1TT2A

Cryogenic crystal structure of staphylococcal nuclease variant truncated delta+phs i92k
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title X-ray and thermodynamic studies of staphylococcal nuclease variants I92E and I92K: insights into polarity of the protein interior
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1tt2A00
3NQTA 3QB3A 5CGKA 5KIXA 2QDBA 3NHHA 4EVOA 5JAVA 2F0PA 4KD4A 5EGTA 5C4HA 3S9WA 2F0KA 5I6WA 2EYJA 5NUCA 4NDXA 1STHA 4KY6A 3SR1A 1STBA 1SYBA 5IGCA 5HGTA 2EY1A 3DHQA 2EYOA 2F0LA 2PQEA 4QF4A 1A3VA 2RDFA 4K6DA 1TQOA 3C1EA 4K8IA 3TP5A 1A3TA 1U9RA 3P75A 2PZUA 1EZ6A 4NP5A 4J6HA 5J39A 1II3A 3EJIA 5C6AA 5EKLA 2PW5A 5IODA 4IALA 5M9OA 1EY9A 1TR5A 2HQEA 2PYKA 5IGDA 1KDAA 5CR3A 3V2TA 3D4DA 1SYEA 2F3VA 3D8GA 2EY6A 4G57A 2PZWA 4QB4A 2EXZA 3SK8A 1IHZA 2O4XA 4KHVA 5CV7A 1STYA 4KD3A 4DGZA 5EKKA 5IGBA 5K5PA 4EQNA 3D6CA 3SHLA 3SXHA 4DF7A 5C3WA 5C4ZA 2SNSA 4K2KA 1NUCA 1SYDA 1JOQA 4WRDA 3ITPA 5I9PA 1F2ZA 3LX0A 1STNA 4ID6A 2EY2A 3EVQA 4KV6A 1EY6A 1SNOA 2F0NA 3T13A 4J1MA 1NSNS 2F0UA 3NXWA 1A2UA 4F7XA 5KGUA 4QMGA 5IGEA 1SNMA 2RBMA 3OMGA 3QOJA 3HZXA 4K8JA 4ODGA 3SK4A 4DU9A 2F3WA 1EY0A 1SYCA 3EROA 4KY5A 1EY4A 1A2TA 2EYHA 5DEHA 5KEEA 5E1FA 2KHSA 2LKVA 3OWFA 1F2YA 3NP8A 1EY8A 1AEXA 3TP7A 4MIUA 5DAUA 2ENBA 2M00A 4F8MA 5C3XA 1ENCA 5HURA 1STGA 1EZ8A 4N9TA 1SYFA 1EQVA 2SOBA 2NUCA 3NK9A 4K5VA 4RKBA 3R3OA 5E3FA 3U9OA 5ISRA 5IGGA 4PMBA 3P1HA 4YIJA 2F0EA 5JOBA 2RKSA 2EYLA 3MVVA 1SYGA 3H6MA 5C5LA 4B9XA 1SNCA 4RKLA 2F0SA 2PW7A 2F0HA 4H7BA 5I6YA 4EQPA 5KRUA 2F0MA 1EYAA 4HMJA 4ME5A 5J1ZA 5F2DA 2F0OA 4K14A 4E6IA 1EY5A 3SK6A 4B9WA 1STAA 4KJNA 4R8NA 1ENAA 3OMCA 1KAAA 3MHBA 1EY7A 3NUCA 4NMZA 2EY5A 4DFAA 1F2MA 2OF1A 3D4WA 3MEHA 2OXPA 1KABA 2EYMA 2F0DA 2F0FA 3OSOA 3VA5A 4HTHA 4KJOA 4TRDA 4WORA 1JORA 1JOKA 3T16A 3BDLA 5KYIA 4ZQ3A 2F0VA 1KDBA 3HEJA 4N9PA 3DMUA 4HMIA 5CC4A 4OL7A 5J22A 4NKLA 3MZ5A 5CV5A 4ZUJA 4K2LA 3MXPA 5C5MA 1A3UA 2OEOA 4K5WA 3BDCA 4EQOA 1EYCA 4KY7A 2F0QA 4PNYA 1SNDA 4IUNA 2F0TA 3E5SA 2F0JA 2F0IA 2PZTA 3RUZA 3SK5A 1TT2A 4K5XA 3TP6A 3ERQA 1EYDA 3QOLA 5IIFA 1KDCA 5IGFA 5CV8A 3C1FA 4IZ8A 4KTAA 4ZUIA 1SNPA 5I9OA 2EYFA 2EYPA 2KQ3A 1JOOA 1RKNA 2F0WA 3TMEA 4I65A 4S3SA 4PMCA 5CV4A 3PMFA 3TP8A 2SNMA 5CV9A 5IOCA 5KYLA 1SNQA 5CV6A 2F0GA 4LAAA 2WACA
chains in the Genus database with same CATH superfamily
1CFMA 2ZT9C 1EOTA 2QDBA 4TSSA 2EYJA 3SR1A 5CYUA 4LFAQ 1KLGD 1F9RA 3HOUG 1BUVT 4C56C 1XPRA 1J9OA 3J81j 1IYUA 1CHQD 2ICEC 3JC66 2R7FA 4Y52H 2MO0A 1Y1VH 1GUOA 3J7A5 1CUKA 4LNQA 3I2ZA 2JE6I 4YY3L 5IGGA 1TY0A 4IN3A 3D8GA 1PH4A 2PZWA 4ZKBB 1LT3D 5EKKA 1R9TH 1K8MA 3SXHA 2E2HB 3ITPA 2R92H 1T5XD 2NVXH 3DWAA 1EY6A 4R9WA 1TS3A 1QCBD 4DV7Q 1PZKD 2E2JB 2F3WA 3G48A 4QIWE 2Q2HA 3GTKB 4GLVB 1KQSA 2JYOA 3DXJC 4JC0A 2WIIB 1LACA 2EJMA 3S1RH 4A3BH 4RHRA 4N9TA 5EBDA 2SOBA 4OGQC 1OTCA 2Z9HA 3U9OA 2F4VQ 2IX0A 1SE8A 3OOCA 1CKMA 2RDGA 4CJ2C 2MNAA 4DV5Q 1L1OC 1SYGA 4RHSA 4XT1B 2KVMA 1ILQA 4H7BA 4DUYL 3NWSA 2TMPA 3I70A 2ID0A 1HQRD 1EQRA 4DV0L 3AQQA 2WV6D 1ENAA 3CCJA 1JWSD 4LF7Q 1EU4A 1JWUD 4CKBA 3H3VC 2OF1A 1EWHA 5FK9C 3U58A 4CDFC 1RIPA 2F0DA 2F0FA 1YJ9A 2X69A 1B44D 3K5OA 3I4MB 4N9PA 1OO9B 1M8AA 1I6HB 2P5ZX 3QR8A 1OXSC 1RHPA 5JPNC 4A3JB 4GLXA 4JI3L 4A3LH 4ZCKA 2XNAC 4DA2A 3ICEA 1TT2A 4DR4L 1XMOQ 5IIFA 3S2HH 2B8GA 4LFCL 1E3PA 1DXMA 4IUVA 1A0IA 2DY7A 5CV4A 1IBML 1CK1A 4KD4A 5BN5A 1JE5A 1U4RA 2MP1A 4NDXA 2FJ2A 1SR3A 1XMQQ 1N32L 1PFMA 2CKZB 2RDFA 1IBLL 3NBIA 3AMUA 3EFXD 1L0WA 3Q8DA 4C3JH 4A3BG 4QQBX 3FP9A 1WOCA 1HRJA 1EY9A 1G8ZD 4LF4L 1G2SA 4G57A 1FL0A 1CT1D 4M1UB 1ZYRD 2YYZA 4XYQA 4HJ8A 4BXXH 2JA5B 4LUOA 3H0GG 3L9AX 3HOVH 5IY0A 5LL6S 5FJ8H 1EFWA 3GP7A 3N52A 4ZK9B 2VUMB 1B50A 4EQ5A 1X6OA 3HKZB 1JQYD 3T13A 5ELOA 3NXWA 4I7ZC 3HKSA 3HOZG 2EPBA 3KBGA 3J81c 1SBBB 4FVMA 4LFBQ 4FP5D 3NP8A 3F2CA 5C4XG 1PTOB 2BE5C 2K32A 4A3IB 4DKAC 4K5VA 1RTOA 4DXGA 4A3LG 4GN3B 3PO3G 3TQYA 4G7HC 4CJ1B 1PRTC 4XQNA 3S16B 1VCIA 2A8VA 4MZ9A 3TDQA 1DCZA 4R8NA 2ALYB 2HDMA 3DM3A 3K58A 1F2MA 3J81E 3BYYB 1KABA 1X3EA 3G7LA 1QZGA 3K7UC 5IP9H 4GOPA 4P2CB 4ZQ3A 1K83H 1KDBA 4JI7Q 4JI2Q 1K9MC 3M4PA 2L0CA 4LF9L 4QUFA 3NTIA 4NXNQ 1UE5A 2YV5A 4GOPB 4X3KA 4X62Q 1BNZA 5ELBA 2F0QA 4DK1A 3TN2A 5C44G 2HHHL 2F0TA 5IYCH 4K5XA 5COYA 1MHWC 5IGFA 2K1BA 3C1FA 1D5MC 4O1NA 2CCZA 3CPWA 3M4YA 1Q7YC 1K0RA 1M4VA 5D3IB 4XT3B 3HOVG 1RDPD 1LO5D 5FJ8G 1RD9D 2F0PA 3M3YH 3S9WA 1MI2A 1STBA 1X9NA 5HGTA 1SLJA 2JA7B 2PQEA 2R92B 4RA8A 2NVXB 4IPHA 4FDBA 1CI3M 5J39A 1BXTA 4DV4Q 2NVYH 1CM9A 5IODA 1FNWA 3A8IE 2A1AA 4KK7A 2PYKA 3D4DA 4RWSC 1J5EL 2EXZA 3RMHA 1LM0A 4JBKA 2A19A 5IGBA 1GHKA 1XTCD 3SHLA 2WKCA 3T56B 3AFPA 4UHVA 1YJNA 3Q23A 1QG7A 3GTQB 3V05A 3ND8A 1IZ6A 2A6ED 1TWFB 1I4XA 1UEBA 2F0NA 2AUKA 5LMNQ 2B63B 5IP9G 2ZJQA 2A69C 1VQBA 2N88A 3OWFA 1H9KA 1VQPA 2M00A 2YTYA 3L3OC 4B3TL 2Y0SE 4JI0L 1J8IA 4Q0FA 5HGQA 3BYTB 1VQ8A 4B3ML 1Y8NB 4DUZL 1NNXA 1EIGA 4X3SA 4IPGA 2UXDL 4ME5A 1KXLA 2QDLA 2ZXRA 4QCLA 3QJYA 1Q3LA 4B9WA 4HJ5A 2JA6H 1LTID 3OMCA 2K01A 4OHJA 1HFNA 5G3LD 1EIHA 5EAYA 2V4DA 4A3MH 2QA4A 4X64Q 1C0AA 1BBWA 4DR2L 4HIDA 3EIVA 1S5CD 3BDLA 1MJCA 2GVAA 3S17H 3J7ZC 5JEAJ 4PZ7A 3BDCA 1ILPA 3LGJA 2EIFA 3L2PA 2KCNA 2A6HC 1MJEA 3IKJA 4JYAQ 4U68A 5FO8B 2KHJA 1L2FA 2NN6I 1HFGA 2EYPA 4C3JB 2KBNA 4JG2A 1QJOA 3KF8B 1SNQA 5CV6A 4NB3A 1PH6A 1OXUA 1K28A 2ZTCA 3IL8A 3M7GA 2KJXA 3NSWA 4FXDA 3K7AH 1X55A 5C0XG 2CQAA 1X32A 2D62A 2K28A 1I5FA 2OQKA 1KL9A 1FVIA 1H9SA 2F4IA 3FDTA 1H9JA 2BOSA 4BBSH 1PV4A 2PZUA 4DK6C 1EEID 2QF7A 2B39A 2LS01 1RTNA 1H9SB 5IGDA 3P20A 1O7YA 2B2VC 1L1OA 1PH9A 4DNTB 2ICIA 1YNJD 3U4VA 2JA6G 3LX0A 2QKIC 1Y69U 3MXGA 4YY3Q 1G291 1PDQA 4KI0A 1PXUA 1L1OB 4A3MG 1A2UA 1KC8C 1SNMA 3HZXA 1FR3A 4ODGA 2N78A 3S1QH 2XRQD 3V96A 2X6LA 4QGUA 2E74C 1HNXL 3S1NB 4CHTB 2VNUD 3GTGH 4AH6A 1C48A 3NK9A 5GROA 3STBC 5IT9L 2HT1A 1JCKB 4YIJA 1G6ZA 3H6MA 2AKWB 2NVQB 1YHBA 4RKLA 1KD1C 2BH2A 4RCNA 1TXYA 1PTOD 4C2MB 4Z9CB 3DEOA 4V190 1LTRD 1B70B 2MJ8A 3H91A 3I4NB 4IPDA 4QJFA 1E2VA 3K80C 3ND9A 3GTOH 4DUYQ 1HTLD 1YNNC 3EA6A 1XTDA 1YI2A 4DV0Q 4FF3A 3W2DA 3AB9A 3BVGA 3G4SA 2KEDA 2JA8G 4BBSG 2J4XA 1L0XB 4K5WA 3CCEA 3EBEA 5FLXL 2FINB 1P8LA 1Y1WG 3QG1A 1WJJA 5EPKA 1UUPA 4A3DH 4KTAA 4UP8A 4DV2L 1PH5A 2JJQA 3DWPA 1HR0W 1BCPC 4JI1L 1SMXA 2NVYB 5JEAH 1WTRA 4LWCA 1IBKL 4CJ0B 1UEAB 4JI3Q 5CV9A 4ULLA 5KYLA 1WTXA 1SRUA 3NQTA 2PNHA 1TS2A 1SJHD 3NHHA 5C4JH 3NBHA 4OO1H 4DR4Q 2WKDA 4BY1H 4LFCQ 3IAYA 1F9QA 4M8AA 3URYA 1IBMQ 5M5XH 4BA1I 3ZYYX 1ICWA 2KCTA 4OEMB 1HPCA 4C3HG 1EEFD 3J80c 1N32Q 1ASYA 1FYCA 5CMDA 4IUPA 5CV7A 4YWLA 3OYYA 1QWYA 1IBLQ 3H15A 2EVBA 1DGSA 4HCEA 1Y14B 2RA4A 3AYHB 4KKUA 4LF4Q 2H1EA 3K5MA 2UUCL 5KGUA 2CFMA 1Q86C 2R7ZG 4QMGA 4EX5A 3E0EA 1PRTB 2K52A 1ZEQX 3TS2A 1LTGD 3BDOA 1XXGA 3T53B 3LWUA 1VF5C 3J80E 4UY8C 4QIWB 2N3SA 4AIMA 4F8MA 3JAMi 3CRKC 4YWKA 3GTLH 3A8KE 2F0EA 2RKSA 2I5HA 1WTHA 2YU9B 5KRUA 1SNCA 2F0SA 1WD0A 2F0MA 3CAMA 4A3DG 5DM63 2XVSA 2WAQE 5A2QL 1N33L 3SK6A 5JEAG 1NMGA 3DUZA 2VB2X 2Q2UA 1C7YA 2DJGC 3HOUH 3D4WA 1VS0A 5IYDG 4GLAC 1WTVA 1JOKA 1VQ7A 3HEJA 1SEBD 3AEVA 3PF5A 1I4PA 1ML0D 3IRBA 4OL7A 1T9HA 1E7ZA 3HS0C 4KLKA 2DNEA 2CH4W 2Z4IA 5I2YA 5LL6X 4KKTA 3NQIA 4KMUC 3H09A 3QOLA 1ENFA 1CZGA 3U9SA 1DOKA 1MD2D 4HR7B 1CQVA 1JOOA 3KOJA 4LF9Q 4A3CG 3S24A 5AFWA 4DR7L 2SEBD 4HJAA 3TZUA 1GOZA 2HHHQ 2Q8RE 2BDOA 1XNRL 1HZ9A 5C4HA 1CA6A 3NENA 1Q82C 3M4OB 2VB3X 4KKSA 2EXDA 2XGTA 3TS0A 3OIQA 1CTMA 3VR4A 4B3RL 5FO9B 5M5WH 2XIWA 4A75A 5LMNW 1ASZA 4GKKL 3S14B 2WINB 4IOAA 3JAML 1P16A 1QNUA 1L0YB 2YTXA 4DF7A 3BU2A 5C3EB 1HA5A 5LMUL 1WCMB 1NUCA 4BY7B 3RR5A 4BBRG 1I4RA 1NBWA 5CORA 4X65L 1STNA 1NTGA 3EVQA 1D5XC 1KRTA 2ZM6L 1J5EQ 2F0UA 3H94A 2LY7A 1FD7D 3T1YL 2Y0SG 3MWYW 4A3EB 2IWHA 3A5ZB 4HSVA 5DAUA 3PSIA 4DR3L 2CQOA 1JJCB 1VQAA 5E3FA 3S1MB 1A63A 4KHPL 2NN6H 5M3MG 2K7VA 4C3IB 2D0PA 4B9XA 3WOFA 1QB5D 3QO2A 4LUZA 3I7FA 3PV0A 2MO1A 2AQ1B 1PFBA 2KUMA 1SDFA 5H1SE 4WJ3M 4B3TQ 1XNQL 2LXKA 4JI0Q 1QE6A 2C5CA 1HZBA 3CPFA 4L5RC 5JJIA 3BZCA 2JA5G 4B3MQ 4DUZQ 2OTLA 1K0SA 4G4KA 5CBAE 2UXDQ 1V1PA 1BO0A 2D0OA 4A3FB 3QIAA 1X3GA 1VQ5A 5CC4A 1HJPA 1KAWA 3A7AB 3MZ5A 3A56A 4K2LA 4OX9L 5C5MA 3X3MA 4BY1B 3FKIB 2R93H 5IYBG 3RLNA 4LMQD 3OIPA 4DR2Q 2BA0A 3H0GH 5M5XB 2FXQA 2QW7A 3MA2B 2PI2E 1EYGA 1N8RC 2EJFC 2UXCL 2DNCA 1AP0A 3NPPA 4HIKA 4WJWA 3RZOB 3HOZH 2B2VA 1YBYA 2K33A 3UE0A 4R4QA 3BZDB 3M7NA 3T1HL 2E76C 2X6GA 5C4XH 4X6AH 4N8X1 4PZ8A 1BCPF 1HZCA 2K05A 3KDFA 3BS1A 1H95A 3PO3H 4QF4A 2VZAA 3KJPA 3GO5A 4GN5A 2E2IH 1D2BA 3FRPB 1STEA 2OQ0A 2HCCA 2KHIA 3NEMA 4A3KB 1NR4A 3KDFB 1D6EC 1KDAA 2NN6G 