2BDOA

Solution structure of holo-biotinyl domain from acetyl coenzyme a carboxylase of escherichia coli determined by triple-resonance nmr spectroscopy
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
80
structure length
80
Chain Sequence
b'EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (ACETYL-COA CARBOXYLASE)
publication title Solution structures of apo and holo biotinyl domains from acetyl coenzyme A carboxylase of Escherichia coli determined by triple-resonance nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biotin
total genus 6
structure length 80
sequence length 80
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1999-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2bdoA00
2NN6I 3EQLC 3M4YA 1YNNC 4KKSA 2BE5C 3OOCA 4I7ZC 1O78A 3H94A 4HR7B 1ZKOA 4KN7C 4KHZA 2JXMB 4IFDG 3VA7A 3SE0A 5KNDA 2PCFB 3VR5A 1CFMA 5BN3A 3A8KE 4H0LC 1TU2B 1GUTA 2EJGC 5JEAG 3MFYA 2NN6G 4TKOB 3A7LA 1VF7A 3QJYA 1OXTA 2A68D 2O5JC 2BA1A 1TKWB 1GUOA 5A35A 2KA7A 3SDZA 2QF7A 1E2VA 1CI3M 3LWUA 3BG3A 2L5TA 3OW7A 2E75C 2ZT9C 3A8JE 3RLFA 4BA1I 1CTMA 4JK1C 1H9SA 4JBWA 1E2WA 5K36G 4XIGS 1QJOA 2A6EC 3D4RA 2IT1A 3FPPA 3MXUA 4OO1G 3A7AB 2BE5D 3PV0A 3GQBA 3D31A 2B8FA 3PUXA 4LJZC 4RCNA 3CRLC 1GHKA 2BDOA 3KLRA 1Q1EA 4G7HC 3U9SA 1PMRA 1IYVA 3I4LA 3N6RA 4PV1C 1FYCA 1OXXK 4DK0A 3PUYA 5BN4A 1OXSC 2K7VA 2F1MA 3VR3A 4H44C 5KNCA 3WDNA 5K36H 2A69C 1T5EA 1HQMC 1FR3A 1EWHA 1IYUA 4DNRB 2KCCA 1ONLA 2E74C 3AB9A 4IFDH 4OO1H 3IFTA 1H9RA 3T51B 1Q12A 3I72A 5KNBA 1ZYRC 3GD7A 5JEAH 4H13C 3VR4A 1Y69U 1Y8PB 3IKJA 1E2ZA 2A6HC 2NN6H 2EJFC 2A6ED 2EJMA 1B9MA 3P20A 3BDOA 4KKUA 1Y8OB 1IW7C 1H9KA 1B9NA 4KI0A 3I73A 4XTCS 2AUKA 4BA2I 3PUZA 4KN4C 2PNRC 2E76C 2AWOA 2K33A 1LABA 2JE6I 2DNCA 1VDZA 1H9MA 1VF5C 3L7ZC 2PPBC 3PUWA 2D2CC 2AUJD 3W3AA 1SMYC 1G291 4DNTB 2JEAI 4GZYC 1GUGA 1H9JA 3DXJC 1Q90A 4KKTA 2DN8A 2DNEA 1GUSA 1K8MA 3TZUA 1DD2A 3OPOA 1DXMA 3ND9A 1V43A 2D5DA 1Z6HA 2A69D 4DK1A 5C0XG 1Y8NB 1HCZA 1YNJC 4OGQC 4TQUS 4G7OC 1Z7TA 3HGBA 1Q1BA 1GJXA 1OXVA 1VCIA 3QIAA 2O5IC 2JEBI 3LNNA 1DCZA 1GHJA 1K8OA 3ND8A 1HPCA 1OXUA 3CRKC 3NE5B 1V8QA 1I6VC 2A68C 3VR6A 5BN5A 2A6HD 1HTPA 3T53B 3M85A 3T56B 2LMCB 4G7ZC 3M7NA 2YYZA 3QG1A 3PUVA 1BDOA 4LK1C 1IW7D 1O7LA 1A6XA 1GUNA 3VR2A 2D62A 4KMUC 2EDGA 2Q8IB 2B8GA 2CW0C 2R6GA 3A8IE 1H9SB 1LACA 2EVBA 4IQZA 4L8JA 2BA0A 5C0XH 2K32A 3FMCA 2V4DA
chains in the Genus database with same CATH superfamily
4HCSA 2MUYA 3CC4A 4YHHQ 3D4DA 1J6QA 1NCVA 4J15A 5H1SE 1NE3A 4K6DA 1NJIC 3OMGA 2F0SA 4R4TA 3WOEA 4PZ7A 1TXYA 3A5UA 4GNXB 4M1UB 5IE8A 1B4OA 2K75A 2F3VA 4LWCA 2R61A 3K7UC 1YNXA 2AQ3B 2QDBA 3OW2A 5E4WC 3VYRA 1GUOA 2KA7A 1YZ6A 1FJGQ 2R93B 4B08A 1KD1C 4EQNA 1T9HA 4DV7Q 5CMDA 2WKDA 4JI3Q 3BG3A 2PZWA 4NP5A 3BU2A 2KUMA 1CHQD 2IT1A 2JA8B 3DLLA 5EPLA 2PW7A 2JA7H 2XRQD 1PH2A 1L0YB 2BH8A 1S72A 4DUZQ 2QEXA 2QILA 2C9OA 4DAVA 3H91A 4KD4A 3M4OB 1TWFB 1PYWD 4N8X1 3HOXH 3ICEA 2I46A 3KBGA 4DR7L 2KCCA 3H3VH 5T1GA 1TIID 3P7JA 3E9HA 4H13C 3TP5A 5EBCA 1G8ZD 3HOWB 5EBDA 1I6HH 1H95A 4KKUA 1EIFA 2NZ1D 2AWOA 4QUFA 2WINB 4CJ1B 1VF5C 4OWXB 3FRPB 1G6PA 1G291 2M00A 1B53A 5IP7H 1TWCH 2F0PA 5DAUA 3T1HQ 1Y1VB 4RWSC 3T1YL 3SHLA 4PMCA 1I50B 5NUCA 2E2DC 2RDHA 4RMFA 3BZKA 4A3JH 4YIJA 4ODGA 5IGFA 1GJXA 4IJLA 1PA6A 2WB1G 3W2DA 2R7ZB 1Q81C 1WD0A 2F0JA 1RD9D 1D5XC 1TWGH 4A3BG 4QF4A 5CGKA 5LMUL 1I3QB 1MIUA 4OIJA 1R4QB 2L55A 2K05A 1PHJA 4BBSH 1A6XA 1GUNA 3QO2A 2EDGA 4HSVA 2X6GA 1H9SB 1SDFA 2WAQB 2CH4A 1G51A 3J80i 2KCMA 2ZM6L 4G4KA 3U4ZA 5EPJA 1HA6A 3GV3A 3S16B 1NAPA 3VDYA 1TS5A 3AFPA 3BZDB 5M3MB 4R4CA 3H94A 4K14A 4A3LG 3CC7A 3PQIA 3VA7A 2ZTEA 1SNPA 3VR5A 5IWAL 4HSPA 5C4JB 1EY9A 1M1KC 5C44H 1IXRA 3RNUA 1TWAH 1VF7A 2KQ3A 4GKJQ 2R92G 3EIVA 4RCOA 4K2LA 1UE6A 2HDLA 3K57A 5C4ZA 2E2IH 3G48A 2G9DA 4FNFA 1WOCA 2IX1A 1VQAA 3F8TA 3PCOB 3S14B 4OO1G 3MA2B 4OEMB 3VYUA 2DUDA 5C4HA 4RCNA 2ZXOA 3A56A 3I4OA 4BY1H 4KHPQ 3P75A 5BR8L 1Q7YC 2XWBB 4JI0L 5E1FA 2RHQB 3N6RA 1UEAB 4MZ9A 1J5EL 1OXXK 1JJ2A 1E7ZA 3AQQA 2FFKB 4C3IH 1DZ1A 1N34Q 1T5EA 4C3HH 3RN5A 1YHQA 4P71A 1KDAA 4IFDH 1S3OA 2OCEA 1U5KA 1N33L 1S40A 1Q12A 3I72A 3NQTA 4A3DH 3J81c 4LUZA 3TS0A 1PH3A 3X3NA 3LX0A 5D3DA 1SYBA 1LT6D 1CUKA 1X54A 1IW7C 2E2HH 2G5DA 3K7AH 3I73A 5IYDH 3I91A 1C0AA 5M5XH 1IBKL 4IPHA 2UXCL 2JE6I 2PI2E 2IHEA 1PXUA 1K9MC 1H9JA 2IWHA 1TS3A 1VS0A 2NVTH 4A3IH 1SR3A 5ELCA 4UP8A 4UDUC 1BCPC 1NMFA 3G4SA 4BBRB 2VQEQ 2P5ZX 4UAIA 1ICWA 4DA2A 1V8QA 1ESFA 2HHHQ 1HTPA 1CSQA 3GTQB 5AFWA 4LK1C 1IW7D 3J7AF 1C48A 1F77A 3VR2A 3MXNB 4OO1I 5CYUA 2NWGA 4IQZA 1EU3A 4I65A 4ZQ3A 4JCVE 2R3ZA 3UE0A 2EYFA 1KIXA 3M4YA 2J4XA 1W6KA 4KHZA 1Q3LA 4DUYL 1AZQA 2IW3A 4OELB 5FOBB 1BCPD 1RDPD 2ZXPA 1XTCD 3TP7A 5LL6S 4DV2L 1PFNA 1E2VA 4JI4Q 1QNUA 5C5MA 4KY6A 3GTJB 3FHWA 3FPUB 1CTMA 3CQZB 1KC8C 1PRTC 4X64L 4IALA 4DR2Q 5I6WA 4OONA 4OXPA 2Q2UA 1K0SA 3PUXA 4M8AA 3PSIA 4PG3A 2H5XA 1PYSB 1KAWA 1IBML 4DGZA 1SNDA 3HOUB 3MWYW 1VQCA 2XGTA 2ZJQA 4MNOA 2MO1A 3HP3A 1JCKB 3RZOH 3K6OA 4B3MQ 3RZDH 1XNRQ 2EZVA 2KENA 1LTAD 2F03A 2UUAQ 5EKIA 5F2DA 4BY7H 3GO5A 1ENAA 4BXXH 4A3EH 3TSSA 1XMQQ 1X6OA 1PRTD 4O42A 3JAMi 2K5WA 2F0TA 1MD2D 5M3FB 1KRTA 4DK3C 2FINB 3PO3G 4FF4A 2F4IA 1JR0D 3T4AC 3GTKB 3A74A 2OWOA 4A93H 3MEFA 4LFAL 1XPOA 4LF6Q 3S1RH 1MBYA 1AN8A 5IGCA 3TZUA 5KGUA 3OPOA 1RL2A 3V2TA 1X3PA 3O13A 4QY7A 3AMUA 1SXTA 4CKEA 1YNJC 1JJCB 3CC2A 2A74C 4P74A 1X56A 5GQOA 3DEOA 3CRKC 2B2UC 4JW0A 5I6YA 4GN4B 1SFOB 1EEID 1CT1D 1I94Q 3T56B 1S5BD 1AW7A 3S1MB 5JJZA 2L11A 3I4NH 1EIGA 3HKZB 1VQJA 2Q8IB 3OHXC 2VL6A 4F88A 1WTRA 3H3VI 2B2UA 1YI2A 1XPUA 4HCEA 4J8QA 4DV0L 1KABA 3CD6A 1A3UA 3FMCA 3M4OH 3CP0A 4JI6L 3FKIB 1QILA 1VQGA 3EQLC 4RHSA 4ILWA 3D3RA 3DM1A 1SE3A 1S5CD 5LHY1 1YNJD 1XX8A 4DR3Q 4XYQA 2AMCB 2QGQA 4IOCA 1V9PA 1SNOA 3J81L 1QVCA 2EY6A 5GAEC 4B3TQ 1OTCA 1EWIA 2A1AA 3U9OA 4BY1G 3KLWA 1F9SA 4LUVA 1VMPA 2CQAA 2WIIB 1STBA 1VQNA 1TWHH 2ATWA 4FXKC 5IODA 4XIGS 1A0IA 4IJHA 1NTGA 4OIKA 2FJ2A 3V96A 1E3PA 2PZUA 3PV0A 1LTGD 3DWQA 4A3DG 3I7FA 4TVAB 4IUQA 1ZXTA 4O2DA 4GKKQ 1I3QH 3ULLA 3PO2H 5IYDG 3BZCA 5K36H 4UP9A 4XQQA 3QR8A 2Q8RE 4A3CH 3PF5A 3QOLA 4G57A 3MXNA 3UDXA 3T51B 2NVXH 4PMWA 1JJGA 1HRJA 3G71A 4JI1Q 3BDOA 1RIPA 2MHVA 1NUCA 1HHVA 3PUZA 5C6AA 4R4QA 3AYHB 3IFDA 3I56A 2UUBL 4FYDA 4JG2A 2MQHA 1BR9A 5I4DA 3S15H 5EGTA 1L1OC 2K6AA 3I2ZA 1X3FA 2HIXA 5LMNQ 1FNWA 4JBKA 1K8OA 2LFNA 1D2BA 4LF8Q 2GVBA 4DFAA 3K0YA 4DAPA 2UXDL 1BDOA 4B3RQ 4OHJA 1QVGA 3KJOA 1YITA 4NPSA 4ZAIA 4IFDI 3A8IE 2KCTA 3NEMA 3SXHA 2WP8J 5E3FA 4K5XA 2D0PA 4YWLA 1XNQQ 4LFCQ 4NXML 1YNNC 1HR0L 3KOJA 4KY5A 4MN3A 3ERSX 5BN3A 1JOQA 4BS9A 3J80E 2F0GA 2HDMA 4OL7A 4QGUA 5JJKA 3ERQA 3SR1A 4CDDC 5A35A 1ML0D 3UDFA 1BBUA 2OEOA 4HN7A 3EJIA 2F3IA 3GTPH 2CVRA 5CV7A 5AJ3Q 4FF1A 4QB4A 5EKKA 1EIYB 4DF7A 4A3MB 2L5TA 3S9WA 2Y0SG 4DR6Q 1YNND 2VUMB 1LTTD 4DR1L 3GQBA 3CF5A 2JQOA 3U4VA 1G91A 3CRLC 3L9AX 3CPFA 3U9SA 5EAYA 5HGTA 5C4XB 2G9HD 2SNMA 3KK7A 1GKHA 3C1FA 3NWSA 4IUTA 1AE2A 3HG9A 1UE7A 2R93G 4A3LH 4NXNL 1DONA 4AQYQ 1WTXA 1H9RA 5GROA 1CK1A 1PV4A 2K50A 4DR7Q 1YEZA 1G2TA 2JA8G 2R92H 1CZWA 2XNAC 1DJRD 4RG1A 1EQRA 4GOPC 3S2HH 3NENA 2EY2A 2K33A 2FMCA 3FVQA 3S17H 4A3GH 2DNCA 1LTBD 3OSOA 2UU9L 4GZYC 4Y7NB 3EVQA 5D65A 1X55A 2IL8A 4KKTA 2DN8A 4JC0A 2F52A 5GAGC 1S4ZA 4GOPA 2K03A 3T1YQ 5JVH3 3CW2C 1JT8A 1VCIA 3M7GA 1WFQA 5A2QE 1B3QA 1NMGA 2DY7A 5JOBA 1KRSA 5IGBA 4IUUA 3HOWG 1J9OA 5LMUQ 4C2MB 2I07B 3HEJA 2FXQA 1PH7A 3H3VC 4R8IA 2K32A 4DV1L 1LV9A 4HJ9A 2UUCQ 2ZM6Q 4I7ZC 4LF9L 3Q0AA 4LF4L 2PQAB 3CCRA 1EOTA 2PCFB 1CFMA 5FO7B 2EJGC 1CKMA 1A2UA 1K73C 2R7ZG 1LYLA 1G2SA 4N9PA 1N32L 1VQ9A 2ZTDA 1TKWB 4QJFA 4EQOA 3PIOA 3S1QH 1X65A 5EJWA 2HCIA 2F0IA 2B2VC 3ULJA 3BYYB 3I3CA 2F0DA 1HZAA 3BVGA 5K36G 3RLFA 1CZGA 1LM0A 3C2PA 3NTKA 3Q6SA 1SBBB 4A3CG 5M5YH 1IKLA 2NTSA 4NW2A 5M3MG 3DWPA 1WTVA 1F9PA 2F0VA 2B3GA 4B3SQ 2RA4A 1E1TA 4WORA 2BCOA 1EWCA 2RBMA 1K8GA 1DYQA 5BR8Q 4A76A 2F4VL 4JI0Q 1LTRD 5BN4A 1N36L 3X3MA 4JI2L 4JYAL 2VB2X 2L12A 3H6MA 3HFZB 4DNRB 3JC66 1KL9A 5CV5A 1QUQA 4RKLA 2NZHA 3GD7A 2KEDA 1BKBA 2A6HC 3IAYA 3S24A 1N33Q 1UEBA 5FKAC 1CA6A 1BCPB 1ASYA 4POGA 3KLSX 5HURA 4QQBX 4DV3L 1AZPA 4KJOA 1PH6A 1GOZA 2F0KA 1H9MA 2ICEC 1IBKQ 1SYEA 3JAME 5DNFA 5IGGA 2UXCQ 4WJ4A 3S2DB 2YU9H 3TS2A 5JPMC 1DD2A 1NY4A 3ND9A 1WTPA 2H4OA 2XIWA 4RA8A 2J7ZA 1K83B 1Z7TA 1KAAA 4IN3A 4V0BA 4PNYA 3WWVA 1EZ6A 3ND8A 1WYDA 4K8IA 1SMXA 2A6HD 2I0QA 4U673 2Z4HA 4XDXA 5FJ8G 2D62A 2BOSA 2VS1A 1KNEA 3KFUA 2CHBD 2XVSA 4ZUJA 2BE5C 1P16A 3NWTA 2OQKA 1JC7A 5HY6A 1PRTB 1K3BC 1SLJA 