3J7AV

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
156
structure length
146
Chain Sequence
DVQHERAYQKQEGASFFNSKRYWKKVGLGFATPKEAKEGVYVDKKCPFTGNVSIRGRILKGMVISNKMKRTIIIRRNYLHYVKKYNRFEKRHKNIPCHCSPCFDVKEGDIVTVGQCRPLSKTVRFNVLHVEKHQIFGSARKQFVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
total genus 20
structure length 146
sequence length 156
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00366 Ribosomal_S17 Ribosomal protein S17
V PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j7aV00
5LL6X 5FLXL 5A2QL 3J80L 3J7AV 3JAML 3J81L 5IT9L
chains in the Genus database with same CATH superfamily
3KDFB 3FRPB 3KJOA 1SRUA 2A8VA 5FJ8G 3MAQA 2J7ZA 2R61A 3VYRA 3GTKB 2D9UA 4XQQA 3GTLB 1PXUA 3NWTA 3K57A 5IP9G 1TWHB 3R2TA 2RCNA 1XJVA 3Q0AA 2HCCA 3ER0A 4QY7A 2LXKA 2VQEL 2YTYA 1OO9B 3LWEA 3PF5A 2NUCA 4XYQA 1MJCA 4DKAC 3GP7A 1YHBA 4QB4A 2B2VA 1GOZA 1Q8KA 3NEMA 3NTIA 1PMRA 1SMXA 3PSIA 4TQUS 2AUJD 2UXCQ 2JK8A 5LMUL 2OTLA 3HS0C 1TWFB 4HSVA 4DV5Q 4BY7H 4UY8C 3BVGA 1LACA 3D6CA 3VR4A 4ZYSA 4YY3Q 2B3GA 4A93B 4C3JG 5C3WA 2A6ED 1IYJB 1Y1VH 3ITPA 3BYTB 5C4HA 3H09A 1XNRL 4XIGS 1GVPA 4LF6L 1EY7A 1A2TA 4DAYB 1N32Q 2ICEC 4LF9Q 1LV9A 1Y1WB 2OXPA 5COYA 4GOPC 2B8FA 3IAYA 1GHJA 2F0JA 4DR5L 2R93G 4KD4A 1WTOA 2EYMA 2PYKA 4HMJA 3J80c 3K0XA 1SJHD 2Z4IA 1M8AA 3M85A 1EIFA 5IGGA 4G7HC 1S5ED 4WJ4A 5C4ZA 3I55A 4A3IH 3CW2C 2K14A 2HIVA 3LNNA 1V8QA 5IGCA 2NN6G 4DAVA 4NPSA 3S2HH 4JYAL 4IN3A 4PMCA 1N33Q 1ZEQX 4MZ9A 1PH4A 1I6HH 1WFQA 2N78A 3PO2H 4IJHA 3EA6A 3GD7A 1H9RA 1SFOB 4TKOB 1X65A 4ZAIA 1CHPD 3C3LA 5C4XG 1NR2A 1IHZA 1JJCB 3CRLC 2C9OA 1HNXQ 1C0AA 1N9WA 3U58A 1YJ9A 3PIPA 2WAQG 3ND8A 3S15H 1FJGL 3PUWA 5FJ8H 1JJGA 1BDOA 4ZK9B 1STEA 4KKUA 2BDNA 2RA4A 5IP9H 2EJGC 3CRKC 1VQGA 1SBBB 2B8GA 4F88A 2YU9B 1DD2A 4H0LC 4IQZA 2PI2E 3H6MA 1GD7A 1SYDA 3R3OA 1WVLA 4QIWB 1EY9A 4BBRB 1CQVA 1WCMB 1PFSA 2XWBB 5J39A 1LTGD 2UUBL 5J22A 1I4PA 3H0GB 4B08A 4BWGB 5D14A 2JSOA 4GKJQ 4CGYB 3KF8A 1IYVA 1NMGA 1TIID 1BNZA 2AWOA 2CCZA 2RSNA 2NWGA 1TWAH 4YHHQ 4UDUC 4OELB 3RLOA 4XQNA 4LF7L 2Q8IB 4GN3B 3UE0A 4ZKCB 4JBJA 5GAGC 3AMUA 1K83H 2R93H 1STNA 1FR3A 1HZ9A 2YTXA 4DV1L 3D4DA 2KCCA 5BR8L 5DAUA 1Z7TA 1C9OA 1R9TH 4RMFA 2KHJA 2GVBA 1EEID 2PZUA 3A54A 1IBKL 3RUZA 3MC0B 2N88A 1VQOA 5FO8B 3HOZB 4HJ9A 3V96A 4U673 4RFBA 1PRTD 2UXDQ 1OXXK 2RBMA 2NZOA 1L0WA 5KNCA 1JOOA 2NN6H 3W2DA 4DV5L 3T53B 1L0YB 1F2ZA 3CCJA 2CWAA 1FGUA 2ZTCA 4YY3L 1SROA 2M00A 1ESFA 5GQOA 3KJPA 1EOTA 1EY4A 2KOLA 2ZM6Q 1RHPA 1TWGH 4LUZA 4HIOA 4PG3A 1BKBA 1SMYD 1E1OA 4KTAA 3J81j 5C4XH 2R6GA 3NHHA 4L63B 3T1YL 1VMPA 2JEBI 2VXWA 3UI2A 3S1RB 1NUCA 5IP7G 3K7AH 4S3SA 1IBLL 1EIYB 2G9DA 5C44G 4NXMQ 3HP3A 4A76A 4DV2Q 3OHXC 3PGZA 2WFWA 3D8GA 5ELDA 5I2XA 1ILQA 4N8X1 1KAWA 4FF4A 1N34L 2UXBQ 3GV6A 2BA1A 1EY6A 4R8NA 1KQSA 1D5MC 1HCZA 2ID0A 3CCLA 2A6HD 3S24A 1SNPA 3BDCA 2B63B 1A6XA 3U9OA 4BY1B 1YEZA 5DEHA 4DR1L 1D7QA 1HNXL 5CV5A 1BVSA 2EVBA 5I6WA 1XWEA 4GOPA 1TS2A 4K5WA 2UUCL 2KEDA 2A6EC 1OXSC 1B3AA 1HA5A 1SNOA 4K0KL 2N8NA 5E3FA 3J81L 1V1PB 4CJ2C 4FXKC 4NXNL 5CV9A 4JW0A 2ZJRA 5JVG3 3QOJA 3SE0A 1B9MA 1CUKA 2PQEA 1SNQA 2JA5G 1F9QA 3K7UC 2NTTA 2OF1A 4F87A 2EYJA 1H9SA 2K75A 1CK1A 1EYAA 4C3HG 1LM0A 1CM9A 4NMZA 3J7ZC 5E4XA 2KEEA 1SNDA 5IGDA 3KLRA 1OTCA 3TBIB 3F2UA 4DAPA 4A3GG 3A5UA 2FMMA 3PO3B 2KVMA 4HCSA 1GUSA 2VB2X 4KY6A 3PF4A 3QWNA 3P1HA 4N9TA 4YHHL 1TY0A 4RGMA 2LKVA 1IZ6A 4LW1A 4P75A 1VQ8A 2KBNA 4JK1C 4X6AH 4EVOA 1VF5C 2D0OA 4CKBA 5IP7H 1H9MA 2CH4A 1S40A 1Q12A 1W6KA 4A3BG 3KBGA 3KF6A 3ERQA 4KKTA 4LFCL 3J80E 5C44H 2CHBD 3IFDA 3HOYB 2K33A 3UDFA 4XDXA 1KLGD 1K8AC 4DV4Q 3C1EA 1YI2A 3M7GA 1KC8C 4UPAA 1JORA 1PH2A 1HRJA 4U68A 1QB5D 3EBEA 2GVAA 2QW7A 1TY2A 4PZ7A 4BS9A 5CR3A 3FVQA 4GLAC 3S1MB 1Z47A 3EIVA 1K3BC 3H91A 1HA6A 1MIUA 5I4DA 5FLMG 4WJ3M 5IT9E 1UEAB 3FPUB 1I5FA 1QNKA 4A3JB 2Q2HA 1VQJA 2F0OA 1KNEA 2A69C 4B9WA 1GO3E 2Z6KC 2QF7A 4EQ5A 1ENCA 2RKSA 4JI3L 4B3TL 4GNXB 4HJ5A 5KNDA 2MNAA 3BU2A 4DR3L 1TWAB 3NTKA 3FHWA 4QUCA 4P72A 4X62L 1QG7A 3TS0A 4PNYA 4ZKBB 2VUMB 1PFNA 3FKIG 2G9HD 4DV2L 1KDCA 1C8CA 2RQXA 5E7NA 2X69A 2R93B 2JA5H 3NBHA 4RHSA 2H5XA 1ESRA 4OHJA 4C3HH 2E2JH 2JXMB 2XVSA 1CKOA 4XQJA 2UXBL 4QIWE 5GROA 4IJLA 3IL8A 4A3KG 4A3GH 4A3EG 4QL5A 2CFMA 3S1NB 4B3RQ 4JV5L 3K58A 2HIXA 1EQTA 2F0KA 2E2IH 1M4VA 3IFTA 2RSOA 3J7AF 4H02A 2K5VA 3KOJA 1ET6A 1PZJD 1S4ZA 4OX9L 1YNJC 1VQLA 2Z0SA 5C0XJ 4LJZC 1IYUA 2H1EA 1B8AA 2ZJQA 3CCMA 4A3BH 2KECA 4LWCA 1HUNA 1A62A 1EYCA 1SMYC 1T5EA 2Q8RE 4IPDA 3M3YB 4PZ8A 3OSOA 3GTPH 1CKNB 3HOVB 1RCVD 4JI2L 3DWQA 3T1HL 1EOVA 3K7AB 2NB0A 1VF7A 2I07B 3AFPA 2E2HB 3W5OA 2V4DA 4A3CG 2VW9A 1WTXA 4JBWA 2K03A 3I4MG 1GUWA 4ABNA 5C3XA 1WTHA 1HNWQ 2GA4B 2VL6A 1CT1D 1QUQB 5AFWA 1Q90A 2JA8G 3K5NA 5ELOA 5FLMH 3PCOB 5ELCA 1WOCA 1LTAD 1D5ZC 3M4YA 1IW7C 1GUNA 2KCNA 1BQQT 4B9XA 4DNRB 3U50C 2KCTA 2X6LA 2EY1A 5C4JH 2TSSA 4C2MB 4JBMA 3MFGA 4NP5A 1WJJA 1X55A 2LS01 2MFIA 2A6HC 1QJOA 4OL7A 1JOKA 1GUTA 5KRUA 3FKIH 1H95A 2F0QA 4FDBA 4FNFA 4RGOS 2QKIC 1VQPA 1SAPA 3I7FA 1EU3A 3DWPA 2G5DA 2K05A 4DK0A 1GKHA 2JEAI 1PA6A 3MTSA 1AEXA 1LO5D 2OTJA 3V2TA 2RCFA 5HGQA 2Z6BA 4A3KH 4HIKA 4A3EH 4KN7C 2EJMA 3EROA 3W1BA 3Q23A 1GUGA 3W1GA 4K2KA 4C1NI 1AZQA 3ONAB 1I3QB 1SEBD 1K8OA 4AQYQ 1BCPB 5A2QE 4RKLA 1DXMA 1TWCB 1KD1C 3FP9A 2HT1A 2PMZE 3CC7A 2SDFA 2UU9Q 4KY5A 2IJ0A 1BXTA 4JI8Q 3VYUA 4LMQD 1PTOB 2EYPA 3AEVA 3B6YA 4A3FB 1HZBA 1ASZA 3T51B 1J6QA 4DNTB 2L9HA 3L0OA 3SXHA 1W2BA 1SE2A 3D4WA 1Q7YC 1DOMA 4CDDC 2E5LL 4A3CH 1Q3LA 2ZT9C 1UE1A 3GTGH 3I4MH 2K1BA 2Q2UA 2JJQA 1E2VA 3NP8A 4IALA 2PPBC 3TDQA 1RODA 5M5XB 2JA8H 4B3RL 2HHHL 4IUNA 5JAVA 2Y0SE 1J8IA 3D6WA 3MFYA 1Y69U 1FD7D 5CBEE 1AP0A 1LTSD 2IX3A 3HOUG 2XTIA 3VR6A 3CCVA 5AJ3L 3HOXG 2WB1B 4C3IG 3L2PA 2QDBA 4ZUIA 3F1ZA 3M4OB 5GADC 1O78A 2F0PA 1TU2B 2F1MA 5M3FB 1B7YB 2IL8A 3P7JA 1KHIA 3BYYB 1JOQA 3RLNA 2ES2A 1NJIC 4EQNA 2PI2A 4ID6A 5DNFA 3R8BA 2K5NA 5M5YB 1MJEA 4GLVB 2LY7A 1I6VC 3HOWG 3K8AA 4CDFC 4I7AA 2L12A 4LF8Q 3K5OA 1A63A 2QGQA 4A3DB 1XNQL 4K8IA 2AHOB 4LF5Q 4WFN3 3J81i 1LABA 1STBA 4KHZA 1LT4D 2E2DC 1XTCD 2CKZB 1RTNA 3JC66 1E3PA 3PIOA 1E7ZA 1EQRA 2NVTH 4HR7B 2JA9A 5IWAQ 2A68C 5FO7B 2HQEA 1PYSB 4TSSA 3I8ZA 4HMIA 4Y52H 1NE3A 4GZYC 3E9HA 3SGIA 3RZDH 1STGA 2IX1A 1LTID 1CKMA 3SK8A 3MXNB 2FINB 1CTMA 3QIAA 1G51A 5BN3A 1VQBA 1K0RA 4JG2A 4KY7A 5EPKA 1A0IA 2SNMA 4GKKQ 2V1CC 2F0UA 3OTOQ 4XXEA 1ZYRC 5JEAG 1JICA 5FLXc 2XWJB 5C5LA 3HFZB 3I4NB 2BE5C 4YWKA 1NAPA 1O7LA 1I94Q 4P74A 3GTOH 2RDHA 4EQOA 2NBFA 3CPWA 4HJ8A 1NCVA 3ULJA 1G2TA 2PW5A 3G7LA 1TVXA 3G48A 4KJNA 2MJ8A 2ZXOA 3HOUH 2L1BA 2EJFC 2UUAQ 1Q81C 3M4QA 1E24A 3GTQB 3HOXH 5M5WH 4C3IH 1VCIA 3CC2A 2N55A 4AIMA 2AQ1B 1G291 1VQNA 4YWMA 2UU9L 1DONA 1D1IA 4A3MG 2JQOA 2ZTEA 2E75C 1EU4A 1Q1BA 1HQMC 1LUZA 1ICWA 1F2MA 1IKLA 3JAML 1HFNA 4WJWA 2OQKA 1RIPA 4JI5Q 1I4RA 3L7ZC 1F2LA 4ZQ3A 1M90C 1SJED 1P16A 2F0VA 1AFPA 1VQIA 2A19A 4DXFA 4H7BA 3HOWH 2WINB 5J1ZA 1A3UA 4JI7Q 2C35B 3CPFA 1Q86C 1DM0B 4JI6Q 1F9PA 1TT2A 2LSSA 5EBCA 3KFUA 1HHVA 2JN4A 1JMCA 2PQAB 2A74C 4Y7NB 5TSSA 2R7ZG 2XRQD 2YYZA 3U4VA 4DUZL 1YHQA 2NVQH 4JI4L 4LFBL 1CA6A 4F7XA 4G7OC 4DV7Q 4JI0Q 1JE4A 2K6AA 1XYIA 2EIFA 1PFBA 3CCRA 1PH6A 2A69D 2K5HA 1HZCA 3U9SA 3G6EA 5M3MB 1C48A 1J9OA 3D31A 4P2CB 3KLSA 4CKEA 4C3JH 4DV6L 3KDFA 4GOPB 4AH6A 1EEFD 1B50A 1E2ZA 5KYLA 1E2WA 4KJOA 1EIHA 5JEAH 2VQFQ 5ELEA 2X6GA 2FFKB 1J5EQ 4B3ML 4PZ6A 3J81c 3RD4A 3OWEB 5ISRA 1JWUD 1OXUA 4UAIA 5HY6A 1WTPA 4X3TA 2DUDA 1UNSA 1B70B 1QNUA 1K28A 1NY4A 1CZGA 2B2UC 4JVZA 4LF5L 2F03A 2L55A 2WV6D 1RD9D 1MI2A 2EOTA 2GN5A 1DYQA 4K6LA 3K59A 2YV5A 4DR2Q 2R7DA 2NVYH 2UXCL 5IWAL 4HCEA 1YNJD 1HR0W 4DAYA 1VQHA 5CV4A 2MHVA 3CCUA 1L1OC 3CQZH 3MWYW 3P20A 4NW2A 2QILA 2IT1A 3RR5A 3OMCA 4O1NA 3J80L 4L6TB 4MTNA 1BBWA 1XPOA 1N32L 4LF9L 4NB3A 1O7YA 1JB7A 3OMGA 1CFMA 2K28A 2KUMA 3DEPA 3MA2B 2PO4A 3HG9A 4NDXA 4RCNA 3STBD 5HURA 1OXTA 3BZDB 4DUYQ 1I94L 4O0AA 1WYDA 1E1TA 1OXVA 2XRSD 1U4LA 3RN5A 3H3VH 3ULPA 5C5MA 3I56A 2MPMA 4QUFA 4RAUC 1F2YA 4YIJA 5IT9L 2R7ZH 