3J7AV

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
156
structure length
146
Chain Sequence
b'DVQHERAYQKQEGASFFNSKRYWKKVGLGFATPKEAKEGVYVDKKCPFTGNVSIRGRILKGMVISNKMKRTIIIRRNYLHYVKKYNRFEKRHKNIPCHCSPCFDVKEGDIVTVGQCRPLSKTVRFNVLHVEKHQIFGSARKQFVLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
molecule tags Ribosome/inhibitor
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
total genus 20
structure length 146
sequence length 156
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00366 Ribosomal_S17 Ribosomal protein S17
V PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j7aV00
3JAML 5FLXL 3J80L 5A2QL 3J7AV 3J81L 5IT9L 5LL6X
chains in the Genus database with same CATH superfamily
4BBRG 3CPWA 3CXCA 2CW0D 2F4VQ 4CBVA 1MI2A 4HJ5A 3S2HH 2EXZA 1JB7A 3CU7A 1MJCA 3OWEB 3KK7A 4LF4L 3SDZA 2BOSA 3LNNA 1TS3A 1HQMC 3RMHA 1STGA 1SNCA 4GKKQ 2B2UC 2CW0C 3I2ZA 1UNSA 1XMOQ 5JVG3 2QKIC 5KEEA 1TWFH 2K32A 3NBHB 2A1AA 3KLSA 3R93A 2F0MA 4DR6L 1V8QA 3IFDA 2JQOA 2QEXA 4KMUC 5ELFA 3T1HQ 1S5DD 3H3VH 4C3IG 1SMYD 3CAMA 4A93H 2Z9HA 1SNQA 3S1QH 3M85A 4DR2L 1RDPD 4HJ8A 5IP9G 1ZYRC 3R8BA 1PMRA 4DNIA 2G9HD 3AQQA 3I8ZA 3BYTB 4A3KG 1I6VC 1VCIA 2PW7A 3EROA 4LFCL 5GQOA 4KI0A 1PH1A 1PDQA 2JA8H 4NXML 2E2JB 3HOZG 4X65L 1SFOH 2F3VA 3HRZC 3E9HA 3I7FA 1Y1WG 2CKZB 2HUGA 2RBMA 1A2TA 4KHPL 4HMJA 1QNKA 5M3FH 4A3BH 2F0OA 1HA5A 1SE2A 2YTXA 3T1HL 1M1KC 3GTPH 5IIFA 1C8CA 2Q2TA 1EIYB 2YTYA 1XXGA 4FYDA 4Y7NB 2WACA 3LWUA 2J7ZA 4AYBB 1EYAA 5C3EH 5C4JB 1D2BA 5A35A 5J39A 4RKBA 2LSSA 2HD3A 2BA0A 2EXDA 2XTIA 5FLXL 1IZ6A 3GO5A 1HA6A 1LTGD 2VUMH 2ZXRA 2UUAQ 1IBKL 1NUCA 4IPGA 1UAPA 1E7ZA 2WAQE 4NB3A 2XIWA 1XWEA 4JI0Q 2KCMA 3GTKB 1HNXL 4BS9A 2EDGA 1SN8A 2A8VA 3NE5B 3U50C 4PG3A 3GP7A 4G57A 4JVZA 1L1OB 3OWFA 4LMQD 2OF1A 1B9MA 3K5OA 2EIFA 1STBA 3FP9A 1EZ6A 2F0TA 4PQXA 3HOUG 2UXBL 5CGKA 1FGUA 1SMXA 1H9SB 2ENBA 4JCVE 5EKKA 3WOEA 5KYIA 1GUWA 1U4PA 2E76C 3E0EA 4YWLA 4C3HG 1PH9A 5DNFA 4DV5L 5C0XI 1KNAA 4JI2L 1ET9A 2F0PA 4QL5A 5IP9H 3S17H 1PFSA 3H15A 1AW7A 4CJ0B 5E4WC 4XQJA 3HOYH 1G51A 4IURA 4KTAA 3IFTA 4KJOA 3NENA 1ENCA 4OWXB 4XT1B 1FVIA 5IYCG 1I94L 3FMCA 3LGJA 5KIXA 1LO5D 4ULLA 5C44G 1PH3A 3NBIA 1SNDA 5M3MG 1O7YA 4F87A 3L7ZC 2UXCQ 4A3GB 1KDAA 2NVQB 3T4AC 4PZ8A 4JBKA 4JI6L 2F0JA 2XGTA 2H1EA 3I56A 1HFGA 4NPSA 1CKNB 1KDCA 4GLXA 4QIWE 3ZJYC 1EEID 1F2MA 1I4QA 2OQKA 4KHZA 1EY4A 2V1CC 1VQLA 5GROA 2RSOA 4Y7NH 4LNQA 2NN6G 4R4OA 4DV3L 1ENFA 3P75A 3D4WA 1YHAA 2HCCA 3UDXA 2F0KA 1GO3E 1CK1A 1P16A 2EYFA 2VQEQ 5T1IA 2DNEA 4DR3L 4KN4C 1TY2A 1R4PB 2M9VA 5JEAG 2PZUA 1E2VA 3BG3A 2GA4B 3TMEA 1TQOA 3AYHB 3C1EA 3TBIB 3MEFA 4UP7A 1YVCA 1N9WA 4J1MA 1FNVA 2ZM6Q 3MHBA 2ES2A 2ICIA 1V1QA 2L55A 1EL0A 4X62Q 1CI3M 4TVAB 5BN5A 3JAMi 1II3A 4JBMA 3WOFA 3ERQA 4HMIA 4JI5L 3GD7A 5G3LF 2UXDL 4KK7A 1SAPA 4FO2A 4BBSG 2IWHA 5ELOA 5IOCA 1VQAA 3J80i 3KUPA 1XTDA 1PLFA 3PIPA 2CCZA 3BZDB 2AWOA 1L1OC 2EQSA 4JYAQ 5CYUA 3CCMA 1X3GA 5BN3A 3FPPA 1P8LA 1VQDA 1EQRA 3VA7A 2VQEL 2E2HB 4NXNL 3R2IA 4JI4Q 3MXNA 2K14A 3P20A 4RGNA 1SBBB 3BZCA 2AMCB 4DAYA 2EY1A 4WRDA 1VQJA 1OXXK 2KVMA 5C3EG 5C4JH 1YNND 1HNWQ 2L9HA 4C3IH 2XSCA 2MPMA 4DUZQ 2DY7A 2EJGC 3SHLA 4ZK9B 1TWCB 3PO2B 4O0AA 3PIO3 1E22A 2N55A 4MTKA 5COYA 5FKAC 2NTSA 4HIMA 3HZXA 1AFPA 1CSQA 1Z6HA 1B44D 5KGUA 4OELB 3KJOA 5I2XA 4TKOB 1UE6A 1SYGA 1SYFA 1Q7YC 3K8AA 5M5YH 3ICEA 2E2HH 2HHHQ 2MQHA 2BH2A 2EY6A 1SJHD 2D0PA 3SEBA 3J7AV 3S2HB 4POFA 3PQIA 2FJ2A 2E2IH 3GTOH 5IT9L 1YI2A 1WTXA 2Z0SA 3AMUA 1X65A 1K3BC 2C9OA 4OIKA 5IYDG 4IPDA 5EPKA 5GADC 4P71A 4ALPA 4U673 1XMOL 2B39A 2LMCB 1MJEA 1HJPA 3W5OA 4M1UB 1OXSC 4LAAA 1G91A 1BCPB 2B2TA 5K5PA 2V4DA 2RKSA 1BCPF 1GUNA 1K3RA 1ZXTA 3J81j 5CV5A 3DMUA 2KBNA 1XNQL 3Q22A 4B3RQ 4ABNA 3MTSA 2FMCA 3HOYB 3DWQA 1D5MC 4HIKA 1X54A 1CT1D 5LL6S 4A3FB 2OEOA 5C4HA 4AYBE 4LF8L 2WAQB 4GZYC 1VQMA 4C3IB 2IJ0A 3RLNA 2EYOA 4LF5Q 2F0WA 4POGA 1FJGQ 5JJLA 1CHQD 3DUZA 1JOKA 3PV0A 3GTOB 3JAMc 2IX3A 1WTOA 1YJNA 4QB4A 1HFNA 4A3GH 1YNJD 3S16B 2Q8RE 2F3IA 1VQ6A 4YWKA 4NXMQ 4LF6Q 2BE5D 2HDMA 3VYUA 1A3VA 1SFOB 4IFDG 3H0GB 4A3MG 2R92B 1IYVA 1O7LA 5IGBA 3M7NA 1IW7D 3DWAA 3N6RA 4CHTB 4DV3Q 3S24A 1BOSA 1TVXA 1PZJD 4B3SL 3T56B 2F0FA 1XPUA 1NMFA 2E2IB 4LF7L 4DV0Q 2K7VA 2O5IC 1O78A 1LT3D 4DK3C 1M90C 4DR3Q 2OTLA 1NSNS 4XQNA 1FD7D 1H9RA 1SE3A 5LL6X 2HT1A 5K36H 3GQBA 1IBLQ 1K8OA 4C3JH 1PH7A 1U4MA 5E3FA 2ALYB 4C2MB 1VQKA 5IYBH 3RN5A 2A74C 3NPPA 4IQZA 3I72A 4X3UA 2KECA 2QILA 1QJOA 1C9OA 1DOLA 4HCSA 2XWJB 1EOTA 1AEXA 1XMQL 1WTWA 2B2YA 1LACA 3TRZA 3FPUB 4DFAA 1BR9A 4K8JA 2J0TD 4DR1Q 2F0EA 3F2UA 2VY3A 3DLLA 3IL8A 2FFKB 4OO1I 2ZTCA 2KCTA 1EY7A 2EJMA 3WDNA 1CKNA 2YTVA 4H0LC 2E5LQ 2UUCL 5T1GA 1QWYA 2VB3X 2F0IA 1EWCA 1HTPA 3KF6B 4C3JB 2VUMB 1HZ9A 2HQEA 5J22A 5LMNW 4DR4L 2F0GA 1VQ9A 3URYA 3RUZA 4JI3Q 5C3XA 1JB3A 1JE5A 1EY9A 1Q12A 5I9OA 5JPMC 2NN6I 3Q8DA 4QGUA 1JOOA 3M4OH 4H02A 3I91A 3M7GA 1H9MA 4A3DH 4IALA 1PYBA 3S1MH 2VZAA 2FXQA 1JJ2A 4LFCQ 5ELBA 1JOQA 3NQIA 1L0XB 3UDFA 5M3FG 2NWGA 3HS0C 2NBFA 3M9BA 1VDZA 2WP8J 2E2DC 3W3AA 4IZ8A 3I55A 1CA6A 2QEJC 3NWSA 2IY5B 1TWAB 5IGDA 2CVRA 1STEA 3CC4A 4Q5VA 3G48A 2I46A 1EY6A 3HOWH 1PHJA 1WCMB 2F4IA 1I94Q 2VW9A 2P5ZX 3TS0A 1E0BA 2E74C 2UUCQ 3QJYA 4QJFA 1XTCD 1XNRL 2BA1A 2BDOA 3BZKA 3H0GH 3NSWA 2R92H 4X3SA 4DNRB 4IO9A 4C1NI 2BCOA 1YBYA 5C0XJ 3EA6A 2R7FA 2E8GA 4BY1G 3A8KE 1D5ZC 2NUCA 4F88A 2VL6A 2CWPA 2JSOA 1RHPA 5E7NA 2PCFB 3R3OA 2YU9H 4RMFA 1N8RC 3SK5A 2KHSA 3S1QB 2KJXA 3NWTA 1TS4A 2GVBA 3BDLA 5I6YA 5EKLA 3VYSA 5FO7B 4CKCA 1NR4A 3I4MG 2FINB 3EVQA 3K57A 4V190 4FF2A 1SROA 2AHOB 4DAYB 3QIAA 4DN4M 4B3RL 1HPCA 5CMDA 5EJWA 3PO2G 4OO1G 2DJFC 3D0FA 4PV1C 5AJ3L 3KLRA 2WKCA 1DCZA 5C44B 3A56A 5K36G 5EGTA 1Q90A 4NKLA 5BN4A 3AU7A 5KRUA 2K5WA 4KKSA 2KCCA 5HURA 5C3EB 1RL2A 4MN3A 3MFYA 4DUYQ 1QILA 3C1FA 1CSPA 4KY7A 1FR3A 2C5CA 4R4IA 1GOZA 2K5DA 1EQVA 2Z6BA 1ESFA 3OSOA 1NBWA 1Z7TA 1F2LA 3K0YA 4GKKL 1Q82C 1TWAH 1LT6D 3OHXC 3U4VA 1DYQA 1UEBA 4ZUIA 1YEZA 3K59A 1BBUA 1Y69U 3PGZA 2F0SA 4N8FA 3JAML 4GN3B 4YY3L 4C3HB 4HR7B 3PIOA 3AFQA 1HH2P 5J1ZA 2JJQA 4MTNA 4N9PA 1JJGA 1WI5A 2RVLA 1D1IA 4IPCA 1SYBA 1YJWA 3QG1A 2K5QA 4K2KA 1HZAA 1SR3A 2XRSD 3HKZE 1LM0A 1PZID 5I2YA 4AH6A 1Q86C 3ERSX 4LF9Q 4LFAQ 2UU9L 2PI2E 1MGSA 4ZAIA 2EPBA 1TKWB 1TWFB 1B7YB 1OO9B 3TP8A 1EQQA 3GTKH 1NR2A 1PRTB 3KF8B 1KXLA 4JI2Q 4CDCC 2AQ2B 1AN8A 2B2UA 1K8GA 1Q3LA 2A68C 2L1BA 3HOVH 1XMQQ 3HOWB 5FJ8G 2IT1A 3NXWA 3TZDA 3KDFB 2XNAC 1PRTD 5NUCA 2VS1A 3VR3A 4MNOA 5IE8A 3BVMA 1BNZA 2QCPX 1RIPA 3AFPA 2OWOA 3X3MA 2B63G 3CCJA 4LK1C 3VR6A 1HZBA 4JW0A 5IGGA 1LTTD 4MZ9A 2QGQA 2F0QA 3SGIA 4KY6A 5C3WA 4IFDH 3I4MB 3J7YW 3U58A 2PQAB 2RDGA 1UE7A 1EIFA 4DR4Q 3S17B 4ID6A 3S2DB 3RZDH 4G7ZC 1AP0A 1E1TA 1N36L 4JI6Q 1LTAD 3EN2A 4H44C 3SXHA 5CBEE 1MHWC 2CWAA 5C6AA 4GN4B 4JC0A 2UU9Q 3GV6A 4LFAL 1AH9A 1QZHA 1N34L 1Y14B 4RKLA 2IW3A 4C1NK 3A54A 5DM63 1L2FA 1K73C 1RCVD 2ZJPA 1CUKA 1A15A 3HOZB 2D62A 4X6AH 1WCMG 3QOLA 2ZXPA 5JEAJ 1KQSA 1U0LA 3ND9A 2VQFQ 3GTQH 3G71A 2NVQH 1QUQB 4A3KB 1HR0W 3QO2A 1A3UA 3L3OC 2WB1E 1KC8C 4C3JG 2HCIA 3STBD 3MXNB 4GOPB 4G7HC 4OEMB 1JT8A 1D6EC 2B29A 4JI8Q 3HOUB 5BR8L 2R6GA 2D0OA 2UXBQ 1K83H 1STAA 1EYGA 4RH6A 1TU2B 3I4NH 2G5DA 2UXDQ 1IL2A 3NHHA 5ISRA 4IUNA 2VUMG 3KF6A 1A3TA 1NY4A 2MFIA 2K05A 5KNCA 5LMUQ 2L0CA 1O7ZA 4JYAL 3F2DA 1QVFA 4LF7Q 1PFBA 2A19A 4FDBA 1NCVA 1PTOH 3A7AB 3S1RB 3Q0AA 4LFBQ 4P2CB 2IL8A 3F8TA 4R4QA 4ZUJA 2VNUD 1IBLL 4DR2Q 5DEHA 3VR4A 5L37A 4BBRB 2A69C 4JI1Q 1BF4A 2WINB 2N3SA 1G6ZA 1LT4D 4KLKA 3S1RH 4AYBG 4J8QA 4A75A 1VMCA 2X6LA 3BU2A 4K5WA 3NP8A 2A69D 4PNYA 1Z9FA 1PTOF 1MD2D 3CQZB 1QB5D 1PFMA 2KEEA 1ML0D 1STHA 1KL9A 2SEBD 4XXEA 3PUYA 3CCUA 4LJZC 3EFXD 2OQ0A 2R7DA 1PXUA 4B9XA 2B63H 1GKHA 3E0JA 1LABA 1IXRA 3P7JA 4X64L 1HR0L 3AEVA 4TQUS 4A3LH 3PCOB 5CV6A 1IHZA 4A3JH 3OOCA 1Y8OB 4MHEA 3ZYYX 1STYA 3OIQA 4BY7H 4EVOA 4LF8Q 4K5XA 3PO3G 4JI7Q 2WAQG 4YIJA 1RODA 4ODGA 5ELDA 1SSOA 1YNXA 3K5NA 3JAME 3I4LA 4QY7A 3HOYG 1HNZQ 5M5WH 2PO4A 5JVH3 4OX9L 4K5VA 1B1ZA 2Y0SE 5JEAH 1H9SA 1LV9A 