1JR0D

Cholera toxin b-pentamer with ligand bmsc-0011
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords cholera toxin B subunit
publication title Anchor-based design of improved cholera toxin and E. coli heat-labile enterotoxin receptor binding antagonists that display multiple binding modes.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 23
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jr0D00
1LTRD 3TSSA 1XTCD 3R2IA 5D3DA 2O2LD 1M4VA 1EWCA 1PRTB 3W2DA 1LT4D 3R2TA 1V1PA 4RH6A 1RDPD 1LTID 3DWQA 4Z9CB 1L0YB 1S5CD 1SEBD 3R8BA 1PTOC 1EEID 4RGNA 1LTAD 2SEBD 2Z8LA 4RGOS 1UUPA 2QEJC 5FK9C 1PRTC 3GP7A 1PTOD 1BCPB 3DWAA 2IJ0A 2ICIA 1V1OA 1JWMD 1CHQD 2AQ1B 1B1ZA 1JQYD 1FNWA 4DXFA 1TY0A 1I4RA 1I4PA 2J4XA 3O13A 1HQRD 1ET9A 1RCVD 3EA6A 3URYA 5ELFA 1TS4A 4RFBA 1F77A 1TY2A 1I4HA 3MC0B 1EU4A 1BCPC 2XRQD 1SJHD 1PTOH 1PTOF 2AQ2B 2RDGA 1D6EC 5ELCA 3V05A 1LO5D 1BXTA 1LLRD 2QILA 1EU3A 3MFGA 3BVGA 4RHRA 1CHPD 1SJED 1CK1A 1BCPD 2XN9C 3DWPA 1HTLD 1I4QA 3CHBD 1PZJD 1FNUA 1LTTD 4L6TB 2R61A 1PRTD 1RD9D 1ESFA 1D5MC 2AQ3B 2IPKD 4TSSA 1KLUD 1S5DD 3BVMA 1SE2A 5ELEA 4O1NA 5TSSA 5ELBA 4C56C 4K6LA 4OHJA 4ZYSA 2XNAC 1AN8A 2NTTA 1ET6A 1V1PB 1TS5A 1FGBD 4RHSA 4RGMA 1BCPF 1G8ZD 1LT6D 1S5ED 3EFXD 1TS3A 1UNSA 2RDHA 1PYWD 4RGTA 1LT5D 5D3IB 1KTKA 1B44D 1KLGD 2TSSA 1PRTF 2G9HD 1HA5A 1PTOB 3KLSX 1AW7A 1SE3A 4DXGA 1JR0D 1I4GA 3BYTB 1ENFA 3BYYB 1FD7D 1JWUD 1T5XD 1D5ZC 1MD2D 2NTSA 4UDUC 4L63B 1CT1D 1DJRD 1S5BD 1I4XA 5I4DA 1FNVA 1L0XB 3BZDB 1LTGD 3BVZA 5ELDA 1DYQA 1EFID 1GOZA 2XRSD 3SEBA 4BWGB 1PZKD 1JCKB 1S5FD 1SE4A 4RCOA 1STEA 5FKAC 1CQVA 1SXTA 1SBBB 1D5XC 3OWEB 1HXYD 1LTBD 1PZID 1QILA 1XXGA 1LTSD 1TS2A 2CHBD 1JWSD 1EEFD 2WV6D 1LT3D 1RF2D
chains in the Genus database with same CATH superfamily
3X3NA 4DV2Q 3IAYA 5C4HA 4IJHA 2TMPA 3CP0A 1GUTA 2R7ZG 4ALPA 2B39A 3DWQA 4KN4C 1XYIA 3R8BA 2ZM6Q 5FO7B 2NN6I 3I7FA 2VUMG 1PRTC 3PQIA 3GO5A 4DNIA 1N8RC 2F0GA 2KQ3A 4GOPB 1Z47A 2F1MA 3AQQA 1U9RA 3I4MH 3Q8DA 2JQOA 3I73A 1U4PA 3S1RH 3S16B 2VW9A 5LMNL 1LM0A 4DV6L 3NBHB 1GM5A 5CR3A 4HIOA 2EYPA 4QB4A 4JI0Q 1AFPA 2ZTEA 4DR1L 1XMOQ 4C3IG 3L0OA 3U50C 2UUBQ 2RKSA 1PHJA 3PO3B 1PVOA 2MO1A 4LFBL 4L6TB 3A8JE 4H02A 1JE5A 1K83B 3OPOA 1IKLA 4K6LA 3PCOB 4X3KA 4A3CH 1GKHA 1FYCA 2NTTA 1NMGA 2F0SA 1VMPA 2PW7A 3H15A 1XX8A 1CFMA 2EY1A 5NUCA 4YY3Q 2HQLA 1L1OC 1SMYD 2C9OA 3BDCA 3GTGB 4A3BG 4K0KL 2A6HD 5EGTA 4CDDC 2VL6A 2PMZE 1SNMA 2OF1A 4IALA 5C0XH 2YYZA 1ASYA 1F2YA 1IXRA 2X6LA 1HFNA 3ZJYC 4OIKA 1MGSA 1D5ZC 2F0DA 4RAUC 2NVQB 3RMHA 3HS0C 2L1BA 2LS01 5KEEA 3I4MB 3U4ZA 1NTGA 1EIFA 4KI0A 1I94Q 3S1RB 1BQQT 4KTAA 4U673 3PUWA 2E8GA 3CF5A 5EPJA 1EUJA 1IYVA 3BZCA 2RHSB 4KV6A 4ME3A 1LTSD 1RTNA 1UEAB 2B29A 1SR3A 5FLMG 2A73B 4X66Q 3F2CA 2ZJQA 4OELB 1Y8NB 2MQHA 2MJ8A 3VR5A 1RDPD 1ENCA 2E75C 1A2UA 2F4VQ 4HCEA 1YNXA 4FYDA 2Y0SB 1SEBD 1WTWA 1E3PA 5M9OA 2K03A 2SEBD 4JOIA 1H9MA 4DR6Q 2JA5H 1FGUA 1C7YA 4HJ9A 3J7AF 2WAQE 2F0UA 3DWAA 4FO2A 3Q22A 2MUYA 3E9HA 3K57A 4LF8Q 1JWMD 4Q5VA 1NE3A 1L1OB 4ZCKA 3PUVA 4BXXG 1KIXA 4LF9Q 2A74C 4DV1L 5KYLA 1PH5A 5IIFA 4X3SA 4RWSC 3P20A 1CKMA 4NP5A 3NPPA 1CTMA 2OCEA 5C4JB 1BBWA 2VY3A 1RODA 4A3KB 1P8LA 2B8GA 4B3SQ 1IZ6A 3Q6SA 1XPUA 2EYMA 2LKVA 2PI2A 2XWBB 1U4LA 2B2TA 3WOEA 1D5MC 4GKKL 4P75A 2SOBA 3G6JB 1XJVA 3JAME 3TZUA 4OHJA 3CPFA 1H9KA 1VQHA 3LX0A 4DV4Q 4AIMA 4S3SA 2F0LA 5CGKA 4JI6Q 3CQZH 5JJLA 4BY7G 3OWFA 3CMEA 3HFZB 4Y7NB 4XT1B 4ABNA 1TWAB 4X64L 4F8MA 4A3GH 4G7ZC 2F0PA 1T9HA 3SK5A 4DXGA 1ESRA 1JR0D 4LK1C 4C1NI 3M7NA 2CKZB 3KF8A 4I65A 3Q24A 1IYJB 1ZYRD 5KNBA 4TVAB 2CW0D 4LF5Q 1DM0B 5LMUL 4FP5D 1SYDA 4NPSA 3MA2B 3J7A5 4HIDA 1TWHH 4ME5A 4FF3A 1VQMA 2UUCL 2BA0A 2MFIA 4MNOA 3DEOA 1B7YB 3CRLC 1EIGA 1TS2A 3HOUG 3HEJA 1RIPA 3SVMA 3TSSA 5I2YA 4YCUA 3HOWG 3D3RA 5EKKA 3S1QB 2SNMA 2EQSA 4DUZQ 1WCMH 3P1HA 4H7BA 2L15A 2A5HA 3NWSA 2NN6H 4O2DA 4DV3L 5CV4A 1QJOA 1ML0D 1TWFH 1EY7A 3K7UC 2B63H 1KDAA 2L55A 5JPNC 2R92G 5AFWA 2LY7A 4C3JH 1PDQA 5BR8L 2JSOA 2ZT9C 1WTRA 4MN3A 1I4RA 3NENA 4P73A 2XGTA 4LF7Q 2NYZD 2RA4A 1U4RA 2BDOA 1GHKA 2PNHA 4CKBA 1J6QA 4CKCA 4ILWA 5I6WA 5EKIA 4GOPA 4B3TL 4QL5A 5EAYA 5LL6X 1TWHB 2A8VA 2NVTH 3NBHA 1JC7A 5J22A 3VYRA 1A3TA 1PFBA 4JI7L 3AB9A 1SRUA 2BE5C 4IO9A 3CD6A 2XSCA 4IFDG 3PGZA 2PNRC 2JP1A 3NQTA 4RHSA 1C0AA 1CZWA 1N36Q 1G8ZD 1CZGA 4EVOA 1WCMB 5C3EH 1YJWA 5K36G 2F0MA 3FKIG 3T1YL 4GKJQ 4X65L 5JJIA 2KENA 2QGQA 1HJPA 1Q1EA 5KNCA 3L3OC 3HOXG 1TWFB 1V8QA 1YNJD 5ISRA 4KY5A 1YNNC 4XYQA 3T4AC 3X3MA 4JYAQ 1Y8PB 3P75A 4POFA 3NTKA 4JI5L 1SXTA 3HP3A 1EY9A 2I46A 4BA2I 1PZID 5C44G 2MNAA 1STAA 1VQ7A 2BOSA 3VR2A 4BY1G 2GVAA 4LF6Q 1IKMA 4A3JH 3KLWA 3SDZA 1Y1WB 1PH9A 1Q46A 4L5SA 3S14H 4HSVA 1MBYA 1WD0A 4NMZA 1L0YB 1K8MA 1PMRA 1DOMA 2F0WA 3FEWX 5CBAE 3TQYA 2K5NA 2EJMA 1RHPA 1O7IA 1PH2A 2ICIA 3HOZB 1DONA 2OQKA 4DK1A 3HKSA 5FOBB 1I6VC 4LNQA 3K0XA 3A8IE 3FHWA 4NB3A 2NVXH 1QOHA 3S9WA 1Q82C 4HEDA 1TWGH 1XMQL 2K75A 3OW7A 3HOVG 3H91A 3VDYA 3EBEA 4LFAQ 3G7LA 2EJFC 4UAIA 5M5XH 1NBWA 1SNDA 2CH4A 3OSOA 2E74C 2CCZA 1O78A 3OTOQ 1I4QA 2UUAQ 1FNUA 4V190 4R4OA 4C3HH 4XYOA 3Q23A 2AQ3B 2IPKD 2NBFA 4BBRG 5CYUA 2N78A 2KA7A 2NWGA 3TREA 4DK6C 2WAQG 4ZYSA 3PIP3 3G48A 2Z6KA 3GQBA 2KHJA 1N32L 1HZ9A 3D0FA 4BS9A 4A3DH 1LT6D 2LXKA 3BDOA 3G71A 3S14B 4NXMQ 2JA6B 2M2LA 1YIJA 2ENBA 4RCNA 4DV2L 1C4QA 3QIAA 4BBSH 3C1EA 1FJGL 4P71A 5JOBA 3BYTB 1VQ5A 4OO1G 1AEXA 1CT1D 2ZM6L 1OXTA 2ZXPA 3GTLH 1X3GA 1A15A 4A93G 3NSWA 3GTQH 3EROA 3SEBA 3K5LA 3RLFA 2F0FA 1A3UA 3QR8A 3IKJA 1STEA 1CQVA 1KNEA 3KJOA 2NVXB 2IX0A 5C4XH 1IBKL 4G7OC 3HKZE 2YTYA 4CGYB 2JA7B 2WKDA 2Z4IA 1DOLA 1JWSD 1H9JA 1LT3D 3LNNA 1LTRD 2UXCL 5J39A 3S2DB 1EIYB 2K5DA 2I5MX 2K32A 2R93G 2G5DA 4R4TA 2B2WA 3V2TA 4DR5Q 2B2UC 4JI0L 3KJPA 2WKCA 1X54A 5FO9B 1ICWA 5DEHA 1LTID 4C3HB 2RHQB 4OX9Q 1OXXK 4K6DA 1PFSA 1EZ6A 1HZBA 4N8FA 4QIWE 4ODGA 4QY7A 1X6OA 1CHQD 2RF4A 4MHEA 4DPGA 2AQ1B 5AJ3Q 1N34L 1E0BA 1TY0A 5G3LD 4DK3C 2WP8J 4RKBA 3L7ZC 4N9PA 4XQJA 2B2YC 4YY3L 3URYA 5ELFA 2KECA 5IGEA 4CJ1B 4PMCA 4IOAA 4C2MH 3I3CA 4PZ8A 4A3FG 1DD2A 3GTPB 2XRQD 3GTLB 5EBDA 3V05A 3K5OA 1CHPD 5EQ0A 3TBIB 1SYGA 4DU9A 2NZOA 2PPBC 2VB2X 5IP7G 1KLUD 3CC4A 4OWXB 1HH2P 1I94L 1EYAA 2JJQA 2Z4HA 1WYDA 3S2HH 2D5DA 3QWNA 2EYJA 5D14A 4DAPA 4JI4Q 1MSHA 4K8IA 3PSIA 1EQRA 1TWCB 3VYTA 5A35A 4F87A 3C3LA 3KLRA 1TQOA 4R9WA 5HGQA 4X66L 2EY2A 4CJ0B 4KKUA 1VQLA 4J15A 4DK0A 4YCVA 1IBML 2IT1A 2K04A 4A3IH 4UDUC 5CV8A 3CW2C 3H0GG 5IGGA 2HT1A 1EQVA 3ULJA 4JG2A 4JBJA 3K81C 3MFYA 5C5LA 3KDFB 4H44C 2UU9L 2CH4W 5FKAC 4LF8L 3F1ZA 2MP1A 4NXNQ 3J80L 3TP6A 1A62A 4C2MB 5IT9c 2GA4B 3I4NH 4A3EH 3HOYG 3EN2A 5A2QE 1EQQA 3K6OA 4WRDA 5DM73 3J7YW 1M4VA 4FXGC 3CCRA 5M3MH 4I7ZC 4LFCQ 2E5LL 5IWAQ 3NTHA 4WJWA 2A19A 1F2ZA 5DM63 2Z9HA 4DUYQ 5BN4A 3J81L 3VR6A 1EIHA 3PO3H 4RGNA 1K8OA 2K4KA 3GP7A 2V1CC 4NKLA 1X56A 1K83H 4DAYA 3PF5A 1Y1VG 4KJNA 5JEAG 2O4XA 4DV4L 3ICEA 2IL8A 1MKHA 5GQOA 5CV9A 4JI6L 1SYEA 1N33L 4KD4A 1WI5A 3EA6A 3GTGH 5JEAJ 3I72A 2E76C 1LYLA 4POGA 5EJWA 4A3IB 1A8VA 1GHJA 1KDBA 5CV7A 2GN5A 1X3FA 1YJNA 3STBD 1JB3A 2XN9C 4KLKA 2RCFA 2NVQH 1MIUA 1OTCA 1GUWA 1SE2A 2HCCA 2MPMA 1B3QA 4O1NA 1VQ9A 1EZ8A 2Q2TA 3IFTA 4RA8A 3I4NB 4A3EB 1NR2A 2V4DA 1Q1BA 1HA6A 3D4WA 1AN8A 1CKOA 2NZ1D 3DLLA 2WACA 1WTVA 5M3MB 3EFXD 1HNZQ 1SNQA 4JV5Q 1P16A 2AMCB 1B44D 1SYBA 5GADC 1IBLL 2R7ZH 1Z9FA 3UDGA 4GN5A 1VQOA 1CI3M 4DUZL 1GVPA 1FD7D 4V0BA 5IYCH 2N88A 2NTSA 2IX3A 4CDFC 1S5BD 1F9RA 3MEHA 1WVLA 5C0XG 1KDCA 1LTGD 5E4WC 4J8QA 1JICA 4L5QA 2PYKA 1A2TA 1GUGA 2A68C 2VXWA 4PV1C 4FVMA 4CDCC 3KFUA 5KIXA 2H4OA 2KCMA 4AYBB 1EEFD 2WV6D 4IPHA 4EQPA 5KYIA 1S40A 4ZKBB 1EYCA 3R2IA 4C3IH 5C4JH 1PRTB 1GO3E 3E3XA 2KHIA 1XNRQ 4A3KH 1V1PA 4WFN3 1YJ9A 3M9BA 3VYUA 4DF7A 2D0PA 1JB7A 4L8JA 1AZPA 3M4YA 2PZUA 2K28A 3I55A 2MHVA 1W2BA 4QCLA 2HUGA 4L5RC 5IYDH 2F0EA 4LUOA 1I6HH 1PLFA 1G2SA 4A76A 4IFDI 1O7LA 2RCNA 2AKWB 3NUCA 2JA5G 2D2CC 2UXDQ 2R7ZB 2Z1CA 4Y7NH 4DAVA 3CCEA 4B3RQ 1RCVD 1VQJA 4CBVA 1TWAH 3HKZG 2R7DA 4ZUIA 1PXUA 2AWOA 5C6AA 3RZOH 4QF4A 1EU4A 2VUMB 1D6EC 4OIJA 1LLRD 1QWYA 4B3ML 2EJGC 3P7JA 1KAAA 3PIO3 1R9TH 3FPPA 4HIMA 2PQAB 4GNXC 4HTHA 2VQFL 1EYGA 4PZ6A 2L12A 3CRKC 2YTVA 5IT9L 1ENAA 1LTTD 4F7XA 1ESFA 3DXJC 4GN3B 2CWPA 3ERQA 3AMUA 3CAMA 4EX5A 5TSSA 4UP9A 4K2KA 3NE5B 4A3LH 5E3FA 4KD3A 4JI2Q 3J80i 4C3IB 2DN8A 2WB1E 4M1UB 1M1KC 1UNSA 2F0OA 5D3IB 1BR9A 4LF6L 2PI2E 1KLGD 4AQYL 1LUZA 1HA5A 