3PO3H 3E6ZX 4DUYQ 1VQIA 4LFBL 2K01A 4RH6A 4BBRG 3J81j 3ULPA 1OXTA 2Z4IA 4V190 2EYPA 4LF5Q 3SDZA 4DAYA 3F2BA 3E0EA 5CBEE 5LMNW 2E75C 3I8ZA 1UWVA 4JBWA 1WVLA 1QJOA 1HUNA 2BE5D 4JI8Q 5J3BA 1PVOA 3K80C 3KLRA 1CA5A 3GTMB 4G7HC 5C3EH 2Z6BA 4S3SA 1IBMQ 3A54A 4JBJA 2NVYH 3J81i 5IY0A 4Q0FA 4IOAA 4PV1C 1IBLL 2Q2HA 3EN2A 1SNMA 4A3GG 4OWTB 1XXGA 3R93A 4FXGC 1A2TA 2WACA 4Q5VA 2OTJA 1R4PB 2LS01 1PLFA 5IP9H 1A63A 4PZ8A 2IY5B 1U0LA 2EYOA 2QEJC 4F87A 3UDGA 5M5WH 4L5QA 4EX5A 1Y8OB 3S1NB 2VB3X 2PQAA 3M4QA 1NR4A 2E76C 1EFWA 1DM0B 2EIFA 1F9QA 4RGNA 2XWJB 1FVIA 3HOUG 2CWPA 1C7YA 3PUWA 2QW7A 1SMYC 3HOYB 1Q90A 2HQEA 4DR4Q 5K5PA 3M3YH 4AYBB 1PTOH 3Q22A 3HGBA 1TT2A 4K5WA 1Q1BA 3URYA 2JA6B 3LNNA 4CKBA 3A0JA 1TR5A 3NUCA 2E5LQ 5CORA 4H02A 3SK6A 4ABNA 1RTNA 1UE1A 1STHA 4DR5L 4UPAA 4G7ZC 1FJGL 5M3FG 5C4XH 1EU4A 1B50A 5ELNA 4KMUC 3VYTA 2Z9HA 5CV6A 3GV6A 2ZTCA 1KLGD 1SMYD 1RODA 4DV0Q 4ZKBB 4JI6Q 5KNDA 4P2CB 4ZCKA 2C5CA 3DEPA 1KHIA 3CMEA 4GN3B 3TZDA 5L37A 2NVQH 4TRDA 5FLMH 3I4MH 2QA4A 1SE8A 1Y1WB 1VQ5A 4ZYSA 1X32A 2BA1A 2PNHA 4U68A 3ONAB 3A5ZB 3MVVA 3HKZG 4IUPA 4C3JB 2X6LA 3UDIA 1I4GA 4KD3A 1DOLA 4A3BB 3D4RA 3FKIG 1LTLA 3J7ZC 3HOZH 2BDNA 3H0GB 1BQQT 3SGIA 2B2TC 4LJZC 4N9TA 3FDTA 4RGOS 3D6CA 4R9WA 1R9TB 3C3LA 1F2LA 4HJAA 4ZUIA 1EFID 1JOKA 1SYCA 2FHTA 2K5HA 2UXBL 2EYLA 2K7VA 2PZTA 1STYA 2B63B 3E5SA 1QCBD 2MGSA 1ONLA 2OQ0A 1KDBA 3G6JB 3C1EA 1L1OB 1ZYRC 4NDXA 2PO4A 4XQJA 3F2UA 5JEAJ 5CBAE 1HUMA 4KV6A 1RJTA 2PI2A 4A3KH 2PMZE 5J1ZA 4DU9A 1XJVA 3NTHA 1VDZA 4P75A 4IPGA 1UUPA 3GTLB 1AFPA 1GUSA 4AH6A 4L5SA 2UUBQ 4YCWA 4DK1A 3MAQA 4JVZA 1XMOQ 3R2TA 1C9OA 1OXUA 2CCZA 1ZYRD 2NZOA 1VQHA 4HIOA 2Q2IA 1K28A 1SYGA 3M85A 1JQYD 3M7NA 2LMCB 2EQSA 2LXJA 1WTOA 4LNQA 5GADC 1O7ZA 3GTOB 4CDCC 4HIDA 1U4RA 5CV8A 3F1ZA 3KF6B 2UXDQ 2F0NA 4A75A 2B39A 2R93H 4WRDA 1M8AA 1JORA 1XPRA 2KOLA 2DJFC 2JK8A 5T1IA 4HR7B 2A19A 2L4NA 2KECA 3SE0A 4NXMQ 3DMUA 4KHPL 1HR0Q 2JA8H 1KLUD 5D14A 3DWAA 3TDQA 3K8AA 1U4MA 1MJCA 2WB1E 1VQPA 2R7DA 4ME5A 1L2FA 1Y14B 3RUZA 2J0TD 1M4VA 5C3EG 4JV5L 1B2TA 1BO0A 4X3SA 1SEBD 3C46A 1W6JA 5ELBA 3S2DH 1D8LA 1TWFH 1VQEA 3SK8A 1VQ6A 1LT4D 1QE6A 3NBHB 2Z6KC 3R2IA 2ZXRA 1VQ7A 2RKSA 1EYGA 1HNXQ 3CCQA 5IP9G 2VQFQ 3AEVA 4FVMA 3HOWH 5FK9C 5JVG3 2NUCA 4CJ0B 1EUJA 1Q8IA 5IYCG 4GOPB 1OXSC 1BF4A 1YIJA 4E6IA 3KF8B 3IL8A 1Y1VH 4DPGA 2E74C 3KLSA 1D5ZC 1I50H 1I4HA 4A3MG 2HHHL 4NXNQ 2JA7B 3VR4A 2TSSA 2R7ZH 3KDFB 4IZ8A 1SN8A 2EJMA 4ME3A 4RKBA 1QB5D 2JN4A 2VUMG 4K0KL 1B9NA 4RGMA 1A3VA 2L15A 4XTCS 2RVLA 3SEBA 3SK5A 2B2YC 4L6TB 5JAVA 5C4XG 4RGTA 1EY5A 3BS1A 3HOXB 1QWYA 2ASBA 2UU9Q 5CV9A 4Y52H 1DXMA 1Y8NB 3S16H 4G7OC 2B2YA 5M3MH 3NTIA 2CQOA 1HPCA 1JOOA 1I6HB 2KJXA 3TN2A 5C4JH 2NYZD 3NSWA 2YYZA 3NK9A 4HJ7A 3OIQA 5FLMG 3I4MG 4ZLTF 3T13A 4ZKCB 3K0XA 4P73A 3F2DA 4OX9L 4A3JB 4DR2L 3TP8A 1DOKA 1FGBD 3OOCA 1O7IA 4DV1Q 1SE2A 1EYAA 3CCJA 3S14H 1WI5A 4R8NA 3BDCA 1TWGB 5IIFA 4LF9Q 4LF4Q 1GUTA 4JI7Q 2JA9A 2NN6G 3HOZG 4EVOA 1GUWA 1L1OA 5A2QL 4BBSB 4IURA 1IKMA 4O1NA 5IT9E 1MSHA 1XNRL 2OXPA 2UUAL 1QUQB 3ER0A 3QB3A 1N32Q 1Z47A 3LWUA 1JB7A 2IX3A 2IPKD 2K5VA 1IL2A 3GDEA 4LMQD 1EYDA 5C0XJ 3OTOQ 1EY6A 1E2WA 2KHJA 4QUCA 2JA6H 5C44B 1KNAA 2SNSA 4B9WA 1TWAB 3ZYYX 1V1QA 2JJQA 3CKIB 1CM9A 5FJ8H 4A3KG 1VQKA 4HIMA 2E2IB 2LY7A 4ALPA 2R7FA 2DGYA 5KNCA 1HQMC 4GS3A 1IYUA 4WFN3 3W5OA 3W1BA 4JI2Q 4EQPA 4LF7L 2CKZB 3KF6A 3J81E 1JMCA 4JYAQ 4CKCA 1VQFA 2O4XA 2LXKA 2MFIA 4B9XA 2YTXA 3H09A 4FP5D 4BBRH 3CCMA 4CBVA 2VXWA 3P20A 3RLNA 3MTSA 1JE5A 1D5MC 1X3EA 3HS0C 1JWUD 1Y1WH 3T16A 3GTQH 1PZID 4MTKA 1VQMA 1S5ED 3TMEA 5CC4A 4DNTB 4ZRZA 4C3IB 2KHIA 4C3HB 4DV3Q 1GUGA 4DV6L 1K8MA 4X3TA 4DR3L 4YY3L 1LT3D 1W3SA 1HCZA 2K1BA 4ID6A 1C4QA 2O5IC 2JEBI 3CMAA 5CR3A 2VW9A 3BJUA 2E2HB 2A68C 4DAYB 1UAPA 5M5XB 2BH2A 3NBHA 3QG1A 2XRSD 1EYCA 3D4WA 1FGUA 2CW0C 3HRZC 2D9UA 1E24A 3HZXA 4IPDA 5C0XH 2RF4A 5COYA 1WJJA 4A3FB 2NVTB 3GTJH 4A3IB 4KKSA 1TY2A 1ZKOA 2ENBA 1E1OA 1B70B 3CQZH 2SOBA 4YWMA 4Z9CB 5JEAG 3KF8A 3K5NA 1KQSA 1F2ZA 3AU7A 1X3GA 2JSOA 2IX0A 4KY7A 1ILQA 1HXYD 1FL0A 1EZ8A 2A5HA 1M90C 3QJYA 2A68D 4KLKA 2VZAA 3HOUH 3Q8DA 2AKWB 4LFBQ 3KDFA 2Q8TA 3K59A 1QVFA 1CI3M 4LAAA 2CW0D 4PMBA 5TSSA 1TS2A 3TRZA 4DV5L 1Y1VG 1GO3E 1WTWA 3RLOA 4L5TA 2B8FA 5JPNC 2EXDA 5M3FH 2VY3A 2E2JB 5IWAQ 4J1MA 5GAHC 2XTIA 4XXEA 1SJHD 4X6AH 1EQTA 1IYVA 2MPMA 5IYBG 1SJED 2KCNA 3GTKH 1GM5A 4R1JA 2K5NA 1B1ZA 1HR0W 1IBLQ 1SNQA 2EYHA 2NTTA 5LMNL 2N55A 1NSNS 2N8NA 2WAQG 4LF8L 1Y69U 1U4PA 1YHBA 1A15A 1AH9A 2HD3A 2B2VA 3PIO3 4B3RL 5KIXA 4F7XA 1Z9FA 1SFOH 1LTID 1PDQA 4KN4C 1S5FD 3S1MH 4GLVB 1XNQL 3RZOB 3LGJA 1HZ9A 4LFCL 2SEBD 2A73B 4APVA 3RZDB 2K28A 1D6EC 1MKHA 1J5EQ 4BY7B 1VQ4A 1V43A 1PYBA 3FKIH 5KRUA 4DNIA 1P8LA 4A3EB 2HUGA 4X66L 1TY0A 4L5RC 3QIAA 5ELOA 2LKVA 1D7QA 3VR6A 2K5DA 1IL8A 1V1PA 4L63B 1D1KA 5AJ3L 5DM73 4DR5Q 1QZGA 4A93B 4HJ8A 4DXFA 3S1RB 1HNZL 1LACA 2EVBA 3CAMA 1RTOA 2HT1A 4TSSA 4C1NK 4FXDA 4DR6L 2JA5B 1HQRD 1WTHA 1HNWL 3OMCA 3HOYG 5I9PA 1VQLA 3E0JA 3D8GA 3GTGB 2YTYA 3HOVB 2CH4W 4QIWE 4P72A 1DOMA 4H0LC 2FMMA 4AYBG 3V05A 1G6ZA 4N8FA 1GD7A 2LSSA 3KUPA 2JA6G 5FLXE 1PH9A 3I4NB 1K8AC 2CWAA 3QOJA 5C3WA 4X62L 3HKSA 1LLRD 2PYKA 5KEEA 1ENCA 5FO8B 4AQYL 3J7YW 1VQBA 5EQ0A 1GVPA 1XWEA 3CHBD 1PTOC 4X65L 1EEFD 2H1EA 5I9OA 3MEHA 3BVZA 4HMJA 1WTQA 3MXUA 3A7AB 1PZJD 1CQVA 1JWSD 1MGSA 4QCLA 1LUZA 3M9BA 1WCMB 2IHFA 2ES2A 2I5MX 5IGEA 1AE3A 2F0HA 4ULLA 4JI5L 1HH2P 1Y1WG 1SSOA 2A69C 4DV2Q 2UXBQ 3I70A 1L0WA 1TWHB 4DKAC 1PTOD 1SAPA 3STBC 3TP6A 4C3JG 3OWEB 4IFDJ 3IKJA 4DV4L 5DM63 3CCUA 4FO2A 2MJ8A 2Y0SE 4X64Q 1I4RA 3D6WA 1H9KA 2PQEA 4KI0A 2V1CC 3H0GG 3TQYA 4BA2I 2KVMA 3VYSA 1ENFA 3BVMA 3PO2B 1JWMD 1ILPA 3L7ZC 3LWEA 2D2CC 2UUCL 3DHQA 4POFA 4XYOA 2F0LA 2HIVA 2DNEA 4OWWB 2NVXB 2A69D 5C0XG 2EPBA 2B63G 1UNSA 5KYIA 2K14A 3STBD 3NE5B 2EE1A 4J6HA 4QMGA 1BVSA 1KDCA 2HQLA 5IYCH 1RHPA 1YVCA 1VMCA 5IT9c 2MNAA 2R6GA 3EA6A 2AWNA 5M9OA 4YHHL 1EOVA 3S15B 4DXGA 1TS4A 4XT3B 1SYFA 4A4IA 4HJ5A 5C3XA 2PMZB 2RCFA 4LFAQ 4A3MH 1YJNA 4AIMA 4HTHA 4B3SL 4CDFC 5ELEA 1TVXA 2M2LA 4IO9A 3NP8A 3A8KE 2VUMH 3J80c 2TMPA 1V1OA 2O5JC 2K04A 4HEDA 5D3IB 2HCCA 3NQIA 4CGYB 4DV7L 1K3RA 4JI3L 1I5FA 3TEHB 5DEHA 4KHVA 3Q23A 2WFWA 3CCVA 4JV5Q 2N49A 1BBWA 1CKNA 2ZT9C 1A3TA 1LO5D 3A8JE 3KBXA 4JK1C 4C56C 4GNXC 1EY8A 1LT5D 4DUZL 2KEEA 4RAUC 3KYHC 5C0XI 4GNXA 1PMRA 2AQ2B 4K2KA 4NB3A 3PUYA 3GTPB 4H44C 4Y7NH 3WDNA 2ZJPA 4WJWA 1EWHA 4FDBA 1Q46A 1I4XA 4WJ3M 2WB1B 4A3FH 3AB9A 4KK7A 1BBXC 1EL0A 1RKNA 4DK6C 2YV5A 2AHOB 4KJNA 1UE5A 4R4OA 3MXGA 1E2ZA 2NN6H 2EJFC 1CSPA 2XSCA 2WAQE 1MI2A 3BYTB 3CCEA 2K4KA 2Q2TA 3Q24A 3VA5A 3RD4A 2PNRC 5G3LD 4K0KQ 1LABA 3T1HL 3OWFA 3P1HA 3EBEA 2AQ1B 2B2TA 4C2MH 2EXZA 1SYDA 4NMZA 4CJ2C 3PGZA 2F0WA 4OGQC 1A8VA 2N78A 5ISRA 2L1BA 1DCZA 4X3UA 5IOCA 3L3OC 2R92B 1I6VC 1FNUA 2JA7G 1PFBA 4LF5L 2B29A 2E2JH 3S2HB 4YCUA 3PUVA 4A3GB 2RSNA 3S17B 1AEXA 3MFGA 4IUVA 1TQOA 4L8JA 3MHBA 2EY5A 4JI8L 1EY0A 3FP9A 4K8JA 4OX9Q 1O78A 1KTKA 3HOXG 1F9RA 1HFGA 4YWKA 3N52A 3NXWA 1TU2B 3K5OA 3MFYA 4GKJL 1PH1A 3A7LA 2MO0A 1SROA 4AYBE 2M9VA 4YCVA 4C1NI 2Z8LA 1T5XD 3CPWA 1B8AA 3K5MA 1HA5A 3RR5A 4LUOA 5IP7G 3OW7A 4GLXA 1H9SA 2YTVA 3F2CA 2JYOA 2RQXA 4A3JG 1FD7D 1PFSA 5DLQE 2EOTA 1ESRA 5J22A 1GHKA 2BDOA 5I2YA 2N3SA 1PTOF 4R4IA 3S1QB 3CU7A 1N34L 1NBWA 4DR4L 1FYCA 1A62A 1ZEQX 3W1GA 4BBSG 5KYLA 3ITPA 3H15A 1FR3A 2Z0SA 4DN4M 5IT9L 2JA5H 1L0XB 4K6LA 3L2PA 2E5LL 4GLAC 1SRUA 5M5YB 5JEAH 3GTGH 3HOVH 1K83H 1FNVA 1D1IA 1DGSA 2DY8A 4LF7Q 2F0EA 2EY1A 1VQOA 2KBNA 2OT2A 5E7NA 4EGVA 4DR1Q 5C44G 1BNZA 2A8VA 2RDFA 3J80L 2ICIA 2ID0A 1QZHA 2Z6KA 2AUJD 4FF2A 2GVAA 3JAMc 1XTDA 4DAMA 3K5LA 4X3KA 4K5VA 5EKLA 2VQEL 4DV6Q 1GXDC 1MSGA 1EIHA 2IJ0A 4BWGB 4YY3Q 1WD1A 5BN5A 1WCMH 2OTLA 1HZBA 5FLXc 3UI2A 2KHSA 5IYBH 3M4PA 3U58A 2NBFA 3TREA 1EQQA 3MZ5A 3K58A 2B8GA 5JJLA 2YU9B 3B6YA 2V4DA 1STGA 2F0QA 1J8IA 5ELDA 4C3IG 2F0OA 4C3HG 4ZK9B 2RSOA 1II3A 4IFDG 1NR2A 2EYMA 3EFXD 3E9IA 2PW5A 3I90A 2I5HA 3U50C 1F2MA 1IHZA 4TKOB 2B2WC 3MC0B 3GTMH 3PMFA 1HJPA 4JI4L 2OF1A 1SNCA 1TWCB 3DUZA 2K5QA 2B2WA 2F3WA 1MJEA 4BA1I 1E22A 5J39A 2GN5A 1QNKA 2A6EC 2QKIC 4F8MA 3FPPA 3L0OA 4A3FG 3MXPA 4A3IG 3D31A 3PO3B 3AFQA 3D0FA 1YJ9A 4DV5Q 2I5LX 1PFMA 2X69A 1E0BA 2MP1A 3S1NH 1PH5A 1RCVD 2O2LD 3PIPA 4B3ML 3KJPA 5HGQA 1XYIA 4PZ6A 3VR3A 1PH8A 3HOYH 1XMOL 5G3LF 1XMQL 3IFTA 2RHSB 2QCPX 1V1PB 3HKZE 1YHAA 5ELFA 1LTSD 3PIP3 4QL5A 2A6ED 1B9MA 5EPKA 2C35B 1STNA 5C3EB 3QWNA 3G7LA 3PF4A 2GA4B 2AUKA 4H7BA 2NVYB 1AP0A 4JBMA 4LF6L 1ASZA 1OO9B 2RCNA 2WV6D 2ALYB 3GP7A 2PPBC 3W3AA 