3J7AV

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
156
structure length
146
Chain Sequence
DVQHERAYQKQEGASFFNSKRYWKKVGLGFATPKEAKEGVYVDKKCPFTGNVSIRGRILKGMVISNKMKRTIIIRRNYLHYVKKYNRFEKRHKNIPCHCSPCFDVKEGDIVTVGQCRPLSKTVRFNVLHVEKHQIFGSARKQFVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 20
structure length 146
sequence length 156
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00366 Ribosomal_S17 Ribosomal protein S17
V PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j7aV00
5LL6X 5IT9L 3J80L 3J7AV 5A2QL 5FLXL 3JAML 3J81L
chains in the Genus database with same CATH superfamily
4A3IB 3OWEB 4DK0A 4HSVA 1AE2A 4J15A 1JE5A 2JA5G 2DJGC 1BDOA 4KD4A 1H9KA 1AN8A 5IT9c 1MKHA 2NYZD 3TZUA 3CMAA 4IN3A 5KNCA 4HIDA 1VQ8A 2KHJA 4LF6Q 4QGUA 2GVBA 1H9SA 2Z0SA 4GOPC 4E6IA 1CKNB 1PH5A 5C0XJ 4X3UA 4LUOA 1SROA 1Q3LA 4DR4Q 4F7XA 4RH6A 3HRZC 2NVXB 1WCMH 1EWHA 3CF5A 4U68A 1J8IA 3CCRA 4G4KA 2K5NA 3E3XA 1FNVA 3X3NA 3ZJYC 3G6EA 4DR3Q 1OXSC 4CJ1B 2UXBQ 3DLLA 4WFN3 1TWFH 1E2WA 2A69D 4A3MH 1K8GA 1M8AA 5BR8L 4NW2A 3AFPA 2EYLA 1AEXA 1UE1A 4B3RQ 2B2VA 2L55A 4CKCA 2N88A 4X66L 5IGCA 4BY7H 1F9RA 4DV5L 3NELA 4XQQA 1W3SA 5COYA 1GXDC 1Q1EA 3JC66 2AUJD 3K7UC 2GA4B 3HOXB 1HRJA 1RKNA 3OW2A 1S5CD 1C48A 5C5MA 1CZWA 4JI7L 4RGTA 1FJGL 3OYYA 1NMGA 1A0IA 4KLKA 4CDCC 2JA8B 3L2PA 4JYAQ 5E1FA 2F0SA 1PTOF 5EJWA 1LTBD 1PLFA 3DWQA 2VNUD 1LO5D 4LNQA 2CFMA 1M90C 2JA6G 3HKSA 3TP5A 4OX9L 3BYYB 4GLVB 1F9PA 3KF8B 3NWSA 2DY8A 1EWIA 3NHHA 2K33A 3H15A 3J81E 3M4PA 3EVQA 4R8NA 1V43A 4QJFA 1S5FD 5ELOA 2LXKA 4EVOA 2A69C 1Q8IA 2KJXA 2EVBA 1BCPF 2F0TA 2TMPA 1SNCA 3S1NB 1LTRD 5CV7A 3RR5A 1QILA 3OW7A 2E2IH 4DV1L 3N52A 2HD3A 4DK1A 4LF5L 4DR7L 1XNRL 3VYUA 1SN8A 3EN2A 2O5IC 1EY4A 3IKJA 3S9WA 3I91A 2EY6A 3FHWA 3HP3A 3P20A 4FO2A 2VS1A 3G48A 3GV6A 2CQOA 5IIFA 5KNBA 4BY1H 2NBFA 3GTQH 2QF7A 1U4RA 1RTOA 3N6RA 5M5XB 1FD7D 2G9DA 1WD0A 2R61A 2BCOA 2Q2UA 1GOZA 1VQAA 2ZXOA 1BUVT 4YCVA 4AYBB 2NVTB 1XJVA 2Z4HA 1SAPA 3I4MH 1MBYA 2F3WA 4F88A 1R9TB 1CQFA 4CKEA 4FF2A 2PW5A 1SR3A 4C3JB 1JT8A 2CW0D 4C56C 1KAAA 5M3FH 4A3EB 3TSSA 3K7AB 3PO2B 1ESRA 1YJ9A 1BF4A 1XTCD 2L9HA 4O42A 3VA7A 2JEAI 1S5DD 4H0LC 3SR1A 3K57A 2JA7H 3HOWH 3GTJH 1UE6A 3TS0A 1SE8A 3F2BA 1YHAA 1CHQD 2V1CC 2D62A 1PFSA 5JPNC 2B2TA 3HOZB 4LK1C 2RHSB 1C0AA 4A3FG 3CPWA 3G6JB 1EIFA 4OWXB 1EWCA 1SSOA 2WAQG 4MZ9A 4EX5A 4IUQA 1U4MA 4YWMA 3F2CA 4J6HA 4P71A 2KEDA 5IT9L 4RGOS 4IJHA 1N34Q 1SRUA 1B9MA 2B2UC 3E0EA 4OIKA 1NJIC 1TWGB 5ISRA 4UHVA 4BBRB 2CW0C 1EU3A 3ITPA 5IYDG 4PMBA 2F1MA 4HJAA 2CHBD 3PF5A 1VQDA 2YU9H 2ZXRA 4RG1A 4NB3A 1WTWA 1WFQA 1WYDA 1XMOL 5IE8A 1MJEA 3WOEA 3TDQA 4GNXB 1EOTA 2K4KA 4EQOA 5DM63 4K5VA 3AEVA 2Q8IB 3TRZA 1LTLA 3VR5A 4B9XA 5GAHC 5E4WC 1VF5C 4JI4L 4H13C 3GTPH 2YYZA 1N33L 1VQMA 5FJ8G 4X3TA 2N49A 2NVYH 4IPCA 4C2MB 5FLXc 2VW9A 2J4XA 4JBWA 3A8KE 3NPPA 4FP5D 1CKMA 4K2LA 2F4IA 2OTJA 2JEBI 2UUCL 4A3BB 2MP1A 1GUWA 2PZWA 5I9PA 5EPLA 2FINB 4R1JA 1E22A 1SYFA 4ZAIA 2Q2HA 2A1AA 2XRQD 1VQ6A 2Z6KC 3A56A 2Z9HA 2PI2E 2RSNA 2QKIC 1QB5D 3TP6A 2PYKA 1RIPA 1GJXA 1WTQA 5KYIA 5JEAG 2NN6G 4LF7L 3I56A 1SYGA 4DAVA 3CRLC 2JA9A 1TQOA 3VR3A 4LFBL 3U50C 2HT1A 5D65A 1EQTA 1WCMB 1STEA 3E0JA 5C4XG 5GAGC 3JAMi 4XT1B 2ZJQA 4B3ML 4GOPB 1ILPA 1IHZA 4KKSA 5ELBA 1BBUA 1QG7A 3NBHA 2PQEA 1F2YA 4N8X1 3UDXA 5ELCA 2Z4IA 3K0XA 3SEBA 1TWFB 2E2JH 2K5QA 2AQ1B 4C3JG 4A3MB 1N36L 1YJWA 3OMCA 5I6YA 1YNND 4BY7B 4JI5Q 3R8BA 2K52A 1KDCA 4JI1Q 3RZDH 1IKLA 4S3SA 1KNEA 2EXZA 2QA4A 3PF4A 1TT2A 3LWUA 3GD7A 2I5MX 5CGKA 3ERQA 3F2UA 2WAQE 3A8IE 3T56B 3AFQA 1WTXA 2WB1B 2HQLA 1TS3A 1PRTD 2WINB 5H1SE 1NMFA 2A5HA 5IGFA 4C3HG 4AH6A 1TS4A 4QB4A 1Q8KA 3PO3G 3KFUA 4C3IG 1HNZL 3I4NG 1A2UA 1KL9A 1LTGD 1HZBA 4R4TA 2UUAQ 4AQYL 1SBBB 3TBIB 4DUZQ 4R8IA 3AYHB 3KLSA 5JJIA 3FEWX 1JORA 4A75A 1E1OA 1ZEQX 1JWSD 1TIID 1K3RA 2IW3A 1YNNC 4RGMA 5F2DA 4OO1H 1ENFA 2E2IB 4DKAC 1P8LA 1PZJD 3L0OA 4ZLTF 2CH4A 2GN5A 3J80c 3CCVA 2XGTA 2R6GA 2UUBL 2KA7A 2I5LX 3ICEA 4LFAQ 4A93H 5BN3A 1PH8A 2D0PA 3KLRA 1ML0D 3UE1A 1Y1VH 1IBKQ 3W1BA 1NSNS 3MZ5A 4DV6L 4BY1B 4N9TA 1V1PB 3BU2A 3GTQB 2MO1A 1SE4A 4A3CG 5TSSA 1NAPA 3BYTB 4Y52H 3U4VA 1KXLA 2AWOA 1Z6HA 3I4MB 1B7YB 1VMCA 4K0KL 2YTXA 3T16A 2K05A 5FLMH 1GUNA 5C3XA 1STYA 5M3FB 4WRDA 1G2SA 2B2WC 4QL5A 4RCNA 1II3A 2B8GA 1XNQQ 1K28A 1MD2D 5JVG3 3DEPA 4RA8A 2DNEA 3PUXA 2CCZA 1PVOA 3GO5A 3MFYA 3D3RA 1SEBD 1MSGA 3OHXC 5C0XH 1CA5A 4HIKA 2ZXPA 4AYBE 1HNXL 2JA7B 3HOWB 3GTJB 2F0IA 1RD9D 5I4DA 1QZHA 2JP1A 5FLXL 3GTMH 2KCMA 1AW7A 2PNHA 1J5EQ 4UAIA 2LKVA 2Q8TA 4RWSC 5C44G 1HNWL 2KCTA 3K0YA 3I90A 4XIGS 1WOCA 4YCUA 4ME3A 4JI3Q 2UU9Q 5J22A 5J39A 3MXNA 2I46A 1IBMQ 1Q82C 2X6GA 3SXHA 4GZYC 4N9PA 5EAYA 4HTHA 2P5ZX 2FMMA 4DGZA 1JQYD 2EY1A 3GDEA 2VQEL 5CR3A 5IWAQ 2PZUA 2RHQB 2B63G 3HKZB 1X3QA 3OIQA 1AP0A 1HFGA 5JAVA 2IL8A 5IGGA 4HMJA 2UXDL 1HUMA 1EY8A 4B08A 1Y8PB 4A3KH 3CCUA 4JI0L 1LT5D 3C46A 2EJFC 4M8AA 1JOOA 4A3JH 2DN8A 4GN3B 4DV0Q 3QOLA 2DY7A 3MHBA 1QCBD 4JVZA 4DR5L 2YU9B 3M85A 4EGVA 2R7DA 3A74A 4P74A 2EYOA 4OWWB 2WP8J 4GN4B 3M7GA 1V9PA 1K3BC 2F0NA 4A3DG 1B53A 2Y0SB 1MI2A 2HHHQ 1M4VA 3H94A 4LFCL 1EFID 3ONAB 2EE1A 3GTPB 1Y1WH 3MVVA 3SK5A 4APVA 3L3OC 4L5QA 5D3DA 2CWPA 2R92G 1T5EA 1YNJD 2NVYB 4ZQ3A 5IYBG 4J1MA 2VUMH 3BDOA 1IW7D 1VQHA 5M3MH 1FVIA 2B2TC 2RSOA 3VYRA 1Q86C 3FKIG 3MTSA 1PTOH 2L11A 2IX3A 4LF9Q 4NXMQ 1K73C 1X65A 2FHTA 3FDTA 2OXPA 2IHFA 1KLUD 1TKWB 2WKDA 4MNOA 1HPCA 5I2YA 1NTGA 4JBJA 2K5VA 3NSWA 1XMQL 5IP9H 1Q90A 3A5UA 2VQFL 3DMUA 2E5LL 2PNRC 2N78A 4XXEA 3CPFA 4DK3C 5LHY1 3M9BA 1VQNA 3HOUG 3PUZA 1CSPA 2UXCL 2K01A 1ILQA 1XTDA 4OONA 5ELDA 5CC4A 1J9OA 3QB3A 2MQHA 1CSQA 2WIIB 1SE2A 1SNQA 1SNOA 3H3VC 3AU7A 4QUFA 3IFDA 2K14A 3PIO3 4IZ8A 2LFNA 1EIYB 2X69A 4GKKL 1KRSA 3RLNA 1KD1C 2IPKD 3TS2A 1H9RA 3VYTA 4KHPL 2E2JB 4X65L 3DUZA 1YNJC 3U9OA 2F0MA 4X62Q 3MC0B 1Q7YC 4R4OA 1EL0A 4K6DA 3KDFB 2DNCA 1X3PA 4OGQC 4U673 1IW7C 1I94L 1B50A 2A73B 4TVAB 3RZDB 1BVSA 3MAQA 3BG3A 5FKAC 3CCJA 1EY0A 2JYOA 3S24A 2O2LD 1PV4A 4YY3L 2IX0A 5M5WH 3ULLA 4FF1A 4KN7C 2PMZE 1K0RA 2F0HA 1L0YB 1YI2A 4ILWA 1WTPA 2KCNA 5FK9C 1SYDA 3M4YA 2HDMA 5D14A 3FMCA 3SK8A 2HUGA 5BN5A 1S5BD 4XTCS 4GLAC 2EJGC 4X66Q 4DV5Q 1IL8A 4YHHL 5T1IA 1GHKA 3BZKA 4OELB 4I65A 2C9OA 2KVMA 2L5TA 1PH3A 5CBEE 1NNXA 1ASYA 3E6ZX 3VR4A 4LF6L 1VQOA 1VQGA 5JEAJ 1Q81C 1FJGQ 1H9SB 1EU4A 3H0GH 4DR4L 1DOLA 4P72A 4FXDA 2NZ1D 2BH2A 1X32A 1JWMD 2ZM6L 3UDIA 1LLRD 1GVPA 3RNUA 4A93B 4OX9Q 2B3GA 1HQRD 4LF4L 1IBLL 1HTPA 1BKBA 2RCFA 2MFIA 3ZYYX 1SMXA 1Y1VB 3HOVH 4A3GG 1JC7A 3GP7A 5A2QL 3DWAA 1F9QA 4IOAA 4B3RL 1HUNA 3CQZH 1D5MC 5DAUA 4POGA 2R7ZH 5M5YH 5IYCH 3IFTA 4JBKA 2PCFB 4ZKBB 5CBAE 4BA1I 3GTLH 1PRTB 2JE6I 1FGBD 1KQSA 4DV1Q 1E2ZA 2R93G 2E2DC 4BXXG 3BVGA 2EY5A 4DR7Q 2KBNA 1XNRQ 2F0QA 4F8MA 3QIAA 2N8NA 2K5HA 1JICA 1VQIA 1D5ZC 3HOYH 1F77A 3RUZA 2D9UA 1A63A 1BQQT 3QJYA 1NE3A 1EYCA 2CWAA 1C8CA 1KAWA 1R4QB 3KK7A 3PSIA 1TWAH 2G9HD 3GTMB 2F0VA 2L12A 4JV5L 3HEJA 2SNSA 1YHBA 3PMFA 3WWVA 5C4JH 2EYJA 3CCSA 1BBWA 4BBSG 1B3AA 3IRBA 3GTKH 1F2LA 4HEDA 1CQVA 1WD1A 1ONLA 2MNAA 4JOIC 3SVMA 4K8JA 1EOVA 1RL2A 2F0WA 3NWTA 4OEMB 4UP9A 4BWGB 1VQ7A 3ULPA 4P73A 1PMRA 1GM5A 1E2VA 4A3IG 2KCCA 2LXJA 3Q23A 1PH7A 3EQLC 2HIVA 1JE4A 1S72A 3BS1A 4A3KB 1E24A 3EIVA 4IALA 3CKIB 4TRDA 1GD7A 4A3JB 2IX1A 5HURA 1TWHH 3OSOA 3ER0A 5HGTA 3OTOQ 4XQJA 3B6YA 4IQZA 4DAMA 4LAAA 2B29A 1VQ5A 1PZKD 1VMPA 1GUGA 1O78A 1X3GA 4KD3A 4L5TA 4CDDC 1ICWA 4RGNA 3KLWA 2D2CC 4DV3L 3HKZE 3CP0A 5IP7G 2K50A 1LUZA 4DXGA 3RD4A 4Q5VA 2A68D 2RCNA 3DHQA 2CKZB 2JA5H 1TS5A 4FF3A 2K75A 4C1NI 1RDPD 2LMCB 4PMWA 4X3KA 5IY0A 4H02A 1DJRD 4DR2L 1Y1WB 3KOJA 3WDNA 4XDXA 4IUPA 3KF6A 3HFZB 1OXUA 2VUMB 1QJOA 2D5DA 4JK1C 3EA6A 3EFXD 5T1GA 1OXVA 5M3MB 2ZTCA 2XTIA 4DV4L 4C1NK 1IKMA 1S5ED 1PTOB 1XMOQ 2Y0SE 3MXUA 4MIUA 1Z47A 1ZKOA 3J81j 2NUCA 3FP9A 4IFDG 1NUCA 3HOXG 1B2TA 1G6PA 4HCEA 2NTSA 4ZK9B 4OXPA 1G91A 3E9HA 2RBMA 2JA8G 1B9NA 1UNSA 5CMDA 1YIJA 3RN2A 4A3LH 1G8ZD 2K5WA 4JI4Q 4MTKA 3X3MA 1DXMA 2JK8A 3F8TA 1N33Q 4ID6A 