  1TKW B;  2JE6 I;  3ND9 A;  4H44 C;  3GQB A;  3LNN A;  1OXU A;  2QF7 A;  1IYU A;  2AWO A;  3LWU A;  4G7H C;  3L7Z C;  3PUY A;  1H9R A;  5BN5 A;  2EVB A;  1K8O A;  4L8J A;  1G29 1;  1IW7 C;  3EQL C;  4JBW A;  4KI0 A;  2R6G A;  1TU2 B;  3P20 A;  1CFM A;  1FR3 A;  2EJG C;  1B9M A;  1Y8N B;  3HGB A;  1GHJ A;  3A7A B;  3CRK C;  4IQZ A;  3A8K E;  3U9S A;  4OO1 G;  2E74 C;  2NN6 G;  2AUJ D;  4BA2 I;  1VF7 A;  3FPP A;  2L5T A;  3N6R A;  5C0X G;  3BG3 A;  3M7N A;  1HQM C;  2A69 C;  3D31 A;  1Y69 U;  2B8G A;  2JEB I;  3IFT A;  5KNB A;  4IFD H;  2O5J C;  2BE5 D;  2A6E D;  4H0L C;  4LJZ C;  3NE5 B;  1YNN C;  2AUK A;  4XTC S;  5KNC A;  2D5D A;  1A6X A;  1OXS C;  3OW7 A;  4KN7 C;  5JEA G;  2EJM A;  1LAC A;  2ZT9 C;  1H9S A;  4BA1 I;  1HTP A;  4G7O C;  2LMC B;  1GUO A;  1V8Q A;  1Q90 A;  1ZKO A;  3VR2 A;  3I73 A;  1QJO A;  2BDO A;  2NN6 I;  3DXJ C;  1Y8O B;  3VR5 A;  1ZYR C;  2A6H C;  5BN3 A;  5KND A;  1HPC A;  1K8M A;  4KHZ A;  4HR7 B;  3T56 B;  4DNR B;  3ND8 A;  2DN8 A;  3A8J E;  5K36 H;  2K7V A;  2JEA I; 
#chains in the Genus database with same CATH topology
 2KBN A;  2MGS A;  1NE3 A;  2YTY A;  2ZJR A;  2KOL A;  2UXC L;  1Q86 C;  5CYU A;  2UXB Q;  5COY A;  2JA9 A;  2KCC A;  1I4Q A;  1QB5 D;  4DR6 Q;  4FXD A;  1EIY B;  3HOZ B;  2NTT A;  2FHT A;  5IOC A;  4A3L H;  2M2L A;  3HKZ B;  5IGF A;  4HID A;  2E2J H;  3SXH A;  1TII D;  2UUA L;  3IKJ A;  2VQF L;  1P8L A;  3CRL C;  4YWM A;  3T4A C;  2C35 B;  4QQB X;  3E9H A;  1V43 A;  3W3A A;  4HIM A;  1IBK Q;  4V19 0;  2ATW A;  4GLV B;  4DV1 Q;  3K0X A;  2B63 B;  1E24 A;  1VQD A;  4JG2 A;  2BH8 A;  5I4D A;  3LGJ A;  1Z9F A;  1JJC B;  1RD9 D;  4FF3 A;  3RZO H;  3MZ5 A;  2HIV A;  5CV5 A;  3TS0 A;  1SE2 A;  3FHW A;  3E6Z X;  4DV4 L;  4DR3 L;  1Y1W G;  2XTI A;  2DY8 A;  5G3L D;  3U58 A;  1H9J A;  3KF8 B;  4JOI C;  2R93 H;  2VUM B;  1ENF A;  3SE0 A;  4A3J B;  4DAP A;  1VQ5 A;  1IBM L;  3CC7 A;  1DGS A;  1LT3 D;  2Z0S A;  2JA7 H;  5AJ3 L;  5GRO A;  4EGV A;  3QOL A;  1F9Q A;  4LFC L;  3TSS A;  4DUY L;  4RWS C;  2EVB A;  2JN4 A;  1SYD A;  1STN A;  2IL8 A;  1VQ4 A;  2GN5 A;  4P72 A;  4JW0 A;  1NR4 A;  4EQO A;  2EJG C;  1FGU A;  1XXG A;  1Y8N B;  5M5W H;  1BF4 A;  3H91 A;  2LKV A;  4IZ8 A;  2E74 C;  3S15 H;  4LUV A;  4JV5 Q;  2SOB A;  5E4W C;  4OWW B;  3PO3 B;  3WWV A;  3DEO A;  1WD1 A;  4BY7 H;  2JJQ A;  4LJZ C;  2EOT A;  5FK9 C;  4O0A A;  1A15 A;  3S1R H;  3NQI A;  1LUZ A;  3F1Z A;  1XMO L;  4ME5 A;  3BU2 A;  1A2U A;  3I73 A;  2ZM6 L;  3DXJ C;  3S2H H;  2F0T A;  3S16 H;  4AQY Q;  2Z4H A;  3FDT A;  3T56 B;  5C3E G;  1LYL A;  2V4D A;  2WV6 D;  3PUV A;  4XIG S;  4B9W A;  1N32 Q;  3K57 A;  1KD1 C;  2NVX H;  1JWU D;  2Z1C A;  3GTJ B;  4C2M H;  1V1Q A;  4I7A A;  1ASZ A;  1II3 A;  4DR4 Q;  4N9T A;  1IYJ B;  1I3Q B;  1EYG A;  2KEC A;  1SLJ A;  4OO1 I;  3NWT A;  4XXE A;  3E9I A;  2D9U A;  1QVG A;  1PYB A;  1I94 L;  4F87 A;  3K59 A;  1A3V A;  1LTS D;  4PQX A;  3M4O B;  1YJW A;  1TS4 A;  3CC2 A;  3U50 C;  4NW2 A;  1S3O A;  2B29 A;  4KN4 C;  3LX0 A;  3D8G A;  3I4O A;  1OXX K;  2UXC Q;  1CUK A;  4JI0 L;  2KVM A;  1UEB A;  3X3M A;  1E7Z A;  3TRE A;  1U4P A;  1N36 L;  3G6J B;  2UUA Q;  3TN2 A;  1SEB D;  3HFZ B;  2OEO A;  2VQF Q;  1BBW A;  1QUQ A;  3URY A;  1L0Y B;  1QOH A;  1BDO A;  4F7X A;  1STY A;  5C4J H;  1BQQ T;  1BCP B;  4GN5 A;  1OXU A;  1RF2 D;  3R2T A;  1G2S A;  2JA6 H;  1O7I A;  3S1Q B;  3OIP A;  5J39 A;  1IZ6 A;  4KK7 A;  4AYB B;  2IHF A;  4DV6 L;  4ZKC B;  5M3F B;  4R8N A;  3HGB A;  1EY0 A;  3TBI B;  3L0O A;  3A7A B;  1QVF A;  2E2I B;  5F2D A;  2CHB D;  1K83 B;  4FP5 D;  2WB1 G;  2PZT A;  3OIQ A;  1HZ9 A;  1JOK A;  4DUY Q;  1LAC A;  2CCZ A;  1HTP A;  4DAY B;  5IGG A;  1ESR A;  4S3S A;  2BDO A;  1DON A;  3S14 B;  2K1B A;  2UUC L;  2P5Z X;  3HOY B;  5FOB B;  2OTL A;  2YU9 H;  3P75 A;  4DNR B;  4GOP B;  4YCW A;  5T1G A;  5FJ8 G;  2WFW A;  4TSS A;  1I4G A;  3WOF A;  1TWH H;  2Z6K A;  1KDB A;  3U4V A;  1AEX A;  4IJH A;  1G6Z A;  1C0A A;  5IIF A;  1I5F A;  3R2I A;  4LAA A;  1QE6 A;  1EYD A;  1VQK A;  1S5B D;  4GN3 B;  3KJP A;  4C3H B;  3VR6 A;  4X66 L;  4A3G G;  4FXK C;  4CGY B;  1IL2 A;  4KKU A;  4DN4 M;  1VQJ A;  3NTI A;  2ZM6 Q;  4WJ4 A;  1F9S A;  4P2C B;  4DR7 Q;  3K0Y A;  4IFD G;  5CV4 A;  3G6E A;  2R92 H;  2PI2 A;  3HOW H;  2HQE A;  2DJG C;  3S1N H;  1KAW A;  1A63 A;  2A6H D;  1WOC A;  1CK1 A;  4LNQ A;  3A8I E;  3GTK B;  3DWP A;  4KLK A;  4C1N K;  2F0H A;  2RKS A;  3MA2 B;  5G3L F;  3W2D A;  1K28 A;  3QJY A;  1S5D D;  4LF5 Q;  2RBM A;  4K6L A;  2Q2U A;  4IFD J;  5GAH C;  1KTK A;  2CH4 W;  1I94 Q;  4BY1 G;  3CP0 A;  3I4M H;  1EYA A;  3ONA B;  1E2Z A;  5C44 B;  4C3J B;  1WVL A;  1SXT A;  4TVA B;  1CA6 A;  3BZC A;  4DR5 Q;  1OXV A;  1B70 B;  4EQN A;  4POG A;  4PNY A;  2QDB A;  3J80 E;  3HOV