1G2TA

Solution structure of eotaxin-3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EOTAXIN-3
publication title NMR solution structure and backbone dynamics of the CC chemokine eotaxin-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g2tA00
1EIHA 3Q6SA 4X3SA 5DNFA 1G6ZA 1WTQA 1BO0A 2DY8A 4UAIA 1ILQA 4HSVA 4ZK9B 1NAPA 4RAUC 2NZ1D 4IUUA 1ZXTA 4CJ1B 4X3KA 1B4OA 5CBEE 1GUWA 1SAPA 4IUTA 5AFWA 2XIWA 1EOTA 4CJ0B 2Q8RE 2H1EA 5EKIA 1PFBA 3R93A 4DN4M 2K03A 3ONAB 1LV9A 3I3CA 1IKMA 4RWSC 4HCSA 2B2VA 1HUMA 1F9RA 5COYA 5D65A 4RA8A 2NWGA 4IURA 2MPMA 1JE4A 1DOMA 1J9OA 2K1BA 2B2YC 3DM1A 1RODA 2BDNA 4MN3A 5T1GA 3SVMA 1EIGA 1E0BA 2JYOA 4XDXA 1B50A 4ZKBB 1F9SA 1RJTA 1G2SA 1F9PA 1SDFA 2HCCA 1DOKA 2HDMA 1VMPA 2L4NA 1RTOA 1TVXA 3G7LA 5E4XA 1MSHA 1CM9A 2K01A 2DY7A 2FFKB 1U4MA 2FHTA 3N52A 5D14A 1O7YA 2FJ2A 1BBXC 3QO2A 1IL8A 2JP1A 2HUGA 1CA5A 1NR2A 1HRJA 2EE1A 2B2YA 3UI2A 1BF4A 1QG7A 1RHPA 3P7JA 1AP0A 2SDFA 1DONA 2N88A 4XT1B 5EPJA 2N55A 2EPBA 1PFNA 3I91A 1U4LA 2K04A 4IUQA 1WTVA 3GV6A 1ICWA 2CVRA 2Q8TA 4LMQD 1J8IA 2RVLA 3KBXA 5CMDA 2MP1A 2RSNA 3DEPA 2IL8A 2X69A 3FDTA 5EPKA 1QNKA 2K05A 1IKLA 4QUCA 1KNEA 2X6GA 3IL8A 2B2WC 2FINB 1X3QA 2L9HA 2HCIA 2KEDA 3F2UA 1WTXA 4HAEA 1DZ1A 1U4RA 2B2UC 1KNAA 1QE6A 1JICA 1U4PA 4XT3B 5T1IA 1HHVA 1PDQA 5EPLA 5CBAE 2L12A 1XX8A 2KEEA 4NW2A 3DEOA 3GV3A 1AZPA 4ZKCB 1G91A 1Q3LA 2MGSA 1A15A 1EL0A 3FPUB 2MJ8A 4OIKA 4O42A 1WTRA 1WTPA 1B3AA 4QUFA 1AZQA 5EQ0A 2EOTA 4CJ2C 1VMCA 5JJZA 1RTNA 1ESRA 2R3ZA 1WD1A 1HFNA 4R8IA 2J7ZA 1HUNA 1MGSA 3KUPA 1NR4A 2B2TC 1NCVA 4OIJA 5E4WC 2B2UA 1O80A 1WTOA 2M2LA 5CORA 1B53A 2KOLA 3D6WA 3MWYW 2L1BA 2L11A 1BNZA 2HDLA 1F2LA 3MTSA 2KUMA 1MI2A 1G2TA 1O7ZA 2D9UA 4HEDA 1WD0A 1CA6A 1M8AA 1XYIA 2X6LA 1X3PA 1ML0D 2RA4A 1PLFA 1WVLA 1HA6A 2RSOA 3HP3A 1DOLA 3LWEA 3I90A 1HFGA 2B2TA 1S4ZA 4R9WA 4ZLTF 4MHEA 1SSOA 3TN2A 2KVMA 5EJWA 2FMMA 4X3UA 2KECA 1F9QA 1X32A 3H91A 1WTWA 2NYZD 4ZAIA 4IUPA 2K28A 1EQTA 2B2WA 4X3TA 3I8ZA 1C8CA 1MSGA 1ILPA 1B2TA 2B2VC 4U68A 2VXWA 4IUVA 3IFDA 3TZDA 1PFMA
chains in the Genus database with same CATH superfamily
1EIHA 1SE3A 3HKZE 2MFIA 4YCUA 5DNFA 3HKZG 4CBVA 1ILQA 4GZYC 4EQ5A 1ZXTA 1GOZA 1QZHA 2EY5A 1SLJA 3D6CA 2YU9H 1MKHA 3AB9A 3DMUA 3OSOA 3ULLA 1JWMD 1A63A 3QR8A 1L1OC 1U9RA 5TSSA 5FLMG 1HUMA 1TY2A 4A3IH 4JPBW 1LTBD 3K7AB 3OIPA 1JE4A 3RD4A 2OTJA 2K5QA 4C2MB 1AEXA 2F0HA 5E3FA 3HOUG 2VB2X 1V9PA 4UP8A 1F9PA 2B8FA 1JJ2A 1PTOH 2Z9HA 3BVZA 4CDDC 1Q8KA 2OXPA 4UDUC 1U4MA 2VL6A 3CCEA 1XMQQ 1U5KA 3NQIA 5JEAG 4Y7NH 1C4QA 3R8BA 1YHAA 3D4RA 3CCQA 3BZDB 3GDEA 5IGCA 2JE6I 4ME3A 2IL8A 2XRQD 3T1HQ 1QNKA 1NTGA 4QUCA 1KNEA 1NMFA 5C3XA 3X3NA 1WTXA 3PUZA 1TWFB 4HAEA 5IODA 4CHTB 1U4PA 2A6EC 1BCPB 3CF5A 1PTOD 5HY6A 3C1EA 3DXJC 2JA7B 3DEOA 2F0IA 4ZKCB 1KQSA 4KHZA 3ER0A 1VQIA 4X6AH 1U0LA 4A76A 1AZQA 1S5DD 1VMCA 3OHXC 2F3IA 4LJZC 3VA5A 1VQFA 4OWTB 1EWIA 5E4WC 4DV4Q 5AJ3L 3HOVH 1H9SA 3I4MB 4DK0A 4A3LG 4FF1A 3MVVA 3NWSA 1MI2A 4BS9A 4NKLA 4WJ4A 4A3BG 4BY1B 3NUCA 2R93B 2UUCQ 2FXQA 3HP3A 2I07B 4X3UA 3CXCA 4DR1L 4CKCA 1ZYRC 4OO1G 2E8GA 5M3FH 5LMUL 2A8VA 2B2VC 1FR3A 3IFDA 1G291 1JORA 4R8NA 3NP8A 3TEHB 2DY8A 1N33Q 3JC66 3KLSX 3T53B 3KJPA 3QOJA 4LFAQ 1STNA 4IUTA 2L15A 2XIWA 3QOLA 4CJ0B 3D0FA 4N8FA 2Z4HA 4BBRG 5DEHA 1SXTA 3R3OA 3IKJA 1RODA 1TWCB 3K5MA 4B3RQ 1PV4A 1F9SA 1QOHA 4KK7A 4RGTA 3UDGA 1YJNA 4DFAA 2JEBI 4GOPB 1Z7TA 1TY0A 1Q82C 1X9NA 5JEAJ 2F0GA 2XWJB 1V1OA 2JP1A 2EE1A 3RUZA 1PH2A 1ASZA 2BCOA 4JI8L 1PH1A 2HQEA 3I91A 5ELEA 3GV6A 3P1HA 2MP1A 3ZJYC 2G9HD 2WINB 2KEDA 1LT3D 1CFMA 1YHQA 5C4ZA 3RLFA 1AE3A 2F0FA 2CH4A 2OT2A 2JA7G 4JI1L 5CV5A 4ZYSA 4DNIA 2MNAA 5BN3A 1I6VC 2EOTA 4UHVA 4DAYA 3KFUA 1HA5A 4JI7L 3FRPB 3CCUA 2HHHL 4EQNA 3E3XA 1K3BC 4DK6C 3UE1A 5IGDA 3I4MG 4OWXB 1NSNS 3M4PA 3Q0AA 1W3SA 1VQLA 4NXMQ 4LAAA 4HN7A 3F1ZA 3HOYH 3VYRA 1SYFA 2F3VA 4L63B 3EIVA 5EKKA 4BY1G 1QVCA 1D1KA 1TS2A 3J80E 2R93G 3V96A 1TWGB 3HOUH 3GTOH 2FMMA 3GTPB 1X32A 3AFPA 1FJGL 1ENAA 4TSSA 4POFA 3W1GA 2K5DA 2K50A 3A7AB 4K2KA 5JEAH 1NAPA 1IBKL 1VQCA 4C3IB 1GUWA 3KDFA 4UP7A 3PUVA 3A8IE 4O0AA 5AFWA 3S1NH 2JEAI 3J81j 1IKMA 4ULLA 4UPAA 1UAPA 3K57A 3AMUA 3HZXA 4RA8A 3W1BA 2VQFQ 3L0OA 3DWQA 3MEHA 3CP0A 3MXNB 3I2ZA 1PH3A 1S40A 3B6YA 3HFZB 2CKZB 2A6HD 1SFOB 4IQZA 1D6EC 1VMPA 5M3MB 4QY7A 3FEWX 3L9AX 3JAMc 2G5DA 2EJGC 1SR3A 2O5JC 4JI6Q 1WCMG 4L6TB 1JC7A 5IYCG 1HNZQ 4DNTB 3MHBA 1BF4A 3P7JA 2I5LX 1EWHA 5A2QE 4A3KH 1DONA 4A3LH 1B9MA 4V190 1GHJA 2WFWA 1Q86C 4IPDA 4DF7A 3GTLH 3VYUA 3NQTA 2Q2HA 1HZAA 4DR3L 1QNUA 1TIID 4ID6A 4E6IA 4A3BH 1PH4A 1K73C 2ZJRA 1G8ZD 1FYCA 2BOSA 4A93H 3VR4A 3BVGA 1X65A 1HHVA 1VQ9A 3S2HB 3I7FA 2KCNA 4NW2A 3BG3A 3D4WA 2RHSB 5EQ0A 2F0LA 1Y1WH 3S1RH 4C3JG 1DM0B 1WD1A 2J7ZA 5IYBG 2H5XA 5M9OA 4FF4A 1SE2A 3TBIB 3CCMA 2F0WA 2M2LA 1A0IA 1KDCA 4DUZL 1VQAA 2BA1A 2EYHA 2OQKA 5FKAC 4A3GB 1HR0W 4BBRH 4HIOA 1WD0A 1CI3M 1EY6A 2GVBA 1MJCA 3M7NA 1EU3A 5FLXc 2IW3A 1I3QB 4YIJA 2JSOA 4F88A 4FYDA 4BBSB 4A3JB 2JA6B 1BUVT 5HGTA 3BYYB 4CDEC 5LHY1 1STBA 3H09A 1YVCA 4LFCL 2RDGA 2R7FA 5C0XG 1I5FA 4YWMA 5JVH3 1HNWL 4K5XA 3TZDA 4C3HB 1MIUA 3OOCA 4V0BA 1V1PA 4X66Q 4IUUA 5EKLA 3MEFA 4HMJA 4Q0FA 4X64L 1O7IA 4DK1A 2KCTA 1AN8A 4DXFA 4DAYB 1PRTB 1HXYD 2H1EA 5EKIA 3ONAB 4NXNL 1X3FA 3CKIB 1OXXK 1EY9A 4LUVA 3VR2A 3A8JE 2NWGA 2MPMA 2UXBL 2PCFB 4X65L 1PHJA 4K0KQ 1YI2A 4DUYQ 3W2DA 1JB7A 3G6EA 5M3MG 2L4NA 1T5XD 2QDBA 2ICEC 4DR7L 2EYMA 4QF4A 1STEA 1S3OA 5D14A 3S17B 4L5SA 2C35B 3BZKA 4RFBA 1DYQA 1CKMA 5I6WA 5L37A 2NVTH 3WOEA 1I4XA 3NBIA 4DV3Q 1Z6HA 4AIMA 1PTOC 4KY5A 3KJOA 3LNNA 3KBXA 1KRSA 2QGQA 3DEPA 2X69A 5J3BA 1QB5D 3CCLA 5I2XA 2ZXOA 1RDPD 1IYUA 2ZT9C 2K33A 1ESFA 1H9MA 3QIAA 3S1QH 3M4YA 1JR0D 5CC4A 2R7ZB 1A15A 2K32A 2UUBL 3IAYA 1XJVA 2QCPX 4KHPL 4A4IA 4R8IA 3GTKB 4R4TA 3PQIA 3S16B 1WTOA 2DJFC 5IYDG 1I4RA 3E0JA 1LTGD 1IYVA 3T56B 2D9UA 3RN2A 4HEDA 4JOIC 2X6LA 2UXDQ 2IX3A 2TMPA 3NTIA 2B2TA 4BBSG 4A3JG 2JA6G 4DV0L 2YYZA 4EQOA 3DLLA 2KECA 4Y52H 4GN3B 3OTOQ 2EIFA 4I7AA 4ZAIA 2NZHA 1RF2D 1WCMH 1X55A 5C3EB 1CK1A 2CW0C 4C3HG 1YITA 1G6ZA 3RNUA 5I6YA 3CQZB 2IX1A 3GTQH 1AFPA 4B3TQ 3Q23A 4DR2L 4IFDG 1SAPA 1R9TH 4C1NI 1XPOA 4YWKA 4DXGA 1K83B 5GQOA 3QWNA 4L8JA 4C1NK 4IUNA 4P72A 2OQ0A 1UE1A 3GTJB 2CQOA 3K5OA 4XDXA 1CZGA 2K4KA 4RGMA 4JI4Q 3SHLA 2RF4A 2Z6BA 1MSHA 3GP7A 1IBLQ 1CM9A 4A3MH 2QEJC 2NVQH 2L55A 2M00A 1O7YA 1LTID 3OMGA 3FHWA 4C3JH 5FOBB 4GNXB 4GKJL 2PMZE 4ZQ3A 4NB3A 5D3DA 3JAMi 1FNVA 4OONA 4JBWA 2K04A 3T16A 1MHWC 2Q8TA 3I73A 1EY0A 1EU4A 4B9WA 3U9SA 3G48A 2ES2A 1SN8A 4A3FB 2RDFA 3I56A 4L5RC 5FK9C 2FMCA 1D2BA 1UE5A 2FINB 2IY5B 1XMQL 4IPHA 2E5LQ 4K5VA 2KA7A 3EA6A 4JYAQ 5M5YH 4HJ5A 4B9XA 2BA0A 3CRLC 4OL7A 2K5NA 5IP9H 1A2TA 2D5DA 3L3OC 5C0XH 4O42A 2R7ZG 1T5EA 1EZ6A 3PO3G 3AU7A 3J7YW 3T1HL 2E2HB 1VF7A 2F0MA 4H44C 3RZOH 3BDLA 3G4SA 2F0VA 1WI5A 5I9PA 3NXWA 4FXKC 3FMCA 5M5WH 4K6LA 2QILA 5M5XB 5KYIA 4XQNA 4GKKL 2SOBA 4I65A 3CHBD 2A69D 1K8MA 2NN6G 1VQBA 4LF4Q 3VDYA 1IHZA 4DNRB 2F1MA 1WVLA 2NTSA 2PZUA 3S14B 1IBML 2KVMA 4FXGC 1TR5A 1B3QA 1BOSA 5IT9L 5C4JB 5IGEA 3Q24A 1WTWA 3SK6A 4X3TA 1EQTA 4DV1Q 1B2TA 3E0EA 5C3EG 3JAML 1L1OB 1N9WA 3RMHA 3VR3A 1HZBA 1FVIA 4HSVA 1YEZA 2R92B 1IW7D 2UUCL 4K8JA 1TWHH 4BY7B 3T13A 4KY7A 4HCSA 3J7AV 5ELFA 2MUYA 4DV7Q 1O7LA 2BH8A 3D4DA 4IURA 3MC0B 1OXTA 4HSPA 1N33L 2JJQA 1I4QA 3KF8A 4LFAL 1RTOA 4JK1C 2D0PA 3GTMH 4KKUA 1QVGA 3FKIG 3BS1A 2FHTA 2EY1A 2FJ2A 4FO2A 3QO2A 1EEFD 2AKWB 1M90C 4KLKA 1NY4A 3MXGA 5IYDH 2KQ3A 4B3RL 4GKJQ 2XVSA 3EBEA 3PF5A 3SGIA 1WTVA 4N9TA 3A55A 2PQEA 2GVAA 2XGTA 3OW2A 1VQ5A 5D3IB 3S2DH 4PMCA 1YHBA 1EUJA 1X3QA 1QUQB 5C4HA 5FLXL 3K59A 1KNAA 3HOWG 5JOBA 1HCZA 5EPLA 4JW0A 5F2DA 5IP7G 4P71A 5EBCA 3M4OH 2UU9L 4LUZA 5J39A 3IFTA 1STGA 4XYQA 4QJFA 1II3A 4R4IA 4G7ZC 2VY3A 1PVOA 1RTNA 2R3ZA 4HJ8A 2XNAC 2B2TC 1WOCA 2B2UA 1SE4A 1GXDC 3WWVA 2N3SA 2QEXA 3MTSA 2JA8B 1GKHA 5CR3A 2QA4A 4GKKQ 3AQQA 1HA6A 3LWEA 1EWCA 1N8RC 2O5IC 1VQJA 1E2ZA 1I6HH 3BYTB 1WYDA 5EGTA 1LYLA 4K2LA 2B29A 3RLOA 4IUPA 2PYKA 2NVXH 2D0OA 3SK8A 1IBMQ 3NEMA 4IUVA 4NXML 3TP8A 3J81E 3I4NH 1Y1VB 3TDQA 1N34Q 1PXUA 4EVOA 2R92G 3HOXH 2G9DA 5IGFA 2PW5A 1SYCA 3E9IA 1H9KA 2OTLA 3K0YA 1UEBA 4KD3A 2XSCA 1LV9A 3NBHB 4RCNA 3F8TA 2EYLA 3PV0A 1EIYB 1BBUA 4LF7Q 1J9OA 3DM1A 3E9HA 1WJJA 2DUDA 4R4CA 3H0GH 2UUAQ 4DR4Q 5ISRA 4PMBA 1HTLD 3OWFA 4K8IA 2F0QA 3PO2H 1YBYA 4OX9L 1KC8C 2PQAA 4QL5A 2KCCA 1JJGA 2JK8A 2K52A 1V1QA 4MZ9A 4ZCKA 2QW7A 1TS5A 4R4QA 4OGQC 3NELA 3N52A 3V05A 5FJ8H 2B2YA 1DD2A 4KI0A 1NJIC 2VQFL 2BDOA 1VF5C 1GM5A 1I4GA 2B63B 