1TT2A

Cryogenic crystal structure of staphylococcal nuclease variant truncated delta+phs i92k
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title X-ray and thermodynamic studies of staphylococcal nuclease variants I92E and I92K: insights into polarity of the protein interior
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1tt2A00
5IGCA 5E3FA 4HTHA 5IOCA 4J1MA 1STYA 4HMJA 5IGDA 4PNYA 2F3WA 2F0SA 4DGZA 3EROA 5IGBA 3D4WA 1EY5A 3RUZA 1SYCA 3MXPA 5C3WA 3LX0A 4ZQ3A 1TR5A 3BDLA 4PMCA 4H7BA 1ENAA 1JOQA 4NDXA 2KHSA 1EZ8A 3T16A 3MVVA 1TQOA 3DHQA 3P75A 5I6WA 1EZ6A 5CV7A 5C5MA 2OXPA 5J39A 2F0EA 1SNQA 2F3VA 2EY1A 5EGTA 4I65A 3NXWA 5IGEA 3NP8A 5C4ZA 5C6AA 2F0MA 5CR3A 2F0TA 4N9TA 3SR1A 3QOLA 3C1EA 4KJNA 4ZUIA 4KHVA 3OWFA 5JAVA 1EY9A 4IALA 5CV8A 2F0VA 2SNSA 5IIFA 4K5WA 2EYPA 2EY2A 2PYKA 1SYDA 4S3SA 5EKLA 5M9OA 2EXZA 4YIJA 2NUCA 1NSNS 1TT2A 2F0HA 3H6MA 2EYLA 4QB4A 1STGA 3TP8A 3U9OA 1EYAA 3PMFA 1EQVA 5C4HA 5HURA 4KV6A 1SNOA 5K5PA 1SNPA 3EVQA 3SK6A 3C1FA 1KABA 4DFAA 1SYFA 1A2UA 4KD3A 4KJOA 2F0DA 2SOBA 4KY6A 5KRUA 2LKVA 1A3UA 2F0QA 1JOKA 3DMUA 3NK9A 3SK4A 5DAUA 2RBMA 5KYLA 2F0FA 3E5SA 4K14A 4KY7A 3VA5A 3TMEA 3HZXA 2ENBA 5KYIA 1A3TA 4F7XA 5CV5A 4HMIA 4ODGA 5CV9A 2F0NA 3MZ5A 1STNA 4PMBA 4ID6A 5KIXA 3NHHA 1A3VA 4B9WA 5C5LA 2F0KA 2F0UA 4OL7A 4E6IA 1KDCA 3R3OA 5F2DA 3TP5A 3QB3A 5IGFA 3NQTA 2OEOA 1SNMA 3SHLA 3TP7A 4G57A 1STBA 2PZTA 3NUCA 5JOBA 4EQNA 2F0JA 2EY6A 3HEJA 3P1HA 4TRDA 1JOOA 1EY8A 2WACA 4K8IA 2HQEA 4KY5A 5EKKA 5HGTA 1SYEA 1EYCA 1F2MA 4LAAA 3D6CA 5I6YA 5J22A 2EYOA 4K6DA 3OMGA 1JORA 1KAAA 1II3A 2EYMA 4RKBA 3TP6A 3BDCA 3SK5A 4B9XA 3SK8A 2EYJA 2F0PA 1U9RA 3T13A 1AEXA 2PZUA 5I9OA 2EYHA 2EYFA 1EY4A 2F0GA 2F0OA 4ME5A 4QMGA 5IODA 1SNDA 2O4XA 3D8GA 4RKLA 4ZUJA 2EY5A 4EQOA 5C3XA 3V2TA 1F2ZA 2M00A 4IUNA 3OSOA 5CV4A 1F2YA 3OMCA 2QDBA 1A2TA 1ENCA 3D4DA 1SNCA 5J1ZA 5NUCA 4F8MA 1RKNA 3SXHA 1NUCA 2RKSA 4K8JA 5DEHA 4MIUA 1KDBA 1SYBA 2SNMA 1SYGA 2KQ3A 4NMZA 2F0IA 2OF1A 4DU9A 4K5XA 4IZ8A 2PW7A 4N9PA 4QF4A 4DF7A 5IGGA 5CC4A 2PZWA 4K2LA 1KDAA 2PQEA 4KTAA 3QOJA 4NKLA 5CV6A 3EJIA 5CGKA 5I9PA 4K5VA 3ERQA 1EY7A 2F0WA 3S9WA 2RDFA 4EQPA 3MHBA 1STHA 4NP5A 2PW5A 1EY6A 3ITPA 4WORA 4WRDA 5KEEA 5KGUA 1EYDA 4J6HA 4KD4A 4R8NA 3MEHA 1IHZA 4EVOA 1EY0A 2F0LA 5ISRA 1STAA 4K2KA 5E1FA
chains in the Genus database with same CATH superfamily
2HCCA 1E1TA 2HHHQ 5GQOA 4EGVA 3W3AA 2HIVA 4C3HB 4BY7G 2DUDA 3AFPA 1L0XB 2C5CA 2R7FA 5JJIA 5C3WA 2ZTEA 1OXTA 4GZYC 5DNFA 2QCPX 4A3MB 1PFNA 2LXKA 1NAPA 1MJCA 3IFTA 3LGJA 2RHSB 3PO3H 4LF7L 1K73C 3TQYA 4N9TA 4HCEA 3GTKH 2AHOB 5LMNW 3WOEA 4FF1A 1A0IA 4R4TA 3BYTB 1DJRD 1DZ1A 1RHPA 1O7IA 3J7ZC 1PH1A 5TSSA 4IOAA 2P5ZX 3SK6A 5IE8A 1MSHA 3K5OA 1XX8A 1C7YA 3HOYB 1IYJB 2V4DA 3NEMA 3H09A 1N33Q 3TMEA 1EWHA 1A3TA 3T1HQ 1K0RA 1S5FD 3MFYA 3M9BA 1F9QA 3GO5A 1NTGA 3MFGA 4CHTB 5AJ3L 3SHLA 2PZTA 3H3VH 2JA7B 3NSWA 3P1HA 4DV4L 2N8NA 3CMEA 1F2MA 4YY3Q 3D6CA 3TREA 3Q0AA 4B3TL 3I4NB 3Q6SA 4RKBA 5GROA 3P7JA 5JVH3 2EYJA 1KNEA 4Y52H 1SE3A 1E22A 3D8GA 4NXML 5FO8B 5JEAH 1XXGA 3J7AV 2RSOA 1H9KA 4UAIA 2MP1A 1I50B 3HFZB 3D4DA 2AUJD 1WI5A 1ET6A 4JOIA 2CHBD 4XYQA 2VS1A 2KENA 1BXTA 3S9WA 2PMZB 5T1GA 2K03A 4NPSA 1XTCD 3T56B 3J80c 1Q81C 2EQSA 3MEHA 3A74A 1QVGA 3GTPH 2KCCA 2FFKB 1LM0A 4JV5Q 1ESFA 1LACA 3K5MA 3E3XA 3GTJB 2DN8A 3J81E 4P2CB 3VR2A 4IUQA 1P16A 1LYLA 1RL2A 3VYRA 2UUAL 1JE4A 1JT8A 2JA9A 3H91A 2YV5A 3S24A 5A35A 1PV4A 2E76C 1FYCA 4A3GB 1GO3E 2B8GA 3PO3G 3K58A 2JA5G 5JVG3 4OO1H 1T9HA 5FLMH 1EY9A 4KKTA 4BS9A 2K33A 2RDGA 4K5WA 4LUVA 3TZUA 3J80L 3AYHB 1R9TB 2XRSD 1LTSD 4OGQC 2ASBA 4G7OC 1QOHA 2K5WA 3QWNA 5KRUA 1RIPA 1A3UA 4A93G 2F0QA 1KRSA 5KYLA 5EQ0A 3RLNA 1HNWQ 4GLAC 3JAML 1C9OA 2XIWA 4BBRH 4A3LG 5CV5A 3TS2A 2F0NA 4C3HH 3FKIG 3KLSA 1YI2A 1PRTD 2EIFA 3NBIA 4A3MH 4A3EB 4BA1I 2B2VA 1G8ZD 3PIOA 1DD2A 4OIKA 4EQNA 4IFDH 3HEJA 1TY0A 2WACA 4YY3L 2CFMA 3H0GB 3S17B 4H0LC 2A69C 2WAQB 4V190 2F0PA 3KF8A 4XQNA 1PRTB 4L5SA 1LT5D 4P73A 3I55A 2M00A 2NZHA 4PV1C 3KBXA 5FK9C 1EQQA 5ELEA 4MIUA 3ZYYX 3HOYH 5FLXc 1C4QA 1VQ9A 1GUTA 1BUVT 1CUKA 4QF4A 4GOPB 3M4OB 4JI7L 3E9IA 1WFQA 4A76A 4K6LA 1FR3A 4FP5D 1K3BC 4WRDA 1FNUA 1HNZQ 3OTOL 4MHEA 2Z4HA 1H95A 5E4WC 2N88A 2B2UA 2VNUD 2JA7H 1EFID 2JK8A 2QGQA 3HOWB 1IZ6A 4CGYB 2E2HB 5IYCG 1SYCA 4KKUA 5BR8Q 1Y1WG 2UXBQ 2V1CC 3K6OA 5I6WA 1WCMG 2MPMA 3OIQA 2G9HD 2NVTH 2MJ8A 1Y69U 3IFDA 3R2TA 2KJXA 3T53B 5IWAQ 1I50H 2RA4A 2RCNA 4MZ9A 3D31A 3KUPA 4JW0A 1BNZA 3OWFA 4C3IG 1J9OA 3TRZA 1SYDA 1TT2A 2EYLA 1PH8A 4YHHQ 2YTXA 2K05A 1SNPA 1LABA 5JJKA 4A3FG 4DV0Q 4A3IB 2B29A 2RBMA 4XT1B 5DAUA 3F8TA 4K14A 2K5NA 4JI6Q 3URYA 4J15A 2AUKA 5CV9A 3RR5A 1B50A 3GTJH 4MNOA 4PMBA 3DWAA 5KIXA 2JJQA 5KNCA 1GUOA 2K5HA 1VQ6A 4A3BG 3LNNA 1UE6A 3QB3A 2UXCQ 3JAMi 1IL8A 3I4MB 2G5DA 1N36L 1SE8A 3PQIA 1KIXA 2EOTA 1SJHD 4AH6A 4A3GH 1VF5C 2BE5C 1I94Q 5C0XJ 4RCNA 1AEXA 4XTCS 2KEDA 4XT3B 2CCZA 2EYHA 3CKIB 5IODA 4QCLA 4EQOA 4L8JA 4P72A 1HCZA 2N3SA 4WJ4A 3BYYB 2DNCA 2N78A 5CV4A 4OONA 2VQEQ 3SDZA 3M4PA 2NVYB 3GTOB 1GHKA 4KTAA 1KDAA 4BY7B 3EJIA 3KDFA 1GHJA 3DWPA 3QJYA 2Q8IB 1PH4A 2VZAA 2PI2E 4LUZA 1EY6A 3S1QB 3A55A 1IHZA 1Y8PB 5ISRA 1NJIC 1KQSA 3VYSA 1HNZL 3AB9A 4HEDA 1LT6D 4J1MA 2AQ1B 1W6KA 4A3EH 1AP0A 4ZKBB 2UXDQ 3X3MA 2ZJPA 4DR3Q 1JC7A 1QILA 1U0LA 3FRPB 3A5UA 3KF6A 2BA1A 1I5FA 1A63A 4X64L 2PPBC 1TS5A 1NR2A 1CA5A 3RLOA 4JI8Q 3H0GH 4LUOA 5M3FG 3S17H 4IQZA 3T1YQ 1IBLQ 1BOSA 2UXBL 5CV7A 2EPBA 1V8QA 1SNQA 4IO9A 1YVCA 3R93A 1YNJD 5M5YB 5FO7B 3GTMB 3RZDB 5IWAL 4DV6L 3D0FA 4KHVA 1EIHA 5BN5A 4WJ3M 1EU3A 3M4OH 1CI3M 1Q1BA 4YHHL 3EBEA 3K0YA 4RHRA 2SDFA 4KD3A 4KJOA 2FMMA 1BVSA 5COYA 4DV0L 3TS0A 1STEA 1WJJA 4JI6L 1OTCA 3J81L 3HKZE 3STBD 3I4LA 4C56C 3HOWH 2E75C 3S15B 5D3IB 4DV1L 1BBWA 4E6IA 1PFBA 1DONA 1HQRD 4UPAA 5IY0A 3K7UC 1HJPA 5IP9G 3W2DA 4TRDA 1VMCA 3LWUA 1ZYRC 2VB3X 1KAAA 1I94L 3TP6A 1VQLA 1UE7A 3U9SA 1Q86C 1E24A 3IL8A 3KF8B 3K57A 2F0GA 1E7ZA 1TY2A 2AQ2B 4JI2Q 4HCSA 1A2TA 1MGSA 1Z9FA 1E2WA 1N9WA 2VQEL 1VQEA 5C4HA 3MC0B 5IYDG 1XMQQ 2F0IA 4A3IH 4DF7A 2XTIA 3I2ZA 3CCUA 1IBMQ 4DUYQ 5D65A 1L1OC 1GUSA 4H13C 2Z6BA 3OIPA 4CDFC 3F2DA 5C0XI 1NMFA 1TWHB 4LNQA 1SE4A 3PO3B 3I4MH 3PUYA 2A6ED 3S1MB 4RGMA 2UXDL 5M5WB 2JA5B 3N52A 3CHBD 1RTOA 4DV3Q 1EFWA 1SEBD 1OXVA 3S1NB 1HFGA 2DNEA 4JI8L 4KI0A 4DAVA 2YTVA 4XQJA 3T1YL 1V9PA 4X3TA 2A6HC 2OXPA 3VR4A 3L0OA 1UUPA 3L7ZC 5M3MG 3NXWA 2D9UA 4A93B 2F0TA 3UDXA 1KL9A 3PUVA 2E8GA 5GAGC 1B9MA 2NVYH 2E2DC 4CDDC 5LMUL 3KFUA 3ONAB 4BY7H 2QEJC 1TVXA 3NWTA 4IPGA 3CPFA 1JR0D 1Q12A 2JSOA 3M7NA 3S1QH 4QJFA 1D1IA 1XPUA 1K28A 2LKVA 4N8X1 3E9HA 2MUYA 3EIVA 2KA7A 4HIMA 5H1SE 1T5EA 5GAEC 3J7YW 2OTLA 4HJ9A 3HOZG 4H02A 2BCOA 3V96A 2IHFA 4YWMA 3DEOA 1YHAA 3PUWA 5IGFA 1SNMA 1GVPA 3TP7A 3VDYA 3J81i 3NUCA 4OEMB 4DR7L 3W5OA 2ZJQA 1K8MA 3CPWA 2IL8A 1EOVA 4JC0A 1QVFA 2ZTDA 5DM73 2JEBI 3GTMH 3RZDH 1I4PA 2XNAC 4C1NK 1I4XA 1PYBA 2IW3A 3EQLC 2EY5A 1QE6A 3V2TA 3Q22A 4HSPA 3PIP3 4JI2L 3SEBA 1V43A 1KHIA 4L5QA 3IRBA 5NUCA 2X6LA 3RD4A 5C44G 5JJLA 2EVBA 3CU7A 4Z9CB 1XMQL 2AKWB 3BJUA 3K7AB 2ZJRA 4IUTA 1DYQA 4DV4Q 1IBKQ 2D0PA 3OYYA 4OWTB 2F0WA 3U4ZA 3KDFB 4B3TQ 3ITPA 1IBML 1Y1WB 4YCVA 2KVMA 4DUYL 2FINB 3I90A 1LO5D 3ER0A 5E1FA 1WCMB 4CKEA 2HD3A 1SROA 1FGBD 2ZT9C 1Y1VG 2X69A 3HKSA 1KC8C 3CCEA 2R3ZA 4PMWA 4DNRB 1HA6A 1HZ9A 3BVMA 2AQ3B 2NVQB 3KF6B 3TN2A 4C3IB 1CKMA 3CW2C 4AYBG 4U673 5FJ8G 1YIJA 4OHJA 4H44C 1NE3A 3I4OA 3MWYW 4QIWB 2HDMA 5T1IA 4X62Q 1HH2P 1SJED 5IGEA 4A3FB 1X3FA 2Q8TA 1F9PA 3SR1A 4POGA 4YCUA 1V1PA 3C1EA 2DGYA 3WWVA 1TIID 2YU9H 4GN4B 3PF4A 4BBRB 1K0SA 5EKLA 2L0CA 2Y0SE 5C4XG 1J6QA 1EWIA 3U9OA 3S14H 4ILWA 1VCIA 2B39A 1V1OA 1SYFA 1RD9D 2BDOA 2UUAQ 1K8AC 1JOKA 3SK4A 3GTQB 1GM5A 1WVLA 4FXKC 1Z6HA 1TWHH 3WDNA 1O7YA 1X3PA 3S1MH 2UUBQ 5M5WH 2JA5H 1A3VA 2JYOA 3ND8A 4R1JA 2B2TA 3S1NH 3R3OA 3CC7A 1ZXTA 2H5XA 1EY8A 2CW0C 3W1BA 1SYEA 2IHEA 4IUPA 4A93H 1YHQA 4Y7NB 1BBUA 3BDCA 3T13A 4FYDA 3OW7A 4OWWB 4A3LH 4GNXA 3AQQA 1X56A 5EAYA 3HS0C 4IUNA 4A75A 1L1OA 4A3CG 3CAMA 3FKIH 1CQFA 1RKNA 4DV5Q 2JN4A 1S72A 1F9SA 1Q8IA 2K50A 2KQ3A 2RQXA 2D0OA 1D5ZC 2PNRC 1K8OA 4YWKA 1IBKL 2JEAI 2ES2A 1JWUD 1E3PA 1SE2A 2NN6G 1TWGB 4DKAC 3CMAA 1S4ZA 5M3FB 2JA6G 3G71A 1WTRA 2A68C 4B3MQ 1STAA 1WYDA 5E3FA 2XRQD 5FOBB 5IOCA 1X9NA 2L55A 2NVTB 2BDNA 1PMRA 1LUZA 3EROA 4DK1A 3KOJA 5HGQA 5IGBA 4JI5Q 1PH5A 1LTID 4RFBA 1QNUA 1BQQT 2K01A 5EKIA 1EEFD 4BA2I 5G3LF 2MFIA 3UE0A 1Q82C 3O13A 2JA8H 4LK1C 3J81j 5I2YA 1Q7YC 4JI7Q 1NNXA 1IL2A 1QG7A 4AQYQ 2D62A 3QIAA 1TS4A 4FF4A 4X62L 3OW2A 4IOCA 3NP8A 2NTSA 3CCSA 1U5KA 3OTOQ 3KJOA 4RAUC 4LFAQ 