3J7AV

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
156
structure length
146
Chain Sequence
DVQHERAYQKQEGASFFNSKRYWKKVGLGFATPKEAKEGVYVDKKCPFTGNVSIRGRILKGMVISNKMKRTIIIRRNYLHYVKKYNRFEKRHKNIPCHCSPCFDVKEGDIVTVGQCRPLSKTVRFNVLHVEKHQIFGSARKQFVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 20
structure length 146
sequence length 156
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00366 Ribosomal_S17 Ribosomal protein S17
V PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j7aV00
3JAML 5LL6X 3J80L 3J81L 5A2QL 5IT9L 3J7AV 5FLXL
chains in the Genus database with same CATH superfamily
3AFQA 2FMCA 1W6JA 4K5XA 5BN5A 1IKMA 1HCZA 4DV6Q 2EY1A 2WV6D 1W3SA 4A3EH 3SE0A 4JI8Q 4A3CG 3SK6A 4HIDA 2UXDQ 3I4NG 3OOCA 1HZAA 2RCNA 4R4TA 1D6EC 3TMEA 2L11A 4C2MH 2F0NA 4LFBQ 4X6AH 1BNZA 4YY3Q 2UU9Q 1PH9A 3HKZB 3K0XA 3ND9A 5IOCA 1VQHA 4C2MB 3ITPA 5KYLA 4UDUC 4OWXB 4IUTA 1OXUA 2M00A 2EJFC 4RKLA 1TWAB 3KF6B 2K14A 4IFDJ 4C3JG 3K5OA 1EY7A 1Z47A 4J8QA 3HKZE 4HN7A 1PH2A 1CQVA 2X69A 3NUCA 3S17H 4JBMA 1WTRA 1IXRA 3OWFA 2L55A 1VS0A 1N9WA 4QGUA 3G6EA 5KNCA 4BXXH 3S17B 1SE8A 3G48A 3KJOA 5C3EG 4YCUA 4KY5A 2R7FA 2OTJA 4JI0Q 1ESRA 5GAEC 5AJ3Q 1MKHA 3QB3A 4K0KQ 1MD2D 4HCEA 3CKIB 2E2HH 2GN5A 1EY8A 4WJ4A 1MJEA 1MSGA 4A3JH 2E2HB 3PF5A 3I3CA 5LMUL 4O0AA 2R7ZH 1I3QH 4HIOA 1S72A 2JEBI 3PO2G 4A3JB 2JA8G 1ENCA 2R7ZB 1F2ZA 1I3QB 1LTGD 1SYDA 3PUZA 2A19A 3VYRA 3HOYG 2JYOA 2EPBA 2Z4IA 5KEEA 2A6HD 5JJKA 5EQ0A 4P73A 1WD1A 4TRDA 3EIVA 2AHOB 2B2VA 1XNRL 1LTBD 3J7AF 1GXDC 2YTXA 4ZUJA 1NJIC 3E9HA 3M3YH 1EIFA 4IJLA 1K9MC 4AYBG 1STBA 3ULLA 5IE8A 4KV6A 4QIWB 1PDQA 2LFNA 3NQIA 3GTMH 1KD1C 3QOJA 3IL8A 3M3YB 2K75A 1PZID 2D0PA 2F3IA 2PQAA 3K5LA 3NTKA 4K2LA 4A93G 3OYYA 1I94L 3GTMB 1EWIA 2KBNA 3S14H 2PYKA 5GAHC 3VA7A 4F7XA 1IBML 4RGMA 1PTOF 4QIWE 1AP0A 1NCVA 2K01A 3S14B 1JJ2A 3S1QH 1D1IA 1QJOA 1CQFA 5IT9E 4XIGS 4HJ9A 1BOSA 1KRSA 2XTIA 5IGFA 2JQOA 5C4XG 4PQXA 1LACA 1BUVT 3S1QB 2B2WC 2ES2A 1HRJA 2CQOA 1KDAA 5DEHA 4PMBA 4BBRG 3QOLA 3S2HH 2ENBA 1STAA 1HNXL 2GVAA 4G7OC 5ELNA 4DXGA 1LT4D 4X62Q 3VYUA 3OSOA 3VYTA 1YHBA 3S2HB 3KK7A 3QJYA 1LLRD 2Q8TA 1KAAA 2UXCL 4QQBX 2AQ3B 2GVBA 1HNZL 2ID0A 1XMQL 3HOVG 1I4HA 2BH8A 1D2BA 4K5WA 4GNXC 4DR3L 1K73C 2ZJPA 1PHJA 2DNCA 1VQKA 3SK4A 4R9WA 1H9SA 3T13A 5DM73 5JEAH 4G57A 5E3FA 2NVXH 1CSPA 3IAYA 3A7LA 5LMNL 4DR6Q 1S4ZA 3TZUA 2JA6G 1Z9FA 3CC4A 1EZ6A 1EOTA 3A56A 1DM0B 2NVXB 3BZDB 2VS1A 5C3WA 1NAPA 5IP7H 4RA8A 2F03A 1VQOA 3M7NA 1U9RA 2NYZD 1JJGA 2K5WA 1X3PA 3EQLC 2B63B 3WOFA 4DGZA 2HIVA 3I4MH 3MAQA 3PIOA 1KNEA 1KDBA 3CU7A 3IFTA 3I4MB 1UE1A 4EQNA 1KABA 2PQAB 5A2QL 3HOZH 1EEFD 2LMCB 3KOJA 1STHA 1VQGA 4RMFA 4X64L 4PZ6A 3H6MA 1RTOA 3HOZB 1EEID 4RHSA 3S1MH 3V96A 1VMCA 1KDCA 2E75C 3CPWA 2TMPA 1JORA 1OTCA 4NPSA 2VW9A 4LUOA 1AN8A 1GUWA 1EY9A 1SYFA 3CCEA 3S1MB 1B4OA 1BVSA 2F0IA 4A3EG 1AE3A 5FJ8H 4TVAB 2NUCA 4Q0FA 4KTAA 3HKZG 2Q2UA 2F0FA 3CCQA 1E1TA 1I94Q 1X3QA 1TWHH 3AU7A 1LABA 5KNBA 3HOXG 1IBMQ 1D5XC 1K8AC 3BYYB 4XYOA 1WJJA 1TWHB 2A69C 1SE4A 1ESFA 4NP5A 1LTSD 4L5TA 1VQNA 4MTKA 4L5QA 3RLFA 1ICWA 1KTKA 3RR5A 3DMUA 2FFKB 1FNVA 5HGTA 2UXBQ 1H9SB 2FINB 3MTSA 1K0RA 4A3GG 5JJLA 3GTJB 3CCSA 4DN4M 1FJGL 1BCPB 1WTWA 3HOUG 1VQJA 1I4QA 2OEOA 3IKJA 1WI5A 2K1BA 4K6LA 5I4DA 5L37A 1FYCA 4JVZA 4R4OA 4BXXG 1E2VA 2CW0C 1XPOA 3F1ZA 4IUVA 2N78A 1HNZQ 1XMQQ 2DY7A 1MIUA 4DR3Q 2WAQE 1XYIA 3S1NH 3MZ5A 5D14A 4OX9L 1PTOD 5IWAL 1OXXK 2PW7A 4KJNA 4A3JG 4JG2A 4A3IH 3I8ZA 3V05A 2BOSA 3P1HA 1Y14B 1C0AA 1LV9A 1YVCA 4IPDA 2EOTA 2KOLA 4NXNL 2FMMA 1K8MA 4GLVB 4DFAA 4H44C 4A3BH 4P2CB 2AWNA 2UUCQ 3J7A5 4N8X1 2Z6KA 3DM3A 3RZDH 1SE2A 2EYOA 2O5JC 1CA5A 3I91A 4A3BB 2IY5B 1HJPA 1BKBA 4X3KA 1Q81C 1QZGA 1G91A 1TIID 5ELBA 2EDGA 1PH6A 4JI6Q 3RZDB 5EKIA 1RIPA 5C44H 2YTYA 1BO0A 1E1OA 1XWEA 4J1MA 3DWPA 2I0QA 4X64Q 3K57A 1DOLA 2H1EA 2KUMA 2A6EC 2F0KA 4CKBA 2I5HA 4KKUA 1BQQT 1F9PA 3BYTB 3EN2A 3K81C 2F0WA 2QA4A 1E22A 4LUZA 3SK8A 3EBEA 4TQUS 3M4PA 5ELEA 5I9OA 3GTLH 3K80C 1Y8NB 1HNWQ 3HG9A 2NVQH 2LS01 1VQ7A 1E2WA 2SOBA 2KEEA 3TREA 2Q2IA 3A7AB 3GTLB 1HR0L 5IGGA 4IPHA 3T1HQ 4CGYB 2NVQB 3TP7A 4YWMA 3K5MA 2EYFA 1Q7YC 3OW7A 2EYLA 3UI2A 3RZOB 1D8LA 1OXTA 2HDMA 3AQQA 3CW2C 4P75A 3PQIA 4HJ7A 1KLUD 2E2DC 3BS1A 4DR2L 5EKLA 4RFBA 3ZJYC 2CWAA 1TQOA 1I50H 3BVMA 1VQ9A 3FHWA 2BDNA 3C1FA 2MO0A 1I50B 4DV1L 1TWCH 1S5BD 2D0OA 1G291 1FJGQ 3F2DA 1JQYD 4NB3A 1YNNC 1TS4A 2R93G 3NEMA 1JOOA 3MXNA 1U5KA 4I7ZC 1KRTA 2E76C 1S3OA 2R3ZA 4B9XA 2PW5A 5GQOA 5DLQE 2WIIB 2F3WA 5GROA 2B2YA 4CKEA 5DAUA 3GTGH 4LF6Q 1MHWC 1PH3A 2B8FA 1PRTC 4NMZA 5ISRA 5C0XH 5IP7G 1M8AA 4IZ8A 3GTGB 1EWHA 4OGQC 3KLWA 2K5DA 2UUAL 1PMRA 2E2JH 3TEHB 2XRSD 3I4MG 2R61A 1GM5A 1F9SA 1QOHA 5IYDH 3CF5A 1PYWD 1SAPA 1CHPD 4V190 1ASYA 1N33Q 3GP7A 2E2JB 2WINB 4RGOS 1NR2A 4DAVA 4JV5L 4C1NK 3HOZG 3C3LA 1L0XB 4OO1G 1GO3E 3HZXA 3MC0B 2F0SA 4JI8L 1SMYC 1YZ6A 2EYPA 2RCFA 1AEXA 2CH4A 3U58A 4RCOA 4LFBL 4DV5Q 4MNOA 2E8GA 3H0GH 1LTLA 2CQAA 1LT3D 1ZYRC 5C5LA 5DM63 1QNKA 2HCIA 2LKVA 3HFZB 2BE5D 4XQJA 3H0GB 3A0JA 4DXFA 4WJ3M 5AFWA 2F0UA 3FVQA 4KY6A 4FXGC 1STEA 2LY7A 3MEFA 3R8BA 1HPCA 3VR6A 1GUNA 1NMFA 1A3VA 5IYCH 1D5MC 1JWSD 5M3FH 1DONA 5CBEE 4IQZA 4JK1C 3W1BA 2N3SA 5EAYA 1QB5D 5I6YA 2DJGC 4KN4C 2KCNA 4ID6A 1JC7A 1I6HH 3I90A 3G7LA 3I72A 3J80i 2F0MA 2MQHA 1R4QB 4R1JA 3FEWX 1Z6HA 4F87A 1HR0Q 4FDBA 4DK6C 5FLMG 3H15A 1K8OA 1WCMB 1I4GA 2Y0SB 4JI0L 2QILA 5AJ3L 4HSVA 1EYGA 1CUKA 4A3MH 1CKMA 4LF7L 2Z1CA 4DAYA 3J81c 3MXNB 2CWPA 1K0SA 4L5RC 3KF6A 3D4RA 4AIMA 4A3MB 1X3EA 4YCVA 2A68C 2XSCA 5A2QE 4R8NA 1X9NA 1PV4A 2BDOA 1SNQA 1BR9A 4X3SA 2WP8J 3H09A 3J81i 3AB9A 2NN6H 2RSOA 2JK8A 3CCJA 5T1IA 2B2UA 2FJ2A 5D65A 1L0WA 1VQLA 4DR5Q 1QG7A 2TSSA 4GOPC 3NK9A 3SEBA 1TR5A 1JOQA 4A3IG 1NR4A 3PIP3 3J7YW 5E4WC 4HR7B 3VR3A 1STGA 4A3FH 4JI2L 4FP5D 4ILWA 1BCPD 1LYLA 4MHEA 1F9QA 2D62A 3PO3H 5I2YA 4N9PA 4A3BG 4A3FB 4HJ5A 4XXEA 3GQBA 3CXCA 2UUAQ 1I4XA 1VQIA 3I4OA 3KDFA 2OTLA 3STBD 1SDFA 3EVQA 1PH4A 5C44G 2ZM6L 1GUGA 5LHY1 1IYVA 1HZ9A 5CORA 2NZHA 4JV5Q 1EZ8A 1WTXA 3J80L 3KJPA 1E0BA 3NPPA 4DUYQ 1PFNA 1V1QA 1II3A 2R6GA 2XGTA 2A73B 3J7AV 3WWVA 1J6QA 4QJFA 3SR1A 3PGZA 1B2TA 1V43A 1TWAH 5E4XA 1N32Q 2Q2HA 1PTOH 2JA7H 1VDZA 4X62L 1TY2A 3S1RB 3OHXC 4DAYB 3MA2B 5IGEA 4IPGA 1CK1A 2FHTA 1SNCA 4OIJA 3BZCA 1PTOB 2JA7B 1BBWA 2OQKA 2RDHA 3J81L 1OO9B 3CQZH 5ELCA 3BZKA 2G9DA 1E7ZA 5IYBH 2R92H 3CQZB 3F2CA 2VNUD 5C4JH 4A3DH 4IFDH 4DAMA 1F77A 1VQMA 2R92B 4DR6L 5J39A 2O2LD 5C4JB 4A3DB 3HKSA 2B2VC 4LF7Q 3CD6A 3J81j 4C3HG 4TSSA 4GN5A 2Z8LA 1EIHA 4LMQD 4L6TB 1SRUA 4EX5A 2HQEA 2NZOA 5C5MA 5COYA 1CZWA 1X65A 1B9NA 3CPFA 5EGTA 3CHBD 1WTOA 2VUMH 2N8NA 1IKLA 2L12A 2QDBA 4ZAIA 2PQEA 2EYJA 1D7QA 1CHQD 4MTNA 1BBXC 4GN4B 1VF7A 2VUMB 3HEJA 5ELOA 1IYJB 2F1MA 2F0DA 2ZXOA 1SYEA 5C0XG 3RD4A 1SJED 3KDFB 1EOVA 3B6YA 5CV9A 2H5XA 1J5EQ 4OONA 1S5FD 5D3DA 2PO4A 1EQQA 2P5ZX 3A8IE 3DEPA 1EYAA 1IHZA 3H94A 2A1AA 1U4RA 3VR5A 4JI2Q 1B50A 1KAWA 5IYDG 3WOEA 4JOIC 1RHPA 2VB3X 1PRTF 3FKIH 2HT1A 4EQ5A 4HEDA 1XJVA 1SNPA 4LW1A 3FKIB 1YBYA 3BDOA 3UDFA 3BJUA 2KHJA 1VF5C 1YJWA 2JA9A 5NUCA 1UE6A 4DV2L 3EFXD 1L1OC 2ZM6Q 3M7GA 1Q82C 4IALA 4IOCA 3FP9A 2MPMA 3HRZC 4XYQA 1JMCA 1F2YA 1U4LA 3R3OA 2XN9C 4P74A 1TS2A 2G5DA 3HOWH 1EY4A 4B3MQ 1JR0D 1G6ZA 5FLXc 1Y1VB 2CW0D 4AH6A 5I6WA 5IYCG 5M3FG 1WD0A 1IW7C 2L9HA 2KHSA 3HOWB 2UXBL 2PZUA 1UWVA 2G9HD 2IHFA 3AYHB 3VYSA 2Y0SG 2HIXA 3W3AA 4CJ2C 3LNNA 3CC7A 4KMUC 1RF2D 3IFDA 3TRZA 2JN4A 4HIMA 1Q90A 1UE7A 1GJXA 2Z4HA 3Q22A 1EU3A 4ZKCB 5IP9H 4U68A 4A3MG 4OELB 3K7UC 1PYSB 3F2UA 4CDCC 4UAIA 1B9MA 3DWAA 1XNQQ 1STYA 2L4NA 3Q24A 2NTTA 4R4IA 3K8AA 3PUVA 3QWNA 5EJWA 3S16H 1SR3A 1EFID 4DV0Q 2NN6G 3GV3A 2Q8RE 3GDEA 3KLSX 2EXZA 1LM0A 2L1BA 1PZKD 3ERSX 3S16B 2B63H 1V1OA 4JBWA 3MFYA 1X54A 1SYGA 1HZCA 2UUCL 5GADC 1EQVA 5HURA 3E3XA 3A74A 4KLKA 3F8TA 1O78A 3CMAA 2PPBC 1ZXTA 4HTHA 5M9OA 4A3FG 4XT3B 2XIWA 4JI6L 2QDLA 1MSHA 4NDXA 3OWEB 4DUZQ 4G7HC 3PO3G 5FO7B 2WB1B 3SVMA 4LFCQ 1ICFB 4H02A 2OT2A 5TSSA 5C4ZA 1WVLA 4QB4A 2J4XA 