1I4HA 1X3EA 1IW7D 1GXDC 3H15A 4BBSG 3S2DH 4DFAA 5CBAE 2J0TD 4OONA 2UUAL 3E5SA 3CCEA 2PZTA 1LTRD 2RHSB 2IX0A 4RWSC 1G6ZA 1WD1A 3MEHA 2VY3A 1N33L 4OO1G 1EZ6A 3C2PA 2KJXA 2WB1E 5D3DA 3NTHA 5CMDA 1I4QA 1K3RA 1K9MC 2PMZB 2E76C 1E22A 4BY7B 4JOIC 4R4QA 4JI5L 2Q8TA 3D0FA 2DNEA 2JA6G 3S14H 1SYEA 4JI1Q 4I65A 4ZRZA 3TP6A 3RZOH 1Y1VB 2QA4A 4JI6L 3LX0A 3OPOA 4LUVA 4TVAB 2F4VQ 2B2YC 2F0NA 3RN2A 2AQ2B 2AKWB 1PYBA 1I50H 2ALYB 3ND9A 1ENFA 2K5WA 2MP1A 3NXWA 1IKMA 2F3VA 1Q46A 5FK9C 4DA2A 1PH1A 3J7A5 5EKIA 2Y0SB 3RNUA 3HRZC 1D8LA 4A4IA 5GAHC 4A3IB 4GKJL 3ZJYC 5JOBA 3WDNA 4IFDJ 2EXZA 1LT5D 1DJRD 4GNXC 4CJ0B 4LK1C 1VQCA 3EFXD 3E6ZX 3SHLA 1G6PA 1G8ZD 1KDBA 3UDIA 4CBVA 3GTMH 4JC0A 4DR4Q 2J4XA 5FLXE 1SYFA 5DLQE 3S2HB 2EZVA 1TKWB 2JYOA 1ILPA 1I6HB 3PO2B 1YHAA 4LNQA 3CAMA 1RTOA 5FKAC 4AYBB 4MNOA 4OEMB 4A93G 1UUPA 3TN2A 1K73C 1KAAA 4PMBA 4DR7Q 2QEXA 4UHVA 2CW0C 5CV7A 2JA7G 1V1QA 3HKZB 4HIMA 3S15B 2KHIA 3I4OA 2UXDL 4BBSH 1X32A 3DXJC 1VQ9A 1FNUA 4FO2A 1DOLA 1O7IA 3DHQA 2EPBA 3S17H 1HQRD 3BZCA 2DJGC 3FDTA 2D5DA 5ELFA 1STAA 4OO1H 1PYWD 3CP0A 1JC7A 2NVQB 2ZM6L 2F0DA 1FGBD 3G6JB 3F2BA 3H3VC 2OWOA 1XMQQ 5EPJA 2LXJA 3S1QH 1YITA 2ICIA 4GN5A 4YCWA 2F0MA 1Q8IA 3CMEA 1PH8A 4JPBW 2JA6H 2D62A 1EWCA 1II3A 4C3JB 3BG3A 3UDGA 2PNRC 4POFA 5D3IB 4A75A 4RHRA 1KDAA 1TXYA 4NXML 2B2UA 2QDLA 2BOSA 1ENAA 1HNZQ 1K83B 2NVXH 1JQYD 4IOCA 3SR1A 3S16H 2F0HA 3L3OC 5KIXA 3FEWX 3WWVA 3AQQA 5A2QL 2K5DA 2K52A 1R9TB 1XMOQ 4R8IA 2A68D 5CGKA 1YNND 5H1SE 1EFWA 3NENA 4ILWA 1WTWA 1L1OA 1X6OA 3GTLH 4KV6A 5K5PA 4C1NK 1TWHH 3OOCA 2RDFA 2XGTA 5EQ0A 3SVMA 1LTTD 4E6IA 3ERSX 4KHPQ 2IY5B 1HXYD 4O2DA 3HGBA 5FO9B 4BBRG 1ZYRD 5I6YA 4IUQA 2BE5D 1TWFH 1TWGB 2FJ2A 2Z1CA 1EWIA 3H0GG 1T9HA 3Q22A 4DV3Q 1HR0Q 4POGA 5C4XB 1UE6A 3Q6SA 2RDGA 4LFAQ 3RMHA 3J7YW 4A93H 2JA7H 3F2CA 4H13C 2FMCA 2WAQB 3JAMi 3WOEA 3E0JA 3CF5A 3STBC 1MSGA 1FNVA 3BDOA 1BCPC 1U4MA 1A2UA 4X64Q 5C0XI 3VR3A 1YZ6A 2EY6A 3S2DB 1JWMD 1P8LA 3SEBA 1PTOC 3HOZG 4IPCA 1LLRD 1KABA 1EYDA 1SSOA 1VMCA 2OEOA 1CSPA 1HTPA 4JOIA 3TSSA 1U9RA 2CQOA 4G7ZC 1XTDA 3NWSA 2VQEQ 2ZJPA 1M1KC 2K7VA 4R4OA 1HZAA 1X3GA 1VQFA 4V0BA 2PW7A 2B2YA 4DV4L 1SFOH 5LMUQ 1CA5A 4K5VA 1H9KA 2NZHA 4P73A 4X66Q 3AU7A 1VQ7A 1Z6HA 1VQEA 2B2TC 4R4TA 1UE7A 5CV8A 1VQ4A 1UWVA 2ATWA 4FF3A 2K50A 3OW7A 1EUJA 1JJ2A 1DZ1A 2C5CA 3FPPA 3A56A 1PRTB 1XNRQ 4LF6Q 5T1GA 1RL2A 1MD2D 1AH9A 1T5XD 4C56C 2YU9H 3QB3A 4GNXA 2ASBA 4DR5Q 3BVMA 4OGQC 2O5IC 4BBRH 4QQBX 2F0EA 4RKBA 2DN8A 1V9PA 2ZXPA 3EVQA 3HEJA 5EKLA 3BZKA 1AW7A 1YNXA 4UP9A 3KYHC 3H0GH 1X54A 4J6HA 3M7NA 3A8IE 1JE5A 3I3CA 3GTMB 3J80i 2R3ZA 1HNZL 2B63G 2CH4W 3QR8A 4OWTB 4QGUA 1B4OA 1V43A 4ALPA 1C4QA 3PUXA 4BY1G 1VQKA 3N52A 4Z9CB 1S72A 1X56A 2L15A 5C44B 1QILA 4JYAQ 3VR2A 1CHQD 2Z8LA 4DGZA 4DNIA 1G91A 2M9VA 5JJLA 1WTQA 5FOBB 4XYOA 3I91A 5C0XG 5JJIA 3L9AX 2F0GA 4M1UB 2SNSA 4PQXA 1PZKD 3I2ZA 3A8KE 1R4PB 1LTBD 4LF4Q 3HOZH 3S17B 2MQHA 2SEBD 1FJGQ 2MO0A 1CKNA 3I72A 4UP8A 2AMCB 4X3UA 1A8VA 5IIFA 1K8MA 1KL9A 3JAMc 2KQ3A 4X3KA 1CI3M 2F3IA 3PO3G 4RCOA 2JA6B 1U5KA 2JP1A 1QUQA 2DY7A 4AYBE 1VQMA 1IL2A 4J15A 2DNCA 2UUBQ 1BO0A 2EYLA 5A35A 3S1RH 3HKZE 1XX8A 2MO1A 2EQSA 1HNWL 4UP7A 1EYGA 3H3VI 2PZWA 3GDEA 3WOFA 2OT2A 2JA5B 3HOYG 2O5JC 1LT3D 1ONLA 3KF8B 4M8AA 4C3HB 2E2JB 5JPMC 5IYCG 2N49A 4A3GB 1YNNC 1BCPF 1QWYA 4DV1Q 4R4IA 5BR8Q 5F2DA 1XPRA 2E2IB 2F0TA 5NUCA 1QZGA 1TQOA 1IBKQ 5EKKA 4QF4A 1VQ5A 1PTOF 1XPUA 2JE6I 2Q2IA 4IO9A 2B63H 4A3JG 3QO2A 3NUCA 1MHWC 1RKNA 3HKSA 3VYSA 1SNMA 4BY1H 4A3BB 4X66L 4QJFA 3M9BA 3G4SA 1PH9A 1SE4A 3NE5B 1BBXC 1N36Q 3GTPB 1ZKOA 3W3AA 2QEJC 3I4LA 1AZPA 2JA7B 1YIJA 1U4RA 5C0XH 2EDGA 1PDQA 4MIUA 1TS4A 5BN4A 2VUMG 4DV0Q 2IHEA 4IPHA 4PV1C 3T1YQ 3D4RA 4DF7A 4AQYL 5JJKA 5T1IA 4L8JA 4Q0FA 2B39A 2EYFA 4GS3A 3UE1A 1S3OA 4XTCS 4K14A 1IBLQ 4IUTA 4XT1B 4R1JA 1K8GA 2HCIA 3K0YA 4EQPA 3GV3A 4OXPA 2PNHA 1ML0D 3F2DA 4JI8L 3PO3H 3I70A 5ELNA 5C4JB 4KN4C 4WRDA 3SK6A 3AFQA 2QCPX 2Z4HA 2CW0D 3PIP3 3LWUA 2CWPA 1HPCA 4ODGA 1LTLA 4KMUC 1N34Q 3M4PA 5IYBG 1AE2A 1SYCA 2WAQE 1STYA 2B2TA 5IT9c 1JR0D 3FKIB 1BF4A 2AUKA 2B2WC 2KENA 1GHKA 1HTLD 3NBIA 1UE5A 4H44C 4LUOA 3GTJH 3HOYH 4DR1Q 2PCFB 4V190 3TRZA 2D2CC 5KEEA 1JT8A 2LMCB 4GLXA 3HOVG 4LF4L 5IYCH 4A3KB 2UUCQ 1D1KA 4CKCA 4A3EB 4RA8A 1WI5A 4HIDA 1NNXA 4K0KQ 1E0BA 3AB9A 2YTVA 4OO1I 1ZXTA 4NXNQ 2RHQB 4DN4M 3S1MH 4G57A 3MXGA 4L5RC 2BA0A 2MUYA 3QJYA 1PHJA 4FYDA 3UDXA 3HZXA 1UAPA 1YJNA 3SDZA 4A3JH 2F0FA 4FF2A 1KRSA 5E4WC 4K6DA 3OW2A 1SYGA 4LF8L 1PH3A 4G4KA 5J3BA 1G2SA 1EQVA 1H9SB 4YCVA 3PV0A 1NBWA 2TMPA 2LFNA 1U0LA 2R7FA 5CC4A 3K5MA 1SE8A 1QOHA 5JVH3 2VUMH 1QVFA 1PZID 4N9PA 3MXNA 3GTGB 3I4MB 3OIPA 2R92G 4RH6A 5FLXL 5DM63 4B3SQ 2JA8B 3PMFA 4LFCQ 5BN5A 2VNUD 1AE3A 2CQAA 2DJFC 4J1MA 5LHY1 1QZHA 1IXRA 3R93A 5IYDG 1A3VA 4A3MH 3KUPA 3S1NH 1MBYA 5CYUA 1B2TA 2KHSA 3CMAA 3KF6B 4MTKA 4GKKL 3E9IA 2E74C 3OTOL 4R9WA 1A15A 4GN4B 3CCQA 5EGTA 4OWWB 3VDYA 5LMNW 1B3QA 3S9WA 5I9PA 5IYBH 4MHEA 2EXDA 3MHBA 3EQLC 1FVIA 1B9NA 1N36L 2E8GA 1BCPD 1FL0A 1JB3A 3VA7A 2AWNA 2K04A 3SK5A 5I9OA 1QCBD 3EJIA 4A3FG 4DV0L 3M3YH 3DWAA 3A0JA 5DM73 4IZ8A 3F8TA 4JCVE 3HOVH 1VDZA 4JI3Q 2H4OA 4HSPA 1PTOD 4FXDA 2DY8A 4B3TQ 1Z9FA 3MZ5A 3C46A 2O2LD 4N8FA 2N3SA 1N8RC 1NTGA 2ENBA 1SNCA 3KLSX 2E2HH 3Q8DA 5C3EG 3NQIA 1EY5A 4DR3Q 3A55A 3ZYYX 4X62Q 4K5XA 3VR5A 3IKJA 4F8MA 3JAME 4PMWA 1CZWA 2BH8A 2NVTB 4KLKA 4CDCC 1JCKB 2FXQA 4BA1I 1KNAA 2I0QA 3PUYA 1D2BA 3VA5A 1HUMA 2RVLA 3RZDB 2PQAA 1F77A 2WKCA 4KK7A 3NQTA 4DPGA 4JI7L 4C2MH 2WB1G 2M2LA 4JV5Q 1Y8PB 3EN2A 1RF2D 3A7AB 3NBHB 4ZUJA 3TMEA 5M3FG 1C7YA 4APVA 1V1OA 1MKHA 3TEHB 5IE8A 4HEDA 4KD3A 4OX9Q 4OWXB 1Y14B 2WACA 5CORA 3K6OA 1VS0A 1L1OB 4DU9A 4DV7L 4JI0L 1YBYA 2NTSA 1BR9A 1GUOA 4YWLA 2R92H 4HN7A 4DK3C 3GTOB 4WORA 4QMGA 3PUVA 2HQLA 4ME3A 1CQFA 1QVCA 2IW3A 3CHBD 1B44D 4A3DG 1O7ZA 2XNAC 5IYDH 3X3MA 3BDLA 3HOUB 2KA7A 4DAMA 1DCZA 3H94A 4NKLA 3PUZA 4JI2Q 4BXXG 3T1HQ 4X65Q 1XXGA 3HOXB 4Q5VA 4ZLTF 3KBXA 4C3IB 1EFID 2VQFL 5M5WB 4KKSA 1J5EL 1I3QH 2A73B 3CD6A 5M9OA 1W3SA 1NR4A 1H9JA 4FXGC 1TWCH 1PH7A 4RG1A 1KLUD 1IBMQ 4LAAA 4IUVA 1HJPA 3CCSA 3C1FA 2EYHA 3GO5A 3KK7A 1X3FA 2B2WA 2KCMA 5D65A 2F0LA 1PTOH 1B1ZA 4A3FH 4IUUA 3HOWB 1SLJA 1I4GA 4IFDI 1S5DD 1L2FA 4DR2L 1Y1WG 1SXTA 1PLFA 1PH5A 3A7LA 4R4CA 4B3SL 1O80A 3I4NG 4A3LG 3A5ZB 1GM5A 5C3EH 5KNBA 3K5LA 3MXPA 3GTJB 5IGBA 1DOKA 1QE6A 1X3PA 1S5FD 2EYOA 5IODA 5M5XH 1U4PA 3FMCA 4CHTB 3NELA 3DEOA 1BUVT 3TQYA 5G3LF 1SR3A 2WIIB 2IHFA 4DR6Q 5CV6A 2B29A 2ZXRA 4DUYL 3I90A 2EE1A 3TZDA 1BOSA 1HH2P 3SK4A 1X3QA 3K80C 1KIXA 3M4OH 4DK1A 1X9NA 4CDEC 1B53A 1JWSD 2WKDA 4FP5D 5E1FA 5M3FH 1GJXA 3QOLA 1EL0A 2OQ0A 4I7ZC 5M5YH 4QCLA 4K8JA 3R2IA 3CU7A 3X3NA 3TP5A 1KTKA 2MGSA 4ZCKA 2XIWA 1UEBA 5EPLA 3K81C 3CC4A 3GTKH 5JPNC 4A3DH 1KXLA 4IUPA 2NVYB 4BXXH 2Z9HA 3URYA 3O13A 3MVVA 2E5LQ 1V1PA 2EY2A 1Y8NB 1WTVA 3CQZB 3MEFA 1EWHA 3ICEA 3TP7A 1YJWA 4JBKA 2I5LX 4JI1L 1WCMG 4YCUA 3J81E 2L4NA 4A3MB 4O42A 5M3MG 2HHHQ 2B2VC 2IWHA 2F4IA 2F4VL 1RJTA 4EGVA 1PRTC 4HTHA 2XSCA 4KI0A 2BDOA 3AYHB 3Q24A 3N6RA 4RGNA 5AJ3Q 4IFDG 4BA2I 2I5HA 1Y1WH 2F52A 1TS5A 1STHA 4HAEA 2A1AA 1EZ8A 3I4NH 4A3LH 5JJZA 1LT6D 1D5XC 1ET9A 3A8JE 5EAYA 2R7ZB 1NMFA 5LMNQ 1D6EC 3DMUA 5I2YA 1TS3A 2HUGA 3J7AV 4DXGA 4ULLA 3V05A 3DLLA 2NZ1D 3VYTA 4X65L 2AQ3B 3LGJA 5KGUA 4DR4L 5EBDA 1RDPD 2Q2TA 1L0XB 3CKIB 4CJ1B 1XNQQ 3GTQH 4EX5A 1R4QB 4L5TA 1IBML 2K5QA 2F3WA 1SDFA 4P71A 2BH2A 2OCEA 2VZAA 3A74A 3E3XA 3GQBA 1MGSA 3IRBA 1TR5A 4DR7L 3S14B 3TREA 2VS1A 4IOAA 2I5MX 3TS2A 3RZOB 4IURA 4J8QA 3CXCA 4OIKA 1PVOA 5EJWA 3NK9A 4L5QA 3D3RA 3DM1A 5K36G 1I50B 1FNWA 1F9SA 1EY0A 1PFMA 2O4XA 1F9RA 1ICFB 3NSWA 1XMQL 4Y7NH 2R92B 3T16A 1SE3A 3OWFA 4MN3A 2CVRA 1VQDA 4DR6L 3BS1A 2K4KA 1WCMH 2F0WA 5LL6X 3OIQA 1SN8A 2XN9C 5C6AA 5JEAJ 2DGYA 2NYZD 5M3MH 5L37A 3ULLA 4K2LA 5IGFA 1Y8OB 3E0EA 3BVZA 1AN8A 3NPPA 2L5TA 5IGEA 1FYCA 4FF1A 4IFDH 2K01A 4BY7G 2F0IA 1IL8A 3T56B 4X3SA 1K0SA 3RLFA 1KRTA 2HDMA 2EY5A 1XMOL 1S5BD 5G3LD 1W6JA 1VQ6A 1EIGA 1Y1VG 5HGTA 2ZTDA 5KYIA 2K32A 4XT3B 2SOBA 3OYYA 1EQQA 4DK6C 1HFGA 4KHVA 3I73A 4HJ7A 2WP8J 5GAEC 4BBSB 2FHTA 3TP8A 4OIJA 4KHPL 1DGSA 2VB3X 2D0PA 1EY8A 2HDLA 2I46A 3G71A 5IY0A 5C3EB 3P75A 2P5ZX 3QG1A 2F0SA 5IOCA 2Y0SG 3KLWA 4FVMA 3PQIA 1Q82C 4A3IG 4DV3L 2L11A 1HR0L 2L0CA 5LL6S 3S1QB 4LFAL 5ELBA 4DUZQ 1CSQA 1WD0A 4RGTA 4JI4Q 4LFBQ 2A5HA 2BCOA 1WTRA 1Q1EA 1NSNS 1S5CD 1MSHA 3MXUA 1BBUA 4TRDA 2NN6I 3BJUA 4HJAA 3TZUA 1YVCA 1ASYA 2IPKD 2Z6KA 3T4AC 3DUZA 1A3TA 1LYLA 4L5SA 3U4ZA 3PO2G 4X64L 1QVGA 4DV6Q 1PV4A 5K36H 5LMNL 2NVXB 4AYBG 3S16B 1PRTF 3T13A 3DM3A 1SYBA 4IPGA 2HD3A 2RF4A 4LF7Q 1VQAA 3PIO3 4ME5A 1I4XA 4B3MQ 3HKZG
