1G2TA

Solution structure of eotaxin-3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure and backbone dynamics of the CC chemokine eotaxin-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords EOTAXIN-3
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g2tA00
2K28A 2K1BA 1CM9A 1BNZA 4QUCA 4ZKCB 1HUNA 2B2VA 1EIHA 1GUWA 1C8CA 1KNAA 2X69A 2X6GA 1MGSA 2M2LA 2K03A 1VMCA 5CBEE 5CMDA 1HHVA 3IL8A 1BO0A 1X3QA 4CJ2C 2RSNA 2B2UC 2JP1A 4IUPA 1G2SA 3N52A 1B3AA 2DY7A 2SDFA 1WTRA 4LMQD 2N88A 1JICA 4NW2A 1DZ1A 1EIGA 3D6WA 2FJ2A 1X3PA 4IUTA 5CBAE 2RA4A 1WD1A 5E4XA 2Q8RE 1MSHA 3I8ZA 1DOLA 2NWGA 3MWYW 2B2YA 2K04A 2B2VC 2KVMA 1F9RA 5D14A 3I91A 3P7JA 2CVRA 3TZDA 2B2TA 1AZPA 5EPLA 1HA6A 3SVMA 4X3SA 4UAIA 2KECA 1F9PA 1RTOA 4IUVA 3I3CA 1WTWA 3DEPA 4X3TA 1HFNA 1WTXA 1J8IA 1PFNA 1O7YA 2KEEA 2HUGA 1RHPA 1HRJA 2KEDA 4ZKBB 3MTSA 4MHEA 2NYZD 1WTPA 3QO2A 3Q6SA 4CJ1B 4HEDA 1QE6A 1B53A 2Q8TA 1F9SA 2B2UA 1B2TA 1S4ZA 2VXWA 4X3UA 2DY8A 4ZAIA 1IKMA 3HP3A 2EE1A 4XDXA 3I90A 1F9QA 3GV6A 1U4MA 2FFKB 2B2WC 2EPBA 2MJ8A 1NCVA 1PFBA 4ZLTF 2MPMA 2B2TC 2B2YC 3LWEA 1J9OA 5EPKA 5EQ0A 1BBXC 1Q3LA 3R93A 1DOMA 2IL8A 1KNEA 1EOTA 5E4WC 4QUFA 1CA6A 1G2TA 1WTOA 4XT3B 1EL0A 1X32A 1PDQA 4ZK9B 1RJTA 2FHTA 4O42A 1SSOA 1WTQA 5EKIA 1WTVA 1MSGA 1A15A 1NAPA 2K01A 1CA5A 1DONA 2J7ZA 2JYOA 1ZXTA 2HCIA 4HAEA 4IUQA 2EOTA 2K05A 1EQTA 2MP1A 1B50A 3TN2A 1MI2A 1U4LA 4OIKA 1HFGA 4RA8A 1SAPA 5EJWA 4CJ0B 1AP0A 1RTNA 4OIJA 4DN4M 1ML0D 4MN3A 1NR4A 3UI2A 4HSVA 1ILPA 1U4RA 1PFMA 2RSOA 5T1GA 4XT1B 2B2WA 1NR2A 1JE4A 2KUMA 3ONAB 1B4OA 4IUUA 4RWSC 1WD0A 1PLFA 1U4PA 2HCCA 1IKLA 1RODA 2RVLA 1QNKA 5JJZA 1XYIA 2X6LA 2L9HA 3FPUB 1ILQA 1G6ZA 1BF4A 4IURA 5COYA 2D9UA 1XX8A 5DNFA 2FMMA 3G7LA 1E0BA 3H91A 1F2LA 1TVXA 4R8IA 1WVLA 2KOLA 1IL8A 3F2UA 4HCSA 4RAUC 2R3ZA 1ICWA 4R9WA 1ESRA 5D65A 3FDTA 2HDLA 3KUPA 4X3KA 5AFWA 1G91A 2HDMA 5CORA 2L12A 4U68A 1SDFA 5T1IA 5EPJA 2L11A 1AZQA 2BDNA 2XIWA 2N55A 3IFDA 1O7ZA 3DM1A 1M8AA 1LV9A 2NZ1D 3GV3A 1VMPA 1HUMA 2FINB 2H1EA 2L1BA 2L4NA 3KBXA 2MGSA 1QG7A 1DOKA 1O80A 3DEOA
chains in the Genus database with same CATH superfamily
1TR5A 2Z8LA 4PMCA 3MHBA 5K5PA 4LF8Q 4L5RC 3H6MA 3A7LA 3SXHA 1Q86C 1I6HB 3IL8A 1PTOB 2VW9A 4JW0A 1CKNB 2B2UC 4XTCS 1N34L 3SR1A 4R4TA 5FKAC 4OEMB 2JA9A 4DK1A 2SNMA 2PW5A 2ASBA 4BBSH 2D0OA 1I94Q 3D6WA 4DR6Q 2VQEL 4Y7NH 5M3FB 1DOLA 1LTTD 2IJ0A 1PYSB 3S1MB 2VB2X 3S1RH 3TMEA 1YNJD 5C4XB 2K5NA 3SK5A 1JWSD 1HRJA 1R4PB 4UP8A 3WDNA 1BVSA 3Q6SA 3J7AF 3MFGA 3MZ5A 2JSOA 3EN2A 1YJ9A 5M5WH 5FJ8H 3GTMH 1JQYD 4R4OA 4G7OC 3CMAA 1PFBA 5EBDA 2B2YC 4DV6Q 1CT1D 5C3EB 1WTOA 2F0SA 2FXQA 2RCFA 4LF5Q 1KABA 1STGA 5IY0A 3VR2A 3CW2C 4KD3A 4IUQA 4JI1L 5ELDA 4OO1I 4BBSB 3CCUA 2QDLA 3HOYH 1Q8KA 5AJ3Q 3CPWA 4UP9A 2EYLA 1Y1WH 1RF2D 1YVCA 2AQ1B 5IWAL 4B3SQ 1ILPA 4IJLA 1SFOH 4BA2I 5IP9G 1I4HA 2JA6G 3URYA 1N9WA 1R4QB 4PNYA 4LF7L 3OMCA 1G6ZA 1LTSD 4IURA 1U0LA 4DR5L 3KFUA 2R3ZA 2VNUD 3EVQA 3BZDB 2CWAA 3K5OA 1XMQL 5JJIA 3KF6B 5M3MH 2DNEA 3TDQA 2JA5G 3BS1A 3VR4A 2NZ1D 4G7HC 1XPOA 3S2DB 1PTOH 1HH2P 3F2CA 1UAPA 1XTCD 2R61A 3HOWH 1ZYRC 1SYBA 2M2LA 1D5XC 4A93G 4DAYB 5CBEE 5CMDA 2B8FA 3DMUA 3NQTA 4A93B 4BY7G 1B9NA 1TS4A 5CV7A 4C3JG 3C1FA 1WTRA 4K8JA 4EVOA 4JYAL 4KN7C 4DV2L 4Q0FA 3TS2A 1ET9A 5G3LD 1PMRA 4N8X1 1XJVA 4P74A 4FP5D 2CWPA 1Q12A 3K5MA 2CQAA 1F9RA 1JJCB 4GLVB 2DUDA 2EY6A 2NVYB 3DUZA 3S16H 3N6RA 3J7AV 3VYTA 3T51B 3DM3A 5IGFA 1SNCA 1GUOA 1STHA 1S5ED 3QO2A 4XYOA 3TRZA 4WORA 1QE6A 5TSSA 3OOCA 2N3SA 1S4ZA 1C4QA 2L5TA 4QY7A 4L6TB 1SMYD 4ILWA 3NTIA 1B7YB 1IBLQ 1STEA 1YHQA 1CQFA 1N34Q 3B6YA 2F03A 4S3SA 4XT3B 5M5YB 3S14B 2D2CC 3SK8A 3UDFA 3GTKB 1ENCA 1TY0A 3RMHA 4FDBA 1EQTA 4EQ5A 1HFGA 4B3TQ 3GTPB 2VB3X 4DR1L 1K83H 3SGIA 2BCOA 2K5DA 3OTOL 3W3AA 4XT1B 1SE2A 1PH9A 1NR2A 3C2PA 1U4PA 1K8GA 3RNUA 2RKSA 1KAAA 3I73A 2L9HA 3S15H 2JA8B 1E1OA 1TKWB 1BF4A 2I5HA 4HTHA 3R8BA 4NXNL 3MEFA 1AFPA 1TVXA 1QUQA 1I4GA 1IL8A 4KMUC 3I2ZA 3KJOA 5AFWA 1HTPA 5CORA 1I6VC 3C3LA 4N8FA 5LMNW 5C5MA 1O7ZA 3SK6A 2H1EA 1U5KA 4LF9L 4OWTB 1G291 2R92H 1D5ZC 3HKSA 1SYEA 1N33Q 1Y1VB 1L1OB 3JAME 3QG1A 4ZUIA 2X69A 4JI3L 3L0OA 4P73A 2NVQH 4HIDA 4CDCC 1LT3D 1PTOC 3MFYA 1LTAD 1EOVA 1X3QA 1N32Q 1RL2A 4DV5Q 1HNWL 2R92G 3Q8DA 3PIOA 4DR4Q 3G6EA 1E2ZA 5C4JB 1KD1C 3CMEA 2Z0SA 3GQBA 3GTQH 3GTLH 1L1OA 1X3PA 3U9SA 4JI1Q 3Q0AA 1HNZL 1P16A 4HIKA 1TWFH 3A74A 1PH3A 2R7ZG 2WV6D 1SRUA 5D14A 4A3EG 2B2VC 3M7NA 1CTMA 4KJOA 2VZAA 3M4YA 4X62L 4ME5A 2WACA 5KYIA 3ERQA 2K14A 4K0KQ 3X3NA 1RTOA 2PQAA 2WFWA 3I3CA 3S17H 1RKNA 4A3FG 1WTXA 4L5QA 3I72A 3DWQA 3D31A 1FVIA 3RD4A 1D8LA 1FD7D 4J8QA 2PW7A 2R92B 4DK3C 1TT2A 4HSPA 1KHIA 2MPMA 1ICFB 3VA7A 3UDIA 2BE5D 3HFZB 4LFCQ 3VA5A 2YU9H 1AN8A 3F8TA 1EQQA 4CDEC 4DV2Q 4H7BA 4A3EB 4JG2A 2VQFL 1XPRA 2MHVA 1SNMA 2NZHA 3SDZA 2JYOA 3C46A 1M90C 5LL6S 1SMYC 4RA8A 4YWMA 4X66Q 2UXDQ 5IT9L 1CHPD 4DN4M 4HN7A 5I9OA 4LJZC 3J80c 5FLXE 2PYKA 3S17B 1GUGA 4LUOA 1PFMA 4C3HH 4DV0L 1TWCB 1B4OA 1RODA 1NTGA 2CHBD 4KHVA 5COYA 2B63H 3RLNA 2F52A 1EY4A 3OPOA 5ELCA 1YITA 3T1HQ 1PHJA 1VQ5A 3S2DH 4GOPA 4RKBA 1HR0Q 1LYLA 2HQEA 1SDFA 3BDCA 5T1IA 1N8RC 1KLGD 2EJGC 3D3RA 4B3RL 2XSCA 3PUYA 1PH4A 1V43A 1V9PA 3CCLA 3G48A 4QUCA 1JJ2A 2NVTB 1OO9B 4KY6A 1FNUA 3HOXG 2RSNA 1PYBA 2EYJA 3N52A 4KHPL 1X9NA 1W3SA 3M7GA 1SNPA 4A3JG 2ZXPA 4JBMA 4OXPA 4F8MA 3HOWG 1I50B 1H9RA 1PV4A 4G7ZC 3RN2A 3K57A 4PZ6A 5IIFA 2M00A 1WD1A 1HQMC 4B3TL 3AMUA 1CI3M 3I8ZA 4DR2Q 4V0BA 1VQKA 3PUWA 2R6GA 1UNSA 4X3SA 3TP6A 1QJOA 3BYTB 1F9PA 5EAYA 3HOZB 5IP9H 2VUMG 2JN4A 1WJJA 4QIWB 3SEBA 1XNQL 3HKZB 3M9BA 5I6WA 4DPGA 1WTPA 4FXKC 3DWAA 4HJAA 3K0XA 4A3KG 2Q8TA 4GN5A 2B2UA 3I4LA 2ZM6Q 3GTKH 2OT2A 3I90A 1VQPA 5C4XH 2UUBL 1SLJA 2G5DA 4QGUA 3BYYB 1JT8A 4RGOS 3PSIA 1N33L 1XPUA 2AQ3B 2A6ED 3MC0B 3I55A 2JA8H 2XGTA 2CH4A 3EBEA 4DV5L 2B8GA 4ID6A 3K59A 4A3DB 1YHBA 3KLSX 4KI0A 1OXUA 2A69C 2E2HH 3HOYB 1JE4A 4PQXA 1V1OA 2HCCA 2RVLA 4R4IA 4E6IA 4C3IB 2XTIA 3KF8B 2Q2IA 4OWXB 2QGQA 2KHJA 5FLMG 5C5LA 3NUCA 5LMNQ 1GO3E 4DR7Q 3GTLB 4DK6C 2PMZB 1SMXA 2WAQE 5IT9E 1E2VA 3G4SA 1EU4A 4JI2Q 1KIXA 2F0GA 2K6AA 3MVVA 4C2MB 3HOVH 4A4IA 1O80A 2Y0SE 4HJ5A 2K1BA 4LFCL 3VYUA 4FNFA 2L15A 1YZ6A 2R7FA 4ZKCB 1EIYB 5GROA 1C8CA 3OMGA 3NWSA 4A3BB 1IBMQ 1JE5A 4FVMA 5HGTA 2R93B 1MKHA 4L8JA 2MNAA 1UE1A 3AQQA 2SDFA 1VQAA 4K5XA 2QCPX 4DAPA 4PMWA 5NUCA 1DZ1A 1XMOL 1EIGA 4IFDG 3CP0A 3E0JA 4EGVA 4ZQ3A 4DNTB 1VQ6A 2QILA 1Q8IA 1PH6A 2RA4A 1Q1EA 4O2DA 4X66L 2UXDL 1DD2A 2F1MA 1VQIA 2K5VA 4JV5Q 4P2CB 5DEHA 2JEBI 1IZ6A 4JPBW 2GVAA 1K3BC 4JYAQ 4PMBA 2AKWB 3V2TA 4CKEA 1LM0A 1K3RA 1KXLA 3A0JA 3MTSA 4OGQC 5J3BA 5HURA 1F9SA 3CQZH 2EDGA 4JI6L 2B2TC 2EJMA 1L2FA 2HIVA 5IGEA 4FF3A 1C7YA 4BA1I 1LT4D 3R93A 2EYFA 2CH4W 1WTQA 4O42A 4FF4A 1CZWA 3U50C 4JI8Q 1G8ZD 5HGQA 4K6LA 1Y14B 2HHHL 3GTOB 4R4QA 3F1ZA 5CV9A 1WCMG 2CW0D 1XNRQ 4HSVA 5FO7B 3S1RB 2B2WA 1X3EA 1QZHA 4H02A 2HD3A 3CC2A 5ELNA 1KC8C 1HCZA 2EXZA 2SOBA 4UY8C 1TWAB 4JOIA 4NPSA 4BY1B 3MXUA 4DR2L 3E3XA 2DGYA 3P1HA 4HCSA 4JVZA 3I4MG 4BY1G 1L0XB 4DR1Q 1V8QA 3ULJA 2G9HD 5ISRA 4X65L 5BN5A 2HDMA 3GTJH 5C3EH 3IAYA 3FRPB 3HOVG 2JA5B 4H13C 1HQRD 4JBJA 4JOIC 1VQNA 1M8AA 2GVBA 4KKUA 4HJ7A 2L4NA 4F88A 1QG7A 1GUTA 2K28A 1SJED 1NE3A 5ELOA 5H1SE 1I4QA 5FOBB 2LKVA 3HRZC 1V1PA 4IPDA 2ZJPA 4FF1A 2Z6KA 1UEBA 3KF8A 1LTRD 2NVXH 3RUZA 2A6EC 4LUVA 2FJ2A 2ZTEA 1KAWA 3BVMA 1EFID 4XQNA 1JWMD 2NUCA 5CGKA 1V1PB 1E2WA 1TWAH 2H4OA 1SE8A 3J81L 5EPLA 2KQ3A 1Q90A 4LF4Q 2Q2UA 1ENFA 1Z9FA 4KKSA 3JAMi 1Y1WB 2A6HC 1SNOA 3FMCA 2UU9L 1TY2A 4EQPA 1SJHD 1YNJC 4GN3B 4AYBB 1CKNA 1TWHB 3E9HA 3UDGA 3OSOA 1S40A 3T1HL 1BOSA 3I4MH 3W2DA 3I4NG 1DJRD 4IJHA 4IQZA 4BXXG 4POFA 3PIP3 3HOZG 2BOSA 3D4WA 3LNNA 4A3MB 5IGDA 1R9TB 3F2DA 4A3MG 1X32A 3E0EA 2FHTA 4QJFA 1TQOA 2XRQD 4A3IB 1WCMH 4KHZA 5DM63 4HCEA 3A5UA 2A19A 4DV4L 3UI2A 3TP7A 2C35B 3ONAB 1WD0A 2YV5A 4YWKA 2EQSA 5C6AA 2JA7H 2MUYA 1BCPD 2CCZA 4PG3A 2D9UA 4C1NI 1B9MA 4DXFA 1U9RA 3GO5A 5IGCA 2RHQB 3QB3A 1ICWA 4HR7B 4B9XA 5IP7H 4LF8L 4GKKL 2I5LX 1OXXK 3G6JB 3K81C 3D4RA 3RZOB 3TP5A 4DK0A 2XIWA 1PTOF 1E1TA 3KLWA 3OWFA 4QB4A 4DUYQ 4DV1Q 1EYGA 2F0WA 1IYVA 2FINB 1PRTB 1BNZA 4FO2A 2UUCL 5IP7G 2VQEQ 1EIHA 1GUWA 2KHIA 4G57A 1HHVA 1A0IA 1F77A 1BO0A 4JI8L 4TVAB 1YBYA 1TXYA 2ZJRA 2M9VA 1GM5A 1CKOA 2F0FA 1SXTA 3NQIA 1EY6A 3MXNB 1XNRL 4K14A 5DLQE 2E2JB 4B3ML 5LMUQ 5C44G 2F0VA 2ALYB 4IOAA 2JA6B 1K28A 2I5MX 4GLAC 5BR8L 3PO2G 5M3MB 1NNXA 3FKIH 2K5HA 4ABNA 4KHPQ 4YY3Q 2NZOA 3QIAA 4R8NA 5M3MG 1EZ6A 1GXDC 4K2LA 1IHZA 3BU2A 2PZTA 3NXWA 1D2BA 3CHBD 2PZUA 2V1CC 