1JR0D

Cholera toxin b-pentamer with ligand bmsc-0011
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anchor-based design of improved cholera toxin and E. coli heat-labile enterotoxin receptor binding antagonists that display multiple binding modes.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords cholera toxin B subunit
total genus 23
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jr0D00
3BYYB 1TS3A 1JWUD 1TS2A 5FK9C 1AN8A 1FD7D 1HQRD 1CHQD 2AQ2B 2RDGA 2NTSA 5FKAC 1LTBD 1RDPD 3BYTB 4RHRA 5D3IB 1SE4A 3BZDB 3MC0B 1ESFA 4RHSA 1LT4D 3CHBD 1EU3A 1PTOC 1XXGA 1PZJD 1KTKA 1I4RA 3BVZA 1EEFD 1ENFA 1ET6A 2XRSD 1CK1A 1FGBD 1MD2D 2XRQD 3R2TA 4K6LA 3URYA 1LTAD 5ELFA 5TSSA 1EWCA 4TSSA 1JCKB 1PYWD 2NTTA 2RDHA 2TSSA 1RD9D 4RH6A 1JQYD 1LTGD 3DWAA 1EFID 1UUPA 1LT3D 1V1PA 1HTLD 1D5XC 1AW7A 3V05A 1PRTB 2IPKD 2J4XA 4RCOA 3TSSA 1I4GA 4Z9CB 3W2DA 1I4PA 1LTSD 3BVGA 2ICIA 1JWMD 1STEA 1QILA 3DWQA 1LO5D 1LTRD 1LTTD 1GOZA 1PTOH 1SXTA 2AQ3B 3BVMA 1HA5A 3KLSX 5ELEA 1F77A 1JR0D 1XTCD 1DYQA 4C56C 1I4HA 1M4VA 1PZKD 1D6EC 1PRTD 4L63B 3R8BA 3O13A 2Z8LA 1V1OA 1ET9A 1S5DD 3GP7A 2G9HD 2QILA 1SJHD 1JWSD 1FNUA 1LT6D 1T5XD 2SEBD 1PTOF 2R61A 1I4QA 4OHJA 1PRTC 4RGOS 1TY0A 1EEID 1KLUD 2WV6D 1S5ED 1TS5A 1RF2D 1S5FD 4O1NA 1S5BD 1S5CD 2QEJC 1CT1D 2IJ0A 4RFBA 1PRTF 4RGTA 1D5ZC 4UDUC 4RGMA 2XNAC 1BCPB 1BCPF 1SEBD 4DXGA 1B44D 1DJRD 1LTID 5ELCA 1SE2A 5ELBA 1G8ZD 3DWPA 1TS4A 1CHPD 1V1PB 3EA6A 1BCPC 2CHBD 1SBBB 1PTOB 1CQVA 1HXYD 1PZID 1SE3A 2AQ1B 3OWEB 1BCPD 3R2IA 4ZYSA 2O2LD 1B1ZA 4DXFA 1UNSA 3EFXD 4BWGB 1LT5D 1SJED 1FNWA 3MFGA 1TY2A 1L0XB 1L0YB 1RCVD 4RGNA 1EU4A 5D3DA 2XN9C 1BXTA 1D5MC 1FNVA 1I4XA 4L6TB 3SEBA 1KLGD 1PTOD 5I4DA 5ELDA 1LLRD
chains in the Genus database with same CATH superfamily
4U673 1TS3A 1STHA 4ZKCB 1QVFA 5EGTA 2NZOA 2JEAI 4G7ZC 2Y0SG 1LTBD 1YHBA 2IT1A 4KHZA 1WOCA 1PFMA 3GTKB 4DNTB 4A3IH 2FXQA 1UAPA 3L2PA 3I7FA 2E2HB 4LUZA 2NN6H 1FGBD 5C44G 3NBHA 1LTAD 1Q8IA 2TSSA 1WTWA 3ULPA 1K28A 2DNEA 1UUPA 3NSWA 2J4XA 1VQJA 2VNUD 3OWFA 4DAMA 4WJWA 2F3WA 3SHLA 4B3SQ 3K80C 2NWGA 1TU2B 1I4PA 3G6EA 1KC8C 3S2DH 4P72A 3J80E 1UEBA 4WJ4A 4MIUA 3OYYA 4JI1Q 1SNOA 2KEDA 4NP5A 2F4VQ 4JI8L 2OQKA 1G6ZA 2PZWA 2LXKA 3CCEA 1SYEA 2X69A 4L5QA 5CYUA 1XMOQ 3GTJH 1L1OC 4GLVB 1P16A 3IAYA 4OHJA 4RGOS 1TY0A 2WV6D 1C9OA 2A73B 5IP7G 4GN3B 4LF7L 2Q8IB 5FJ8H 3H0GB 5LMUQ 1Y1VG 2EYHA 4JK1C 3A8IE 1CA6A 1YJNA 4KV6A 2PQEA 1SE8A 3PIPA 2RSNA 5ELCA 1E3PA 4PNYA 1CHPD 3IFTA 1A3UA 4DUYQ 1STGA 2IHEA 3S1RH 2VXWA 5IP9G 5M5XB 2A6HD 5D65A 1B4OA 3ULLA 3PUWA 4HJ9A 4QMGA 5C5LA 2JK8A 2DJGC 4DR4Q 3PO3B 3CPWA 3I4MH 1O7LA 4JOIA 4BXXH 2GN5A 1Q8KA 2JYOA 4X3TA 4IPCA 3ICEA 1TS2A 1WCMB 4DUZQ 2KCNA 4GKKL 4C2MH 3SGIA 4A3EB 2UUCL 5LMNQ 2HQEA 3DEPA 3CHBD 3R3OA 2UUAL 3T1YQ 1JB7A 3K81C 3CKIB 3A5ZB 1OXXK 4L8JA 1WVLA 1TWFH 4DR7L 2UUBL 4MNOA 3GV6A 3KLSA 3RZDB 5M5WH 1N33Q 1X54A 2B2YC 1BKBA 3AFQA 3K7AB 1JE5A 2UU9Q 1YNNC 1SNPA 3A7AB 3IL8A 1V1PA 5M9OA 1D5XC 4B9XA 1Z9FA 3V05A 2BCOA 2LXJA 1B9MA 3G48A 5CV9A 2LSSA 2EE1A 1BUVT 1ONLA 1SFOB 2HQLA 4C3IB 3WOFA 1GOZA 1TWCB 3PV0A 3TN2A 1U9RA 1HZBA 3H3VI 3L9AX 3SXHA 4LF4L 1FGUA 4XQQA 1Z47A 1PRTD 1YZ6A 3QJYA 1EY4A 3NWSA 1WCMH 2PQAA 3M7GA 5E7NA 2JA5G 2PNHA 2F0DA 1PRTC 3EROA 1SLJA 2EYMA 1SYFA 2F3VA 1KD1C 3HFZB 2XSCA 3HKZE 3FDTA 1DGSA 3HKZB 4YIJA 1R9TB 1DZ1A 3MXPA 2A6ED 4DV4Q 1HUNA 4KTAA 2WB1B 2O5IC 5ELBA 1NAPA 2RHSB 4IQZA 1W2BA 2B3GA 3S15B 4ID6A 5M3MH 5EAYA 4LMQD 1HA6A 1X3FA 3HZXA 3OOCA 4FF2A 1PTOB 1SE3A 3T16A 1Y8OB 3OWEB 1JMCA 3NXWA 2RA4A 1UNSA 5LL6X 4KJNA 2L0CA 4BWGB 2EZVA 2N49A 1L0XB 2Q2UA 4OXPA 3I90A 2XN9C 4E6IA 1HHVA 1V1QA 4GOPA 4UPAA 2UU9L 4AIMA 1RIPA 4K5WA 2BOSA 3HEJA 5CBEE 4FF4A 1AN8A 3MHBA 1DOMA 1MSGA 4IUNA 2B29A 3H3VH 1M90C 4LF9Q 2LY7A 2CFMA 4RHSA 2Z0SA 4GOPB 1G291 1KABA 3T1YL 2UUAQ 2AKWB 3A8KE 4GNXC 5LMNL 1T9HA 1TIID 4KI0A 4QUFA 2B2TA 3Q24A 4QB4A 4HEDA 1SYGA 4RAUC 2WP8J 4J1MA 5IT9E 1O80A 4PZ8A 1DXMA 5IGDA 3NP8A 1PYWD 4IPDA 2VQFQ 4IFDJ 3DM1A 3PGZA 3DUZA 5ELOA 2RCFA 4DR6Q 2CW0D 1VQ4A 2Z6KA 3L0OA 3CCVA 1D8LA 2PW7A 4DV5L 1GUSA 4XQJA 2F0QA 3GTMB 1EYDA 4HCSA 5T1IA 1HNZQ 2KCTA 4PZ7A 3OSOA 4YWMA 4A3CG 4KK7A 2MFIA 2RKSA 5C3WA 2V1CC 1B9NA 3TREA 1WYDA 2YTYA 1ILQA 3U4VA 2H4OA 4DKAC 2R93G 5KNCA 2NVXB 2AUJD 2AWNA 5JPNC 4X66L 4CJ1B 5A35A 3OW2A 2E76C 2N78A 4RFBA 3TRZA 1B3QA 3EBEA 4UDUC 3RUZA 2HHHQ 5E1FA 1Q1BA 5FLXL 1AEXA 5FLMH 3KDFA 1BBWA 1SROA 2AUKA 1PFBA 1HR0Q 1BO0A 1V1PB 1S4ZA 2WACA 1WTOA 2QGQA 3PO2G 3CU7A 1BCPD 1NCVA 2O2LD 1IBLL 3EFXD 4BA1I 3E0JA 4HTHA 3KYHC 2M00A 2V4DA 3M4PA 5C4ZA 3MFGA 4V0BA 1TY2A 4OWTB 4A3BH 1EY8A 1G2SA 3KJPA 4A3KH 1KLGD 1Q3LA 3T53B 4BY1H 1N32Q 4IJLA 1YNJC 1WTRA 3C1EA 1B70B 4Y7NH 5IGGA 4JBWA 2E75C 5D3IB 4K5XA 3OTOL 3NQTA 1ESFA 1CKMA 4BBSB 2SNSA 4PMCA 3GTQB 1WI5A 4O42A 4MTNA 2JA6B 1EYAA 1ET6A 3S1RB 3L7ZC 1OXSC 4UP8A 2H1EA 3P7JA 1HFGA 4N8FA 1J5EL 2F03A 1HRJA 2ZJRA 2KHJA 2JJQA 4QIWB 4DR5Q 3PO3H 1UE1A 4X6AH 1BR9A 4ZCKA 2MP1A 2CQOA 1Z6HA 2BE5D 4NXNQ 3R93A 2DY8A 5CV8A 4JI7L 2A8VA 4KLKA 5FO7B 2EYOA 1GXDC 3I70A 1QB5D 3F2UA 5GAEC 2B63B 1STEA 1TWHB 3KLWA 1HZCA 4DV1Q 3BVMA 1PH1A 3LWUA 2D2CC 2EJGC 4JG2A 5EKLA 3VA7A 1UE6A 4K6DA 3CC7A 2K01A 3CP0A 1D6EC 2N55A 4POFA 4LF8L 4N9TA 3Q0AA 3PF4A 3JAML 3DHQA 1F2ZA 5JJZA 1VQMA 5C6AA 3E3XA 4R8IA 1OO9B 2K33A 5M3FH 1PTOF 4OONA 3ER0A 1XX8A 2UXBL 2I0QA 2R92B 1LUZA 4JV5L 2JE6I 3M4OB 3H3VC 5IOCA 1S5BD 3GTGB 1A3VA 4QL5A 2IX3A 3V2TA 1A8VA 1PH5A 2NVTH 1RJTA 4G4KA 4A3BB 4R4TA 2Z4IA 2JXMB 3VR4A 3A74A 4DAYB 1TS4A 3MTSA 2R7ZG 3SVMA 1L1OA 4Y7NB 1D1IA 1TWCH 3NK9A 4CHTB 2VQEQ 3M4YA 4ZYSA 5ISRA 3HOYB 4A3GB 3GTLH 3HOWG 5JJLA 2ZM6Q 2BA0A 4PQXA 4DPGA 3CMAA 3A0JA 1BOSA 1STAA 4C2MB 5C0XG 3NTKA 4RWSC 1IXRA 1LTLA 1KIXA 4B3RL 5ELDA 2OTJA 4CDEC 3CXCA 4EGVA 2K05A 2VZAA 3S2DB 5C4XB 2NN6G 1K0SA 1HH2P 4K14A 4NXML 1FJGL 2JA8G 1TWFB 2Y0SB 1HNWQ 2EY1A 1EU3A 4A3KB 1Y14B 3I72A 1ZEQX 5ELNA 1X65A 4BY7B 2R6GA 5IT9L 2RSOA 3J7AV 2X6LA 1CKNB 3KBGA 1X32A 3D31A 2KOLA 2KBNA 2ZM6L 4C3HH 3J81i 2A5HA 1I50H 2F0GA 1LT3D 3FKIG 2E2HH 5FOBB 3J7YW 4NXMQ 4DAYA 1O7YA 2HHHL 3HOVB 4B3RQ 1EL0A 3EJIA 1ILPA 3CQZB 3GTOH 1XTDA 1VQAA 1YNND 5H1SE 5BR8L 1YHQA 2EYLA 1CUKA 2WKDA 4XT3B 3QB3A 3VYRA 3HOUB 1L2FA 4KY7A 1XTCD 4MTKA 1S3OA 1I5FA 2NBFA 1MKHA 1PLFA 1SNQA 1PZKD 3R8BA 5GAGC 3BG3A 2IX1A 4A3DB 1YEZA 3GP7A 2K28A 2ZTEA 1N9WA 1VF7A 1SR3A 2EIFA 1Y1VH 1A2TA 1FR3A 2RBMA 1LYLA 4IUVA 1AFPA 4X65L 1CFMA 1Q12A 3DMUA 4NPSA 4HJ5A 2QEJC 3PCOB 5DNFA 1ESRA 1O7ZA 1E1TA 5IE8A 1BCPB 4BA2I 4F8MA 3SE0A 2F0WA 1VQHA 4H13C 2VQFL 5AFWA 4K8JA 3EQLC 1IYJB 2QDBA 1CTMA 1PZID 1SN8A 3DXJC 3RZOB 1CZGA 2NZHA 3NELA 1H9RA 1V43A 3S16H 1DM0B 1D7QA 3HOZG 4DV1L 1FNWA 4A3MB 1VQ7A 4C1NI 2ZJQA 2XVSA 3SEBA 4QIWE 2H5XA 2HUGA 5JOBA 1IYUA 4OELB 1XMQL 2E2IB 2RDFA 4B08A 1AP0A 5A2QL 4K0KL 5EPJA 5IYCG 2AQ2B 3H91A 4EQPA 4FF1A 2A6HC 2EOTA 3OTOQ 1KXLA 1HZAA 3BYTB 5HURA 3I56A 1PH4A 4H02A 2QCPX 3M4QA 2QF7A 3K7AH 4A3JH 4DV3Q 1EEFD 3C2PA 4YHHL 2XRQD 4P71A 4K6LA 3UDXA 5A2QE 4J15A 5ELFA 2ZJPA 2IWHA 5LHY1 1Q82C 1K0RA 2KHIA 5IWAL 5IT9c 1PYBA 3CCQA 4NKLA 1EFID 3MZ5A 1JOKA 1B53A 2ZXOA 2F4IA 3KDFB 5AJ3L 1XNQL 2E8GA 4ME3A 1HR0L 2K50A 4DR3Q 4R4OA 1H9MA 5M3MB 4JI2Q 1FVIA 4EVOA 5ELEA 1VS0A 5HGQA 1XWEA 3ERSX 1Y69U 4JBJA 5HY6A 1CKOA 3VYUA 1HTPA 3TP6A 1KRTA 1E2WA 2L55A 3FRPB 2XWJB 2Z8LA 1JOOA 1V1OA 1XPOA 1ET9A 5JEAH 1SJHD 1Q46A 3VYTA 2K5DA 3H0GG 4DK0A 4TVAB 1KLUD 2YYZA 1W6JA 3Q23A 1X3QA 5JEAG 4O1NA 4WFN3 3U4ZA 1RTOA 3S1NB 4RG1A 4A3EG 4LF5Q 2IY5B 3MWYW 4HSVA 3S2HH 3J80L 2UXCL 3GDEA 5C4JH 1MIUA 1K83H 4DR6L 1NTGA 5M5YB 4ALPA 4IOCA 1ENAA 3NHHA 3K0YA 2CH4W 2L4NA 1LT5D 3J7A5 5I9PA 1DCZA 1ML0D 1H9SB 2UUCQ 4JI0Q 3SK5A 3CCSA 4A3CH 5I4DA 3I4NG 1WFQA 4KN7C 2QEXA 2F0LA 3GTMH 3S14H 4BS9A 1HQRD 1R4QB 5CV4A 1LV9A 4ZAIA 1ICWA 3W1GA 3BZDB 4OGQC 2TMPA 2R92G 2OQ0A 3KJOA 1A0IA 2EYJA 4EQOA 2KECA 2FMCA 2EPBA 5C0XI 2F0MA 5DM63 4Y52H 3IKJA 1EY9A 4LFBQ 3CMEA 4POGA 3G7LA 3URYA 4FF3A 5TSSA 1STYA 4A75A 1DONA 2CH4A 4DUYL 3DWAA 3PO2H 4XYQA 2ASBA 1EZ6A 1CA5A 1EQVA 4KKUA 4DK3C 3OPOA 1JORA 3HP3A 1PVOA 4MN3A 4A93H 4XIGS 4CKEA 1WTVA 2NVQH 2WINB 4FP5D 3OMGA 4IO9A 2ZXPA 2G9DA 4LF7Q 2ICIA 4KJOA 4PG3A 4ABNA 1LO5D 2I5LX 1R4PB 4DV4L 3PUYA 4OWWB 4GKJQ 1K8OA 4ZRZA 2K4KA 5IGEA 4A3FB 1B7YB 3PQIA 4A3FG 4JI6L 3A54A 4JI6Q 2PQAB 5GQOA 1W3SA 2G5DA 2QILA 1K83B 3X3MA 3M4OH 1IBKQ 5C3EB 5C3EG 1EIHA 3QO2A 4ULLA 1IKLA 5EPKA 4HIDA 