5M3FG

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
237
structure length
193
Chain Sequence
ARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
total genus 32
structure length 193
sequence length 237
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3fG02
2ZTEA 1YHQA 2XGTA 4HIOA 1IBLL 2A8VA 1XMOL 4TQUS 5IYDH 1SMXA 1SE8A 2JA5H 1M90C 5BR8L 1ASZA 3PGZA 1SLJA 4LF5L 1Q7YC 4GN5A 1XMOQ 4DV0L 2K14A 3NEMA 2KENA 5BR8Q 4JI8Q 1X56A 1PH1A 4IOCA 1OXSC 3G48A 5C0XG 3G71A 4LFAL 1I6HH 1GVPA 3M4QA 3UDIA 4YWLA 2MNAA 3F2DA 4LFAQ 1TWGH 3FHWA 4J15A 4LNQA 3RN2A 1AE3A 1Q1BA 3ERSX 1V1QA 3HOXG 4A3GG 1CKOA 4R4IA 5LMNW 2RHSB 1Q81C 3MXNB 4AH6A 5IY0A 5LMNL 2IHEA 1Q82C 2WB1E 2WP8J 2NVTH 2EQSA 1JJGA 1AH9A 2WAQE 1S40A 2GVBA 5FJ8G 4TVAB 5LMNQ 1M1KC 1TWHH 3K8AA 1VQJA 2KBNA 2Z6KA 1QVFA 3PSIA 2UXCL 1CKMA 2RF4A 1Y14B 4JI1L 1EFWA 3KFUA 3D31A 4LF9Q 4P73A 1UE1A 4A3JH 1Y1WH 1HR0W 2UXCQ 4YCUA 4R4CA 4JOIA 3TQYA 4LUOA 1CSPA 1L0WA 1TWAH 1KD1C 2N49A 4DR1L 3KF6A 3I4NG 1YVCA 1Z47A 3E9HA 3HFZB 1HJPA 2HT1A 1GD7A 5M5WH 4OX9Q 4JYAL 3TREA 4DV7L 3RZDH 1BVSA 1XJVA 1K73C 2CFMA 1VQBA 1B7YB 1X65A 1VQGA 2R6GA 3F8TA 5IYCH 2CWPA 3WWVA 4DV7Q 1EIFA 2PQAA 1WCMH 3GTLH 2R93G 4DAYB 3PV0A 4QGUA 5M3FH 2Q2HA 1X54A 1N34L 4DKAC 1VQ4A 1LYLA 3CMEA 3GTOH 1WFQA 3A5ZB 2JA8G 1I50H 3M4OH 4OWWB 1N34Q 3S1QH 1FVIA 3L2PA 4HJAA 5GROA 3S24A 2ZJRA 3T1HL 4A3KH 3S1MH 2B3GA 3M85A 4YCWA 3A74A 1E3PA 3U4VA 1Q12A 2ATWA 3T1HQ 5FLMH 5LMUL 4DR2L 4LUVA 4H02A 1XNRL 2RHQB 1SROA 2JEBI 1IXRA 3W1BA 4BBRG 2WB1G 1PYSB 3G6EA 4DR2Q 3S14H 1TWCH 1XNRQ 2WAQG 4JI2L 4JBKA 2K75A 4A3DH 3I4MH 3S2DH 2JEAI 1YIJA 3GTKH 2ZJPA 1WI5A 2QGQA 2ZTDA 1SR3A 3E0EA 4JI2Q 4JBJA 2Q2UA 1P8LA 1WYDA 4A3EG 4JI0L 3I7FA 1QUQA 2V1CC 4C3HH 3I56A 3ULPA 1W3SA 1HZAA 5M5YH 3EBEA 2KHIA 4YWKA 3ER0A 3K7AH 2E2HH 4NXNL 4JI0Q 4PG3A 1G6PA 3K81C 4B3ML 3M3YH 4A3LH 4JV5Q 3KDFB 2AMCB 2NZHA 5FLXc 4HJ7A 4NXNQ 3U4ZA 2QA4A 1CKNB 2K4KA 4BY1H 4QY7A 2VQFL 1FL0A 1A0IA 1EUJA 3S17H 4POGA 4MNOA 1X6OA 3BZKA 4DR6Q 2OTJA 1YJ9A 1OXVA 2UXBL 2E8GA 5IP9G 3CC7A 3KLWA 1PH9A 3CPWA 2ES2A 3W1GA 4LF8L 3J7A5 4XIGS 5GAEC 4A3MH 1I3QH 4QJFA 1N33L 1G51A 3FKIH 2JA6H 2UXBQ 2VNUD 4PMWA 3M9BA 3KOJA 4DNIA 4LF8Q 2JA7H 1EOVA 3UE1A 2YYZA 3J81c 1N33Q 1K83H 3CMAA 3OTOQ 2CCZA 2OTLA 4DV2L 2D0PA 1MJEA 1PH3A 4A3IG 2JK8A 2UUBQ 1UEBA 4DR3L 1EYGA 2I5MX 3PIOA 4DV2Q 1D7QA 4DV3L 1JB7A 1VQLA 5IWAL 4IFDG 4GS3A 4A3BH 3J81j 3J80c 3CW2C 1Q46A 4DR3Q 1HNZL 2I0QA 2ZM6Q 2UUCL 4AYBG 4BXXG 1HNWL 1YNXA 4UY8C 3GO5A 3RLOA 5IWAQ 1RIPA 2K52A 1XMQQ 1J5EQ 1YBYA 3PF4A 4K0KL 2L15A 3HOVG 1HNWQ 3TEHB 1CSQA 4YHHL 5AJ3L 5H1SE 4BA1I 3KJPA 1UWVA 1K9MC 1EIYB 4OO1G 5JJIA 2R7FA 3H15A 4K0KQ 1LTLA 5C44G 4R4TA 1TXYA 4YHHQ 3M4PA 4APVA 1YZ6A 1S3OA 4DR4L 4A3JG 1IBLQ 2Y0SE 3NELA 1R9TH 4DR4Q 2MO1A 4LF5Q 1N8RC 4DV0Q 4P72A 3B6YA 5JEAJ 4UP8A 1KAWA 2VUMH 2GVAA 3CC2A 1FJGL 4GLXA 1IBKL 3S1NH 1L1OB 2RCNA 3KF6B 2HIVA 3CAMA 4IPGA 2AHOB 4WJ4A 4IOAA 1KHIA 3NBHB 1VQ8A 1EQRA 1FJGQ 1KQSA 1IBKQ 1MIUA 1X3EA 2DUDA 4DR5L 3I4OA 4RMFA 1K8GA 1H95A 2IX0A 2EIFA 1E1OA 1JJCB 1WCMG 3JC66 4YY3L 4DR5Q 1X55A 1TWFH 5M5XH 3HKSA 4JBWA 4UPAA 1YEZA 2R7ZH 3TS0A 4JI6L 2R7DA 4WJ3M 1X3FA 4YCVA 4KHZA 4UP7A 4YY3Q 2R92H 3GTGH 3PCOB 4HJ9A 2DGYA 1NTGA 3PUVA 3I55A 3GTQH 2FXQA 3STBD 4JI1Q 1HR0L 2PI2E 4LWCA 1AE2A 4YWMA 1VQDA 1FGUA 1X3GA 5ELNA 1OXXK 4X64L 4GNXB 2Z0SA 3CPFA 2C35B 1HR0Q 1YI2A 1VS0A 3AEVA 4DPGA 1VQMA 2E2JH 1VQIA 1XNQL 2OQ0A 3HOZH 3CCRA 1GO3E 4X64Q 3JAMc 1X9NA 3U58A 5K36G 1PVOA 3HOUH 5C4XH 3MEFA 1C9OA 2K5HA 3CQZH 4DR1Q 1HNXL 4OWXB 1ASYA 1XNQQ 3I4MG 2PI2A 3UDXA 3F2BA 3RN5A 3HOYG 4FDBA 1HNXQ 1K8AC 4A3CH 2UUAL 4JYAQ 1A8VA 1MJCA 2JA9A 2B63G 2CKZB 2HQLA 4LFCL 1NE3A 2UUAQ 1YITA 2N3SA 4AIMA 3GTMH 4DV5L 4X65L 1VQ7A 4LFCQ 4LF7L 2F4VL 4A3LG 3CC4A 1VCIA 1IL2A 4JI7L 4IFDJ 3J81i 1OXTA 1XPUA 3ULLA 1EWIA 4LF7Q 2F4VQ 4BY1G 4POFA 1JT8A 4JI7Q 4BBSG 1NY4A 2VY3A 2WFWA 1UE5A 3HOXH 3CF5A 2LXJA 4DV1L 2QEXA 2OQKA 4QL5A 4DV4L 1Q86C 3CCLA 4A3GH 4IPHA 3CCQA 2XTIA 4A3FG 3GTJH 3PUWA 4JI3L 4DV4Q 5LMUQ 3J80i 4DV1Q 2VW9A 3FKIG 5GAGC 4NB3A 1KL9A 5C4JH 1JJ2A 2VL6A 3K80C 5EAYA 4JI3Q 5IE8A 3EIVA 5C0XJ 2VQEL 1YHAA 2OWOA 1QZHA 3H0GG 4XTCS 4B3TL 2NN6I 3PUYA 1PH6A 2BH2A 1P16A 2NVQH 4A93H 3RLNA 2YU9H 3PO3G 1WJJA 3PO2G 4A3BG 1O7IA 4IPCA 2KHJA 1KC8C 3HKZE 4GOPB 4PZ6A 4B3MQ 3VDYA 4BY7G 1QVGA 1KRTA 4MTNA 3SGIA 2E5LL 3RZOH 4JG2A 1UE7A 4Y7NH 4DUYL 3CCEA 3OW2A 5IYDG 3F2CA 2JA5G 5DLQE 2VQFQ 1OTCA 4HIKA 1XPOA 2R93H 5GAHC 2BH8A 4P74A 3DM3A 3KYHC 1T9HA 2MQHA 4R4OA 4A4IA 5C3EH 1S72A 2BA1A 3RR5A 3HOWH 4LFBL 4A75A 2K5VA 4R1JA 2AWOA 4JI5L 1NMGA 4PZ8A 1HZ9A 3T1YL 3AFQA 4GKJL 5C4XG 4DUZL 1BBUA 4LFBQ 4NPSA 1IBML 4X6AH 5ELOA 1YJWA 4JI5Q 4ME3A 2OCEA 2JE6I 2VS1A 4GKJQ 4DUZQ 2EXDA 4PZ7A 4RG1A 1IBMQ 1VQ9A 2IX1A 2IY5B 3AFPA 4DV3Q 1JMCA 3J7ZC 1CUKA 1L1OC 2K5NA 4BBRH 1HNZQ 2UUCQ 4OWTB 1VQOA 3BZCA 1YJNA 4X62L 1D8LA 4OXPA 2ZTCA 3AQQA 4X62Q 5AJ3Q 5GQOA 2F52A 4A3EH 1Q8KA 1Y1WG 1SFOH 4LF4L 4BA2I 1C0AA 4B3SL 1BBWA 1PFSA 4Y52H 2AWNA 2UXDL 5M3MH 3EN2A 4LF4Q 3HOZG 3CCJA 4B3SQ 3S1RH 1YHBA 4C3JH 5C0XI 3CP0A 3CXCA 1CKNA 3GTPH 2UXDQ 3ZJYC 1B8AA 3HKZG 3AYHB 1RL2A 3I2ZA 1EQQA 2PMZE 2A19A 2D0OA 3E9IA 3K7UC 4L5QA 1VQAA 2KCMA 2VZAA 4R4QA 1Q1EA 4GNXC 5IP9H 2IT1A 2D62A 5IYCG 4AQYL 4A3CG 4JI8L 2E2IH 1UE6A 2H5XA 4L5SA 1VQFA 2PQAB 4DR7L 2ASBA 3DLLA 4HJ8A 5M3FG 4AQYQ 4A76A 1PH2A 4DR7Q 4JI6Q 1W2BA 4A3IH 4A3KG 4O0AA 2HHHL 3BU2A 4KI0A 2ZJQA 2IHFA 1E7ZA 5IP7H 4HIDA 1PA6A 1Y1VH 1L2FA 3F1ZA 5IYBH 5FLMG 2B29A 3PF5A 2HHHQ 1V43A 3L0OA 4IPDA 3H3VI 3A5UA 5HGQA 2NZOA 3M7NA 2Q2TA 4DV6L 4A3DG 4GN4B 4HIMA 1N36L 3HOVH 3RNUA 2LSSA 1HZBA 4JCVE 1G291 5HY6A 4LF9L 1NJIC 1HZCA 1NBWA 4DV6Q 4X66L 1N36Q 5C44H 2AKWB 4UP9A 1QUQB 3CCMA 3D0FA 3ULJA 4X66Q 2UU9L 2Y0SG 4A93G 1WOCA 2YTXA 4L5TA 3PUZA 4KLKA 4JI4L 3S2HH 3OYYA 4B3RL 2UU9Q 5J3BA 2MO0A 1L1OA 4OX9L 4DK3C 3CCVA 4DV5Q 4JBMA 4JI4Q 4X65Q 4B3RQ 5IT9c 5JJKA 1SN8A 1VQCA 4GLVB 1E22A 4LW1A 1PH8A 1Z9FA 3Q8DA 3U50C 1SRUA 4P75A 1KRSA 3CCSA 2K50A 1LUZA 2JJQA 4GOPC 2F3IA 4A3MG 1PHJA 2JA6G 1XTDA 5FJ8H 1PH7A 1IZ6A 4GKKL 4NXML 1BKBA 4KHPL 5JJLA 5C3EG 2JA7G 2NVXH 2CWAA 3HOWG 5E7NA 4GKKQ 1VQEA 1I94L 4KHPQ 4NXMQ 3FP9A 1A62A 4EQ5A 2N8NA 1IYJB 2CQOA 1I94Q 3KF8B 1VQ5A 3H3VH 1N32L 5JEAG 2VQEQ 4GNXA 3ICEA 3TS2A 1NMFA 2LXKA 4OONA 1QZGA 1HH2P 4QIWE 4AYBE 4B3TQ 3CD6A 1N32Q 1V9PA 2Q2IA 3I4NH 1VQNA 1A63A 1U5KA 4IO9A 4O2DA 1OXUA 3NENA 2YV5A 4L5RC 2I5HA 2JQOA 3UE0A 3HOYH 4C2MH 4HJ5A 1KXLA 1PH4A 2E5LQ 2B63H 1PYBA 2NN6G 4DUYQ 4LF6L 1VQ6A 2PNHA 3BJUA 4GLAC 3A0JA 4IJHA 1U0LA 4MZ9A 4JV5L 4LUZA 4LF6Q 3PUXA 3S15H 1C7YA 3RLFA 1N9WA 5M3MG 2A1AA 1I5FA 1JE5A 1VQPA 2Z6KC 3CCUA 2JA8H 2VUMG 1K0RA 2N78A 4DR6L 2ALYB 2BA0A 3W5OA 2ID0A 3T1YQ 4BXXH 4JOIC 4BBSH 1LM0A 3S16H 1GM5A 2NVYH 1K3RA 3PIPA 4QQBX 2GN5A 4IFDI 2I5LX 4A3FH 4JC0A 3GDEA 1J6QA 1GKHA 3STBC 4DK6C 5GADC 3JAMi 3OTOL 3G4SA 2R7ZG 2R92G 4IJLA 2UUBL 1PV4A 4OO1I 2MFIA 3UDFA 4GN3B 4P71A 1E1TA 1QVCA 3L7ZC 1E24A 1MKHA 1DGSA 1VQHA 3H0GH 3LGJA 3GD7A 2KCTA 5IP7G 3KJOA 4EX5A 1Y1VG 2ZM6L 5IYBG 1XMQL 3PO3H 3IRBA 3PO2H 3KDFA 4C3IH 1XPRA 3UDGA 1J5EL 4DAMA 4ALPA 4GOPA 2HIXA 1PH5A 3TRZA 1VQKA 2YTVA 3K0XA 3HOUG 1B70B 4BY7H 1KIXA 2YTYA
chains in the Genus database with same CATH superfamily
2PNRC 3URYA 4HIOA 1IL8A 1XMOL 4TQUS 4A3BB 2WIIB 3TP6A 4KN4C 5EPJA 4LF5L 2A68D 3BG3A 3I4LA 2QCPX 4JI8Q 4ID6A 2RCFA 1PH1A 4IOCA 1WVLA 1I6HH 3HG9A 4NP5A 4N8X1 2A69D 4YWLA 3UDIA 3LWUA 3R2TA 3DM1A 1TWGH 2CW0D 3FHWA 4J15A 3RN2A 2QDBA 1R9TB 5CR3A 1CKOA 3O13A 3AMUA 2RHSB 4BXXH 4AH6A 2WB1E 4L8JA 3S1NB 3KLRA 5FJ8G 1M1KC 1TWHH 3K8AA 3P20A 3PSIA 3KFUA 3D31A 4XQQA 4A3JH 1ILQA 1HR0W 2UXCQ 3TQYA 4XQJA 5KGUA 4R8IA 2A6ED 2R92B 2N49A 2K32A 3KF6A 5IGDA 1LTAD 4OL7A 2PZTA 4RHRA 3GTQB 1GUWA 1Z47A 3DEPA 3QOJA 4OX9Q 1AZPA 3TREA 2MPMA 4DV7L 4KHVA 4DK0A 2CFMA 2R6GA 4QIWB 1WCMH 4DAYB 4RHSA 1A6XA 4K6LA 3CQZB 4ZRZA 4K5XA 4PMCA 4F87A 1N34Q 3L2PA 4HJAA 2ZJRA 1JORA 3S1MH 1E3PA 1Q12A 1DD2A 4DXFA 5J39A 4H02A 5K36H 3D6WA 4BBRG 3Q6SA 3W1BA 2WB1G 3G6EA 3S14H 4A3DH 4JI2L 4JBKA 2K75A 4A3GB 1WYDA 4JI0L 3I7FA 2V1CC 3N52A 4JVZA 4C3HH 3I56A 5M5YH 2XSCA 1STNA 3EBEA 2KHIA 4YWKA 2E2HH 4NXNL 4Q0FA 2RBMA 1STGA 4B3ML 2QF7A 1G8ZD 2AMCB 2NZHA 5FLXc 5C3WA 4R9WA 4QY7A 3S17H 1A0IA 3BZKA 4A93B 2FINB 2UXBL 2Z4HA 1BUVT 4F8MA 1B3AA 1U4LA 2IW3A 1SYGA 3CRKC 1EOVA 3UE1A 1V1PA 1N33Q 1K83H 3OTOQ 1FD7D 4A3IG 1A2TA 2JK8A 1SYDA 2K04A 1EYGA 3MC0B 4J1MA 5KEEA 5EGTA 5HURA 4PNYA 4IFDG 1HNZL 2UUCL 4H0LC 4AYBG 2RA4A 1M8AA 4UY8C 5I9PA 1XMQQ 3PF4A 1RIPA 4K0KL 1CSQA 4YHHL 1EIYB 1O7ZA 5BN5A 2F0JA 3H15A 1S5DD 1ESFA 5C44G 2ICIA 3M4PA 3QIAA 2F0NA 1S3OA 3IKJA 5ELDA 3MFGA 1D1IA 1RKNA 2LY7A 5IGFA 2MO1A 2WAQB 2GVAA 1FJGL 4GLXA 4ZCKA 1SMYC 2HIVA 2AHOB 3NBHB 4I7AA 1EQRA 5A35A 1IBKQ 1MIUA 2B2WA 4DR5L 1JE4A 1PXUA 5ELCA 3S1RB 3GV6A 4ZK9B 1TWFH 5M5XH 1H9SA 1YEZA 4JI6L 2F0HA 5CYUA 4UP7A 1B9NA 5I4DA 3MEHA 2DNCA 2F0WA 4G7ZC 2FXQA 1IKMA 4HR7B 1HR0L 1AE2A 4IUUA 1VQDA 4OEMB 4GNXB 3TN2A 2Z0SA 3HOZH 2E2JH 1GO3E 3NSWA 3U58A 2WKCA 4DK1A 3MEFA 4DR1Q 1HNXL 1MGSA 2Z8LA 4X3KA 1QNUA 4PQXA 5EPKA 1Y1VB 4K14A 1PFMA 4FDBA 4KY6A 3HOYG 2UUAL 5CV7A 1MJCA 4S3SA 3DHQA 1I4GA 2CKZB 3GQBA 3J81E 1NE3A 4XT3B 3HOVB 3GTMH 4EVOA 4O42A 1OXTA 1EWIA 3J80E 2HD3A 1PRTF 4JI7Q 3Q23A 1B53A 1CFMA 1UE5A 2OQKA 4QL5A 2BCOA 1PTOF 3PUWA 4JI3L 5LMUQ 1YNNC 1EY5A 1ZEQX 1F9SA 2ICEC 2KECA 2K33A 4KK7A 1YNJC 4RGNA 