1SE3A 1PH1A 3PIO3 1TS3A 3ND8A 4BXXH 3UE1A 4HEDA 3S15B 2C9OA 2G9DA 2DY8A 1VDZA 4J6HA 2FFKB 1Z7TA 1DM0B 3CD6A 3H3VH 1G6PA 1DOMA 2TSSA 1ESFA 4AQYQ 2IPKD 1GHKA 2R7ZB 3HZXA 2NN6I 3AEVA 1Z47A 2JA6H 3AFPA 3A56A 2EVBA 2ATWA 2K01A 2ZM6L 5IYBH 3GTQB 2HCIA 2IX0A 1W6KA 2O5IC 2MP1A 1TS5A 2F4VQ 4QQBX 5KNDA 4LUZA 4IZ8A 5IGGA 3M3YB 1PTOD 3KLRA 2PQAB 3E9IA 3FKIB 4RWSC 4RMFA 3PUZA 1QNKA 1ZKOA 1PYWD 1QILA 5EGTA 2F0TA 1SROA 1XTDA 2E8GA 4ALPA 3S14H 3PGZA 1HR0W 4BBRB 5C4XG 2NB0A 1HZAA 4LFAQ 3Q23A 1JMCA 3T53B 4P72A 3GTGH 1LTLA 3I4MB 4BY1H 4DV3L 2WP8J 2VUMH 1TWHH 4IN3A 4JI5L 1IBLL 4JI2L 3EFXD 1JR0D 4L63B 1IBKQ 1N36Q 2CFMA 5I2XA 1QVGA 1B3AA 1FGBD 2DY7A 1MD2D 4RHRA 5M9OA 1I6HH 2MFIA 4ZYSA 1OTCA 2Z9HA 5G3LF 5M5XB 3WOFA 4B08A 5C0XJ 3DLLA 3CCVA 3CXCA 2B39A 3BVZA 4IUTA 3FEWX 1J6QA 1IBML 1NY4A 1MSHA 4CGYB 3KDFA 1BDOA 2KVMA 1HA6A 2CVRA 1QB5D 1X54A 1PXUA 2B3GA 2Z6BA 4TSSA 3RR5A 5ELEA 4XQJA 3HKZG 4DV7L 1HFNA 1EY9A 1PFNA 4DR6L 1VQLA 3GTPH 1D1KA 2A69D 1RHPA 4QF4A 1JOOA 2RDGA 5FJ8G 4IPHA 4K8IA 3HOXB 1EQRA 4X65Q 2O5JC 3S24A 4CDFC 2N78A 3LWEA 2LSSA 1FR3A 2E75C 4YHHL 1EOTA 4JC0A 5FO9B 5D3DA 2JXMB 5F2DA 4JI3Q 1DONA 3NTHA 4NXNQ 1A3TA 4KK7A 2AMCB 4JCVE 1VQ4A 2SEBD 2OEOA 3TSSA 4C1NK 4MN3A 1SFOB 1VQHA 2F0EA 2WB1E 1V1QA 5T1GA 4DXGA 5C4ZA 4AH6A 4B3MQ 2R93G 1OXSC 1X65A 4G4KA 4UDUC 4OO1G 2EY5A 1RIPA 4L5TA 3CPFA 1C0AA 3SK4A 1ILQA 1E7ZA 4XIGS 3STBD 4X64L 3JAML 4A3IG 3KLSA 1XX8A 5DNFA 4RFBA 1W2BA 3BVGA 4GKJQ 4LFBL 4LF4L 4JBKA 1GJXA 1CK1A 1SE4A 1Y69U 2I46A 3T1YQ 5EPJA 3OTOQ 1HNWQ 1VQ7A 1H9MA 2CQOA 3ITPA 1VQDA 1EY8A 2F0LA 1VQCA 1MJCA 3I4NB 1IYUA 2QDBA 1I5FA 1JOKA 2K03A 3CRKC 3E6ZX 5BN3A 4NMZA 4A3BG 1MIUA 3VDYA 3HOYG 4I65A 3RLOA 3H3VI 1XXGA 1WTHA 2F0UA 4NW2A 2NTSA 2I07B 1EYAA 2EY2A 1CHQD 2GA4B 3NE5B 2UXCL 4EQNA 2NWGA 2B2YA 2K04A 3I91A 1IL2A 2EYPA 4LF6L 5L37A 2NVXB 2K5QA 1PZID 3NBIA 3S9WA 4FXDA 4RGTA 3QWNA 1A8VA 2KECA 5IYBG 3DEPA 2F0HA 3TZUA 2KA7A 1H9KA 1K83B 3PV0A 3RLFA 3R3OA 4K5WA 4A3CG 3M4OH 1BBWA 4A3BH 2XWBB 1UE6A 3A8KE 2QKIC 3Q22A 3KBGA 2MO0A 1VF7A 3P20A 4KJNA 3EIVA 4ZAIA 3M4PA 5FLXL 4XDXA 1GKHA 2AWOA 2B2WC 5LHY1 2E76C 1IXRA 4JI4L 2YTVA 1QZGA 4R4CA 4HIMA 1PRTD 1Y1VG 5EPKA 5E1FA 3PO3G 1N36L 2IL8A 4O1NA 5E4WC 1CA6A 2OWOA 2L55A 5C3EG 5M3FG 3FKIG 4WJWA 4DKAC 3L9AX 4EX5A 1X55A 3BG3A 4HAEA 5CYUA 3TN2A 4GNXB 4ZRZA 5EJWA 1FGUA 1SAPA 1K8MA 3H0GG 1BCPB 3HKZE 1DXMA 2A68D 4OO1H 2EJFC 1PFSA 3BDLA 2A68C 4LW1A 1PVOA 2PNHA 5LMUL 1HPCA 2JE6I 2YTYA 1VQMA 5C44H 1XYIA 1E22A 2F0NA 1A62A 2OQ0A 4IPGA 5IOCA 5A2QL 2OXPA 4OWWB 4K2KA 1STBA 3RN5A 4QIWE 2A8VA 4RAUC 2BH8A 2LS01 4KN4C 3C1EA 4MNOA 4WRDA 2D62A 3S1NB 5C3XA 1S72A 1HXYD 3GV3A 1KL9A 1XNQQ 3RZDB 1BUVT 2RDHA 4YHHQ 3PQIA 3TBIB 4HMJA 4BBRG 2I0QA 2Q2TA 3J80i 4RKLA 1VMCA 3J7ZC 3M4OB 4GN4B 4CJ2C 4TQUS 1Q46A 2JP1A 1NMGA 3BJUA 4B3RQ 4DV1L 2HIXA 2F0OA 3DWPA 4LF9Q 1SR3A 2IWHA 1A63A 1B44D 2WAQB 2IW3A 1PRTC 4ZUJA 4Z9CB 5CC4A 4DR3Q 3I70A 1BR9A 4JK1C 3W1GA 2F4VL 3QOLA 4IPCA 1S5CD 3J7YW 4KKTA 3CCMA 4OONA 1GD7A 5BN4A 4U673 3P7JA 1F2MA 2B2TA 2Q2HA 1FNVA 5GAGC 1A3UA 4J15A 3T1YL 1WTWA 4GLXA 3H15A 1J8IA 4IUNA 1O7YA 2UXBQ 2KEDA 3HOXH 3T4AC 4DAVA 4CJ1B 1EU3A 1MBYA 1SYDA 4BY7B 4KLKA 4X3UA 1BCPC 1IKMA 2XVSA 4GNXC 1U4MA 4JI0L 4K0KL 1H9SB 1BBUA 4LWCA 4ME3A 5EQ0A 5EBCA 1PZKD 1K0SA 1KNEA 1SYFA 1EL0A 2RHSB 1F2YA 1QVCA 5M5WB 3GTMB 4WJ3M 2HT1A 3BDOA 5CV8A 1HZ9A 3L3OC 1CA5A 1PH8A 1SYCA 2KCTA 5M5YH 1PZJD 2K05A 4DNRB 2A73B 1KTKA 1MI2A 1U4LA 5JVH3 3VYSA 4MTKA 3S2HH 1T5EA 5JPMC 1U4RA 3M3YH 3J81i 3O13A 3J81j 1LT6D 4CHTB 2OF1A 5JJZA 3EJIA 1ET6A 3HS0C 2NVTH 1Y8OB 2BDOA 3L2PA 4I7ZC 3F2UA 2CKZB 5I2YA 4JV5L 5KNBA 1I50H 1PA6A 3GTGB 2DJGC 1G91A 3NP8A 2AHOB 1ASYA 3PUXA 2L11A 3HEJA 3IFDA 1LTID 1NSNS 2AQ2B 4HJ8A 3K7UC 3KBXA 2LY7A 3OIQA 2PO4A 5K36G 1II3A 1I3QB 1I94L 4RG1A 5JPNC 1QNUA 4KV6A 1K0RA 2MQHA 2B2VA 2YTXA 4ZCKA 4OL7A 3J81E 4A3FH 3I4NH 5JJKA 3HOZH 2VS1A 2ZTCA 1EUJA 1QWYA 2H5XA 4IUPA 4NDXA 1EY0A 1LT5D 1PH7A 1SN8A 3IKJA 4JI7L 2Y0SG 3LWUA 1WCMB 3BZCA 2LMCB 1YJWA 1K9MC 1OXVA 4QCLA 2CW0C 3TS0A 4P71A 2OTLA 2E2IB 1TU2B 3TZDA 2E2JH 1DCZA 1O7IA 3NTKA 1CUKA 5DM73 2E5LQ 2KCNA 4DV6L 3CCRA 2KEEA 4X64Q 5A2QE 3PO3B 2HUGA 2A6HD 5JVG3 4H44C 2JA7G 2N8NA 5KIXA 2K4KA 2JA7B 2XNAC 3UE0A 3JC66 1X3FA 1WFQA 2EXDA 2UUAL 1AE2A 1I3QH 2F0DA 1HJPA 3HP3A 3TEHB 1F9QA 3GV6A 3VR3A 3CKIB 3ND9A 3U58A 1K73C 3H0GB 1BBXC 1Q3LA 3ULLA 4DV7Q 4B3SL 5E7NA 4MIUA 3GP7A 1LTGD 1BCPF 3NELA 1ENAA 5CV5A 5EKIA 3KK7A 4N9PA 1A15A 2F3IA 2RBMA 1JJGA 1LUZA 4J1MA 1SBBB 4DU9A 1TWCH 2XWJB 1A2TA 1GUNA 2KUMA 2ZTDA 1YNXA 4LF5L 4YCVA 1FNWA 3G71A 1YNND 1Q81C 1TWGH 2ENBA 4A3JH 5IYCG 1A2UA 3E5SA 2WIIB 1YHAA 3I4OA 1HNXL 2UU9Q 2ZXRA 4ULLA 5IGBA 1K8AC 1UWVA 1WYDA 4A75A 2IHEA 3J7A5 3DEOA 1CSPA 2EYHA 4M8AA 5JOBA 4DR5Q 4APVA 5I4DA 3BZKA 3UDXA 1SYGA 1X3GA 4DF7A 1Q1BA 3AFQA 3U9OA 4GS3A 3HOUG 2ZT9C 3ULPA 1A6XA 4DAYA 1EWHA 3EA6A 3LX0A 3CRLC 4PZ8A 5C0XH 4BBRH 1YNNC 2P5ZX 3K8AA 2Z4IA 5GADC 2KJXA 3EROA 2KCMA 2JEAI 4RGMA 2IT1A 3FPPA 4CKCA 4DV4Q 2E74C 2QW7A 1GUSA 4C3JH 1PH5A 5C4JH 4IFDI 1EEFD 4C56C 2AUJD 2PI2E 1UE7A 3GTJB 1VQGA 4A93H 3S2HB 2C5CA 3S1QH 4BY7H 2NVQB 2UXCQ 5J39A 1JC7A 1B53A 4GKKQ 1Z6HA 1T5XD 1M1KC 4ZLTF 2EIFA 2NVYH 4F87A 1EYDA 4NB3A 3GTOH 2SNSA 3OIPA 1H9JA 4XYQA 2PQEA 3EQLC 2O4XA 1KDBA 3KYHC 4Y7NB 4M1UB 1EEID 1MSGA 1CZGA 4DA2A 1O78A 4PZ7A 2F0MA 2K33A 1RTNA 5FLMH 3K5LA 1JOQA 1ML0D 2QF7A 2WAQG 1HR0L 3S16B 1YIJA 4CKBA 5JEAG 3QJYA 2XN9C 4NXMQ 1D5MC 1ZEQX 1PLFA 3STBC 1RD9D 3OW7A 3FPUB 1VQOA 3NSWA 4HJ9A 1B70B 4IOCA 3L7ZC 1GOZA 1F2LA 4R8IA 2KOLA 1DYQA 2MO1A 3FDTA 3KUPA 3RZDH 2UUAQ 4GZYC 1QOHA 1VQFA 4FXGC 4C2MH 3MEHA 2KCCA 5KEEA 2N49A 1I4XA 2WKCA 3DXJC 1UE5A 1UUPA 2JA8G 1VMPA 1HUMA 1KRSA 2L1BA 4DUZQ 1DOKA 1RCVD 3G7LA 3D0FA 1CKMA 1CM9A 4K5VA 5I9PA 1D6EC 3NPPA 2F0QA 4QL5A 3K58A 1VQEA 2BA1A 3DHQA 3V05A 1BKBA 4A3GH 3W5OA 1L0WA 1G2SA 4GNXA 4C3IG 1VQ8A 1D7QA 1L1OC 4YY3L 4XXEA 4H0LC 1IW7D 1JICA 3OHXC 3V96A 2IHFA 2UUCQ 2RQXA 1W6JA 3WWVA 1VCIA 1Q82C 1J5EL 3H3VC 1LO5D 1JB7A 3MXNA 5E4XA 2DN8A 4FF2A 1NUCA 4BBSG 3KOJA 1STNA 3HGBA 3P75A 4YIJA 1D1IA 2R93H 4K6DA 5IYDH 1G51A 3SHLA 3PF5A 1Y8PB 1HA5A 2WB1G 1I4PA 4A3IH 4OHJA 5GAEC 3JAMc 4DAMA 2WB1B 4ODGA 2VQFQ 1KDAA 2PZWA 3OW2A 4A76A 2ES2A 2ICIA 2JJQA 4LFAL 5JEAJ 1IW7C 3R2IA 1L0YB 4A3MH 1N32L 1QCBD 2JQOA 1J9OA 4Q5VA 2VY3A 1ONLA 2HQLA 1X56A 4QUFA 4DV0Q 2BH2A 2UXBL 4CDDC 4DR4L 1B8AA 1PDQA 4I7AA 3CQZB 3QR8A 1WTVA 3GD7A 2J7ZA 1ZXTA 2Z6KC 4F7XA 3SE0A 3GDEA 1IBKL 2B63G 4N9TA 1XWEA 1NR4A 4A3DH 4AQYL 1EY5A 3A5ZB 1IKLA 2PPBC 3ERSX 3ZJYC 3OYYA 4CBVA 1EWIA 2EZVA 4AYBE 3CC7A 4DFAA 2HDLA 3HOVB 4U68A 2XRSD 4L5SA 4QMGA 1VQ9A 3DM1A 2MGSA 1OXTA 1EFWA 1KDCA 4PV1C 2BE5C 2B63B 1HUNA 3HOWB 1EQVA 1KNAA 5ELBA 3QOJA 4JBWA 1EWCA 1MGSA 2TMPA 3WOEA 4OX9L 3D4DA 1WOCA 2E2HB 2A5HA 4P75A 4KTAA 3Q24A 4DUYL 4AIMA 3S1NH 5JEAH 1WI5A 2RF4A 3MA2B 3AYHB 1MJEA 4C3JB 4KY5A 2L0CA 2D5DA 5CV6A 4NXML 5M3FH 4DV3Q 4A3EH 5CBAE 3FVQA 5C0XI 5C3WA 1JORA 4IFDJ 1AZPA 3A54A 2UUBQ 1PRTF 3CU7A 3PUVA 3SVMA 1VQJA 1Y1WG 1S5FD 4IUVA 4BWGB 1X6OA 1SEBD 1AW7A 2PCFB 4MTNA 1PH2A 4WFN3 1VF5C 4ZKBB 2ZXOA 3A8IE 3MXGA 1JCKB 1STAA 2IY5B 1LLRD 2F3WA 3AU7A 3VR5A 3VYRA 2VXWA 1STYA 3CC4A 1CSQA 2KENA 1HNXQ 2HHHQ 2E5LL 3T16A 3J80L 5AJ3L 4X6AH 3K5NA 2K52A 2NTTA 3T13A 1RDPD 3I7FA 3F2BA 1HZCA 4A3KH 3OWEB 1RJTA 1KQSA 4R1JA 1NAPA 2EYMA 1QVFA 2K5WA 1AEXA 4POGA 3K6OA 5LMNL 4OIKA 4CJ0B 4RCOA 4LFBQ 4OIJA 1XMQQ 4LNQA 2RSOA 2F4IA 2KHSA 2QEJC 2QEXA 3H94A 1M4VA 4KY7A 2ICEC 2X6LA 2LXKA 3AB9A 2Z4HA 3H91A 3M85A 1YEZA 4NP5A 1Q7YC 4R9WA 4LF6Q 5M5XH 1BQQT 4X3KA 2F3VA 2DJFC 1S5BD 3FP9A 1GHJA 2N55A 4RCNA 4UPAA 2NN6G 4DNIA 3NK9A 3PO2H 1TWGB 1B1ZA 5EKLA 4HMIA 4A3GB 2LFNA 4DR7L 2K50A 2FMCA 2IX1A 2K75A 5C0XG 1F2ZA 3T56B 4LMQD 1BXTA 4A3LG 3KJPA 2PNRC 3K7AH 1EZ8A 2YYZA 1NJIC 4RGNA 3K0YA 2F0KA 4DGZA 2YU9B 3PO2B 2Q8RE 3CCQA 4WJ4A 3MWYW 4O0AA 4C3IH 4YCUA 1EY7A 4UHVA 4C3HB 1NMFA 1VQBA 1P8LA 4TRDA 4IFDH 3NHHA 1S3OA 1FJGL 4A3GG 1XMOQ 1LTBD 1IYJB 3NEMA 2JK8A 4A3FB 1GVPA 2NYZD 1UEAB 1CFMA 3TP8A 3ICEA 2EE1A 3CCSA 1T9HA 4Y52H 2Y0SB 3PF4A 4HIOA 5IYDG 4B9WA 3H0GH 1FYCA 2NN6H 2PI2A 3VR6A 1G2TA 5CV4A 2WINB 2J0TD 3NBHA 4KD4A 2V4DA 2AUKA 4ZK9B 3A55A 5J1ZA 1I4RA 3LGJA 2WKDA 4OX9Q 1B50A 3A8JE 1R9TH 1DGSA 3PO3H 2LXJA 4JI4Q 5LL6X 2VL6A 1E24A 3KDFB 3U4ZA 2OQKA 5KRUA 4IO9A 5FLXc 2AWNA 5GAHC 2BA0A 4IUUA 5D3IB 4DR3L 3NBHB 2O2LD 3HOUB 2E2IH 2A1AA 2QA4A 2OCEA 1WVLA 1Y8NB 1Y1VH 5I6YA 2R7ZH 2ZJQA 5J22A 4XQQA 5KYLA 2OTJA 3CCEA 3K7AB 2L12A 5IODA 2Q8IB 4JI6Q 1JB3A 2F0JA 1SNDA 1LV9A 3J80E 3HG9A 1CQVA 1B3QA 2K32A 3KF6A 5CR3A 4A3CH 1C48A 3ZYYX 5KNCA 2VUMB 2IX3A 3W1BA 5JAVA 2X6GA 3TREA 4GKJL 3X3MA 2EY1A 3R2TA 5IE8A 3ER0A 5BR8Q 2R7DA 3MAQA 5FK9C 1HTLD 1SNQA 2GN5A 4DUZL 2D0PA 2N88A 3RZOH 5A35A 3CAMA 4RH6A 1QUQB 1A3VA 4A3JB 1TWFB 4BS9A 4LF7Q 1EIFA 1NBWA 1H95A 3MXPA 3HOUH 2DNCA 3A7AB 3IRBA 4MZ9A 5IWAQ 4FYDA 4EQOA 1FL0A 2F0PA 4JI0Q 4NKLA 4UAIA 1AE3A 3M4QA 2PMZE 1TIID 3D8GA 4X3TA 1KLUD 2KBNA 3CCJA 1AH9A 2E2DC 5K36H 3IFTA 4MHEA 1C9OA 1J5EQ 1H9SA 4GOPB 1K8OA 3U4VA 5E3FA 2B29A 4YWLA 1B2TA 4A3KB 5IYCH 3NENA 2F0IA 2EPBA 2MJ8A 1NCVA 3S1MH 4TKOB 2JA5H 2RDFA 3NWTA 2ID0A 2K7VA 3PMFA 1LACA 1HZBA 5GQOA 1YJNA 1SSOA 1O7LA 4LAAA 1VS0A 4IALA 1KRTA 2A74C 3K80C 4YCWA 2EOTA 5C44B 1HNZQ 1ASZA 1AP0A 4A3DG 3PCOB 4LK1C 5C4HA 4GOPC 3FHWA 4X62Q 4JI7Q 1LABA 1MHWC 1S5DD 5ELFA 4V190 1EYCA 3J81c 3CF5A 1E3PA 4C3HG 3H09A 4OELB 5FO8B 2J4XA 1YI2A 2EYOA 2FMMA 1E0BA 3S1QB 2RCNA 4A3LH 2Z1CA 2NBFA 1ESRA 5D65A 4JI5Q 1JWUD 1ZYRD 3D6CA 5EKKA 4UP7A 5DAUA 3PIPA 4AYBG 1AZQA 2BDNA 1FJGQ 3TQYA 5IT9c 5HY6A 4RHSA 5KGUA 3I56A 5JJLA 1TS2A