1EQQA 4KJNA 5E3FA 4IJLA 1A3UA 4BA2I 1N34L 3V2TA 4GKJQ 1F2ZA 4DAYA 1X3FA 2E76C 2A68C 3T13A 2N55A 4LF8L 1EIHA 2F3VA 1L0XB 3DM3A 5K36G 4Q0FA 4K2KA 5M9OA 5GADC 1OXTA 2BE5D 3CXCA 1VQ9A 1SJHD 3S15H 1AE3A 4YCWA 2JA6H 1GUSA 1MIUA 5AJ3L 2MGSA 3J81c 2EYPA 1N9WA 2CH4W 2PO4A 3VA5A 3GTGH 4LF7Q 2VB2X 3T1YL 1KIXA 3CD6A 4JI2Q 3L7ZC 3SK6A 4LFBQ 1U4PA 1KABA 3D6WA 5EQ0A 4ZRZA 2RQXA 4NKLA 4NPSA 5M5WB 4B3MQ 1CHPD 5LMNW 2EXDA 3G71A 1KLGD 5C3WA 3J7ZC 1C7YA 4G7OC 1HFNA 1MJCA 1PFBA 2EYHA 2QILA 2QW7A 4YWLA 5C6AA 1N36Q 1LT3D 4AYBG 1EY6A 4QIWB 2EY2A 5LMUL 4DXFA 1YNXA 1B70B 3TQYA 2QGQA 3IL8A 3NTIA 4KJOA 1X3EA 4LUVA 1EY5A 1Z7TA 1XPUA 1I5FA 4XT3B 3P1HA 1PYSB 4A3EG 2K03A 1GUTA 3PUVA 1RF2D 2BE5C 3PO2G 1FGUA 1STGA 1K9MC 5EBCA 1PA6A 2B2YC 5A2QE 3NQIA 1LV9A 4HJ9A 1EEID 1YZ6A 3H0GB 3RLFA 4G7HC 4B3SL 4JI6L 3S2HH 1EYAA 1I4RA 1WI5A 2F4VL 4HAEA 1A3VA 4K5WA 1SYCA 1VQFA 2BA1A 3RN5A 1V8QA 3HOZG 4YIJA 1HNZQ 2F03A 1LYLA 3NBHB 3QG1A 1JMCA 5IOCA 1SFOH 4LWCA 4FDBA 4DV2L 1HR0W 3HOVB 2OQKA 2VL6A 1CUKA 3BDCA 1ASZA 3SE0A 4DUYL 4IURA 1CA6A 4L6TB 1U9RA 4NDXA 4WJ4A 2A74C 3NUCA 3SHLA 3CQZB 3BJUA 4JI5L 2R7ZB 1PZID 5M5YB 2Z1CA 4L5SA 4JI1L 4HR7B 4XQNA 3BDLA 5GQOA 4KHZA 2VUMG 2PW7A 3GTLB 2DUDA 3VR6A 4X6AH 4O2DA 5JJLA 3OOCA 1LTID 2O4XA 1NCVA 4KV6A 1I4GA 1QVGA 3Q24A 5DNFA 4BBRG 2UUBQ 4A3FH 2XN9C 5G3LD 5CV5A 2NVQH 3I72A 4DAPA 3HOYB 1T9HA 4HJ5A 3MFGA 3CAMA 5KNDA 1PHJA 2H4OA 2PQAA 3K6OA 4WJWA 1TWAB 2NTTA 1X56A 3KLSX 2B2VC 1VQPA 2YV5A 2SEBD 3C1FA 1B1ZA 3T1HL 5BN4A 1PRTC 5EPJA 5C4JB 1N32L 5IYDH 1HHVA 4JI8Q 4K0KQ 1DYQA 3NQTA 1D5XC 4Z9CB 4POFA 4FF4A 3NXWA 3GTKB 4G57A 2MPMA 1GUOA 1PH2A 3QOJA 2R7FA 3SK4A 2RVLA 1DM0B 4A3BG 2F52A 4OIJA 3WOFA 3J7YW 1K8AC 1IXRA 1HNXQ 1F2MA 5EKLA 2PQAB 1C9OA 5EGTA 4R4IA 3PIP3 3PQIA 3TP8A 3KJOA 4DR1L 5FJ8H 1IBKL 2MJ8A 3IAYA 4O0AA 3J7AV 5JPMC 1TWHB 1C4QA 1ZYRD 1DOMA 4DPGA 5IT9E 1HNWQ 4DR6L 4ZCKA 2KOLA 1HZAA 1FYCA 2JXMB 5JJZA 3KBXA 3KJPA 1S3OA 1EQVA 2TSSA 3HGBA 5FO7B 1WCMG 3PGZA 4EQ5A 5EBDA 2NB0A 4RKLA 2JA5B 1A15A 5E4XA 1PTOD 2IT1A 2ATWA 2K5DA 1TU2B 3U9SA 1CTMA 3K5OA 2UXDQ 2OQ0A 4CJ2C 4FYDA 4JBMA 5JEAH 1TR5A 4A3MG 2NN6H 4JI0Q 5GAEC 4K8IA 1EFWA 2QDBA 1XWEA 2I0QA 4DR5Q 4BY7G 2HDLA 1NR2A 2VY3A 5C4XH 3T53B 3TP7A 4XYQA 2PPBC 1T5XD 3FRPB 3K5LA 2ZJRA 1ENCA 2XNAC 1BCPD 5LMNL 1HH2P 4RKBA 1K8OA 1JJCB 5KYLA 2EYFA 2WB1G 3MXNB 2WACA 5GROA 1ZYRC 4DA2A 5FO9B 3TMEA 4Y7NH 1DONA 4NXNL 1GKHA 1YEZA 4DV7Q 4QY7A 3PIPA 1AH9A 1BR9A 4HN7A 2HIXA 3I55A 4KY6A 2X6LA 1PTOC 5J3BA 2RA4A 4QCLA 2B8FA 3S1QH 4PZ8A 3U4ZA 1I6VC 3BVZA 3UI2A 1YVCA 2JN4A 3S15B 5NUCA 1XMQQ 2OEOA 4C3HH 1JCKB 3A5ZB 2JA6B 4A4IA 2VQFQ 1AZPA 3PO3H 1DCZA 1SJED 4LW1A 4GLXA 3GTGB 4C3IH 3M4OH 2UXCQ 1E1TA 1RJTA 3I4NH 3I70A 3C1EA 1FL0A 1AFPA 1JB7A 2K1BA 5CV4A 2NZHA 1VS0A 2K32A 4IUUA 2KHIA 4PNYA 1BCPC 1PYBA 2PI2A 1HR0L 2M2LA 3I2ZA 5L37A 2KECA 1X55A 4IPHA 4BY1G 4X64L 4MN3A 1WTHA 3I7FA 4IUNA 4H44C 4KHPQ 1G2TA 1Y8OB 1PRTF 3DEOA 4X65Q 1E3PA 5CV6A 2OTLA 4PMCA 5A35A 3D4WA 3I4MG 1I94Q 3HZXA 1TY2A 1A6XA 3NENA 4IFDJ 4B3TL 3J80L 3MXPA 2LS01 4IPGA 1SNPA 1PYWD 5M3FG 2GVAA 2SNMA 1EEFD 3ERSX 2AKWB 1TS2A 4A3CH 1CKNA 3H6MA 3S2HB 4ME5A 3LWEA 1BOSA 2M9VA 3I4OA 4QIWE 2JA7G 3HOWG 2ID0A 1ET6A 1E0BA 1S40A 1RTNA 4JC0A 3K59A 3LX0A 2F3IA 2E2HH 1D2BA 2ZTDA 1PFMA 3R93A 1SFOB 4YHHQ 1O7YA 2DGYA 2NN6I 3A54A 4N8FA 1EUJA 2BH8A 2HCIA 3GV3A 1HCZA 2D0OA 2M00A 5BR8Q 2WKCA 1O7ZA 1JB3A 4X62L 2XIWA 1EY9A 1J6QA 5CV9A 2E74C 3ND8A 5KEEA 1PH9A 3G7LA 4QMGA 3J80i 1S4ZA 3A0JA 4B9WA 3HKZG 2QDLA 4PZ7A 2WB1E 1QNUA 3UDFA 2AWNA 3D4DA 4ZYSA 5C44H 5JOBA 1VQCA 4JI7Q 2ZM6Q 3P75A 1TWCH 5EKKA 4A3FB 1H95A 4LF4Q 2G5DA 1XX8A 3PIOA 1IBLQ 2NVQB 2WAQB 1UE5A 2R3ZA 5C5LA 1STHA 3S17H 2IY5B 2EPBA 4L63B 1RODA 3U58A 3Q22A 2AQ3B 2HQEA 2JQOA 4A3LG 4RAUC 1QOHA 3KF8A 3KYHC 3D31A 3K5MA 1KHIA 2C35B 3JAMc 2B63H 3MEHA 1SE3A 3QR8A 4DR3L 3EJIA 2UXBL 2Y0SG 1EYDA 4CDFC 1EYGA 4RFBA 3A55A 3F1ZA 4DFAA 3NE5B 3GQBA 3NP8A 4HMIA 5C3EH 2H1EA 1EIGA 1N8RC 3VDYA 2AUKA 3S14H 4F87A 4JCVE 3BVMA 2RF4A 4KKUA 5FLXE 4A3DH 3Q0AA 4KN4C 4LF5Q 4UP8A 2KENA 2B2WA 2I07B 1QE6A 3ND9A 2HCCA 2PZTA 2F0OA 4JYAL 1I50H 2SDFA 3PCOB 2L1BA 4K5XA 5JJKA 3W1GA 3EROA 1W2BA 4JV5Q 1EY7A 5DLQE 5IGDA 2R92H 2EQSA 4IPDA 1K83H 5IYBH 3R2TA 5C4HA 1KDAA 3S2DH 5I6WA 4DNTB 3Q8DA 4R4CA 4KHVA 3FKIH 4ULLA 1A62A 2ALYB 4EQNA 2L0CA 1B4OA 2QCPX 4J8QA 1BNZA 2K04A 1HZ9A 1JOQA 1Q12A 3S1MH 4EQPA 2OWOA 2BA0A 4WORA 1IYVA 4HSPA 4GN5A 1DZ1A 1MSHA 3HOUH 3NTKA 5HGQA 3D4RA 3M4QA 4KTAA 4PQXA 4H7BA 4DK6C 1FNWA 3H3VI 2RKSA 3G4SA 2FJ2A 1KDBA 2OCEA 1IZ6A 1B8AA 5C4XB 2WV6D 2Z8LA 5ELFA 3CMEA 2MHVA 3SGIA 1CZGA 1HA6A 4DV3Q 2LSSA 4O1NA 1VQLA 3R2IA 1VQJA 2O5JC 1HZCA 3NTHA 1YITA 1XYIA 3FPPA 1IL2A 1LACA 4DR2Q 1YHQA 4Y7NB 2EYMA 4OL7A 5D3IB 2KEEA 3CHBD 4JW0A 3CC2A 3RMHA 3DXJC 4DF7A 3K8AA 3M7NA 2L4NA 1NBWA 2J0TD 2KQ3A 3VYSA 4DV4Q 1L2FA 5J1ZA 1VQ4A 1OTCA 2JJQA 2NWGA 4PG3A 1LT4D 3DWPA 4IO9A 4DNIA 2OT2A 4FXGC 3S1QB 2XVSA 1LM0A 1BBXC 5K5PA 3OTOL 5HY6A 2K28A 4RHSA 4C3HB 1SNDA 3PV0A 2A19A 2KHSA 4GNXA 3PO3B 3H09A 4OO1G 1UUPA 1VCIA 2MO0A 1MHWC 2YTYA 1XPOA 2EDGA 4C3IB 1K8MA 1JJ2A 3M4OB 3I4NB 1CFMA 5AFWA 3W5OA 1LTTD 2F0FA 1HTLD 4A93G 1UAPA 3J80E 3AMUA 2VB3X 3NBIA 4IUTA 1Y1VG 5CV8A 3I3CA 4LF8Q 4ZUIA 5IGBA 2F0PA 3KF6B 2F0LA 1BXTA 1NR4A 2CQAA 4P2CB 1BCPB 2UUCQ 4JG2A 3CU7A 3CW2C 4QF4A 1H9JA 1JR0D 5AJ3Q 3J7AF 1CT1D 3CC4A 1CM9A 2LY7A 2N3SA 3W2DA 1EZ8A 5FLMG 3K58A 3GTOH 1L1OA 3T1YQ 1BO0A 1I3QH 3JAML 4A3GH 2IJ0A 3UDGA 3K81C 4DU9A 1HXYD 5EPKA 5KGUA 1SMYD 4K6LA 4PZ6A 4BS9A 2OF1A 1W6JA 5C0XG 3A7LA 2YTVA 4UPAA 1AZQA 1LABA 4GKJL 3M3YH 1LTAD 4DAYB 4GOPA 1IYUA 3UE0A 2R93H 1Y8NB 2QEXA 3ULJA 5KRUA 4BXXH 3MA2B 2E2HB 1D1KA 5LMUQ 3P7JA 3RZOH 1W6KA 3E5SA 1LTSD 1QZGA 3D8GA 1VDZA 1L1OB 1ESFA 4I7ZC 4IOCA 2Q2IA 3CRKC 5ELEA 4GS3A 4FVMA 1H9MA 2B39A 4JPBW 5CORA 1K0SA 3OWFA 4IUVA 3S16H 2FXQA 2F0GA 2E75C 2EZVA 1QWYA 4JI2L 3OMGA 4JI6Q 1NY4A 4B3SQ 1A8VA 2F4VQ 4P75A 1SDFA 1Y69U 1TXYA 1SYBA 1JJGA 5C44B 3EBEA 1MGSA 4HJ8A 2ES2A 4A3KG 4BBSH 1QVCA 1TWCB 4DN4M 3NK9A 2IWHA 4A3JG 3V96A 1XPRA 4R4QA 5EKIA 2AHOB 1STAA 1I6HH 4K14A 3S1RH 3S17B 2PMZB 1SMYC 4NMZA 4DV2Q 1Q46A 3CCLA 4DUYQ 2EJMA 3H91A 4LMQD 2B63B 4A3IH 3KBGA 2AQ2B 1XXGA 1UWVA 3J7A5 3Q6SA 2Z6BA 3TREA 4X3SA 1PH6A 4CHTB 5JVH3 4AQYQ 3I4LA 3F2DA 1Y1WG 5C3EB 2F0JA 4YWKA 4TQUS 1L0WA 5ELNA 1PH1A 3S14B 1ENAA 1IYJB 1M1KC 1WTRA 1Z9FA 5M3MG 1OO9B 1B3QA 4LJZC 1X54A 2ZJPA 4A3DB 2NVXH 2EOTA 5IP7H 3QO2A 4CBVA 3OPOA 3CCMA 3C3LA 1A2TA 3CC7A 1HJPA 3FVQA 1I50B 1JOKA 3QWNA 3RLOA 3PUWA 5IP9G 2MUYA 3T1HQ 1O7IA 1FNUA 2R92B 4DV6Q 1V1PA 4A76A 1K83B 1G291 5FO8B 1N32Q 2V4DA 3STBD 1ZXTA 3S2DB 5LL6X 1WTVA 1VQBA 4ABNA 2F0DA 1O7LA 1R4PB 3FKIB 4HIOA 3LNNA 1SXTA 2UUAL 4DUZL 4IFDH 3O13A 3TN2A 3HOXH 2BDNA 2RDHA 3S1MB 1B44D 4R9WA 1QNKA 4JOIA 2JA8H 2BDOA 3MXGA 3D6CA 1D7QA 4KK7A 3HOUB 3LGJA 4DR1Q 2Q8RE 2AMCB 2L15A 4XYOA 2RDFA 3A7AB 2XWJB 4LFAL 1RHPA 4MHEA 3NEMA 2NZOA 4DR6Q 4LUZA 3BZDB 3CCEA 1LT6D 2A8VA 5K36H 4JI8L 1UEBA 4V0BA 2BOSA 2I5HA 2ICIA 1YBYA 3HS0C 2SOBA 4RCOA 4OWTB 1D1IA 2XWBB 1X9NA 2F0EA 3STBC 3W3AA 1I4PA 2J7ZA 3S1NH 1SYEA 2ASBA 2IHEA 2JSOA 1I4QA 5KIXA 3I73A 2VQEQ 3J81L 4KY5A 1I4HA 1FR3A 1KRTA 2E8GA 1ICFB 4CKBA 3TZDA 1VQEA 1UE7A 3V05A 2Q2TA 3I8ZA 1XNQL 1A3TA 3MWYW 1STNA 1U5KA 4ALPA 1GHJA 1Y14B 5I2XA 1VQKA 1SNMA 1WTOA 1KC8C 1V1QA 2B2UA 1ET9A 4NP5A 5M5XH 5E7NA 5LMNQ 1JWUD 4MTNA 4WJ3M 3H0GG 1WVLA 2FFKB 4QUCA 3URYA 2NVTH 4CGYB 1E7ZA 1J5EL 3BZCA 1CKOA 1CI3M 1TVXA 4M1UB 2F0UA 3C2PA 1U4LA 3T4AC 2DJFC 4NXNQ 1F9SA 1R9TH 4KMUC 1DD2A 5LL6S 4JI3L 2UU9L 3MEFA 4L5RC 4LFCQ 4C3JH 1IBML 2C5CA 1STBA 3K5NA 3K80C 4A3EH 2F0KA 1KNAA 3K7AH 2ICEC 3R3OA 3JAME 4RMFA 3HOVG 1VF7A 1V1OA 3PO2H 1HQMC 2A6ED 4DNRB 1DGSA 5I9OA 3T51B 5IWAL 4UP7A 1TY0A 3CCQA 3HG9A 5C3EG 1RCVD 2R7ZG 3L9AX 5CYUA 5IYCG 4L8JA 3J81i 4KI0A 1G6ZA 4TKOB 5C4ZA 1PH4A 2KUMA 1GO3E 4HJ7A 4DV0L 4V190 3HOZH 3GTOB 4AIMA 2CVRA 1YJNA 2A6HD 2K6AA 1I3QB 1Q1BA 2XRSD 4A3GB 1D8LA 1PDQA 1QVFA 2EIFA 1PFNA 2E5LQ 4FXKC 4UY8C 4RHRA 3HOYG 1O80A 5DEHA 1HR0Q 2Z6KA 4QQBX 3DM1A 1QUQA 5IODA 4X64Q 2HHHL 4DV7L 4OO1I 3M3YB 4IFDI 1CK1A 1I4XA 1DOKA 2R93B 1TWGH 3AB9A 4GKKQ 2XSCA 5DM73 4BBRH 3OIPA 4G7ZC 3RZOB 4KKTA 5IGEA 4GNXC 1SLJA 4B3TQ 1U0LA 2H5XA 2ENBA 1X6OA 2K7VA 2A6EC 1OXXK 4OHJA 4UDUC 3KDFA 3AQQA 3KUPA 4HIMA 3D0FA 4LF9L 4NXML 3TEHB 3E9IA 2QEJC 3S16B 4ZKCB 4ZUJA 5FOBB 2ZT9C 4FNFA 3FPUB 1P16A 2FMCA 3A8JE 1PXUA 2ZTEA 1QUQB 1G51A 4HCSA 4ODGA 4YY3Q 1EZ6A 1EQRA 2B2YA 2A6HC 3PUYA 4BBSB 4I7AA 4TSSA 4CDEC 2WFWA 2VZAA 1I6HB 4PV1C 3SDZA 4C2MH 4CJ0B 1D6EC 3S1RB 1HA5A 3H3VH 4KY7A 1WJJA 1UEAB 5G3LF 3VR2A 1L1OC 2VXWA 5C0XI 4A3BH 2RDGA 1KTKA
