2BDOA

Solution structure of holo-biotinyl domain from acetyl coenzyme a carboxylase of escherichia coli determined by triple-resonance nmr spectroscopy
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
80
structure length
80
Chain Sequence
EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structures of apo and holo biotinyl domains from acetyl coenzyme A carboxylase of Escherichia coli determined by triple-resonance nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biotin
molecule keywords PROTEIN (ACETYL-COA CARBOXYLASE)
total genus 6
structure length 80
sequence length 80
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1999-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2bdoA00
2JEBI 4DNTB 3SDZA 2EJFC 1OXTA 4HR7B 4KN4C 2QF7A 1VF7A 1VF5C 3QJYA 2A6HC 4KHZA 1FYCA 1Z6HA 5KNBA 2Q8IB 3M7NA 5C0XH 3CRLC 3D4RA 4TKOB 1V43A 1DCZA 3FMCA 2PCFB 3NE5B 2DN8A 2NN6H 2EJMA 1OXVA 1Q90A 1Z7TA 2AUJD 3IFTA 3ND8A 1TKWB 2PPBC 1GHKA 1DXMA 1CTMA 3BDOA 5JEAH 4OO1G 1IW7D 4IQZA 1Q1EA 3OW7A 5BN3A 1GJXA 2R6GA 1LACA 2D62A 2E76C 2L5TA 3T53B 2KCCA 3PUXA 3A7LA 3LNNA 1VDZA 3AB9A 1GUNA 2BE5D 3EQLC 2BA0A 1FR3A 3CRKC 2AWOA 3VR4A 2JXMB 1QJOA 2NN6G 4KI0A 1Q1BA 2E75C 4TQUS 3VR2A 1B9NA 4I7ZC 4KKSA 1I6VC 1B9MA 1DD2A 2A69C 1Y69U 3PUZA 2A68D 1Y8NB 1VCIA 1IYVA 1CI3M 1LABA 1H9SA 2D2CC 2ZT9C 3MFYA 1V8QA 2JEAI 4G7ZC 1YNJC 1CFMA 3LWUA 3PV0A 2A6HD 1YNNC 1GUTA 2EVBA 1SMYC 2F1MA 3BG3A 3SE0A 1E2WA 2A6EC 3U9SA 3PUVA 3VR3A 4G7OC 5KNDA 4OGQC 2A6ED 3GD7A 2AUKA 3OOCA 2E74C 2DNCA 1O78A 4JBWA 1H9MA 3OPOA 2O5IC 1TU2B 2DNEA 4XTCS 2KA7A 3T56B 5K36G 1K8MA 1H9JA 1HPCA 3L7ZC 1GHJA 2A68C 1IYUA 1HTPA 4DNRB 3A8IE 1H9SB 2LMCB 2BE5C 3I72A 3N6RA 4LK1C 3WDNA 3M4YA 3ND9A 1OXSC 2CW0C 1E2ZA 1Q12A 2K7VA 2O5JC 2K32A 1BDOA 4KKTA 1G291 2K33A 4RCNA 1ZYRC 2D5DA 3PUYA 1HQMC 1EWHA 4G7HC 3KLRA 3P20A 1Y8OB 1H9KA 2B8FA 1Y8PB 2EDGA 1PMRA 1A6XA 4BA2I 3HGBA 1O7LA 1GUOA 4PV1C 1OXXK 4H0LC 3VR6A 1IW7C 1ZKOA 1E2VA 2EJGC 2JE6I 3FPPA 5A35A 3VR5A 3M85A 3I4LA 4XIGS 1T5EA 3A7AB 4L8JA 5BN4A 4KN7C 3I73A 1GUGA 2IT1A 3IKJA 4JK1C 4LJZC 5K36H 2PNRC 4DK1A 3QIAA 1H9RA 5KNCA 3VA7A 4KMUC 1HCZA 4BA1I 5JEAG 4OO1H 2YYZA 3QG1A 2BDOA 1OXUA 3MXUA 3RLFA 4H44C 2V4DA 3DXJC 1GUSA 2BA1A 3D31A 1ONLA 3PUWA 4DK0A 5C0XG 3A8KE 3H94A 3TZUA 2NN6I 3A8JE 4H13C 2A69D 3T51B 4GZYC 4KKUA 3W3AA 2B8GA 1K8OA 4IFDH 4IFDG 5BN5A 3GQBA
chains in the Genus database with same CATH superfamily
2MFIA 4DNIA 1B53A 4MHEA 4APVA 4LF9L 1VS0A 2HD3A 3CRLC 4YWMA 4KD3A 1V43A 1EYAA 3K59A 1OXVA 1F2MA 4KHVA 1N33L 1TR5A 3ND8A 4K0KQ 2JA9A 4GLXA 3R3OA 1PFMA 4OO1G 2QDBA 1PH7A 1CHQD 3OW7A 4K6LA 1FL0A 2E76C 4JBMA 1WOCA 1I3QH 4KD4A 4A3CH 1HJPA 1B3QA 1X32A 1KNAA 1YIJA 4RA8A 4C3IG 4H02A 4DV2Q 4Y7NH 1EY4A 2AWNA 2R7DA 3G6JB 5M5XB 1BBUA 1V8QA 2OEOA 4DAVA 1VMPA 5DM63 4NDXA 3C2PA 4B3ML 2F1MA 3TS2A 3J80i 4K14A 2A6EC 1OTCA 1GUWA 3UDFA 4DV1L 4BY1G 3OOCA 3STBC 5DAUA 3CC2A 3NBHA 5FO9B 4GNXC 5IYBG 1TWGH 1RDPD 1CQVA 4IPHA 3I7FA 3S17H 2VB3X 1TS5A 1STEA 4A3FB 2UXCL 1TWAH 4WJ4A 1LTLA 1E2ZA 1CT1D 4BY7G 4IPDA 1I50B 4RH6A 2B2YC 2FINB 4JI1L 3SXHA 1Y1VG 1SJED 2EDGA 3E0JA 3SK8A 4B3RL 1QG7A 2OQKA 3P1HA 3HGBA 3HS0C 3C3LA 4ZUJA 1AH9A 3VR6A 4J8QA 4LF9Q 1PFNA 3JAME 3M85A 4A3KG 4DV4Q 3PF5A 1EEID 4DR3L 2Z4IA 3S1RH 2OWOA 4FF1A 5K36H 1ML0D 3M4OH 5D3IB 4R4IA 4IOAA 4L5RC 1HNWQ 2ICIA 1IKMA 1LTGD 1BUVT 1OXUA 3A55A 4OONA 5FJ8H 2Y0SE 1JJ2A 2UXBQ 4H44C 2F0HA 2FFKB 4HMJA 2NVQB 1A0IA 3ICEA 5IYDH 1TY2A 4X65L 3GTJH 2GA4B 2WAQE 5I6YA 2GVBA 1IBLQ 2R3ZA 3KJOA 1A3TA 1VQMA 4KJNA 4IFDJ 5E7NA 2R7ZG 1VQHA 2K4KA 2NVYH 1HZBA 4X3TA 2EQSA 5FLXL 1SR3A 4ME3A 1JE5A 2R93B 2BDNA 3TMEA 5IGCA 3LNNA 2Q2HA 2NTSA 2JJQA 2YTXA 4EQNA 4RG1A 1VQNA 1WI5A 2CW0D 4DR2Q 2PQEA 4OO1I 2KEEA 2Z8LA 1Y69U 4RCOA 3RN2A 4LF4L 2ZT9C 4KY6A 2E2JB 4ZKCB 5EGTA 3DHQA 2E2JH 3PV0A 2A6HD 1K73C 1SNOA 2A74C 2PZUA 1JORA 4QQBX 1K28A 2ZXOA 1Q81C 1PTOD 3H3VC 2IX1A 4NKLA 4OX9L 2O5IC 1X6OA 4LFCQ 4JI0Q 1EY0A 1HFGA 1K0RA 1H9JA 3BU2A 2E2IB 3J7AV 5C4XG 2F3IA 3DWQA 4LUZA 1LTTD 1W3SA 4CDCC 1VQOA 2NVYB 3GTPH 1BF4A 1QCBD 1N32Q 1GOZA 3KF6A 4EX5A 2AHOB 2V1CC 4HIDA 1V1OA 1TWHH 4NB3A 1YITA 1H9KA 1N36Q 3QWNA 4IUVA 3BZKA 3K7AB 1JWUD 1SE8A 3GV6A 2EJGC 1MBYA 3PO2G 1X3PA 4DR7L 3NTKA 1L0WA 3GTJB 1KDCA 2Z6KC 1ASZA 4DUYL 1K3RA 3NHHA 3I4MG 3HRZC 5IYBH 2Y0SB 1ET9A 2JK8A 4CBVA 1GVPA 2Z1CA 4JVZA 2EYMA 1BCPD 5LMNL 2K04A 4IURA 4GS3A 1C0AA 1F9SA 1HZCA 1FJGL 3I4NG 3QO2A 4H13C 4GLAC 4LF6Q 4LF7L 1WCMB 1K8OA 3HOWH 2CQOA 1JCKB 4O42A 4MZ9A 3C46A 1OXTA 2F0GA 1Y14B 2RVLA 4A75A 1IKLA 5JJIA 1B2TA 3E0EA 3PSIA 3LX0A 4A3KH 3NE5B 3DLLA 4JYAL 3I2ZA 2M2LA 4XYOA 2R7FA 5BN3A 1D5XC 1RJTA 1TVXA 1NY4A 3M3YB 3RZOB 3K8AA 2OTLA 1S3OA 4JI7Q 1EY9A 3K81C 4UPAA 4C56C 1BCPB 2JP1A 2L12A 1A15A 5M5XH 4B9XA 1QJOA 1GM5A 3E5SA 1PH9A 1CA6A 1Q1BA 5E3FA 4UP8A 1SLJA 2BH8A 1TQOA 1Q82C 2GVAA 1ILQA 5LMNW 5T1GA 2JA8H 3TBIB 1I4RA 4JYAQ 1CFMA 3FHWA 3K5OA 4LUOA 5M3FB 3NK9A 3X3MA 2KVMA 3F2UA 4DU9A 1G8ZD 4ODGA 3CQZH 2L55A 3OWEB 3E9IA 3HOXH 3NENA 3MTSA 1SYCA 1JR0D 2VS1A 3TEHB 4AYBG 2ALYB 4JI2L 1IBMQ 1N34L 1D1IA 2CVRA 3ND9A 5G3LF 1IL2A 1VQCA 3QB3A 1QB5D 1VQ6A 3MAQA 3AFQA 1NAPA 1D5ZC 1VQLA 3F2BA 3Q22A 3DMUA 3OHXC 3H91A 1PH3A 5IP9H 1YI2A 2MQHA 3S24A 2ZTEA 1PTOH 5A2QE 4LFAL 5JVH3 2KCMA 1AE3A 3K58A 2KBNA 1IXRA 2L15A 5A35A 5IGFA 5DLQE 5EAYA 4C2MH 2KHSA 3I73A 3HOZH 1HZAA 4FXDA 5I9OA 3KBXA 2RCFA 4OWWB 2D9UA 4RWSC 4YCUA 1TS3A 3DWPA 1D5MC 2H1EA 1JOOA 3QG1A 5M5YH 2YU9H 1HA6A 4IFDI 4YY3Q 1FGUA 4HSVA 2AKWB 3GTGH 3T51B 2Y0SG 2F4IA 1X65A 1K8GA 1ZEQX 1XYIA 2NVXH 2HDLA 3UDXA 2G9HD 5CV9A 2K75A 1AFPA 2WAQG 2UUCQ 5D14A 1XMOQ 1QILA 2LS01 2EJMA 3W1BA 3H0GB 5J3BA 3TSSA 2F0QA 4IO9A 2C35B 1CTMA 4JI2Q 4XYQA 2XTIA 1VQDA 2YTYA 2HUGA 2L5TA 3SHLA 4CDFC 5IGDA 1PH2A 3SK4A 3K6OA 4DF7A 3S16H 2VUMH 5LMUL 3S14H 2P5ZX 3SR1A 4CJ1B 3GV3A 1BQQT 1EOTA 1XX8A 2E75C 1CUKA 1Q8IA 5ELEA 4XQQA 3R2IA 4OIKA 1EEFD 1CA5A 1OO9B 4BY7H 4BBSB 1DM0B 1CI3M 4L5QA 3NXWA 1WTXA 3UDGA 1B44D 1VQFA 3CAMA 1I4QA 5ELOA 4ZKBB 3RN5A 3UDIA 1JJGA 3H0GH 4G4KA 4WJ3M 1D1KA 1H9MA 1IHZA 2IY5B 1PZKD 3OTOQ 4N8FA 5EKIA 1ET6A 1PTOF 2IL8A 1MHWC 1BKBA 2PNHA 4A3LG 4DNRB 4B3TQ 3HFZB 4BXXG 1HUNA 2QEXA 1VQAA 1Y1WH 3N6RA 2F0NA 3T1YL 1D2BA 2PQAB 3WOFA 4KKTA 1IL8A 3GTGB 2WFWA 5M3MH 2Q8TA 4DFAA 2L11A 4DR4Q 2F0OA 5FKAC 2MPMA 5M5YB 2ATWA 3Q8DA 4DV4L 4QF4A 1BNZA 1E2VA 3V96A 4K5WA 2JSOA 5I2XA 1J6QA 2E2DC 3WOEA 1MD2D 3HZXA 3FKIG 5IODA 4JI1Q 2LXJA 1VQ4A 3SVMA 2I46A 4MNOA 1XNRL 3BVGA 4NXML 2UXCQ 5M5WB 3A8JE 5C0XJ 1F77A 1N8RC 1IBKQ 1QWYA 4IFDH 3C1EA 2AQ2B 3JAML 2HCIA 1E7ZA 4UHVA 5I6WA 5E1FA 1TWCH 3VYRA 3KF6B 3EA6A 4KHZA 4E6IA 2KHIA 1NR4A 1IYJB 3D4RA 3I3CA 3FMCA 2PCFB 4I65A 4TKOB 4F8MA 2ZM6Q 1JMCA 3NWSA 2HHHL 3W5OA 3TRZA 1HNZQ 1LTBD 1S72A 1KL9A 4R4TA 1GJXA 4HAEA 1DOLA 1BBWA 2F0SA 2LXKA 4PMBA 5HY6A 4O1NA 3KLSX 2I5HA 3R8BA 2JXMB 1KRTA 2DGYA 4RGNA 2NVQH 2CH4W 3VR2A 2TSSA 1JC7A 3CCVA 1WTWA 1STNA 1VQIA 3PUZA 2JA6B 2XRSD 3T4AC 2E5LL 3D0FA 3I90A 1N33Q 2RF4A 3K7UC 4DA2A 2F0DA 2VZAA 5LL6X 2IJ0A 2OCEA 2VNUD 2NTTA 3R2TA 2WV6D 1H95A 4Y7NB 3RZDB 4KY5A 3QOJA 5GADC 1C7YA 4XQJA 3S2DH 1I3QB 4KJOA 4IN3A 5FLMH 3GTKB 1KLUD 4GN3B 4A3IB 3KJPA 1DGSA 3HOWB 5IIFA 3NBIA 3SEBA 2K33A 1TWFH 3PGZA 4G7HC 5JAVA 4YY3L 1Q3LA 3UE0A 5DNFA 2ID0A 5C0XI 5E4XA 4NXNL 2ZM6L 1S5DD 4K8JA 2JE6I 2NBFA 3U50C 2A8VA 2L1BA 2HT1A 2B2TC 5IP9G 1UE5A 1SNQA 1PZID 1ZYRD 1UNSA 1XTCD 2J7ZA 3OW2A 4A3BB 3TP5A 3BYTB 1AE2A 3PIPA 1YHQA 3GTOB 3F2DA 1NUCA 4FNFA 4LFAQ 1STGA 2I07B 2L9HA 1SROA 4XT3B 3HOXG 2DY7A 2JA5H 1F9QA 3OMCA 1LT6D 4GKJL 1T9HA 4A3FG 3ZJYC 1V1PA 2B2YA 2ZTCA 1X3EA 3TP8A 1WD1A 2PO4A 3HOWG 2IX3A 3M3YH 2QF7A 1RL2A 1JB3A 4PNYA 1K83B 2O4XA 4OELB 1XNQQ 3MVVA 1I4PA 5CV6A 3NTIA 1GHKA 3DM1A 1G51A 2B2VA 1EZ6A 3KOJA 4K2KA 5C4ZA 2JA5B 4DUZL 2H4OA 3KFUA 3M4PA 2YV5A 3D4DA 4FXGC 3M4QA 4KI0A 1M8AA 4RHRA 4A3EH 2PYKA 4KLKA 3GTOH 5CMDA 1B9NA 3HOVG 4LF5Q 4RAUC 3OTOL 3S15B 1KHIA 3BDCA 1KAWA 3MFYA 1TY0A 3NELA 3URYA 4A3MB 2R7ZH 3PO2B 1BR9A 4P71A 3CCJA 1HZ9A 4DPGA 1E2WA 3CF5A 4X3SA 3I4MB 2ZJPA 5KNDA 1S4ZA 4EVOA 1DOKA 5C5LA 2DNEA 3A5UA 1Z9FA 1K8MA 1HPCA 4L6TB 1W6JA 3J7AF 5LMUQ 4C3JH 1CSPA 3I72A 3S1QB 3HOUH 4C3JB 5BR8L 3J7YW 4QIWB 4AH6A 4LF7Q 4LF6L 2K32A 2E2IH 1DJRD 1JE4A 1VQ7A 2F4VL 4XDXA 3NUCA 1C8CA 1C48A 1XMOL 2LY7A 4BS9A 3ITPA 1X54A 2K5WA 1VQ5A 1T5EA 5JEAJ 1QNKA 4R4CA 5IP7G 3AYHB 4BXXH 4LJZC 1VQKA 1SAPA 4DK1A 1STAA 3FDTA 2KEDA 3QR8A 4KMUC 1J9OA 4DK3C 3S1NH 1I4GA 4N9TA 3TP7A 2KCTA 4JI4L 4LNQA 2DY8A 3I4OA 2ZJRA 4DR1L 3UI2A 3HOYB 4J15A 5JJZA 