5M3FG

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
237
structure length
193
Chain Sequence
ARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 32
structure length 193
sequence length 237
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3fG02
4GKKQ 3CAMA 2B29A 3M4OH 1NE3A 4GN3B 3AEVA 3HOUH 5IT9c 2L15A 4DV6Q 2Y0SE 4LF7L 2LSSA 2BA1A 4DUZQ 2ALYB 4JOIA 4WJ4A 5JJIA 2A1AA 1A8VA 1YZ6A 2VL6A 2Y0SG 4IPHA 2E2IH 2CKZB 4WJ3M 4C3IH 1KAWA 3CCVA 5AJ3Q 4HJ7A 2MQHA 4B3SQ 2JA6G 4DR6L 2UU9L 1PH4A 1VQ5A 1EWIA 4O0AA 1VQIA 1VQLA 4A3BG 4YWMA 2CWAA 4OO1I 1OXTA 1Y14B 4A3GH 3CPFA 1AE3A 3I55A 4L5RC 2OQ0A 1G291 2N49A 5JEAG 1YI2A 1KIXA 4A76A 3WWVA 4X66L 3F1ZA 2Q2IA 5FLMG 2ZTDA 2R6GA 2HT1A 1TWCH 4A3CH 5IP7H 3VDYA 4A3IG 1VCIA 2LXKA 2D0PA 1QVGA 4GKKL 3H3VH 2HHHL 2YTXA 4Y52H 2V1CC 2C35B 1EFWA 2XGTA 1VQEA 4JI4Q 4A3FG 3CC7A 5C44G 4DUYL 5JEAJ 1VQ8A 2UXBQ 3W1BA 1HZAA 3HOWH 1YITA 4X64L 1XMQQ 2B63H 3OTOQ 1KHIA 1VQDA 1YJ9A 4PZ8A 2IX1A 1OXSC 2R7DA 1OXUA 4FDBA 4POFA 3TREA 3CXCA 3CF5A 1Q7YC 1C9OA 4DPGA 1PH8A 2R7ZG 1IZ6A 4DUZL 1BBUA 4JI6L 2K75A 2R93G 3K7UC 3PV0A 1L1OC 1HZCA 2AWNA 3FKIH 3TQYA 2JA8H 4GKJQ 1L1OB 2N8NA 5IP9G 4JI1Q 2VY3A 4JI5L 4AQYL 4A3JG 5HGQA 5LMNL 3BJUA 1K73C 4DV0L 2ZM6Q 1RL2A 5IP7G 1N36L 4IPDA 1N34Q 4DR7L 4LFBQ 4A75A 1OXVA 1VQAA 2B3GA 4DV3Q 4B3TL 3KF6B 3PUWA 4YCWA 3I56A 4NPSA 1PH6A 2UUCL 2E8GA 3HOUG 1X3EA 1Q46A 3CW2C 4AIMA 3TEHB 4UP9A 1EYGA 4OONA 2Z6KA 2YU9H 3PO3H 1IBLQ 1VQMA 2NZOA 5BR8L 4HIDA 2OCEA 2KBNA 1NMFA 3GD7A 3ER0A 1IL2A 2IT1A 1X3GA 2JA5H 3STBC 2KHJA 4IOAA 2NZHA 5C3EG 4LNQA 4DKAC 4LF6Q 3J80c 1VS0A 2OWOA 1QZGA 4BY7G 4R4QA 1PH5A 4JBMA 2R93H 1FGUA 5GADC 1PFSA 4YY3L 3ULJA 4JI7Q 4IO9A 4A3CG 4RMFA 3EBEA 1IXRA 1GKHA 1HZBA 4R4OA 5IYBH 3PUYA 2JA9A 2R92G 4BY1H 4GOPB 2UUCQ 4OXPA 4H02A 3M9BA 4JCVE 1E1OA 1U5KA 1WI5A 4MNOA 1IYJB 4BBSH 2UXCQ 4LW1A 4A4IA 3LGJA 4LWCA 4R4CA 4DV0Q 1N34L 1GM5A 4QJFA 1Y1VH 3F2CA 1V9PA 1X65A 3J7A5 1FL0A 4L5TA 4BXXH 4JYAL 2WAQG 2RF4A 4R4TA 2BH2A 2Q2UA 4JYAQ 4DV4L 3GTMH 2MFIA 1PH2A 2OQKA 2HHHQ 4LUOA 1GD7A 4X62L 4L5SA 2D0OA 2NVYH 1AE2A 2KCMA 1FJGQ 2EXDA 3TS2A 1Q8KA 3PGZA 3I4MH 5C3EH 2RHQB 1IBLL 1WJJA 3ERSX 1MKHA 1B8AA 1X56A 1PHJA 5DLQE 3T1HQ 3KOJA 1E24A 2KENA 3KYHC 3S16H 4GNXC 3S17H 3RZOH 3KJPA 2BA0A 3PUXA 5IP9H 3U4VA 3HKZE 3CCQA 1XNQQ 3M3YH 4OX9L 3PIOA 4A3IH 1W2BA 1J5EL 1IBMQ 2E2HH 4KHZA 1GO3E 4C3JH 4B3MQ 4DR7Q 3I4OA 1SMXA 4MTNA 3G71A 1YJWA 4LUVA 4L5QA 4QY7A 1XPOA 1X3FA 2NVXH 3CCSA 4DV7L 3GTOH 1VQKA 2UUAL 1SN8A 4GLVB 4A3DH 2QGQA 3NBHB 4LFBL 3GTLH 3AFQA 3HOZH 2WB1E 3UDGA 2BH8A 1PH3A 2E5LQ 5FJ8G 2N78A 2R7FA 4DR5L 2I5MX 3K81C 4R4IA 4JOIC 1VQJA 3OYYA 2ES2A 4JI6Q 4BY7H 1N33Q 1N32L 4P75A 3UE1A 4X62Q 2JA6H 3CD6A 4A3GG 1LTLA 2JJQA 4DK3C 5IE8A 1I3QH 3M4PA 5C4XH 4A3BH 2ID0A 1VQ6A 3HOVG 4OWTB 2R92H 4DV2L 5GAEC 4AH6A 2MNAA 2VUMG 5LMUL 4K0KL 3T1YQ 1JJCB 4POGA 3T1HL 2Z0SA 1PH1A 1QVFA 1SROA 1N32Q 1WFQA 1Y1WH 1WOCA 1KQSA 4UP7A 4HIKA 4NB3A 3DM3A 3K7AH 1Q1BA 1SRUA 1UWVA 3JC66 4PG3A 1FJGL 3S1QH 3I7FA 1Q82C 1HNWL 3RNUA 4DR1L 4IJHA 1V1QA 4DK6C 2AWOA 4UY8C 2I5HA 1L0WA 2CWPA 2NVQH 4GN5A 1GVPA 1JJGA 4B3RL 1O7IA 3FHWA 2N3SA 1RIPA 4B3RQ 3E0EA 5ELOA 2R7ZH 2NN6G 1IBML 2Z6KC 4X65L 1TWFH 4JI7L 5ELNA 3ICEA 1VQGA 1UE7A 2NN6I 3HOYG 1XMOQ 4JC0A 2YV5A 2KCTA 4JG2A 1LUZA 1M1KC 4APVA 2ZJRA 1EQQA 4QL5A 1Q86C 1R9TH 4OWXB 1WYDA 4DR3L 1LYLA 4OO1G 5GROA 3PO2H 4RG1A 1UE1A 3FKIG 4JI1L 3F2DA 1TWAH 3U4ZA 5IYCG 4OWWB 1XNRL 4DR1Q 1JE5A 2I5LX 2YTVA 4P74A 3UDFA 3H3VI 3TRZA 2WB1G 1CUKA 4DNIA 4NXNQ 1JB7A 3MEFA 4HJAA 1ASZA 2JEAI 3A5UA 3PUVA 1Q1EA 2VQFQ 1PH7A 4YCUA 3HFZB 3JAMi 2OTJA 1XNRQ 5E7NA 2K4KA 3CC4A 4JI4L 4MZ9A 4X6AH 5M3MG 1VQNA 4A3LG 5C0XJ 3I4MG 1S3OA 1CKMA 2I0QA 1JT8A 3AFPA 5M5YH 3CQZH 1Z47A 4C3HH 1LM0A 4LF8L 1CSQA 4A3KH 3HOXH 1A62A 5LMNW 2JA7H 2ZM6L 2IX0A 1E22A 4HJ5A 3RZDH 1QVCA 2ZTCA 3H0GH 4BY1G 1QZHA 1XPUA 3KFUA 3K8AA 4A93G 1M90C 5IYBG 1K9MC 5EAYA 4YWLA 4DV1Q 4P71A 4JBKA 3GDEA 1B70B 2GVAA 5M5WH 1BKBA 3S2HH 1K8AC 3KDFA 1EQRA 1Z9FA 2H5XA 1IBKL 2HIVA 1XNQL 3CMEA 1I5FA 4GOPC 2VQEQ 1SLJA 4X65Q 1XPRA 4JI3Q 2F4VL 4QQBX 1C7YA 4ALPA 1NMGA 3PF5A 4BA2I 1BVSA 1KRTA 2CQOA 4Y7NH 1JJ2A 3HOZG 3PSIA 1KL9A 1S40A 1HR0Q 1K3RA 5IYDH 3CP0A 1X6OA 1KD1C 2YTYA 1SR3A 1DGSA 3GTPH 1NY4A 4DR4L 1HNXQ 4B3ML 3S14H 2LXJA 5C4JH 1QUQA 2JK8A 4GS3A 1AH9A 1K83H 4JI2Q 3GTKH 1A63A 1H95A 1L2FA 1VQHA 3HOVH 5IY0A 4C2MH 4X66Q 3KDFB 2CCZA 1SFOH 3I4NG 1G6PA 2UXDQ 4UPAA 5IYCH 4HJ9A 4LUZA 3ZJYC 1X9NA 1VQBA 4JBJA 4JBWA 5LMNQ 1NTGA 1N36Q 3CMAA 4DV5Q 2JA8G 1Y1WG 1YHBA 4DR5Q 1CKOA 4JI2L 1PYBA 3JAMc 4B3TQ 2ATWA 3CCJA 5IWAL 3J81j 3Q8DA 4TVAB 3D31A 4A3FH 4TQUS 3HKSA 3L2PA 4DV1L 1YEZA 1K8GA 1Q12A 4GN4B 3E9IA 2UUBQ 1CSPA 3A74A 3J80i 3RN5A 1VQ7A 4DV5L 1EUJA 2F52A 1QUQB 4YWKA 1V43A 3F2BA 1I94Q 2E5LL 2IHEA 4PZ6A 1EIFA 3K80C 3J81c 3T1YL 5FJ8H 1E3PA 1NBWA 1HNZL 5M3MH 4LF4Q 3CCMA 4A3LH 1SE8A 1HR0W 2K5HA 3H0GG 4JI8Q 4ME3A 2K14A 3PUZA 4IJLA 4GOPA 2GVBA 1VQFA 3G48A 3RLNA 3HOXG 4AYBE 1XJVA 4A3MG 4DR4Q 3AYHB 3CCRA 1WCMH 5M5XH 4NXMQ 2JE6I 2YYZA 2VUMH 4A93H 2JQOA 3F8TA 1HNZQ 4HIOA 4LF9Q 1MJEA 3U58A 3GTQH 4PZ7A 1JMCA 1L1OA 4GLAC 2XTIA 3UE0A 4J15A 4OX9Q 5JJKA 5C0XI 3CCEA 1X55A 4P72A 4DV3L 2VZAA 3KF6A 3KF8B 3NELA 3FP9A 3OW2A 1EOVA 2PNHA 2MO1A 3S24A 3S1NH 1PVOA 4QIWE 1PA6A 4BBRH 1X54A 4JI0Q 4KHPL 1HZ9A 1IBKQ 2HIXA 2IY5B 3PCOB 4B3SL 2PI2A 3L7ZC 3OTOL 3CCLA 2K5VA 3B6YA 1G51A 1YIJA 3CCUA 5LMUQ 4K0KQ 1I50H 2ZJPA 4DV6L 3S1RH 1OTCA 3HOYH 3I2ZA 1J6QA 1UE5A 1T9HA 1WCMG 2QEXA 3A5ZB 1OXXK 4LF6L 4DR3Q 3GO5A 1K0RA 4DAYB 3ULPA 1W3SA 2UXDL 4LF8Q 1VQPA 3U50C 1I94L 2EQSA 4YY3Q 4IPGA 4HIMA 4JI5Q 2EIFA 5GAHC 4LFCQ 5BR8Q 3RN2A 4NXNL 3NENA 1N9WA 3AQQA 4A3EH 1Q81C 4JI8L 2UUAQ 2B63G 1VQOA 1B7YB 3GTJH 5H1SE 2QA4A 4LFAL 2NVTH 4PMWA 3M4QA 3J7ZC 3M85A 2FXQA 2VW9A 4GNXB 4NXML 3G6EA 1E1TA 2WAQE 4EX5A 3CC2A 4LF7Q 1N33L 1C0AA 1PYSB 4DR2L 1YHAA 3KLWA 3UDIA 2AHOB 3IRBA 4AYBG 4EQ5A 1BBWA 5AJ3L 2JA7G 3G4SA 2AKWB 1YHQA 1S72A 5C4XG 1KC8C 2ZTEA 4QGUA 2A8VA 3I4NH 1P8LA 3TS0A 1MIUA 4R1JA 1A0IA 4BA1I 1J5EQ 3KJOA 5J3BA 4JV5L 2VNUD 2K52A 1HR0L 2Q2TA 4DR2Q 5C0XG 2CFMA 4LF5Q 2GN5A 4X64Q 1XMQL 3HKZG 4LF5L 1E7ZA 4A3DG 1I6HH 5FLXc 4GNXA 3EIVA 3SGIA 1PV4A 2JEBI 4XIGS 3MXNB 4JI3L 2VQEL 1D8LA 4AQYQ 2F4VQ 5IYDG 1U0LA 5K36G 1VQ9A 1PH9A 3HOWG 3ULLA 1KRSA 4GLXA 2JA5G 2AMCB 4IOCA 1CKNB 4DUYQ 3E9HA 2UXBL 2WFWA 2WP8J 4GKJL 5JJLA 2DGYA 1XTDA 3BZCA 3RLOA 2ASBA 1UEBA 2DUDA 2IHFA 3K0XA 4XTCS 1FVIA 2HQLA 5GAGC 5M3FH 2VS1A 4KLKA 4P73A 4DAMA 4LF9L 3PF4A 3CPWA 1YJNA 3GTGH 4IFDI 1YNXA 1UE6A 4JI0L 4KHPQ 2F3IA 2E2JH 3M7NA 3RR5A 4IFDG 4BBSG 2UXCL 5GQOA 3H15A 3DLLA 2VQFL 3S2DH 4A3EG 3BZKA 1TWGH 2PI2E 4LFCL 3RLFA 2PQAB 4BXXG 4LF4L 1KXLA 1CKNA 1HJPA 2ZJQA 3BU2A 1ASYA 1Y1VG 3EN2A 1YVCA 2PMZE 1N8RC 2MO0A 4HJ8A 3PO3G 2Q2HA 4DV4Q 1VQ4A 1HNXL 2K50A 1TWHH 4DV7Q 5C44H 1MJCA 2UU9Q 4BBRG 4IFDJ 4KI0A 3J81i 2KHIA 1VQCA 5HY6A 1EIYB 3W1GA 3D0FA 3PIPA 4A3MH 1XMOL 4YHHQ 3UDXA 2K5NA 5M3FG 4LFAQ 4YHHL 4DR6Q 3PO2G 4A3KG 4A3JH 3L0OA 3A0JA 4O2DA 5FLMH 1D7QA 2PQAA 2A19A 1TXYA 3S15H 3STBD 5IWAQ 2OTLA 3NEMA 1NJIC 1HNWQ 1HH2P 3S1MH 2RHSB 4DV2Q 2D62A 4IPCA 4JV5Q 4YCVA 3W5OA 1P16A 2RCNA 2UUBL 4UP8A 1YBYA
chains in the Genus database with same CATH superfamily
4ZKBB 2K32A 4ZRZA 1I4XA 4K2KA 1SE3A 1NE3A 1DYQA 1PRTC 5IT9c 2L15A 2Y0SE 1WTPA 4LF7L 4DUZQ 4WJ4A 1QNKA 5JJIA 1TVXA 2A1AA 5DEHA 3D8GA 1YZ6A 2KJXA 1M8AA 2MQHA 4B3SQ 2JA6G 3GTGB 3I72A 1VQ5A 4I7AA 1OXTA 3T13A 1AE3A 3I55A 4L5RC 2N49A 1SYGA 3OWFA 3HS0C 4A3KB 1II3A 4EQNA 4A3CH 1VCIA 4B08A 5COYA 4NW2A 2CVRA 2A68D 3HOZB 2C35B 1SNMA 1S5ED 4E6IA 1TR5A 1I4PA 1NAPA 4R9WA 5CV8A 4X3KA 2UXBQ 1HZAA 3PQIA 4X64L 1XMQQ 2B63H 2PPBC 2AUKA 1KHIA 5C6AA 1U4RA 2TSSA 5E3FA 3TREA 1Z7TA 4RGTA 3CF5A 1PH8A 4JI6L 4U68A 2FMMA 1WTQA 1L1OC 3TQYA 1S5CD 3C46A 1B44D 1JICA 1R4QB 3P7JA 3BJUA 1O7YA 4DV0L 1E2ZA 4DR7L 4A75A 2B3GA 3VYRA 4NPSA 2UUCL 3CRKC 1X3EA 5JJZA 3CW2C 3T51B 3TZDA 2H4OA 1RDPD 2WB1B 3DEPA 4OONA 2B2UA 2Z8LA 3NXWA 4MIUA 1F2ZA 5I6YA 1NMFA 3ER0A 5IGCA 1IL2A 2KHJA 4QMGA 5C3EG 4LNQA 2QDBA 1CQFA 1VS0A 4R4QA 2L5TA 2PYKA 5FO7B 4JBMA 3ULJA 4JI7Q 4A3CG 1BNZA 2PW7A 1Q3LA 4OXPA 2VB3X 1IYJB 1HUMA 1CM9A 3ONAB 5DM63 2UXCQ 4QJFA 1X65A 1FL0A 3NHHA 4DV4L 2NVXB 1PH2A 1V1PA 4X62L 3GV3A 1EIHA 3RZDB 4KTAA 3QJYA 3NTHA 3TS2A 4OL7A 1IBLL 1B8AA 1PHJA 1STHA 2KENA 4HTHA 4KHVA 2IWHA 2BA0A 5HGTA 1XNQQ 3HKZE 4OX9L 2D9UA 2NTTA 3PIOA 1BCPC 4KHZA 5EGTA 4CKBA 3I4OA 4L6TB 2G9DA 4MTNA 2RDHA 2VB2X 2Z9HA 3G71A 1FR3A 3Q23A 4NP5A 4JK1C 4L5QA 4QY7A 1VQKA 4GLVB 2QGQA 1PXUA 2RSNA 3HOZH 3AFQA 1K0SA 3HKZB 3HGBA 4UAIA 3RZOB 4JOIC 3J7AF 1DZ1A 2E2JB 4P75A 1CHPD 2JA6H 1SFOB 2JJQA 4C3IG 4DK3C 1I3QH 5KYIA 2ID0A 4J1MA 3A54A 5GAEC 2MNAA 2VUMG 5LMUL 1GHKA 1JJCB 1PTOD 1KNAA 3K7AH 1D2BA 1SRUA 1UWVA 4PG3A 3S1QH 3MAQA 3RNUA 1KLGD 5IOCA 4IJHA 3NQIA 2E2DC 1W6KA 3HG9A 4GN5A 1GVPA 4DK1A 1QNUA 5F2DA 5K5PA 5CV7A 2R7ZH 2NN6G 1UEAB 4G7HC 1IYVA 3ICEA 1VQGA 5EPKA 4KY6A 4IUNA 1LUZA 1R9TH 4OWXB 1WYDA 5CV6A 4OO1G 2L55A 4RG1A 4JI1L 1MD2D 3F2DA 5IYCG 4OWWB 4P74A 2K04A 5D3DA 2B8FA 3QOJA 3URYA 1B9NA 3I3CA 2JEAI 3PUVA 1SNDA 3HFZB 1XNRQ 1EQVA 1VQNA 1S3OA 4H13C 2I0QA 1JT8A 1Z47A 1TKWB 1LM0A 3RZDH 1QVCA 2ZTCA 5C4JB 4ZLTF 1U4PA 3K8AA 4A93G 2A73B 1PLFA 4P71A 5M5WH 3S2HH 3OWEB 4DFAA 2F1MA 2X6LA 1XNQL 2K05A 2F0OA 1XPRA 1EEFD 4QQBX 5BN3A 1NMGA 3PF5A 2V4DA 2JXMB 4XQQA 1CHQD 1H9SA 4H0LC 4RA8A 1S40A 