1SYEA 2EY6A 5GQOA 3PQIA 2CWAA 1O7ZA 1NR2A 1UE1A 3MFYA 3CCQA 3GTLB 1TY2A 1H9MA 4WRDA 1TWHH 3D3RA 4CDDC 1PFSA 5M3FH 1T5EA 5E7NA 1NSNS 3VA7A 2AUJD 2HCIA 3SK4A 2TSSA 3NTHA 1GJXA 1R4QB 1EY0A 1SYCA 5C44H 4MTNA 1TWCB 4FXKC 5E1FA 3ULPA 1EY8A 1OXTA 2NTSA 4TQUS 5C0XJ 3K5NA 2QILA 5ISRA 2M9VA 4A3GB 2R93G 1B4OA 3HG9A 3S2DH 1I4QA 3PIPA 1QVFA 1PRTD 3I4OA 1FJGL 4HMJA 3CCVA 2F03A 3Q6SA 1HNXQ 2C35B 3I73A 3QWNA 2Z0SA 1C9OA 4UPAA 1EY5A 2IPKD 1BDOA 4JVZA 2FFKB 2OTJA 5ELEA 4RFBA 3T4AC 3NUCA 2HIVA 1AW7A 2MUYA 4DFAA 4MTKA 3CXCA 1Q1EA 2WB1G 4JI4L 3OSOA 1V1QA 2L4NA 1KNEA 2N49A 3HOWG 4X3UA 3PUZA 4GS3A 2B63G 1V9PA 4L8JA 4A93B 1S5BD 1GUSA 1M90C 1DD2A 2EDGA 3KF6A 1B2TA 3F2UA 3U50C 1G91A 1TWGH 2I5LX 3I3CA 3TEHB 3O13A 1JT8A 2NBFA 1I4GA 2WFWA 3KF6B 3TP8A 2VQEL 1QVGA 1TWAH 3PGZA 1ZYRC 5GAGC 1XWEA 2QEJC 4EVOA 2K5WA 3GTPB 1TS4A 4DR5L 4DPGA 3SDZA 5M3FG 4KY6A 3HOXG 4O0AA 4DV2Q 4IFDI 4OWXB 2R61A 4JI1Q 2SDFA 1Q1BA 1IBKQ 1IL2A 1Z47A 4H0LC 4AYBB 4R4CA 2I46A 4UAIA 3VR5A 1A62A 4J6HA 4HJ7A 1Y1VB 4XXEA 3TREA 3KLSX 3SK8A 1GUWA 3GD7A 1JB3A 1FNUA 1R9TB 5I2XA 4IJHA 4K6LA 5I9PA 3MEFA 1V43A 1RODA 3CKIB 2BCOA 5EPLA 1JJ2A 5KNBA 4F7XA 1E24A 2DJFC 2IHFA 1B3QA 4PMWA 2J7ZA 1EQTA 2A69D 4WJ4A 4NPSA 2Q8TA 3OHXC 1ENCA 1S5DD 2RHQB 3AFQA 1YVCA 2Q2TA 3R3OA 3S1RB 4CKCA 4F87A 5AJ3L 4A3BB 3LWEA 2UUCQ 5EBCA 4IPCA 1SFOH 1VQKA 2EYLA 2WAQG 1E1TA 2BH8A 3RNUA 4YWMA 2F0OA 2RQXA 1YNXA 3CW2C 5C0XH 1LT4D 3K81C 1HNWL 2OCEA 5FLMG 2YTVA 3PIP3 1RCVD 4TKOB 4TRDA 1JORA 5KYIA 1UAPA 2IHEA 1JB7A 1PVOA 4JOIC 1C4QA 2AQ2B 4UP7A 3HOZB 1N33Q 1Q81C 5C4XB 4N8FA 1A3UA 2A6HD 3BJUA 1VQFA 1SNDA 4IUNA 2K04A 3PO3B 2E2IB 4OXPA 4DR6L 1XYIA 5JVH3 2IW3A 5E4XA 5I9OA 3S2HB 2F0WA 2L5TA 3W1GA 1SE2A 1GO3E 4RCOA 2WACA 1S4ZA 5CGKA 5JAVA 4I7AA 5GAEC 5HY6A 2O5IC 1ET9A 5NUCA 1STHA 1AE2A 3CC2A 1SMYC 1VMPA 1E2ZA 1B7YB 1NY4A 2EYOA 3HRZC 1X3PA 4MN3A 4JI5L 2NZ1D 1UE7A 3DWQA 4DR7Q 3K0YA 3HOYH 4IUQA 2NVTH 2PW5A 3A5UA 2XN9C 1SE4A 5M9OA 1XNRQ 4GNXC 1G2TA 1I94L 3MC0B 1XX8A 3AU7A 3EN2A 1PMRA 3D4RA 2ZXOA 5D3DA 3CCMA 4HSPA 5C3WA 3J80i 5BR8L 4RGTA 4B3RQ 4O2DA 1IW7C 1YZ6A 3CU7A 4ZAIA 1VQHA 3OW2A 1K8OA 3HOVB 4ZYSA 4GKKQ 5KNCA 4XQJA 3U4ZA 2JA8H 3A74A 2A73B 2DUDA 1RL2A 5LMUQ 1EY4A 1Y1WH 2KECA 4MIUA 1K3BC 1ESRA 3BVZA 3GTJH 4X65Q 2JA9A 3STBD 3CQZH 4QL5A 3CC4A 3GV6A 4PMBA 2ZM6Q 4RAUC 2FMMA 4RGNA 1Q8IA 3T1YQ 5M5YH 4OIJA 2AWOA 5F2DA 3CP0A 2XWJB 4DR3Q 1TIID 1EY7A 1EUJA 1EWIA 2E2DC 3ZJYC 4KHPQ 1YHAA 2EYMA 1HR0L 4LK1C 4NXML 2I5MX 1VQJA 1PH3A 4WORA 1PH1A 1YNND 3UDFA 2RDHA 3KJOA 4P75A 1K83B 1U4MA 1U4PA 1XNQQ 3HP3A 4C3HH 3PO2H 3TZDA 5JJKA 4R4IA 1SJED 2G9DA 2VXWA 1GUGA 2E5LL 3A55A 1LABA 4DNRB 3HOYG 5EPJA 1Y8PB 1KDCA 2EZVA 4L63B 3K0XA 2CH4A 3BZKA 1EIFA 4S3SA 2R7ZH 4OX9Q 2R7DA 1LTSD 3M4QA 5IOCA 2WB1E 3MXUA 4ILWA 4Y7NH 3QB3A 4C1NK 2Z1CA 5E4WC 1BBUA 2KA7A 3IFDA 3OTOQ 1ET6A 5EKIA 3M3YB 1SYBA 4DV3L 1VQ9A 1BBXC 3KFUA 2F0LA 3G71A 1A8VA 2PPBC 2UXCQ 2K14A 1WVLA 2DGYA 3C46A 5FO7B 1B1ZA 4LF5L 3T1HQ 3KLWA 4PG3A 2HQEA 1GXDC 1JOQA 4RGMA 2IT1A 5GADC 5IYDH 1TKWB 3T51B 1KNAA 2E2HH 1NMFA 1PLFA 1Q12A 2VL6A 1SFOB 3FPUB 2CVRA 1QNKA 3A8JE 2UUAQ 1A15A 1GUTA 1PYBA 1PTOC 2E2JH 3NBHB 2IX1A 4FF1A 1B9MA 3GTKH 1IXRA 3QOJA 1DM0B 1HUMA 5IT9c 4YHHL 1NJIC 2EYHA 4JV5L 3A54A 3NELA 4HN7A 3KBXA 1F2YA 4OONA 1B9NA 1K73C 3PO2G 1SYFA 3E0JA 2PMZE 1CKNA 1PH2A 3P1HA 1HNZL 4A3CH 3KK7A 1MSHA 2DN8A 2F0HA 3GTMH 4WFN3 1CKNB 4E6IA 1XJVA 4KJNA 4B3SL 1QOHA 2EY5A 2VQFL 5IT9E 1Y8OB 2JA6B 4BA2I 4IFDH 2WP8J 3I4MH 2KENA 1LTLA 2ATWA 1PFNA 1I6HH 4A3MB 1FJGQ 2JSOA 5FLXc 1O7LA 2GN5A 1KIXA 3OW7A 2B8FA 4DV1L 4A3JH 2IL8A 3S17B 3ER0A 4QY7A 4X66L 3I72A 1JC7A 1CSPA 1X3QA 1JWMD 3F1ZA 3R2IA 4JI4Q 1RF2D 3H3VI 2EJGC 4BBRH 4RG1A 5CV8A 2A68D 2O2LD 2NVTB 2KQ3A 2L12A 2R6GA 3PMFA 5FLXE 3RZDH 1CHPD 2V1CC 3F8TA 4LAAA 3IFTA 1CZWA 2ZTDA 3CMAA 4J15A 2H5XA 3K7AB 1WTQA 4H44C 2EY1A 5L37A 2RSOA 4K6DA 5M3MH 2VQEQ 1U9RA 4A3FG 1G51A 2MFIA 2Z6BA 4BBSB 4JI6Q 3UDXA 4ZLTF 4IALA 1XPUA 1PYSB 1NAPA 4DR5Q 4K0KL 1Y1WB 3VR6A 2E75C 3FKIG 1Q46A 3CHBD 4OWTB 1PA6A 4GKJL 3TSSA 2JA5H 4EQNA 2IX3A 4JK1C 4L6TB 4FO2A 2VUMH 3F2BA 3KLSA 2Q2IA 4UP9A 3HGBA 4IFDG 3D0FA 1AZPA 1EU3A 1VQIA 4LF6L 3I4MG 2ASBA 5IGEA 4LF8L 2RBMA 4K8JA 1K8AC 5IYBH 3W5OA 1K3RA 2K5NA 1PTOH 5KEEA 1ESFA 2KHSA 3S1QB 1Z7TA 3TP7A 4A3JG 2MPMA 2ENBA 4JOIA 2KCCA 3NWTA 2RVLA 3KLRA 3GTGB 2HIXA 5JOBA 5G3LF 4JI8L 1GHJA 3MVVA 5I4DA 4C3HB 2CHBD 3VYRA 1JR0D 4FF2A 1R4PB 1VQNA 1STAA 1LTAD 2AQ3B 3TBIB 4HIOA 4IURA 4DR1L 2CW0C 5AJ3Q 1AZQA 4DN4M 3T16A 3HFZB 1DOLA 3K57A 2R7ZB 1IYJB 3GTOB 5A2QE 4Y7NB 3J81i 1MIUA 2B2WC 3K5LA 1O78A 1WI5A 1HNWQ 2CWPA 2G5DA 5BN3A 1DZ1A 4GZYC 1RJTA 3VDYA 2PZTA 3TP6A 2XWBB 2HQLA 4A3GG 1I4HA 2B2YC 4IZ8A 3J7AF 2L15A 2FMCA 4GNXA 4A3DB 2EYFA 1B3AA 3X3NA 5IWAL 4FXGC 1JICA 1BVSA 3S15H 1O80A 1CKOA 1WTOA 2VUMG 1VMCA 2I07B 3HKZG 1SROA 3GDEA 3PUXA 4GNXB 4JW0A 2JXMB 1W3SA 5C4JB 5JJZA 4DR6Q 2PQAA 2JA7H 1V1PB 4POGA 3BVMA 3OWEB 3C1EA 3P75A 4A3IG 1KHIA 3JAMc 2PQAB 3FVQA 2L9HA 3OTOL 4ZKCB 2NZHA 4A93G 3VR3A 1BR9A 1XPOA 2C9OA 4JI5Q 4KN4C 3GTQH 3E6ZX 1UNSA 3LNNA 3HOWH 2IY5B 3A7LA 1FGUA 1TWFH 3DEPA 3M9BA 4BWGB 5FKAC 2EY2A 3GTMB 2H4OA 2K5QA 1QZHA 2B63H 1I94Q 4EGVA 3OPOA 3JAME 4XIGS 3OMGA 4G7OC 1U0LA 1X56A 3K8AA 5BR8Q 4A76A 2UUAL 1YHQA 5HURA 2B2UC 3I90A 1STGA 1FNVA 1I3QH 2JEBI 1EQVA 3PIOA 3E9IA 4AYBG 1UWVA 1PTOF 3J81L 2HD3A 2KOLA 1GD7A 5C5LA 1Y1VG 1VQ6A 4EQPA 1X3FA 2UUBL 1S5FD 1VQEA 2ZXPA 2BDNA 1EOVA 3C2PA 1TVXA 3HOXH 2F3IA 3WDNA 1S72A 3FEWX 4BBRB 3MEHA 1EFID 3SVMA 1LUZA 2LXJA 3HOUB 2BE5D 2JA7G 2R92G 3RZDB 1A6XA 3GV3A 2Y0SB 4DNIA 1AFPA 1E0BA 1HR0Q 4NXMQ 4HJ9A 2K6AA 2UXBL 1N36L 3RUZA 2NZOA 2M2LA 5M3MB 4ZUIA 4R4OA 3TRZA 2GVBA 1RKNA 1F9SA 1DJRD 4PV1C 1S5ED 2E5LQ 4DV6L 1LTTD 1BCPB 4XTCS 2O5JC 5EGTA 4IJLA 5ELFA 4JBJA 1PH7A 1BF4A 2NWGA 3DHQA 3NE5B 1D1KA 4P72A 1TQOA 1BOSA 2LFNA 3TP5A 1EZ6A 3RN5A 2LSSA 2E8GA 4RGOS 4J8QA 2QEXA 1N9WA 4OO1I 1TR5A 1U5KA 3DLLA 2RHSB 2F3VA 5M5WB 4DV3Q 4KHVA 5FLMH 1STYA 3MAQA 1EQQA 1U4LA 3VYTA 4PZ6A 3Q0AA 4K2KA 4JI6L 1SYDA 1E22A 2B2TC 3DM1A 3I4LA 3F2DA 4AQYL 2RCFA 4FF4A 1V1OA 4LF5Q 1N34L 2HDLA 2Q8IB 3BG3A 3R93A 1SNOA 2K50A 2G9HD 1HCZA 2UU9L 2XSCA 3R8BA 3S1NH 3MFGA 4U673 3H3VH 5JJLA 1B8AA 1LYLA 2D9UA 1HUNA 1H9RA 3ULJA 1HH2P 2NVQH 3CD6A 1W6JA 3UDGA 5I6YA 3SE0A 3RD4A 4XQQA 3VR2A 4YHHQ 4C3JG 4JV5Q 4C2MH 2D5DA 1VQ4A 3I4NH 3PIO3 1VDZA 4IUUA 3N6RA 4HCSA 3I56A 4ME3A 2J0TD 3PUVA 1HNZQ 2R3ZA 1QVCA 1X65A 4HTHA 1OXVA 4Q5VA 3I55A 4BXXG 4V0BA 4L5TA 3C3LA 2F0VA 5ELNA 3S15B 1KTKA 2JEAI 2BA1A 1IKLA 2QCPX 3ULLA 3PUWA 2L55A 4B3SQ 3GQBA 3MXPA 2VQFQ 1IYVA 4G7ZC 1EYCA 1Q90A 1TU2B 5LHY1 3MTSA 4PNYA 1D7QA 4DAYA 3WWVA 2ZTEA 3E5SA 2MHVA 3WOEA 2R93B 3SK5A 3J7YW 3ERQA 1C8CA 1VQDA 4KHZA 4LFAL 1S3OA 2A5HA 3H0GB 2K5HA 4DV1Q 2AHOB 4X66Q 4DAYB 4NW2A 1D8LA 4UDUC 4BS9A 4LJZC 1ONLA 3RLFA 1X54A 3B6YA 2Z6KC 3A0JA 2WB1B 4ABNA 5I6WA 3CC7A 1SMYD 3HOWB 3FMCA 3SEBA 4K8IA 3EJIA 1FGBD 4P71A 5C6AA 4P73A 1WTWA 1EWCA 3KYHC 3VYSA 5CR3A 1OXXK 4X3TA 1IHZA 4DV7L 1I50H 4DGZA 1WTPA 1I3QB 5K5PA 1HXYD 1MSGA 5IYCG 5D14A 1HZAA 4HEDA 1IW7D 3I4NG 5EQ0A 3HKZE 1ZXTA 2MQHA 2F4VL 1TWHB 4R1JA 2A6EC 4K0KQ 1GVPA 4J1MA 3RLOA 2ZJRA 4DV5L 5M3FB 1DOMA 4GKJQ 3HOXB 4JPBW 1PYWD 2VY3A 4XDXA 1VQLA 5C44B 3CMEA 4LF7L 1JJGA 1TS5A 2NUCA 3MXNA 2B2WA 2ZJPA 5BN4A 2YU9H 4LF6Q 1K8GA 4LW1A 2PMZB 4LF8Q 3S2DB 2AMCB 1YEZA 4H13C 3L7ZC 3P7JA 3MXNB 5J3BA 5J1ZA 2JN4A 3KF8A 2B2YA 1LT6D 2D2CC 5KNDA 1LLRD 4XYOA 3ONAB 4JI8Q 1LT5D 3J7AV 4KN7C 1XMOL 3DMUA 2JK8A 2XTIA 1VQCA 2QGQA 2AWNA 5JPMC 4IFDJ 5D65A 1IL8A 5CV5A 4AYBE 4DR1Q 1F2LA 1SXTA 4CGYB 1E1OA 3PCOB 3CF5A 4CKEA 3CCUA 1HA6A 1VF7A 4YCVA 2WAQB 1XMQL 2GA4B 3NTKA 4DK3C 5ELCA 5IP7H 3TMEA 1TWGB 4I65A 1F9PA 2KEEA 2K03A 2VW9A 2NB0A 3D31A 5GAHC 4R8IA 3M4OH 1SN8A 1TWAB 3W1BA 4IO9A 2F0KA 4DK0A 3PF4A 3E3XA 2DY8A 5IGCA 4HAEA 2XRSD 1ZKOA 5IWAQ 1D1IA 2EQSA 2I0QA 4POFA 1II3A 3SGIA 5EKLA 4A4IA 1BCPD 2HUGA 5ELDA 3Q24A 1M1KC 3S14H 2B2UA 1HQMC 5TSSA 1BKBA 3RN2A 4L5QA 4MHEA 2EE1A 2ES2A 5C3EH 4KD3A 1WCMH 4BY7H 2L1BA 3D6CA 1YJWA 3Q22A 1QUQA 2SNSA 4LFBL 1CQFA 1NE3A 2PCFB 3J80L 4JBMA 2N55A 1F2ZA 4CDCC 1YNJC 3VYUA 2JP1A 1Z6HA 2MGSA 3E9HA 2K4KA 1QUQB 3CCLA 4R4TA 4A3EH 5T1GA 4FNFA 4RH6A 1MGSA 2B3GA 1CSQA 1A2TA 5CBEE 4B08A 1PRTF 1LV9A 3PUYA 3S1MH 5C3XA 3W3AA 2A74C 1EZ8A 4RKBA 2KCMA 1MBYA 4C3IH 5JVG3 1I6VC 4CDEC 2NYZD 2OWOA 2PW7A 4DXFA 1VQOA 2RF4A 1LTBD 1EYAA 4JCVE 4JI7L 4JI2L 2RSNA 3R2TA 4GN4B 4TVAB 5IP7G 1KAAA 3MHBA 4PQXA 4DAMA 4NXNL 4HIMA 4NMZA 1EIYB 4X62L 2OXPA 1MKHA 1V8QA 1ICFB 3CRLC 4APVA 4A3FH 4RMFA 1JE4A 4OIKA 1W2BA 4HMIA 1BQQT 2UUBQ 3UI2A 2PNRC 3FKIH 4ZUJA 4H02A 1KLUD 2OEOA 1AE3A 1Z9FA 3FPPA 2F0IA 4FYDA 4C1NI 5T1IA 1CA5A 1DYQA 4F88A 2JQOA 4L5SA 5C3EG 3RZOH 1WCMG 4BY7G 3I91A 4PMCA 3CCSA 4DAPA 4GOPC 2F0GA 4DV4L 5EJWA 1J6QA 2UXBQ 5KIXA 1AH9A 1O7IA 3UE1A 1N36Q 2B2TA 1I50B 3I8ZA 1PH8A 2K5DA 1HTPA 1D5ZC 1IKMA 1VQGA 2PO4A 1JMCA 1GM5A 2RCNA 4A3EG 4O42A 2B29A 1PHJA 1A3VA 1WFQA 1YIJA 4A3KH 4IUTA 1GUNA 1A3TA 4NP5A 2PI2A 4LUVA 1E2WA 4DV6Q 1GKHA 1UE6A 1W6KA 1B53A 4MNOA 3HOYB 4C3IG 3V2TA 4IQZA 2Z8LA 4QB4A 1F77A 1G6PA 2IJ0A 5LMNL 3D6WA 2O4XA 4ALPA 4YCUA 1QILA 2OT2A 4ZRZA 5C4ZA 5IE8A 2Z4HA 2FHTA 5K36H 1EL0A 1NCVA 2L11A 2N8NA 2LMCB 4P74A 3G6EA 4ID6A 4KV6A 3G6JB 4YCWA 5DLQE 1HHVA 1TWCH 4DU9A 2JA8B 1SE3A 5A35A 3EROA 4KY5A 5DEHA 2LKVA 3UDIA 1AEXA 4OO1G 4AQYQ 4BY1G 4A3GH 1N34Q 2K75A 3KUPA 4OELB 4OWWB 2K5VA 3GTJB 2NTTA 2VS1A 3CQZB 4X64L 2UU9Q 1SAPA 1SSOA 3K59A 3M85A 5M5YB 4K14A 3FHWA 2CW0D 3ERSX 2A68C 3L0OA 3K6OA 4IOCA 1PZID 3VA5A 4KJOA 4QUCA 4A3IH 4JYAL 1DONA 1PZJD 3EQLC 2Z6KA 1WD1A 4A93H 5FOBB 4JBWA 5C0XI 5J22A 4NKLA 1KRSA 4A3KG 3S16H 4EQOA 3PO2B 4KY7A 4CBVA 1VQMA 2F0JA 1WYDA 1EYDA 3CCRA 2EOTA 5DNFA 1SNPA 1Q8KA 2F52A 1AN8A 1YITA 5DM73 1S40A 3GTPH 2F1MA 2SNMA 4DAVA 5K36G