H;  3L7Z C;  4FO2 A;  1Q3L A;  1F9R A;  1JB7 A;  1D5M C;  1WCM H;  4OEM B;  1H9R A;  2RA4 A;  2UUB L;  1HNX L;  4IO9 A;  2XWB B;  4IUQ A;  3V2T A;  4CJ1 B;  1N36 Q;  3I55 A;  4QF4 A;  3J7Z C;  3HRZ C;  1UE7 A;  4FVM A;  4FDB A;  4UAI A;  3CAM A;  1PV4 A;  2IX1 A;  4B3R L;  3GTG H;  4HCS A;  1NUC A;  2LY7 A;  3DWQ A;  2F0F A;  3H3V C;  1G51 A;  1NSN S;  3IFT A;  4H0L C;  2AUK A;  5IYD H;  1HRJ A;  1L1O A;  3HOZ H;  2DUD A;  4KN7 C;  3IL8 A;  3SEB A;  4OWX B;  3EBE A;  4F88 A;  3Q23 A;  1MIU A;  5M3M B;  3TDQ A;  1JIC A;  5C4X G;  3HEJ A;  3C2P A;  2WIN B;  2A6H C;  2N8N A;  1VQG A;  4CKB A;  3PIO A;  5CV6 A;  3I90 A;  3BJU A;  4IN3 A;  2CWA A;  1ET9 A;  4MTN A;  1VQB A;  4JYA Q;  3GTM B;  2B63 H;  3PSI A;  3GD7 A;  3PCO B;  4JI1 Q;  2I07 B;  4XYO A;  4QJF A;  3TZD A;  1G2T A;  2NZ1 D;  3D4W A;  2VY3 A;  2I0Q A;  4C3I H;  5BN4 A;  3VYR A;  2F4V L;  4ZAI A;  3M3Y B;  1SYG A;  2MQH A;  1GUT A;  2KHI A;  1PH4 A;  1VMP A;  4L5Q A;  2A69 D;  2XRQ D;  4IUT A;  2EYL A;  2UUC Q;  2F4I A;  4J1M A;  2VB2 X;  2VUM H;  4A3J H;  2O4X A;  5IYC H;  3JAM i;  2F0O A;  2YTV A;  3S15 B;  1NAP A;  1PXU A;  1TWF B;  4DFA A;  3D0F A;  1KQS A;  1VDZ A;  3MXU A;  1GJX A;  1SRO A;  1CZW A;  2QIL A;  5ELC A;  4ZLT F;  4G4K A;  2F0G A;  1GD7 A;  3G48 A;  4LF9 L;  1A0I A;  1CSP A;  1ROD A;  2NVY B;  5HUR A;  2SDF A;  3T13 A;  5JEA H;  1D7Q A;  1HHV A;  5T1I A;  1RCV D;  3UE1 A;  1L0X B;  2PZW A;  1XJV A;  2JA8 B;  4QUF A;  3A7L A;  4JI8 Q;  4DAM A;  5EBC A;  5I9O A;  3K5M A;  2F0K A;  4IUV A;  1EY5 A;  4GKJ L;  2K05 A;  1CKM A;  1SYB A;  3HZX A;  1RDP D;  1X32 A;  3GQB A;  2IX0 A;  3A56 A;  4A3B B;  3I7F A;  3VDY A;  3CKI B;  1U4R A;  4MZ9 A;  3NPP A;  2NYZ D;  1VS0 A;  1KHI A;  4JBW A;  4KHP L;  2HDL A;  1SDF A;  1PH1 A;  1UEA B;  3PO3 G;  3AMU A;  2G5D A;  4KV6 A;  1GHJ A;  5IGD A;  4X64 L;  3EN2 A;  3HOU G;  4JOI A;  1UWV A;  3J80 L;  5IYB G;  1PLF A;  1Y14 B;  3KDF B;  2QDL A;  1Q46 A;  4JVZ A;  1YJN A;  2A69 C;  3DHQ A;  4R4T A;  3Q22 A;  1Y69 U;  2O5J C;  1SYF A;  3GTJ H;  5JEA J;  2Y0S G;  4XTC S;  1VQM A;  5ELD A;  5IP9 G;  2PNH A;  4YHH L;  1I3Q H;  4BA1 I;  2TMP A;  1FJG L;  3M9B A;  2WAC A;  1B7Y B;  1HNX Q;  2Q8R E;  2IPK D;  4YWK A;  4WJ3 M;  1TS5 A;  4OIK A;  4NXN L;  4YWL A;  3M4O H;  3HKZ E;  3A8J E;  1EWH A;  4NDX A;  2Z6K C;  3FKI H;  2EDG A;  5EAY A;  3RR5 A;  4OGQ C;  1HR0 L;  2K03 A;  1EQR A;  2MP1 A;  4MTK A;  3M85 A;  1TWC B;  3EVQ A;  2IJ0 A;  5KYL A;  3D6W A;  3KUP A;  1FVI A;  3X3N A;  3AFP A;  5IE8 A;  1YHQ A;  1KAA A;  2RVL A;  1WD0 A;  3W5O A;  1A3U A;  1JQY D;  4PZ7 A;  2F0I A;  1Y8P B;  1EUJ A;  4Q5V A;  5LMN L;  3CC4 A;  1F2Y A;  1MSH A;  4LK1 C;  3PIO 3;  3A5U A;  3K6O A;  2MO1 A;  2F4V Q;  2F0S A;  4QL5 A;  4A3I G;  3S1Q H;  4QCL A;  1PMR A;  2C9O A;  2ID0 A;  4K6D A;  4CKE A;  1ENA A;  3OMC A;  1J6Q A;  5BR8 L;  4J15 A;  2G9D A;  5ELF A;  3CCU A;  1LAB A;  2VQE L;  3PF5 A;  4N9P A;  1K83 H;  2YU9 B;  1B2T A;  2PMZ B;  2E75 C;  4FNF A;  4OO1 H;  1K8G A;  2R7D A;  2Z6B A;  5M3F G;  3UDI A;  5BN5 A;  4L8J A;  2ZTD A;  3S14 H;  5EJW A;  2NVT B;  3HOY H;  1WTR A;  3RZD H;  2J0T D;  3CRK C;  3I4N B;  4R4Q A;  1HXY D;  4V0B A;  3BS1 A;  1VQ8 A;  2Y0S E;  4RGN A;  2LS0 1;  4KTA A;  4NXM L;  2JEB I;  5KNB A;  3NEM A;  1L1O C;  1M90 C;  3PO2 H;  2R7Z H;  1PH9 A;  2E2H B;  4LUZ A;  4C3H H;  4PMW A;  1H9S A;  3ERO A;  4L63 B;  5EKK A;  1KLU D;  2XNA C;  2FIN B;  2KUM A;  1EL0 A;  2HIX A;  3ULJ A;  1ML0 D;  5C4Z A;  1Y8O B;  1SNP A;  3GP7 A;  2L11 A;  3HOX B;  1SBB B;  4POF A;  2EXZ A;  3J81 E;  2DN8 A;  1U9R A;  4A3C H;  4L5S A;  3OYY A;  3MAQ A;  1SJE D;  1YEZ A;  4YCV A;  1TT2 A;  3EFX D;  2I5M X;  4RGT A;  4DPG A;  1KAB A;  3D4R A;  3GTK H;  3MXP A;  4ZQ3 A;  1UE1 A;  2H1E A;  1MD2 D;  4ZUJ A;  2N49 A;  1D5X C;  2F3I A;  1XNR L;  2ALY B;  4LF7 Q;  3O13 A;  4A3K G;  1X3E A;  2OQK A;  1CKN B;  3PQI A;  4A3M B;  1KLG D;  3F2D A;  2KQ3 A;  3QO2 A;  1YNN D;  2LXK A;  1EIF A;  1HJP A;  5FLM H;  4ID6 A;  1K8A C;  1LM0 A;  1LTR D;  2DNE A;  5C44 H;  2CWP A;  4C3J H;  3GTG B;  4G7Z C;  1YBY A;  1PTO B;  2M9V A;  3CXC A;  4A3D H;  2F0Q A;  1E2W A;  3J7Y W;  1JMC A;  2ZJP A;  4LFB L;  2BA0 A;  1X55 A;  5CV8 A;  4PMB A;  1HNZ L;  3DM1 A;  1JOO A;  5K36 G;  5FKA C;  5C6A A;  3OHX C;  2MPM A;  3I8Z A;  1EWC A;  2E5L L;  2I5L X;  3SGI A;  4FYD A;  1I6V C;  3BYT B;  4ZCK A;  4AYB E;  1EOT A;  1C9O A;  1CTM A;  1LLR D;  3T1H L;  1SNQ A;  5LMN Q;  3ND9 A;  4A3L G;  4K5V A;  3TP6 A;  3LWU A;  1AW7 A;  5M3M H;  4PG3 A;  4C3I B;  3RN5 A;  3NBH B;  4YCU A;  4X62 Q;  5JVH 3;  5JJK A;  3A0J A;  1VQ7 A;  1ESF A;  1SE3 A;  4DU9 A;  1QIL A;  3P20 A;  1PVO A;  4H7B A;  1SMX A;  4APV A;  1HNW L;  4BBR H;  4RA8 A;  5E3F A;  3GTM H;  