1X6OA 1SR3A 1DGSA 4TRDA 3GTPH 1NY4A 2G9HD 4KV6A 3Q24A 1D5XC 5E4XA 4B3ML 1UNSA 2EY1A 2JK8A 2B2VC 3GTKH 3S16B 1VQHA 2PZUA 5IY0A 4C2MH 3SE0A 4EVOA 3I4NG 2B39A 4UPAA 5IYCH 1MI2A 4LUZA 1IHZA 1X9NA 5LMNQ 1N36Q 4DV5Q 1YHBA 3A8IE 2F0TA 3J81j 3V2TA 2CQAA 4ODGA 4A3FH 4TQUS 4KMUC 2SNMA 1K8GA 3KUPA 3E9IA 3A74A 3M7GA 3T16A 2K5WA 4YWKA 3S1QB 4K5VA 1I94Q 4PZ6A 1EIFA 4DA2A 5M3MH 4A3LH 5CBAE 3CCMA 1SE8A 3NP8A 1AP0A 3PUZA 2O2LD 3K5OA 4GOPA 3RLNA 1ESFA 5M5XB 2ICEC 2YYZA 2D2CC 3F8TA 3FVQA 3ZYYX 4WORA 1VMPA 5CR3A 1JMCA 3DMUA 4GLAC 1XWEA 2XTIA 2F0JA 4C1NI 5JJKA 5C0XI 5C44B 5EPJA 2F0IA 5IT9L 2PNHA 2MO1A 3S1NH 3PMFA 1UUPA 1X54A 1HZ9A 1KAAA 1IBKQ 3OTOL 3G7LA 2XIWA 4C1NK 1XTCD 5JEAH 5LMUQ 2ZJPA 3S1RH 1OTCA 2F0UA 4N8FA 1F2LA 1WCMG 4DAYB 2UXDL 5KIXA 2NWGA 2EQSA 1I94L 4FF4A 3MXGA 2L12A 2KCCA 4NXNL 1PTOF 3AQQA 5I2XA 2UUAQ 3GTJH 5CYUA 2K28A 4HSVA 5CV5A 3OHXC 5H1SE 2QA4A 3HEJA 2NVTH 3M4QA 3J7ZC 3TP8A 1BCPF 2E2HB 1E1TA 2B2WC 2WAQE 1BO0A 4LF7Q 4NMZA 2K01A 1N33L 1PYSB 4AYBG 5C4ZA 3CQZB 1GUTA 1S72A 2ZTEA 1GXDC 1P8LA 3A8JE 1A0IA 2BE5D 2Q2TA 2FMCA 2E2IB 3HOWB 5CGKA 3EIVA 3SGIA 2JEBI 2F4VQ 4A3IB 5K36G 1B1ZA 3K5MA 2L1BA 4K8JA 4A3JB 5D14A 4IOCA 1CKNB 2UXBL 5TSSA 3S1MB 3NBHA 4IN3A 3BZCA 3RLOA 4QB4A 2ASBA 2IHFA 2GA4B 3K0XA 3I4NB 5M3FH 4KLKA 2A68C 4DAMA 3VA7A 4CKCA 2N55A 3I91A 3J80E 1YNXA 4BBRB 3M7NA 1WD1A 3RR5A 4V0BA 1Y8PB 1TS4A 4IFDG 4OEMB 3VYTA 2FFKB 3I70A 3AU7A 5ELCA 4LF4L 1CKNA 1HJPA 4IURA 3BU2A 1N8RC 4HJ8A 3PO3G 1JWSD 2Q2HA 2K50A 2KCNA 5CV4A 3GQBA 2SNSA 1IW7C 2EYOA 5HY6A 4K6DA 5JVH3 3GTKB 4LFAQ 1UAPA 1CK1A 2KVMA 3L0OA 3A0JA 2A19A 3STBD 1NJIC 2F0HA 3LWEA 4DV2Q 3BDLA 4Q0FA 2D62A 4YCVA 3MWYW 1LTGD 4DK6C 4OIKA 1TQOA 1EOTA 1B9MA 4K5WA 4GKKQ 3SR1A 2RA4A 3M4OH 3HOUH 3AEVA 2WV6D 4DV6Q 1NCVA 2LSSA 2A5HA 2BA1A 2ALYB 4JOIA 2L4NA 3S2HB 4QCLA 4EQOA 4WJ3M 1KAWA 3S17B 5AJ3Q 4HJ7A 4RCOA 1NR4A 4DR6L 2UU9L 4V190 3H91A 4O0AA 1VQLA 1SYCA 3CPFA 1G291 1YI2A 3WWVA 1RF2D 2HT1A 5IP7H 4A3IG 3SK5A 1STEA 2D0PA 1QVGA 4BWGB 3GTLB 1EY7A 1O78A 5E4WC 1S5DD 3OW7A 5IT9E 2JSOA 3HZXA 1ZYRC 3L9AX 1VQEA 2Q8TA 4A3FG 1K3BC 4QF4A 4A3EB 1PYWD 3OTOQ 3R93A 5IGFA 1PMRA 4PZ8A 1OXSC 3X3MA 4FDBA 4POFA 1VDZA 2MPMA 2RDFA 1WTRA 1Q7YC 1C9OA 2EDGA 1IZ6A 1BBUA 1F9SA 2K75A 4X3UA 2K03A 1HZCA 3IAYA 3S1RB 4AQYL 3K5LA 1G2SA 3IKJA 5LMNL 1K73C 1N36L 1EU3A 4DV3Q 3PUWA 3QIAA 4YCWA 1HQMC 2ENBA 2E8GA 1STYA 3KBGA 2NVQB 1SMYD 1Q46A 5A2QL 1S5FD 4KN4C 3TEHB 5HURA 2YU9H 1IBLQ 1VQMA 4N9PA 5BR8L 4HIDA 5BN5A 1V8QA 3ERQA 3BYTB 4I65A 3GD7A 2IT1A 2DY7A 1T5EA 1I50B 4HEDA 4LF6Q 2XSCA 2OWOA 1QZGA 4JW0A 2PNRC 4RGNA 1PH5A 1FGUA 1PFSA 5J39A 4ME5A 4YY3L 3EBEA 3PUYA 1JWMD 1PRTD 3E6ZX 4IFDH 2EYPA 4JCVE 4HSPA 4BBSH 1O80A 2NVTB 4LW1A 3LGJA 4LWCA 1FYCA 2B2VA 1N34L 1GM5A 3J7A5 4BXXH 3U9OA 3OMGA 1IYUA 2WAQG 4R4TA 2Q2UA 5CBEE 3I73A 5C3WA 2HHHQ 1GD7A 5I9PA 2D0OA 1AE2A 1TIID 2EXDA 1H9MA 2R93B 1K83B 1WJJA 1F77A 1TY0A 3EROA 5DLQE 4EGVA 4HR7B 2KQ3A 3VYUA 3KYHC 3S16H 4OO1H 3S17H 3KJPA 3PUXA 5IP9H 3M3YH 3C2PA 4A3IH 2E2HH 1W2BA 4FF3A 4DR7Q 1LV9A 2PMZB 3SHLA 2J0TD 2WKDA 2UUAL 4A3DH 1K8MA 4LFBL 2I46A 3GTLH 2E5LQ 4B9XA 1PH3A 2R7FA 3W3AA 4RGMA 4DR5L 2B2WA 3OYYA 3HOVB 4BY7H 3D3RA 1N33Q 3UE1A 1G6ZA 2NZ1D 1MSGA 5IE8A 3M4PA 1QJOA 1WTVA 1SJHD 4DV2L 5LHY1 1BDOA 4XXEA 1W6JA 2DNEA 2XWBB 4CHTB 2Z0SA 2IW3A 1QVFA 1WFQA 1KQSA 3BS1A 4NB3A 3TP7A 1TS5A 4HMJA 2KUMA 3KK7A 2MHVA 4RCNA 4OGQC 5FLXE 1V1QA 2EY5A 3M4OB 2WIIB 4UY8C 1QILA 3S9WA 4MTKA 1L0WA 2CWPA 5C5MA 1O7IA 3FHWA 2N3SA 1I4QA 1I4RA 3E0EA 1MSHA 4X65L 1TWFH 3NE5B 4K6LA 3ITPA 3HOYG 4ZQ3A 2JA8B 4JC0A 2YV5A 1EQQA 2ZJRA 1EIGA 2CW0D 2DN8A 3UI2A 3D6CA 1LYLA 5GROA 3FKIG 1XXGA 3MEHA 4DR1Q 1D1IA 3UDFA 1SSOA 3RUZA 1JB7A 3MEFA 4HJAA 5DNFA 3CU7A 2KA7A 1VF7A 1CQVA 3A5UA 1Q1EA 2ZT9C 5E7NA 3S15B 2K4KA 2SDFA 4MZ9A 4RKBA 3OOCA 1CZWA 1LTRD 4P2CB 4A3KH 2JA7H 2XRSD 2IX0A 1NUCA 5IIFA 3H0GH 4BY1G 2Z4IA 4WRDA 1B70B 2GVAA 3SEBA 1SBBB 3NBIA 4X3TA 2A6HC 2LKVA 4H44C 1Y1VB 1I5FA 3NK9A 2L11A 2VQEQ 1SLJA 4X65Q 4K8IA 4JI3Q 4ALPA 4BA2I 1KRTA 4Y7NH 1JJ2A 3PSIA 1KL9A 5EKIA 1HR0Q 5K36H 3EFXD 5EBCA 1DOKA 2K1BA 4AYBB 5JAVA 1H95A 1A63A 1L2FA 2RSOA 1TS2A 2E76C 3V05A 2CCZA 4LK1C 1G6PA 3ZJYC 2R7ZB 1EU4A 4YIJA 1BQQT 3EQLC 3CHBD 4DV1L 3J80i 3EJIA 5EKLA 1BBXC 1VQ7A 4DV5L 1QUQB 1V43A 3TP6A 1LT4D 2IHEA 3I8ZA 4KY7A 1HNZL 2K5HA 5C4HA 4ME3A 2GVBA 1VQFA 3G48A 3HOXG 3BDCA 4DR4Q 3AYHB 3CCRA 5M5XH 2JE6I 3D6WA 4A93H 5J22A 3U58A 5G3LD 4PZ7A 2EY6A 1L1OA 3A55A 4OX9Q 3H09A 1Y8NB 4DAYA 4KN7C 4P72A 2QEJC 3KF8B 3NELA 3MHBA 1EOVA 3QO2A 4QIWE 2RKSA 1LLRD 4JI0Q 2LMCB 4KHPL 3PCOB 4B3SL 2PI2A 5JPNC 5C3XA 4L8JA 1D5ZC 3AB9A 2K5VA 1TT2A 3B6YA 1YIJA 3CCUA 2EJMA 5I6WA 5FO8B 1T9HA 1AEXA 3A5ZB 4DR3Q 3GTPB 3ULPA 1YNND 2E75C 5M3MB 2F0PA 2BDOA 2F4IA 4JI5Q 5C0XH 2EIFA 3WOFA 4KJOA 1LTID 4QUFA 4CJ2C 4PQXA 4PMCA 1EY9A 3DUZA 1B7YB 1GUSA 4RH6A 1DOLA 3RMHA 1ENAA 4PMWA 3N6RA 3SK8A 2EVBA 4ZK9B 3CC2A 5ELDA 4EX5A 1HTLD 1YHAA 3UDIA 1KTKA 5M9OA 5AJ3L 2LFNA 4J6HA 3G4SA 1KNEA 5C4XG 4ID6A 1V1OA 2Y0SB 1MIUA 3K58A 4R1JA 4BA1I 3KJOA 5L37A 4XYOA 2K52A 2IX3A 3PIP3 1EYCA 3OIQA 4GNXA 3MXNB 4KD3A 1D8LA 5ELFA 4BS9A 5IYDG 5A35A 4M8AA 3RD4A 1KRSA 3ULLA 2JA5G 1JCKB 3E9HA 2WFWA 4ZYSA 2DGYA 4XTCS 1FVIA 2N88A 5GAGC 4N8X1 4C3IB 4LF9L 3PF4A 3D4WA 4S3SA 4IFDI 1UE6A 4FO2A 4UHVA 4Y7NB 2Z1CA 2UXCL 2EOTA 1CA5A 3RLFA 2ZJQA 1B50A 1EZ6A 1Y1VG 3C1EA 3EN2A 2F0SA 4DV4Q 1VQ4A 4KY5A 1F9PA 4DV7Q 2R61A 2UU9Q 5FOBB 4BBRG 4IFDJ 2XWJB 3J81i 2KHIA 1VQCA 2B2TC 1EIYB 4A3MB 1EY4A 2A69D 2K5NA 5M3FG 2ZXPA 2VUMB 2A6EC 3PO2G 2KECA 1TY2A 4A3JH 1D7QA 2E74C 3PO3B 3S15H 1HNWQ 2OTLA 3NEMA 1S4ZA 3S1MH 1LT6D 1P16A 4FVMA 2PZWA 2M9VA 1MJEA 3GTOB 5EJWA 4DK0A 2B29A 4GN3B 1FNVA 4A3DB 1A8VA 2VL6A 2E2IH 2Y0SG 2CKZB 4RKLA 1EWIA 1VQIA 1EL0A 1Y14B 4A3GH 5M5YB 4XYQA 5JEAG 3VYSA 4A76A 3QR8A 4X66L 3F1ZA 4U673 2ZTDA 3Q0AA 1TWCH 2EYMA 3VDYA 3TBIB 1PZID 4N9TA 2YTXA 4Y52H 2V1CC 1STGA 4DAVA 1GUOA 3MFGA 1EFWA 2XGTA 4JI4Q 2SOBA 3KLSA 3CC7A 4DUYL 1LABA 5C5LA 5JEAJ 1JR0D 2H1EA 1YITA 2EZVA 2EPBA 1VQDA 1YJ9A 4CJ1B 2C9OA 2IX1A 1Q90A 2R92B 2UUBL 2EE1A 4NKLA 3DXJC 3JAML 1AN8A 2R93G 3FPPA 3K7UC 3PV0A 3CKIB 2AWNA 3FKIH 2HCCA 2JA8H 2QCPX 2N8NA 5IP9G 4JI1Q 2VY3A 4JI5L 2JA5B 5HGQA 1N34Q 1RL2A 5IP7G 4IPDA 3S14B 2K6AA 3MA2B 1OXVA 1VQAA 5KYLA 1CA6A 1I6HB 3KF6B 3J81E 3I56A 3Q22A 1E0BA 1GOZA 1EYGA 2Z6KA 2NZOA 5AFWA 2OCEA 2B2TA 2KBNA 3OPOA 4L63B 3STBC 5FK9C 4K2LA 2O4XA 3Q6SA 1HA5A 1ICWA 1V1PB 2QW7A 4B9WA 5EBDA 2F0NA 4RMFA 1HZBA 4R4OA 5IYBH 4A3BB 2R92G 4BY1H 4GOPB 2UUCQ 3M9BA 2C5CA 1A2TA 3FDTA 4MNOA 5IGBA 1ESRA 3MVVA 2O5JC 4R4CA 3F2CA 1Y1VH 1WVLA 1H9KA 4JYAL 4L5TA 4O1NA 1TS3A 4JYAQ 4CGYB 1SNPA 4LJZC 3GTMH 4LUOA 1HCZA 1MBYA 3TZUA 1FJGQ 3PGZA 3I4MH 3VR3A 1SYDA 2PQEA 1MKHA 1QG7A 1X56A 3FPUB 1E2VA 4GNXC 1EWHA 5CORA 3D4RA 4CDEC 1IBMQ 3AMUA 3OIPA 1GO3E 2B63B 2WINB 3BG3A 1YJWA 1XPOA 1X3FA 5CMDA 2NVXH 1EQTA 4DV7L 2XNAC 3NBHB 1JOKA 3P1HA 2BH8A 5FJ8G 4FXKC 2I5MX 4R4IA 1EEID 3T4AC 4BBSB 1VQJA 2ES2A 1N32L 2R3ZA 1LTLA 2D5DA 1GUWA 5KNCA 4OWTB 2R92H 4FXGC 4C3HB 3T1YQ 3T1HL 3QOLA 1PH1A 1JORA 1SROA 3DM3A 1O7ZA 5G3LF 1Q1BA 3R3OA 1ENCA 1FJGL 3JAME 4WJWA 4TKOB 1EWCA 2I07B 4UDUC 2I5HA 3SK4A 3FEWX 1I4HA 1ET9A 2F03A 4B3RL 1JJGA 2HQEA 4B3RQ 5ELOA 1IBML 2Z6KC 2CH4A 1UE7A 2NN6I 4ZUJA 1PTOC 1XMOQ 3MXUA 1M1KC 4APVA 1Q86C 1HA6A 3PO2H 3DWPA 1UE1A 1PFBA 1TWAH 3E3XA 3H3VI 1JE5A 2I5LX 2YTVA 3M4YA 3TRZA 2KHSA 2WB1G 4NXNQ 4FF2A 4F8MA 1AZPA 3S1NB 3MFYA 1CFMA 1ONLA 3K6OA 1LACA 4IALA 2VQFQ 5I4DA 2OTJA 4KKTA 3CC4A 3FKIB 4I7ZC 4OHJA 4X6AH 1A6XA 3R2TA 3I4MG 3AFPA 1R9TB 3A8KE 1CSQA 1ENFA 3HOXH 1FGBD 1E22A 1AW7A 2FJ2A 3IFTA 5IYBG 1ILPA 5EAYA 4DV1Q 4BY7B 1KDAA 1HQRD 2RBMA 1K8AC 2Z4HA 3KDFA 1EQRA 1Z9FA 2H5XA 1IBKL 2HIVA 2X69A 1RHPA 4GOPC 2F4VL 2F0LA 2BDNA 2KEEA 2CQOA 1ML0D 1WTWA 3HOZG 1F9RA 1TWCB 5IYDH 1KDCA 1LTAD 2NN6H 3VR5A 2RCFA 1WD0A 4DR4L 5FLXL 4QUCA 1XX8A 3S14H 2LXJA 1DM0B 5C4JH 1AH9A 1K83H 4JI2Q 4R8NA 2K5DA 3SK6A 4PV1C 1SE4A 4X66Q 2AUJD 1K8OA 4HCEA 1SFOH 1S5BD 4CKEA 2JA8G 4JBWA 2B2YA 2EJFC 4DR5Q 1CKOA 1PYBA 3JAMc 4MHEA 4B3TQ 3CCJA 2NUCA 5IWAL 1J9OA 3Q8DA 4WFN3 3D31A 3O13A 1EY8A 1YEZA 4RFBA 3L2PA 1Q12A 1QCBD 1YNJC 4GN4B 1B3QA 3ND8A 1CSPA 3P20A 4KD4A 1JOQA 3GTQB 5LL6S 4IZ8A 2Q8RE 1RTNA 1E3PA 1SYFA 5C4XB 4CBVA 1HR0W 1RKNA 2PW5A 2L0CA 4O42A 4JI8Q 2HDLA 4IJLA 3A7AB 1GHJA 3OSOA 1XJVA 4AYBE 3SXHA 1FNUA 1WCMB 1ZKOA 2VUMH 2XN9C 1HNZQ 1F2YA 4K14A 5ELBA 4HIOA 4LF9Q 1STAA 2PO4A 4IUVA 1ICFB 3TSSA 2VZAA 3KF6A 2JN4A 3FP9A 3OW2A 1J8IA 1PA6A 1BCPD 2IY5B 4C56C 4A93B 3GV6A 3CCLA 1G51A 2A74C 3PIO3 1BCPB 1C4QA 3HOYH 3I2ZA 4X3SA 3DM1A 1J6QA 1RCVD 1U4LA 4HMIA 1OXXK 3LX0A 1WTHA 1C48A 2EXZA 4Z9CB 3U50C 2K5QA 3HOUB 5GAHC 4LFCQ 1JWUD 2FINB 2WACA 3RN2A 5DAUA 3NENA 4ULLA 1N9WA 1Q81C 2NB0A 4JI8L 2B63G 1H9JA 3J81L 1VQOA 1CI3M 4LFAL 3M85A 2FXQA 4GNXB 1SAPA 1LO5D 2A6ED 3IL8A 2HUGA 3G6EA 1HFNA 4XDXA 1C0AA 2F0QA 4DR2L 3KLWA 1U4MA 1BBWA 4TSSA 1KC8C 1QB5D 3NQTA 3I4NH 5D3IB 4ZUIA 1TWHB 3VA5A 4JV5L 1HR0L 1KABA 5C0XG 2CFMA 2EYFA 2GN5A 3I90A 2XRQD 3QG1A 5KRUA 4A3DG 5BN4A 1I6HH 4XIGS 1U0LA 3HOWG 1GUNA 3G6JB 4GLXA 1G91A 4LMQD 1B4OA 4DUYQ 1D1KA 4GKJL 5JJLA 1FNWA 1JE4A 1UEBA 2HQLA 2VS1A 4P73A 1SDFA 3CPWA 3A56A 1YJNA 2ICIA 3GTGH 5KGUA 1G8ZD 1LT5D 1ILQA 4BBSG 2B2YC 5GQOA 3S2DH 4HCSA 1TWGB 3QB3A 3BZKA 3K5NA 2PQAB 1KXLA 1YVCA 2PMZE 4RAUC 2EYHA 2O5IC 5C44H 1TWAB 1MJCA 1NR2A 3CRLC 3VR2A 5IGEA 4Q5VA 