chains in the Genus database with same CATH topology
1TR5A 2Z8LA 4PMCA 3MHBA 5K5PA 3H6MA 3A7LA 3SXHA 1I6HB 3IL8A 1PTOB 2B2UC 4XTCS 3SR1A 5FKAC 4DK1A 2SNMA 2PW5A 3D6WA 5M3FB 1DOLA 1LTTD 2IJ0A 3S1MB 2VB2X 3TMEA 1YNJD 5C4XB 3SK5A 1JWSD 1HRJA 1R4PB 3WDNA 3Q6SA 3J7AF 3MFGA 3MZ5A 2JSOA 1JQYD 4G7OC 1PFBA 5EBDA 2B2YC 1CT1D 5C3EB 1WTOA 2F0SA 1KABA 1STGA 3VR2A 4KD3A 4IUQA 5ELDA 4OO1I 4BBSB 2EYLA 1RF2D 2AQ1B 1ILPA 4BA2I 1I4HA 3URYA 1R4QB 4PNYA 3OMCA 1G6ZA 1LTSD 4IURA 2R3ZA 2VNUD 3EVQA 3BZDB 3K5OA 2DNEA 3TDQA 3BS1A 3VR4A 2NZ1D 4G7HC 3S2DB 1PTOH 1UAPA 1XTCD 2R61A 1ZYRC 1SYBA 2M2LA 1D5XC 5CBEE 5CMDA 2B8FA 3DMUA 3NQTA 4A93B 1B9NA 1TS4A 5CV7A 4C3JG 3C1FA 1WTRA 4K8JA 4EVOA 4KN7C 4Q0FA 1ET9A 5G3LD 1PMRA 4FP5D 1Q12A 3K5MA 2CQAA 1F9RA 2EY6A 2NVYB 3DUZA 3N6RA 3J7AV 3VYTA 3T51B 5IGFA 1SNCA 1GUOA 1STHA 1S5ED 3QO2A 4XYOA 4WORA 1QE6A 5TSSA 3OOCA 1S4ZA 1C4QA 2L5TA 4L6TB 1SMYD 4ILWA 3NTIA 1STEA 1CQFA 2F03A 4S3SA 4XT3B 5M5YB 3S14B 2D2CC 3SK8A 3GTKB 1ENCA 1TY0A 3RMHA 1EQTA 1HFGA 3GTPB 2VB3X 2BCOA 2K5DA 3W3AA 4XT1B 1SE2A 1NR2A 3C2PA 1U4PA 2RKSA 1KAAA 3I73A 2L9HA 2JA8B 1TKWB 1BF4A 4HTHA 3R8BA 1AFPA 1TVXA 1I4GA 1IL8A 4KMUC 5AFWA 1HTPA 5CORA 1I6VC 3C3LA 5C5MA 1O7ZA 3SK6A 2H1EA 1G291 1D5ZC 1SYEA 1Y1VB 3JAME 3QG1A 4ZUIA 2X69A 1LT3D 1PTOC 3MFYA 1LTAD 1X3QA 1E2ZA 5C4JB 3GQBA 1X3PA 3U9SA 3Q0AA 2WV6D 5D14A 2B2VC 3M7NA 1CTMA 4KJOA 3M4YA 4ME5A 2WACA 5KYIA 3ERQA 3X3NA 1RTOA 3I3CA 1RKNA 1WTXA 3I72A 3DWQA 3D31A 3RD4A 1FD7D 4J8QA 2PW7A 2R92B 1TT2A 4HSPA 2MPMA 3VA7A 2BE5D 3VA5A 1AN8A 4H7BA 4A3EB 2MHVA 1SNMA 3SDZA 2JYOA 3C46A 5LL6S 1SMYC 4RA8A 5IT9L 1CHPD 4DN4M 4HN7A 5I9OA 4LJZC 5FLXE 2PYKA 3S17B 1GUGA 1PFMA 1TWCB 1B4OA 1RODA 2CHBD 4KHVA 5COYA 3OPOA 1EY4A 5ELCA 4RKBA 2HQEA 1SDFA 3BDCA 5T1IA 1KLGD 2EJGC 3D3RA 2XSCA 3PUYA 1V43A 4QUCA 2NVTB 1OO9B 4KY6A 1FNUA 2RSNA 2EYJA 3N52A 3M7GA 1SNPA 2ZXPA 4F8MA 1I50B 1H9RA 4G7ZC 3K57A 5IIFA 2M00A 1WD1A 1HQMC 3AMUA 1CI3M 3I8ZA 4V0BA 3PUWA 2R6GA 1UNSA 4X3SA 3TP6A 1QJOA 3BYTB 1F9PA 3HOZB 4QIWB 3SEBA 3HKZB 5I6WA 1WTPA 4FXKC 3DWAA 2Q8TA 2B2UA 3I4LA 2OT2A 3I90A 3BYYB 4RGOS 2AQ3B 2A6ED 3MC0B 2B8GA 4ID6A 3K59A 4A3DB 3KLSX 4KI0A 1OXUA 2A69C 3HOYB 1JE4A 4PQXA 1V1OA 2HCCA 2RVLA 4E6IA 4C3IB 5C5LA 3NUCA 3GTLB 2PMZB 5IT9E 1E2VA 1EU4A 2F0GA 2K6AA 3MVVA 4C2MB 1O80A 2K1BA 3VYUA 4FNFA 4ZKCB 1C8CA 3OMGA 3NWSA 4A3BB 4FVMA 5HGTA 2R93B 4L8JA 2SDFA 4K5XA 2QCPX 4DAPA 4PMWA 5NUCA 1DZ1A 1EIGA 4IFDG 3E0JA 4EGVA 4ZQ3A 4DNTB 2QILA 1Q8IA 2RA4A 1Q1EA 1DD2A 2F1MA 4P2CB 5DEHA 2JEBI 4PMBA 3V2TA 4CKEA 3MTSA 4OGQC 5HURA 1F9SA 2EDGA 2B2TC 2EJMA 5IGEA 4FF3A 4BA1I 1LT4D 3R93A 2EYFA 1WTQA 4O42A 4FF4A 1CZWA 1G8ZD 4K6LA 3GTOB 5CV9A 2CW0D 4HSVA 5FO7B 3S1RB 2B2WA 1HCZA 2EXZA 2SOBA 1TWAB 4BY1B 3MXUA 3P1HA 4HCSA 1L0XB 1V8QA 2G9HD 5ISRA 5BN5A 2HDMA 3IAYA 3FRPB 2JA5B 4H13C 1HQRD 1M8AA 4KKUA 2L4NA 4F88A 1QG7A 1GUTA 2K28A 1SJED 1I4QA 5FOBB 2LKVA 3HRZC 1V1PA 4FF1A 3KF8A 1LTRD 3RUZA 2A6EC 2FJ2A 3BVMA 1EFID 4XQNA 1JWMD 2NUCA 5CGKA 1V1PB 1E2WA 2H4OA 3J81L 5EPLA 2KQ3A 1Q90A 1ENFA 4KKSA 1Y1WB 2A6HC 1SNOA 3FMCA 1TY2A 4EQPA 1SJHD 1YNJC 4AYBB 1TWHB 3OSOA 1BOSA 3W2DA 1DJRD 4IQZA 3PIP3 2BOSA 3D4WA 3LNNA 4A3MB 5IGDA 1R9TB 1X32A 2FHTA 1TQOA 2XRQD 4A3IB 4KHZA 5DM63 4HCEA 3UI2A 3TP7A 3ONAB 1WD0A 5C6AA 2MUYA 1BCPD 2D9UA 4C1NI 1B9MA 4DXFA 1U9RA 5IGCA 3GO5A 3QB3A 4B9XA 1ICWA 4HR7B 1OXXK 3G6JB 3D4RA 3RZOB 3TP5A 4DK0A 2XIWA 1PTOF 4QB4A 3OWFA 2F0WA 1IYVA 2FINB 1PRTB 1BNZA 4FO2A 1EIHA 1GUWA 4G57A 1HHVA 1F77A 1BO0A 2M9VA 3NQIA 2F0FA 1SXTA 1EY6A 4K14A 2E2JB 2F0VA 2JA6B 5M3MB 4ABNA 3QIAA 4R8NA 1EZ6A 1GXDC 4K2LA 1IHZA 2PZTA 3NXWA 1D2BA 3CHBD 2PZUA 1SE3A 3PIO3 1TS3A 3ND8A 3S15B 4HEDA 2C9OA 2G9DA 2DY8A 1VDZA 4J6HA 2FFKB 1Z7TA 1DM0B 1DOMA 2TSSA 1ESFA 2IPKD 1GHKA 2R7ZB 3HZXA 2NN6I 1Z47A 3A56A 2EVBA 2K01A 3GTQB 2HCIA 2IX0A 1W6KA 2O5IC 2MP1A 1TS5A 5KNDA 4IZ8A 5IGGA 3M3YB 1PTOD 3KLRA 3FKIB 4RWSC 3PUZA 1QNKA 1ZKOA 1PYWD 1QILA 5EGTA 2F0TA 4BBRB 2NB0A 3Q23A 3T53B 3I4MB 2WP8J 4IN3A 3EFXD 1JR0D 4L63B 5I2XA 1B3AA 1FGBD 2DY7A 1MD2D 4RHRA 5M9OA 4ZYSA 5G3LF 5M5XB 3WOFA 4B08A 5C0XJ 2B39A 3BVZA 4IUTA 3FEWX 1MSHA 4CGYB 1BDOA 2KVMA 1HA6A 2CVRA 1QB5D 1PXUA 4TSSA 5ELEA 4XQJA 1HFNA 1EY9A 1PFNA 1D1KA 2A69D 1RHPA 4QF4A 1JOOA 2RDGA 4K8IA 3HOXB 2O5JC 3LWEA 1FR3A 2E75C 1EOTA 5FO9B 5D3DA 2JXMB 5F2DA 1DONA 3NTHA 1A3TA 4KK7A 2SEBD 2OEOA 3TSSA 4C1NK 4MN3A 1SFOB 2F0EA 5T1GA 4DXGA 5C4ZA 1OXSC 4G4KA 4UDUC 4OO1G 2EY5A 3SK4A 1ILQA 4XIGS 3JAML 3KLSA 1XX8A 5DNFA 4RFBA 3BVGA 1GJXA 1Y69U 1CK1A 1SE4A 2I46A 5EPJA 1H9MA 3ITPA 1EY8A 2F0LA 3I4NB 1IYUA 2QDBA 1JOKA 2K03A 3CRKC 3E6ZX 5BN3A 4NMZA 4I65A 1XXGA 2F0UA 4NW2A 2NTSA 2I07B 1EYAA 2EY2A 1CHQD 2GA4B 3NE5B 4EQNA 2NWGA 2B2YA 2K04A 3I91A 2EYPA 2NVXB 2K5QA 1PZID 3NBIA 3S9WA 4FXDA 4RGTA 3QWNA 2KECA 3DEPA 2F0HA 3TZUA 2KA7A 1H9KA 1K83B 3PV0A 3RLFA 3R3OA 4K5WA 2XWBB 3A8KE 2QKIC 3Q22A 3KBGA 1VF7A 3P20A 4KJNA 4ZAIA 5FLXL 4XDXA 2AWOA 2B2WC 5LHY1 2E76C 1PRTD 5EPKA 5E1FA 2IL8A 4O1NA 5E4WC 1CA6A 2L55A 4WJWA 3L9AX 3BG3A 4HAEA 5CYUA 3TN2A 4ZRZA 5EJWA 1SAPA 1K8MA 1BCPB 1DXMA 2A68D 4OO1H 2EJFC 3BDLA 2A68C 1HPCA 2JE6I 1XYIA 2F0NA 5A2QL 5IOCA 2OXPA 4K2KA 1STBA 4RAUC 2LS01 4KN4C 3C1EA 4WRDA 2D62A 3S1NB 5C3XA 1HXYD 3GV3A 3RZDB 1BUVT 2RDHA 3TBIB 4HMJA 4RKLA 1VMCA 3M4OB 4CJ2C 4TQUS 2JP1A 2F0OA 3DWPA 2IWHA 1B44D 2WAQB 2IW3A 1PRTC 4ZUJA 4Z9CB 5CC4A 3I70A 1BR9A 4JK1C 3QOLA 1S5CD 3J7YW 4KKTA 5BN4A 4U673 3P7JA 1F2MA 2B2TA 1FNVA 1A3UA 1WTWA 1J8IA 4IUNA 1O7YA 2KEDA 3T4AC 4DAVA 4CJ1B 1EU3A 1MBYA 1SYDA 4BY7B 4X3UA 1BCPC 1IKMA 2XVSA 1U4MA 1H9SB 5EQ0A 5EBCA 1PZKD 1KNEA 1SYFA 1EL0A 1F2YA 5M5WB 3GTMB 3BDOA 5CV8A 3L3OC 1CA5A 1SYCA 1PZJD 2K05A 4DNRB 2A73B 1KTKA 1MI2A 1U4LA 5JVH3 3VYSA 1T5EA 5JPMC 1U4RA 3O13A 1LT6D 4CHTB 2OF1A 5JJZA 3EJIA 1ET6A 3HS0C 1Y8OB 2BDOA 4I7ZC 3F2UA 5I2YA 5KNBA 3GTGB 1G91A 3NP8A 3PUXA 2L11A 3HEJA 3IFDA 1LTID 1NSNS 2AQ2B 3KBXA 2LY7A 3OIQA 2PO4A 5K36G 1II3A 1I3QB 5JPNC 1QNUA 4KV6A 2B2VA 4OL7A 3J81E 1QWYA 4IUPA 4NDXA 1EY0A 1LT5D 3IKJA 3LWUA 1WCMB 2LMCB 1OXVA 4QCLA 2CW0C 2E2IB 1TU2B 3TZDA 1DCZA 3NTKA 5DM73 2KCNA 2KEEA 5A2QE 3PO3B 2HUGA 2A6HD 5JVG3 4H44C 5KIXA 2JA7B 2XNAC 2F0DA 3HP3A 1F9QA 3GV6A 3VR3A 3CKIB 3ND9A 3H0GB 1BBXC 1Q3LA 4MIUA 3GP7A 1LTGD 1BCPF 1ENAA 5CV5A 5EKIA 3KK7A 4N9PA 1A15A 2RBMA 4J1MA 1SBBB 4DU9A 2XWJB 1A2TA 1GUNA 2KUMA 1FNWA 1YNND 2ENBA 1A2UA 3E5SA 2WIIB 2ZXRA 4ULLA 5IGBA 3DEOA 2EYHA 4M8AA 5JOBA 5I4DA 1SYGA 4DF7A 1Q1BA 3U9OA 2ZT9C 1A6XA 4DAYA 1EWHA 3EA6A 3LX0A 3CRLC 5C0XH 1YNNC 2Z4IA 2KJXA 3EROA 2JEAI 4RGMA 4CKCA 2IT1A 3FPPA 2E74C 1GUSA 4IFDI 1EEFD 4C56C 2AUJD 3GTJB 3S2HB 2C5CA 2NVQB 5J39A 1JC7A 1B53A 1Z6HA 1T5XD 4ZLTF 4F87A 1EYDA 2SNSA 3OIPA 1H9JA 4XYQA 2PQEA 3EQLC 2O4XA 1KDBA 4Y7NB 4M1UB 1EEID 1MSGA 1CZGA 4DA2A 1O78A 2F0MA 2K33A 1RTNA 3K5LA 1JOQA 1ML0D 2QF7A 3S16B 4CKBA 5JEAG 3QJYA 2XN9C 1D5MC 1ZEQX 1PLFA 1RD9D 3OW7A 3FPUB 3NSWA 3L7ZC 1GOZA 1F2LA 4R8IA 2KOLA 1DYQA 3FDTA 3KUPA 4GZYC 1QOHA 4FXGC 3MEHA 2KCCA 5KEEA 1I4XA 2WKCA 3DXJC 1UUPA 1VMPA 1HUMA 2L1BA 1DOKA 1RCVD 3G7LA 1CM9A 4K5VA 5I9PA 1D6EC 3NPPA 2F0QA 3K58A 2BA1A 3DHQA 3V05A 1G2SA 4C3IG 4XXEA 4H0LC 1IW7D 1JICA 3OHXC 3V96A 2RQXA 1W6JA 1VCIA 3H3VC 1LO5D 3MXNA 5E4XA 2DN8A 4FF2A 1NUCA 1STNA 3HGBA 3P75A 4YIJA 1D1IA 4K6DA 3SHLA 1Y8PB 1HA5A 1I4PA 4OHJA 2WB1B 4ODGA 1KDAA 2PZWA 2ICIA 5JEAJ 1IW7C 3R2IA 1L0YB 1QCBD 1J9OA 4Q5VA 1ONLA 4QUFA 1PDQA 3CQZB 1WTVA 3GD7A 2J7ZA 1ZXTA 4F7XA 3SE0A 