1TT2A

Cryogenic crystal structure of staphylococcal nuclease variant truncated delta+phs i92k
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title X-ray and thermodynamic studies of staphylococcal nuclease variants I92E and I92K: insights into polarity of the protein interior
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1tt2A00
3MVVA 4EVOA 2EYMA 2F0SA 5DAUA 4ZUIA 4F8MA 1JOKA 3S9WA 1SNMA 1SYCA 4K14A 5I6WA 5IIFA 4KJNA 3RUZA 1STAA 1KDAA 2EYFA 4K5WA 5E1FA 1SYGA 3OMCA 2OXPA 2EY6A 3DHQA 3MXPA 3T16A 2F0UA 3NUCA 4K2LA 4E6IA 1JOQA 4RKLA 3MHBA 4ME5A 5CV6A 4R8NA 5I6YA 1RKNA 4J1MA 3T13A 5CGKA 3HEJA 3NXWA 5C3WA 5C4ZA 2EY2A 5IGEA 5DEHA 5HURA 5KEEA 4S3SA 4KD4A 1EY9A 4LAAA 1F2YA 4KJOA 1A3UA 1KABA 4IZ8A 4OL7A 4WORA 3TMEA 3U9OA 2RBMA 4F7XA 2EYJA 2PZUA 1A2UA 2F0DA 3EJIA 5M9OA 2NUCA 1A3VA 3OSOA 4EQNA 1ENCA 4EQPA 3R3OA 2PZTA 5EKKA 5IGCA 4N9TA 3OMGA 5CV9A 5CR3A 2OEOA 4IUNA 2F0KA 4PNYA 2F0MA 2F0TA 2QDBA 2F0NA 3SHLA 5HGTA 1KAAA 3NP8A 1SNQA 2EYOA 3E5SA 5IGBA 5C5MA 4HTHA 4ODGA 4K6DA 4QB4A 4K5XA 1EZ8A 1EY4A 1F2MA 1EZ6A 5ISRA 3HZXA 3MZ5A 5F2DA 5KIXA 5KYIA 3DMUA 4KY5A 2ENBA 3SXHA 5JAVA 4K2KA 5IGFA 5C3XA 2LKVA 3QOLA 2EY1A 1JOOA 3D4WA 4EQOA 1EY0A 4KY7A 1A3TA 1TR5A 4MIUA 4N9PA 2PW5A 4NKLA 5CC4A 4HMJA 4HMIA 2F0VA 3SK6A 5KRUA 4IALA 3QOJA 1SNOA 3NQTA 4K5VA 2PQEA 3NHHA 1EY5A 1STNA 3C1FA 4TRDA 3SK5A 2F0QA 1SNDA 2F0PA 2KQ3A 5KYLA 1STYA 1SYEA 3SR1A 4NDXA 4DGZA 1EQVA 4KHVA 4NMZA 1KDBA 1SNCA 2O4XA 2EYLA 3C1EA 2SNMA 1A2TA 1U9RA 4KD3A 1SYBA 3D4DA 4KTAA 2F3WA 1AEXA 3TP5A 5IGGA 3ERQA 1STGA 1STHA 2F0HA 3P1HA 4PMCA 4ZUJA 3TP7A 1STBA 1EYDA 2F0IA 4G57A 4NP5A 4QMGA 5CV8A 4YIJA 3SK8A 4PMBA 2EY5A 2RKSA 3BDLA 1SYFA 4ZQ3A 5I9OA 4K8IA 1EY8A 5J1ZA 1NSNS 4QF4A 3NK9A 3TP8A 2F3VA 4B9XA 5CV7A 4I65A 4J6HA 4WRDA 4DFAA 3SK4A 5EGTA 5J39A 3QB3A 1NUCA 2RDFA 1JORA 2F0FA 3P75A 2F0JA 2OF1A 4H7BA 5C4HA 1EY7A 5CV5A 2PZWA 2SOBA 2SNSA 3V2TA 5IODA 1TQOA 5NUCA 5IGDA 3VA5A 4B9WA 2PYKA 1EYAA 2F0OA 3MEHA 4ID6A 3H6MA 1EYCA 4KV6A 5IOCA 5I9PA 3BDCA 1SNPA 5C6AA 2EYHA 2WACA 5EKLA 5K5PA 5J22A 4DU9A 3OWFA 5CV4A 4KY6A 3PMFA 2F0EA 2F0LA 2PW7A 1EY6A 3TP6A 3D8GA 4DF7A 2HQEA 3LX0A 1II3A 5C5LA 2KHSA 2EYPA 4K8JA 2EXZA 5JOBA 3D6CA 5KGUA 2M00A 1SYDA 1ENAA 1F2ZA 1TT2A 1KDCA 3ITPA 4RKBA 3EVQA 3EROA 5E3FA 1IHZA 2F0GA 2F0WA
chains in the Genus database with same CATH superfamily
1U0LA 3TS2A 2Y0SB 1E2WA 1RJTA 1VF5C 3S9WA 3VYRA 2NTTA 4ZCKA 1G2TA 1I94L 4ALPA 3CCLA 3HRZC 1O7LA 2OXPA 3SE0A 1EUJA 3PQIA 4ZAIA 1AE3A 2G9DA 1LTLA 2PI2E 1PH8A 3O13A 2Z4IA 3VR3A 1I4XA 1F9QA 1YHBA 2KOLA 1EY9A 3TMEA 2PI2A 4F7XA 1M1KC 2L15A 1A2UA 5M9OA 1AZPA 1HQRD 1V1OA 1KC8C 4I7ZC 2NB0A 5JJKA 1B44D 3NTHA 4O42A 3QO2A 2EZVA 1XMOL 1NNXA 3MZ5A 1GO3E 5LMNW 4JBKA 2L5TA 2VUMH 2ENBA 2B2YC 3HOZH 3BS1A 3GTJH 2EE1A 2LKVA 2EY1A 1ICWA 2LXKA 4JC0A 1AP0A 5EPJA 3PUXA 2UXCQ 5IT9E 1F77A 4NPSA 2ID0A 1PH1A 4JI5L 2IHEA 3FRPB 4HEDA 4GOPB 2F0PA 2Z8LA 4FF3A 3GTPH 4JI2Q 4CDFC 2O4XA 4NB3A 2ES2A 1GUOA 2SEBD 3KK7A 1RODA 1IBMQ 1FR3A 3PIO3 4A3MG 4A3JG 3NK9A 1PZKD 5D3DA 1T5EA 2K28A 1BQQT 3NBIA 3BU2A 4C2MH 1R4PB 1YJWA 4C3JH 1WTXA 3MFGA 3M7NA 4NXNL 1W6KA 1JB7A 3UI2A 1K3BC 3Q6SA 5M5YH 3I4MG 3K0YA 4AH6A 1JCKB 3RZDB 2E2HH 5FLMH 3LX0A 3S16B 3RLFA 3BZCA 3M85A 2XVSA 4UHVA 4C2MB 1CM9A 5E3FA 4EVOA 3B6YA 4BY1G 3DWPA 1WVLA 2R7ZB 4F88A 4IPHA 4UPAA 5FO7B 1N32L 5E7NA 3CMEA 2QEXA 2FHTA 1PYWD 4YCUA 1XTDA 3RUZA 2H4OA 5M5YB 2WINB 1XPUA 1M4VA 3IAYA 5CORA 1IBML 1WTRA 2E2HB 1TS3A 1SJHD 3MHBA 1P8LA 3K80C 1X9NA 2K04A 3AQQA 2JK8A 1ENFA 5DEHA 1TWFH 3IFTA 1UUPA 3BDOA 5C0XH 3DXJC 2BE5D 1VQAA 3HOUB 3MXGA 2QW7A 5DNFA 1D1IA 3HGBA 2K14A 1OXSC 4EQPA 1GHJA 2PZTA 1Q12A 4GN5A 1LUZA 3PUZA 1E22A 3NP8A 1I50H 2I5MX 1XTCD 2DN8A 4A3CG 4JI7Q 1D6EC 1JE4A 1UE6A 1DOKA 4C3HG 1F9SA 3FPPA 5GAHC 4Q5VA 3S15H 1TWFB 1L0XB 2WV6D 5C3EG 3TRZA 2KCMA 1GUWA 1J6QA 4J8QA 3DLLA 2WAQB 3QOLA 4IUUA 1TR5A 3J80i 4ZRZA 4JI1L 2X6LA 1SFOH 4NW2A 3I4NH 3NQTA 1UWVA 3DWAA 1EY5A 4KKSA 4DAYB 3RZOH 4FYDA 1U5KA 1MJCA 3K8AA 1SYEA 5M3FH 4JI4Q 3F8TA 3GTLH 4I7AA 4QGUA 4B3SQ 3S15B 3DEPA 1TS2A 3E3XA 2JEAI 1JT8A 1PTOH 1VQMA 4DR7Q 1PFBA 2J7ZA 1UE5A 5LMUQ 1EU3A 3MA2B 1X65A 1N8RC 1BO0A 5GAEC 3RZOB 1X3EA 5CV5A 1AFPA 2BH2A 2O5JC 1B3AA 1S5FD 2O5IC 3GTKH 5IOCA 2HDMA 1XNRQ 3J81i 2R93B 4KN7C 3S2DH 3JC66 5IYDH 2NZOA 5JVH3 5HY6A 1EQQA 1XJVA 2XRQD 1BUVT 2O2LD 1LTAD 1O7IA 3SGIA 1Z6HA 3EROA 1PYBA 1KLGD 2NN6I 5M5WH 3VYTA 5FO8B 2YU9H 4YCWA 5DAUA 4ZUIA 2K1BA 1KLUD 4L63B 2JN4A 4X3KA 5I4DA 4LF8Q 2MGSA 2AKWB 5M3MH 2EVBA 1LO5D 3S2DB 1PA6A 2EY6A 2UXBQ 3K5LA 4O1NA 4P75A 4RKLA 4DR7L 3CPFA 1PRTC 3FP9A 1J8IA 1WD1A 1P16A 1V8QA 3I3CA 1GD7A 4LMQD 2JA6H 1Q90A 5HGQA 4LAAA 3E0JA 3FDTA 1QOHA 4H44C 1QILA 4DNRB 3TN2A 3CCUA 3CPWA 2EPBA 4A3BB 3T1HQ 4JOIA 2NVXH 3E9HA 2D5DA 4A3KG 4OWWB 4XIGS 4GZYC 4MN3A 5CV9A 5CR3A 1LTSD 4R4OA 4IJHA 1HZBA 4UAIA 4C1NK 4DV4L 2MUYA 3W1GA 4TQUS 2VS1A 4LF6L 4K6DA 1PV4A 4FDBA 5EQ0A 2XTIA 3W1BA 4GKKQ 4XYQA 1XWEA 2E75C 5IGFA 1YI2A 1L1OB 4N8X1 4NXMQ 3VR2A 2IPKD 4HJ9A 4HMJA 2DUDA 3DEOA 2MFIA 4LF8L 2AQ1B 1PH6A 3I56A 4A3DG 1KQSA 3J81L 1HNZL 3AFPA 3X3NA 1ILQA 1H9RA 4KD3A 4BXXH 1K73C 2AMCB 5ELFA 3P1HA 4FVMA 4GKJQ 5G3LF 2XRSD 1F9RA 4JI6Q 1FNWA 1IKMA 4FXKC 3OTOL 2EQSA 1D2BA 3PO2G 4ZKCB 4GOPC 4WRDA 4DFAA 4OIJA 4YWLA 4CKEA 5A2QE 2VQFL 2E76C 1EFWA 1BCPD 3STBC 3CD6A 4MHEA 1RHPA 2Q2HA 2Y0SG 4BY7G 4Y7NB 1MKHA 4XXEA 3H0GB 2EYHA 3F2DA 2HHHQ 4QL5A 4A3EH 4GKKL 2B63G 3PMFA 1EYGA 2F0EA 1E1TA 2ICEC 1VQ6A 1E7ZA 1B53A 3HOYB 4K8JA 2NVQB 4G4KA 1NMFA 1GUTA 3W5OA 2UUCQ 1VQ7A 1Z9FA 1LT3D 1BCPB 1TWHH 1R9TB 4R8IA 5C4XH 2FINB 1RL2A 2HT1A 4HIKA 3HKZE 1NMGA 3BVZA 4A3FG 1VQNA 3J7YW 3W2DA 1BVSA 2MJ8A 1KDAA 1XMQQ 4KHPQ 4HSPA 4GKJL 3TQYA 3CRKC 1H9JA 5FLXc 4JCVE 5IGEA 4F87A 2WKCA 2B2VC 4AYBB 2MP1A 4IZ8A 2JEBI 4QQBX 1TWHB 3CRLC 1IBKQ 5CMDA 3M4YA 4LFBQ 5JVG3 1FJGQ 1MBYA 5FJ8H 3H15A 3Q24A 1Q86C 1V9PA 2HHHL 1B4OA 2OTJA 1TS4A 1GOZA 4DR4Q 3OIPA 5KYIA 4TSSA 2VUMG 2NWGA 3IRBA 1C9OA 3HOZG 3S17H 3H94A 1I4PA 3ZJYC 3KUPA 2E5LQ 2YTVA 2B2TA 4DK0A 5C3XA 1GUNA 2PNHA 3SK6A 2R92B 4X66Q 1E0BA 1WCMB 5IE8A 2KEDA 1YVCA 1HTLD 2UUBL 2E8GA 2RCFA 4LF5Q 5FK9C 1VQJA 3C1EA 1QVGA 2I5HA 1EIFA 3ERSX 2BE5C 3D4DA 2IW3A 3TBIB 1VF7A 4AQYQ 3S17B 2A69D 3A5UA 2JA5H 4QF4A 3NPPA 4QCLA 5CV7A 4I65A 3VDYA 1SJED 5EGTA 2R7FA 4AYBE 4LJZC 1KHIA 4H7BA 1G91A 4ZK9B 1DZ1A 4C3JG 2VQEQ 5C44H 1Y1VH 2MPMA 1EYCA 3UDIA 2UXDL 4XT1B 4DKAC 4DXGA 4HJAA 3UDFA 2WFWA 4DF7A 1PH7A 4JI3Q 1E2VA 4JI0Q 3S1NB 2QCPX 2XSCA 2ZXPA 5CBEE 1K83H 1KDCA 2E2IH 4A76A 2LXJA 1EWHA 1I4HA 2JA9A 3T56B 5C44B 1YNNC 1Y1VB 1EOTA 1EQRA 1CKNB 1X3GA 3HKSA 3CF5A 2UUAL 2ZTEA 4DV1Q 3TZUA 1SNMA 2MQHA 4WFN3 1PH5A 1IYJB 2Z4HA 3KLWA 3PO3B 1PTOC 1VQDA 4KJNA 3TSSA 2CCZA 4AQYL 4X64L 3HOVG 3KDFB 4LFAL 1MHWC 3K81C 1IXRA 4UP7A 3I73A 1W6JA 1NY4A 5T1IA 1B7YB 2EY2A 2D0PA 1EIHA 5C0XG 2D9UA 2HUGA 2E2IB 5IP7H 1VMCA 4LUOA 1KTKA 4ABNA 3H3VH 3UDXA 5FLXL 1DGSA 5IGCA 1MJEA 2K52A 4GNXB 4L5RC 3BYTB 3SHLA 2MNAA 2WB1B 3E5SA 2A68C 3F1ZA 2E2DC 2KCTA 1I6VC 1EZ8A 1FYCA 2IWHA 1MI2A 5F2DA 2HD3A 4HSVA 4DR6L 3K59A 5ELOA 3JAMc 2NBFA 2ZM6Q 5JJZA 3BYYB 1SSOA 1TWGH 4DNIA 3I4NG 4A4IA 4DV1L 4TRDA 2A8VA 2G9HD 5GROA 3PUWA 1YNJD 5M3FG 4DK3C 4AIMA 1WTPA 4IPDA 4DGZA 1CA6A 3KF8B 3MC0B 1DJRD 2IHFA 2PQAB 1JWMD 3P20A 5C0XJ 1YZ6A 1L1OC 1STGA 1STHA 1IYUA 1STBA 2P5ZX 4G57A 4QMGA 3M3YH 2K33A 3TP8A 3WOEA 2KECA 2VB2X 5BR8L 3VR5A 1KNEA 3IKJA 1NJIC 2OF1A 2KCCA 4DAVA 4BBRG 5NUCA 3UE1A 1D5MC 1SNPA 4OO1I 3F2BA 2JA7H 3ULLA 5IYDG 1X3QA 2KVMA 4OELB 3M3YB 1M90C 1I94Q 2VW9A 1II3A 2ZM6L 4A3IH 4DV5Q 4YHHL 1BBWA 2EYPA 2PO4A 1TU2B 3PUVA 4R1JA 5JJIA 3M4OB 2F0WA 1SE4A 5JEAJ 1JJGA 1TIID 4DUZQ 4IUVA 1VQ4A 4OWTB 5I6WA 5M3MG 3NTKA 1SYGA 3I70A 1E3PA 2I0QA 4IFDH 4L8JA 3I55A 4DAPA 1DD2A 4OHJA 1G8ZD 2JA6G 5KEEA 3TREA 3LNNA 3J7A5 1YJNA 4C56C 2PQAA 2CQAA 3R3OA 1ZXTA 1LTID 3HP3A 2HDLA 1VQFA 5JPNC 1JC7A 3U50C 4IO9A 4JI5Q 2EYOA 1FNVA 3V05A 1L0WA 1GUGA 4UP8A 4DV5L 4G7HC 1EY4A 1F2MA 5KIXA 3J81j 1UE1A 3R8BA 4CKCA 5G3LD 1WTWA 1IW7C 4DR1L 4DUZL 1RTOA 4IALA 3NHHA 3JAML 1Y8OB 2NTSA 1B9MA 4P72A 3DUZA 4J15A 3VYSA 1CHQD 1Y14B 1Q46A 2V4DA 4DV0L 4NXNQ 3BG3A 3MXUA 1D7QA 4IUTA 1FD7D 4KMUC 5I9OA 2MHVA 4IOAA 4R4TA 1DCZA 2K5NA 4A93G 1K0RA 2IY5B 1CA5A 1BXTA 4RMFA 5J3BA 2K5WA 1ILPA 1C4QA 3CKIB 2QILA 4DXFA 1MD2D 4A3EG 1N32Q 1HR0L 1KXLA 4XT3B 1JJ2A 3NBHA 4FF4A 3L7ZC 3RZDH 3S16H 3EQLC 3AEVA 1WTVA 4RKBA 3EVQA 4WJ4A 3Q0AA 5C4XG 1TWCB 1NR4A 4HJ5A 4RAUC 1SYCA 2R7ZH 1S5DD 2C9OA 1NR2A 2CW0C 2EYFA 3OWEB 1VQIA 1SLJA 1O7YA 4XTCS 4FF2A 1H9KA 3MXNA 5I2XA 5BN5A 2B2UC 4FXDA 1B50A 4QUFA 1QWYA 