4HAEA 1I6VC 1SYBA 1DCZA 3J7AV 1SE2A 2JA7B 3W1GA 3D0FA 3LNNA 4A3MH 2DJFC 1HTPA 1XMOL 3UDXA 2MP1A 1PFMA 3MZ5A 4DR6Q 1RTOA 2PQAA 1TXYA 5IWAQ 3FMCA 3GTJB 1HH2P 2QDLA 4DXGA 2AQ2B 2BOSA 4G57A 3SVMA 1BR9A 3NWSA 3CAMA 1AZQA 4XT3B 2XVSA 4R8IA 1FD7D 1OO9B 4DNTB 4IPHA 1ZYRD 4C3IH 3CCVA 4FF1A 2M2LA 2MJ8A 1PH4A 4ILWA 1G2TA 4A3BG 4YWMA 2CWAA 4OO1I 1JB3A 2IJ0A 4K5XA 3P75A 2EY2A 2F0EA 2OQ0A 1KIXA 2Q2IA 5FLMG 2R6GA 3T56B 2LXKA 4DU9A 3MTSA 4GKKL 3H3VH 2ZXOA 2HHHL 5IODA 4XT1B 4ABNA 1F9QA 5KNDA 1AFPA 3LWUA 4DF7A 4IQZA 5C44G 1VQ8A 3W1BA 3HOWH 1R4PB 1CT1D 3W2DA 1WTOA 2K7VA 2R7DA 3TDQA 1OXUA 3CXCA 2EYLA 3N52A 5J1ZA 4DPGA 2R7ZG 3NSWA 4DUZL 4ZAIA 2P5ZX 3L3OC 4GKJQ 1L1OB 1QE6A 4A3JG 1Q8IA 2ZM6Q 4LFBQ 2F0FA 4B3TL 2KEDA 3KF8A 1RODA 4C3JG 1PH6A 3HOUG 1A2UA 5E1FA 4AIMA 1MGSA 4UP9A 2A69C 4A3FB 3PO3H 3S2DB 1SXTA 3KLRA 1X3QA 1Y69U 4IUPA 2OT2A 1D5MC 2J7ZA 2JYOA 1X3GA 2JA5H 4DAPA 2HDMA 3IFDA 4IOAA 2NZHA 3X3NA 1Z6HA 2RDGA 4DKAC 3J80c 3I4LA 4BY7G 1BF4A 2R93H 5GADC 4IO9A 2JA6B 1IXRA 1T5XD 1GKHA 1SMYC 1I3QB 2PZTA 5LL6X 4FP5D 2JA9A 2F0WA 5IGDA 4H02A 4KKUA 1E1OA 1U5KA 1WI5A 1B53A 4A4IA 3K59A 3H94A 4DV0Q 2EYJA 4PNYA 3VR4A 1V9PA 4XQNA 1PRTB 1X3PA 2RF4A 2BH2A 4KK7A 1SYEA 2MFIA 2F3WA 2OQKA 4L5SA 2CHBD 2NVYH 2KCMA 1H9RA 1Q8KA 3H0GB 5C3EH 2RHQB 3ERSX 4IUTA 4C2MB 1STBA 4CJ0B 1HHVA 3T1HQ 3KOJA 1E24A 1IKMA 4J8QA 3RZOH 3U4VA 3CCQA 1Y8OB 1EY0A 1J5EL 1EY5A 4OIJA 4C3JH 4B3MQ 4IUUA 3GTMB 4JPBW 1SMXA 5I9OA 4LUVA 3FRPB 3CCSA 3GTOH 1SN8A 4G7ZC 2DNCA 2WB1E 3UDGA 2LS01 1EZ8A 1PTOB 2N78A 3K7AB 1NSNS 4NDXA 3K81C 1SNCA 4JI6Q 5M5WB 4X62Q 2HD3A 3CD6A 4A3GG 1EY6A 2AQ3B 5C4XH 2QKIC 4A3BH 2DJGC 4DGZA 1VQ6A 1TWFB 3HOVG 4A3GB 4AH6A 4K0KL 4POGA 4ZKCB 3GP7A 1N32Q 1ZEQX 1Y1WH 1WOCA 4UP7A 2RVLA 4HIKA 2RQXA 4H7BA 1PZJD 3JC66 2IPKD 2OF1A 3TMEA 2CW0C 3I7FA 1Q82C 1HNWL 1QOHA 4DR1L 1I4GA 2F0DA 2AWOA 2QILA 3ND9A 3TN2A 2OXPA 2NVQH 4M1UB 1B3AA 1RIPA 2WKCA 3NUCA 4JI7L 5ELNA 1F2MA 5EQ0A 3HP3A 4KKSA 5JVG3 4JG2A 2VXWA 2KCTA 4QL5A 4DR3L 5FKAC 3F2UA 1GJXA 2HCIA 1L0YB 3U4ZA 2JP1A 3I4MB 4FYDA 1PZKD 4MN3A 1XNRL 3H3VC 1CUKA 4DNIA 1VF5C 3WOEA 5DM73 1ASZA 3KBXA 1PH7A 4G7OC 4YCUA 1VMCA 3JAMi 2A6HD 2KOLA 4DN4M 3M3YB 4JI4L 1DD2A 1SNQA 5M3MG 4A3LG 2IL8A 5C0XJ 1CKMA 5M5YH 1H9SB 3CQZH 4C3HH 4LF8L 1A3UA 1A62A 3A7LA 5LMNW 2ZM6L 1JC7A 3VR6A 4HJ5A 1QZHA 1XPUA 1O7LA 1KDBA 3KFUA 5C3EB 1M90C 1M4VA 1K9MC 4YWLA 3NWTA 4JBKA 3GDEA 1A3VA 5JOBA 1BKBA 1RJTA 3DWQA 4OELB 1A15A 3CMEA 2M00A 4FNFA 1C7YA 2OEOA 1EFID 1BVSA 1CTMA 3E0JA 3C3LA 1SEBD 1K3RA 5I2YA 3CP0A 1K28A 1LTSD 1KD1C 2YTYA 2Q8IB 1HNXQ 3BVGA 1QUQA 4GS3A 5M3FB 4EQPA 3HOVH 2DY8A 3U9SA 3BVZA 2F0MA 3KDFB 3H6MA 1PFNA 2UXDQ 4HJ9A 3J7YW 1VQBA 4JBJA 1NTGA 2MUYA 3NTKA 3CMAA 1Y1WG 3DWAA 1HUNA 1PRTF 4JI2L 1DJRD 2ATWA 1MHWC 5FO9B 4TVAB 2F0KA 3D4DA 1L0XB 3E5SA 3HKSA 1ZXTA 2UUBQ 4GZYC 3RN5A 2PCFB 1EUJA 2F52A 2BE5C 3F2BA 1ET6A 2E5LL 3J81c 3K80C 4JVZA 5KEEA 3T1YL 2B2UC 5FJ8H 3HOXB 4DNRB 4IUQA 3KLSX 1NBWA 4LF4Q 2CH4W 3H0GG 4ZCKA 1GUGA 2K14A 1BUVT 4A3MG 2QF7A 4DXFA 1WCMH 4NXMQ 4KJNA 2ZXRA 2JQOA 1E2WA 1WTXA 2SEBD 3GTQH 4LAAA 1STNA 3R2IA 3UE0A 4J15A 1HXYD 1LTBD 5D65A 3CCEA 1X55A 4DV3L 5ISRA 3R8BA 3WDNA 3S24A 1PVOA 4BBRH 2HIXA 3J80L 3L7ZC 1BOSA 4K0KQ 1I50H 4DV6L 2NYZD 3BVMA 1UE5A 2K33A 2QEXA 4RHRA 4LF6L 4QIWB 4F7XA 3GO5A 1K0RA 3MC0B 1W3SA 4LF8Q 1VQPA 3K57A 1IW7D 2NVYB 1XYIA 4YY3Q 2B8GA 4IPGA 2J4XA 1PTOH 4HIMA 5BR8Q 1BXTA 4RWSC 1JQYD 4A3EH 1A3TA 1HFGA 3DEOA 1B2TA 2F0GA 2G5DA 4NXML 2VW9A 1EYAA 2LY7A 4C3JB 3MXNA 3BZDB 1TU2B 1YNNC 4HN7A 4CDDC 2AHOB 3IRBA 4CDCC 1IL8A 4EQ5A 1Y1WB 3DHQA 2JA7G 3T53B 2AKWB 2EJGC 1YHQA 2NBFA 3SDZA 4FXDA 4QGUA 2F3VA 2A8VA 1YNJD 1HPCA 3TS0A 1LT3D 5IGGA 1J5EQ 2FHTA 3OMCA 5J3BA 5EKKA 3K0YA 2VNUD 4DR2Q 1KLUD 3BYYB 3MXPA 4LF5Q 4X64Q 1XMQL 3HKZG 1QWYA 4LF5L 1E7ZA 4F88A 3TP5A 5FLXc 1PV4A 4JI3L 2VQEL 4AQYQ 1DOMA 5T1GA 4RGOS 3BDOA 1VQ9A 5KNBA 5T1IA 1PH9A 5CV9A 5EPLA 2AMCB 1SJED 1JOOA 2WP8J 5JPMC 1EYDA 1XTDA 3HOYB 5ELEA 2DUDA 3NTIA 1C8CA 3EA6A 3PO2B 4RHSA 2BCOA 4JI0L 1DXMA 4KHPQ 2F3IA 2E2JH 1PDQA 3C1FA 1CZGA 5CC4A 3EVQA 2WAQB 3H15A 3DLLA 2VQFL 4A3EG 1TWGH 2PI2E 4LFCL 4F87A 4XQJA 2MGSA 4BXXG 1SNOA 2AQ1B 1ASYA 4CDFC 3QWNA 2F0VA 2MO0A 2Z6BA 1HNXL 1TWHH 3HRZC 4PMBA 3V96A 4KI0A 1HRJA 1NNXA 1LTTD 1RD9D 2NTSA 2L9HA 4G4KA 3PIPA 1D6EC 1X32A 4YHHQ 4BY1B 4C3HG 4YHHL 4A3KG 1IKLA 1U9RA 5FLMH 4O2DA 5A2QE 3NPPA 2YU9B 1DONA 2TMPA 2RHSB 4IPCA 4JV5Q 2X6GA 2RCNA 3W5OA 5NUCA 4UP8A 1YBYA
chains in the Genus database with same CATH topology
4GKKQ 3CAMA 2B29A 3M4OH 1NE3A 4GN3B 3AEVA 3HOUH 5IT9c 2L15A 4DV6Q 2Y0SE 4LF7L 2LSSA 2BA1A 4DUZQ 2ALYB 4JOIA 4WJ4A 5JJIA 2A1AA 1A8VA 1YZ6A 2VL6A 2Y0SG 4IPHA 2E2IH 2CKZB 4WJ3M 4C3IH 1KAWA 3CCVA 5AJ3Q 4HJ7A 2MQHA 4B3SQ 2JA6G 4DR6L 2UU9L 1PH4A 1VQ5A 1EWIA 4O0AA 1VQIA 1VQLA 4A3BG 4YWMA 2CWAA 4OO1I 1OXTA 1Y14B 4A3GH 3CPFA 1AE3A 3I55A 4L5RC 2OQ0A 1G291 2N49A 5JEAG 1YI2A 1KIXA 4A76A 3WWVA 4X66L 3F1ZA 2Q2IA 5FLMG 2ZTDA 2R6GA 2HT1A 1TWCH 4A3CH 5IP7H 3VDYA 4A3IG 1VCIA 2LXKA 2D0PA 1QVGA 4GKKL 3H3VH 2HHHL 2YTXA 4Y52H 2V1CC 2C35B 1EFWA 2XGTA 1VQEA 4JI4Q 4A3FG 3CC7A 5C44G 4DUYL 5JEAJ 1VQ8A 2UXBQ 3W1BA 1HZAA 3HOWH 1YITA 4X64L 1XMQQ 2B63H 3OTOQ 1KHIA 1VQDA 1YJ9A 4PZ8A 2IX1A 1OXSC 2R7DA 1OXUA 4FDBA 4POFA 3TREA 3CXCA 3CF5A 1Q7YC 1C9OA 4DPGA 1PH8A 2R7ZG 1IZ6A 4DUZL 1BBUA 4JI6L 2K75A 2R93G 3K7UC 3PV0A 1L1OC 1HZCA 2AWNA 3FKIH 3TQYA 2JA8H 4GKJQ 1L1OB 2N8NA 5IP9G 4JI1Q 2VY3A 4JI5L 4AQYL 4A3JG 5HGQA 5LMNL 3BJUA 1K73C 4DV0L 2ZM6Q 1RL2A 5IP7G 1N36L 4IPDA 1N34Q 4DR7L 4LFBQ 4A75A 1OXVA 1VQAA 2B3GA 4DV3Q 4B3TL 3KF6B 3PUWA 4YCWA 3I56A 4NPSA 1PH6A 2UUCL 2E8GA 3HOUG 1X3EA 1Q46A 3CW2C 4AIMA 3TEHB 4UP9A 1EYGA 4OONA 2Z6KA 2YU9H 3PO3H 1IBLQ 1VQMA 2NZOA 5BR8L 4HIDA 2OCEA 2KBNA 1NMFA 3GD7A 3ER0A 1IL2A 2IT1A 1X3GA 2JA5H 3STBC 2KHJA 4IOAA 2NZHA 5C3EG 4LNQA 4DKAC 4LF6Q 3J80c 1VS0A 2OWOA 1QZGA 4BY7G 4R4QA 1PH5A 4JBMA 2R93H 1FGUA 5GADC 1PFSA 4YY3L 3ULJA 4JI7Q 4IO9A 4A3CG 4RMFA 3EBEA 1IXRA 1GKHA 1HZBA 4R4OA 5IYBH 3PUYA 2JA9A 2R92G 4BY1H 4GOPB 2UUCQ 4OXPA 4H02A 3M9BA 4JCVE 1E1OA 1U5KA 1WI5A 4MNOA 1IYJB 4BBSH 2UXCQ 4LW1A 4A4IA 3LGJA 4LWCA 4R4CA 4DV0Q 1N34L 1GM5A 4QJFA 1Y1VH 3F2CA 1V9PA 1X65A 3J7A5 1FL0A 4L5TA 4BXXH 4JYAL 2WAQG 2RF4A 4R4TA 2BH2A 2Q2UA 4JYAQ 4DV4L 3GTMH 2MFIA 1PH2A 2OQKA 2HHHQ 4LUOA 1GD7A 4X62L 4L5SA 2D0OA 2NVYH 1AE2A 2KCMA 1FJGQ 2EXDA 3TS2A 1Q8KA 3PGZA 3I4MH 5C3EH 2RHQB 1IBLL 1WJJA 3ERSX 1MKHA 1B8AA 1X56A 1PHJA 5DLQE 3T1HQ 3KOJA 1E24A 2KENA 3KYHC 3S16H 4GNXC 3S17H 3RZOH 3KJPA 2BA0A 3PUXA 5IP9H 3U4VA 3HKZE 3CCQA 1XNQQ 3M3YH 4OX9L 3PIOA 4A3IH 1W2BA 1J5EL 1IBMQ 2E2HH 4KHZA 1GO3E 4C3JH 4B3MQ 4DR7Q 3I4OA 1SMXA 4MTNA 3G71A 1YJWA 4LUVA 4L5QA 4QY7A 1XPOA 1X3FA 2NVXH 3CCSA 4DV7L 3GTOH 1VQKA 2UUAL 1SN8A 4GLVB 4A3DH 2QGQA 3NBHB 4LFBL 3GTLH 3AFQA 3HOZH 2WB1E 3UDGA 2BH8A 1PH3A 2E5LQ 5FJ8G 2N78A 2R7FA 4DR5L 2I5MX 3K81C 4R4IA 4JOIC 1VQJA 3OYYA 2ES2A 4JI6Q 4BY7H 1N33Q 1N32L 4P75A 3UE1A 4X62Q 2JA6H 3CD6A 4A3GG 1LTLA 2JJQA 4DK3C 5IE8A 1I3QH 3M4PA 5C4XH 4A3BH 2ID0A 1VQ6A 3HOVG 4OWTB 2R92H 4DV2L 5GAEC 4AH6A 2MNAA 2VUMG 5LMUL 4K0KL 3T1YQ 1JJCB 4POGA 3T1HL 2Z0SA 1PH1A 1QVFA 1SROA 1N32Q 1WFQA 1Y1WH 1WOCA 1KQSA 4UP7A 4HIKA 4NB3A 3DM3A 3K7AH 1Q1BA 1SRUA 1UWVA 3JC66 4PG3A 1FJGL 3S1QH 3I7FA 1Q82C 1HNWL 3RNUA 4DR1L 4IJHA 1V1QA 4DK6C 2AWOA 4UY8C 2I5HA 1L0WA 2CWPA 2NVQH 4GN5A 1GVPA 1JJGA 4B3RL 1O7IA 3FHWA 2N3SA 1RIPA 4B3RQ 3E0EA 5ELOA 2R7ZH 2NN6G 1IBML 2Z6KC 4X65L 1TWFH 4JI7L 5ELNA 3ICEA 1VQGA 1UE7A 2NN6I 3HOYG 1XMOQ 4JC0A 2YV5A 2KCTA 4JG2A 1LUZA 1M1KC 4APVA 2ZJRA 1EQQA 4QL5A 1Q86C 1R9TH 4OWXB 1WYDA 4DR3L 1LYLA 4OO1G 5GROA 3PO2H 4RG1A 1UE1A 3FKIG 4JI1L 3F2DA 1TWAH 3U4ZA 5IYCG 4OWWB 1XNRL 4DR1Q 1JE5A 2I5LX 2YTVA 4P74A 3UDFA 3H3VI 3TRZA 2WB1G 1CUKA 4DNIA 4NXNQ 1JB7A 3MEFA 4HJAA 1ASZA 2JEAI 3A5UA 3PUVA 1Q1EA 2VQFQ 1PH7A 4YCUA 3HFZB 3JAMi 2OTJA 1XNRQ 5E7NA 2K4KA 3CC4A 4JI4L 4MZ9A 4X6AH 5M3MG 1VQNA 4A3LG 5C0XJ 3I4MG 1S3OA 1CKMA 2I0QA 1JT8A 3AFPA 5M5YH 3CQZH 1Z47A 4C3HH 1LM0A 4LF8L 1CSQA 4A3KH 3HOXH 1A62A 5LMNW 2JA7H 2ZM6L 2IX0A 1E22A 4HJ5A 3RZDH 1QVCA 2ZTCA 3H0GH 4BY1G 1QZHA 1XPUA 3KFUA 3K8AA 4A93G 1M90C 5IYBG 1K9MC 5EAYA 4YWLA 4DV1Q 4P71A 4JBKA 3GDEA 1B70B 2GVAA 5M5WH 1BKBA 3S2HH 1K8AC 3KDFA 1EQRA 1Z9FA 2H5XA 1IBKL 2HIVA 1XNQL 3CMEA 1I5FA 4GOPC 2VQEQ 1SLJA 4X65Q 1XPRA 4JI3Q 2F4VL 4QQBX 1C7YA 4ALPA 1NMGA 3PF5A 4BA2I 1BVSA 1KRTA 2CQOA 4Y7NH 1JJ2A 3HOZG 3PSIA 1KL9A 1S40A 1HR0Q 1K3RA 5IYDH 3CP0A 1X6OA 1KD1C 2YTYA 1SR3A 1DGSA 3GTPH 1NY4A 4DR4L 1HNXQ 4B3ML 3S14H 2LXJA 5C4JH 1QUQA 2JK8A 4GS3A 1AH9A 1K83H 4JI2Q 3GTKH 1A63A 1H95A 1L2FA 1VQHA 3HOVH 5IY0A 4C2MH 4X66Q 3KDFB 2CCZA 1SFOH 3I4NG 1G6PA 2UXDQ 4UPAA 5IYCH 4HJ9A 4LUZA 3ZJYC 1X9NA 1VQBA 4JBJA 4JBWA 5LMNQ 1NTGA 1N36Q 3CMAA 4DV5Q 2JA8G 1Y1WG 1YHBA 4DR5Q 1CKOA 4JI2L 1PYBA 3JAMc 4B3TQ 2ATWA 3CCJA 5IWAL 3J81j 3Q8DA 4TVAB 3D31A 4A3FH 4TQUS 3HKSA 3L2PA 4DV1L 1YEZA 1K8GA 1Q12A 4GN4B 3E9IA 2UUBQ 1CSPA 3A74A 3J80i 3RN5A 1VQ7A 4DV5L 1EUJA 2F52A 1QUQB 4YWKA 1V43A 3F2BA 1I94Q 2E5LL 2IHEA 4PZ6A 1EIFA 3K80C 3J81c 3T1YL 5FJ8H 1E3PA 1NBWA 1HNZL 5M3MH 4LF4Q 3CCMA 4A3LH 1SE8A 1HR0W 2K5HA 3H0GG 4JI8Q 4ME3A 2K14A 3PUZA 4IJLA 4GOPA 2GVBA 1VQFA 3G48A 3RLNA 3HOXG 4AYBE 1XJVA 4A3MG 4DR4Q 3AYHB 3CCRA 1WCMH 5M5XH 4NXMQ 2JE6I 2YYZA 2VUMH 4A93H 2JQOA 3F8TA 1HNZQ 4HIOA 4LF9Q 1MJEA 3U58A 3GTQH 4PZ7A 1JMCA 1L1OA 4GLAC 2XTIA 3UE0A 