2XWBB 2F0FA 3U4VA 4HR7B 1E1OA 2QILA 1EU3A 4K5VA 1VF5C 1PTOB 2A6HC 1EIGA 2CWPA 3W1GA 1C9OA 4DV7Q 5KNBA 2UUAQ 2MGSA 1G2TA 5FO7B 1I94Q 5C3XA 4B08A 4IQZA 4A3CG 1Q1EA 4DR5L 4YHHL 4A3BG 1HA5A 3A56A 3ULJA 1HNXQ 3W2DA 5C3WA 3RLOA 1SN8A 2CWAA 3CRKC 3Q24A 2WKDA 2Z6KA 5C3EG 1FD7D 5JPMC 5KIXA 4H7BA 4HJ7A 4LFBL 4DKAC 1WD0A 3ULPA 5M3MG 4DR5Q 1VCIA 1X3GA 5HGTA 1SFOH 5C44B 3BJUA 2EVBA 1E22A 3S1MH 4AYBB 3K80C 4KY7A 4XQNA 1VQJA 2A6ED 1VMCA 5M3MB 2RQXA 2DNCA 3OPOA 3AQQA 2F0PA 1YNJD 3Q6SA 5IGBA 2TMPA 2WP8J 1RF2D 1LV9A 2JA8G 2K5DA 3C1FA 4DV5L 1HFNA 1CKOA 5CORA 3L3OC 4A3DB 3PCOB 1CKNA 1KDBA 4X65Q 1T5XD 2CH4A 1O7IA 2KCNA 1TIID 3ERSX 4A93G 3NWTA 4YCVA 1J5EQ 1OXXK 3H3VI 3K0YA 1U0LA 5CGKA 4LWCA 2DJGC 1WTQA 3ERQA 3KF8B 4QIWE 2VQEQ 3QIAA 1H9RA 2K01A 4JG2A 5EBDA 2R92G 1B4OA 1AW7A 2B2VC 4BBRG 5C0XG 1BBXC 5FLMG 3VDYA 4BBRH 4HSPA 4TVAB 1EWCA 3CP0A 1WTVA 3S1QH 4XT1B 2MUYA 1QNUA 2R92B 2J0TD 5C3EB 4A3JG 1CKNB 3GTMB 3TQYA 4JBJA 1LO5D 4MN3A 5IYCG 1EQQA 5F2DA 5FJ8G 4DV5Q 2PPBC 5C4JH 2NVXB 1VQEA 1IW7D 4JI5Q 1MJEA 3K0XA 4A3EG 1PVOA 4GKKQ 4JV5L 2ASBA 1Y1VH 2KCCA 4L63B 4IOCA 3GDEA 2PZTA 1EQRA 3S15H 2CHBD 5DEHA 1NCVA 5CBAE 4DUZQ 1UWVA 3H09A 1STYA 1I6VC 1SYDA 3KK7A 4PZ6A 3CW2C 4CKBA 4QGUA 1E0BA 4HN7A 2QGQA 5JPNC 2B29A 4HJ9A 4KHPQ 4R9WA 5KRUA 1BO0A 5CV5A 1LLRD 4IZ8A 4A3IG 2AUKA 5I9PA 4JBWA 4A3DH 3DEOA 3T56B 5EPJA 1G2SA 1SYEA 2NWGA 4P73A 1PA6A 2Q8RE 3D3RA 4DV0L 4RHSA 1SJHD 2BE5C 1PHJA 1SE3A 2PI2E 3G7LA 5C4JB 4X64Q 2UU9L 2JYOA 2HQLA 4P74A 2EYFA 3NBHB 3KLRA 1PH4A 2ZXPA 1JWSD 3CMAA 1BCPF 1O80A 1LTRD 4MIUA 5IOCA 1SBBB 2EYPA 3X3NA 1O7ZA 4H0LC 5IYCH 1ZKOA 3FPPA 2MNAA 3S2HB 5GAEC 4NXNQ 3NQIA 4OL7A 3V05A 4QMGA 2WACA 4JI4Q 5KNCA 1R9TH 2E2HH 4U68A 4X62Q 4BA1I 2Q2UA 2RSNA 4BY7B 4F7XA 4CJ0B 3T1HL 4R4QA 3TN2A 3DUZA 3PUWA 5TSSA 1JOKA 4HIMA 2MHVA 2QDLA 2X69A 3S16B 3W3AA 5E4WC 1L0YB 1RHPA 2F3VA 1NMFA 1NNXA 2EY6A 4DV0Q 1VF7A 4IUTA 2D0PA 4RMFA 5JJLA 4DV3Q 1PYWD 1DONA 2CKZB 3D6CA 1CZGA 4V190 1L2FA 1BVSA 3O13A 4A76A 4I7AA 3I70A 2E5LQ 1C4QA 1DXMA 4QJFA 1I6HH 4CDDC 1E1TA 1ESRA 4LF8L 2IWHA 1G91A 1VQ9A 2FMCA 2OQ0A 1VDZA 3RMHA 1LT5D 2BE5D 3CCLA 4UP7A 2F0TA 4GN5A 3HOUG 3MC0B 2EE1A 5I4DA 5IGGA 2WB1B 1XJVA 2YU9B 1WTRA 1FNUA 1LUZA 5CC4A 2NB0A 4N9PA 1JOQA 1HNZL 3PO3B 3OMGA 2PQAA 4BY1H 2HHHQ 5C44H 2VW9A 1ICWA 5ELBA 1MGSA 1PZJD 3NEMA 1MKHA 3GD7A 2JA6G 1M1KC 1TU2B 4B9WA 4PZ8A 1PRTC 4DV6L 4HJ5A 3KYHC 1GXDC 1TWCB 2PMZB 2XN9C 1X55A 2OF1A 3KUPA 4HCSA 1XXGA 4PQXA 2RDFA 4UAIA 3PIP3 3M4YA 1B7YB 1XNRQ 5KYIA 1U5KA 2MO1A 1R4QB 4ALPA 2EY1A 5A2QL 1TT2A 3FKIH 4IUUA 1KXLA 2C5CA 2KJXA 5T1IA 4A3MH 2R7ZB 1R9TB 2E2HB 1NR2A 1LTID 5M3FH 2VQEL 2F0VA 4JC0A 5C5MA 1WTHA 4BY1B 2NYZD 1KAAA 3PO3H 4IJLA 1LYLA 1FNVA 1A62A 2YYZA 1PV4A 1J5EL 2F0JA 2RDGA 4OEMB 1EQTA 1Q8KA 5FLXc 4YWLA 4R1JA 1W2BA 1PLFA 1F2LA 3R93A 4ILWA 3I4NH 5J22A 4ID6A 2A69D 4A3JH 1V1PB 4RGMA 3H15A 4GN4B 2B3GA 1F9PA 1ENCA 4IALA 4QUFA 1F2ZA 2EJFC 3HOZG 1SDFA 4YIJA 5M3FG 4AQYL 1FYCA 4LAAA 3MEFA 2Q2TA 2N88A 5C3EH 2DN8A 3IL8A 2NN6H 5IY0A 2R92H 4P72A 4C3IH 4NP5A 3E6ZX 4WFN3 5J39A 3J81c 4JW0A 2QKIC 2QA4A 3HOVB 2UU9Q 4WRDA 1QE6A 3PUXA 3AMUA 4AYBE 3VR4A 3J80L 2WIIB 1SE4A 1HTLD 3BS1A 2N55A 2R61A 3M4OB 2OTJA 1K3BC 2ZJQA 2D2CC 1PTOC 4FF3A 2UUBQ 5GAHC 2X6LA 1GUTA 1SYFA 1AP0A 1MI2A 4C3HB 1A2UA 2F3WA 1XPOA 3S2HH 2UUCL 3FP9A 3U9OA 1UEAB 2RHSB 4V0BA 3GTQB 1LT3D 1SYBA 1EUJA 4CGYB 1PH8A 3G48A 4QL5A 3TREA 4HJAA 5K36G 4WORA 3J81L 4A3FH 1SNMA 3T16A 4M8AA 2JA5G 4X3UA 3TS0A 1XPRA 4BWGB 1V1QA 4IUQA 5IT9E 1QVGA 1UE7A 4C3IB 4JV5Q 1ZYRC 3RZDH 4JI5L 3MWYW 2B8FA 3KBGA 5EKLA 5KEEA 5EBCA 4G57A 1S5FD 3SK5A 1RODA 3CPWA 1IW7C 3BZDB 1IBKL 4FF4A 2M9VA 4JK1C 3I4NB 5EQ0A 1LT4D 3CD6A 1Q46A 3CHBD 2SNMA 4FVMA 3FPUB 3AU7A 3MXUA 1SSOA 4K5XA 2F4VQ 4DK0A 1RD9D 4B3SL 3D6WA 2NN6I 3BYYB 3B6YA 1A8VA 1PXUA 5CBEE 5BR8Q 4FXKC 4HJ8A 2WINB 3CC4A 5AFWA 1NE3A 2D0OA 3A0JA 2IW3A 4KN4C 1SMYD 4L5SA 2VUMG 1KDAA 1DCZA 2AUJD 1EWIA 3ONAB 3GTMH 1CQFA 2ES2A 2K05A 1XPUA 1XTDA 4B3TL 4DR6L 3GTKH 5D3DA 5GAGC 5CYUA 3T53B 3A7LA 1KIXA 5KYLA 4K8IA 2K14A 2PI2A 4CKEA 4JI7L 1QOHA 3T13A 4UP9A 5K5PA 2XVSA 1STHA 1TS2A 3K5MA 2A68D 1LABA 2EOTA 4G7ZC 1YNJC 5EPLA 3LWUA 3RZOH 1QVCA 1ENAA 5ELDA 2JA6H 1E3PA 5AJ3Q 2QEJC 1I4HA 3P75A 4PZ7A 4ME5A 2NUCA 1O78A 3J80E 1JT8A 4A3DG 4P2CB 4LFBQ 5IWAQ 3UE1A 3HOUB 1Y1WB 2EYOA 4JOIC 1X3FA 3I8ZA 1WJJA 3WDNA 3MZ5A 5LMNQ 3KLSA 3MHBA 2O5JC 4PG3A 1HNXL 1WVLA 2IHEA 1BDOA 3J80c 1K9MC 3JAMi 4GKJQ 4YHHQ 2KOLA 4JBKA 1Y8PB 3GP7A 3Q23A 1AZQA 3S1NB 1F9RA 2QW7A 4C3HH 1I94L 3BVZA 3I56A 4C3JG 4DR7Q 3PO2H 2JA7B 3M7GA 1ASYA 5BN4A 4JPBW 1RIPA 3HKSA 1N36L 2GN5A 2HCCA 2K5NA 4OWXB 1M4VA 1RCVD 1NBWA 3EBEA 5EJWA 3RLFA 4JI6L 4LMQD 2BA1A 3A74A 4ZAIA 1TWHB 1ONLA 3H94A 3TZUA 2B2TA 2FMMA 2B63B 5JVG3 5I2YA 3CCUA 1UAPA 2NZHA 5EPKA 2CCZA 1KLGD 3GTLB 4OHJA 4LFCL 1U9RA 2VQFQ 2I0QA 1G6ZA 2RKSA 5LHY1 2PW7A 2PZWA 3DEPA 4ULLA 4HIOA 4LUVA 3SGIA 1Z7TA 1Q90A 1IBML 5L37A 5IT9L 4OWTB 3F8TA 4LF4Q 4A3JB 2LKVA 1CM9A 1KTKA 1HUMA 2RBMA 4DR2L 3G4SA 1GUNA 3EQLC 3MFGA 2LSSA 2CFMA 3RNUA 2AWOA 5EKKA 3FVQA 4A93H 4EQOA 1SE2A 2FJ2A 1KABA 1DD2A 1VQ8A 4Q5VA 3MXNA 4A3BH 1Y8NB 1EL0A 3DWAA 3H0GG 4A3GB 4DGZA 3BG3A 1YJNA 3SE0A 3E3XA 1QZGA 4RKBA 4J6HA 3PQIA 2XRQD 4KK7A 2EZVA 2EY5A 2F0MA 4G7OC 3EROA 2YTVA 4BBSG 2PW5A 3S14B 4XTCS 2KA7A 1X3QA 1K83H 4ZQ3A 3MXPA 4OXPA 4IUNA 1WTOA 1Y1VB 4A3IH 3S9WA 2A68C 4X66Q 1YJWA 3FEWX 2G5DA 1SNDA 4ZRZA 5ELFA 4QCLA 2ICEC 2HQEA 3JAMc 1Z47A 2WKCA 3K5NA 3L9AX 1B3AA 4JI8Q 3K57A 1G291 2N3SA 1I5FA 3IFDA 2D5DA 3PUYA 4R8NA 1EWHA 3VYSA 1U4PA 2SNSA 4C1NK 2XIWA 4NXMQ 4PV1C 4GOPB 1STBA 5CV7A 2FXQA 3J7ZC 1K0SA 3S1RB 5CV4A 4KN7C 1GUGA 4GOPC 4B3SQ 3CU7A 2PNRC 1MSHA 2MP1A 2K1BA 4KV6A 2DJFC 3WWVA 5JEAG 2K6AA 2BDOA 1A3UA 5C4HA 2JN4A 1P16A 4A3EB 4DR4L 2N78A 2RHQB 4DXGA 1TXYA 4JI8L 1CZWA 4C1NI 3T1YQ 1VQPA 4F87A 1JB7A 4ABNA 4A3KB 3F1ZA 4O0AA 4X66L 5CV8A 3FKIB 1TWGB 5C0XH 1KNEA 3TDQA 3IFTA 4CJ2C 3NPPA 5GQOA 4A4IA 3FRPB 3S1MB 2R6GA 3ZYYX 1EYDA 3J81i 1NTGA 5M5WH 2H5XA 3KF8A 1SFOB 5ELNA 4OX9Q 3I91A 3CQZB 2B63H 1FVIA 1AN8A 3IRBA 3CCQA 4TQUS 1YNXA 4AIMA 1Y1WG 1SYGA 3AEVA 2IX0A 3A54A 1RTNA 2A69C 4IUPA 2L0CA 2UUBL 2HIXA 4POGA 2KQ3A 2NZOA 3QOLA 5IYDG 4CKCA 5H1SE 1AZPA 3D4WA 1LM0A 3VR3A 4Y52H 2ZTDA 3HG9A 2A1AA 1EYCA 1SNCA 2AMCB 2WB1E 3JC66 2B2UC 3GTPB 1Q7YC 4NW2A 1TWFB 2A5HA 1U4RA 1EY7A 1IYUA 1JWMD 3A8IE 4GNXB 3AFPA 2LMCB 4F88A 1KC8C 3M9BA 1K8AC 4J1MA 4FO2A 3HOYH 2CW0C 5ISRA 5C44G 2K7VA 1DYQA 4RCNA 1Q86C 4RKLA 2EYHA 4R4OA 4C3HG 4X62L 1NSNS 3P20A 1Y8OB 1V9PA 3RLNA 2NVTB 4AQYQ 3J81j 1PH6A 4JI6Q 4R8IA 1YJ9A 4POFA 4GNXA 2AQ3B 1G6PA 3VR5A 4TRDA 4XIGS 1WCMH 1II3A 3A7AB 4L8JA 1SNPA 2B39A 2VY3A 4QY7A 3VA7A 1EY5A 4OO1H 3ULLA 3OSOA 4X64L 2SDFA 3DXJC 1GUSA 2K5HA 3RR5A 4DAMA 2X6GA 5C4XH 2A73B 1ICFB 4DR3Q 3CC7A 1PDQA 1B50A 4L5TA 1JICA 2EYJA 2EY2A 2O2LD 2B8GA 5JJKA 4DXFA 4IFDG 4HTHA 4JI3Q 2JEBI 1UEBA 3SDZA 4FP5D 2HIVA 2VL6A 2Z9HA 3I55A 2R93G 3KDFA 3N52A 1L1OB 3MXNB 4DAYB 2K5VA 1EFWA 3M7NA 2XWJB 1U4LA 5NUCA 2ENBA 5IWAL 4KHPL 1S5ED 3PO3G 1L1OC 2B2UA 1ENFA 3ER0A 3BDOA 3I4MH 1PH1A 2B2WC 5M9OA 4BBRB 2RDHA 1PRTB 1PYSB 1WTPA 5C4XB 4UDUC 4DV6Q 1XMQQ 4PMWA 3J81E 3U4ZA 4IJHA 2BA0A 2MO0A 1W6KA 3HP3A 3KDFB 4YCWA 2UXDQ 4DV1Q 2BCOA 4K6DA 4I7ZC 4KKSA 2F03A 4HCEA 4GKKL 1EZ8A 1GKHA 1P8LA 4A3LH 4B3MQ 1D8LA 1LTAD 2VUMB 2JEAI 3F2CA 4A3GH 1PRTD 2OT2A 1YNNC 3OYYA 1QVFA 1SMYC 4QUCA 4DR6Q 1YNND 1A3VA 3NTHA 2BH2A 2RSOA 1I50H 3HKZE 4JOIA 1F2YA 1TWAB 2G9DA 4IPCA 3NP8A 1GHJA 2ZXRA 2B63G 4LK1C 3PIOA 4K0KL 1OXSC 4A3MG 3RD4A 4A3GG 1Q12A 3GO5A 1HQMC 1E24A 4DV3L 1WYDA 4RGTA 3OWFA 1CHPD 4ZCKA 1LTSD 2L4NA 5G3LD 3GTLH 4FF2A 4IPGA 1EFID 2K28A 1I4XA 1U4MA 3I4LA 5JOBA 3CCMA 3U58A 4DUYQ 1YVCA 5FOBB 3J7A5 3H3VH 1ESFA 2VQFL 4GOPA 1BXTA 3KLWA 3TZDA 3G71A 1HH2P 3T1HQ 3L0OA 1HR0W 3CCEA 4TSSA 2A19A 2LFNA 1PYBA 1KD1C 1A2TA 1AEXA 1PFSA 2EXZA 3RUZA 1S5CD 4QB4A 2EXDA 5FK9C 5CR3A 2N8NA 4KKUA 1B1ZA 1N32L 1JQYD 3SK6A 5BN5A 3GQBA 1MSGA 4ZLTF 4DNTB 3IAYA 1PFBA 3G6EA 3HOVH 1D7QA 3QJYA 4X3KA 1B8AA 3S2DB 2Z0SA 4JI0L 3E9HA 1WCMG 3EJIA 1NJIC 3L2PA 1IZ6A 2K5QA 1EQVA 1BCPC 2FHTA 4ZYSA 1HR0Q 1N34Q 4ZUIA 1FR3A 2NN6G 1HXYD 4CHTB 4JCVE 4CDEC 1X56A 1HR0L 2EPBA 2Z4HA 4P75A 1RKNA 2F0UA 1IYVA 3CCRA 4YWKA 2E8GA 5FO8B 1PRTF 4NPSA 4DAPA 2JQOA 5DM73 3HOZB 3EN2A 5AJ3L 1MJCA 3U9SA 2UUAL 3HKZB 2F0KA 2E74C 5HURA 1HHVA 2XNAC 1DZ1A 2IHFA 2NVTH 1L0XB 3A5ZB 4N8X1 2B2WA 2F0WA 2WB1G 4MTNA 1HTPA 1HQRD 1H9SB 4OIJA 2CQAA 3MEHA 2Z6BA 1CSQA 1ZXTA 1PH5A 2HDMA 1B70B 3OIQA 5IP7H 3HOXB 1J8IA 2NZ1D 4MTKA 2F52A 2XGTA 4FDBA 