1G2TA

Solution structure of eotaxin-3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords EOTAXIN-3
publication title NMR solution structure and backbone dynamics of the CC chemokine eotaxin-3.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g2tA00
2HDMA 2B2YC 4CJ0B 1F9SA 1SAPA 4HCSA 1EOTA 1Q3LA 3TZDA 5CBEE 4HEDA 2KEDA 2L9HA 1CM9A 1X3PA 1KNEA 2FMMA 4UAIA 1B2TA 1LV9A 1PFMA 2RA4A 5CMDA 3LWEA 1A15A 1NR4A 4ZLTF 1EL0A 2XIWA 1RTNA 2J7ZA 3DEPA 1BNZA 2MPMA 3KUPA 1U4PA 3MTSA 4OIKA 4U68A 2X6LA 1PFBA 1AZQA 1WVLA 2B2VC 1F2LA 3H91A 2M2LA 4CJ1B 1SSOA 2FJ2A 2RSOA 1J9OA 1B53A 2VXWA 4IUTA 1HHVA 4XDXA 5CBAE 1ILQA 1QNKA 2X69A 3N52A 2FHTA 2B2UA 3G7LA 2HUGA 2MJ8A 4MHEA 1WD1A 2L12A 1XX8A 4IUVA 2Q8TA 2K1BA 2KEEA 1JICA 1VMCA 4OIJA 1CA6A 1HRJA 4IUUA 4X3KA 1DONA 1DOKA 4ZK9B 2KVMA 2DY8A 3UI2A 2NYZD 3F2UA 3GV6A 3TN2A 2Q8RE 1EIHA 4RWSC 3DEOA 1KNAA 1DZ1A 1B3AA 1RTOA 3QO2A 1ILPA 1M8AA 3I91A 4IUPA 4X3TA 1X32A 5D14A 1TVXA 4X3UA 1CA5A 2K04A 3I8ZA 3IFDA 3FDTA 1PLFA 4R8IA 1HFGA 2EE1A 5EPJA 1QE6A 1PFNA 1WTVA 1WTOA 1B4OA 4RAUC 1IL8A 5EPKA 1XYIA 5CORA 1IKLA 5EKIA 1ICWA 2JP1A 1MGSA 1DOLA 5E4XA 2B2UC 4ZAIA 1J8IA 2NWGA 2EPBA 1O7YA 2HCIA 2K05A 4XT1B 1MSGA 2EOTA 4X3SA 2HCCA 1RHPA 1ESRA 1MSHA 3I3CA 1O80A 1NCVA 3P7JA 1F9RA 2MGSA 4LMQD 1U4LA 1WD0A 1C8CA 1X3QA 3MWYW 1WTQA 3R93A 1QG7A 1WTXA 2K01A 2NZ1D 2R3ZA 2RVLA 5D65A 1DOMA 4ZKBB 1HFNA 2JYOA 1AP0A 1AZPA 1EQTA 2SDFA 1GUWA 4XT3B 2HDLA 1WTRA 2IL8A 2L1BA 1NR2A 1VMPA 1F9PA 2D9UA 1JE4A 1PDQA 2X6GA 1ML0D 1O7ZA 1HUMA 2FINB 4NW2A 2K28A 2KECA 1G2SA 4MN3A 1HA6A 5T1GA 4HSVA 5EQ0A 1EIGA 2BDNA 1SDFA 1ZXTA 3I90A 4RA8A 2B2YA 3DM1A 3SVMA 3D6WA 2KUMA 2B2WC 3IL8A 2B2WA 3FPUB 5JJZA 5E4WC 1WTPA 2DY7A 2KOLA 2CVRA 4HAEA 2K03A 5T1IA 2MP1A 5COYA 3GV3A 4CJ2C 1MI2A 4IURA 3ONAB 5DNFA 1E0BA 1RODA 2B2TC 2N55A 4O42A 4R9WA 5AFWA 2B2TA 4ZKCB 1WTWA 1BBXC 1RJTA 1BO0A 5EPLA 4DN4M 2N88A 1G6ZA 1HUNA 1U4MA 3Q6SA 2B2VA 5EJWA 1G91A 1B50A 2L4NA 1IKMA 1NAPA 2RSNA 1BF4A 3HP3A 3KBXA 2H1EA 1F9QA 2FFKB 4QUCA 4QUFA 4IUQA 1G2TA 1U4RA 1S4ZA 2L11A
chains in the Genus database with same CATH superfamily
3SDZA 1QILA 5GAEC 2A6HC 5IOCA 5I6YA 1VQ5A 4ZRZA 1KAWA 1KHIA 2KQ3A 1MIUA 2QA4A 5C0XH 1PVOA 4EX5A 2DJGC 1EYGA 3MFGA 4Y52H 4WRDA 2E2IB 4FXGC 2B3GA 4YHHL 2PYKA 2F0MA 4DV4Q 3U9OA 4H02A 1DD2A 4RGTA 2XN9C 3CCMA 3NUCA 4A3IH 3SK4A 2NVXH 1TXYA 4OWWB 5CV4A 2N3SA 1SFOH 3NHHA 1CZWA 2E2JB 4WFN3 2EXDA 4I7AA 4H0LC 1BOSA 3NPPA 4KY6A 3JAMi 4DR1Q 3A7AB 1I4QA 3STBD 4A3GB 5C4JH 1K3RA 3CW2C 4R8IA 3FEWX 2UUBL 1SNMA 1XNQL 1EQRA 4A93G 4C2MB 5IODA 3M3YH 1W6JA 1SMYC 3OYYA 4X3SA 3IKJA 4P73A 4JBMA 3A55A 4HMIA 3H3VH 3WOEA 4Y7NB 2MO1A 3D3RA 5EBCA 3S2DH 3ICEA 3PO3G 3FPPA 5BR8L 3NK9A 2FMCA 4B9XA 3CCVA 4IFDH 1I6HB 1E7ZA 2PZTA 5GAHC 1PDQA 2PZWA 1O7ZA 2EY6A 4KHVA 1STHA 2B63B 1ZKOA 1HR0L 2N8NA 1MKHA 2FXQA 2F3VA 2PW7A 4POFA 5JJZA 1WTPA 2HQEA 3T53B 2KOLA 2CVRA 4LFCQ 3S15B 2VW9A 3SGIA 1KD1C 4LF4Q 4CJ2C 1HZCA 2WFWA 1E24A 3OIPA 2UUBQ 1RODA 3KFUA 4GZYC 4A3DH 1RJTA 4DN4M 4DXFA 4DAYB 1WYDA 1K73C 3T16A 2SNSA 4L8JA 3T4AC 2ES2A 1PH9A 1A3TA 4B3TL 2K32A 3BYYB 4PMWA 1SNDA 1XMQL 2KA7A 3GTGB 4K8JA 2NN6G 5BR8Q 1NMFA 2WAQB 1TWFH 1KNEA 4A3GG 4Q0FA 2PNHA 3OWEB 4LF8Q 1M4VA 2XVSA 1EL0A 1SYEA 1PA6A 4GN5A 4X64L 1DJRD 3PIOA 3ERSX 1TS3A 3EQLC 3J81E 5C44H 4DV6L 3I4MH 3E0JA 3E6ZX 4R4OA 3PCOB 4IN3A 1ASZA 1ENAA 5C3XA 4LF5L 4CDCC 2CKZB 2D0OA 4QQBX 5DM73 1EYCA 1O78A 3S1RB 4LF7L 2CHBD 3BJUA 4TQUS 3W1GA 5JOBA 3C46A 3CCLA 2C9OA 4X66L 1JOKA 2QDLA 2JA6H 3IFDA 1B9MA 2ZJRA 1VQ6A 1HFGA 4A3KB 1FJGQ 1XMQQ 1PFNA 3T56B 1GUOA 1HJPA 1IKLA 2J4XA 1MGSA 1DOLA 1HQMC 2EPBA 2A69D 3TP5A 5IP9G 1Q81C 2LMCB 4K6DA 4BY1H 4JI2L 4X64Q 4RHRA 1NMGA 2F0LA 2NN6I 3CXCA 4IOAA 3H0GH 3D6CA 1B44D 2LY7A 1LTID 4DK3C 1HUMA 4JYAQ 3NXWA 4LF5Q 2R7FA 2GN5A 2JSOA 4HSVA 1LTRD 3H3VI 3OOCA 4HSPA 5KRUA 3B6YA 4LF7Q 3SVMA 3J80L 4HCEA 3P75A 1YBYA 2RDGA 3HOYB 1BXTA 4X66Q 1SE3A 5FOBB 1QUQA 5CR3A 2EY5A 2YYZA 2E2HH 3BVZA 4P75A 3VR2A 2YU9H 4HJAA 2YTYA 3HP3A 3S17B 1Q46A 1Q8KA 4G57A 1U4RA 4JI2Q 1AEXA 4Z9CB 3JAMc 5JAVA 1Q3LA 1Y8NB 1OXUA 4HEDA 2I5HA 1PH5A 5J3BA 4UAIA 1EYAA 1M90C 1UAPA 3HOWH 4A3KG 3VYTA 3TSSA 3ZJYC 2VQFL 3LWUA 1PFSA 5ELBA 4GKJQ 3TMEA 2IY5B 3RR5A 1D5XC 5CBAE 5IY0A 2R93H 1KC8C 3N52A 4A76A 1STGA 2CWAA 3EIVA 4L63B 2VQEL 4GOPC 4DR7L 4IUVA 2K1BA 4NDXA 3V05A 3WWVA 3OHXC 1J5EQ 4EQPA 4OHJA 2K5WA 4KJNA 1TY0A 3SK8A 4RWSC 2IWHA 4BBSH 1KLGD 4C3JG 4LUOA 3NTHA 2MO0A 2CH4A 5DM63 1ENFA 4CHTB 3A5UA 3E3XA 1UWVA 3I8ZA 4O2DA 3I56A 1VQIA 4BY7H 2F0JA 5DEHA 1Y1WH 1S5ED 4OWTB 4WJWA 5LL6X 1VDZA 1EYDA 3I3CA 2F0OA 1CHQD 3QG1A 1F9RA 4JW0A 2VQFQ 4LMQD 1RF2D 2IPKD 2KCTA 3MWYW 5FLXL 1WTQA 1QG7A 3GTJH 4WORA 4M8AA 3S14H 3NE5B 2UUCL 3AFQA 4A3LG 3HOXG 2VQEQ 4DR7Q 1WCMB 3KBGA 1TWGH 2JA8H 3F2DA 5HURA 4GKKL 1N34L 3KF8A 4P2CB 3KF6B 4JI3L 4XQQA 5IIFA 1CK1A 1SRUA 1F2ZA 5FJ8G 5A2QL 2ICIA 4GOPB 1QZGA 1H9MA 1S5FD 4RKBA 3CAMA 2EVBA 3CRKC 3D31A 5M5WB 3GV3A 2IX1A 2XNAC 1E0BA 1IBKQ 1OXTA 2WACA 2HD3A 4JK1C 5HGQA 1HUNA 3Q6SA 1K8MA 3CCRA 3WDNA 3HFZB 2H1EA 5DAUA 4JI5L 4UP7A 1I50B 4RCOA 2JA5G 3NBIA 2EYOA 4YWLA 1VQJA 5C6AA 4GN4B 1TWHB 3RZOB 2UXDL 3BZCA 4KKTA 1S5DD 4YIJA 3HKZE 5GAGC 1CKNB 1PH3A 4RHSA 2UU9L 1BDOA 3CMAA 3KDFA 5C4XB 1MHWC 4JI3Q 2Z6KA 2FJ2A 4IUTA 1BKBA 3S1NH 2JXMB 4PG3A 3BZKA 1N33L 1CKOA 3VR4A 1JICA 2JJQA 1SE2A 4XIGS 2Z4IA 3DUZA 4LUZA 1SNCA 4WJ4A 5C5MA 3V2TA 1YNND 3QOJA 1SJHD 2VUMH 1L1OC 2NVTH 2ZTDA 2TSSA 1JB3A 1HR0W 3QO2A 3S1MB 2NB0A 3HS0C 1STEA 1X32A 2CQOA 2CCZA 1PMRA 2Q2UA 4HTHA 1PZID 2BE5C 3H15A 2EQSA 1YEZA 4M1UB 5EKIA 1HTLD 2UXDQ 2NWGA 3HGBA 2D0PA 1JE5A 5K36H 4XT1B 2EOTA 1PYSB 1KABA 1D1KA 4OONA 2UU9Q 2GVBA 1NCVA 1HZBA 1LT3D 3FKIH 4DR4L 2DUDA 5C4HA 4N8X1 1TWCH 5KNDA 4BXXG 2ZXRA 2HDLA 1N33Q 3PUVA 1IHZA 3HOUB 1VQPA 3HOZB 1TY2A 1HA6A 3ND9A 3R8BA 2WB1E 4WJ3M 2R92H 3W2DA 1IL2A 4XYOA 1Y69U 5IWAL 3K0YA 1ENCA 4KTAA 3A74A 5I2XA 1CSPA 3DWPA 2N55A 3T1HQ 2AKWB 2R6GA 5IP7H 3HOVG 2VB2X 4K5VA 1E2ZA 4RMFA 1VQ7A 1IKMA 3LNNA 1E2VA 1JOOA 3A8KE 1DGSA 4IUQA 2L11A 4X6AH 4DUYL 5FLMG 4DR4Q 2PMZE 4UP9A 3K5OA 3GTQB 2F0NA 3EN2A 1EZ8A 1XPUA 2FMMA 3H94A 1LV9A 1X9NA 3LWEA 4ZYSA 1NR4A 4K2LA 1K83H 3DEPA 2M00A 2A6ED 2HHHQ 2V4DA 3EFXD 3L3OC 4CJ1B 2IHEA 1YJ9A 1ILQA 1JJ2A 1X56A 5IWAQ 5IGEA 2B2UA 4A3MB 3P1HA 2JA7H 1A8VA 1QVCA 3PUXA 2KEEA 3CD6A 2LXKA 1VCIA 4IUUA 3BDLA 4DU9A 1GHKA 2PQAA 3VYRA 1I4GA 4Q5VA 5IYDH 4OX9L 2NVQB 4BA2I 3CQZB 1ILPA 4XQNA 1Q1BA 1GUTA 4HIOA 5FO7B 2EE1A 1Q8IA 1L0XB 1JWMD 4FXKC 3LGJA 1PH7A 1JWSD 4C3HH 4A3JG 5I4DA 1R9TH 1AE2A 5C3EG 2Z8LA 2K5DA 1S72A 1H9KA 3M4OB 4QJFA 1Z9FA 2ASBA 1LUZA 4DF7A 1PRTC 2JYOA 4J1MA 3PMFA 2IL8A 2L1BA 3BG3A 4GNXA 1NBWA 2RHQB 2JE6I 2KECA 3EVQA 4C3IH 3A8JE 3QR8A 1TQOA 4HJ8A 2B2YA 3DM1A 1HNXL 2F0KA 1LT5D 3S16B 3DHQA 2BDOA 1VQOA 2ICEC 2OT2A 2PW5A 4MIUA 1ZEQX 4A3EH 4RH6A 2EY1A 4FNFA 3ULPA 2E2DC 2F1MA 4DV3L 3IRBA 4KKSA 2I46A 4UPAA 5M5YH 4NB3A 4A3MG 1EOVA 3GTOB 2NTSA 3U50C 5JJLA 4F8MA 4DAVA 1TIID 4F88A 2F0PA 4CJ0B 4OXPA 3RZDH 1TS4A 2E5LQ 3Q22A 4A3BB 4G7OC 2A5HA 3F2BA 1XWEA 2OXPA 5CV6A 3CPFA 3QIAA 4BBRG 3O13A 3G48A 3VYUA 1Q7YC 4LW1A 3GO5A 1GOZA 1V8QA 3MEFA 1CUKA 1A2UA 1LTAD 2EYMA 2Y0SE 1TKWB 2D62A 4R4QA 1PRTB 4DUZQ 4RGMA 3PQIA 2BA1A 3PO3B 1NTGA 1KAAA 1SROA 3I2ZA 4IOCA 1CKMA 1BBUA 1XTDA 2NUCA 1G291 3GTLB 3GD7A 4ZK9B 1SXTA 1MBYA 1RCVD 3A8IE 5G3LD 3MXNB 1XTCD 2UXBL 4DK1A 1KDBA 2QDBA 1QUQB 3GTMH 4NPSA 1Y1VG 3F2CA 3T13A 2O4XA 1ZYRC 1SEBD 1R4PB 2F0GA 1HXYD 3I4OA 1S5CD 5K5PA 2K05A 1K0SA 2ID0A 4A3IB 1MSHA 1C9OA 3GDEA 4JBKA 4RKLA 5ELDA 3MHBA 4CDFC 1STAA 1C0AA 5KNBA 4G7HC 3PIPA 1WTXA 4GN3B 2RVLA 3OIQA 1IYVA 4J15A 2PZUA 5M5XB 1ONLA 1NR2A 2E2IH 3K0XA 3M9BA 2FINB 2K28A 4A3BG 1YNJC 3I73A 1DM0B 2K75A 4AYBE 2UXBQ 3M7NA 3M85A 2IT1A 4MTNA 5IYCG 2CFMA 4KK7A 2E2JH 3DWQA 1H95A 1K3BC 1A2TA 1W3SA 5IGFA 1QVGA 1JC7A 1J6QA 4FF3A 3I4NB 2OWOA 2KENA 5D3DA 4YHHQ 3J81L 2N78A 4A3GH 1G6ZA 1BCPD 1XJVA 5I2YA 2L4NA 1GVPA 4O0AA 4C2MH 4HJ9A 3M7GA 1D5MC 2XRSD 1PHJA 1A3UA 1FYCA 2ALYB 3ND8A 2ENBA 3CC4A 2KHJA 5CBEE 5C0XG 3MA2B 3NQIA 4Y7NH 4R4CA 1V1PA 1SNOA 1X3PA 1Z47A 3GTPB 3NQTA 5IGDA 1XNQQ 1AFPA 3MTSA 4U68A 1PFBA 2ZJPA 2Z6KC 1B53A 4A3IG 4CDDC 2F0EA 3UE0A 1KLUD 2FHTA 2B63H 2O5IC 4LUVA 3KF8B 2F0WA 1CFMA 5C0XJ 4IPHA 3S15H 3K59A 2LSSA 5GADC 5GQOA 3OWFA 1TWFB 5IP9H 4XYQA 5GROA 3ITPA 4X3TA 3QOLA 4MZ9A 3A7LA 4X3UA 4DV0L 3K7AB 5IGCA 1HR0Q 5EPJA 1BUVT 5LMNL 1DCZA 5C44B 1WTOA 3U9SA 3RN2A 1G51A 3AEVA 2I07B 4ULLA 3GTGH 2DN8A 3TBIB 5EAYA 3SHLA 3I4NG 5C0XI 4IFDG 1QNUA 4HJ5A 4N9TA 5EKLA 2SDFA 