5FJ8G 3ULJA 3HOUH 1B2TA 2BCOA 1D1KA 4JI1Q 2AQ2B 4UP9A 5EBCA 1UAPA 3FMCA 4HTHA 3J80c 5AFWA 4QB4A 4A3LH 2RDHA 2Q2TA 1OXXK 4POGA 4ME3A 5EAYA 3IL8A 3K5OA 1LABA 1HZ9A 1I4RA 2L4NA 4GNXC 3HOWH 1X54A 4FO2A 1Q82C 2F0VA 2DY7A 3RD4A 2N8NA 4KN4C 1VMPA 3KJPA 4HJ8A 5DLQE 3MAQA 1YJ9A 1TKWB 3SDZA 4NMZA 3GTOB 2L1BA 2A6HD 4XQNA 4XDXA 3GTMB 5ELEA 1OXVA 2SDFA 1HQMC 2XN9C 3W3AA 5C4JB 4ZUJA 3I90A 3H3VC 1LV9A 2G5DA 2X69A 2JA5G 3HOWB 2DJGC 1KIXA 2NVYH 3K6OA 1QCBD 1PFNA 4JI8Q 3J81c 3L3OC 1IL8A 2RDFA 1JORA 2F0FA 3A74A 1Y1WG 5C4HA 2Z6KC 2B2WC 1G6ZA 4MTKA 4ID6A 3WOFA 1Q7YC 1QNUA 5EKIA 1XYIA 5JEAH 4DU9A 3S14B 2R93H 2D62A 3K57A 1ASZA 4JBMA 2KBNA 3D6CA 3KF6A 2NVYB 4K6LA 3QJYA 2JXMB 2WKDA 3J7AF 2XNAC 3L2PA 4X3UA 2QEJC 1IHZA 2F0GA 3KLRA 3K7AB 4F8MA 3UDGA 4GN3B 4HCEA 3R2TA 3CMAA 2PPBC 1LM0A 1STAA 2JQOA 3OMCA 5BN4A 4BBSG 1N36L 3MTSA 1N34Q 4DV4Q 2ZJPA 4R8NA 2VNUD 3HEJA 4C3IB 4LF6Q 3NXWA 5BN3A 1VCIA 4LF4Q 1K8MA 5IP7G 4JI8L 1F2YA 2FMCA 5COYA 2F4VL 2D0OA 4QJFA 4EX5A 1RTNA 2EXDA 4OX9Q 1MGSA 1HH2P 4A3BH 4RG1A 3I4LA 4IUNA 2GVBA 2AUJD 1EU4A 4JW0A 1CSQA 4ODGA 1UNSA 3GV6A 4R4CA 1ZYRD 1HNZQ 1IZ6A 2FJ2A 1K9MC 4IUPA 2L55A 2N55A 2A1AA 3A8IE 4EQOA 3J80L 3A7AB 2KENA 1GHKA 1ASYA 1HPCA 1K3RA 3VA7A 3OTOQ 1EIGA 4L5SA 1RCVD 3C1FA 1FNUA 1SEBD 2VQFQ 1QUQA 3QG1A 4QUCA 3SR1A 2L12A 1QZGA 2KA7A 3X3MA 1SNCA 1N34L 4B3RQ 1EEFD 2XWJB 1VDZA 2DNEA 3D6WA 4LF4L 3EN2A 3N6RA 3FEWX 1SMYD 1EYDA 1G291 4N8FA 5J1ZA 4OX9L 4BA1I 1Q8KA 3OOCA 3SK4A 2LMCB 1N33Q 2ZTCA 3KLSX 3AB9A 3BVGA 1G6PA 3HKZB 5IODA 3V2TA 3HOXB 1PMRA 3A5ZB 4PQXA 4X3TA 2K5QA 2PYKA 4Y7NH 2JA7G 5I9PA 3H0GH 2DGYA 3NTIA 1PFMA 1IKLA 4DUYL 2BA1A 4A3IG 1CKOA 1VQ9A 3HFZB 3LWUA 1EWCA 3HOYH 1BOSA 3M9BA 4DK1A 2CWPA 1VQGA 2NVQH 1C7YA 3A0JA 4RGTA 4P2CB 1HJPA 3NENA 4LF7L 1R9TH 1MSGA 4B3RL 3PCOB 2JA8H 2B39A 4POFA 2VL6A 4K14A 3S24A 4IFDG 4E6IA 4KHZA 4ME5A 1PH3A 5GAGC 5C4ZA 1JQYD 5HURA 1N33L 2ASBA 3U9OA 2I46A 4OL7A 2FMMA 3V96A 1Q1BA 2EYJA 2J4XA 3EFXD 2RSOA 3M4PA 5EJWA 2B3GA 3C3LA 4N9TA 2JA8B 3HG9A 5IWAL 5JPMC 3RN5A 1X55A 5IGBA 3KYHC 3RLNA 2UUBQ 2HCCA 1Q81C 2KEEA 2NYZD 3VR6A 3AYHB 3HZXA 1N9WA 3SXHA 4K2KA 3U4ZA 3G7LA 1HUMA 2JSOA 2ZXOA 4A75A 4O0AA 1UEBA 4DAMA 1OTCA 2YV5A 2F1MA 2VZAA 1SNOA 3WWVA 2R92H 5IYCH 1WCMH 2Z9HA 1FGBD 2C35B 3AMUA 3CCSA 4IFDJ 1SROA 4WJWA 1STYA 4ZLTF 1KDBA 4MZ9A 3PF4A 1A62A 2OTLA 3A7LA 2OT2A 4JBJA 1SYBA 2F3WA 3CC4A 3HS0C 2UXDQ 1VQLA 5KNCA 4NP5A 5LMNL 4A3MB 3G6JB 4A3JB 1C0AA 2LS01 2QA4A 2R61A 2TMPA 3A55A 5J39A 1LTBD 3BZKA 4BY1H 4EQ5A 1T9HA 3NWSA 1PHJA 3M7GA 4PV1C 1S40A 3I4MB 2UUAQ 5J22A 3EA6A 2NN6H 4Q0FA 2PW7A 1S4ZA 5TSSA 2AWNA 4X64Q 1HZCA 4LFAQ 1SN8A 3GTGB 3KJOA 3S1NH 2M9VA 3J81E 1LACA 1DOMA 3ITPA 5IT9c 1A15A 4FNFA 5I2YA 3RNUA 4IFDI 4BY1B 2NZ1D 4GS3A 1LTRD 1JOKA 2R7ZG 4V0BA 3D0FA 4RH6A 4JOIC 2AHOB 3Q8DA 2M2LA 3PIPA 3PO3H 5A35A 1VQHA 2CFMA 5FLMG 2K75A 1RKNA 3KLSA 1B70B 5T1GA 4JBWA 3H09A 2CH4A 5FO9B 1YHAA 4S3SA 4WORA 4DR6Q 1JE5A 3HOUG 3EJIA 2C5CA 5EKKA 4DK6C 3OMGA 3S1QH 1B8AA 1SXTA 1IL2A 1K8OA 1S5CD 4A3LG 4C3HB 4JYAL 5ISRA 5C3EB 2K32A 1ET6A 1YEZA 2MO1A 4PG3A 3HOWG 1JOOA 1SDFA 4KKTA 1DYQA 1EY0A 3T53B 2WAQG 4N9PA 5CC4A 4HMIA 2YYZA 4GLVB 4CJ0B 2B29A 3A8KE 4RGMA 3S1QB 3SK5A 3A8JE 1SNDA 5BR8Q 5M5XB 1HHVA 1B9NA 1Y8NB 3L0OA 3IFDA 3GV3A 2B2YA 5EPKA 3C2PA 1PTOF 5D14A 3RR5A 4R4QA 1XNQQ 1JWSD 4YHHQ 3BVMA 4IUQA 1OXTA 2DNCA 4LUVA 3DWQA 1RDPD 1K28A 3CCQA 2PZWA 4BA2I 1ZYRC 4DPGA 4B9WA 1MIUA 2IX0A 4YY3L 1JJCB 3I91A 5JEAG 1I3QB 5C6AA 1JICA 1PH9A 2EOTA 2QKIC 4JG2A 1FVIA 2UU9L 2R93G 3CHBD 1ML0D 4RWSC 1TWAB 2KHSA 3T1YL 2ZXRA 5JOBA 5KGUA 1Y8PB 1QG7A 1C8CA 4XQQA 2PMZB 1CZWA 4LK1C 1CSPA 2Q2IA 1D5ZC 4LUZA 3M4OH 3U58A 4CGYB 4PZ6A 3CCJA 2B8FA 1PH4A 3S2HB 5IT9L 2YTYA 3URYA 1HXYD 1LT6D 3FKIH 4K2LA 2N3SA 3GO5A 3T51B 1XNQL 3GD7A 5C3WA 4CDEC 1A8VA 5K5PA 1A3UA 4HR7B 3OHXC 2KCNA 3CU7A 4A3KB 1J9OA 3OSOA 1GM5A 4EQNA 2B2TC 2A5HA 4A3BG 3FHWA 4L5TA 4DR1Q 2E74C 1H9SB 2F0KA 4PNYA 5HGTA 4A3DH 4LW1A 3PSIA 5C0XI 5C5MA 1U4RA 3FKIB 4X62Q 2QF7A 1WOCA 1X32A 4K5XA 3S1RB 4CJ2C 4X65Q 1QNKA 2IJ0A 4KY5A 2CH4W 4DV0Q 1BCPC 4K0KQ 1W3SA 4X6AH 3NBHB 3UE0A 1E24A 3HKZG 4BY7H 2PMZE 4OWXB 4A3DB 4DR3L 2Z0SA 1I6HH 4APVA 1DONA 1DM0B 1MSHA 1Y69U 3NE5B 1AEXA 3CQZB 3OW7A 3ERQA 5FLXE 4H02A 1PZJD 4YIJA 5CV8A 1HR0Q 2QGQA 3PO2B 3G48A 2RA4A 1SYFA 1EQTA 3I7FA 2D2CC 1LYLA 3G6EA 2F3VA 2B8GA 2EJFC 2KHIA 4FF1A 4BY7B 3K0XA 2F0JA 3D4RA 3P75A 4LF9L 4BWGB 2SNSA 2HQLA 4ZKBB 4FXGC 4A3FH 4X62L 1I6HB 3MEHA 1HZAA 4KV6A 1VQBA 3H0GG 3MXNB 2ALYB 1I4GA 2VB3X 4LWCA 4X65L 2B63B 3QR8A 1HFGA 4BXXG 4XYOA 1EOVA 5KNDA 4QY7A 1TY2A 4K0KL 3RLOA 1H9SA 3HOYG 3P7JA 4JPBW 3EBEA 2KUMA 1F2ZA 1B1ZA 1TT2A 1WTHA 3C46A 2N49A 2EYMA 4DNTB 4A3FB 1JWUD 2RHSB 5DM73 1HUNA 3KBGA 5LL6S 2JA8G 5AJ3L 1K8GA 1TWCH 4CDDC 1CQFA 5IIFA 1NBWA 1XPRA 5E1FA 3STBD 5CYUA 1C48A 2F0UA 3NUCA 3CP0A 2A73B 3VR4A 2OQKA 1F2LA 2ZT9C 3T13A 4A3GH 1E1OA 3EIVA 3U4VA 4HIDA 3I4OA 4G7ZC 3NQIA 1EIYB 3MFYA 2LFNA 3D31A 4U68A 4AYBG 1CKMA 2NUCA 2RHQB 3R2IA 2Y0SE 2OEOA 4CHTB 2F0MA 2F0TA 4OEMB 5L37A 1SNQA 2A69C 1NAPA 3CAMA 4JK1C 3OYYA 1STEA 1CFMA 2VUMB 1EZ6A 4A3GB 3HOZB 2WIIB 3GTJB 1YNXA 3DMUA 1SRUA 1VQPA 1OXUA 5ELNA 1G2SA 1TS5A 4B3MQ 4NKLA 5IY0A 3Q23A 2R92G 5IYCG 1VQCA 1WCMG 1ZEQX 3GTPB 1HRJA 1LTGD 2KQ3A 4RA8A 5KYLA 3A56A 1EQVA 2R6GA 3I72A 3KF6B 3AFQA 3NEMA 2SNMA 1A2TA 3GTOH 4HAEA 3TP5A 2NVTH 2A74C 3GTMH 1U4LA 3ICEA 4ZYSA 5C4JH 2UXCL 3H91A 4OO1H 1AZQA 1YHQA 5IYBH 4J6HA 4CDCC 3CCRA 1S3OA 2K01A 2HIVA 4C3JB 2BOSA 4DA2A 5IP9H 4JI2L 1NTGA 1TQOA 3VA5A 1CI3M 4FP5D 3H6MA 1VQEA 4H13C 1CZGA 1Q3LA 1CHPD 1KRSA 3BDCA 3PIP3 1WD0A 3K58A 2NN6G 3HOVH 2NVTB 4KY6A 4YWMA 2J0TD 2PCFB 2R3ZA 3D8GA 4P71A 4GOPA 1ESRA 2EJMA 1IBLQ 4B3ML 1BNZA 3S14H 1N36Q 3JAME 3NSWA 3AU7A 1S5BD 1QVFA 3FPUB 1I5FA 1PFSA 5EBDA 2RDGA 2F4VQ 4CKBA 2E2JH 2K6AA 2NZHA 5C44G 1Y1VG 1X3PA 3K7AH 5LHY1 4OIKA 3HOVB 1CQVA 3N52A 3PO3G 1GUSA 2ZJRA 3D3RA 1L2FA 1B3QA 5I6YA 2EIFA 1EFID 2F4IA 4DV6Q 2A6ED 1GVPA 1QUQB 3A54A 4KD4A 4C3IH 1YITA 1KABA 1YNJC 2RBMA 4KI0A 2PZUA 1EL0A 2H5XA 2E2JB 1ENCA 1Q8IA 2IX3A 1CT1D 1UE7A 1LLRD 4HN7A 2Q2UA 1I50B 4QIWB 2LY7A 5K36H 1CTMA 5A2QL 1HNWQ 1YNND 4LFCQ 2WB1G 1SAPA 1U4PA 1IBLL 2B2VA 1BBUA 1LT5D 2EJGC 1RF2D 1PTOD 5JJLA 2VY3A 1SFOB 4KY7A 1A3TA 3I4NB 2GVAA 1X3FA 2Z1CA 3QOJA 3K5NA 4K5VA 2PQEA 4BBRH 5M3FB 3GTLB 4JI7L 2ATWA 3CCVA 4KHVA 2FXQA 1VQOA 1AH9A 1U9RA 1W2BA 1PDQA 3M4QA 3GQBA 4DV6L 1PTOB 1KRTA 1VQ5A 2F0HA 5FKAC 1SE3A 2F0IA 2TSSA 4DUYQ 2A68D 4CBVA 1H9MA 4PMBA 2F3IA 4K8IA 5GADC 2I07B 4B9XA 1SR3A 4OXPA 3RMHA 2WAQE 3G4SA 1DXMA 4IPCA 4L5QA 3QB3A 2N78A 4BBRB 4JI4L 1ESFA 1CK1A 3GTKB 2AQ3B 5IGDA 1HNWL 2HCIA 4LFCL 4B3SL 3HOXH 2RCNA 2IL8A 1QZHA 4LF7Q 4PZ8A 4QIWE 2RVLA 4JVZA 5EKLA 4MNOA 2Z6BA 5DM63 2YTXA 3ND9A 4DAYA 5LMUL 1RD9D 2JE6I 1ENAA 1U4MA 1OO9B 1PRTF 4O2DA 5M5WB 1JMCA 2ZTDA 2YU9B 1AW7A 3KFUA 1VS0A 3MVVA 3ND8A 2F0SA 3R93A 1XNRL 5EPLA 5M3MB 2F52A 5FOBB 1SE8A 4B3TQ 3Q22A 2L0CA 1PVOA 3NELA 2K03A 5IWAQ 3FKIG 1V1PB 3DHQA 1JOQA 1XX8A 2CWAA 4UDUC 5CV6A 3E9IA 2JA6B 5CGKA 1A6XA 4RCOA 1T5XD 1NCVA 4MTNA 5E4XA 2NVXB 4OONA 2F0DA 3ULPA 2RQXA 3DM1A 4DV2Q 3GTQH 1HA5A 3J7ZC 2UXBL 1TVXA 4ULLA 3CXCA 4LNQA 2EDGA 4WJ3M 1BKBA 3OPOA 3H3VI 1O78A 3KBXA 3ONAB 5JAVA 4RGNA 3T1HL 2IX1A 4ILWA 4MIUA 5LMNQ 3QIAA 3E0EA 1PH2A 4A93H 4GLAC 4B3TL 3ER0A 1AN8A 3SEBA 3GTQB 1KL9A 3SVMA 4DR2Q 3E6ZX 1LT4D 1HR0W 3K7UC 4KTAA 5IGGA 1HFNA 1D8LA 4NXML 2N88A 3SK8A 4KK7A 2K5HA 2EY5A 2RKSA 1WYDA 3BDLA 4ZQ3A 4X3SA 3MWYW 4YCVA 1NSNS 4RHSA 4A3MH 3G71A 4A3JH 4A93B 1WI5A 1V1PA 5E4WC 4DV2L 2CKZB 2GA4B 1IW7D 4V190 1PZID 2F0OA 1L1OA 4GLXA 2ICIA 2XGTA 4A3EB 4KKUA 4Y52H 3J80E 3OWFA 4JI6L 3GDEA 1V43A 3I4MH 1QVCA 3S1MH 2L11A 2Q8IB 3LWEA 2HQEA 1HNXQ 4R9WA 5D65A 3PIOA 2DY8A 2K4KA 1SMXA 3L9AX 3CCMA 4IQZA 1BBXC 2OQ0A 3GTGH 5C4XB 4DR2L 1G51A 2K7VA 1X6OA 1ONLA 1HTPA 1CUKA 1A63A 1GKHA 1FGUA 4GN4B 2AUKA 3S1MB 3MXPA 3BJUA 1QB5D 3T16A 3NWTA 2JYOA 3CC7A 1JR0D 5LL6X 2R7DA 4A3GG 2XIWA 2UUCL 4JYAQ 4IN3A 2A19A 4HCSA 4KJOA 2K50A 1BR9A 1YBYA 1A3VA 2BH8A 4IOCA 1J5EQ 2A6HC 1DOLA 1XXGA 4XQJA 4HJ7A 1K0SA 1XMQL 4KHPL 1BF4A 2QDBA 1KAAA 4EGVA 4KLKA 1X56A 1HNXL 4A3CH 2V1CC 2BDOA 4C3HH 2RSNA 4HIOA 4LFBL 5C3EH 2CW0D 1IBKL 1FJGL 4P74A 1K8AC 3TDQA 1M8AA 2PW5A 5KRUA 3F2UA 1HCZA 1O80A 1Y1WH 3QWNA 3I8ZA 4R4IA 1STNA 3WDNA 1QJOA 3PF5A 2F0QA 1RIPA 4DR4L 4M8AA 2BA0A 3KOJA 2EYLA 2A6EC 5M5XH 2CHBD 2K05A 1WJJA 5ELBA 4YY3Q 1D5XC 1VQKA 2OWOA 4TKOB 2E5LL 2JA5B 1LTTD 2RF4A 1ZKOA 2UU9Q 4X66L 2CVRA 4OO1G 1EY8A 5KNBA 5IYBG 1J5EL 3TS0A 3T1YQ 3VYUA 5ELDA 1Y1WB 1ICFB 3F2CA 5IP9G 4LF5L 2GN5A 2IT1A 2AWOA 1L0YB 1XPOA 1R4QB 1YIJA 1TY0A 4JV5Q 2K5VA 3J7AV 4DR5Q 2X6GA 4BBSH 1I3QH 2LSSA 1BDOA 2F0LA 4IJLA 3TP6A 4U673 3CW2C 2FFKB 1K83B 1S5ED 5C5LA 4C1NI 2XWBB 2EXZA 2M00A 2VXWA 1SYDA 1F9PA 1TWAH 2VQEL 3T4AC 3PUYA 1WTQA 3DM3A 2KHJA 4G7OC 4B08A 2F03A 1IYVA 1GJXA 3K5MA 5GQOA 4BBSB 4K5WA 4DV3Q 3S2HH 1E2ZA 1FL0A 3BZDB 4IPGA 4JI3L 4JI0L 3CCEA 4DV7Q 1H95A 3TEHB 4OGQC 1I4QA 4J1MA 1KD1C 1JB3A 4TVAB 2Q8TA 4IURA 4C3IG 3ZYYX 3PV0A 3OW2A 3PGZA 4CJ1B 4RCNA 4Z9CB 5ELCA 4A3KH 4JV5L 3GP7A 4DR5L 5H1SE 5K36G 2L9HA 2F0NA 3LGJA 1SMYC 3OIQA 2PNRC 4DR3Q 3MEFA 1V1QA 2B2UA 2OCEA 1VQ8A 1CKNA 1KNAA 3RN2A 1SE2A 2JP1A 1PLFA 3S1RH 1TXYA 1Z7TA 1TWGB 2WP8J 4PMWA 3D4WA 1PYSB 4RFBA 3KDFA 1ET9A 2Q8RE 3U9SA 1PXUA 3I2ZA 1EWIA 4HIMA 3JAMi 4DV3L 4LF9Q 4NDXA 4DV7L 2BDNA 2QDLA 1QE6A 1UEAB 2WB1E 2MO0A 4BS9A 1S72A 1Q1EA 4GNXA 4PMCA 4YWKA 2KJXA 3TP7A 2DJFC 3CQZH 1WTOA 4DN4M 3CC2A 3PO2H 1KAWA 2CQOA 1PRTD 2ZJQA 1NUCA 4M1UB 4PZ7A 1SBBB 1EEID 2K5DA 1GXDC 4RHRA 1EY7A 1NE3A 2HIXA 2SOBA 4H0LC 5D3IB 1O7ZA 2I5LX 1A0IA 2JJQA 1WFQA 3HOXG 4UY8C 2JA7B 1EYAA 1HA6A 3TZDA 2WACA 5AJ3Q 4A3IB 5CV4A 1EY6A 2B63H 2H1EA 4RGOS 1AE2A 1XMOQ 4L6TB 3FVQA 5CBAE 3KF8A 2B2WA 2Z6KA 1PRTB 4P73A 1Z47A 1BCPF