5IGBA 1VQ4A 3M4QA 4KHZA 3D6WA 4R8IA 2KHIA 4BY7B 5CR3A 3D0FA 4FF3A 4FYDA 4UPAA 4BS9A 1VQEA 2WB1E 1CT1D 2D5DA 2AKWB 4IUQA 2H4OA 1JWMD 2N88A 4RAUC 2IW3A 1HNWL 4ZYSA 1EQTA 2PMZE 3PIO3 2NZ1D 3KLSA 4JI3L 2A5HA 1DYQA 1FNUA 1HTLD 2J0TD 2NTSA 2AMCB 4DK1A 1X56A 1SJHD 3UE0A 3T1HL 3DEOA 2JJQA 1EQRA 4DV2Q 1IL2A 1R4PB 1PH8A 2B3GA 2RVLA 4DV7Q 3L7ZC 4GLAC 5CMDA 1JT8A 2YTVA 3W2DA 4X66Q 4MIUA 5LMNW 4POFA 4JI4Q 2JA7G 4OWWB 4E6IA 1WYDA 2YYZA 4A76A 2ZXRA 1YNND 1QVCA 1GOZA 4JBJA 5G3LF 4BWGB 1FNWA 1I5FA 3ND8A 3V2TA 3GTJH 2MJ8A 3EA6A 1NTGA 2V4DA 2ZTDA 2CCZA 1HFNA 1M90C 2WAQB 4AQYQ 1PFBA 4RHRA 4RWSC 3NTHA 2R92G 1Q12A 3I55A 1KIXA 2K4KA 1RD9D 4JW0A 5CYUA 4IFDG 1TY0A 2AWOA 3I7FA 4M8AA 3AMUA 4ABNA 2QF7A 4DF7A 4LF9L 2VB2X 1KL9A 4C56C 3U50C 2EJMA 4LF6L 5A35A 5JOBA 2B2TC 1K28A 3K7AH 3HGBA 2MFIA 1GUOA 1M4VA 1X55A 1RL2A 2R7ZG 2WFWA 3J80E 4WORA 3K7AB 4FF4A 1JCKB 2IX0A 1N33L 2QEJC 1DZ1A 1FR3A 1WOCA 2RDFA 1YEZA 1YNJC 1TU2B 5ELDA 2Q8IB 3TBIB 1ILQA 1YJ9A 1SEBD 1SN8A 5IIFA 1UEAB 3K5NA 5EPJA 2VQEL 4GNXB 4JC0A 3PV0A 4XQQA 4DAPA 3PCOB 3BVGA 1SMXA 5LL6X 3A5UA 4APVA 4YHHL 3HP3A 4DV5L 1NNXA 3FKIG 1ET9A 2EY5A 1SXTA 3J81E 3BDLA 4QMGA 2X6GA 1B3QA 5M5XH 4A3KB 4GKKL 2F52A 3JAMc 1PYBA 3O13A 1ASZA 3H3VC 2CH4W 1C48A 2JXMB 4L8JA 2Z6BA 5M5XB 2F0EA 1VQCA 3X3MA 3T1YL 1XTCD 2CHBD 3JAMi 4MZ9A 1N8RC 2ZT9C 3T51B 1EY5A 1Q8KA 2XVSA 4JI3Q 4A3CH 3Q6SA 3HOWG 5JJIA 4FO2A 3RZOH 4DR4L 1HHVA 2DN8A 4YWLA 3E0EA 1KHIA 2B2YC 1RTNA 3DUZA 4GN3B 1UE5A 2BA1A 2ALYB 4WJWA 4OO1I 4ZQ3A 1VMPA 3MVVA 5FK9C 3K0YA 4PMWA 1X6OA 2RKSA 1G51A 4DK3C 2OF1A 3JC66 3ONAB 1ZKOA 1MI2A 2R7DA 3LX0A 1BBUA 1LT5D 3VR4A 4KHPQ 5IP9G 2CKZB 1Y1WH 2K04A 2AUKA 4OEMB 1N36Q 4PZ7A 2LSSA 1NUCA 4K8JA 3TP5A 3H91A 4IO9A 1Y1WB 1LT6D 1CKNB 2F0OA 3RUZA 1TS5A 5JEAG 2J7ZA 3KBGA 4HSPA 4LF9Q 3TS0A 1C4QA 3D8GA 4LF5Q 1BDOA 4ZLTF 2EYHA 1QWYA 3PUYA 3AFPA 1XPUA 1QILA 2A8VA 1XMOL 2B63G 2RF4A 4MN3A 4OL7A 4A4IA 1YNXA 1YI2A 2KENA 2DNEA 3LWEA 1FVIA 1A15A 1W2BA 1PZJD 5CGKA 4LWCA 4KK7A 2CFMA 1EYDA 3GV6A 3NBIA 2KVMA 1QVGA 3L3OC 2M9VA 3PO2H 2NBFA 1K3RA 2PCFB 4ODGA 2N49A 3PO2B 3JAML 1RKNA 1WTHA 2VL6A 4BA2I 3EJIA 1XXGA 2VQEQ 1M1KC 4DUYL 1GHKA 3Q8DA 1TWFH 5M3MH 2HUGA 3R93A 5JAVA 4WRDA 4YHHQ 4XQNA 1FGUA 2B39A 1IBKQ 4CJ1B 4DPGA 4ME3A 5T1GA 1TWFB 5M3MB 3OMCA 1G8ZD 5JVG3 1N32L 2EQSA 1DOKA 4GKKQ 2JSOA 3UDIA 1VCIA 5FJ8G 4DR7Q 4AYBB 4R4CA 1UUPA 2UUBQ 3KF8A 2D2CC 4A93H 3SHLA 1TVXA 3T1YQ 1BXTA 1D5ZC 4K5VA 4PMCA 5JJZA 2F0TA 1JE5A 1SBBB 1WCMH 4ZK9B 1YHQA 4Y7NB 1V8QA 2MHVA 3PUXA 1FD7D 4A93B 3NENA 5FOBB 3T16A 1DXMA 1EYCA 2FXQA 4X65L 2I46A 4B3SQ 4AYBE 1FGBD 4O1NA 2L0CA 3T53B 5JVH3 1S5DD 1E3PA 5EKKA 4UP9A 2WAQG 4ZCKA 2KCCA 4LFAQ 3GTKH 4DR4Q 2EJGC 4RGTA 1QNUA 1SROA 2ICEC 5C4XB 1O7ZA 2JE6I 3GTKB 4PG3A 3BDCA 4CBVA 4ZKBB 1NBWA 3KLRA 4LJZC 3L2PA 2N55A 1I4PA 4EQOA 1U4MA 3NTIA 5M5WH 2F3VA 3CC2A 1S5ED 4KY7A 3HOVH 2LXJA 4LF8Q 2C35B 2SNSA 3E6ZX 4BA1I 5M5WB 3GTQH 3E9IA 4DV4Q 1YJNA 2K5HA 3S24A 4RGNA 5HY6A 3RNUA 1B70B 1W6KA 3HOVB 2VY3A 3GTQB 1J5EL 4I7AA 3GTOH 1XX8A 3NBHA 1ONLA 1JE4A 4GKJQ 4QCLA 4FF1A 3GTOB 3CP0A 1XMOQ 1EL0A 3CCMA 4EVOA 1JWUD 2MP1A 2KCMA 2GA4B 2I07B 4F88A 4JBKA 4DA2A 3RMHA 3SDZA 3OW2A 5HGQA 4LF4Q 2EY2A 1XTDA 4G4KA 3UE1A 1IW7D 5I2XA 4KD3A 2AQ2B 4O2DA 1EWCA 1OXVA 3P75A 1GUTA 3LWUA 5IY0A 2ATWA 4OWTB 3KF8B 1VQ8A 1O7YA 1PRTB 1Y8OB 3NHHA 1JOKA 2EZVA 1CM9A 1PH5A 2XWJB 4B3ML 1P16A 4DNRB 5D3IB 3TP6A 1TXYA 2I5LX 1VQFA 1GKHA 2VZAA 3OTOL 1T9HA 2E5LQ 2EIFA 3S1RH 4POGA 4U673 1HTPA 1K3BC 3U4ZA 5C0XI 4K8IA 1A6XA 1SYCA 3RLNA 4GOPA 3CRLC 1LTTD 3MFGA 1C9OA 1EUJA 3CRKC 4HMJA 1QCBD 3KYHC 2HCCA 3PSIA 1KLGD 5GAGC 4YIJA 3QIAA 4LNQA 1Z7TA 1VQ5A 4A3EB 2D9UA 5C4HA 5EPLA 4IURA 1Q46A 2RHSB 3HOXH 4DV3L 1X3FA 4IJHA 3I56A 4KN7C 3S9WA 1SNDA 4X65Q 3HOXB 5BR8Q 1XNQL 3HS0C 1LUZA 4B9WA 1P8LA 4QL5A 2VQFL 4IUNA 4DV0L 5CV6A 2PI2E 1ENAA 4HJ8A 1O80A 1Y1WG 1TKWB 1AH9A 3K58A 3RN5A 4A3GH 1G2TA 2BE5C 3ULPA 3NBHB 3HOUH 3PF4A 5J1ZA 3C2PA 2DUDA 4A3GB 4JYAL 3H3VI 3TZDA 2Z9HA 3F2BA 1HQRD 3CCVA 1A63A 4B08A 3HOUB 1MBYA 2VXWA 3NWTA 3N52A 4P72A 5J3BA 3NE5B 4DUZL 4HCSA 4H13C 5DNFA 4LFCL 2K52A 4S3SA 2SNMA 1CSQA 2JA5H 2ZXPA 1ET6A 1A2TA 4QY7A 3Q23A 1QVFA 1J9OA 4LUVA 4G7ZC 3C46A 2JA5B 1Q8IA 1YIJA 1X3GA 3DM1A 2HD3A 4OXPA 4JI7L 4ME5A 1WTPA 1JB7A 1A62A 4Q5VA 2MGSA 1JB3A 2A69D 2NVYH 1U0LA 1L0YB 2NN6I 1CFMA 5M3MG 2I5MX 4GOPB 1H9MA 2O4XA 5C3XA 2NB0A 1H95A 3H0GG 2NVYB 4DKAC 1LTAD 2HDLA 4DV7L 1O7LA 1X32A 1Y1VH 4UHVA 4X66L 1C8CA 4JI4L 2K5VA 2ICIA 1V1PA 1KC8C 1EY6A 1GUSA 3DXJC 4A3LH 1PFSA 1BCPC 3OTOQ 3KFUA 3BU2A 2BH2A 1JJCB 2PNRC 4IUPA 4XT1B 4AQYL 2EXDA 1WCMG 1PA6A 2K05A 5JPMC 1SLJA 2WKDA 1K83H 4LK1C 2AUJD 2EYMA 1SSOA 3L9AX 2ZTCA 1B53A 3STBC 4JOIA 4HJAA 4UP7A 1U4PA 3FRPB 1K83B 3TQYA 1A3TA 4DV3Q 3DWQA 5KGUA 5J22A 1RDPD 1YNJD 4Y52H 2ZJQA 3BVZA 1DOMA 3RN2A 1L2FA 4CHTB 3JAME 2Q2TA 2F4IA 3KBXA 1NY4A 5JEAJ 1ILPA 3VDYA 2NWGA 4FXKC 3ZYYX 2VQFQ 4JI1L 2K50A 1L1OA 1T5XD 2F0QA 1H9RA 2C5CA 3T4AC 1G2SA 1R9TH 1KQSA 2KCTA 2BA0A 1E24A 5FO9B 1VQPA 2E74C 4JYAQ 2R93H 2IL8A 3X3NA 1S40A 2A6ED 1R9TB 4TKOB 1DGSA 4L5SA 2B2WA 2KEDA 1N34L 2R93B 1BF4A 4BY1H 2KECA 4HMIA 1SNOA 1F9RA 3D6CA 2K03A 3NP8A 1AE2A 4BY7H 4KJOA 4BY1B 2PMZB 2X6LA 3NSWA 2K6AA 4H0LC 3CMEA 4IFDI 4FNFA 2ZTEA 3J7ZC 3TS2A 2IPKD 5LMUQ 1YHAA 1HH2P 3MXGA 4DK0A 4N8FA 2V1CC 2MUYA 4GNXA 4BBSH 4K14A 1V1PB 4JI7Q 1OXSC 4IN3A 4XTCS 2DY8A 2KQ3A 1UNSA 4BBSB 3FPPA 2OCEA 1CA6A 4OO1H 3TN2A 5FLXL 2EY6A 5F2DA 3M85A 1GD7A 1VQ6A 1SNMA 1WFQA 1FL0A 1VQBA 2K28A 1I4RA 1RODA 3C1EA 4QUFA 3UDXA 3G4SA 1XNRQ 4V0BA 1IBLL 1MJCA 3T56B 2WACA 4NXML 1STNA 1UEBA 2A6HC 3OPOA 4YWKA 1SE3A 2BCOA 3LGJA 3ERQA 3I70A 3SK5A 4KKSA 1F2LA 3PMFA 1VQDA 4UP8A 3I4LA 4OHJA 3RLOA 2KA7A 2PZTA 5IGCA 5IODA 1DD2A 1E2ZA 4KHPL 5IGDA 5KNDA 2IJ0A 3DHQA 1VQAA 3CCLA 3S15H 4IUUA 1N36L 2K33A 3SXHA 1PRTD 4JI5L 3OIPA 2PZWA 5IYBG 1HA5A 3OMGA 3A54A 1KXLA 2F0GA 4A3DG 1L1OB 2C9OA 3S15B 2B8GA 2Z6KC 5FLMH 1V9PA 4GZYC 4HAEA 4DU9A 5M5YH 1B1ZA 4LF5L 2F0VA 3ER0A 2IHEA 3QO2A 3G71A 1HFGA 1HNXQ 2IWHA 3A8KE 4M1UB 3R2TA 5M5YB 3U4VA 3NWSA 1AFPA 1UAPA 2OWOA 1NSNS 1HXYD 1TS3A 5K36H 1B44D 4B3TL 2PNHA 5EBDA 1PH7A 1PVOA 2VUMG 1SMYD 2UXCQ 2F0JA 5BN3A 4JI1Q 1CKNA 1EIYB 3MXUA 2OXPA 3FMCA 4J15A 1ZYRD 4EGVA 2DJFC 5ELFA 1IYUA 1QE6A 1CKOA 3QR8A 4C3IH 3TDQA 3GD7A 2YU9H 2JA5G 5IT9c 3S1NB 3VA5A 4H7BA 4X3UA 4C1NI 4PV1C 4GLXA 1NMGA 5LMNQ 4C3IB 4CDEC 1N34Q 1SFOH 1Q86C 1CTMA 5EBCA 4A3KH 4A3IB 1IBKL 2YU9B 2K5NA 5CV4A 3KUPA 2DGYA 4K6DA 4WFN3 1SFOB 1SYBA 5I9PA 3M4OH 4DR7L 2RQXA 5CBAE 2UUBL 4RH6A 1CI3M 1LTRD 1NE3A 5C6AA 3M4OB 5KIXA 1Q1BA 1QUQA 1RJTA 2B2TA 4FXDA 3TP8A 2F0PA 1Y1VG 4RKBA 3A5ZB 2IX3A 4FVMA 3ICEA 5C44B 2A68D 1PLFA 2F4VL 4B3SL 2MO1A 3U9OA 3I4NH 4A75A 4A3LG 3NXWA 4JPBW 4LFAL 3PUWA 1IBLQ 2F0HA 1WTVA 3D4DA 1QZHA 4X3TA 4NXMQ 3I4NB 1HZBA 3IRBA 4CKCA 2K7VA 1LTID 1KNAA 2HHHL 1IL8A 3S2DH 2RA4A 2SDFA 5CV5A 4DR1L 1B7YB 4N9TA 3GTPH 4CDDC 1BCPF 4C3JH 2EVBA 2XNAC 3S2DB 3MWYW 2QEXA 2RSNA 2YV5A 4LF8L 5KYIA 3MXPA 3G6JB 3GTPB 4DV4L 2RBMA 4P71A 2Z0SA 4ALPA 4JI5Q 4C3JB 5E1FA 1D1KA 3M4YA 1J8IA 2JEAI 5C3EH 2IT1A 1DCZA 4QUCA 4GKJL 4C3HH 5C3EB 3Q0AA 2KJXA 2E2IH 4EQPA 2M2LA 3GO5A 1HA6A 5E7NA 5IT9L 5C0XJ 3A55A 4C3HB 1AZPA 3W1GA 1LO5D 1TT2A 2B29A 4B3TQ 1PFMA 2E2IB 1TWCB 1K8GA 4B3RL 2A74C 2WB1G 4LF4L 3E5SA 2ASBA 5G3LD 2JA8H 1B8AA 5LL6S 1S5CD 1C7YA 2SEBD 4BY1G 1H9JA 1AW7A 4NKLA 1MGSA 3HOYH 1HR0W 2JA8B 4OX9Q 2HQLA 4BY7G 5IWAQ 1H9KA 2EE1A 3U9SA 3FPUB 4ULLA 4R4QA 2NVTH 4J6HA 1QUQB 3SGIA 3I73A 3HOYB 2QCPX 3ULJA 2F0LA 4KHVA 4YCWA 3A8JE 1IZ6A 4DR5L 3FDTA 4JCVE 4BBSG 4NXNQ 2NVTB 4O42A 2E5LL 4DNIA 3MEHA 5FKAC 1A0IA 1EIGA 1PTOC 4LAAA 4ZRZA 3DLLA 1ZEQX 4PNYA 4DV6L 2OQ0A 3BG3A 3EROA 4XDXA 2RDGA 4DNTB 1PH1A 2JP1A 2UXDL 5CV7A 1T5EA 4Y7NH 1CZGA 1YITA 2CVRA 2B2UC 4YY3L 2UU9L 2L15A 5KRUA 2AQ1B 4I65A 2QGQA 4RCNA 3W5OA 3URYA 1A8VA 2QKIC 4PZ8A 5CC4A 1Y8PB 3WDNA 3CCRA 2F4VQ 1A3UA 5BR8L 3UDGA 5C4XH 4FF2A 1F2MA 3J80c 3D3RA 3H3VH 1O7IA 2LXKA 4HIKA 4GS3A 3M9BA 3R2IA 4CJ0B 1A2UA 4BBRH 4ZUIA 4UY8C 2L5TA 3TSSA 3NQTA 1AZQA 2K5QA 3N6RA 3NELA 1HUMA 3D4WA 4CDFC 5M3FB 2HHHQ 2PI2A 3QG1A 4BBRB 4DR1Q 4IPCA 3CAMA 1I6HB 1TWGH 1B3AA 4OIKA 2XRQD 2MNAA 4IOAA 1ML0D 1Y69U 2O5IC 1WTQA 2XWBB 3OIQA 1TWGB 3VR2A 3PIPA 4K0KL 1JICA 5FO8B 1HQMC 1Q1EA 2QW7A 3L0OA 1EFWA 1G6PA 5JPNC 1XPRA 4DR2Q 5K36G 3MHBA 2ZJRA 3E0JA 5FLXE 1HUNA 4K2KA 2Y0SE 2RHQB 2JA6H 5EPKA 4KKTA 3I2ZA 3CCUA 3K6OA 1RCVD 1EY0A 1DJRD 4F8MA 4DV1Q 2JA6B 5BN4A 3AEVA 1ENFA 4NW2A 4C3IG 3P7JA 3D31A 1GHJA 4Z9CB 1GVPA 4B3RQ 3K59A 2K32A 4L63B 5K5PA 1I6VC 1Q3LA 5CV8A 4A3KG 2WKCA 1EU4A 4RG1A 2IX1A 5H1SE 3P20A 3PO3B 4KI0A 4KD4A 4QF4A 1PXUA