4EQNA 2CW0C 3I4LA 3KDFB 4B3TQ 2X6GA 1ML0D 3PV0A 4NW2A 5ELCA 1YHQA 1PH1A 4G4KA 1PTOC 2RHSB 5EQ0A 1EIGA 1SDFA 4P74A 1PTOF 2B29A 3TP6A 1Q12A 1PV4A 2F0FA 2F0QA 3OW2A 1SLJA 2LFNA 5IT9c 3KJOA 1BBWA 3S1RH 4BY1B 4IFDJ 1ASYA 2B8GA 1RIPA 1QWYA 4IURA 3PIP3 2WINB 1S5BD 2ZTEA 4R9WA 4IZ8A 4KY5A 1BBXC 4DV6Q 2E75C 2BH2A 2N88A 1N32L 5CC4A 3EA6A 1GO3E 2Z6BA 4UHVA 2AMCB 4C3JB 3W3AA 2YV5A 3QWNA 4GLVB 1CZGA 1KXLA 2AWOA 1K8GA 1OXSC 3MXNA 3TS2A 1PFMA 5CMDA 2NZOA 4IFDI 4K14A 5IE8A 4HN7A 5C44G 3I4MG 3F1ZA 4OIKA 2YU9B 1WVLA 1T9HA 3P20A 3BVGA 3X3MA 1EUJA 2TMPA 3S1QH 2NZHA 1HTPA 3IAYA 1KQSA 2OF1A 3HOXB 4FYDA 1MJCA 3OPOA 1PTOB 1VQ4A 1HCZA 3HOYH 3RN5A 4B3RL 5JEAH 3R2IA 2WB1B 1V9PA 2H5XA 2JA6G 3NEMA 3HOWB 2AQ1B 2LXJA 4OO1H 1MD2D 4OELB 3HKZG 4DGZA 3Q23A 3QJYA 5I9PA 1EQVA 3FDTA 4CBVA 3KK7A 1YIJA 1YI2A 4NXNL 1QVFA 1QCBD 4BY1G 1D2BA 4DFAA 2K7VA 1QOHA 3NBHA 4BWGB 1JCKB 2A6HD 3H0GG 4FDBA 1DXMA 2BOSA 2JA5B 5FO8B 1X3QA 5L37A 2AWNA 2R3ZA 3NENA 3DM3A 2NTTA 4JI4L 1GKHA 4A75A 4GLAC 1VQ9A 4KHPL 4GNXC 2A73B 5KEEA 5A35A 3VA7A 3PIO3 3Q0AA 1WI5A 4G7ZC 1LTGD 5H1SE 4BY7B 3K80C 2ZXOA 4B3RQ 4JOIA 2AUJD 1GJXA 3D0FA 2XRQD 1JR0D 4R4IA 3J7AV 1IW7C 1I4RA 4NXML 1SNPA 2EY2A 4C1NI 2E76C 1JOQA 3ONAB 2PQAB 3L7ZC 2L15A 1UE6A 1WTWA 3RD4A 3K6OA 4NXNQ 3CC2A 1YHAA 3ULJA 1NY4A 1JB7A 3L2PA 1BF4A 1VQEA 1SMYD 2HDMA 3KJPA 5J39A 1K8AC 2MUYA 2WB1G 1VS0A 1EOTA 4ME3A 3HOWG 1MJEA 2JEAI 1EQQA 1QZHA 3C2PA 1B2TA 4KHPQ 2RA4A 2XGTA 2C35B 3T1YL 2K52A 2RDHA 3VA5A 5CV9A 4P71A 5M3MB 1BNZA 2EZVA 4AIMA 1WCMH 2B2VC 5ELOA 1UE1A 3KYHC 4KN7C 1R4QB 3D4DA 1YITA 3U4ZA 3KOJA 5JEAJ 4GNXB 4PNYA 2VY3A 2KHSA 3CCQA 1GUSA 2QKIC 1VQBA 5M3FB 1EIFA 4QGUA 5J1ZA 1Y14B 4OIJA 1EEFD 4BBSG 3K81C 1DOKA 2F3WA 3C1EA 2DY8A 5M5WH 3J7AF 2UUCQ 3S2HB 3DEOA 4IALA 5LMUL 1KL9A 2IJ0A 1STNA 1M8AA 4HMJA 4GKKQ 3RLFA 4JI8L 1X65A 1N34Q 4BY7G 3I7FA 3TP7A 1Y1WG 1HZAA 3HOVB 4V0BA 5IYBG 3ERQA 1SYFA 3A54A 3PO2H 5LHY1 1HNZL 1UE5A 2ZTCA 1RHPA 1ESRA 1TWHH 2F0SA 3T1YQ 1EY0A 4IUNA 3VR6A 3RZOH 2L5TA 3SEBA 3E5SA 4LF9L 3OTOL 4X62L 3A56A 1N36L 2R7ZH 3CP0A 1CHPD 5C4XH 4JI5Q 1VQ8A 4ME5A 4R8NA 4DXGA 4DV2L 1TWAB 4RG1A 2K5NA 5KIXA 2MNAA 1D1IA 1TT2A 5E1FA 2OTJA 1JWUD 4HJ7A 1D6EC 2Y0SB 2UXCL 2L55A 3FPUB 1V43A 3F8TA 5LMUQ 1K8OA 1LT4D 4JI8Q 5M3MG 4A3FH 3S1MH 2QCPX 1KTKA 3MEHA 1TWCB 3HG9A 3J7YW 1E1TA 1CQFA 3G4SA 3STBC 4H44C 5M3FG 1PZKD 2D5DA 1HNZQ 3URYA 4KD3A 2EYJA 3K5NA 2Q2IA 2R92B 4LF9Q 3OTOQ 3J80i 4X62Q 4JCVE 4HCSA 1N36Q 1VQAA 5LMNW 1VQNA 2RKSA 3AB9A 4A3JB 4DR6L 2AQ3B 1I4PA 1LYLA 1ICFB 5C3EB 3D4WA 4C1NK 1E22A 2Z0SA 2J7ZA 4DV2Q 1N8RC 1NSNS 1VQGA 3JAML 1C4QA 1B70B 3RUZA 2KJXA 5CV7A 2O5JC 3M4PA 3ER0A 3HOUH 2M2LA 3HOZH 1J9OA 2Q2HA 2UXCQ 5JVG3 1BCPF 3M4YA 3BZDB 1BR9A 1II3A 1EU3A 4MHEA 5IT9E 1IYJB 3NTIA 1CA6A 3UDGA 2G9DA 5AJ3L 1I4HA 5C4ZA 1I3QB 1C48A 1STBA 2Q8RE 3UE1A 1KRTA 4AYBB 1K83B 2QEJC 3OMCA 4B3ML 4FO2A 4CGYB 2K04A 4YY3L 1GXDC 1F2YA 2Y0SG 5K36G 1V1QA 1D8LA 1B4OA 1IL8A 1O7LA 5CV5A 2RCNA 3FKIG 2B39A 4DR6Q 4LFAL 2D2CC 3MVVA 3GTQH 4B3SL 1EY5A 1U5KA 3K8AA 2MGSA 2RCFA 1JQYD 3V96A 1V1PB 2K01A 2WP8J 1DOMA 1RD9D 2CH4W 4BBRB 3TZUA 1VMPA 2D9UA 2R92G 3BYTB 3NWSA 4DUYQ 4K2KA 5T1GA 1BCPB 5AJ3Q 3I90A 3PF4A 5CV8A 1EWCA 3PUZA 3CCEA 4KV6A 5IP7G 2MP1A 2F4IA 2NVQH 2E8GA 1ET6A 4YY3Q 4DV7L 3CQZH 1EU4A 2B2TA 3L0OA 1B50A 3GTKB 1LLRD 3OW7A 4X65L 2PCFB 5I6WA 1YNXA 3KBXA 4QUFA 4BS9A 2I0QA 3MXPA 1EY6A 4B3SQ 1S4ZA 1Y1VB 4IJLA 3BDCA 1F77A 4JVZA 3R3OA 2NVYB 1IW7D 3AFPA 4MNOA 4OX9Q 2A69C 3M4OH 4AYBG 2RF4A 1A15A 4JI1L 3TEHB 3E0EA 3FRPB 3G6JB 5KYLA 1YJWA 4QCLA 2Z1CA 4DAPA 3H6MA 1LTLA 2K33A 2ATWA 3H91A 2CWPA 1Z6HA 3SK6A 2JA7G 1KDAA 3D4RA 2I5LX 4O1NA 1H9RA 1WD1A 2L12A 3TQYA 1EY7A 4JI0L 1XX8A 4DV1L 3S16H 5IYDG 3CC7A 3L9AX 1Z7TA 4FXDA 1DONA 3CU7A 2SNMA 4R4TA 3F2UA 3A0JA 5J22A 4B9WA 1KNAA 4X65Q 1RTOA 2YTXA 3CCUA 1B7YB 2QW7A 3GTOH 1Y8OB 1HNXQ 4C3HG 4QL5A 1A6XA 4ZAIA 4PZ8A 1CT1D 1O7YA 1LT6D 4PZ6A 4CKBA 3K5MA 4HIMA 3N6RA 3H3VC 2PQEA 4A3BH 4A93H 4DV3Q 1T5EA 1TS5A 2K5QA 4CKCA 3VYSA 5ELNA 2K4KA 1A63A 1SN8A 5IYCH 3HEJA 1LTBD 3AQQA 2KCCA 1AZPA 1EQTA 4C3IG 3J80c 1A0IA 4GLXA 5JJIA 5BN3A 4QIWE 3BVMA 4JI0Q 3PO3H 4DV1Q 1UNSA 2R61A 4AH6A 3EBEA 1D5ZC 1G2SA 2EJMA 4BA1I 1JMCA 1OXVA 1YJNA 1L0WA 3S24A 4JOIC 1U0LA 1XXGA 4A3EG 2B2WA 1X3GA 3GTLH 2PPBC 2NVXB 1GUNA 3D8GA 3GP7A 1GM5A 1SFOB 2O2LD 4H13C 1VQHA 2G9HD 4JBJA 4ID6A 4A3CG 2BE5D 1W6KA 1NAPA 5C4JB 1RDPD 4JI7L 2ZJQA 3UDFA 1F9QA 1G8ZD 1OXXK 4FF2A 1N9WA 3FVQA 1JJCB 3M3YB 1SAPA 1PYWD 1SYCA 1VQCA 3MZ5A 3NBHB 4K6LA 1XPRA 1CSQA 3SE0A 1PZJD 2DNEA 1YZ6A 1L1OA 4IPGA 4LFCL 4R1JA 2NN6H 3S2DB 3DXJC 3C1FA 5M5XH 2MPMA 4LF4L 1U4PA 1X55A 1HH2P 3PF5A 2N49A 4XDXA 2MJ8A 4KLKA 3RLNA 1QJOA 4KD4A 4EQ5A 3H09A 3MXGA 1SYGA 4DR2L 1L0YB 2MFIA 5JVH3 1A62A 3I4NH 4JI7Q 2VNUD 2F3IA 1TR5A 4KHZA 2EXZA 3I91A 4IUPA 4A3DB 1I6HH 4LF8L 4L5QA 4DAMA 2OQKA 1STYA 1QE6A 4LK1C 5FLXc 2JP1A 3I70A 5E4XA 5E7NA 4A4IA 2RQXA 4IO9A 4DR3L 2HCCA 2BH8A 1AN8A 3SK5A 2A19A 4PMBA 3K58A 3P7JA 3GTPH 2OQ0A 1U4LA 1WD0A 2F03A 4QY7A 4FP5D 4YCUA 1WOCA 5D65A 1HFNA 1AP0A 1WFQA 3A5ZB 1X54A 3KLWA 1WTRA 3BDOA 3E9IA 4UP8A 1T5XD 2Q2TA 4QMGA 3TREA 3I4MB 1C7YA 2HQLA 5IGBA 1FJGL 4DR2Q 1VQKA 1JT8A 3R2TA 4K5WA 4HAEA 4ZQ3A 2F0VA 3GQBA 2P5ZX 1SJED 3TS0A 1YNNC 1NUCA 1CQVA 4EVOA 4HIDA 1CTMA 3K7AH 2A8VA 3HZXA 4F87A 1G91A 2JA6B 2RSNA 2XWJB 4DR3Q 4RGNA 3SR1A 4ZCKA 3HKZB 2E74C 1GUGA 2R7DA 4JYAL 4XXEA 1B3QA 1EFWA 4IQZA 4KY7A 1E2WA 5C3WA 2J0TD 3TZDA 4DNRB 2QILA 5CGKA 2KEDA 1M1KC 4HR7B 4A3DG 1CM9A 4DV0Q 5EBDA 1PRTD 2UUAL 4LF6L 4GS3A 4C56C 2VL6A 3H0GB 2XIWA 5LMNQ 4ZUIA 3KUPA 2X6LA 3W1BA 2B63G 1F2LA 4NMZA 2GA4B 4A3KH 3TDQA 1X6OA 1SSOA 2WKDA 4DNIA 1HHVA 2OCEA 1EWIA 1UUPA 4JI6L 3BS1A 2X69A 3G7LA 2QGQA 1PYBA 4LFBL 4S3SA 2PNRC 1Q82C 2Q8TA 4E6IA 2L0CA 3Q8DA 4ODGA 2ZT9C 1UEBA 1EWHA 3EJIA 4U673 3J7A5 4DPGA 4K0KL 2KCMA 3RMHA 5IGGA 5TSSA 4DK6C 1B3AA 3UDXA 2JA9A 3NP8A 2EYLA 2E2HB 1VQMA 3E9HA 1EY9A 2ZXPA 5EGTA 3S1QB 1FNUA 1I6VC 2K50A 4YWMA 4C3JH 4APVA 1XYIA 5EPKA 1LTTD 1XNRL 1AH9A 1FR3A 1ICWA 5JJKA 4GKJL 1EFID 2B2UC 2WAQG 1J8IA 1W2BA 2F0HA 2OTLA 1MSGA 1SMXA 3I72A 2UUAQ 2OEOA 4LF6Q 4JC0A 5KGUA 4JV5L 5JPNC 1B8AA 4EGVA 1I94L 1J5EL 1N32Q 4ZKBB 4JI6Q 1GUWA 3DWAA 3NTKA 2SEBD 1HPCA 1NNXA 3I55A 4LFBQ 1XPOA 2PI2E 3S17H 2A6EC 1V1OA 1SNQA 3JC66 2YTVA 4A3LH 4HIKA 3HOXH 2R93B 2K5HA 2A68C 1B9NA 5ISRA 2PI2A 4RGOS 1PTOH 4K0KQ 3HRZC 5I9OA 3MC0B 1IYUA 1H9SB 1PH4A 1EY8A 2XTIA 1KRSA 4YWKA 1LABA 5FJ8H 3MFYA 3KLSA 4ZKCB 2B2TC 4O42A 4BBSB 1FD7D 2A74C 1S40A 1FGUA 4UY8C 1XNRQ 4N8FA 1U4MA 2PMZB 1ZYRD 3UDIA 2VZAA 1NE3A 2FFKB 4RCNA 1JORA 1I4XA 5LL6S 4V190 4JV5Q 2B2YC 1F9SA 1I94Q 3T51B 1Y1WB 2BA0A 1IBLL 4QB4A 2RDFA 1PH8A 5HGTA 2JA5H 2L9HA 2C5CA 4FF4A 1K9MC 1VF5C 5JPMC 3J80E 4JBWA 4LAAA 1SYBA 1AW7A 3J81i 3GTJB 3TRZA 3S14B 2BCOA 1FGBD 5FKAC 1IBKL 1OO9B 1YNJD 1TWGB 5KYIA 2JA8B 1PH6A 1QNKA 1LM0A 4OWXB 3HOYG 2HUGA 1WTHA 3NSWA 4DK0A 5JEAG 2HIVA 3QB3A 5IYBH 1B1ZA 4OO1G 3UI2A 1LACA 2NYZD 4JI4Q 3GV6A 1TU2B 2VB3X 5M9OA 1DZ1A 2DJFC 4B08A 4DAYA 4MTKA 3PSIA 1EIYB 1TVXA 4LNQA 3KLSX 2R93G 1Y8PB 4ALPA 1RKNA 3G6EA 1WTVA 1IBLQ 2WAQE 5D3IB 3FMCA 2Z9HA 1KDCA 4ZUJA 1IBML 2IW3A 4NXMQ 2Q8IB 2K6AA 1Q1EA 2QF7A 1PXUA 3X3NA 2XSCA 4K5XA 5CYUA 3J7ZC 2EIFA 4DKAC 3R93A 1OTCA 5M3MH 4L5SA 1GD7A 4IPCA 1E1OA 1F9PA 5FK9C 1JE4A 3CPWA 4BXXH 1E3PA 2EYHA 1X3FA 1I5FA 3S1NB 2BDNA 4RA8A 4CKEA 1I50H 3ULLA 5M3FH 3PO2B 3D6WA 2B2WC 3IL8A 1LTSD 1NJIC 1DYQA 2DY7A 4IPDA 1UEAB 1O7IA 4YCWA 4OO1I 3S2HH 2MQHA 1MI2A 2R7ZB 5BN5A 4L5TA 2VUMB 2NVTB 4RFBA 1BO0A 2JA8G 5G3LF 5FLXE 4DR5L 1VQDA 5EJWA 4DV5L 4QF4A 1ESFA 2K5VA 4J6HA 1IBMQ 2EJFC 2F0DA 5IT9L 3HOVH 2IX3A 2V1CC 1CA5A 3C3LA 1FNVA 5ELEA 1HZ9A 2NBFA 2IHFA 1FL0A 5A2QE 4A3FB 5FLMH 1WCMG 4XTCS 3FKIB 2CW0D 1P16A 3OSOA 2Z4HA 2A1AA 4DNTB 4LWCA 4AQYL 3RLOA 1AZQA 3T1HL 1SBBB 1PTOD 4TVAB 4POGA 1TWAH 1KIXA 1VF7A 2KBNA 1JJGA 3VR3A 2F0IA 4QIWB 1QB5D 4L5RC 5EKKA 4DR5Q 1VQFA 4KJOA 3TN2A 1EIHA 4DV5Q 1AE3A 2RBMA 1LO5D 3DLLA 4J8QA 5D14A 1SYDA 4FF1A 3PO2G 2B8FA 4OGQC 1BCPC 1Q86C 3J81j 1HA5A 3IFTA 5CORA 5F2DA 2ZM6L 2HHHL 4ILWA 2EJGC 5E3FA 4ABNA 2WV6D 1H9SA 3ZYYX 2R7ZG 1WJJA 2VS1A 2VUMG 5C4XG 4AQYQ 4A3JH 5C3EH 4H7BA 3NELA 4JPBW 2LKVA 3RNUA 1L1OB 3AYHB 3K5LA 3U58A 3AMUA 2XWBB 3BU2A 2HT1A 1PH2A 5NUCA 3MXUA 1YVCA 4K8IA 3J81c 1HQRD 2LS01 2JA7B 2KUMA 4A3FG 4DA2A 3M4QA 4L6TB 1K0RA 1XMOL 1I3QH 2K03A 2SOBA 5T1IA 5COYA 4NP5A 5DNFA 3CRLC 1ET9A 2AUKA 4KKUA 5EPLA 2ZM6Q 4JG2A 1H9JA 1A3VA 1HNWL 4TSSA 4TRDA 2A68D 3SXHA 3NWTA 3PUWA 2JEBI 2HIXA 2WKCA 4UDUC 4A3MH 2JK8A 2EYFA 1BQQT 4PZ7A 2WIIB 3AU7A 3K7UC 2JN4A 3LX0A 2EYPA 3PGZA 4I7ZC 3CCSA 4C3HB 1BVSA 5BN4A 1R9TB 4TKOB 4PV1C 3CCJA 1X3EA 3G71A 1VQLA 5ELFA 4B3MQ 5KNCA 4F7XA 1EY4A 3HOUG 4ZLTF 2F4VL 1FNWA 3HOZG 1RTNA 4BBRH 3EROA 2IX0A 1IXRA 5HY6A 3WOFA 2QEXA 3W5OA 3JAME 2RSOA 4OEMB 2M9VA 2VXWA 3KF6A 3Q24A 5FO9B 4C3IB 4OL7A 1EZ6A 4LFAQ 1G6PA 1XMOQ 2H4OA 3DMUA 4GOPA 2I5MX 4P72A 1VMCA 4IJHA 1HRJA 1GHJA 2G5DA 4X3KA 2KVMA 1K28A 2E5LL 3HKSA 4PQXA 4KI0A 1Q90A 4A3EB 3CKIB 2JQOA 1HNWQ 2F0UA 1EEID 3PUYA 1P8LA 4LJZC 4NKLA 1PRTF 1S3OA 3S9WA 3GTKH 5M5YB 1L2FA 1PLFA 1SR3A 1UE7A 4PMCA 4RAUC 2F52A 4EQOA 4N9PA 1Y1VH 2GVAA 4DUZL 2HCIA 3K57A 2NVYH 4KN4C 4FVMA 2KHIA 2KCNA 1U9RA 3RZDB 4DV7Q 2F4VQ 1O80A 3CHBD 1CKNA 4XQJA 3TP8A 1C8CA 3KLRA 1RL2A 4CDEC 2NZ1D 1F2MA 4XT3B 1TS2A 2EDGA 3MAQA 4A3CH 2AQ2B 4MN3A 1ZXTA 2CQAA 3U4VA 3VR5A 2AHOB 5DLQE 4A93B 2F0TA 1SE4A 3VDYA 3OMGA 4DV4L 1CI3M 2MHVA 4YCVA 5E4WC 4JI1Q 1SE8A 2DGYA 2PO4A 3FP9A 5AFWA 1D7QA 4KMUC 3GTMB 4I65A 3CMEA 2B2VA 1FVIA 2DNCA 3FHWA 4QUCA 5C5LA 3CF5A 1YHBA 2K14A 4DR1L 1IZ6A 1G2TA
