5M3FG

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
237
structure length
193
Chain Sequence
ARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
total genus 32
structure length 193
sequence length 237
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3fG02
3HOZG 1QVFA 2RCNA 1U0LA 4IPHA 3PO3H 4DR7Q 5IP7G 3TS0A 3A5UA 1K8GA 4BY7G 4LF4L 4A3IH 2JA8G 4LF8L 4B3TQ 4LFAQ 4A3BH 2ZJPA 1N33L 2YU9H 1K83H 4A3EG 2DGYA 3CCMA 1BKBA 2R7FA 4YY3Q 1QVGA 1VQ7A 1SN8A 1XPRA 1CKOA 4DUYL 1JE5A 2D0OA 3MEFA 2R93G 2Z6KA 2ZJQA 1XPUA 1I6HH 1UE7A 2Y0SE 3KF6B 1FJGL 3U4ZA 3JC66 4AQYL 1C0AA 1I94L 3CPFA 2NVXH 4IPDA 3RLOA 3CCSA 5IWAQ 4HIKA 2HHHL 4X65Q 1KL9A 3AYHB 3KOJA 2Q2TA 3GTOH 1WCMG 4XTCS 4DV3Q 1NBWA 2CWPA 3CC7A 3PO2H 2D0PA 4WJ4A 4C3IH 5ELOA 1G51A 3I4MG 2K14A 2RF4A 3GTJH 1XNQQ 2UXCL 1VQDA 3PSIA 2AHOB 1JT8A 4BBRG 5DLQE 1X3GA 1OXUA 2A19A 2GVAA 4DV2L 3K7AH 4GLAC 2NVTH 1E24A 3S24A 2R7ZH 3K8AA 3G71A 2WP8J 3CC4A 1MKHA 2I5LX 3HKZE 2HT1A 4AH6A 4GN3B 3HOUH 4R4TA 5BR8L 3PO3G 2UXBQ 2R92H 1HR0L 4BBSH 4A3IG 1VQMA 4X66Q 4JI1Q 4DK6C 1PH5A 4LF5Q 4A3BG 4JI0Q 4DR3Q 5AJ3L 2WFWA 3F2DA 1I5FA 3PF4A 4KLKA 4LFCQ 1WJJA 1VQPA 1VQKA 5IP9H 4NXML 1D8LA 5IYDH 1IBLQ 1HR0W 3OTOQ 1HH2P 3A0JA 3CP0A 1XNRL 1TWHH 1SLJA 1Y1VH 3GO5A 1NJIC 2K5NA 1OTCA 2UUCL 1PH2A 5LMUL 4JI7L 4LF9L 1BBWA 5IT9c 3CF5A 4GNXA 3KFUA 4IOAA 4LFBL 2H5XA 1GM5A 4JI6Q 4LWCA 1HNXQ 1X3FA 5JEAJ 4PZ6A 1K0RA 4JI2Q 1G291 2K75A 3PUZA 3ICEA 1GO3E 1B8AA 2MO1A 2B63G 3L7ZC 2PI2E 2F4VQ 4JV5L 1X65A 4L5QA 2R7DA 1YI2A 4A3JG 3RZDH 3PO2G 5E7NA 5JJLA 5H1SE 2K4KA 3T1HQ 5JJIA 4DV7Q 4TQUS 4BA2I 1HJPA 1P16A 1N36Q 2F3IA 1ASYA 3ZJYC 3PF5A 2N49A 1XPOA 1J5EL 3EN2A 3PUXA 2F52A 2E2IH 3M3YH 4OO1I 1VQ4A 2UU9Q 4JI8L 1L1OC 2MO0A 4Y52H 2JA5H 4GKJQ 4BY1G 4HJ7A 2ZM6Q 2KCMA 4HIOA 2R7ZG 1CKNA 3F2BA 1VQBA 4JYAL 2LXJA 2MQHA 4GNXB 1UE5A 3B6YA 2E5LQ 1UE1A 4A3MH 3IRBA 2PNHA 4QY7A 4PMWA 5C44H 2JA7H 2NVQH 3F8TA 1HNZL 2WB1G 1VQHA 2VQFQ 3RLFA 1PYSB 1K8AC 3S15H 2AWOA 1MJEA 3S2HH 3G6EA 4B3SL 2VQEL 2EQSA 4KHZA 5IP9G 2KHIA 4DV6Q 3AFQA 1YJNA 1XJVA 5IYDG 4B3RL 1HZCA 4LNQA 4DUZL 4HJ9A 2JA6G 1HZBA 4EX5A 3TS2A 3M4QA 4YWLA 1I50H 4X64L 4OX9Q 4A4IA 1Y14B 4DPGA 1JB7A 4R4IA 3I7FA 3WWVA 4X62L 1YVCA 1YZ6A 3HOYH 4KHPL 4AYBG 1E3PA 1Q82C 3H15A 3GTQH 1CKNB 3UE1A 3CCQA 1VQ6A 1VQ5A 2ZTEA 1K9MC 3CAMA 2C35B 4OWWB 3H0GH 3UDXA 4B3ML 4R4OA 3F2CA 3KJPA 5C0XG 3EBEA 3UDGA 5M5WH 1R9TH 5C0XI 5C0XJ 1X54A 3J80i 1S72A 1N34Q 2UXDQ 1JJGA 4JI3L 2JE6I 2CKZB 5LMNL 2K5VA 1WOCA 2CQOA 4A3FH 4DV0L 5ELNA 2ZJRA 1QZHA 4ALPA 4P72A 4APVA 4DK3C 2JEAI 4H02A 2Q2HA 4P71A 3ULLA 4DR6L 4DR4Q 1PA6A 5LMNW 4JCVE 4DAYB 1YHQA 3FHWA 4OONA 2VS1A 4YCVA 5M3FG 4A3MG 4JI4Q 5GQOA 5HGQA 4R4CA 5C44G 2JA7G 4IJLA 3NELA 1IYJB 1YHAA 1M90C 1CSPA 1X55A 1VQJA 2BA0A 3NBHB 4IPGA 4YHHQ 1EYGA 4L5SA 4GN5A 3CC2A 1AH9A 1XMOL 3RR5A 5JJKA 3RNUA 3K80C 4DV5Q 1NMGA 1EQRA 3ER0A 1VQNA 1VQAA 1IZ6A 3ERSX 1IBML 3MXNB 5IYCH 1IBKQ 4A3GH 1E7ZA 4MTNA 2UUBQ 1XMQQ 3F1ZA 4DAMA 3D0FA 5GAHC 5M3MH 4A93H 2GVBA 3PUVA 4ME3A 1P8LA 4DR1L 3T1YQ 3U58A 3HOYG 3S2DH 4J15A 3A74A 4MNOA 5EAYA 2IX1A 3BU2A 4LUVA 1MIUA 1KC8C 2E2JH 2QA4A 1VQOA 4LF6Q 2QEXA 2I5MX 2BH2A 3M7NA 4NXNQ 2JEBI 1Q8KA 4PZ7A 3K0XA 5C4JH 3G4SA 3PUYA 2N8NA 2PQAA 1GD7A 1WFQA 4K0KQ 3RLNA 3L0OA 4R1JA 1VQ9A 1A63A 4OXPA 3KDFA 4DV1L 5M5YH 2IHFA 4JBWA 4JI5Q 3M85A 2YYZA 4A76A 4HIDA 4DR5Q 4A3KH 2UUAL 3I4NH 4HIMA 2NZOA 4DV4L 4YWKA 3RZOH 1N32Q 1A62A 3PUWA 4DR2L 3TRZA 3TREA 1KRSA 4PZ8A 3HOVH 2Z6KC 4LW1A 1HNWQ 2B3GA 1VQGA 1W3SA 3ULJA 4C3JH 3PGZA 2LXKA 1PH9A 3S16H 4GOPA 4DR7L 3BJUA 1SMXA 2VZAA 3KLWA 4GKKQ 3KJOA 4L5RC 4OWXB 4B3TL 1BVSA 3I4OA 4P73A 1SR3A 2PQAB 4LUZA 2WAQE 5FJ8H 4DV1Q 2E8GA 3J80c 1X56A 2VL6A 4YY3L 2VNUD 5IYBH 1VCIA 3W1BA 4GLVB 1HZ9A 2I5HA 4P74A 3CCUA 3KDFB 3PV0A 1EUJA 4LF4Q 4LF8Q 1CUKA 2AKWB 1PH6A 2OWOA 1A0IA 2ATWA 1N33Q 3GTKH 3CMEA 1YHBA 2K50A 1O7IA 3UDIA 4JOIA 2XGTA 1M1KC 4DR6Q 1IXRA 2FXQA 2K5HA 3FP9A 2YTXA 5IWAL 4DUYQ 3S1MH 1TWCH 3GTMH 3KF8B 4O2DA 2ZTCA 1Q81C 1T9HA 1G6PA 1NY4A 3J7ZC 3HKZG 3HOWH 1FJGQ 4BA1I 2EXDA 1E22A 3CCJA 4DV3L 4AQYQ 1Z47A 3HOUG 1I94Q 3STBC 3TEHB 4GOPB 3ULPA 1S3OA 3KYHC 2HHHQ 2R92G 2NN6G 1UWVA 1CSQA 4BBSG 4FDBA 1JJ2A 2NN6I 1E1TA 3W5OA 5IP7H 1L0WA 1KAWA 4RG1A 3D31A 1LTLA 5HY6A 3I55A 1MJCA 3UDFA 3A5ZB 1EWIA 2NZHA 1XNQL 4A3KG 1X6OA 4A3EH 3U50C 1SROA 4DNIA 2RHQB 2XTIA 5C4XH 1Y1VG 2CFMA 3H3VH 4QQBX 1UEBA 4IPCA 4QIWE 1OXTA 3GTGH 3HOVG 2KHJA 2UXCQ 2AMCB 4A3DH 2OQKA 3BZCA 1WI5A 2UXBL 3JAMi 4DV2Q 4GNXC 5C3EH 4OWTB 4JBMA 1CKMA 2CCZA 1QZGA 2OCEA 3M9BA 5GADC 4X66L 4LF5L 4JI0L 4DR3L 2AWNA 4LFCL 3M4PA 4LUOA 1LM0A 1U5KA 4L5TA 5BR8Q 5IYBG 1IBLL 2KBNA 5IE8A 2ZTDA 5FLMH 3OTOL 1HR0Q 2I0QA 4BXXH 1A8VA 2KENA 1Q12A 2JQOA 4Y7NH 5AJ3Q 3CW2C 3FKIH 4YWMA 3I4MH 1GVPA 3CCVA 1SRUA 1VQEA 4NXMQ 2JA5G 4JI6L 1YEZA 2LSSA 2BH8A 1HNXL 3S17H 4UP8A 3OYYA 1XNRQ 3NEMA 3TQYA 4JI2L 4C3HH 4DR2Q 2UUCQ 3S1NH 1NE3A 2B29A 5LMUQ 4JI7Q 4LF9Q 4WJ3M 4IOCA 3HOWG 2GN5A 1KIXA 1PHJA 2YV5A 3E0EA 2A1AA 2F4VL 4LFBQ 5FLXc 1TXYA 3J81i 1C7YA 1BBUA 1L2FA 4DKAC 3PIPA 1EQQA 2ES2A 1V9PA 4NPSA 3K7UC 5IY0A 3T1HL 1X3EA 1W2BA 1PH4A 1Q1EA 4DV7L 5GROA 3L2PA 1N36L 1JMCA 4JV5Q 1YJ9A 2ALYB 4MZ9A 2UU9L 5C4XG 4GKJL 1PV4A 3H3VI 3E9IA 2N3SA 3NENA 2ZM6L 3U4VA 2OQ0A 4OO1G 4O0AA 1WYDA 1KD1C 1RL2A 1J5EQ 2OTJA 4A3DG 2E5LL 1OXVA 2YTYA 3G48A 3SGIA 4UY8C 4JI8Q 5C3EG 4GN4B 3AQQA 2MFIA 1TWGH 2VQFL 2K52A 2PI2A 1VQ8A 4LF7L 4UP9A 3AEVA 2CWAA 4HJ8A 4JYAQ 2JA9A 1Q46A 3H0GG 3HFZB 2JJQA 3CCEA 1SFOH 4IFDI 4IFDG 4DV6L 2OTLA 2HIVA 2HQLA 2B63H 3OW2A 4IFDJ 4KI0A 3UE0A 2MNAA 1HNZQ 2KCTA 5FLMG 3CMAA 4BXXG 1YIJA 5J3BA 4A3JH 3PCOB 4R4QA 1Y1WH 4POFA 1Q7YC 3FKIG 1NTGA 3GDEA 4A3FG 4B3SQ 4OX9L 2VQEQ 3CCRA 1V43A 1VQCA 2Q2UA 3M4OH 1L1OA 3GTLH 3RN5A 1YNXA 2Q2IA 4B3RQ 1GKHA 4UP7A 1SE8A 4XIGS 1HZAA 1TWFH 4DUZQ 1S40A 2ASBA 3AFPA 4PG3A 4A3LH 1PH1A 4X64Q 5GAGC 1AE3A 4BY1H 1PYBA 4C2MH 1PH7A 1KHIA 4A75A 3CXCA 1LUZA 1AE2A 4IO9A 1N8RC 1YITA 1JJCB 2Y0SG 3DM3A 3JAMc 1PH3A 1VQLA 1VQFA 2N78A 4X62Q 4KHPQ 1E1OA 1EOVA 2WB1E 4AIMA 2QGQA 1K73C 1J6QA 2IX0A 3STBD 1N34L 2UXDL 4LFAL 1PFSA 4POGA 3E9HA 1ASZA 3CD6A 4JG2A 2JK8A 4B3MQ 1TWAH 4UPAA 4GS3A 1FL0A 5IYCG 4JBKA 4A3GG 1PH8A 4A3CH 2DUDA 4DR4L 2JA6H 1KXLA 2IT1A 5M3MG 3PIOA 4JI3Q 2A8VA 5LMNQ 1OXXK 3S14H 1L1OB 4A93G 1PVOA 1FVIA 4DV0Q 1KRTA 3I56A 3CPWA 1Q1BA 3VDYA 4JI4L 1B70B 2VUMH 4AYBE 1QVCA 5JEAG 4YHHL 3CCLA 2NVYH 4X65L 2RHSB 1Z9FA 4HJ5A 2PMZE 3HOXH 4P75A 3J81c 1EIFA 4YCUA 4DV5L 3K81C 4JBJA 1EIYB 1VQIA 3GD7A 1X9NA 3W1GA 3HOZH 1K3RA 2EIFA 1Y1WG 1IBKL 1FGUA 2UUBL 4HJAA 1XTDA 1XMQL 1XMOQ 4BY7H 3DLLA 2JA8H 4QJFA 1EFWA 2E2HH 4YCWA 2Z0SA 1DGSA 1I3QH 3T1YL 2HIXA 3I4NG 4GLXA 1NMFA 4EQ5A 1KQSA 2IHEA 2BA1A 3BZKA 4RMFA 1IBMQ 4A3LG 1H95A 1C9OA 4LF6L 1VS0A 5K36G 2R93H 4NXNL 4DR1Q 2V1CC 1B7YB 5M3FH 3LGJA 1QUQA 3I2ZA 4K0KL 3S1RH 1Q86C 1D7QA 5GAEC 4QL5A 4JI1L 2L15A 4LF7Q 2D62A 4GOPC 1LYLA 2R6GA 5FJ8G 1WCMH 3GTPH 2WAQG 4JI5L 1YJWA 3J7A5 3S1QH 4A3CG 4DR5L 2YTVA 1RIPA 3J81j 3EIVA 2ID0A 1N32L 1YBYA 2IY5B 3HKSA 5M5XH 1IL2A 2VUMG 4IJHA 2VW9A 1HNWL 3KF6A 4QGUA 2UUAQ 4BBRH 1UE6A 2VY3A 3CQZH 4DV4Q 4X6AH 3RN2A 4GKKL 3HOXG 4JOIC 3Q8DA 1OXSC 4NB3A 4TVAB 1QUQB 1N9WA 1V1QA 4JC0A
chains in the Genus database with same CATH superfamily
1SNDA 3PO3H 1GHJA 1F9SA 3A5UA 2E76C 3T51B 4A3BH 4C3IB 4A3GB 1EYDA 2YU9H 1K83H 1O7ZA 3CCMA 1BKBA 4YY3Q 1ILPA 1MD2D 1VQ7A 1SN8A 1LABA 5ELEA 3K7AB 4QCLA 1VDZA 1CKOA 3FPPA 3MEFA 2E2JB 5EPKA 5FK9C 1UE7A 3U4ZA 1C4QA 1IHZA 3MHBA 4L8JA 1C0AA 3CPFA 4IPDA 1SYGA 5E4WC 5FO7B 3TBIB 3AYHB 2Q2TA 4XTCS 2RKSA 2XRQD 2CWPA 5JVH3 2D0PA 2NZ1D 4KTAA 1STAA 2EYJA 3GTJH 1XNQQ 4HTHA 3PSIA 2UXCL 2O4XA 5DEHA 3FMCA 5DLQE 5BN3A 4DV2L 3O13A 2L1BA 3JAML 3Q24A 2ICEC 5BR8L 2UXBQ 4BWGB 2NB0A 4X3SA 3M7GA 3T13A 3BZDB 5ELCA 4DK6C 4X66Q 4DR3Q 2BE5D 3F2DA 4LFCQ 1VQKA 5IYDH 2EYPA 1HH2P 1I4QA 3QOJA 2JA5B 1XNRL 5I9PA 1SLJA 3E6ZX 1OTCA 4JI7L 3NWSA 4JVZA 3VYSA 1BBWA 4MTKA 3GTMB 3CF5A 4GNXA 3MC0B 3KFUA 2E74C 2CQAA 4LWCA 2PZUA 2F0PA 2PO4A 2NVQB 4OEMB 4ILWA 5E4XA 1B8AA 4UAIA 4KY6A 2QDBA 2PI2E 2F4VQ 1HFNA 1KDBA 4L5QA 1PLFA 3C46A 5E7NA 2G9DA 5CBEE 5C4XB 4BA2I 3NE5B 2F3IA 3GP7A 3ZJYC 2SEBD 2N49A 4OO1I 2F52A 2MO0A 4UHVA 3FDTA 4GKJQ 2O2LD 1PXUA 2ZM6Q 3GTQB 2KCMA 5C3EB 3X3MA 4F8MA 3OPOA 4MHEA 1JWUD 1UEAB 1UE1A 1DZ1A 2B2UA 4JPBW 1YNND 4QY7A 1UUPA 1A2UA 3SK8A 1HNZL 1VQHA 2M00A 3DWAA 1K8AC 2ZXOA 1X3PA 4RGMA 2VQEL 2EQSA 5IP9G 2PZWA 3OHXC 4LNQA 1WD0A 1O80A 1I50H 3S17B 4OX9Q 1TS5A 3WWVA 2H1EA 1YZ6A 1E3PA 1F2ZA 2K5WA 1CKNB 3NBHA 3UE1A 1QNUA 1F9RA 2F0WA 1D1KA 4OWWB 4IFDH 3UDXA 1PZID 4R4OA 1B9MA 3I8ZA 1EIGA 4XT3B 1C8CA 1X54A 5C3WA 1EY5A 2JE6I 5LMNL 4A93B 1QZHA 2Z8LA 2F0EA 1STBA 2AUKA 4H02A 4IQZA 1JOOA 3BDLA 5EKIA 1YHQA 5HGQA 2JA7G 5LHY1 1VQJA 2BA0A 3QB3A 5C4ZA 3F2UA 1Y1WB 1SDFA 2L11A 4DV5Q 5T1IA 2DJFC 2F0LA 3ER0A 3GTLB 2A6HD 1IBML 1IZ6A 1HTPA 3HZXA 3FRPB 1IBKQ 1E7ZA 4DAMA 5M3MH 1LTSD 3H6MA 3U58A 3T16A 1BCPF 2D5DA 3A74A 4MNOA 4LUVA 3D6CA 1KC8C 5A2QE 2QEXA 3M7NA 4PZ7A 3A7LA 4L6TB 2PQAA 2K03A 4HMJA 1WFQA 1TWAB 1VQ9A 4OXPA 3G6JB 5ELBA 3J7YW 1IW7D 3S14B 2WKDA 3OW7A 3M85A 1ML0D 4A76A 4A3KH 1EWHA 3I4NH 2PNRC 5C5LA 1RD9D 5BN4A 3PUWA 1MI2A 4DR2L 3M4YA 4EQNA 5EBDA 3HOXB 1JCKB 1J8IA 1ZKOA 5EKKA 1PH9A 3S16H 4GOPA 3HOZB 3KJOA 4L5RC 5EQ0A 4OWXB 4KJOA 4BY7B 5FJ8H 2A68D 4XT1B 4PQXA 5NUCA 4FXKC 2VL6A 4YY3L 3KBGA 1G8ZD 3PV0A 1EUJA 1CUKA 3ND8A 2ATWA 2IL8A 