2BDOA

Solution structure of holo-biotinyl domain from acetyl coenzyme a carboxylase of escherichia coli determined by triple-resonance nmr spectroscopy
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
80
structure length
80
Chain Sequence
EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Biotin
molecule keywords PROTEIN (ACETYL-COA CARBOXYLASE)
publication title Solution structures of apo and holo biotinyl domains from acetyl coenzyme A carboxylase of Escherichia coli determined by triple-resonance nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
total genus 6
structure length 80
sequence length 80
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1999-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2bdoA00
2NN6I 1GUOA 4H13C 2JXMB 4LK1C 3I4LA 2BDOA 3VR6A 1DCZA 1GHKA 3PV0A 1K8OA 1GUNA 1IW7C 1GUSA 2EJMA 3ND9A 5KNBA 5KNCA 1A6XA 3PUWA 1E2WA 1GHJA 1H9SA 2A6HD 2NN6G 2R6GA 3VR5A 4G7HC 4G7OC 4KKUA 4DK0A 1BDOA 2A6ED 1TKWB 3A8IE 1I6VC 3FMCA 1GUGA 4KHZA 3W3AA 3SE0A 4DK1A 4KKSA 1CI3M 1HTPA 5C0XH 4HR7B 2JE6I 1K8MA 1LABA 2D5DA 2E74C 2K33A 2PCFB 5JEAH 1Y8NB 1SMYC 3MXUA 1IYUA 3I73A 1H9JA 1CFMA 2BE5D 2V4DA 2AUKA 3D4RA 4OO1G 1YNJC 3MFYA 4BA2I 3AB9A 1OXTA 3PUXA 3U9SA 1HPCA 1PMRA 1Q1EA 3DXJC 5K36G 3BDOA 2JEBI 3H94A 3PUYA 4TQUS 2NN6H 1CTMA 3VA7A 3PUZA 3QJYA 2B8GA 3VR4A 2O5IC 2A68D 1Q90A 3A8KE 4KKTA 2BA1A 3ND8A 1OXXK 3PUVA 3LNNA 4DNTB 1OXSC 4BA1I 4DNRB 1HCZA 1GUTA 3IFTA 2YYZA 2EVBA 2Q8IB 5BN5A 3T53B 1ZYRC 3HGBA 1G291 4RCNA 3QG1A 2DN8A 3WDNA 2A6HC 5BN3A 2A69D 4KI0A 1FYCA 1VCIA 1T5EA 4G7ZC 1VDZA 3A8JE 1VF5C 4IFDG 1E2VA 2A6EC 2IT1A 1DXMA 3A7LA 3GQBA 3M4YA 3P20A 3T56B 2KA7A 4OGQC 4OO1H 2O5JC 3OOCA 2CW0C 5C0XG 1H9SB 2PPBC 3RLFA 5K36H 1O7LA 2E75C 2EJGC 1Z6HA 1H9KA 1QJOA 3BG3A 3GD7A 1Y8OB 3N6RA 4JK1C 2F1MA 3VR3A 2K32A 5A35A 4PV1C 2BA0A 1V8QA 3FPPA 3D31A 3A7AB 1GJXA 1HQMC 2A69C 2DNCA 2PNRC 2BE5C 2LMCB 2E76C 3T51B 1B9NA 2JEAI 1YNNC 3VR2A 3TZUA 1H9RA 3KLRA 2L5TA 1Y69U 4KN7C 4KN4C 4L8JA 2D62A 1H9MA 2QF7A 3M7NA 3IKJA 5KNDA 3LWUA 3QIAA 5BN4A 1B9MA 2K7VA 1LACA 1V43A 3OW7A 1IYVA 1OXUA 3CRKC 4XTCS 4LJZC 3NE5B 1OXVA 4KMUC 2A68C 2AWOA 4XIGS 3CRLC 3EQLC 4IFDH 1E2ZA 3I72A 4IQZA 4TKOB 2ZT9C 1Y8PB 3SDZA 1IW7D 1TU2B 2D2CC 1DD2A 1Z7TA 1VF7A 4H0LC 3M85A 5JEAG 1ZKOA 4GZYC 2EJFC 1EWHA 3OPOA 2AUJD 1Q1BA 1O78A 4I7ZC 1FR3A 3L7ZC 4H44C 1ONLA 4JBWA 2KCCA 2B8FA 2DNEA 1Q12A 2EDGA
chains in the Genus database with same CATH superfamily
2GVAA 1Y1VG 1GUOA 5CBAE 1EOTA 3F1ZA 2XVSA 4JI6L 1KC8C 5D14A 2N78A 1VQ5A 1A6XA 5IYBH 2XRQD 1L1OC 4B3TL 4XYQA 3NTKA 4G7HC 5KIXA 1XNRQ 3OWFA 1KRSA 2VB2X 1SROA 3K8AA 2EQSA 1S40A 1T5XD 2HUGA 3CPFA 4NP5A 2DY7A 1BCPD 1KTKA 3M7GA 4X3TA 2Z1CA 3OIQA 4K2KA 1PFMA 1E7ZA 2RDFA 4B3RL 1QG7A 2NB0A 1CSPA 3G7LA 5JEAH 3KJOA 1XX8A 4OWTB 1NE3A 3HKZE 4X64L 3E9IA 1QZGA 2HT1A 3V2TA 1BBXC 4Y52H 2UXCL 4FVMA 1TWAH 3BDOA 3S15H 2YV5A 2QDBA 2ENBA 1MJEA 1WTQA 1VQKA 1Y1WB 3ITPA 2JJQA 3D6WA 1WTWA 4PMWA 4L63B 2E5LL 1VQ4A 1PRTB 5CYUA 1KAWA 3HKZG 5EKKA 2YYZA 4GOPC 1BO0A 3IRBA 1WYDA 1SR3A 4P72A 1YITA 4CKCA 2Y0SB 4KJOA 2K6AA 1GKHA 1UEAB 3CMEA 1HRJA 3QO2A 4A3CH 5FLXL 3I4NG 1QNKA 2UUAL 1KRTA 2PPBC 1WTVA 1X3GA 1H9KA 3N6RA 1XXGA 4ZAIA 4LFAL 2RBMA 4XT3B 2G5DA 1FJGL 1LTLA 1RKNA 3EBEA 2LMCB 4EQ5A 1EY4A 4CKEA 4HN7A 4KD3A 4ID6A 1XMOQ 3GTKH 4RHSA 1SFOH 1DYQA 3LWUA 2PQEA 2OF1A 4O42A 4GKJQ 5JVH3 1UAPA 1SBBB 1DD2A 1NBWA 1VF7A 4A3KH 4ALPA 1MD2D 3EA6A 2EJFC 1QVFA 2B2TA 3TRZA 1JE4A 1Q8IA 4HJ5A 3FDTA 4RGNA 5F2DA 5C4XB 1RTOA 4H13C 1JOQA 2VQFQ 3STBC 5C3WA 1ZYRD 2KECA 4LF9L 5JPNC 5CGKA 2ZXOA 2K5DA 1ENCA 3CCUA 4FDBA 4C3IH 5G3LD 3A8IE 5GQOA 2VQEQ 3HFZB 1VQAA 4BBRG 1DZ1A 3SK6A 2KHJA 1R4QB 2VZAA 5E7NA 4NMZA 1MI2A 5C0XH 4X3UA 1PRTD 2OT2A 4RGTA 1B44D 3U50C 1BBUA 3J80c 2YU9B 2LY7A 2WAQG 2ZTCA 1SYFA 4L5TA 1VQ7A 1DOKA 1LTRD 4S3SA 3AB9A 1Y1VH 3K0YA 2AQ2B 1SJHD 3DXJC 1R9TH 3HOUB 3TZDA 4CDDC 2PI2A 2R7ZG 4RG1A 5ELFA 4IPGA 1M90C 1CHQD 4ZRZA 2ZXRA 3ERQA 4KKTA 4JI2L 1YZ6A 4LF7L 3P1HA 1C0AA 4A3BB 1IL2A 3DWQA 1CM9A 1KLGD 2PZUA 1PYSB 5A2QL 4RH6A 1TXYA 1NUCA 4JI5Q 2UUBL 4WJ3M 5M5XB 5M5YB 1X3FA 2NVTH 4DF7A 2MHVA 1W6JA 2J0TD 5LMUQ 3BU2A 2F0MA 3OOCA 5FO7B 4NXML 3GTLH 3BVZA 4HTHA 5IGGA 5LMNQ 5CMDA 1TWGH 2Z9HA 2K32A 2MO0A 2NTSA 1SSOA 4RMFA 4NXNL 3HOYB 1HQMC 1PTOC 3SXHA 2BE5C 3FVQA 3NBIA 2Y0SE 3R2TA 2IX0A 2QW7A 2L5TA 4HIMA 4IFDI 3VYUA 4A76A 2F0SA 4OIKA 2F0WA 1Y1WG 1WVLA 1F2LA 2F03A 3H0GB 3PF4A 4LFBQ 3QIAA 5IWAQ 2JA5G 3OW7A 2IL8A 3SR1A 4NKLA 3L3OC 5IP7G 3T1HL 1CA5A 1VQGA 4RWSC 2A8VA 4R8NA 2RA4A 3I72A 2D0PA 5FKAC 3RN5A 1EYGA 3GTOB 1YEZA 4N9PA 4DN4M 4EQOA 4H7BA 4DV2Q 2KBNA 2Y0SG 3I4NH 1ZXTA 4ZKBB 3Q6SA 1O78A 1S5FD 3KOJA 1N34Q 3OMCA 2KCCA 1IHZA 1IXRA 4M8AA 3Q0AA 2F4VL 2LXJA 2MGSA 5EPLA 3VR6A 1WTRA 3UDGA 4DR4Q 2F0IA 2E2HB 4OWXB 3NTIA 1HUMA 4DUZL 4F88A 2Z0SA 1A63A 4RA8A 1AZPA 4HMJA 1I6VC 3ULJA 3J7AV 4JI7L 1CQFA 2KCTA 2VW9A 4JPBW 1EEID 2I46A 1RF2D 2K33A 1PXUA 5NUCA 2OTJA 3QOLA 1N32Q 3E9HA 1E0BA 5J22A 3KF8B 3MXGA 1UE5A 4LF8L 4PQXA 1GXDC 4WJWA 2K5QA 4H02A 4BA2I 3H15A 4DV4Q 3PUXA 2DUDA 4XYOA 2B2WA 4UP9A 3R8BA 5C4XG 1EYCA 3CMAA 1EQRA 1CTMA 1A3UA 2B8GA 4FYDA 1EYDA 2JK8A 2ZJRA 3WOEA 4C3HB 1D8LA 1X54A 4BBRH 3IFTA 4OO1I 2F0JA 2PZTA 1FGBD 4ZUIA 1EIHA 4IOCA 3HGBA 4DR6Q 3WDNA 4C2MH 2KENA 1QWYA 3GV3A 1VF5C 4JOIC 3ULLA 5D65A 4R4QA 1I94Q 2IT1A 2XSCA 5C4HA 3HOXB 1S4ZA 4G57A 1SMXA 1SLJA 5BR8L 3K5MA 2ES2A 4UP8A 1XMQQ 1Q46A 3W1GA 5A35A 2R7ZH 5EKIA 3FPPA 3KFUA 3A7AB 1XNQQ 2DNCA 3HOUG 1Q82C 1QB5D 2F0TA 1I4HA 1Y69U 4B3MQ 3CCMA 1BXTA 1D6EC 5ELNA 5BN4A 2K7VA 5JJLA 4A3BG 3U9OA 2CKZB 3AU7A 4LJZC 4XTCS 1NMFA 4GLXA 4X62Q 1C7YA 1E2ZA 1Q81C 1TY0A 1L1OB 2OEOA 3M85A 3K58A 5DAUA 2DGYA 2EYLA 2VL6A 5COYA 1B8AA 4OL7A 1A62A 1I4RA 1FL0A 5E4WC 3S1MB 3IL8A 1O7YA 1PZKD 3NENA 2F0PA 1F2YA 3AMUA 3NQIA 1TS3A 2RQXA 5KNCA 1Y1WH 3P75A 1HNZQ 2R6GA 3GTJB 1J9OA 4PMBA 2CQOA 3GTMB 1YNJD 4QUFA 2ZJQA 2PO4A 5IP7H 1GUGA 3H0GG 1EQQA 3GO5A 1PA6A 1E3PA 3FP9A 1SN8A 4IUQA 1NSNS 2XN9C 5IT9E 2D5DA 4WRDA 2JQOA 4DV6L 2FMMA 2H4OA 2UXBL 3Q8DA 2EY1A 2V4DA 5IYDG 3M9BA 1HR0W 4GOPB 1YNND 4L5QA 4HAEA 2K50A 1JOKA 3KYHC 1N36L 2K01A 3L2PA 1M1KC 4QCLA 2B39A 4Q0FA 1STEA 1BOSA 4B3SQ 2A1AA 4ME3A 1KHIA 1MIUA 3VR4A 1BR9A 1JJGA 2RSOA 4DR2L 3N52A 5J3BA 5EJWA 4EGVA 4GKKQ 4JI1L 5IOCA 2XTIA 3J81j 4RCNA 3ICEA 2ICIA 3TP6A 5M3MH 1D5MC 1WTPA 1KXLA 2A69D 1IBKQ 2ASBA 3MTSA 3BZDB 4IPDA 4FF3A 4RKLA 4IOAA 4JI8L 3BJUA 3I8ZA 3IFDA 5CV9A 3IAYA 3MFGA 5C4XH 5EPKA 4JI6Q 2PZWA 1IBLQ 3KF8A 1J5EL 1H9RA 1XYIA 5GAHC 3K81C 4ZCKA 1EYAA 2YTXA 3D0FA 1V9PA 4DV0Q 1L0WA 4QQBX 1ILPA 5C0XI 4C3HG 5I2XA 1PH2A 4B3RQ 5KGUA 2BH8A 2RVLA 1I5FA 1TU2B 4PZ6A 4ME5A 3HKSA 1EU4A 1ZKOA 1BQQT 2LXKA 2YU9H 3HOXG 1VQEA 2UXCQ 5C44B 1I3QB 4FNFA 4JI4Q 4NB3A 2MNAA 2B63B 1Q12A 1UE6A 1SYCA 4IUNA 1SYBA 5ELDA 2YTYA 5LL6X 4J6HA 1AEXA 5DNFA 1F9SA 2NZOA 2ZXPA 1BCPF 2NN6G 4J1MA 4A3IG 5JVG3 2KCMA 1XTCD 1BF4A 4A3BH 2J7ZA 4GLVB 4KHVA 4A3DB 4GN5A 2E2DC 3SE0A 4R4IA 1GUWA 1RDPD 4K0KL 2JE6I 1LABA 4JV5L 5M5XH 4BY1B 2NYZD 5M5YH 4B08A 4HJ9A 3CCVA 2Q2HA 3KBXA 5KEEA 3I73A 4KTAA 2OQ0A 1VMPA 2UUAQ 1D5ZC 1YJNA 4LFAQ 4U673 5K36G 4HEDA 3PUYA 1L1OA 5FLMG 3HOYH 1FNWA 3DEPA 1S72A 4OONA 1U0LA 2RDGA 1YHAA 3TP8A 1I4GA 3BYYB 1HZAA 1F9QA 1HZBA 4DAMA 1EQVA 2D9UA 2K04A 3LNNA 3H0GH 1EWCA 1GUTA 1BVSA 4NDXA 1JICA 1AW7A 4DR3L 3KDFB 2IHEA 3VYRA 2M00A 3GTOH 3NEMA 4CJ2C 3RZDB 2VY3A 1WTXA 2O5JC 1C8CA 5IYDH 1K28A 2OCEA 1H95A 4N9TA 1U4PA 1JQYD 4WORA 2BOSA 3F2DA 2E75C 2R93B 1B7YB 1YBYA 4PMCA 3RUZA 3M3YB 5I6WA 5AFWA 1V8QA 1NJIC 3V96A 4LF9Q 2PNRC 4XDXA 1SE4A 1YNXA 4GOPA 1FVIA 2E2HH 3NPPA 4L8JA 4CDEC 1SJED 2D62A 3NSWA 4O2DA 1D7QA 3HOVB 1PH5A 1P16A 3BDLA 3C1EA 4DK6C 4FF4A 4RKBA 3OSOA 5DM63 1CSQA 3OTOL 3CRKC 2KVMA 2JN4A 1BBWA 1E1TA 4CBVA 2A68C 3S14B 2F0QA 1FGUA 1TT2A 1DOMA 5CV4A 4J15A 5JPMC 2HDMA 3I4OA 4FO2A 3QOJA 4XXEA 3OPOA 4JBWA 3G6JB 1SYEA 2ZM6Q 1PZJD 2Q2TA 1HHVA 2MFIA 1SE8A 4X3SA 2JXMB 5AJ3L 3K7UC 5G3LF 2BDOA 1GHKA 3A55A 3SHLA 1BNZA 4DXFA 2NVXB 2A73B 1VQIA 3T1YQ 1GHJA 1E22A 1WJJA 1PRTF 2AKWB 1VQ8A 3J7ZC 3CC2A 4C3HH 4KHZA 3CCSA 1TS5A 1J6QA 2UUBQ 2M9VA 1U4RA 1B3AA 1S5CD 1Y8NB 2XGTA 3HOXH 4NXMQ 3G48A 2HIVA 2JA6B 1CFMA 2BE5D 4KLKA 2L11A 1LT3D 3UE1A 3CP0A 3E3XA 2TSSA 1GD7A 3QB3A 4DV7Q 4NXNQ 5C44G 4UP7A 2F0OA 5LL6S 5CV5A 1G51A 2RSNA 2B63G 3FEWX 2KEDA 4X66Q 2NN6H 2AHOB 1LTBD 2O5IC 3I3CA 1N33L 3U4VA 1OXXK 5EAYA 4U68A 3TEHB 2EYMA 4DV5L 1CA6A 1G291 2CQAA 4JYAL 2WB1E 4A3DG 1FYCA 4G7ZC 3FHWA 2B2UC 3NWSA 1JOOA 1E2VA 3P20A 4KHPQ 5IODA 1B4OA 1WFQA 