1H95 A;  1MKH A;  3V05 A;  1E0B A;  4CDE C;  1ICW A;  4LF8 L;  2B8G A;  3J7A V;  1YNN C;  3M3Y H;  1JJG A;  1V1P B;  3MEH A;  3QR8 A;  1YVC A;  3H15 A;  1B8A A;  4DV2 L;  2R93 G;  2K5D A;  3CCM A;  1IXR A;  2L0C A;  4IPG A;  1R4Q B;  4ZYS A;  4OX9 L;  4UPA A;  1T9H A;  3VA5 A;  2F3W A;  2NZO A;  2JA7 G;  5CV9 A;  3TME A;  5E1F A;  1TS2 A;  4TKO B;  4O42 A;  3H0G B;  1TWF H;  1XMQ L;  3QB3 A;  1CM9 A;  1VQ6 A;  5CV7 A;  2L4N A;  1Q7Y C;  4NXM Q;  1Q8K A;  3STB D;  3D3R A;  1HQR D;  1PZJ D;  4A93 B;  1ET6 A;  1EIG A;  3K81 C;  4H13 C;  2NVY H;  1JJ2 A;  1V9P A;  3J81 L;  1U0L A;  2QW7 A;  4EQP A;  1X3F A;  2RF4 A;  2JA8 H;  4P75 A;  1PRT B;  1YHA A;  2SEB D;  1KIX A;  3VR3 A;  4BY7 G;  3OTO L;  2GVA A;  4I7Z C;  1JE5 A;  3P1H A;  1J9O A;  4KY7 A;  2BA1 A;  2UXD Q;  3PUX A;  1YI2 A;  1KL9 A;  3W1G A;  4A3B H;  1BCP F;  3KF6 B;  4LWC A;  2TSS A;  1SFO B;  1MJE A;  2PYK A;  4K2K A;  1GUS A;  3VA7 A;  3UDX A;  5IY0 A;  5KRU A;  3IFD A;  4IJL A;  4EVO A;  3PUW A;  3UI2 A;  3ICE A;  2X69 A;  2Q8I B;  1GUG A;  4IUP A;  5EPK A;  1KRT A;  4JPB W;  1K3B C;  2CW0 D;  4JK1 C;  1HH2 P;  4BBS B;  2E8G A;  4XQJ A;  1LTI D;  3AU7 A;  2QEJ C;  3W1B A;  3FKI B;  1WJJ A;  1L2F A;  2WKC A;  3GDE A;  4A3E G;  1VQH A;  3NXW A;  1D1K A;  4DAV A;  4DR2 L;  4LFB Q;  1CKN A;  1VMC A;  2K14 A;  1HNZ Q;  2MJ8 A;  1EQQ A;  2K4K A;  4YY3 L;  3STB C;  2EZV A;  2DGY A;  1C8C A;  3M4P A;  2K5H A;  4R1J A;  4BA2 I;  3MXN B;  2JA5 B;  3N6R A;  4IUR A;  4K5W A;  2KHJ A;  5FLX c;  1HA5 A;  1HFN A;  3A5Z B;  4JI6 L;  3T1H Q;  4JI2 L;  3K7U C;  1TWC H;  4JI5 L;  2ASB A;  5JOB A;  4DV5 L;  4AH6 A;  3GTL B;  2AQ1 B;  2NN6 I;  1ILP A;  2F0L A;  3ITP A;  1CQF A;  4DV4 Q;  1Y1V B;  2GA4 B;  4DR3 Q;  3R3O A;  2J4X A;  2Z8L A;  1HNW Q;  4A76 A;  3C1F A;  3T53 B;  3T1Y L;  2XIW A;  5IP7 G;  2K5V A;  2JA6 G;  1DZ1 A;  3ER0 A;  3CCJ A;  1TWA H;  2Q2I A;  5C0X H;  4X3U A;  1IBM Q;  2GVB A;  3JAM E;  3JAM c;  3NBH A;  5AJ3 Q;  2CW0 C;  4EQ5 A;  1VF5 C;  5ISR A;  4FXG C;  3PV0 A;  4LFC Q;  1EY8 A;  4OIJ A;  1TY2 A;  1SE8 A;  3K58 A;  1MBY A;  2KA7 A;  2O5I C;  3KF8 A;  4IOC A;  1KXL A;  4UDU C;  1IYV A;  3OWE B;  5JPN C;  1G6P A;  2RDH A;  4ABN A;  4KKS A;  4XT1 B;  3K5O A;  3RZD B;  4ULL A;  4RKB A;  3OSO A;  2IWH A;  3Q0A A;  1OO9 B;  4K0K L;  1WTP A;  2K50 A;  1Z7T A;  3CCE A;  1C48 A;  3BZD B;  2B2Y A;  1JE4 A;  3FMC A;  3PO2 B;  3K7A B;  3ZYY X;  2R7Z B;  4RG1 A;  2HCI A;  1JB3 A;  1ICF B;  3FPU B;  2UU9 L;  2NVT H;  1XMO Q;  3BDO A;  4L6T B;  5C0X J;  2LFN A;  2N88 A;  3I4N H;  2KED A;  1ONL A;  2K04 A;  5I2X A;  1D5Z C;  1ILQ A;  3OTO Q;  2VB3 X;  3ULP A;  1YHB A;  1EU4 A;  3CCS A;  2RSN A;  1PFN A;  2OT2 A;  2E2H H;  1B3Q A;  1KDC A;  3EA6 A;  1XTC D;  2LXJ A;  2RCF A;  3NEN A;  3G4S A;  4HMJ A;  4XYQ A;  3HOX H;  2KEN A;  2R92 G;  3KFU A;  2BOS A;  3HOW G;  1HZB A;  4I65 A;  5H1S E;  2B2W A;  3NK9 A;  5C5L A;  3RLN A;  1F2Z A;  5CGK A;  4DV0 L;  5IGB A;  4J6H A;  2WAQ B;  2EY6 A;  5GAD C;  2F0D A;  3OW7 A;  2MHV A;  4A3D B;  4DR2 Q;  4JI0 Q;  1GUO A;  4KD4 A;  4DXG A;  4RKL A;  1AE2 A;  1QJO A;  2A74 C;  4A3M H;  3I4M G;  4YY3 Q;  4XQQ A;  1HPC A;  1EEI D;  1FYC A;  2XGT A;  4J8Q A;  3HOV G;  3KK7 A;  1PTO H;  3KLR A;  1RTN A;  1WCM G;  5LL6 S;  2EY5 A;  3K80 C;  1PZK D;  1JWM D;  4GLA C;  3D4D A;  2D2C C;  1B1Z A;  2PCF B;  1BKB A;  1QG7 A;  5LMU L;  1PTO D;  2RHQ B;  1BBU A;  1F9P A;  1YNX A;  1DOL A;  4DK6 C;  5EBD A;  2J7Z A;  4RFB A;  4EX5 A;  2K33 A;  1GUN A;  1MHW C;  2YV5 A;  3LWE A;  4GNX B;  3L2P A;  2MFI A;  1HFG A;  4DV6 Q;  3JAM L;  1SYE A;  3K5L A;  4JCV E;  3NQT A;  1D8L A;  1RTO A;  4K8J A;  1MJC A;  4BBR B;  5IYD G;  3T1Y Q;  1Y1W B;  3HOZ G;  1B3A A;  1T5E A;  4C1N I;  1OTC A;  1N34 L;  3HKZ G;  5HY6 A;  1MSG A;  2PMZ E;  2EYO A;  3D6C A;  2ZXO A;  3AYH B;  2EE1 A;  2Z9H A;  1HZA A;  4Y7N H;  1E1T A;  2B63 G;  5C3W A;  5DLQ E;  1ZXT A;  2ZXR A;  3TRZ A;  1HZC A;  2FMC A;  4NPS A;  1FNW A;  4QGU A;  1XNQ L;  3E5S A;  1HCZ A;  1EFW A;  1X65 A;  3EIV A;  3R93 A;  4DAY A;  2K5N A;  3MFG A;  4G7H C;  4A3F H;  1Q8I A;  4HIO A;  2VUM G;  4A3J G;  1KNE A;  2B2U A;  4QB4 A;  3C3L A;  1X54 A;  3HKS A;  5IYC G;  5FO9 B;  4IUN A;  4X66 Q;  1D2B A;  3C1E A;  1CFM A;  4GOP A;  1K0R A;  1YZ6 A;  2FFK B;  2I5H A;  3SK6 A;  3N52 A;  4K8I A;  1LT5 D;  3NEL A;  3H0G H;  3S17 B;  3F2U A;  2OQ0 A;  1EWI A;  1SMY D;  1Z47 A;  5EPL A;  4KHV A;  2A6E D;  3U9O A;  5C3E B;  3NE5 B;  3BVM A;  3A74 A;  4A93 H;  2D5D A;  1OXS C;  5JEA G;  1HUM A;  1I4P A;  1X3P A;  4DF7 A;  1GOZ A;  1AZQ A;  4XDX A;  2PW5 A;  2Q8T A;  1QZH A;  3UE0 A;  2K7V A;  1PRT D;  4JBM A;  5I6W A;  5CC4 A;  1SYC A;  1STB A;  2F52 A;  1SFO H;  1RHP A;  4R4O A;  1SNM A;  2EY2 A;  1FNV