3NENA 2HT1A 4FNFA 2SNSA 4WJWA 2RQXA 3VR5A 3M3YB 1U4LA 1I50H 1XPUA 3C3LA 3OPOA 3A5UA 1VQDA 4R4OA 1HZ9A 2ZTCA 4G7HC 3S1MH 4DAVA 1SNQA 4JI6L 2B2WC 2KHSA 5KNBA 1HNZL 1KL9A 4BA2I 1LT4D 2KHIA 3I4OA 3CMAA 2WB1B 2CWAA 1Q3LA 5CGKA 2WP8J 4MTNA 1VQKA 1A3UA 3MFYA 1W6KA 2UU9Q 4DV6L 1XNRQ 2E2IB 3A54A 1GUNA 1KAAA 1NMGA 4GLXA 3ICEA 1EYDA 2HD3A 4H13C 5CV9A 2NVYB 5C5LA 3AYHB 3RN5A 2HDLA 5CYUA 5ELOA 3GO5A 2RCNA 2JA8G 1O7ZA 1CA6A 1E2WA 3OW7A 1K0RA 1HFGA 1N36L 5EAYA 2CQAA 1SSOA 3TRZA 3RZDH 1SMYC 3STBC 1YNJD 3PIOA 4ZRZA 3GTGB 2K28A 2PZWA 2NB0A 3FKIH 2VUMB 4TKOB 3PIPA 2LSSA 3VA7A 2E2JB 1HZCA 1Y1VG 4XQQA 3F2BA 3SXHA 2WAQB 5FLMH 4J6HA 5J22A 5NUCA 4ALPA 2UXCQ 1PFBA 2VB3X 3I3CA 1UUPA 1FGUA 5KNCA 1BXTA 1D7QA 1BDOA 2HQLA 1IYJB 2RDHA 4KN7C 3HOWH 4ZKBB 1PZID 2K5VA 4X66L 4JOIA 1RL2A 2O2LD 3F2CA 4IO9A 1KTKA 3GQBA 2EYOA 1WFQA 3M85A 1QWYA 3M7GA 3CC4A 4OX9Q 3I70A 4QIWB 4LF5Q 1K9MC 4JCVE 3CU7A 4FVMA 3CPWA 4K0KL 2B63G 5EPJA 4DUYL 1VQNA 4WRDA 4YHHQ 1H9SB 4IUQA 4HJ7A 1ICWA 3KLSA 4H02A 2MHVA 4R1JA 1QZGA 1P16A 2A1AA 3HOZB 2B2UC 3PSIA 3CRKC 5C44B 3S15B 1GD7A 2WB1E 1CHQD 1XX8A 5IY0A 5HGQA 1EZ8A 4DV3L 4I7ZC 3FPUB 1VQ6A 1FGBD 4PMWA 2A69C 2J0TD 1L0WA 1TWAB 4CDCC 4RHSA 5C5MA 4F87A 4DU9A 1I94Q 4DV6Q 3R2TA 2A74C 2L1BA 1P8LA 4O2DA 1MJEA 1SNMA 1EYGA 5C4XB 2VW9A 5IOCA 4L5TA 1EIFA 1X6OA 3SE0A 3I90A 4ZLTF 2B3GA 2N78A 4OO1H 4X62Q 4KD4A 1BCPF 1OXUA 2JA5B 1IW7C 4IPCA 2LFNA 4M8AA 3J7ZC 1N36Q 1PZKD 3EROA 2ZXPA 4A3DB 1W2BA 4DK3C 4DGZA 2UXDL 4A3EB 4ZK9B 3A74A 2NZ1D 1VQ7A 1ET6A 4EGVA 3M4QA 4PQXA 4QB4A 1M4VA 1STAA 3K7AH 1YIJA 5KNDA 3OTOL 1LTTD 1SYDA 1CT1D 4C2MH 2YU9B 4LFBQ 4OWWB 4DA2A 5CV4A 1ENCA 4LW1A 5LMNW 2B2YC 1E0BA 4F7XA 4A3IB 1G2SA 1UWVA 4B3TL 4JI0L 2RHQB 4KY6A 3P20A 1FNWA 4CKBA 5GAGC 1F77A 1PTOB 1Q46A 1CSQA 2IX0A 3NK9A 4C3IG 2DNEA 3J80i 1RIPA 4QIWE 1FD7D 3LX0A 1HQMC 1RHPA 5GROA 1A6XA 1PYWD 3MA2B 2NTTA 2CWPA 4JI4L 3D8GA 2SNMA 5J1ZA 4AYBB 4Y7NB 5CMDA 4KV6A 1TWFH 4RH6A 1IBLL 1RD9D 1B1ZA 1SYGA 5DAUA 1GUSA 2JA7H 3PIP3 3KF6A 5CV6A 2ID0A 3HOZG 3TP6A 2JQOA 4B08A 2RCFA 3G71A 5IT9E 1G6PA 1VQ4A 1AW7A 4G7OC 1WTPA 3JAME 4AQYL 3I4MH 2CFMA 1PH8A 3TZUA 2OF1A 4FDBA 3HEJA 2A5HA 4JBMA 3KUPA 3MZ5A 1SE8A 2E5LL 3PMFA 4JYAL 3KDFB 3PF4A 1VDZA 1TQOA 3HOVB 5C4XG 1R4PB 2E75C 4BY1H 2R93H 1JMCA 1BCPD 4A3CG 2AUKA 1ML0D 2V1CC 4CDFC 2RSOA 2LS01 4LF8Q 1I4PA 1UNSA 4DR6L 1LLRD 5KEEA 2M9VA 4FP5D 2ZXRA 4LUOA 3I4LA 1E7ZA 1HR0L 3TS0A 4BXXG 4LF4L 4A3DG 2N49A 4NDXA 5M3FB 4X3KA 1E3PA 4A3GG 1C0AA 1ICFB 4TQUS 4HJAA 1EY4A 5CV8A 5DM63 1SRUA 2AWOA 2C5CA 5LMNL 3HGBA 2RBMA 2K03A 5BN5A 4GS3A 2LKVA 3ERQA 4YCVA 1TWCH 4DV1L 1PH6A 3ND9A 3K5NA 5C0XJ 3CW2C 2F4IA 3C2PA 1J6QA 4UY8C 4A3IG 4XIGS 1VQHA 3KLRA 1DOKA 3EQLC 3IRBA 2QDLA 5IYCH 4JG2A 1VQGA 3MXUA 4XYOA 2EQSA 1S5BD 2FFKB 4G4KA 4FF3A 4JI0Q 1AE2A 1UE6A 2HUGA 4EX5A 4DV7L 4HMIA 4M1UB 1B8AA 2PNRC 3NSWA 2SDFA 1GUTA 2EYJA 1Y14B 3U9OA 4LNQA 4PNYA 4AYBE 4LMQD 4AYBG 1TKWB 5A2QL 3U58A 3ND8A 1LABA 2QKIC 3F2UA 2HCIA 4G57A 1DZ1A 2WIIB 1PDQA 4RGOS 3V2TA 2E2DC 1AZPA 1VQOA 2EDGA 5IYBH 1EL0A 2MJ8A 3A8KE 1H9RA 4GN4B 4UP9A 1D8LA 2JN4A 4HIKA 4FF2A 1XXGA 1ZKOA 1QJOA 1K8AC 2I5HA 1XNQL 1EY5A 1GVPA 2F0OA 4AQYQ 4J1MA 3AFQA 4IZ8A 1E2VA 3T51B 1V1PB 1X54A 1B53A 3HKZB 2XRSD 2K5WA 2EVBA 3HOVG 4BWGB 3M9BA 4JV5Q 4OO1I 1BBWA 4TRDA 1TWGH 1PMRA 1X3PA 4DV2Q 3GTPH 3CD6A 3QJYA 1ET9A 3HOYB 3G6JB 3U4ZA 4IOAA 1TXYA 3N6RA 3KLWA 3HOUB 2B2WA 3GTOB 5IGBA 1S72A 4DR6Q 1SJED 3KF6B 5KRUA 4C3IH 4X3SA 5IIFA 1STHA 1BO0A 3OIQA 5JVG3 1HR0Q 4P74A 5I4DA 1B4OA 3MXPA 1T9HA 2EXZA 1VQPA 2K6AA 1QCBD 3BVMA 3I72A 1KAWA 1LTLA 1VQEA 4IPGA 3S1NB 3J7A5 1A3TA 5LMNQ 1SFOH 1N32Q 5ELNA 2CH4W 3W5OA 5M3MH 5KIXA 4MIUA 2JYOA 3L7ZC 1N34L 4GN5A 2VS1A 1SDFA 3EFXD 3D3RA 3S24A 4IFDJ 1A8VA 4WFN3 1MD2D 2K01A 3H94A 4KN4C 3KBGA 1VQ8A 1NR2A 4PZ6A 3UI2A 5GAEC 4LF7L 1AP0A 2A6HC 5HURA 3J81c 3T4AC 2UUAL 4DR4L 3GD7A 1F2YA 2Q2UA 4A3KB 1O78A 1PRTF 2H4OA 3OWEB 5FO8B 1VCIA 1YZ6A 3PUYA 4A3CH 1JB3A 2K05A 3K0XA 3GTLB 3CCJA 3S2HH 4Q5VA 1K3RA 4ABNA 1JWUD 4A3BB 2L5TA 3OYYA 4GOPA 1EQRA 3A56A 3BJUA 4XXEA 1LT5D 4NP5A 4A93B 1B3AA 4QUFA 3NWTA 3FPPA 4LK1C 1GJXA 1BVSA 2HIXA 2AWNA 1ESRA 2Y0SB 1HUNA 1MGSA 4XQJA 4HIMA 1JCKB 1HTPA 1Y1WB 4ZUIA 3S1RB 4A3GH 3EVQA 2J4XA 2F0EA 1S5FD 5KGUA 4DV5Q 1Z9FA 4A3FG 1XNQQ 1I3QH 3O13A 4JI2Q 4BBSH 5E1FA 4A3JH 2JA6H 3PCOB 1M8AA 2LXJA 3HRZC 1XNRL 2F0UA 2Q8IB 4BBRB 1S4ZA 4MHEA 1EFID 3HOYG 3TN2A 1Y8OB 4B3SQ 1Y8NB 1EEID 1F9QA 4C3HH 4WJ3M 3H3VH 4A75A 3HG9A 2NZOA 1Q7YC 3I8ZA 1FNUA 2EZVA 4IFDH 3Q6SA 4APVA 4P73A 2BE5D 1V43A 4GLVB 2EY2A 2DGYA 2ZTEA 3P75A 4ME5A 1KDBA 4RWSC 1J5EL 2RKSA 3ITPA 1E1TA 3NE5B 4CKEA 3DHQA 3H15A 4MN3A 5T1GA 1IXRA 4FXDA 1XMOQ 1RJTA 4JVZA 2HDMA 4GLAC 1NUCA 1K28A 1SNOA 4JI5Q 1TS3A 3S17H 5E4XA 3MAQA 2ATWA 2CHBD 2UXCL 3E6ZX 1WTHA 1F2ZA 3OMCA 4RG1A 4BY7G 4B3ML 1PRTD 1CHPD 1Q1EA 2NUCA 1CKNA 4XT1B 1RKNA 1JOQA 2VNUD 2PZTA 2CVRA 4ZUJA 4A3KG 2A68D 4OXPA 2NVTB 2HIVA 3MXNA 3J80c 2E76C 1Z47A 4YY3Q 2L9HA 1HJPA 1UEAB 1U4RA 4LF5L 4IN3A 2R7ZH 2AQ1B 1L0XB 3UDFA 3PO3H 4YHHL 2KENA 3TQYA 1WTRA 3K6OA 5K36G 4A93G 2L0CA 3GTKH 2PPBC 3DWAA 4XTCS 5FO9B 3S16H 3S1QB 2Y0SE 1EQQA 1XPRA 1JJCB 2Y0SG 4OEMB 1BCPC 2K75A 1D5MC 2NN6H 1O80A 1Y1WG 1B44D 3SK5A 3ULJA 1Y69U 2IJ0A 1Q90A 4C56C 2PI2A 3H6MA 1EFWA 5C0XI 3W3AA 2D2CC 2YTXA 2CW0D 2F0TA 1A2UA 2R61A 4RKBA 2VQEL 5JAVA 4LWCA 5EJWA 5C3EH 1I94L 1M1KC 3KF8B 4O1NA 2EY6A 5ELBA 5LL6X 1GHKA 1ILPA 2AQ2B 3CQZH 2IWHA 4DPGA 4DAPA 5C3WA 3FVQA 5JJKA 4LF9L 4UAIA 4ILWA 3K58A 1WCMB 3K5LA 1K83H 2XN9C 5CBEE 3EN2A 3VYTA 1EOTA 4X62L 1C48A 3GTQB 4PZ8A 3GTJH 3CCRA 1EY8A 2R6GA 1R9TB 3SR1A 3ERSX 4K14A 4JI3L 3CAMA 4AH6A 2ICIA 2Z4IA 1J5EQ 1EIGA 2DJGC 1B50A 3HKSA 3BDCA 1HH2P 1YNND 1KLUD 2EYFA 3AEVA 5BR8L 5JPMC 1S5ED 2ZJQA 3G7LA 1EY7A 2DY7A 4KHVA 2Z6KA 1OXVA 2D62A 1K8OA 2DN8A 3KYHC 5IE8A 4A3MB 4LFBL 1JQYD 2NVQB 4C3JB 2N55A 2EPBA 2Z1CA 4GOPC 2F0PA 4NPSA 4A3FH 4RMFA 5A35A 1K8GA 1D5XC 4B3MQ 2WACA 4EQPA 1CUKA 5EPKA 3J81i 1HQRD 5BN4A 3NTKA 3WOFA 5IP7H 1JT8A 5AJ3Q 1H9JA 4XT3B 3SK4A 5T1IA 1F2MA 2L12A 2EJFC 1KABA 2E2HH 1SJHD 5M5YB 1EYAA 1PA6A 1LTRD 4CJ2C 2F52A 1BQQT 4JBJA 4CGYB 2MO0A 5M5XH 1JOOA 2A73B 2IHFA 3A7LA 4DR1Q 1GUOA 1Q81C 5CORA 3D6WA 1BNZA 1YJ9A 2I5MX 4HR7B 5LMUQ 4DAMA 3RZOB 3UE0A 4N9PA 4N8X1 2EXDA 3S14H 1LTAD 5M5WB 1CKNB 2YV5A 3ULPA 1XYIA 4KKSA 2RA4A 2Q2TA 1DOLA 2WB1G 4MTKA 4P2CB 5C4JH 3H3VI 1VS0A 2AQ3B 1GO3E 1YNXA 2YTYA 1KRTA 4IFDI 2NYZD 2VQEQ 3U4VA 5IT9c 1LACA 2PQAB 5ELDA 2OWOA 2R92H 2VXWA 1SNPA 4BY7H 2F0JA 1WTQA 3KOJA 3PGZA 1LUZA 5ELCA 4CJ1B 1NE3A 4HJ9A 1SNDA 1B70B 4LF8L 3J81L 4LF9Q 2ENBA 4DN4M 2F0KA 3R93A 3CC2A 1TWHB 1Q12A 2ZM6L 2KHJA 4K6DA 1F9RA 5COYA 2F0NA 4YWLA 1DOMA 2BDNA 4JI8Q 1ENFA 2F0SA 5I2YA 1SYEA 4HIDA 2VUMG 4JI3Q 3TS2A 1CQVA 5K36H 5BR8Q 3A0JA 2WAQE 4K5WA 3GTMB 3CC7A 1KD1C 1E1OA 2WAQG 1H95A 3PUXA 1QG7A 4A3MG 3E5SA 2N88A 5LL6S 4S3SA 1NBWA 5G3LF 4KJOA 4JI1Q 1J8IA 2KJXA 1CSPA 1DCZA 2WKCA 4JI7Q 2KCMA 3IL8A 2HHHQ 3K8AA 1RCVD 3Q8DA 3S2DB 1EOVA 2K14A 3TMEA 2AHOB 3D31A 3LGJA 2KBNA 4U673 2GN5A 2EJMA 3TP7A 1L0YB 4GNXA 2NBFA 3M4OB 2NN6I 1HNXL 2A6ED 4JC0A 1HFNA 5IP9G 1XTCD 1GUGA 3F2DA 4DKAC 2JA8H 1SNCA 4HCEA 3PIO3 2L11A 2Q2IA 1FJGQ 4QGUA 3ZYYX 1G2TA 2ALYB 2F0DA 3K80C 2WKDA 1TU2B 5C44G 1PLFA 1PH7A 1IBKQ 2WV6D 3R2IA 4HTHA 2I0QA 4H7BA 3CPFA 2BE5C 5GAHC 3I55A 5EBDA 1IZ6A 1FL0A 1D1IA 1Y1VH 1MSGA 3NTHA 3BU2A 1I6HB 2OCEA 1B7YB 1XTDA 4JV5L 1SEBD 1JWSD 2ZTDA 2NVXB 4DV2L 3VYSA 4RAUC 1PYSB 3T1YL 3NPPA 4ODGA 3I4NB 1ZYRD 1Q1BA 1Q8IA 2PMZB 3HOXB 3QB3A 2LY7A 2IPKD 1UE7A 3H3VC 4KTAA 1B9NA 2I46A 2Z6KC 3C1FA 1XWEA 3KK7A 1W6JA 2E74C 5JJIA 2JA5G 1LTSD 4OELB 1PYBA 2ZM6Q 2CCZA 5H1SE 2K5HA 4NMZA 1JOKA 1PFSA 2PW7A 3J80L 4YCWA 5JPNC 2PI2E 2HCCA 1C7YA 1PRTC 2N8NA 5E7NA 1SBBB 3S9WA 5I9OA 3H0GB 1TVXA 1YJWA 4DR3Q 1L1OA 4A3EG 3PO2B 1TT2A 5G3LD 2LMCB 2B63H 3PUWA 3SEBA 5K5PA 1CA5A 2A68C 3EJIA 2XTIA 1N32L 3M3YH 1NNXA 3PO3B 2SEBD 2F4VL 1OTCA 1OXSC 1PFNA 4DR5L 3J7AF 1I4HA 1E22A 5FLXE 2RVLA 1A3VA 3CMEA 2RSNA 4IALA 3FDTA 1I50B 4IOCA 4KMUC 2X6GA 3CCVA 4PV1C 3S1MB 1KXLA 4J15A 2V4DA 4DUZQ 3WDNA 5DLQE 4RCOA 4WORA 3A5ZB 2F03A 5KYLA 1G91A 1SMXA 2QF7A 2E2IH 1IL2A 4OIKA 3CCSA 1E24A 2NVYH 3HS0C 1LM0A 3FP9A 2O4XA 1EYCA 1NR4A 2DNCA 2ASBA 1ONLA 1HNXQ 2MO1A 1DJRD 4LFCQ 1ZEQX 1F2LA 1SMYD 5FO7B 3STBD 1HPCA 2KUMA 5IWAL 1HNWQ 2TSSA 2B8GA 4RKLA 2B39A 4RHRA 3DM3A 4L5QA 1QUQA 4LF6L 4R9WA 4X64Q 2AUJD 4Z9CB 3SDZA 3GTGH 1PH9A 2A19A 2VUMH 2BH2A 2YTVA 2XWBB 3H91A 4NXNQ 4DV5L 1MBYA 2ZJPA 2E2JH 1QVFA 1X3GA 1Y8PB 2PNHA 1SROA 3RZDB 4U68A 2UXBQ 4JI2L 1EQVA 1PFMA 3URYA 4X65Q 1PH5A 5JJLA 2EYPA 3UDXA 3FKIB 4KJNA 4MNOA 3DUZA 4PG3A 4PZ7A 5GADC 1YNJC 4QMGA 4QCLA 3TREA 1X3EA 3I4NG 2F3WA 4DR7Q 2LXKA 4B3SL 1YNNC 2Q8RE 1TS4A 2K7VA 1DXMA 1G51A 3HOXG 3T1YQ 2B2VA 5D65A 2K1BA 3SVMA 3UDIA 1K0SA 1OO9B 1BKBA 2JXMB 3H0GG 3RLNA 3HOWB 1KIXA 5M3FG 3PO2G 3LWUA 1QILA 1BBXC 1HRJA 5CV7A 1IL8A 1LO5D 1S5CD 4P75A 1STYA 2MQHA 1KHIA 4J8QA 1CKOA 1CTMA 1XMOL 5FJ8G 2Z8LA 3NBHA 2UUBQ 1CQFA 1R4QB 4JI5L 4KHPQ 1ASYA 4GNXC 2F4VQ 1CZWA 3BDOA 3HOZH 1DGSA 1L2FA 2C9OA 4DR5Q 1D5ZC 5C44H 3S15H 1IKLA 4QQBX 1QE6A 1JICA 1V8QA 3RR5A 3U50C 5CBAE 5IGGA 2KEEA 3GV3A 2MGSA 3QG1A 1BR9A 4DV4L 1KLGD 1TWAH 4JBKA 3TSSA 3MFGA 1PTOF 4OHJA 5JJZA 2P5ZX 5DM73 2R7DA 3NHHA 1VQMA 4POGA 1A62A 2AMCB 3BZCA 4DV0Q 4H0LC 3Q22A 5C4XH 1NCVA 4OIJA 2PO4A 3TP5A 4YY3L 1PZJD 4IJLA 2OEOA 2KOLA 3MWYW 4BA1I 1AH9A 4RGNA 3DWPA 4IJHA 3VR6A 2IHEA 4TVAB 1SYBA 4KKTA 2GA4B 3K7UC 3K81C 1JE5A 2JA5H 5IWAQ 3L2PA 4DR2Q 1LT6D 3C46A 1KDAA 4F8MA 4LF6Q 4BXXH 4A3DH 1C9OA 2Z0SA 3X3MA 5C6AA 2JA9A 1C8CA 4A3EH 2VZAA 2IT1A 1X56A