4BY1G 3EIVA 1HNWL 2KHSA 1ENAA 4A3GB 1LT6D 2AQ1B 5K36H 1QJOA 3NXWA 5CV6A 5FLMH 4HCSA 1EIYB 5D3DA 2BA0A 3S1MH 4X65Q 3S1RB 3D31A 4LF5Q 2JA5B 4DR7Q 5E4XA 4A3MB 1EOVA 1PH6A 4DUZQ 3I7FA 3GTJH 2K52A 4YY3Q 1STBA 3GTMH 1LACA 4R4CA 3PO3B 3C2PA 2FMCA 4XIGS 1MKHA 1STAA 1JB3A 2ZT9C 3A0JA 3K6OA 4I7ZC 3KDFA 1LO5D 3AQQA 2UU9L 3WOFA 2EDGA 2R93G 3VA5A 4DV3L 1DCZA 1HNXQ 2G9DA 4MHEA 3H3VI 1B70B 3QR8A 3CCLA 4YHHL 3TP7A 1PH1A 1LV9A 4FF1A 2EPBA 3TSSA 4LUZA 1VQNA 2I5MX 1A8VA 3HOVG 1KABA 1CK1A 1RHPA 1HTPA 2Z4HA 2IY5B 4UPAA 5E1FA 1O7IA 3H09A 1WOCA 2JA9A 5BR8Q 1EFID 4IFDJ 2L0CA 1X32A 1U9RA 4LW1A 4RAUC 2XNAC 3KF6A 3OWEB 4QGUA 3CC7A 2F0NA 2HQEA 2AQ3B 3URYA 2I07B 3T16A 1K0RA 3TDQA 3C46A 2HCIA 4GNXC 4KD4A 1IKMA 1G6ZA 2WP8J 4DV1L 4IPCA 4GS3A 4HJ8A 1BUVT 4LFCL 4JBKA 4K5WA 1PH7A 3T56B 1VQPA 1DXMA 3M4YA 1U4LA 2KA7A 1DJRD 1PDQA 4A93G 1STHA 1HR0L 5KRUA 3A54A 4Q5VA 2JA6G 5C44H 1I3QH 2QDLA 2B63H 4PV1C 5E3FA 1I4PA 5I2YA 1HH2P 1TIID 3S2HB 2GN5A 5I9OA 1YIJA 4OX9L 4C3JB 3JAME 1TWHB 3E0EA 5IT9L 2JYOA 2KCNA 3NK9A 1I50B 4JOIA 4A3DH 3U4ZA 5EGTA 3PGZA 4F7XA 4A3FB 2QA4A 2EYPA 5DLQE 2ZJPA 3ULPA 3EFXD 3SDZA 4DV6Q 4BY1H 2UXBQ 1KDCA 4X3KA 2EYHA 1XTDA 1IL8A 1SNPA 5C5LA 3RZOB 4AYBE 1N36Q 3L7ZC 1ET6A 2ATWA 1HTLD 3SK4A 4A3GG 4DR5Q 4LUOA 1JJ2A 4R4OA 4FP5D 2R7DA 1IW7C 1G6PA 3PUWA 1SNCA 2EYOA 4A3MG 4DR2Q 2XWBB 3I70A 4KKUA 1A0IA 2N3SA 2A74C 4JI1Q 1S5DD 4IUVA 1CZWA 3NQTA 4HJ7A 3PO3G 2EYJA 1WD0A 4CHTB 3K57A 1K8MA 3S16B 1NCVA 5EPJA 2V1CC 2GVBA 4OXPA 4UAIA 3TBIB 3RZDH 1JR0D 3Q23A 2WINB 5JOBA 1VQLA 3DUZA 2RCFA 3NTHA 2LS01 2AUKA 1KNAA 3D4WA 3Q24A 1QNUA 2EY5A 2N49A 2IHFA 5IP9G 1QUQB 2R93H 3BYTB 2JEBI 3M3YH 2FHTA 2R92B 5IGEA 3J81E 1WCMG 1JT8A 1J5EQ 2B2VC 4LF4Q 3RMHA 4APVA 4PZ7A 2H5XA 3L0OA 3HOVH 1HJPA 4BA1I 4DNRB 3G6EA 2MUYA 3ZJYC 1A2UA 5FK9C 1SNMA 4CKBA 2A6HC 4ODGA 5BN3A 3S14H 4BBSB 1LUZA 1VDZA 2TMPA 4K6DA 1A2TA 1PV4A 2RHSB 3DLLA 4DR1L 2F3IA 1IBMQ 1UNSA 3NELA 1RTNA 1Y8OB 4JK1C 4IJLA 4IUPA 4A3EB 3CD6A 1LLRD 1EWIA 2Z6KC 3O13A 1MGSA 4Y7NB 2FXQA 3VR2A 2HCCA 1TY2A 3LWEA 4OHJA 1YI2A 1J8IA 1TWCB 5FLXE 2NVXH 4X6AH 2QF7A 1QE6A 3M4QA 4POFA 1MSHA 4L5RC 3S1NB 1EY9A 2R3ZA 2A5HA 3CCQA 3I4MB 4K0KQ 2CWAA 1O7ZA 4FXKC 4MNOA 2UXDQ 1TWFB 3RNUA 4GKJL 3UDXA 1SNOA 2Z4IA 5EKLA 4KY6A 2JA6H 1II3A 1D1IA 1U4MA 2R61A 4A3IB 5TSSA 3W1BA 4JBMA 4HIKA 2CVRA 2NN6I 3SVMA 3I4LA 4P74A 4HIDA 1K73C 4R1JA 1GUNA 3ND9A 5IE8A 4L5SA 1I6HB 4KK7A 4JI0L 2F0DA 4G7OC 2SNMA 2RHQB 4C3JG 2I5HA 4JG2A 3E6ZX 4HR7B 4Z9CB 4DAYB 2L9HA 1JMCA 1A15A 5ELEA 4A3FG 2VQEL 4NW2A 4RFBA 1SMYC 3PCOB 3FPUB 3F2BA 3K7AB 1RL2A 4A3GH 4JW0A 1HPCA 3M4PA 1VMCA 3P7JA 2KOLA 5C0XJ 3JC66 3S1RH 1PRTC 1VQOA 2JA5H 1G8ZD 4A3MH 3DM1A 2OTLA 4WJ4A 2A68D 1DOLA 2FINB 4DNTB 4QMGA 5ELBA 1HCZA 1JWSD 5T1GA 2DJGC 3PO3H 2Q2UA 2LSSA 3VYTA 2E8GA 1YHQA 3SGIA 1B50A 4IFDG 3FKIB 4GN3B 1WTOA 4NPSA 3I91A 4JBJA 4JI5L 5IP9H 1V1PB 2JSOA 3ER0A 3BG3A 1ML0D 3BZCA 3VR3A 3H3VC 5AJ3Q 1Q8KA 1EY5A 4JI3Q 3T51B 2JEAI 5LMNL 2CWPA 4K5VA 2R92G 1K83B 2IJ0A 2WACA 1QUQA 2B2YC 4F87A 4ILWA 3PIOA 1JB7A 1S5ED 3R93A 4QB4A 2EIFA 2C5CA 4LFBL 4TKOB 5IWAL 4B9XA 4DUYQ 2D2CC 1Z7TA 4BBSG 1VQDA 1C4QA 1UEBA 2EE1A 4I7AA 2AUJD 4H44C 1ASZA 3BZKA 1X3PA 4B3TQ 3CC4A 1IKLA 4LK1C 1R4PB 4A3JB 1SYDA 1D2BA 4ZKCB 4A3EG 3CAMA 1RCVD 2R7FA 3U58A 2AWNA 1N33Q 4G4KA 2N55A 5IT9c 4JYAQ 4X64Q 1VQFA 1CUKA 5GROA 1I4XA 2PCFB 3J7A5 3I4MG 4GNXB 3SEBA 2WV6D 2ZTDA 1HNWQ 1TVXA 4OO1G 4LMQD 2K5HA 2F0LA 3HOUH 4DFAA 2C35B 1MBYA 1PMRA 1Q1EA 3GV6A 4IJHA 1N32L 1RIPA 2E5LQ 3H94A 2K75A 2RKSA 4XQNA 3OW2A 2NZHA 5KYIA 4DV4L 3VA7A 1STNA 3S2HH 2WKCA 1KD1C 1Q90A 4YCUA 1SXTA 3ND8A 2K05A 4C3JH 1TWHH 5FJ8G 1EY0A 1JORA 1HA6A 4V190 1I50H 5J1ZA 4C1NK 3EJIA 4P2CB 4A3FH 1ICWA 4KI0A 2CCZA 3I2ZA 1VQCA 4BY7B 1ET9A 3EVQA 2VB3X 3GQBA 1FJGQ 2WB1B 2VNUD 3RZOH 3PF5A 2CW0C 3RLFA 1EUJA 3GTQB 4DAYA 3DMUA 5C4JB 5DM73 1W3SA 4DV3Q 4HIOA 3M4OB 4ULLA 5JJZA 3NWTA 1VQ9A 4F8MA 1K3RA 4KN4C 1EIFA 1PH4A 1PTOB 4MIUA 2F3VA 1CKOA 2B2UA 3R2IA 5GAGC 3STBD 1B3QA 4HMIA 4IFDH 3S16H 1PH3A 2BH2A 4EX5A 4DU9A 3CPWA 4X62L 3FKIG 4FXGC 1SAPA 2I5LX 5IGCA 5CBEE 1PZID 3TREA 2H1EA 1PFSA 4AQYL 2CHBD 3MVVA 2JA8B 1LM0A 2PQAB 4DK3C 2R92H 1KDAA 1K8OA 4DA2A 3HEJA 1KDBA 4BS9A 1V1PA 4IUUA 1OO9B 1BDOA 1C48A 4DV1Q 3KF6B 5C6AA 1X56A 2F0EA 3WWVA 1L0XB 1Z9FA 4LFCQ 1K9MC 2LKVA 1I4QA 2E74C 2MJ8A 4BBSH 3HOZB 2DY8A 2C9OA 1EQTA 1YNJC 3UI2A 2RF4A 4LF7Q 4JI2Q 1RJTA 4A3EH 2K5NA 3CCRA 1NAPA 5IGBA 3JAML 1C9OA 2X6LA 4Y7NH 4A3LG 4A3JG 4OX9Q 2WKDA 1TWCH 4RCOA 3UE0A 1GO3E 3S17B 1ILQA 5DEHA 3HOWB 3S1NH 4A93B 2VXWA 5FO8B 1FNUA 2DN8A 1GOZA 3I4MH 1PTOD 2E2IB 4C3IG 4GKKL 3VDYA 2A6EC 5C4ZA 1STYA 2KHIA 4OO1H 4K8IA 1TWFH 5C0XG 3GDEA 1IBKL 5HY6A 3PO2B 5LMNW 3W5OA 1X3EA 2EJGC 3A5ZB 1Z6HA 4HSPA 2EXZA 2PMZB 1KLUD 4A3IH 4C1NI 4GNXA 1LYLA 4ZK9B 3G71A 5JJKA 1LTAD 1DONA 2A69C 1QVCA 4QL5A 4QUCA 3T1HQ 1AN8A 1I6HH 3I90A 3D6CA 2NUCA 5FJ8H 5KNDA 1B9MA 1CKNB 1IBLL 4EQNA 2N88A 3EROA 2KJXA 1PYBA 1SE2A 1OXVA 1GM5A 1YVCA 2AWOA 3A5UA 4IPHA 2B29A 1CZGA 4DV0L 2MQHA 5CORA 3K0XA 3RN2A 1UUPA 4H0LC 3T13A 2F4VQ 5IYCG 1AZQA 4BY7G 3RR5A 5ELCA 3K7AH 1DGSA 1MJCA 1Q1BA 3BS1A 1F9PA 3MXPA 4PZ8A 2WB1G 2B8FA 3J81L 3K80C 2IPKD 4OELB 5C3EB 1JWUD 2F4IA 2VS1A 4AYBB 1NR2A 4WFN3 4JI4L 4JI7Q 4K5XA 1WD1A 2A6HD 4DNIA 4N8X1 4OIJA 1XPUA 3OYYA 4EQPA 2BDNA 2Z6BA 3FMCA 2NVQB 3W3AA 4YWKA 4DK1A 2EY6A 4LF8Q 2UUCL 3FKIH 4DR1Q 4OWWB 3HZXA 1KAAA 2QEXA 1WCMB 4L6TB 3HS0C 4LUVA 3J80E 2PW7A 2G9HD 2DJFC 3JAMi 3ONAB 1X9NA 2IWHA 4HJAA 2L12A 3TQYA 2JA8G 2SNSA 2IX3A 1W6KA 1U5KA 2A19A 3A8KE 1K83H 3PUVA 2K4KA 1VQBA 4KJNA 1QILA 5CC4A 4M1UB 2EVBA 3R3OA 2EXDA 2PQAA 1RD9D 2X69A 3UDIA 2Q8RE 1S3OA 3CQZB 5J39A 1N9WA 1ZEQX 5M3MB 3CU7A 2NZ1D 1XPOA 1EL0A 3HOZG 1SRUA 3H91A 5EBCA 3BDCA 2B2VA 2HD3A 3PMFA 4RGMA 1TS4A 1BKBA 2OQKA 4A3LH 4A3JH 3S2DB 1WI5A 2BCOA 4IURA 2PYKA 3TZUA 3KLRA 3MXNB 5M3FB 4JI0Q 2F0VA 3PIO3 3AFPA 4QIWE 3W2DA 1EY7A 3M7NA 1PFNA 1ICFB 1B2TA 3KLSA 1SMYD 2PI2E 2WAQE 3K5OA 2PMZE 3KK7A 4BWGB 3HOWG 3MZ5A 1PVOA 1T9HA 1STGA 1B53A 1ENFA 1L0YB 2HHHL 2JA7B 1GVPA 3DWAA 3QWNA 3J81i 3F2UA 1PYWD 1EZ6A 2Z6KA 3PQIA 1WTHA 2L4NA 4K8JA 3S9WA 3PO2G 2N8NA 3V05A 2QGQA 3GTGB 1UE7A 2ZM6L 5FO9B 2L1BA 2EJMA 4RHRA 1E2WA 3RLOA 3AEVA 1LT5D 1PHJA 3T1YL 1CI3M 1UE1A 3S1QB 2QILA 4EVOA 5ELOA 5IYCH 4GN4B 3ZYYX 4BY7H 1L2FA 4UHVA 4XQJA 1IYUA 1CKNA 5L37A 3F8TA 2CH4W 2EYFA 4LF6L 2IW3A 1ESRA 3PIPA 1G91A 2CH4A 4HSVA 1B1ZA 1OXTA 3GTQH 4K14A 5C4JH 2XWJB 4IALA 2K5WA 4E6IA 3MWYW 1XJVA 2L15A 3M4OH 1JC7A 1SDFA 5C3EG 1V1OA 3PUZA 2K28A 4DV7L 4AYBG 1HXYD 2BA1A 2Q8TA 4TRDA 1OXSC 1PTOH 1XNRL 4X66L 5BN5A 1K0SA 4B9WA 4JI8Q 2NBFA 3K5NA 1CQVA 4JCVE 1PH9A 2NTTA 3K5LA 1SNDA 2F52A 1X65A 2ICEC 2E2JB 4ZQ3A 3A7LA 3I55A 4OGQC 1HUNA 4OEMB 1LTGD 1VS0A 2WIIB 1BCPC 3EN2A 5C5MA 3AFQA 1H9SB 5JEAJ 4KHPL 2QKIC 1OTCA 1ESFA 5JJIA 2B2TC 4CJ1B 2JA8H 2E76C 2HDLA 3JAMc 5KYLA 1JWMD 2KQ3A 4X65L 4LF5L 2RDHA 4DR7L 2NVYB 5IGDA 1IYVA 4O0AA 2VUMB 1JE5A 1NY4A 4KMUC 1HZ9A 1K8GA 4YY3L 3EQLC 4AIMA 4KV6A 1A3TA 1CKMA 3E5SA 3HOZH 2GA4B 3NP8A 1NMGA 5D3IB 5M3MG 1G2SA 1Z47A 3HRZC 3L9AX 4QJFA 3OIPA 1M8AA 2AMCB 1NR4A 4LWCA 2F0KA 3FRPB 5CR3A 4XQQA 2I0QA 4DXGA 2B2YA 4R9WA 3PV0A 4ZLTF 1Q7YC 4ZUJA 3A56A 1KNEA 5GAEC 1VQJA 1XMOL 4BXXG 1TQOA 5M3FG 5M5WB 4JV5Q 1HNXL 3S17H 1TKWB 4GLAC 3GTPB 1VQ6A 2FJ2A 3HOWH 4A93H 2F3WA 2CW0D 1AE2A 3MXNA 1W2BA 2SDFA 3A74A 4POGA 1UWVA 2E2IH 5GADC 3MC0B 3GP7A 3TS2A 1H9JA 3CW2C 3S24A 3MFYA 2JA7G 1D1KA 1MSGA 3PO2H 3BVMA 3J7AF 3J81c 1F2MA 1N8RC 2VQFL 4TQUS 4DR3Q 1YJ9A 1AFPA 1X3QA 2Q8IB 4J8QA 3T53B 1ZYRC 5I6YA 5IIFA 2O2LD 1VCIA 3RLNA 3A8JE 1EEFD 1KL9A 1EIGA 3VYSA 3K59A 3MA2B 2IX1A 4P73A 2F0FA 4K2LA 3SK5A 2OXPA 1TWAB 4AQYQ 3S15B 5JAVA 5C3EH 4P75A 5FLXc 1V1QA 1GJXA 1FNVA 1B9NA 1XWEA 3OTOQ 1QZHA 1EY6A 4KN7C 2L55A 4MTKA 1HFNA 2F0UA 5I4DA 1MHWC 1QOHA 3HOYG 3KJPA 2XRSD 1YJWA 2ZTEA 1OXUA 1JJCB 3NE5B 4HCEA 2NVQH 3CCJA 3CRLC 1Q86C 2MPMA 4DAPA 5A2QE 1Y8PB 2M2LA 5HGQA 4O1NA 3CKIB 4DAVA 2Q2IA 4DPGA 5LMUL 1WCMH 1K8AC 2R7ZB 1NNXA 1IZ6A 1HZCA 1LTID 4V0BA 4LAAA 2DNEA 4XT1B 2XIWA 4DGZA 1EZ8A 2O4XA 2JP1A 3DM3A 1EU3A 4JC0A 3C1FA 2B2WC 3AYHB 3KUPA 3NBHB 3GTKB 1AH9A 1F2ZA 1H9SA 3VR5A 1SFOB 3UDFA 4DR5L 4CDCC 2A6ED 4IN3A 5FOBB 2J4XA 3H3VH 5HGTA 4KKSA 2EY2A 2VUMG 3LX0A 4P71A 3CQZH 3OMGA 1RODA 4A3KB 1VQMA 3DEOA 4DV2L 4CJ0B 2B3GA 3D3RA 1QVGA 4FF2A 1QCBD 3B6YA 5HURA 1O80A 3TMEA 3X3MA 3HG9A 1N34L 4R8IA 4K6LA 2YTVA 3PSIA 4RGOS 3S2DH 1A3VA 4DR4L 4DV5Q 4BXXH 3QJYA 2OWOA 3BVGA 5M3FH 5M9OA 1LTTD 5CV8A 1AE3A 1PTOF 1X55A 3CHBD 4C3IB 2ALYB 4LF4L 1TS2A 3MHBA 3RD4A 