chains in the Genus database with same CATH topology
4A3IB 3OWEB 4DK0A 4HSVA 1BDOA 4KD4A 1H9KA 1AN8A 2NYZD 3TZUA 4IN3A 5KNCA 1H9SA 4E6IA 5C0XJ 4X3UA 1Q3LA 4F7XA 4RH6A 3HRZC 2NVXB 1EWHA 4U68A 1J8IA 4G4KA 1FNVA 3X3NA 1OXSC 4CJ1B 4WFN3 1E2WA 2A69D 1M8AA 4NW2A 2EYLA 1AEXA 2B2VA 2L55A 4CKCA 2N88A 5IGCA 1F9RA 4XQQA 5COYA 1GXDC 1Q1EA 2AUJD 2GA4B 3HOXB 1HRJA 1RKNA 1S5CD 1C48A 5C5MA 1CZWA 4RGTA 2JA8B 5E1FA 2F0SA 1PTOF 5EJWA 1LTBD 1PLFA 3DWQA 2VNUD 1LO5D 3TP5A 3BYYB 1F9PA 3NWSA 2DY8A 3NHHA 2K33A 3J81E 3EVQA 4R8NA 1V43A 1S5FD 4EVOA 2A69C 1Q8IA 2KJXA 2EVBA 1BCPF 2F0TA 2TMPA 1SNCA 3S1NB 1LTRD 5CV7A 1QILA 3OW7A 3N52A 4DK1A 3VYUA 2O5IC 1EY4A 3IKJA 3S9WA 3I91A 2EY6A 3HP3A 3P20A 4FO2A 3GV6A 5IIFA 5KNBA 2NBFA 2QF7A 1U4RA 1RTOA 3N6RA 5M5XB 1FD7D 2G9DA 1WD0A 2R61A 2BCOA 1GOZA 2ZXOA 1BUVT 4AYBB 2NVTB 2Z4HA 1SAPA 1MBYA 2F3WA 4F88A 1R9TB 1CQFA 4CKEA 4FF2A 2PW5A 4C3JB 2CW0D 4C56C 1KAAA 4A3EB 3TSSA 3K7AB 3PO2B 1ESRA 1BF4A 1XTCD 2L9HA 4O42A 3VA7A 2JEAI 1S5DD 4H0LC 3SR1A 3K57A 1CHQD 5JPNC 2D62A 3HOZB 2B2TA 4LK1C 3G6JB 1EWCA 1SSOA 4IUQA 1U4MA 4J6HA 5IT9L 2KEDA 4RGOS 1B9MA 2B2UC 4OIKA 1TWGB 5ISRA 4BBRB 2CW0C 1EU3A 3ITPA 4PMBA 2F1MA 2CHBD 2ZXRA 1WTWA 3WOEA 3TDQA 1EOTA 4EQOA 5DM63 4K5VA 2Q8IB 3VR5A 4B9XA 5E4WC 1VF5C 4H13C 2YYZA 4X3TA 4C2MB 2J4XA 4JBWA 3A8KE 3NPPA 4FP5D 4K2LA 2F4IA 2JEBI 4A3BB 2MP1A 1GUWA 2PZWA 5I9PA 5EPLA 2FINB 1SYFA 4ZAIA 2XRQD 3A56A 2RSNA 2QKIC 1QB5D 3TP6A 2PYKA 1GJXA 1WTQA 5KYIA 5JEAG 2NN6G 1SYGA 4DAVA 3CRLC 1TQOA 3VR3A 5D65A 1EQTA 1WCMB 1STEA 3E0JA 4XT1B 1ILPA 1IHZA 4KKSA 5ELBA 1QG7A 3NBHA 2PQEA 1F2YA 5ELCA 2Z4IA 3SEBA 1TWFB 2K5QA 2AQ1B 4C3JG 4A3MB 3OMCA 5I6YA 1YNND 4BY7B 3R8BA 1KDCA 1IKLA 4S3SA 1KNEA 2EXZA 1TT2A 3LWUA 3GD7A 5CGKA 3ERQA 3F2UA 3A8IE 3T56B 1WTXA 2WB1B 1TS3A 1PRTD 2WINB 2A5HA 5IGFA 4C3HG 1TS4A 4QB4A 4C3IG 1A2UA 1LTGD 1SBBB 3TBIB 4R8IA 3KLSA 3FEWX 1JORA 1ZEQX 1JWSD 1TIID 2IW3A 1YNNC 4RGMA 5F2DA 4OO1H 1ENFA 2E2IB 1PZJD 4ZLTF 2R6GA 2KA7A 5BN3A 3KLRA 1ML0D 1NSNS 3MZ5A 4BY1B 4N9TA 1V1PB 3GTQB 1SE4A 5TSSA 1NAPA 3BYTB 2AWOA 1Z6HA 3I4MB 1VMCA 3T16A 2K05A 1GUNA 5C3XA 1STYA 5M3FB 4WRDA 1G2SA 2B2WC 4RCNA 1II3A 2B8GA 1MD2D 5JVG3 3DEPA 4RA8A 2DNEA 3PUXA 3GO5A 3MFYA 3D3RA 1SEBD 1MSGA 3OHXC 5C0XH 1CA5A 2ZXPA 2JA7B 3HOWB 3GTJB 2F0IA 1RD9D 5I4DA 2JP1A 5FLXL 1AW7A 4UAIA 2LKVA 2Q8TA 4RWSC 3K0YA 3I90A 4XIGS 5J22A 5J39A 3MXNA 2I46A 2X6GA 3SXHA 4GZYC 4N9PA 4HTHA 2FMMA 4DGZA 1JQYD 2EY1A 5CR3A 2PZUA 3HKZB 1X3QA 3OIQA 1AP0A 1HFGA 5JAVA 2IL8A 5IGGA 4HMJA 1HUMA 1EY8A 4B08A 1Y8PB 1LT5D 3C46A 2EJFC 4M8AA 1JOOA 2DN8A 3QOLA 2DY7A 3MHBA 1QCBD 2YU9B 3M85A 4EGVA 2EYOA 2WP8J 3M7GA 2F0NA 1B53A 2Y0SB 1MI2A 1M4VA 3H94A 1EFID 3ONAB 2EE1A 3GTPB 3MVVA 3SK5A 3L3OC 5D3DA 1T5EA 1YNJD 2NVYB 4ZQ3A 4J1MA 3BDOA 1IW7D 2B2TC 2RSOA 3VYRA 3MTSA 1PTOH 2L11A 2IX3A 2FHTA 3FDTA 2OXPA 1KLUD 1TKWB 2WKDA 1HPCA 5I2YA 3NSWA 1Q90A 3DMUA 2PNRC 4XXEA 5LHY1 3PUZA 2K01A 1ILQA 5ELDA 5CC4A 1J9OA 3QB3A 2WIIB 1SE2A 1SNQA 1SNOA 3H3VC 3AU7A 4QUFA 3IFDA 3PIO3 4IZ8A 2LFNA 2X69A 2IPKD 1H9RA 3VYTA 2E2JB 3DUZA 1YNJC 3U9OA 2F0MA 3MC0B 1EL0A 4K6DA 4OGQC 2DNCA 1X3PA 4U673 1B50A 1IW7C 2A73B 3RZDB 3MAQA 3BG3A 5FKAC 1EY0A 2JYOA 2O2LD 2IX0A 4FF1A 4KN7C 2F0HA 1L0YB 4ILWA 1WTPA 2KCNA 5FK9C 1SYDA 3M4YA 2HDMA 5D14A 3FMCA 3SK8A 2HUGA 5BN5A 1S5BD 4XTCS 2EJGC 1IL8A 5T1IA 1GHKA 4I65A 2C9OA 2KVMA 2L5TA 5CBEE 3E6ZX 3VR4A 5JEAJ 1H9SB 1EU4A 1DOLA 4FXDA 2NZ1D 1X32A 1JWMD 1LLRD 4A93B 1HQRD 1HTPA 3ZYYX 1Y1VB 1JC7A 3GP7A 5A2QL 3DWAA 1F9QA 1HUNA 1D5MC 5DAUA 3IFTA 2PCFB 4ZKBB 5CBAE 4BA1I 1PRTB 2JE6I 1FGBD 1E2ZA 2E2DC 3BVGA 2EY5A 2F0QA 4F8MA 3QIAA 1JICA 1D5ZC 1F77A 3RUZA 2D9UA 1BQQT 3QJYA 1EYCA 1C8CA 1R4QB 3KK7A 2G9HD 3GTMB 2F0VA 2L12A 3HEJA 2SNSA 3PMFA 2EYJA 1B3AA 1F2LA 4HEDA 1CQVA 1WD1A 1ONLA 3SVMA 4K8JA 2F0WA 3NWTA 4BWGB 1PMRA 1E2VA 2KCCA 3Q23A 3EQLC 1JE4A 3BS1A 4A3KB 4IALA 3CKIB 4TRDA 4A3JB 2IX1A 5HURA 3OSOA 5HGTA 4XQJA 4IQZA 4LAAA 1PZKD 1VMPA 1GUGA 1O78A 4KD3A 1ICWA 4RGNA 2D2CC 4DXGA 3RD4A 4Q5VA 2A68D 3DHQA 4FF3A 1TS5A 4C1NI 1RDPD 2LMCB 4PMWA 4X3KA 1DJRD 1Y1WB 3WDNA 4XDXA 4IUPA 1OXUA 2VUMB 1QJOA 2D5DA 4JK1C 3EA6A 3EFXD 5T1GA 1OXVA 5M3MB 4C1NK 1IKMA 1S5ED 1PTOB 3MXUA 4MIUA 1Z47A 1ZKOA 2NUCA 4IFDG 1NUCA 1B2TA 4HCEA 2NTSA 4ZK9B 1G91A 2RBMA 1B9NA 1UNSA 5CMDA 1G8ZD 2K5WA 3X3MA 1DXMA 4ID6A 4KJNA 5E3FA 1A3UA 4BA2I 3V2TA 1F2ZA 4DAYA 2E76C 2A68C 3T13A 2N55A 1EIHA 2F3VA 1L0XB 5K36G 4Q0FA 4K2KA 5M9OA 1OXTA 2BE5D 1SJHD 1GUSA 2MGSA 2EYPA 2PO4A 3VA5A 2VB2X 3L7ZC 3SK6A 1U4PA 1KABA 3D6WA 5EQ0A 4ZRZA 2RQXA 4NKLA 5M5WB 1CHPD 1KLGD 5C3WA 4G7OC 1HFNA 1PFBA 2EYHA 2QILA 5C6AA 1LT3D 1EY6A 4QIWB 2EY2A 4DXFA 3IL8A 3NTIA 4KJOA 1EY5A 1Z7TA 4XT3B 3P1HA 2K03A 1GUTA 3PUVA 1RF2D 2BE5C 1STGA 5EBCA 2B2YC 5A2QE 3NQIA 1LV9A 1EEID 3H0GB 3RLFA 4G7HC 1EYAA 1I4RA 4HAEA 1A3VA 4K5WA 1SYCA 2BA1A 1V8QA 4YIJA 2F03A 3QG1A 5IOCA 3HOVB 3BDCA 3SE0A 4IURA 1CA6A 4L6TB 1U9RA 4NDXA 2A74C 3NUCA 3SHLA 3CQZB 2R7ZB 1PZID 5M5YB 2Z1CA 4HR7B 4XQNA 3BDLA 4KHZA 2PW7A 3GTLB 3VR6A 3OOCA 1LTID 2O4XA 1NCVA 4KV6A 1I4GA 3Q24A 5DNFA 2XN9C 5G3LD 5CV5A 3I72A 4DAPA 3HOYB 3MFGA 5KNDA 2H4OA 3K6OA 4WJWA 1TWAB 2NTTA 3KLSX 2B2VC 2SEBD 3C1FA 1B1ZA 5BN4A 1PRTC 5EPJA 5C4JB 1HHVA 1DYQA 3NQTA 1D5XC 4Z9CB 4FF4A 3NXWA 3GTKB 4G57A 2MPMA 1GUOA 3QOJA 3SK4A 2RVLA 1DM0B 4OIJA 3WOFA 3J7YW 1F2MA 5EKLA 5EGTA 3PIP3 3TP8A 2MJ8A 3IAYA 3J7AV 5JPMC 1TWHB 1C4QA 1ZYRD 1DOMA 5IT9E 2KOLA 1FYCA 2JXMB 5JJZA 3KBXA 1EQVA 2TSSA 3HGBA 5FO7B 5EBDA 2NB0A 4RKLA 2JA5B 1A15A 5E4XA 1PTOD 2IT1A 2K5DA 1TU2B 3U9SA 1CTMA 3K5OA 4CJ2C 4FYDA 5JEAH 1TR5A 2NN6H 4K8IA 2QDBA 1XWEA 2HDLA 1NR2A 3T53B 3TP7A 4XYQA 2PPBC 1T5XD 3FRPB 3K5LA 1ENCA 2XNAC 1BCPD 4RKBA 1K8OA 5KYLA 2EYFA 2WACA 1ZYRC 4DA2A 5FO9B 3TMEA 1DONA 1BR9A 4HN7A 4KY6A 2X6LA 1PTOC 2RA4A 4QCLA 2B8FA 1I6VC 3BVZA 3UI2A 3S15B 5NUCA 2OEOA 1JCKB 2JA6B 1AZPA 1DCZA 1SJED 3GTGB 1RJTA 3I70A 3C1EA 1AFPA 2K1BA 5CV4A 2K32A 4IUUA 4PNYA 1BCPC 2M2LA 2KECA 4MN3A 4IUNA 4H44C 1G2TA 1Y8OB 1PRTF 3DEOA 5CV6A 4PMCA 5A35A 3D4WA 3HZXA 1TY2A 1A6XA 4IFDJ 3J80L 3MXPA 2LS01 1SNPA 1PYWD 2SNMA 1EEFD 1TS2A 3H6MA 3S2HB 4ME5A 3LWEA 1BOSA 2M9VA 2ID0A 1ET6A 1E0BA 1RTNA 3K59A 3LX0A 1D2BA 1PFMA 3R93A 1SFOB 1O7YA 2NN6I 3A54A 2HCIA 3GV3A 1HCZA 2M00A 2WKCA 1O7ZA 1JB3A 2XIWA 1EY9A 5CV9A 2E74C 3ND8A 5KEEA 3G7LA 4QMGA 1S4ZA 4B9WA 1QNUA 2AWNA 3D4DA 4ZYSA 5JOBA 3P75A 5EKKA 4A3FB 1XX8A 2NVQB 2WAQB 2R3ZA 5C5LA 1STHA 2EPBA 4L63B 1RODA 3Q22A 2AQ3B 2HQEA 4RAUC 1QOHA 3KF8A 3K5MA 3D31A 3MEHA 1SE3A 3EJIA 1EYDA 4RFBA 3A55A 4DFAA 3NE5B 3GQBA 3NP8A 4HMIA 2H1EA 1EIGA 2AUKA 4F87A 3BVMA 4KKUA 5FLXE 3Q0AA 4KN4C 2B2WA 2I07B 1QE6A 3ND9A 2HCCA 2PZTA 2F0OA 2SDFA 2L1BA 4K5XA 3EROA 1EY7A 5IGDA 3R2TA 5C4HA 1KDAA 5I6WA 4DNTB 4KHVA 4ULLA 4EQNA 4J8QA 2L0CA 1B4OA 2QCPX 1BNZA 2K04A 1JOQA 1Q12A 4EQPA 2BA0A 4WORA 1IYVA 4HSPA 1DZ1A 1MSHA 3NTKA 3D4RA 4KTAA 4PQXA 4H7BA 1FNWA 2RKSA 2FJ2A 1KDBA 5C4XB 2WV6D 2Z8LA 5ELFA 2MHVA 1CZGA 1HA6A 4O1NA 3R2IA 2O5JC 3NTHA 1XYIA 3FPPA 1LACA 4Y7NB 2EYMA 4OL7A 5D3IB 2KEEA 3CHBD 3RMHA 3DXJC 4DF7A 3M7NA 2L4NA 2J0TD 2KQ3A 3VYSA 5J1ZA 2NWGA 1LT4D 3DWPA 2OT2A 4FXGC 3S1QB 2XVSA 1BBXC 5K5PA 2K28A 4RHSA 4C3HB 1SNDA 3PV0A 2KHSA 3PO3B 3H09A 4OO1G 1UUPA 1VCIA 2EDGA 4C3IB 1K8MA 3M4OB 3I4NB 1CFMA 5AFWA 1LTTD 2F0FA 1HTLD 1UAPA 3J80E 3AMUA 2VB3X 3NBIA 4IUTA 5CV8A 3I3CA 4ZUIA 5IGBA 2F0PA 2F0LA 1BXTA 1NR4A 2CQAA 4P2CB 1BCPB 