chains in the Genus database with same CATH topology
1CFMA 2ZT9C 1EOTA 2QDBA 4TSSA 2EYJA 3SR1A 5CYUA 1KLGD 1F9RA 1BUVT 4C56C 1J9OA 1IYUA 1CHQD 2ICEC 1GUOA 2JE6I 5IGGA 1TY0A 4IN3A 3D8GA 2PZWA 4ZKBB 1LT3D 5EKKA 1K8MA 3SXHA 2E2HB 3ITPA 1T5XD 3DWAA 1EY6A 4R9WA 1TS3A 1QCBD 1PZKD 2E2JB 2F3WA 3GTKB 2JYOA 3DXJC 2WIIB 1LACA 2EJMA 4RHRA 4N9TA 5EBDA 2SOBA 4OGQC 3U9OA 2IX0A 3OOCA 2RDGA 4CJ2C 1SYGA 4RHSA 4XT1B 2KVMA 1ILQA 4H7BA 3NWSA 2TMPA 3I70A 2ID0A 1HQRD 2WV6D 1ENAA 1JWSD 1EU4A 1JWUD 4CKBA 3H3VC 2OF1A 1EWHA 5FK9C 2F0DA 2F0FA 2X69A 1B44D 3K5OA 3I4MB 4N9PA 1OO9B 1M8AA 1I6HB 1OXSC 1RHPA 5JPNC 4A3JB 2XNAC 4DA2A 1TT2A 5IIFA 2B8GA 1DXMA 4IUVA 2DY7A 5CV4A 1CK1A 4KD4A 5BN5A 1U4RA 2MP1A 4NDXA 2FJ2A 1PFMA 2RDFA 3NBIA 3AMUA 3EFXD 1HRJA 1EY9A 1G8ZD 1G2SA 4G57A 1CT1D 4M1UB 1ZYRD 2YYZA 4XYQA 2JA5B 3L9AX 5LL6S 3GP7A 3N52A 4ZK9B 2VUMB 1B50A 3HKZB 1JQYD 3T13A 3NXWA 4I7ZC 2EPBA 3KBGA 1SBBB 4FVMA 4FP5D 3NP8A 1PTOB 2BE5C 2K32A 4A3IB 4K5VA 1RTOA 4DXGA 4G7HC 4CJ1B 1PRTC 4XQNA 3S16B 1VCIA 3TDQA 1DCZA 4R8NA 2HDMA 3K58A 1F2MA 3J81E 3BYYB 1KABA 3G7LA 4P2CB 4ZQ3A 1KDBA 2L0CA 4QUFA 3NTIA 4X3KA 1BNZA 5ELBA 2F0QA 4DK1A 3TN2A 2F0TA 4K5XA 5COYA 5IGFA 2K1BA 3C1FA 1D5MC 4O1NA 3M4YA 1M4VA 5D3IB 4XT3B 1RDPD 1LO5D 1RD9D 2F0PA 3S9WA 1MI2A 1STBA 5HGTA 2JA7B 2PQEA 2R92B 4RA8A 2NVXB 1CI3M 5J39A 1BXTA 1CM9A 5IODA 1FNWA 3A8IE 4KK7A 2PYKA 3D4DA 4RWSC 2EXZA 3RMHA 5IGBA 1GHKA 1XTCD 3SHLA 2WKCA 3T56B 3Q23A 1QG7A 3GTQB 3V05A 3ND8A 2A6ED 1TWFB 1I4XA 2F0NA 2AUKA 2B63B 2A69C 2N88A 3OWFA 1H9KA 2M00A 3L3OC 1J8IA 4Q0FA 3BYTB 1Y8NB 1EIGA 4X3SA 4ME5A 2ZXRA 4QCLA 3QJYA 1Q3LA 4B9WA 1LTID 3OMCA 2K01A 4OHJA 1HFNA 5G3LD 1EIHA 2V4DA 1S5CD 3BDLA 5JEAJ 3BDCA 1ILPA 2KCNA 2A6HC 3IKJA 4U68A 5FO8B 2NN6I 1HFGA 2EYPA 4C3JB 1QJOA 1SNQA 5CV6A 1OXUA 3IL8A 3M7GA 2KJXA 3NSWA 4FXDA 5C0XG 2CQAA 1X32A 2D62A 2K28A 1H9SA 2F4IA 3FDTA 1H9JA 2BOSA 2PZUA 1EEID 2QF7A 2B39A 2LS01 1RTNA 1H9SB 5IGDA 3P20A 1O7YA 2B2VC 4DNTB 2ICIA 1YNJD 3LX0A 2QKIC 1Y69U 3MXGA 1G291 1PDQA 4KI0A 1PXUA 1A2UA 1SNMA 3HZXA 1FR3A 4ODGA 2XRQD 3V96A 2X6LA 2E74C 3S1NB 4CHTB 2VNUD 1C48A 3NK9A 5IT9L 1JCKB 4YIJA 1G6ZA 3H6MA 2NVQB 4RKLA 4RCNA 1PTOD 4C2MB 4Z9CB 3DEOA 4V190 1LTRD 2MJ8A 3H91A 3I4NB 1E2VA 3ND9A 1HTLD 1YNNC 3EA6A 4FF3A 3W2DA 3AB9A 3BVGA 2KEDA 2J4XA 1L0XB 4K5WA 5FLXL 2FINB 3QG1A 5EPKA 1UUPA 4KTAA 3DWPA 1BCPC 5JEAH 1WTRA 2NVYB 4CJ0B 1UEAB 5CV9A 4ULLA 5KYLA 1WTXA 3NQTA 3NHHA 1TS2A 1SJHD 3NBHA 4OO1H 2WKDA 3IAYA 1F9QA 4M8AA 3URYA 4BA1I 3ZYYX 1ICWA 1HPCA 4C3HG 1EEFD 1FYCA 5CMDA 4IUPA 5CV7A 1QWYA 2EVBA 4HCEA 2RA4A 4KKUA 2H1EA 3K5MA 5KGUA 4QMGA 1PRTB 1ZEQX 1LTGD 3BDOA 1XXGA 3T53B 3LWUA 1VF5C 3J80E 4QIWB 4F8MA 3CRKC 3A8KE 2F0EA 2RKSA 2YU9B 5KRUA 1SNCA 2F0SA 1WD0A 2F0MA 5DM63 2XVSA 5A2QL 3SK6A 5JEAG 3DUZA 2VB2X 3D4WA 1WTVA 1JOKA 3HEJA 1SEBD 1I4PA 1ML0D 4OL7A 3HS0C 2DNEA 2Z4IA 5I2YA 5LL6X 4KKTA 3NQIA 4KMUC 3H09A 3QOLA 1ENFA 1CZGA 3U9SA 1DOKA 1MD2D 4HR7B 1CQVA 1JOOA 5AFWA 2SEBD 3TZUA 1GOZA 2Q8RE 2BDOA 5C4HA 1CA6A 3M4OB 2VB3X 4KKSA 3OIQA 1CTMA 3VR4A 5FO9B 2XIWA 3S14B 2WINB 3JAML 1QNUA 1L0YB 4DF7A 5C3EB 1HA5A 1WCMB 1NUCA 4BY7B 1I4RA 5CORA 1STNA 3EVQA 1D5XC 2F0UA 3H94A 2LY7A 1FD7D 3MWYW 4A3EB 2IWHA 4HSVA 5DAUA 5E3FA 3S1MB 2NN6H 2K7VA 4C3IB 4B9XA 3WOFA 1QB5D 3QO2A 3PV0A 2AQ1B 1PFBA 2KUMA 1SDFA 1QE6A 2C5CA 4G4KA 5CBAE 1V1PA 1BO0A 4A3FB 3QIAA 5CC4A 3A7AB 3MZ5A 3A56A 4K2LA 5C5MA 3X3MA 4BY1B 3FKIB 4LMQD 3OIPA 2BA0A 5M5XB 3MA2B 2EJFC 2DNCA 1AP0A 3NPPA 3RZOB 4WJWA 2B2VA 2K33A 3BZDB 3M7NA 2E76C 2X6GA 1BCPF 2K05A 3BS1A 4QF4A 3GO5A 1D2BA 3FRPB 1STEA 4A3KB 2HCCA 1NR4A 1D6EC 1KDAA 2NN6G 1SYEA 2EY6A 1O7ZA 1NR2A 3MFYA 3GTLB 1TY2A 1H9MA 4WRDA 3D3RA 1T5EA 1NSNS 3VA7A 2AUJD 2HCIA 3SK4A 2TSSA 3NTHA 1GJXA 1R4QB 1EY0A 1SYCA 5E1FA 1TWCB 4FXKC 1EY8A 1OXTA 2NTSA 4TQUS 5C0XJ 3K5NA 2QILA 5ISRA 2M9VA 4A3GB 1B4OA 3HG9A 1I4QA 1PRTD 4HMJA 2F03A 3Q6SA 3I73A 3QWNA 1EY5A 2IPKD 1BDOA 2FFKB 5ELEA 4RFBA 3T4AC 3NUCA 1AW7A 2MUYA 4DFAA 1Q1EA 3OSOA 2L4NA 1KNEA 4X3UA 3PUZA 4L8JA 4A93B 1S5BD 1GUSA 1DD2A 2EDGA 1B2TA 3F2UA 1G91A 3I3CA 3O13A 2NBFA 1I4GA 3TP8A 1ZYRC 1XWEA 2QEJC 4EVOA 2K5WA 3GTPB 1TS4A 3SDZA 4KY6A 4IFDI 2R61A 2SDFA 1Q1BA 1Z47A 4H0LC 4AYBB 2I46A 4UAIA 3VR5A 4J6HA 1Y1VB 4XXEA 3KLSX 3SK8A 1GUWA 3GD7A 1JB3A 1FNUA 1R9TB 5I2XA 4K6LA 5I9PA 1V43A 1RODA 3CKIB 2BCOA 5EPLA 5KNBA 4F7XA 4PMWA 2J7ZA 1EQTA 2A69D 2Q8TA 3OHXC 1ENCA 1S5DD 3R3OA 3S1RB 4CKCA 4F87A 4A3BB 3LWEA 5EBCA 2EYLA 2F0OA 2RQXA 5C0XH 1LT4D 3PIP3 1RCVD 4TKOB 4TRDA 1JORA 5KYIA 1UAPA 1C4QA 2AQ2B 3HOZB 5C4XB 1A3UA 2A6HD 1SNDA 4IUNA 2K04A 3PO3B 2E2IB 1XYIA 5JVH3 2IW3A 5E4XA 5I9OA 3S2HB 2F0WA 2L5TA 1SE2A 4RCOA 2WACA 1S4ZA 5CGKA 5JAVA 2O5IC 1ET9A 5NUCA 1STHA 1SMYC 1VMPA 1E2ZA 2EYOA 3HRZC 1X3PA 4MN3A 2NZ1D 3DWQA 3K0YA 4IUQA 2PW5A 2XN9C 1SE4A 5M9OA 1G2TA 3MC0B 1XX8A 3AU7A 1PMRA 3D4RA 2ZXOA 5D3DA 4HSPA 5C3WA 4RGTA 1IW7C 3CU7A 4ZAIA 1K8OA 3HOVB 4ZYSA 5KNCA 4XQJA 2A73B 1EY4A 2KECA 4MIUA 1ESRA 3BVZA 3GV6A 4PMBA 4RAUC 2FMMA 4RGNA 1Q8IA 4OIJA 2AWOA 5F2DA 2XWJB 1TIID 1EY7A 2E2DC 2EYMA 4LK1C 4WORA 1YNND 2RDHA 1K83B 1U4MA 1U4PA 3HP3A 3TZDA 1SJED 2G9DA 2VXWA 1GUGA 3A55A 1LABA 4DNRB 5EPJA 1Y8PB 1KDCA 2EZVA 4L63B 4S3SA 1LTSD 5IOCA 3MXUA 4ILWA 3QB3A 4C1NK 2Z1CA 5E4WC 2KA7A 3IFDA 1ET6A 5EKIA 3M3YB 1SYBA 1BBXC 2F0LA 2PPBC 1WVLA 3C46A 5FO7B 1B1ZA 2HQEA 1GXDC 1JOQA 4RGMA 2IT1A 1TKWB 3T51B 1KNAA 1PLFA 1Q12A 1SFOB 3FPUB 2CVRA 1QNKA 3A8JE 1A15A 1GUTA 1PTOC 2IX1A 4FF1A 1B9MA 3QOJA 1DM0B 1HUMA 2EYHA 3A54A 4HN7A 3KBXA 1F2YA 1B9NA 1SYFA 3E0JA 3P1HA 3KK7A 1MSHA 2DN8A 2F0HA 4WFN3 4E6IA 4KJNA 1QOHA 2EY5A 5IT9E 2JA6B 1Y8OB 4BA2I 4IFDH 2WP8J 1PFNA 4A3MB 2JSOA 1O7LA 2B8FA 3OW7A 2IL8A 3S17B 3I72A 1JC7A 1X3QA 1JWMD 3R2IA 1RF2D 2EJGC 5CV8A 2A68D 2O2LD 2NVTB 2KQ3A 2L12A 2R6GA 3PMFA 5FLXE 1CHPD 4LAAA 3IFTA 1CZWA 3K7AB 1WTQA 4H44C 2EY1A 2RSOA 4K6DA 1U9RA 4BBSB 4ZLTF 4IALA 1NAPA 1Y1WB 3VR6A 2E75C 3CHBD 3TSSA 4EQNA 2IX3A 4JK1C 4L6TB 4FO2A 3KLSA 3HGBA 4IFDG 1AZPA 1EU3A 5IGEA 2RBMA 4K8JA 1PTOH 5KEEA 1ESFA 2KHSA 3S1QB 3TP7A 1Z7TA 2MPMA 2ENBA 2KCCA 3NWTA 2RVLA 3KLRA 3GTGB 5JOBA 5G3LF 5I4DA 1GHJA 3MVVA 4C3HB 2CHBD 3VYRA 1JR0D 4FF2A 1R4PB 1STAA 1LTAD 2AQ3B 3TBIB 4IURA 2CW0C 1AZQA 4DN4M 3T16A 1DOLA 3K57A 2R7ZB 3GTOB 5A2QE 4Y7NB 2B2WC 3K5LA 1O78A 5BN3A 1DZ1A 4GZYC 1RJTA 2PZTA 3TP6A 2XWBB 1I4HA 2B2YC 4IZ8A 3J7AF 2FMCA 4A3DB 2EYFA 1B3AA 3X3NA 4FXGC 1JICA 1O80A 1WTOA 1VMCA 2I07B 3PUXA 2JXMB 5C4JB 5JJZA 1V1PB 3BVMA 3OWEB 3C1EA 3P75A 3FVQA 2L9HA 4ZKCB 3VR3A 1BR9A 2C9OA 4KN4C 3E6ZX 1UNSA 3LNNA 3A7LA 3DEPA 4BWGB 5FKAC 2EY2A 3GTMB 2H4OA 2K5QA 4EGVA 3OPOA 3JAME 4XIGS 3OMGA 4G7OC 5HURA 2B2UC 3I90A 1STGA 1FNVA 2JEBI 1EQVA 1PTOF 3J81L 2KOLA 5C5LA 4EQPA 1S5FD 2ZXPA 2BDNA 3C2PA 1TVXA 3WDNA 3FEWX 4BBRB 3MEHA 1EFID 3SVMA 3HOUB 2BE5D 3RZDB 1A6XA 3GV3A 2Y0SB 1AFPA 1E0BA 2K6AA 3RUZA 2M2LA 5M3MB 4ZUIA 1RKNA 1F9SA 1DJRD 4PV1C 1S5ED 1LTTD 1BCPB 4XTCS 2O5JC 5EGTA 5ELFA 1BF4A 2NWGA 3DHQA 3NE5B 1D1KA 1TQOA 1BOSA 2LFNA 3TP5A 1EZ6A 4RGOS 4J8QA 4OO1I 1TR5A 2F3VA 5M5WB 4KHVA 1STYA 3MAQA 1U4LA 3VYTA 3Q0AA 4K2KA 1SYDA 2B2TC 3I4LA 3DM1A 4FF4A 1V1OA 2HDLA 2Q8IB 3BG3A 3R93A 1SNOA 2G9HD 1HCZA 2XSCA 3R8BA 3MFGA 4U673 2D9UA 1HUNA 1H9RA 1W6JA 5I6YA 3SE0A 3RD4A 4XQQA 3VR2A 4C3JG 2D5DA 3PIO3 1VDZA 4IUUA 3N6RA 4HCSA 2J0TD 3PUVA 2R3ZA 4HTHA 1OXVA 4Q5VA 4V0BA 3C3LA 2F0VA 3S15B 1KTKA 2JEAI 2BA1A 1IKLA 