A;  3NTH A;  4OON A;  5EGT A;  4RH6 A;  2IHE A;  4HIK A;  5IT9 c;  4UHV A;  2UUB Q;  4X3T A;  4WFN 3;  1DD2 A;  2N3S A;  2OCE A;  1WFQ A;  1TWG B;  1C4Q A;  2JSO A;  4B3M L;  4BBS H;  4U68 A;  1F2L A;  1WTH A;  4B3R Q;  3ERQ A;  3L3O C;  3QOJ A;  3C46 A;  3A54 A;  3HG9 A;  1DXM A;  5CMD A;  3M4Q A;  4QUC A;  3B6Y A;  2B2Y C;  4B3T L;  1J5E L;  5LMU Q;  4DNI A;  1B53 A;  1KC8 C;  1PDQ A;  1SMY C;  4IFD I;  2NWG A;  3RLF A;  3H3V I;  2A6E C;  3QG1 A;  2VNU D;  3TS2 A;  5IWA L;  1DCZ A;  4PV1 C;  1S72 A;  2JA5 H;  4HJ7 A;  1IBL L;  4L5T A;  4R9W A;  2L9H A;  2DY7 A;  2K28 A;  3WDN A;  1TWA B;  1N34 Q;  2HHH L;  3RLO A;  1BCP D;  1PRT C;  4ILW A;  3I56 A;  2WB1 B;  3GTQ H;  3BZK A;  3GTL H;  2D0O A;  5JVG 3;  1TU2 B;  4DV3 L;  3NWS A;  1MGS A;  4LFA L;  1Y1V H;  2JQO A;  1FL0 A;  1B9M A;  4RMF A;  3NP8 A;  2OF1 A;  2NUC A;  2K52 A;  3FVQ A;  2B2W C;  1IBK L;  4PMC A;  4LW1 A;  1VF7 A;  2XSC A;  2EYH A;  3CHB D;  5KIX A;  1XNQ Q;  1U4L A;  1X9N A;  4A75 A;  4MHE A;  3A55 A;  1K73 C;  4AYB G;  1SE4 A;  2QCP X;  2HUG A;  4HAE A;  5KYI A;  4OXP A;  3FRP B;  4LF9 Q;  3G7L A;  5FO7 B;  4UP9 A;  1I50 B;  1JR0 D;  5D3D A;  1JOR A;  4KHZ A;  1K8M A;  4M8A A;  4RHR A;  2F0J A;  4HR7 B;  4P71 A;  3DWA A;  3ND8 A;  4OO1 G;  4A3G B;  3CMA A;  2JEA I;  1EFI D;  4H02 A;  2EYJ A;  4HCE A;  1CI3 M;  1S5E D;  1ENC A;  4ME3 A;  2PQE A;  3MHB A;  5EKL A;  5J22 A;  4DNT B;  4GKJ Q;  1BXT A;  1PTO F;  1GXD C;  4BXX H;  3K7A H;  3HOY G;  1Q1E A;  4X3K A;  3PUZ A;  2RDG A;  1H9M A;  1SJH D;  3V96 A;  2NVQ B;  3I3C A;  3H6M A;  2HDM A;  4KHP Q;  4JBJ A;  1W3S A;  1QNK A;  4JV5 L;  1BCP C;  5C3X A;  4TRD A;  4X64 Q;  4BWG B;  2EIF A;  4G57 A;  1LTA D;  1QWY A;  2F0U A;  5CBE E;  1W2B A;  3SK8 A;  2R7Z G;  2A73 B;  5JJL A;  3NUC A;  4C3H G;  4CDF C;  3DMU A;  2PQA B;  2NN6 H;  1ZYR D;  2ENB A;  4IPD A;  4BY1 B;  4F8M A;  1VQ9 A;  2K32 A;  4CDC C;  4IPH A;  4RCN A;  5KGU A;  1E22 A;  1PYW D;  4YHH Q;  1FJG Q;  4ZRZ A;  4A3C G;  1W6K A;  5EPJ A;  3L9A X;  4HSV A;  5JJI A;  5A35 A;  3KDF A;  1GO3 E;  1SND A;  1XYI A;  4NXN Q;  3MWY W;  4DGZ A;  4DXF A;  4B3M Q;  5K5P A;  1GM5 A;  3IRB A;  2VS1 A;  2B8F A;  1XX8 A;  3AFQ A;  3CF5 A;  3NTK A;  2B2V A;  3LNN A;  5E4X A;  1HR0 Q;  3NSW A;  3PUY A;  1YIT A;  4B3T Q;  1NY4 A;  5KEE A;  2B2U C;  2HQL A;  4GOP C;  1TVX A;  2Q2H A;  5FLM G;  4M1U B;  5C44 G;  4C3J G;  1G8Z D;  2RHS B;  4R4I A;  5IWA Q;  3A8K E;  2R7F A;  5C4X B;  4A3D G;  1SSO A;  1EYC A;  3R8B A;  1IBL Q;  1EY7 A;  5IGC A;  5M5X B;  1QUQ B;  4LUO A;  4G7O C;  3KBG A;  3I70 A;  3K5N A;  2F03 A;  4QIW B;  1JCK B;  1EY9 A;  2H5X A;  2HHH Q;  1FNU A;  3SK4 A;  2EJM A;  4K2L A;  1XPU A;  2LMC B;  3GTP B;  4Y52 H;  4DV3 Q;  3RMH A;  1I4X A;  1ZYR C;  2F0E A;  1DOK A;  4LFA Q;  3RN2 A;  3PGZ A;  5KND A;  3JC6 6;  2EXD A;  4Y7N B;  5BR8 Q;  1PRT F;  2BDN A;  3BVZ A;  1Y1W H;  4AIM A;  2VQE Q;  1Z6H A;  1EY4 A;  1V1O A;  2AKW B;  5M3M G;  4KY5 A;  4JI7 L;  4DV7 L;  1NR2 A;  1RKN A;  4CHT B;  3I91 A;  4PZ6 A;  1SNC A;  3G71 A;  4A3F B;  1KDA A;  4KMU C;  1S4Z A;  1NBW A;  4YIJ A;  4GLX A;  4MNO A;  3KJO A;  1O7Z A;  3TQY A;  4BBR G;  5M5Y B;  4HJA A;  3NHH A;  2N78 A;  3CW2 C;  4U67 3;  2NTS A;  4RCO A;  2FXQ A;  4OHJ A;  4PZ8 A;  1PFB A;  5ELN A;  2X6G A;  1SAP A;  3M4Y A;  5J1Z A;  1H9K A;  2D62 A;  2F0M A;  3OOC A;  3GV3 A;  4HJ8 A;  2KCM A;  3BDL A;  3BYY B;  1MI2 A;  2OTJ A;  3RUZ A;  3UDG A;  1HR0 W;  4Z9C B;  2A19 A;  2ZXP A;  4ALP A;  3BDC A;  5TSS A;  4FF2 A;  1Q1B A;  3S17 H;  2HD3 A;  5DNF A;  1AE3 A;  1VQA A;  1VCI A;  2L15 A;  3I2Z A;  5IGE A;  3J81 j;  3CQZ B;  4TQU S;  5C3E H;  3HOU B;  5DM6 3;  2BCO A;  1CHP D;  2XRS D;  4CJ0 B;  2ZTC A;  2CQA A;  2K5W A;  3E0J A;  2JA8 G;  4GNX C;  2CVR A;  1WTW A;  2WAQ E;  1WTQ A;  3VYU A;  5LMN W;  1XNR Q;  1Q82 C;  2Y0S B;  1SR3 A;  2XN9 C;  2A1A A;  4DR7 L;  3J7A 5;  2K75 A;  2PQA A;  2AUJ D;  4UP8 A;  3FPP A;  4A3B G;  3M7N A;  1YIJ A;  3D31 A;  1PH2 A;  4P74 A;  2Z4I A;  4DR1 L;  1YNJ D;  1A2T A;  3EJI A;  2L12 A;  4CJ2 C;  2XWJ B;  3J81 i;  5I6Y A;  1J8I A;  4ZKB B;  1ZKO A;  4A3E H;  1FGB D;  2EPB A;  1TY0 A;  4ODG A;  4LF5 L;  5ELE A;  1TWG H;  1NNX A;  1KNA A;  1VQE A;  3PIP A;  2E5L Q;  1EQV A;  2HT1 A;  1NMF A;  3HP3 A;  1AP0 A;  1LTL A;  2F0W A;  2SNS A;  4DR5 L;  5FLX E;  2WP8 J;  1QNU A;  3S2D B;  4DK0 A;  4LF4 L;  3GV6 A;  1L1O B;  3T51 B;  1EIH A;  1K0S A;  1WYD A;  4HSP A;  3GTQ B;  4R8I A;  2EQS A;  1A3T A;  5HGQ A;  4A3I B;  3GTO B;  1LT6 D;  5ELO A;  1PFS A;  3QWN A;  1B44 D;  3OPO A;  2RCN A;  1XPR A;  1N33 L;  1A8V A;  1SNO A;  1JOQ A;  3DLL A;  2PPB C;  4JI7 Q;  4JC0 A;  4LF8 Q;  5IP7 H;  4DV7 Q;  3HS0 C;  1PFM A;  4O2D A;  1IKL A;  5HGT A;  2QEX A;  2PNR C;  