1BCPF 2JEAI 3OYYA 3A55A 3DXJC 1QG7A 1MHWC 3TBIB 2F4VQ 1N9WA 1Z6HA 3RMHA 1PH4A 1N36Q 2NB0A 4TQUS 1U4LA 1YJWA 1I4PA 1STEA 5CV4A 1GHJA 5M5WB 1I94L 5IGDA 4MIUA 4X66Q 2JP1A 4BY1B 3T53B 1B7YB 1VQ8A 3SVMA 1K0RA 5E4XA 4HAEA 4CHTB 2D0OA 2QDLA 1O7YA 2F0FA 2WKCA 3NPPA 3RN2A 1HNZQ 3M3YB 2NN6I 4C3JH 1ICFB 1PTOB 2XN9C 1HNXL 2VQFL 2EYJA 4KN7C 4A3DB 2JXMB 4BY7G 2ZJRA 4A3BH 4JOIC 4BXXG 1HNWQ 1JB3A 4A3EG 1X9NA 3H0GH 4HMIA 4B3TL 1O80A 3K7AB 2Z1CA 1C8CA 4O0AA 1ET6A 1HFNA 4EQ5A 5C5LA 3OIPA 1EY4A 1BXTA 4NKLA 1R9TH 3G6EA 1PRTF 4JOIA 2VNUD 2QF7A 3IRBA 1BUVT 4X62Q 2CFMA 2E8GA 4A93G 1BOSA 2B63H 3CXCA 1IZ6A 4X65Q 1U9RA 3JAML 1STAA 4FF3A 2JA5G 5LL6X 2NVQB 4GKKL 2L9HA 3SK4A 1I4QA 3J7AV 3I4MB 4PQXA 3HOVG 2F0UA 1CQFA 1Q1EA 1KXLA 3E3XA 4IUNA 3WOFA 1IYJB 5FO9B 1ET9A 1SE4A 1JE4A 3I4LA 3J7A5 1B44D 3NELA 4QIWB 4DK0A 3I4NG 5FLXL 4HIKA 1CHPD 2F1MA 1S5DD 4MHEA 4IPCA 4XQNA 5I2XA 3R3OA 4JI5Q 3GTLH 4OO1H 2K52A 1JICA 1W2BA 3NHHA 4JI1L 3FEWX 3UE1A 5KNBA 4KTAA 1X3QA 3HOZB 1NNXA 1Y8PB 3CCSA 3EROA 3DM3A 2DJGC 1EQVA 4DV4Q 1Q8KA 4MTNA 1RF2D 1Q82C 4CDEC 1WCMG 3GTOH 1Q86C 3R8BA 4RFBA 2L0CA 4GN5A 3ZJYC 3K81C 3I55A 1HTLD 4UHVA 1N8RC 2D5DA 4RHRA 4JI7L 3CCLA 4UP7A 1F2YA 1OXVA 4I7AA 1YBYA 2SDFA 3NBIA 1CKOA 1QOHA 4A3KB 1VQDA 1PZKD 2F0MA 1O7LA 1B3AA 1CKNB 1HZCA 5JJIA 2N88A 1EY7A 4XT1B 4UY8C 4JPBW 3OTOL 3PO2G 2BA0A 4LW1A 2Y0SB 2RDGA 3BDLA
chains in the Genus database with same CATH topology
4HCSA 2MUYA 3D4DA 1NCVA 4K6DA 3OMGA 2F0SA 3WOEA 4M1UB 1B4OA 2F3VA 2R61A 2AQ3B 2QDBA 5E4WC 3VYRA 1GUOA 2KA7A 2R93B 4B08A 4EQNA 5CMDA 2WKDA 3BG3A 2PZWA 4NP5A 2KUMA 1CHQD 2IT1A 2JA8B 5EPLA 2PW7A 2XRQD 1L0YB 2QILA 2C9OA 4DAVA 3H91A 4KD4A 3M4OB 1TWFB 1PYWD 2I46A 3KBGA 2KCCA 5T1GA 1TIID 3P7JA 4H13C 3TP5A 5EBCA 1G8ZD 3HOWB 5EBDA 4KKUA 2NZ1D 2AWOA 4QUFA 2WINB 4CJ1B 1VF5C 3FRPB 1G291 2M00A 1B53A 2F0PA 5DAUA 1Y1VB 4RWSC 3SHLA 4PMCA 1I50B 5NUCA 2E2DC 2RDHA 4YIJA 4ODGA 5IGFA 1GJXA 2R7ZB 3W2DA 1WD0A 2F0JA 1RD9D 1D5XC 4QF4A 5CGKA 1I3QB 4OIJA 1R4QB 2L55A 2K05A 1A6XA 1GUNA 3QO2A 2EDGA 4HSVA 2X6GA 1H9SB 1SDFA 2WAQB 4G4KA 5EPJA 1HA6A 3GV3A 3S16B 1NAPA 1TS5A 3BZDB 5M3MB 3H94A 4K14A 3VA7A 1SNPA 3VR5A 4HSPA 5C4JB 1EY9A 1VF7A 2KQ3A 4RCOA 4K2LA 2HDLA 3K57A 5C4ZA 2G9DA 4FNFA 2IX1A 3S14B 4OO1G 3MA2B 3VYUA 5C4HA 4RCNA 2ZXOA 3A56A 3P75A 2XWBB 5E1FA 3N6RA 1UEAB 1OXXK 1DZ1A 2FFKB 1T5EA 1KDAA 4IFDH 1Q12A 3I72A 3NQTA 3X3NA 3LX0A 5D3DA 1SYBA 1LT6D 1IW7C 3I73A 3I91A 2JE6I 1PXUA 1H9JA 2IWHA 1TS3A 5ELCA 4UDUC 1BCPC 4BBRB 4UAIA 1ICWA 4DA2A 1V8QA 1ESFA 1HTPA 3GTQB 5AFWA 4LK1C 1IW7D 3J7AF 1C48A 1F77A 3VR2A 4OO1I 5CYUA 2NWGA 4IQZA 1EU3A 4I65A 4ZQ3A 2R3ZA 2EYFA 3M4YA 2J4XA 1W6KA 4KHZA 1Q3LA 1AZQA 2IW3A 5FOBB 1BCPD 1RDPD 2ZXPA 1XTCD 3TP7A 5LL6S 1PFNA 1E2VA 1QNUA 5C5MA 4KY6A 3GTJB 3FPUB 1CTMA 3CQZB 1PRTC 4IALA 5I6WA 3PUXA 4M8AA 4DGZA 1SNDA 3HOUB 3MWYW 3HP3A 1JCKB 3K6OA 2EZVA 2F03A 1LTAD 5EKIA 5F2DA 3GO5A 1ENAA 3TSSA 1PRTD 4O42A 2K5WA 2F0TA 1MD2D 5M3FB 2FINB 4FF4A 2F4IA 1JR0D 3T4AC 3GTKB 1MBYA 1AN8A 5IGCA 3TZUA 5KGUA 3OPOA 3V2TA 1X3PA 3O13A 3AMUA 1SXTA 4CKEA 1YNJC 2A74C 3DEOA 3CRKC 2B2UC 5I6YA 1SFOB 1EEID 1CT1D 3T56B 1S5BD 1AW7A 3S1MB 5JJZA 2L11A 1EIGA 3HKZB 2Q8IB 3OHXC 4F88A 1WTRA 2B2UA 4HCEA 4J8QA 1KABA 1A3UA 3FMCA 3FKIB 1QILA 3EQLC 4RHSA 4ILWA 3D3RA 3DM1A 1SE3A 1S5CD 5LHY1 1YNJD 1XX8A 4XYQA 1SNOA 3J81L 2EY6A 3U9OA 1F9SA 1VMPA 2CQAA 2WIIB 1STBA 4FXKC 5IODA 4XIGS 4OIKA 3V96A 2FJ2A 2PZUA 3PV0A 1LTGD 3DWQA 4IUQA 1ZXTA 5K36H 4XQQA 2Q8RE 3QOLA 4G57A 3MXNA 3T51B 4PMWA 1HRJA 3BDOA 2MHVA 1NUCA 1HHVA 3PUZA 5C6AA 3IFDA 4FYDA 1BR9A 5I4DA 5EGTA 2K6AA 1FNWA 1K8OA 2LFNA 1D2BA 4DFAA 3K0YA 4DAPA 1BDOA 4OHJA 4ZAIA 4IFDI 3A8IE 3SXHA 2WP8J 5E3FA 4K5XA 1YNNC 4KY5A 4MN3A 5BN3A 1JOQA 4BS9A 3J80E 2F0GA 2HDMA 4OL7A 3ERQA 3SR1A 5A35A 1ML0D 2OEOA 4HN7A 3EJIA 2CVRA 5CV7A 4FF1A 4QB4A 5EKKA 4DF7A 4A3MB 2L5TA 3S9WA 1YNND 2VUMB 1LTTD 3GQBA 1G91A 3CRLC 3L9AX 3U9SA 5HGTA 5C4XB 2G9HD 2SNMA 3KK7A 3C1FA 3NWSA 4IUTA 3HG9A 1DONA 1WTXA 1H9RA 1CK1A 1G2TA 1CZWA 2XNAC 1DJRD 2EY2A 2K33A 2FMCA 3FVQA 2DNCA 1LTBD 3OSOA 4GZYC 4Y7NB 3EVQA 5D65A 2IL8A 4KKTA 2DN8A 1S4ZA 2K03A 5JVH3 1VCIA 3M7GA 5A2QE 2DY7A 5JOBA 5IGBA 4IUUA 1J9OA 4C2MB 2I07B 3HEJA 3H3VC 4R8IA 2K32A 1LV9A 4I7ZC 3Q0AA 1EOTA 2PCFB 1CFMA 5FO7B 2EJGC 1A2UA 1G2SA 4N9PA 1TKWB 4EQOA 5EJWA 2HCIA 2F0IA 2B2VC 3BYYB 3I3CA 2F0DA 3BVGA 5K36G 3RLFA 1CZGA 3C2PA 3NTKA 3Q6SA 1SBBB 1IKLA 2NTSA 4NW2A 3DWPA 1WTVA 1F9PA 2F0VA 2RA4A 4WORA 2BCOA 1EWCA 2RBMA 1DYQA 1LTRD 5BN4A 3X3MA 2VB2X 2L12A 3H6MA 4DNRB 5CV5A 4RKLA 3GD7A 2KEDA 2A6HC 3IAYA 5FKAC 1CA6A 1BCPB 3KLSX 5HURA 1AZPA 4KJOA 1GOZA 2F0KA 1H9MA 2ICEC 1SYEA 3JAME 5DNFA 5IGGA 3S2DB 5JPMC 1DD2A 3ND9A 1WTPA 2H4OA 2XIWA 4RA8A 2J7ZA 1K83B 1Z7TA 1KAAA 4IN3A 4V0BA 4PNYA 1EZ6A 3ND8A 4K8IA 2A6HD 4U673 2Z4HA 4XDXA 2D62A 2BOSA 1KNEA 2CHBD 2XVSA 4ZUJA 2BE5C 3NWTA 1JC7A 1PRTB 3E6ZX 2K01A 4RH6A 1OXTA 2Z4IA 4V190 2EYPA 3SDZA 4DAYA 5CBEE 2E75C 3I8ZA 4JBWA 1WVLA 1QJOA 1HUNA 2BE5D 3KLRA 1CA5A 3GTMB 4G7HC 4S3SA 3A54A 4Q0FA 4PV1C 1SNMA 1XXGA 3R93A 4FXGC 1A2TA 2WACA 4Q5VA 1R4PB 2LS01 1PLFA 2EYOA 2QEJC 4F87A 1Y8OB 3S1NB 2VB3X 1NR4A 2E76C 1DM0B 1F9QA 4RGNA 2XWJB 3PUWA 1SMYC 3HOYB 1Q90A 2HQEA 5K5PA 4AYBB 1PTOH 3Q22A 3HGBA 1TT2A 4K5WA 1Q1BA 3URYA 2JA6B 3LNNA 4CKBA 1TR5A 3NUCA 5CORA 3SK6A 4ABNA 1RTNA 1STHA 4G7ZC 1EU4A 1B50A 4KMUC 3VYTA 5CV6A 3GV6A 1KLGD 1SMYD 1RODA 4ZKBB 5KNDA 4P2CB 2C5CA 3DEPA 3TZDA 4TRDA 1Y1WB 4ZYSA 1X32A 2BA1A 4U68A 3ONAB 3MVVA 4IUPA 4C3JB 2X6LA 1I4GA 4KD3A 1DOLA 4A3BB 3D4RA 2BDNA 3H0GB 1BQQT 2B2TC 4LJZC 4N9TA 3FDTA 4RGOS 3D6CA 4R9WA 1R9TB 3C3LA 1F2LA 4ZUIA 1EFID 1JOKA 1SYCA 2FHTA 2EYLA 2K7VA 2PZTA 1STYA 2B63B 3E5SA 1QCBD 2MGSA 1ONLA 1KDBA 3G6JB 3C1EA 1ZYRC 4NDXA 2PO4A 4XQJA 3F2UA 5JEAJ 5CBAE 1HUMA 4KV6A 1RJTA 5J1ZA 4DU9A 3NTHA 1VDZA 1UUPA 3GTLB 1AFPA 1GUSA 4DK1A 3MAQA 3R2TA 1OXUA 1ZYRD 3M85A 1SYGA 1JQYD 3M7NA 2LMCB 1WTOA 1O7ZA 3GTOB 1U4RA 5CV8A 2F0NA 2B39A 4WRDA 1M8AA 1JORA 2KOLA 5T1IA 4HR7B 2L4NA 2KECA 3SE0A 3DMUA 1KLUD 5D14A 3DWAA 3TDQA 1U4MA 4ME5A 3RUZA 2J0TD 1M4VA 1B2TA 1BO0A 4X3SA 1SEBD 3C46A 1W6JA 5ELBA 3SK8A 1LT4D 1QE6A 3R2IA 2ZXRA 2RKSA 4FVMA 5FK9C 5JVG3 2NUCA 4CJ0B 1Q8IA 1OXSC 1BF4A 4E6IA 3IL8A 2E74C 3KLSA 1D5ZC 1I4HA 2JA7B 3VR4A 2TSSA 4IZ8A 2EJMA 4RKBA 1QB5D 1B9NA 4RGMA 1A3VA 4XTCS 2RVLA 3SEBA 3SK5A 2B2YC 4L6TB 5JAVA 4RGTA 1EY5A 3BS1A 3HOXB 1QWYA 5CV9A 1DXMA 1Y8NB 4G7OC 2B2YA 3NTIA 1HPCA 1JOOA 1I6HB 2KJXA 3TN2A 2NYZD 3NSWA 2YYZA 3NK9A 3OIQA 4ZLTF 3T13A 4ZKCB 4A3JB 3TP8A 1DOKA 1FGBD 3OOCA 1SE2A 1EYAA 4R8NA 3BDCA 1TWGB 5IIFA 1GUTA 2NN6G 4EVOA 1GUWA 5A2QL 4BBSB 1IKMA 4IURA 4O1NA 5IT9E 1MSHA 2OXPA 3QB3A 1Z47A 3LWUA 2IX3A 2IPKD 4LMQD 1EYDA 5C0XJ 1EY6A 1E2WA 4QUCA 5C44B 1KNAA 2SNSA 4B9WA 1TWAB 3ZYYX 3CKIB 1CM9A 2E2IB 2LY7A 5KNCA 1HQMC 1IYUA 4WFN3 4EQPA 3J81E 4CKCA 2O4XA 4B9XA 3H09A 4FP5D 4CBVA 2VXWA 3P20A 3MTSA 1D5MC 3HS0C 1JWUD 3T16A 1PZID 1S5ED 3TMEA 5CC4A 4DNTB 4ZRZA 4C3IB 4C3HB 1GUGA 1K8MA 4X3TA 1LT3D 1HCZA 2K1BA 4ID6A 1C4QA 2O5IC 2JEBI 5CR3A 2E2HB 2A68C 1UAPA 5M5XB 3NBHA 3QG1A 2XRSD 1EYCA 3D4WA 2CW0C 3HRZC 2D9UA 3HZXA 5C0XH 5COYA 4A3FB 2NVTB 4A3IB 4KKSA 1TY2A 1ZKOA 2ENBA 2SOBA 4Z9CB 5JEAG 3KF8A 3K5NA 1F2ZA 3AU7A 2JSOA 2IX0A 4KY7A 1ILQA 1HXYD 1EZ8A 2A5HA 3QJYA 2A68D 2Q8TA 3K59A 1CI3M 4LAAA 2CW0D 4PMBA 5TSSA 1TS2A 1WTWA 2B8FA 5JPNC 2E2JB 4J1MA 4XXEA 1SJHD 1EQTA 1IYVA 2MPMA 1SJED 2KCNA 1B1ZA 1SNQA 2EYHA 2NTTA 2N55A 1NSNS 1Y69U 1U4PA 1A15A 2B2VA 3PIO3 5KIXA 4F7XA 1LTID 1PDQA 4KN4C 1S5FD 3RZOB 2SEBD 2A73B 3RZDB 2K28A 1D6EC 4BY7B 1V43A 5KRUA 4A3EB 2HUGA 1TY0A 3QIAA 2LKVA 3VR6A 2K5DA 1IL8A 1V1PA 4L63B 1D1KA 5DM73 4A93B 4DXFA 3S1RB 1LACA 2EVBA 1RTOA 4TSSA 4C1NK 4FXDA 2JA5B 1HQRD 3OMCA 5I9PA 3E0JA 3D8GA 3GTGB 3HOVB 1DOMA 4H0LC 2FMMA 3V05A 1G6ZA 3KUPA 5FLXE 3I4NB 3QOJA 5C3WA 1LLRD 2PYKA 5KEEA 1ENCA 5FO8B 3J7YW 5EQ0A 1XWEA 3CHBD 1PTOC 1EEFD 2H1EA 5I9OA 3MEHA 3BVZA 4HMJA 1WTQA 3MXUA 3A7AB 1PZJD 1CQVA 1JWSD 1MGSA 4QCLA 1WCMB 5IGEA 2F0HA 4ULLA 1SSOA 2A69C 3I70A 1TWHB 1PTOD 1SAPA 3TP6A 4C3JG 3OWEB 4IFDJ 3IKJA 5DM63 4FO2A 2MJ8A 1I4RA 3D6WA 1H9KA 2PQEA 4KI0A 4BA2I 2KVMA 3VYSA 1ENFA 3BVMA 3PO2B 1JWMD 1ILPA 3L7ZC 3LWEA 2D2CC 3DHQA 4XYOA 2F0LA 2DNEA 2NVXB 2A69D 5C0XG 2EPBA 1UNSA 5KYIA 3NE5B 2EE1A 4J6HA 4QMGA 1KDCA 1RHPA 1VMCA 2R6GA 3EA6A 2AWNA 5M9OA 3S15B 4DXGA 4XT3B 1TS4A 1SYFA 5C3XA 2PMZB 4HTHA 5ELEA 1TVXA 2M2LA 3NP8A 3A8KE 2TMPA 1V1OA 2O5JC 2K04A 4HEDA 5D3IB 2HCCA 3NQIA 4CGYB 5DEHA 4KHVA 3Q23A 2ZT9C 1A3TA 1LO5D 3A8JE 3KBXA 4JK1C 4C56C 1EY8A 