chains in the Genus database with same CATH topology
3SDZA 1QILA 2A6HC 5IOCA 5I6YA 4ZRZA 2KQ3A 5C0XH 3MFGA 4WRDA 2E2IB 4FXGC 2PYKA 2F0MA 3U9OA 1DD2A 4RGTA 2XN9C 3NUCA 3SK4A 5CV4A 3NHHA 1CZWA 2E2JB 4WFN3 4H0LC 1BOSA 3NPPA 4KY6A 3A7AB 1I4QA 4A3GB 4R8IA 3FEWX 1SNMA 4C2MB 5IODA 1W6JA 1SMYC 4X3SA 3IKJA 3A55A 4HMIA 3WOEA 4Y7NB 3D3RA 5EBCA 3FPPA 3NK9A 2FMCA 4B9XA 4IFDH 1I6HB 2PZTA 1PDQA 2PZWA 1O7ZA 2EY6A 4KHVA 1STHA 2B63B 1ZKOA 2F3VA 2PW7A 5JJZA 1WTPA 2HQEA 3T53B 2KOLA 2CVRA 3S15B 4CJ2C 3OIPA 1RODA 4GZYC 1RJTA 4DN4M 4DXFA 3T16A 2SNSA 4L8JA 3T4AC 1A3TA 2K32A 3BYYB 4PMWA 1SNDA 2KA7A 3GTGB 4K8JA 2NN6G 2WAQB 1KNEA 4Q0FA 3OWEB 1M4VA 2XVSA 1EL0A 1SYEA 1DJRD 1TS3A 3EQLC 3J81E 3E0JA 3E6ZX 4IN3A 1ENAA 5C3XA 5DM73 1EYCA 1O78A 3S1RB 2CHBD 4TQUS 5JOBA 3C46A 2C9OA 1JOKA 3IFDA 1B9MA 1HFGA 4A3KB 1PFNA 3T56B 1GUOA 1IKLA 2J4XA 1MGSA 1DOLA 1HQMC 2EPBA 2A69D 3TP5A 2LMCB 4K6DA 4RHRA 2F0LA 2NN6I 3D6CA 1B44D 2LY7A 1LTID 1HUMA 3NXWA 2JSOA 4HSVA 1LTRD 3OOCA 4HSPA 5KRUA 3SVMA 3J80L 4HCEA 3P75A 2RDGA 3HOYB 1BXTA 1SE3A 5FOBB 5CR3A 2EY5A 2YYZA 3BVZA 3VR2A 3S17B 3HP3A 4G57A 1U4RA 1AEXA 4Z9CB 5JAVA 1Q3LA 1Y8NB 1OXUA 4HEDA 4UAIA 1EYAA 1UAPA 3VYTA 3TSSA 3LWUA 5ELBA 3TMEA 1D5XC 5CBAE 3N52A 1STGA 4L63B 4IUVA 2K1BA 4NDXA 3V05A 3OHXC 4EQPA 4OHJA 2K5WA 4KJNA 1TY0A 3SK8A 4RWSC 2IWHA 1KLGD 4C3JG 3NTHA 5DM63 1ENFA 4CHTB 3I8ZA 2F0JA 5DEHA 1S5ED 4WJWA 5LL6X 1VDZA 1EYDA 3I3CA 2F0OA 1CHQD 3QG1A 1F9RA 4LMQD 1RF2D 2IPKD 3MWYW 1WTQA 5FLXL 1QG7A 4WORA 4M8AA 3NE5B 1WCMB 3KBGA 5HURA 3KF8A 4P2CB 4XQQA 5IIFA 1CK1A 1F2ZA 5A2QL 2ICIA 1H9MA 1S5FD 4RKBA 2EVBA 3CRKC 3D31A 5M5WB 3GV3A 2IX1A 2XNAC 1E0BA 1OXTA 2WACA 4JK1C 1HUNA 3Q6SA 1K8MA 3WDNA 2H1EA 5DAUA 1I50B 4RCOA 3NBIA 2EYOA 5C6AA 1TWHB 3RZOB 4KKTA 1S5DD 4YIJA 4RHSA 1BDOA 5C4XB 2FJ2A 4IUTA 2JXMB 3VR4A 1JICA 1SE2A 4XIGS 2Z4IA 3DUZA 1SNCA 5C5MA 3V2TA 1YNND 3QOJA 1SJHD 2TSSA 1JB3A 3QO2A 3S1MB 2NB0A 3HS0C 1STEA 1X32A 1PMRA 4HTHA 1PZID 2BE5C 4M1UB 5EKIA 1HTLD 2NWGA 3HGBA 5K36H 4XT1B 2EOTA 1KABA 1D1KA 1NCVA 1LT3D 5C4HA 5KNDA 2ZXRA 2HDLA 3PUVA 1IHZA 3HOUB 3HOZB 1TY2A 1HA6A 3ND9A 3R8BA 3W2DA 4XYOA 1Y69U 3K0YA 1ENCA 4KTAA 5I2XA 3DWPA 2N55A 2R6GA 2VB2X 4K5VA 1E2ZA 1IKMA 3LNNA 1E2VA 1JOOA 3A8KE 4IUQA 2L11A 3K5OA 3GTQB 2F0NA 1EZ8A 2FMMA 3H94A 1LV9A 3LWEA 4ZYSA 1NR4A 4K2LA 3DEPA 2M00A 2A6ED 2V4DA 3EFXD 3L3OC 4CJ1B 1ILQA 5IGEA 2B2UA 4A3MB 3P1HA 3PUXA 2KEEA 1VCIA 4IUUA 3BDLA 4DU9A 1GHKA 3VYRA 1I4GA 4Q5VA 2NVQB 4BA2I 3CQZB 1ILPA 4XQNA 1Q1BA 1GUTA 5FO7B 2EE1A 1Q8IA 1L0XB 1JWMD 4FXKC 1JWSD 5I4DA 2Z8LA 2K5DA 1H9KA 3M4OB 4DF7A 1PRTC 2JYOA 4J1MA 3PMFA 2IL8A 2L1BA 3BG3A 2JE6I 2KECA 3EVQA 3A8JE 1TQOA 2B2YA 3DM1A 2F0KA 1LT5D 3S16B 3DHQA 2BDOA 2ICEC 2OT2A 2PW5A 4MIUA 1ZEQX 4RH6A 2EY1A 4FNFA 2E2DC 2F1MA 4KKSA 2I46A 3GTOB 2NTSA 4F8MA 4DAVA 1TIID 4F88A 2F0PA 4CJ0B 1TS4A 3Q22A 4A3BB 4G7OC 2A5HA 1XWEA 2OXPA 5CV6A 3QIAA 3O13A 3VYUA 3GO5A 1GOZA 1V8QA 1A2UA 1LTAD 2EYMA 1TKWB 2D62A 1PRTB 4RGMA 2BA1A 3PO3B 1KAAA 2NUCA 1G291 3GTLB 3GD7A 4ZK9B 1SXTA 1MBYA 1RCVD 3A8IE 5G3LD 1XTCD 4DK1A 1KDBA 2QDBA 3T13A 2O4XA 1ZYRC 1SEBD 1R4PB 2F0GA 1HXYD 1S5CD 5K5PA 2K05A 2ID0A 4A3IB 1MSHA 4RKLA 5ELDA 3MHBA 1STAA 5KNBA 4G7HC 1WTXA 2RVLA 3OIQA 1IYVA 5M5XB 2PZUA 1ONLA 1NR2A 2FINB 2K28A 1YNJC 3I73A 1DM0B 3M7NA 3M85A 2IT1A 4KK7A 3DWQA 1A2TA 5IGFA 4FF3A 1JC7A 3I4NB 5D3DA 3J81L 1G6ZA 1BCPD 5I2YA 2L4NA 3M7GA 1D5MC 2XRSD 1A3UA 1FYCA 3ND8A 2ENBA 5CBEE 5C0XG 3MA2B 3NQIA 1V1PA 1SNOA 1X3PA 1Z47A 3GTPB 3NQTA 5IGDA 1AFPA 3MTSA 4U68A 1PFBA 1B53A 2F0EA 1KLUD 2FHTA 2O5IC 2F0WA 1CFMA 5C0XJ 3K59A 3OWFA 1TWFB 4XYQA 3ITPA 4X3TA 3QOLA 3A7LA 4X3UA 3K7AB 5IGCA 5EPJA 1BUVT 1DCZA 5C44B 1WTOA 3U9SA 2I07B 4ULLA 2DN8A 3TBIB 3SHLA 5C0XI 4IFDG 1QNUA 4N9TA 5EKLA 2SDFA 4EQNA 2CW0C 3I4LA 2X6GA 1ML0D 3PV0A 4NW2A 5ELCA 4G4KA 1PTOC 5EQ0A 1EIGA 1SDFA 1PTOF 3TP6A 1Q12A 2F0FA 2F0QA 2LFNA 4BY1B 4IFDJ 2B8GA 1QWYA 4IURA 3PIP3 2WINB 1S5BD 4R9WA 4IZ8A 4KY5A 1BBXC 2E75C 2N88A 5CC4A 3EA6A 4C3JB 3W3AA 3QWNA 1CZGA 2AWOA 1OXSC 3MXNA 1PFMA 5CMDA 4IFDI 4K14A 4HN7A 4OIKA 2YU9B 1WVLA 3P20A 3BVGA 3X3MA 2TMPA 1HTPA 3IAYA 2OF1A 3HOXB 4FYDA 3OPOA 1PTOB 1HCZA 5JEAH 3R2IA 2WB1B 3HOWB 2AQ1B 4OO1H 1MD2D 4DGZA 3Q23A 3QJYA 5I9PA 1EQVA 3FDTA 4CBVA 3KK7A 1QCBD 1D2BA 4DFAA 2K7VA 1QOHA 3NBHA 4BWGB 1JCKB 2A6HD 1DXMA 2BOSA 2JA5B 5FO8B 1X3QA 2AWNA 2R3ZA 2NTTA 2A73B 5KEEA 5A35A 3VA7A 3PIO3 3Q0AA 4G7ZC 1LTGD 4BY7B 2ZXOA 2AUJD 1GJXA 2XRQD 1JR0D 3J7AV 1IW7C 1I4RA 1SNPA 2EY2A 4C1NI 2E76C 1JOQA 3ONAB 3L7ZC 1WTWA 3RD4A 3K6OA 1BF4A 1SMYD 2HDMA 5J39A 2MUYA 1EOTA 2JEAI 3C2PA 1B2TA 2RA4A 2RDHA 3VA5A 5CV9A 1BNZA 5M3MB 2EZVA 2B2VC 4KN7C 1R4QB 3D4DA 5JEAJ 4PNYA 2KHSA 1GUSA 2QKIC 5M3FB 5J1ZA 4OIJA 1EEFD 1DOKA 2F3WA 3C1EA 2DY8A 3J7AF 3S2HB 3DEOA 4IALA 2IJ0A 1STNA 1M8AA 4HMJA 3RLFA 3TP7A 3HOVB 4V0BA 3ERQA 1SYFA 3A54A 5LHY1 1RHPA 1ESRA 2F0SA 1EY0A 4IUNA 3VR6A 2L5TA 3SEBA 3E5SA 3A56A 1CHPD 4ME5A 4R8NA 4DXGA 1TWAB 5KIXA 1D1IA 1TT2A 5E1FA 1JWUD 1D6EC 2Y0SB 2L55A 3FPUB 1V43A 1K8OA 1LT4D 2QCPX 1KTKA 3MEHA 1TWCB 3HG9A 3J7YW 1CQFA 4H44C 1PZKD 2D5DA 3URYA 4KD3A 2EYJA 3K5NA 2R92B 4HCSA 2RKSA 3AB9A 4A3JB 2AQ3B 1I4PA 5C3EB 3D4WA 4C1NK 2J7ZA 1NSNS 3JAML 1C4QA 3RUZA 2KJXA 5CV7A 2O5JC 2M2LA 1J9OA 5JVG3 1BCPF 3M4YA 3BZDB 1BR9A 1II3A 1EU3A 4MHEA 5IT9E 3NTIA 1CA6A 2G9DA 1I4HA 5C4ZA 1I3QB 1C48A 1STBA 2Q8RE 4AYBB 1K83B 2QEJC 3OMCA 4FO2A 4CGYB 2K04A 1GXDC 1F2YA 5K36G 1B4OA 1IL8A 1O7LA 5CV5A 2B39A 2D2CC 3MVVA 1EY5A 2MGSA 1JQYD 3V96A 1V1PB 2K01A 2WP8J 1DOMA 1RD9D 4BBRB 3TZUA 1VMPA 2D9UA 3BYTB 3NWSA 4K2KA 5T1GA 1BCPB 3I90A 5CV8A 1EWCA 3PUZA 4KV6A 2MP1A 2F4IA 1ET6A 1EU4A 2B2TA 1B50A 3GTKB 1LLRD 3OW7A 2PCFB 5I6WA 3KBXA 4QUFA 4BS9A 3MXPA 1EY6A 1S4ZA 1Y1VB 3BDCA 1F77A 3R3OA 2NVYB 1IW7D 2A69C 1A15A 3FRPB 3G6JB 5KYLA 4QCLA 2Z1CA 4DAPA 3H6MA 2K33A 3H91A 1Z6HA 3SK6A 1KDAA 3D4RA 4O1NA 1H9RA 1WD1A 2L12A 1EY7A 1XX8A 3L9AX 1Z7TA 4FXDA 1DONA 3CU7A 2SNMA 3F2UA 5J22A 4B9WA 1KNAA 1RTOA 1Y8OB 4C3HG 1A6XA 4ZAIA 1CT1D 1O7YA 1LT6D 3K5MA 4CKBA 3H3VC 3N6RA 2PQEA 1T5EA 1TS5A 2K5QA 4CKCA 3VYSA 3HEJA 1LTBD 2KCCA 1AZPA 1EQTA 4C3IG 5BN3A 3BVMA 1UNSA 2R61A 1D5ZC 1G2SA 2EJMA 4BA1I 1OXVA 1XXGA 2B2WA 2PPBC 2NVXB 1GUNA 3D8GA 3GP7A 1SFOB 2O2LD 4H13C 2G9HD 4ID6A 2BE5D 1W6KA 1NAPA 5C4JB 1RDPD 1F9QA 1G8ZD 1OXXK 4FF2A 3FVQA 3M3YB 1SAPA 1PYWD 1SYCA 3MZ5A 4K6LA 3SE0A 1PZJD 2DNEA 3S2DB 2NN6H 3DXJC 3C1FA 2MPMA 1U4PA 4XDXA 2MJ8A 1QJOA 4KD4A 3H09A 3MXGA 1SYGA 1L0YB 5JVH3 2VNUD 1TR5A 4KHZA 2EXZA 3I91A 4IUPA 4A3DB 1STYA 1QE6A 4LK1C 2JP1A 3I70A 5E4XA 2RQXA 2HCCA 1AN8A 3SK5A 4PMBA 3K58A 3P7JA 1U4LA 1WD0A 2F03A 4FP5D 5D65A 1HFNA 1AP0A 1WTRA 3BDOA 1T5XD 4QMGA 3I4MB 5IGBA 3R2TA 4K5WA 4HAEA 4ZQ3A 2F0VA 3GQBA 1SJED 1YNNC 1NUCA 1CQVA 4EVOA 1CTMA 3HZXA 4F87A 1G91A 2JA6B 2RSNA 2XWJB 4RGNA 3SR1A 3HKZB 2E74C 1GUGA 4XXEA 4IQZA 4KY7A 1E2WA 5C3WA 2J0TD 3TZDA 4DNRB 2QILA 5CGKA 2KEDA 4HR7B 1CM9A 5EBDA 1PRTD 4C56C 3H0GB 2XIWA 4ZUIA 3KUPA 2X6LA 1F2LA 4NMZA 2GA4B 3TDQA 2WKDA 1SSOA 1HHVA 1UUPA 3BS1A 2X69A 3G7LA 4S3SA 2PNRC 2Q8TA 4E6IA 2L0CA 4ODGA 2ZT9C 4U673 1EWHA 3EJIA 3RMHA 5IGGA 5TSSA 1B3AA 3NP8A 2EYLA 2E2HB 1EY9A 2ZXPA 5EGTA 3S1QB 1FNUA 1I6VC 1XYIA 5EPKA 1LTTD 1FR3A 1ICWA 1EFID 2B2UC 1J8IA 2F0HA 1MSGA 3I72A 2OEOA 5KGUA 5JPNC 4EGVA 4ZKBB 1GUWA 3DWAA 3NTKA 2SEBD 1HPCA 2A6EC 1V1OA 1SNQA 2R93B 2A68C 1B9NA 5ISRA 4RGOS 1PTOH 3HRZC 5I9OA 3MC0B 1IYUA 1H9SB 1EY8A 1LABA 3MFYA 3KLSA 4ZKCB 2B2TC 4O42A 