4B3TL 1V1OA 2IWHA 4F7XA 2NVQH 1A15A 3RLNA 2YU9H 4ZKBB 3C3LA 4RA8A 5JAVA 4A3BG 1MSHA 4GOPB 4PZ6A 4BY7G 1F9RA 4MN3A 1SYBA 5IGCA 2KEDA 3LWEA 4Y7NH 2BE5C 1OTCA 1D2BA 2SEBD 3I8ZA 1LLRD 5CGKA 4CGYB 1HRJA 3DM3A 2VB3X 5C3EH 1S72A 1J8IA 3QO2A 4PZ8A 4DUZL 4NPSA 1IBML 4X6AH 4ME3A 2OCEA 2JE6I 3WOEA 1R4QB 4GKJQ 4RCNA 3EJIA 2EXDA 1A3UA 4DV3Q 1AZQA 1SE4A 3MFYA 4FXKC 3OW7A 4OXPA 3AQQA 4K5WA 5GQOA 2PZWA 2F52A 4A3EH 1Q8KA 4A3FB 2KEEA 1C0AA 4B3SL 2UXDL 4LF4Q 4MTKA 4XYOA 4HCEA 1YHBA 4C3JH 4CDDC 3CXCA 1E0BA 4FF1A 3G6JB 1PZJD 1RL2A 3H0GB 1EQQA 2H4OA 2PMZE 2R3ZA 2D0OA 5COYA 1VQ7A 1VQAA 1DJRD 2VZAA 4R4QA 2D62A 4C3IB 2F0DA 4L5SA 1MSGA 2ASBA 4DR7L 2K03A 3DXJC 2B2VA 4O0AA 2WKDA 2HHHL 3NTIA 4HTHA 5IP7H 2VXWA 5FLXE 1EIGA 3H3VI 1CHPD 1SBBB 2NZ1D 1I6HB 3L9AX 4TKOB 4DN4M 3A5UA 1TWGB 2Q2TA 4IZ8A 3BYYB 5DM63 1B9MA 4ODGA 1BCPF 5G3LF 3EROA 1XWEA 2AKWB 3E3XA 4DF7A 3D0FA 2KJXA 2CVRA 2Y0SG 4A93G 1TWHB 3S2HH 3OYYA 2UU9Q 1DOKA 2MO0A 4JW0A 3L3OC 4A3JB 1G6ZA 5JJKA 1F9PA 4GLVB 1PYWD 3MXNA 3Q8DA 4P75A 1CK1A 1KRSA 2EXZA 2HDLA 4KHPL 2BOSA 5JJLA 2B2YA 2JA7G 1G2SA 1CI3M 3K6OA 1I94L 4CKBA 1TKWB 2N8NA 2DJGC 2Z4IA 1WCMB 3H3VH 3TP7A 3VR6A 4GNXA 1VDZA 3ICEA 2A73B 1NMFA 2HCIA 1QZGA 3NTHA 1HH2P 1DCZA 3OMGA 3VA5A 1N32Q 2B2TA 1SEBD 1U5KA 3BVGA 4CDFC 3S1MB 1W6JA 4DXGA 2YV5A 1KABA 3R3OA 3LNNA 2E5LQ 2B63H 3E6ZX 1PYBA 2NN6G 4DUYQ 3BJUA 1E2WA 3S14B 1U0LA 3NWSA 4A3DB 4LUZA 4MHEA 1LTGD 3HZXA 1I5FA 2VUMG 2JA8H 2Z6KC 1WD0A 1T5XD 4ZLTF 3J81L 4C3HB 3W5OA 5M5YB 4JOIC 4BBSH 1LM0A 2E2HB 2P5ZX 3S16H 1GM5A 1JCKB 1J6QA 2K05A 3J80L 1PMRA 2R7ZG 3JAMi 3S17B 2UUBL 1EYDA 2F0SA 5IODA 1TQOA 1E1TA 1UAPA 5E4WC 4X3SA 3LGJA 1TU2B 2KCTA 1DXMA 1SNCA 1Y1VG 1PFBA 2OXPA 4KD3A 3PO3H 3PO2H 3KDFA 4DGZA 1O7LA 1TS4A 5I6YA 1K83B 4DAMA 1NR4A 4GOPA 1PH5A 1I4QA 1O7YA 3K5MA 4PMBA 2XGTA 5D3IB 1SMXA 1QB5D 1SE8A 5DNFA 2JA5H 5BR8L 4EGVA 1SLJA 3FVQA 3VA7A 1Q7YC 1XMOQ 4FP5D 2M00A 4DV0L 2K14A 2K5QA 1ZYRC 2DNEA 5C0XG 1LACA 1LT5D 3F2DA 2J4XA 1HHVA 4HMIA 1RJTA 1EL0A 3ERSX 3HOXG 1HA6A 5CMDA 2EYLA 5IY0A 2NVTH 1Q82C 1AH9A 2X6GA 2E2DC 1JWUD 1CHQD 4TVAB 3QJYA 3NUCA 2EYJA 2LKVA 1QVFA 3DUZA 2RF4A 1Y14B 1SAPA 1NAPA 1U4RA 1FNUA 1UE1A 1Y1WH 3A8KE 4YCUA 1D6EC 1TWFB 5M5XB 5I2YA 1L0WA 1F9QA 3TDQA 2D5DA 3P1HA 5JOBA 1Z6HA 1SYFA 2L5TA 1B1ZA 1GD7A 5M5WH 4HMJA 2ZXPA 2CQAA 3RZDH 3C1FA 1BVSA 1SE2A 1G2TA 1XJVA 1ESRA 3HOZB 2E2JB 4DV7Q 4NDXA 2R93G 3GTLH 1WTOA 5M3FH 1WFQA 3M4OH 1FVIA 1EWCA 4ILWA 3U4VA 5KYIA 1GHJA 1R4PB 1TVXA 4IURA 2M2LA 5FLMH 3GTMB 4HSPA 4V0BA 4I65A 2RHQB 3OHXC 1K8MA 2JEBI 1TWCH 3HGBA 3I4MH 3W2DA 2F3WA 2QGQA 1SR3A 3E0EA 4JI2Q 2EY2A 1P8LA 3CU7A 1W3SA 1I4RA 4EQPA 3K7AH 4QUFA 4JI0Q 4PG3A 1G6PA 2Z1CA 3K81C 2F03A 4JV5Q 4NXNQ 5NUCA 5I9OA 4BY1H 2VQFL 1DZ1A 2F0LA 4POGA 4DR6Q 2NVQB 2OTJA 2YU9B 4TSSA 2ES2A 1IYUA 2LFNA 3W1GA 4A3MH 2UXBQ 3FKIH 5TSSA 3X3NA 4DNIA 1EQTA 5ELEA 3J81c 4ZKCB 4Y7NB 3V96A 1VF5C 2D0PA 1PH3A 5LL6X 4H44C 4DR3L 4OELB 5C3EB 3J80c 1Q46A 3I73A 1HNWL 2ZM6Q 4BXXG 2FHTA 3TEHB 5H1SE 2D9UA 3NXWA 4K0KQ 1LTLA 4YHHQ 3C1EA 2BDNA 4A3JG 1IBLQ 1TS2A 2F0MA 1K3BC 5EBCA 4B9WA 4C1NI 4N9TA 1N8RC 4P72A 4Z9CB 1FGBD 5D3DA 5C4ZA 2H1EA 1KNEA 1DM0B 1SYEA 2JN4A 4IPGA 4O1NA 3CAMA 1SE3A 3D4RA 4A3EB 1U9RA 1FJGQ 2IX3A 2SDFA 4LMQD 1JC7A 1EY8A 3ND9A 1K8GA 5ISRA 2KCNA 2EIFA 5LHY1 1FYCA 4C3JB 1WCMG 3JC66 4DR5Q 1X55A 2L12A 4UPAA 4QF4A 1X3FA 3GTGH 5KIXA 2DGYA 3STBD 4JI1Q 4LWCA 4YWMA 1FGUA 2QDLA 2A74C 3CPFA 1HR0Q 3OPOA 1YI2A 1VS0A 3AEVA 1VQIA 1XNQL 1Z7TA 1B3QA 5EKKA 1X9NA 5K36G 5A2QL 3HOUH 1PVOA 5C4XH 1C9OA 3F2BA 2ZXRA 5IT9L 1HNXQ 4JYAQ 2JA9A 2OF1A 1WTQA 1CM9A 2UUAQ 1YITA 4KJOA 4ZUJA 4DV5L 4X65L 4LF7L 4IFDJ 2QW7A 4DA2A 3CF5A 1K73C 4DV1L 1Q86C 3S2HB 4RCOA 1EIHA 2XTIA 2L11A 3H91A 2VW9A 5I6WA 2NTTA 4I7ZC 2WV6D 4JI3Q 2QEJC 5IGBA 3HRZC 4X3TA 3EIVA 1NCVA 1X3PA 4N8FA 1YHAA 1NNXA 2OWOA 4FYDA 1V8QA 3PUYA 2R61A 1WTXA 4DAVA 1GUGA 3BZDB 3CHBD 4IPCA 3BDCA 2RDFA 3VDYA 1QVGA 1KRTA 3SGIA 3RZOH 2F0VA 1UE7A 2QILA 5IYDG 3F2CA 1XPOA 4P74A 4DFAA 4BS9A 3KYHC 2XRSD 1T9HA 2MQHA 4R4OA 4A4IA 1EY4A 4LFBL 4JI5L 1RCVD 4E6IA 3T1YL 2B63B 1BBUA 5J22A 5D65A 4DUZQ 1IBMQ 4PZ7A 4RG1A 2IX1A 3M3YB 2JA8B 2RSNA 3NK9A 1CUKA 3J7ZC 2K5NA 4BBRH 4OWTB 1VQOA 3BZCA 3NBIA 4ABNA 1MBYA 1CA5A 3VR3A 4U673 4BBSB 3S16B 3ONAB 1DOLA 5AJ3Q 2Z6BA 1IYVA 1SFOH 2G9HD 4Y52H 5KRUA 1K28A 3EN2A 4K5VA 5M3MH 2EDGA 3W3AA 4B3SQ 3HOZG 1EEFD 1U4MA 3CP0A 2O2LD 2UXDQ 4ULLA 1B8AA 5KNDA 3I2ZA 2K5WA 4XYQA 2FJ2A 3NQIA 3E9IA 3K7UC 4FO2A 3PO3B 5IYCG 4AQYL 3PO2B 3J7YW 1I4HA 4JI8L 1TY2A 1UE6A 1VQFA 3MTSA 4K6DA 4DR7Q 1J9OA 1CQFA 1HQMC 3IL8A 2JA5B 4A3IH 4A3KG 2A6HC 3BU2A 4C56C 2ZJQA 2IHFA 2HDMA 4XXEA 3BDOA 4NKLA 5IYBH 3F1ZA 2HHHQ 3BS1A 4IFDH 1A2UA 4IPDA 5EKLA 1D1KA 5HGQA 2EOTA 3M7NA 1G91A 2MJ8A 4KKUA 4GN4B 3S9WA 5JVG3 1N36L 1G291 4C1NK 1NJIC 1HZCA 4X66L 5C44H 3C2PA 2F0UA 2NVTB 2KCCA 2NYZD 1ZKOA 3G7LA 2YTXA 1QILA 3U9SA 4B3RL 4OX9L 4DK3C 5EKIA 4JBMA 2PZUA 1STEA 5IT9c 3DWPA 1Y1WB 2XN9C 2I46A 1RTOA 1SN8A 3C46A 3N6RA 1SMYD 2FMMA 4QB4A 5BN4A 5DEHA 5FO8B 2JJQA 1IW7C 2JA6G 1XTDA 4NXML 1FNWA 5M5WB 5C3EG 2NVXH 2CWAA 3OWEB 3RZDB 1B50A 1SSOA 1VQEA 4KHPQ 2EYPA 1XX8A 1IYJB 1I94Q 3GTLB 4CJ2C 1VQ5A 2VQEQ 3TMEA 5M3FB 4J8QA 2B39A 1H9MA 3TS2A 4QIWE 3I4NH 3M4OB 1I4PA 3SXHA 4IO9A 2I5HA 2B8GA 1BXTA 3HOYH 4RGOS 2C9OA 1WTRA 1PH4A 4DAYA 1VQ6A 4IJHA 2EVBA 1TWCB 1HFNA 3I4MB 1C7YA 2ENBA 1JE5A 3PIO3 2EZVA 4C3JG 1MHWC 1K0RA 4OGQC 3ERQA 3K7AB 4RKBA 4QQBX 1HXYD 2I5LX 4JC0A 3BYTB 5F2DA 1PFNA 1GKHA 5E1FA 3OTOL 3G4SA 4BY1B 2EJGC 2R92G 1EY7A 1PV4A 4OO1I 4GZYC 5C3XA 3T13A 4GN3B 1YNND 1DGSA 4IN3A 4A3MB 5IP7G 3IAYA 3FKIB 4EX5A 1XMQL 1F2MA 3IRBA 4HEDA 3Q24A 4H7BA 1XPRA 3UDGA 1WTPA 3TRZA 2L1BA 1VQKA 1LTSD 2YTVA 4BY7H 3FPPA 1KIXA 2F3VA 2ZTEA 2A8VA 3BVZA 4CJ1B 1ASZA 3P7JA 3PGZA 4GN5A 2KENA 5BR8Q 2BE5D 4LFAL 1OXSC 1GVPA 3M4QA 2MNAA 1SDFA 3P75A 4H13C 2L4NA 1Q1BA 4A3GG 1Q81C 3TBIB 5LMNL 1JJGA 5KYLA 2EQSA 2WAQE 5IGEA 2SNMA 1CTMA 4OO1H 3JAML 2KBNA 2Z6KA 4RGTA 2O5JC 1CKMA 1EFWA 1DOMA 4LF9Q 3QR8A 5JPNC 4R4CA 4JOIA 3D6CA 1PRTC 4LUOA 2LMCB 2XRQD 1KD1C 3R8BA 3GTGB 5CBEE 4DR1L 3NE5B 1X32A 1PTOC 1YVCA 3NBHA 3E9HA 3HFZB 1B4OA 5IOCA 1CT1D 1QE6A 1PTOH 1VQBA 3F8TA 1D5MC 2CWPA 3DWQA 1WTVA 2K28A 4OIKA 3HOUB 2CHBD 5C4XB 3K0YA 1X54A 1VQ4A 4CDCC 1LYLA 3TP5A 3LX0A 2JA8G 3MHBA 4OWWB 3T1HL 1EY6A 2F0PA 3QWNA 1UNSA 4KMUC 1PZID 3MXGA 2ATWA 5C4HA 1D5ZC 2E74C 5LMUL 4DR2L 1MD2D 4LUVA 4ZYSA 3K58A 1XNRL 1SROA 2WAQG 5AFWA 2JEAI 3GTKH 2ZJPA 4IUQA 2AUJD 2F0TA 4ZUIA 3ER0A 4DAPA 5CBAE 3M3YH 4KKSA 3SVMA 4A3LH 2B2VC 4HJ7A 4RFBA 2QA4A 2K4KA 3SDZA 1FL0A 3IFDA 1EUJA 4MNOA 1D5XC 2TSSA 3R2IA 2PCFB 2SNSA 4IUVA 5IP9G 1PH9A 4LF8L 2NTSA 4QJFA 2VNUD 1ONLA 4CKCA 2J0TD 3M9BA 3KOJA 2JA7H 4WJWA 3RZOB 4DV2L 3KBGA 5A2QE 2XNAC 1JOQA 1D7QA 2I5MX 3PIOA 4DV3L 1JB7A 1VQLA 5IWAL 4IQZA 3J81j 3GP7A 4DR3Q 5IT9E 2I0QA 4G7OC 1QNKA 1YNXA 3GO5A 1HFGA 1J5EQ 1A3VA 1HNWQ 2L15A 5KNBA 3HOVG 5JVH3 5JJIA 2EYOA 4IUNA 3A54A 3OIQA 1GJXA 4R8NA 1EZ6A 1YZ6A 4DR4L 5CV9A 4BBRB 1JOKA 3NELA 2NBFA 4LF5Q 1LTID 3B6YA 5JEAJ 1S5BD 2VUMH 3CC2A 4WJ4A 3KF6B 3K5NA 2JXMB 4IOAA 1SFOB 1KHIA 4NW2A 1VQ8A 2DUDA 1BCPC 5M3MB 4RMFA 1H95A 1VMPA 2B2TC 2B2UC 4YY3L 3RD4A 2R7ZH 3TS0A 2R7DA 4WJ3M 1OO9B 4KHZA 1I6VC 4TRDA 4FXDA 1Q3LA 2PI2E 2WACA 2F1MA 5ELNA 4X64L 5IIFA 3KLSA 2OQ0A 3CCRA 3JAMc 1Q8IA 2RDHA 4A3IB 1ICFB 2K5HA 1XNQQ 5E3FA 1ASYA 3I4MG 2PI2A 2K5DA 2FFKB 3PQIA 1K8AC 4A3CH 1A8VA 1GUTA 1EYCA 3R93A 4AYBB 3ZYYX 1EQVA 5C5LA 4LFCL 2MHVA 1STYA 5EQ0A 5L37A 3IFTA 5C0XH 2F4VL 1RD9D 1VCIA 1IL2A 5C44B 1ZYRD 1JQYD 3J81i 3NHHA 1XPUA 4LF7Q 4BY1G 2Q8TA 4RGMA 2K1BA 1NY4A 2VY3A 4YIJA 3HOXH 4DV4L 2LXJA 2QEXA 2EJMA 2KVMA 1LV9A 3CCQA 4A3FG 3GTJH 2WINB 2QKIC 2I07B 3J80i 4DV1Q 1UEAB 3FKIG 1AW7A 5GAGC 5C4JH 1JJ2A 1K8OA 2VL6A 2GA4B 5EAYA 1EEID 4M1UB 5FO7B 4HAEA 1F77A 1HQRD 4U68A 3H0GG 1EFID 1PH6A 1WJJA 2NVXB 5T1GA 4IALA 1O7IA 4C3IG 2KHJA 3J7AF 2JYOA 1KC8C 1M4VA 4B3MQ 4OIJA 1TY0A 1MI2A 2A68C 2E5LL 4FF3A 4PV1C 4DUYL 3SK4A 3X3MA 3OW2A 5CC4A 4HIKA 3D4DA 3I4NB 2R93H 2A69C 2CW0C 1H9KA 1CZGA 2BA1A 3HOWH 2CH4A 2G9DA 4A75A 5CORA 1TT2A 3HOYB 1HZ9A 1QJOA 1TS3A 5EPLA 2IJ0A 5K5PA 3TZUA 1W6KA 4OHJA 4HN7A 4LFBQ 1SNPA 1YJWA 4JI5Q 5JEAH 1LT6D 2F0GA 4K2KA 2VS1A 4KTAA 4CJ0B 5FKAC 2IY5B 1VQ9A 1HUNA 3VYTA 1L1OC 1HNZQ 1SXTA 2UUCQ 1YJNA 4X62L 1LO5D 1B44D 3E0JA 1H9SB 3NPPA 3A7LA 4CBVA 2A6EC 5FO9B 5CV6A 2L0CA 3NP8A 3RMHA 2AWNA 3ND8A 3OOCA 1QOHA 2ZT9C 3CCJA 3EA6A 2MUYA 1KTKA 1NUCA 1S5CD 1X3QA 3GTPH 1RHPA 2RKSA 5BN3A 2DY8A 3VYUA 3AYHB 4G7HC 3SR1A 2A19A 3J7AV 4L5QA 2KCMA 1KLUD 2IT1A 4CKEA 1KDBA 2E2IH 2H5XA 2PQAB 4FVMA 3BDLA 2CH4W 4AQYQ 4BY7B 4A76A 1H9RA 4IUTA 5EBDA 4JI6Q 2PYKA 1W2BA 1E7ZA 3SK8A 3NWTA 1L2FA 2HQEA 2NZOA 4DV6L 4A3DG 4HIMA 3RNUA 2LSSA 2F0QA 1HZBA 4UDUC 1NBWA 1IKLA 1N36Q 1EU4A 4C3HG 1QUQB 2PW5A 3ULJA 4X66Q 3K5LA 1LTBD 4L5TA 3PUZA 4JI4L 2EYFA 3T51B 5C5MA 1O80A 3SEBA 4B3RQ 4DU9A 1EOTA 3AU7A 1VQCA 4LW1A 4RWSC 1E22A 1PH8A 1T5EA 3WOFA 1SRUA 3CCSA 1LUZA 2F3IA 3E5SA 4GKKL 2EY5A 5FJ8H 1IZ6A 1PRTB 1PH7A 1BKBA 1ZXTA 4UAIA 1WTWA 4NXMQ 2PW7A 1PTOB 1ET9A 2CQOA 3KF8B 2PPBC 4OONA 4AYBE 4B3TQ 3M7GA 2EYMA 2Q2IA 1VQNA 4X3UA 1BO0A 1OXUA 5M9OA 3NENA 3UE0A 2JQOA 1ENAA 3ITPA 4HJ5A 3RUZA 4LF6L 2RQXA 1JR0D 3I91A 4GLAC 4MZ9A 1BOSA 4JV5L 3D8GA 3S15H 3GTKB 2DY7A 5M3MG 1N9WA 1AEXA 1LTRD 3CKIB 1JOOA 3CCUA 3NTKA 4RAUC 2N78A 4DR6L 3A7AB 1SYCA 2O4XA 4WFN3 4WRDA 3JAME 1EYAA 