2QCPX 3PUWA 2L55A 3GQBA 3MXPA 1IYVA 4G7ZC 1EYCA 1Q90A 1TU2B 5LHY1 3MTSA 4PNYA 4DAYA 3E5SA 2MHVA 3WOEA 2R93B 3SK5A 3J7YW 3ERQA 1C8CA 4KHZA 2A5HA 3H0GB 4NW2A 4UDUC 4BS9A 4LJZC 1ONLA 3RLFA 2WB1B 4ABNA 5I6WA 1SMYD 3HOWB 3FMCA 3SEBA 4K8IA 3EJIA 1FGBD 5C6AA 1WTWA 1EWCA 3VYSA 5CR3A 1OXXK 4X3TA 1IHZA 4DGZA 1WTPA 1I3QB 5K5PA 1HXYD 1MSGA 5D14A 4HEDA 1IW7D 5EQ0A 1ZXTA 1TWHB 2A6EC 4J1MA 5M3FB 1DOMA 3HOXB 1PYWD 4XDXA 5C44B 1TS5A 2NUCA 3MXNA 2B2WA 5BN4A 2PMZB 3S2DB 4H13C 3L7ZC 3P7JA 5J1ZA 3KF8A 2B2YA 1LT6D 2D2CC 5KNDA 1LLRD 4XYOA 3ONAB 1LT5D 3J7AV 4KN7C 3DMUA 2AWNA 5JPMC 4IFDJ 5D65A 1IL8A 5CV5A 1F2LA 1SXTA 4CGYB 4CKEA 1HA6A 1VF7A 2WAQB 2GA4B 3NTKA 5ELCA 3TMEA 1TWGB 4I65A 1F9PA 2KEEA 2K03A 2NB0A 3D31A 4R8IA 1TWAB 2F0KA 4DK0A 2DY8A 5IGCA 4HAEA 2XRSD 1ZKOA 1D1IA 1II3A 5EKLA 1BCPD 2HUGA 5ELDA 3Q24A 2B2UA 1HQMC 5TSSA 4MHEA 2EE1A 4KD3A 2L1BA 3D6CA 3Q22A 2SNSA 1CQFA 2PCFB 3J80L 2N55A 1F2ZA 1YNJC 3VYUA 2JP1A 1Z6HA 2MGSA 5T1GA 4FNFA 4RH6A 1MGSA 1A2TA 5CBEE 4B08A 1PRTF 1LV9A 3PUYA 5C3XA 3W3AA 2A74C 1EZ8A 4RKBA 1MBYA 5JVG3 1I6VC 2NYZD 2PW7A 4DXFA 1LTBD 1EYAA 2RSNA 3R2TA 1KAAA 3MHBA 4PQXA 4NMZA 2OXPA 1V8QA 3CRLC 1JE4A 4OIKA 4HMIA 1BQQT 3UI2A 2PNRC 4ZUJA 1KLUD 2OEOA 3FPPA 2F0IA 4FYDA 4C1NI 5T1IA 1CA5A 1DYQA 4F88A 3I91A 4PMCA 4DAPA 2F0GA 5EJWA 5KIXA 2B2TA 1I50B 3I8ZA 2K5DA 1HTPA 1D5ZC 1IKMA 2PO4A 4O42A 1A3VA 4IUTA 1GUNA 1A3TA 4NP5A 1E2WA 1W6KA 1B53A 3HOYB 4C3IG 3V2TA 4IQZA 2Z8LA 4QB4A 1F77A 2IJ0A 3D6WA 2O4XA 1QILA 2OT2A 4ZRZA 5C4ZA 2Z4HA 2FHTA 5K36H 1EL0A 1NCVA 2L11A 2LMCB 4ID6A 4KV6A 3G6JB 1HHVA 4DU9A 2JA8B 1SE3A 5A35A 3EROA 4KY5A 5DEHA 2LKVA 1AEXA 4OO1G 3KUPA 3GTJB 2NTTA 3CQZB 1SAPA 1SSOA 3K59A 3M85A 5M5YB 4K14A 2CW0D 2A68C 3K6OA 1PZID 3VA5A 4KJOA 4QUCA 1DONA 1PZJD 3EQLC 1WD1A 5FOBB 4JBWA 5C0XI 5J22A 4NKLA 4EQOA 3PO2B 4KY7A 4CBVA 2F0JA 1EYDA 2EOTA 5DNFA 1SNPA 1AN8A 5DM73 5K36G 2F1MA 2SNMA 4DAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQT A;  3QB3 A;  5CGK A;  5KIX A;  2QDB A;  3NHH A;  4EVO A;  5JAV A;  2F0P A;  4KD4 A;  5EGT A;  5C4H A;  3S9W A;  2F0K A;  5I6W A;  2EYJ A;  5NUC A;  4NDX A;  1STH A;  4KY6 A;  3SR1 A;  1STB A;  1SYB A;  5IGC A;  5HGT A;  2EY1 A;  3DHQ A;  2EYO A;  2F0L A;  2PQE A;  4QF4 A;  1A3V A;  2RDF A;  4K6D A;  1TQO A;  3C1E A;  4K8I A;  3TP5 A;  1A3T A;  1U9R A;  3P75 A;  2PZU A;  1EZ6 A;  4NP5 A;  4J6H A;  5J39 A;  1II3 A;  3EJI A;  5C6A A;  5EKL A;  2PW5 A;  5IOD A;  4IAL A;  5M9O A;  1EY9 A;  1TR5 A;  2HQE A;  2PYK A;  5IGD A;  1KDA A;  5CR3 A;  3V2T A;  3D4D A;  1SYE A;  2F3V A;  3D8G A;  2EY6 A;  4G57 A;  2PZW A;  4QB4 A;  2EXZ A;  3SK8 A;  1IHZ A;  2O4X A;  4KHV A;  5CV7 A;  1STY A;  4KD3 A;  4DGZ A;  5EKK A;  5IGB A;  5K5P A;  4EQN A;  3D6C A;  3SHL A;  3SXH A;  4DF7 A;  5C3W A;  5C4Z A;  2SNS A;  4K2K A;  1NUC A;  1SYD A;  1JOQ A;  4WRD A;  3ITP A;  5I9P A;  1F2Z A;  3LX0 A;  1STN A;  4ID6 A;  2EY2 A;  3EVQ A;  4KV6 A;  1EY6 A;  1SNO A;  2F0N A;  3T13 A;  4J1M A;  1NSN S;  2F0U A;  3NXW A;  1A2U A;  4F7X A;  5KGU A;  4QMG A;  5IGE A;  1SNM A;  2RBM A;  3OMG A;  3QOJ A;  3HZX A;  4K8J A;  4ODG A;  3SK4 A;  4DU9 A;  2F3W A;  1EY0 A;  1SYC A;  3ERO A;  4KY5 A;  1EY4 A;  1A2T A;  2EYH A;  5DEH A;  5KEE A;  5E1F A;  2KHS A;  2LKV A;  3OWF A;  1F2Y A;  3NP8 A;  1EY8 A;  1AEX A;  3TP7 A;  4MIU A;  5DAU A;  2ENB A;  2M00 A;  4F8M A;  5C3X A;  1ENC A;  5HUR A;  1STG A;  1EZ8 A;  4N9T A;  1SYF A;  1EQV A;  2SOB A;  2NUC A;  3NK9 A;  4K5V A;  4RKB A;  3R3O A;  5E3F A;  3U9O A;  5ISR A;  5IGG A;  4PMB A;  3P1H A;  4YIJ A;  2F0E A;  5JOB A;  2RKS A;  2EYL A;  3MVV A;  1SYG A;  3H6M A;  5C5L A;  4B9X A;  1SNC A;  4RKL A;  2F0S A;  2PW7 A;  2F0H A;  4H7B A;  5I6Y A;  4EQP A;  5KRU A;  2F0M A;  1EYA A;  4HMJ A;  4ME5 A;  5J1Z A;  5F2D A;  2F0O A;  4K14 A;  4E6I A;  1EY5 A;  3SK6 A;  4B9W A;  1STA A;  4KJN A;  4R8N A;  1ENA A;  3OMC A;  1KAA A;  3MHB A;  1EY7 A;  3NUC A;  4NMZ A;  2EY5 A;  4DFA A;  1F2M A;  2OF1 A;  3D4W A;  3MEH A;  2OXP A;  1KAB A;  2EYM A;  2F0D A;  2F0F A;  3OSO A;  3VA5 A;  4HTH A;  4KJO A;  4TRD A;  4WOR A;  1JOR A;  1JOK A;  3T16 A;  3BDL A;  5KYI A;  4ZQ3 A;  2F0V A;  1KDB A;  3HEJ A;  4N9P A;  3DMU A;  4HMI A;  5CC4 A;  4OL7 A;  5J22 A;  4NKL A;  3MZ5 A;  5CV5 A;  4ZUJ A;  4K2L A;  3MXP A;  5C5M A;  1A3U A;  2OEO A;  4K5W A;  3BDC A;  4EQO A;  1EYC A;  4KY7 A;  2F0Q A;  4PNY A;  1SND A;  4IUN A;  2F0T A;  3E5S A;  2F0J A;  2F0I A;  2PZT A;  3RUZ A;  3SK5 A;  1TT2 A;  4K5X A;  3TP6 A;  3ERQ A;  1EYD A;  3QOL A;  5IIF A;  1KDC A;  5IGF A;  5CV8 A;  3C1F A;  4IZ8 A;  4KTA A;  4ZUI A;  1SNP A;  5I9O A;  2EYF A;  2EYP A;  2KQ3 A;  1JOO A;  1RKN A;  2F0W A;  3TME A;  4I65 A;  4S3S A;  4PMC A;  5CV4 A;  3PMF A;  3TP8 A;  2SNM A;  5CV9 A;  5IOC A;  5KYL A;  1SNQ A;  5CV6 A;  2F0G A;  4LAA A;  2WAC A; 
#chains in the Genus database with same CATH topology
 1CFM A;  2ZT9 C;  1EOT A;  2QDB A;  4TSS A;  2EYJ A;  3SR1 A;  5CYU A;  4LFA Q;  1KLG D;  1F9R A;  3HOU G;  1BUV T;  4C56 C;  1XPR A;  1J9O A;  3J81 j;  1IYU A;  1CHQ D;  2ICE C;  3JC6 6;  2R7F A;  4Y52 H;  2MO0 A;  1Y1V H;  1GUO A;  3J7A 5;  1CUK A;  4LNQ A;  3I2Z A;  2JE6 I;  4YY3 L;  5IGG A;  1TY0 A;  4IN3 A;  3D8G A;  1PH4 A;  2PZW A;  4ZKB B;  1LT3 D;  5EKK A;  1R9T H;  1K8M A;  3SXH A;  2E2H B;  3ITP A;  2R92 H;  1T5X D;  2NVX H;  3DWA A;  1EY6 A;  4R9W A;  1TS3 A;  1QCB D;  4DV7 Q;  1PZK D;  2E2J B;  2F3W A;  3G48 A;  4QIW E;  2Q2H A;  3GTK B;  4GLV B;  1KQS A;  2JYO A;  3DXJ C;  4JC0 A;  2WII B;  1LAC A;  2EJM A;  3S1R H;  4A3B H;  4RHR A;  4N9T A;  5EBD A;  2SOB A;  4OGQ C;  1OTC A;  2Z9H A;  3U9O A;  2F4V Q;  2IX0 A;  1SE8 A;  3OOC A;  1CKM A;  2RDG A;  4CJ2 C;  2MNA A;  4DV5 Q;  1L1O C;  1SYG A;  4RHS A;  4XT1 B;  2KVM A;  1ILQ A;  4H7B A;  4DUY L;  3NWS A;  2TMP A;  3I70 A;  2ID0 A;  1HQR D;  1EQR A;  4DV0 L;  3AQQ A;  2WV6 D;  1ENA A;  3CCJ A;  1JWS D;  4LF7 Q;  1EU4 A;  1JWU D;  4CKB A;  3H3V C;  2OF1 A;  1EWH A;  5FK9 C;  3U58 A;  4CDF C;  1RIP A;  2F0D A;  2F0F A;  1YJ9 A;  2X69 A;  1B44 D;  3K5O A;  3I4M B;  4N9P A;  1OO9 B;  1M8A A;  1I6H B;  2P5Z X;  3QR8 A;  1OXS C;  1RHP A;  5JPN C;  4A3J B;  4GLX A;  4JI3 L;  4A3L H;  4ZCK A;  2XNA C;  4DA2 A;  3ICE A;  1TT2 A;  4DR4 L;  1XMO Q;  5IIF A;  3S2H H;  2B8G A;  4LFC L;  1E3P A;  1DXM A;  4IUV A;  1A0I A;  2DY7 A;  5CV4 A;  1IBM L;  1CK1 A;  4KD4 A;  5BN5 A;  1JE5 A;  1U4R A;  2MP1 A;  4NDX A;  2FJ2 A;  1SR3 A;  1XMQ Q;  1N32 L;  1PFM A;  2CKZ B;  2RDF A;  1IBL L;  3NBI A;  3AMU A;  3EFX D;  1L0W A;  3Q8D A;  4C3J H;  4A3B G;  4QQB X;  3FP9 A;  1WOC A;  1HRJ A;  1EY9 A;  1G8Z D;  4LF4 L;  1G2S A;  4G57 A;  1FL0 A;  1CT1 D;  4M1U B;  1ZYR D;  2YYZ A;  4XYQ A;  4HJ8 A;  4BXX H;  2JA5 B;  4LUO A;  3H0G G;  3L9A X;  3HOV H;  5IY0 A;  5LL6 S;  5FJ8 H;  1EFW A;  3GP7 A;  3N52 A;  4ZK9 B;  2VUM B;  1B50 A;  4EQ5 A;  1X6O A;  3HKZ B;  1JQY D;  3T13 A;  5ELO A;  3NXW A;  4I7Z C;  3HKS A;  3HOZ G;  2EPB A;  3KBG A;  3J81 c;  1SBB B;  4FVM A;  4LFB Q;  4FP5 D;  3NP8 A;  3F2C A;  5C4X G;  1PTO B;  2BE5 C;  2K32 A;  4A3I B;  4DKA C;  4K5V A;  1RTO A;  4DXG A;  4A3L G;  4GN3 B;  3PO3 G;  3TQY A;  4G7H C;  4CJ1 B;  1PRT C;  4XQN A;  3S16 B;  1VCI A;  2A8V A;  4MZ9 A;  3TDQ A;  1DCZ A;  4R8N A;  2ALY B;  2HDM A;  3DM3 A;  3K58 A;  1F2M A;  3J81 E;  3BYY B;  1KAB A;  1X3E A;  3G7L A;  1QZG A;  3K7U C;  5IP9 H;  4GOP A;  4P2C B;  4ZQ3 A;  1K83 H;  1KDB A;  4JI7 Q;  4JI2 Q;  1K9M C;  3M4P A;  2L0C A;  4LF9 L;  4QUF A;  3NTI A;  4NXN Q;  1UE5 A;  2YV5 A;  4GOP B;  4X3K A;  4X62 Q;  1BNZ A;  5ELB A;  2F0Q A;  4DK1 A;  3TN2 A;  5C44 G;  2HHH L;  2F0T A;  5IYC H;  4K5X A;  5COY A;  1MHW C;  5IGF A;  2K1B A;  3C1F A;  1D5M C;  4O1N A;  2CCZ A;  3CPW A;  3M4Y A;  1Q7Y C;  1K0R A;  1M4V A;  5D3I B;  4XT3 B;  3HOV G;  1RDP D;  1LO5 D;  5FJ8 G;  1RD9 D;  2F0P A;  3M3Y H;  3S9W A;  1MI2 A;  1STB A;  1X9N A;  5HGT A;  1SLJ A;  2JA7 B;  2PQE A;  2R92 B;  4RA8 A;  2NVX B;  4IPH A;  4FDB A;  1CI3 M;  5J39 A;  1BXT A;  4DV4 Q;  2NVY H;  1CM9 A;  5IOD A;  1FNW A;  3A8I E;  2A1A A;  4KK7 A;  2PYK A;  3D4D A;  4RWS C;  1J5E L;  2EXZ A;  3RMH A;  1LM0 A;  4JBK A;  2A19 A;  5IGB A;  1GHK A;  1XTC D;  3SHL A;  2WKC A;  3T56 B;  3AFP A;  4UHV A;  1YJN A;  3Q23 A;  1QG7 A;  3GTQ B;  3V05 A;  3ND8 A;  1IZ6 A;  2A6E D;  1TWF B;  1I4X A;  1UEB A;  2F0N A;  2AUK A;  5LMN Q;  2B63 B;  5IP9 G;  2ZJQ A;  2A69 C;  1VQB