chains in the Genus database with same CATH topology
2FMCA 1W6JA 4K5XA 5BN5A 1IKMA 1HCZA 2EY1A 2WV6D 3SE0A 3SK6A 3OOCA 1D6EC 3TMEA 2L11A 2F0NA 1BNZA 3HKZB 3ND9A 5IOCA 4C2MB 3ITPA 5KYLA 4UDUC 4IUTA 1OXUA 2M00A 2EJFC 4RKLA 1TWAB 4IFDJ 4C3JG 3K5OA 1EY7A 1Z47A 4J8QA 4HN7A 1CQVA 2X69A 3NUCA 1WTRA 3OWFA 2L55A 5KNCA 3S17B 4KY5A 1ESRA 3QB3A 1MD2D 4HCEA 3CKIB 1EY8A 1MSGA 2E2HB 3I3CA 2JEBI 4A3JB 1ENCA 2R7ZB 1F2ZA 1I3QB 1LTGD 1SYDA 3PUZA 3VYRA 2JYOA 2EPBA 2Z4IA 5KEEA 2A6HD 5EQ0A 1WD1A 4TRDA 2B2VA 1LTBD 3J7AF 1GXDC 4ZUJA 1STBA 4KV6A 4QIWB 1PDQA 2LFNA 3NQIA 3QOJA 3IL8A 3M3YB 1PZID 3K5LA 3NTKA 4K2LA 3GTMB 2PYKA 3VA7A 4F7XA 4RGMA 1PTOF 1AP0A 1NCVA 2K01A 3S14B 1D1IA 1QJOA 1CQFA 5IT9E 4XIGS 1BOSA 5IGFA 4PQXA 1LACA 1BUVT 3S1QB 2B2WC 1HRJA 1KDAA 5DEHA 4PMBA 3QOLA 2ENBA 1STAA 4G7OC 4DXGA 1LT4D 3VYUA 3OSOA 3VYTA 3S2HB 3KK7A 3QJYA 1LLRD 2Q8TA 1KAAA 2AQ3B 2ID0A 1I4HA 1D2BA 4K5WA 2DNCA 3SK4A 4R9WA 1H9SA 3T13A 5DM73 5JEAH 4G57A 5E3FA 3IAYA 3A7LA 1S4ZA 3TZUA 1EZ6A 1EOTA 3A56A 1DM0B 2NVXB 3BZDB 5C3WA 1NAPA 4RA8A 2F03A 3M7NA 1U9RA 2NYZD 2K5WA 1X3PA 3EQLC 2B63B 3WOFA 4DGZA 3MAQA 1KNEA 1KDBA 3CU7A 3IFTA 3I4MB 4EQNA 1KABA 5A2QL 1EEFD 2LMCB 1STHA 3H6MA 1RTOA 3HOZB 1EEID 4RHSA 3V96A 1VMCA 1KDCA 2E75C 1JORA 2TMPA 1AN8A 1GUWA 1EY9A 1SYFA 3S1MB 1B4OA 2F0IA 2NUCA 4Q0FA 4KTAA 2F0FA 1X3QA 3AU7A 1LABA 5KNBA 1D5XC 3BYYB 4XYOA 1TWHB 2A69C 1SE4A 1ESFA 4NP5A 1LTSD 3RLFA 1ICWA 1KTKA 3DMUA 2FFKB 1FNVA 5HGTA 1H9SB 2FINB 3MTSA 3GTJB 4DN4M 1BCPB 1WTWA 2OEOA 1I4QA 3IKJA 2K1BA 4K6LA 5I4DA 1FYCA 1E2VA 2CW0C 4IUVA 2DY7A 1XYIA 3MZ5A 5D14A 1PTOD 1OXXK 2PW7A 4KJNA 3I8ZA 3V05A 2BOSA 3P1HA 1LV9A 2EOTA 2KOLA 2FMMA 1K8MA 4DFAA 4H44C 4P2CB 2AWNA 1SE2A 2EYOA 2O5JC 1CA5A 3I91A 4A3BB 1G91A 4X3KA 1TIID 5ELBA 2EDGA 3RZDB 5EKIA 1BO0A 1XWEA 4J1MA 3DWPA 3K57A 1DOLA 2H1EA 2KUMA 2A6EC 2F0KA 4CKBA 4KKUA 1BQQT 1F9PA 3BYTB 2F0WA 3SK8A 4TQUS 5ELEA 5I9OA 1Y8NB 3HG9A 2LS01 1E2WA 2SOBA 2KEEA 3A7AB 3GTLB 5IGGA 4CGYB 2NVQB 3TP7A 3K5MA 2EYFA 3OW7A 2EYLA 3UI2A 3RZOB 1OXTA 2HDMA 1KLUD 2E2DC 3BS1A 5EKLA 4RFBA 1TQOA 3BVMA 2BDNA 3C1FA 1I50B 1S5BD 1G291 1JQYD 1YNNC 1TS4A 1JOOA 3MXNA 4I7ZC 2E76C 2R3ZA 4B9XA 2PW5A 2WIIB 2F3WA 2B2YA 4CKEA 5DAUA 2B8FA 1PRTC 4NMZA 5ISRA 5C0XH 1M8AA 4IZ8A 3GTGB 1EWHA 4OGQC 2K5DA 1PMRA 2XRSD 2R61A 1F9SA 1QOHA 1PYWD 1SAPA 1CHPD 4V190 3GP7A 2E2JB 2WINB 4RGOS 1NR2A 4DAVA 4C1NK 3C3LA 1L0XB 4OO1G 3HZXA 3MC0B 2F0SA 1SMYC 2EYPA 1AEXA 4RCOA 2CQAA 1LT3D 1ZYRC 5C5LA 5DM63 1QNKA 2HCIA 2LKVA 2BE5D 4XQJA 3H0GB 4DXFA 5AFWA 4KY6A 2F0UA 3FVQA 4FXGC 1STEA 2LY7A 3R8BA 1HPCA 3VR6A 1GUNA 1A3VA 1D5MC 1JWSD 1DONA 5CBEE 4IQZA 4JK1C 1QB5D 5I6YA 4KN4C 2KCNA 4ID6A 1JC7A 3I90A 3G7LA 3I72A 2F0MA 1R4QB 4F87A 3FEWX 1Z6HA 1K8OA 1WCMB 1I4GA 2Y0SB 2QILA 4HSVA 2Z1CA 4DAYA 3D4RA 4A3MB 2A68C 2XSCA 5A2QE 4R8NA 2BDOA 1SNQA 1BR9A 4X3SA 2WP8J 3H09A 3AB9A 2NN6H 2RSOA 5T1IA 2B2UA 2FJ2A 5D65A 1QG7A 2TSSA 3NK9A 3SEBA 1TR5A 1JOQA 1NR4A 3PIP3 3J7YW 5E4WC 4HR7B 3VR3A 1STGA 4FP5D 4ILWA 1BCPD 4MHEA 1F9QA 2D62A 5I2YA 4N9PA 4A3FB 4XXEA 3GQBA 1I4XA 1SDFA 3EVQA 1GUGA 5LHY1 1IYVA 5CORA 1EZ8A 1WTXA 3J80L 1E0BA 3NPPA 1PFNA 1II3A 2R6GA 3J7AV 2A73B 3SR1A 1B2TA 1V43A 5E4XA 1PTOH 1VDZA 1TY2A 3S1RB 3OHXC 3MA2B 5IGEA 1CK1A 2FHTA 1SNCA 4OIJA 1PTOB 2JA7B 2RDHA 3J81L 1OO9B 5ELCA 2G9DA 3CQZB 2VNUD 4IFDH 1F77A 2R92B 5J39A 2O2LD 5C4JB 4A3DB 2B2VC 4C3HG 4TSSA 2Z8LA 1EIHA 4LMQD 4L6TB 2HQEA 5C5MA 5COYA 1CZWA 1B9NA 5EGTA 3CHBD 1WTOA 1IKLA 2L12A 2QDBA 4ZAIA 2PQEA 2EYJA 1CHQD 1BBXC 1VF7A 2VUMB 3HEJA 2F1MA 2F0DA 2ZXOA 1SYEA 5C0XG 3RD4A 1SJED 5CV9A 1S5FD 5D3DA 2PO4A 3A8IE 3DEPA 1EYAA 1IHZA 3H94A 1U4RA 3VR5A 1B50A 3WOEA 1RHPA 2VB3X 1PRTF 4HEDA 1SNPA 3FKIB 3BDOA 1VF5C 5NUCA 3EFXD 3M7GA 4IALA 2MPMA 3HRZC 4XYQA 1F2YA 1U4LA 3R3OA 2XN9C 1TS2A 1EY4A 1JR0D 1G6ZA 1Y1VB 2CW0D 5I6WA 1WD0A 1IW7C 2L9HA 2KHSA 3HOWB 2PZUA 2G9HD 3VYSA 3W3AA 4CJ2C 3LNNA 4KMUC 1RF2D 3IFDA 1Q90A 1GJXA 2Z4HA 3Q22A 1EU3A 4ZKCB 4U68A 3F2UA 4UAIA 1B9MA 3DWAA 1STYA 2L4NA 3Q24A 2NTTA 3PUVA 3QWNA 5EJWA 1EFID 2NN6G 3GV3A 2Q8RE 3KLSX 2EXZA 2L1BA 1PZKD 3S16B 1V1OA 4JBWA 3MFYA 1SYGA 1EQVA 5HURA 1O78A 2PPBC 1ZXTA 4HTHA 5M9OA 4XT3B 2XIWA 1MSHA 4NDXA 3OWEB 4G7HC 5FO7B 2WB1B 3SVMA 2OT2A 5TSSA 5C4ZA 1WVLA 4QB4A 2J4XA 5IGBA 4KHZA 3D6WA 4R8IA 4BY7B 5CR3A 4FF3A 4FYDA 4BS9A 1CT1D 2D5DA 4IUQA 2H4OA 1JWMD 2N88A 4RAUC 2IW3A 4ZYSA 1EQTA 3PIO3 2NZ1D 3KLSA 2A5HA 1DYQA 1FNUA 1HTLD 2J0TD 2NTSA 4DK1A 1SJHD 3DEOA 1R4PB 2RVLA 3L7ZC 5CMDA 3W2DA 4MIUA 4E6IA 2YYZA 2ZXRA 1YNND 5G3LF 1GOZA 4BWGB 1FNWA 3V2TA 3ND8A 2MJ8A 3EA6A 2V4DA 1HFNA 2WAQB 1PFBA 4RHRA 4RWSC 3NTHA 1Q12A 1RD9D 5CYUA 4IFDG 1TY0A 2AWOA 4M8AA 3AMUA 4ABNA 2QF7A 4DF7A 2VB2X 4C56C 2EJMA 5A35A 5JOBA 2B2TC 3HGBA 1GUOA 1M4VA 3J80E 4WORA 3K7AB 4FF4A 1JCKB 2IX0A 2QEJC 1DZ1A 1FR3A 2RDFA 1YNJC 2Q8IB 1TU2B 5ELDA 3TBIB 1ILQA 1SEBD 5IIFA 1UEAB 3K5NA 5EPJA 3PV0A 4XQQA 4DAPA 3BVGA 5LL6X 3HP3A 1ET9A 2EY5A 1SXTA 3J81E 3BDLA 4QMGA 2X6GA 4A3KB 3O13A 3H3VC 1C48A 2JXMB 4L8JA 5M5XB 2F0EA 3X3MA 1XTCD 2CHBD 2ZT9C 3T51B 1EY5A 2XVSA 3Q6SA 4FO2A 1HHVA 2DN8A 2B2YC 1RTNA 3DUZA 2BA1A 4WJWA 4OO1I 4ZQ3A 1VMPA 3MVVA 5FK9C 3K0YA 4PMWA 2RKSA 2OF1A 3ONAB 1ZKOA 1MI2A 3LX0A 1LT5D 3VR4A 2K04A 2AUKA 1NUCA 4K8JA 3TP5A 3H91A 1Y1WB 1LT6D 2F0OA 3RUZA 1TS5A 5JEAG 2J7ZA 3KBGA 4HSPA 1C4QA 3D8GA 1BDOA 4ZLTF 2EYHA 1QWYA 3PUYA 1QILA 4MN3A 4OL7A 2DNEA 3LWEA 1A15A 1PZJD 5CGKA 4KK7A 3GV6A 1EYDA 3NBIA 2KVMA 3L3OC 2M9VA 2NBFA 2PCFB 4ODGA 3PO2B 3JAML 1RKNA 4BA2I 3EJIA 1XXGA 1GHKA 2HUGA 3R93A 5JAVA 4WRDA 4XQNA 2B39A 4CJ1B 5T1GA 1TWFB 5M3MB 3OMCA 1G8ZD 5JVG3 1DOKA 2JSOA 1VCIA 4AYBB 1UUPA 3KF8A 2D2CC 3SHLA 1TVXA 1BXTA 1D5ZC 4K5VA 4PMCA 5JJZA 2F0TA 1SBBB 4ZK9B 4Y7NB 1V8QA 2MHVA 3PUXA 1FD7D 4A93B 5FOBB 3T16A 1DXMA 1EYCA 2I46A 1FGBD 4O1NA 2L0CA 3T53B 5JVH3 1S5DD 5EKKA 2KCCA 2EJGC 4RGTA 1QNUA 2ICEC 5C4XB 1O7ZA 2JE6I 3GTKB 3BDCA 4CBVA 4ZKBB 3KLRA 4LJZC 2N55A 1I4PA 4EQOA 1U4MA 3NTIA 2F3VA 1S5ED 4KY7A 2SNSA 3E6ZX 4BA1I 5M5WB 4RGNA 1W6KA 3HOVB 3GTQB 1XX8A 3NBHA 1ONLA 1JE4A 4QCLA 4FF1A 3GTOB 1EL0A 4EVOA 1JWUD 2MP1A 2GA4B 2I07B 4F88A 4DA2A 3RMHA 3SDZA 2EY2A 4G4KA 1IW7D 5I2XA 4KD3A 2AQ2B 1EWCA 1OXVA 3P75A 1GUTA 3LWUA 1O7YA 1PRTB 1Y8OB 3NHHA 1JOKA 2EZVA 1CM9A 2XWJB 4DNRB 5D3IB 3TP6A 4U673 1HTPA 5C0XI 1A6XA 4K8IA 1SYCA 3CRLC 1LTTD 3MFGA 3CRKC 4HMJA 1QCBD 2HCCA 1KLGD 4YIJA 3QIAA 1Z7TA 4A3EB 5C4HA 2D9UA 5EPLA 4IURA 4KN7C 3S9WA 1SNDA 3HOXB 3HS0C 4B9WA 4IUNA 5CV6A 1ENAA 1O80A 1TKWB 3K58A 1G2TA 2BE5C 5J1ZA 3C2PA 4A3GB 3TZDA 1HQRD 4B08A 3HOUB 1MBYA 2VXWA 3NWTA 3N52A 3NE5B 4HCSA 4H13C 5DNFA 4S3SA 2SNMA 2ZXPA 1ET6A 1A2TA 3Q23A 1J9OA 4G7ZC 3C46A 2JA5B 1Q8IA 3DM1A 4ME5A 1WTPA 4Q5VA 2MGSA 1JB3A 2A69D 1L0YB 2NN6I 1CFMA 1H9MA 2O4XA 5C3XA 2NB0A 2NVYB 1LTAD 2HDLA 1O7LA 1X32A 1C8CA 2ICIA 1V1PA 1EY6A 1GUSA 3DXJC 1BCPC 2PNRC 4IUPA 4XT1B 2K05A 5JPMC 2WKDA 4LK1C 2AUJD 2EYMA 1SSOA 3L9AX 1B53A 1U4PA 3FRPB 1K83B 1A3TA 3DWQA 5KGUA 5J22A 1RDPD 1YNJD 3BVZA 1DOMA 3JAME 4CHTB 2F4IA 3KBXA 5JEAJ 1ILPA 2NWGA 4FXKC 3ZYYX 1T5XD 2F0QA 1H9RA 2C5CA 3T4AC 1G2SA 2BA0A 5FO9B 2E74C 2IL8A 3X3NA 2A6ED 1R9TB 4TKOB 2B2WA 2KEDA 2R93B 1BF4A 2KECA 4HMIA 1SNOA 1F9RA 3D6CA 2K03A 3NP8A 4KJOA 4BY1B 2PMZB 2X6LA 3NSWA 2K6AA 4H0LC 4IFDI 4FNFA 2IPKD 3MXGA 4DK0A 2MUYA 4K14A 1V1PB 1OXSC 4IN3A 4XTCS 2DY8A 2KQ3A 1UNSA 4BBSB 3FPPA 1CA6A 4OO1H 3TN2A 5FLXL 2EY6A 5F2DA 3M85A 1SNMA 