5M3FG

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
237
structure length
193
Chain Sequence
ARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 32
structure length 193
sequence length 237
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3fG02
3BZCA 1BBWA 3CPWA 3HOYG 1E1OA 5FLMG 1N34L 1UE1A 1QVCA 2UXBQ 5HGQA 1NMGA 3S2HH 1LUZA 1XMQL 1K0RA 2OCEA 2PI2E 4L5QA 4JC0A 4DV5L 3H3VH 4POFA 3UE1A 3I4MG 2EQSA 4X66L 4DR4L 5JJKA 4R4TA 1HR0W 5M3FH 3PO2G 4MZ9A 2E5LQ 2WFWA 3U4ZA 3K7AH 4X65L 3J80i 2Z6KC 1WYDA 1XMOL 3GTLH 4JI7L 1W2BA 1YIJA 1IBMQ 4LFBQ 1IBML 3A5UA 1V43A 3F1ZA 3CCQA 1K8GA 4LFBL 1O7IA 2VS1A 3I2ZA 4TQUS 2R7ZG 3RLOA 1JE5A 2ZJQA 4B3SQ 1AH9A 5IT9c 2F52A 3M85A 4R1JA 1X3EA 2BH8A 4BBRG 5C0XG 2N8NA 3ICEA 2B63H 1E1TA 1K73C 1VQBA 2DGYA 1U5KA 3FHWA 1PH2A 2CCZA 1V1QA 3W1GA 1N32Q 3AFQA 3OTOL 3PO3G 2K14A 4GLVB 3FKIH 3MXNB 4ALPA 2Q2TA 4LF4Q 2ZJPA 2YTYA 1XPUA 2R7ZH 1S40A 4EQ5A 1ASYA 3NBHB 3RLNA 4IFDJ 5GAHC 5GQOA 4AIMA 4BA1I 4AYBE 4YCUA 1X55A 4A3JH 1HNWQ 3GTPH 2KHIA 1PH4A 3ULLA 3PCOB 2JA6H 4X62L 4LF5Q 1GM5A 3F2DA 1VQFA 1A63A 3A0JA 4HJ7A 1AE2A 5C4JH 2JEBI 5IYBG 3J81c 2KCTA 3DM3A 4RG1A 4DR1L 4DPGA 1D7QA 2JEAI 2JJQA 1I94Q 3PF4A 1I5FA 5LMUL 4GOPC 1CKNB 2B29A 4XIGS 3KOJA 4HJ8A 1YJNA 4BY7H 1N36Q 1TXYA 1JJCB 1HH2P 1S3OA 2R92G 4O2DA 1FL0A 4C3JH 2VQEQ 4IOCA 4X6AH 3MEFA 4TVAB 4A3BG 1HZAA 4BY1H 3HOUG 3I7FA 2PMZE 1QZGA 4K0KL 3PSIA 3I55A 4X64L 4HJAA 2UUAQ 4KLKA 3TQYA 1Q86C 3H3VI 3PUZA 4DR3L 4POGA 2KENA 3S15H 3HOXG 1G291 1Y1VG 4XTCS 5IWAL 1VQ7A 4HJ9A 2IY5B 1SRUA 3WWVA 4JYAL 1Q7YC 1GKHA 2OTJA 1Z9FA 3TEHB 1Z47A 2VUMH 2PQAB 5BR8L 3IRBA 3S1QH 5E7NA 1EIFA 5AJ3L 3OW2A 3SGIA 2VY3A 1KQSA 4L5TA 5EAYA 1L0WA 4A76A 5GROA 3I56A 1WFQA 1KAWA 4A75A 4DV5Q 2WB1G 3GDEA 4LF7L 3T1YL 4DV4L 4JBKA 2LSSA 4A3CH 4B3TL 1HZCA 1VQGA 1Y14B 2OQKA 3PV0A 4YCWA 2Y0SG 4YHHQ 1K9MC 4DR6L 4JBMA 4HIKA 4ME3A 3S1NH 1PV4A 4B3ML 1L1OA 4LWCA 1Q82C 4B3SL 2JA9A 4A3BH 3S17H 4A3MG 3HOYH 1UE6A 2ATWA 3PUXA 1WJJA 1LYLA 2B3GA 4PMWA 4DV7Q 4YWLA 1X65A 1Y1WH 1B70B 4GLXA 1N32L 2NVYH 4Y52H 2QEXA 1TWGH 1HNZQ 1UE7A 3AYHB 3HFZB 4YWKA 1PH1A 1S72A 3NELA 3G6EA 3KDFA 2Q2UA 4IO9A 2JA8G 3HOWG 4K0KQ 3CCLA 5GAGC 3CF5A 1VQ6A 4A93G 4JBJA 1QUQA 2BA0A 5DLQE 2K50A 4R4OA 2VUMG 3KJOA 2JA5G 1HNWL 1SE8A 2IX0A 2A19A 5LMNW 2HT1A 1IZ6A 1QVGA 3M7NA 3AFPA 1NY4A 1YEZA 1I50H 2CQOA 2UUCQ 3T1HQ 4JI6L 2UUCL 2R6GA 3GTMH 1PA6A 4GS3A 2YTXA 3KDFB 4WJ4A 1PYSB 4KHPQ 4A3DH 3KYHC 1GO3E 3W5OA 1VQCA 5M5WH 4DV2Q 2K75A 2UXBL 1UWVA 1H95A 3E9HA 4LF9L 1HNXL 5LMUQ 4OO1G 4NXMQ 2VQFQ 3GTOH 4B3RL 2PNHA 4OWXB 2PI2A 1PH3A 1GD7A 5ELOA 5JEAJ 3LGJA 1X3FA 4DR7Q 2E2JH 4GN3B 4JI7Q 4A3MH 1OXXK 4JI3L 4BA2I 2ZTDA 3NEMA 1TWAH 1CSQA 5IYCG 4OX9Q 4DUZL 3K81C 4QIWE 3KF6A 4OX9L 2K5VA 4A3LH 4NXNQ 1NMFA 3I4NG 2XTIA 3JAMi 3I4NH 1G51A 3GTGH 2KHJA 1X9NA 1B8AA 1VQDA 1SMXA 4JI5L 1Q12A 1YI2A 2JE6I 2EIFA 1M90C 4WJ3M 2Y0SE 2K4KA 5GAEC 2PQAA 1EYGA 4GKKQ 2JA5H 4IFDG 4IJHA 1EQQA 2RF4A 4DV1L 2YYZA 2D0PA 1B7YB 5AJ3Q 3CCEA 3JC66 1WOCA 1YBYA 4LUOA 4GNXA 3VDYA 2CWAA 4LF4L 4Y7NH 2CWPA 1YITA 2WP8J 3M4QA 1X56A 4LF8L 1FGUA 4JI1Q 3HOUH 4A3FG 4LF6L 2HHHL 1L2FA 2MO0A 3M3YH 4LF7Q 4IPCA 3ER0A 4GN5A 1K83H 4DV6Q 1FJGQ 4LF5L 1VQAA 3M4PA 3NENA 4JI2Q 5LMNL 1IYJB 3GTKH 1N33L 3H0GH 4JI8Q 2F3IA 5C3EH 2JA8H 1EIYB 3HOWH 4DV3L 1VS0A 1XTDA 1C7YA 2UUBQ 4A93H 2I5LX 1BBUA 4B3MQ 4BY1G 2R93G 2BA1A 2C35B 1PVOA 1N36L 1J5EL 1FVIA 1Y1WG 4DV7L 1CKOA 3CP0A 3RNUA 4A3KH 2QA4A 4A3KG 1MJEA 4JI0L 3BU2A 4OWTB 2VQEL 3I4MH 3K7UC 2ZM6L 1V9PA 4C2MH 3DLLA 2CFMA 1KIXA 2ZTEA 3RR5A 3U4VA 2UUAL 4DR2L 1VQIA 3UDGA 2JQOA 3BJUA 3GD7A 2IX1A 2MNAA 1HJPA 3CPFA 4LFCL 1YHQA 4GKJQ 2FXQA 4LFCQ 1IL2A 4IPHA 5C44H 4GKJL 4YWMA 4P73A 4OWWB 3CCVA 1X3GA 3AEVA 2UU9Q 3F2BA 1JB7A 3KLWA 4GKKL 4H02A 3CCRA 3ULPA 1SFOH 2R7FA 5H1SE 1OXSC 1IBLQ 3RLFA 3F8TA 3EBEA 2ID0A 1N9WA 3PIPA 1YVCA 1HNXQ 4DV2L 1NE3A 4HIDA 2V1CC 1RIPA 3H0GG 1HR0L 1SLJA 2VQFL 1VQ5A 4L5RC 2R92H 3S2DH 1KD1C 2E2HH 2E5LL 4DKAC 4BBRH 4B3TQ 3UE0A 1E24A 1EUJA 3G48A 3D31A 5C0XI 4X64Q 2UXCL 3A5ZB 4NXNL 1CKMA 2K5HA 2YU9H 3I4OA 1YHAA 1JJ2A 2Z0SA 2RCNA 1QZHA 1BVSA 4GNXC 1XPOA 1IBKQ 1C0AA 1XJVA 1OXVA 2Q2HA 3CC7A 2XGTA 3S16H 1HNZL 1LM0A 2GVAA 4P75A 3HOZG 3EIVA 1JJGA 5IP7H 2AWNA 1K3RA 5C0XJ 4JV5L 5JJLA 1WCMH 2WB1E 1Q46A 3E0EA 4R4IA 2IT1A 3J7A5 4LF6Q 4P72A 2HHHQ 2K52A 1VQKA 3S24A 3PUWA 3S1MH 2ASBA 3PO3H 4DUYQ 4C3HH 4PZ6A 1PH5A 1VQ9A 3KF6B 3T1HL 4MNOA 3GTQH 4OO1I 4KHZA 4LW1A 3ZJYC 4NB3A 1XNRL 1Q1EA 2E8GA 4YHHL 2VL6A 2N49A 3CC4A 4HIMA 1VQHA 1XNRQ 4KHPL 2JA7H 5IYDH 1N34Q 4AQYL 2UXDQ 5K36G 1P8LA 1W3SA 4A3JG 3GO5A 4IPGA 4LF9Q 4MTNA 4DV3Q 5J3BA 5IYCH 4DAYB 3TS0A 2I5MX 1VQJA 2L15A 2RHQB 3TREA 1VQLA 3S14H 4JBWA 4DK3C 3ERSX 1J5EQ 1AE3A 2I0QA 2LXKA 4YY3L 1KRSA 4JCVE 1HZ9A 4DR7L 3HKZE 1SN8A 4IPDA 4L5SA 3UDXA 2GVBA 4X65Q 1E22A 3A74A 3U50C 1U0LA 4A3FH 1TWHH 4HJ5A 2DUDA 3KF8B 4GLAC 3CW2C 1HZBA 1PHJA 1EFWA 5IWAQ 1E7ZA 2VW9A 1OXTA 4QL5A 1Q1BA 4LFAL 5IP9G 4JYAQ 5FLXc 3B6YA 5ELNA 2Z6KA 4AH6A 4BXXH 4HIOA 1TWCH 3M4OH 3FP9A 1UEBA 4DR5L 2B63G 1GVPA 4DR5Q 3M9BA 3H15A 4FDBA 2WAQE 3PGZA 4A4IA 2RHSB 4DAMA 1NTGA 4DK6C 3CXCA 4PZ8A 4DV1Q 3KFUA 4A3LG 4QGUA 5C4XG 3U58A 1IBLL 4LF8Q 3HOZH 3J7ZC 1TWFH 1G6PA 5C3EG 1DGSA 2ZJRA 5IYDG 1K8AC 3J80c 1L1OB 2JA7G 4J15A 4A3IH 4P71A 2NZOA 1HR0Q 3CCUA 4BXXG 4OXPA 5GADC 4DV6L 1XNQL 1VCIA 1VQ8A 2ZTCA 3PUYA 4P74A 4JI4Q 4JI4L 4JI8L 4QY7A 5LMNQ 4JI2L 4IOAA 4QQBX 1NBWA 1KC8C 4AQYQ 2NVQH 1YJ9A 2UXDL 1WCMG 1A62A 3AQQA 1YNXA 1N8RC 2CKZB 4EX5A 4JI0Q 1Q8KA 3G4SA 2E2IH 3RN5A 1E3PA 3OYYA 3D0FA 5JEAG 1IBKL 1VQMA 2I5HA 3BZKA 3EN2A 5M5XH 3OTOQ 3KJPA 4QJFA 5IP9H 2ZM6Q 2GN5A 4UPAA 4LUVA 4JV5Q 4UP9A 1A8VA 2IHFA 2MO1A 5IYBH 3HOVG 2R93H 2F4VQ 4DR3Q 3CC2A 2MFIA 3CMAA 2KBNA 3JAMc 5M3MH 4LFAQ 1BKBA 3CCMA 3ULJA 1I6HH 2HIXA 2JK8A 4AYBG 4PZ7A 4JI6Q 3TRZA 5FJ8G 3L0OA 4GNXB 1RL2A 3W1BA 1CUKA 1I3QH 2NN6G 4A3IG 1N33Q 3PF5A 2LXJA 1PH8A 3HOVH 2R7DA 1P16A 1JMCA 1YZ6A 1PH6A 3F2CA 1MKHA 3CCJA 1I94L 2OTLA 5HY6A 2BH2A 1M1KC 4DR1Q 1XMQQ 1CKNA 4B3RQ 5M5YH 2N3SA 4NXML 4UP7A 1QUQB 1UE5A 1VQEA 1PH7A 1X54A 4YY3Q 3E9IA 4UY8C 1XNQQ 5IY0A 4DV4Q 2K5NA 3PO2H 4BBSH 4BBSG 4UP8A 1XMOQ 3G71A 4RMFA 4IFDI 4YCVA 1MJCA 1PYBA 5M3MG 4DR6Q 1LTLA 1EQRA 5C44G 4DUZQ 1VQOA 4NPSA 3CD6A 1L1OC 1SROA 2N78A 1KXLA 3PUVA 1KL9A 5IP7G 2OWOA 4JI5Q 3K8AA 2IHEA 2AMCB 4A3EG 3L7ZC 5M3FG 1A0IA 1WI5A 2AKWB 4R4CA 4APVA 5IE8A 3RN2A 5BR8Q 2YTVA 4KI0A 1IXRA 3RZDH 4DV0Q 2KCMA 4JOIC 1XPRA 3HOXH 1KHIA 4DV0L 2YV5A 4OONA 3CMEA 4PG3A 2ES2A 3STBD 4A3GG 3STBC 1YJWA 1KRTA 1VQNA 4LUZA 4JI1L 4X66Q 4DR4Q 2A1AA 4JOIA 1VQPA 2ALYB 1PH9A 2AWOA 2HQLA 2QGQA 3UDIA 1FJGL 3Q8DA 4DNIA 3T1YQ 2WAQG 1OXUA 2JA6G 2MQHA 1Y1VH 4JG2A 2UXCQ 2UUBL 1ASZA 1EOVA 2H5XA 2A8VA 1X6OA 3CQZH 3GTJH 5JJIA 4A3DG 2NVXH 5FLMH 3HKZG 4A3CG 2EXDA 3J81i 3CAMA 4O0AA 3FKIG 4GOPB 3UDFA 4C3IH 2VZAA 4BY7G 2VNUD 2OQ0A 1OTCA 2NN6I 3HKSA 1D8LA 3PIOA 1JT8A 3CCSA 2Q2IA 5C4XH 4JI3Q 1PFSA 1T9HA 3K80C 4A3GH 4A3EH 1EWIA 1SR3A 4DR2Q 4GOPA 1VQ4A 2D0OA 4GN4B 3J81j 4LNQA 1C9OA 2D62A 2F4VL 3RZOH 2HIVA 1MIUA 1YHBA 3K0XA 2NZHA 1R9TH 4R4QA 1NJIC 1QVFA 2NVTH 5FJ8H 4DUYL 3S1RH 1J6QA 2UU9L 3TS2A 1CSPA 3L2PA 4X62Q 4IJLA 2AHOB 1Q81C
chains in the Genus database with same CATH superfamily
3BZCA 1SJHD 3NXWA 3CPWA 3C3LA 1N34L 2UXBQ 5HGQA 1NMGA 3T53B 2O2LD 4DV5L 4EVOA 1EYAA 2HCIA 5BN5A 1HR0W 5M3FH 1STYA 1HQRD 1EYDA 2WFWA 1D5ZC 4FF4A 2E2HB 1W2BA 5CV8A 4LFBQ 3CCQA 2VB3X 3I2ZA 3G6JB 4IN3A 4CDEC 1HA6A 1II3A 1X3EA 3GV6A 4BBRG 1TWCB 3ICEA 1K73C 1PH2A 3W1GA 1N32Q 4K6LA 3AFQA 3PO3G 4Q0FA 3SDZA 3MXNB 4ALPA 4IALA 1DCZA 2YTYA 1FNUA 2R7ZH 1STHA 5FKAC 1ASYA 4IFDJ 1ENCA 4A3JH 1X55A 3BG3A 4KKUA 3OHXC 1PH4A 2JA6H 3HOXB 1UNSA 4HJ7A 2KCTA 1EL0A 4DPGA 4C56C 2JA8B 4G7OC 4HJ8A 3KOJA 2H1EA 2EVBA 1N36Q 2A73B 3T51B 1HH2P 1FD7D 3WOEA 2R92G 2VQEQ 3U9OA 2ZXOA 4A3BG 3HOUG 3I55A 3C1FA 2NVQB 1Q86C 1FR3A 1EY7A 5EGTA 5C3WA 2NVTB 3S15H 2XRQD 1SE4A 3U9SA 1TKWB 4HJ9A 2IY5B 2B2VC 3LWEA 4JYAL 3D4RA 4YIJA 5KGUA 1U9RA 4RFBA 3T13A 1HUNA 3TEHB 2VUMH 3NSWA 2SOBA 1DXMA 2IJ0A 4QF4A 1A2TA 3DEPA 4A76A 4HCSA 1OO9B 3VR4A 4J1MA 5IT9E 4B3TL 1HZCA 1PTOD 2EY2A 1F2ZA 2KQ3A 4B3ML 2OT2A 1SFOB 3S17H 2N55A 1IKLA 1UE6A 1EY0A 1E2VA 2B3GA 4PMWA 1X65A 2Z4HA 4Y52H 1KABA 1TWFB 3BYYB 4YWKA 1NAPA 1PH1A 3NELA 4HN7A 2CH4A 4NKLA 3KDFA 4R8NA 2Q2UA 4IO9A 3HG9A 2JA8G 4KY6A 1WTVA 1BQQT 1QUQA 1SBBB 1H9KA 3FPPA 3NK9A 3KJOA 1SE8A 1PZID 1S4ZA 3PIP3 2F0TA 2BCOA 5T1IA 1QVGA 1PRTD 2CQOA 2K32A 5CV7A 3T1HQ 1PA6A 4GS3A 2YTXA 1KDBA 2GA4B 1QWYA 2XNAC 1V1PA 5C3XA 3W5OA 2WKCA 3E9HA 4OO1G 1WTXA 4OWXB 1TS4A 1PH3A 3HKZB 1V1OA 3LGJA 4GN3B 4JI3L 4BA2I 1SYFA 2ZTDA 3NEMA 2Z9HA 3HOVB 2RKSA 1QG7A 3K81C 1RDPD 4K5VA 2XTIA 1X9NA 1B8AA 3CKIB 1SMXA 1EIGA 2RDFA 4PMCA 2JE6I 4A3IB 1M90C 3MFYA 2Y0SE 1EYGA 4WJWA 4IJHA 4DV1L 2D0PA 1B7YB 5AJ3Q 4LUOA 4GNXA 4LF4L 2JN4A 2CWAA 4Y7NH 4HCEA 4JI1Q 3OPOA 4A3FG 2J0TD 2WKDA 1YNND 4DV6Q 4LF5L 3NENA 4DN4M 5ELDA 2F3IA 5C3EH 4DV3L 1UUPA 2WIIB 3QJYA 2V4DA 4DV7L 5CORA 1BCPF 1SAPA 3HOZB 1JWSD 3I4MH 4C2MH 1EYCA 1H9SB 2ZTEA 3UDGA 5IGFA 3GD7A 2MGSA 1SNDA 2ICEC 1YHQA 1IL2A 3BYTB 4IPHA 4YWMA 5NUCA 3C46A 4ID6A 4P73A 4ODGA 4KD3A 3AEVA 4C3JG 1HUMA 3MTSA 2Z8LA 4GKKL 5IGEA 5EKIA 2H4OA 5E1FA 3RLFA 2CW0D 3F2UA 3EBEA 2ID0A 3PIPA 4HIDA 2CQAA 1Q8IA 1RIPA 4DXFA 2F3WA 2VQFL 2R92H 3VYSA 1F9SA 4L6TB 4DKAC 1GUTA 3RD4A 1EY5A 2RSNA 1E24A 4XQNA 5C0XI 2FHTA 2UXCL 3A5ZB 