chains in the Genus database with same CATH topology
2Y0SB 1E2WA 1RJTA 1VF5C 3S9WA 3VYRA 2NTTA 1G2TA 3HRZC 1O7LA 2OXPA 3SE0A 4ZAIA 2G9DA 3O13A 2Z4IA 3VR3A 1I4XA 1F9QA 2KOLA 1EY9A 3TMEA 4F7XA 1A2UA 5M9OA 1AZPA 1HQRD 1V1OA 4I7ZC 2NB0A 1B44D 3NTHA 4O42A 3QO2A 2EZVA 3MZ5A 2L5TA 2ENBA 2B2YC 3BS1A 2EE1A 2LKVA 2EY1A 1ICWA 1AP0A 5EPJA 3PUXA 5IT9E 1F77A 2ID0A 3FRPB 4HEDA 2F0PA 2Z8LA 4FF3A 2O4XA 1GUOA 2SEBD 3KK7A 1RODA 1FR3A 3PIO3 3NK9A 1PZKD 5D3DA 1T5EA 2K28A 1BQQT 3NBIA 1R4PB 1WTXA 3MFGA 3M7NA 1W6KA 3UI2A 3Q6SA 3K0YA 1JCKB 3RZDB 3LX0A 3S16B 3RLFA 3M85A 2XVSA 4C2MB 1CM9A 5E3FA 4EVOA 3DWPA 1WVLA 2R7ZB 4F88A 5FO7B 2FHTA 1PYWD 3RUZA 2H4OA 5M5YB 2WINB 1M4VA 3IAYA 5CORA 1WTRA 2E2HB 1TS3A 1SJHD 3MHBA 2K04A 1ENFA 5DEHA 3IFTA 1UUPA 3BDOA 5C0XH 3DXJC 2BE5D 3HOUB 3MXGA 5DNFA 1D1IA 3HGBA 1OXSC 4EQPA 1GHJA 2PZTA 1Q12A 3PUZA 3NP8A 1XTCD 2DN8A 1D6EC 1JE4A 1DOKA 4C3HG 1F9SA 3FPPA 4Q5VA 1TWFB 1L0XB 2WV6D 1GUWA 4J8QA 2WAQB 3QOLA 4IUUA 1TR5A 4ZRZA 2X6LA 4NW2A 3NQTA 3DWAA 1EY5A 4KKSA 4FYDA 1SYEA 3S15B 3DEPA 1TS2A 2JEAI 1PTOH 1PFBA 2J7ZA 1EU3A 3MA2B 1BO0A 3RZOB 5CV5A 1AFPA 2O5JC 1B3AA 1S5FD 2O5IC 5IOCA 2HDMA 2R93B 4KN7C 5JVH3 2XRQD 1BUVT 2O2LD 1LTAD 1Z6HA 3EROA 1KLGD 2NN6I 3VYTA 5FO8B 5DAUA 4ZUIA 2K1BA 1KLUD 4L63B 4X3KA 5I4DA 2MGSA 2EVBA 1LO5D 3S2DB 2EY6A 3K5LA 4O1NA 4RKLA 1PRTC 1J8IA 1WD1A 1V8QA 3I3CA 4LMQD 1Q90A 4LAAA 3E0JA 3FDTA 1QOHA 4H44C 1QILA 4DNRB 3TN2A 4A3BB 2EPBA 2D5DA 4XIGS 4GZYC 4MN3A 5CV9A 5CR3A 1LTSD 4UAIA 4C1NK 2MUYA 4TQUS 4K6DA 5EQ0A 4XYQA 1XWEA 2E75C 5IGFA 3VR2A 2IPKD 4HMJA 3DEOA 2AQ1B 3J81L 3X3NA 1ILQA 1H9RA 4KD3A 5ELFA 3P1HA 4FVMA 5G3LF 2XRSD 1F9RA 1FNWA 1IKMA 4FXKC 1D2BA 4ZKCB 4WRDA 4DFAA 4OIJA 4CKEA 5A2QE 2E76C 1BCPD 4MHEA 1RHPA 4Y7NB 4XXEA 3H0GB 2EYHA 3PMFA 2F0EA 2ICEC 3HOYB 1B53A 4K8JA 2NVQB 4G4KA 1GUTA 1LT3D 1BCPB 1R9TB 4R8IA 2FINB 3BVZA 3J7YW 3W2DA 2MJ8A 1KDAA 4HSPA 3CRKC 1H9JA 5IGEA 4F87A 2WKCA 2B2VC 4AYBB 2MP1A 4IZ8A 2JEBI 1TWHB 3CRLC 5CMDA 3M4YA 5JVG3 1MBYA 3Q24A 1B4OA 1TS4A 1GOZA 3OIPA 5KYIA 4TSSA 2NWGA 3H94A 1I4PA 3KUPA 4DK0A 5C3XA 2B2TA 1GUNA 3SK6A 2R92B 1E0BA 1WCMB 2KEDA 1HTLD 5FK9C 3C1EA 2BE5C 3D4DA 2IW3A 3TBIB 1VF7A 3S17B 2A69D 4QF4A 3NPPA 4QCLA 5CV7A 4I65A 1SJED 5EGTA 4LJZC 1G91A 4H7BA 4ZK9B 1DZ1A 4C3JG 2MPMA 1EYCA 4XT1B 4DXGA 4DF7A 3S1NB 1E2VA 2QCPX 2XSCA 2ZXPA 5CBEE 1KDCA 1EWHA 1I4HA 3T56B 5C44B 1YNNC 1Y1VB 1EOTA 3TZUA 1SNMA 4WFN3 2Z4HA 3PO3B 1PTOC 4KJNA 3TSSA 3I73A 1W6JA 5T1IA 2EY2A 1EIHA 5C0XG 2D9UA 2HUGA 2E2IB 1VMCA 1KTKA 4ABNA 5FLXL 5IGCA 3BYTB 3SHLA 2WB1B 3E5SA 2A68C 2E2DC 1I6VC 1EZ8A 1FYCA 2IWHA 1MI2A 5F2DA 4HSVA 3K59A 2NBFA 5JJZA 3BYYB 1SSOA 4TRDA 2G9HD 3PUWA 1YNJD 1WTPA 4DGZA 1CA6A 3MC0B 1DJRD 1JWMD 3P20A 5C0XJ 1STGA 1STHA 1IYUA 1STBA 4QMGA 4G57A 2K33A 3TP8A 3WOEA 2KECA 2VB2X 3VR5A 1KNEA 3IKJA 2OF1A 2KCCA 4DAVA 5NUCA 1D5MC 1SNPA 4OO1I 1X3QA 2KVMA 3M3YB 1II3A 2EYPA 2PO4A 1TU2B 3PUVA 3M4OB 2F0WA 1SE4A 5JEAJ 1TIID 4IUVA 5I6WA 3NTKA 1SYGA 3I70A 4IFDH 4L8JA 4DAPA 1DD2A 4OHJA 1G8ZD 5KEEA 3LNNA 4C56C 2CQAA 3R3OA 1ZXTA 1LTID 3HP3A 2HDLA 5JPNC 1JC7A 2EYOA 1FNVA 3V05A 1GUGA 4G7HC 1EY4A 1F2MA 5KIXA 3R8BA 4CKCA 5G3LD 1WTWA 1IW7C 1RTOA 4IALA 3NHHA 3JAML 1Y8OB 2NTSA 1B9MA 3DUZA 3VYSA 1CHQD 2V4DA 3BG3A 3MXUA 4IUTA 1FD7D 4KMUC 5I9OA 2MHVA 1DCZA 1CA5A 1BXTA 2K5WA 1ILPA 1C4QA 3CKIB 2QILA 4DXFA 1MD2D 4XT3B 3NBHA 4FF4A 3L7ZC 3EQLC 1WTVA 4RKBA 3EVQA 3Q0AA 1TWCB 1NR4A 4RAUC 1SYCA 1S5DD 2C9OA 1NR2A 2CW0C 2EYFA 3OWEB 1O7YA 4XTCS 4FF2A 1H9KA 3MXNA 5I2XA 5BN5A 2B2UC 4FXDA 1B50A 4QUFA 1QWYA 1B2TA 2BCOA 1D1KA 2AQ2B 5EBCA 1UAPA 3FMCA 4HTHA 5AFWA 4QB4A 2RDHA 1OXXK 3IL8A 3K5OA 1LABA 1I4RA 2L4NA 4FO2A 2F0VA 2DY7A 3RD4A 4KN4C 1VMPA 3MAQA 1TKWB 3SDZA 4NMZA 3GTOB 2L1BA 2A6HD 4XQNA 4XDXA 3GTMB 5ELEA 1OXVA 2SDFA 1HQMC 2XN9C 3W3AA 5C4JB 4ZUJA 3I90A 3H3VC 1LV9A 2X69A 3HOWB 3K6OA 1QCBD 1PFNA 1IL8A 3L3OC 2RDFA 1JORA 2F0FA 5C4HA 2B2WC 1G6ZA 4ID6A 3WOFA 1QNUA 5EKIA 1XYIA 5JEAH 4DU9A 3S14B 2D62A 3K57A 3D6CA 2NVYB 4K6LA 2JXMB 2WKDA 3QJYA 3J7AF 2XNAC 4X3UA 2QEJC 1IHZA 2F0GA 3KLRA 3K7AB 4F8MA 4HCEA 3R2TA 2PPBC 1STAA 3OMCA 5BN4A 3MTSA 4R8NA 2VNUD 3HEJA 4C3IB 3NXWA 5BN3A 1VCIA 1K8MA 1F2YA 2FMCA 5COYA 1RTNA 1MGSA 3I4LA 4IUNA 2AUJD 1EU4A 4ODGA 1UNSA 3GV6A 1ZYRD 2FJ2A 4IUPA 2L55A 2N55A 4EQOA 3A8IE 3J80L 3A7AB 1GHKA 1HPCA 3VA7A 1EIGA 1RCVD 3C1FA 1FNUA 1SEBD 3QG1A 4QUCA 3SR1A 2L12A 2KA7A 3X3MA 1SNCA 1EEFD 2XWJB 1VDZA 2DNEA 3D6WA 3N6RA 3FEWX 1SMYD 1EYDA 1G291 5J1ZA 4BA1I 3OOCA 3SK4A 2LMCB 3KLSX 3AB9A 3BVGA 3HKZB 5IODA 3V2TA 3HOXB 1PMRA 4PQXA 4X3TA 2K5QA 2PYKA 5I9PA 3NTIA 1PFMA 1IKLA 2BA1A 3LWUA 1EWCA 1BOSA 4DK1A 4RGTA 4P2CB 1MSGA 2B39A 4K14A 4IFDG 4E6IA 4KHZA 4ME5A 5C4ZA 1JQYD 5HURA 3U9OA 2I46A 4OL7A 2FMMA 3V96A 1Q1BA 2EYJA 2J4XA 3EFXD 2RSOA 5EJWA 3C3LA 4N9TA 2JA8B 3HG9A 5JPMC 5IGBA 2HCCA 2KEEA 2NYZD 3VR6A 3HZXA 3SXHA 4K2KA 3G7LA 1HUMA 2JSOA 2ZXOA 2F1MA 1SNOA 3AMUA 1FGBD 4IFDJ 4WJWA 1STYA 4ZLTF 1KDBA 3A7LA 2OT2A 1SYBA 2F3WA 3HS0C 5KNCA 4NP5A 4A3MB 3G6JB 4A3JB 2LS01 2R61A 2TMPA 3A55A 5J39A 1LTBD 3NWSA 3M7GA 4PV1C 3I4MB 5J22A 3EA6A 2NN6H 4Q0FA 2PW7A 1S4ZA 5TSSA 2AWNA 3GTGB 2M9VA 3J81E 1LACA 1DOMA 3ITPA 1A15A 4FNFA 5I2YA 4IFDI 4BY1B 2NZ1D 1LTRD 1JOKA 4V0BA 4RH6A 2M2LA 5A35A 1RKNA 3KLSA 5T1GA 4JBWA 3H09A 5FO9B 4S3SA 4WORA 3EJIA 2C5CA 5EKKA 3OMGA 1SXTA 1K8OA 1S5CD 4C3HB 5ISRA 5C3EB 2K32A 1ET6A 1JOOA 1SDFA 4KKTA 1DYQA 1EY0A 3T53B 4N9PA 5CC4A 4HMIA 2YYZA 4CJ0B 3A8KE 4RGMA 3S1QB 3SK5A 3A8JE 1SNDA 5M5XB 1HHVA 1B9NA 1Y8NB 3IFDA 3GV3A 2B2YA 5EPKA 3C2PA 1PTOF 5D14A 1JWSD 3BVMA 4IUQA 1OXTA 2DNCA 3DWQA 1RDPD 2PZWA 4BA2I 1ZYRC 4B9WA 2IX0A 3I91A 5JEAG 1I3QB 5C6AA 1JICA 2EOTA 2QKIC 3CHBD 1ML0D 4RWSC 1TWAB 2KHSA 2ZXRA 5JOBA 5KGUA 1Y8PB 1QG7A 1C8CA 4XQQA 2PMZB 1CZWA 4LK1C 1D5ZC 4CGYB 2B8FA 3S2HB 5IT9L 3URYA 1HXYD 1LT6D 4K2LA 3GO5A 3T51B 3GD7A 5C3WA 5K5PA 1A3UA 4HR7B 3OHXC 2KCNA 3CU7A 4A3KB 1J9OA 3OSOA 4EQNA 2B2TC 2A5HA 2E74C 1H9SB 2F0KA 4PNYA 5HGTA 5C0XI 5C5MA 1U4RA 3FKIB 2QF7A 1X32A 4K5XA 3S1RB 4CJ2C 1QNKA 2IJ0A 4KY5A 1BCPC 4A3DB 1DONA 1DM0B 1MSHA 1Y69U 3NE5B 1AEXA 3CQZB 3OW7A 3ERQA 5FLXE 1PZJD 4YIJA 5CV8A 3PO2B 2RA4A 1SYFA 1EQTA 2D2CC 2F3VA 2B8GA 2EJFC 4FF1A 4BY7B 3P75A 2F0JA 3D4RA 4BWGB 2SNSA 4ZKBB 4FXGC 1I6HB 3MEHA 4KV6A 2VB3X 1I4GA 2B63B 1HFGA 4XYOA 5KNDA 1TY2A 1H9SA 3P7JA 2KUMA 1F2ZA 1B1ZA 1TT2A 3C46A 2EYMA 4DNTB 4A3FB 1JWUD 5DM73 1HUNA 3KBGA 5LL6S 1CQFA 5IIFA 5E1FA 5CYUA 1C48A 2F0UA 3NUCA 3VR4A 2A73B 1F2LA 2ZT9C 3T13A 4G7ZC 3NQIA 3MFYA 2LFNA 3D31A 4U68A 2NUCA 3R2IA 2OEOA 4CHTB 2F0MA 2F0TA 1SNQA 2A69C 1NAPA 4JK1C 1STEA 1CFMA 2VUMB 1EZ6A 4A3GB 3HOZB 2WIIB 3GTJB 3DMUA 1OXUA 1G2SA 1TS5A 4NKLA 3Q23A 1ZEQX 3GTPB 1HRJA 1LTGD 2KQ3A 4RA8A 5KYLA 3A56A 1EQVA 2R6GA 3I72A 2SNMA 1A2TA 4HAEA 3TP5A 2A74C 1U4LA 4ZYSA 3H91A 4OO1H 1AZQA 4J6HA 2K01A 4C3JB 2BOSA 4DA2A 1TQOA 3VA5A 1CI3M 4FP5D 3H6MA 4H13C 3PIP3 1CZGA 1Q3LA 1CHPD 3BDCA 1WD0A 3K58A 2NN6G 2NVTB 4KY6A 2J0TD 2PCFB 2R3ZA 3D8GA 1ESRA 2EJMA 1BNZA 3JAME 3NSWA 3AU7A 1S5BD 3FPUB 5EBDA 2RDGA 4CKBA 2K6AA 1X3PA 5LHY1 4OIKA 3HOVB 1CQVA 3N52A 1GUSA 3D3RA 5I6YA 1EFID 2F4IA 2A6ED 4KD4A 3A54A 1KABA 1YNJC 2RBMA 4KI0A 2PZUA 1EL0A 2E2JB 1ENCA 1Q8IA 2IX3A 1CT1D 1LLRD 4HN7A 1I50B 4QIWB 2LY7A 5K36H 1CTMA 5A2QL 1YNND 1SAPA 1U4PA 2B2VA 1LT5D 2EJGC 1RF2D 1PTOD 1SFOB 4KY7A 1A3TA 3I4NB 2Z1CA 3QOJA 3K5NA 4K5VA 2PQEA 5M3FB 3GTLB 4KHVA 