1T5EA 4TVAB 4PNYA 1NTGA 3HP3A 3NUCA 4QF4A 2EOTA 2JA7H 5T1IA 3D4DA 4KY5A 1SNQA 2F0GA 2KUMA 1Y1VB 1CT1D 2HQLA 1R9TB 4FXDA 3GD7A 2F1MA 3G4SA 1Q3LA 5CV7A 4TSSA 4ZYSA 1IBML 3GTGH 4N8FA 3TS0A 1D5XC 3CXCA 1H9MA 5IYBG 1SE3A 3MEFA 2LFNA 2SEBD 2CFMA 1LTSD 4DKAC 4QY7A 1V43A 3MAQA 4A75A 1S5BD 2FFKB 4MZ9A 1PLFA 2K1BA 3T4AC 3F2CA 2QEJC 4DR6L 2ID0A 3S1QH 5ISRA 4PG3A 4MTNA 2HIXA 2MO1A 3DHQA 2UUCQ 2UU9Q 2NVTB 1I94L 2NWGA 3J80L 5JEAG 3GTLB 3TN2A 4GZYC 4C56C 3C3LA 1EWHA 1JCKB 1FR3A 4KY7A 4YHHQ 1TWGB 2UXDL 1XMQL 3H6MA 1F77A 2QCPX 1E1OA 2MP1A 1VQHA 1XNQL 5I9PA 1GUSA 5KNBA 3HKZB 4B3ML 3SK8A 4DK0A 3CCEA 1HFGA 1P8LA 5H1SE 4AH6A 5IGFA 1G2TA 4IUTA 2PNHA 5EBDA 3J7YW 3PIP3 4CGYB 4UY8C 3Q22A 2E2JH 1PFBA 2P5ZX 3E0JA 1F9RA 3MXUA 3I4NB 3D8GA 2RCNA 3D4RA 4A3CG 3U9SA 3TP5A 1HA5A 5K5PA 3LGJA 1FD7D 3X3NA 3MEHA 1ASYA 4A4IA 2KEEA 1PH8A 4IZ8A 1HNZL 1BCPB 3KBGA 1SEBD 2Z8LA 5IY0A 4LNQA 1CHPD 2NVYH 5C3XA 1EY8A 2VUMH 3QG1A 3NBHA 3CF5A 1HR0Q 2D0OA 1YHBA 2WFWA 3NHHA 2HHHQ 3I56A 1TR5A 2K5VA 4YWMA 1E24A 4A3KG 1KIXA 4YIJA 1EFWA 4IO9A 1SYGA 4CDFC 1O7LA 1M4VA 4ABNA 5EQ0A 5LHY1 1AP0A 1K3BC 4I65A 4B3SL 3OHXC 1YNNC 2SOBA 4JVZA 1Y14B 1HQRD 3IKJA 4BBRB 4YCVA 4JI3L 5M5WH 2PW5A 3DWPA 3GTPH 1IYJB 4YWLA 4C2MB 2K03A 1XPRA 4MN3A 2K14A 3J80i 4R4TA 3KLSX 1DM0B 4QIWB 4IQZA 4YCWA 2F0HA 2EZVA 1IW7D 1KQSA 3ERSX 2WAQB 4UDUC 4LF6Q 2X6GA 1X6OA 4DUYL 1ONLA 3KLWA 1LT4D
chains in the Genus database with same CATH topology
1GUOA 5CBAE 1EOTA 2XVSA 5D14A 1A6XA 2XRQD 4XYQA 3NTKA 4G7HC 5KIXA 3OWFA 2VB2X 1T5XD 2HUGA 4NP5A 2DY7A 1BCPD 1KTKA 3M7GA 4X3TA 2Z1CA 3OIQA 4K2KA 1PFMA 2RDFA 1QG7A 2NB0A 3G7LA 5JEAH 1XX8A 3V2TA 1BBXC 4FVMA 3BDOA 2QDBA 2ENBA 1WTQA 1Y1WB 3ITPA 3D6WA 1WTWA 4PMWA 4L63B 1PRTB 5CYUA 5EKKA 2YYZA 1BO0A 4CKCA 2Y0SB 4KJOA 2K6AA 1UEAB 1HRJA 3QO2A 5FLXL 1QNKA 2PPBC 1WTVA 1H9KA 3N6RA 1XXGA 4ZAIA 2RBMA 4XT3B 1RKNA 2LMCB 1EY4A 4CKEA 4HN7A 4KD3A 4ID6A 4RHSA 1DYQA 3LWUA 2PQEA 2OF1A 4O42A 5JVH3 1UAPA 1SBBB 1DD2A 1VF7A 1MD2D 3EA6A 2EJFC 2B2TA 1JE4A 1Q8IA 3FDTA 4RGNA 5F2DA 5C4XB 1RTOA 4H13C 1JOQA 5C3WA 1ZYRD 2KECA 5JPNC 5CGKA 2ZXOA 2K5DA 1ENCA 5G3LD 3A8IE 1DZ1A 3SK6A 1R4QB 4NMZA 1MI2A 5C0XH 4X3UA 1PRTD 2OT2A 4RGTA 1B44D 2YU9B 2LY7A 1SYFA 4S3SA 1DOKA 1LTRD 3AB9A 3K0YA 2AQ2B 1SJHD 3DXJC 3HOUB 3TZDA 5ELFA 1CHQD 4ZRZA 2ZXRA 3ERQA 4KKTA 3P1HA 4A3BB 3DWQA 1CM9A 1KLGD 2PZUA 5A2QL 4RH6A 1NUCA 5M5XB 5M5YB 4DF7A 2MHVA 1W6JA 2J0TD 2F0MA 3OOCA 5FO7B 3BVZA 4HTHA 5IGGA 5CMDA 2K32A 2NTSA 1SSOA 3HOYB 1HQMC 1PTOC 3SXHA 2BE5C 3FVQA 3NBIA 3R2TA 2IX0A 2L5TA 4IFDI 3VYUA 2F0SA 4OIKA 2F0WA 2F03A 1WVLA 1F2LA 3H0GB 3QIAA 3OW7A 2IL8A 3SR1A 4NKLA 3L3OC 1CA5A 4RWSC 4R8NA 2RA4A 3I72A 3GTOB 5FKAC 4N9PA 4DN4M 4EQOA 4H7BA 1ZXTA 4ZKBB 3Q6SA 1S5FD 1O78A 3OMCA 2KCCA 1IHZA 4M8AA 3Q0AA 2MGSA 5EPLA 3VR6A 1WTRA 2F0IA 2E2HB 3NTIA 1HUMA 4F88A 4RA8A 1AZPA 4HMJA 1I6VC 3J7AV 1CQFA 1EEID 2I46A 1RF2D 2K33A 1PXUA 5NUCA 3QOLA 1E0BA 5J22A 3MXGA 4PQXA 1GXDC 4WJWA 2K5QA 4BA2I 3PUXA 4XYOA 2B2WA 3R8BA 1EYCA 1CTMA 1A3UA 2B8GA 4FYDA 1EYDA 3WOEA 4C3HB 3IFTA 4OO1I 2F0JA 2PZTA 1FGBD 4ZUIA 1EIHA 3HGBA 3WDNA 1QWYA 3GV3A 1VF5C 5D65A 2IT1A 2XSCA 5C4HA 3HOXB 1S4ZA 4G57A 3K5MA 5A35A 5EKIA 3FPPA 3A7AB 2DNCA 1QB5D 2F0TA 1I4HA 1Y69U 1BXTA 1D6EC 5BN4A 2K7VA 3U9OA 3AU7A 4LJZC 4XTCS 1E2ZA 1TY0A 2OEOA 3M85A 3K58A 5DAUA 2EYLA 5COYA 4OL7A 1I4RA 5E4WC 3S1MB 3IL8A 1O7YA 1PZKD 2F0PA 1F2YA 3AMUA 3NQIA 1TS3A 2RQXA 5KNCA 3P75A 2R6GA 3GTJB 1J9OA 4PMBA 3GTMB 1YNJD 4QUFA 2PO4A 1GUGA 3GO5A 4IUQA 1NSNS 2XN9C 5IT9E 2D5DA 4WRDA 2FMMA 2H4OA 2EY1A 2V4DA 1YNND 4HAEA 1JOKA 2K01A 4QCLA 2B39A 4Q0FA 1STEA 1BOSA 3VR4A 1BR9A 2RSOA 3N52A 5EJWA 4EGVA 5IOCA 4RCNA 2ICIA 3TP6A 1D5MC 1WTPA 2A69D 3MTSA 3BZDB 4FF3A 4RKLA 3I8ZA 3IFDA 5CV9A 3IAYA 3MFGA 5EPKA 2PZWA 3KF8A 1H9RA 1XYIA 1EYAA 1ILPA 5C0XI 4C3HG 5I2XA 5KGUA 2RVLA 1TU2B 4ME5A 1EU4A 1ZKOA 1BQQT 5C44B 1I3QB 4FNFA 2B63B 1Q12A 1SYCA 4IUNA 1SYBA 5ELDA 5LL6X 4J6HA 1AEXA 5DNFA 1F9SA 2ZXPA 1BCPF 2NN6G 4J1MA 5JVG3 1XTCD 1BF4A 2J7ZA 4KHVA 4A3DB 2E2DC 3SE0A 1GUWA 1RDPD 2JE6I 1LABA 4BY1B 2NYZD 4B08A 3KBXA 5KEEA 3I73A 4KTAA 1VMPA 1D5ZC 4U673 5K36G 4HEDA 3PUYA 1FNWA 3DEPA 2RDGA 3TP8A 1I4GA 3BYYB 1F9QA 1EQVA 2D9UA 2K04A 3LNNA 1EWCA 1GUTA 4NDXA 1JICA 1AW7A 3VYRA 2M00A 4CJ2C 3RZDB 1WTXA 2O5JC 1C8CA 4N9TA 1U4PA 1JQYD 4WORA 2BOSA 2E75C 2R93B 4PMCA 3RUZA 3M3YB 5I6WA 5AFWA 1V8QA 3V96A 2PNRC 4XDXA 1SE4A 3NPPA 4L8JA 1SJED 2D62A 3NSWA 3HOVB 3BDLA 3C1EA 4FF4A 4RKBA 3OSOA 5DM63 3CRKC 2KVMA 4CBVA 2A68C 3S14B 2F0QA 1TT2A 1DOMA 5CV4A 5JPMC 2HDMA 4FO2A 3QOJA 4XXEA 3OPOA 4JBWA 3G6JB 1SYEA 1PZJD 1HHVA 4X3SA 2JXMB 5G3LF 2BDOA 1GHKA 3A55A 3SHLA 1BNZA 4DXFA 2NVXB 2A73B 1GHJA 1PRTF 4KHZA 1TS5A 2M9VA 1U4RA 1B3AA 1S5CD 1Y8NB 2JA6B 1CFMA 2BE5D 2L11A 1LT3D 2TSSA 3QB3A 2F0OA 5LL6S 5CV5A 2RSNA 3FEWX 2KEDA 2NN6H 1LTBD 2O5IC 3I3CA 1OXXK 4U68A 2EYMA 1CA6A 1G291 2CQAA 1FYCA 4G7ZC 2B2UC 3NWSA 1JOOA 1E2VA 3P20A 5IODA 1B4OA 2KHSA 1ENAA 4A3GB 1LT6D 2AQ1B 5K36H 1QJOA 3NXWA 5CV6A 4HCSA 5D3DA 2BA0A 3S1RB 3D31A 2JA5B 5E4XA 4A3MB 1STBA 1LACA 3PO3B 3C2PA 2FMCA 4XIGS 1STAA 1JB3A 2ZT9C 3K6OA 4I7ZC 1LO5D 3WOFA 2EDGA 3VA5A 1DCZA 2G9DA 4MHEA 3TP7A 1LV9A 4FF1A 2EPBA 3TSSA 1KABA 1CK1A 1RHPA 1HTPA 2Z4HA 5E1FA 3H09A 1EFID 4IFDJ 2L0CA 1X32A 1U9RA 4RAUC 2XNAC 3OWEB 2F0NA 2HQEA 2AQ3B 3URYA 2I07B 3T16A 3TDQA 3C46A 2HCIA 4KD4A 1IKMA 1G6ZA 2WP8J 1BUVT 4K5WA 3T56B 1DXMA 3M4YA 1U4LA 2KA7A 1DJRD 1PDQA 1STHA 5KRUA 3A54A 4Q5VA 4PV1C 5E3FA 1I4PA 5I2YA 1TIID 3S2HB 5I9OA 4C3JB 3JAME 1TWHB 5IT9L 2JYOA 2KCNA 3NK9A 1I50B 5EGTA 4F7XA 4A3FB 2EYPA 3EFXD 3SDZA 1KDCA 4X3KA 2EYHA 1IL8A 1SNPA 5C5LA 3RZOB 3L7ZC 1ET6A 1HTLD 3SK4A 4FP5D 1IW7C 3PUWA 1SNCA 2EYOA 2XWBB 3I70A 4KKUA 2A74C 1S5DD 4IUVA 1CZWA 3NQTA 2EYJA 1WD0A 4CHTB 3K57A 1K8MA 3S16B 1NCVA 5EPJA 4UAIA 3TBIB 1JR0D 3Q23A 2WINB 5JOBA 3DUZA 3NTHA 2LS01 2AUKA 1KNAA 3D4WA 3Q24A 1QNUA 2EY5A 3BYTB 2JEBI 2FHTA 2R92B 5IGEA 3J81E 2B2VC 3RMHA 4BA1I 4DNRB 2MUYA 1A2UA 5FK9C 1SNMA 4CKBA 2A6HC 4ODGA 5BN3A 4BBSB 1VDZA 2TMPA 4K6DA 1A2TA 1UNSA 1RTNA 1Y8OB 4JK1C 4IUPA 4A3EB 1LLRD 3O13A 1MGSA 4Y7NB 3VR2A 2HCCA 1TY2A 3LWEA 4OHJA 1J8IA 1TWCB 5FLXE 2QF7A 1QE6A 1MSHA 3S1NB 1EY9A 2R3ZA 2A5HA 3I4MB 1O7ZA 4FXKC 1TWFB 1SNOA 2Z4IA 5EKLA 4KY6A 1II3A 1D1IA 1U4MA 2R61A 4A3IB 5TSSA 2CVRA 2NN6I 3SVMA 3I4LA 1GUNA 3ND9A 1I6HB 4KK7A 2F0DA 4G7OC 2SNMA 4C3JG 3E6ZX 4HR7B 4Z9CB 2L9HA 1A15A 5ELEA 4NW2A 4RFBA 1SMYC 3FPUB 3K7AB 1HPCA 1VMCA 3P7JA 2KOLA 5C0XJ 1PRTC 1G8ZD 3DM1A 2A68D 1DOLA 2FINB 4DNTB 4QMGA 5ELBA 1HCZA 1JWSD 5T1GA 3VYTA 1B50A 4IFDG 3FKIB 1WTOA 3I91A 1V1PB 2JSOA 3BG3A 1ML0D 3VR3A 3H3VC 1EY5A 3T51B 2JEAI 4K5VA 1K83B 2IJ0A 2WACA 2B2YC 4F87A 4ILWA 1S5ED 3R93A 4QB4A 2C5CA 4TKOB 4B9XA 2D2CC 1Z7TA 1C4QA 2EE1A 2AUJD 4H44C 1X3PA 1IKLA 4LK1C 1R4PB 4A3JB 1SYDA 1D2BA 4ZKCB 1RCVD 2AWNA 4G4KA 2N55A 1I4XA 2PCFB 3SEBA 2WV6D 1TVXA 4OO1G 4LMQD 2F0LA 4DFAA 1MBYA 1PMRA 1Q1EA 3GV6A 3H94A 2RKSA 4XQNA 5KYIA 3VA7A 1STNA 2WKCA 1Q90A 1SXTA 3ND8A 2K05A 1JORA 1EY0A 1HA6A 4V190 5J1ZA 4C1NK 3EJIA 4P2CB 1ICWA 4KI0A 4BY7B 1ET9A 3EVQA 2VB3X 3GQBA 2WB1B 2VNUD 2CW0C 3RLFA 3GTQB 4DAYA 3DMUA 5C4JB 5DM73 3M4OB 4ULLA 5JJZA 3NWTA 4F8MA 4KN4C 1PTOB 4MIUA 2F3VA 2B2UA 3R2IA 4HMIA 4IFDH 4DU9A 4FXGC 1SAPA 5IGCA 5CBEE 1PZID 2H1EA 2CHBD 3MVVA 2JA8B 1KDAA 1K8OA 4DA2A 3HEJA 1KDBA 4BS9A 1V1PA 4IUUA 1OO9B 1BDOA 1C48A 5C6AA 2F0EA 1L0XB 2LKVA 1I4QA 2E74C 2MJ8A 3HOZB 2DY8A 2C9OA 1EQTA 1YNJC 3UI2A 1RJTA 1NAPA 5IGBA 3JAML 2X6LA 2WKDA 4RCOA 3S17B 1ILQA 5DEHA 3HOWB 4A93B 2VXWA 5FO8B 1FNUA 2DN8A 1GOZA 1PTOD 2E2IB 4C3IG 2A6EC 5C4ZA 1STYA 4OO1H 4K8IA 5C0XG 3PO2B 2EJGC 4HSPA 1Z6HA 2EXZA 2PMZB 1KLUD 4C1NI 4ZK9B 1DONA 1LTAD 2A69C 4QUCA 1AN8A 3I90A 3D6CA 2NUCA 5KNDA 1B9MA 4EQNA 2N88A 3EROA 2KJXA 1SE2A 1OXVA 2AWOA 1CZGA 5CORA 1UUPA 4H0LC 3T13A 1AZQA 5ELCA 1Q1BA 3BS1A 1F9PA 3MXPA 2B8FA 3J81L 2IPKD 5C3EB 1JWUD 2F4IA 4AYBB 1NR2A 4WFN3 4K5XA 1WD1A 2A6HD 4OIJA 4EQPA 2BDNA 3FMCA 2NVQB 3W3AA 4DK1A 2EY6A 3HZXA 1KAAA 1WCMB 4L6TB 3HS0C 3J80E 2PW7A 2G9HD 3ONAB 2IWHA 2L12A 2SNSA 2IX3A 1W6KA 3A8KE 3PUVA 4KJNA 1QILA 5CC4A 4M1UB 2EVBA 3R3OA 1RD9D 2X69A 2Q8RE 3CQZB 5J39A 1ZEQX 5M3MB 3CU7A 2NZ1D 1EL0A 3H91A 5EBCA 3BDCA 2B2VA 3PMFA 4RGMA 1TS4A 3S2DB 2BCOA 4IURA 2PYKA 3TZUA 3KLRA 5M3FB 2F0VA 3PIO3 3M7NA 3W2DA 1EY7A 1PFNA 1B2TA 3KLSA 1SMYD 3K5OA 3KK7A 4BWGB 3MZ5A 1STGA 1B53A 1ENFA 1L0YB 2JA7B 3DWAA 3QWNA 3F2UA 1PYWD 1EZ6A 2L4NA 4K8JA 3S9WA 3V05A 3GTGB 5FO9B 2L1BA 2EJMA 4RHRA 1E2WA 1LT5D 1CI3M 3S1QB 2QILA 4EVOA 3ZYYX 4XQJA 1IYUA 2EYFA 