3NBHA 4UPAA 2PMZE 1BBXC 3GV3A 4A93G 4A3IH 1PVOA 1E1OA 1GUSA 1VQEA 2B2YC 1QE6A 3A7LA 1EY5A 2F52A 2PNHA 3KLSX 3QWNA 2K28A 3G7LA 4B3SQ 1QUQA 3K6OA 4QUCA 4X64Q 1HR0Q 4EGVA 3H3VI 1SNMA 4E6IA 1C4QA 5EAYA 1PH8A 2JA8G 2K33A 4ME3A 4FF3A 1GUOA 1R9TH 4IUUA 1X32A 2LY7A 2RCNA 4GOPA 3U4ZA 4LF4Q 3RZDB 1YNJC 2K75A 1SLJA 2PI2A 4RGMA 1X3EA 4IOCA 1BXTA 3CW2C 1SE4A 4HSPA 3ULJA 5GAGC 2TMPA 5D3IB 3MEHA 4JOIC 4RWSC 2B63B 1X3QA 2O2LD 2DN8A 1E2ZA 2I5LX 3IAYA 4UP9A 3U9SA 4DV7Q 2F03A 4IJLA 1B3QA 1Q8KA 2K52A 3T1YQ 3K58A 1IW7C 2PNRC 4B08A 3RD4A 2B2VC 1VQFA 3EJIA 1L0YB 2EYLA 4BY7B 3K80C 4JV5L 1M8AA 1VF7A 4IUQA 1SEBD 2RA4A 4QUFA 2EOTA 3UI2A 1ILPA 5EQ0A 5M5WB 2XVSA 1AZPA 3A8JE 2YU9B 2HHHL 1U5KA 2UUBL 3T53B 3HFZB 3KF8A 2SOBA 1CQFA 2NTTA 4K0KQ 2I5MX 3NELA 3DHQA 4J6HA 1KD1C 3OW7A 2NZOA 1QOHA 2ATWA 1S5ED 4DK6C 3CC2A 1LTLA 2AKWB 2KOLA 3KDFA 2JYOA 1MSHA 1AE3A 1YZ6A 4H13C 1HCZA 4GNXC 1F2YA 3F2BA 2PQAA 5C44H 1IL8A 4DV6L 3HP3A 1LTSD 3OPOA 4R8IA 3AB9A 3BJUA 1SYEA 4DV1L 4TSSA 5HGTA 1WD1A 3RZOH 5JJIA 2DUDA 3KFUA 4JV5Q 2SNMA 1A8VA 3VYRA 2I0QA 3CF5A 3IRBA 1G2SA 5CV9A 4HCEA 2E2JH 1B9NA 5IODA 1CTMA 1A62A 1V1PA 2AQ3B 2UUBQ 3SK8A 4HIOA 1WTQA 1B70B 1IYJB 1SMYC 1N32L 2K50A 3RLFA 1I6HB 1WVLA 4I7ZC 4A4IA 2ID0A 3HEJA 4WJWA 3S1MB 1OXUA 1D7QA 4JI5Q 4HJAA 3CD6A 5M9OA 2CQAA 3GTJB 3K81C 1IKLA 1R9TB 4B3ML 2LXJA 3TDQA 3EQLC 1T5EA 4L5RC 3H09A 4K14A 4ZQ3A 5FJ8H 2PQEA 4BWGB 5KYLA 4JG2A 4RHSA 4DR5Q 3UDIA 3KBGA 5C0XH 2CHBD 4DAVA 5EPJA 1LTID 1LTRD 2RSNA 1OTCA 5CBAE 5FOBB 3FKIH 4HJ7A 1B2TA 1GJXA 3HOVG 1J5EL 3K7UC 4A3BB 1PFNA 2HQLA 3HOXB 1I4XA 2CH4W 4A3GG 3S14B 4FNFA 2NZ1D 5A2QE 1RTOA 1K28A 2B2WA 4G4KA 4PMBA 1Q81C 4GNXA 2D2CC 1CKMA 4BA1I 3I4OA 2R93G 4KKTA 1KTKA 4L5SA 3D6CA 2NVTB 3S9WA 2VB2X 1NAPA 4Z9CB 4IFDI 1O7IA 5D65A 1PTOC 3FDTA 3DEOA 1I6HH 4KN7C 4DK0A 4PMCA 4DV4Q 3TP5A 4CJ1B 2R7ZG 4G7OC 1DZ1A 2F0UA 2DNCA 1BO0A 2MO0A 5IGFA 1F2ZA 2KEDA 1BBWA 4XT3B 1SNOA 4LF9L 1PV4A 3D8GA 4DR7L 3RZOB 2K03A 1KAWA 1C0AA 1WOCA 3G6EA 3ULLA 4L8JA 1TWCH 4YY3Q 1WTHA 3PO2H 4UDUC 2LXKA 2Q2UA 3GDEA 3LWEA 5HY6A 4AIMA 5IGEA 4M8AA 5IT9E 4Q0FA 1UE5A 1S5BD 5C0XG 1HZCA 1TWGH 2JA6H 1KNEA 4V0BA 3T13A 4LW1A 1J6QA 1TS5A 3FEWX 4UP8A 2ZJQA 1KRSA 3J7A5 3MZ5A 1CZGA 2LFNA 4BBRH 5G3LD 3CKIB 3A5ZB 4I65A 5GAEC 4OIJA 1YHQA 1PA6A 3MWYW 4R8NA 3D31A 2IX0A 4C3HH 3J81c 3SVMA 3CCVA 4DV4L 1HUMA 1L1OA 1AZQA 1IBML 5JJKA 1U4RA 1SE8A 4R4CA 5IGCA 1RJTA 1DJRD 3I3CA 4ZKBB 1Y1WB 1B3AA 1JMCA 1BVSA 3J81i 3J7AF 4L63B 1VQOA 4OWWB 5LMNL 4OONA 3NTIA 1XJVA 3EIVA 4FF1A 3L0OA 1VQGA 3MA2B 2PZWA 3H0GG 4A3MB 2R92G 1ENAA 1GXDC 2MUYA 3QR8A 4YCVA 4PZ7A 2B2WC 5I9PA 2N8NA 2ZTDA 4DR6Q 2EJFC 5IYDH 1I3QH 1SYDA 1WTVA 5IWAQ 3T51B 1EIGA 2KUMA 2KCNA 4DKAC 2EZVA 1C48A 5M3FB 4YWMA 4CDFC 4F7XA 4QF4A 1ZEQX 5CORA 1HUNA 4X66Q 4IUVA 3J7ZC 2CFMA 1S5FD 2MHVA 2F0LA 3CMAA 4OX9Q 4KD4A 3PO3H 2R7ZH 4A3FG 4CKBA 3K5LA 2JE6I 3D6WA 1FGBD 4BXXG 4DNTB 1PRTF 5FK9C 3HOZH 4WJ3M 2X6GA 4KHVA 1EEFD 4EQOA 4X65Q 2JA7B 1M4VA 2GVAA 2A6ED 1YITA 3GTJH 4B3MQ 4UY8C 1JR0D 4N8X1 4NW2A 4YCWA 4EQNA 2OCEA 3V05A 1VQ4A 1G6PA 4BA2I 1D5XC 4QCLA 4ZCKA 2R7ZB 1N33Q 4DR5L 3CRLC 1RF2D 2Z6KC 2JXMB 2JN4A 1D8LA 3PF4A 1EUJA 2EVBA 2I07B 5BR8Q 4DF7A 1QG7A 3CMEA 3FKIB 2ZJRA 1HTLD 3KBXA 4A3CG 1B4OA 3K7AH 2JA5G 1YIJA 1IKMA 1TXYA 3M3YH 4IUPA 5C4XG 1I50B 3EBEA 3MXPA 1BQQT 2ZM6L 2AUJD 2N78A 3R2TA 4DV7L 3ND8A 2A68D 1W2BA 5LMUL 3QB3A 2UUAL 1S72A 1KHIA 1TT2A 5LHY1 1IBKQ 1XNQQ 1BDOA 1UUPA 2WV6D 1PRTC 1GHJA 1H9KA 3M4YA 4DXGA 2K1BA 1VQ5A 1CQVA 2MP1A 1YHBA 4P74A 1JE4A 4HEDA 1HNXQ 2NVTH 4DAMA 4OXPA 1QVCA 4ILWA 4LWCA 4XQQA 3VA5A 3GTLH 3I90A 1DOKA 5FO8B 1KIXA 1N33L 3I4NG 1XNRQ 1MIUA 1EYDA 2EYPA 3KOJA 2AQ1B 1SDFA 3GTGH 3ITPA 1VQIA 3MXGA 1VQHA 4YHHQ 3PMFA 1JWMD 5EKIA 4K6DA 4APVA 1SJED 4JI7L 5JAVA 5I6WA 1PTOB 1NTGA 4LF6L 1E2WA 1VS0A 2EYMA 3V96A 4LUZA 2RQXA 1CFMA 5M5YB 4RGOS 1HNWL 1XX8A 3JC66 1Y8PB 5ELEA 1RTNA 1PZKD 2RF4A 5HGQA 1Z47A 1ESRA 1JORA 2J4XA 1NNXA 3NEMA 2F0VA 2RDFA 3D4DA 4DV0L 1X55A 2LKVA 2JA6B 1X3PA 2NB0A 1BKBA 1HRJA 4ZLTF 5AJ3Q 4EX5A 4A3JB 3L9AX 4RG1A 3TP6A 1I50H 2O4XA 4MIUA 5IYBG 2PYKA 5FO9B 1ZYRD 3V2TA 1PH6A 2BE5C 3K7AB 3D4RA 1CHPD 4OGQC 1A63A 1VF5C 2QDLA 5C5LA 1HNZL 1WJJA 2CQOA 4GS3A 4C56C 3T16A 4OO1H 1FYCA 4KV6A 3GTQB 4DPGA 2M00A 3S15H 4KJNA 5CV8A 3U9OA 2MNAA 4P75A 1GD7A 2L4NA 1QCBD 3NQTA 2NVXH 1CA5A 3P1HA 1NJIC 2QDBA 4KHPQ 1F9SA 5C4XH 2E5LL 4HTHA 4WORA 3A0JA 1UE1A 1TIID 2A73B 5JJZA 3O13A 1W6JA 2G9DA 2FMMA 3ULPA 3I4NB 1E3PA 4FVMA 2LS01 1LYLA 1T9HA 3VR5A 3CP0A 3HOWG 1VQCA 4JI1L 3C3LA 4KY5A 2OT2A 2B2TC 2NVYH 1SRUA 1I4GA 1A0IA 1TS2A 3OMGA 3C2PA 4LUOA 2R93H 1S40A 1ICWA 1A6XA 2B8GA 3T1YL 3CCRA 2K6AA 1EY0A 2HDLA 3HKZG 5CV7A 4ZKCB 4AQYQ 4B9WA 2MGSA 1VQBA 1EFWA 4OHJA 5EBCA 3OW2A 1FNUA 2R3ZA 2Z6KA 3CHBD 2HIVA 1VQPA 1ET6A 1DD2A 2DY8A 1NMGA 2BDNA 5C4XB 1ASZA 3M4QA 3M4OB 1KDBA 3CRKC 2H5XA 2F4VL 2K5NA 1D1KA 1I4PA 3F2CA 3PIP3 2JA8B 1G291 3OTOQ 4UAIA 2RHSB 3OMCA 3BDOA 2DGYA 1MSGA 1X3FA 4S3SA 5ELNA 3CCSA 2EY5A 1QVGA 1N36Q 3H91A 5M5XH 1WYDA 3Q6SA 1E24A 2RCFA 4GKJL 1V43A 3C46A 3J80c 4IJHA 4F8MA 4FF4A 1B53A 2ZXOA 1S4ZA 2N49A 1N32Q 1QNUA 2D9UA 2NVXB 1LLRD 1WTRA 1SYCA 4N9TA 2WIIB 1EU3A 4NMZA 2PPBC 1F77A 3PUVA 1TWGB 4ME5A 2B3GA 3MVVA 5CV4A 4DV2L 2JP1A 4RA8A 2F1MA 3NTKA 2WFWA 4DGZA 3H94A 3I4MH 2F3WA 4EQ5A 2NVYB 1KAAA 2PW5A 1I4HA 2ASBA 1EOVA 3DEPA 4CJ2C 3GTPB 4R4TA 3DWPA 2IPKD 2SNSA 4X3KA 3I70A 3UE1A 1EY8A 3OTOL 4DUYL 5EPLA 1IBMQ 3GTGB 4JI8L 1KLUD 1F9RA 2BH8A 4IPHA 4CKEA 4YHHL 3BYYB 1EYCA 2EE1A 3FVQA 5FLXc 4A3IB 3A8IE 5LMNQ 3KLWA 4BY1B 2F0HA 2WB1G 2KHJA 4A3EG 4DU9A 1BCPD 3RN2A 4A3MH 2JA9A 3ONAB 4DA2A 3BVZA 3L2PA 1EZ8A 3RR5A 2B2VA 2XN9C 2NYZD 3OYYA 5IYCH 1CM9A 3GTMB 1F9QA 2K04A 1TWHH 1VQ7A 4U68A 1BCPC 1ZKOA 3NUCA 1PH5A 2TSSA 2KQ3A 2A6HD 2RHQB 1ILQA 1QZGA 3W2DA 1PTOD 1JCKB 4LF5L 1V9PA 4X66L 3MXUA 2F0DA 4GOPC 4DAPA 2Y0SB 2O5JC 2H4OA 1PH2A 3OIPA 2JA5B 4X3TA 1HQRD 4K0KL 3HKSA 4C2MH 5DLQE 1EQTA 4HIDA 1Q1BA 3G6JB 3M4PA 5E1FA 2CH4A 1DOMA 4R1JA 3VYTA 5GAHC 1R4QB 4DR7Q 1EWHA 1B50A 4DV5Q 4K8IA 4GLAC 1FNWA 3PUZA 4DV6Q 4A3CH 2EYHA 4O42A 3Q24A 1V1PB 1GHKA 1J8IA 5FLMG 4K2LA 3CCQA 2JA7G 2OTJA 1HHVA 2AWNA 2KHIA 4CGYB 4JK1C 3KJPA 4BY1H 2K4KA 3SR1A 4HSVA 5F2DA 5A2QL 1DGSA 3HGBA 4BXXH 1PYSB 3E3XA 1N34Q 1CZWA 2R93B 2Z4HA 5D3DA 2Y0SG 3TP7A 3CCLA 2F0NA 2L11A 3E9IA 4QIWB 3A55A 4DXFA 1OXVA 2K01A 1KLGD 4O1NA 4NDXA 2VQFL 4A3EB 5FLXE 4RCNA 2A5HA 1XYIA 1CKOA 2PMZB 1VMPA 4DR1L 4A3IG 3DM1A 2FHTA 1ASYA 1K0RA 3E6ZX 1K0SA 4XYOA 4A3BG 5IP7G 1JWUD 2B8FA 4A76A 3M3YB 4PZ6A 3HOVB 3H3VC 2JA5H 2KA7A 4WJ4A 1DM0B 1G8ZD 5IWAL 3TQYA 4OL7A 4IUTA 3Q23A 1G2TA 2UXCL 1RD9D 1GUTA 1S3OA 4ZRZA 1K8AC 2YYZA 5DM73 2WB1B 4A3FH 2JEBI 4JI3L 5H1SE 2SDFA 1XPRA 5M5XB 1A2UA 1J5EQ 3W1BA 4GNXB 2D5DA 1Y1VH 4GKJQ 3MAQA 3TREA 4A3KH 1ONLA 3X3NA 1TWHB 1IYUA 4JBJA 4X62L 1WD0A 2JEAI 3GTLB 3S2DH 3IKJA 2A6HC 1LT5D 1KRTA 2JA7H 4FXKC 2VXWA 3J80L 4CDDC 4DV2Q 2K5VA 3TEHB 1Y1WH 1V1OA 1LUZA 4XTCS 4JI0L 3UDGA 1K83B 4K6LA 3HOXH 5ELCA 3S14H 3E5SA 1U9RA 4L5TA 1FJGL 1OXTA 2L12A 1SXTA 4FP5D 3FHWA 1GVPA 4XYQA 4J15A 3J80E 3TS2A 3RNUA 4RHRA 4TRDA 4JI4L 1NE3A 4NXNQ 4RAUC 2HIXA 2L15A 1I3QB 1U4LA 3BDCA 2IX1A 1JQYD 3STBC 1SNPA 1TY0A 2C35B 4JOIA 2ZTEA 4A3EH 1W3SA 4XDXA 3DXJC 1JC7A 1STNA 2E75C 5TSSA 3CCEA 1EFID 3HOUH 4EQPA 3CPFA 3VDYA 2EY2A 3GTMH 1T5XD 2OXPA 2Q8TA 3K0XA 4A3DB 1VQ8A 4RCOA 4HJ9A 4I7AA 2QW7A 5C5MA 3PUXA 5IT9c 2XRQD 5I4DA 2MJ8A 1FL0A 1PH4A 2IHEA 4KKUA 2JK8A 4CDEC 2AUKA 3S15B 1RKNA 3HOXG 3S16H 3HKZB 1PYWD 1DXMA 2QA4A 1H9JA 1Y1VB 1YNNC 4RFBA 1AE2A 4B3TL 5CR3A 4HN7A 5AFWA 4WFN3 4A3DG 4BY7G 1S5CD 1ICFB 4L6TB 4DUZL 4IFDJ 4QQBX 4H7BA 1F9PA 1WCMH 2Z8LA 4UHVA 2K5HA 4XIGS 1L0WA 5EBDA 3NTHA 5M3MH 1X6OA 1XPOA 3J81L 1JICA 1Y8NB 2YV5A 3PUWA 4PMWA 1JWSD 2GN5A 1W6KA 3VR2A 1I5FA 3BVGA 3TZUA 4IN3A 5CC4A 3SK4A 1DONA 3CQZH 2X69A 1EU4A 4FXDA 4BBSB 4LFBL 2L5TA 3LX0A 3A5UA 1I4RA 1HXYD 3HG9A 4P72A 1EWIA 3UE0A 3RLOA 2ICEC 3WWVA 3CC7A 1Q1EA 1K9MC 2M2LA 3F1ZA 2XWBB 4OWTB 1C7YA 2JA6G 1JJCB 2RDHA 1KABA 2MO1A 5E4XA 4B3TQ 4FXGC 3MFGA 4A93B 4QMGA 4IOAA 1VQNA 4BBSH 2R61A 1Q46A 5IY0A 2NZHA 2A6EC 4A3JG 4RGTA 5JPNC 3KYHC 2NN6H 2IHFA 4P73A 3ER0A 1Q8IA 5IP7H 3QOJA 3S1NH 3D3RA 4GLVB 3FRPB 1TR5A 3NK9A 3SK6A 1K8MA 3PO3B 1EIHA 4A3LG 4L5QA 4ZYSA 4JPBW 4HAEA 2PZTA 5D14A 2KENA 5J3BA 3K5MA 3H6MA 3B6YA 3PF5A 2WKDA 3DM3A 1GUGA 2Z4IA 4GN5A 2DJGC 4R9WA 2EYJA 5JOBA 5FLMH 3J81E 1WTPA 4Y52H 1B8AA 2Q2IA 5KNDA 1X56A 1Y1VG 2Z1CA 4LUVA 2N88A 3MC0B 4DK1A 1H95A 1MBYA 1WFQA 2ZT9C 3G4SA 3TN2A 4O2DA 1MKHA 5M3MB 3I73A 1X9NA 1UEAB 4JBWA 3SE0A 5C4ZA 3BS1A 5DAUA 1BUVT 2I5HA 4AQYL 2QF7A 4YCUA 3TSSA 4DV1Q 1UWVA 3W1GA 2Q8IB 1GM5A 4NP5A 4KD3A 3PSIA 5KNBA 3A74A 1LTBD 1YJ9A 3S1NB 3FKIG 1O80A 1J9OA 2Q2HA 3N52A