chains in the Genus database with same CATH topology
1EIHA 1SE3A 5DNFA 4CBVA 1ILQA 4GZYC 1ZXTA 1GOZA 2EY5A 3D6CA 3AB9A 3DMUA 3OSOA 1JWMD 1U9RA 5TSSA 1HUMA 1TY2A 1LTBD 3K7AB 3OIPA 1JE4A 3RD4A 2K5QA 4C2MB 1AEXA 2F0HA 5E3FA 2VB2X 1F9PA 2B8FA 1PTOH 3BVZA 2OXPA 4UDUC 1U4MA 3NQIA 5JEAG 1C4QA 3R8BA 3D4RA 3BZDB 5IGCA 2JE6I 2IL8A 2XRQD 1QNKA 4QUCA 1KNEA 5C3XA 3X3NA 1WTXA 3PUZA 1TWFB 4HAEA 5IODA 4CHTB 1U4PA 2A6EC 1BCPB 1PTOD 3C1EA 3DXJC 2JA7B 3DEOA 2F0IA 4ZKCB 4KHZA 1AZQA 1S5DD 1VMCA 3OHXC 4LJZC 3VA5A 5E4WC 1H9SA 3I4MB 4DK0A 4FF1A 3MVVA 3NWSA 1MI2A 4BS9A 4NKLA 4BY1B 3NUCA 2R93B 3HP3A 2I07B 4X3UA 4CKCA 1ZYRC 4OO1G 2B2VC 1FR3A 3IFDA 1G291 1JORA 4R8NA 3NP8A 2DY8A 3KLSX 3T53B 3QOJA 1STNA 4IUTA 2XIWA 3QOLA 4CJ0B 2Z4HA 5DEHA 1SXTA 3R3OA 3IKJA 1RODA 1TWCB 3K5MA 1F9SA 1QOHA 4KK7A 4RGTA 4DFAA 2JEBI 1Z7TA 1TY0A 5JEAJ 2F0GA 2XWJB 1V1OA 2JP1A 2EE1A 3RUZA 2BCOA 2HQEA 3I91A 5ELEA 3GV6A 3P1HA 2MP1A 2G9HD 2WINB 2KEDA 1LT3D 1CFMA 5C4ZA 3RLFA 2F0FA 2OT2A 5CV5A 4ZYSA 5BN3A 1I6VC 2EOTA 4DAYA 1HA5A 3FRPB 4EQNA 5IGDA 1NSNS 3Q0AA 4LAAA 4HN7A 3VYRA 1SYFA 2F3VA 4L63B 5EKKA 1D1KA 1TS2A 3J80E 3V96A 1TWGB 2FMMA 3GTPB 1X32A 1ENAA 4TSSA 2K5DA 3A7AB 4K2KA 5JEAH 1NAPA 4C3IB 1GUWA 5AFWA 3PUVA 3A8IE 2JEAI 1IKMA 4ULLA 3K57A 1UAPA 3AMUA 3HZXA 4RA8A 3DWQA 3MEHA 2A6HD 1SFOB 4IQZA 1D6EC 1VMPA 5M3MB 3FEWX 3L9AX 2O5JC 2EJGC 4L6TB 1JC7A 4DNTB 3MHBA 1BF4A 3P7JA 1EWHA 5A2QE 1DONA 1B9MA 4V190 1GHJA 4DF7A 3VYUA 3NQTA 1QNUA 1TIID 4ID6A 4E6IA 1G8ZD 1FYCA 2BOSA 3VR4A 3BVGA 1HHVA 3S2HB 2KCNA 4NW2A 3BG3A 3D4WA 5EQ0A 2F0LA 4C3JG 1DM0B 1WD1A 2J7ZA 4FF4A 5M9OA 1SE2A 3TBIB 2F0WA 2M2LA 1KDCA 2BA1A 2EYHA 5FKAC 4A3GB 1WD0A 1CI3M 1EY6A 3M7NA 1EU3A 2IW3A 1I3QB 4YIJA 2JSOA 4F88A 4FYDA 4BBSB 4A3JB 2JA6B 1BUVT 5HGTA 3BYYB 5LHY1 1STBA 3H09A 2RDGA 5C0XG 5JVH3 4K5XA 3TZDA 4C3HB 3OOCA 4V0BA 1V1PA 4IUUA 5EKLA 4HMJA 4Q0FA 4DK1A 1AN8A 4DXFA 1PRTB 1HXYD 2H1EA 5EKIA 3ONAB 3CKIB 1OXXK 1EY9A 3VR2A 3A8JE 2NWGA 2MPMA 2PCFB 3W2DA 2L4NA 1T5XD 2QDBA 2ICEC 2EYMA 4QF4A 1STEA 5D14A 3S17B 4RFBA 1DYQA 5I6WA 3WOEA 1I4XA 3NBIA 1Z6HA 1PTOC 4KY5A 3LNNA 3KBXA 3DEPA 2X69A 1QB5D 5I2XA 2ZXOA 1RDPD 1IYUA 2ZT9C 2K33A 1ESFA 1H9MA 3QIAA 3M4YA 1JR0D 5CC4A 2R7ZB 1A15A 2K32A 3IAYA 2QCPX 4R8IA 3GTKB 3S16B 1WTOA 1I4RA 3E0JA 1LTGD 1IYVA 3T56B 2D9UA 4HEDA 2X6LA 2IX3A 2TMPA 3NTIA 2B2TA 2YYZA 4EQOA 2KECA 4ZAIA 1RF2D 5C3EB 1CK1A 2CW0C 4C3HG 1G6ZA 5I6YA 3CQZB 2IX1A 1AFPA 3Q23A 4IFDG 1SAPA 4C1NI 4DXGA 1K83B 3QWNA 4L8JA 4C1NK 4IUNA 3GTJB 3K5OA 4XDXA 1CZGA 4RGMA 3SHLA 1MSHA 3GP7A 1CM9A 2QEJC 2L55A 2M00A 1O7YA 1LTID 3OMGA 5FOBB 4ZQ3A 5D3DA 1FNVA 4JBWA 2K04A 3T16A 2Q8TA 3I73A 1EY0A 1EU4A 4B9WA 3U9SA 4A3FB 2RDFA 5FK9C 2FMCA 1D2BA 2FINB 4K5VA 2KA7A 3EA6A 4B9XA 2BA0A 3CRLC 4OL7A 1A2TA 2D5DA 3L3OC 5C0XH 4O42A 1T5EA 1EZ6A 3AU7A 3J7YW 2E2HB 1VF7A 2F0MA 4H44C 3BDLA 2F0VA 5I9PA 3NXWA 4FXKC 3FMCA 4K6LA 2QILA 5M5XB 5KYIA 4XQNA 2SOBA 4I65A 3CHBD 2A69D 1K8MA 2NN6G 1IHZA 4DNRB 2F1MA 1WVLA 2NTSA 2PZUA 3S14B 2KVMA 4FXGC 1TR5A 1BOSA 5IT9L 5C4JB 5IGEA 3Q24A 1WTWA 3SK6A 4X3TA 1EQTA 1B2TA 3JAML 3RMHA 3VR3A 4HSVA 2R92B 1IW7D 4K8JA 4BY7B 3T13A 4KY7A 4HCSA 3J7AV 5ELFA 2MUYA 1O7LA 3D4DA 4IURA 3MC0B 1OXTA 4HSPA 1I4QA 3KF8A 1RTOA 4JK1C 4KKUA 3BS1A 2FHTA 2EY1A 2FJ2A 4FO2A 3QO2A 1EEFD 3MXGA 2KQ3A 2XVSA 1WTVA 4N9TA 3A55A 2PQEA 5D3IB 4PMCA 1X3QA 5C4HA 5FLXL 3K59A 1KNAA 5JOBA 1HCZA 5EPLA 5F2DA 5EBCA 5J39A 3IFTA 1STGA 4XYQA 1II3A 4G7ZC 1RTNA 2R3ZA 2XNAC 2B2TC 2B2UA 1SE4A 1GXDC 3MTSA 2JA8B 5CR3A 1HA6A 3LWEA 1EWCA 2O5IC 1E2ZA 3BYTB 5EGTA 4K2LA 4IUPA 2PYKA 3SK8A 4IUVA 3TP8A 3J81E 1Y1VB 3TDQA 1PXUA 4EVOA 2G9DA 5IGFA 2PW5A 1SYCA 1H9KA 3K0YA 4KD3A 2XSCA 1LV9A 4RCNA 2EYLA 3PV0A 1J9OA 3DM1A 5ISRA 4PMBA 1HTLD 3OWFA 4K8IA 2F0QA 2KCCA 1TS5A 4OGQC 3N52A 3V05A 2B2YA 1DD2A 4KI0A 2BDOA 1VF5C 1I4GA 2B63B 4FNFA 2SNSA 4WJWA 2RQXA 3VR5A 3M3YB 1U4LA 3C3LA 3OPOA 4G7HC 4DAVA 1SNQA 2B2WC 2KHSA 5KNBA 4BA2I 1LT4D 2WB1B 1Q3LA 5CGKA 2WP8J 1A3UA 3MFYA 1W6KA 2E2IB 3A54A 1GUNA 1KAAA 1EYDA 4H13C 5CV9A 2NVYB 5C5LA 2HDLA 5CYUA 3GO5A 1O7ZA 1CA6A 1E2WA 3OW7A 1HFGA 2CQAA 1SSOA 1SMYC 1YNJD 4ZRZA 3GTGB 2K28A 2PZWA 2NB0A 2VUMB 4TKOB 3VA7A 2E2JB 4XQQA 3SXHA 2WAQB 4J6HA 5J22A 5NUCA 1PFBA 2VB3X 3I3CA 1UUPA 5KNCA 1BXTA 1BDOA 2RDHA 4KN7C 4ZKBB 1PZID 2O2LD 1KTKA 3GQBA 2EYOA 3M85A 1QWYA 3M7GA 3I70A 4QIWB 3CU7A 4FVMA 5EPJA 4WRDA 1H9SB 4IUQA 1ICWA 3KLSA 2MHVA 3HOZB 2B2UC 3CRKC 5C44B 3S15B 1CHQD 1XX8A 1EZ8A 4I7ZC 3FPUB 1FGBD 4PMWA 2A69C 2J0TD 1TWAB 4RHSA 5C5MA 4F87A 4DU9A 3R2TA 2A74C 2L1BA 1SNMA 5C4XB 5IOCA 3SE0A 3I90A 4ZLTF 4OO1H 4KD4A 1BCPF 1OXUA 2JA5B 1IW7C 2LFNA 4M8AA 1PZKD 3EROA 2ZXPA 4A3DB 4DGZA 4A3EB 4ZK9B 2NZ1D 1ET6A 4EGVA 4PQXA 4QB4A 1M4VA 1STAA 5KNDA 1LTTD 1SYDA 1CT1D 2YU9B 4DA2A 5CV4A 1ENCA 2B2YC 1E0BA 4F7XA 4A3IB 1G2SA 4KY6A 3P20A 1FNWA 4CKBA 1F77A 1PTOB 2IX0A 3NK9A 4C3IG 2DNEA 1FD7D 3LX0A 1HQMC 1RHPA 1A6XA 1PYWD 3MA2B 2NTTA 3D8GA 2SNMA 5J1ZA 4AYBB 4Y7NB 5CMDA 4KV6A 4RH6A 1RD9D 1B1ZA 1SYGA 5DAUA 1GUSA 3PIP3 5CV6A 2ID0A 3TP6A 4B08A 5IT9E 1AW7A 4G7OC 1WTPA 3JAME 3TZUA 2OF1A 3HEJA 2A5HA 3KUPA 3MZ5A 3PMFA 1VDZA 1TQOA 3HOVB 1R4PB 2E75C 1BCPD 2AUKA 1ML0D 2RSOA 2LS01 1I4PA 1UNSA 1LLRD 5KEEA 2M9VA 4FP5D 2ZXRA 3I4LA 4NDXA 5M3FB 4X3KA 4TQUS 1EY4A 5CV8A 5DM63 2AWOA 2C5CA 3HGBA 2RBMA 2K03A 5BN5A 2LKVA 3ERQA 3ND9A 3K5NA 5C0XJ 2F4IA 3C2PA 4XIGS 3KLRA 1DOKA 3EQLC 3MXUA 4XYOA 1S5BD 2FFKB 4G4KA 4FF3A 2HUGA 4HMIA 4M1UB 2PNRC 3NSWA 2SDFA 1GUTA 2EYJA 3U9OA 4PNYA 4LMQD 1TKWB 5A2QL 3ND8A 1LABA 2QKIC 3F2UA 2HCIA 4G57A 1DZ1A 2WIIB 1PDQA 4RGOS 3V2TA 2E2DC 1AZPA 2EDGA 1EL0A 2MJ8A 3A8KE 1H9RA 4FF2A 1XXGA 1ZKOA 1QJOA 1EY5A 2F0OA 4J1MA 4IZ8A 1E2VA 3T51B 1V1PB 1B53A 3HKZB 2XRSD 2K5WA 2EVBA 4BWGB 4OO1I 4TRDA 1PMRA 1X3PA 3QJYA 1ET9A 3HOYB 3G6JB 3N6RA 3HOUB 2B2WA 3GTOB 5IGBA 1SJED 5KRUA 4X3SA 5IIFA 1STHA 1BO0A 3OIQA 5JVG3 5I4DA 1B4OA 3MXPA 2EXZA 2K6AA 1QCBD 3BVMA 3I72A 3S1NB 1A3TA 5KIXA 4MIUA 2JYOA 3L7ZC 1SDFA 3EFXD 3D3RA 4IFDJ 4WFN3 1MD2D 2K01A 3H94A 4KN4C 3KBGA 1NR2A 3UI2A 1AP0A 2A6HC 5HURA 3T4AC 3GD7A 1F2YA 4A3KB 5FO8B 1O78A 1PRTF 2H4OA 3OWEB 1VCIA 3PUYA 1JB3A 2K05A 3GTLB 4Q5VA 4ABNA 1JWUD 4A3BB 2L5TA 3A56A 4XXEA 1LT5D 4NP5A 4A93B 1B3AA 4QUFA 3NWTA 3FPPA 4LK1C 1GJXA 2AWNA 1ESRA 2Y0SB 1HUNA 1MGSA 4XQJA 1JCKB 1HTPA 1Y1WB 4ZUIA 3S1RB 3EVQA 2J4XA 2F0EA 1S5FD 5KGUA 3O13A 5E1FA 1M8AA 3HRZC 2F0UA 2Q8IB 4BBRB 1S4ZA 4MHEA 1EFID 3TN2A 1Y8OB 1Y8NB 1EEID 1F9QA 3HG9A 3I8ZA 1FNUA 2EZVA 4IFDH 3Q6SA 2BE5D 1V43A 2EY2A 3P75A 4ME5A 1KDBA 4RWSC 2RKSA 3ITPA 3NE5B 4CKEA 3DHQA 4MN3A 5T1GA 4FXDA 1RJTA 2HDMA 1NUCA 1SNOA 1TS3A 5E4XA 3MAQA 2CHBD 3E6ZX 1F2ZA 3OMCA 1PRTD 1CHPD 1Q1EA 2NUCA 4XT1B 1RKNA 1JOQA 2VNUD 2PZTA 2CVRA 4ZUJA 2A68D 2NVTB 3MXNA 2E76C 1Z47A 2L9HA 1UEAB 1U4RA 4IN3A 2AQ1B 1L0XB 1WTRA 3K6OA 5K36G 2L0CA 2PPBC 3DWAA 4XTCS 5FO9B 3S1QB 1BCPC 1D5MC 2NN6H 1O80A 1B44D 3SK5A 1Y69U 2IJ0A 1Q90A 4C56C 3H6MA 5C0XI 3W3AA 2D2CC 2CW0D 2F0TA 1A2UA 2R61A 4RKBA 5JAVA 5EJWA 4O1NA 2EY6A 5ELBA 5LL6X 1GHKA 1ILPA 2AQ2B 2IWHA 4DAPA 5C3WA 3FVQA 4UAIA 4ILWA 3K58A 1WCMB 3K5LA 2XN9C 5CBEE 3VYTA 1EOTA 1C48A 3GTQB 1EY8A 2R6GA 1R9TB 3SR1A 4K14A 2ICIA 2Z4IA 1EIGA 1B50A 3BDCA 1YNND 1KLUD 2EYFA 5JPMC 1S5ED 3G7LA 1EY7A 2DY7A 4KHVA 1OXVA 2D62A 1K8OA 2DN8A 4A3MB 1JQYD 2NVQB 4C3JB 2N55A 2EPBA 2Z1CA 2F0PA 5A35A 1D5XC 2WACA 4EQPA 5EPKA 1HQRD 5BN4A 3NTKA 3WOFA 1H9JA 4XT3B 3SK4A 5T1IA 1F2MA 2L12A 2EJFC 1KABA 1SJHD 5M5YB 1EYAA 1LTRD 