4NKL A;  1AN8 A;  5E7N A;  1JWS D;  5NUC A;  2IY5 B;  3U4Z A;  2IW3 A;  5I2Y A;  3KBX A;  4DV2 Q;  5CBA E;  1VQI A;  2ES2 A;  1DOM A;  4N8X 1;  3ULL A;  1YNJ C;  5C0X G;  2YTX A;  1B9N A;  2KJX A;  4OX9 Q;  4JYA L;  3CPF A;  4JI1 L;  1STH A;  1CA5 A;  4MIU A;  1V1P A;  1R9T B;  1XMQ Q;  2A68 D;  2DNC A;  5I9P A;  2B2V C;  5FJ8 H;  5LHY 1;  3E3X A;  5GAG C;  2RQX A;  2NZH A;  3KLS A;  4K5X A;  2PZU A;  4GS3 A;  2BH2 A;  4K14 A;  3T16 A;  1ZEQ X;  4KI0 A;  2R6G A;  4B3S L;  4X6A H;  1I50 H;  1I6H B;  1X3G A;  3F2B A;  3WOE A;  4A3G H;  1BUV T;  2AWN A;  4KJN A;  4UP7 A;  3U9S A;  1JT8 A;  3BG3 A;  2F0N A;  1HQM C;  2QA4 A;  4IFD H;  3H3V H;  1CQV A;  4NMZ A;  5KNC A;  2CH4 A;  1A6X A;  2B2T A;  3KLW A;  1BVS A;  1LTB D;  1LTG D;  1V8Q A;  1UE6 A;  2NVQ H;  3I4N G;  5M9O A;  4CKC A;  4HED A;  1UE5 A;  1EY6 A;  2VZA A;  1VQO A;  4JI8 L;  1ASY A;  3CCL A;  3DUZ A;  4A3K B;  1EQT A;  3P7J A;  2EJF C;  4JI3 L;  4OL7 A;  3KF6 A;  1XWE A;  2PO4 A;  4BY1 H;  1VQC A;  2IX3 A;  2CKZ B;  4DR1 Q;  3PF4 A;  1AFP A;  4QY7 A;  1E1O A;  3HOX G;  1R4P B;  2WII B;  1DM0 B;  4WRD A;  3H09 A;  1F77 A;  2AHO B;  4Q0F A;  3UDF A;  2A68 C;  4UY8 C;  3F2C A;  2G9H D;  4RGM A;  1E3P A;  5FLX L;  1C7Y A;  5CR3 A;  1BNZ A;  3E0E A;  2EYF A;  2F0V A;  3S1M B;  3CD6 A;  4C56 C;  1VQP A;  3AB9 A;  1TS3 A;  3Q6S A;  3FEW X;  2FMM A;  2MUY A;  2QGQ A;  3TP7 A;  2VXW A;  5DM7 3;  1VQL A;  1D1I A;  3QIA A;  3SR1 A;  2AQ3 B;  3MXG A;  5LL6 X;  3J80 c;  2R3Z A;  3S9W A;  4JI6 Q;  4JI2 Q;  4A3M G;  4HMI A;  3PIP 3;  1NMG A;  4JI5 Q;  5COR A;  4LF4 Q;  4HJ5 A;  1VQF A;  4DV5 Q;  3NBI A;  2O2L D;  4R4C A;  2EYP A;  2E2J B;  2JK8 A;  2WB1 E;  3MXN A;  1IHZ A;  2F1M A;  5GQO A;  3CCQ A;  4RAU C;  4IPC A;  3CPW A;  5C4X H;  1Q81 C;  1BBX C;  1UUP A;  3I4L A;  4LMQ D;  4BS9 A;  5M5X H;  1O80 A;  2JXM B;  1N33 Q;  3I72 A;  3VR4 A;  1TKW B;  1L0W A;  1B50 A;  1STA A;  2QF7 A;  2AWO A;  3K8A A;  3MVV A;  3GTP H;  3RZO B;  1K8O A;  4FF1 A;  4XQN A;  2A8V A;  2VL6 A;  3DM3 A;  1DJR D;  3VYS A;  2R93 B;  2F0P A;  4X65 L;  2EYM A;  3FP9 A;  4WOR A;  1PH6 A;  2DJF C;  4C3I G;  1BOS A;  2JA7 B;  4K0K Q;  1RL2 A;  4O1N A;  3OWF A;  2R61 A;  1STE A;  2RSO A;  3SVM A;  4WJW A;  1QCB D;  4DUZ L;  5A2Q E;  5M5Y H;  3RNU A;  4JBK A;  1K3R A;  1KRS A;  2XVS A;  4B3S Q;  2UU9 Q;  2RDF A;  4JI4 L;  1RJT A;  5M5W B;  5D3I B;  1PTO C;  2I46 A;  1GVP A;  5D65 A;  4E6I A;  1AH9 A;  1F2M A;  2LSS A;  1IW7 D;  2PW7 A;  5JPM C;  4A3F G;  2OXP A;  3SK5 A;  1QVC A;  4X3S A;  1GHK A;  5JJZ A;  4BY7 B;  4DA2 A;  4DKA C;  1CSQ A;  4FF4 A;  3S1R B;  1LV9 A;  1M4V A;  2ICI A;  1PH8 A;  3VYT A;  1H9S B;  2IT1 A;  3H0G G;  3S2H B;  2F3V A;  3S16 B;  2A5H A;  5J3B A;  4LF6 L;  2C5C A;  3BVG A;  3PO3 H;  4CBV A;  2AMC B;  4A93 G;  1PZI D;  1O78 A;  1LT4 D;  5JAV A;  3CQZ H;  1OXT A;  1AZP A;  2Q2T A;  4JI3 Q;  1IL8 A;  3HOU H;  1T5X D;  4DV0 Q;  3SDZ A;  5IYB H;  1XTD A;  2NVX B;  2E76 C;  1U5K A;  1SRU A;  4C2M B;  1Q12 A;  1N8R C;  5C0X I;  1LTT D;  4DK1 A;  5IT9 E;  5IP9 H;  1PYS B;  2NBF A;  1GKH A;  4A3E B;  1PHJ A;  2KEE A;  1WTX A;  4CDD C;  2MO0 A;  1CHQ D;  1O7Y A;  1IKM A;  2CFM A;  2KCN A;  4IOA A;  2ZTE A;  5C5M A;  2NB0 A;  5D14 A;  2JE6 I;  4MN3 A;  1EZ8 A;  1IYU A;  4GKK L;  2HCC A;  3J7A F;  1XPO A;  3Q8D A;  4A4I A;  4LF7 L;  4QMG A;  1G29 1;  1IW7 C;  2H4O A;  3EQL C;  1STG A;  3CCV A;  3F8T A;  4QIW E;  3OW2 A;  4BBS G;  4ZK9 B;  1FR3 A;  3KOJ A;  2FJ2 A;  3FKI G;  3MTS A;  2VW9 A;  1I4R A;  1X6O A;  3TEH B;  3KLS X;  2MNA A;  1WTV A;  4NB3 A;  4L5R C;  3J80 i;  3MC0 B;  3TP5 A;  1CT1 D;  2JP1 A;  5FO8 B;  5C4J B;  2K01 A;  1D6E C;  2QKI C;  3CU7 A;  2BE5 D;  2UXB L;  3CME A;  2B2T C;  4OWT B;  4DR6 L;  3S2D H;  4N8F A;  2N55 A;  4IUU A;  2K5Q A;  2JA6 B;  2L55 A;  1DYQ A;  3VR2 A;  1Q90 A;  2K6A A;  4GNX A;  4HN7 A;  2KCT A;  2JA5 G;  4A3I H;  4HTH A;  3GTO H;  5BN3 A;  1QZG A;  1M1K C;  4KD3 A;  5C4H A;  4DV1 L;  1U4M A;  4X65 Q;  1UAP A;  5ELB A;  2V1C C;  4KKT A;  1SN8 A;  5A2Q L;  1K9M C;  3KYH C;  1TXY A;  1P16 A;  4X62 L;  1WTO A;  1G91 A;  1Y1V G;  1N9W A;  1TR5 A;  3IAY A;  5EKI A;  1EOV A;  4DUZ Q;  5M3F H;  4GZY C;  1GUW A;  1O7L A;  1E2V A;  1M8A A;  1TQO A;  3ZJY C;  3OMG A;  1HA6 A;  1EU3 A;  4JI4 Q;  2E2I H;  3AQQ A;  3MFY A;  3MEF A;  4RHS A;  5IOD A;  2JYO A;  1I4H A;  4B08 A;  3M7G A;  4HJ9 A;  1R9T H;  1TWH B;  4RGO S;  3SHL A;  1HTL D;  1YJ9 A;  1PH3 A;  5DEH A;  1BO0 A;  3GO5 A;  2AQ2 B;  3ERS X;  1NTG A;  1A62 A;  2YYZ A;  2PI2 E;  1W6J A;  1I6H H;  1S5F D;  3TZU A;  1NJI C;  2BE5 C;  5GAE C;  3DEP A;  3H94 A;  1NCV A;  3PMF A;  3S24 A;  2E2D C;  2M00 A;  4LF6 Q;  4BXX G;  5L37 A;  3AEV A;  3PO2 G;  2R92 B;  3HOW B;  3S1N B;  1EEF D;  4H44 C;  5IT9 L;  4OEL B;  5DAU A;  4KJO A;  4KY6 A;  2CQO A;  3CCR A;  1PA6 A;  2B39 A;  1VQN A;  4XT3 B;  1BR9 A;  1RIP A;  1UNS A;  4AQY L;  2KHS A;  3TP8 A;  2D0P A;  2ZJQ A;  4GN4 B;  1LO5 D;  2ICE C;  4ZUI A;  2SNM A;  3J81 c;  1CZG A;  4IQZ A;  4A3K H;  1WI5 A;  1PH7 A;  2EY1 A;  2NN6 G;  1X3Q A;  2UXD L;  2L5T A;  3I4M B;  4IAL A;  5AFW A;  1N32 L;  3RD4 A;  3Q24 A;  1HUN A;  1FD7 D;  2WKD A;  2B3G A;  4DK3 C;  4DR4 L;  1S5C D;  3HOV B;  4GKK Q;  1B4O A;  4P73 A;  5EQ0 A;  2OWO A;  2ZT9 C;  1S40 A;  1J5E Q;  1WCM B;  1PH5 A;  3VR5 A;  2X6L A;  1EZ6 A;  4NP5 A;  2L1B A;  1CKO A;  2WAQ G;  1X56 A;  4B9X A;  5K36 H;  1JC7 A;  3S1M H; 