5J3BA 2K28A 3U58A 5LHY1 2NB0A 3PO2G 2BE5D 2PYKA 3K7AH 3HOXG 3JAMc 2R92G 4YIJA 4FNFA 3X3NA 2A5HA 2OQ0A 5IYCH 1D6EC 1PTOC 4IURA 1Y1WH 3CXCA 2LY7A 1WCMH 2L9HA 3PUXA 3BG3A 3VA5A 3UDIA 1KTKA 2WFWA 5KYIA 2JXMB 3SE0A 1RJTA 3D6WA 2R93G 2Q2HA 1PTOF 1H9SA 2O2LD 2UUBL 2EXDA 1F2LA 1MD2D 2NVQH 4UP8A 1QZGA 4UP7A 4C3IH 3GDEA 3TP5A 2VUMG 5IT9E 4GN5A 1VQ7A 3TSSA 5C0XG 2JQOA 5GAHC 4A3FH 2EYOA 3OMGA 4DK3C 3SK5A 3SK8A 1I4RA 5I9OA 4DV2Q 2EYFA 4ME5A 1SNDA 4OX9Q 3M4QA 1X55A 3K59A 3A8KE 4KMUC 1EOTA 4RCOA 4A3BH 4DV5L 3OWEB 1O78A 3PV0A 4O42A 2OF1A 1N36Q 1D1KA 3GTQH 3CRLC 3MXNA 3MTSA 2J7ZA 4FO2A 2EJMA 5I9PA 2EJGC 2K7VA 1TS3A 4IN3A 1A15A 1VQCA 5LL6X 2WB1E 5M5XH 5KGUA 1AW7A 1EUJA 3F2BA 3CCVA 4EVOA 2WKDA 2AWOA 4B3ML 3C3LA 5IGCA 4ZKCB 2UU9Q 5M3MB 1YNNC 2F3WA 4DAYA 4RGTA 2G9DA 4JI5L 1EY5A 3ULLA 4X3UA 3MXPA 2JA8G 1NCVA 1R4QB 3DM1A 4Y7NH 3DHQA 1EZ6A 4RMFA 1CSQA 4AQYL 3FPUB 5L37A 1G2SA 3G6JB 1Q1EA 1D5XC 1VQ5A 2F0MA 2NVXB 4JI4Q 3M85A 1V1PB 4ZUIA 4O0AA 1CTMA 2O5IC 4LFAL 3AEVA 1BF4A 4DV7L 1JJ2A 1Y8NB 2SEBD 1ZYRD 5IIFA 3N6RA 4NB3A 1NSNS 5JPMC 4X64Q 1B3QA 1TWGH 5K5PA 1AZPA 3C1FA 4EX5A 4JYAQ 5M3FH 4GS3A 2KCNA 4JK1C 3S2HB 1SBBB 2X6GA 1M4VA 3K81C 3OOCA 2E5LL 2LFNA 3IAYA 2IX3A 4F7XA 2H1EA 2NWGA 4DV6Q 4R8IA 1V1QA 1XPOA 1KAWA 1HRJA 4R4OA 4RHSA 4RG1A 2OEOA 3K8AA 1CFMA 4DXGA 4ME3A 4NW2A 1L0WA 1OXXK 4OELB 1EYCA 3U50C 1CK1A 5I6YA 2R7ZG 4XIGS 2EYMA 5ELCA 1CKOA 1U9RA 2F3IA 4DV2L 1A62A 1CKNA 2NBFA 4JBWA 1GXDC 3NWSA 4ZUJA 4A4IA 3RNUA 4GNXB 4OX9L 2ATWA 4ZRZA 3OSOA 2I5HA 1L1OB 1FNVA 3PIPA 1N32Q 4CKCA 4DV1Q 1DXMA 3RLFA 2A6HD 1FJGL 4KN4C 4NMZA 1U4RA 2EE1A 3OHXC 1Y1VB 4LFBQ 5IGGA 5IP9H 3D4RA 2PQEA 2XVSA 3MEFA 1NR4A 1QJOA 1AFPA 4WORA 4ZAIA 5KEEA 4AYBB 1D5MC 3CQZH 3ND9A 2IT1A 5J22A 2UU9L 5IGDA 2F0SA 3PSIA 2PMZE 3ICEA 4B3RQ 1EIGA 5IYDH 3LX0A 2I5MX 1YJNA 2I5LX 4NDXA 1S5CD 5C4XB 3A7LA 5C5MA 1JB3A 2F4IA 4UDUC 1W6JA 1WOCA 2VB2X 1AE3A 1X3EA 1RF2D 4WFN3 2HIXA 2Z1CA 4ABNA 2EZVA 3I7FA 3MA2B 5EBCA 4JI4L 1GKHA 1JMCA 1SXTA 5A2QE 1D2BA 2SNSA 4ULLA 3S1RB 1B2TA 3NENA 3J81c 1EYAA 4DN4M 4QUCA 4KV6A 2Z6KC 3EVQA 1MSGA 2A73B 4L5TA 4PG3A 4JYAL 4LF8L 4UY8C 3RZOB 2F0FA 5GADC 2GN5A 5M3MH 4P75A 1HNXQ 1B7YB 2LS01 3GQBA 5C4JB 3TBIB 2UUCQ 1GUWA 1NY4A 2NN6I 1H9SB 2I07B 5JEAJ 3G4SA 3T51B 3AU7A 1EL0A 5F2DA 4BWGB 5LMUQ 3I4NG 2L4NA 3CC4A 1HQMC 4BBSG 1PVOA 2WKCA 4QY7A 1VQHA 1QUQA 4FXGC 5C3XA 2NVXH 2QDLA 4LFCL 1WTVA 4M8AA 1EY4A 1PRTF 1ONLA 2TMPA 4RKLA 3HOZH 5EPLA 4GOPC 2JA6B 1B44D 1F2YA 2A1AA 1N32L 2IPKD 1YITA 1MHWC 1XMOQ 4JCVE 1SMYC 3BS1A 2WAQE 1HZCA 3GD7A 1SYGA 4HJ7A 1LV9A 1EQRA 3H94A 3S2HH 4LFBL 2RDHA 1M1KC 4K2LA 4DR7Q 3MXNB 1PH7A 3MHBA 1MJEA 4DR6Q 4BY1G 4DNIA 4K2KA 4A3KG 3WOFA 3L3OC 3AMUA 3BU2A 3A54A 5IT9L 4POFA 4CDEC 1DGSA 1OO9B 2QA4A 4DAYB 1I6HB 3M7GA 3RUZA 3ZJYC 4DR1Q 2YU9B 5C44H 4B3RL 1VMPA 4DUZQ 3PO2B 3HOXB 4ALPA 2R92B 1EZ8A 1TQOA 4JBKA 1OXSC 4C2MB 3S14B 2QW7A 4I65A 1HPCA 2B63G 2JE6I 3PCOB 1CZWA 2Q2IA 5JAVA 1XPRA 1X6OA 2CW0D 1Y1VH 5K36G 2R93B 2EY2A 4R9WA 2EXZA 2PQAA 3PIO3 1STGA 2Z4IA 2VQFQ 4ZYSA 3PUZA 1PXUA 4IFDJ 2I46A 3DEPA 2QKIC 1Q90A 3I73A 2DY8A 1TU2B 3AFQA 4RWSC 2SOBA 3UDGA 2VUMB 4X6AH 5FJ8H 3DXJC 1VQPA 3DMUA 1NMGA 1HR0Q 1PH3A 4TKOB 3FP9A 5ELFA 3HGBA 1HNXL 2WP8J 1N34L 2UUCL 2RCFA 1B1ZA 3HKZG 2L1BA 2C35B 5FKAC 1LTGD 1TXYA 1G51A 2JP1A 5C4XH 3NE5B 3FKIB 2WAQG 2QF7A 2CH4W 1J5EQ 2HQEA 1BBXC 2ZXPA 4LAAA 2M2LA 2WIIB 5IP7G 4QMGA 1P8LA 4DK6C 4DPGA 3S1RH 3HRZC 1CKNB 1Q46A 2PI2A 2VW9A 3OMCA 4XDXA 1XMOL 1CZGA 1MIUA 3RN5A 2ICEC 1KLGD 5CC4A 3RZOH 1SMXA 3F2UA 4N8FA 1EY7A 1RCVD 2RDFA 3S16B 2PW5A 4TQUS 2KBNA 5C4JH 2JA8B 3FVQA 2F4VQ 1A8VA 4WJWA 4DR6L 4HJ5A 1YNXA 3LWEA 1T5XD 3E6ZX 3GV6A 4HTHA 2RSNA 1I4QA 1PTOD 4X66Q 2KECA 2Q2UA 4A3CH 1F77A 2D5DA 4F88A 1VQMA 3FDTA 4DR1L 4LF6L 2OCEA 1JOQA 4H7BA 4DUZL 4A3JG 1XNRL 1PZJD 4GKKQ 2NN6H 5J39A 5E7NA 1WD1A 3F1ZA 3M3YB 4JI1Q 2FHTA 1C8CA 2JA6H 3DWQA 1PTOB 4P71A 3EN2A 1GD7A 5CR3A 4FF3A 4A3DH 2K4KA 3UE1A 3NTIA 3FPPA 2F0VA 2ZXRA 4FXDA 4S3SA 2CQAA 3H6MA 4QB4A 1E2VA 1KLUD 2VQFL 4PZ6A 4JI3L 5C3EG 1VQDA 1XNQQ 4KY7A 1HR0L 1IW7C 1CQVA 1HUNA 3SGIA 1WTOA 4RGNA 5JPNC 2BA0A 4C3JG 2R7ZB 4QQBX 1UNSA 2GA4B 3MZ5A 5KNDA 1STNA 1I6HH 4HJAA 2CH4A 3CCRA 1CHPD 2ZTCA 2KHIA 2MO0A 5BN4A 2MGSA 4OL7A 1K8GA 1GUNA 3PO2H 3STBC 4R4CA 3NQTA 3HOXH 2R92H 4FVMA 3VYTA 5FLXE 2A69D 4C2MH 2F0JA 1JOOA 4A3BB 3BDOA 1J5EL 1TWAB 1EEID 1FNWA 3GP7A 1U4PA 3A5ZB 5A2QL 1PH6A 1I4HA 1QUQB 4IFDI 2EDGA 4DR5L 3G7LA 4L5RC 3MXUA 2R93H 5M5XB 2DJGC 1SFOB 1EQTA 2ALYB 2Z8LA 4F8MA 1JB7A 1F9RA 3NTHA 4LF9Q 2VXWA 4DU9A 3K5LA 2LSSA 4TSSA 2VUMH 3HOUG 4LW1A 1VQGA 4FF2A 3NBHA 5C0XH 1PH9A 1EYGA 3MAQA 3C46A 4R8NA 4RA8A 2B2UC 2F4VL 1EY0A 3EA6A 4G7HC 3DLLA 2OTJA 2NZ1D 3ERSX 4YWLA 1B9NA 4X66L 1RTNA 1B3AA 1ET9A 3JC66 1S5ED 5FO9B 4M1UB 1VQKA 1H9JA 3HG9A 1TR5A 3BDLA 1ICFB 1UE5A 2A6EC 4FDBA 2VY3A 3P75A 3VYUA 1IKLA 1UAPA 5ELBA 1B70B 2PCFB 5EBDA 1YJ9A 4GKKL 1ESRA 1SLJA 4JI1L 2IX0A 5IYBG 1TWCB 5EJWA 4A3DG 1GJXA 3QOLA 4O2DA 4DA2A 5CV8A 1WTWA 3CCLA 2NUCA 5LL6S 3H3VC 1R4PB 1GOZA 2FJ2A 2PQAB 2MNAA 1EIFA 4B3SQ 2Y0SG 3HOVG 3S16H 2O5JC 5DM63 4KN7C 1VQ4A 1KD1C 1S40A 3T4AC 2CKZB 2F0DA 2KUMA 1LTRD 2K04A 4BBSB 3KBGA 1XNQL 3BVZA 1S3OA 2ENBA 3CRKC 1ILQA 3UI2A 4BXXG 1HHVA 1H9MA 1X3QA 1OXUA 4DV7Q 3I91A 3KYHC 4L63B 4TVAB 5JOBA 2EY6A 4MTNA 4K8IA 5HGTA 4X65L 3M3YH 2B2YC 1RDPD 1PTOH 2HQLA 4IUVA 2E5LQ 4K0KL 5EPJA 4GKJQ 2HCIA 4CKBA 5LMNQ 1Z7TA 3D3RA 2OQKA 2XGTA 2HHHL 1EWCA 3TZDA 1TWFH 1QVCA 2N55A 3CQZB 4UHVA 1X54A 4BY1B 4A3KB 2N49A 3SXHA 4LF9L 4IJLA 4K5XA 4IZ8A 1HXYD 1B53A 2R7ZH 4KK7A 1HUMA 4XQQA 5I4DA 2C9OA 4B08A 5I2XA 1JICA 2B63B 3BZDB 3D4WA 2K5QA 4QL5A 3VR5A 5KNBA 1FJGQ 1X32A 2VL6A 1D7QA 1VQAA 1FGUA 1BCPC 1TWAH 4HN7A 1K83B 2DY7A 3T16A 3I70A 1S5DD 5AFWA 1G2TA 2F0EA 1IYUA 1N33L 1VQBA 5EGTA 1BCPF 3J7AF 2GVBA 2BOSA 4C1NI 2OWOA 3T1HL 5C4ZA 1SFOH 2B8FA 4IPDA 5ELDA 3E0JA 1LTAD 4IALA 4HIDA 2YTYA 5E4XA 1ZEQX 2EJFC 1IKMA 1JWMD 1YZ6A 4QIWE 3HKZB 4CJ2C 1L2FA 4OWXB 2WINB 1DOKA 4B3SL 4PZ7A 4KHPQ 5DLQE 2LMCB 1PFMA 3W1GA 1YBYA 1CM9A 4P74A 2CWPA 5CBAE 2BH2A 4QUFA 5CBEE 3I56A 1SMYD 2AWNA 5JEAG 2M9VA 4ID6A 1VQNA 1U4LA 1HTLD 1XYIA 3HOZB 1SDFA 3A0JA 2K1BA 4G57A 3R2IA 1LT3D 3A56A 4LWCA 5CYUA 4MN3A 4UP9A 2K32A 1Z47A 3GTGB 4KKSA 4LF8Q 1TWCH 2KHJA 2I0QA 4JI0Q 1II3A 3RMHA 2R7DA 4B9XA 3K0XA 4GKJL 1BDOA 1D8LA 3TDQA 5LMNL 1K9MC 2ZM6Q 1LT4D 4JV5L 2O4XA 1F2ZA 1C48A 1LTLA 1WTQA 4ZCKA 1ENCA 5ELOA 2RKSA 3BZCA 3I8ZA 2Z0SA 3EFXD 3L9AX 1PDQA 4N9PA 3CCMA 3I4NH 3TEHB 1LLRD 5CGKA 4BBSH 1JWSD 3ULJA 4K5VA 3ERQA 1QB5D 5C44B 1I3QB 3NBHB 4NP5A 1JJGA 1UE1A 1EYDA 3UDFA 4LFCQ 1E1OA 4Q0FA 1KNAA 2WB1G 4A3JB 5FLXL 4OO1G 2RF4A 2IY5B 1B4OA 2PO4A 5FLMG 1STYA 4HMJA 2L5TA 1PA6A 3QG1A 1W3SA 1SR3A 1G6PA 2TSSA 4CJ0B 2A19A 1PZID 4NXNQ 3S2DB 4PMCA 3M4YA 4J8QA 2RVLA 3CC2A 3F2CA 4LF5Q 3KLSX 4DR4Q 3CP0A 1HNWL 3J80i 2K6AA 2EY1A 4BBRG 3I3CA 5C3EB 1QWYA 3A8JE 4BY1H 2MHVA 2ICIA 4RH6A 4DAPA 2K5VA 4C3HG 4A3KH 4X3KA 2Q2TA 1RODA 1MI2A 1BO0A 1I6VC 4L6TB 1CT1D 4C3JB 4GN3B 4A3MG 2F0HA 4RGOS 3PMFA 1EQVA 3CCQA 4IFDG 1JJCB 1TS2A 1J8IA 1DCZA 4KHPL 1ML0D 4PQXA 3GTLB 1FD7D 2XWBB 4JBMA 2J4XA 1ILPA 2BH8A 3NK9A 2HDLA 5CMDA 1ENFA 2B2WC 3HZXA 1M90C 1G91A 2QEXA 2B2YA 4HSVA 2B63H 3NHHA 3RN2A 1R9TH 4DK0A 5EPKA 3Q8DA 1W2BA 1UEAB 1ASZA 1PYSB 5K36H 1K83H 1WD0A 3HOYG 1UEBA 5JJZA 1C0AA 2E2IB 1STBA 1PZKD 2HUGA 4JVZA 3NQIA 4KY5A 1BR9A 4LJZC 3HOUB 1GUGA 2CQOA 4JI0L 1VQFA 2PZUA 3BVGA 2F0OA 2IWHA 2ZM6L 1Y8OB 4HJ8A 1N34Q 3QR8A 2B3GA 2AMCB 2JA7G 4JPBW 4OXPA 2QDBA 1TKWB 1VQOA 3OPOA 3IKJA 2PW7A 5IT9c 5BR8L 2R61A 3PGZA 1PRTC 2KEEA 3BZKA 2L15A 3J7A5 1UWVA 3Q23A 2K75A 3CD6A 1VF7A 4J6HA 5IP7H 1HR0W 1HFNA 5D3DA 4I7AA 1PLFA 5BN3A 4CDCC 4PNYA 1IYVA 1VQJA 4DGZA 2HT1A 4A3DB 3E0EA 4F87A 1N8RC 4KHZA 1SAPA 1IW7D 1E0BA 1HZAA 3GTGH 1WTPA 4ZQ3A 4NXNL 3FMCA 4U68A 1ENAA 2ID0A 3MVVA 2ZXOA 4LF5L 4IPCA 2DJFC 1ZKOA 2Y0SB 4HIKA 1S5BD 3HOVB 4DR4L 2F3VA 4HR7B 3VA7A 1JCKB 5C6AA 4GLVB 4XXEA 4KJNA 2E2HH 1E2ZA 2K14A 3VR6A 2KCTA 2EYPA 1A6XA 3NTKA 1X65A 3KLWA 1K3RA 1LTBD 2UXCL 5HURA 4LF6Q 2F52A 2J0TD 1I3QH 1SNOA 2NTTA 4A3GG 4DFAA 1JQYD 2A8VA 2GVAA 4A3JH 1XNRQ 1HTPA 3E5SA 1ASYA 2CWAA 1O7LA 2E2JB 4AIMA 2B2TC 4HMIA 5CORA 4IUUA 3FEWX 4B9WA 2H4OA 1EU4A 5C5LA 2F0KA 2F0UA 3S2DH 1ICWA 3MXGA 2Z9HA 3A7AB 4IPHA 4O1NA 2IX1A 1SRUA 4CBVA 2XWJB 3K80C 3ULPA 1VQ8A 1VS0A 2D2CC 3I72A 5EKKA 4JI3Q 1Q8KA 3U4VA 3Q24A 4PZ8A 5C3EH 4GNXC 4G7ZC 4K6DA 1DOMA 3L2PA 4HIOA 2L12A 4DNTB 3C2PA 2KCMA 3FHWA 4C3JH 4DXFA 1SSOA 4A3EG 1BKBA 4LMQD 1O7ZA 1AN8A 2MQHA 4DR3L 5J1ZA 3GTKB 4DR2Q 1SNCA 1NUCA 5HY6A 1KDBA 1SYBA 4APVA 3GTLH 1AH9A 2IJ0A 3H0GG 2NYZD 2A68D 1PYWD 1IBLL 2F1MA 4HAEA 5G3LD 3A8IE 4EQPA 4X3SA 3J80E 2R6GA 2WV6D 3K5NA 3H3VI 4LF4Q 3DUZA 4DR5Q 3NPPA 2LXJA 1AZQA 1QZHA 3HP3A 1KXLA 4JOIC 2E2IH 1FL0A 3GTOH 3R8BA 4MTKA 2FMCA 3JAME 1XWEA 1G6ZA 1QNKA 4DAMA 4AYBE 3KJPA 2KOLA 3HOUH 2KHSA 1NBWA 2XSCA 2FXQA 1DM0B 1O80A 3NELA 1HA5A 1L0YB 1FVIA 1I4GA 3PF5A 4LF7Q 4R4QA 4XYOA 3HOWG 3DM3A 2Q8RE 2B2WA 3V05A 1IXRA 2K52A 1WTXA 1B8AA 1AE2A 5M9OA 4ZK9B 3TP8A 4R4IA 1YHBA 3KK7A 1VDZA 3G6EA 1KABA 4YCWA 1WTHA 1A2UA 4ZLTF 4KY6A 4EQ5A 5M5YH 2Z6KA 1Y14B 3QO2A 5IYBH 1VQIA 1XTDA 4ODGA 4KLKA 4QGUA 3CF5A 2MO1A 3GTPB 4JBJA 3H15A 3KLRA 1KDCA 1KRTA 5AJ3Q 2L11A 1YNJC 3GV3A 1TWFB 2NZOA 4A3IG 1YJWA 4OO1I 1XJVA 1YEZA 1JE5A 2RHQB 3HOVH 2CVRA 4V0BA 1LTTD 1SN8A 1QCBD 1X3GA 3SVMA 3CCJA 2K5DA 5D14A 1Q3LA 1PH2A 1JORA 1MBYA 3P20A 2A74C 2PNHA 1H9RA 3S15H 5ELNA 1DOLA 4CJ1B 4NXMQ 1BCPD 1M8AA 4OIJA 1EIYB 1CSPA 2F03A 2B2VC 4GLXA 3I4MG 4BXXH 2WB1B 3G48A 1PHJA 1CA6A 2E74C 4DR2L 4K8JA 5DEHA 4DV3L 2YYZA 1CHQD 2SNMA 3B6YA 4GOPA 4I7ZC 1PFSA 2QILA 2PZWA 4NKLA 1U4MA 3QOJA 5CV6A 4X65Q 4JG2A 1MKHA 2E2JH 1HZBA 1STHA 2XN9C 4IJHA 1BCPB 1YNND 4K0KQ 4KD4A 4G4KA 4Q5VA 3VR3A 4LF4L 2F0LA 1G291 2OT2A