4N9TA 1XWEA 1NR4A 1EY5A 1IKLA 2PPBC 4CBVA 2EZVA 4DFAA 2HDLA 3HOVB 4U68A 2XRSD 4QMGA 3DM1A 2MGSA 1OXTA 1KDCA 4PV1C 2BE5C 2B63B 1HUNA 3HOWB 1EQVA 1KNAA 5ELBA 3QOJA 4JBWA 1EWCA 1MGSA 2TMPA 3WOEA 3D4DA 2E2HB 2A5HA 4KTAA 3Q24A 5JEAH 3MA2B 4C3JB 4KY5A 2L0CA 2D5DA 5CV6A 5CBAE 3FVQA 5C0XI 5C3WA 1JORA 4IFDJ 1AZPA 3A54A 1PRTF 3CU7A 3PUVA 3SVMA 1S5FD 4IUVA 4BWGB 1SEBD 1AW7A 2PCFB 4WFN3 1VF5C 4ZKBB 2ZXOA 3A8IE 3MXGA 1JCKB 1STAA 1LLRD 2F3WA 3AU7A 3VR5A 3VYRA 2VXWA 1STYA 3T16A 3J80L 3K5NA 2NTTA 3T13A 1RDPD 3OWEB 1RJTA 1NAPA 2EYMA 2K5WA 1AEXA 3K6OA 4OIKA 4CJ0B 4RCOA 4OIJA 2RSOA 2F4IA 2KHSA 2QEJC 3H94A 1M4VA 4KY7A 2ICEC 2X6LA 3AB9A 2Z4HA 3H91A 3M85A 4NP5A 4R9WA 1BQQT 4X3KA 2F3VA 1S5BD 1GHJA 2N55A 4RCNA 2NN6G 3NK9A 1TWGB 1B1ZA 5EKLA 4HMIA 4A3GB 2LFNA 2FMCA 2IX1A 5C0XG 1F2ZA 3T56B 4LMQD 1BXTA 2PNRC 1EZ8A 2YYZA 4RGNA 3K0YA 2F0KA 4DGZA 2YU9B 3PO2B 2Q8RE 3MWYW 1EY7A 4C3HB 4TRDA 4IFDH 3NHHA 1LTBD 4A3FB 2NYZD 1UEAB 1CFMA 3TP8A 2EE1A 2Y0SB 4B9WA 1FYCA 2NN6H 3VR6A 1G2TA 5CV4A 2WINB 2J0TD 3NBHA 4KD4A 2V4DA 2AUKA 4ZK9B 3A55A 5J1ZA 1I4RA 2WKDA 1B50A 3A8JE 5LL6X 5KRUA 2AWNA 2BA0A 4IUUA 5D3IB 2O2LD 3HOUB 1WVLA 1Y8NB 5I6YA 5J22A 4XQQA 5KYLA 3K7AB 2L12A 5IODA 2Q8IB 1JB3A 2F0JA 1SNDA 1LV9A 3J80E 3HG9A 1CQVA 2K32A 5CR3A 1C48A 3ZYYX 5KNCA 2VUMB 2IX3A 5JAVA 2X6GA 3X3MA 2EY1A 3R2TA 3MAQA 5FK9C 1HTLD 1SNQA 2N88A 5A35A 4RH6A 1A3VA 4A3JB 1TWFB 4BS9A 3MXPA 2DNCA 3A7AB 4FYDA 4EQOA 2F0PA 4NKLA 4UAIA 4X3TA 1TIID 3D8GA 1KLUD 2E2DC 5K36H 3IFTA 4MHEA 1H9SA 1K8OA 5E3FA 1B2TA 4A3KB 2F0IA 2EPBA 2MJ8A 1NCVA 4TKOB 2RDFA 3NWTA 2ID0A 2K7VA 3PMFA 1LACA 1SSOA 1O7LA 4LAAA 4IALA 2A74C 2EOTA 5C44B 1AP0A 4LK1C 5C4HA 1LABA 1S5DD 5ELFA 4V190 1EYCA 4C3HG 3H09A 5FO8B 2J4XA 2EYOA 2FMMA 1E0BA 3S1QB 2Z1CA 2NBFA 1ESRA 5D65A 1JWUD 1ZYRD 3D6CA 5EKKA 5DAUA 1AZQA 2BDNA 4RHSA 5KGUA 1TS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K28 A;  2K1B A;  1CM9 A;  1BNZ A;  4QUC A;  4ZKC B;  1HUN A;  2B2V A;  1EIH A;  1GUW A;  1C8C A;  1KNA A;  2X69 A;  2X6G A;  1MGS A;  2M2L A;  2K03 A;  1VMC A;  5CBE E;  5CMD A;  1HHV A;  3IL8 A;  1BO0 A;  1X3Q A;  4CJ2 C;  2RSN A;  2B2U C;  2JP1 A;  4IUP A;  1G2S A;  3N52 A;  1B3A A;  2DY7 A;  2SDF A;  1WTR A;  4LMQ D;  2N88 A;  1JIC A;  4NW2 A;  1DZ1 A;  1EIG A;  3D6W A;  2FJ2 A;  1X3P A;  4IUT A;  5CBA E;  2RA4 A;  1WD1 A;  5E4X A;  2Q8R E;  1MSH A;  3I8Z A;  1DOL A;  2NWG A;  3MWY W;  2B2Y A;  2K04 A;  2B2V C;  2KVM A;  1F9R A;  5D14 A;  3I91 A;  3P7J A;  2CVR A;  3TZD A;  2B2T A;  1AZP A;  5EPL A;  1HA6 A;  3SVM A;  4X3S A;  4UAI A;  2KEC A;  1F9P A;  1RTO A;  4IUV A;  3I3C A;  1WTW A;  3DEP A;  4X3T A;  1HFN A;  1WTX A;  1J8I A;  1PFN A;  1O7Y A;  2KEE A;  2HUG A;  1RHP A;  1HRJ A;  2KED A;  4ZKB B;  3MTS A;  4MHE A;  2NYZ D;  1WTP A;  3QO2 A;  3Q6S A;  4CJ1 B;  4HED A;  1QE6 A;  1B53 A;  2Q8T A;  1F9S A;  2B2U A;  1B2T A;  1S4Z A;  2VXW A;  4X3U A;  2DY8 A;  4ZAI A;  1IKM A;  3HP3 A;  2EE1 A;  4XDX A;  3I90 A;  1F9Q A;  3GV6 A;  1U4M A;  2FFK B;  2B2W C;  2EPB A;  2MJ8 A;  1NCV A;  1PFB A;  4ZLT F;  2MPM A;  2B2T C;  2B2Y C;  3LWE A;  1J9O A;  5EPK A;  5EQ0 A;  1BBX C;  1Q3L A;  3R93 A;  1DOM A;  2IL8 A;  1KNE A;  1EOT A;  5E4W C;  4QUF A;  1CA6 A;  1G2T A;  1WTO A;  4XT3 B;  1EL0 A;  1X32 A;  1PDQ A;  4ZK9 B;  1RJT A;  2FHT A;  4O42 A;  1SSO A;  1WTQ A;  5EKI A;  1WTV A;  1MSG A;  1A15 A;  1NAP A;  2K01 A;  1CA5 A;  1DON A;  2J7Z A;  2JYO A;  1ZXT A;  2HCI A;  4HAE A;  4IUQ A;  2EOT A;  2K05 A;  1EQT A;  2MP1 A;  1B50 A;  3TN2 A;  1MI2 A;  1U4L A;  4OIK A;  1HFG A;  4RA8 A;  1SAP A;  5EJW A;  4CJ0 B;  1AP0 A;  1RTN A;  4OIJ A;  4DN4 M;  1ML0 D;  4MN3 A;  1NR4 A;  3UI2 A;  4HSV A;  1ILP A;  1U4R A;  1PFM A;  2RSO A;  5T1G A;  4XT1 B;  2B2W A;  1NR2 A;  1JE4 A;  2KUM A;  3ONA B;  1B4O A;  4IUU A;  4RWS C;  1WD0 A;  1PLF A;  1U4P A;  2HCC A;  1IKL A;  1ROD A;  2RVL A;  1QNK A;  5JJZ A;  1XYI A;  2X6L A;  2L9H A;  3FPU B;  1ILQ A;  1G6Z A;  1BF4 A;  4IUR A;  5COY A;  2D9U A;  1XX8 A;  5DNF A;  2FMM A;  3G7L A;  1E0B A;  3H91 A;  1F2L A;  1TVX A;  4R8I A;  1WVL A;  2KOL A;  1IL8 A;  3F2U A;  4HCS A;  4RAU C;  2R3Z A;  1ICW A;  4R9W A;  1ESR A;  5D65 A;  3FDT A;  2HDL A;  3KUP A;  4X3K A;  5AFW A;  1G91 A;  2HDM A;  5COR A;  2L12 A;  4U68 A;  1SDF A;  5T1I A;  5EPJ A;  2L11 A;  1AZQ A;  2BDN A;  2XIW A;  2N55 A;  3IFD A;  1O7Z A;  3DM1 A;  1M8A A;  1LV9 A;  2NZ1 D;  3GV3 A;  1VMP A;  1HUM A;  2FIN B;  2H1E A;  2L1B A;  2L4N A;  3KBX A;  2MGS A;  1QG7 A;  1DOK A;  1O80 A;  3DEO A; 
#chains in the Genus database with same CATH topology
 1TR5 A;  2Z8L A;  4PMC A;  3MHB A;  5K5P A;  4LF8 Q;  4L5R C;  3H6M A;  3A7L A;  3SXH A;  1Q86 C;  1I6H B;  3IL8 A;  1PTO B;  2VW9 A;  4JW0 A;  1CKN B;  2B2U C;  4XTC S;  1N34 L;  3SR1 A;  4R4T A;  5FKA C;  4OEM B;  2JA9 A;  4DK1 A;  2SNM A;  2PW5 A;  2ASB A;  4BBS H;  2D0O A;  1I94 Q;  3D6W A;  4DR6 Q;  2VQE L;  4Y7N H;  5M3F B;  1DOL A;  1LTT D;  2IJ0 A;  1PYS B;  3S1M B;  2VB2 X;  3S1R H;  3TME A;  1YNJ D;  5C4X B;  2K5N A;  3SK5 A;  1JWS D;  1HRJ A;  1R4P B;  4UP8 A;  3WDN A;  1BVS A;  3Q6S A;  3J7A F;  3MFG A;  3MZ5 A;  2JSO A;  3EN2 A;  1YJ9 A;  5M5W H;  5FJ8 H;  3GTM H;  1JQY D;  4R4O A;  4G7O C;  3CMA A;  1PFB A;  5EBD A;  2B2Y C;  4DV6 Q;  1CT1 D;  5C3E B;  1WTO A;  2F0S A;  2FXQ A;  2RCF A;  4LF5 Q;  1KAB A;  1STG A;  5IY0 A;  3VR2 A;  3CW2 C;  4KD3 A;  4IUQ A;  4JI1 L;  5ELD A;  4OO1 I;  4BBS B;  3CCU A;  2QDL A;  3HOY H;  1Q8K A;  5AJ3 Q;  3CPW A;  4UP9 A;  2EYL A;  1Y1W H;  1RF2 D;  1YVC A;  2AQ1 B;  5IWA L;  4B3S Q;  1ILP A;  4IJL A;  1SFO H;  4BA2 I;  5IP9 G;  1I4H A;  2JA6 G;  3URY A;  1N9W A;  1R4Q B;  4PNY A;  4LF7 L;  3OMC A;  1G6Z A;  1LTS D;  4IUR A;  1U0L A;  4DR5 L;  3KFU A;  2R3Z A;  2VNU D;  3EVQ A;  3BZD B;  2CWA A;  3K5O A;  1XMQ L;  5JJI A;  3KF6 B;  5M3M H;  2DNE A;  3TDQ A;  2JA5 G;  3BS1 A;  3VR4 A;  2NZ1 D;  4G7H C;  1XPO A;  3S2D B;  1PTO H;  1HH2 P;  3F2C A;  1UAP A;  1XTC D;  2R61 A;  3HOW H;  1ZYR C;  1SYB A;  2M2L A;  1D5X C;  4A93 G;  4DAY B;  5CBE E;  5CMD A;  2B8F A;  3DMU A;  3NQT A;  4A93 B;  4BY7 G;  1B9N A;  1TS4 A;  5CV7 A;  4C3J G;  3C1F A;  1WTR A;  4K8J A;  4EVO A;  4JYA L;  4KN7 C;  4DV2 L;  4Q0F A;  3TS2 A;  1ET9 A;  5G3L D;  1PMR A;  4N8X 1;  1XJV A;  4P74 A;  4FP5 D;  2CWP A;  1Q12 A;  3K5M A;  2CQA A;  1F9R A;  1JJC B;  4GLV B;  2DUD A;  2EY6 A;  2NVY B;  3DUZ A;  3S16 H;  3N6R A;  3J7A V;  3VYT A;  3T51 B;  3DM3 A;  5IGF A;  1SNC A;  1GUO A;  1STH A;  1S5E D;  3QO2 A;  4XYO A;  3TRZ A;  4WOR A;  1QE6 A;  5TSS A;  3OOC A;  2N3S A;  1S4Z A;  1C4Q A;  2L5T A;  4QY7 A;  4L6T B;  1SMY D;  4ILW A;  3NTI A;  1B7Y B;  1IBL Q;  1STE A;  1YHQ A;  1CQF A;  1N34 Q;  3B6Y A;  2F03 A;  4S3S A;  4XT3 B;  5M5Y B;  3S14 B;  2D2C C;  3SK8 A;  3UDF A;  3GTK B;  1ENC A;  1TY0 A;  3RMH A;  4FDB A;  1EQT A;  4EQ5 A;  1HFG A;  4B3T Q;  3GTP B;  2VB3 X;  4DR1 L;  1K83 H;  3SGI A;  2BCO A;  2K5D A;  3OTO L;  3W3A A;  4XT1 B;  1SE2 A;  1PH9 A;  1NR2 A;  3C2P A;  1U4P A;  1K8G A;  3RNU A;  2RKS A;  1KAA A;  3I73 A;  2L9H A;  3S15 H;  2JA8 B;  1E1O A;  1TKW B;  1BF4 A;  2I5H A;  4HTH A;  3R8B A;  4NXN L;  3MEF A;  1AFP A;  1TVX A;  1QUQ A;  1I4G A;  1IL8 A;  4KMU C;  3I2Z A;  3KJO A;  5AFW A;  1HTP A;  5COR A;  1I6V C;  3C3L A;  4N8F A;  5LMN W;  5C5M A;  1O7Z A;  3SK6 A;  2H1E A;  1U5K A;  4LF9 L;  4OWT B;  1G29 1;  2R92 H;  1D5Z C;  3HKS A;  1SYE A;  1N33 Q;  1Y1V B;  1L1O B;  3JAM E;  3QG1 A;  4ZUI A;  2X69 A;  4JI3 L;  3L0O A;  4P73 A;  2NVQ H;  4HID A;  4CDC C;  1LT3 D;  1PTO C;  3MFY A;  1LTA D;  1EOV A;  1X3Q A;  1N32 Q;  1RL2 A;  4DV5 Q;  1HNW L;  2R92 G;  3Q8D A;  3PIO A;  4DR4 Q;  3G6E A;  1E2Z A;  5C4J B;  1KD1 C;  3CME A;  2Z0S A;  3GQB A;  3GTQ H;  3GTL H;  1L1O A;  1X3P A;  3U9S A;  4JI1 Q;  3Q0A A;  1HNZ L;  1P16 A;  4HIK A;  1TWF H;  3A74 A;  1PH3 A;  2R7Z G;  2WV6 D;  1SRU A;  5D14 A;  4A3E G;  2B2V C;  3M7N A;  1CTM A;  4KJO A;  2VZA A;  3M4Y A;  4X62 L;  4ME5 A;  2WAC A;  5KYI A;  3ERQ A;  2K14 A;  4K0K Q;  3X3N A;  1RTO A;  2PQA A;  2WFW A;  3I3C A;  3S17 H;  1RKN A;  4A3F G;  1WTX A;  4L5Q A;  3I72 A;  3DWQ A;  3D31 A;  1FVI A;  3RD4 A;  1D8L A;  1FD7 D;  4J8Q A;  2PW7 A;  2R92 B;  4DK3 C;  1TT2 A;  4HSP A;  1KHI A;  2MPM A;  1ICF B;  3VA7 A;  3UDI A;  2BE5 D;  3HFZ B;  4LFC Q;  3VA5 A;  2YU9 H;  1AN8 A;  3F8T