3S1QH 5IGFA 4R4IA 3OYYA 4MTKA 1ENFA 2JA8G 4OWWB 4A3GG 2KBNA 1DJRD 3J81i 1I6HB 1Q81C 2B2UA 1DZ1A 1FVIA 1HQMC 1O80A 4WORA 4A3BB 2QF7A 1MHWC 2LFNA 1S5FD 1ICFB 4BXXH 5IE8A 3WDNA 4HJAA 3W1BA 5IYBH 3RZOB 3K58A 2DNEA 2O2LD 4DR4Q 1R9TB 1G2TA 1EL0A 2VB3X 2N49A 2WINB 3MAQA 2B2VA 4GNXB 2HIXA 3KDFA 1EY5A 2L11A 4LF4L 4Z9CB 4ZKCB 4LFAL 3MXNB 1SE8A 1D2BA 1NR4A 1S5CD 4E6IA 1PTOC 3K5MA 4KN7C 1UE5A 2F3WA 4XIGS 2Z8LA 4RGOS 1SN8A 1D8LA 2J7ZA 2KJXA 2BH8A 3CU7A 2IJ0A 2F0KA 3F2DA 2F0NA 1V1QA 4BY7H 3HGBA 1JE4A 4CJ2C 2QKIC 1HNWQ 2XWJB 3GV6A 1I4PA 2NUCA 1SMYC 1X55A 2A6HC 2B63G 4NXML 1HHVA 2E2HB 2OWOA 2AQ2B 4C3JG 5LMNQ 4DV6Q 5ELCA 2QILA 2PZWA 1C48A 4OO1I 3MFGA 3UDIA 4P74A 5EPLA 5G3LF 2K14A 3I70A 3CPWA 2KVMA 4PG3A 5H1SE 1ZXTA 4LJZC 3W5OA 1S5DD 4FF2A 4LFBQ 1JJGA 3NP8A 4JK1C 2BH2A 2JN4A 2D62A 1FR3A 3LGJA 3T51B 1VS0A 1ZKOA 4L5TA 3ULPA 3GTOB 4DR7L 4EQ5A 3HOWH 1K3BC 2HQEA 2K7VA 1H9SB 4RGTA 5E1FA 2JXMB 2UXBL 2G9HD 4K0KQ 1PTOB 4O42A 1Y1WH 2NVYB 1VQKA 1HZCA 5C3EG 4L63B 4OX9L 4PMWA 3PUYA 1VF5C 2N55A 3L2PA 4BY7B 1NCVA 3BVZA 4MIUA 2J0TD 3SE0A 1SYCA 2I5LX 2XRSD 3HOZH 1YHQA 2F3VA 4AH6A 3U58A 1D5XC 1YHAA 4ID6A 2HCIA 4KHPL 4IFDJ 3A0JA 3B6YA 1SFOH 4MTNA 4HJ5A 1IW7C 4JI1Q 1R4PB 1VQAA 1XTCD 3N6RA 1KNAA 5BN3A 2ZJPA 2E2JH 1QZGA 1RTOA 1XTDA 2EY5A 3CCVA 1XNQQ 3HZXA 5J1ZA 3U4VA 4FF1A 1Z7TA 2FMMA 1VQCA 4GZYC 3ZYYX 2WIIB 3VA7A 4A3JG 4YCWA 3TP8A 4WJ3M 1UUPA 1TXYA 3DMUA 1CA5A 3HOUB 1OXVA 1I50H 4LW1A 4CKEA 1AP0A 4IUUA 3HOWB 4YWKA 1HNXL 5K36H 3H3VI 1DGSA 2F0IA 3QOLA 3CCUA 3DUZA 1B4OA 4DV1Q 1KHIA 3ND9A 4EGVA 3GV3A 2JA6H 4RFBA 3J81E 1PV4A 1BCPC 1XPRA 2OT2A 1EOTA 1K9MC 4RG1A 2ID0A 3SK6A 4DV7Q 1EU3A 3LWUA 4IUNA 4K5WA 4X62L 5JAVA 2R92B 1QUQB 2BDNA 4J1MA 2R61A 1ZYRC 2Y0SE 4IUQA 5FLXL 3CXCA 2CW0C 1TKWB 3A74A 3ERSX 3NWTA 1JOQA 3E5SA 4KKSA 3K5NA 5C44H 4IZ8A 5FJ8H 1SFOB 2IX1A 4C1NK 4R8IA 1QB5D 4NXNL 5E7NA 4QUCA 3MWYW 3TS0A 1S4ZA 2NB0A 2E2JB 1CUKA 2PQAA 2JA7H 2L0CA 4DN4M 3J80c 2H5XA 2PZTA 2OXPA 4HMJA 2QW7A 1L1OA 2VS1A 3EQLC 3S2DH 5JVH3 2TSSA 2Q2UA 1U0LA 2K33A 3R93A 3T1HL 4IPCA 4XT3B 3BJUA 4A3DG 4CHTB 1V43A 1I50B 1T5EA 2HDMA 1EY0A 1YEZA 1ZEQX 1YHBA 1KL9A 4DR2L 5CORA 3J81c 4BBSG 1GOZA 2HIVA 1QVGA 1SAPA 1GUOA 4EQOA 1SE4A 4RCOA 1JOKA 3FKIB 1Q90A 4OWTB 4XQNA 1GUNA 1LTBD 1HFGA 1QCBD 1XXGA 4DV5Q 2VQEQ 2CHBD 1BCPB 4YHHQ 2F0VA 2UUCQ 3HOXB 3GTJH 2WB1G 3TZDA 2HHHQ 2PCFB 2EXDA 3GTPH 4HSPA 5C4XG 2K5VA 4A3MG 1QNKA 3CMAA 4HR7B 1X3EA 2D9UA 1KAWA 1ILPA 2B8FA 4BBRH 5C44B 1W3SA 4BY1B 4DV3Q 2K5WA 3K59A 3PO2G 4DFAA 3OIPA 3U9OA 2I0QA 4QQBX 1O7YA 3U9SA 2PMZB 1DOKA 1UE6A 1TWCH 1Y14B 5BR8Q 1LTLA 1XMOL 1NAPA 2UUBL 4OO1H 1LO5D 1QVFA 4EQNA 5M3FG 1BUVT 4QMGA 1WTPA 1SJED 1CK1A 2B2TC 4A93H 5C0XI 1WTHA 5BN5A 1D7QA 4B3TQ 4M8AA 3F8TA 2F0JA 1PRTD 1GJXA 4IPDA 2FXQA 5HY6A 2RSOA 2QDLA 2K5HA 2XNAC 2CQOA 3HOVB 3ONAB 3GTJB 1FGBD 1WD1A 4JI7Q 3I4LA 1E2WA 2C35B 3GTKB 2R93H 2EVBA 1PH6A 2X6GA 4X3TA 1G6PA 2K50A 3MTSA 3LWEA 4IN3A 1AW7A 4ZUJA 4XQQA 4BBRB 2SDFA 4XTCS 4X65Q 5IT9E 1YBYA 3KUPA 4KY6A 4FNFA 3OW2A 2WAQB 5IP9G 1WTXA 4K8JA 5GAEC 3W3AA 2KOLA 3D4DA 5ELDA 1EFID 2M00A 1HTPA 2AHOB 1Q12A 5EKLA 1G91A 4LUVA 4OL7A 1K28A 2A6EC 2L5TA 1TT2A 2A68D 1EY4A 4JI5Q 4TRDA 5KNDA 4TKOB 3M4OB 5KRUA 3KF6B 1X65A 5C3XA 3GDEA 2MO0A 3IRBA 1EWCA 3RZDB 1M90C 2F4VL 4A93B 2KUMA 5KGUA 4ZLTF 4YIJA 3QO2A 2OTJA 4U68A 3C2PA 4DR6L 3T16A 1YITA 3FP9A 4MZ9A 2F3IA 3AU7A 3S1MB 3A7LA 4JBMA 3BU2A 4RKLA 2XIWA 2QEJC 1QVCA 3OOCA 1KRSA 5FK9C 5C5MA 2EYHA 4IQZA 4HAEA 1J8IA 1RJTA 1VQ8A 4LF9L 4G57A 2K05A 3PO3G 2R93B 1JQYD 2SNSA 1B9NA 2A69C 3E6ZX 4GLVB 4DXFA 2AWNA 3H3VC 4N8X1 1JJCB 4JI2L 1HQRD 5COYA 4NW2A 4P72A 2EDGA 2K5QA 1B70B 5IODA 4HN7A 2RDFA 1SROA 2N3SA 1F77A 1EY8A 2D0OA 4B3SL 4LWCA 1X32A 3H6MA 4BA1I 3M7GA 3WWVA 1KC8C 2EOTA 3S17B 4ZRZA 1G291 1RD9D 2JYOA 4OXPA 4TSSA 3OIQA 3EJIA 3OHXC 2HDLA 4CDEC 1N9WA 5LMNW 3UI2A 4A3FB 3HOYH 2JEBI 3BS1A 1OXSC 3I4MG 1S5ED 2RDHA 1QUQA 4DV0Q 2AUJD 1OXUA 1NUCA 3A55A 3A8KE 3AFPA 4JVZA 4O0AA 4KHZA 4HIKA 4GLXA 1CKNB 4FF4A 1FJGQ 4LF5L 2F03A 4IUVA 3NELA 3UE1A 2Z0SA 1S3OA 4P2CB 3KK7A 1Y1VH 5I2XA 5JEAH 4HJ7A 4DR3Q 1Q86C 5IYCG 4APVA 2Y0SG 1STGA 1BF4A 4KMUC 2OQ0A 1Q8IA 2Z6BA 3IL8A 1QILA 1H95A 1I3QB 1HNWL 3M3YH 4OGQC 4A3CG 3FVQA 4QJFA 3FRPB 4UP8A 1QNUA 5K5PA 1IBKQ 3DHQA 3H0GB 1SNPA 2RQXA 1UAPA 1HRJA 1VQ4A 1EWIA 1J5EQ 2VUMH 1LT4D 2UXCQ 4LUZA 3TN2A 3SXHA 1STNA 2KHSA 4DGZA 2RSNA 1HUNA 3J7ZC 5C4ZA 4I7AA 4Q0FA 5C0XJ 1GXDC 4A3KG 1PTOD 3HOYB 1KQSA 1VQNA 1EY6A 1STHA 3M85A 1HR0Q 1TIID 4LF7L 1HCZA 2IWHA 3S24A 4UP7A 1Y69U 2KCTA 5IYDG 1N34Q 2H1EA 3O13A 3I90A 3R3OA 3NQIA 1TS4A 1LACA 1TY2A 3MC0B 1I4HA 3HG9A 5T1IA 2ZXOA 1WTQA 5DNFA 2IY5B 2EYFA 4A4IA 4JBWA 3BVGA 1VQFA 4K5VA 2F4IA 1HTLD 2KEEA 3QG1A 4FXDA 3EIVA 1Y1VB 4Y52H 3JC66 3ER0A 3I91A 4JI8Q 3I56A 4A3BH 2RVLA 3IFDA 3M3YB 2YU9H 5I6YA 2Z6KC 5ELBA 4QGUA 1U4MA 4H13C 1N36L 5GAHC 3MXUA 1K8GA 4GKJL 1B50A 1LT5D 3SR1A 4JI1L 1VMCA 4GN4B 3NTIA 4A3LG 3KLSX 2L9HA 1K8AC 1XNQL 1BNZA 4WJ4A 3RN5A 3KOJA 4JI3Q 1R4QB 5FLXE 1T5XD 3WOFA 5JPMC 4JYAL 1LABA 4OEMB 3W1GA 3C1FA 1A0IA 1IBMQ 5DAUA 5I9OA 5FLMH 1VDZA 3TP7A 2ATWA 3RNUA 4PNYA 2BE5D 4JW0A 2UU9Q 1GD7A 1WOCA 3BZKA 2B2WC 1M8AA 4QUFA 1PH1A 3D8GA 2E2HH 1IW7D 3KBXA 1AE3A 5IYBG 2GVBA 4DV7L 1E2ZA 2R6GA 2L4NA 2E5LQ 1VQIA 3STBC 3MZ5A 3E9IA 2YU9B 1SYFA 1YNND 2EYLA 3Q0AA 2ICEC 3KF6A 5GROA 1D1IA 3A5ZB 2YV5A 1EFWA 5I9PA 2G9DA 3V96A 3PV0A 5FLXc 1B1ZA 4B9WA 1KABA 4G7HC 2A1AA 3CC2A 1NNXA 1SMXA 2EY6A 3GTOH 1D1KA 4PQXA 2K1BA 1II3A 2E2DC 2B2YA 1N33Q 1V9PA 1BBXC 1C9OA 1PH8A 1HZAA 1IL8A 5CV5A 1PTOH 4DKAC 2JA8H 4FXKC 1BXTA 3OTOL 1EOVA 1B53A 2NVYH 2UUAL 1BCPD 2VNUD 1WCMG 1U5KA 5A2QL 1PZJD 2CFMA 3UE0A 2JA5B 3CCSA 2PO4A 1YI2A 2NN6G 1JJ2A 3TS2A 2N8NA 3BVMA 1QG7A 3HKZB 1F2MA 5HGTA 4K14A 2NZHA 3RN2A 3HRZC 4R4QA 2CVRA 3UDFA 3DM3A 2C5CA 3J81j 2K01A 2ZTDA 1PFMA 4DV5L 2VQEL 4KK7A 1KD1C 3DM1A 4YHHL 2QDBA 4PMBA 2CWAA 1PRTF 2HHHL 4DR1Q 3PIPA 1IHZA 1IBLQ 4IUTA 2Q8RE 3JAMc 3PUZA 3MXPA 1YZ6A 4DAMA 1IYUA 5EBCA 2EIFA 4IOCA 1Z6HA 4QIWB 2LXJA 3BZDB 1YVCA 5LL6S 1CQFA 4LAAA 1Y1WG 3HOUH 1JCKB 1VF7A 4DA2A 1X3QA 4IUPA 2ZTCA 1CM9A 3CQZB 3NHHA 1L0WA 1CKNA 1UE1A 2FHTA 5M5WH 5CC4A 2EYOA 1WTOA 2JA8B 3HOZG 4R1JA 4DR5L 5E4XA 4A3GB 2LMCB 5CBEE 2ASBA 3R2TA 4RH6A 3S15H 1BKBA 2M9VA 1VQPA 3D6CA 3AEVA 2R92H 4N9TA 1F2LA 4NDXA 3MXGA 1AZQA 3K0YA 2IHEA 3F2UA 4B08A 1JORA 1A3VA 3CKIB 1BO0A 1SLJA 5AJ3L 1PH7A 2EZVA 3A54A 2R3ZA 3MHBA 4UY8C 4KHVA 1A6XA 4A75A 1B8AA 2QEXA 5J3BA 3J7AV 1OO9B 2FMCA 5ELOA 2AUKA 4K5XA 3SGIA 3CCJA 3SK4A 2JK8A 3E0JA 1E1TA 3A7AB 3CCMA 3AFQA 4AYBE 2RDGA 1GUSA 3G6EA 3K8AA 1EYDA 2DY8A 3NBIA 3RR5A 2WFWA 1VQEA 2HD3A 5ELNA 3DWPA 3GD7A 5L37A 3J80E 3CCQA 4B3MQ 3G4SA 2JA6G 3CHBD 2BCOA 3D6WA 4IFDH 3BG3A 2VQFQ 3SK8A 1XPOA 2B63B 1B2TA 5M5WB 4JI4L 3FKIH 1JOOA 1B3AA 4ZAIA 4RMFA 4C3JB 3CCLA 1RL2A 4RGMA 1WFQA 1DCZA 3S15B 1PYWD 3HOXH 1VQ6A 5IGCA 5FJ8G 3VYSA 1SNCA 2XVSA 5GAGC 5IY0A 1CA6A 1SE3A 2FFKB 2JA7G 4AQYQ 3K7AH 4DAYB 3FPUB 3QOJA 4B9XA 1IL2A 2DJGC 5JVG3 3D31A 1UWVA 2YTXA 4GKKQ 3S1NH 2BA1A 2NVTB 4BY1H 4BWGB 1PZKD 4UPAA 4YWLA 4C3HG 2OEOA 2RBMA 1SBBB 1PFNA 3OWEB 2DNCA 3TDQA 1STYA 2F0HA 2IW3A 4X64Q 4HJ8A 1RF2D 4H0LC 5C3EB 4LFCL 2A6ED 1TVXA 5D3DA 5IWAL 4DNTB 1O7ZA 4G4KA 3QB3A 3VR3A 3FMCA 3W2DA 2LSSA 4DUYL 1K73C 2OTLA 1ILQA 4GS3A 5C3WA 4HMIA 1MI2A 5IGBA 1BOSA 1PYSB 5JJKA 2I5HA 4LF4Q 1JMCA 2VZAA 1QZHA 3GTMH 1LTAD 1W6JA 1Q8KA 1G6ZA 1NJIC 4F88A 2F0QA 5LMUQ 1V1OA 4X3UA 2FJ2A 1RKNA 1AE2A 1MSGA 1F9PA 1NSNS 1MJEA 3HOVH 1PH3A 4ZQ3A 5CMDA 1B9MA 5JJZA 1S72A 3E0EA 4DNRB 3H09A 3JAML 1ET9A 2FINB 3GTKH 2A69D 1JT8A 3K7AB 4DV0L 2E2IH 3RUZA 4A3JB 2ZJRA 4R8NA 4JOIC 3UDXA 2F0TA 1PTOF 1WJJA 2EXZA 5D65A 1XWEA 1HR0W 4JBKA 4JC0A 4RHRA 3S1NB 3EVQA 3C46A 4GLAC 1E7ZA 1F9QA 1VQDA 4GNXA 3I4OA 2K6AA 5FO8B 2O5JC 1KRTA 1FL0A 5ELEA 3MXNA 3F2BA 1SNOA 4KJOA 4DR3L 1Q3LA 1F9SA 4J6HA 1HNZL 5HURA 3SHLA 1V1PB 4JV5L 5M5YH 4ZK9B 3KYHC 1Y8OB 2DJFC 3M4OH 4A3MH 4DR7Q 1TWGB 2B3GA 3RZDH 4KY7A 4OONA 4XXEA 3GTMB 1YNJC 2F52A 1J5EL 1G51A 1UE7A 2K52A 3TRZA 3AYHB 2UXBQ 5M5XB 2QA4A 1JWUD 4PZ7A 1STBA 4X6AH 1PH4A 1E24A 5I4DA 1I4XA 1VCIA 3OMCA 1L0XB 5DLQE 3S1MH 1C8CA 3PO2H 1UEBA 3K80C 3BDLA 1DXMA 3I8ZA 1DYQA 3RD4A 2JA9A 4HCSA 1SDFA 4KKTA 3D4RA 1HR0L 3RLNA 2E2IB 5IGDA 3NK9A 1Q7YC 5F2DA 2KCNA 4A3DB 2ALYB 3H94A 3A56A 4TQUS 1XNRL 2B2VC 1L2FA 4KHPQ 3T1YQ 3MVVA 3PF4A 5M3FH 1TU2B 1K0SA 1E22A 4IJLA 4K2LA 1BDOA 4BBSB 3VR4A 3ITPA 3VA5A 1H9SA 1LV9A 1I5FA 1EEID 5T1GA 5EPKA 3PMFA 1CSPA 1AH9A 3S17H 3ULLA 4A3IG 2Q2IA 3GTQB 4IPGA 4FDBA 3PUXA 3T56B 4JCVE 4JI8L 5M5YB 5CV6A 2UXDL 2O5IC 2PQEA 2P5ZX 2WB1B 3DEPA 1J9OA 3M4QA 3TP5A 3T13A 3MEFA 2ES2A 4B3RL 4A3FH 1W6KA 1FNWA 5C4XB 4A3MB 5LHY1 4JPBW 2QCPX 2J4XA 1SSOA 2XTIA 2Q8IB 2I07B 1HNXQ 1X9NA 3A5UA 1ONLA 1E1OA 2MGSA 3I4NG 4A3EG 1EQTA 1VQGA 1NMFA 1SJHD 4YWMA 3QJYA 1PA6A 2JE6I 5IP9H 1E2VA 1NY4A 5IP7H 3PO2B 3TMEA 5M3MG 4ULLA 2Q2HA 4JI3L 1HUMA 2KCCA 1EWHA 4X62Q 1K3RA 1PYBA 3KBGA 5IOCA 2IHFA 1BBUA 2DGYA 3H3VH 3I2ZA 4C56C 3PIOA 4R4CA 2Q8TA 3KF8B 2DY7A 1HPCA 1ET6A 3NXWA 1H9RA 1TS5A 1K0RA 1I3QH 2CQAA 4UHVA 1QE6A 4GOPC 5M3FB 2R7FA 1BCPF 3OMGA 1TS3A 2PW5A 3TEHB 1ASZA 3H0GH 1XMQQ 1KTKA 3RLOA 2ZXRA 3CC7A 4IURA 2EPBA 1MJCA 3S16H 1I4GA 2KEDA 3KLSA 3L9AX 2DUDA 2X69A 4AYBG 3BYYB 3NEMA 3T1HQ 1MD2D 4LMQD 1BVSA 1FNVA 4XDXA 1A63A 1CSQA 3ND8A 1VQBA 4DR2Q 3S2HB 3FDTA 1TR5A 1HXYD 1N32Q 2EE1A 3N52A 1X3PA 1KXLA 2JEAI 3T53B 4DR4L 3M4PA 3JAMi