2K28A 1I4RA 1RODA 4QUFA 3C1EA 4V0BA 3T56B 2WACA 1STNA 2A6HC 3OPOA 1SE3A 2BCOA 3ERQA 3I70A 3SK5A 4KKSA 1F2LA 3PMFA 3I4LA 4OHJA 2KA7A 2PZTA 5IGCA 5IODA 1DD2A 1E2ZA 5IGDA 5KNDA 2IJ0A 3DHQA 4IUUA 2K33A 3SXHA 1PRTD 3OIPA 2PZWA 1HA5A 3OMGA 3A54A 2F0GA 2C9OA 3S15B 2B8GA 4GZYC 4HAEA 4DU9A 1B1ZA 2F0VA 3QO2A 1HFGA 2IWHA 3A8KE 4M1UB 3R2TA 5M5YB 3NWSA 1AFPA 1UAPA 1NSNS 1HXYD 1TS3A 5K36H 1B44D 5EBDA 1SMYD 2F0JA 5BN3A 3MXUA 2OXPA 3FMCA 1ZYRD 4EGVA 5ELFA 1QE6A 1IYUA 3TDQA 3GD7A 3S1NB 3VA5A 4H7BA 4X3UA 4C1NI 4PV1C 4C3IB 2YU9B 1CTMA 5EBCA 4A3IB 5CV4A 3KUPA 4K6DA 4WFN3 1SFOB 1SYBA 5I9PA 2RQXA 5CBAE 4RH6A 1CI3M 1LTRD 5C6AA 3M4OB 5KIXA 1Q1BA 1RJTA 2B2TA 4FXDA 3TP8A 2F0PA 4RKBA 2IX3A 4FVMA 5C44B 2A68D 1PLFA 3U9OA 3NXWA 3PUWA 2F0HA 1WTVA 3D4DA 4X3TA 3I4NB 4CKCA 2K7VA 1LTID 1KNAA 1IL8A 2RA4A 2SDFA 5CV5A 4N9TA 1BCPF 2EVBA 2XNAC 3S2DB 3MWYW 2RSNA 5KYIA 3MXPA 3G6JB 3GTPB 2RBMA 4C3JB 5E1FA 1D1KA 3M4YA 1J8IA 2JEAI 2IT1A 1DCZA 4QUCA 5C3EB 3Q0AA 2KJXA 4EQPA 2M2LA 3GO5A 1HA6A 5IT9L 5C0XJ 4C3HB 3A55A 1AZPA 1LO5D 1TT2A 2E2IB 1PFMA 1TWCB 2A74C 3E5SA 5G3LD 5LL6S 1S5CD 2SEBD 1H9JA 1AW7A 4NKLA 1MGSA 2JA8B 1H9KA 2EE1A 3U9SA 3FPUB 4ULLA 4J6HA 3I73A 3HOYB 2QCPX 2F0LA 4KHVA 3A8JE 3FDTA 2NVTB 4O42A 3MEHA 5FKAC 1EIGA 1PTOC 4LAAA 4ZRZA 1ZEQX 4PNYA 3BG3A 3EROA 4XDXA 2RDGA 4DNTB 2JP1A 5CV7A 1T5EA 1CZGA 2CVRA 2B2UC 5KRUA 2AQ1B 4I65A 4RCNA 3URYA 2QKIC 5CC4A 1Y8PB 3WDNA 1A3UA 4FF2A 1F2MA 3D3RA 3R2IA 4CJ0B 1A2UA 4ZUIA 2L5TA 3TSSA 3NQTA 1AZQA 2K5QA 3N6RA 1HUMA 3D4WA 5M3FB 3QG1A 4BBRB 1I6HB 1B3AA 4OIKA 2XRQD 1ML0D 1Y69U 2O5IC 1WTQA 2XWBB 1TWGB 3OIQA 3VR2A 1JICA 5FO8B 1HQMC 1Q1EA 5JPNC 5K36G 3MHBA 3E0JA 5FLXE 1HUNA 4K2KA 5EPKA 4KKTA 3K6OA 1RCVD 1EY0A 1DJRD 4F8MA 2JA6B 5BN4A 1ENFA 4NW2A 4C3IG 3P7JA 3D31A 1GHJA 4Z9CB 3K59A 2K32A 4L63B 5K5PA 1I6VC 1Q3LA 5CV8A 2WKCA 1EU4A 2IX1A 3PO3B 3P20A 4KI0A 4KD4A 4QF4A 1PXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM L;  5LL6 X;  3J80 L;  3J81 L;  5A2Q L;  5IT9 L;  3J7A V;  5FLX L; 
#chains in the Genus database with same CATH topology
 3AFQ A;  2FMC A;  1W6J A;  4K5X A;  5BN5 A;  1IKM A;  1HCZ A;  4DV6 Q;  2EY1 A;  2WV6 D;  1W3S A;  4A3E H;  3SE0 A;  4JI8 Q;  4A3C G;  3SK6 A;  4HID A;  2UXD Q;  3I4N G;  3OOC A;  1HZA A;  2RCN A;  4R4T A;  1D6E C;  3TME A;  2L11 A;  4C2M H;  2F0N A;  4LFB Q;  4X6A H;  1BNZ A;  4YY3 Q;  2UU9 Q;  1PH9 A;  3HKZ B;  3K0X A;  3ND9 A;  5IOC A;  1VQH A;  4C2M B;  3ITP A;  5KYL A;  4UDU C;  4OWX B;  4IUT A;  1OXU A;  2M00 A;  2EJF C;  4RKL A;  1TWA B;  3KF6 B;  2K14 A;  4IFD J;  4C3J G;  3K5O A;  1EY7 A;  1Z47 A;  4J8Q A;  3HKZ E;  4HN7 A;  1PH2 A;  1CQV A;  2X69 A;  3NUC A;  3S17 H;  4JBM A;  1WTR A;  1IXR A;  3OWF A;  2L55 A;  1VS0 A;  1N9W A;  4QGU A;  3G6E A;  5KNC A;  4BXX H;  3S17 B;  1SE8 A;  3G48 A;  3KJO A;  5C3E G;  4YCU A;  4KY5 A;  2R7F A;  2OTJ A;  4JI0 Q;  1ESR A;  5GAE C;  5AJ3 Q;  1MKH A;  3QB3 A;  4K0K Q;  1MD2 D;  4HCE A;  3CKI B;  2E2H H;  2GN5 A;  1EY8 A;  4WJ4 A;  1MJE A;  1MSG A;  4A3J H;  2E2H B;  3PF5 A;  3I3C A;  5LMU L;  4O0A A;  2R7Z H;  1I3Q H;  4HIO A;  1S72 A;  2JEB I;  3PO2 G;  4A3J B;  2JA8 G;  1ENC A;  2R7Z B;  1F2Z A;  1I3Q B;  1LTG D;  1SYD A;  3PUZ A;  2A19 A;  3VYR A;  3HOY G;  2JYO A;  2EPB A;  2Z4I A;  5KEE A;  2A6H D;  5JJK A;  5EQ0 A;  4P73 A;  1WD1 A;  4TRD A;  3EIV A;  2AHO B;  2B2V A;  1XNR L;  1LTB D;  3J7A F;  1GXD C;  2YTX A;  4ZUJ A;  1NJI C;  3E9H A;  3M3Y H;  1EIF A;  4IJL A;  1K9M C;  4AYB G;  1STB A;  3ULL A;  5IE8 A;  4KV6 A;  4QIW B;  1PDQ A;  2LFN A;  3NQI A;  3GTM H;  1KD1 C;  3QOJ A;  3IL8 A;  3M3Y B;  2K75 A;  1PZI D;  2D0P A;  2F3I A;  2PQA A;  3K5L A;  3NTK A;  4K2L A;  4A93 G;  3OYY A;  1I94 L;  3GTM B;  1EWI A;  2KBN A;  3S14 H;  2PYK A;  5GAH C;  3VA7 A;  4F7X A;  1IBM L;  4RGM A;  1PTO F;  4QIW E;  1AP0 A;  1NCV A;  2K01 A;  3S14 B;  1JJ2 A;  3S1Q H;  1D1I A;  1QJO A;  1CQF A;  5IT9 E;  4XIG S;  4HJ9 A;  1BOS A;  1KRS A;  2XTI A;  5IGF A;  2JQO A;  5C4X G;  4PQX A;  1LAC A;  1BUV T;  3S1Q B;  2B2W C;  2ES2 A;  1HRJ A;  2CQO A;  1KDA A;  5DEH A;  4PMB A;  4BBR G;  3QOL A;  3S2H H;  2ENB A;  1STA A;  1HNX L;  2GVA A;  4G7O C;  5ELN A;  4DXG A;  1LT4 D;  4X62 Q;  3VYU A;  3OSO A;  3VYT A;  1YHB A;  3S2H B;  3KK7 A;  3QJY A;  1LLR D;  2Q8T A;  1KAA A;  2UXC L;  4QQB X;  2AQ3 B;  2GVB A;  1HNZ L;  2ID0 A;  1XMQ L;  3HOV G;  1I4H A;  2BH8 A;  1D2B A;  4K5W A;  4GNX C;  4DR3 L;  1K73 C;  2ZJP A;  1PHJ A;  2DNC A;  1VQK A;  3SK4 A;  4R9W A;  1H9S A;  3T13 A;  5DM7 3;  5JEA H;  4G57 A;  5E3F A;  2NVX H;  1CSP A;  3IAY A;  3A7L A;  5LMN L;  4DR6 Q;  1S4Z A;  3TZU A;  2JA6 G;  1Z9F A;  3CC4 A;  1EZ6 A;  1EOT A;  3A56 A;  1DM0 B;  2NVX B;  3BZD B;  2VS1 A;  5C3W A;  1NAP A;  5IP7 H;  4RA8 A;  2F03 A;  1VQO A;  3M7N A;  1U9R A;  2NYZ D;  1JJG A;  2K5W A;  1X3P A;  3EQL C;  2B63 B;  3WOF A;  4DGZ A;  2HIV A;  3I4M H;  3MAQ A;  3PIO A;  1KNE A;  1KDB A;  3CU7 A;  3IFT A;  3I4M B;  1UE1 A;  4EQN A;  1KAB A;  2PQA B;  5A2Q L;  3HOZ H;  1EEF D;  2LMC B;  3KOJ A;  1STH A;  1VQG A;  4RMF A;  4X64 L;  4PZ6 A;  3H6M A;  1RTO A;  3HOZ B;  1EEI D;  4RHS A;  3S1M H;  3V96 A;  1VMC A;  1KDC A;  2E75 C;  3CPW A;  2TMP A;  1JOR A;  1OTC A;  4NPS A;  2VW9 A;  4LUO A;  1AN8 A;  1GUW A;  1EY9 A;  1SYF A;  3CCE A;  3S1M B;  1B4O A;  1BVS A;  2F0I A;  4A3E G;  1AE3 A;  5FJ8 H;  4TVA B;  2NUC A;  4Q0F A;  4KTA A;  3HKZ G;  2Q2U A;  2F0F A;  3CCQ A;  1E1T A;  1I94 Q;  1X3Q A;  1TWH H;  3AU7 A;  1LAB A;  5KNB A;  3HOX G;  1IBM Q;  1D5X C;  1K8A C;  3BYY B;  4XYO A;  1WJJ A;  1TWH B;  2A69 C;  1SE4 A;  1ESF A;  4NP5 A;  1LTS D;  4L5T A;  1VQN A;  4MTK A;  4L5Q A;  3RLF A;  1ICW A;  1KTK A;  3RR5 A;  3DMU A;  2FFK B;  1FNV A;  5HGT A;  2UXB Q;  1H9S B;  2FIN B;  3MTS A;  1K0R A;  4A3G G;  5JJL A;  3GTJ B;  3CCS A;  4DN4 M;  1FJG L;  1BCP B;  1WTW A;  3HOU G;  1VQJ A;  1I4Q A;  2OEO A;  3IKJ A;  1WI5 A;  2K1B A;  4K6L A;  5I4D A;  5L37 A;  1FYC A;  4JVZ A;  4R4O A;  4BXX G;  1E2V A;  2CW0 C;  1XPO A;  3F1Z A;  4IUV A;  2N78 A;  1HNZ Q;  1XMQ Q;  2DY7 A;  1MIU A;  4DR3 Q;  2WAQ E;  1XYI A;  3S1N H;  3MZ5 A;  5D14 A;  4OX9 L;  1PTO D;  5IWA L;  1OXX K;  2PW7 A;  4KJN A;  4A3J G;  4JG2 A;  4A3I H;  3I8Z A;  3V05 A;  2BOS A;  3P1H A;  1Y14 B;  1C0A A;  1LV9 A;  1YVC A;  4IPD A;  2EOT A;  2KOL A;  4NXN L;  2FMM A;  1K8M A;  4GLV B;  4DFA A;  4H44 C;  4A3B H;  4P2C B;  2AWN A;  2UUC Q;  3J7A 5;  4N8X 1;  2Z6K A;  3DM3 A;  3RZD H;  1SE2 A;  2EYO A;  2O5J C;  1CA5 A;  3I91 A;  4A3B B;  2IY5 B;  1HJP A;  1BKB A;  4X3K A;  1Q81 C;  1QZG A;  1G91 A;  1TII D;  5ELB A;  2EDG A;  1PH6 A;  4JI6 Q;  3RZD B;  5EKI A;  1RIP A;  5C44 H;  2YTY A;  1BO0 A;  1E1O A;  1XWE A;  4J1M A;  3DWP A;  2I0Q A;  4X64 Q;  3K57 A;  1DOL A;  2H1E A;  2KUM A;  2A6E C;  2F0K A;  4CKB A;  2I5H A;  4KKU A;  1BQQ T;  1F9P A;  3BYT B;  3EN2 A;  3K81 C;  2F0W A;  2QA4 A;  1E22 A;  4LUZ A;  3SK8 A;  3EBE A;  4TQU S;  3M4P A;  5ELE A;  5I9O A;  3GTL H;  3K80 C;  1Y8N B;  1HNW Q;  3HG9 A;  2NVQ H;  2LS0 1;  1VQ7 A;  1E2W A;  2SOB A;  2KEE A;  3TRE A;  2Q2I A;  3A7A B;  3GTL B;  1HR0 L;  5IGG A;  4IPH A;  3T1H Q;  4CGY B;  2NVQ B;  3TP7 A;  4YWM A;  3K5M A;  2EYF A;  1Q7Y C;  3OW7 A;  2EYL A;  3UI2 A;  3RZO B;  1D8L A;  1OXT A;  2HDM A;  3AQQ A;  3CW2 C;  4P75 A;  3PQI A;  4HJ7 A;  1KLU D;  2E2D C;  3BS1 A;  4DR2 L;  5EKL A;  4RFB A;  3ZJY C;  2CWA A;  1TQO A;  1I50 H;  3BVM A;  1VQ9 A;  3FHW A;  2BDN A;  3C1F A;  2MO0 A;  1I50 B;  4DV1 L;  1TWC H;  1S5B D;  2D0O A;  1G29 1;  1FJG Q;  3F2D A;  1JQY D;  4NB3 A;  1YNN C;  1TS4 A;  2R93 G;  3NEM A;  1JOO A;  3MXN A;  1U5K A;  4I7Z C;  1KRT A;  2E76 C;  1S3O A;  2R3Z A;  4B9X A;  2PW5 A;  5GQO A;  5DLQ E;  2WII B;  2F3W A;  5GRO A;  2B2Y A;  4CKE A;  5DAU A;  3GTG H;  4LF6 Q;  1MHW C;  1PH3 A;  2B8F A;  1PRT C;  4NMZ A;  5ISR A;  5C0X