1PMRA 4X6AH 2UXBL 1YHAA 3HOYG 3H6MA 4BA2I 4K2LA 1A6XA 2C9OA 1YBYA 1EY6A 1WFQA 1A63A 1HNWL 2IT1A 3IKJA 3PF4A 2Q2IA 4Z9CB 1XWEA 3K7AH 3P7JA 4A93B 2JA8B 1HCZA 3MXGA 1EOVA 3TP6A 3EIVA 4ZK9B 4HEDA 1FJGQ 4B3RQ 4Q0FA 2V4DA 1X9NA 3D31A 5HGQA 4O2DA 1DOMA 1N9WA 4KTAA 1L1OA 5C6AA 2RA4A 1TS4A 2PMZE 3CPFA 1EIYB 5FLXE 5IGEA 3OIPA 2KUMA 2I5MX 2MJ8A 2K03A 4HMIA 3NQTA 1I6HB 1FGBD 2RCNA 1Z6HA 2Q8IB 2DUDA 2J4XA 1YEZA 2JA7G 1TKWB 2EYLA 5JEAH 5LL6S 2XSCA 3VYTA 1LACA 2D62A 4LF5L 1EIFA 3NSWA 1KRSA 2F0EA 2UXDL 1NMGA 3AB9A 1YZ6A 3GTQH 2AQ1B 1XMQL 2WAQB 3CCSA 2EIFA 3PMFA 5IE8A 1B9MA 4HIKA 2KENA 3MA2B 4DV2L 1MIUA 3STBD 1JJCB 1H9SA 4WJWA 3CKIB 2JA7H 3LGJA 1BOSA 4LW1A 1FNWA 4DK6C 5D65A 1XNQL 1R4PB 4BBSH 2R93H 1HRJA 1UE6A 4EQPA 4LF8Q 3PUVA 1VQGA 2F0LA 1QUQA 3V2TA 4OGQC 5GROA 1SEBD 1M90C 1D6EC 3EFXD 3BDLA 4JI3L 3CMEA 1CKMA 4NMZA 1YHBA 3HEJA 4XXEA 3LWEA 5IT9c 2N49A 3L7ZC 1ILPA 1EY8A 5COYA 3VYUA 3S17B 2QCPX 3HKZG 4DN4M 1CK1A 2I5LX 2IPKD 2M00A 2K52A 1UUPA 5KGUA 1SRUA 1EU4A 1RTOA 2SEBD 1SMXA 1GO3E 3VA5A 4UY8C 4DV7L 2K50A 4RGOS 3BVMA 3D8GA 3CXCA 1O7LA 1GUOA 4EQ5A 4FYDA 1VQBA 2KHJA 1EYGA 1KQSA 5J1ZA 4DR1Q 1IBLL 4C2MB 4EGVA 1GD7A 4S3SA 3PIO3 2F0IA 3K5LA 1EIHA 1QZHA 2SOBA 3DM3A 1S40A 2VB2X 4DAYA 1S5BD 4M1UB 4U673 2OXPA 1SXTA 4RFBA 2VXWA 3A8KE 3Q0AA 5ELCA 4GLVB 2KECA 1QUQB 2BOSA 4GZYC 3BZCA 3EVQA 1O7YA 4PMCA 1UE1A
chains in the Genus database with same CATH topology
1B53A 4MHEA 3CRLC 4KD3A 1V43A 1EYAA 3K59A 1OXVA 1F2MA 4KHVA 1TR5A 3ND8A 3R3OA 1PFMA 4OO1G 2QDBA 1CHQD 3OW7A 4K6LA 2E76C 4KD4A 1X32A 1KNAA 4RA8A 4C3IG 1EY4A 2AWNA 3G6JB 5M5XB 1V8QA 2OEOA 4DAVA 1VMPA 5DM63 4NDXA 3C2PA 2F1MA 4K14A 2A6EC 1GUWA 3OOCA 5DAUA 3NBHA 5FO9B 1RDPD 1CQVA 2VB3X 1TS5A 1STEA 4A3FB 1E2ZA 1CT1D 1I50B 4RH6A 2B2YC 2FINB 3SXHA 1SJED 2EDGA 3E0JA 3SK8A 1QG7A 3P1HA 3HGBA 3HS0C 3C3LA 4ZUJA 3VR6A 4J8QA 1PFNA 3JAME 3M85A 1EEID 2Z4IA 4FF1A 5K36H 1ML0D 5D3IB 2ICIA 1IKMA 1LTGD 1BUVT 1OXUA 3A55A 4H44C 2F0HA 2FFKB 4HMJA 2NVQB 1TY2A 2GA4B 5I6YA 2R3ZA 1A3TA 4KJNA 4IFDJ 4X3TA 5FLXL 2R93B 2BDNA 3TMEA 5IGCA 3LNNA 2NTSA 4EQNA 2CW0D 2PQEA 4OO1I 2KEEA 2Z8LA 1Y69U 4RCOA 2ZT9C 4KY6A 2E2JB 4ZKCB 5EGTA 3DHQA 3PV0A 2A6HD 1SNOA 2A74C 2PZUA 1JORA 2ZXOA 1PTOD 3H3VC 2IX1A 4NKLA 2O5IC 1EY0A 1HFGA 1H9JA 2E2IB 3J7AV 3DWQA 1LTTD 2NVYB 1BF4A 1QCBD 1GOZA 1V1OA 1H9KA 3QWNA 4IUVA 3K7AB 1JWUD 3GV6A 2EJGC 1MBYA 1X3PA 3NTKA 3GTJB 1KDCA 3NHHA 3HRZC 2Y0SB 1ET9A 4CBVA 2Z1CA 2EYMA 1BCPD 2K04A 4IURA 1F9SA 3QO2A 4H13C 1WCMB 1K8OA 1JCKB 4O42A 3C46A 1OXTA 2F0GA 2RVLA 1IKLA 1B2TA 3LX0A 3NE5B 2M2LA 4XYOA 5BN3A 1D5XC 1RJTA 1TVXA 3M3YB 3RZOB 1EY9A 4C56C 1BCPB 2JP1A 2L12A 1A15A 4B9XA 1QJOA 1CA6A 3E5SA 1Q1BA 5E3FA 1TQOA 1ILQA 5T1GA 3TBIB 1I4RA 1CFMA 3K5OA 5M3FB 3NK9A 3X3MA 2KVMA 3F2UA 4DU9A 1G8ZD 4ODGA 2L55A 3OWEB 3MTSA 1SYCA 1JR0D 1D1IA 2CVRA 3ND9A 5G3LF 3QB3A 1QB5D 3MAQA 1NAPA 1D5ZC 3Q22A 3DMUA 3OHXC 3H91A 1PTOH 5A2QE 5JVH3 3K58A 5A35A 5IGFA 2KHSA 3I73A 4FXDA 5I9OA 3KBXA 2D9UA 4RWSC 1TS3A 3DWPA 1D5MC 2H1EA 1JOOA 3QG1A 1HA6A 4IFDI 4HSVA 3T51B 2F4IA 1ZEQX 1XYIA 2HDLA 2G9HD 5CV9A 1AFPA 5D14A 1QILA 2LS01 2EJMA 3H0GB 3TSSA 2F0QA 1CTMA 4XYQA 2HUGA 2L5TA 3SHLA 5IGDA 3SK4A 3K6OA 4DF7A 3SR1A 4CJ1B 3GV3A 1BQQT 1EOTA 1XX8A 2E75C 1Q8IA 4XQQA 5ELEA 3R2IA 4OIKA 1EEFD 1CA5A 1OO9B 4BBSB 1DM0B 1CI3M 3NXWA 1WTXA 1B44D 1I4QA 4ZKBB 4G4KA 1D1KA 1H9MA 1IHZA 1PZKD 5EKIA 1ET6A 1PTOF 2IL8A 4DNRB 1HUNA 3N6RA 2F0NA 1D2BA 3WOFA 4KKTA 1IL8A 3GTGB 2Q8TA 4DFAA 2L11A 2F0OA 5FKAC 2MPMA 5M5YB 4QF4A 1BNZA 1E2VA 3V96A 4K5WA 2JSOA 5I2XA 2E2DC 3WOEA 1MD2D 3HZXA 5IODA 3SVMA 2I46A 3BVGA 5M5WB 3A8JE 5C0XJ 1F77A 1QWYA 4IFDH 3C1EA 3JAML 2AQ2B 2HCIA 5I6WA 5E1FA 3VYRA 3EA6A 4KHZA 4E6IA 1NR4A 3D4RA 3I3CA 4I65A 3FMCA 2PCFB 4TKOB 4F8MA 3NWSA 1LTBD 1GJXA 4HAEA 1DOLA 2F0SA 4PMBA 4O1NA 3KLSX 3R8BA 2JXMB 4RGNA 3VR2A 2TSSA 1JC7A 1WTWA 1STNA 3PUZA 2JA6B 2XRSD 3T4AC 3I90A 4DA2A 2F0DA 5LL6X 2IJ0A 2VNUD 2NTTA 3R2TA 2WV6D 4Y7NB 3RZDB 4KY5A 3QOJA 4XQJA 1I3QB 4KJOA 4IN3A 3GTKB 1KLUD 4A3IB 3HOWB 5IIFA 3NBIA 3SEBA 2K33A 4G7HC 5JAVA 1Q3LA 5DNFA 2ID0A 5C0XI 5E4XA 1S5DD 4K8JA 2JE6I 2NBFA 2L1BA 2B2TC 1SNQA 1PZID 1ZYRD 1UNSA 1XTCD 2J7ZA 4A3BB 3TP5A 3BYTB 3GTOB 1NUCA 4FNFA 1STGA 2I07B 2L9HA 4XT3B 2DY7A 1F9QA 3OMCA 1LT6D 1WD1A 1V1PA 2B2YA 3TP8A 2PO4A 2IX3A 2QF7A 1JB3A 4PNYA 1K83B 2O4XA 3MVVA 1I4PA 5CV6A 3NTIA 1GHKA 3DM1A 2B2VA 1EZ6A 4K2KA 5C4ZA 2JA5B 2H4OA 3D4DA 4FXGC 4KI0A 1M8AA 4RHRA 2PYKA 5CMDA 1B9NA 4RAUC 3S15B 3BDCA 3MFYA 1TY0A 3URYA 4A3MB 3PO2B 1BR9A 1E2WA 4X3SA 3I4MB 5KNDA 1S4ZA 4EVOA 1DOKA 5C5LA 2DNEA 1K8MA 1HPCA 4L6TB 1W6JA 3J7AF 3I72A 3S1QB 4C3JB 3J7YW 4QIWB 2K32A 1DJRD 1JE4A 4XDXA 3NUCA 1C8CA 1C48A 2LY7A 4BS9A 3ITPA 2K5WA 1T5EA 5JEAJ 1QNKA 4LJZC 1SAPA 4DK1A 1STAA 3FDTA 2KEDA 4KMUC 1J9OA 1I4GA 4N9TA 3TP7A 2DY8A 3UI2A 3HOYB 5JJZA 2XWBB 2F0FA 4HR7B 2QILA 1EU3A 4K5VA 1VF5C 1PTOB 2A6HC 1EIGA 5KNBA 2MGSA 1G2TA 5FO7B 5C3XA 4B08A 4IQZA 1Q1EA 1HA5A 3A56A 3W2DA 5C3WA 3CRKC 3Q24A 2WKDA 1FD7D 5JPMC 5KIXA 4H7BA 1WD0A 1VCIA 5HGTA 5C44B 2EVBA 4AYBB 4XQNA 4KY7A 2A6ED 1VMCA 5M3MB 2RQXA 2DNCA 3OPOA 2F0PA 1YNJD 3Q6SA 5IGBA 2TMPA 2WP8J 1RF2D 1LV9A 2K5DA 3C1FA 1HFNA 4A3DB 5CORA 3L3OC 1KDBA 1T5XD 2KCNA 1TIID 3NWTA 1OXXK 3K0YA 5CGKA 1WTQA 3ERQA 3QIAA 1H9RA 2K01A 5EBDA 1B4OA 1AW7A 2B2VC 5C0XG 1BBXC 4HSPA 1EWCA 1WTVA 4XT1B 2MUYA 1QNUA 2R92B 2J0TD 5C3EB 3GTMB 4MN3A 1LO5D 5F2DA 2PPBC 2NVXB 1IW7D 2KCCA 4L63B 2PZTA 2CHBD 5DEHA 1NCVA 5CBAE 3H09A 1STYA 1I6VC 1SYDA 3KK7A 4CKBA 1E0BA 4HN7A 5JPNC 4R9WA 5KRUA 1BO0A 5CV5A 1LLRD 4IZ8A 2AUKA 5I9PA 4JBWA 3DEOA 3T56B 5EPJA 1G2SA 1SYEA 2NWGA 2Q8RE 3D3RA 4RHSA 1SJHD 2BE5C 1SE3A 3G7LA 5C4JB 2JYOA 2EYFA 3KLRA 2ZXPA 1JWSD 1BCPF 1O80A 1LTRD 4MIUA 5IOCA 1SBBB 2EYPA 3X3NA 1O7ZA 4H0LC 1ZKOA 3FPPA 3S2HB 3NQIA 4OL7A 3V05A 4QMGA 2WACA 5KNCA 4U68A 4BA1I 2RSNA 4BY7B 4F7XA 4CJ0B 3TN2A 3DUZA 3PUWA 5TSSA 1JOKA 2MHVA 2X69A 3S16B 3W3AA 5E4WC 1L0YB 1RHPA 2F3VA 2EY6A 1VF7A 4IUTA 1PYWD 1DONA 3D6CA 1CZGA 4V190 3O13A 3I70A 1C4QA 1DXMA 1ESRA 2IWHA 1G91A 2FMCA 1VDZA 3RMHA 1LT5D 2BE5D 2F0TA 3MC0B 2EE1A 5I4DA 5IGGA 2WB1B 2YU9B 1WTRA 1FNUA 5CC4A 2NB0A 4N9PA 1JOQA 3PO3B 3OMGA 1ICWA 5ELBA 1MGSA 1PZJD 3GD7A 1TU2B 4B9WA 1PRTC 1GXDC 1TWCB 2PMZB 2XN9C 2OF1A 4HCSA 3KUPA 1XXGA 4PQXA 2RDFA 4UAIA 3PIP3 3M4YA 5KYIA 1R4QB 2EY1A 5A2QL 1TT2A 4IUUA 2C5CA 2KJXA 5T1IA 2R7ZB 1R9TB 2E2HB 1NR2A 1LTID 2F0VA 5C5MA 4BY1B 2NYZD 1KAAA 1FNVA 2YYZA 2F0JA 2RDGA 1EQTA 1PLFA 1F2LA 3R93A 4ILWA 5J22A 4ID6A 2A69D 1V1PB 4RGMA 1F9PA 1ENCA 4IALA 4QUFA 1F2ZA 2EJFC 1SDFA 4YIJA 1FYCA 4LAAA 2N88A 2DN8A 3IL8A 2NN6H 4NP5A 3E6ZX 4WFN3 5J39A 2QKIC 3HOVB 4WRDA 1QE6A 3PUXA 3AMUA 3VR4A 3J80L 2WIIB 1SE4A 1HTLD 3BS1A 2N55A 2R61A 3M4OB 2D2CC 1PTOC 4FF3A 2X6LA 1GUTA 1SYFA 1AP0A 1MI2A 4C3HB 1A2UA 2F3WA 3U9OA 1UEAB 4V0BA 3GTQB 1LT3D 1SYBA 4CGYB 5K36G 4WORA 3J81L 1SNMA 3T16A 4M8AA 4X3UA 4BWGB 5IT9E 4IUQA 4C3IB 1ZYRC 3MWYW 2B8FA 3KBGA 5EKLA 5KEEA 5EBCA 4G57A 1S5FD 3SK5A 1RODA 1IW7C 3BZDB 4FF4A 2M9VA 4JK1C 3I4NB 5EQ0A 1LT4D 3CHBD 2SNMA 4FVMA 3FPUB 3AU7A 3MXUA 1SSOA 4K5XA 4DK0A 1RD9D 3D6WA 2NN6I 3BYYB 1PXUA 5CBEE 4FXKC 2WINB 5AFWA 2IW3A 4KN4C 1SMYD 1KDAA 1DCZA 2AUJD 3ONAB 1CQFA 2K05A 5D3DA 5CYUA 3T53B 3A7LA 5KYLA 4K8IA 4CKEA 1QOHA 3T13A 5K5PA 2XVSA 1STHA 1TS2A 3K5MA 2A68D 1LABA 2EOTA 4G7ZC 1YNJC 5EPLA 3LWUA 1ENAA 5ELDA 2QEJC 1I4HA 3P75A 4ME5A 2NUCA 1O78A 3J80E 4P2CB 3HOUB 1Y1WB 2EYOA 3I8ZA 3WDNA 3MZ5A 3KLSA 3MHBA 2O5JC 1WVLA 1BDOA 2KOLA 1Y8PB 3GP7A 3Q23A 1AZQA 3S1NB 1F9RA 3BVZA 4C3JG 2JA7B 3M7GA 5BN4A 2HCCA 1M4VA 1RCVD 5EJWA 3RLFA 4LMQD 2BA1A 4ZAIA 1TWHB 1ONLA 3H94A 3TZUA 2B2TA 2FMMA 2B63B 5JVG3 5I2YA 1UAPA 5EPKA 1KLGD 3GTLB 4OHJA 1U9RA 1G6ZA 2RKSA 5LHY1 2PW7A 2PZWA 3DEPA 4ULLA 1Z7TA 1Q90A 5IT9L 4A3JB 2LKVA 1CM9A 1KTKA 1HUMA 2RBMA 1GUNA 3EQLC 3MFGA 2AWOA 5EKKA 3FVQA 4EQOA 1SE2A 2FJ2A 1KABA 1DD2A 4Q5VA 3MXNA 1Y8NB 1EL0A 3DWAA 4A3GB 4DGZA 3BG3A 3SE0A 4RKBA 4J6HA 2XRQD 4KK7A 2EZVA 2EY5A 2F0MA 4G7OC 3EROA 2PW5A 3S14B 4XTCS 2KA7A 1X3QA 4ZQ3A 3MXPA 4IUNA 1WTOA 1Y1VB 3S9WA 2A68C 3FEWX 1SNDA 4ZRZA 5ELFA 4QCLA 2ICEC 2HQEA 3K5NA 1Z47A 2WKCA 3L9AX 1B3AA 3K57A 1G291 3IFDA 2D5DA 3PUYA 4R8NA 1EWHA 3VYSA 1U4PA 2SNSA 4C1NK 2XIWA 4PV1C 1STBA 5CV7A 3S1RB 5CV4A 4KN7C 1GUGA 3CU7A 2PNRC 1MSHA 2MP1A 2K1BA 4KV6A 5JEAG 2K6AA 2BDOA 1A3UA 5C4HA 4A3EB 4DXGA 1CZWA 4C1NI 4F87A 4ABNA 4A3KB 5CV8A 3FKIB 1TWGB 5C0XH 1KNEA 3TDQA 3IFTA 4CJ2C 3NPPA 3FRPB 3S1MB 2R6GA 3ZYYX 1EYDA 3KF8A 1SFOB 3I91A 3CQZB 1AN8A 4TQUS 1SYGA 2IX0A 3A54A 1RTNA 2A69C 