1U9RA 1PDQA 3GQBA 1PTOB 2F0HA 5FKAC 1SE3A 2F0IA 2TSSA 2A68D 4CBVA 1H9MA 4PMBA 4K8IA 2I07B 4B9XA 3RMHA 1DXMA 3QB3A 4BBRB 1ESFA 1CK1A 3GTKB 2AQ3B 5IGDA 2HCIA 2IL8A 2RVLA 5EKLA 5DM63 3ND9A 4DAYA 1RD9D 2JE6I 1ENAA 1U4MA 1OO9B 1PRTF 5M5WB 2YU9B 1AW7A 3MVVA 3ND8A 2F0SA 3R93A 5EPLA 5M3MB 5FOBB 3Q22A 2L0CA 2K03A 1V1PB 3DHQA 1JOQA 1XX8A 4UDUC 5CV6A 2JA6B 5CGKA 1A6XA 4RCOA 1T5XD 1NCVA 5E4XA 2NVXB 2F0DA 2RQXA 3DM1A 1HA5A 1TVXA 4ULLA 2EDGA 3OPOA 1O78A 3KBXA 3ONAB 5JAVA 4RGNA 2IX1A 4ILWA 4MIUA 3QIAA 1AN8A 3SEBA 3GTQB 3SVMA 3E6ZX 1LT4D 4KTAA 5IGGA 1HFNA 2N88A 3SK8A 4KK7A 2EY5A 2RKSA 3BDLA 4ZQ3A 4X3SA 3MWYW 1NSNS 4RHSA 4A93B 1V1PA 5E4WC 2GA4B 1IW7D 4V190 1PZID 2F0OA 2ICIA 4A3EB 4KKUA 3J80E 3OWFA 1V43A 2L11A 2Q8IB 3LWEA 2HQEA 4R9WA 5D65A 2DY8A 3L9AX 5C4XB 4IQZA 1BBXC 2K7VA 1ONLA 1HTPA 2AUKA 3S1MB 3MXPA 3T16A 1QB5D 3NWTA 2JYOA 1JR0D 5LL6X 2XIWA 4IN3A 4HCSA 4KJOA 1BR9A 1A3VA 2A6HC 1DOLA 1XXGA 4XQJA 1BF4A 2QDBA 1KAAA 4EGVA 2BDOA 2RSNA 2CW0D 3TDQA 1M8AA 2PW5A 5KRUA 3F2UA 1HCZA 1O80A 3QWNA 3I8ZA 1STNA 3WDNA 1QJOA 2F0QA 4M8AA 2BA0A 2EYLA 2A6EC 2CHBD 2K05A 5ELBA 1D5XC 4TKOB 2JA5B 1LTTD 1ZKOA 2CVRA 4OO1G 1EY8A 5KNBA 3VYUA 5ELDA 1Y1WB 2IT1A 2AWOA 1L0YB 1R4QB 1TY0A 3J7AV 2X6GA 1BDOA 2F0LA 3TP6A 4U673 2FFKB 1K83B 1S5ED 5C5LA 4C1NI 2XWBB 2EXZA 2M00A 2VXWA 1SYDA 1F9PA 3T4AC 3PUYA 1WTQA 4G7OC 4B08A 2F03A 1IYVA 1GJXA 3K5MA 4BBSB 4K5WA 1E2ZA 3BZDB 4OGQC 1I4QA 4J1MA 1JB3A 2Q8TA 4IURA 4C3IG 3ZYYX 3PV0A 4CJ1B 4RCNA 4Z9CB 5ELCA 3GP7A 5K36G 2L9HA 2F0NA 1SMYC 3OIQA 2PNRC 2B2UA 1KNAA 1SE2A 2JP1A 1PLFA 1Z7TA 1TWGB 2WP8J 4PMWA 3D4WA 4RFBA 1ET9A 2Q8RE 3U9SA 1PXUA 4NDXA 2BDNA 1QE6A 1UEAB 4BS9A 1Q1EA 4PMCA 2KJXA 3TP7A 1WTOA 4DN4M 1PRTD 1NUCA 4M1UB 1SBBB 1EEID 2K5DA 1GXDC 4RHRA 1EY7A 4H0LC 2SOBA 5D3IB 1O7ZA 2JA7B 1EYAA 1HA6A 3TZDA 2WACA 4A3IB 5CV4A 1EY6A 2H1EA 4RGOS 4L6TB 3FVQA 5CBAE 3KF8A 2B2WA 1PRTB 1Z47A 1BCPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVV A;  4EVO A;  2EYM A;  2F0S A;  5DAU A;  4ZUI A;  4F8M A;  1JOK A;  3S9W A;  1SNM A;  1SYC A;  4K14 A;  5I6W A;  5IIF A;  4KJN A;  3RUZ A;  1STA A;  1KDA A;  2EYF A;  4K5W A;  5E1F A;  1SYG A;  3OMC A;  2OXP A;  2EY6 A;  3DHQ A;  3MXP A;  3T16 A;  2F0U A;  3NUC A;  4K2L A;  4E6I A;  1JOQ A;  4RKL A;  3MHB A;  4ME5 A;  5CV6 A;  4R8N A;  5I6Y A;  1RKN A;  4J1M A;  3T13 A;  5CGK A;  3HEJ A;  3NXW A;  5C3W A;  5C4Z A;  2EY2 A;  5IGE A;  5DEH A;  5HUR A;  5KEE A;  4S3S A;  4KD4 A;  1EY9 A;  4LAA A;  1F2Y A;  4KJO A;  1A3U A;  1KAB A;  4IZ8 A;  4OL7 A;  4WOR A;  3TME A;  3U9O A;  2RBM A;  4F7X A;  2EYJ A;  2PZU A;  1A2U A;  2F0D A;  3EJI A;  5M9O A;  2NUC A;  1A3V A;  3OSO A;  4EQN A;  1ENC A;  4EQP A;  3R3O A;  2PZT A;  5EKK A;  5IGC A;  4N9T A;  3OMG A;  5CV9 A;  5CR3 A;  2OEO A;  4IUN A;  2F0K A;  4PNY A;  2F0M A;  2F0T A;  2QDB A;  2F0N A;  3SHL A;  5HGT A;  1KAA A;  3NP8 A;  1SNQ A;  2EYO A;  3E5S A;  5IGB A;  5C5M A;  4HTH A;  4ODG A;  4K6D A;  4QB4 A;  4K5X A;  1EZ8 A;  1EY4 A;  1F2M A;  1EZ6 A;  5ISR A;  3HZX A;  3MZ5 A;  5F2D A;  5KIX A;  5KYI A;  3DMU A;  4KY5 A;  2ENB A;  3SXH A;  5JAV A;  4K2K A;  5IGF A;  5C3X A;  2LKV A;  3QOL A;  2EY1 A;  1JOO A;  3D4W A;  4EQO A;  1EY0 A;  4KY7 A;  1A3T A;  1TR5 A;  4MIU A;  4N9P A;  2PW5 A;  4NKL A;  5CC4 A;  4HMJ A;  4HMI A;  2F0V A;  3SK6 A;  5KRU A;  4IAL A;  3QOJ A;  1SNO A;  3NQT A;  4K5V A;  2PQE A;  3NHH A;  1EY5 A;  1STN A;  3C1F A;  4TRD A;  3SK5 A;  2F0Q A;  1SND A;  2F0P A;  2KQ3 A;  5KYL A;  1STY A;  1SYE A;  3SR1 A;  4NDX A;  4DGZ A;  1EQV A;  4KHV A;  4NMZ A;  1KDB A;  1SNC A;  2O4X A;  2EYL A;  3C1E A;  2SNM A;  1A2T A;  1U9R A;  4KD3 A;  1SYB A;  3D4D A;  4KTA A;  2F3W A;  1AEX A;  3TP5 A;  5IGG A;  3ERQ A;  1STG A;  1STH A;  2F0H A;  3P1H A;  4PMC A;  4ZUJ A;  3TP7 A;  1STB A;  1EYD A;  2F0I A;  4G57 A;  4NP5 A;  4QMG A;  5CV8 A;  4YIJ A;  3SK8 A;  4PMB A;  2EY5 A;  2RKS A;  3BDL A;  1SYF A;  4ZQ3 A;  5I9O A;  4K8I A;  1EY8 A;  5J1Z A;  1NSN S;  4QF4 A;  3NK9 A;  3TP8 A;  2F3V A;  4B9X A;  5CV7 A;  4I65 A;  4J6H A;  4WRD A;  4DFA A;  3SK4 A;  5EGT A;  5J39 A;  3QB3 A;  1NUC A;  2RDF A;  1JOR A;  2F0F A;  3P75 A;  2F0J A;  2OF1 A;  4H7B A;  5C4H A;  1EY7 A;  5CV5 A;  2PZW A;  2SOB A;  2SNS A;  3V2T A;  5IOD A;  1TQO A;  5NUC A;  5IGD A;  3VA5 A;  4B9W A;  2PYK A;  1EYA A;  2F0O A;  3MEH A;  4ID6 A;  3H6M A;  1EYC A;  4KV6 A;  5IOC A;  5I9P A;  3BDC A;  1SNP A;  5C6A A;  2EYH A;  2WAC A;  5EKL A;  5K5P A;  5J22 A;  4DU9 A;  3OWF A;  5CV4 A;  4KY6 A;  3PMF A;  2F0E A;  2F0L A;  2PW7 A;  1EY6 A;  3TP6 A;  3D8G A;  4DF7 A;  2HQE A;  3LX0 A;  1II3 A;  5C5L A;  2KHS A;  2EYP A;  4K8J A;  2EXZ A;  5JOB A;  3D6C A;  5KGU A;  2M00 A;  1SYD A;  1ENA A;  1F2Z A;  1TT2 A;  1KDC A;  3ITP A;  4RKB A;  3EVQ A;  3ERO A;  5E3F A;  1IHZ A;  2F0G A;  2F0W A; 
#chains in the Genus database with same CATH topology
 1U0L A;  3TS2 A;  2Y0S B;  1E2W A;  1RJT A;  1VF5 C;  3S9W A;  3VYR A;  2NTT A;  4ZCK A;  1G2T A;  1I94 L;  4ALP A;  3CCL A;  3HRZ C;  1O7L A;  2OXP A;  3SE0 A;  1EUJ A;  3PQI A;  4ZAI A;  1AE3 A;  2G9D A;  1LTL A;  2PI2 E;  1PH8 A;  3O13 A;  2Z4I A;  3VR3 A;  1I4X A;  1F9Q A;  1YHB A;  2KOL A;  1EY9 A;  3TME A;  2PI2 A;  4F7X A;  1M1K C;  2L15 A;  1A2U A;  5M9O A;  1AZP A;  1HQR D;  1V1O A;  1KC8 C;  4I7Z C;  2NB0 A;  5JJK A;  1B44 D;  3NTH A;  4O42 A;  3QO2 A;  2EZV A;  1XMO L;  1NNX A;  3MZ5 A;  1GO3 E;  5LMN W;  4JBK A;  2L5T A;  2VUM H;  2ENB A;  2B2Y C;  3HOZ H;  3BS1 A;  3GTJ H;  2EE1 A;  2LKV A;  2EY1 A;  1ICW A;  2LXK A;  4JC0 A;  1AP0 A;  5EPJ A;  3PUX A;  2UXC Q;  5IT9 E;  1F77 A;  4NPS A;  2ID0 A;  1PH1 A;  4JI5 L;  2IHE A;  3FRP B;  4HED A;  4GOP B;  2F0P A;  2Z8L A;  4FF3 A;  3GTP H;  4JI2 Q;  4CDF C;  2O4X A;  4NB3 A;  2ES2 A;  1GUO A;  2SEB D;  3KK7 A;  1ROD A;  1IBM Q;  1FR3 A;  3PIO 3;  4A3M G;  4A3J G;  3NK9 A;  1PZK D;  5D3D A;  1T5E A;  2K28 A;  1BQQ T;  3NBI A;  3BU2 A;  4C2M H;  1R4P B;  1YJW A;  4C3J H;  1WTX A;  3MFG A;  3M7N A;  4NXN L;  1W6K A;  1JB7 A;  3UI2 A;  1K3B C;  3Q6S A;  5M5Y H;  3I4M G;  3K0Y A;  4AH6 A;  1JCK B;  3RZD B;  2E2H H;  5FLM H;  3LX0 A;  3S16 B;  3RLF A;  3BZC A;  3M85 A;  2XVS A;  4UHV A;  4C2M B;  1CM9 A;  5E3F A;  4EVO A;  3B6Y A;  4BY1 G;  3DWP A;  1WVL A;  2R7Z B;  4F88 A;  4IPH A;  4UPA A;  5FO7 B;  1N32 L;  5E7N A;  3CME A;  2QEX A;  2FHT A;  1PYW D;  4YCU A;  1XTD A;  3RUZ A;  2H4O A;  5M5Y B;  2WIN B;  1XPU A;  1M4V A;  3IAY A;  5COR A;  1IBM L;  1WTR A;  2E2H B;  1TS3 A;  1SJH D;  3MHB A;  1P8L A;  3K80 C;  1X9N A;  2K04 A;  3AQQ A;  2JK8 A;  1ENF A;  5DEH A;  1TWF H;  3IFT A;  1UUP A;  3BDO A;  5C0X H;  3DXJ C;  2BE5 D;  1VQA A;  3HOU B;  3MXG A;  2QW7 A;  5DNF A;  1D1I A;  3HGB A;  2K14 A;  1OXS C;  4EQP A;  1GHJ A;  2PZT A;  1Q12 A;  4GN5 A;  1LUZ A;  3PUZ A;  1E22 A;  3NP8 A;  1I50 H;  2I5M X;  1XTC D;  2DN8 A;  4A3C G;  4JI7 Q;  1D6E C;  1JE4 A;  1UE6 A;  1DOK A;  4C3H G;  1F9S A;  3FPP A;  5GAH C;  4Q5V A;  3S15 H;  1TWF B;  1L0X B;  2WV6 D;  5C3E G;  3TRZ A;  2KCM A;  1GUW A;  1J6Q A;  4J8Q A;  3DLL A;  2WAQ B;  3QOL A;  4IUU A;  1TR5 A;  3J80 i;  4ZRZ A;  4JI1 L;  2X6L A;  1SFO H;  4NW2 A;  3I4N H;  3NQT A;  1UWV A;  3DWA A;  1EY5 A;  4KKS A;  4DAY B;  3RZO H;  4FYD A;  1U5K A;  1MJC A;  3K8A A;  1SYE A;  5M3F H;  4JI4 Q;  3F8T A;  3GTL H;  4I7A A;  4QGU A;  4B3S Q;  3S15 B;  3DEP A;  1TS2 A;  3E3X A;  2JEA I;  1JT8 A;  1PTO H;  1VQM A;  4DR7 Q;  1PFB A;  2J7Z A;  1UE5 A;  5LMU Q;  1EU3 A;  3MA2 B;  1X65 A;  1N8R C;  1BO0 A;  5GAE C;  3RZO B;  1X3E A;  5CV5 A;  1AFP A;  2BH2 A;  2O5J C;  1B3A A;  1S5F D;  2O5I C;  3GTK H;  5IOC A;  2HDM A;  1XNR Q;  3J81 i;  2R93 B;  4KN7 C;  3S2D H;  3JC6 6;  5IYD H;  2NZO A;  5JVH 3;  5HY6 A;  1EQQ A;  1XJV A;  2XRQ D;  1BUV T;  2O2L D;  1LTA D;  1O7I A;  3SGI A;  1Z6H A;  3ERO A;  1PYB A;  1KLG D;  2NN6 I;  5M5W H;  3VYT A;  5FO8 B;  2YU9 H;  4YCW A;  5DAU A;  4ZUI A;  2K1B A;  1KLU D;  4L63 B;  2JN4 A;  4X3K A;  5I4D A;  4LF8 Q;  2MGS A;  2AKW B;  5M3M H;  2EVB A;  1LO5 D;  3S2D B;  1PA6 A;  2EY6 A;  2UXB Q;  3K5L A;  4O1N A;  4P75 A;  4RKL A;  4DR7 L;  3CPF A;  1PRT C;  3FP9 A;  1J8I A;  1WD1 A;  1P16 A;  1V8Q A;  3I3C A;  1GD7 A;  4LMQ D;  2JA6 H;  1Q90 A;  5HGQ A;  4LAA A;  3E0J A;  3FDT A;  1QOH A;  4H44 C;  1QIL A;  4DNR B;  3TN2 A;  3CCU A;  3CPW A;  2EPB A;  4A3B B;  3T1H Q;  4JOI A;  2NVX H;  3E9H A;  2D5D A;  4A3K G;  4OWW