chains in the Genus database with same CATH topology
3FRPB 3MAQA 2J7ZA 2R61A 3VYRA 3GTKB 2D9UA 4XQQA 3GTLB 1PXUA 3NWTA 3K57A 1TWHB 3R2TA 3Q0AA 2HCCA 1OO9B 3LWEA 2NUCA 4XYQA 3GP7A 4QB4A 2B2VA 1GOZA 3NTIA 1PMRA 4TQUS 2AUJD 3HS0C 1TWFB 4HSVA 3BVGA 1LACA 3D6CA 3VR4A 4ZYSA 4A93B 4C3JG 5C3WA 2A6ED 3ITPA 3BYTB 5C4HA 3H09A 4XIGS 1EY7A 1A2TA 2ICEC 1LV9A 1Y1WB 2OXPA 5COYA 2B8FA 3IAYA 1GHJA 2F0JA 4KD4A 1WTOA 2EYMA 2PYKA 4HMJA 1SJHD 2Z4IA 1M8AA 3M85A 5IGGA 4G7HC 1S5ED 5C4ZA 3LNNA 1V8QA 5IGCA 2NN6G 4DAVA 4IN3A 4PMCA 1ZEQX 3EA6A 3GD7A 1H9RA 1SFOB 4TKOB 4ZAIA 1CHPD 3C3LA 1NR2A 1IHZA 3CRLC 2C9OA 3ND8A 3PUWA 1BDOA 4ZK9B 1STEA 4KKUA 2BDNA 2RA4A 2EJGC 3CRKC 1SBBB 2B8GA 4F88A 2YU9B 1DD2A 4H0LC 4IQZA 3H6MA 1SYDA 3R3OA 1WVLA 4QIWB 1EY9A 4BBRB 1CQVA 1WCMB 2XWBB 5J39A 1LTGD 5J22A 1I4PA 3H0GB 4B08A 4BWGB 5D14A 2JSOA 4CGYB 3KF8A 1IYVA 1TIID 1BNZA 2AWOA 2RSNA 2NWGA 4UDUC 4XQNA 2Q8IB 4ZKCB 3AMUA 1STNA 1FR3A 3D4DA 2KCCA 5DAUA 1Z7TA 3A54A 1EEID 2PZUA 3RUZA 3MC0B 2N88A 5FO8B 3HOZB 3V96A 4U673 4RFBA 1PRTD 1OXXK 2RBMA 5KNCA 1JOOA 2NN6H 3W2DA 3T53B 1L0YB 1F2ZA 2M00A 1ESFA 1EOTA 1EY4A 2KOLA 1RHPA 1SMYD 4KTAA 2R6GA 3NHHA 4L63B 1VMPA 2JEBI 2VXWA 3UI2A 3S1RB 1NUCA 4S3SA 2G9DA 3HP3A 3OHXC 3D8GA 5ELDA 5I2XA 1ILQA 4FF4A 3GV6A 2BA1A 1EY6A 4R8NA 1D5MC 1HCZA 2ID0A 2A6HD 1SNPA 3BDCA 2B63B 1A6XA 3U9OA 4BY1B 5DEHA 5CV5A 2EVBA 5I6WA 1XWEA 1TS2A 4K5WA 2KEDA 2A6EC 1OXSC 1B3AA 1HA5A 1SNOA 5E3FA 3J81L 1V1PB 4CJ2C 4FXKC 5CV9A 5JVG3 3QOJA 3SE0A 1B9MA 2PQEA 1SNQA 1F9QA 2NTTA 4F87A 2OF1A 2EYJA 1H9SA 1CK1A 1EYAA 4C3HG 1CM9A 4NMZA 5E4XA 2KEEA 1SNDA 5IGDA 3KLRA 3TBIB 3F2UA 4DAPA 2FMMA 3PO3B 2KVMA 4HCSA 1GUSA 2VB2X 4KY6A 3QWNA 3P1HA 4N9TA 1TY0A 4RGMA 2LKVA 4JK1C 4EVOA 1VF5C 4CKBA 1H9MA 1Q12A 1W6KA 3KBGA 3ERQA 4KKTA 3J80E 2CHBD 3IFDA 3HOYB 2K33A 4XDXA 1KLGD 3C1EA 3M7GA 1JORA 1HRJA 4U68A 1QB5D 1TY2A 4BS9A 5CR3A 3FVQA 3S1MB 1Z47A 3H91A 1HA6A 5I4DA 5IT9E 1UEAB 3FPUB 1QNKA 4A3JB 2F0OA 1KNEA 2A69C 4B9WA 2QF7A 1ENCA 2RKSA 5KNDA 1TWAB 3NTKA 4QUCA 1QG7A 4PNYA 4ZKBB 2VUMB 1PFNA 2G9HD 1KDCA 1C8CA 2RQXA 2X69A 2R93B 3NBHA 4RHSA 1ESRA 4OHJA 2JXMB 2XVSA 4XQJA 3IL8A 3S1NB 3K58A 1EQTA 2F0KA 1M4VA 3IFTA 2RSOA 3J7AF 1ET6A 1PZJD 1S4ZA 1YNJC 5C0XJ 4LJZC 1IYUA 2H1EA 2KECA 1HUNA 1EYCA 1SMYC 1T5EA 2Q8RE 3M3YB 3OSOA 3HOVB 1RCVD 3DWQA 3K7AB 2NB0A 1VF7A 2I07B 2E2HB 2V4DA 1WTXA 4JBWA 2K03A 1GUWA 4ABNA 5C3XA 2GA4B 5AFWA 1CT1D 1Q90A 3K5NA 5ELCA 1LTAD 1D5ZC 3M4YA 1IW7C 1GUNA 2KCNA 1BQQT 4B9XA 4DNRB 2X6LA 2EY1A 2TSSA 4C2MB 3MFGA 4NP5A 2LS01 2A6HC 1QJOA 4OL7A 1JOKA 1GUTA 5KRUA 2F0QA 4FNFA 4RGOS 2QKIC 1SAPA 1EU3A 3DWPA 2K05A 4DK0A 2JEAI 3MTSA 1AEXA 1LO5D 3V2TA 4KN7C 2EJMA 3EROA 3Q23A 1GUGA 4K2KA 4C1NI 1AZQA 3ONAB 1I3QB 1SEBD 1K8OA 1BCPB 5A2QE 4RKLA 1DXMA 1TWCB 2SDFA 4KY5A 2IJ0A 1BXTA 3VYUA 4LMQD 1PTOB 2EYPA 4A3FB 3T51B 4DNTB 2L9HA 3SXHA 1SE2A 3D4WA 1DOMA 1Q3LA 2ZT9C 2K1BA 1E2VA 3NP8A 4IALA 2PPBC 3TDQA 1RODA 5M5XB 4IUNA 5JAVA 1J8IA 3D6WA 3MFYA 1Y69U 1FD7D 5CBEE 1AP0A 1LTSD 2IX3A 3VR6A 2WB1B 4C3IG 2QDBA 4ZUIA 3M4OB 1O78A 2F0PA 1TU2B 2F1MA 5M3FB 2IL8A 3P7JA 3BYYB 1JOQA 4EQNA 4ID6A 5DNFA 3R8BA 5M5YB 2LY7A 1I6VC 2L12A 3K5OA 4A3DB 4K8IA 4WFN3 1LABA 1STBA 4KHZA 1LT4D 2E2DC 1XTCD 1RTNA 4HR7B 2A68C 5FO7B 2HQEA 4TSSA 3I8ZA 4HMIA 4GZYC 1STGA 2IX1A 1LTID 3SK8A 2FINB 1CTMA 3QIAA 5BN3A 4KY7A 5EPKA 2SNMA 2F0UA 4XXEA 1ZYRC 5JEAG 1JICA 2XWJB 5C5LA 3I4NB 2BE5C 1NAPA 1O7LA 2RDHA 4EQOA 2NBFA 1NCVA 1G2TA 2PW5A 3G7LA 1TVXA 4KJNA 2MJ8A 2ZXOA 2L1BA 2EJFC 3GTQB 1VCIA 2N55A 2AQ1B 1G291 1DONA 1D1IA 2E75C 1EU4A 1Q1BA 1HQMC 1ICWA 1F2MA 1IKLA 3JAML 1HFNA 4WJWA 1I4RA 3L7ZC 1F2LA 4ZQ3A 1SJED 2F0VA 1AFPA 4DXFA 4H7BA 2WINB 5J1ZA 1A3UA 1DM0B 1F9PA 1TT2A 5EBCA 1HHVA 2A74C 4Y7NB 5TSSA 2XRQD 2YYZA 1CA6A 4F7XA 4G7OC 1JE4A 2K6AA 1XYIA 1PFBA 2A69D 3U9SA 5M3MB 1C48A 1J9OA 3D31A 4P2CB 3KLSA 4CKEA 1EEFD 1B50A 1E2ZA 5KYLA 1E2WA 4KJOA 1EIHA 5JEAH 5ELEA 2X6GA 2FFKB 3RD4A 3OWEB 5ISRA 1JWUD 1OXUA 4UAIA 1WTPA 4X3TA 1UNSA 1QNUA 1CZGA 2B2UC 2F03A 2L55A 2WV6D 1RD9D 1MI2A 2EOTA 1DYQA 4K6LA 3K59A 4HCEA 1YNJD 4DAYA 5CV4A 2MHVA 3MWYW 3P20A 4NW2A 2QILA 2IT1A 3OMCA 4O1NA 3J80L 4L6TB 1O7YA 3OMGA 1CFMA 2K28A 2KUMA 3DEPA 3MA2B 2PO4A 3HG9A 4NDXA 4RCNA 5HURA 1OXTA 3BZDB 2XRSD 1OXVA 1U4LA 5C5MA 2MPMA 4QUFA 4RAUC 1F2YA 4YIJA 5IT9L 1I4HA 1IW7D 1GXDC 4DFAA 5CBAE 2J0TD 3E5SA 2PZTA 1LTRD 2IX0A 4RWSC 1G6ZA 1WD1A 3MEHA 4OO1G 1EZ6A 3C2PA 2KJXA 5D3DA 3NTHA 5CMDA 1I4QA 2PMZB 2E76C 4BY7B 2Q8TA 2DNEA 1SYEA 4I65A 4ZRZA 3TP6A 1Y1VB 3LX0A 3OPOA 2B2YC 2F0NA 2AQ2B 3ND9A 1ENFA 2K5WA 2MP1A 3NXWA 1IKMA 2F3VA 5FK9C 4DA2A 5EKIA 2Y0SB 3HRZC 4A3IB 5JOBA 3WDNA 4IFDJ 2EXZA 1LT5D 1DJRD 4CJ0B 4LK1C 3EFXD 3E6ZX 3SHLA 1G8ZD 1KDBA 4CBVA 2J4XA 5FLXE 1SYFA 3S2HB 2EZVA 1TKWB 2JYOA 1ILPA 1I6HB 3PO2B 1RTOA 5FKAC 4AYBB 1UUPA 3TN2A 1KAAA 4PMBA 2CW0C 5CV7A 3HKZB 3S15B 1X32A 3DXJC 1FNUA 4FO2A 1DOLA 3DHQA 2EPBA 1HQRD 3FDTA 2D5DA 5ELFA 1STAA 4OO1H 1PYWD 1JC7A 2NVQB 2F0DA 1FGBD 3G6JB 3H3VC 5EPJA 2ICIA 2F0MA 1Q8IA 2D62A 1EWCA 1II3A 4C3JB 3BG3A 2PNRC 5D3IB 4RHRA 1KDAA 2B2UA 2BOSA 1ENAA 1K83B 1JQYD 3SR1A 2F0HA 3L3OC 5KIXA 3FEWX 5A2QL 2K5DA 1R9TB 4R8IA 2A68D 5CGKA 1YNND 4ILWA 1WTWA 4KV6A 5K5PA 4C1NK 3OOCA 2RDFA 5EQ0A 3SVMA 1LTTD 4E6IA 1HXYD 3HGBA 5FO9B 1ZYRD 5I6YA 4IUQA 2BE5D 1TWGB 2FJ2A 2Z1CA 3Q22A 5C4XB 3Q6SA 2RDGA 3RMHA 3J7YW 4H13C 2FMCA 2WAQB 3WOEA 3E0JA 1MSGA 1FNVA 3BDOA 1BCPC 1U4MA 1A2UA 5C0XI 3VR3A 2EY6A 3S2DB 1JWMD 3SEBA 1PTOC 1LLRD 1KABA 1EYDA 1SSOA 1VMCA 2OEOA 1HTPA 3TSSA 1U9RA 4G7ZC 3NWSA 2K7VA 4V0BA 2PW7A 2B2YA 1CA5A 4K5VA 1H9KA 3AU7A 1Z6HA 2B2TC 5CV8A 4FF3A 3OW7A 1DZ1A 2C5CA 3FPPA 3A56A 1PRTB 5T1GA 1MD2D 1T5XD 4C56C 3QB3A 3BVMA 4OGQC 2O5IC 2F0EA 4RKBA 2DN8A 3HEJA 2ZXPA 3EVQA 5EKLA 1AW7A 4J6HA 3M7NA 3A8IE 3I3CA 3GTMB 2R3ZA 1B4OA 1V43A 1C4QA 3PUXA 3N52A 4Z9CB 5C44B 1QILA 3VR2A 1CHQD 2Z8LA 4DGZA 1G91A 2M9VA 1WTQA 5FOBB 4XYOA 3I91A 5C0XG 3L9AX 2F0GA 4M1UB 2SNSA 4PQXA 1PZKD 3A8KE 1R4PB 1LTBD 3S17B 2SEBD 3I72A 4X3UA 5IIFA 1K8MA 2KQ3A 4X3KA 1CI3M 4RCOA 2JA6B 2JP1A 2DY7A 2DNCA 1BO0A 2EYLA 5A35A 1XX8A 2PZWA 3WOFA 2OT2A 2JA5B 2O5JC 1LT3D 1ONLA 4M8AA 4C3HB 2E2JB 5JPMC 4A3GB 1YNNC 1BCPF 1QWYA 5F2DA 2E2IB 2F0TA 5NUCA 1TQOA 5EKKA 4QF4A 1PTOF 2JE6I 3QO2A 3NUCA 1RKNA 3VYSA 1SNMA 4A3BB 1SE4A 3NE5B 1BBXC 3GTPB 1ZKOA 3W3AA 2QEJC 3I4LA 1AZPA 2JA7B 1U4RA 5C0XH 2EDGA 1PDQA 4MIUA 1TS4A 5BN4A 4PV1C 3D4RA 4DF7A 5T1IA 4L8JA 4Q0FA 2B39A 2EYFA 4XTCS 4K14A 4IUTA 4XT1B 2HCIA 3K0YA 4EQPA 3GV3A 1ML0D 3I70A 5C4JB 4KN4C 4WRDA 3SK6A 2QCPX 2Z4HA 2CW0D 3PIP3 3LWUA 1HPCA 4ODGA 4KMUC 1SYCA 1STYA 2B2TA 1BF4A 1JR0D 3FKIB 2AUKA 2B2WC 1GHKA 1HTLD 3NBIA 4H44C 2PCFB 4V190 2D2CC 5KEEA 2LMCB 4A3KB 1D1KA 4CKCA 4A3EB 4RA8A 1E0BA 3AB9A 4OO1I 1ZXTA 4DN4M 4G57A 3MXGA 2BA0A 2MUYA 3QJYA 4FYDA 3HZXA 1UAPA 3SDZA 2F0FA 4FF2A 5E4WC 4K6DA 1SYGA 4G4KA 1G2SA 1EQVA 1H9SB 3PV0A 2TMPA 2LFNA 5CC4A 3K5MA 1QOHA 5JVH3 1PZID 4N9PA 3MXNA 3GTGB 3I4MB 3OIPA 4RH6A 5FLXL 5DM63 2JA8B 3PMFA 5BN5A 2VNUD 2CQAA 4J1MA 5LHY1 3R93A 1A3VA 3KUPA 1MBYA 5CYUA 1B2TA 2KHSA 2E74C 4R9WA 1A15A 5EGTA 3S9WA 5I9PA 4MHEA 3MHBA 3EQLC 1B9NA 1BCPD 1JB3A 3VA7A 2AWNA 2K04A 3SK5A 5I9OA 1QCBD 3EJIA 3DWAA 5DM73 4IZ8A 1VDZA 2H4OA 4HSPA 1PTOD 4FXDA 2DY8A 3C46A 3MZ5A 2O2LD 2ENBA 1SNCA 3KLSX 3NQIA 1EY5A 3A55A 3ZYYX 4K5XA 3VR5A 3IKJA 4F8MA 3JAME 4PMWA 1CZWA 2NVTB 1JCKB 4BA1I 1KNAA 3PUYA 1D2BA 3VA5A 