3CU7A 4QF4A 1H9JA 1JR0D 3J7AF 1CT1D 1CM9A 2LY7A 3W2DA 1EZ8A 3K58A 1BO0A 3JAML 2IJ0A 4DU9A 1HXYD 5EPKA 5KGUA 1SMYD 4K6LA 4BS9A 2OF1A 1W6JA 5C0XG 3A7LA 1AZQA 1LABA 1LTAD 1IYUA 1Y8NB 5KRUA 3MA2B 2E2HB 1D1KA 3P7JA 1W6KA 3E5SA 1LTSD 3D8GA 1VDZA 1ESFA 4I7ZC 3CRKC 5ELEA 4FVMA 1H9MA 2B39A 5CORA 3OWFA 4IUVA 2F0GA 2E75C 2EZVA 1QWYA 3OMGA 1SDFA 1Y69U 1SYBA 5C44B 1MGSA 1TWCB 4DN4M 3NK9A 2IWHA 3V96A 5EKIA 1STAA 4K14A 3S17B 2PMZB 1SMYC 4NMZA 2EJMA 3H91A 4LMQD 2B63B 3KBGA 2AQ2B 1XXGA 3Q6SA 4X3SA 4CHTB 5JVH3 3I4LA 5C3EB 2F0JA 4TQUS 3S14B 1ENAA 1WTRA 1OO9B 4LJZC 4A3DB 2EOTA 3QO2A 4CBVA 3OPOA 3C3LA 1A2TA 3FVQA 1I50B 1JOKA 3QWNA 3PUWA 2MUYA 1FNUA 2R92B 1V1PA 1K83B 1G291 5FO8B 2V4DA 1ZXTA 3S2DB 5LL6X 1WTVA 4ABNA 2F0DA 1O7LA 1R4PB 3FKIB 3LNNA 1SXTA 4IFDH 3O13A 3TN2A 2BDNA 2RDHA 3S1MB 1B44D 4R9WA 1QNKA 2BDOA 3MXGA 3D6CA 4KK7A 3HOUB 2Q8RE 4XYOA 2RDFA 3A7AB 2XWJB 1RHPA 4MHEA 3BZDB 1LT6D 5K36H 4V0BA 2BOSA 2ICIA 3HS0C 2SOBA 4RCOA 1D1IA 2XWBB 2F0EA 3W3AA 1I4PA 2J7ZA 1SYEA 2JSOA 1I4QA 5KIXA 3I73A 3J81L 4KY5A 1I4HA 1FR3A 4CKBA 3TZDA 3V05A 3I8ZA 1A3TA 3MWYW 1STNA 1GHJA 5I2XA 1SNMA 1WTOA 2B2UA 1ET9A 4NP5A 1JWUD 1WVLA 2FFKB 4QUCA 3URYA 4CGYB 4M1UB 1CI3M 1TVXA 3C2PA 2F0UA 1U4LA 3T4AC 1F9SA 1DD2A 4KMUC 5LL6S 2C5CA 1STBA 3K5NA 2F0KA 1KNAA 2ICEC 3R3OA 3JAME 1VF7A 1V1OA 1HQMC 2A6ED 4DNRB 5I9OA 3T51B 1TY0A 3HG9A 1RCVD 3L9AX 5CYUA 4L8JA 4KI0A 1G6ZA 4TKOB 5C4ZA 2KUMA 4V190 3GTOB 2CVRA 2A6HD 2K6AA 1I3QB 1Q1BA 2XRSD 4A3GB 1PDQA 1PFNA 4FXKC 4RHRA 1O80A 5DEHA 3DM1A 5IODA 4OO1I 3M3YB 4IFDI 1CK1A 1I4XA 1DOKA 2R93B 3AB9A 2XSCA 5DM73 3OIPA 4G7ZC 3RZOB 4KKTA 5IGEA 2ENBA 2K7VA 2A6EC 1OXXK 4OHJA 4UDUC 3KUPA 2QEJC 3S16B 4ZKCB 4ZUJA 5FOBB 2ZT9C 3FPUB 4FNFA 2FMCA 3A8JE 1PXUA 4HCSA 4ODGA 1EZ6A 2B2YA 2A6HC 3PUYA 4BBSB 4TSSA 1I6HB 4PV1C 3SDZA 4CJ0B 3S1RB 1D6EC 1HA5A 4KY7A 5G3LF 1UEAB 3VR2A 2VXWA 5C0XI 2RDGA 1KTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 X;  5IT9 L;  3J80 L;  3J7A V;  5A2Q L;  5FLX L;  3JAM L;  3J81 L; 
#chains in the Genus database with same CATH topology
 4A3I B;  3OWE B;  4DK0 A;  4HSV A;  1AE2 A;  4J15 A;  1JE5 A;  2JA5 G;  2DJG C;  1BDO A;  4KD4 A;  1H9K A;  1AN8 A;  5IT9 c;  1MKH A;  2NYZ D;  3TZU A;  3CMA A;  4IN3 A;  5KNC A;  4HID A;  1VQ8 A;  2KHJ A;  4LF6 Q;  4QGU A;  2GVB A;  1H9S A;  2Z0S A;  4GOP C;  4E6I A;  1CKN B;  1PH5 A;  5C0X J;  4X3U A;  4LUO A;  1SRO A;  1Q3L A;  4DR4 Q;  4F7X A;  4RH6 A;  3HRZ C;  2NVX B;  1WCM H;  1EWH A;  3CF5 A;  4U68 A;  1J8I A;  3CCR A;  4G4K A;  2K5N A;  3E3X A;  1FNV A;  3X3N A;  3ZJY C;  3G6E A;  4DR3 Q;  1OXS C;  4CJ1 B;  2UXB Q;  3DLL A;  4WFN 3;  1TWF H;  1E2W A;  2A69 D;  4A3M H;  1K8G A;  1M8A A;  5BR8 L;  4NW2 A;  3AFP A;  2EYL A;  1AEX A;  1UE1 A;  4B3R Q;  2B2V A;  2L55 A;  4CKC A;  2N88 A;  4X66 L;  5IGC A;  4BY7 H;  1F9R A;  4DV5 L;  3NEL A;  4XQQ A;  1W3S A;  5COY A;  1GXD C;  1Q1E A;  3JC6 6;  2AUJ D;  3K7U C;  2GA4 B;  3HOX B;  1HRJ A;  1RKN A;  3OW2 A;  1S5C D;  1C48 A;  5C5M A;  1CZW A;  4JI7 L;  4RGT A;  1FJG L;  3OYY A;  1NMG A;  1A0I A;  4KLK A;  4CDC C;  2JA8 B;  3L2P A;  4JYA Q;  5E1F A;  2F0S A;  1PTO F;  5EJW A;  1LTB D;  1PLF A;  3DWQ A;  2VNU D;  1LO5 D;  4LNQ A;  2CFM A;  1M90 C;  2JA6 G;  3HKS A;  3TP5 A;  4OX9 L;  3BYY B;  4GLV B;  1F9P A;  3KF8 B;  3NWS A;  2DY8 A;  1EWI A;  3NHH A;  2K33 A;  3H15 A;  3J81 E;  3M4P A;  3EVQ A;  4R8N A;  1V43 A;  4QJF A;  1S5F D;  5ELO A;  2LXK A;  4EVO A;  2A69 C;  1Q8I A;  2KJX A;  2EVB A;  1BCP F;  2F0T A;  2TMP A;  1SNC A;  3S1N B;  1LTR D;  5CV7 A;  3RR5 A;  1QIL A;  3OW7 A;  2E2I H;  4DV1 L;  3N52 A;  2HD3 A;  4DK1 A;  4LF5 L;  4DR7 L;  1XNR L;  3VYU A;  1SN8 A;  3EN2 A;  2O5I C;  1EY4 A;  3IKJ A;  3S9W A;  3I91 A;  2EY6 A;  3FHW A;  3HP3 A;  3P20 A;  4FO2 A;  2VS1 A;  3G48 A;  3GV6 A;  2CQO A;  5IIF A;  5KNB A;  4BY1 H;  2NBF A;  3GTQ H;  2QF7 A;  1U4R A;  1RTO A;  3N6R A;  5M5X B;  1FD7 D;  2G9D A;  1WD0 A;  2R61 A;  2BCO A;  2Q2U A;  1GOZ A;  1VQA A;  2ZXO A;  1BUV T;  4YCV A;  4AYB B;  2NVT B;  1XJV A;  2Z4H A;  1SAP A;  3I4M H;  1MBY A;  2F3W A;  4F88 A;  1R9T B;  1CQF A;  4CKE A;  4FF2 A;  2PW5 A;  1SR3 A;  4C3J B;  1JT8 A;  2CW0 D;  4C56 C;  1KAA A;  5M3F H;  4A3E B;  3TSS A;  3K7A B;  3PO2 B;  1ESR A;  1YJ9 A;  1BF4 A;  1XTC D;  2L9H A;  4O42 A;  3VA7 A;  2JEA I;  1S5D D;  4H0L C;  3SR1 A;  3K57 A;  2JA7 H;  3HOW H;  3GTJ H;  1UE6 A;  3TS0 A;  1SE8 A;  3F2B A;  1YHA A;  1CHQ D;  2V1C C;  2D62 A;  1PFS A;  5JPN C;  2B2T A;  3HOZ B;  4LK1 C;  2RHS B;  1C0A A;  4A3F G;  3CPW A;  3G6J B;  1EIF A;  4OWX B;  1EWC A;  1SSO A;  2WAQ G;  4MZ9 A;  4EX5 A;  4IUQ A;  1U4M A;  4YWM A;  3F2C A;  4J6H A;  4P71 A;  2KED A;  5IT9 L;  4RGO S;  4IJH A;  1N34 Q;  1SRU A;  1B9M A;  2B2U C;  3E0E A;  4OIK A;  1NJI C;  1TWG B;  5ISR A;  4UHV A;  4BBR B;  2CW0 C;  1EU3 A;  3ITP A;  5IYD G;  4PMB A;  2F1M A;  4HJA A;  2CHB D;  3PF5 A;  1VQD A;  2YU9 H;  2ZXR A;  4RG1 A;  4NB3 A;  1WTW A;  1WFQ A;  1WYD A;  1XMO L;  5IE8 A;  1MJE A;  3WOE A;  3TDQ A;  4GNX B;  1EOT A;  2K4K A;  4EQO A;  5DM6 3;  4K5V A;  3AEV A;  2Q8I B;  3TRZ A;  1LTL A;  3VR5 A;  4B9X A;  5GAH C;  5E4W C;  1VF5 C;  4JI4 L;  4H13 C;  3GTP H;  2YYZ A;  1N33 L;  1VQM A;  5FJ8 G;  4X3T A;  2N49 A;  2NVY H;  4IPC A;  4C2M B;  5FLX c;  2VW9 A;  2J4X A;  4JBW A;  3A8K E;  3NPP A;  4FP5 D;  1CKM A;  4K2L A;  2F4I A;  2OTJ A;  2JEB I;  2UUC L;  4A3B B;  2MP1 A;  1GUW A;  2PZW A;  5I9P A;  5EPL A;  2FIN B;  4R1J A;  1E22 A;  1SYF A;  4ZAI A;  2Q2H A;  2A1A A;  2XRQ D;  1VQ6 A;  2Z6K C;  3A56 A;  2Z9H A;  2PI2 E;  2RSN A;  2QKI C;  1QB5 D;  3TP6 A;  2PYK A;  1RIP A;  1GJX A;  1WTQ A;  5KYI A;  5JEA G;  2NN6 G;  4LF7 L;  3I56 A;  1SYG A;  4DAV A;  3CRL C;  2JA9 A;  1TQO A;  3VR3 A;  4LFB L;  3U50 C;  2HT1 A;  5D65 A;  1EQT A;  1WCM B;  1STE A;  3E0J A;  5C4X G;  5GAG C;  3JAM i;  4XT1 B;  2ZJQ A;  4B3M L;  4GOP B;  1ILP A;  1IHZ A;  4KKS A;  5ELB A;  1BBU A;  1QG7 A;  3NBH A;  2PQE A;  1F2Y A;  4N8X 1;  3UDX A;  5ELC A;  2Z4I A;  3K0X A;  3SEB A;  1TWF B;  2E2J H;  2K5Q A;  2AQ1 B;  4C3J G;  4A3M B;  1N36 L;  1YJW A;  3OMC A;  5I6Y A;  1YNN D;  4BY7 B;  4JI5 Q;  3R8B A;  2K52 A;  1KDC A;  4JI1 Q;  3RZD H;  1IKL A;  4S3S A;  1KNE A;  2EXZ A;  2QA4 A;  3PF4 A;  1TT2 A;  3LWU A;  3GD7 A;  2I5M X;  5CGK A;  3ERQ A;  3F2U A;  2WAQ E;  3A8I E;  3T56 B;  3AFQ A;  1WTX A;  2WB1 B;  2HQL A;  1TS3 A;  1PRT D;  2WIN B;  5H1S E;  1NMF A;  2A5H A;  5IGF A;  4C3H G;  4AH6 A;  1TS4 A;  4QB4 A;  1Q8K A;  3PO3 G;  3KFU A;  4C3I G;  1HNZ L;  3I4N G;  1A2U A;  1KL9 A;  1LTG D;  1HZB A;  4R4T A;  2UUA Q;  4AQY L;  1SBB B;  3TBI B;  4DUZ Q;  4R8I A;  3AYH B;  3KLS A;  5JJI A;  3FEW X;  1JOR A;  4A75 A;  1E1O A;  1ZEQ X;  1JWS D;  1TII D;  1K3R A;  2IW3 A;  1YNN C;  4RGM A;  5F2D A;  4OO1 H;  1ENF A;  2E2I B;  4DKA C;  1P8L A;  1PZJ D;  3L0O A;  4ZLT F;  2CH4 A;  2GN5 A;  3J80 c;  3CCV A;  2XGT A;  2R6G A;  2UUB L;  2KA7 A;  2I5L X;  3ICE A;  4LFA Q;  4A93 H;  5BN3 A;  1PH8 A;  2D0P A;  3KLR A;  1ML0 D;  3UE1 A;  1Y1V H;  1IBK Q;  3W1B A;  1NSN S;  3MZ5 A;  4DV6 L;  4BY1 B;  4N9T A;  1V1P B;  3BU2 A;  3GTQ B;  2MO1 A;  1SE4 A;  4A3C G;  5TSS A;  1NAP A;  3BYT B;  4Y52 H;  3U4V A;  1KXL A;  2AWO A;  1Z6H A;  3I4M B;  1B7Y B;  1VMC A;  4K0K L;  2YTX A;  3T16 A;  2K05 A;  5FLM H;  1GUN A;  5C3X A;  1STY A;  5M3F B;  4WRD A;  1G2S A;  2B2W C;  4QL5 A;  4RCN A;  1II3 A;  2B8G A;  1XNQ Q;  1K28 A;  1MD2 D;  5JVG 3;  3DEP A;  4RA8 A;  2DNE A;  3PUX A;  2CCZ A;  1PVO A;  3GO5 A;  3MFY A;  3D3R A;  1SEB D;  1MSG A;  3OHX C;  5C0X H;  1CA5 A;  4HIK A;  2ZXP A;  4AYB E;  1HNX L;  2JA7 B;  3HOW B;  3GTJ B;  2F0I A;  1RD9 D;  5I4D A;  1QZH A;  2JP1 A;  5FLX L;  3GTM H;  2KCM A;  1AW7 A;  2PNH A;  1J5E Q;  4UAI A;  2LKV A;  2Q8T A;  4RWS C;  5C44 G;  1HNW L;  2KCT A;  3K0Y A;  3I90 A;  4XIG