2Y0SB 2NVYH 5FK9C 3T53B 4IFDI 1XYIA 3GDEA 1ML0D 1NR2A 4DK6C 5GADC 1WTHA 5CV5A 5C6AA 2PMZB 3UDFA 3L7ZC 1MKHA 1VQHA 3GD7A 2ZM6L 5IYBG 1AN8A 3Q0AA 2JA7B 4ALPA 3K0XA 2K7VA 1YHQA 1IBLL 4LK1C 5IYDH 2MP1A 4EQOA 3WDNA 1M90C 5ELBA 3BVMA 4P2CB 3NEMA 3I3CA 1X56A 3G48A 3G71A 1C4QA 4LFAQ 3T56B 2NB0A 4LNQA 1AE3A 4B9XA 1V1QA 4R4IA 5LMNW 1STAA 2G5DA 1GOZA 3MXNB 2IHEA 2VUMB 2WP8J 1S40A 2GVBA 5LMNQ 1ILPA 1VQJA 2UXCL 4JI1L 1LT3D 4P73A 4KY5A 1HTPA 5J1ZA 2R7ZB 1CSPA 1BCPB 1TWAH 4RH6A 1EY0A 3A8JE 4IUPA 3I4NG 3KLSX 1HJPA 2HT1A 3FEWX 3A8IE 1WD1A 4JYAL 4DNTB 5DAUA 1F2ZA 1B7YB 1X65A 1VQGA 5IYCH 2DN8A 3WWVA 1EIFA 2PQAA 3M4YA 3PV0A 3FDTA 4QGUA 3HKZB 3D4WA 2Q2HA 1N34L 4DKAC 1E2ZA 3CMEA 4MIUA 4XQNA 1STBA 3GTOH 3A5ZB 4L6TB 1I50H 4G4KA 3S1QH 5GROA 4FXGC 3S24A 4A3KH 3MXPA 3VR5A 2B3GA 1DONA 3M85A 4YCWA 3A74A 3KUPA 2Z9HA 3T1HQ 5CV4A 4QCLA 2A6HD 3OMCA 2K01A 1IXRA 3DEOA 1PYSB 4DR2Q 1XNRQ 3S2DH 4ZAIA 1YIJA 2F0OA 1WI5A 2ZTDA 3HOXB 1E2VA 3AB9A 2TMPA 2B8FA 4JBJA 2B2WC 2Q2UA 2XWBB 1I4XA 2AUKA 4A3EG 1QUQA 3GTJB 1Y69U 3ULPA 1BQQT 1HZAA 3VYRA 3MVVA 5C4JB 2EYHA 3MWYW 2OT2A 3KDFB 3U4ZA 1CKNB 2HCCA 1JB3A 3SHLA 1X6OA 1YJ9A 1OXVA 2E8GA 2RSOA 3CC7A 1HPCA 3KLWA 3T16A 4FF4A 3CPWA 1BBXC 3J7A5 4XIGS 5GAEC 1I3QH 1N33L 1G51A 2JA6H 2NUCA 3KBXA 4PMWA 2EY1A 4LF8Q 2YYZA 3CMAA 2CCZA 2OTLA 1IW7D 1MJEA 4C2MB 2UUBQ 4K8IA 1EU3A 3KF8A 1UEBA 2R93B 2KHSA 1KDAA 4DV2Q 1A3TA 4JK1C 4QUCA 1GUOA 4GS3A 4L63B 4A3BH 3CW2C 3HOWB 1YNJD 1XXGA 3RLOA 2EE1A 5IWAQ 2K52A 1YBYA 3HS0C 2N55A 2KQ3A 3KJPA 4OO1G 1L0XB 5AJ3L 1K9MC 4BA1I 1UWVA 4DNRB 2R7FA 1LTTD 1QG7A 4R4TA 1TXYA 4APVA 4M8AA 3EFXD 2JP1A 2Y0SE 4XT1B 1R9TH 4DR4Q 2AQ3B 3VYSA 4DV0Q 4UP8A 2MGSA 1KAWA 4LAAA 1IBKL 3S1NH 1L1OB 2RCNA 5CV8A 1KQSA 4NMZA 1X3EA 2N88A 2X69A 3I4OA 2IX0A 4KJNA 1HCZA 1H9JA 1E1OA 4KKTA 1JJCB 3GTPB 1FNVA 1NSNS 3T4AC 2EY6A 3HKSA 4JBWA 1KAAA 1KLGD 4G57A 4YCVA 4YY3Q 1JWSD 1SNOA 2R92H 3PCOB 4LJZC 4HJ9A 1NTGA 3PUVA 2C5CA 1TIID 2F0KA 3I55A 3GTQH 2KOLA 3D3RA 2E2IB 2E75C 1X3GA 1OXXK 3EQLC 3OWFA 2C35B 4DPGA 1VQMA 5E4XA 3FMCA 1BNZA 4X64Q 2Q8RE 4EQNA 2V4DA 2SOBA 3CQZH 2F0IA 2F4IA 2X6LA 4RKLA 4OWXB 1AFPA 3UDXA 4Q5VA 3RN5A 1PZKD 2B63G 3FPUB 5EJWA 2AQ2B 2HQLA 1S5ED 1C48A 3HEJA 2N3SA 3MA2B 4AIMA 3TZDA 2XIWA 4LFCQ 1SNQA 4A3LG 3CC4A 3A56A 4JI7L 1AP0A 3V2TA 1SJHD 3ULLA 2F4VQ 1JT8A 1II3A 4POFA 2RDGA 4BBSG 2WFWA 3CCLA 4A3GH 2L9HA 2ZXOA 4IPHA 4DV4Q 2A5HA 2F0FA 1C8CA 1O78A 2EJFC 4NB3A 1KL9A 3I70A 3K80C 5IE8A 3H3VC 2IPKD 2BDOA 1GUNA 4KY7A 5DM73 5C0XJ 2VQEL 1QZHA 3H6MA 1PLFA 4XTCS 1KDCA 2NN6I 2BH2A 1P16A 4A93H 3PO3G 1ET6A 3PO2G 4KD4A 2B2UA 3HKZE 1EZ8A 1Y8PB 1PRTD 3TSSA 3PIP3 5FOBB 1IHZA 3H94A 4MTNA 4JG2A 5JJZA 3CCEA 1PTOD 5I2XA 2HUGA 5DLQE 1CQVA 1SNDA 1Y8OB 2VQFQ 2JA5G 4XDXA 3MZ5A 2M9VA 5GAHC 4UHVA 1F2YA 1VMCA 2BH8A 3SK5A 1EY9A 4J6HA 3RR5A 2K5VA 4R1JA 2AWOA 1NMGA 3AFQA 4GKJL 2PO4A 1S4ZA 5T1IA 5ELOA 3S15B 1SNMA 3AFPA 3KK7A 1JMCA 1GXDC 4KV6A 3Q22A 1D8LA 3QG1A 2ZTCA 3A55A 5LL6S 1GHKA 2NVYB 4X62Q 2NN6H 1Y1WG 4LF4L 4BA2I 2WB1B 1BBWA 1PFSA 4ZQ3A 2EPBA 2B2YC 4QMGA 1RTNA 3S1RH 5C0XI 2AQ1B 1CKNA 1K0SA 3ZJYC 3HKZG 4JPBW 3SE0A 4N9PA 3F2UA 4GNXC 1Q1EA 5IP9H 2KUMA 4A3CG 3QB3A 1LABA 3H09A 3DLLA 4HJ8A 5M3FG 3I72A 1PH2A 4BWGB 1RDPD 3V05A 1VF7A 2FMCA 5JPMC 4KI0A 4HIDA 1PA6A 1TS5A 1Y1VH 3I90A 5FLMG 2B29A 3PF5A 1V43A 3L0OA 4HCSA 1CZWA 1BR9A 3NQTA 3UI2A 4V190 5KNCA 2LS01 1XTCD 3DWAA 3HOVH 1Y8NB 1LT4D 4JCVE 2VB2X 1HTLD 5HY6A 3TP8A 3VR2A 4LF9L 4DV6Q 2XVSA 4UP9A 3CCMA 2OEOA 1UUPA 2UU9L 1WOCA 1TR5A 2K6AA 4KLKA 1JWMD 5J3BA 1RODA 1L1OA 3CCVA 4DV5Q 4JI4Q 4X65Q 4WORA 2DJFC 1EWHA 1QWYA 3K59A 4K8JA 1Z9FA 1TWAB 2XWJB 3U50C 2K50A 4GOPC 4A3MG 1PHJA 5HGTA 5G3LD 1BCPD 3MAQA 2KA7A 3PMFA 5IGGA 1ENCA 3HOWG 5E7NA 1CA6A 1Q90A 1V1PB 4GKKQ 3FRPB 4F88A 3FP9A 1A62A 4ME5A 4K2LA 4EQ5A 4KN7C 1FR3A 2D2CC 1ICWA 1N32L 2PQEA 5JEAG 3VR4A 2LXKA 3CD6A 3HP3A 3MXUA 1V9PA 2F0EA 3OSOA 5D14A 3GTOB 1I50B 3S1QB 1A63A 4A3KB 3CRLC 4O2DA 4L5RC 5FLXL 3K57A 1PDQA 3U9OA 4C2MH 1KXLA 1DYQA 1BF4A 3SK6A 2PNHA 1F2LA 1GUSA 3A0JA 2IL8A 1JICA 4LF6Q 3PUXA 3S2DB 4CHTB 3GV3A 2Q8IB 3RLFA 2A1AA 1HA5A 4CDEC 2JSOA 2RVLA 1VQPA 1L0YB 2J7ZA 4HSVA 2ALYB 1QCBD 1S5FD 2BA0A 1U4PA 2ID0A 3EVQA 3T1YQ 4B08A 1ENFA 1K3RA 3PIPA 5ELFA 2E76C 3K5OA 2GN5A 4A3FH 2L55A 1HUMA 2O5IC 3STBC 3QOLA 4FNFA 4FF2A 3OIPA 4IJLA 3DMUA 2MFIA 1BDOA 1B2TA 4P71A 1QVCA 1E24A 3H0GH 1I3QB 2JA6B 3KJOA 1KNAA 1STHA 4C3IH 1RF2D 1J5EL 2HIXA 2NWGA 3HOUG 5C4XG 1B70B 1SJED 2YTYA
chains in the Genus database with same CATH topology
2ZTEA 1YHQA 2XGTA 4HIOA 1IBLL 2A8VA 1XMOL 4TQUS 5IYDH 1SMXA 1SE8A 2JA5H 1M90C 5BR8L 1ASZA 3PGZA 1SLJA 4LF5L 1Q7YC 4GN5A 1XMOQ 4DV0L 2K14A 3NEMA 2KENA 5BR8Q 4JI8Q 1X56A 1PH1A 4IOCA 1OXSC 3G48A 5C0XG 3G71A 4LFAL 1I6HH 1GVPA 3M4QA 3UDIA 4YWLA 2MNAA 3F2DA 4LFAQ 1TWGH 3FHWA 4J15A 4LNQA 3RN2A 1AE3A 1Q1BA 3ERSX 1V1QA 3HOXG 4A3GG 1CKOA 4R4IA 5LMNW 2RHSB 1Q81C 3MXNB 4AH6A 5IY0A 5LMNL 2IHEA 1Q82C 2WB1E 2WP8J 2NVTH 2EQSA 1JJGA 1AH9A 2WAQE 1S40A 2GVBA 5FJ8G 4TVAB 5LMNQ 1M1KC 1TWHH 3K8AA 1VQJA 2KBNA 2Z6KA 1QVFA 3PSIA 2UXCL 1CKMA 2RF4A 1Y14B 4JI1L 1EFWA 3KFUA 3D31A 4LF9Q 4P73A 1UE1A 4A3JH 1Y1WH 1HR0W 2UXCQ 4YCUA 4R4CA 4JOIA 3TQYA 4LUOA 1CSPA 1L0WA 1TWAH 1KD1C 2N49A 4DR1L 3KF6A 3I4NG 1YVCA 1Z47A 3E9HA 3HFZB 1HJPA 2HT1A 1GD7A 5M5WH 4OX9Q 4JYAL 3TREA 4DV7L 3RZDH 1BVSA 1XJVA 1K73C 2CFMA 1VQBA 1B7YB 1X65A 1VQGA 2R6GA 3F8TA 5IYCH 2CWPA 3WWVA 4DV7Q 1EIFA 2PQAA 1WCMH 3GTLH 2R93G 4DAYB 3PV0A 4QGUA 5M3FH 2Q2HA 1X54A 1N34L 4DKAC 1VQ4A 1LYLA 3CMEA 3GTOH 1WFQA 3A5ZB 2JA8G 1I50H 3M4OH 4OWWB 1N34Q 3S1QH 1FVIA 3L2PA 4HJAA 5GROA 3S24A 2ZJRA 3T1HL 4A3KH 3S1MH 2B3GA 3M85A 4YCWA 3A74A 1E3PA 3U4VA 1Q12A 2ATWA 3T1HQ 5FLMH 5LMUL 4DR2L 4LUVA 4H02A 1XNRL 2RHQB 1SROA 2JEBI 1IXRA 3W1BA 4BBRG 2WB1G 1PYSB 3G6EA 4DR2Q 3S14H 1TWCH 1XNRQ 2WAQG 4JI2L 4JBKA 2K75A 4A3DH 3I4MH 3S2DH 2JEAI 1YIJA 3GTKH 2ZJPA 1WI5A 2QGQA 2ZTDA 1SR3A 3E0EA 4JI2Q 4JBJA 2Q2UA 1P8LA 1WYDA 4A3EG 4JI0L 3I7FA 1QUQA 2V1CC 4C3HH 3I56A 3ULPA 1W3SA 1HZAA 5M5YH 3EBEA 2KHIA 4YWKA 3ER0A 3K7AH 2E2HH 4NXNL 4JI0Q 4PG3A 1G6PA 3K81C 4B3ML 3M3YH 4A3LH 4JV5Q 3KDFB 2AMCB 2NZHA 5FLXc 4HJ7A 4NXNQ 3U4ZA 2QA4A 1CKNB 2K4KA 4BY1H 4QY7A 2VQFL 1FL0A 1A0IA 1EUJA 3S17H 4POGA 4MNOA 1X6OA 3BZKA 4DR6Q 2OTJA 1YJ9A 1OXVA 2UXBL 2E8GA 5IP9G 3CC7A 3KLWA 1PH9A 3CPWA 2ES2A 3W1GA 4LF8L 3J7A5 4XIGS 5GAEC 4A3MH 1I3QH 4QJFA 1N33L 1G51A 3FKIH 2JA6H 2UXBQ 2VNUD 4PMWA 3M9BA 3KOJA 4DNIA 4LF8Q 2JA7H 1EOVA 3UE1A 2YYZA 3J81c 1N33Q 1K83H 3CMAA 3OTOQ 2CCZA 2OTLA 4DV2L 2D0PA 1MJEA 1PH3A 4A3IG 2JK8A 2UUBQ 1UEBA 4DR3L 1EYGA 2I5MX 3PIOA 4DV2Q 1D7QA 4DV3L 1JB7A 1VQLA 5IWAL 4IFDG 4GS3A 4A3BH 3J81j 3J80c 3CW2C 1Q46A 4DR3Q 1HNZL 2I0QA 2ZM6Q 2UUCL 4AYBG 4BXXG 1HNWL 1YNXA 4UY8C 3GO5A 3RLOA 5IWAQ 1RIPA 2K52A 1XMQQ 1J5EQ 1YBYA 3PF4A 4K0KL 2L15A 3HOVG 1HNWQ 3TEHB 1CSQA 4YHHL 5AJ3L 5H1SE 4BA1I 3KJPA 1UWVA 1K9MC 1EIYB 4OO1G 5JJIA 2R7FA 3H15A 4K0KQ 1LTLA 5C44G 4R4TA 1TXYA 4YHHQ 3M4PA 4APVA 1YZ6A 1S3OA 4DR4L 4A3JG 1IBLQ 2Y0SE 3NELA 1R9TH 4DR4Q 2MO1A 4LF5Q 1N8RC 4DV0Q 4P72A 3B6YA 5JEAJ 4UP8A 1KAWA 2VUMH 2GVAA 3CC2A 1FJGL 4GLXA 1IBKL 3S1NH 1L1OB 2RCNA 3KF6B 2HIVA 3CAMA 4IPGA 2AHOB 4WJ4A 4IOAA 1KHIA 3NBHB 1VQ8A 1EQRA 1FJGQ 1KQSA 1IBKQ 1MIUA 1X3EA 2DUDA 4DR5L 3I4OA 4RMFA 1K8GA 1H95A 2IX0A 2EIFA 1E1OA 1JJCB 1WCMG 3JC66 4YY3L 4DR5Q 1X55A 1TWFH 5M5XH 3HKSA 4JBWA 4UPAA 1YEZA 2R7ZH 3TS0A 4JI6L 2R7DA 4WJ3M 1X3FA 4YCVA 4KHZA 4UP7A 4YY3Q 2R92H 3GTGH 3PCOB 4HJ9A 2DGYA 1NTGA 3PUVA 3I55A 3GTQH 2FXQA 3STBD 4JI1Q 1HR0L 2PI2E 4LWCA 1AE2A 4YWMA 1VQDA 1FGUA 1X3GA 5ELNA 1OXXK 4X64L 4GNXB 2Z0SA 3CPFA 2C35B 1HR0Q 1YI2A 1VS0A 3AEVA 4DPGA 1VQMA 2E2JH 1VQIA 1XNQL 2OQ0A 3HOZH 3CCRA 1GO3E 4X64Q 3JAMc 1X9NA 3U58A 5K36G 1PVOA 3HOUH 5C4XH 3MEFA 1C9OA 2K5HA 3CQZH 4DR1Q 1HNXL 4OWXB 1ASYA 1XNQQ 3I4MG 2PI2A 3UDXA 3F2BA 3RN5A 3HOYG 4FDBA 1HNXQ 1K8AC 4A3CH 2UUAL 4JYAQ 1A8VA 1MJCA 2JA9A 2B63G 2CKZB 2HQLA 4LFCL 1NE3A 2UUAQ 1YITA 2N3SA 4AIMA 3GTMH 4DV5L 4X65L 1VQ7A 4LFCQ 4LF7L 2F4VL 4A3LG 3CC4A 1VCIA 1IL2A 4JI7L 4IFDJ 3J81i 1OXTA 1XPUA 3ULLA 1EWIA 4LF7Q 2F4VQ 4BY1G 4POFA 1JT8A 4JI7Q 4BBSG 1NY4A 2VY3A 2WFWA 1UE5A 3HOXH 3CF5A 2LXJA 4DV1L 2QEXA 2OQKA 4QL5A 4DV4L 1Q86C 3CCLA 4A3GH 4IPHA 3CCQA 2XTIA 4A3FG 3GTJH 3PUWA 4JI3L 4DV4Q 5LMUQ 3J80i 4DV1Q 2VW9A 3FKIG 5GAGC 4NB3A 1KL9A 5C4JH 1JJ2A 2VL6A 3K80C 5EAYA 4JI3Q 5IE8A 3EIVA 5C0XJ 2VQEL 1YHAA 2OWOA 1QZHA 3H0GG 4XTCS 4B3TL 2NN6I 3PUYA 1PH6A 2BH2A 1P16A 2NVQH 4A93H 3RLNA 2YU9H 3PO3G 1WJJA 3PO2G 4A3BG 1O7IA 4IPCA 2KHJA 1KC8C 3HKZE 4GOPB 4PZ6A 4B3MQ 3VDYA 4BY7G 1QVGA 1KRTA 4MTNA 3SGIA 2E5LL 3RZOH 4JG2A 1UE7A 4Y7NH 4DUYL 3CCEA 3OW2A 5IYDG 3F2CA 2JA5G 5DLQE 2VQFQ 1OTCA 4HIKA 1XPOA 2R93H 5GAHC 2BH8A 4P74A 3DM3A 3KYHC 1T9HA 2MQHA 4R4OA 4A4IA 5C3EH 1S72A 2BA1A 3RR5A 3HOWH 4LFBL 4A75A 2K5VA 4R1JA 2AWOA 4JI5L 1NMGA 4PZ8A 1HZ9A 3T1YL 3AFQA 4GKJL 5C4XG 4DUZL 1BBUA 4LFBQ 4NPSA 1IBML 4X6AH 5ELOA 1YJWA 4JI5Q 4ME3A 2OCEA 2JE6I 2VS1A 4GKJQ 4DUZQ 2EXDA 4PZ7A 4RG1A 1IBMQ 1VQ9A 2IX1A 2IY5B 3AFPA 4DV3Q 1JMCA 3J7ZC 1CUKA 1L1OC 2K5NA 4BBRH 1HNZQ 2UUCQ 4OWTB 1VQOA 3BZCA 1YJNA 4X62L 1D8LA 4OXPA 2ZTCA 3AQQA 4X62Q 5AJ3Q 5GQOA 2F52A 4A3EH 1Q8KA 1Y1WG 1SFOH 4LF4L 4BA2I 1C0AA 4B3SL 1BBWA 1PFSA 4Y52H 2AWNA 2UXDL 5M3MH 3EN2A 4LF4Q 3HOZG 3CCJA 4B3SQ 3S1RH 1YHBA 4C3JH 5C0XI 3CP0A 3CXCA 1CKNA 3GTPH 2UXDQ 3ZJYC 1B8AA 3HKZG 3AYHB 1RL2A 3I2ZA 1EQQA 