3GTKH 1YHBA 2Q8RE 3UDIA 1H9SA 4JOIA 2XGTA 5D3DA 4DR6Q 3K0YA 3VYTA 1AP0A 1TU2B 2EE1A 3KF8B 4HAEA 4XQJA 2GA4B 2EXDA 3CRKC 3IL8A 3NTIA 3GTPB 1DOKA 3TEHB 3KYHC 2NN6G 5JJZA 4P2CB 4QMGA 5IP7H 1MHWC 1EWIA 1XNQL 3I4MB 4A3EH 2L9HA 4DNIA 2XTIA 3H3VH 4QQBX 2J0TD 4TSSA 4QB4A 2OF1A 1SE4A 4IN3A 3GTGH 3HOVG 5C5MA 2VB2X 3R2TA 1GUNA 3BZCA 2UXBL 3JAMi 4GNXC 1FNVA 2EZVA 3PO3B 4X66L 1I4RA 3SDZA 4QUFA 4DR3L 4A3BB 2EJMA 3U9OA 4LFCL 3MTSA 4LUOA 2YU9B 1K83B 1HR0Q 2ZTDA 3A8KE 1Q12A 2CH4W 2RDGA 5AJ3Q 3CW2C 4NXMQ 1VQEA 3RD4A 2F0MA 4RHSA 2K33A 4H0LC 2KECA 4TKOB 4C3HH 2UUCQ 3S1NH 4WJ3M 4IOCA 4KJNA 3SHLA 3HS0C 1SFOB 3E0EA 5D3IB 2F4VL 5FLXc 1TXYA 2B63B 1LTAD 1A3VA 2B39A 4KKSA 2B2UC 1EQQA 2N55A 5IY0A 3K7UC 1W2BA 5EJWA 3L2PA 5CGKA 3GTJB 4MZ9A 4GKJL 1PV4A 3E9IA 2N3SA 2ZM6L 4BY1B 1KD1C 1II3A 2A73B 3WOEA 1LT6D 1RDPD 4K2KA 3AQQA 2MFIA 5CC4A 1D6EC 2F0QA 2PI2A 1VQ8A 4LF7L 4UP9A 3AEVA 1Q46A 1D5ZC 2JA9A 3HFZB 4IFDG 3OWFA 4DAPA 3UE0A 1IL8A 2MNAA 3CMAA 1WTRA 2M2LA 1Q7YC 3SK5A 4OX9L 3GDEA 4B3SQ 3PIP3 1V43A 1GKHA 1KLUD 1TWFH 4DUZQ 3C2PA 3MAQA 4A3LH 1CHQD 4PV1C 2NWGA 4C2MH 1U9RA 4A75A 3CXCA 1PH3A 1N8RC 3OIPA 1JWMD 3FVQA 2Y0SG 1YITA 1DCZA 2Z6BA 4X62Q 3K5LA 2DNCA 1E1OA 4M8AA 3BVZA 4POGA 1ASZA 4CKBA 4B3MQ 2KA7A 2ICIA 4JBKA 1JE4A 5M3MG 1KDAA 5IGCA 4I65A 1NAPA 3PIOA 1OXXK 2A8VA 1FVIA 3CPWA 1B70B 3JAME 1EIHA 1QVCA 5T1GA 1G2SA 3CCLA 1H9KA 2F0SA 3A8IE 1SBBB 1Z9FA 4CGYB 1HUMA 4P75A 1F9PA 4DV5L 1KABA 1EEFD 1EU4A 1KNAA 2EIFA 1IBKL 4GZYC 4HJAA 1I50B 2RQXA 4QUCA 3VR6A 3WOFA 3I4NG 2F0HA 1NMFA 1KQSA 2IHEA 2BA1A 3BZKA 1CI3M 4DR1Q 1B7YB 5GAEC 1WTXA 2L15A 4GOPC 1RTOA 4KK7A 5FJ8G 1QCBD 2WAQG 1TT2A 1GUGA 1GUTA 1V8QA 4A3CG 3U9SA 2K32A 3V2TA 1EZ8A 2FJ2A 2H4OA 4IJHA 1Y8OB 2Y0SB 4M1UB 2VY3A 4X6AH 4JOIC 4TVAB 5LL6S 5FLXL 4CDDC 2RCNA 5IP7G 3C1EA 4HSPA 4LFAQ 1LTGD 1I4XA 4A3EG 1F2MA 3HEJA 2DGYA 2R7FA 1QVGA 2L0CA 2HUGA 2NVTB 2KCCA 2R93G 2Y0SE 1O7LA 4KY7A 3KF6B 2K1BA 3JC66 5ELFA 2NVXH 2XIWA 3I3CA 3HKZB 1HCZA 3CCSA 2R92B 4X65Q 1XYIA 1KL9A 2BDNA 3GTOH 1FYCA 3V96A 4DV3Q 1NBWA 1QNKA 3GV6A 4A3KB 1D1IA 2RBMA 1KAAA 5CV4A 5ELOA 5ELDA 1G51A 1Y1VB 1A3UA 2E75C 2K14A 4G4KA 2RF4A 1CA5A 3SK4A 2AHOB 3A54A 1T5EA 4C3HG 3Q0AA 3OWEB 3S24A 3CC4A 3HKZE 3NQIA 5BN5A 1STGA 2X6LA 4R4TA 4IZ8A 2WAQB 1HR0L 3RZDB 1VQMA 4DGZA 3K57A 2PZTA 4XQQA 5AJ3L 1AEXA 2WFWA 4EQOA 1VQPA 1PYWD 5IP9H 4NXML 3GTKB 1D8LA 1EY6A 2XWJB 1TWHH 3GO5A 5F2DA 2UUCL 3W3AA 1PH2A 3G7LA 1U4RA 5IT9c 1K3BC 2HCCA 3MA2B 1SE3A 4JI6Q 3A7AB 2PW7A 2WINB 3ICEA 3HRZC 5I2XA 4WRDA 4KN4C 2FFKB 1MSGA 1X65A 2R7DA 1YI2A 4G7OC 5H1SE 5AFWA 1SE2A 1ILQA 1P16A 1ASYA 4OO1G 5I9OA 3GTGB 1GOZA 2IJ0A 1VQ4A 2EJGC 1U4MA 2PQEA 2CH4A 4HIOA 2R7ZG 3F2BA 1VQBA 2ENBA 2MQHA 4DU9A 2B2TA 3IRBA 2JA7H 3H0GB 2MP1A 1HFGA 2K5DA 3S15H 4B3SL 4DN4M 2KHIA 2F0UA 2HQEA 4DUZL 1R4QB 4EX5A 3M4QA 3TS2A 2WIIB 4DK1A 4CDCC 1NR2A 1Y14B 4DAYA 3S1NB 5IODA 3DHQA 5JOBA 4X62L 1H9SB 4ME5A 5CR3A 4AYBG 4EGVA 1Q82C 3Q23A 2ZTEA 1C48A 2ZXRA 5DM63 5JPNC 4B3ML 3KJPA 3EBEA 3UDGA 1R9TH 5I6YA 1S72A 3MXNA 1PRTB 3A56A 1WOCA 1AN8A 2CQOA 2A74C 2E2DC 4NKLA 4P72A 1CQVA 4RH6A 2Q2HA 1GUSA 4DR4Q 3AMUA 1PMRA 3FHWA 4OONA 4YCVA 2QKIC 2NYZD 4R4CA 5C44G 4IJLA 1YHAA 2TMPA 2JYOA 4G7ZC 4IPGA 2SNSA 4YHHQ 1AZPA 4L5SA 4GN5A 3CC2A 4EVOA 5JJKA 4UDUC 1F2YA 1NMGA 5M5YB 1EQRA 2A6EC 3NBIA 4PMBA 5J22A 4DA2A 2JXMB 2UUBQ 2EY2A 2PYKA 4DR1L 3HOYG 2SNMA 3S2DH 4J15A 1B2TA 1UAPA 2XRSD 3BU2A 4C3JB 1X3QA 2I5MX 5C4JH 2EDGA 3G4SA 3C3LA 3SE0A 1NR4A 2NN6H 5KNBA 2Q8TA 2SOBA 2TSSA 1QJOA 1HHVA 2O5JC 3MXPA 1DOLA 2IHFA 4JBWA 3QOLA 4JI5Q 2NZOA 1K28A 1Q90A 3TRZA 2WKCA 5IT9L 2WV6D 3HOVH 2B3GA 1SNMA 3ULJA 2D2CC 2P5ZX 3BJUA 5IOCA 3OSOA 3I4OA 2E8GA 3J80L 1VCIA 4C1NK 1DJRD 3KDFB 3LNNA 4J8QA 4LF4Q 4LF8Q 2AKWB 1PH6A 2G5DA 1B4OA 1O7IA 5JAVA 2K5HA 5FO8B 4DUYQ 3S1MH 2AQ2B 3EJIA 1Q81C 1G6PA 2DY8A 1NY4A 1S5DD 1FJGQ 4BA1I 3CCJA 4DV3L 4AQYQ 1I94Q 3STBC 3T53B 2XSCA 1S3OA 2HHHQ 1UWVA 4K5WA 1E1TA 4L63B 4RG1A 3I55A 3UDFA 1BNZA 1GHKA 4O42A 1SROA 1EYCA 2RHQB 1E2VA 1K0SA 1Y8NB 2CFMA 5C4HA 2Z4IA 1EU3A 3NXWA 4IPCA 4DAVA 1OXTA 4IALA 4C56C 1SYFA 1WI5A 3SR1A 3M9BA 5GADC 5EPLA 2B2YA 3ZYYX 2KUMA 3M4PA 2HCIA 1V1PB 4LMQD 2EVBA 1SJHD 2IPKD 2I0QA 2A6ED 5KNCA 1A8VA 3AB9A 1CHPD 2JQOA 3CHBD 4Y7NH 4YWMA 2F0TA 1GVPA 1SRUA 2LY7A 2EOTA 4JI6L 2NTSA 3NEMA 2N88A 1BOSA 2B29A 4LF9Q 3HOWG 2GN5A 2PW5A 3R2IA 3GTOB 2YV5A 2A1AA 1XX8A 2B2TC 1L2FA 2ES2A 1S4ZA 1V9PA 4NPSA 4KMUC 1SNQA 1RODA 3RMHA 4RAUC 2Q8IB 3M4OB 1QG7A 2ALYB 4DK0A 4F87A 3NENA 4WFN3 4O0AA 3KUPA 1J5EQ 3HGBA 2OTJA 4A3DG 1EQVA 1OXVA 3G48A 4GN4B 5FLXE 2CVRA 1VMCA 1TWGH 1W6KA 4JYAQ 4HJ8A 4R8NA 2HIVA 3NSWA 5G3LF 5FLMG 4BXXG 4HR7B 1YIJA 4F88A 2F0KA 4R4QA 2PPBC 4HCSA 3FKIG 2EXZA 2AUJD 4ZKBB 1LO5D 1L1OA 3RN5A 2Q2IA 4B3RQ 4UP7A 1HZAA 1S40A 1L0XB 3D4RA 1EY9A 3K59A 2G9HD 4PG3A 1PH1A 4DXFA 2NVYB 3BDOA 4IO9A 2QCPX 1HPCA 4KHPQ 1W6JA 1EOVA 4AIMA 2FINB 2RDFA 1PZJD 2QGQA 1J6QA 3STBD 2OT2A 4OIKA 3CD6A 3RUZA 1HTLD 5KYIA 1GJXA 4JG2A 2JK8A 2LFNA 2EYHA 4UPAA 4A3CH 2RA4A 4DR4L 4JI3Q 1A6XA 2JA7B 4YHHL 2MHVA 4FF1A 3S15B 1IYVA 3J81c 3QG1A 1PFBA 1VQIA 1PTOF 1SYCA 3GD7A 3URYA 3W1GA 4RFBA 1CM9A 1LT5D 2UUBL 4XXEA 3MFGA 3DLLA 4QJFA 2E2HH 2R3ZA 2Z0SA 2EYFA 4RMFA 1QB5D 2KVMA 1BCPC 1VS0A 4FXGC 2R93H 1D5MC 3PIO3 1I6VC 1QUQA 1ZXTA 4LJZC 1NCVA 1LYLA 2R6GA 3LWUA 4H7BA 4ULLA 4JI5L 2EYOA 3S1QH 1WTHA 2YTVA 3LWEA 2KOLA 3I90A 3J81j 1YBYA 5C3XA 1R4PB 2VUMG 3TDQA 4QGUA 2VB3X 3EQLC 2Z1CA 2UUAQ 1UE6A 3CQZH 2DY7A 3Q8DA 4IUTA 5A35A 5E3FA 4I7ZC 3R93A 1EY0A 5KIXA 1U0LA 4IPHA 3TS0A 1K8GA 1BQQT 4LF4L 3I73A 2JA8G 4LF8L 4CJ0B 1BXTA 2ZJPA 1WTVA 3S2DB 2F0FA 4DUYL 1PFNA 2D0OA 1LTID 2Z6KA 4ID6A 1XPUA 1I6HH 2XWBB 1WTWA 3P20A 1FJGL 4AQYL 1I94L 2HHHL 4HIKA 3K5OA 1PTOC 1WCMG 3I72A 5CORA 2A69C 2B2YC 1TY2A 4WJ4A 4C3IH 1YNJC 2VXWA 4ZK9B 3BYYB 4OO1H 3MXUA 1VQDA 3GQBA 1JT8A 4BBRG 3HOVB 1X3GA 1OXUA 2A19A 2GVAA 3K7AH 1I4HA 1E24A 2R7ZH 3K8AA 1MKHA 1CTMA 4AH6A 4GN3B 5TSSA 3H94A 4ZKCB 5KEEA 4LK1C 5CV6A 2KEEA 4BBSH 4A3IG 4JI1Q 4LF5Q 4JI0Q 3EROA 1I5FA 4KLKA 1WJJA 2F03A 4RGTA 2X6GA 3C1FA 1IBLQ 1H9MA 5DNFA 4FVMA 3OTOQ 1V1OA 3CP0A 1NJIC 4RGNA 5KRUA 4LF9L 3S1MB 3DEOA 1BCPD 3VR4A 4IOAA 2H5XA 1GM5A 1HNXQ 5FO9B 1X3FA 1KLGD 4Q5VA 1K0RA 1KTKA 3R3OA 2K75A 3J81L 1LACA 3L7ZC 3BDCA 5KNDA 3QIAA 3PO2G 5JJIA 3T1HQ 1PRTF 1BDOA 3DEPA 4TQUS 4DV7Q 1HJPA 1N36Q 1J5EL 3PF5A 2E2IH 3PUXA 5IT9E 5IGGA 2UU9Q 4FYDA 1L1OC 4X3UA 4Y52H 2JA5H 1WVLA 4HEDA 3S9WA 1CKNA 2ZT9C 4JYAL 2LXJA 4GNXB 5ISRA 3B6YA 1M4VA 1ET9A 4PMWA 5C44H 2NVQH 2WB1G 3J80E 4CJ2C 4O1NA 3K58A 1PYSB 3I70A 2AWOA 4FF4A 3V05A 3S2HH 3G6EA 4KHZA 2DJGC 2EPBA 3AFQA 4B3RL 4B9XA 1HZBA 2NUCA 2F0GA 2KEDA 5D65A 1JB7A 3I7FA 1YVCA 4NW2A 3HOYH 4KHPL 3GTQH 1D2BA 3CCQA 1VQ6A 4K5XA 1VQ5A 3CAMA 2C35B 2K5QA 4IUVA 4RKBA 1ESRA 1Z6HA 1JQYD 1LV9A 1S5BD 5C0XI 1AW7A 5C0XJ 1RCVD 4JI3L 5IGEA 4A3FH 5M3MB 1BR9A 1YNJD 4K14A 4ALPA 3KLSA 2A5HA 4APVA 4DK3C 1WTPA 2JEAI 1TIID 2BCOA 4P71A 3ULLA 4DR6L 1EEID 2F0OA 5LMNW 1TWGB 1AFPA 4JCVE 2VS1A 1JORA 4A3MG 4JI4Q 3EFXD 1EY8A 3NUCA 4HSVA 5GQOA 4IURA 5J1ZA 1MSHA 5EBCA 1X55A 3NBHB 3TP7A 1AH9A 5IGFA 4FXDA 2I07B 3RNUA 3K80C 1M8AA 4KY5A 3CU7A 4R8IA 5IYCH 3I4NB 1D5XC 1B9NA 2HDLA 3A55A 4A93H 2K04A 4ME3A 1HQRD 1HUNA 1A15A 4XDXA 1CQFA 1SXTA 2V4DA 3S16B 2QA4A 1VQOA 4N9TA 4BS9A 4ZLTF 3K0XA 3PUYA 2N8NA 4K0KQ 3RLNA 4R1JA 1MGSA 3DM1A 3H91A 3DXJC 1ENFA 2D9UA 1Q3LA 1VF7A 1A2TA 2F3WA 2UUAL 2CHBD 3MWYW 3RZOH 1G91A 1A62A 4FO2A 3KF8A 1KRSA 1LT4D 2Z6KC 1VQGA 4E6IA 3EVQA 1LTTD 3D4DA 4GKKQ 1BVSA 4P73A 1SR3A 1STHA 2PQAB 2WAQE 4DV1Q 2E2HB 3J80c 1X56A 2VNUD 1DYQA 4A3EB 3IFTA 4C3IG 3QWNA 4GLVB 1HZ9A 2I5HA 4P74A 4ZCKA 1I4PA 3CCUA 3HP3A 1VMPA 1A0IA 1KDCA 1N33Q 2HDMA 1H9JA 3CMEA 4QIWB 2R93B 2K50A 1XTCD 5DAUA 4HMIA 2J7ZA 1EFID 2L55A 1IXRA 3FP9A 2YTXA 4WORA 1TWCH 3KLRA 2F0IA 2EY1A 3HOWH 3EA6A 1Z47A 4GOPB 3ULPA 4BBSG 1CSQA 3S1QB 4FDBA 3W5OA 2OEOA 1KAWA 3D31A 1LTLA 5HY6A 3A5ZB 2NZHA 1X6OA 4XYOA 3U50C 1UNSA 3E0JA 1TS2A 3UI2A 3CQZB 4QIWE 5KYLA 4C3HB 2B2WA 2AMCB 4A3DH 1QILA 2K7VA 2F0VA 4OWTB 1FR3A 5IGDA 2ZXPA 4LF5L 4ZRZA 2QW7A 4JI0L 2AWNA 3X3NA 4OL7A 1U5KA 4L5TA 5IYBG 2BOSA 1IBLL 3HG9A 5FLMH 3OTOL 4BXXH 1ONLA 1JOQA 4S3SA 3FKIH 4KD3A 3I4MH 1I6HB 1GUOA 1SAPA 3KK7A 2JA5G 2KCNA 4RCNA 1YEZA 2LSSA 2F4IA 1HNXL 4UP8A 2SDFA 3D3RA 1FGBD 4DR2Q 1NE3A 1S5ED 1YNNC 5LMUQ 1KIXA 1PHJA 4LFBQ 3J81i 2JP1A 2AQ3B 1NNXA 3T1HL 1X3EA 4DV7L 5CV5A 1N36L 4JV5Q 4XQNA 1GXDC 1VF5C 2UU9L 4LAAA 5C4XG 1TWFB 1CZWA 5C6AA 1F9QA 2RSNA 3H3VI 1IKLA 3U4VA 4C2MB 1WYDA 2R7ZB 2LKVA 2YTYA 4UY8C 1HXYD 4JI8Q 1XXGA 4KN7C 5C3EG 4ODGA 2F3VA 3OMGA 4BBSB 1SFOH 2JJQA 4KKUA 1KXLA 2OTLA 2B63H 1QOHA 5EKLA 5J3BA 4A3JH 3PCOB 4A3FG 3DUZA 1VQCA 2Q2UA 4XIGS 1SE8A 4CDEC 3ERQA 1HQMC 4X64Q 2CW0C 4AYBB 4BY1H 2K6AA 1PH7A 3Q22A 1LUZA 5E1FA 1JJCB 3DM3A 4YIJA 4G57A 1DOMA 1PDQA 2F0NA 4XYQA 5CV7A 1RTNA 3K6OA 5CBAE 1ICWA 1PFSA 2KHSA 2F0DA 4LFAL 3E9HA 2A6HC 3BYTB 4K5VA 3WDNA 4FP5D 3BVMA 4IUUA 3J7AV 2E2IB 5IYCG 1ZEQX 1STNA 2DUDA 4DF7A 1F2LA 2JA6H 2IT1A 1NSNS 4A93G 3H09A 2M9VA 4DV0Q 4JI4L 2VUMH 1Q1BA 1ENCA 4AYBE 5C44B 5JEAG 1BF4A 2PCFB 4DXGA 4X65L 2RHSB 2FHTA 2F1MA 4HJ5A 2NBFA 1EIFA 4FF3A 3S2HB 4YCUA 1Y69U 3K81C 1Z7TA 2Z4HA 4JBJA 1MBYA 3K5MA 1X9NA 1K3RA 1TVXA 1Y1WG 5C0XH 1IW7C 1ICFB 1XMOQ 2JA8H 2KJXA 1DGSA 1I3QH 2HIXA 3BVGA 4GLXA 3HOYB 1DM0B 3OMCA 4JW0A 1C9OA 3IKJA 3ONAB 3J81E 5M3FH 3LGJA 4N9PA 3I2ZA 5CMDA 4K0KL 