1HTPA 3K6OA 4NXNL 1CKMA 2YU9H 2Z0SA 1KTKA 2RCNA 3FRPB 1BVSA 3I91A 1IBKQ 2EY1A 2Q2HA 3CC7A 5LL6X 1K8MA 4CDDC 1F2LA 3MFGA 3HOZG 1JJGA 5C0XJ 2DJFC 4B9XA 1Q46A 3E0EA 4R4IA 3DUZA 4LF6Q 3SXHA 2HHHQ 4CJ1B 3Q23A 1VQKA 1DONA 3PO3H 2M2LA 4PZ6A 1FNWA 1AP0A 5C4HA 5M5WB 5COYA 2JA7H 5IYDH 4JVZA 4AQYL 1CI3M 2UXDQ 1P8LA 1B1ZA 2KJXA 1STBA 5J3BA 4DAYB 2DY8A 2L15A 1DM0B 4JBWA 1AE3A 4DR7L 3HKZE 4IPDA 4X65Q 3D8GA 1E22A 3A74A 1U0LA 3EVQA 2KHSA 2K6AA 2L55A 1PHJA 2XRSD 1JQYD 4K5XA 1Q1BA 1QNKA 4RGOS 5FLXc 2Z6KA 3R2TA 3H94A 2F1MA 1ILPA 1UEBA 4DR5Q 4IUVA 3H15A 3PGZA 3BS1A 4EQNA 4A3LG 4LF8Q 3HOZH 1TWFH 3D6CA 3NQTA 1G6PA 1DGSA 4JPBW 3J80c 2A6EC 3P7JA 3I72A 4P71A 4A3IH 4H7BA 2DY7A 1XNQL 2RA4A 1VQ8A 5J39A 2PMZB 4JI4L 1G2SA 5LMNQ 5JVG3 1K83B 1KC8C 1YJ9A 2KA7A 2IWHA 3NTHA 1WCMG 3AQQA 3HOUB 4HEDA 2A68D 2NN6H 1EIHA 2L0CA 5DM63 4JI0Q 2F0HA 2E2IH 3SK8A 3RN5A 1CFMA 3OYYA 3D0FA 1G2TA 4G7ZC 3BZDB 3EN2A 5M5XH 4Q5VA 2L9HA 2O5JC 4JV5Q 2R93H 4DR3Q 3IL8A 3HS0C 1SNOA 3CC2A 3CMAA 1HRJA 1WTHA 4ZYSA 4DNTB 3ULJA 2HIXA 1K8OA 1CHPD 5JEAH 4AYBG 1UEAB 5FK9C 3W1BA 3PF5A 2LXJA 3HOVH 2EXZA 2JSOA 3EA6A 3F2CA 3CCJA 2OTLA 4H13C 1M1KC 1XMQQ 1CKNA 4TRDA 5M5YH 4QMGA 2A6HC 1X54A 4BBSG 2B2WC 4UY8C 2K5NA 3G71A 4IFDI 1JWMD 2D9UA 3MVVA 1MJCA 4DR6Q 5ELBA 2EYMA 2PCFB 5IGGA 2K7VA 5I9OA 1L1OC 2K5WA 1HFNA 4IZ8A 3PUVA 3L7ZC 3K58A 1A0IA 1WI5A 4DNRB 3J80E 4A3BB 5BR8Q 3A55A 4DV0Q 2G9DA 3GTKB 3TZUA 3HZXA 2WV6D 2WAQB 1EQVA 3A8IE 5KNCA 4OONA 3HOXH 1GOZA 4PG3A 1M4VA 1B9MA 3STBD 5IODA 3STBC 1YJWA 4JI1L 2A68C 4X66Q 2ALYB 2QGQA 5BN4A 3UDIA 1X3PA 1B44D 1YNJC 1TWGB 2F0KA 4L63B 2B2YA 4JG2A 1BNZA 1I4RA 4G4KA 4DK0A 1E0BA 2UXCQ 3H91A 2NYZD 3HKZG 2EXDA 1IW7C 3R8BA 4C3IH 4H0LC 1JB3A 1BOSA 3CHBD 1G8ZD 4CHTB 1T9HA 2NVYB 2K04A 1AN8A 1D6EC 3MA2B 1SR3A 1VQ4A 2KECA 2IW3A 2BDNA 1C9OA 2HIVA 1R9TH 2JA6B 2KEEA 4R4QA 3H0GB 3S1RH 2K5DA 3S1QB 4IJLA 2AHOB 4POFA 3MXUA 3FPUB 4ZKBB 1E1OA 5FLMG 1LT4D 1MHWC 1UE1A 2Z1CA 2A6ED 4OHJA 3GTMB 2QCPX 3OWEB 2YU9B 2A74C 1K0RA 3UE1A 4DAPA 4EQPA 4DR4L 5JJKA 3ONAB 3PO2G 2RSOA 4XXEA 3TZDA 2LS01 3U4ZA 3K7AH 4X65L 3BVMA 1XMOL 3GTLH 3S9WA 1PYWD 1JCKB 1IBML 3A5UA 3K59A 3TBIB 1O7IA 4C1NK 2VS1A 4TQUS 1YNNC 3RLOA 4NDXA 1WD0A 3J7AF 1AH9A 1S5BD 2F52A 3ND8A 1E1TA 1VQBA 1WTOA 4KY5A 1ZYRC 2K14A 3EFXD 4GLVB 1PLFA 1YNJD 3DEOA 1XPUA 2FMMA 1TVXA 4EQ5A 2AQ2B 1I3QB 3RLNA 2K33A 3NTKA 2LMCB 4YCUA 4A3DB 2KHIA 1LLRD 2F0JA 1RJTA 3GTLB 2E2DC 4RGNA 2AQ1B 3M7GA 2JEBI 1CQVA 3KBGA 4XQQA 2JYOA 3OWFA 2K05A 3QIAA 2JJQA 4OEMB 2B2WA 1I94Q 1GHKA 1CKNB 2CVRA 3OSOA 1STAA 5FO9B 4BY7H 4IUNA 5C5MA 1JJCB 3P1HA 1S3OA 4O2DA 4ABNA 3MEFA 1JICA 1HZAA 4BY1H 3I7FA 2PMZE 4K0KL 4KLKA 2AUJD 3H3VI 2B2VA 4DR3L 4POGA 3NTIA 4XTCS 2B8FA 1VQ7A 3FDTA 1SRUA 5AFWA 1C48A 4K5WA 3K57A 1JOQA 2OTJA 1A3UA 5C4XB 2PQAB 2F0EA 2J4XA 2DN8A 2VY3A 1HHVA 1D2BA 3I56A 1KAWA 2CHBD 2WB1G 4LF7L 2TMPA 3T1YL 4MHEA 2C5CA 2EDGA 1VQGA 1BCPB 4YCWA 2Y0SG 1K9MC 4DR6L 1FGBD 1PV4A 1JOKA 4LWCA 3MWYW 2JA9A 1SSOA 1WJJA 1LT5D 1LYLA 3SR1A 4DAVA 1R4PB 1Y1WH 4PV1C 4GLXA 1U4LA 2NVYH 2XVSA 1N32L 2QEXA 1HNZQ 3AYHB 1S72A 3L3OC 4NMZA 3G6EA 5EBCA 1AEXA 2TSSA 4CKEA 2F0DA 5GAGC 3OIPA 4FXGC 3AB9A 4JBJA 5FO7B 2BA0A 5HURA 4IFDH 2L5TA 3KUPA 2JA5G 1HNWL 4F7XA 3GTQB 1EWCA 2A19A 1CK1A 4FO2A 3AFPA 1DYQA 1ET9A 5FLXE 1I50H 3S1MB 1XTCD 2UUCL 3GTMH 3N6RA 5KRUA 2FJ2A 1EY8A 5JOBA 3M4OB 3KDFB 1WTRA 1PYSB 2FMCA 4X3UA 5M5WH 4DV2Q 2K75A 2UXBL 3N52A 4O1NA 5I6YA 4NXMQ 3GTOH 3SK4A 3S1RB 4AYBB 3A7LA 1W6KA 4DR7Q 4JI7Q 1XXGA 4FP5D 3T4AC 4C1NI 4A3MH 1TS2A 2B63B 1CSQA 3E3XA 4WORA 4DUZL 3ERQA 1PFMA 1TS3A 4A3LH 1NMFA 3JAMi 3I4NH 1G51A 3LNNA 2ZXPA 2QW7A 3TSSA 3NWSA 2R93B 4M8AA 1Q12A 2EIFA 3K7AB 1TR5A 2K4KA 2PQAA 3ITPA 3TMEA 2JA5H 1EQQA 2YYZA 3CCEA 1WOCA 3TDQA 2CWPA 4LF8L 5CMDA 2MO0A 3E6ZX 3M3YH 4IPCA 1JOOA 1K83H 4GN5A 2IX3A 4EGVA 1Y8NB 1NSNS 4JI2Q 4RHSA 3GTKH 3H0GH 2JA8H 1VS0A 3I3CA 5K36H 4B3MQ 2Q8RE 2R93G 1LTAD 2BA1A 2C35B 4PNYA 2F0WA 3RNUA 2QA4A 4A3KG 1MJEA 4JI0L 3QO2A 2VQEL 1ICWA 2ZM6L 2CFMA 3LX0A 2UUAL 4DR2L 2N88A 2JQOA 3VA5A 1HJPA 2FXQA 4LFCQ 3X3MA 3S17B 4RHRA 1SFOH 1QCBD 1Y69U 2R7FA 4FVMA 2NBFA 1OXSC 1KAAA 5E3FA 1N9WA 2MUYA 4R8IA 1NE3A 3H0GG 5CV6A 1SLJA 1VQ5A 4L5RC 2E2HH 3L9AX 2HDMA 2P5ZX 2QDLA 3D31A 3VR3A 1DD2A 1WTPA 1PRTC 1QB5D 3DXJC 3I4OA 5IIFA 3SK5A 1YHAA 4N8FA 4DAYA 3S16H 3H09A 2GVAA 2AWNA 1K3RA 1IW7D 3ZYYX 2RDGA 2IT1A 3J7A5 4FXKC 3J7AV 3S1MH 2ASBA 4C3HH 1PH5A 3GTQH 3GTGB 3CC4A 2VL6A 1XNRQ 4CKBA 4IUPA 1ESRA 4A3JG 1I4XA 1SYDA 3MXGA 2EPBA 3GP7A 3M4YA 4MTNA 4HTHA 5IYCH 1LO5D 2RDHA 4LK1C 5ISRA 1VQLA 4DK3C 3ERSX 1PFBA 4CJ2C 2M00A 1EOTA 1S5ED 2GVBA 3O13A 1TWHH 2DUDA 5IT9L 3S1NB 1HZBA 1C4QA 1E7ZA 3E5SA 1CTMA 4LFAL 1VF7A 1PZJD 4KHVA 4LJZC 1NR4A 5EPLA 4HIOA 1TWCH 4G7HC 4WFN3 3D4DA 4EQOA 4DR5L 3M9BA 2RHSB 4G57A 1NTGA 4DK6C 4DV1Q 4MIUA 5G3LF 2F0OA 1IBLL 2NTTA 3FMCA 3J7ZC 4V190 4CDFC 4BXXG 1HR0Q 1B4OA 5EKKA 3LWUA 1SE2A 1TY0A 4B08A 2ZTCA 3X3NA 4JI4Q 3PQIA 4JI8L 1PXUA 2NUCA 3QR8A 2PW7A 5JPMC 4AQYQ 2UXDL 3Q24A 4HMJA 2XN9C 1A62A 1MBYA 3H6MA 1YNXA 1A6XA 5D65A 1Y8OB 3IAYA 3BZKA 2E74C 5ELFA 4C3HB 5LHY1 3FVQA 2O5IC 5EPJA 4QIWB 4I7ZC 4UAIA 3I4LA 5JPNC 3OMCA 5M3MH 1BKBA 4J8QA 4B9WA 2JK8A 4JI6Q 1ZEQX 4GNXB 1EZ8A 1I3QH 1PH8A 5HY6A 2BH2A 3I4NB 4NXML 5CV4A 1LTTD 1UE5A 1VQEA 1B3AA 3URYA 5A35A 2FINB 4YY3Q 1XNQQ 5IY0A 5EQ0A 3R2IA 1SNMA 4YCVA 3T16A 2A69C 4N9PA 4DUZQ 1VQOA 1SROA 1Z7TA 2N78A 1KL9A 2A5HA 1HXYD 4QB4A 2OWOA 2AMCB 3J81L 3I4MB 5FO8B 4LMQD 3MXNA 5FLXL 4KI0A 4JOIC 2YV5A 3CRKC 3VA7A 1TT2A 4A3GG 1VQNA 1IL8A 4ZLTF 1VQPA 5CBAE 4DNIA 3T1YQ 1GUWA 1V8QA 2JA6G 2BOSA 2MQHA 1JE4A 4MTKA 2F0LA 1X6OA 4L8JA 3V96A 4FXDA 3MHBA 2NVXH 3KBXA 4A3CG 3J81i 1FYCA 3FKIG 3UDFA 4C2MB 2VZAA 4BY7G 2NN6I 3HKSA 3PIOA 4NP5A 4A3EH 5TSSA 4Z9CB 1EWIA 4DR2Q 2D0OA 1CHQD 4JK1C 3NBIA 1F77A 2D62A 2F4VL 3RZOH 1MIUA 1U4PA 1YHBA 2NZHA 2NVTH 1QVFA 3TS2A 1PTOB 2UU9L 1CSPA 4OELB 4X62Q 1Q81C 4K14A 4XYOA 1NUCA 1Z6HA 3AU7A 2I46A 4M1UB 1CQFA 1XMQL 2OCEA 3AMUA 1LACA 2PI2E 3H3VH 3DHQA 3I4MG 4X66L 2MPMA 2Z6KC 4JI7L 1IBMQ 2G9HD 4QUFA 5I2XA 1K8GA 1S5FD 5FOBB 4B3SQ 5IT9c 3M85A 4R1JA 4RKBA 5ELEA 2BH8A 3GTJB 5C0XG 2CCZA 1U5KA 3FHWA 1V1QA 1CA5A 3OTOL 2SNSA 1RHPA 3FKIH 2JXMB 2E75C 1BDOA 2Q2TA 2ZJPA 1IYUA 4BA1I 4X3TA 2OF1A 3GTPH 1JWUD 3ULLA 3I90A 5IGCA 1GM5A 5KEEA 1VQFA 1A63A 1LTID 5IYBG 1NNXA 2B2YC 3IKJA 2C9OA 2E76C 1STEA 1QNUA 1BXTA 1I5FA 5LMUL 3HOWB 4A93B 4C3IG 1T5EA 5I2YA 1TXYA 3QWNA 4C3JH 1FL0A 4IOCA 3S2HB 3CQZB 1JORA 3CRLC 3PSIA 2UUAQ 3TQYA 3PUZA 1TU2B 2KENA 1F2YA 1ML0D 1BO0A 1Q7YC 4ZKCB 1IYVA 1Z9FA 3J80L 5BR8L 3IRBA 3S1QH 3J81E 1KQSA 4L5TA 1L0WA 2JP1A 5GROA 1WFQA 5M5XB 4A75A 4ZCKA 4DV5Q 4CGYB 1ENAA 3DMUA 4JBKA 1X3QA 2LSSA 4A3CH 2Z4IA 1Y14B 2OQKA 4YHHQ 1GXDC 1EY9A 1SEBD 1MSHA 2IPKD 2X69A 3GTOB 3D3RA 1CT1D 1Q82C 3PO2B 4A3MG 3HOYH 2ATWA 3A8KE 2ENBA 5CYUA 4YWLA 2EYFA 1B70B 4A3EB 2D5DA 4KK7A 1TWGH 3HFZB 1O7YA 2X6LA 2EJMA 1H9SA 3HOWG 4K0KQ 4A93G 3CF5A 2NVXB 5DLQE 1DOKA 4R4OA 5KNBA 2VUMG 1MSGA 2AUKA 2IX0A 1IZ6A 1H9JA 3VYRA 3M7NA 1H9MA 1NY4A 4KN7C 4JI6L 3W3AA 2UUCQ 3MZ5A 2EYOA 2A69D 2R6GA 1LTGD 5KYLA 3KLRA 3A8JE 1DJRD 4WJ4A 3HEJA 3KYHC 1GO3E 1VF5C 1BCPD 1HNXL 2VQFQ 1PTOH 1SYEA 2PNHA 1QILA 3VR6A 3NP8A 5CC4A 1GD7A 2F0NA 1PMRA 5JEAJ 3UI2A 2E2JH 1OXXK 1TWAH 2RQXA 1EEID 3KF6A 4OX9L 2QEJC 2K5VA 1Q3LA 2EJGC 3I4NG 2FFKB 4ZAIA 1ET6A 2ICIA 1YI2A 1BBXC 1X32A 4A3GB 4UHVA 4ZK9B 1F2MA 5IGBA 2RF4A 3I70A 3JC66 3WOFA 1KLGD 4XYQA 1YITA 2WP8J 4K8JA 1X56A 3KLSA 2RVLA 3ER0A 3H3VC 1VQAA 3M4PA 4JW0A 2AQ3B 1RKNA 1IYJB 1N33L 4JI8Q 5M9OA 1BUVT 1JC7A 4KN4C 1TY2A 4IURA 2I5LX 1BBUA 4BY1G 3SE0A 2G5DA 3Q0AA 1J5EL 1Y1WG 4A3KH 2F0VA 1XWEA 5D3DA 2EJFC 5L37A 2LY7A 1G6ZA 2B2UC 4OWTB 1B2TA 1WD1A 3K7UC 1C8CA 3DLLA 3RR5A 3U4VA 5I6WA 3BJUA 2MNAA 3CPFA 1KNAA 4LFCL 3K0YA 4GKJL 3OIQA 3CCVA 4U673 2ZT9C 1I6VC 1CZGA 4X3KA 2UU9Q 2HUGA 1SDFA 2SEBD 3KLWA 3QOLA 4A3FB 4H02A 3ULPA 1XX8A 1RODA 5CGKA 3PMFA 2DNEA 4OO1H 5A2QE 1B3QA 3S2DH 2E5LL 4PQXA 4DXGA 3K5OA 3S14B 2DNCA 3HGBA 3UE0A 4U68A 4KTAA 2VXWA 1G91A 2K5HA 1SNPA 5CR3A 1JJ2A 3TP7A 1ILQA 1QZHA 4ZQ3A 1XPOA 1AFPA 1TWHB 1OXVA 2XGTA 1STNA 1HNZL 1LM0A 3EIVA 5IP7H 2PZTA 3RUZA 2L12A 4KY7A 2KCCA 2EYJA 4P72A 1T5XD 3PUWA 4DUYQ 4IUQA 2IL8A 2EY5A 2Z6BA 4KHZA 4LW1A 4F8MA 1BCPC 1XNRL 4YHHL 2N49A 4KHPL 1VQHA 1QJOA 2XWJB 1ENFA 5K36G 1SYCA 1W3SA 3GO5A 4LF9Q 4DV3Q 5C4JB 3TS0A 2I5MX 5K5PA 3S14H 2NTSA 4CDCC 2LXKA 1KRSA 1SN8A 4P2CB 3UDXA 5C44B 3S16B 2KVMA 2HCCA 3U50C 2E2JB 3K5LA 2R92B 1U4MA 5IWAQ 2VW9A 1OXTA 1O78A 3BDLA 2BE5C 2BE5D 4ME5A 3FP9A 2B63G 1GVPA 4BS9A 4FDBA 1KLUD 3CXCA 1WVLA 4K2KA 4QGUA 2K01A 4I7AA 5C3EG 1L1OB 1VCIA 3V2TA 3VYTA 4P74A 1D5XC 3PUYA 4C3HG 2J7ZA 2F0FA 5KYIA 4JI2L 5D3IB 4IOAA 4QQBX 2NVQH 2PNRC 2PO4A 2CKZB 1Q8KA 4GZYC 3HP3A 5JEAG 1IBKL 2I5HA 3KJPA 3OTOQ 4QJFA 2ZM6Q 2GN5A 4UPAA 3NE5B 4LUVA 1KDCA 4S3SA 4UP9A 1A8VA 2IHFA 4RKLA 5LL6S 4DGZA 3HOVG 4A3MB 2PYKA 2KBNA 4LFAQ 1HQMC 2MHVA 3TRZA 1VMPA 2Y0SB 1RL2A 5E4XA 1CUKA 2NN6G 1N33Q 1FNVA 1P16A 1JMCA 2QILA 5KIXA 4B3RQ 2N3SA 1HPCA 4UP7A 2PQEA 1QUQB 5G3LD 1A2UA 1TWAB 4DV4Q 3PO2H 4UP8A 1XMOQ 4RMFA 1I4PA 1PYBA 5M3MG 1LTLA 1EQRA 5C44G 4NPSA 4V0BA 3VR2A 3NPPA 1KXLA 5IP7G 1Y8PB 2XWBB 4RGMA 4JI5Q 3K8AA 2IHEA 1EU3A 4A3EG 2AKWB 4APVA 3RN2A 5C4ZA 2YTVA 1IXRA 1XPRA 2KCMA 1KHIA 2DJGC 3I8ZA 2ES2A 4RA8A 2VUMB 1CA6A 2RCFA 3M3YB 1R4QB 5KNDA 2BDOA 2F03A 1PH9A 2AWOA 3TP8A 1FJGL 3Q8DA 