B;  4XIG S;  4GZY C;  4MN3 A;  5CV9 A;  5CR3 A;  1LTS D;  4R4O A;  4IJH A;  1HZB A;  4UAI A;  4C1N K;  4DV4 L;  2MUY A;  3W1G A;  4TQU S;  2VS1 A;  4LF6 L;  4K6D A;  1PV4 A;  4FDB A;  5EQ0 A;  2XTI A;  3W1B A;  4GKK Q;  4XYQ A;  1XWE A;  2E75 C;  5IGF A;  1YI2 A;  1L1O B;  4N8X 1;  4NXM Q;  3VR2 A;  2IPK D;  4HJ9 A;  4HMJ A;  2DUD A;  3DEO A;  2MFI A;  4LF8 L;  2AQ1 B;  1PH6 A;  3I56 A;  4A3D G;  1KQS A;  3J81 L;  1HNZ L;  3AFP A;  3X3N A;  1ILQ A;  1H9R A;  4KD3 A;  4BXX H;  1K73 C;  2AMC B;  5ELF A;  3P1H A;  4FVM A;  4GKJ Q;  5G3L F;  2XRS D;  1F9R A;  4JI6 Q;  1FNW A;  1IKM A;  4FXK C;  3OTO L;  2EQS A;  1D2B A;  3PO2 G;  4ZKC B;  4GOP C;  4WRD A;  4DFA A;  4OIJ A;  4YWL A;  4CKE A;  5A2Q E;  2VQF L;  2E76 C;  1EFW A;  1BCP D;  3STB C;  3CD6 A;  4MHE A;  1RHP A;  2Q2H A;  2Y0S G;  4BY7 G;  4Y7N B;  1MKH A;  4XXE A;  3H0G B;  2EYH A;  3F2D A;  2HHH Q;  4QL5 A;  4A3E H;  4GKK L;  2B63 G;  3PMF A;  1EYG A;  2F0E A;  1E1T A;  2ICE C;  1VQ6 A;  1E7Z A;  1B53 A;  3HOY B;  4K8J A;  2NVQ B;  4G4K A;  1NMF A;  1GUT A;  3W5O A;  2UUC Q;  1VQ7 A;  1Z9F A;  1LT3 D;  1BCP B;  1TWH H;  1R9T B;  4R8I A;  5C4X H;  2FIN B;  1RL2 A;  2HT1 A;  4HIK A;  3HKZ E;  1NMG A;  3BVZ A;  4A3F G;  1VQN A;  3J7Y W;  3W2D A;  1BVS A;  2MJ8 A;  1KDA A;  1XMQ Q;  4KHP Q;  4HSP A;  4GKJ L;  3TQY A;  3CRK C;  1H9J A;  5FLX c;  4JCV E;  5IGE A;  4F87 A;  2WKC A;  2B2V C;  4AYB B;  2MP1 A;  4IZ8 A;  2JEB I;  4QQB X;  1TWH B;  3CRL C;  1IBK Q;  5CMD A;  3M4Y A;  4LFB Q;  5JVG 3;  1FJG Q;  1MBY A;  5FJ8 H;  3H15 A;  3Q24 A;  1Q86 C;  1V9P A;  2HHH L;  1B4O A;  2OTJ A;  1TS4 A;  1GOZ A;  4DR4 Q;  3OIP A;  5KYI A;  4TSS A;  2VUM G;  2NWG A;  3IRB A;  1C9O A;  3HOZ G;  3S17 H;  3H94 A;  1I4P A;  3ZJY C;  3KUP A;  2E5L Q;  2YTV A;  2B2T A;  4DK0 A;  5C3X A;  1GUN A;  2PNH A;  3SK6 A;  2R92 B;  4X66 Q;  1E0B A;  1WCM B;  5IE8 A;  2KED A;  1YVC A;  1HTL D;  2UUB L;  2E8G A;  2RCF A;  4LF5 Q;  5FK9 C;  1VQJ A;  3C1E A;  1QVG A;  2I5H A;  1EIF A;  3ERS X;  2BE5 C;  3D4D A;  2IW3 A;  3TBI B;  1VF7 A;  4AQY Q;  3S17 B;  2A69 D;  3A5U A;  2JA5 H;  4QF4 A;  3NPP A;  4QCL A;  5CV7 A;  4I65 A;  3VDY A;  1SJE D;  5EGT A;  2R7F A;  4AYB E;  4LJZ C;  1KHI A;  4H7B A;  1G91 A;  4ZK9 B;  1DZ1 A;  4C3J G;  2VQE Q;  5C44 H;  1Y1V H;  2MPM A;  1EYC A;  3UDI A;  2UXD L;  4XT1 B;  4DKA C;  4DXG A;  4HJA A;  3UDF A;  2WFW A;  4DF7 A;  1PH7 A;  4JI3 Q;  1E2V A;  4JI0 Q;  3S1N B;  2QCP X;  2XSC A;  2ZXP A;  5CBE E;  1K83 H;  1KDC A;  2E2I H;  4A76 A;  2LXJ A;  1EWH A;  1I4H A;  2JA9 A;  3T56 B;  5C44 B;  1YNN C;  1Y1V B;  1EOT A;  1EQR A;  1CKN B;  1X3G A;  3HKS A;  3CF5 A;  2UUA L;  2ZTE A;  4DV1 Q;  3TZU A;  1SNM A;  2MQH A;  4WFN 3;  1PH5 A;  1IYJ B;  2Z4H A;  3KLW A;  3PO3 B;  1PTO C;  1VQD A;  4KJN A;  3TSS A;  2CCZ A;  4AQY L;  4X64 L;  3HOV G;  3KDF B;  4LFA L;  1MHW C;  3K81 C;  1IXR A;  4UP7 A;  3I73 A;  1W6J A;  1NY4 A;  5T1I A;  1B7Y B;  2EY2 A;  2D0P A;  1EIH A;  5C0X G;  2D9U A;  2HUG A;  2E2I B;  5IP7 H;  1VMC A;  4LUO A;  1KTK A;  4ABN A;  3H3V H;  3UDX A;  5FLX L;  1DGS A;  5IGC A;  1MJE A;  2K52 A;  4GNX B;  4L5R C;  3BYT B;  3SHL A;  2MNA A;  2WB1 B;  3E5S A;  2A68 C;  3F1Z A;  2E2D C;  2KCT A;  1I6V C;  1EZ8 A;  1FYC A;  2IWH A;  1MI2 A;  5F2D A;  2HD3 A;  4HSV A;  4DR6 L;  3K59 A;  5ELO A;  3JAM c;  2NBF A;  2ZM6 Q;  5JJZ A;  3BYY B;  1SSO A;  1TWG H;  4DNI A;  3I4N G;  4A4I A;  4DV1 L;  4TRD A;  2A8V A;  2G9H D;  5GRO A;  3PUW A;  1YNJ D;  5M3F G;  4DK3 C;  4AIM A;  1WTP A;  4IPD A;  4DGZ A;  1CA6 A;  3KF8 B;  3MC0 B;  1DJR D;  2IHF A;  2PQA B;  1JWM D;  3P20 A;  5C0X J;  1YZ6 A;  1L1O C;  1STG A;  1STH A;  1IYU A;  1STB A;  2P5Z X;  4G57 A;  4QMG A;  3M3Y H;  2K33 A;  3TP8 A;  3WOE A;  2KEC A;  2VB2 X;  5BR8 L;  3VR5 A;  1KNE A;  3IKJ A;  1NJI C;  2OF1 A;  2KCC A;  4DAV A;  4BBR G;  5NUC A;  3UE1 A;  1D5M C;  1SNP A;  4OO1 I;  3F2B A;  2JA7 H;  3ULL A;  5IYD G;  1X3Q A;  2KVM A;  4OEL B;  3M3Y B;  1M90 C;  1I94 Q;  2VW9 A;  1II3 A;  2ZM6 L;  4A3I H;  4DV5 Q;  4YHH L;  1BBW A;  2EYP A;  2PO4 A;  1TU2 B;  3PUV A;  4R1J A;  5JJI A;  3M4O B;  2F0W A;  1SE4 A;  5JEA J;  1JJG A;  1TII D;  4DUZ Q;  4IUV A;  1VQ4 A;  4OWT B;  5I6W A;  5M3M G;  3NTK A;  1SYG A;  3I70 A;  1E3P A;  2I0Q A;  4IFD H;  4L8J A;  3I55 A;  4DAP A;  1DD2 A;  4OHJ A;  1G8Z D;  2JA6 G;  5KEE A;  3TRE A;  3LNN A;  3J7A 5;  1YJN A;  4C56 C;  2PQA A;  2CQA A;  3R3O A;  1ZXT A;  1LTI D;  3HP3 A;  2HDL A;  1VQF A;  5JPN C;  1JC7 A;  3U50 C;  4IO9 A;  4JI5 Q;  2EYO A;  1FNV A;  3V05 A;  1L0W A;  1GUG A;  4UP8 A;  4DV5 L;  4G7H C;  1EY4 A;  1F2M A;  5KIX A;  3J81 j;  1UE1 A;  3R8B A;  4CKC A;  5G3L D;  1WTW A;  1IW7 C;  4DR1 L;  4DUZ L;  1RTO A;  4IAL A;  3NHH A;  3JAM L;  1Y8O B;  2NTS A;  1B9M A;  4P72 A;  3DUZ A;  4J15 A;  3VYS A;  1CHQ D;  1Y14 B;  1Q46 A;  2V4D A;  4DV0 L;  4NXN Q;  3BG3 A;  3MXU A;  1D7Q A;  4IUT A;  1FD7 D;  4KMU C;  5I9O A;  2MHV A;  4IOA A;  4R4T A;  1DCZ A;  2K5N A;  4A93 G;  1K0R A;  2IY5 B;  1CA5 A;  1BXT A;  4RMF A;  5J3B A;  2K5W A;  1ILP A;  1C4Q A;  3CKI B;  2QIL A;  4DXF A;  1MD2 D;  4A3E G;  1N32 Q;  1HR0 L;  1KXL A;  4XT3 B;  1JJ2 A;  3NBH A;  4FF4 A;  3L7Z C;  3RZD H;  3S16 H;  3EQL C;  3AEV A;  1WTV A;  4RKB A;  3EVQ A;  4WJ4 A;  3Q0A A;  5C4X G;  1TWC B;  1NR4 A;  4HJ5 A;  4RAU C;  1SYC A;  2R7Z H;  1S5D D;  2C9O A;  1NR2 A;  2CW0 C;  2EYF A;  3OWE B;  1VQI A;  1SLJ A;  1O7Y A;  4XTC S;  4FF2 A;  1H9K A;  3MXN A;  5I2X A;  5BN5 A;  2B2U C;  4FXD A;  1B50 A;  4QUF A;  1QWY A;  5FJ8 G;  3ULJ A;  3HOU H;  1B2T A;  2BCO A;  1D1K A;  4JI1 Q;  2AQ2 B;  4UP9 A;  5EBC A;  1UAP A;  3FMC A;  4HTH A;  3J80 c;  5AFW A;  4QB4 A;  4A3L H;  2RDH A;  2Q2T A;  1OXX K;  4POG A;  4ME3 A;  5EAY A;  3IL8 A;  3K5O A;  1LAB A;  1HZ9 A;  1I4R A;  2L4N A;  4GNX C;  3HOW H;  1X54 A;  4FO2 A;  1Q82 C;  2F0V A;  2DY7 A;  3RD4 A;  2N8N A;  4KN4 C;  1VMP A;  3KJP A;  4HJ8 A;  5DLQ E;  3MAQ A;  1YJ9 A;  1TKW B;  3SDZ A;  4NMZ A;  3GTO B;  2L1B A;  2A6H D;  4XQN A;  4XDX A;  3GTM B;  5ELE A;  1OXV A;  2SDF A;  1HQM C;  2XN9 C;  3W3A A;  5C4J B;  4ZUJ A;  3I90 A;  3H3V C;  1LV9 A;  2G5D A;  2X69 A;  2JA5 G;  3HOW B;  2DJG C;  1KIX A;  2NVY H;  3K6O A;  1QCB D;  1PFN A;  4JI8 Q;  3J81 c;  3L3O C;  1IL8 A;  2RDF A;  1JOR A;  2F0F A;  3A74 A;  1Y1W G;  5C4H A;  2Z6K C;  2B2W C;  1G6Z A;  4MTK A;  4ID6 A;  3WOF A;  1Q7Y C;  1QNU A;  5EKI A;  1XYI A;  5JEA H;  4DU9 A;  3S14 B;  2R93 H;  2D62 A;  3K57 A;  1ASZ A;  4JBM A;  2KBN A;  3D6C A;  3KF6 A;  2NVY B;  4K6L A;  3QJY A;  2JXM B;  2WKD A;  3J7A F;  2XNA C;  3L2P A;  4X3U A;  2QEJ C;  1IHZ A;  2F0G A;  3KLR A;  3K7A B;  4F8M A;  3UDG A;  4GN3 B;  4HCE A;  3R2T A;  3CMA A;  2PPB C;  1LM0 A;  1STA A;  2JQO A;  3OMC A;  5BN4 A;  4BBS G;  1N36 L;  3MTS A;  1N34 Q;  4DV4 Q;  2ZJP A;  4R8N A;  2VNU D;  3HEJ A;  4C3I B;  4LF6 Q;  3NXW A;  5BN3 A;  1VCI A;  4LF4 Q;  1K8M A;  5IP7 G;  4JI8 L;  1F2Y A;  2FMC A;  5COY A;  2F4V L;  2D0O A;  4QJF A;  4EX5 A;  1RTN A;  2EXD A;  4OX9 Q;  1MGS A;  1HH2 P;  4A3B H;  4RG1 A;  3I4L A;  4IUN A;  2GVB A;  2AUJ D;  1EU4 A;  4JW0 A;  1CSQ A;  4ODG A;  1UNS A;  3GV6 A;  4R4C A;  1ZYR D;  1HNZ Q;  1IZ6 A;  2FJ2 A;  1K9M C;  4IUP A;  2L55 A;  2N55 A;  2A1A A;  3A8I E;  4EQO A;  3J80 L;  3A7A B;  2KEN A;  1GHK A;  1ASY A;  1HPC A;  1K3R A;  3VA7 A;  3OTO Q;  1EIG A;  4L5S A;  1RCV D;  3C1F A;  1FNU A;  1SEB D;  2VQF Q;  1QUQ A;  3QG1 A;  4QUC A;  3SR1 A;  2L12 A;  1QZG A;  2KA7 A;  3X3M A;  1SNC A;  1N34 L;  4B3R Q;  1EEF D;  2XWJ B;  1VDZ A;  2DNE A;  3D6W A;  4LF4 L;  3EN2 A;  3N6R A;  3FEW X;  1SMY D;  1EYD A;  1G29 1;  4N8F A;  5J1Z A;  4OX9 L;  4BA1 I;  1Q8K A;  3OOC A;  3SK4 A;  2LMC B;  1N33 Q;  2ZTC A;  3KLS X;  3AB9 A;  3BVG A;  1G6P A;  3HKZ B;  5IOD A;  3V2T A;  3HOX B;  1PMR A;  3A5Z B;  4PQX A;  4X3T A;  2K5Q A;  2PYK A;  4Y7N H;  2JA7 G;  5I9P A;  3H0G H;  2DGY A;  3NTI A;  1PFM A;  1IKL A;  4DUY L;  2BA1 A;  4A3I G;  1CKO A;  1VQ9 A;  3HFZ B;  3LWU A;  1EWC A;  3HOY H;  1BOS A;  3M9B A;  4DK1 A;  2CWP A;  1VQG A;  2NVQ H;  1C7Y A;  3A0J A;  4RGT A;  4P2C B;  1HJP A;  3NEN A;  4LF7 L;  1R9T H;  1MSG A;  4B3R L;  3PCO B;  2JA8 H;  2B39 A;  4POF A;  2VL6 A;  4K14 A;  3S24 A;  4IFD G;  4E6I A;  4KHZ A;  4ME5 A;  1PH3 A;  5GAG C;  5C4Z A;  1JQY D;  5HUR A;  1N33 L;  2ASB A;  3U9O A;  2I46 A;  4OL7 A;  