H;  5IP7 G;  1M8A A;  4IZ8 A;  3GTG B;  1EWH A;  4OGQ C;  3KLW A;  2K5D A;  2UUA L;  1PMR A;  2E2J H;  3TEH B;  2XRS D;  3I4M G;  2R61 A;  1GM5 A;  1F9S A;  1QOH A;  5IYD H;  3CF5 A;  1PYW D;  1SAP A;  1CHP D;  4V19 0;  1ASY A;  1N33 Q;  3GP7 A;  2E2J B;  2WIN B;  4RGO S;  1NR2 A;  4DAV A;  4JV5 L;  4C1N K;  3HOZ G;  3C3L A;  1L0X B;  4OO1 G;  1GO3 E;  3HZX A;  3MC0 B;  2F0S A;  4JI8 L;  1SMY C;  1YZ6 A;  2EYP A;  2RCF A;  1AEX A;  2CH4 A;  3U58 A;  4RCO A;  4LFB L;  4DV5 Q;  4MNO A;  2E8G A;  3H0G H;  1LTL A;  2CQA A;  1LT3 D;  1ZYR C;  5C5L A;  5DM6 3;  1QNK A;  2HCI A;  2LKV A;  3HFZ B;  2BE5 D;  4XQJ A;  3H0G B;  3A0J A;  4DXF A;  4WJ3 M;  5AFW A;  2F0U A;  3FVQ A;  4KY6 A;  4FXG C;  1STE A;  2LY7 A;  3MEF A;  3R8B A;  1HPC A;  3VR6 A;  1GUN A;  1NMF A;  1A3V A;  5IYC H;  1D5M C;  1JWS D;  5M3F H;  1DON A;  5CBE E;  4IQZ A;  4JK1 C;  3W1B A;  2N3S A;  5EAY A;  1QB5 D;  5I6Y A;  2DJG C;  4KN4 C;  2KCN A;  4ID6 A;  1JC7 A;  1I6H H;  3I90 A;  3G7L A;  3I72 A;  3J80 i;  2F0M A;  2MQH A;  1R4Q B;  4R1J A;  3FEW X;  1Z6H A;  4F87 A;  1HR0 Q;  4FDB A;  4DK6 C;  5FLM G;  3H15 A;  1K8O A;  1WCM B;  1I4G A;  2Y0S B;  4JI0 L;  2QIL A;  5AJ3 L;  4HSV A;  1EYG A;  1CUK A;  4A3M H;  1CKM A;  4LF7 L;  2Z1C A;  4DAY A;  3J81 c;  3MXN B;  2CWP A;  1K0S A;  4L5R C;  3KF6 A;  3D4R A;  4AIM A;  4A3M B;  1X3E A;  4YCV A;  2A68 C;  2XSC A;  5A2Q E;  4R8N A;  1X9N A;  1PV4 A;  2BDO A;  1SNQ A;  1BR9 A;  4X3S A;  2WP8 J;  3H09 A;  3J81 i;  3AB9 A;  2NN6 H;  2RSO A;  2JK8 A;  3CCJ A;  5T1I A;  2B2U A;  2FJ2 A;  5D65 A;  1L0W A;  1VQL A;  4DR5 Q;  1QG7 A;  2TSS A;  4GOP C;  3NK9 A;  3SEB A;  1TR5 A;  1JOQ A;  4A3I G;  1NR4 A;  3PIP 3;  3J7Y W;  5E4W C;  4HR7 B;  3VR3 A;  1STG A;  4A3F H;  4JI2 L;  4FP5 D;  4ILW A;  1BCP D;  1LYL A;  4MHE A;  1F9Q A;  2D62 A;  3PO3 H;  5I2Y A;  4N9P A;  4A3B G;  4A3F B;  4HJ5 A;  4XXE A;  3GQB A;  3CXC A;  2UUA Q;  1I4X A;  1VQI A;  3I4O A;  3KDF A;  2OTL A;  3STB D;  1SDF A;  3EVQ A;  1PH4 A;  5C44 G;  2ZM6 L;  1GUG A;  5LHY 1;  1IYV A;  1HZ9 A;  5COR A;  2NZH A;  4JV5 Q;  1EZ8 A;  1WTX A;  3J80 L;  3KJP A;  1E0B A;  3NPP A;  4DUY Q;  1PFN A;  1V1Q A;  1II3 A;  2R6G A;  2XGT A;  2A73 B;  3J7A V;  3WWV A;  1J6Q A;  4QJF A;  3SR1 A;  3PGZ A;  1B2T A;  1V43 A;  1TWA H;  5E4X A;  1N32 Q;  2Q2H A;  1PTO H;  2JA7 H;  1VDZ A;  4X62 L;  1TY2 A;  3S1R B;  3OHX C;  4DAY B;  3MA2 B;  5IGE A;  4IPG A;  1CK1 A;  2FHT A;  1SNC A;  4OIJ A;  3BZC A;  1PTO B;  2JA7 B;  1BBW A;  2OQK A;  2RDH A;  3J81 L;  1OO9 B;  3CQZ H;  5ELC A;  3BZK A;  2G9D A;  1E7Z A;  5IYB H;  2R92 H;  3CQZ B;  3F2C A;  2VNU D;  5C4J H;  4A3D H;  4IFD H;  4DAM A;  1F77 A;  1VQM A;  2R92 B;  4DR6 L;  5J39 A;  2O2L D;  5C4J B;  4A3D B;  3HKS A;  2B2V C;  4LF7 Q;  3CD6 A;  3J81 j;  4C3H G;  4TSS A;  4GN5 A;  2Z8L A;  1EIH A;  4LMQ D;  4L6T B;  1SRU A;  4EX5 A;  2HQE A;  2NZO A;  5C5M A;  5COY A;  1CZW A;  1X65 A;  1B9N A;  3CPF A;  5EGT A;  3CHB D;  1WTO A;  2VUM H;  2N8N A;  1IKL A;  2L12 A;  2QDB A;  4ZAI A;  2PQE A;  2EYJ A;  1D7Q A;  1CHQ D;  4MTN A;  1BBX C;  4GN4 B;  1VF7 A;  2VUM B;  3HEJ A;  5ELO A;  1IYJ B;  2F1M A;  2F0D A;  2ZXO A;  1SYE A;  5C0X G;  3RD4 A;  1SJE D;  3KDF B;  1EOV A;  3B6Y A;  5CV9 A;  2H5X A;  1J5E Q;  4OON A;  1S5F D;  5D3D A;  2PO4 A;  1EQQ A;  2P5Z X;  3A8I E;  3DEP A;  1EYA A;  1IHZ A;  3H94 A;  2A1A A;  1U4R A;  3VR5 A;  4JI2 Q;  1B50 A;  1KAW A;  5IYD G;  3WOE A;  4JOI C;  1RHP A;  2VB3 X;  1PRT F;  3FKI H;  2HT1 A;  4EQ5 A;  4HED A;  1XJV A;  1SNP A;  4LW1 A;  3FKI B;  1YBY A;  3BDO A;  3UDF A;  3BJU A;  2KHJ A;  1VF5 C;  1YJW A;  2JA9 A;  5NUC A;  1UE6 A;  4DV2 L;  3EFX D;  1L1O C;  2ZM6 Q;  3M7G A;  1Q82 C;  4IAL A;  4IOC A;  3FP9 A;  2MPM A;  3HRZ C;  4XYQ A;  1JMC A;  1F2Y A;  1U4L A;  3R3O A;  2XN9 C;  4P74 A;  1TS2 A;  2G5D A;  3HOW H;  1EY4 A;  4B3M Q;  1JR0 D;  1G6Z A;  5FLX c;  1Y1V B;  2CW0 D;  4AH6 A;  5I6W A;  5IYC G;  5M3F G;  1WD0 A;  1IW7 C;  2L9H A;  2KHS A;  3HOW B;  2UXB L;  2PZU A;  1UWV A;  2G9H D;  2IHF A;  3AYH B;  3VYS A;  2Y0S G;  2HIX A;  3W3A A;  4CJ2 C;  3LNN A;  3CC7 A;  4KMU C;  1RF2 D;  3IFD A;  3TRZ A;  2JN4 A;  4HIM A;  1Q90 A;  1UE7 A;  1GJX A;  2Z4H A;  3Q22 A;  1EU3 A;  4ZKC B;  5IP9 H;  4U68 A;  4A3M G;  4OEL B;  3K7U C;  1PYS B;  3F2U A;  4CDC C;  4UAI A;  1B9M A;  3DWA A;  1XNQ Q;  1STY A;  2L4N A;  3Q24 A;  2NTT A;  4R4I A;  3K8A A;  3PUV A;  3QWN A;  5EJW A;  3S16 H;  1SR3 A;  1EFI D;  4DV0 Q;  2NN6 G;  3GV3 A;  2Q8R E;  3GDE A;  3KLS X;  2EXZ A;  1LM0 A;  2L1B A;  1PZK D;  3ERS X;  3S16 B;  2B63 H;  1V1O A;  4JBW A;  3MFY A;  1X54 A;  1SYG A;  1HZC A;  2UUC L;  5GAD C;  1EQV A;  5HUR A;  3E3X A;  3A74 A;  4KLK A;  3F8T A;  1O78 A;  3CMA A;  2PPB C;  1ZXT A;  4HTH A;  5M9O A;  4A3F G;  4XT3 B;  2XIW A;  4JI6 L;  2QDL A;  1MSH A;  4NDX A;  3OWE B;  4DUZ Q;  4G7H C;  3PO3 G;  5FO7 B;  2WB1 B;  3SVM A;  4LFC Q;  1ICF B;  4H02 A;  2OT2 A;  5TSS A;  5C4Z A;  1WVL A;  4QB4 A;  2J4X A;  5IGB A;  1VQ4 A;  3M4Q A;  4KHZ A;  3D6W A;  4R8I A;  2KHI A;  4BY7 B;  5CR3 A;  3D0F A;  4FF3 A;  4FYD A;  4UPA A;  4BS9 A;  1VQE A;  2WB1 E;  1CT1 D;  2D5D A;  2AKW B;  4IUQ A;  2H4O A;  1JWM D;  2N88 A;  4RAU C;  2IW3 A;  1HNW L;  4ZYS A;  1EQT A;  2PMZ E;  3PIO 3;  2NZ1 D;  3KLS A;  4JI3 L;  2A5H A;  1DYQ A;  1FNU A;  1HTL D;  2J0T D;  2NTS A;  2AMC B;  4DK1 A;  1X56 A;  1SJH D;  3UE0 A;  3T1H L;  3DEO A;  2JJQ A;  1EQR A;  4DV2 Q;  1IL2 A;  1R4P B;  1PH8 A;  2B3G A;  2RVL A;  4DV7 Q;  3L7Z C;  4GLA C;  5CMD A;  1JT8 A;  2YTV A;  3W2D A;  4X66 Q;  4MIU A;  5LMN W;  4POF A;  4JI4 Q;  2JA7 G;  4OWW B;  4E6I A;  1WYD A;  2YYZ A;  4A76 A;  2ZXR A;  1YNN D;  1QVC A;  1GOZ A;  4JBJ A;  5G3L F;  4BWG B;  1FNW A;  1I5F A;  3ND8 A;  3V2T A;  3GTJ H;  2MJ8 A;  3EA6 A;  1NTG A;  2V4D A;  2ZTD A;  2CCZ A;  1HFN A;  1M90 C;  2WAQ B;  4AQY Q;  1PFB A;  4RHR A;  4RWS C;  3NTH A;  2R92 G;  1Q12 A;  3I55 A;  1KIX A;  2K4K A;  1RD9 D;  4JW0 A;  5CYU A;  4IFD G;  1TY0 A;  2AWO A;  3I7F A;  4M8A A;  3AMU A;  4ABN A;  2QF7 A;  4DF7 A;  4LF9 L;  2VB2 X;  1KL9 A;  4C56 C;  3U50 C;  2EJM A;  4LF6 L;  5A35 A;  5JOB A;  2B2T C;  1K28 A;  3K7A H;  3HGB A;  2MFI A;  1GUO A;  1M4V A;  1X55 A;  1RL2 A;  2R7Z G;  2WFW A;  3J80 E;  4WOR A;  3K7A B;  4FF4 A;  1JCK B;  2IX0 A;  1N33 L;  2QEJ C;  1DZ1 A;  1FR3 A;  1WOC A;  2RDF A;  1YEZ A;  1YNJ C;  1TU2 B;  5ELD A;  2Q8I B;  3TBI B;  1ILQ A;  1YJ9 A;  1SEB D;  1SN8 A;  5IIF A;  1UEA B;  3K5N A;  5EPJ A;  2VQE L;  4GNX B;  4JC0 A;  3PV0 A;  4XQQ A;  4DAP A;  3PCO B;  3BVG A;  1SMX A;  5LL6 X;  3A5U A;  4APV A;  4YHH L;  3HP3 A;  4DV5 L;  1NNX A;  3FKI G;  1ET9 A;  2EY5 A;  1SXT A;  3J81 E;  3BDL A;  4QMG A;  2X6G A;  1B3Q A;  5M5X H;  4A3K B;  4GKK L;  2F52 A;  3JAM c;  1PYB A;  3O13 A;  1ASZ A;  3H3V C;  2CH4 W;  1C48 A;  2JXM B;  4L8J A;  2Z6B A;  5M5X B;  2F0E A;  1VQC A;  3X3M A;  3T1Y L;  1XTC D;  2CHB D;  3JAM i;  4MZ9 A;  1N8R C;  2ZT9 C;  3T51 B;  1EY5 A;  1Q8K A;  2XVS A;  4JI3 Q;  4A3C H;  3Q6S A;  3HOW G;  5JJI A;  4FO2 A;  3RZO H;  4DR4 L;  1HHV A;  2DN8 A;  4YWL A;  3E0E A;  1KHI A;  2B2Y C;  1RTN A;  3DUZ A;  4GN3 B;  1UE5 A;  2BA1 A;  2ALY B;  4WJW A;  4OO1 I;  4ZQ3 A;  1VMP A;  3MVV A;  5FK9 C;  3K0Y A;  4PMW A;  1X6O A;  2RKS A;  1G51 A;  4DK3 C;  2OF1 A;  3JC6 6;  3ONA B;  1ZKO A;  1MI2 A;  2R7D A;  3LX0 A;  1BBU A;  1LT5 D;  3VR4 A;  4KHP Q;  5IP9 G;  2CKZ B;  1Y1W H;  2K04 A;  2AUK A;  4OEM B;  1N36 Q;  4PZ7 A;  2LSS A;  1NUC A;  4K8J A;  3TP5 A;  3H91 A;  4IO9 A;  1Y1W B;  1LT6 D;  1CKN B;  2F0O A;  3RUZ A;  1TS5 A;  5JEA G;  2J7Z A;  3KBG A;  4HSP A;  4LF9 Q;  3TS0 A;  1C4Q A;  3D8G A;  4LF5 Q;  1BDO A;  4ZLT F;  2EYH A;  1QWY A;  3PUY A;  3AFP A;  1XPU A;  1QIL A;  2A8V A;  1XMO L;  2B63 G;  2RF4 A;  4MN3 A;  4OL7 