3ERQA 1AZQA 2ZT9C 1PV4A 2YTXA 1DOLA 4X62L 2DGYA 1GUOA 2ENBA 5CV7A 3MEHA 1IBKL 2PZUA 1VQ8A 4DFAA 4IALA 2K5HA 4RKBA 2K04A 2B2YA 1J9OA 1U4LA 4QQBX 3UE0A 1EIGA 2F3IA 3M9BA 3EA6A 1RHPA 2CHBD 2IX0A 4M8AA 2K7VA 3X3NA 5KEEA 3SDZA 4BBRG 2X6GA 3TP8A 5I6YA 4LFBL 3A5UA 1IL8A 3K58A 1PA6A 1RCVD 4RMFA 1YITA 2UUBQ 1SRUA 1SNCA 1VQKA 1TWGB 2NVXH 2EJMA 1JE4A 2WB1E 3UE1A 3NBIA 4BY7H 4F88A 4JI0L 1CSQA 2JP1A 3GQBA 4B3ML 4KD4A 2F0PA 5CR3A 3VDYA 1IL2A 4R9WA 3LX0A 1NY4A 5DAUA 4YWKA 1YI2A 2L11A 4P73A 1JJ2A 4OWXB 5HGTA 2Q2TA 5J39A 1CQFA 2F0HA 1PFNA 4V190 1VQDA 4TSSA 1I6VC 5C0XH 3FPPA 2ES2A 4WJ3M 3S1QB 4GKKQ 1EZ8A 3S9WA 2PCFB 3I4LA 3F2BA 4DR1L 1A2UA 4GLXA 4G7OC 3D0FA 1QZHA 3S1MH 4RCOA 3PIOA 3AB9A 4NMZA 3HG9A 1VQEA 4QF4A 1KDCA 2E2IH 1I6HB 1NR4A 3BVGA 4XT1B 1VMCA 4DR4L 2WAQB 4CJ2C 4OL7A 1N34Q 5KIXA 1KNEA 2B8FA 1I4HA 1SMYC 1VQIA 1JC7A 5KRUA 2DN8A 1F2LA 3O13A 3SR1A 2RQXA 1OXVA 4I65A 1FNUA 3CCMA 1GO3E 2JEBI 5IGBA 3CW2C 3F2DA 1I4QA 1EEID 2F0OA 4WORA 4HMJA 5LMUL 3IRBA 1I3QB 2Z4HA 2R7FA 4GS3A 3S1NH 4JI1L 2KEEA 2XNAC 1GM5A 1VQ6A 1QE6A 1YNXA 3Q8DA 4A3JG 4A76A 1ZYRC 1KAWA 1XMOL 3S15H 3I4OA 5IWAQ 1G2TA 1TQOA 4NDXA 4H7BA 2I5HA 4GLAC 5IP7H 3W3AA 3FEWX 4DR3L 4M1UB 1BBUA 4DXFA 4GKJL 2F0UA 3HOXG 2MQHA 4FXGC 2OEOA 3SK6A 5D3DA 1J8IA 2FHTA 4B3SL 1I4XA 3I3CA 1T5EA 2FMMA 4DV2Q 2DJFC 4ZKBB 4OO1G 2NTTA 1HPCA 1JWUD 3MXGA 1Q86C 1MJEA 4FO2A 2K14A 2OF1A 4YHHQ 2K52A 3RNUA 3MC0B 4ZLTF 3KFUA 4R4CA 2ID0A 4K2LA 4DV0L 1ASZA 5JPMC 1I4RA 1PH8A 2YU9B 5JJIA 2B2VC 1I3QH 2B2WC 4ODGA 1WTQA 4K0KQ 4Q0FA 2JA8H 2A6EC 4YCUA 1S72A 1GUGA 2B2UA 1JQYD 2JA9A 1L1OB 1MJCA 1Y8NB 2HIVA 1IKMA 1GUNA 4A3EH 1EIYB 3A7LA 2WKCA 5GAHC 4ILWA 1EQQA 2MNAA 1QNKA 5K36G 3HOWH 1C48A 1WCMG 3KF8B 1SXTA 5CMDA 1HA5A 1JT8A 1F77A 2L12A 1JR0D 3PF5A 2NZ1D 1STBA 1WD1A 4DR2Q 4UP9A 5D14A 3KLRA 3BZCA 1YVCA 1HR0W 5DEHA 4GZYC 2RVLA 3QG1A 1NMGA 4X3KA 4EX5A 3QOLA 1IW7C 4J6HA 3K5LA 1VQOA 1RTNA 4YY3L 1SFOH 3VR5A 4IUPA 4LF5L 1S5ED 2KUMA 4A3IB 2D0OA 3GD7A 2E5LL 2K5WA 5M3FB 1XNRL 2Z6KC 1V9PA 3T1HL 4RGMA 3RZDH 4DF7A 3D4DA 2E2JB 1NBWA 4C3IG 3VYSA 2JA5H 2YTVA 3P1HA 3MXNB 5F2DA 4A3MH 1SBBB 3D3RA 1I94Q 2WB1G 4CKCA 2DNCA 3D4RA 1Y1WB 3GTPB 3KUPA 2OT2A 4A4IA 4B9WA 5C44H 1GHKA 2A68C 1NE3A 1GKHA 4RGNA 1GHJA 1HNWL 5BN4A 2ZTDA 4X3SA 2LMCB 2KVMA 4JBMA 3RZOH 2JA8B 1PTOD 3QIAA 1J6QA 2Q2IA 5DM73 1TWGH 4DV7Q 1XNQQ 4KHPL 3F2CA 1D2BA 1BQQT 1AZPA 2B39A 4IUTA 1FD7D 3P20A 1VF5C 3FHWA 4APVA 3HOUG 4PZ6A 1E7ZA 4LUVA 3GV3A 3DEOA 1KL9A 2F0SA 4XYOA 4JBKA 1OXTA 4KKTA 3Q22A 4KHPQ 4LUOA 2K03A 4DV3L 1FJGQ 1EIFA 1KDBA 1MD2D 2VW9A 3R2TA 4LNQA 1K3BC 1TR5A 1X3EA 2SOBA 5K5PA 2VQEL 1VMPA 4RH6A 3STBD 1PH7A 1LTGD 3HOXH 3GTJB 4FDBA 3S16B 4YCVA 3L3OC 3K5OA 3F1ZA 3NENA 2K32A 3DM3A 1C0AA 5M5XH 4TRDA 3TSSA 5KNDA 4HR7B 1IBML 1QUQB 2PNRC 1QILA 4JV5Q 1X56A 2EY2A 1NMFA 2NN6I 3MXUA 4BXXG 5I9OA 3T1HQ 1KNAA 2IL8A 4C56C 4A3LG 2C35B 1LABA 2Z1CA 3GTLB 1TT2A 1MBYA 2E2JH 4I7AA 2GA4B 3RLNA 2K75A 1KRSA 2PPBC 2MO1A 5C0XJ 3VR3A 4RCNA 2HD3A 5DLQE 2NVYH 3CCUA 4A3DH 1EY5A 2WFWA 2J7ZA 1OXUA 3A56A 4UHVA 1U5KA 2M2LA 3I73A 5LL6S 3FVQA 4JI7Q 4IOAA 4C1NK 2B2UC 2E74C 4NXNL 2IHFA 3PUZA 4EQNA 3DWPA 3MAQA 4DR5L 5J1ZA 1K9MC 1WTXA 1WJJA 2B2WA 3GO5A 2UXDQ 2B2VA 4GOPC 4OX9Q 4QUCA 3NTHA 3CF5A 5CV6A 4FXDA 3J80c 3C46A 4A3GH 5EBCA 3PO2B 3S14B 1BNZA 3I8ZA 1Z7TA 2B8GA 5FO9B 1E24A 5BR8Q 2ZXRA 4LJZC 2LKVA 2N8NA 2AHOB 1VQ9A 3H6MA 4QGUA 3J81E 1J5EQ 1LLRD 3BYYB 3EN2A 1F9PA 3I4NB 2A74C 2RHQB 4DNRB 1CHQD 2NTSA 4CDCC 4K5VA 4RHRA 1IW7D 3W5OA 1O78A 5IYDH 1LT4D 1PTOC 2L5TA 1H9SA 1Y8PB 5KYIA 3D6WA 1A63A 4HAEA 4CDDC 2MO0A 1ASYA 4JI5L 1SMYD 2EVBA 4KHVA 3PMFA 4IUUA 1Y1VB 3J80i 3M3YB 1V8QA 1F2MA 1N32L 2F0TA 1YJWA 1B8AA 4AQYL 4HIMA 1MI2A 2CQAA 1GUTA 2HCCA 1AW7A 1EY6A 3BU2A 4A3GG 1RODA 1EOVA 3K7UC 2PO4A 3K57A 2NVYB 3KF6B 1H9JA 1IBLQ 4HCEA 4OO1I 1WTPA 1IYVA 3A55A 3HRZC 3G6JB 4XQNA 3LGJA 3PSIA 5J22A 4GNXB 3KOJA 2AQ3B 1VQLA 5NUCA 4UAIA 1TKWB 3H09A 1MHWC 4A93B 5EQ0A 3A8JE 1II3A 1O7IA 1VCIA 1X55A 4OIKA 4AYBB 4BBSG 4QJFA 3PIP3 3GTKH 1L0WA 3HS0C 4QCLA 1VQPA 3EIVA 1GD7A 1B50A 5JJKA 4LFAQ 3J7ZC 4HIKA 1PXUA 2RF4A 4DAPA 5E4XA 2WAQE 2EY5A 2Z9HA 1S5FD 2C5CA 4DV5Q 4LFCQ 4J8QA 3J81c 5J3BA 2JA7G 1N34L 4RKLA 1QOHA 3D4WA 4TQUS 4X64L 3BS1A 4IPGA 1DJRD 1EY7A 5I2XA 4DR2L 1EYGA 4QY7A 1OTCA 1YBYA 1PYSB 1RKNA 2VUMG 4DGZA 2MGSA 2F0FA 4CJ0B 4ZQ3A 3R2IA 4CKBA 4G57A 1BBXC 3TS2A 1E0BA 2I5MX 4JI3L 1QG7A 4IUQA 4OO1H 1B2TA 1WTHA 3ND8A 5EKIA 5CGKA 1X6OA 5M5YH 2DUDA 2BH2A 2XGTA 5FK9C 3P75A 2PI2A 4UY8C 4YWLA 3TQYA 4IPHA 3E9HA 2E2DC 4DNIA 5CC4A 5BN5A 3BJUA 2R92H 1YJ9A 1XPRA 3M85A 4LF9L 1Q81C 1EQTA 3FP9A 3PIO3 3BVZA 3NWTA 2VY3A 3K6OA 2Z6BA 4HJ8A 3DLLA 3G71A 4C3JG 4C3JB 4A3KG 3S1MB 4XXEA 4Q5VA 1JOQA 3HOYG 2NYZD 1Q90A 1RD9D 3I55A 4DV2L 3ZYYX 5FLMG 2FINB 5C44B 5GADC 3CC4A 5JEAJ 3U9OA 3MVVA 3OIQA 1PDQA 2F0NA 2EJFC 2EQSA 5C3XA 1HQMC 4A3MG 4C3IH 1C7YA 3S2HB 2QW7A 3ULJA 3KK7A 1C8CA 4LAAA 3T13A 1JICA 5IIFA 1ZKOA 2AMCB 4L5SA 1EQRA 5L37A 4X62Q 3PUVA 4DV6L 2XTIA 1LACA 4OIJA 2F0KA 1X3GA 5G3LD 4WRDA 4DV6Q 2QA4A 2EYFA 2O4XA 4LF4Q 5CORA 3H0GH 2R61A 4H0LC 3WOEA 5M5WB 3CQZH 2L15A 3AU7A 1DD2A 2R93H 4BBSH 4BBRH 2B2TC 4A3DG 2NUCA 3N6RA 4IURA 1JJCB 5IGFA 3TS0A 1VQ5A 2O5JC 2KQ3A 3Q6SA 1STNA 1Q1EA 1YNJD 3T51B 3E6ZX 2BH8A 3QOJA 5C3EH 4YCWA 3JAME 4HJAA 4X66Q 2IW3A 3J81L 1G6PA 1BVSA 1LTID 2HDMA 4BY1B 2ATWA 1SNDA 3S24A 2JSOA 3LNNA 3I91A 4PV1C 1M1KC 3JC66 1TVXA 3C3LA 4C3HG 1LM0A 1B1ZA 4GN4B 1HNZL 2A68D 5IY0A 1SJED 2KHSA 3CCRA 1L0YB 5I6WA 3HOUH 2K5QA 4L5RC 2EY6A 2K5VA 4C3JH 3PO3G 1B3AA 2OXPA 5JAVA 1PH9A 1N33L 2F52A 1MGSA 1RL2A 2RDGA 1R9TH 4DR7Q 4S3SA 3QR8A 1RDPD 5IP9H 1H95A 4H44C 2JA6G 1WD0A 4B3MQ 4RA8A 1S40A 2R93B 3NQIA 5KGUA 1KTKA 1F9RA 3LWEA 2HIXA 3GTGH 5CBAE 2B63H 1QWYA 2CVRA 5FJ8G 2MUYA 2OWOA 3TP7A 1C4QA 2KENA 4HN7A 4JOIC 2YU9H 4NB3A 3RN2A 3VR2A 4A3BG 4KY6A 2UXCQ 3E0EA 3RN5A 1FL0A 2WAQG 4OEMB 4HJ7A 4LFCL 4A3JB 1U4MA 1JWMD 4NW2A 3KLSX 3I4MG 1QVCA 3TMEA 1DYQA 2PYKA 1M4VA 1NUCA 3ITPA 5FLXE 1QNUA 3OIPA 4KN4C 3JAMi 4IFDI 4TKOB 2SDFA 5I2YA 3UDGA 2VUMH 2EXZA 1LT6D 4F87A 3M3YH 3MEFA 1XPUA 2VB2X 3CAMA 3CRLC 2VS1A 3H15A 1QZGA 3NTIA 2JA5B 2IJ0A 4RGTA 5EKKA 1BF4A 4CGYB 1DOKA 3CCJA 4HMIA 2F4VL 1SE2A 3ONAB 3WWVA 2WIIB 4P75A 3NE5B 3HOWB 5C4XH 3QWNA 5AJ3Q 5IYBH 1CQVA 3EVQA 3K0XA 5KYLA 4DN4M 2Q8RE 4FYDA 1A3TA 3E5SA 4KKSA 4PMWA 1U4PA 2B63G 1SYCA 5JVH3 1EU4A 2CWAA 1KDAA 1NSNS 4AYBG 3AEVA 2PZTA 4R4IA 2A69D 1K8MA 2D0PA 2EDGA 3H94A 3TEHB 1D1KA 2Y0SE 3HKZG 4LWCA 5FKAC 2KA7A 1SSOA 3UDIA 2OTLA 1SAPA 1E22A 1CKNA 1SE4A 3RR5A 1HJPA 1M8AA 1NR2A 3U58A 4BY7G 5C4JB 3HOVH 1EFWA 1XMQQ 1PZJD 1K8AC 3VR6A 3GTOB 3M7NA 4DAVA 1CK1A 1QVGA 4OX9L 2F1MA 1EWCA 1SYBA 1PHJA 1KHIA 3HOVG 2FFKB 2RDHA 1SYDA 4JI3Q 2VUMB 5COYA 1JJGA 4DK1A 4DUZL 2HCIA 3CC2A 4JI4L 1EUJA 3D8GA 4IFDH 4N8X1 2PI2E 2I46A 1VQGA 2GVAA 2KJXA 4O0AA 3T56B 5IODA 1G91A 3DWQA 1TWHH 3BDCA 1PTOH 2EYPA 4HSPA 1EY0A 4FXKC 2LFNA 4LK1C 3C1FA 2D62A 4FNFA 4EQ5A 4X65Q 4L63B 3GTQH 4P2CB 1VQCA 1TWAB 3AQQA 1TXYA 4LFAL 1AH9A 1JWSD 1KAAA 1MSHA 4HIOA 5C4XG 1T5XD 4CBVA 2F0JA 2SEBD 5CV5A 1NNXA 1N8RC 5EPLA 1VQBA 5M3FG 4X64Q 1K73C 5E3FA 5LMNW 1W6KA 4DA2A 2ZTCA 5T1GA 1AE2A 1F9SA 2L1BA 2RCNA 5G3LF 3RLOA 2Q2HA 2AWOA 5GROA 1FYCA 4A3FH 3KBXA 1BCPF 1A15A 4JW0A 3HKSA 4G7HC 2I07B 2VL6A 3TZDA 2OCEA 1PH6A 5EJWA 5FLXc 1AE3A 4IJHA 4O2DA 4R4QA 3G4SA 3N52A 4JI2L 4MHEA 1HXYD 4JI8Q 2F0EA 3HOYH 3U50C 4A3LH 2ICEC 4FVMA 1K3RA 2CKZB 3K59A 1BXTA 2K1BA 4L6TB 2KCCA 3OMCA 4UP7A 1TWAH 4AQYQ 1PH2A 2NVTB 3MFYA 2MJ8A 3AMUA 2JA6H 4IFDG 1F9QA 1JB3A 3TP5A 4LF6Q 1XXGA 4JI5Q 1ICFB 1SDFA 3I4NH 1VQNA 1ENFA 2XRSD 1H9KA 5IYBG 2XWBB 4BY1G 3K8AA 3CRKC 4IZ8A 3VA5A 4P74A 4K2KA 1HTLD 4R8NA 1GJXA 4X3UA 1UE5A 4AYBE 1UWVA 5M3MG 3UI2A 1X3PA 2JN4A 1A6XA 3HOXB 1K8GA 2E5LQ 3K5MA 4Z9CB 1PFSA 3W2DA 4PMBA 1E2VA 3MA2B 1F2YA 1UEAB 2KCMA 3E9IA 1LTTD 4B3TQ 4JC0A 4JVZA 4R1JA 1SNMA 2R3ZA 1YIJA 4N9PA 3NPPA 2GVBA 3HGBA 3GTPH 1HUMA 3S17B 3S1QH 2HDLA 2UXDL 4ME5A 4KY5A 2G9HD 2UXBQ 2A1AA 3JAMc 2CWPA 1I6HH 1U0LA 3PUXA 3CD6A 3FKIH 1A62A 2CCZA 1X9NA 1I50B 1S5CD 2JQOA 2R7ZH 1IHZA 4ZUIA 3I2ZA 4I7ZC 2JA7B 3ND9A 1SEBD 5IGCA 3FMCA 2M9VA 3RLFA 1B44D 2XIWA 1IBMQ 2DY7A 3D6CA 4ZK9B 1BCPC 4U68A 5E4WC 3IFDA 2AQ1B 3FPUB 2LS01 3V96A 1HZ9A 1Y1WH 2A19A 4GNXA 4LW1A 1N36Q 3I4MB 4DV0Q 4LF6L 1P8LA 4JYAL 2YV5A 3UDFA 3KF6A 1ZYRD 3TBIB 1D5MC 2BE5C 4DU9A 2NB0A 1CSPA 3NEMA 1ENCA 4CDFC 5JVG3 2C9OA 5FO8B 3K5NA 4A93G 2ALYB 4A3IG 2BA1A 1EOTA 1HNXQ 1SMXA 2NVQB 2R7ZB 1HCZA 2F0IA 2QKIC 1HNXL 2VB3X 3S17H 2FJ2A 1JCKB 3NUCA 2F0VA 2BDNA 2MHVA 1ZXTA 4K8IA 4KD3A 5C4HA 3HOZH 1GUWA 3MXNA 2K5NA 5EBDA 4F7XA 1I94L 1XJVA 4IN3A 1EWHA 1PRTB 1E1OA 1VQFA 2IPKD 4L5TA 2L9HA 2SNMA 4XTCS 4DV7L 1Y1WG 5C5MA 1NJIC 3FKIB 3T4AC 1I4GA 3CPFA 4MZ9A 4DK6C 1LTSD 2R7DA 4JYAQ 2D5DA 1LTRD 1N36L 3OW7A 2K6AA 4AH6A 1XNRQ 2MPMA 3F8TA 3ZJYC 1HFNA 1BDOA 1U4RA 2JA7H 3BDOA 3SK4A 5BN3A 3BDLA 3WDNA 1PH3A 1KQSA 2N88A 1S5DD 2A69C 1CM9A 3BZKA 1YHAA 2BDOA 3OHXC 3CCLA 1GVPA 4JCVE 3B6YA 1EWIA 1Q7YC 3SK8A 5K36H 3W1BA 1TS5A 1CI3M 1RF2D 3STBC 1XYIA 2PMZE 1G51A 2Q8TA 3TDQA 1CT1D 1QJOA 2P5ZX 3KF8A 1PRTF 4GN5A 3J7AF 1D5ZC 2QDLA 3TZUA 2N3SA 4YY3Q 4DXGA 4DR1Q 4LF8Q 5KNBA 1UE7A 4BBRB 3U9SA 1EYCA 1G8ZD 2PW5A 2J0TD 3RD4A 2EXDA 3AYHB 4ZUJA 5IYDG 4C3HB 4KMUC 3AFPA 3NBHB 1PMRA 1VDZA 4B3TL 1QCBD 1IZ6A 1QUQA 4JI4Q 1CZWA 4XDXA 4JPBW 2HT1A 2D9UA 3RMHA 1E2ZA 1FNVA 2CW0C 5IYCH 2PMZB 3HOZB 3J81j