chains in the Genus database with same CATH topology
2CW0D 4CBVA 1MI2A 2EXZA 3CU7A 3OWEB 3KK7A 3SDZA 2BOSA 3LNNA 1TS3A 1HQMC 3RMHA 1STGA 1SNCA 2B2UC 2CW0C 1UNSA 5JVG3 2QKIC 5KEEA 2K32A 3KLSA 3R93A 2F0MA 1V8QA 3IFDA 4KMUC 5ELFA 1S5DD 4C3IG 1SMYD 1SNQA 3M85A 1RDPD 1ZYRC 3R8BA 1PMRA 2G9HD 3I8ZA 3BYTB 1I6VC 1VCIA 2PW7A 3EROA 4KI0A 1PDQA 2E2JB 2F3VA 3HRZC 2HUGA 2RBMA 1A2TA 4HMJA 1QNKA 2F0OA 1HA5A 1SE2A 5IIFA 1C8CA 1XXGA 4FYDA 4Y7NB 2WACA 3LWUA 2J7ZA 4AYBB 1EYAA 5C4JB 1D2BA 5A35A 5J39A 4RKBA 2BA0A 5FLXL 3GO5A 1HA6A 1LTGD 2ZXRA 1NUCA 1UAPA 2XIWA 1XWEA 3GTKB 4BS9A 2EDGA 3NE5B 3GP7A 4G57A 3OWFA 4LMQD 2OF1A 1B9MA 3K5OA 1STBA 1EZ6A 2F0TA 4PQXA 5CGKA 1H9SB 2ENBA 5EKKA 3WOEA 5KYIA 1GUWA 1U4PA 2E76C 4C3HG 5DNFA 5C0XI 1KNAA 1ET9A 2F0PA 1AW7A 4CJ0B 5E4WC 4XQJA 4IURA 4KTAA 3IFTA 4KJOA 1ENCA 4XT1B 3FMCA 5KIXA 1LO5D 4ULLA 3NBIA 1SNDA 1O7YA 4F87A 3L7ZC 4A3GB 1KDAA 2NVQB 3T4AC 2F0JA 2H1EA 1HFGA 1KDCA 1EEID 1F2MA 1I4QA 4KHZA 1EY4A 2RSOA 2NN6G 1ENFA 3P75A 3D4WA 2HCCA 2F0KA 1CK1A 2EYFA 5T1IA 2DNEA 4KN4C 1TY2A 1R4PB 2M9VA 5JEAG 2PZUA 1E2VA 3BG3A 2GA4B 3TMEA 1TQOA 3C1EA 3TBIB 4J1MA 1FNVA 3MHBA 2ICIA 2L55A 1EL0A 1CI3M 5BN5A 1II3A 3WOFA 3ERQA 4HMIA 3GD7A 5G3LF 4KK7A 1SAPA 4FO2A 2IWHA 5IOCA 3KUPA 1PLFA 3BZDB 2AWOA 5CYUA 5BN3A 3FPPA 3VA7A 2E2HB 3R2IA 3MXNA 3P20A 4RGNA 1SBBB 4DAYA 2EY1A 4WRDA 1OXXK 2KVMA 1YNND 2L9HA 2XSCA 2MPMA 2DY7A 2EJGC 3SHLA 4ZK9B 1TWCB 3PO2B 3PIO3 2N55A 5COYA 5FKAC 2NTSA 3HZXA 1AFPA 1Z6HA 1B44D 5KGUA 5I2XA 4TKOB 1SYGA 1SYFA 2EY6A 1SJHD 3SEBA 3J7AV 3S2HB 2FJ2A 5IT9L 1WTXA 3AMUA 2C9OA 4OIKA 5EPKA 4U673 2B39A 2LMCB 4M1UB 1OXSC 4LAAA 1G91A 1BCPB 2B2TA 5K5PA 2V4DA 2RKSA 1BCPF 1GUNA 1ZXTA 5CV5A 3DMUA 3Q22A 3HOYB 4ABNA 3MTSA 2FMCA 1D5MC 3DWQA 4A3FB 5LL6S 1CT1D 2OEOA 5C4HA 2WAQB 4GZYC 4C3IB 2IJ0A 2EYOA 2F0WA 1CHQD 3DUZA 1JOKA 3PV0A 3GTOB 2IX3A 1WTOA 1HFNA 4QB4A 1YNJD 3S16B 2Q8RE 2BE5D 2HDMA 3VYUA 1A3VA 1SFOB 4IFDG 3H0GB 2R92B 1IYVA 1O7LA 5IGBA 3M7NA 1IW7D 3DWAA 3N6RA 4CHTB 1TVXA 1BOSA 1PZJD 3T56B 2F0FA 2E2IB 2K7VA 2O5IC 1O78A 1LT3D 1NSNS 4XQNA 1FD7D 1H9RA 1SE3A 5LL6X 5K36H 3GQBA 1K8OA 1U4MA 5E3FA 4C2MB 2A74C 3NPPA 4IQZA 3I72A 4X3UA 2KECA 2QILA 1QJOA 1DOLA 4HCSA 2XWJB 1EOTA 1AEXA 1WTWA 2B2YA 1LACA 3FPUB 4DFAA 1BR9A 4K8JA 2J0TD 2F0EA 3F2UA 3IL8A 2FFKB 4OO1I 1EY7A 2EJMA 3WDNA 4H0LC 5T1GA 1QWYA 2VB3X 2F0IA 1EWCA 1HTPA 4C3JB 2VUMB 2HQEA 5J22A 2F0GA 3URYA 3RUZA 5C3XA 1JB3A 1EY9A 1Q12A 5I9OA 5JPMC 2NN6I 1JOOA 3I91A 3M7GA 1H9MA 4IALA 5ELBA 1JOQA 3NQIA 1L0XB 2NWGA 3HS0C 2NBFA 1VDZA 2WP8J 2E2DC 3W3AA 4IZ8A 1CA6A 2QEJC 3NWSA 1TWAB 5IGDA 2CVRA 1STEA 4Q5VA 2I46A 1EY6A 1WCMB 2F4IA 1E0BA 2E74C 3QJYA 1XTCD 2BA1A 2BDOA 3NSWA 4X3SA 4DNRB 4C1NI 2BCOA 5C0XJ 3EA6A 3A8KE 1D5ZC 2NUCA 4F88A 2JSOA 1RHPA 2PCFB 3R3OA 3SK5A 2KHSA 3S1QB 2KJXA 3NWTA 1TS4A 3BDLA 5I6YA 5EKLA 3VYSA 5FO7B 4CKCA 1NR4A 2FINB 3EVQA 3K57A 4V190 4FF2A 3QIAA 4DN4M 1HPCA 5CMDA 5EJWA 4OO1G 4PV1C 3KLRA 2WKCA 1DCZA 5C44B 3A56A 5K36G 5EGTA 1Q90A 4NKLA 5BN4A 3AU7A 5KRUA 2K5WA 4KKSA 2KCCA 5HURA 5C3EB 4MN3A 3MFYA 1QILA 3C1FA 4KY7A 1FR3A 2C5CA 1GOZA 2K5DA 1EQVA 1ESFA 3OSOA 1Z7TA 1F2LA 3K0YA 1LT6D 3OHXC 1DYQA 4ZUIA 3K59A 1Y69U 2F0SA 3JAML 4C3HB 4HR7B 5J1ZA 4N9PA 2RVLA 1D1IA 1SYBA 3QG1A 2K5QA 4K2KA 2XRSD 1PZID 5I2YA 1MGSA 4ZAIA 2EPBA 1TKWB 1TWFB 1OO9B 3TP8A 1NR2A 1PRTB 2AQ2B 1AN8A 2B2UA 1Q3LA 2A68C 2L1BA 3HOWB 2IT1A 3NXWA 3TZDA 2XNAC 1PRTD 5NUCA 3VR3A 3BVMA 1BNZA 2QCPX 3X3MA 4LK1C 3VR6A 5IGGA 1LTTD 2F0QA 4KY6A 5C3WA 4IFDH 3I4MB 3J7YW 2RDGA 3S17B 4ID6A 3S2DB 4G7ZC 1AP0A 1LTAD 4H44C 3SXHA 5CBEE 5C6AA 3GV6A 4RKLA 2IW3A 4C1NK 3A54A 5DM63 1RCVD 1A15A 3HOZB 2D62A 3QOLA 2ZXPA 5JEAJ 3ND9A 4A3KB 3QO2A 1A3UA 3L3OC 4C3JG 2HCIA 4G7HC 1D6EC 3HOUB 2R6GA 1STAA 4RH6A 1TU2B 3NHHA 5ISRA 4IUNA 1A3TA 2K05A 5KNCA 2L0CA 1O7ZA 1PFBA 3S1RB 1NCVA 1PTOH 3A7AB 3Q0AA 4P2CB 2IL8A 4ZUJA 2VNUD 5DEHA 3VR4A 4BBRB 2A69C 1BF4A 2WINB 1G6ZA 1LT4D 4J8QA 1VMCA 2X6LA 4K5WA 3NP8A 2A69D 4PNYA 1PTOF 1MD2D 3CQZB 1QB5D 1PFMA 2KEEA 1ML0D 1STHA 2SEBD 4XXEA 3PUYA 4B9XA 4LJZC 3EFXD 1PXUA 3E0JA 1LABA 3P7JA 4TQUS 5CV6A 1IHZA 3OOCA 1Y8OB 4MHEA 3ZYYX 1STYA 3OIQA 4EVOA 4K5XA 4YIJA 1RODA 4ODGA 5ELDA 1SSOA 3K5NA 3JAME 3I4LA 2PO4A 5JVH3 4K5VA 1B1ZA 5JEAH 1H9SA 1LV9A 3NBHA 1BBXC 3GV3A 1GUSA 2B2YC 1QE6A 3A7LA 1EY5A 3KLSX 3QWNA 2K28A 3G7LA 3K6OA 4QUCA 4EGVA 1SNMA 4E6IA 1C4QA 2K33A 4FF3A 1GUOA 4IUUA 1X32A 2LY7A 3RZDB 1YNJC 4RGMA 1BXTA 1SE4A 4HSPA 2TMPA 5D3IB 3MEHA 4RWSC 2B63B 1X3QA 2O2LD 2DN8A 1E2ZA 3IAYA 2F03A 3U9SA 3K58A 1IW7C 2PNRC 4B08A 3RD4A 2B2VC 3EJIA 1L0YB 2EYLA 4BY7B 1M8AA 1VF7A 4IUQA 1SEBD 2RA4A 4QUFA 2EOTA 3UI2A 1ILPA 5EQ0A 5M5WB 2XVSA 1AZPA 3A8JE 2YU9B 3T53B 3KF8A 2SOBA 1CQFA 2NTTA 4J6HA 3DHQA 3OW7A 1QOHA 1S5ED 2KOLA 2JYOA 1MSHA 4H13C 1HCZA 1F2YA 1IL8A 3HP3A 1LTSD 3OPOA 4R8IA 3AB9A 1SYEA 4TSSA 5HGTA 1WD1A 2SNMA 3VYRA 1G2SA 5CV9A 4HCEA 1B9NA 5IODA 1CTMA 1V1PA 2AQ3B 3SK8A 1WTQA 1SMYC 3RLFA 1I6HB 1WVLA 4I7ZC 2ID0A 3HEJA 4WJWA 3S1MB 1OXUA 5M9OA 2CQAA 3GTJB 1IKLA 1R9TB 3TDQA 3EQLC 1T5EA 3H09A 4K14A 4ZQ3A 2PQEA 4BWGB 5KYLA 4RHSA 3KBGA 5C0XH 2CHBD 4DAVA 5EPJA 1LTID 1LTRD 2RSNA 5CBAE 5FOBB 1B2TA 1GJXA 4A3BB 1PFNA 3HOXB 1I4XA 3S14B 4FNFA 2NZ1D 5A2QE 1RTOA 2B2WA 4G4KA 4PMBA 2D2CC 4BA1I 4KKTA 1KTKA 3D6CA 2NVTB 3S9WA 2VB2X 1NAPA 4Z9CB 4IFDI 5D65A 1PTOC 3FDTA 3DEOA 4KN7C 4DK0A 4PMCA 3TP5A 4CJ1B 4G7OC 1DZ1A 2F0UA 2DNCA 1BO0A 5IGFA 1F2ZA 2KEDA 4XT3B 1SNOA 3D8GA 3RZOB 2K03A 4L8JA 4UDUC 3LWEA 5IGEA 4M8AA 5IT9E 4Q0FA 1S5BD 5C0XG 1KNEA 4V0BA 3T13A 1TS5A 3FEWX 3MZ5A 1CZGA 2LFNA 5G3LD 3CKIB 4I65A 4OIJA 3MWYW 4R8NA 3D31A 2IX0A 3SVMA 1HUMA 1AZQA 1U4RA 5IGCA 1RJTA 1DJRD 3I3CA 4ZKBB 1Y1WB 1B3AA 3J7AF 4L63B 3NTIA 4FF1A 3MA2B 2PZWA 4A3MB 1ENAA 1GXDC 2MUYA 2B2WC 5I9PA 2EJFC 1SYDA 1WTVA 3T51B 1EIGA 2KUMA 2KCNA 2EZVA 1C48A 5M3FB 4F7XA 4QF4A 1ZEQX 5CORA 1HUNA 4IUVA 1S5FD 2MHVA 2F0LA 4KD4A 4CKBA 3K5LA 2JE6I 3D6WA 1FGBD 4DNTB 1PRTF 5FK9C 2X6GA 4KHVA 1EEFD 4EQOA 2JA7B 1M4VA 2A6ED 1JR0D 4NW2A 4EQNA 3V05A 4BA2I 1D5XC 4QCLA 2R7ZB 3CRLC 1RF2D 2JXMB 2EVBA 2I07B 4DF7A 1QG7A 3FKIB 1HTLD 3KBXA 1B4OA 1IKMA 4IUPA 1I50B 3MXPA 1BQQT 2AUJD 3R2TA 3ND8A 2A68D 3QB3A 1TT2A 5LHY1 1BDOA 1UUPA 2WV6D 1PRTC 1GHJA 1H9KA 3M4YA 4DXGA 2K1BA 1CQVA 2MP1A 1JE4A 4HEDA 4ILWA 4XQQA 3VA5A 3I90A 1DOKA 5FO8B 1EYDA 2EYPA 2AQ1B 1SDFA 3ITPA 3MXGA 1JWMD 5EKIA 3PMFA 4K6DA 1SJED 5JAVA 5I6WA 1PTOB 1E2WA 2EYMA 3V96A 5M5YB 2RQXA 1CFMA 4RGOS 1XX8A 1Y8PB 5ELEA 1RTNA 1PZKD 1Z47A 1ESRA 1JORA 2J4XA 2F0VA 2RDFA 3D4DA 2LKVA 2JA6B 1X3PA 2NB0A 1HRJA 4ZLTF 4A3JB 3L9AX 3TP6A 2O4XA 4MIUA 2PYKA 5FO9B 1ZYRD 3V2TA 2BE5C 3K7AB 3D4RA 1CHPD 4OGQC 1VF5C 5C5LA 4C56C 3T16A 4OO1H 1FYCA 4KV6A 3GTQB 2M00A 4KJNA 5CV8A 3U9OA 2L4NA 1QCBD 3NQTA 1CA5A 3P1HA 2QDBA 1F9SA 4HTHA 4WORA 2A73B 1TIID 5JJZA 1W6JA 3O13A 2G9DA 2FMMA 3I4NB 4FVMA 2LS01 3VR5A 3C3LA 4KY5A 2OT2A 2B2TC 1I4GA 1TS2A 3OMGA 3C2PA 1ICWA 1A6XA 2B8GA 2K6AA 1EY0A 2HDLA 5CV7A 4ZKCB 4B9WA 2MGSA 4OHJA 5EBCA 1FNUA 2R3ZA 3CHBD 1ET6A 1DD2A 2DY8A 2BDNA 5C4XB 3M4OB 1KDBA 3CRKC 1D1KA 1I4PA 3PIP3 2JA8B 1G291 4UAIA 3OMCA 3BDOA 1MSGA 4S3SA 2EY5A 3H91A 3Q6SA 1V43A 3C46A 4FF4A 4F8MA 1B53A 2ZXOA 1S4ZA 1QNUA 2D9UA 2NVXB 1LLRD 1WTRA 1SYCA 4N9TA 2WIIB 1EU3A 4NMZA 2PPBC 1F77A 3PUVA 1TWGB 4ME5A 3MVVA 5CV4A 2JP1A 4RA8A 2F1MA 3NTKA 4DGZA 3H94A 2F3WA 