A;  2N88 A;  3OWF A;  1H9K A;  1VQP A;  2M00 A;  2YTY A;  3L3O C;  4B3T L;  2Y0S E;  4JI0 L;  1J8I A;  4Q0F A;  5HGQ A;  3BYT B;  1VQ8 A;  4B3M L;  1Y8N B;  4DUZ L;  1NNX A;  1EIG A;  4X3S A;  4IPG A;  2UXD L;  4ME5 A;  1KXL A;  2QDL A;  2ZXR A;  4QCL A;  3QJY A;  1Q3L A;  4B9W A;  4HJ5 A;  2JA6 H;  1LTI D;  3OMC A;  2K01 A;  4OHJ A;  1HFN A;  5G3L D;  1EIH A;  5EAY A;  2V4D A;  4A3M H;  2QA4 A;  4X64 Q;  1C0A A;  1BBW A;  4DR2 L;  4HID A;  3EIV A;  1S5C D;  3BDL A;  1MJC A;  2GVA A;  3S17 H;  3J7Z C;  5JEA J;  4PZ7 A;  3BDC A;  1ILP A;  3LGJ A;  2EIF A;  3L2P A;  2KCN A;  2A6H C;  1MJE A;  3IKJ A;  4JYA Q;  4U68 A;  5FO8 B;  2KHJ A;  1L2F A;  2NN6 I;  1HFG A;  2EYP A;  4C3J B;  2KBN A;  4JG2 A;  1QJO A;  3KF8 B;  1SNQ A;  5CV6 A;  4NB3 A;  1PH6 A;  1OXU A;  1K28 A;  2ZTC A;  3IL8 A;  3M7G A;  2KJX A;  3NSW A;  4FXD A;  3K7A H;  1X55 A;  5C0X G;  2CQA A;  1X32 A;  2D62 A;  2K28 A;  1I5F A;  2OQK A;  1KL9 A;  1FVI A;  1H9S A;  2F4I A;  3FDT A;  1H9J A;  2BOS A;  4BBS H;  1PV4 A;  2PZU A;  4DK6 C;  1EEI D;  2QF7 A;  2B39 A;  2LS0 1;  1RTN A;  1H9S B;  5IGD A;  3P20 A;  1O7Y A;  2B2V C;  1L1O A;  1PH9 A;  4DNT B;  2ICI A;  1YNJ D;  3U4V A;  2JA6 G;  3LX0 A;  2QKI C;  1Y69 U;  3MXG A;  4YY3 Q;  1G29 1;  1PDQ A;  4KI0 A;  1PXU A;  1L1O B;  4A3M G;  1A2U A;  1KC8 C;  1SNM A;  3HZX A;  1FR3 A;  4ODG A;  2N78 A;  3S1Q H;  2XRQ D;  3V96 A;  2X6L A;  4QGU A;  2E74 C;  1HNX L;  3S1N B;  4CHT B;  2VNU D;  3GTG H;  4AH6 A;  1C48 A;  3NK9 A;  5GRO A;  3STB C;  5IT9 L;  2HT1 A;  1JCK B;  4YIJ A;  1G6Z A;  3H6M A;  2AKW B;  2NVQ B;  1YHB A;  4RKL A;  1KD1 C;  2BH2 A;  4RCN A;  1TXY A;  1PTO D;  4C2M B;  4Z9C B;  3DEO A;  4V19 0;  1LTR D;  1B70 B;  2MJ8 A;  3H91 A;  3I4N B;  4IPD A;  4QJF A;  1E2V A;  3K80 C;  3ND9 A;  3GTO H;  4DUY Q;  1HTL D;  1YNN C;  3EA6 A;  1XTD A;  1YI2 A;  4DV0 Q;  4FF3 A;  3W2D A;  3AB9 A;  3BVG A;  3G4S A;  2KED A;  2JA8 G;  4BBS G;  2J4X A;  1L0X B;  4K5W A;  3CCE A;  3EBE A;  5FLX L;  2FIN B;  1P8L A;  1Y1W G;  3QG1 A;  1WJJ A;  5EPK A;  1UUP A;  4A3D H;  4KTA A;  4UP8 A;  4DV2 L;  1PH5 A;  2JJQ A;  3DWP A;  1HR0 W;  1BCP C;  4JI1 L;  1SMX A;  2NVY B;  5JEA H;  1WTR A;  4LWC A;  1IBK L;  4CJ0 B;  1UEA B;  4JI3 Q;  5CV9 A;  4ULL A;  5KYL A;  1WTX A;  1SRU A;  3NQT A;  2PNH A;  1TS2 A;  1SJH D;  3NHH A;  5C4J H;  3NBH A;  4OO1 H;  4DR4 Q;  2WKD A;  4BY1 H;  4LFC Q;  3IAY A;  1F9Q A;  4M8A A;  3URY A;  1IBM Q;  5M5X H;  4BA1 I;  3ZYY X;  1ICW A;  2KCT A;  4OEM B;  1HPC A;  4C3H G;  1EEF D;  3J80 c;  1N32 Q;  1ASY A;  1FYC A;  5CMD A;  4IUP A;  5CV7 A;  4YWL A;  3OYY A;  1QWY A;  1IBL Q;  3H15 A;  2EVB A;  1DGS A;  4HCE A;  1Y14 B;  2RA4 A;  3AYH B;  4KKU A;  4LF4 Q;  2H1E A;  3K5M A;  2UUC L;  5KGU A;  2CFM A;  1Q86 C;  2R7Z G;  4QMG A;  4EX5 A;  3E0E A;  1PRT B;  2K52 A;  1ZEQ X;  3TS2 A;  1LTG D;  3BDO A;  1XXG A;  3T53 B;  3LWU A;  1VF5 C;  3J80 E;  4UY8 C;  4QIW B;  2N3S A;  4AIM A;  4F8M A;  3JAM i;  3CRK C;  4YWK A;  3GTL H;  3A8K E;  2F0E A;  2RKS A;  2I5H A;  1WTH A;  2YU9 B;  5KRU A;  1SNC A;  2F0S A;  1WD0 A;  2F0M A;  3CAM A;  4A3D G;  5DM6 3;  2XVS A;  2WAQ E;  5A2Q L;  1N33 L;  3SK6 A;  5JEA G;  1NMG A;  3DUZ A;  2VB2 X;  2Q2U A;  1C7Y A;  2DJG C;  3HOU H;  3D4W A;  1VS0 A;  5IYD G;  4GLA C;  1WTV A;  1JOK A;  1VQ7 A;  3HEJ A;  1SEB D;  3AEV A;  3PF5 A;  1I4P A;  1ML0 D;  3IRB A;  4OL7 A;  1T9H A;  1E7Z A;  3HS0 C;  4KLK A;  2DNE A;  2CH4 W;  2Z4I A;  5I2Y A;  5LL6 X;  4KKT A;  3NQI A;  4KMU C;  3H09 A;  3QOL A;  1ENF A;  1CZG A;  3U9S A;  1DOK A;  1MD2 D;  4HR7 B;  1CQV A;  1JOO A;  3KOJ A;  4LF9 Q;  4A3C G;  3S24 A;  5AFW A;  4DR7 L;  2SEB D;  4HJA A;  3TZU A;  1GOZ A;  2HHH Q;  2Q8R E;  2BDO A;  1XNR L;  1HZ9 A;  5C4H A;  1CA6 A;  3NEN A;  1Q82 C;  3M4O B;  2VB3 X;  4KKS A;  2EXD A;  2XGT A;  3TS0 A;  3OIQ A;  1CTM A;  3VR4 A;  4B3R L;  5FO9 B;  5M5W H;  2XIW A;  4A75 A;  5LMN W;  1ASZ A;  4GKK L;  3S14 B;  2WIN B;  4IOA A;  3JAM L;  1P16 A;  1QNU A;  1L0Y B;  2YTX A;  4DF7 A;  3BU2 A;  5C3E B;  1HA5 A;  5LMU L;  1WCM B;  1NUC A;  4BY7 B;  3RR5 A;  4BBR G;  1I4R A;  1NBW A;  5COR A;  4X65 L;  1STN A;  1NTG A;  3EVQ A;  1D5X C;  1KRT A;  2ZM6 L;  1J5E Q;  2F0U A;  3H94 A;  2LY7 A;  1FD7 D;  3T1Y L;  2Y0S G;  3MWY W;  4A3E B;  2IWH A;  3A5Z B;  4HSV A;  5DAU A;  3PSI A;  4DR3 L;  2CQO A;  1JJC B;  1VQA A;  5E3F A;  3S1M B;  1A63 A;  4KHP L;  2NN6 H;  5M3M G;  2K7V A;  4C3I B;  2D0P A;  4B9X A;  3WOF A;  1QB5 D;  3QO2 A;  4LUZ A;  3I7F A;  3PV0 A;  2MO1 A;  2AQ1 B;  1PFB A;  2KUM A;  1SDF A;  5H1S E;  4WJ3 M;  4B3T Q;  1XNQ L;  2LXK A;  4JI0 Q;  1QE6 A;  2C5C A;  1HZB A;  3CPF A;  4L5R C;  5JJI A;  3BZC A;  2JA5 G;  4B3M Q;  4DUZ Q;  2OTL A;  1K0S A;  4G4K A;  5CBA E;  2UXD Q;  1V1P A;  1BO0 A;  2D0O A;  4A3F B;  3QIA A;  1X3G A;  1VQ5 A;  5CC4 A;  1HJP A;  1KAW A;  3A7A B;  3MZ5 A;  3A56 A;  4K2L A;  4OX9 L;  5C5M A;  3X3M A;  4BY1 B;  3FKI B;  2R93 H;  5IYB G;  3RLN A;  4LMQ D;  3OIP A;  4DR2 Q;  2BA0 A;  3H0G H;  5M5X B;  2FXQ A;  2QW7 A;  3MA2 B;  2PI2 E;  1EYG A;  1N8R C;  2EJF C;  2UXC L;  2DNC A;  1AP0 A;  3NPP A;  4HIK A;  4WJW A;  3RZO B;  3HOZ H;  2B2V A;  1YBY A;  2K33 A;  3UE0 A;  4R4Q A;  3BZD B;  3M7N A;  3T1H L;  2E76 C;  2X6G A;  5C4X H;  4X6A H;  4N8X 1;  4PZ8 A;  1BCP F;  1HZC A;  2K05 A;  3KDF A;  3BS1 A;  1H95 A;  3PO3 H;  4QF4 A;  2VZA A;  3KJP A;  3GO5 A;  4GN5 A;  2E2I H;  1D2B A;  3FRP B;  1STE A;  2OQ0 A;  2HCC A;  2KHI A;  3NEM A;  4A3K B;  1NR4 A;  3KDF B;  1D6E C;  1KDA A;  2NN6 G;  1SYE A;  2EY6 A;  5GQO A;  3PQI A;  2CWA A;  1O7Z A;  1NR2 A;  1UE1 A;  3MFY A;  3CCQ A;  3GTL B;  1TY2 A;  1H9M A;  4WRD A;  1TWH H;  3D3R A;  4CDD C;  1PFS A;  5M3F H;  1T5E A;  5E7N A;  1NSN S;  3VA7 A;  2AUJ D;  2HCI A;  3SK4 A;  2TSS A;  3NTH A;  1GJX A;  1R4Q B;  1EY0 A;  1SYC A;  5C44 H;  4MTN A;  1TWC B;  4FXK C;  5E1F A;  3ULP A;  1EY8 A;  1OXT A;  2NTS A;  4TQU S;  5C0X J;  3K5N A;  2QIL A;  5ISR A;  2M9V A;  4A3G B;  2R93 G;  1B4O A;  3HG9 A;  3S2D H;  1I4Q A;  3PIP A;  1QVF A;  1PRT D;  3I4O A;  1FJG L;  4HMJ A;  3CCV A;  2F03 A;  3Q6S A;  1HNX Q;  2C35 B;  3I73 A;  3QWN A;  2Z0S A;  1C9O A;  4UPA A;  1EY5 A;  2IPK D;  1BDO A;  4JVZ A;  2FFK B;  2OTJ A;  5ELE A;  4RFB A;  3T4A C;  3NUC A;  2HIV A;  1AW7 A;  2MUY A;  4DFA A;  4MTK A;  3CXC A;  1Q1E A;  2WB1 G;  4JI4 L;  3OSO A;  1V1Q A;  2L4N A;  1KNE A;  2N49 A;  3HOW G;  4X3U A;  3PUZ A;  4GS3 A;  2B63 G;  1V9P A;  4L8J A;  4A93 B;  1S5B D;  1GUS A;  1M90 C;  1DD2 A;  2EDG A;  3KF6 A;  1B2T A;  3F2U A;  3U50 C;  1G91 A;  1TWG H;  2I5L X;  3I3C A;  3TEH B;  3O13 A;  1JT8 A;  2NBF A;  1I4G A;  2WFW A;  3KF6 B;  3TP8 A;  2VQE L;  1QVG A;  1TWA H;  3PGZ A;  1ZYR C;  5GAG C;  1XWE A;  2QEJ C;  4EVO A;  2K5W A;  3GTP B;  1TS4 A;  4DR5 L;  4DPG A;  3SDZ A;  5M3F G;  4KY6 A;  3HOX G;  4O0A A;  4DV2 Q;  4IFD I;  4OWX B;  2R61 A;  4JI1 Q;  2SDF A;  1Q1B A;  1IBK Q;  1IL2 A;  1Z47 A;  4H0L C;  4AYB B;  4R4C A;  2I46 A;  4UAI A;  3VR5 A;  1A62 A;  4J6H A;  4HJ7 A;  1Y1V B;  4XXE A;  3TRE A;  3KLS X;  3SK8 A;  1GUW A;  3GD7 A;  1JB3 A;  1FNU A;  1R9T B;  5I2X A;  4IJH A;  4K6L A;  5I9P A;  3MEF A;  1V43 A;  1ROD A;  3CKI B;  2BCO A;  5EPL A;  1JJ2 A;  5KNB A;  4F7X A;  1E24 A;  2DJF C;  2IHF A;  1B3Q A;  4PMW A;  2J7Z A;  1EQT A;  2A69 D;  4WJ4 A;  4NPS A;  2Q8T A;  3OHX C;  1ENC A;  1S5D D;  2RHQ B;  3AFQ A;  1YVC A;  2Q2T A;  3R3O A;  3S1R B;  4CKC A;  4F87 A;  5AJ3 L;  4A3B B;  3LWE A;  2UUC Q;  5EBC A;  4IPC A;  1SFO H;  1VQK A;  2EYL A;  2WAQ G;  1E1T A;  2BH8 A;  3RNU A;  4YWM A;  2F0O A;  2RQX A;  1YNX A;  3CW2 C;  5C0X H;  1LT4 D;  3K81 C;  1HNW L;  2OCE A;  5FLM G;  2YTV A;  3PIP 3;  1RCV D;  4TKO B;  4TRD A;  1JOR A;  5KYI A;  1UAP A;  2IHE A;  1JB7 A;  1PVO A;  4JOI C;  1C4Q A;  2AQ2 B;  4UP7 A;  3HOZ B;  1N33 Q;  1Q81 C;  5C4X B;  4N8F A;  1A3U A;  2A6H D;  3BJU A;  1VQF A;  1SND A;  4IUN A;  2K04 A;  3PO3 B;  2E2I B;  4OXP A;  4DR6 L;  1XYI A;  5JVH 3;  2IW3 A;  5E4X A;  5I9O A;  3S2H B;  2F0W A;  2L5T A;  3W1G A;  1SE2 A;  1GO3 E;  4RCO A;  2WAC A;  1S4Z A;  5CGK A;  5JAV A;  4I7A A;  5GAE C;  5HY6 A;  2O5I C;  1ET9 A;  5NUC A;  1STH A;  1AE2 A;  3CC2 A;  1SMY C;  1VMP A;  1E2Z A;  1B7Y B;  1NY4 A;  2EYO A;  3HRZ C;  1X3P A;  4MN3 A;  4JI5 L;  2NZ1 D;  1UE7 A;  3DWQ A;  4DR7 Q;  3K0Y A;  3HOY H;  4IUQ A;  2NVT H;  