4J15A 4OX9Q 5JJKA 5C0XI 3CCEA 1X55A 4P72A 4DV3L 2VZAA 3KF6A 3KF8B 3NELA 3FP9A 3OW2A 1EOVA 2PNHA 2MO1A 3S24A 3S1NH 1PVOA 4QIWE 1PA6A 4BBRH 1X54A 4JI0Q 4KHPL 1HZ9A 1IBKQ 2HIXA 2IY5B 3PCOB 4B3SL 2PI2A 3L7ZC 3OTOL 3CCLA 2K5VA 3B6YA 1G51A 1YIJA 3CCUA 5LMUQ 4K0KQ 1I50H 2ZJPA 4DV6L 3S1RH 1OTCA 3HOYH 3I2ZA 1J6QA 1UE5A 1T9HA 1WCMG 2QEXA 3A5ZB 1OXXK 4LF6L 4DR3Q 3GO5A 1K0RA 4DAYB 3ULPA 1W3SA 2UXDL 4LF8Q 1VQPA 3U50C 1I94L 2EQSA 4YY3Q 4IPGA 4HIMA 4JI5Q 2EIFA 5GAHC 4LFCQ 5BR8Q 3RN2A 4NXNL 3NENA 1N9WA 3AQQA 4A3EH 1Q81C 4JI8L 2UUAQ 2B63G 1VQOA 1B7YB 3GTJH 5H1SE 2QA4A 4LFAL 2NVTH 4PMWA 3M4QA 3J7ZC 3M85A 2FXQA 2VW9A 4GNXB 4NXML 3G6EA 1E1TA 2WAQE 4EX5A 3CC2A 4LF7Q 1N33L 1C0AA 1PYSB 4DR2L 1YHAA 3KLWA 3UDIA 2AHOB 3IRBA 4AYBG 4EQ5A 1BBWA 5AJ3L 2JA7G 3G4SA 2AKWB 1YHQA 1S72A 5C4XG 1KC8C 2ZTEA 4QGUA 2A8VA 3I4NH 1P8LA 3TS0A 1MIUA 4R1JA 1A0IA 4BA1I 1J5EQ 3KJOA 5J3BA 4JV5L 2VNUD 2K52A 1HR0L 2Q2TA 4DR2Q 5C0XG 2CFMA 4LF5Q 2GN5A 4X64Q 1XMQL 3HKZG 4LF5L 1E7ZA 4A3DG 1I6HH 5FLXc 4GNXA 3EIVA 3SGIA 1PV4A 2JEBI 4XIGS 3MXNB 4JI3L 2VQEL 1D8LA 4AQYQ 2F4VQ 5IYDG 1U0LA 5K36G 1VQ9A 1PH9A 3HOWG 3ULLA 1KRSA 4GLXA 2JA5G 2AMCB 4IOCA 1CKNB 4DUYQ 3E9HA 2UXBL 2WFWA 2WP8J 4GKJL 5JJLA 2DGYA 1XTDA 3BZCA 3RLOA 2ASBA 1UEBA 2DUDA 2IHFA 3K0XA 4XTCS 1FVIA 2HQLA 5GAGC 5M3FH 2VS1A 4KLKA 4P73A 4DAMA 4LF9L 3PF4A 3CPWA 1YJNA 3GTGH 4IFDI 1YNXA 1UE6A 4JI0L 4KHPQ 2F3IA 2E2JH 3M7NA 3RR5A 4IFDG 4BBSG 2UXCL 5GQOA 3H15A 3DLLA 2VQFL 3S2DH 4A3EG 3BZKA 1TWGH 2PI2E 4LFCL 3RLFA 2PQAB 4BXXG 4LF4L 1KXLA 1CKNA 1HJPA 2ZJQA 3BU2A 1ASYA 1Y1VG 3EN2A 1YVCA 2PMZE 1N8RC 2MO0A 4HJ8A 3PO3G 2Q2HA 4DV4Q 1VQ4A 1HNXL 2K50A 1TWHH 4DV7Q 5C44H 1MJCA 2UU9Q 4BBRG 4IFDJ 4KI0A 3J81i 2KHIA 1VQCA 5HY6A 1EIYB 3W1GA 3D0FA 3PIPA 4A3MH 1XMOL 4YHHQ 3UDXA 2K5NA 5M3FG 4LFAQ 4YHHL 4DR6Q 3PO2G 4A3KG 4A3JH 3L0OA 3A0JA 4O2DA 5FLMH 1D7QA 2PQAA 2A19A 1TXYA 3S15H 3STBD 5IWAQ 2OTLA 3NEMA 1NJIC 1HNWQ 1HH2P 3S1MH 2RHSB 4DV2Q 2D62A 4IPCA 4JV5Q 4YCVA 3W5OA 1P16A 2RCNA 2UUBL 4UP8A 1YBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK Q;  3CAM A;  2B29 A;  3M4O H;  1NE3 A;  4GN3 B;  3AEV A;  3HOU H;  5IT9 c;  2L15 A;  4DV6 Q;  2Y0S E;  4LF7 L;  2LSS A;  2BA1 A;  4DUZ Q;  2ALY B;  4JOI A;  4WJ4 A;  5JJI A;  2A1A A;  1A8V A;  1YZ6 A;  2VL6 A;  2Y0S G;  4IPH A;  2E2I H;  2CKZ B;  4WJ3 M;  4C3I H;  1KAW A;  3CCV A;  5AJ3 Q;  4HJ7 A;  2MQH A;  4B3S Q;  2JA6 G;  4DR6 L;  2UU9 L;  1PH4 A;  1VQ5 A;  1EWI A;  4O0A A;  1VQI A;  1VQL A;  4A3B G;  4YWM A;  2CWA A;  4OO1 I;  1OXT A;  1Y14 B;  4A3G H;  3CPF A;  1AE3 A;  3I55 A;  4L5R C;  2OQ0 A;  1G29 1;  2N49 A;  5JEA G;  1YI2 A;  1KIX A;  4A76 A;  3WWV A;  4X66 L;  3F1Z A;  2Q2I A;  5FLM G;  2ZTD A;  2R6G A;  2HT1 A;  1TWC H;  4A3C H;  5IP7 H;  3VDY A;  4A3I G;  1VCI A;  2LXK A;  2D0P A;  1QVG A;  4GKK L;  3H3V H;  2HHH L;  2YTX A;  4Y52 H;  2V1C C;  2C35 B;  1EFW A;  2XGT A;  1VQE A;  4JI4 Q;  4A3F G;  3CC7 A;  5C44 G;  4DUY L;  5JEA J;  1VQ8 A;  2UXB Q;  3W1B A;  1HZA A;  3HOW H;  1YIT A;  4X64 L;  1XMQ Q;  2B63 H;  3OTO Q;  1KHI A;  1VQD A;  1YJ9 A;  4PZ8 A;  2IX1 A;  1OXS C;  2R7D A;  1OXU A;  4FDB A;  4POF A;  3TRE A;  3CXC A;  3CF5 A;  1Q7Y C;  1C9O A;  4DPG A;  1PH8 A;  2R7Z G;  1IZ6 A;  4DUZ L;  1BBU A;  4JI6 L;  2K75 A;  2R93 G;  3K7U C;  3PV0 A;  1L1O C;  1HZC A;  2AWN A;  3FKI H;  3TQY A;  2JA8 H;  4GKJ Q;  1L1O B;  2N8N A;  5IP9 G;  4JI1 Q;  2VY3 A;  4JI5 L;  4AQY L;  4A3J G;  5HGQ A;  5LMN L;  3BJU A;  1K73 C;  4DV0 L;  2ZM6 Q;  1RL2 A;  5IP7 G;  1N36 L;  4IPD A;  1N34 Q;  4DR7 L;  4LFB Q;  4A75 A;  1OXV A;  1VQA A;  2B3G A;  4DV3 Q;  4B3T L;  3KF6 B;  3PUW A;  4YCW A;  3I56 A;  4NPS A;  1PH6 A;  2UUC L;  2E8G A;  3HOU G;  1X3E A;  1Q46 A;  3CW2 C;  4AIM A;  3TEH B;  4UP9 A;  1EYG A;  4OON A;  2Z6K A;  2YU9 H;  3PO3 H;  1IBL Q;  1VQM A;  2NZO A;  5BR8 L;  4HID A;  2OCE A;  2KBN A;  1NMF A;  3GD7 A;  3ER0 A;  1IL2 A;  2IT1 A;  1X3G A;  2JA5 H;  3STB C;  2KHJ A;  4IOA A;  2NZH A;  5C3E G;  4LNQ A;  4DKA C;  4LF6 Q;  3J80 c;  1VS0 A;  2OWO A;  1QZG A;  4BY7 G;  4R4Q A;  1PH5 A;  4JBM A;  2R93 H;  1FGU A;  5GAD C;  1PFS A;  4YY3 L;  3ULJ A;  4JI7 Q;  4IO9 A;  4A3C G;  4RMF A;  3EBE A;  1IXR A;  1GKH A;  1HZB A;  4R4O A;  5IYB H;  3PUY A;  2JA9 A;  2R92 G;  4BY1 H;  4GOP B;  2UUC Q;  4OXP A;  4H02 A;  3M9B A;  4JCV E;  1E1O A;  1U5K A;  1WI5 A;  4MNO A;  1IYJ B;  4BBS H;  2UXC Q;  4LW1 A;  4A4I A;  3LGJ A;  4LWC A;  4R4C A;  4DV0 Q;  1N34 L;  1GM5 A;  4QJF A;  1Y1V H;  3F2C A;  1V9P A;  1X65 A;  3J7A 5;  1FL0 A;  4L5T A;  4BXX H;  4JYA L;  2WAQ G;  2RF4 A;  4R4T A;  2BH2 A;  2Q2U A;  4JYA Q;  4DV4 L;  3GTM H;  2MFI A;  1PH2 A;  2OQK A;  2HHH Q;  4LUO A;  1GD7 A;  4X62 L;  4L5S A;  2D0O A;  2NVY H;  1AE2 A;  2KCM A;  1FJG Q;  2EXD A;  3TS2 A;  1Q8K A;  3PGZ A;  3I4M H;  5C3E H;  2RHQ B;  1IBL L;  1WJJ A;  3ERS X;  1MKH A;  1B8A A;  1X56 A;  1PHJ A;  5DLQ E;  3T1H Q;  3KOJ A;  1E24 A;  2KEN A;  3KYH C;  3S16 H;  4GNX C;  3S17 H;  3RZO H;  3KJP A;  2BA0 A;  3PUX A;  5IP9 H;  3U4V A;  3HKZ E;  3CCQ A;  1XNQ Q;  3M3Y H;  4OX9 L;  3PIO A;  4A3I H;  1W2B A;  1J5E L;  1IBM Q;  2E2H H;  4KHZ A;  1GO3 E;  4C3J H;  4B3M Q;  4DR7 Q;  3I4O A;  1SMX A;  4MTN A;  3G71 A;  1YJW A;  4LUV A;  4L5Q A;  4QY7 A;  1XPO A;  1X3F A;  2NVX H;  3CCS A;  4DV7 L;  3GTO H;  1VQK A;  2UUA L;  1SN8 A;  4GLV B;  4A3D H;  2QGQ A;  3NBH B;  4LFB L;  3GTL H;  3AFQ A;  3HOZ H;  2WB1 E;  3UDG A;  2BH8 A;  1PH3 A;  2E5L Q;  5FJ8 G;  2N78 A;  2R7F A;  4DR5 L;  2I5M X;  3K81 C;  4R4I A;  4JOI C;  1VQJ A;  3OYY A;  2ES2 A;  4JI6 Q;  4BY7 H;  1N33 Q;  1N32 L;  4P75 A;  3UE1 A;  4X62 Q;  2JA6 H;  3CD6 A;  4A3G G;  1LTL A;  2JJQ A;  4DK3 C;  5IE8 A;  1I3Q H;  3M4P A;  5C4X H;  4A3B H;  2ID0 A;  1VQ6 A;  3HOV G;  4OWT B;  2R92 H;  4DV2 L;  5GAE C;  4AH6 A;  2MNA A;  2VUM G;  5LMU L;  4K0K L;  3T1Y Q;  1JJC B;  4POG A;  3T1H L;  2Z0S A;  1PH1 A;  1QVF A;  1SRO A;  1N32 Q;  1WFQ A;  1Y1W H;  1WOC A;  1KQS A;  4UP7 A;  4HIK A;  4NB3 A;  3DM3 A;  3K7A H;  1Q1B A;  1SRU A;  1UWV A;  3JC6 6;  4PG3 A;  1FJG L;  3S1Q H;  3I7F A;  1Q82 C;  1HNW L;  3RNU A;  4DR1 L;  4IJH A;  1V1Q A;  4DK6 C;  2AWO A;  4UY8 C;  2I5H A;  1L0W A;  2CWP A;  2NVQ H;  4GN5 A;  1GVP A;  1JJG A;  4B3R L;  1O7I A;  3FHW A;  2N3S A;  1RIP A;  4B3R Q;  3E0E A;  5ELO A;  2R7Z H;  2NN6 G;  1IBM L;  2Z6K C;  4X65 L;  1TWF H;  4JI7 L;  5ELN A;  3ICE A;  1VQG A;  1UE7 A;  2NN6 I;  3HOY G;  1XMO Q;  4JC0 A;  2YV5 A;  2KCT A;  4JG2 A;  1LUZ A;  1M1K C;  4APV A;  2ZJR A;  1EQQ A;  4QL5 A;  1Q86 C;  1R9T H;  4OWX B;  1WYD A;  4DR3 L;  1LYL A;  4OO1 G;  5GRO A;  3PO2 H;  4RG1 A;  1UE1 A;  3FKI G;  4JI1 L;  3F2D A;  1TWA H;  3U4Z A;  5IYC G;  4OWW B;  1XNR L;  4DR1 Q;  1JE5 A;  2I5L X;  2YTV A;  4P74 A;  3UDF A;  3H3V I;  3TRZ A;  2WB1 G;  1CUK A;  4DNI A;  4NXN Q;  1JB7 A;  3MEF A;  4HJA A;  1ASZ A;  2JEA I;  3A5U A;  3PUV A;  1Q1E A;  2VQF Q;  1PH7 A;  4YCU A;  3HFZ B;  3JAM i;  2OTJ A;  1XNR Q;  5E7N A;  2K4K A;  3CC4 A;  4JI4 L;  4MZ9 A;  4X6A H;  5M3M G;  1VQN A;  4A3L G;  5C0X J;  3I4M G;  1S3O A;  1CKM A;  2I0Q A;  1JT8 A;  3AFP A;  5M5Y H;  3CQZ H;  1Z47 A;  4C3H H;  1LM0 A;  4LF8 L;  1CSQ A;  4A3K H;  3HOX H;  1A62 A;  5LMN W;  2JA7 H;  2ZM6 L;  2IX0 A;  1E22 A;  4HJ5 A;  3RZD H;  1QVC A;  2ZTC A;  3H0G H;  4BY1 G;  1QZH A;  1XPU A;  3KFU A;  3K8A A;  4A93 G;  1M90 C;  5IYB G;  1K9M C;  5EAY A;  4YWL A;  4DV1 Q;  4P71 A;  4JBK A;  3GDE A;  1B70 B;  2GVA A;  5M5W H;  1BKB A;  3S2H H;  1K8A C;  3KDF A;  1EQR A;  1Z9F A;  2H5X A;  1IBK L;  2HIV A;  1XNQ L;  3CME A;  1I5F A;  4GOP C;  2VQE Q;  1SLJ A;  4X65 Q;  1XPR A;  4JI3 Q;  2F4V L;  4QQB X;  1C7Y A;  4ALP A;  1NMG A;  3PF5 A;  4BA2 I;  1BVS A;  1KRT A;  2CQO A;  4Y7N H;  1JJ2 A;  3HOZ G;  3PSI A;  1KL9 A;  1S40 A;  1HR0 Q;  1K3R A;  5IYD H;  3CP0 A;  1X6O A;  1KD1 C;  2YTY A;  1SR3 A;  1DGS A;  3GTP H;  1NY4 A;  4DR4 L;  1HNX Q;  4B3M L;  3S14 H;  2LXJ A;  5C4J H;  1QUQ A;  2JK8 A;  4GS3 A;  1AH9 A;  1K83 H;  4JI2 Q;  3GTK H;  1A63 A;  1H95 A;  1L2F A;  1VQH A;  3HOV H;  5IY0 A;  4C2M H;  4X66 Q;  3KDF B;  2CCZ A;  1SFO H;  3I4N G;  1G6P A;  2UXD Q;  4UPA A;  5IYC H;  4HJ9 A;  4LUZ A;  3ZJY C;  1X9N A;  1VQB A;  4JBJ A;  4JBW A;  5LMN Q;  1NTG A;  1N36 Q;  3CMA A;  4DV5 Q;  2JA8 G;  1Y1W G;  1YHB A;  4DR5 Q;  1CKO A;  4JI2 L;  1PYB A;  3JAM c;  4B3T Q;  2ATW A;  3CCJ A;  5IWA L;  3J81 j;  3Q8D A;  4TVA B;  3D31 A;  4A3F H;  4TQU S;  3HKS A;  3L2P A;  4DV1 L;  1YEZ A;  1K8G A;  1Q12 A;  4GN4 B;  3E9I A;  2UUB Q;  1CSP A;  3A74 A;  3J80 i;  3RN5 A;  1VQ7 A;  4DV5 L;  1EUJ A;  2F52 A;  1QUQ B;  4YWK A;  1V43 A;  3F2B A;  1I94 Q;  2E5L L;  2IHE A;  4PZ6 A;  1EIF A;  3K80 C;  3J81 c;  3T1Y L;  5FJ8 H;  1E3P A;  1NBW A;  1HNZ L;  5M3M H;  4LF4 Q;  3CCM A;  4A3L H;  1SE8 A;  1HR0 W;  2K5H A;  3H0G G;  4JI8 Q;  4ME3 A;  2K14 A;  3PUZ A;  4IJL A;  4GOP A;  2GVB A;  1VQF A;  3G48 A;  3RLN A;  3HOX G;  4AYB E;  1XJV A;  4A3M G;  4DR4 Q;  3AYH B;  3CCR A;  1WCM H;  5M5X H;  4NXM Q;  2JE6 I;  2YYZ A;  2VUM H;  4A93 H;  2JQO A;  3F8T A;  1HNZ Q;  4HIO A;  4LF9 Q;  1MJE A;  3U58 A;  3GTQ H;  4PZ7 A;  1JMC A;  1L1O A;  4GLA C;  2XTI A;  3UE0 A;  4J15 A;  