1LT5D 2KEEA 4RAUC 5C0XI 1PMRA 2AQ2B 4K2KA 3PUYA 3GTPB 4H44C 3WDNA 4WJWA 1EWHA 1I4XA 2WB1B 3AB9A 4KK7A 1BBXC 1EL0A 1RKNA 4KJNA 3MXGA 1E2ZA 2NN6H 2EJFC 2XSCA 1MI2A 3BYTB 3Q24A 3VA5A 3RD4A 2PNRC 5G3LD 1LABA 3OWFA 3P1HA 2AQ1B 2B2TA 2EXZA 1SYDA 4NMZA 4CJ2C 2F0WA 4OGQC 5ISRA 2L1BA 1DCZA 4X3UA 5IOCA 3L3OC 2R92B 1I6VC 1FNUA 1PFBA 3S2HB 3PUVA 4A3GB 2RSNA 3S17B 1AEXA 3MFGA 4IUVA 1TQOA 4L8JA 3MHBA 2EY5A 1EY0A 4K8JA 1O78A 1KTKA 1F9RA 1HFGA 3N52A 3NXWA 1TU2B 3K5OA 3MFYA 3A7LA 2M9VA 4C1NI 2Z8LA 1T5XD 3K5MA 1HA5A 3OW7A 1H9SA 2JYOA 2RQXA 1FD7D 2EOTA 1ESRA 5J22A 1GHKA 2BDOA 5I2YA 1PTOF 3S1QB 3CU7A 1FYCA 1ZEQX 5KYLA 3ITPA 1FR3A 4DN4M 5IT9L 1L0XB 4K6LA 5M5YB 5JEAH 1FNVA 1D1IA 2DY8A 2F0EA 2EY1A 2OT2A 4EGVA 1BNZA 2RDFA 3J80L 2ICIA 2ID0A 4FF2A 2AUJD 3K5LA 4X3KA 4K5VA 5EKLA 1GXDC 1MSGA 1EIHA 2IJ0A 4BWGB 1WD1A 5BN5A 3UI2A 2KHSA 2NBFA 3MZ5A 3K58A 2B8GA 2YU9B 2V4DA 1STGA 2F0QA 1J8IA 5ELDA 4C3IG 2F0OA 4C3HG 4ZK9B 2RSOA 1II3A 4IFDG 1NR2A 2EYMA 3EFXD 2PW5A 3I90A 1F2MA 1IHZA 4TKOB 2B2WC 3MC0B 3PMFA 2OF1A 1SNCA 1TWCB 3DUZA 2K5QA 2B2WA 2F3WA 4BA1I 5J39A 1QNKA 2A6EC 2QKIC 4F8MA 3FPPA 3MXPA 3D31A 3PO3B 1PFMA 2X69A 1E0BA 2MP1A 1RCVD 2O2LD 1XYIA 3VR3A 5G3LF 3IFTA 2QCPX 1V1PB 5ELFA 1LTSD 3PIP3 2A6ED 1B9MA 5EPKA 1STNA 5C3EB 3QWNA 3G7LA 2GA4B 2AUKA 4H7BA 2NVYB 1AP0A 1OO9B 2WV6D 3GP7A 2PPBC 3W3AA 1BCPF 2JEAI 3A55A 3DXJC 1QG7A 3TBIB 1Z6HA 3RMHA 2NB0A 4TQUS 1U4LA 1I4PA 1STEA 5CV4A 1GHJA 5M5WB 5IGDA 4MIUA 2JP1A 4BY1B 3T53B 3SVMA 5E4XA 4HAEA 4CHTB 1O7YA 2F0FA 2WKCA 3NPPA 3M3YB 2NN6I 1PTOB 2XN9C 2EYJA 4KN7C 4A3DB 2JXMB 1JB3A 4HMIA 1O80A 3K7AB 2Z1CA 1C8CA 1HFNA 1ET6A 5C5LA 3OIPA 1EY4A 1BXTA 4NKLA 1PRTF 2VNUD 2QF7A 1BUVT 1BOSA 1U9RA 3JAML 1STAA 4FF3A 5LL6X 2NVQB 2L9HA 3SK4A 1I4QA 3J7AV 3I4MB 4PQXA 2F0UA 1CQFA 1Q1EA 4IUNA 3WOFA 5FO9B 1ET9A 1SE4A 1JE4A 3I4LA 1B44D 4QIWB 4DK0A 5FLXL 1CHPD 2F1MA 1S5DD 4MHEA 4XQNA 5I2XA 3R3OA 4OO1H 1JICA 3NHHA 3FEWX 5KNBA 4KTAA 1X3QA 3HOZB 1Y8PB 3EROA 1EQVA 1RF2D 3R8BA 4RFBA 2L0CA 1HTLD 2D5DA 4RHRA 1F2YA 1OXVA 2SDFA 3NBIA 4A3KB 1QOHA 1PZKD 2F0MA 1O7LA 1B3AA 2N88A 1EY7A 4XT1B 2BA0A 2Y0SB 2RDGA 3BDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 I;  3EQL C;  3M4Y A;  1YNN C;  4KKS A;  2BE5 C;  3OOC A;  4I7Z C;  1O78 A;  3H94 A;  4HR7 B;  1ZKO A;  4KN7 C;  4KHZ A;  2JXM B;  4IFD G;  3VA7 A;  3SE0 A;  5KND A;  2PCF B;  3VR5 A;  1CFM A;  5BN3 A;  3A8K E;  4H0L C;  1TU2 B;  1GUT A;  2EJG C;  5JEA G;  3MFY A;  2NN6 G;  4TKO B;  3A7L A;  1VF7 A;  3QJY A;  1OXT A;  2A68 D;  2O5J C;  2BA1 A;  1TKW B;  1GUO A;  5A35 A;  2KA7 A;  3SDZ A;  2QF7 A;  1E2V A;  1CI3 M;  3LWU A;  3BG3 A;  2L5T A;  3OW7 A;  2E75 C;  2ZT9 C;  3A8J E;  3RLF A;  4BA1 I;  1CTM A;  4JK1 C;  1H9S A;  4JBW A;  1E2W A;  5K36 G;  4XIG S;  1QJO A;  2A6E C;  3D4R A;  2IT1 A;  3FPP A;  3MXU A;  4OO1 G;  3A7A B;  2BE5 D;  3PV0 A;  3GQB A;  3D31 A;  2B8F A;  3PUX A;  4LJZ C;  4RCN A;  3CRL C;  1GHK A;  2BDO A;  3KLR A;  1Q1E A;  4G7H C;  3U9S A;  1PMR A;  1IYV A;  3I4L A;  3N6R A;  4PV1 C;  1FYC A;  1OXX K;  4DK0 A;  3PUY A;  5BN4 A;  1OXS C;  2K7V A;  2F1M A;  3VR3 A;  4H44 C;  5KNC A;  3WDN A;  5K36 H;  2A69 C;  1T5E A;  1HQM C;  1FR3 A;  1EWH A;  1IYU A;  4DNR B;  2KCC A;  1ONL A;  2E74 C;  3AB9 A;  4IFD H;  4OO1 H;  3IFT A;  1H9R A;  3T51 B;  1Q12 A;  3I72 A;  5KNB A;  1ZYR C;  3GD7 A;  5JEA H;  4H13 C;  3VR4 A;  1Y69 U;  1Y8P B;  3IKJ A;  1E2Z A;  2A6H C;  2NN6 H;  2EJF C;  2A6E D;  2EJM A;  1B9M A;  3P20 A;  3BDO A;  4KKU A;  1Y8O B;  1IW7 C;  1H9K A;  1B9N A;  4KI0 A;  3I73 A;  4XTC S;  2AUK A;  4BA2 I;  3PUZ A;  4KN4 C;  2PNR C;  2E76 C;  2AWO A;  2K33 A;  1LAB A;  2JE6 I;  2DNC A;  1VDZ A;  1H9M A;  1VF5 C;  3L7Z C;  2PPB C;  3PUW A;  2D2C C;  2AUJ D;  3W3A A;  1SMY C;  1G29 1;  4DNT B;  2JEA I;  4GZY C;  1GUG A;  1H9J A;  3DXJ C;  1Q90 A;  4KKT A;  2DN8 A;  2DNE A;  1GUS A;  1K8M A;  3TZU A;  1DD2 A;  3OPO A;  1DXM A;  3ND9 A;  1V43 A;  2D5D A;  1Z6H A;  2A69 D;  4DK1 A;  5C0X G;  1Y8N B;  1HCZ A;  1YNJ C;  4OGQ C;  4TQU S;  4G7O C;  1Z7T A;  3HGB A;  1Q1B A;  1GJX A;  1OXV A;  1VCI A;  3QIA A;  2O5I C;  2JEB I;  3LNN A;  1DCZ A;  1GHJ A;  1K8O A;  3ND8 A;  1HPC A;  1OXU A;  3CRK C;  3NE5 B;  1V8Q A;  1I6V C;  2A68 C;  3VR6 A;  5BN5 A;  2A6H D;  1HTP A;  3T53 B;  3M85 A;  3T56 B;  2LMC B;  4G7Z C;  3M7N A;  2YYZ A;  3QG1 A;  3PUV A;  1BDO A;  4LK1 C;  1IW7 D;  1O7L A;  1A6X A;  1GUN A;  3VR2 A;  2D62 A;  4KMU C;  2EDG A;  2Q8I B;  2B8G A;  2CW0 C;  2R6G A;  3A8I E;  1H9S B;  1LAC A;  2EVB A;  4IQZ A;  4L8J A;  2BA0 A;  5C0X H;  2K32 A;  3FMC A;  2V4D A; 
#chains in the Genus database with same CATH topology
 4HCS A;  2MUY A;  3CC4 A;  4YHH Q;  3D4D A;  1J6Q A;  1NCV A;  4J15 A;  5H1S E;  1NE3 A;  4K6D A;  1NJI C;  3OMG A;  2F0S A;  4R4T A;  3WOE A;  4PZ7 A;  1TXY A;  3A5U A;  4GNX B;  4M1U B;  5IE8 A;  1B4O A;  2K75 A;  2F3V A;  4LWC A;  2R61 A;  3K7U C;  1YNX A;  2AQ3 B;  2QDB A;  3OW2 A;  5E4W C;  3VYR A;  1GUO A;  2KA7 A;  1YZ6 A;  1FJG Q;  2R93 B;  4B08 A;  1KD1 C;  4EQN A;  1T9H A;  4DV7 Q;  5CMD A;  2WKD A;  4JI3 Q;  3BG3 A;  2PZW A;  4NP5 A;  3BU2 A;  2KUM A;  1CHQ D;  2IT1 A;  2JA8 B;  3DLL A;  5EPL A;  2PW7 A;  2JA7 H;  2XRQ D;  1PH2 A;  1L0Y B;  2BH8 A;  1S72 A;  4DUZ Q;  2QEX A;  2QIL A;  2C9O A;  4DAV A;  3H91 A;  4KD4 A;  3M4O B;  1TWF B;  1PYW D;  4N8X 1;  3HOX H;  3ICE A;  2I46 A;  3KBG A;  4DR7 L;  2KCC A;  3H3V H;  5T1G A;  1TII D;  3P7J A;  3E9H A;  4H13 C;  3TP5 A;  5EBC A;  1G8Z D;  3HOW B;  5EBD A;  1I6H H;  1H95 A;  4KKU A;  1EIF A;  2NZ1 D;  2AWO A;  4QUF A;  2WIN B;  4CJ1 B;  1VF5 C;  4OWX B;  3FRP B;  1G6P A;  1G29 1;  2M00 A;  1B53 A;  5IP7 H;  1TWC H;  2F0P A;  5DAU A;  3T1H Q;  1Y1V B;  4RWS C;  3T1Y L;  3SHL A;  4PMC A;  1I50 B;  5NUC A;  2E2D C;  2RDH A;  4RMF A;  3BZK A;  4A3J H;  4YIJ A;  4ODG A;  5IGF A;  1GJX A;  4IJL A;  1PA6 A;  2WB1 G;  3W2D A;  2R7Z B;  1Q81 C;  1WD0 A;  2F0J A;  1RD9 D;  1D5X C;  1TWG H;  4A3B G;  4QF4 A;  5CGK A;  5LMU L;  1I3Q B;  1MIU A;  4OIJ A;  1R4Q B;  2L55 A;  2K05 A;  1PHJ A;  4BBS H;  1A6X A;  1GUN A;  3QO2 A;  2EDG A;  4HSV A;  2X6G A;  1H9S B;  1SDF A;  2WAQ B;  2CH4 A;  1G51 A;  3J80 i;  2KCM A;  2ZM6 L;  4G4K A;  3U4Z A;  5EPJ A;  1HA6 A;  3GV3 A;  3S16 B;  1NAP A;  3VDY A;  1TS5 A;  3AFP A;  3BZD B;  5M3M B;  4R4C A;  3H94 A;  4K14 A;  4A3L G;  3CC7 A;  3PQI A;  3VA7 A;  2ZTE A;  1SNP A;  3VR5 A;  5IWA L;  4HSP A;  5C4J B;  1EY9 A;  1M1K C;  5C44 H;  1IXR A;  3RNU A;  1TWA H;  1VF7 A;  2KQ3 A;  4GKJ Q;  2R92 G;  3EIV A;  4RCO A;  4K2L A;  1UE6 A;  2HDL A;  3K57 A;  5C4Z A;  2E2I H;  3G48 A;  2G9D A;  4FNF A;  1WOC A;  2IX1 A;  1VQA A;  3F8T A;  3PCO B;  3S14 B;  4OO1 G;  3MA2 B;  4OEM B;  3VYU A;  2DUD A;  5C4H A;  4RCN A;  2ZXO A;  3A56 A;  3I4O A;  4BY1 H;  4KHP Q;  3P75 A;  5BR8 L;  1Q7Y C;  2XWB B;  4JI0 L;  5E1F A;  2RHQ B;  3N6R A;  1UEA B;  4MZ9 A;  1J5E L;  1OXX K;  1JJ2 A;  1E7Z A;  3AQQ A;  2FFK B;  4C3I H;  1DZ1 A;  1N34 Q;  1T5E A;  4C3H H;  3RN5 A;  1YHQ A;  4P71 A;  1KDA A;  4IFD H;  1S3O A;  2OCE A;  1U5K A;  1N33 L;  1S40 A;  1Q12 A;  3I72 A;  3NQT A;  4A3D H;  3J81 c;  4LUZ A;  3TS0 A;  1PH3 A;  3X3N A;  3LX0 A;  5D3D A;  1SYB A;  1LT6 D;  1CUK A;  1X54 A;  1IW7 C;  2E2H H;  2G5D A;  3K7A H;  3I73 A;  5IYD H;  3I91 A;  1C0A A;  5M5X H;  1IBK L;  4IPH A;  2UXC L;  2JE6 I;  2PI2 E;  2IHE A;  1PXU A;  1K9M C;  1H9J A;  2IWH A;  1TS3 A;  1VS0 A;  2NVT H;  4A3I H;  1SR3 A;  5ELC A;  4UP8 A;  4UDU C;  1BCP C;  1NMF A;  3G4S A;  4BBR B;  2VQE Q;  2P5Z X;  4UAI A;  1ICW A;  4DA2 A;  1V8Q A;  1ESF A;  2HHH Q;  1HTP A;  1CSQ A;  3GTQ B;  5AFW A;  4LK1 C;  1IW7 D;  3J7A F;  1C48 A;  1F77 A;  3VR2 A;  3MXN B;  4OO1 I;  5CYU A;  2NWG A;  4IQZ A;  1EU3 A;  4I65 A;  4ZQ3 A;  4JCV E;  2R3Z A;  3UE0 A;  2EYF A;  1KIX A;  3M4Y A;  2J4X A;  1W6K A;  4KHZ A;  1Q3L A;  4DUY L;  1AZQ A;  2IW3 A;  4OEL B;  5FOB B;  1BCP D;  1RDP D;  2ZXP A;  1XTC D;  3TP7 A;  5LL6 S;  4DV2 L;  1PFN A;  1E2V A;  4JI4 Q;  1QNU A;  5C5M A;  4KY6 A;  3GTJ B;  3FHW A;  3FPU B;  1CTM A;  3CQZ B;  1KC8 C;  1PRT C;  4X64 L;  4IAL A;  4DR2 Q;  5I6W A;  4OON A;  4OXP A;  2Q2U A;  1K0S A;  3PUX A;  4M8A A;  3PSI A;  4PG3 A;  2H5X A;  1PYS B;  1KAW A;  1IBM L;  4DGZ A;  1SND A;  3HOU B;  3MWY W;  1VQC A;  2XGT A;  2ZJQ A;  4MNO A;  2MO1 A;  3HP3 A;  1JCK B;  3RZO H;  3K6O A;  