3S1RH 1Q86C 1D7QA 4JK1C 3NPPA 4QL5A 4ZYSA 4LF7Q 3TN2A 2A68C 1WCMH 4A3FB 3J7A5 1ZYRC 5CV9A 1RIPA 1G6ZA 2C9OA 3EIVA 5CYUA 3HKSA 5M5XH 2IY5B 1E0BA 2FMCA 1S5CD 4CKEA 3L3OC 3P7JA 5FKAC 3KF6A 4BBRH 2MUYA 2NVXB 4DV4Q 1SNOA 4GKKL 3HOXG 1KNEA 3I91A 3P1HA 1JICA 1OXSC 4NB3A 4DV1L 4JC0A 4IUNA 3HOZG 4H13C 3VA7A 3DMUA 4N8X1 1QVFA 4DR7Q 4BY7G 4A3IH 4B3TQ 1N33L 1ESFA 1CFMA 3R8BA 1TKWB 2J4XA 1XPRA 1JE5A 2AQ1B 2ZJQA 2CW0D 1XWEA 2B2WC 3RLOA 5IWAQ 2F0JA 4RHRA 3DWQA 3KOJA 1PTOH 4RWSC 3SVMA 3CC7A 3PO2H 2L5TA 3SEBA 1ENAA 4J1MA 3RZOB 1TWHB 2R61A 4K6DA 3I4MG 3TZDA 1QWYA 3QJYA 2LMCB 1EY7A 1O7YA 4ZUIA 2IX3A 4GLAC 2NVTH 4RCOA 3G71A 2WP8J 1RKNA 2I5LX 4CDFC 2HT1A 3OOCA 3HOUH 3PO3G 3N6RA 2R92H 2XNAC 4A3BG 1PH5A 3PF4A 3D4WA 1JR0D 2IWHA 1HR0W 1F77A 3A0JA 1B53A 4G7HC 1Y1VH 2K5NA 1U4LA 5LMUL 1TWCB 4ZQ3A 4LFBL 3HOWB 3W2DA 5JEAJ 1JB3A 4PZ6A 1T5XD 4JI2Q 1G291 2LS01 3PUZA 1GO3E 2MO1A 2B63G 1RF2D 4JV5L 4K6LA 4A3JG 3RZDH 1S5FD 5JJLA 2K4KA 1O78A 1ZYRD 5M9OA 1XPOA 2K28A 3EN2A 3M3YH 4JI8L 4A3DB 1LTBD 5KGUA 4BY1G 4HJ7A 1TQOA 1UE5A 3AU7A 2E5LQ 1GUWA 4A3MH 2PNHA 4B9WA 3F8TA 2JSOA 3TP5A 3KBXA 4QF4A 2VQFQ 3RLFA 2QILA 1R9TB 4ZAIA 1MJEA 1TY0A 3FKIB 4DV6Q 1YJNA 1XJVA 5IYDG 1AZQA 1HZCA 1Y8PB 2IW3A 4HJ9A 2JA6G 4YWLA 4X64L 4A4IA 1WTOA 4DPGA 4FNFA 4R4IA 4V190 1EL0A 1JOKA 1IYUA 1X32A 3H15A 1DXMA 1EOTA 1K9MC 3TMEA 2DNEA 3H0GH 5L37A 3F2CA 1PZKD 1L0YB 5C0XG 2QEJC 5HGTA 5M5WH 1RHPA 3J80i 1N34Q 1JWSD 2UXDQ 4U673 1JJGA 2CKZB 2K5VA 4DV0L 5ELNA 2ZJRA 4HCEA 2QF7A 1SSOA 3NHHA 1PA6A 1FD7D 1SYEA 4DAYB 5M3FG 2B2VA 3NELA 1IYJB 5C4JB 1M90C 1CSPA 1EYGA 4MIUA 4HN7A 4A3JB 1XMOL 3RR5A 4NP5A 5J39A 4RA8A 3L9AX 3NWTA 1VQNA 1VQAA 1JC7A 3ERSX 5LL6X 3MXNB 4DFAA 4A3GH 1EY4A 4MTNA 1XMQQ 3F1ZA 3D0FA 5GAHC 1LT3D 1SMYC 2GVBA 3PUVA 1P8LA 3T1YQ 1EYAA 4C1NI 4H44C 5EAYA 2IX1A 1MIUA 2E2JH 4LF6Q 3Q6SA 4Z9CB 1K8MA 2BH2A 4NXNQ 2JEBI 1Q8KA 4WJWA 4F7XA 3TSSA 1GD7A 1QE6A 3L0OA 5DM73 4CJ1B 3MEHA 1A63A 2JA6B 3KDFA 3VYUA 5JVG3 4MN3A 1B3QA 3ITPA 5M5YH 4EQPA 4CKCA 4KV6A 2VUMB 2YYZA 2MPMA 4HIDA 4DR5Q 4ABNA 4HIMA 1J9OA 4DV4L 4YWKA 1N32Q 3TREA 2OXPA 3VYRA 4K8IA 1LLRD 5K36H 4PZ8A 2X69A 4LW1A 1HNWQ 1W3SA 3MFYA 3PGZA 4C3JH 2LXKA 3VR2A 4DR7L 1SMXA 2VZAA 3NP8A 3KLWA 2JN4A 4B3TL 5EPJA 5D14A 2JA8B 4LUZA 3I4LA 1B3AA 1I3QB 5G3LD 5IYBH 3W1BA 4IUPA 4DNTB 2OWOA 3P75A 2NTTA 3PMFA 1BCPB 5M3FB 1E2WA 2BDOA 4CHTB 1M1KC 4FF2A 2FXQA 1A3TA 5IWAL 3S1RB 3TP8A 3GTMH 4O2DA 4DNRB 2ZTCA 1B1ZA 1T9HA 3J7ZC 3HKZG 3HOUG 1E22A 1WCMB 2R92G 2EYLA 1PFMA 4ZUJA 1V1PA 1JJ2A 2NN6I 1RJTA 1L0WA 1SJED 2FMMA 4Y7NB 5M5XB 1MJCA 1CZGA 5I6WA 4A3KG 3H3VC 3N52A 1BUVT 3CKIB 5C4XH 1Y1VG 4BBRB 1UEBA 3VR3A 1B44D 2MGSA 2KHJA 1NUCA 2UXCQ 2OQKA 5COYA 3TP6A 4DV2Q 5C3EH 4JBMA 1CKMA 4CBVA 3FEWX 3E5SA 5IIFA 2OCEA 1QZGA 2CCZA 1Q8IA 1BO0A 2O5IC 4A3IB 4B08A 3MVVA 4X3TA 3IAYA 1LM0A 1B50A 1PTOD 3GV3A 5BR8Q 2A69D 2KBNA 5IE8A 3NQTA 1BBXC 2KENA 4KD4A 5CV8A 4OHJA 3K5NA 1I4GA 4N8FA 3CCVA 4K2LA 1SMYD 3S17H 2BH8A 1HA6A 3OYYA 1XNRQ 3TQYA 3FPUB 4JI2L 4JI7Q 1C7YA 1BBUA 1PTOB 3NTHA 4DKAC 5A2QL 3PIPA 2HD3A 1PH4A 2RDHA 3PO2B 1CT1D 1H9RA 1Q1EA 4Q0FA 5GROA 1JMCA 2RCFA 1YJ9A 1PRTC 2DN8A 1IKMA 1CK1A 2B8GA 2OQ0A 1RL2A 1EZ6A 2E5LL 5IGBA 3SGIA 4OIJA 2KQ3A 3DWPA 1TR5A 3HOUB 5JEAH 3T4AC 2VQFL 2K52A 2WB1B 1ET6A 2CWAA 3D8GA 3H0GG 2K05A 3CCEA 3LX0A 3D6WA 4DV6L 4IFDI 4IFDJ 1LTRD 2HQLA 3OW2A 3KLSX 4KI0A 1HNZQ 2KCTA 3PQIA 5JPMC 4PNYA 2RVLA 1Y1WH 4POFA 1NTGA 2L12A 2VQEQ 2XN9C 3CCRA 1WD1A 3M4OH 3GTLH 3IFDA 1YNXA 4KHVA 4IUQA 2ASBA 1SNPA 3AFPA 4I7AA 4NMZA 5GAGC 1AE3A 1PYBA 2EJFC 1KHIA 1AE2A 3SK6A 1STYA 1VQLA 3J7AF 3JAMc 1DD2A 1U4PA 1VQFA 2N78A 1DONA 2PMZB 3NK9A 2WB1E 2K01A 2B2VC 4NDXA 3QR8A 1K73C 2IX0A 1N34L 2UXDL 3OIQA 2I46A 1TWAH 2B8FA 3E3XA 5EGTA 1K8OA 4GS3A 1FL0A 3M3YB 3QO2A 4A3GG 1PH8A 2QDLA 4KKTA 1TS3A 3ND9A 1PVOA 3A8JE 5LMNQ 3S14H 1L1OB 3CRLC 1E2ZA 1KRTA 3I56A 4J6HA 3VDYA 4A3MB 4K8JA 1TS4A 2NVYH 1SYBA 2MJ8A 2PMZE 3HOXH 5K5PA 1SYDA 3VA5A 1SNCA 1EIYB 3HOZH 5I4DA 4V0BA 2Z9HA 2BE5C 1FGUA 4BY7H 1XTDA 3SXHA 3BS1A 1XMQL 4RGOS 5FOBB 1EFWA 4YCWA 3T1YL 2EY6A 4OELB 1CA6A 4EQ5A 1IBMQ 4A3LG 2C5CA 2EY5A 1HRJA 3MXGA 4OGQC 1H95A 4LF6L 3NTKA 2RSOA 5K36G 4NXNL 2V1CC 3T56B 1EQTA 4C3JG 1WTQA 3BG3A 4TRDA 4JI1L 5M5WB 2D62A 4X3KA 4U68A 3GTPH 1FNWA 5HURA 1YJWA 4DR5L 2L4NA 4PMCA 2EYMA 4R9WA 1PRTD 2ID0A 1N32L 3MZ5A 1IL2A 4RKLA 1OO9B 3TZUA 1EWCA 1HA5A 2WACA 2VW9A 1HNWL 2XVSA 3VR5A 3RN2A 1SEBD 5I2YA 1G2TA 1QUQB 1N9WA 1FNUA 1V1QA 1STEA
chains in the Genus database with same CATH topology
3HOZG 1QVFA 2RCNA 1U0LA 4IPHA 3PO3H 4DR7Q 5IP7G 3TS0A 3A5UA 1K8GA 4BY7G 4LF4L 4A3IH 2JA8G 4LF8L 4B3TQ 4LFAQ 4A3BH 2ZJPA 1N33L 2YU9H 1K83H 4A3EG 2DGYA 3CCMA 1BKBA 2R7FA 4YY3Q 1QVGA 1VQ7A 1SN8A 1XPRA 1CKOA 4DUYL 1JE5A 2D0OA 3MEFA 2R93G 2Z6KA 2ZJQA 1XPUA 1I6HH 1UE7A 2Y0SE 3KF6B 1FJGL 3U4ZA 3JC66 4AQYL 1C0AA 1I94L 3CPFA 2NVXH 4IPDA 3RLOA 3CCSA 5IWAQ 4HIKA 2HHHL 4X65Q 1KL9A 3AYHB 3KOJA 2Q2TA 3GTOH 1WCMG 4XTCS 4DV3Q 1NBWA 2CWPA 3CC7A 3PO2H 2D0PA 4WJ4A 4C3IH 5ELOA 1G51A 3I4MG 2K14A 2RF4A 3GTJH 1XNQQ 2UXCL 1VQDA 3PSIA 2AHOB 1JT8A 4BBRG 5DLQE 1X3GA 1OXUA 2A19A 2GVAA 4DV2L 3K7AH 4GLAC 2NVTH 1E24A 3S24A 2R7ZH 3K8AA 3G71A 2WP8J 3CC4A 1MKHA 2I5LX 3HKZE 2HT1A 4AH6A 4GN3B 3HOUH 4R4TA 5BR8L 3PO3G 2UXBQ 2R92H 1HR0L 4BBSH 4A3IG 1VQMA 4X66Q 4JI1Q 4DK6C 1PH5A 4LF5Q 4A3BG 4JI0Q 4DR3Q 5AJ3L 2WFWA 3F2DA 1I5FA 3PF4A 4KLKA 4LFCQ 1WJJA 1VQPA 1VQKA 5IP9H 4NXML 1D8LA 5IYDH 1IBLQ 1HR0W 3OTOQ 1HH2P 3A0JA 3CP0A 1XNRL 1TWHH 1SLJA 1Y1VH 3GO5A 1NJIC 2K5NA 1OTCA 2UUCL 1PH2A 5LMUL 4JI7L 4LF9L 1BBWA 5IT9c 3CF5A 4GNXA 3KFUA 4IOAA 4LFBL 2H5XA 1GM5A 4JI6Q 4LWCA 1HNXQ 1X3FA 5JEAJ 4PZ6A 1K0RA 4JI2Q 1G291 2K75A 3PUZA 3ICEA 1GO3E 1B8AA 2MO1A 2B63G 3L7ZC 2PI2E 2F4VQ 4JV5L 1X65A 4L5QA 2R7DA 1YI2A 4A3JG 3RZDH 3PO2G 5E7NA 5JJLA 5H1SE 2K4KA 3T1HQ 5JJIA 4DV7Q 4TQUS 4BA2I 1HJPA 1P16A 1N36Q 2F3IA 1ASYA 3ZJYC 3PF5A 2N49A 1XPOA 1J5EL 3EN2A 3PUXA 2F52A 2E2IH 3M3YH 4OO1I 1VQ4A 2UU9Q 4JI8L 1L1OC 2MO0A 4Y52H 2JA5H 4GKJQ 4BY1G 4HJ7A 2ZM6Q 2KCMA 4HIOA 2R7ZG 1CKNA 3F2BA 1VQBA 4JYAL 2LXJA 2MQHA 4GNXB 1UE5A 3B6YA 2E5LQ 1UE1A 4A3MH 3IRBA 2PNHA 4QY7A 4PMWA 5C44H 2JA7H 2NVQH 3F8TA 1HNZL 2WB1G 1VQHA 2VQFQ 3RLFA 1PYSB 1K8AC 3S15H 2AWOA 1MJEA 3S2HH 3G6EA 4B3SL 2VQEL 2EQSA 4KHZA 5IP9G 2KHIA 4DV6Q 3AFQA 1YJNA 1XJVA 5IYDG 4B3RL 1HZCA 4LNQA 4DUZL 4HJ9A 2JA6G 1HZBA 4EX5A 3TS2A 3M4QA 4YWLA 1I50H 4X64L 4OX9Q 4A4IA 1Y14B 4DPGA 1JB7A 4R4IA 3I7FA 3WWVA 4X62L 1YVCA 1YZ6A 3HOYH 4KHPL 4AYBG 1E3PA 1Q82C 3H15A 3GTQH 1CKNB 3UE1A 3CCQA 1VQ6A 1VQ5A 2ZTEA 1K9MC 3CAMA 2C35B 4OWWB 3H0GH 3UDXA 4B3ML 4R4OA 3F2CA 3KJPA 5C0XG 3EBEA 3UDGA 5M5WH 1R9TH 5C0XI 5C0XJ 1X54A 3J80i 1S72A 1N34Q 2UXDQ 1JJGA 4JI3L 2JE6I 2CKZB 5LMNL 2K5VA 1WOCA 2CQOA 4A3FH 4DV0L 5ELNA 2ZJRA 1QZHA 4ALPA 4P72A 4APVA 4DK3C 2JEAI 4H02A 2Q2HA 4P71A 3ULLA 4DR6L 4DR4Q 1PA6A 5LMNW 4JCVE 4DAYB 1YHQA 3FHWA 4OONA 2VS1A 4YCVA 5M3FG 4A3MG 4JI4Q 5GQOA 5HGQA 4R4CA 5C44G 2JA7G 4IJLA 3NELA 1IYJB 1YHAA 1M90C 1CSPA 1X55A 1VQJA 2BA0A 3NBHB 4IPGA 4YHHQ 1EYGA 4L5SA 4GN5A 3CC2A 1AH9A 1XMOL 3RR5A 5JJKA 3RNUA 3K80C 4DV5Q 1NMGA 1EQRA 3ER0A 1VQNA 1VQAA 1IZ6A 3ERSX 1IBML 3MXNB 5IYCH 1IBKQ 4A3GH 1E7ZA 4MTNA 2UUBQ 1XMQQ 3F1ZA 4DAMA 3D0FA 5GAHC 5M3MH 4A93H 2GVBA 3PUVA 4ME3A 1P8LA 4DR1L 3T1YQ 3U58A 3HOYG 3S2DH 4J15A 3A74A 4MNOA 5EAYA 2IX1A 3BU2A 4LUVA 1MIUA 1KC8C 2E2JH 2QA4A 1VQOA 4LF6Q 2QEXA 2I5MX 2BH2A 3M7NA 4NXNQ 2JEBI 1Q8KA 4PZ7A 3K0XA 5C4JH 3G4SA 3PUYA 2N8NA 2PQAA 1GD7A 1WFQA 4K0KQ 3RLNA 3L0OA 4R1JA 1VQ9A 1A63A 4OXPA 3KDFA 4DV1L 5M5YH 2IHFA 4JBWA 4JI5Q 3M85A 2YYZA 4A76A 4HIDA 4DR5Q 4A3KH 2UUAL 3I4NH 4HIMA 2NZOA 4DV4L 4YWKA 3RZOH 1N32Q 1A62A 3PUWA 4DR2L 3TRZA 3TREA 1KRSA 4PZ8A 3HOVH 2Z6KC 4LW1A 1HNWQ 2B3GA 1VQGA 1W3SA 3ULJA 4C3JH 3PGZA 2LXKA 1PH9A 3S16H 4GOPA 4DR7L 3BJUA 1SMXA 2VZAA 3KLWA 4GKKQ 3KJOA 4L5RC 4OWXB 4B3TL 1BVSA 3I4OA 4P73A 1SR3A 2PQAB 4LUZA 2WAQE 5FJ8H 4DV1Q 2E8GA 3J80c 1X56A 2VL6A 4YY3L 2VNUD 5IYBH 1VCIA 3W1BA 4GLVB 1HZ9A 2I5HA 4P74A 3CCUA 3KDFB 3PV0A 1EUJA 4LF4Q 4LF8Q 1CUKA 2AKWB 1PH6A 2OWOA 1A0IA 2ATWA 1N33Q 3GTKH 3CMEA 1YHBA 2K50A 1O7IA 3UDIA 4JOIA 2XGTA 1M1KC 4DR6Q 1IXRA 2FXQA 2K5HA 3FP9A 2YTXA 5IWAL 4DUYQ 3S1MH 1TWCH 3GTMH 3KF8B 4O2DA 2ZTCA 1Q81C 1T9HA 1G6PA 1NY4A 3J7ZC 3HKZG 3HOWH 1FJGQ 4BA1I 2EXDA 1E22A 3CCJA 4DV3L 4AQYQ 1Z47A 3HOUG 1I94Q 3STBC 3TEHB 4GOPB 3ULPA 1S3OA 3KYHC 2HHHQ 2R92G 2NN6G 1UWVA 1CSQA 4BBSG 4FDBA 1JJ2A 2NN6I 1E1TA 3W5OA 5IP7H 1L0WA 1KAWA 4RG1A 3D31A 1LTLA 5HY6A 3I55A 1MJCA 3UDFA 3A5ZB 1EWIA 2NZHA 1XNQL 4A3KG 1X6OA 4A3EH 3U50C 1SROA 4DNIA 2RHQB 2XTIA 5C4XH 1Y1VG 2CFMA 3H3VH 4QQBX 1UEBA 4IPCA 4QIWE 1OXTA 3GTGH 3HOVG 2KHJA 2UXCQ 2AMCB 4A3DH 2OQKA 3BZCA 1WI5A 2UXBL 3JAMi 4DV2Q 4GNXC 5C3EH 4OWTB 4JBMA 1CKMA 2CCZA 1QZGA 2OCEA 3M9BA 5GADC 4X66L 4LF5L 4JI0L 4DR3L 2AWNA 4LFCL 3M4PA 4LUOA 1LM0A 1U5KA 4L5TA 5BR8Q 5IYBG 1IBLL 2KBNA 5IE8A 2ZTDA 5FLMH 3OTOL 1HR0Q 2I0QA 4BXXH 1A8VA 2KENA 1Q12A 2JQOA 4Y7NH 5AJ3Q 3CW2C 3FKIH 4YWMA 3I4MH 1GVPA 3CCVA 1SRUA 1VQEA 4NXMQ 2JA5G 4JI6L 1YEZA 2LSSA 2BH8A 1HNXL 3S17H 4UP8A 3OYYA 1XNRQ 3NEMA 3TQYA 4JI2L 4C3HH 4DR2Q 2UUCQ 3S1NH 1NE3A 2B29A 5LMUQ 4JI7Q 4LF9Q 4WJ3M 4IOCA 3HOWG 2GN5A 1KIXA 1PHJA 2YV5A 3E0EA 2A1AA 2F4VL 4LFBQ 5FLXc 1TXYA 3J81i 1C7YA 1BBUA 1L2FA 4DKAC 3PIPA 1EQQA 2ES2A 1V9PA 4NPSA 3K7UC 5IY0A 3T1HL 1X3EA 1W2BA 1PH4A 1Q1EA 4DV7L 5GROA 3L2PA 1N36L 1JMCA 