1HUMA 2RVLA 3RZDB 1F77A 2WKCA 4KK7A 3NQTA 2M2LA 1Y8PB 1RF2D 3A7AB 4ZUJA 3TMEA 1V1OA 4HEDA 4KD3A 2WACA 5CORA 3K6OA 4DU9A 2NTSA 1BR9A 1GUOA 4HN7A 3GTOB 4WORA 4QMGA 3PUVA 1CQFA 2IW3A 3CHBD 1B44D 1O7ZA 2XNAC 3X3MA 3BDLA 3HOUB 2KA7A 1DCZA 3H94A 4NKLA 3PUZA 1XXGA 3HOXB 4Q5VA 4ZLTF 3KBXA 4C3IB 1EFID 5M5WB 4KKSA 2A73B 5M9OA 1NR4A 1H9JA 4FXGC 1KLUD 4LAAA 4IUVA 3C1FA 2EYHA 3GO5A 3KK7A 2B2WA 5D65A 2F0LA 1PTOH 1B1ZA 4IUUA 3HOWB 1I4GA 4IFDI 1S5DD 1SXTA 1PLFA 3A7LA 1O80A 5KNBA 3K5LA 3MXPA 3GTJB 5IGBA 1DOKA 1QE6A 1X3PA 1S5FD 2EYOA 5IODA 1U4PA 3FMCA 4CHTB 3DEOA 1BUVT 5G3LF 2WIIB 5CV6A 2ZXRA 3I90A 2EE1A 3TZDA 1BOSA 3SK4A 1X3QA 4DK1A 1B53A 1JWSD 2WKDA 4FP5D 5E1FA 1GJXA 3QOLA 1EL0A 4I7ZC 4QCLA 4K8JA 3R2IA 3CU7A 3X3NA 3TP5A 1KTKA 2MGSA 2XIWA 5EPLA 5JPNC 4IUPA 2NVYB 3URYA 3O13A 3MVVA 1V1PA 2EY2A 1Y8NB 1WTVA 3CQZB 1EWHA 3TP7A 3J81E 2L4NA 4A3MB 4O42A 2B2VC 2IWHA 2F4IA 1RJTA 4EGVA 1PRTC 4HTHA 2XSCA 4KI0A 2BDOA 3Q24A 3N6RA 4RGNA 4IFDG 4BA2I 1TS5A 1STHA 4HAEA 1EZ8A 5JJZA 1LT6D 1D5XC 1ET9A 3A8JE 2R7ZB 1D6EC 3DMUA 5I2YA 1TS3A 2HUGA 3J7AV 4DXGA 4ULLA 3V05A 2NZ1D 3VYTA 2AQ3B 5KGUA 5EBDA 1RDPD 1L0XB 3CKIB 4CJ1B 1R4QB 2K5QA 2F3WA 1SDFA 3GQBA 1MGSA 1TR5A 3S14B 3RZOB 4IURA 4J8QA 4OIKA 5EJWA 3NK9A 3D3RA 3DM1A 5K36G 1I50B 1FNWA 1F9SA 1EY0A 1PFMA 2O4XA 1F9RA 3NSWA 2R92B 3T16A 1SE3A 3OWFA 4MN3A 2CVRA 3BS1A 2F0WA 5LL6X 3OIQA 2XN9C 5C6AA 5JEAJ 2NYZD 4K2LA 5IGFA 1Y8OB 3BVZA 1AN8A 3NPPA 2L5TA 5IGEA 1FYCA 4FF1A 4IFDH 2K01A 2F0IA 1IL8A 3T56B 4X3SA 3RLFA 2HDMA 2EY5A 1S5BD 5G3LD 1W6JA 1EIGA 5HGTA 5KYIA 2K32A 4XT3B 2SOBA 1HFGA 4KHVA 3I73A 2WP8J 4BBSB 2FHTA 3TP8A 4OIJA 2VB3X 2HDLA 1EY8A 2I46A 5C3EB 3P75A 3QG1A 2F0SA 5IOCA 4FVMA 2L11A 2L0CA 5LL6S 3S1QB 5ELBA 1WD0A 4RGTA 2A5HA 2BCOA 1WTRA 1Q1EA 1NSNS 1S5CD 1MSHA 3MXUA 4TRDA 2NN6I 3TZUA 2IPKD 3T4AC 3DUZA 1A3TA 5K36H 2NVXB 3S16B 1PRTF 3T13A 1SYBA 3PIO3 4ME5A 1I4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 X;  5FLX L;  5A2Q L;  3J80 L;  3J7A V;  3JAM L;  3J81 L;  5IT9 L; 
#chains in the Genus database with same CATH topology
 3KDF B;  3FRP B;  3KJO A;  1SRU A;  2A8V A;  5FJ8 G;  3MAQ A;  2J7Z A;  2R61 A;  3VYR A;  3GTK B;  2D9U A;  4XQQ A;  3GTL B;  1PXU A;  3NWT A;  3K57 A;  5IP9 G;  1TWH B;  3R2T A;  2RCN A;  1XJV A;  3Q0A A;  2HCC A;  3ER0 A;  4QY7 A;  2LXK A;  2VQE L;  2YTY A;  1OO9 B;  3LWE A;  3PF5 A;  2NUC A;  4XYQ A;  1MJC A;  4DKA C;  3GP7 A;  1YHB A;  4QB4 A;  2B2V A;  1GOZ A;  1Q8K A;  3NEM A;  3NTI A;  1PMR A;  1SMX A;  3PSI A;  4TQU S;  2AUJ D;  2UXC Q;  2JK8 A;  5LMU L;  2OTL A;  3HS0 C;  1TWF B;  4HSV A;  4DV5 Q;  4BY7 H;  4UY8 C;  3BVG A;  1LAC A;  3D6C A;  3VR4 A;  4ZYS A;  4YY3 Q;  2B3G A;  4A93 B;  4C3J G;  5C3W A;  2A6E D;  1IYJ B;  1Y1V H;  3ITP A;  3BYT B;  5C4H A;  3H09 A;  1XNR L;  4XIG S;  1GVP A;  4LF6 L;  1EY7 A;  1A2T A;  4DAY B;  1N32 Q;  2ICE C;  4LF9 Q;  1LV9 A;  1Y1W B;  2OXP A;  5COY A;  4GOP C;  2B8F A;  3IAY A;  1GHJ A;  2F0J A;  4DR5 L;  2R93 G;  4KD4 A;  1WTO A;  2EYM A;  2PYK A;  4HMJ A;  3J80 c;  3K0X A;  1SJH D;  2Z4I A;  1M8A A;  3M85 A;  1EIF A;  5IGG A;  4G7H C;  1S5E D;  4WJ4 A;  5C4Z A;  3I55 A;  4A3I H;  3CW2 C;  2K14 A;  2HIV A;  3LNN A;  1V8Q A;  5IGC A;  2NN6 G;  4DAV A;  4NPS A;  3S2H H;  4JYA L;  4IN3 A;  4PMC A;  1N33 Q;  1ZEQ X;  4MZ9 A;  1PH4 A;  1I6H H;  1WFQ A;  2N78 A;  3PO2 H;  4IJH A;  3EA6 A;  3GD7 A;  1H9R A;  1SFO B;  4TKO B;  1X65 A;  4ZAI A;  1CHP D;  3C3L A;  5C4X G;  1NR2 A;  1IHZ A;  1JJC B;  3CRL C;  2C9O A;  1HNX Q;  1C0A A;  1N9W A;  3U58 A;  1YJ9 A;  3PIP A;  2WAQ G;  3ND8 A;  3S15 H;  1FJG L;  3PUW A;  5FJ8 H;  1JJG A;  1BDO A;  4ZK9 B;  1STE A;  4KKU A;  2BDN A;  2RA4 A;  5IP9 H;  2EJG C;  3CRK C;  1VQG A;  1SBB B;  2B8G A;  4F88 A;  2YU9 B;  1DD2 A;  4H0L C;  4IQZ A;  2PI2 E;  3H6M A;  1GD7 A;  1SYD A;  3R3O A;  1WVL A;  4QIW B;  1EY9 A;  4BBR B;  1CQV A;  1WCM B;  1PFS A;  2XWB B;  5J39 A;  1LTG D;  2UUB L;  5J22 A;  1I4P A;  3H0G B;  4B08 A;  4BWG B;  5D14 A;  2JSO A;  4GKJ Q;  4CGY B;  3KF8 A;  1IYV A;  1NMG A;  1TII D;  1BNZ A;  2AWO A;  2CCZ A;  2RSN A;  2NWG A;  1TWA H;  4YHH Q;  4UDU C;  4OEL B;  3RLO A;  4XQN A;  4LF7 L;  2Q8I B;  4GN3 B;  3UE0 A;  4ZKC B;  4JBJ A;  5GAG C;  3AMU A;  1K83 H;  2R93 H;  1STN A;  1FR3 A;  1HZ9 A;  2YTX A;  4DV1 L;  3D4D A;  2KCC A;  5BR8 L;  5DAU A;  1Z7T A;  1C9O A;  1R9T H;  4RMF A;  2KHJ A;  2GVB A;  1EEI D;  2PZU A;  3A54 A;  1IBK L;  3RUZ A;  3MC0 B;  2N88 A;  1VQO A;  5FO8 B;  3HOZ B;  4HJ9 A;  3V96 A;  4U67 3;  4RFB A;  1PRT D;  2UXD Q;  1OXX K;  2RBM A;  2NZO A;  1L0W A;  5KNC A;  1JOO A;  2NN6 H;  3W2D A;  4DV5 L;  3T53 B;  1L0Y B;  1F2Z A;  3CCJ A;  2CWA A;  1FGU A;  2ZTC A;  4YY3 L;  1SRO A;  2M00 A;  1ESF A;  5GQO A;  3KJP A;  1EOT A;  1EY4 A;  2KOL A;  2ZM6 Q;  1RHP A;  1TWG H;  4LUZ A;  4HIO A;  4PG3 A;  1BKB A;  1SMY D;  1E1O A;  4KTA A;  3J81 j;  5C4X H;  2R6G A;  3NHH A;  4L63 B;  3T1Y L;  1VMP A;  2JEB I;  2VXW A;  3UI2 A;  3S1R B;  1NUC A;  5IP7 G;  3K7A H;  4S3S A;  1IBL L;  1EIY B;  2G9D A;  5C44 G;  4NXM Q;  3HP3 A;  4A76 A;  4DV2 Q;  3OHX C;  3PGZ A;  2WFW A;  3D8G A;  5ELD A;  5I2X A;  1ILQ A;  4N8X 1;  1KAW A;  4FF4 A;  1N34 L;  2UXB Q;  3GV6 A;  2BA1 A;  1EY6 A;  4R8N A;  1KQS A;  1D5M C;  1HCZ A;  2ID0 A;  3CCL A;  2A6H D;  3S24 A;  1SNP A;  3BDC A;  2B63 B;  1A6X A;  3U9O A;  4BY1 B;  1YEZ A;  5DEH A;  4DR1 L;  1D7Q A;  1HNX L;  5CV5 A;  1BVS A;  2EVB A;  5I6W A;  1XWE A;  4GOP A;  1TS2 A;  4K5W A;  2UUC L;  2KED A;  2A6E C;  1OXS C;  1B3A A;  1HA5 A;  1SNO A;  4K0K L;  2N8N A;  5E3F A;  3J81 L;  1V1P B;  4CJ2 C;  4FXK C;  4NXN L;  5CV9 A;  4JW0 A;  2ZJR A;  5JVG 3;  3QOJ A;  3SE0 A;  1B9M A;  1CUK A;  2PQE A;  1SNQ A;  2JA5 G;  1F9Q A;  3K7U C;  2NTT A;  2OF1 A;  4F87 A;  2EYJ A;  1H9S A;  2K75 A;  1CK1 A;  1EYA A;  4C3H G;  1LM0 A;  1CM9 A;  4NMZ A;  3J7Z C;  5E4X A;  2KEE A;  1SND A;  5IGD A;  3KLR A;  1OTC A;  3TBI B;  3F2U A;  4DAP A;  4A3G G;  3A5U A;  2FMM A;  3PO3 B;  2KVM A;  4HCS A;  1GUS A;  2VB2 X;  4KY6 A;  3PF4 A;  3QWN A;  3P1H A;  4N9T A;  4YHH L;  1TY0 A;  4RGM A;  2LKV A;  1IZ6 A;  4LW1 A;  4P75 A;  1VQ8 A;  2KBN A;  4JK1 C;  4X6A H;  4EVO A;  1VF5 C;  2D0O A;  4CKB A;  5IP7 H;  1H9M A;  2CH4 A;  1S40 A;  1Q12 A;  1W6K A;  4A3B G;  3KBG A;  3KF6 A;  3ERQ A;  4KKT A;  4LFC L;  3J80 E;  5C44 H;  2CHB D;  3IFD A;  3HOY B;  2K33 A;  3UDF A;  4XDX A;  1KLG D;  1K8A C;  4DV4 Q;  3C1E A;  1YI2 A;  3M7G A;  1KC8 C;  4UPA A;  1JOR A;  1PH2 A;  1HRJ A;  4U68 A;  1QB5 D;  3EBE A;  2GVA A;  2QW7 A;  1TY2 A;  4PZ7 A;  4BS9 A;  5CR3 A;  3FVQ A;  4GLA C;  3S1M B;  1Z47 A;  3EIV A;  1K3B C;  3H91 A;  1HA6 A;  1MIU A;  5I4D A;  5FLM G;  4WJ3 M;  5IT9 E;  1UEA B;  3FPU B;  1I5F A;  1QNK A;  4A3J B;  2Q2H A;  1VQJ A;  2F0O A;  1KNE A;  2A69 C;  4B9W A;  1GO3 E;  2Z6K C;  2QF7 A;  4EQ5 A;  1ENC A;  2RKS A;  4JI3 L;  4B3T L;  4GNX B;  4HJ5 A;  5KND A;  2MNA A;  3BU2 A;  4DR3 L;  1TWA B;  3NTK A;  3FHW A;  4QUC A;  4P72 A;  4X62 L;  1QG7 A;  3TS0 A;  4PNY A;  4ZKB B;  2VUM B;  1PFN A;  3FKI G;  2G9H D;  4DV2 L;  1KDC A;  1C8C A;  2RQX A;  5E7N A;  2X69 A;  2R93 B;  2JA5 H;  3NBH A;  4RHS A;  2H5X A;  1ESR A;  4OHJ A;  4C3H H;  2E2J H;  2JXM B;  2XVS A;  1CKO A;  4XQJ A;  2UXB L;  4QIW E;  5GRO A;  4IJL A;  3IL8 A;  4A3K G;  4A3G H;  4A3E G;  4QL5 A;  2CFM A;  3S1N B;  4B3R Q;  4JV5 L;  3K58 A;  2HIX A;  1EQT A;  2F0K A;  2E2I H;  1M4V A;  3IFT A;  2RSO A;  3J7A F;  4H02 A;  2K5V A;  3KOJ A;  1ET6 A;  1PZJ D;  1S4Z A;  4OX9 L;  1YNJ C;  1VQL A;  2Z0S A;  5C0X J;  4LJZ C;  1IYU A;  2H1E A;  1B8A A;  2ZJQ A;  3CCM A;  4A3B H;  2KEC A;  4LWC A;  1HUN A;  1A62 A;  1EYC A;  1SMY C;  1T5E A;  2Q8R E;  4IPD A;  3M3Y B;  4PZ8 A;  3OSO A;  3GTP H;  1CKN B;  3HOV B;  1RCV D;  4JI2 L;  3DWQ A;  3T1H L;  1EOV A;  3K7A B;  2NB0 A;  1VF7 A;  2I07 B;  