2PMZE 2A19A 2D0OA 3E9IA 3K7UC 4L5QA 1VQAA 2KCMA 2VZAA 4R4QA 1Q1EA 4GNXC 5IP9H 2IT1A 2D62A 5IYCG 4AQYL 4A3CG 4JI8L 2E2IH 1UE6A 2H5XA 4L5SA 1VQFA 2PQAB 4DR7L 2ASBA 3DLLA 4HJ8A 5M3FG 4AQYQ 4A76A 1PH2A 4DR7Q 4JI6Q 1W2BA 4A3IH 4A3KG 4O0AA 2HHHL 3BU2A 4KI0A 2ZJQA 2IHFA 1E7ZA 5IP7H 4HIDA 1PA6A 1Y1VH 1L2FA 3F1ZA 5IYBH 5FLMG 2B29A 3PF5A 2HHHQ 1V43A 3L0OA 4IPDA 3H3VI 3A5UA 5HGQA 2NZOA 3M7NA 2Q2TA 4DV6L 4A3DG 4GN4B 4HIMA 1N36L 3HOVH 3RNUA 2LSSA 1HZBA 4JCVE 1G291 5HY6A 4LF9L 1NJIC 1HZCA 1NBWA 4DV6Q 4X66L 1N36Q 5C44H 2AKWB 4UP9A 1QUQB 3CCMA 3D0FA 3ULJA 4X66Q 2UU9L 2Y0SG 4A93G 1WOCA 2YTXA 4L5TA 3PUZA 4KLKA 4JI4L 3S2HH 3OYYA 4B3RL 2UU9Q 5J3BA 2MO0A 1L1OA 4OX9L 4DK3C 3CCVA 4DV5Q 4JBMA 4JI4Q 4X65Q 4B3RQ 5IT9c 5JJKA 1SN8A 1VQCA 4GLVB 1E22A 4LW1A 1PH8A 1Z9FA 3Q8DA 3U50C 1SRUA 4P75A 1KRSA 3CCSA 2K50A 1LUZA 2JJQA 4GOPC 2F3IA 4A3MG 1PHJA 2JA6G 1XTDA 5FJ8H 1PH7A 1IZ6A 4GKKL 4NXML 1BKBA 4KHPL 5JJLA 5C3EG 2JA7G 2NVXH 2CWAA 3HOWG 5E7NA 4GKKQ 1VQEA 1I94L 4KHPQ 4NXMQ 3FP9A 1A62A 4EQ5A 2N8NA 1IYJB 2CQOA 1I94Q 3KF8B 1VQ5A 3H3VH 1N32L 5JEAG 2VQEQ 4GNXA 3ICEA 3TS2A 1NMFA 2LXKA 4OONA 1QZGA 1HH2P 4QIWE 4AYBE 4B3TQ 3CD6A 1N32Q 1V9PA 2Q2IA 3I4NH 1VQNA 1A63A 1U5KA 4IO9A 4O2DA 1OXUA 3NENA 2YV5A 4L5RC 2I5HA 2JQOA 3UE0A 3HOYH 4C2MH 4HJ5A 1KXLA 1PH4A 2E5LQ 2B63H 1PYBA 2NN6G 4DUYQ 4LF6L 1VQ6A 2PNHA 3BJUA 4GLAC 3A0JA 4IJHA 1U0LA 4MZ9A 4JV5L 4LUZA 4LF6Q 3PUXA 3S15H 1C7YA 3RLFA 1N9WA 5M3MG 2A1AA 1I5FA 1JE5A 1VQPA 2Z6KC 3CCUA 2JA8H 2VUMG 1K0RA 2N78A 4DR6L 2ALYB 2BA0A 3W5OA 2ID0A 3T1YQ 4BXXH 4JOIC 4BBSH 1LM0A 3S16H 1GM5A 2NVYH 1K3RA 3PIPA 4QQBX 2GN5A 4IFDI 2I5LX 4A3FH 4JC0A 3GDEA 1J6QA 1GKHA 3STBC 4DK6C 5GADC 3JAMi 3OTOL 3G4SA 2R7ZG 2R92G 4IJLA 2UUBL 1PV4A 4OO1I 2MFIA 3UDFA 4GN3B 4P71A 1E1TA 1QVCA 3L7ZC 1E24A 1MKHA 1DGSA 1VQHA 3H0GH 3LGJA 3GD7A 2KCTA 5IP7G 3KJOA 4EX5A 1Y1VG 2ZM6L 5IYBG 1XMQL 3PO3H 3IRBA 3PO2H 3KDFA 4C3IH 1XPRA 3UDGA 1J5EL 4DAMA 4ALPA 4GOPA 2HIXA 1PH5A 3TRZA 1VQKA 2YTVA 3K0XA 3HOUG 1B70B 4BY7H 1KIXA 2YTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTE A;  1YHQ A;  2XGT A;  4HIO A;  1IBL L;  2A8V A;  1XMO L;  4TQU S;  5IYD H;  1SMX A;  1SE8 A;  2JA5 H;  1M90 C;  5BR8 L;  1ASZ A;  3PGZ A;  1SLJ A;  4LF5 L;  1Q7Y C;  4GN5 A;  1XMO Q;  4DV0 L;  2K14 A;  3NEM A;  2KEN A;  5BR8 Q;  4JI8 Q;  1X56 A;  1PH1 A;  4IOC A;  1OXS C;  3G48 A;  5C0X G;  3G71 A;  4LFA L;  1I6H H;  1GVP A;  3M4Q A;  3UDI A;  4YWL A;  2MNA A;  3F2D A;  4LFA Q;  1TWG H;  3FHW A;  4J15 A;  4LNQ A;  3RN2 A;  1AE3 A;  1Q1B A;  3ERS X;  1V1Q A;  3HOX G;  4A3G G;  1CKO A;  4R4I A;  5LMN W;  2RHS B;  1Q81 C;  3MXN B;  4AH6 A;  5IY0 A;  5LMN L;  2IHE A;  1Q82 C;  2WB1 E;  2WP8 J;  2NVT H;  2EQS A;  1JJG A;  1AH9 A;  2WAQ E;  1S40 A;  2GVB A;  5FJ8 G;  4TVA B;  5LMN Q;  1M1K C;  1TWH H;  3K8A A;  1VQJ A;  2KBN A;  2Z6K A;  1QVF A;  3PSI A;  2UXC L;  1CKM A;  2RF4 A;  1Y14 B;  4JI1 L;  1EFW A;  3KFU A;  3D31 A;  4LF9 Q;  4P73 A;  1UE1 A;  4A3J H;  1Y1W H;  1HR0 W;  2UXC Q;  4YCU A;  4R4C A;  4JOI A;  3TQY A;  4LUO A;  1CSP A;  1L0W A;  1TWA H;  1KD1 C;  2N49 A;  4DR1 L;  3KF6 A;  3I4N G;  1YVC A;  1Z47 A;  3E9H A;  3HFZ B;  1HJP A;  2HT1 A;  1GD7 A;  5M5W H;  4OX9 Q;  4JYA L;  3TRE A;  4DV7 L;  3RZD H;  1BVS A;  1XJV A;  1K73 C;  2CFM A;  1VQB A;  1B7Y B;  1X65 A;  1VQG A;  2R6G A;  3F8T A;  5IYC H;  2CWP A;  3WWV A;  4DV7 Q;  1EIF A;  2PQA A;  1WCM H;  3GTL H;  2R93 G;  4DAY B;  3PV0 A;  4QGU A;  5M3F H;  2Q2H A;  1X54 A;  1N34 L;  4DKA C;  1VQ4 A;  1LYL A;  3CME A;  3GTO H;  1WFQ A;  3A5Z B;  2JA8 G;  1I50 H;  3M4O H;  4OWW B;  1N34 Q;  3S1Q H;  1FVI A;  3L2P A;  4HJA A;  5GRO A;  3S24 A;  2ZJR A;  3T1H L;  4A3K H;  3S1M H;  2B3G A;  3M85 A;  4YCW A;  3A74 A;  1E3P A;  3U4V A;  1Q12 A;  2ATW A;  3T1H Q;  5FLM H;  5LMU L;  4DR2 L;  4LUV A;  4H02 A;  1XNR L;  2RHQ B;  1SRO A;  2JEB I;  1IXR A;  3W1B A;  4BBR G;  2WB1 G;  1PYS B;  3G6E A;  4DR2 Q;  3S14 H;  1TWC H;  1XNR Q;  2WAQ G;  4JI2 L;  4JBK A;  2K75 A;  4A3D H;  3I4M H;  3S2D H;  2JEA I;  1YIJ A;  3GTK H;  2ZJP A;  1WI5 A;  2QGQ A;  2ZTD A;  1SR3 A;  3E0E A;  4JI2 Q;  4JBJ A;  2Q2U A;  1P8L A;  1WYD A;  4A3E G;  4JI0 L;  3I7F A;  1QUQ A;  2V1C C;  4C3H H;  3I56 A;  3ULP A;  1W3S A;  1HZA A;  5M5Y H;  3EBE A;  2KHI A;  4YWK A;  3ER0 A;  3K7A H;  2E2H H;  4NXN L;  4JI0 Q;  4PG3 A;  1G6P A;  3K81 C;  4B3M L;  3M3Y H;  4A3L H;  4JV5 Q;  3KDF B;  2AMC B;  2NZH A;  5FLX c;  4HJ7 A;  4NXN Q;  3U4Z A;  2QA4 A;  1CKN B;  2K4K A;  4BY1 H;  4QY7 A;  2VQF L;  1FL0 A;  1A0I A;  1EUJ A;  3S17 H;  4POG A;  4MNO A;  1X6O A;  3BZK A;  4DR6 Q;  2OTJ A;  1YJ9 A;  1OXV A;  2UXB L;  2E8G A;  5IP9 G;  3CC7 A;  3KLW A;  1PH9 A;  3CPW A;  2ES2 A;  3W1G A;  4LF8 L;  3J7A 5;  4XIG S;  5GAE C;  4A3M H;  1I3Q H;  4QJF A;  1N33 L;  1G51 A;  3FKI H;  2JA6 H;  2UXB Q;  2VNU D;  4PMW A;  3M9B A;  3KOJ A;  4DNI A;  4LF8 Q;  2JA7 H;  1EOV A;  3UE1 A;  2YYZ A;  3J81 c;  1N33 Q;  1K83 H;  3CMA A;  3OTO Q;  2CCZ A;  2OTL A;  4DV2 L;  2D0P A;  1MJE A;  1PH3 A;  4A3I G;  2JK8 A;  2UUB Q;  1UEB A;  4DR3 L;  1EYG A;  2I5M X;  3PIO A;  4DV2 Q;  1D7Q A;  4DV3 L;  1JB7 A;  1VQL A;  5IWA L;  4IFD G;  4GS3 A;  4A3B H;  3J81 j;  3J80 c;  3CW2 C;  1Q46 A;  4DR3 Q;  1HNZ L;  2I0Q A;  2ZM6 Q;  2UUC L;  4AYB G;  4BXX G;  1HNW L;  1YNX A;  4UY8 C;  3GO5 A;  3RLO A;  5IWA Q;  1RIP A;  2K52 A;  1XMQ Q;  1J5E Q;  1YBY A;  3PF4 A;  4K0K L;  2L15 A;  3HOV G;  1HNW Q;  3TEH B;  1CSQ A;  4YHH L;  5AJ3 L;  5H1S E;  4BA1 I;  3KJP A;  1UWV A;  1K9M C;  1EIY B;  4OO1 G;  5JJI A;  2R7F A;  3H15 A;  4K0K Q;  1LTL A;  5C44 G;  4R4T A;  1TXY A;  4YHH Q;  3M4P A;  4APV A;  1YZ6 A;  1S3O A;  4DR4 L;  4A3J G;  1IBL Q;  2Y0S E;  3NEL A;  1R9T H;  4DR4 Q;  2MO1 A;  4LF5 Q;  1N8R C;  4DV0 Q;  4P72 A;  3B6Y A;  5JEA J;  4UP8 A;  1KAW A;  2VUM H;  2GVA A;  3CC2 A;  1FJG L;  4GLX A;  1IBK L;  3S1N H;  1L1O B;  2RCN A;  3KF6 B;  2HIV A;  3CAM A;  4IPG A;  2AHO B;  4WJ4 A;  4IOA A;  1KHI A;  3NBH B;  1VQ8 A;  1EQR A;  1FJG Q;  1KQS A;  1IBK Q;  1MIU A;  1X3E A;  2DUD A;  4DR5 L;  3I4O A;  4RMF A;  1K8G A;  1H95 A;  2IX0 A;  2EIF A;  1E1O A;  1JJC B;  1WCM G;  3JC6 6;  4YY3 L;  4DR5 Q;  1X55 A;  1TWF H;  5M5X H;  3HKS A;  4JBW A;  4UPA A;  1YEZ A;  2R7Z H;  3TS0 A;  4JI6 L;  2R7D A;  4WJ3 M;  1X3F A;  4YCV A;  4KHZ A;  4UP7 A;  4YY3 Q;  2R92 H;  3GTG H;  3PCO B;  4HJ9 A;  2DGY A;  1NTG A;  3PUV A;  3I55 A;  3GTQ H;  2FXQ A;  3STB D;  4JI1 Q;  1HR0 L;  2PI2 E;  4LWC A;  1AE2 A;  4YWM A;  1VQD A;  1FGU A;  1X3G A;  5ELN A;  1OXX K;  4X64 L;  4GNX B;  2Z0S A;  3CPF A;  2C35 B;  1HR0 Q;  1YI2 A;  1VS0 A;  3AEV A;  4DPG A;  1VQM A;  2E2J H;  1VQI A;  1XNQ L;  2OQ0 A;  3HOZ H;  3CCR A;  1GO3 E;  4X64 Q;  3JAM c;  1X9N A;  3U58 A;  5K36 G;  1PVO A;  3HOU H;  5C4X H;  3MEF A;  1C9O A;  2K5H A;  3CQZ H;  4DR1 Q;  1HNX L;  4OWX B;  1ASY A;  1XNQ Q;  3I4M G;  2PI2 A;  3UDX A;  3F2B A;  3RN5 A;  3HOY G;  4FDB A;  1HNX Q;  1K8A C;  4A3C H;  2UUA L;  4JYA Q;  1A8V A;  1MJC A;  2JA9 A;  2B63 G;  2CKZ B;  2HQL A;  4LFC L;  1NE3 A;  2UUA Q;  1YIT A;  2N3S A;  4AIM A;  3GTM H;  4DV5 L;  4X65 L;  1VQ7 A;  4LFC Q;  4LF7 L;  2F4V L;  4A3L G;  3CC4 A;  1VCI A;  1IL2 A;  4JI7 L;  4IFD J;  3J81 i;  1OXT A;  1XPU A;  3ULL A;  1EWI A;  4LF7 Q;  2F4V Q;  4BY1 G;  4POF A;  1JT8 A;  4JI7 Q;  4BBS G;  1NY4 A;  2VY3 A;  2WFW A;  1UE5 A;  3HOX H;  3CF5 A;  2LXJ A;  4DV1 L;  2QEX A;  2OQK A;  4QL5 A;  4DV4 L;  1Q86 C;  3CCL A;  4A3G H;  4IPH A;  3CCQ A;  2XTI A;  4A3F G;  3GTJ H;  3PUW A;  4JI3 L;  4DV4 Q;  5LMU Q;  3J80 i;  4DV1 Q;  2VW9 A;  3FKI G;  5GAG C;  4NB3 A;  1KL9 A;  5C4J H;  1JJ2 A;  2VL6 A;  3K80 C;  5EAY A;  4JI3 Q;  5IE8 A;  3EIV A;  5C0X J;  2VQE L;  1YHA A;  2OWO A;  1QZH A;  3H0G G;  4XTC S;  4B3T L;  2NN6 I;  3PUY A;  1PH6 A;  2BH2 A;  1P16 A;  2NVQ H;  4A93 H;  3RLN A;  2YU9 H;  3PO3 G;  1WJJ A;  3PO2 G;  4A3B G;  1O7I A;  4IPC A;  2KHJ A;  1KC8 C;  3HKZ E;  4GOP B;  4PZ6 A;  4B3M Q;  3VDY A;  4BY7 G;  1QVG A;  1KRT A;  4MTN A;  3SGI A;  2E5L L;  3RZO H;  4JG2 A;  1UE7 A;  4Y7N H;  4DUY L;  3CCE A;  3OW2 A;  5IYD G;  3F2C A;  2JA5 G;  5DLQ E;  2VQF Q;  1OTC A;  4HIK A;  1XPO A;  2R93 H;  5GAH C;  2BH8 A;  4P74 A;  3DM3 A;  3KYH C;  1T9H A;  2MQH A;  4R4O A;  4A4I A;  5C3E H;  1S72 A;  2BA1 A;  3RR5 A;  3HOW H;  4LFB L;  4A75 A;  2K5V A;  4R1J A;  2AWO A;  4JI5 L;  1NMG A;  4PZ8 A;  1HZ9 A;  3T1Y L;  3AFQ A;  4GKJ L;  5C4X G;  4DUZ L;  1BBU A;  4LFB Q;  4NPS A;  1IBM L;  4X6A H;  5ELO A;  1YJW A;  4JI5 Q;  4ME3 A;  2OCE A;  2JE6 I;  2VS1 A;  4GKJ Q;  4DUZ Q;  2EXD A;  4PZ7 A;  4RG1 A;  1IBM Q;  1VQ9 A;  2IX1 A;  2IY5 B;  3AFP A;  4DV3 Q;  1JMC A;  3J7Z C;  1CUK A;  1L1O C;  2K5N A;  4BBR H;  1HNZ Q;  2UUC Q;  4OWT B;  1VQO A;  3BZC A;  1YJN A;  4X62 L;  1D8L A;  4OXP A;  2ZTC A;  3AQQ A;  4X62 Q;  5AJ3 Q;  5GQO A;  2F52 A;  4A3E H;  1Q8K A;  1Y1W G;  1SFO H;  4LF4 L;  4BA2 I;  1C0A A;  4B3S L;  1BBW A;  1PFS A;  4Y52 H;  2AWN A;  2UXD L;  5M3M H;  3EN2 A;  4LF4 Q;  3HOZ G;  3CCJ A;  4B3S Q;  3S1R H;  1YHB A;  4C3J H;  5C0X I;  3CP0 A;  3CXC A;  1CKN A;  3GTP H;  2UXD Q;  3ZJY C;  1B8A A;  3HKZ G;  3AYH B;  1RL2 A;  3I2Z A;  1EQQ A;  2PMZ E;  