chains in the Genus database with same CATH topology
4U673 1TS3A 1STHA 4ZKCB 5EGTA 2JEAI 4G7ZC 1LTBD 2IT1A 4KHZA 1PFMA 3GTKB 4DNTB 1UAPA 2E2HB 2NN6H 1FGBD 3NBHA 1LTAD 1Q8IA 2TSSA 1WTWA 2DNEA 1UUPA 3NSWA 2J4XA 2VNUD 3OWFA 4WJWA 2F3WA 3SHLA 2NWGA 1TU2B 1I4PA 3J80E 4MIUA 1SNOA 2KEDA 4NP5A 1G6ZA 2PZWA 1SYEA 2X69A 5CYUA 3IAYA 4OHJA 4RGOS 1TY0A 2WV6D 2A73B 2Q8IB 3H0GB 2EYHA 4JK1C 3A8IE 1CA6A 4KV6A 2PQEA 2RSNA 5ELCA 4PNYA 1CHPD 3IFTA 1A3UA 1STGA 2VXWA 5M5XB 2A6HD 5D65A 1B4OA 3PUWA 4QMGA 5C5LA 3PO3B 1O7LA 2JYOA 4X3TA 1TS2A 1WCMB 2KCNA 4A3EB 2HQEA 3DEPA 3CHBD 3R3OA 3CKIB 1OXXK 4L8JA 1WVLA 3GV6A 3KLSA 3RZDB 2B2YC 3K7AB 1YNNC 1SNPA 3A7AB 3IL8A 1V1PA 5M9OA 1D5XC 4B9XA 3V05A 2BCOA 1B9MA 5CV9A 2EE1A 1BUVT 1ONLA 1SFOB 4C3IB 3WOFA 1GOZA 1TWCB 3PV0A 3TN2A 1U9RA 3L9AX 3SXHA 4XQQA 1Z47A 1PRTD 3QJYA 1EY4A 3NWSA 3M7GA 2F0DA 1PRTC 3EROA 2EYMA 1SYFA 2F3VA 2XSCA 3FDTA 3HKZB 4YIJA 1R9TB 1DZ1A 3MXPA 2A6ED 1HUNA 4KTAA 2WB1B 2O5IC 5ELBA 1NAPA 4IQZA 3S15B 4ID6A 4LMQD 1HA6A 3HZXA 3OOCA 4FF2A 1PTOB 1SE3A 3T16A 1Y8OB 3OWEB 3NXWA 2RA4A 1UNSA 5LL6X 4KJNA 2L0CA 4BWGB 2EZVA 1L0XB 3I90A 2XN9C 4E6IA 1HHVA 4K5WA 2BOSA 3HEJA 5CBEE 4FF4A 1AN8A 3MHBA 1DOMA 1MSGA 4IUNA 2LY7A 4RHSA 1G291 1KABA 3A8KE 1TIID 4KI0A 4QUFA 2B2TA 3Q24A 4QB4A 4HEDA 1SYGA 4RAUC 2WP8J 4J1MA 5IT9E 1O80A 1DXMA 5IGDA 3NP8A 1PYWD 4IFDJ 3DM1A 3DUZA 2CW0D 2PW7A 1GUSA 4XQJA 2F0QA 3GTMB 1EYDA 4HCSA 5T1IA 3OSOA 4KK7A 2RKSA 5C3WA 1B9NA 1ILQA 2H4OA 2NVXB 5KNCA 2AUJD 2AWNA 5JPNC 4CJ1B 5A35A 2E76C 4RFBA 4UDUC 3RUZA 5E1FA 1Q1BA 5FLXL 1AEXA 2AUKA 1PFBA 1BO0A 1V1PB 1S4ZA 2WACA 1WTOA 3CU7A 1BCPD 1NCVA 2O2LD 3EFXD 4BA1I 3E0JA 4HTHA 2M00A 2V4DA 5C4ZA 3MFGA 4V0BA 1TY2A 1EY8A 1G2SA 1KLGD 1Q3LA 3T53B 1YNJC 1WTRA 3C1EA 5IGGA 4JBWA 2E75C 5D3IB 4K5XA 3NQTA 1ESFA 4BBSB 2SNSA 4PMCA 3GTQB 4O42A 2JA6B 1EYAA 1ET6A 3S1RB 3L7ZC 1OXSC 2H1EA 3P7JA 1HFGA 2F03A 1HRJA 4QIWB 1BR9A 2MP1A 1Z6HA 2BE5D 3R93A 2DY8A 5CV8A 5FO7B 2EYOA 1GXDC 3I70A 1QB5D 3F2UA 2B63B 1STEA 1TWHB 3BVMA 3LWUA 3VA7A 2D2CC 2EJGC 5EKLA 4K6DA 2K01A 1D6EC 2N55A 4N9TA 3Q0AA 3JAML 3DHQA 1F2ZA 5JJZA 5C6AA 4R8IA 1OO9B 2K33A 1PTOF 1XX8A 2R92B 2JE6I 3M4OB 3H3VC 5IOCA 1S5BD 3GTGB 1A3VA 2IX3A 3V2TA 1RJTA 4G4KA 4A3BB 2Z4IA 2JXMB 3VR4A 1TS4A 3MTSA 3SVMA 4Y7NB 1D1IA 3NK9A 4CHTB 3M4YA 4ZYSA 5ISRA 3HOYB 4A3GB 2BA0A 4PQXA 1BOSA 1STAA 4C2MB 5C0XG 3NTKA 4RWSC 5ELDA 3S2DB 4EGVA 2K05A 5C4XB 2NN6G 4K14A 1TWFB 2Y0SB 2EY1A 1EU3A 4A3KB 3I72A 1ZEQX 4BY7B 2R6GA 5IT9L 2RSOA 3J7AV 2X6LA 3KBGA 1X32A 3D31A 2KOLA 2A5HA 2F0GA 1LT3D 5FOBB 3J7YW 4DAYA 1O7YA 3HOVB 1EL0A 3EJIA 1ILPA 3CQZB 1YNND 2EYLA 2WKDA 4XT3B 3QB3A 3VYRA 3HOUB 4KY7A 1XTCD 2NBFA 1PLFA 1SNQA 1PZKD 3R8BA 3BG3A 2IX1A 4A3DB 3GP7A 2K28A 1VF7A 1A2TA 1FR3A 2RBMA 4IUVA 1AFPA 1CFMA 1Q12A 3DMUA 2QEJC 5DNFA 1ESRA 1O7ZA 1BCPB 4BA2I 4F8MA 3SE0A 2F0WA 4H13C 5AFWA 4K8JA 3EQLC 2QDBA 1CTMA 1PZID 3DXJC 3RZOB 1CZGA 1H9RA 1V43A 1DM0B 1FNWA 4A3MB 4C1NI 2XVSA 3SEBA 2HUGA 5JOBA 1IYUA 2E2IB 2RDFA 4B08A 1AP0A 5A2QL 5EPJA 2AQ2B 3H91A 4EQPA 4FF1A 2A6HC 2EOTA 3BYTB 5HURA 2QCPX 2QF7A 3C2PA 1EEFD 2XRQD 4K6LA 5A2QE 5ELFA 2IWHA 5LHY1 4NKLA 1EFID 3MZ5A 1JOKA 1B53A 2ZXOA 2F4IA 5M3MB 1H9MA 4EVOA 5ELEA 1XWEA 1Y69U 3VYUA 1HTPA 3TP6A 1E2WA 2L55A 3FRPB 2XWJB 2Z8LA 1JOOA 1V1OA 1ET9A 5JEAH 1SJHD 3VYTA 2K5DA 4DK0A 1KLUD 2YYZA 1W6JA 3Q23A 1X3QA 5JEAG 4O1NA 4WFN3 1RTOA 3S1NB 3MWYW 4HSVA 3J80L 5M5YB 1ENAA 3NHHA 3K0YA 2L4NA 1LT5D 5I9PA 1DCZA 1ML0D 1H9SB 3SK5A 5I4DA 4KN7C 2F0LA 4BS9A 1HQRD 1R4QB 5CV4A 1LV9A 4ZAIA 1ICWA 3BZDB 4OGQC 2TMPA 2EYJA 4EQOA 2KECA 2FMCA 2EPBA 5C0XI 2F0MA 5DM63 3IKJA 1EY9A 3G7LA 3URYA 4FF3A 5TSSA 1STYA 1DONA 3DWAA 4XYQA 1EZ6A 1CA5A 1EQVA 4KKUA 1JORA 3OPOA 3HP3A 4MN3A 4XIGS 4CKEA 1WTVA 2WINB 4FP5D 3OMGA 2ZXPA 2G9DA 2ICIA 4KJOA 4ABNA 1LO5D 1R4PB 3PUYA 1K8OA 4ZRZA 5IGEA 4A3FB 3A54A 3X3MA 2QILA 1K83B 5C3EB 1EIHA 3QO2A 4ULLA 1IKLA 5EPKA 3ERQA 1AZQA 2ZT9C 1DOLA 1GUOA 2ENBA 5CV7A 3MEHA 2PZUA 4DFAA 4IALA 4RKBA 2K04A 2B2YA 1J9OA 1U4LA 1EIGA 3EA6A 1RHPA 2CHBD 2IX0A 4M8AA 2K7VA 3X3NA 5KEEA 3SDZA 2X6GA 3TP8A 5I6YA 1IL8A 3K58A 1RCVD 1SNCA 1TWGB 2EJMA 1JE4A 3NBIA 4F88A 2JP1A 3GQBA 4KD4A 2F0PA 5CR3A 4R9WA 3LX0A 5DAUA 2L11A 5HGTA 5J39A 1CQFA 2F0HA 1PFNA 4V190 4TSSA 5C0XH 1I6VC 3FPPA 3S1QB 1EZ8A 3S9WA 2PCFB 3I4LA 1A2UA 4G7OC 4RCOA 3AB9A 4NMZA 3HG9A 4QF4A 1KDCA 1I6HB 1NR4A 3BVGA 4XT1B 1VMCA 2WAQB 4CJ2C 4OL7A 5KIXA 1KNEA 2B8FA 1SMYC 1I4HA 5KRUA 1JC7A 2DN8A 1F2LA 3O13A 3SR1A 2RQXA 1OXVA 4I65A 1FNUA 2JEBI 5IGBA 1I4QA 1EEID 2F0OA 4WORA 4HMJA 1I3QB 2Z4HA 2KEEA 2XNAC 1QE6A 1ZYRC 1G2TA 1TQOA 4NDXA 4H7BA 3W3AA 3FEWX 4M1UB 4DXFA 2F0UA 4FXGC 2OEOA 3SK6A 5D3DA 1J8IA 2FHTA 1I4XA 3I3CA 1T5EA 2FMMA 4ZKBB 4OO1G 2NTTA 1HPCA 1JWUD 3MXGA 4FO2A 2OF1A 3MC0B 4ZLTF 2ID0A 4K2LA 5JPMC 1I4RA 2YU9B 2B2VC 2B2WC 4ODGA 1WTQA 4Q0FA 2A6EC 1GUGA 2B2UA 1JQYD 1Y8NB 1IKMA 1GUNA 3A7LA 2WKCA 4ILWA 1QNKA 5K36G 1C48A 1SXTA 5CMDA 1HA5A 1F77A 2L12A 1JR0D 2NZ1D 1STBA 1WD1A 5D14A 3KLRA 5DEHA 4GZYC 2RVLA 3QG1A 4X3KA 3QOLA 1IW7C 4J6HA 3K5LA 1RTNA 3VR5A 4IUPA 1S5ED 2KUMA 4A3IB 3GD7A 2K5WA 5M3FB 4RGMA 4DF7A 3D4DA 2E2JB 4C3IG 3VYSA 3P1HA 5F2DA 1SBBB 3D3RA 4CKCA 2DNCA 3D4RA 1Y1WB 3GTPB 3KUPA 2OT2A 4B9WA 1GHKA 2A68C 4RGNA 1GHJA 5BN4A 4X3SA 2LMCB 2KVMA 2JA8B 1PTOD 3QIAA 5DM73 1D2BA 1BQQT 1AZPA 2B39A 4IUTA 1FD7D 3P20A 1VF5C 3GV3A 3DEOA 2F0SA 4XYOA 1OXTA 4KKTA 3Q22A 2K03A 1KDBA 1MD2D 3R2TA 1TR5A 2SOBA 5K5PA 1VMPA 4RH6A 1LTGD 3GTJB 3S16B 3L3OC 3K5OA 2K32A 4TRDA 3TSSA 5KNDA 4HR7B 2PNRC 1QILA 2EY2A 2NN6I 3MXUA 5I9OA 1KNAA 2IL8A 4C56C 1LABA 2Z1CA 3GTLB 1TT2A 1MBYA 2GA4B 2PPBC 5C0XJ 3VR3A 4RCNA 1EY5A 2J7ZA 1OXUA 3A56A 2M2LA 3I73A 5LL6S 3FVQA 4C1NK 2B2UC 2E74C 3PUZA 4EQNA 3DWPA 3MAQA 5J1ZA 1WTXA 3GO5A 2B2WA 2B2VA 4QUCA 3NTHA 5CV6A 4FXDA 3C46A 5EBCA 3PO2B 3S14B 1BNZA 3I8ZA 1Z7TA 2B8GA 5FO9B 2ZXRA 4LJZC 2LKVA 3H6MA 3J81E 1LLRD 3BYYB 1F9PA 3I4NB 2A74C 4DNRB 1CHQD 2NTSA 4K5VA 4RHRA 1IW7D 1O78A 1LT4D 1PTOC 2L5TA 1H9SA 1Y8PB 5KYIA 3D6WA 4HAEA 1SMYD 2EVBA 4KHVA 3PMFA 4IUUA 1Y1VB 3M3YB 1V8QA 1F2MA 2F0TA 1MI2A 2CQAA 1GUTA 2HCCA 1AW7A 1EY6A 1RODA 2PO4A 3K57A 2NVYB 4OO1I 1H9JA 4HCEA 1WTPA 1IYVA 3A55A 3HRZC 3G6JB 4XQNA 5J22A 2AQ3B 5NUCA 4UAIA 1TKWB 3H09A 4A93B 5EQ0A 3A8JE 1II3A 1VCIA 4OIKA 4AYBB 3PIP3 3HS0C 4QCLA 1B50A 1PXUA 4DAPA 5E4XA 2EY5A 1S5FD 2C5CA 4J8QA 4RKLA 1QOHA 3D4WA 4TQUS 3BS1A 1DJRD 1EY7A 5I2XA 1RKNA 4DGZA 2MGSA 2F0FA 4CJ0B 4ZQ3A 3R2IA 4CKBA 4G57A 1BBXC 1E0BA 1QG7A 4IUQA 4OO1H 1B2TA 3ND8A 5EKIA 5CGKA 5FK9C 3P75A 2E2DC 5CC4A 5BN5A 3M85A 1EQTA 3PIO3 3BVZA 3NWTA 3K6OA 4C3JG 4C3JB 3S1MB 4XXEA 4Q5VA 1JOQA 2NYZD 1Q90A 1RD9D 3ZYYX 2FINB 5C44B 5JEAJ 3U9OA 3MVVA 3OIQA 1PDQA 2F0NA 2EJFC 5C3XA 1HQMC 3S2HB 3KK7A 1C8CA 4LAAA 3T13A 1JICA 5IIFA 1ZKOA 3PUVA 1LACA 4OIJA 2F0KA 5G3LD 4WRDA 2EYFA 2O4XA 5CORA 2R61A 4H0LC 3WOEA 5M5WB 3AU7A 1DD2A 2B2TC 2NUCA 3N6RA 4IURA 5IGFA 2O5JC 2KQ3A 3Q6SA 1STNA 1Q1EA 1YNJD 3T51B 3E6ZX 3QOJA 3JAME 2IW3A 3J81L 2HDMA 1LTID 4BY1B 1SNDA 2JSOA 3LNNA 3I91A 4PV1C 1TVXA 3C3LA 4C3HG 1B1ZA 2A68D 1SJED 2KHSA 1L0YB 5I6WA 2K5QA 2EY6A 1B3AA 2OXPA 5JAVA 1MGSA 2RDGA 4S3SA 1RDPD 4H44C 1WD0A 4RA8A 2R93B 3NQIA 5KGUA 1KTKA 1F9RA 3LWEA 5CBAE 1QWYA 2CVRA 2MUYA 3TP7A 1C4QA 4HN7A 3VR2A 4KY6A 4A3JB 1U4MA 1JWMD 4NW2A 3KLSX 3TMEA 1DYQA 2PYKA 1M4VA 1NUCA 3ITPA 5FLXE 1QNUA 3OIPA 4KN4C 4IFDI 4TKOB 2SDFA 5I2YA 2EXZA 