4BBSB 1FD7D 2A74C 1U4MA 2PMZB 1ZYRD 2FFKB 4RCNA 1JORA 1I4XA 5LL6S 4V190 2B2YC 1F9SA 3T51B 1Y1WB 2BA0A 4QB4A 2RDFA 5HGTA 2L9HA 2C5CA 4FF4A 1VF5C 5JPMC 3J80E 4JBWA 4LAAA 1SYBA 1AW7A 3GTJB 3S14B 2BCOA 1FGBD 5FKAC 1OO9B 1YNJD 1TWGB 5KYIA 2JA8B 1QNKA 2HUGA 3NSWA 4DK0A 5JEAG 3QB3A 1B1ZA 4OO1G 3UI2A 1LACA 2NYZD 3GV6A 1TU2B 2VB3X 5M9OA 1DZ1A 4B08A 4DAYA 1TVXA 3KLSX 1Y8PB 1RKNA 1WTVA 5D3IB 3FMCA 1KDCA 4ZUJA 2IW3A 2Q8IB 2K6AA 1Q1EA 2QF7A 1PXUA 3X3NA 2XSCA 4K5XA 5CYUA 3R93A 1F9PA 5FK9C 1JE4A 2EYHA 3S1NB 2BDNA 4RA8A 4CKEA 3PO2B 3D6WA 2B2WC 3IL8A 1LTSD 1DYQA 2DY7A 1UEAB 4OO1I 1MI2A 2R7ZB 5BN5A 2VUMB 2NVTB 4RFBA 1BO0A 5G3LF 5FLXE 5EJWA 4QF4A 1ESFA 4J6HA 2EJFC 2F0DA 5IT9L 2IX3A 1CA5A 3C3LA 1FNVA 5ELEA 2NBFA 5A2QE 4A3FB 4XTCS 3FKIB 2CW0D 3OSOA 2Z4HA 4DNTB 1AZQA 1SBBB 1PTOD 1VF7A 3VR3A 2F0IA 4QIWB 1QB5D 5EKKA 4KJOA 3TN2A 1EIHA 2RBMA 1LO5D 4J8QA 5D14A 1SYDA 4FF1A 2B8FA 4OGQC 1BCPC 1HA5A 3IFTA 5CORA 5F2DA 4ILWA 2EJGC 5E3FA 4ABNA 2WV6D 1H9SA 3ZYYX 4H7BA 2LKVA 3K5LA 3AMUA 2XWBB 5NUCA 3MXUA 4K8IA 1HQRD 2LS01 2JA7B 2KUMA 4DA2A 4L6TB 2K03A 2SOBA 5T1IA 5COYA 4NP5A 5DNFA 3CRLC 1ET9A 2AUKA 4KKUA 5EPLA 1H9JA 1A3VA 4TSSA 4TRDA 2A68D 3SXHA 3NWTA 3PUWA 2JEBI 2WKCA 4UDUC 2EYFA 1BQQT 2WIIB 3AU7A 3LX0A 2EYPA 4I7ZC 4C3HB 5BN4A 1R9TB 4TKOB 4PV1C 5ELFA 5KNCA 4F7XA 1EY4A 4ZLTF 1FNWA 1RTNA 3EROA 2IX0A 3WOFA 3JAME 2RSOA 2M9VA 2VXWA 3Q24A 5FO9B 4C3IB 4OL7A 1EZ6A 2H4OA 3DMUA 1VMCA 1HRJA 1GHJA 4X3KA 2KVMA 4PQXA 4KI0A 1Q90A 4A3EB 3CKIB 2F0UA 1EEID 3PUYA 4LJZC 4NKLA 1PRTF 3S9WA 5M5YB 1PLFA 4PMCA 4RAUC 4EQOA 4N9PA 2HCIA 3K57A 4KN4C 4FVMA 2KCNA 1U9RA 3RZDB 1O80A 3CHBD 4XQJA 3TP8A 1C8CA 3KLRA 2NZ1D 1F2MA 4XT3B 1TS2A 2EDGA 3MAQA 2AQ2B 4MN3A 1ZXTA 2CQAA 3VR5A 4A93B 2F0TA 1SE4A 3OMGA 1CI3M 2MHVA 5E4WC 2PO4A 5AFWA 4KMUC 3GTMB 4I65A 2B2VA 2DNCA 5C5LA 4QUCA 1G2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDM A;  2B2Y C;  4CJ0 B;  1F9S A;  1SAP A;  4HCS A;  1EOT A;  1Q3L A;  3TZD A;  5CBE E;  4HED A;  2KED A;  2L9H A;  1CM9 A;  1X3P A;  1KNE A;  2FMM A;  4UAI A;  1B2T A;  1LV9 A;  1PFM A;  2RA4 A;  5CMD A;  3LWE A;  1A15 A;  1NR4 A;  4ZLT F;  1EL0 A;  2XIW A;  1RTN A;  2J7Z A;  3DEP A;  1BNZ A;  2MPM A;  3KUP A;  1U4P A;  3MTS A;  4OIK A;  4U68 A;  2X6L A;  1PFB A;  1AZQ A;  1WVL A;  2B2V C;  1F2L A;  3H91 A;  2M2L A;  4CJ1 B;  1SSO A;  2FJ2 A;  2RSO A;  1J9O A;  1B53 A;  2VXW A;  4IUT A;  1HHV A;  4XDX A;  5CBA E;  1ILQ A;  1QNK A;  2X69 A;  3N52 A;  2FHT A;  2B2U A;  3G7L A;  2HUG A;  2MJ8 A;  4MHE A;  1WD1 A;  2L12 A;  1XX8 A;  4IUV A;  2Q8T A;  2K1B A;  2KEE A;  1JIC A;  1VMC A;  4OIJ A;  1CA6 A;  1HRJ A;  4IUU A;  4X3K A;  1DON A;  1DOK A;  4ZK9 B;  2KVM A;  2DY8 A;  3UI2 A;  2NYZ D;  3F2U A;  3GV6 A;  3TN2 A;  2Q8R E;  1EIH A;  4RWS C;  3DEO A;  1KNA A;  1DZ1 A;  1B3A A;  1RTO A;  3QO2 A;  1ILP A;  1M8A A;  3I91 A;  4IUP A;  4X3T A;  1X32 A;  5D14 A;  1TVX A;  4X3U A;  1CA5 A;  2K04 A;  3I8Z A;  3IFD A;  3FDT A;  1PLF A;  4R8I A;  1HFG A;  2EE1 A;  5EPJ A;  1QE6 A;  1PFN A;  1WTV A;  1WTO A;  1B4O A;  4RAU C;  1IL8 A;  5EPK A;  1XYI A;  5COR A;  1IKL A;  5EKI A;  1ICW A;  2JP1 A;  1MGS A;  1DOL A;  5E4X A;  2B2U C;  4ZAI A;  1J8I A;  2NWG A;  2EPB A;  1O7Y A;  2HCI A;  2K05 A;  4XT1 B;  1MSG A;  2EOT A;  4X3S A;  2HCC A;  1RHP A;  1ESR A;  1MSH A;  3I3C A;  1O80 A;  1NCV A;  3P7J A;  1F9R A;  2MGS A;  4LMQ D;  1U4L A;  1WD0 A;  1C8C A;  1X3Q A;  3MWY W;  1WTQ A;  3R93 A;  1QG7 A;  1WTX A;  2K01 A;  2NZ1 D;  2R3Z A;  2RVL A;  5D65 A;  1DOM A;  4ZKB B;  1HFN A;  2JYO A;  1AP0 A;  1AZP A;  1EQT A;  2SDF A;  1GUW A;  4XT3 B;  2HDL A;  1WTR A;  2IL8 A;  2L1B A;  1NR2 A;  1VMP A;  1F9P A;  2D9U A;  1JE4 A;  1PDQ A;  2X6G A;  1ML0 D;  1O7Z A;  1HUM A;  2FIN B;  4NW2 A;  2K28 A;  2KEC A;  1G2S A;  4MN3 A;  1HA6 A;  5T1G A;  4HSV A;  5EQ0 A;  1EIG A;  2BDN A;  1SDF A;  1ZXT A;  3I90 A;  4RA8 A;  2B2Y A;  3DM1 A;  3SVM A;  3D6W A;  2KUM A;  2B2W C;  3IL8 A;  2B2W A;  3FPU B;  5JJZ A;  5E4W C;  1WTP A;  2DY7 A;  2KOL A;  2CVR A;  4HAE A;  2K03 A;  5T1I A;  2MP1 A;  5COY A;  3GV3 A;  4CJ2 C;  1MI2 A;  4IUR A;  3ONA B;  5DNF A;  1E0B A;  1ROD A;  2B2T C;  2N55 A;  4O42 A;  4R9W A;  5AFW A;  2B2T A;  4ZKC B;  1WTW A;  1BBX C;  1RJT A;  1BO0 A;  5EPL A;  4DN4 M;  2N88 A;  1G6Z A;  1HUN A;  1U4M A;  3Q6S A;  2B2V A;  5EJW A;  1G91 A;  1B50 A;  2L4N A;  1IKM A;  1NAP A;  2RSN A;  1BF4 A;  3HP3 A;  3KBX A;  2H1E A;  1F9Q A;  2FFK B;  4QUC A;  4QUF A;  4IUQ A;  1G2T A;  1U4R A;  1S4Z A;  2L11 A; 
#chains in the Genus database with same CATH topology
 3SDZ A;  1QIL A;  5GAE C;  2A6H C;  5IOC A;  5I6Y A;  1VQ5 A;  4ZRZ A;  1KAW A;  1KHI A;  2KQ3 A;  1MIU A;  2QA4 A;  5C0X H;  1PVO A;  4EX5 A;  2DJG C;  1EYG A;  3MFG A;  4Y52 H;  4WRD A;  2E2I B;  4FXG C;  2B3G A;  4YHH L;  2PYK A;  2F0M A;  4DV4 Q;  3U9O A;  4H02 A;  1DD2 A;  4RGT A;  2XN9 C;  3CCM A;  3NUC A;  4A3I H;  3SK4 A;  2NVX H;  1TXY A;  4OWW B;  5CV4 A;  2N3S A;  1SFO H;  3NHH A;  1CZW A;  2E2J B;  4WFN 3;  2EXD A;  4I7A A;  4H0L C;  1BOS A;  3NPP A;  4KY6 A;  3JAM i;  4DR1 Q;  3A7A B;  1I4Q A;  3STB D;  4A3G B;  5C4J H;  1K3R A;  3CW2 C;  4R8I A;  3FEW X;  2UUB L;  1SNM A;  1XNQ L;  1EQR A;  4A93 G;  4C2M B;  5IOD A;  3M3Y H;  1W6J A;  1SMY C;  3OYY A;  4X3S A;  3IKJ A;  4P73 A;  4JBM A;  3A55 A;  4HMI A;  3H3V H;  3WOE A;  4Y7N B;  2MO1 A;  3D3R A;  5EBC A;  3S2D H;  3ICE A;  3PO3 G;  3FPP A;  5BR8 L;  3NK9 A;  2FMC A;  4B9X A;  3CCV A;  4IFD H;  1I6H B;  1E7Z A;  2PZT A;  5GAH C;  1PDQ A;  2PZW A;  1O7Z A;  2EY6 A;  4KHV A;  1STH A;  2B63 B;  1ZKO A;  1HR0 L;  2N8N A;  1MKH A;  2FXQ A;  2F3V A;  2PW7 A;  4POF A;  5JJZ A;  1WTP A;  2HQE A;  3T53 B;  2KOL A;  2CVR A;  4LFC Q;  3S15 B;  2VW9 A;  3SGI A;  1KD1 C;  4LF4 Q;  4CJ2 C;  1HZC A;  2WFW A;  1E24 A;  3OIP A;  2UUB Q;  1ROD A;  3KFU A;  4GZY C;  4A3D H;  1RJT A;  4DN4 M;  4DXF A;  4DAY B;  1WYD A;  1K73 C;  3T16 A;  2SNS A;  4L8J A;  3T4A C;  2ES2 A;  1PH9 A;  1A3T A;  4B3T L;  2K32 A;  3BYY B;  4PMW A;  1SND A;  1XMQ L;  2KA7 A;  3GTG B;  4K8J A;  2NN6 G;  5BR8 Q;  1NMF A;  2WAQ B;  1TWF H;  1KNE A;  4A3G G;  4Q0F A;  2PNH A;  3OWE B;  4LF8 Q;  1M4V A;  2XVS A;  1EL0 A;  1SYE A;  1PA6 A;  4GN5 A;  4X64 L;  1DJR D;  3PIO A;  3ERS X;  1TS3 A;  3EQL C;  3J81 E;  5C44 H;  4DV6 L;  3I4M H;  3E0J A;  3E6Z X;  4R4O A;  3PCO B;  4IN3 A;  1ASZ A;  1ENA A;  5C3X A;  4LF5 L;  4CDC C;  2CKZ B;  2D0O A;  4QQB X;  5DM7 3;  1EYC A;  1O78 A;  3S1R B;  4LF7 L;  2CHB D;  3BJU A;  4TQU S;  3W1G A;  5JOB A;  3C46 A;  3CCL A;  2C9O A;  4X66 L;  1JOK A;  2QDL A;  2JA6 H;  3IFD A;  1B9M A;  2ZJR A;  1VQ6 A;  1HFG A;  4A3K B;  1FJG Q;  1XMQ Q;  1PFN A;  3T56 B;  1GUO A;  1HJP A;  1IKL A;  2J4X A;  1MGS A;  1DOL A;  1HQM C;  2EPB A;  2A69 D;  3TP5 A;  5IP9 G;  1Q81 C;  2LMC B;  4K6D A;  4BY1 H;  4JI2 L;  4X64 Q;  4RHR A;  1NMG A;  2F0L A;  2NN6 I;  3CXC A;  4IOA A;  3H0G H;  3D6C A;  1B44 D;  2LY7 A;  1LTI D;  4DK3 C;  1HUM A;  4JYA Q;  3NXW A;  4LF5 Q;  2R7F A;  2GN5 A;  2JSO A;  4HSV A;  1LTR D;  3H3V I;  3OOC A;  4HSP A;  5KRU A;  3B6Y A;  4LF7 Q;  3SVM A;  3J80 L;  4HCE A;  3P75 A;  1YBY A;  2RDG A;  3HOY B;  1BXT A;  4X66 Q;  1SE3 A;  5FOB B;  1QUQ A;  5CR3 A;  2EY5 A;  2YYZ A;  2E2H H;  3BVZ A;  4P75 A;  3VR2 A;  2YU9 H;  4HJA A;  2YTY A;  3HP3 A;  3S17 B;  1Q46 A;  1Q8K A;  4G57 A;  1U4R A;  4JI2 Q;  1AEX A;  4Z9C B;  3JAM c;  5JAV A;  1Q3L A;  1Y8N B;  1OXU A;  4HED A;  2I5H A;  1PH5 A;  5J3B A;  4UAI A;  1EYA A;  1M90 C;  1UAP A;  3HOW H;  4A3K G;  3VYT A;  3TSS A;  3ZJY C;  2VQF L;  3LWU A;  1PFS A;  5ELB A;  4GKJ Q;  3TME A;  2IY5 B;  3RR5 A;  1D5X C;  5CBA E;  5IY0 A;  2R93 H;  1KC8 C;  3N52 A;  4A76 A;  1STG A;  2CWA A;  3EIV A;  4L63 B;  2VQE L;  4GOP C;  4DR7 L;  4IUV A;  2K1B A;  4NDX A;  3V05 A;  3WWV A;  3OHX C;  1J5E Q;  4EQP A;  4OHJ A;  2K5W A;  4KJN A;  1TY0 A;  3SK8 A;  4RWS C;  2IWH A;  4BBS H;  1KLG D;  4C3J G;  4LUO A;  3NTH A;  2MO0 A;  2CH4 A;  5DM6 3;  1ENF A;  4CHT B;  3A5U A;  3E3X A;  1UWV A;  3I8Z A;  4O2D A;  3I56 A;  1VQI A;  4BY7 H;  2F0J A;  5DEH A;  1Y1W H;  1S5E D;  4OWT B;  4WJW A;  5LL6 X;  1VDZ A;  1EYD A;  3I3C A;  2F0O A;  1CHQ D;  3QG1 A;  1F9R A;  4JW0 A;  2VQF Q;  4LMQ D;  1RF2 D;  2IPK D;  2KCT A;  3MWY W;  5FLX L;  1WTQ A;  1QG7 A;  3GTJ H;  4WOR A;  4M8A A;  3S14 H;  3NE5 