chains in the Genus database with same CATH topology
2HCCA 4EGVA 3W3AA 4C3HB 1L0XB 2C5CA 5C3WA 4GZYC 1OXTA 5DNFA 2QCPX 4A3MB 1PFNA 1NAPA 3IFTA 4N9TA 4HCEA 3WOEA 4FF1A 3BYTB 1DJRD 1DZ1A 1RHPA 5TSSA 3SK6A 1MSHA 3K5OA 1XX8A 3HOYB 2V4DA 3H09A 3TMEA 1EWHA 1A3TA 1S5FD 3MFYA 1F9QA 3GO5A 3MFGA 4CHTB 3SHLA 2PZTA 2JA7B 3NSWA 3P1HA 1F2MA 3Q0AA 3D6CA 3I4NB 3Q6SA 4RKBA 3P7JA 5JVH3 2EYJA 1KNEA 1SE3A 3D8GA 5FO8B 5JEAH 1XXGA 3J7AV 2RSOA 1H9KA 4UAIA 2MP1A 1I50B 3D4DA 2AUJD 1ET6A 2CHBD 4XYQA 1BXTA 3S9WA 2PMZB 5T1GA 2K03A 1XTCD 3T56B 3MEHA 2KCCA 2FFKB 1ESFA 1LACA 3K5MA 3GTJB 2DN8A 3J81E 4P2CB 3VR2A 4IUQA 3VYRA 1JE4A 3H91A 5A35A 2E76C 1FYCA 4A3GB 2B8GA 3K58A 5JVG3 4OO1H 1EY9A 4KKTA 4BS9A 2K33A 2RDGA 4K5WA 3TZUA 3J80L 1R9TB 2XRSD 1LTSD 4OGQC 4G7OC 1QOHA 2K5WA 3QWNA 5KRUA 1A3UA 2F0QA 5KYLA 5EQ0A 3JAML 2XIWA 5CV5A 2F0NA 3KLSA 1PRTD 3NBIA 4A3EB 4BA1I 2B2VA 1G8ZD 1DD2A 4OIKA 4EQNA 4IFDH 3HEJA 1TY0A 2WACA 3H0GB 3S17B 4H0LC 2A69C 2WAQB 4V190 2F0PA 3KF8A 4XQNA 1PRTB 1LT5D 2M00A 4PV1C 3KBXA 5FK9C 5ELEA 4MIUA 3ZYYX 1C4QA 1GUTA 1BUVT 4QF4A 3M4OB 4K6LA 1FR3A 4FP5D 4WRDA 1FNUA 4MHEA 2Z4HA 5E4WC 2N88A 2B2UA 2VNUD 1EFID 3HOWB 4CGYB 2E2HB 1SYCA 4KKUA 3K6OA 5I6WA 2MPMA 3OIQA 2G9HD 2MJ8A 1Y69U 3IFDA 3R2TA 2KJXA 3T53B 2RA4A 3D31A 3KUPA 1BNZA 3OWFA 4C3IG 1J9OA 1SYDA 1TT2A 2EYLA 2K05A 1SNPA 1LABA 4A3IB 5DAUA 2RBMA 4XT1B 4K14A 3URYA 2AUKA 5CV9A 1B50A 4PMBA 3DWAA 5KIXA 5KNCA 1GUOA 3LNNA 3QB3A 1IL8A 3I4MB 2EOTA 1SJHD 1VF5C 2BE5C 5C0XJ 4RCNA 1AEXA 4XTCS 2KEDA 4XT3B 2EYHA 3CKIB 5IODA 4QCLA 4EQOA 4L8JA 1HCZA 3BYYB 2DNCA 5CV4A 3SDZA 2NVYB 3GTOB 1GHKA 4KTAA 1KDAA 4BY7B 3EJIA 1GHJA 3DWPA 3QJYA 2Q8IB 1EY6A 3S1QB 3A55A 1IHZA 1Y8PB 5ISRA 3VYSA 3AB9A 4HEDA 1LT6D 4J1MA 2AQ1B 1W6KA 1AP0A 4ZKBB 3X3MA 1JC7A 1QILA 3FRPB 2BA1A 2PPBC 1TS5A 1NR2A 1CA5A 4IQZA 1BOSA 5CV7A 2EPBA 1V8QA 1SNQA 3R93A 1YNJD 5M5YB 5FO7B 3GTMB 3RZDB 4KHVA 1EIHA 5BN5A 1EU3A 1CI3M 1Q1BA 3K0YA 4RHRA 2SDFA 4KD3A 4KJOA 2FMMA 5COYA 1STEA 3J81L 3I4LA 4C56C 2E75C 3S15B 5D3IB 4E6IA 1PFBA 1DONA 1HQRD 3W2DA 4TRDA 1VMCA 3LWUA 1ZYRC 2VB3X 1KAAA 3TP6A 3U9SA 3IL8A 3K57A 2F0GA 1TY2A 2AQ2B 4HCSA 1A2TA 1MGSA 1E2WA 5C4HA 3MC0B 2F0IA 4DF7A 5D65A 1GUSA 4H13C 3OIPA 5C0XI 1TWHB 1SE4A 3PO3B 3PUYA 2A6ED 3S1MB 4RGMA 5M5WB 2JA5B 3N52A 3CHBD 1RTOA 1SEBD 1OXVA 3S1NB 1HFGA 2DNEA 4DAVA 4KI0A 4XQJA 4X3TA 2A6HC 2OXPA 3VR4A 1UUPA 3L7ZC 3NXWA 2D9UA 4A93B 2F0TA 3PUVA 1B9MA 2E2DC 3ONAB 2QEJC 1TVXA 3NWTA 1JR0D 1Q12A 2JSOA 3M7NA 1D1IA 2LKVA 2MUYA 2KA7A 1T5EA 3J7YW 2BCOA 3V96A 3DEOA 3PUWA 5IGFA 1SNMA 3TP7A 3NUCA 1K8MA 2IL8A 5DM73 2JEBI 1I4PA 2XNAC 4C1NK 1I4XA 2IW3A 3EQLC 2EY5A 1QE6A 3V2TA 3Q22A 4HSPA 3PIP3 3SEBA 1V43A 5NUCA 2X6LA 3RD4A 2EVBA 3CU7A 4Z9CB 3K7AB 4IUTA 1DYQA 2F0WA 3ITPA 1Y1WB 2KVMA 2FINB 3I90A 1LO5D 5E1FA 1WCMB 4CKEA 1FGBD 2ZT9C 2X69A 2R3ZA 4PMWA 4DNRB 1HA6A 3BVMA 2AQ3B 2NVQB 3TN2A 4C3IB 4U673 4OHJA 4H44C 3MWYW 4QIWB 2HDMA 5T1IA 1SJED 5IGEA 4A3FB 2Q8TA 1F9PA 3SR1A 1V1PA 3C1EA 1TIID 4BBRB 5EKLA 2L0CA 3U9OA 4ILWA 1VCIA 2B39A 1V1OA 1SYFA 1RD9D 2BDOA 1JOKA 3SK4A 3GTQB 1WVLA 4FXKC 1Z6HA 3WDNA 1O7YA 1X3PA 1A3VA 2JYOA 3ND8A 2B2TA 3R3OA 1ZXTA 1EY8A 2CW0C 1SYEA 4IUPA 4Y7NB 3BDCA 3T13A 4FYDA 3OW7A 3HS0C 4IUNA 1CQFA 1RKNA 1F9SA 1Q8IA 2RQXA 2KQ3A 1D5ZC 2PNRC 1K8OA 2JEAI 1JWUD 1SE2A 2NN6G 1TWGB 1S4ZA 5M3FB 1WTRA 2A68C 1STAA 5E3FA 2XRQD 5FOBB 5IOCA 2NVTB 2L55A 2BDNA 1PMRA 3EROA 4DK1A 5IGBA 1LTID 4RFBA 1QNUA 1BQQT 2K01A 5EKIA 1EEFD 4BA2I 5G3LF 3O13A 4LK1C 5I2YA 1QG7A 2D62A 3QIAA 1TS4A 4FF4A 3NP8A 2NTSA 4RAUC 2K28A 5LHY1 2NB0A 2BE5D 2PYKA 4YIJA 4FNFA 3X3NA 2A5HA 1D6EC 1PTOC 4IURA 2LY7A 2L9HA 3PUXA 3BG3A 3VA5A 1KTKA 5KYIA 2JXMB 3SE0A 1RJTA 3D6WA 1PTOF 1H9SA 2O2LD 1F2LA 1MD2D 3TP5A 5IT9E 3TSSA 5C0XG 2EYOA 3OMGA 3SK5A 3SK8A 1I4RA 5I9OA 2EYFA 4ME5A 1SNDA 3K59A 3A8KE 4KMUC 1EOTA 4RCOA 3OWEB 1O78A 3PV0A 4O42A 2OF1A 1D1KA 3CRLC 3MXNA 3MTSA 2J7ZA 2EJMA 4FO2A 5I9PA 2EJGC 2K7VA 1TS3A 4IN3A 1A15A 5LL6X 5KGUA 1AW7A 4EVOA 2WKDA 2AWOA 3C3LA 5IGCA 4ZKCB 5M3MB 1YNNC 2F3WA 4DAYA 4RGTA 2G9DA 1EY5A 4X3UA 3MXPA 1NCVA 1R4QB 3DM1A 3DHQA 1EZ6A 3FPUB 1G2SA 3G6JB 1Q1EA 1D5XC 2F0MA 2NVXB 3M85A 1V1PB 4ZUIA 2O5IC 1CTMA 1BF4A 1Y8NB 2SEBD 1ZYRD 5IIFA 3N6RA 1NSNS 5JPMC 5K5PA 1AZPA 3C1FA 2KCNA 4JK1C 3S2HB 1SBBB 2X6GA 1M4VA 3OOCA 2LFNA 3IAYA 2IX3A 4F7XA 2H1EA 2NWGA 4R8IA 1HRJA 4RHSA 2OEOA 1CFMA 4DXGA 4NW2A 1OXXK 1EYCA 1CK1A 5I6YA 4XIGS 2EYMA 5ELCA 1U9RA 2NBFA 4JBWA 1GXDC 3NWSA 4ZUJA 4ZRZA 3OSOA 1FNVA 4CKCA 1DXMA 3RLFA 2A6HD 4KN4C 4NMZA 1U4RA 2EE1A 3OHXC 1Y1VB 5IGGA 3D4RA 2PQEA 2XVSA 1NR4A 1QJOA 1AFPA 4WORA 4ZAIA 5KEEA 4AYBB 1D5MC 3ND9A 2IT1A 5J22A 5IGDA 2F0SA 1EIGA 3LX0A 4NDXA 1S5CD 5C4XB 3A7LA 5C5MA 1JB3A 2F4IA 4UDUC 1W6JA 2VB2X 1RF2D 4WFN3 2Z1CA 4ABNA 2EZVA 3MA2B 5EBCA 1SXTA 5A2QE 1D2BA 2SNSA 4ULLA 3S1RB 1B2TA 1EYAA 4DN4M 4QUCA 4KV6A 3EVQA 1MSGA 2A73B 3RZOB 2F0FA 2LS01 3GQBA 5C4JB 3TBIB 1GUWA 2NN6I 1H9SB 2I07B 5JEAJ 3T51B 3AU7A 1EL0A 5F2DA 4BWGB 2L4NA 1HQMC 2WKCA 4FXGC 5C3XA 1WTVA 4M8AA 1EY4A 1PRTF 1ONLA 2TMPA 4RKLA 5EPLA 2JA6B 1B44D 1F2YA 2IPKD 3BS1A 1SMYC 3GD7A 1SYGA 1LV9A 3H94A 2RDHA 4K2LA 3MHBA 4K2KA 3WOFA 3L3OC 3AMUA 3A54A 5IT9L 1OO9B 1I6HB 3M7GA 3RUZA 2YU9B 1VMPA 3PO2B 3HOXB 2R92B 1EZ8A 1TQOA 1OXSC 4C2MB 3S14B 4I65A 1HPCA 2JE6I 1CZWA 5JAVA 2CW0D 5K36G 2R93B 2EY2A 4R9WA 2EXZA 3PIO3 1STGA 2Z4IA 4ZYSA 3PUZA 1PXUA 4IFDJ 2I46A 3DEPA 4RWSC 2QKIC 1Q90A 2DY8A 1TU2B 3I73A 2SOBA 2VUMB 3DXJC 3DMUA 4TKOB 5ELFA 3HGBA 2WP8J 1B1ZA 2L1BA 5FKAC 1LTGD 2JP1A 3NE5B 3FKIB 2QF7A 2HQEA 1BBXC 2ZXPA 4LAAA 2M2LA 2WIIB 4QMGA 3HRZC 3OMCA 4XDXA 1CZGA 2ICEC 1KLGD 5CC4A 3F2UA 1EY7A 1RCVD 2RDFA 3S16B 2PW5A 4TQUS 2JA8B 3FVQA 4WJWA 3LWEA 1T5XD 3E6ZX 3GV6A 4HTHA 2RSNA 1I4QA 1PTOD 2KECA 1F77A 2D5DA 4F88A 3FDTA 1JOQA 4H7BA 1PZJD 2NN6H 5J39A 1WD1A 3M3YB 2FHTA 1C8CA 3DWQA 1PTOB 5CR3A 4FF3A 3NTIA 3FPPA 2F0VA 2ZXRA 4FXDA 4S3SA 2CQAA 3H6MA 4QB4A 1E2VA 1KLUD 4KY7A 1HUNA 1IW7C 1CQVA 1WTOA 4RGNA 5JPNC 2BA0A 4C3JG 2R7ZB 1UNSA 2GA4B 3MZ5A 5KNDA 1STNA 1CHPD 5BN4A 2MGSA 4OL7A 1GUNA 3NQTA 4FVMA 3VYTA 5FLXE 2A69D 2F0JA 1JOOA 4A3BB 3BDOA 1TWAB 1EEID 1FNWA 3GP7A 1U4PA 5A2QL 4IFDI 1I4HA 2EDGA 3G7LA 3MXUA 5M5XB 1SFOB 1EQTA 2Z8LA 4F8MA 1F9RA 3NTHA 2VXWA 4DU9A 3K5LA 4TSSA 4FF2A 3NBHA 5C0XH 3MAQA 3C46A 4R8NA 4RA8A 2B2UC 1EY0A 3EA6A 4G7HC 2NZ1D 1B9NA 1RTNA 1B3AA 1ET9A 1S5ED 5FO9B 4M1UB 1H9JA 3HG9A 1TR5A 3BDLA 2A6EC 3P75A 3VYUA 1IKLA 1UAPA 5ELBA 2PCFB 5EBDA 1ESRA 2IX0A 1TWCB 5EJWA 1GJXA 3QOLA 4DA2A 5CV8A 1WTWA 2NUCA 5LL6S 3H3VC 1R4PB 1GOZA 2FJ2A 2O5JC 5DM63 4KN7C 3T4AC 2F0DA 2KUMA 1LTRD 2K04A 4BBSB 3KBGA 3BVZA 2ENBA 3CRKC 1ILQA 3UI2A 1HHVA 1H9MA 1X3QA 1OXUA 3I91A 4L63B 5JOBA 2EY6A 5HGTA 4K8IA 2B2YC 1RDPD 1PTOH 4IUVA 5EPJA 2HCIA 4CKBA 1Z7TA 3D3RA 1EWCA 3TZDA 2N55A 3CQZB 4BY1B 4A3KB 3SXHA 4K5XA 4IZ8A 1HXYD 1B53A 4KK7A 1HUMA 4XQQA 5I4DA 2C9OA 4B08A 5I2XA 1JICA 2B63B 3BZDB 3D4WA 2K5QA 3VR5A 5KNBA 1X32A 4HN7A 1BCPC 1K83B 2DY7A 3T16A 3I70A 1S5DD 5AFWA 1G2TA 2F0EA 1IYUA 5EGTA 1BCPF 3J7AF 4C1NI 2BOSA 5C4ZA 2B8FA 5ELDA 3E0JA 1LTAD 4IALA 5E4XA 1ZEQX 2EJFC 1IKMA 1JWMD 3HKZB 4CJ2C 2WINB 1DOKA 2LMCB 1PFMA 1CM9A 5CBAE 4QUFA 5CBEE 1SMYD 2AWNA 5JEAG 2M9VA 4ID6A 1U4LA 1HTLD 1XYIA 3HOZB 1SDFA 2K1BA 4G57A 3R2IA 1LT3D 3A56A 5CYUA 4MN3A 2K32A 1Z47A 3GTGB 4KKSA 1II3A 3RMHA 4B9XA 1BDOA 3TDQA 1LT4D 2O4XA 1F2ZA 1C48A 1WTQA 1ENCA 2RKSA 