4JV5Q 1YJ9A 2ALYB 4MZ9A 2UU9L 5C4XG 4GKJL 1PV4A 3H3VI 3E9IA 2N3SA 3NENA 2ZM6L 3U4VA 2OQ0A 4OO1G 4O0AA 1WYDA 1KD1C 1RL2A 1J5EQ 2OTJA 4A3DG 2E5LL 1OXVA 2YTYA 3G48A 3SGIA 4UY8C 4JI8Q 5C3EG 4GN4B 3AQQA 2MFIA 1TWGH 2VQFL 2K52A 2PI2A 1VQ8A 4LF7L 4UP9A 3AEVA 2CWAA 4HJ8A 4JYAQ 2JA9A 1Q46A 3H0GG 3HFZB 2JJQA 3CCEA 1SFOH 4IFDI 4IFDG 4DV6L 2OTLA 2HIVA 2HQLA 2B63H 3OW2A 4IFDJ 4KI0A 3UE0A 2MNAA 1HNZQ 2KCTA 5FLMG 3CMAA 4BXXG 1YIJA 5J3BA 4A3JH 3PCOB 4R4QA 1Y1WH 4POFA 1Q7YC 3FKIG 1NTGA 3GDEA 4A3FG 4B3SQ 4OX9L 2VQEQ 3CCRA 1V43A 1VQCA 2Q2UA 3M4OH 1L1OA 3GTLH 3RN5A 1YNXA 2Q2IA 4B3RQ 1GKHA 4UP7A 1SE8A 4XIGS 1HZAA 1TWFH 4DUZQ 1S40A 2ASBA 3AFPA 4PG3A 4A3LH 1PH1A 4X64Q 5GAGC 1AE3A 4BY1H 1PYBA 4C2MH 1PH7A 1KHIA 4A75A 3CXCA 1LUZA 1AE2A 4IO9A 1N8RC 1YITA 1JJCB 2Y0SG 3DM3A 3JAMc 1PH3A 1VQLA 1VQFA 2N78A 4X62Q 4KHPQ 1E1OA 1EOVA 2WB1E 4AIMA 2QGQA 1K73C 1J6QA 2IX0A 3STBD 1N34L 2UXDL 4LFAL 1PFSA 4POGA 3E9HA 1ASZA 3CD6A 4JG2A 2JK8A 4B3MQ 1TWAH 4UPAA 4GS3A 1FL0A 5IYCG 4JBKA 4A3GG 1PH8A 4A3CH 2DUDA 4DR4L 2JA6H 1KXLA 2IT1A 5M3MG 3PIOA 4JI3Q 2A8VA 5LMNQ 1OXXK 3S14H 1L1OB 4A93G 1PVOA 1FVIA 4DV0Q 1KRTA 3I56A 3CPWA 1Q1BA 3VDYA 4JI4L 1B70B 2VUMH 4AYBE 1QVCA 5JEAG 4YHHL 3CCLA 2NVYH 4X65L 2RHSB 1Z9FA 4HJ5A 2PMZE 3HOXH 4P75A 3J81c 1EIFA 4YCUA 4DV5L 3K81C 4JBJA 1EIYB 1VQIA 3GD7A 1X9NA 3W1GA 3HOZH 1K3RA 2EIFA 1Y1WG 1IBKL 1FGUA 2UUBL 4HJAA 1XTDA 1XMQL 1XMOQ 4BY7H 3DLLA 2JA8H 4QJFA 1EFWA 2E2HH 4YCWA 2Z0SA 1DGSA 1I3QH 3T1YL 2HIXA 3I4NG 4GLXA 1NMFA 4EQ5A 1KQSA 2IHEA 2BA1A 3BZKA 4RMFA 1IBMQ 4A3LG 1H95A 1C9OA 4LF6L 1VS0A 5K36G 2R93H 4NXNL 4DR1Q 2V1CC 1B7YB 5M3FH 3LGJA 1QUQA 3I2ZA 4K0KL 3S1RH 1Q86C 1D7QA 5GAEC 4QL5A 4JI1L 2L15A 4LF7Q 2D62A 4GOPC 1LYLA 2R6GA 5FJ8G 1WCMH 3GTPH 2WAQG 4JI5L 1YJWA 3J7A5 3S1QH 4A3CG 4DR5L 2YTVA 1RIPA 3J81j 3EIVA 2ID0A 1N32L 1YBYA 2IY5B 3HKSA 5M5XH 1IL2A 2VUMG 4IJHA 2VW9A 1HNWL 3KF6A 4QGUA 2UUAQ 4BBRH 1UE6A 2VY3A 3CQZH 4DV4Q 4X6AH 3RN2A 4GKKL 3HOXG 4JOIC 3Q8DA 1OXSC 4NB3A 4TVAB 1QUQB 1N9WA 1V1QA 4JC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ G;  1QVF A;  2RCN A;  1U0L A;  4IPH A;  3PO3 H;  4DR7 Q;  5IP7 G;  3TS0 A;  3A5U A;  1K8G A;  4BY7 G;  4LF4 L;  4A3I H;  2JA8 G;  4LF8 L;  4B3T Q;  4LFA Q;  4A3B H;  2ZJP A;  1N33 L;  2YU9 H;  1K83 H;  4A3E G;  2DGY A;  3CCM A;  1BKB A;  2R7F A;  4YY3 Q;  1QVG A;  1VQ7 A;  1SN8 A;  1XPR A;  1CKO A;  4DUY L;  1JE5 A;  2D0O A;  3MEF A;  2R93 G;  2Z6K A;  2ZJQ A;  1XPU A;  1I6H H;  1UE7 A;  2Y0S E;  3KF6 B;  1FJG L;  3U4Z A;  3JC6 6;  4AQY L;  1C0A A;  1I94 L;  3CPF A;  2NVX H;  4IPD A;  3RLO A;  3CCS A;  5IWA Q;  4HIK A;  2HHH L;  4X65 Q;  1KL9 A;  3AYH B;  3KOJ A;  2Q2T A;  3GTO H;  1WCM G;  4XTC S;  4DV3 Q;  1NBW A;  2CWP A;  3CC7 A;  3PO2 H;  2D0P A;  4WJ4 A;  4C3I H;  5ELO A;  1G51 A;  3I4M G;  2K14 A;  2RF4 A;  3GTJ H;  1XNQ Q;  2UXC L;  1VQD A;  3PSI A;  2AHO B;  1JT8 A;  4BBR G;  5DLQ E;  1X3G A;  1OXU A;  2A19 A;  2GVA A;  4DV2 L;  3K7A H;  4GLA C;  2NVT H;  1E24 A;  3S24 A;  2R7Z H;  3K8A A;  3G71 A;  2WP8 J;  3CC4 A;  1MKH A;  2I5L X;  3HKZ E;  2HT1 A;  4AH6 A;  4GN3 B;  3HOU H;  4R4T A;  5BR8 L;  3PO3 G;  2UXB Q;  2R92 H;  1HR0 L;  4BBS H;  4A3I G;  1VQM A;  4X66 Q;  4JI1 Q;  4DK6 C;  1PH5 A;  4LF5 Q;  4A3B G;  4JI0 Q;  4DR3 Q;  5AJ3 L;  2WFW A;  3F2D A;  1I5F A;  3PF4 A;  4KLK A;  4LFC Q;  1WJJ A;  1VQP A;  1VQK A;  5IP9 H;  4NXM L;  1D8L A;  5IYD H;  1IBL Q;  1HR0 W;  3OTO Q;  1HH2 P;  3A0J A;  3CP0 A;  1XNR L;  1TWH H;  1SLJ A;  1Y1V H;  3GO5 A;  1NJI C;  2K5N A;  1OTC A;  2UUC L;  1PH2 A;  5LMU L;  4JI7 L;  4LF9 L;  1BBW A;  5IT9 c;  3CF5 A;  4GNX A;  3KFU A;  4IOA A;  4LFB L;  2H5X A;  1GM5 A;  4JI6 Q;  4LWC A;  1HNX Q;  1X3F A;  5JEA J;  4PZ6 A;  1K0R A;  4JI2 Q;  1G29 1;  2K75 A;  3PUZ A;  3ICE A;  1GO3 E;  1B8A A;  2MO1 A;  2B63 G;  3L7Z C;  2PI2 E;  2F4V Q;  4JV5 L;  1X65 A;  4L5Q A;  2R7D A;  1YI2 A;  4A3J G;  3RZD H;  3PO2 G;  5E7N A;  5JJL A;  5H1S E;  2K4K A;  3T1H Q;  5JJI A;  4DV7 Q;  4TQU S;  4BA2 I;  1HJP A;  1P16 A;  1N36 Q;  2F3I A;  1ASY A;  3ZJY C;  3PF5 A;  2N49 A;  1XPO A;  1J5E L;  3EN2 A;  3PUX A;  2F52 A;  2E2I H;  3M3Y H;  4OO1 I;  1VQ4 A;  2UU9 Q;  4JI8 L;  1L1O C;  2MO0 A;  4Y52 H;  2JA5 H;  4GKJ Q;  4BY1 G;  4HJ7 A;  2ZM6 Q;  2KCM A;  4HIO A;  2R7Z G;  1CKN A;  3F2B A;  1VQB A;  4JYA L;  2LXJ A;  2MQH A;  4GNX B;  1UE5 A;  3B6Y A;  2E5L Q;  1UE1 A;  4A3M H;  3IRB A;  2PNH A;  4QY7 A;  4PMW A;  5C44 H;  2JA7 H;  2NVQ H;  3F8T A;  1HNZ L;  2WB1 G;  1VQH A;  2VQF Q;  3RLF A;  1PYS B;  1K8A C;  3S15 H;  2AWO A;  1MJE A;  3S2H H;  3G6E A;  4B3S L;  2VQE L;  2EQS A;  4KHZ A;  5IP9 G;  2KHI A;  4DV6 Q;  3AFQ A;  1YJN A;  1XJV A;  5IYD G;  4B3R L;  1HZC A;  4LNQ A;  4DUZ L;  4HJ9 A;  2JA6 G;  1HZB A;  4EX5 A;  3TS2 A;  3M4Q A;  4YWL A;  1I50 H;  4X64 L;  4OX9 Q;  4A4I A;  1Y14 B;  4DPG A;  1JB7 A;  4R4I A;  3I7F A;  3WWV A;  4X62 L;  1YVC A;  1YZ6 A;  3HOY H;  4KHP L;  4AYB G;  1E3P A;  1Q82 C;  3H15 A;  3GTQ H;  1CKN B;  3UE1 A;  3CCQ A;  1VQ6 A;  1VQ5 A;  2ZTE A;  1K9M C;  3CAM A;  2C35 B;  4OWW B;  3H0G H;  3UDX A;  4B3M L;  4R4O A;  3F2C A;  3KJP A;  5C0X G;  3EBE A;  3UDG A;  5M5W H;  1R9T H;  5C0X I;  5C0X J;  1X54 A;  3J80 i;  1S72 A;  1N34 Q;  2UXD Q;  1JJG A;  4JI3 L;  2JE6 I;  2CKZ B;  5LMN L;  2K5V A;  1WOC A;  2CQO A;  4A3F H;  4DV0 L;  5ELN A;  2ZJR A;  1QZH A;  4ALP A;  4P72 A;  4APV A;  4DK3 C;  2JEA I;  4H02 A;  2Q2H A;  4P71 A;  3ULL A;  4DR6 L;  4DR4 Q;  1PA6 A;  5LMN W;  4JCV E;  4DAY B;  1YHQ A;  3FHW A;  4OON A;  2VS1 A;  4YCV A;  5M3F G;  4A3M G;  4JI4 Q;  5GQO A;  5HGQ A;  4R4C A;  5C44 G;  2JA7 G;  4IJL A;  3NEL A;  1IYJ B;  1YHA A;  1M90 C;  1CSP A;  1X55 A;  1VQJ A;  2BA0 A;  3NBH B;  4IPG A;  4YHH Q;  1EYG A;  4L5S A;  4GN5 A;  3CC2 A;  1AH9 A;  1XMO L;  3RR5 A;  5JJK A;  3RNU A;  3K80 C;  4DV5 Q;  1NMG A;  1EQR A;  3ER0 A;  1VQN A;  1VQA A;  1IZ6 A;  3ERS X;  1IBM L;  3MXN B;  5IYC H;  1IBK Q;  4A3G H;  1E7Z A;  4MTN A;  2UUB Q;  1XMQ Q;  3F1Z A;  4DAM A;  3D0F A;  5GAH C;  5M3M H;  4A93 H;  2GVB A;  3PUV A;  4ME3 A;  1P8L A;  4DR1 L;  3T1Y Q;  3U58 A;  3HOY G;  3S2D H;  4J15 A;  3A74 A;  4MNO A;  5EAY A;  2IX1 A;  3BU2 A;  4LUV A;  1MIU A;  1KC8 C;  2E2J H;  2QA4 A;  1VQO A;  4LF6 Q;  2QEX A;  2I5M X;  2BH2 A;  3M7N A;  4NXN Q;  2JEB I;  1Q8K A;  4PZ7 A;  3K0X A;  5C4J H;  3G4S A;  3PUY A;  2N8N A;  2PQA A;  1GD7 A;  1WFQ A;  4K0K Q;  3RLN A;  3L0O A;  4R1J A;  1VQ9 A;  1A63 A;  4OXP A;  3KDF A;  4DV1 L;  5M5Y H;  2IHF A;  4JBW A;  4JI5 Q;  3M85 A;  2YYZ A;  4A76 A;  4HID A;  4DR5 Q;  4A3K H;  2UUA L;  3I4N H;  4HIM A;  2NZO A;  4DV4 L;  4YWK A;  3RZO H;  1N32 Q;  1A62 A;  3PUW A;  4DR2 L;  3TRZ A;  3TRE A;  1KRS A;  4PZ8 A;  3HOV H;  2Z6K C;  4LW1 A;  1HNW Q;  2B3G A;  1VQG A;  1W3S A;  3ULJ A;  4C3J H;  3PGZ A;  2LXK A;  1PH9 A;  3S16 H;  4GOP A;  4DR7 L;  3BJU A;  1SMX A;  2VZA A;  3KLW A;  4GKK Q;  3KJO A;  4L5R C;  4OWX B;  4B3T L;  1BVS A;  3I4O A;  4P73 A;  1SR3 A;  2PQA B;  4LUZ A;  2WAQ E;  5FJ8 H;  4DV1 Q;  2E8G A;  3J80 c;  1X56 A;  2VL6 A;  4YY3 L;  2VNU D;  5IYB H;  1VCI A;  3W1B A;  4GLV B;  1HZ9 A;  2I5H A;  4P74 A;  3CCU A;  3KDF B;  3PV0 A;  1EUJ A;  4LF4 Q;  4LF8 Q;  1CUK A;  2AKW B;  1PH6 A;  2OWO A;  1A0I A;  2ATW A;  1N33 Q;  3GTK H;  3CME A;  1YHB A;  2K50 A;  1O7I A;  3UDI A;  4JOI A;  2XGT A;  1M1K C;  4DR6 Q;  1IXR A;  2FXQ A;  2K5H A;  3FP9 A;  2YTX A;  5IWA L;  4DUY Q;  3S1M H;  1TWC H;  3GTM H;  3KF8 B;  4O2D A;  2ZTC A;  1Q81 C;  1T9H A;  1G6P A;  1NY4 A;  3J7Z C;  3HKZ G;  3HOW H;  1FJG Q;  4BA1 I;  2EXD A;  1E22 A;  3CCJ A;  4DV3 L;  4AQY Q;  1Z47 A;  3HOU G;  1I94 Q;  3STB C;  3TEH B;  4GOP B;  3ULP A;  1S3O A;  3KYH C;  2HHH Q;  2R92 G;  2NN6 G;  1UWV A;  1CSQ A;  4BBS G;  4FDB A;  1JJ2 A;  2NN6 I;  1E1T A;  3W5O A;  5IP7 H;  1L0W A;  1KAW A;  4RG1 A;  3D31 A;  1LTL A;  5HY6 A;  3I55 A;  1MJC A;  3UDF A;  3A5Z B;  1EWI A;  2NZH A;  1XNQ L;  4A3K G;  1X6O A;  4A3E H;  3U50 C;  1SRO A;  4DNI A;  2RHQ B;  2XTI A;  5C4X H;  1Y1V G;  2CFM A;  3H3V H;  4QQB X;  1UEB A;  4IPC A;  4QIW E;  1OXT A;  3GTG H;  3HOV G;  2KHJ A;  2UXC Q;  2AMC B;  4A3D H;  2OQK A;  3BZC A;  1WI5 A;  2UXB L;  3JAM i;  4DV2 Q;  4GNX C;  5C3E H;  4OWT B;  4JBM A;  1CKM A;  2CCZ A;  1QZG A;  2OCE A;  3M9B A;  5GAD C;  4X66 L;  4LF5 L;  4JI0 L;  4DR3 L;  2AWN A;  4LFC L;  3M4P A;  4LUO A;  1LM0 A;  1U5K A;  4L5T A;  5BR8 Q;  5IYB G;  1IBL L;  2KBN A;  5IE8 A;  2ZTD A;  5FLM H;  3OTO L;  1HR0 Q;  2I0Q A;  4BXX H;  1A8V A;  2KEN A;  1Q12 A;  2JQO A;  4Y7N H;  5AJ3 Q;  3CW2 C;  3FKI H;  4YWM A;  3I4M H;  1GVP A;  3CCV A;  1SRU A;  1VQE A;  4NXM Q;  2JA5 G;  4JI6 L;  1YEZ A;  2LSS A;  2BH8 A;  1HNX L;  3S17 H;  4UP8 A;  3OYY A;  1XNR Q;  3NEM A;  3TQY A;  4JI2 L;  4C3H H;  4DR2 Q;  2UUC Q;  3S1N H;  1NE3 A;  2B29 A;  5LMU Q;  4JI7 Q;  4LF9 Q;  4WJ3 M;  4IOC A;  3HOW G;  2GN5 A;  1KIX A;  1PHJ A;  2YV5 A;  3E0E A;  2A1A A;  2F4V L;  4LFB Q;  5FLX c;  1TXY A;  3J81 i;  1C7Y A;  1BBU A;  1L2F A;  4DKA C;  3PIP A;  1EQQ A;  2ES2 A;  1V9P A;  4NPS A;  3K7U C;  5IY0 A;  3T1H L;  1X3E A;  1W2B A;  1PH4 A;  1Q1E A;  4DV7 L;  5GRO A;  3L2P A;  1N36 L;  1JMC A;  4JV5 Q;  1YJ9 