2A19 A;  2D0O A;  3E9I A;  3K7U C;  4L5Q A;  1VQA A;  2KCM A;  2VZA A;  4R4Q A;  1Q1E A;  4GNX C;  5IP9 H;  2IT1 A;  2D62 A;  5IYC G;  4AQY L;  4A3C G;  4JI8 L;  2E2I H;  1UE6 A;  2H5X A;  4L5S A;  1VQF A;  2PQA B;  4DR7 L;  2ASB A;  3DLL A;  4HJ8 A;  5M3F G;  4AQY Q;  4A76 A;  1PH2 A;  4DR7 Q;  4JI6 Q;  1W2B A;  4A3I H;  4A3K G;  4O0A A;  2HHH L;  3BU2 A;  4KI0 A;  2ZJQ A;  2IHF A;  1E7Z A;  5IP7 H;  4HID A;  1PA6 A;  1Y1V H;  1L2F A;  3F1Z A;  5IYB H;  5FLM G;  2B29 A;  3PF5 A;  2HHH Q;  1V43 A;  3L0O A;  4IPD A;  3H3V I;  3A5U A;  5HGQ A;  2NZO A;  3M7N A;  2Q2T A;  4DV6 L;  4A3D G;  4GN4 B;  4HIM A;  1N36 L;  3HOV H;  3RNU A;  2LSS A;  1HZB A;  4JCV E;  1G29 1;  5HY6 A;  4LF9 L;  1NJI C;  1HZC A;  1NBW A;  4DV6 Q;  4X66 L;  1N36 Q;  5C44 H;  2AKW B;  4UP9 A;  1QUQ B;  3CCM A;  3D0F A;  3ULJ A;  4X66 Q;  2UU9 L;  2Y0S G;  4A93 G;  1WOC A;  2YTX A;  4L5T A;  3PUZ A;  4KLK A;  4JI4 L;  3S2H H;  3OYY A;  4B3R L;  2UU9 Q;  5J3B A;  2MO0 A;  1L1O A;  4OX9 L;  4DK3 C;  3CCV A;  4DV5 Q;  4JBM A;  4JI4 Q;  4X65 Q;  4B3R Q;  5IT9 c;  5JJK A;  1SN8 A;  1VQC A;  4GLV B;  1E22 A;  4LW1 A;  1PH8 A;  1Z9F A;  3Q8D A;  3U50 C;  1SRU A;  4P75 A;  1KRS A;  3CCS A;  2K50 A;  1LUZ A;  2JJQ A;  4GOP C;  2F3I A;  4A3M G;  1PHJ A;  2JA6 G;  1XTD A;  5FJ8 H;  1PH7 A;  1IZ6 A;  4GKK L;  4NXM L;  1BKB A;  4KHP L;  5JJL A;  5C3E G;  2JA7 G;  2NVX H;  2CWA A;  3HOW G;  5E7N A;  4GKK Q;  1VQE A;  1I94 L;  4KHP Q;  4NXM Q;  3FP9 A;  1A62 A;  4EQ5 A;  2N8N A;  1IYJ B;  2CQO A;  1I94 Q;  3KF8 B;  1VQ5 A;  3H3V H;  1N32 L;  5JEA G;  2VQE Q;  4GNX A;  3ICE A;  3TS2 A;  1NMF A;  2LXK A;  4OON A;  1QZG A;  1HH2 P;  4QIW E;  4AYB E;  4B3T Q;  3CD6 A;  1N32 Q;  1V9P A;  2Q2I A;  3I4N H;  1VQN A;  1A63 A;  1U5K A;  4IO9 A;  4O2D A;  1OXU A;  3NEN A;  2YV5 A;  4L5R C;  2I5H A;  2JQO A;  3UE0 A;  3HOY H;  4C2M H;  4HJ5 A;  1KXL A;  1PH4 A;  2E5L Q;  2B63 H;  1PYB A;  2NN6 G;  4DUY Q;  4LF6 L;  1VQ6 A;  2PNH A;  3BJU A;  4GLA C;  3A0J A;  4IJH A;  1U0L A;  4MZ9 A;  4JV5 L;  4LUZ A;  4LF6 Q;  3PUX A;  3S15 H;  1C7Y A;  3RLF A;  1N9W A;  5M3M G;  2A1A A;  1I5F A;  1JE5 A;  1VQP A;  2Z6K C;  3CCU A;  2JA8 H;  2VUM G;  1K0R A;  2N78 A;  4DR6 L;  2ALY B;  2BA0 A;  3W5O A;  2ID0 A;  3T1Y Q;  4BXX H;  4JOI C;  4BBS H;  1LM0 A;  3S16 H;  1GM5 A;  2NVY H;  1K3R A;  3PIP A;  4QQB X;  2GN5 A;  4IFD I;  2I5L X;  4A3F H;  4JC0 A;  3GDE A;  1J6Q A;  1GKH A;  3STB C;  4DK6 C;  5GAD C;  3JAM i;  3OTO L;  3G4S A;  2R7Z G;  2R92 G;  4IJL A;  2UUB L;  1PV4 A;  4OO1 I;  2MFI A;  3UDF A;  4GN3 B;  4P71 A;  1E1T A;  1QVC A;  3L7Z C;  1E24 A;  1MKH A;  1DGS A;  1VQH A;  3H0G H;  3LGJ A;  3GD7 A;  2KCT A;  5IP7 G;  3KJO A;  4EX5 A;  1Y1V G;  2ZM6 L;  5IYB G;  1XMQ L;  3PO3 H;  3IRB A;  3PO2 H;  3KDF A;  4C3I H;  1XPR A;  3UDG A;  1J5E L;  4DAM A;  4ALP A;  4GOP A;  2HIX A;  1PH5 A;  3TRZ A;  1VQK A;  2YTV A;  3K0X A;  3HOU G;  1B70 B;  4BY7 H;  1KIX A;  2YTY A; 
#chains in the Genus database with same CATH topology
 2PNR C;  3URY A;  4HIO A;  1IL8 A;  1XMO L;  4TQU S;  4A3B B;  2WII B;  3TP6 A;  4KN4 C;  5EPJ A;  4LF5 L;  2A68 D;  3BG3 A;  3I4L A;  2QCP X;  4JI8 Q;  4ID6 A;  2RCF A;  1PH1 A;  4IOC A;  1WVL A;  1I6H H;  3HG9 A;  4NP5 A;  4N8X 1;  2A69 D;  4YWL A;  3UDI A;  3LWU A;  3R2T A;  3DM1 A;  1TWG H;  2CW0 D;  3FHW A;  4J15 A;  3RN2 A;  2QDB A;  1R9T B;  5CR3 A;  1CKO A;  3O13 A;  3AMU A;  2RHS B;  4BXX H;  4AH6 A;  2WB1 E;  4L8J A;  3S1N B;  3KLR A;  5FJ8 G;  1M1K C;  1TWH H;  3K8A A;  3P20 A;  3PSI A;  3KFU A;  3D31 A;  4XQQ A;  4A3J H;  1ILQ A;  1HR0 W;  2UXC Q;  3TQY A;  4XQJ A;  5KGU A;  4R8I A;  2A6E D;  2R92 B;  2N49 A;  2K32 A;  3KF6 A;  5IGD A;  1LTA D;  4OL7 A;  2PZT A;  4RHR A;  3GTQ B;  1GUW A;  1Z47 A;  3DEP A;  3QOJ A;  4OX9 Q;  1AZP A;  3TRE A;  2MPM A;  4DV7 L;  4KHV A;  4DK0 A;  2CFM A;  2R6G A;  4QIW B;  1WCM H;  4DAY B;  4RHS A;  1A6X A;  4K6L A;  3CQZ B;  4ZRZ A;  4K5X A;  4PMC A;  4F87 A;  1N34 Q;  3L2P A;  4HJA A;  2ZJR A;  1JOR A;  3S1M H;  1E3P A;  1Q12 A;  1DD2 A;  4DXF A;  5J39 A;  4H02 A;  5K36 H;  3D6W A;  4BBR G;  3Q6S A;  3W1B A;  2WB1 G;  3G6E A;  3S14 H;  4A3D H;  4JI2 L;  4JBK A;  2K75 A;  4A3G B;  1WYD A;  4JI0 L;  3I7F A;  2V1C C;  3N52 A;  4JVZ A;  4C3H H;  3I56 A;  5M5Y H;  2XSC A;  1STN A;  3EBE A;  2KHI A;  4YWK A;  2E2H H;  4NXN L;  4Q0F A;  2RBM A;  1STG A;  4B3M L;  2QF7 A;  1G8Z D;  2AMC B;  2NZH A;  5FLX c;  5C3W A;  4R9W A;  4QY7 A;  3S17 H;  1A0I A;  3BZK A;  4A93 B;  2FIN B;  2UXB L;  2Z4H A;  1BUV T;  4F8M A;  1B3A A;  1U4L A;  2IW3 A;  1SYG A;  3CRK C;  1EOV A;  3UE1 A;  1V1P A;  1N33 Q;  1K83 H;  3OTO Q;  1FD7 D;  4A3I G;  1A2T A;  2JK8 A;  1SYD A;  2K04 A;  1EYG A;  3MC0 B;  4J1M A;  5KEE A;  5EGT A;  5HUR A;  4PNY A;  4IFD G;  1HNZ L;  2UUC L;  4H0L C;  4AYB G;  2RA4 A;  1M8A A;  4UY8 C;  5I9P A;  1XMQ Q;  3PF4 A;  1RIP A;  4K0K L;  1CSQ A;  4YHH L;  1EIY B;  1O7Z A;  5BN5 A;  2F0J A;  3H15 A;  1S5D D;  1ESF A;  5C44 G;  2ICI A;  3M4P A;  3QIA A;  2F0N A;  1S3O A;  3IKJ A;  5ELD A;  3MFG A;  1D1I A;  1RKN A;  2LY7 A;  5IGF A;  2MO1 A;  2WAQ B;  2GVA A;  1FJG L;  4GLX A;  4ZCK A;  1SMY C;  2HIV A;  2AHO B;  3NBH B;  4I7A A;  1EQR A;  5A35 A;  1IBK Q;  1MIU A;  2B2W A;  4DR5 L;  1JE4 A;  1PXU A;  5ELC A;  3S1R B;  3GV6 A;  4ZK9 B;  1TWF H;  5M5X H;  1H9S A;  1YEZ A;  4JI6 L;  2F0H A;  5CYU A;  4UP7 A;  1B9N A;  5I4D A;  3MEH A;  2DNC A;  2F0W A;  4G7Z C;  2FXQ A;  1IKM A;  4HR7 B;  1HR0 L;  1AE2 A;  4IUU A;  1VQD A;  4OEM B;  4GNX B;  3TN2 A;  2Z0S A;  3HOZ H;  2E2J H;  1GO3 E;  3NSW A;  3U58 A;  2WKC A;  4DK1 A;  3MEF A;  4DR1 Q;  1HNX L;  1MGS A;  2Z8L A;  4X3K A;  1QNU A;  4PQX A;  5EPK A;  1Y1V B;  4K14 A;  1PFM A;  4FDB A;  4KY6 A;  3HOY G;  2UUA L;  5CV7 A;  1MJC A;  4S3S A;  3DHQ A;  1I4G A;  2CKZ B;  3GQB A;  3J81 E;  1NE3 A;  4XT3 B;  3HOV B;  3GTM H;  4EVO A;  4O42 A;  1OXT A;  1EWI A;  3J80 E;  2HD3 A;  1PRT F;  4JI7 Q;  3Q23 A;  1B53 A;  1CFM A;  1UE5 A;  2OQK A;  4QL5 A;  2BCO A;  1PTO F;  3PUW A;  4JI3 L;  5LMU Q;  1YNN C;  1EY5 A;  1ZEQ X;  1F9S A;  2ICE C;  2KEC A;  2K33 A;  4KK7 A;  1YNJ C;  4RGN A;  4B3T L;  1V1O A;  2IWH A;  4F7X A;  2NVQ H;  1A15 A;  3RLN A;  2YU9 H;  4ZKB B;  3C3L A;  4RA8 A;  5JAV A;  4A3B G;  1MSH A;  4GOP B;  4PZ6 A;  4BY7 G;  1F9R A;  4MN3 A;  1SYB A;  5IGC A;  2KED A;  3LWE A;  4Y7N H;  2BE5 C;  1OTC A;  1D2B A;  2SEB D;  3I8Z A;  1LLR D;  5CGK A;  4CGY B;  1HRJ A;  3DM3 A;  2VB3 X;  5C3E H;  1S72 A;  1J8I A;  3QO2 A;  4PZ8 A;  4DUZ L;  4NPS A;  1IBM L;  4X6A H;  4ME3 A;  2OCE A;  2JE6 I;  3WOE A;  1R4Q B;  4GKJ Q;  4RCN A;  3EJI A;  2EXD A;  1A3U A;  4DV3 Q;  1AZQ A;  1SE4 A;  3MFY A;  4FXK C;  3OW7 A;  4OXP A;  3AQQ A;  4K5W A;  5GQO A;  2PZW A;  2F52 A;  4A3E H;  1Q8K A;  4A3F B;  2KEE A;  1C0A A;  4B3S L;  2UXD L;  4LF4 Q;  4MTK A;  4XYO A;  4HCE A;  1YHB A;  4C3J H;  4CDD C;  3CXC A;  1E0B A;  4FF1 A;  3G6J B;  1PZJ D;  1RL2 A;  3H0G B;  1EQQ A;  2H4O A;  2PMZ E;  2R3Z A;  2D0O A;  5COY A;  1VQ7 A;  1VQA A;  1DJR D;  2VZA A;  4R4Q A;  2D62 A;  4C3I B;  2F0D A;  4L5S A;  1MSG A;  2ASB A;  4DR7 L;  2K03 A;  3DXJ C;  2B2V A;  4O0A A;  2WKD A;  2HHH L;  3NTI A;  4HTH A;  5IP7 H;  2VXW A;  5FLX E;  1EIG A;  3H3V I;  1CHP D;  1SBB B;  2NZ1 D;  1I6H B;  3L9A X;  4TKO B;  4DN4 M;  3A5U A;  1TWG B;  2Q2T A;  4IZ8 A;  3BYY B;  5DM6 3;  1B9M A;  4ODG A;  1BCP F;  5G3L F;  3ERO A;  1XWE A;  2AKW B;  3E3X A;  4DF7 A;  3D0F A;  2KJX A;  2CVR A;  2Y0S G;  4A93 G;  1TWH B;  3S2H H;  3OYY A;  2UU9 Q;  1DOK A;  2MO0 A;  4JW0 A;  3L3O C;  4A3J B;  1G6Z A;  5JJK A;  1F9P A;  4GLV B;  1PYW D;  3MXN A;  3Q8D A;  4P75 A;  1CK1 A;  1KRS A;  2EXZ A;  2HDL A;  4KHP L;  2BOS A;  5JJL A;  2B2Y A;  2JA7 G;  1G2S A;  1CI3 M;  3K6O A;  1I94 L;  4CKB A;  1TKW B;  2N8N A;  2DJG C;  2Z4I A;  1WCM B;  3H3V H;  3TP7 A;  3VR6 A;  4GNX A;  1VDZ A;  3ICE A;  2A73 B;  1NMF A;  2HCI A;  1QZG A;  3NTH A;  1HH2 P;  1DCZ A;  3OMG A;  3VA5 A;  1N32 Q;  2B2T A;  1SEB D;  1U5K A;  3BVG A;  4CDF C;  3S1M B;  1W6J A;  4DXG A;  2YV5 A;  1KAB A;  3R3O A;  3LNN A;  2E5L Q;  2B63 H;  3E6Z X;  1PYB A;  2NN6 G;  4DUY Q;  3BJU A;  1E2W A;  3S14 B;  1U0L A;  3NWS A;  4A3D B;  4LUZ A;  4MHE A;  1LTG D;  3HZX A;  1I5F A;  2VUM G;  2JA8 H;  2Z6K C;  1WD0 A;  1T5X D;  4ZLT F;  3J81 L;  4C3H B;  3W5O A;  5M5Y B;  4JOI C;  4BBS H;  1LM0 A;  2E2H B;  2P5Z X;  3S16 H;  1GM5 A;  1JCK B;  1J6Q A;  2K05 A;  3J80 L;  1PMR A;  2R7Z G;  3JAM i;  3S17 B;  2UUB L;  1EYD A;  2F0S A;  5IOD A;  1TQO A;  1E1T A;  1UAP A;  5E4W C;  4X3S A;  3LGJ A;  1TU2 B;  2KCT A;  1DXM A;  1SNC A;  1Y1V G;  1PFB A;  2OXP A;  4KD3 A;  3PO3 H;  3PO2 H;  3KDF A;  4DGZ A;  1O7L A;  1TS4 A;  5I6Y A;  1K83 B;  4DAM A;  1NR4 A;  4GOP A;  1PH5 A;  1I4Q A;  1O7Y A;  3K5M A;  4PMB A;  2XGT A;  5D3I B;  1SMX A;  1QB5 D;  1SE8 A;  5DNF A;  2JA5 H;  5BR8 L;  4EGV A;  1SLJ A;  3FVQ A;  3VA7 A;  1Q7Y C;  1XMO Q;  4FP5 D;  2M00 A;  4DV0 L;  2K14 A;  2K5Q A;  1ZYR C;  2DNE A;  5C0X G;  1LAC A;  1LT5 D;  3F2D A;  2J4X A;  1HHV A;  4HMI A;  1RJT A;  1EL0 A;  3ERS X;  3HOX G;  1HA6 A;  5CMD A;  2EYL A;  5IY0 