4OX9 Q;  5JJK A;  5C0X I;  3CCE A;  1X55 A;  4P72 A;  4DV3 L;  2VZA A;  3KF6 A;  3KF8 B;  3NEL A;  3FP9 A;  3OW2 A;  1EOV A;  2PNH A;  2MO1 A;  3S24 A;  3S1N H;  1PVO A;  4QIW E;  1PA6 A;  4BBR H;  1X54 A;  4JI0 Q;  4KHP L;  1HZ9 A;  1IBK Q;  2HIX A;  2IY5 B;  3PCO B;  4B3S L;  2PI2 A;  3L7Z C;  3OTO L;  3CCL A;  2K5V A;  3B6Y A;  1G51 A;  1YIJ A;  3CCU A;  5LMU Q;  4K0K Q;  1I50 H;  2ZJP A;  4DV6 L;  3S1R H;  1OTC A;  3HOY H;  3I2Z A;  1J6Q A;  1UE5 A;  1T9H A;  1WCM G;  2QEX A;  3A5Z B;  1OXX K;  4LF6 L;  4DR3 Q;  3GO5 A;  1K0R A;  4DAY B;  3ULP A;  1W3S A;  2UXD L;  4LF8 Q;  1VQP A;  3U50 C;  1I94 L;  2EQS A;  4YY3 Q;  4IPG A;  4HIM A;  4JI5 Q;  2EIF A;  5GAH C;  4LFC Q;  5BR8 Q;  3RN2 A;  4NXN L;  3NEN A;  1N9W A;  3AQQ A;  4A3E H;  1Q81 C;  4JI8 L;  2UUA Q;  2B63 G;  1VQO A;  1B7Y B;  3GTJ H;  5H1S E;  2QA4 A;  4LFA L;  2NVT H;  4PMW A;  3M4Q A;  3J7Z C;  3M85 A;  2FXQ A;  2VW9 A;  4GNX B;  4NXM L;  3G6E A;  1E1T A;  2WAQ E;  4EX5 A;  3CC2 A;  4LF7 Q;  1N33 L;  1C0A A;  1PYS B;  4DR2 L;  1YHA A;  3KLW A;  3UDI A;  2AHO B;  3IRB A;  4AYB G;  4EQ5 A;  1BBW A;  5AJ3 L;  2JA7 G;  3G4S A;  2AKW B;  1YHQ A;  1S72 A;  5C4X G;  1KC8 C;  2ZTE A;  4QGU A;  2A8V A;  3I4N H;  1P8L A;  3TS0 A;  1MIU A;  4R1J A;  1A0I A;  4BA1 I;  1J5E Q;  3KJO A;  5J3B A;  4JV5 L;  2VNU D;  2K52 A;  1HR0 L;  2Q2T A;  4DR2 Q;  5C0X G;  2CFM A;  4LF5 Q;  2GN5 A;  4X64 Q;  1XMQ L;  3HKZ G;  4LF5 L;  1E7Z A;  4A3D G;  1I6H H;  5FLX c;  4GNX A;  3EIV A;  3SGI A;  1PV4 A;  2JEB I;  4XIG S;  3MXN B;  4JI3 L;  2VQE L;  1D8L A;  4AQY Q;  2F4V Q;  5IYD G;  1U0L A;  5K36 G;  1VQ9 A;  1PH9 A;  3HOW G;  3ULL A;  1KRS A;  4GLX A;  2JA5 G;  2AMC B;  4IOC A;  1CKN B;  4DUY Q;  3E9H A;  2UXB L;  2WFW A;  2WP8 J;  4GKJ L;  5JJL A;  2DGY A;  1XTD A;  3BZC A;  3RLO A;  2ASB A;  1UEB A;  2DUD A;  2IHF A;  3K0X A;  4XTC S;  1FVI A;  2HQL A;  5GAG C;  5M3F H;  2VS1 A;  4KLK A;  4P73 A;  4DAM A;  4LF9 L;  3PF4 A;  3CPW A;  1YJN A;  3GTG H;  4IFD I;  1YNX A;  1UE6 A;  4JI0 L;  4KHP Q;  2F3I A;  2E2J H;  3M7N A;  3RR5 A;  4IFD G;  4BBS G;  2UXC L;  5GQO A;  3H15 A;  3DLL A;  2VQF L;  3S2D H;  4A3E G;  3BZK A;  1TWG H;  2PI2 E;  4LFC L;  3RLF A;  2PQA B;  4BXX G;  4LF4 L;  1KXL A;  1CKN A;  1HJP A;  2ZJQ A;  3BU2 A;  1ASY A;  1Y1V G;  3EN2 A;  1YVC A;  2PMZ E;  1N8R C;  2MO0 A;  4HJ8 A;  3PO3 G;  2Q2H A;  4DV4 Q;  1VQ4 A;  1HNX L;  2K50 A;  1TWH H;  4DV7 Q;  5C44 H;  1MJC A;  2UU9 Q;  4BBR G;  4IFD J;  4KI0 A;  3J81 i;  2KHI A;  1VQC A;  5HY6 A;  1EIY B;  3W1G A;  3D0F A;  3PIP A;  4A3M H;  1XMO L;  4YHH Q;  3UDX A;  2K5N A;  5M3F G;  4LFA Q;  4YHH L;  4DR6 Q;  3PO2 G;  4A3K G;  4A3J H;  3L0O A;  3A0J A;  4O2D A;  5FLM H;  1D7Q A;  2PQA A;  2A19 A;  1TXY A;  3S15 H;  3STB D;  5IWA Q;  2OTL A;  3NEM A;  1NJI C;  1HNW Q;  1HH2 P;  3S1M H;  2RHS B;  4DV2 Q;  2D62 A;  4IPC A;  4JV5 Q;  4YCV A;  3W5O A;  1P16 A;  2RCN A;  2UUB L;  4UP8 A;  1YBY A; 
#chains in the Genus database with same CATH topology
 4ZKB B;  2K32 A;  4ZRZ A;  1I4X A;  4K2K A;  1SE3 A;  1NE3 A;  1DYQ A;  1PRT C;  5IT9 c;  2L15 A;  2Y0S E;  1WTP A;  4LF7 L;  4DUZ Q;  4WJ4 A;  1QNK A;  5JJI A;  1TVX A;  2A1A A;  5DEH A;  3D8G A;  1YZ6 A;  2KJX A;  1M8A A;  2MQH A;  4B3S Q;  2JA6 G;  3GTG B;  3I72 A;  1VQ5 A;  4I7A A;  1OXT A;  3T13 A;  1AE3 A;  3I55 A;  4L5R C;  2N49 A;  1SYG A;  3OWF A;  3HS0 C;  4A3K B;  1II3 A;  4EQN A;  4A3C H;  1VCI A;  4B08 A;  5COY A;  4NW2 A;  2CVR A;  2A68 D;  3HOZ B;  2C35 B;  1SNM A;  1S5E D;  4E6I A;  1TR5 A;  1I4P A;  1NAP A;  4R9W A;  5CV8 A;  4X3K A;  2UXB Q;  1HZA A;  3PQI A;  4X64 L;  1XMQ Q;  2B63 H;  2PPB C;  2AUK A;  1KHI A;  5C6A A;  1U4R A;  2TSS A;  5E3F A;  3TRE A;  1Z7T A;  4RGT A;  3CF5 A;  1PH8 A;  4JI6 L;  4U68 A;  2FMM A;  1WTQ A;  1L1O C;  3TQY A;  1S5C D;  3C46 A;  1B44 D;  1JIC A;  1R4Q B;  3P7J A;  3BJU A;  1O7Y A;  4DV0 L;  1E2Z A;  4DR7 L;  4A75 A;  2B3G A;  3VYR A;  4NPS A;  2UUC L;  3CRK C;  1X3E A;  5JJZ A;  3CW2 C;  3T51 B;  3TZD A;  2H4O A;  1RDP D;  2WB1 B;  3DEP A;  4OON A;  2B2U A;  2Z8L A;  3NXW A;  4MIU A;  1F2Z A;  5I6Y A;  1NMF A;  3ER0 A;  5IGC A;  1IL2 A;  2KHJ A;  4QMG A;  5C3E G;  4LNQ A;  2QDB A;  1CQF A;  1VS0 A;  4R4Q A;  2L5T A;  2PYK A;  5FO7 B;  4JBM A;  3ULJ A;  4JI7 Q;  4A3C G;  1BNZ A;  2PW7 A;  1Q3L A;  4OXP A;  2VB3 X;  1IYJ B;  1HUM A;  1CM9 A;  3ONA B;  5DM6 3;  2UXC Q;  4QJF A;  1X65 A;  1FL0 A;  3NHH A;  4DV4 L;  2NVX B;  1PH2 A;  1V1P A;  4X62 L;  3GV3 A;  1EIH A;  3RZD B;  4KTA A;  3QJY A;  3NTH A;  3TS2 A;  4OL7 A;  1IBL L;  1B8A A;  1PHJ A;  1STH A;  2KEN A;  4HTH A;  4KHV A;  2IWH A;  2BA0 A;  5HGT A;  1XNQ Q;  3HKZ E;  4OX9 L;  2D9U A;  2NTT A;  3PIO A;  1BCP C;  4KHZ A;  5EGT A;  4CKB A;  3I4O A;  4L6T B;  2G9D A;  4MTN A;  2RDH A;  2VB2 X;  2Z9H A;  3G71 A;  1FR3 A;  3Q23 A;  4NP5 A;  4JK1 C;  4L5Q A;  4QY7 A;  1VQK A;  4GLV B;  2QGQ A;  1PXU A;  2RSN A;  3HOZ H;  3AFQ A;  1K0S A;  3HKZ B;  3HGB A;  4UAI A;  3RZO B;  4JOI C;  3J7A F;  1DZ1 A;  2E2J B;  4P75 A;  1CHP D;  2JA6 H;  1SFO B;  2JJQ A;  4C3I G;  4DK3 C;  1I3Q H;  5KYI A;  2ID0 A;  4J1M A;  3A54 A;  5GAE C;  2MNA A;  2VUM G;  5LMU L;  1GHK A;  1JJC B;  1PTO D;  1KNA A;  3K7A H;  1D2B A;  1SRU A;  1UWV A;  4PG3 A;  3S1Q H;  3MAQ A;  3RNU A;  1KLG D;  5IOC A;  4IJH A;  3NQI A;  2E2D C;  1W6K A;  3HG9 A;  4GN5 A;  1GVP A;  4DK1 A;  1QNU A;  5F2D A;  5K5P A;  5CV7 A;  2R7Z H;  2NN6 G;  1UEA B;  4G7H C;  1IYV A;  3ICE A;  1VQG A;  5EPK A;  4KY6 A;  4IUN A;  1LUZ A;  1R9T H;  4OWX B;  1WYD A;  5CV6 A;  4OO1 G;  2L55 A;  4RG1 A;  4JI1 L;  1MD2 D;  3F2D A;  5IYC G;  4OWW B;  4P74 A;  2K04 A;  5D3D A;  2B8F A;  3QOJ A;  3URY A;  1B9N A;  3I3C A;  2JEA I;  3PUV A;  1SND A;  3HFZ B;  1XNR Q;  1EQV A;  1VQN A;  1S3O A;  4H13 C;  2I0Q A;  1JT8 A;  1Z47 A;  1TKW B;  1LM0 A;  3RZD H;  1QVC A;  2ZTC A;  5C4J B;  4ZLT F;  1U4P A;  3K8A A;  4A93 G;  2A73 B;  1PLF A;  4P71 A;  5M5W H;  3S2H H;  3OWE B;  4DFA A;  2F1M A;  2X6L A;  1XNQ L;  2K05 A;  2F0O A;  1XPR A;  1EEF D;  4QQB X;  5BN3 A;  1NMG A;  3PF5 A;  2V4D A;  2JXM B;  4XQQ A;  1CHQ D;  1H9S A;  4H0L C;  4RA8 A;  1S40 A;  1X6O A;  1SR3 A;  1DGS A;  4TRD A;  3GTP H;  1NY4 A;  2G9H D;  4KV6 A;  3Q24 A;  1D5X C;  5E4X A;  4B3M L;  1UNS A;  2EY1 A;  2JK8 A;  2B2V C;  3GTK H;  3S16 B;  1VQH A;  2PZU A;  5IY0 A;  4C2M H;  3SE0 A;  4EVO A;  3I4N G;  2B39 A;  4UPA A;  5IYC H;  1MI2 A;  4LUZ A;  1IHZ A;  1X9N A;  5LMN Q;  1N36 Q;  4DV5 Q;  1YHB A;  3A8I E;  2F0T A;  3J81 j;  3V2T A;  2CQA A;  4ODG A;  4A3F H;  4TQU S;  4KMU C;  2SNM A;  1K8G A;  3KUP A;  3E9I A;  3A74 A;  3M7G A;  3T16 A;  2K5W A;  4YWK A;  3S1Q B;  4K5V A;  1I94 Q;  4PZ6 A;  1EIF A;  4DA2 A;  5M3M H;  4A3L H;  5CBA E;  3CCM A;  1SE8 A;  3NP8 A;  1AP0 A;  3PUZ A;  2O2L D;  3K5O A;  4GOP A;  3RLN A;  1ESF A;  5M5X B;  2ICE C;  2YYZ A;  2D2C C;  3F8T A;  3FVQ A;  3ZYY X;  4WOR A;  1VMP A;  5CR3 A;  1JMC A;  3DMU A;  4GLA C;  1XWE A;  2XTI A;  2F0J A;  4C1N I;  5JJK A;  5C0X I;  5C44 B;  5EPJ A;  2F0I A;  5IT9 L;  2PNH A;  2MO1 A;  3S1N H;  3PMF A;  1UUP A;  1X54 A;  1HZ9 A;  1KAA A;  1IBK Q;  3OTO L;  3G7L A;  2XIW A;  4C1N K;  1XTC D;  5JEA H;  5LMU Q;  2ZJP A;  3S1R H;  1OTC A;  2F0U A;  4N8F A;  1F2L A;  1WCM G;  4DAY B;  2UXD L;  5KIX A;  2NWG A;  2EQS A;  1I94 L;  4FF4 A;  3MXG A;  2L12 A;  2KCC A;  4NXN L;  1PTO F;  3AQQ A;  5I2X A;  2UUA Q;  3GTJ H;  5CYU A;  2K28 A;  4HSV A;  5CV5 A;  3OHX C;  5H1S E;  2QA4 A;  3HEJ A;  2NVT H;  3M4Q A;  3J7Z C;  3TP8 A;  1BCP F;  2E2H B;  1E1T A;  2B2W C;  2WAQ E;  1BO0 A;  4LF7 Q;  4NMZ A;  2K01 A;  1N33 L;  1PYS B;  4AYB G;  5C4Z A;  3CQZ B;  1GUT A;  1S72 A;  2ZTE A;  1GXD C;  1P8L A;  3A8J E;  1A0I A;  2BE5 D;  2Q2T A;  2FMC A;  2E2I B;  3HOW B;  5CGK A;  3EIV A;  3SGI A;  2JEB I;  2F4V Q;  4A3I B;  5K36 G;  1B1Z A;  3K5M A;  2L1B A;  4K8J A;  4A3J B;  5D14 A;  4IOC A;  1CKN B;  2UXB L;  5TSS A;  3S1M B;  3NBH A;  4IN3 A;  3BZC A;  3RLO A;  4QB4 A;  2ASB A;  2IHF A;  2GA4 B;  3K0X A;  3I4N B;  5M3F H;  4KLK A;  2A68 C;  4DAM A;  3VA7 A;  4CKC A;  2N55 A;  3I91 A;  3J80 E;  1YNX A;  4BBR B;  3M7N A;  1WD1 A;  3RR5 A;  4V0B A;  1Y8P B;  1TS4 A;  4IFD G;  4OEM B;  3VYT A;  2FFK B;  3I70 A;  3AU7 A;  5ELC A;  4LF4 L;  1CKN A;  1HJP A;  4IUR A;  3BU2 A;  1N8R C;  4HJ8 A;  3PO3 G;  1JWS D;  2Q2H A;  2K50 A;  2KCN A;  5CV4 A;  3GQB A;  2SNS A;  1IW7 C;  2EYO A;  5HY6 A;  4K6D A;  5JVH 3;  3GTK B;  4LFA Q;  1UAP A;  1CK1 A;  2KVM A;  3L0O A;  3A0J A;  2A19 A;  3STB D;  1NJI C;  2F0H A;  3LWE A;  4DV2 Q;  3BDL A;  4Q0F A;  2D62 A;  4YCV A;  3MWY W;  1LTG D;  4DK6 C;  4OIK A;  1TQO A;  1EOT A;  1B9M A;  4K5W A;  4GKK Q;  3SR1 A;  2RA4 A;  3M4O H;  3HOU H;  3AEV A;  2WV6 D;  4DV6 Q;  1NCV A;  2LSS A;  2A5H A;  2BA1 A;  2ALY B;  4JOI A;  2L4N A;  3S2H B;  4QCL A;  4EQO A;  4WJ3 M;  1KAW A;  3S17 B;  5AJ3 Q;  4HJ7 A;  4RCO A;  1NR4 A;  4DR6 L;  2UU9 L;  4V19 0;  3H91 A;  4O0A A;  1VQL A;  1SYC A;  3CPF A;  1G29 1;  1YI2 A;  3WWV A;  1RF2 D;  2HT1 A;  5IP7 H;  4A3I G;  3SK5 A;  1STE A;  2D0P A;  1QVG A;  4BWG B;  3GTL B;  1EY7 A;  1O78 A;  5E4W C;  