3AFP A;  2E2H B;  3W5O A;  2V4D A;  4A3C G;  2VW9 A;  1WTX A;  4JBW A;  2K03 A;  3I4M G;  1GUW A;  4ABN A;  5C3X A;  1WTH A;  1HNW Q;  2GA4 B;  2VL6 A;  1CT1 D;  1QUQ B;  5AFW A;  1Q90 A;  2JA8 G;  3K5N A;  5ELO A;  5FLM H;  3PCO B;  5ELC A;  1WOC A;  1LTA D;  1D5Z C;  3M4Y A;  1IW7 C;  1GUN A;  2KCN A;  1BQQ T;  4B9X A;  4DNR B;  3U50 C;  2KCT A;  2X6L A;  2EY1 A;  5C4J H;  2TSS A;  4C2M B;  4JBM A;  3MFG A;  4NP5 A;  1WJJ A;  1X55 A;  2LS0 1;  2MFI A;  2A6H C;  1QJO A;  4OL7 A;  1JOK A;  1GUT A;  5KRU A;  3FKI H;  1H95 A;  2F0Q A;  4FDB A;  4FNF A;  4RGO S;  2QKI C;  1VQP A;  1SAP A;  3I7F A;  1EU3 A;  3DWP A;  2G5D A;  2K05 A;  4DK0 A;  1GKH A;  2JEA I;  1PA6 A;  3MTS A;  1AEX A;  1LO5 D;  2OTJ A;  3V2T A;  2RCF A;  5HGQ A;  2Z6B A;  4A3K H;  4HIK A;  4A3E H;  4KN7 C;  2EJM A;  3ERO A;  3W1B A;  3Q23 A;  1GUG A;  3W1G A;  4K2K A;  4C1N I;  1AZQ A;  3ONA B;  1I3Q B;  1SEB D;  1K8O A;  4AQY Q;  1BCP B;  5A2Q E;  4RKL A;  1DXM A;  1TWC B;  1KD1 C;  3FP9 A;  2HT1 A;  2PMZ E;  3CC7 A;  2SDF A;  2UU9 Q;  4KY5 A;  2IJ0 A;  1BXT A;  4JI8 Q;  3VYU A;  4LMQ D;  1PTO B;  2EYP A;  3AEV A;  3B6Y A;  4A3F B;  1HZB A;  1ASZ A;  3T51 B;  1J6Q A;  4DNT B;  2L9H A;  3L0O A;  3SXH A;  1W2B A;  1SE2 A;  3D4W A;  1Q7Y C;  1DOM A;  4CDD C;  2E5L L;  4A3C H;  1Q3L A;  2ZT9 C;  1UE1 A;  3GTG H;  3I4M H;  2K1B A;  2Q2U A;  2JJQ A;  1E2V A;  3NP8 A;  4IAL A;  2PPB C;  3TDQ A;  1ROD A;  5M5X B;  2JA8 H;  4B3R L;  2HHH L;  4IUN A;  5JAV A;  2Y0S E;  1J8I A;  3D6W A;  3MFY A;  1Y69 U;  1FD7 D;  5CBE E;  1AP0 A;  1LTS D;  2IX3 A;  3HOU G;  2XTI A;  3VR6 A;  3CCV A;  5AJ3 L;  3HOX G;  2WB1 B;  4C3I G;  3L2P A;  2QDB A;  4ZUI A;  3F1Z A;  3M4O B;  5GAD C;  1O78 A;  2F0P A;  1TU2 B;  2F1M A;  5M3F B;  1B7Y B;  2IL8 A;  3P7J A;  1KHI A;  3BYY B;  1JOQ A;  3RLN A;  2ES2 A;  1NJI C;  4EQN A;  2PI2 A;  4ID6 A;  5DNF A;  3R8B A;  2K5N A;  5M5Y B;  1MJE A;  4GLV B;  2LY7 A;  1I6V C;  3HOW G;  3K8A A;  4CDF C;  4I7A A;  2L12 A;  4LF8 Q;  3K5O A;  1A63 A;  2QGQ A;  4A3D B;  1XNQ L;  4K8I A;  2AHO B;  4LF5 Q;  4WFN 3;  3J81 i;  1LAB A;  1STB A;  4KHZ A;  1LT4 D;  2E2D C;  1XTC D;  2CKZ B;  1RTN A;  3JC6 6;  1E3P A;  3PIO A;  1E7Z A;  1EQR A;  2NVT H;  4HR7 B;  2JA9 A;  5IWA Q;  2A68 C;  5FO7 B;  2HQE A;  1PYS B;  4TSS A;  3I8Z A;  4HMI A;  4Y52 H;  1NE3 A;  4GZY C;  3E9H A;  3SGI A;  3RZD H;  1STG A;  2IX1 A;  1LTI D;  1CKM A;  3SK8 A;  3MXN B;  2FIN B;  1CTM A;  3QIA A;  1G51 A;  5BN3 A;  1VQB A;  1K0R A;  4JG2 A;  4KY7 A;  5EPK A;  1A0I A;  2SNM A;  4GKK Q;  2V1C C;  2F0U A;  3OTO Q;  4XXE A;  1ZYR C;  5JEA G;  1JIC A;  5FLX c;  2XWJ B;  5C5L A;  3HFZ B;  3I4N B;  2BE5 C;  4YWK A;  1NAP A;  1O7L A;  1I94 Q;  4P74 A;  3GTO H;  2RDH A;  4EQO A;  2NBF A;  3CPW A;  4HJ8 A;  1NCV A;  3ULJ A;  1G2T A;  2PW5 A;  3G7L A;  1TVX A;  3G48 A;  4KJN A;  2MJ8 A;  2ZXO A;  3HOU H;  2L1B A;  2EJF C;  2UUA Q;  1Q81 C;  3M4Q A;  1E24 A;  3GTQ B;  3HOX H;  5M5W H;  4C3I H;  1VCI A;  3CC2 A;  2N55 A;  4AIM A;  2AQ1 B;  1G29 1;  1VQN A;  4YWM A;  2UU9 L;  1DON A;  1D1I A;  4A3M G;  2JQO A;  2ZTE A;  2E75 C;  1EU4 A;  1Q1B A;  1HQM C;  1LUZ A;  1ICW A;  1F2M A;  1IKL A;  3JAM L;  1HFN A;  4WJW A;  2OQK A;  1RIP A;  4JI5 Q;  1I4R A;  3L7Z C;  1F2L A;  4ZQ3 A;  1M90 C;  1SJE D;  1P16 A;  2F0V A;  1AFP A;  1VQI A;  2A19 A;  4DXF A;  4H7B A;  3HOW H;  2WIN B;  5J1Z A;  1A3U A;  4JI7 Q;  2C35 B;  3CPF A;  1Q86 C;  1DM0 B;  4JI6 Q;  1F9P A;  1TT2 A;  2LSS A;  5EBC A;  3KFU A;  1HHV A;  2JN4 A;  1JMC A;  2PQA B;  2A74 C;  4Y7N B;  5TSS A;  2R7Z G;  2XRQ D;  2YYZ A;  3U4V A;  4DUZ L;  1YHQ A;  2NVQ H;  4JI4 L;  4LFB L;  1CA6 A;  4F7X A;  4G7O C;  4DV7 Q;  4JI0 Q;  1JE4 A;  2K6A A;  1XYI A;  2EIF A;  1PFB A;  3CCR A;  1PH6 A;  2A69 D;  2K5H A;  1HZC A;  3U9S A;  3G6E A;  5M3M B;  1C48 A;  1J9O A;  3D31 A;  4P2C B;  3KLS A;  4CKE A;  4C3J H;  4DV6 L;  3KDF A;  4GOP B;  4AH6 A;  1EEF D;  1B50 A;  1E2Z A;  5KYL A;  1E2W A;  4KJO A;  1EIH A;  5JEA H;  2VQF Q;  5ELE A;  2X6G A;  2FFK B;  1J5E Q;  4B3M L;  4PZ6 A;  3J81 c;  3RD4 A;  3OWE B;  5ISR A;  1JWU D;  1OXU A;  4UAI A;  5HY6 A;  1WTP A;  4X3T A;  2DUD A;  1UNS A;  1B70 B;  1QNU A;  1K28 A;  1NY4 A;  1CZG A;  2B2U C;  4JVZ A;  4LF5 L;  2F03 A;  2L55 A;  2WV6 D;  1RD9 D;  1MI2 A;  2EOT A;  2GN5 A;  1DYQ A;  4K6L A;  3K59 A;  2YV5 A;  4DR2 Q;  2R7D A;  2NVY H;  2UXC L;  5IWA L;  4HCE A;  1YNJ D;  1HR0 W;  4DAY A;  1VQH A;  5CV4 A;  2MHV A;  3CCU A;  1L1O C;  3CQZ H;  3MWY W;  3P20 A;  4NW2 A;  2QIL A;  2IT1 A;  3RR5 A;  3OMC A;  4O1N A;  3J80 L;  4L6T B;  4MTN A;  1BBW A;  1XPO A;  1N32 L;  4LF9 L;  4NB3 A;  1O7Y A;  1JB7 A;  3OMG A;  1CFM A;  2K28 A;  2KUM A;  3DEP A;  3MA2 B;  2PO4 A;  3HG9 A;  4NDX A;  4RCN A;  3STB D;  5HUR A;  1OXT A;  3BZD B;  4DUY Q;  1I94 L;  4O0A A;  1WYD A;  1E1T A;  1OXV A;  2XRS D;  1U4L A;  3RN5 A;  3H3V H;  3ULP A;  5C5M A;  3I56 A;  2MPM A;  4QUF A;  4RAU C;  1F2Y A;  4YIJ A;  5IT9 L;  2R7Z H;  1I4H A;  1X3E A;  1IW7 D;  1GXD C;  3H15 A;  4BBS G;  3S2D H;  4DFA A;  5CBA E;  2J0T D;  4OON A;  2UUA L;  3E5S A;  3CCE A;  2PZT A;  1LTR D;  2RHS B;  2IX0 A;  4RWS C;  1G6Z A;  1WD1 A;  3MEH A;  2VY3 A;  1N33 L;  4OO1 G;  1EZ6 A;  3C2P A;  2KJX A;  2WB1 E;  5D3D A;  3NTH A;  5CMD A;  1I4Q A;  1K3R A;  1K9M C;  2PMZ B;  2E76 C;  1E22 A;  4BY7 B;  4JOI C;  4R4Q A;  4JI5 L;  2Q8T A;  3D0F A;  2DNE A;  2JA6 G;  3S14 H;  1SYE A;  4JI1 Q;  4I65 A;  4ZRZ A;  3TP6 A;  3RZO H;  1Y1V B;  2QA4 A;  4JI6 L;  3LX0 A;  3OPO A;  4LUV A;  4TVA B;  2F4V Q;  2B2Y C;  2F0N A;  3RN2 A;  2AQ2 B;  2AKW B;  1PYB A;  1I50 H;  2ALY B;  3ND9 A;  1ENF A;  2K5W A;  2MP1 A;  3NXW A;  1IKM A;  2F3V A;  1Q46 A;  5FK9 C;  4DA2 A;  1PH1 A;  3J7A 5;  5EKI A;  2Y0S B;  3RNU A;  3HRZ C;  1D8L A;  4A4I A;  5GAH C;  4A3I B;  4GKJ L;  3ZJY C;  5JOB A;  3WDN A;  4IFD J;  2EXZ A;  1LT5 D;  1DJR D;  4GNX C;  4CJ0 B;  4LK1 C;  1VQC A;  3EFX D;  3E6Z X;  3SHL A;  1G6P A;  1G8Z D;  1KDB A;  3UDI A;  4CBV A;  3GTM H;  4JC0 A;  4DR4 Q;  2J4X A;  5FLX E;  1SYF A;  5DLQ E;  3S2H B;  2EZV A;  1TKW B;  2JYO A;  1ILP A;  1I6H B;  3PO2 B;  1YHA A;  4LNQ A;  3CAM A;  1RTO A;  5FKA C;  4AYB B;  4MNO A;  4OEM B;  4A93 G;  1UUP A;  3TN2 A;  1K73 C;  1KAA A;  4PMB A;  4DR7 Q;  2QEX A;  4UHV A;  2CW0 C;  5CV7 A;  2JA7 G;  1V1Q A;  3HKZ B;  4HIM A;  3S15 B;  2KHI A;  3I4O A;  2UXD L;  4BBS H;  1X32 A;  3DXJ C;  1VQ9 A;  1FNU A;  4FO2 A;  1DOL A;  1O7I A;  3DHQ A;  2EPB A;  3S17 H;  1HQR D;  3BZC A;  2DJG C;  3FDT A;  2D5D A;  5ELF A;  1STA A;  4OO1 H;  1PYW D;  3CP0 A;  1JC7 A;  2NVQ B;  2ZM6 L;  2F0D A;  1FGB D;  3G6J B;  3F2B A;  3H3V C;  2OWO A;  1XMQ Q;  5EPJ A;  2LXJ A;  3S1Q H;  1YIT A;  2ICI A;  4GN5 A;  4YCW A;  2F0M A;  1Q8I A;  3CME A;  1PH8 A;  4JPB W;  2JA6 H;  2D62 A;  1EWC A;  1II3 A;  4C3J B;  3BG3 A;  3UDG A;  2PNR C;  4POF A;  5D3I B;  4A75 A;  4RHR A;  1KDA A;  1TXY A;  4NXM L;  2B2U A;  2QDL A;  2BOS A;  1ENA A;  1HNZ Q;  1K83 B;  2NVX H;  1JQY D;  4IOC A;  3SR1 A;  3S16 H;  2F0H A;  3L3O C;  5KIX A;  3FEW X;  3WWV A;  3AQQ A;  5A2Q L;  2K5D A;  2K52 A;  1R9T B;  1XMO Q;  4R8I A;  2A68 D;  5CGK A;  1YNN D;  5H1S E;  1EFW A;  3NEN A;  4ILW A;  1WTW A;  1L1O A;  1X6O A;  3GTL H;  4KV6 A;  5K5P A;  4C1N K;  1TWH H;  3OOC A;  2RDF A;  2XGT A;  5EQ0 A;  3SVM A;  1LTT D;  4E6I A;  3ERS X;  4KHP Q;  2IY5 B;  1HXY D;  4O2D A;  3HGB A;  5FO9 B;  4BBR G;  1ZYR D;  5I6Y A;  4IUQ A;  2BE5 D;  1TWF H;  1TWG B;  2FJ2 A;  2Z1C A;  1EWI A;  3H0G G;  1T9H A;  3Q22 A;  4DV3 Q;  1HR0 Q;  4POG A;  5C4X B;  1UE6 A;  3Q6S A;  2RDG A;  4LFA Q;  3RMH A;  3J7Y W;  4A93 H;  2JA7 H;  3F2C A;  4H13 C;  2FMC A;  2WAQ B;  3JAM i;  3WOE A;  3E0J A;  3CF5 A;  3STB C;  1MSG A;  1FNV A;  3BDO A;  1BCP C;  1U4M A;  1A2U A;  4X64 Q;  5C0X I;  3VR3 