1LT6D 4F87A 2VB2X 3CRLC 3NTIA 2JA5B 2IJ0A 4RGTA 5EKKA 1BF4A 4CGYB 1DOKA 4HMIA 1SE2A 3ONAB 2WIIB 3NE5B 3HOWB 3QWNA 1CQVA 3EVQA 5KYLA 4DN4M 2Q8RE 4FYDA 1A3TA 3E5SA 4KKSA 4PMWA 1U4PA 1SYCA 5JVH3 1EU4A 1KDAA 1NSNS 2PZTA 2A69D 1K8MA 2EDGA 3H94A 1D1KA 5FKAC 2KA7A 1SSOA 1SAPA 1SE4A 1M8AA 1NR2A 5C4JB 1PZJD 3VR6A 3GTOB 3M7NA 4DAVA 1CK1A 2F1MA 1EWCA 1SYBA 2FFKB 2RDHA 1SYDA 2VUMB 5COYA 4DK1A 2HCIA 3D8GA 4IFDH 2I46A 2KJXA 3T56B 5IODA 1G91A 3DWQA 3BDCA 1PTOH 2EYPA 4HSPA 1EY0A 4FXKC 2LFNA 3C1FA 4LK1C 2D62A 4FNFA 4L63B 4P2CB 1TWAB 1JWSD 1KAAA 1MSHA 1T5XD 4CBVA 2F0JA 2SEBD 5CV5A 5EPLA 5E3FA 1W6KA 4DA2A 5T1GA 1F9SA 2L1BA 5G3LF 2AWOA 1FYCA 3KBXA 1BCPF 1A15A 4G7HC 2I07B 3TZDA 5EJWA 3N52A 4MHEA 1HXYD 2F0EA 2ICEC 4FVMA 3K59A 1BXTA 2K1BA 4L6TB 2KCCA 3OMCA 2NVTB 3MFYA 2MJ8A 3AMUA 4IFDG 1F9QA 1JB3A 3TP5A 1XXGA 1SDFA 1ENFA 2XRSD 1H9KA 2XWBB 3CRKC 4IZ8A 3VA5A 4K2KA 1HTLD 4R8NA 1GJXA 4X3UA 3UI2A 1X3PA 1A6XA 3HOXB 3K5MA 4Z9CB 3W2DA 4PMBA 1E2VA 3MA2B 1F2YA 1UEAB 1LTTD 1SNMA 2R3ZA 4N9PA 3NPPA 3HGBA 1HUMA 3S17B 2HDLA 4ME5A 4KY5A 2G9HD 3PUXA 1I50B 1S5CD 1IHZA 4ZUIA 4I7ZC 2JA7B 3ND9A 1SEBD 5IGCA 3FMCA 2M9VA 3RLFA 1B44D 2XIWA 2DY7A 3D6CA 4ZK9B 1BCPC 4U68A 5E4WC 3IFDA 2AQ1B 3FPUB 2LS01 3V96A 3I4MB 1ZYRD 3TBIB 1D5MC 2BE5C 4DU9A 2NB0A 1ENCA 5JVG3 2C9OA 5FO8B 3K5NA 2BA1A 1EOTA 2NVQB 2R7ZB 1HCZA 2F0IA 2QKIC 2VB3X 2FJ2A 1JCKB 3NUCA 2F0VA 2BDNA 2MHVA 1ZXTA 4K8IA 4KD3A 5C4HA 1GUWA 3MXNA 5EBDA 4F7XA 4IN3A 1EWHA 1PRTB 2IPKD 2L9HA 2SNMA 4XTCS 5C5MA 3FKIB 3T4AC 1I4GA 1LTSD 2D5DA 1LTRD 3OW7A 2K6AA 2MPMA 1HFNA 1U4RA 1BDOA 3BDOA 3SK4A 5BN3A 3BDLA 3WDNA 2N88A 1S5DD 2A69C 1CM9A 2BDOA 3OHXC 3SK8A 5K36H 1TS5A 1CI3M 1RF2D 1XYIA 2Q8TA 3TDQA 1CT1D 1QJOA 3KF8A 3J7AF 1PRTF 1D5ZC 3TZUA 4DXGA 5KNBA 4BBRB 3U9SA 1EYCA 1G8ZD 2PW5A 2J0TD 3RD4A 4ZUJA 4C3HB 4KMUC 1PMRA 1VDZA 1QCBD 1CZWA 4XDXA 2D9UA 3RMHA 1E2ZA 1FNVA 2CW0C 2PMZB 3HOZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BYY B;  1TS3 A;  1JWU D;  1TS2 A;  5FK9 C;  1AN8 A;  1FD7 D;  1HQR D;  1CHQ D;  2AQ2 B;  2RDG A;  2NTS A;  5FKA C;  1LTB D;  1RDP D;  3BYT B;  4RHR A;  5D3I B;  1SE4 A;  3BZD B;  3MC0 B;  1ESF A;  4RHS A;  1LT4 D;  3CHB D;  1EU3 A;  1PTO C;  1XXG A;  1PZJ D;  1KTK A;  1I4R A;  3BVZ A;  1EEF D;  1ENF A;  1ET6 A;  2XRS D;  1CK1 A;  1FGB D;  1MD2 D;  2XRQ D;  3R2T A;  4K6L A;  3URY A;  1LTA D;  5ELF A;  5TSS A;  1EWC A;  4TSS A;  1JCK B;  1PYW D;  2NTT A;  2RDH A;  2TSS A;  1RD9 D;  4RH6 A;  1JQY D;  1LTG D;  3DWA A;  1EFI D;  1UUP A;  1LT3 D;  1V1P A;  1HTL D;  1D5X C;  1AW7 A;  3V05 A;  1PRT B;  2IPK D;  2J4X A;  4RCO A;  3TSS A;  1I4G A;  4Z9C B;  3W2D A;  1I4P A;  1LTS D;  3BVG A;  2ICI A;  1JWM D;  1STE A;  1QIL A;  3DWQ A;  1LO5 D;  1LTR D;  1LTT D;  1GOZ A;  1PTO H;  1SXT A;  2AQ3 B;  3BVM A;  1HA5 A;  3KLS X;  5ELE A;  1F77 A;  1JR0 D;  1XTC D;  1DYQ A;  4C56 C;  1I4H A;  1M4V A;  1PZK D;  1D6E C;  1PRT D;  4L63 B;  3R8B A;  3O13 A;  2Z8L A;  1V1O A;  1ET9 A;  1S5D D;  3GP7 A;  2G9H D;  2QIL A;  1SJH D;  1JWS D;  1FNU A;  1LT6 D;  1T5X D;  2SEB D;  1PTO F;  2R61 A;  1I4Q A;  4OHJ A;  1PRT C;  4RGO S;  1TY0 A;  1EEI D;  1KLU D;  2WV6 D;  1S5E D;  1TS5 A;  1RF2 D;  1S5F D;  4O1N A;  1S5B D;  1S5C D;  2QEJ C;  1CT1 D;  2IJ0 A;  4RFB A;  1PRT F;  4RGT A;  1D5Z C;  4UDU C;  4RGM A;  2XNA C;  1BCP B;  1BCP F;  1SEB D;  4DXG A;  1B44 D;  1DJR D;  1LTI D;  5ELC A;  1SE2 A;  5ELB A;  1G8Z D;  3DWP A;  1TS4 A;  1CHP D;  1V1P B;  3EA6 A;  1BCP C;  2CHB D;  1SBB B;  1PTO B;  1CQV A;  1HXY D;  1PZI D;  1SE3 A;  2AQ1 B;  3OWE B;  1BCP D;  3R2I A;  4ZYS A;  2O2L D;  1B1Z A;  4DXF A;  1UNS A;  3EFX D;  4BWG B;  1LT5 D;  1SJE D;  1FNW A;  3MFG A;  1TY2 A;  1L0X B;  1L0Y B;  1RCV D;  4RGN A;  1EU4 A;  5D3D A;  2XN9 C;  1BXT A;  1D5M C;  1FNV A;  1I4X A;  4L6T B;  3SEB A;  1KLG D;  1PTO D;  5I4D A;  5ELD A;  1LLR D; 
#chains in the Genus database with same CATH topology
 4U67 3;  1TS3 A;  1STH A;  4ZKC B;  1QVF A;  5EGT A;  2NZO A;  2JEA I;  4G7Z C;  2Y0S G;  1LTB D;  1YHB A;  2IT1 A;  4KHZ A;  1WOC A;  1PFM A;  3GTK B;  4DNT B;  4A3I H;  2FXQ A;  1UAP A;  3L2P A;  3I7F A;  2E2H B;  4LUZ A;  2NN6 H;  1FGB D;  5C44 G;  3NBH A;  1LTA D;  1Q8I A;  2TSS A;  1WTW A;  3ULP A;  1K28 A;  2DNE A;  1UUP A;  3NSW A;  2J4X A;  1VQJ A;  2VNU D;  3OWF A;  4DAM A;  4WJW A;  2F3W A;  3SHL A;  4B3S Q;  3K80 C;  2NWG A;  1TU2 B;  1I4P A;  3G6E A;  1KC8 C;  3S2D H;  4P72 A;  3J80 E;  1UEB A;  4WJ4 A;  4MIU A;  3OYY A;  4JI1 Q;  1SNO A;  2KED A;  4NP5 A;  2F4V Q;  4JI8 L;  2OQK A;  1G6Z A;  2PZW A;  2LXK A;  3CCE A;  1SYE A;  2X69 A;  4L5Q A;  5CYU A;  1XMO Q;  3GTJ H;  1L1O C;  4GLV B;  1P16 A;  3IAY A;  4OHJ A;  4RGO S;  1TY0 A;  2WV6 D;  1C9O A;  2A73 B;  5IP7 G;  4GN3 B;  4LF7 L;  2Q8I B;  5FJ8 H;  3H0G B;  5LMU Q;  1Y1V G;  2EYH A;  4JK1 C;  3A8I E;  1CA6 A;  1YJN A;  4KV6 A;  2PQE A;  1SE8 A;  3PIP A;  2RSN A;  5ELC A;  1E3P A;  4PNY A;  1CHP D;  3IFT A;  1A3U A;  4DUY Q;  1STG A;  2IHE A;  3S1R H;  2VXW A;  5IP9 G;  5M5X B;  2A6H D;  5D65 A;  1B4O A;  3ULL A;  3PUW A;  4HJ9 A;  4QMG A;  5C5L A;  2JK8 A;  2DJG C;  4DR4 Q;  3PO3 B;  3CPW A;  3I4M H;  1O7L A;  4JOI A;  4BXX H;  2GN5 A;  1Q8K A;  2JYO A;  4X3T A;  4IPC A;  3ICE A;  1TS2 A;  1WCM B;  4DUZ Q;  2KCN A;  4GKK L;  4C2M H;  3SGI A;  4A3E B;  2UUC L;  5LMN Q;  2HQE A;  3DEP A;  3CHB D;  3R3O A;  2UUA L;  3T1Y Q;  1JB7 A;  3K81 C;  3CKI B;  3A5Z B;  1OXX K;  4L8J A;  1WVL A;  1TWF H;  4DR7 L;  2UUB L;  4MNO A;  3GV6 A;  3KLS A;  3RZD B;  5M5W H;  1N33 Q;  1X54 A;  2B2Y C;  1BKB A;  3AFQ A;  3K7A B;  1JE5 A;  2UU9 Q;  1YNN C;  1SNP A;  3A7A B;  3IL8 A;  1V1P A;  5M9O A;  1D5X C;  4B9X A;  1Z9F A;  3V05 A;  2BCO A;  2LXJ A;  1B9M A;  3G48 A;  5CV9 A;  2LSS A;  2EE1 A;  1BUV T;  1ONL A;  1SFO B;  2HQL A;  4C3I B;  3WOF A;  1GOZ A;  1TWC B;  3PV0 A;  3TN2 A;  1U9R A;  1HZB A;  3H3V I;  3L9A X;  3SXH A;  4LF4 L;  1FGU A;  4XQQ A;  1Z47 A;  1PRT D;  1YZ6 A;  3QJY A;  1EY4 A;  3NWS A;  1WCM H;  2PQA A;  3M7G A;  5E7N A;  2JA5 G;  2PNH A;  2F0D A;  1PRT C;  3ERO A;  1SLJ A;  2EYM A;  1SYF A;  2F3V A;  1KD1 C;  3HFZ B;  2XSC A;  3HKZ E;  3FDT A;  1DGS A;  3HKZ B;  4YIJ A;  1R9T B;  1DZ1 A;  3MXP A;  2A6E D;  4DV4 Q;  1HUN A;  4KTA A;  2WB1 B;  2O5I C;  5ELB A;  1NAP A;  2RHS B;  4IQZ A;  1W2B A;  2B3G A;  3S15 B;  4ID6 A;  5M3M H;  5EAY A;  4LMQ D;  1HA6 A;  1X3F A;  3HZX A;  3OOC A;  4FF2 A;  1PTO B;  1SE3 A;  3T16 A;  1Y8O B;  3OWE B;  1JMC A;  3NXW A;  2RA4 A;  1UNS A;  5LL6 X;  4KJN A;  2L0C A;  4BWG B;  2EZV A;  2N49 A;  1L0X B;  2Q2U A;  4OXP A;  3I90 A;  2XN9 C;  4E6I A;  1HHV A;  1V1Q A;  4GOP A;  4UPA A;  2UU9 L;  4AIM A;  1RIP A;  4K5W A;  2BOS A;  3HEJ A;  5CBE E;  4FF4 A;  1AN8 A;  3MHB A;  1DOM A;  1MSG A;  4IUN A;  2B29 A;  3H3V H;  1M90 C;  4LF9 Q;  2LY7 A;  2CFM A;  4RHS A;  2Z0S A;  4GOP B;  1G29 1;  1KAB A;  3T1Y L;  2UUA Q;  2AKW B;  3A8K E;  4GNX C;  5LMN L;  1T9H A;  1TII D;  4KI0 A;  4QUF A;  2B2T A;  3Q24 A;  4QB4 A;  4HED A;  1SYG A;  4RAU C;  2WP8 J;  4J1M A;  5IT9 E;  1O80 A;  4PZ8 A;  1DXM A;  5IGD A;  3NP8 A;  1PYW D;  4IPD A;  2VQF Q;  4IFD J;  3DM1 A;  3PGZ A;  3DUZ A;  5ELO A;  2RCF A;  4DR6 Q;  2CW0 D;  1VQ4 A;  2Z6K A;  3L0O A;  3CCV A;  1D8L A;  2PW7 A;  4DV5 L;  1GUS A;  4XQJ A;  2F0Q A;  3GTM B;  1EYD A;  4HCS A;  5T1I A;  1HNZ Q;  2KCT A;  4PZ7 A;  3OSO A;  4YWM A;  4A3C G;  4KK7 A;  2MFI A;  2RKS A;  5C3W A;  2V1C C;  1B9N A;  3TRE A;  1WYD A;  2YTY A;  1ILQ A;  3U4V A;  2H4O A;  4DKA C;  2R93 G;  5KNC A;  2NVX B;  2AUJ D;  2AWN A;  5JPN C;  4X66 L;  4CJ1 B;  5A35 A;  3OW2 A;  2E76 C;  2N78 A;  4RFB A;  3TRZ A;  1B3Q A;  3EBE A;  4UDU C;  3RUZ A;  2HHH Q;  5E1F A;  1Q1B A;  5FLX L;  1AEX A;  5FLM H;  3KDF A;  1BBW A;  1SRO A;  2AUK A;  1PFB A;  1HR0 Q;  1BO0 A;  1V1P B;  1S4Z A;  2WAC A;  1WTO A;  2QGQ A;  3PO2 G;  3CU7 A;  1BCP D;  1NCV A;  2O2L D;  1IBL L;  3EFX D;  4BA1 I;  3E0J A;  4HTH A;  3KYH C;  2M00 A;  2V4D A;  3M4P A;  5C4Z A;  3MFG A;  4V0B A;  1TY2 A;  4OWT B;  4A3B H;  1EY8 A;  1G2S A;  3KJP A;  4A3K H;  1KLG D;  1Q3L A;  3T53 B;  4BY1 H;  1N32 Q;  4IJL A;  1YNJ C;  1WTR A;  3C1E A;  1B70 B;  4Y7N H;  5IGG A;  4JBW A;  2E75 C;  5D3I B;  