A;  2ALY B;  4MZ9 A;  2UU9 L;  5C4X G;  4GKJ L;  1PV4 A;  3H3V I;  3E9I A;  2N3S A;  3NEN A;  2ZM6 L;  3U4V A;  2OQ0 A;  4OO1 G;  4O0A A;  1WYD A;  1KD1 C;  1RL2 A;  1J5E Q;  2OTJ A;  4A3D G;  2E5L L;  1OXV A;  2YTY A;  3G48 A;  3SGI A;  4UY8 C;  4JI8 Q;  5C3E G;  4GN4 B;  3AQQ A;  2MFI A;  1TWG H;  2VQF L;  2K52 A;  2PI2 A;  1VQ8 A;  4LF7 L;  4UP9 A;  3AEV A;  2CWA A;  4HJ8 A;  4JYA Q;  2JA9 A;  1Q46 A;  3H0G G;  3HFZ B;  2JJQ A;  3CCE A;  1SFO H;  4IFD I;  4IFD G;  4DV6 L;  2OTL A;  2HIV A;  2HQL A;  2B63 H;  3OW2 A;  4IFD J;  4KI0 A;  3UE0 A;  2MNA A;  1HNZ Q;  2KCT A;  5FLM G;  3CMA A;  4BXX G;  1YIJ A;  5J3B A;  4A3J H;  3PCO B;  4R4Q A;  1Y1W H;  4POF A;  1Q7Y C;  3FKI G;  1NTG A;  3GDE A;  4A3F G;  4B3S Q;  4OX9 L;  2VQE Q;  3CCR A;  1V43 A;  1VQC A;  2Q2U A;  3M4O H;  1L1O A;  3GTL H;  3RN5 A;  1YNX A;  2Q2I A;  4B3R Q;  1GKH A;  4UP7 A;  1SE8 A;  4XIG S;  1HZA A;  1TWF H;  4DUZ Q;  1S40 A;  2ASB A;  3AFP A;  4PG3 A;  4A3L H;  1PH1 A;  4X64 Q;  5GAG C;  1AE3 A;  4BY1 H;  1PYB A;  4C2M H;  1PH7 A;  1KHI A;  4A75 A;  3CXC A;  1LUZ A;  1AE2 A;  4IO9 A;  1N8R C;  1YIT A;  1JJC B;  2Y0S G;  3DM3 A;  3JAM c;  1PH3 A;  1VQL A;  1VQF A;  2N78 A;  4X62 Q;  4KHP Q;  1E1O A;  1EOV A;  2WB1 E;  4AIM A;  2QGQ A;  1K73 C;  1J6Q A;  2IX0 A;  3STB D;  1N34 L;  2UXD L;  4LFA L;  1PFS A;  4POG A;  3E9H A;  1ASZ A;  3CD6 A;  4JG2 A;  2JK8 A;  4B3M Q;  1TWA H;  4UPA A;  4GS3 A;  1FL0 A;  5IYC G;  4JBK A;  4A3G G;  1PH8 A;  4A3C H;  2DUD A;  4DR4 L;  2JA6 H;  1KXL A;  2IT1 A;  5M3M G;  3PIO A;  4JI3 Q;  2A8V A;  5LMN Q;  1OXX K;  3S14 H;  1L1O B;  4A93 G;  1PVO A;  1FVI A;  4DV0 Q;  1KRT A;  3I56 A;  3CPW A;  1Q1B A;  3VDY A;  4JI4 L;  1B70 B;  2VUM H;  4AYB E;  1QVC A;  5JEA G;  4YHH L;  3CCL A;  2NVY H;  4X65 L;  2RHS B;  1Z9F A;  4HJ5 A;  2PMZ E;  3HOX H;  4P75 A;  3J81 c;  1EIF A;  4YCU A;  4DV5 L;  3K81 C;  4JBJ A;  1EIY B;  1VQI A;  3GD7 A;  1X9N A;  3W1G A;  3HOZ H;  1K3R A;  2EIF A;  1Y1W G;  1IBK L;  1FGU A;  2UUB L;  4HJA A;  1XTD A;  1XMQ L;  1XMO Q;  4BY7 H;  3DLL A;  2JA8 H;  4QJF A;  1EFW A;  2E2H H;  4YCW A;  2Z0S A;  1DGS A;  1I3Q H;  3T1Y L;  2HIX A;  3I4N G;  4GLX A;  1NMF A;  4EQ5 A;  1KQS A;  2IHE A;  2BA1 A;  3BZK A;  4RMF A;  1IBM Q;  4A3L G;  1H95 A;  1C9O A;  4LF6 L;  1VS0 A;  5K36 G;  2R93 H;  4NXN L;  4DR1 Q;  2V1C C;  1B7Y B;  5M3F H;  3LGJ A;  1QUQ A;  3I2Z A;  4K0K L;  3S1R H;  1Q86 C;  1D7Q A;  5GAE C;  4QL5 A;  4JI1 L;  2L15 A;  4LF7 Q;  2D62 A;  4GOP C;  1LYL A;  2R6G A;  5FJ8 G;  1WCM H;  3GTP H;  2WAQ G;  4JI5 L;  1YJW A;  3J7A 5;  3S1Q H;  4A3C G;  4DR5 L;  2YTV A;  1RIP A;  3J81 j;  3EIV A;  2ID0 A;  1N32 L;  1YBY A;  2IY5 B;  3HKS A;  5M5X H;  1IL2 A;  2VUM G;  4IJH A;  2VW9 A;  1HNW L;  3KF6 A;  4QGU A;  2UUA Q;  4BBR H;  1UE6 A;  2VY3 A;  3CQZ H;  4DV4 Q;  4X6A H;  3RN2 A;  4GKK L;  3HOX G;  4JOI C;  3Q8D A;  1OXS C;  4NB3 A;  4TVA B;  1QUQ B;  1N9W A;  1V1Q A;  4JC0 A; 
#chains in the Genus database with same CATH topology
 1SND A;  3PO3 H;  1GHJ A;  1F9S A;  3A5U A;  2E76 C;  3T51 B;  4A3B H;  4C3I B;  4A3G B;  1EYD A;  2YU9 H;  1K83 H;  1O7Z A;  3CCM A;  1BKB A;  4YY3 Q;  1ILP A;  1MD2 D;  1VQ7 A;  1SN8 A;  1LAB A;  5ELE A;  3K7A B;  4QCL A;  1VDZ A;  1CKO A;  3FPP A;  3MEF A;  2E2J B;  5EPK A;  5FK9 C;  1UE7 A;  3U4Z A;  1C4Q A;  1IHZ A;  3MHB A;  4L8J A;  1C0A A;  3CPF A;  4IPD A;  1SYG A;  5E4W C;  5FO7 B;  3TBI B;  3AYH B;  2Q2T A;  4XTC S;  2RKS A;  2XRQ D;  2CWP A;  5JVH 3;  2D0P A;  2NZ1 D;  4KTA A;  1STA A;  2EYJ A;  3GTJ H;  1XNQ Q;  4HTH A;  3PSI A;  2UXC L;  2O4X A;  5DEH A;  3FMC A;  5DLQ E;  5BN3 A;  4DV2 L;  3O13 A;  2L1B A;  3JAM L;  3Q24 A;  2ICE C;  5BR8 L;  2UXB Q;  4BWG B;  2NB0 A;  4X3S A;  3M7G A;  3T13 A;  3BZD B;  5ELC A;  4DK6 C;  4X66 Q;  4DR3 Q;  2BE5 D;  3F2D A;  4LFC Q;  1VQK A;  5IYD H;  2EYP A;  1HH2 P;  1I4Q A;  3QOJ A;  2JA5 B;  1XNR L;  5I9P A;  1SLJ A;  3E6Z X;  1OTC A;  4JI7 L;  3NWS A;  4JVZ A;  3VYS A;  1BBW A;  4MTK A;  3GTM B;  3CF5 A;  4GNX A;  3MC0 B;  3KFU A;  2E74 C;  2CQA A;  4LWC A;  2PZU A;  2F0P A;  2PO4 A;  2NVQ B;  4OEM B;  4ILW A;  5E4X A;  1B8A A;  4UAI A;  4KY6 A;  2QDB A;  2PI2 E;  2F4V Q;  1HFN A;  1KDB A;  4L5Q A;  1PLF A;  3C46 A;  5E7N A;  2G9D A;  5CBE E;  5C4X B;  4BA2 I;  3NE5 B;  2F3I A;  3GP7 A;  3ZJY C;  2SEB D;  2N49 A;  4OO1 I;  2F52 A;  2MO0 A;  4UHV A;  3FDT A;  4GKJ Q;  2O2L D;  1PXU A;  2ZM6 Q;  3GTQ B;  2KCM A;  5C3E B;  3X3M A;  4F8M A;  3OPO A;  4MHE A;  1JWU D;  1UEA B;  1UE1 A;  1DZ1 A;  2B2U A;  4JPB W;  1YNN D;  4QY7 A;  1UUP A;  1A2U A;  3SK8 A;  1HNZ L;  1VQH A;  2M00 A;  3DWA A;  1K8A C;  2ZXO A;  1X3P A;  4RGM A;  2VQE L;  2EQS A;  5IP9 G;  2PZW A;  3OHX C;  4LNQ A;  1WD0 A;  1O80 A;  1I50 H;  3S17 B;  4OX9 Q;  1TS5 A;  3WWV A;  2H1E A;  1YZ6 A;  1E3P A;  1F2Z A;  2K5W A;  1CKN B;  3NBH A;  3UE1 A;  1QNU A;  1F9R A;  2F0W A;  1D1K A;  4OWW B;  4IFD H;  3UDX A;  1PZI D;  4R4O A;  1B9M A;  3I8Z A;  1EIG A;  4XT3 B;  1C8C A;  1X54 A;  5C3W A;  1EY5 A;  2JE6 I;  5LMN L;  4A93 B;  1QZH A;  2Z8L A;  2F0E A;  1STB A;  2AUK A;  4H02 A;  4IQZ A;  1JOO A;  3BDL A;  5EKI A;  1YHQ A;  5HGQ A;  2JA7 G;  5LHY 1;  1VQJ A;  2BA0 A;  3QB3 A;  5C4Z A;  3F2U A;  1Y1W B;  1SDF A;  2L11 A;  4DV5 Q;  5T1I A;  2DJF C;  2F0L A;  3ER0 A;  3GTL B;  2A6H D;  1IBM L;  1IZ6 A;  1HTP A;  3HZX A;  3FRP B;  1IBK Q;  1E7Z A;  4DAM A;  5M3M H;  1LTS D;  3H6M A;  3U58 A;  3T16 A;  1BCP F;  2D5D A;  3A74 A;  4MNO A;  4LUV A;  3D6C A;  1KC8 C;  5A2Q E;  2QEX A;  3M7N A;  4PZ7 A;  3A7L A;  4L6T B;  2PQA A;  2K03 A;  4HMJ A;  1WFQ A;  1TWA B;  1VQ9 A;  4OXP A;  3G6J B;  5ELB A;  3J7Y W;  1IW7 D;  3S14 B;  2WKD A;  3OW7 A;  3M85 A;  1ML0 D;  4A76 A;  4A3K H;  1EWH A;  3I4N H;  2PNR C;  5C5L A;  1RD9 D;  5BN4 A;  3PUW A;  1MI2 A;  4DR2 L;  3M4Y A;  4EQN A;  5EBD A;  3HOX B;  1JCK B;  1J8I A;  1ZKO A;  5EKK A;  1PH9 A;  3S16 H;  4GOP A;  3HOZ B;  3KJO A;  4L5R C;  5EQ0 A;  4OWX B;  4KJO A;  4BY7 B;  5FJ8 H;  2A68 D;  4XT1 B;  4PQX A;  5NUC A;  4FXK C;  2VL6 A;  4YY3 L;  3KBG A;  1G8Z D;  3PV0 A;  1EUJ A;  1CUK A;  3ND8 A;  2ATW A;  2IL8 A;  3GTK H;  1YHB A;  2Q8R E;  3UDI A;  1H9S A;  4JOI A;  2XGT A;  5D3D A;  4DR6 Q;  3K0Y A;  3VYT A;  1AP0 A;  1TU2 B;  2EE1 A;  3KF8 B;  4HAE A;  4XQJ A;  2GA4 B;  2EXD A;  3CRK C;  3IL8 A;  3NTI A;  3GTP B;  1DOK A;  3TEH B;  3KYH C;  2NN6 G;  5JJZ A;  4P2C B;  4QMG A;  5IP7 H;  1MHW C;  1EWI A;  1XNQ L;  3I4M B;  4A3E H;  2L9H A;  4DNI A;  2XTI A;  3H3V H;  4QQB X;  2J0T D;  4TSS A;  4QB4 A;  2OF1 A;  1SE4 A;  4IN3 A;  3GTG H;  3HOV G;  5C5M A;  2VB2 X;  3R2T A;  1GUN A;  3BZC A;  2UXB L;  3JAM i;  4GNX C;  1FNV A;  2EZV A;  3PO3 B;  4X66 L;  1I4R A;  3SDZ A;  4QUF A;  4DR3 L;  4A3B B;  2EJM A;  3U9O A;  4LFC L;  3MTS A;  4LUO A;  2YU9 B;  1K83 B;  1HR0 Q;  2ZTD A;  3A8K E;  1Q12 A;  2CH4 W;  2RDG A;  5AJ3 Q;  3CW2 C;  4NXM Q;  1VQE A;  3RD4 A;  2F0M A;  4RHS A;  2K33 A;  4H0L C;  2KEC A;  4TKO B;  4C3H H;  2UUC Q;  3S1N H;  4WJ3 M;  4IOC A;  4KJN A;  3SHL A;  3HS0 C;  1SFO B;  3E0E A;  5D3I B;  2F4V L;  5FLX c;  1TXY A;  2B63 B;  1LTA D;  1A3V A;  2B39 A;  4KKS A;  2B2U C;  1EQQ A;  2N55 A;  5IY0 A;  3K7U C;  1W2B A;  5EJW A;  3L2P A;  5CGK A;  3GTJ B;  4MZ9 A;  4GKJ L;  1PV4 A;  3E9I A;  2N3S A;  2ZM6 L;  4BY1 B;  1KD1 C;  1II3 A;  2A73 B;  3WOE A;  1LT6 D;  1RDP D;  4K2K A;  3AQQ A;  2MFI A;  5CC4 A;  1D6E C;  2F0Q A;  2PI2 A;  1VQ8 A;  4LF7 L;  4UP9 A;  3AEV A;  1Q46 A;  1D5Z C;  2JA9 A;  3HFZ B;  4IFD G;  3OWF A;  4DAP A;  3UE0 A;  1IL8 A;  2MNA A;  3CMA A;  1WTR A;  2M2L A;  1Q7Y C;  3SK5 A;  4OX9 L;  3GDE A;  4B3S Q;  3PIP 3;  1V43 A;  1GKH A;  1KLU D;  1TWF H;  4DUZ Q;  3C2P A;  3MAQ A;  4A3L H;  1CHQ D;  4PV1 C;  2NWG A;  4C2M H;  1U9R A;  4A75 A;  3CXC A;  1PH3 A;  1N8R C;  3OIP A;  1JWM D;  3FVQ A;  2Y0S G;  1YIT A;  1DCZ A;  2Z6B A;  4X62 Q;  3K5L A;  2DNC A;  1E1O A;  4M8A A;  3BVZ A;  4POG A;  1ASZ A;  4CKB A;  4B3M Q;  2KA7 A;  2ICI A;  4JBK A;  1JE4 A;  5M3M G;  1KDA A;  5IGC A;  4I65 A;  1NAP A;  3PIO A;  1OXX K;  2A8V A;  1FVI A;  3CPW A;  1B70 B;  3JAM E;  1EIH A;  1QVC A;  5T1G A;  1G2S A;  3CCL A;  1H9K A;  2F0S A;  3A8I E;  1SBB B;  1Z9F A;  4CGY B;  1HUM A;  4P75 A;  1F9P A;  4DV5 L;  1KAB A;  1EEF D;  1EU4 A;  1KNA A;  2EIF A;  1IBK L;  4GZY C;  4HJA A;  1I50 B;  2RQX A;  4QUC A;  3VR6 A;  3WOF A;  3I4N G;  2F0H A;  1NMF A;  1KQS A;  2IHE A;  2BA1 A;  3BZK A;  1CI3 M;  4DR1 Q;  1B7Y B;  5GAE C;  1WTX A;  2L15 A;  4GOP C;  1RTO A;  4KK7 A;  5FJ8 G;  1QCB D;  2WAQ G;  1TT2 A;  1GUG A;  1GUT A;  1V8Q A;  4A3C G;  3U9S A;  2K32 A;  3V2T A;  1EZ8 A;  2FJ2 A;  2H4O A;  4IJH A;  1Y8O B;  2Y0S B;  4M1U B;  2VY3 A;  4X6A H;  4JOI C;  4TVA B;  5LL6 S;  5FLX L;  4CDD C;  2RCN A;  5IP7 G;  3C1E A;  4HSP A;  4LFA Q;  1LTG D;  1I4X A;  4A3E G;  1F2M A;  3HEJ A;  2DGY A;  2R7F A;  1QVG A;  2L0C A;  2HUG A;  2NVT B;  2KCC A;  2R93 G;  2Y0S E;  1O7L A;  4KY7 A;  3KF6 B;  2K1B A;  3JC6 6;  5ELF A;  2NVX H;  2XIW A;  3I3C A;  3HKZ B;  1HCZ A;  3CCS A;  2R92 B;  4X65 Q;  1XYI A;  1KL9 A;  2BDN A;  3GTO H;  1FYC A;  3V96 A;  4DV3 