2IW3A 1ESRA 1G91A 4HSVA 1B1ZA 1OXTA 4K14A 2XWJB 4IALA 2K5WA 4E6IA 3MWYW 1JC7A 1SDFA 1V1OA 3PUZA 2K28A 1HXYD 2BA1A 2Q8TA 4TRDA 1OXSC 1PTOH 5BN5A 4B9WA 2NBFA 3K5NA 1CQVA 2NTTA 3K5LA 1SNDA 2ICEC 2E2JB 4ZQ3A 3A7LA 4OGQC 1HUNA 1LTGD 2WIIB 1BCPC 5C5MA 1H9SB 5JEAJ 2QKIC 1ESFA 2B2TC 4CJ1B 2E76C 2HDLA 5KYLA 1JWMD 2KQ3A 2RDHA 2NVYB 5IGDA 1IYVA 2VUMB 4KMUC 3EQLC 4KV6A 1A3TA 3E5SA 2GA4B 3NP8A 5D3IB 1G2SA 1Z47A 3HRZC 3L9AX 3OIPA 1M8AA 1NR4A 2F0KA 3FRPB 5CR3A 4XQQA 4DXGA 2B2YA 4R9WA 3PV0A 4ZLTF 4ZUJA 3A56A 1KNEA 1TQOA 5M5WB 1TKWB 3GTPB 2FJ2A 2F3WA 2CW0D 3MXNA 2SDFA 3MC0B 3GP7A 1H9JA 3MFYA 1D1KA 1MSGA 3BVMA 3J7AF 1F2MA 4TQUS 1AFPA 1X3QA 2Q8IB 4J8QA 3T53B 1ZYRC 5I6YA 5IIFA 2O2LD 1VCIA 3A8JE 1EEFD 1EIGA 3VYSA 3K59A 3MA2B 2IX1A 2F0FA 4K2LA 3SK5A 2OXPA 1TWAB 3S15B 5JAVA 1GJXA 1FNVA 1B9NA 1XWEA 1EY6A 4KN7C 2L55A 1HFNA 2F0UA 5I4DA 1QOHA 2XRSD 1OXUA 3NE5B 4HCEA 3CRLC 2MPMA 4DAPA 5A2QE 1Y8PB 2M2LA 4O1NA 3CKIB 4DAVA 1LTID 4V0BA 4LAAA 2DNEA 4XT1B 2XIWA 4DGZA 1EZ8A 2O4XA 2JP1A 1EU3A 3C1FA 2B2WC 3KUPA 3GTKB 1F2ZA 1H9SA 3VR5A 1SFOB 2A6ED 4IN3A 5FOBB 2J4XA 5HGTA 4KKSA 2EY2A 3LX0A 3OMGA 1RODA 4A3KB 3DEOA 4CJ0B 3D3RA 4FF2A 1QCBD 5HURA 1O80A 3TMEA 3X3MA 3HG9A 4R8IA 4K6LA 4RGOS 1A3VA 3QJYA 3BVGA 5M9OA 1LTTD 5CV8A 1PTOF 3CHBD 4C3IB 1TS2A 3MHBA 3RD4A 1T5EA 4PNYA 3HP3A 3NUCA 4QF4A 2EOTA 5T1IA 3D4DA 4KY5A 1SNQA 2F0GA 2KUMA 1Y1VB 1CT1D 1R9TB 4FXDA 3GD7A 2F1MA 1Q3LA 5CV7A 4TSSA 4ZYSA 1D5XC 1H9MA 1SE3A 2LFNA 2SEBD 1LTSD 1V43A 3MAQA 1S5BD 2FFKB 1PLFA 2K1BA 3T4AC 2QEJC 2ID0A 5ISRA 2NVTB 3DHQA 2NWGA 3J80L 5JEAG 3GTLB 3TN2A 4GZYC 4C56C 3C3LA 1EWHA 1JCKB 1FR3A 4KY7A 1TWGB 3H6MA 1F77A 2QCPX 2MP1A 5I9PA 1GUSA 5KNBA 3HKZB 3SK8A 4DK0A 1HFGA 5IGFA 1G2TA 4IUTA 5EBDA 3J7YW 3PIP3 4CGYB 3Q22A 1PFBA 3E0JA 3MXUA 1F9RA 3I4NB 3D8GA 3D4RA 3U9SA 3TP5A 1HA5A 5K5PA 1FD7D 3X3NA 3MEHA 2KEEA 4IZ8A 1BCPB 3KBGA 1SEBD 2Z8LA 1CHPD 5C3XA 1EY8A 3QG1A 3NBHA 3NHHA 1TR5A 4YIJA 1SYGA 1O7LA 1M4VA 4ABNA 5EQ0A 5LHY1 1AP0A 4I65A 3OHXC 1YNNC 2SOBA 1HQRD 3IKJA 4BBRB 2PW5A 3DWPA 4C2MB 2K03A 4MN3A 4QIWB 3KLSX 1DM0B 4IQZA 2EZVA 2F0HA 1IW7D 2WAQB 4UDUC 2X6GA 1ONLA 2R7ZB 1LT4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 I;  1GUO A;  4H13 C;  2JXM B;  4LK1 C;  3I4L A;  2BDO A;  3VR6 A;  1DCZ A;  1GHK A;  3PV0 A;  1K8O A;  1GUN A;  1IW7 C;  1GUS A;  2EJM A;  3ND9 A;  5KNB A;  5KNC A;  1A6X A;  3PUW A;  1E2W A;  1GHJ A;  1H9S A;  2A6H D;  2NN6 G;  2R6G A;  3VR5 A;  4G7H C;  4G7O C;  4KKU A;  4DK0 A;  1BDO A;  2A6E D;  1TKW B;  3A8I E;  1I6V C;  3FMC A;  1GUG A;  4KHZ A;  3W3A A;  3SE0 A;  4DK1 A;  4KKS A;  1CI3 M;  1HTP A;  5C0X H;  4HR7 B;  2JE6 I;  1K8M A;  1LAB A;  2D5D A;  2E74 C;  2K33 A;  2PCF B;  5JEA H;  1Y8N B;  1SMY C;  3MXU A;  1IYU A;  3I73 A;  1H9J A;  1CFM A;  2BE5 D;  2V4D A;  2AUK A;  3D4R A;  4OO1 G;  1YNJ C;  3MFY A;  4BA2 I;  3AB9 A;  1OXT A;  3PUX A;  3U9S A;  1HPC A;  1PMR A;  1Q1E A;  3DXJ C;  5K36 G;  3BDO A;  2JEB I;  3H94 A;  3PUY A;  4TQU S;  2NN6 H;  1CTM A;  3VA7 A;  3PUZ A;  3QJY A;  2B8G A;  3VR4 A;  2O5I C;  2A68 D;  1Q90 A;  3A8K E;  4KKT A;  2BA1 A;  3ND8 A;  1OXX K;  3PUV A;  3LNN A;  4DNT B;  1OXS C;  4BA1 I;  4DNR B;  1HCZ A;  1GUT A;  3IFT A;  2YYZ A;  2EVB A;  2Q8I B;  5BN5 A;  3T53 B;  1ZYR C;  3HGB A;  1G29 1;  4RCN A;  3QG1 A;  2DN8 A;  3WDN A;  2A6H C;  5BN3 A;  2A69 D;  4KI0 A;  1FYC A;  1VCI A;  1T5E A;  4G7Z C;  1VDZ A;  3A8J E;  1VF5 C;  4IFD G;  1E2V A;  2A6E C;  2IT1 A;  1DXM A;  3A7L A;  3GQB A;  3M4Y A;  3P20 A;  3T56 B;  2KA7 A;  4OGQ C;  4OO1 H;  2O5J C;  3OOC A;  2CW0 C;  5C0X G;  1H9S B;  2PPB C;  3RLF A;  5K36 H;  1O7L A;  2E75 C;  2EJG C;  1Z6H A;  1H9K A;  1QJO A;  3BG3 A;  3GD7 A;  1Y8O B;  3N6R A;  4JK1 C;  2F1M A;  3VR3 A;  2K32 A;  5A35 A;  4PV1 C;  2BA0 A;  1V8Q A;  3FPP A;  3D31 A;  3A7A B;  1GJX A;  1HQM C;  2A69 C;  2DNC A;  2PNR C;  2BE5 C;  2LMC B;  2E76 C;  3T51 B;  1B9N A;  2JEA I;  1YNN C;  3VR2 A;  3TZU A;  1H9R A;  3KLR A;  2L5T A;  1Y69 U;  4KN7 C;  4KN4 C;  4L8J A;  2D62 A;  1H9M A;  2QF7 A;  3M7N A;  3IKJ A;  5KND A;  3LWU A;  3QIA A;  5BN4 A;  1B9M A;  2K7V A;  1LAC A;  1V43 A;  3OW7 A;  1IYV A;  1OXU A;  3CRK C;  4XTC S;  4LJZ C;  3NE5 B;  1OXV A;  4KMU C;  2A68 C;  2AWO A;  4XIG S;  3CRL C;  3EQL C;  4IFD H;  1E2Z A;  3I72 A;  4IQZ A;  4TKO B;  2ZT9 C;  1Y8P B;  3SDZ A;  1IW7 D;  1TU2 B;  2D2C C;  1DD2 A;  1Z7T A;  1VF7 A;  4H0L C;  3M85 A;  5JEA G;  1ZKO A;  4GZY C;  2EJF C;  1EWH A;  3OPO A;  2AUJ D;  1Q1B A;  1O78 A;  4I7Z C;  1FR3 A;  3L7Z C;  4H44 C;  1ONL A;  4JBW A;  2KCC A;  2B8F A;  2DNE A;  1Q12 A;  2EDG A; 
#chains in the Genus database with same CATH topology
 2GVA A;  1Y1V G;  1GUO A;  5CBA E;  1EOT A;  3F1Z A;  2XVS A;  4JI6 L;  1KC8 C;  5D14 A;  2N78 A;  1VQ5 A;  1A6X A;  5IYB H;  2XRQ D;  1L1O C;  4B3T L;  4XYQ A;  3NTK A;  4G7H C;  5KIX A;  1XNR Q;  3OWF A;  1KRS A;  2VB2 X;  1SRO A;  3K8A A;  2EQS A;  1S40 A;  1T5X D;  2HUG A;  3CPF A;  4NP5 A;  2DY7 A;  1BCP D;  1KTK A;  3M7G A;  4X3T A;  2Z1C A;  3OIQ A;  4K2K A;  1PFM A;  1E7Z A;  2RDF A;  4B3R L;  1QG7 A;  2NB0 A;  1CSP A;  3G7L A;  5JEA H;  3KJO A;  1XX8 A;  4OWT B;  1NE3 A;  3HKZ E;  4X64 L;  3E9I A;  1QZG A;  2HT1 A;  3V2T A;  1BBX C;  4Y52 H;  2UXC L;  4FVM A;  1TWA H;  3BDO A;  3S15 H;  2YV5 A;  2QDB A;  2ENB A;  1MJE A;  1WTQ A;  1VQK A;  1Y1W B;  3ITP A;  2JJQ A;  3D6W A;  1WTW A;  4PMW A;  4L63 B;  2E5L L;  1VQ4 A;  1PRT B;  5CYU A;  1KAW A;  3HKZ G;  5EKK A;  2YYZ A;  4GOP C;  1BO0 A;  3IRB A;  1WYD A;  1SR3 A;  4P72 A;  1YIT A;  4CKC A;  2Y0S B;  4KJO A;  2K6A A;  1GKH A;  1UEA B;  3CME A;  1HRJ A;  3QO2 A;  4A3C H;  5FLX L;  3I4N G;  1QNK A;  2UUA L;  1KRT A;  2PPB C;  1WTV A;  1X3G A;  1H9K A;  3N6R A;  1XXG A;  4ZAI A;  4LFA L;  2RBM A;  4XT3 B;  2G5D A;  1FJG L;  1LTL A;  1RKN A;  3EBE A;  2LMC B;  4EQ5 A;  1EY4 A;  4CKE A;  4HN7 A;  4KD3 A;  4ID6 A;  1XMO Q;  3GTK H;  4RHS A;  1SFO H;  1DYQ A;  3LWU A;  2PQE A;  2OF1 A;  4O42 A;  4GKJ Q;  5JVH 3;  1UAP A;  1SBB B;  1DD2 A;  1NBW A;  1VF7 A;  4A3K H;  4ALP A;  1MD2 D;  3EA6 A;  2EJF C;  1QVF A;  2B2T A;  3TRZ A;  1JE4 A;  1Q8I A;  4HJ5 A;  3FDT A;  4RGN A;  5F2D A;  5C4X B;  1RTO A;  4H13 C;  1JOQ A;  2VQF Q;  3STB C;  5C3W A;  1ZYR D;  2KEC A;  4LF9 L;  5JPN C;  5CGK A;  2ZXO A;  2K5D A;  1ENC A;  3CCU A;  4FDB A;  4C3I H;  5G3L D;  3A8I E;  5GQO A;  2VQE Q;  3HFZ B;  1VQA A;  4BBR G;  1DZ1 A;  3SK6 A;  2KHJ A;  1R4Q B;  2VZA A;  5E7N A;  4NMZ A;  1MI2 A;  5C0X H;  4X3U A;  1PRT D;  2OT2 A;  4RGT A;  1B44 D;  3U50 C;  1BBU A;  3J80 c;  2YU9 B;  2LY7 A;  2WAQ G;  2ZTC A;  1SYF A;  4L5T A;  1VQ7 A;  1DOK A;  1LTR D;  4S3S A;  3AB9 A;  1Y1V H;  3K0Y A;  2AQ2 B;  1SJH D;  3DXJ C;  1R9T H;  3HOU B;  3TZD A;  4CDD C;  2PI2 A;  2R7Z G;  4RG1 A;  5ELF A;  4IPG A;  1M90 C;  1CHQ D;  4ZRZ A;  2ZXR A;  3ERQ A;  4KKT A;  4JI2 L;  1YZ6 A;  4LF7 L;  3P1H A;  1C0A A;  4A3B B;  1IL2 A;  3DWQ A;  1CM9 A;  1KLG D;  2PZU A;  1PYS B;  5A2Q L;  4RH6 A;  1TXY A;  1NUC A;  4JI5 Q;  2UUB L;  4WJ3 M;  5M5X B;  5M5Y B;  1X3F A;  2NVT H;  4DF7 A;  2MHV A;  1W6J A;  2J0T D;  5LMU Q;  3BU2 A;  2F0M A;  3OOC A;  5FO7 B;  4NXM L;  3GTL H;  3BVZ A;  4HTH A;  5IGG A;  5LMN Q;  5CMD A;  1TWG H;  2Z9H A;  2K32 A;  2MO0 A;  2NTS A;  1SSO A;  4RMF A;  4NXN L;  3HOY B;  1HQM C;  1PTO C;  3SXH A;  2BE5 C;  3FVQ A;  3NBI A;  2Y0S E;  3R2T A;  2IX0 A;  2QW7 A;  2L5T A;  4HIM A;  4IFD I;  3VYU A;  4A76 A;  2F0S A;  4OIK A;  2F0W A;  1Y1W G;  1WVL A;  1F2L A;  2F03 A;  3H0G B;  3PF4 A;  4LFB Q;  3QIA A;  5IWA Q;  2JA5 G;  3OW7 A;  2IL8 A;  3SR1 A;  4NKL A;  3L3O C;  5IP7 G;  3T1H L;  1CA5 A;  1VQG A;  4RWS C;  2A8V A;  4R8N A;  2RA4 A;  3I72 A;  2D0P A;  5FKA C;  3RN5 A;  1EYG A;  3GTO B;  1YEZ A;  4N9P A;  4DN4 M;  4EQO A;  4H7B A;  4DV2 Q;  2KBN A;  2Y0S G;  3I4N H;  1ZXT A;  4ZKB B;  3Q6S A;  1O78 A;  1S5F D;  3KOJ A;  1N34 Q;  3OMC A;  2KCC A;  1IHZ A;  1IXR A;  4M8A A;  3Q0A A;  2F4V L;  2LXJ A;  2MGS A;  5EPL A;  3VR6 A;  1WTR A;  3UDG A;  4DR4 Q;  2F0I A;  2E2H B;  4OWX B;  3NTI A;  1HUM A;  4DUZ L;  4F88 A;  2Z0S A;  1A63 A;  4RA8 A;  1AZP A;  4HMJ A;  1I6V C;  3ULJ A;  3J7A V;  4JI7 L;  1CQF A;  2KCT A;  2VW9 A;  4JPB W;  1EEI D;  2I46 A;  1RF2 D;  2K33 A;  1PXU A;  5NUC A;  2OTJ A;  3QOL A;  1N32 Q;  3E9H A;  1E0B A;  5J22 A;  3KF8 B;  3MXG A;  1UE5 A;  4LF8 L;  