4B3M Q;  3RZD H;  1XNR Q;  2EZV A;  2KEN A;  1LTA D;  2F03 A;  2UUA Q;  5EKI A;  5F2D A;  4BY7 H;  3GO5 A;  1ENA A;  4BXX H;  4A3E H;  3TSS A;  1XMQ Q;  1X6O A;  1PRT D;  4O42 A;  3JAM i;  2K5W A;  2F0T A;  1MD2 D;  5M3F B;  1KRT A;  4DK3 C;  2FIN B;  3PO3 G;  4FF4 A;  2F4I A;  1JR0 D;  3T4A C;  3GTK B;  3A74 A;  2OWO A;  4A93 H;  3MEF A;  4LFA L;  1XPO A;  4LF6 Q;  3S1R H;  1MBY A;  1AN8 A;  5IGC A;  3TZU A;  5KGU A;  3OPO A;  1RL2 A;  3V2T A;  1X3P A;  3O13 A;  4QY7 A;  3AMU A;  1SXT A;  4CKE A;  1YNJ C;  1JJC B;  3CC2 A;  2A74 C;  4P74 A;  1X56 A;  5GQO A;  3DEO A;  3CRK C;  2B2U C;  4JW0 A;  5I6Y A;  4GN4 B;  1SFO B;  1EEI D;  1CT1 D;  1I94 Q;  3T56 B;  1S5B D;  1AW7 A;  3S1M B;  5JJZ A;  2L11 A;  3I4N H;  1EIG A;  3HKZ B;  1VQJ A;  2Q8I B;  3OHX C;  2VL6 A;  4F88 A;  1WTR A;  3H3V I;  2B2U A;  1YI2 A;  1XPU A;  4HCE A;  4J8Q A;  4DV0 L;  1KAB A;  3CD6 A;  1A3U A;  3FMC A;  3M4O H;  3CP0 A;  4JI6 L;  3FKI B;  1QIL A;  1VQG A;  3EQL C;  4RHS A;  4ILW A;  3D3R A;  3DM1 A;  1SE3 A;  1S5C D;  5LHY 1;  1YNJ D;  1XX8 A;  4DR3 Q;  4XYQ A;  2AMC B;  2QGQ A;  4IOC A;  1V9P A;  1SNO A;  3J81 L;  1QVC A;  2EY6 A;  5GAE C;  4B3T Q;  1OTC A;  1EWI A;  2A1A A;  3U9O A;  4BY1 G;  3KLW A;  1F9S A;  4LUV A;  1VMP A;  2CQA A;  2WII B;  1STB A;  1VQN A;  1TWH H;  2ATW A;  4FXK C;  5IOD A;  4XIG S;  1A0I A;  4IJH A;  1NTG A;  4OIK A;  2FJ2 A;  3V96 A;  1E3P A;  2PZU A;  3PV0 A;  1LTG D;  3DWQ A;  4A3D G;  3I7F A;  4TVA B;  4IUQ A;  1ZXT A;  4O2D A;  4GKK Q;  1I3Q H;  3ULL A;  3PO2 H;  5IYD G;  3BZC A;  5K36 H;  4UP9 A;  4XQQ A;  3QR8 A;  2Q8R E;  4A3C H;  3PF5 A;  3QOL A;  4G57 A;  3MXN A;  3UDX A;  3T51 B;  2NVX H;  4PMW A;  1JJG A;  1HRJ A;  3G71 A;  4JI1 Q;  3BDO A;  1RIP A;  2MHV A;  1NUC A;  1HHV A;  3PUZ A;  5C6A A;  4R4Q A;  3AYH B;  3IFD A;  3I56 A;  2UUB L;  4FYD A;  4JG2 A;  2MQH A;  1BR9 A;  5I4D A;  3S15 H;  5EGT A;  1L1O C;  2K6A A;  3I2Z A;  1X3F A;  2HIX A;  5LMN Q;  1FNW A;  4JBK A;  1K8O A;  2LFN A;  1D2B A;  4LF8 Q;  2GVB A;  4DFA A;  3K0Y A;  4DAP A;  2UXD L;  1BDO A;  4B3R Q;  4OHJ A;  1QVG A;  3KJO A;  1YIT A;  4NPS A;  4ZAI A;  4IFD I;  3A8I E;  2KCT A;  3NEM A;  3SXH A;  2WP8 J;  5E3F A;  4K5X A;  2D0P A;  4YWL A;  1XNQ Q;  4LFC Q;  4NXM L;  1YNN C;  1HR0 L;  3KOJ A;  4KY5 A;  4MN3 A;  3ERS X;  5BN3 A;  1JOQ A;  4BS9 A;  3J80 E;  2F0G A;  2HDM A;  4OL7 A;  4QGU A;  5JJK A;  3ERQ A;  3SR1 A;  4CDD C;  5A35 A;  1ML0 D;  3UDF A;  1BBU A;  2OEO A;  4HN7 A;  3EJI A;  2F3I A;  3GTP H;  2CVR A;  5CV7 A;  5AJ3 Q;  4FF1 A;  4QB4 A;  5EKK A;  1EIY B;  4DF7 A;  4A3M B;  2L5T A;  3S9W A;  2Y0S G;  4DR6 Q;  1YNN D;  2VUM B;  1LTT D;  4DR1 L;  3GQB A;  3CF5 A;  2JQO A;  3U4V A;  1G91 A;  3CRL C;  3L9A X;  3CPF A;  3U9S A;  5EAY A;  5HGT A;  5C4X B;  2G9H D;  2SNM A;  3KK7 A;  1GKH A;  3C1F A;  3NWS A;  4IUT A;  1AE2 A;  3HG9 A;  1UE7 A;  2R93 G;  4A3L H;  4NXN L;  1DON A;  4AQY Q;  1WTX A;  1H9R A;  5GRO A;  1CK1 A;  1PV4 A;  2K50 A;  4DR7 Q;  1YEZ A;  1G2T A;  2JA8 G;  2R92 H;  1CZW A;  2XNA C;  1DJR D;  4RG1 A;  1EQR A;  4GOP C;  3S2H H;  3NEN A;  2EY2 A;  2K33 A;  2FMC A;  3FVQ A;  3S17 H;  4A3G H;  2DNC A;  1LTB D;  3OSO A;  2UU9 L;  4GZY C;  4Y7N B;  3EVQ A;  5D65 A;  1X55 A;  2IL8 A;  4KKT A;  2DN8 A;  4JC0 A;  2F52 A;  5GAG C;  1S4Z A;  4GOP A;  2K03 A;  3T1Y Q;  5JVH 3;  3CW2 C;  1JT8 A;  1VCI A;  3M7G A;  1WFQ A;  5A2Q E;  1B3Q A;  1NMG A;  2DY7 A;  5JOB A;  1KRS A;  5IGB A;  4IUU A;  3HOW G;  1J9O A;  5LMU Q;  4C2M B;  2I07 B;  3HEJ A;  2FXQ A;  1PH7 A;  3H3V C;  4R8I A;  2K32 A;  4DV1 L;  1LV9 A;  4HJ9 A;  2UUC Q;  2ZM6 Q;  4I7Z C;  4LF9 L;  3Q0A A;  4LF4 L;  2PQA B;  3CCR A;  1EOT A;  2PCF B;  1CFM A;  5FO7 B;  2EJG C;  1CKM A;  1A2U A;  1K73 C;  2R7Z G;  1LYL A;  1G2S A;  4N9P A;  1N32 L;  1VQ9 A;  2ZTD A;  1TKW B;  4QJF A;  4EQO A;  3PIO A;  3S1Q H;  1X65 A;  5EJW A;  2HCI A;  2F0I A;  2B2V C;  3ULJ A;  3BYY B;  3I3C A;  2F0D A;  1HZA A;  3BVG A;  5K36 G;  3RLF A;  1CZG A;  1LM0 A;  3C2P A;  3NTK A;  3Q6S A;  1SBB B;  4A3C G;  5M5Y H;  1IKL A;  2NTS A;  4NW2 A;  5M3M G;  3DWP A;  1WTV A;  1F9P A;  2F0V A;  2B3G A;  4B3S Q;  2RA4 A;  1E1T A;  4WOR A;  2BCO A;  1EWC A;  2RBM A;  1K8G A;  1DYQ A;  5BR8 Q;  4A76 A;  2F4V L;  4JI0 Q;  1LTR D;  5BN4 A;  1N36 L;  3X3M A;  4JI2 L;  4JYA L;  2VB2 X;  2L12 A;  3H6M A;  3HFZ B;  4DNR B;  3JC6 6;  1KL9 A;  5CV5 A;  1QUQ A;  4RKL A;  2NZH A;  3GD7 A;  2KED A;  1BKB A;  2A6H C;  3IAY A;  3S24 A;  1N33 Q;  1UEB A;  5FKA C;  1CA6 A;  1BCP B;  1ASY A;  4POG A;  3KLS X;  5HUR A;  4QQB X;  4DV3 L;  1AZP A;  4KJO A;  1PH6 A;  1GOZ A;  2F0K A;  1H9M A;  2ICE C;  1IBK Q;  1SYE A;  3JAM E;  5DNF A;  5IGG A;  2UXC Q;  4WJ4 A;  3S2D B;  2YU9 H;  3TS2 A;  5JPM C;  1DD2 A;  1NY4 A;  3ND9 A;  1WTP A;  2H4O A;  2XIW A;  4RA8 A;  2J7Z A;  1K83 B;  1Z7T A;  1KAA A;  4IN3 A;  4V0B A;  4PNY A;  3WWV A;  1EZ6 A;  3ND8 A;  1WYD A;  4K8I A;  1SMX A;  2A6H D;  2I0Q A;  4U67 3;  2Z4H A;  4XDX A;  5FJ8 G;  2D62 A;  2BOS A;  2VS1 A;  1KNE A;  3KFU A;  2CHB D;  2XVS A;  4ZUJ A;  2BE5 C;  1P16 A;  3NWT A;  2OQK A;  1JC7 A;  5HY6 A;  1PRT B;  1K3B C;  1SLJ A;  3PO3 H;  3E6Z X;  4DUY Q;  1VQI A;  4LFB L;  2K01 A;  4RH6 A;  4BBR G;  3J81 j;  3ULP A;  1OXT A;  2Z4I A;  4V19 0;  2EYP A;  4LF5 Q;  3SDZ A;  4DAY A;  3F2B A;  3E0E A;  5CBE E;  5LMN W;  2E75 C;  3I8Z A;  1UWV A;  4JBW A;  1WVL A;  1QJO A;  1HUN A;  2BE5 D;  4JI8 Q;  5J3B A;  1PVO A;  3K80 C;  3KLR A;  1CA5 A;  3GTM B;  4G7H C;  5C3E H;  2Z6B A;  4S3S A;  1IBM Q;  3A54 A;  4JBJ A;  2NVY H;  3J81 i;  5IY0 A;  4Q0F A;  4IOA A;  4PV1 C;  1IBL L;  2Q2H A;  3EN2 A;  1SNM A;  4A3G G;  4OWT B;  1XXG A;  3R93 A;  4FXG C;  1A2T A;  2WAC A;  4Q5V A;  2OTJ A;  1R4P B;  2LS0 1;  1PLF A;  5IP9 H;  1A63 A;  4PZ8 A;  2IY5 B;  1U0L A;  2EYO A;  2QEJ C;  4F87 A;  3UDG A;  5M5W H;  4L5Q A;  4EX5 A;  1Y8O B;  3S1N B;  2VB3 X;  2PQA A;  3M4Q A;  1NR4 A;  2E76 C;  1EFW A;  1DM0 B;  2EIF A;  1F9Q A;  4RGN A;  2XWJ B;  1FVI A;  3HOU G;  2CWP A;  1C7Y A;  3PUW A;  2QW7 A;  1SMY C;  3HOY B;  1Q90 A;  2HQE A;  4DR4 Q;  5K5P A;  3M3Y H;  4AYB B;  1PTO H;  3Q22 A;  3HGB A;  1TT2 A;  4K5W A;  1Q1B A;  3URY A;  2JA6 B;  3LNN A;  4CKB A;  3A0J A;  1TR5 A;  3NUC A;  2E5L Q;  5COR A;  4H02 A;  3SK6 A;  4ABN A;  1RTN A;  1UE1 A;  1STH A;  4DR5 L;  4UPA A;  4G7Z C;  1FJG L;  5M3F G;  5C4X H;  1EU4 A;  1B50 A;  5ELN A;  4KMU C;  3VYT A;  2Z9H A;  5CV6 A;  3GV6 A;  2ZTC A;  1KLG D;  1SMY D;  1ROD A;  4DV0 Q;  4ZKB B;  4JI6 Q;  5KND A;  4P2C B;  4ZCK A;  2C5C A;  3DEP A;  1KHI A;  3CME A;  4GN3 B;  3TZD A;  5L37 A;  2NVQ H;  4TRD A;  5FLM H;  3I4M H;  2QA4 A;  1SE8 A;  1Y1W B;  1VQ5 A;  4ZYS A;  1X32 A;  2BA1 A;  2PNH A;  4U68 A;  3ONA B;  3A5Z B;  3MVV A;  3HKZ G;  4IUP A;  4C3J B;  2X6L A;  3UDI A;  1I4G A;  4KD3 A;  1DOL A;  4A3B B;  3D4R A;  3FKI G;  1LTL A;  3J7Z C;  3HOZ H;  2BDN A;  3H0G B;  1BQQ T;  3SGI A;  2B2T C;  4LJZ C;  4N9T A;  3FDT A;  4RGO S;  3D6C A;  4R9W A;  1R9T B;  3C3L A;  1F2L A;  4HJA A;  4ZUI A;  1EFI D;  1JOK A;  1SYC A;  2FHT A;  2K5H A;  2UXB L;  2EYL A;  2K7V A;  2PZT A;  1STY A;  2B63 B;  3E5S A;  1QCB D;  2MGS A;  1ONL A;  2OQ0 A;  1KDB A;  3G6J B;  3C1E A;  1L1O B;  1ZYR C;  4NDX A;  2PO4 A;  4XQJ A;  3F2U A;  5JEA J;  5CBA E;  1HUM A;  4KV6 A;  1RJT A;  2PI2 A;  4A3K H;  2PMZ E;  5J1Z A;  4DU9 A;  1XJV A;  3NTH A;  1VDZ A;  4P75 A;  4IPG A;  1UUP A;  3GTL B;  1AFP A;  1GUS A;  4AH6 A;  4L5S A;  2UUB Q;  4YCW A;  4DK1 A;  3MAQ A;  4JVZ A;  1XMO Q;  3R2T A;  1C9O A;  1OXU A;  2CCZ A;  1ZYR D;  2NZO A;  1VQH A;  4HIO A;  2Q2I A;  1K28 A;  1SYG A;  3M85 A;  1JQY D;  3M7N A;  2LMC B;  2EQS A;  2LXJ A;  1WTO A;  4LNQ A;  5GAD C;  1O7Z A;  3GTO B;  4CDC C;  4HID A;  1U4R A;  5CV8 A;  3F1Z A;  3KF6 B;  2UXD Q;  2F0N A;  4A75 A;  2B39 A;  2R93 H;  4WRD A;  1M8A A;  1JOR A;  1XPR A;  2KOL A;  2DJF C;  2JK8 A;  5T1I A;  4HR7 B;  2A19 A;  2L4N A;  2KEC A;  3SE0 A;  4NXM Q;  3DMU A;  4KHP L;  1HR0 Q;  2JA8 H;  1KLU D;  5D14 A;  3DWA A;  3TDQ A;  3K8A A;  1U4M A;  1MJC A;  2WB1 E;  1VQP A;  2R7D A;  4ME5 A;  1L2F A;  1Y14 B;  3RUZ A;  2J0T D;  1M4V A;  5C3E G;  4JV5 L;  1B2T A;  1BO0 A;  4X3S A;  1SEB D;  3C46 A;  1W6J A;  5ELB A;  3S2D H;  1D8L A;  1TWF H;  1VQE A;  3SK8 A;  1VQ6 A;  1LT4 D;  1QE6 A;  3NBH