chains in the Genus database with same CATH topology
3X3NA 3IAYA 5C4HA 2TMPA 1GUTA 2B39A 3DWQA 4KN4C 1XYIA 3R8BA 5FO7B 2NN6I 1PRTC 3GO5A 2F0GA 2KQ3A 1Z47A 2F1MA 1U9RA 3I73A 1U4PA 3S16B 5CR3A 2EYPA 4QB4A 1AFPA 4C3IG 2RKSA 3PO3B 4L6TB 3A8JE 1K83B 3OPOA 1IKLA 4K6LA 4X3KA 2F0SA 1FYCA 2NTTA 1VMPA 2PW7A 1XX8A 1CFMA 2EY1A 5NUCA 1SMYD 2C9OA 3BDCA 3GTGB 2A6HD 5EGTA 1SNMA 2OF1A 4IALA 5C0XH 2YYZA 1F2YA 1HFNA 2X6LA 4OIKA 1MGSA 1D5ZC 2F0DA 4RAUC 2NVQB 3RMHA 3HS0C 2L1BA 2LS01 5KEEA 3I4MB 4KI0A 3S1RB 1BQQT 4KTAA 4U673 3PUWA 1IYVA 5EPJA 4KV6A 1LTSD 1RTNA 1UEAB 2A73B 1Y8NB 2MJ8A 3VR5A 1RDPD 1ENCA 2E75C 1A2UA 4HCEA 4FYDA 2Y0SB 1SEBD 1WTWA 5M9OA 2K03A 2SEBD 1H9MA 3J7AF 2F0UA 3DWAA 4FO2A 3Q22A 2MUYA 3K57A 1JWMD 4Q5VA 3PUVA 2A74C 5KYLA 5IIFA 4X3SA 4RWSC 3P20A 4NP5A 3NPPA 1CTMA 5C4JB 1RODA 4A3KB 2B8GA 3Q6SA 2EYMA 2LKVA 2XWBB 1U4LA 2B2TA 3WOEA 1D5MC 2SOBA 3G6JB 3JAME 3TZUA 4OHJA 1H9KA 3LX0A 4S3SA 2F0LA 5CGKA 3OWFA 4Y7NB 4XT1B 4ABNA 1TWAB 4F8MA 4G7ZC 2F0PA 3SK5A 4DXGA 1ESRA 1JR0D 4LK1C 4C1NI 3M7NA 3KF8A 4I65A 3Q24A 5KNBA 1ZYRD 2CW0D 1DM0B 4FP5D 1SYDA 3MA2B 4ME5A 4FF3A 2BA0A 3DEOA 3CRLC 1EIGA 1TS2A 3HEJA 3SVMA 3TSSA 5I2YA 3D3RA 5EKKA 3S1QB 2SNMA 3P1HA 4H7BA 2A5HA 3NWSA 2NN6H 5CV4A 1QJOA 1ML0D 1EY7A 1KDAA 2L55A 5JPNC 5AFWA 2LY7A 1PDQA 2JSOA 2ZT9C 1WTRA 4MN3A 1I4RA 2NYZD 2RA4A 1U4RA 2BDOA 1GHKA 4CKBA 4CKCA 5I6WA 4ILWA 5EKIA 5LL6X 1TWHB 3NBHA 1JC7A 5J22A 3VYRA 1A3TA 1PFBA 3AB9A 2BE5C 2XSCA 4IFDG 2PNRC 2JP1A 3NQTA 4RHSA 1CZWA 1G8ZD 1CZGA 4EVOA 1WCMB 5K36G 2F0MA 1Q1EA 5KNCA 3L3OC 1TWFB 1V8QA 1YNJD 5ISRA 4KY5A 1YNNC 4XYQA 3T4AC 3X3MA 1Y8PB 3P75A 3NTKA 1SXTA 3HP3A 1EY9A 2I46A 4BA2I 1PZID 1STAA 2BOSA 3VR2A 1IKMA 3SDZA 1Y1WB 4HSVA 1MBYA 1WD0A 4NMZA 1L0YB 1K8MA 1PMRA 1DOMA 2F0WA 3FEWX 5CBAE 2EJMA 1RHPA 2ICIA 3HOZB 1DONA 4DK1A 5FOBB 1I6VC 3A8IE 1QOHA 3S9WA 4HEDA 3OW7A 3H91A 3G7LA 2EJFC 4UAIA 1SNDA 3OSOA 2E74C 1O78A 1I4QA 1FNUA 4V190 4XYOA 3Q23A 2AQ3B 2IPKD 2NBFA 5CYUA 2KA7A 2NWGA 4ZYSA 3PIP3 3GQBA 4BS9A 1LT6D 3BDOA 3S14B 2JA6B 2M2LA 2ENBA 4RCNA 1C4QA 3QIAA 3C1EA 5JOBA 3BYTB 4OO1G 1AEXA 1CT1D 1OXTA 2ZXPA 1A15A 3NSWA 3EROA 3SEBA 3K5LA 3RLFA 2F0FA 1A3UA 3IKJA 1STEA 1CQVA 1KNEA 2NVXB 2IX0A 4G7OC 4CGYB 2JA7B 2WKDA 2Z4IA 1DOLA 1JWSD 1H9JA 1LT3D 3LNNA 1LTRD 5J39A 3S2DB 2K5DA 2K32A 3V2TA 2B2WA 2B2UC 2WKCA 5FO9B 1ICWA 5DEHA 1LTID 4C3HB 1OXXK 4K6DA 1EZ6A 4ODGA 1CHQD 4MHEA 2AQ1B 1E0BA 1TY0A 5G3LD 2WP8J 4RKBA 3L7ZC 4N9PA 4XQJA 2B2YC 3URYA 5ELFA 2KECA 5IGEA 4CJ1B 4PMCA 3I3CA 1DD2A 3GTPB 2XRQD 3GTLB 5EBDA 3V05A 3K5OA 1CHPD 5EQ0A 3TBIB 1SYGA 4DU9A 2PPBC 2VB2X 1KLUD 1EYAA 2Z4HA 2D5DA 3QWNA 2EYJA 5D14A 4DAPA 1MSHA 4K8IA 3VYTA 1TWCB 5A35A 4F87A 3C3LA 3KLRA 1TQOA 4R9WA 2EY2A 4CJ0B 4KKUA 4DK0A 2IT1A 2K04A 4UDUC 5CV8A 5IGGA 1EQVA 3MFYA 5C5LA 4H44C 5FKAC 2MP1A 3J80L 3TP6A 4C2MB 2GA4B 5A2QE 3K6OA 4WRDA 5DM73 3J7YW 1M4VA 4FXGC 4I7ZC 3NTHA 4WJWA 1F2ZA 5DM63 5BN4A 3J81L 3VR6A 1EIHA 4RGNA 1K8OA 3GP7A 4NKLA 4DAYA 4KJNA 5JEAG 2O4XA 2IL8A 5CV9A 1SYEA 4KD4A 3EA6A 5JEAJ 3I72A 2E76C 5EJWA 4A3IB 1GHJA 1KDBA 5CV7A 1JB3A 2XN9C 1GUWA 1SE2A 2HCCA 2MPMA 4O1NA 1EZ8A 3IFTA 4RA8A 3I4NB 4A3EB 1NR2A 2V4DA 1Q1BA 1HA6A 3D4WA 1AN8A 2NZ1D 2WACA 1WTVA 5M3MB 3EFXD 1SNQA 1B44D 1SYBA 1CI3M 1FD7D 4V0BA 2N88A 2NTSA 2IX3A 1S5BD 1F9RA 3MEHA 1WVLA 5C0XG 1KDCA 1LTGD 5E4WC 4J8QA 1JICA 2PYKA 1A2TA 1GUGA 2A68C 2VXWA 4PV1C 4FVMA 5KIXA 2H4OA 4AYBB 1EEFD 2WV6D 4EQPA 5KYIA 4ZKBB 1EYCA 3R2IA 1PRTB 1V1PA 4WFN3 3VYUA 4DF7A 4L8JA 1AZPA 3M4YA 2PZUA 2K28A 2MHVA 4QCLA 2HUGA 2F0EA 1PLFA 1G2SA 4IFDI 1O7LA 3NUCA 2D2CC 2R7ZB 2Z1CA 4DAVA 1RCVD 4CBVA 4ZUIA 1PXUA 2AWOA 5C6AA 4QF4A 1EU4A 2VUMB 1D6EC 4OIJA 1LLRD 1QWYA 2EJGC 3P7JA 1KAAA 3PIO3 3FPPA 4HTHA 2L12A 3CRKC 5IT9L 1ENAA 1LTTD 4F7XA 1ESFA 3DXJC 3ERQA 3AMUA 5TSSA 4K2KA 3NE5B 5E3FA 4KD3A 4C3IB 2DN8A 4M1UB 1UNSA 2F0OA 5D3IB 1BR9A 1KLGD 1HA5A 5IGFA 1ENFA 1DJRD 1I6HB 2B2UA 1DZ1A 1HQMC 1O80A 4WORA 4A3BB 2QF7A 2LFNA 1S5FD 3WDNA 3RZOB 3K58A 2DNEA 2O2LD 1G2TA 1R9TB 1EL0A 2VB3X 2WINB 3MAQA 2B2VA 1EY5A 2L11A 4Z9CB 4ZKCB 1D2BA 1NR4A 4E6IA 1S5CD 1PTOC 3K5MA 4KN7C 2F3WA 4XIGS 2Z8LA 4RGOS 2J7ZA 2KJXA 3CU7A 2IJ0A 2F0KA 2F0NA 3HGBA 1JE4A 4CJ2C 2QKIC 2XWJB 3GV6A 1I4PA 2NUCA 1SMYC 2A6HC 1HHVA 2E2HB 2AQ2B 4C3JG 5ELCA 2QILA 2PZWA 1C48A 4OO1I 3MFGA 5EPLA 5G3LF 3I70A 2KVMA 1ZXTA 4LJZC 1S5DD 4FF2A 3NP8A 4JK1C 2D62A 1FR3A 3T51B 1ZKOA 3GTOB 2HQEA 2K7VA 1H9SB 4RGTA 5E1FA 2JXMB 2G9HD 1PTOB 4O42A 2NVYB 4L63B 4PMWA 3PUYA 1VF5C 2N55A 4BY7B 1NCVA 3BVZA 4MIUA 2J0TD 3SE0A 1SYCA 2XRSD 2F3VA 1D5XC 4ID6A 2HCIA 4IFDJ 1IW7C 1R4PB 1XTCD 3N6RA 1KNAA 5BN3A 1RTOA 2EY5A 3HZXA 5J1ZA 4FF1A 1Z7TA 2FMMA 4GZYC 3ZYYX 2WIIB 3VA7A 3TP8A 1UUPA 3DMUA 1CA5A 3HOUB 1OXVA 4CKEA 1AP0A 4IUUA 3HOWB 5K36H 2F0IA 3QOLA 3DUZA 1B4OA 3ND9A 4EGVA 3GV3A 4RFBA 3J81E 1BCPC 2OT2A 1EOTA 2ID0A 3SK6A 1EU3A 3LWUA 4IUNA 4K5WA 5JAVA 2R92B 2BDNA 4J1MA 2R61A 1ZYRC 4IUQA 5FLXL 2CW0C 1TKWB 3NWTA 1JOQA 3E5SA 4KKSA 3K5NA 4IZ8A 1SFOB 2IX1A 4C1NK 4R8IA 1QB5D 4QUCA 3MWYW 1S4ZA 2NB0A 2E2JB 2L0CA 4DN4M 2PZTA 2OXPA 4HMJA 3EQLC 5JVH3 2TSSA 2K33A 3R93A 4XT3B 4CHTB 1V43A 1I50B 1T5EA 2HDMA 1EY0A 1ZEQX 5CORA 1GOZA 1SAPA 1GUOA 4EQOA 1SE4A 4RCOA 1JOKA 3FKIB 1Q90A 4XQNA 1GUNA 1LTBD 1HFGA 1QCBD 1XXGA 2CHBD 1BCPB 2F0VA 3HOXB 3TZDA 2PCFB 4HSPA 1QNKA 4HR7B 2D9UA 1ILPA 2B8FA 5C44B 4BY1B 2K5WA 3K59A 4DFAA 3OIPA 3U9OA 1O7YA 3U9SA 2PMZB 1DOKA 1NAPA 4OO1H 1LO5D 4EQNA 1BUVT 4QMGA 1WTPA 1SJED 1CK1A 2B2TC 5C0XI 5BN5A 4M8AA 2F0JA 1PRTD 1GJXA 2RSOA 2XNAC 3HOVB 3ONAB 3GTJB 1FGBD 1WD1A 3I4LA 1E2WA 3GTKB 2EVBA 2X6GA 4X3TA 3MTSA 4IN3A 3LWEA 1AW7A 4ZUJA 4XQQA 4BBRB 2SDFA 4XTCS 5IT9E 3KUPA 4KY6A 4FNFA 2WAQB 1WTXA 4K8JA 3W3AA 2KOLA 3D4DA 5ELDA 1EFID 2M00A 1HTPA 1Q12A 5EKLA 1G91A 4OL7A 2A6EC 2L5TA 1TT2A 2A68D 1EY4A 4TRDA 5KNDA 4TKOB 3M4OB 5KRUA 5C3XA 1EWCA 3RZDB 4A93B 2KUMA 5KGUA 4ZLTF 4YIJA 3QO2A 4U68A 3C2PA 3T16A 3AU7A 3S1MB 3A7LA 4RKLA 2XIWA 2QEJC 3OOCA 5FK9C 5C5MA 2EYHA 4IQZA 4HAEA 1J8IA 1RJTA 4G57A 2K05A 2R93B 1JQYD 2SNSA 1B9NA 2A69C 3E6ZX 4DXFA 3H3VC 2AWNA 1HQRD 5COYA 4NW2A 2EDGA 2K5QA 5IODA 4HN7A 2RDFA 1F77A 1EY8A 1X32A 3H6MA 4BA1I 3M7GA 2EOTA 3S17B 4ZRZA 1G291 1RD9D 2JYOA 4TSSA 3OIQA 3EJIA 3OHXC 2HDLA 3UI2A 4A3FB 2JEBI 3BS1A 1OXSC 1S5ED 2RDHA 2AUJD 1OXUA 1NUCA 3A55A 3A8KE 4KHZA 4FF4A 2F03A 4IUVA 4P2CB 3KK7A 5I2XA 5JEAH 1STGA 1BF4A 4KMUC 1Q8IA 3IL8A 1QILA 1I3QB 4OGQC 3FVQA 3FRPB 1QNUA 5K5PA 3DHQA 3H0GB 1SNPA 2RQXA 1UAPA 1HRJA 1LT4D 3TN2A 3SXHA 1STNA 2KHSA 4DGZA 2RSNA 1HUNA 5C4ZA 4Q0FA 5C0XJ 1GXDC 1PTOD 3HOYB 1EY6A 1STHA 3M85A 1TIID 1HCZA 2IWHA 1Y69U 2H1EA 3O13A 3I90A 3R3OA 3NQIA 1TS4A 1LACA 1TY2A 3MC0B 1I4HA 3HG9A 5T1IA 2ZXOA 1WTQA 5DNFA 2EYFA 4JBWA 3BVGA 4K5VA 2F4IA 1HTLD 2KEEA 3QG1A 4FXDA 1Y1VB 3I91A 2RVLA 3IFDA 3M3YB 5I6YA 5ELBA 1U4MA 4H13C 3MXUA 1B50A 1LT5D 3SR1A 1VMCA 3NTIA 3KLSX 2L9HA 1BNZA 1R4QB 5FLXE 1T5XD 3WOFA 5JPMC 1LABA 3C1FA 5DAUA 5I9OA 1VDZA 3TP7A 4PNYA 2BE5D 2B2WC 1M8AA 4QUFA 3D8GA 1IW7D 3KBXA 1E2ZA 2R6GA 2L4NA 3MZ5A 2YU9B 1SYFA 1YNND 2EYLA 3Q0AA 2ICEC 1D1IA 5I9PA 2G9DA 3V96A 3PV0A 1B1ZA 4B9WA 1KABA 4G7HC 2EY6A 1D1KA 4PQXA 2K1BA 1II3A 2E2DC 2B2YA 1BBXC 1IL8A 5CV5A 1PTOH 4FXKC 1BXTA 1B53A 1BCPD 2VNUD 5A2QL 1PZJD 2JA5B 2PO4A 2NN6G 3BVMA 1QG7A 3HKZB 1F2MA 5HGTA 4K14A 3HRZC 2CVRA 2C5CA 2K01A 1PFMA 4KK7A 3DM1A 2QDBA 4PMBA 1PRTF 1IHZA 4IUTA 2Q8RE 3PUZA 