2FMM A;  3V96 A;  1Q1B A;  2EYJ A;  2J4X A;  3EFX D;  2RSO A;  3M4P A;  5EJW A;  2B3G A;  3C3L A;  4N9T A;  2JA8 B;  3HG9 A;  5IWA L;  5JPM C;  3RN5 A;  1X55 A;  5IGB A;  3KYH C;  3RLN A;  2UUB Q;  2HCC A;  1Q81 C;  2KEE A;  2NYZ D;  3VR6 A;  3AYH B;  3HZX A;  1N9W A;  3SXH A;  4K2K A;  3U4Z A;  3G7L A;  1HUM A;  2JSO A;  2ZXO A;  4A75 A;  4O0A A;  1UEB A;  4DAM A;  1OTC A;  2YV5 A;  2F1M A;  2VZA A;  1SNO A;  3WWV A;  2R92 H;  5IYC H;  1WCM H;  2Z9H A;  1FGB D;  2C35 B;  3AMU A;  3CCS A;  4IFD J;  1SRO A;  4WJW A;  1STY A;  4ZLT F;  1KDB A;  4MZ9 A;  3PF4 A;  1A62 A;  2OTL A;  3A7L A;  2OT2 A;  4JBJ A;  1SYB A;  2F3W A;  3CC4 A;  3HS0 C;  2UXD Q;  1VQL A;  5KNC A;  4NP5 A;  5LMN L;  4A3M B;  3G6J B;  4A3J B;  1C0A A;  2LS0 1;  2QA4 A;  2R61 A;  2TMP A;  3A55 A;  5J39 A;  1LTB D;  3BZK A;  4BY1 H;  4EQ5 A;  1T9H A;  3NWS A;  1PHJ A;  3M7G A;  4PV1 C;  1S40 A;  3I4M B;  2UUA Q;  5J22 A;  3EA6 A;  2NN6 H;  4Q0F A;  2PW7 A;  1S4Z A;  5TSS A;  2AWN A;  4X64 Q;  1HZC A;  4LFA Q;  1SN8 A;  3GTG B;  3KJO A;  3S1N H;  2M9V A;  3J81 E;  1LAC A;  1DOM A;  3ITP A;  5IT9 c;  1A15 A;  4FNF A;  5I2Y A;  3RNU A;  4IFD I;  4BY1 B;  2NZ1 D;  4GS3 A;  1LTR D;  1JOK A;  2R7Z G;  4V0B A;  3D0F A;  4RH6 A;  4JOI C;  2AHO B;  3Q8D A;  2M2L A;  3PIP A;  3PO3 H;  5A35 A;  1VQH A;  2CFM A;  5FLM G;  2K75 A;  1RKN A;  3KLS A;  1B70 B;  5T1G A;  4JBW A;  3H09 A;  2CH4 A;  5FO9 B;  1YHA A;  4S3S A;  4WOR A;  4DR6 Q;  1JE5 A;  3HOU G;  3EJI A;  2C5C A;  5EKK A;  4DK6 C;  3OMG A;  3S1Q H;  1B8A A;  1SXT A;  1IL2 A;  1K8O A;  1S5C D;  4A3L G;  4C3H B;  4JYA L;  5ISR A;  5C3E B;  2K32 A;  1ET6 A;  1YEZ A;  2MO1 A;  4PG3 A;  3HOW G;  1JOO A;  1SDF A;  4KKT A;  1DYQ A;  1EY0 A;  3T53 B;  2WAQ G;  4N9P A;  5CC4 A;  4HMI A;  2YYZ A;  4GLV B;  4CJ0 B;  2B29 A;  3A8K E;  4RGM A;  3S1Q B;  3SK5 A;  3A8J E;  1SND A;  5BR8 Q;  5M5X B;  1HHV A;  1B9N A;  1Y8N B;  3L0O A;  3IFD A;  3GV3 A;  2B2Y A;  5EPK A;  3C2P A;  1PTO F;  5D14 A;  3RR5 A;  4R4Q A;  1XNQ Q;  1JWS D;  4YHH Q;  3BVM A;  4IUQ A;  1OXT A;  2DNC A;  4LUV A;  3DWQ A;  1RDP D;  1K28 A;  3CCQ A;  2PZW A;  4BA2 I;  1ZYR C;  4DPG A;  4B9W A;  1MIU A;  2IX0 A;  4YY3 L;  1JJC B;  3I91 A;  5JEA G;  1I3Q B;  5C6A A;  1JIC A;  1PH9 A;  2EOT A;  2QKI C;  4JG2 A;  1FVI A;  2UU9 L;  2R93 G;  3CHB D;  1ML0 D;  4RWS C;  1TWA B;  2KHS A;  3T1Y L;  2ZXR A;  5JOB A;  5KGU A;  1Y8P B;  1QG7 A;  1C8C A;  4XQQ A;  2PMZ B;  1CZW A;  4LK1 C;  1CSP A;  2Q2I A;  1D5Z C;  4LUZ A;  3M4O H;  3U58 A;  4CGY B;  4PZ6 A;  3CCJ A;  2B8F A;  1PH4 A;  3S2H B;  5IT9 L;  2YTY A;  3URY A;  1HXY D;  1LT6 D;  3FKI H;  4K2L A;  2N3S A;  3GO5 A;  3T51 B;  1XNQ L;  3GD7 A;  5C3W A;  4CDE C;  1A8V A;  5K5P A;  1A3U A;  4HR7 B;  3OHX C;  2KCN A;  3CU7 A;  4A3K B;  1J9O A;  3OSO A;  1GM5 A;  4EQN A;  2B2T C;  2A5H A;  4A3B G;  3FHW A;  4L5T A;  4DR1 Q;  2E74 C;  1H9S B;  2F0K A;  4PNY A;  5HGT A;  4A3D H;  4LW1 A;  3PSI A;  5C0X I;  5C5M A;  1U4R A;  3FKI B;  4X62 Q;  2QF7 A;  1WOC A;  1X32 A;  4K5X A;  3S1R B;  4CJ2 C;  4X65 Q;  1QNK A;  2IJ0 A;  4KY5 A;  2CH4 W;  4DV0 Q;  1BCP C;  4K0K Q;  1W3S A;  4X6A H;  3NBH B;  3UE0 A;  1E24 A;  3HKZ G;  4BY7 H;  2PMZ E;  4OWX B;  4A3D B;  4DR3 L;  2Z0S A;  1I6H H;  4APV A;  1DON A;  1DM0 B;  1MSH A;  1Y69 U;  3NE5 B;  1AEX A;  3CQZ B;  3OW7 A;  3ERQ A;  5FLX E;  4H02 A;  1PZJ D;  4YIJ A;  5CV8 A;  1HR0 Q;  2QGQ A;  3PO2 B;  3G48 A;  2RA4 A;  1SYF A;  1EQT A;  3I7F A;  2D2C C;  1LYL A;  3G6E A;  2F3V A;  2B8G A;  2EJF C;  2KHI A;  4FF1 A;  4BY7 B;  3K0X A;  2F0J A;  3D4R A;  3P75 A;  4LF9 L;  4BWG B;  2SNS A;  2HQL A;  4ZKB B;  4FXG C;  4A3F H;  4X62 L;  1I6H B;  3MEH A;  1HZA A;  4KV6 A;  1VQB A;  3H0G G;  3MXN B;  2ALY B;  1I4G A;  2VB3 X;  4LWC A;  4X65 L;  2B63 B;  3QR8 A;  1HFG A;  4BXX G;  4XYO A;  1EOV A;  5KND A;  4QY7 A;  1TY2 A;  4K0K L;  3RLO A;  1H9S A;  3HOY G;  3P7J A;  4JPB W;  3EBE A;  2KUM A;  1F2Z A;  1B1Z A;  1TT2 A;  1WTH A;  3C46 A;  2N49 A;  2EYM A;  4DNT B;  4A3F B;  1JWU D;  2RHS B;  5DM7 3;  1HUN A;  3KBG A;  5LL6 S;  2JA8 G;  5AJ3 L;  1K8G A;  1TWC H;  4CDD C;  1CQF A;  5IIF A;  1NBW A;  1XPR A;  5E1F A;  3STB D;  5CYU A;  1C48 A;  2F0U A;  3NUC A;  3CP0 A;  2A73 B;  3VR4 A;  2OQK A;  1F2L A;  2ZT9 C;  3T13 A;  4A3G H;  1E1O A;  3EIV A;  3U4V A;  4HID A;  3I4O A;  4G7Z C;  3NQI A;  1EIY B;  3MFY A;  2LFN A;  3D31 A;  4U68 A;  4AYB G;  1CKM A;  2NUC A;  2RHQ B;  3R2I A;  2Y0S E;  2OEO A;  4CHT B;  2F0M A;  2F0T A;  4OEM B;  5L37 A;  1SNQ A;  2A69 C;  1NAP A;  3CAM A;  4JK1 C;  3OYY A;  1STE A;  1CFM A;  2VUM B;  1EZ6 A;  4A3G B;  3HOZ B;  2WII B;  3GTJ B;  1YNX A;  3DMU A;  1SRU A;  1VQP A;  1OXU A;  5ELN A;  1G2S A;  1TS5 A;  4B3M Q;  4NKL A;  5IY0 A;  3Q23 A;  2R92 G;  5IYC G;  1VQC A;  1WCM G;  1ZEQ X;  3GTP B;  1HRJ A;  1LTG D;  2KQ3 A;  4RA8 A;  5KYL A;  3A56 A;  1EQV A;  2R6G A;  3I72 A;  3KF6 B;  3AFQ A;  3NEM A;  2SNM A;  1A2T A;  3GTO H;  4HAE A;  3TP5 A;  2NVT H;  2A74 C;  3GTM H;  1U4L A;  3ICE A;  4ZYS A;  5C4J H;  2UXC L;  3H91 A;  4OO1 H;  1AZQ A;  1YHQ A;  5IYB H;  4J6H A;  4CDC C;  3CCR A;  1S3O A;  2K01 A;  2HIV A;  4C3J B;  2BOS A;  4DA2 A;  5IP9 H;  4JI2 L;  1NTG A;  1TQO A;  3VA5 A;  1CI3 M;  4FP5 D;  3H6M A;  1VQE A;  4H13 C;  1CZG A;  1Q3L A;  1CHP D;  1KRS A;  3BDC A;  3PIP 3;  1WD0 A;  3K58 A;  2NN6 G;  3HOV H;  2NVT B;  4KY6 A;  4YWM A;  2J0T D;  2PCF B;  2R3Z A;  3D8G A;  4P71 A;  4GOP A;  1ESR A;  2EJM A;  1IBL Q;  4B3M L;  1BNZ A;  3S14 H;  1N36 Q;  3JAM E;  3NSW A;  3AU7 A;  1S5B D;  1QVF A;  3FPU B;  1I5F A;  1PFS A;  5EBD A;  2RDG A;  2F4V Q;  4CKB A;  2E2J H;  2K6A A;  2NZH A;  5C44 G;  1Y1V G;  1X3P A;  3K7A H;  5LHY 1;  4OIK A;  3HOV B;  1CQV A;  3N52 A;  3PO3 G;  1GUS A;  2ZJR A;  3D3R A;  1L2F A;  1B3Q A;  5I6Y A;  2EIF A;  1EFI D;  2F4I A;  4DV6 Q;  2A6E D;  1GVP A;  1QUQ B;  3A54 A;  4KD4 A;  4C3I H;  1YIT A;  1KAB A;  1YNJ C;  2RBM A;  4KI0 A;  2PZU A;  1EL0 A;  2H5X A;  2E2J B;  1ENC A;  1Q8I A;  2IX3 A;  1CT1 D;  1UE7 A;  1LLR D;  4HN7 A;  2Q2U A;  1I50 B;  4QIW B;  2LY7 A;  5K36 H;  1CTM A;  5A2Q L;  1HNW Q;  1YNN D;  4LFC Q;  2WB1 G;  1SAP A;  1U4P A;  1IBL L;  2B2V A;  1BBU A;  1LT5 D;  2EJG C;  1RF2 D;  1PTO D;  5JJL A;  2VY3 A;  1SFO B;  4KY7 A;  1A3T A;  3I4N B;  2GVA A;  1X3F A;  2Z1C A;  3QOJ A;  3K5N A;  4K5V A;  2PQE A;  4BBR H;  5M3F B;  3GTL B;  4JI7 L;  2ATW A;  3CCV A;  4KHV A;  2FXQ A;  1VQO A;  1AH9 A;  1U9R A;  1W2B A;  1PDQ A;  3M4Q A;  3GQB A;  4DV6 L;  1PTO B;  1KRT A;  1VQ5 A;  2F0H A;  5FKA C;  1SE3 A;  2F0I A;  2TSS A;  4DUY Q;  2A68 D;  4CBV A;  1H9M A;  4PMB A;  2F3I A;  4K8I A;  5GAD C;  2I07 B;  4B9X A;  1SR3 A;  4OXP A;  3RMH A;  2WAQ E;  3G4S A;  1DXM A;  4IPC A;  4L5Q A;  3QB3 A;  2N78 A;  4BBR B;  4JI4 L;  1ESF A;  1CK1 A;  3GTK B;  2AQ3 B;  5IGD A;  1HNW L;  2HCI A;  4LFC L;  4B3S L;  3HOX H;  2RCN A;  2IL8 A;  1QZH A;  4LF7 Q;  4PZ8 A;  4QIW E;  2RVL A;  4JVZ A;  5EKL A;  4MNO A;  2Z6B A;  5DM6 3;  2YTX A;  3ND9 A;  4DAY A;  5LMU L;  1RD9 D;  2JE6 I;  1ENA A;  1U4M A;  1OO9 B;  1PRT F;  4O2D A;  5M5W B;  1JMC A;  2ZTD A;  2YU9 B;  1AW7 A;  3KFU A;  1VS0 A;  3MVV A;  3ND8 A;  2F0S A;  3R93 A;  1XNR L;  5EPL A;  5M3M B;  2F52 A;  5FOB B;  1SE8 A;  4B3T Q;  3Q22 A;  2L0C A;  1PVO A;  3NEL A;  2K03 A;  5IWA Q;  3FKI G;  1V1P B;  3DHQ A;  1JOQ A;  1XX8 A;  2CWA A;  4UDU C;  5CV6 A;  3E9I A;  2JA6 B;  5CGK A;  1A6X A;  4RCO A;  1T5X D;  1NCV A;  4MTN A;  5E4X A;  2NVX B;  4OON A;  2F0D A;  3ULP A;  2RQX A;  3DM1 A;  4DV2 Q;  3GTQ H;  1HA5 A;  3J7Z C;  2UXB L;  1TVX A;  4ULL A;  3CXC A;  4LNQ A;  2EDG A;  4WJ3 M;  1BKB A;  3OPO A;  3H3V I;  1O78 A;  3KBX A;  3ONA B;  5JAV A;  4RGN A;  3T1H L;  2IX1 A;  4ILW A;  4MIU A;  5LMN Q;  3QIA A;  3E0E A;  1PH2 A;  4A93 H;  4GLA C;  4B3T L;  3ER0 A;  1AN8 A;  3SEB A;  3GTQ B;  1KL9 A;  3SVM A;  4DR2 Q;  3E6Z X;  1LT4 D;  1HR0 W;  3K7U C;  4KTA A;  5IGG A;  1HFN A;  1D8L A;  4NXM L;  2N88 A;  3SK8 A;  4KK7 A;  2K5H A;  2EY5 A;  2RKS A;  1WYD A;  3BDL A;  4ZQ3 A;  4X3S A;  3MWY W;  4YCV A;  1NSN S;  4RHS A;  4A3M H;  3G71 A;  4A3J H;  4A93 B;  1WI5 A;  1V1P A;  5E4W C;  4DV2 L;  2CKZ B;  2GA4 B;  1IW7 D;  4V19 0;  1PZI D;  2F0O A;  1L1O A;  4GLX A;  2ICI A;  2XGT A;  4A3E B;  4KKU A;  4Y52 H;  3J80 E;  3OWF A;  4JI6 L;  3GDE A;  1V43 A;  3I4M H;  1QVC A;  