B;  2Z6K C;  3R2I A;  2ZXR A;  1VQ7 A;  2RKS A;  1EYG A;  1HNX Q;  3CCQ A;  5IP9 G;  2VQF Q;  3AEV A;  4FVM A;  3HOW H;  5FK9 C;  5JVG 3;  2NUC A;  4CJ0 B;  1EUJ A;  1Q8I A;  5IYC G;  4GOP B;  1OXS C;  1BF4 A;  1YIJ A;  4E6I A;  3KF8 B;  3IL8 A;  1Y1V H;  4DPG A;  2E74 C;  3KLS A;  1D5Z C;  1I50 H;  1I4H A;  4A3M G;  2HHH L;  4NXN Q;  2JA7 B;  3VR4 A;  2TSS A;  2R7Z H;  3KDF B;  4IZ8 A;  1SN8 A;  2EJM A;  4ME3 A;  4RKB A;  1QB5 D;  2JN4 A;  2VUM G;  4K0K L;  1B9N A;  4RGM A;  1A3V A;  2L15 A;  4XTC S;  2RVL A;  3SEB A;  3SK5 A;  2B2Y C;  4L6T B;  5JAV A;  5C4X G;  4RGT A;  1EY5 A;  3BS1 A;  3HOX B;  1QWY A;  2ASB A;  2UU9 Q;  5CV9 A;  4Y52 H;  1DXM A;  1Y8N B;  3S16 H;  4G7O C;  2B2Y A;  5M3M H;  3NTI A;  2CQO A;  1HPC A;  1JOO A;  1I6H B;  2KJX A;  3TN2 A;  5C4J H;  2NYZ D;  3NSW A;  2YYZ A;  3NK9 A;  4HJ7 A;  3OIQ A;  5FLM G;  3I4M G;  4ZLT F;  3T13 A;  4ZKC B;  3K0X A;  4P73 A;  3F2D A;  4OX9 L;  4A3J B;  4DR2 L;  3TP8 A;  1DOK A;  1FGB D;  3OOC A;  1O7I A;  4DV1 Q;  1SE2 A;  1EYA A;  3CCJ A;  3S14 H;  1WI5 A;  4R8N A;  3BDC A;  1TWG B;  5IIF A;  4LF9 Q;  4LF4 Q;  1GUT A;  4JI7 Q;  2JA9 A;  2NN6 G;  3HOZ G;  4EVO A;  1GUW A;  1L1O A;  5A2Q L;  4BBS B;  4IUR A;  1IKM A;  4O1N A;  5IT9 E;  1MSH A;  1XNR L;  2OXP A;  2UUA L;  1QUQ B;  3ER0 A;  3QB3 A;  1N32 Q;  1Z47 A;  3LWU A;  1JB7 A;  2IX3 A;  2IPK D;  2K5V A;  1IL2 A;  3GDE A;  4LMQ D;  1EYD A;  5C0X J;  3OTO Q;  1EY6 A;  1E2W A;  2KHJ A;  4QUC A;  2JA6 H;  5C44 B;  1KNA A;  2SNS A;  4B9W A;  1TWA B;  3ZYY X;  1V1Q A;  2JJQ A;  3CKI B;  1CM9 A;  5FJ8 H;  4A3K G;  1VQK A;  4HIM A;  2E2I B;  2LY7 A;  4ALP A;  2R7F A;  2DGY A;  5KNC A;  1HQM C;  4GS3 A;  1IYU A;  4WFN 3;  3W5O A;  3W1B A;  4JI2 Q;  4EQP A;  4LF7 L;  2CKZ B;  3KF6 A;  3J81 E;  1JMC A;  4JYA Q;  4CKC A;  1VQF A;  2O4X A;  2LXK A;  2MFI A;  4B9X A;  2YTX A;  3H09 A;  4FP5 D;  4BBR H;  3CCM A;  4CBV A;  2VXW A;  3P20 A;  3RLN A;  3MTS A;  1JE5 A;  1D5M C;  1X3E A;  3HS0 C;  1JWU D;  1Y1W H;  3T16 A;  3GTQ H;  1PZI D;  4MTK A;  1VQM A;  1S5E D;  3TME A;  5CC4 A;  4DNT B;  4ZRZ A;  4C3I B;  2KHI A;  4C3H B;  4DV3 Q;  1GUG A;  4DV6 L;  1K8M A;  4X3T A;  4DR3 L;  4YY3 L;  1LT3 D;  1W3S A;  1HCZ A;  2K1B A;  4ID6 A;  1C4Q A;  2O5I C;  2JEB I;  3CMA A;  5CR3 A;  2VW9 A;  3BJU A;  2E2H B;  2A68 C;  4DAY B;  1UAP A;  5M5X B;  2BH2 A;  3NBH A;  3QG1 A;  2XRS D;  1EYC A;  3D4W A;  1FGU A;  2CW0 C;  3HRZ C;  2D9U A;  1E24 A;  3HZX A;  4IPD A;  5C0X H;  2RF4 A;  5COY A;  1WJJ A;  4A3F B;  2NVT B;  3GTJ H;  4A3I B;  4KKS A;  1TY2 A;  1ZKO A;  2ENB A;  1E1O A;  1B70 B;  3CQZ H;  2SOB A;  4YWM A;  4Z9C B;  5JEA G;  3KF8 A;  3K5N A;  1KQS A;  1F2Z A;  3AU7 A;  1X3G A;  2JSO A;  2IX0 A;  4KY7 A;  1ILQ A;  1HXY D;  1FL0 A;  1EZ8 A;  2A5H A;  1M90 C;  3QJY A;  2A68 D;  4KLK A;  2VZA A;  3HOU H;  3Q8D A;  2AKW B;  4LFB Q;  3KDF A;  2Q8T A;  3K59 A;  1QVF A;  1CI3 M;  4LAA A;  2CW0 D;  4PMB A;  5TSS A;  1TS2 A;  3TRZ A;  4DV5 L;  1Y1V G;  1GO3 E;  1WTW A;  3RLO A;  4L5T A;  2B8F A;  5JPN C;  2EXD A;  5M3F H;  2VY3 A;  2E2J B;  5IWA Q;  4J1M A;  5GAH C;  2XTI A;  4XXE A;  1SJH D;  4X6A H;  1EQT A;  1IYV A;  2MPM A;  5IYB G;  1SJE D;  2KCN A;  3GTK H;  1GM5 A;  4R1J A;  2K5N A;  1B1Z A;  1HR0 W;  1IBL Q;  1SNQ A;  2EYH A;  2NTT A;  5LMN L;  2N55 A;  1NSN S;  2N8N A;  2WAQ G;  4LF8 L;  1Y69 U;  1U4P A;  1YHB A;  1A15 A;  1AH9 A;  2HD3 A;  2B2V A;  3PIO 3;  4B3R L;  5KIX A;  4F7X A;  1Z9F A;  1SFO H;  1LTI D;  1PDQ A;  4KN4 C;  1S5F D;  3S1M H;  4GLV B;  1XNQ L;  3RZO B;  3LGJ A;  1HZ9 A;  4LFC L;  2SEB D;  2A73 B;  4APV A;  3RZD B;  2K28 A;  1D6E C;  1MKH A;  1J5E Q;  4BY7 B;  1VQ4 A;  1V43 A;  1PYB A;  3FKI H;  5KRU A;  4DNI A;  1P8L A;  4A3E B;  2HUG A;  4X66 L;  1TY0 A;  4L5R C;  3QIA A;  5ELO A;  2LKV A;  1D7Q A;  3VR6 A;  2K5D A;  1IL8 A;  1V1P A;  4L63 B;  1D1K A;  5AJ3 L;  5DM7 3;  4DR5 Q;  1QZG A;  4A93 B;  4HJ8 A;  4DXF A;  3S1R B;  1HNZ L;  1LAC A;  2EVB A;  3CAM A;  1RTO A;  2HT1 A;  4TSS A;  4C1N K;  4FXD A;  4DR6 L;  2JA5 B;  1HQR D;  1WTH A;  1HNW L;  3OMC A;  3HOY G;  5I9P A;  1VQL A;  3E0J A;  3D8G A;  3GTG B;  2YTY A;  3HOV B;  2CH4 W;  4QIW E;  4P72 A;  1DOM A;  4H0L C;  2FMM A;  4AYB G;  3V05 A;  1G6Z A;  4N8F A;  1GD7 A;  2LSS A;  3KUP A;  2JA6 G;  5FLX E;  1PH9 A;  3I4N B;  1K8A C;  2CWA A;  3QOJ A;  5C3W A;  4X62 L;  3HKS A;  1LLR D;  2PYK A;  5KEE A;  1ENC A;  5FO8 B;  4AQY L;  3J7Y W;  1VQB A;  5EQ0 A;  1GVP A;  1XWE A;  3CHB D;  1PTO C;  4X65 L;  1EEF D;  2H1E A;  5I9O A;  3MEH A;  3BVZ A;  4HMJ A;  1WTQ A;  3MXU A;  3A7A B;  1PZJ D;  1CQV A;  1JWS D;  1MGS A;  4QCL A;  1LUZ A;  3M9B A;  1WCM B;  2IHF A;  2ES2 A;  2I5M X;  5IGE A;  1AE3 A;  2F0H A;  4ULL A;  4JI5 L;  1HH2 P;  1Y1W G;  1SSO A;  2A69 C;  4DV2 Q;  2UXB Q;  3I70 A;  1L0W A;  1TWH B;  4DKA C;  1PTO D;  1SAP A;  3STB C;  3TP6 A;  4C3J G;  3OWE B;  4IFD J;  3IKJ A;  4DV4 L;  5DM6 3;  3CCU A;  4FO2 A;  2MJ8 A;  2Y0S E;  4X64 Q;  1I4R A;  3D6W A;  1H9K A;  2PQE A;  4KI0 A;  2V1C C;  3H0G G;  3TQY A;  4BA2 I;  2KVM A;  3VYS A;  1ENF A;  3BVM A;  3PO2 B;  1JWM D;  1ILP A;  3L7Z C;  3LWE A;  2D2C C;  2UUC L;  3DHQ A;  4POF A;  4XYO A;  2F0L A;  2HIV A;  2DNE A;  4OWW B;  2NVX B;  2A69 D;  5C0X G;  2EPB A;  2B63 G;  1UNS A;  5KYI A;  2K14 A;  3STB D;  3NE5 B;  2EE1 A;  4J6H A;  4QMG A;  1BVS A;  1KDC A;  2HQL A;  5IYC H;  1RHP A;  1YVC A;  1VMC A;  5IT9 c;  2MNA A;  2R6G A;  3EA6 A;  2AWN A;  5M9O A;  4YHH L;  1EOV A;  3S15 B;  4DXG A;  1TS4 A;  4XT3 B;  1SYF A;  4A4I A;  4HJ5 A;  5C3X A;  2PMZ B;  2RCF A;  4LFA Q;  4A3M H;  1YJN A;  4AIM A;  4HTH A;  4B3S L;  4CDF C;  5ELE A;  1TVX A;  2M2L A;  4IO9 A;  3NP8 A;  3A8K E;  2VUM H;  3J80 c;  2TMP A;  1V1O A;  2O5J C;  2K04 A;  4HED A;  5D3I B;  2HCC A;  3NQI A;  4CGY B;  4DV7 L;  1K3R A;  4JI3 L;  1I5F A;  3TEH B;  5DEH A;  4KHV A;  3Q23 A;  2WFW A;  3CCV A;  4JV5 Q;  2N49 A;  1BBW A;  1CKN A;  2ZT9 C;  1A3T A;  1LO5 D;  3A8J E;  3KBX A;  4JK1 C;  4C56 C;  4GNX C;  1EY8 A;  1LT5 D;  4DUZ L;  2KEE A;  4RAU C;  3KYH C;  5C0X I;  4GNX A;  1PMR A;  2AQ2 B;  4K2K A;  4NB3 A;  3PUY A;  3GTP B;  4H44 C;  4Y7N H;  3WDN A;  2ZJP A;  4WJW A;  1EWH A;  4FDB A;  1Q46 A;  1I4X A;  4WJ3 M;  2WB1 B;  4A3F H;  3AB9 A;  4KK7 A;  1BBX C;  1EL0 A;  1RKN A;  4DK6 C;  2YV5 A;  2AHO B;  4KJN A;  1UE5 A;  4R4O A;  3MXG A;  1E2Z A;  2NN6 H;  2EJF C;  1CSP A;  2XSC A;  2WAQ E;  1MI2 A;  3BYT B;  3CCE A;  2K4K A;  2Q2T A;  3Q24 A;  3VA5 A;  3RD4 A;  2PNR C;  5G3L D;  4K0K Q;  1LAB A;  3T1H L;  3OWF A;  3P1H A;  3EBE A;  2AQ1 B;  2B2T A;  4C2M H;  2EXZ A;  1SYD A;  4NMZ A;  4CJ2 C;  3PGZ A;  2F0W A;  4OGQ C;  1A8V A;  2N78 A;  5ISR A;  2L1B A;  1DCZ A;  4X3U A;  5IOC A;  3L3O C;  2R92 B;  1I6V C;  1FNU A;  2JA7 G;  1PFB A;  4LF5 L;  2B29 A;  2E2J H;  3S2H B;  4YCU A;  3PUV A;  4A3G B;  2RSN A;  3S17 B;  1AEX A;  3MFG A;  4IUV A;  1TQO A;  4L8J A;  3MHB A;  2EY5 A;  4JI8 L;  1EY0 A;  3FP9 A;  4K8J A;  4OX9 Q;  1O78 A;  1KTK A;  3HOX G;  1F9R A;  1HFG A;  4YWK A;  3N52 A;  3NXW A;  1TU2 B;  3K5O A;  3MFY A;  4GKJ L;  1PH1 A;  3A7L A;  2MO0 A;  1SRO A;  4AYB E;  2M9V A;  4YCV A;  4C1N I;  2Z8L A;  1T5X D;  3CPW A;  1B8A A;  3K5M A;  1HA5 A;  3RR5 A;  4LUO A;  5IP7 G;  3OW7 A;  4GLX A;  1H9S A;  2YTV A;  3F2C A;  2JYO A;  2RQX A;  4A3J G;  1FD7 D;  1PFS A;  5DLQ E;  2EOT A;  1ESR A;  5J22 A;  1GHK A;  2BDO A;  5I2Y A;  2N3S A;  1PTO F;  4R4I A;  3S1Q B;  3CU7 A;  1N34 L;  1NBW A;  4DR4 L;  1FYC A;  1A62 A;  1ZEQ X;  3W1G A;  4BBS G;  5KYL A;  3ITP A;  3H15 A;  1FR3 A;  2Z0S A;  4DN4 M;  5IT9 L;  2JA5 H;  1L0X B;  4K6L A;  3L2P A;  2E5L L;  4GLA C;  1SRU A;  5M5Y B;  5JEA H;  3GTG H;  3HOV H;  1K83 H;  1FNV A;  1D1I A;  1DGS A;  2DY8 A;  4LF7 Q;  2F0E A;  2EY1 A;  1VQO A;  2KBN A;  2OT2 A;  5E7N A;  4EGV A;  4DR1 Q;  5C44 G;  1BNZ A;  2A8V A;  2RDF A;  3J80 L;  2ICI A;  2ID0 A;  1QZH A;  2Z6K A;  2AUJ D;  4FF2 A;  2GVA A;  3JAM c;  1XTD A;  4DAM A;  3K5L A;  4X3K A;  4K5V A;  5EKL A;  2VQE L;  4DV6 Q;  1GXD C;  1MSG A;  1EIH A;  2IJ0 A;  4BWG B;  4YY3 Q;  1WD1 A;  5BN5 A;  1WCM H;  2OTL A;  1HZB A;  5FLX c;  3UI2 A;  2KHS A;  5IYB H;  3M4P A;  3U58 A;  2NBF A;  3TRE A;  1EQQ A;  3MZ5 A;  3K58 A;  2B8G A;  5JJL A;  2YU9 B;  3B6Y A;  2V4D A;  1STG A;  2F0Q A;  1J8I A;  5ELD A;  