3I8ZA 3EFXD 3L9AX 1PDQA 4N9PA 1LLRD 5CGKA 1JWSD 4K5VA 3ERQA 1QB5D 5C44B 1I3QB 4NP5A 1EYDA 4Q0FA 1KNAA 4A3JB 5FLXL 4OO1G 1B4OA 2PO4A 1STYA 4HMJA 2L5TA 3QG1A 2TSSA 4CJ0B 1PZID 3S2DB 4PMCA 3M4YA 4J8QA 2RVLA 3KLSX 2K6AA 2EY1A 3I3CA 5C3EB 1QWYA 3A8JE 2MHVA 2ICIA 4RH6A 4DAPA 4C3HG 4X3KA 1RODA 1MI2A 1BO0A 1I6VC 4L6TB 1CT1D 4C3JB 2F0HA 4RGOS 3PMFA 1EQVA 4IFDG 1TS2A 1J8IA 1DCZA 1ML0D 4PQXA 3GTLB 1FD7D 2XWBB 2J4XA 1ILPA 3NK9A 2HDLA 5CMDA 1ENFA 2B2WC 3HZXA 1G91A 2B2YA 4HSVA 3NHHA 4DK0A 5EPKA 1UEAB 5K36H 1WD0A 5JJZA 2E2IB 1STBA 1PZKD 2HUGA 3NQIA 4KY5A 1BR9A 4LJZC 3HOUB 1GUGA 2PZUA 3BVGA 2F0OA 2IWHA 1Y8OB 2QDBA 1TKWB 3OPOA 3IKJA 2PW7A 2R61A 1PRTC 2KEEA 3Q23A 1VF7A 4J6HA 1HFNA 5D3DA 1PLFA 5BN3A 1IYVA 4PNYA 4DGZA 4A3DB 4F87A 4KHZA 1SAPA 1IW7D 1E0BA 1WTPA 4ZQ3A 3FMCA 4U68A 1ENAA 2ID0A 3MVVA 2ZXOA 1ZKOA 2Y0SB 3HOVB 1S5BD 2F3VA 4HR7B 3VA7A 1JCKB 5C6AA 4XXEA 4KJNA 1E2ZA 3VR6A 2EYPA 1A6XA 3NTKA 1LTBD 5HURA 2J0TD 1SNOA 2NTTA 4DFAA 1JQYD 1HTPA 3E5SA 1O7LA 2E2JB 2B2TC 4HMIA 5CORA 4IUUA 3FEWX 4B9WA 2H4OA 1EU4A 5C5LA 2F0KA 2F0UA 1ICWA 3MXGA 4O1NA 3A7AB 2IX1A 4CBVA 2XWJB 2D2CC 3I72A 5EKKA 3Q24A 4G7ZC 4K6DA 1DOMA 2L12A 4DNTB 3C2PA 4DXFA 1SSOA 4LMQD 1O7ZA 1AN8A 5J1ZA 3GTKB 1SNCA 1NUCA 1KDBA 1SYBA 2IJ0A 2NYZD 2A68D 1PYWD 2F1MA 5G3LD 4HAEA 3A8IE 4EQPA 4X3SA 3J80E 2R6GA 2WV6D 3K5NA 3DUZA 3NPPA 1AZQA 3HP3A 3R8BA 2FMCA 3JAME 1XWEA 1G6ZA 1QNKA 2KOLA 2KHSA 2XSCA 1DM0B 1O80A 1HA5A 1L0YB 1I4GA 4XYOA 2Q8RE 2B2WA 3V05A 1WTXA 5M9OA 4ZK9B 3TP8A 3KK7A 1VDZA 1KABA 4ZLTF 1A2UA 4KY6A 3QO2A 4ODGA 3GTPB 3KLRA 1KDCA 2L11A 1YNJC 3GV3A 1TWFB 4OO1I 2CVRA 4V0BA 1LTTD 1QCBD 3SVMA 2K5DA 5D14A 1Q3LA 1JORA 1MBYA 3P20A 2A74C 1H9RA 1DOLA 4CJ1B 1BCPD 1M8AA 4OIJA 2F03A 2B2VC 2WB1B 1CA6A 2E74C 4K8JA 5DEHA 2YYZA 1CHQD 2SNMA 4I7ZC 2QILA 2PZWA 4NKLA 1U4MA 3QOJA 5CV6A 1STHA 2XN9C 1BCPB 1YNND 4KD4A 4G4KA 4Q5VA 3VR3A 2F0LA 1G291 2OT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGC A;  5E3F A;  4HTH A;  5IOC A;  4J1M A;  1STY A;  4HMJ A;  5IGD A;  4PNY A;  2F3W A;  2F0S A;  4DGZ A;  3ERO A;  5IGB A;  3D4W A;  1EY5 A;  3RUZ A;  1SYC A;  3MXP A;  5C3W A;  3LX0 A;  4ZQ3 A;  1TR5 A;  3BDL A;  4PMC A;  4H7B A;  1ENA A;  1JOQ A;  4NDX A;  2KHS A;  1EZ8 A;  3T16 A;  3MVV A;  1TQO A;  3DHQ A;  3P75 A;  5I6W A;  1EZ6 A;  5CV7 A;  5C5M A;  2OXP A;  5J39 A;  2F0E A;  1SNQ A;  2F3V A;  2EY1 A;  5EGT A;  4I65 A;  3NXW A;  5IGE A;  3NP8 A;  5C4Z A;  5C6A A;  2F0M A;  5CR3 A;  2F0T A;  4N9T A;  3SR1 A;  3QOL A;  3C1E A;  4KJN A;  4ZUI A;  4KHV A;  3OWF A;  5JAV A;  1EY9 A;  4IAL A;  5CV8 A;  2F0V A;  2SNS A;  5IIF A;  4K5W A;  2EYP A;  2EY2 A;  2PYK A;  1SYD A;  4S3S A;  5EKL A;  5M9O A;  2EXZ A;  4YIJ A;  2NUC A;  1NSN S;  1TT2 A;  2F0H A;  3H6M A;  2EYL A;  4QB4 A;  1STG A;  3TP8 A;  3U9O A;  1EYA A;  3PMF A;  1EQV A;  5C4H A;  5HUR A;  4KV6 A;  1SNO A;  5K5P A;  1SNP A;  3EVQ A;  3SK6 A;  3C1F A;  1KAB A;  4DFA A;  1SYF A;  1A2U A;  4KD3 A;  4KJO A;  2F0D A;  2SOB A;  4KY6 A;  5KRU A;  2LKV A;  1A3U A;  2F0Q A;  1JOK A;  3DMU A;  3NK9 A;  3SK4 A;  5DAU A;  2RBM A;  5KYL A;  2F0F A;  3E5S A;  4K14 A;  4KY7 A;  3VA5 A;  3TME A;  3HZX A;  2ENB A;  5KYI A;  1A3T A;  4F7X A;  5CV5 A;  4HMI A;  4ODG A;  5CV9 A;  2F0N A;  3MZ5 A;  1STN A;  4PMB A;  4ID6 A;  5KIX A;  3NHH A;  1A3V A;  4B9W A;  5C5L A;  2F0K A;  2F0U A;  4OL7 A;  4E6I A;  1KDC A;  3R3O A;  5F2D A;  3TP5 A;  3QB3 A;  5IGF A;  3NQT A;  2OEO A;  1SNM A;  3SHL A;  3TP7 A;  4G57 A;  1STB A;  2PZT A;  3NUC A;  5JOB A;  4EQN A;  2F0J A;  2EY6 A;  3HEJ A;  3P1H A;  4TRD A;  1JOO A;  1EY8 A;  2WAC A;  4K8I A;  2HQE A;  4KY5 A;  5EKK A;  5HGT A;  1SYE A;  1EYC A;  1F2M A;  4LAA A;  3D6C A;  5I6Y A;  5J22 A;  2EYO A;  4K6D A;  3OMG A;  1JOR A;  1KAA A;  1II3 A;  2EYM A;  4RKB A;  3TP6 A;  3BDC A;  3SK5 A;  4B9X A;  3SK8 A;  2EYJ A;  2F0P A;  1U9R A;  3T13 A;  1AEX A;  2PZU A;  5I9O A;  2EYH A;  2EYF A;  1EY4 A;  2F0G A;  2F0O A;  4ME5 A;  4QMG A;  5IOD A;  1SND A;  2O4X A;  3D8G A;  4RKL A;  4ZUJ A;  2EY5 A;  4EQO A;  5C3X A;  3V2T A;  1F2Z A;  2M00 A;  4IUN A;  3OSO A;  5CV4 A;  1F2Y A;  3OMC A;  2QDB A;  1A2T A;  1ENC A;  3D4D A;  1SNC A;  5J1Z A;  5NUC A;  4F8M A;  1RKN A;  3SXH A;  1NUC A;  2RKS A;  4K8J A;  5DEH A;  4MIU A;  1KDB A;  1SYB A;  2SNM A;  1SYG A;  2KQ3 A;  4NMZ A;  2F0I A;  2OF1 A;  4DU9 A;  4K5X A;  4IZ8 A;  2PW7 A;  4N9P A;  4QF4 A;  4DF7 A;  5IGG A;  5CC4 A;  2PZW A;  4K2L A;  1KDA A;  2PQE A;  4KTA A;  3QOJ A;  4NKL A;  5CV6 A;  3EJI A;  5CGK A;  5I9P A;  4K5V A;  3ERQ A;  1EY7 A;  2F0W A;  3S9W A;  2RDF A;  4EQP A;  3MHB A;  1STH A;  4NP5 A;  2PW5 A;  1EY6 A;  3ITP A;  4WOR A;  4WRD A;  5KEE A;  5KGU A;  1EYD A;  4J6H A;  4KD4 A;  4R8N A;  3MEH A;  1IHZ A;  4EVO A;  1EY0 A;  2F0L A;  5ISR A;  1STA A;  4K2K A;  5E1F A; 
#chains in the Genus database with same CATH topology
 2HCC A;  1E1T A;  2HHH Q;  5GQO A;  4EGV A;  3W3A A;  2HIV A;  4C3H B;  4BY7 G;  2DUD A;  3AFP A;  1L0X B;  2C5C A;  2R7F A;  5JJI A;  5C3W A;  2ZTE A;  1OXT A;  4GZY C;  5DNF A;  2QCP X;  4A3M B;  1PFN A;  2LXK A;  1NAP A;  1MJC A;  3IFT A;  3LGJ A;  2RHS B;  3PO3 H;  4LF7 L;  1K73 C;  3TQY A;  4N9T A;  4HCE A;  3GTK H;  2AHO B;  5LMN W;  3WOE A;  4FF1 A;  1A0I A;  4R4T A;  3BYT B;  1DJR D;  1DZ1 A;  1RHP A;  1O7I A;  3J7Z C;  1PH1 A;  5TSS A;  4IOA A;  2P5Z X;  3SK6 A;  5IE8 A;  1MSH A;  3K5O A;  1XX8 A;  1C7Y A;  3HOY B;  1IYJ B;  2V4D A;  3NEM A;  3H09 A;  1N33 Q;  3TME A;  1EWH A;  1A3T A;  3T1H Q;  1K0R A;  1S5F D;  3MFY A;  3M9B A;  1F9Q A;  3GO5 A;  1NTG A;  3MFG A;  4CHT B;  5AJ3 L;  3SHL A;  2PZT A;  3H3V H;  2JA7 B;  3NSW A;  3P1H A;  4DV4 L;  2N8N A;  3CME A;  1F2M A;  4YY3 Q;  3D6C A;  3TRE A;  3Q0A A;  4B3T L;  3I4N B;  3Q6S A;  4RKB A;  5GRO A;  3P7J A;  5JVH 3;  2EYJ A;  1KNE A;  4Y52 H;  1SE3 A;  1E22 A;  3D8G A;  4NXM L;  5FO8 B;  5JEA H;  1XXG A;  3J7A V;  2RSO A;  1H9K A;  4UAI A;  2MP1 A;  1I50 B;  3HFZ B;  3D4D A;  2AUJ D;  1WI5 A;  1ET6 A;  4JOI A;  2CHB D;  4XYQ A;  2VS1 A;  2KEN A;  1BXT A;  3S9W A;  2PMZ B;  5T1G A;  2K03 A;  4NPS A;  1XTC D;  3T56 B;  3J80 c;  1Q81 C;  2EQS A;  3MEH A;  3A74 A;  1QVG A;  3GTP H;  2KCC A;  2FFK B;  1LM0 A;  4JV5 Q;  1ESF A;  1LAC A;  3K5M A;  3E3X A;  3GTJ B;  2DN8 A;  3J81 E;  4P2C B;  3VR2 A;  4IUQ A;  1P16 A;  1LYL A;  1RL2 A;  3VYR A;  2UUA L;  1JE4 A;  1JT8 A;  2JA9 A;  3H91 A;  2YV5 A;  3S24 A;  5A35 A;  1PV4 A;  2E76 C;  1FYC A;  4A3G B;  1GO3 E;  2B8G A;  3PO3 G;  3K58 A;  2JA5 G;  5JVG 3;  4OO1 H;  1T9H A;  5FLM H;  1EY9 A;  4KKT A;  4BS9 A;  2K33 A;  2RDG A;  4K5W A;  4LUV A;  3TZU A;  3J80 L;  3AYH B;  1R9T B;  2XRS D;  1LTS D;  4OGQ C;  2ASB A;  4G7O C;  1QOH A;  2K5W A;  3QWN A;  5KRU A;  1RIP A;  1A3U A;  4A93 G;  2F0Q A;  1KRS A;  5KYL A;  5EQ0 A;  3RLN A;  1HNW Q;  4GLA C;  3JAM L;  1C9O A;  2XIW A;  4BBR H;  4A3L G;  5CV5 A;  3TS2 A;  2F0N A;  4C3H H;  3FKI G;  3KLS A;  1YI2 A;  1PRT D;  2EIF A;  3NBI A;  4A3M H;  4A3E B;  4BA1 I;  2B2V A;  1G8Z D;  3PIO A;  1DD2 A;  4OIK A;  4EQN A;  4IFD H;  3HEJ A;  1TY0 A;  2WAC A;  4YY3 L;  2CFM A;  3H0G B;  3S17 B;  4H0L C;  2A69 C;  2WAQ B;  4V19 0;  2F0P A;  3KF8 A;  4XQN A;  1PRT B;  4L5S A;  1LT5 D;  4P73 A;  3I55 A;  2M00 A;  2NZH A;  4PV1 C;  3KBX A;  5FK9 C;  1EQQ A;  5ELE A;  4MIU A;  3ZYY X;  3HOY H;  5FLX c;  1C4Q A;  1VQ9 A;  1GUT A;  1BUV T;  1CUK A;  4QF4 A;  4GOP B;  3M4O B;  4JI7 L;  3E9I A;  1WFQ A;  4A76 A;  4K6L A;  1FR3 A;  4FP5 D;  1K3B C;  4WRD A;  1FNU A;  1HNZ Q;  3OTO L;  4MHE A;  2Z4H A;  1H95 A;  5E4W C;  2N88 A;  2B2U A;  2VNU D;  2JA7 H;  1EFI D;  2JK8 A;  2QGQ A;  3HOW B;  1IZ6 A;  4CGY B;  2E2H B;  5IYC G;  1SYC A;  4KKU A;  5BR8 Q;  1Y1W G;  2UXB Q;  2V1C C;  3K6O A;  5I6W A;  1WCM G;  2MPM A;  3OIQ A;  2G9H D;  2NVT H;  2MJ8 A;  1Y69 U;  3IFD A;  3R2T A;  2KJX A;  3T53 B;  5IWA Q;  1I50 H;  2RA4 A;  2RCN A;  4MZ9 A;  3D31 A;  3KUP A;  4JW0 A;  1BNZ A;  3OWF A;  4C3I G;  1J9O A;  3TRZ A;  1SYD A;  1TT2 A;  2EYL A;  1PH8 A;  4YHH Q;  2YTX A;  2K05 A;  1SNP A;  1LAB A;  5JJK A;  4A3F G;  4DV0 Q;  4A3I B;  2B29 A;  2RBM A;  4XT1 B;  5DAU A;  3F8T A;  4K14 A;  2K5N A;  4JI6 Q;  3URY A;  4J15 A;  2AUK A;  5CV9 A;  3RR5 A;  1B50 A;  3GTJ H;  4MNO A;  4PMB A;  3DWA A;  5KIX A;  2JJQ A;  5KNC A;  1GUO A;  2K5H A;  1VQ6 A;  4A3B G;  3LNN A;  1UE6 A;  3QB3 A;  2UXC Q;  3JAM i;  1IL8 A;  3I4M B;  2G5D