B;  2UUC L;  3AFQ A;  4A3L G;  3HOX G;  2VQE Q;  4DR7 Q;  1WCM B;  3KBG A;  1TWG H;  2JA8 H;  3F2D A;  5HUR A;  4GKK L;  1N34 L;  3KF8 A;  4P2C B;  3KF6 B;  4JI3 L;  4XQQ A;  5IIF A;  1CK1 A;  1SRU A;  1F2Z A;  5FJ8 G;  5A2Q L;  2ICI A;  4GOP B;  1QZG A;  1H9M A;  1S5F D;  4RKB A;  3CAM A;  2EVB A;  3CRK C;  3D31 A;  5M5W B;  3GV3 A;  2IX1 A;  2XNA C;  1E0B A;  1IBK Q;  1OXT A;  2WAC A;  2HD3 A;  4JK1 C;  5HGQ A;  1HUN A;  3Q6S A;  1K8M A;  3CCR A;  3WDN A;  3HFZ B;  2H1E A;  5DAU A;  4JI5 L;  4UP7 A;  1I50 B;  4RCO A;  2JA5 G;  3NBI A;  2EYO A;  4YWL A;  1VQJ A;  5C6A A;  4GN4 B;  1TWH B;  3RZO B;  2UXD L;  3BZC A;  4KKT A;  1S5D D;  4YIJ A;  3HKZ E;  5GAG C;  1CKN B;  1PH3 A;  4RHS A;  2UU9 L;  1BDO A;  3CMA A;  3KDF A;  5C4X B;  1MHW C;  4JI3 Q;  2Z6K A;  2FJ2 A;  4IUT A;  1BKB A;  3S1N H;  2JXM B;  4PG3 A;  3BZK A;  1N33 L;  1CKO A;  3VR4 A;  1JIC A;  2JJQ A;  1SE2 A;  4XIG S;  2Z4I A;  3DUZ A;  4LUZ A;  1SNC A;  4WJ4 A;  5C5M A;  3V2T A;  1YNN D;  3QOJ A;  1SJH D;  2VUM H;  1L1O C;  2NVT H;  2ZTD A;  2TSS A;  1JB3 A;  1HR0 W;  3QO2 A;  3S1M B;  2NB0 A;  3HS0 C;  1STE A;  1X32 A;  2CQO A;  2CCZ A;  1PMR A;  2Q2U A;  4HTH A;  1PZI D;  2BE5 C;  3H15 A;  2EQS A;  1YEZ A;  4M1U B;  5EKI A;  1HTL D;  2UXD Q;  2NWG A;  3HGB A;  2D0P A;  1JE5 A;  5K36 H;  4XT1 B;  2EOT A;  1PYS B;  1KAB A;  1D1K A;  4OON A;  2UU9 Q;  2GVB A;  1NCV A;  1HZB A;  1LT3 D;  3FKI H;  4DR4 L;  2DUD A;  5C4H A;  4N8X 1;  1TWC H;  5KND A;  4BXX G;  2ZXR A;  2HDL A;  1N33 Q;  3PUV A;  1IHZ A;  3HOU B;  1VQP A;  3HOZ B;  1TY2 A;  1HA6 A;  3ND9 A;  3R8B A;  2WB1 E;  4WJ3 M;  2R92 H;  3W2D A;  1IL2 A;  4XYO A;  1Y69 U;  5IWA L;  3K0Y A;  1ENC A;  4KTA A;  3A74 A;  5I2X A;  1CSP A;  3DWP A;  2N55 A;  3T1H Q;  2AKW B;  2R6G A;  5IP7 H;  3HOV G;  2VB2 X;  4K5V A;  1E2Z A;  4RMF A;  1VQ7 A;  1IKM A;  3LNN A;  1E2V A;  1JOO A;  3A8K E;  1DGS A;  4IUQ A;  2L11 A;  4X6A H;  4DUY L;  5FLM G;  4DR4 Q;  2PMZ E;  4UP9 A;  3K5O A;  3GTQ B;  2F0N A;  3EN2 A;  1EZ8 A;  1XPU A;  2FMM A;  3H94 A;  1LV9 A;  1X9N A;  3LWE A;  4ZYS A;  1NR4 A;  4K2L A;  1K83 H;  3DEP A;  2M00 A;  2A6E D;  2HHH Q;  2V4D A;  3EFX D;  3L3O C;  4CJ1 B;  2IHE A;  1YJ9 A;  1ILQ A;  1JJ2 A;  1X56 A;  5IWA Q;  5IGE A;  2B2U A;  4A3M B;  3P1H A;  2JA7 H;  1A8V A;  1QVC A;  3PUX A;  2KEE A;  3CD6 A;  2LXK A;  1VCI A;  4IUU A;  3BDL A;  4DU9 A;  1GHK A;  2PQA A;  3VYR A;  1I4G A;  4Q5V A;  5IYD H;  4OX9 L;  2NVQ B;  4BA2 I;  3CQZ B;  1ILP A;  4XQN A;  1Q1B A;  1GUT A;  4HIO A;  5FO7 B;  2EE1 A;  1Q8I A;  1L0X B;  1JWM D;  4FXK C;  3LGJ A;  1PH7 A;  1JWS D;  4C3H H;  4A3J G;  5I4D A;  1R9T H;  1AE2 A;  5C3E G;  2Z8L A;  2K5D A;  1S72 A;  1H9K A;  3M4O B;  4QJF A;  1Z9F A;  2ASB A;  1LUZ A;  4DF7 A;  1PRT C;  2JYO A;  4J1M A;  3PMF A;  2IL8 A;  2L1B A;  3BG3 A;  4GNX A;  1NBW A;  2RHQ B;  2JE6 I;  2KEC A;  3EVQ A;  4C3I H;  3A8J E;  3QR8 A;  1TQO A;  4HJ8 A;  2B2Y A;  3DM1 A;  1HNX L;  2F0K A;  1LT5 D;  3S16 B;  3DHQ A;  2BDO A;  1VQO A;  2ICE C;  2OT2 A;  2PW5 A;  4MIU A;  1ZEQ X;  4A3E H;  4RH6 A;  2EY1 A;  4FNF A;  3ULP A;  2E2D C;  2F1M A;  4DV3 L;  3IRB A;  4KKS A;  2I46 A;  4UPA A;  5M5Y H;  4NB3 A;  4A3M G;  1EOV A;  3GTO B;  2NTS A;  3U50 C;  5JJL A;  4F8M A;  4DAV A;  1TII D;  4F88 A;  2F0P A;  4CJ0 B;  4OXP A;  3RZD H;  1TS4 A;  2E5L Q;  3Q22 A;  4A3B B;  4G7O C;  2A5H A;  3F2B A;  1XWE A;  2OXP A;  5CV6 A;  3CPF A;  3QIA A;  4BBR G;  3O13 A;  3G48 A;  3VYU A;  1Q7Y C;  4LW1 A;  3GO5 A;  1GOZ A;  1V8Q A;  3MEF A;  1CUK A;  1A2U A;  1LTA D;  2EYM A;  2Y0S E;  1TKW B;  2D62 A;  4R4Q A;  1PRT B;  4DUZ Q;  4RGM A;  3PQI A;  2BA1 A;  3PO3 B;  1NTG A;  1KAA A;  1SRO A;  3I2Z A;  4IOC A;  1CKM A;  1BBU A;  1XTD A;  2NUC A;  1G29 1;  3GTL B;  3GD7 A;  4ZK9 B;  1SXT A;  1MBY A;  1RCV D;  3A8I E;  5G3L D;  3MXN B;  1XTC D;  2UXB L;  4DK1 A;  1KDB A;  2QDB A;  1QUQ B;  3GTM H;  4NPS A;  1Y1V G;  3F2C A;  3T13 A;  2O4X A;  1ZYR C;  1SEB D;  1R4P B;  2F0G A;  1HXY D;  3I4O A;  1S5C D;  5K5P A;  2K05 A;  1K0S A;  2ID0 A;  4A3I B;  1MSH A;  1C9O A;  3GDE A;  4JBK A;  4RKL A;  5ELD A;  3MHB A;  4CDF C;  1STA A;  1C0A A;  5KNB A;  4G7H C;  3PIP A;  1WTX A;  4GN3 B;  2RVL A;  3OIQ A;  1IYV A;  4J15 A;  2PZU A;  5M5X B;  1ONL A;  1NR2 A;  2E2I H;  3K0X A;  3M9B A;  2FIN B;  2K28 A;  4A3B G;  1YNJ C;  3I73 A;  1DM0 B;  2K75 A;  4AYB E;  2UXB Q;  3M7N A;  3M85 A;  2IT1 A;  4MTN A;  5IYC G;  2CFM A;  4KK7 A;  2E2J H;  3DWQ A;  1H95 A;  1K3B C;  1A2T A;  1W3S A;  5IGF A;  1QVG A;  1JC7 A;  1J6Q A;  4FF3 A;  3I4N B;  2OWO A;  2KEN A;  5D3D A;  4YHH Q;  3J81 L;  2N78 A;  4A3G H;  1G6Z A;  1BCP D;  1XJV A;  5I2Y A;  2L4N A;  1GVP A;  4O0A A;  4C2M H;  4HJ9 A;  3M7G A;  1D5M C;  2XRS D;  1PHJ A;  1A3U A;  1FYC A;  2ALY B;  3ND8 A;  2ENB A;  3CC4 A;  2KHJ A;  5CBE E;  5C0X G;  3MA2 B;  3NQI A;  4Y7N H;  4R4C A;  1V1P A;  1SNO A;  1X3P A;  1Z47 A;  3GTP B;  3NQT A;  5IGD A;  1XNQ Q;  1AFP A;  3MTS A;  4U68 A;  1PFB A;  2ZJP A;  2Z6K C;  1B53 A;  4A3I G;  4CDD C;  2F0E A;  3UE0 A;  1KLU D;  2FHT A;  2B63 H;  2O5I C;  4LUV A;  3KF8 B;  2F0W A;  1CFM A;  5C0X J;  4IPH A;  3S15 H;  3K59 A;  2LSS A;  5GAD C;  5GQO A;  3OWF A;  1TWF B;  5IP9 H;  4XYQ A;  5GRO A;  3ITP A;  4X3T A;  3QOL A;  4MZ9 A;  3A7L A;  4X3U A;  4DV0 L;  3K7A B;  5IGC A;  1HR0 Q;  5EPJ A;  1BUV T;  5LMN L;  1DCZ A;  5C44 B;  1WTO A;  3U9S A;  3RN2 A;  1G51 A;  3AEV A;  2I07 B;  4ULL A;  3GTG H;  2DN8 A;  3TBI B;  5EAY A;  3SHL A;  3I4N G;  5C0X I;  4IFD G;  1QNU A;  4HJ5 A;  4N9T A;  5EKL A;  2SDF A;  4EQN A;  2CW0 C;  3I4L A;  3KDF B;  4B3T Q;  2X6G A;  1ML0 D;  3PV0 A;  4NW2 A;  5ELC A;  1YHQ A;  1PH1 A;  4G4K A;  1PTO C;  2RHS B;  5EQ0 A;  1EIG A;  1SDF A;  4P74 A;  1PTO F;  2B29 A;  3TP6 A;  1Q12 A;  1PV4 A;  2F0F A;  2F0Q A;  3OW2 A;  1SLJ A;  2LFN A;  5IT9 c;  3KJO A;  1BBW A;  3S1R H;  4BY1 B;  4IFD J;  1ASY A;  2B8G A;  1RIP A;  1QWY A;  4IUR A;  3PIP 3;  2WIN B;  1S5B D;  2ZTE A;  4R9W A;  4IZ8 A;  4KY5 A;  1BBX C;  4DV6 Q;  2E75 C;  2BH2 A;  2N88 A;  1N32 L;  5CC4 A;  3EA6 A;  1GO3 E;  2Z6B A;  4UHV A;  2AMC B;  4C3J B;  3W3A A;  2YV5 A;  3QWN A;  4GLV B;  1CZG A;  1KXL A;  2AWO A;  1K8G A;  1OXS C;  3MXN A;  3TS2 A;  1PFM A;  5CMD A;  2NZO A;  4IFD I;  4K14 A;  5IE8 A;  4HN7 A;  5C44 G;  3I4M G;  3F1Z A;  4OIK A;  2YU9 B;  1WVL A;  1T9H A;  3P20 A;  3BVG A;  3X3M A;  1EUJ A;  2TMP A;  3S1Q H;  2NZH A;  1HTP A;  3IAY A;  1KQS A;  2OF1 A;  3HOX B;  4FYD A;  1MJC A;  3OPO A;  1PTO B;  1VQ4 A;  1HCZ A;  3HOY H;  3RN5 A;  4B3R L;  5JEA H;  3R2I A;  2WB1 B;  1V9P A;  2H5X A;  2JA6 G;  3NEM A;  3HOW B;  2AQ1 B;  2LXJ A;  4OO1 H;  1MD2 D;  4OEL B;  3HKZ G;  4DGZ A;  3Q23 A;  3QJY A;  5I9P A;  1EQV A;  3FDT A;  4CBV A;  3KK7 A;  1YIJ A;  1YI2 A;  4NXN L;  1QVF A;  1QCB D;  4BY1 G;  1D2B A;  4DFA A;  2K7V A;  1QOH A;  3NBH A;  4BWG B;  1JCK B;  2A6H D;  3H0G G;  4FDB A;  1DXM A;  2BOS A;  2JA5 B;  5FO8 B;  1X3Q A;  5L37 A;  2AWN A;  2R3Z A;  3NEN A;  3DM3 A;  2NTT A;  4JI4 L;  1GKH A;  4A75 A;  4GLA C;  1VQ9 A;  4KHP L;  4GNX C;  2A73 B;  5KEE A;  5A35 A;  3VA7 A;  3PIO 3;  3Q0A A;  1WI5 A;  4G7Z C;  1LTG D;  5H1S E;  4BY7 B;  3K80 C;  2ZXO A;  4B3R Q;  4JOI A;  2AUJ D;  1GJX A;  3D0F A;  2XRQ D;  1JR0 D;  4R4I A;  3J7A V;  1IW7 C;  1I4R A;  4NXM L;  1SNP A;  2EY2 A;  4C1N I;  2E76 C;  1JOQ A;  3ONA B;  2PQA B;  3L7Z C;  2L15 A;  1UE6 A;  1WTW A;  3RD4 A;  3K6O A;  4NXN Q;  3CC2 A;  1YHA A;  3ULJ A;  1NY4 A;  1JB7 A;  3L2P A;  1BF4 A;  1VQE A;  1SMY D;  2HDM A;  3KJP A;  5J39 A;  1K8A C;  2MUY A;  2WB1 G;  1VS0 A;  1EOT A;  4ME3 A;  3HOW G;  1MJE A;  2JEA I;  1EQQ A;  1QZH A;  3C2P A;  1B2T A;  4KHP Q;  2RA4 A;  2XGT A;  2C35 B;  3T1Y L;  2K52 A;  2RDH A;  3VA5 A;  5CV9 A;  4P71 A;  5M3M B;  1BNZ A;  2EZV A;  4AIM A;  1WCM H;  2B2V C;  5ELO A;  1UE1 A;  3KYH C;  4KN7 C;  1R4Q B;  3D4D A;  1YIT A;  3U4Z A;  3KOJ A;  5JEA J;  4GNX B;  4PNY A;  2VY3 A;  2KHS A;  3CCQ A;  1GUS A;  2QKI C;  1VQB A;  5M3F B;  1EIF A;  4QGU A;  5J1Z A;  1Y14 B;  4OIJ A;  1EEF D;  4BBS G;  3K81 C;  1DOK A;  2F3W A;  3C1E A;  2DY8 A;  5M5W H;  3J7A F;  2UUC Q;  3S2H B;  3DEO A;  4IAL A;  5LMU L;  1KL9 A;  2IJ0 A;  1STN A;  1M8A A;  4HMJ A;  4GKK Q;  3RLF A;  4JI8 L;  1X65 A;  1N34 Q;  4BY7 G;  3I7F A;  