3MXPA 1IYUA 5EBCA 1Z6HA 4QIWB 3BZDB 5LL6S 1CQFA 4LAAA 1JCKB 1VF7A 4DA2A 1X3QA 4IUPA 1CM9A 3CQZB 3NHHA 2FHTA 5CC4A 2EYOA 1WTOA 2JA8B 5E4XA 4A3GB 2LMCB 5CBEE 3R2TA 4RH6A 2M9VA 3D6CA 4N9TA 1F2LA 4NDXA 3MXGA 1AZQA 3K0YA 4B08A 3F2UA 1JORA 1A3VA 3CKIB 1BO0A 2EZVA 3A54A 2R3ZA 3MHBA 4KHVA 1A6XA 3J7AV 1OO9B 2FMCA 2AUKA 4K5XA 3SK4A 3E0JA 3A7AB 2RDGA 1GUSA 1EYDA 2DY8A 3NBIA 3DWPA 3GD7A 3J80E 3CHBD 2BCOA 3D6WA 4IFDH 3BG3A 3SK8A 2B63B 1B2TA 5M5WB 1JOOA 1B3AA 4ZAIA 4C3JB 4RGMA 1DCZA 3S15B 1PYWD 5IGCA 3VYSA 1SNCA 2XVSA 1CA6A 1SE3A 2FFKB 3FPUB 3QOJA 4B9XA 5JVG3 3D31A 2BA1A 2NVTB 4BWGB 1PZKD 4C3HG 2OEOA 2RBMA 1SBBB 1PFNA 3OWEB 2DNCA 3TDQA 1STYA 2F0HA 2IW3A 1RF2D 4H0LC 5C3EB 2A6ED 1TVXA 5D3DA 4DNTB 1O7ZA 4G4KA 3QB3A 3VR3A 3FMCA 3W2DA 1ILQA 5C3WA 4HMIA 1MI2A 5IGBA 1BOSA 1LTAD 1W6JA 1G6ZA 4F88A 2F0QA 1V1OA 4X3UA 2FJ2A 1RKNA 1MSGA 1F9PA 1NSNS 4ZQ3A 5CMDA 1B9MA 5JJZA 4DNRB 3H09A 3JAML 1ET9A 2FINB 2A69D 3K7AB 3RUZA 4A3JB 4R8NA 2F0TA 1PTOF 2EXZA 5D65A 1XWEA 4RHRA 3S1NB 3EVQA 3C46A 1F9QA 2K6AA 5FO8B 2O5JC 5ELEA 3MXNA 1SNOA 4KJOA 1Q3LA 1F9SA 4J6HA 5HURA 3SHLA 1V1PB 4ZK9B 1Y8OB 1TWGB 4KY7A 4XXEA 3GTMB 1YNJC 5M5XB 1JWUD 1STBA 5I4DA 1I4XA 1VCIA 3OMCA 1L0XB 1C8CA 3BDLA 1DXMA 3I8ZA 1DYQA 3RD4A 4HCSA 1SDFA 4KKTA 3D4RA 2E2IB 5IGDA 3NK9A 5F2DA 2KCNA 4A3DB 3H94A 3A56A 4TQUS 2B2VC 3MVVA 1TU2B 4BBSB 4K2LA 1BDOA 3VR4A 3ITPA 3VA5A 1H9SA 1LV9A 1EEID 5T1GA 5EPKA 3PMFA 3GTQB 3PUXA 3T56B 5M5YB 5CV6A 2O5IC 2PQEA 2WB1B 3DEPA 1J9OA 3TP5A 3T13A 1W6KA 1FNWA 5C4XB 4A3MB 5LHY1 2QCPX 2J4XA 1SSOA 2Q8IB 2I07B 1ONLA 2MGSA 1EQTA 1SJHD 3QJYA 2JE6I 1E2VA 3PO2B 3TMEA 4ULLA 1HUMA 2KCCA 1EWHA 3KBGA 5IOCA 4C56C 2Q8TA 2DY7A 1HPCA 1ET6A 3NXWA 1H9RA 1TS5A 2CQAA 1QE6A 5M3FB 1BCPF 3OMGA 1TS3A 2PW5A 1KTKA 2ZXRA 4IURA 2EPBA 1I4GA 2KEDA 3KLSA 3L9AX 2X69A 3BYYB 1MD2D 4LMQD 1FNVA 4XDXA 3ND8A 3S2HB 3FDTA 1TR5A 1HXYD 2EE1A 3N52A 1X3PA 2JEAI 3T53B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTR D;  3TSS A;  1XTC D;  3R2I A;  5D3D A;  2O2L D;  1M4V A;  1EWC A;  1PRT B;  3W2D A;  1LT4 D;  3R2T A;  1V1P A;  4RH6 A;  1RDP D;  1LTI D;  3DWQ A;  4Z9C B;  1L0Y B;  1S5C D;  1SEB D;  3R8B A;  1PTO C;  1EEI D;  4RGN A;  1LTA D;  2SEB D;  2Z8L A;  4RGO S;  1UUP A;  2QEJ C;  5FK9 C;  1PRT C;  3GP7 A;  1PTO D;  1BCP B;  3DWA A;  2IJ0 A;  2ICI A;  1V1O A;  1JWM D;  1CHQ D;  2AQ1 B;  1B1Z A;  1JQY D;  1FNW A;  4DXF A;  1TY0 A;  1I4R A;  1I4P A;  2J4X A;  3O13 A;  1HQR D;  1ET9 A;  1RCV D;  3EA6 A;  3URY A;  5ELF A;  1TS4 A;  4RFB A;  1F77 A;  1TY2 A;  1I4H A;  3MC0 B;  1EU4 A;  1BCP C;  2XRQ D;  1SJH D;  1PTO H;  1PTO F;  2AQ2 B;  2RDG A;  1D6E C;  5ELC A;  3V05 A;  1LO5 D;  1BXT A;  1LLR D;  2QIL A;  1EU3 A;  3MFG A;  3BVG A;  4RHR A;  1CHP D;  1SJE D;  1CK1 A;  1BCP D;  2XN9 C;  3DWP A;  1HTL D;  1I4Q A;  3CHB D;  1PZJ D;  1FNU A;  1LTT D;  4L6T B;  2R61 A;  1PRT D;  1RD9 D;  1ESF A;  1D5M C;  2AQ3 B;  2IPK D;  4TSS A;  1KLU D;  1S5D D;  3BVM A;  1SE2 A;  5ELE A;  4O1N A;  5TSS A;  5ELB A;  4C56 C;  4K6L A;  4OHJ A;  4ZYS A;  2XNA C;  1AN8 A;  2NTT A;  1ET6 A;  1V1P B;  1TS5 A;  1FGB D;  4RHS A;  4RGM A;  1BCP F;  1G8Z D;  1LT6 D;  1S5E D;  3EFX D;  1TS3 A;  1UNS A;  2RDH A;  1PYW D;  4RGT A;  1LT5 D;  5D3I B;  1KTK A;  1B44 D;  1KLG D;  2TSS A;  1PRT F;  2G9H D;  1HA5 A;  1PTO B;  3KLS X;  1AW7 A;  1SE3 A;  4DXG A;  1JR0 D;  1I4G A;  3BYT B;  1ENF A;  3BYY B;  1FD7 D;  1JWU D;  1T5X D;  1D5Z C;  1MD2 D;  2NTS A;  4UDU C;  4L63 B;  1CT1 D;  1DJR D;  1S5B D;  1I4X A;  5I4D A;  1FNV A;  1L0X B;  3BZD B;  1LTG D;  3BVZ A;  5ELD A;  1DYQ A;  1EFI D;  1GOZ A;  2XRS D;  3SEB A;  4BWG B;  1PZK D;  1JCK B;  1S5F D;  1SE4 A;  4RCO A;  1STE A;  5FKA C;  1CQV A;  1SXT A;  1SBB B;  1D5X C;  3OWE B;  1HXY D;  1LTB D;  1PZI D;  1QIL A;  1XXG A;  1LTS D;  1TS2 A;  2CHB D;  1JWS D;  1EEF D;  2WV6 D;  1LT3 D;  1RF2 D; 
#chains in the Genus database with same CATH topology
 3X3N A;  4DV2 Q;  3IAY A;  5C4H A;  4IJH A;  2TMP A;  3CP0 A;  1GUT A;  2R7Z G;  4ALP A;  2B39 A;  3DWQ A;  4KN4 C;  1XYI A;  3R8B A;  2ZM6 Q;  5FO7 B;  2NN6 I;  3I7F A;  2VUM G;  1PRT C;  3PQI A;  3GO5 A;  4DNI A;  1N8R C;  2F0G A;  2KQ3 A;  4GOP B;  1Z47 A;  2F1M A;  3AQQ A;  1U9R A;  3I4M H;  3Q8D A;  2JQO A;  3I73 A;  1U4P A;  3S1R H;  3S16 B;  2VW9 A;  5LMN L;  1LM0 A;  4DV6 L;  3NBH B;  1GM5 A;  5CR3 A;  4HIO A;  2EYP A;  4QB4 A;  4JI0 Q;  1AFP A;  2ZTE A;  4DR1 L;  1XMO Q;  4C3I G;  3L0O A;  3U50 C;  2UUB Q;  2RKS A;  1PHJ A;  3PO3 B;  1PVO A;  2MO1 A;  4LFB L;  4L6T B;  3A8J E;  4H02 A;  1JE5 A;  1K83 B;  3OPO A;  1IKL A;  4K6L A;  3PCO B;  4X3K A;  4A3C H;  1GKH A;  1FYC A;  2NTT A;  1NMG A;  2F0S A;  1VMP A;  2PW7 A;  3H15 A;  1XX8 A;  1CFM A;  2EY1 A;  5NUC A;  4YY3 Q;  2HQL A;  1L1O C;  1SMY D;  2C9O A;  3BDC A;  3GTG B;  4A3B G;  4K0K L;  2A6H D;  5EGT A;  4CDD C;  2VL6 A;  2PMZ E;  1SNM A;  2OF1 A;  4IAL A;  5C0X H;  2YYZ A;  1ASY A;  1F2Y A;  1IXR A;  2X6L A;  1HFN A;  3ZJY C;  4OIK A;  1MGS A;  1D5Z C;  2F0D A;  4RAU C;  2NVQ B;  3RMH A;  3HS0 C;  2L1B A;  2LS0 1;  5KEE A;  3I4M B;  3U4Z A;  1NTG A;  1EIF A;  4KI0 A;  1I94 Q;  3S1R B;  1BQQ T;  4KTA A;  4U67 3;  3PUW A;  2E8G A;  3CF5 A;  5EPJ A;  1EUJ A;  1IYV A;  3BZC A;  2RHS B;  4KV6 A;  4ME3 A;  1LTS D;  1RTN A;  1UEA B;  2B29 A;  1SR3 A;  5FLM G;  2A73 B;  4X66 Q;  3F2C A;  2ZJQ A;  4OEL B;  1Y8N B;  2MQH A;  2MJ8 A;  3VR5 A;  1RDP D;  1ENC A;  2E75 C;  1A2U A;  2F4V Q;  4HCE A;  1YNX A;  4FYD A;  2Y0S B;  1SEB D;  1WTW A;  1E3P A;  5M9O A;  2K03 A;  2SEB D;  4JOI A;  1H9M A;  4DR6 Q;  2JA5 H;  1FGU A;  1C7Y A;  4HJ9 A;  3J7A F;  2WAQ E;  2F0U A;  3DWA A;  4FO2 A;  3Q22 A;  2MUY A;  3E9H A;  3K57 A;  4LF8 Q;  1JWM D;  4Q5V A;  1NE3 A;  1L1O B;  4ZCK A;  3PUV A;  4BXX G;  1KIX A;  4LF9 Q;  2A74 C;  4DV1 L;  5KYL A;  1PH5 A;  5IIF A;  4X3S A;  4RWS C;  3P20 A;  1CKM A;  4NP5 A;  3NPP A;  1CTM A;  2OCE A;  5C4J B;  1BBW A;  2VY3 A;  1ROD A;  4A3K B;  1P8L A;  2B8G A;  4B3S Q;  1IZ6 A;  3Q6S A;  1XPU A;  2EYM A;  2LKV A;  2PI2 A;  2XWB B;  1U4L A;  2B2T A;  3WOE A;  1D5M C;  4GKK L;  4P75 A;  2SOB A;  3G6J B;  1XJV A;  3JAM E;  3TZU A;  4OHJ A;  3CPF A;  1H9K A;  1VQH A;  3LX0 A;  4DV4 Q;  4AIM A;  4S3S A;  2F0L A;  5CGK A;  4JI6 Q;  3CQZ H;  5JJL A;  4BY7 G;  3OWF A;  3CME A;  3HFZ B;  4Y7N B;  4XT1 B;  4ABN A;  1TWA B;  4X64 L;  4F8M A;  4A3G H;  4G7Z C;  2F0P A;  1T9H A;  3SK5 A;  4DXG A;  1ESR A;  1JR0 D;  4LK1 C;  4C1N I;  3M7N A;  2CKZ B;  3KF8 A;  4I65 A;  3Q24 A;  1IYJ B;  1ZYR D;  5KNB A;  4TVA B;  2CW0 D;  4LF5 Q;  1DM0 B;  5LMU L;  4FP5 D;  1SYD A;  4NPS A;  3MA2 B;  3J7A 5;  4HID A;  1TWH H;  4ME5 A;  4FF3 A;  1VQM A;  2UUC L;  2BA0 A;  2MFI A;  4MNO A;  3DEO A;  1B7Y B;  3CRL C;  1EIG A;  1TS2 A;  3HOU G;  3HEJ A;  1RIP A;  3SVM A;  3TSS A;  5I2Y A;  4YCU A;  3HOW G;  3D3R A;  5EKK A;  3S1Q B;  2SNM A;  2EQS A;  4DUZ Q;  1WCM H;  3P1H A;  4H7B A;  2L15 A;  2A5H A;  3NWS A;  2NN6 H;  4O2D A;  4DV3 L;  5CV4 A;  1QJO A;  1ML0 D;  1TWF H;  1EY7 A;  3K7U C;  2B63 H;  1KDA A;  2L55 A;  5JPN C;  2R92 G;  5AFW A;  2LY7 A;  4C3J H;  1PDQ A;  5BR8 L;  2JSO A;  2ZT9 C;  1WTR A;  4MN3 A;  1I4R A;  3NEN A;  4P73 A;  2XGT A;  4LF7 Q;  2NYZ D;  2RA4 A;  1U4R A;  2BDO A;  1GHK A;  2PNH A;  4CKB A;  1J6Q A;  4CKC A;  4ILW A;  5I6W A;  5EKI A;  4GOP A;  4B3T L;  4QL5 A;  5EAY A;  5LL6 X;  1TWH B;  2A8V A;  2NVT H;  3NBH A;  1JC7 A;  5J22 A;  3VYR A;  1A3T A;  1PFB A;  4JI7 L;  3AB9 A;  1SRU A;  2BE5 C;  4IO9 A;  3CD6 A;  2XSC A;  4IFD G;  3PGZ A;  2PNR C;  2JP1 A;  3NQT A;  4RHS A;  1C0A A;  1CZW A;  1N36 Q;  1G8Z D;  1CZG A;  4EVO A;  1WCM B;  5C3E H;  1YJW A;  5K36 G;  2F0M A;  3FKI G;  3T1Y L;  4GKJ Q;  4X65 L;  5JJI A;  2KEN A;  2QGQ A;  1HJP A;  1Q1E A;  5KNC A;  3L3O C;  3HOX G;  1TWF B;  1V8Q A;  1YNJ D;  5ISR A;  4KY5 A;  1YNN C;  4XYQ A;  3T4A C;  3X3M A;  4JYA Q;  1Y8P B;  3P75 A;  4POF A;  3NTK A;  4JI5 L;  1SXT A;  3HP3 A;  1EY9 A;  2I46 A;  4BA2 I;  1PZI D;  5C44 G;  2MNA A;  1STA A;  1VQ7 A;  2BOS A;  3VR2 A;  4BY1 G;  2GVA A;  4LF6 Q;  1IKM A;  4A3J H;  3KLW A;  3SDZ A;  1Y1W B;  1PH9 A;  1Q46 A;  4L5S A;  3S14 H;  4HSV A;  1MBY A;  1WD0 A;  4NMZ A;  1L0Y B;  1K8M A;  1PMR