4PQX A;  1GXD C;  4WJW A;  2K5Q A;  4H02 A;  4BA2 I;  3H15 A;  4DV4 Q;  3PUX A;  2DUD A;  4XYO A;  2B2W A;  4UP9 A;  3R8B A;  5C4X G;  1EYC A;  3CMA A;  1EQR A;  1CTM A;  1A3U A;  2B8G A;  4FYD A;  1EYD A;  2JK8 A;  2ZJR A;  3WOE A;  4C3H B;  1D8L A;  1X54 A;  4BBR H;  3IFT A;  4OO1 I;  2F0J A;  2PZT A;  1FGB D;  4ZUI A;  1EIH A;  4IOC A;  3HGB A;  4DR6 Q;  3WDN A;  4C2M H;  2KEN A;  1QWY A;  3GV3 A;  1VF5 C;  4JOI C;  3ULL A;  5D65 A;  4R4Q A;  1I94 Q;  2IT1 A;  2XSC A;  5C4H A;  3HOX B;  1S4Z A;  4G57 A;  1SMX A;  1SLJ A;  5BR8 L;  3K5M A;  2ES2 A;  4UP8 A;  1XMQ Q;  1Q46 A;  3W1G A;  5A35 A;  2R7Z H;  5EKI A;  3FPP A;  3KFU A;  3A7A B;  1XNQ Q;  2DNC A;  3HOU G;  1Q82 C;  1QB5 D;  2F0T A;  1I4H A;  1Y69 U;  4B3M Q;  3CCM A;  1BXT A;  1D6E C;  5ELN A;  5BN4 A;  2K7V A;  5JJL A;  4A3B G;  3U9O A;  2CKZ B;  3AU7 A;  4LJZ C;  4XTC S;  1NMF A;  4GLX A;  4X62 Q;  1C7Y A;  1E2Z A;  1Q81 C;  1TY0 A;  1L1O B;  2OEO A;  3M85 A;  3K58 A;  5DAU A;  2DGY A;  2EYL A;  2VL6 A;  5COY A;  1B8A A;  4OL7 A;  1A62 A;  1I4R A;  1FL0 A;  5E4W C;  3S1M B;  3IL8 A;  1O7Y A;  1PZK D;  3NEN A;  2F0P A;  1F2Y A;  3AMU A;  3NQI A;  1TS3 A;  2RQX A;  5KNC A;  1Y1W H;  3P75 A;  1HNZ Q;  2R6G A;  3GTJ B;  1J9O A;  4PMB A;  2CQO A;  3GTM B;  1YNJ D;  4QUF A;  2ZJQ A;  2PO4 A;  5IP7 H;  1GUG A;  3H0G G;  1EQQ A;  3GO5 A;  1PA6 A;  1E3P A;  3FP9 A;  1SN8 A;  4IUQ A;  1NSN S;  2XN9 C;  5IT9 E;  2D5D A;  4WRD A;  2JQO A;  4DV6 L;  2FMM A;  2H4O A;  2UXB L;  3Q8D A;  2EY1 A;  2V4D A;  5IYD G;  3M9B A;  1HR0 W;  4GOP B;  1YNN D;  4L5Q A;  4HAE A;  2K50 A;  1JOK A;  3KYH C;  1N36 L;  2K01 A;  3L2P A;  1M1K C;  4QCL A;  2B39 A;  4Q0F A;  1STE A;  1BOS A;  4B3S Q;  2A1A A;  4ME3 A;  1KHI A;  1MIU A;  3VR4 A;  1BR9 A;  1JJG A;  2RSO A;  4DR2 L;  3N52 A;  5J3B A;  5EJW A;  4EGV A;  4GKK Q;  4JI1 L;  5IOC A;  2XTI A;  3J81 j;  4RCN A;  3ICE A;  2ICI A;  3TP6 A;  5M3M H;  1D5M C;  1WTP A;  1KXL A;  2A69 D;  1IBK Q;  2ASB A;  3MTS A;  3BZD B;  4IPD A;  4FF3 A;  4RKL A;  4IOA A;  4JI8 L;  3BJU A;  3I8Z A;  3IFD A;  5CV9 A;  3IAY A;  3MFG A;  5C4X H;  5EPK A;  4JI6 Q;  2PZW A;  1IBL Q;  3KF8 A;  1J5E L;  1H9R A;  1XYI A;  5GAH C;  3K81 C;  4ZCK A;  1EYA A;  2YTX A;  3D0F A;  1V9P A;  4DV0 Q;  1L0W A;  4QQB X;  1ILP A;  5C0X I;  4C3H G;  5I2X A;  1PH2 A;  4B3R Q;  5KGU A;  2BH8 A;  2RVL A;  1I5F A;  1TU2 B;  4PZ6 A;  4ME5 A;  3HKS A;  1EU4 A;  1ZKO A;  1BQQ T;  2LXK A;  2YU9 H;  3HOX G;  1VQE A;  2UXC Q;  5C44 B;  1I3Q B;  4FNF A;  4JI4 Q;  4NB3 A;  2MNA A;  2B63 B;  1Q12 A;  1UE6 A;  1SYC A;  4IUN A;  1SYB A;  5ELD A;  2YTY A;  5LL6 X;  4J6H A;  1AEX A;  5DNF A;  1F9S A;  2NZO A;  2ZXP A;  1BCP F;  2NN6 G;  4J1M A;  4A3I G;  5JVG 3;  2KCM A;  1XTC D;  1BF4 A;  4A3B H;  2J7Z A;  4GLV B;  4KHV A;  4A3D B;  4GN5 A;  2E2D C;  3SE0 A;  4R4I A;  1GUW A;  1RDP D;  4K0K L;  2JE6 I;  1LAB A;  4JV5 L;  5M5X H;  4BY1 B;  2NYZ D;  5M5Y H;  4B08 A;  4HJ9 A;  3CCV A;  2Q2H A;  3KBX A;  5KEE A;  3I73 A;  4KTA A;  2OQ0 A;  1VMP A;  2UUA Q;  1D5Z C;  1YJN A;  4LFA Q;  4U67 3;  5K36 G;  4HED A;  3PUY A;  1L1O A;  5FLM G;  3HOY H;  1FNW A;  3DEP A;  1S72 A;  4OON A;  1U0L A;  2RDG A;  1YHA A;  3TP8 A;  1I4G A;  3BYY B;  1HZA A;  1F9Q A;  1HZB A;  4DAM A;  1EQV A;  2D9U A;  2K04 A;  3LNN A;  3H0G H;  1EWC A;  1GUT A;  1BVS A;  4NDX A;  1JIC A;  1AW7 A;  4DR3 L;  3KDF B;  2IHE A;  3VYR A;  2M00 A;  3GTO H;  3NEM A;  4CJ2 C;  3RZD B;  2VY3 A;  1WTX A;  2O5J C;  1C8C A;  5IYD H;  1K28 A;  2OCE A;  1H95 A;  4N9T A;  1U4P A;  1JQY D;  4WOR A;  2BOS A;  3F2D A;  2E75 C;  2R93 B;  1B7Y B;  1YBY A;  4PMC A;  3RUZ A;  3M3Y B;  5I6W A;  5AFW A;  1V8Q A;  1NJI C;  3V96 A;  4LF9 Q;  2PNR C;  4XDX A;  1SE4 A;  1YNX A;  4GOP A;  1FVI A;  2E2H H;  3NPP A;  4L8J A;  4CDE C;  1SJE D;  2D62 A;  3NSW A;  4O2D A;  1D7Q A;  3HOV B;  1PH5 A;  1P16 A;  3BDL A;  3C1E A;  4DK6 C;  4FF4 A;  4RKB A;  3OSO A;  5DM6 3;  1CSQ A;  3OTO L;  3CRK C;  2KVM A;  2JN4 A;  1BBW A;  1E1T A;  4CBV A;  2A68 C;  3S14 B;  2F0Q A;  1FGU A;  1TT2 A;  1DOM A;  5CV4 A;  4J15 A;  5JPM C;  2HDM A;  3I4O A;  4FO2 A;  3QOJ A;  4XXE A;  3OPO A;  4JBW A;  3G6J B;  1SYE A;  2ZM6 Q;  1PZJ D;  2Q2T A;  1HHV A;  2MFI A;  1SE8 A;  4X3S A;  2JXM B;  5AJ3 L;  3K7U C;  5G3L F;  2BDO A;  1GHK A;  3A55 A;  3SHL A;  1BNZ A;  4DXF A;  2NVX B;  2A73 B;  1VQI A;  3T1Y Q;  1GHJ A;  1E22 A;  1WJJ A;  1PRT F;  2AKW B;  1VQ8 A;  3J7Z C;  3CC2 A;  4C3H H;  4KHZ A;  3CCS A;  1TS5 A;  1J6Q A;  2UUB Q;  2M9V A;  1U4R A;  1B3A A;  1S5C D;  1Y8N B;  2XGT A;  3HOX H;  4NXM Q;  3G48 A;  2HIV A;  2JA6 B;  1CFM A;  2BE5 D;  4KLK A;  2L11 A;  1LT3 D;  3UE1 A;  3CP0 A;  3E3X A;  2TSS A;  1GD7 A;  3QB3 A;  4DV7 Q;  4NXN Q;  5C44 G;  4UP7 A;  2F0O A;  5LL6 S;  5CV5 A;  1G51 A;  2RSN A;  2B63 G;  3FEW X;  2KED A;  4X66 Q;  2NN6 H;  2AHO B;  1LTB D;  2O5I C;  3I3C A;  1N33 L;  3U4V A;  1OXX K;  5EAY A;  4U68 A;  3TEH B;  2EYM A;  4DV5 L;  1CA6 A;  1G29 1;  2CQA A;  4JYA L;  2WB1 E;  4A3D G;  1FYC A;  4G7Z C;  3FHW A;  2B2U C;  3NWS A;  1JOO A;  1E2V A;  3P20 A;  4KHP Q;  5IOD A;  1B4O A;  1WFQ A;  4BY1 G;  3EIV A;  1HNW L;  2KHS A;  1ENA A;  4A3G B;  1LT6 D;  2AQ1 B;  5K36 H;  1QJO A;  3NXW A;  5CV6 A;  5FLM H;  4HCS A;  1EIY B;  5D3D A;  2BA0 A;  3S1M H;  4X65 Q;  3S1R B;  3D31 A;  4LF5 Q;  2JA5 B;  4DR7 Q;  5E4X A;  4A3M B;  1EOV A;  1PH6 A;  4DUZ Q;  3I7F A;  3GTJ H;  2K52 A;  4YY3 Q;  1STB A;  3GTM H;  1LAC A;  4R4C A;  3PO3 B;  3C2P A;  2FMC A;  4XIG S;  1MKH A;  1STA A;  1JB3 A;  2ZT9 C;  3A0J A;  3K6O A;  4I7Z C;  3KDF A;  1LO5 D;  3AQQ A;  2UU9 L;  3WOF A;  2EDG A;  2R93 G;  3VA5 A;  4DV3 L;  1DCZ A;  1HNX Q;  2G9D A;  4MHE A;  3H3V I;  1B70 B;  3QR8 A;  3CCL A;  4YHH L;  3TP7 A;  1PH1 A;  1LV9 A;  4FF1 A;  2EPB A;  3TSS A;  4LUZ A;  1VQN A;  2I5M X;  1A8V A;  3HOV G;  1KAB A;  1CK1 A;  1RHP A;  1HTP A;  2Z4H A;  2IY5 B;  4UPA A;  5E1F A;  1O7I A;  3H09 A;  1WOC A;  2JA9 A;  5BR8 Q;  1EFI D;  4IFD J;  2L0C A;  1X32 A;  1U9R A;  4LW1 A;  4RAU C;  2XNA C;  3KF6 A;  3OWE B;  4QGU A;  3CC7 A;  2F0N A;  2HQE A;  2AQ3 B;  3URY A;  2I07 B;  3T16 A;  1K0R A;  3TDQ A;  3C46 A;  2HCI A;  4GNX C;  4KD4 A;  1IKM A;  1G6Z A;  2WP8 J;  4DV1 L;  4IPC A;  4GS3 A;  4HJ8 A;  1BUV T;  4LFC L;  4JBK A;  4K5W A;  1PH7 A;  3T56 B;  1VQP A;  1DXM A;  3M4Y A;  1U4L A;  2KA7 A;  1DJR D;  1PDQ A;  4A93 G;  1STH A;  1HR0 L;  5KRU A;  3A54 A;  4Q5V A;  2JA6 G;  5C44 H;  1I3Q H;  2QDL A;  2B63 H;  4PV1 C;  5E3F A;  1I4P A;  5I2Y A;  1HH2 P;  1TII D;  3S2H B;  2GN5 A;  5I9O A;  1YIJ A;  4OX9 L;  4C3J B;  3JAM E;  1TWH B;  3E0E A;  5IT9 L;  2JYO A;  2KCN A;  3NK9 A;  1I50 B;  4JOI A;  4A3D H;  3U4Z A;  5EGT A;  3PGZ A;  4F7X A;  4A3F B;  2QA4 A;  2EYP A;  5DLQ E;  2ZJP A;  3ULP A;  3EFX D;  3SDZ A;  4DV6 Q;  4BY1 H;  2UXB Q;  1KDC A;  4X3K A;  2EYH A;  1XTD A;  1IL8 A;  1SNP A;  5C5L A;  3RZO B;  4AYB E;  1N36 Q;  3L7Z C;  1ET6 A;  2ATW A;  1HTL D;  3SK4 A;  4A3G G;  4DR5 Q;  4LUO A;  1JJ2 A;  4R4O A;  4FP5 D;  2R7D A;  1IW7 C;  1G6P A;  3PUW A;  1SNC A;  2EYO A;  4A3M G;  4DR2 Q;  2XWB B;  3I70 A;  4KKU A;  1A0I A;  2N3S A;  2A74 C;  4JI1 Q;  1S5D D;  4IUV A;  1CZW A;  3NQT A;  4HJ7 A;  3PO3 G;  2EYJ A;  1WD0 A;  4CHT B;  3K57 A;  1K8M A;  3S16 B;  1NCV A;  5EPJ A;  2V1C C;  2GVB A;  4OXP A;  4UAI A;  3TBI B;  3RZD H;  1JR0 D;  3Q23 A;  2WIN B;  5JOB A;  1VQL A;  3DUZ A;  2RCF A;  3NTH A;  2LS0 1;  2AUK A;  1KNA A;  3D4W A;  3Q24 A;  1QNU A;  2EY5 A;  2N49 A;  2IHF A;  5IP9 G;  1QUQ B;  2R93 H;  3BYT B;  2JEB I;  3M3Y H;  2FHT A;  2R92 B;  5IGE A;  3J81 E;  1WCM G;  1JT8 A;  1J5E Q;  2B2V C;  4LF4 Q;  3RMH A;  4APV A;  4PZ7 A;  2H5X A;  3L0O A;  3HOV H;  1HJP A;  4BA1 I;  4DNR B;  3G6E A;  2MUY A;  3ZJY C;  1A2U A;  5FK9 C;  1SNM A;  4CKB A;  2A6H C;  4ODG A;  5BN3 A;  3S14 H;  4BBS B;  1LUZ A;  1VDZ A;  2TMP A;  4K6D A;  1A2T A;  1PV4 A;  2RHS B;  3DLL A;  4DR1 L;  2F3I A;  1IBM Q;  1UNS A;  3NEL A;  1RTN A;  1Y8O B;  4JK1 C;  4IJL A;  4IUP A;  4A3E B;  3CD6 A;  1LLR D;  1EWI A;  2Z6K C;  3O13 A;  1MGS A;  4Y7N B;  2FXQ A;  3VR2 A;  2HCC A;  1TY2 A;  3LWE A;  4OHJ A;  1YI2 A;  1J8I A;  1TWC B;  5FLX E;  2NVX H;  4X6A H;  2QF7 A;  1QE6 A;  3M4Q A;  4POF A;  1MSH A;  4L5R C;  3S1N B;  1EY9 A;  2R3Z A;  2A5H A;  3CCQ A;  3I4M B;  4K0K