A;  1EQQ A;  4CDE C;  4DV2 Q;  4H7B A;  4A3E B;  4JG2 A;  2VQF L;  1XPR A;  2MHV A;  1SNM A;  2NZH A;  3SDZ A;  2JYO A;  3C46 A;  1M90 C;  5LL6 S;  1SMY C;  4RA8 A;  4YWM A;  4X66 Q;  2UXD Q;  5IT9 L;  1CHP D;  4DN4 M;  4HN7 A;  5I9O A;  4LJZ C;  3J80 c;  5FLX E;  2PYK A;  3S17 B;  1GUG A;  4LUO A;  1PFM A;  4C3H H;  4DV0 L;  1TWC B;  1B4O A;  1ROD A;  1NTG A;  2CHB D;  4KHV A;  5COY A;  2B63 H;  3RLN A;  2F52 A;  1EY4 A;  3OPO A;  5ELC A;  1YIT A;  3T1H Q;  1PHJ A;  1VQ5 A;  3S2D H;  4GOP A;  4RKB A;  1HR0 Q;  1LYL A;  2HQE A;  1SDF A;  3BDC A;  5T1I A;  1N8R C;  1KLG D;  2EJG C;  3D3R A;  4B3R L;  2XSC A;  3PUY A;  1PH4 A;  1V43 A;  1V9P A;  3CCL A;  3G48 A;  4QUC A;  1JJ2 A;  2NVT B;  1OO9 B;  4KY6 A;  1FNU A;  3HOX G;  2RSN A;  1PYB A;  2EYJ A;  3N52 A;  4KHP L;  1X9N A;  1W3S A;  3M7G A;  1SNP A;  4A3J G;  2ZXP A;  4JBM A;  4OXP A;  4F8M A;  3HOW G;  1I50 B;  1H9R A;  1PV4 A;  4G7Z C;  3RN2 A;  3K57 A;  4PZ6 A;  5IIF A;  2M00 A;  1WD1 A;  1HQM C;  4B3T L;  3AMU A;  1CI3 M;  3I8Z A;  4DR2 Q;  4V0B A;  1VQK A;  3PUW A;  2R6G A;  1UNS A;  4X3S A;  3TP6 A;  1QJO A;  3BYT B;  1F9P A;  5EAY A;  3HOZ B;  5IP9 H;  2VUM G;  2JN4 A;  1WJJ A;  4QIW B;  3SEB A;  1XNQ L;  3HKZ B;  3M9B A;  5I6W A;  4DPG A;  1WTP A;  4FXK C;  3DWA A;  4HJA A;  3K0X A;  4A3K G;  2Q8T A;  4GN5 A;  2B2U A;  3I4L A;  2ZM6 Q;  3GTK H;  2OT2 A;  3I90 A;  1VQP A;  5C4X H;  2UUB L;  1SLJ A;  2G5D A;  4QGU A;  3BYY B;  1JT8 A;  4RGO S;  3PSI A;  1N33 L;  1XPU A;  2AQ3 B;  2A6E D;  3MC0 B;  3I55 A;  2JA8 H;  2XGT A;  2CH4 A;  3EBE A;  4DV5 L;  2B8G A;  4ID6 A;  3K59 A;  4A3D B;  1YHB A;  3KLS X;  4KI0 A;  1OXU A;  2A69 C;  2E2H H;  3HOY B;  1JE4 A;  4PQX A;  1V1O A;  2HCC A;  2RVL A;  4R4I A;  4E6I A;  4C3I B;  2XTI A;  3KF8 B;  2Q2I A;  4OWX B;  2QGQ A;  2KHJ A;  5FLM G;  5C5L A;  3NUC A;  5LMN Q;  1GO3 E;  4DR7 Q;  3GTL B;  4DK6 C;  2PMZ B;  1SMX A;  2WAQ E;  5IT9 E;  1E2V A;  3G4S A;  1EU4 A;  4JI2 Q;  1KIX A;  2F0G A;  2K6A A;  3MVV A;  4C2M B;  3HOV H;  4A4I A;  1O80 A;  2Y0S E;  4HJ5 A;  2K1B A;  4LFC L;  3VYU A;  4FNF A;  2L15 A;  1YZ6 A;  2R7F A;  4ZKC B;  1EIY B;  5GRO A;  1C8C A;  3OMG A;  3NWS A;  4A3B B;  1IBM Q;  1JE5 A;  4FVM A;  5HGT A;  2R93 B;  1MKH A;  4L8J A;  2MNA A;  1UE1 A;  3AQQ A;  2SDF A;  1VQA A;  4K5X A;  2QCP X;  4DAP A;  4PMW A;  5NUC A;  1DZ1 A;  1XMO L;  1EIG A;  4IFD G;  3CP0 A;  3E0J A;  4EGV A;  4ZQ3 A;  4DNT B;  1VQ6 A;  2QIL A;  1Q8I A;  1PH6 A;  2RA4 A;  1Q1E A;  4O2D A;  4X66 L;  2UXD L;  1DD2 A;  2F1M A;  1VQI A;  2K5V A;  4JV5 Q;  4P2C B;  5DEH A;  2JEB I;  1IZ6 A;  4JPB W;  2GVA A;  1K3B C;  4JYA Q;  4PMB A;  2AKW B;  3V2T A;  4CKE A;  1LM0 A;  1K3R A;  1KXL A;  3A0J A;  3MTS A;  4OGQ C;  5J3B A;  5HUR A;  1F9S A;  3CQZ H;  2EDG A;  4JI6 L;  2B2T C;  2EJM A;  1L2F A;  2HIV A;  5IGE A;  4FF3 A;  1C7Y A;  4BA1 I;  1LT4 D;  3R93 A;  2EYF A;  2CH4 W;  1WTQ A;  4O42 A;  4FF4 A;  1CZW A;  3U50 C;  4JI8 Q;  1G8Z D;  5HGQ A;  4K6L A;  1Y14 B;  2HHH L;  3GTO B;  4R4Q A;  3F1Z A;  5CV9 A;  1WCM G;  2CW0 D;  1XNR Q;  4HSV A;  5FO7 B;  3S1R B;  2B2W A;  1X3E A;  1QZH A;  4H02 A;  2HD3 A;  3CC2 A;  5ELN A;  1KC8 C;  1HCZ A;  2EXZ A;  2SOB A;  4UY8 C;  1TWA B;  4JOI A;  4NPS A;  4BY1 B;  3MXU A;  4DR2 L;  3E3X A;  2DGY A;  3P1H A;  4HCS A;  4JVZ A;  3I4M G;  4BY1 G;  1L0X B;  4DR1 Q;  1V8Q A;  3ULJ A;  2G9H D;  5ISR A;  4X65 L;  5BN5 A;  2HDM A;  3GTJ H;  5C3E H;  3IAY A;  3FRP B;  3HOV G;  2JA5 B;  4H13 C;  1HQR D;  4JBJ A;  4JOI C;  1VQN A;  1M8A A;  2GVB A;  4KKU A;  4HJ7 A;  2L4N A;  4F88 A;  1QG7 A;  1GUT A;  2K28 A;  1SJE D;  1NE3 A;  5ELO A;  5H1S E;  1I4Q A;  5FOB B;  2LKV A;  3HRZ C;  1V1P A;  4IPD A;  2ZJP A;  4FF1 A;  2Z6K A;  1UEB A;  3KF8 A;  1LTR D;  2NVX H;  3RUZ A;  2A6E C;  4LUV A;  2FJ2 A;  2ZTE A;  1KAW A;  3BVM A;  1EFI D;  4XQN A;  1JWM D;  2NUC A;  5CGK A;  1V1P B;  1E2W A;  1TWA H;  2H4O A;  1SE8 A;  3J81 L;  5EPL A;  2KQ3 A;  1Q90 A;  4LF4 Q;  2Q2U A;  1ENF A;  1Z9F A;  4KKS A;  3JAM i;  1Y1W B;  2A6H C;  1SNO A;  3FMC A;  2UU9 L;  1TY2 A;  4EQP A;  1SJH D;  1YNJ C;  4GN3 B;  4AYB B;  1CKN A;  1TWH B;  3E9H A;  3UDG A;  3OSO A;  1S40 A;  3T1H L;  1BOS A;  3I4M H;  3W2D A;  3I4N G;  1DJR D;  4IJH A;  4IQZ A;  4BXX G;  4POF A;  3PIP 3;  3HOZ G;  2BOS A;  3D4W A;  3LNN A;  4A3M B;  5IGD A;  1R9T B;  3F2D A;  4A3M G;  1X32 A;  3E0E A;  2FHT A;  4QJF A;  1TQO A;  2XRQ D;  4A3I B;  1WCM H;  4KHZ A;  5DM6 3;  4HCE A;  3A5U A;  2A19 A;  4DV4 L;  3UI2 A;  3TP7 A;  2C35 B;  3ONA B;  1WD0 A;  2YV5 A;  4YWK A;  2EQS A;  5C6A A;  2JA7 H;  2MUY A;  1BCP D;  2CCZ A;  4PG3 A;  2D9U A;  4C1N I;  1B9M A;  4DXF A;  1U9R A;  3GO5 A;  5IGC A;  2RHQ B;  3QB3 A;  1ICW A;  4HR7 B;  4B9X A;  5IP7 H;  4LF8 L;  4GKK L;  2I5L X;  1OXX K;  3G6J B;  3K81 C;  3D4R A;  3RZO B;  3TP5 A;  4DK0 A;  2XIW A;  1PTO F;  1E1T A;  3KLW A;  3OWF A;  4QB4 A;  4DUY Q;  4DV1 Q;  1EYG A;  2F0W A;  1IYV A;  2FIN B;  1PRT B;  1BNZ A;  4FO2 A;  2UUC L;  5IP7 G;  2VQE Q;  1EIH A;  1GUW A;  2KHI A;  4G57 A;  1HHV A;  1A0I A;  1F77 A;  1BO0 A;  4JI8 L;  4TVA B;  1YBY A;  1TXY A;  2ZJR A;  2M9V A;  1GM5 A;  1CKO A;  2F0F A;  1SXT A;  3NQI A;  1EY6 A;  3MXN B;  1XNR L;  4K14 A;  5DLQ E;  2E2J B;  4B3M L;  5LMU Q;  5C44 G;  2F0V A;  2ALY B;  4IOA A;  2JA6 B;  1K28 A;  2I5M X;  4GLA C;  5BR8 L;  3PO2 G;  5M3M B;  1NNX A;  3FKI H;  2K5H A;  4ABN A;  4KHP Q;  4YY3 Q;  2NZO A;  3QIA A;  4R8N A;  5M3M G;  1EZ6 A;  1GXD C;  4K2L A;  1IHZ A;  3BU2 A;  2PZT A;  3NXW A;  1D2B A;  3CHB D;  2PZU A;  2V1C C;  1SE3 A;  1PH1 A;  3PIO 3;  1TS3 A;  3ND8 A;  4BXX H;  3UE1 A;  4HED A;  3S15 B;  2C9O A;  2G9D A;  2DY8 A;  1VDZ A;  4J6H A;  2FFK B;  1Z7T A;  1DM0 B;  3CD6 A;  3H3V H;  1G6P A;  1DOM A;  2TSS A;  1ESF A;  4AQY Q;  2IPK D;  1GHK A;  2R7Z B;  3HZX A;  2NN6 I;  3AEV A;  1Z47 A;  2JA6 H;  3AFP A;  3A56 A;  2EVB A;  2ATW A;  2K01 A;  2ZM6 L;  5IYB H;  3GTQ B;  2HCI A;  2IX0 A;  1W6K A;  2O5I C;  2MP1 A;  1TS5 A;  2F4V Q;  4QQB X;  5KND A;  4LUZ A;  4IZ8 A;  5IGG A;  3M3Y B;  1PTO D;  3KLR A;  2PQA B;  3E9I A;  3FKI B;  4RWS C;  4RMF A;  3PUZ A;  1QNK A;  1ZKO A;  1PYW D;  1QIL A;  5EGT A;  2F0T A;  1SRO A;  1XTD A;  2E8G A;  4ALP A;  3S14 H;  3PGZ A;  1HR0 W;  4BBR B;  5C4X G;  2NB0 A;  1HZA A;  4LFA Q;  3Q23 A;  1JMC A;  3T53 B;  4P72 A;  3GTG H;  1LTL A;  3I4M B;  4BY1 H;  4DV3 L;  2WP8 J;  2VUM H;  1TWH H;  4IN3 A;  4JI5 L;  1IBL L;  4JI2 L;  3EFX D;  1JR0 D;  4L63 B;  1IBK Q;  1N36 Q;  2CFM A;  5I2X A;  1QVG A;  1B3A A;  1FGB D;  2DY7 A;  1MD2 D;  4RHR A;  5M9O A;  1I6H H;  2MFI A;  4ZYS A;  1OTC A;  2Z9H A;  5G3L F;  5M5X B;  3WOF A;  4B08 A;  5C0X J;  3DLL A;  3CCV A;  3CXC A;  2B39 A;  3BVZ A;  4IUT A;  3FEW X;  1J6Q A;  1IBM L;  1NY4 A;  1MSH A;  4CGY B;  3KDF A;  1BDO A;  2KVM A;  1HA6 A;  2CVR A;  1QB5 D;  1X54 A;  1PXU A;  2B3G A;  2Z6B A;  4TSS A;  3RR5 A;  5ELE A;  4XQJ A;  3HKZ G;  4DV7 L;  1HFN A;  1EY9 A;  1PFN A;  4DR6 L;  1VQL A;  3GTP H;  1D1K A;  2A69 D;  1RHP A;  4QF4 A;  1JOO A;  2RDG A;  5FJ8 G;  4IPH A;  4K8I A;  3HOX B;  1EQR A;  4X65 Q;  2O5J C;  3S24 A;  4CDF C;  2N78 A;  3LWE A;  2LSS A;  1FR3 A;  2E75 C;  4YHH L;  1EOT A;  4JC0 A;  5FO9 B;  5D3D A;  2JXM B;  5F2D A;  4JI3 Q;  1DON A;  3NTH A;  4NXN Q;  1A3T A;  4KK7 A;  2AMC B;  4JCV E;  1VQ4 A;  2SEB D;  2OEO A;  3TSS A;  4C1N K;  4MN3 A;  1SFO B;  1VQH A;  2F0E A;  2WB1 E;  1V1Q A;  5T1G A;  4DXG A;  5C4Z A;  4AH6 A;  4B3M Q;  2R93 G;  1OXS C;  1X65 A;  4G4K A;  4UDU C;  4OO1 G;  2EY5 A;  1RIP A;  4L5T A;  3CPF A;  1C0A A;  3SK4 A;  1ILQ A;  1E7Z A;  4XIG S;  3STB D;  4X64 L;  3JAM L;  4A3I G;  3KLS A;  1XX8 A;  5DNF A;  4RFB A;  1W2B A;  3BVG A;  4GKJ Q;  4LFB L;  4LF4 L;  4JBK A;  1GJX A;  1CK1 A;  1SE4 A;  1Y69 U;  2I46 A;  3T1Y Q;  5EPJ A;  3OTO Q;  1HNW Q;  1VQ7 A;  1H9M A;  2CQO A;  3ITP A;  1VQD A;  1EY8 A;  2F0L A;  1VQC A;  1MJC A;  3I4N B;  1IYU A;  2QDB A;  1I5F A;  1JOK A;  2K03 A;  3CRK C;  3E6Z X;  5BN3 A;  4NMZ A;  4A3B G;  1MIU A;  3VDY A;  3HOY G;  4I65 A;  3RLO A;  3H3V I;  1XXG A;  1WTH A;  2F0U A;  4NW2 A;  2NTS A;  2I07 B;  1EYA A;  2EY2 A;  1CHQ D;  2GA4 B;  3NE5 B;  2UXC L;  4EQN A;  2NWG A;  2B2Y A;  2K04 A;  3I91 A;  1IL2 A;  2EYP A;  4LF6 L;  5L37 A;  2NVX B;  2K5Q A;  1PZI D;  3NBI A;  3S9W