1PRTB 2WAQG 1OXUA 3VR5A 3S15B 2HQEA 3W2DA 2UUBL 1ASZA 1EOVA 2H5XA 2A8VA 3CQZH 3D6WA 1VMCA 3GTJH 5JJIA 3DWPA 3G7LA 5EKLA 1O7LA 1EU4A 1OTCA 1LTBD 3BDOA 3DWAA 3JAML 2Q2IA 5E4WC 5C4XH 3CCSA 2CW0C 3K80C 3TP5A 5I4DA 4GOPA 4BY1B 3OOCA 3J81j 2PZUA 4RGTA 4R9WA 1LT6D 3K0XA 4MN3A 2RBMA 2K28A 1RCVD 5FJ8H 4DUYL 1J6QA 1F9PA 3L2PA 4GOPB 2M9VA 4N8X1 1BBWA 3HOYG 2F0IA 3WDNA 1QVCA 4C3JB 1LUZA 2ZXRA 3S2HH 2F0PA 4L5QA 1PRTF 1HFGA 4JC0A 4XDXA 2EQSA 4R4TA 4MZ9A 2E5LQ 4CJ0B 1IKMA 4OIJA 3J80i 1WYDA 1ONLA 1YIJA 4DF7A 1XYIA 4LFBL 1V43A 3F1ZA 5EPKA 4HSVA 5C6AA 2R7ZG 3K5MA 1JE5A 2ZJQA 1Y1WB 1LABA 4XT1B 3GTPB 2N8NA 4FF2A 2B63H 2DGYA 1ESFA 3V05A 1LTRD 2R7ZB 1I4HA 3KF8A 4K8IA 4LF4Q 1SMYD 1S40A 1PZKD 3NBHB 1EWHA 1Q90A 5T1GA 5GAHC 5GQOA 4AIMA 1HNWQ 4AYBE 4J6HA 1MI2A 4F87A 3PCOB 5DM73 1SJED 4X62L 5M5YB 4LF5Q 3F2DA 4KJNA 1KDAA 3A0JA 3OW7A 1AE2A 5C4JH 2Q8TA 1ZXTA 3J7YW 3NUCA 3HRZC 3J81c 4DU9A 2NB0A 3DM3A 4RG1A 4DR1L 3HOYB 1D7QA 2JEAI 3PF4A 1NR2A 4GOPC 4XIGS 2B29A 1AZQA 1YJNA 1WTWA 1LT3D 1CM9A 2WACA 2SDFA 1EY4A 4X6AH 3R93A 4TVAB 1HA5A 2XSCA 2PPBC 1QZGA 2X6GA 1J8IA 4X64L 3E0JA 4HJAA 2B2TC 4OL7A 4E6IA 3JAME 3HOXG 1G291 1Y1VG 2KOLA 5IWAL 1DZ1A 4BY7B 4XQJA 1F9RA 3MC0B 3WWVA 1QOHA 3RZOB 3GQBA 1GKHA 4RH6A 2SNMA 5M3MB 5C0XH 1Z47A 2F0UA 5E7NA 1RTNA 1EIFA 2F0QA 5AJ3L 3SGIA 3OW2A 4F88A 1GHJA 2R61A 5EAYA 1I6HB 2B39A 3BDCA 3GDEA 4DV4L 4O42A 2I07B 4HAEA 1K3BC 4H44C 1ZYRD 2CH4W 3PV0A 4BWGB 5IOCA 4JBMA 1GUNA 3EJIA 4HIKA 1Y1VB 4ME3A 3S1NH 1EZ6A 4A3BH 1L1OA 4B3SL 3PUXA 4DV7Q 2KCNA 2K1BA 4DA2A 1L0YB 4DFAA 3SEBA 1UE7A 5DEHA 2PW5A 1E2WA 3CCLA 1VQ6A 2OEOA 2K50A 2A6HD 5LMNW 2HT1A 1YEZA 3VYUA 4X3SA 4WRDA 4KHPQ 4A3DH 4TSSA 4KKSA 1H95A 1VQCA 1UWVA 3RMHA 4LF9L 5LMUQ 4B3RL 3QG1A 5EBDA 1WTQA 2PI2A 3T56B 5ELOA 5J22A 2EYLA 1X3FA 4BBSB 4RWSC 5IYCG 4OX9Q 4QIWE 1R9TB 3NHHA 4NXNQ 3GTGH 2KHJA 4C3IB 3R3OA 1GJXA 1VQDA 2NZ1D 4JI5L 3GV3A 4WJ3M 2F0MA 5GAEC 4GKKQ 2D2CC 4IFDG 1WCMB 5BN3A 1YBYA 3VDYA 4KD4A 1MD2D 1JR0D 3M4QA 1FGUA 3HOUH 4LF6L 2HHHL 1L2FA 1V1PB 2Q8IB 4LF7Q 4IQZA 2L1BA 1FJGQ 1W6JA 1K0SA 1DOMA 5JAVA 5LMNL 1I4GA 2L11A 4LAAA 1EIYB 3HOWH 1C7YA 2UUBQ 1XTDA 4A93H 3QB3A 1S5DD 1U4RA 2WINB 4KJOA 1AZPA 4BBRB 1PVOA 4FF3A 2K5QA 3NQIA 1N36L 1FVIA 1CKOA 3CP0A 1SE3A 2EYHA 3BU2A 3KK7A 1A3TA 3DWQA 1V9PA 1LTSD 1KIXA 1D1KA 1VQIA 2IX1A 1EFID 5F2DA 1EY6A 4GKJQ 5C44H 4OWWB 3TN2A 3FEWX 1X3GA 1F9QA 3QOJA 3F2BA 1JB7A 1A15A 4QCLA 3CCRA 4KMUC 4PMBA 5H1SE 1D5MC 1IBLQ 3F8TA 2B2UA 1EEFD 1YVCA 1HNXQ 4DV2L 1A3VA 1TQOA 2JA5B 2V1CC 1HR0L 4RCNA 1K28A 4RCOA 1KD1C 3P75A 3SK6A 2L4NA 4BBRH 4B3TQ 5JJZA 1EQTA 4ZUJA 1EUJA 5M3FB 3G48A 4X64Q 2QF7A 4QUCA 3PIO3 1SYGA 2F3VA 1O80A 2B2TA 3DM1A 1MGSA 1O7ZA 2LFNA 4RAUC 4GNXC 2R3ZA 1NCVA 2MP1A 1C0AA 1XJVA 3CU7A 1RTOA 2B8GA 2F0SA 3MEHA 4P75A 2HD3A 4JV5L 5JJLA 4HMIA 1WCMH 2WB1E 2WB1B 3EROA 3BVGA 2K52A 3S24A 1KNEA 5IGDA 3S2DB 4UDUC 1VQ9A 3KF6B 3T1HL 4MNOA 4OO1I 2QDBA 3ZJYC 3OMGA 5A2QL 4NB3A 4IUUA 1Q1EA 2E8GA 4ZUIA 1SYBA 3IFDA 4HIMA 1IHZA 2EYPA 3I73A 1N34Q 2OXPA 2NWGA 4IPGA 3A7AB 2LKVA 1VQJA 2RHQB 3TREA 1J5EQ 2QKIC 3P20A 2I0QA 4YY3L 4JCVE 1PTOF 1HZ9A 4K2LA 2F0GA 4L5SA 1ICFB 3NBHA 1B50A 1RD9D 4A3JB 2E2IB 4A3FH 4HJ5A 1D1IA 3KF8B 4GLAC 3CW2C 1PDQA 1EFWA 4QL5A 1DOLA 5CV9A 5IP9G 4JYAQ 4A3KB 3RZDB 3B6YA 5ELNA 4KV6A 1ZKOA 4AH6A 4BXXH 1L0XB 3MXPA 3M4OH 3A54A 4IUTA 2EZVA 5I9PA 2WAQE 4A4IA 4DAMA 1I50B 3KFUA 4PZ8A 1J9OA 2XIWA 3U58A 4ZRZA 1SNCA 5HGTA 2HDLA 2ZJRA 5IYDG 1K8AC 2JA7G 5C4XG 3BVZA 4J15A 2NZOA 1STGA 3CCUA 4OXPA 3SHLA 5GADC 4DV6L 1SXTA 3K5NA 1SMYC 4TKOB 1E2ZA 4Y7NB 4K6DA 4QY7A 3Q6SA 1NBWA 3PO3B 2F4IA 5J1ZA 5EJWA 1RF2D 1UAPA 1N8RC 4I65A 4EX5A 3G4SA 1E3PA 1VQMA 4FYDA 5JVH3 5IP9H 1PTOC 3ND9A 4ULLA 1TIID 4FF1A 3A56A 2MO1A 5IYBH 1GUSA 2F4VQ 4KKTA 2EY6A 2MFIA 3JAMc 3Q22A 2VB2X 2JA7B 3CCMA 1I6HH 5CBEE 5C3EB 1QE6A 1S5CD 4PZ7A 1H9RA 5FJ8G 4ILWA 3L0OA 1PFNA 4OGQC 4CKCA 4A3IG 4NW2A 2R7DA 1YZ6A 1PH6A 1MKHA 4FNFA 1I94L 4DR1Q 4HSPA 1PH7A 3E9IA 4BBSH 1LV9A 5ELCA 1TS5A 4N9TA 1BF4A 2MJ8A 3CD6A 3FKIB 1CZWA 5C5LA 2KEDA 1B9NA 5M3FG 3MAQA 3D4WA 3EQLC 4R4CA 5DAUA 5IE8A 3RZDH 2EOTA 2EE1A 2K03A 3C1EA 3C2PA 2O4XA 4DV0L 2PZWA 3CMEA 1I4QA 1BR9A 1KRTA 3TP6A 4LUZA 4DR4Q 2A1AA 4JOIA 2HQLA 3NWTA 1Y1VH 1HCZA 3KLSX 4CBVA 1AW7A 1B53A 4A3DG 5FLMH 3CAMA 4O0AA 1HTLD 2KUMA 5D14A 2VNUD 4OIKA 2OQ0A 1M8AA 1D8LA 1GUOA 4XT3B 5CV5A 1JT8A 4JI3Q 1PFSA 1GUGA 5DNFA 4A3GH 3IFTA 3SVMA 4GN4B 4LNQA 4HR7B 1NJIC 1SNQA 4DK1A 1VDZA
chains in the Genus database with same CATH topology
3BZCA 1BBWA 3CPWA 3HOYG 1E1OA 5FLMG 1N34L 1UE1A 1QVCA 2UXBQ 5HGQA 1NMGA 3S2HH 1LUZA 1XMQL 1K0RA 2OCEA 2PI2E 4L5QA 4JC0A 4DV5L 3H3VH 4POFA 3UE1A 3I4MG 2EQSA 4X66L 4DR4L 5JJKA 4R4TA 1HR0W 5M3FH 3PO2G 4MZ9A 2E5LQ 2WFWA 3U4ZA 3K7AH 4X65L 3J80i 2Z6KC 1WYDA 1XMOL 3GTLH 4JI7L 1W2BA 1YIJA 1IBMQ 4LFBQ 1IBML 3A5UA 1V43A 3F1ZA 3CCQA 1K8GA 4LFBL 1O7IA 2VS1A 3I2ZA 4TQUS 2R7ZG 3RLOA 1JE5A 2ZJQA 4B3SQ 1AH9A 5IT9c 2F52A 3M85A 4R1JA 1X3EA 2BH8A 4BBRG 5C0XG 2N8NA 3ICEA 2B63H 1E1TA 1K73C 1VQBA 2DGYA 1U5KA 3FHWA 1PH2A 2CCZA 1V1QA 3W1GA 1N32Q 3AFQA 3OTOL 3PO3G 2K14A 4GLVB 3FKIH 3MXNB 4ALPA 2Q2TA 4LF4Q 2ZJPA 2YTYA 1XPUA 2R7ZH 1S40A 4EQ5A 1ASYA 3NBHB 3RLNA 4IFDJ 5GAHC 5GQOA 4AIMA 4BA1I 4AYBE 4YCUA 1X55A 4A3JH 1HNWQ 3GTPH 2KHIA 1PH4A 3ULLA 3PCOB 2JA6H 4X62L 4LF5Q 1GM5A 3F2DA 1VQFA 1A63A 3A0JA 4HJ7A 1AE2A 5C4JH 2JEBI 5IYBG 3J81c 2KCTA 3DM3A 4RG1A 4DR1L 4DPGA 1D7QA 2JEAI 2JJQA 1I94Q 3PF4A 1I5FA 5LMUL 4GOPC 1CKNB 2B29A 4XIGS 3KOJA 4HJ8A 1YJNA 4BY7H 1N36Q 1TXYA 1JJCB 1HH2P 1S3OA 2R92G 4O2DA 1FL0A 4C3JH 2VQEQ 4IOCA 4X6AH 3MEFA 4TVAB 4A3BG 1HZAA 4BY1H 3HOUG 3I7FA 2PMZE 1QZGA 4K0KL 3PSIA 3I55A 4X64L 4HJAA 2UUAQ 4KLKA 3TQYA 1Q86C 3H3VI 3PUZA 4DR3L 4POGA 2KENA 3S15H 3HOXG 1G291 1Y1VG 4XTCS 5IWAL 1VQ7A 4HJ9A 2IY5B 1SRUA 3WWVA 4JYAL 1Q7YC 1GKHA 2OTJA 1Z9FA 3TEHB 1Z47A 2VUMH 2PQAB 5BR8L 3IRBA 3S1QH 5E7NA 1EIFA 5AJ3L 3OW2A 3SGIA 2VY3A 1KQSA 4L5TA 5EAYA 1L0WA 4A76A 5GROA 3I56A 1WFQA 1KAWA 4A75A 4DV5Q 2WB1G 3GDEA 4LF7L 3T1YL 4DV4L 4JBKA 2LSSA 4A3CH 4B3TL 1HZCA 1VQGA 1Y14B 2OQKA 3PV0A 4YCWA 2Y0SG 4YHHQ 1K9MC 4DR6L 4JBMA 4HIKA 4ME3A 3S1NH 1PV4A 4B3ML 1L1OA 4LWCA 1Q82C 4B3SL 2JA9A 4A3BH 3S17H 4A3MG 3HOYH 1UE6A 2ATWA 3PUXA 1WJJA 1LYLA 2B3GA 4PMWA 4DV7Q 4YWLA 1X65A 1Y1WH 1B70B 4GLXA 1N32L 2NVYH 4Y52H 2QEXA 1TWGH 1HNZQ 1UE7A 3AYHB 3HFZB 4YWKA 1PH1A 1S72A 3NELA 3G6EA 3KDFA 2Q2UA 4IO9A 2JA8G 3HOWG 4K0KQ 3CCLA 5GAGC 3CF5A 1VQ6A 4A93G 4JBJA 1QUQA 2BA0A 5DLQE 2K50A 4R4OA 2VUMG 3KJOA 2JA5G 1HNWL 1SE8A 2IX0A 2A19A 5LMNW 2HT1A 1IZ6A 1QVGA 3M7NA 3AFPA 1NY4A 1YEZA 1I50H 2CQOA 2UUCQ 3T1HQ 4JI6L 2UUCL 2R6GA 3GTMH 1PA6A 4GS3A 2YTXA 3KDFB 4WJ4A 1PYSB 4KHPQ 4A3DH 3KYHC 1GO3E 3W5OA 1VQCA 5M5WH 4DV2Q 2K75A 2UXBL 1UWVA 1H95A 3E9HA 4LF9L 1HNXL 5LMUQ 4OO1G 4NXMQ 2VQFQ 3GTOH 4B3RL 2PNHA 4OWXB 2PI2A 1PH3A 1GD7A 5ELOA 5JEAJ 3LGJA 1X3FA 4DR7Q 2E2JH 4GN3B 4JI7Q 4A3MH 1OXXK 4JI3L 4BA2I 2ZTDA 3NEMA 1TWAH 1CSQA 5IYCG 4OX9Q 4DUZL 3K81C 4QIWE 3KF6A 4OX9L 2K5VA 4A3LH 4NXNQ 1NMFA 3I4NG 2XTIA 3JAMi 3I4NH 1G51A 3GTGH 2KHJA 1X9NA 1B8AA 1VQDA 1SMXA 4JI5L 1Q12A 1YI2A 2JE6I 2EIFA 1M90C 4WJ3M 2Y0SE 2K4KA 5GAEC 2PQAA 1EYGA 4GKKQ 2JA5H 4IFDG 4IJHA 1EQQA 2RF4A 4DV1L 2YYZA 2D0PA 1B7YB 5AJ3Q 3CCEA 3JC66 1WOCA 1YBYA 4LUOA 4GNXA 3VDYA 2CWAA 4LF4L 4Y7NH 2CWPA 1YITA 2WP8J 3M4QA 1X56A 4LF8L 1FGUA 4JI1Q 3HOUH 4A3FG 4LF6L 2HHHL 1L2FA 2MO0A 3M3YH 4LF7Q 4IPCA 3ER0A 4GN5A 1K83H 4DV6Q 1FJGQ 4LF5L 1VQAA 3M4PA 3NENA 4JI2Q 5LMNL 1IYJB 3GTKH 1N33L 3H0GH 4JI8Q 2F3IA 5C3EH 2JA8H 1EIYB 3HOWH 4DV3L 1VS0A 1XTDA 1C7YA 2UUBQ 4A93H 2I5LX 1BBUA 4B3MQ 4BY1G 2R93G 2BA1A 2C35B 1PVOA 1N36L 1J5EL 1FVIA 1Y1WG 4DV7L 1CKOA 3CP0A 3RNUA 4A3KH 2QA4A 4A3KG 1MJEA 4JI0L 3BU2A 4OWTB 2VQEL 3I4MH 3K7UC 2ZM6L 1V9PA 4C2MH 3DLLA 2CFMA 1KIXA 2ZTEA 3RR5A 3U4VA 2UUAL 4DR2L 1VQIA 3UDGA 2JQOA 3BJUA 3GD7A 2IX1A 2MNAA 1HJPA 3CPFA 4LFCL 1YHQA 4GKJQ 2FXQA 4LFCQ 1IL2A 4IPHA 5C44H 4GKJL 4YWMA 4P73A 4OWWB 3CCVA 1X3GA 3AEVA 2UU9Q 3F2BA 1JB7A 3KLWA 4GKKL 4H02A 3CCRA 3ULPA 1SFOH 2R7FA 5H1SE 1OXSC 1IBLQ 3RLFA 3F8TA 3EBEA 2ID0A 1N9WA 3PIPA 1YVCA 1HNXQ 4DV2L 1NE3A 4HIDA 2V1CC 1RIPA 3H0GG 1HR0L 1SLJA 2VQFL 1VQ5A 4L5RC 2R92H 3S2DH 1KD1C 2E2HH 2E5LL 4DKAC 4BBRH 4B3TQ 3UE0A 1E24A 1EUJA 3G48A 3D31A 5C0XI 4X64Q 2UXCL 3A5ZB 4NXNL 1CKMA 2K5HA 2YU9H 3I4OA 1YHAA 1JJ2A 2Z0SA 2RCNA 1QZHA 1BVSA 4GNXC 1XPOA 1IBKQ 1C0AA 1XJVA 1OXVA 2Q2HA 3CC7A 2XGTA 3S16H 1HNZL 1LM0A 2GVAA 4P75A 3HOZG 3EIVA 1JJGA 5IP7H 2AWNA 1K3RA 5C0XJ 4JV5L 5JJLA 1WCMH 2WB1E 1Q46A 3E0EA 4R4IA 2IT1A 3J7A5 4LF6Q 4P72A 2HHHQ 2K52A 1VQKA 3S24A 3PUWA 3S1MH 2ASBA 3PO3H 4DUYQ 4C3HH 4PZ6A 1PH5A 1VQ9A 3KF6B 3T1HL 4MNOA 3GTQH 4OO1I 4KHZA 4LW1A 3ZJYC 4NB3A 1XNRL 1Q1EA 2E8GA 4YHHL 2VL6A 2N49A 3CC4A 4HIMA 1VQHA 1XNRQ 4KHPL 2JA7H 5IYDH 1N34Q 4AQYL 2UXDQ 5K36G 1P8LA 1W3SA 4A3JG 3GO5A 4IPGA 4LF9Q 4MTNA 4DV3Q 5J3BA 5IYCH 4DAYB 3TS0A 2I5MX 1VQJA 2L15A 2RHQB 3TREA 1VQLA 3S14H 4JBWA 4DK3C 3ERSX 1J5EQ 1AE3A 2I0QA 2LXKA 4YY3L 1KRSA 4JCVE 1HZ9A 4DR7L 3HKZE 1SN8A 4IPDA 4L5SA 3UDXA 2GVBA 4X65Q 1E22A 3A74A 3U50C 1U0LA 4A3FH 1TWHH 4HJ5A 2DUDA 3KF8B 4GLAC 3CW2C 1HZBA 1PHJA 1EFWA 5IWAQ 1E7ZA 2VW9A 1OXTA 4QL5A 1Q1BA 4LFAL 5IP9G 4JYAQ 5FLXc 3B6YA 5ELNA 2Z6KA 4AH6A 4BXXH 4HIOA 1TWCH 3M4OH 3FP9A 1UEBA 4DR5L 2B63G 1GVPA 4DR5Q 3M9BA 3H15A 4FDBA 2WAQE 3PGZA 4A4IA 2RHSB 4DAMA 1NTGA 4DK6C 3CXCA 4PZ8A 4DV1Q 3KFUA 4A3LG 