A;  1N36 L;  1SE8 A;  3PQI A;  1KIX A;  2EOT A;  1SJH D;  4AH6 A;  4A3G H;  1VF5 C;  2BE5 C;  1I94 Q;  5C0X J;  4RCN A;  1AEX A;  4XTC S;  2KED A;  4XT3 B;  2CCZ A;  2EYH A;  3CKI B;  5IOD A;  4QCL A;  4EQO A;  4L8J A;  4P72 A;  1HCZ A;  2N3S A;  4WJ4 A;  3BYY B;  2DNC A;  2N78 A;  5CV4 A;  4OON A;  2VQE Q;  3SDZ A;  3M4P A;  2NVY B;  3GTO B;  1GHK A;  4KTA A;  1KDA A;  4BY7 B;  3EJI A;  3KDF A;  1GHJ A;  3DWP A;  3QJY A;  2Q8I B;  1PH4 A;  2VZA A;  2PI2 E;  4LUZ A;  1EY6 A;  3S1Q B;  3A55 A;  1IHZ A;  1Y8P B;  5ISR A;  1NJI C;  1KQS A;  3VYS A;  1HNZ L;  3AB9 A;  4HED A;  1LT6 D;  4J1M A;  2AQ1 B;  1W6K A;  4A3E H;  1AP0 A;  4ZKB B;  2UXD Q;  3X3M A;  2ZJP A;  4DR3 Q;  1JC7 A;  1QIL A;  1U0L A;  3FRP B;  3A5U A;  3KF6 A;  2BA1 A;  1I5F A;  1A63 A;  4X64 L;  2PPB C;  1TS5 A;  1NR2 A;  1CA5 A;  3RLO A;  4JI8 Q;  3H0G H;  4LUO A;  5M3F G;  3S17 H;  4IQZ A;  3T1Y Q;  1IBL Q;  1BOS A;  2UXB L;  5CV7 A;  2EPB A;  1V8Q A;  1SNQ A;  4IO9 A;  1YVC A;  3R93 A;  1YNJ D;  5M5Y B;  5FO7 B;  3GTM B;  3RZD B;  5IWA L;  4DV6 L;  3D0F A;  4KHV A;  1EIH A;  5BN5 A;  4WJ3 M;  1EU3 A;  3M4O H;  1CI3 M;  1Q1B A;  4YHH L;  3EBE A;  3K0Y A;  4RHR A;  2SDF A;  4KD3 A;  4KJO A;  2FMM A;  1BVS A;  5COY A;  4DV0 L;  3TS0 A;  1STE A;  1WJJ A;  4JI6 L;  1OTC A;  3J81 L;  3HKZ E;  3STB D;  3I4L A;  4C56 C;  3HOW H;  2E75 C;  3S15 B;  5D3I B;  4DV1 L;  1BBW A;  4E6I A;  1PFB A;  1DON A;  1HQR D;  4UPA A;  5IY0 A;  3K7U C;  1HJP A;  5IP9 G;  3W2D A;  4TRD A;  1VMC A;  3LWU A;  1ZYR C;  2VB3 X;  1KAA A;  1I94 L;  3TP6 A;  1VQL A;  1UE7 A;  3U9S A;  1Q86 C;  1E24 A;  3IL8 A;  3KF8 B;  3K57 A;  2F0G A;  1E7Z A;  1TY2 A;  2AQ2 B;  4JI2 Q;  4HCS A;  1A2T A;  1MGS A;  1Z9F A;  1E2W A;  1N9W A;  2VQE L;  1VQE A;  5C4H A;  3MC0 B;  5IYD G;  1XMQ Q;  2F0I A;  4A3I H;  4DF7 A;  2XTI A;  3I2Z A;  3CCU A;  1IBM Q;  4DUY Q;  5D65 A;  1L1O C;  1GUS A;  4H13 C;  2Z6B A;  3OIP A;  4CDF C;  3F2D A;  5C0X I;  1NMF A;  1TWH B;  4LNQ A;  1SE4 A;  3PO3 B;  3I4M H;  3PUY A;  2A6E D;  3S1M B;  4RGM A;  2UXD L;  5M5W B;  2JA5 B;  3N52 A;  3CHB D;  1RTO A;  4DV3 Q;  1EFW A;  1SEB D;  1OXV A;  3S1N B;  1HFG A;  2DNE A;  4JI8 L;  4KI0 A;  4DAV A;  2YTV A;  4XQJ A;  3T1Y L;  1V9P A;  4X3T A;  2A6H C;  2OXP A;  3VR4 A;  3L0O A;  1UUP A;  3L7Z C;  5M3M G;  3NXW A;  2D9U A;  4A93 B;  2F0T A;  3UDX A;  1KL9 A;  3PUV A;  2E8G A;  5GAG C;  1B9M A;  2NVY H;  2E2D C;  4CDD C;  5LMU L;  3KFU A;  3ONA B;  4BY7 H;  2QEJ C;  1TVX A;  3NWT A;  4IPG A;  3CPF A;  1JR0 D;  1Q12 A;  2JSO A;  3M7N A;  3S1Q H;  4QJF A;  1D1I A;  1XPU A;  1K28 A;  2LKV A;  4N8X 1;  3E9H A;  2MUY A;  3EIV A;  2KA7 A;  4HIM A;  5H1S E;  1T5E A;  5GAE C;  3J7Y W;  2OTL A;  4HJ9 A;  3HOZ G;  4H02 A;  2BCO A;  3V96 A;  2IHF A;  4YWM A;  3DEO A;  1YHA A;  3PUW A;  5IGF A;  1SNM A;  1GVP A;  3TP7 A;  3VDY A;  3J81 i;  3NUC A;  4OEM B;  4DR7 L;  3W5O A;  2ZJQ A;  1K8M A;  3CPW A;  2IL8 A;  1EOV A;  4JC0 A;  1QVF A;  2ZTD A;  5DM7 3;  2JEB I;  3GTM H;  3RZD H;  1I4P A;  2XNA C;  4C1N K;  1I4X A;  1PYB A;  2IW3 A;  3EQL C;  2EY5 A;  1QE6 A;  3V2T A;  3Q22 A;  4HSP A;  3PIP 3;  4JI2 L;  3SEB A;  1V43 A;  1KHI A;  4L5Q A;  3IRB A;  5NUC A;  2X6L A;  3RD4 A;  5C44 G;  5JJL A;  2EVB A;  3CU7 A;  4Z9C B;  1XMQ L;  2AKW B;  3BJU A;  3K7A B;  2ZJR A;  4IUT A;  1DYQ A;  4DV4 Q;  1IBK Q;  2D0P A;  3OYY A;  4OWT B;  2F0W A;  3U4Z A;  3KDF B;  4B3T Q;  3ITP A;  1IBM L;  1Y1W B;  4YCV A;  2KVM A;  4DUY L;  2FIN B;  3I90 A;  1LO5 D;  3ER0 A;  5E1F A;  1WCM B;  4CKE A;  2HD3 A;  1SRO A;  1FGB D;  2ZT9 C;  1Y1V G;  2X69 A;  3HKS A;  1KC8 C;  3CCE A;  2R3Z A;  4PMW A;  4DNR B;  1HA6 A;  1HZ9 A;  3BVM A;  2AQ3 B;  2NVQ B;  3KF6 B;  3TN2 A;  4C3I B;  1CKM A;  3CW2 C;  4AYB G;  4U67 3;  5FJ8 G;  1YIJ A;  4OHJ A;  4H44 C;  1NE3 A;  3I4O A;  3MWY W;  4QIW B;  2HDM A;  5T1I A;  4X62 Q;  1HH2 P;  1SJE D;  5IGE A;  4A3F B;  1X3F A;  2Q8T A;  1F9P A;  3SR1 A;  4POG A;  4YCU A;  1V1P A;  3C1E A;  2DGY A;  3WWV A;  1TII D;  2YU9 H;  4GN4 B;  3PF4 A;  4BBR B;  1K0S A;  5EKL A;  2L0C A;  2Y0S E;  5C4X G;  1J6Q A;  1EWI A;  3U9O A;  3S14 H;  4ILW A;  1VCI A;  2B39 A;  1V1O A;  1SYF A;  1RD9 D;  2BDO A;  2UUA Q;  1K8A C;  1JOK A;  3SK4 A;  3GTQ B;  1GM5 A;  1WVL A;  4FXK C;  1Z6H A;  1TWH H;  3WDN A;  1O7Y A;  1X3P A;  3S1M H;  2UUB Q;  5M5W H;  2JA5 H;  1A3V A;  2JYO A;  3ND8 A;  4R1J A;  2B2T A;  3S1N H;  3R3O A;  3CC7 A;  1ZXT A;  2H5X A;  1EY8 A;  2CW0 C;  3W1B A;  1SYE A;  2IHE A;  4IUP A;  4A93 H;  1YHQ A;  4Y7N B;  1BBU A;  3BDC A;  3T13 A;  4FYD A;  3OW7 A;  4OWW B;  4A3L H;  4GNX A;  3AQQ A;  1X56 A;  5EAY A;  3HS0 C;  4IUN A;  4A75 A;  1L1O A;  4A3C G;  3CAM A;  3FKI H;  1CQF A;  1RKN A;  4DV5 Q;  2JN4 A;  1S72 A;  1F9S A;  1Q8I A;  2K50 A;  2KQ3 A;  2RQX A;  2D0O A;  1D5Z C;  2PNR C;  1K8O A;  4YWK A;  1IBK L;  2JEA I;  2ES2 A;  1JWU D;  1E3P A;  1SE2 A;  2NN6 G;  1TWG B;  4DKA C;  3CMA A;  1S4Z A;  5M3F B;  2JA6 G;  3G71 A;  1WTR A;  2A68 C;  4B3M Q;  1STA A;  1WYD A;  5E3F A;  2XRQ D;  5FOB B;  5IOC A;  1X9N A;  2L55 A;  2NVT B;  2BDN A;  1PMR A;  1LUZ A;  3ERO A;  4DK1 A;  3KOJ A;  5HGQ A;  5IGB A;  4JI5 Q;  1PH5 A;  1LTI D;  4RFB A;  1QNU A;  1BQQ T;  2K01 A;  5EKI A;  1EEF D;  4BA2 I;  5G3L F;  2MFI A;  3UE0 A;  1Q82 C;  3O13 A;  2JA8 H;  4LK1 C;  3J81 j;  5I2Y A;  1Q7Y C;  4JI7 Q;  1NNX A;  1IL2 A;  1QG7 A;  4AQY Q;  2D62 A;  3QIA A;  1TS4 A;  4FF4 A;  4X62 L;  3OW2 A;  4IOC A;  3NP8 A;  2NTS A;  3CCS A;  1U5K A;  3OTO Q;  3KJO A;  4RAU C;  4LFA Q;  5J3B A;  2K28 A;  3U58 A;  5LHY 1;  2NB0 A;  3PO2 G;  2BE5 D;  2PYK A;  3K7A H;  3HOX G;  3JAM c;  2R92 G;  4YIJ A;  4FNF A;  3X3N A;  2A5H A;  2OQ0 A;  5IYC H;  1D6E C;  1PTO C;  4IUR A;  1Y1W H;  3CXC A;  2LY7 A;  1WCM H;  2L9H A;  3PUX A;  3BG3 A;  3VA5 A;  3UDI A;  1KTK A;  2WFW A;  5KYI A;  2JXM B;  3SE0 A;  1RJT A;  3D6W A;  2R93 G;  2Q2H A;  1PTO F;  1H9S A;  2O2L D;  2UUB L;  2EXD A;  1F2L A;  1MD2 D;  2NVQ H;  4UP8 A;  1QZG A;  4UP7 A;  4C3I H;  3GDE A;  3TP5 A;  2VUM G;  5IT9 E;  4GN5 A;  1VQ7 A;  3TSS A;  5C0X G;  2JQO A;  5GAH C;  4A3F H;  2EYO A;  3OMG A;  4DK3 C;  3SK5 A;  3SK8 A;  1I4R A;  5I9O A;  4DV2 Q;  2EYF A;  4ME5 A;  1SND A;  4OX9 Q;  3M4Q A;  1X55 A;  3K59 A;  3A8K E;  4KMU C;  1EOT A;  4RCO A;  4A3B H;  4DV5 L;  3OWE B;  1O78 A;  3PV0 A;  4O42 A;  2OF1 A;  1N36 Q;  1D1K A;  3GTQ H;  3CRL C;  3MXN A;  3MTS A;  2J7Z A;  4FO2 A;  2EJM A;  5I9P A;  2EJG C;  2K7V A;  1TS3 A;  4IN3 A;  1A15 A;  1VQC A;  5LL6 X;  2WB1 E;  5M5X H;  5KGU A;  1AW7 A;  1EUJ A;  3F2B A;  3CCV A;  4EVO A;  2WKD A;  2AWO A;  4B3M L;  3C3L A;  5IGC A;  4ZKC B;  2UU9 Q;  5M3M B;  1YNN C;  2F3W A;  4DAY A;  4RGT A;  2G9D A;  4JI5 L;  1EY5 A;  3ULL A;  4X3U A;  3MXP A;  2JA8 G;  1NCV A;  1R4Q B;  3DM1 A;  4Y7N H;  3DHQ A;  1EZ6 A;  4RMF A;  1CSQ A;  4AQY L;  3FPU B;  5L37 A;  1G2S A;  3G6J B;  1Q1E A;  1D5X C;  1VQ5 A;  2F0M A;  2NVX B;  4JI4 Q;  3M85 A;  1V1P B;  4ZUI A;  4O0A A;  1CTM A;  2O5I C;  4LFA L;  3AEV A;  1BF4 A;  4DV7 L;  1JJ2 A;  1Y8N B;  2SEB D;  1ZYR D;  5IIF A;  3N6R A;  4NB3 A;  1NSN S;  5JPM C;  4X64 Q;  1B3Q A;  1TWG H;  5K5P A;  1AZP A;  3C1F A;  4EX5 A;  4JYA Q;  5M3F H;  4GS3 A;  2KCN A;  4JK1 C;  3S2H B;  1SBB B;  2X6G A;  1M4V A;  3K81 C;  3OOC A;  2E5L L;  2LFN A;  3IAY A;  2IX3 A;  4F7X A;  2H1E A;  2NWG A;  4DV6 Q;  4R8I A;  1V1Q A;  1XPO A;  1KAW A;  1HRJ A;  4R4O A;  4RHS A;  4RG1 A;  2OEO A;  3K8A A;  1CFM A;  4DXG A;  4ME3 A;  4NW2 A;  1L0W A;  1OXX K;  4OEL B;  1EYC A;  3U50 C;  1CK1 A;  5I6Y A;  2R7Z G;  4XIG S;  2EYM A;  5ELC A;  1CKO A;  1U9R A;  2F3I A;  4DV2 L;  1A62 A;  1CKN A;  2NBF A;  4JBW A;  1GXD C;  3NWS A;  4ZUJ A;  4A4I A;  3RNU A;  4GNX B;  4OX9 L;  2ATW A;  4ZRZ A;  3OSO A;  2I5H A;  1L1O B;  1FNV A;  3PIP A;  1N32 Q;  4CKC A;  4DV1 Q;  1DXM A;  3RLF A;  2A6H D;  1FJG L;  4KN4 C;  4NMZ A;  1U4R A;  2EE1 A;  3OHX C;  1Y1V B;  4LFB Q;  5IGG A;  5IP9 H;  3D4R A;  2PQE A;  2XVS A;  3MEF A;  1NR4 A;  1QJO A;  1AFP A;  4WOR A;  4ZAI A;  5KEE A;  4AYB B;  1D5M C;  3CQZ H;  3ND9 A;  2IT1 A;  5J22 A;  2UU9 L;  5IGD A;  2F0S A;  3PSI A;  2PMZ E;  3ICE A;  4B3R Q;  1EIG A;  5IYD H;  3LX0 A;  2I5M X;  1YJN A;  2I5L X;  4NDX A;  1S5C D;  5C4X B;  3A7L A;  5C5M A;  1JB3 A;  2F4I A;  4UDU C;  1W6J A;  1WOC A;  2VB2 X;  1AE3 A;  1X3E A;  1RF2 D;  4WFN 3;  