4C3I G;  2F0O A;  4C3H G;  4ZK9 B;  2RSO A;  1II3 A;  4IFD G;  1NR2 A;  2EYM A;  3EFX D;  3E9I A;  2PW5 A;  3I90 A;  2I5H A;  3U50 C;  1F2M A;  1IHZ A;  4TKO B;  2B2W C;  3MC0 B;  3GTM H;  3PMF A;  1HJP A;  4JI4 L;  2OF1 A;  1SNC A;  1TWC B;  3DUZ A;  2K5Q A;  2B2W A;  2F3W A;  1MJE A;  4BA1 I;  1E22 A;  5J39 A;  2GN5 A;  1QNK A;  2A6E C;  2QKI C;  4F8M A;  3FPP A;  3L0O A;  4A3F G;  3MXP A;  4A3I G;  3D31 A;  3PO3 B;  3AFQ A;  3D0F A;  1YJ9 A;  4DV5 Q;  2I5L X;  1PFM A;  2X69 A;  1E0B A;  2MP1 A;  3S1N H;  1PH5 A;  1RCV D;  2O2L D;  3PIP A;  4B3M L;  3KJP A;  5HGQ A;  1XYI A;  4PZ6 A;  3VR3 A;  1PH8 A;  3HOY H;  1XMO L;  5G3L F;  1XMQ L;  3IFT A;  2RHS B;  2QCP X;  1V1P B;  3HKZ E;  1YHA A;  5ELF A;  1LTS D;  3PIP 3;  4QL5 A;  2A6E D;  1B9M A;  5EPK A;  2C35 B;  1STN A;  5C3E B;  3QWN A;  3G7L A;  3PF4 A;  2GA4 B;  2AUK A;  4H7B A;  2NVY B;  1AP0 A;  4JBM A;  4LF6 L;  1ASZ A;  1OO9 B;  2RCN A;  2WV6 D;  2ALY B;  3GP7 A;  2PPB C;  3W3A A;  1BCP F;  2JEA I;  3OYY A;  3A55 A;  3DXJ C;  1QG7 A;  1MHW C;  3TBI B;  2F4V Q;  1N9W A;  1Z6H A;  3RMH A;  1PH4 A;  1N36 Q;  2NB0 A;  4TQU S;  1U4L A;  1YJW A;  1I4P A;  1STE A;  5CV4 A;  1GHJ A;  5M5W B;  1I94 L;  5IGD A;  4MIU A;  4X66 Q;  2JP1 A;  4BY1 B;  3T53 B;  1B7Y B;  1VQ8 A;  3SVM A;  1K0R A;  5E4X A;  4HAE A;  4CHT B;  2D0O A;  2QDL A;  1O7Y A;  2F0F A;  2WKC A;  3NPP A;  3RN2 A;  1HNZ Q;  3M3Y B;  2NN6 I;  4C3J H;  1ICF B;  1PTO B;  2XN9 C;  1HNX L;  2VQF L;  2EYJ A;  4KN7 C;  4A3D B;  2JXM B;  4BY7 G;  2ZJR A;  4A3B H;  4JOI C;  4BXX G;  1HNW Q;  1JB3 A;  4A3E G;  1X9N A;  3H0G H;  4HMI A;  4B3T L;  1O80 A;  3K7A B;  2Z1C A;  1C8C A;  4O0A A;  1ET6 A;  1HFN A;  4EQ5 A;  5C5L A;  3OIP A;  1EY4 A;  1BXT A;  4NKL A;  1R9T H;  3G6E A;  1PRT F;  4JOI A;  2VNU D;  2QF7 A;  3IRB A;  1BUV T;  4X62 Q;  2CFM A;  2E8G A;  4A93 G;  1BOS A;  2B63 H;  3CXC A;  1IZ6 A;  4X65 Q;  1U9R A;  3JAM L;  1STA A;  4FF3 A;  2JA5 G;  5LL6 X;  2NVQ B;  4GKK L;  2L9H A;  3SK4 A;  1I4Q A;  3J7A V;  3I4M B;  4PQX A;  3HOV G;  2F0U A;  1CQF A;  1Q1E A;  1KXL A;  3E3X A;  4IUN A;  3WOF A;  1IYJ B;  5FO9 B;  1ET9 A;  1SE4 A;  1JE4 A;  3I4L A;  3J7A 5;  1B44 D;  3NEL A;  4QIW B;  4DK0 A;  3I4N G;  5FLX L;  4HIK A;  1CHP D;  2F1M A;  1S5D D;  4MHE A;  4IPC A;  4XQN A;  5I2X A;  3R3O A;  4JI5 Q;  3GTL H;  4OO1 H;  2K52 A;  1JIC A;  1W2B A;  3NHH A;  4JI1 L;  3FEW X;  3UE1 A;  5KNB A;  4KTA A;  1X3Q A;  3HOZ B;  1NNX A;  1Y8P B;  3CCS A;  3ERO A;  3DM3 A;  2DJG C;  1EQV A;  4DV4 Q;  1Q8K A;  4MTN A;  1RF2 D;  1Q82 C;  4CDE C;  1WCM G;  3GTO H;  1Q86 C;  3R8B A;  4RFB A;  2L0C A;  4GN5 A;  3ZJY C;  3K81 C;  3I55 A;  1HTL D;  4UHV A;  1N8R C;  2D5D A;  4RHR A;  4JI7 L;  3CCL A;  4UP7 A;  1F2Y A;  1OXV A;  4I7A A;  1YBY A;  2SDF A;  3NBI A;  1CKO A;  1QOH A;  4A3K B;  1VQD A;  1PZK D;  2F0M A;  1O7L A;  1B3A A;  1CKN B;  1HZC A;  5JJI A;  2N88 A;  1EY7 A;  4XT1 B;  4UY8 C;  4JPB W;  3OTO L;  3PO2 G;  2BA0 A;  4LW1 A;  2Y0S B;  2RDG A;  3BDL A; 
#chains in the Genus database with same CATH homology
 4HCS A;  2MUY A;  3D4D A;  1NCV A;  4K6D A;  3OMG A;  2F0S A;  3WOE A;  4M1U B;  1B4O A;  2F3V A;  2R61 A;  2AQ3 B;  2QDB A;  5E4W C;  3VYR A;  1GUO A;  2KA7 A;  2R93 B;  4B08 A;  4EQN A;  5CMD A;  2WKD A;  3BG3 A;  2PZW A;  4NP5 A;  2KUM A;  1CHQ D;  2IT1 A;  2JA8 B;  5EPL A;  2PW7 A;  2XRQ D;  1L0Y B;  2QIL A;  2C9O A;  4DAV A;  3H91 A;  4KD4 A;  3M4O B;  1TWF B;  1PYW D;  2I46 A;  3KBG A;  2KCC A;  5T1G A;  1TII D;  3P7J A;  4H13 C;  3TP5 A;  5EBC A;  1G8Z D;  3HOW B;  5EBD A;  4KKU A;  2NZ1 D;  2AWO A;  4QUF A;  2WIN B;  4CJ1 B;  1VF5 C;  3FRP B;  1G29 1;  2M00 A;  1B53 A;  2F0P A;  5DAU A;  1Y1V B;  4RWS C;  3SHL A;  4PMC A;  1I50 B;  5NUC A;  2E2D C;  2RDH A;  4YIJ A;  4ODG A;  5IGF A;  1GJX A;  2R7Z B;  3W2D A;  1WD0 A;  2F0J A;  1RD9 D;  1D5X C;  4QF4 A;  5CGK A;  1I3Q B;  4OIJ A;  1R4Q B;  2L55 A;  2K05 A;  1A6X A;  1GUN A;  3QO2 A;  2EDG A;  4HSV A;  2X6G A;  1H9S B;  1SDF A;  2WAQ B;  4G4K A;  5EPJ A;  1HA6 A;  3GV3 A;  3S16 B;  1NAP A;  1TS5 A;  3BZD B;  5M3M B;  3H94 A;  4K14 A;  3VA7 A;  1SNP A;  3VR5 A;  4HSP A;  5C4J B;  1EY9 A;  1VF7 A;  2KQ3 A;  4RCO A;  4K2L A;  2HDL A;  3K57 A;  5C4Z A;  2G9D A;  4FNF A;  2IX1 A;  3S14 B;  4OO1 G;  3MA2 B;  3VYU A;  5C4H A;  4RCN A;  2ZXO A;  3A56 A;  3P75 A;  2XWB B;  5E1F A;  3N6R A;  1UEA B;  1OXX K;  1DZ1 A;  2FFK B;  1T5E A;  1KDA A;  4IFD H;  1Q12 A;  3I72 A;  3NQT A;  3X3N A;  3LX0 A;  5D3D A;  1SYB A;  1LT6 D;  1IW7 C;  3I73 A;  3I91 A;  2JE6 I;  1PXU A;  1H9J A;  2IWH A;  1TS3 A;  5ELC A;  4UDU C;  1BCP C;  4BBR B;  4UAI A;  1ICW A;  4DA2 A;  1V8Q A;  1ESF A;  1HTP A;  3GTQ B;  5AFW A;  4LK1 C;  1IW7 D;  3J7A F;  1C48 A;  1F77 A;  3VR2 A;  4OO1 I;  5CYU A;  2NWG A;  4IQZ A;  1EU3 A;  4I65 A;  4ZQ3 A;  2R3Z A;  2EYF A;  3M4Y A;  2J4X A;  1W6K A;  4KHZ A;  1Q3L A;  1AZQ A;  2IW3 A;  5FOB B;  1BCP D;  1RDP D;  2ZXP A;  1XTC D;  3TP7 A;  5LL6 S;  1PFN A;  1E2V A;  1QNU A;  5C5M A;  4KY6 A;  3GTJ B;  3FPU B;  1CTM A;  3CQZ B;  1PRT C;  4IAL A;  5I6W A;  3PUX A;  4M8A A;  4DGZ A;  1SND A;  3HOU B;  3MWY W;  3HP3 A;  1JCK B;  3K6O A;  2EZV A;  2F03 A;  1LTA D;  5EKI A;  5F2D A;  3GO5 A;  1ENA A;  3TSS A;  1PRT D;  4O42 A;  2K5W A;  2F0T A;  1MD2 D;  5M3F B;  2FIN B;  4FF4 A;  2F4I A;  1JR0 D;  3T4A C;  3GTK B;  1MBY A;  1AN8 A;  5IGC A;  3TZU A;  5KGU A;  3OPO A;  3V2T A;  1X3P A;  3O13 A;  3AMU A;  1SXT A;  4CKE A;  1YNJ C;  2A74 C;  3DEO A;  3CRK C;  2B2U C;  5I6Y A;  1SFO B;  1EEI D;  1CT1 D;  3T56 B;  1S5B D;  1AW7 A;  3S1M B;  5JJZ A;  2L11 A;  1EIG A;  3HKZ B;  2Q8I B;  3OHX C;  4F88 A;  1WTR A;  2B2U A;  4HCE A;  4J8Q A;  1KAB A;  1A3U A;  3FMC A;  3FKI B;  1QIL A;  3EQL C;  4RHS A;  4ILW A;  3D3R A;  3DM1 A;  1SE3 A;  1S5C D;  5LHY 1;  1YNJ D;  1XX8 A;  4XYQ A;  1SNO A;  3J81 L;  2EY6 A;  3U9O A;  1F9S A;  1VMP A;  2CQA A;  2WII B;  1STB A;  4FXK C;  5IOD A;  4XIG S;  4OIK A;  3V96 A;  2FJ2 A;  2PZU A;  3PV0 A;  1LTG D;  3DWQ A;  4IUQ A;  1ZXT A;  5K36 H;  4XQQ A;  2Q8R E;  3QOL A;  4G57 A;  3MXN A;  3T51 B;  4PMW A;  1HRJ A;  3BDO A;  2MHV A;  1NUC A;  1HHV A;  3PUZ A;  5C6A A;  3IFD A;  4FYD A;  1BR9 A;  5I4D A;  5EGT A;  2K6A A;  1FNW A;  1K8O A;  2LFN A;  1D2B A;  4DFA A;  3K0Y A;  4DAP A;  1BDO A;  4OHJ A;  4ZAI A;  4IFD I;  3A8I E;  3SXH A;  2WP8 J;  5E3F A;  4K5X A;  1YNN C;  4KY5 A;  4MN3 A;  5BN3 A;  1JOQ A;  4BS9 A;  3J80 E;  2F0G A;  2HDM A;  4OL7 A;  3ERQ A;  3SR1 A;  5A35 A;  1ML0 D;  2OEO A;  4HN7 A;  3EJI A;  2CVR A;  5CV7 A;  4FF1 A;  4QB4 A;  5EKK A;  4DF7 A;  4A3M B;  2L5T A;  3S9W A;  1YNN D;  2VUM B;  1LTT D;  3GQB A;  1G91 A;  3CRL C;  3L9A X;  3U9S A;  5HGT A;  5C4X B;  2G9H D;  2SNM A;  3KK7 A;  3C1F A;  3NWS A;  4IUT A;  3HG9 A;  1DON A;  1WTX A;  1H9R A;  1CK1 A;  1G2T A;  1CZW A;  2XNA C;  1DJR D;  2EY2 A;  2K33 A;  2FMC A;  3FVQ A;  2DNC A;  1LTB D;  3OSO A;  4GZY C;  4Y7N B;  3EVQ A;  5D65 A;  2IL8 A;  4KKT A;  2DN8 A;  1S4Z A;  2K03 A;  5JVH 3;  1VCI A;  3M7G A;  5A2Q E;  2DY7 A;  5JOB A;  5IGB A;  4IUU A;  1J9O A;  4C2M B;  2I07 B;  3HEJ A;  3H3V C;  4R8I A;  2K32 A;  1LV9 A;  4I7Z C;  3Q0A A;  1EOT A;  2PCF B;  1CFM A;  5FO7 B;  2EJG C;  1A2U A;  1G2S A;  4N9P A;  1TKW B;  4EQO A;  5EJW A;  2HCI A;  2F0I A;  2B2V C;  3BYY B;  3I3C A;  2F0D A;  3BVG A;  5K36 G;  3RLF A;  1CZG A;  3C2P A;  3NTK A;  3Q6S A;  1SBB B;  1IKL A;  2NTS A;  4NW2 A;  3DWP A;  1WTV A;  1F9P A;  2F0V A;  2RA4 A;  4WOR A;  2BCO A;  1EWC A;  2RBM A;  1DYQ A;  1LTR D;  5BN4 A;  3X3M A;  2VB2 X;  2L12 A;  3H6M A;  4DNR B;  5CV5 A;  4RKL A;  3GD7 A;  2KED A;  2A6H C;  3IAY A;  5FKA C;  1CA6 A;  1BCP B;  3KLS X;  5HUR A;  1AZP A;  4KJO A;  1GOZ A;  2F0K A;  1H9M A;  2ICE C;  1SYE A;  3JAM E;  5DNF A;  5IGG A;  3S2D B;  5JPM C;  1DD2 A;  3ND9 A;  1WTP A;  2H4O A;  2XIW A;  4RA8 A;  2J7Z A;  1K83 B;  1Z7T A;  1KAA A;  4IN3 A;  4V0B A;  4PNY A;  1EZ6 A;  3ND8 A;  4K8I A;  2A6H D;  4U67 3;  2Z4H A;  4XDX A;  2D62 A;  2BOS A;  1KNE A;  2CHB D;  2XVS A;  4ZUJ A;  2BE5 C;  3NWT A;  1JC7 A;  1PRT B;  3E6Z X;  2K01 A;  4RH6 A;  1OXT A;  2Z4I A;  4V19 0;  2EYP A;  3SDZ A;  4DAY A;  5CBE E;  2E75 C;  3I8Z A;  4JBW A;  1WVL A;  1QJO A;  1HUN A;  2BE5 D;  3KLR A;  1CA5 A;  3GTM B;  4G7H C;  4S3S A;  3A54 A;  