4QGUA 5C4XG 3U58A 1IBLL 4LF8Q 3HOZH 3J7ZC 1TWFH 1G6PA 5C3EG 1DGSA 2ZJRA 5IYDG 1K8AC 3J80c 1L1OB 2JA7G 4J15A 4A3IH 4P71A 2NZOA 1HR0Q 3CCUA 4BXXG 4OXPA 5GADC 4DV6L 1XNQL 1VCIA 1VQ8A 2ZTCA 3PUYA 4P74A 4JI4Q 4JI4L 4JI8L 4QY7A 5LMNQ 4JI2L 4IOAA 4QQBX 1NBWA 1KC8C 4AQYQ 2NVQH 1YJ9A 2UXDL 1WCMG 1A62A 3AQQA 1YNXA 1N8RC 2CKZB 4EX5A 4JI0Q 1Q8KA 3G4SA 2E2IH 3RN5A 1E3PA 3OYYA 3D0FA 5JEAG 1IBKL 1VQMA 2I5HA 3BZKA 3EN2A 5M5XH 3OTOQ 3KJPA 4QJFA 5IP9H 2ZM6Q 2GN5A 4UPAA 4LUVA 4JV5Q 4UP9A 1A8VA 2IHFA 2MO1A 5IYBH 3HOVG 2R93H 2F4VQ 4DR3Q 3CC2A 2MFIA 3CMAA 2KBNA 3JAMc 5M3MH 4LFAQ 1BKBA 3CCMA 3ULJA 1I6HH 2HIXA 2JK8A 4AYBG 4PZ7A 4JI6Q 3TRZA 5FJ8G 3L0OA 4GNXB 1RL2A 3W1BA 1CUKA 1I3QH 2NN6G 4A3IG 1N33Q 3PF5A 2LXJA 1PH8A 3HOVH 2R7DA 1P16A 1JMCA 1YZ6A 1PH6A 3F2CA 1MKHA 3CCJA 1I94L 2OTLA 5HY6A 2BH2A 1M1KC 4DR1Q 1XMQQ 1CKNA 4B3RQ 5M5YH 2N3SA 4NXML 4UP7A 1QUQB 1UE5A 1VQEA 1PH7A 1X54A 4YY3Q 3E9IA 4UY8C 1XNQQ 5IY0A 4DV4Q 2K5NA 3PO2H 4BBSH 4BBSG 4UP8A 1XMOQ 3G71A 4RMFA 4IFDI 4YCVA 1MJCA 1PYBA 5M3MG 4DR6Q 1LTLA 1EQRA 5C44G 4DUZQ 1VQOA 4NPSA 3CD6A 1L1OC 1SROA 2N78A 1KXLA 3PUVA 1KL9A 5IP7G 2OWOA 4JI5Q 3K8AA 2IHEA 2AMCB 4A3EG 3L7ZC 5M3FG 1A0IA 1WI5A 2AKWB 4R4CA 4APVA 5IE8A 3RN2A 5BR8Q 2YTVA 4KI0A 1IXRA 3RZDH 4DV0Q 2KCMA 4JOIC 1XPRA 3HOXH 1KHIA 4DV0L 2YV5A 4OONA 3CMEA 4PG3A 2ES2A 3STBD 4A3GG 3STBC 1YJWA 1KRTA 1VQNA 4LUZA 4JI1L 4X66Q 4DR4Q 2A1AA 4JOIA 1VQPA 2ALYB 1PH9A 2AWOA 2HQLA 2QGQA 3UDIA 1FJGL 3Q8DA 4DNIA 3T1YQ 2WAQG 1OXUA 2JA6G 2MQHA 1Y1VH 4JG2A 2UXCQ 2UUBL 1ASZA 1EOVA 2H5XA 2A8VA 1X6OA 3CQZH 3GTJH 5JJIA 4A3DG 2NVXH 5FLMH 3HKZG 4A3CG 2EXDA 3J81i 3CAMA 4O0AA 3FKIG 4GOPB 3UDFA 4C3IH 2VZAA 4BY7G 2VNUD 2OQ0A 1OTCA 2NN6I 3HKSA 1D8LA 3PIOA 1JT8A 3CCSA 2Q2IA 5C4XH 4JI3Q 1PFSA 1T9HA 3K80C 4A3GH 4A3EH 1EWIA 1SR3A 4DR2Q 4GOPA 1VQ4A 2D0OA 4GN4B 3J81j 4LNQA 1C9OA 2D62A 2F4VL 3RZOH 2HIVA 1MIUA 1YHBA 3K0XA 2NZHA 1R9TH 4R4QA 1NJIC 1QVFA 2NVTH 5FJ8H 4DUYL 3S1RH 1J6QA 2UU9L 3TS2A 1CSPA 3L2PA 4X62Q 4IJLA 2AHOB 1Q81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BZC A;  1BBW A;  3CPW A;  3HOY G;  1E1O A;  5FLM G;  1N34 L;  1UE1 A;  1QVC A;  2UXB Q;  5HGQ A;  1NMG A;  3S2H H;  1LUZ A;  1XMQ L;  1K0R A;  2OCE A;  2PI2 E;  4L5Q A;  4JC0 A;  4DV5 L;  3H3V H;  4POF A;  3UE1 A;  3I4M G;  2EQS A;  4X66 L;  4DR4 L;  5JJK A;  4R4T A;  1HR0 W;  5M3F H;  3PO2 G;  4MZ9 A;  2E5L Q;  2WFW A;  3U4Z A;  3K7A H;  4X65 L;  3J80 i;  2Z6K C;  1WYD A;  1XMO L;  3GTL H;  4JI7 L;  1W2B A;  1YIJ A;  1IBM Q;  4LFB Q;  1IBM L;  3A5U A;  1V43 A;  3F1Z A;  3CCQ A;  1K8G A;  4LFB L;  1O7I A;  2VS1 A;  3I2Z A;  4TQU S;  2R7Z G;  3RLO A;  1JE5 A;  2ZJQ A;  4B3S Q;  1AH9 A;  5IT9 c;  2F52 A;  3M85 A;  4R1J A;  1X3E A;  2BH8 A;  4BBR G;  5C0X G;  2N8N A;  3ICE A;  2B63 H;  1E1T A;  1K73 C;  1VQB A;  2DGY A;  1U5K A;  3FHW A;  1PH2 A;  2CCZ A;  1V1Q A;  3W1G A;  1N32 Q;  3AFQ A;  3OTO L;  3PO3 G;  2K14 A;  4GLV B;  3FKI H;  3MXN B;  4ALP A;  2Q2T A;  4LF4 Q;  2ZJP A;  2YTY A;  1XPU A;  2R7Z H;  1S40 A;  4EQ5 A;  1ASY A;  3NBH B;  3RLN A;  4IFD J;  5GAH C;  5GQO A;  4AIM A;  4BA1 I;  4AYB E;  4YCU A;  1X55 A;  4A3J H;  1HNW Q;  3GTP H;  2KHI A;  1PH4 A;  3ULL A;  3PCO B;  2JA6 H;  4X62 L;  4LF5 Q;  1GM5 A;  3F2D A;  1VQF A;  1A63 A;  3A0J A;  4HJ7 A;  1AE2 A;  5C4J H;  2JEB I;  5IYB G;  3J81 c;  2KCT A;  3DM3 A;  4RG1 A;  4DR1 L;  4DPG A;  1D7Q A;  2JEA I;  2JJQ A;  1I94 Q;  3PF4 A;  1I5F A;  5LMU L;  4GOP C;  1CKN B;  2B29 A;  4XIG S;  3KOJ A;  4HJ8 A;  1YJN A;  4BY7 H;  1N36 Q;  1TXY A;  1JJC B;  1HH2 P;  1S3O A;  2R92 G;  4O2D A;  1FL0 A;  4C3J H;  2VQE Q;  4IOC A;  4X6A H;  3MEF A;  4TVA B;  4A3B G;  1HZA A;  4BY1 H;  3HOU G;  3I7F A;  2PMZ E;  1QZG A;  4K0K L;  3PSI A;  3I55 A;  4X64 L;  4HJA A;  2UUA Q;  4KLK A;  3TQY A;  1Q86 C;  3H3V I;  3PUZ A;  4DR3 L;  4POG A;  2KEN A;  3S15 H;  3HOX G;  1G29 1;  1Y1V G;  4XTC S;  5IWA L;  1VQ7 A;  4HJ9 A;  2IY5 B;  1SRU A;  3WWV A;  4JYA L;  1Q7Y C;  1GKH A;  2OTJ A;  1Z9F A;  3TEH B;  1Z47 A;  2VUM H;  2PQA B;  5BR8 L;  3IRB A;  3S1Q H;  5E7N A;  1EIF A;  5AJ3 L;  3OW2 A;  3SGI A;  2VY3 A;  1KQS A;  4L5T A;  5EAY A;  1L0W A;  4A76 A;  5GRO A;  3I56 A;  1WFQ A;  1KAW A;  4A75 A;  4DV5 Q;  2WB1 G;  3GDE A;  4LF7 L;  3T1Y L;  4DV4 L;  4JBK A;  2LSS A;  4A3C H;  4B3T L;  1HZC A;  1VQG A;  1Y14 B;  2OQK A;  3PV0 A;  4YCW A;  2Y0S G;  4YHH Q;  1K9M C;  4DR6 L;  4JBM A;  4HIK A;  4ME3 A;  3S1N H;  1PV4 A;  4B3M L;  1L1O A;  4LWC A;  1Q82 C;  4B3S L;  2JA9 A;  4A3B H;  3S17 H;  4A3M G;  3HOY H;  1UE6 A;  2ATW A;  3PUX A;  1WJJ A;  1LYL A;  2B3G A;  4PMW A;  4DV7 Q;  4YWL A;  1X65 A;  1Y1W H;  1B70 B;  4GLX A;  1N32 L;  2NVY H;  4Y52 H;  2QEX A;  1TWG H;  1HNZ Q;  1UE7 A;  3AYH B;  3HFZ B;  4YWK A;  1PH1 A;  1S72 A;  3NEL A;  3G6E A;  3KDF A;  2Q2U A;  4IO9 A;  2JA8 G;  3HOW G;  4K0K Q;  3CCL A;  5GAG C;  3CF5 A;  1VQ6 A;  4A93 G;  4JBJ A;  1QUQ A;  2BA0 A;  5DLQ E;  2K50 A;  4R4O A;  2VUM G;  3KJO A;  2JA5 G;  1HNW L;  1SE8 A;  2IX0 A;  2A19 A;  5LMN W;  2HT1 A;  1IZ6 A;  1QVG A;  3M7N A;  3AFP A;  1NY4 A;  1YEZ A;  1I50 H;  2CQO A;  2UUC Q;  3T1H Q;  4JI6 L;  2UUC L;  2R6G A;  3GTM H;  1PA6 A;  4GS3 A;  2YTX A;  3KDF B;  4WJ4 A;  1PYS B;  4KHP Q;  4A3D H;  3KYH C;  1GO3 E;  3W5O A;  1VQC A;  5M5W H;  4DV2 Q;  2K75 A;  2UXB L;  1UWV A;  1H95 A;  3E9H A;  4LF9 L;  1HNX L;  5LMU Q;  4OO1 G;  4NXM Q;  2VQF Q;  3GTO H;  4B3R L;  2PNH A;  4OWX B;  2PI2 A;  1PH3 A;  1GD7 A;  5ELO A;  5JEA J;  3LGJ A;  1X3F A;  4DR7 Q;  2E2J H;  4GN3 B;  4JI7 Q;  4A3M H;  1OXX K;  4JI3 L;  4BA2 I;  2ZTD A;  3NEM A;  1TWA H;  1CSQ A;  5IYC G;  4OX9 Q;  4DUZ L;  3K81 C;  4QIW E;  3KF6 A;  4OX9 L;  2K5V A;  4A3L H;  4NXN Q;  1NMF A;  3I4N G;  2XTI A;  3JAM i;  3I4N H;  1G51 A;  3GTG H;  2KHJ A;  1X9N A;  1B8A A;  1VQD A;  1SMX A;  4JI5 L;  1Q12 A;  1YI2 A;  2JE6 I;  2EIF A;  1M90 C;  4WJ3 M;  2Y0S E;  2K4K A;  5GAE C;  2PQA A;  1EYG A;  4GKK Q;  2JA5 H;  4IFD G;  4IJH A;  1EQQ A;  2RF4 A;  4DV1 L;  2YYZ A;  2D0P A;  1B7Y B;  5AJ3 Q;  3CCE A;  3JC6 6;  1WOC A;  1YBY A;  4LUO A;  4GNX A;  3VDY A;  2CWA A;  4LF4 L;  4Y7N H;  2CWP A;  1YIT A;  2WP8 J;  3M4Q A;  1X56 A;  4LF8 L;  1FGU A;  4JI1 Q;  3HOU H;  4A3F G;  4LF6 L;  2HHH L;  1L2F A;  2MO0 A;  3M3Y H;  4LF7 Q;  4IPC A;  3ER0 A;  4GN5 A;  1K83 H;  4DV6 Q;  1FJG Q;  4LF5 L;  1VQA A;  3M4P A;  3NEN A;  4JI2 Q;  5LMN L;  1IYJ B;  3GTK H;  1N33 L;  3H0G H;  4JI8 Q;  2F3I A;  5C3E H;  2JA8 H;  1EIY B;  3HOW H;  4DV3 L;  1VS0 A;  1XTD A;  1C7Y A;  2UUB Q;  4A93 H;  2I5L X;  1BBU A;  4B3M Q;  4BY1 G;  2R93 G;  2BA1 A;  2C35 B;  1PVO A;  1N36 L;  1J5E L;  1FVI A;  1Y1W G;  4DV7 L;  1CKO A;  3CP0 A;  3RNU A;  4A3K H;  2QA4 A;  4A3K G;  1MJE A;  4JI0 L;  3BU2 A;  4OWT B;  2VQE L;  3I4M H;  3K7U C;  2ZM6 L;  1V9P A;  4C2M H;  3DLL A;  2CFM A;  1KIX A;  2ZTE A;  3RR5 A;  3U4V A;  2UUA L;  4DR2 L;  1VQI A;  3UDG A;  2JQO A;  3BJU A;  3GD7 A;  2IX1 A;  2MNA A;  1HJP A;  3CPF A;  4LFC L;  1YHQ A;  4GKJ Q;  2FXQ A;  4LFC Q;  1IL2 A;  4IPH A;  5C44 H;  4GKJ L;  4YWM A;  4P73 A;  4OWW B;  3CCV A;  1X3G A;  3AEV A;  2UU9 Q;  3F2B A;  1JB7 A;  3KLW A;  4GKK L;  4H02 A;  3CCR A;  3ULP A;  1SFO H;  2R7F A;  5H1S E;  1OXS C;  1IBL Q;  3RLF A;  3F8T A;  3EBE A;  2ID0 A;  1N9W A;  3PIP A;  1YVC A;  1HNX Q;  4DV2 L;  1NE3 A;  4HID A;  2V1C C;  1RIP A;  3H0G G;  1HR0 L;  1SLJ A;  2VQF L;  1VQ5 A;  4L5R C;  2R92 H;  3S2D H;  1KD1 C;  2E2H H;  2E5L L;  4DKA C;  4BBR H;  4B3T Q;  3UE0 A;  1E24 A;  1EUJ A;  3G48 A;  3D31 A;  5C0X I;  4X64 Q;  2UXC L;  3A5Z B;  4NXN L;  1CKM A;  2K5H A;  2YU9 H;  3I4O A;  1YHA A;  1JJ2 A;  2Z0S A;  2RCN A;  1QZH A;  1BVS A;  4GNX C;  1XPO A;  1IBK Q;  1C0A A;  1XJV A;  1OXV A;  2Q2H A;  3CC7 A;  2XGT A;  3S16 H;  1HNZ L;  1LM0 A;  2GVA A;  4P75 A;  3HOZ G;  3EIV A;  1JJG A;  5IP7 H;  2AWN A;  1K3R A;  5C0X J;  4JV5 L;  5JJL A;  1WCM H;  2WB1 E;  1Q46 A;  3E0E A;  4R4I A;  2IT1 A;  3J7A 5;  4LF6 Q;  4P72 A;  2HHH Q;  2K52 A;  1VQK A;  3S24 A;  3PUW A;  3S1M H;  2ASB A;  3PO3 H;  4DUY Q;  4C3H H;  4PZ6 A;  1PH5 A;  1VQ9 A;  3KF6 B;  3T1H L;  4MNO A;  3GTQ H;  4OO1 I;  4KHZ A;  4LW1 A;  3ZJY C;  4NB3 A;  1XNR L;  1Q1E A;  2E8G A;  4YHH L;  2VL6 A;  2N49 A;  3CC4 A;  4HIM A;  1VQH A;  1XNR Q;  4KHP L;  2JA7 H;  5IYD H;  1N34 Q;  4AQY L;  2UXD Q;  5K36 G;  1P8L A;  1W3S A;  4A3J G;  3GO5 A;  4IPG A;  4LF9 Q;  4MTN A;  4DV3 Q;  5J3B A;  5IYC H;  4DAY B;  3TS0 A;  2I5M X;  1VQJ A;  2L15 A;  2RHQ B;  3TRE A;  1VQL A;  3S14 H;  4JBW A;  4DK3 C;  3ERS X;  1J5E Q;  1AE3 A;  2I0Q A;  2LXK A;  4YY3 L;  1KRS A;  4JCV E;  1HZ9 A;  4DR7 L;  3HKZ E;  1SN8 A;  4IPD A;  4L5S A;  3UDX A;  2GVB A;  4X65 Q;  1E22 A;  3A74 A;  3U50 C;  1U0L A;  4A3F H;  1TWH H;  4HJ5 A;  2DUD A;  3KF8 B;  4GLA C;  3CW2 C;  1HZB A;  1PHJ A;  1EFW A;  5IWA Q;  1E7Z A;  2VW9 A;  1OXT A;  4QL5 A;  1Q1B A;  4LFA L;  5IP9 G;  4JYA Q;  5FLX c;  3B6Y A;  5ELN A;  2Z6K A;  4AH6 A;  4BXX H;  4HIO A;  1TWC H;  3M4O H;  3FP9 A;  1UEB A;  4DR5 L;  2B63 G;  1GVP A;  4DR5 Q;  3M9B A;  3H15 A;  4FDB A;  2WAQ E;  3PGZ A;  4A4I A;  2RHS B;  4DAM A;  1NTG A;  4DK6 C;  3CXC A;  4PZ8 A;  4DV1 Q;  3KFU A;  4A3L G;  