A;  2NVT H;  1Q82 C;  1AH9 A;  2X6G A;  2E2D C;  1JWU D;  1CHQ D;  4TVA B;  3QJY A;  3NUC A;  2EYJ A;  2LKV A;  1QVF A;  3DUZ A;  2RF4 A;  1Y14 B;  1SAP A;  1NAP A;  1U4R A;  1FNU A;  1UE1 A;  1Y1W H;  3A8K E;  4YCU A;  1D6E C;  1TWF B;  5M5X B;  5I2Y A;  1L0W A;  1F9Q A;  3TDQ A;  2D5D A;  3P1H A;  5JOB A;  1Z6H A;  1SYF A;  2L5T A;  1B1Z A;  1GD7 A;  5M5W H;  4HMJ A;  2ZXP A;  2CQA A;  3RZD H;  3C1F A;  1BVS A;  1SE2 A;  1G2T A;  1XJV A;  1ESR A;  3HOZ B;  2E2J B;  4DV7 Q;  4NDX A;  2R93 G;  3GTL H;  1WTO A;  5M3F H;  1WFQ A;  3M4O H;  1FVI A;  1EWC A;  4ILW A;  3U4V A;  5KYI A;  1GHJ A;  1R4P B;  1TVX A;  4IUR A;  2M2L A;  5FLM H;  3GTM B;  4HSP A;  4V0B A;  4I65 A;  2RHQ B;  3OHX C;  1K8M A;  2JEB I;  1TWC H;  3HGB A;  3I4M H;  3W2D A;  2F3W A;  2QGQ A;  1SR3 A;  3E0E A;  4JI2 Q;  2EY2 A;  1P8L A;  3CU7 A;  1W3S A;  1I4R A;  4EQP A;  3K7A H;  4QUF A;  4JI0 Q;  4PG3 A;  1G6P A;  2Z1C A;  3K81 C;  2F03 A;  4JV5 Q;  4NXN Q;  5NUC A;  5I9O A;  4BY1 H;  2VQF L;  1DZ1 A;  2F0L A;  4POG A;  4DR6 Q;  2NVQ B;  2OTJ A;  2YU9 B;  4TSS A;  2ES2 A;  1IYU A;  2LFN A;  3W1G A;  4A3M H;  2UXB Q;  3FKI H;  5TSS A;  3X3N A;  4DNI A;  1EQT A;  5ELE A;  3J81 c;  4ZKC B;  4Y7N B;  3V96 A;  1VF5 C;  2D0P A;  1PH3 A;  5LL6 X;  4H44 C;  4DR3 L;  4OEL B;  5C3E B;  3J80 c;  1Q46 A;  3I73 A;  1HNW L;  2ZM6 Q;  4BXX G;  2FHT A;  3TEH B;  5H1S E;  2D9U A;  3NXW A;  4K0K Q;  1LTL A;  4YHH Q;  3C1E A;  2BDN A;  4A3J G;  1IBL Q;  1TS2 A;  2F0M A;  1K3B C;  5EBC A;  4B9W A;  4C1N I;  4N9T A;  1N8R C;  4P72 A;  4Z9C B;  1FGB D;  5D3D A;  5C4Z A;  2H1E A;  1KNE A;  1DM0 B;  1SYE A;  2JN4 A;  4IPG A;  4O1N A;  3CAM A;  1SE3 A;  3D4R A;  4A3E B;  1U9R A;  1FJG Q;  2IX3 A;  2SDF A;  4LMQ D;  1JC7 A;  1EY8 A;  3ND9 A;  1K8G A;  5ISR A;  2KCN A;  2EIF A;  5LHY 1;  1FYC A;  4C3J B;  1WCM G;  3JC6 6;  4DR5 Q;  1X55 A;  2L12 A;  4UPA A;  4QF4 A;  1X3F A;  3GTG H;  5KIX A;  2DGY A;  3STB D;  4JI1 Q;  4LWC A;  4YWM A;  1FGU A;  2QDL A;  2A74 C;  3CPF A;  1HR0 Q;  3OPO A;  1YI2 A;  1VS0 A;  3AEV A;  1VQI A;  1XNQ L;  1Z7T A;  1B3Q A;  5EKK A;  1X9N A;  5K36 G;  5A2Q L;  3HOU H;  1PVO A;  5C4X H;  1C9O A;  3F2B A;  2ZXR A;  5IT9 L;  1HNX Q;  4JYA Q;  2JA9 A;  2OF1 A;  1WTQ A;  1CM9 A;  2UUA Q;  1YIT A;  4KJO A;  4ZUJ A;  4DV5 L;  4X65 L;  4LF7 L;  4IFD J;  2QW7 A;  4DA2 A;  3CF5 A;  1K73 C;  4DV1 L;  1Q86 C;  3S2H B;  4RCO A;  1EIH A;  2XTI A;  2L11 A;  3H91 A;  2VW9 A;  5I6W A;  2NTT A;  4I7Z C;  2WV6 D;  4JI3 Q;  2QEJ C;  5IGB A;  3HRZ C;  4X3T A;  3EIV A;  1NCV A;  1X3P A;  4N8F A;  1YHA A;  1NNX A;  2OWO A;  4FYD A;  1V8Q A;  3PUY A;  2R61 A;  1WTX A;  4DAV A;  1GUG A;  3BZD B;  3CHB D;  4IPC A;  3BDC A;  2RDF A;  3VDY A;  1QVG A;  1KRT A;  3SGI A;  3RZO H;  2F0V A;  1UE7 A;  2QIL A;  5IYD G;  3F2C A;  1XPO A;  4P74 A;  4DFA A;  4BS9 A;  3KYH C;  2XRS D;  1T9H A;  2MQH A;  4R4O A;  4A4I A;  1EY4 A;  4LFB L;  4JI5 L;  1RCV D;  4E6I A;  3T1Y L;  2B63 B;  1BBU A;  5J22 A;  5D65 A;  4DUZ Q;  1IBM Q;  4PZ7 A;  4RG1 A;  2IX1 A;  3M3Y B;  2JA8 B;  2RSN A;  3NK9 A;  1CUK A;  3J7Z C;  2K5N A;  4BBR H;  4OWT B;  1VQO A;  3BZC A;  3NBI A;  4ABN A;  1MBY A;  1CA5 A;  3VR3 A;  4U67 3;  4BBS B;  3S16 B;  3ONA B;  1DOL A;  5AJ3 Q;  2Z6B A;  1IYV A;  1SFO H;  2G9H D;  4Y52 H;  5KRU A;  1K28 A;  3EN2 A;  4K5V A;  5M3M H;  2EDG A;  3W3A A;  4B3S Q;  3HOZ G;  1EEF D;  1U4M A;  3CP0 A;  2O2L D;  2UXD Q;  4ULL A;  1B8A A;  5KND A;  3I2Z A;  2K5W A;  4XYQ A;  2FJ2 A;  3NQI A;  3E9I A;  3K7U C;  4FO2 A;  3PO3 B;  5IYC G;  4AQY L;  3PO2 B;  3J7Y W;  1I4H A;  4JI8 L;  1TY2 A;  1UE6 A;  1VQF A;  3MTS A;  4K6D A;  4DR7 Q;  1J9O A;  1CQF A;  1HQM C;  3IL8 A;  2JA5 B;  4A3I H;  4A3K G;  2A6H C;  3BU2 A;  4C56 C;  2ZJQ A;  2IHF A;  2HDM A;  4XXE A;  3BDO A;  4NKL A;  5IYB H;  3F1Z A;  2HHH Q;  3BS1 A;  4IFD H;  1A2U A;  4IPD A;  5EKL A;  1D1K A;  5HGQ A;  2EOT A;  3M7N A;  1G91 A;  2MJ8 A;  4KKU A;  4GN4 B;  3S9W A;  5JVG 3;  1N36 L;  1G29 1;  4C1N K;  1NJI C;  1HZC A;  4X66 L;  5C44 H;  3C2P A;  2F0U A;  2NVT B;  2KCC A;  2NYZ D;  1ZKO A;  3G7L A;  2YTX A;  1QIL A;  3U9S A;  4B3R L;  4OX9 L;  4DK3 C;  5EKI A;  4JBM A;  2PZU A;  1STE A;  5IT9 c;  3DWP A;  1Y1W B;  2XN9 C;  2I46 A;  1RTO A;  1SN8 A;  3C46 A;  3N6R A;  1SMY D;  2FMM A;  4QB4 A;  5BN4 A;  5DEH A;  5FO8 B;  2JJQ A;  1IW7 C;  2JA6 G;  1XTD A;  4NXM L;  1FNW A;  5M5W B;  5C3E G;  2NVX H;  2CWA A;  3OWE B;  3RZD B;  1B50 A;  1SSO A;  1VQE A;  4KHP Q;  2EYP A;  1XX8 A;  1IYJ B;  1I94 Q;  3GTL B;  4CJ2 C;  1VQ5 A;  2VQE Q;  3TME A;  5M3F B;  4J8Q A;  2B39 A;  1H9M A;  3TS2 A;  4QIW E;  3I4N H;  3M4O B;  1I4P A;  3SXH A;  4IO9 A;  2I5H A;  2B8G A;  1BXT A;  3HOY H;  4RGO S;  2C9O A;  1WTR A;  1PH4 A;  4DAY A;  1VQ6 A;  4IJH A;  2EVB A;  1TWC B;  1HFN A;  3I4M B;  1C7Y A;  2ENB A;  1JE5 A;  3PIO 3;  2EZV A;  4C3J G;  1MHW C;  1K0R A;  4OGQ C;  3ERQ A;  3K7A B;  4RKB A;  4QQB X;  1HXY D;  2I5L X;  4JC0 A;  3BYT B;  5F2D A;  1PFN A;  1GKH A;  5E1F A;  3OTO L;  3G4S A;  4BY1 B;  2EJG C;  2R92 G;  1EY7 A;  1PV4 A;  4OO1 I;  4GZY C;  5C3X A;  3T13 A;  4GN3 B;  1YNN D;  1DGS A;  4IN3 A;  4A3M B;  5IP7 G;  3IAY A;  3FKI B;  4EX5 A;  1XMQ L;  1F2M A;  3IRB A;  4HED A;  3Q24 A;  4H7B A;  1XPR A;  3UDG A;  1WTP A;  3TRZ A;  2L1B A;  1VQK A;  1LTS D;  2YTV A;  4BY7 H;  3FPP A;  1KIX A;  2F3V A;  2ZTE A;  2A8V A;  3BVZ A;  4CJ1 B;  1ASZ A;  3P7J A;  3PGZ A;  4GN5 A;  2KEN A;  5BR8 Q;  2BE5 D;  4LFA L;  1OXS C;  1GVP A;  3M4Q A;  2MNA A;  1SDF A;  3P75 A;  4H13 C;  2L4N A;  1Q1B A;  4A3G G;  1Q81 C;  3TBI B;  5LMN L;  1JJG A;  5KYL A;  2EQS A;  2WAQ E;  5IGE A;  2SNM A;  1CTM A;  4OO1 H;  3JAM L;  2KBN A;  2Z6K A;  4RGT A;  2O5J C;  1CKM A;  1EFW A;  1DOM A;  4LF9 Q;  3QR8 A;  5JPN C;  4R4C A;  4JOI A;  3D6C A;  1PRT C;  4LUO A;  2LMC B;  2XRQ D;  1KD1 C;  3R8B A;  3GTG B;  5CBE E;  4DR1 L;  3NE5 B;  1X32 A;  1PTO C;  1YVC A;  3NBH A;  3E9H A;  3HFZ B;  1B4O A;  5IOC A;  1CT1 D;  1QE6 A;  1PTO H;  1VQB A;  3F8T A;  1D5M C;  2CWP A;  3DWQ A;  1WTV A;  2K28 A;  4OIK A;  3HOU B;  2CHB D;  5C4X B;  3K0Y A;  1X54 A;  1VQ4 A;  4CDC C;  1LYL A;  3TP5 A;  3LX0 A;  2JA8 G;  3MHB A;  4OWW B;  3T1H L;  1EY6 A;  2F0P A;  3QWN A;  1UNS A;  4KMU C;  1PZI D;  3MXG A;  2ATW A;  5C4H A;  1D5Z C;  2E74 C;  5LMU L;  4DR2 L;  1MD2 D;  4LUV A;  4ZYS A;  3K58 A;  1XNR L;  1SRO A;  2WAQ G;  5AFW A;  2JEA I;  3GTK H;  2ZJP A;  4IUQ A;  2AUJ D;  2F0T A;  4ZUI A;  3ER0 A;  4DAP A;  5CBA E;  3M3Y H;  4KKS A;  3SVM A;  4A3L H;  2B2V C;  4HJ7 A;  4RFB A;  2QA4 A;  2K4K A;  3SDZ A;  1FL0 A;  3IFD A;  1EUJ A;  4MNO A;  1D5X C;  2TSS A;  3R2I A;  2PCF B;  2SNS A;  4IUV A;  5IP9 G;  1PH9 A;  4LF8 L;  2NTS A;  4QJF A;  2VNU D;  1ONL A;  4CKC A;  2J0T D;  3M9B A;  3KOJ A;  2JA7 H;  4WJW A;  3RZO B;  4DV2 L;  3KBG A;  5A2Q E;  2XNA C;  1JOQ A;  1D7Q A;  2I5M X;  3PIO A;  4DV3 L;  1JB7 A;  1VQL A;  5IWA L;  4IQZ A;  3J81 j;  3GP7 A;  4DR3 Q;  5IT9 E;  2I0Q A;  4G7O C;  1QNK A;  1YNX A;  3GO5 A;  1HFG A;  1J5E Q;  1A3V A;  1HNW Q;  2L15 A;  5KNB A;  3HOV G;  5JVH 3;  5JJI A;  2EYO A;  4IUN A;  3A54 A;  3OIQ A;  1GJX A;  4R8N A;  1EZ6 A;  1YZ6 A;  4DR4 L;  5CV9 A;  4BBR B;  1JOK A;  3NEL A;  2NBF A;  4LF5 Q;  1LTI D;  3B6Y A;  5JEA J;  1S5B D;  2VUM H;  3CC2 A;  4WJ4 A;  3KF6 B;  3K5N A;  2JXM B;  4IOA A;  1SFO B;  1KHI A;  4NW2 A;  1VQ8 A;  2DUD A;  1BCP C;  5M3M B;  4RMF A;  1H95 A;  1VMP A;  2B2T C;  2B2U C;  4YY3 L;  3RD4 A;  2R7Z H;  3TS0 A;  2R7D A;  4WJ3 M;  1OO9 B;  4KHZ A;  1I6V C;  4TRD A;  4FXD A;  1Q3L A;  2PI2 E;  2WAC A;  2F1M A;  5ELN A;  4X64 L;  5IIF A;  3KLS A;  2OQ0 A;  3CCR A;  3JAM c;  1Q8I A;  2RDH A;  4A3I B;  1ICF B;  2K5H A;  1XNQ Q;  5E3F A;  1ASY A;  3I4M G;  2PI2 A;  2K5D A;  2FFK B;  3PQI A;  1K8A C;  4A3C H;  1A8V A;  1GUT A;  1EYC A;  3R93 A;  4AYB B;  3ZYY X;  1EQV A;  5C5L A;  4LFC L;  2MHV A;  1STY A;  5EQ0 A;  5L37 A;  3IFT A;  5C0X H;  2F4V L;  1RD9 D;  1VCI A;  1IL2 A;  5C44 B;  1ZYR D;  1JQY D;  3J81 i;  3NHH A;  1XPU A;  4LF7 Q;  4BY1 G;  2Q8T A;  4RGM A;  2K1B A;  1NY4 A;  2VY3 A;  4YIJ A;  3HOX H;  4DV4 L;  2LXJ A;  2QEX A;  2EJM A;  2KVM A;  1LV9 A;  3CCQ A;  4A3F G;  3GTJ H;  2WIN B;  2QKI C;  2I07 B;  3J80 i;  4DV1 Q;  1UEA B;  3FKI G;  1AW7 A;  5GAG C;  5C4J H;  1JJ2 A;  1K8O A;  2VL6 A;  2GA4 B;  5EAY A;  1EEI D;  4M1U B;  5FO7 B;  4HAE A;  1F77 A;  1HQR D;  4U68 A;  3H0G G;  1EFI D;  1PH6 A;  1WJJ A;  2NVX B;  5T1G A;  4IAL A;  1O7I A;  4C3I G;  2KHJ A;  3J7A F;  2JYO A;  1KC8 C;  1M4V A;  4B3M Q;  4OIJ A;  1TY0 A;  1MI2 A;  2A68 C;  2E5L L;  4FF3 A;  4PV1 C;  4DUY L;  3SK4 A;  3X3M A;  3OW2 A;  5CC4 A;  4HIK A;  3D4D A;  3I4N B;  2R93 H;  2A69 C;  2CW0 C;  1H9K A;  1CZG A;  2BA1 A;  3HOW H;  2CH4 A;  2G9D A;  4A75 A;  5COR A;  1TT2 A;  3HOY B;  1HZ9 A;  1QJO A;  1TS3 A;  5EPL A;  2IJ0 A;  5K5P A;  3TZU A;  1W6K A;  4OHJ A;  4HN7 A;  4LFB Q;  1SNP A;  1YJW A;  4JI5 Q;  5JEA H;  1LT6 D;  2F0G A;  4K2K A;  2VS1 A;  4KTA A;  4CJ0 B;  5FKA C;  2IY5 B;  1VQ9 A;  1HUN A;  3VYT A;  1L1O C;  1HNZ Q;  1SXT A;  2UUC Q;  1YJN A;  4X62 L;  1LO5 D;  1B44 D;  3E0J A;  