A;  4FXD A;  4RGT A;  3QWN A;  1A8V A;  2KEC A;  5IYB G;  3DEP A;  2F0H A;  3TZU A;  2KA7 A;  1H9K A;  1K83 B;  3PV0 A;  3RLF A;  3R3O A;  4K5W A;  4A3C G;  3M4O H;  1BBW A;  4A3B H;  2XWB B;  1UE6 A;  3A8K E;  2QKI C;  3Q22 A;  3KBG A;  2MO0 A;  1VF7 A;  3P20 A;  4KJN A;  3EIV A;  4ZAI A;  3M4P A;  5FLX L;  4XDX A;  1GKH A;  2AWO A;  2B2W C;  5LHY 1;  2E76 C;  1IXR A;  4JI4 L;  2YTV A;  1QZG A;  4R4C A;  4HIM A;  1PRT D;  1Y1V G;  5EPK A;  5E1F A;  3PO3 G;  1N36 L;  2IL8 A;  4O1N A;  5E4W C;  1CA6 A;  2OWO A;  2L55 A;  5C3E G;  5M3F G;  3FKI G;  4WJW A;  4DKA C;  3L9A X;  4EX5 A;  1X55 A;  3BG3 A;  4HAE A;  5CYU A;  3TN2 A;  4GNX B;  4ZRZ A;  5EJW A;  1FGU A;  1SAP A;  1K8M A;  3H0G G;  1BCP B;  3HKZ E;  1DXM A;  2A68 D;  4OO1 H;  2EJF C;  1PFS A;  3BDL A;  2A68 C;  4LW1 A;  1PVO A;  2PNH A;  5LMU L;  1HPC A;  2JE6 I;  2YTY A;  1VQM A;  5C44 H;  1XYI A;  1E22 A;  2F0N A;  1A62 A;  2OQ0 A;  4IPG A;  5IOC A;  5A2Q L;  2OXP A;  4OWW B;  4K2K A;  1STB A;  3RN5 A;  4QIW E;  2A8V A;  4RAU C;  2BH8 A;  2LS0 1;  4KN4 C;  3C1E A;  4MNO A;  4WRD A;  2D62 A;  3S1N B;  5C3X A;  1S72 A;  1HXY D;  3GV3 A;  1KL9 A;  1XNQ Q;  3RZD B;  1BUV T;  2RDH A;  4YHH Q;  3PQI A;  3TBI B;  4HMJ A;  4BBR G;  2I0Q A;  2Q2T A;  3J80 i;  4RKL A;  1VMC A;  3J7Z C;  3M4O B;  4GN4 B;  4CJ2 C;  4TQU S;  1Q46 A;  2JP1 A;  1NMG A;  3BJU A;  4B3R Q;  4DV1 L;  2HIX A;  2F0O A;  3DWP A;  4LF9 Q;  1SR3 A;  2IWH A;  1A63 A;  1B44 D;  2WAQ B;  2IW3 A;  1PRT C;  4ZUJ A;  4Z9C B;  5CC4 A;  4DR3 Q;  3I70 A;  1BR9 A;  4JK1 C;  3W1G A;  2F4V L;  3QOL A;  4IPC A;  1S5C D;  3J7Y W;  4KKT A;  3CCM A;  4OON A;  1GD7 A;  5BN4 A;  4U67 3;  3P7J A;  1F2M A;  2B2T A;  2Q2H A;  1FNV A;  5GAG C;  1A3U A;  4J15 A;  3T1Y L;  1WTW A;  4GLX A;  3H15 A;  1J8I A;  4IUN A;  1O7Y A;  2UXB Q;  2KED A;  3HOX H;  3T4A C;  4DAV A;  4CJ1 B;  1EU3 A;  1MBY A;  1SYD A;  4BY7 B;  4KLK A;  4X3U A;  1BCP C;  1IKM A;  2XVS A;  4GNX C;  1U4M A;  4JI0 L;  4K0K L;  1H9S B;  1BBU A;  4LWC A;  4ME3 A;  5EQ0 A;  5EBC A;  1PZK D;  1K0S A;  1KNE A;  1SYF A;  1EL0 A;  2RHS B;  1F2Y A;  1QVC A;  5M5W B;  3GTM B;  4WJ3 M;  2HT1 A;  3BDO A;  5CV8 A;  1HZ9 A;  3L3O C;  1CA5 A;  1PH8 A;  1SYC A;  2KCT A;  5M5Y H;  1PZJ D;  2K05 A;  4DNR B;  2A73 B;  1KTK A;  1MI2 A;  1U4L A;  5JVH 3;  3VYS A;  4MTK A;  3S2H H;  1T5E A;  5JPM C;  1U4R A;  3M3Y H;  3J81 i;  3O13 A;  3J81 j;  1LT6 D;  4CHT B;  2OF1 A;  5JJZ A;  3EJI A;  1ET6 A;  3HS0 C;  2NVT H;  1Y8O B;  2BDO A;  3L2P A;  4I7Z C;  3F2U A;  2CKZ B;  5I2Y A;  4JV5 L;  5KNB A;  1I50 H;  1PA6 A;  3GTG B;  2DJG C;  1G91 A;  3NP8 A;  2AHO B;  1ASY A;  3PUX A;  2L11 A;  3HEJ A;  3IFD A;  1LTI D;  1NSN S;  2AQ2 B;  4HJ8 A;  3K7U C;  3KBX A;  2LY7 A;  3OIQ A;  2PO4 A;  5K36 G;  1II3 A;  1I3Q B;  1I94 L;  4RG1 A;  5JPN C;  1QNU A;  4KV6 A;  1K0R A;  2MQH A;  2B2V A;  2YTX A;  4ZCK A;  4OL7 A;  3J81 E;  4A3F H;  3I4N H;  5JJK A;  3HOZ H;  2VS1 A;  2ZTC A;  1EUJ A;  1QWY A;  2H5X A;  4IUP A;  4NDX A;  1EY0 A;  1LT5 D;  1PH7 A;  1SN8 A;  3IKJ A;  4JI7 L;  2Y0S G;  3LWU A;  1WCM B;  3BZC A;  2LMC B;  1YJW A;  1K9M C;  1OXV A;  4QCL A;  2CW0 C;  3TS0 A;  4P71 A;  2OTL A;  2E2I B;  1TU2 B;  3TZD A;  2E2J H;  1DCZ A;  1O7I A;  3NTK A;  1CUK A;  5DM7 3;  2E5L Q;  2KCN A;  4DV6 L;  3CCR A;  2KEE A;  4X64 Q;  5A2Q E;  3PO3 B;  2HUG A;  2A6H D;  5JVG 3;  4H44 C;  2JA7 G;  2N8N A;  5KIX A;  2K4K A;  2JA7 B;  2XNA C;  3UE0 A;  3JC6 6;  1X3F A;  1WFQ A;  2EXD A;  2UUA L;  1AE2 A;  1I3Q H;  2F0D A;  1HJP A;  3HP3 A;  3TEH B;  1F9Q A;  3GV6 A;  3VR3 A;  3CKI B;  3ND9 A;  3U58 A;  1K73 C;  3H0G B;  1BBX C;  1Q3L A;  3ULL A;  4DV7 Q;  4B3S L;  5E7N A;  4MIU A;  3GP7 A;  1LTG D;  1BCP F;  3NEL A;  1ENA A;  5CV5 A;  5EKI A;  3KK7 A;  4N9P A;  1A15 A;  2F3I A;  2RBM A;  1JJG A;  1LUZ A;  4J1M A;  1SBB B;  4DU9 A;  1TWC H;  2XWJ B;  1A2T A;  1GUN A;  2KUM A;  2ZTD A;  1YNX A;  4LF5 L;  4YCV A;  1FNW A;  3G71 A;  1YNN D;  1Q81 C;  1TWG H;  2ENB A;  4A3J H;  5IYC G;  1A2U A;  3E5S A;  2WII B;  1YHA A;  3I4O A;  1HNX L;  2UU9 Q;  2ZXR A;  4ULL A;  5IGB A;  1K8A C;  1UWV A;  1WYD A;  4A75 A;  2IHE A;  3J7A 5;  3DEO A;  1CSP A;  2EYH A;  4M8A A;  5JOB A;  4DR5 Q;  4APV A;  5I4D A;  3BZK A;  3UDX A;  1SYG A;  1X3G A;  4DF7 A;  1Q1B A;  3AFQ A;  3U9O A;  4GS3 A;  3HOU G;  2ZT9 C;  3ULP A;  1A6X A;  4DAY A;  1EWH A;  3EA6 A;  3LX0 A;  3CRL C;  4PZ8 A;  5C0X H;  4BBR H;  1YNN C;  2P5Z X;  3K8A A;  2Z4I A;  5GAD C;  2KJX A;  3ERO A;  2KCM A;  2JEA I;  4RGM A;  2IT1 A;  3FPP A;  4CKC A;  4DV4 Q;  2E74 C;  2QW7 A;  1GUS A;  4C3J H;  1PH5 A;  5C4J H;  4IFD I;  1EEF D;  4C56 C;  2AUJ D;  2PI2 E;  1UE7 A;  3GTJ B;  1VQG A;  4A93 H;  3S2H B;  2C5C A;  3S1Q H;  4BY7 H;  2NVQ B;  2UXC Q;  5J39 A;  1JC7 A;  1B53 A;  4GKK Q;  1Z6H A;  1T5X D;  1M1K C;  4ZLT F;  2EIF A;  2NVY H;  4F87 A;  1EYD A;  4NB3 A;  3GTO H;  2SNS A;  3OIP A;  1H9J A;  4XYQ A;  2PQE A;  3EQL C;  2O4X A;  1KDB A;  3KYH C;  4Y7N B;  4M1U B;  1EEI D;  1MSG A;  1CZG A;  4DA2 A;  1O78 A;  4PZ7 A;  2F0M A;  2K33 A;  1RTN A;  5FLM H;  3K5L A;  1JOQ A;  1ML0 D;  2QF7 A;  2WAQ G;  1HR0 L;  3S16 B;  1YIJ A;  4CKB A;  5JEA G;  3QJY A;  2XN9 C;  4NXM Q;  1D5M C;  1ZEQ X;  1PLF A;  3STB C;  1RD9 D;  3OW7 A;  3FPU B;  1VQO A;  3NSW A;  4HJ9 A;  1B70 B;  4IOC A;  3L7Z C;  1GOZ A;  1F2L A;  4R8I A;  2KOL A;  1DYQ A;  2MO1 A;  3FDT A;  3KUP A;  3RZD H;  2UUA Q;  4GZY C;  1QOH A;  1VQF A;  4FXG C;  4C2M H;  3MEH A;  2KCC A;  5KEE A;  2N49 A;  1I4X A;  2WKC A;  3DXJ C;  1UE5 A;  1UUP A;  2JA8 G;  1VMP A;  1HUM A;  1KRS A;  2L1B A;  4DUZ Q;  1DOK A;  1RCV D;  3G7L A;  3D0F A;  1CKM A;  1CM9 A;  4K5V A;  5I9P A;  1D6E C;  3NPP A;  2F0Q A;  4QL5 A;  3K58 A;  1VQE A;  2BA1 A;  3DHQ A;  3V05 A;  1BKB A;  4A3G H;  3W5O A;  1L0W A;  1G2S A;  4GNX A;  4C3I G;  1VQ8 A;  1D7Q A;  1L1O C;  4YY3 L;  4XXE A;  4H0L C;  1IW7 D;  1JIC A;  3OHX C;  3V96 A;  2IHF A;  2UUC Q;  2RQX A;  1W6J A;  3WWV A;  1VCI A;  1Q82 C;  1J5E L;  3H3V C;  1LO5 D;  1JB7 A;  3MXN A;  5E4X A;  2DN8 A;  4FF2 A;  1NUC A;  4BBS G;  3KOJ A;  1STN A;  3HGB A;  3P75 A;  4YIJ A;  1D1I A;  2R93 H;  4K6D A;  5IYD H;  1G51 A;  3SHL A;  3PF5 A;  1Y8P B;  1HA5 A;  2WB1 G;  1I4P A;  4A3I H;  4OHJ A;  5GAE C;  3JAM c;  4DAM A;  2WB1 B;  4ODG A;  2VQF Q;  1KDA A;  2PZW A;  3OW2 A;  4A76 A;  2ES2 A;  2ICI A;  2JJQ A;  4LFA L;  5JEA J;  1IW7 C;  3R2I A;  1L0Y B;  4A3M H;  1N32 L;  1QCB D;  2JQO A;  1J9O A;  4Q5V A;  2VY3 A;  1ONL A;  2HQL A;  1X56 A;  4QUF A;  4DV0 Q;  2BH2 A;  2UXB L;  4CDD C;  4DR4 L;  1B8A A;  1PDQ A;  4I7A A;  3CQZ B;  3QR8 A;  1WTV A;  3GD7 A;  2J7Z A;  1ZXT A;  2Z6K C;  4F7X A;  3SE0 A;  3GDE A;  1IBK L;  2B63 G;  4N9T A;  1XWE A;  1NR4 A;  4A3D H;  4AQY L;  1EY5 A;  3A5Z B;  1IKL A;  2PPB C;  3ERS X;  3ZJY C;  3OYY A;  4CBV A;  1EWI A;  2EZV A;  4AYB E;  3CC7 A;  4DFA A;  2HDL A;  3HOV B;  4U68 A;  2XRS D;  4L5S A;  4QMG A;  1VQ9 A;  3DM1 A;  2MGS A;  1OXT A;  1EFW A;  1KDC A;  4PV1 C;  2BE5 C;  2B63 B;  1HUN A;  3HOW B;  1EQV A;  1KNA A;  5ELB A;  3QOJ A;  4JBW A;  1EWC A;  1MGS A;  2TMP A;  3WOE A;  4OX9 L;  3D4D A;  1WOC A;  2E2H B;  2A5H A;  4P75 A;  4KTA A;  3Q24 A;  4DUY L;  4AIM A;  3S1N H;  5JEA H;  1WI5 A;  2RF4 A;  3MA2 B;  3AYH B;  1MJE A;  4C3J B;  4KY5 A;  2L0C A;  2D5D A;  5CV6 A;  4NXM L;  5M3F H;  4DV3 Q;  4A3E H;  5CBA E;  3FVQ A;  5C0X I;  5C3W A;  1JOR A;  4IFD J;  1AZP A;  3A54 A;  2UUB Q;  1PRT F;  3CU7 A;  3PUV A;  3SVM A;  1VQJ A;  1Y1W G;  1S5F D;  4IUV A;  4BWG B;  1X6O A;  1SEB D;  1AW7 A;  2PCF B;  4MTN A;  1PH2 A;  4WFN 3;  1VF5 C;  4ZKB B;  2ZXO A;  3A8I E;  3MXG A;  1JCK B;  1STA A;  2IY5 B;  1LLR D;  2F3W A;  3AU7 A;  3VR5 A;  3VYR A;  2VXW A;  1STY A;  3CC4 A;  1CSQ A;  2KEN A;  1HNX Q;  2HHH Q;  2E5L L;  3T16 A;  3J80 L;  5AJ3 L;  4X6A H;  3K5N A;  2K52 A;  2NTT A;  3T13 A;  1RDP D;  3I7F A;  3F2B A;  1HZC A;  4A3K H;  3OWE B;  1RJT A;  1KQS A;  4R1J A;  1NAP A;  2EYM A;  1QVF A;  2K5W A;  1AEX A;  4POG A;  3K6O A;  5LMN L;  4OIK A;  4CJ0 B;  4RCO A;  4LFB Q;  4OIJ A;  1XMQ Q;  4LNQ A;  2RSO A;  2F4I A;  2KHS A;  2QEJ C;  2QEX A;  3H94 A;  1M4V A;  4KY7 A;  2ICE C;  2X6L A;  2LXK A;  3AB9 A;  2Z4H A;  3H91 A;  3M85 A;  1YEZ A;  4NP5 A;  1Q7Y C;  4R9W A;  4LF6 Q;  5M5X H;  1BQQ T;  4X3K