3TP7 A;  1Y1W G;  1HZA A;  3HOV B;  4V0B A;  5IYB G;  3ERQ A;  1SYF A;  3A54 A;  3PO2 H;  5LHY 1;  1HNZ L;  1UE5 A;  2ZTC A;  1RHP A;  1ESR A;  1TWH H;  2F0S A;  3T1Y Q;  1EY0 A;  4IUN A;  3VR6 A;  3RZO H;  2L5T A;  3SEB A;  3E5S A;  4LF9 L;  3OTO L;  4X62 L;  3A56 A;  1N36 L;  2R7Z H;  3CP0 A;  1CHP D;  5C4X H;  4JI5 Q;  1VQ8 A;  4ME5 A;  4R8N A;  4DXG A;  4DV2 L;  1TWA B;  4RG1 A;  2K5N A;  5KIX A;  2MNA A;  1D1I A;  1TT2 A;  5E1F A;  2OTJ A;  1JWU D;  4HJ7 A;  1D6E C;  2Y0S B;  2UXC L;  2L55 A;  3FPU B;  1V43 A;  3F8T A;  5LMU Q;  1K8O A;  1LT4 D;  4JI8 Q;  5M3M G;  4A3F H;  3S1M H;  2QCP X;  1KTK A;  3MEH A;  1TWC B;  3HG9 A;  3J7Y W;  1E1T A;  1CQF A;  3G4S A;  3STB C;  4H44 C;  5M3F G;  1PZK D;  2D5D A;  1HNZ Q;  3URY A;  4KD3 A;  2EYJ A;  3K5N A;  2Q2I A;  2R92 B;  4LF9 Q;  3OTO Q;  3J80 i;  4X62 Q;  4JCV E;  4HCS A;  1N36 Q;  1VQA A;  5LMN W;  1VQN A;  2RKS A;  3AB9 A;  4A3J B;  4DR6 L;  2AQ3 B;  1I4P A;  1LYL A;  1ICF B;  5C3E B;  3D4W A;  4C1N K;  1E22 A;  2Z0S A;  2J7Z A;  4DV2 Q;  1N8R C;  1NSN S;  1VQG A;  3JAM L;  1C4Q A;  1B70 B;  3RUZ A;  2KJX A;  5CV7 A;  2O5J C;  3M4P A;  3ER0 A;  3HOU H;  2M2L A;  3HOZ H;  1J9O A;  2Q2H A;  2UXC Q;  5JVG 3;  1BCP F;  3M4Y A;  3BZD B;  1BR9 A;  1II3 A;  1EU3 A;  4MHE A;  5IT9 E;  1IYJ B;  3NTI A;  1CA6 A;  3UDG A;  2G9D A;  5AJ3 L;  1I4H A;  5C4Z A;  1I3Q B;  1C48 A;  1STB A;  2Q8R E;  3UE1 A;  1KRT A;  4AYB B;  1K83 B;  2QEJ C;  3OMC A;  4B3M L;  4FO2 A;  4CGY B;  2K04 A;  4YY3 L;  1GXD C;  1F2Y A;  2Y0S G;  5K36 G;  1V1Q A;  1D8L A;  1B4O A;  1IL8 A;  1O7L A;  5CV5 A;  2RCN A;  3FKI G;  2B39 A;  4DR6 Q;  4LFA L;  2D2C C;  3MVV A;  3GTQ H;  4B3S L;  1EY5 A;  1U5K A;  3K8A A;  2MGS A;  2RCF A;  1JQY D;  3V96 A;  1V1P B;  2K01 A;  2WP8 J;  1DOM A;  1RD9 D;  2CH4 W;  4BBR B;  3TZU A;  1VMP A;  2D9U A;  2R92 G;  3BYT B;  3NWS A;  4DUY Q;  4K2K A;  5T1G A;  1BCP B;  5AJ3 Q;  3I90 A;  3PF4 A;  5CV8 A;  1EWC A;  3PUZ A;  3CCE A;  4KV6 A;  5IP7 G;  2MP1 A;  2F4I A;  2NVQ H;  2E8G A;  1ET6 A;  4YY3 Q;  4DV7 L;  3CQZ H;  1EU4 A;  2B2T A;  3L0O A;  1B50 A;  3GTK B;  1LLR D;  3OW7 A;  4X65 L;  2PCF B;  5I6W A;  1YNX A;  3KBX A;  4QUF A;  4BS9 A;  2I0Q A;  3MXP A;  1EY6 A;  4B3S Q;  1S4Z A;  1Y1V B;  4IJL A;  3BDC A;  1F77 A;  4JVZ A;  3R3O A;  2NVY B;  1IW7 D;  3AFP A;  4MNO A;  4OX9 Q;  2A69 C;  3M4O H;  4AYB G;  2RF4 A;  1A15 A;  4JI1 L;  3TEH B;  3E0E A;  3FRP B;  3G6J B;  5KYL A;  1YJW A;  4QCL A;  2Z1C A;  4DAP A;  3H6M A;  1LTL A;  2K33 A;  2ATW A;  3H91 A;  2CWP A;  1Z6H A;  3SK6 A;  2JA7 G;  1KDA A;  3D4R A;  2I5L X;  4O1N A;  1H9R A;  1WD1 A;  2L12 A;  3TQY A;  1EY7 A;  4JI0 L;  1XX8 A;  4DV1 L;  3S16 H;  5IYD G;  3CC7 A;  3L9A X;  1Z7T A;  4FXD A;  1DON A;  3CU7 A;  2SNM A;  4R4T A;  3F2U A;  3A0J A;  5J22 A;  4B9W A;  1KNA A;  4X65 Q;  1RTO A;  2YTX A;  3CCU A;  1B7Y B;  2QW7 A;  3GTO H;  1Y8O B;  1HNX Q;  4C3H G;  4QL5 A;  1A6X A;  4ZAI A;  4PZ8 A;  1CT1 D;  1O7Y A;  1LT6 D;  4PZ6 A;  4CKB A;  3K5M A;  4HIM A;  3N6R A;  3H3V C;  2PQE A;  4A3B H;  4A93 H;  4DV3 Q;  1T5E A;  1TS5 A;  2K5Q A;  4CKC A;  3VYS A;  5ELN A;  2K4K A;  1A63 A;  1SN8 A;  5IYC H;  3HEJ A;  1LTB D;  3AQQ A;  2KCC A;  1AZP A;  1EQT A;  4C3I G;  3J80 c;  1A0I A;  4GLX A;  5JJI A;  5BN3 A;  4QIW E;  3BVM A;  4JI0 Q;  3PO3 H;  4DV1 Q;  1UNS A;  2R61 A;  4AH6 A;  3EBE A;  1D5Z C;  1G2S A;  2EJM A;  4BA1 I;  1JMC A;  1OXV A;  1YJN A;  1L0W A;  3S24 A;  4JOI C;  1U0L A;  1XXG A;  4A3E G;  2B2W A;  1X3G A;  3GTL H;  2PPB C;  2NVX B;  1GUN A;  3D8G A;  3GP7 A;  1GM5 A;  1SFO B;  2O2L D;  4H13 C;  1VQH A;  2G9H D;  4JBJ A;  4ID6 A;  4A3C G;  2BE5 D;  1W6K A;  1NAP A;  5C4J B;  1RDP D;  4JI7 L;  2ZJQ A;  3UDF A;  1F9Q A;  1G8Z D;  1OXX K;  4FF2 A;  1N9W A;  3FVQ A;  1JJC B;  3M3Y B;  1SAP A;  1PYW D;  1SYC A;  1VQC A;  3MZ5 A;  3NBH B;  4K6L A;  1XPR A;  1CSQ A;  3SE0 A;  1PZJ D;  2DNE A;  1YZ6 A;  1L1O A;  4IPG A;  4LFC L;  4R1J A;  2NN6 H;  3S2D B;  3DXJ C;  3C1F A;  5M5X H;  2MPM A;  4LF4 L;  1U4P A;  1X55 A;  1HH2 P;  3PF5 A;  2N49 A;  4XDX A;  2MJ8 A;  4KLK A;  3RLN A;  1QJO A;  4KD4 A;  4EQ5 A;  3H09 A;  3MXG A;  1SYG A;  4DR2 L;  1L0Y B;  2MFI A;  5JVH 3;  1A62 A;  3I4N H;  4JI7 Q;  2VNU D;  2F3I A;  1TR5 A;  4KHZ A;  2EXZ A;  3I91 A;  4IUP A;  4A3D B;  1I6H H;  4LF8 L;  4L5Q A;  4DAM A;  2OQK A;  1STY A;  1QE6 A;  4LK1 C;  5FLX c;  2JP1 A;  3I70 A;  5E4X A;  5E7N A;  4A4I A;  2RQX A;  4IO9 A;  4DR3 L;  2HCC A;  2BH8 A;  1AN8 A;  3SK5 A;  2A19 A;  4PMB A;  3K58 A;  3P7J A;  3GTP H;  2OQ0 A;  1U4L A;  1WD0 A;  2F03 A;  4QY7 A;  4FP5 D;  4YCU A;  1WOC A;  5D65 A;  1HFN A;  1AP0 A;  1WFQ A;  3A5Z B;  1X54 A;  3KLW A;  1WTR A;  3BDO A;  3E9I A;  4UP8 A;  1T5X D;  2Q2T A;  4QMG A;  3TRE A;  3I4M B;  1C7Y A;  2HQL A;  5IGB A;  1FJG L;  4DR2 Q;  1VQK A;  1JT8 A;  3R2T A;  4K5W A;  4HAE A;  4ZQ3 A;  2F0V A;  3GQB A;  2P5Z X;  1SJE D;  3TS0 A;  1YNN C;  1NUC A;  1CQV A;  4EVO A;  4HID A;  1CTM A;  3K7A H;  2A8V A;  3HZX A;  4F87 A;  1G91 A;  2JA6 B;  2RSN A;  2XWJ B;  4DR3 Q;  4RGN A;  3SR1 A;  4ZCK A;  3HKZ B;  2E74 C;  1GUG A;  2R7D A;  4JYA L;  4XXE A;  1B3Q A;  1EFW A;  4IQZ A;  4KY7 A;  1E2W A;  5C3W A;  2J0T D;  3TZD A;  4DNR B;  2QIL A;  5CGK A;  2KED A;  1M1K C;  4HR7 B;  4A3D G;  1CM9 A;  4DV0 Q;  5EBD A;  1PRT D;  2UUA L;  4LF6 L;  4GS3 A;  4C56 C;  2VL6 A;  3H0G B;  2XIW A;  5LMN Q;  4ZUI A;  3KUP A;  2X6L A;  3W1B A;  2B63 G;  1F2L A;  4NMZ A;  2GA4 B;  4A3K H;  3TDQ A;  1X6O A;  1SSO A;  2WKD A;  4DNI A;  1HHV A;  2OCE A;  1EWI A;  1UUP A;  4JI6 L;  3BS1 A;  2X69 A;  3G7L A;  2QGQ A;  1PYB A;  4LFB L;  4S3S A;  2PNR C;  1Q82 C;  2Q8T A;  4E6I A;  2L0C A;  3Q8D A;  4ODG A;  2ZT9 C;  1UEB A;  1EWH A;  3EJI A;  4U67 3;  3J7A 5;  4DPG A;  4K0K L;  2KCM A;  3RMH A;  5IGG A;  5TSS A;  4DK6 C;  1B3A A;  3UDX A;  2JA9 A;  3NP8 A;  2EYL A;  2E2H B;  1VQM A;  3E9H A;  1EY9 A;  2ZXP A;  5EGT A;  3S1Q B;  1FNU A;  1I6V C;  2K50 A;  4YWM A;  4C3J H;  4APV A;  1XYI A;  5EPK A;  1LTT D;  1XNR L;  1AH9 A;  1FR3 A;  1ICW A;  5JJK A;  4GKJ L;  1EFI D;  2B2U C;  2WAQ G;  1J8I A;  1W2B A;  2F0H A;  2OTL A;  1MSG A;  1SMX A;  3I72 A;  2UUA Q;  2OEO A;  4LF6 Q;  4JC0 A;  5KGU A;  4JV5 L;  5JPN C;  1B8A A;  4EGV A;  1I94 L;  1J5E L;  1N32 Q;  4ZKB B;  4JI6 Q;  1GUW A;  3DWA A;  3NTK A;  2SEB D;  1HPC A;  1NNX A;  3I55 A;  4LFB Q;  1XPO A;  2PI2 E;  3S17 H;  2A6E C;  1V1O A;  1SNQ A;  3JC6 6;  2YTV A;  4A3L H;  4HIK A;  3HOX H;  2R93 B;  2K5H A;  2A68 C;  1B9N A;  5ISR A;  2PI2 A;  4RGO S;  1PTO H;  4K0K Q;  3HRZ C;  5I9O A;  3MC0 B;  1IYU A;  1H9S B;  1PH4 A;  1EY8 A;  2XTI A;  1KRS A;  4YWK A;  1LAB A;  5FJ8 H;  3MFY A;  3KLS A;  4ZKC B;  2B2T C;  4O42 A;  4BBS B;  1FD7 D;  2A74 C;  1S40 A;  1FGU A;  4UY8 C;  1XNR Q;  4N8F A;  1U4M A;  2PMZ B;  1ZYR D;  3UDI A;  2VZA A;  1NE3 A;  2FFK B;  4RCN A;  1JOR A;  1I4X A;  5LL6 S;  4V19 0;  4JV5 Q;  2B2Y C;  1F9S A;  1I94 Q;  3T51 B;  1Y1W B;  2BA0 A;  1IBL L;  4QB4 A;  2RDF A;  1PH8 A;  5HGT A;  2JA5 H;  2L9H A;  2C5C A;  4FF4 A;  1K9M C;  1VF5 C;  5JPM C;  3J80 E;  4JBW A;  4LAA A;  1SYB A;  1AW7 A;  3J81 i;  3GTJ B;  3TRZ A;  3S14 B;  2BCO A;  1FGB D;  5FKA C;  1IBK L;  1OO9 B;  1YNJ D;  1TWG B;  5KYI A;  2JA8 B;  1PH6 A;  1QNK A;  1LM0 A;  4OWX B;  3HOY G;  2HUG A;  1WTH A;  3NSW A;  4DK0 A;  5JEA G;  2HIV A;  3QB3 A;  5IYB H;  1B1Z A;  4OO1 G;  3UI2 A;  1LAC A;  2NYZ D;  4JI4 Q;  3GV6 A;  1TU2 B;  2VB3 X;  5M9O A;  1DZ1 A;  2DJF C;  4B08 A;  4DAY A;  4MTK A;  3PSI A;  1EIY B;  1TVX A;  4LNQ A;  3KLS X;  2R93 G;  1Y8P B;  4ALP A;  1RKN A;  3G6E A;  1WTV A;  1IBL Q;  2WAQ E;  5D3I B;  3FMC A;  2Z9H A;  1KDC A;  4ZUJ A;  1IBM L;  2IW3 A;  4NXM Q;  2Q8I B;  2K6A A;  1Q1E A;  2QF7 A;  1PXU A;  3X3N A;  2XSC A;  4K5X A;  5CYU A;  3J7Z C;  2EIF A;  4DKA C;  3R93 A;  1OTC A;  5M3M H;  4L5S A;  1GD7 A;  4IPC A;  1E1O A;  1F9P A;  5FK9 C;  1JE4 A;  3CPW A;  4BXX H;  1E3P A;  2EYH A;  1X3F A;  1I5F A;  3S1N B;  2BDN A;  4RA8 A;  4CKE A;  1I50 H;  3ULL A;  5M3F H;  3PO2 B;  3D6W A;  2B2W C;  3IL8 A;  1LTS D;  1NJI C;  1DYQ A;  2DY7 A;  4IPD A;  1UEA B;  1O7I A;  4YCW A;  4OO1 I;  3S2H H;  2MQH A;  1MI2 A;  2R7Z B;  5BN5 A;  4L5T A;  2VUM B;  2NVT B;  4RFB A;  1BO0 A;  2JA8 G;  5G3L F;  5FLX E;  4DR5 L;  1VQD A;  