#chains in the Genus database with same CATH homology
 2MGS A;  2KOL A;  5CYU A;  5COY A;  2KCC A;  1I4Q A;  1QB5 D;  4FXD A;  3HOZ B;  2NTT A;  2FHT A;  5IOC A;  2M2L A;  3HKZ B;  5IGF A;  3SXH A;  1TII D;  3IKJ A;  3CRL C;  3T4A C;  1V43 A;  3W3A A;  4V19 0;  2B63 B;  5I4D A;  1RD9 D;  4FF3 A;  3MZ5 A;  5CV5 A;  1SE2 A;  3E6Z X;  2DY8 A;  5G3L D;  1H9J A;  2VUM B;  1ENF A;  3SE0 A;  4A3J B;  4DAP A;  1LT3 D;  4EGV A;  3QOL A;  1F9Q A;  3TSS A;  4RWS C;  2EVB A;  1SYD A;  1STN A;  2IL8 A;  4EQO A;  1NR4 A;  2EJG C;  1XXG A;  1Y8N B;  1BF4 A;  3H91 A;  2LKV A;  4IZ8 A;  2E74 C;  2SOB A;  5E4W C;  3PO3 B;  3DEO A;  1WD1 A;  4LJZ C;  2EOT A;  5FK9 C;  1A15 A;  3NQI A;  4ME5 A;  3I73 A;  1A2U A;  3DXJ C;  2F0T A;  2Z4H A;  3FDT A;  3T56 B;  2V4D A;  2WV6 D;  3PUV A;  4XIG S;  4B9W A;  3K57 A;  1JWU D;  2Z1C A;  3GTJ B;  1II3 A;  4N9T A;  1I3Q B;  2KEC A;  4OO1 I;  3NWT A;  4XXE A;  2D9U A;  4F87 A;  3K59 A;  1A3V A;  1LTS D;  4PQX A;  3M4O B;  1TS4 A;  4NW2 A;  4KN4 C;  3LX0 A;  3D8G A;  1OXX K;  2KVM A;  3X3M A;  1U4P A;  3G6J B;  3TN2 A;  1SEB D;  2OEO A;  3URY A;  1L0Y B;  1QOH A;  1BDO A;  4F7X A;  1STY A;  1BQQ T;  1BCP B;  1OXU A;  1RF2 D;  3R2T A;  1G2S A;  3S1Q B;  3OIP A;  5J39 A;  4KK7 A;  4AYB B;  4ZKC B;  5M3F B;  4R8N A;  3HGB A;  1EY0 A;  3TBI B;  3A7A B;  2E2I B;  5F2D A;  2CHB D;  1K83 B;  4FP5 D;  2PZT A;  3OIQ A;  1JOK A;  1LAC A;  1HTP A;  5IGG A;  1ESR A;  4S3S A;  2BDO A;  1DON A;  3S14 B;  2K1B A;  3HOY B;  5FOB B;  3P75 A;  4DNR B;  5T1G A;  4TSS A;  1I4G A;  3WOF A;  1KDB A;  1AEX A;  1G6Z A;  5IIF A;  3R2I A;  4LAA A;  1QE6 A;  1EYD A;  1S5B D;  4C3H B;  3VR6 A;  4FXK C;  4CGY B;  4KKU A;  4DN4 M;  3NTI A;  1F9S A;  4P2C B;  3K0Y A;  4IFD G;  5CV4 A;  2HQE A;  2A6H D;  1CK1 A;  3A8I E;  3GTK B;  3DWP A;  4C1N K;  2F0H A;  2RKS A;  3MA2 B;  5G3L F;  3W2D A;  3QJY A;  1S5D D;  2RBM A;  4K6L A;  4IFD J;  1KTK A;  1EYA A;  3ONA B;  1E2Z A;  5C44 B;  4C3J B;  1WVL A;  1SXT A;  1CA6 A;  1OXV A;  4EQN A;  4PNY A;  2QDB A;  3J80 E;  3L7Z C;  4FO2 A;  1Q3L A;  1F9R A;  1D5M C;  1H9R A;  2RA4 A;  2XWB B;  4IUQ A;  3V2T A;  4CJ1 B;  4QF4 A;  3HRZ C;  4FVM A;  4UAI A;  2IX1 A;  4HCS A;  1NUC A;  2LY7 A;  3DWQ A;  2F0F A;  3H3V C;  1NSN S;  3IFT A;  4H0L C;  2AUK A;  1HRJ A;  4KN7 C;  3IL8 A;  3SEB A;  3Q23 A;  4F88 A;  5M3M B;  3TDQ A;  1JIC A;  3HEJ A;  3C2P A;  2WIN B;  2A6H C;  4CKB A;  5CV6 A;  3I90 A;  4IN3 A;  1ET9 A;  3GTM B;  3GD7 A;  2I07 B;  4XYO A;  3TZD A;  1G2T A;  2NZ1 D;  3D4W A;  5BN4 A;  3VYR A;  4ZAI A;  3M3Y B;  1SYG A;  1GUT A;  1VMP A;  2A69 D;  2XRQ D;  4IUT A;  2EYL A;  2F4I A;  4J1M A;  2VB2 X;  2O4X A;  2F0O A;  3S15 B;  1NAP A;  1PXU A;  1TWF B;  4DFA A;  1VDZ A;  3MXU A;  1GJX A;  1CZW A;  2QIL A;  4ZLT F;  5ELC A;  4G4K A;  2F0G A;  1ROD A;  2NVY B;  5HUR A;  2SDF A;  3T13 A;  5JEA H;  1HHV A;  5T1I A;  1RCV D;  1L0X B;  2PZW A;  2JA8 B;  4QUF A;  3A7L A;  5EBC A;  5I9O A;  3K5M A;  2F0K A;  4IUV A;  1EY5 A;  2K05 A;  1SYB A;  3HZX A;  1RDP D;  1X32 A;  3GQB A;  2IX0 A;  3A56 A;  4A3B B;  3CKI B;  1U4R A;  3NPP A;  2NYZ D;  4JBW A;  2HDL A;  1SDF A;  1UEA B;  3AMU A;  4KV6 A;  1GHJ A;  5IGD A;  3J80 L;  1PLF A;  2A69 C;  3DHQ A;  3Q22 A;  1Y69 U;  2O5J C;  1SYF A;  5JEA J;  4XTC S;  5ELD A;  4BA1 I;  2TMP A;  2WAC A;  2Q8R E;  2IPK D;  1TS5 A;  4OIK A;  3A8J E;  1EWH A;  4NDX A;  2EDG A;  4OGQ C;  2K03 A;  2MP1 A;  3M85 A;  1TWC B;  3EVQ A;  2IJ0 A;  5KYL A;  3D6W A;  3KUP A;  3X3N A;  1KAA A;  2RVL A;  1WD0 A;  1A3U A;  1JQY D;  2F0I A;  1Y8P B;  4Q5V A;  1F2Y A;  1MSH A;  4LK1 C;  3PIO 3;  3K6O A;  2F0S A;  4QCL A;  1PMR A;  2C9O A;  2ID0 A;  4K6D A;  4CKE A;  1ENA A;  3OMC A;  2G9D A;  5ELF A;  1LAB A;  4N9P A;  2YU9 B;  1B2T A;  2PMZ B;  2E75 C;  4FNF A;  4OO1 H;  5BN5 A;  4L8J A;  5EJW A;  2NVT B;  1WTR A;  2J0T D;  3CRK C;  3I4N B;  1HXY D;  4V0B A;  3BS1 A;  4RGN A;  2LS0 1;  4KTA A;  2JEB I;  5KNB A;  2E2H B;  4PMW A;  1H9S A;  3ERO A;  4L63 B;  5EKK A;  1KLU D;  2XNA C;  2FIN B;  2KUM A;  1EL0 A;  1ML0 D;  5C4Z A;  1Y8O B;  1SNP