4Q0F A;  4PV1 C;  1SNM A;  1XXG A;  3R93 A;  4FXG C;  1A2T A;  2WAC A;  4Q5V A;  1R4P B;  2LS0 1;  1PLF A;  2EYO A;  2QEJ C;  4F87 A;  1Y8O B;  3S1N B;  2VB3 X;  1NR4 A;  2E76 C;  1DM0 B;  1F9Q A;  4RGN A;  2XWJ B;  3PUW A;  1SMY C;  3HOY B;  1Q90 A;  2HQE A;  5K5P A;  4AYB B;  1PTO H;  3Q22 A;  3HGB A;  1TT2 A;  4K5W A;  1Q1B A;  3URY A;  2JA6 B;  3LNN A;  4CKB A;  1TR5 A;  3NUC A;  5COR A;  3SK6 A;  4ABN A;  1RTN A;  1STH A;  4G7Z C;  1EU4 A;  1B50 A;  4KMU C;  3VYT A;  5CV6 A;  3GV6 A;  1KLG D;  1SMY D;  1ROD A;  4ZKB B;  5KND A;  4P2C B;  2C5C A;  3DEP A;  3TZD A;  4TRD A;  1Y1W B;  4ZYS A;  1X32 A;  2BA1 A;  4U68 A;  3ONA B;  3MVV A;  4IUP A;  4C3J B;  2X6L A;  1I4G A;  4KD3 A;  1DOL A;  4A3B B;  3D4R A;  2BDN A;  3H0G B;  1BQQ T;  2B2T C;  4LJZ C;  4N9T A;  3FDT A;  4RGO S;  3D6C A;  4R9W A;  1R9T B;  3C3L A;  1F2L A;  4ZUI A;  1EFI D;  1JOK A;  1SYC A;  2FHT A;  2EYL A;  2K7V A;  2PZT A;  1STY A;  2B63 B;  3E5S A;  1QCB D;  2MGS A;  1ONL A;  1KDB A;  3G6J B;  3C1E A;  1ZYR C;  4NDX A;  2PO4 A;  4XQJ A;  3F2U A;  5JEA J;  5CBA E;  1HUM A;  4KV6 A;  1RJT A;  5J1Z A;  4DU9 A;  3NTH A;  1VDZ A;  1UUP A;  3GTL B;  1AFP A;  1GUS A;  4DK1 A;  3MAQ A;  3R2T A;  1OXU A;  1ZYR D;  3M85 A;  1SYG A;  1JQY D;  3M7N A;  2LMC B;  1WTO A;  1O7Z A;  3GTO B;  1U4R A;  5CV8 A;  2F0N A;  2B39 A;  4WRD A;  1M8A A;  1JOR A;  2KOL A;  5T1I A;  4HR7 B;  2L4N A;  2KEC A;  3SE0 A;  3DMU A;  1KLU D;  5D14 A;  3DWA A;  3TDQ A;  1U4M A;  4ME5 A;  3RUZ A;  2J0T D;  1M4V A;  1B2T A;  1BO0 A;  4X3S A;  1SEB D;  3C46 A;  1W6J A;  5ELB A;  3SK8 A;  1LT4 D;  1QE6 A;  3R2I A;  2ZXR A;  2RKS A;  4FVM A;  5FK9 C;  5JVG 3;  2NUC A;  4CJ0 B;  1Q8I A;  1OXS C;  1BF4 A;  4E6I A;  3IL8 A;  2E74 C;  3KLS A;  1D5Z C;  1I4H A;  2JA7 B;  3VR4 A;  2TSS A;  4IZ8 A;  2EJM A;  4RKB A;  1QB5 D;  1B9N A;  4RGM A;  1A3V A;  4XTC S;  2RVL A;  3SEB A;  3SK5 A;  2B2Y C;  4L6T B;  5JAV A;  4RGT A;  1EY5 A;  3BS1 A;  3HOX B;  1QWY A;  5CV9 A;  1DXM A;  1Y8N B;  4G7O C;  2B2Y A;  3NTI A;  1HPC A;  1JOO A;  1I6H B;  2KJX A;  3TN2 A;  2NYZ D;  3NSW A;  2YYZ A;  3NK9 A;  3OIQ A;  4ZLT F;  3T13 A;  4ZKC B;  4A3J B;  3TP8 A;  1DOK A;  1FGB D;  3OOC A;  1SE2 A;  1EYA A;  4R8N A;  3BDC A;  1TWG B;  5IIF A;  1GUT A;  2NN6 G;  4EVO A;  1GUW A;  5A2Q L;  4BBS B;  1IKM A;  4IUR A;  4O1N A;  5IT9 E;  1MSH A;  2OXP A;  3QB3 A;  1Z47 A;  3LWU A;  2IX3 A;  2IPK D;  4LMQ D;  1EYD A;  5C0X J;  1EY6 A;  1E2W A;  4QUC A;  5C44 B;  1KNA A;  2SNS A;  4B9W A;  1TWA B;  3ZYY X;  3CKI B;  1CM9 A;  2E2I B;  2LY7 A;  5KNC A;  1HQM C;  1IYU A;  4WFN 3;  4EQP A;  3J81 E;  4CKC A;  2O4X A;  4B9X A;  3H09 A;  4FP5 D;  4CBV A;  2VXW A;  3P20 A;  3MTS A;  1D5M C;  3HS0 C;  1JWU D;  3T16 A;  1PZI D;  1S5E D;  3TME A;  5CC4 A;  4DNT B;  4ZRZ A;  4C3I B;  4C3H B;  1GUG A;  1K8M A;  4X3T A;  1LT3 D;  1HCZ A;  2K1B A;  4ID6 A;  1C4Q A;  2O5I C;  2JEB I;  5CR3 A;  2E2H B;  2A68 C;  1UAP A;  5M5X B;  3NBH A;  3QG1 A;  2XRS D;  1EYC A;  3D4W A;  2CW0 C;  3HRZ C;  2D9U A;  3HZX A;  5C0X H;  5COY A;  4A3F B;  2NVT B;  4A3I B;  4KKS A;  1TY2 A;  1ZKO A;  2ENB A;  2SOB A;  4Z9C B;  5JEA G;  3KF8 A;  3K5N A;  1F2Z A;  3AU7 A;  2JSO A;  2IX0 A;  4KY7 A;  1ILQ A;  1HXY D;  1EZ8 A;  2A5H A;  3QJY A;  2A68 D;  2Q8T A;  3K59 A;  1CI3 M;  4LAA A;  2CW0 D;  4PMB A;  5TSS A;  1TS2 A;  1WTW A;  2B8F A;  5JPN C;  2E2J B;  4J1M A;  4XXE A;  1SJH D;  1EQT A;  1IYV A;  2MPM A;  1SJE D;  2KCN A;  1B1Z A;  1SNQ A;  2EYH A;  2NTT A;  2N55 A;  1NSN S;  1Y69 U;  1U4P A;  1A15 A;  2B2V A;  3PIO 3;  5KIX A;  4F7X A;  1LTI D;  1PDQ A;  4KN4 C;  1S5F D;  3RZO B;  2SEB D;  2A73 B;  3RZD B;  2K28 A;  1D6E C;  4BY7 B;  1V43 A;  5KRU A;  4A3E B;  2HUG A;  1TY0 A;  3QIA A;  2LKV A;  3VR6 A;  2K5D A;  1IL8 A;  1V1P A;  4L63 B;  1D1K A;  5DM7 3;  4A93 B;  4DXF A;  3S1R B;  1LAC A;  2EVB A;  1RTO A;  4TSS A;  4C1N K;  4FXD A;  2JA5 B;  1HQR D;  3OMC A;  5I9P A;  3E0J A;  3D8G A;  3GTG B;  3HOV B;  1DOM A;  4H0L C;  2FMM A;  3V05 A;  1G6Z A;  3KUP A;  5FLX E;  3I4N B;  3QOJ A;  5C3W A;  1LLR D;  2PYK A;  5KEE A;  1ENC A;  5FO8 B;  3J7Y W;  5EQ0 A;  1XWE A;  3CHB D;  1PTO C;  1EEF D;  2H1E A;  5I9O A;  3MEH A;  3BVZ A;  4HMJ A;  1WTQ A;  3MXU A;  3A7A B;  1PZJ D;  1CQV A;  1JWS D;  1MGS A;  4QCL A;  1WCM B;  5IGE A;  2F0H A;  4ULL A;  1SSO A;  2A69 C;  3I70 A;  1TWH B;  1PTO D;  1SAP A;  3TP6 A;  4C3J G;  3OWE B;  4IFD J;  3IKJ A;  5DM6 3;  4FO2 A;  2MJ8 A;  1I4R A;  3D6W A;  1H9K A;  2PQE A;  4KI0 A;  4BA2 I;  2KVM A;  3VYS A;  1ENF A;  3BVM A;  3PO2 B;  1JWM D;  1ILP A;  3L7Z C;  3LWE A;  2D2C C;  3DHQ A;  4XYO A;  2F0L A;  2DNE A;  2NVX B;  2A69 D;  5C0X G;  2EPB A;  1UNS A;  5KYI A;  3NE5 B;  2EE1 A;  4J6H A;  4QMG A;  1KDC A;  1RHP A;  1VMC A;  2R6G A;  3EA6 A;  2AWN A;  5M9O A;  3S15 B;  4DXG A;  4XT3 B;  1TS4 A;  1SYF A;  5C3X A;  2PMZ B;  4HTH A;  5ELE A;  1TVX A;  2M2L A;  3NP8 A;  3A8K E;  2TMP A;  1V1O A;  2O5J C;  2K04 A;  4HED A;  5D3I B;  2HCC A;  3NQI A;  4CGY B;  5DEH A;  4KHV A;  3Q23 A;  2ZT9 C;  1A3T A;  1LO5 D;  3A8J E;  3KBX A;  4JK1 C;  4C56 C;  1EY8 A;  1LT5 D;  2KEE A;  4RAU C;  5C0X I;  1PMR A;  2AQ2 B;  4K2K A;  3PUY A;  3GTP B;  4H44 C;  3WDN A;  4WJW A;  1EWH A;  1I4X A;  2WB1 B;  3AB9 A;  4KK7 A;  1BBX C;  1EL0 A;  1RKN A;  4KJN A;  3MXG A;  1E2Z A;  2NN6 H;  2EJF C;  2XSC A;  1MI2 A;  3BYT B;  3Q24 A;  3VA5 A;  3RD4 A;  2PNR C;  5G3L D;  1LAB A;  3OWF A;  3P1H A;  2AQ1 B;  2B2T A;  2EXZ A;  1SYD A;  4NMZ A;  4CJ2 C;  2F0W A;  4OGQ C;  5ISR A;  2L1B A;  1DCZ A;  4X3U A;  5IOC A;  3L3O C;  2R92 B;  1I6V C;  1FNU A;  1PFB A;  3S2H B;  3PUV A;  4A3G B;  2RSN A;  3S17 B;  1AEX A;  3MFG A;  4IUV A;  1TQO A;  4L8J A;  3MHB A;  2EY5 A;  1EY0 A;  4K8J A;  1O78 A;  1KTK A;  1F9R A;  1HFG A;  3N52 A;  3NXW A;  1TU2 B;  3K5O A;  3MFY A;  3A7L A;  2M9V A;  4C1N I;  2Z8L A;  1T5X D;  3K5M A;  1HA5 A;  3OW7 A;  1H9S A;  2JYO A;  2RQX A;  1FD7 D;  2EOT A;  1ESR A;  5J22 A;  1GHK A;  2BDO A;  5I2Y A;  1PTO F;  3S1Q B;  3CU7 A;  1FYC A;  1ZEQ X;  5KYL A;  3ITP A;  1FR3 A;  4DN4 M;  5IT9 L;  1L0X B;  4K6L A;  5M5Y B;  5JEA H;  1FNV A;  1D1I A;  2DY8 A;  2F0E A;  2EY1 A;  2OT2 A;  4EGV A;  1BNZ A;  2RDF A;  3J80 L;  2ICI A;  2ID0 A;  4FF2 A;  2AUJ D;  3K5L A;  4X3K A;  4K5V A;  5EKL A;  1GXD C;  1MSG A;  1EIH A;  2IJ0 A;  4BWG B;  1WD1 A;  5BN5 A;  3UI2 A;  2KHS A;  2NBF A;  3MZ5 A;  3K58 A;  2B8G A;  2YU9 B;  2V4D A;  1STG A;  2F0Q A;  1J8I A;  5ELD A;  4C3I G;  2F0O A;  4C3H G;  4ZK9 B;  2RSO A;  1II3 A;  4IFD G;  1NR2 A;  2EYM A;  3EFX D;  2PW5 A;  3I90 A;  1F2M A;  1IHZ A;  4TKO B;  2B2W C;  3MC0 B;  3PMF A;  2OF1 A;  1SNC A;  1TWC B;  3DUZ A;  2K5Q A;  2B2W A;  2F3W A;  4BA1 I;  5J39 A;  1QNK A;  2A6E C;  2QKI C;  4F8M A;  3FPP A;  3MXP A;  3D31 A;  3PO3 B;  1PFM A;  2X69 A;  1E0B A;  2MP1 A;  1RCV D;  2O2L D;  1XYI A;  3VR3 A;  5G3L F;  3IFT A;  2QCP X;  1V1P B;  5ELF A;  1LTS D;  3PIP 3;  2A6E D;  1B9M A;  5EPK A;  1STN A;  5C3E B;  3QWN A;  3G7L A;  2GA4 B;  2AUK A;  4H7B A;  2NVY B;  1AP0 A;  1OO9 B;  2WV6 D;  3GP7 A;  2PPB C;  3W3A A;  1BCP F;  2JEA I;  3A55 A;  3DXJ C;  1QG7 A;  3TBI B;  1Z6H A;  3RMH A;  2NB0 A;  4TQU S;  1U4L A;  1I4P A;  1STE A;  5CV4 A;  1GHJ A;  5M5W B;  5IGD A;  4MIU A;  2JP1 A;  4BY1 B;  3T53 B;  3SVM A;  5E4X A;  4HAE A;  4CHT B;  1O7Y A;  2F0F A;  2WKC A;  3NPP A;  3M3Y B;  2NN6 I;  1PTO B;  2XN9 C;  2EYJ A;  4KN7 C;  4A3D B;  2JXM B;  1JB3 A;  4HMI A;  1O80 A;  3K7A B;  2Z1C A;  1C8C A;  1HFN A;  1ET6 A;  5C5L A;  3OIP A;  1EY4 A;  1BXT A;  4NKL A;  1PRT F;  2VNU D;  2QF7 A;  1BUV T;  1BOS A;  1U9R A;  3JAM L;  1STA A;  4FF3 A;  5LL6 X;  2NVQ B;  2L9H A;  3SK4 A;  1I4Q A;  3J7A V;  3I4M B;  4PQX A;  2F0U A;  1CQF A;  1Q1E A;  4IUN A;  3WOF A;  5FO9 B;  1ET9 A;  1SE4 A;  1JE4 A;  3I4L A;  1B44 D;  4QIW B;  4DK0 A;  5FLX L;  1CHP D;  2F1M A;  1S5D D;  4MHE A;  4XQN A;  5I2X A;  3R3O A;  4OO1 H;  1JIC A;  3NHH A;  3FEW X;  5KNB A;  4KTA A;  1X3Q A;  3HOZ B;  1Y8P B;  3ERO A;  1EQV A;  1RF2 D;  3R8B A;  4RFB A;  2L0C A;  1HTL D;  2D5D A;  4RHR A;  1F2Y A;  1OXV A;  2SDF A;  3NBI A;  4A3K B;  1QOH A;  1PZK D;  2F0M A;  1O7L A;  1B3A A;  2N88 A;  1EY7 A;  4XT1 B;  2BA0 A;  2Y0S B;  2RDG A;  3BDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...