4QGU A;  5C4X G;  3U58 A;  1IBL L;  4LF8 Q;  3HOZ H;  3J7Z C;  1TWF H;  1G6P A;  5C3E G;  1DGS A;  2ZJR A;  5IYD G;  1K8A C;  3J80 c;  1L1O B;  2JA7 G;  4J15 A;  4A3I H;  4P71 A;  2NZO A;  1HR0 Q;  3CCU A;  4BXX G;  4OXP A;  5GAD C;  4DV6 L;  1XNQ L;  1VCI A;  1VQ8 A;  2ZTC A;  3PUY A;  4P74 A;  4JI4 Q;  4JI4 L;  4JI8 L;  4QY7 A;  5LMN Q;  4JI2 L;  4IOA A;  4QQB X;  1NBW A;  1KC8 C;  4AQY Q;  2NVQ H;  1YJ9 A;  2UXD L;  1WCM G;  1A62 A;  3AQQ A;  1YNX A;  1N8R C;  2CKZ B;  4EX5 A;  4JI0 Q;  1Q8K A;  3G4S A;  2E2I H;  3RN5 A;  1E3P A;  3OYY A;  3D0F A;  5JEA G;  1IBK L;  1VQM A;  2I5H A;  3BZK A;  3EN2 A;  5M5X H;  3OTO Q;  3KJP A;  4QJF A;  5IP9 H;  2ZM6 Q;  2GN5 A;  4UPA A;  4LUV A;  4JV5 Q;  4UP9 A;  1A8V A;  2IHF A;  2MO1 A;  5IYB H;  3HOV G;  2R93 H;  2F4V Q;  4DR3 Q;  3CC2 A;  2MFI A;  3CMA A;  2KBN A;  3JAM c;  5M3M H;  4LFA Q;  1BKB A;  3CCM A;  3ULJ A;  1I6H H;  2HIX A;  2JK8 A;  4AYB G;  4PZ7 A;  4JI6 Q;  3TRZ A;  5FJ8 G;  3L0O A;  4GNX B;  1RL2 A;  3W1B A;  1CUK A;  1I3Q H;  2NN6 G;  4A3I G;  1N33 Q;  3PF5 A;  2LXJ A;  1PH8 A;  3HOV H;  2R7D A;  1P16 A;  1JMC A;  1YZ6 A;  1PH6 A;  3F2C A;  1MKH A;  3CCJ A;  1I94 L;  2OTL A;  5HY6 A;  2BH2 A;  1M1K C;  4DR1 Q;  1XMQ Q;  1CKN A;  4B3R Q;  5M5Y H;  2N3S A;  4NXM L;  4UP7 A;  1QUQ B;  1UE5 A;  1VQE A;  1PH7 A;  1X54 A;  4YY3 Q;  3E9I A;  4UY8 C;  1XNQ Q;  5IY0 A;  4DV4 Q;  2K5N A;  3PO2 H;  4BBS H;  4BBS G;  4UP8 A;  1XMO Q;  3G71 A;  4RMF A;  4IFD I;  4YCV A;  1MJC A;  1PYB A;  5M3M G;  4DR6 Q;  1LTL A;  1EQR A;  5C44 G;  4DUZ Q;  1VQO A;  4NPS A;  3CD6 A;  1L1O C;  1SRO A;  2N78 A;  1KXL A;  3PUV A;  1KL9 A;  5IP7 G;  2OWO A;  4JI5 Q;  3K8A A;  2IHE A;  2AMC B;  4A3E G;  3L7Z C;  5M3F G;  1A0I A;  1WI5 A;  2AKW B;  4R4C A;  4APV A;  5IE8 A;  3RN2 A;  5BR8 Q;  2YTV A;  4KI0 A;  1IXR A;  3RZD H;  4DV0 Q;  2KCM A;  4JOI C;  1XPR A;  3HOX H;  1KHI A;  4DV0 L;  2YV5 A;  4OON A;  3CME A;  4PG3 A;  2ES2 A;  3STB D;  4A3G G;  3STB C;  1YJW A;  1KRT A;  1VQN A;  4LUZ A;  4JI1 L;  4X66 Q;  4DR4 Q;  2A1A A;  4JOI A;  1VQP A;  2ALY B;  1PH9 A;  2AWO A;  2HQL A;  2QGQ A;  3UDI A;  1FJG L;  3Q8D A;  4DNI A;  3T1Y Q;  2WAQ G;  1OXU A;  2JA6 G;  2MQH A;  1Y1V H;  4JG2 A;  2UXC Q;  2UUB L;  1ASZ A;  1EOV A;  2H5X A;  2A8V A;  1X6O A;  3CQZ H;  3GTJ H;  5JJI A;  4A3D G;  2NVX H;  5FLM H;  3HKZ G;  4A3C G;  2EXD A;  3J81 i;  3CAM A;  4O0A A;  3FKI G;  4GOP B;  3UDF A;  4C3I H;  2VZA A;  4BY7 G;  2VNU D;  2OQ0 A;  1OTC A;  2NN6 I;  3HKS A;  1D8L A;  3PIO A;  1JT8 A;  3CCS A;  2Q2I A;  5C4X H;  4JI3 Q;  1PFS A;  1T9H A;  3K80 C;  4A3G H;  4A3E H;  1EWI A;  1SR3 A;  4DR2 Q;  4GOP A;  1VQ4 A;  2D0O A;  4GN4 B;  3J81 j;  4LNQ A;  1C9O A;  2D62 A;  2F4V L;  3RZO H;  2HIV A;  1MIU A;  1YHB A;  3K0X A;  2NZH A;  1R9T H;  4R4Q A;  1NJI C;  1QVF A;  2NVT H;  5FJ8 H;  4DUY L;  3S1R H;  1J6Q A;  2UU9 L;  3TS2 A;  1CSP A;  3L2P A;  4X62 Q;  4IJL A;  2AHO B;  1Q81 C; 
#chains in the Genus database with same CATH topology
 3BZC A;  1SJH D;  3NXW A;  3CPW A;  3C3L A;  1N34 L;  2UXB Q;  5HGQ A;  1NMG A;  3T53 B;  2O2L D;  4DV5 L;  4EVO A;  1EYA A;  2HCI A;  5BN5 A;  1HR0 W;  5M3F H;  1STY A;  1HQR D;  1EYD A;  2WFW A;  1D5Z C;  4FF4 A;  2E2H B;  1W2B A;  5CV8 A;  4LFB Q;  3CCQ A;  2VB3 X;  3I2Z A;  3G6J B;  4IN3 A;  4CDE C;  1HA6 A;  1II3 A;  1X3E A;  3GV6 A;  4BBR G;  1TWC B;  3ICE A;  1K73 C;  1PH2 A;  3W1G A;  1N32 Q;  4K6L A;  3AFQ A;  3PO3 G;  4Q0F A;  3SDZ A;  3MXN B;  4ALP A;  4IAL A;  1DCZ A;  2YTY A;  1FNU A;  2R7Z H;  1STH A;  5FKA C;  1ASY A;  4IFD J;  1ENC A;  4A3J H;  1X55 A;  3BG3 A;  4KKU A;  3OHX C;  1PH4 A;  2JA6 H;  3HOX B;  1UNS A;  4HJ7 A;  2KCT A;  1EL0 A;  4DPG A;  4C56 C;  2JA8 B;  4G7O C;  4HJ8 A;  3KOJ A;  2H1E A;  2EVB A;  1N36 Q;  2A73 B;  3T51 B;  1HH2 P;  1FD7 D;  3WOE A;  2R92 G;  2VQE Q;  3U9O A;  2ZXO A;  4A3B G;  3HOU G;  3I55 A;  3C1F A;  2NVQ B;  1Q86 C;  1FR3 A;  1EY7 A;  5EGT A;  5C3W A;  2NVT B;  3S15 H;  2XRQ D;  1SE4 A;  3U9S A;  1TKW B;  4HJ9 A;  2IY5 B;  2B2V C;  3LWE A;  4JYA L;  3D4R A;  4YIJ A;  5KGU A;  1U9R A;  4RFB A;  3T13 A;  1HUN A;  3TEH B;  2VUM H;  3NSW A;  2SOB A;  1DXM A;  2IJ0 A;  4QF4 A;  1A2T A;  3DEP A;  4A76 A;  4HCS A;  1OO9 B;  3VR4 A;  4J1M A;  5IT9 E;  4B3T L;  1HZC A;  1PTO D;  2EY2 A;  1F2Z A;  2KQ3 A;  4B3M L;  2OT2 A;  1SFO B;  3S17 H;  2N55 A;  1IKL A;  1UE6 A;  1EY0 A;  1E2V A;  2B3G A;  4PMW A;  1X65 A;  2Z4H A;  4Y52 H;  1KAB A;  1TWF B;  3BYY B;  4YWK A;  1NAP A;  1PH1 A;  3NEL A;  4HN7 A;  2CH4 A;  4NKL A;  3KDF A;  4R8N A;  2Q2U A;  4IO9 A;  3HG9 A;  2JA8 G;  4KY6 A;  1WTV A;  1BQQ T;  1QUQ A;  1SBB B;  1H9K A;  3FPP A;  3NK9 A;  3KJO A;  1SE8 A;  1PZI D;  1S4Z A;  3PIP 3;  2F0T A;  2BCO A;  5T1I A;  1QVG A;  1PRT D;  2CQO A;  2K32 A;  5CV7 A;  3T1H Q;  1PA6 A;  4GS3 A;  2YTX A;  1KDB A;  2GA4 B;  1QWY A;  2XNA C;  1V1P A;  5C3X A;  3W5O A;  2WKC A;  3E9H A;  4OO1 G;  1WTX A;  4OWX B;  1TS4 A;  1PH3 A;  3HKZ B;  1V1O A;  3LGJ A;  4GN3 B;  4JI3 L;  4BA2 I;  1SYF A;  2ZTD A;  3NEM A;  2Z9H A;  3HOV B;  2RKS A;  1QG7 A;  3K81 C;  1RDP D;  4K5V A;  2XTI A;  1X9N A;  1B8A A;  3CKI B;  1SMX A;  1EIG A;  2RDF A;  4PMC A;  2JE6 I;  4A3I B;  1M90 C;  3MFY A;  2Y0S E;  1EYG A;  4WJW A;  4IJH A;  4DV1 L;  2D0P A;  1B7Y B;  5AJ3 Q;  4LUO A;  4GNX A;  4LF4 L;  2JN4 A;  2CWA A;  4Y7N H;  4HCE A;  4JI1 Q;  3OPO A;  4A3F G;  2J0T D;  2WKD A;  1YNN D;  4DV6 Q;  4LF5 L;  3NEN A;  4DN4 M;  5ELD A;  2F3I A;  5C3E H;  4DV3 L;  1UUP A;  2WII B;  3QJY A;  2V4D A;  4DV7 L;  5COR A;  1BCP F;  1SAP A;  3HOZ B;  1JWS D;  3I4M H;  4C2M H;  1EYC A;  1H9S B;  2ZTE A;  3UDG A;  5IGF A;  3GD7 A;  2MGS A;  1SND A;  2ICE C;  1YHQ A;  1IL2 A;  3BYT B;  4IPH A;  4YWM A;  5NUC A;  3C46 A;  4ID6 A;  4P73 A;  4ODG A;  4KD3 A;  3AEV A;  4C3J G;  1HUM A;  3MTS A;  2Z8L A;  4GKK L;  5IGE A;  5EKI A;  2H4O A;  5E1F A;  3RLF A;  2CW0 D;  3F2U A;  3EBE A;  2ID0 A;  3PIP A;  4HID A;  2CQA A;  1Q8I A;  1RIP A;  4DXF A;  2F3W A;  2VQF L;  2R92 H;  3VYS A;  1F9S A;  4L6T B;  4DKA C;  1GUT A;  3RD4 A;  1EY5 A;  2RSN A;  1E24 A;  4XQN A;  5C0X I;  2FHT A;  2UXC L;  3A5Z B;  1HTP A;  3K6O A;  4NXN L;  1CKM A;  2YU9 H;  2Z0S A;  1KTK A;  2RCN A;  3FRP B;  1BVS A;  3I91 A;  1IBK Q;  2EY1 A;  2Q2H A;  3CC7 A;  5LL6 X;  1K8M A;  4CDD C;  1F2L A;  3MFG A;  3HOZ G;  1JJG A;  5C0X J;  2DJF C;  4B9X A;  1Q46 A;  3E0E A;  4R4I A;  3DUZ A;  4LF6 Q;  3SXH A;  2HHH Q;  4CJ1 B;  3Q23 A;  1VQK A;  1DON A;  3PO3 H;  2M2L A;  4PZ6 A;  1FNW A;  1AP0 A;  5C4H A;  5M5W B;  5COY A;  2JA7 H;  5IYD H;  4JVZ A;  4AQY L;  1CI3 M;  2UXD Q;  1P8L A;  1B1Z A;  2KJX A;  1STB A;  5J3B A;  4DAY B;  2DY8 A;  2L15 A;  1DM0 B;  4JBW A;  1AE3 A;  4DR7 L;  3HKZ E;  4IPD A;  4X65 Q;  3D8G A;  1E22 A;  3A74 A;  1U0L A;  3EVQ A;  2KHS A;  2K6A A;  2L55 A;  1PHJ A;  2XRS D;  1JQY D;  4K5X A;  1Q1B A;  1QNK A;  4RGO S;  5FLX c;  2Z6K A;  3R2T A;  3H94 A;  2F1M A;  1ILP A;  1UEB A;  4DR5 Q;  4IUV A;  3H15 A;  3PGZ A;  3BS1 A;  4EQN A;  4A3L G;  4LF8 Q;  3HOZ H;  1TWF H;  3D6C A;  3NQT A;  1G6P A;  1DGS A;  4JPB W;  3J80 c;  2A6E C;  3P7J A;  3I72 A;  4P71 A;  4A3I H;  4H7B A;  2DY7 A;  1XNQ L;  2RA4 A;  1VQ8 A;  5J39 A;  2PMZ B;  4JI4 L;  1G2S A;  5LMN Q;  5JVG 3;  1K83 B;  1KC8 C;  1YJ9 A;  2KA7 A;  2IWH A;  3NTH A;  1WCM G;  3AQQ A;  3HOU B;  4HED A;  2A68 D;  2NN6 H;  1EIH A;  2L0C A;  5DM6 3;  4JI0 Q;  2F0H A;  2E2I H;  3SK8 A;  3RN5 A;  1CFM A;  3OYY A;  3D0F A;  1G2T A;  4G7Z C;  3BZD B;  3EN2 A;  5M5X H;  4Q5V A;  2L9H A;  2O5J C;  4JV5 Q;  2R93 H;  4DR3 Q;  3IL8 A;  3HS0 C;  1SNO A;  3CC2 A;  3CMA A;  1HRJ A;  1WTH A;  4ZYS A;  4DNT B;  3ULJ A;  2HIX A;  1K8O A;  1CHP D;  5JEA H;  4AYB G;  1UEA B;  5FK9 C;  3W1B A;  3PF5 A;  2LXJ A;  3HOV H;  2EXZ A;  2JSO A;  3EA6 A;  3F2C A;  3CCJ A;  2OTL A;  4H13 C;  1M1K C;  1XMQ Q;  1CKN A;  4TRD A;  5M5Y H;  4QMG A;  2A6H C;  1X54 A;  4BBS G;  2B2W C;  4UY8 C;  2K5N A;  3G71 A;  4IFD I;  1JWM D;  2D9U A;  3MVV A;  1MJC A;  4DR6 Q;  5ELB A;  2EYM A;  2PCF B;  5IGG A;  2K7V A;  5I9O A;  1L1O C;  2K5W A;  1HFN A;  4IZ8 A;  3PUV A;  3L7Z C;  3K58 A;  1A0I A;  1WI5 A;  4DNR B;  3J80 E;  4A3B B;  5BR8 Q;  3A55 A;  4DV0 Q;  2G9D A;  3GTK B;  3TZU A;  3HZX A;  2WV6 D;  2WAQ B;  1EQV A;  3A8I E;  5KNC A;  4OON A;  3HOX H;  1GOZ A;  4PG3 A;  1M4V A;  1B9M A;  3STB D;  5IOD A;  3STB C;  1YJW A;  4JI1 L;  2A68 C;  4X66 Q;  2ALY B;  2QGQ A;  5BN4 A;  3UDI A;  1X3P A;  1B44 D;  1YNJ C;  1TWG B;  2F0K A;  4L63 B;  2B2Y A;  4JG2 A;  1BNZ A;  1I4R A;  4G4K A;  4DK0 A;  1E0B A;  2UXC Q;  3H91 A;  2NYZ D;  3HKZ G;  2EXD A;  1IW7 C;  3R8B A;  4C3I H;  4H0L C;  1JB3 A;  1BOS A;  3CHB D;  1G8Z D;  4CHT B;  1T9H A;  2NVY B;  2K04 A;  1AN8 A;  1D6E C;  3MA2 B;  1SR3 A;  1VQ4 A;  2KEC A;  2IW3 A;  2BDN A;  1C9O A;  2HIV A;  1R9T H;  2JA6 B;  2KEE A;  4R4Q A;  3H0G B;  3S1R H;  2K5D A;  3S1Q B;  4IJL A;  2AHO B;  4POF A;  3MXU A;  3FPU B;  4ZKB B;  1E1O A;  5FLM G;  1LT4 D;  1MHW C;  1UE1 A;  2Z1C A;  2A6E D;  4OHJ A;  3GTM B;  2QCP X;  3OWE B;  2YU9 B;  2A74 C;  1K0R A;  3UE1 A;  4DAP A;  4EQP A;  4DR4 L;  