3S1M H;  2L11 A;  2Q8I B;  3LWE A;  2HQE A;  1HNX Q;  4R9W A;  5D65 A;  3PIO A;  2DY8 A;  2K4K A;  1SMX A;  3L9A X;  3CCM A;  4IQZ A;  1BBX C;  2OQ0 A;  3GTG H;  5C4X B;  4DR2 L;  1G51 A;  2K7V A;  1X6O A;  1ONL A;  1HTP A;  1CUK A;  1A63 A;  1GKH A;  1FGU A;  4GN4 B;  2AUK A;  3S1M B;  3MXP A;  3BJU A;  1QB5 D;  3T16 A;  3NWT A;  2JYO A;  3CC7 A;  1JR0 D;  5LL6 X;  2R7D A;  4A3G G;  2XIW A;  2UUC L;  4JYA Q;  4IN3 A;  2A19 A;  4HCS A;  4KJO A;  2K50 A;  1BR9 A;  1YBY A;  1A3V A;  2BH8 A;  4IOC A;  1J5E Q;  2A6H C;  1DOL A;  1XXG A;  4XQJ A;  4HJ7 A;  1K0S A;  1XMQ L;  4KHP L;  1BF4 A;  2QDB A;  1KAA A;  4EGV A;  4KLK A;  1X56 A;  1HNX L;  4A3C H;  2V1C C;  2BDO A;  4C3H H;  2RSN A;  4HIO A;  4LFB L;  5C3E H;  2CW0 D;  1IBK L;  1FJG L;  4P74 A;  1K8A C;  3TDQ A;  1M8A A;  2PW5 A;  5KRU A;  3F2U A;  1HCZ A;  1O80 A;  1Y1W H;  3QWN A;  3I8Z A;  4R4I A;  1STN A;  3WDN A;  1QJO A;  3PF5 A;  2F0Q A;  1RIP A;  4DR4 L;  4M8A A;  2BA0 A;  3KOJ A;  2EYL A;  2A6E C;  5M5X H;  2CHB D;  2K05 A;  1WJJ A;  5ELB A;  4YY3 Q;  1D5X C;  1VQK A;  2OWO A;  4TKO B;  2E5L L;  2JA5 B;  1LTT D;  2RF4 A;  1ZKO A;  2UU9 Q;  4X66 L;  2CVR A;  4OO1 G;  1EY8 A;  5KNB A;  5IYB G;  1J5E L;  3TS0 A;  3T1Y Q;  3VYU A;  5ELD A;  1Y1W B;  1ICF B;  3F2C A;  5IP9 G;  4LF5 L;  2GN5 A;  2IT1 A;  2AWO A;  1L0Y B;  1XPO A;  1R4Q B;  1YIJ A;  1TY0 A;  4JV5 Q;  2K5V A;  3J7A V;  4DR5 Q;  2X6G A;  4BBS H;  1I3Q H;  2LSS A;  1BDO A;  2F0L A;  4IJL A;  3TP6 A;  4U67 3;  3CW2 C;  2FFK B;  1K83 B;  1S5E D;  5C5L A;  4C1N I;  2XWB B;  2EXZ A;  2M00 A;  2VXW A;  1SYD A;  1F9P A;  1TWA H;  2VQE L;  3T4A C;  3PUY A;  1WTQ A;  3DM3 A;  2KHJ A;  4G7O C;  4B08 A;  2F03 A;  1IYV A;  1GJX A;  3K5M A;  5GQO A;  4BBS B;  4K5W A;  4DV3 Q;  3S2H H;  1E2Z A;  1FL0 A;  3BZD B;  4IPG A;  4JI3 L;  4JI0 L;  3CCE A;  4DV7 Q;  1H95 A;  3TEH B;  4OGQ C;  1I4Q A;  4J1M A;  1KD1 C;  1JB3 A;  4TVA B;  2Q8T A;  4IUR A;  4C3I G;  3ZYY X;  3PV0 A;  3OW2 A;  3PGZ A;  4CJ1 B;  4RCN A;  4Z9C B;  5ELC A;  4A3K H;  4JV5 L;  3GP7 A;  4DR5 L;  5H1S E;  5K36 G;  2L9H A;  2F0N A;  3LGJ A;  1SMY C;  3OIQ A;  2PNR C;  4DR3 Q;  3MEF A;  1V1Q A;  2B2U A;  2OCE A;  1VQ8 A;  1CKN A;  1KNA A;  3RN2 A;  1SE2 A;  2JP1 A;  1PLF A;  3S1R H;  1TXY A;  1Z7T A;  1TWG B;  2WP8 J;  4PMW A;  3D4W A;  1PYS B;  4RFB A;  3KDF A;  1ET9 A;  2Q8R E;  3U9S A;  1PXU A;  3I2Z A;  1EWI A;  4HIM A;  3JAM i;  4DV3 L;  4LF9 Q;  4NDX A;  4DV7 L;  2BDN A;  2QDL A;  1QE6 A;  1UEA B;  2WB1 E;  2MO0 A;  4BS9 A;  1S72 A;  1Q1E A;  4GNX A;  4PMC A;  4YWK A;  2KJX A;  3TP7 A;  2DJF C;  3CQZ H;  1WTO A;  4DN4 M;  3CC2 A;  3PO2 H;  1KAW A;  2CQO A;  1PRT D;  2ZJQ A;  1NUC A;  4M1U B;  4PZ7 A;  1SBB B;  1EEI D;  2K5D A;  1GXD C;  4RHR A;  1EY7 A;  1NE3 A;  2HIX A;  2SOB A;  4H0L C;  5D3I B;  1O7Z A;  2I5L X;  1A0I A;  2JJQ A;  1WFQ A;  3HOX G;  4UY8 C;  2JA7 B;  1EYA A;  1HA6 A;  3TZD A;  2WAC A;  5AJ3 Q;  4A3I B;  5CV4 A;  1EY6 A;  2B63 H;  2H1E A;  4RGO S;  1AE2 A;  1XMO Q;  4L6T B;  3FVQ A;  5CBA E;  3KF8 A;  2B2W A;  2Z6K A;  1PRT B;  4P73 A;  1Z47 A;  1BCP F; 
#chains in the Genus database with same CATH homology
 2Y0S B;  1E2W A;  1RJT A;  1VF5 C;  3S9W A;  3VYR A;  2NTT A;  1G2T A;  3HRZ C;  1O7L A;  2OXP A;  3SE0 A;  4ZAI A;  2G9D A;  3O13 A;  2Z4I A;  3VR3 A;  1I4X A;  1F9Q A;  2KOL A;  1EY9 A;  3TME A;  4F7X A;  1A2U A;  5M9O A;  1AZP A;  1HQR D;  1V1O A;  4I7Z C;  2NB0 A;  1B44 D;  3NTH A;  4O42 A;  3QO2 A;  2EZV A;  3MZ5 A;  2L5T A;  2ENB A;  2B2Y C;  3BS1 A;  2EE1 A;  2LKV A;  2EY1 A;  1ICW A;  1AP0 A;  5EPJ A;  3PUX A;  5IT9 E;  1F77 A;  2ID0 A;  3FRP B;  4HED A;  2F0P A;  2Z8L A;  4FF3 A;  2O4X A;  1GUO A;  2SEB D;  3KK7 A;  1ROD A;  1FR3 A;  3PIO 3;  3NK9 A;  1PZK D;  5D3D A;  1T5E A;  2K28 A;  1BQQ T;  3NBI A;  1R4P B;  1WTX A;  3MFG A;  3M7N A;  1W6K A;  3UI2 A;  3Q6S A;  3K0Y A;  1JCK B;  3RZD B;  3LX0 A;  3S16 B;  3RLF A;  3M85 A;  2XVS A;  4C2M B;  1CM9 A;  5E3F A;  4EVO A;  3DWP A;  1WVL A;  2R7Z B;  4F88 A;  5FO7 B;  2FHT A;  1PYW D;  3RUZ A;  2H4O A;  5M5Y B;  2WIN B;  1M4V A;  3IAY A;  5COR A;  1WTR A;  2E2H B;  1TS3 A;  1SJH D;  3MHB A;  2K04 A;  1ENF A;  5DEH A;  3IFT A;  1UUP A;  3BDO A;  5C0X H;  3DXJ C;  2BE5 D;  3HOU B;  3MXG A;  5DNF A;  1D1I A;  3HGB A;  1OXS C;  4EQP A;  1GHJ A;  2PZT A;  1Q12 A;  3PUZ A;  3NP8 A;  1XTC D;  2DN8 A;  1D6E C;  1JE4 A;  1DOK A;  4C3H G;  1F9S A;  3FPP A;  4Q5V A;  1TWF B;  1L0X B;  2WV6 D;  1GUW A;  4J8Q A;  2WAQ B;  3QOL A;  4IUU A;  1TR5 A;  4ZRZ A;  2X6L A;  4NW2 A;  3NQT A;  3DWA A;  1EY5 A;  4KKS A;  4FYD A;  1SYE A;  3S15 B;  3DEP A;  1TS2 A;  2JEA I;  1PTO H;  1PFB A;  2J7Z A;  1EU3 A;  3MA2 B;  1BO0 A;  3RZO B;  5CV5 A;  1AFP A;  2O5J C;  1B3A A;  1S5F D;  2O5I C;  5IOC A;  2HDM A;  2R93 B;  4KN7 C;  5JVH 3;  2XRQ D;  1BUV T;  2O2L D;  1LTA D;  1Z6H A;  3ERO A;  1KLG D;  2NN6 I;  3VYT A;  5FO8 B;  5DAU A;  4ZUI A;  2K1B A;  1KLU D;  4L63 B;  4X3K A;  5I4D A;  2MGS A;  2EVB A;  1LO5 D;  3S2D B;  2EY6 A;  3K5L A;  4O1N A;  4RKL A;  1PRT C;  1J8I A;  1WD1 A;  1V8Q A;  3I3C A;  4LMQ D;  1Q90 A;  4LAA A;  3E0J A;  3FDT A;  1QOH A;  4H44 C;  1QIL A;  4DNR B;  3TN2 A;  4A3B B;  2EPB A;  2D5D A;  4XIG S;  4GZY C;  4MN3 A;  5CV9 A;  5CR3 A;  1LTS D;  4UAI A;  4C1N K;  2MUY A;  4TQU S;  4K6D A;  5EQ0 A;  4XYQ A;  1XWE A;  2E75 C;  5IGF A;  3VR2 A;  2IPK D;  4HMJ A;  3DEO A;  2AQ1 B;  3J81 L;  3X3N A;  1ILQ A;  1H9R A;  4KD3 A;  5ELF A;  3P1H A;  4FVM A;  5G3L F;  2XRS D;  1F9R A;  1FNW A;  1IKM A;  4FXK C;  1D2B A;  4ZKC B;  4WRD A;  4DFA A;  4OIJ A;  4CKE A;  5A2Q E;  2E76 C;  1BCP D;  4MHE A;  1RHP A;  4Y7N B;  4XXE A;  3H0G B;  2EYH A;  3PMF A;  2F0E A;  2ICE C;  3HOY B;  1B53 A;  4K8J A;  2NVQ B;  4G4K A;  1GUT A;  1LT3 D;  1BCP B;  1R9T B;  4R8I A;  2FIN B;  3BVZ A;  3J7Y W;  3W2D A;  2MJ8 A;  1KDA A;  4HSP A;  3CRK C;  1H9J A;  5IGE A;  4F87 A;  2WKC A;  2B2V C;  4AYB B;  2MP1 A;  4IZ8 A;  2JEB I;  1TWH B;  3CRL C;  5CMD A;  3M4Y A;  5JVG 3;  1MBY A;  3Q24 A;  1B4O A;  1TS4 A;  1GOZ A;  3OIP A;  5KYI A;  4TSS A;  2NWG A;  3H94 A;  1I4P A;  3KUP A;  4DK0 A;  5C3X A;  2B2T A;  1GUN A;  3SK6 A;  2R92 B;  1E0B A;  1WCM B;  2KED A;  1HTL D;  5FK9 C;  3C1E A;  2BE5 C;  3D4D A;  2IW3 A;  3TBI B;  1VF7 A;  3S17 B;  2A69 D;  4QF4 A;  3NPP A;  4QCL A;  5CV7 A;  4I65 A;  1SJE D;  5EGT A;  4LJZ C;  1G91 A;  4H7B A;  4ZK9 B;  1DZ1 A;  4C3J G;  2MPM A;  1EYC A;  4XT1 B;  4DXG A;  4DF7 A;  3S1N B;  1E2V A;  2QCP X;  2XSC A;  2ZXP A;  5CBE E;  1KDC A;  1EWH A;  1I4H A;  3T56 B;  5C44 B;  1YNN C;  1Y1V B;  1EOT A;  3TZU A;  1SNM A;  4WFN 3;  2Z4H A;  3PO3 B;  1PTO C;  4KJN A;  3TSS A;  3I73 A;  1W6J A;  5T1I A;  2EY2 A;  1EIH A;  5C0X G;  2D9U A;  2HUG A;  2E2I B;  1VMC A;  1KTK A;  4ABN A;  5FLX L;  5IGC A;  3BYT B;  3SHL A;  2WB1 B;  3E5S A;  2A68 C;  2E2D C;  1I6V C;  1EZ8 A;  1FYC A;  2IWH A;  1MI2 A;  5F2D A;  4HSV A;  3K59 A;  2NBF A;  5JJZ A;  3BYY B;  1SSO A;  4TRD A;  2G9H D;  3PUW A;  1YNJ D;  1WTP A;  4DGZ A;  1CA6 A;  3MC0 B;  1DJR D;  1JWM D;  3P20 A;  5C0X J;  1STG A;  1STH A;  1IYU A;  1STB A;  4QMG A;  4G57 A;  2K33 A;  3TP8 A;  3WOE A;  2KEC A;  2VB2 X;  3VR5 A;  1KNE A;  3IKJ A;  2OF1 A;  2KCC A;  4DAV A;  5NUC A;  1D5M C;  1SNP A;  4OO1 I;  1X3Q A;  2KVM A;  3M3Y B;  1II3 A;  2EYP A;  2PO4 A;  1TU2 B;  3PUV A;  3M4O B;  2F0W A;  1SE4 A;  5JEA J;  1TII D;  4IUV A;  5I6W A;  3NTK A;  1SYG A;  3I70 A;  4IFD H;  4L8J A;  4DAP A;  1DD2 A;  4OHJ A;  1G8Z D;  5KEE A;  3LNN A;  4C56 C;  2CQA A;  3R3O A;  1ZXT A;  1LTI D;  3HP3 A;  2HDL A;  5JPN C;  1JC7 A;  2EYO A;  1FNV A;  3V05 A;  1GUG A;  4G7H C;  1EY4 A;  1F2M A;  5KIX A;  3R8B A;  4CKC A;  5G3L D;  1WTW A;  1IW7 C;  1RTO A;  4IAL A;  3NHH A;  3JAM L;  1Y8O B;  2NTS A;  1B9M A;  3DUZ A;  3VYS A;  1CHQ D;  2V4D A;  3BG3 A;  3MXU A;  4IUT A;  1FD7 D;  4KMU C;  5I9O A;  2MHV A;  1DCZ A;  1CA5 A;  1BXT A;  2K5W A;  1ILP A;  1C4Q A;  3CKI B;  2QIL A;  4DXF A;  1MD2 D;  4XT3 B;  3NBH A;  4FF4 A;  3L7Z C;  3EQL C;  1WTV A;  4RKB A;  3EVQ A;  3Q0A A;  1TWC B;  1NR4 A;  4RAU C;  1SYC A;  1S5D D;  2C9O A;  1NR2 A;  2CW0 C;  2EYF A;  3OWE B;  1O7Y A;  4XTC S;  4FF2 A;  1H9K A;  3MXN A;  5I2X A;  5BN5 A;  2B2U C;  4FXD A;  1B50 A;  4QUF A;  1QWY A;  1B2T A;  2BCO A;  1D1K A;  2AQ2 B;  5EBC A;  1UAP A;  3FMC A;  4HTH A;  5AFW