1H9S B;  3NPP A;  3A7L A;  4CBV A;  2A6E C;  5FO9 B;  5CV6 A;  2L0C A;  3NP8 A;  3RMH A;  2AWN A;  3ND8 A;  3OOC A;  1QOH A;  2ZT9 C;  3CCJ A;  3EA6 A;  2MUY A;  1KTK A;  1NUC A;  1S5C D;  1X3Q A;  3GTP H;  1RHP A;  2RKS A;  5BN3 A;  2DY8 A;  3VYU A;  3AYH B;  4G7H C;  3SR1 A;  2A19 A;  3J7A V;  4L5Q A;  2KCM A;  1KLU D;  2IT1 A;  4CKE A;  1KDB A;  2E2I H;  2H5X A;  2PQA B;  4FVM A;  3BDL A;  2CH4 W;  4AQY Q;  4BY7 B;  4A76 A;  1H9R A;  4IUT A;  5EBD A;  4JI6 Q;  2PYK A;  1W2B A;  1E7Z A;  3SK8 A;  3NWT A;  1L2F A;  2HQE A;  2NZO A;  4DV6 L;  4A3D G;  4HIM A;  3RNU A;  2LSS A;  2F0Q A;  1HZB A;  4UDU C;  1NBW A;  1IKL A;  1N36 Q;  1EU4 A;  4C3H G;  1QUQ B;  2PW5 A;  3ULJ A;  4X66 Q;  3K5L A;  1LTB D;  4L5T A;  3PUZ A;  4JI4 L;  2EYF A;  3T51 B;  5C5M A;  1O80 A;  3SEB A;  4B3R Q;  4DU9 A;  1EOT A;  3AU7 A;  1VQC A;  4LW1 A;  4RWS C;  1E22 A;  1PH8 A;  1T5E A;  3WOF A;  1SRU A;  3CCS A;  1LUZ A;  2F3I A;  3E5S A;  4GKK L;  2EY5 A;  5FJ8 H;  1IZ6 A;  1PRT B;  1PH7 A;  1BKB A;  1ZXT A;  4UAI A;  1WTW A;  4NXM Q;  2PW7 A;  1PTO B;  1ET9 A;  2CQO A;  3KF8 B;  2PPB C;  4OON A;  4AYB E;  4B3T Q;  3M7G A;  2EYM A;  2Q2I A;  1VQN A;  4X3U A;  1BO0 A;  1OXU A;  5M9O A;  3NEN A;  3UE0 A;  2JQO A;  1ENA A;  3ITP A;  4HJ5 A;  3RUZ A;  4LF6 L;  2RQX A;  1JR0 D;  3I91 A;  4GLA C;  4MZ9 A;  1BOS A;  4JV5 L;  3D8G A;  3S15 H;  3GTK B;  2DY7 A;  5M3M G;  1N9W A;  1AEX A;  1LTR D;  3CKI B;  1JOO A;  3CCU A;  3NTK A;  4RAU C;  2N78 A;  4DR6 L;  3A7A B;  1SYC A;  2O4X A;  4WFN 3;  4WRD A;  3JAM E;  1EYA A;  2Y0S B;  2NVY H;  5FK9 C;  3T53 B;  4IFD I;  1XYI A;  3GDE A;  1ML0 D;  1NR2 A;  4DK6 C;  5GAD C;  1WTH A;  5CV5 A;  5C6A A;  2PMZ B;  3UDF A;  3L7Z C;  1MKH A;  1VQH A;  3GD7 A;  2ZM6 L;  5IYB G;  1AN8 A;  3Q0A A;  2JA7 B;  4ALP A;  3K0X A;  2K7V A;  1YHQ A;  1IBL L;  4LK1 C;  5IYD H;  2MP1 A;  4EQO A;  3WDN A;  1M90 C;  5ELB A;  3BVM A;  4P2C B;  3NEM A;  3I3C A;  1X56 A;  3G48 A;  3G71 A;  1C4Q A;  4LFA Q;  3T56 B;  2NB0 A;  4LNQ A;  1AE3 A;  4B9X A;  1V1Q A;  4R4I A;  5LMN W;  1STA A;  2G5D A;  1GOZ A;  3MXN B;  2IHE A;  2VUM B;  2WP8 J;  1S40 A;  2GVB A;  5LMN Q;  1ILP A;  1VQJ A;  2UXC L;  4JI1 L;  1LT3 D;  4P73 A;  4KY5 A;  1HTP A;  5J1Z A;  2R7Z B;  1CSP A;  1BCP B;  1TWA H;  4RH6 A;  1EY0 A;  3A8J E;  4IUP A;  3I4N G;  3KLS X;  1HJP A;  2HT1 A;  3FEW X;  3A8I E;  1WD1 A;  4JYA L;  4DNT B;  5DAU A;  1F2Z A;  1B7Y B;  1X65 A;  1VQG A;  5IYC H;  2DN8 A;  3WWV A;  1EIF A;  2PQA A;  3M4Y A;  3PV0 A;  3FDT A;  4QGU A;  3HKZ B;  3D4W A;  2Q2H A;  1N34 L;  4DKA C;  1E2Z A;  3CME A;  4MIU A;  4XQN A;  1STB A;  3GTO H;  3A5Z B;  4L6T B;  1I50 H;  4G4K A;  3S1Q H;  5GRO A;  4FXG C;  3S24 A;  4A3K H;  3MXP A;  3VR5 A;  2B3G A;  1DON A;  3M85 A;  4YCW A;  3A74 A;  3KUP A;  2Z9H A;  3T1H Q;  5CV4 A;  4QCL A;  2A6H D;  3OMC A;  2K01 A;  1IXR A;  3DEO A;  1PYS B;  4DR2 Q;  1XNR Q;  3S2D H;  4ZAI A;  1YIJ A;  2F0O A;  1WI5 A;  2ZTD A;  3HOX B;  1E2V A;  3AB9 A;  2TMP A;  2B8F A;  4JBJ A;  2B2W C;  2Q2U A;  2XWB B;  1I4X A;  2AUK A;  4A3E G;  1QUQ A;  3GTJ B;  1Y69 U;  3ULP A;  1BQQ T;  1HZA A;  3VYR A;  3MVV A;  5C4J B;  2EYH A;  3MWY W;  2OT2 A;  3KDF B;  3U4Z A;  1CKN B;  2HCC A;  1JB3 A;  3SHL A;  1X6O A;  1YJ9 A;  1OXV A;  2E8G A;  2RSO A;  3CC7 A;  1HPC A;  3KLW A;  3T16 A;  4FF4 A;  3CPW A;  1BBX C;  3J7A 5;  4XIG S;  5GAE C;  1I3Q H;  1N33 L;  1G51 A;  2JA6 H;  2NUC A;  3KBX A;  4PMW A;  2EY1 A;  4LF8 Q;  2YYZ A;  3CMA A;  2CCZ A;  2OTL A;  1IW7 D;  1MJE A;  4C2M B;  2UUB Q;  4K8I A;  1EU3 A;  3KF8 A;  1UEB A;  2R93 B;  2KHS A;  1KDA A;  4DV2 Q;  1A3T A;  4JK1 C;  4QUC A;  1GUO A;  4GS3 A;  4L63 B;  4A3B H;  3CW2 C;  3HOW B;  1YNJ D;  1XXG A;  3RLO A;  2EE1 A;  5IWA Q;  2K52 A;  1YBY A;  3HS0 C;  2N55 A;  2KQ3 A;  3KJP A;  4OO1 G;  1L0X B;  5AJ3 L;  1K9M C;  4BA1 I;  1UWV A;  4DNR B;  2R7F A;  1LTT D;  1QG7 A;  4R4T A;  1TXY A;  4APV A;  4M8A A;  3EFX D;  2JP1 A;  2Y0S E;  4XT1 B;  1R9T H;  4DR4 Q;  2AQ3 B;  3VYS A;  4DV0 Q;  4UP8 A;  2MGS A;  1KAW A;  4LAA A;  1IBK L;  3S1N H;  1L1O B;  2RCN A;  5CV8 A;  1KQS A;  4NMZ A;  1X3E A;  2N88 A;  2X69 A;  3I4O A;  2IX0 A;  4KJN A;  1HCZ A;  1H9J A;  1E1O A;  4KKT A;  1JJC B;  3GTP B;  1FNV A;  1NSN S;  3T4A C;  2EY6 A;  3HKS A;  4JBW A;  1KAA A;  1KLG D;  4G57 A;  4YCV A;  4YY3 Q;  1JWS D;  1SNO A;  2R92 H;  3PCO B;  4LJZ C;  4HJ9 A;  1NTG A;  3PUV A;  2C5C A;  1TII D;  2F0K A;  3I55 A;  3GTQ H;  2KOL A;  3D3R A;  2E2I B;  2E75 C;  1X3G A;  1OXX K;  3EQL C;  3OWF A;  2C35 B;  4DPG A;  1VQM A;  5E4X A;  3FMC A;  1BNZ A;  4X64 Q;  2Q8R E;  4EQN A;  2V4D A;  2SOB A;  3CQZ H;  2F0I A;  2F4I A;  2X6L A;  4RKL A;  4OWX B;  1AFP A;  3UDX A;  4Q5V A;  3RN5 A;  1PZK D;  2B63 G;  3FPU B;  5EJW A;  2AQ2 B;  2HQL A;  1S5E D;  1C48 A;  3HEJ A;  2N3S A;  3MA2 B;  4AIM A;  3TZD A;  2XIW A;  4LFC Q;  1SNQ A;  4A3L G;  3CC4 A;  3A56 A;  4JI7 L;  1AP0 A;  3V2T A;  1SJH D;  3ULL A;  2F4V Q;  1JT8 A;  1II3 A;  4POF A;  2RDG A;  4BBS G;  2WFW A;  3CCL A;  4A3G H;  2L9H A;  2ZXO A;  4IPH A;  4DV4 Q;  2A5H A;  2F0F A;  1C8C A;  1O78 A;  2EJF C;  4NB3 A;  1KL9 A;  3I70 A;  3K80 C;  5IE8 A;  3H3V C;  2IPK D;  2BDO A;  1GUN A;  4KY7 A;  5DM7 3;  5C0X J;  2VQE L;  1QZH A;  3H6M A;  1PLF A;  4XTC S;  1KDC A;  2NN6 I;  2BH2 A;  1P16 A;  4A93 H;  3PO3 G;  1ET6 A;  3PO2 G;  4KD4 A;  2B2U A;  3HKZ E;  1EZ8 A;  1Y8P B;  1PRT D;  3TSS A;  3PIP 3;  5FOB B;  1IHZ A;  3H94 A;  4MTN A;  4JG2 A;  5JJZ A;  3CCE A;  1PTO D;  5I2X A;  2HUG A;  5DLQ E;  1CQV A;  1SND A;  1Y8O B;  2VQF Q;  2JA5 G;  4XDX A;  3MZ5 A;  2M9V A;  5GAH C;  4UHV A;  1F2Y A;  1VMC A;  2BH8 A;  3SK5 A;  1EY9 A;  4J6H A;  3RR5 A;  2K5V A;  4R1J A;  2AWO A;  1NMG A;  3AFQ A;  4GKJ L;  2PO4 A;  1S4Z A;  5T1I A;  5ELO A;  3S15 B;  1SNM A;  3AFP A;  3KK7 A;  1JMC A;  1GXD C;  4KV6 A;  3Q22 A;  1D8L A;  3QG1 A;  2ZTC A;  3A55 A;  5LL6 S;  1GHK A;  2NVY B;  4X62 Q;  2NN6 H;  1Y1W G;  4LF4 L;  4BA2 I;  2WB1 B;  1BBW A;  1PFS A;  4ZQ3 A;  2EPB A;  2B2Y C;  4QMG A;  1RTN A;  3S1R H;  5C0X I;  2AQ1 B;  1CKN A;  1K0S A;  3ZJY C;  3HKZ G;  4JPB W;  3SE0 A;  4N9P A;  3F2U A;  4GNX C;  1Q1E A;  5IP9 H;  2KUM A;  4A3C G;  3QB3 A;  1LAB A;  3H09 A;  3DLL A;  4HJ8 A;  5M3F G;  3I72 A;  1PH2 A;  4BWG B;  1RDP D;  3V05 A;  1VF7 A;  2FMC A;  5JPM C;  4KI0 A;  4HID A;  1PA6 A;  1TS5 A;  1Y1V H;  3I90 A;  5FLM G;  2B29 A;  3PF5 A;  1V43 A;  3L0O A;  4HCS A;  1CZW A;  1BR9 A;  3NQT A;  3UI2 A;  4V19 0;  5KNC A;  2LS0 1;  1XTC D;  3DWA A;  3HOV H;  1Y8N B;  1LT4 D;  4JCV E;  2VB2 X;  1HTL D;  5HY6 A;  3TP8 A;  3VR2 A;  4LF9 L;  4DV6 Q;  2XVS A;  4UP9 A;  3CCM A;  2OEO A;  1UUP A;  2UU9 L;  1WOC A;  1TR5 A;  2K6A A;  4KLK A;  1JWM D;  5J3B A;  1ROD A;  1L1O A;  3CCV A;  4DV5 Q;  4JI4 Q;  4X65 Q;  4WOR A;  2DJF C;  1EWH A;  1QWY A;  3K59 A;  4K8J A;  1Z9F A;  1TWA B;  2XWJ B;  3U50 C;  2K50 A;  4GOP C;  4A3M G;  1PHJ A;  5HGT A;  5G3L D;  1BCP D;  3MAQ A;  2KA7 A;  3PMF A;  5IGG A;  1ENC A;  3HOW G;  5E7N A;  1CA6 A;  1Q90 A;  1V1P B;  4GKK Q;  3FRP B;  4F88 A;  3FP9 A;  1A62 A;  4ME5 A;  4K2L A;  4EQ5 A;  4KN7 C;  1FR3 A;  2D2C C;  1ICW A;  1N32 L;  2PQE A;  5JEA G;  3VR4 A;  2LXK A;  3CD6 A;  3HP3 A;  3MXU A;  1V9P A;  2F0E A;  3OSO A;  5D14 A;  3GTO B;  1I50 B;  3S1Q B;  1A63 A;  4A3K B;  3CRL C;  4O2D A;  4L5R C;  5FLX L;  3K57 A;  1PDQ A;  3U9O A;  4C2M H;  1KXL A;  1DYQ A;  1BF4 A;  3SK6 A;  2PNH A;  1F2L A;  1GUS A;  3A0J A;  2IL8 A;  1JIC A;  4LF6 Q;  3PUX A;  3S2D B;  4CHT B;  3GV3 A;  2Q8I B;  3RLF A;  2A1A A;  1HA5 A;  4CDE C;  2JSO A;  2RVL A;  1VQP A;  1L0Y B;  2J7Z A;  4HSV A;  2ALY B;  1QCB D;  1S5F D;  2BA0 A;  1U4P A;  2ID0 A;  3EVQ A;  3T1Y Q;  4B08 A;  1ENF A;  1K3R A;  3PIP A;  5ELF A;  2E76 C;  3K5O A;  2GN5 A;  4A3F H;  2L55 A;  1HUM A;  2O5I C;  3STB C;  3QOL A;  4FNF A;  4FF2 A;  3OIP A;  4IJL A;  3DMU A;  2MFI A;  1BDO A;  1B2T A;  4P71 A;  1QVC A;  1E24 A;  3H0G H;  1I3Q B;  2JA6 B;  3KJO A;  1KNA A;  1STH A;  4C3I H;  1RF2 D;  1J5E L;  2HIX A;  2NWG A;  3HOU G;  5C4X G;  1B70 B;  1SJE D;  2YTY A; 
#chains in the Genus database with same CATH homology