4IUPA 2L0CA 2KQ3A 3QOLA 4CKCA 1AZPA 3D4WA 3VR3A 3HG9A 1EYCA 1SNCA 2B2UC 3GTPB 4NW2A 1TWFB 2A5HA 1U4RA 1EY7A 1IYUA 1JWMD 3A8IE 2LMCB 4F88A 4J1MA 4FO2A 2CW0C 5ISRA 2K7VA 1DYQA 4RCNA 4RKLA 2EYHA 4C3HG 1NSNS 3P20A 1Y8OB 2NVTB 4R8IA 2AQ3B 3VR5A 4TRDA 4XIGS 1II3A 3A7AB 4L8JA 1SNPA 2B39A 3VA7A 1EY5A 4OO1H 3OSOA 2SDFA 3DXJC 1GUSA 2X6GA 2A73B 1PDQA 1B50A 1JICA 2EYJA 2EY2A 2O2LD 2B8GA 4DXFA 4IFDG 4HTHA 2JEBI 3SDZA 4FP5D 3N52A 3M7NA 2XWJB 1U4LA 5NUCA 2ENBA 1S5ED 2B2UA 1ENFA 3BDOA 2B2WC 5M9OA 4BBRB 2RDHA 1PRTB 1WTPA 5C4XB 4UDUC 4PMWA 3J81E 2BA0A 1W6KA 3HP3A 2BCOA 4K6DA 4I7ZC 4KKSA 2F03A 4HCEA 1EZ8A 1LTAD 2VUMB 2JEAI 1PRTD 2OT2A 1YNNC 1SMYC 4QUCA 1YNND 1A3VA 3NTHA 2RSOA 1F2YA 1TWAB 2G9DA 3NP8A 1GHJA 2ZXRA 4LK1C 1OXSC 3RD4A 1Q12A 3GO5A 1HQMC 4RGTA 3OWFA 1CHPD 1LTSD 2L4NA 5G3LD 4FF2A 1EFID 2K28A 1I4XA 1U4MA 3I4LA 5JOBA 5FOBB 1ESFA 1BXTA 3TZDA 4TSSA 2LFNA 1A2TA 1AEXA 2EXZA 3RUZA 1S5CD 4QB4A 5FK9C 5CR3A 4KKUA 1B1ZA 1JQYD 3SK6A 5BN5A 3GQBA 1MSGA 4ZLTF 4DNTB 3IAYA 1PFBA 3QJYA 4X3KA 3S2DB 3EJIA 2K5QA 1EQVA 1BCPC 2FHTA 4ZYSA 4ZUIA 1FR3A 2NN6G 1HXYD 4CHTB 2EPBA 2Z4HA 1RKNA 2F0UA 1IYVA 5FO8B 1PRTF 4DAPA 5DM73 3HOZB 3U9SA 3HKZB 2F0KA 2E74C 5HURA 1HHVA 2XNAC 1DZ1A 1L0XB 2B2WA 2F0WA 1HTPA 1HQRD 1H9SB 4OIJA 2CQAA 3MEHA 1ZXTA 2HDMA 3OIQA 3HOXB 1J8IA 2NZ1D 1PMRA 3H6MA 4BA2I 4K2LA 1A6XA 2C9OA 1EY6A 2IT1A 3IKJA 4Z9CB 1XWEA 3P7JA 4A93B 2JA8B 1HCZA 3MXGA 3TP6A 4ZK9B 4HEDA 4Q0FA 2V4DA 3D31A 1DOMA 4KTAA 5C6AA 2RA4A 1TS4A 5FLXE 5IGEA 3OIPA 2KUMA 2MJ8A 2K03A 4HMIA 3NQTA 1I6HB 1FGBD 1Z6HA 2Q8IB 2J4XA 1TKWB 2EYLA 5JEAH 5LL6S 2XSCA 3VYTA 1LACA 2D62A 3NSWA 2F0EA 3AB9A 2AQ1B 2WAQB 3PMFA 1B9MA 3MA2B 1H9SA 4WJWA 3CKIB 1BOSA 1FNWA 5D65A 1R4PB 1HRJA 4EQPA 3PUVA 2F0LA 3V2TA 4OGQC 1SEBD 1D6EC 3EFXD 3BDLA 4NMZA 3HEJA 4XXEA 3LWEA 1ILPA 3L7ZC 1EY8A 5COYA 3VYUA 3S17B 2QCPX 4DN4M 1CK1A 2IPKD 2M00A 1UUPA 5KGUA 1EU4A 1RTOA 2SEBD 3VA5A 4RGOS 3BVMA 3D8GA 1O7LA 1GUOA 4FYDA 5J1ZA 4C2MB 4EGVA 4S3SA 3PIO3 2F0IA 3K5LA 1EIHA 2SOBA 2VB2X 4DAYA 1S5BD 4M1UB 4U673 2OXPA 1SXTA 4RFBA 2VXWA 3A8KE 3Q0AA 5ELCA 2KECA 2BOSA 4GZYC 3EVQA 1O7YA 4PMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEB I;  4DNT B;  3SDZ A;  2EJF C;  1OXT A;  4HR7 B;  4KN4 C;  2QF7 A;  1VF7 A;  1VF5 C;  3QJY A;  2A6H C;  4KHZ A;  1FYC A;  1Z6H A;  5KNB A;  2Q8I B;  3M7N A;  5C0X H;  3CRL C;  3D4R A;  4TKO B;  1V43 A;  1DCZ A;  3FMC A;  2PCF B;  3NE5 B;  2DN8 A;  2NN6 H;  2EJM A;  1OXV A;  1Q90 A;  1Z7T A;  2AUJ D;  3IFT A;  3ND8 A;  1TKW B;  2PPB C;  1GHK A;  1DXM A;  1CTM A;  3BDO A;  5JEA H;  4OO1 G;  1IW7 D;  4IQZ A;  1Q1E A;  3OW7 A;  5BN3 A;  1GJX A;  2R6G A;  1LAC A;  2D62 A;  2E76 C;  2L5T A;  3T53 B;  2KCC A;  3PUX A;  3A7L A;  3LNN A;  1VDZ A;  3AB9 A;  1GUN A;  2BE5 D;  3EQL C;  2BA0 A;  1FR3 A;  3CRK C;  2AWO A;  3VR4 A;  2JXM B;  1QJO A;  2NN6 G;  4KI0 A;  1Q1B A;  2E75 C;  4TQU S;  3VR2 A;  1B9N A;  4I7Z C;  4KKS A;  1I6V C;  1B9M A;  1DD2 A;  2A69 C;  1Y69 U;  3PUZ A;  2A68 D;  1Y8N B;  1VCI A;  1IYV A;  1CI3 M;  1LAB A;  1H9S A;  2D2C C;  2ZT9 C;  3MFY A;  1V8Q A;  2JEA I;  4G7Z C;  1YNJ C;  1CFM A;  3LWU A;  3PV0 A;  2A6H D;  1YNN C;  1GUT A;  2EVB A;  1SMY C;  2F1M A;  3BG3 A;  3SE0 A;  1E2W A;  2A6E C;  3U9S A;  3PUV A;  3VR3 A;  4G7O C;  5KND A;  4OGQ C;  2A6E D;  3GD7 A;  2AUK A;  3OOC A;  2E74 C;  2DNC A;  1O78 A;  4JBW A;  1H9M A;  3OPO A;  2O5I C;  1TU2 B;  2DNE A;  4XTC S;  2KA7 A;  3T56 B;  5K36 G;  1K8M A;  1H9J A;  1HPC A;  3L7Z C;  1GHJ A;  2A68 C;  1IYU A;  1HTP A;  4DNR B;  3A8I E;  1H9S B;  2LMC B;  2BE5 C;  3I72 A;  3N6R A;  4LK1 C;  3WDN A;  3M4Y A;  3ND9 A;  1OXS C;  2CW0 C;  1E2Z A;  1Q12 A;  2K7V A;  2O5J C;  2K32 A;  1BDO A;  4KKT A;  1G29 1;  2K33 A;  4RCN A;  1ZYR C;  2D5D A;  3PUY A;  1HQM C;  1EWH A;  4G7H C;  3KLR A;  3P20 A;  1Y8O B;  1H9K A;  2B8F A;  1Y8P B;  2EDG A;  1PMR A;  1A6X A;  4BA2 I;  3HGB A;  1O7L A;  1GUO A;  4PV1 C;  1OXX K;  4H0L C;  3VR6 A;  1IW7 C;  1ZKO A;  1E2V A;  2EJG C;  2JE6 I;  3FPP A;  5A35 A;  3VR5 A;  3M85 A;  3I4L A;  4XIG S;  1T5E A;  3A7A B;  4L8J A;  5BN4 A;  4KN7 C;  3I73 A;  1GUG A;  2IT1 A;  3IKJ A;  4JK1 C;  4LJZ C;  5K36 H;  2PNR C;  4DK1 A;  3QIA A;  1H9R A;  5KNC A;  3VA7 A;  4KMU C;  1HCZ A;  4BA1 I;  5JEA G;  4OO1 H;  2YYZ A;  3QG1 A;  2BDO A;  1OXU A;  3MXU A;  3RLF A;  4H44 C;  2V4D A;  3DXJ C;  1GUS A;  2BA1 A;  3D31 A;  1ONL A;  3PUW A;  4DK0 A;  5C0X G;  3A8K E;  3H94 A;  3TZU A;  2NN6 I;  3A8J E;  4H13 C;  2A69 D;  3T51 B;  4GZY C;  4KKU A;  3W3A A;  2B8G A;  1K8O A;  4IFD H;  4IFD G;  5BN5 A;  3GQB A; 
#chains in the Genus database with same CATH topology
 2MFI A;  4DNI A;  1B53 A;  4MHE A;  4APV A;  4LF9 L;  1VS0 A;  2HD3 A;  3CRL C;  4YWM A;  4KD3 A;  1V43 A;  1EYA A;  3K59 A;  1OXV A;  1F2M A;  4KHV A;  1N33 L;  1TR5 A;  3ND8 A;  4K0K Q;  2JA9 A;  4GLX A;  3R3O A;  1PFM A;  4OO1 G;  2QDB A;  1PH7 A;  1CHQ D;  3OW7 A;  4K6L A;  1FL0 A;  2E76 C;  4JBM A;  1WOC A;  1I3Q H;  4KD4 A;  4A3C H;  1HJP A;  1B3Q A;  1X32 A;  1KNA A;  1YIJ A;  4RA8 A;  4C3I G;  4H02 A;  4DV2 Q;  4Y7N H;  1EY4 A;  2AWN A;  2R7D A;  3G6J B;  5M5X B;  1BBU A;  1V8Q A;  2OEO A;  4DAV A;  1VMP A;  5DM6 3;  4NDX A;  3C2P A;  4B3M L;  2F1M A;  3TS2 A;  3J80 i;  4K14 A;  2A6E C;  1OTC A;  1GUW A;  3UDF A;  4DV1 L;  4BY1 G;  3OOC A;  3STB C;  5DAU A;  3CC2 A;  3NBH A;  5FO9 B;  4GNX C;  5IYB G;  1TWG H;  1RDP D;  1CQV A;  4IPH A;  3I7F A;  3S17 H;  2VB3 X;  1TS5 A;  1STE A;  4A3F B;  2UXC L;  1TWA H;  4WJ4 A;  1LTL A;  1E2Z A;  1CT1 D;  4BY7 G;  4IPD A;  1I50 B;  4RH6 A;  2B2Y C;  2FIN B;  4JI1 L;  3SXH A;  1Y1V G;  1SJE D;  2EDG A;  3E0J A;  3SK8 A;  4B3R L;  1QG7 A;  2OQK A;  3P1H A;  3HGB A;  3HS0 C;  3C3L A;  4ZUJ A;  1AH9 A;  3VR6 A;  4J8Q A;  4LF9 Q;  1PFN A;  3JAM E;  3M85 A;  4A3K G;  4DV4 Q;  3PF5 A;  1EEI D;  4DR3 L;  2Z4I A;  3S1R H;  2OWO A;  4FF1 A;  5K36 H;  1ML0 D;  3M4O H;  5D3I B;  4R4I A;  4IOA A;  4L5R C;  1HNW Q;  2ICI A;  1IKM A;  1LTG D;  1BUV T;  1OXU A;  3A55 A;  4OON A;  5FJ8 H;  2Y0S E;  1JJ2 A;  2UXB Q;  4H44 C;  2F0H A;  2FFK B;  4HMJ A;  2NVQ B;  1A0I A;  3ICE A;  5IYD H;  1TY2 A;  4X65 L;  3GTJ H;  2GA4 B;  2WAQ E;  5I6Y A;  2GVB A;  1IBL Q;  2R3Z A;  3KJO A;  1A3T A;  1VQM A;  4KJN A;  4IFD J;  5E7N A;  2R7Z G;  1VQH A;  2K4K A;  2NVY H;  1HZB A;  4X3T A;  2EQS A;  5FLX L;  1SR3 A;  4ME3 A;  1JE5 A;  2R93 B;  2BDN A;  3TME A;  5IGC A;  3LNN A;  2Q2H A;  2NTS A;  2JJQ A;  2YTX A;  4EQN A;  4RG1 A;  1VQN A;  1WI5 A;  2CW0 D;  4DR2 Q;  2PQE A;  4OO1 I;  2KEE A;  2Z8L A;  1Y69 U;  4RCO A;  3RN2 A;  4LF4 L;  2ZT9 C;  4KY6 A;  2E2J B;  4ZKC B;  5EGT A;  3DHQ A;  2E2J H;  3PV0 A;  2A6H D;  1K73 C;  1SNO A;  2A74 C;  2PZU A;  1JOR A;  4QQB X;  1K28 A;  2ZXO A;  1Q81 C;  1PTO D;  3H3V C;  2IX1 A;  4NKL A;  4OX9 L;  2O5I C;  1X6O A;  4LFC Q;  4JI0 Q;  1EY0 A;  1HFG A;  1K0R A;  1H9J A;  3BU2 A;  2E2I B;  3J7A V;  5C4X G;  2F3I A;  3DWQ A;  4LUZ A;  1LTT D;  1W3S A;  4CDC C;  1VQO A;  2NVY B;  3GTP H;  1BF4 A;  1QCB D;  1N32 Q;  1GOZ A;  3KF6 A;  4EX5 A;  2AHO B;  2V1C C;  4HID A;  1V1O A;  1TWH H;  4NB3 A;  1YIT A;  1H9K A;  1N36 Q;  3QWN A;  4IUV A;  3BZK A;  3K7A B;  1JWU D;  1SE8 A;  3GV6 A;  2EJG C;  1MBY A;  3PO2 G;  1X3P A;  4DR7 L;  3NTK A;  1L0W A;  3GTJ B;  1KDC A;  2Z6K C;  1ASZ A;  4DUY L;  1K3R A;  3NHH A;  3I4M G;  3HRZ C;  5IYB H;  2Y0S B;  1ET9 A;  2JK8 A;  4CBV A;  1GVP A;  2Z1C A;  4JVZ A;  2EYM A;  1BCP D;  5LMN L;  2K04 A;  4IUR A;  4GS3 A;  1C0A A;  1F9S A;  1HZC A;  1FJG L;  3I4N G;  3QO2 A;  4H13 C;  4GLA C;  4LF6 Q;  4LF7 L;  1WCM B;  1K8O A;  3HOW H;  2CQO A;  1JCK B;  4O42 A;  4MZ9 A;  3C46 A;  1OXT A;  2F0G A;  1Y14 B;  2RVL A;  4A75 A;  1IKL A;  5JJI A;  1B2T A;  3E0E A;  3PSI A;  3LX0 A;  4A3K H;  3NE5 B;  3DLL A;  4JYA L;  3I2Z A;  2M2L A;  4XYO A;  2R7F A;  5BN3 A;  1D5X C;  1RJT A;  1TVX A;  1NY4 A;  3M3Y B;  3RZO B;  3K8A A;  2OTL A;  1S3O A;  4JI7 Q;  1EY9 A;  3K81 C;  4UPA A;  4C56 C;  1BCP B;  2JP1 A;  2L12 A;  1A15 A;  5M5X H;  4B9X A;  1QJO A;  1GM5 A;  3E5S A;  1PH9 A;  1CA6 A;  1Q1B A;  5E3F A;  4UP8 A;  1SLJ A;  2BH8 A;  1TQO A;  1Q82 C;  2GVA A;  1ILQ A;  5LMN W;  5T1G A;  2JA8 H;  3TBI B;  1I4R A;  4JYA Q;  1CFM A;  3FHW A;  3K5O A;  4LUO A;  5M3F B;  3NK9 A;  3X3M A;  2KVM A;  3F2U A;  4DU9 A;  1G8Z D;  4ODG A;  3CQZ H;  2L55 A;  