S;  1WOC A;  4YCU A;  4ME3 A;  4JI3 Q;  2UU9 Q;  5J22 A;  5J39 A;  3MXN A;  2I46 A;  1IBM Q;  1Q82 C;  2X6G A;  3SXH A;  4GZY C;  4N9P A;  5EAY A;  4HTH A;  2P5Z X;  2FMM A;  4DGZ A;  1JQY D;  2EY1 A;  3GDE A;  2VQE L;  5CR3 A;  5IWA Q;  2PZU A;  2RHQ B;  2B63 G;  3HKZ B;  1X3Q A;  3OIQ A;  1AP0 A;  1HFG A;  5JAV A;  2IL8 A;  5IGG A;  4HMJ A;  2UXD L;  1HUM A;  1EY8 A;  4B08 A;  1Y8P B;  4A3K H;  3CCU A;  4JI0 L;  1LT5 D;  3C46 A;  2EJF C;  4M8A A;  1JOO A;  4A3J H;  2DN8 A;  4GN3 B;  4DV0 Q;  3QOL A;  2DY7 A;  3MHB A;  1QCB D;  4JVZ A;  4DR5 L;  2YU9 B;  3M85 A;  4EGV A;  2R7D A;  3A74 A;  4P74 A;  2EYO A;  4OWW B;  2WP8 J;  4GN4 B;  3M7G A;  1V9P A;  1K3B C;  2F0N A;  4A3D G;  1B53 A;  2Y0S B;  1MI2 A;  2HHH Q;  1M4V A;  3H94 A;  4LFC L;  1EFI D;  3ONA B;  2EE1 A;  3GTP B;  1Y1W H;  3MVV A;  3SK5 A;  4APV A;  3L3O C;  4L5Q A;  5D3D A;  2CWP A;  2R92 G;  1T5E A;  1YNJ D;  2NVY B;  4ZQ3 A;  5IYB G;  4J1M A;  2VUM H;  3BDO A;  1IW7 D;  1VQH A;  5M3M H;  1FVI A;  2B2T C;  2RSO A;  3VYR A;  1Q86 C;  3FKI G;  3MTS A;  1PTO H;  2L11 A;  2IX3 A;  4LF9 Q;  4NXM Q;  1K73 C;  1X65 A;  2FHT A;  3FDT A;  2OXP A;  2IHF A;  1KLU D;  1TKW B;  2WKD A;  4MNO A;  1HPC A;  5I2Y A;  1NTG A;  4JBJ A;  2K5V A;  3NSW A;  1XMQ L;  5IP9 H;  1Q90 A;  3A5U A;  2VQF L;  3DMU A;  2E5L L;  2PNR C;  2N78 A;  4XXE A;  3CPF A;  4DK3 C;  5LHY 1;  3M9B A;  1VQN A;  3HOU G;  3PUZ A;  1CSP A;  2UXC L;  2K01 A;  1ILQ A;  1XTD A;  4OON A;  5ELD A;  5CC4 A;  1J9O A;  3QB3 A;  2MQH A;  1CSQ A;  2WII B;  1SE2 A;  1SNQ A;  1SNO A;  3H3V C;  3AU7 A;  4QUF A;  3IFD A;  2K14 A;  3PIO 3;  4IZ8 A;  2LFN A;  1EIY B;  2X69 A;  4GKK L;  1KRS A;  3RLN A;  1KD1 C;  2IPK D;  3TS2 A;  1H9R A;  3VYT A;  4KHP L;  2E2J B;  4X65 L;  3DUZ A;  1YNJ C;  3U9O A;  2F0M A;  4X62 Q;  3MC0 B;  1Q7Y C;  4R4O A;  1EL0 A;  4K6D A;  3KDF B;  2DNC A;  1X3P A;  4OGQ C;  4U67 3;  1IW7 C;  1I94 L;  1B50 A;  2A73 B;  4TVA B;  3RZD B;  1BVS A;  3MAQ A;  3BG3 A;  5FKA C;  3CCJ A;  1EY0 A;  2JYO A;  3S24 A;  2O2L D;  1PV4 A;  4YY3 L;  2IX0 A;  5M5W H;  3ULL A;  4FF1 A;  4KN7 C;  2PMZ E;  1K0R A;  2F0H A;  1L0Y B;  1YI2 A;  4ILW A;  1WTP A;  2KCN A;  5FK9 C;  1SYD A;  3M4Y A;  2HDM A;  5D14 A;  3FMC A;  3SK8 A;  2HUG A;  5BN5 A;  1S5B D;  4XTC S;  4GLA C;  2EJG C;  4X66 Q;  4DV5 Q;  1IL8 A;  4YHH L;  5T1I A;  1GHK A;  3BZK A;  4OEL B;  4I65 A;  2C9O A;  2KVM A;  2L5T A;  1PH3 A;  5CBE E;  1NNX A;  1ASY A;  3E6Z X;  3VR4 A;  4LF6 L;  1VQO A;  1VQG A;  5JEA J;  1Q81 C;  1FJG Q;  1H9S B;  1EU4 A;  3H0G H;  4DR4 L;  1DOL A;  4P72 A;  4FXD A;  2NZ1 D;  2BH2 A;  1X32 A;  1JWM D;  2ZM6 L;  3UDI A;  1LLR D;  1GVP A;  3RNU A;  4A93 B;  4OX9 Q;  2B3G A;  1HQR D;  4LF4 L;  1IBL L;  1HTP A;  1BKB A;  2RCF A;  2MFI A;  3ZYY X;  1SMX A;  1Y1V B;  3HOV H;  4A3G G;  1JC7 A;  3GP7 A;  5A2Q L;  3DWA A;  1F9Q A;  4IOA A;  4B3R L;  1HUN A;  3CQZ H;  1D5M C;  5DAU A;  4POG A;  2R7Z H;  5M5Y H;  5IYC H;  3IFT A;  4JBK A;  2PCF B;  4ZKB B;  5CBA E;  4BA1 I;  3GTL H;  1PRT B;  2JE6 I;  1FGB D;  1KQS A;  4DV1 Q;  1E2Z A;  2R93 G;  2E2D C;  4BXX G;  3BVG A;  2EY5 A;  4DR7 Q;  2KBN A;  1XNR Q;  2F0Q A;  4F8M A;  3QIA A;  2N8N A;  2K5H A;  1JIC A;  1VQI A;  1D5Z C;  3HOY H;  1F77 A;  3RUZ A;  2D9U A;  1A63 A;  1BQQ T;  3QJY A;  1NE3 A;  1EYC A;  2CWA A;  1C8C A;  1KAW A;  1R4Q B;  3KK7 A;  3PSI A;  1TWA H;  2G9H D;  3GTM B;  2F0V A;  2L12 A;  4JV5 L;  3HEJ A;  2SNS A;  1YHB A;  3PMF A;  3WWV A;  5C4J H;  2EYJ A;  3CCS A;  1BBW A;  4BBS G;  1B3A A;  3IRB A;  3GTK H;  1F2L A;  4HED A;  1CQV A;  1WD1 A;  1ONL A;  2MNA A;  4JOI C;  3SVM A;  4K8J A;  1EOV A;  1RL2 A;  2F0W A;  3NWT A;  4OEM B;  4UP9 A;  4BWG B;  1VQ7 A;  3ULP A;  4P73 A;  1PMR A;  1GM5 A;  1E2V A;  4A3I G;  2KCC A;  2LXJ A;  3Q23 A;  1PH7 A;  3EQL C;  2HIV A;  1JE4 A;  1S72 A;  3BS1 A;  4A3K B;  1E24 A;  3EIV A;  4IAL A;  3CKI B;  4TRD A;  1GD7 A;  4A3J B;  2IX1 A;  5HUR A;  1TWH H;  3OSO A;  3ER0 A;  5HGT A;  3OTO Q;  4XQJ A;  3B6Y A;  4IQZ A;  4DAM A;  4LAA A;  2B29 A;  1VQ5 A;  1PZK D;  1VMP A;  1GUG A;  1O78 A;  1X3G A;  4KD3 A;  4L5T A;  4CDD C;  1ICW A;  4RGN A;  3KLW A;  2D2C C;  4DV3 L;  3HKZ E;  3CP0 A;  5IP7 G;  2K50 A;  1LUZ A;  4DXG A;  3RD4 A;  4Q5V A;  2A68 D;  2RCN A;  3DHQ A;  2CKZ B;  2JA5 H;  1TS5 A;  4FF3 A;  2K75 A;  4C1N I;  1RDP D;  2LMC B;  4PMW A;  4X3K A;  5IY0 A;  4H02 A;  1DJR D;  4DR2 L;  1Y1W B;  3KOJ A;  3WDN A;  4XDX A;  4IUP A;  3KF6 A;  3HFZ B;  1OXU A;  2VUM B;  1QJO A;  2D5D A;  4JK1 C;  3EA6 A;  3EFX D;  5T1G A;  1OXV A;  5M3M B;  2ZTC A;  2XTI A;  4DV4 L;  4C1N K;  1IKM A;  1S5E D;  1PTO B;  1XMO Q;  2Y0S E;  3MXU A;  4MIU A;  1Z47 A;  1ZKO A;  3J81 j;  2NUC A;  3FP9 A;  4IFD G;  1NUC A;  3HOX G;  1B2T A;  1G6P A;  4HCE A;  2NTS A;  4ZK9 B;  4OXP A;  1G91 A;  3E9H A;  2RBM A;  2JA8 G;  1B9N A;  1UNS A;  5CMD A;  1YIJ A;  3RN2 A;  4A3L H;  1G8Z D;  2K5W A;  4JI4 Q;  4MTK A;  3X3M A;  1DXM A;  2JK8 A;  3F8T A;  1N33 Q;  4ID6 A;  1EQQ A;  4KJN A;  5E3F A;  4IJL A;  1A3U A;  4BA2 I;  1N34 L;  3V2T A;  4GKJ Q;  1F2Z A;  4DAY A;  1X3F A;  2E76 C;  2A68 C;  3T13 A;  2N55 A;  4LF8 L;  1EIH A;  2F3V A;  1L0X B;  3DM3 A;  5K36 G;  4Q0F A;  4K2K A;  5M9O A;  5GAD C;  1OXT A;  2BE5 D;  3CXC A;  1VQ9 A;  1SJH D;  3S15 H;  1AE3 A;  4YCW A;  2JA6 H;  1GUS A;  1MIU A;  5AJ3 L;  2MGS A;  3J81 c;  2EYP A;  1N9W A;  2CH4 W;  2PO4 A;  3VA5 A;  3GTG H;  4LF7 Q;  2VB2 X;  3T1Y L;  1KIX A;  3CD6 A;  4JI2 Q;  3L7Z C;  3SK6 A;  4LFB Q;  1U4P A;  1KAB A;  3D6W A;  5EQ0 A;  4ZRZ A;  2RQX A;  4NKL A;  4NPS A;  5M5W B;  4B3M Q;  1CHP D;  5LMN W;  2EXD A;  3G71 A;  1KLG D;  5C3W A;  3J7Z C;  1C7Y A;  4G7O C;  1HFN A;  1MJC A;  1PFB A;  2EYH A;  2QIL A;  2QW7 A;  4YWL A;  5C6A A;  1N36 Q;  1LT3 D;  4AYB G;  1EY6 A;  4QIW B;  2EY2 A;  5LMU L;  4DXF A;  1YNX A;  1B70 B;  3TQY A;  2QGQ A;  3IL8 A;  3NTI A;  4KJO A;  1X3E A;  4LUV A;  1EY5 A;  1Z7T A;  1XPU A;  1I5F A;  4XT3 B;  3P1H A;  1PYS B;  4A3E G;  2K03 A;  1GUT A;  3PUV A;  1RF2 D;  2BE5 C;  3PO2 G;  1FGU A;  1STG A;  1K9M C;  5EBC A;  1PA6 A;  2B2Y C;  5A2Q E;  3NQI A;  1LV9 A;  4HJ9 A;  1EEI D;  1YZ6 A;  3H0G B;  3RLF A;  4G7H C;  4B3S L;  4JI6 L;  3S2H H;  1EYA A;  1I4R A;  1WI5 A;  2F4V L;  4HAE A;  1A3V A;  4K5W A;  1SYC A;  1VQF A;  2BA1 A;  3RN5 A;  1V8Q A;  3HOZ G;  4YIJ A;  1HNZ Q;  2F03 A;  1LYL A;  3NBH B;  3QG1 A;  1JMC A;  5IOC A;  1SFO H;  4LWC A;  4FDB A;  4DV2 L;  1HR0 W;  3HOV B;  2OQK A;  2VL6 A;  1CUK A;  3BDC A;  1ASZ A;  3SE0 A;  4DUY L;  4IUR A;  1CA6 A;  4L6T B;  1U9R A;  4NDX A;  4WJ4 A;  2A74 C;  3NUC A;  3SHL A;  3CQZ B;  3BJU A;  4JI5 L;  2R7Z B;  1PZI D;  5M5Y B;  2Z1C A;  4L5S A;  4JI1 L;  4HR7 B;  4XQN A;  3BDL A;  5GQO A;  4KHZ A;  2VUM G;  2PW7 A;  3GTL B;  2DUD A;  3VR6 A;  4X6A H;  4O2D A;  5JJL A;  3OOC A;  1LTI D;  2O4X A;  1NCV A;  4KV6 A;  1I4G A;  1QVG A;  3Q24 A;  5DNF A;  4BBR G;  2UUB Q;  4A3F H;  2XN9 C;  5G3L D;  5CV5 A;  2NVQ H;  3I72 A;  4DAP A;  3HOY B;  1T9H A;  4HJ5 A;  3MFG A;  3CAM A;  5KND A;  1PHJ A;  2H4O A;  2PQA A;  3K6O A;  4WJW A;  1TWA B;  2NTT A;  1X56 A;  3KLS X;  2B2V C;  1VQP A;  2YV5 A;  2SEB D;  3C1F A;  1B1Z A;  3T1H L;  5BN4 A;  1PRT C;  5EPJ A;  5C4J B;  1N32 L;  5IYD H;  1HHV A;  4JI8 Q;  4K0K Q;  1DYQ A;  3NQT A;  1D5X C;  4Z9C B;  4POF A;  4FF4 A;  3NXW A;  3GTK B;  4G57 A;  2MPM A;  1GUO A;  1PH2 A;  3QOJ A;  2R7F A;  3SK4 A;  2RVL A;  1DM0 B;  4A3B G;  2F52 A;  4OIJ A;  3WOF A;  3J7Y W;  1K8A C;  1IXR A;  1HNX Q;  1F2M A;  5EKL A;  2PQA B;  1C9O A;  5EGT A;  4R4I A;  3PIP 3;  3PQI A;  3TP8 A;  3KJO A;  4DR1 L;  5FJ8 H;  1IBK L;  2MJ8 A;  3IAY A;  4O0A A;  3J7A V;  5JPM C;  1TWH B;  1C4Q A;  1ZYR D;  1DOM A;  4DPG A;  5IT9 E;  1HNW Q;  4DR6 L;  4ZCK A;  2KOL A;  1HZA A;  1FYC A;  2JXM B;  