2PW5 A;  3A5U A;  2XN9 C;  1SE4 A;  5M9O A;  1XNR Q;  4GNX C;  1G2T A;  1I94 L;  3MC0 B;  1XX8 A;  3AU7 A;  3EN2 A;  1PMR A;  3D4R A;  2ZXO A;  5D3D A;  3CCM A;  4HSP A;  5C3W A;  3J80 i;  5BR8 L;  4RGT A;  4B3R Q;  4O2D A;  1IW7 C;  1YZ6 A;  3CU7 A;  4ZAI A;  1VQH A;  3OW2 A;  1K8O A;  3HOV B;  4ZYS A;  4GKK Q;  5KNC A;  4XQJ A;  3U4Z A;  2JA8 H;  3A74 A;  2A73 B;  2DUD A;  1RL2 A;  5LMU Q;  1EY4 A;  1Y1W H;  2KEC A;  4MIU A;  1K3B C;  1ESR A;  3BVZ A;  3GTJ H;  4X65 Q;  2JA9 A;  3STB D;  3CQZ H;  4QL5 A;  3CC4 A;  3GV6 A;  4PMB A;  2ZM6 Q;  4RAU C;  2FMM A;  4RGN A;  1Q8I A;  3T1Y Q;  5M5Y H;  4OIJ A;  2AWO A;  5F2D A;  3CP0 A;  2XWJ B;  4DR3 Q;  1TII D;  1EY7 A;  1EUJ A;  1EWI A;  2E2D C;  3ZJY C;  4KHP Q;  1YHA A;  2EYM A;  1HR0 L;  4LK1 C;  4NXM L;  2I5M X;  1VQJ A;  1PH3 A;  4WOR A;  1PH1 A;  1YNN D;  3UDF A;  2RDH A;  3KJO A;  4P75 A;  1K83 B;  1U4M A;  1U4P A;  1XNQ Q;  3HP3 A;  4C3H H;  3PO2 H;  3TZD A;  5JJK A;  4R4I A;  1SJE D;  2G9D A;  2VXW A;  1GUG A;  2E5L L;  3A55 A;  1LAB A;  4DNR B;  3HOY G;  5EPJ A;  1Y8P B;  1KDC A;  2EZV A;  4L63 B;  3K0X A;  2CH4 A;  3BZK A;  1EIF A;  4S3S A;  2R7Z H;  4OX9 Q;  2R7D A;  1LTS D;  3M4Q A;  5IOC A;  2WB1 E;  3MXU A;  4ILW A;  4Y7N H;  3QB3 A;  4C1N K;  2Z1C A;  5E4W C;  1BBU A;  2KA7 A;  3IFD A;  3OTO Q;  1ET6 A;  5EKI A;  3M3Y B;  1SYB A;  4DV3 L;  1VQ9 A;  1BBX C;  3KFU A;  2F0L A;  3G71 A;  1A8V A;  2PPB C;  2UXC Q;  2K14 A;  1WVL A;  2DGY A;  3C46 A;  5FO7 B;  1B1Z A;  4LF5 L;  3T1H Q;  3KLW A;  4PG3 A;  2HQE A;  1GXD C;  1JOQ A;  4RGM A;  2IT1 A;  5GAD C;  5IYD H;  1TKW B;  3T51 B;  1KNA A;  2E2H H;  1NMF A;  1PLF A;  1Q12 A;  2VL6 A;  1SFO B;  3FPU B;  2CVR A;  1QNK A;  3A8J E;  2UUA Q;  1A15 A;  1GUT A;  1PYB A;  1PTO C;  2E2J H;  3NBH B;  2IX1 A;  4FF1 A;  1B9M A;  3GTK H;  1IXR A;  3QOJ A;  1DM0 B;  1HUM A;  5IT9 c;  4YHH L;  1NJI C;  2EYH A;  4JV5 L;  3A54 A;  3NEL A;  4HN7 A;  3KBX A;  1F2Y A;  4OON A;  1B9N A;  1K73 C;  3PO2 G;  1SYF A;  3E0J A;  2PMZ E;  1CKN A;  1PH2 A;  3P1H A;  1HNZ L;  4A3C H;  3KK7 A;  1MSH A;  2DN8 A;  2F0H A;  3GTM H;  4WFN 3;  1CKN B;  4E6I A;  1XJV A;  4KJN A;  4B3S L;  1QOH A;  2EY5 A;  2VQF L;  5IT9 E;  1Y8O B;  2JA6 B;  4BA2 I;  4IFD H;  2WP8 J;  3I4M H;  2KEN A;  1LTL A;  2ATW A;  1PFN A;  1I6H H;  4A3M B;  1FJG Q;  2JSO A;  5FLX c;  1O7L A;  2GN5 A;  1KIX A;  3OW7 A;  2B8F A;  4DV1 L;  4A3J H;  2IL8 A;  3S17 B;  3ER0 A;  4QY7 A;  4X66 L;  3I72 A;  1JC7 A;  1CSP A;  1X3Q A;  1JWM D;  3F1Z A;  3R2I A;  4JI4 Q;  1RF2 D;  3H3V I;  2EJG C;  4BBR H;  4RG1 A;  5CV8 A;  2A68 D;  2O2L D;  2NVT B;  2KQ3 A;  2L12 A;  2R6G A;  3PMF A;  5FLX E;  3RZD H;  1CHP D;  2V1C C;  3F8T A;  4LAA A;  3IFT A;  1CZW A;  2ZTD A;  3CMA A;  4J15 A;  2H5X A;  3K7A B;  1WTQ A;  4H44 C;  2EY1 A;  5L37 A;  2RSO A;  4K6D A;  5M3M H;  2VQE Q;  1U9R A;  4A3F G;  1G51 A;  2MFI A;  2Z6B A;  4BBS B;  4JI6 Q;  3UDX A;  4ZLT F;  4IAL A;  1XPU A;  1PYS B;  1NAP A;  4DR5 Q;  4K0K L;  1Y1W B;  3VR6 A;  2E75 C;  3FKI G;  1Q46 A;  3CHB D;  4OWT B;  1PA6 A;  4GKJ L;  3TSS A;  2JA5 H;  4EQN A;  2IX3 A;  4JK1 C;  4L6T B;  4FO2 A;  2VUM H;  3F2B A;  3KLS A;  2Q2I A;  4UP9 A;  3HGB A;  4IFD G;  3D0F A;  1AZP A;  1EU3 A;  1VQI A;  4LF6 L;  3I4M G;  2ASB A;  5IGE A;  4LF8 L;  2RBM A;  4K8J A;  1K8A C;  5IYB H;  3W5O A;  1K3R A;  2K5N A;  1PTO H;  5KEE A;  1ESF A;  2KHS A;  3S1Q B;  1Z7T A;  3TP7 A;  4A3J G;  2MPM A;  2ENB A;  4JOI A;  2KCC A;  3NWT A;  2RVL A;  3KLR A;  3GTG B;  2HIX A;  5JOB A;  5G3L F;  4JI8 L;  1GHJ A;  3MVV A;  5I4D A;  4C3H B;  2CHB D;  3VYR A;  1JR0 D;  4FF2 A;  1R4P B;  1VQN A;  1STA A;  1LTA D;  2AQ3 B;  3TBI B;  4HIO A;  4IUR A;  4DR1 L;  2CW0 C;  5AJ3 Q;  1AZQ A;  4DN4 M;  3T16 A;  3HFZ B;  1DOL A;  3K57 A;  2R7Z B;  1IYJ B;  3GTO B;  5A2Q E;  4Y7N B;  3J81 i;  1MIU A;  2B2W C;  3K5L A;  1O78 A;  1WI5 A;  1HNW Q;  2CWP A;  2G5D A;  5BN3 A;  1DZ1 A;  4GZY C;  1RJT A;  3VDY A;  2PZT A;  3TP6 A;  2XWB B;  2HQL A;  4A3G G;  1I4H A;  2B2Y C;  4IZ8 A;  3J7A F;  2L15 A;  2FMC A;  4GNX A;  4A3D B;  2EYF A;  1B3A A;  3X3N A;  5IWA L;  4FXG C;  1JIC A;  1BVS A;  3S15 H;  1O80 A;  1CKO A;  1WTO A;  2VUM G;  1VMC A;  2I07 B;  3HKZ G;  1SRO A;  3GDE A;  3PUX A;  4GNX B;  4JW0 A;  2JXM B;  1W3S A;  5C4J B;  5JJZ A;  4DR6 Q;  2PQA A;  2JA7 H;  1V1P B;  4POG A;  3BVM A;  3OWE B;  3C1E A;  3P75 A;  4A3I G;  1KHI A;  3JAM c;  2PQA B;  3FVQ A;  2L9H A;  3OTO L;  4ZKC B;  2NZH A;  4A93 G;  3VR3 A;  1BR9 A;  1XPO A;  2C9O A;  4JI5 Q;  4KN4 C;  3GTQ H;  3E6Z X;  1UNS A;  3LNN A;  3HOW H;  2IY5 B;  3A7L A;  1FGU A;  1TWF H;  3DEP A;  3M9B A;  4BWG B;  5FKA C;  2EY2 A;  3GTM B;  2H4O A;  2K5Q A;  1QZH A;  2B63 H;  1I94 Q;  4EGV A;  3OPO A;  3JAM E;  4XIG S;  3OMG A;  4G7O C;  1U0L A;  1X56 A;  3K8A A;  5BR8 Q;  4A76 A;  2UUA L;  1YHQ A;  5HUR A;  2B2U C;  3I90 A;  1STG A;  1FNV A;  1I3Q H;  2JEB I;  1EQV A;  3PIO A;  3E9I A;  4AYB G;  1UWV A;  1PTO F;  3J81 L;  2HD3 A;  2KOL A;  1GD7 A;  5C5L A;  1Y1V G;  1VQ6 A;  4EQP A;  1X3F A;  2UUB L;  1S5F D;  1VQE A;  2ZXP A;  2BDN A;  1EOV A;  3C2P A;  1TVX A;  3HOX H;  2F3I A;  3WDN A;  1S72 A;  3FEW X;  4BBR B;  3MEH A;  1EFI D;  3SVM A;  1LUZ A;  2LXJ A;  3HOU B;  2BE5 D;  2JA7 G;  2R92 G;  3RZD B;  1A6X A;  3GV3 A;  2Y0S B;  4DNI A;  1AFP A;  1E0B A;  1HR0 Q;  4NXM Q;  4HJ9 A;  2K6A A;  2UXB L;  1N36 L;  3RUZ A;  2NZO A;  2M2L A;  5M3M B;  4ZUI A;  4R4O A;  3TRZ A;  2GVB A;  1RKN A;  1F9S A;  1DJR D;  4PV1 C;  1S5E D;  2E5L Q;  4DV6 L;  1LTT D;  1BCP B;  4XTC S;  2O5J C;  5EGT A;  4IJL A;  5ELF A;  4JBJ A;  1PH7 A;  1BF4 A;  2NWG A;  3DHQ A;  3NE5 B;  1D1K A;  4P72 A;  1TQO A;  1BOS A;  2LFN A;  3TP5 A;  1EZ6 A;  3RN5 A;  2LSS A;  2E8G A;  4RGO S;  4J8Q A;  2QEX A;  1N9W A;  4OO1 I;  1TR5 A;  1U5K A;  3DLL A;  2RHS B;  2F3V A;  5M5W B;  4DV3 Q;  4KHV A;  5FLM H;  1STY A;  3MAQ A;  1EQQ A;  1U4L A;  3VYT A;  4PZ6 A;  3Q0A A;  4K2K A;  4JI6 L;  1SYD A;  1E22 A;  2B2T C;  3DM1 A;  3I4L A;  3F2D A;  4AQY L;  2RCF A;  4FF4 A;  1V1O A;  4LF5 Q;  1N34 L;  2HDL A;  2Q8I B;  3BG3 A;  3R93 A;  1SNO A;  2K50 A;  2G9H D;  1HCZ A;  2UU9 L;  2XSC A;  3R8B A;  3S1N H;  3MFG A;  4U67 3;  3H3V H;  5JJL A;  1B8A A;  1LYL A;  2D9U A;  1HUN A;  1H9R A;  3ULJ A;  1HH2 P;  2NVQ H;  3CD6 A;  1W6J A;  3UDG A;  5I6Y A;  3SE0 A;  3RD4 A;  4XQQ A;  3VR2 A;  4YHH Q;  4C3J G;  4JV5 Q;  4C2M H;  2D5D A;  1VQ4 A;  3I4N H;  3PIO 3;  1VDZ A;  4IUU A;  3N6R A;  4HCS A;  3I56 A;  4ME3 A;  2J0T D;  3PUV A;  1HNZ Q;  2R3Z A;  1QVC A;  1X65 A;  4HTH A;  1OXV A;  4Q5V A;  3I55 A;  4BXX G;  4V0B A;  4L5T A;  3C3L A;  2F0V A;  5ELN A;  3S15 B;  1KTK A;  2JEA I;  2BA1 A;  1IKL A;  2QCP X;  3ULL A;  3PUW A;  2L55 A;  4B3S Q;  3GQB A;  3MXP A;  2VQF Q;  1IYV A;  4G7Z C;  1EYC A;  1Q90 A;  1TU2 B;  5LHY 1;  3MTS A;  4PNY A;  1D7Q A;  4DAY A;  3WWV A;  2ZTE A;  3E5S A;  2MHV A;  3WOE A;  2R93 B;  3SK5 A;  3J7Y W;  3ERQ A;  1C8C A;  1VQD A;  4KHZ A;  4LFA L;  1S3O A;  2A5H A;  3H0G B;  2K5H A;  4DV1 Q;  2AHO B;  4X66 Q;  4DAY B;  4NW2 A;  1D8L A;  4UDU C;  4BS9 A;  4LJZ C;  1ONL A;  3RLF A;  1X54 A;  3B6Y A;  2Z6K C;  3A0J A;  2WB1 B;  4ABN A;  5I6W A;  3CC7 A;  1SMY D;  3HOW B;  3FMC A;  3SEB A;  4K8I A;  3EJI A;  1FGB D;  4P71 A;  5C6A A;  4P73 A;  1WTW A;  1EWC A;  3KYH C;  3VYS A;  5CR3 A;  1OXX K;  4X3T A;  1IHZ A;  4DV7 L;  1I50 H;  4DGZ A;  1WTP A;  1I3Q B;  5K5P A;  1HXY D;  1MSG A;  5IYC G;  5D14 A;  1HZA A;  4HED A;  1IW7 D;  3I4N G;  5EQ0 A;  3HKZ E;  1ZXT A;  2MQH A;  2F4V L;  1TWH B;  4R1J A;  2A6E C;  4K0K Q;  1GVP A;  4J1M A;  3RLO A;  2ZJR A;  4DV5 L;  5M3F B;  1DOM A;  4GKJ Q;  3HOX B;  4JPB W;  1PYW D;  2VY3 A;  4XDX A;  1VQL A;  5C44 B;  3CME A;  4LF7 L;  1JJG A;  1TS5 A;  2NUC A;  3MXN A;  2B2W A;  2ZJP A;  5BN4 A;  2YU9 H;  4LF6 Q;  1K8G A;  4LW1 A;  2PMZ B;  4LF8 Q;  3S2D B;  2AMC B;  1YEZ A;  4H13 C;  3L7Z C;  3P7J A;  3MXN B;  5J3B A;  5J1Z A;  2JN4 A;  3KF8 A;  2B2Y A;  1LT6 D;  2D2C C;  5KND A;  1LLR D;  4XYO A;  3ONA B;  4JI8 Q;  1LT5 D;  3J7A V;  4KN7 C;  1XMO L;  3DMU A;  2JK8 A;  2XTI A;  1VQC A;  2QGQ A;  2AWN A;  5JPM C;  4IFD J;  5D65 A;  1IL8 A;  5CV5 A;  4AYB E;  4DR1 Q;  1F2L A;  1SXT A;  4CGY B;  1E1O A;  3PCO B;  3CF5 A;  4CKE A;  3CCU A;  1HA6 A;  1VF7 A;  4YCV A;  2WAQ B;  1XMQ L;  2GA4 B;  3NTK A;  4DK3 C;  5ELC A;  