Q;  2CWA A;  1O7Z A;  4FXK C;  4MNO A;  2UXD Q;  1TWF B;  3RNU A;  4GKJ L;  3UDX A;  1SNO A;  2Z4I A;  5EKL A;  4KY6 A;  2JA6 H;  1II3 A;  1D1I A;  1U4M A;  2R61 A;  4A3I B;  5TSS A;  3W1B A;  4JBM A;  4HIK A;  2CVR A;  2NN6 I;  3SVM A;  3I4L A;  4P74 A;  4HID A;  1K73 C;  4R1J A;  1GUN A;  3ND9 A;  5IE8 A;  4L5S A;  1I6H B;  4KK7 A;  4JI0 L;  2F0D A;  4G7O C;  2SNM A;  2RHQ B;  4C3J G;  2I5H A;  4JG2 A;  3E6Z X;  4HR7 B;  4Z9C B;  4DAY B;  2L9H A;  1JMC A;  1A15 A;  5ELE A;  4A3F G;  2VQE L;  4NW2 A;  4RFB A;  1SMY C;  3PCO B;  3FPU B;  3F2B A;  3K7A B;  1RL2 A;  4A3G H;  4JW0 A;  1HPC A;  3M4P A;  1VMC A;  3P7J A;  2KOL A;  5C0X J;  3JC6 6;  3S1R H;  1PRT C;  1VQO A;  2JA5 H;  1G8Z D;  4A3M H;  3DM1 A;  2OTL A;  4WJ4 A;  2A68 D;  1DOL A;  2FIN B;  4DNT B;  4QMG A;  5ELB A;  1HCZ A;  1JWS D;  5T1G A;  2DJG C;  3PO3 H;  2Q2U A;  2LSS A;  3VYT A;  2E8G A;  1YHQ A;  3SGI A;  1B50 A;  4IFD G;  3FKI B;  4GN3 B;  1WTO A;  4NPS A;  3I91 A;  4JBJ A;  4JI5 L;  5IP9 H;  1V1P B;  2JSO A;  3ER0 A;  3BG3 A;  1ML0 D;  3BZC A;  3VR3 A;  3H3V C;  5AJ3 Q;  1Q8K A;  1EY5 A;  4JI3 Q;  3T51 B;  2JEA I;  5LMN L;  2CWP A;  4K5V A;  2R92 G;  1K83 B;  2IJ0 A;  2WAC A;  1QUQ A;  2B2Y C;  4F87 A;  4ILW A;  3PIO A;  1JB7 A;  1S5E D;  3R93 A;  4QB4 A;  2EIF A;  2C5C A;  4LFB L;  4TKO B;  5IWA L;  4B9X A;  4DUY Q;  2D2C C;  1Z7T A;  4BBS G;  1VQD A;  1C4Q A;  1UEB A;  2EE1 A;  4I7A A;  2AUJ D;  4H44 C;  1ASZ A;  3BZK A;  1X3P A;  4B3T Q;  3CC4 A;  1IKL A;  4LK1 C;  1R4P B;  4A3J B;  1SYD A;  1D2B A;  4ZKC B;  4A3E G;  3CAM A;  1RCV D;  2R7F A;  3U58 A;  2AWN A;  1N33 Q;  4G4K A;  2N55 A;  5IT9 c;  4JYA Q;  4X64 Q;  1VQF A;  1CUK A;  5GRO A;  1I4X A;  2PCF B;  3J7A 5;  3I4M G;  4GNX B;  3SEB A;  2WV6 D;  2ZTD A;  1HNW Q;  1TVX A;  4OO1 G;  4LMQ D;  2K5H A;  2F0L A;  3HOU H;  4DFA A;  2C35 B;  1MBY A;  1PMR A;  1Q1E A;  3GV6 A;  4IJH A;  1N32 L;  1RIP A;  2E5L Q;  3H94 A;  2K75 A;  2RKS A;  4XQN A;  3OW2 A;  2NZH A;  5KYI A;  4DV4 L;  3VA7 A;  1STN A;  3S2H H;  2WKC A;  1KD1 C;  1Q90 A;  4YCU A;  1SXT A;  3ND8 A;  2K05 A;  4C3J H;  1TWH H;  5FJ8 G;  1EY0 A;  1JOR A;  1HA6 A;  4V19 0;  1I50 H;  5J1Z A;  4C1N K;  3EJI A;  4P2C B;  4A3F H;  1ICW A;  4KI0 A;  2CCZ A;  3I2Z A;  1VQC A;  4BY7 B;  1ET9 A;  3EVQ A;  2VB3 X;  3GQB A;  1FJG Q;  2WB1 B;  2VNU D;  3RZO H;  3PF5 A;  2CW0 C;  3RLF A;  1EUJ A;  3GTQ B;  4DAY A;  3DMU A;  5C4J B;  5DM7 3;  1W3S A;  4DV3 Q;  4HIO A;  3M4O B;  4ULL A;  5JJZ A;  3NWT A;  1VQ9 A;  4F8M A;  1K3R A;  4KN4 C;  1EIF A;  1PH4 A;  1PTO B;  4MIU A;  2F3V A;  1CKO A;  2B2U A;  3R2I A;  5GAG C;  3STB D;  1B3Q A;  4HMI A;  4IFD H;  3S16 H;  1PH3 A;  2BH2 A;  4EX5 A;  4DU9 A;  3CPW A;  4X62 L;  3FKI G;  4FXG C;  1SAP A;  2I5L X;  5IGC A;  5CBE E;  1PZI D;  3TRE A;  2H1E A;  1PFS A;  4AQY L;  2CHB D;  3MVV A;  2JA8 B;  1LM0 A;  2PQA B;  4DK3 C;  2R92 H;  1KDA A;  1K8O A;  4DA2 A;  3HEJ A;  1KDB A;  4BS9 A;  1V1P A;  4IUU A;  1OO9 B;  1BDO A;  1C48 A;  4DV1 Q;  3KF6 B;  5C6A A;  1X56 A;  2F0E A;  3WWV A;  1L0X B;  1Z9F A;  4LFC Q;  1K9M C;  2LKV A;  1I4Q A;  2E74 C;  2MJ8 A;  4BBS H;  3HOZ B;  2DY8 A;  2C9O A;  1EQT A;  1YNJ C;  3UI2 A;  2RF4 A;  4LF7 Q;  4JI2 Q;  1RJT A;  4A3E H;  2K5N A;  3CCR A;  1NAP A;  5IGB A;  3JAM L;  1C9O A;  2X6L A;  4Y7N H;  4A3L G;  4A3J G;  4OX9 Q;  2WKD A;  1TWC H;  4RCO A;  3UE0 A;  1GO3 E;  3S17 B;  1ILQ A;  5DEH A;  3HOW B;  3S1N H;  4A93 B;  2VXW A;  5FO8 B;  1FNU A;  2DN8 A;  1GOZ A;  3I4M H;  1PTO D;  2E2I B;  4C3I G;  4GKK L;  3VDY A;  2A6E C;  5C4Z A;  1STY A;  2KHI A;  4OO1 H;  4K8I A;  1TWF H;  5C0X G;  3GDE A;  1IBK L;  5HY6 A;  3PO2 B;  5LMN W;  3W5O A;  1X3E A;  2EJG C;  3A5Z B;  1Z6H A;  4HSP A;  2EXZ A;  2PMZ B;  1KLU D;  4A3I H;  4C1N I;  4GNX A;  1LYL A;  4ZK9 B;  3G71 A;  5JJK A;  1LTA D;  1DON A;  2A69 C;  1QVC A;  4QL5 A;  4QUC A;  3T1H Q;  1AN8 A;  1I6H H;  3I90 A;  3D6C A;  2NUC A;  5FJ8 H;  5KND A;  1B9M A;  1CKN B;  1IBL L;  4EQN A;  2N88 A;  3ERO A;  2KJX A;  1PYB A;  1SE2 A;  1OXV A;  1GM5 A;  1YVC A;  2AWO A;  3A5U A;  4IPH A;  2B29 A;  1CZG A;  4DV0 L;  2MQH A;  5COR A;  3K0X A;  3RN2 A;  1UUP A;  4H0L C;  3T13 A;  2F4V Q;  5IYC G;  1AZQ A;  4BY7 G;  3RR5 A;  5ELC A;  3K7A H;  1DGS A;  1MJC A;  1Q1B A;  3BS1 A;  1F9P A;  3MXP A;  4PZ8 A;  2WB1 G;  2B8F A;  3J81 L;  3K80 C;  2IPK D;  4OEL B;  5C3E B;  1JWU D;  2F4I A;  2VS1 A;  4AYB B;  1NR2 A;  4WFN 3;  4JI4 L;  4JI7 Q;  4K5X A;  1WD1 A;  2A6H D;  4DNI A;  4N8X 1;  4OIJ A;  1XPU A;  3OYY A;  4EQP A;  2BDN A;  2Z6B A;  3FMC A;  2NVQ B;  3W3A A;  4YWK A;  4DK1 A;  2EY6 A;  4LF8 Q;  2UUC L;  3FKI H;  4DR1 Q;  4OWW B;  3HZX A;  1KAA A;  2QEX A;  1WCM B;  4L6T B;  3HS0 C;  4LUV A;  3J80 E;  2PW7 A;  2G9H D;  2DJF C;  3JAM i;  3ONA B;  1X9N A;  2IWH A;  4HJA A;  2L12 A;  3TQY A;  2JA8 G;  2SNS A;  2IX3 A;  1W6K A;  1U5K A;  2A19 A;  3A8K E;  1K83 H;  3PUV A;  2K4K A;  1VQB A;  4KJN A;  1QIL A;  5CC4 A;  4M1U B;  2EVB A;  3R3O A;  2EXD A;  2PQA A;  1RD9 D;  2X69 A;  3UDI A;  2Q8R E;  1S3O A;  3CQZ B;  5J39 A;  1N9W A;  1ZEQ X;  5M3M B;  3CU7 A;  2NZ1 D;  1XPO A;  1EL0 A;  3HOZ G;  1SRU A;  3H91 A;  5EBC A;  3BDC A;  2B2V A;  2HD3 A;  3PMF A;  4RGM A;  1TS4 A;  1BKB A;  2OQK A;  4A3L H;  4A3J H;  3S2D B;  1WI5 A;  2BCO A;  4IUR A;  2PYK A;  3TZU A;  3KLR A;  3MXN B;  5M3F B;  4JI0 Q;  2F0V A;  3PIO 3;  3AFP A;  4QIW E;  3W2D A;  1EY7 A;  3M7N A;  1PFN A;  1ICF B;  1B2T A;  3KLS A;  1SMY D;  2PI2 E;  2WAQ E;  3K5O A;  2PMZ E;  3KK7 A;  4BWG B;  3HOW G;  3MZ5 A;  1PVO A;  1T9H A;  1STG A;  1B53 A;  1ENF A;  1L0Y B;  2HHH L;  2JA7 B;  1GVP A;  3DWA A;  3QWN A;  3J81 i;  3F2U A;  1PYW D;  1EZ6 A;  2Z6K A;  3PQI A;  1WTH A;  2L4N A;  4K8J A;  3S9W A;  3PO2 G;  2N8N A;  3V05 A;  2QGQ A;  3GTG B;  1UE7 A;  2ZM6 L;  5FO9 B;  2L1B A;  2EJM A;  4RHR A;  1E2W A;  3RLO A;  3AEV A;  1LT5 D;  1PHJ A;  3T1Y L;  1CI3 M;  1UE1 A;  3S1Q B;  2QIL A;  4EVO A;  5ELO A;  5IYC H;  4GN4 B;  3ZYY X;  4BY7 H;  1L2F A;  4UHV A;  4XQJ A;  1IYU A;  1CKN A;  5L37 A;  3F8T A;  2CH4 W;  2EYF A;  4LF6 L;  2IW3 A;  1ESR A;  3PIP A;  1G91 A;  2CH4 A;  4HSV A;  1B1Z A;  1OXT A;  3GTQ H;  4K14 A;  5C4J H;  2XWJ B;  4IAL A;  2K5W A;  4E6I A;  3MWY W;  1XJV A;  2L15 A;  3M4O H;  1JC7 A;  1SDF A;  5C3E G;  1V1O A;  3PUZ A;  2K28 A;  4DV7 L;  4AYB G;  1HXY D;  2BA1 A;  2Q8T A;  4TRD A;  1OXS C;  1PTO H;  1XNR L;  4X66 L;  5BN5 A;  1K0S A;  4B9W A;  4JI8 Q;  2NBF A;  3K5N A;  1CQV A;  4JCV E;  1PH9 A;  2NTT A;  3K5L A;  1SND A;  2F52 A;  1X65 A;  2ICE C;  2E2J B;  4ZQ3 A;  3A7L A;  3I55 A;  4OGQ C;  1HUN A;  4OEM B;  1LTG D;  1VS0 A;  2WII B;  1BCP C;  3EN2 A;  5C5M A;  3AFQ A;  1H9S B;  5JEA J;  4KHP L;  2QKI C;  1OTC A;  1ESF A;  5JJI A;  2B2T C;  4CJ1 B;  2JA8 H;  2E76 C;  2HDL A;  3JAM c;  5KYL A;  1JWM D;  2KQ3 A;  4X65 L;  4LF5 L;  2RDH A;  4DR7 L;  2NVY B;  5IGD A;  1IYV A;  4O0A A;  2VUM B;  1JE5 A;  1NY4 A;  4KMU C;  1HZ9 A;  1K8G A;  4YY3 L;  3EQL C;  4AIM A;  4KV6 A;  1A3T A;  1CKM A;  3E5S A;  3HOZ H;  2GA4 B;  3NP8 A;  1NMG A;  5D3I B;  5M3M G;  1G2S A;  1Z47 A;  3HRZ C;  3L9A X;  4QJF A;  3OIP A;  1M8A A;  2AMC B;  1NR4 A;  4LWC A;  2F0K A;  3FRP B;  5CR3 A;  4XQQ A;  2I0Q A;  4DXG A;  2B2Y A;  4R9W A;  3PV0 A;  4ZLT F;  1Q7Y C;  4ZUJ A;  3A56 A;  1KNE A;  5GAE C;  1VQJ A;  1XMO L;  4BXX G;  1TQO A;  5M3F G;  5M5W B;  4JV5 Q;  1HNX L;  3S17 H;  1TKW B;  4GLA C;  3GTP B;  1VQ6 A;  2FJ2 A;  3HOW H;  4A93 H;  2F3W A;  2CW0 D;  1AE2 A;  3MXN A;  1W2B A;  2SDF A;  3A74 A;  4POG A;  1UWV A;  2E2I H;  5GAD C;  3MC0 B;  3GP7 A;  3TS2 A;  1H9J A;  3CW2 C;  3S24 A;  3MFY A;  2JA7 G;  1D1K A;  1MSG A;  3PO2 H;  3BVM A;  3J7A F;  3J81 c;  1F2M A;  1N8R C;  2VQF L;  4TQU S;  4DR3 Q;  1YJ9 A;  1AFP A;  1X3Q A;  2Q8I B;  4J8Q A;  3T53 B;  1ZYR C;  5I6Y A;  5IIF A;  2O2L D;  1VCI A;  3RLN A;  3A8J E;  1EEF D;  1KL9 A;  1EIG A;  3VYS A;  3K59 A;  3MA2 B;  2IX1 A;  4P73 A;  2F0F A;  4K2L A;  3SK5 A;  2OXP A;  1TWA B;  4AQY Q;  3S15 B;  5JAV A;  5C3E H;  4P75 A;  5FLX c;  1V1Q A;  1GJX A;  1FNV A;  1B9N A;  1XWE A;  3OTO Q;  1QZH A;  1EY6 A;  4KN7 C;  2L55 A;  4MTK A;  1HFN A;  2F0U A;  5I4D A;  1MHW C;  1QOH A;  3HOY G;  3KJP A;  2XRS D;  1YJW A;  2ZTE A;  1OXU A;  1JJC B;  3NE5 B;  4HCE A;  2NVQ H;  3CCJ A;  3CRL C;  1Q86 