2HIX A;  2Z1C A;  4ABN A;  2EZV A;  3I7F A;  3MA2 B;  5EBC A;  4JI4 L;  1GKH A;  1JMC A;  1SXT A;  5A2Q E;  1D2B A;  2SNS A;  4ULL A;  3S1R B;  1B2T A;  3NEN A;  3J81 c;  1EYA A;  4DN4 M;  4QUC A;  4KV6 A;  2Z6K C;  3EVQ A;  1MSG A;  2A73 B;  4L5T A;  4PG3 A;  4JYA L;  4LF8 L;  4UY8 C;  3RZO B;  2F0F A;  5GAD C;  2GN5 A;  5M3M H;  4P75 A;  1HNX Q;  1B7Y B;  2LS0 1;  3GQB A;  5C4J B;  3TBI B;  2UUC Q;  1GUW A;  1NY4 A;  2NN6 I;  1H9S B;  2I07 B;  5JEA J;  3G4S A;  3T51 B;  3AU7 A;  1EL0 A;  5F2D A;  4BWG B;  5LMU Q;  3I4N G;  2L4N A;  3CC4 A;  1HQM C;  4BBS G;  1PVO A;  2WKC A;  4QY7 A;  1VQH A;  1QUQ A;  4FXG C;  5C3X A;  2NVX H;  2QDL A;  4LFC L;  1WTV A;  4M8A A;  1EY4 A;  1PRT F;  1ONL A;  2TMP A;  4RKL A;  3HOZ H;  5EPL A;  4GOP C;  2JA6 B;  1B44 D;  1F2Y A;  2A1A A;  1N32 L;  2IPK D;  1YIT A;  1MHW C;  1XMO Q;  4JCV E;  1SMY C;  3BS1 A;  2WAQ E;  1HZC A;  3GD7 A;  1SYG A;  4HJ7 A;  1LV9 A;  1EQR A;  3H94 A;  3S2H H;  4LFB L;  2RDH A;  1M1K C;  4K2L A;  4DR7 Q;  3MXN B;  1PH7 A;  3MHB A;  1MJE A;  4DR6 Q;  4BY1 G;  4DNI A;  4K2K A;  4A3K G;  3WOF A;  3L3O C;  3AMU A;  3BU2 A;  3A54 A;  5IT9 L;  4POF A;  4CDE C;  1DGS A;  1OO9 B;  2QA4 A;  4DAY B;  1I6H B;  3M7G A;  3RUZ A;  3ZJY C;  4DR1 Q;  2YU9 B;  5C44 H;  4B3R L;  1VMP A;  4DUZ Q;  3PO2 B;  3HOX B;  4ALP A;  2R92 B;  1EZ8 A;  1TQO A;  4JBK A;  1OXS C;  4C2M B;  3S14 B;  2QW7 A;  4I65 A;  1HPC A;  2B63 G;  2JE6 I;  3PCO B;  1CZW A;  2Q2I A;  5JAV A;  1XPR A;  1X6O A;  2CW0 D;  1Y1V H;  5K36 G;  2R93 B;  2EY2 A;  4R9W A;  2EXZ A;  2PQA A;  3PIO 3;  1STG A;  2Z4I A;  2VQF Q;  4ZYS A;  3PUZ A;  1PXU A;  4IFD J;  2I46 A;  3DEP A;  2QKI C;  1Q90 A;  3I73 A;  2DY8 A;  1TU2 B;  3AFQ A;  4RWS C;  2SOB A;  3UDG A;  2VUM B;  4X6A H;  5FJ8 H;  3DXJ C;  1VQP A;  3DMU A;  1NMG A;  1HR0 Q;  1PH3 A;  4TKO B;  3FP9 A;  5ELF A;  3HGB A;  1HNX L;  2WP8 J;  1N34 L;  2UUC L;  2RCF A;  1B1Z A;  3HKZ G;  2L1B A;  2C35 B;  5FKA C;  1LTG D;  1TXY A;  1G51 A;  2JP1 A;  5C4X H;  3NE5 B;  3FKI B;  2WAQ G;  2QF7 A;  2CH4 W;  1J5E Q;  2HQE A;  1BBX C;  2ZXP A;  4LAA A;  2M2L A;  2WII B;  5IP7 G;  4QMG A;  1P8L A;  4DK6 C;  4DPG A;  3S1R H;  3HRZ C;  1CKN B;  1Q46 A;  2PI2 A;  2VW9 A;  3OMC A;  4XDX A;  1XMO L;  1CZG A;  1MIU A;  3RN5 A;  2ICE C;  1KLG D;  5CC4 A;  3RZO H;  1SMX A;  3F2U A;  4N8F A;  1EY7 A;  1RCV D;  2RDF A;  3S16 B;  2PW5 A;  4TQU S;  2KBN A;  5C4J H;  2JA8 B;  3FVQ A;  2F4V Q;  1A8V A;  4WJW A;  4DR6 L;  4HJ5 A;  1YNX A;  3LWE A;  1T5X D;  3E6Z X;  3GV6 A;  4HTH A;  2RSN A;  1I4Q A;  1PTO D;  4X66 Q;  2KEC A;  2Q2U A;  4A3C H;  1F77 A;  2D5D A;  4F88 A;  1VQM A;  3FDT A;  4DR1 L;  4LF6 L;  2OCE A;  1JOQ A;  4H7B A;  4DUZ L;  4A3J G;  1XNR L;  1PZJ D;  4GKK Q;  2NN6 H;  5J39 A;  5E7N A;  1WD1 A;  3F1Z A;  3M3Y B;  4JI1 Q;  2FHT A;  1C8C A;  2JA6 H;  3DWQ A;  1PTO B;  4P71 A;  3EN2 A;  1GD7 A;  5CR3 A;  4FF3 A;  4A3D H;  2K4K A;  3UE1 A;  3NTI A;  3FPP A;  2F0V A;  2ZXR A;  4FXD A;  4S3S A;  2CQA A;  3H6M A;  4QB4 A;  1E2V A;  1KLU D;  2VQF L;  4PZ6 A;  4JI3 L;  5C3E G;  1VQD A;  1XNQ Q;  4KY7 A;  1HR0 L;  1IW7 C;  1CQV A;  1HUN A;  3SGI A;  1WTO A;  4RGN A;  5JPN C;  2BA0 A;  4C3J G;  2R7Z B;  4QQB X;  1UNS A;  2GA4 B;  3MZ5 A;  5KND A;  1STN A;  1I6H H;  4HJA A;  2CH4 A;  3CCR A;  1CHP D;  2ZTC A;  2KHI A;  2MO0 A;  5BN4 A;  2MGS A;  4OL7 A;  1K8G A;  1GUN A;  3PO2 H;  3STB C;  4R4C A;  3NQT A;  3HOX H;  2R92 H;  4FVM A;  3VYT A;  5FLX E;  2A69 D;  4C2M H;  2F0J A;  1JOO A;  4A3B B;  3BDO A;  1J5E L;  1TWA B;  1EEI D;  1FNW A;  3GP7 A;  1U4P A;  3A5Z B;  5A2Q L;  1PH6 A;  1I4H A;  1QUQ B;  4IFD I;  2EDG A;  4DR5 L;  3G7L A;  4L5R C;  3MXU A;  2R93 H;  5M5X B;  2DJG C;  1SFO B;  1EQT A;  2ALY B;  2Z8L A;  4F8M A;  1JB7 A;  1F9R A;  3NTH A;  4LF9 Q;  2VXW A;  4DU9 A;  3K5L A;  2LSS A;  4TSS A;  2VUM H;  3HOU G;  4LW1 A;  1VQG A;  4FF2 A;  3NBH A;  5C0X H;  1PH9 A;  1EYG A;  3MAQ A;  3C46 A;  4R8N A;  4RA8 A;  2B2U C;  2F4V L;  1EY0 A;  3EA6 A;  4G7H C;  3DLL A;  2OTJ A;  2NZ1 D;  3ERS X;  4YWL A;  1B9N A;  4X66 L;  1RTN A;  1B3A A;  1ET9 A;  3JC6 6;  1S5E D;  5FO9 B;  4M1U B;  1VQK A;  1H9J A;  3HG9 A;  1TR5 A;  3BDL A;  1ICF B;  1UE5 A;  2A6E C;  4FDB A;  2VY3 A;  3P75 A;  3VYU A;  1IKL A;  1UAP A;  5ELB A;  1B70 B;  2PCF B;  5EBD A;  1YJ9 A;  4GKK L;  1ESR A;  1SLJ A;  4JI1 L;  2IX0 A;  5IYB G;  1TWC B;  5EJW A;  4A3D G;  1GJX A;  3QOL A;  4O2D A;  4DA2 A;  5CV8 A;  1WTW A;  3CCL A;  2NUC A;  5LL6 S;  3H3V C;  1R4P B;  1GOZ A;  2FJ2 A;  2PQA B;  2MNA A;  1EIF A;  4B3S Q;  2Y0S G;  3HOV G;  3S16 H;  2O5J C;  5DM6 3;  4KN7 C;  1VQ4 A;  1KD1 C;  1S40 A;  3T4A C;  2CKZ B;  2F0D A;  2KUM A;  1LTR D;  2K04 A;  4BBS B;  3KBG A;  1XNQ L;  3BVZ A;  1S3O A;  2ENB A;  3CRK C;  1ILQ A;  3UI2 A;  4BXX G;  1HHV A;  1H9M A;  1X3Q A;  1OXU A;  4DV7 Q;  3I91 A;  3KYH C;  4L63 B;  4TVA B;  5JOB A;  2EY6 A;  4MTN A;  4K8I A;  5HGT A;  4X65 L;  3M3Y H;  2B2Y C;  1RDP D;  1PTO H;  2HQL A;  4IUV A;  2E5L Q;  4K0K L;  5EPJ A;  4GKJ Q;  2HCI A;  4CKB A;  5LMN Q;  1Z7T A;  3D3R A;  2OQK A;  2XGT A;  2HHH L;  1EWC A;  3TZD A;  1TWF H;  1QVC A;  2N55 A;  3CQZ B;  4UHV A;  1X54 A;  4BY1 B;  4A3K B;  2N49 A;  3SXH A;  4LF9 L;  4IJL A;  4K5X A;  4IZ8 A;  1HXY D;  1B53 A;  2R7Z H;  4KK7 A;  1HUM A;  4XQQ A;  5I4D A;  2C9O A;  4B08 A;  5I2X A;  1JIC A;  2B63 B;  3BZD B;  3D4W A;  2K5Q A;  4QL5 A;  3VR5 A;  5KNB A;  1FJG Q;  1X32 A;  2VL6 A;  1D7Q A;  1VQA A;  1FGU A;  1BCP C;  1TWA H;  4HN7 A;  1K83 B;  2DY7 A;  3T16 A;  3I70 A;  1S5D D;  5AFW A;  1G2T A;  2F0E A;  1IYU A;  1N33 L;  1VQB A;  5EGT A;  1BCP F;  3J7A F;  2GVB A;  2BOS A;  4C1N I;  2OWO A;  3T1H L;  5C4Z A;  1SFO H;  2B8F A;  4IPD A;  5ELD A;  3E0J A;  1LTA D;  4IAL A;  4HID A;  2YTY A;  5E4X A;  1ZEQ X;  2EJF C;  1IKM A;  1JWM D;  1YZ6 A;  4QIW E;  3HKZ B;  4CJ2 C;  1L2F A;  4OWX B;  2WIN B;  1DOK A;  4B3S L;  4PZ7 A;  4KHP Q;  5DLQ E;  2LMC B;  1PFM A;  3W1G A;  1YBY A;  1CM9 A;  4P74 A;  2CWP A;  5CBA E;  2BH2 A;  4QUF A;  5CBE E;  3I56 A;  1SMY D;  2AWN A;  5JEA G;  2M9V A;  4ID6 A;  1VQN A;  1U4L A;  1HTL D;  1XYI A;  3HOZ B;  1SDF A;  3A0J A;  2K1B A;  4G57 A;  3R2I A;  1LT3 D;  3A56 A;  4LWC A;  5CYU A;  4MN3 A;  4UP9 A;  2K32 A;  1Z47 A;  3GTG B;  4KKS A;  4LF8 Q;  1TWC H;  2KHJ A;  2I0Q A;  4JI0 Q;  1II3 A;  3RMH A;  2R7D A;  4B9X A;  3K0X A;  4GKJ L;  1BDO A;  1D8L A;  3TDQ A;  5LMN L;  1K9M C;  2ZM6 Q;  1LT4 D;  4JV5 L;  2O4X A;  1F2Z A;  1C48 A;  1LTL A;  1WTQ A;  4ZCK A;  1ENC A;  5ELO A;  2RKS A;  3BZC A;  3I8Z A;  2Z0S A;  3EFX D;  3L9A X;  1PDQ A;  4N9P A;  3CCM A;  3I4N H;  3TEH B;  1LLR D;  5CGK A;  4BBS H;  1JWS D;  3ULJ A;  4K5V A;  3ERQ A;  1QB5 D;  5C44 B;  1I3Q B;  3NBH B;  4NP5 A;  1JJG A;  1UE1 A;  1EYD A;  3UDF A;  4LFC Q;  1E1O A;  4Q0F A;  1KNA A;  2WB1 G;  4A3J B;  5FLX L;  4OO1 G;  2RF4 A;  2IY5 B;  1B4O A;  2PO4 A;  5FLM G;  1STY A;  4HMJ A;  2L5T A;  1PA6 A;  3QG1 A;  1W3S A;  1SR3 A;  1G6P A;  2TSS A;  4CJ0 B;  2A19 A;  1PZI D;  4NXN Q;  3S2D B;  4PMC A;  3M4Y A;  4J8Q A;  2RVL A;  3CC2 A;  3F2C A;  4LF5 Q;  3KLS X;  4DR4 Q;  3CP0 A;  1HNW L;  3J80 i;  2K6A A;  2EY1 A;  4BBR G;  3I3C A;  5C3E B;  1QWY A;  3A8J E;  4BY1 H;  2MHV A;  2ICI A;  4RH6 A;  4DAP A;  2K5V A;  4C3H G;  4A3K H;  4X3K A;  2Q2T A;  1ROD A;  1MI2 A;  1BO0 A;  1I6V C;  4L6T B;  1CT1 D;  4C3J B;  4GN3 B;  4A3M G;  2F0H A;  4RGO S;  3PMF A;  1EQV A;  3CCQ A;  4IFD G;  1JJC B;  1TS2 A;  1J8I A;  1DCZ A;  4KHP L;  1ML0 D;  4PQX A;  3GTL B;  1FD7 D;  2XWB B;  4JBM A;  2J4X A;  1ILP A;  2BH8 A;  3NK9 A;  2HDL A;  5CMD A;  1ENF A;  2B2W C;  3HZX A;  1M90 C;  1G91 A;  2QEX A;  2B2Y A;  4HSV A;  2B63 H;  3NHH A;  3RN2 A;  1R9T H;  4DK0 A;  5EPK A;  3Q8D A;  1W2B A;  1UEA B;  1ASZ A;  1PYS B;  5K36 H;  1K83 H;  1WD0 A;  3HOY G;  1UEB A;  5JJZ A;  1C0A A;  2E2I B;  1STB A;  1PZK D;  2HUG A;  4JVZ A;  3NQI A;  4KY5 A;  1BR9 A;  4LJZ C;  3HOU B;  1GUG A;  2CQO A;  4JI0 L;  1VQF A;  2PZU A;  3BVG A;  2F0O A;  2IWH A;  2ZM6 L;  1Y8O B;  4HJ8 A;  1N34 Q;  3QR8 A;  2B3G A;  2AMC B;  2JA7 G;  4JPB W;  4OXP A;  2QDB A;  1TKW B;  1VQO A;  3OPO A;  3IKJ A;  2PW7 A;  5IT9 c;  5BR8 L;  2R61 A;  3PGZ A;  1PRT C;  2KEE A;  3BZK A;  2L15 A;  3J7A 5;  1UWV A;  3Q23 A;  2K75 A;  3CD6 A;  1VF7 A;  4J6H A;  5IP7 H;  1HR0 W;  1HFN A;  5D3D A;  4I7A A;  