5JJK A;  3ONA B;  3PO2 G;  2RSO A;  4XXE A;  3TZD A;  2LS0 1;  3U4Z A;  3K7A H;  4X65 L;  3BVM A;  1XMO L;  3GTL H;  3S9W A;  1PYW D;  1JCK B;  1IBM L;  3A5U A;  3K59 A;  3TBI B;  1O7I A;  4C1N K;  2VS1 A;  4TQU S;  1YNN C;  3RLO A;  4NDX A;  1WD0 A;  3J7A F;  1AH9 A;  1S5B D;  2F52 A;  3ND8 A;  1E1T A;  1VQB A;  1WTO A;  4KY5 A;  1ZYR C;  2K14 A;  3EFX D;  4GLV B;  1PLF A;  1YNJ D;  3DEO A;  1XPU A;  2FMM A;  1TVX A;  4EQ5 A;  2AQ2 B;  1I3Q B;  3RLN A;  2K33 A;  3NTK A;  2LMC B;  4YCU A;  4A3D B;  2KHI A;  1LLR D;  2F0J A;  1RJT A;  3GTL B;  2E2D C;  4RGN A;  2AQ1 B;  3M7G A;  2JEB I;  1CQV A;  3KBG A;  4XQQ A;  2JYO A;  3OWF A;  2K05 A;  3QIA A;  2JJQ A;  4OEM B;  2B2W A;  1I94 Q;  1GHK A;  1CKN B;  2CVR A;  3OSO A;  1STA A;  5FO9 B;  4BY7 H;  4IUN A;  5C5M A;  1JJC B;  3P1H A;  1S3O A;  4O2D A;  4ABN A;  3MEF A;  1JIC A;  1HZA A;  4BY1 H;  3I7F A;  2PMZ E;  4K0K L;  4KLK A;  2AUJ D;  3H3V I;  2B2V A;  4DR3 L;  4POG A;  3NTI A;  4XTC S;  2B8F A;  1VQ7 A;  3FDT A;  1SRU A;  5AFW A;  1C48 A;  4K5W A;  3K57 A;  1JOQ A;  2OTJ A;  1A3U A;  5C4X B;  2PQA B;  2F0E A;  2J4X A;  2DN8 A;  2VY3 A;  1HHV A;  1D2B A;  3I56 A;  1KAW A;  2CHB D;  2WB1 G;  4LF7 L;  2TMP A;  3T1Y L;  4MHE A;  2C5C A;  2EDG A;  1VQG A;  1BCP B;  4YCW A;  2Y0S G;  1K9M C;  4DR6 L;  1FGB D;  1PV4 A;  1JOK A;  4LWC A;  3MWY W;  2JA9 A;  1SSO A;  1WJJ A;  1LT5 D;  1LYL A;  3SR1 A;  4DAV A;  1R4P B;  1Y1W H;  4PV1 C;  4GLX A;  1U4L A;  2NVY H;  2XVS A;  1N32 L;  2QEX A;  1HNZ Q;  3AYH B;  1S72 A;  3L3O C;  4NMZ A;  3G6E A;  5EBC A;  1AEX A;  2TSS A;  4CKE A;  2F0D A;  5GAG C;  3OIP A;  4FXG C;  3AB9 A;  4JBJ A;  5FO7 B;  2BA0 A;  5HUR A;  4IFD H;  2L5T A;  3KUP A;  2JA5 G;  1HNW L;  4F7X A;  3GTQ B;  1EWC A;  2A19 A;  1CK1 A;  4FO2 A;  3AFP A;  1DYQ A;  1ET9 A;  5FLX E;  1I50 H;  3S1M B;  1XTC D;  2UUC L;  3GTM H;  3N6R A;  5KRU A;  2FJ2 A;  1EY8 A;  5JOB A;  3M4O B;  3KDF B;  1WTR A;  1PYS B;  2FMC A;  4X3U A;  5M5W H;  4DV2 Q;  2K75 A;  2UXB L;  3N52 A;  4O1N A;  5I6Y A;  4NXM Q;  3GTO H;  3SK4 A;  3S1R B;  4AYB B;  3A7L A;  1W6K A;  4DR7 Q;  4JI7 Q;  1XXG A;  4FP5 D;  3T4A C;  4C1N I;  4A3M H;  1TS2 A;  2B63 B;  1CSQ A;  3E3X A;  4WOR A;  4DUZ L;  3ERQ A;  1PFM A;  1TS3 A;  4A3L H;  1NMF A;  3JAM i;  3I4N H;  1G51 A;  3LNN A;  2ZXP A;  2QW7 A;  3TSS A;  3NWS A;  2R93 B;  4M8A A;  1Q12 A;  2EIF A;  3K7A B;  1TR5 A;  2K4K A;  2PQA A;  3ITP A;  3TME A;  2JA5 H;  1EQQ A;  2YYZ A;  3CCE A;  1WOC A;  3TDQ A;  2CWP A;  4LF8 L;  5CMD A;  2MO0 A;  3E6Z X;  3M3Y H;  4IPC A;  1JOO A;  1K83 H;  4GN5 A;  2IX3 A;  4EGV A;  1Y8N B;  1NSN S;  4JI2 Q;  4RHS A;  3GTK H;  3H0G H;  2JA8 H;  1VS0 A;  3I3C A;  5K36 H;  4B3M Q;  2Q8R E;  2R93 G;  1LTA D;  2BA1 A;  2C35 B;  4PNY A;  2F0W A;  3RNU A;  2QA4 A;  4A3K G;  1MJE A;  4JI0 L;  3QO2 A;  2VQE L;  1ICW A;  2ZM6 L;  2CFM A;  3LX0 A;  2UUA L;  4DR2 L;  2N88 A;  2JQO A;  3VA5 A;  1HJP A;  2FXQ A;  4LFC Q;  3X3M A;  3S17 B;  4RHR A;  1SFO H;  1QCB D;  1Y69 U;  2R7F A;  4FVM A;  2NBF A;  1OXS C;  1KAA A;  5E3F A;  1N9W A;  2MUY A;  4R8I A;  1NE3 A;  3H0G G;  5CV6 A;  1SLJ A;  1VQ5 A;  4L5R C;  2E2H H;  3L9A X;  2HDM A;  2P5Z X;  2QDL A;  3D31 A;  3VR3 A;  1DD2 A;  1WTP A;  1PRT C;  1QB5 D;  3DXJ C;  3I4O A;  5IIF A;  3SK5 A;  1YHA A;  4N8F A;  4DAY A;  3S16 H;  3H09 A;  2GVA A;  2AWN A;  1K3R A;  1IW7 D;  3ZYY X;  2RDG A;  2IT1 A;  3J7A 5;  4FXK C;  3J7A V;  3S1M H;  2ASB A;  4C3H H;  1PH5 A;  3GTQ H;  3GTG B;  3CC4 A;  2VL6 A;  1XNR Q;  4CKB A;  4IUP A;  1ESR A;  4A3J G;  1I4X A;  1SYD A;  3MXG A;  2EPB A;  3GP7 A;  3M4Y A;  4MTN A;  4HTH A;  5IYC H;  1LO5 D;  2RDH A;  4LK1 C;  5ISR A;  1VQL A;  4DK3 C;  3ERS X;  1PFB A;  4CJ2 C;  2M00 A;  1EOT A;  1S5E D;  2GVB A;  3O13 A;  1TWH H;  2DUD A;  5IT9 L;  3S1N B;  1HZB A;  1C4Q A;  1E7Z A;  3E5S A;  1CTM A;  4LFA L;  1VF7 A;  1PZJ D;  4KHV A;  4LJZ C;  1NR4 A;  5EPL A;  4HIO A;  1TWC H;  4G7H C;  4WFN 3;  3D4D A;  4EQO A;  4DR5 L;  3M9B A;  2RHS B;  4G57 A;  1NTG A;  4DK6 C;  4DV1 Q;  4MIU A;  5G3L F;  2F0O A;  1IBL L;  2NTT A;  3FMC A;  3J7Z C;  4V19 0;  4CDF C;  4BXX G;  1HR0 Q;  1B4O A;  5EKK A;  3LWU A;  1SE2 A;  1TY0 A;  4B08 A;  2ZTC A;  3X3N A;  4JI4 Q;  3PQI A;  4JI8 L;  1PXU A;  2NUC A;  3QR8 A;  2PW7 A;  5JPM C;  4AQY Q;  2UXD L;  3Q24 A;  4HMJ A;  2XN9 C;  1A62 A;  1MBY A;  3H6M A;  1YNX A;  1A6X A;  5D65 A;  1Y8O B;  3IAY A;  3BZK A;  2E74 C;  5ELF A;  4C3H B;  5LHY 1;  3FVQ A;  2O5I C;  5EPJ A;  4QIW B;  4I7Z C;  4UAI A;  3I4L A;  5JPN C;  3OMC A;  5M3M H;  1BKB A;  4J8Q A;  4B9W A;  2JK8 A;  4JI6 Q;  1ZEQ X;  4GNX B;  1EZ8 A;  1I3Q H;  1PH8 A;  5HY6 A;  2BH2 A;  3I4N B;  4NXM L;  5CV4 A;  1LTT D;  1UE5 A;  1VQE A;  1B3A A;  3URY A;  5A35 A;  2FIN B;  4YY3 Q;  1XNQ Q;  5IY0 A;  5EQ0 A;  3R2I A;  1SNM A;  4YCV A;  3T16 A;  2A69 C;  4N9P A;  4DUZ Q;  1VQO A;  1SRO A;  1Z7T A;  2N78 A;  1KL9 A;  2A5H A;  1HXY D;  4QB4 A;  2OWO A;  2AMC B;  3J81 L;  3I4M B;  5FO8 B;  4LMQ D;  3MXN A;  5FLX L;  4KI0 A;  4JOI C;  2YV5 A;  3CRK C;  3VA7 A;  1TT2 A;  4A3G G;  1VQN A;  1IL8 A;  4ZLT F;  1VQP A;  5CBA E;  4DNI A;  3T1Y Q;  1GUW A;  1V8Q A;  2JA6 G;  2BOS A;  2MQH A;  1JE4 A;  4MTK A;  2F0L A;  1X6O A;  4L8J A;  3V96 A;  4FXD A;  3MHB A;  2NVX H;  3KBX A;  4A3C G;  3J81 i;  1FYC A;  3FKI G;  3UDF A;  4C2M B;  2VZA A;  4BY7 G;  2NN6 I;  3HKS A;  3PIO A;  4NP5 A;  4A3E H;  5TSS A;  4Z9C B;  1EWI A;  4DR2 Q;  2D0O A;  1CHQ D;  4JK1 C;  3NBI A;  1F77 A;  2D62 A;  2F4V L;  3RZO H;  1MIU A;  1U4P A;  1YHB A;  2NZH A;  2NVT H;  1QVF A;  3TS2 A;  1PTO B;  2UU9 L;  1CSP A;  4OEL B;  4X62 Q;  1Q81 C;  4K14 A;  4XYO A;  1NUC A;  1Z6H A;  3AU7 A;  2I46 A;  4M1U B;  1CQF A;  1XMQ L;  2OCE A;  3AMU A;  1LAC A;  2PI2 E;  3H3V H;  3DHQ A;  3I4M G;  4X66 L;  2MPM A;  2Z6K C;  4JI7 L;  1IBM Q;  2G9H D;  4QUF A;  5I2X A;  1K8G A;  1S5F D;  5FOB B;  4B3S Q;  5IT9 c;  3M85 A;  4R1J A;  4RKB A;  5ELE A;  2BH8 A;  3GTJ B;  5C0X G;  2CCZ A;  1U5K A;  3FHW A;  1V1Q A;  1CA5 A;  3OTO L;  2SNS A;  1RHP A;  3FKI H;  2JXM B;  2E75 C;  1BDO A;  2Q2T A;  2ZJP A;  1IYU A;  4BA1 I;  4X3T A;  2OF1 A;  3GTP H;  1JWU D;  3ULL A;  3I90 A;  5IGC A;  1GM5 A;  5KEE A;  1VQF A;  1A63 A;  1LTI D;  5IYB G;  1NNX A;  2B2Y C;  3IKJ A;  2C9O A;  2E76 C;  1STE A;  1QNU A;  1BXT A;  1I5F A;  5LMU L;  3HOW B;  4A93 B;  4C3I G;  1T5E A;  5I2Y A;  1TXY A;  3QWN A;  4C3J H;  1FL0 A;  4IOC A;  3S2H B;  3CQZ B;  1JOR A;  3CRL C;  3PSI A;  2UUA Q;  3TQY A;  3PUZ A;  1TU2 B;  2KEN A;  1F2Y A;  1ML0 D;  1BO0 A;  1Q7Y C;  4ZKC B;  1IYV A;  1Z9F A;  3J80 L;  5BR8 L;  3IRB A;  3S1Q H;  3J81 E;  1KQS A;  4L5T A;  1L0W A;  2JP1 A;  5GRO A;  1WFQ A;  5M5X B;  4A75 A;  4ZCK A;  4DV5 Q;  4CGY B;  1ENA A;  3DMU A;  4JBK A;  1X3Q A;  2LSS A;  4A3C H;  2Z4I A;  1Y14 B;  2OQK A;  4YHH Q;  1GXD C;  1EY9 A;  1SEB D;  1MSH A;  2IPK D;  2X69 A;  3GTO B;  3D3R A;  1CT1 D;  1Q82 C;  3PO2 B;  4A3M G;  3HOY H;  2ATW A;  3A8K E;  2ENB A;  5CYU A;  4YWL A;  2EYF A;  1B70 B;  4A3E B;  2D5D A;  4KK7 A;  1TWG H;  3HFZ B;  1O7Y A;  2X6L A;  2EJM A;  1H9S A;  3HOW G;  4K0K Q;  4A93 G;  3CF5 A;  2NVX B;  5DLQ E;  1DOK A;  4R4O A;  5KNB A;  2VUM G;  1MSG A;  2AUK A;  2IX0 A;  1IZ6 A;  1H9J A;  3VYR A;  3M7N A;  1H9M A;  1NY4 A;  4KN7 C;  4JI6 L;  3W3A A;  2UUC Q;  3MZ5 A;  2EYO A;  2A69 D;  2R6G A;  1LTG D;  5KYL A;  3KLR A;  3A8J E;  1DJR D;  4WJ4 A;  3HEJ A;  3KYH C;  1GO3 E;  1VF5 C;  1BCP D;  1HNX L;  2VQF Q;  1PTO H;  1SYE A;  2PNH A;  1QIL A;  3VR6 A;  3NP8 A;  5CC4 A;  1GD7 A;  2F0N A;  1PMR A;  5JEA J;  3UI2 A;  2E2J H;  1OXX K;  1TWA H;  2RQX A;  1EEI D;  3KF6 A;  4OX9 L;  2QEJ C;  2K5V A;  1Q3L A;  2EJG C;  3I4N G;  2FFK B;  4ZAI A;  1ET6 A;  2ICI A;  1YI2 A;  1BBX C;  1X32 A;  4A3G B;  4UHV A;  4ZK9 B;  1F2M A;  5IGB A;  2RF4 A;  3I70 A;  3JC6 6;  3WOF A;  1KLG D;  4XYQ A;  1YIT A;  2WP8 J;  4K8J A;  1X56 A;  3KLS A;  2RVL A;  3ER0 A;  3H3V C;  1VQA A;  3M4P A;  4JW0 A;  2AQ3 B;  1RKN A;  1IYJ B;  1N33 L;  4JI8 Q;  5M9O A;  1BUV T;  1JC7 A;  4KN4 C;  1TY2 A;  4IUR A;  2I5L X;  1BBU A;  4BY1 G;  3SE0 A;  2G5D A;  3Q0A A;  1J5E L;  1Y1W G;  4A3K H;  2F0V A;  1XWE A;  5D3D A;  2EJF C;  5L37 A;  2LY7 A;  1G6Z A;  2B2U C;  4OWT B;  1B2T A;  1WD1 A;  3K7U C;  1C8C A;  3DLL A;  3RR5 A;  3U4V A;  5I6W A;  3BJU A;  2MNA A;  3CPF A;  1KNA A;  4LFC L;  3K0Y A;  4GKJ L;  3OIQ A;  3CCV A;  4U67 3;  2ZT9 C;  1I6V C;  1CZG A;  4X3K A;  2UU9 Q;  2HUG A;  1SDF A;  2SEB D;  3KLW A;  3QOL A;  4A3F B;  4H02 A;  3ULP A;  1XX8 A;  1ROD A;  5CGK A;  3PMF A;  2DNE A;  4OO1 H;  5A2Q E;  1B3Q A;  3S2D H;  2E5L L;  4PQX A;  4DXG A;  3K5O A;  3S14 B;  2DNC A;  3HGB A;  3UE0 A;  4U68 A;  4KTA A;  2VXW A;  1G91 A;  2K5H A;  1SNP A;  5CR3 A;  1JJ2 A;  3TP7 A;  1ILQ A;  1QZH A;  4ZQ3 A;  1XPO A;  1AFP A;  1TWH B;  1OXV A;  2XGT A;  1STN A;  1HNZ L;  1LM0 A;  3EIV A;  5IP7 H;  2PZT A;  3RUZ A;  2L12 A;  4KY7 A;  2KCC A;  2EYJ A;  4P72 A;  1T5X D;  3PUW A;  4DUY Q;  4IUQ A;  2IL8 A;  2EY5 A;  2Z6B A;  4KHZ A;  4LW1 A;  4F8M A;  1BCP C;  1XNR L;  4YHH L;  2N49 A;  4KHP L;  1VQH A;  1QJO A;  2XWJ B;  