5JJZ A;  3KBX A;  3KJP A;  1S3O A;  1EQV A;  2TSS A;  3HGB A;  5FO7 B;  1WCM G;  3PGZ A;  4EQ5 A;  5EBD A;  2NB0 A;  4RKL A;  2JA5 B;  1A15 A;  5E4X A;  1PTO D;  2IT1 A;  2ATW A;  2K5D A;  1TU2 B;  3U9S A;  1CTM A;  3K5O A;  2UXD Q;  2OQ0 A;  4CJ2 C;  4FYD A;  4JBM A;  5JEA H;  1TR5 A;  4A3M G;  2NN6 H;  4JI0 Q;  5GAE C;  4K8I A;  1EFW A;  2QDB A;  1XWE A;  2I0Q A;  4DR5 Q;  4BY7 G;  2HDL A;  1NR2 A;  2VY3 A;  5C4X H;  3T53 B;  3TP7 A;  4XYQ A;  2PPB C;  1T5X D;  3FRP B;  3K5L A;  2ZJR A;  1ENC A;  2XNA C;  1BCP D;  5LMN L;  1HH2 P;  4RKB A;  1K8O A;  1JJC B;  5KYL A;  2EYF A;  2WB1 G;  3MXN B;  2WAC A;  5GRO A;  1ZYR C;  4DA2 A;  5FO9 B;  3TME A;  4Y7N H;  1DON A;  4NXN L;  1GKH A;  1YEZ A;  4DV7 Q;  4QY7 A;  3PIP A;  1AH9 A;  1BR9 A;  4HN7 A;  2HIX A;  3I55 A;  4KY6 A;  2X6L A;  1PTO C;  5J3B A;  2RA4 A;  4QCL A;  2B8F A;  3S1Q H;  4PZ8 A;  3U4Z A;  1I6V C;  3BVZ A;  3UI2 A;  1YVC A;  2JN4 A;  3S15 B;  5NUC A;  1XMQ Q;  2OEO A;  4C3H H;  1JCK B;  3A5Z B;  2JA6 B;  4A4I A;  2VQF Q;  1AZP A;  3PO3 H;  1DCZ A;  1SJE D;  4LW1 A;  4GLX A;  3GTG B;  4C3I H;  3M4O H;  2UXC Q;  1E1T A;  1RJT A;  3I4N H;  3I70 A;  3C1E A;  1FL0 A;  1AFP A;  1JB7 A;  2K1B A;  5CV4 A;  2NZH A;  1VS0 A;  2K32 A;  4IUU A;  2KHI A;  4PNY A;  1BCP C;  1PYB A;  2PI2 A;  1HR0 L;  2M2L A;  3I2Z A;  5L37 A;  2KEC A;  1X55 A;  4IPH A;  4BY1 G;  4X64 L;  4MN3 A;  1WTH A;  3I7F A;  4IUN A;  4H44 C;  4KHP Q;  1G2T A;  1Y8O B;  1PRT F;  3DEO A;  4X65 Q;  1E3P A;  5CV6 A;  2OTL A;  4PMC A;  5A35 A;  3D4W A;  3I4M G;  1I94 Q;  3HZX A;  1TY2 A;  1A6X A;  3NEN A;  4IFD J;  4B3T L;  3J80 L;  3MXP A;  2LS0 1;  4IPG A;  1SNP A;  1PYW D;  5M3F G;  2GVA A;  2SNM A;  1EEF D;  3ERS X;  2AKW B;  1TS2 A;  4A3C H;  1CKN A;  3H6M A;  3S2H B;  4ME5 A;  3LWE A;  1BOS A;  2M9V A;  3I4O A;  4QIW E;  2JA7 G;  3HOW G;  2ID0 A;  1ET6 A;  1E0B A;  1S40 A;  1RTN A;  4JC0 A;  3K59 A;  3LX0 A;  2F3I A;  2E2H H;  1D2B A;  2ZTD A;  1PFM A;  3R93 A;  1SFO B;  4YHH Q;  1O7Y A;  2DGY A;  2NN6 I;  3A54 A;  4N8F A;  1EUJ A;  2BH8 A;  2HCI A;  3GV3 A;  1HCZ A;  2D0O A;  2M00 A;  5BR8 Q;  2WKC A;  1O7Z A;  1JB3 A;  4X62 L;  2XIW A;  1EY9 A;  1J6Q A;  5CV9 A;  2E74 C;  3ND8 A;  5KEE A;  1PH9 A;  3G7L A;  4QMG A;  3J80 i;  1S4Z A;  3A0J A;  4B9W A;  3HKZ G;  2QDL A;  4PZ7 A;  2WB1 E;  1QNU A;  3UDF A;  2AWN A;  3D4D A;  4ZYS A;  5C44 H;  5JOB A;  1VQC A;  4JI7 Q;  2ZM6 Q;  3P75 A;  1TWC H;  5EKK A;  4A3F B;  1H95 A;  4LF4 Q;  2G5D A;  1XX8 A;  3PIO A;  1IBL Q;  2NVQ B;  2WAQ B;  1UE5 A;  2R3Z A;  5C5L A;  1STH A;  3S17 H;  2IY5 B;  2EPB A;  4L63 B;  1ROD A;  3U58 A;  3Q22 A;  2AQ3 B;  2HQE A;  2JQO A;  4A3L G;  4RAU C;  1QOH A;  3KF8 A;  3KYH C;  3D31 A;  3K5M A;  1KHI A;  2C35 B;  3JAM c;  2B63 H;  3MEH A;  1SE3 A;  3QR8 A;  4DR3 L;  3EJI A;  2UXB L;  2Y0S G;  1EYD A;  4CDF C;  1EYG A;  4RFB A;  3A55 A;  3F1Z A;  4DFA A;  3NE5 B;  3GQB A;  3NP8 A;  4HMI A;  5C3E H;  2H1E A;  1EIG A;  1N8R C;  3VDY A;  2AUK A;  3S14 H;  4F87 A;  4JCV E;  3BVM A;  2RF4 A;  4KKU A;  5FLX E;  4A3D H;  3Q0A A;  4KN4 C;  4LF5 Q;  4UP8 A;  2KEN A;  2B2W A;  2I07 B;  1QE6 A;  3ND9 A;  2HCC A;  2PZT A;  2F0O A;  4JYA L;  1I50 H;  2SDF A;  3PCO B;  2L1B A;  4K5X A;  5JJK A;  3W1G A;  3ERO A;  1W2B A;  4JV5 Q;  1EY7 A;  5DLQ E;  5IGD A;  2R92 H;  2EQS A;  4IPD A;  1K83 H;  5IYB H;  3R2T A;  5C4H A;  1KDA A;  3S2D H;  5I6W A;  4DNT B;  3Q8D A;  4R4C A;  4KHV A;  3FKI H;  4ULL A;  1A62 A;  2ALY B;  4EQN A;  2L0C A;  1B4O A;  2QCP X;  4J8Q A;  1BNZ A;  2K04 A;  1HZ9 A;  1JOQ A;  1Q12 A;  3S1M H;  4EQP A;  2OWO A;  2BA0 A;  4WOR A;  1IYV A;  4HSP A;  4GN5 A;  1DZ1 A;  1MSH A;  3HOU H;  3NTK A;  5HGQ A;  3D4R A;  3M4Q A;  4KTA A;  4PQX A;  4H7B A;  4DK6 C;  1FNW A;  3H3V I;  2RKS A;  3G4S A;  2FJ2 A;  1KDB A;  2OCE A;  1IZ6 A;  1B8A A;  5C4X B;  2WV6 D;  2Z8L A;  5ELF A;  3CME A;  2MHV A;  3SGI A;  1CZG A;  1HA6 A;  4DV3 Q;  2LSS A;  4O1N A;  1VQL A;  3R2I A;  1VQJ A;  2O5J C;  1HZC A;  3NTH A;  1YIT A;  1XYI A;  3FPP A;  1IL2 A;  1LAC A;  4DR2 Q;  1YHQ A;  4Y7N B;  2EYM A;  4OL7 A;  5D3I B;  2KEE A;  3CHB D;  4JW0 A;  3CC2 A;  3RMH A;  3DXJ C;  4DF7 A;  3K8A A;  3M7N A;  2L4N A;  1NBW A;  2J0T D;  2KQ3 A;  3VYS A;  4DV4 Q;  1L2F A;  5J1Z A;  1VQ4 A;  1OTC A;  2JJQ A;  2NWG A;  4PG3 A;  1LT4 D;  3DWP A;  4IO9 A;  4DNI A;  2OT2 A;  4FXG C;  3S1Q B;  2XVS A;  1LM0 A;  1BBX C;  5K5P A;  3OTO L;  5HY6 A;  2K28 A;  4RHS A;  4C3H B;  1SND A;  3PV0 A;  2A19 A;  2KHS A;  4GNX A;  3PO3 B;  3H09 A;  4OO1 G;  1UUP A;  1VCI A;  2MO0 A;  1MHW C;  2YTY A;  1XPO A;  2EDG A;  4C3I B;  1K8M A;  1JJ2 A;  3M4O B;  3I4N B;  1CFM A;  5AFW A;  3W5O A;  1LTT D;  2F0F A;  1HTL D;  4A93 G;  1UAP A;  3J80 E;  3AMU A;  2VB3 X;  3NBI A;  4IUT A;  1Y1V G;  5CV8 A;  3I3C A;  4LF8 Q;  4ZUI A;  5IGB A;  2F0P A;  3KF6 B;  2F0L A;  1BXT A;  1NR4 A;  2CQA A;  4P2C B;  1BCP B;  2UUC Q;  4JG2 A;  3CU7 A;  3CW2 C;  4QF4 A;  1H9J A;  1JR0 D;  5AJ3 Q;  3J7A F;  1CT1 D;  3CC4 A;  1CM9 A;  2LY7 A;  2N3S A;  3W2D A;  1EZ8 A;  5FLM G;  3K58 A;  3GTO H;  1L1O A;  3T1Y Q;  1BO0 A;  1I3Q H;  3JAM L;  4A3G H;  2IJ0 A;  3UDG A;  3K81 C;  4DU9 A;  1HXY D;  5EPK A;  5KGU A;  1SMY D;  4K6L A;  4PZ6 A;  4BS9 A;  2OF1 A;  1W6J A;  5C0X G;  3A7L A;  2YTV A;  4UPA A;  1AZQ A;  1LAB A;  4GKJ L;  3M3Y H;  1LTA D;  4DAY B;  4GOP A;  1IYU A;  3UE0 A;  2R93 H;  1Y8N B;  2QEX A;  3ULJ A;  5KRU A;  4BXX H;  3MA2 B;  2E2H B;  1D1K A;  5LMU Q;  3P7J A;  3RZO H;  1W6K A;  3E5S A;  1LTS D;  1QZG A;  3D8G A;  1VDZ A;  1L1O B;  1ESF A;  4I7Z C;  4IOC A;  2Q2I A;  3CRK C;  5ELE A;  4GS3 A;  4FVM A;  1H9M A;  2B39 A;  4JPB W;  5COR A;  1K0S A;  3OWF A;  4IUV A;  3S16 H;  2FXQ A;  2F0G A;  2E75 C;  2EZV A;  1QWY A;  4JI2 L;  3OMG A;  4JI6 Q;  1NY4 A;  4B3S Q;  1A8V A;  2F4V Q;  4P75 A;  1SDF A;  1Y69 U;  1TXY A;  1SYB A;  1JJG A;  5C44 B;  3EBE A;  1MGS A;  4HJ8 A;  2ES2 A;  4A3K G;  4BBS H;  1QVC A;  1TWC B;  4DN4 M;  3NK9 A;  2IWH A;  4A3J G;  3V96 A;  1XPR A;  4R4Q A;  5EKI A;  2AHO B;  1STA A;  1I6H H;  4K14 A;  3S1R H;  3S17 B;  2PMZ B;  1SMY C;  4NMZ A;  4DV2 Q;  1Q46 A;  3CCL A;  4DUY Q;  2EJM A;  3H91 A;  4LMQ D;  2B63 B;  4A3I H;  3KBG A;  2AQ2 B;  1XXG A;  1UWV A;  3J7A 5;  3Q6S A;  2Z6B A;  3TRE A;  4X3S A;  1PH6 A;  4CHT B;  5JVH 3;  4AQY Q;  3I4L A;  3F2D A;  1Y1W G;  5C3E B;  2F0J A;  4YWK A;  4TQU S;  1L0W A;  5ELN A;  1PH1 A;  3S14 B;  1ENA A;  1IYJ B;  1M1K C;  1WTR A;  1Z9F A;  5M3M G;  1OO9 B;  1B3Q A;  4LJZ C;  1X54 A;  2ZJP A;  4A3D B;  2NVX H;  2EOT A;  5IP7 H;  3QO2 A;  4CBV A;  3OPO A;  3CCM A;  3C3L A;  1A2T A;  3CC7 A;  1HJP A;  3FVQ A;  1I50 B;  1JOK A;  3QWN A;  3RLO A;  3PUW A;  5IP9 G;  2MUY A;  3T1H Q;  1O7I A;  1FNU A;  2R92 B;  4DV6 Q;  1V1P A;  4A76 A;  1K83 B;  1G29 1;  5FO8 B;  1N32 Q;  2V4D A;  3STB D;  1ZXT A;  3S2D B;  5LL6 X;  1WTV A;  1VQB A;  4ABN A;  2F0D A;  1O7L A;  1R4P B;  3FKI B;  4HIO A;  3LNN A;  1SXT A;  2UUA L;  4DUZ L;  4IFD H;  3O13 A;  3TN2 A;  3HOX H;  2BDN A;  2RDH A;  3S1M B;  1B44 D;  4R9W A;  1QNK A;  4JOI A;  2JA8 H;  2BDO A;  3MXG A;  3D6C A;  1D7Q A;  4KK7 A;  3HOU B;  3LGJ A;  4DR1 Q;  2Q8R E;  2AMC B;  2L15 A;  4XYO A;  2RDF A;  3A7A B;  2XWJ B;  4LFA L;  1RHP A;  4MHE A;  3NEM A;  2NZO A;  4DR6 Q;  4LUZ A;  3BZD B;  3CCE A;  1LT6 D;  2A8V A;  5K36 H;  4JI8 L;  1UEB A;  4V0B A;  2BOS A;  2I5H A;  2ICI A;  1YBY A;  3HS0 C;  2SOB A;  4RCO A;  4OWT B;  1D1I A;  2XWB B;  1X9N A;  2F0E A;  3STB C;  3W3A A;  1I4P A;  2J7Z A;  3S1N H;  1SYE A;  2ASB A;  2IHE A;  2JSO A;  1I4Q A;  5KIX A;  3I73 A;  2VQE Q;  3J81 L;  4KY5 A;  1I4H A;  1FR3 A;  1KRT A;  2E8G A;  1ICF B;  4CKB A;  3TZD A;  1VQE A;  1UE7 A;  3V05 A;  2Q2T A;  3I8Z A;  1XNQ L;  1A3T A;  3MWY W;  1STN A;  1U5K A;  4ALP A;  1GHJ A;  