4K5X A;  3OTO L;  3NQT A;  1ESF A;  1CKM A;  4BBS B;  2SNS A;  4PMC A;  3GTQ B;  1WI5 A;  4O42 A;  4MTN A;  2JA6 B;  1EYA A;  1ET6 A;  3S1R B;  3L7Z C;  1OXS C;  4UP8 A;  2H1E A;  3P7J A;  1HFG A;  4N8F A;  1J5E L;  2F03 A;  1HRJ A;  2ZJR A;  2KHJ A;  2JJQ A;  4QIW B;  4DR5 Q;  3PO3 H;  1UE1 A;  4X6A H;  1BR9 A;  4ZCK A;  2MP1 A;  2CQO A;  1Z6H A;  2BE5 D;  4NXN Q;  3R93 A;  2DY8 A;  5CV8 A;  4JI7 L;  2A8V A;  4KLK A;  5FO7 B;  2EYO A;  1GXD C;  3I70 A;  1QB5 D;  3F2U A;  5GAE C;  2B63 B;  1STE A;  1TWH B;  3KLW A;  1HZC A;  4DV1 Q;  3BVM A;  1PH1 A;  3LWU A;  2D2C C;  2EJG C;  4JG2 A;  5EKL A;  3VA7 A;  1UE6 A;  4K6D A;  3CC7 A;  2K01 A;  3CP0 A;  1D6E C;  2N55 A;  4POF A;  4LF8 L;  4N9T A;  3Q0A A;  3PF4 A;  3JAM L;  3DHQ A;  1F2Z A;  5JJZ A;  1VQM A;  5C6A A;  3E3X A;  4R8I A;  1OO9 B;  2K33 A;  5M3F H;  1PTO F;  4OON A;  3ER0 A;  1XX8 A;  2UXB L;  2I0Q A;  2R92 B;  1LUZ A;  4JV5 L;  2JE6 I;  3M4O B;  3H3V C;  5IOC A;  1S5B D;  3GTG B;  1A3V A;  4QL5 A;  2IX3 A;  3V2T A;  1A8V A;  1PH5 A;  2NVT H;  1RJT A;  4G4K A;  4A3B B;  4R4T A;  2Z4I A;  2JXM B;  3VR4 A;  3A74 A;  4DAY B;  1TS4 A;  3MTS A;  2R7Z G;  3SVM A;  1L1O A;  4Y7N B;  1D1I A;  1TWC H;  3NK9 A;  4CHT B;  2VQE Q;  3M4Y A;  4ZYS A;  5ISR A;  3HOY B;  4A3G B;  3GTL H;  3HOW G;  5JJL A;  2ZM6 Q;  2BA0 A;  4PQX A;  4DPG A;  3CMA A;  3A0J A;  1BOS A;  1STA A;  4C2M B;  5C0X G;  3NTK A;  4RWS C;  1IXR A;  1LTL A;  1KIX A;  4B3R L;  5ELD A;  2OTJ A;  4CDE C;  3CXC A;  4EGV A;  2K05 A;  2VZA A;  3S2D B;  5C4X B;  2NN6 G;  1K0S A;  1HH2 P;  4K14 A;  4NXM L;  1FJG L;  2JA8 G;  1TWF B;  2Y0S B;  1HNW Q;  2EY1 A;  1EU3 A;  4A3K B;  1Y14 B;  3I72 A;  1ZEQ X;  5ELN A;  1X65 A;  4BY7 B;  2R6G A;  5IT9 L;  2RSO A;  3J7A V;  2X6L A;  1CKN B;  3KBG A;  1X32 A;  3D31 A;  2KOL A;  2KBN A;  2ZM6 L;  4C3H H;  3J81 i;  2A5H A;  1I50 H;  2F0G A;  1LT3 D;  3FKI G;  2E2H H;  5FOB B;  3J7Y W;  4NXM Q;  4DAY A;  1O7Y A;  2HHH L;  3HOV B;  4B3R Q;  1EL0 A;  3EJI A;  1ILP A;  3CQZ B;  3GTO H;  1XTD A;  1VQA A;  1YNN D;  5H1S E;  5BR8 L;  1YHQ A;  2EYL A;  1CUK A;  2WKD A;  4XT3 B;  3QB3 A;  3VYR A;  3HOU B;  1L2F A;  4KY7 A;  1XTC D;  4MTK A;  1S3O A;  1I5F A;  2NBF A;  1MKH A;  1PLF A;  1SNQ A;  1PZK D;  3R8B A;  5GAG C;  3BG3 A;  2IX1 A;  4A3D B;  1YEZ A;  3GP7 A;  2K28 A;  2ZTE A;  1N9W A;  1VF7 A;  1SR3 A;  2EIF A;  1Y1V H;  1A2T A;  1FR3 A;  2RBM A;  1LYL A;  4IUV A;  1AFP A;  4X65 L;  1CFM A;  1Q12 A;  3DMU A;  4NPS A;  4HJ5 A;  2QEJ C;  3PCO B;  5DNF A;  1ESR A;  1O7Z A;  1E1T A;  5IE8 A;  1BCP B;  4BA2 I;  4F8M A;  3SE0 A;  2F0W A;  1VQH A;  4H13 C;  2VQF L;  5AFW A;  4K8J A;  3EQL C;  1IYJ B;  2QDB A;  1CTM A;  1PZI D;  1SN8 A;  3DXJ C;  3RZO B;  1CZG A;  2NZH A;  3NEL A;  1H9R A;  1V43 A;  3S16 H;  1DM0 B;  1D7Q A;  3HOZ G;  4DV1 L;  1FNW A;  4A3M B;  1VQ7 A;  4C1N I;  2ZJQ A;  2XVS A;  3SEB A;  4QIW E;  2H5X A;  2HUG A;  5JOB A;  1IYU A;  4OEL B;  1XMQ L;  2E2I B;  2RDF A;  4B08 A;  1AP0 A;  5A2Q L;  4K0K L;  5EPJ A;  5IYC G;  2AQ2 B;  3H91 A;  4EQP A;  4FF1 A;  2A6H C;  2EOT A;  3OTO Q;  1KXL A;  1HZA A;  3BYT B;  5HUR A;  3I56 A;  1PH4 A;  4H02 A;  2QCP X;  3M4Q A;  2QF7 A;  3K7A H;  4A3J H;  4DV3 Q;  1EEF D;  3C2P A;  4YHH L;  2XRQ D;  4P71 A;  4K6L A;  3UDX A;  5A2Q E;  4J15 A;  5ELF A;  2ZJP A;  2IWH A;  5LHY 1;  1Q82 C;  1K0R A;  2KHI A;  5IWA L;  5IT9 c;  1PYB A;  3CCQ A;  4NKL A;  1EFI D;  3MZ5 A;  1JOK A;  1B53 A;  2ZXO A;  2F4I A;  3KDF B;  5AJ3 L;  1XNQ L;  2E8G A;  4ME3 A;  1HR0 L;  2K50 A;  4DR3 Q;  4R4O A;  1H9M A;  5M3M B;  4JI2 Q;  1FVI A;  4EVO A;  5ELE A;  1VS0 A;  5HGQ A;  1XWE A;  3ERS X;  1Y69 U;  4JBJ A;  5HY6 A;  1CKO A;  3VYU A;  1HTP A;  3TP6 A;  1KRT A;  1E2W A;  2L55 A;  3FRP B;  2XWJ B;  2Z8L A;  1JOO A;  1V1O A;  1XPO A;  1ET9 A;  5JEA H;  1SJH D;  1Q46 A;  3VYT A;  2K5D A;  3H0G G;  4DK0 A;  4TVA B;  1KLU D;  2YYZ A;  1W6J A;  3Q23 A;  1X3Q A;  5JEA G;  4O1N A;  4WFN 3;  3U4Z A;  1RTO A;  3S1N B;  4RG1 A;  4A3E G;  4LF5 Q;  2IY5 B;  3MWY W;  4HSV A;  3S2H H;  3J80 L;  2UXC L;  3GDE A;  5C4J H;  1MIU A;  1K83 H;  4DR6 L;  1NTG A;  5M5Y B;  4ALP A;  4IOC A;  1ENA A;  3NHH A;  3K0Y A;  2CH4 W;  2L4N A;  1LT5 D;  3J7A 5;  5I9P A;  1DCZ A;  1ML0 D;  1H9S B;  2UUC Q;  4JI0 Q;  3SK5 A;  3CCS A;  4A3C H;  5I4D A;  3I4N G;  1WFQ A;  4KN7 C;  2QEX A;  2F0L A;  3GTM H;  3S14 H;  4BS9 A;  1HQR D;  1R4Q B;  5CV4 A;  1LV9 A;  4ZAI A;  1ICW A;  3W1G A;  3BZD B;  4OGQ C;  2TMP A;  2R92 G;  2OQ0 A;  3KJO A;  1A0I A;  2EYJ A;  4EQO A;  2KEC A;  2FMC A;  2EPB A;  5C0X I;  2F0M A;  5DM6 3;  4Y52 H;  3IKJ A;  1EY9 A;  4LFB Q;  3CME A;  4POG A;  3G7L A;  3URY A;  4FF3 A;  5TSS A;  1STY A;  4A75 A;  1DON A;  2CH4 A;  4DUY L;  3DWA A;  3PO2 H;  4XYQ A;  2ASB A;  1EZ6 A;  1CA5 A;  1EQV A;  4KKU A;  4DK3 C;  3OPO A;  1JOR A;  3HP3 A;  1PVO A;  4MN3 A;  4A93 H;  4XIG S;  4CKE A;  1WTV A;  2NVQ H;  2WIN B;  4FP5 D;  3OMG A;  4IO9 A;  2ZXP A;  2G9D A;  4LF7 Q;  2ICI A;  4KJO A;  4PG3 A;  4ABN A;  1LO5 D;  2I5L X;  1R4P B;  4DV4 L;  3PUY A;  4OWW B;  4GKJ Q;  1K8O A;  4ZRZ A;  2K4K A;  5IGE A;  4A3F B;  1B7Y B;  3PQI A;  4A3F G;  4JI6 L;  3A54 A;  4JI6 Q;  2PQA B;  5GQO A;  1W3S A;  2G5D A;  2QIL A;  1K83 B;  3X3M A;  3M4O H;  1IBK Q;  5C3E B;  5C3E G;  1EIH A;  3QO2 A;  4ULL A;  1IKL A;  5EPK A;  4HID A;  3ERQ A;  1AZQ A;  2ZT9 C;  1PV4 A;  2YTX A;  1DOL A;  4X62 L;  2DGY A;  1GUO A;  2ENB A;  5CV7 A;  3MEH A;  1IBK L;  2PZU A;  1VQ8 A;  4DFA A;  4IAL A;  2K5H A;  4RKB A;  2K04 A;  2B2Y A;  1J9O A;  1U4L A;  4QQB X;  3UE0 A;  1EIG A;  2F3I A;  3M9B A;  3EA6 A;  1RHP A;  2CHB D;  2IX0 A;  4M8A A;  2K7V A;  3X3N A;  5KEE A;  3SDZ A;  4BBR G;  2X6G A;  3TP8 A;  5I6Y A;  4LFB L;  3A5U A;  1IL8 A;  3K58 A;  1PA6 A;  1RCV D;  4RMF A;  1YIT A;  2UUB Q;  1SRU A;  1SNC A;  1VQK A;  1TWG B;  2NVX H;  2EJM A;  1JE4 A;  2WB1 E;  3UE1 A;  3NBI A;  4BY7 H;  4F88 A;  4JI0 L;  1CSQ A;  2JP1 A;  3GQB A;  4B3M L;  4KD4 A;  2F0P A;  5CR3 A;  3VDY A;  1IL2 A;  4R9W A;  3LX0 A;  1NY4 A;  5DAU A;  4YWK A;  1YI2 A;  2L11 A;  4P73 A;  1JJ2 A;  4OWX B;  5HGT A;  2Q2T A;  5J39 A;  1CQF A;  2F0H A;  1PFN A;  4V19 0;  1VQD A;  4TSS A;  1I6V C;  5C0X H;  3FPP A;  2ES2 A;  4WJ3 M;  3S1Q B;  4GKK Q;  1EZ8 A;  3S9W A;  2PCF B;  3I4L A;  3F2B A;  4DR1 L;  1A2U A;  4GLX A;  4G7O C;  3D0F A;  1QZH A;  3S1M H;  4RCO A;  3PIO A;  3AB9 A;  4NMZ A;  3HG9 A;  1VQE A;  4QF4 A;  1KDC A;  2E2I H;  1I6H B;  1NR4 A;  3BVG A;  4XT1 B;  1VMC A;  4DR4 L;  2WAQ B;  4CJ2 C;  4OL7 A;  1N34 Q;  5KIX A;  1KNE A;  2B8F A;  1I4H A;  1SMY C;  1VQI A;  1JC7 A;  5KRU A;  2DN8 A;  1F2L A;  3O13 A;  3SR1 A;  2RQX A;  1OXV A;  4I65 A;  1FNU A;  3CCM A;  1GO3 E;  2JEB I;  5IGB A;  3CW2 C;  3F2D A;  1I4Q A;  1EEI D;  2F0O A;  4WOR A;  4HMJ A;  5LMU L;  3IRB A;  1I3Q B;  2Z4H A;  2R7F A;  4GS3 A;  3S1N H;  4JI1 L;  2KEE A;  2XNA C;  1GM5 A;  1VQ6 A;  1QE6 A;  1YNX A;  3Q8D A;  4A3J G;  4A76 A;  1ZYR C;  1KAW A;  1XMO L;  3S15 H;  3I4O A;  5IWA Q;  1G2T A;  1TQO A;  4NDX A;  4H7B A;  2I5H A;  4GLA C;  5IP7 H;  3W3A A;  3FEW X;  4DR3 L;  4M1U B;  1BBU A;  4DXF A;  4GKJ L;  2F0U A;  3HOX G;  2MQH A;  4FXG C;  2OEO A;  3SK6 A;  5D3D A;  1J8I A;  2FHT A;  4B3S L;  1I4X A;  3I3C A;  1T5E A;  2FMM A;  4DV2 Q;  2DJF C;  4ZKB B;  4OO1 G;  2NTT A;  1HPC A;  1JWU D;  3MXG A;  1Q86 C;  1MJE A;  4FO2 A;  2K14 A;  2OF1 A;  4YHH Q;  2K52 A;  3RNU A;  3MC0 B;  4ZLT F;  3KFU A;  4R4C A;  2ID0 A;  4K2L A;  4DV0 L;  1ASZ A;  5JPM C;  1I4R A;  1PH8 A;  2YU9 B;  5JJI A;  2B2V C;  1I3Q H;  2B2W C;  4ODG A;  1WTQ A;  4K0K Q;  4Q0F A;  2JA8 H;  2A6E C;  4YCU A;  1S72 A;  1GUG A;  2B2U A;  1JQY D;  2JA9 A;  1L1O B;  1MJC A;  1Y8N B;  2HIV A;  1IKM A;  1GUN A;  4A3E H;  1EIY B;  3A7L A;  2WKC A;  5GAH C;  4ILW A;  1EQQ A;  2MNA A;  1QNK A;  5K36 G;  3HOW H;  1C48 A;  1WCM G;  3KF8 B;  1SXT A;  5CMD A;  1HA5 A;  1JT8 A;  1F77 A;  2L12 A;  1JR0 D;  3PF5 A;  2NZ1 D;  1STB A;  1WD1 A;  4DR2 Q;  4UP9 A;  5D14 A;  3KLR A;  3BZC A;  1YVC A;  1HR0 W;  5DEH A;  4GZY C;  2RVL A;  3QG1 A;  1NMG A;  4X3K A;  4EX5 A;  3QOL A;  1IW7 C;  4J6H A;  3K5L A;  1VQO A;  1RTN A;  4YY3 L;  