A;  2F3V A;  2DJF C;  1S5B D;  3FP9 A;  1GHJ A;  2N55 A;  4RCN A;  4UPA A;  2NN6 G;  4DNI A;  3NK9 A;  3PO2 H;  1TWG B;  1B1Z A;  5EKL A;  4HMI A;  4A3G B;  2LFN A;  4DR7 L;  2K50 A;  2FMC A;  2IX1 A;  2K75 A;  5C0X G;  1F2Z A;  3T56 B;  4LMQ D;  1BXT A;  4A3L G;  3KJP A;  2PNR C;  3K7A H;  1EZ8 A;  2YYZ A;  1NJI C;  4RGN A;  3K0Y A;  2F0K A;  4DGZ A;  2YU9 B;  3PO2 B;  2Q8R E;  3CCQ A;  4WJ4 A;  3MWY W;  4O0A A;  4C3I H;  4YCU A;  1EY7 A;  4UHV A;  4C3H B;  1NMF A;  1VQB A;  1P8L A;  4TRD A;  4IFD H;  3NHH A;  1S3O A;  1FJG L;  4A3G G;  1XMO Q;  1LTB D;  1IYJ B;  3NEM A;  2JK8 A;  4A3F B;  1GVP A;  2NYZ D;  1UEA B;  1CFM A;  3TP8 A;  3ICE A;  2EE1 A;  3CCS A;  1T9H A;  4Y52 H;  2Y0S B;  3PF4 A;  4HIO A;  5IYD G;  4B9W A;  3H0G H;  1FYC A;  2NN6 H;  2PI2 A;  3VR6 A;  1G2T A;  5CV4 A;  2WIN B;  2J0T D;  3NBH A;  4KD4 A;  2V4D A;  2AUK A;  4ZK9 B;  3A55 A;  5J1Z A;  1I4R A;  3LGJ A;  2WKD A;  4OX9 Q;  1B50 A;  3A8J E;  1R9T H;  1DGS A;  3PO3 H;  2LXJ A;  4JI4 Q;  5LL6 X;  2VL6 A;  1E24 A;  3KDF B;  3U4Z A;  2OQK A;  5KRU A;  4IO9 A;  5FLX c;  2AWN A;  5GAH C;  2BA0 A;  4IUU A;  5D3I B;  4DR3 L;  3NBH B;  2O2L D;  3HOU B;  2E2I H;  2A1A A;  2QA4 A;  2OCE A;  1WVL A;  1Y8N B;  1Y1V H;  5I6Y A;  2R7Z H;  2ZJQ A;  5J22 A;  4XQQ A;  5KYL A;  2OTJ A;  3CCE A;  3K7A B;  2L12 A;  5IOD A;  2Q8I B;  4JI6 Q;  1JB3 A;  2F0J A;  1SND A;  1LV9 A;  3J80 E;  3HG9 A;  1CQV A;  1B3Q A;  2K32 A;  3KF6 A;  5CR3 A;  4A3C H;  1C48 A;  3ZYY X;  5KNC A;  2VUM B;  2IX3 A;  3W1B A;  5JAV A;  2X6G A;  3TRE A;  4GKJ L;  3X3M A;  2EY1 A;  3R2T A;  5IE8 A;  3ER0 A;  5BR8 Q;  2R7D A;  3MAQ A;  5FK9 C;  1HTL D;  1SNQ A;  2GN5 A;  4DUZ L;  2D0P A;  2N88 A;  3RZO H;  5A35 A;  3CAM A;  4RH6 A;  1QUQ B;  1A3V A;  4A3J B;  1TWF B;  4BS9 A;  4LF7 Q;  1EIF A;  1NBW A;  1H95 A;  3MXP A;  3HOU H;  2DNC A;  3A7A B;  3IRB A;  4MZ9 A;  5IWA Q;  4FYD A;  4EQO A;  1FL0 A;  2F0P A;  4JI0 Q;  4NKL A;  4UAI A;  1AE3 A;  3M4Q A;  2PMZ E;  1TII D;  3D8G A;  4X3T A;  1KLU D;  2KBN A;  3CCJ A;  1AH9 A;  2E2D C;  5K36 H;  3IFT A;  4MHE A;  1C9O A;  1J5E Q;  1H9S A;  4GOP B;  1K8O A;  3U4V A;  5E3F A;  2B29 A;  4YWL A;  1B2T A;  4A3K B;  5IYC H;  3NEN A;  2F0I A;  2EPB A;  2MJ8 A;  1NCV A;  3S1M H;  4TKO B;  2JA5 H;  2RDF A;  3NWT A;  2ID0 A;  2K7V A;  3PMF A;  1LAC A;  1HZB A;  5GQO A;  1YJN A;  1SSO A;  1O7L A;  4LAA A;  1VS0 A;  4IAL A;  1KRT A;  2A74 C;  3K80 C;  4YCW A;  2EOT A;  5C44 B;  1HNZ Q;  1ASZ A;  1AP0 A;  4A3D G;  3PCO B;  4LK1 C;  5C4H A;  4GOP C;  3FHW A;  4X62 Q;  4JI7 Q;  1LAB A;  1MHW C;  1S5D D;  5ELF A;  4V19 0;  1EYC A;  3J81 c;  3CF5 A;  1E3P A;  4C3H G;  3H09 A;  4OEL B;  5FO8 B;  2J4X A;  1YI2 A;  2EYO A;  2FMM A;  1E0B A;  3S1Q B;  2RCN A;  4A3L H;  2Z1C A;  2NBF A;  1ESR A;  5D65 A;  4JI5 Q;  1JWU D;  1ZYR D;  3D6C A;  5EKK A;  4UP7 A;  5DAU A;  3PIP A;  4AYB G;  1AZQ A;  2BDN A;  1FJG Q;  3TQY A;  5IT9 c;  5HY6 A;  4RHS A;  5KGU A;  3I56 A;  5JJL A;  1TS2 A; 
#chains in the Genus database with same CATH homology
 1TR5 A;  2Z8L A;  4PMC A;  3MHB A;  5K5P A;  3H6M A;  3A7L A;  3SXH A;  1I6H B;  3IL8 A;  1PTO B;  2B2U C;  4XTC S;  3SR1 A;  5FKA C;  4DK1 A;  2SNM A;  2PW5 A;  3D6W A;  5M3F B;  1DOL A;  1LTT D;  2IJ0 A;  3S1M B;  2VB2 X;  3TME A;  1YNJ D;  5C4X B;  3SK5 A;  1JWS D;  1HRJ A;  1R4P B;  3WDN A;  3Q6S A;  3J7A F;  3MFG A;  3MZ5 A;  2JSO A;  1JQY D;  4G7O C;  1PFB A;  5EBD A;  2B2Y C;  1CT1 D;  5C3E B;  1WTO A;  2F0S A;  1KAB A;  1STG A;  3VR2 A;  4KD3 A;  4IUQ A;  5ELD A;  4OO1 I;  4BBS B;  2EYL A;  1RF2 D;  2AQ1 B;  1ILP A;  4BA2 I;  1I4H A;  3URY A;  1R4Q B;  4PNY A;  3OMC A;  1G6Z A;  1LTS D;  4IUR A;  2R3Z A;  2VNU D;  3EVQ A;  3BZD B;  3K5O A;  2DNE A;  3TDQ A;  3BS1 A;  3VR4 A;  2NZ1 D;  4G7H C;  3S2D B;  1PTO H;  1UAP A;  1XTC D;  2R61 A;  1ZYR C;  1SYB A;  2M2L A;  1D5X C;  5CBE E;  5CMD A;  2B8F A;  3DMU A;  3NQT A;  4A93 B;  1B9N A;  1TS4 A;  5CV7 A;  4C3J G;  3C1F A;  1WTR A;  4K8J A;  4EVO A;  4KN7 C;  4Q0F A;  1ET9 A;  5G3L D;  1PMR A;  4FP5 D;  1Q12 A;  3K5M A;  2CQA A;  1F9R A;  2EY6 A;  2NVY B;  3DUZ A;  3N6R A;  3J7A V;  3VYT A;  3T51 B;  5IGF A;  1SNC A;  1GUO A;  1STH A;  1S5E D;  3QO2 A;  4XYO A;  4WOR A;  1QE6 A;  5TSS A;  3OOC A;  1S4Z A;  1C4Q A;  2L5T A;  4L6T B;  1SMY D;  4ILW A;  3NTI A;  1STE A;  1CQF A;  2F03 A;  4S3S A;  4XT3 B;  5M5Y B;  3S14 B;  2D2C C;  3SK8 A;  3GTK B;  1ENC A;  1TY0 A;  3RMH A;  1EQT A;  1HFG A;  3GTP B;  2VB3 X;  2BCO A;  2K5D A;  3W3A A;  4XT1 B;  1SE2 A;  1NR2 A;  3C2P A;  1U4P A;  2RKS A;  1KAA A;  3I73 A;  2L9H A;  2JA8 B;  1TKW B;  1BF4 A;  4HTH A;  3R8B A;  1AFP A;  1TVX A;  1I4G A;  1IL8 A;  4KMU C;  5AFW A;  1HTP A;  5COR A;  1I6V C;  3C3L A;  5C5M A;  1O7Z A;  3SK6 A;  2H1E A;  1G29 1;  1D5Z C;  1SYE A;  1Y1V B;  3JAM E;  3QG1 A;  4ZUI A;  2X69 A;  1LT3 D;  1PTO C;  3MFY A;  1LTA D;  1X3Q A;  1E2Z A;  5C4J B;  3GQB A;  1X3P A;  3U9S A;  3Q0A A;  2WV6 D;  5D14 A;  2B2V C;  3M7N A;  1CTM A;  4KJO A;  3M4Y A;  4ME5 A;  2WAC A;  5KYI A;  3ERQ A;  3X3N A;  1RTO A;  3I3C A;  1RKN A;  1WTX A;  3I72 A;  3DWQ A;  3D31 A;  3RD4 A;  1FD7 D;  4J8Q A;  2PW7 A;  2R92 B;  1TT2 A;  4HSP A;  2MPM A;  3VA7 A;  2BE5 D;  3VA5 A;  1AN8 A;  4H7B A;  4A3E B;  2MHV A;  1SNM A;  3SDZ A;  2JYO A;  3C46 A;  5LL6 S;  1SMY C;  4RA8 A;  5IT9 L;  1CHP D;  4DN4 M;  4HN7 A;  5I9O A;  4LJZ C;  5FLX E;  2PYK A;  3S17 B;  1GUG A;  1PFM A;  1TWC B;  1B4O A;  1ROD A;  2CHB D;  4KHV A;  5COY A;  3OPO A;  1EY4 A;  5ELC A;  4RKB A;  2HQE A;  1SDF A;  3BDC A;  5T1I A;  1KLG D;  2EJG C;  3D3R A;  2XSC A;  3PUY A;  1V43 A;  4QUC A;  2NVT B;  1OO9 B;  4KY6 A;  1FNU A;  2RSN A;  2EYJ A;  3N52 A;  3M7G A;  1SNP A;  2ZXP A;  4F8M A;  1I50 B;  1H9R A;  4G7Z C;  3K57 A;  5IIF A;  2M00 A;  1WD1 A;  1HQM C;  3AMU A;  1CI3 M;  3I8Z A;  4V0B A;  3PUW A;  2R6G A;  1UNS A;  4X3S A;  3TP6 A;  1QJO A;  3BYT B;  1F9P A;  3HOZ B;  4QIW B;  3SEB A;  3HKZ B;  5I6W A;  1WTP A;  4FXK C;  3DWA A;  2Q8T A;  2B2U A;  3I4L A;  2OT2 A;  3I90 A;  3BYY B;  4RGO S;  2AQ3 B;  2A6E D;  3MC0 B;  2B8G A;  4ID6 A;  3K59 A;  4A3D B;  3KLS X;  4KI0 A;  1OXU A;  2A69 C;  3HOY B;  1JE4 A;  4PQX A;  1V1O A;  2HCC A;  2RVL A;  4E6I A;  4C3I B;  5C5L A;  3NUC A;  3GTL B;  2PMZ B;  5IT9 E;  1E2V A;  1EU4 A;  2F0G A;  2K6A A;  3MVV A;  4C2M B;  1O80 A;  2K1B A;  3VYU A;  4FNF A;  4ZKC B;  1C8C A;  3OMG A;  3NWS A;  4A3B B;  4FVM A;  5HGT A;  2R93 B;  4L8J A;  2SDF A;  4K5X A;  2QCP X;  4DAP A;  4PMW A;  5NUC A;  1DZ1 A;  1EIG A;  4IFD G;  3E0J A;  4EGV A;  4ZQ3 A;  4DNT B;  2QIL A;  1Q8I A;  2RA4 A;  1Q1E A;  1DD2 A;  2F1M A;  4P2C B;  5DEH A;  2JEB I;  4PMB A;  3V2T A;  4CKE A;  3MTS A;  4OGQ C;  5HUR A;  1F9S A;  2EDG A;  2B2T C;  2EJM A;  5IGE A;  4FF3 A;  4BA1 I;  1LT4 D;  3R93 A;  2EYF A;  1WTQ A;  4O42 A;  4FF4 A;  1CZW A;  1G8Z D;  4K6L A;  3GTO B;  5CV9 A;  2CW0 D;  4HSV A;  5FO7 B;  3S1R B;  2B2W A;  1HCZ A;  2EXZ A;  2SOB A;  1TWA B;  4BY1 B;  3MXU A;  3P1H A;  4HCS A;  1L0X B;  1V8Q A;  2G9H D;  5ISR A;  5BN5 A;  2HDM A;  3IAY A;  3FRP B;  2JA5 B;  4H13 C;  1HQR D;  1M8A A;  4KKU A;  2L4N A;  4F88 A;  1QG7 A;  1GUT A;  2K28 A;  1SJE D;  1I4Q A;  5FOB B;  2LKV A;  3HRZ C;  1V1P A;  4FF1 A;  3KF8 A;  1LTR D;  3RUZ A;  2A6E C;  2FJ2 A;  3BVM A;  1EFI D;  4XQN A;  1JWM D;  2NUC A;  5CGK A;  1V1P B;  1E2W A;  2H4O A;  3J81 L;  5EPL A;  2KQ3 A;  1Q90 A;  1ENF A;  4KKS A;  1Y1W B;  2A6H C;  1SNO A;  3FMC A;  1TY2 A;  4EQP A;  1SJH D;  1YNJ C;  4AYB B;  1TWH B;  3OSO A;  1BOS A;  3W2D A;  1DJR D;  4IQZ A;  3PIP 3;  2BOS A;  3D4W A;  3LNN A;  4A3M B;  5IGD A;  1R9T B;  1X32 A;  2FHT A;  1TQO A;  2XRQ D;  4A3I B;  4KHZ A;  5DM6 3;  4HCE A;  3UI2 A;  3TP7 A;  3ONA B;  1WD0 A;  5C6A A;  2MUY A;  1BCP D;  2D9U A;  4C1N I;  1B9M A;  4DXF A;  1U9R A;  5IGC A;  3GO5 A;  3QB3 A;  4B9X A;  1ICW A;  4HR7 B;  1OXX K;  3G6J B;  3D4R A;  3RZO B;  3TP5 A;  4DK0 A;  2XIW A;  1PTO F;  4QB4 A;  3OWF A;  2F0W A;  1IYV A;  2FIN B;  1PRT B;  1BNZ A;  4FO2 A;  1EIH A;  1GUW A;  4G57 A;  1HHV A;  1F77 A;  1BO0 A;  2M9V A;  3NQI A;  2F0F A;  1SXT A;  1EY6 A;  4K14 A;  2E2J B;  2F0V A;  2JA6 B;  5M3M B;  4ABN A;  3QIA A;  4R8N A;  1EZ6 A;  1GXD C;  4K2L A;  1IHZ A;  2PZT A;  3NXW A;  1D2B A;  3CHB D;  2PZU A;  1SE3 