5IP7 H;  3TME A;  1TWG B;  4I65 A;  1F9P A;  2KEE A;  2K03 A;  2VW9 A;  2NB0 A;  3D31 A;  5GAH C;  4R8I A;  3M4O H;  1SN8 A;  1TWA B;  3W1B A;  4IO9 A;  2F0K A;  4DK0 A;  3PF4 A;  3E3X A;  2DY8 A;  5IGC A;  4HAE A;  2XRS D;  1ZKO A;  5IWA Q;  1D1I A;  2EQS A;  2I0Q A;  4POF A;  1II3 A;  3SGI A;  5EKL A;  4A4I A;  1BCP D;  2HUG A;  5ELD A;  3Q24 A;  1M1K C;  3S14 H;  2B2U A;  1HQM C;  5TSS A;  1BKB A;  3RN2 A;  4L5Q A;  4MHE A;  2EE1 A;  2ES2 A;  5C3E H;  4KD3 A;  1WCM H;  4BY7 H;  2L1B A;  3D6C A;  1YJW A;  3Q22 A;  1QUQ A;  2SNS A;  4LFB L;  1CQF A;  1NE3 A;  2PCF B;  3J80 L;  4JBM A;  2N55 A;  1F2Z A;  4CDC C;  1YNJ C;  3VYU A;  2JP1 A;  1Z6H A;  2MGS A;  3E9H A;  2K4K A;  1QUQ B;  3CCL A;  4R4T A;  4A3E H;  5T1G A;  4FNF A;  4RH6 A;  1MGS A;  2B3G A;  1CSQ A;  1A2T A;  5CBE E;  4B08 A;  1PRT F;  1LV9 A;  3PUY A;  3S1M H;  5C3X A;  3W3A A;  2A74 C;  1EZ8 A;  4RKB A;  2KCM A;  1MBY A;  4C3I H;  5JVG 3;  1I6V C;  4CDE C;  2NYZ D;  2OWO A;  2PW7 A;  4DXF A;  1VQO A;  2RF4 A;  1LTB D;  1EYA A;  4JCV E;  4JI7 L;  4JI2 L;  2RSN A;  3R2T A;  4GN4 B;  4TVA B;  5IP7 G;  1KAA A;  3MHB A;  4PQX A;  4DAM A;  4NXN L;  4HIM A;  4NMZ A;  1EIY B;  4X62 L;  2OXP A;  1MKH A;  1V8Q A;  1ICF B;  3CRL C;  4APV A;  4A3F H;  4RMF A;  1JE4 A;  4OIK A;  1W2B A;  4HMI A;  1BQQ T;  2UUB Q;  3UI2 A;  2PNR C;  3FKI H;  4ZUJ A;  4H02 A;  1KLU D;  2OEO A;  1AE3 A;  1Z9F A;  3FPP A;  2F0I A;  4FYD A;  4C1N I;  5T1I A;  1CA5 A;  1DYQ A;  4F88 A;  2JQO A;  4L5S A;  5C3E G;  3RZO H;  1WCM G;  4BY7 G;  3I91 A;  4PMC A;  3CCS A;  4DAP A;  4GOP C;  2F0G A;  4DV4 L;  5EJW A;  1J6Q A;  2UXB Q;  5KIX A;  1AH9 A;  1O7I A;  3UE1 A;  1N36 Q;  2B2T A;  1I50 B;  3I8Z A;  1PH8 A;  2K5D A;  1HTP A;  1D5Z C;  1IKM A;  1VQG A;  2PO4 A;  1JMC A;  1GM5 A;  2RCN A;  4A3E G;  4O42 A;  2B29 A;  1PHJ A;  1A3V A;  1WFQ A;  1YIJ A;  4A3K H;  4IUT A;  1GUN A;  1A3T A;  4NP5 A;  2PI2 A;  4LUV A;  1E2W A;  4DV6 Q;  1GKH A;  1UE6 A;  1W6K A;  1B53 A;  4MNO A;  3HOY B;  4C3I G;  3V2T A;  4IQZ A;  2Z8L A;  4QB4 A;  1F77 A;  1G6P A;  2IJ0 A;  5LMN L;  3D6W A;  2O4X A;  4ALP A;  4YCU A;  1QIL A;  2OT2 A;  4ZRZ A;  5C4Z A;  5IE8 A;  2Z4H A;  2FHT A;  5K36 H;  1EL0 A;  1NCV A;  2L11 A;  2N8N A;  2LMC B;  4P74 A;  3G6E A;  4ID6 A;  4KV6 A;  3G6J B;  4YCW A;  5DLQ E;  1HHV A;  1TWC H;  4DU9 A;  2JA8 B;  1SE3 A;  5A35 A;  3ERO A;  4KY5 A;  5DEH A;  2LKV A;  3UDI A;  1AEX A;  4OO1 G;  4AQY Q;  4BY1 G;  4A3G H;  1N34 Q;  2K75 A;  3KUP A;  4OEL B;  4OWW B;  2K5V A;  3GTJ B;  2NTT A;  2VS1 A;  3CQZ B;  4X64 L;  2UU9 Q;  1SAP A;  1SSO A;  3K59 A;  3M85 A;  5M5Y B;  4K14 A;  3FHW A;  2CW0 D;  3ERS X;  2A68 C;  3L0O A;  3K6O A;  4IOC A;  1PZI D;  3VA5 A;  4KJO A;  4QUC A;  4A3I H;  4JYA L;  1DON A;  1PZJ D;  3EQL C;  2Z6K A;  1WD1 A;  4A93 H;  5FOB B;  4JBW A;  5C0X I;  5J22 A;  4NKL A;  1KRS A;  4A3K G;  3S16 H;  4EQO A;  3PO2 B;  4KY7 A;  4CBV A;  1VQM A;  2F0J A;  1WYD A;  1EYD A;  3CCR A;  2EOT A;  5DNF A;  1SNP A;  1Q8K A;  2F52 A;  1AN8 A;  1YIT A;  5DM7 3;  1S40 A;  3GTP H;  2F1M A;  2SNM A;  4DAV A;  5K36 G; 
#chains in the Genus database with same CATH homology
 1CFM A;  2ZT9 C;  1EOT A;  2QDB A;  4TSS A;  2EYJ A;  3SR1 A;  5CYU A;  1KLG D;  1F9R A;  1BUV T;  4C56 C;  1J9O A;  1IYU A;  1CHQ D;  2ICE C;  1GUO A;  2JE6 I;  5IGG A;  1TY0 A;  4IN3 A;  3D8G A;  2PZW A;  4ZKB B;  1LT3 D;  5EKK A;  1K8M A;  3SXH A;  2E2H B;  3ITP A;  1T5X D;  3DWA A;  1EY6 A;  4R9W A;  1TS3 A;  1QCB D;  1PZK D;  2E2J B;  2F3W A;  3GTK B;  2JYO A;  3DXJ C;  2WII B;  1LAC A;  2EJM A;  4RHR A;  4N9T A;  5EBD A;  2SOB A;  4OGQ C;  3U9O A;  2IX0 A;  3OOC A;  2RDG A;  4CJ2 C;  1SYG A;  4RHS A;  4XT1 B;  2KVM A;  1ILQ A;  4H7B A;  3NWS A;  2TMP A;  3I70 A;  2ID0 A;  1HQR D;  2WV6 D;  1ENA A;  1JWS D;  1EU4 A;  1JWU D;  4CKB A;  3H3V C;  2OF1 A;  1EWH A;  5FK9 C;  2F0D A;  2F0F A;  2X69 A;  1B44 D;  3K5O A;  3I4M B;  4N9P A;  1OO9 B;  1M8A A;  1I6H B;  1OXS C;  1RHP A;  5JPN C;  4A3J B;  2XNA C;  4DA2 A;  1TT2 A;  5IIF A;  2B8G A;  1DXM A;  4IUV A;  2DY7 A;  5CV4 A;  1CK1 A;  4KD4 A;  5BN5 A;  1U4R A;  2MP1 A;  4NDX A;  2FJ2 A;  1PFM A;  2RDF A;  3NBI A;  3AMU A;  3EFX D;  1HRJ A;  1EY9 A;  1G8Z D;  1G2S A;  4G57 A;  1CT1 D;  4M1U B;  1ZYR D;  2YYZ A;  4XYQ A;  2JA5 B;  3L9A X;  5LL6 S;  3GP7 A;  3N52 A;  4ZK9 B;  2VUM B;  1B50 A;  3HKZ B;  1JQY D;  3T13 A;  3NXW A;  4I7Z C;  2EPB A;  3KBG A;  1SBB B;  4FVM A;  4FP5 D;  3NP8 A;  1PTO B;  2BE5 C;  2K32 A;  4A3I B;  4K5V A;  1RTO A;  4DXG A;  4G7H C;  4CJ1 B;  1PRT C;  4XQN A;  3S16 B;  1VCI A;  3TDQ A;  1DCZ A;  4R8N A;  2HDM A;  3K58 A;  1F2M A;  3J81 E;  3BYY B;  1KAB A;  3G7L A;  4P2C B;  4ZQ3 A;  1KDB A;  2L0C A;  4QUF A;  3NTI A;  4X3K A;  1BNZ A;  5ELB A;  2F0Q A;  4DK1 A;  3TN2 A;  2F0T A;  4K5X A;  5COY A;  5IGF A;  2K1B A;  3C1F A;  1D5M C;  4O1N A;  3M4Y A;  1M4V A;  5D3I B;  4XT3 B;  1RDP D;  1LO5 D;  1RD9 D;  2F0P A;  3S9W A;  1MI2 A;  1STB A;  5HGT A;  2JA7 B;  2PQE A;  2R92 B;  4RA8 A;  2NVX B;  1CI3 M;  5J39 A;  1BXT A;  1CM9 A;  5IOD A;  1FNW A;  3A8I E;  4KK7 A;  2PYK A;  3D4D A;  4RWS C;  2EXZ A;  3RMH A;  5IGB A;  1GHK A;  1XTC D;  3SHL A;  2WKC A;  3T56 B;  3Q23 A;  1QG7 A;  3GTQ B;  3V05 A;  3ND8 A;  2A6E D;  1TWF B;  1I4X A;  2F0N A;  2AUK A;  2B63 B;  2A69 C;  2N88 A;  3OWF A;  1H9K A;  2M00 A;  3L3O C;  1J8I A;  4Q0F A;  3BYT B;  1Y8N B;  1EIG A;  4X3S A;  4ME5 A;  2ZXR A;  4QCL A;  3QJY A;  1Q3L A;  4B9W A;  1LTI D;  3OMC A;  2K01 A;  4OHJ A;  1HFN A;  5G3L D;  1EIH A;  2V4D A;  1S5C D;  3BDL A;  5JEA J;  3BDC A;  1ILP A;  2KCN A;  2A6H C;  3IKJ A;  4U68 A;  5FO8 B;  2NN6 I;  1HFG A;  2EYP A;  4C3J B;  1QJO A;  1SNQ A;  5CV6 A;  1OXU A;  3IL8 A;  3M7G A;  2KJX A;  3NSW A;  4FXD A;  5C0X G;  2CQA A;  1X32 A;  2D62 A;  2K28 A;  1H9S A;  2F4I A;  3FDT A;  1H9J A;  2BOS A;  2PZU A;  1EEI D;  2QF7 A;  2B39 A;  2LS0 1;  1RTN A;  1H9S B;  5IGD A;  3P20 A;  1O7Y A;  2B2V C;  4DNT B;  2ICI A;  1YNJ D;  3LX0 A;  2QKI C;  1Y69 U;  3MXG A;  1G29 1;  1PDQ A;  4KI0 A;  1PXU A;  1A2U A;  1SNM A;  3HZX A;  1FR3 A;  4ODG A;  2XRQ D;  3V96 A;  2X6L A;  2E74 C;  3S1N B;  4CHT B;  2VNU D;  1C48 A;  3NK9 A;  5IT9 L;  1JCK B;  4YIJ A;  1G6Z A;  3H6M A;  2NVQ B;  4RKL A;  4RCN A;  1PTO D;  4C2M B;  4Z9C B;  3DEO A;  4V19 0;  1LTR D;  2MJ8 A;  3H91 A;  3I4N B;  1E2V A;  3ND9 A;  1HTL D;  1YNN C;  3EA6 A;  4FF3 A;  3W2D A;  3AB9 A;  3BVG A;  2KED A;  2J4X A;  1L0X B;  4K5W A;  5FLX L;  2FIN B;  3QG1 A;  5EPK A;  1UUP A;  4KTA A;  3DWP A;  1BCP C;  5JEA H;  1WTR A;  2NVY B;  4CJ0 B;  1UEA B;  5CV9 A;  4ULL A;  5KYL A;  1WTX A;  3NQT A;  3NHH A;  1TS2 A;  1SJH D;  3NBH A;  4OO1 H;  2WKD A;  3IAY A;  1F9Q A;  4M8A A;  3URY A;  4BA1 I;  3ZYY X;  1ICW A;  1HPC A;  4C3H G;  1EEF D;  1FYC A;  5CMD A;  4IUP A;  5CV7 A;  1QWY A;  2EVB A;  4HCE A;  2RA4 A;  4KKU A;  2H1E A;  3K5M A;  5KGU A;  4QMG A;  1PRT B;  1ZEQ X;  1LTG D;  3BDO A;  1XXG A;  3T53 B;  3LWU A;  1VF5 C;  3J80 E;  4QIW B;  4F8M A;  3CRK C;  3A8K E;  2F0E A;  2RKS A;  2YU9 B;  5KRU A;  1SNC A;  2F0S A;  1WD0 A;  2F0M A;  5DM6 3;  2XVS A;  5A2Q L;  3SK6 A;  5JEA G;  3DUZ A;  2VB2 X;  3D4W A;  1WTV A;  1JOK A;  3HEJ A;  1SEB D;  1I4P A;  1ML0 D;  4OL7 A;  3HS0 C;  2DNE A;  2Z4I A;  5I2Y A;  5LL6 X;  4KKT A;  3NQI A;  4KMU C;  3H09 A;  3QOL A;  1ENF A;  1CZG A;  3U9S A;  1DOK A;  1MD2 D;  4HR7 B;  1CQV A;  1JOO A;  5AFW A;  2SEB D;  3TZU A;  1GOZ A;  2Q8R E;  2BDO A;  5C4H A;  1CA6 A;  3M4O B;  2VB3 X;  4KKS A;  3OIQ A;  1CTM A;  3VR4 A;  5FO9 B;  2XIW A;  3S14 B;  2WIN B;  3JAM L;  1QNU A;  1L0Y B;  4DF7 A;  5C3E B;  1HA5 A;  1WCM B;  1NUC A;  4BY7 B;  1I4R A;  5COR A;  1STN A;  3EVQ A;  1D5X C;  2F0U A;  3H94 A;  2LY7 A;  1FD7 D;  3MWY W;  4A3E B;  2IWH A;  4HSV A;  5DAU A;  5E3F A;  3S1M B;  2NN6 H;  2K7V A;  4C3I B;  4B9X A;  3WOF A;  1QB5 D;  3QO2 A;  3PV0 A;  2AQ1 B;  1PFB A;  2KUM A;  1SDF A;  1QE6 A;  2C5C A;  4G4K A;  5CBA E;  1V1P A;  1BO0 A;  4A3F B;  3QIA A;  5CC4 A;  3A7A B;  3MZ5 A;  3A56 A;  4K2L A;  5C5M A;  3X3M A;  4BY1 B;  3FKI B;  4LMQ D;  3OIP A;  2BA0 A;  5M5X B;  3MA2 B;  2EJF C;  2DNC A;  1AP0 A;  3NPP A;  3RZO B;  4WJW A;  2B2V A;  2K33 A;  3BZD B;  3M7N A;  2E76 C;  2X6G A;  1BCP F;  2K05 A;  3BS1 A;  4QF4 A;  3GO5 A;  1D2B A;  3FRP B;  1STE A;  4A3K B;  2HCC A;  1NR4 A;  1D6E