3OWE B;  3E9I A;  3HOX H;  3NEN A;  3MTS A;  1SYC A;  1JR0 D;  2VS1 A;  3TEH B;  4AYB G;  2ALY B;  4JI2 L;  1IBM Q;  1N34 L;  1D1I A;  2CVR A;  3ND9 A;  5G3L F;  1IL2 A;  1VQC A;  3QB3 A;  1QB5 D;  1VQ6 A;  3MAQ A;  3AFQ A;  1NAP A;  1D5Z C;  1VQL A;  3F2B A;  3Q22 A;  3DMU A;  3OHX C;  3H91 A;  1PH3 A;  5IP9 H;  1YI2 A;  2MQH A;  3S24 A;  2ZTE A;  1PTO H;  5A2Q E;  4LFA L;  5JVH 3;  2KCM A;  1AE3 A;  3K58 A;  2KBN A;  1IXR A;  2L15 A;  5A35 A;  5IGF A;  5DLQ E;  5EAY A;  4C2M H;  2KHS A;  3I73 A;  3HOZ H;  1HZA A;  4FXD A;  5I9O A;  3KBX A;  2RCF A;  4OWW B;  2D9U A;  4RWS C;  4YCU A;  1TS3 A;  3DWP A;  1D5M C;  2H1E A;  1JOO A;  3QG1 A;  5M5Y H;  2YU9 H;  1HA6 A;  4IFD I;  4YY3 Q;  1FGU A;  4HSV A;  2AKW B;  3GTG H;  3T51 B;  2Y0S G;  2F4I A;  1X65 A;  1K8G A;  1ZEQ X;  1XYI A;  2NVX H;  2HDL A;  3UDX A;  2G9H D;  5CV9 A;  2K75 A;  1AFP A;  2WAQ G;  2UUC Q;  5D14 A;  1XMO Q;  1QIL A;  2LS0 1;  2EJM A;  3W1B A;  3H0G B;  5J3B A;  3TSS A;  2F0Q A;  4IO9 A;  2C35 B;  1CTM A;  4JI2 Q;  4XYQ A;  2XTI A;  1VQD A;  2YTY A;  2HUG A;  2L5T A;  3SHL A;  4CDF C;  5IGD A;  1PH2 A;  3SK4 A;  3K6O A;  4DF7 A;  3S16 H;  2VUM H;  5LMU L;  3S14 H;  2P5Z X;  3SR1 A;  4CJ1 B;  3GV3 A;  1BQQ T;  1EOT A;  1XX8 A;  2E75 C;  1CUK A;  1Q8I A;  5ELE A;  4XQQ A;  3R2I A;  4OIK A;  1EEF D;  1CA5 A;  1OO9 B;  4BY7 H;  4BBS B;  1DM0 B;  1CI3 M;  4L5Q A;  3NXW A;  1WTX A;  3UDG A;  1B44 D;  1VQF A;  3CAM A;  1I4Q A;  5ELO A;  4ZKB B;  3RN5 A;  3UDI A;  1JJG A;  3H0G H;  4G4K A;  4WJ3 M;  1D1K A;  1H9M A;  1IHZ A;  2IY5 B;  1PZK D;  3OTO Q;  4N8F A;  5EKI A;  1ET6 A;  1PTO F;  2IL8 A;  1MHW C;  1BKB A;  2PNH A;  4A3L G;  4DNR B;  4B3T Q;  3HFZ B;  4BXX G;  1HUN A;  2QEX A;  1VQA A;  1Y1W H;  3N6R A;  2F0N A;  3T1Y L;  1D2B A;  2PQA B;  3WOF A;  4KKT A;  1IL8 A;  3GTG B;  2WFW A;  5M3M H;  2Q8T A;  4DFA A;  2L11 A;  4DR4 Q;  2F0O A;  5FKA C;  2MPM A;  5M5Y B;  2ATW A;  3Q8D A;  4DV4 L;  4QF4 A;  1BNZ A;  1E2V A;  3V96 A;  4K5W A;  2JSO A;  5I2X A;  1J6Q A;  2E2D C;  3WOE A;  1MD2 D;  3HZX A;  3FKI G;  5IOD A;  4JI1 Q;  2LXJ A;  1VQ4 A;  3SVM A;  2I46 A;  4MNO A;  1XNR L;  3BVG A;  4NXM L;  2UXC Q;  5M5W B;  3A8J E;  5C0X J;  1F77 A;  1N8R C;  1IBK Q;  1QWY A;  4IFD H;  3C1E A;  2AQ2 B;  3JAM L;  2HCI A;  1E7Z A;  4UHV A;  5I6W A;  5E1F A;  1TWC H;  3VYR A;  3KF6 B;  3EA6 A;  4KHZ A;  4E6I A;  2KHI A;  1NR4 A;  1IYJ B;  3D4R A;  3I3C A;  3FMC A;  2PCF B;  4I65 A;  4TKO B;  4F8M A;  2ZM6 Q;  1JMC A;  3NWS A;  2HHH L;  3W5O A;  3TRZ A;  1HNZ Q;  1LTB D;  1S72 A;  1KL9 A;  4R4T A;  1GJX A;  4HAE A;  1DOL A;  1BBW A;  2F0S A;  2LXK A;  4PMB A;  5HY6 A;  4O1N A;  3KLS X;  2I5H A;  3R8B A;  2JXM B;  1KRT A;  2DGY A;  4RGN A;  2NVQ H;  2CH4 W;  3VR2 A;  2TSS A;  1JC7 A;  3CCV A;  1WTW A;  1STN A;  1VQI A;  3PUZ A;  2JA6 B;  2XRS D;  3T4A C;  2E5L L;  3D0F A;  3I90 A;  1N33 Q;  2RF4 A;  3K7U C;  4DA2 A;  2F0D A;  2VZA A;  5LL6 X;  2IJ0 A;  2OCE A;  2VNU D;  2NTT A;  3R2T A;  2WV6 D;  1H95 A;  4Y7N B;  3RZD B;  4KY5 A;  3QOJ A;  5GAD C;  1C7Y A;  4XQJ A;  3S2D H;  1I3Q B;  4KJO A;  4IN3 A;  5FLM H;  3GTK B;  1KLU D;  4GN3 B;  4A3I B;  3KJP A;  1DGS A;  3HOW B;  5IIF A;  3NBI A;  3SEB A;  2K33 A;  1TWF H;  3PGZ A;  4G7H C;  5JAV A;  4YY3 L;  1Q3L A;  3UE0 A;  5DNF A;  2ID0 A;  5C0X I;  5E4X A;  4NXN L;  2ZM6 L;  1S5D D;  4K8J A;  2JE6 I;  2NBF A;  3U50 C;  2A8V A;  2L1B A;  2HT1 A;  2B2T C;  5IP9 G;  1UE5 A;  1SNQ A;  1PZI D;  1ZYR D;  1UNS A;  1XTC D;  2J7Z A;  3OW2 A;  4A3B B;  3TP5 A;  3BYT B;  1AE2 A;  3PIP A;  1YHQ A;  3GTO B;  3F2D A;  1NUC A;  4FNF A;  4LFA Q;  1STG A;  2I07 B;  2L9H A;  1SRO A;  4XT3 B;  3HOX G;  2DY7 A;  2JA5 H;  1F9Q A;  3OMC A;  1LT6 D;  4GKJ L;  1T9H A;  4A3F G;  3ZJY C;  1V1P A;  2B2Y A;  2ZTC A;  1X3E A;  3TP8 A;  1WD1 A;  2PO4 A;  3HOW G;  2IX3 A;  3M3Y H;  2QF7 A;  1RL2 A;  1JB3 A;  4PNY A;  1K83 B;  2O4X A;  4OEL B;  1XNQ Q;  3MVV A;  1I4P A;  5CV6 A;  3NTI A;  1GHK A;  3DM1 A;  1G51 A;  2B2V A;  1EZ6 A;  3KOJ A;  4K2K A;  5C4Z A;  2JA5 B;  4DUZ L;  2H4O A;  3KFU A;  3M4P A;  2YV5 A;  3D4D A;  4FXG C;  3M4Q A;  4KI0 A;  1M8A A;  4RHR A;  4A3E H;  2PYK A;  4KLK A;  3GTO H;  5CMD A;  1B9N A;  3HOV G;  4LF5 Q;  4RAU C;  3OTO L;  3S15 B;  1KHI A;  3BDC A;  1KAW A;  3MFY A;  1TY0 A;  3NEL A;  3URY A;  4A3M B;  2R7Z H;  3PO2 B;  1BR9 A;  4P71 A;  3CCJ A;  1HZ9 A;  4DPG A;  1E2W A;  3CF5 A;  4X3S A;  3I4M B;  2ZJP A;  5KND A;  1S4Z A;  4EVO A;  1DOK A;  5C5L A;  2DNE A;  3A5U A;  1Z9F A;  1K8M A;  1HPC A;  4L6T B;  1W6J A;  3J7A F;  5LMU Q;  4C3J H;  1CSP A;  3I72 A;  3S1Q B;  3HOU H;  4C3J B;  5BR8 L;  3J7Y W;  4QIW B;  4AH6 A;  4LF7 Q;  4LF6 L;  2K32 A;  2E2I H;  1DJR D;  1JE4 A;  1VQ7 A;  2F4V L;  4XDX A;  3NUC A;  1C8C A;  1C48 A;  1XMO L;  2LY7 A;  4BS9 A;  3ITP A;  1X54 A;  2K5W A;  1VQ5 A;  1T5E A;  5JEA J;  1QNK A;  4R4C A;  5IP7 G;  3AYH B;  4BXX H;  4LJZ C;  1VQK A;  1SAP A;  4DK1 A;  1STA A;  3FDT A;  2KED A;  3QR8 A;  4KMU C;  1J9O A;  4DK3 C;  3S1N H;  1I4G A;  4N9T A;  3TP7 A;  2KCT A;  4JI4 L;  4LNQ A;  2DY8 A;  3I4O A;  2ZJR A;  4DR1 L;  3UI2 A;  3HOY B;  4J15 A;  5JJZ A;  2XWB B;  2F0F A;  3U4V A;  4HR7 B;  1E1O A;  2QIL A;  1EU3 A;  4K5V A;  1VF5 C;  1PTO B;  2A6H C;  1EIG A;  2CWP A;  3W1G A;  1C9O A;  4DV7 Q;  5KNB A;  2UUA Q;  2MGS A;  1G2T A;  5FO7 B;  1I94 Q;  5C3X A;  4B08 A;  4IQZ A;  4A3C G;  1Q1E A;  4DR5 L;  4YHH L;  4A3B G;  1HA5 A;  3A56 A;  3ULJ A;  1HNX Q;  3W2D A;  5C3W A;  3RLO A;  1SN8 A;  2CWA A;  3CRK C;  3Q24 A;  2WKD A;  2Z6K A;  5C3E G;  1FD7 D;  5JPM C;  5KIX A;  4H7B A;  4HJ7 A;  4LFB L;  4DKA C;  1WD0 A;  3ULP A;  5M3M G;  4DR5 Q;  1VCI A;  1X3G A;  5HGT A;  1SFO H;  5C44 B;  3BJU A;  2EVB A;  1E22 A;  3S1M H;  4AYB B;  3K80 C;  4KY7 A;  4XQN A;  1VQJ A;  2A6E D;  1VMC A;  5M3M B;  2RQX A;  2DNC A;  3OPO A;  3AQQ A;  2F0P A;  1YNJ D;  3Q6S A;  5IGB A;  2TMP A;  2WP8 J;  1RF2 D;  1LV9 A;  2JA8 G;  2K5D A;  3C1F A;  4DV5 L;  1HFN A;  1CKO A;  5COR A;  3L3O C;  4A3D B;  3PCO B;  1CKN A;  1KDB A;  4X65 Q;  1T5X D;  2CH4 A;  1O7I A;  2KCN A;  1TII D;  3ERS X;  4A93 G;  3NWT A;  4YCV A;  1J5E Q;  1OXX K;  3H3V I;  3K0Y A;  1U0L A;  5CGK A;  4LWC A;  2DJG C;  1WTQ A;  3ERQ A;  3KF8 B;  4QIW E;  2VQE Q;  3QIA A;  1H9R A;  2K01 A;  4JG2 A;  5EBD A;  2R92 G;  1B4O A;  1AW7 A;  2B2V C;  4BBR G;  5C0X G;  1BBX C;  5FLM G;  3VDY A;  4BBR H;  4HSP A;  4TVA B;  1EWC A;  3CP0 A;  1WTV A;  3S1Q H;  4XT1 B;  2MUY A;  1QNU A;  2R92 B;  2J0T D;  5C3E B;  4A3J G;  1CKN B;  3GTM B;  3TQY A;  4JBJ A;  1LO5 D;  4MN3 A;  5IYC G;  1EQQ A;  5F2D A;  5FJ8 G;  4DV5 Q;  2PPB C;  5C4J H;  2NVX B;  1VQE A;  1IW7 D;  4JI5 Q;  1MJE A;  3K0X A;  4A3E G;  1PVO A;  4GKK Q;  4JV5 L;  2ASB A;  1Y1V H;  2KCC A;  4L63 B;  4IOC A;  3GDE A;  2PZT A;  1EQR A;  3S15 H;  2CHB D;  5DEH A;  1NCV A;  5CBA E;  4DUZ Q;  1UWV A;  3H09 A;  1STY A;  1I6V C;  1SYD A;  3KK7 A;  4PZ6 A;  3CW2 C;  4CKB A;  4QGU A;  1E0B A;  4HN7 A;  2QGQ A;  5JPN C;  2B29 A;  4HJ9 A;  4KHP Q;  4R9W A;  5KRU A;  1BO0 A;  5CV5 A;  1LLR D;  4IZ8 A;  4A3I G;  2AUK A;  5I9P A;  4JBW A;  4A3D H;  3DEO A;  3T56 B;  5EPJ A;  1G2S A;  1SYE A;  2NWG A;  4P73 A;  1PA6 A;  2Q8R E;  3D3R A;  4DV0 L;  4RHS A;  1SJH D;  2BE5 C;  1PHJ A;  1SE3 A;  2PI2 E;  3G7L A;  5C4J B;  4X64 Q;  2UU9 L;  2JYO A;  2HQL A;  4P74 A;  2EYF A;  3NBH B;  3KLR A;  1PH4 A;  2ZXP A;  1JWS D;  3CMA A;  1BCP F;  1O80 A;  1LTR D;  4MIU A;  5IOC A;  1SBB B;  2EYP A;  3X3N A;  1O7Z A;  4H0L C;  5IYC H;  1ZKO A;  3FPP A;  2MNA A;  3S2H B;  5GAE C;  4NXN Q;  3NQI A;  4OL7 A;  3V05 A;  4QMG A;  2WAC A;  4JI4 Q;  5KNC A;  1R9T H;  2E2H H;  4U68 A;  4X62 Q;  4BA1 I;  2Q2U A;  2RSN A;  4BY7 B;  4F7X A;  4CJ0 B;  3T1H L;  4R4Q A;  3TN2 A;  3DUZ A;  3PUW A;  5TSS A;  1JOK A;  4HIM A;  2MHV A;  2QDL A;  2X69 A;  3S16 B;  3W3A A;  5E4W C;  1L0Y B;  1RHP A;  2F3V A;  1NMF A;  1NNX A;  2EY6 A;  4DV0 Q;  1VF7 A;  4IUT A;  2D0P A;  4RMF A;  5JJL A;  4DV3 Q;  1PYW D;  1DON A;  2CKZ B;  3D6C A;  1CZG A;  4V19 0;  1L2F A;  1BVS A;  3O13 A;  4A76 A;  4I7A A;  3I70 A;  2E5L Q;  1C4Q A;  1DXM A;  4QJF A;  1I6H H;  4CDD C;  1E1T A;  1ESR A;  4LF8 L;  2IWH A;  1G91 A;  1VQ9 A;  2FMC A;  2OQ0 A;  1VDZ A;  3RMH A;  1LT5 D;  2BE5 D;  3CCL A;  4UP7 A;  2F0T A;  4GN5 A;  3HOU