2NVYB 1KAAA 2PW5A 1I4HA 3DEPA 4CJ2C 3GTPB 3DWPA 2IPKD 2SNSA 4X3KA 3I70A 1EY8A 5EPLA 3GTGB 1KLUD 1F9RA 4CKEA 3BYYB 1EYCA 2EE1A 3FVQA 4A3IB 3A8IE 4BY1B 2F0HA 4DU9A 1BCPD 3ONAB 4DA2A 3BVZA 1EZ8A 2B2VA 2XN9C 2NYZD 1CM9A 3GTMB 1F9QA 2K04A 4U68A 1BCPC 1ZKOA 3NUCA 2TSSA 2KQ3A 2A6HD 1ILQA 3W2DA 1PTOD 1JCKB 3MXUA 2F0DA 4DAPA 2Y0SB 2O5JC 2H4OA 3OIPA 2JA5B 4X3TA 1HQRD 1EQTA 1Q1BA 3G6JB 5E1FA 1DOMA 3VYTA 1R4QB 1EWHA 1B50A 4K8IA 1FNWA 3PUZA 2EYHA 4O42A 3Q24A 1V1PB 1GHKA 1J8IA 4K2LA 1HHVA 2AWNA 4CGYB 4JK1C 3SR1A 4HSVA 5F2DA 5A2QL 3HGBA 1CZWA 2R93B 2Z4HA 5D3DA 3TP7A 2F0NA 2L11A 4QIWB 3A55A 4DXFA 1OXVA 2K01A 1KLGD 4A3EB 4O1NA 4NDXA 5FLXE 1XYIA 2A5HA 4RCNA 2PMZB 1VMPA 3DM1A 2FHTA 3E6ZX 4XYOA 1JWUD 2B8FA 3M3YB 3HOVB 3H3VC 2KA7A 1DM0B 1G8ZD 4OL7A 4IUTA 3Q23A 1G2TA 1RD9D 1GUTA 4ZRZA 2YYZA 5DM73 2WB1B 2JEBI 2SDFA 5M5XB 1A2UA 2D5DA 3MAQA 1ONLA 3X3NA 1TWHB 1IYUA 1WD0A 2JEAI 3GTLB 3IKJA 2A6HC 1LT5D 4FXKC 2VXWA 3J80L 1V1OA 4XTCS 1K83B 4K6LA 5ELCA 3E5SA 1U9RA 1OXTA 2L12A 1SXTA 4FP5D 4XYQA 3J80E 4RHRA 4TRDA 4RAUC 1I3QB 1U4LA 3BDCA 2IX1A 1JQYD 1SNPA 1TY0A 4XDXA 3DXJC 1JC7A 1STNA 2E75C 5TSSA 1EFID 4EQPA 2EY2A 1T5XD 2OXPA 2Q8TA 4A3DB 4RCOA 5C5MA 3PUXA 2XRQD 5I4DA 2MJ8A 3S15B 4KKUA 2AUKA 1RKNA 3HKZB 1PYWD 1DXMA 1H9JA 1Y1VB 1YNNC 4RFBA 5CR3A 4HN7A 5AFWA 4WFN3 1S5CD 4L6TB 4IFDJ 4H7BA 1F9PA 2Z8LA 4XIGS 5EBDA 3NTHA 3J81L 1JICA 1Y8NB 3PUWA 4PMWA 1JWSD 1W6KA 3VR2A 3BVGA 3TZUA 4IN3A 5CC4A 3SK4A 1DONA 2X69A 1EU4A 4FXDA 4BBSB 2L5TA 3LX0A 1I4RA 1HXYD 3HG9A 2ICEC 1Q1EA 2M2LA 2XWBB 2RDHA 1KABA 5E4XA 4FXGC 3MFGA 4A93B 4QMGA 2R61A 2A6EC 4RGTA 5JPNC 2NN6H 1Q8IA 3QOJA 3D3RA 3FRPB 1TR5A 3NK9A 3SK6A 1K8MA 3PO3B 1EIHA 4ZYSA 4HAEA 2PZTA 5D14A 3K5MA 3H6MA 2WKDA 1GUGA 2Z4IA 4R9WA 2EYJA 5JOBA 3J81E 1WTPA 5KNDA 2Z1CA 2N88A 3MC0B 4DK1A 1MBYA 2ZT9C 3TN2A 5M3MB 3I73A 1UEAB 4JBWA 3SE0A 5C4ZA 3BS1A 5DAUA 1BUVT 2QF7A 3TSSA 2Q8IB 4KD3A 4NP5A 5KNBA 1LTBD 3S1NB 1O80A 1J9OA 3N52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM L;  5FLX L;  3J80 L;  5A2Q L;  3J7A V;  3J81 L;  5IT9 L;  5LL6 X; 
#chains in the Genus database with same CATH topology
 4BBR G;  3CPW A;  3CXC A;  2CW0 D;  2F4V Q;  4CBV A;  1MI2 A;  4HJ5 A;  3S2H H;  2EXZ A;  1JB7 A;  3CU7 A;  1MJC A;  3OWE B;  3KK7 A;  4LF4 L;  3SDZ A;  2BOS A;  3LNN A;  1TS3 A;  1HQM C;  3RMH A;  1STG A;  1SNC A;  4GKK Q;  2B2U C;  2CW0 C;  3I2Z A;  1UNS A;  1XMO Q;  5JVG 3;  2QKI C;  5KEE A;  1TWF H;  2K32 A;  3NBH B;  2A1A A;  3KLS A;  3R93 A;  2F0M A;  4DR6 L;  1V8Q A;  3IFD A;  2JQO A;  2QEX A;  4KMU C;  5ELF A;  3T1H Q;  1S5D D;  3H3V H;  4C3I G;  1SMY D;  3CAM A;  4A93 H;  2Z9H A;  1SNQ A;  3S1Q H;  3M85 A;  4DR2 L;  1RDP D;  4HJ8 A;  5IP9 G;  1ZYR C;  3R8B A;  1PMR A;  4DNI A;  2G9H D;  3AQQ A;  3I8Z A;  3BYT B;  4A3K G;  1I6V C;  1VCI A;  2PW7 A;  3ERO A;  4LFC L;  5GQO A;  4KI0 A;  1PH1 A;  1PDQ A;  2JA8 H;  4NXM L;  2E2J B;  3HOZ G;  4X65 L;  1SFO H;  2F3V A;  3HRZ C;  3E9H A;  3I7F A;  1Y1W G;  2CKZ B;  2HUG A;  2RBM A;  1A2T A;  4KHP L;  4HMJ A;  1QNK A;  5M3F H;  4A3B H;  2F0O A;  1HA5 A;  1SE2 A;  2YTX A;  3T1H L;  1M1K C;  3GTP H;  5IIF A;  1C8C A;  2Q2T A;  1EIY B;  2YTY A;  1XXG A;  4FYD A;  4Y7N B;  2WAC A;  3LWU A;  2J7Z A;  4AYB B;  1EYA A;  5C3E H;  5C4J B;  1D2B A;  5A35 A;  5J39 A;  4RKB A;  2LSS A;  2HD3 A;  2BA0 A;  2EXD A;  2XTI A;  5FLX L;  1IZ6 A;  3GO5 A;  1HA6 A;  1LTG D;  2VUM H;  2ZXR A;  2UUA Q;  1IBK L;  1NUC A;  4IPG A;  1UAP A;  1E7Z A;  2WAQ E;  4NB3 A;  2XIW A;  1XWE A;  4JI0 Q;  2KCM A;  3GTK B;  1HNX L;  4BS9 A;  2EDG A;  1SN8 A;  2A8V A;  3NE5 B;  3U50 C;  4PG3 A;  3GP7 A;  4G57 A;  4JVZ A;  1L1O B;  3OWF A;  4LMQ D;  2OF1 A;  1B9M A;  3K5O A;  2EIF A;  1STB A;  3FP9 A;  1EZ6 A;  2F0T A;  4PQX A;  3HOU G;  2UXB L;  5CGK A;  1FGU A;  1SMX A;  1H9S B;  2ENB A;  4JCV E;  5EKK A;  3WOE A;  5KYI A;  1GUW A;  1U4P A;  2E76 C;  3E0E A;  4YWL A;  4C3H G;  1PH9 A;  5DNF A;  4DV5 L;  5C0X I;  1KNA A;  4JI2 L;  1ET9 A;  2F0P A;  4QL5 A;  5IP9 H;  3S17 H;  1PFS A;  3H15 A;  1AW7 A;  4CJ0 B;  5E4W C;  4XQJ A;  3HOY H;  1G51 A;  4IUR A;  4KTA A;  3IFT A;  4KJO A;  3NEN A;  1ENC A;  4OWX B;  4XT1 B;  1FVI A;  5IYC G;  1I94 L;  3FMC A;  3LGJ A;  5KIX A;  1LO5 D;  4ULL A;  5C44 G;  1PH3 A;  3NBI A;  1SND A;  5M3M G;  1O7Y A;  4F87 A;  3L7Z C;  2UXC Q;  4A3G B;  1KDA A;  2NVQ B;  3T4A C;  4PZ8 A;  4JBK A;  4JI6 L;  2F0J A;  2XGT A;  2H1E A;  3I56 A;  1HFG A;  4NPS A;  1CKN B;  1KDC A;  4GLX A;  4QIW E;  3ZJY C;  1EEI D;  1F2M A;  1I4Q A;  2OQK A;  4KHZ A;  1EY4 A;  2V1C C;  1VQL A;  5GRO A;  2RSO A;  4Y7N H;  4LNQ A;  2NN6 G;  4R4O A;  4DV3 L;  1ENF A;  3P75 A;  3D4W A;  1YHA A;  2HCC A;  3UDX A;  2F0K A;  1GO3 E;  1CK1 A;  1P16 A;  2EYF A;  2VQE Q;  5T1I A;  2DNE A;  4DR3 L;  4KN4 C;  1TY2 A;  1R4P B;  2M9V A;  5JEA G;  2PZU A;  1E2V A;  3BG3 A;  2GA4 B;  3TME A;  1TQO A;  3AYH B;  3C1E A;  3TBI B;  3MEF A;  4UP7 A;  1YVC A;  1N9W A;  4J1M A;  1FNV A;  2ZM6 Q;  3MHB A;  2ES2 A;  2ICI A;  1V1Q A;  2L55 A;  1EL0 A;  4X62 Q;  1CI3 M;  4TVA B;  5BN5 A;  3JAM i;  1II3 A;  4JBM A;  3WOF A;  3ERQ A;  4HMI A;  4JI5 L;  3GD7 A;  5G3L F;  2UXD L;  4KK7 A;  1SAP A;  4FO2 A;  4BBS G;  2IWH A;  5ELO A;  5IOC A;  1VQA A;  3J80 i;  3KUP A;  1XTD A;  1PLF A;  3PIP A;  2CCZ A;  3BZD B;  2AWO A;  1L1O C;  2EQS A;  4JYA Q;  5CYU A;  3CCM A;  1X3G A;  5BN3 A;  3FPP A;  1P8L A;  1VQD A;  1EQR A;  3VA7 A;  2VQE L;  2E2H B;  4NXN L;  3R2I A;  4JI4 Q;  3MXN A;  2K14 A;  3P20 A;  4RGN A;  1SBB B;  3BZC A;  2AMC B;  4DAY A;  2EY1 A;  4WRD A;  1VQJ A;  1OXX K;  2KVM A;  5C3E G;  5C4J H;  1YNN D;  1HNW Q;  2L9H A;  4C3I H;  2XSC A;  2MPM A;  4DUZ Q;  2DY7 A;  2EJG C;  3SHL A;  4ZK9 B;  1TWC B;  3PO2 B;  4O0A A;  3PIO 3;  1E22 A;  2N55 A;  4MTK A;  5COY A;  5FKA C;  2NTS A;  4HIM A;  3HZX A;  1AFP A;  1CSQ A;  1Z6H A;  1B44 D;  5KGU A;  4OEL B;  3KJO A;  5I2X A;  4TKO B;  1UE6 A;  1SYG A;  1SYF A;  1Q7Y C;  3K8A A;  5M5Y H;  3ICE A;  2E2H H;  2HHH Q;  2MQH A;  2BH2 A;  2EY6 A;  1SJH D;  2D0P A;  3SEB A;  3J7A V;  3S2H B;  4POF A;  3PQI A;  2FJ2 A;  2E2I H;  3GTO H;  5IT9 L;  1YI2 A;  1WTX A;  2Z0S A;  3AMU A;  1X65 A;  1K3B C;  2C9O A;  4OIK A;  5IYD G;  4IPD A;  5EPK A;  5GAD C;  4P71 A;  4ALP A;  4U67 3;  1XMO L;  2B39 A;  2LMC B;  1MJE A;  1HJP A;  3W5O A;  4M1U B;  1OXS C;  4LAA A;  1G91 A;  1BCP B;  2B2T A;  5K5P A;  2V4D A;  2RKS A;  1BCP F;  1GUN A;  1K3R A;  1ZXT A;  3J81 j;  5CV5 A;  3DMU A;  2KBN A;  1XNQ L;  3Q22 A;  4B3R Q;  4ABN A;  3MTS A;  2FMC A;  3HOY B;  3DWQ A;  1D5M C;  4HIK A;  1X54 A;  1CT1 D;  5LL6 S;  4A3F B;  2OEO A;  5C4H A;  4AYB E;  4LF8 L;  2WAQ B;  4GZY C;  1VQM A;  4C3I B;  2IJ0 A;  3RLN A;  2EYO A;  4LF5 Q;  2F0W A;  4POG A;  1FJG Q;  5JJL A;  1CHQ D;  3DUZ A;  1JOK A;  3PV0 A;  3GTO B;  3JAM c;  2IX3 A;  1WTO A;  1YJN A;  4QB4 A;  1HFN A;  4A3G H;  1YNJ D;  3S16 B;  2Q8R E;  2F3I A;  1VQ6 A;  4YWK A;  4NXM Q;  4LF6 Q;  2BE5 D;  2HDM A;  3VYU A;  1A3V A;  1SFO B;  4IFD G;  3H0G B;  4A3M G;  2R92 B;  1IYV A;  1O7L A;  5IGB A;  3M7N A;  1IW7 D;  3DWA A;  3N6R A;  4CHT B;  4DV3 Q;  3S24 A;  1BOS A;  1TVX A;  1PZJ D;  4B3S L;  3T56 B;  2F0F A;  1XPU A;  1NMF A;  2E2I B;  4LF7 L;  4DV0 Q;  2K7V A;  2O5I C;  1O78 A;  1LT3 D;  4DK3 C;  1M90 C;  4DR3 Q;  2OTL A;  1NSN S;  4XQN A;  1FD7 D;  1H9R A;  1SE3 A;  5LL6 X;  2HT1 A;  5K36 H;  3GQB A;  1IBL Q;  1K8O A;  4C3J H;  1PH7 A;  1U4M A;  5E3F A;  2ALY B;  4C2M B;  1VQK A;  5IYB H;  3RN5 A;  2A74 C;  3NPP A;  4IQZ A;  3I72 A;  4X3U A;  2KEC A;  2QIL A;  1QJO A;  1C9O A;  1DOL A;  4HCS A;  2XWJ B;  1EOT A;  1AEX A;  1XMQ L;  1WTW A;  2B2Y A;  1LAC A;  3TRZ A;  3FPU B;  4DFA A;  1BR9 A;  4K8J A;  2J0T D;  4DR1 Q;  2F0E A;  3F2U A;  2VY3 A;  3DLL A;  3IL8 A;  2FFK B;  4OO1 I;  2ZTC A;  2KCT A;  1EY7 A;  2EJM A;  3WDN A;  1CKN A;  2YTV