4CJ2C 1BQQT 4CGYB 1JOOA 2A73B 3A7LA 1GUOA 5CORA 3D6WA 1BNZA 4HR7B 3RZOB 4N9PA 1LTAD 5M5WB 1XYIA 4KKSA 2RA4A 1DOLA 4P2CB 2AQ3B 4IFDI 2NYZD 1LACA 5ELDA 2VXWA 1SNPA 2F0JA 1WTQA 5ELCA 4CJ1B 1SNDA 3J81L 2ENBA 4DN4M 2F0KA 3R93A 1TWHB 1Q12A 4K6DA 1F9RA 5COYA 2F0NA 1DOMA 2BDNA 1ENFA 2F0SA 5I2YA 1SYEA 1CQVA 5K36H 4K5WA 3GTMB 3PUXA 1QG7A 3E5SA 2N88A 5LL6S 4S3SA 5G3LF 4KJOA 1J8IA 2KJXA 1DCZA 2WKCA 3IL8A 1RCVD 3S2DB 3TMEA 3D31A 4U673 2EJMA 3TP7A 1L0YB 2NBFA 3M4OB 2NN6I 2A6ED 1HFNA 1XTCD 1GUGA 1SNCA 4HCEA 3PIO3 2L11A 3ZYYX 1G2TA 2F0DA 2WKDA 1TU2B 1PLFA 2WV6D 3R2IA 4HTHA 4H7BA 2BE5C 5EBDA 1D1IA 1MSGA 3NTHA 1I6HB 1SEBD 1JWSD 2NVXB 3VYSA 4RAUC 3NPPA 4ODGA 3I4NB 1ZYRD 1Q1BA 1Q8IA 2PMZB 3HOXB 3QB3A 2LY7A 2IPKD 3H3VC 4KTAA 1B9NA 2I46A 3C1FA 1XWEA 3KK7A 1W6JA 2E74C 1LTSD 4NMZA 1JOKA 2PW7A 3J80L 5JPNC 2HCCA 1PRTC 1SBBB 3S9WA 5I9OA 3H0GB 1TVXA 3PO2B 1TT2A 5G3LD 2LMCB 3PUWA 3SEBA 5K5PA 1CA5A 2A68C 3EJIA 3PO3B 2SEBD 1OXSC 1PFNA 3J7AF 1I4HA 5FLXE 1A3VA 2RVLA 2RSNA 4IALA 3FDTA 1I50B 4KMUC 2X6GA 4PV1C 3S1MB 2V4DA 3WDNA 4RCOA 4WORA 2F03A 5KYLA 1G91A 2QF7A 4OIKA 3HS0C 2O4XA 1EYCA 1NR4A 2DNCA 1ONLA 1DJRD 1ZEQX 1F2LA 1SMYD 5FO7B 1HPCA 2KUMA 2TSSA 2B8GA 4RKLA 2B39A 4RHRA 4R9WA 2AUJD 4Z9CB 3SDZA 2XWBB 3H91A 1MBYA 1Y8PB 3RZDB 4U68A 1EQVA 1PFMA 3URYA 2EYPA 3FKIB 4KJNA 3DUZA 1YNJC 4QMGA 4QCLA 2F3WA 1YNNC 2Q8RE 1TS4A 2K7VA 1DXMA 2B2VA 5D65A 2K1BA 3SVMA 1OO9B 2JXMB 3HOWB 3LWUA 1QILA 1BBXC 1HRJA 5CV7A 1IL8A 1LO5D 1S5CD 1STYA 4J8QA 1CTMA 2Z8LA 3NBHA 1CQFA 1R4QB 1CZWA 3BDOA 2C9OA 1D5ZC 1IKLA 1QE6A 1JICA 1V8QA 5CBAE 5IGGA 2KEEA 3GV3A 2MGSA 3QG1A 1BR9A 1KLGD 3TSSA 3MFGA 1PTOF 4OHJA 5JJZA 5DM73 3NHHA 4H0LC 3Q22A 1NCVA 4OIJA 2PO4A 3TP5A 1PZJD 2OEOA 2KOLA 4BA1I 3MWYW 4RGNA 3DWPA 3VR6A 1SYBA 4KKTA 2GA4B 1LT6D 3C46A 1KDAA 4F8MA 3X3MA 5C6AA 1C8CA 2IT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIH A;  3Q6S A;  4X3S A;  5DNF A;  1G6Z A;  1WTQ A;  1BO0 A;  2DY8 A;  4UAI A;  1ILQ A;  4HSV A;  4ZK9 B;  1NAP A;  4RAU C;  2NZ1 D;  4IUU A;  1ZXT A;  4CJ1 B;  4X3K A;  1B4O A;  5CBE E;  1GUW A;  1SAP A;  4IUT A;  5AFW A;  2XIW A;  1EOT A;  4CJ0 B;  2Q8R E;  2H1E A;  5EKI A;  1PFB A;  3R93 A;  4DN4 M;  2K03 A;  3ONA B;  1LV9 A;  3I3C A;  1IKM A;  4RWS C;  4HCS A;  2B2V A;  1HUM A;  1F9R A;  5COY A;  5D65 A;  4RA8 A;  2NWG A;  4IUR A;  2MPM A;  1JE4 A;  1DOM A;  1J9O A;  2K1B A;  2B2Y C;  3DM1 A;  1ROD A;  2BDN A;  4MN3 A;  5T1G A;  3SVM A;  1EIG A;  1E0B A;  2JYO A;  4XDX A;  1B50 A;  4ZKB B;  1F9S A;  1RJT A;  1G2S A;  1F9P A;  1SDF A;  2HCC A;  1DOK A;  2HDM A;  1VMP A;  2L4N A;  1RTO A;  1TVX A;  3G7L A;  5E4X A;  1MSH A;  1CM9 A;  2K01 A;  2DY7 A;  2FFK B;  1U4M A;  2FHT A;  3N52 A;  5D14 A;  1O7Y A;  2FJ2 A;  1BBX C;  3QO2 A;  1IL8 A;  2JP1 A;  2HUG A;  1CA5 A;  1NR2 A;  1HRJ A;  2EE1 A;  2B2Y A;  3UI2 A;  1BF4 A;  1QG7 A;  1RHP A;  3P7J A;  1AP0 A;  2SDF A;  1DON A;  2N88 A;  4XT1 B;  5EPJ A;  2N55 A;  2EPB A;  1PFN A;  3I91 A;  1U4L A;  2K04 A;  4IUQ A;  1WTV A;  3GV6 A;  1ICW A;  2CVR A;  2Q8T A;  4LMQ D;  1J8I A;  2RVL A;  3KBX A;  5CMD A;  2MP1 A;  2RSN A;  3DEP A;  2IL8 A;  2X69 A;  3FDT A;  5EPK A;  1QNK A;  2K05 A;  1IKL A;  4QUC A;  1KNE A;  2X6G A;  3IL8 A;  2B2W C;  2FIN B;  1X3Q A;  2L9H A;  2HCI A;  2KED A;  3F2U A;  1WTX A;  4HAE A;  1DZ1 A;  1U4R A;  2B2U C;  1KNA A;  1QE6 A;  1JIC A;  1U4P A;  4XT3 B;  5T1I A;  1HHV A;  1PDQ A;  5EPL A;  5CBA E;  2L12 A;  1XX8 A;  2KEE A;  4NW2 A;  3DEO A;  3GV3 A;  1AZP A;  4ZKC B;  1G91 A;  1Q3L A;  2MGS A;  1A15 A;  1EL0 A;  3FPU B;  2MJ8 A;  4OIK A;  4O42 A;  1WTR A;  1WTP A;  1B3A A;  4QUF A;  1AZQ A;  5EQ0 A;  2EOT A;  4CJ2 C;  1VMC A;  5JJZ A;  1RTN A;  1ESR A;  2R3Z A;  1WD1 A;  1HFN A;  4R8I A;  2J7Z A;  1HUN A;  1MGS A;  3KUP A;  1NR4 A;  2B2T C;  1NCV A;  4OIJ A;  5E4W C;  2B2U A;  1O80 A;  1WTO A;  2M2L A;  5COR A;  1B53 A;  2KOL A;  3D6W A;  3MWY W;  2L1B A;  2L11 A;  1BNZ A;  2HDL A;  1F2L A;  3MTS A;  2KUM A;  1MI2 A;  1G2T A;  1O7Z A;  2D9U A;  4HED A;  1WD0 A;  1CA6 A;  1M8A A;  1XYI A;  2X6L A;  1X3P A;  1ML0 D;  2RA4 A;  1PLF A;  1WVL A;  1HA6 A;  2RSO A;  3HP3 A;  1DOL A;  3LWE A;  3I90 A;  1HFG A;  2B2T A;  1S4Z A;  4R9W A;  4ZLT F;  4MHE A;  1SSO A;  3TN2 A;  2KVM A;  5EJW A;  2FMM A;  4X3U A;  2KEC A;  1F9Q A;  1X32 A;  3H91 A;  1WTW A;  2NYZ D;  4ZAI A;  4IUP A;  2K28 A;  1EQT A;  2B2W A;  4X3T A;  3I8Z A;  1C8C A;  1MSG A;  1ILP A;  1B2T A;  2B2V C;  4U68 A;  2VXW A;  4IUV A;  3IFD A;  3TZD A;  1PFM A; 
#chains in the Genus database with same CATH topology
 1EIH A;  1SE3 A;  3HKZ E;  2MFI A;  4YCU A;  5DNF A;  3HKZ G;  4CBV A;  1ILQ A;  4GZY C;  4EQ5 A;  1ZXT A;  1GOZ A;  1QZH A;  2EY5 A;  1SLJ A;  3D6C A;  2YU9 H;  1MKH A;  3AB9 A;  3DMU A;  3OSO A;  3ULL A;  1JWM D;  1A63 A;  3QR8 A;  1L1O C;  1U9R A;  5TSS A;  5FLM G;  1HUM A;  1TY2 A;  4A3I H;  4JPB W;  1LTB D;  3K7A B;  3OIP A;  1JE4 A;  3RD4 A;  2OTJ A;  2K5Q A;  4C2M B;  1AEX A;  2F0H A;  5E3F A;  3HOU G;  2VB2 X;  1V9P A;  4UP8 A;  1F9P A;  2B8F A;  1JJ2 A;  1PTO H;  2Z9H A;  3BVZ A;  4CDD C;  1Q8K A;  2OXP A;  4UDU C;  1U4M A;  2VL6 A;  3CCE A;  1XMQ Q;  1U5K A;  3NQI A;  5JEA G;  4Y7N H;  1C4Q A;  3R8B A;  1YHA A;  3D4R A;  3CCQ A;  3BZD B;  3GDE A;  5IGC A;  2JE6 I;  4ME3 A;  2IL8 A;  2XRQ D;  3T1H Q;  1QNK A;  1NTG A;  4QUC A;  1KNE A;  1NMF A;  5C3X A;  3X3N A;  1WTX A;  3PUZ A;  1TWF B;  4HAE A;  5IOD A;  4CHT B;  1U4P A;  2A6E C;  1BCP B;  3CF5 A;  1PTO D;  5HY6 A;  3C1E A;  3DXJ C;  2JA7 B;  3DEO A;  2F0I A;  4ZKC B;  1KQS A;  4KHZ A;  3ER0 A;  1VQI A;  4X6A H;  1U0L A;  4A76 A;  1AZQ A;  1S5D D;  1VMC A;  3OHX C;  2F3I A;  4LJZ C;  3VA5 A;  1VQF A;  4OWT B;  1EWI A;  5E4W C;  4DV4 Q;  5AJ3 L;  3HOV H;  1H9S A;  3I4M B;  4DK0 A;  4A3L G;  4FF1 A;  3MVV A;  3NWS A;  1MI2 A;  4BS9 A;  4NKL A;  4WJ4 A;  4A3B G;  4BY1 B;  3NUC A;  2R93 B;  2UUC Q;  2FXQ A;  3HP3 A;  2I07 B;  4X3U A;  3CXC A;  4DR1 L;  4CKC A;  1ZYR C;  4OO1 G;  2E8G A;  5M3F H;  5LMU L;  2A8V A;  2B2V C;  1FR3 A;  3IFD A;  1G29 1;  1JOR A;  4R8N A;  3NP8 A;  3TEH B;  2DY8 A;  1N33 Q;  3JC6 6;  3KLS X;  3T53 B;  3KJP A;  3QOJ A;  4LFA Q;  1STN A;  4IUT A;  2L15 A;  2XIW A;  3QOL A;  4CJ0 B;  3D0F A;  4N8F A;  2Z4H A;  4BBR G;  5DEH A;  1SXT A;  3R3O A;  3IKJ A;  1ROD A;  1TWC B;  3K5M A;  4B3R Q;  1PV4 A;  1F9S A;  1QOH A;  4KK7 A;  4RGT A;  3UDG A;  1YJN A;  4DFA A;  2JEB I;  4GOP B;  1Z7T A;  1TY0 A;  1Q82 C;  1X9N A;  5JEA J;  2F0G A;  2XWJ B;  1V1O A;  2JP1 A;  2EE1 A;  3RUZ A;  1PH2 A;  1ASZ A;  2BCO A;  4JI8 L;  1PH1 A;  2HQE A;  3I91 A;  5ELE A;  3GV6 A;  3P1H A;  2MP1 A;  3ZJY C;  2G9H D;  2WIN B;  2KED A;  1LT3 D;  1CFM A;  1YHQ A;  5C4Z A;  3RLF A;  1AE3 A;  2F0F A;  2CH4 A;  2OT2 A;  2JA7 G;  4JI1 L;  5CV5 A;  4ZYS A;  4DNI A;  2MNA A;  5BN3 A;  1I6V C;  2EOT A;  4UHV A;  4DAY A;  3KFU A;  1HA5 A;  4JI7 L;  3FRP B;  3CCU A;  2HHH L;  4EQN A;  3E3X A;  1K3B C;  4DK6 C;  3UE1 A;  5IGD A;  3I4M G;  4OWX B;  1NSN S;  3M4P A;  3Q0A A;  1W3S A;  1VQL A;  4NXM Q;  4LAA A;  4HN7 A;  3F1Z A;  3HOY H;  3VYR A;  1SYF A;  2F3V A;  4L63 B;  3EIV A;  5EKK A;  4BY1 G;  1QVC A;  1D1K A;  1TS2 A;  3J80 E;  2R93 G;  3V96 A;  1TWG B;  3HOU H;  3GTO H;  2FMM A;  3GTP B;  1X32 A;  3AFP A;  1FJG L;  1ENA A;  4TSS A;  4POF A;  3W1G A;  2K5D A;  2K50 A;  3A7A B;  4K2K A;  5JEA H;  1NAP A;  1IBK L;  1VQC A;  4C3I B;  1GUW A;  3KDF A;  4UP7 A;  3PUV A;  3A8I E;  4O0A A;  5AFW A;  3S1N H;  2JEA I;  3J81 j;  1IKM A;  4ULL A;  4UPA A;  1UAP A;  3K57 A;  3AMU A;  3HZX A;  4RA8 A;  3W1B A;  2VQF Q;  3L0O A;  3DWQ A;  3MEH A;  3CP0 A;  3MXN B;  3I2Z A;  1PH3 A;  1S40 A;  3B6Y A;  3HFZ B;  2CKZ B;  2A6H D;  1SFO B;  4IQZ A;  1D6E C;  1VMP A;  5M3M B;  4QY7 A;  3FEW X;  3L9A X;  3JAM c;  2G5D A;  2EJG C;  1SR3 A;  2O5J C;  4JI6 Q;  1WCM G;  4L6T B;  1JC7 A;  5IYC G;  1HNZ Q;  4DNT B;  3MHB A;  1BF4 A;  3P7J A;  2I5L X;  1EWH A;  5A2Q E;  4A3K H;  1DON A;  4A3L H;  1B9M A;  4V19 0;  1GHJ A;  2WFW A;  1Q86 C;  4IPD A;  4DF7 A;  3GTL H;  3VYU A;  3NQT A;  2Q2H A;  1HZA A;  4DR3 L;  1QNU A;  1TII D;  4ID6 A;  4E6I A;  4A3B H;  1PH4 A;  1K73 C;  2ZJR A;  1G8Z D;  1FYC A;  2BOS A;  4A93 H;  3VR4 A;  3BVG A;  1X65 A;  1HHV A;  1VQ9 A;  3S2H B;  3I7F A;  2KCN A;  4NW2 A;  3BG3 A;  3D4W A;  2RHS B;  5EQ0 A;  2F0L A;  1Y1W