G;  3MC0 B;  2EE1 A;  5I4D A;  5IGG A;  2WB1 B;  1XJV A;  2YU9 B;  1WTR A;  1FNU A;  1LUZ A;  5CC4 A;  2NB0 A;  4N9P A;  1JOQ A;  1HNZ L;  3PO3 B;  3OMG A;  2PQA A;  4BY1 H;  2HHH Q;  5C44 H;  2VW9 A;  1ICW A;  5ELB A;  1MGS A;  1PZJ D;  3NEM A;  1MKH A;  3GD7 A;  2JA6 G;  1M1K C;  1TU2 B;  4B9W A;  4PZ8 A;  1PRT C;  4DV6 L;  4HJ5 A;  3KYH C;  1GXD C;  1TWC B;  2PMZ B;  2XN9 C;  1X55 A;  2OF1 A;  3KUP A;  4HCS A;  1XXG A;  4PQX A;  2RDF A;  4UAI A;  3PIP 3;  3M4Y A;  1B7Y B;  1XNR Q;  5KYI A;  1U5K A;  2MO1 A;  1R4Q B;  4ALP A;  2EY1 A;  5A2Q L;  1TT2 A;  3FKI H;  4IUU A;  1KXL A;  2C5C A;  2KJX A;  5T1I A;  4A3M H;  2R7Z B;  1R9T B;  2E2H B;  1NR2 A;  1LTI D;  5M3F H;  2VQE L;  2F0V A;  4JC0 A;  5C5M A;  1WTH A;  4BY1 B;  2NYZ D;  1KAA A;  3PO3 H;  4IJL A;  1LYL A;  1FNV A;  1A62 A;  2YYZ A;  1PV4 A;  1J5E L;  2F0J A;  2RDG A;  4OEM B;  1EQT A;  1Q8K A;  5FLX c;  4YWL A;  4R1J A;  1W2B A;  1PLF A;  1F2L A;  3R93 A;  4ILW A;  3I4N H;  5J22 A;  4ID6 A;  2A69 D;  4A3J H;  1V1P B;  4RGM A;  3H15 A;  4GN4 B;  2B3G A;  1F9P A;  1ENC A;  4IAL A;  4QUF A;  1F2Z A;  2EJF C;  3HOZ G;  1SDF A;  4YIJ A;  5M3F G;  4AQY L;  1FYC A;  4LAA A;  3MEF A;  2Q2T A;  2N88 A;  5C3E H;  2DN8 A;  3IL8 A;  2NN6 H;  5IY0 A;  2R92 H;  4P72 A;  4C3I H;  4NP5 A;  3E6Z X;  4WFN 3;  5J39 A;  3J81 c;  4JW0 A;  2QKI C;  2QA4 A;  3HOV B;  2UU9 Q;  4WRD A;  1QE6 A;  3PUX A;  3AMU A;  4AYB E;  3VR4 A;  3J80 L;  2WII B;  1SE4 A;  1HTL D;  3BS1 A;  2N55 A;  2R61 A;  3M4O B;  2OTJ A;  1K3B C;  2ZJQ A;  2D2C C;  1PTO C;  4FF3 A;  2UUB Q;  5GAH C;  2X6L A;  1GUT A;  1SYF A;  1AP0 A;  1MI2 A;  4C3H B;  1A2U A;  2F3W A;  1XPO A;  3S2H H;  2UUC L;  3FP9 A;  3U9O A;  1UEA B;  2RHS B;  4V0B A;  3GTQ B;  1LT3 D;  1SYB A;  1EUJ A;  4CGY B;  1PH8 A;  3G48 A;  4QL5 A;  3TRE A;  4HJA A;  5K36 G;  4WOR A;  3J81 L;  4A3F H;  1SNM A;  3T16 A;  4M8A A;  2JA5 G;  4X3U A;  3TS0 A;  1XPR A;  4BWG B;  1V1Q A;  4IUQ A;  5IT9 E;  1QVG A;  1UE7 A;  4C3I B;  4JV5 Q;  1ZYR C;  3RZD H;  4JI5 L;  3MWY W;  2B8F A;  3KBG A;  5EKL A;  5KEE A;  5EBC A;  4G57 A;  1S5F D;  3SK5 A;  1ROD A;  3CPW A;  1IW7 C;  3BZD B;  1IBK L;  4FF4 A;  2M9V A;  4JK1 C;  3I4N B;  5EQ0 A;  1LT4 D;  3CD6 A;  1Q46 A;  3CHB D;  2SNM A;  4FVM A;  3FPU B;  3AU7 A;  3MXU A;  1SSO A;  4K5X A;  2F4V Q;  4DK0 A;  1RD9 D;  4B3S L;  3D6W A;  2NN6 I;  3BYY B;  3B6Y A;  1A8V A;  1PXU A;  5CBE E;  5BR8 Q;  4FXK C;  4HJ8 A;  2WIN B;  3CC4 A;  5AFW A;  1NE3 A;  2D0O A;  3A0J A;  2IW3 A;  4KN4 C;  1SMY D;  4L5S A;  2VUM G;  1KDA A;  1DCZ A;  2AUJ D;  1EWI A;  3ONA B;  3GTM H;  1CQF A;  2ES2 A;  2K05 A;  1XPU A;  1XTD A;  4B3T L;  4DR6 L;  3GTK H;  5D3D A;  5GAG C;  5CYU A;  3T53 B;  3A7L A;  1KIX A;  5KYL A;  4K8I A;  2K14 A;  2PI2 A;  4CKE A;  4JI7 L;  1QOH A;  3T13 A;  4UP9 A;  5K5P A;  2XVS A;  1STH A;  1TS2 A;  3K5M A;  2A68 D;  1LAB A;  2EOT A;  4G7Z C;  1YNJ C;  5EPL A;  3LWU A;  3RZO H;  1QVC A;  1ENA A;  5ELD A;  2JA6 H;  1E3P A;  5AJ3 Q;  2QEJ C;  1I4H A;  3P75 A;  4PZ7 A;  4ME5 A;  2NUC A;  1O78 A;  3J80 E;  1JT8 A;  4A3D G;  4P2C B;  4LFB Q;  5IWA Q;  3UE1 A;  3HOU B;  1Y1W B;  2EYO A;  4JOI C;  1X3F A;  3I8Z A;  1WJJ A;  3WDN A;  3MZ5 A;  5LMN Q;  3KLS A;  3MHB A;  2O5J C;  4PG3 A;  1HNX L;  1WVL A;  2IHE A;  1BDO A;  3J80 c;  1K9M C;  3JAM i;  4GKJ Q;  4YHH Q;  2KOL A;  4JBK A;  1Y8P B;  3GP7 A;  3Q23 A;  1AZQ A;  3S1N B;  1F9R A;  2QW7 A;  4C3H H;  1I94 L;  3BVZ A;  3I56 A;  4C3J G;  4DR7 Q;  3PO2 H;  2JA7 B;  3M7G A;  1ASY A;  5BN4 A;  4JPB W;  1RIP A;  3HKS A;  1N36 L;  2GN5 A;  2HCC A;  2K5N A;  4OWX B;  1M4V A;  1RCV D;  1NBW A;  3EBE A;  5EJW A;  3RLF A;  4JI6 L;  4LMQ D;  2BA1 A;  3A74 A;  4ZAI A;  1TWH B;  1ONL A;  3H94 A;  3TZU A;  2B2T A;  2FMM A;  2B63 B;  5JVG 3;  5I2Y A;  3CCU A;  1UAP A;  2NZH A;  5EPK A;  2CCZ A;  1KLG D;  3GTL B;  4OHJ A;  4LFC L;  1U9R A;  2VQF Q;  2I0Q A;  1G6Z A;  2RKS A;  5LHY 1;  2PW7 A;  2PZW A;  3DEP A;  4ULL A;  4HIO A;  4LUV A;  3SGI A;  1Z7T A;  1Q90 A;  1IBM L;  5L37 A;  5IT9 L;  4OWT B;  3F8T A;  4LF4 Q;  4A3J B;  2LKV A;  1CM9 A;  1KTK A;  1HUM A;  2RBM A;  4DR2 L;  3G4S A;  1GUN A;  3EQL C;  3MFG A;  2LSS A;  2CFM A;  3RNU A;  2AWO A;  5EKK A;  3FVQ A;  4A93 H;  4EQO A;  1SE2 A;  2FJ2 A;  1KAB A;  1DD2 A;  1VQ8 A;  4Q5V A;  3MXN A;  4A3B H;  1Y8N B;  1EL0 A;  3DWA A;  3H0G G;  4A3G B;  4DGZ A;  3BG3 A;  1YJN A;  3SE0 A;  3E3X A;  1QZG A;  4RKB A;  4J6H A;  3PQI A;  2XRQ D;  4KK7 A;  2EZV A;  2EY5 A;  2F0M A;  4G7O C;  3ERO A;  2YTV A;  4BBS G;  2PW5 A;  3S14 B;  4XTC S;  2KA7 A;  1X3Q A;  1K83 H;  4ZQ3 A;  3MXP A;  4OXP A;  4IUN A;  1WTO A;  1Y1V B;  4A3I H;  3S9W A;  2A68 C;  4X66 Q;  1YJW A;  3FEW X;  2G5D A;  1SND A;  4ZRZ A;  5ELF A;  4QCL A;  2ICE C;  2HQE A;  3JAM c;  1Z47 A;  2WKC A;  3K5N A;  3L9A X;  1B3A A;  4JI8 Q;  3K57 A;  1G29 1;  2N3S A;  1I5F A;  3IFD A;  2D5D A;  3PUY A;  4R8N A;  1EWH A;  3VYS A;  1U4P A;  2SNS A;  4C1N K;  2XIW A;  4NXM Q;  4PV1 C;  4GOP B;  1STB A;  5CV7 A;  2FXQ A;  3J7Z C;  1K0S A;  3S1R B;  5CV4 A;  4KN7 C;  1GUG A;  4GOP C;  4B3S Q;  3CU7 A;  2PNR C;  1MSH A;  2MP1 A;  2K1B A;  4KV6 A;  2DJF C;  3WWV A;  5JEA G;  2K6A A;  2BDO A;  1A3U A;  5C4H A;  2JN4 A;  1P16 A;  4A3E B;  4DR4 L;  2N78 A;  2RHQ B;  4DXG A;  1TXY A;  4JI8 L;  1CZW A;  4C1N I;  3T1Y Q;  1VQP A;  4F87 A;  1JB7 A;  4ABN A;  4A3K B;  3F1Z A;  4O0A A;  4X66 L;  5CV8 A;  3FKI B;  1TWG B;  5C0X H;  1KNE A;  3TDQ A;  3IFT A;  4CJ2 C;  3NPP A;  5GQO A;  4A4I A;  3FRP B;  3S1M B;  2R6G A;  3ZYY X;  1EYD A;  3J81 i;  1NTG A;  5M5W H;  2H5X A;  3KF8 A;  1SFO B;  5ELN A;  4OX9 Q;  3I91 A;  3CQZ B;  2B63 H;  1FVI A;  1AN8 A;  3IRB A;  3CCQ A;  4TQU S;  1YNX A;  4AIM A;  1Y1W G;  1SYG A;  3AEV A;  2IX0 A;  3A54 A;  1RTN A;  2A69 C;  4IUP A;  2L0C A;  2UUB L;  2HIX A;  4POG A;  2KQ3 A;  2NZO A;  3QOL A;  5IYD G;  4CKC A;  5H1S E;  1AZP A;  3D4W A;  1LM0 A;  3VR3 A;  4Y52 H;  2ZTD A;  3HG9 A;  2A1A A;  1EYC A;  1SNC A;  2AMC B;  2WB1 E;  3JC6 6;  2B2U C;  3GTP B;  1Q7Y C;  4NW2 A;  1TWF B;  2A5H A;  1U4R A;  1EY7 A;  1IYU A;  1JWM D;  3A8I E;  4GNX B;  3AFP A;  2LMC B;  4F88 A;  1KC8 C;  3M9B A;  1K8A C;  4J1M A;  4FO2 A;  3HOY H;  2CW0 C;  5ISR A;  5C44 G;  2K7V A;  1DYQ A;  4RCN A;  1Q86 C;  4RKL A;  2EYH A;  4R4O A;  4C3H G;  4X62 L;  1NSN S;  3P20 A;  1Y8O B;  1V9P A;  3RLN A;  2NVT B;  4AQY Q;  3J81 j;  1PH6 A;  4JI6 Q;  4R8I A;  1YJ9 A;  4POF A;  4GNX A;  2AQ3 B;  1G6P A;  3VR5 A;  4TRD A;  4XIG S;  1WCM H;  1II3 A;  3A7A B;  4L8J A;  1SNP A;  2B39 A;  2VY3 A;  4QY7 A;  3VA7 A;  1EY5 A;  4OO1 H;  3ULL A;  3OSO A;  4X64 L;  2SDF A;  3DXJ C;  1GUS A;  2K5H A;  3RR5 A;  4DAM A;  2X6G A;  5C4X H;  2A73 B;  1ICF B;  4DR3 Q;  3CC7 A;  1PDQ A;  1B50 A;  4L5T A;  1JIC A;  2EYJ A;  2EY2 A;  2O2L D;  2B8G A;  5JJK A;  4DXF A;  4IFD G;  4HTH A;  4JI3 Q;  2JEB I;  1UEB A;  3SDZ A;  4FP5 D;  2HIV A;  2VL6 A;  2Z9H A;  3I55 A;  2R93 G;  3KDF A;  3N52 A;  1L1O B;  3MXN B;  4DAY B;  2K5V A;  1EFW A;  3M7N A;  2XWJ B;  1U4L A;  5NUC A;  2ENB A;  5IWA L;  4KHP L;  1S5E D;  3PO3 G;  1L1O C;  2B2U A;  1ENF A;  3ER0 A;  3BDO A;  3I4M H;  1PH1 A;  2B2W C;  5M9O A;  4BBR B;  2RDH A;  1PRT B;  1PYS B;  1WTP A;  5C4X B;  4UDU C;  4DV6 Q;  1XMQ Q;  4PMW A;  3J81 E;  3U4Z A;  4IJH A;  2BA0 A;  2MO0 A;  1W6K A;  3HP3 A;  3KDF B;  4YCW A;  2UXD Q;  4DV1 Q;  2BCO A;  4K6D A;  4I7Z C;  4KKS A;  2F03 A;  4HCE A;  4GKK L;  1EZ8 A;  1GKH A;  1P8L A;  4A3L H;  4B3M Q;  1D8L A;  1LTA D;  2VUM B;  2JEA I;  3F2C A;  4A3G H;  1PRT D;  2OT2 A;  1YNN C;  3OYY A;  1QVF A;  1SMY C;  4QUC A;  4DR6 Q;  1YNN D;  1A3V A;  3NTH A;  2BH2 A;  2RSO A;  1I50 H;  3HKZ E;  4JOI A;  1F2Y A;  1TWA B;  2G9D A;  4IPC A;  3NP8 A;  1GHJ A;  2ZXR A;  2B63 G;  4LK1 C;  3PIO A;  4K0K L;  1OXS C;  4A3M G;  3RD4 A;  4A3G G;  1Q12 A;  3GO5 A;  1HQM C;  1E24 A;  4DV3 L;  1WYD A;  4RGT A;  3OWF A;  1CHP D;  4ZCK A;  1LTS D;  2L4N A;  5G3L D;  3GTL H;  4FF2 A;  4IPG A;  1EFI D;  2K28 A;  1I4X A;  1U4M A;  3I4L A;  5JOB A;  3CCM A;  3U58 A;  4DUY Q;  1YVC A;  5FOB B;  3J7A 5;  3H3V H;  1ESF A;  2VQF L;  4GOP A;  1BXT A;  3KLW A;  3TZD A;  3G71 A;  1HH2 P;  3T1H Q;  3L0O A;  1HR0 W;  3CCE A;  4TSS A;  2A19 A;  2LFN A;  1PYB A;  1KD1 C;  1A2T A;  1AEX A;  1PFS A;  2EXZ A;  3RUZ A;  