A;  4H0L C;  2E5L Q;  2UUC L;  5T1G A;  1QWY A;  2VB3 X;  2F0I A;  1EWC A;  1HTP A;  3KF6 B;  4C3J B;  2VUM B;  1HZ9 A;  2HQE A;  5J22 A;  5LMN W;  4DR4 L;  2F0G A;  1VQ9 A;  3URY A;  3RUZ A;  4JI3 Q;  5C3X A;  1JB3 A;  1JE5 A;  1EY9 A;  1Q12 A;  5I9O A;  5JPM C;  2NN6 I;  3Q8D A;  4QGU A;  1JOO A;  3M4O H;  4H02 A;  3I91 A;  3M7G A;  1H9M A;  4A3D H;  4IAL A;  1PYB A;  3S1M H;  2VZA A;  2FXQ A;  1JJ2 A;  4LFC Q;  5ELB A;  1JOQ A;  3NQI A;  1L0X B;  3UDF A;  5M3F G;  2NWG A;  3HS0 C;  2NBF A;  3M9B A;  1VDZ A;  2WP8 J;  2E2D C;  3W3A A;  4IZ8 A;  3I55 A;  1CA6 A;  2QEJ C;  3NWS A;  2IY5 B;  1TWA B;  5IGD A;  2CVR A;  1STE A;  3CC4 A;  4Q5V A;  3G48 A;  2I46 A;  1EY6 A;  3HOW H;  1PHJ A;  1WCM B;  2F4I A;  1I94 Q;  2VW9 A;  2P5Z X;  3TS0 A;  1E0B A;  2E74 C;  2UUC Q;  3QJY A;  4QJF A;  1XTC D;  1XNR L;  2BA1 A;  2BDO A;  3BZK A;  3H0G H;  3NSW A;  2R92 H;  4X3S A;  4DNR B;  4IO9 A;  4C1N I;  2BCO A;  1YBY A;  5C0X J;  3EA6 A;  2R7F A;  2E8G A;  4BY1 G;  3A8K E;  1D5Z C;  2NUC A;  4F88 A;  2VL6 A;  2CWP A;  2JSO A;  1RHP A;  5E7N A;  2PCF B;  3R3O A;  2YU9 H;  4RMF A;  1N8R C;  3SK5 A;  2KHS A;  3S1Q B;  2KJX A;  3NWT A;  1TS4 A;  2GVB A;  3BDL A;  5I6Y A;  5EKL A;  3VYS A;  5FO7 B;  4CKC A;  1NR4 A;  3I4M G;  2FIN B;  3EVQ A;  3K57 A;  4V19 0;  4FF2 A;  1SRO A;  2AHO B;  4DAY B;  3QIA A;  4DN4 M;  4B3R L;  1HPC A;  5CMD A;  5EJW A;  3PO2 G;  4OO1 G;  2DJF C;  3D0F A;  4PV1 C;  5AJ3 L;  3KLR A;  2WKC A;  1DCZ A;  5C44 B;  3A56 A;  5K36 G;  5EGT A;  1Q90 A;  4NKL A;  5BN4 A;  3AU7 A;  5KRU A;  2K5W A;  4KKS A;  2KCC A;  5HUR A;  5C3E B;  1RL2 A;  4MN3 A;  3MFY A;  4DUY Q;  1QIL A;  3C1F A;  1CSP A;  4KY7 A;  1FR3 A;  2C5C A;  4R4I A;  1GOZ A;  2K5D A;  1EQV A;  2Z6B A;  1ESF A;  3OSO A;  1NBW A;  1Z7T A;  1F2L A;  3K0Y A;  4GKK L;  1Q82 C;  1TWA H;  1LT6 D;  3OHX C;  3U4V A;  1DYQ A;  1UEB A;  4ZUI A;  1YEZ A;  3K59 A;  1BBU A;  1Y69 U;  3PGZ A;  2F0S A;  4N8F A;  3JAM L;  4GN3 B;  4YY3 L;  4C3H B;  4HR7 B;  3PIO A;  3AFQ A;  1HH2 P;  5J1Z A;  2JJQ A;  4MTN A;  4N9P A;  1JJG A;  1WI5 A;  2RVL A;  1D1I A;  4IPC A;  1SYB A;  1YJW A;  3QG1 A;  2K5Q A;  4K2K A;  1HZA A;  1SR3 A;  2XRS D;  3HKZ E;  1LM0 A;  1PZI D;  5I2Y A;  4AH6 A;  1Q86 C;  3ERS X;  4LF9 Q;  4LFA Q;  2UU9 L;  2PI2 E;  1MGS A;  4ZAI A;  2EPB A;  1TKW B;  1TWF B;  1B7Y B;  1OO9 B;  3TP8 A;  1EQQ A;  3GTK H;  1NR2 A;  1PRT B;  3KF8 B;  1KXL A;  4JI2 Q;  4CDC C;  2AQ2 B;  1AN8 A;  2B2U A;  1K8G A;  1Q3L A;  2A68 C;  2L1B A;  3HOV H;  1XMQ Q;  3HOW B;  5FJ8 G;  2IT1 A;  3NXW A;  3TZD A;  3KDF B;  2XNA C;  1PRT D;  5NUC A;  2VS1 A;  3VR3 A;  4MNO A;  5IE8 A;  3BVM A;  1BNZ A;  2QCP X;  1RIP A;  3AFP A;  2OWO A;  3X3M A;  2B63 G;  3CCJ A;  4LK1 C;  3VR6 A;  1HZB A;  4JW0 A;  5IGG A;  1LTT D;  4MZ9 A;  2QGQ A;  2F0Q A;  3SGI A;  4KY6 A;  5C3W A;  4IFD H;  3I4M B;  3J7Y W;  3U58 A;  2PQA B;  2RDG A;  1UE7 A;  1EIF A;  4DR4 Q;  3S17 B;  4ID6 A;  3S2D B;  3RZD H;  4G7Z C;  1AP0 A;  1E1T A;  1N36 L;  4JI6 Q;  1LTA D;  3EN2 A;  4H44 C;  3SXH A;  5CBE E;  1MHW C;  2CWA A;  5C6A A;  4GN4 B;  4JC0 A;  2UU9 Q;  3GV6 A;  4LFA L;  1AH9 A;  1QZH A;  1N34 L;  1Y14 B;  4RKL A;  2IW3 A;  4C1N K;  3A54 A;  5DM6 3;  1L2F A;  1K73 C;  1RCV D;  2ZJP A;  1CUK A;  1A15 A;  3HOZ B;  2D62 A;  4X6A H;  1WCM G;  3QOL A;  2ZXP A;  5JEA J;  1KQS A;  1U0L A;  3ND9 A;  2VQF Q;  3GTQ H;  3G71 A;  2NVQ H;  1QUQ B;  4A3K B;  1HR0 W;  3QO2 A;  1A3U A;  3L3O C;  2WB1 E;  1KC8 C;  4C3J G;  2HCI A;  3STB D;  3MXN B;  4GOP B;  4G7H C;  4OEM B;  1JT8 A;  1D6E C;  2B29 A;  4JI8 Q;  3HOU B;  5BR8 L;  2R6G A;  2D0O A;  2UXB Q;  1K83 H;  1STA A;  1EYG A;  4RH6 A;  1TU2 B;  3I4N H;  2G5D A;  2UXD Q;  1IL2 A;  3NHH A;  5ISR A;  4IUN A;  2VUM G;  3KF6 A;  1A3T A;  1NY4 A;  2MFI A;  2K05 A;  5KNC A;  5LMU Q;  2L0C A;  1O7Z A;  4JYA L;  3F2D A;  1QVF A;  4LF7 Q;  1PFB A;  2A19 A;  4FDB A;  1NCV A;  1PTO H;  3A7A B;  3S1R B;  3Q0A A;  4LFB Q;  4P2C B;  2IL8 A;  3F8T A;  4R4Q A;  4ZUJ A;  2VNU D;  1IBL L;  4DR2 Q;  5DEH A;  3VR4 A;  5L37 A;  4BBR B;  2A69 C;  4JI1 Q;  1BF4 A;  2WIN B;  2N3S A;  1G6Z A;  1LT4 D;  4KLK A;  3S1R H;  4AYB G;  4J8Q A;  4A75 A;  1VMC A;  2X6L A;  3BU2 A;  4K5W A;  3NP8 A;  2A69 D;  4PNY A;  1Z9F A;  1PTO F;  1MD2 D;  3CQZ B;  1QB5 D;  1PFM A;  2KEE A;  1ML0 D;  1STH A;  1KL9 A;  2SEB D;  4XXE A;  3PUY A;  3CCU A;  4LJZ C;  3EFX D;  2OQ0 A;  2R7D A;  1PXU A;  4B9X A;  2B63 H;  1GKH A;  3E0J A;  1LAB A;  1IXR A;  3P7J A;  4X64 L;  1HR0 L;  3AEV A;  4TQU S;  4A3L H;  3PCO B;  5CV6 A;  1IHZ A;  4A3J H;  3OOC A;  1Y8O B;  4MHE A;  3ZYY X;  1STY A;  3OIQ A;  4BY7 H;  4EVO A;  4LF8 Q;  4K5X A;  3PO3 G;  4JI7 Q;  2WAQ G;  4YIJ A;  1ROD A;  4ODG A;  5ELD A;  1SSO A;  1YNX A;  3K5N A;  3JAM E;  3I4L A;  4QY7 A;  3HOY G;  1HNZ Q;  5M5W H;  2PO4 A;  5JVH 3;  4OX9 L;  4K5V A;  1B1Z A;  2Y0S E;  5JEA H;  1H9S A;  1LV9 A;  3NBH A;  4UPA A;  2PMZ E;  1BBX C;  3GV3 A;  4A93 G;  4A3I H;  1PVO A;  1E1O A;  1GUS A;  1VQE A;  2B2Y C;  1QE6 A;  3A7L A;  1EY5 A;  2F52 A;  2PNH A;  3KLS X;  3QWN A;  2K28 A;  3G7L A;  4B3S Q;  1QUQ A;  3K6O A;  4QUC A;  4X64 Q;  1HR0 Q;  4EGV A;  3H3V I;  1SNM A;  4E6I A;  1C4Q A;  5EAY A;  1PH8 A;  2JA8 G;  2K33 A;  4ME3 A;  4FF3 A;  1GUO A;  1R9T H;  4IUU A;  1X32 A;  2LY7 A;  2RCN A;  4GOP A;  3U4Z A;  4LF4 Q;  3RZD B;  1YNJ C;  2K75 A;  1SLJ A;  2PI2 A;  4RGM A;  1X3E A;  4IOC A;  1BXT A;  3CW2 C;  1SE4 A;  4HSP A;  3ULJ A;  5GAG C;  2TMP A;  5D3I B;  3MEH A;  4JOI C;  4RWS C;  2B63 B;  1X3Q A;  2O2L D;  2DN8 A;  1E2Z A;  2I5L X;  3IAY A;  4UP9 A;  3U9S A;  4DV7 Q;  2F03 A;  4IJL A;  1B3Q A;  1Q8K A;  2K52 A;  3T1Y Q;  3K58 A;  1IW7 C;  2PNR C;  4B08 A;  3RD4 A;  2B2V C;  1VQF A;  3EJI A;  1L0Y B;  2EYL A;  4BY7 B;  3K80 C;  4JV5 L;  1M8A A;  1VF7 A;  4IUQ A;  1SEB D;  2RA4 A;  4QUF A;  2EOT A;  3UI2 A;  1ILP A;  5EQ0 A;  5M5W B;  2XVS A;  1AZP A;  3A8J E;  2YU9 B;  2HHH L;  1U5K A;  2UUB L;  3T53 B;  3HFZ B;  3KF8 A;  2SOB A;  1CQF A;  2NTT A;  4K0K Q;  2I5M X;  3NEL A;  3DHQ A;  4J6H A;  1KD1 C;  3OW7 A;  2NZO A;  1QOH A;  2ATW A;  1S5E D;  4DK6 C;  3CC2 A;  1LTL A;  2AKW B;  2KOL A;  3KDF A;  2JYO A;  1MSH A;  1AE3 A;  1YZ6 A;  4H13 C;  1HCZ A;  4GNX C;  1F2Y A;  3F2B A;  2PQA A;  5C44 H;  1IL8 A;  4DV6 L;  3HP3 A;  1LTS D;  3OPO A;  4R8I A;  3AB9 A;  3BJU A;  1SYE A;  4DV1 L;  4TSS A;  5HGT A;  1WD1 A;  3RZO H;  5JJI A;  2DUD A;  3KFU A;  4JV5 Q;  2SNM A;  1A8V A;  3VYR A;  2I0Q A;  3CF5 A;  3IRB A;  1G2S A;  5CV9 A;  4HCE A;  2E2J H;  1B9N A;  5IOD A;  1CTM A;  1A62 A;  1V1P A;  2AQ3 B;  2UUB Q;  3SK8 A;  4HIO A;  1WTQ A;  1B70 B;  1IYJ B;  1SMY C;  1N32 L;  2K50 A;  3RLF A;  1I6H B;  1WVL A;  4I7Z C;  4A4I A;  2ID0 A;  3HEJ A;  4WJW A;  3S1M B;  1OXU A;  1D7Q A;  4JI5 Q;  4HJA A;  3CD6 A;  5M9O A;  2CQA A;  3GTJ B;  3K81 C;  1IKL A;  1R9T B;  4B3M L;  2LXJ A;  3TDQ A;  3EQL C;  1T5E A;  4L5R C;  3H09 A;  4K14 A;  4ZQ3 A;  5FJ8 H;  2PQE A;  4BWG B;  5KYL A;  4JG2 A;  4RHS A;  4DR5 Q;  3UDI A;  3KBG A;  5C0X H;  2CHB D;  4DAV A;  5EPJ A;  1LTI D;  1LTR D;  2RSN A;  1OTC A;  5CBA E;  5FOB B;  3FKI H;  4HJ7 A;  1B2T A;  1GJX A;  3HOV G;  1J5E L;  3K7U C;  4A3B B;  1PFN A;  2HQL A;  3HOX B;  1I4X A;  2CH4 W;  4A3G G;  3S14 B;  4FNF A;  2NZ1 D;  5A2Q E;  1RTO A;  1K28 A;  2B2W A;  4G4K A;  4PMB A;  1Q81 C;  4GNX A;  2D2C C;  1CKM A;  4BA1 I;  3I4O A;  2R93 G;  4KKT A;  1KTK A;  4L5S A;  3D6C A;  2NVT B;  3S9W A;  2VB2 X;  1NAP A;  4Z9C B;  4IFD I;  1O7I A;  5D65 A;  1PTO C;  3FDT A;  3DEO A;  1I6H H;  4KN7 C;  4DK0 A;  4PMC A;  4DV4 Q;  3TP5 A;  4CJ1 B;  2R7Z G;  4G7O C;  1DZ1 A;  2F0U A;  2DNC A;  1BO0 A;  2MO0 A;  5IGF A;  1F2Z A;  2KED A;  1BBW A;  4XT3 B;  1SNO A;  4LF9 L;  1PV4 A;  3D8G A;  4DR7 L;  3RZO B;  2K03 A;  1KAW A;  1C0A A;  1WOC