C;  2MPM A;  4DAP A;  5A2Q E;  1Y8P B;  2M2L A;  5HGQ A;  4O1N A;  3CKI B;  4DAV A;  2Q2I A;  4DPG A;  5LMU L;  1WCM H;  1K8A C;  2R7Z B;  1NNX A;  1IZ6 A;  1HZC A;  1LTI D;  4V0B A;  4LAA A;  2DNE A;  4XT1 B;  2XIW A;  4DGZ A;  1EZ8 A;  2O4X A;  2JP1 A;  3DM3 A;  1EU3 A;  4JC0 A;  3C1F A;  2B2W C;  3AYH B;  3KUP A;  3NBH B;  3GTK B;  1AH9 A;  1F2Z A;  1H9S A;  3VR5 A;  1SFO B;  3UDF A;  4DR5 L;  4CDC C;  2A6E D;  4IN3 A;  5FOB B;  2J4X A;  3H3V H;  5HGT A;  4KKS A;  2EY2 A;  2VUM G;  3LX0 A;  4P71 A;  3CQZ H;  3OMG A;  1ROD A;  4A3K B;  1VQM A;  3DEO A;  4DV2 L;  4CJ0 B;  2B3G A;  3D3R A;  1QVG A;  4FF2 A;  1QCB D;  3B6Y A;  5HUR A;  1O80 A;  3TME A;  3X3M A;  3HG9 A;  1N34 L;  4R8I A;  4K6L A;  2YTV A;  3PSI A;  4RGO S;  3S2D H;  1A3V A;  4DR4 L;  4DV5 Q;  4BXX H;  3QJY A;  2OWO A;  3BVG A;  5M3F H;  5M9O A;  1LTT D;  5CV8 A;  1AE3 A;  1PTO F;  1X55 A;  3CHB D;  4C3I B;  2ALY B;  4LF4 L;  1TS2 A;  3MHB A;  3RD4 A;  1T5E A;  4TVA B;  4PNY A;  1NTG A;  3HP3 A;  3NUC A;  4QF4 A;  2EOT A;  2JA7 H;  5T1I A;  3D4D A;  4KY5 A;  1SNQ A;  2F0G A;  2KUM A;  1Y1V B;  1CT1 D;  2HQL A;  1R9T B;  4FXD A;  3GD7 A;  2F1M A;  3G4S A;  1Q3L A;  5CV7 A;  4TSS A;  4ZYS A;  1IBM L;  3GTG H;  4N8F A;  3TS0 A;  1D5X C;  3CXC A;  1H9M A;  5IYB G;  1SE3 A;  3MEF A;  2LFN A;  2SEB D;  2CFM A;  1LTS D;  4DKA C;  4QY7 A;  1V43 A;  3MAQ A;  4A75 A;  1S5B D;  2FFK B;  4MZ9 A;  1PLF A;  2K1B A;  3T4A C;  3F2C A;  2QEJ C;  4DR6 L;  2ID0 A;  3S1Q H;  5ISR A;  4PG3 A;  4MTN A;  2HIX A;  2MO1 A;  3DHQ A;  2UUC Q;  2UU9 Q;  2NVT B;  1I94 L;  2NWG A;  3J80 L;  5JEA G;  3GTL B;  3TN2 A;  4GZY C;  4C56 C;  3C3L A;  1EWH A;  1JCK B;  1FR3 A;  4KY7 A;  4YHH Q;  1TWG B;  2UXD L;  1XMQ L;  3H6M A;  1F77 A;  2QCP X;  1E1O A;  2MP1 A;  1VQH A;  1XNQ L;  5I9P A;  1GUS A;  5KNB A;  3HKZ B;  4B3M L;  3SK8 A;  4DK0 A;  3CCE A;  1HFG A;  1P8L A;  5H1S E;  4AH6 A;  5IGF A;  1G2T A;  4IUT A;  2PNH A;  5EBD A;  3J7Y W;  3PIP 3;  4CGY B;  4UY8 C;  3Q22 A;  2E2J H;  1PFB A;  2P5Z X;  3E0J A;  1F9R A;  3MXU A;  3I4N B;  3D8G A;  2RCN A;  3D4R A;  4A3C G;  3U9S A;  3TP5 A;  1HA5 A;  5K5P A;  3LGJ A;  1FD7 D;  3X3N A;  3MEH A;  1ASY A;  4A4I A;  2KEE A;  1PH8 A;  4IZ8 A;  1HNZ L;  1BCP B;  3KBG A;  1SEB D;  2Z8L A;  5IY0 A;  4LNQ A;  1CHP D;  2NVY H;  5C3X A;  1EY8 A;  2VUM H;  3QG1 A;  3NBH A;  3CF5 A;  1HR0 Q;  2D0O A;  1YHB A;  2WFW A;  3NHH A;  2HHH Q;  3I56 A;  1TR5 A;  2K5V A;  4YWM A;  1E24 A;  4A3K G;  1KIX A;  4YIJ A;  1EFW A;  4IO9 A;  1SYG A;  4CDF C;  1O7L A;  1M4V A;  4ABN A;  5EQ0 A;  5LHY 1;  1AP0 A;  1K3B C;  4I65 A;  4B3S L;  3OHX C;  1YNN C;  2SOB A;  4JVZ A;  1Y14 B;  1HQR D;  3IKJ A;  4BBR B;  4YCV A;  4JI3 L;  5M5W H;  2PW5 A;  3DWP A;  3GTP H;  1IYJ B;  4YWL A;  4C2M B;  2K03 A;  1XPR A;  4MN3 A;  2K14 A;  3J80 i;  4R4T A;  3KLS X;  1DM0 B;  4QIW B;  4IQZ A;  4YCW A;  2F0H A;  2EZV A;  1IW7 D;  1KQS A;  3ERS X;  2WAQ B;  4UDU C;  4LF6 Q;  2X6G A;  1X6O A;  4DUY L;  1ONL A;  3KLW A;  1LT4 D; 
#chains in the Genus database with same CATH homology
 1GUO A;  5CBA E;  1EOT A;  2XVS A;  5D14 A;  1A6X A;  2XRQ D;  4XYQ A;  3NTK A;  4G7H C;  5KIX A;  3OWF A;  2VB2 X;  1T5X D;  2HUG A;  4NP5 A;  2DY7 A;  1BCP D;  1KTK A;  3M7G A;  4X3T A;  2Z1C A;  3OIQ A;  4K2K A;  1PFM A;  2RDF A;  1QG7 A;  2NB0 A;  3G7L A;  5JEA H;  1XX8 A;  3V2T A;  1BBX C;  4FVM A;  3BDO A;  2QDB A;  2ENB A;  1WTQ A;  1Y1W B;  3ITP A;  3D6W A;  1WTW A;  4PMW A;  4L63 B;  1PRT B;  5CYU A;  5EKK A;  2YYZ A;  1BO0 A;  4CKC A;  2Y0S B;  4KJO A;  2K6A A;  1UEA B;  1HRJ A;  3QO2 A;  5FLX L;  1QNK A;  2PPB C;  1WTV A;  1H9K A;  3N6R A;  1XXG A;  4ZAI A;  2RBM A;  4XT3 B;  1RKN A;  2LMC B;  1EY4 A;  4CKE A;  4HN7 A;  4KD3 A;  4ID6 A;  4RHS A;  1DYQ A;  3LWU A;  2PQE A;  2OF1 A;  4O42 A;  5JVH 3;  1UAP A;  1SBB B;  1DD2 A;  1VF7 A;  1MD2 D;  3EA6 A;  2EJF C;  2B2T A;  1JE4 A;  1Q8I A;  3FDT A;  4RGN A;  5F2D A;  5C4X B;  1RTO A;  4H13 C;  1JOQ A;  5C3W A;  1ZYR D;  2KEC A;  5JPN C;  5CGK A;  2ZXO A;  2K5D A;  1ENC A;  5G3L D;  3A8I E;  1DZ1 A;  3SK6 A;  1R4Q B;  4NMZ A;  1MI2 A;  5C0X H;  4X3U A;  1PRT D;  2OT2 A;  4RGT A;  1B44 D;  2YU9 B;  2LY7 A;  1SYF A;  4S3S A;  1DOK A;  1LTR D;  3AB9 A;  3K0Y A;  2AQ2 B;  1SJH D;  3DXJ C;  3HOU B;  3TZD A;  5ELF A;  1CHQ D;  4ZRZ A;  2ZXR A;  3ERQ A;  4KKT A;  3P1H A;  4A3B B;  3DWQ A;  1CM9 A;  1KLG D;  2PZU A;  5A2Q L;  4RH6 A;  1NUC A;  5M5X B;  5M5Y B;  4DF7 A;  2MHV A;  1W6J A;  2J0T D;  2F0M A;  3OOC A;  5FO7 B;  3BVZ A;  4HTH A;  5IGG A;  5CMD A;  2K32 A;  2NTS A;  1SSO A;  3HOY B;  1HQM C;  1PTO C;  3SXH A;  2BE5 C;  3FVQ A;  3NBI A;  3R2T A;  2IX0 A;  2L5T A;  4IFD I;  3VYU A;  2F0S A;  4OIK A;  2F0W A;  2F03 A;  1WVL A;  1F2L A;  3H0G B;  3QIA A;  3OW7 A;  2IL8 A;  3SR1 A;  4NKL A;  3L3O C;  1CA5 A;  4RWS C;  4R8N A;  2RA4 A;  3I72 A;  3GTO B;  5FKA C;  4N9P A;  4DN4 M;  4EQO A;  4H7B A;  1ZXT A;  4ZKB B;  3Q6S A;  1S5F D;  1O78 A;  3OMC A;  2KCC A;  1IHZ A;  4M8A A;  3Q0A A;  2MGS A;  5EPL A;  3VR6 A;  1WTR A;  2F0I A;  2E2H B;  3NTI A;  1HUM A;  4F88 A;  4RA8 A;  1AZP A;  4HMJ A;  1I6V C;  3J7A V;  1CQF A;  1EEI D;  2I46 A;  1RF2 D;  2K33 A;  1PXU A;  5NUC A;  3QOL A;  1E0B A;  5J22 A;  3MXG A;  4PQX A;  1GXD C;  4WJW A;  2K5Q A;  4BA2 I;  3PUX A;  4XYO A;  2B2W A;  3R8B A;  1EYC A;  1CTM A;  1A3U A;  2B8G A;  4FYD A;  1EYD A;  3WOE A;  4C3H B;  3IFT A;  4OO1 I;  2F0J A;  2PZT A;  1FGB D;  4ZUI A;  1EIH A;  3HGB A;  3WDN A;  1QWY A;  3GV3 A;  1VF5 C;  5D65 A;  2IT1 A;  2XSC A;  5C4H A;  3HOX B;  1S4Z A;  4G57 A;  3K5M A;  5A35 A;  5EKI A;  3FPP A;  3A7A B;  2DNC A;  1QB5 D;  2F0T A;  1I4H A;  1Y69 U;  1BXT A;  1D6E C;  5BN4 A;  2K7V A;  3U9O A;  3AU7 A;  4LJZ C;  4XTC S;  1E2Z A;  1TY0 A;  2OEO A;  3M85 A;  3K58 A;  5DAU A;  2EYL A;  5COY A;  4OL7 A;  1I4R A;  5E4W C;  3S1M B;  3IL8 A;  1O7Y A;  1PZK D;  2F0P A;  1F2Y A;  3AMU A;  3NQI A;  1TS3 A;  2RQX A;  5KNC A;  3P75 A;  2R6G A;  3GTJ B;  1J9O A;  4PMB A;  3GTM B;  1YNJ D;  4QUF A;  2PO4 A;  1GUG A;  3GO5 A;  4IUQ A;  1NSN S;  2XN9 C;  5IT9 E;  2D5D A;  4WRD A;  2FMM A;  2H4O A;  2EY1 A;  2V4D A;  1YNN D;  4HAE A;  1JOK A;  2K01 A;  4QCL A;  2B39 A;  4Q0F A;  1STE A;  1BOS A;  3VR4 A;  1BR9 A;  2RSO A;  3N52 A;  5EJW A;  4EGV A;  5IOC A;  4RCN A;  2ICI A;  3TP6 A;  1D5M C;  1WTP A;  2A69 D;  3MTS A;  3BZD B;  4FF3 A;  4RKL A;  3I8Z A;  3IFD A;  5CV9 A;  3IAY A;  3MFG A;  5EPK A;  2PZW A;  3KF8 A;  1H9R A;  1XYI A;  1EYA A;  1ILP A;  5C0X I;  4C3H G;  5I2X A;  5KGU A;  2RVL A;  1TU2 B;  4ME5 A;  1EU4 A;  1ZKO A;  1BQQ T;  5C44 B;  1I3Q B;  4FNF A;  2B63 B;  1Q12 A;  1SYC A;  4IUN A;  1SYB A;  5ELD A;  5LL6 X;  4J6H A;  1AEX A;  5DNF A;  1F9S A;  2ZXP A;  1BCP F;  2NN6 G;  4J1M A;  5JVG 3;  1XTC D;  1BF4 A;  2J7Z A;  4KHV A;  4A3D B;  2E2D C;  3SE0 A;  1GUW A;  1RDP D;  2JE6 I;  1LAB A;  4BY1 B;  2NYZ D;  4B08 A;  3KBX A;  5KEE A;  3I73 A;  4KTA A;  1VMP A;  1D5Z C;  4U67 3;  5K36 G;  4HED A;  3PUY A;  1FNW A;  3DEP A;  2RDG A;  3TP8 A;  1I4G A;  3BYY B;  1F9Q A;  1EQV A;  2D9U A;  2K04 A;  3LNN A;  1EWC A;  1GUT A;  4NDX A;  1JIC A;  1AW7 A;  3VYR A;  2M00 A;  4CJ2 C;  3RZD B;  1WTX A;  2O5J C;  1C8C A;  4N9T A;  1U4P A;  1JQY D;  4WOR A;  2BOS A;  2E75 C;  2R93 B;  4PMC A;  3RUZ A;  3M3Y B;  5I6W A;  5AFW A;  1V8Q A;  3V96 A;  2PNR C;  4XDX A;  1SE4 A;  3NPP A;  4L8J A;  1SJE D;  2D62 A;  3NSW A;  3HOV B;  3BDL A;  3C1E A;  4FF4 A;  4RKB A;  3OSO A;  5DM6 3;  3CRK C;  2KVM A;  4CBV A;  2A68 C;  3S14 B;  2F0Q A;  1TT2 A;  1DOM A;  5CV4 A;  5JPM C;  2HDM A;  4FO2 A;  3QOJ A;  4XXE A;  3OPO A;  4JBW A;  3G6J B;  1SYE A;  1PZJ D;  1HHV A;  4X3S A;  2JXM B;  5G3L F;  2BDO A;  1GHK A;  3A55 A;  3SHL A;  1BNZ A;  4DXF A;  2NVX B;  2A73 B;  1GHJ A;  1PRT F;  4KHZ A;  1TS5 A;  2M9V A;  1U4R A;  1B3A A;  1S5C D;  1Y8N B;  2JA6 B;  1CFM A;  2BE5 D;  2L11 A;  1LT3 D;  2TSS A;  3QB3 A;  2F0O A;  5LL6 S;  5CV5 A;  2RSN A;  3FEW X;  2KED A;  2NN6 H;  1LTB D;  2O5I C;  3I3C A;  1OXX K;  4U68 A;  2EYM A;  1CA6 A;  1G29 1;  2CQA A;  1FYC A;  4G7Z C;  2B2U C;  3NWS A;  1JOO A;  1E2V A;  3P20 A;  5IOD A;  1B4O A;  2KHS A;  1ENA A;  4A3G B;  1LT6 D;  2AQ1 B;  5K36 H;  1QJO A;  3NXW A;  5CV6 A;  4HCS A;  5D3D A;  2BA0 A;  3S1R B;  3D31 A;  2JA5 B;  5E4X A;  