H;  3S1R H;  4C3J G;  1DM0 B;  1WD1 A;  2J7Z A;  5IYB G;  2H5X A;  5M9O A;  4FF4 A;  1SE2 A;  3TBI B;  3CCM A;  2F0W A;  2M2L A;  1A0I A;  1KDC A;  4DUZ L;  1VQA A;  2BA1 A;  2EYH A;  2OQK A;  5FKA C;  4A3G B;  1HR0 W;  4BBR H;  4HIO A;  1WD0 A;  1CI3 M;  1EY6 A;  2GVB A;  1MJC A;  3M7N A;  1EU3 A;  5FLX c;  2IW3 A;  1I3Q B;  4YIJ A;  2JSO A;  4F88 A;  4FYD A;  4BBS B;  4A3J B;  2JA6 B;  1BUV T;  5HGT A;  3BYY B;  4CDE C;  5LHY 1;  1STB A;  3H09 A;  1YVC A;  4LFC L;  2RDG A;  2R7F A;  5C0X G;  1I5F A;  4YWM A;  5JVH 3;  1HNW L;  4K5X A;  3TZD A;  4C3H B;  1MIU A;  3OOC A;  4V0B A;  1V1P A;  4X66 Q;  4IUU A;  5EKL A;  3MEF A;  4HMJ A;  4Q0F A;  4X64 L;  1O7I A;  4DK1 A;  2KCT A;  1AN8 A;  4DXF A;  4DAY B;  1PRT B;  1HXY D;  2H1E A;  5EKI A;  3ONA B;  4NXN L;  1X3F A;  3CKI B;  1OXX K;  1EY9 A;  4LUV A;  3VR2 A;  3A8J E;  2NWG A;  2MPM A;  2UXB L;  2PCF B;  4X65 L;  1PHJ A;  4K0K Q;  1YI2 A;  4DUY Q;  3W2D A;  1JB7 A;  3G6E A;  5M3M G;  2L4N A;  1T5X D;  2QDB A;  2ICE C;  4DR7 L;  2EYM A;  4QF4 A;  1STE A;  1S3O A;  5D14 A;  3S17 B;  4L5S A;  2C35 B;  3BZK A;  4RFB A;  1DYQ A;  1CKM A;  5I6W A;  5L37 A;  2NVT H;  3WOE A;  1I4X A;  3NBI A;  4DV3 Q;  1Z6H A;  4AIM A;  1PTO C;  4KY5 A;  3KJO A;  3LNN A;  3KBX A;  1KRS A;  2QGQ A;  3DEP A;  2X69 A;  5J3B A;  1QB5 D;  3CCL A;  5I2X A;  2ZXO A;  1RDP D;  1IYU A;  2ZT9 C;  2K33 A;  1ESF A;  1H9M A;  3QIA A;  3S1Q H;  3M4Y A;  1JR0 D;  5CC4 A;  2R7Z B;  1A15 A;  2K32 A;  2UUB L;  3IAY A;  1XJV A;  2QCP X;  4KHP L;  4A4I A;  4R8I A;  3GTK B;  4R4T A;  3PQI A;  3S16 B;  1WTO A;  2DJF C;  5IYD G;  1I4R A;  3E0J A;  1LTG D;  1IYV A;  3T56 B;  2D9U A;  3RN2 A;  4HED A;  4JOI C;  2X6L A;  2UXD Q;  2IX3 A;  2TMP A;  3NTI A;  2B2T A;  4BBS G;  4A3J G;  2JA6 G;  4DV0 L;  2YYZ A;  4EQO A;  3DLL A;  2KEC A;  4Y52 H;  4GN3 B;  3OTO Q;  2EIF A;  4I7A A;  4ZAI A;  2NZH A;  1RF2 D;  1WCM H;  1X55 A;  5C3E B;  1CK1 A;  2CW0 C;  4C3H G;  1YIT A;  1G6Z A;  3RNU A;  5I6Y A;  3CQZ B;  2IX1 A;  3GTQ H;  1AFP A;  4B3T Q;  3Q23 A;  4DR2 L;  4IFD G;  1SAP A;  1R9T H;  4C1N I;  1XPO A;  4YWK A;  4DXG A;  1K83 B;  5GQO A;  3QWN A;  4L8J A;  4C1N K;  4IUN A;  4P72 A;  2OQ0 A;  1UE1 A;  3GTJ B;  2CQO A;  3K5O A;  4XDX A;  1CZG A;  2K4K A;  4RGM A;  4JI4 Q;  3SHL A;  2RF4 A;  2Z6B A;  1MSH A;  3GP7 A;  1IBL Q;  1CM9 A;  4A3M H;  2QEJ C;  2NVQ H;  2L55 A;  2M00 A;  1O7Y A;  1LTI D;  3OMG A;  3FHW A;  4C3J H;  5FOB B;  4GNX B;  4GKJ L;  2PMZ E;  4ZQ3 A;  4NB3 A;  5D3D A;  3JAM i;  1FNV A;  4OON A;  4JBW A;  2K04 A;  3T16 A;  1MHW C;  2Q8T A;  3I73 A;  1EY0 A;  1EU4 A;  4B9W A;  3U9S A;  3G48 A;  2ES2 A;  1SN8 A;  4A3F B;  2RDF A;  3I56 A;  4L5R C;  5FK9 C;  2FMC A;  1D2B A;  1UE5 A;  2FIN B;  2IY5 B;  1XMQ L;  4IPH A;  2E5L Q;  4K5V A;  2KA7 A;  3EA6 A;  4JYA Q;  5M5Y H;  4HJ5 A;  4B9X A;  2BA0 A;  3CRL C;  4OL7 A;  2K5N A;  5IP9 H;  1A2T A;  2D5D A;  3L3O C;  5C0X H;  4O42 A;  2R7Z G;  1T5E A;  1EZ6 A;  3PO3 G;  3AU7 A;  3J7Y W;  3T1H L;  2E2H B;  1VF7 A;  2F0M A;  4H44 C;  3RZO H;  3BDL A;  3G4S A;  2F0V A;  1WI5 A;  5I9P A;  3NXW A;  4FXK C;  3FMC A;  5M5W H;  4K6L A;  2QIL A;  5M5X B;  5KYI A;  4XQN A;  4GKK L;  2SOB A;  4I65 A;  3CHB D;  2A69 D;  1K8M A;  2NN6 G;  1VQB A;  4LF4 Q;  3VDY A;  1IHZ A;  4DNR B;  2F1M A;  1WVL A;  2NTS A;  2PZU A;  3S14 B;  1IBM L;  2KVM A;  4FXG C;  1TR5 A;  1B3Q A;  1BOS A;  5IT9 L;  5C4J B;  5IGE A;  3Q24 A;  1WTW A;  3SK6 A;  4X3T A;  1EQT A;  4DV1 Q;  1B2T A;  3E0E A;  5C3E G;  3JAM L;  1L1O B;  1N9W A;  3RMH A;  3VR3 A;  1HZB A;  1FVI A;  4HSV A;  1YEZ A;  2R92 B;  1IW7 D;  2UUC L;  4K8J A;  1TWH H;  4BY7 B;  3T13 A;  4KY7 A;  4HCS A;  3J7A V;  5ELF A;  2MUY A;  4DV7 Q;  1O7L A;  2BH8 A;  3D4D A;  4IUR A;  3MC0 B;  1OXT A;  4HSP A;  1N33 L;  2JJQ A;  1I4Q A;  3KF8 A;  4LFA L;  1RTO A;  4JK1 C;  2D0P A;  3GTM H;  4KKU A;  1QVG A;  3FKI G;  3BS1 A;  2FHT A;  2EY1 A;  2FJ2 A;  4FO2 A;  3QO2 A;  1EEF D;  2AKW B;  1M90 C;  4KLK A;  1NY4 A;  3MXG A;  5IYD H;  2KQ3 A;  4B3R L;  4GKJ Q;  2XVS A;  3EBE A;  3PF5 A;  3SGI A;  1WTV A;  4N9T A;  3A55 A;  2PQE A;  2GVA A;  2XGT A;  3OW2 A;  1VQ5 A;  5D3I B;  3S2D H;  4PMC A;  1YHB A;  1EUJ A;  1X3Q A;  1QUQ B;  5C4H A;  5FLX L;  3K59 A;  1KNA A;  3HOW G;  5JOB A;  1HCZ A;  5EPL A;  4JW0 A;  5F2D A;  5IP7 G;  4P71 A;  5EBC A;  3M4O H;  2UU9 L;  4LUZ A;  5J39 A;  3IFT A;  1STG A;  4XYQ A;  4QJF A;  1II3 A;  4R4I A;  4G7Z C;  2VY3 A;  1PVO A;  1RTN A;  2R3Z A;  4HJ8 A;  2XNA C;  2B2T C;  1WOC A;  2B2U A;  1SE4 A;  1GXD C;  3WWV A;  2N3S A;  2QEX A;  3MTS A;  2JA8 B;  1GKH A;  5CR3 A;  2QA4 A;  4GKK Q;  3AQQ A;  1HA6 A;  3LWE A;  1EWC A;  1N8R C;  2O5I C;  1VQJ A;  1E2Z A;  1I6H H;  3BYT B;  1WYD A;  5EGT A;  1LYL A;  4K2L A;  2B29 A;  3RLO A;  4IUP A;  2PYK A;  2NVX H;  2D0O A;  3SK8 A;  1IBM Q;  3NEM A;  4IUV A;  4NXM L;  3TP8 A;  3J81 E;  3I4N H;  1Y1V B;  3TDQ A;  1N34 Q;  1PXU A;  4EVO A;  2R92 G;  3HOX H;  2G9D A;  5IGF A;  2PW5 A;  1SYC A;  3E9I A;  1H9K A;  2OTL A;  3K0Y A;  1UEB A;  4KD3 A;  2XSC A;  1LV9 A;  3NBH B;  4RCN A;  3F8T A;  2EYL A;  3PV0 A;  1EIY B;  1BBU A;  4LF7 Q;  1J9O A;  3DM1 A;  3E9H A;  1WJJ A;  2DUD A;  4R4C A;  3H0G H;  2UUA Q;  4DR4 Q;  5ISR A;  4PMB A;  1HTL D;  3OWF A;  4K8I A;  2F0Q A;  3PO2 H;  1YBY A;  4OX9 L;  1KC8 C;  2PQA A;  4QL5 A;  2KCC A;  1JJG A;  2JK8 A;  2K52 A;  1V1Q A;  4MZ9 A;  4ZCK A;  2QW7 A;  1TS5 A;  4R4Q A;  4OGQ C;  3NEL A;  3N52 A;  3V05 A;  5FJ8 H;  2B2Y A;  1DD2 A;  4KI0 A;  1NJI C;  2VQF L;  2BDO A;  1VF5 C;  1GM5 A;  1I4G A;  2B63 B;  3NEN A;  2HT1 A;  4FNF A;  2SNS A;  4WJW A;  2RQX A;  3VR5 A;  3M3Y B;  1U4L A;  1I50 H;  1XPU A;  3C3L A;  3OPO A;  3A5U A;  1VQD A;  4R4O A;  1HZ9 A;  2ZTC A;  4G7H C;  3S1M H;  4DAV A;  1SNQ A;  4JI6 L;  2B2W C;  2KHS A;  5KNB A;  1HNZ L;  1KL9 A;  4BA2 I;  1LT4 D;  2KHI A;  3I4O A;  3CMA A;  2WB1 B;  2CWA A;  1Q3L A;  5CGK A;  2WP8 J;  4MTN A;  1VQK A;  1A3U A;  3MFY A;  1W6K A;  2UU9 Q;  4DV6 L;  1XNR Q;  2E2I B;  3A54 A;  1GUN A;  1KAA A;  1NMG A;  4GLX A;  3ICE A;  1EYD A;  2HD3 A;  4H13 C;  5CV9 A;  2NVY B;  5C5L A;  3AYH B;  3RN5 A;  2HDL A;  5CYU A;  5ELO A;  3GO5 A;  2RCN A;  2JA8 G;  1O7Z A;  1CA6 A;  1E2W A;  3OW7 A;  1K0R A;  1HFG A;  1N36 L;  5EAY A;  2CQA A;  1SSO A;  3TRZ A;  3RZD H;  1SMY C;  3STB C;  1YNJ D;  3PIO A;  4ZRZ A;  3GTG B;  2K28 A;  2PZW A;  2NB0 A;  3FKI H;  2VUM B;  4TKO B;  3PIP A;  2LSS A;  3VA7 A;  2E2J B;  1HZC A;  1Y1V G;  4XQQ A;  3F2B A;  3SXH A;  2WAQ B;  5FLM H;  4J6H A;  5J22 A;  5NUC A;  4ALP A;  2UXC Q;  1PFB A;  2VB3 X;  3I3C A;  1UUP A;  1FGU A;  5KNC A;  1BXT A;  1D7Q A;  1BDO A;  2HQL A;  1IYJ B;  2RDH A;  4KN7 C;  3HOW H;  4ZKB B;  1PZI D;  2K5V A;  4X66 L;  4JOI A;  1RL2 A;  2O2L D;  3F2C A;  4IO9 A;  1KTK A;  3GQB A;  2EYO A;  1WFQ A;  3M85 A;  1QWY A;  3M7G A;  3CC4 A;  4OX9 Q;  3I70 A;  4QIW B;  4LF5 Q;  1K9M C;  4JCV E;  3CU7 A;  4FVM A;  3CPW A;  4K0K L;  2B63 G;  5EPJ A;  4DUY L;  1VQN A;  4WRD A;  4YHH Q;  1H9S B;  4IUQ A;  4HJ7 A;  1ICW A;  3KLS A;  4H02 A;  2MHV A;  4R1J A;  1QZG A;  1P16 A;  2A1A A;  3HOZ B;  2B2U C;  3PSI A;  3CRK C;  5C44 B;  3S15 B;  1GD7 A;  2WB1 E;  1CHQ D;  1XX8 A;  5IY0 A;  5HGQ A;  1EZ8 A;  4DV3 L;  4I7Z C;  3FPU B;  1VQ6 A;  1FGB D;  4PMW A;  2A69 C;  2J0T D;  1L0W A;  1TWA B;  4CDC C;  4RHS A;  5C5M A;  4F87 A;  4DU9 A;  1I94 Q;  4DV6 Q;  3R2T A;  2A74 C;  2L1B A;  1P8L A;  4O2D A;  1MJE A;  1SNM A;  1EYG A;  5C4X B;  2VW9 A;  5IOC A;  4L5T A;  1EIF A;  1X6O A;  3SE0 A;  3I90 A;  4ZLT F;  2B3G A;  2N78 A;  4OO1 H;  4X62 Q;  4KD4 A;  1BCP F;  1OXU A;  2JA5 B;  1IW7 C;  4IPC A;  2LFN A;  4M8A A;  3J7Z C;  1N36 Q;  1PZK D;  3ERO A;  2ZXP A;  4A3D B;  1W2B A;  4DK3 C;  4DGZ A;  2UXD L;  4A3E B;  4ZK9 B;  3A74 A;  2NZ1 D;  1VQ7 A;  1ET6 A;  4EGV A;  3M4Q A;  4PQX A;  4QB4 A;  1M4V A;  1STA A;  3K7A H;  1YIJ A;  5KND A;  3OTO L;  1LTT D;  1SYD A;  1CT1 D;  4C2M H;  2YU9 B;  4LFB Q;  4OWW B;  4DA2 A;  5CV4 A;  1ENC A;  4LW1 A;  5LMN W;  2B2Y C;  1E0B A;  4F7X A;  4A3I B;  1G2S A;  1UWV A;  4B3T L;  4JI0 L;  2RHQ B;  4KY6 A;  3P20 A;  1FNW A;  4CKB A;  5GAG C;  1F77 A;  1PTO B;  1Q46 A;  1CSQ A;  2IX0 A;  3NK9 A;  4C3I G;  2DNE A;  3J80 i;  1RIP A;  4QIW E;  1FD7 D;  3LX0 A;  1HQM C;  1RHP A;  5GRO