1S5D D;  3OW7 A;  5IT9 E;  2JSO A;  3HZX A;  1ZYR C;  3L9A X;  1VQE A;  2Q8T A;  4A3F G;  1K3B C;  4QF4 A;  4A3E B;  1PYW D;  3OTO Q;  3R93 A;  5IGF A;  1PMR A;  4PZ8 A;  1OXS C;  3X3M A;  4FDB A;  4POF A;  1VDZ A;  2MPM A;  2RDF A;  1WTR A;  1Q7Y C;  1C9O A;  2EDG A;  1IZ6 A;  1BBU A;  1F9S A;  2K75 A;  4X3U A;  2K03 A;  1HZC A;  3IAY A;  3S1R B;  4AQY L;  3K5L A;  1G2S A;  3IKJ A;  5LMN L;  1K73 C;  1N36 L;  1EU3 A;  4DV3 Q;  3PUW A;  3QIA A;  4YCW A;  1HQM C;  2ENB A;  2E8G A;  1STY A;  3KBG A;  2NVQ B;  1SMY D;  1Q46 A;  5A2Q L;  1S5F D;  4KN4 C;  3TEH B;  5HUR A;  2YU9 H;  1IBL Q;  1VQM A;  4N9P A;  5BR8 L;  4HID A;  5BN5 A;  1V8Q A;  3ERQ A;  3BYT B;  4I65 A;  3GD7 A;  2IT1 A;  2DY7 A;  1T5E A;  1I50 B;  4HED A;  4LF6 Q;  2XSC A;  2OWO A;  1QZG A;  4JW0 A;  2PNR C;  4RGN A;  1PH5 A;  1FGU A;  1PFS A;  5J39 A;  4ME5 A;  4YY3 L;  3EBE A;  3PUY A;  1JWM D;  1PRT D;  3E6Z X;  4IFD H;  2EYP A;  4JCV E;  4HSP A;  4BBS H;  1O80 A;  2NVT B;  4LW1 A;  3LGJ A;  4LWC A;  1FYC A;  2B2V A;  1N34 L;  1GM5 A;  3J7A 5;  4BXX H;  3U9O A;  3OMG A;  1IYU A;  2WAQ G;  4R4T A;  2Q2U A;  5CBE E;  3I73 A;  5C3W A;  2HHH Q;  1GD7 A;  5I9P A;  2D0O A;  1AE2 A;  1TII D;  2EXD A;  1H9M A;  2R93 B;  1K83 B;  1WJJ A;  1F77 A;  1TY0 A;  3ERO A;  5DLQ E;  4EGV A;  4HR7 B;  2KQ3 A;  3VYU A;  3KYH C;  3S16 H;  4OO1 H;  3S17 H;  3KJP A;  3PUX A;  5IP9 H;  3M3Y H;  3C2P A;  4A3I H;  2E2H H;  1W2B A;  4FF3 A;  4DR7 Q;  1LV9 A;  2PMZ B;  3SHL A;  2J0T D;  2WKD A;  2UUA L;  4A3D H;  1K8M A;  4LFB L;  2I46 A;  3GTL H;  2E5L Q;  4B9X A;  1PH3 A;  2R7F A;  3W3A A;  4RGM A;  4DR5 L;  2B2W A;  3OYY A;  3HOV B;  4BY7 H;  3D3R A;  1N33 Q;  3UE1 A;  1G6Z A;  2NZ1 D;  1MSG A;  5IE8 A;  3M4P A;  1QJO A;  1WTV A;  1SJH D;  4DV2 L;  5LHY 1;  1BDO A;  4XXE A;  1W6J A;  2DNE A;  2XWB B;  4CHT B;  2Z0S A;  2IW3 A;  1QVF A;  1WFQ A;  1KQS A;  3BS1 A;  4NB3 A;  3TP7 A;  1TS5 A;  4HMJ A;  2KUM A;  3KK7 A;  2MHV A;  4RCN A;  4OGQ C;  5FLX E;  1V1Q A;  2EY5 A;  3M4O B;  2WII B;  4UY8 C;  1QIL A;  3S9W A;  4MTK A;  1L0W A;  2CWP A;  5C5M A;  1O7I A;  3FHW A;  2N3S A;  1I4Q A;  1I4R A;  3E0E A;  1MSH A;  4X65 L;  1TWF H;  3NE5 B;  4K6L A;  3ITP A;  3HOY G;  4ZQ3 A;  2JA8 B;  4JC0 A;  2YV5 A;  1EQQ A;  2ZJR A;  1EIG A;  2CW0 D;  2DN8 A;  3UI2 A;  3D6C A;  1LYL A;  5GRO A;  3FKI G;  1XXG A;  3MEH A;  4DR1 Q;  1D1I A;  3UDF A;  1SSO A;  3RUZ A;  1JB7 A;  3MEF A;  4HJA A;  5DNF A;  3CU7 A;  2KA7 A;  1VF7 A;  1CQV A;  3A5U A;  1Q1E A;  2ZT9 C;  5E7N A;  3S15 B;  2K4K A;  2SDF A;  4MZ9 A;  4RKB A;  3OOC A;  1CZW A;  1LTR D;  4P2C B;  4A3K H;  2JA7 H;  2XRS D;  2IX0 A;  1NUC A;  5IIF A;  3H0G H;  4BY1 G;  2Z4I A;  4WRD A;  1B70 B;  2GVA A;  3SEB A;  1SBB B;  3NBI A;  4X3T A;  2A6H C;  2LKV A;  4H44 C;  1Y1V B;  1I5F A;  3NK9 A;  2L11 A;  2VQE Q;  1SLJ A;  4X65 Q;  4K8I A;  4JI3 Q;  4ALP A;  4BA2 I;  1KRT A;  4Y7N H;  1JJ2 A;  3PSI A;  1KL9 A;  5EKI A;  1HR0 Q;  5K36 H;  3EFX D;  5EBC A;  1DOK A;  2K1B A;  4AYB B;  5JAV A;  1H95 A;  1A63 A;  1L2F A;  2RSO A;  1TS2 A;  2E76 C;  3V05 A;  2CCZ A;  4LK1 C;  1G6P A;  3ZJY C;  2R7Z B;  1EU4 A;  4YIJ A;  1BQQ T;  3EQL C;  3CHB D;  4DV1 L;  3J80 i;  3EJI A;  5EKL A;  1BBX C;  1VQ7 A;  4DV5 L;  1QUQ B;  1V43 A;  3TP6 A;  1LT4 D;  2IHE A;  3I8Z A;  4KY7 A;  1HNZ L;  2K5H A;  5C4H A;  4ME3 A;  2GVB A;  1VQF A;  3G48 A;  3HOX G;  3BDC A;  4DR4 Q;  3AYH B;  3CCR A;  5M5X H;  2JE6 I;  3D6W A;  4A93 H;  5J22 A;  3U58 A;  5G3L D;  4PZ7 A;  2EY6 A;  1L1O A;  3A55 A;  4OX9 Q;  3H09 A;  1Y8N B;  4DAY A;  4KN7 C;  4P72 A;  2QEJ C;  3KF8 B;  3NEL A;  3MHB A;  1EOV A;  3QO2 A;  4QIW E;  2RKS A;  1LLR D;  4JI0 Q;  2LMC B;  4KHP L;  3PCO B;  4B3S L;  2PI2 A;  5JPN C;  5C3X A;  4L8J A;  1D5Z C;  3AB9 A;  2K5V A;  1TT2 A;  3B6Y A;  1YIJ A;  3CCU A;  2EJM A;  5I6W A;  5FO8 B;  1T9H A;  1AEX A;  3A5Z B;  4DR3 Q;  3GTP B;  3ULP A;  1YNN D;  2E75 C;  5M3M B;  2F0P A;  2BDO A;  2F4I A;  4JI5 Q;  5C0X H;  2EIF A;  3WOF A;  4KJO A;  1LTI D;  4QUF A;  4CJ2 C;  4PQX A;  4PMC A;  1EY9 A;  3DUZ A;  1B7Y B;  1GUS A;  4RH6 A;  1DOL A;  3RMH A;  1ENA A;  4PMW A;  3N6R A;  3SK8 A;  2EVB A;  4ZK9 B;  3CC2 A;  5ELD A;  4EX5 A;  1HTL D;  1YHA A;  3UDI A;  1KTK A;  5M9O A;  5AJ3 L;  2LFN A;  4J6H A;  3G4S A;  1KNE A;  5C4X G;  4ID6 A;  1V1O A;  2Y0S B;  1MIU A;  3K58 A;  4R1J A;  4BA1 I;  3KJO A;  5L37 A;  4XYO A;  2K52 A;  2IX3 A;  3PIP 3;  1EYC A;  3OIQ A;  4GNX A;  3MXN B;  4KD3 A;  1D8L A;  5ELF A;  4BS9 A;  5IYD G;  5A35 A;  4M8A A;  3RD4 A;  1KRS A;  3ULL A;  2JA5 G;  1JCK B;  3E9H A;  2WFW A;  4ZYS A;  2DGY A;  4XTC S;  1FVI A;  2N88 A;  5GAG C;  4N8X 1;  4C3I B;  4LF9 L;  3PF4 A;  3D4W A;  4S3S A;  4IFD I;  1UE6 A;  4FO2 A;  4UHV A;  4Y7N B;  2Z1C A;  2UXC L;  2EOT A;  1CA5 A;  3RLF A;  2ZJQ A;  1B50 A;  1EZ6 A;  1Y1V G;  3C1E A;  3EN2 A;  2F0S A;  4DV4 Q;  1VQ4 A;  4KY5 A;  1F9P A;  4DV7 Q;  2R61 A;  2UU9 Q;  5FOB B;  4BBR G;  4IFD J;  2XWJ B;  3J81 i;  2KHI A;  1VQC A;  2B2T C;  1EIY B;  4A3M B;  1EY4 A;  2A69 D;  2K5N A;  5M3F G;  2ZXP A;  2VUM B;  2A6E C;  3PO2 G;  2KEC A;  1TY2 A;  4A3J H;  1D7Q A;  2E74 C;  3PO3 B;  3S15 H;  1HNW Q;  2OTL A;  3NEM A;  1S4Z A;  3S1M H;  1LT6 D;  1P16 A;  4FVM A;  2PZW A;  2M9V A;  1MJE A;  3GTO B;  5EJW A;  4DK0 A;  2B29 A;  4GN3 B;  1FNV A;  4A3D B;  1A8V A;  2VL6 A;  2E2I H;  2Y0S G;  2CKZ B;  4RKL A;  1EWI A;  1VQI A;  1EL0 A;  1Y14 B;  4A3G H;  5M5Y B;  4XYQ A;  5JEA G;  3VYS A;  4A76 A;  3QR8 A;  4X66 L;  3F1Z A;  4U67 3;  2ZTD A;  3Q0A A;  1TWC H;  2EYM A;  3VDY A;  3TBI B;  1PZI D;  4N9T A;  2YTX A;  4Y52 H;  2V1C C;  1STG A;  4DAV A;  1GUO A;  3MFG A;  1EFW A;  2XGT A;  4JI4 Q;  2SOB A;  3KLS A;  3CC7 A;  4DUY L;  1LAB A;  5C5L A;  5JEA J;  1JR0 D;  2H1E A;  1YIT A;  2EZV A;  2EPB A;  1VQD A;  1YJ9 A;  4CJ1 B;  2C9O A;  2IX1 A;  1Q90 A;  2R92 B;  2UUB L;  2EE1 A;  4NKL A;  3DXJ C;  3JAM L;  1AN8 A;  2R93 G;  3FPP A;  3K7U C;  3PV0 A;  3CKI B;  2AWN A;  3FKI H;  2HCC A;  2JA8 H;  2QCP X;  2N8N A;  5IP9 G;  4JI1 Q;  2VY3 A;  4JI5 L;  2JA5 B;  5HGQ A;  1N34 Q;  1RL2 A;  5IP7 G;  4IPD A;  3S14 B;  2K6A A;  3MA2 B;  1OXV A;  1VQA A;  5KYL A;  1CA6 A;  1I6H B;  3KF6 B;  3J81 E;  3I56 A;  3Q22 A;  1E0B A;  1GOZ A;  1EYG A;  2Z6K A;  2NZO A;  5AFW A;  2OCE A;  2B2T A;  2KBN A;  3OPO A;  4L63 B;  3STB C;  5FK9 C;  4K2L A;  2O4X A;  3Q6S A;  1HA5 A;  1ICW A;  1V1P B;  2QW7 A;  4B9W A;  5EBD A;  2F0N A;  4RMF A;  1HZB A;  4R4O A;  5IYB H;  4A3B B;  2R92 G;  4BY1 H;  4GOP B;  2UUC Q;  3M9B A;  2C5C A;  1A2T A;  3FDT A;  4MNO A;  5IGB A;  1ESR A;  3MVV A;  2O5J C;  4R4C A;  3F2C A;  1Y1V H;  1WVL A;  1H9K A;  4JYA L;  4L5T A;  4O1N A;  1TS3 A;  4JYA Q;  4CGY B;  1SNP A;  4LJZ C;  3GTM H;  4LUO A;  1HCZ A;  1MBY A;  3TZU A;  1FJG Q;  3PGZ A;  3I4M H;  3VR3 A;  1SYD A;  2PQE A;  1MKH A;  1QG7 A;  1X56 A;  3FPU B;  1E2V A;  4GNX C;  1EWH A;  5COR A;  3D4R A;  4CDE C;  1IBM Q;  3AMU A;  3OIP A;  1GO3 E;  2B63 B;  2WIN B;  3BG3 A;  1YJW A;  1XPO A;  1X3F A;  5CMD A;  2NVX H;  1EQT A;  4DV7 L;  2XNA C;  3NBH B;  1JOK A;  3P1H A;  2BH8 A;  5FJ8 G;  4FXK C;  2I5M X;  4R4I A;  1EEI D;  3T4A C;  4BBS B;  1VQJ A;  2ES2 A;  1N32 L;  2R3Z A;  1LTL A;  2D5D A;  1GUW A;  5KNC A;  4OWT B;  2R92 H;  4FXG C;  4C3H B;  3T1Y Q;  3T1H L;  3QOL A;  1PH1 A;  1JOR A;  1SRO A;  3DM3 A;  1O7Z A;  5G3L F;  1Q1B A;  3R3O A;  1ENC A;  1FJG L;  3JAM E;  4WJW A;  4TKO B;  1EWC A;  2I07 B;  4UDU C;  2I5H A;  3SK4 A;  3FEW X;  1I4H A;  1ET9 A;  2F03 A;  4B3R L;  1JJG A;  2HQE A;  4B3R Q;  5ELO A;  1IBM L;  2Z6K C;  2CH4 A;  1UE7 A;  2NN6 I;  4ZUJ A;  1PTO C;  1XMO Q;  3MXU A;  1M1K C;  4APV A;  1Q86 C;  1HA6 A;  3PO2 H;  3DWP A;  1UE1 A;  1PFB A;  1TWA H;  3E3X A;  3H3V I;  1JE5 A;  2I5L X;  2YTV A;  3M4Y A;  3TRZ A;  2KHS A;  2WB1 G;  4NXN Q;  4FF2 A;  4F8M A;  1AZP A;  3S1N B;  3MFY A;  1CFM A;  1ONL A;  3K6O A;  1LAC A;  4IAL A;  2VQF Q;  5I4D A;  2OTJ A;  4KKT A;  3CC4 A;  3FKI B;  4I7Z C;  4OHJ A;  4X6A H;  1A6X A;  3R2T A;  3I4M G;  3AFP A;  1R9T B;  3A8K E;  1CSQ A;  1ENF A;  3HOX H;  1FGB D;  1E22 A;  1AW7 A;  2FJ2 A;  3IFT A;  5IYB G;  1ILP A;  5EAY A;  4DV1 Q;  4BY7 B;  1KDA A;  1HQR D;  2RBM A;  1K8A C;  2Z4H A;  3KDF A;  1EQR A;  1Z9F A;  2H5X A;  1IBK L;  2HIV A;  2X69 A;  1RHP A;  4GOP C;  2F4V L;  2F0L A;  2BDN A;  2KEE A;  2CQO A;  1ML0 D;  1WTW A;  3HOZ G;  1F9R A;  1TWC B;  5IYD H;  1KDC A;  1LTA D;  2NN6 H;  3VR5 A;  2RCF A;  1WD0 A;  4DR4 L;  5FLX L;  4QUC A;  1XX8 A;  3S14 H;  2LXJ A;  1DM0 B;  5C4J H;  1AH9 A;  1K83 H;  4JI2 Q;  4R8N A;  2K5D A;  3SK6 A;  4PV1 C;  1SE4 A;  4X66 Q;  2AUJ D;  1K8O A;  4HCE A;  1SFO H;  1S5B D;  4CKE A;  2JA8 G;  4JBW A;  2B2Y A;  2EJF C;  4DR5 Q;  1CKO A;  1PYB A;  3JAM c;  4MHE A;  4B3T Q;  3CCJ A;  2NUC A;  5IWA L;  1J9O A;  3Q8D A;  4WFN 3;  3D31 A;  3O13 A;  1EY8 A;  1YEZ A;  4RFB A;  3L2P A;  1Q12 A;  1QCB D;  1YNJ C;  4GN4 B;  1B3Q A;  3ND8 A;  1CSP A;  3P20 A;  4KD4 A;  1JOQ A;  3GTQ B;  5LL6 S;  4IZ8 A;  2Q8R E;  1RTN A;  1E3P A;  1SYF A;  5C4X B;  4CBV A;  1HR0 W;  1RKN A;  2PW5 A;  2L0C A;  4O42 A;  4JI8 Q;  2HDL A;  