A;  1YZ6 A;  2EY6 A;  3S2D B;  1JWM D;  1P8L A;  3SEB A;  1PTO C;  3HOZ G;  4IPC A;  1LLR D;  1KAB A;  1EYD A;  1SSO A;  1VMC A;  2OEO A;  1CSP A;  1HTP A;  4JOI A;  3TSS A;  1U9R A;  2CQO A;  4G7Z C;  1XTD A;  3NWS A;  2VQE Q;  2ZJP A;  1M1K C;  2K7V A;  4R4O A;  1HZA A;  1X3G A;  1VQF A;  4V0B A;  2PW7 A;  2B2Y A;  4DV4 L;  1SFO H;  5LMU Q;  1CA5 A;  4K5V A;  1H9K A;  2NZH A;  4P73 A;  4X66 Q;  3AU7 A;  1VQ7 A;  1Z6H A;  1VQE A;  2B2T C;  4R4T A;  1UE7 A;  5CV8 A;  1VQ4 A;  1UWV A;  2ATW A;  4FF3 A;  2K50 A;  3OW7 A;  1EUJ A;  1JJ2 A;  1DZ1 A;  2C5C A;  3FPP A;  3A56 A;  1PRT B;  1XNR Q;  4LF6 Q;  5T1G A;  1RL2 A;  1MD2 D;  1AH9 A;  1T5X D;  4C56 C;  2YU9 H;  3QB3 A;  4GNX A;  2ASB A;  4DR5 Q;  3BVM A;  4OGQ C;  2O5I C;  4BBR H;  4QQB X;  2F0E A;  4RKB A;  2DN8 A;  1V9P A;  2ZXP A;  3EVQ A;  3HEJ A;  5EKL A;  3BZK A;  1AW7 A;  1YNX A;  4UP9 A;  3KYH C;  3H0G H;  1X54 A;  4J6H A;  3M7N A;  3A8I E;  1JE5 A;  3I3C A;  3GTM B;  3J80 i;  2R3Z A;  1HNZ L;  2B63 G;  2CH4 W;  3QR8 A;  4OWT B;  4QGU A;  1B4O A;  1V43 A;  4ALP A;  1C4Q A;  3PUX A;  4BY1 G;  1VQK A;  3N52 A;  4Z9C B;  1S72 A;  1X56 A;  2L15 A;  5C44 B;  1QIL A;  4JYA Q;  3VR2 A;  1CHQ D;  2Z8L A;  4DGZ A;  4DNI A;  1G91 A;  2M9V A;  5JJL A;  1WTQ A;  5FOB B;  4XYO A;  3I91 A;  5C0X G;  5JJI A;  3L9A X;  2F0G A;  4M1U B;  2SNS A;  4PQX A;  1PZK D;  3I2Z A;  3A8K E;  1R4P B;  1LTB D;  4LF4 Q;  3HOZ H;  3S17 B;  2MQH A;  2SEB D;  1FJG Q;  2MO0 A;  1CKN A;  3I72 A;  4UP8 A;  2AMC B;  4X3U A;  1A8V A;  5IIF A;  1K8M A;  1KL9 A;  3JAM c;  2KQ3 A;  4X3K A;  1CI3 M;  2F3I A;  3PO3 G;  4RCO A;  2JA6 B;  1U5K A;  2JP1 A;  1QUQ A;  2DY7 A;  4AYB E;  1VQM A;  1IL2 A;  4J15 A;  2DNC A;  2UUB Q;  1BO0 A;  2EYL A;  5A35 A;  3S1R H;  3HKZ E;  1XX8 A;  2MO1 A;  2EQS A;  1HNW L;  4UP7 A;  1EYG A;  3H3V I;  2PZW A;  3GDE A;  3WOF A;  2OT2 A;  2JA5 B;  3HOY G;  2O5J C;  1LT3 D;  1ONL A;  3KF8 B;  4M8A A;  4C3H B;  2E2J B;  5JPM C;  5IYC G;  2N49 A;  4A3G B;  1YNN C;  1BCP F;  1QWY A;  4DV1 Q;  4R4I A;  5BR8 Q;  5F2D A;  1XPR A;  2E2I B;  2F0T A;  5NUC A;  1QZG A;  1TQO A;  1IBK Q;  5EKK A;  4QF4 A;  1VQ5 A;  1PTO F;  1XPU A;  2JE6 I;  2Q2I A;  4IO9 A;  2B63 H;  4A3J G;  3QO2 A;  3NUC A;  1MHW C;  1RKN A;  3HKS A;  3VYS A;  1SNM A;  4BY1 H;  4A3B B;  4X66 L;  4QJF A;  3M9B A;  3G4S A;  1PH9 A;  1SE4 A;  3NE5 B;  1BBX C;  1N36 Q;  3GTP B;  1ZKO A;  3W3A A;  2QEJ C;  3I4L A;  1AZP A;  2JA7 B;  1YIJ A;  1U4R A;  5C0X H;  2EDG A;  1PDQ A;  4MIU A;  1TS4 A;  5BN4 A;  2VUM G;  4DV0 Q;  2IHE A;  4IPH A;  4PV1 C;  3T1Y Q;  3D4R A;  4DF7 A;  4AQY L;  5JJK A;  5T1I A;  4L8J A;  4Q0F A;  2B39 A;  2EYF A;  4GS3 A;  3UE1 A;  1S3O A;  4XTC S;  4K14 A;  1IBL Q;  4IUT A;  4XT1 B;  4R1J A;  1K8G A;  2HCI A;  3K0Y A;  4EQP A;  3GV3 A;  4OXP A;  2PNH A;  1ML0 D;  3F2D A;  4JI8 L;  3PO3 H;  3I70 A;  5ELN A;  5C4J B;  4KN4 C;  4WRD A;  3SK6 A;  3AFQ A;  2QCP X;  2Z4H A;  2CW0 D;  3PIP 3;  3LWU A;  2CWP A;  1HPC A;  4ODG A;  1LTL A;  4KMU C;  1N34 Q;  3M4P A;  5IYB G;  1AE2 A;  1SYC A;  2WAQ E;  1STY A;  2B2T A;  5IT9 c;  1JR0 D;  3FKI B;  1BF4 A;  2AUK A;  2B2W C;  2KEN A;  1GHK A;  1HTL D;  3NBI A;  1UE5 A;  4H44 C;  4LUO A;  3GTJ H;  3HOY H;  4DR1 Q;  2PCF B;  4V19 0;  3TRZ A;  2D2C C;  5KEE A;  1JT8 A;  2LMC B;  4GLX A;  3HOV G;  4LF4 L;  5IYC H;  4A3K B;  2UUC Q;  1D1K A;  4CKC A;  4A3E B;  4RA8 A;  1WI5 A;  4HID A;  1NNX A;  4K0K Q;  1E0B A;  3AB9 A;  2YTV A;  4OO1 I;  1ZXT A;  4NXN Q;  2RHQ B;  4DN4 M;  3S1M H;  4G57 A;  3MXG A;  4L5R C;  2BA0 A;  2MUY A;  3QJY A;  1PHJ A;  4FYD A;  3UDX A;  3HZX A;  1UAP A;  1YJN A;  3SDZ A;  4A3J H;  2F0F A;  4FF2 A;  1KRS A;  5E4W C;  4K6D A;  3OW2 A;  1SYG A;  4LF8 L;  1PH3 A;  4G4K A;  5J3B A;  1G2S A;  1EQV A;  1H9S B;  4YCV A;  3PV0 A;  1NBW A;  2TMP A;  2LFN A;  1U0L A;  2R7F A;  5CC4 A;  3K5M A;  1SE8 A;  1QOH A;  5JVH 3;  2VUM H;  1QVF A;  1PZI D;  4N9P A;  3MXN A;  3GTG B;  3I4M B;  3OIP A;  2R92 G;  4RH6 A;  5FLX L;  5DM6 3;  4B3S Q;  2JA8 B;  3PMF A;  4LFC Q;  5BN5 A;  2VNU D;  1AE3 A;  2CQA A;  2DJF C;  4J1M A;  5LHY 1;  1QZH A;  1IXR A;  3R93 A;  5IYD G;  1A3V A;  4A3M H;  3KUP A;  3S1N H;  1MBY A;  5CYU A;  1B2T A;  2KHS A;  3CMA A;  3KF6 B;  4MTK A;  4GKK L;  3E9I A;  2E74 C;  3OTO L;  4R9W A;  1A15 A;  4GN4 B;  3CCQ A;  5EGT A;  4OWW B;  3VDY A;  5LMN W;  1B3Q A;  3S9W A;  5I9P A;  5IYB H;  4MHE A;  2EXD A;  3MHB A;  3EQL C;  1FVI A;  1B9N A;  1N36 L;  2E8G A;  1BCP D;  1FL0 A;  1JB3 A;  3VA7 A;  2AWN A;  2K04 A;  3SK5 A;  5I9O A;  1QCB D;  3EJI A;  4A3F G;  4DV0 L;  3M3Y H;  3DWA A;  3A0J A;  5DM7 3;  4IZ8 A;  3F8T A;  4JCV E;  3HOV H;  1VDZ A;  4JI3 Q;  2H4O A;  4HSP A;  1PTO D;  4FXD A;  2DY8 A;  4B3T Q;  1Z9F A;  3MZ5 A;  3C46 A;  2O2L D;  4N8F A;  2N3S A;  1N8R C;  1NTG A;  2ENB A;  1SNC A;  3KLS X;  2E2H H;  3Q8D A;  5C3E G;  3NQI A;  1EY5 A;  4DR3 Q;  3A55 A;  3ZYY X;  4X62 Q;  4K5X A;  3VR5 A;  3IKJ A;  4F8M A;  3JAM E;  4PMW A;  1CZW A;  2BH8 A;  2NVT B;  4KLK A;  4CDC C;  1JCK B;  2FXQ A;  4BA1 I;  1KNA A;  2I0Q A;  3PUY A;  1D2B A;  3VA5 A;  1HUM A;  2RVL A;  3RZD B;  2PQA A;  1F77 A;  2WKC A;  4KK7 A;  3NQT A;  4DPG A;  4JI7 L;  4C2M H;  2WB1 G;  2M2L A;  4JV5 Q;  1Y8P B;  3EN2 A;  1RF2 D;  3A7A B;  3NBH B;  4ZUJ A;  3TME A;  5M3F G;  1C7Y A;  4APV A;  1V1O A;  1MKH A;  3TEH B;  5IE8 A;  4HED A;  4KD3 A;  4OX9 Q;  4OWX B;  1Y14 B;  2WAC A;  5COR A;  3K6O A;  1VS0 A;  1L1O B;  4DU9 A;  4DV7 L;  4JI0 L;  1YBY A;  2NTS A;  1BR9 A;  1GUO A;  4YWL A;  2R92 H;  4HN7 A;  4DK3 C;  3GTO B;  4WOR A;  4QMG A;  3PUV A;  2HQL A;  4ME3 A;  1CQF A;  1QVC A;  2IW3 A;  3CHB D;  1B44 D;  4A3D G;  1O7Z A;  2XNA C;  5IYD H;  3X3M A;  3BDL A;  3HOU B;  2KA7 A;  4DAM A;  1DCZ A;  3H94 A;  4NKL A;  3PUZ A;  4JI2 Q;  4BXX G;  3T1H Q;  4X65 Q;  1XXG A;  3HOX B;  4Q5V A;  4ZLT F;  3KBX A;  4C3I B;  1EFI D;  2VQF L;  5M5W B;  4KKS A;  1J5E L;  1I3Q H;  2A73 B;  3CD6 A;  5M9O A;  1W3S A;  1NR4 A;  1H9J A;  4FXG C;  1TWC H;  1PH7 A;  4RG1 A;  1KLU D;  1IBM Q;  4LAA A;  4IUV A;  1HJP A;  3CCS A;  3C1F A;  2EYH A;  3GO5 A;  3KK7 A;  1X3F A;  2B2W A;  2KCM A;  5D65 A;  2F0L A;  1PTO H;  1B1Z A;  4A3F H;  4IUU A;  3HOW B;  1SLJ A;  1I4G A;  4IFD I;  1S5D D;  1L2F A;  4DR2 L;  1Y1W G;  1SXT A;  1PLF A;  1PH5 A;  3A7L A;  4R4C A;  4B3S L;  1O80 A;  3I4N G;  4A3L G;  3A5Z B;  1GM5 A;  5C3E H;  5KNB A;  3K5L A;  3MXP A;  3GTJ B;  5IGB A;  1DOK A;  1QE6 A;  1X3P A;  1S5F D;  2EYO A;  5IOD A;  5M5X H;  1U4P A;  3FMC A;  4CHT B;  3NEL A;  3DEO A;  1BUV T;  3TQY A;  5G3L F;  1SR3 A;  2WII B;  2IHF A;  4DR6 Q;  5CV6 A;  2B29 A;  2ZXR A;  4DUY L;  3I90 A;  2EE1 A;  3TZD A;  1BOS A;  1HH2 P;  3SK4 A;  1X3Q A;  3K80 C;  1KIX A;  3M4O H;  4DK1 A;  1X9N A;  4CDE C;  1B53 A;  1JWS D;  2WKD A;  4FP5 D;  5E1F A;  5M3F H;  1GJX A;  3QOL A;  1EL0 A;  2OQ0 A;  4I7Z C;  5M5Y H;  4QCL A;  4K8J A;  3R2I A;  3CU7 A;  3X3N A;  3TP5 A;  1KTK A;  2MGS A;  4ZCK A;  2XIW A;  1UEB A;  5EPL A;  3K81 C;  3CC4 A;  3GTK H;  5JPN C;  4A3D H;  1KXL A;  4IUP A;  2NVY B;  4BXX H;  2Z9H A;  3URY A;  3O13 A;  3MVV A;  2E5L Q;  1V1P A;  2EY2 A;  1Y8N B;  1WTV A;  3CQZ B;  3MEF A;  1EWH A;  3ICE A;  3TP7 A;  1YJW A;  4JBK A;  2I5L X;  4JI1 L;  1WCM G;  4YCU A;  3J81 E;  2L4N A;  4A3M B;  4O42 A;  5M3M G;  2HHH Q;  2B2V C;  2IWH A;  2F4I A;  2F4V L;  1RJT A;  4EGV A;  1PRT C;  4HTH A;  2XSC A;  4KI0 A;  2BDO A;  3AYH B;  3Q24 A;  3N6R A;  4RGN A;  5AJ3 Q;  4IFD G;  4BA2 I;  2I5H A;  1Y1W H;  2F52 A;  1TS5 A;  1STH A;  4HAE A;  2A1A A;  1EZ8 A;  3I4N H;  4A3L H;  5JJZ A;  1LT6 D;  1D5X C;  1ET9 A;  3A8J E;  5EAY A;  2R7Z B;  1NMF A;  5LMN Q;  1D6E C;  3DMU A;  5I2Y A;  1TS3 A;  2HUG A;  3J7A V;  4DXG A;  4ULL A;  3V05 A;  3DLL A;  2NZ1 D;  3VYT A;  4X65 L;  2AQ3 