A;  3GP7 A;  2L11 A;  3HOX B;  1SBB B;  2EXZ A;  3J81 E;  2DN8 A;  1U9R A;  3MAQ A;  1SJE D;  1TT2 A;  3EFX D;  4RGT A;  1KAB A;  3D4R A;  3MXP A;  4ZQ3 A;  2H1E A;  1MD2 D;  4ZUJ A;  1D5X C;  3O13 A;  4A3M B;  1KLG D;  2KQ3 A;  3QO2 A;  1YNN D;  4ID6 A;  2DNE A;  1LTR D;  3GTG B;  4G7Z C;  1PTO B;  2M9V A;  2F0Q A;  1E2W A;  3J7Y W;  2BA0 A;  5CV8 A;  4PMB A;  3DM1 A;  1JOO A;  5K36 G;  5FKA C;  5C6A A;  3OHX C;  2MPM A;  3I8Z A;  1EWC A;  4FYD A;  1I6V C;  3BYT B;  1EOT A;  1CTM A;  1LLR D;  1SNQ A;  3ND9 A;  4K5V A;  3TP6 A;  3LWU A;  1AW7 A;  4C3I B;  5JVH 3;  1ESF A;  1SE3 A;  4DU9 A;  1QIL A;  3P20 A;  4H7B A;  4RA8 A;  5E3F A;  3V05 A;  1E0B A;  1ICW A;  2B8G A;  3J7A V;  1YNN C;  1V1P B;  3MEH A;  2K5D A;  2L0C A;  1R4Q B;  4ZYS A;  3VA5 A;  2F3W A;  5CV9 A;  3TME A;  5E1F A;  1TS2 A;  4TKO B;  4O42 A;  3H0G B;  3QB3 A;  1CM9 A;  5CV7 A;  2L4N A;  3D3R A;  1HQR D;  1PZJ D;  4A93 B;  1ET6 A;  1EIG A;  4H13 C;  3J81 L;  4EQP A;  1PRT B;  2SEB D;  3VR3 A;  4I7Z C;  3P1H A;  1J9O A;  4KY7 A;  2BA1 A;  3PUX A;  1BCP F;  1SFO B;  2TSS A;  2PYK A;  4K2K A;  1GUS A;  3VA7 A;  5KRU A;  3IFD A;  4EVO A;  3PUW A;  3UI2 A;  2X69 A;  2Q8I B;  1GUG A;  4IUP A;  5EPK A;  2CW0 D;  4JK1 C;  4BBS B;  4XQJ A;  1LTI D;  3AU7 A;  2QEJ C;  3FKI B;  2WKC A;  3NXW A;  1D1K A;  4DAV A;  1VMC A;  2MJ8 A;  2EZV A;  1C8C A;  4BA2 I;  2JA5 B;  3N6R A;  4IUR A;  4K5W A;  1HFN A;  1HA5 A;  5JOB A;  3GTL B;  2AQ1 B;  2NN6 I;  1ILP A;  2F0L A;  3ITP A;  1CQF A;  1Y1V B;  2GA4 B;  3R3O A;  2J4X A;  2Z8L A;  3C1F A;  3T53 B;  2XIW A;  1DZ1 A;  5C0X H;  4X3U A;  3JAM E;  3NBH A;  2CW0 C;  1VF5 C;  5ISR A;  4FXG C;  3PV0 A;  1EY8 A;  4OIJ A;  1TY2 A;  3K58 A;  1MBY A;  2KA7 A;  2O5I C;  3KF8 A;  4UDU C;  1IYV A;  3OWE B;  5JPN C;  2RDH A;  4ABN A;  4KKS A;  4XT1 B;  3K5O A;  3RZD B;  4ULL A;  4RKB A;  3OSO A;  2IWH A;  3Q0A A;  1OO9 B;  1WTP A;  1Z7T A;  1C48 A;  3BZD B;  2B2Y A;  1JE4 A;  3FMC A;  3PO2 B;  3K7A B;  3ZYY X;  2R7Z B;  2HCI A;  1JB3 A;  3FPU B;  3BDO A;  4L6T B;  5C0X J;  2LFN A;  2N88 A;  2KED A;  1ONL A;  2K04 A;  5I2X A;  1D5Z C;  1ILQ A;  2VB3 X;  1EU4 A;  2RSN A;  1PFN A;  2OT2 A;  1KDC A;  3EA6 A;  1XTC D;  4HMJ A;  4XYQ A;  2BOS A;  4I65 A;  2B2W A;  3NK9 A;  5C5L A;  1F2Z A;  5CGK A;  5IGB A;  4J6H A;  2WAQ B;  2EY6 A;  2F0D A;  3OW7 A;  2MHV A;  4A3D B;  1GUO A;  4KD4 A;  4DXG A;  4RKL A;  1QJO A;  2A74 C;  4XQQ A;  1HPC A;  1EEI D;  1FYC A;  4J8Q A;  3KK7 A;  1PTO H;  3KLR A;  1RTN A;  5LL6 S;  2EY5 A;  1PZK D;  1JWM D;  3D4D A;  2D2C C;  1B1Z A;  2PCF B;  1QG7 A;  1PTO D;  1F9P A;  1DOL A;  5EBD A;  2J7Z A;  4RFB A;  2K33 A;  1GUN A;  3LWE A;  1HFG A;  3JAM L;  1SYE A;  3K5L A;  3NQT A;  1RTO A;  4K8J A;  4BBR B;  1Y1W B;  1B3A A;  1T5E A;  4C1N I;  1MSG A;  2EYO A;  3D6C A;  2ZXO A;  2EE1 A;  5C3W A;  1ZXT A;  2ZXR A;  2FMC A;  1FNW A;  3E5S A;  1HCZ A;  3R93 A;  4DAY A;  3MFG A;  4G7H C;  1Q8I A;  1KNE A;  2B2U A;  4QB4 A;  3C3L A;  5FO9 B;  4IUN A;  1D2B A;  3C1E A;  1CFM A;  2FFK B;  3SK6 A;  3N52 A;  4K8I A;  1LT5 D;  3S17 B;  3F2U A;  1SMY D;  1Z47 A;  5EPL A;  4KHV A;  2A6E D;  3U9O A;  5C3E B;  3NE5 B;  3BVM A;  2D5D A;  1OXS C;  5JEA G;  1HUM A;  1I4P A;  1X3P A;  4DF7 A;  1GOZ A;  1AZQ A;  4XDX A;  2PW5 A;  2Q8T A;  2K7V A;  1PRT D;  5I6W A;  5CC4 A;  1SYC A;  1STB A;  1RHP A;  1SNM A;  2EY2 A;  1FNV A;  3NTH A;  5EGT A;  4RH6 A;  4X3T A;  4WFN 3;  1DD2 A;  1TWG B;  1C4Q A;  2JSO A;  4U68 A;  1F2L A;  3ERQ A;  3L3O C;  3QOJ A;  3C46 A;  3A54 A;  3HG9 A;  1DXM A;  5CMD A;  4QUC A;  2B2Y C;  1B53 A;  1PDQ A;  1SMY C;  4IFD I;  2NWG A;  3RLF A;  2A6E C;  3QG1 A;  2VNU D;  1DCZ A;  4PV1 C;  4R9W A;  2L9H A;  2DY7 A;  2K28 A;  3WDN A;  1TWA B;  1BCP D;  1PRT C;  4ILW A;  2WB1 B;  5JVG 3;  1TU2 B;  3NWS A;  1MGS A;  1B9M A;  3NP8 A;  2OF1 A;  2NUC A;  3FVQ A;  2B2W C;  4PMC A;  1VF7 A;  2XSC A;  2EYH A;  3CHB D;  5KIX A;  1U4L A;  4MHE A;  3A55 A;  1SE4 A;  2QCP X;  2HUG A;  4HAE A;  5KYI A;  3FRP B;  3G7L A;  5FO7 B;  1I50 B;  1JR0 D;  5D3D A;  1JOR A;  4KHZ A;  1K8M A;  4M8A A;  4RHR A;  2F0J A;  4HR7 B;  3DWA A;  3ND8 A;  4OO1 G;  4A3G B;  2JEA I;  1EFI D;  2EYJ A;  4HCE A;  1CI3 M;  1S5E D;  1ENC A;  2PQE A;  3MHB A;  5EKL A;  5J22 A;  4DNT B;  1BXT A;  1PTO F;  1GXD C;  1Q1E A;  4X3K A;  3PUZ A;  2RDG A;  1H9M A;  1SJH D;  3V96 A;  2NVQ B;  3I3C A;  3H6M A;  2HDM A;  1QNK A;  1BCP C;  5C3X A;  4TRD A;  4BWG B;  1LTA D;  4G57 A;  1QWY A;  2F0U A;  5CBE E;  3SK8 A;  2A73 B;  3NUC A;  4C3H G;  3DMU A;  2NN6 H;  1ZYR D;  2ENB A;  4BY1 B;  4F8M A;  2K32 A;  4RCN A;  5KGU A;  1PYW D;  4ZRZ A;  1W6K A;  5EPJ A;  3L9A X;  4HSV A;  5A35 A;  1SND A;  1XYI A;  3MWY W;  4DGZ A;  4DXF A;  5K5P A;  2B8F A;  