A;  3G6E A;  3ULL A;  4L8J A;  1TWC H;  4YY3 Q;  1WTH A;  3PO2 H;  4UDU C;  2LXK A;  2Q2U A;  3GDE A;  3LWE A;  5HY6 A;  4AIM A;  5IGE A;  4M8A A;  5IT9 E;  4Q0F A;  1UE5 A;  1S5B D;  5C0X G;  1HZC A;  1TWG H;  2JA6 H;  1KNE A;  4V0B A;  3T13 A;  4LW1 A;  1J6Q A;  1TS5 A;  3FEW X;  4UP8 A;  2ZJQ A;  1KRS A;  3J7A 5;  3MZ5 A;  1CZG A;  2LFN A;  4BBR H;  5G3L D;  3CKI B;  3A5Z B;  4I65 A;  5GAE C;  4OIJ A;  1YHQ A;  1PA6 A;  3MWY W;  4R8N A;  3D31 A;  2IX0 A;  4C3H H;  3J81 c;  3SVM A;  3CCV A;  4DV4 L;  1HUM A;  1L1O A;  1AZQ A;  1IBM L;  5JJK A;  1U4R A;  1SE8 A;  4R4C A;  5IGC A;  1RJT A;  1DJR D;  3I3C A;  4ZKB B;  1Y1W B;  1B3A A;  1JMC A;  1BVS A;  3J81 i;  3J7A F;  4L63 B;  1VQO A;  4OWW B;  5LMN L;  4OON A;  3NTI A;  1XJV A;  3EIV A;  4FF1 A;  3L0O A;  1VQG A;  3MA2 B;  2PZW A;  3H0G G;  4A3M B;  2R92 G;  1ENA A;  1GXD C;  2MUY A;  3QR8 A;  4YCV A;  4PZ7 A;  2B2W C;  5I9P A;  2N8N A;  2ZTD A;  4DR6 Q;  2EJF C;  5IYD H;  1I3Q H;  1SYD A;  1WTV A;  5IWA Q;  3T51 B;  1EIG A;  2KUM A;  2KCN A;  4DKA C;  2EZV A;  1C48 A;  5M3F B;  4YWM A;  4CDF C;  4F7X A;  4QF4 A;  1ZEQ X;  5COR A;  1HUN A;  4X66 Q;  4IUV A;  3J7Z C;  2CFM A;  1S5F D;  2MHV A;  2F0L A;  3CMA A;  4OX9 Q;  4KD4 A;  3PO3 H;  2R7Z H;  4A3F G;  4CKB A;  3K5L A;  2JE6 I;  3D6W A;  1FGB D;  4BXX G;  4DNT B;  1PRT F;  5FK9 C;  3HOZ H;  4WJ3 M;  2X6G A;  4KHV A;  1EEF D;  4EQO A;  4X65 Q;  2JA7 B;  1M4V A;  2GVA A;  2A6E D;  1YIT A;  3GTJ H;  4B3M Q;  4UY8 C;  1JR0 D;  4N8X 1;  4NW2 A;  4YCW A;  4EQN A;  2OCE A;  3V05 A;  1VQ4 A;  1G6P A;  4BA2 I;  1D5X C;  4QCL A;  4ZCK A;  2R7Z B;  1N33 Q;  4DR5 L;  3CRL C;  1RF2 D;  2Z6K C;  2JXM B;  2JN4 A;  1D8L A;  3PF4 A;  1EUJ A;  2EVB A;  2I07 B;  5BR8 Q;  4DF7 A;  1QG7 A;  3CME A;  3FKI B;  2ZJR A;  1HTL D;  3KBX A;  4A3C G;  1B4O A;  3K7A H;  2JA5 G;  1YIJ A;  1IKM A;  1TXY A;  3M3Y H;  4IUP A;  5C4X G;  1I50 B;  3EBE A;  3MXP A;  1BQQ T;  2ZM6 L;  2AUJ D;  2N78 A;  3R2T A;  4DV7 L;  3ND8 A;  2A68 D;  1W2B A;  5LMU L;  3QB3 A;  2UUA L;  1S72 A;  1KHI A;  1TT2 A;  5LHY 1;  1IBK Q;  1XNQ Q;  1BDO A;  1UUP A;  2WV6 D;  1PRT C;  1GHJ A;  1H9K A;  3M4Y A;  4DXG A;  2K1B A;  1VQ5 A;  1CQV A;  2MP1 A;  1YHB A;  4P74 A;  1JE4 A;  4HED A;  1HNX Q;  2NVT H;  4DAM A;  4OXP A;  1QVC A;  4ILW A;  4LWC A;  4XQQ A;  3VA5 A;  3GTL H;  3I90 A;  1DOK A;  5FO8 B;  1KIX A;  1N33 L;  3I4N G;  1XNR Q;  1MIU A;  1EYD A;  2EYP A;  3KOJ A;  2AQ1 B;  1SDF A;  3GTG H;  3ITP A;  1VQI A;  3MXG A;  1VQH A;  4YHH Q;  3PMF A;  1JWM D;  5EKI A;  4K6D A;  4APV A;  1SJE D;  4JI7 L;  5JAV A;  5I6W A;  1PTO B;  1NTG A;  4LF6 L;  1E2W A;  1VS0 A;  2EYM A;  3V96 A;  4LUZ A;  2RQX A;  1CFM A;  5M5Y B;  4RGO S;  1HNW L;  1XX8 A;  3JC6 6;  1Y8P B;  5ELE A;  1RTN A;  1PZK D;  2RF4 A;  5HGQ A;  1Z47 A;  1ESR A;  1JOR A;  2J4X A;  1NNX A;  3NEM A;  2F0V A;  2RDF A;  3D4D A;  4DV0 L;  1X55 A;  2LKV A;  2JA6 B;  1X3P A;  2NB0 A;  1BKB A;  1HRJ A;  4ZLT F;  5AJ3 Q;  4EX5 A;  4A3J B;  3L9A X;  4RG1 A;  3TP6 A;  1I50 H;  2O4X A;  4MIU A;  5IYB G;  2PYK A;  5FO9 B;  1ZYR D;  3V2T A;  1PH6 A;  2BE5 C;  3K7A B;  3D4R A;  1CHP D;  4OGQ C;  1A63 A;  1VF5 C;  2QDL A;  5C5L A;  1HNZ L;  1WJJ A;  2CQO A;  4GS3 A;  4C56 C;  3T16 A;  4OO1 H;  1FYC A;  4KV6 A;  3GTQ B;  4DPG A;  2M00 A;  3S15 H;  4KJN A;  5CV8 A;  3U9O A;  2MNA A;  4P75 A;  1GD7 A;  2L4N A;  1QCB D;  3NQT A;  2NVX H;  1CA5 A;  3P1H A;  1NJI C;  2QDB A;  4KHP Q;  1F9S A;  5C4X H;  2E5L L;  4HTH A;  4WOR A;  3A0J A;  1UE1 A;  1TII D;  2A73 B;  5JJZ A;  3O13 A;  1W6J A;  2G9D A;  2FMM A;  3ULP A;  3I4N B;  1E3P A;  4FVM A;  2LS0 1;  1LYL A;  1T9H A;  3VR5 A;  3CP0 A;  3HOW G;  1VQC A;  4JI1 L;  3C3L A;  4KY5 A;  2OT2 A;  2B2T C;  2NVY H;  1SRU A;  1I4G A;  1A0I A;  1TS2 A;  3OMG A;  3C2P A;  4LUO A;  2R93 H;  1S40 A;  1ICW A;  1A6X A;  2B8G A;  3T1Y L;  3CCR A;  2K6A A;  1EY0 A;  2HDL A;  3HKZ G;  5CV7 A;  4ZKC B;  4AQY Q;  4B9W A;  2MGS A;  1VQB A;  1EFW A;  4OHJ A;  5EBC A;  3OW2 A;  1FNU A;  2R3Z A;  2Z6K A;  3CHB D;  2HIV A;  1VQP A;  1ET6 A;  1DD2 A;  2DY8 A;  1NMG A;  2BDN A;  5C4X B;  1ASZ A;  3M4Q A;  3M4O B;  1KDB A;  3CRK C;  2H5X A;  2F4V L;  2K5N A;  1D1K A;  1I4P A;  3F2C A;  3PIP 3;  2JA8 B;  1G29 1;  3OTO Q;  4UAI A;  2RHS B;  3OMC A;  3BDO A;  2DGY A;  1MSG A;  1X3F A;  4S3S A;  5ELN A;  3CCS A;  2EY5 A;  1QVG A;  1N36 Q;  3H91 A;  5M5X H;  1WYD A;  3Q6S A;  1E24 A;  2RCF A;  4GKJ L;  1V43 A;  3C46 A;  3J80 c;  4IJH A;  4F8M A;  4FF4 A;  1B53 A;  2ZXO A;  1S4Z A;  2N49 A;  1N32 Q;  1QNU A;  2D9U A;  2NVX B;  1LLR D;  1WTR A;  1SYC A;  4N9T A;  2WII B;  1EU3 A;  4NMZ A;  2PPB C;  1F77 A;  3PUV A;  1TWG B;  4ME5 A;  2B3G A;  3MVV A;  5CV4 A;  4DV2 L;  2JP1 A;  4RA8 A;  2F1M A;  3NTK A;  2WFW A;  4DGZ A;  3H94 A;  3I4M H;  2F3W A;  4EQ5 A;  2NVY B;  1KAA A;  2PW5 A;  1I4H A;  2ASB A;  1EOV A;  3DEP A;  4CJ2 C;  3GTP B;  4R4T A;  3DWP A;  2IPK D;  2SNS A;  4X3K A;  3I70 A;  3UE1 A;  1EY8 A;  3OTO L;  4DUY L;  5EPL A;  1IBM Q;  3GTG B;  4JI8 L;  1KLU D;  1F9R A;  2BH8 A;  4IPH A;  4CKE A;  4YHH L;  3BYY B;  1EYC A;  2EE1 A;  3FVQ A;  5FLX c;  4A3I B;  3A8I E;  5LMN Q;  3KLW A;  4BY1 B;  2F0H A;  2WB1 G;  2KHJ A;  4A3E G;  4DU9 A;  1BCP D;  3RN2 A;  4A3M H;  2JA9 A;  3ONA B;  4DA2 A;  3BVZ A;  3L2P A;  1EZ8 A;  3RR5 A;  2B2V A;  2XN9 C;  2NYZ D;  3OYY A;  5IYC H;  1CM9 A;  3GTM B;  1F9Q A;  2K04 A;  1TWH H;  1VQ7 A;  4U68 A;  1BCP C;  1ZKO A;  3NUC A;  1PH5 A;  2TSS A;  2KQ3 A;  2A6H D;  2RHQ B;  1ILQ A;  1QZG A;  3W2D A;  1PTO D;  1JCK B;  4LF5 L;  1V9P A;  4X66 L;  3MXU A;  2F0D A;  4GOP C;  4DAP A;  2Y0S B;  2O5J C;  2H4O A;  1PH2 A;  3OIP A;  2JA5 B;  4X3T A;  1HQR D;  4K0K L;  3HKS A;  4C2M H;  5DLQ E;  1EQT A;  4HID A;  1Q1B A;  3G6J B;  3M4P A;  5E1F A;  2CH4 A;  1DOM A;  4R1J A;  3VYT A;  5GAH C;  1R4Q B;  4DR7 Q;  1EWH A;  1B50 A;  4DV5 Q;  4K8I A;  4GLA C;  1FNW A;  3PUZ A;  4DV6 Q;  4A3C H;  2EYH A;  4O42 A;  3Q24 A;  1V1P B;  1GHK A;  1J8I A;  5FLM G;  4K2L A;  3CCQ A;  2JA7 G;  2OTJ A;  1HHV A;  2AWN A;  2KHI A;  4CGY B;  4JK1 C;  3KJP A;  4BY1 H;  2K4K A;  3SR1 A;  4HSV A;  5F2D A;  5A2Q L;  1DGS A;  3HGB A;  4BXX H;  1PYS B;  3E3X A;  1N34 Q;  1CZW A;  2R93 B;  2Z4H A;  5D3D A;  2Y0S G;  3TP7 A;  3CCL A;  2F0N A;  2L11 A;  3E9I A;  4QIW B;  3A55 A;  4DXF A;  1OXV A;  2K01 A;  1KLG D;  4O1N A;  4NDX A;  2VQF L;  4A3E B;  5FLX E;  4RCN A;  2A5H A;  1XYI A;  1CKO A;  2PMZ B;  1VMP A;  4DR1 L;  4A3I G;  3DM1 A;  2FHT A;  1ASY A;  1K0R A;  3E6Z X;  1K0S A;  4XYO A;  4A3B G;  5IP7 G;  1JWU D;  2B8F A;  4A76 A;  3M3Y B;  4PZ6 A;  3HOV B;  3H3V C;  2JA5 H;  2KA7 A;  4WJ4 A;  1DM0 B;  1G8Z D;  5IWA L;  3TQY A;  4OL7 A;  4IUT A;  3Q23 A;  1G2T A;  2UXC L;  1RD9 D;  1GUT A;  1S3O A;  4ZRZ A;  1K8A C;  2YYZ A;  5DM7 3;  2WB1 B;  4A3F H;  2JEB I;  4JI3 L;  5H1S E;  2SDF A;  1XPR A;  5M5X B;  1A2U A;  1J5E Q;  3W1B A;  4GNX B;  2D5D A;  1Y1V H;  4GKJ Q;  3MAQ A;  3TRE A;  4A3K H;  1ONL A;  3X3N A;  1TWH B;  1IYU A;  4JBJ A;  4X62 L;  1WD0 A;  2JEA I;  3GTL B;  3S2D H;  3IKJ A;  2A6H C;  1LT5 D;  1KRT A;  2JA7 H;  4FXK C;  2VXW A;  3J80 L;  4CDD C;  4DV2 Q;  2K5V A;  3TEH B;  1Y1W H;  1V1O A;  1LUZ A;  4XTC S;  4JI0 L;  3UDG A;  1K83 B;  4K6L A;  3HOX H;  5ELC A;  3S14 H;  3E5S A;  1U9R A;  4L5T A;  1FJG L;  1OXT A;  2L12 A;  1SXT A;  4FP5 D;  3FHW A;  1GVP A;  4XYQ A;  4J15 A;  3J80 E;  3TS2 A;  3RNU A;  4RHR A;  4TRD A;  4JI4 L;  1NE3 A;  4NXN Q;  4RAU C;  2HIX A;  2L15 A;  1I3Q B;  1U4L A;  3BDC A;  2IX1 A;  1JQY D;  3STB C;  1SNP A;  1TY0 A;  2C35 B;  4JOI A;  2ZTE A;  4A3E H;  1W3S A;  4XDX A;  3DXJ C;  1JC7 A;  1STN A;  2E75 C;  5TSS A;  3CCE A;  1EFI D;  3HOU H;  4EQP A;  3CPF A;  3VDY A;  2EY2 A;  3GTM H;  1T5X D;  2OXP A;  2Q8T A;  3K0X A;  4A3D B;  1VQ8 A;  