1ENF A;  5K36 G;  1SYC A;  1W3S A;  3GO5 A;  4LF9 Q;  4DV3 Q;  5C4J B;  3TS0 A;  2I5M X;  5K5P A;  3S14 H;  2NTS A;  4CDC C;  2LXK A;  1KRS A;  1SN8 A;  4P2C B;  3UDX A;  5C44 B;  3S16 B;  2KVM A;  2HCC A;  3U50 C;  2E2J B;  3K5L A;  2R92 B;  1U4M A;  5IWA Q;  2VW9 A;  1OXT A;  1O78 A;  3BDL A;  2BE5 C;  2BE5 D;  4ME5 A;  3FP9 A;  2B63 G;  1GVP A;  4BS9 A;  4FDB A;  1KLU D;  3CXC A;  1WVL A;  4K2K A;  4QGU A;  2K01 A;  4I7A A;  5C3E G;  1L1O B;  1VCI A;  3V2T A;  3VYT A;  4P74 A;  1D5X C;  3PUY A;  4C3H G;  2J7Z A;  2F0F A;  5KYI A;  4JI2 L;  5D3I B;  4IOA A;  4QQB X;  2NVQ H;  2PNR C;  2PO4 A;  2CKZ B;  1Q8K A;  4GZY C;  3HP3 A;  5JEA G;  1IBK L;  2I5H A;  3KJP A;  3OTO Q;  4QJF A;  2ZM6 Q;  2GN5 A;  4UPA A;  3NE5 B;  4LUV A;  1KDC A;  4S3S A;  4UP9 A;  1A8V A;  2IHF A;  4RKL A;  5LL6 S;  4DGZ A;  3HOV G;  4A3M B;  2PYK A;  2KBN A;  4LFA Q;  1HQM C;  2MHV A;  3TRZ A;  1VMP A;  2Y0S B;  1RL2 A;  5E4X A;  1CUK A;  2NN6 G;  1N33 Q;  1FNV A;  1P16 A;  1JMC A;  2QIL A;  5KIX A;  4B3R Q;  2N3S A;  1HPC A;  4UP7 A;  2PQE A;  1QUQ B;  5G3L D;  1A2U A;  1TWA B;  4DV4 Q;  3PO2 H;  4UP8 A;  1XMO Q;  4RMF A;  1I4P A;  1PYB A;  5M3M G;  1LTL A;  1EQR A;  5C44 G;  4NPS A;  4V0B A;  3VR2 A;  3NPP A;  1KXL A;  5IP7 G;  1Y8P B;  2XWB B;  4RGM A;  4JI5 Q;  3K8A A;  2IHE A;  1EU3 A;  4A3E G;  2AKW B;  4APV A;  3RN2 A;  5C4Z A;  2YTV A;  1IXR A;  1XPR A;  2KCM A;  1KHI A;  2DJG C;  3I8Z A;  2ES2 A;  4RA8 A;  2VUM B;  1CA6 A;  2RCF A;  3M3Y B;  1R4Q B;  5KND A;  2BDO A;  2F03 A;  1PH9 A;  2AWO A;  3TP8 A;  1FJG L;  3Q8D A;  1PRT B;  2WAQ G;  1OXU A;  3VR5 A;  3S15 B;  2HQE A;  3W2D A;  2UUB L;  1ASZ A;  1EOV A;  2H5X A;  2A8V A;  3CQZ H;  3D6W A;  1VMC A;  3GTJ H;  5JJI A;  3DWP A;  3G7L A;  5EKL A;  1O7L A;  1EU4 A;  1OTC A;  1LTB D;  3BDO A;  3DWA A;  3JAM L;  2Q2I A;  5E4W C;  5C4X H;  3CCS A;  2CW0 C;  3K80 C;  3TP5 A;  5I4D A;  4GOP A;  4BY1 B;  3OOC A;  3J81 j;  2PZU A;  4RGT A;  4R9W A;  1LT6 D;  3K0X A;  4MN3 A;  2RBM A;  2K28 A;  1RCV D;  5FJ8 H;  4DUY L;  1J6Q A;  1F9P A;  3L2P A;  4GOP B;  2M9V A;  4N8X 1;  1BBW A;  3HOY G;  2F0I A;  3WDN A;  1QVC A;  4C3J B;  1LUZ A;  2ZXR A;  3S2H H;  2F0P A;  4L5Q A;  1PRT F;  1HFG A;  4JC0 A;  4XDX A;  2EQS A;  4R4T A;  4MZ9 A;  2E5L Q;  4CJ0 B;  1IKM A;  4OIJ A;  3J80 i;  1WYD A;  1ONL A;  1YIJ A;  4DF7 A;  1XYI A;  4LFB L;  1V43 A;  3F1Z A;  5EPK A;  4HSV A;  5C6A A;  2R7Z G;  3K5M A;  1JE5 A;  2ZJQ A;  1Y1W B;  1LAB A;  4XT1 B;  3GTP B;  2N8N A;  4FF2 A;  2B63 H;  2DGY A;  1ESF A;  3V05 A;  1LTR D;  2R7Z B;  1I4H A;  3KF8 A;  4K8I A;  4LF4 Q;  1SMY D;  1S40 A;  1PZK D;  3NBH B;  1EWH A;  1Q90 A;  5T1G A;  5GAH C;  5GQO A;  4AIM A;  1HNW Q;  4AYB E;  4J6H A;  1MI2 A;  4F87 A;  3PCO B;  5DM7 3;  1SJE D;  4X62 L;  5M5Y B;  4LF5 Q;  3F2D A;  4KJN A;  1KDA A;  3A0J A;  3OW7 A;  1AE2 A;  5C4J H;  2Q8T A;  1ZXT A;  3J7Y W;  3NUC A;  3HRZ C;  3J81 c;  4DU9 A;  2NB0 A;  3DM3 A;  4RG1 A;  4DR1 L;  3HOY B;  1D7Q A;  2JEA I;  3PF4 A;  1NR2 A;  4GOP C;  4XIG S;  2B29 A;  1AZQ A;  1YJN A;  1WTW A;  1LT3 D;  1CM9 A;  2WAC A;  2SDF A;  1EY4 A;  4X6A H;  3R93 A;  4TVA B;  1HA5 A;  2XSC A;  2PPB C;  1QZG A;  2X6G A;  1J8I A;  4X64 L;  3E0J A;  4HJA A;  2B2T C;  4OL7 A;  4E6I A;  3JAM E;  3HOX G;  1G29 1;  1Y1V G;  2KOL A;  5IWA L;  1DZ1 A;  4BY7 B;  4XQJ A;  1F9R A;  3MC0 B;  3WWV A;  1QOH A;  3RZO B;  3GQB A;  1GKH A;  4RH6 A;  2SNM A;  5M3M B;  5C0X H;  1Z47 A;  2F0U A;  5E7N A;  1RTN A;  1EIF A;  2F0Q A;  5AJ3 L;  3SGI A;  3OW2 A;  4F88 A;  1GHJ A;  2R61 A;  5EAY A;  1I6H B;  2B39 A;  3BDC A;  3GDE A;  4DV4 L;  4O42 A;  2I07 B;  4HAE A;  1K3B C;  4H44 C;  1ZYR D;  2CH4 W;  3PV0 A;  4BWG B;  5IOC A;  4JBM A;  1GUN A;  3EJI A;  4HIK A;  1Y1V B;  4ME3 A;  3S1N H;  1EZ6 A;  4A3B H;  1L1O A;  4B3S L;  3PUX A;  4DV7 Q;  2KCN A;  2K1B A;  4DA2 A;  1L0Y B;  4DFA A;  3SEB A;  1UE7 A;  5DEH A;  2PW5 A;  1E2W A;  3CCL A;  1VQ6 A;  2OEO A;  2K50 A;  2A6H D;  5LMN W;  2HT1 A;  1YEZ A;  3VYU A;  4X3S A;  4WRD A;  4KHP Q;  4A3D H;  4TSS A;  4KKS A;  1H95 A;  1VQC A;  1UWV A;  3RMH A;  4LF9 L;  5LMU Q;  4B3R L;  3QG1 A;  5EBD A;  1WTQ A;  2PI2 A;  3T56 B;  5ELO A;  5J22 A;  2EYL A;  1X3F A;  4BBS B;  4RWS C;  5IYC G;  4OX9 Q;  4QIW E;  1R9T B;  3NHH A;  4NXN Q;  3GTG H;  2KHJ A;  4C3I B;  3R3O A;  1GJX A;  1VQD A;  2NZ1 D;  4JI5 L;  3GV3 A;  4WJ3 M;  2F0M A;  5GAE C;  4GKK Q;  2D2C C;  4IFD G;  1WCM B;  5BN3 A;  1YBY A;  3VDY A;  4KD4 A;  1MD2 D;  1JR0 D;  3M4Q A;  1FGU A;  3HOU H;  4LF6 L;  2HHH L;  1L2F A;  1V1P B;  2Q8I B;  4LF7 Q;  4IQZ A;  2L1B A;  1FJG Q;  1W6J A;  1K0S A;  1DOM A;  5JAV A;  5LMN L;  1I4G A;  2L11 A;  4LAA A;  1EIY B;  3HOW H;  1C7Y A;  2UUB Q;  1XTD A;  4A93 H;  3QB3 A;  1S5D D;  1U4R A;  2WIN B;  4KJO A;  1AZP A;  4BBR B;  1PVO A;  4FF3 A;  2K5Q A;  3NQI A;  1N36 L;  1FVI A;  1CKO A;  3CP0 A;  1SE3 A;  2EYH A;  3BU2 A;  3KK7 A;  1A3T A;  3DWQ A;  1V9P A;  1LTS D;  1KIX A;  1D1K A;  1VQI A;  2IX1 A;  1EFI D;  5F2D A;  1EY6 A;  4GKJ Q;  5C44 H;  4OWW B;  3TN2 A;  3FEW X;  1X3G A;  1F9Q A;  3QOJ A;  3F2B A;  1JB7 A;  1A15 A;  4QCL A;  3CCR A;  4KMU C;  4PMB A;  5H1S E;  1D5M C;  1IBL Q;  3F8T A;  2B2U A;  1EEF D;  1YVC A;  1HNX Q;  4DV2 L;  1A3V A;  1TQO A;  2JA5 B;  2V1C C;  1HR0 L;  4RCN A;  1K28 A;  4RCO A;  1KD1 C;  3P75 A;  3SK6 A;  2L4N A;  4BBR H;  4B3T Q;  5JJZ A;  1EQT A;  4ZUJ A;  1EUJ A;  5M3F B;  3G48 A;  4X64 Q;  2QF7 A;  4QUC A;  3PIO 3;  1SYG A;  2F3V A;  1O80 A;  2B2T A;  3DM1 A;  1MGS A;  1O7Z A;  2LFN A;  4RAU C;  4GNX C;  2R3Z A;  1NCV A;  2MP1 A;  1C0A A;  1XJV A;  3CU7 A;  1RTO A;  2B8G A;  2F0S A;  3MEH A;  4P75 A;  2HD3 A;  4JV5 L;  5JJL A;  4HMI A;  1WCM H;  2WB1 E;  2WB1 B;  3ERO A;  3BVG A;  2K52 A;  3S24 A;  1KNE A;  5IGD A;  3S2D B;  4UDU C;  1VQ9 A;  3KF6 B;  3T1H L;  4MNO A;  4OO1 I;  2QDB A;  3ZJY C;  3OMG A;  5A2Q L;  4NB3 A;  4IUU A;  1Q1E A;  2E8G A;  4ZUI A;  1SYB A;  3IFD A;  4HIM A;  1IHZ A;  2EYP A;  3I73 A;  1N34 Q;  2OXP A;  2NWG A;  4IPG A;  3A7A B;  2LKV A;  1VQJ A;  2RHQ B;  3TRE A;  1J5E Q;  2QKI C;  3P20 A;  2I0Q A;  4YY3 L;  4JCV E;  1PTO F;  1HZ9 A;  4K2L A;  2F0G A;  4L5S A;  1ICF B;  3NBH A;  1B50 A;  1RD9 D;  4A3J B;  2E2I B;  4A3F H;  4HJ5 A;  1D1I A;  3KF8 B;  4GLA C;  3CW2 C;  1PDQ A;  1EFW A;  4QL5 A;  1DOL A;  5CV9 A;  5IP9 G;  4JYA Q;  4A3K B;  3RZD B;  3B6Y A;  5ELN A;  4KV6 A;  1ZKO A;  4AH6 A;  4BXX H;  1L0X B;  3MXP A;  3M4O H;  3A54 A;  4IUT A;  2EZV A;  5I9P A;  2WAQ E;  4A4I A;  4DAM A;  1I50 B;  3KFU A;  4PZ8 A;  1J9O A;  2XIW A;  3U58 A;  4ZRZ A;  1SNC A;  5HGT A;  2HDL A;  2ZJR A;  5IYD G;  1K8A C;  2JA7 G;  5C4X G;  3BVZ A;  4J15 A;  2NZO A;  1STG A;  3CCU A;  4OXP A;  3SHL A;  5GAD C;  4DV6 L;  1SXT A;  3K5N A;  1SMY C;  4TKO B;  1E2Z A;  4Y7N B;  4K6D A;  4QY7 A;  3Q6S A;  1NBW A;  3PO3 B;  2F4I A;  5J1Z A;  5EJW A;  1RF2 D;  1UAP A;  1N8R C;  4I65 A;  4EX5 A;  3G4S A;  1E3P A;  1VQM A;  4FYD A;  5JVH 3;  5IP9 H;  1PTO C;  3ND9 A;  4ULL A;  1TII D;  4FF1 A;  3A56 A;  2MO1 A;  5IYB H;  1GUS A;  2F4V Q;  4KKT A;  2EY6 A;  2MFI A;  3JAM c;  3Q22 A;  2VB2 X;  2JA7 B;  3CCM A;  1I6H H;  5CBE E;  5C3E B;  1QE6 A;  1S5C D;  4PZ7 A;  1H9R A;  5FJ8 G;  4ILW A;  3L0O A;  1PFN A;  4OGQ C;  4CKC A;  4A3I G;  4NW2 A;  2R7D A;  1YZ6 A;  1PH6 A;  1MKH A;  4FNF A;  1I94 L;  4DR1 Q;  4HSP A;  1PH7 A;  3E9I A;  4BBS H;  1LV9 A;  5ELC A;  1TS5 A;  4N9T A;  1BF4 A;  2MJ8 A;  3CD6 A;  3FKI B;  1CZW A;  5C5L A;  2KED A;  1B9N A;  5M3F G;  3MAQ A;  3D4W A;  3EQL C;  4R4C A;  5DAU A;  5IE8 A;  3RZD H;  2EOT A;  2EE1 A;  2K03 A;  3C1E A;  3C2P A;  2O4X A;  4DV0 L;  2PZW A;  3CME A;  1I4Q A;  1BR9 A;  1KRT A;  3TP6 A;  4LUZ A;  4DR4 Q;  2A1A A;  4JOI A;  2HQL A;  3NWT A;  1Y1V H;  1HCZ A;  3KLS X;  4CBV A;  1AW7 A;  1B53 A;  4A3D G;  5FLM H;  3CAM A;  4O0A A;  1HTL D;  2KUM A;  5D14 A;  2VNU D;  4OIK A;  2OQ0 A;  1M8A A;  1D8L A;  1GUO A;  4XT3 B;  5CV5 A;  1JT8 A;  4JI3 Q;  1PFS A;  1GUG A;  5DNF A;  4A3G H;  3IFT A;  3SVM A;  4GN4 B;  4LNQ A;  4HR7 B;  1NJI C;  1SNQ A;  4DK1 A;  1VDZ A; 
#chains in the Genus database with same CATH homology