1Y14 B;  5I2X A;  1VQK A;  1SNM A;  1WTO A;  1KC8 C;  1V1Q A;  2B2U A;  1ET9 A;  4NP5 A;  5M5X H;  5E7N A;  5LMN Q;  1JWU D;  4MTN A;  4WJ3 M;  3H0G G;  1WVL A;  2FFK B;  4QUC A;  3URY A;  2NVT H;  4CGY B;  1E7Z A;  1J5E L;  3BZC A;  1CKO A;  1CI3 M;  1TVX A;  4M1U B;  2F0U A;  3C2P A;  1U4L A;  3T4A C;  2DJF C;  4NXN Q;  1F9S A;  1R9T H;  4KMU C;  1DD2 A;  5LL6 S;  4JI3 L;  2UU9 L;  3MEF A;  4L5R C;  4LFC Q;  4C3J H;  1IBM L;  2C5C A;  1STB A;  3K5N A;  3K80 C;  4A3E H;  2F0K A;  1KNA A;  3K7A H;  2ICE C;  3R3O A;  3JAM E;  4RMF A;  3HOV G;  1VF7 A;  1V1O A;  3PO2 H;  1HQM C;  2A6E D;  4DNR B;  1DGS A;  5I9O A;  3T51 B;  5IWA L;  4UP7 A;  1TY0 A;  3CCQ A;  3HG9 A;  5C3E G;  1RCV D;  2R7Z G;  3L9A X;  5CYU A;  5IYC G;  4L8J A;  3J81 i;  4KI0 A;  1G6Z A;  4TKO B;  5C4Z A;  1PH4 A;  2KUM A;  1GO3 E;  4HJ7 A;  4DV0 L;  4V19 0;  3HOZ H;  3GTO B;  4AIM A;  2CVR A;  1YJN A;  2A6H D;  2K6A A;  1I3Q B;  1Q1B A;  2XRS D;  4A3G B;  1D8L A;  1PDQ A;  1QVF A;  2EIF A;  1PFN A;  2E5L Q;  4FXK C;  4UY8 C;  4RHR A;  3HOY G;  1O80 A;  5DEH A;  1HR0 Q;  2Z6K A;  4QQB X;  3DM1 A;  1QUQ A;  5IOD A;  4X64 Q;  2HHH L;  4DV7 L;  4OO1 I;  3M3Y B;  4IFD I;  1CK1 A;  1I4X A;  1DOK A;  2R93 B;  1TWG H;  3AB9 A;  4GKK Q;  2XSC A;  5DM7 3;  4BBR H;  3OIP A;  4G7Z C;  3RZO B;  4KKT A;  5IGE A;  4GNX C;  1SLJ A;  4B3T Q;  1U0L A;  2H5X A;  2ENB A;  1X6O A;  2K7V A;  2A6E C;  1OXX K;  4OHJ A;  4UDU C;  3KDF A;  3AQQ A;  3KUP A;  4HIM A;  3D0F A;  4LF9 L;  4NXM L;  3TEH B;  3E9I A;  2QEJ C;  3S16 B;  4ZKC B;  4ZUJ A;  5FOB B;  2ZT9 C;  4FNF A;  3FPU B;  1P16 A;  2FMC A;  3A8J E;  1PXU A;  2ZTE A;  1QUQ B;  1G51 A;  4HCS A;  4ODG A;  4YY3 Q;  1EZ6 A;  1EQR A;  2B2Y A;  2A6H C;  3PUY A;  4BBS B;  4I7A A;  4TSS A;  4CDE C;  2WFW A;  2VZA A;  1I6H B;  4PV1 C;  3SDZ A;  4C2M H;  4CJ0 B;  1D6E C;  3S1R B;  1HA5 A;  3H3V H;  4KY7 A;  1WJJ A;  1UEA B;  5G3L F;  3VR2 A;  1L1O C;  2VXW A;  5C0X I;  4A3B H;  2RDG A;  1KTK A; 
#chains in the Genus database with same CATH homology
 4A3I B;  3OWE B;  4DK0 A;  4HSV A;  1BDO A;  4KD4 A;  1H9K A;  1AN8 A;  2NYZ D;  3TZU A;  4IN3 A;  5KNC A;  1H9S A;  4E6I A;  5C0X J;  4X3U A;  1Q3L A;  4F7X A;  4RH6 A;  3HRZ C;  2NVX B;  1EWH A;  4U68 A;  1J8I A;  4G4K A;  1FNV A;  3X3N A;  1OXS C;  4CJ1 B;  4WFN 3;  1E2W A;  2A69 D;  1M8A A;  4NW2 A;  2EYL A;  1AEX A;  2B2V A;  2L55 A;  4CKC A;  2N88 A;  5IGC A;  1F9R A;  4XQQ A;  5COY A;  1GXD C;  1Q1E A;  2AUJ D;  2GA4 B;  3HOX B;  1HRJ A;  1RKN A;  1S5C D;  1C48 A;  5C5M A;  1CZW A;  4RGT A;  2JA8 B;  5E1F A;  2F0S A;  1PTO F;  5EJW A;  1LTB D;  1PLF A;  3DWQ A;  2VNU D;  1LO5 D;  3TP5 A;  3BYY B;  1F9P A;  3NWS A;  2DY8 A;  3NHH A;  2K33 A;  3J81 E;  3EVQ A;  4R8N A;  1V43 A;  1S5F D;  4EVO A;  2A69 C;  1Q8I A;  2KJX A;  2EVB A;  1BCP F;  2F0T A;  2TMP A;  1SNC A;  3S1N B;  1LTR D;  5CV7 A;  1QIL A;  3OW7 A;  3N52 A;  4DK1 A;  3VYU A;  2O5I C;  1EY4 A;  3IKJ A;  3S9W A;  3I91 A;  2EY6 A;  3HP3 A;  3P20 A;  4FO2 A;  3GV6 A;  5IIF A;  5KNB A;  2NBF A;  2QF7 A;  1U4R A;  1RTO A;  3N6R A;  5M5X B;  1FD7 D;  2G9D A;  1WD0 A;  2R61 A;  2BCO A;  1GOZ A;  2ZXO A;  1BUV T;  4AYB B;  2NVT B;  2Z4H A;  1SAP A;  1MBY A;  2F3W A;  4F88 A;  1R9T B;  1CQF A;  4CKE A;  4FF2 A;  2PW5 A;  4C3J B;  2CW0 D;  4C56 C;  1KAA A;  4A3E B;  3TSS A;  3K7A B;  3PO2 B;  1ESR A;  1BF4 A;  1XTC D;  2L9H A;  4O42 A;  3VA7 A;  2JEA I;  1S5D D;  4H0L C;  3SR1 A;  3K57 A;  1CHQ D;  5JPN C;  2D62 A;  3HOZ B;  2B2T A;  4LK1 C;  3G6J B;  1EWC A;  1SSO A;  4IUQ A;  1U4M A;  4J6H A;  5IT9 L;  2KED A;  4RGO S;  1B9M A;  2B2U C;  4OIK A;  1TWG B;  5ISR A;  4BBR B;  2CW0 C;  1EU3 A;  3ITP A;  4PMB A;  2F1M A;  2CHB D;  2ZXR A;  1WTW A;  3WOE A;  3TDQ A;  1EOT A;  4EQO A;  5DM6 3;  4K5V A;  2Q8I B;  3VR5 A;  4B9X A;  5E4W C;  1VF5 C;  4H13 C;  2YYZ A;  4X3T A;  4C2M B;  2J4X A;  4JBW A;  3A8K E;  3NPP A;  4FP5 D;  4K2L A;  2F4I A;  2JEB I;  4A3B B;  2MP1 A;  1GUW A;  2PZW A;  5I9P A;  5EPL A;  2FIN B;  1SYF A;  4ZAI A;  2XRQ D;  3A56 A;  2RSN A;  2QKI C;  1QB5 D;  3TP6 A;  2PYK A;  1GJX A;  1WTQ A;  5KYI A;  5JEA G;  2NN6 G;  1SYG A;  4DAV A;  3CRL C;  1TQO A;  3VR3 A;  5D65 A;  1EQT A;  1WCM B;  1STE A;  3E0J A;  4XT1 B;  1ILP A;  1IHZ A;  4KKS A;  5ELB A;  1QG7 A;  3NBH A;  2PQE A;  1F2Y A;  5ELC A;  2Z4I A;  3SEB A;  1TWF B;  2K5Q A;  2AQ1 B;  4C3J G;  4A3M B;  3OMC A;  5I6Y A;  1YNN D;  4BY7 B;  3R8B A;  1KDC A;  1IKL A;  4S3S A;  1KNE A;  2EXZ A;  1TT2 A;  3LWU A;  3GD7 A;  5CGK A;  3ERQ A;  3F2U A;  3A8I E;  3T56 B;  1WTX A;  2WB1 B;  1TS3 A;  1PRT D;  2WIN B;  2A5H A;  5IGF A;  4C3H G;  1TS4 A;  4QB4 A;  4C3I G;  1A2U A;  1LTG D;  1SBB B;  3TBI B;  4R8I A;  3KLS A;  3FEW X;  1JOR A;  1ZEQ X;  1JWS D;  1TII D;  2IW3 A;  1YNN C;  4RGM A;  5F2D A;  4OO1 H;  1ENF A;  2E2I B;  1PZJ D;  4ZLT F;  2R6G A;  2KA7 A;  5BN3 A;  3KLR A;  1ML0 D;  1NSN S;  3MZ5 A;  4BY1 B;  4N9T A;  1V1P B;  3GTQ B;  1SE4 A;  5TSS A;  1NAP A;  3BYT B;  2AWO A;  1Z6H A;  3I4M B;  1VMC A;  3T16 A;  2K05 A;  1GUN A;  5C3X A;  1STY A;  5M3F B;  4WRD A;  1G2S A;  2B2W C;  4RCN A;  1II3 A;  2B8G A;  1MD2 D;  5JVG 3;  3DEP A;  4RA8 A;  2DNE A;  3PUX A;  3GO5 A;  3MFY A;  3D3R A;  1SEB D;  1MSG A;  3OHX C;  5C0X H;  1CA5 A;  2ZXP A;  2JA7 B;  3HOW B;  3GTJ B;  2F0I A;  1RD9 D;  5I4D A;  2JP1 A;  5FLX L;  1AW7 A;  4UAI A;  2LKV A;  2Q8T A;  4RWS C;  3K0Y A;  3I90 A;  4XIG S;  5J22 A;  5J39 A;  3MXN A;  2I46 A;  2X6G A;  3SXH A;  4GZY C;  4N9P A;  4HTH A;  2FMM A;  4DGZ A;  1JQY D;  2EY1 A;  5CR3 A;  2PZU A;  3HKZ B;  1X3Q A;  3OIQ A;  1AP0 A;  1HFG A;  5JAV A;  2IL8 A;  5IGG A;  4HMJ A;  1HUM A;  1EY8 A;  4B08 A;  1Y8P B;  1LT5 D;  3C46 A;  2EJF C;  4M8A A;  1JOO A;  2DN8 A;  3QOL A;  2DY7 A;  3MHB A;  1QCB D;  2YU9 B;  3M85 A;  4EGV A;  2EYO A;  2WP8 J;  3M7G A;  2F0N A;  1B53 A;  2Y0S B;  1MI2 A;  1M4V A;  3H94 A;  1EFI D;  3ONA B;  2EE1 A;  3GTP B;  3MVV A;  3SK5 A;  3L3O C;  5D3D A;  1T5E A;  1YNJ D;  2NVY B;  4ZQ3 A;  4J1M A;  3BDO A;  1IW7 D;  2B2T C;  2RSO A;  3VYR A;  3MTS A;  1PTO H;  2L11 A;  2IX3 A;  2FHT A;  3FDT A;  2OXP A;  1KLU D;  1TKW B;  2WKD A;  1HPC A;  5I2Y A;  3NSW A;  1Q90 A;  3DMU A;  2PNR C;  4XXE A;  5LHY 1;  3PUZ A;  2K01 A;  1ILQ A;  5ELD A;  5CC4 A;  1J9O A;  3QB3 A;  2WII B;  1SE2 A;  1SNQ A;  1SNO A;  3H3V C;  3AU7 A;  4QUF A;  3IFD A;  3PIO 3;  4IZ8 A;  2LFN A;  2X69 A;  2IPK D;  1H9R A;  3VYT A;  2E2J B;  3DUZ A;  1YNJ C;  3U9O A;  2F0M A;  3MC0 B;  1EL0 A;  4K6D A;  4OGQ C;  2DNC A;  1X3P A;  4U67 3;  1B50 A;  1IW7 C;  2A73 B;  3RZD B;  3MAQ A;  3BG3 A;  5FKA C;  1EY0 A;  2JYO A;  2O2L D;  2IX0 A;  4FF1 A;  4KN7 C;  2F0H A;  1L0Y B;  4ILW A;  1WTP A;  2KCN A;  5FK9 C;  1SYD A;  3M4Y A;  2HDM A;  5D14 A;  3FMC A;  3SK8 A;  2HUG A;  5BN5 A;  1S5B D;  4XTC S;  2EJG C;  1IL8 A;  5T1I A;  1GHK A;  4I65 A;  2C9O A;  2KVM A;  2L5T A;  5CBE E;  3E6Z X;  3VR4 A;  5JEA J;  1H9S B;  1EU4 A;  1DOL A;  4FXD A;  2NZ1 D;  1X32 A;  1JWM D;  1LLR D;  4A93 B;  1HQR D;  1HTP A;  3ZYY X;  1Y1V B;  1JC7 A;  3GP7 A;  5A2Q L;  3DWA A;  1F9Q A;  1HUN A;  1D5M C;  5DAU A;  3IFT A;  2PCF B;  4ZKB B;  5CBA E;  4BA1 I;  1PRT B;  2JE6 I;  1FGB D;  1E2Z A;  2E2D C;  3BVG A;  2EY5 A;  2F0Q A;  4F8M A;  3QIA A;  1JIC A;  1D5Z C;  1F77 A;  3RUZ A;  2D9U A;  1BQQ T;  3QJY A;  1EYC A;  1C8C A;  1R4Q B;  3KK7 A;  2G9H D;  3GTM B;  2F0V A;  2L12 A;  3HEJ A;  2SNS A;  3PMF A;  2EYJ A;  1B3A A;  1F2L A;  4HED A;  1CQV A;  1WD1 A;  1ONL A;  3SVM A;  4K8J A;  2F0W A;  3NWT A;  4BWG B;  1PMR A;  1E2V A;  2KCC A;  3Q23 A;  3EQL C;  1JE4 A;  3BS1 A;  4A3K B;  4IAL A;  3CKI B;  4TRD A;  4A3J B;  2IX1 A;  5HUR A;  3OSO A;  5HGT A;  4XQJ A;  4IQZ A;  4LAA A;  1PZK D;  1VMP A;  1GUG A;  1O78 A;  4KD3 A;  1ICW A;  4RGN A;  