A;  4A4I A;  1YNX A;  1YI2 A;  2KEN A;  2DNE A;  3LWE A;  1FVI A;  1A15 A;  1W2B A;  1PZJ D;  5CGK A;  4LWC A;  4KK7 A;  2CFM A;  1EYD A;  3GV6 A;  3NBI A;  2KVM A;  1QVG A;  3L3O C;  2M9V A;  3PO2 H;  2NBF A;  1K3R A;  2PCF B;  4ODG A;  2N49 A;  3PO2 B;  3JAM L;  1RKN A;  1WTH A;  2VL6 A;  4BA2 I;  3EJI A;  1XXG A;  2VQE Q;  1M1K C;  4DUY L;  1GHK A;  3Q8D A;  1TWF H;  5M3M H;  2HUG A;  3R93 A;  5JAV A;  4WRD A;  4YHH Q;  4XQN A;  1FGU A;  2B39 A;  1IBK Q;  4CJ1 B;  4DPG A;  4ME3 A;  5T1G A;  1TWF B;  5M3M B;  3OMC A;  1G8Z D;  5JVG 3;  1N32 L;  2EQS A;  1DOK A;  4GKK Q;  2JSO A;  3UDI A;  1VCI A;  5FJ8 G;  4DR7 Q;  4AYB B;  4R4C A;  1UUP A;  2UUB Q;  3KF8 A;  2D2C C;  4A93 H;  3SHL A;  1TVX A;  3T1Y Q;  1BXT A;  1D5Z C;  4K5V A;  4PMC A;  5JJZ A;  2F0T A;  1JE5 A;  1SBB B;  1WCM H;  4ZK9 B;  1YHQ A;  4Y7N B;  1V8Q A;  2MHV A;  3PUX A;  1FD7 D;  4A93 B;  3NEN A;  5FOB B;  3T16 A;  1DXM A;  1EYC A;  2FXQ A;  4X65 L;  2I46 A;  4B3S Q;  4AYB E;  1FGB D;  4O1N A;  2L0C A;  3T53 B;  5JVH 3;  1S5D D;  1E3P A;  5EKK A;  4UP9 A;  2WAQ G;  4ZCK A;  2KCC A;  4LFA Q;  3GTK H;  4DR4 Q;  2EJG C;  4RGT A;  1QNU A;  1SRO A;  2ICE C;  5C4X B;  1O7Z A;  2JE6 I;  3GTK B;  4PG3 A;  3BDC A;  4CBV A;  4ZKB B;  1NBW A;  3KLR A;  4LJZ C;  3L2P A;  2N55 A;  1I4P A;  4EQO A;  1U4M A;  3NTI A;  5M5W H;  2F3V A;  3CC2 A;  1S5E D;  4KY7 A;  3HOV H;  2LXJ A;  4LF8 Q;  2C35 B;  2SNS A;  3E6Z X;  4BA1 I;  5M5W B;  3GTQ H;  3E9I A;  4DV4 Q;  1YJN A;  2K5H A;  3S24 A;  4RGN A;  5HY6 A;  3RNU A;  1B70 B;  1W6K A;  3HOV B;  2VY3 A;  3GTQ B;  1J5E L;  4I7A A;  3GTO H;  1XX8 A;  3NBH A;  1ONL A;  1JE4 A;  4GKJ Q;  4QCL A;  4FF1 A;  3GTO B;  3CP0 A;  1XMO Q;  1EL0 A;  3CCM A;  4EVO A;  1JWU D;  2MP1 A;  2KCM A;  2GA4 B;  2I07 B;  4F88 A;  4JBK A;  4DA2 A;  3RMH A;  3SDZ A;  3OW2 A;  5HGQ A;  4LF4 Q;  2EY2 A;  1XTD A;  4G4K A;  3UE1 A;  1IW7 D;  5I2X A;  4KD3 A;  2AQ2 B;  4O2D A;  1EWC A;  1OXV A;  3P75 A;  1GUT A;  3LWU A;  5IY0 A;  2ATW A;  4OWT B;  3KF8 B;  1VQ8 A;  1O7Y A;  1PRT B;  1Y8O B;  3NHH A;  1JOK A;  2EZV A;  1CM9 A;  1PH5 A;  2XWJ B;  4B3M L;  1P16 A;  4DNR B;  5D3I B;  3TP6 A;  1TXY A;  2I5L X;  1VQF A;  1GKH A;  2VZA A;  3OTO L;  1T9H A;  2E5L Q;  2EIF A;  3S1R H;  4POG A;  4U67 3;  1HTP A;  1K3B C;  3U4Z A;  5C0X I;  4K8I A;  1A6X A;  1SYC A;  3RLN A;  4GOP A;  3CRL C;  1LTT D;  3MFG A;  1C9O A;  1EUJ A;  3CRK C;  4HMJ A;  1QCB D;  3KYH C;  2HCC A;  3PSI A;  1KLG D;  5GAG C;  4YIJ A;  3QIA A;  4LNQ A;  1Z7T A;  1VQ5 A;  4A3E B;  2D9U A;  5C4H A;  5EPL A;  4IUR A;  1Q46 A;  2RHS B;  3HOX H;  4DV3 L;  1X3F A;  4IJH A;  3I56 A;  4KN7 C;  3S9W A;  1SND A;  4X65 Q;  3HOX B;  5BR8 Q;  1XNQ L;  3HS0 C;  1LUZ A;  4B9W A;  1P8L A;  4QL5 A;  2VQF L;  4IUN A;  4DV0 L;  5CV6 A;  2PI2 E;  1ENA A;  4HJ8 A;  1O80 A;  1Y1W G;  1TKW B;  1AH9 A;  3K58 A;  3RN5 A;  4A3G H;  1G2T A;  2BE5 C;  3ULP A;  3NBH B;  3HOU H;  3PF4 A;  5J1Z A;  3C2P A;  2DUD A;  4A3G B;  4JYA L;  3H3V I;  3TZD A;  2Z9H A;  3F2B A;  1HQR D;  3CCV A;  1A63 A;  4B08 A;  3HOU B;  1MBY A;  2VXW A;  3NWT A;  3N52 A;  4P72 A;  5J3B A;  3NE5 B;  4DUZ L;  4HCS A;  4H13 C;  5DNF A;  4LFC L;  2K52 A;  4S3S A;  2SNM A;  1CSQ A;  2JA5 H;  2ZXP A;  1ET6 A;  1A2T A;  4QY7 A;  3Q23 A;  1QVF A;  1J9O A;  4LUV A;  4G7Z C;  3C46 A;  2JA5 B;  1Q8I A;  1YIJ A;  1X3G A;  3DM1 A;  2HD3 A;  4OXP A;  4JI7 L;  4ME5 A;  1WTP A;  1JB7 A;  1A62 A;  4Q5V A;  2MGS A;  1JB3 A;  2A69 D;  2NVY H;  1U0L A;  1L0Y B;  2NN6 I;  1CFM A;  5M3M G;  2I5M X;  4GOP B;  1H9M A;  2O4X A;  5C3X A;  2NB0 A;  1H95 A;  3H0G G;  2NVY B;  4DKA C;  1LTA D;  2HDL A;  4DV7 L;  1O7L A;  1X32 A;  1Y1V H;  4UHV A;  4X66 L;  1C8C A;  4JI4 L;  2K5V A;  2ICI A;  1V1P A;  1KC8 C;  1EY6 A;  1GUS A;  3DXJ C;  4A3L H;  1PFS A;  1BCP C;  3OTO Q;  3KFU A;  3BU2 A;  2BH2 A;  1JJC B;  2PNR C;  4IUP A;  4XT1 B;  4AQY L;  2EXD A;  1WCM G;  1PA6 A;  2K05 A;  5JPM C;  1SLJ A;  2WKD A;  1K83 H;  4LK1 C;  2AUJ D;  2EYM A;  1SSO A;  3L9A X;  2ZTC A;  1B53 A;  3STB C;  4JOI A;  4HJA A;  4UP7 A;  1U4P A;  3FRP B;  1K83 B;  3TQY A;  1A3T A;  4DV3 Q;  3DWQ A;  5KGU A;  5J22 A;  1RDP D;  1YNJ D;  4Y52 H;  2ZJQ A;  3BVZ A;  1DOM A;  3RN2 A;  1L2F A;  4CHT B;  3JAM E;  2Q2T A;  2F4I A;  3KBX A;  1NY4 A;  5JEA J;  1ILP A;  3VDY A;  2NWG A;  4FXK C;  3ZYY X;  2VQF Q;  4JI1 L;  2K50 A;  1L1O A;  1T5X D;  2F0Q A;  1H9R A;  2C5C A;  3T4A C;  1G2S A;  1R9T H;  1KQS A;  2KCT A;  2BA0 A;  1E24 A;  5FO9 B;  1VQP A;  2E74 C;  4JYA Q;  2R93 H;  2IL8 A;  3X3N A;  1S40 A;  2A6E D;  1R9T B;  4TKO B;  1DGS A;  4L5S A;  2B2W A;  2KED A;  1N34 L;  2R93 B;  1BF4 A;  4BY1 H;  2KEC A;  4HMI A;  1SNO A;  1F9R A;  3D6C A;  2K03 A;  3NP8 A;  1AE2 A;  4BY7 H;  4KJO A;  4BY1 B;  2PMZ B;  2X6L A;  3NSW A;  2K6A A;  4H0L C;  3CME A;  4IFD I;  4FNF A;  2ZTE A;  3J7Z C;  3TS2 A;  2IPK D;  5LMU Q;  1YHA A;  1HH2 P;  3MXG A;  4DK0 A;  4N8F A;  2V1C C;  2MUY A;  4GNX A;  4BBS H;  4K14 A;  1V1P B;  4JI7 Q;  1OXS C;  4IN3 A;  4XTC S;  2DY8 A;  2KQ3 A;  1UNS A;  4BBS B;  3FPP A;  2OCE A;  1CA6 A;  4OO1 H;  3TN2 A;  5FLX L;  2EY6 A;  5F2D A;  3M85 A;  1GD7 A;  1VQ6 A;  1SNM A;  1WFQ A;  1FL0 A;  1VQB A;  2K28 A;  1I4R A;  1ROD A;  3C1E A;  4QUF A;  3UDX A;  3G4S A;  1XNR Q;  4V0B A;  1IBL L;  1MJC A;  3T56 B;  2WAC A;  4NXM L;  1STN A;  1UEB A;  2A6H C;  3OPO A;  4YWK A;  1SE3 A;  2BCO A;  3LGJ A;  3ERQ A;  3I70 A;  3SK5 A;  4KKS A;  1F2L A;  3PMF A;  1VQD A;  4UP8 A;  3I4L A;  4OHJ A;  3RLO A;  2KA7 A;  2PZT A;  5IGC A;  5IOD A;  1DD2 A;  1E2Z A;  4KHP L;  5IGD A;  5KND A;  2IJ0 A;  3DHQ A;  1VQA A;  3CCL A;  3S15 H;  4IUU A;  1N36 L;  2K33 A;  3SXH A;  1PRT D;  4JI5 L;  3OIP A;  2PZW A;  5IYB G;  1HA5 A;  3OMG A;  3A54 A;  1KXL A;  2F0G A;  4A3D G;  1L1O B;  2C9O A;  3S15 B;  2B8G A;  2Z6K C;  5FLM H;  1V9P A;  4GZY C;  4HAE A;  4DU9 A;  5M5Y H;  1B1Z A;  4LF5 L;  2F0V A;  3ER0 A;  2IHE A;  3QO2 A;  3G71 A;  1HFG A;  1HNX Q;  2IWH A;  3A8K E;  4M1U B;  3R2T A;  5M5Y B;  3U4V A;  3NWS A;  1AFP A;  1UAP A;  2OWO A;  1NSN S;  1HXY D;  1TS3 A;  5K36 H;  1B44 D;  4B3T L;  2PNH A;  5EBD A;  1PH7 A;  1PVO A;  2VUM G;  1SMY D;  2UXC Q;  2F0J A;  5BN3 A;  4JI1 Q;  1CKN A;  1EIY B;  3MXU A;  2OXP A;  3FMC A;  4J15 A;  1ZYR D;  4EGV A;  2DJF C;  5ELF A;  1IYU A;  1QE6 A;  1CKO A;  3QR8 A;  4C3I H;  3TDQ A;  3GD7 A;  2YU9 H;  2JA5 G;  5IT9 c;  3S1N B;  3VA5 A;  4H7B A;  4X3U A;  4C1N I;  4PV1 C;  4GLX A;  1NMG A;  5LMN Q;  4C3I B;  4CDE C;  1N34 Q;  1SFO H;  1Q86 C;  1CTM A;  5EBC A;  4A3K H;  4A3I B;  1IBK L;  2YU9 B;  2K5N A;  5CV4 A;  3KUP A;  2DGY A;  4K6D A;  4WFN 3;  1SFO B;  1SYB A;  5I9P A;  3M4O H;  4DR7 L;  2RQX A;  5CBA E;  2UUB L;  4RH6 A;  1CI3 M;  1LTR D;  1NE3 A;  5C6A A;  3M4O B;  5KIX A;  1Q1B A;  1QUQ A;  1RJT A;  2B2T A;  4FXD A;  3TP8 A;  2F0P A;  1Y1V G;  4RKB A;  3A5Z B;  2IX3 A;  4FVM A;  3ICE A;  5C44 B;  2A68 D;  1PLF A;  2F4V L;  4B3S L;  2MO1 A;  3U9O A;  3I4N H;  4A75 A;  4A3L G;  3NXW A;  4JPB W;  4LFA L;  3PUW A;  1IBL Q;  2F0H A;  1WTV A;  3D4D A;  1QZH A;  4X3T A;  4NXM Q;  3I4N B;  1HZB A;  3IRB A;  4CKC A;  2K7V A;  1LTI D;  1KNA A;  2HHH L;  1IL8 A;  3S2D H;  2RA4 A;  2SDF A;  5CV5 A;  4DR1 L;  1B7Y B;  4N9T A;  3GTP H;  4CDD C;  1BCP F;  4C3J H;  2EVB A;  2XNA C;  3S2D B;  3MWY W;  2QEX A;  2RSN A;  2YV5 A;  4LF8 L;  5KYI A;  3MXP A;  3G6J B;  3GTP B;  4DV4 L;  2RBM A;  4P71 A;  2Z0S A;  4ALP A;  4JI5 Q;  4C3J B;  5E1F A;  1D1K A;  3M4Y A;  1J8I A;  2JEA I;  5C3E H;  2IT1 A;  1DCZ A;  4QUC A;  4GKJ L;  4C3H H;  5C3E B;  3Q0A A;  2KJX A;  2E2I H;  4EQP A;  2M2L A;  3GO5 A;  1HA6 A;  5E7N A;  5IT9 L;  5C0X J;  3A55 A;  4C3H B;  1AZP A;  3W1G A;  1LO5 D;  1TT2 A;  2B29 A;  4B3T Q;  1PFM A;  2E2I B;  1TWC B;  1K8G A;  4B3R L;  2A74 C;  