4RCO A;  4HJ9 A;  4I7A A;  2QW7 A;  5C5M A;  3PUX A;  5IT9 c;  2XRQ D;  5I4D A;  2MJ8 A;  1FL0 A;  1PH4 A;  2IHE A;  4KKU A;  2JK8 A;  4CDE C;  2AUK A;  3S15 B;  1RKN A;  3HOX G;  3S16 H;  3HKZ B;  1PYW D;  1DXM A;  2QA4 A;  1H9J A;  1Y1V B;  1YNN C;  4RFB A;  1AE2 A;  4B3T L;  5CR3 A;  4HN7 A;  5AFW A;  4WFN 3;  4A3D G;  4BY7 G;  1S5C D;  1ICF B;  4L6T B;  4DUZ L;  4IFD J;  4QQB X;  4H7B A;  1F9P A;  1WCM H;  2Z8L A;  4UHV A;  2K5H A;  4XIG S;  1L0W A;  5EBD A;  3NTH A;  5M3M H;  1X6O A;  1XPO A;  3J81 L;  1JIC A;  1Y8N B;  2YV5 A;  3PUW A;  4PMW A;  1JWS D;  2GN5 A;  1W6K A;  3VR2 A;  1I5F A;  3BVG A;  3TZU A;  4IN3 A;  5CC4 A;  3SK4 A;  1DON A;  3CQZ H;  2X69 A;  1EU4 A;  4FXD A;  4BBS B;  4LFB L;  2L5T A;  3LX0 A;  3A5U A;  1I4R A;  1HXY D;  3HG9 A;  4P72 A;  1EWI A;  3UE0 A;  3RLO A;  2ICE C;  3WWV A;  3CC7 A;  1Q1E A;  1K9M C;  2M2L A;  3F1Z A;  2XWB B;  4OWT B;  1C7Y A;  2JA6 G;  1JJC B;  2RDH A;  1KAB A;  2MO1 A;  5E4X A;  4B3T Q;  4FXG C;  3MFG A;  4A93 B;  4QMG A;  4IOA A;  1VQN A;  4BBS H;  2R61 A;  1Q46 A;  5IY0 A;  2NZH A;  2A6E C;  4A3J G;  4RGT A;  5JPN C;  3KYH C;  2NN6 H;  2IHF A;  4P73 A;  3ER0 A;  1Q8I A;  5IP7 H;  3QOJ A;  3S1N H;  3D3R A;  4GLV B;  3FRP B;  1TR5 A;  3NK9 A;  3SK6 A;  1K8M A;  3PO3 B;  1EIH A;  4A3L G;  4L5Q A;  4ZYS A;  4JPB W;  4HAE A;  2PZT A;  5D14 A;  2KEN A;  5J3B A;  3K5M A;  3H6M A;  3B6Y A;  3PF5 A;  2WKD A;  3DM3 A;  1GUG A;  2Z4I A;  4GN5 A;  2DJG C;  4R9W A;  2EYJ A;  5JOB A;  5FLM H;  3J81 E;  1WTP A;  4Y52 H;  1B8A A;  2Q2I A;  5KND A;  1X56 A;  1Y1V G;  2Z1C A;  4LUV A;  2N88 A;  3MC0 B;  4DK1 A;  1H95 A;  1MBY A;  1WFQ A;  2ZT9 C;  3G4S A;  3TN2 A;  4O2D A;  1MKH A;  5M3M B;  3I73 A;  1X9N A;  1UEA B;  4JBW A;  3SE0 A;  5C4Z A;  3BS1 A;  5DAU A;  1BUV T;  2I5H A;  4AQY L;  2QF7 A;  4YCU A;  3TSS A;  4DV1 Q;  1UWV A;  3W1G A;  2Q8I B;  1GM5 A;  4NP5 A;  4KD3 A;  3PSI A;  5KNB A;  3A74 A;  1LTB D;  1YJ9 A;  3S1N B;  3FKI G;  1O80 A;  1J9O A;  2Q2H A;  3N52 A; 
#chains in the Genus database with same CATH homology
 2CW0 D;  4CBV A;  1MI2 A;  2EXZ A;  3CU7 A;  3OWE B;  3KK7 A;  3SDZ A;  2BOS A;  3LNN A;  1TS3 A;  1HQM C;  3RMH A;  1STG A;  1SNC A;  2B2U C;  2CW0 C;  1UNS A;  5JVG 3;  2QKI C;  5KEE A;  2K32 A;  3KLS A;  3R93 A;  2F0M A;  1V8Q A;  3IFD A;  4KMU C;  5ELF A;  1S5D D;  4C3I G;  1SMY D;  1SNQ A;  3M85 A;  1RDP D;  1ZYR C;  3R8B A;  1PMR A;  2G9H D;  3I8Z A;  3BYT B;  1I6V C;  1VCI A;  2PW7 A;  3ERO A;  4KI0 A;  1PDQ A;  2E2J B;  2F3V A;  3HRZ C;  2HUG A;  2RBM A;  1A2T A;  4HMJ A;  1QNK A;  2F0O A;  1HA5 A;  1SE2 A;  5IIF A;  1C8C A;  1XXG A;  4FYD A;  4Y7N B;  2WAC A;  3LWU A;  2J7Z A;  4AYB B;  1EYA A;  5C4J B;  1D2B A;  5A35 A;  5J39 A;  4RKB A;  2BA0 A;  5FLX L;  3GO5 A;  1HA6 A;  1LTG D;  2ZXR A;  1NUC A;  1UAP A;  2XIW A;  1XWE A;  3GTK B;  4BS9 A;  2EDG A;  3NE5 B;  3GP7 A;  4G57 A;  3OWF A;  4LMQ D;  2OF1 A;  1B9M A;  3K5O A;  1STB A;  1EZ6 A;  2F0T A;  4PQX A;  5CGK A;  1H9S B;  2ENB A;  5EKK A;  3WOE A;  5KYI A;  1GUW A;  1U4P A;  2E76 C;  4C3H G;  5DNF A;  5C0X I;  1KNA A;  1ET9 A;  2F0P A;  1AW7 A;  4CJ0 B;  5E4W C;  4XQJ A;  4IUR A;  4KTA A;  3IFT A;  4KJO A;  1ENC A;  4XT1 B;  3FMC A;  5KIX A;  1LO5 D;  4ULL A;  3NBI A;  1SND A;  1O7Y A;  4F87 A;  3L7Z C;  4A3G B;  1KDA A;  2NVQ B;  3T4A C;  2F0J A;  2H1E A;  1HFG A;  1KDC A;  1EEI D;  1F2M A;  1I4Q A;  4KHZ A;  1EY4 A;  2RSO A;  2NN6 G;  1ENF A;  3P75 A;  3D4W A;  2HCC A;  2F0K A;  1CK1 A;  2EYF A;  5T1I A;  2DNE A;  4KN4 C;  1TY2 A;  1R4P B;  2M9V A;  5JEA G;  2PZU A;  1E2V A;  3BG3 A;  2GA4 B;  3TME A;  1TQO A;  3C1E A;  3TBI B;  4J1M A;  1FNV A;  3MHB A;  2ICI A;  2L55 A;  1EL0 A;  1CI3 M;  5BN5 A;  1II3 A;  3WOF A;  3ERQ A;  4HMI A;  3GD7 A;  5G3L F;  4KK7 A;  1SAP A;  4FO2 A;  2IWH A;  5IOC A;  3KUP A;  1PLF A;  3BZD B;  2AWO A;  5CYU A;  5BN3 A;  3FPP A;  3VA7 A;  2E2H B;  3R2I A;  3MXN A;  3P20 A;  4RGN A;  1SBB B;  4DAY A;  2EY1 A;  4WRD A;  1OXX K;  2KVM A;  1YNN D;  2L9H A;  2XSC A;  2MPM A;  2DY7 A;  2EJG C;  3SHL A;  4ZK9 B;  1TWC B;  3PO2 B;  3PIO 3;  2N55 A;  5COY A;  5FKA C;  2NTS A;  3HZX A;  1AFP A;  1Z6H A;  1B44 D;  5KGU A;  5I2X A;  4TKO B;  1SYG A;  1SYF A;  2EY6 A;  1SJH D;  3SEB A;  3J7A V;  3S2H B;  2FJ2 A;  5IT9 L;  1WTX A;  3AMU A;  2C9O A;  4OIK A;  5EPK A;  4U67 3;  2B39 A;  2LMC B;  4M1U B;  1OXS C;  4LAA A;  1G91 A;  1BCP B;  2B2T A;  5K5P A;  2V4D A;  2RKS A;  1BCP F;  1GUN A;  1ZXT A;  5CV5 A;  3DMU A;  3Q22 A;  3HOY B;  4ABN A;  3MTS A;  2FMC A;  1D5M C;  3DWQ A;  4A3F B;  5LL6 S;  1CT1 D;  2OEO A;  5C4H A;  2WAQ B;  4GZY C;  4C3I B;  2IJ0 A;  2EYO A;  2F0W A;  1CHQ D;  3DUZ A;  1JOK A;  3PV0 A;  3GTO B;  2IX3 A;  1WTO A;  1HFN A;  4QB4 A;  1YNJ D;  3S16 B;  2Q8R E;  2BE5 D;  2HDM A;  3VYU A;  1A3V A;  1SFO B;  4IFD G;  3H0G B;  2R92 B;  1IYV A;  1O7L A;  5IGB A;  3M7N A;  1IW7 D;  3DWA A;  3N6R A;  4CHT B;  1TVX A;  1BOS A;  1PZJ D;  3T56 B;  2F0F A;  2E2I B;  2K7V A;  2O5I C;  1O78 A;  1LT3 D;  1NSN S;  4XQN A;  1FD7 D;  1H9R A;  1SE3 A;  5LL6 X;  5K36 H;  3GQB A;  1K8O A;  1U4M A;  5E3F A;  4C2M B;  2A74 C;  3NPP A;  4IQZ A;  3I72 A;  4X3U A;  2KEC A;  2QIL A;  1QJO A;  1DOL A;  4HCS A;  2XWJ B;  1EOT A;  1AEX A;  1WTW A;  2B2Y A;  1LAC A;  3FPU B;  4DFA A;  1BR9 A;  4K8J A;  2J0T D;  2F0E A;  3F2U A;  3IL8 A;  2FFK B;  4OO1 I;  1EY7 A;  2EJM A;  3WDN A;  4H0L C;  5T1G A;  1QWY A;  2VB3 X;  2F0I A;  1EWC A;  1HTP A;  4C3J B;  2VUM B;  2HQE A;  5J22 A;  2F0G A;  3URY A;  3RUZ A;  5C3X A;  1JB3 A;  1EY9 A;  1Q12 A;  5I9O A;  5JPM C;  2NN6 I;  1JOO A;  3I91 A;  3M7G A;  1H9M A;  4IAL A;  5ELB A;  1JOQ A;  3NQI A;  1L0X B;  2NWG A;  3HS0 C;  2NBF A;  1VDZ A;  2WP8 J;  2E2D C;  3W3A A;  4IZ8 A;  1CA6 A;  2QEJ C;  3NWS A;  1TWA B;  5IGD A;  2CVR A;  1STE A;  4Q5V A;  2I46 A;  1EY6 A;  1WCM B;  2F4I A;  1E0B A;  2E74 C;  3QJY A;  1XTC D;  2BA1 A;  2BDO A;  3NSW A;  4X3S A;  4DNR B;  4C1N I;  2BCO A;  5C0X J;  3EA6 A;  3A8K E;  1D5Z C;  2NUC A;  4F88 A;  2JSO A;  1RHP A;  2PCF B;  3R3O A;  3SK5 A;  2KHS A;  3S1Q B;  2KJX A;  3NWT A;  1TS4 A;  3BDL A;  5I6Y A;  5EKL A;  3VYS A;  5FO7 B;  4CKC A;  1NR4 A;  2FIN B;  3EVQ A;  3K57 A;  4V19 0;  4FF2 A;  3QIA A;  4DN4 M;  1HPC A;  5CMD A;  5EJW A;  4OO1 G;  4PV1 C;  3KLR A;  2WKC A;  1DCZ A;  5C44 B;  3A56 A;  5K36 G;  5EGT A;  1Q90 A;  4NKL A;  5BN4 A;  3AU7 A;  5KRU A;  2K5W A;  4KKS A;  2KCC A;  5HUR A;  5C3E B;  4MN3 A;  3MFY A;  1QIL A;  3C1F A;  4KY7 A;  1FR3 A;  2C5C A;  1GOZ A;  2K5D A;  1EQV A;  1ESF A;  3OSO A;  1Z7T A;  1F2L A;  3K0Y A;  1LT6 D;  3OHX C;  1DYQ A;  4ZUI A;  3K59 A;  1Y69 U;  2F0S A;  3JAM L;  4C3H B;  4HR7 B;  5J1Z A;  4N9P A;  2RVL A;  1D1I A;  1SYB A;  3QG1 A;  2K5Q A;  4K2K A;  2XRS D;  1PZI D;  5I2Y A;  1MGS A;  4ZAI A;  2EPB A;  1TKW B;  1TWF B;  1OO9 B;  3TP8 A;  1NR2 A;  1PRT B;  2AQ2 B;  1AN8 A;  2B2U A;  1Q3L A;  2A68 C;  2L1B A;  3HOW B;  2IT1 A;  3NXW A;  3TZD A;  2XNA C;  1PRT D;  5NUC A;  3VR3 A;  3BVM A;  1BNZ A;  2QCP X;  3X3M A;  4LK1 C;  3VR6 A;  5IGG A;  1LTT D;  2F0Q A;  4KY6 A;  5C3W A;  4IFD H;  3I4M B;  3J7Y W;  2RDG A;  3S17 B;  4ID6 A;  3S2D B;  4G7Z C;  1AP0 A;  1LTA D;  4H44 C;  3SXH A;  5CBE E;  5C6A A;  3GV6 A;  4RKL A;  2IW3 A;  4C1N K;  3A54 A;  5DM6 3;  1RCV D;  1A15 A;  3HOZ B;  2D62 A;  3QOL A;  2ZXP A;  5JEA J;  3ND9 A;  4A3K B;  3QO2 A;  1A3U A;  3L3O C;  4C3J G;  2HCI A;  4G7H C;  1D6E C;  3HOU B;  2R6G A;  1STA A;  4RH6 A;  1TU2 B;  3NHH A;  5ISR A;  4IUN A;  1A3T A;  2K05 A;  5KNC A;  2L0C A;  1O7Z A;  1PFB A;  3S1R B;  1NCV A;  1PTO H;  3A7A B;  3Q0A A;  4P2C B;  2IL8 A;  4ZUJ A;  2VNU D;  5DEH A;  3VR4 A;  4BBR B;  2A69 C;  1BF4 A;  2WIN B;  1G6Z A;  1LT4 D;  4J8Q A;  1VMC A;  2X6L A;  4K5W A;  3NP8 A;  2A69 D;  4PNY A;  1PTO F;  