1XX8 A;  3NTK A;  2B2V A;  3LNN A;  5E4X A;  3NSW A;  3PUY A;  5KEE A;  2B2U C;  1TVX A;  4M1U B;  4C3J G;  1G8Z D;  3A8K E;  5C4X B;  1SSO A;  1EYC A;  3R8B A;  1EY7 A;  5IGC A;  5M5X B;  4G7O C;  3KBG A;  3I70 A;  3K5N A;  2F03 A;  4QIW B;  1JCK B;  1EY9 A;  1FNU A;  3SK4 A;  2EJM A;  4K2L A;  2LMC B;  3GTP B;  3RMH A;  1I4X A;  1ZYR C;  2F0E A;  1DOK A;  5KND A;  4Y7N B;  1PRT F;  2BDN A;  3BVZ A;  1Z6H A;  1EY4 A;  1V1O A;  4KY5 A;  1NR2 A;  1RKN A;  4CHT B;  3I91 A;  1SNC A;  4A3F B;  1KDA A;  4KMU C;  1S4Z A;  4YIJ A;  1O7Z A;  5M5Y B;  3NHH A;  4U67 3;  2NTS A;  4RCO A;  4OHJ A;  1PFB A;  2X6G A;  1SAP A;  3M4Y A;  5J1Z A;  1H9K A;  2D62 A;  2F0M A;  3OOC A;  3GV3 A;  3BDL A;  3BYY B;  1MI2 A;  3RUZ A;  4Z9C B;  2ZXP A;  3BDC A;  5TSS A;  4FF2 A;  1Q1B A;  5DNF A;  1VCI A;  5IGE A;  3CQZ B;  4TQU S;  3HOU B;  5DM6 3;  2BCO A;  1CHP D;  2XRS D;  4CJ0 B;  2CQA A;  2K5W A;  3E0J A;  2CVR A;  1WTW A;  1WTQ A;  3VYU A;  2Y0S B;  2XN9 C;  2AUJ D;  3FPP A;  3M7N A;  3D31 A;  2Z4I A;  1YNJ D;  1A2T A;  3EJI A;  2L12 A;  4CJ2 C;  2XWJ B;  5I6Y A;  1J8I A;  4ZKB B;  1ZKO A;  1FGB D;  2EPB A;  1TY0 A;  4ODG A;  5ELE A;  1KNA A;  1EQV A;  1AP0 A;  3HP3 A;  2F0W A;  2SNS A;  5FLX E;  2WP8 J;  1QNU A;  3S2D B;  4DK0 A;  3GV6 A;  3T51 B;  1EIH A;  3GTQ B;  4HSP A;  4R8I A;  1A3T A;  4A3I B;  3GTO B;  1LT6 D;  3QWN A;  1B44 D;  3OPO A;  1SNO A;  1JOQ A;  2PPB C;  3HS0 C;  1PFM A;  1IKL A;  5HGT A;  2PNR C;  4NKL A;  1AN8 A;  1JWS D;  5NUC A;  2IW3 A;  5I2Y A;  3KBX A;  5CBA E;  1DOM A;  1YNJ C;  5C0X G;  1B9N A;  2KJX A;  1STH A;  1CA5 A;  4MIU A;  1V1P A;  1R9T B;  2A68 D;  2DNC A;  5I9P A;  2B2V C;  5LHY 1;  2RQX A;  4K5X A;  3KLS A;  2PZU A;  4K14 A;  3T16 A;  1ZEQ X;  4KI0 A;  2R6G A;  1I6H B;  3WOE A;  1BUV T;  2AWN A;  4KJN A;  3U9S A;  3BG3 A;  2F0N A;  1HQM C;  4IFD H;  1CQV A;  4NMZ A;  5KNC A;  1A6X A;  2B2T A;  1LTB D;  1LTG D;  1V8Q A;  5M9O A;  4CKC A;  4HED A;  1EY6 A;  3DUZ A;  4A3K B;  1EQT A;  3P7J A;  2EJF C;  4OL7 A;  1XWE A;  2PO4 A;  2IX3 A;  1AFP A;  1R4P B;  2WII B;  1DM0 B;  4WRD A;  3H09 A;  1F77 A;  4Q0F A;  2A68 C;  2G9H D;  4RGM A;  5FLX L;  5CR3 A;  1BNZ A;  2EYF A;  2F0V A;  3S1M B;  4C56 C;  3AB9 A;  1TS3 A;  3Q6S A;  3FEW X;  2FMM A;  2MUY A;  3TP7 A;  5DM7 3;  2VXW A;  1D1I A;  3QIA A;  3SR1 A;  2AQ3 B;  3MXG A;  5LL6 X;  2R3Z A;  3S9W A;  4HMI A;  3PIP 3;  5COR A;  3NBI A;  2O2L D;  2EYP A;  2E2J B;  3MXN A;  1IHZ A;  2F1M A;  4RAU C;  1BBX C;  1UUP A;  3I4L A;  4LMQ D;  4BS9 A;  1O80 A;  2JXM B;  3I72 A;  3VR4 A;  1TKW B;  1B50 A;  1STA A;  2QF7 A;  2AWO A;  3MVV A;  3RZO B;  1K8O A;  4FF1 A;  4XQN A;  3VYS A;  1DJR D;  2R93 B;  2F0P A;  2EYM A;  4WOR A;  4C3I G;  1BOS A;  2JA7 B;  4O1N A;  3OWF A;  2R61 A;  1STE A;  2RSO A;  3SVM A;  4WJW A;  1QCB D;  5A2Q E;  2XVS A;  2RDF A;  1RJT A;  5M5W B;  5D3I B;  1PTO C;  2I46 A;  5D65 A;  4E6I A;  1F2M A;  5JPM C;  1IW7 D;  2PW7 A;  2OXP A;  3SK5 A;  4X3S A;  1GHK A;  5JJZ A;  4BY7 B;  4DA2 A;  4FF4 A;  3S1R B;  1LV9 A;  1M4V A;  2ICI A;  3VYT A;  1H9S B;  2IT1 A;  3S2H B;  2F3V A;  3S16 B;  2A5H A;  2C5C A;  3BVG A;  4CBV A;  1PZI D;  1O78 A;  1LT4 D;  5JAV A;  1AZP A;  1OXT A;  1IL8 A;  1T5X D;  3SDZ A;  2NVX B;  2E76 C;  4C2M B;  1Q12 A;  5C0X I;  1LTT D;  4DK1 A;  5IT9 E;  2NBF A;  4A3E B;  2KEE A;  1WTX A;  1CHQ D;  1O7Y A;  1IKM A;  2KCN A;  5C5M A;  2NB0 A;  5D14 A;  2JE6 I;  4MN3 A;  1EZ8 A;  1IYU A;  2HCC A;  3J7A F;  4QMG A;  1G29 1;  1IW7 C;  2H4O A;  3EQL C;  1STG A;  4ZK9 B;  1FR3 A;  2FJ2 A;  3MTS A;  1I4R A;  3KLS X;  1WTV A;  3MC0 B;  3TP5 A;  1CT1 D;  2JP1 A;  5FO8 B;  5C4J B;  2K01 A;  1D6E C;  2QKI C;  3CU7 A;  2BE5 D;  2B2T C;  2N55 A;  4IUU A;  2K5Q A;  2JA6 B;  2L55 A;  1DYQ A;  3VR2 A;  1Q90 A;  2K6A A;  4HN7 A;  4HTH A;  5BN3 A;  4KD3 A;  5C4H A;  1U4M A;  1UAP A;  5ELB A;  4KKT A;  5A2Q L;  1G91 A;  1WTO A;  1TR5 A;  3IAY A;  5EKI A;  4GZY C;  1GUW A;  1O7L A;  1E2V A;  1M8A A;  1TQO A;  3OMG A;  1HA6 A;  1EU3 A;  3MFY A;  4RHS A;  5IOD A;  2JYO A;  1I4H A;  4B08 A;  3M7G A;  1TWH B;  4RGO S;  3SHL A;  1HTL D;  5DEH A;  1BO0 A;  3GO5 A;  2AQ2 B;  2YYZ A;  1W6J A;  1S5F D;  3TZU A;  2BE5 C;  3DEP A;  3H94 A;  1NCV A;  3PMF A;  2E2D C;  2M00 A;  2R92 B;  3HOW B;  3S1N B;  1EEF D;  4H44 C;  5IT9 L;  5DAU A;  4KJO A;  4KY6 A;  2B39 A;  4XT3 B;  1BR9 A;  1UNS A;  2KHS A;  3TP8 A;  1LO5 D;  2ICE C;  4ZUI A;  2SNM A;  1CZG A;  4IQZ A;  2EY1 A;  2NN6 G;  1X3Q A;  2L5T A;  3I4M B;  4IAL A;  5AFW A;  3RD4 A;  3Q24 A;  1HUN A;  1FD7 D;  2WKD A;  1S5C D;  3HOV B;  1B4O A;  5EQ0 A;  2ZT9 C;  1WCM B;  3VR5 A;  2X6L A;  1EZ6 A;  4NP5 A;  2L1B A;  4B9X A;  5K36 H;  1JC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...