5EJW A;  4DV5 L;  4QF4 A;  1ESF A;  2K5V A;  4J6H A;  1IBM Q;  2EJF C;  2F0D A;  5IT9 L;  3HOV H;  2IX3 A;  2V1C C;  1CA5 A;  3C3L A;  1FNV A;  5ELE A;  1HZ9 A;  2NBF A;  2IHF A;  1FL0 A;  5A2Q E;  4A3F B;  5FLM H;  1WCM G;  4XTC S;  3FKI B;  2CW0 D;  1P16 A;  3OSO A;  2Z4H A;  2A1A A;  4DNT B;  4LWC A;  4AQY L;  3RLO A;  1AZQ A;  3T1H L;  1SBB B;  1PTO D;  4TVA B;  4POG A;  1TWA H;  1KIX A;  1VF7 A;  2KBN A;  1JJG A;  3VR3 A;  2F0I A;  4QIW B;  1QB5 D;  4L5R C;  5EKK A;  4DR5 Q;  1VQF A;  4KJO A;  3TN2 A;  1EIH A;  4DV5 Q;  1AE3 A;  2RBM A;  1LO5 D;  3DLL A;  4J8Q A;  5D14 A;  1SYD A;  4FF1 A;  3PO2 G;  2B8F A;  4OGQ C;  1BCP C;  1Q86 C;  3J81 j;  1HA5 A;  3IFT A;  5COR A;  5F2D A;  2ZM6 L;  2HHH L;  4ILW A;  2EJG C;  5E3F A;  4ABN A;  2WV6 D;  1H9S A;  3ZYY X;  2R7Z G;  1WJJ A;  2VS1 A;  2VUM G;  5C4X G;  4AQY Q;  4A3J H;  5C3E H;  4H7B A;  3NEL A;  4JPB W;  2LKV A;  3RNU A;  1L1O B;  3AYH B;  3K5L A;  3U58 A;  3AMU A;  2XWB B;  3BU2 A;  2HT1 A;  1PH2 A;  5NUC A;  3MXU A;  1YVC A;  4K8I A;  3J81 c;  1HQR D;  2LS0 1;  2JA7 B;  2KUM A;  4A3F G;  4DA2 A;  3M4Q A;  4L6T B;  1K0R A;  1XMO L;  1I3Q H;  2K03 A;  2SOB A;  5T1I A;  5COY A;  4NP5 A;  5DNF A;  3CRL C;  1ET9 A;  2AUK A;  4KKU A;  5EPL A;  2ZM6 Q;  4JG2 A;  1H9J A;  1A3V A;  1HNW L;  4TSS A;  4TRD A;  2A68 D;  3SXH A;  3NWT A;  3PUW A;  2JEB I;  2HIX A;  2WKC A;  4UDU C;  4A3M H;  2JK8 A;  2EYF A;  1BQQ T;  4PZ7 A;  2WII B;  3AU7 A;  3K7U C;  2JN4 A;  3LX0 A;  2EYP A;  3PGZ A;  4I7Z C;  3CCS A;  4C3H B;  1BVS A;  5BN4 A;  1R9T B;  4TKO B;  4PV1 C;  3CCJ A;  1X3E A;  3G71 A;  1VQL A;  5ELF A;  4B3M Q;  5KNC A;  4F7X A;  1EY4 A;  3HOU G;  4ZLT F;  2F4V L;  1FNW A;  3HOZ G;  1RTN A;  4BBR H;  3ERO A;  2IX0 A;  1IXR A;  5HY6 A;  3WOF A;  2QEX A;  3W5O A;  3JAM E;  2RSO A;  4OEM B;  2M9V A;  2VXW A;  3KF6 A;  3Q24 A;  5FO9 B;  4C3I B;  4OL7 A;  1EZ6 A;  4LFA Q;  1G6P A;  1XMO Q;  2H4O A;  3DMU A;  4GOP A;  2I5M X;  4P72 A;  1VMC A;  4IJH A;  1HRJ A;  1GHJ A;  2G5D A;  4X3K A;  2KVM A;  1K28 A;  2E5L L;  3HKS A;  4PQX A;  4KI0 A;  1Q90 A;  4A3E B;  3CKI B;  2JQO A;  1HNW Q;  2F0U A;  1EEI D;  3PUY A;  1P8L A;  4LJZ C;  4NKL A;  1PRT F;  1S3O A;  3S9W A;  3GTK H;  5M5Y B;  1L2F A;  1PLF A;  1SR3 A;  1UE7 A;  4PMC A;  4RAU C;  2F52 A;  4EQO A;  4N9P A;  1Y1V H;  2GVA A;  4DUZ L;  2HCI A;  3K57 A;  2NVY H;  4KN4 C;  4FVM A;  2KHI A;  2KCN A;  1U9R A;  3RZD B;  4DV7 Q;  2F4V Q;  1O80 A;  3CHB D;  1CKN A;  4XQJ A;  3TP8 A;  1C8C A;  3KLR A;  1RL2 A;  4CDE C;  2NZ1 D;  1F2M A;  4XT3 B;  1TS2 A;  2EDG A;  3MAQ A;  4A3C H;  2AQ2 B;  4MN3 A;  1ZXT A;  2CQA A;  3U4V A;  3VR5 A;  2AHO B;  5DLQ E;  4A93 B;  2F0T A;  1SE4 A;  3VDY A;  3OMG A;  4DV4 L;  1CI3 M;  2MHV A;  4YCV A;  5E4W C;  4JI1 Q;  1SE8 A;  2DGY A;  2PO4 A;  3FP9 A;  5AFW A;  1D7Q A;  4KMU C;  3GTM B;  4I65 A;  3CME A;  2B2V A;  1FVI A;  2DNC A;  3FHW A;  4QUC A;  5C5L A;  3CF5 A;  1YHB A;  2K14 A;  4DR1 L;  1IZ6 A;  1G2T A; 
#chains in the Genus database with same CATH homology
 3SDZ A;  1QIL A;  2A6H C;  5IOC A;  5I6Y A;  4ZRZ A;  2KQ3 A;  5C0X H;  3MFG A;  4WRD A;  2E2I B;  4FXG C;  2PYK A;  2F0M A;  3U9O A;  1DD2 A;  4RGT A;  2XN9 C;  3NUC A;  3SK4 A;  5CV4 A;  3NHH A;  1CZW A;  2E2J B;  4WFN 3;  4H0L C;  1BOS A;  3NPP A;  4KY6 A;  3A7A B;  1I4Q A;  4A3G B;  4R8I A;  3FEW X;  1SNM A;  4C2M B;  5IOD A;  1W6J A;  1SMY C;  4X3S A;  3IKJ A;  3A55 A;  4HMI A;  3WOE A;  4Y7N B;  3D3R A;  5EBC A;  3FPP A;  3NK9 A;  2FMC A;  4B9X A;  4IFD H;  1I6H B;  2PZT A;  1PDQ A;  2PZW A;  1O7Z A;  2EY6 A;  4KHV A;  1STH A;  2B63 B;  1ZKO A;  2F3V A;  2PW7 A;  5JJZ A;  1WTP A;  2HQE A;  3T53 B;  2KOL A;  2CVR A;  3S15 B;  4CJ2 C;  3OIP A;  1ROD A;  4GZY C;  1RJT A;  4DN4 M;  4DXF A;  3T16 A;  2SNS A;  4L8J A;  3T4A C;  1A3T A;  2K32 A;  3BYY B;  4PMW A;  1SND A;  2KA7 A;  3GTG B;  4K8J A;  2NN6 G;  2WAQ B;  1KNE A;  4Q0F A;  3OWE B;  1M4V A;  2XVS A;  1EL0 A;  1SYE A;  1DJR D;  1TS3 A;  3EQL C;  3J81 E;  3E0J A;  3E6Z X;  4IN3 A;  1ENA A;  5C3X A;  5DM7 3;  1EYC A;  1O78 A;  3S1R B;  2CHB D;  4TQU S;  5JOB A;  3C46 A;  2C9O A;  1JOK A;  3IFD A;  1B9M A;  1HFG A;  4A3K B;  1PFN A;  3T56 B;  1GUO A;  1IKL A;  2J4X A;  1MGS A;  1DOL A;  1HQM C;  2EPB A;  2A69 D;  3TP5 A;  2LMC B;  4K6D A;  4RHR A;  2F0L A;  2NN6 I;  3D6C A;  1B44 D;  2LY7 A;  1LTI D;  1HUM A;  3NXW A;  2JSO A;  4HSV A;  1LTR D;  3OOC A;  4HSP A;  5KRU A;  3SVM A;  3J80 L;  4HCE A;  3P75 A;  2RDG A;  3HOY B;  1BXT A;  1SE3 A;  5FOB B;  5CR3 A;  2EY5 A;  2YYZ A;  3BVZ A;  3VR2 A;  3S17 B;  3HP3 A;  4G57 A;  1U4R A;  1AEX A;  4Z9C B;  5JAV A;  1Q3L A;  1Y8N B;  1OXU A;  4HED A;  4UAI A;  1EYA A;  1UAP A;  3VYT A;  3TSS A;  3LWU A;  5ELB A;  3TME A;  1D5X C;  5CBA E;  3N52 A;  1STG A;  4L63 B;  4IUV A;  2K1B A;  4NDX A;  3V05 A;  3OHX C;  4EQP A;  4OHJ A;  2K5W A;  4KJN A;  1TY0 A;  3SK8 A;  4RWS C;  2IWH A;  1KLG D;  4C3J G;  3NTH A;  5DM6 3;  1ENF A;  4CHT B;  3I8Z A;  2F0J A;  5DEH A;  1S5E D;  4WJW A;  5LL6 X;  1VDZ A;  1EYD A;  3I3C A;  2F0O A;  1CHQ D;  3QG1 A;  1F9R A;  4LMQ D;  1RF2 D;  2IPK D;  3MWY W;  1WTQ A;  5FLX L;  1QG7 A;  4WOR A;  4M8A A;  3NE5 B;  1WCM B;  3KBG A;  5HUR A;  3KF8 A;  4P2C B;  4XQQ A;  5IIF A;  1CK1 A;  1F2Z A;  5A2Q L;  2ICI A;  1H9M A;  1S5F D;  4RKB A;  2EVB A;  3CRK C;  3D31 A;  5M5W B;  3GV3 A;  2IX1 A;  2XNA C;  1E0B A;  1OXT A;  2WAC A;  4JK1 C;  1HUN A;  3Q6S A;  1K8M A;  3WDN A;  2H1E A;  5DAU A;  1I50 B;  4RCO A;  3NBI A;  2EYO A;  5C6A A;  1TWH B;  3RZO B;  4KKT A;  1S5D D;  4YIJ A;  4RHS A;  1BDO A;  5C4X B;  2FJ2 A;  4IUT A;  2JXM B;  3VR4 A;  1JIC A;  1SE2 A;  4XIG S;  2Z4I A;  3DUZ A;  1SNC A;  5C5M A;  3V2T A;  1YNN D;  3QOJ A;  1SJH D;  2TSS A;  1JB3 A;  3QO2 A;  3S1M B;  2NB0 A;  3HS0 C;  1STE A;  1X32 A;  1PMR A;  4HTH A;  1PZI D;  2BE5 C;  4M1U B;  5EKI A;  1HTL D;  2NWG A;  3HGB A;  5K36 H;  4XT1 B;  2EOT A;  1KAB A;  1D1K A;  1NCV A;  1LT3 D;  5C4H A;  5KND A;  2ZXR A;  2HDL A;  3PUV A;  1IHZ A;  3HOU B;  3HOZ B;  1TY2 A;  1HA6 A;  3ND9 A;  3R8B A;  3W2D A;  4XYO A;  1Y69 U;  3K0Y A;  1ENC A;  4KTA A;  5I2X A;  3DWP A;  2N55 A;  2R6G A;  2VB2 X;  4K5V A;  1E2Z A;  1IKM A;  3LNN A;  1E2V A;  1JOO A;  3A8K E;  4IUQ A;  2L11 A;  3K5O A;  3GTQ B;  2F0N A;  1EZ8 A;  2FMM A;  3H94 A;  1LV9 A;  3LWE A;  4ZYS A;  1NR4 A;  4K2L A;  3DEP A;  2M00 A;  2A6E D;  2V4D A;  3EFX D;  3L3O C;  4CJ1 B;  1ILQ A;  5IGE A;  2B2U A;  4A3M B;  3P1H A;  3PUX A;  2KEE A;  1VCI A;  4IUU A;  3BDL A;  4DU9 A;  1GHK A;  3VYR A;  1I4G A;  4Q5V A;  2NVQ B;  4BA2 I;  3CQZ B;  1ILP A;  4XQN A;  1Q1B A;  1GUT A;  5FO7 B;  2EE1 A;  1Q8I A;  1L0X B;  1JWM D;  4FXK C;  1JWS D;  5I4D A;  2Z8L A;  2K5D A;  1H9K A;  3M4O B;  4DF7 A;  1PRT C;  2JYO A;  4J1M A;  3PMF A;  2IL8 A;  2L1B A;  3BG3 A;  2JE6 I;  2KEC A;  3EVQ A;  3A8J E;  1TQO A;  2B2Y A;  3DM1 A;  2F0K A;  1LT5 D;  3S16 B;  3DHQ A;  2BDO A;  2ICE C;  2OT2 A;  2PW5 A;  4MIU A;  1ZEQ X;  4RH6 A;  2EY1 A;  4FNF A;  2E2D C;  2F1M A;  4KKS A;  2I46 A;  3GTO B;  2NTS A;  4F8M A;  4DAV A;  1TII D;  4F88 A;  2F0P A;  4CJ0 B;  1TS4 A;  3Q22 A;  4A3B B;  4G7O C;  2A5H A;  1XWE A;  2OXP A;  5CV6 A;  3QIA A;  3O13 A;  3VYU A;  3GO5 A;  1GOZ A;  1V8Q A;  1A2U A;  1LTA D;  2EYM A;  1TKW B;  2D62 A;  1PRT B;  4RGM A;  2BA1 A;  3PO3 B;  1KAA A;  2NUC A;  1G29 1;  3GTL B;  3GD7 A;  4ZK9 B;  1SXT A;  1MBY A;  1RCV D;  3A8I E;  5G3L D;  1XTC D;  4DK1 A;  1KDB A;  2QDB A;  3T13 A;  2O4X A;  1ZYR C;  1SEB D;  1R4P B;  2F0G A;  1HXY D;  1S5C D;  5K5P A;  2K05 A;  2ID0 A;  4A3I B;  1MSH A;  4RKL A;  5ELD A;  3MHB A;  1STA A;  5KNB A;  4G7H C;  1WTX A;  2RVL A;  3OIQ A;  1IYV A;  5M5X B;  2PZU A;  1ONL A;  1NR2 A;  2FIN B;  2K28 A;  1YNJ C;  3I73 A;  1DM0 B;  3M7N A;  3M85 A;  2IT1 A;  4KK7 A;  3DWQ A;  1A2T A;  5IGF A;  4FF3 A;  1JC7 A;  3I4N B;  5D3D A;  3J81 L;  1G6Z A;  1BCP D;  5I2Y A;  2L4N A;  3M7G A;  1D5M C;  2XRS D;  1A3U A;  1FYC A;  3ND8 A;  2ENB A;  5CBE E;  5C0X G;  3MA2 B;  3NQI A;  1V1P A;  1SNO A;  1X3P A;  1Z47 A;  3GTP B;  3NQT A;  5IGD A;  1AFP A;  3MTS A;  4U68 A;  1PFB A;  1B53 A;  2F0E A;  1KLU D;  2FHT A;  2O5I C;  2F0W A;  1CFM A;  5C0X J;  3K59 A;  3OWF A;  1TWF B;  4XYQ A;  3ITP A;  4X3T A;  3QOL A;  3A7L A;  4X3U A;  3K7A