2D2C C;  4DXG A;  3RD4 A;  4Q5V A;  2A68 D;  3DHQ A;  4FF3 A;  1TS5 A;  4C1N I;  1RDP D;  2LMC B;  4PMW A;  4X3K A;  1DJR D;  1Y1W B;  3WDN A;  4XDX A;  4IUP A;  1OXU A;  2VUM B;  1QJO A;  2D5D A;  4JK1 C;  3EA6 A;  3EFX D;  5T1G A;  1OXV A;  5M3M B;  4C1N K;  1IKM A;  1S5E D;  1PTO B;  3MXU A;  4MIU A;  1Z47 A;  1ZKO A;  2NUC A;  4IFD G;  1NUC A;  1B2T A;  4HCE A;  2NTS A;  4ZK9 B;  1G91 A;  2RBM A;  1B9N A;  1UNS A;  5CMD A;  1G8Z D;  2K5W A;  3X3M A;  1DXM A;  4ID6 A;  4KJN A;  5E3F A;  1A3U A;  4BA2 I;  3V2T A;  1F2Z A;  4DAY A;  2E76 C;  2A68 C;  3T13 A;  2N55 A;  1EIH A;  2F3V A;  1L0X B;  5K36 G;  4Q0F A;  4K2K A;  5M9O A;  1OXT A;  2BE5 D;  1SJH D;  1GUS A;  2MGS A;  2EYP A;  2PO4 A;  3VA5 A;  2VB2 X;  3L7Z C;  3SK6 A;  1U4P A;  1KAB A;  3D6W A;  5EQ0 A;  4ZRZ A;  2RQX A;  4NKL A;  5M5W B;  1CHP D;  1KLG D;  5C3W A;  4G7O C;  1HFN A;  1PFB A;  2EYH A;  2QIL A;  5C6A A;  1LT3 D;  1EY6 A;  4QIW B;  2EY2 A;  4DXF A;  3IL8 A;  3NTI A;  4KJO A;  1EY5 A;  1Z7T A;  4XT3 B;  3P1H A;  2K03 A;  1GUT A;  3PUV A;  1RF2 D;  2BE5 C;  1STG A;  5EBC A;  2B2Y C;  5A2Q E;  3NQI A;  1LV9 A;  1EEI D;  3H0G B;  3RLF A;  4G7H C;  1EYA A;  1I4R A;  4HAE A;  1A3V A;  4K5W A;  1SYC A;  2BA1 A;  1V8Q A;  4YIJ A;  2F03 A;  3QG1 A;  5IOC A;  3HOV B;  3BDC A;  3SE0 A;  4IUR A;  1CA6 A;  4L6T B;  1U9R A;  4NDX A;  2A74 C;  3NUC A;  3SHL A;  3CQZ B;  2R7Z B;  1PZI D;  5M5Y B;  2Z1C A;  4HR7 B;  4XQN A;  3BDL A;  4KHZ A;  2PW7 A;  3GTL B;  3VR6 A;  3OOC A;  1LTI D;  2O4X A;  1NCV A;  4KV6 A;  1I4G A;  3Q24 A;  5DNF A;  2XN9 C;  5G3L D;  5CV5 A;  3I72 A;  4DAP A;  3HOY B;  3MFG A;  5KND A;  2H4O A;  3K6O A;  4WJW A;  1TWA B;  2NTT A;  3KLS X;  2B2V C;  2SEB D;  3C1F A;  1B1Z A;  5BN4 A;  1PRT C;  5EPJ A;  5C4J B;  1HHV A;  1DYQ A;  3NQT A;  1D5X C;  4Z9C B;  4FF4 A;  3NXW A;  3GTK B;  4G57 A;  2MPM A;  1GUO A;  3QOJ A;  3SK4 A;  2RVL A;  1DM0 B;  4OIJ A;  3WOF A;  3J7Y W;  1F2M A;  5EKL A;  5EGT A;  3PIP 3;  3TP8 A;  2MJ8 A;  3IAY A;  3J7A V;  5JPM C;  1TWH B;  1C4Q A;  1ZYR D;  1DOM A;  5IT9 E;  2KOL A;  1FYC A;  2JXM B;  5JJZ A;  3KBX A;  1EQV A;  2TSS A;  3HGB A;  5FO7 B;  5EBD A;  2NB0 A;  4RKL A;  2JA5 B;  1A15 A;  5E4X A;  1PTO D;  2IT1 A;  2K5D A;  1TU2 B;  3U9S A;  1CTM A;  3K5O A;  4CJ2 C;  4FYD A;  5JEA H;  1TR5 A;  2NN6 H;  4K8I A;  2QDB A;  1XWE A;  2HDL A;  1NR2 A;  3T53 B;  3TP7 A;  4XYQ A;  2PPB C;  1T5X D;  3FRP B;  3K5L A;  1ENC A;  2XNA C;  1BCP D;  4RKB A;  1K8O A;  5KYL A;  2EYF A;  2WAC A;  1ZYR C;  4DA2 A;  5FO9 B;  3TME A;  1DON A;  1BR9 A;  4HN7 A;  4KY6 A;  2X6L A;  1PTO C;  2RA4 A;  4QCL A;  2B8F A;  1I6V C;  3BVZ A;  3UI2 A;  3S15 B;  5NUC A;  2OEO A;  1JCK B;  2JA6 B;  1AZP A;  1DCZ A;  1SJE D;  3GTG B;  1RJT A;  3I70 A;  3C1E A;  1AFP A;  2K1B A;  5CV4 A;  2K32 A;  4IUU A;  4PNY A;  1BCP C;  2M2L A;  2KEC A;  4MN3 A;  4IUN A;  4H44 C;  1G2T A;  1Y8O B;  1PRT F;  3DEO A;  5CV6 A;  4PMC A;  5A35 A;  3D4W A;  3HZX A;  1TY2 A;  1A6X A;  4IFD J;  3J80 L;  3MXP A;  2LS0 1;  1SNP A;  1PYW D;  2SNM A;  1EEF D;  1TS2 A;  3H6M A;  3S2H B;  4ME5 A;  3LWE A;  1BOS A;  2M9V A;  2ID0 A;  1ET6 A;  1E0B A;  1RTN A;  3K59 A;  3LX0 A;  1D2B A;  1PFM A;  3R93 A;  1SFO B;  1O7Y A;  2NN6 I;  3A54 A;  2HCI A;  3GV3 A;  1HCZ A;  2M00 A;  2WKC A;  1O7Z A;  1JB3 A;  2XIW A;  1EY9 A;  5CV9 A;  2E74 C;  3ND8 A;  5KEE A;  3G7L A;  4QMG A;  1S4Z A;  4B9W A;  1QNU A;  2AWN A;  3D4D A;  4ZYS A;  5JOB A;  3P75 A;  5EKK A;  4A3F B;  1XX8 A;  2NVQ B;  2WAQ B;  2R3Z A;  5C5L A;  1STH A;  2EPB A;  4L63 B;  1ROD A;  3Q22 A;  2AQ3 B;  2HQE A;  4RAU C;  1QOH A;  3KF8 A;  3K5M A;  3D31 A;  3MEH A;  1SE3 A;  3EJI A;  1EYD A;  4RFB A;  3A55 A;  4DFA A;  3NE5 B;  3GQB A;  3NP8 A;  4HMI A;  2H1E A;  1EIG A;  2AUK A;  4F87 A;  3BVM A;  4KKU A;  5FLX E;  3Q0A A;  4KN4 C;  2B2W A;  2I07 B;  1QE6 A;  3ND9 A;  2HCC A;  2PZT A;  2F0O A;  2SDF A;  2L1B A;  4K5X A;  3ERO A;  1EY7 A;  5IGD A;  3R2T A;  5C4H A;  1KDA A;  5I6W A;  4DNT B;  4KHV A;  4ULL A;  4EQN A;  4J8Q A;  2L0C A;  1B4O A;  2QCP X;  1BNZ A;  2K04 A;  1JOQ A;  1Q12 A;  4EQP A;  2BA0 A;  4WOR A;  1IYV A;  4HSP A;  1DZ1 A;  1MSH A;  3NTK A;  3D4R A;  4KTA A;  4PQX A;  4H7B A;  1FNW A;  2RKS A;  2FJ2 A;  1KDB A;  5C4X B;  2WV6 D;  2Z8L A;  5ELF A;  2MHV A;  1CZG A;  1HA6 A;  4O1N A;  3R2I A;  2O5J C;  3NTH A;  1XYI A;  3FPP A;  1LAC A;  4Y7N B;  2EYM A;  4OL7 A;  5D3I B;  2KEE A;  3CHB D;  3RMH A;  3DXJ C;  4DF7 A;  3M7N A;  2L4N A;  2J0T D;  2KQ3 A;  3VYS A;  5J1Z A;  2NWG A;  1LT4 D;  3DWP A;  2OT2 A;  4FXG C;  3S1Q B;  2XVS A;  1BBX C;  5K5P A;  2K28 A;  4RHS A;  4C3H B;  1SND A;  3PV0 A;  2KHS A;  3PO3 B;  3H09 A;  4OO1 G;  1UUP A;  1VCI A;  2EDG A;  4C3I B;  1K8M A;  3M4O B;  3I4N B;  1CFM A;  5AFW A;  1LTT D;  2F0F A;  1HTL D;  1UAP A;  3J80 E;  3AMU A;  2VB3 X;  3NBI A;  4IUT A;  5CV8 A;  3I3C A;  4ZUI A;  5IGB A;  2F0P A;  2F0L A;  1BXT A;  1NR4 A;  2CQA A;  4P2C B;  1BCP B;  3CU7 A;  4QF4 A;  1H9J A;  1JR0 D;  3J7A F;  1CT1 D;  1CM9 A;  2LY7 A;  3W2D A;  1EZ8 A;  3K58 A;  1BO0 A;  3JAM L;  2IJ0 A;  4DU9 A;  1HXY D;  5EPK A;  5KGU A;  1SMY D;  4K6L A;  4BS9 A;  2OF1 A;  1W6J A;  5C0X G;  3A7L A;  1AZQ A;  1LAB A;  1LTA D;  1IYU A;  1Y8N B;  5KRU A;  3MA2 B;  2E2H B;  1D1K A;  3P7J A;  1W6K A;  3E5S A;  1LTS D;  3D8G A;  1VDZ A;  1ESF A;  4I7Z C;  3CRK C;  5ELE A;  4FVM A;  1H9M A;  2B39 A;  5COR A;  3OWF A;  4IUV A;  2F0G A;  2E75 C;  2EZV A;  1QWY A;  3OMG A;  1SDF A;  1Y69 U;  1SYB A;  5C44 B;  1MGS A;  1TWC B;  4DN4 M;  3NK9 A;  2IWH A;  3V96 A;  5EKI A;  1STA A;  4K14 A;  3S17 B;  2PMZ B;  1SMY C;  4NMZ A;  2EJM A;  3H91 A;  4LMQ D;  2B63 B;  3KBG A;  2AQ2 B;  1XXG A;  3Q6S A;  4X3S A;  4CHT B;  5JVH 3;  3I4L A;  5C3E B;  2F0J A;  4TQU S;  3S14 B;  1ENA A;  1WTR A;  1OO9 B;  4LJZ C;  4A3D B;  2EOT A;  3QO2 A;  4CBV A;  3OPO A;  3C3L A;  1A2T A;  3FVQ A;  1I50 B;  1JOK A;  3QWN A;  3PUW A;  2MUY A;  1FNU A;  2R92 B;  1V1P A;  1K83 B;  1G29 1;  5FO8 B;  2V4D A;  1ZXT A;  3S2D B;  5LL6 X;  1WTV A;  4ABN A;  2F0D A;  1O7L A;  1R4P B;  3FKI B;  3LNN A;  1SXT A;  4IFD H;  3O13 A;  3TN2 A;  2BDN A;  2RDH A;  3S1M B;  1B44 D;  4R9W A;  1QNK A;  2BDO A;  3MXG A;  3D6C A;  4KK7 A;  3HOU B;  2Q8R E;  4XYO A;  2RDF A;  3A7A B;  2XWJ B;  1RHP A;  4MHE A;  3BZD B;  1LT6 D;  5K36 H;  4V0B A;  2BOS A;  2ICI A;  3HS0 C;  2SOB A;  4RCO A;  1D1I A;  2XWB B;  2F0E A;  3W3A A;  1I4P A;  2J7Z A;  1SYE A;  2JSO A;  1I4Q A;  5KIX A;  3I73 A;  3J81 L;  4KY5 A;  1I4H A;  1FR3 A;  4CKB A;  3TZD A;  3V05 A;  3I8Z A;  1A3T A;  3MWY W;  1STN A;  1GHJ A;  5I2X A;  1SNM A;  1WTO A;  2B2U A;  1ET9 A;  4NP5 A;  1JWU D;  1WVL A;  2FFK B;  4QUC A;  3URY A;  4CGY B;  4M1U B;  1CI3 M;  1TVX A;  3C2P A;  2F0U A;  1U4L A;  3T4A C;  1F9S A;  1DD2 A;  4KMU C;  5LL6 S;  2C5C A;  1STB A;  3K5N A;  2F0K A;  1KNA A;  2ICE C;  3R3O A;  3JAM E;  1VF7 A;  1V1O A;  1HQM C;  2A6E D;  4DNR B;  5I9O A;  3T51 B;  1TY0 A;  3HG9 A;  1RCV D;  3L9A X;  5CYU A;  4L8J A;  4KI0 A;  1G6Z A;  4TKO B;  5C4Z A;  2KUM A;  4V19 0;  3GTO B;  2CVR A;  2A6H D;  2K6A A;  1I3Q B;  1Q1B A;  2XRS D;  4A3G B;  1PDQ A;  1PFN A;  4FXK C;  4RHR A;  1O80 A;  5DEH A;  3DM1 A;  5IOD A;  4OO1 I;  3M3Y B;  4IFD I;  1CK1 A;  1I4X A;  1DOK A;  2R93 B;  3AB9 A;  2XSC A;  5DM7 3;  3OIP A;  4G7Z C;  3RZO B;  4KKT A;  5IGE A;  2ENB A;  2K7V A;  2A6E C;  1OXX K;  4OHJ A;  4UDU C;  3KUP A;  2QEJ C;  3S16 B;  4ZKC B;  4ZUJ A;  5FOB B;  2ZT9 C;  3FPU B;  4FNF A;  2FMC A;  3A8J E;  1PXU A;  4HCS A;  4ODG A;  1EZ6 A;  2B2Y A;  2A6H C;  3PUY A;  4BBS B;  4TSS A;  1I6H B;  4PV1 C;  3SDZ A;  4CJ0 B;  3S1R B;  1D6E C;  1HA5 A;  4KY7 A;  5G3L F;  1UEA B;  3VR2 A;  2VXW A;  5C0X I;  2RDG A;  1KTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...