2WB1 G;  4LF4 L;  3E5S A;  2ASB A;  5G3L D;  2JA8 H;  1B8A A;  5LL6 S;  1S5C D;  1C7Y A;  2SEB D;  4BY1 G;  1H9J A;  1AW7 A;  4NKL A;  1MGS A;  3HOY H;  1HR0 W;  2JA8 B;  4OX9 Q;  2HQL A;  4BY7 G;  5IWA Q;  1H9K A;  2EE1 A;  3U9S A;  3FPU B;  4ULL A;  4R4Q A;  2NVT H;  4J6H A;  1QUQ B;  3SGI A;  3I73 A;  3HOY B;  2QCP X;  3ULJ A;  2F0L A;  4KHV A;  4YCW A;  3A8J E;  1IZ6 A;  4DR5 L;  3FDT A;  4JCV E;  4BBS G;  4NXN Q;  2NVT B;  4O42 A;  2E5L L;  4DNI A;  3MEH A;  5FKA C;  1A0I A;  1EIG A;  1PTO C;  4LAA A;  4ZRZ A;  3DLL A;  1ZEQ X;  4PNY A;  4DV6 L;  2OQ0 A;  3BG3 A;  3ERO A;  4XDX A;  2RDG A;  4DNT B;  1PH1 A;  2JP1 A;  2UXD L;  5CV7 A;  1T5E A;  4Y7N H;  1CZG A;  1YIT A;  2CVR A;  2B2U C;  4YY3 L;  2UU9 L;  2L15 A;  5KRU A;  2AQ1 B;  4I65 A;  2QGQ A;  4RCN A;  3W5O A;  3URY A;  1A8V A;  2QKI C;  4PZ8 A;  5CC4 A;  1Y8P B;  3WDN A;  3CCR A;  2F4V Q;  1A3U A;  5BR8 L;  3UDG A;  5C4X H;  4FF2 A;  1F2M A;  3J80 c;  3D3R A;  3H3V H;  1O7I A;  2LXK A;  4HIK A;  4GS3 A;  3M9B A;  3R2I A;  4CJ0 B;  1A2U A;  4BBR H;  4ZUI A;  4UY8 C;  2L5T A;  3TSS A;  3NQT A;  1AZQ A;  2K5Q A;  3N6R A;  3NEL A;  1HUM A;  3D4W A;  4CDF C;  5M3F B;  2HHH Q;  2PI2 A;  3QG1 A;  4BBR B;  4DR1 Q;  4IPC A;  3CAM A;  1I6H B;  1TWG H;  1B3A A;  4OIK A;  2XRQ D;  2MNA A;  4IOA A;  1ML0 D;  1Y69 U;  2O5I C;  1WTQ A;  2XWB B;  3OIQ A;  1TWG B;  3VR2 A;  3PIP A;  4K0K L;  1JIC A;  5FO8 B;  1HQM C;  1Q1E A;  2QW7 A;  3L0O A;  1EFW A;  1G6P A;  5JPN C;  1XPR A;  4DR2 Q;  5K36 G;  3MHB A;  2ZJR A;  3E0J A;  5FLX E;  1HUN A;  4K2K A;  2Y0S E;  2RHQ B;  2JA6 H;  5EPK A;  4KKT A;  3I2Z A;  3CCU A;  3K6O A;  1RCV D;  1EY0 A;  1DJR D;  4F8M A;  4DV1 Q;  2JA6 B;  5BN4 A;  3AEV A;  1ENF A;  4NW2 A;  4C3I G;  3P7J A;  3D31 A;  1GHJ A;  4Z9C B;  1GVP A;  4B3R Q;  3K59 A;  2K32 A;  4L63 B;  5K5P A;  1I6V C;  1Q3L A;  5CV8 A;  4A3K G;  2WKC A;  1EU4 A;  4RG1 A;  2IX1 A;  5H1S E;  3P20 A;  3PO3 B;  4KI0 A;  4KD4 A;  4QF4 A;  1PXU A; 
#chains in the Genus database with same CATH homology
 2FMC A;  1W6J A;  4K5X A;  5BN5 A;  1IKM A;  1HCZ A;  2EY1 A;  2WV6 D;  3SE0 A;  3SK6 A;  3OOC A;  1D6E C;  3TME A;  2L11 A;  2F0N A;  1BNZ A;  3HKZ B;  3ND9 A;  5IOC A;  4C2M B;  3ITP A;  5KYL A;  4UDU C;  4IUT A;  1OXU A;  2M00 A;  2EJF C;  4RKL A;  1TWA B;  4IFD J;  4C3J G;  3K5O A;  1EY7 A;  1Z47 A;  4J8Q A;  4HN7 A;  1CQV A;  2X69 A;  3NUC A;  1WTR A;  3OWF A;  2L55 A;  5KNC A;  3S17 B;  4KY5 A;  1ESR A;  3QB3 A;  1MD2 D;  4HCE A;  3CKI B;  1EY8 A;  1MSG A;  2E2H B;  3I3C A;  2JEB I;  4A3J B;  1ENC A;  2R7Z B;  1F2Z A;  1I3Q B;  1LTG D;  1SYD A;  3PUZ A;  3VYR A;  2JYO A;  2EPB A;  2Z4I A;  5KEE A;  2A6H D;  5EQ0 A;  1WD1 A;  4TRD A;  2B2V A;  1LTB D;  3J7A F;  1GXD C;  4ZUJ A;  1STB A;  4KV6 A;  4QIW B;  1PDQ A;  2LFN A;  3NQI A;  3QOJ A;  3IL8 A;  3M3Y B;  1PZI D;  3K5L A;  3NTK A;  4K2L A;  3GTM B;  2PYK A;  3VA7 A;  4F7X A;  4RGM A;  1PTO F;  1AP0 A;  1NCV A;  2K01 A;  3S14 B;  1D1I A;  1QJO A;  1CQF A;  5IT9 E;  4XIG S;  1BOS A;  5IGF A;  4PQX A;  1LAC A;  1BUV T;  3S1Q B;  2B2W C;  1HRJ A;  1KDA A;  5DEH A;  4PMB A;  3QOL A;  2ENB A;  1STA A;  4G7O C;  4DXG A;  1LT4 D;  3VYU A;  3OSO A;  3VYT A;  3S2H B;  3KK7 A;  3QJY A;  1LLR D;  2Q8T A;  1KAA A;  2AQ3 B;  2ID0 A;  1I4H A;  1D2B A;  4K5W A;  2DNC A;  3SK4 A;  4R9W A;  1H9S A;  3T13 A;  5DM7 3;  5JEA H;  4G57 A;  5E3F A;  3IAY A;  3A7L A;  1S4Z A;  3TZU A;  1EZ6 A;  1EOT A;  3A56 A;  1DM0 B;  2NVX B;  3BZD B;  5C3W A;  1NAP A;  4RA8 A;  2F03 A;  3M7N A;  1U9R A;  2NYZ D;  2K5W A;  1X3P A;  3EQL C;  2B63 B;  3WOF A;  4DGZ A;  3MAQ A;  1KNE A;  1KDB A;  3CU7 A;  3IFT A;  3I4M B;  4EQN A;  1KAB A;  5A2Q L;  1EEF D;  2LMC B;  1STH A;  3H6M A;  1RTO A;  3HOZ B;  1EEI D;  4RHS A;  3V96 A;  1VMC A;  1KDC A;  2E75 C;  1JOR A;  2TMP A;  1AN8 A;  1GUW A;  1EY9 A;  1SYF A;  3S1M B;  1B4O A;  2F0I A;  2NUC A;  4Q0F A;  4KTA A;  2F0F A;  1X3Q A;  3AU7 A;  1LAB A;  5KNB A;  1D5X C;  3BYY B;  4XYO A;  1TWH B;  2A69 C;  1SE4 A;  1ESF A;  4NP5 A;  1LTS D;  3RLF A;  1ICW A;  1KTK A;  3DMU A;  2FFK B;  1FNV A;  5HGT A;  1H9S B;  2FIN B;  3MTS A;  3GTJ B;  4DN4 M;  1BCP B;  1WTW A;  2OEO A;  1I4Q A;  3IKJ A;  2K1B A;  4K6L A;  5I4D A;  1FYC A;  1E2V A;  2CW0 C;  4IUV A;  2DY7 A;  1XYI A;  3MZ5 A;  5D14 A;  1PTO D;  1OXX K;  2PW7 A;  4KJN A;  3I8Z A;  3V05 A;  2BOS A;  3P1H A;  1LV9 A;  2EOT A;  2KOL A;  2FMM A;  1K8M A;  4DFA A;  4H44 C;  4P2C B;  2AWN A;  1SE2 A;  2EYO A;  2O5J C;  1CA5 A;  3I91 A;  4A3B B;  1G91 A;  4X3K A;  1TII D;  5ELB A;  2EDG A;  3RZD B;  5EKI A;  1BO0 A;  1XWE A;  4J1M A;  3DWP A;  3K57 A;  1DOL A;  2H1E A;  2KUM A;  2A6E C;  2F0K A;  4CKB A;  4KKU A;  1BQQ T;  1F9P A;  3BYT B;  2F0W A;  3SK8 A;  4TQU S;  5ELE A;  5I9O A;  1Y8N B;  3HG9 A;  2LS0 1;  1E2W A;  2SOB A;  2KEE A;  3A7A B;  3GTL B;  5IGG A;  4CGY B;  2NVQ B;  3TP7 A;  3K5M A;  2EYF A;  3OW7 A;  2EYL A;  3UI2 A;  3RZO B;  1OXT A;  2HDM A;  1KLU D;  2E2D C;  3BS1 A;  5EKL A;  4RFB A;  1TQO A;  3BVM A;  2BDN A;  3C1F A;  1I50 B;  1S5B D;  1G29 1;  1JQY D;  1YNN C;  1TS4 A;  1JOO A;  3MXN A;  4I7Z C;  2E76 C;  2R3Z A;  4B9X A;  2PW5 A;  2WII B;  2F3W A;  2B2Y A;  4CKE A;  5DAU A;  2B8F A;  1PRT C;  4NMZ A;  5ISR A;  5C0X H;  1M8A A;  4IZ8 A;  3GTG B;  1EWH A;  4OGQ C;  2K5D A;  1PMR A;  2XRS D;  2R61 A;  1F9S A;  1QOH A;  1PYW D;  1SAP A;  1CHP D;  4V19 0;  3GP7 A;  2E2J B;  2WIN B;  4RGO S;  1NR2 A;  4DAV A;  4C1N K;  3C3L A;  1L0X B;  4OO1 G;  3HZX A;  3MC0 B;  2F0S A;  1SMY C;  2EYP A;  1AEX A;  4RCO A;  2CQA A;  1LT3 D;  1ZYR C;  5C5L A;  5DM6 3;  1QNK A;  2HCI A;  2LKV A;  2BE5 D;  4XQJ A;  3H0G B;  4DXF A;  5AFW A;  4KY6 A;  2F0U A;  3FVQ A;  4FXG C;  1STE A;  2LY7 A;  3R8B A;  1HPC A;  3VR6 A;  1GUN A;  1A3V A;  1D5M C;  1JWS D;  1DON A;  5CBE E;  4IQZ A;  4JK1 C;  1QB5 D;  5I6Y A;  4KN4 C;  2KCN A;  4ID6 A;  1JC7 A;  3I90 A;  3G7L A;  3I72 A;  2F0M A;  1R4Q B;  4F87 A;  3FEW X;  1Z6H A;  1K8O A;  1WCM B;  1I4G A;  2Y0S B;  2QIL A;  4HSV A;  2Z1C A;  4DAY A;  3D4R A;  4A3M B;  2A68 C;  2XSC A;  5A2Q E;  4R8N A;  2BDO A;  1SNQ A;  1BR9 A;  4X3S A;  2WP8 J;  3H09 A;  3AB9 A;  2NN6 H;  2RSO A;  5T1I A;  2B2U A;  2FJ2 A;  5D65 A;  1QG7 A;  2TSS A;  3NK9 A;  3SEB A;  1TR5 A;  1JOQ A;  1NR4 A;  3PIP 3;  3J7Y W;  5E4W C;  4HR7 B;  3VR3 A;  1STG A;  4FP5 D;  4ILW A;  1BCP D;  4MHE A;  1F9Q A;  2D62 A;  5I2Y A;  4N9P A;  4A3F B;  4XXE A;  3GQB A;  1I4X A;  1SDF A;  3EVQ A;  1GUG A;  5LHY 1;  1IYV A;  5COR A;  1EZ8 A;  1WTX A;  3J80 L;  1E0B A;  3NPP A;  1PFN A;  1II3 A;  2R6G A;  3J7A V;  2A73 B;  3SR1 A;  1B2T A;  1V43 A;  5E4X A;  1PTO H;  1VDZ A;  1TY2 A;  3S1R B;  3OHX C;  3MA2 B;  5IGE A;  1CK1 A;  2FHT A;  1SNC A;  4OIJ A;  1PTO B;  2JA7 B;  2RDH A;  3J81 L;  1OO9 B;  5ELC A;  2G9D A;  3CQZ B;  2VNU D;  4IFD H;  1F77 A;  2R92 B;  5J39 A;  2O2L D;  5C4J B;  4A3D B;  2B2V C;  4C3H G;  4TSS A;  2Z8L A;  1EIH A;  4LMQ D;  4L6T B;  2HQE A;  5C5M A;  5COY A;  1CZW A;  1B9N A;  5EGT A;  3CHB D;  1WTO A;  1IKL A;  2L12 A;  2QDB A;  4ZAI A;  2PQE A;  2EYJ A;  1CHQ D;  1BBX C;  1VF7 A;  2VUM B;  3HEJ A;  2F1M A;  2F0D A;  2ZXO A;  1SYE A;  5C0X G;  3RD4 A;  1SJE D;  5CV9 A;  1S5F D;  5D3D A;  2PO4 A;  3A8I E;  3DEP A;  1EYA A;  1IHZ A;  3H94 A;  1U4R A;  3VR5 A;  1B50 A;  3WOE A;  1RHP A;  2VB3 X;  1PRT F;  4HED A;  1SNP A;  3FKI B;  3BDO A;  1VF5 C;  5NUC A;  3EFX D;  3M7G A;  4IAL A;  2MPM A;  3HRZ C;  4XYQ A;  1F2Y A;  1U4L A;  3R3O A;  2XN9 C;  1TS2 A;  1EY4 A;  1JR0 D;  1G6Z A;  1Y1V B;  2CW0 D;  5I6W A;  1WD0 A;  1IW7 C;  2L9H A;  2KHS A;  3HOW B;  2PZU A;  2G9H D;  3VYS A;  3W3A A;  4CJ2 C;  3LNN A;  4KMU C;  1RF2 D;  3IFD A;  1Q90 A;  1GJX A;  2Z4H A;  3Q22 A;  1EU3 A;  4ZKC B;  4U68 A;  3F2U A;  4UAI A;  1B9M A;  