4A3M B;  1STB A;  1LAC A;  3PO3 B;  3C2P A;  2FMC A;  4XIG S;  1STA A;  1JB3 A;  2ZT9 C;  3K6O A;  4I7Z C;  1LO5 D;  3WOF A;  2EDG A;  3VA5 A;  1DCZ A;  2G9D A;  4MHE A;  3TP7 A;  1LV9 A;  4FF1 A;  2EPB A;  3TSS A;  1KAB A;  1CK1 A;  1RHP A;  1HTP A;  2Z4H A;  5E1F A;  3H09 A;  1EFI D;  4IFD J;  2L0C A;  1X32 A;  1U9R A;  4RAU C;  2XNA C;  3OWE B;  2F0N A;  2HQE A;  2AQ3 B;  3URY A;  2I07 B;  3T16 A;  3TDQ A;  3C46 A;  2HCI A;  4KD4 A;  1IKM A;  1G6Z A;  2WP8 J;  1BUV T;  4K5W A;  3T56 B;  1DXM A;  3M4Y A;  1U4L A;  2KA7 A;  1DJR D;  1PDQ A;  1STH A;  5KRU A;  3A54 A;  4Q5V A;  4PV1 C;  5E3F A;  1I4P A;  5I2Y A;  1TII D;  3S2H B;  5I9O A;  4C3J B;  3JAM E;  1TWH B;  5IT9 L;  2JYO A;  2KCN A;  3NK9 A;  1I50 B;  5EGT A;  4F7X A;  4A3F B;  2EYP A;  3EFX D;  3SDZ A;  1KDC A;  4X3K A;  2EYH A;  1IL8 A;  1SNP A;  5C5L A;  3RZO B;  3L7Z C;  1ET6 A;  1HTL D;  3SK4 A;  4FP5 D;  1IW7 C;  3PUW A;  1SNC A;  2EYO A;  2XWB B;  3I70 A;  4KKU A;  2A74 C;  1S5D D;  4IUV A;  1CZW A;  3NQT A;  2EYJ A;  1WD0 A;  4CHT B;  3K57 A;  1K8M A;  3S16 B;  1NCV A;  5EPJ A;  4UAI A;  3TBI B;  1JR0 D;  3Q23 A;  2WIN B;  5JOB A;  3DUZ A;  3NTH A;  2LS0 1;  2AUK A;  1KNA A;  3D4W A;  3Q24 A;  1QNU A;  2EY5 A;  3BYT B;  2JEB I;  2FHT A;  2R92 B;  5IGE A;  3J81 E;  2B2V C;  3RMH A;  4BA1 I;  4DNR B;  2MUY A;  1A2U A;  5FK9 C;  1SNM A;  4CKB A;  2A6H C;  4ODG A;  5BN3 A;  4BBS B;  1VDZ A;  2TMP A;  4K6D A;  1A2T A;  1UNS A;  1RTN A;  1Y8O B;  4JK1 C;  4IUP A;  4A3E B;  1LLR D;  3O13 A;  1MGS A;  4Y7N B;  3VR2 A;  2HCC A;  1TY2 A;  3LWE A;  4OHJ A;  1J8I A;  1TWC B;  5FLX E;  2QF7 A;  1QE6 A;  1MSH A;  3S1N B;  1EY9 A;  2R3Z A;  2A5H A;  3I4M B;  1O7Z A;  4FXK C;  1TWF B;  1SNO A;  2Z4I A;  5EKL A;  4KY6 A;  1II3 A;  1D1I A;  1U4M A;  2R61 A;  4A3I B;  5TSS A;  2CVR A;  2NN6 I;  3SVM A;  3I4L A;  1GUN A;  3ND9 A;  1I6H B;  4KK7 A;  2F0D A;  4G7O C;  2SNM A;  4C3J G;  3E6Z X;  4HR7 B;  4Z9C B;  2L9H A;  1A15 A;  5ELE A;  4NW2 A;  4RFB A;  1SMY C;  3FPU B;  3K7A B;  1HPC A;  1VMC A;  3P7J A;  2KOL A;  5C0X J;  1PRT C;  1G8Z D;  3DM1 A;  2A68 D;  1DOL A;  2FIN B;  4DNT B;  4QMG A;  5ELB A;  1HCZ A;  1JWS D;  5T1G A;  3VYT A;  1B50 A;  4IFD G;  3FKI B;  1WTO A;  3I91 A;  1V1P B;  2JSO A;  3BG3 A;  1ML0 D;  3VR3 A;  3H3V C;  1EY5 A;  3T51 B;  2JEA I;  4K5V A;  1K83 B;  2IJ0 A;  2WAC A;  2B2Y C;  4F87 A;  4ILW A;  1S5E D;  3R93 A;  4QB4 A;  2C5C A;  4TKO B;  4B9X A;  2D2C C;  1Z7T A;  1C4Q A;  2EE1 A;  2AUJ D;  4H44 C;  1X3P A;  1IKL A;  4LK1 C;  1R4P B;  4A3J B;  1SYD A;  1D2B A;  4ZKC B;  1RCV D;  2AWN A;  4G4K A;  2N55 A;  1I4X A;  2PCF B;  3SEB A;  2WV6 D;  1TVX A;  4OO1 G;  4LMQ D;  2F0L A;  4DFA A;  1MBY A;  1PMR A;  1Q1E A;  3GV6 A;  3H94 A;  2RKS A;  4XQN A;  5KYI A;  3VA7 A;  1STN A;  2WKC A;  1Q90 A;  1SXT A;  3ND8 A;  2K05 A;  1JOR A;  1EY0 A;  1HA6 A;  4V19 0;  5J1Z A;  4C1N K;  3EJI A;  4P2C B;  1ICW A;  4KI0 A;  4BY7 B;  1ET9 A;  3EVQ A;  2VB3 X;  3GQB A;  2WB1 B;  2VNU D;  2CW0 C;  3RLF A;  3GTQ B;  4DAY A;  3DMU A;  5C4J B;  5DM7 3;  3M4O B;  4ULL A;  5JJZ A;  3NWT A;  4F8M A;  4KN4 C;  1PTO B;  4MIU A;  2F3V A;  2B2U A;  3R2I A;  4HMI A;  4IFD H;  4DU9 A;  4FXG C;  1SAP A;  5IGC A;  5CBE E;  1PZI D;  2H1E A;  2CHB D;  3MVV A;  2JA8 B;  1KDA A;  1K8O A;  4DA2 A;  3HEJ A;  1KDB A;  4BS9 A;  1V1P A;  4IUU A;  1OO9 B;  1BDO A;  1C48 A;  5C6A A;  2F0E A;  1L0X B;  2LKV A;  1I4Q A;  2E74 C;  2MJ8 A;  3HOZ B;  2DY8 A;  2C9O A;  1EQT A;  1YNJ C;  3UI2 A;  1RJT A;  1NAP A;  5IGB A;  3JAM L;  2X6L A;  2WKD A;  4RCO A;  3S17 B;  1ILQ A;  5DEH A;  3HOW B;  4A93 B;  2VXW A;  5FO8 B;  1FNU A;  2DN8 A;  1GOZ A;  1PTO D;  2E2I B;  4C3I G;  2A6E C;  5C4Z A;  1STY A;  4OO1 H;  4K8I A;  5C0X G;  3PO2 B;  2EJG C;  4HSP A;  1Z6H A;  2EXZ A;  2PMZ B;  1KLU D;  4C1N I;  4ZK9 B;  1DON A;  1LTA D;  2A69 C;  4QUC A;  1AN8 A;  3I90 A;  3D6C A;  2NUC A;  5KND A;  1B9M A;  4EQN A;  2N88 A;  3ERO A;  2KJX A;  1SE2 A;  1OXV A;  2AWO A;  1CZG A;  5COR A;  1UUP A;  4H0L C;  3T13 A;  1AZQ A;  5ELC A;  1Q1B A;  3BS1 A;  1F9P A;  3MXP A;  2B8F A;  3J81 L;  2IPK D;  5C3E B;  1JWU D;  2F4I A;  4AYB B;  1NR2 A;  4WFN 3;  4K5X A;  1WD1 A;  2A6H D;  4OIJ A;  4EQP A;  2BDN A;  3FMC A;  2NVQ B;  3W3A A;  4DK1 A;  2EY6 A;  3HZX A;  1KAA A;  1WCM B;  4L6T B;  3HS0 C;  3J80 E;  2PW7 A;  2G9H D;  3ONA B;  2IWH A;  2L12 A;  2SNS A;  2IX3 A;  1W6K A;  3A8K E;  3PUV A;  4KJN A;  1QIL A;  5CC4 A;  4M1U B;  2EVB A;  3R3O A;  1RD9 D;  2X69 A;  2Q8R E;  3CQZ B;  5J39 A;  1ZEQ X;  5M3M B;  3CU7 A;  2NZ1 D;  1EL0 A;  3H91 A;  5EBC A;  3BDC A;  2B2V A;  3PMF A;  4RGM A;  1TS4 A;  3S2D B;  2BCO A;  4IUR A;  2PYK A;  3TZU A;  3KLR A;  5M3F B;  2F0V A;  3PIO 3;  3M7N A;  3W2D A;  1EY7 A;  1PFN A;  1B2T A;  3KLS A;  1SMY D;  3K5O A;  3KK7 A;  4BWG B;  3MZ5 A;  1STG A;  1B53 A;  1ENF A;  1L0Y B;  2JA7 B;  3DWA A;  3QWN A;  3F2U A;  1PYW D;  1EZ6 A;  2L4N A;  4K8J A;  3S9W A;  3V05 A;  3GTG B;  5FO9 B;  2L1B A;  2EJM A;  4RHR A;  1E2W A;  1LT5 D;  1CI3 M;  3S1Q B;  2QIL A;  4EVO A;  3ZYY X;  4XQJ A;  1IYU A;  2EYF A;  2IW3 A;  1ESR A;  1G91 A;  4HSV A;  1B1Z A;  1OXT A;  4K14 A;  2XWJ B;  4IAL A;  2K5W A;  4E6I A;  3MWY W;  1JC7 A;  1SDF A;  1V1O A;  3PUZ A;  2K28 A;  1HXY D;  2BA1 A;  2Q8T A;  4TRD A;  1OXS C;  1PTO H;  5BN5 A;  4B9W A;  2NBF A;  3K5N A;  1CQV A;  2NTT A;  3K5L A;  1SND A;  2ICE C;  2E2J B;  4ZQ3 A;  3A7L A;  4OGQ C;  1HUN A;  1LTG D;  2WII B;  1BCP C;  5C5M A;  1H9S B;  5JEA J;  2QKI C;  1ESF A;  2B2T C;  4CJ1 B;  2E76 C;  2HDL A;  5KYL A;  1JWM D;  2KQ3 A;  2RDH A;  2NVY B;  5IGD A;  1IYV A;  2VUM B;  4KMU C;  3EQL C;  4KV6 A;  1A3T A;  3E5S A;  2GA4 B;  3NP8 A;  5D3I B;  1G2S A;  1Z47 A;  3HRZ C;  3L9A X;  3OIP A;  1M8A A;  1NR4 A;  2F0K A;  3FRP B;  5CR3 A;  4XQQ A;  4DXG A;  2B2Y A;  4R9W A;  3PV0 A;  4ZLT F;  4ZUJ A;  3A56 A;  1KNE A;  1TQO A;  5M5W B;  1TKW B;  3GTP B;  2FJ2 A;  2F3W A;  2CW0 D;  3MXN A;  2SDF A;  3MC0 B;  3GP7 A;  1H9J A;  3MFY A;  1D1K A;  1MSG A;  3BVM A;  3J7A F;  1F2M A;  4TQU S;  1AFP A;  1X3Q A;  2Q8I B;  4J8Q A;  3T53 B;  1ZYR C;  5I6Y A;  5IIF A;  2O2L D;  1VCI A;  3A8J E;  1EEF D;  1EIG A;  3VYS A;  3K59 A;  3MA2 B;  2IX1 A;  2F0F A;  4K2L A;  3SK5 A;  2OXP A;  1TWA B;  3S15 B;  5JAV A;  1GJX A;  1FNV A;  1B9N A;  1XWE A;  1EY6 A;  4KN7 C;  2L55 A;  1HFN A;  2F0U A;  5I4D A;  1QOH A;  2XRS D;  1OXU A;  3NE5 B;  4HCE A;  3CRL C;  2MPM A;  4DAP A;  5A2Q E;  1Y8P B;  2M2L A;  4O1N A;  3CKI B;  4DAV A;  1LTI D;  4V0B A;  4LAA A;  2DNE A;  4XT1 B;  2XIW A;  4DGZ A;  1EZ8 A;  2O4X A;  2JP1 A;  1EU3 A;  3C1F A;  2B2W C;  3KUP A;  3GTK B;  1F2Z A;  1H9S A;  3VR5 A;  1SFO B;  2A6E D;  4IN3 A;  5FOB B;  2J4X A;  5HGT A;  4KKS A;  2EY2 A;  3LX0 A;  3OMG A;  1ROD A;  4A3K B;  3DEO A;  4CJ0 B;  3D3R A;  4FF2 A;  1QCB D;  5HUR A;  1O80 A;  3TME A;  3X3M A;  3HG9 A;  4R8I A;  4K6L A;  4RGO S;  1A3V A;  3QJY A;  3BVG A;  5M9O A;  1LTT D;  5CV8 A;  1PTO F;  3CHB D;  4C3I B;  1TS2 A;  3MHB A;  3RD4 A;  1T5E A;  4PNY A;  3HP3 A;  3NUC A;  4QF4 A;  2EOT A;  5T1I A;  3D4D A;  4KY5 A;  1SNQ A;  2F0G A;  2KUM A;  1Y1V B;  1CT1 D;  1R9T B;  4FXD A;  3GD7 A;  2F1M A;  1Q3L A;  5CV7 A;  4TSS A;  4ZYS A;  1D5X C;  1H9M A;  1SE3 A;  2LFN A;  2SEB D;  1LTS D;  1V43 A;  3MAQ A;  1S5B D;  2FFK B;  1PLF A;  2K1B A;  3T4A C;  2QEJ C;  2ID0 A;  5ISR A;  2NVT B;  3DHQ A;  2NWG A;  3J80 L;  5JEA G;  3GTL B;  3TN2 A;  4GZY C;  4C56 C;  3C3L A;  1EWH A;  1JCK B;  1FR3 A;  4KY7 A;  1TWG B;  3H6M A;  1F77 A;  2QCP X;  2MP1 A;  5I9P A;  1GUS A;  5KNB A;  3HKZ B;  3SK8 A;  4DK0 A;  1HFG A;  5IGF A;  1G2T A;  4IUT A;  5EBD A;  3J7Y W;  3PIP 3;  4CGY B;  3Q22 A;  1PFB A;  3E0J A;  3MXU A;  1F9R A;  3I4N B;  3D8G A;  3D4R A;  3U9S A;  3TP5 A;  1HA5 A;  5K5P A;  1FD7 D;  3X3N A;  3MEH A;  2KEE A;  4IZ8 A;  1BCP B;  3KBG A;  1SEB D;  2Z8L A;  1CHP D;  5C3X A;  1EY8 A;  3QG1 A;  3NBH A;  3NHH A;  1TR5 A;  4YIJ A;  1SYG A;  1O7L A;  1M4V A;  4ABN A;  5EQ0 A;  5LHY 1;  1AP0 A;  4I65 A;  3OHX C;  1YNN C;  2SOB A;  1HQR D;  3IKJ A;  4BBR B;  2PW5 A;  3DWP A;  4C2M B;  2K03 A;  4MN3 A;  4QIW B;  3KLS X;  1DM0 B;  4IQZ A;  2EZV A;  2F0H A;  1IW7 D;  2WAQ B;  4UDU C;  2X6G A;  1ONL A;  2R7Z B;  1LT4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...