B;  3LGJ A;  5KGU A;  4DR4 L;  5EBD A;  1RDP D;  2Q2T A;  1L0X B;  3CKI B;  4CJ1 B;  1XNQ Q;  3GTQ H;  4EX5 A;  1R4Q B;  4L5T A;  1IBM L;  2K5Q A;  2F3W A;  1SDF A;  4P71 A;  2BH2 A;  2OCE A;  2VZA A;  3A74 A;  3E3X A;  3GQB A;  1MGS A;  3IRB A;  1TR5 A;  4DR7 L;  3S14 B;  3TRE A;  2VS1 A;  4IOA A;  2I5M X;  3TS2 A;  3RZO B;  4IUR A;  4J8Q A;  3CXC A;  4OIK A;  1PVO A;  5EJW A;  3NK9 A;  4L5Q A;  3D3R A;  3DM1 A;  5K36 G;  1I50 B;  1FNW A;  1F9S A;  1EY0 A;  1PFM A;  2O4X A;  1F9R A;  1ICF B;  3NSW A;  1XMQ L;  4Y7N H;  2R92 B;  3T16 A;  1SE3 A;  3OWF A;  4MN3 A;  2CVR A;  1VQD A;  4DR6 L;  3BS1 A;  2K4K A;  1WCM H;  2F0W A;  5LL6 X;  3OIQ A;  1SN8 A;  2XN9 C;  5C6A A;  5JEA J;  2DGY A;  2NYZ D;  5M3M H;  5L37 A;  3ULL A;  4K2L A;  5IGF A;  1Y8O B;  3E0E A;  3BVZ A;  1AN8 A;  3NPP A;  2L5T A;  5IGE A;  1FYC A;  4FF1 A;  4IFD H;  2K01 A;  4BY7 G;  2F0I A;  1IL8 A;  3T56 B;  4X3S A;  1K0S A;  3RLF A;  1KRT A;  2HDM A;  2EY5 A;  1XMO L;  1S5B D;  5G3L D;  1W6J A;  1VQ6 A;  1EIG A;  1Y1V G;  5HGT A;  2ZTD A;  5KYI A;  2K32 A;  4XT3 B;  2SOB A;  3OYY A;  1EQQ A;  4DK6 C;  1HFG A;  4KHV A;  3I73 A;  4HJ7 A;  2WP8 J;  5GAE C;  4BBS B;  2FHT A;  3TP8 A;  4OIJ A;  4KHP L;  1DGS A;  2VB3 X;  2D0P A;  1EY8 A;  2HDL A;  2I46 A;  3G71 A;  5IY0 A;  5C3E B;  3P75 A;  2P5Z X;  3QG1 A;  2F0S A;  5IOC A;  2Y0S G;  3KLW A;  4FVM A;  3PQI A;  1Q82 C;  4A3I G;  4DV3 L;  2L11 A;  1HR0 L;  2L0C A;  5LL6 S;  3S1Q B;  4LFA L;  5ELB A;  4DUZ Q;  1CSQ A;  1WD0 A;  4RGT A;  4JI4 Q;  4LFB Q;  2A5H A;  2BCO A;  1WTR A;  1Q1E A;  1NSN S;  1S5C D;  1MSH A;  3MXU A;  1BBU A;  4TRD A;  2NN6 I;  3BJU A;  4HJA A;  3TZU A;  1YVC A;  1ASY A;  2IPK D;  2Z6K A;  3T4A C;  3DUZ A;  1A3T A;  1LYL A;  4L5S A;  3U4Z A;  3PO2 G;  4X64 L;  1QVG A;  4DV6 Q;  1PV4 A;  5K36 H;  5LMN L;  2NVX B;  4AYB G;  3S16 B;  1PRT F;  3T13 A;  3DM3 A;  1SYB A;  4IPG A;  2HD3 A;  2RF4 A;  4LF7 Q;  1VQA A;  3PIO 3;  4ME5 A;  1I4X A;  4B3M Q;  3HKZ G; 
#chains in the Genus database with same CATH homology
 3FRP B;  3MAQ A;  2J7Z A;  2R61 A;  3VYR A;  3GTK B;  2D9U A;  4XQQ A;  3GTL B;  1PXU A;  3NWT A;  3K57 A;  1TWH B;  3R2T A;  3Q0A A;  2HCC A;  1OO9 B;  3LWE A;  2NUC A;  4XYQ A;  3GP7 A;  4QB4 A;  2B2V A;  1GOZ A;  3NTI A;  1PMR A;  4TQU S;  2AUJ D;  3HS0 C;  1TWF B;  4HSV A;  3BVG A;  1LAC A;  3D6C A;  3VR4 A;  4ZYS A;  4A93 B;  4C3J G;  5C3W A;  2A6E D;  3ITP A;  3BYT B;  5C4H A;  3H09 A;  4XIG S;  1EY7 A;  1A2T A;  2ICE C;  1LV9 A;  1Y1W B;  2OXP A;  5COY A;  2B8F A;  3IAY A;  1GHJ A;  2F0J A;  4KD4 A;  1WTO A;  2EYM A;  2PYK A;  4HMJ A;  1SJH D;  2Z4I A;  1M8A A;  3M85 A;  5IGG A;  4G7H C;  1S5E D;  5C4Z A;  3LNN A;  1V8Q A;  5IGC A;  2NN6 G;  4DAV A;  4IN3 A;  4PMC A;  1ZEQ X;  3EA6 A;  3GD7 A;  1H9R A;  1SFO B;  4TKO B;  4ZAI A;  1CHP D;  3C3L A;  1NR2 A;  1IHZ A;  3CRL C;  2C9O A;  3ND8 A;  3PUW A;  1BDO A;  4ZK9 B;  1STE A;  4KKU A;  2BDN A;  2RA4 A;  2EJG C;  3CRK C;  1SBB B;  2B8G A;  4F88 A;  2YU9 B;  1DD2 A;  4H0L C;  4IQZ A;  3H6M A;  1SYD A;  3R3O A;  1WVL A;  4QIW B;  1EY9 A;  4BBR B;  1CQV A;  1WCM B;  2XWB B;  5J39 A;  1LTG D;  5J22 A;  1I4P A;  3H0G B;  4B08 A;  4BWG B;  5D14 A;  2JSO A;  4CGY B;  3KF8 A;  1IYV A;  1TII D;  1BNZ A;  2AWO A;  2RSN A;  2NWG A;  4UDU C;  4XQN A;  2Q8I B;  4ZKC B;  3AMU A;  1STN A;  1FR3 A;  3D4D A;  2KCC A;  5DAU A;  1Z7T A;  3A54 A;  1EEI D;  2PZU A;  3RUZ A;  3MC0 B;  2N88 A;  5FO8 B;  3HOZ B;  3V96 A;  4U67 3;  4RFB A;  1PRT D;  1OXX K;  2RBM A;  5KNC A;  1JOO A;  2NN6 H;  3W2D A;  3T53 B;  1L0Y B;  1F2Z A;  2M00 A;  1ESF A;  1EOT A;  1EY4 A;  2KOL A;  1RHP A;  1SMY D;  4KTA A;  2R6G A;  3NHH A;  4L63 B;  1VMP A;  2JEB I;  2VXW A;  3UI2 A;  3S1R B;  1NUC A;  4S3S A;  2G9D A;  3HP3 A;  3OHX C;  3D8G A;  5ELD A;  5I2X A;  1ILQ A;  4FF4 A;  3GV6 A;  2BA1 A;  1EY6 A;  4R8N A;  1D5M C;  1HCZ A;  2ID0 A;  2A6H D;  1SNP A;  3BDC A;  2B63 B;  1A6X A;  3U9O A;  4BY1 B;  5DEH A;  5CV5 A;  2EVB A;  5I6W A;  1XWE A;  1TS2 A;  4K5W A;  2KED A;  2A6E C;  1OXS C;  1B3A A;  1HA5 A;  1SNO A;  5E3F A;  3J81 L;  1V1P B;  4CJ2 C;  4FXK C;  5CV9 A;  5JVG 3;  3QOJ A;  3SE0 A;  1B9M A;  2PQE A;  1SNQ A;  1F9Q A;  2NTT A;  4F87 A;  2OF1 A;  2EYJ A;  1H9S A;  1CK1 A;  1EYA A;  4C3H G;  1CM9 A;  4NMZ A;  5E4X A;  2KEE A;  1SND A;  5IGD A;  3KLR A;  3TBI B;  3F2U A;  4DAP A;  2FMM A;  3PO3 B;  2KVM A;  4HCS A;  1GUS A;  2VB2 X;  4KY6 A;  3QWN A;  3P1H A;  4N9T A;  1TY0 A;  4RGM A;  2LKV A;  4JK1 C;  4EVO A;  1VF5 C;  4CKB A;  1H9M A;  1Q12 A;  1W6K A;  3KBG A;  3ERQ A;  4KKT A;  3J80 E;  2CHB D;  3IFD A;  3HOY B;  2K33 A;  4XDX A;  1KLG D;  3C1E A;  3M7G A;  1JOR A;  1HRJ A;  4U68 A;  1QB5 D;  1TY2 A;  4BS9 A;  5CR3 A;  3FVQ A;  3S1M B;  1Z47 A;  3H91 A;  1HA6 A;  5I4D A;  5IT9 E;  1UEA B;  3FPU B;  1QNK A;  4A3J B;  2F0O A;  1KNE A;  2A69 C;  4B9W A;  2QF7 A;  1ENC A;  2RKS A;  5KND A;  1TWA B;  3NTK A;  4QUC A;  1QG7 A;  4PNY A;  4ZKB B;  2VUM B;  1PFN A;  2G9H D;  1KDC A;  1C8C A;  2RQX A;  2X69 A;  2R93 B;  3NBH A;  4RHS A;  1ESR A;  4OHJ A;  2JXM B;  2XVS A;  4XQJ A;  3IL8 A;  3S1N B;  3K58 A;  1EQT A;  2F0K A;  1M4V A;  3IFT A;  2RSO A;  3J7A F;  1ET6 A;  1PZJ D;  1S4Z A;  1YNJ C;  5C0X J;  4LJZ C;  1IYU A;  2H1E A;  2KEC A;  1HUN A;  1EYC A;  1SMY C;  1T5E A;  2Q8R E;  3M3Y B;  3OSO A;  3HOV B;  1RCV D;  3DWQ A;  3K7A B;  2NB0 A;  1VF7 A;  2I07 B;  2E2H B;  2V4D A;  1WTX A;  4JBW A;  2K03 A;  1GUW A;  4ABN A;  5C3X A;  2GA4 B;  5AFW A;  1CT1 D;  1Q90 A;  3K5N A;  5ELC A;  1LTA D;  1D5Z C;  3M4Y A;  1IW7 C;  1GUN A;  2KCN A;  1BQQ T;  4B9X A;  4DNR B;  2X6L A;  2EY1 A;  2TSS A;  4C2M B;  3MFG A;  4NP5 A;  2LS0 1;  2A6H C;  1QJO A;  4OL7 A;  1JOK A;  1GUT A;  5KRU A;  2F0Q A;  4FNF A;  4RGO S;  2QKI C;  1SAP A;  1EU3 A;  3DWP A;  2K05 A;  4DK0 A;  2JEA I;  3MTS A;  1AEX A;  1LO5 D;  3V2T A;  4KN7 C;  2EJM A;  3ERO A;  3Q23 A;  1GUG A;  4K2K A;  4C1N I;  1AZQ A;  3ONA B;  1I3Q B;  1SEB D;  1K8O A;  1BCP B;  5A2Q E;  4RKL A;  1DXM A;  1TWC B;  2SDF A;  4KY5 A;  2IJ0 A;  1BXT A;  3VYU A;  4LMQ D;  1PTO B;  2EYP A;  4A3F B;  3T51 B;  4DNT B;  2L9H A;  3SXH A;  1SE2 A;  3D4W A;  1DOM A;  1Q3L A;  2ZT9 C;  2K1B A;  1E2V A;  3NP8 A;  4IAL A;  2PPB C;  3TDQ A;  1ROD A;  5M5X B;  4IUN A;  5JAV A;  1J8I A;  3D6W A;  3MFY A;  1Y69 U;  1FD7 D;  5CBE E;  1AP0 A;  1LTS D;  2IX3 A;  3VR6 A;  2WB1 B;  4C3I G;  2QDB A;  4ZUI A;  3M4O B;  1O78 A;  2F0P A;  1TU2 B;  2F1M A;  5M3F B;  2IL8 A;  3P7J A;  3BYY B;  1JOQ A;  4EQN A;  4ID6 A;  5DNF A;  3R8B A;  5M5Y B;  2LY7 A;  1I6V C;  2L12 A;  3K5O A;  4A3D B;  4K8I A;  4WFN 3;  1LAB A;  1STB A;  4KHZ A;  1LT4 D;  2E2D C;  1XTC D;  1RTN A;  4HR7 B;  2A68 C;  5FO7 B;  2HQE A;  4TSS A;  3I8Z A;  4HMI A;  4GZY C;  1STG A;  2IX1 A;  1LTI D;  3SK8 A;  2FIN B;  1CTM A;  3QIA A;  5BN3 A;  4KY7 A;  5EPK A;  2SNM A;  2F0U A;  4XXE A;  1ZYR C;  5JEA G;  1JIC A;  2XWJ B;  5C5L A;  3I4N B;  2BE5 C;  1NAP A;  1O7L A;  2RDH A;  4EQO A;  2NBF A;  1NCV A;  1G2T A;  2PW5 A;  3G7L A;  1TVX A;  4KJN A;  2MJ8 A;  2ZXO A;  2L1B A;  2EJF C;  3GTQ B;  1VCI A;  2N55 A;  2AQ1 B;  1G29 1;  1DON A;  1D1I A;  2E75 C;  1EU4 A;  1Q1B A;  1HQM C;  1ICW A;  1F2M A;  1IKL A;  3JAM L;  1HFN A;  4WJW A;  1I4R A;  3L7Z C;  1F2L A;  4ZQ3 A;  1SJE D;  2F0V A;  1AFP A;  4DXF A;  4H7B A;  2WIN B;  5J1Z A;  1A3U A;  1DM0 B;  1F9P A;  1TT2 A;  5EBC A;  1HHV A;  2A74 C;  4Y7N B;  5TSS A;  2XRQ D;  2YYZ A;  1CA6 A;  4F7X A;  4G7O C;  1JE4 A;  2K6A A;  1XYI A;  1PFB A;  2A69 D;  3U9S A;  5M3M B;  1C48 A;  1J9O A;  3D31 A;  4P2C B;  3KLS A;  4CKE A;  1EEF D;  1B50 A;  1E2Z A;  5KYL A;  1E2W A;  4KJO A;  1EIH A;  5JEA H;  5ELE A;  2X6G A;  2FFK B;  3RD4 A;  3OWE B;  5ISR A;  1JWU D;  1OXU A;  4UAI A;  1WTP A;  4X3T A;  1UNS A;  