3DWA A;  1STY A;  2L4N A;  3Q24 A;  2NTT A;  3PUV A;  3QWN A;  5EJW A;  1EFI D;  2NN6 G;  3GV3 A;  2Q8R E;  3KLS X;  2EXZ A;  2L1B A;  1PZK D;  3S16 B;  1V1O A;  4JBW A;  3MFY A;  1SYG A;  1EQV A;  5HUR A;  1O78 A;  2PPB C;  1ZXT A;  4HTH A;  5M9O A;  4XT3 B;  2XIW A;  1MSH A;  4NDX A;  3OWE B;  4G7H C;  5FO7 B;  2WB1 B;  3SVM A;  2OT2 A;  5TSS A;  5C4Z A;  1WVL A;  4QB4 A;  2J4X A;  5IGB A;  4KHZ A;  3D6W A;  4R8I A;  4BY7 B;  5CR3 A;  4FF3 A;  4FYD A;  4BS9 A;  1CT1 D;  2D5D A;  4IUQ A;  2H4O A;  1JWM D;  2N88 A;  4RAU C;  2IW3 A;  4ZYS A;  1EQT A;  3PIO 3;  2NZ1 D;  3KLS A;  2A5H A;  1DYQ A;  1FNU A;  1HTL D;  2J0T D;  2NTS A;  4DK1 A;  1SJH D;  3DEO A;  1R4P B;  2RVL A;  3L7Z C;  5CMD A;  3W2D A;  4MIU A;  4E6I A;  2YYZ A;  2ZXR A;  1YNN D;  5G3L F;  1GOZ A;  4BWG B;  1FNW A;  3V2T A;  3ND8 A;  2MJ8 A;  3EA6 A;  2V4D A;  1HFN A;  2WAQ B;  1PFB A;  4RHR A;  4RWS C;  3NTH A;  1Q12 A;  1RD9 D;  5CYU A;  4IFD G;  1TY0 A;  2AWO A;  4M8A A;  3AMU A;  4ABN A;  2QF7 A;  4DF7 A;  2VB2 X;  4C56 C;  2EJM A;  5A35 A;  5JOB A;  2B2T C;  3HGB A;  1GUO A;  1M4V A;  3J80 E;  4WOR A;  3K7A B;  4FF4 A;  1JCK B;  2IX0 A;  2QEJ C;  1DZ1 A;  1FR3 A;  2RDF A;  1YNJ C;  2Q8I B;  1TU2 B;  5ELD A;  3TBI B;  1ILQ A;  1SEB D;  5IIF A;  1UEA B;  3K5N A;  5EPJ A;  3PV0 A;  4XQQ A;  4DAP A;  3BVG A;  5LL6 X;  3HP3 A;  1ET9 A;  2EY5 A;  1SXT A;  3J81 E;  3BDL A;  4QMG A;  2X6G A;  4A3K B;  3O13 A;  3H3V C;  1C48 A;  2JXM B;  4L8J A;  5M5X B;  2F0E A;  3X3M A;  1XTC D;  2CHB D;  2ZT9 C;  3T51 B;  1EY5 A;  2XVS A;  3Q6S A;  4FO2 A;  1HHV A;  2DN8 A;  2B2Y C;  1RTN A;  3DUZ A;  2BA1 A;  4WJW A;  4OO1 I;  4ZQ3 A;  1VMP A;  3MVV A;  5FK9 C;  3K0Y A;  4PMW A;  2RKS A;  2OF1 A;  3ONA B;  1ZKO A;  1MI2 A;  3LX0 A;  1LT5 D;  3VR4 A;  2K04 A;  2AUK A;  1NUC A;  4K8J A;  3TP5 A;  3H91 A;  1Y1W B;  1LT6 D;  2F0O A;  3RUZ A;  1TS5 A;  5JEA G;  2J7Z A;  3KBG A;  4HSP A;  1C4Q A;  3D8G A;  1BDO A;  4ZLT F;  2EYH A;  1QWY A;  3PUY A;  1QIL A;  4MN3 A;  4OL7 A;  2DNE A;  3LWE A;  1A15 A;  1PZJ D;  5CGK A;  4KK7 A;  3GV6 A;  1EYD A;  3NBI A;  2KVM A;  3L3O C;  2M9V A;  2NBF A;  2PCF B;  4ODG A;  3PO2 B;  3JAM L;  1RKN A;  4BA2 I;  3EJI A;  1XXG A;  1GHK A;  2HUG A;  3R93 A;  5JAV A;  4WRD A;  4XQN A;  2B39 A;  4CJ1 B;  5T1G A;  1TWF B;  5M3M B;  3OMC A;  1G8Z D;  5JVG 3;  1DOK A;  2JSO A;  1VCI A;  4AYB B;  1UUP A;  3KF8 A;  2D2C C;  3SHL A;  1TVX A;  1BXT A;  1D5Z C;  4K5V A;  4PMC A;  5JJZ A;  2F0T A;  1SBB B;  4ZK9 B;  4Y7N B;  1V8Q A;  2MHV A;  3PUX A;  1FD7 D;  4A93 B;  5FOB B;  3T16 A;  1DXM A;  1EYC A;  2I46 A;  1FGB D;  4O1N A;  2L0C A;  3T53 B;  5JVH 3;  1S5D D;  5EKK A;  2KCC A;  2EJG C;  4RGT A;  1QNU A;  2ICE C;  5C4X B;  1O7Z A;  2JE6 I;  3GTK B;  3BDC A;  4CBV A;  4ZKB B;  3KLR A;  4LJZ C;  2N55 A;  1I4P A;  4EQO A;  1U4M A;  3NTI A;  2F3V A;  1S5E D;  4KY7 A;  2SNS A;  3E6Z X;  4BA1 I;  5M5W B;  4RGN A;  1W6K A;  3HOV B;  3GTQ B;  1XX8 A;  3NBH A;  1ONL A;  1JE4 A;  4QCL A;  4FF1 A;  3GTO B;  1EL0 A;  4EVO A;  1JWU D;  2MP1 A;  2GA4 B;  2I07 B;  4F88 A;  4DA2 A;  3RMH A;  3SDZ A;  2EY2 A;  4G4K A;  1IW7 D;  5I2X A;  4KD3 A;  2AQ2 B;  1EWC A;  1OXV A;  3P75 A;  1GUT A;  3LWU A;  1O7Y A;  1PRT B;  1Y8O B;  3NHH A;  1JOK A;  2EZV A;  1CM9 A;  2XWJ B;  4DNR B;  5D3I B;  3TP6 A;  4U67 3;  1HTP A;  5C0X I;  1A6X A;  4K8I A;  1SYC A;  3CRL C;  1LTT D;  3MFG A;  3CRK C;  4HMJ A;  1QCB D;  2HCC A;  1KLG D;  4YIJ A;  3QIA A;  1Z7T A;  4A3E B;  5C4H A;  2D9U A;  5EPL A;  4IUR A;  4KN7 C;  3S9W A;  1SND A;  3HOX B;  3HS0 C;  4B9W A;  4IUN A;  5CV6 A;  1ENA A;  1O80 A;  1TKW B;  3K58 A;  1G2T A;  2BE5 C;  5J1Z A;  3C2P A;  4A3G B;  3TZD A;  1HQR D;  4B08 A;  3HOU B;  1MBY A;  2VXW A;  3NWT A;  3N52 A;  3NE5 B;  4HCS A;  4H13 C;  5DNF A;  4S3S A;  2SNM A;  2ZXP A;  1ET6 A;  1A2T A;  3Q23 A;  1J9O A;  4G7Z C;  3C46 A;  2JA5 B;  1Q8I A;  3DM1 A;  4ME5 A;  1WTP A;  4Q5V A;  2MGS A;  1JB3 A;  2A69 D;  1L0Y B;  2NN6 I;  1CFM A;  1H9M A;  2O4X A;  5C3X A;  2NB0 A;  2NVY B;  1LTA D;  2HDL A;  1O7L A;  1X32 A;  1C8C A;  2ICI A;  1V1P A;  1EY6 A;  1GUS A;  3DXJ C;  1BCP C;  2PNR C;  4IUP A;  4XT1 B;  2K05 A;  5JPM C;  2WKD A;  4LK1 C;  2AUJ D;  2EYM A;  1SSO A;  3L9A X;  1B53 A;  1U4P A;  3FRP B;  1K83 B;  1A3T A;  3DWQ A;  5KGU A;  5J22 A;  1RDP D;  1YNJ D;  3BVZ A;  1DOM A;  3JAM E;  4CHT B;  2F4I A;  3KBX A;  5JEA J;  1ILP A;  2NWG A;  4FXK C;  3ZYY X;  1T5X D;  2F0Q A;  1H9R A;  2C5C A;  3T4A C;  1G2S A;  2BA0 A;  5FO9 B;  2E74 C;  2IL8 A;  3X3N A;  2A6E D;  1R9T B;  4TKO B;  2B2W A;  2KED A;  2R93 B;  1BF4 A;  2KEC A;  4HMI A;  1SNO A;  1F9R A;  3D6C A;  2K03 A;  3NP8 A;  4KJO A;  4BY1 B;  2PMZ B;  2X6L A;  3NSW A;  2K6A A;  4H0L C;  4IFD I;  4FNF A;  2IPK D;  3MXG A;  4DK0 A;  2MUY A;  4K14 A;  1V1P B;  1OXS C;  4IN3 A;  4XTC S;  2DY8 A;  2KQ3 A;  1UNS A;  4BBS B;  3FPP A;  1CA6 A;  4OO1 H;  3TN2 A;  5FLX L;  2EY6 A;  5F2D A;  3M85 A;  1SNM A;  2K28 A;  1I4R A;  1ROD A;  4QUF A;  3C1E A;  4V0B A;  3T56 B;  2WAC A;  1STN A;  2A6H C;  3OPO A;  1SE3 A;  2BCO A;  3ERQ A;  3I70 A;  3SK5 A;  4KKS A;  1F2L A;  3PMF A;  3I4L A;  4OHJ A;  2KA7 A;  2PZT A;  5IGC A;  5IOD A;  1DD2 A;  1E2Z A;  5IGD A;  5KND A;  2IJ0 A;  3DHQ A;  4IUU A;  2K33 A;  3SXH A;  1PRT D;  3OIP A;  2PZW A;  1HA5 A;  3OMG A;  3A54 A;  2F0G A;  2C9O A;  3S15 B;  2B8G A;  4GZY C;  4HAE A;  4DU9 A;  1B1Z A;  2F0V A;  3QO2 A;  1HFG A;  2IWH A;  3A8K E;  4M1U B;  3R2T A;  5M5Y B;  3NWS A;  1AFP A;  1UAP A;  1NSN S;  1HXY D;  1TS3 A;  5K36 H;  1B44 D;  5EBD A;  1SMY D;  2F0J A;  5BN3 A;  3MXU A;  2OXP A;  3FMC A;  1ZYR D;  4EGV A;  5ELF A;  1QE6 A;  1IYU A;  3TDQ A;  3GD7 A;  3S1N B;  3VA5 A;  4H7B A;  4X3U A;  4C1N I;  4PV1 C;  4C3I B;  2YU9 B;  1CTM A;  5EBC A;  4A3I B;  5CV4 A;  3KUP A;  4K6D A;  4WFN 3;  1SFO B;  1SYB A;  5I9P A;  2RQX A;  5CBA E;  4RH6 A;  1CI3 M;  1LTR D;  5C6A A;  3M4O B;  5KIX A;  1Q1B A;  1RJT A;  2B2T A;  4FXD A;  3TP8 A;  2F0P A;  4RKB A;  2IX3 A;  4FVM A;  5C44 B;  2A68 D;  1PLF A;  3U9O A;  3NXW A;  3PUW A;  2F0H A;  1WTV A;  3D4D A;  4X3T A;  3I4N B;  4CKC A;  2K7V A;  1LTI D;  1KNA A;  1IL8 A;  2RA4 A;  2SDF A;  5CV5 A;  4N9T A;  1BCP F;  2EVB A;  2XNA C;  3S2D B;  3MWY W;  2RSN A;  5KYI A;  3MXP A;  3G6J B;  3GTP B;  2RBM A;  4C3J B;  5E1F A;  1D1K A;  3M4Y A;  1J8I A;  2JEA I;  2IT1 A;  1DCZ A;  4QUC A;  5C3E B;  3Q0A A;  2KJX A;  4EQP A;  2M2L A;  3GO5 A;  1HA6 A;  5IT9 L;  5C0X J;  4C3H B;  3A55 A;  1AZP A;  1LO5 D;  1TT2 A;  2E2I B;  1PFM A;  1TWC B;  2A74 C;  3E5S A;  5G3L D;  5LL6 S;  1S5C D;  2SEB D;  1H9J A;  1AW7 A;  4NKL A;  1MGS A;  2JA8 B;  1H9K A;  2EE1 A;  3U9S A;  3FPU B;  4ULL A;  4J6H A;  3I73 A;  3HOY B;  2QCP X;  2F0L A;  4KHV A;  3A8J E;  3FDT A;  2NVT B;  4O42 A;  3MEH A;  5FKA C;  1EIG A;  1PTO C;  4LAA A;  4ZRZ A;  1ZEQ X;  4PNY A;  3BG3 A;  3ERO A;  4XDX A;  2RDG A;  4DNT B;  2JP1 A;  5CV7 A;  1T5E A;  1CZG A;  2CVR A;  2B2U C;  5KRU A;  2AQ1 B;  4I65 A;  4RCN A;  3URY A;  2QKI C;  5CC4 A;  1Y8P B;  3WDN A;  1A3U A;  4FF2 A;  1F2M A;  3D3R A;  3R2I A;  4CJ0 B;  1A2U A;  4ZUI A;  2L5T A;  3TSS A;  3NQT A;  1AZQ A;  2K5Q A;  3N6R A;  1HUM A;  3D4W A;  5M3F B;  3QG1 A;  4BBR B;  1I6H B;  1B3A A;  4OIK A;  2XRQ D;  1ML0 D;  1Y69 U;  2O5I C;  1WTQ A;  2XWB B;  1TWG B;  3OIQ A;  3VR2 A;  1JIC A;  5FO8 B;  1HQM C;  1Q1E A;  5JPN C;  5K36 G;  3MHB A;  3E0J A;  5FLX E;  1HUN A;  4K2K A;  5EPK A;  4KKT A;  3K6O A;  1RCV D;  1EY0 A;  1DJR D;  4F8M A;  2JA6 B;  5BN4 A;  1ENF A;  4NW2 A;  4C3I G;  3P7J A;  3D31 A;  1GHJ A;  4Z9C B;  3K59 A;  2K32 A;  4L63 B;  5K5P A;  1I6V C;  1Q3L A;  5CV8 A;  2WKC A;  1EU4 A;  2IX1 A;  3PO3 B;  3P20 A;  4KI0 A;  4KD4 A;  4QF4 A;  1PXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...