C;  1KDA A;  2NN6 G;  1SYE A;  2EY6 A;  1O7Z A;  1NR2 A;  3MFY A;  3GTL B;  1TY2 A;  1H9M A;  4WRD A;  3D3R A;  1T5E A;  1NSN S;  3VA7 A;  2AUJ D;  2HCI A;  3SK4 A;  2TSS A;  3NTH A;  1GJX A;  1R4Q B;  1EY0 A;  1SYC A;  5E1F A;  1TWC B;  4FXK C;  1EY8 A;  1OXT A;  2NTS A;  4TQU S;  5C0X J;  3K5N A;  2QIL A;  5ISR A;  2M9V A;  4A3G B;  1B4O A;  3HG9 A;  1I4Q A;  1PRT D;  4HMJ A;  2F03 A;  3Q6S A;  3I73 A;  3QWN A;  1EY5 A;  2IPK D;  1BDO A;  2FFK B;  5ELE A;  4RFB A;  3T4A C;  3NUC A;  1AW7 A;  2MUY A;  4DFA A;  1Q1E A;  3OSO A;  2L4N A;  1KNE A;  4X3U A;  3PUZ A;  4L8J A;  4A93 B;  1S5B D;  1GUS A;  1DD2 A;  2EDG A;  1B2T A;  3F2U A;  1G91 A;  3I3C A;  3O13 A;  2NBF A;  1I4G A;  3TP8 A;  1ZYR C;  1XWE A;  2QEJ C;  4EVO A;  2K5W A;  3GTP B;  1TS4 A;  3SDZ A;  4KY6 A;  4IFD I;  2R61 A;  2SDF A;  1Q1B A;  1Z47 A;  4H0L C;  4AYB B;  2I46 A;  4UAI A;  3VR5 A;  4J6H A;  1Y1V B;  4XXE A;  3KLS X;  3SK8 A;  1GUW A;  3GD7 A;  1JB3 A;  1FNU A;  1R9T B;  5I2X A;  4K6L A;  5I9P A;  1V43 A;  1ROD A;  3CKI B;  2BCO A;  5EPL A;  5KNB A;  4F7X A;  4PMW A;  2J7Z A;  1EQT A;  2A69 D;  2Q8T A;  3OHX C;  1ENC A;  1S5D D;  3R3O A;  3S1R B;  4CKC A;  4F87 A;  4A3B B;  3LWE A;  5EBC A;  2EYL A;  2F0O A;  2RQX A;  5C0X H;  1LT4 D;  3PIP 3;  1RCV D;  4TKO B;  4TRD A;  1JOR A;  5KYI A;  1UAP A;  1C4Q A;  2AQ2 B;  3HOZ B;  5C4X B;  1A3U A;  2A6H D;  1SND A;  4IUN A;  2K04 A;  3PO3 B;  2E2I B;  1XYI A;  5JVH 3;  2IW3 A;  5E4X A;  5I9O A;  3S2H B;  2F0W A;  2L5T A;  1SE2 A;  4RCO A;  2WAC A;  1S4Z A;  5CGK A;  5JAV A;  2O5I C;  1ET9 A;  5NUC A;  1STH A;  1SMY C;  1VMP A;  1E2Z A;  2EYO A;  3HRZ C;  1X3P A;  4MN3 A;  2NZ1 D;  3DWQ A;  3K0Y A;  4IUQ A;  2PW5 A;  2XN9 C;  1SE4 A;  5M9O A;  1G2T A;  3MC0 B;  1XX8 A;  3AU7 A;  1PMR A;  3D4R A;  2ZXO A;  5D3D A;  4HSP A;  5C3W A;  4RGT A;  1IW7 C;  3CU7 A;  4ZAI A;  1K8O A;  3HOV B;  4ZYS A;  5KNC A;  4XQJ A;  2A73 B;  1EY4 A;  2KEC A;  4MIU A;  1ESR A;  3BVZ A;  3GV6 A;  4PMB A;  4RAU C;  2FMM A;  4RGN A;  1Q8I A;  4OIJ A;  2AWO A;  5F2D A;  2XWJ B;  1TII D;  1EY7 A;  2E2D C;  2EYM A;  4LK1 C;  4WOR A;  1YNN D;  2RDH A;  1K83 B;  1U4M A;  1U4P A;  3HP3 A;  3TZD A;  1SJE D;  2G9D A;  2VXW A;  1GUG A;  3A55 A;  1LAB A;  4DNR B;  5EPJ A;  1Y8P B;  1KDC A;  2EZV A;  4L63 B;  4S3S A;  1LTS D;  5IOC A;  3MXU A;  4ILW A;  3QB3 A;  4C1N K;  2Z1C A;  5E4W C;  2KA7 A;  3IFD A;  1ET6 A;  5EKI A;  3M3Y B;  1SYB A;  1BBX C;  2F0L A;  2PPB C;  1WVL A;  3C46 A;  5FO7 B;  1B1Z A;  2HQE A;  1GXD C;  1JOQ A;  4RGM A;  2IT1 A;  1TKW B;  3T51 B;  1KNA A;  1PLF A;  1Q12 A;  1SFO B;  3FPU B;  2CVR A;  1QNK A;  3A8J E;  1A15 A;  1GUT A;  1PTO C;  2IX1 A;  4FF1 A;  1B9M A;  3QOJ A;  1DM0 B;  1HUM A;  2EYH A;  3A54 A;  4HN7 A;  3KBX A;  1F2Y A;  1B9N A;  1SYF A;  3E0J A;  3P1H A;  3KK7 A;  1MSH A;  2DN8 A;  2F0H A;  4WFN 3;  4E6I A;  4KJN A;  1QOH A;  2EY5 A;  5IT9 E;  2JA6 B;  1Y8O B;  4BA2 I;  4IFD H;  2WP8 J;  1PFN A;  4A3M B;  2JSO A;  1O7L A;  2B8F A;  3OW7 A;  2IL8 A;  3S17 B;  3I72 A;  1JC7 A;  1X3Q A;  1JWM D;  3R2I A;  1RF2 D;  2EJG C;  5CV8 A;  2A68 D;  2O2L D;  2NVT B;  2KQ3 A;  2L12 A;  2R6G A;  3PMF A;  5FLX E;  1CHP D;  4LAA A;  3IFT A;  1CZW A;  3K7A B;  1WTQ A;  4H44 C;  2EY1 A;  2RSO A;  4K6D A;  1U9R A;  4BBS B;  4ZLT F;  4IAL A;  1NAP A;  1Y1W B;  3VR6 A;  2E75 C;  3CHB D;  3TSS A;  4EQN A;  2IX3 A;  4JK1 C;  4L6T B;  4FO2 A;  3KLS A;  3HGB A;  4IFD G;  1AZP A;  1EU3 A;  5IGE A;  2RBM A;  4K8J A;  1PTO H;  5KEE A;  1ESF A;  2KHS A;  3S1Q B;  3TP7 A;  1Z7T A;  2MPM A;  2ENB A;  2KCC A;  3NWT A;  2RVL A;  3KLR A;  3GTG B;  5JOB A;  5G3L F;  5I4D A;  1GHJ A;  3MVV A;  4C3H B;  2CHB D;  3VYR A;  1JR0 D;  4FF2 A;  1R4P B;  1STA A;  1LTA D;  2AQ3 B;  3TBI B;  4IUR A;  2CW0 C;  1AZQ A;  4DN4 M;  3T16 A;  1DOL A;  3K57 A;  2R7Z B;  3GTO B;  5A2Q E;  4Y7N B;  2B2W C;  3K5L A;  1O78 A;  5BN3 A;  1DZ1 A;  4GZY C;  1RJT A;  2PZT A;  3TP6 A;  2XWB B;  1I4H A;  2B2Y C;  4IZ8 A;  3J7A F;  2FMC A;  4A3D B;  2EYF A;  1B3A A;  3X3N A;  4FXG C;  1JIC A;  1O80 A;  1WTO A;  1VMC A;  2I07 B;  3PUX A;  2JXM B;  5C4J B;  5JJZ A;  1V1P B;  3BVM A;  3OWE B;  3C1E A;  3P75 A;  3FVQ A;  2L9H A;  4ZKC B;  3VR3 A;  1BR9 A;  2C9O A;  4KN4 C;  3E6Z X;  1UNS A;  3LNN A;  3A7L A;  3DEP A;  4BWG B;  5FKA C;  2EY2 A;  3GTM B;  2H4O A;  2K5Q A;  4EGV A;  3OPO A;  3JAM E;  4XIG S;  3OMG A;  4G7O C;  5HUR A;  2B2U C;  3I90 A;  1STG A;  1FNV A;  2JEB I;  1EQV A;  1PTO F;  3J81 L;  2KOL A;  5C5L A;  4EQP A;  1S5F D;  2ZXP A;  2BDN A;  3C2P A;  1TVX A;  3WDN A;  3FEW X;  4BBR B;  3MEH A;  1EFI D;  3SVM A;  3HOU B;  2BE5 D;  3RZD B;  1A6X A;  3GV3 A;  2Y0S B;  1AFP A;  1E0B A;  2K6A A;  3RUZ A;  2M2L A;  5M3M B;  4ZUI A;  1RKN A;  1F9S A;  1DJR D;  4PV1 C;  1S5E D;  1LTT D;  1BCP B;  4XTC S;  2O5J C;  5EGT A;  5ELF A;  1BF4 A;  2NWG A;  3DHQ A;  3NE5 B;  1D1K A;  1TQO A;  1BOS A;  2LFN A;  3TP5 A;  1EZ6 A;  4RGO S;  4J8Q A;  4OO1 I;  1TR5 A;  2F3V A;  5M5W B;  4KHV A;  1STY A;  3MAQ A;  1U4L A;  3VYT A;  3Q0A A;  4K2K A;  1SYD A;  2B2T C;  3I4L A;  3DM1 A;  4FF4 A;  1V1O A;  2HDL A;  2Q8I B;  3BG3 A;  3R93 A;  1SNO A;  2G9H D;  1HCZ A;  2XSC A;  3R8B A;  3MFG A;  4U67 3;  2D9U A;  1HUN A;  1H9R A;  1W6J A;  5I6Y A;  3SE0 A;  3RD4 A;  4XQQ A;  3VR2 A;  4C3J G;  2D5D A;  3PIO 3;  1VDZ A;  4IUU A;  3N6R A;  4HCS A;  2J0T D;  3PUV A;  2R3Z A;  4HTH A;  1OXV A;  4Q5V A;  4V0B A;  3C3L A;  2F0V A;  3S15 B;  1KTK A;  2JEA I;  2BA1 A;  1IKL A;  2QCP X;  3PUW A;  2L55 A;  3GQB A;  3MXP A;  1IYV A;  4G7Z C;  1EYC A;  1Q90 A;  1TU2 B;  5LHY 1;  3MTS A;  4PNY A;  4DAY A;  3E5S A;  2MHV A;  3WOE A;  2R93 B;  3SK5 A;  3J7Y W;  3ERQ A;  1C8C A;  4KHZ A;  2A5H A;  3H0G B;  4NW2 A;  4UDU C;  4BS9 A;  4LJZ C;  1ONL A;  3RLF A;  2WB1 B;  4ABN A;  5I6W A;  1SMY D;  3HOW B;  3FMC A;  3SEB A;  4K8I A;  3EJI A;  1FGB D;  5C6A A;  1WTW A;  1EWC A;  3VYS A;  5CR3 A;  1OXX K;  4X3T A;  1IHZ A;  4DGZ A;  1WTP A;  1I3Q B;  5K5P A;  1HXY D;  1MSG A;  5D14 A;  4HED A;  1IW7 D;  5EQ0 A;  1ZXT A;  1TWH B;  2A6E C;  4J1M A;  5M3F B;  1DOM A;  3HOX B;  1PYW D;  4XDX A;  5C44 B;  1TS5 A;  2NUC A;  3MXN A;  2B2W A;  5BN4 A;  2PMZ B;  3S2D B;  4H13 C;  3L7Z C;  3P7J A;  5J1Z A;  3KF8 A;  2B2Y A;  1LT6 D;  2D2C C;  5KND A;  1LLR D;  4XYO A;  3ONA B;  1LT5 D;  3J7A V;  4KN7 C;  3DMU A;  2AWN A;  5JPM C;  4IFD J;  5D65 A;  1IL8 A;  5CV5 A;  1F2L A;  1SXT A;  4CGY B;  4CKE A;  1HA6 A;  1VF7 A;  2WAQ B;  2GA4 B;  3NTK A;  5ELC A;  3TME A;  1TWG B;  4I65 A;  1F9P A;  2KEE A;  2K03 A;  2NB0 A;  3D31 A;  4R8I A;  1TWA B;  2F0K A;  4DK0 A;  2DY8 A;  5IGC A;  4HAE A;  2XRS D;  1ZKO A;  1D1I A;  1II3 A;  5EKL A;  1BCP D;  2HUG A;  5ELD A;  3Q24 A;  2B2U A;  1HQM C;  5TSS A;  4MHE A;  2EE1 A;  4KD3 A;  2L1B A;  3D6C A;  3Q22 A;  2SNS A;  1CQF A;  2PCF B;  3J80 L;  2N55 A;  1F2Z A;  1YNJ C;  3VYU A;  2JP1 A;  1Z6H A;  2MGS A;  5T1G A;  4FNF A;  4RH6 A;  1MGS A;  1A2T A;  5CBE E;  4B08 A;  1PRT F;  1LV9 A;  3PUY A;  5C3X A;  3W3A A;  2A74 C;  1EZ8 A;  4RKB A;  1MBY A;  5JVG 3;  1I6V C;  2NYZ D;  2PW7 A;  4DXF A;  1LTB D;  1EYA A;  2RSN A;  3R2T A;  1KAA A;  3MHB A;  4PQX A;  4NMZ A;  2OXP A;  1V8Q A;  3CRL C;  1JE4 A;  4OIK A;  4HMI A;  1BQQ T;  3UI2 A;  2PNR C;  4ZUJ A;  1KLU D;  2OEO A;  3FPP A;  2F0I A;  4FYD A;  4C1N I;  5T1I A;  1CA5 A;  1DYQ A;  4F88 A;  3I91 A;  4PMC A;  4DAP A;  2F0G A;  5EJW A;  5KIX A;  2B2T A;  1I50 B;  3I8Z A;  2K5D A;  1HTP A;  1D5Z C;  1IKM A;  2PO4 A;  4O42 A;  1A3V A;  4IUT A;  1GUN A;  1A3T A;  4NP5 A;  1E2W A;  1W6K A;  1B53 A;  3HOY B;  4C3I G;  3V2T A;  4IQZ A;  2Z8L A;  4QB4 A;  1F77 A;  2IJ0 A;  3D6W A;  2O4X A;  1QIL A;  2OT2 A;  4ZRZ A;  5C4Z A;  2Z4H A;  2FHT A;  5K36 H;  1EL0 A;  1NCV A;  2L11 A;  2LMC B;  4ID6 A;  4KV6 A;  3G6J B;  1HHV A;  4DU9 A;  2JA8 B;  1SE3 A;  5A35 A;  3ERO A;  4KY5 A;  5DEH A;  2LKV A;  1AEX A;  4OO1 G;  3KUP A;  3GTJ B;  2NTT A;  3CQZ B;  1SAP A;  1SSO A;  3K59 A;  3M85 A;  5M5Y B;  4K14 A;  2CW0 D;  2A68 C;  3K6O A;  1PZI D;  3VA5 A;  4KJO A;  4QUC A;  1DON A;  1PZJ D;  3EQL C;  1WD1 A;  5FOB B;  4JBW A;  5C0X I;  5J22 A;  4NKL A;  4EQO A;  3PO2 B;  4KY7 A;  4CBV A;  2F0J A;  1EYD A;  2EOT A;  5DNF A;  1SNP A;  1AN8 A;  5DM7 3;  5K36 G;  2F1M A;  2SNM A;  4DAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...