B;  5IGC A;  5EPJ A;  1BUV T;  1DCZ A;  5C44 B;  1WTO A;  3U9S A;  2I07 B;  4ULL A;  2DN8 A;  3TBI B;  3SHL A;  5C0X I;  4IFD G;  1QNU A;  4N9T A;  5EKL A;  2SDF A;  4EQN A;  2CW0 C;  3I4L A;  2X6G A;  1ML0 D;  3PV0 A;  4NW2 A;  5ELC A;  4G4K A;  1PTO C;  5EQ0 A;  1EIG A;  1SDF A;  1PTO F;  3TP6 A;  1Q12 A;  2F0F A;  2F0Q A;  2LFN A;  4BY1 B;  4IFD J;  2B8G A;  1QWY A;  4IUR A;  3PIP 3;  2WIN B;  1S5B D;  4R9W A;  4IZ8 A;  4KY5 A;  1BBX C;  2E75 C;  2N88 A;  5CC4 A;  3EA6 A;  4C3J B;  3W3A A;  3QWN A;  1CZG A;  2AWO A;  1OXS C;  3MXN A;  1PFM A;  5CMD A;  4IFD I;  4K14 A;  4HN7 A;  4OIK A;  2YU9 B;  1WVL A;  3P20 A;  3BVG A;  3X3M A;  2TMP A;  1HTP A;  3IAY A;  2OF1 A;  3HOX B;  4FYD A;  3OPO A;  1PTO B;  1HCZ A;  5JEA H;  3R2I A;  2WB1 B;  3HOW B;  2AQ1 B;  4OO1 H;  1MD2 D;  4DGZ A;  3Q23 A;  3QJY A;  5I9P A;  1EQV A;  3FDT A;  4CBV A;  3KK7 A;  1QCB D;  1D2B A;  4DFA A;  2K7V A;  1QOH A;  3NBH A;  4BWG B;  1JCK B;  2A6H D;  1DXM A;  2BOS A;  2JA5 B;  5FO8 B;  1X3Q A;  2AWN A;  2R3Z A;  2NTT A;  2A73 B;  5KEE A;  5A35 A;  3VA7 A;  3PIO 3;  3Q0A A;  4G7Z C;  1LTG D;  4BY7 B;  2ZXO A;  2AUJ D;  1GJX A;  2XRQ D;  1JR0 D;  3J7A V;  1IW7 C;  1I4R A;  1SNP A;  2EY2 A;  4C1N I;  2E76 C;  1JOQ A;  3ONA B;  3L7Z C;  1WTW A;  3RD4 A;  3K6O A;  1BF4 A;  1SMY D;  2HDM A;  5J39 A;  2MUY A;  1EOT A;  2JEA I;  3C2P A;  1B2T A;  2RA4 A;  2RDH A;  3VA5 A;  5CV9 A;  1BNZ A;  5M3M B;  2EZV A;  2B2V C;  4KN7 C;  1R4Q B;  3D4D A;  5JEA J;  4PNY A;  2KHS A;  1GUS A;  2QKI C;  5M3F B;  5J1Z A;  4OIJ A;  1EEF D;  1DOK A;  2F3W A;  3C1E A;  2DY8 A;  3J7A F;  3S2H B;  3DEO A;  4IAL A;  2IJ0 A;  1STN A;  1M8A A;  4HMJ A;  3RLF A;  3TP7 A;  3HOV B;  4V0B A;  3ERQ A;  1SYF A;  3A54 A;  5LHY 1;  1RHP A;  1ESR A;  2F0S A;  1EY0 A;  4IUN A;  3VR6 A;  2L5T A;  3SEB A;  3E5S A;  3A56 A;  1CHP D;  4ME5 A;  4R8N A;  4DXG A;  1TWA B;  5KIX A;  1D1I A;  1TT2 A;  5E1F A;  1JWU D;  1D6E C;  2Y0S B;  2L55 A;  3FPU B;  1V43 A;  1K8O A;  1LT4 D;  2QCP X;  1KTK A;  3MEH A;  1TWC B;  3HG9 A;  3J7Y W;  1CQF A;  4H44 C;  1PZK D;  2D5D A;  3URY A;  4KD3 A;  2EYJ A;  3K5N A;  2R92 B;  4HCS A;  2RKS A;  3AB9 A;  4A3J B;  2AQ3 B;  1I4P A;  5C3E B;  3D4W A;  4C1N K;  2J7Z A;  1NSN S;  3JAM L;  1C4Q A;  3RUZ A;  2KJX A;  5CV7 A;  2O5J C;  2M2L A;  1J9O A;  5JVG 3;  1BCP F;  3M4Y A;  3BZD B;  1BR9 A;  1II3 A;  1EU3 A;  4MHE A;  5IT9 E;  3NTI A;  1CA6 A;  2G9D A;  1I4H A;  5C4Z A;  1I3Q B;  1C48 A;  1STB A;  2Q8R E;  4AYB B;  1K83 B;  2QEJ C;  3OMC A;  4FO2 A;  4CGY B;  2K04 A;  1GXD C;  1F2Y A;  5K36 G;  1B4O A;  1IL8 A;  1O7L A;  5CV5 A;  2B39 A;  2D2C C;  3MVV A;  1EY5 A;  2MGS A;  1JQY D;  3V96 A;  1V1P B;  2K01 A;  2WP8 J;  1DOM A;  1RD9 D;  4BBR B;  3TZU A;  1VMP A;  2D9U A;  3BYT B;  3NWS A;  4K2K A;  5T1G A;  1BCP B;  3I90 A;  5CV8 A;  1EWC A;  3PUZ A;  4KV6 A;  2MP1 A;  2F4I A;  1ET6 A;  1EU4 A;  2B2T A;  1B50 A;  3GTK B;  1LLR D;  3OW7 A;  2PCF B;  5I6W A;  3KBX A;  4QUF A;  4BS9 A;  3MXP A;  1EY6 A;  1S4Z A;  1Y1V B;  3BDC A;  1F77 A;  3R3O A;  2NVY B;  1IW7 D;  2A69 C;  1A15 A;  3FRP B;  3G6J B;  5KYL A;  4QCL A;  2Z1C A;  4DAP A;  3H6M A;  2K33 A;  3H91 A;  1Z6H A;  3SK6 A;  1KDA A;  3D4R A;  4O1N A;  1H9R A;  1WD1 A;  2L12 A;  1EY7 A;  1XX8 A;  3L9A X;  1Z7T A;  4FXD A;  1DON A;  3CU7 A;  2SNM A;  3F2U A;  5J22 A;  4B9W A;  1KNA A;  1RTO A;  1Y8O B;  4C3H G;  1A6X A;  4ZAI A;  1CT1 D;  1O7Y A;  1LT6 D;  3K5M A;  4CKB A;  3H3V C;  3N6R A;  2PQE A;  1T5E A;  1TS5 A;  2K5Q A;  4CKC A;  3VYS A;  3HEJ A;  1LTB D;  2KCC A;  1AZP A;  1EQT A;  4C3I G;  5BN3 A;  3BVM A;  1UNS A;  2R61 A;  1D5Z C;  1G2S A;  2EJM A;  4BA1 I;  1OXV A;  1XXG A;  2B2W A;  2PPB C;  2NVX B;  1GUN A;  3D8G A;  3GP7 A;  1SFO B;  2O2L D;  4H13 C;  2G9H D;  4ID6 A;  2BE5 D;  1W6K A;  1NAP A;  5C4J B;  1RDP D;  1F9Q A;  1G8Z D;  1OXX K;  4FF2 A;  3FVQ A;  3M3Y B;  1SAP A;  1PYW D;  1SYC A;  3MZ5 A;  4K6L A;  3SE0 A;  1PZJ D;  2DNE A;  3S2D B;  2NN6 H;  3DXJ C;  3C1F A;  2MPM A;  1U4P A;  4XDX A;  2MJ8 A;  1QJO A;  4KD4 A;  3H09 A;  3MXG A;  1SYG A;  1L0Y B;  5JVH 3;  2VNU D;  1TR5 A;  4KHZ A;  2EXZ A;  3I91 A;  4IUP A;  4A3D B;  1STY A;  1QE6 A;  4LK1 C;  2JP1 A;  3I70 A;  5E4X A;  2RQX A;  2HCC A;  1AN8 A;  3SK5 A;  4PMB A;  3K58 A;  3P7J A;  1U4L A;  1WD0 A;  2F03 A;  4FP5 D;  5D65 A;  1HFN A;  1AP0 A;  1WTR A;  3BDO A;  1T5X D;  4QMG A;  3I4M B;  5IGB A;  3R2T A;  4K5W A;  4HAE A;  4ZQ3 A;  2F0V A;  3GQB A;  1SJE D;  1YNN C;  1NUC A;  1CQV A;  4EVO A;  1CTM A;  3HZX A;  4F87 A;  1G91 A;  2JA6 B;  2RSN A;  2XWJ B;  4RGN A;  3SR1 A;  3HKZ B;  2E74 C;  1GUG A;  4XXE A;  4IQZ A;  4KY7 A;  1E2W A;  5C3W A;  2J0T D;  3TZD A;  4DNR B;  2QIL A;  5CGK A;  2KED A;  4HR7 B;  1CM9 A;  5EBD A;  1PRT D;  4C56 C;  3H0G B;  2XIW A;  4ZUI A;  3KUP A;  2X6L A;  1F2L A;  4NMZ A;  2GA4 B;  3TDQ A;  2WKD A;  1SSO A;  1HHV A;  1UUP A;  3BS1 A;  2X69 A;  3G7L A;  4S3S A;  2PNR C;  2Q8T A;  4E6I A;  2L0C A;  4ODG A;  2ZT9 C;  4U67 3;  1EWH A;  3EJI A;  3RMH A;  5IGG A;  5TSS A;  1B3A A;  3NP8 A;  2EYL A;  2E2H B;  1EY9 A;  2ZXP A;  5EGT A;  3S1Q B;  1FNU A;  1I6V C;  1XYI A;  5EPK A;  1LTT D;  1FR3 A;  1ICW A;  1EFI D;  2B2U C;  1J8I A;  2F0H A;  1MSG A;  3I72 A;  2OEO A;  5KGU A;  5JPN C;  4EGV A;  4ZKB B;  1GUW A;  3DWA A;  3NTK A;  2SEB D;  1HPC A;  2A6E C;  1V1O A;  1SNQ A;  2R93 B;  2A68 C;  1B9N A;  5ISR A;  4RGO S;  1PTO H;  3HRZ C;  5I9O A;  3MC0 B;  1IYU A;  1H9S B;  1EY8 A;  1LAB A;  3MFY A;  3KLS A;  4ZKC B;  2B2T C;  4O42 A;  4BBS B;  1FD7 D;  2A74 C;  1U4M A;  2PMZ B;  1ZYR D;  2FFK B;  4RCN A;  1JOR A;  1I4X A;  5LL6 S;  4V19 0;  2B2Y C;  1F9S A;  3T51 B;  1Y1W B;  2BA0 A;  4QB4 A;  2RDF A;  5HGT A;  2L9H A;  2C5C A;  4FF4 A;  1VF5 C;  5JPM C;  3J80 E;  4JBW A;  4LAA A;  1SYB A;  1AW7 A;  3GTJ B;  3S14 B;  2BCO A;  1FGB D;  5FKA C;  1OO9 B;  1YNJ D;  1TWG B;  5KYI A;  2JA8 B;  1QNK A;  2HUG A;  3NSW A;  4DK0 A;  5JEA G;  3QB3 A;  1B1Z A;  4OO1 G;  3UI2 A;  1LAC A;  2NYZ D;  3GV6 A;  1TU2 B;  2VB3 X;  5M9O A;  1DZ1 A;  4B08 A;  4DAY A;  1TVX A;  3KLS X;  1Y8P B;  1RKN A;  1WTV A;  5D3I B;  3FMC A;  1KDC A;  4ZUJ A;  2IW3 A;  2Q8I B;  2K6A A;  1Q1E A;  2QF7 A;  1PXU A;  3X3N A;  2XSC A;  4K5X A;  5CYU A;  3R93 A;  1F9P A;  5FK9 C;  1JE4 A;  2EYH A;  3S1N B;  2BDN A;  4RA8 A;  4CKE A;  3PO2 B;  3D6W A;  2B2W C;  3IL8 A;  1LTS D;  1DYQ A;  2DY7 A;  1UEA B;  4OO1 I;  1MI2 A;  2R7Z B;  5BN5 A;  2VUM B;  2NVT B;  4RFB A;  1BO0 A;  5G3L F;  5FLX E;  5EJW A;  4QF4 A;  1ESF A;  4J6H A;  2EJF C;  2F0D A;  5IT9 L;  2IX3 A;  1CA5 A;  3C3L A;  1FNV A;  5ELE A;  2NBF A;  5A2Q E;  4A3F B;  4XTC S;  3FKI B;  2CW0 D;  3OSO A;  2Z4H A;  4DNT B;  1AZQ A;  1SBB B;  1PTO D;  1VF7 A;  3VR3 A;  2F0I A;  4QIW B;  1QB5 D;  5EKK A;  4KJO A;  3TN2 A;  1EIH A;  2RBM A;  1LO5 D;  4J8Q A;  5D14 A;  1SYD A;  4FF1 A;  2B8F A;  4OGQ C;  1BCP C;  1HA5 A;  3IFT A;  5COR A;  5F2D A;  4ILW A;  2EJG C;  5E3F A;  4ABN A;  2WV6 D;  1H9S A;  3ZYY X;  4H7B A;  2LKV A;  3K5L A;  3AMU A;  2XWB B;  5NUC A;  3MXU A;  4K8I A;  1HQR D;  2LS0 1;  2JA7 B;  2KUM A;  4DA2 A;  4L6T B;  2K03 A;  2SOB A;  5T1I A;  5COY A;  4NP5 A;  5DNF A;  3CRL C;  1ET9 A;  2AUK A;  4KKU A;  5EPL A;  1H9J A;  1A3V A;  4TSS A;  4TRD A;  2A68 D;  3SXH A;  3NWT A;  3PUW A;  2JEB I;  2WKC A;  4UDU C;  2EYF A;  1BQQ T;  2WII B;  3AU7 A;  3LX0 A;  2EYP A;  4I7Z C;  4C3H B;  5BN4 A;  1R9T B;  4TKO B;  4PV1 C;  5ELF A;  5KNC A;  4F7X A;  1EY4 A;  4ZLT F;  1FNW A;  1RTN A;  3ERO A;  2IX0 A;  3WOF A;  3JAM E;  2RSO A;  2M9V A;  2VXW A;  3Q24 A;  5FO9 B;  4C3I B;  4OL7 A;  1EZ6 A;  2H4O A;  3DMU A;  1VMC A;  1HRJ A;  1GHJ A;  4X3K A;  2KVM A;  4PQX A;  4KI0 A;  1Q90 A;  4A3E B;  3CKI B;  2F0U A;  1EEI D;  3PUY A;  4LJZ C;  4NKL A;  1PRT F;  3S9W A;  5M5Y B;  1PLF A;  4PMC A;  4RAU C;  4EQO A;  4N9P A;  2HCI A;  3K57 A;  4KN4 C;  4FVM A;  2KCN A;  1U9R A;  3RZD B;  1O80 A;  3CHB D;  4XQJ A;  3TP8 A;  1C8C A;  3KLR A;  2NZ1 D;  1F2M A;  4XT3 B;  1TS2 A;  2EDG A;  3MAQ A;  2AQ2 B;  4MN3 A;  1ZXT A;  2CQA A;  3VR5 A;  4A93 B;  2F0T A;  1SE4 A;  3OMG A;  1CI3 M;  2MHV A;  5E4W C;  2PO4 A;  5AFW A;  4KMU C;  3GTM B;  4I65 A;  2B2V A;  2DNC A;  5C5L A;  4QUC A;  1G2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...