Q;  1NBW A;  1QNK A;  3GV6 A;  4A3K B;  1D1I A;  2RBM A;  1KAA A;  5CV4 A;  5ELO A;  5ELD A;  1G51 A;  1Y1V B;  1A3U A;  2E75 C;  2K14 A;  4G4K A;  2RF4 A;  1CA5 A;  3SK4 A;  2AHO B;  3A54 A;  1T5E A;  4C3H G;  3Q0A A;  3OWE B;  3S24 A;  3CC4 A;  3HKZ E;  3NQI A;  5BN5 A;  1STG A;  2X6L A;  4R4T A;  4IZ8 A;  2WAQ B;  1HR0 L;  3RZD B;  1VQM A;  4DGZ A;  3K57 A;  2PZT A;  4XQQ A;  5AJ3 L;  1AEX A;  2WFW A;  4EQO A;  1VQP A;  1PYW D;  5IP9 H;  4NXM L;  3GTK B;  1D8L A;  1EY6 A;  2XWJ B;  1TWH H;  3GO5 A;  5F2D A;  2UUC L;  3W3A A;  1PH2 A;  3G7L A;  1U4R A;  5IT9 c;  1K3B C;  2HCC A;  3MA2 B;  1SE3 A;  4JI6 Q;  3A7A B;  2PW7 A;  2WIN B;  3ICE A;  3HRZ C;  5I2X A;  4WRD A;  4KN4 C;  2FFK B;  1MSG A;  1X65 A;  2R7D A;  1YI2 A;  4G7O C;  5H1S E;  5AFW A;  1SE2 A;  1ILQ A;  1P16 A;  1ASY A;  4OO1 G;  5I9O A;  3GTG B;  1GOZ A;  2IJ0 A;  1VQ4 A;  2EJG C;  1U4M A;  2PQE A;  2CH4 A;  4HIO A;  2R7Z G;  3F2B A;  1VQB A;  2ENB A;  2MQH A;  4DU9 A;  2B2T A;  3IRB A;  2JA7 H;  3H0G B;  2MP1 A;  1HFG A;  2K5D A;  3S15 H;  4B3S L;  4DN4 M;  2KHI A;  2F0U A;  2HQE A;  4DUZ L;  1R4Q B;  4EX5 A;  3M4Q A;  3TS2 A;  2WII B;  4DK1 A;  4CDC C;  1NR2 A;  1Y14 B;  4DAY A;  3S1N B;  5IOD A;  3DHQ A;  5JOB A;  4X62 L;  1H9S B;  4ME5 A;  5CR3 A;  4AYB G;  4EGV A;  1Q82 C;  3Q23 A;  2ZTE A;  1C48 A;  2ZXR A;  5DM6 3;  5JPN C;  4B3M L;  3KJP A;  3EBE A;  3UDG A;  1R9T H;  5I6Y A;  1S72 A;  3MXN A;  1PRT B;  3A56 A;  1WOC A;  1AN8 A;  2CQO A;  2A74 C;  2E2D C;  4NKL A;  4P72 A;  1CQV A;  4RH6 A;  2Q2H A;  1GUS A;  4DR4 Q;  3AMU A;  1PMR A;  3FHW A;  4OON A;  4YCV A;  2QKI C;  2NYZ D;  4R4C A;  5C44 G;  4IJL A;  1YHA A;  2TMP A;  2JYO A;  4G7Z C;  4IPG A;  2SNS A;  4YHH Q;  1AZP A;  4L5S A;  4GN5 A;  3CC2 A;  4EVO A;  5JJK A;  4UDU C;  1F2Y A;  1NMG A;  5M5Y B;  1EQR A;  2A6E C;  3NBI A;  4PMB A;  5J22 A;  4DA2 A;  2JXM B;  2UUB Q;  2EY2 A;  2PYK A;  4DR1 L;  3HOY G;  2SNM A;  3S2D H;  4J15 A;  1B2T A;  1UAP A;  2XRS D;  3BU2 A;  4C3J B;  1X3Q A;  2I5M X;  5C4J H;  2EDG A;  3G4S A;  3C3L A;  3SE0 A;  1NR4 A;  2NN6 H;  5KNB A;  2Q8T A;  2SOB A;  2TSS A;  1QJO A;  1HHV A;  2O5J C;  3MXP A;  1DOL A;  2IHF A;  4JBW A;  3QOL A;  4JI5 Q;  2NZO A;  1K28 A;  1Q90 A;  3TRZ A;  2WKC A;  5IT9 L;  2WV6 D;  3HOV H;  2B3G A;  1SNM A;  3ULJ A;  2D2C C;  2P5Z X;  3BJU A;  5IOC A;  3OSO A;  3I4O A;  2E8G A;  3J80 L;  1VCI A;  4C1N K;  1DJR D;  3KDF B;  3LNN A;  4J8Q A;  4LF4 Q;  4LF8 Q;  2AKW B;  1PH6 A;  2G5D A;  1B4O A;  1O7I A;  5JAV A;  2K5H A;  5FO8 B;  4DUY Q;  3S1M H;  2AQ2 B;  3EJI A;  1Q81 C;  1G6P A;  2DY8 A;  1NY4 A;  1S5D D;  1FJG Q;  4BA1 I;  3CCJ A;  4DV3 L;  4AQY Q;  1I94 Q;  3STB C;  3T53 B;  2XSC A;  1S3O A;  2HHH Q;  1UWV A;  4K5W A;  1E1T A;  4L63 B;  4RG1 A;  3I55 A;  3UDF A;  1BNZ A;  1GHK A;  4O42 A;  1SRO A;  1EYC A;  2RHQ B;  1E2V A;  1K0S A;  1Y8N B;  2CFM A;  5C4H A;  2Z4I A;  1EU3 A;  3NXW A;  4IPC A;  4DAV A;  1OXT A;  4IAL A;  4C56 C;  1SYF A;  1WI5 A;  3SR1 A;  3M9B A;  5GAD C;  5EPL A;  2B2Y A;  3ZYY X;  2KUM A;  3M4P A;  2HCI A;  1V1P B;  4LMQ D;  2EVB A;  1SJH D;  2IPK D;  2I0Q A;  2A6E D;  5KNC A;  1A8V A;  3AB9 A;  1CHP D;  2JQO A;  3CHB D;  4Y7N H;  4YWM A;  2F0T A;  1GVP A;  1SRU A;  2LY7 A;  2EOT A;  4JI6 L;  2NTS A;  3NEM A;  2N88 A;  1BOS A;  2B29 A;  4LF9 Q;  3HOW G;  2GN5 A;  2PW5 A;  3R2I A;  3GTO B;  2YV5 A;  2A1A A;  1XX8 A;  2B2T C;  1L2F A;  2ES2 A;  1S4Z A;  1V9P A;  4NPS A;  4KMU C;  1SNQ A;  1ROD A;  3RMH A;  4RAU C;  2Q8I B;  3M4O B;  1QG7 A;  2ALY B;  4DK0 A;  4F87 A;  3NEN A;  4WFN 3;  4O0A A;  3KUP A;  1J5E Q;  3HGB A;  2OTJ A;  4A3D G;  1EQV A;  1OXV A;  3G48 A;  4GN4 B;  5FLX E;  2CVR A;  1VMC A;  1TWG H;  1W6K A;  4JYA Q;  4HJ8 A;  4R8N A;  2HIV A;  3NSW A;  5G3L F;  5FLM G;  4BXX G;  4HR7 B;  1YIJ A;  4F88 A;  2F0K A;  4R4Q A;  2PPB C;  4HCS A;  3FKI G;  2EXZ A;  2AUJ D;  4ZKB B;  1LO5 D;  1L1O A;  3RN5 A;  2Q2I A;  4B3R Q;  4UP7 A;  1HZA A;  1S40 A;  1L0X B;  3D4R A;  1EY9 A;  3K59 A;  2G9H D;  4PG3 A;  1PH1 A;  4DXF A;  2NVY B;  3BDO A;  4IO9 A;  2QCP X;  1HPC A;  4KHP Q;  1W6J A;  1EOV A;  4AIM A;  2FIN B;  2RDF A;  1PZJ D;  2QGQ A;  1J6Q A;  3STB D;  2OT2 A;  4OIK A;  3CD6 A;  3RUZ A;  1HTL D;  5KYI A;  1GJX A;  4JG2 A;  2JK8 A;  2LFN A;  2EYH A;  4UPA A;  4A3C H;  2RA4 A;  4DR4 L;  4JI3 Q;  1A6X A;  2JA7 B;  4YHH L;  2MHV A;  4FF1 A;  3S15 B;  1IYV A;  3J81 c;  3QG1 A;  1PFB A;  1VQI A;  1PTO F;  1SYC A;  3GD7 A;  3URY A;  3W1G A;  4RFB A;  1CM9 A;  1LT5 D;  2UUB L;  4XXE A;  3MFG A;  3DLL A;  4QJF A;  2E2H H;  2R3Z A;  2Z0S A;  2EYF A;  4RMF A;  1QB5 D;  2KVM A;  1BCP C;  1VS0 A;  4FXG C;  2R93 H;  1D5M C;  3PIO 3;  1I6V C;  1QUQ A;  1ZXT A;  4LJZ C;  1NCV A;  1LYL A;  2R6G A;  3LWU A;  4H7B A;  4ULL A;  4JI5 L;  2EYO A;  3S1Q H;  1WTH A;  2YTV A;  3LWE A;  2KOL A;  3I90 A;  3J81 j;  1YBY A;  5C3X A;  1R4P B;  2VUM G;  3TDQ A;  4QGU A;  2VB3 X;  3EQL C;  2Z1C A;  2UUA Q;  1UE6 A;  3CQZ H;  2DY7 A;  3Q8D A;  4IUT A;  5A35 A;  5E3F A;  4I7Z C;  3R93 A;  1EY0 A;  5KIX A;  1U0L A;  4IPH A;  3TS0 A;  1K8G A;  1BQQ T;  4LF4 L;  3I73 A;  2JA8 G;  4LF8 L;  4CJ0 B;  1BXT A;  2ZJP A;  1WTV A;  3S2D B;  2F0F A;  4DUY L;  1PFN A;  2D0O A;  1LTI D;  2Z6K A;  4ID6 A;  1XPU A;  1I6H H;  2XWB B;  1WTW A;  3P20 A;  1FJG L;  4AQY L;  1I94 L;  2HHH L;  4HIK A;  3K5O A;  1PTO C;  1WCM G;  3I72 A;  5COR A;  2A69 C;  2B2Y C;  1TY2 A;  4WJ4 A;  4C3I H;  1YNJ C;  2VXW A;  4ZK9 B;  3BYY B;  4OO1 H;  3MXU A;  1VQD A;  3GQB A;  1JT8 A;  4BBR G;  3HOV B;  1X3G A;  1OXU A;  2A19 A;  2GVA A;  3K7A H;  1I4H A;  1E24 A;  2R7Z H;  3K8A A;  1MKH A;  1CTM A;  4AH6 A;  4GN3 B;  5TSS A;  3H94 A;  4ZKC B;  5KEE A;  4LK1 C;  5CV6 A;  2KEE A;  4BBS H;  4A3I G;  4JI1 Q;  4LF5 Q;  4JI0 Q;  3ERO A;  1I5F A;  4KLK A;  1WJJ A;  2F03 A;  4RGT A;  2X6G A;  3C1F A;  1IBL Q;  1H9M A;  5DNF A;  4FVM A;  3OTO Q;  1V1O A;  3CP0 A;  1NJI C;  4RGN A;  5KRU A;  4LF9 L;  3S1M B;  3DEO A;  1BCP D;  3VR4 A;  4IOA A;  2H5X A;  1GM5 A;  1HNX Q;  5FO9 B;  1X3F A;  1KLG D;  4Q5V A;  1K0R A;  1KTK A;  3R3O A;  2K75 A;  3J81 L;  1LAC A;  3L7Z C;  3BDC A;  5KND A;  3QIA A;  3PO2 G;  5JJI A;  3T1H Q;  1PRT F;  1BDO A;  3DEP A;  4TQU S;  4DV7 Q;  1HJP A;  1N36 Q;  1J5E L;  3PF5 A;  2E2I H;  3PUX A;  5IT9 E;  5IGG A;  2UU9 Q;  4FYD A;  1L1O C;  4X3U A;  4Y52 H;  2JA5 H;  1WVL A;  4HED A;  3S9W A;  1CKN A;  2ZT9 C;  4JYA L;  2LXJ A;  4GNX B;  5ISR A;  3B6Y A;  1M4V A;  1ET9 A;  4PMW A;  5C44 H;  2NVQ H;  2WB1 G;  3J80 E;  4CJ2 C;  4O1N A;  3K58 A;  1PYS B;  3I70 A;  2AWO A;  4FF4 A;  3V05 A;  3S2H H;  3G6E A;  4KHZ A;  2DJG C;  2EPB A;  3AFQ A;  4B3R L;  4B9X A;  1HZB A;  2NUC A;  2F0G A;  2KED A;  5D65 A;  1JB7 A;  3I7F A;  1YVC A;  4NW2 A;  3HOY H;  4KHP L;  3GTQ H;  1D2B A;  3CCQ A;  1VQ6 A;  4K5X A;  1VQ5 A;  3CAM A;  2C35 B;  2K5Q A;  4IUV A;  4RKB A;  1ESR A;  1Z6H A;  1JQY D;  1LV9 A;  1S5B D;  5C0X I;  1AW7 A;  5C0X J;  1RCV D;  4JI3 L;  5IGE A;  4A3F H;  5M3M B;  1BR9 A;  1YNJ D;  4K14 A;  4ALP A;  3KLS A;  2A5H A;  4APV A;  4DK3 C;  1WTP A;  2JEA I;  1TII D;  2BCO A;  4P71 A;  3ULL A;  4DR6 L;  1EEI D;  2F0O A;  5LMN W;  1TWG B;  1AFP A;  4JCV E;  2VS1 A;  1JOR A;  4A3M G;  4JI4 Q;  3EFX D;  1EY8 A;  3NUC A;  4HSV A;  5GQO A;  4IUR A;  5J1Z A;  1MSH A;  5EBC A;  1X55 A;  3NBH B;  3TP7 A;  1AH9 A;  5IGF A;  4FXD A;  2I07 B;  3RNU A;  3K80 C;  1M8A A;  4KY5 A;  3CU7 A;  4R8I A;  5IYC H;  3I4N B;  1D5X C;  1B9N A;  2HDL A;  3A55 A;  4A93 H;  2K04 A;  4ME3 A;  1HQR D;  1HUN A;  1A15 A;  4XDX A;  1CQF A;  1SXT A;  2V4D A;  3S16 B;  2QA4 A;  1VQO A;  4N9T A;  4BS9 A;  4ZLT F;  3K0X A;  3PUY A;  2N8N A;  4K0K Q;  3RLN A;  4R1J A;  1MGS A;  3DM1 A;  3H91 A;  3DXJ C;  1ENF A;  2D9U A;  1Q3L A;  1VF7 A;  1A2T A;  2F3W A;  2UUA L;  2CHB D;  3MWY W;  3RZO H;  1G91 A;  1A62 A;  4FO2 A;  3KF8 A;  1KRS A;  1LT4 D;  2Z6K C;  1VQG A;  4E6I A;  3EVQ A;  1LTT D;  3D4D A;  4GKK Q;  1BVS A;  4P73 A;  1SR3 A;  1STH A;  2PQA B;  2WAQ E;  4DV1 Q;  2E2H B;  3J80 c;  1X56 A;  2VNU D;  1DYQ A;  4A3E B;  3IFT A;  4C3I G;  3QWN A;  4GLV B;  1HZ9 A;  2I5H A;  4P74 A;  4ZCK A;  1I4P A;  3CCU A;  3HP3 A;  1VMP A;  1A0I A;  1KDC A;  1N33 Q;  2HDM A;  1H9J A;  3CME A;  4QIW B;  2R93 B;  2K50 A;  1XTC D;  5DAU A;  4HMI A;  2J7Z A;  1EFI D;  2L55 A;  1IXR A;  3FP9 A;  2YTX A;  4WOR A;  1TWC H;  3KLR A;  2F0I A;  2EY1 A;  3HOW H;  3EA6 A;  1Z47 A;  4GOP B;  3ULP A;  4BBS G;  1CSQ A;  3S1Q B;  4FDB A;  3W5O A;  2OEO A;  1KAW A;  3D31 A;  1LTL A;  5HY6 A;  3A5Z B;  2NZH A;  1X6O A;  4XYO A;  3U50 C;  1UNS A;  3E0J A;  1TS2 A;  3UI2 A;  3CQZ B;  4QIW E;  5KYL A;  4C3H B;  2B2W A;  2AMC B;  4A3D H;  1QIL A;  2K7V A;  2F0V A;  4OWT B;  1FR3 A;  5IGD A;  2ZXP A;  4LF5 L;  4ZRZ A;  2QW7 A;  4JI0 L;  2AWN A;  3X3N A;  4OL7 A;  1U5K A;  4L5T A;  5IYB G;  2BOS A;  1IBL L;  3HG9 A;  5FLM H;  3OTO L;  4BXX H;  1ONL A;  1JOQ A;  4S3S A;  3FKI H;  4KD3 A;  3I4M H;  1I6H B;  1GUO A;  1SAP A;  3KK7 A;  2JA5 G;  2KCN A;  4RCN A;  1YEZ A;  2LSS A;  2F4I A;  1HNX L;  4UP8 A;  2SDF A;  3D3R A;  1FGB D;  4DR2 Q;  1NE3 A;  1S5E D;  1YNN C;  