1S5C D;  4QB4 A;  2EXD A;  5FK9 C;  5CR3 A;  2N8N A;  4KKU A;  1B1Z A;  1N32 L;  1JQY D;  3SK6 A;  5BN5 A;  3GQB A;  1MSG A;  4ZLT F;  4DNT B;  3IAY A;  1PFB A;  3G6E A;  3HOV H;  1D7Q A;  3QJY A;  4X3K A;  1B8A A;  3S2D B;  2Z0S A;  4JI0 L;  3E9H A;  1WCM G;  3EJI A;  1NJI C;  3L2P A;  1IZ6 A;  2K5Q A;  1EQV A;  1BCP C;  2FHT A;  4ZYS A;  1HR0 Q;  1N34 Q;  4ZUI A;  1FR3 A;  2NN6 G;  1HXY D;  4CHT B;  4JCV E;  4CDE C;  1X56 A;  1HR0 L;  2EPB A;  2Z4H A;  4P75 A;  1RKN A;  2F0U A;  1IYV A;  3CCR A;  4YWK A;  2E8G A;  5FO8 B;  1PRT F;  4NPS A;  4DAP A;  2JQO A;  5DM7 3;  3HOZ B;  3EN2 A;  5AJ3 L;  1MJC A;  3U9S A;  2UUA L;  3HKZ B;  2F0K A;  2E74 C;  5HUR A;  1HHV A;  2XNA C;  1DZ1 A;  2IHF A;  2NVT H;  1L0X B;  3A5Z B;  4N8X 1;  2B2W A;  2F0W A;  2WB1 G;  4MTN A;  1HTP A;  1HQR D;  1H9S B;  4OIJ A;  2CQA A;  3MEH A;  2Z6B A;  1CSQ A;  1ZXT A;  1PH5 A;  2HDM A;  1B70 B;  3OIQ A;  5IP7 H;  3HOX B;  1J8I A;  2NZ1 D;  4MTK A;  2F52 A;  2XGT A;  4FDB A;  1PMR A;  4X6A H;  2UXB L;  1YHA A;  3HOY G;  3H6M A;  4BA2 I;  4K2L A;  1A6X A;  2C9O A;  1YBY A;  1EY6 A;  1WFQ A;  1A63 A;  1HNW L;  2IT1 A;  3IKJ A;  3PF4 A;  2Q2I A;  4Z9C B;  1XWE A;  3K7A H;  3P7J A;  4A93 B;  2JA8 B;  1HCZ A;  3MXG A;  1EOV A;  3TP6 A;  3EIV A;  4ZK9 B;  4HED A;  1FJG Q;  4B3R Q;  4Q0F A;  2V4D A;  1X9N A;  3D31 A;  5HGQ A;  4O2D A;  1DOM A;  1N9W A;  4KTA A;  1L1O A;  5C6A A;  2RA4 A;  1TS4 A;  2PMZ E;  3CPF A;  1EIY B;  5FLX E;  5IGE A;  3OIP A;  2KUM A;  2I5M X;  2MJ8 A;  2K03 A;  4HMI A;  3NQT A;  1I6H B;  1FGB D;  2RCN A;  1Z6H A;  2Q8I B;  2DUD A;  2J4X A;  1YEZ A;  2JA7 G;  1TKW B;  2EYL A;  5JEA H;  5LL6 S;  2XSC A;  3VYT A;  1LAC A;  2D62 A;  4LF5 L;  1EIF A;  3NSW A;  1KRS A;  2F0E A;  2UXD L;  1NMG A;  3AB9 A;  1YZ6 A;  3GTQ H;  2AQ1 B;  1XMQ L;  2WAQ B;  3CCS A;  2EIF A;  3PMF A;  5IE8 A;  1B9M A;  4HIK A;  2KEN A;  3MA2 B;  4DV2 L;  1MIU A;  3STB D;  1JJC B;  1H9S A;  4WJW A;  3CKI B;  2JA7 H;  3LGJ A;  1BOS A;  4LW1 A;  1FNW A;  4DK6 C;  5D65 A;  1XNQ L;  1R4P B;  4BBS H;  2R93 H;  1HRJ A;  1UE6 A;  4EQP A;  4LF8 Q;  3PUV A;  1VQG A;  2F0L A;  1QUQ A;  3V2T A;  4OGQ C;  5GRO A;  1SEB D;  1M90 C;  1D6E C;  3EFX D;  3BDL A;  4JI3 L;  3CME A;  1CKM A;  4NMZ A;  1YHB A;  3HEJ A;  4XXE A;  3LWE A;  5IT9 c;  2N49 A;  3L7Z C;  1ILP A;  1EY8 A;  5COY A;  3VYU A;  3S17 B;  2QCP X;  3HKZ G;  4DN4 M;  1CK1 A;  2I5L X;  2IPK D;  2M00 A;  2K52 A;  1UUP A;  5KGU A;  1SRU A;  1EU4 A;  1RTO A;  2SEB D;  1SMX A;  1GO3 E;  3VA5 A;  4UY8 C;  4DV7 L;  2K50 A;  4RGO S;  3BVM A;  3D8G A;  3CXC A;  1O7L A;  1GUO A;  4EQ5 A;  4FYD A;  1VQB A;  2KHJ A;  1EYG A;  1KQS A;  5J1Z A;  4DR1 Q;  1IBL L;  4C2M B;  4EGV A;  1GD7 A;  4S3S A;  3PIO 3;  2F0I A;  3K5L A;  1EIH A;  1QZH A;  2SOB A;  3DM3 A;  1S40 A;  2VB2 X;  4DAY A;  1S5B D;  4M1U B;  4U67 3;  2OXP A;  1SXT A;  4RFB A;  2VXW A;  3A8K E;  3Q0A A;  5ELC A;  4GLV B;  2KEC A;  1QUQ B;  2BOS A;  4GZY C;  3BZC A;  3EVQ A;  1O7Y A;  4PMC A;  1UE1 A; 
#chains in the Genus database with same CATH homology
 1B53 A;  4MHE A;  3CRL C;  4KD3 A;  1V43 A;  1EYA A;  3K59 A;  1OXV A;  1F2M A;  4KHV A;  1TR5 A;  3ND8 A;  3R3O A;  1PFM A;  4OO1 G;  2QDB A;  1CHQ D;  3OW7 A;  4K6L A;  2E76 C;  4KD4 A;  1X32 A;  1KNA A;  4RA8 A;  4C3I G;  1EY4 A;  2AWN A;  3G6J B;  5M5X B;  1V8Q A;  2OEO A;  4DAV A;  1VMP A;  5DM6 3;  4NDX A;  3C2P A;  2F1M A;  4K14 A;  2A6E C;  1GUW A;  3OOC A;  5DAU A;  3NBH A;  5FO9 B;  1RDP D;  1CQV A;  2VB3 X;  1TS5 A;  1STE A;  4A3F B;  1E2Z A;  1CT1 D;  1I50 B;  4RH6 A;  2B2Y C;  2FIN B;  3SXH A;  1SJE D;  2EDG A;  3E0J A;  3SK8 A;  1QG7 A;  3P1H A;  3HGB A;  3HS0 C;  3C3L A;  4ZUJ A;  3VR6 A;  4J8Q A;  1PFN A;  3JAM E;  3M85 A;  1EEI D;  2Z4I A;  4FF1 A;  5K36 H;  1ML0 D;  5D3I B;  2ICI A;  1IKM A;  1LTG D;  1BUV T;  1OXU A;  3A55 A;  4H44 C;  2F0H A;  2FFK B;  4HMJ A;  2NVQ B;  1TY2 A;  2GA4 B;  5I6Y A;  2R3Z A;  1A3T A;  4KJN A;  4IFD J;  4X3T A;  5FLX L;  2R93 B;  2BDN A;  3TME A;  5IGC A;  3LNN A;  2NTS A;  4EQN A;  2CW0 D;  2PQE A;  4OO1 I;  2KEE A;  2Z8L A;  1Y69 U;  4RCO A;  2ZT9 C;  4KY6 A;  2E2J B;  4ZKC B;  5EGT A;  3DHQ A;  3PV0 A;  2A6H D;  1SNO A;  2A74 C;  2PZU A;  1JOR A;  2ZXO A;  1PTO D;  3H3V C;  2IX1 A;  4NKL A;  2O5I C;  1EY0 A;  1HFG A;  1H9J A;  2E2I B;  3J7A V;  3DWQ A;  1LTT D;  2NVY B;  1BF4 A;  1QCB D;  1GOZ A;  1V1O A;  1H9K A;  3QWN A;  4IUV A;  3K7A B;  1JWU D;  3GV6 A;  2EJG C;  1MBY A;  1X3P A;  3NTK A;  3GTJ B;  1KDC A;  3NHH A;  3HRZ C;  2Y0S B;  1ET9 A;  4CBV A;  2Z1C A;  2EYM A;  1BCP D;  2K04 A;  4IUR A;  1F9S A;  3QO2 A;  4H13 C;  1WCM B;  1K8O A;  1JCK B;  4O42 A;  3C46 A;  1OXT A;  2F0G A;  2RVL A;  1IKL A;  1B2T A;  3LX0 A;  3NE5 B;  2M2L A;  4XYO A;  5BN3 A;  1D5X C;  1RJT A;  1TVX A;  3M3Y B;  3RZO B;  1EY9 A;  4C56 C;  1BCP B;  2JP1 A;  2L12 A;  1A15 A;  4B9X A;  1QJO A;  1CA6 A;  3E5S A;  1Q1B A;  5E3F A;  1TQO A;  1ILQ A;  5T1G A;  3TBI B;  1I4R A;  1CFM A;  3K5O A;  5M3F B;  3NK9 A;  3X3M A;  2KVM A;  3F2U A;  4DU9 A;  1G8Z D;  4ODG A;  2L55 A;  3OWE B;  3MTS A;  1SYC A;  1JR0 D;  1D1I A;  2CVR A;  3ND9 A;  5G3L F;  3QB3 A;  1QB5 D;  3MAQ A;  1NAP A;  1D5Z C;  3Q22 A;  3DMU A;  3OHX C;  3H91 A;  1PTO H;  5A2Q E;  5JVH 3;  3K58 A;  5A35 A;  5IGF A;  2KHS A;  3I73 A;  4FXD A;  5I9O A;  3KBX A;  2D9U A;  4RWS C;  1TS3 A;  3DWP A;  1D5M C;  2H1E A;  1JOO A;  3QG1 A;  1HA6 A;  4IFD I;  4HSV A;  3T51 B;  2F4I A;  1ZEQ X;  1XYI A;  2HDL A;  2G9H D;  5CV9 A;  1AFP A;  5D14 A;  1QIL A;  2LS0 1;  2EJM A;  3H0G B;  3TSS A;  2F0Q A;  1CTM A;  4XYQ A;  2HUG A;  2L5T A;  3SHL A;  5IGD A;  3SK4 A;  3K6O A;  4DF7 A;  3SR1 A;  4CJ1 B;  3GV3 A;  1BQQ T;  1EOT A;  1XX8 A;  2E75 C;  1Q8I A;  4XQQ A;  5ELE A;  3R2I A;  4OIK A;  1EEF D;  1CA5 A;  1OO9 B;  4BBS B;  1DM0 B;  1CI3 M;  3NXW A;  1WTX A;  1B44 D;  1I4Q A;  4ZKB B;  4G4K A;  1D1K A;  1H9M A;  1IHZ A;  1PZK D;  5EKI A;  1ET6 A;  1PTO F;  2IL8 A;  4DNR B;  1HUN A;  3N6R A;  2F0N A;  1D2B A;  3WOF A;  4KKT A;  1IL8 A;  3GTG B;  2Q8T A;  4DFA A;  2L11 A;  2F0O A;  5FKA C;  2MPM A;  5M5Y B;  4QF4 A;  1BNZ A;  1E2V A;  3V96 A;  4K5W A;  2JSO A;  5I2X A;  2E2D C;  3WOE A;  1MD2 D;  3HZX A;  5IOD A;  3SVM A;  2I46 A;  3BVG A;  5M5W B;  3A8J E;  5C0X J;  1F77 A;  1QWY A;  4IFD H;  3C1E A;  3JAM L;  2AQ2 B;  2HCI A;  5I6W A;  5E1F A;  3VYR A;  3EA6 A;  4KHZ A;  4E6I A;  1NR4 A;  3D4R A;  3I3C A;  4I65 A;  3FMC A;  2PCF B;  4TKO B;  4F8M A;  3NWS A;  1LTB D;  1GJX A;  4HAE A;  1DOL A;  2F0S A;  4PMB A;  4O1N A;  3KLS X;  3R8B A;  2JXM B;  4RGN A;  3VR2 A;  2TSS A;  1JC7 A;  1WTW A;  1STN A;  3PUZ A;  2JA6 B;  2XRS D;  3T4A C;  3I90 A;  4DA2 A;  2F0D A;  5LL6 X;  2IJ0 A;  2VNU D;  2NTT A;  3R2T A;  2WV6 D;  4Y7N B;  3RZD B;  4KY5 A;  3QOJ A;  4XQJ A;  1I3Q B;  4KJO A;  4IN3 A;  3GTK B;  1KLU D;  4A3I B;  3HOW B;  5IIF A;  3NBI A;  3SEB A;  2K33 A;  4G7H C;  5JAV A;  1Q3L A;  5DNF A;  2ID0 A;  5C0X I;  5E4X A;  1S5D D;  4K8J A;  2JE6 I;  2NBF A;  2L1B A;  2B2T C;  1SNQ A;  1PZI D;  1ZYR D;  1UNS A;  1XTC D;  2J7Z A;  4A3B B;  3TP5 A;  3BYT B;  3GTO B;  1NUC A;  4FNF A;  1STG A;  2I07 B;  2L9H A;  4XT3 B;  2DY7 A;  1F9Q A;  3OMC A;  1LT6 D;  1WD1 A;  1V1P A;  2B2Y A;  3TP8 A;  2PO4 A;  2IX3 A;  2QF7 A;  1JB3 A;  4PNY A;  1K83 B;  2O4X A;  3MVV A;  1I4P A;  5CV6 A;  3NTI A;  1GHK A;  3DM1 A;  2B2V A;  1EZ6 A;  4K2K A;  5C4Z A;  2JA5 B;  2H4O A;  3D4D A;  4FXG C;  4KI0 A;  1M8A A;  4RHR A;  2PYK A;  5CMD A;  1B9N A;  4RAU C;  3S15 B;  3BDC A;  3MFY A;  1TY0 A;  3URY A;  4A3M B;  3PO2 B;  1BR9 A;  1E2W A;  4X3S A;  3I4M B;  5KND A;  1S4Z A;  4EVO A;  1DOK A;  5C5L A;  2DNE A;  1K8M A;  1HPC A;  4L6T B;  1W6J A;  3J7A F;  3I72 A;  3S1Q B;  4C3J B;  3J7Y W;  4QIW B;  2K32 A;  1DJR D;  1JE4 A;  4XDX A;  3NUC A;  1C8C A;  1C48 A;  2LY7 A;  4BS9 A;  3ITP A;  2K5W A;  1T5E A;  5JEA J;  1QNK A;  4LJZ C;  1SAP A;  4DK1 A;  1STA A;  3FDT A;  2KED A;  4KMU C;  1J9O A;  1I4G A;  4N9T A;  3TP7 A;  2DY8 A;  3UI2 A;  3HOY B;  5JJZ A;  2XWB B;  2F0F A;  4HR7 B;  2QIL A;  1EU3 A;  4K5V A;  1VF5 C;  1PTO B;  2A6H C;  1EIG A;  5KNB A;  2MGS A;  1G2T A;  5FO7 B;  5C3X A;  4B08 A;  4IQZ A;  1Q1E A;  1HA5 A;  3A56 A;  3W2D A;  5C3W A;  3CRK C;  3Q24 A;  2WKD A;  1FD7 D;  5JPM C;  5KIX A;  4H7B A;  