 3BZC A;  1BBW A;  3CPW A;  3HOY G;  1E1O A;  5FLM G;  1N34 L;  1UE1 A;  1QVC A;  2UXB Q;  5HGQ A;  1NMG A;  3S2H H;  1LUZ A;  1XMQ L;  1K0R A;  2OCE A;  2PI2 E;  4L5Q A;  4JC0 A;  4DV5 L;  3H3V H;  4POF A;  3UE1 A;  3I4M G;  2EQS A;  4X66 L;  4DR4 L;  5JJK A;  4R4T A;  1HR0 W;  5M3F H;  3PO2 G;  4MZ9 A;  2E5L Q;  2WFW A;  3U4Z A;  3K7A H;  4X65 L;  3J80 i;  2Z6K C;  1WYD A;  1XMO L;  3GTL H;  4JI7 L;  1W2B A;  1YIJ A;  1IBM Q;  4LFB Q;  1IBM L;  3A5U A;  1V43 A;  3F1Z A;  3CCQ A;  1K8G A;  4LFB L;  1O7I A;  2VS1 A;  3I2Z A;  4TQU S;  2R7Z G;  3RLO A;  1JE5 A;  2ZJQ A;  4B3S Q;  1AH9 A;  5IT9 c;  2F52 A;  3M85 A;  4R1J A;  1X3E A;  2BH8 A;  4BBR G;  5C0X G;  2N8N A;  3ICE A;  2B63 H;  1E1T A;  1K73 C;  1VQB A;  2DGY A;  1U5K A;  3FHW A;  1PH2 A;  2CCZ A;  1V1Q A;  3W1G A;  1N32 Q;  3AFQ A;  3OTO L;  3PO3 G;  2K14 A;  4GLV B;  3FKI H;  3MXN B;  4ALP A;  2Q2T A;  4LF4 Q;  2ZJP A;  2YTY A;  1XPU A;  2R7Z H;  1S40 A;  4EQ5 A;  1ASY A;  3NBH B;  3RLN A;  4IFD J;  5GAH C;  5GQO A;  4AIM A;  4BA1 I;  4AYB E;  4YCU A;  1X55 A;  4A3J H;  1HNW Q;  3GTP H;  2KHI A;  1PH4 A;  3ULL A;  3PCO B;  2JA6 H;  4X62 L;  4LF5 Q;  1GM5 A;  3F2D A;  1VQF A;  1A63 A;  3A0J A;  4HJ7 A;  1AE2 A;  5C4J H;  2JEB I;  5IYB G;  3J81 c;  2KCT A;  3DM3 A;  4RG1 A;  4DR1 L;  4DPG A;  1D7Q A;  2JEA I;  2JJQ A;  1I94 Q;  3PF4 A;  1I5F A;  5LMU L;  4GOP C;  1CKN B;  2B29 A;  4XIG S;  3KOJ A;  4HJ8 A;  1YJN A;  4BY7 H;  1N36 Q;  1TXY A;  1JJC B;  1HH2 P;  1S3O A;  2R92 G;  4O2D A;  1FL0 A;  4C3J H;  2VQE Q;  4IOC A;  4X6A H;  3MEF A;  4TVA B;  4A3B G;  1HZA A;  4BY1 H;  3HOU G;  3I7F A;  2PMZ E;  1QZG A;  4K0K L;  3PSI A;  3I55 A;  4X64 L;  4HJA A;  2UUA Q;  4KLK A;  3TQY A;  1Q86 C;  3H3V I;  3PUZ A;  4DR3 L;  4POG A;  2KEN A;  3S15 H;  3HOX G;  1G29 1;  1Y1V G;  4XTC S;  5IWA L;  1VQ7 A;  4HJ9 A;  2IY5 B;  1SRU A;  3WWV A;  4JYA L;  1Q7Y C;  1GKH A;  2OTJ A;  1Z9F A;  3TEH B;  1Z47 A;  2VUM H;  2PQA B;  5BR8 L;  3IRB A;  3S1Q H;  5E7N A;  1EIF A;  5AJ3 L;  3OW2 A;  3SGI A;  2VY3 A;  1KQS A;  4L5T A;  5EAY A;  1L0W A;  4A76 A;  5GRO A;  3I56 A;  1WFQ A;  1KAW A;  4A75 A;  4DV5 Q;  2WB1 G;  3GDE A;  4LF7 L;  3T1Y L;  4DV4 L;  4JBK A;  2LSS A;  4A3C H;  4B3T L;  1HZC A;  1VQG A;  1Y14 B;  2OQK A;  3PV0 A;  4YCW A;  2Y0S G;  4YHH Q;  1K9M C;  4DR6 L;  4JBM A;  4HIK A;  4ME3 A;  3S1N H;  1PV4 A;  4B3M L;  1L1O A;  4LWC A;  1Q82 C;  4B3S L;  2JA9 A;  4A3B H;  3S17 H;  4A3M G;  3HOY H;  1UE6 A;  2ATW A;  3PUX A;  1WJJ A;  1LYL A;  2B3G A;  4PMW A;  4DV7 Q;  4YWL A;  1X65 A;  1Y1W H;  1B70 B;  4GLX A;  1N32 L;  2NVY H;  4Y52 H;  2QEX A;  1TWG H;  1HNZ Q;  1UE7 A;  3AYH B;  3HFZ B;  4YWK A;  1PH1 A;  1S72 A;  3NEL A;  3G6E A;  3KDF A;  2Q2U A;  4IO9 A;  2JA8 G;  3HOW G;  4K0K Q;  3CCL A;  5GAG C;  3CF5 A;  1VQ6 A;  4A93 G;  4JBJ A;  1QUQ A;  2BA0 A;  5DLQ E;  2K50 A;  4R4O A;  2VUM G;  3KJO A;  2JA5 G;  1HNW L;  1SE8 A;  2IX0 A;  2A19 A;  5LMN W;  2HT1 A;  1IZ6 A;  1QVG A;  3M7N A;  3AFP A;  1NY4 A;  1YEZ A;  1I50 H;  2CQO A;  2UUC Q;  3T1H Q;  4JI6 L;  2UUC L;  2R6G A;  3GTM H;  1PA6 A;  4GS3 A;  2YTX A;  3KDF B;  4WJ4 A;  1PYS B;  4KHP Q;  4A3D H;  3KYH C;  1GO3 E;  3W5O A;  1VQC A;  5M5W H;  4DV2 Q;  2K75 A;  2UXB L;  1UWV A;  1H95 A;  3E9H A;  4LF9 L;  1HNX L;  5LMU Q;  4OO1 G;  4NXM Q;  2VQF Q;  3GTO H;  4B3R L;  2PNH A;  4OWX B;  2PI2 A;  1PH3 A;  1GD7 A;  5ELO A;  5JEA J;  3LGJ A;  1X3F A;  4DR7 Q;  2E2J H;  4GN3 B;  4JI7 Q;  4A3M H;  1OXX K;  4JI3 L;  4BA2 I;  2ZTD A;  3NEM A;  1TWA H;  1CSQ A;  5IYC G;  4OX9 Q;  4DUZ L;  3K81 C;  4QIW E;  3KF6 A;  4OX9 L;  2K5V A;  4A3L H;  4NXN Q;  1NMF A;  3I4N G;  2XTI A;  3JAM i;  3I4N H;  1G51 A;  3GTG H;  2KHJ A;  1X9N A;  1B8A A;  1VQD A;  1SMX A;  4JI5 L;  1Q12 A;  1YI2 A;  2JE6 I;  2EIF A;  1M90 C;  4WJ3 M;  2Y0S E;  2K4K A;  5GAE C;  2PQA A;  1EYG A;  4GKK Q;  2JA5 H;  4IFD G;  4IJH A;  1EQQ A;  2RF4 A;  4DV1 L;  2YYZ A;  2D0P A;  1B7Y B;  5AJ3 Q;  3CCE A;  3JC6 6;  1WOC A;  1YBY A;  4LUO A;  4GNX A;  3VDY A;  2CWA A;  4LF4 L;  4Y7N H;  2CWP A;  1YIT A;  2WP8 J;  3M4Q A;  1X56 A;  4LF8 L;  1FGU A;  4JI1 Q;  3HOU H;  4A3F G;  4LF6 L;  2HHH L;  1L2F A;  2MO0 A;  3M3Y H;  4LF7 Q;  4IPC A;  3ER0 A;  4GN5 A;  1K83 H;  4DV6 Q;  1FJG Q;  4LF5 L;  1VQA A;  3M4P A;  3NEN A;  4JI2 Q;  5LMN L;  1IYJ B;  3GTK H;  1N33 L;  3H0G H;  4JI8 Q;  2F3I A;  5C3E H;  2JA8 H;  1EIY B;  3HOW H;  4DV3 L;  1VS0 A;  1XTD A;  1C7Y A;  2UUB Q;  4A93 H;  2I5L X;  1BBU A;  4B3M Q;  4BY1 G;  2R93 G;  2BA1 A;  2C35 B;  1PVO A;  1N36 L;  1J5E L;  1FVI A;  1Y1W G;  4DV7 L;  1CKO A;  3CP0 A;  3RNU A;  4A3K H;  2QA4 A;  4A3K G;  1MJE A;  4JI0 L;  3BU2 A;  4OWT B;  2VQE L;  3I4M H;  3K7U C;  2ZM6 L;  1V9P A;  4C2M H;  3DLL A;  2CFM A;  1KIX A;  2ZTE A;  3RR5 A;  3U4V A;  2UUA L;  4DR2 L;  1VQI A;  3UDG A;  2JQO A;  3BJU A;  3GD7 A;  2IX1 A;  2MNA A;  1HJP A;  3CPF A;  4LFC L;  1YHQ A;  4GKJ Q;  2FXQ A;  4LFC Q;  1IL2 A;  4IPH A;  5C44 H;  4GKJ L;  4YWM A;  4P73 A;  4OWW B;  3CCV A;  1X3G A;  3AEV A;  2UU9 Q;  3F2B A;  1JB7 A;  3KLW A;  4GKK L;  4H02 A;  3CCR A;  3ULP A;  1SFO H;  2R7F A;  5H1S E;  1OXS C;  1IBL Q;  3RLF A;  3F8T A;  3EBE A;  2ID0 A;  1N9W A;  3PIP A;  1YVC A;  1HNX Q;  4DV2 L;  1NE3 A;  4HID A;  2V1C C;  1RIP A;  3H0G G;  1HR0 L;  1SLJ A;  2VQF L;  1VQ5 A;  4L5R C;  2R92 H;  3S2D H;  1KD1 C;  2E2H H;  2E5L L;  4DKA C;  4BBR H;  4B3T Q;  3UE0 A;  1E24 A;  1EUJ A;  3G48 A;  3D31 A;  5C0X I;  4X64 Q;  2UXC L;  3A5Z B;  4NXN L;  1CKM A;  2K5H A;  2YU9 H;  3I4O A;  1YHA A;  1JJ2 A;  2Z0S A;  2RCN A;  1QZH A;  1BVS A;  4GNX C;  1XPO A;  1IBK Q;  1C0A A;  1XJV A;  1OXV A;  2Q2H A;  3CC7 A;  2XGT A;  3S16 H;  1HNZ L;  1LM0 A;  2GVA A;  4P75 A;  3HOZ G;  3EIV A;  1JJG A;  5IP7 H;  2AWN A;  1K3R A;  5C0X J;  4JV5 L;  5JJL A;  1WCM H;  2WB1 E;  1Q46 A;  3E0E A;  4R4I A;  2IT1 A;  3J7A 5;  4LF6 Q;  4P72 A;  2HHH Q;  2K52 A;  1VQK A;  3S24 A;  3PUW A;  3S1M H;  2ASB A;  3PO3 H;  4DUY Q;  4C3H H;  4PZ6 A;  1PH5 A;  1VQ9 A;  3KF6 B;  3T1H L;  4MNO A;  3GTQ H;  4OO1 I;  4KHZ A;  4LW1 A;  3ZJY C;  4NB3 A;  1XNR L;  1Q1E A;  2E8G A;  4YHH L;  2VL6 A;  2N49 A;  3CC4 A;  4HIM A;  1VQH A;  1XNR Q;  4KHP L;  2JA7 H;  5IYD H;  1N34 Q;  4AQY L;  2UXD Q;  5K36 G;  1P8L A;  1W3S A;  4A3J G;  3GO5 A;  4IPG A;  4LF9 Q;  4MTN A;  4DV3 Q;  5J3B A;  5IYC H;  4DAY B;  3TS0 A;  2I5M X;  1VQJ A;  2L15 A;  2RHQ B;  3TRE A;  1VQL A;  3S14 H;  4JBW A;  4DK3 C;  3ERS X;  1J5E Q;  1AE3 A;  2I0Q A;  2LXK A;  4YY3 L;  1KRS A;  4JCV E;  1HZ9 A;  4DR7 L;  3HKZ E;  1SN8 A;  4IPD A;  4L5S A;  3UDX A;  2GVB A;  4X65 Q;  1E22 A;  3A74 A;  3U50 C;  1U0L A;  4A3F H;  1TWH H;  4HJ5 A;  2DUD A;  3KF8 B;  4GLA C;  3CW2 C;  1HZB A;  1PHJ A;  1EFW A;  5IWA Q;  1E7Z A;  2VW9 A;  1OXT A;  4QL5 A;  1Q1B A;  4LFA L;  5IP9 G;  4JYA Q;  5FLX c;  3B6Y A;  5ELN A;  2Z6K A;  4AH6 A;  4BXX H;  4HIO A;  1TWC H;  3M4O H;  3FP9 A;  1UEB A;  4DR5 L;  2B63 G;  1GVP A;  4DR5 Q;  3M9B A;  3H15 A;  4FDB A;  2WAQ E;  3PGZ A;  4A4I A;  2RHS B;  4DAM A;  1NTG A;  4DK6 C;  3CXC A;  4PZ8 A;  4DV1 Q;  3KFU A;  4A3L G;  4QGU A;  5C4X G;  3U58 A;  1IBL L;  4LF8 Q;  3HOZ H;  3J7Z C;  1TWF H;  1G6P A;  5C3E G;  1DGS A;  2ZJR A;  5IYD G;  1K8A C;  3J80 c;  1L1O B;  2JA7 G;  4J15 A;  4A3I H;  4P71 A;  2NZO A;  1HR0 Q;  3CCU A;  4BXX G;  4OXP A;  5GAD C;  4DV6 L;  1XNQ L;  1VCI A;  1VQ8 A;  2ZTC A;  3PUY A;  4P74 A;  4JI4 Q;  4JI4 L;  4JI8 L;  4QY7 A;  5LMN Q;  4JI2 L;  4IOA A;  4QQB X;  1NBW A;  1KC8 C;  4AQY Q;  2NVQ H;  1YJ9 A;  2UXD L;  1WCM G;  1A62 A;  3AQQ A;  1YNX A;  1N8R C;  2CKZ B;  4EX5 A;  4JI0 Q;  1Q8K A;  3G4S A;  2E2I H;  3RN5 A;  1E3P A;  3OYY A;  3D0F A;  5JEA G;  1IBK L;  1VQM A;  2I5H A;  3BZK A;  3EN2 A;  5M5X H;  3OTO Q;  3KJP A;  4QJF A;  5IP9 H;  2ZM6 Q;  2GN5 A;  4UPA A;  4LUV A;  4JV5 Q;  4UP9 A;  1A8V A;  2IHF A;  2MO1 A;  5IYB H;  3HOV G;  2R93 H;  2F4V Q;  4DR3 Q;  3CC2 A;  2MFI A;  3CMA A;  2KBN A;  3JAM c;  5M3M H;  4LFA Q;  1BKB A;  3CCM A;  3ULJ A;  1I6H H;  2HIX A;  2JK8 A;  4AYB G;  4PZ7 A;  4JI6 Q;  3TRZ A;  5FJ8 G;  3L0O A;  4GNX B;  1RL2 A;  3W1B A;  1CUK A;  1I3Q H;  2NN6 G;  4A3I G;  1N33 Q;  3PF5 A;  2LXJ A;  1PH8 A;  3HOV H;  2R7D A;  1P16 A;  1JMC A;  1YZ6 A;  1PH6 A;  3F2C A;  1MKH A;  3CCJ A;  1I94 L;  2OTL A;  5HY6 A;  2BH2 A;  1M1K C;  4DR1 Q;  1XMQ Q;  1CKN A;  4B3R Q;  5M5Y H;  2N3S A;  4NXM L;  4UP7 A;  1QUQ B;  1UE5 A;  1VQE A;  1PH7 A;  1X54 A;  4YY3 Q;  3E9I A;  4UY8 C;  1XNQ Q;  5IY0 A;  4DV4 Q;  2K5N A;  3PO2 H;  4BBS H;  4BBS G;  4UP8 A;  1XMO Q;  3G71 A;  4RMF A;  4IFD I;  4YCV A;  1MJC A;  1PYB A;  5M3M G;  4DR6 Q;  1LTL A;  1EQR A;  5C44 G;  4DUZ Q;  1VQO A;  4NPS A;  3CD6 A;  1L1O C;  1SRO A;  2N78 A;  1KXL A;  3PUV A;  1KL9 A;  5IP7 G;  2OWO A;  4JI5 Q;  3K8A A;  2IHE A;  2AMC B;  4A3E G;  3L7Z C;  5M3F G;  1A0I A;  1WI5 A;  2AKW B;  4R4C A;  4APV A;  5IE8 A;  3RN2 A;  5BR8 Q;  2YTV A;  4KI0 A;  1IXR A;  3RZD H;  4DV0 Q;  2KCM A;  4JOI C;  1XPR A;  3HOX H;  1KHI A;  4DV0 L;  2YV5 A;  4OON A;  3CME A;  4PG3 A;  2ES2 A;  3STB D;  4A3G G;  3STB C;  1YJW A;  1KRT A;  1VQN A;  4LUZ A;  4JI1 L;  4X66 Q;  4DR4 Q;  2A1A A;  4JOI A;  1VQP A;  2ALY B;  1PH9 A;  2AWO A;  2HQL A;  2QGQ A;  3UDI A;  1FJG L;  3Q8D A;  4DNI A;  3T1Y Q;  2WAQ G;  1OXU A;  2JA6 G;  2MQH A;  1Y1V H;  4JG2 A;  2UXC Q;  2UUB L;  1ASZ A;  1EOV A;  2H5X A;  2A8V A;  1X6O A;  3CQZ H;  3GTJ H;  5JJI A;  4A3D G;  2NVX H;  5FLM H;  3HKZ G;  4A3C G;  2EXD A;  3J81 i;  3CAM A;  4O0A A;  3FKI G;  4GOP B;  3UDF A;  4C3I H;  2VZA A;  4BY7 G;  2VNU D;  2OQ0 A;  1OTC A;  2NN6 I;  3HKS A;  1D8L A;  3PIO A;  1JT8 A;  3CCS A;  2Q2I A;  5C4X H;  4JI3 Q;  1PFS A;  1T9H A;  3K80 C;  4A3G H;  4A3E H;  1EWI A;  1SR3 A;  4DR2 Q;  4GOP A;  1VQ4 A;  2D0O A;  4GN4 B;  3J81 j;  4LNQ A;  1C9O A;  2D62 A;  2F4V L;  3RZO H;  2HIV A;  1MIU A;  1YHB A;  3K0X A;  2NZH A;  1R9T H;  4R4Q A;  1NJI C;  1QVF A;  2NVT H;  5FJ8 H;  4DUY L;  3S1R H;  1J6Q A;  2UU9 L;  3TS2 A;  1CSP A;  3L2P A;  4X62 Q;  4IJL A;  2AHO B;  1Q81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...