1SFO H;  3VR5 A;  4IUP A;  4LF5 L;  1S5E D;  2KUM A;  4A3I B;  2D0O A;  3GD7 A;  2E5L L;  2K5W A;  5M3F B;  1XNR L;  2Z6K C;  1V9P A;  3T1H L;  4RGM A;  3RZD H;  4DF7 A;  3D4D A;  2E2J B;  1NBW A;  4C3I G;  3VYS A;  2JA5 H;  2YTV A;  3P1H A;  3MXN B;  5F2D A;  4A3M H;  1SBB B;  3D3R A;  1I94 Q;  2WB1 G;  4CKC A;  2DNC A;  3D4R A;  1Y1W B;  3GTP B;  3KUP A;  2OT2 A;  4A4I A;  4B9W A;  5C44 H;  1GHK A;  2A68 C;  1NE3 A;  1GKH A;  4RGN A;  1GHJ A;  1HNW L;  5BN4 A;  2ZTD A;  4X3S A;  2LMC B;  2KVM A;  4JBM A;  3RZO H;  2JA8 B;  1PTO D;  3QIA A;  1J6Q A;  2Q2I A;  5DM7 3;  1TWG H;  4DV7 Q;  1XNQ Q;  4KHP L;  3F2C A;  1D2B A;  1BQQ T;  1AZP A;  2B39 A;  4IUT A;  1FD7 D;  3P20 A;  1VF5 C;  3FHW A;  4APV A;  3HOU G;  4PZ6 A;  1E7Z A;  4LUV A;  3GV3 A;  3DEO A;  1KL9 A;  2F0S A;  4XYO A;  4JBK A;  1OXT A;  4KKT A;  3Q22 A;  4KHP Q;  4LUO A;  2K03 A;  4DV3 L;  1FJG Q;  1EIF A;  1KDB A;  1MD2 D;  2VW9 A;  3R2T A;  4LNQ A;  1K3B C;  1TR5 A;  1X3E A;  2SOB A;  5K5P A;  2VQE L;  1VMP A;  4RH6 A;  3STB D;  1PH7 A;  1LTG D;  3HOX H;  3GTJ B;  4FDB A;  3S16 B;  4YCV A;  3L3O C;  3K5O A;  3F1Z A;  3NEN A;  2K32 A;  3DM3 A;  1C0A A;  5M5X H;  4TRD A;  3TSS A;  5KND A;  4HR7 B;  1IBM L;  1QUQ B;  2PNR C;  1QIL A;  4JV5 Q;  1X56 A;  2EY2 A;  1NMF A;  2NN6 I;  3MXU A;  4BXX G;  5I9O A;  3T1H Q;  1KNA A;  2IL8 A;  4C56 C;  4A3L G;  2C35 B;  1LAB A;  2Z1C A;  3GTL B;  1TT2 A;  1MBY A;  2E2J H;  4I7A A;  2GA4 B;  3RLN A;  2K75 A;  1KRS A;  2PPB C;  2MO1 A;  5C0X J;  3VR3 A;  4RCN A;  2HD3 A;  5DLQ E;  2NVY H;  3CCU A;  4A3D H;  1EY5 A;  2WFW A;  2J7Z A;  1OXU A;  3A56 A;  4UHV A;  1U5K A;  2M2L A;  3I73 A;  5LL6 S;  3FVQ A;  4JI7 Q;  4IOA A;  4C1N K;  2B2U C;  2E74 C;  4NXN L;  2IHF A;  3PUZ A;  4EQN A;  3DWP A;  3MAQ A;  4DR5 L;  5J1Z A;  1K9M C;  1WTX A;  1WJJ A;  2B2W A;  3GO5 A;  2UXD Q;  2B2V A;  4GOP C;  4OX9 Q;  4QUC A;  3NTH A;  3CF5 A;  5CV6 A;  4FXD A;  3J80 c;  3C46 A;  4A3G H;  5EBC A;  3PO2 B;  3S14 B;  1BNZ A;  3I8Z A;  1Z7T A;  2B8G A;  5FO9 B;  1E24 A;  5BR8 Q;  2ZXR A;  4LJZ C;  2LKV A;  2N8N A;  2AHO B;  1VQ9 A;  3H6M A;  4QGU A;  3J81 E;  1J5E Q;  1LLR D;  3BYY B;  3EN2 A;  1F9P A;  3I4N B;  2A74 C;  2RHQ B;  4DNR B;  1CHQ D;  2NTS A;  4CDC C;  4K5V A;  4RHR A;  1IW7 D;  3W5O A;  1O78 A;  5IYD H;  1LT4 D;  1PTO C;  2L5T A;  1H9S A;  1Y8P B;  5KYI A;  3D6W A;  1A63 A;  4HAE A;  4CDD C;  2MO0 A;  1ASY A;  4JI5 L;  1SMY D;  2EVB A;  4KHV A;  3PMF A;  4IUU A;  1Y1V B;  3J80 i;  3M3Y B;  1V8Q A;  1F2M A;  1N32 L;  2F0T A;  1YJW A;  1B8A A;  4AQY L;  4HIM A;  1MI2 A;  2CQA A;  1GUT A;  2HCC A;  1AW7 A;  1EY6 A;  3BU2 A;  4A3G G;  1ROD A;  1EOV A;  3K7U C;  2PO4 A;  3K57 A;  2NVY B;  3KF6 B;  1H9J A;  1IBL Q;  4HCE A;  4OO1 I;  1WTP A;  1IYV A;  3A55 A;  3HRZ C;  3G6J B;  4XQN A;  3LGJ A;  3PSI A;  5J22 A;  4GNX B;  3KOJ A;  2AQ3 B;  1VQL A;  5NUC A;  4UAI A;  1TKW B;  3H09 A;  1MHW C;  4A93 B;  5EQ0 A;  3A8J E;  1II3 A;  1O7I A;  1VCI A;  1X55 A;  4OIK A;  4AYB B;  4BBS G;  4QJF A;  3PIP 3;  3GTK H;  1L0W A;  3HS0 C;  4QCL A;  1VQP A;  3EIV A;  1GD7 A;  1B50 A;  5JJK A;  4LFA Q;  3J7Z C;  4HIK A;  1PXU A;  2RF4 A;  4DAP A;  5E4X A;  2WAQ E;  2EY5 A;  2Z9H A;  1S5F D;  2C5C A;  4DV5 Q;  4LFC Q;  4J8Q A;  3J81 c;  5J3B A;  2JA7 G;  1N34 L;  4RKL A;  1QOH A;  3D4W A;  4TQU S;  4X64 L;  3BS1 A;  4IPG A;  1DJR D;  1EY7 A;  5I2X A;  4DR2 L;  1EYG A;  4QY7 A;  1OTC A;  1YBY A;  1PYS B;  1RKN A;  2VUM G;  4DGZ A;  2MGS A;  2F0F A;  4CJ0 B;  4ZQ3 A;  3R2I A;  4CKB A;  4G57 A;  1BBX C;  3TS2 A;  1E0B A;  2I5M X;  4JI3 L;  1QG7 A;  4IUQ A;  4OO1 H;  1B2T A;  1WTH A;  3ND8 A;  5EKI A;  5CGK A;  1X6O A;  5M5Y H;  2DUD A;  2BH2 A;  2XGT A;  5FK9 C;  3P75 A;  2PI2 A;  4UY8 C;  4YWL A;  3TQY A;  4IPH A;  3E9H A;  2E2D C;  4DNI A;  5CC4 A;  5BN5 A;  3BJU A;  2R92 H;  1YJ9 A;  1XPR A;  3M85 A;  4LF9 L;  1Q81 C;  1EQT A;  3FP9 A;  3PIO 3;  3BVZ A;  3NWT A;  2VY3 A;  3K6O A;  2Z6B A;  4HJ8 A;  3DLL A;  3G71 A;  4C3J G;  4C3J B;  4A3K G;  3S1M B;  4XXE A;  4Q5V A;  1JOQ A;  3HOY G;  2NYZ D;  1Q90 A;  1RD9 D;  3I55 A;  4DV2 L;  3ZYY X;  5FLM G;  2FIN B;  5C44 B;  5GAD C;  3CC4 A;  5JEA J;  3U9O A;  3MVV A;  3OIQ A;  1PDQ A;  2F0N A;  2EJF C;  2EQS A;  5C3X A;  1HQM C;  4A3M G;  4C3I H;  1C7Y A;  3S2H B;  2QW7 A;  3ULJ A;  3KK7 A;  1C8C A;  4LAA A;  3T13 A;  1JIC A;  5IIF A;  1ZKO A;  2AMC B;  4L5S A;  1EQR A;  5L37 A;  4X62 Q;  3PUV A;  4DV6 L;  2XTI A;  1LAC A;  4OIJ A;  2F0K A;  1X3G A;  5G3L D;  4WRD A;  4DV6 Q;  2QA4 A;  2EYF A;  2O4X A;  4LF4 Q;  5COR A;  3H0G H;  2R61 A;  4H0L C;  3WOE A;  5M5W B;  3CQZ H;  2L15 A;  3AU7 A;  1DD2 A;  2R93 H;  4BBS H;  4BBR H;  2B2T C;  4A3D G;  2NUC A;  3N6R A;  4IUR A;  1JJC B;  5IGF A;  3TS0 A;  1VQ5 A;  2O5J C;  2KQ3 A;  3Q6S A;  1STN A;  1Q1E A;  1YNJ D;  3T51 B;  3E6Z X;  2BH8 A;  3QOJ A;  5C3E H;  4YCW A;  3JAM E;  4HJA A;  4X66 Q;  2IW3 A;  3J81 L;  1G6P A;  1BVS A;  1LTI D;  2HDM A;  4BY1 B;  2ATW A;  1SND A;  3S24 A;  2JSO A;  3LNN A;  3I91 A;  4PV1 C;  1M1K C;  3JC6 6;  1TVX A;  3C3L A;  4C3H G;  1LM0 A;  1B1Z A;  4GN4 B;  1HNZ L;  2A68 D;  5IY0 A;  1SJE D;  2KHS A;  3CCR A;  1L0Y B;  5I6W A;  3HOU H;  2K5Q A;  4L5R C;  2EY6 A;  2K5V A;  4C3J H;  3PO3 G;  1B3A A;  2OXP A;  5JAV A;  1PH9 A;  1N33 L;  2F52 A;  1MGS A;  1RL2 A;  2RDG A;  1R9T H;  4DR7 Q;  4S3S A;  3QR8 A;  1RDP D;  5IP9 H;  1H95 A;  4H44 C;  2JA6 G;  1WD0 A;  4B3M Q;  4RA8 A;  1S40 A;  2R93 B;  3NQI A;  5KGU A;  1KTK A;  1F9R A;  3LWE A;  2HIX A;  3GTG H;  5CBA E;  2B63 H;  1QWY A;  2CVR A;  5FJ8 G;  2MUY A;  2OWO A;  3TP7 A;  1C4Q A;  2KEN A;  4HN7 A;  4JOI C;  2YU9 H;  4NB3 A;  3RN2 A;  3VR2 A;  4A3B G;  4KY6 A;  2UXC Q;  3E0E A;  3RN5 A;  1FL0 A;  2WAQ G;  4OEM B;  4HJ7 A;  4LFC L;  4A3J B;  1U4M A;  1JWM D;  4NW2 A;  3KLS X;  3I4M G;  1QVC A;  3TME A;  1DYQ A;  2PYK A;  1M4V A;  1NUC A;  3ITP A;  5FLX E;  1QNU A;  3OIP A;  4KN4 C;  3JAM i;  4IFD I;  4TKO B;  2SDF A;  5I2Y A;  3UDG A;  2VUM H;  2EXZ A;  1LT6 D;  4F87 A;  3M3Y H;  3MEF A;  1XPU A;  2VB2 X;  3CAM A;  3CRL C;  2VS1 A;  3H15 A;  1QZG A;  3NTI A;  2JA5 B;  2IJ0 A;  4RGT A;  5EKK A;  1BF4 A;  4CGY B;  1DOK A;  3CCJ A;  4HMI A;  2F4V L;  1SE2 A;  3ONA B;  3WWV A;  2WII B;  4P75 A;  3NE5 B;  3HOW B;  5C4X H;  3QWN A;  5AJ3 Q;  5IYB H;  1CQV A;  3EVQ A;  3K0X A;  5KYL A;  4DN4 M;  2Q8R E;  4FYD A;  1A3T A;  3E5S A;  4KKS A;  4PMW A;  1U4P A;  2B63 G;  1SYC A;  5JVH 3;  1EU4 A;  2CWA A;  1KDA A;  1NSN S;  4AYB G;  3AEV A;  2PZT A;  4R4I A;  2A69 D;  1K8M A;  2D0P A;  2EDG A;  3H94 A;  3TEH B;  1D1K A;  2Y0S E;  3HKZ G;  4LWC A;  5FKA C;  2KA7 A;  1SSO A;  3UDI A;  2OTL A;  1SAP A;  1E22 A;  1CKN A;  1SE4 A;  3RR5 A;  1HJP A;  1M8A A;  1NR2 A;  3U58 A;  4BY7 G;  5C4J B;  3HOV H;  1EFW A;  1XMQ Q;  1PZJ D;  1K8A C;  3VR6 A;  3GTO B;  3M7N A;  4DAV A;  1CK1 A;  1QVG A;  4OX9 L;  2F1M A;  1EWC A;  1SYB A;  1PHJ A;  1KHI A;  3HOV G;  2FFK B;  2RDH A;  1SYD A;  4JI3 Q;  2VUM B;  5COY A;  1JJG A;  4DK1 A;  4DUZ L;  2HCI A;  3CC2 A;  4JI4 L;  1EUJ A;  3D8G A;  4IFD H;  4N8X 1;  2PI2 E;  2I46 A;  1VQG A;  2GVA A;  2KJX A;  4O0A A;  3T56 B;  5IOD A;  1G91 A;  3DWQ A;  1TWH H;  3BDC A;  1PTO H;  2EYP A;  4HSP A;  1EY0 A;  4FXK C;  2LFN A;  4LK1 C;  3C1F A;  2D62 A;  4FNF A;  4EQ5 A;  4X65 Q;  4L63 B;  3GTQ H;  4P2C B;  1VQC A;  1TWA B;  3AQQ A;  1TXY A;  4LFA L;  1AH9 A;  1JWS D;  1KAA A;  1MSH A;  4HIO A;  5C4X G;  1T5X D;  4CBV A;  2F0J A;  2SEB D;  5CV5 A;  1NNX A;  1N8R C;  5EPL A;  1VQB A;  5M3F G;  4X64 Q;  1K73 C;  5E3F A;  5LMN W;  1W6K A;  4DA2 A;  2ZTC A;  5T1G A;  1AE2 A;  1F9S A;  2L1B A;  2RCN A;  5G3L F;  3RLO A;  2Q2H A;  2AWO A;  5GRO A;  1FYC A;  4A3F H;  3KBX A;  1BCP F;  1A15 A;  4JW0 A;  3HKS A;  4G7H C;  2I07 B;  2VL6 A;  3TZD A;  2OCE A;  1PH6 A;  5EJW A;  5FLX c;  1AE3 A;  4IJH A;  4O2D A;  4R4Q A;  3G4S A;  3N52 A;  4JI2 L;  4MHE A;  1HXY D;  4JI8 Q;  2F0E A;  3HOY H;  3U50 C;  4A3L H;  2ICE C;  4FVM A;  1K3R A;  2CKZ B;  3K59 A;  1BXT A;  2K1B A;  4L6T B;  2KCC A;  3OMC A;  4UP7 A;  1TWA H;  4AQY Q;  1PH2 A;  2NVT B;  3MFY A;  2MJ8 A;  3AMU A;  2JA6 H;  4IFD G;  1F9Q A;  