5LMU Q;  1KIX A;  1PHJ A;  4LFB Q;  3J81 i;  2JP1 A;  2AQ3 B;  1NNX A;  3T1H L;  1X3E A;  4DV7 L;  5CV5 A;  1N36 L;  4JV5 Q;  4XQN A;  1GXD C;  1VF5 C;  2UU9 L;  4LAA A;  5C4X G;  1TWF B;  1CZW A;  5C6A A;  1F9Q A;  2RSN A;  3H3V I;  1IKL A;  3U4V A;  4C2M B;  1WYD A;  2R7Z B;  2LKV A;  2YTY A;  4UY8 C;  1HXY D;  4JI8 Q;  1XXG A;  4KN7 C;  5C3E G;  4ODG A;  2F3V A;  3OMG A;  4BBS B;  1SFO H;  2JJQ A;  4KKU A;  1KXL A;  2OTL A;  2B63 H;  1QOH A;  5EKL A;  5J3B A;  4A3J H;  3PCO B;  4A3F G;  3DUZ A;  1VQC A;  2Q2U A;  4XIG S;  1SE8 A;  4CDE C;  3ERQ A;  1HQM C;  4X64 Q;  2CW0 C;  4AYB B;  4BY1 H;  2K6A A;  1PH7 A;  3Q22 A;  1LUZ A;  5E1F A;  1JJC B;  3DM3 A;  4YIJ A;  4G57 A;  1DOM A;  1PDQ A;  2F0N A;  4XYQ A;  5CV7 A;  1RTN A;  3K6O A;  5CBA E;  1ICW A;  1PFS A;  2KHS A;  2F0D A;  4LFA L;  3E9H A;  2A6H C;  3BYT B;  4K5V A;  3WDN A;  4FP5 D;  3BVM A;  4IUU A;  3J7A V;  2E2I B;  5IYC G;  1ZEQ X;  1STN A;  2DUD A;  4DF7 A;  1F2L A;  2JA6 H;  2IT1 A;  1NSN S;  4A93 G;  3H09 A;  2M9V A;  4DV0 Q;  4JI4 L;  2VUM H;  1Q1B A;  1ENC A;  4AYB E;  5C44 B;  5JEA G;  1BF4 A;  2PCF B;  4DXG A;  4X65 L;  2RHS B;  2FHT A;  2F1M A;  4HJ5 A;  2NBF A;  1EIF A;  4FF3 A;  3S2H B;  4YCU A;  1Y69 U;  3K81 C;  1Z7T A;  2Z4H A;  4JBJ A;  1MBY A;  3K5M A;  1X9N A;  1K3R A;  1TVX A;  1Y1W G;  5C0X H;  1IW7 C;  1ICF B;  1XMO Q;  2JA8 H;  2KJX A;  1DGS A;  1I3Q H;  2HIX A;  3BVG A;  4GLX A;  3HOY B;  1DM0 B;  3OMC A;  4JW0 A;  1C9O A;  3IKJ A;  3ONA B;  3J81 E;  5M3F H;  3LGJ A;  4N9P A;  3I2Z A;  5CMD A;  4K0K L;  3S1R H;  1Q86 C;  1D7Q A;  4JK1 C;  3NPP A;  4QL5 A;  4ZYS A;  4LF7 Q;  3TN2 A;  2A68 C;  1WCM H;  4A3F B;  3J7A 5;  1ZYR C;  5CV9 A;  1RIP A;  1G6Z A;  2C9O A;  3EIV A;  5CYU A;  3HKS A;  5M5X H;  2IY5 B;  1E0B A;  2FMC A;  1S5C D;  4CKE A;  3L3O C;  3P7J A;  5FKA C;  3KF6 A;  4BBR H;  2MUY A;  2NVX B;  4DV4 Q;  1SNO A;  4GKK L;  3HOX G;  1KNE A;  3I91 A;  3P1H A;  1JIC A;  1OXS C;  4NB3 A;  4DV1 L;  4JC0 A;  4IUN A;  3HOZ G;  4H13 C;  3VA7 A;  3DMU A;  4N8X 1;  1QVF A;  4DR7 Q;  4BY7 G;  4A3I H;  4B3T Q;  1N33 L;  1ESF A;  1CFM A;  3R8B A;  1TKW B;  2J4X A;  1XPR A;  1JE5 A;  2AQ1 B;  2ZJQ A;  2CW0 D;  1XWE A;  2B2W C;  3RLO A;  5IWA Q;  2F0J A;  4RHR A;  3DWQ A;  3KOJ A;  1PTO H;  4RWS C;  3SVM A;  3CC7 A;  3PO2 H;  2L5T A;  3SEB A;  1ENA A;  4J1M A;  3RZO B;  1TWH B;  2R61 A;  4K6D A;  3I4M G;  3TZD A;  1QWY A;  3QJY A;  2LMC B;  1EY7 A;  1O7Y A;  4ZUI A;  2IX3 A;  4GLA C;  2NVT H;  4RCO A;  3G71 A;  2WP8 J;  1RKN A;  2I5L X;  4CDF C;  2HT1 A;  3OOC A;  3HOU H;  3PO3 G;  3N6R A;  2R92 H;  2XNA C;  4A3B G;  1PH5 A;  3PF4 A;  3D4W A;  1JR0 D;  2IWH A;  1HR0 W;  1F77 A;  3A0J A;  1B53 A;  4G7H C;  1Y1V H;  2K5N A;  1U4L A;  5LMU L;  1TWC B;  4ZQ3 A;  4LFB L;  3HOW B;  3W2D A;  5JEA J;  1JB3 A;  4PZ6 A;  1T5X D;  4JI2 Q;  1G29 1;  2LS0 1;  3PUZ A;  1GO3 E;  2MO1 A;  2B63 G;  1RF2 D;  4JV5 L;  4K6L A;  4A3J G;  3RZD H;  1S5F D;  5JJL A;  2K4K A;  1O78 A;  1ZYR D;  5M9O A;  1XPO A;  2K28 A;  3EN2 A;  3M3Y H;  4JI8 L;  4A3D B;  1LTB D;  5KGU A;  4BY1 G;  4HJ7 A;  1TQO A;  1UE5 A;  3AU7 A;  2E5L Q;  1GUW A;  4A3M H;  2PNH A;  4B9W A;  3F8T A;  2JSO A;  3TP5 A;  3KBX A;  4QF4 A;  2VQF Q;  3RLF A;  2QIL A;  1R9T B;  4ZAI A;  1MJE A;  1TY0 A;  3FKI B;  4DV6 Q;  1YJN A;  1XJV A;  5IYD G;  1AZQ A;  1HZC A;  1Y8P B;  2IW3 A;  4HJ9 A;  2JA6 G;  4YWL A;  4X64 L;  4A4I A;  1WTO A;  4DPG A;  4FNF A;  4R4I A;  4V19 0;  1EL0 A;  1JOK A;  1IYU A;  1X32 A;  3H15 A;  1DXM A;  1EOT A;  1K9M C;  3TME A;  2DNE A;  3H0G H;  5L37 A;  3F2C A;  1PZK D;  1L0Y B;  5C0X G;  2QEJ C;  5HGT A;  5M5W H;  1RHP A;  3J80 i;  1N34 Q;  1JWS D;  2UXD Q;  4U67 3;  1JJG A;  2CKZ B;  2K5V A;  4DV0 L;  5ELN A;  2ZJR A;  4HCE A;  2QF7 A;  1SSO A;  3NHH A;  1PA6 A;  1FD7 D;  1SYE A;  4DAY B;  5M3F G;  2B2V A;  3NEL A;  1IYJ B;  5C4J B;  1M90 C;  1CSP A;  1EYG A;  4MIU A;  4HN7 A;  4A3J B;  1XMO L;  3RR5 A;  4NP5 A;  5J39 A;  4RA8 A;  3L9A X;  3NWT A;  1VQN A;  1VQA A;  1JC7 A;  3ERS X;  5LL6 X;  3MXN B;  4DFA A;  4A3G H;  1EY4 A;  4MTN A;  1XMQ Q;  3F1Z A;  3D0F A;  5GAH C;  1LT3 D;  1SMY C;  2GVB A;  3PUV A;  1P8L A;  3T1Y Q;  1EYA A;  4C1N I;  4H44 C;  5EAY A;  2IX1 A;  1MIU A;  2E2J H;  4LF6 Q;  3Q6S A;  4Z9C B;  1K8M A;  2BH2 A;  4NXN Q;  2JEB I;  1Q8K A;  4WJW A;  4F7X A;  3TSS A;  1GD7 A;  1QE6 A;  3L0O A;  5DM7 3;  4CJ1 B;  3MEH A;  1A63 A;  2JA6 B;  3KDF A;  3VYU A;  5JVG 3;  4MN3 A;  1B3Q A;  3ITP A;  5M5Y H;  4EQP A;  4CKC A;  4KV6 A;  2VUM B;  2YYZ A;  2MPM A;  4HID A;  4DR5 Q;  4ABN A;  4HIM A;  1J9O A;  4DV4 L;  4YWK A;  1N32 Q;  3TRE A;  2OXP A;  3VYR A;  4K8I A;  1LLR D;  5K36 H;  4PZ8 A;  2X69 A;  4LW1 A;  1HNW Q;  1W3S A;  3MFY A;  3PGZ A;  4C3J H;  2LXK A;  3VR2 A;  4DR7 L;  1SMX A;  2VZA A;  3NP8 A;  3KLW A;  2JN4 A;  4B3T L;  5EPJ A;  5D14 A;  2JA8 B;  4LUZ A;  3I4L A;  1B3A A;  1I3Q B;  5G3L D;  5IYB H;  3W1B A;  4IUP A;  4DNT B;  2OWO A;  3P75 A;  2NTT A;  3PMF A;  1BCP B;  5M3F B;  1E2W A;  2BDO A;  4CHT B;  1M1K C;  4FF2 A;  2FXQ A;  1A3T A;  5IWA L;  3S1R B;  3TP8 A;  3GTM H;  4O2D A;  4DNR B;  2ZTC A;  1B1Z A;  1T9H A;  3J7Z C;  3HKZ G;  3HOU G;  1E22 A;  1WCM B;  2R92 G;  2EYL A;  1PFM A;  4ZUJ A;  1V1P A;  1JJ2 A;  2NN6 I;  1RJT A;  1L0W A;  1SJE D;  2FMM A;  4Y7N B;  5M5X B;  1MJC A;  1CZG A;  5I6W A;  4A3K G;  3H3V C;  3N52 A;  1BUV T;  3CKI B;  5C4X H;  1Y1V G;  4BBR B;  1UEB A;  3VR3 A;  1B44 D;  2MGS A;  2KHJ A;  1NUC A;  2UXC Q;  2OQK A;  5COY A;  3TP6 A;  4DV2 Q;  5C3E H;  4JBM A;  1CKM A;  4CBV A;  3FEW X;  3E5S A;  5IIF A;  2OCE A;  1QZG A;  2CCZ A;  1Q8I A;  1BO0 A;  2O5I C;  4A3I B;  4B08 A;  3MVV A;  4X3T A;  3IAY A;  1LM0 A;  1B50 A;  1PTO D;  3GV3 A;  5BR8 Q;  2A69 D;  2KBN A;  5IE8 A;  3NQT A;  1BBX C;  2KEN A;  4KD4 A;  5CV8 A;  4OHJ A;  3K5N A;  1I4G A;  4N8F A;  3CCV A;  4K2L A;  1SMY D;  3S17 H;  2BH8 A;  1HA6 A;  3OYY A;  1XNR Q;  3TQY A;  3FPU B;  4JI2 L;  4JI7 Q;  1C7Y A;  1BBU A;  1PTO B;  3NTH A;  4DKA C;  5A2Q L;  3PIP A;  2HD3 A;  1PH4 A;  2RDH A;  3PO2 B;  1CT1 D;  1H9R A;  1Q1E A;  4Q0F A;  5GRO A;  1JMC A;  2RCF A;  1YJ9 A;  1PRT C;  2DN8 A;  1IKM A;  1CK1 A;  2B8G A;  2OQ0 A;  1RL2 A;  1EZ6 A;  2E5L L;  5IGB A;  3SGI A;  4OIJ A;  2KQ3 A;  3DWP A;  1TR5 A;  3HOU B;  5JEA H;  3T4A C;  2VQF L;  2K52 A;  2WB1 B;  1ET6 A;  2CWA A;  3D8G A;  3H0G G;  2K05 A;  3CCE A;  3LX0 A;  3D6W A;  4DV6 L;  4IFD I;  4IFD J;  1LTR D;  2HQL A;  3OW2 A;  3KLS X;  4KI0 A;  1HNZ Q;  2KCT A;  3PQI A;  5JPM C;  4PNY A;  2RVL A;  1Y1W H;  4POF A;  1NTG A;  2L12 A;  2VQE Q;  2XN9 C;  3CCR A;  1WD1 A;  3M4O H;  3GTL H;  3IFD A;  1YNX A;  4KHV A;  4IUQ A;  2ASB A;  1SNP A;  3AFP A;  4I7A A;  4NMZ A;  5GAG C;  1AE3 A;  1PYB A;  2EJF C;  1KHI A;  1AE2 A;  3SK6 A;  1STY A;  1VQL A;  3J7A F;  3JAM c;  1DD2 A;  1U4P A;  1VQF A;  2N78 A;  1DON A;  2PMZ B;  3NK9 A;  2WB1 E;  2K01 A;  2B2V C;  4NDX A;  3QR8 A;  1K73 C;  2IX0 A;  1N34 L;  2UXD L;  3OIQ A;  2I46 A;  1TWA H;  2B8F A;  3E3X A;  5EGT A;  1K8O A;  4GS3 A;  1FL0 A;  3M3Y B;  3QO2 A;  4A3G G;  1PH8 A;  2QDL A;  4KKT A;  1TS3 A;  3ND9 A;  1PVO A;  3A8J E;  5LMN Q;  3S14 H;  1L1O B;  3CRL C;  1E2Z A;  1KRT A;  3I56 A;  4J6H A;  3VDY A;  4A3M B;  4K8J A;  1TS4 A;  2NVY H;  1SYB A;  2MJ8 A;  2PMZ E;  3HOX H;  5K5P A;  1SYD A;  3VA5 A;  1SNC A;  1EIY B;  3HOZ H;  5I4D A;  4V0B A;  2Z9H A;  2BE5 C;  1FGU A;  4BY7 H;  1XTD A;  3SXH A;  3BS1 A;  1XMQ L;  4RGO S;  5FOB B;  1EFW A;  4YCW A;  3T1Y L;  2EY6 A;  4OEL B;  1CA6 A;  4EQ5 A;  1IBM Q;  4A3L G;  2C5C A;  2EY5 A;  1HRJ A;  3MXG A;  4OGQ C;  1H95 A;  4LF6 L;  3NTK A;  2RSO A;  5K36 G;  4NXN L;  2V1C C;  3T56 B;  1EQT A;  4C3J G;  1WTQ A;  3BG3 A;  4TRD A;  4JI1 L;  5M5W B;  2D62 A;  4X3K A;  4U68 A;  3GTP H;  1FNW A;  5HUR A;  1YJW A;  4DR5 L;  2L4N A;  4PMC A;  2EYM A;  4R9W A;  1PRT D;  2ID0 A;  1N32 L;  3MZ5 A;  1IL2 A;  4RKL A;  1OO9 B;  3TZU A;  1EWC A;  1HA5 A;  2WAC A;  2VW9 A;  1HNW L;  2XVS A;  3VR5 A;  3RN2 A;  1SEB D;  5I2Y A;  1G2T A;  1QUQ B;  1N9W A;  1FNU A;  1V1Q A;  1STE A; 
#chains in the Genus database with same CATH homology