4IJL A;  3A7A B;  1GHJ A;  3OSO A;  1XJV A;  4AYB E;  3SXH A;  1FNU A;  1WCM B;  1ZKO A;  2VUM H;  2XN9 C;  1HNZ Q;  1F2Y A;  4K14 A;  5ELB A;  4HIO A;  4LF9 Q;  1STA A;  2PO4 A;  4IUV A;  1ICF B;  3TSS A;  2VZA A;  3KF6 A;  2JN4 A;  3FP9 A;  3OW2 A;  1J8I A;  1PA6 A;  1BCP D;  2IY5 B;  4C56 C;  4A93 B;  3GV6 A;  3CCL A;  1G51 A;  2A74 C;  3PIO 3;  1BCP B;  1C4Q A;  3HOY H;  3I2Z A;  4X3S A;  3DM1 A;  1J6Q A;  1RCV D;  1U4L A;  4HMI A;  1OXX K;  3LX0 A;  1WTH A;  1C48 A;  2EXZ A;  4Z9C B;  3U50 C;  2K5Q A;  3HOU B;  5GAH C;  4LFC Q;  1JWU D;  2FIN B;  2WAC A;  3RN2 A;  5DAU A;  3NEN A;  4ULL A;  1N9W A;  1Q81 C;  2NB0 A;  4JI8 L;  2B63 G;  1H9J A;  3J81 L;  1VQO A;  1CI3 M;  4LFA L;  3M85 A;  2FXQ A;  4GNX B;  1SAP A;  1LO5 D;  2A6E D;  3IL8 A;  2HUG A;  3G6E A;  1HFN A;  4XDX A;  1C0A A;  2F0Q A;  4DR2 L;  3KLW A;  1U4M A;  1BBW A;  4TSS A;  1KC8 C;  1QB5 D;  3NQT A;  3I4N H;  5D3I B;  4ZUI A;  1TWH B;  3VA5 A;  4JV5 L;  1HR0 L;  1KAB A;  5C0X G;  2CFM A;  2EYF A;  2GN5 A;  3I90 A;  2XRQ D;  3QG1 A;  5KRU A;  4A3D G;  5BN4 A;  1I6H H;  4XIG S;  1U0L A;  3HOW G;  1GUN A;  3G6J B;  4GLX A;  1G91 A;  4LMQ D;  1B4O A;  4DUY Q;  1D1K A;  4GKJ L;  5JJL A;  1FNW A;  1JE4 A;  1UEB A;  2HQL A;  2VS1 A;  4P73 A;  1SDF A;  3CPW A;  3A56 A;  1YJN A;  2ICI A;  3GTG H;  5KGU A;  1G8Z D;  1LT5 D;  1ILQ A;  4BBS G;  2B2Y C;  5GQO A;  3S2D H;  4HCS A;  1TWG B;  3QB3 A;  3BZK A;  3K5N A;  2PQA B;  1KXL A;  1YVC A;  2PMZ E;  4RAU C;  2EYH A;  2O5I C;  5C44 H;  1TWA B;  1MJC A;  1NR2 A;  3CRL C;  3VR2 A;  5IGE A;  4Q5V A;  4HAE A;  1I6V C;  1SYB A;  1DCZ A;  3J7A V;  1SE2 A;  2JA7 B;  3W1G A;  3D0F A;  3LNN A;  4A3M H;  2DJF C;  1HTP A;  1XMO L;  3UDX A;  2MP1 A;  1PFM A;  3MZ5 A;  4DR6 Q;  1RTO A;  2PQA A;  1TXY A;  5IWA Q;  3FMC A;  3GTJ B;  1HH2 P;  2QDL A;  4DXG A;  2AQ2 B;  2BOS A;  4G57 A;  3SVM A;  1BR9 A;  3NWS A;  3CAM A;  1AZQ A;  4XT3 B;  2XVS A;  4R8I A;  1FD7 D;  1OO9 B;  4DNT B;  4IPH A;  1ZYR D;  4C3I H;  3CCV A;  4FF1 A;  2M2L A;  2MJ8 A;  1PH4 A;  4ILW A;  1G2T A;  4A3B G;  4YWM A;  2CWA A;  4OO1 I;  1JB3 A;  2IJ0 A;  4K5X A;  3P75 A;  2EY2 A;  2F0E A;  2OQ0 A;  1KIX A;  2Q2I A;  5FLM G;  2R6G A;  3T56 B;  2LXK A;  4DU9 A;  3MTS A;  4GKK L;  3H3V H;  2ZXO A;  2HHH L;  5IOD A;  4XT1 B;  4ABN A;  1F9Q A;  5KND A;  1AFP A;  3LWU A;  4DF7 A;  4IQZ A;  5C44 G;  1VQ8 A;  3W1B A;  3HOW H;  1R4P B;  1CT1 D;  3W2D A;  1WTO A;  2K7V A;  2R7D A;  3TDQ A;  1OXU A;  3CXC A;  2EYL A;  3N52 A;  5J1Z A;  4DPG A;  2R7Z G;  3NSW A;  4DUZ L;  4ZAI A;  2P5Z X;  3L3O C;  4GKJ Q;  1L1O B;  1QE6 A;  4A3J G;  1Q8I A;  2ZM6 Q;  4LFB Q;  2F0F A;  4B3T L;  2KED A;  3KF8 A;  1ROD A;  4C3J G;  1PH6 A;  3HOU G;  1A2U A;  5E1F A;  4AIM A;  1MGS A;  4UP9 A;  2A69 C;  4A3F B;  3PO3 H;  3S2D B;  1SXT A;  3KLR A;  1X3Q A;  1Y69 U;  4IUP A;  2OT2 A;  1D5M C;  2J7Z A;  2JYO A;  1X3G A;  2JA5 H;  4DAP A;  2HDM A;  3IFD A;  4IOA A;  2NZH A;  3X3N A;  1Z6H A;  2RDG A;  4DKA C;  3J80 c;  3I4L A;  4BY7 G;  1BF4 A;  2R93 H;  5GAD C;  4IO9 A;  2JA6 B;  1IXR A;  1T5X D;  1GKH A;  1SMY C;  1I3Q B;  2PZT A;  5LL6 X;  4FP5 D;  2JA9 A;  2F0W A;  5IGD A;  4H02 A;  4KKU A;  1E1O A;  1U5K A;  1WI5 A;  1B53 A;  4A4I A;  3K59 A;  3H94 A;  4DV0 Q;  2EYJ A;  4PNY A;  3VR4 A;  1V9P A;  4XQN A;  1PRT B;  1X3P A;  2RF4 A;  2BH2 A;  4KK7 A;  1SYE A;  2MFI A;  2F3W A;  2OQK A;  4L5S A;  2CHB D;  2NVY H;  2KCM A;  1H9R A;  1Q8K A;  3H0G B;  5C3E H;  2RHQ B;  3ERS X;  4IUT A;  4C2M B;  1STB A;  4CJ0 B;  1HHV A;  3T1H Q;  3KOJ A;  1E24 A;  1IKM A;  4J8Q A;  3RZO H;  3U4V A;  3CCQ A;  1Y8O B;  1EY0 A;  1J5E L;  1EY5 A;  4OIJ A;  4C3J H;  4B3M Q;  4IUU A;  3GTM B;  4JPB W;  1SMX A;  5I9O A;  4LUV A;  3FRP B;  3CCS A;  3GTO H;  1SN8 A;  4G7Z C;  2DNC A;  2WB1 E;  3UDG A;  2LS0 1;  1EZ8 A;  1PTO B;  2N78 A;  3K7A B;  1NSN S;  4NDX A;  3K81 C;  1SNC A;  4JI6 Q;  5M5W B;  4X62 Q;  2HD3 A;  3CD6 A;  4A3G G;  1EY6 A;  2AQ3 B;  5C4X H;  2QKI C;  4A3B H;  2DJG C;  4DGZ A;  1VQ6 A;  1TWF B;  3HOV G;  4A3G B;  4AH6 A;  4K0K L;  4POG A;  4ZKC B;  3GP7 A;  1N32 Q;  1ZEQ X;  1Y1W H;  1WOC A;  4UP7 A;  2RVL A;  4HIK A;  2RQX A;  4H7B A;  1PZJ D;  3JC6 6;  2IPK D;  2OF1 A;  3TME A;  2CW0 C;  3I7F A;  1Q82 C;  1HNW L;  1QOH A;  4DR1 L;  1I4G A;  2F0D A;  2AWO A;  2QIL A;  3ND9 A;  3TN2 A;  2OXP A;  2NVQ H;  4M1U B;  1B3A A;  1RIP A;  2WKC A;  3NUC A;  4JI7 L;  5ELN A;  1F2M A;  5EQ0 A;  3HP3 A;  4KKS A;  5JVG 3;  4JG2 A;  2VXW A;  2KCT A;  4QL5 A;  4DR3 L;  5FKA C;  3F2U A;  1GJX A;  2HCI A;  1L0Y B;  3U4Z A;  2JP1 A;  3I4M B;  4FYD A;  1PZK D;  4MN3 A;  1XNR L;  3H3V C;  1CUK A;  4DNI A;  1VF5 C;  3WOE A;  5DM7 3;  1ASZ A;  3KBX A;  1PH7 A;  4G7O C;  4YCU A;  1VMC A;  3JAM i;  2A6H D;  2KOL A;  4DN4 M;  3M3Y B;  4JI4 L;  1DD2 A;  1SNQ A;  5M3M G;  4A3L G;  2IL8 A;  5C0X J;  1CKM A;  5M5Y H;  1H9S B;  3CQZ H;  4C3H H;  4LF8 L;  1A3U A;  1A62 A;  3A7L A;  5LMN W;  2ZM6 L;  1JC7 A;  3VR6 A;  4HJ5 A;  1QZH A;  1XPU A;  1O7L A;  1KDB A;  3KFU A;  5C3E B;  1M90 C;  1M4V A;  1K9M C;  4YWL A;  3NWT A;  4JBK A;  3GDE A;  1A3V A;  5JOB A;  1BKB A;  1RJT A;  3DWQ A;  4OEL B;  1A15 A;  3CME A;  2M00 A;  4FNF A;  1C7Y A;  2OEO A;  1EFI D;  1BVS A;  1CTM A;  3E0J A;  3C3L A;  1SEB D;  1K3R A;  5I2Y A;  3CP0 A;  1K28 A;  1LTS D;  1KD1 C;  2YTY A;  2Q8I B;  1HNX Q;  3BVG A;  1QUQ A;  4GS3 A;  5M3F B;  4EQP A;  3HOV H;  2DY8 A;  3U9S A;  3BVZ A;  2F0M A;  3KDF B;  3H6M A;  1PFN A;  2UXD Q;  4HJ9 A;  3J7Y W;  1VQB A;  4JBJ A;  1NTG A;  2MUY A;  3NTK A;  3CMA A;  1Y1W G;  3DWA A;  1HUN A;  1PRT F;  4JI2 L;  1DJR D;  2ATW A;  1MHW C;  5FO9 B;  4TVA B;  2F0K A;  3D4D A;  1L0X B;  3E5S A;  3HKS A;  1ZXT A;  2UUB Q;  4GZY C;  3RN5 A;  2PCF B;  1EUJ A;  2F52 A;  2BE5 C;  3F2B A;  1ET6 A;  2E5L L;  3J81 c;  3K80 C;  4JVZ A;  5KEE A;  3T1Y L;  2B2U C;  5FJ8 H;  3HOX B;  4DNR B;  4IUQ A;  3KLS X;  1NBW A;  4LF4 Q;  2CH4 W;  3H0G G;  4ZCK A;  1GUG A;  2K14 A;  1BUV T;  4A3M G;  2QF7 A;  4DXF A;  1WCM H;  4NXM Q;  4KJN A;  2ZXR A;  2JQO A;  1E2W A;  1WTX A;  2SEB D;  3GTQ H;  4LAA A;  1STN A;  3R2I A;  3UE0 A;  4J15 A;  1HXY D;  1LTB D;  5D65 A;  3CCE A;  1X55 A;  4DV3 L;  5ISR A;  3R8B A;  3WDN A;  3S24 A;  1PVO A;  4BBR H;  2HIX A;  3J80 L;  3L7Z C;  1BOS A;  4K0K Q;  1I50 H;  4DV6 L;  2NYZ D;  3BVM A;  1UE5 A;  2K33 A;  2QEX A;  4RHR A;  4LF6 L;  4QIW B;  4F7X A;  3GO5 A;  1K0R A;  3MC0 B;  1W3S A;  4LF8 Q;  1VQP A;  3K57 A;  1IW7 D;  2NVY B;  1XYI A;  4YY3 Q;  2B8G A;  4IPG A;  2J4X A;  1PTO H;  4HIM A;  5BR8 Q;  1BXT A;  4RWS C;  1JQY D;  4A3E H;  1A3T A;  1HFG A;  3DEO A;  1B2T A;  2F0G A;  2G5D A;  4NXM L;  2VW9 A;  1EYA A;  2LY7 A;  4C3J B;  3MXN A;  3BZD B;  1TU2 B;  1YNN C;  4HN7 A;  4CDD C;  2AHO B;  3IRB A;  4CDC C;  1IL8 A;  4EQ5 A;  1Y1W B;  3DHQ A;  2JA7 G;  3T53 B;  2AKW B;  2EJG C;  1YHQ A;  2NBF A;  3SDZ A;  4FXD A;  4QGU A;  2F3V A;  2A8V A;  1YNJ D;  1HPC A;  3TS0 A;  1LT3 D;  5IGG A;  1J5E Q;  2FHT A;  3OMC A;  5J3B A;  5EKK A;  3K0Y A;  2VNU D;  4DR2 Q;  1KLU D;  3BYY B;  3MXP A;  4LF5 Q;  4X64 Q;  1XMQ L;  3HKZ G;  1QWY A;  4LF5 L;  1E7Z A;  4F88 A;  3TP5 A;  5FLX c;  1PV4 A;  4JI3 L;  2VQE L;  4AQY Q;  1DOM A;  5T1G A;  4RGO S;  3BDO A;  1VQ9 A;  5KNB A;  5T1I A;  1PH9 A;  5CV9 A;  5EPL A;  2AMC B;  1SJE D;  1JOO A;  2WP8 J;  5JPM C;  1EYD A;  1XTD A;  3HOY B;  5ELE A;  2DUD A;  3NTI A;  1C8C A;  3EA6 A;  3PO2 B;  4RHS A;  2BCO A;  4JI0 L;  1DXM A;  4KHP Q;  2F3I A;  2E2J H;  1PDQ A;  3C1F A;  1CZG A;  5CC4 A;  3EVQ A;  2WAQ B;  3H15 A;  3DLL A;  2VQF L;  4A3E G;  1TWG H;  2PI2 E;  4LFC L;  4F87 A;  4XQJ A;  2MGS A;  4BXX G;  1SNO A;  2AQ1 B;  1ASY A;  4CDF C;  3QWN A;  2F0V A;  2MO0 A;  2Z6B A;  1HNX L;  1TWH H;  3HRZ C;  4PMB A;  3V96 A;  4KI0 A;  1HRJ A;  1NNX A;  1LTT D;  1RD9 D;  2NTS A;  2L9H A;  4G4K A;  3PIP A;  1D6E C;  1X32 A;  4YHH Q;  4BY1 B;  4C3H G;  4YHH L;  4A3K G;  1IKL A;  1U9R A;  5FLM H;  4O2D A;  5A2Q E;  3NPP A;  2YU9 B;  1DON A;  2TMP A;  2RHS B;  4IPC A;  4JV5 Q;  2X6G A;  2RCN A;  3W5O A;  5NUC A;  4UP8 A;  1YBY A; 
#chains in the Genus database with same CATH homology