A;  1A6X A;  1PYW D;  3MA2 B;  2NTT A;  2CWP A;  4JI4 L;  3D8G A;  2SNM A;  5J1Z A;  4AYB B;  4Y7N B;  5CMD A;  4KV6 A;  1TWF H;  4RH6 A;  1IBL L;  1RD9 D;  1B1Z A;  1SYG A;  5DAU A;  1GUS A;  2JA7 H;  3PIP 3;  3KF6 A;  5CV6 A;  2ID0 A;  3HOZ G;  3TP6 A;  2JQO A;  4B08 A;  2RCF A;  3G71 A;  5IT9 E;  1G6P A;  1VQ4 A;  1AW7 A;  4G7O C;  1WTP A;  3JAM E;  4AQY L;  3I4M H;  2CFM A;  1PH8 A;  3TZU A;  2OF1 A;  4FDB A;  3HEJ A;  2A5H A;  4JBM A;  3KUP A;  3MZ5 A;  1SE8 A;  2E5L L;  3PMF A;  4JYA L;  3KDF B;  3PF4 A;  1VDZ A;  1TQO A;  3HOV B;  5C4X G;  1R4P B;  2E75 C;  4BY1 H;  2R93 H;  1JMC A;  1BCP D;  4A3C G;  2AUK A;  1ML0 D;  2V1C C;  4CDF C;  2RSO A;  2LS0 1;  4LF8 Q;  1I4P A;  1UNS A;  4DR6 L;  1LLR D;  5KEE A;  2M9V A;  4FP5 D;  2ZXR A;  4LUO A;  3I4L A;  1E7Z A;  1HR0 L;  3TS0 A;  4BXX G;  4LF4 L;  4A3D G;  2N49 A;  4NDX A;  5M3F B;  4X3K A;  1E3P A;  4A3G G;  1C0A A;  1ICF B;  4TQU S;  4HJA A;  1EY4 A;  5CV8 A;  5DM6 3;  1SRU A;  2AWO A;  2C5C A;  5LMN L;  3HGB A;  2RBM A;  2K03 A;  5BN5 A;  4GS3 A;  2LKV A;  3ERQ A;  4YCV A;  1TWC H;  4DV1 L;  1PH6 A;  3ND9 A;  3K5N A;  5C0X J;  3CW2 C;  2F4I A;  3C2P A;  1J6Q A;  4UY8 C;  4A3I G;  4XIG S;  1VQH A;  3KLR A;  1DOK A;  3EQL C;  3IRB A;  2QDL A;  5IYC H;  4JG2 A;  1VQG A;  3MXU A;  4XYO A;  2EQS A;  1S5B D;  2FFK B;  4G4K A;  4FF3 A;  4JI0 Q;  1AE2 A;  1UE6 A;  2HUG A;  4EX5 A;  4DV7 L;  4HMI A;  4M1U B;  1B8A A;  2PNR C;  3NSW A;  2SDF A;  1GUT A;  2EYJ A;  1Y14 B;  3U9O A;  4LNQ A;  4PNY A;  4AYB E;  4LMQ D;  4AYB G;  1TKW B;  5A2Q L;  3U58 A;  3ND8 A;  1LAB A;  2QKI C;  3F2U A;  2HCI A;  4G57 A;  1DZ1 A;  2WII B;  1PDQ A;  4RGO S;  3V2T A;  2E2D C;  1AZP A;  1VQO A;  2EDG A;  5IYB H;  1EL0 A;  2MJ8 A;  3A8K E;  1H9R A;  4GN4 B;  4UP9 A;  1D8L A;  2JN4 A;  4HIK A;  4FF2 A;  1XXG A;  1ZKO A;  1QJO A;  1K8A C;  2I5H A;  1XNQ L;  1EY5 A;  1GVP A;  2F0O A;  4AQY Q;  4J1M A;  3AFQ A;  4IZ8 A;  1E2V A;  3T51 B;  1V1P B;  1X54 A;  1B53 A;  3HKZ B;  2XRS D;  2K5W A;  2EVB A;  3HOV G;  4BWG B;  3M9B A;  4JV5 Q;  4OO1 I;  1BBW A;  4TRD A;  1TWG H;  1PMR A;  1X3P A;  4DV2 Q;  3GTP H;  3CD6 A;  3QJY A;  1ET9 A;  3HOY B;  3G6J B;  3U4Z A;  4IOA A;  1TXY A;  3N6R A;  3KLW A;  3HOU B;  2B2W A;  3GTO B;  5IGB A;  1S72 A;  4DR6 Q;  1SJE D;  3KF6 B;  5KRU A;  4C3I H;  4X3S A;  5IIF A;  1STH A;  1BO0 A;  3OIQ A;  5JVG 3;  1HR0 Q;  4P74 A;  5I4D A;  1B4O A;  3MXP A;  1T9H A;  2EXZ A;  1VQP A;  2K6A A;  1QCB D;  3BVM A;  3I72 A;  1KAW A;  1LTL A;  1VQE A;  4IPG A;  3S1N B;  3J7A 5;  1A3T A;  5LMN Q;  1SFO H;  1N32 Q;  5ELN A;  2CH4 W;  3W5O A;  5M3M H;  5KIX A;  4MIU A;  2JYO A;  3L7Z C;  1N34 L;  4GN5 A;  2VS1 A;  1SDF A;  3EFX D;  3D3R A;  3S24 A;  4IFD J;  1A8V A;  4WFN 3;  1MD2 D;  2K01 A;  3H94 A;  4KN4 C;  3KBG A;  1VQ8 A;  1NR2 A;  4PZ6 A;  3UI2 A;  5GAE C;  4LF7 L;  1AP0 A;  2A6H C;  5HUR A;  3J81 c;  3T4A C;  2UUA L;  4DR4 L;  3GD7 A;  1F2Y A;  2Q2U A;  4A3K B;  1O78 A;  1PRT F;  2H4O A;  3OWE B;  5FO8 B;  1VCI A;  1YZ6 A;  3PUY A;  4A3C H;  1JB3 A;  2K05 A;  3K0X A;  3GTL B;  3CCJ A;  3S2H H;  4Q5V A;  1K3R A;  4ABN A;  1JWU D;  4A3B B;  2L5T A;  3OYY A;  4GOP A;  1EQR A;  3A56 A;  3BJU A;  4XXE A;  1LT5 D;  4NP5 A;  4A93 B;  1B3A A;  4QUF A;  3NWT A;  3FPP A;  4LK1 C;  1GJX A;  1BVS A;  2HIX A;  2AWN A;  1ESR A;  2Y0S B;  1HUN A;  1MGS A;  4XQJ A;  4HIM A;  1JCK B;  1HTP A;  1Y1W B;  4ZUI A;  3S1R B;  4A3G H;  3EVQ A;  2J4X A;  2F0E A;  1S5F D;  5KGU A;  4DV5 Q;  1Z9F A;  4A3F G;  1XNQ Q;  1I3Q H;  3O13 A;  4JI2 Q;  4BBS H;  5E1F A;  4A3J H;  2JA6 H;  3PCO B;  1M8A A;  2LXJ A;  3HRZ C;  1XNR L;  2F0U A;  2Q8I B;  4BBR B;  1S4Z A;  4MHE A;  1EFI D;  3HOY G;  3TN2 A;  1Y8O B;  4B3S Q;  1Y8N B;  1EEI D;  1F9Q A;  4C3H H;  4WJ3 M;  3H3V H;  4A75 A;  3HG9 A;  2NZO A;  1Q7Y C;  3I8Z A;  1FNU A;  2EZV A;  4IFD H;  3Q6S A;  4APV A;  4P73 A;  2BE5 D;  1V43 A;  4GLV B;  2EY2 A;  2DGY A;  2ZTE A;  3P75 A;  4ME5 A;  1KDB A;  4RWS C;  1J5E L;  2RKS A;  3ITP A;  1E1T A;  3NE5 B;  4CKE A;  3DHQ A;  3H15 A;  4MN3 A;  5T1G A;  1IXR A;  4FXD A;  1XMO Q;  1RJT A;  4JVZ A;  2HDM A;  4GLA C;  1NUC A;  1K28 A;  1SNO A;  4JI5 Q;  1TS3 A;  3S17 H;  5E4X A;  3MAQ A;  2ATW A;  2CHB D;  2UXC L;  3E6Z X;  1WTH A;  1F2Z A;  3OMC A;  4RG1 A;  4BY7 G;  4B3M L;  1PRT D;  1CHP D;  1Q1E A;  2NUC A;  1CKN A;  4XT1 B;  1RKN A;  1JOQ A;  2VNU D;  2PZT A;  2CVR A;  4ZUJ A;  4A3K G;  2A68 D;  4OXP A;  2NVT B;  2HIV A;  3MXN A;  3J80 c;  2E76 C;  1Z47 A;  4YY3 Q;  2L9H A;  1HJP A;  1UEA B;  1U4R A;  4LF5 L;  4IN3 A;  2R7Z H;  2AQ1 B;  1L0X B;  3UDF A;  3PO3 H;  4YHH L;  2KEN A;  3TQY A;  1WTR A;  3K6O A;  5K36 G;  4A93 G;  2L0C A;  3GTK H;  2PPB C;  3DWA A;  4XTC S;  5FO9 B;  3S16 H;  3S1Q B;  2Y0S E;  1EQQ A;  1XPR A;  1JJC B;  2Y0S G;  4OEM B;  1BCP C;  2K75 A;  1D5M C;  2NN6 H;  1O80 A;  1Y1W G;  1B44 D;  3SK5 A;  3ULJ A;  1Y69 U;  2IJ0 A;  1Q90 A;  4C56 C;  2PI2 A;  3H6M A;  1EFW A;  5C0X I;  3W3A A;  2D2C C;  2YTX A;  2CW0 D;  2F0T A;  1A2U A;  2R61 A;  4RKB A;  2VQE L;  5JAV A;  4LWC A;  5EJW A;  5C3E H;  1I94 L;  1M1K C;  3KF8 B;  4O1N A;  2EY6 A;  5ELB A;  5LL6 X;  1GHK A;  1ILP A;  2AQ2 B;  3CQZ H;  2IWH A;  4DPG A;  4DAP A;  5C3W A;  3FVQ A;  5JJK A;  4LF9 L;  4UAI A;  4ILW A;  3K58 A;  1WCM B;  3K5L A;  1K83 H;  2XN9 C;  5CBE E;  3EN2 A;  3VYT A;  1EOT A;  4X62 L;  1C48 A;  3GTQ B;  4PZ8 A;  3GTJ H;  3CCR A;  1EY8 A;  2R6G A;  1R9T B;  3SR1 A;  3ERS X;  4K14 A;  4JI3 L;  3CAM A;  4AH6 A;  2ICI A;  2Z4I A;  1J5E Q;  1EIG A;  2DJG C;  1B50 A;  3HKS A;  3BDC A;  1HH2 P;  1YNN D;  1KLU D;  2EYF A;  3AEV A;  5BR8 L;  5JPM C;  1S5E D;  2ZJQ A;  3G7L A;  1EY7 A;  2DY7 A;  4KHV A;  2Z6K A;  1OXV A;  2D62 A;  1K8O A;  2DN8 A;  3KYH C;  5IE8 A;  4A3M B;  4LFB L;  1JQY D;  2NVQ B;  4C3J B;  2N55 A;  2EPB A;  2Z1C A;  4GOP C;  2F0P A;  4NPS A;  4A3F H;  4RMF A;  5A35 A;  1K8G A;  1D5X C;  4B3M Q;  2WAC A;  4EQP A;  1CUK A;  5EPK A;  3J81 i;  1HQR D;  5BN4 A;  3NTK A;  3WOF A;  5IP7 H;  1JT8 A;  5AJ3 Q;  1H9J A;  4XT3 B;  3SK4 A;  5T1I A;  1F2M A;  2L12 A;  2EJF C;  1KAB A;  2E2H H;  1SJH D;  5M5Y B;  1EYA A;  1PA6 A;  1LTR D;  4CJ2 C;  2F52 A;  1BQQ T;  4JBJ A;  4CGY B;  2MO0 A;  5M5X H;  1JOO A;  2A73 B;  2IHF A;  3A7L A;  4DR1 Q;  1GUO A;  1Q81 C;  5COR A;  3D6W A;  1BNZ A;  1YJ9 A;  2I5M X;  4HR7 B;  5LMU Q;  4DAM A;  3RZO B;  3UE0 A;  4N9P A;  4N8X 1;  2EXD A;  3S14 H;  1LTA D;  5M5W B;  1CKN B;  2YV5 A;  3ULP A;  1XYI A;  4KKS A;  2RA4 A;  2Q2T A;  1DOL A;  2WB1 G;  4MTK A;  4P2C B;  5C4J H;  3H3V I;  1VS0 A;  2AQ3 B;  1GO3 E;  1YNX A;  2YTY A;  1KRT A;  4IFD I;  2NYZ D;  2VQE Q;  3U4V A;  5IT9 c;  1LAC A;  2PQA B;  5ELD A;  2OWO A;  2R92 H;  2VXW A;  1SNP A;  4BY7 H;  2F0J A;  1WTQ A;  3KOJ A;  3PGZ A;  1LUZ A;  5ELC A;  4CJ1 B;  1NE3 A;  4HJ9 A;  1SND A;  1B70 B;  4LF8 L;  3J81 L;  4LF9 Q;  2ENB A;  4DN4 M;  2F0K A;  3R93 A;  3CC2 A;  1TWH B;  1Q12 A;  2ZM6 L;  2KHJ A;  4K6D A;  1F9R A;  5COY A;  2F0N A;  4YWL A;  1DOM A;  2BDN A;  4JI8 Q;  1ENF A;  2F0S A;  5I2Y A;  1SYE A;  4HID A;  2VUM G;  4JI3 Q;  3TS2 A;  1CQV A;  5K36 H;  5BR8 Q;  3A0J A;  2WAQ E;  4K5W A;  3GTM B;  3CC7 A;  1KD1 C;  1E1O A;  2WAQ G;  1H95 A;  3PUX A;  1QG7 A;  4A3M G;  3E5S A;  2N88 A;  5LL6 S;  4S3S A;  1NBW A;  5G3L F;  4KJO A;  4JI1 Q;  1J8I A;  2KJX A;  1CSP A;  1DCZ A;  2WKC A;  4JI7 Q;  2KCM A;  3IL8 A;  2HHH Q;  3K8A A;  1RCV D;  3Q8D A;  3S2D B;  1EOV A;  2K14 A;  3TME A;  2AHO B;  3D31 A;  3LGJ A;  2KBN A;  4U67 3;  2GN5 A;  2EJM A;  3TP7 A;  1L0Y B;  4GNX A;  2NBF A;  3M4O B;  2NN6 I;  1HNX L;  2A6E D;  4JC0 A;  1HFN A;  5IP9 G;  1XTC D;  1GUG A;  3F2D A;  4DKA C;  2JA8 H;  1SNC A;  4HCE A;  3PIO 3;  2L11 A;  2Q2I A;  1FJG Q;  4QGU A;  3ZYY X;  1G2T A;  2ALY B;  2F0D A;  3K80 C;  2WKD A;  1TU2 B;  5C44 G;  1PLF A;  1PH7 A;  1IBK Q;  2WV6 D;  3R2I A;  4HTH A;  2I0Q A;  4H7B A;  3CPF A;  2BE5 C;  5GAH C;  3I55 A;  5EBD A;  1IZ6 A;  1FL0 A;  1D1I A;  1Y1V H;  1MSG A;  3NTH A;  3BU2 A;  1I6H B;  2OCE A;  1B7Y B;  1XTD A;  4JV5 L;  1SEB D;  1JWS D;  2ZTD A;  2NVX B;  4DV2 L;  3VYS A;  4RAU C;  1PYS B;  3T1Y L;  3NPP A;  4ODG A;  3I4N B;  1ZYR D;  1Q1B A;  1Q8I A;  2PMZ B;  3HOX B;  3QB3 A;  2LY7 A;  2IPK D;  1UE7 A;  3H3V C;  4KTA A;  1B9N A;  2I46 A;  