 2ZTE A;  1YHQ A;  2XGT A;  4HIO A;  1IBL L;  2A8V A;  1XMO L;  4TQU S;  5IYD H;  1SMX A;  1SE8 A;  2JA5 H;  1M90 C;  5BR8 L;  1ASZ A;  3PGZ A;  1SLJ A;  4LF5 L;  1Q7Y C;  4GN5 A;  1XMO Q;  4DV0 L;  2K14 A;  3NEM A;  2KEN A;  5BR8 Q;  4JI8 Q;  1X56 A;  1PH1 A;  4IOC A;  1OXS C;  3G48 A;  5C0X G;  3G71 A;  4LFA L;  1I6H H;  1GVP A;  3M4Q A;  3UDI A;  4YWL A;  2MNA A;  3F2D A;  4LFA Q;  1TWG H;  3FHW A;  4J15 A;  4LNQ A;  3RN2 A;  1AE3 A;  1Q1B A;  3ERS X;  1V1Q A;  3HOX G;  4A3G G;  1CKO A;  4R4I A;  5LMN W;  2RHS B;  1Q81 C;  3MXN B;  4AH6 A;  5IY0 A;  5LMN L;  2IHE A;  1Q82 C;  2WB1 E;  2WP8 J;  2NVT H;  2EQS A;  1JJG A;  1AH9 A;  2WAQ E;  1S40 A;  2GVB A;  5FJ8 G;  4TVA B;  5LMN Q;  1M1K C;  1TWH H;  3K8A A;  1VQJ A;  2KBN A;  2Z6K A;  1QVF A;  3PSI A;  2UXC L;  1CKM A;  2RF4 A;  1Y14 B;  4JI1 L;  1EFW A;  3KFU A;  3D31 A;  4LF9 Q;  4P73 A;  1UE1 A;  4A3J H;  1Y1W H;  1HR0 W;  2UXC Q;  4YCU A;  4R4C A;  4JOI A;  3TQY A;  4LUO A;  1CSP A;  1L0W A;  1TWA H;  1KD1 C;  2N49 A;  4DR1 L;  3KF6 A;  3I4N G;  1YVC A;  1Z47 A;  3E9H A;  3HFZ B;  1HJP A;  2HT1 A;  1GD7 A;  5M5W H;  4OX9 Q;  4JYA L;  3TRE A;  4DV7 L;  3RZD H;  1BVS A;  1XJV A;  1K73 C;  2CFM A;  1VQB A;  1B7Y B;  1X65 A;  1VQG A;  2R6G A;  3F8T A;  5IYC H;  2CWP A;  3WWV A;  4DV7 Q;  1EIF A;  2PQA A;  1WCM H;  3GTL H;  2R93 G;  4DAY B;  3PV0 A;  4QGU A;  5M3F H;  2Q2H A;  1X54 A;  1N34 L;  4DKA C;  1VQ4 A;  1LYL A;  3CME A;  3GTO H;  1WFQ A;  3A5Z B;  2JA8 G;  1I50 H;  3M4O H;  4OWW B;  1N34 Q;  3S1Q H;  1FVI A;  3L2P A;  4HJA A;  5GRO A;  3S24 A;  2ZJR A;  3T1H L;  4A3K H;  3S1M H;  2B3G A;  3M85 A;  4YCW A;  3A74 A;  1E3P A;  3U4V A;  1Q12 A;  2ATW A;  3T1H Q;  5FLM H;  5LMU L;  4DR2 L;  4LUV A;  4H02 A;  1XNR L;  2RHQ B;  1SRO A;  2JEB I;  1IXR A;  3W1B A;  4BBR G;  2WB1 G;  1PYS B;  3G6E A;  4DR2 Q;  3S14 H;  1TWC H;  1XNR Q;  2WAQ G;  4JI2 L;  4JBK A;  2K75 A;  4A3D H;  3I4M H;  3S2D H;  2JEA I;  1YIJ A;  3GTK H;  2ZJP A;  1WI5 A;  2QGQ A;  2ZTD A;  1SR3 A;  3E0E A;  4JI2 Q;  4JBJ A;  2Q2U A;  1P8L A;  1WYD A;  4A3E G;  4JI0 L;  3I7F A;  1QUQ A;  2V1C C;  4C3H H;  3I56 A;  3ULP A;  1W3S A;  1HZA A;  5M5Y H;  3EBE A;  2KHI A;  4YWK A;  3ER0 A;  3K7A H;  2E2H H;  4NXN L;  4JI0 Q;  4PG3 A;  1G6P A;  3K81 C;  4B3M L;  3M3Y H;  4A3L H;  4JV5 Q;  3KDF B;  2AMC B;  2NZH A;  5FLX c;  4HJ7 A;  4NXN Q;  3U4Z A;  2QA4 A;  1CKN B;  2K4K A;  4BY1 H;  4QY7 A;  2VQF L;  1FL0 A;  1A0I A;  1EUJ A;  3S17 H;  4POG A;  4MNO A;  1X6O A;  3BZK A;  4DR6 Q;  2OTJ A;  1YJ9 A;  1OXV A;  2UXB L;  2E8G A;  5IP9 G;  3CC7 A;  3KLW A;  1PH9 A;  3CPW A;  2ES2 A;  3W1G A;  4LF8 L;  3J7A 5;  4XIG S;  5GAE C;  4A3M H;  1I3Q H;  4QJF A;  1N33 L;  1G51 A;  3FKI H;  2JA6 H;  2UXB Q;  2VNU D;  4PMW A;  3M9B A;  3KOJ A;  4DNI A;  4LF8 Q;  2JA7 H;  1EOV A;  3UE1 A;  2YYZ A;  3J81 c;  1N33 Q;  1K83 H;  3CMA A;  3OTO Q;  2CCZ A;  2OTL A;  4DV2 L;  2D0P A;  1MJE A;  1PH3 A;  4A3I G;  2JK8 A;  2UUB Q;  1UEB A;  4DR3 L;  1EYG A;  2I5M X;  3PIO A;  4DV2 Q;  1D7Q A;  4DV3 L;  1JB7 A;  1VQL A;  5IWA L;  4IFD G;  4GS3 A;  4A3B H;  3J81 j;  3J80 c;  3CW2 C;  1Q46 A;  4DR3 Q;  1HNZ L;  2I0Q A;  2ZM6 Q;  2UUC L;  4AYB G;  4BXX G;  1HNW L;  1YNX A;  4UY8 C;  3GO5 A;  3RLO A;  5IWA Q;  1RIP A;  2K52 A;  1XMQ Q;  1J5E Q;  1YBY A;  3PF4 A;  4K0K L;  2L15 A;  3HOV G;  1HNW Q;  3TEH B;  1CSQ A;  4YHH L;  5AJ3 L;  5H1S E;  4BA1 I;  3KJP A;  1UWV A;  1K9M C;  1EIY B;  4OO1 G;  5JJI A;  2R7F A;  3H15 A;  4K0K Q;  1LTL A;  5C44 G;  4R4T A;  1TXY A;  4YHH Q;  3M4P A;  4APV A;  1YZ6 A;  1S3O A;  4DR4 L;  4A3J G;  1IBL Q;  2Y0S E;  3NEL A;  1R9T H;  4DR4 Q;  2MO1 A;  4LF5 Q;  1N8R C;  4DV0 Q;  4P72 A;  3B6Y A;  5JEA J;  4UP8 A;  1KAW A;  2VUM H;  2GVA A;  3CC2 A;  1FJG L;  4GLX A;  1IBK L;  3S1N H;  1L1O B;  2RCN A;  3KF6 B;  2HIV A;  3CAM A;  4IPG A;  2AHO B;  4WJ4 A;  4IOA A;  1KHI A;  3NBH B;  1VQ8 A;  1EQR A;  1FJG Q;  1KQS A;  1IBK Q;  1MIU A;  1X3E A;  2DUD A;  4DR5 L;  3I4O A;  4RMF A;  1K8G A;  1H95 A;  2IX0 A;  2EIF A;  1E1O A;  1JJC B;  1WCM G;  3JC6 6;  4YY3 L;  4DR5 Q;  1X55 A;  1TWF H;  5M5X H;  3HKS A;  4JBW A;  4UPA A;  1YEZ A;  2R7Z H;  3TS0 A;  4JI6 L;  2R7D A;  4WJ3 M;  1X3F A;  4YCV A;  4KHZ A;  4UP7 A;  4YY3 Q;  2R92 H;  3GTG H;  3PCO B;  4HJ9 A;  2DGY A;  1NTG A;  3PUV A;  3I55 A;  3GTQ H;  2FXQ A;  3STB D;  4JI1 Q;  1HR0 L;  2PI2 E;  4LWC A;  1AE2 A;  4YWM A;  1VQD A;  1FGU A;  1X3G A;  5ELN A;  1OXX K;  4X64 L;  4GNX B;  2Z0S A;  3CPF A;  2C35 B;  1HR0 Q;  1YI2 A;  1VS0 A;  3AEV A;  4DPG A;  1VQM A;  2E2J H;  1VQI A;  1XNQ L;  2OQ0 A;  3HOZ H;  3CCR A;  1GO3 E;  4X64 Q;  3JAM c;  1X9N A;  3U58 A;  5K36 G;  1PVO A;  3HOU H;  5C4X H;  3MEF A;  1C9O A;  2K5H A;  3CQZ H;  4DR1 Q;  1HNX L;  4OWX B;  1ASY A;  1XNQ Q;  3I4M G;  2PI2 A;  3UDX A;  3F2B A;  3RN5 A;  3HOY G;  4FDB A;  1HNX Q;  1K8A C;  4A3C H;  2UUA L;  4JYA Q;  1A8V A;  1MJC A;  2JA9 A;  2B63 G;  2CKZ B;  2HQL A;  4LFC L;  1NE3 A;  2UUA Q;  1YIT A;  2N3S A;  4AIM A;  3GTM H;  4DV5 L;  4X65 L;  1VQ7 A;  4LFC Q;  4LF7 L;  2F4V L;  4A3L G;  3CC4 A;  1VCI A;  1IL2 A;  4JI7 L;  4IFD J;  3J81 i;  1OXT A;  1XPU A;  3ULL A;  1EWI A;  4LF7 Q;  2F4V Q;  4BY1 G;  4POF A;  1JT8 A;  4JI7 Q;  4BBS G;  1NY4 A;  2VY3 A;  2WFW A;  1UE5 A;  3HOX H;  3CF5 A;  2LXJ A;  4DV1 L;  2QEX A;  2OQK A;  4QL5 A;  4DV4 L;  1Q86 C;  3CCL A;  4A3G H;  4IPH A;  3CCQ A;  2XTI A;  4A3F G;  3GTJ H;  3PUW A;  4JI3 L;  4DV4 Q;  5LMU Q;  3J80 i;  4DV1 Q;  2VW9 A;  3FKI G;  5GAG C;  4NB3 A;  1KL9 A;  5C4J H;  1JJ2 A;  2VL6 A;  3K80 C;  5EAY A;  4JI3 Q;  5IE8 A;  3EIV A;  5C0X J;  2VQE L;  1YHA A;  2OWO A;  1QZH A;  3H0G G;  4XTC S;  4B3T L;  2NN6 I;  3PUY A;  1PH6 A;  2BH2 A;  1P16 A;  2NVQ H;  4A93 H;  3RLN A;  2YU9 H;  3PO3 G;  1WJJ A;  3PO2 G;  4A3B G;  1O7I A;  4IPC A;  2KHJ A;  1KC8 C;  3HKZ E;  4GOP B;  4PZ6 A;  4B3M Q;  3VDY A;  4BY7 G;  1QVG A;  1KRT A;  4MTN A;  3SGI A;  2E5L L;  3RZO H;  4JG2 A;  1UE7 A;  4Y7N H;  4DUY L;  3CCE A;  3OW2 A;  5IYD G;  3F2C A;  2JA5 G;  5DLQ E;  2VQF Q;  1OTC A;  4HIK A;  1XPO A;  2R93 H;  5GAH C;  2BH8 A;  4P74 A;  3DM3 A;  3KYH C;  1T9H A;  2MQH A;  4R4O A;  4A4I A;  5C3E H;  1S72 A;  2BA1 A;  3RR5 A;  3HOW H;  4LFB L;  4A75 A;  2K5V A;  4R1J A;  2AWO A;  4JI5 L;  1NMG A;  4PZ8 A;  1HZ9 A;  3T1Y L;  3AFQ A;  4GKJ L;  5C4X G;  4DUZ L;  1BBU A;  4LFB Q;  4NPS A;  1IBM L;  4X6A H;  5ELO A;  1YJW A;  4JI5 Q;  4ME3 A;  2OCE A;  2JE6 I;  2VS1 A;  4GKJ Q;  4DUZ Q;  2EXD A;  4PZ7 A;  4RG1 A;  1IBM Q;  1VQ9 A;  2IX1 A;  2IY5 B;  3AFP A;  4DV3 Q;  1JMC A;  3J7Z C;  1CUK A;  1L1O C;  2K5N A;  4BBR H;  1HNZ Q;  2UUC Q;  4OWT B;  1VQO A;  3BZC A;  1YJN A;  4X62 L;  1D8L A;  4OXP A;  2ZTC A;  3AQQ A;  4X62 Q;  5AJ3 Q;  5GQO A;  2F52 A;  4A3E H;  1Q8K A;  1Y1W G;  1SFO H;  4LF4 L;  4BA2 I;  1C0A A;  4B3S L;  1BBW A;  1PFS A;  4Y52 H;  2AWN A;  2UXD L;  5M3M H;  3EN2 A;  4LF4 Q;  3HOZ G;  3CCJ A;  4B3S Q;  3S1R H;  1YHB A;  4C3J H;  5C0X I;  3CP0 A;  3CXC A;  1CKN A;  3GTP H;  2UXD Q;  3ZJY C;  1B8A A;  3HKZ G;  3AYH B;  1RL2 A;  3I2Z A;  1EQQ A;  2PMZ E;  2A19 A;  2D0O A;  3E9I A;  3K7U C;  4L5Q A;  1VQA A;  2KCM A;  2VZA A;  4R4Q A;  1Q1E A;  4GNX C;  5IP9 H;  2IT1 A;  2D62 A;  5IYC G;  4AQY L;  4A3C G;  4JI8 L;  2E2I H;  1UE6 A;  2H5X A;  4L5S A;  1VQF A;  2PQA B;  4DR7 L;  2ASB A;  3DLL A;  4HJ8 A;  5M3F G;  4AQY Q;  4A76 A;  1PH2 A;  4DR7 Q;  4JI6 Q;  1W2B A;  4A3I H;  4A3K G;  4O0A A;  2HHH L;  3BU2 A;  4KI0 A;  2ZJQ A;  2IHF A;  1E7Z A;  5IP7 H;  4HID A;  1PA6 A;  1Y1V H;  1L2F A;  3F1Z A;  5IYB H;  5FLM G;  2B29 A;  3PF5 A;  2HHH Q;  1V43 A;  3L0O A;  4IPD A;  3H3V I;  3A5U A;  5HGQ A;  2NZO A;  3M7N A;  2Q2T A;  4DV6 L;  4A3D G;  4GN4 B;  4HIM A;  1N36 L;  3HOV H;  3RNU A;  2LSS A;  1HZB A;  4JCV E;  1G29 1;  5HY6 A;  4LF9 L;  1NJI C;  1HZC A;  1NBW A;  4DV6 Q;  4X66 L;  1N36 Q;  5C44 H;  2AKW B;  4UP9 A;  1QUQ B;  3CCM A;  3D0F A;  3ULJ A;  4X66 Q;  2UU9 L;  2Y0S G;  4A93 G;  1WOC A;  2YTX A;  4L5T A;  3PUZ A;  4KLK A;  4JI4 L;  3S2H H;  3OYY A;  4B3R L;  2UU9 Q;  5J3B A;  2MO0 A;  1L1O A;  4OX9 L;  4DK3 C;  3CCV A;  4DV5 Q;  4JBM A;  4JI4 Q;  4X65 Q;  4B3R Q;  5IT9 c;  5JJK A;  1SN8 A;  1VQC A;  4GLV B;  1E22 A;  4LW1 A;  1PH8 A;  1Z9F A;  3Q8D A;  3U50 C;  1SRU A;  4P75 A;  1KRS A;  3CCS A;  2K50 A;  1LUZ A;  2JJQ A;  4GOP C;  2F3I A;  4A3M G;  1PHJ A;  2JA6 G;  1XTD A;  5FJ8 H;  1PH7 A;  1IZ6 A;  4GKK L;  4NXM L;  1BKB A;  4KHP L;  5JJL A;  5C3E G;  2JA7 G;  2NVX H;  2CWA A;  3HOW G;  5E7N A;  4GKK Q;  1VQE A;  1I94 L;  4KHP Q;  4NXM Q;  3FP9 A;  1A62 A;  4EQ5 A;  2N8N A;  1IYJ B;  2CQO A;  1I94 Q;  3KF8 B;  1VQ5 A;  3H3V H;  1N32 L;  5JEA G;  2VQE Q;  4GNX A;  3ICE A;  3TS2 A;  1NMF A;  2LXK A;  4OON A;  1QZG A;  1HH2 P;  4QIW E;  4AYB E;  4B3T Q;  3CD6 A;  1N32 Q;  1V9P A;  2Q2I A;  3I4N H;  1VQN A;  1A63 A;  1U5K A;  4IO9 A;  4O2D A;  1OXU A;  3NEN A;  2YV5 A;  4L5R C;  2I5H A;  2JQO A;  3UE0 A;  3HOY H;  4C2M H;  4HJ5 A;  1KXL A;  1PH4 A;  2E5L Q;  2B63 H;  1PYB A;  2NN6 G;  4DUY Q;  4LF6 L;  1VQ6 A;  2PNH A;  3BJU A;  4GLA C;  3A0J A;  4IJH A;  1U0L A;  4MZ9 A;  4JV5 L;  4LUZ A;  4LF6 Q;  3PUX A;  3S15 H;  1C7Y A;  3RLF A;  1N9W A;  5M3M G;  2A1A A;  1I5F A;  1JE5 A;  1VQP A;  2Z6K C;  3CCU A;  2JA8 H;  2VUM G;  1K0R A;  2N78 A;  4DR6 L;  2ALY B;  2BA0 A;  3W5O A;  2ID0 A;  3T1Y Q;  4BXX H;  4JOI C;  4BBS H;  1LM0 A;  3S16 H;  1GM5 A;  2NVY H;  1K3R A;  3PIP A;  4QQB X;  2GN5 A;  4IFD I;  2I5L X;  4A3F H;  4JC0 A;  3GDE A;  1J6Q A;  1GKH A;  3STB C;  4DK6 C;  5GAD C;  3JAM i;  3OTO L;  3G4S A;  2R7Z G;  2R92 G;  4IJL A;  2UUB L;  1PV4 A;  4OO1 I;  2MFI A;  3UDF A;  4GN3 B;  4P71 A;  1E1T A;  1QVC A;  3L7Z C;  1E24 A;  1MKH A;  1DGS A;  1VQH A;  3H0G H;  3LGJ A;  3GD7 A;  2KCT A;  5IP7 G;  3KJO A;  4EX5 A;  1Y1V G;  2ZM6 L;  5IYB G;  1XMQ L;  3PO3 H;  3IRB A;  3PO2 H;  3KDF A;  4C3I H;  1XPR A;  3UDG A;  1J5E L;  4DAM A;  4ALP A;  4GOP A;  2HIX A;  1PH5 A;  3TRZ A;  1VQK A;  2YTV A;  3K0X A;  3HOU G;  1B70 B;  4BY7 H;  1KIX A;  2YTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...