 3HOZ G;  1QVF A;  2RCN A;  1U0L A;  4IPH A;  3PO3 H;  4DR7 Q;  5IP7 G;  3TS0 A;  3A5U A;  1K8G A;  4BY7 G;  4LF4 L;  4A3I H;  2JA8 G;  4LF8 L;  4B3T Q;  4LFA Q;  4A3B H;  2ZJP A;  1N33 L;  2YU9 H;  1K83 H;  4A3E G;  2DGY A;  3CCM A;  1BKB A;  2R7F A;  4YY3 Q;  1QVG A;  1VQ7 A;  1SN8 A;  1XPR A;  1CKO A;  4DUY L;  1JE5 A;  2D0O A;  3MEF A;  2R93 G;  2Z6K A;  2ZJQ A;  1XPU A;  1I6H H;  1UE7 A;  2Y0S E;  3KF6 B;  1FJG L;  3U4Z A;  3JC6 6;  4AQY L;  1C0A A;  1I94 L;  3CPF A;  2NVX H;  4IPD A;  3RLO A;  3CCS A;  5IWA Q;  4HIK A;  2HHH L;  4X65 Q;  1KL9 A;  3AYH B;  3KOJ A;  2Q2T A;  3GTO H;  1WCM G;  4XTC S;  4DV3 Q;  1NBW A;  2CWP A;  3CC7 A;  3PO2 H;  2D0P A;  4WJ4 A;  4C3I H;  5ELO A;  1G51 A;  3I4M G;  2K14 A;  2RF4 A;  3GTJ H;  1XNQ Q;  2UXC L;  1VQD A;  3PSI A;  2AHO B;  1JT8 A;  4BBR G;  5DLQ E;  1X3G A;  1OXU A;  2A19 A;  2GVA A;  4DV2 L;  3K7A H;  4GLA C;  2NVT H;  1E24 A;  3S24 A;  2R7Z H;  3K8A A;  3G71 A;  2WP8 J;  3CC4 A;  1MKH A;  2I5L X;  3HKZ E;  2HT1 A;  4AH6 A;  4GN3 B;  3HOU H;  4R4T A;  5BR8 L;  3PO3 G;  2UXB Q;  2R92 H;  1HR0 L;  4BBS H;  4A3I G;  1VQM A;  4X66 Q;  4JI1 Q;  4DK6 C;  1PH5 A;  4LF5 Q;  4A3B G;  4JI0 Q;  4DR3 Q;  5AJ3 L;  2WFW A;  3F2D A;  1I5F A;  3PF4 A;  4KLK A;  4LFC Q;  1WJJ A;  1VQP A;  1VQK A;  5IP9 H;  4NXM L;  1D8L A;  5IYD H;  1IBL Q;  1HR0 W;  3OTO Q;  1HH2 P;  3A0J A;  3CP0 A;  1XNR L;  1TWH H;  1SLJ A;  1Y1V H;  3GO5 A;  1NJI C;  2K5N A;  1OTC A;  2UUC L;  1PH2 A;  5LMU L;  4JI7 L;  4LF9 L;  1BBW A;  5IT9 c;  3CF5 A;  4GNX A;  3KFU A;  4IOA A;  4LFB L;  2H5X A;  1GM5 A;  4JI6 Q;  4LWC A;  1HNX Q;  1X3F A;  5JEA J;  4PZ6 A;  1K0R A;  4JI2 Q;  1G29 1;  2K75 A;  3PUZ A;  3ICE A;  1GO3 E;  1B8A A;  2MO1 A;  2B63 G;  3L7Z C;  2PI2 E;  2F4V Q;  4JV5 L;  1X65 A;  4L5Q A;  2R7D A;  1YI2 A;  4A3J G;  3RZD H;  3PO2 G;  5E7N A;  5JJL A;  5H1S E;  2K4K A;  3T1H Q;  5JJI A;  4DV7 Q;  4TQU S;  4BA2 I;  1HJP A;  1P16 A;  1N36 Q;  2F3I A;  1ASY A;  3ZJY C;  3PF5 A;  2N49 A;  1XPO A;  1J5E L;  3EN2 A;  3PUX A;  2F52 A;  2E2I H;  3M3Y H;  4OO1 I;  1VQ4 A;  2UU9 Q;  4JI8 L;  1L1O C;  2MO0 A;  4Y52 H;  2JA5 H;  4GKJ Q;  4BY1 G;  4HJ7 A;  2ZM6 Q;  2KCM A;  4HIO A;  2R7Z G;  1CKN A;  3F2B A;  1VQB A;  4JYA L;  2LXJ A;  2MQH A;  4GNX B;  1UE5 A;  3B6Y A;  2E5L Q;  1UE1 A;  4A3M H;  3IRB A;  2PNH A;  4QY7 A;  4PMW A;  5C44 H;  2JA7 H;  2NVQ H;  3F8T A;  1HNZ L;  2WB1 G;  1VQH A;  2VQF Q;  3RLF A;  1PYS B;  1K8A C;  3S15 H;  2AWO A;  1MJE A;  3S2H H;  3G6E A;  4B3S L;  2VQE L;  2EQS A;  4KHZ A;  5IP9 G;  2KHI A;  4DV6 Q;  3AFQ A;  1YJN A;  1XJV A;  5IYD G;  4B3R L;  1HZC A;  4LNQ A;  4DUZ L;  4HJ9 A;  2JA6 G;  1HZB A;  4EX5 A;  3TS2 A;  3M4Q A;  4YWL A;  1I50 H;  4X64 L;  4OX9 Q;  4A4I A;  1Y14 B;  4DPG A;  1JB7 A;  4R4I A;  3I7F A;  3WWV A;  4X62 L;  1YVC A;  1YZ6 A;  3HOY H;  4KHP L;  4AYB G;  1E3P A;  1Q82 C;  3H15 A;  3GTQ H;  1CKN B;  3UE1 A;  3CCQ A;  1VQ6 A;  1VQ5 A;  2ZTE A;  1K9M C;  3CAM A;  2C35 B;  4OWW B;  3H0G H;  3UDX A;  4B3M L;  4R4O A;  3F2C A;  3KJP A;  5C0X G;  3EBE A;  3UDG A;  5M5W H;  1R9T H;  5C0X I;  5C0X J;  1X54 A;  3J80 i;  1S72 A;  1N34 Q;  2UXD Q;  1JJG A;  4JI3 L;  2JE6 I;  2CKZ B;  5LMN L;  2K5V A;  1WOC A;  2CQO A;  4A3F H;  4DV0 L;  5ELN A;  2ZJR A;  1QZH A;  4ALP A;  4P72 A;  4APV A;  4DK3 C;  2JEA I;  4H02 A;  2Q2H A;  4P71 A;  3ULL A;  4DR6 L;  4DR4 Q;  1PA6 A;  5LMN W;  4JCV E;  4DAY B;  1YHQ A;  3FHW A;  4OON A;  2VS1 A;  4YCV A;  5M3F G;  4A3M G;  4JI4 Q;  5GQO A;  5HGQ A;  4R4C A;  5C44 G;  2JA7 G;  4IJL A;  3NEL A;  1IYJ B;  1YHA A;  1M90 C;  1CSP A;  1X55 A;  1VQJ A;  2BA0 A;  3NBH B;  4IPG A;  4YHH Q;  1EYG A;  4L5S A;  4GN5 A;  3CC2 A;  1AH9 A;  1XMO L;  3RR5 A;  5JJK A;  3RNU A;  3K80 C;  4DV5 Q;  1NMG A;  1EQR A;  3ER0 A;  1VQN A;  1VQA A;  1IZ6 A;  3ERS X;  1IBM L;  3MXN B;  5IYC H;  1IBK Q;  4A3G H;  1E7Z A;  4MTN A;  2UUB Q;  1XMQ Q;  3F1Z A;  4DAM A;  3D0F A;  5GAH C;  5M3M H;  4A93 H;  2GVB A;  3PUV A;  4ME3 A;  1P8L A;  4DR1 L;  3T1Y Q;  3U58 A;  3HOY G;  3S2D H;  4J15 A;  3A74 A;  4MNO A;  5EAY A;  2IX1 A;  3BU2 A;  4LUV A;  1MIU A;  1KC8 C;  2E2J H;  2QA4 A;  1VQO A;  4LF6 Q;  2QEX A;  2I5M X;  2BH2 A;  3M7N A;  4NXN Q;  2JEB I;  1Q8K A;  4PZ7 A;  3K0X A;  5C4J H;  3G4S A;  3PUY A;  2N8N A;  2PQA A;  1GD7 A;  1WFQ A;  4K0K Q;  3RLN A;  3L0O A;  4R1J A;  1VQ9 A;  1A63 A;  4OXP A;  3KDF A;  4DV1 L;  5M5Y H;  2IHF A;  4JBW A;  4JI5 Q;  3M85 A;  2YYZ A;  4A76 A;  4HID A;  4DR5 Q;  4A3K H;  2UUA L;  3I4N H;  4HIM A;  2NZO A;  4DV4 L;  4YWK A;  3RZO H;  1N32 Q;  1A62 A;  3PUW A;  4DR2 L;  3TRZ A;  3TRE A;  1KRS A;  4PZ8 A;  3HOV H;  2Z6K C;  4LW1 A;  1HNW Q;  2B3G A;  1VQG A;  1W3S A;  3ULJ A;  4C3J H;  3PGZ A;  2LXK A;  1PH9 A;  3S16 H;  4GOP A;  4DR7 L;  3BJU A;  1SMX A;  2VZA A;  3KLW A;  4GKK Q;  3KJO A;  4L5R C;  4OWX B;  4B3T L;  1BVS A;  3I4O A;  4P73 A;  1SR3 A;  2PQA B;  4LUZ A;  2WAQ E;  5FJ8 H;  4DV1 Q;  2E8G A;  3J80 c;  1X56 A;  2VL6 A;  4YY3 L;  2VNU D;  5IYB H;  1VCI A;  3W1B A;  4GLV B;  1HZ9 A;  2I5H A;  4P74 A;  3CCU A;  3KDF B;  3PV0 A;  1EUJ A;  4LF4 Q;  4LF8 Q;  1CUK A;  2AKW B;  1PH6 A;  2OWO A;  1A0I A;  2ATW A;  1N33 Q;  3GTK H;  3CME A;  1YHB A;  2K50 A;  1O7I A;  3UDI A;  4JOI A;  2XGT A;  1M1K C;  4DR6 Q;  1IXR A;  2FXQ A;  2K5H A;  3FP9 A;  2YTX A;  5IWA L;  4DUY Q;  3S1M H;  1TWC H;  3GTM H;  3KF8 B;  4O2D A;  2ZTC A;  1Q81 C;  1T9H A;  1G6P A;  1NY4 A;  3J7Z C;  3HKZ G;  3HOW H;  1FJG Q;  4BA1 I;  2EXD A;  1E22 A;  3CCJ A;  4DV3 L;  4AQY Q;  1Z47 A;  3HOU G;  1I94 Q;  3STB C;  3TEH B;  4GOP B;  3ULP A;  1S3O A;  3KYH C;  2HHH Q;  2R92 G;  2NN6 G;  1UWV A;  1CSQ A;  4BBS G;  4FDB A;  1JJ2 A;  2NN6 I;  1E1T A;  3W5O A;  5IP7 H;  1L0W A;  1KAW A;  4RG1 A;  3D31 A;  1LTL A;  5HY6 A;  3I55 A;  1MJC A;  3UDF A;  3A5Z B;  1EWI A;  2NZH A;  1XNQ L;  4A3K G;  1X6O A;  4A3E H;  3U50 C;  1SRO A;  4DNI A;  2RHQ B;  2XTI A;  5C4X H;  1Y1V G;  2CFM A;  3H3V H;  4QQB X;  1UEB A;  4IPC A;  4QIW E;  1OXT A;  3GTG H;  3HOV G;  2KHJ A;  2UXC Q;  2AMC B;  4A3D H;  2OQK A;  3BZC A;  1WI5 A;  2UXB L;  3JAM i;  4DV2 Q;  4GNX C;  5C3E H;  4OWT B;  4JBM A;  1CKM A;  2CCZ A;  1QZG A;  2OCE A;  3M9B A;  5GAD C;  4X66 L;  4LF5 L;  4JI0 L;  4DR3 L;  2AWN A;  4LFC L;  3M4P A;  4LUO A;  1LM0 A;  1U5K A;  4L5T A;  5BR8 Q;  5IYB G;  1IBL L;  2KBN A;  5IE8 A;  2ZTD A;  5FLM H;  3OTO L;  1HR0 Q;  2I0Q A;  4BXX H;  1A8V A;  2KEN A;  1Q12 A;  2JQO A;  4Y7N H;  5AJ3 Q;  3CW2 C;  3FKI H;  4YWM A;  3I4M H;  1GVP A;  3CCV A;  1SRU A;  1VQE A;  4NXM Q;  2JA5 G;  4JI6 L;  1YEZ A;  2LSS A;  2BH8 A;  1HNX L;  3S17 H;  4UP8 A;  3OYY A;  1XNR Q;  3NEM A;  3TQY A;  4JI2 L;  4C3H H;  4DR2 Q;  2UUC Q;  3S1N H;  1NE3 A;  2B29 A;  5LMU Q;  4JI7 Q;  4LF9 Q;  4WJ3 M;  4IOC A;  3HOW G;  2GN5 A;  1KIX A;  1PHJ A;  2YV5 A;  3E0E A;  2A1A A;  2F4V L;  4LFB Q;  5FLX c;  1TXY A;  3J81 i;  1C7Y A;  1BBU A;  1L2F A;  4DKA C;  3PIP A;  1EQQ A;  2ES2 A;  1V9P A;  4NPS A;  3K7U C;  5IY0 A;  3T1H L;  1X3E A;  1W2B A;  1PH4 A;  1Q1E A;  4DV7 L;  5GRO A;  3L2P A;  1N36 L;  1JMC A;  4JV5 Q;  1YJ9 A;  2ALY B;  4MZ9 A;  2UU9 L;  5C4X G;  4GKJ L;  1PV4 A;  3H3V I;  3E9I A;  2N3S A;  3NEN A;  2ZM6 L;  3U4V A;  2OQ0 A;  4OO1 G;  4O0A A;  1WYD A;  1KD1 C;  1RL2 A;  1J5E Q;  2OTJ A;  4A3D G;  2E5L L;  1OXV A;  2YTY A;  3G48 A;  3SGI A;  4UY8 C;  4JI8 Q;  5C3E G;  4GN4 B;  3AQQ A;  2MFI A;  1TWG H;  2VQF L;  2K52 A;  2PI2 A;  1VQ8 A;  4LF7 L;  4UP9 A;  3AEV A;  2CWA A;  4HJ8 A;  4JYA Q;  2JA9 A;  1Q46 A;  3H0G G;  3HFZ B;  2JJQ A;  3CCE A;  1SFO H;  4IFD I;  4IFD G;  4DV6 L;  2OTL A;  2HIV A;  2HQL A;  2B63 H;  3OW2 A;  4IFD J;  4KI0 A;  3UE0 A;  2MNA A;  1HNZ Q;  2KCT A;  5FLM G;  3CMA A;  4BXX G;  1YIJ A;  5J3B A;  4A3J H;  3PCO B;  4R4Q A;  1Y1W H;  4POF A;  1Q7Y C;  3FKI G;  1NTG A;  3GDE A;  4A3F G;  4B3S Q;  4OX9 L;  2VQE Q;  3CCR A;  1V43 A;  1VQC A;  2Q2U A;  3M4O H;  1L1O A;  3GTL H;  3RN5 A;  1YNX A;  2Q2I A;  4B3R Q;  1GKH A;  4UP7 A;  1SE8 A;  4XIG S;  1HZA A;  1TWF H;  4DUZ Q;  1S40 A;  2ASB A;  3AFP A;  4PG3 A;  4A3L H;  1PH1 A;  4X64 Q;  5GAG C;  1AE3 A;  4BY1 H;  1PYB A;  4C2M H;  1PH7 A;  1KHI A;  4A75 A;  3CXC A;  1LUZ A;  1AE2 A;  4IO9 A;  1N8R C;  1YIT A;  1JJC B;  2Y0S G;  3DM3 A;  3JAM c;  1PH3 A;  1VQL A;  1VQF A;  2N78 A;  4X62 Q;  4KHP Q;  1E1O A;  1EOV A;  2WB1 E;  4AIM A;  2QGQ A;  1K73 C;  1J6Q A;  2IX0 A;  3STB D;  1N34 L;  2UXD L;  4LFA L;  1PFS A;  4POG A;  3E9H A;  1ASZ A;  3CD6 A;  4JG2 A;  2JK8 A;  4B3M Q;  1TWA H;  4UPA A;  4GS3 A;  1FL0 A;  5IYC G;  4JBK A;  4A3G G;  1PH8 A;  4A3C H;  2DUD A;  4DR4 L;  2JA6 H;  1KXL A;  2IT1 A;  5M3M G;  3PIO A;  4JI3 Q;  2A8V A;  5LMN Q;  1OXX K;  3S14 H;  1L1O B;  4A93 G;  1PVO A;  1FVI A;  4DV0 Q;  1KRT A;  3I56 A;  3CPW A;  1Q1B A;  3VDY A;  4JI4 L;  1B70 B;  2VUM H;  4AYB E;  1QVC A;  5JEA G;  4YHH L;  3CCL A;  2NVY H;  4X65 L;  2RHS B;  1Z9F A;  4HJ5 A;  2PMZ E;  3HOX H;  4P75 A;  3J81 c;  1EIF A;  4YCU A;  4DV5 L;  3K81 C;  4JBJ A;  1EIY B;  1VQI A;  3GD7 A;  1X9N A;  3W1G A;  3HOZ H;  1K3R A;  2EIF A;  1Y1W G;  1IBK L;  1FGU A;  2UUB L;  4HJA A;  1XTD A;  1XMQ L;  1XMO Q;  4BY7 H;  3DLL A;  2JA8 H;  4QJF A;  1EFW A;  2E2H H;  4YCW A;  2Z0S A;  1DGS A;  1I3Q H;  3T1Y L;  2HIX A;  3I4N G;  4GLX A;  1NMF A;  4EQ5 A;  1KQS A;  2IHE A;  2BA1 A;  3BZK A;  4RMF A;  1IBM Q;  4A3L G;  1H95 A;  1C9O A;  4LF6 L;  1VS0 A;  5K36 G;  2R93 H;  4NXN L;  4DR1 Q;  2V1C C;  1B7Y B;  5M3F H;  3LGJ A;  1QUQ A;  3I2Z A;  4K0K L;  3S1R H;  1Q86 C;  1D7Q A;  5GAE C;  4QL5 A;  4JI1 L;  2L15 A;  4LF7 Q;  2D62 A;  4GOP C;  1LYL A;  2R6G A;  5FJ8 G;  1WCM H;  3GTP H;  2WAQ G;  4JI5 L;  1YJW A;  3J7A 5;  3S1Q H;  4A3C G;  4DR5 L;  2YTV A;  1RIP A;  3J81 j;  3EIV A;  2ID0 A;  1N32 L;  1YBY A;  2IY5 B;  3HKS A;  5M5X H;  1IL2 A;  2VUM G;  4IJH A;  2VW9 A;  1HNW L;  3KF6 A;  4QGU A;  2UUA Q;  4BBR H;  1UE6 A;  2VY3 A;  3CQZ H;  4DV4 Q;  4X6A H;  3RN2 A;  4GKK L;  3HOX G;  4JOI C;  3Q8D A;  1OXS C;  4NB3 A;  4TVA B;  1QUQ B;  1N9W A;  1V1Q A;  4JC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...