A;  3PIO 3;  1TS3 A;  3ND8 A;  3S15 B;  4HED A;  2C9O A;  2G9D A;  2DY8 A;  1VDZ A;  4J6H A;  2FFK B;  1Z7T A;  1DM0 B;  1DOM A;  2TSS A;  1ESF A;  2IPK D;  1GHK A;  2R7Z B;  3HZX A;  2NN6 I;  1Z47 A;  3A56 A;  2EVB A;  2K01 A;  3GTQ B;  2HCI A;  2IX0 A;  1W6K A;  2O5I C;  2MP1 A;  1TS5 A;  5KND A;  4IZ8 A;  5IGG A;  3M3Y B;  1PTO D;  3KLR A;  3FKI B;  4RWS C;  3PUZ A;  1QNK A;  1ZKO A;  1PYW D;  1QIL A;  5EGT A;  2F0T A;  4BBR B;  2NB0 A;  3Q23 A;  3T53 B;  3I4M B;  2WP8 J;  4IN3 A;  3EFX D;  1JR0 D;  4L63 B;  5I2X A;  1B3A A;  1FGB D;  2DY7 A;  1MD2 D;  4RHR A;  5M9O A;  4ZYS A;  5G3L F;  5M5X B;  3WOF A;  4B08 A;  5C0X J;  2B39 A;  3BVZ A;  4IUT A;  3FEW X;  1MSH A;  4CGY B;  1BDO A;  2KVM A;  1HA6 A;  2CVR A;  1QB5 D;  1PXU A;  4TSS A;  5ELE A;  4XQJ A;  1HFN A;  1EY9 A;  1PFN A;  1D1K A;  2A69 D;  1RHP A;  4QF4 A;  1JOO A;  2RDG A;  4K8I A;  3HOX B;  2O5J C;  3LWE A;  1FR3 A;  2E75 C;  1EOT A;  5FO9 B;  5D3D A;  2JXM B;  5F2D A;  1DON A;  3NTH A;  1A3T A;  4KK7 A;  2SEB D;  2OEO A;  3TSS A;  4C1N K;  4MN3 A;  1SFO B;  2F0E A;  5T1G A;  4DXG A;  5C4Z A;  1OXS C;  4G4K A;  4UDU C;  4OO1 G;  2EY5 A;  3SK4 A;  1ILQ A;  4XIG S;  3JAM L;  3KLS A;  1XX8 A;  5DNF A;  4RFB A;  3BVG A;  1GJX A;  1Y69 U;  1CK1 A;  1SE4 A;  2I46 A;  5EPJ A;  1H9M A;  3ITP A;  1EY8 A;  2F0L A;  3I4N B;  1IYU A;  2QDB A;  1JOK A;  2K03 A;  3CRK C;  3E6Z X;  5BN3 A;  4NMZ A;  4I65 A;  1XXG A;  2F0U A;  4NW2 A;  2NTS A;  2I07 B;  1EYA A;  2EY2 A;  1CHQ D;  2GA4 B;  3NE5 B;  4EQN A;  2NWG A;  2B2Y A;  2K04 A;  3I91 A;  2EYP A;  2NVX B;  2K5Q A;  1PZI D;  3NBI A;  3S9W A;  4FXD A;  4RGT A;  3QWN A;  2KEC A;  3DEP A;  2F0H A;  3TZU A;  2KA7 A;  1H9K A;  1K83 B;  3PV0 A;  3RLF A;  3R3O A;  4K5W A;  2XWB B;  3A8K E;  2QKI C;  3Q22 A;  3KBG A;  1VF7 A;  3P20 A;  4KJN A;  4ZAI A;  5FLX L;  4XDX A;  2AWO A;  2B2W C;  5LHY 1;  2E76 C;  1PRT D;  5EPK A;  5E1F A;  2IL8 A;  4O1N A;  5E4W C;  1CA6 A;  2L55 A;  4WJW A;  3L9A X;  3BG3 A;  4HAE A;  5CYU A;  3TN2 A;  4ZRZ A;  5EJW A;  1SAP A;  1K8M A;  1BCP B;  1DXM A;  2A68 D;  4OO1 H;  2EJF C;  3BDL A;  2A68 C;  1HPC A;  2JE6 I;  1XYI A;  2F0N A;  5A2Q L;  5IOC A;  2OXP A;  4K2K A;  1STB A;  4RAU C;  2LS0 1;  4KN4 C;  3C1E A;  4WRD A;  2D62 A;  3S1N B;  5C3X A;  1HXY D;  3GV3 A;  3RZD B;  1BUV T;  2RDH A;  3TBI B;  4HMJ A;  4RKL A;  1VMC A;  3M4O B;  4CJ2 C;  4TQU S;  2JP1 A;  2F0O A;  3DWP A;  2IWH A;  1B44 D;  2WAQ B;  2IW3 A;  1PRT C;  4ZUJ A;  4Z9C B;  5CC4 A;  3I70 A;  1BR9 A;  4JK1 C;  3QOL A;  1S5C D;  3J7Y W;  4KKT A;  5BN4 A;  4U67 3;  3P7J A;  1F2M A;  2B2T A;  1FNV A;  1A3U A;  1WTW A;  1J8I A;  4IUN A;  1O7Y A;  2KED A;  3T4A C;  4DAV A;  4CJ1 B;  1EU3 A;  1MBY A;  1SYD A;  4BY7 B;  4X3U A;  1BCP C;  1IKM A;  2XVS A;  1U4M A;  1H9S B;  5EQ0 A;  5EBC A;  1PZK D;  1KNE A;  1SYF A;  1EL0 A;  1F2Y A;  5M5W B;  3GTM B;  3BDO A;  5CV8 A;  3L3O C;  1CA5 A;  1SYC A;  1PZJ D;  2K05 A;  4DNR B;  2A73 B;  1KTK A;  1MI2 A;  1U4L A;  5JVH 3;  3VYS A;  1T5E A;  5JPM C;  1U4R A;  3O13 A;  1LT6 D;  4CHT B;  2OF1 A;  5JJZ A;  3EJI A;  1ET6 A;  3HS0 C;  1Y8O B;  2BDO A;  4I7Z C;  3F2U A;  5I2Y A;  5KNB A;  3GTG B;  1G91 A;  3NP8 A;  3PUX A;  2L11 A;  3HEJ A;  3IFD A;  1LTI D;  1NSN S;  2AQ2 B;  3KBX A;  2LY7 A;  3OIQ A;  2PO4 A;  5K36 G;  1II3 A;  1I3Q B;  5JPN C;  1QNU A;  4KV6 A;  2B2V A;  4OL7 A;  3J81 E;  1QWY A;  4IUP A;  4NDX A;  1EY0 A;  1LT5 D;  3IKJ A;  3LWU A;  1WCM B;  2LMC B;  1OXV A;  4QCL A;  2CW0 C;  2E2I B;  1TU2 B;  3TZD A;  1DCZ A;  3NTK A;  5DM7 3;  2KCN A;  2KEE A;  5A2Q E;  3PO3 B;  2HUG A;  2A6H D;  5JVG 3;  4H44 C;  5KIX A;  2JA7 B;  2XNA C;  2F0D A;  3HP3 A;  1F9Q A;  3GV6 A;  3VR3 A;  3CKI B;  3ND9 A;  3H0G B;  1BBX C;  1Q3L A;  4MIU A;  3GP7 A;  1LTG D;  1BCP F;  1ENA A;  5CV5 A;  5EKI A;  3KK7 A;  4N9P A;  1A15 A;  2RBM A;  4J1M A;  1SBB B;  4DU9 A;  2XWJ B;  1A2T A;  1GUN A;  2KUM A;  1FNW A;  1YNN D;  2ENB A;  1A2U A;  3E5S A;  2WII B;  2ZXR A;  4ULL A;  5IGB A;  3DEO A;  2EYH A;  4M8A A;  5JOB A;  5I4D A;  1SYG A;  4DF7 A;  1Q1B A;  3U9O A;  2ZT9 C;  1A6X A;  4DAY A;  1EWH A;  3EA6 A;  3LX0 A;  3CRL C;  5C0X H;  1YNN C;  2Z4I A;  2KJX A;  3ERO A;  2JEA I;  4RGM A;  4CKC A;  2IT1 A;  3FPP A;  2E74 C;  1GUS A;  4IFD I;  1EEF D;  4C56 C;  2AUJ D;  3GTJ B;  3S2H B;  2C5C A;  2NVQ B;  5J39 A;  1JC7 A;  1B53 A;  1Z6H A;  1T5X D;  4ZLT F;  4F87 A;  1EYD A;  2SNS A;  3OIP A;  1H9J A;  4XYQ A;  2PQE A;  3EQL C;  2O4X A;  1KDB A;  4Y7N B;  4M1U B;  1EEI D;  1MSG A;  1CZG A;  4DA2 A;  1O78 A;  2F0M A;  2K33 A;  1RTN A;  3K5L A;  1JOQ A;  1ML0 D;  2QF7 A;  3S16 B;  4CKB A;  5JEA G;  3QJY A;  2XN9 C;  1D5M C;  1ZEQ X;  1PLF A;  1RD9 D;  3OW7 A;  3FPU B;  3NSW A;  3L7Z C;  1GOZ A;  1F2L A;  4R8I A;  2KOL A;  1DYQ A;  3FDT A;  3KUP A;  4GZY C;  1QOH A;  4FXG C;  3MEH A;  2KCC A;  5KEE A;  1I4X A;  2WKC A;  3DXJ C;  1UUP A;  1VMP A;  1HUM A;  2L1B A;  1DOK A;  1RCV D;  3G7L A;  1CM9 A;  4K5V A;  5I9P A;  1D6E C;  3NPP A;  2F0Q A;  3K58 A;  2BA1 A;  3DHQ A;  3V05 A;  1G2S A;  4C3I G;  4XXE A;  4H0L C;  1IW7 D;  1JIC A;  3OHX C;  3V96 A;  2RQX A;  1W6J A;  1VCI A;  3H3V C;  1LO5 D;  3MXN A;  5E4X A;  2DN8 A;  4FF2 A;  1NUC A;  1STN A;  3HGB A;  3P75 A;  4YIJ A;  1D1I A;  4K6D A;  3SHL A;  1Y8P B;  1HA5 A;  1I4P A;  4OHJ A;  2WB1 B;  4ODG A;  1KDA A;  2PZW A;  2ICI A;  5JEA J;  1IW7 C;  3R2I A;  1L0Y B;  1QCB D;  1J9O A;  4Q5V A;  1ONL A;  4QUF A;  1PDQ A;  3CQZ B;  1WTV A;  3GD7 A;  2J7Z A;  1ZXT A;  4F7X A;  3SE0 A;  4N9T A;  1XWE A;  1NR4 A;  1EY5 A;  1IKL A;  2PPB C;  4CBV A;  2EZV A;  4DFA A;  2HDL A;  3HOV B;  4U68 A;  2XRS D;  4QMG A;  3DM1 A;  2MGS A;  1OXT A;  1KDC A;  4PV1 C;  2BE5 C;  2B63 B;  1HUN A;  3HOW B;  1EQV A;  1KNA A;  5ELB A;  3QOJ A;  4JBW A;  1EWC A;  1MGS A;  2TMP A;  3WOE A;  3D4D A;  2E2H B;  2A5H A;  4KTA A;  3Q24 A;  5JEA H;  3MA2 B;  4C3J B;  4KY5 A;  2L0C A;  2D5D A;  5CV6 A;  5CBA E;  3FVQ A;  5C0X I;  5C3W A;  1JOR A;  4IFD J;  1AZP A;  3A54 A;  1PRT F;  3CU7 A;  3PUV A;  3SVM A;  1S5F D;  4IUV A;  4BWG B;  1SEB D;  1AW7 A;  2PCF B;  4WFN 3;  1VF5 C;  4ZKB B;  2ZXO A;  3A8I E;  3MXG A;  1JCK B;  1STA A;  1LLR D;  2F3W A;  3AU7 A;  3VR5 A;  3VYR A;  2VXW A;  1STY A;  3T16 A;  3J80 L;  3K5N A;  2NTT A;  3T13 A;  1RDP D;  3OWE B;  1RJT A;  1NAP A;  2EYM A;  2K5W A;  1AEX A;  3K6O A;  4OIK A;  4CJ0 B;  4RCO A;  4OIJ A;  2RSO A;  2F4I A;  2KHS A;  2QEJ C;  3H94 A;  1M4V A;  4KY7 A;  2ICE C;  2X6L A;  3AB9 A;  2Z4H A;  3H91 A;  3M85 A;  4NP5 A;  4R9W A;  1BQQ T;  4X3K A;  2F3V A;  1S5B D;  1GHJ A;  2N55 A;  4RCN A;  2NN6 G;  3NK9 A;  1TWG B;  1B1Z A;  5EKL A;  4HMI A;  4A3G B;  2LFN A;  2FMC A;  2IX1 A;  5C0X G;  1F2Z A;  3T56 B;  4LMQ D;  1BXT A;  2PNR C;  1EZ8 A;  2YYZ A;  4RGN A;  3K0Y A;  2F0K A;  4DGZ A;  2YU9 B;  3PO2 B;  2Q8R E;  3MWY W;  1EY7 A;  4C3H B;  4TRD A;  4IFD H;  3NHH A;  1LTB D;  4A3F B;  2NYZ D;  1UEA B;  1CFM A;  3TP8 A;  2EE1 A;  2Y0S B;  4B9W A;  1FYC A;  2NN6 H;  3VR6 A;  1G2T A;  5CV4 A;  2WIN B;  2J0T D;  3NBH A;  4KD4 A;  2V4D A;  2AUK A;  4ZK9 B;  3A55 A;  5J1Z A;  1I4R A;  2WKD A;  1B50 A;  3A8J E;  5LL6 X;  5KRU A;  2AWN A;  2BA0 A;  4IUU A;  5D3I B;  2O2L D;  3HOU B;  1WVL A;  1Y8N B;  5I6Y A;  5J22 A;  4XQQ A;  5KYL A;  3K7A B;  2L12 A;  5IOD A;  2Q8I B;  1JB3 A;  2F0J A;  1SND A;  1LV9 A;  3J80 E;  3HG9 A;  1CQV A;  2K32 A;  5CR3 A;  1C48 A;  3ZYY X;  5KNC A;  2VUM B;  2IX3 A;  5JAV A;  2X6G A;  3X3M A;  2EY1 A;  3R2T A;  3MAQ A;  5FK9 C;  1HTL D;  1SNQ A;  2N88 A;  5A35 A;  4RH6 A;  1A3V A;  4A3J B;  1TWF B;  4BS9 A;  3MXP A;  2DNC A;  3A7A B;  4FYD A;  4EQO A;  2F0P A;  4NKL A;  4UAI A;  4X3T A;  1TII D;  3D8G A;  1KLU D;  2E2D C;  5K36 H;  3IFT A;  4MHE A;  1H9S A;  1K8O A;  5E3F A;  1B2T A;  4A3K B;  2F0I A;  2EPB A;  2MJ8 A;  1NCV A;  4TKO B;  2RDF A;  3NWT A;  2ID0 A;  2K7V A;  3PMF A;  1LAC A;  1SSO A;  1O7L A;  4LAA A;  4IAL A;  2A74 C;  2EOT A;  5C44 B;  1AP0 A;  4LK1 C;  5C4H A;  1LAB A;  1S5D D;  5ELF A;  4V19 0;  1EYC A;  4C3H G;  3H09 A;  5FO8 B;  2J4X A;  2EYO A;  2FMM A;  1E0B A;  3S1Q B;  2Z1C A;  2NBF A;  1ESR A;  5D65 A;  1JWU D;  1ZYR D;  3D6C A;  5EKK A;  5DAU A;  1AZQ A;  2BDN A;  4RHS A;  5KGU A;  1TS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...