A;  4QB4 A;  2RDH A;  1OXX K;  3IL8 A;  3K5O A;  1LAB A;  1I4R A;  2L4N A;  4FO2 A;  2F0V A;  2DY7 A;  3RD4 A;  4KN4 C;  1VMP A;  3MAQ A;  1TKW B;  3SDZ A;  4NMZ A;  3GTO B;  2L1B A;  2A6H D;  4XQN A;  4XDX A;  3GTM B;  5ELE A;  1OXV A;  2SDF A;  1HQM C;  2XN9 C;  3W3A A;  5C4J B;  4ZUJ A;  3I90 A;  3H3V C;  1LV9 A;  2X69 A;  3HOW B;  3K6O A;  1QCB D;  1PFN A;  1IL8 A;  3L3O C;  2RDF A;  1JOR A;  2F0F A;  5C4H A;  2B2W C;  1G6Z A;  4ID6 A;  3WOF A;  1QNU A;  5EKI A;  1XYI A;  5JEA H;  4DU9 A;  3S14 B;  2D62 A;  3K57 A;  3D6C A;  2NVY B;  4K6L A;  2JXM B;  2WKD A;  3QJY A;  3J7A F;  2XNA C;  4X3U A;  2QEJ C;  1IHZ A;  2F0G A;  3KLR A;  3K7A B;  4F8M A;  4HCE A;  3R2T A;  2PPB C;  1STA A;  3OMC A;  5BN4 A;  3MTS A;  4R8N A;  2VNU D;  3HEJ A;  4C3I B;  3NXW A;  5BN3 A;  1VCI A;  1K8M A;  1F2Y A;  2FMC A;  5COY A;  1RTN A;  1MGS A;  3I4L A;  4IUN A;  2AUJ D;  1EU4 A;  4ODG A;  1UNS A;  3GV6 A;  1ZYR D;  2FJ2 A;  4IUP A;  2L55 A;  2N55 A;  4EQO A;  3A8I E;  3J80 L;  3A7A B;  1GHK A;  1HPC A;  3VA7 A;  1EIG A;  1RCV D;  3C1F A;  1FNU A;  1SEB D;  3QG1 A;  4QUC A;  3SR1 A;  2L12 A;  2KA7 A;  3X3M A;  1SNC A;  1EEF D;  2XWJ B;  1VDZ A;  2DNE A;  3D6W A;  3N6R A;  3FEW X;  1SMY D;  1EYD A;  1G29 1;  5J1Z A;  4BA1 I;  3OOC A;  3SK4 A;  2LMC B;  3KLS X;  3AB9 A;  3BVG A;  3HKZ B;  5IOD A;  3V2T A;  3HOX B;  1PMR A;  4PQX A;  4X3T A;  2K5Q A;  2PYK A;  5I9P A;  3NTI A;  1PFM A;  1IKL A;  2BA1 A;  3LWU A;  1EWC A;  1BOS A;  4DK1 A;  4RGT A;  4P2C B;  1MSG A;  2B39 A;  4K14 A;  4IFD G;  4E6I A;  4KHZ A;  4ME5 A;  5C4Z A;  1JQY D;  5HUR A;  3U9O A;  2I46 A;  4OL7 A;  2FMM A;  3V96 A;  1Q1B A;  2EYJ A;  2J4X A;  3EFX D;  2RSO A;  5EJW A;  3C3L A;  4N9T A;  2JA8 B;  3HG9 A;  5JPM C;  5IGB A;  2HCC A;  2KEE A;  2NYZ D;  3VR6 A;  3HZX A;  3SXH A;  4K2K A;  3G7L A;  1HUM A;  2JSO A;  2ZXO A;  2F1M A;  1SNO A;  3AMU A;  1FGB D;  4IFD J;  4WJW A;  1STY A;  4ZLT F;  1KDB A;  3A7L A;  2OT2 A;  1SYB A;  2F3W A;  3HS0 C;  5KNC A;  4NP5 A;  4A3M B;  3G6J B;  4A3J B;  2LS0 1;  2R61 A;  2TMP A;  3A55 A;  5J39 A;  1LTB D;  3NWS A;  3M7G A;  4PV1 C;  3I4M B;  5J22 A;  3EA6 A;  2NN6 H;  4Q0F A;  2PW7 A;  1S4Z A;  5TSS A;  2AWN A;  3GTG B;  2M9V A;  3J81 E;  1LAC A;  1DOM A;  3ITP A;  1A15 A;  4FNF A;  5I2Y A;  4IFD I;  4BY1 B;  2NZ1 D;  1LTR D;  1JOK A;  4V0B A;  4RH6 A;  2M2L A;  5A35 A;  1RKN A;  3KLS A;  5T1G A;  4JBW A;  3H09 A;  5FO9 B;  4S3S A;  4WOR A;  3EJI A;  2C5C A;  5EKK A;  3OMG A;  1SXT A;  1K8O A;  1S5C D;  4C3H B;  5ISR A;  5C3E B;  2K32 A;  1ET6 A;  1JOO A;  1SDF A;  4KKT A;  1DYQ A;  1EY0 A;  3T53 B;  4N9P A;  5CC4 A;  4HMI A;  2YYZ A;  4CJ0 B;  3A8K E;  4RGM A;  3S1Q B;  3SK5 A;  3A8J E;  1SND A;  5M5X B;  1HHV A;  1B9N A;  1Y8N B;  3IFD A;  3GV3 A;  2B2Y A;  5EPK A;  3C2P A;  1PTO F;  5D14 A;  1JWS D;  3BVM A;  4IUQ A;  1OXT A;  2DNC A;  3DWQ A;  1RDP D;  2PZW A;  4BA2 I;  1ZYR C;  4B9W A;  2IX0 A;  3I91 A;  5JEA G;  1I3Q B;  5C6A A;  1JIC A;  2EOT A;  2QKI C;  3CHB D;  1ML0 D;  4RWS C;  1TWA B;  2KHS A;  2ZXR A;  5JOB A;  5KGU A;  1Y8P B;  1QG7 A;  1C8C A;  4XQQ A;  2PMZ B;  1CZW A;  4LK1 C;  1D5Z C;  4CGY B;  2B8F A;  3S2H B;  5IT9 L;  3URY A;  1HXY D;  1LT6 D;  4K2L A;  3GO5 A;  3T51 B;  3GD7 A;  5C3W A;  5K5P A;  1A3U A;  4HR7 B;  3OHX C;  2KCN A;  3CU7 A;  4A3K B;  1J9O A;  3OSO A;  4EQN A;  2B2T C;  2A5H A;  2E74 C;  1H9S B;  2F0K A;  4PNY A;  5HGT A;  5C0X I;  5C5M A;  1U4R A;  3FKI B;  2QF7 A;  1X32 A;  4K5X A;  3S1R B;  4CJ2 C;  1QNK A;  2IJ0 A;  4KY5 A;  1BCP C;  4A3D B;  1DON A;  1DM0 B;  1MSH A;  1Y69 U;  3NE5 B;  1AEX A;  3CQZ B;  3OW7 A;  3ERQ A;  5FLX E;  1PZJ D;  4YIJ A;  5CV8 A;  3PO2 B;  2RA4 A;  1SYF A;  1EQT A;  2D2C C;  2F3V A;  2B8G A;  2EJF C;  4FF1 A;  4BY7 B;  3P75 A;  2F0J A;  3D4R A;  4BWG B;  2SNS A;  4ZKB B;  4FXG C;  1I6H B;  3MEH A;  4KV6 A;  2VB3 X;  1I4G A;  2B63 B;  1HFG A;  4XYO A;  5KND A;  1TY2 A;  1H9S A;  3P7J A;  2KUM A;  1F2Z A;  1B1Z A;  1TT2 A;  3C46 A;  2EYM A;  4DNT B;  4A3F B;  1JWU D;  5DM7 3;  1HUN A;  3KBG A;  5LL6 S;  1CQF A;  5IIF A;  5E1F A;  5CYU A;  1C48 A;  2F0U A;  3NUC A;  3VR4 A;  2A73 B;  1F2L A;  2ZT9 C;  3T13 A;  4G7Z C;  3NQI A;  3MFY A;  2LFN A;  3D31 A;  4U68 A;  2NUC A;  3R2I A;  2OEO A;  4CHT B;  2F0M A;  2F0T A;  1SNQ A;  2A69 C;  1NAP A;  4JK1 C;  1STE A;  1CFM A;  2VUM B;  1EZ6 A;  4A3G B;  3HOZ B;  2WII B;  3GTJ B;  3DMU A;  1OXU A;  1G2S A;  1TS5 A;  4NKL A;  3Q23 A;  1ZEQ X;  3GTP B;  1HRJ A;  1LTG D;  2KQ3 A;  4RA8 A;  5KYL A;  3A56 A;  1EQV A;  2R6G A;  3I72 A;  2SNM A;  1A2T A;  4HAE A;  3TP5 A;  2A74 C;  1U4L A;  4ZYS A;  3H91 A;  4OO1 H;  1AZQ A;  4J6H A;  2K01 A;  4C3J B;  2BOS A;  4DA2 A;  1TQO A;  3VA5 A;  1CI3 M;  4FP5 D;  3H6M A;  4H13 C;  3PIP 3;  1CZG A;  1Q3L A;  1CHP D;  3BDC A;  1WD0 A;  3K58 A;  2NN6 G;  2NVT B;  4KY6 A;  2J0T D;  2PCF B;  2R3Z A;  3D8G A;  1ESR A;  2EJM A;  1BNZ A;  3JAM E;  3NSW A;  3AU7 A;  1S5B D;  3FPU B;  5EBD A;  2RDG A;  4CKB A;  2K6A A;  1X3P A;  5LHY 1;  4OIK A;  3HOV B;  1CQV A;  3N52 A;  1GUS A;  3D3R A;  5I6Y A;  1EFI D;  2F4I A;  2A6E D;  4KD4 A;  3A54 A;  1KAB A;  1YNJ C;  2RBM A;  4KI0 A;  2PZU A;  1EL0 A;  2E2J B;  1ENC A;  1Q8I A;  2IX3 A;  1CT1 D;  1LLR D;  4HN7 A;  1I50 B;  4QIW B;  2LY7 A;  5K36 H;  1CTM A;  5A2Q L;  1YNN D;  1SAP A;  1U4P A;  2B2V A;  1LT5 D;  2EJG C;  1RF2 D;  1PTO D;  1SFO B;  4KY7 A;  1A3T A;  3I4N B;  2Z1C A;  3QOJ A;  3K5N A;  4K5V A;  2PQE A;  5M3F B;  3GTL B;  4KHV A;  1U9R A;  1PDQ A;  3GQB A;  1PTO B;  2F0H A;  5FKA C;  1SE3 A;  2F0I A;  2TSS A;  2A68 D;  4CBV A;  1H9M A;  4PMB A;  4K8I A;  2I07 B;  4B9X A;  3RMH A;  1DXM A;  3QB3 A;  4BBR B;  1ESF A;  1CK1 A;  3GTK B;  2AQ3 B;  5IGD A;  2HCI A;  2IL8 A;  2RVL A;  5EKL A;  5DM6 3;  3ND9 A;  4DAY A;  1RD9 D;  2JE6 I;  1ENA A;  1U4M A;  1OO9 B;  1PRT F;  5M5W B;  2YU9 B;  1AW7 A;  3MVV A;  3ND8 A;  2F0S A;  3R93 A;  5EPL A;  5M3M B;  5FOB B;  3Q22 A;  2L0C A;  2K03 A;  1V1P B;  3DHQ A;  1JOQ A;  1XX8 A;  4UDU C;  5CV6 A;  2JA6 B;  5CGK A;  1A6X A;  4RCO A;  1T5X D;  1NCV A;  5E4X A;  2NVX B;  2F0D A;  2RQX A;  3DM1 A;  1HA5 A;  1TVX A;  4ULL A;  2EDG A;  3OPO A;  1O78 A;  3KBX A;  3ONA B;  5JAV A;  4RGN A;  2IX1 A;  4ILW A;  4MIU A;  3QIA A;  1AN8 A;  3SEB A;  3GTQ B;  3SVM A;  3E6Z X;  1LT4 D;  4KTA A;  5IGG A;  1HFN A;  2N88 A;  3SK8 A;  4KK7 A;  2EY5 A;  2RKS A;  3BDL A;  4ZQ3 A;  4X3S A;  3MWY W;  1NSN S;  4RHS A;  4A93 B;  1V1P A;  5E4W C;  2GA4 B;  1IW7 D;  4V19 0;  1PZI D;  2F0O A;  2ICI A;  4A3E B;  4KKU A;  3J80 E;  3OWF A;  1V43 A;  2L11 A;  2Q8I B;  3LWE A;  2HQE A;  4R9W A;  5D65 A;  2DY8 A;  3L9A X;  5C4X B;  4IQZ A;  1BBX C;  2K7V A;  1ONL A;  1HTP A;  2AUK A;  3S1M B;  3MXP A;  3T16 A;  1QB5 D;  3NWT A;  2JYO A;  1JR0 D;  5LL6 X;  2XIW A;  4IN3 A;  4HCS A;  4KJO A;  1BR9 A;  1A3V A;  2A6H C;  1DOL A;  1XXG A;  4XQJ A;  1BF4 A;  2QDB A;  1KAA A;  4EGV A;  2BDO A;  2RSN A;  2CW0 D;  3TDQ A;  1M8A A;  2PW5 A;  5KRU A;  3F2U A;  1HCZ A;  1O80 A;  3QWN A;  3I8Z A;  1STN A;  3WDN A;  1QJO A;  2F0Q A;  4M8A A;  2BA0 A;  2EYL A;  2A6E C;  2CHB D;  2K05 A;  5ELB A;  1D5X C;  4TKO B;  2JA5 B;  1LTT D;  1ZKO A;  2CVR A;  4OO1 G;  1EY8 A;  5KNB A;  3VYU A;  5ELD A;  1Y1W B;  2IT1 A;  2AWO A;  1L0Y B;  1R4Q B;  1TY0 A;  3J7A V;  2X6G A;  1BDO A;  2F0L A;  3TP6 A;  4U67 3;  2FFK B;  1K83 B;  1S5E D;  5C5L A;  4C1N I;  2XWB B;  2EXZ A;  2M00 A;  2VXW A;  1SYD A;  1F9P A;  3T4A C;  3PUY A;  1WTQ A;  4G7O C;  4B08 A;  2F03 A;  1IYV A;  1GJX A;  3K5M A;  4BBS B;  4K5W A;  1E2Z A;  3BZD B;  4OGQ C;  1I4Q A;  4J1M A;  1JB3 A;  2Q8T A;  4IUR A;  4C3I G;  3ZYY X;  3PV0 A;  4CJ1 B;  4RCN A;  4Z9C B;  5ELC A;  3GP7 A;  5K36 G;  2L9H A;  2F0N A;  1SMY C;  3OIQ A;  2PNR C;  2B2U A;  1KNA A;  1SE2 A;  2JP1 A;  1PLF A;  1Z7T A;  1TWG B;  2WP8 J;  4PMW A;  3D4W A;  4RFB A;  1ET9 A;  2Q8R E;  3U9S A;  1PXU A;  4NDX A;  2BDN A;  1QE6 A;  1UEA B;  4BS9 A;  1Q1E A;  4PMC A;  2KJX A;  3TP7 A;  1WTO A;  4DN4 M;  1PRT D;  1NUC A;  4M1U B;  1SBB B;  1EEI D;  2K5D A;  1GXD C;  4RHR A;  1EY7 A;  4H0L C;  2SOB A;  5D3I B;  1O7Z A;  2JA7 B;  1EYA A;  1HA6 A;  3TZD A;  2WAC A;  4A3I B;  5CV4 A;  1EY6 A;  2H1E A;  4RGO S;  4L6T B;  3FVQ A;  5CBA E;  3KF8 A;  2B2W A;  1PRT B;  1Z47 A;  1BCP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...