A;  1DOM A;  2F0W A;  3FEW X;  5CBA E;  3TQY A;  2K5N A;  2EJM A;  1RHP A;  1O7I A;  1PH2 A;  2ICI A;  3HOZ B;  1DON A;  2OQK A;  4DK1 A;  3HKS A;  5FOB B;  1I6V C;  4LNQ A;  3K0X A;  3A8I E;  3FHW A;  4NB3 A;  2NVX H;  1QOH A;  3S9W A;  1Q82 C;  4HED A;  1TWG H;  1XMQ L;  2K75 A;  3OW7 A;  3HOV G;  3H91 A;  3VDY A;  3EBE A;  4LFA Q;  3G7L A;  2EJF C;  4UAI A;  5M5X H;  1NBW A;  1SND A;  2CH4 A;  3OSO A;  2E74 C;  2CCZ A;  1O78 A;  3OTO Q;  1I4Q A;  2UUA Q;  1FNU A;  4V19 0;  4R4O A;  4C3H H;  4XYO A;  3Q23 A;  2AQ3 B;  2IPK D;  2NBF A;  4BBR G;  5CYU A;  2N78 A;  2KA7 A;  2NWG A;  3TRE A;  4DK6 C;  2WAQ G;  4ZYS A;  3PIP 3;  3G48 A;  2Z6K A;  3GQB A;  2KHJ A;  1N32 L;  1HZ9 A;  3D0F A;  4BS9 A;  4A3D H;  1LT6 D;  2LXK A;  3BDO A;  3G71 A;  3S14 B;  4NXM Q;  2JA6 B;  2M2L A;  1YIJ A;  2ENB A;  4RCN A;  4DV2 L;  1C4Q A;  3QIA A;  4BBS H;  3C1E A;  1FJG L;  4P71 A;  5JOB A;  3BYT B;  1VQ5 A;  4OO1 G;  1AEX A;  1CT1 D;  2ZM6 L;  1OXT A;  2ZXP A;  3GTL H;  1X3G A;  1A15 A;  4A93 G;  3NSW A;  3GTQ H;  3ERO A;  3SEB A;  3K5L A;  3RLF A;  2F0F A;  1A3U A;  3QR8 A;  3IKJ A;  1STE A;  1CQV A;  1KNE A;  3KJO A;  2NVX B;  2IX0 A;  5C4X H;  1IBK L;  4G7O C;  3HKZ E;  2YTY A;  4CGY B;  2JA7 B;  2WKD A;  2Z4I A;  1DOL A;  1JWS D;  1H9J A;  1LT3 D;  3LNN A;  1LTR D;  2UXC L;  5J39 A;  3S2D B;  1EIY B;  2K5D A;  2I5M X;  2K32 A;  2R93 G;  2G5D A;  4R4T A;  2B2W A;  3V2T A;  4DR5 Q;  2B2U C;  4JI0 L;  3KJP A;  2WKC A;  1X54 A;  5FO9 B;  1ICW A;  5DEH A;  1LTI D;  4C3H B;  2RHQ B;  4OX9 Q;  1OXX K;  4K6D A;  1PFS A;  1EZ6 A;  1HZB A;  4N8F A;  4QIW E;  4ODG A;  4QY7 A;  1X6O A;  1CHQ D;  2RF4 A;  4MHE A;  4DPG A;  2AQ1 B;  5AJ3 Q;  1N34 L;  1E0B A;  1TY0 A;  5G3L D;  4DK3 C;  2WP8 J;  4RKB A;  3L7Z C;  4N9P A;  4XQJ A;  2B2Y C;  4YY3 L;  3URY A;  5ELF A;  2KEC A;  5IGE A;  4CJ1 B;  4PMC A;  4IOA A;  4C2M H;  3I3C A;  4PZ8 A;  4A3F G;  1DD2 A;  3GTP B;  2XRQ D;  3GTL B;  5EBD A;  3V05 A;  3K5O A;  1CHP D;  5EQ0 A;  3TBI B;  1SYG A;  4DU9 A;  2NZO A;  2PPB C;  2VB2 X;  5IP7 G;  1KLU D;  3CC4 A;  4OWX B;  1HH2 P;  1I94 L;  1EYA A;  2JJQ A;  2Z4H A;  1WYD A;  3S2H H;  2D5D A;  3QWN A;  2EYJ A;  5D14 A;  4DAP A;  4JI4 Q;  1MSH A;  4K8I A;  3PSI A;  1EQR A;  1TWC B;  3VYT A;  5A35 A;  4F87 A;  3C3L A;  3KLR A;  1TQO A;  4R9W A;  5HGQ A;  4X66 L;  2EY2 A;  4CJ0 B;  4KKU A;  1VQL A;  4J15 A;  4DK0 A;  4YCV A;  1IBM L;  2IT1 A;  2K04 A;  4A3I H;  4UDU C;  5CV8 A;  3CW2 C;  3H0G G;  5IGG A;  2HT1 A;  1EQV A;  3ULJ A;  4JG2 A;  4JBJ A;  3K81 C;  3MFY A;  5C5L A;  3KDF B;  4H44 C;  2UU9 L;  2CH4 W;  5FKA C;  4LF8 L;  3F1Z A;  2MP1 A;  4NXN Q;  3J80 L;  3TP6 A;  1A62 A;  4C2M B;  5IT9 c;  2GA4 B;  3I4N H;  4A3E H;  3HOY G;  3EN2 A;  5A2Q E;  1EQQ A;  3K6O A;  4WRD A;  5DM7 3;  3J7Y W;  1M4V A;  4FXG C;  3CCR A;  5M3M H;  4I7Z C;  4LFC Q;  2E5L L;  5IWA Q;  3NTH A;  4WJW A;  2A19 A;  1F2Z A;  5DM6 3;  2Z9H A;  4DUY Q;  5BN4 A;  3J81 L;  3VR6 A;  1EIH A;  3PO3 H;  4RGN A;  1K8O A;  2K4K A;  3GP7 A;  2V1C C;  4NKL A;  1X56 A;  1K83 H;  4DAY A;  3PF5 A;  1Y1V G;  4KJN A;  5JEA G;  2O4X A;  4DV4 L;  3ICE A;  2IL8 A;  1MKH A;  5GQO A;  5CV9 A;  4JI6 L;  1SYE A;  1N33 L;  4KD4 A;  1WI5 A;  3EA6 A;  3GTG H;  5JEA J;  3I72 A;  2E76 C;  1LYL A;  4POG A;  5EJW A;  4A3I B;  1A8V A;  1GHJ A;  1KDB A;  5CV7 A;  2GN5 A;  1X3F A;  1YJN A;  3STB D;  1JB3 A;  2XN9 C;  4KLK A;  2RCF A;  2NVQ H;  1MIU A;  1OTC A;  1GUW A;  1SE2 A;  2HCC A;  2MPM A;  1B3Q A;  4O1N A;  1VQ9 A;  1EZ8 A;  2Q2T A;  3IFT A;  4RA8 A;  3I4N B;  4A3E B;  1NR2 A;  2V4D A;  1Q1B A;  1HA6 A;  3D4W A;  1AN8 A;  1CKO A;  2NZ1 D;  3DLL A;  2WAC A;  1WTV A;  5M3M B;  3EFX D;  1HNZ Q;  1SNQ A;  4JV5 Q;  1P16 A;  2AMC B;  1B44 D;  1SYB A;  5GAD C;  1IBL L;  2R7Z H;  1Z9F A;  3UDG A;  4GN5 A;  1VQO A;  1CI3 M;  4DUZ L;  1GVP A;  1FD7 D;  4V0B A;  5IYC H;  2N88 A;  2NTS A;  2IX3 A;  4CDF C;  1S5B D;  1F9R A;  3MEH A;  1WVL A;  5C0X G;  1KDC A;  1LTG D;  5E4W C;  4J8Q A;  1JIC A;  4L5Q A;  2PYK A;  1A2T A;  1GUG A;  2A68 C;  2VXW A;  4PV1 C;  4FVM A;  4CDC C;  3KFU A;  5KIX A;  2H4O A;  2KCM A;  4AYB B;  1EEF D;  2WV6 D;  4IPH A;  4EQP A;  5KYI A;  1S40 A;  4ZKB B;  1EYC A;  3R2I A;  4C3I H;  5C4J H;  1PRT B;  1GO3 E;  3E3X A;  2KHI A;  1XNR Q;  4A3K H;  1V1P A;  4WFN 3;  1YJ9 A;  3M9B A;  3VYU A;  4DF7 A;  2D0P A;  1JB7 A;  4L8J A;  1AZP A;  3M4Y A;  2PZU A;  2K28 A;  3I55 A;  2MHV A;  1W2B A;  4QCL A;  2HUG A;  4L5R C;  5IYD H;  2F0E A;  4LUO A;  1I6H H;  1PLF A;  1G2S A;  4A76 A;  4IFD I;  1O7L A;  2RCN A;  2AKW B;  3NUC A;  2JA5 G;  2D2C C;  2UXD Q;  2R7Z B;  2Z1C A;  4Y7N H;  4DAV A;  3CCE A;  4B3R Q;  1RCV D;  1VQJ A;  4CBV A;  1TWA H;  3HKZ G;  2R7D A;  4ZUI A;  1PXU A;  2AWO A;  5C6A A;  3RZO H;  4QF4 A;  1EU4 A;  2VUM B;  1D6E C;  4OIJ A;  1LLR D;  1QWY A;  4B3M L;  2EJG C;  3P7J A;  1KAA A;  3PIO 3;  1R9T H;  3FPP A;  4HIM A;  2PQA B;  4GNX C;  4HTH A;  2VQF L;  1EYG A;  4PZ6 A;  2L12 A;  3CRK C;  2YTV A;  5IT9 L;  1ENA A;  1LTT D;  4F7X A;  1ESF A;  3DXJ C;  4GN3 B;  2CWP A;  3ERQ A;  3AMU A;  3CAM A;  4EX5 A;  5TSS A;  4UP9 A;  4K2K A;  3NE5 B;  4A3L H;  5E3F A;  4KD3 A;  4JI2 Q;  3J80 i;  4C3I B;  2DN8 A;  2WB1 E;  4M1U B;  1M1K C;  1UNS A;  2F0O A;  5D3I B;  1BR9 A;  4LF6 L;  2PI2 E;  1KLG D;  4AQY L;  1LUZ A;  1HA5 A;  3S1Q H;  5IGF A;  4R4I A;  3OYY A;  4MTK A;  1ENF A;  2JA8 G;  4OWW B;  4A3G G;  2KBN A;  1DJR D;  3J81 i;  1I6H B;  1Q81 C;  2B2U A;  1DZ1 A;  1FVI A;  1HQM C;  1O80 A;  4WOR A;  4A3B B;  2QF7 A;  1MHW C;  2LFN A;  1S5F D;  1ICF B;  4BXX H;  5IE8 A;  3WDN A;  4HJA A;  3W1B A;  5IYB H;  3RZO B;  3K58 A;  2DNE A;  2O2L D;  4DR4 Q;  1R9T B;  1G2T A;  1EL0 A;  2VB3 X;  2N49 A;  2WIN B;  3MAQ A;  2B2V A;  4GNX B;  2HIX A;  3KDF A;  1EY5 A;  2L11 A;  4LF4 L;  4Z9C B;  4ZKC B;  4LFA L;  3MXN B;  1SE8 A;  1D2B A;  1NR4 A;  1S5C D;  4E6I A;  1PTO C;  3K5M A;  4KN7 C;  1UE5 A;  2F3W A;  4XIG S;  2Z8L A;  4RGO S;  1SN8 A;  1D8L A;  2J7Z A;  2KJX A;  2BH8 A;  3CU7 A;  2IJ0 A;  2F0K A;  3F2D A;  2F0N A;  1V1Q A;  4BY7 H;  3HGB A;  1JE4 A;  4CJ2 C;  2QKI C;  1HNW Q;  2XWJ B;  3GV6 A;  1I4P A;  2NUC A;  1SMY C;  1X55 A;  2A6H C;  2B63 G;  4NXM L;  1HHV A;  2E2H B;  2OWO A;  2AQ2 B;  4C3J G;  5LMN Q;  4DV6 Q;  5ELC A;  2QIL A;  2PZW A;  1C48 A;  4OO1 I;  3MFG A;  3UDI A;  4P74 A;  5EPL A;  5G3L F;  2K14 A;  3I70 A;  3CPW A;  2KVM A;  4PG3 A;  5H1S E;  1ZXT A;  4LJZ C;  3W5O A;  1S5D D;  4FF2 A;  4LFB Q;  1JJG A;  3NP8 A;  4JK1 C;  2BH2 A;  2JN4 A;  2D62 A;  1FR3 A;  3LGJ A;  3T51 B;  1VS0 A;  1ZKO A;  4L5T A;  3ULP A;  3GTO B;  4DR7 L;  4EQ5 A;  3HOW H;  1K3B C;  2HQE A;  2K7V A;  1H9S B;  4RGT A;  5E1F A;  2JXM B;  2UXB L;  2G9H D;  4K0K Q;  1PTO B;  4O42 A;  1Y1W H;  2NVY B;  1VQK A;  1HZC A;  5C3E G;  4L63 B;  4OX9 L;  4PMW A;  3PUY A;  1VF5 C;  2N55 A;  3L2P A;  4BY7 B;  1NCV A;  3BVZ A;  4MIU A;  2J0T D;  3SE0 A;  1SYC A;  2I5L X;  2XRS D;  3HOZ H;  1YHQ A;  2F3V A;  4AH6 A;  3U58 A;  1D5X C;  1YHA A;  4ID6 A;  2HCI A;  4KHP L;  4IFD J;  3A0J A;  3B6Y A;  1SFO H;  4MTN A;  4HJ5 A;  1IW7 C;  4JI1 Q;  1R4P B;  1VQA A;  1XTC D;  3N6R A;  1KNA A;  5BN3 A;  2ZJP A;  2E2J H;  1QZG A;  1RTO A;  1XTD A;  2EY5 A;  3CCV A;  1XNQ Q;  3HZX A;  5J1Z A;  3U4V A;  4FF1 A;  1Z7T A;  2FMM A;  1VQC A;  4GZY C;  3ZYY X;  2WII B;  3VA7 A;  4A3J G;  4YCW A;  3TP8 A;  4WJ3 M;  1UUP A;  1TXY A;  3DMU A;  1CA5 A;  3HOU B;  1OXV A;  1I50 H;  4LW1 A;  4CKE A;  1AP0 A;  4IUU A;  3HOW B;  4YWK A;  1HNX L;  5K36 H;  3H3V I;  1DGS A;  2F0I A;  3QOL A;  3CCU A;  3DUZ A;  1B4O A;  4DV1 Q;  1KHI A;  3ND9 A;  4EGV A;  3GV3 A;  2JA6 H;  4RFB A;  3J81 E;  1PV4 A;  1BCP C;  1XPR A;  2OT2 A;  1EOT A;  1K9M C;  4RG1 A;  2ID0 A;  3SK6 A;  4DV7 Q;  1EU3 A;  3LWU A;  4IUN A;  4K5W A;  4X62 L;  5JAV A;  2R92 B;  1QUQ B;  2BDN A;  4J1M A;  2R61 A;  1ZYR C;  2Y0S E;  4IUQ A;  5FLX L;  3CXC A;  2CW0 C;  1TKW B;  3A74 A;  3ERS X;  3NWT A;  1JOQ A;  3E5S A;  4KKS A;  3K5N A;  5C44 H;  4IZ8 A;  5FJ8 H;  1SFO B;  2IX1 A;  4C1N K;  4R8I A;  1QB5 D;  4NXN L;  5E7N A;  4QUC A;  3MWY W;  3TS0 A;  1S4Z A;  2NB0 A;  2E2J B;  1CUK A;  2PQA A;  2JA7 