1JB3 A;  3TP5 A;  4LF6 Q;  1XXG A;  4JI5 Q;  1ICF B;  1SDF A;  3I4N H;  1VQN A;  1ENF A;  2XRS D;  1H9K A;  5IYB G;  2XWB B;  4BY1 G;  3K8A A;  3CRK C;  4IZ8 A;  3VA5 A;  4P74 A;  4K2K A;  1HTL D;  4R8N A;  1GJX A;  4X3U A;  1UE5 A;  4AYB E;  1UWV A;  5M3M G;  3UI2 A;  1X3P A;  2JN4 A;  1A6X A;  3HOX B;  1K8G A;  2E5L Q;  3K5M A;  4Z9C B;  1PFS A;  3W2D A;  4PMB A;  1E2V A;  3MA2 B;  1F2Y A;  1UEA B;  2KCM A;  3E9I A;  1LTT D;  4B3T Q;  4JC0 A;  4JVZ A;  4R1J A;  1SNM A;  2R3Z A;  1YIJ A;  4N9P A;  3NPP A;  2GVB A;  3HGB A;  3GTP H;  1HUM A;  3S17 B;  3S1Q H;  2HDL A;  2UXD L;  4ME5 A;  4KY5 A;  2G9H D;  2UXB Q;  2A1A A;  3JAM c;  2CWP A;  1I6H H;  1U0L A;  3PUX A;  3CD6 A;  3FKI H;  1A62 A;  2CCZ A;  1X9N A;  1I50 B;  1S5C D;  2JQO A;  2R7Z H;  1IHZ A;  4ZUI A;  3I2Z A;  4I7Z C;  2JA7 B;  3ND9 A;  1SEB D;  5IGC A;  3FMC A;  2M9V A;  3RLF A;  1B44 D;  2XIW A;  1IBM Q;  2DY7 A;  3D6C A;  4ZK9 B;  1BCP C;  4U68 A;  5E4W C;  3IFD A;  2AQ1 B;  3FPU B;  2LS0 1;  3V96 A;  1HZ9 A;  1Y1W H;  2A19 A;  4GNX A;  4LW1 A;  1N36 Q;  3I4M B;  4DV0 Q;  4LF6 L;  1P8L A;  4JYA L;  2YV5 A;  3UDF A;  3KF6 A;  1ZYR D;  3TBI B;  1D5M C;  2BE5 C;  4DU9 A;  2NB0 A;  1CSP A;  3NEM A;  1ENC A;  4CDF C;  5JVG 3;  2C9O A;  5FO8 B;  3K5N A;  4A93 G;  2ALY B;  4A3I G;  2BA1 A;  1EOT A;  1HNX Q;  1SMX A;  2NVQ B;  2R7Z B;  1HCZ A;  2F0I A;  2QKI C;  1HNX L;  2VB3 X;  3S17 H;  2FJ2 A;  1JCK B;  3NUC A;  2F0V A;  2BDN A;  2MHV A;  1ZXT A;  4K8I A;  4KD3 A;  5C4H A;  3HOZ H;  1GUW A;  3MXN A;  2K5N A;  5EBD A;  4F7X A;  1I94 L;  1XJV A;  4IN3 A;  1EWH A;  1PRT B;  1E1O A;  1VQF A;  2IPK D;  4L5T A;  2L9H A;  2SNM A;  4XTC S;  4DV7 L;  1Y1W G;  5C5M A;  1NJI C;  3FKI B;  3T4A C;  1I4G A;  3CPF A;  4MZ9 A;  4DK6 C;  1LTS D;  2R7D A;  4JYA Q;  2D5D A;  1LTR D;  1N36 L;  3OW7 A;  2K6A A;  4AH6 A;  1XNR Q;  2MPM A;  3F8T A;  3ZJY C;  1HFN A;  1BDO A;  1U4R A;  2JA7 H;  3BDO A;  3SK4 A;  5BN3 A;  3BDL A;  3WDN A;  1PH3 A;  1KQS A;  2N88 A;  1S5D D;  2A69 C;  1CM9 A;  3BZK A;  1YHA A;  2BDO A;  3OHX C;  3CCL A;  1GVP A;  4JCV E;  3B6Y A;  1EWI A;  1Q7Y C;  3SK8 A;  5K36 H;  3W1B A;  1TS5 A;  1CI3 M;  1RF2 D;  3STB C;  1XYI A;  2PMZ E;  1G51 A;  2Q8T A;  3TDQ A;  1CT1 D;  1QJO A;  2P5Z X;  3KF8 A;  1PRT F;  4GN5 A;  3J7A F;  1D5Z C;  2QDL A;  3TZU A;  2N3S A;  4YY3 Q;  4DXG A;  4DR1 Q;  4LF8 Q;  5KNB A;  1UE7 A;  4BBR B;  3U9S A;  1EYC A;  1G8Z D;  2PW5 A;  2J0T D;  3RD4 A;  2EXD A;  3AYH B;  4ZUJ A;  5IYD G;  4C3H B;  4KMU C;  3AFP A;  3NBH B;  1PMR A;  1VDZ A;  4B3T L;  1QCB D;  1IZ6 A;  1QUQ A;  4JI4 Q;  1CZW A;  4XDX A;  4JPB W;  2HT1 A;  2D9U A;  3RMH A;  1E2Z A;  1FNV A;  2CW0 C;  5IYC H;  2PMZ B;  3HOZ B;  3J81 j; 
#chains in the Genus database with same CATH homology
 4U67 3;  1TS3 A;  1STH A;  4ZKC B;  5EGT A;  2JEA I;  4G7Z C;  1LTB D;  2IT1 A;  4KHZ A;  1PFM A;  3GTK B;  4DNT B;  1UAP A;  2E2H B;  2NN6 H;  1FGB D;  3NBH A;  1LTA D;  1Q8I A;  2TSS A;  1WTW A;  2DNE A;  1UUP A;  3NSW A;  2J4X A;  2VNU D;  3OWF A;  4WJW A;  2F3W A;  3SHL A;  2NWG A;  1TU2 B;  1I4P A;  3J80 E;  4MIU A;  1SNO A;  2KED A;  4NP5 A;  1G6Z A;  2PZW A;  1SYE A;  2X69 A;  5CYU A;  3IAY A;  4OHJ A;  4RGO S;  1TY0 A;  2WV6 D;  2A73 B;  2Q8I B;  3H0G B;  2EYH A;  4JK1 C;  3A8I E;  1CA6 A;  4KV6 A;  2PQE A;  2RSN A;  5ELC A;  4PNY A;  1CHP D;  3IFT A;  1A3U A;  1STG A;  2VXW A;  5M5X B;  2A6H D;  5D65 A;  1B4O A;  3PUW A;  4QMG A;  5C5L A;  3PO3 B;  1O7L A;  2JYO A;  4X3T A;  1TS2 A;  1WCM B;  2KCN A;  4A3E B;  2HQE A;  3DEP A;  3CHB D;  3R3O A;  3CKI B;  1OXX K;  4L8J A;  1WVL A;  3GV6 A;  3KLS A;  3RZD B;  2B2Y C;  3K7A B;  1YNN C;  1SNP A;  3A7A B;  3IL8 A;  1V1P A;  5M9O A;  1D5X C;  4B9X A;  3V05 A;  2BCO A;  1B9M A;  5CV9 A;  2EE1 A;  1BUV T;  1ONL A;  1SFO B;  4C3I B;  3WOF A;  1GOZ A;  1TWC B;  3PV0 A;  3TN2 A;  1U9R A;  3L9A X;  3SXH A;  4XQQ A;  1Z47 A;  1PRT D;  3QJY A;  1EY4 A;  3NWS A;  3M7G A;  2F0D A;  1PRT C;  3ERO A;  2EYM A;  1SYF A;  2F3V A;  2XSC A;  3FDT A;  3HKZ B;  4YIJ A;  1R9T B;  1DZ1 A;  3MXP A;  2A6E D;  1HUN A;  4KTA A;  2WB1 B;  2O5I C;  5ELB A;  1NAP A;  4IQZ A;  3S15 B;  4ID6 A;  4LMQ D;  1HA6 A;  3HZX A;  3OOC A;  4FF2 A;  1PTO B;  1SE3 A;  3T16 A;  1Y8O B;  3OWE B;  3NXW A;  2RA4 A;  1UNS A;  5LL6 X;  4KJN A;  2L0C A;  4BWG B;  2EZV A;  1L0X B;  3I90 A;  2XN9 C;  4E6I A;  1HHV A;  4K5W A;  2BOS A;  3HEJ A;  5CBE E;  4FF4 A;  1AN8 A;  3MHB A;  1DOM A;  1MSG A;  4IUN A;  2LY7 A;  4RHS A;  1G29 1;  1KAB A;  3A8K E;  1TII D;  4KI0 A;  4QUF A;  2B2T A;  3Q24 A;  4QB4 A;  4HED A;  1SYG A;  4RAU C;  2WP8 J;  4J1M A;  5IT9 E;  1O80 A;  1DXM A;  5IGD A;  3NP8 A;  1PYW D;  4IFD J;  3DM1 A;  3DUZ A;  2CW0 D;  2PW7 A;  1GUS A;  4XQJ A;  2F0Q A;  3GTM B;  1EYD A;  4HCS A;  5T1I A;  3OSO A;  4KK7 A;  2RKS A;  5C3W A;  1B9N A;  1ILQ A;  2H4O A;  2NVX B;  5KNC A;  2AUJ D;  2AWN A;  5JPN C;  4CJ1 B;  5A35 A;  2E76 C;  4RFB A;  4UDU C;  3RUZ A;  5E1F A;  1Q1B A;  5FLX L;  1AEX A;  2AUK A;  1PFB A;  1BO0 A;  1V1P B;  1S4Z A;  2WAC A;  1WTO A;  3CU7 A;  1BCP D;  1NCV A;  2O2L D;  3EFX D;  4BA1 I;  3E0J A;  4HTH A;  2M00 A;  2V4D A;  5C4Z A;  3MFG A;  4V0B A;  1TY2 A;  1EY8 A;  1G2S A;  1KLG D;  1Q3L A;  3T53 B;  1YNJ C;  1WTR A;  3C1E A;  5IGG A;  4JBW A;  2E75 C;  5D3I B;  4K5X A;  3NQT A;  1ESF A;  4BBS B;  2SNS A;  4PMC A;  3GTQ B;  4O42 A;  2JA6 B;  1EYA A;  1ET6 A;  3S1R B;  3L7Z C;  1OXS C;  2H1E A;  3P7J A;  1HFG A;  2F03 A;  1HRJ A;  4QIW B;  1BR9 A;  2MP1 A;  1Z6H A;  2BE5 D;  3R93 A;  2DY8 A;  5CV8 A;  5FO7 B;  2EYO A;  1GXD C;  3I70 A;  1QB5 D;  3F2U A;  2B63 B;  1STE A;  1TWH B;  3BVM A;  3LWU A;  3VA7 A;  2D2C C;  2EJG C;  5EKL A;  4K6D A;  2K01 A;  1D6E C;  2N55 A;  4N9T A;  3Q0A A;  3JAM L;  3DHQ A;  1F2Z A;  5JJZ A;  5C6A A;  4R8I A;  1OO9 B;  2K33 A;  1PTO F;  1XX8 A;  2R92 B;  2JE6 I;  3M4O B;  3H3V C;  5IOC A;  1S5B D;  3GTG B;  1A3V A;  2IX3 A;  3V2T A;  1RJT A;  4G4K A;  4A3B B;  2Z4I A;  2JXM B;  3VR4 A;  1TS4 A;  3MTS A;  3SVM A;  4Y7N B;  1D1I A;  3NK9 A;  4CHT B;  3M4Y A;  4ZYS A;  5ISR A;  3HOY B;  4A3G B;  2BA0 A;  4PQX A;  1BOS A;  1STA A;  4C2M B;  5C0X G;  3NTK A;  4RWS C;  5ELD A;  3S2D B;  4EGV A;  2K05 A;  5C4X B;  2NN6 G;  4K14 A;  1TWF B;  2Y0S B;  2EY1 A;  1EU3 A;  4A3K B;  3I72 A;  1ZEQ X;  4BY7 B;  2R6G A;  5IT9 L;  2RSO A;  3J7A V;  2X6L A;  3KBG A;  1X32 A;  3D31 A;  2KOL A;  2A5H A;  2F0G A;  1LT3 D;  5FOB B;  3J7Y W;  4DAY A;  1O7Y A;  3HOV B;  1EL0 A;  3EJI A;  1ILP A;  3CQZ B;  1YNN D;  2EYL A;  2WKD A;  4XT3 B;  3QB3 A;  3VYR A;  3HOU B;  4KY7 A;  1XTC D;  2NBF A;  1PLF A;  1SNQ A;  1PZK D;  3R8B A;  3BG3 A;  2IX1 A;  4A3D B;  3GP7 A;  2K28 A;  1VF7 A;  1A2T A;  1FR3 A;  2RBM A;  4IUV A;  1AFP A;  1CFM A;  1Q12 A;  3DMU A;  2QEJ C;  5DNF A;  1ESR A;  1O7Z A;  1BCP B;  4BA2 I;  4F8M A;  3SE0 A;  2F0W A;  4H13 C;  5AFW A;  4K8J A;  3EQL C;  2QDB A;  1CTM A;  1PZI D;  3DXJ C;  3RZO B;  1CZG A;  1H9R A;  1V43 A;  1DM0 B;  1FNW A;  4A3M B;  4C1N I;  2XVS A;  3SEB A;  2HUG A;  5JOB A;  1IYU A;  2E2I B;  2RDF A;  4B08 A;  1AP0 A;  5A2Q L;  5EPJ A;  2AQ2 B;  3H91 A;  4EQP A;  4FF1 A;  2A6H C;  2EOT A;  3BYT B;  5HUR A;  2QCP X;  2QF7 A;  3C2P A;  1EEF D;  2XRQ D;  4K6L A;  5A2Q E;  5ELF A;  2IWH A;  5LHY 1;  4NKL A;  1EFI D;  3MZ5 A;  1JOK A;  1B53 A;  2ZXO A;  2F4I A;  5M3M B;  1H9M A;  4EVO A;  5ELE A;  1XWE A;  1Y69 U;  3VYU A;  1HTP A;  3TP6 A;  1E2W A;  2L55 A;  3FRP B;  2XWJ B;  2Z8L A;  1JOO A;  1V1O A;  1ET9 A;  5JEA H;  1SJH D;  3VYT A;  2K5D A;  4DK0 A;  1KLU D;  2YYZ A;  1W6J A;  3Q23 A;  1X3Q A;  5JEA G;  4O1N A;  4WFN 3;  1RTO A;  3S1N B;  3MWY W;  4HSV A;  3J80 L;  5M5Y B;  1ENA A;  3NHH A;  3K0Y A;  2L4N A;  1LT5 D;  5I9P A;  1DCZ A;  1ML0 D;  1H9S B;  3SK5 A;  5I4D A;  4KN7 C;  2F0L A;  4BS9 A;  1HQR D;  1R4Q B;  5CV4 A;  1LV9 A;  4ZAI A;  1ICW A;  3BZD B;  4OGQ C;  2TMP A;  2EYJ A;  4EQO A;  2KEC A;  2FMC A;  2EPB A;  5C0X I;  2F0M A;  5DM6 3;  3IKJ A;  1EY9 A;  3G7L A;  3URY A;  4FF3 A;  5TSS A;  1STY A;  1DON A;  3DWA A;  4XYQ A;  1EZ6 A;  1CA5 A;  1EQV A;  4KKU A;  1JOR A;  3OPO A;  3HP3 A;  4MN3 A;  4XIG S;  4CKE