 4GKK Q;  3CAM A;  2B29 A;  3M4O H;  1NE3 A;  4GN3 B;  3AEV A;  3HOU H;  5IT9 c;  2L15 A;  4DV6 Q;  2Y0S E;  4LF7 L;  2LSS A;  2BA1 A;  4DUZ Q;  2ALY B;  4JOI A;  4WJ4 A;  5JJI A;  2A1A A;  1A8V A;  1YZ6 A;  2VL6 A;  2Y0S G;  4IPH A;  2E2I H;  2CKZ B;  4WJ3 M;  4C3I H;  1KAW A;  3CCV A;  5AJ3 Q;  4HJ7 A;  2MQH A;  4B3S Q;  2JA6 G;  4DR6 L;  2UU9 L;  1PH4 A;  1VQ5 A;  1EWI A;  4O0A A;  1VQI A;  1VQL A;  4A3B G;  4YWM A;  2CWA A;  4OO1 I;  1OXT A;  1Y14 B;  4A3G H;  3CPF A;  1AE3 A;  3I55 A;  4L5R C;  2OQ0 A;  1G29 1;  2N49 A;  5JEA G;  1YI2 A;  1KIX A;  4A76 A;  3WWV A;  4X66 L;  3F1Z A;  2Q2I A;  5FLM G;  2ZTD A;  2R6G A;  2HT1 A;  1TWC H;  4A3C H;  5IP7 H;  3VDY A;  4A3I G;  1VCI A;  2LXK A;  2D0P A;  1QVG A;  4GKK L;  3H3V H;  2HHH L;  2YTX A;  4Y52 H;  2V1C C;  2C35 B;  1EFW A;  2XGT A;  1VQE A;  4JI4 Q;  4A3F G;  3CC7 A;  5C44 G;  4DUY L;  5JEA J;  1VQ8 A;  2UXB Q;  3W1B A;  1HZA A;  3HOW H;  1YIT A;  4X64 L;  1XMQ Q;  2B63 H;  3OTO Q;  1KHI A;  1VQD A;  1YJ9 A;  4PZ8 A;  2IX1 A;  1OXS C;  2R7D A;  1OXU A;  4FDB A;  4POF A;  3TRE A;  3CXC A;  3CF5 A;  1Q7Y C;  1C9O A;  4DPG A;  1PH8 A;  2R7Z G;  1IZ6 A;  4DUZ L;  1BBU A;  4JI6 L;  2K75 A;  2R93 G;  3K7U C;  3PV0 A;  1L1O C;  1HZC A;  2AWN A;  3FKI H;  3TQY A;  2JA8 H;  4GKJ Q;  1L1O B;  2N8N A;  5IP9 G;  4JI1 Q;  2VY3 A;  4JI5 L;  4AQY L;  4A3J G;  5HGQ A;  5LMN L;  3BJU A;  1K73 C;  4DV0 L;  2ZM6 Q;  1RL2 A;  5IP7 G;  1N36 L;  4IPD A;  1N34 Q;  4DR7 L;  4LFB Q;  4A75 A;  1OXV A;  1VQA A;  2B3G A;  4DV3 Q;  4B3T L;  3KF6 B;  3PUW A;  4YCW A;  3I56 A;  4NPS A;  1PH6 A;  2UUC L;  2E8G A;  3HOU G;  1X3E A;  1Q46 A;  3CW2 C;  4AIM A;  3TEH B;  4UP9 A;  1EYG A;  4OON A;  2Z6K A;  2YU9 H;  3PO3 H;  1IBL Q;  1VQM A;  2NZO A;  5BR8 L;  4HID A;  2OCE A;  2KBN A;  1NMF A;  3GD7 A;  3ER0 A;  1IL2 A;  2IT1 A;  1X3G A;  2JA5 H;  3STB C;  2KHJ A;  4IOA A;  2NZH A;  5C3E G;  4LNQ A;  4DKA C;  4LF6 Q;  3J80 c;  1VS0 A;  2OWO A;  1QZG A;  4BY7 G;  4R4Q A;  1PH5 A;  4JBM A;  2R93 H;  1FGU A;  5GAD C;  1PFS A;  4YY3 L;  3ULJ A;  4JI7 Q;  4IO9 A;  4A3C G;  4RMF A;  3EBE A;  1IXR A;  1GKH A;  1HZB A;  4R4O A;  5IYB H;  3PUY A;  2JA9 A;  2R92 G;  4BY1 H;  4GOP B;  2UUC Q;  4OXP A;  4H02 A;  3M9B A;  4JCV E;  1E1O A;  1U5K A;  1WI5 A;  4MNO A;  1IYJ B;  4BBS H;  2UXC Q;  4LW1 A;  4A4I A;  3LGJ A;  4LWC A;  4R4C A;  4DV0 Q;  1N34 L;  1GM5 A;  4QJF A;  1Y1V H;  3F2C A;  1V9P A;  1X65 A;  3J7A 5;  1FL0 A;  4L5T A;  4BXX H;  4JYA L;  2WAQ G;  2RF4 A;  4R4T A;  2BH2 A;  2Q2U A;  4JYA Q;  4DV4 L;  3GTM H;  2MFI A;  1PH2 A;  2OQK A;  2HHH Q;  4LUO A;  1GD7 A;  4X62 L;  4L5S A;  2D0O A;  2NVY H;  1AE2 A;  2KCM A;  1FJG Q;  2EXD A;  3TS2 A;  1Q8K A;  3PGZ A;  3I4M H;  5C3E H;  2RHQ B;  1IBL L;  1WJJ A;  3ERS X;  1MKH A;  1B8A A;  1X56 A;  1PHJ A;  5DLQ E;  3T1H Q;  3KOJ A;  1E24 A;  2KEN A;  3KYH C;  3S16 H;  4GNX C;  3S17 H;  3RZO H;  3KJP A;  2BA0 A;  3PUX A;  5IP9 H;  3U4V A;  3HKZ E;  3CCQ A;  1XNQ Q;  3M3Y H;  4OX9 L;  3PIO A;  4A3I H;  1W2B A;  1J5E L;  1IBM Q;  2E2H H;  4KHZ A;  1GO3 E;  4C3J H;  4B3M Q;  4DR7 Q;  3I4O A;  1SMX A;  4MTN A;  3G71 A;  1YJW A;  4LUV A;  4L5Q A;  4QY7 A;  1XPO A;  1X3F A;  2NVX H;  3CCS A;  4DV7 L;  3GTO H;  1VQK A;  2UUA L;  1SN8 A;  4GLV B;  4A3D H;  2QGQ A;  3NBH B;  4LFB L;  3GTL H;  3AFQ A;  3HOZ H;  2WB1 E;  3UDG A;  2BH8 A;  1PH3 A;  2E5L Q;  5FJ8 G;  2N78 A;  2R7F A;  4DR5 L;  2I5M X;  3K81 C;  4R4I A;  4JOI C;  1VQJ A;  3OYY A;  2ES2 A;  4JI6 Q;  4BY7 H;  1N33 Q;  1N32 L;  4P75 A;  3UE1 A;  4X62 Q;  2JA6 H;  3CD6 A;  4A3G G;  1LTL A;  2JJQ A;  4DK3 C;  5IE8 A;  1I3Q H;  3M4P A;  5C4X H;  4A3B H;  2ID0 A;  1VQ6 A;  3HOV G;  4OWT B;  2R92 H;  4DV2 L;  5GAE C;  4AH6 A;  2MNA A;  2VUM G;  5LMU L;  4K0K L;  3T1Y Q;  1JJC B;  4POG A;  3T1H L;  2Z0S A;  1PH1 A;  1QVF A;  1SRO A;  1N32 Q;  1WFQ A;  1Y1W H;  1WOC A;  1KQS A;  4UP7 A;  4HIK A;  4NB3 A;  3DM3 A;  3K7A H;  1Q1B A;  1SRU A;  1UWV A;  3JC6 6;  4PG3 A;  1FJG L;  3S1Q H;  3I7F A;  1Q82 C;  1HNW L;  3RNU A;  4DR1 L;  4IJH A;  1V1Q A;  4DK6 C;  2AWO A;  4UY8 C;  2I5H A;  1L0W A;  2CWP A;  2NVQ H;  4GN5 A;  1GVP A;  1JJG A;  4B3R L;  1O7I A;  3FHW A;  2N3S A;  1RIP A;  4B3R Q;  3E0E A;  5ELO A;  2R7Z H;  2NN6 G;  1IBM L;  2Z6K C;  4X65 L;  1TWF H;  4JI7 L;  5ELN A;  3ICE A;  1VQG A;  1UE7 A;  2NN6 I;  3HOY G;  1XMO Q;  4JC0 A;  2YV5 A;  2KCT A;  4JG2 A;  1LUZ A;  1M1K C;  4APV A;  2ZJR A;  1EQQ A;  4QL5 A;  1Q86 C;  1R9T H;  4OWX B;  1WYD A;  4DR3 L;  1LYL A;  4OO1 G;  5GRO A;  3PO2 H;  4RG1 A;  1UE1 A;  3FKI G;  4JI1 L;  3F2D A;  1TWA H;  3U4Z A;  5IYC G;  4OWW B;  1XNR L;  4DR1 Q;  1JE5 A;  2I5L X;  2YTV A;  4P74 A;  3UDF A;  3H3V I;  3TRZ A;  2WB1 G;  1CUK A;  4DNI A;  4NXN Q;  1JB7 A;  3MEF A;  4HJA A;  1ASZ A;  2JEA I;  3A5U A;  3PUV A;  1Q1E A;  2VQF Q;  1PH7 A;  4YCU A;  3HFZ B;  3JAM i;  2OTJ A;  1XNR Q;  5E7N A;  2K4K A;  3CC4 A;  4JI4 L;  4MZ9 A;  4X6A H;  5M3M G;  1VQN A;  4A3L G;  5C0X J;  3I4M G;  1S3O A;  1CKM A;  2I0Q A;  1JT8 A;  3AFP A;  5M5Y H;  3CQZ H;  1Z47 A;  4C3H H;  1LM0 A;  4LF8 L;  1CSQ A;  4A3K H;  3HOX H;  1A62 A;  5LMN W;  2JA7 H;  2ZM6 L;  2IX0 A;  1E22 A;  4HJ5 A;  3RZD H;  1QVC A;  2ZTC A;  3H0G H;  4BY1 G;  1QZH A;  1XPU A;  3KFU A;  3K8A A;  4A93 G;  1M90 C;  5IYB G;  1K9M C;  5EAY A;  4YWL A;  4DV1 Q;  4P71 A;  4JBK A;  3GDE A;  1B70 B;  2GVA A;  5M5W H;  1BKB A;  3S2H H;  1K8A C;  3KDF A;  1EQR A;  1Z9F A;  2H5X A;  1IBK L;  2HIV A;  1XNQ L;  3CME A;  1I5F A;  4GOP C;  2VQE Q;  1SLJ A;  4X65 Q;  1XPR A;  4JI3 Q;  2F4V L;  4QQB X;  1C7Y A;  4ALP A;  1NMG A;  3PF5 A;  4BA2 I;  1BVS A;  1KRT A;  2CQO A;  4Y7N H;  1JJ2 A;  3HOZ G;  3PSI A;  1KL9 A;  1S40 A;  1HR0 Q;  1K3R A;  5IYD H;  3CP0 A;  1X6O A;  1KD1 C;  2YTY A;  1SR3 A;  1DGS A;  3GTP H;  1NY4 A;  4DR4 L;  1HNX Q;  4B3M L;  3S14 H;  2LXJ A;  5C4J H;  1QUQ A;  2JK8 A;  4GS3 A;  1AH9 A;  1K83 H;  4JI2 Q;  3GTK H;  1A63 A;  1H95 A;  1L2F A;  1VQH A;  3HOV H;  5IY0 A;  4C2M H;  4X66 Q;  3KDF B;  2CCZ A;  1SFO H;  3I4N G;  1G6P A;  2UXD Q;  4UPA A;  5IYC H;  4HJ9 A;  4LUZ A;  3ZJY C;  1X9N A;  1VQB A;  4JBJ A;  4JBW A;  5LMN Q;  1NTG A;  1N36 Q;  3CMA A;  4DV5 Q;  2JA8 G;  1Y1W G;  1YHB A;  4DR5 Q;  1CKO A;  4JI2 L;  1PYB A;  3JAM c;  4B3T Q;  2ATW A;  3CCJ A;  5IWA L;  3J81 j;  3Q8D A;  4TVA B;  3D31 A;  4A3F H;  4TQU S;  3HKS A;  3L2P A;  4DV1 L;  1YEZ A;  1K8G A;  1Q12 A;  4GN4 B;  3E9I A;  2UUB Q;  1CSP A;  3A74 A;  3J80 i;  3RN5 A;  1VQ7 A;  4DV5 L;  1EUJ A;  2F52 A;  1QUQ B;  4YWK A;  1V43 A;  3F2B A;  1I94 Q;  2E5L L;  2IHE A;  4PZ6 A;  1EIF A;  3K80 C;  3J81 c;  3T1Y L;  5FJ8 H;  1E3P A;  1NBW A;  1HNZ L;  5M3M H;  4LF4 Q;  3CCM A;  4A3L H;  1SE8 A;  1HR0 W;  2K5H A;  3H0G G;  4JI8 Q;  4ME3 A;  2K14 A;  3PUZ A;  4IJL A;  4GOP A;  2GVB A;  1VQF A;  3G48 A;  3RLN A;  3HOX G;  4AYB E;  1XJV A;  4A3M G;  4DR4 Q;  3AYH B;  3CCR A;  1WCM H;  5M5X H;  4NXM Q;  2JE6 I;  2YYZ A;  2VUM H;  4A93 H;  2JQO A;  3F8T A;  1HNZ Q;  4HIO A;  4LF9 Q;  1MJE A;  3U58 A;  3GTQ H;  4PZ7 A;  1JMC A;  1L1O A;  4GLA C;  2XTI A;  3UE0 A;  4J15 A;  4OX9 Q;  5JJK A;  5C0X I;  3CCE A;  1X55 A;  4P72 A;  4DV3 L;  2VZA A;  3KF6 A;  3KF8 B;  3NEL A;  3FP9 A;  3OW2 A;  1EOV A;  2PNH A;  2MO1 A;  3S24 A;  3S1N H;  1PVO A;  4QIW E;  1PA6 A;  4BBR H;  1X54 A;  4JI0 Q;  4KHP L;  1HZ9 A;  1IBK Q;  2HIX A;  2IY5 B;  3PCO B;  4B3S L;  2PI2 A;  3L7Z C;  3OTO L;  3CCL A;  2K5V A;  3B6Y A;  1G51 A;  1YIJ A;  3CCU A;  5LMU Q;  4K0K Q;  1I50 H;  2ZJP A;  4DV6 L;  3S1R H;  1OTC A;  3HOY H;  3I2Z A;  1J6Q A;  1UE5 A;  1T9H A;  1WCM G;  2QEX A;  3A5Z B;  1OXX K;  4LF6 L;  4DR3 Q;  3GO5 A;  1K0R A;  4DAY B;  3ULP A;  1W3S A;  2UXD L;  4LF8 Q;  1VQP A;  3U50 C;  1I94 L;  2EQS A;  4YY3 Q;  4IPG A;  4HIM A;  4JI5 Q;  2EIF A;  5GAH C;  4LFC Q;  5BR8 Q;  3RN2 A;  4NXN L;  3NEN A;  1N9W A;  3AQQ A;  4A3E H;  1Q81 C;  4JI8 L;  2UUA Q;  2B63 G;  1VQO A;  1B7Y B;  3GTJ H;  5H1S E;  2QA4 A;  4LFA L;  2NVT H;  4PMW A;  3M4Q A;  3J7Z C;  3M85 A;  2FXQ A;  2VW9 A;  4GNX B;  4NXM L;  3G6E A;  1E1T A;  2WAQ E;  4EX5 A;  3CC2 A;  4LF7 Q;  1N33 L;  1C0A A;  1PYS B;  4DR2 L;  1YHA A;  3KLW A;  3UDI A;  2AHO B;  3IRB A;  4AYB G;  4EQ5 A;  1BBW A;  5AJ3 L;  2JA7 G;  3G4S A;  2AKW B;  1YHQ A;  1S72 A;  5C4X G;  1KC8 C;  2ZTE A;  4QGU A;  2A8V A;  3I4N H;  1P8L A;  3TS0 A;  1MIU A;  4R1J A;  1A0I A;  4BA1 I;  1J5E Q;  3KJO A;  5J3B A;  4JV5 L;  2VNU D;  2K52 A;  1HR0 L;  2Q2T A;  4DR2 Q;  5C0X G;  2CFM A;  4LF5 Q;  2GN5 A;  4X64 Q;  1XMQ L;  3HKZ G;  4LF5 L;  1E7Z A;  4A3D G;  1I6H H;  5FLX c;  4GNX A;  3EIV A;  3SGI A;  1PV4 A;  2JEB I;  4XIG S;  3MXN B;  4JI3 L;  2VQE L;  1D8L A;  4AQY Q;  2F4V Q;  5IYD G;  1U0L A;  5K36 G;  1VQ9 A;  1PH9 A;  3HOW G;  3ULL A;  1KRS A;  4GLX A;  2JA5 G;  2AMC B;  4IOC A;  1CKN B;  4DUY Q;  3E9H A;  2UXB L;  2WFW A;  2WP8 J;  4GKJ L;  5JJL A;  2DGY A;  1XTD A;  3BZC A;  3RLO A;  2ASB A;  1UEB A;  2DUD A;  2IHF A;  3K0X A;  4XTC S;  1FVI A;  2HQL A;  5GAG C;  5M3F H;  2VS1 A;  4KLK A;  4P73 A;  4DAM A;  4LF9 L;  3PF4 A;  3CPW A;  1YJN A;  3GTG H;  4IFD I;  1YNX A;  1UE6 A;  4JI0 L;  4KHP Q;  2F3I A;  2E2J H;  3M7N A;  3RR5 A;  4IFD G;  4BBS G;  2UXC L;  5GQO A;  3H15 A;  3DLL A;  2VQF L;  3S2D H;  4A3E G;  3BZK A;  1TWG H;  2PI2 E;  4LFC L;  3RLF A;  2PQA B;  4BXX G;  4LF4 L;  1KXL A;  1CKN A;  1HJP A;  2ZJQ A;  3BU2 A;  1ASY A;  1Y1V G;  3EN2 A;  1YVC A;  2PMZ E;  1N8R C;  2MO0 A;  4HJ8 A;  3PO3 G;  2Q2H A;  4DV4 Q;  1VQ4 A;  1HNX L;  2K50 A;  1TWH H;  4DV7 Q;  5C44 H;  1MJC A;  2UU9 Q;  4BBR G;  4IFD J;  4KI0 A;  3J81 i;  2KHI A;  1VQC A;  5HY6 A;  1EIY B;  3W1G A;  3D0F A;  3PIP A;  4A3M H;  1XMO L;  4YHH Q;  3UDX A;  2K5N A;  5M3F G;  4LFA Q;  4YHH L;  4DR6 Q;  3PO2 G;  4A3K G;  4A3J H;  3L0O A;  3A0J A;  4O2D A;  5FLM H;  1D7Q A;  2PQA A;  2A19 A;  1TXY A;  3S15 H;  3STB D;  5IWA Q;  2OTL A;  3NEM A;  1NJI C;  1HNW Q;  1HH2 P;  3S1M H;  2RHS B;  4DV2 Q;  2D62 A;  4IPC A;  4JV5 Q;  4YCV A;  3W5O A;  1P16 A;  2RCN A;  2UUB L;  4UP8 A;  1YBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...