1QNU A;  1CZG A;  2B2U C;  2F03 A;  2L55 A;  2WV6 D;  1RD9 D;  1MI2 A;  2EOT A;  1DYQ A;  4K6L A;  3K59 A;  4HCE A;  1YNJ D;  4DAY A;  5CV4 A;  2MHV A;  3MWY W;  3P20 A;  4NW2 A;  2QIL A;  2IT1 A;  3OMC A;  4O1N A;  3J80 L;  4L6T B;  1O7Y A;  3OMG A;  1CFM A;  2K28 A;  2KUM A;  3DEP A;  3MA2 B;  2PO4 A;  3HG9 A;  4NDX A;  4RCN A;  5HUR A;  1OXT A;  3BZD B;  2XRS D;  1OXV A;  1U4L A;  5C5M A;  2MPM A;  4QUF A;  4RAU C;  1F2Y A;  4YIJ A;  5IT9 L;  1I4H A;  1IW7 D;  1GXD C;  4DFA A;  5CBA E;  2J0T D;  3E5S A;  2PZT A;  1LTR D;  2IX0 A;  4RWS C;  1G6Z A;  1WD1 A;  3MEH A;  4OO1 G;  1EZ6 A;  3C2P A;  2KJX A;  5D3D A;  3NTH A;  5CMD A;  1I4Q A;  2PMZ B;  2E76 C;  4BY7 B;  2Q8T A;  2DNE A;  1SYE A;  4I65 A;  4ZRZ A;  3TP6 A;  1Y1V B;  3LX0 A;  3OPO A;  2B2Y C;  2F0N A;  2AQ2 B;  3ND9 A;  1ENF A;  2K5W A;  2MP1 A;  3NXW A;  1IKM A;  2F3V A;  5FK9 C;  4DA2 A;  5EKI A;  2Y0S B;  3HRZ C;  4A3I B;  5JOB A;  3WDN A;  4IFD J;  2EXZ A;  1LT5 D;  1DJR D;  4CJ0 B;  4LK1 C;  3EFX D;  3E6Z X;  3SHL A;  1G8Z D;  1KDB A;  4CBV A;  2J4X A;  5FLX E;  1SYF A;  3S2H B;  2EZV A;  1TKW B;  2JYO A;  1ILP A;  1I6H B;  3PO2 B;  1RTO A;  5FKA C;  4AYB B;  1UUP A;  3TN2 A;  1KAA A;  4PMB A;  2CW0 C;  5CV7 A;  3HKZ B;  3S15 B;  1X32 A;  3DXJ C;  1FNU A;  4FO2 A;  1DOL A;  3DHQ A;  2EPB A;  1HQR D;  3FDT A;  2D5D A;  5ELF A;  1STA A;  4OO1 H;  1PYW D;  1JC7 A;  2NVQ B;  2F0D A;  1FGB D;  3G6J B;  3H3V C;  5EPJ A;  2ICI A;  2F0M A;  1Q8I A;  2D62 A;  1EWC A;  1II3 A;  4C3J B;  3BG3 A;  2PNR C;  5D3I B;  4RHR A;  1KDA A;  2B2U A;  2BOS A;  1ENA A;  1K83 B;  1JQY D;  3SR1 A;  2F0H A;  3L3O C;  5KIX A;  3FEW X;  5A2Q L;  2K5D A;  1R9T B;  4R8I A;  2A68 D;  5CGK A;  1YNN D;  4ILW A;  1WTW A;  4KV6 A;  5K5P A;  4C1N K;  3OOC A;  2RDF A;  5EQ0 A;  3SVM A;  1LTT D;  4E6I A;  1HXY D;  3HGB A;  5FO9 B;  1ZYR D;  5I6Y A;  4IUQ A;  2BE5 D;  1TWG B;  2FJ2 A;  2Z1C A;  3Q22 A;  5C4X B;  3Q6S A;  2RDG A;  3RMH A;  3J7Y W;  4H13 C;  2FMC A;  2WAQ B;  3WOE A;  3E0J A;  1MSG A;  1FNV A;  3BDO A;  1BCP C;  1U4M A;  1A2U A;  5C0X I;  3VR3 A;  2EY6 A;  3S2D B;  1JWM D;  3SEB A;  1PTO C;  1LLR D;  1KAB A;  1EYD A;  1SSO A;  1VMC A;  2OEO A;  1HTP A;  3TSS A;  1U9R A;  4G7Z C;  3NWS A;  2K7V A;  4V0B A;  2PW7 A;  2B2Y A;  1CA5 A;  4K5V A;  1H9K A;  3AU7 A;  1Z6H A;  2B2T C;  5CV8 A;  4FF3 A;  3OW7 A;  1DZ1 A;  2C5C A;  3FPP A;  3A56 A;  1PRT B;  5T1G A;  1MD2 D;  1T5X D;  4C56 C;  3QB3 A;  3BVM A;  4OGQ C;  2O5I C;  2F0E A;  4RKB A;  2DN8 A;  3HEJ A;  2ZXP A;  3EVQ A;  5EKL A;  1AW7 A;  4J6H A;  3M7N A;  3A8I E;  3I3C A;  3GTM B;  2R3Z A;  1B4O A;  1V43 A;  1C4Q A;  3PUX A;  3N52 A;  4Z9C B;  5C44 B;  1QIL A;  3VR2 A;  1CHQ D;  2Z8L A;  4DGZ A;  1G91 A;  2M9V A;  1WTQ A;  5FOB B;  4XYO A;  3I91 A;  5C0X G;  3L9A X;  2F0G A;  4M1U B;  2SNS A;  4PQX A;  1PZK D;  3A8K E;  1R4P B;  1LTB D;  3S17 B;  2SEB D;  3I72 A;  4X3U A;  5IIF A;  1K8M A;  2KQ3 A;  4X3K A;  1CI3 M;  4RCO A;  2JA6 B;  2JP1 A;  2DY7 A;  2DNC A;  1BO0 A;  2EYL A;  5A35 A;  1XX8 A;  2PZW A;  3WOF A;  2OT2 A;  2JA5 B;  2O5J C;  1LT3 D;  1ONL A;  4M8A A;  4C3H B;  2E2J B;  5JPM C;  4A3G B;  1YNN C;  1BCP F;  1QWY A;  5F2D A;  2E2I B;  2F0T A;  5NUC A;  1TQO A;  5EKK A;  4QF4 A;  1PTO F;  2JE6 I;  3QO2 A;  3NUC A;  1RKN A;  3VYS A;  1SNM A;  4A3B B;  1SE4 A;  3NE5 B;  1BBX C;  3GTP B;  1ZKO A;  3W3A A;  2QEJ C;  3I4L A;  1AZP A;  2JA7 B;  1U4R A;  5C0X H;  2EDG A;  1PDQ A;  4MIU A;  1TS4 A;  5BN4 A;  4PV1 C;  3D4R A;  4DF7 A;  5T1I A;  4L8J A;  4Q0F A;  2B39 A;  2EYF A;  4XTC S;  4K14 A;  4IUT A;  4XT1 B;  2HCI A;  3K0Y A;  4EQP A;  3GV3 A;  1ML0 D;  3I70 A;  5C4J B;  4KN4 C;  4WRD A;  3SK6 A;  2QCP X;  2Z4H A;  2CW0 D;  3PIP 3;  3LWU A;  1HPC A;  4ODG A;  4KMU C;  1SYC A;  1STY A;  2B2T A;  1BF4 A;  1JR0 D;  3FKI B;  2AUK A;  2B2W C;  1GHK A;  1HTL D;  3NBI A;  4H44 C;  2PCF B;  4V19 0;  2D2C C;  5KEE A;  2LMC B;  4A3K B;  1D1K A;  4CKC A;  4A3E B;  4RA8 A;  1E0B A;  3AB9 A;  4OO1 I;  1ZXT A;  4DN4 M;  4G57 A;  3MXG A;  2BA0 A;  2MUY A;  3QJY A;  4FYD A;  3HZX A;  1UAP A;  3SDZ A;  2F0F A;  4FF2 A;  5E4W C;  4K6D A;  1SYG A;  4G4K A;  1G2S A;  1EQV A;  1H9S B;  3PV0 A;  2TMP A;  2LFN A;  5CC4 A;  3K5M A;  1QOH A;  5JVH 3;  1PZI D;  4N9P A;  3MXN A;  3GTG B;  3I4M B;  3OIP A;  4RH6 A;  5FLX L;  5DM6 3;  2JA8 B;  3PMF A;  5BN5 A;  2VNU D;  2CQA A;  4J1M A;  5LHY 1;  3R93 A;  1A3V A;  3KUP A;  1MBY A;  5CYU A;  1B2T A;  2KHS A;  2E74 C;  4R9W A;  1A15 A;  5EGT A;  3S9W A;  5I9P A;  4MHE A;  3MHB A;  3EQL C;  1B9N A;  1BCP D;  1JB3 A;  3VA7 A;  2AWN A;  2K04 A;  3SK5 A;  5I9O A;  1QCB D;  3EJI A;  3DWA A;  5DM7 3;  4IZ8 A;  1VDZ A;  2H4O A;  4HSP A;  1PTO D;  4FXD A;  2DY8 A;  3C46 A;  3MZ5 A;  2O2L D;  2ENB A;  1SNC A;  3KLS X;  3NQI A;  1EY5 A;  3A55 A;  3ZYY X;  4K5X A;  3VR5 A;  3IKJ A;  4F8M A;  3JAM E;  4PMW A;  1CZW A;  2NVT B;  1JCK B;  4BA1 I;  1KNA A;  3PUY A;  1D2B A;  3VA5 A;  1HUM A;  2RVL A;  3RZD B;  1F77 A;  2WKC A;  4KK7 A;  3NQT A;  2M2L A;  1Y8P B;  1RF2 D;  3A7A B;  4ZUJ A;  3TME A;  1V1O A;  4HED A;  4KD3 A;  2WAC A;  5COR A;  3K6O A;  4DU9 A;  2NTS A;  1BR9 A;  1GUO A;  4HN7 A;  3GTO B;  4WOR A;  4QMG A;  3PUV A;  1CQF A;  2IW3 A;  3CHB D;  1B44 D;  1O7Z A;  2XNA C;  3X3M A;  3BDL A;  3HOU B;  2KA7 A;  1DCZ A;  3H94 A;  4NKL A;  3PUZ A;  1XXG A;  3HOX B;  4Q5V A;  4ZLT F;  3KBX A;  4C3I B;  1EFI D;  5M5W B;  4KKS A;  2A73 B;  5M9O A;  1NR4 A;  1H9J A;  4FXG C;  1KLU D;  4LAA A;  4IUV A;  3C1F A;  2EYH A;  3GO5 A;  3KK7 A;  2B2W A;  5D65 A;  2F0L A;  1PTO H;  1B1Z A;  4IUU A;  3HOW B;  1I4G A;  4IFD I;  1S5D D;  1SXT A;  1PLF A;  3A7L A;  1O80 A;  5KNB A;  3K5L A;  3MXP A;  3GTJ B;  5IGB A;  1DOK A;  1QE6 A;  1X3P A;  1S5F D;  2EYO A;  5IOD A;  1U4P A;  3FMC A;  4CHT B;  3DEO A;  1BUV T;  5G3L F;  2WII B;  5CV6 A;  2ZXR A;  3I90 A;  2EE1 A;  3TZD A;  1BOS A;  3SK4 A;  1X3Q A;  4DK1 A;  1B53 A;  1JWS D;  2WKD A;  4FP5 D;  5E1F A;  1GJX A;  3QOL A;  1EL0 A;  4I7Z C;  4QCL A;  4K8J A;  3R2I A;  3CU7 A;  3X3N A;  3TP5 A;  1KTK A;  2MGS A;  2XIW A;  5EPL A;  5JPN C;  4IUP A;  2NVY B;  3URY A;  3O13 A;  3MVV A;  1V1P A;  2EY2 A;  1Y8N B;  1WTV A;  3CQZ B;  1EWH A;  3TP7 A;  3J81 E;  2L4N A;  4A3M B;  4O42 A;  2B2V C;  2IWH A;  2F4I A;  1RJT A;  4EGV A;  1PRT C;  4HTH A;  2XSC A;  4KI0 A;  2BDO A;  3Q24 A;  3N6R A;  4RGN A;  4IFD G;  4BA2 I;  1TS5 A;  1STH A;  4HAE A;  1EZ8 A;  5JJZ A;  1LT6 D;  1D5X C;  1ET9 A;  3A8J E;  2R7Z B;  1D6E C;  3DMU A;  5I2Y A;  1TS3 A;  2HUG A;  3J7A V;  4DXG A;  4ULL A;  3V05 A;  2NZ1 D;  3VYT A;  2AQ3 B;  5KGU A;  5EBD A;  1RDP D;  1L0X B;  3CKI B;  4CJ1 B;  1R4Q B;  2K5Q A;  2F3W A;  1SDF A;  3GQB A;  1MGS A;  1TR5 A;  3S14 B;  3RZO B;  4IUR A;  4J8Q A;  4OIK A;  5EJW A;  3NK9 A;  3D3R A;  3DM1 A;  5K36 G;  1I50 B;  1FNW A;  1F9S A;  1EY0 A;  1PFM A;  2O4X A;  1F9R A;  3NSW A;  2R92 B;  3T16 A;  1SE3 A;  3OWF A;  4MN3 A;  2CVR A;  3BS1 A;  2F0W A;  5LL6 X;  3OIQ A;  2XN9 C;  5C6A A;  5JEA J;  2NYZ D;  4K2L A;  5IGF A;  1Y8O B;  3BVZ A;  1AN8 A;  3NPP A;  2L5T A;  5IGE A;  1FYC A;  4FF1 A;  4IFD H;  2K01 A;  2F0I A;  1IL8 A;  3T56 B;  4X3S A;  3RLF A;  2HDM A;  2EY5 A;  1S5B D;  5G3L D;  1W6J A;  1EIG A;  5HGT A;  5KYI A;  2K32 A;  4XT3 B;  2SOB A;  1HFG A;  4KHV A;  3I73 A;  2WP8 J;  4BBS B;  2FHT A;  3TP8 A;  4OIJ A;  2VB3 X;  2HDL A;  1EY8 A;  2I46 A;  5C3E B;  3P75 A;  3QG1 A;  2F0S A;  5IOC A;  4FVM A;  2L11 A;  2L0C A;  5LL6 S;  3S1Q B;  5ELB A;  1WD0 A;  4RGT A;  2A5H A;  2BCO A;  1WTR A;  1Q1E A;  1NSN S;  1S5C D;  1MSH A;  3MXU A;  4TRD A;  2NN6 I;  3TZU A;  2IPK D;  3T4A C;  3DUZ A;  1A3T A;  5K36 H;  2NVX B;  3S16 B;  1PRT F;  3T13 A;  1SYB A;  3PIO 3;  4ME5 A;  1I4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...