1MD2 D;  3CQZ B;  1QB5 D;  1PFM A;  2KEE A;  1ML0 D;  1STH A;  2SEB D;  4XXE A;  3PUY A;  4B9X A;  4LJZ C;  3EFX D;  1PXU A;  3E0J A;  1LAB A;  3P7J A;  4TQU S;  5CV6 A;  1IHZ A;  3OOC A;  1Y8O B;  4MHE A;  3ZYY X;  1STY A;  3OIQ A;  4EVO A;  4K5X A;  4YIJ A;  1ROD A;  4ODG A;  5ELD A;  1SSO A;  3K5N A;  3JAM E;  3I4L A;  2PO4 A;  5JVH 3;  4K5V A;  1B1Z A;  5JEA H;  1H9S A;  1LV9 A;  3NBH A;  1BBX C;  3GV3 A;  1GUS A;  2B2Y C;  1QE6 A;  3A7L A;  1EY5 A;  3KLS X;  3QWN A;  2K28 A;  3G7L A;  3K6O A;  4QUC A;  4EGV A;  1SNM A;  4E6I A;  1C4Q A;  2K33 A;  4FF3 A;  1GUO A;  4IUU A;  1X32 A;  2LY7 A;  3RZD B;  1YNJ C;  4RGM A;  1BXT A;  1SE4 A;  4HSP A;  2TMP A;  5D3I B;  3MEH A;  4RWS C;  2B63 B;  1X3Q A;  2O2L D;  2DN8 A;  1E2Z A;  3IAY A;  2F03 A;  3U9S A;  3K58 A;  1IW7 C;  2PNR C;  4B08 A;  3RD4 A;  2B2V C;  3EJI A;  1L0Y B;  2EYL A;  4BY7 B;  1M8A A;  1VF7 A;  4IUQ A;  1SEB D;  2RA4 A;  4QUF A;  2EOT A;  3UI2 A;  1ILP A;  5EQ0 A;  5M5W B;  2XVS A;  1AZP A;  3A8J E;  2YU9 B;  3T53 B;  3KF8 A;  2SOB A;  1CQF A;  2NTT A;  4J6H A;  3DHQ A;  3OW7 A;  1QOH A;  1S5E D;  2KOL A;  2JYO A;  1MSH A;  4H13 C;  1HCZ A;  1F2Y A;  1IL8 A;  3HP3 A;  1LTS D;  3OPO A;  4R8I A;  3AB9 A;  1SYE A;  4TSS A;  5HGT A;  1WD1 A;  2SNM A;  3VYR A;  1G2S A;  5CV9 A;  4HCE A;  1B9N A;  5IOD A;  1CTM A;  1V1P A;  2AQ3 B;  3SK8 A;  1WTQ A;  1SMY C;  3RLF A;  1I6H B;  1WVL A;  4I7Z C;  2ID0 A;  3HEJ A;  4WJW A;  3S1M B;  1OXU A;  5M9O A;  2CQA A;  3GTJ B;  1IKL A;  1R9T B;  3TDQ A;  3EQL C;  1T5E A;  3H09 A;  4K14 A;  4ZQ3 A;  2PQE A;  4BWG B;  5KYL A;  4RHS A;  3KBG A;  5C0X H;  2CHB D;  4DAV A;  5EPJ A;  1LTI D;  1LTR D;  2RSN A;  5CBA E;  5FOB B;  1B2T A;  1GJX A;  4A3B B;  1PFN A;  3HOX B;  1I4X A;  3S14 B;  4FNF A;  2NZ1 D;  5A2Q E;  1RTO A;  2B2W A;  4G4K A;  4PMB A;  2D2C C;  4BA1 I;  4KKT A;  1KTK A;  3D6C A;  2NVT B;  3S9W A;  2VB2 X;  1NAP A;  4Z9C B;  4IFD I;  5D65 A;  1PTO C;  3FDT A;  3DEO A;  4KN7 C;  4DK0 A;  4PMC A;  3TP5 A;  4CJ1 B;  4G7O C;  1DZ1 A;  2F0U A;  2DNC A;  1BO0 A;  5IGF A;  1F2Z A;  2KED A;  4XT3 B;  1SNO A;  3D8G A;  3RZO B;  2K03 A;  4L8J A;  4UDU C;  3LWE A;  5IGE A;  4M8A A;  5IT9 E;  4Q0F A;  1S5B D;  5C0X G;  1KNE A;  4V0B A;  3T13 A;  1TS5 A;  3FEW X;  3MZ5 A;  1CZG A;  2LFN A;  5G3L D;  3CKI B;  4I65 A;  4OIJ A;  3MWY W;  4R8N A;  3D31 A;  2IX0 A;  3SVM A;  1HUM A;  1AZQ A;  1U4R A;  5IGC A;  1RJT A;  1DJR D;  3I3C A;  4ZKB B;  1Y1W B;  1B3A A;  3J7A F;  4L63 B;  3NTI A;  4FF1 A;  3MA2 B;  2PZW A;  4A3M B;  1ENA A;  1GXD C;  2MUY A;  2B2W C;  5I9P A;  2EJF C;  1SYD A;  1WTV A;  3T51 B;  1EIG A;  2KUM A;  2KCN A;  2EZV A;  1C48 A;  5M3F B;  4F7X A;  4QF4 A;  1ZEQ X;  5COR A;  1HUN A;  4IUV A;  1S5F D;  2MHV A;  2F0L A;  4KD4 A;  4CKB A;  3K5L A;  2JE6 I;  3D6W A;  1FGB D;  4DNT B;  1PRT F;  5FK9 C;  2X6G A;  4KHV A;  1EEF D;  4EQO A;  2JA7 B;  1M4V A;  2A6E D;  1JR0 D;  4NW2 A;  4EQN A;  3V05 A;  4BA2 I;  1D5X C;  4QCL A;  2R7Z B;  3CRL C;  1RF2 D;  2JXM B;  2EVB A;  2I07 B;  4DF7 A;  1QG7 A;  3FKI B;  1HTL D;  3KBX A;  1B4O A;  1IKM A;  4IUP A;  1I50 B;  3MXP A;  1BQQ T;  2AUJ D;  3R2T A;  3ND8 A;  2A68 D;  3QB3 A;  1TT2 A;  5LHY 1;  1BDO A;  1UUP A;  2WV6 D;  1PRT C;  1GHJ A;  1H9K A;  3M4Y A;  4DXG A;  2K1B A;  1CQV A;  2MP1 A;  1JE4 A;  4HED A;  4ILW A;  4XQQ A;  3VA5 A;  3I90 A;  1DOK A;  5FO8 B;  1EYD A;  2EYP A;  2AQ1 B;  1SDF A;  3ITP A;  3MXG A;  1JWM D;  5EKI A;  3PMF A;  4K6D A;  1SJE D;  5JAV A;  5I6W A;  1PTO B;  1E2W A;  2EYM A;  3V96 A;  5M5Y B;  2RQX A;  1CFM A;  4RGO S;  1XX8 A;  1Y8P B;  5ELE A;  1RTN A;  1PZK D;  1Z47 A;  1ESR A;  1JOR A;  2J4X A;  2F0V A;  2RDF A;  3D4D A;  2LKV A;  2JA6 B;  1X3P A;  2NB0 A;  1HRJ A;  4ZLT F;  4A3J B;  3L9A X;  3TP6 A;  2O4X A;  4MIU A;  2PYK A;  5FO9 B;  1ZYR D;  3V2T A;  2BE5 C;  3K7A B;  3D4R A;  1CHP D;  4OGQ C;  1VF5 C;  5C5L A;  4C56 C;  3T16 A;  4OO1 H;  1FYC A;  4KV6 A;  3GTQ B;  2M00 A;  4KJN A;  5CV8 A;  3U9O A;  2L4N A;  1QCB D;  3NQT A;  1CA5 A;  3P1H A;  2QDB A;  1F9S A;  4HTH A;  4WOR A;  2A73 B;  1TII D;  5JJZ A;  1W6J A;  3O13 A;  2G9D A;  2FMM A;  3I4N B;  4FVM A;  2LS0 1;  3VR5 A;  3C3L A;  4KY5 A;  2OT2 A;  2B2T C;  1I4G A;  1TS2 A;  3OMG A;  3C2P A;  1ICW A;  1A6X A;  2B8G A;  2K6A A;  1EY0 A;  2HDL A;  5CV7 A;  4ZKC B;  4B9W A;  2MGS A;  4OHJ A;  5EBC A;  1FNU A;  2R3Z A;  3CHB D;  1ET6 A;  1DD2 A;  2DY8 A;  2BDN A;  5C4X B;  3M4O B;  1KDB A;  3CRK C;  1D1K A;  1I4P A;  3PIP 3;  2JA8 B;  1G29 1;  4UAI A;  3OMC A;  3BDO A;  1MSG A;  4S3S A;  2EY5 A;  3H91 A;  3Q6S A;  1V43 A;  3C46 A;  4FF4 A;  4F8M A;  1B53 A;  2ZXO A;  1S4Z A;  1QNU A;  2D9U A;  2NVX B;  1LLR D;  1WTR A;  1SYC A;  4N9T A;  2WII B;  1EU3 A;  4NMZ A;  2PPB C;  1F77 A;  3PUV A;  1TWG B;  4ME5 A;  3MVV A;  5CV4 A;  2JP1 A;  4RA8 A;  2F1M A;  3NTK A;  4DGZ A;  3H94 A;  2F3W A;  2NVY B;  1KAA A;  2PW5 A;  1I4H A;  3DEP A;  4CJ2 C;  3GTP B;  3DWP A;  2IPK D;  2SNS A;  4X3K A;  3I70 A;  1EY8 A;  5EPL A;  3GTG B;  1KLU D;  1F9R A;  4CKE A;  3BYY B;  1EYC A;  2EE1 A;  3FVQ A;  4A3I B;  3A8I E;  4BY1 B;  2F0H A;  4DU9 A;  1BCP D;  3ONA B;  4DA2 A;  3BVZ A;  1EZ8 A;  2B2V A;  2XN9 C;  2NYZ D;  1CM9 A;  3GTM B;  1F9Q A;  2K04 A;  4U68 A;  1BCP C;  1ZKO A;  3NUC A;  2TSS A;  2KQ3 A;  2A6H D;  1ILQ A;  3W2D A;  1PTO D;  1JCK B;  3MXU A;  2F0D A;  4DAP A;  2Y0S B;  2O5J C;  2H4O A;  3OIP A;  2JA5 B;  4X3T A;  1HQR D;  1EQT A;  1Q1B A;  3G6J B;  5E1F A;  1DOM A;  3VYT A;  1R4Q B;  1EWH A;  1B50 A;  4K8I A;  1FNW A;  3PUZ A;  2EYH A;  4O42 A;  3Q24 A;  1V1P B;  1GHK A;  1J8I A;  4K2L A;  1HHV A;  2AWN A;  4CGY B;  4JK1 C;  3SR1 A;  4HSV A;  5F2D A;  5A2Q L;  3HGB A;  1CZW A;  2R93 B;  2Z4H A;  5D3D A;  3TP7 A;  2F0N A;  2L11 A;  4QIW B;  3A55 A;  4DXF A;  1OXV A;  2K01 A;  1KLG D;  4A3E B;  4O1N A;  4NDX A;  5FLX E;  1XYI A;  2A5H A;  4RCN A;  2PMZ B;  1VMP A;  3DM1 A;  2FHT A;  3E6Z X;  4XYO A;  1JWU D;  2B8F A;  3M3Y B;  3HOV B;  3H3V C;  2KA7 A;  1DM0 B;  1G8Z D;  4OL7 A;  4IUT A;  3Q23 A;  1G2T A;  1RD9 D;  1GUT A;  4ZRZ A;  2YYZ A;  5DM7 3;  2WB1 B;  2JEB I;  2SDF A;  5M5X B;  1A2U A;  2D5D A;  3MAQ A;  1ONL A;  3X3N A;  1TWH B;  1IYU A;  1WD0 A;  2JEA I;  3GTL B;  3IKJ A;  2A6H C;  1LT5 D;  4FXK C;  2VXW A;  3J80 L;  1V1O A;  4XTC S;  1K83 B;  4K6L A;  5ELC A;  3E5S A;  1U9R A;  1OXT A;  2L12 A;  1SXT A;  4FP5 D;  4XYQ A;  3J80 E;  4RHR A;  4TRD A;  4RAU C;  1I3Q B;  1U4L A;  3BDC A;  2IX1 A;  1JQY D;  1SNP A;  1TY0 A;  4XDX A;  3DXJ C;  1JC7 A;  1STN A;  2E75 C;  5TSS A;  1EFI D;  4EQP A;  2EY2 A;  1T5X D;  2OXP A;  2Q8T A;  4A3D B;  4RCO A;  5C5M A;  3PUX A;  2XRQ D;  5I4D A;  2MJ8 A;  3S15 B;  4KKU A;  2AUK A;  1RKN A;  3HKZ B;  1PYW D;  1DXM A;  1H9J A;  1Y1V B;  1YNN C;  4RFB A;  5CR3 A;  4HN7 A;  5AFW A;  4WFN 3;  1S5C D;  4L6T B;  4IFD J;  4H7B A;  1F9P A;  2Z8L A;  4XIG S;  5EBD A;  3NTH A;  3J81 L;  1JIC A;  1Y8N B;  3PUW A;  4PMW A;  1JWS D;  1W6K A;  3VR2 A;  3BVG A;  3TZU A;  4IN3 A;  5CC4 A;  3SK4 A;  1DON A;  2X69 A;  1EU4 A;  4FXD A;  4BBS B;  2L5T A;  3LX0 A;  1I4R A;  1HXY D;  3HG9 A;  2ICE C;  1Q1E A;  2M2L A;  2XWB B;  2RDH A;  1KAB A;  5E4X A;  4FXG C;  3MFG A;  4A93 B;  4QMG A;  2R61 A;  2A6E C;  4RGT A;  5JPN C;  2NN6 H;  1Q8I A;  3QOJ A;  3D3R A;  3FRP B;  1TR5 A;  3NK9 A;  3SK6 A;  1K8M A;  3PO3 B;  1EIH A;  4ZYS A;  4HAE A;  2PZT A;  5D14 A;  3K5M A;  3H6M A;  2WKD A;  1GUG A;  2Z4I A;  4R9W A;  2EYJ A;  5JOB A;  3J81 E;  1WTP A;  5KND A;  2Z1C A;  2N88 A;  3MC0 B;  4DK1 A;  1MBY A;  2ZT9 C;  3TN2 A;  5M3M B;  3I73 A;  1UEA B;  4JBW A;  3SE0 A;  5C4Z A;  3BS1 A;  5DAU A;  1BUV T;  2QF7 A;  3TSS A;  2Q8I B;  4KD3 A;  4NP5 A;  5KNB A;  1LTB D;  3S1N B;  1O80 A;  1J9O A;  3N52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...