H;  2L0C A;  4DN4 M;  3J80 c;  2H5X A;  2PZT A;  2OXP A;  4HMJ A;  2QW7 A;  1L1O A;  2VS1 A;  3EQL C;  3S2D H;  5JVH 3;  2TSS A;  2Q2U A;  1U0L A;  2K33 A;  3R93 A;  3T1H L;  4IPC A;  4XT3 B;  3BJU A;  4A3D G;  4CHT B;  1V43 A;  1I50 B;  1T5E A;  2HDM A;  1EY0 A;  1YEZ A;  1ZEQ X;  1YHB A;  1KL9 A;  4DR2 L;  5COR A;  3J81 c;  4BBS G;  1GOZ A;  2HIV A;  1QVG A;  1SAP A;  1GUO A;  4EQO A;  1SE4 A;  4RCO A;  1JOK A;  3FKI B;  1Q90 A;  4OWT B;  4XQN A;  1GUN A;  1LTB D;  1HFG A;  1QCB D;  1XXG A;  4DV5 Q;  2VQE Q;  2CHB D;  1BCP B;  4YHH Q;  2F0V A;  2UUC Q;  3HOX B;  3GTJ H;  2WB1 G;  3TZD A;  2HHH Q;  2PCF B;  2EXD A;  3GTP H;  4HSP A;  5C4X G;  2K5V A;  4A3M G;  1QNK A;  3CMA A;  4HR7 B;  1X3E A;  2D9U A;  1KAW A;  1ILP A;  2B8F A;  4BBR H;  5C44 B;  1W3S A;  4BY1 B;  4DV3 Q;  2K5W A;  3K59 A;  3PO2 G;  4DFA A;  3OIP A;  3U9O A;  2I0Q A;  4QQB X;  1O7Y A;  3U9S A;  2PMZ B;  1DOK A;  1UE6 A;  1TWC H;  1Y14 B;  5BR8 Q;  1LTL A;  1XMO L;  1NAP A;  2UUB L;  4OO1 H;  1LO5 D;  1QVF A;  4EQN A;  5M3F G;  1BUV T;  4QMG A;  1WTP A;  1SJE D;  1CK1 A;  2B2T C;  4A93 H;  5C0X I;  1WTH A;  5BN5 A;  1D7Q A;  4B3T Q;  4M8A A;  3F8T A;  2F0J A;  1PRT D;  1GJX A;  4IPD A;  2FXQ A;  5HY6 A;  2RSO A;  2QDL A;  2K5H A;  2XNA C;  2CQO A;  3HOV B;  3ONA B;  3GTJ B;  1FGB D;  1WD1 A;  4JI7 Q;  3I4L A;  1E2W A;  2C35 B;  3GTK B;  2R93 H;  2EVB A;  1PH6 A;  2X6G A;  4X3T A;  1G6P A;  2K50 A;  3MTS A;  3LWE A;  4IN3 A;  1AW7 A;  4ZUJ A;  4XQQ A;  4BBR B;  2SDF A;  4XTC S;  4X65 Q;  5IT9 E;  1YBY A;  3KUP A;  4KY6 A;  4FNF A;  3OW2 A;  2WAQ B;  5IP9 G;  1WTX A;  4K8J A;  5GAE C;  3W3A A;  2KOL A;  3D4D A;  5ELD A;  1EFI D;  2M00 A;  1HTP A;  2AHO B;  1Q12 A;  5EKL A;  1G91 A;  4LUV A;  4OL7 A;  1K28 A;  2A6E C;  2L5T A;  1TT2 A;  2A68 D;  1EY4 A;  4JI5 Q;  4TRD A;  5KND A;  4TKO B;  3M4O B;  5KRU A;  3KF6 B;  1X65 A;  5C3X A;  3GDE A;  2MO0 A;  3IRB A;  1EWC A;  3RZD B;  1M90 C;  2F4V L;  4A93 B;  2KUM A;  5KGU A;  4ZLT F;  4YIJ A;  3QO2 A;  2OTJ A;  4U68 A;  3C2P A;  4DR6 L;  3T16 A;  1YIT A;  3FP9 A;  4MZ9 A;  2F3I A;  3AU7 A;  3S1M B;  3A7L A;  4JBM A;  3BU2 A;  4RKL A;  2XIW A;  2QEJ C;  1QVC A;  3OOC A;  1KRS A;  5FK9 C;  5C5M A;  2EYH A;  4IQZ A;  4HAE A;  1J8I A;  1RJT A;  1VQ8 A;  4LF9 L;  4G57 A;  2K05 A;  3PO3 G;  2R93 B;  1JQY D;  2SNS A;  1B9N A;  2A69 C;  3E6Z X;  4GLV B;  4DXF A;  2AWN A;  3H3V C;  4N8X 1;  1JJC B;  4JI2 L;  1HQR D;  5COY A;  4NW2 A;  4P72 A;  2EDG A;  2K5Q A;  1B70 B;  5IOD A;  4HN7 A;  2RDF A;  1SRO A;  2N3S A;  1F77 A;  1EY8 A;  2D0O A;  4B3S L;  4LWC A;  1X32 A;  3H6M A;  4BA1 I;  3M7G A;  3WWV A;  1KC8 C;  2EOT A;  3S17 B;  4ZRZ A;  1G29 1;  1RD9 D;  2JYO A;  4OXP A;  4TSS A;  3OIQ A;  3EJI A;  3OHX C;  2HDL A;  4CDE C;  1N9W A;  5LMN W;  3UI2 A;  4A3F B;  3HOY H;  2JEB I;  3BS1 A;  1OXS C;  3I4M G;  1S5E D;  2RDH A;  1QUQ A;  4DV0 Q;  2AUJ D;  1OXU A;  1NUC A;  3A55 A;  3A8K E;  3AFP A;  4JVZ A;  4O0A A;  4KHZ A;  4HIK A;  4GLX A;  1CKN B;  4FF4 A;  1FJG Q;  4LF5 L;  2F03 A;  4IUV A;  3NEL A;  3UE1 A;  2Z0S A;  1S3O A;  4P2C B;  3KK7 A;  1Y1V H;  5I2X A;  5JEA H;  4HJ7 A;  4DR3 Q;  1Q86 C;  5IYC G;  4APV A;  2Y0S G;  1STG A;  1BF4 A;  4KMU C;  2OQ0 A;  1Q8I A;  2Z6B A;  3IL8 A;  1QIL A;  1H95 A;  1I3Q B;  1HNW L;  3M3Y H;  4OGQ C;  4A3C G;  3FVQ A;  4QJF A;  3FRP B;  4UP8 A;  1QNU A;  5K5P A;  1IBK Q;  3DHQ A;  3H0G B;  1SNP A;  2RQX A;  1UAP A;  1HRJ A;  1VQ4 A;  1EWI A;  1J5E Q;  2VUM H;  1LT4 D;  2UXC Q;  4LUZ A;  3TN2 A;  3SXH A;  1STN A;  2KHS A;  4DGZ A;  2RSN A;  1HUN A;  3J7Z C;  5C4Z A;  4I7A A;  4Q0F A;  5C0X J;  1GXD C;  4A3K G;  1PTO D;  3HOY B;  1KQS A;  1VQN A;  1EY6 A;  1STH A;  3M85 A;  1HR0 Q;  1TII D;  4LF7 L;  1HCZ A;  2IWH A;  3S24 A;  4UP7 A;  1Y69 U;  2KCT A;  5IYD G;  1N34 Q;  2H1E A;  3O13 A;  3I90 A;  3R3O A;  3NQI A;  1TS4 A;  1LAC A;  1TY2 A;  3MC0 B;  1I4H A;  3HG9 A;  5T1I A;  2ZXO A;  1WTQ A;  5DNF A;  2IY5 B;  2EYF A;  4A4I A;  4JBW A;  3BVG A;  1VQF A;  4K5V A;  2F4I A;  1HTL D;  2KEE A;  3QG1 A;  4FXD A;  3EIV A;  1Y1V B;  4Y52 H;  3JC6 6;  3ER0 A;  3I91 A;  4JI8 Q;  3I56 A;  4A3B H;  2RVL A;  3IFD A;  3M3Y B;  2YU9 H;  5I6Y A;  2Z6K C;  5ELB A;  4QGU A;  1U4M A;  4H13 C;  1N36 L;  5GAH C;  3MXU A;  1K8G A;  4GKJ L;  1B50 A;  1LT5 D;  3SR1 A;  4JI1 L;  1VMC A;  4GN4 B;  3NTI A;  4A3L G;  3KLS X;  2L9H A;  1K8A C;  1XNQ L;  1BNZ A;  4WJ4 A;  3RN5 A;  3KOJ A;  4JI3 Q;  1R4Q B;  5FLX E;  1T5X D;  3WOF A;  5JPM C;  4JYA L;  1LAB A;  4OEM B;  3W1G A;  3C1F A;  1A0I A;  1IBM Q;  5DAU A;  5I9O A;  5FLM H;  1VDZ A;  3TP7 A;  2ATW A;  3RNU A;  4PNY A;  2BE5 D;  4JW0 A;  2UU9 Q;  1GD7 A;  1WOC A;  3BZK A;  2B2W C;  1M8A A;  4QUF A;  1PH1 A;  3D8G A;  2E2H H;  1IW7 D;  3KBX A;  1AE3 A;  5IYB G;  2GVB A;  4DV7 L;  1E2Z A;  2R6G A;  2L4N A;  2E5L Q;  1VQI A;  3STB C;  3MZ5 A;  3E9I A;  2YU9 B;  1SYF A;  1YNN D;  2EYL A;  3Q0A A;  2ICE C;  3KF6 A;  5GRO A;  1D1I A;  3A5Z B;  2YV5 A;  1EFW A;  5I9P A;  2G9D A;  3V96 A;  3PV0 A;  5FLX c;  1B1Z A;  4B9W A;  1KAB A;  4G7H C;  2A1A A;  3CC2 A;  1NNX A;  1SMX A;  2EY6 A;  3GTO H;  1D1K A;  4PQX A;  2K1B A;  1II3 A;  2E2D C;  2B2Y A;  1N33 Q;  1V9P A;  1BBX C;  1C9O A;  1PH8 A;  1HZA A;  1IL8 A;  5CV5 A;  1PTO H;  4DKA C;  2JA8 H;  4FXK C;  1BXT A;  3OTO L;  1EOV A;  1B53 A;  2NVY H;  2UUA L;  1BCP D;  2VNU D;  1WCM G;  1U5K A;  5A2Q L;  1PZJ D;  2CFM A;  3UE0 A;  2JA5 B;  3CCS A;  2PO4 A;  1YI2 A;  2NN6 G;  1JJ2 A;  3TS2 A;  2N8N A;  3BVM A;  1QG7 A;  3HKZ B;  1F2M A;  5HGT A;  4K14 A;  2NZH A;  3RN2 A;  3HRZ C;  4R4Q A;  2CVR A;  3UDF A;  3DM3 A;  2C5C A;  3J81 j;  2K01 A;  2ZTD A;  1PFM A;  4DV5 L;  2VQE L;  4KK7 A;  1KD1 C;  3DM1 A;  4YHH L;  2QDB A;  4PMB A;  2CWA A;  1PRT F;  2HHH L;  4DR1 Q;  3PIP A;  1IHZ A;  1IBL Q;  4IUT A;  2Q8R E;  3JAM c;  3PUZ A;  3MXP A;  1YZ6 A;  4DAM A;  1IYU A;  5EBC A;  2EIF A;  4IOC A;  1Z6H A;  4QIW B;  2LXJ A;  3BZD B;  1YVC A;  5LL6 S;  1CQF A;  4LAA A;  1Y1W G;  3HOU H;  1JCK B;  1VF7 A;  4DA2 A;  1X3Q A;  4IUP A;  2ZTC A;  1CM9 A;  3CQZ B;  3NHH A;  1L0W A;  1CKN A;  1UE1 A;  2FHT A;  5M5W H;  5CC4 A;  2EYO A;  1WTO A;  2JA8 B;  3HOZ G;  4R1J A;  4DR5 L;  5E4X A;  4A3G B;  2LMC B;  5CBE E;  2ASB A;  3R2T A;  4RH6 A;  3S15 H;  1BKB A;  2M9V A;  1VQP A;  3D6C A;  3AEV A;  2R92 H;  4N9T A;  1F2L A;  4NDX A;  3MXG A;  1AZQ A;  3K0Y A;  2IHE A;  3F2U A;  4B08 A;  1JOR A;  1A3V A;  3CKI B;  1BO0 A;  1SLJ A;  5AJ3 L;  1PH7 A;  2EZV A;  3A54 A;  2R3Z A;  3MHB A;  4UY8 C;  4KHV A;  1A6X A;  4A75 A;  1B8A A;  2QEX A;  5J3B A;  3J7A V;  1OO9 B;  2FMC A;  5ELO A;  2AUK A;  4K5X A;  3SGI A;  3CCJ A;  3SK4 A;  2JK8 A;  3E0J A;  1E1T A;  3A7A B;  3CCM A;  3AFQ A;  4AYB E;  2RDG A;  1GUS A;  3G6E A;  3K8A A;  1EYD A;  2DY8 A;  3NBI A;  3RR5 A;  2WFW A;  1VQE A;  2HD3 A;  5ELN A;  3DWP A;  3GD7 A;  5L37 A;  3J80 E;  3CCQ A;  4B3M Q;  3G4S A;  2JA6 G;  3CHB D;  2BCO A;  3D6W A;  4IFD H;  3BG3 A;  2VQF Q;  3SK8 A;  1XPO A;  2B63 B;  1B2T A;  5M5W B;  4JI4 L;  3FKI H;  1JOO A;  1B3A A;  4ZAI A;  4RMF A;  4C3J B;  3CCL A;  1RL2 A;  4RGM A;  1WFQ A;  1DCZ A;  3S15 B;  1PYW D;  3HOX H;  1VQ6 A;  5IGC A;  5FJ8 G;  3VYS A;  1SNC A;  2XVS A;  5GAG C;  5IY0 A;  1CA6 A;  1SE3 A;  2FFK B;  2JA7 G;  4AQY Q;  3K7A H;  4DAY B;  3FPU B;  3QOJ A;  4B9X A;  1IL2 A;  2DJG C;  5JVG 3;  3D31 A;  1UWV A;  2YTX A;  4GKK Q;  3S1N H;  2BA1 A;  2NVT B;  4BY1 H;  4BWG B;  1PZK D;  4UPA A;  4YWL A;  4C3H G;  2OEO A;  2RBM A;  1SBB B;  1PFN A;  3OWE B;  2DNC A;  3TDQ A;  1STY A;  2F0H A;  2IW3 A;  4X64 Q;  4HJ8 A;  1RF2 D;  4H0L C;  5C3E B;  4LFC L;  2A6E D;  1TVX A;  5D3D A;  5IWA L;  4DNT B;  1O7Z A;  4G4K A;  3QB3 A;  3VR3 A;  3FMC A;  3W2D A;  2LSS A;  4DUY L;  1K73 C;  2OTL A;  1ILQ A;  4GS3 A;  5C3W A;  4HMI A;  1MI2 A;  5IGB A;  1BOS A;  1PYS B;  5JJK A;  2I5H A;  4LF4 Q;  1JMC A;  2VZA A;  1QZH A;  3GTM H;  1LTA D;  1W6J A;  1Q8K A;  1G6Z A;  1NJI C;  4F88 A;  2F0Q A;  5LMU Q;  1V1O A;  4X3U A;  2FJ2 A;  1RKN A;  1AE2 A;  1MSG A;  1F9P A;  1NSN S;  1MJE A;  3HOV H;  1PH3 A;  4ZQ3 A;  5CMD A;  1B9M A;  5JJZ A;  1S72 A;  3E0E A;  4DNR B;  3H09 A;  3JAM