1WD0 A;  1VCI A;  5HGT A;  5C44 B;  2EVB A;  4AYB B;  4XQN A;  4KY7 A;  2A6E D;  1VMC A;  5M3M B;  2RQX A;  2DNC A;  3OPO A;  2F0P A;  1YNJ D;  3Q6S A;  5IGB A;  2TMP A;  2WP8 J;  1RF2 D;  1LV9 A;  2K5D A;  3C1F A;  1HFN A;  4A3D B;  5COR A;  3L3O C;  1KDB A;  1T5X D;  2KCN A;  1TII D;  3NWT A;  1OXX K;  3K0Y A;  5CGK A;  1WTQ A;  3ERQ A;  3QIA A;  1H9R A;  2K01 A;  5EBD A;  1B4O A;  1AW7 A;  2B2V C;  5C0X G;  1BBX C;  4HSP A;  1EWC A;  1WTV A;  4XT1 B;  2MUY A;  1QNU A;  2R92 B;  2J0T D;  5C3E B;  3GTM B;  4MN3 A;  1LO5 D;  5F2D A;  2PPB C;  2NVX B;  1IW7 D;  2KCC A;  4L63 B;  2PZT A;  2CHB D;  5DEH A;  1NCV A;  5CBA E;  3H09 A;  1STY A;  1I6V C;  1SYD A;  3KK7 A;  4CKB A;  1E0B A;  4HN7 A;  5JPN C;  4R9W A;  5KRU A;  1BO0 A;  5CV5 A;  1LLR D;  4IZ8 A;  2AUK A;  5I9P A;  4JBW A;  3DEO A;  3T56 B;  5EPJ A;  1G2S A;  1SYE A;  2NWG A;  2Q8R E;  3D3R A;  4RHS A;  1SJH D;  2BE5 C;  1SE3 A;  3G7L A;  5C4J B;  2JYO A;  2EYF A;  3KLR A;  2ZXP A;  1JWS D;  1BCP F;  1O80 A;  1LTR D;  4MIU A;  5IOC A;  1SBB B;  2EYP A;  3X3N A;  1O7Z A;  4H0L C;  1ZKO A;  3FPP A;  3S2H B;  3NQI A;  4OL7 A;  3V05 A;  4QMG A;  2WAC A;  5KNC A;  4U68 A;  4BA1 I;  2RSN A;  4BY7 B;  4F7X A;  4CJ0 B;  3TN2 A;  3DUZ A;  3PUW A;  5TSS A;  1JOK A;  2MHV A;  2X69 A;  3S16 B;  3W3A A;  5E4W C;  1L0Y B;  1RHP A;  2F3V A;  2EY6 A;  1VF7 A;  4IUT A;  1PYW D;  1DON A;  3D6C A;  1CZG A;  4V19 0;  3O13 A;  3I70 A;  1C4Q A;  1DXM A;  1ESR A;  2IWH A;  1G91 A;  2FMC A;  1VDZ A;  3RMH A;  1LT5 D;  2BE5 D;  2F0T A;  3MC0 B;  2EE1 A;  5I4D A;  5IGG A;  2WB1 B;  2YU9 B;  1WTR A;  1FNU A;  5CC4 A;  2NB0 A;  4N9P A;  1JOQ A;  3PO3 B;  3OMG A;  1ICW A;  5ELB A;  1MGS A;  1PZJ D;  3GD7 A;  1TU2 B;  4B9W A;  1PRT C;  1GXD C;  1TWC B;  2PMZ B;  2XN9 C;  2OF1 A;  4HCS A;  3KUP A;  1XXG A;  4PQX A;  2RDF A;  4UAI A;  3PIP 3;  3M4Y A;  5KYI A;  1R4Q B;  2EY1 A;  5A2Q L;  1TT2 A;  4IUU A;  2C5C A;  2KJX A;  5T1I A;  2R7Z B;  1R9T B;  2E2H B;  1NR2 A;  1LTI D;  2F0V A;  5C5M A;  4BY1 B;  2NYZ D;  1KAA A;  1FNV A;  2YYZ A;  2F0J A;  2RDG A;  1EQT A;  1PLF A;  1F2L A;  3R93 A;  4ILW A;  5J22 A;  4ID6 A;  2A69 D;  1V1P B;  4RGM A;  1F9P A;  1ENC A;  4IAL A;  4QUF A;  1F2Z A;  2EJF C;  1SDF A;  4YIJ A;  1FYC A;  4LAA A;  2N88 A;  2DN8 A;  3IL8 A;  2NN6 H;  4NP5 A;  3E6Z X;  4WFN 3;  5J39 A;  2QKI C;  3HOV B;  4WRD A;  1QE6 A;  3PUX A;  3AMU A;  3VR4 A;  3J80 L;  2WII B;  1SE4 A;  1HTL D;  3BS1 A;  2N55 A;  2R61 A;  3M4O B;  2D2C C;  1PTO C;  4FF3 A;  2X6L A;  1GUT A;  1SYF A;  1AP0 A;  1MI2 A;  4C3H B;  1A2U A;  2F3W A;  3U9O A;  1UEA B;  4V0B A;  3GTQ B;  1LT3 D;  1SYB A;  4CGY B;  5K36 G;  4WOR A;  3J81 L;  1SNM A;  3T16 A;  4M8A A;  4X3U A;  4BWG B;  5IT9 E;  4IUQ A;  4C3I B;  1ZYR C;  3MWY W;  2B8F A;  3KBG A;  5EKL A;  5KEE A;  5EBC A;  4G57 A;  1S5F D;  3SK5 A;  1ROD A;  1IW7 C;  3BZD B;  4FF4 A;  2M9V A;  4JK1 C;  3I4N B;  5EQ0 A;  1LT4 D;  3CHB D;  2SNM A;  4FVM A;  3FPU B;  3AU7 A;  3MXU A;  1SSO A;  4K5X A;  4DK0 A;  1RD9 D;  3D6W A;  2NN6 I;  3BYY B;  1PXU A;  5CBE E;  4FXK C;  2WIN B;  5AFW A;  2IW3 A;  4KN4 C;  1SMY D;  1KDA A;  1DCZ A;  2AUJ D;  3ONA B;  1CQF A;  2K05 A;  5D3D A;  5CYU A;  3T53 B;  3A7L A;  5KYL A;  4K8I A;  4CKE A;  1QOH A;  3T13 A;  5K5P A;  2XVS A;  1STH A;  1TS2 A;  3K5M A;  2A68 D;  1LAB A;  2EOT A;  4G7Z C;  1YNJ C;  5EPL A;  3LWU A;  1ENA A;  5ELD A;  2QEJ C;  1I4H A;  3P75 A;  4ME5 A;  2NUC A;  1O78 A;  3J80 E;  4P2C B;  3HOU B;  1Y1W B;  2EYO A;  3I8Z A;  3WDN A;  3MZ5 A;  3KLS A;  3MHB A;  2O5J C;  1WVL A;  1BDO A;  2KOL A;  1Y8P B;  3GP7 A;  3Q23 A;  1AZQ A;  3S1N B;  1F9R A;  3BVZ A;  4C3J G;  2JA7 B;  3M7G A;  5BN4 A;  2HCC A;  1M4V A;  1RCV D;  5EJW A;  3RLF A;  4LMQ D;  2BA1 A;  4ZAI A;  1TWH B;  1ONL A;  3H94 A;  3TZU A;  2B2T A;  2FMM A;  2B63 B;  5JVG 3;  5I2Y A;  1UAP A;  5EPK A;  1KLG D;  3GTL B;  4OHJ A;  1U9R A;  1G6Z A;  2RKS A;  5LHY 1;  2PW7 A;  2PZW A;  3DEP A;  4ULL A;  1Z7T A;  1Q90 A;  5IT9 L;  4A3J B;  2LKV A;  1CM9 A;  1KTK A;  1HUM A;  2RBM A;  1GUN A;  3EQL C;  3MFG A;  2AWO A;  5EKK A;  3FVQ A;  4EQO A;  1SE2 A;  2FJ2 A;  1KAB A;  1DD2 A;  4Q5V A;  3MXN A;  1Y8N B;  1EL0 A;  3DWA A;  4A3G B;  4DGZ A;  3BG3 A;  3SE0 A;  4RKB A;  4J6H A;  2XRQ D;  4KK7 A;  2EZV A;  2EY5 A;  2F0M A;  4G7O C;  3ERO A;  2PW5 A;  3S14 B;  4XTC S;  2KA7 A;  1X3Q A;  4ZQ3 A;  3MXP A;  4IUN A;  1WTO A;  1Y1V B;  3S9W A;  2A68 C;  3FEW X;  1SND A;  4ZRZ A;  5ELF A;  4QCL A;  2ICE C;  2HQE A;  3K5N A;  1Z47 A;  2WKC A;  3L9A X;  1B3A A;  3K57 A;  1G29 1;  3IFD A;  2D5D A;  3PUY A;  4R8N A;  1EWH A;  3VYS A;  1U4P A;  2SNS A;  4C1N K;  2XIW A;  4PV1 C;  1STB A;  5CV7 A;  3S1R B;  5CV4 A;  4KN7 C;  1GUG A;  3CU7 A;  2PNR C;  1MSH A;  2MP1 A;  2K1B A;  4KV6 A;  5JEA G;  2K6A A;  2BDO A;  1A3U A;  5C4H A;  4A3E B;  4DXG A;  1CZW A;  4C1N I;  4F87 A;  4ABN A;  4A3K B;  5CV8 A;  3FKI B;  1TWG B;  5C0X H;  1KNE A;  3TDQ A;  3IFT A;  4CJ2 C;  3NPP A;  3FRP B;  3S1M B;  2R6G A;  3ZYY X;  1EYD A;  3KF8 A;  1SFO B;  3I91 A;  3CQZ B;  1AN8 A;  4TQU S;  1SYG A;  2IX0 A;  3A54 A;  1RTN A;  2A69 C;  4IUP A;  2L0C A;  2KQ3 A;  3QOL A;  4CKC A;  1AZP A;  3D4W A;  3VR3 A;  3HG9 A;  1EYC A;  1SNC A;  2B2U C;  3GTP B;  4NW2 A;  1TWF B;  2A5H A;  1U4R A;  1EY7 A;  1IYU A;  1JWM D;  3A8I E;  2LMC B;  4F88 A;  4J1M A;  4FO2 A;  2CW0 C;  5ISR A;  2K7V A;  1DYQ A;  4RCN A;  4RKL A;  2EYH A;  4C3H G;  1NSN S;  3P20 A;  1Y8O B;  2NVT B;  4R8I A;  2AQ3 B;  3VR5 A;  4TRD A;  4XIG S;  1II3 A;  3A7A B;  4L8J A;  1SNP A;  2B39 A;  3VA7 A;  1EY5 A;  4OO1 H;  3OSO A;  2SDF A;  3DXJ C;  1GUS A;  2X6G A;  2A73 B;  1PDQ A;  1B50 A;  1JIC A;  2EYJ A;  2EY2 A;  2O2L D;  2B8G A;  4DXF A;  4IFD G;  4HTH A;  2JEB I;  3SDZ A;  4FP5 D;  3N52 A;  3M7N A;  2XWJ B;  1U4L A;  5NUC A;  2ENB A;  1S5E D;  2B2U A;  1ENF A;  3BDO A;  2B2W C;  5M9O A;  4BBR B;  2RDH A;  1PRT B;  1WTP A;  5C4X B;  4UDU C;  4PMW A;  3J81 E;  2BA0 A;  1W6K A;  3HP3 A;  2BCO A;  4K6D A;  4I7Z C;  4KKS A;  2F03 A;  4HCE A;  1EZ8 A;  1LTA D;  2VUM B;  2JEA I;  1PRT D;  2OT2 A;  1YNN C;  1SMY C;  4QUC A;  1YNN D;  1A3V A;  3NTH A;  2RSO A;  1F2Y A;  1TWA B;  2G9D A;  3NP8 A;  1GHJ A;  2ZXR A;  4LK1 C;  1OXS C;  3RD4 A;  1Q12 A;  3GO5 A;  1HQM C;  4RGT A;  3OWF A;  1CHP D;  1LTS D;  2L4N A;  5G3L D;  4FF2 A;  1EFI D;  2K28 A;  1I4X A;  1U4M A;  3I4L A;  5JOB A;  5FOB B;  1ESF A;  1BXT A;  3TZD A;  4TSS A;  2LFN A;  1A2T A;  1AEX A;  2EXZ A;  3RUZ A;  1S5C D;  4QB4 A;  5FK9 C;  5CR3 A;  4KKU A;  1B1Z A;  1JQY D;  3SK6 A;  5BN5 A;  3GQB A;  1MSG A;  4ZLT F;  4DNT B;  3IAY A;  1PFB A;  3QJY A;  4X3K A;  3S2D B;  3EJI A;  2K5Q A;  1EQV A;  1BCP C;  2FHT A;  4ZYS A;  4ZUI A;  1FR3 A;  2NN6 G;  1HXY D;  4CHT B;  2EPB A;  2Z4H A;  1RKN A;  2F0U A;  1IYV A;  5FO8 B;  1PRT F;  4DAP A;  5DM7 3;  3HOZ B;  3U9S A;  3HKZ B;  2F0K A;  2E74 C;  5HUR A;  1HHV A;  2XNA C;  1DZ1 A;  1L0X B;  2B2W A;  2F0W A;  1HTP A;  1HQR D;  1H9S B;  4OIJ A;  2CQA A;  3MEH A;  1ZXT A;  2HDM A;  3OIQ A;  3HOX B;  1J8I A;  2NZ1 D;  1PMR A;  3H6M A;  4BA2 I;  4K2L A;  1A6X A;  2C9O A;  1EY6 A;  2IT1 A;  3IKJ A;  4Z9C B;  1XWE A;  3P7J A;  4A93 B;  2JA8 B;  1HCZ A;  3MXG A;  3TP6 A;  4ZK9 B;  4HED A;  4Q0F A;  2V4D A;  3D31 A;  1DOM A;  4KTA A;  5C6A A;  2RA4 A;  1TS4 A;  5FLX E;  5IGE A;  3OIP A;  2KUM A;  2MJ8 A;  2K03 A;  4HMI A;  3NQT A;  1I6H B;  1FGB D;  1Z6H A;  2Q8I B;  2J4X A;  1TKW B;  2EYL A;  5JEA H;  5LL6 S;  2XSC A;  3VYT A;  1LAC A;  2D62 A;  3NSW A;  2F0E A;  3AB9 A;  2AQ1 B;  2WAQ B;  3PMF A;  1B9M A;  3MA2 B;  1H9S A;  4WJW A;  3CKI B;  1BOS A;  1FNW A;  5D65 A;  1R4P B;  1HRJ A;  4EQP A;  3PUV A;  2F0L A;  3V2T A;  4OGQ C;  1SEB D;  1D6E C;  3EFX D;  3BDL A;  4NMZ A;  3HEJ A;  4XXE A;  3LWE A;  1ILP A;  3L7Z C;  1EY8 A;  5COY A;  3VYU A;  3S17 B;  2QCP X;  4DN4 M;  1CK1 A;  2IPK D;  2M00 A;  1UUP A;  5KGU A;  1EU4 A;  1RTO A;  2SEB D;  3VA5 A;  4RGO S;  3BVM A;  3D8G A;  1O7L A;  1GUO A;  4FYD A;  5J1Z A;  4C2M B;  4EGV A;  4S3S A;  3PIO 3;  2F0I A;  3K5L A;  1EIH A;  2SOB A;  2VB2 X;  4DAY A;  1S5B D;  4M1U B;  4U67 3;  2OXP A;  1SXT A;  4RFB A;  2VXW A;  3A8K E;  3Q0A A;  5ELC A;  2KEC A;  2BOS A;  4GZY C;  3EVQ A;  1O7Y A;  4PMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...