2Z6K C;  3C1F A;  1XWE A;  3KK7 A;  1W6J A;  2E74 C;  5JJI A;  2JA5 G;  1LTS D;  4OEL B;  1PYB A;  2ZM6 Q;  2CCZ A;  5H1S E;  2K5H A;  4NMZ A;  1JOK A;  1PFS A;  2PW7 A;  3J80 L;  4YCW A;  5JPN C;  2PI2 E;  2HCC A;  1C7Y A;  1PRT C;  2N8N A;  5E7N A;  1SBB B;  3S9W A;  5I9O A;  3H0G B;  1TVX A;  1YJW A;  4DR3 Q;  1L1O A;  4A3E G;  3PO2 B;  1TT2 A;  5G3L D;  2LMC B;  2B63 H;  3PUW A;  3SEB A;  5K5P A;  1CA5 A;  2A68 C;  3EJI A;  2XTI A;  1N32 L;  3M3Y H;  1NNX A;  3PO3 B;  2SEB D;  2F4V L;  1OTC A;  1OXS C;  1PFN A;  4DR5 L;  3J7A F;  1I4H A;  1E22 A;  5FLX E;  2RVL A;  1A3V A;  3CME A;  2RSN A;  4IAL A;  3FDT A;  1I50 B;  4IOC A;  4KMU C;  2X6G A;  3CCV A;  4PV1 C;  3S1M B;  1KXL A;  4J15 A;  2V4D A;  4DUZ Q;  3WDN A;  5DLQ E;  4RCO A;  4WOR A;  3A5Z B;  2F03 A;  5KYL A;  1G91 A;  1SMX A;  2QF7 A;  2E2I H;  1IL2 A;  4OIK A;  3CCS A;  1E24 A;  2NVY H;  3HS0 C;  1LM0 A;  3FP9 A;  2O4X A;  1EYC A;  1NR4 A;  2DNC A;  2ASB A;  1ONL A;  1HNX Q;  2MO1 A;  1DJR D;  4LFC Q;  1ZEQ X;  1F2L A;  1SMY D;  5FO7 B;  3STB D;  1HPC A;  2KUM A;  5IWA L;  1HNW Q;  2TSS A;  2B8G A;  4RKL A;  2B39 A;  4RHR A;  3DM3 A;  4L5Q A;  1QUQ A;  4LF6 L;  4R9W A;  4X64 Q;  2AUJ D;  4Z9C B;  3SDZ A;  3GTG H;  1PH9 A;  2A19 A;  2VUM H;  2BH2 A;  2YTV A;  2XWB B;  3H91 A;  4NXN Q;  4DV5 L;  1MBY A;  2ZJP A;  2E2J H;  1QVF A;  1X3G A;  1Y8P B;  2PNH A;  1SRO A;  3RZD B;  4U68 A;  2UXB Q;  4JI2 L;  1EQV A;  1PFM A;  3URY A;  4X65 Q;  1PH5 A;  5JJL A;  2EYP A;  3UDX A;  3FKI B;  4KJN A;  4MNO A;  3DUZ A;  4PG3 A;  4PZ7 A;  5GAD C;  1YNJ C;  4QMG A;  4QCL A;  3TRE A;  1X3E A;  3I4N G;  2F3W A;  4DR7 Q;  2LXK A;  4B3S L;  1YNN C;  2Q8R E;  1TS4 A;  2K7V A;  1DXM A;  1G51 A;  3HOX G;  3T1Y Q;  2B2V A;  5D65 A;  2K1B A;  3SVM A;  3UDI A;  1K0S A;  1OO9 B;  1BKB A;  2JXM B;  3H0G G;  3RLN A;  3HOW B;  1KIX A;  5M3F G;  3PO2 G;  3LWU A;  1QIL A;  1BBX C;  1HRJ A;  5CV7 A;  1IL8 A;  1LO5 D;  1S5C D;  4P75 A;  1STY A;  2MQH A;  1KHI A;  4J8Q A;  1CKO A;  1CTM A;  1XMO L;  5FJ8 G;  2Z8L A;  3NBH A;  2UUB Q;  1CQF A;  1R4Q B;  4JI5 L;  4KHP Q;  1ASY A;  4GNX C;  2F4V Q;  1CZW A;  3BDO A;  3HOZ H;  1DGS A;  1L2F A;  2C9O A;  4DR5 Q;  1D5Z C;  5C44 H;  3S15 H;  1IKL A;  4QQB X;  1QE6 A;  1JIC A;  1V8Q A;  3RR5 A;  3U50 C;  5CBA E;  5IGG A;  2KEE A;  3GV3 A;  2MGS A;  3QG1 A;  1BR9 A;  4DV4 L;  1KLG D;  1TWA H;  4JBK A;  3TSS A;  3MFG A;  1PTO F;  4OHJ A;  5JJZ A;  2P5Z X;  5DM7 3;  2R7D A;  3NHH A;  1VQM A;  4POG A;  1A62 A;  2AMC B;  3BZC A;  4DV0 Q;  4H0L C;  3Q22 A;  5C4X H;  1NCV A;  4OIJ A;  2PO4 A;  3TP5 A;  4YY3 L;  1PZJ D;  4IJL A;  2OEO A;  2KOL A;  3MWY W;  4BA1 I;  1AH9 A;  4RGN A;  3DWP A;  4IJH A;  3VR6 A;  2IHE A;  4TVA B;  1SYB A;  4KKT A;  2GA4 B;  3K7U C;  3K81 C;  1JE5 A;  2JA5 H;  5IWA Q;  3L2P A;  4DR2 Q;  1LT6 D;  3C46 A;  1KDA A;  4F8M A;  4LF6 Q;  4BXX H;  4A3D H;  1C9O A;  2Z0S A;  3X3M A;  5C6A A;  2JA9 A;  1C8C A;  4A3E H;  2VZA A;  2IT1 A;  1X56 A; 
#chains in the Genus database with same CATH homology
 1EIH A;  1SE3 A;  5DNF A;  4CBV A;  1ILQ A;  4GZY C;  1ZXT A;  1GOZ A;  2EY5 A;  3D6C A;  3AB9 A;  3DMU A;  3OSO A;  1JWM D;  1U9R A;  5TSS A;  1HUM A;  1TY2 A;  1LTB D;  3K7A B;  3OIP A;  1JE4 A;  3RD4 A;  2K5Q A;  4C2M B;  1AEX A;  2F0H A;  5E3F A;  2VB2 X;  1F9P A;  2B8F A;  1PTO H;  3BVZ A;  2OXP A;  4UDU C;  1U4M A;  3NQI A;  5JEA G;  1C4Q A;  3R8B A;  3D4R A;  3BZD B;  5IGC A;  2JE6 I;  2IL8 A;  2XRQ D;  1QNK A;  4QUC A;  1KNE A;  5C3X A;  3X3N A;  1WTX A;  3PUZ A;  1TWF B;  4HAE A;  5IOD A;  4CHT B;  1U4P A;  2A6E C;  1BCP B;  1PTO D;  3C1E A;  3DXJ C;  2JA7 B;  3DEO A;  2F0I A;  4ZKC B;  4KHZ A;  1AZQ A;  1S5D D;  1VMC A;  3OHX C;  4LJZ C;  3VA5 A;  5E4W C;  1H9S A;  3I4M B;  4DK0 A;  4FF1 A;  3MVV A;  3NWS A;  1MI2 A;  4BS9 A;  4NKL A;  4BY1 B;  3NUC A;  2R93 B;  3HP3 A;  2I07 B;  4X3U A;  4CKC A;  1ZYR C;  4OO1 G;  2B2V C;  1FR3 A;  3IFD A;  1G29 1;  1JOR A;  4R8N A;  3NP8 A;  2DY8 A;  3KLS X;  3T53 B;  3QOJ A;  1STN A;  4IUT A;  2XIW A;  3QOL A;  4CJ0 B;  2Z4H A;  5DEH A;  1SXT A;  3R3O A;  3IKJ A;  1ROD A;  1TWC B;  3K5M A;  1F9S A;  1QOH A;  4KK7 A;  4RGT A;  4DFA A;  2JEB I;  1Z7T A;  1TY0 A;  5JEA J;  2F0G A;  2XWJ B;  1V1O A;  2JP1 A;  2EE1 A;  3RUZ A;  2BCO A;  2HQE A;  3I91 A;  5ELE A;  3GV6 A;  3P1H A;  2MP1 A;  2G9H D;  2WIN B;  2KED A;  1LT3 D;  1CFM A;  5C4Z A;  3RLF A;  2F0F A;  2OT2 A;  5CV5 A;  4ZYS A;  5BN3 A;  1I6V C;  2EOT A;  4DAY A;  1HA5 A;  3FRP B;  4EQN A;  5IGD A;  1NSN S;  3Q0A A;  4LAA A;  4HN7 A;  3VYR A;  1SYF A;  2F3V A;  4L63 B;  5EKK A;  1D1K A;  1TS2 A;  3J80 E;  3V96 A;  1TWG B;  2FMM A;  3GTP B;  1X32 A;  1ENA A;  4TSS A;  2K5D A;  3A7A B;  4K2K A;  5JEA H;  1NAP A;  4C3I B;  1GUW A;  5AFW A;  3PUV A;  3A8I E;  2JEA I;  1IKM A;  4ULL A;  3K57 A;  1UAP A;  3AMU A;  3HZX A;  4RA8 A;  3DWQ A;  3MEH A;  2A6H D;  1SFO B;  4IQZ A;  1D6E C;  1VMP A;  5M3M B;  3FEW X;  3L9A X;  2O5J C;  2EJG C;  4L6T B;  1JC7 A;  4DNT B;  3MHB A;  1BF4 A;  3P7J A;  1EWH A;  5A2Q E;  1DON A;  1B9M A;  4V19 0;  1GHJ A;  4DF7 A;  3VYU A;  3NQT A;  1QNU A;  1TII D;  4ID6 A;  4E6I A;  1G8Z D;  1FYC A;  2BOS A;  3VR4 A;  3BVG A;  1HHV A;  3S2H B;  2KCN A;  4NW2 A;  3BG3 A;  3D4W A;  5EQ0 A;  2F0L A;  4C3J G;  1DM0 B;  1WD1 A;  2J7Z A;  4FF4 A;  5M9O A;  1SE2 A;  3TBI B;  2F0W A;  2M2L A;  1KDC A;  2BA1 A;  2EYH A;  5FKA C;  4A3G B;  1WD0 A;  1CI3 M;  1EY6 A;  3M7N A;  1EU3 A;  2IW3 A;  1I3Q B;  4YIJ A;  2JSO A;  4F88 A;  4FYD A;  4BBS B;  4A3J B;  2JA6 B;  1BUV T;  5HGT A;  3BYY B;  5LHY 1;  1STB A;  3H09 A;  2RDG A;  5C0X G;  5JVH 3;  4K5X A;  3TZD A;  4C3H B;  3OOC A;  4V0B A;  1V1P A;  4IUU A;  5EKL A;  4HMJ A;  4Q0F A;  4DK1 A;  1AN8 A;  4DXF A;  1PRT B;  1HXY D;  2H1E A;  5EKI A;  3ONA B;  3CKI B;  1OXX K;  1EY9 A;  3VR2 A;  3A8J E;  2NWG A;  2MPM A;  2PCF B;  3W2D A;  2L4N A;  1T5X D;  2QDB A;  2ICE C;  2EYM A;  4QF4 A;  1STE A;  5D14 A;  3S17 B;  4RFB A;  1DYQ A;  5I6W A;  3WOE A;  1I4X A;  3NBI A;  1Z6H A;  1PTO C;  4KY5 A;  3LNN A;  3KBX A;  3DEP A;  2X69 A;  1QB5 D;  5I2X A;  2ZXO A;  1RDP D;  1IYU A;  2ZT9 C;  2K33 A;  1ESF A;  1H9M A;  3QIA A;  3M4Y A;  1JR0 D;  5CC4 A;  2R7Z B;  1A15 A;  2K32 A;  3IAY A;  2QCP X;  4R8I A;  3GTK B;  3S16 B;  1WTO A;  1I4R A;  3E0J A;  1LTG D;  1IYV A;  3T56 B;  2D9U A;  4HED A;  2X6L A;  2IX3 A;  2TMP A;  3NTI A;  2B2T A;  2YYZ A;  4EQO A;  2KEC A;  4ZAI A;  1RF2 D;  5C3E B;  1CK1 A;  2CW0 C;  4C3H G;  1G6Z A;  5I6Y A;  3CQZ B;  2IX1 A;  1AFP A;  3Q23 A;  4IFD G;  1SAP A;  4C1N I;  4DXG A;  1K83 B;  3QWN A;  4L8J A;  4C1N K;  4IUN A;  3GTJ B;  3K5O A;  4XDX A;  1CZG A;  4RGM A;  3SHL A;  1MSH A;  3GP7 A;  1CM9 A;  2QEJ C;  2L55 A;  2M00 A;  1O7Y A;  1LTI D;  3OMG A;  5FOB B;  4ZQ3 A;  5D3D A;  1FNV A;  4JBW A;  2K04 A;  3T16 A;  2Q8T A;  3I73 A;  1EY0 A;  1EU4 A;  4B9W A;  3U9S A;  4A3F B;  2RDF A;  5FK9 C;  2FMC A;  1D2B A;  2FIN B;  4K5V A;  2KA7 A;  3EA6 A;  4B9X A;  2BA0 A;  3CRL C;  4OL7 A;  1A2T A;  2D5D A;  3L3O C;  5C0X H;  4O42 A;  1T5E A;  1EZ6 A;  3AU7 A;  3J7Y W;  2E2H B;  1VF7 A;  2F0M A;  4H44 C;  3BDL A;  2F0V A;  5I9P A;  3NXW A;  4FXK C;  3FMC A;  4K6L A;  2QIL A;  5M5X B;  5KYI A;  4XQN A;  2SOB A;  4I65 A;  3CHB D;  2A69 D;  1K8M A;  2NN6 G;  1IHZ A;  4DNR B;  2F1M A;  1WVL A;  2NTS A;  2PZU A;  3S14 B;  2KVM A;  4FXG C;  1TR5 A;  1BOS A;  5IT9 L;  5C4J B;  5IGE A;  3Q24 A;  1WTW A;  3SK6 A;  4X3T A;  1EQT A;  1B2T A;  3JAM L;  3RMH A;  3VR3 A;  4HSV A;  2R92 B;  1IW7 D;  4K8J A;  4BY7 B;  3T13 A;  4KY7 A;  4HCS A;  3J7A V;  5ELF A;  2MUY A;  1O7L A;  3D4D A;  4IUR A;  3MC0 B;  1OXT A;  4HSP A;  1I4Q A;  3KF8 A;  1RTO A;  4JK1 C;  4KKU A;  3BS1 A;  2FHT A;  2EY1 A;  2FJ2 A;  4FO2 A;  3QO2 A;  1EEF D;  3MXG A;  2KQ3 A;  2XVS A;  1WTV A;  4N9T A;  3A55 A;  2PQE A;  5D3I B;  4PMC A;  1X3Q A;  5C4H A;  5FLX L;  3K59 A;  1KNA A;  5JOB A;  1HCZ A;  5EPL A;  5F2D A;  5EBC A;  5J39 A;  3IFT A;  1STG A;  4XYQ A;  1II3 A;  4G7Z C;  1RTN A;  2R3Z A;  2XNA C;  2B2T C;  2B2U A;  1SE4 A;  1GXD C;  3MTS A;  2JA8 B;  5CR3 A;  1HA6 A;  3LWE A;  1EWC A;  2O5I C;  1E2Z A;  3BYT B;  5EGT A;  4K2L A;  4IUP A;  2PYK A;  3SK8 A;  4IUV A;  3TP8 A;  3J81 E;  1Y1V B;  3TDQ A;  1PXU A;  4EVO A;  2G9D A;  5IGF A;  2PW5 A;  