1PLF A;  5BN3 A;  4CDC C;  4PNY A;  1IYV A;  1VQJ A;  4DGZ A;  2HT1 A;  4A3D B;  3E0E A;  4F87 A;  1N8R C;  4KHZ A;  1SAP A;  1IW7 D;  1E0B A;  1HZA A;  3GTG H;  1WTP A;  4ZQ3 A;  4NXN L;  3FMC A;  4U68 A;  1ENA A;  2ID0 A;  3MVV A;  2ZXO A;  4LF5 L;  4IPC A;  2DJF C;  1ZKO A;  2Y0S B;  4HIK A;  1S5B D;  3HOV B;  4DR4 L;  2F3V A;  4HR7 B;  3VA7 A;  1JCK B;  5C6A A;  4GLV B;  4XXE A;  4KJN A;  2E2H H;  1E2Z A;  2K14 A;  3VR6 A;  2KCT A;  2EYP A;  1A6X A;  3NTK A;  1X65 A;  3KLW A;  1K3R A;  1LTB D;  2UXC L;  5HUR A;  4LF6 Q;  2F52 A;  2J0T D;  1I3Q H;  1SNO A;  2NTT A;  4A3G G;  4DFA A;  1JQY D;  2A8V A;  2GVA A;  4A3J H;  1XNR Q;  1HTP A;  3E5S A;  1ASY A;  2CWA A;  1O7L A;  2E2J B;  4AIM A;  2B2T C;  4HMI A;  5COR A;  4IUU A;  3FEW X;  4B9W A;  2H4O A;  1EU4 A;  5C5L A;  2F0K A;  2F0U A;  3S2D H;  1ICW A;  3MXG A;  2Z9H A;  3A7A B;  4IPH A;  4O1N A;  2IX1 A;  1SRU A;  4CBV A;  2XWJ B;  3K80 C;  3ULP A;  1VQ8 A;  1VS0 A;  2D2C C;  3I72 A;  5EKK A;  4JI3 Q;  1Q8K A;  3U4V A;  3Q24 A;  4PZ8 A;  5C3E H;  4GNX C;  4G7Z C;  4K6D A;  1DOM A;  3L2P A;  4HIO A;  2L12 A;  4DNT B;  3C2P A;  2KCM A;  3FHW A;  4C3J H;  4DXF A;  1SSO A;  4A3E G;  1BKB A;  4LMQ D;  1O7Z A;  1AN8 A;  2MQH A;  4DR3 L;  5J1Z A;  3GTK B;  4DR2 Q;  1SNC A;  1NUC A;  5HY6 A;  1KDB A;  1SYB A;  4APV A;  3GTL H;  1AH9 A;  2IJ0 A;  3H0G G;  2NYZ D;  2A68 D;  1PYW D;  1IBL L;  2F1M A;  4HAE A;  5G3L D;  3A8I E;  4EQP A;  4X3S A;  3J80 E;  2R6G A;  2WV6 D;  3K5N A;  3H3V I;  4LF4 Q;  3DUZ A;  4DR5 Q;  3NPP A;  2LXJ A;  1AZQ A;  1QZH A;  3HP3 A;  1KXL A;  4JOI C;  2E2I H;  1FL0 A;  3GTO H;  3R8B A;  4MTK A;  2FMC A;  3JAM E;  1XWE A;  1G6Z A;  1QNK A;  4DAM A;  4AYB E;  3KJP A;  2KOL A;  3HOU H;  2KHS A;  1NBW A;  2XSC A;  2FXQ A;  1DM0 B;  1O80 A;  3NEL A;  1HA5 A;  1L0Y B;  1FVI A;  1I4G A;  3PF5 A;  4LF7 Q;  4R4Q A;  4XYO A;  3HOW G;  3DM3 A;  2Q8R E;  2B2W A;  3V05 A;  1IXR A;  2K52 A;  1WTX A;  1B8A A;  1AE2 A;  5M9O A;  4ZK9 B;  3TP8 A;  4R4I A;  1YHB A;  3KK7 A;  1VDZ A;  3G6E A;  1KAB A;  4YCW A;  1WTH A;  1A2U A;  4ZLT F;  4KY6 A;  4EQ5 A;  5M5Y H;  2Z6K A;  1Y14 B;  3QO2 A;  5IYB H;  1VQI A;  1XTD A;  4ODG A;  4KLK A;  4QGU A;  3CF5 A;  2MO1 A;  3GTP B;  4JBJ A;  3H15 A;  3KLR A;  1KDC A;  1KRT A;  5AJ3 Q;  2L11 A;  1YNJ C;  3GV3 A;  1TWF B;  2NZO A;  4A3I G;  1YJW A;  4OO1 I;  1XJV A;  1YEZ A;  1JE5 A;  2RHQ B;  3HOV H;  2CVR A;  4V0B A;  1LTT D;  1SN8 A;  1QCB D;  1X3G A;  3SVM A;  3CCJ A;  2K5D A;  5D14 A;  1Q3L A;  1PH2 A;  1JOR A;  1MBY A;  3P20 A;  2A74 C;  2PNH A;  1H9R A;  3S15 H;  5ELN A;  1DOL A;  4CJ1 B;  4NXM Q;  1BCP D;  1M8A A;  4OIJ A;  1EIY B;  1CSP A;  2F03 A;  2B2V C;  4GLX A;  3I4M G;  4BXX H;  2WB1 B;  3G48 A;  1PHJ A;  1CA6 A;  2E74 C;  4DR2 L;  4K8J A;  5DEH A;  4DV3 L;  2YYZ A;  1CHQ D;  2SNM A;  3B6Y A;  4GOP A;  4I7Z C;  1PFS A;  2QIL A;  2PZW A;  4NKL A;  1U4M A;  3QOJ A;  5CV6 A;  4X65 Q;  4JG2 A;  1MKH A;  2E2J H;  1HZB A;  1STH A;  2XN9 C;  4IJH A;  1BCP B;  1YNN D;  4K0K Q;  4KD4 A;  4G4K A;  4Q5V A;  3VR3 A;  4LF4 L;  2F0L A;  1G29 1;  2OT2 A; 
#chains in the Genus database with same CATH homology
 2HCC A;  4EGV A;  3W3A A;  4C3H B;  1L0X B;  2C5C A;  5C3W A;  4GZY C;  1OXT A;  5DNF A;  2QCP X;  4A3M B;  1PFN A;  1NAP A;  3IFT A;  4N9T A;  4HCE A;  3WOE A;  4FF1 A;  3BYT B;  1DJR D;  1DZ1 A;  1RHP A;  5TSS A;  3SK6 A;  1MSH A;  3K5O A;  1XX8 A;  3HOY B;  2V4D A;  3H09 A;  3TME A;  1EWH A;  1A3T A;  1S5F D;  3MFY A;  1F9Q A;  3GO5 A;  3MFG A;  4CHT B;  3SHL A;  2PZT A;  2JA7 B;  3NSW A;  3P1H A;  1F2M A;  3Q0A A;  3D6C A;  3I4N B;  3Q6S A;  4RKB A;  3P7J A;  5JVH 3;  2EYJ A;  1KNE A;  1SE3 A;  3D8G A;  5FO8 B;  5JEA H;  1XXG A;  3J7A V;  2RSO A;  1H9K A;  4UAI A;  2MP1 A;  1I50 B;  3D4D A;  2AUJ D;  1ET6 A;  2CHB D;  4XYQ A;  1BXT A;  3S9W A;  2PMZ B;  5T1G A;  2K03 A;  1XTC D;  3T56 B;  3MEH A;  2KCC A;  2FFK B;  1ESF A;  1LAC A;  3K5M A;  3GTJ B;  2DN8 A;  3J81 E;  4P2C B;  3VR2 A;  4IUQ A;  3VYR A;  1JE4 A;  3H91 A;  5A35 A;  2E76 C;  1FYC A;  4A3G B;  2B8G A;  3K58 A;  5JVG 3;  4OO1 H;  1EY9 A;  4KKT A;  4BS9 A;  2K33 A;  2RDG A;  4K5W A;  3TZU A;  3J80 L;  1R9T B;  2XRS D;  1LTS D;  4OGQ C;  4G7O C;  1QOH A;  2K5W A;  3QWN A;  5KRU A;  1A3U A;  2F0Q A;  5KYL A;  5EQ0 A;  3JAM L;  2XIW A;  5CV5 A;  2F0N A;  3KLS A;  1PRT D;  3NBI A;  4A3E B;  4BA1 I;  2B2V A;  1G8Z D;  1DD2 A;  4OIK A;  4EQN A;  4IFD H;  3HEJ A;  1TY0 A;  2WAC A;  3H0G B;  3S17 B;  4H0L C;  2A69 C;  2WAQ B;  4V19 0;  2F0P A;  3KF8 A;  4XQN A;  1PRT B;  1LT5 D;  2M00 A;  4PV1 C;  3KBX A;  5FK9 C;  5ELE A;  4MIU A;  3ZYY X;  1C4Q A;  1GUT A;  1BUV T;  4QF4 A;  3M4O B;  4K6L A;  1FR3 A;  4FP5 D;  4WRD A;  1FNU A;  4MHE A;  2Z4H A;  5E4W C;  2N88 A;  2B2U A;  2VNU D;  1EFI D;  3HOW B;  4CGY B;  2E2H B;  1SYC A;  4KKU A;  3K6O A;  5I6W A;  2MPM A;  3OIQ A;  2G9H D;  2MJ8 A;  1Y69 U;  3IFD A;  3R2T A;  2KJX A;  3T53 B;  2RA4 A;  3D31 A;  3KUP A;  1BNZ A;  3OWF A;  4C3I G;  1J9O A;  1SYD A;  1TT2 A;  2EYL A;  2K05 A;  1SNP A;  1LAB A;  4A3I B;  5DAU A;  2RBM A;  4XT1 B;  4K14 A;  3URY A;  2AUK A;  5CV9 A;  1B50 A;  4PMB A;  3DWA A;  5KIX A;  5KNC A;  1GUO A;  3LNN A;  3QB3 A;  1IL8 A;  3I4M B;  2EOT A;  1SJH D;  1VF5 C;  2BE5 C;  5C0X J;  4RCN A;  1AEX A;  4XTC S;  2KED A;  4XT3 B;  2EYH A;  3CKI B;  5IOD A;  4QCL A;  4EQO A;  4L8J A;  1HCZ A;  3BYY B;  2DNC A;  5CV4 A;  3SDZ A;  2NVY B;  3GTO B;  1GHK A;  4KTA A;  1KDA A;  4BY7 B;  3EJI A;  1GHJ A;  3DWP A;  3QJY A;  2Q8I B;  1EY6 A;  3S1Q B;  3A55 A;  1IHZ A;  1Y8P B;  5ISR A;  3VYS A;  3AB9 A;  4HED A;  1LT6 D;  4J1M A;  2AQ1 B;  1W6K A;  1AP0 A;  4ZKB B;  3X3M A;  1JC7 A;  1QIL A;  3FRP B;  2BA1 A;  2PPB C;  1TS5 A;  1NR2 A;  1CA5 A;  4IQZ A;  1BOS A;  5CV7 A;  2EPB A;  1V8Q A;  1SNQ A;  3R93 A;  1YNJ D;  5M5Y B;  5FO7 B;  3GTM B;  3RZD B;  4KHV A;  1EIH A;  5BN5 A;  1EU3 A;  1CI3 M;  1Q1B A;  3K0Y A;  4RHR A;  2SDF A;  4KD3 A;  4KJO A;  2FMM A;  5COY A;  1STE A;  3J81 L;  3I4L A;  4C56 C;  2E75 C;  3S15 B;  5D3I B;  4E6I A;  1PFB A;  1DON A;  1HQR D;  3W2D A;  4TRD A;  1VMC A;  3LWU A;  1ZYR C;  2VB3 X;  1KAA A;  3TP6 A;  3U9S A;  3IL8 A;  3K57 A;  2F0G A;  1TY2 A;  2AQ2 B;  4HCS A;  1A2T A;  1MGS A;  1E2W A;  5C4H A;  3MC0 B;  2F0I A;  4DF7 A;  5D65 A;  1GUS A;  4H13 C;  3OIP A;  5C0X I;  1TWH B;  1SE4 A;  3PO3 B;  3PUY A;  2A6E D;  3S1M B;  4RGM A;  5M5W B;  2JA5 B;  3N52 A;  3CHB D;  1RTO A;  1SEB D;  1OXV A;  3S1N B;  1HFG A;  2DNE A;  4DAV A;  4KI0 A;  4XQJ A;  4X3T A;  2A6H C;  2OXP A;  3VR4 A;  1UUP A;  3L7Z C;  3NXW A;  2D9U A;  4A93 B;  2F0T A;  3PUV A;  1B9M A;  2E2D C;  3ONA B;  2QEJ C;  1TVX A;  3NWT A;  1JR0 D;  1Q12 A;  2JSO A;  3M7N A;  1D1I A;  2LKV A;  2MUY A;  2KA7 A;  1T5E A;  3J7Y W;  2BCO A;  3V96 A;  3DEO A;  3PUW A;  5IGF A;  1SNM A;  3TP7 A;  3NUC A;  1K8M A;  2IL8 A;  5DM7 3;  2JEB I;  1I4P A;  2XNA C;  4C1N K;  1I4X A;  2IW3 A;  3EQL C;  2EY5 A;  1QE6 A;  3V2T A;  3Q22 A;  4HSP A;  3PIP 3;  3SEB A;  1V43 A;  5NUC A;  2X6L A;  3RD4 A;  2EVB A;  3CU7 A;  4Z9C B;  3K7A B;  4IUT A;  1DYQ A;  2F0W A;  3ITP A;  1Y1W B;  2KVM A;  2FIN B;  3I90 A;  1LO5 D;  5E1F A;  1WCM B;  4CKE A;  1FGB D;  2ZT9 C;  2X69 A;  2R3Z A;  4PMW A;  4DNR B;  1HA6 A;  3BVM A;  2AQ3 B;  2NVQ B;  3TN2 A;  4C3I B;  4U67 3;  4OHJ A;  4H44 C;  3MWY W;  4QIW B;  2HDM A;  5T1I A;  1SJE D;  5IGE A;  4A3F B;  2Q8T A;  1F9P A;  3SR1 A;  1V1P A;  3C1E A;  1TII D;  4BBR B;  5EKL A;  2L0C A;  3U9O A;  4ILW A;  1VCI A;  2B39 A;  1V1O A;  1SYF A;  1RD9 D;  2BDO A;  1JOK A;  3SK4 A;  3GTQ B;  1WVL A;  4FXK C;  1Z6H A;  3WDN A;  1O7Y A;  1X3P A;  1A3V A;  2JYO A;  3ND8 A;  2B2T A;  3R3O A;  1ZXT A;  1EY8 A;  2CW0 C;  1SYE A;  4IUP A;  4Y7N B;  3BDC A;  3T13 A;  4FYD A;  3OW7 A;  3HS0 C;  4IUN A;  1CQF A;  1RKN A;  1F9S A;  1Q8I A;  2RQX A;  2KQ3 A;  1D5Z C;  2PNR C;  1K8O A;  2JEA I;  1JWU D;  1SE2 A;  2NN6 G;  1TWG B;  1S4Z A;  5M3F B;  1WTR A;  2A68 C;  1STA A;  5E3F A;  2XRQ D;  5FOB B;  5IOC A;  2NVT B;  2L55 A;  2BDN A;  1PMR A;  3ERO A;  4DK1 A;  5IGB A;  1LTI D;  4RFB A;  1QNU A;  1BQQ T;  2K01 A;  5EKI A;  1EEF D;  4BA2 I;  5G3L F;  3O13 A;  4LK1 C;  5I2Y A;  1QG7 A;  2D62 A;  3QIA A;  1TS4 A;  4FF4 A;  3NP8 A;  2NTS A;  4RAU C;  2K28 A;  5LHY 1;  2NB0 A;  2BE5 D;  2PYK A;  4YIJ A;  4FNF A;  3X3N A;  2A5H