L;  1ET9 A;  2FIN B;  3GTK H;  2A69 D;  1JT8 A;  3K7A B;  4DV0 L;  2E2I H;  3RUZ A;  4A3J B;  2ZJR A;  4R8N A;  4JOI C;  3UDX A;  2F0T A;  1PTO F;  1WJJ A;  2EXZ A;  5D65 A;  1XWE A;  1HR0 W;  4JBK A;  4JC0 A;  4RHR A;  3S1N B;  3EVQ A;  3C46 A;  4GLA C;  1E7Z A;  1F9Q A;  1VQD A;  4GNX A;  3I4O A;  2K6A A;  5FO8 B;  2O5J C;  1KRT A;  1FL0 A;  5ELE A;  3MXN A;  3F2B A;  1SNO A;  4KJO A;  4DR3 L;  1Q3L A;  1F9S A;  4J6H A;  1HNZ L;  5HUR A;  3SHL A;  1V1P B;  4JV5 L;  5M5Y H;  4ZK9 B;  3KYH C;  1Y8O B;  2DJF C;  3M4O H;  4A3M H;  4DR7 Q;  1TWG B;  2B3G A;  3RZD H;  4KY7 A;  4OON A;  4XXE A;  3GTM B;  1YNJ C;  2F52 A;  1J5E L;  1G51 A;  1UE7 A;  2K52 A;  3TRZ A;  3AYH B;  2UXB Q;  5M5X B;  2QA4 A;  1JWU D;  4PZ7 A;  1STB A;  4X6A H;  1PH4 A;  1E24 A;  5I4D A;  1I4X A;  1VCI A;  3OMC A;  1L0X B;  5DLQ E;  3S1M H;  1C8C A;  3PO2 H;  1UEB A;  3K80 C;  3BDL A;  1DXM A;  3I8Z A;  1DYQ A;  3RD4 A;  2JA9 A;  4HCS A;  1SDF A;  4KKT A;  3D4R A;  1HR0 L;  3RLN A;  2E2I B;  5IGD A;  3NK9 A;  1Q7Y C;  5F2D A;  2KCN A;  4A3D B;  2ALY B;  3H94 A;  3A56 A;  4TQU S;  1XNR L;  2B2V C;  1L2F A;  4KHP Q;  3T1Y Q;  3MVV A;  3PF4 A;  5M3F H;  1TU2 B;  1K0S A;  1E22 A;  4IJL A;  4K2L A;  1BDO A;  4BBS B;  3VR4 A;  3ITP A;  3VA5 A;  1H9S A;  1LV9 A;  1I5F A;  1EEI D;  5T1G A;  5EPK A;  3PMF A;  1CSP A;  1AH9 A;  3S17 H;  3ULL A;  4A3I G;  2Q2I A;  3GTQ B;  4IPG A;  4FDB A;  3PUX A;  3T56 B;  4JCV E;  4JI8 L;  5M5Y B;  5CV6 A;  2UXD L;  2O5I C;  2PQE A;  2P5Z X;  2WB1 B;  3DEP A;  1J9O A;  3M4Q A;  3TP5 A;  3T13 A;  3MEF A;  2ES2 A;  4B3R L;  4A3F H;  1W6K A;  1FNW A;  5C4X B;  4A3M B;  5LHY 1;  4JPB W;  2QCP X;  2J4X A;  1SSO A;  2XTI A;  2Q8I B;  2I07 B;  1HNX Q;  1X9N A;  3A5U A;  1ONL A;  1E1O A;  2MGS A;  3I4N G;  4A3E G;  1EQT A;  1VQG A;  1NMF A;  1SJH D;  4YWM A;  3QJY A;  1PA6 A;  2JE6 I;  5IP9 H;  1E2V A;  1NY4 A;  5IP7 H;  3PO2 B;  3TME A;  5M3M G;  4ULL A;  2Q2H A;  4JI3 L;  1HUM A;  2KCC A;  1EWH A;  4X62 Q;  1K3R A;  1PYB A;  3KBG A;  5IOC A;  2IHF A;  1BBU A;  2DGY A;  3H3V H;  3I2Z A;  4C56 C;  3PIO A;  4R4C A;  2Q8T A;  3KF8 B;  2DY7 A;  1HPC A;  1ET6 A;  3NXW A;  1H9R A;  1TS5 A;  1K0R A;  1I3Q H;  2CQA A;  4UHV A;  1QE6 A;  4GOP C;  5M3F B;  2R7F A;  1BCP F;  3OMG A;  1TS3 A;  2PW5 A;  3TEH B;  1ASZ A;  3H0G H;  1XMQ Q;  1KTK A;  3RLO A;  2ZXR A;  3CC7 A;  4IUR A;  2EPB A;  1MJC A;  3S16 H;  1I4G A;  2KED A;  3KLS A;  3L9A X;  2DUD A;  2X69 A;  4AYB G;  3BYY B;  3NEM A;  3T1H Q;  1MD2 D;  4LMQ D;  1BVS A;  1FNV A;  4XDX A;  1A63 A;  1CSQ A;  3ND8 A;  1VQB A;  4DR2 Q;  3S2H B;  3FDT A;  1TR5 A;  1HXY D;  1N32 Q;  2EE1 A;  3N52 A;  1X3P A;  1KXL A;  2JEA I;  3T53 B;  4DR4 L;  3M4P A;  3JAM i; 
#chains in the Genus database with same CATH homology
 3X3N A;  3IAY A;  5C4H A;  2TMP A;  1GUT A;  2B39 A;  3DWQ A;  4KN4 C;  1XYI A;  3R8B A;  5FO7 B;  2NN6 I;  1PRT C;  3GO5 A;  2F0G A;  2KQ3 A;  1Z47 A;  2F1M A;  1U9R A;  3I73 A;  1U4P A;  3S16 B;  5CR3 A;  2EYP A;  4QB4 A;  1AFP A;  4C3I G;  2RKS A;  3PO3 B;  4L6T B;  3A8J E;  1K83 B;  3OPO A;  1IKL A;  4K6L A;  4X3K A;  2F0S A;  1FYC A;  2NTT A;  1VMP A;  2PW7 A;  1XX8 A;  1CFM A;  2EY1 A;  5NUC A;  1SMY D;  2C9O A;  3BDC A;  3GTG B;  2A6H D;  5EGT A;  1SNM A;  2OF1 A;  4IAL A;  5C0X H;  2YYZ A;  1F2Y A;  1HFN A;  2X6L A;  4OIK A;  1MGS A;  1D5Z C;  2F0D A;  4RAU C;  2NVQ B;  3RMH A;  3HS0 C;  2L1B A;  2LS0 1;  5KEE A;  3I4M B;  4KI0 A;  3S1R B;  1BQQ T;  4KTA A;  4U67 3;  3PUW A;  1IYV A;  5EPJ A;  4KV6 A;  1LTS D;  1RTN A;  1UEA B;  2A73 B;  1Y8N B;  2MJ8 A;  3VR5 A;  1RDP D;  1ENC A;  2E75 C;  1A2U A;  4HCE A;  4FYD A;  2Y0S B;  1SEB D;  1WTW A;  5M9O A;  2K03 A;  2SEB D;  1H9M A;  3J7A F;  2F0U A;  3DWA A;  4FO2 A;  3Q22 A;  2MUY A;  3K57 A;  1JWM D;  4Q5V A;  3PUV A;  2A74 C;  5KYL A;  5IIF A;  4X3S A;  4RWS C;  3P20 A;  4NP5 A;  3NPP A;  1CTM A;  5C4J B;  1ROD A;  4A3K B;  2B8G A;  3Q6S A;  2EYM A;  2LKV A;  2XWB B;  1U4L A;  2B2T A;  3WOE A;  1D5M C;  2SOB A;  3G6J B;  3JAM E;  3TZU A;  4OHJ A;  1H9K A;  3LX0 A;  4S3S A;  2F0L A;  5CGK A;  3OWF A;  4Y7N B;  4XT1 B;  4ABN A;  1TWA B;  4F8M A;  4G7Z C;  2F0P A;  3SK5 A;  4DXG A;  1ESR A;  1JR0 D;  4LK1 C;  4C1N I;  3M7N A;  3KF8 A;  4I65 A;  3Q24 A;  5KNB A;  1ZYR D;  2CW0 D;  1DM0 B;  4FP5 D;  1SYD A;  3MA2 B;  4ME5 A;  4FF3 A;  2BA0 A;  3DEO A;  3CRL C;  1EIG A;  1TS2 A;  3HEJ A;  3SVM A;  3TSS A;  5I2Y A;  3D3R A;  5EKK A;  3S1Q B;  2SNM A;  3P1H A;  4H7B A;  2A5H A;  3NWS A;  2NN6 H;  5CV4 A;  1QJO A;  1ML0 D;  1EY7 A;  1KDA A;  2L55 A;  5JPN C;  5AFW A;  2LY7 A;  1PDQ A;  2JSO A;  2ZT9 C;  1WTR A;  4MN3 A;  1I4R A;  2NYZ D;  2RA4 A;  1U4R A;  2BDO A;  1GHK A;  4CKB A;  4CKC A;  5I6W A;  4ILW A;  5EKI A;  5LL6 X;  1TWH B;  3NBH A;  1JC7 A;  5J22 A;  3VYR A;  1A3T A;  1PFB A;  3AB9 A;  2BE5 C;  2XSC A;  4IFD G;  2PNR C;  2JP1 A;  3NQT A;  4RHS A;  1CZW A;  1G8Z D;  1CZG A;  4EVO A;  1WCM B;  5K36 G;  2F0M A;  1Q1E A;  5KNC A;  3L3O C;  1TWF B;  1V8Q A;  1YNJ D;  5ISR A;  4KY5 A;  1YNN C;  4XYQ A;  3T4A C;  3X3M A;  1Y8P B;  3P75 A;  3NTK A;  1SXT A;  3HP3 A;  1EY9 A;  2I46 A;  4BA2 I;  1PZI D;  1STA A;  2BOS A;  3VR2 A;  1IKM A;  3SDZ A;  1Y1W B;  4HSV A;  1MBY A;  1WD0 A;  4NMZ A;  1L0Y B;  1K8M A;  1PMR A;  1DOM A;  2F0W A;  3FEW X;  5CBA E;  2EJM A;  1RHP A;  2ICI A;  3HOZ B;  1DON A;  4DK1 A;  5FOB B;  1I6V C;  3A8I E;  1QOH A;  3S9W A;  4HED A;  3OW7 A;  3H91 A;  3G7L A;  2EJF C;  4UAI A;  1SND A;  3OSO A;  2E74 C;  1O78 A;  1I4Q A;  1FNU A;  4V19 0;  4XYO A;  3Q23 A;  2AQ3 B;  2IPK D;  2NBF A;  5CYU A;  2KA7 A;  2NWG A;  4ZYS A;  3PIP 3;  3GQB A;  4BS9 A;  1LT6 D;  3BDO A;  3S14 B;  2JA6 B;  2M2L A;  2ENB A;  4RCN A;  1C4Q A;  3QIA A;  3C1E A;  5JOB A;  3BYT B;  4OO1 G;  1AEX A;  1CT1 D;  1OXT A;  2ZXP A;  1A15 A;  3NSW A;  3ERO A;  3SEB A;  3K5L A;  3RLF A;  2F0F A;  1A3U A;  3IKJ A;  1STE A;  1CQV A;  1KNE A;  2NVX B;  2IX0 A;  4G7O C;  4CGY B;  2JA7 B;  2WKD A;  2Z4I A;  1DOL A;  1JWS D;  1H9J A;  1LT3 D;  3LNN A;  1LTR D;  5J39 A;  3S2D B;  2K5D A;  2K32 A;  3V2T A;  2B2W A;  2B2U C;  2WKC A;  5FO9 B;  1ICW A;  5DEH A;  1LTI D;  4C3H B;  1OXX K;  4K6D A;  1EZ6 A;  4ODG A;  1CHQ D;  4MHE A;  2AQ1 B;  1E0B A;  1TY0 A;  5G3L D;  2WP8 J;  4RKB A;  3L7Z C;  4N9P A;  4XQJ A;  2B2Y C;  3URY A;  5ELF A;  2KEC A;  5IGE A;  4CJ1 B;  4PMC A;  3I3C A;  1DD2 A;  3GTP B;  2XRQ D;  3GTL B;  5EBD A;  3V05 A;  3K5O A;  1CHP D;  5EQ0 A;  3TBI B;  1SYG A;  4DU9 A;  2PPB C;  2VB2 X;  1KLU D;  1EYA A;  2Z4H A;  2D5D A;  3QWN A;  2EYJ A;  5D14 A;  4DAP A;  1MSH A;  4K8I A;  3VYT A;  1TWC B;  5A35 A;  4F87 A;  3C3L A;  3KLR A;  1TQO A;  4R9W A;  2EY2 A;  4CJ0 B;  4KKU A;  4DK0 A;  2IT1 A;  2K04 A;  4UDU C;  5CV8 A;  5IGG A;  1EQV A;  3MFY A;  5C5L A;  4H44 C;  5FKA C;  2MP1 A;  3J80 L;  3TP6 A;  4C2M B;  2GA4 B;  5A2Q E;  3K6O A;  4WRD A;  5DM7 3;  3J7Y W;  1M4V A;  4FXG C;  4I7Z C;  3NTH A;  4WJW A;  1F2Z A;  5DM6 3;  5BN4 A;  3J81 L;  3VR6 A;  1EIH A;  4RGN A;  1K8O A;  3GP7 A;  4NKL A;  4DAY A;  4KJN A;  5JEA G;  2O4X A;  2IL8 A;  5CV9 A;  1SYE A;  4KD4 A;  3EA6 A;  5JEA J;  3I72 A;  2E76 C;  5EJW A;  4A3I B;  1GHJ A;  1KDB A;  5CV7 A;  1JB3 A;  2XN9 C;  1GUW A;  1SE2 A;  2HCC A;  2MPM A;  4O1N A;  1EZ8 A;  3IFT A;  4RA8 A;  3I4N B;  4A3E B;  1NR2 A;  2V4D A;  1Q1B A;  1HA6 A;  3D4W A;  1AN8 A;  2NZ1 D;  2WAC A;  1WTV A;  5M3M B;  3EFX D;  1SNQ A;  1B44 D;  1SYB A;  1CI3 M;  1FD7 D;  4V0B A;  2N88 A;  2NTS A;  2IX3 A;  1S5B D;  1F9R A;  3MEH A;  1WVL A;  5C0X G;  1KDC A;  1LTG D;  5E4W C;  4J8Q A;  1JIC A;  2PYK A;  1A2T A;  1GUG A;  2A68 C;  2VXW A;  4PV1 C;  4FVM A;  5KIX A;  2H4O A;  4AYB B;  1EEF D;  2WV6 D;  4EQP A;  5KYI A;  4ZKB B;  1EYC A;  3R2I A;  1PRT B;  1V1P A;  4WFN 3;  3VYU A;  4DF7 A;  4L8J A;  1AZP A;  3M4Y A;  2PZU A;  2K28 A;  2MHV A;  4QCL A;  2HUG A;  2F0E A;  1PLF A;  1G2S A;  4IFD I;  1O7L A;  3NUC A;  2D2C C;  2R7Z B;  2Z1C A;  4DAV A;  1RCV D;  4CBV A;  4ZUI A;  1PXU A;  2AWO A;  5C6A A;  4QF4 A;  1EU4 A;  2VUM B;  1D6E C;  4OIJ A;  1LLR D;  1QWY A;  2EJG C;  3P7J A;  1KAA A;  3PIO 3;  3FPP A;  4HTH A;  2L12 A;  3CRK