A;  1WTV A;  2WIN B;  4FP5 D;  3OMG A;  2ZXP A;  2G9D A;  2ICI A;  4KJO A;  4ABN A;  1LO5 D;  1R4P B;  3PUY A;  1K8O A;  4ZRZ A;  5IGE A;  4A3F B;  3A54 A;  3X3M A;  2QIL A;  1K83 B;  5C3E B;  1EIH A;  3QO2 A;  4ULL A;  1IKL A;  5EPK A;  3ERQ A;  1AZQ A;  2ZT9 C;  1DOL A;  1GUO A;  2ENB A;  5CV7 A;  3MEH A;  2PZU A;  4DFA A;  4IAL A;  4RKB A;  2K04 A;  2B2Y A;  1J9O A;  1U4L A;  1EIG A;  3EA6 A;  1RHP A;  2CHB D;  2IX0 A;  4M8A A;  2K7V A;  3X3N A;  5KEE A;  3SDZ A;  2X6G A;  3TP8 A;  5I6Y A;  1IL8 A;  3K58 A;  1RCV D;  1SNC A;  1TWG B;  2EJM A;  1JE4 A;  3NBI A;  4F88 A;  2JP1 A;  3GQB A;  4KD4 A;  2F0P A;  5CR3 A;  4R9W A;  3LX0 A;  5DAU A;  2L11 A;  5HGT A;  5J39 A;  1CQF A;  2F0H A;  1PFN A;  4V19 0;  4TSS A;  5C0X H;  1I6V C;  3FPP A;  3S1Q B;  1EZ8 A;  3S9W A;  2PCF B;  3I4L A;  1A2U A;  4G7O C;  4RCO A;  3AB9 A;  4NMZ A;  3HG9 A;  4QF4 A;  1KDC A;  1I6H B;  1NR4 A;  3BVG A;  4XT1 B;  1VMC A;  2WAQ B;  4CJ2 C;  4OL7 A;  5KIX A;  1KNE A;  2B8F A;  1SMY C;  1I4H A;  5KRU A;  1JC7 A;  2DN8 A;  1F2L A;  3O13 A;  3SR1 A;  2RQX A;  1OXV A;  4I65 A;  1FNU A;  2JEB I;  5IGB A;  1I4Q A;  1EEI D;  2F0O A;  4WOR A;  4HMJ A;  1I3Q B;  2Z4H A;  2KEE A;  2XNA C;  1QE6 A;  1ZYR C;  1G2T A;  1TQO A;  4NDX A;  4H7B A;  3W3A A;  3FEW X;  4M1U B;  4DXF A;  2F0U A;  4FXG C;  2OEO A;  3SK6 A;  5D3D A;  1J8I A;  2FHT A;  1I4X A;  3I3C A;  1T5E A;  2FMM A;  4ZKB B;  4OO1 G;  2NTT A;  1HPC A;  1JWU D;  3MXG A;  4FO2 A;  2OF1 A;  3MC0 B;  4ZLT F;  2ID0 A;  4K2L A;  5JPM C;  1I4R A;  2YU9 B;  2B2V C;  2B2W C;  4ODG A;  1WTQ A;  4Q0F A;  2A6E C;  1GUG A;  2B2U A;  1JQY D;  1Y8N B;  1IKM A;  1GUN A;  3A7L A;  2WKC A;  4ILW A;  1QNK A;  5K36 G;  1C48 A;  1SXT A;  5CMD A;  1HA5 A;  1F77 A;  2L12 A;  1JR0 D;  2NZ1 D;  1STB A;  1WD1 A;  5D14 A;  3KLR A;  5DEH A;  4GZY C;  2RVL A;  3QG1 A;  4X3K A;  3QOL A;  1IW7 C;  4J6H A;  3K5L A;  1RTN A;  3VR5 A;  4IUP A;  1S5E D;  2KUM A;  4A3I B;  3GD7 A;  2K5W A;  5M3F B;  4RGM A;  4DF7 A;  3D4D A;  2E2J B;  4C3I G;  3VYS A;  3P1H A;  5F2D A;  1SBB B;  3D3R A;  4CKC A;  2DNC A;  3D4R A;  1Y1W B;  3GTP B;  3KUP A;  2OT2 A;  4B9W A;  1GHK A;  2A68 C;  4RGN A;  1GHJ A;  5BN4 A;  4X3S A;  2LMC B;  2KVM A;  2JA8 B;  1PTO D;  3QIA A;  5DM7 3;  1D2B A;  1BQQ T;  1AZP A;  2B39 A;  4IUT A;  1FD7 D;  3P20 A;  1VF5 C;  3GV3 A;  3DEO A;  2F0S A;  4XYO A;  1OXT A;  4KKT A;  3Q22 A;  2K03 A;  1KDB A;  1MD2 D;  3R2T A;  1TR5 A;  2SOB A;  5K5P A;  1VMP A;  4RH6 A;  1LTG D;  3GTJ B;  3S16 B;  3L3O C;  3K5O A;  2K32 A;  4TRD A;  3TSS A;  5KND A;  4HR7 B;  2PNR C;  1QIL A;  2EY2 A;  2NN6 I;  3MXU A;  5I9O A;  1KNA A;  2IL8 A;  4C56 C;  1LAB A;  2Z1C A;  3GTL B;  1TT2 A;  1MBY A;  2GA4 B;  2PPB C;  5C0X J;  3VR3 A;  4RCN A;  1EY5 A;  2J7Z A;  1OXU A;  3A56 A;  2M2L A;  3I73 A;  5LL6 S;  3FVQ A;  4C1N K;  2B2U C;  2E74 C;  3PUZ A;  4EQN A;  3DWP A;  3MAQ A;  5J1Z A;  1WTX A;  3GO5 A;  2B2W A;  2B2V A;  4QUC A;  3NTH A;  5CV6 A;  4FXD A;  3C46 A;  5EBC A;  3PO2 B;  3S14 B;  1BNZ A;  3I8Z A;  1Z7T A;  2B8G A;  5FO9 B;  2ZXR A;  4LJZ C;  2LKV A;  3H6M A;  3J81 E;  1LLR D;  3BYY B;  1F9P A;  3I4N B;  2A74 C;  4DNR B;  1CHQ D;  2NTS A;  4K5V A;  4RHR A;  1IW7 D;  1O78 A;  1LT4 D;  1PTO C;  2L5T A;  1H9S A;  1Y8P B;  5KYI A;  3D6W A;  4HAE A;  1SMY D;  2EVB A;  4KHV A;  3PMF A;  4IUU A;  1Y1V B;  3M3Y B;  1V8Q A;  1F2M A;  2F0T A;  1MI2 A;  2CQA A;  1GUT A;  2HCC A;  1AW7 A;  1EY6 A;  1ROD A;  2PO4 A;  3K57 A;  2NVY B;  4OO1 I;  1H9J A;  4HCE A;  1WTP A;  1IYV A;  3A55 A;  3HRZ C;  3G6J B;  4XQN A;  5J22 A;  2AQ3 B;  5NUC A;  4UAI A;  1TKW B;  3H09 A;  4A93 B;  5EQ0 A;  3A8J E;  1II3 A;  1VCI A;  4OIK A;  4AYB B;  3PIP 3;  3HS0 C;  4QCL A;  1B50 A;  1PXU A;  4DAP A;  5E4X A;  2EY5 A;  1S5F D;  2C5C A;  4J8Q A;  4RKL A;  1QOH A;  3D4W A;  4TQU S;  3BS1 A;  1DJR D;  1EY7 A;  5I2X A;  1RKN A;  4DGZ A;  2MGS A;  2F0F A;  4CJ0 B;  4ZQ3 A;  3R2I A;  4CKB A;  4G57 A;  1BBX C;  1E0B A;  1QG7 A;  4IUQ A;  4OO1 H;  1B2T A;  3ND8 A;  5EKI A;  5CGK A;  5FK9 C;  3P75 A;  2E2D C;  5CC4 A;  5BN5 A;  3M85 A;  1EQT A;  3PIO 3;  3BVZ A;  3NWT A;  3K6O A;  4C3J G;  4C3J B;  3S1M B;  4XXE A;  4Q5V A;  1JOQ A;  2NYZ D;  1Q90 A;  1RD9 D;  3ZYY X;  2FIN B;  5C44 B;  5JEA J;  3U9O A;  3MVV A;  3OIQ A;  1PDQ A;  2F0N A;  2EJF C;  5C3X A;  1HQM C;  3S2H B;  3KK7 A;  1C8C A;  4LAA A;  3T13 A;  1JIC A;  5IIF A;  1ZKO A;  3PUV A;  1LAC A;  4OIJ A;  2F0K A;  5G3L D;  4WRD A;  2EYF A;  2O4X A;  5COR A;  2R61 A;  4H0L C;  3WOE A;  5M5W B;  3AU7 A;  1DD2 A;  2B2T C;  2NUC A;  3N6R A;  4IUR A;  5IGF A;  2O5J C;  2KQ3 A;  3Q6S A;  1STN A;  1Q1E A;  1YNJ D;  3T51 B;  3E6Z X;  3QOJ A;  3JAM E;  2IW3 A;  3J81 L;  2HDM A;  1LTI D;  4BY1 B;  1SND A;  2JSO A;  3LNN A;  3I91 A;  4PV1 C;  1TVX A;  3C3L A;  4C3H G;  1B1Z A;  2A68 D;  1SJE D;  2KHS A;  1L0Y B;  5I6W A;  2K5Q A;  2EY6 A;  1B3A A;  2OXP A;  5JAV A;  1MGS A;  2RDG A;  4S3S A;  1RDP D;  4H44 C;  1WD0 A;  4RA8 A;  2R93 B;  3NQI A;  5KGU A;  1KTK A;  1F9R A;  3LWE A;  5CBA E;  1QWY A;  2CVR A;  2MUY A;  3TP7 A;  1C4Q A;  4HN7 A;  3VR2 A;  4KY6 A;  4A3J B;  1U4M A;  1JWM D;  4NW2 A;  3KLS X;  3TME A;  1DYQ A;  2PYK A;  1M4V A;  1NUC A;  3ITP A;  5FLX E;  1QNU A;  3OIP A;  4KN4 C;  4IFD I;  4TKO B;  2SDF A;  5I2Y A;  2EXZ A;  1LT6 D;  4F87 A;  2VB2 X;  3CRL C;  3NTI A;  2JA5 B;  2IJ0 A;  4RGT A;  5EKK A;  1BF4 A;  4CGY B;  1DOK A;  4HMI A;  1SE2 A;  3ONA B;  2WII B;  3NE5 B;  3HOW B;  3QWN A;  1CQV A;  3EVQ A;  5KYL A;  4DN4 M;  2Q8R E;  4FYD A;  1A3T A;  3E5S A;  4KKS A;  4PMW A;  1U4P A;  1SYC A;  5JVH 3;  1EU4 A;  1KDA A;  1NSN S;  2PZT A;  2A69 D;  1K8M A;  2EDG A;  3H94 A;  1D1K A;  5FKA C;  2KA7 A;  1SSO A;  1SAP A;  1SE4 A;  1M8A A;  1NR2 A;  5C4J B;  1PZJ D;  3VR6 A;  3GTO B;  3M7N A;  4DAV A;  1CK1 A;  2F1M A;  1EWC A;  1SYB A;  2FFK B;  2RDH A;  1SYD A;  2VUM B;  5COY A;  4DK1 A;  2HCI A;  3D8G A;  4IFD H;  2I46 A;  2KJX A;  3T56 B;  5IOD A;  1G91 A;  3DWQ A;  3BDC A;  1PTO H;  2EYP A;  4HSP A;  1EY0 A;  4FXK C;  2LFN A;  3C1F A;  4LK1 C;  2D62 A;  4FNF A;  4L63 B;  4P2C B;  1TWA B;  1JWS D;  1KAA A;  1MSH A;  1T5X D;  4CBV A;  2F0J A;  2SEB D;  5CV5 A;  5EPL A;  5E3F A;  1W6K A;  4DA2 A;  5T1G A;  1F9S A;  2L1B A;  5G3L F;  2AWO A;  1FYC A;  3KBX A;  1BCP F;  1A15 A;  4G7H C;  2I07 B;  3TZD A;  5EJW A;  3N52 A;  4MHE A;  1HXY D;  2F0E A;  2ICE C;  4FVM A;  3K59 A;  1BXT A;  2K1B A;  4L6T B;  2KCC A;  3OMC A;  2NVT B;  3MFY A;  2MJ8 A;  3AMU A;  4IFD G;  1F9Q A;  1JB3 A;  3TP5 A;  1XXG A;  1SDF A;  1ENF A;  2XRS D;  1H9K A;  2XWB B;  3CRK C;  4IZ8 A;  3VA5 A;  4K2K A;  1HTL D;  4R8N A;  1GJX A;  4X3U A;  3UI2 A;  1X3P A;  1A6X A;  3HOX B;  3K5M A;  4Z9C B;  3W2D A;  4PMB A;  1E2V A;  3MA2 B;  1F2Y A;  1UEA B;  1LTT D;  1SNM A;  2R3Z A;  4N9P A;  3NPP A;  3HGB A;  1HUM A;  3S17 B;  2HDL A;  4ME5 A;  4KY5 A;  2G9H D;  3PUX A;  1I50 B;  1S5C D;  1IHZ A;  4ZUI A;  4I7Z C;  2JA7 B;  3ND9 A;  1SEB D;  5IGC A;  3FMC A;  2M9V A;  3RLF A;  1B44 D;  2XIW A;  2DY7 A;  3D6C A;  4ZK9 B;  1BCP C;  4U68 A;  5E4W C;  3IFD A;  2AQ1 B;  3FPU B;  2LS0 1;  3V96 A;  3I4M B;  1ZYR D;  3TBI B;  1D5M C;  2BE5 C;  4DU9 A;  2NB0 A;  1ENC A;  5JVG 3;  2C9O A;  5FO8 B;  3K5N A;  2BA1 A;  1EOT A;  2NVQ B;  2R7Z B;  1HCZ A;  2F0I A;  2QKI C;  2VB3 X;  2FJ2 A;  1JCK B;  3NUC A;  2F0V A;  2BDN A;  2MHV A;  1ZXT A;  4K8I A;  4KD3 A;  5C4H A;  1GUW A;  3MXN A;  5EBD A;  4F7X A;  4IN3 A;  1EWH A;  1PRT B;  2IPK D;  2L9H A;  2SNM A;  4XTC S;  5C5M A;  3FKI B;  3T4A C;  1I4G A;  1LTS D;  2D5D A;  1LTR D;  3OW7 A;  2K6A A;  2MPM A;  1HFN A;  1U4R A;  1BDO A;  3BDO A;  3SK4 A;  5BN3 A;  3BDL A;  3WDN A;  2N88 A;  1S5D D;  2A69 C;  1CM9 A;  2BDO A;  3OHX C;  3SK8 A;  5K36 H;  1TS5 A;  1CI3 M;  1RF2 D;  1XYI A;  2Q8T A;  3TDQ A;  1CT1 D;  1QJO A;  3KF8 A;  3J7A F;  1PRT F;  1D5Z C;  3TZU A;  4DXG A;  5KNB A;  4BBR B;  3U9S A;  1EYC A;  1G8Z D;  2PW5 A;  2J0T D;  3RD4 A;  4ZUJ A;  4C3H B;  4KMU C;  1PMR A;  1VDZ A;  1QCB D;  1CZW A;  4XDX A;  2D9U A;  3RMH A;  1E2Z A;  1FNV A;  2CW0 C;  2PMZ B;  3HOZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...