A;  1D6E C;  1PTO C;  4IUR A;  2LY7 A;  2L9H A;  3PUX A;  3BG3 A;  3VA5 A;  1KTK A;  5KYI A;  2JXM B;  3SE0 A;  1RJT A;  3D6W A;  1PTO F;  1H9S A;  2O2L D;  1F2L A;  1MD2 D;  3TP5 A;  5IT9 E;  3TSS A;  5C0X G;  2EYO A;  3OMG A;  3SK5 A;  3SK8 A;  1I4R A;  5I9O A;  2EYF A;  4ME5 A;  1SND A;  3K59 A;  3A8K E;  4KMU C;  1EOT A;  4RCO A;  3OWE B;  1O78 A;  3PV0 A;  4O42 A;  2OF1 A;  1D1K A;  3CRL C;  3MXN A;  3MTS A;  2J7Z A;  2EJM A;  4FO2 A;  5I9P A;  2EJG C;  2K7V A;  1TS3 A;  4IN3 A;  1A15 A;  5LL6 X;  5KGU A;  1AW7 A;  4EVO A;  2WKD A;  2AWO A;  3C3L A;  5IGC A;  4ZKC B;  5M3M B;  1YNN C;  2F3W A;  4DAY A;  4RGT A;  2G9D A;  1EY5 A;  4X3U A;  3MXP A;  1NCV A;  1R4Q B;  3DM1 A;  3DHQ A;  1EZ6 A;  3FPU B;  1G2S A;  3G6J B;  1Q1E A;  1D5X C;  2F0M A;  2NVX B;  3M85 A;  1V1P B;  4ZUI A;  2O5I C;  1CTM A;  1BF4 A;  1Y8N B;  2SEB D;  1ZYR D;  5IIF A;  3N6R A;  1NSN S;  5JPM C;  5K5P A;  1AZP A;  3C1F A;  2KCN A;  4JK1 C;  3S2H B;  1SBB B;  2X6G A;  1M4V A;  3OOC A;  2LFN A;  3IAY A;  2IX3 A;  4F7X A;  2H1E A;  2NWG A;  4R8I A;  1HRJ A;  4RHS A;  2OEO A;  1CFM A;  4DXG A;  4NW2 A;  1OXX K;  1EYC A;  1CK1 A;  5I6Y A;  4XIG S;  2EYM A;  5ELC A;  1U9R A;  2NBF A;  4JBW A;  1GXD C;  3NWS A;  4ZUJ A;  4ZRZ A;  3OSO A;  1FNV A;  4CKC A;  1DXM A;  3RLF A;  2A6H D;  4KN4 C;  4NMZ A;  1U4R A;  2EE1 A;  3OHX C;  1Y1V B;  5IGG A;  3D4R A;  2PQE A;  2XVS A;  1NR4 A;  1QJO A;  1AFP A;  4WOR A;  4ZAI A;  5KEE A;  4AYB B;  1D5M C;  3ND9 A;  2IT1 A;  5J22 A;  5IGD A;  2F0S A;  1EIG A;  3LX0 A;  4NDX A;  1S5C D;  5C4X B;  3A7L A;  5C5M A;  1JB3 A;  2F4I A;  4UDU C;  1W6J A;  2VB2 X;  1RF2 D;  4WFN 3;  2Z1C A;  4ABN A;  2EZV A;  3MA2 B;  5EBC A;  1SXT A;  5A2Q E;  1D2B A;  2SNS A;  4ULL A;  3S1R B;  1B2T A;  1EYA A;  4DN4 M;  4QUC A;  4KV6 A;  3EVQ A;  1MSG A;  2A73 B;  3RZO B;  2F0F A;  2LS0 1;  3GQB A;  5C4J B;  3TBI B;  1GUW A;  2NN6 I;  1H9S B;  2I07 B;  5JEA J;  3T51 B;  3AU7 A;  1EL0 A;  5F2D A;  4BWG B;  2L4N A;  1HQM C;  2WKC A;  4FXG C;  5C3X A;  1WTV A;  4M8A A;  1EY4 A;  1PRT F;  1ONL A;  2TMP A;  4RKL A;  5EPL A;  2JA6 B;  1B44 D;  1F2Y A;  2IPK D;  3BS1 A;  1SMY C;  3GD7 A;  1SYG A;  1LV9 A;  3H94 A;  2RDH A;  4K2L A;  3MHB A;  4K2K A;  3WOF A;  3L3O C;  3AMU A;  3A54 A;  5IT9 L;  1OO9 B;  1I6H B;  3M7G A;  3RUZ A;  2YU9 B;  1VMP A;  3PO2 B;  3HOX B;  2R92 B;  1EZ8 A;  1TQO A;  1OXS C;  4C2M B;  3S14 B;  4I65 A;  1HPC A;  2JE6 I;  1CZW A;  5JAV A;  2CW0 D;  5K36 G;  2R93 B;  2EY2 A;  4R9W A;  2EXZ A;  3PIO 3;  1STG A;  2Z4I A;  4ZYS A;  3PUZ A;  1PXU A;  4IFD J;  2I46 A;  3DEP A;  4RWS C;  2QKI C;  1Q90 A;  2DY8 A;  1TU2 B;  3I73 A;  2SOB A;  2VUM B;  3DXJ C;  3DMU A;  4TKO B;  5ELF A;  3HGB A;  2WP8 J;  1B1Z A;  2L1B A;  5FKA C;  1LTG D;  2JP1 A;  3NE5 B;  3FKI B;  2QF7 A;  2HQE A;  1BBX C;  2ZXP A;  4LAA A;  2M2L A;  2WII B;  4QMG A;  3HRZ C;  3OMC A;  4XDX A;  1CZG A;  2ICE C;  1KLG D;  5CC4 A;  3F2U A;  1EY7 A;  1RCV D;  2RDF A;  3S16 B;  2PW5 A;  4TQU S;  2JA8 B;  3FVQ A;  4WJW A;  3LWE A;  1T5X D;  3E6Z X;  3GV6 A;  4HTH A;  2RSN A;  1I4Q A;  1PTO D;  2KEC A;  1F77 A;  2D5D A;  4F88 A;  3FDT A;  1JOQ A;  4H7B A;  1PZJ D;  2NN6 H;  5J39 A;  1WD1 A;  3M3Y B;  2FHT A;  1C8C A;  3DWQ A;  1PTO B;  5CR3 A;  4FF3 A;  3NTI A;  3FPP A;  2F0V A;  2ZXR A;  4FXD A;  4S3S A;  2CQA A;  3H6M A;  4QB4 A;  1E2V A;  1KLU D;  4KY7 A;  1HUN A;  1IW7 C;  1CQV A;  1WTO A;  4RGN A;  5JPN C;  2BA0 A;  4C3J G;  2R7Z B;  1UNS A;  2GA4 B;  3MZ5 A;  5KND A;  1STN A;  1CHP D;  5BN4 A;  2MGS A;  4OL7 A;  1GUN A;  3NQT A;  4FVM A;  3VYT A;  5FLX E;  2A69 D;  2F0J A;  1JOO A;  4A3B B;  3BDO A;  1TWA B;  1EEI D;  1FNW A;  3GP7 A;  1U4P A;  5A2Q L;  4IFD I;  1I4H A;  2EDG A;  3G7L A;  3MXU A;  5M5X B;  1SFO B;  1EQT A;  2Z8L A;  4F8M A;  1F9R A;  3NTH A;  2VXW A;  4DU9 A;  3K5L A;  4TSS A;  4FF2 A;  3NBH A;  5C0X H;  3MAQ A;  3C46 A;  4R8N A;  4RA8 A;  2B2U C;  1EY0 A;  3EA6 A;  4G7H C;  2NZ1 D;  1B9N A;  1RTN A;  1B3A A;  1ET9 A;  1S5E D;  5FO9 B;  4M1U B;  1H9J A;  3HG9 A;  1TR5 A;  3BDL A;  2A6E C;  3P75 A;  3VYU A;  1IKL A;  1UAP A;  5ELB A;  2PCF B;  5EBD A;  1ESR A;  2IX0 A;  1TWC B;  5EJW A;  1GJX A;  3QOL A;  4DA2 A;  5CV8 A;  1WTW A;  2NUC A;  5LL6 S;  3H3V C;  1R4P B;  1GOZ A;  2FJ2 A;  2O5J C;  5DM6 3;  4KN7 C;  3T4A C;  2F0D A;  2KUM A;  1LTR D;  2K04 A;  4BBS B;  3KBG A;  3BVZ A;  2ENB A;  3CRK C;  1ILQ A;  3UI2 A;  1HHV A;  1H9M A;  1X3Q A;  1OXU A;  3I91 A;  4L63 B;  5JOB A;  2EY6 A;  5HGT A;  4K8I A;  2B2Y C;  1RDP D;  1PTO H;  4IUV A;  5EPJ A;  2HCI A;  4CKB A;  1Z7T A;  3D3R A;  1EWC A;  3TZD A;  2N55 A;  3CQZ B;  4BY1 B;  4A3K B;  3SXH A;  4K5X A;  4IZ8 A;  1HXY D;  1B53 A;  4KK7 A;  1HUM A;  4XQQ A;  5I4D A;  2C9O A;  4B08 A;  5I2X A;  1JIC A;  2B63 B;  3BZD B;  3D4W A;  2K5Q A;  3VR5 A;  5KNB A;  1X32 A;  4HN7 A;  1BCP C;  1K83 B;  2DY7 A;  3T16 A;  3I70 A;  1S5D D;  5AFW A;  1G2T A;  2F0E A;  1IYU A;  5EGT A;  1BCP F;  3J7A F;  4C1N I;  2BOS A;  5C4Z A;  2B8F A;  5ELD A;  3E0J A;  1LTA D;  4IAL A;  5E4X A;  1ZEQ X;  2EJF C;  1IKM A;  1JWM D;  3HKZ B;  4CJ2 C;  2WIN B;  1DOK A;  2LMC B;  1PFM A;  1CM9 A;  5CBA E;  4QUF A;  5CBE E;  1SMY D;  2AWN A;  5JEA G;  2M9V A;  4ID6 A;  1U4L A;  1HTL D;  1XYI A;  3HOZ B;  1SDF A;  2K1B A;  4G57 A;  3R2I A;  1LT3 D;  3A56 A;  5CYU A;  4MN3 A;  2K32 A;  1Z47 A;  3GTG B;  4KKS A;  1II3 A;  3RMH A;  4B9X A;  1BDO A;  3TDQ A;  1LT4 D;  2O4X A;  1F2Z A;  1C48 A;  1WTQ A;  1ENC A;  2RKS A;  3I8Z A;  3EFX D;  3L9A X;  1PDQ A;  4N9P A;  1LLR D;  5CGK A;  1JWS D;  4K5V A;  3ERQ A;  1QB5 D;  5C44 B;  1I3Q B;  4NP5 A;  1EYD A;  4Q0F A;  1KNA A;  4A3J B;  5FLX L;  4OO1 G;  1B4O A;  2PO4 A;  1STY A;  4HMJ A;  2L5T A;  3QG1 A;  2TSS A;  4CJ0 B;  1PZI D;  3S2D B;  4PMC A;  3M4Y A;  4J8Q A;  2RVL A;  3KLS X;  2K6A A;  2EY1 A;  3I3C A;  5C3E B;  1QWY A;  3A8J E;  2MHV A;  2ICI A;  4RH6 A;  4DAP A;  4C3H G;  4X3K A;  1ROD A;  1MI2 A;  1BO0 A;  1I6V C;  4L6T B;  1CT1 D;  4C3J B;  2F0H A;  4RGO S;  3PMF A;  1EQV A;  4IFD G;  1TS2 A;  1J8I A;  1DCZ A;  1ML0 D;  4PQX A;  3GTL B;  1FD7 D;  2XWB B;  2J4X A;  1ILP A;  3NK9 A;  2HDL A;  5CMD A;  1ENF A;  2B2W C;  3HZX A;  1G91 A;  2B2Y A;  4HSV A;  3NHH A;  4DK0 A;  5EPK A;  1UEA B;  5K36 H;  1WD0 A;  5JJZ A;  2E2I B;  1STB A;  1PZK D;  2HUG A;  3NQI A;  4KY5 A;  1BR9 A;  4LJZ C;  3HOU B;  1GUG A;  2PZU A;  3BVG A;  2F0O A;  2IWH A;  1Y8O B;  2QDB A;  1TKW B;  3OPO A;  3IKJ A;  2PW7 A;  2R61 A;  1PRT C;  2KEE A;  3Q23 A;  1VF7 A;  4J6H A;  1HFN A;  5D3D A;  1PLF A;  5BN3 A;  1IYV A;  4PNY A;  4DGZ A;  4A3D B;  4F87 A;  4KHZ A;  1SAP A;  1IW7 D;  1E0B A;  1WTP A;  4ZQ3 A;  3FMC A;  4U68 A;  1ENA A;  2ID0 A;  3MVV A;  2ZXO A;  1ZKO A;  2Y0S B;  3HOV B;  1S5B D;  2F3V A;  4HR7 B;  3VA7 A;  1JCK B;  5C6A A;  4XXE A;  4KJN A;  1E2Z A;  3VR6 A;  2EYP A;  1A6X A;  3NTK A;  1LTB D;  5HUR A;  2J0T D;  1SNO A;  2NTT A;  4DFA A;  1JQY D;  1HTP A;  3E5S A;  1O7L A;  2E2J B;  2B2T C;  4HMI A;  5COR A;  4IUU A;  3FEW X;  4B9W A;  2H4O A;  1EU4 A;  5C5L A;  2F0K A;  2F0U A;  1ICW A;  3MXG A;  4O1N A;  3A7A B;  2IX1 A;  4CBV A;  2XWJ B;  2D2C C;  3I72 A;  5EKK A;  3Q24 A;  4G7Z C;  4K6D A;  1DOM A;  2L12 A;  4DNT B;  3C2P A;  4DXF A;  1SSO A;  4LMQ D;  1O7Z A;  1AN8 A;  5J1Z A;  3GTK B;  1SNC A;  1NUC A;  1KDB A;  1SYB A;  2IJ0 A;  2NYZ D;  2A68 D;  1PYW D;  2F1M A;  5G3L D;  4HAE A;  3A8I E;  4EQP A;  4X3S A;  3J80 E;  2R6G A;  2WV6 D;  3K5N A;  3DUZ A;  3NPP A;  1AZQ A;  3HP3 A;  3R8B A;  2FMC A;  3JAM E;  1XWE A;  1G6Z A;  1QNK A;  2KOL A;  2KHS A;  2XSC A;  1DM0 B;  1O80 A;  1HA5 A;  1L0Y B;  1I4G A;  4XYO A;  2Q8R E;  2B2W A;  3V05 A;  1WTX A;  5M9O A;  4ZK9 B;  3TP8 A;  3KK7 A;  1VDZ A;  1KAB A;  4ZLT F;  1A2U A;  4KY6 A;  3QO2 A;  4ODG A;  3GTP B;  3KLR A;  1KDC A;  2L11 A;  1YNJ C;  3GV3 A;  1TWF B;  4OO1 I;  2CVR A;  4V0B A;  1LTT D;  1QCB D;  3SVM A;  2K5D A;  5D14 A;  1Q3L A;  1JOR A;  1MBY A;  3P20 A;  2A74 C;  1H9R A;  1DOL A;  4CJ1 B;  1BCP D;  1M8A A;  4OIJ A;  2F03 A;  2B2V C;  2WB1 B;  1CA6 A;  2E74 C;  4K8J A;  5DEH A;  2YYZ A;  1CHQ D;  2SNM A;  4I7Z C;  2QIL A;  2PZW A;  4NKL A;  1U4M A;  3QOJ A;  5CV6 A;  1STH A;  2XN9 C;  1BCP B;  1YNN D;  4KD4 A;  4G4K A;  4Q5V A;  3VR3 A;  2F0L A;  1G29 1;  2OT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...