C;  5IT9 L;  1ENA A;  1LTT D;  4F7X A;  1ESF A;  3DXJ C;  3ERQ A;  3AMU A;  5TSS A;  4K2K A;  3NE5 B;  5E3F A;  4KD3 A;  4C3I B;  2DN8 A;  4M1U B;  1UNS A;  2F0O A;  5D3I B;  1BR9 A;  1KLG D;  1HA5 A;  5IGF A;  1ENF A;  1DJR D;  1I6H B;  2B2U A;  1DZ1 A;  1HQM C;  1O80 A;  4WOR A;  4A3B B;  2QF7 A;  2LFN A;  1S5F D;  3WDN A;  3RZO B;  3K58 A;  2DNE A;  2O2L D;  1G2T A;  1R9T B;  1EL0 A;  2VB3 X;  2WIN B;  3MAQ A;  2B2V A;  1EY5 A;  2L11 A;  4Z9C B;  4ZKC B;  1D2B A;  1NR4 A;  4E6I A;  1S5C D;  1PTO C;  3K5M A;  4KN7 C;  2F3W A;  4XIG S;  2Z8L A;  4RGO S;  2J7Z A;  2KJX A;  3CU7 A;  2IJ0 A;  2F0K A;  2F0N A;  3HGB A;  1JE4 A;  4CJ2 C;  2QKI C;  2XWJ B;  3GV6 A;  1I4P A;  2NUC A;  1SMY C;  2A6H C;  1HHV A;  2E2H B;  2AQ2 B;  4C3J G;  5ELC A;  2QIL A;  2PZW A;  1C48 A;  4OO1 I;  3MFG A;  5EPL A;  5G3L F;  3I70 A;  2KVM A;  1ZXT A;  4LJZ C;  1S5D D;  4FF2 A;  3NP8 A;  4JK1 C;  2D62 A;  1FR3 A;  3T51 B;  1ZKO A;  3GTO B;  2HQE A;  2K7V A;  1H9S B;  4RGT A;  5E1F A;  2JXM B;  2G9H D;  1PTO B;  4O42 A;  2NVY B;  4L63 B;  4PMW A;  3PUY A;  1VF5 C;  2N55 A;  4BY7 B;  1NCV A;  3BVZ A;  4MIU A;  2J0T D;  3SE0 A;  1SYC A;  2XRS D;  2F3V A;  1D5X C;  4ID6 A;  2HCI A;  4IFD J;  1IW7 C;  1R4P B;  1XTC D;  3N6R A;  1KNA A;  5BN3 A;  1RTO A;  2EY5 A;  3HZX A;  5J1Z A;  4FF1 A;  1Z7T A;  2FMM A;  4GZY C;  3ZYY X;  2WII B;  3VA7 A;  3TP8 A;  1UUP A;  3DMU A;  1CA5 A;  3HOU B;  1OXV A;  4CKE A;  1AP0 A;  4IUU A;  3HOW B;  5K36 H;  2F0I A;  3QOL A;  3DUZ A;  1B4O A;  3ND9 A;  4EGV A;  3GV3 A;  4RFB A;  3J81 E;  1BCP C;  2OT2 A;  1EOT A;  2ID0 A;  3SK6 A;  1EU3 A;  3LWU A;  4IUN A;  4K5W A;  5JAV A;  2R92 B;  2BDN A;  4J1M A;  2R61 A;  1ZYR C;  4IUQ A;  5FLX L;  2CW0 C;  1TKW B;  3NWT A;  1JOQ A;  3E5S A;  4KKS A;  3K5N A;  4IZ8 A;  1SFO B;  2IX1 A;  4C1N K;  4R8I A;  1QB5 D;  4QUC A;  3MWY W;  1S4Z A;  2NB0 A;  2E2J B;  2L0C A;  4DN4 M;  2PZT A;  2OXP A;  4HMJ A;  3EQL C;  5JVH 3;  2TSS A;  2K33 A;  3R93 A;  4XT3 B;  4CHT B;  1V43 A;  1I50 B;  1T5E A;  2HDM A;  1EY0 A;  1ZEQ X;  5COR A;  1GOZ A;  1SAP A;  1GUO A;  4EQO A;  1SE4 A;  4RCO A;  1JOK A;  3FKI B;  1Q90 A;  4XQN A;  1GUN A;  1LTB D;  1HFG A;  1QCB D;  1XXG A;  2CHB D;  1BCP B;  2F0V A;  3HOX B;  3TZD A;  2PCF B;  4HSP A;  1QNK A;  4HR7 B;  2D9U A;  1ILP A;  2B8F A;  5C44 B;  4BY1 B;  2K5W A;  3K59 A;  4DFA A;  3OIP A;  3U9O A;  1O7Y A;  3U9S A;  2PMZ B;  1DOK A;  1NAP A;  4OO1 H;  1LO5 D;  4EQN A;  1BUV T;  4QMG A;  1WTP A;  1SJE D;  1CK1 A;  2B2T C;  5C0X I;  5BN5 A;  4M8A A;  2F0J A;  1PRT D;  1GJX A;  2RSO A;  2XNA C;  3HOV B;  3ONA B;  3GTJ B;  1FGB D;  1WD1 A;  3I4L A;  1E2W A;  3GTK B;  2EVB A;  2X6G A;  4X3T A;  3MTS A;  4IN3 A;  3LWE A;  1AW7 A;  4ZUJ A;  4XQQ A;  4BBR B;  2SDF A;  4XTC S;  5IT9 E;  3KUP A;  4KY6 A;  4FNF A;  2WAQ B;  1WTX A;  4K8J A;  3W3A A;  2KOL A;  3D4D A;  5ELD A;  1EFI D;  2M00 A;  1HTP A;  1Q12 A;  5EKL A;  1G91 A;  4OL7 A;  2A6E C;  2L5T A;  1TT2 A;  2A68 D;  1EY4 A;  4TRD A;  5KND A;  4TKO B;  3M4O B;  5KRU A;  5C3X A;  1EWC A;  3RZD B;  4A93 B;  2KUM A;  5KGU A;  4ZLT F;  4YIJ A;  3QO2 A;  4U68 A;  3C2P A;  3T16 A;  3AU7 A;  3S1M B;  3A7L A;  4RKL A;  2XIW A;  2QEJ C;  3OOC A;  5FK9 C;  5C5M A;  2EYH A;  4IQZ A;  4HAE A;  1J8I A;  1RJT A;  4G57 A;  2K05 A;  2R93 B;  1JQY D;  2SNS A;  1B9N A;  2A69 C;  3E6Z X;  4DXF A;  3H3V C;  2AWN A;  1HQR D;  5COY A;  4NW2 A;  2EDG A;  2K5Q A;  5IOD A;  4HN7 A;  2RDF A;  1F77 A;  1EY8 A;  1X32 A;  3H6M A;  4BA1 I;  3M7G A;  2EOT A;  3S17 B;  4ZRZ A;  1G29 1;  1RD9 D;  2JYO A;  4TSS A;  3OIQ A;  3EJI A;  3OHX C;  2HDL A;  3UI2 A;  4A3F B;  2JEB I;  3BS1 A;  1OXS C;  1S5E D;  2RDH A;  2AUJ D;  1OXU A;  1NUC A;  3A55 A;  3A8K E;  4KHZ A;  4FF4 A;  2F03 A;  4IUV A;  4P2C B;  3KK7 A;  5I2X A;  5JEA H;  1STG A;  1BF4 A;  4KMU C;  1Q8I A;  3IL8 A;  1QIL A;  1I3Q B;  4OGQ C;  3FVQ A;  3FRP B;  1QNU A;  5K5P A;  3DHQ A;  3H0G B;  1SNP A;  2RQX A;  1UAP A;  1HRJ A;  1LT4 D;  3TN2 A;  3SXH A;  1STN A;  2KHS A;  4DGZ A;  2RSN A;  1HUN A;  5C4Z A;  4Q0F A;  5C0X J;  1GXD C;  1PTO D;  3HOY B;  1EY6 A;  1STH A;  3M85 A;  1TII D;  1HCZ A;  2IWH A;  1Y69 U;  2H1E A;  3O13 A;  3I90 A;  3R3O A;  3NQI A;  1TS4 A;  1LAC A;  1TY2 A;  3MC0 B;  1I4H A;  3HG9 A;  5T1I A;  2ZXO A;  1WTQ A;  5DNF A;  2EYF A;  4JBW A;  3BVG A;  4K5V A;  2F4I A;  1HTL D;  2KEE A;  3QG1 A;  4FXD A;  1Y1V B;  3I91 A;  2RVL A;  3IFD A;  3M3Y B;  5I6Y A;  5ELB A;  1U4M A;  4H13 C;  3MXU A;  1B50 A;  1LT5 D;  3SR1 A;  1VMC A;  3NTI A;  3KLS X;  2L9H A;  1BNZ A;  1R4Q B;  5FLX E;  1T5X D;  3WOF A;  5JPM C;  1LAB A;  3C1F A;  5DAU A;  5I9O A;  1VDZ A;  3TP7 A;  4PNY A;  2BE5 D;  2B2W C;  1M8A A;  4QUF A;  3D8G A;  1IW7 D;  3KBX A;  1E2Z A;  2R6G A;  2L4N A;  3MZ5 A;  2YU9 B;  1SYF A;  1YNN D;  2EYL A;  3Q0A A;  2ICE C;  1D1I A;  5I9P A;  2G9D A;  3V96 A;  3PV0 A;  1B1Z A;  4B9W A;  1KAB A;  4G7H C;  2EY6 A;  1D1K A;  4PQX A;  2K1B A;  1II3 A;  2E2D C;  2B2Y A;  1BBX C;  1IL8 A;  5CV5 A;  1PTO H;  4FXK C;  1BXT A;  1B53 A;  1BCP D;  2VNU D;  5A2Q L;  1PZJ D;  2JA5 B;  2PO4 A;  2NN6 G;  3BVM A;  1QG7 A;  3HKZ B;  1F2M A;  5HGT A;  4K14 A;  3HRZ C;  2CVR A;  2C5C A;  2K01 A;  1PFM A;  4KK7 A;  3DM1 A;  2QDB A;  4PMB A;  1PRT F;  1IHZ A;  4IUT A;  2Q8R E;  3PUZ A;  3MXP A;  1IYU A;  5EBC A;  1Z6H A;  4QIW B;  3BZD B;  5LL6 S;  1CQF A;  4LAA A;  1JCK B;  1VF7 A;  4DA2 A;  1X3Q A;  4IUP A;  1CM9 A;  3CQZ B;  3NHH A;  2FHT A;  5CC4 A;  2EYO A;  1WTO A;  2JA8 B;  5E4X A;  4A3G B;  2LMC B;  5CBE E;  3R2T A;  4RH6 A;  2M9V A;  3D6C A;  4N9T A;  1F2L A;  4NDX A;  3MXG A;  1AZQ A;  3K0Y A;  4B08 A;  3F2U A;  1JOR A;  1A3V A;  3CKI B;  1BO0 A;  2EZV A;  3A54 A;  2R3Z A;  3MHB A;  4KHV A;  1A6X A;  3J7A V;  1OO9 B;  2FMC A;  2AUK A;  4K5X A;  3SK4 A;  3E0J A;  3A7A B;  2RDG A;  1GUS A;  1EYD A;  2DY8 A;  3NBI A;  3DWP A;  3GD7 A;  3J80 E;  3CHB D;  2BCO A;  3D6W A;  4IFD H;  3BG3 A;  3SK8 A;  2B63 B;  1B2T A;  5M5W B;  1JOO A;  1B3A A;  4ZAI A;  4C3J B;  4RGM A;  1DCZ A;  3S15 B;  1PYW D;  5IGC A;  3VYS A;  1SNC A;  2XVS A;  1CA6 A;  1SE3 A;  2FFK B;  3FPU B;  3QOJ A;  4B9X A;  5JVG 3;  3D31 A;  2BA1 A;  2NVT B;  4BWG B;  1PZK D;  4C3H G;  2OEO A;  2RBM A;  1SBB B;  1PFN A;  3OWE B;  2DNC A;  3TDQ A;  1STY A;  2F0H A;  2IW3 A;  1RF2 D;  4H0L C;  5C3E B;  2A6E D;  1TVX A;  5D3D A;  4DNT B;  1O7Z A;  4G4K A;  3QB3 A;  3VR3 A;  3FMC A;  3W2D A;  1ILQ A;  5C3W A;  4HMI A;  1MI2 A;  5IGB A;  1BOS A;  1LTA D;  1W6J A;  1G6Z A;  4F88 A;  2F0Q A;  1V1O A;  4X3U A;  2FJ2 A;  1RKN A;  1MSG A;  1F9P A;  1NSN S;  4ZQ3 A;  5CMD A;  1B9M A;  5JJZ A;  4DNR B;  3H09 A;  3JAM L;  1ET9 A;  2FIN B;  2A69 D;  3K7A B;  3RUZ A;  4A3J B;  4R8N A;  2F0T A;  1PTO F;  2EXZ A;  5D65 A;  1XWE A;  4RHR A;  3S1N B;  3EVQ A;  3C46 A;  1F9Q A;  2K6A A;  5FO8 B;  2O5J C;  5ELE A;  3MXN A;  1SNO A;  4KJO A;  1Q3L A;  1F9S A;  4J6H A;  5HUR A;  3SHL A;  1V1P B;  4ZK9 B;  1Y8O B;  1TWG B;  4KY7 A;  4XXE A;  3GTM B;  1YNJ C;  5M5X B;  1JWU D;  1STB A;  5I4D A;  1I4X A;  1VCI A;  3OMC A;  1L0X B;  1C8C A;  3BDL A;  1DXM A;  3I8Z A;  1DYQ A;  3RD4 A;  4HCS A;  1SDF A;  4KKT A;  3D4R A;  2E2I B;  5IGD A;  3NK9 A;  5F2D A;  2KCN A;  4A3D B;  3H94 A;  3A56 A;  4TQU S;  2B2V C;  3MVV A;  1TU2 B;  4BBS B;  4K2L A;  1BDO A;  3VR4 A;  3ITP A;  3VA5 A;  1H9S A;  1LV9 A;  1EEI D;  5T1G A;  5EPK A;  3PMF A;  3GTQ B;  3PUX A;  3T56 B;  5M5Y B;  5CV6 A;  2O5I C;  2PQE A;  2WB1 B;  3DEP A;  1J9O A;  3TP5 A;  3T13 A;  1W6K A;  1FNW A;  5C4X B;  4A3M B;  5LHY 1;  2QCP X;  2J4X A;  1SSO A;  2Q8I B;  2I07 B;  1ONL A;  2MGS A;  1EQT A;  1SJH D;  3QJY A;  2JE6 I;  1E2V A;  3PO2 B;  3TME A;  4ULL A;  1HUM A;  2KCC A;  1EWH A;  3KBG A;  5IOC A;  4C56 C;  2Q8T A;  2DY7 A;  1HPC A;  1ET6 A;  3NXW A;  1H9R A;  1TS5 A;  2CQA A;  1QE6 A;  5M3F B;  1BCP F;  3OMG A;  1TS3 A;  2PW5 A;  1KTK A;  2ZXR A;  4IUR A;  2EPB A;  1I4G A;  2KED A;  3KLS A;  3L9A X;  2X69 A;  3BYY B;  1MD2 D;  4LMQ D;  1FNV A;  4XDX A;  3ND8 A;  3S2H B;  3FDT A;  1TR5 A;  1HXY D;  2EE1 A;  3N52 A;  1X3P A;  2JEA I;  3T53 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...