1SYC A;  1H9K A;  3K0Y A;  4KD3 A;  2XSC A;  1LV9 A;  4RCN A;  2EYL A;  3PV0 A;  1J9O A;  3DM1 A;  5ISR A;  4PMB A;  1HTL D;  3OWF A;  4K8I A;  2F0Q A;  2KCC A;  1TS5 A;  4OGQ C;  3N52 A;  3V05 A;  2B2Y A;  1DD2 A;  4KI0 A;  2BDO A;  1VF5 C;  1I4G A;  2B63 B;  4FNF A;  2SNS A;  4WJW A;  2RQX A;  3VR5 A;  3M3Y B;  1U4L A;  3C3L A;  3OPO A;  4G7H C;  4DAV A;  1SNQ A;  2B2W C;  2KHS A;  5KNB A;  4BA2 I;  1LT4 D;  2WB1 B;  1Q3L A;  5CGK A;  2WP8 J;  1A3U A;  3MFY A;  1W6K A;  2E2I B;  3A54 A;  1GUN A;  1KAA A;  1EYD A;  4H13 C;  5CV9 A;  2NVY B;  5C5L A;  2HDL A;  5CYU A;  3GO5 A;  1O7Z A;  1CA6 A;  1E2W A;  3OW7 A;  1HFG A;  2CQA A;  1SSO A;  1SMY C;  1YNJ D;  4ZRZ A;  3GTG B;  2K28 A;  2PZW A;  2NB0 A;  2VUM B;  4TKO B;  3VA7 A;  2E2J B;  4XQQ A;  3SXH A;  2WAQ B;  4J6H A;  5J22 A;  5NUC A;  1PFB A;  2VB3 X;  3I3C A;  1UUP A;  5KNC A;  1BXT A;  1BDO A;  2RDH A;  4KN7 C;  4ZKB B;  1PZI D;  2O2L D;  1KTK A;  3GQB A;  2EYO A;  3M85 A;  1QWY A;  3M7G A;  3I70 A;  4QIW B;  3CU7 A;  4FVM A;  5EPJ A;  4WRD A;  1H9S B;  4IUQ A;  1ICW A;  3KLS A;  2MHV A;  3HOZ B;  2B2U C;  3CRK C;  5C44 B;  3S15 B;  1CHQ D;  1XX8 A;  1EZ8 A;  4I7Z C;  3FPU B;  1FGB D;  4PMW A;  2A69 C;  2J0T D;  1TWA B;  4RHS A;  5C5M A;  4F87 A;  4DU9 A;  3R2T A;  2A74 C;  2L1B A;  1SNM A;  5C4X B;  5IOC A;  3SE0 A;  3I90 A;  4ZLT F;  4OO1 H;  4KD4 A;  1BCP F;  1OXU A;  2JA5 B;  1IW7 C;  2LFN A;  4M8A A;  1PZK D;  3ERO A;  2ZXP A;  4A3D B;  4DGZ A;  4A3E B;  4ZK9 B;  2NZ1 D;  1ET6 A;  4EGV A;  4PQX A;  4QB4 A;  1M4V A;  1STA A;  5KND A;  1LTT D;  1SYD A;  1CT1 D;  2YU9 B;  4DA2 A;  5CV4 A;  1ENC A;  2B2Y C;  1E0B A;  4F7X A;  4A3I B;  1G2S A;  4KY6 A;  3P20 A;  1FNW A;  4CKB A;  1F77 A;  1PTO B;  2IX0 A;  3NK9 A;  4C3I G;  2DNE A;  1FD7 D;  3LX0 A;  1HQM C;  1RHP A;  1A6X A;  1PYW D;  3MA2 B;  2NTT A;  3D8G A;  2SNM A;  5J1Z A;  4AYB B;  4Y7N B;  5CMD A;  4KV6 A;  4RH6 A;  1RD9 D;  1B1Z A;  1SYG A;  5DAU A;  1GUS A;  3PIP 3;  5CV6 A;  2ID0 A;  3TP6 A;  4B08 A;  5IT9 E;  1AW7 A;  4G7O C;  1WTP A;  3JAM E;  3TZU A;  2OF1 A;  3HEJ A;  2A5H A;  3KUP A;  3MZ5 A;  3PMF A;  1VDZ A;  1TQO A;  3HOV B;  1R4P B;  2E75 C;  1BCP D;  2AUK A;  1ML0 D;  2RSO A;  2LS0 1;  1I4P A;  1UNS A;  1LLR D;  5KEE A;  2M9V A;  4FP5 D;  2ZXR A;  3I4L A;  4NDX A;  5M3F B;  4X3K A;  4TQU S;  1EY4 A;  5CV8 A;  5DM6 3;  2AWO A;  2C5C A;  3HGB A;  2RBM A;  2K03 A;  5BN5 A;  2LKV A;  3ERQ A;  3ND9 A;  3K5N A;  5C0X J;  2F4I A;  3C2P A;  4XIG S;  3KLR A;  1DOK A;  3EQL C;  3MXU A;  4XYO A;  1S5B D;  2FFK B;  4G4K A;  4FF3 A;  2HUG A;  4HMI A;  4M1U B;  2PNR C;  3NSW A;  2SDF A;  1GUT A;  2EYJ A;  3U9O A;  4PNY A;  4LMQ D;  1TKW B;  5A2Q L;  3ND8 A;  1LAB A;  2QKI C;  3F2U A;  2HCI A;  4G57 A;  1DZ1 A;  2WII B;  1PDQ A;  4RGO S;  3V2T A;  2E2D C;  1AZP A;  2EDG A;  1EL0 A;  2MJ8 A;  3A8K E;  1H9R A;  4FF2 A;  1XXG A;  1ZKO A;  1QJO A;  1EY5 A;  2F0O A;  4J1M A;  4IZ8 A;  1E2V A;  3T51 B;  1V1P B;  1B53 A;  3HKZ B;  2XRS D;  2K5W A;  2EVB A;  4BWG B;  4OO1 I;  4TRD A;  1PMR A;  1X3P A;  3QJY A;  1ET9 A;  3HOY B;  3G6J B;  3N6R A;  3HOU B;  2B2W A;  3GTO B;  5IGB A;  1SJE D;  5KRU A;  4X3S A;  5IIF A;  1STH A;  1BO0 A;  3OIQ A;  5JVG 3;  5I4D A;  1B4O A;  3MXP A;  2EXZ A;  2K6A A;  1QCB D;  3BVM A;  3I72 A;  3S1N B;  1A3T A;  5KIX A;  4MIU A;  2JYO A;  3L7Z C;  1SDF A;  3EFX D;  3D3R A;  4IFD J;  4WFN 3;  1MD2 D;  2K01 A;  3H94 A;  4KN4 C;  3KBG A;  1NR2 A;  3UI2 A;  1AP0 A;  2A6H C;  5HUR A;  3T4A C;  3GD7 A;  1F2Y A;  4A3K B;  5FO8 B;  1O78 A;  1PRT F;  2H4O A;  3OWE B;  1VCI A;  3PUY A;  1JB3 A;  2K05 A;  3GTL B;  4Q5V A;  4ABN A;  1JWU D;  4A3B B;  2L5T A;  3A56 A;  4XXE A;  1LT5 D;  4NP5 A;  4A93 B;  1B3A A;  4QUF A;  3NWT A;  3FPP A;  4LK1 C;  1GJX A;  2AWN A;  1ESR A;  2Y0S B;  1HUN A;  1MGS A;  4XQJ A;  1JCK B;  1HTP A;  1Y1W B;  4ZUI A;  3S1R B;  3EVQ A;  2J4X A;  2F0E A;  1S5F D;  5KGU A;  3O13 A;  5E1F A;  1M8A A;  3HRZ C;  2F0U A;  2Q8I B;  4BBR B;  1S4Z A;  4MHE A;  1EFI D;  3TN2 A;  1Y8O B;  1Y8N B;  1EEI D;  1F9Q A;  3HG9 A;  3I8Z A;  1FNU A;  2EZV A;  4IFD H;  3Q6S A;  2BE5 D;  1V43 A;  2EY2 A;  3P75 A;  4ME5 A;  1KDB A;  4RWS C;  2RKS A;  3ITP A;  3NE5 B;  4CKE A;  3DHQ A;  4MN3 A;  5T1G A;  4FXD A;  1RJT A;  2HDM A;  1NUC A;  1SNO A;  1TS3 A;  5E4X A;  3MAQ A;  2CHB D;  3E6Z X;  1F2Z A;  3OMC A;  1PRT D;  1CHP D;  1Q1E A;  2NUC A;  4XT1 B;  1RKN A;  1JOQ A;  2VNU D;  2PZT A;  2CVR A;  4ZUJ A;  2A68 D;  2NVT B;  3MXN A;  2E76 C;  1Z47 A;  2L9H A;  1UEA B;  1U4R A;  4IN3 A;  2AQ1 B;  1L0X B;  1WTR A;  3K6O A;  5K36 G;  2L0C A;  2PPB C;  3DWA A;  4XTC S;  5FO9 B;  3S1Q B;  1BCP C;  1D5M C;  2NN6 H;  1O80 A;  1B44 D;  3SK5 A;  1Y69 U;  2IJ0 A;  1Q90 A;  4C56 C;  3H6M A;  5C0X I;  3W3A A;  2D2C C;  2CW0 D;  2F0T A;  1A2U A;  2R61 A;  4RKB A;  5JAV A;  5EJW A;  4O1N A;  2EY6 A;  5ELB A;  5LL6 X;  1GHK A;  1ILP A;  2AQ2 B;  2IWH A;  4DAP A;  5C3W A;  3FVQ A;  4UAI A;  4ILW A;  3K58 A;  1WCM B;  3K5L A;  2XN9 C;  5CBE E;  3VYT A;  1EOT A;  1C48 A;  3GTQ B;  1EY8 A;  2R6G A;  1R9T B;  3SR1 A;  4K14 A;  2ICI A;  2Z4I A;  1EIG A;  1B50 A;  3BDC A;  1YNN D;  1KLU D;  2EYF A;  5JPM C;  1S5E D;  3G7L A;  1EY7 A;  2DY7 A;  4KHV A;  1OXV A;  2D62 A;  1K8O A;  2DN8 A;  4A3M B;  1JQY D;  2NVQ B;  4C3J B;  2N55 A;  2EPB A;  2Z1C A;  2F0P A;  5A35 A;  1D5X C;  2WAC A;  4EQP A;  5EPK A;  1HQR D;  5BN4 A;  3NTK A;  3WOF A;  1H9J A;  4XT3 B;  3SK4 A;  5T1I A;  1F2M A;  2L12 A;  2EJF C;  1KAB A;  1SJH D;  5M5Y B;  1EYA A;  1LTR D;  4CJ2 C;  1BQQ T;  4CGY B;  1JOO A;  2A73 B;  3A7L A;  1GUO A;  5COR A;  3D6W A;  1BNZ A;  4HR7 B;  3RZO B;  4N9P A;  1LTA D;  5M5W B;  1XYI A;  4KKS A;  2RA4 A;  1DOL A;  4P2C B;  2AQ3 B;  4IFD I;  2NYZ D;  1LAC A;  5ELD A;  2VXW A;  1SNP A;  2F0J A;  1WTQ A;  5ELC A;  4CJ1 B;  1SND A;  3J81 L;  2ENB A;  4DN4 M;  2F0K A;  3R93 A;  1TWH B;  1Q12 A;  4K6D A;  1F9R A;  5COY A;  2F0N A;  1DOM A;  2BDN A;  1ENF A;  2F0S A;  5I2Y A;  1SYE A;  1CQV A;  5K36 H;  4K5W A;  3GTM B;  3PUX A;  1QG7 A;  3E5S A;  2N88 A;  5LL6 S;  4S3S A;  5G3L F;  4KJO A;  1J8I A;  2KJX A;  1DCZ A;  2WKC A;  3IL8 A;  1RCV D;  3S2D B;  3TME A;  3D31 A;  4U67 3;  2EJM A;  3TP7 A;  1L0Y B;  2NBF A;  3M4O B;  2NN6 I;  2A6E D;  1HFN A;  1XTC D;  1GUG A;  1SNC A;  4HCE A;  3PIO 3;  2L11 A;  3ZYY X;  1G2T A;  2F0D A;  2WKD A;  1TU2 B;  1PLF A;  2WV6 D;  3R2I A;  4HTH A;  4H7B A;  2BE5 C;  5EBD A;  1D1I A;  1MSG A;  3NTH A;  1I6H B;  1SEB D;  1JWS D;  2NVX B;  3VYS A;  4RAU C;  3NPP A;  4ODG A;  3I4N B;  1ZYR D;  1Q1B A;  1Q8I A;  2PMZ B;  3HOX B;  3QB3 A;  2LY7 A;  2IPK D;  3H3V C;  4KTA A;  1B9N A;  2I46 A;  3C1F A;  1XWE A;  3KK7 A;  1W6J A;  2E74 C;  1LTS D;  4NMZ A;  1JOK A;  2PW7 A;  3J80 L;  5JPN C;  2HCC A;  1PRT C;  1SBB B;  3S9W A;  5I9O A;  3H0G B;  1TVX A;  3PO2 B;  1TT2 A;  5G3L D;  2LMC B;  3PUW A;  3SEB A;  5K5P A;  1CA5 A;  2A68 C;  3EJI A;  3PO3 B;  2SEB D;  1OXS C;  1PFN A;  3J7A F;  1I4H A;  5FLX E;  1A3V A;  2RVL A;  2RSN A;  4IAL A;  3FDT A;  1I50 B;  4KMU C;  2X6G A;  4PV1 C;  3S1M B;  2V4D A;  3WDN A;  4RCO A;  4WOR A;  2F03 A;  5KYL A;  1G91 A;  2QF7 A;  4OIK A;  3HS0 C;  2O4X A;  1EYC A;  1NR4 A;  2DNC A;  1ONL A;  1DJR D;  1ZEQ X;  1F2L A;  1SMY D;  5FO7 B;  1HPC A;  2KUM A;  2TSS A;  2B8G A;  4RKL A;  2B39 A;  4RHR A;  4R9W A;  2AUJ D;  4Z9C B;  3SDZ A;  2XWB B;  3H91 A;  1MBY A;  1Y8P B;  3RZD B;  4U68 A;  1EQV A;  1PFM A;  3URY A;  2EYP A;  3FKI B;  4KJN A;  3DUZ A;  1YNJ C;  4QMG A;  4QCL A;  2F3W A;  1YNN C;  2Q8R E;  1TS4 A;  2K7V A;  1DXM A;  2B2V A;  5D65 A;  2K1B A;  3SVM A;  1OO9 B;  2JXM B;  3HOW B;  3LWU A;  1QIL A;  1BBX C;  1HRJ A;  5CV7 A;  1IL8 A;  1LO5 D;  1S5C D;  1STY A;  4J8Q A;  1CTM A;  2Z8L A;  3NBH A;  1CQF A;  1R4Q B;  1CZW A;  3BDO A;  2C9O A;  1D5Z C;  1IKL A;  1QE6 A;  1JIC A;  1V8Q A;  5CBA E;  5IGG A;  2KEE A;  3GV3 A;  2MGS A;  3QG1 A;  1BR9 A;  1KLG D;  3TSS A;  3MFG A;  1PTO F;  4OHJ A;  5JJZ A;  5DM7 3;  3NHH A;  4H0L C;  3Q22 A;  1NCV A;  4OIJ A;  2PO4 A;  3TP5 A;  1PZJ D;  2OEO A;  2KOL A;  4BA1 I;  3MWY W;  4RGN A;  3DWP A;  3VR6 A;  1SYB A;  4KKT A;  2GA4 B;  1LT6 D;  3C46 A;  1KDA A;  4F8M A;  3X3M A;  5C6A A;  1C8C A;  2IT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...