1MSGA

Solution structure of gro(slash)melanoma growth stimulatory activity determined by 1h nmr spectroscopy
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN MELANOMA GROWTH STIMULATORY ACTIVITY
publication title Solution structure of GRO/melanoma growth stimulatory activity determined by 1H NMR spectroscopy.
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine (chemotactic)
total genus 8
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1msgA00
2HDLA 2L1BA 3GV3A 2RA4A 5COYA 3D6WA 1WVLA 4X3SA 3LWEA 1E0BA 1JE4A 1VMPA 3GV6A 1PFNA 3N52A 4R9WA 1XYIA 2K28A 2EOTA 2Q8RE 1AP0A 1HFGA 1IL8A 1O80A 1RTNA 1QG7A 1B4OA 1B3AA 2HDMA 1WD0A 1J8IA 1PFBA 2EE1A 2FINB 5D14A 5EKIA 3FDTA 3UI2A 2L9HA 1U4LA 2MPMA 4OIKA 1HUMA 2NZ1D 2M2LA 2B2UC 1O7ZA 1ESRA 1F9SA 3I8ZA 1O7YA 4IUQA 5AFWA 2X69A 4X3KA 2D9UA 2B2UA 2SDFA 2KVMA 5DNFA 1X32A 5T1IA 1IKMA 4RWSC 5E4WC 1IKLA 1NR4A 2K05A 2DY7A 1BF4A 2FMMA 1PDQA 2HCCA 1CA6A 1ILQA 1WTPA 2KUMA 2L12A 2RSOA 4IUTA 1JICA 1DOMA 2XIWA 3R93A 4RAUC 1MI2A 1G91A 3MWYW 5T1GA 5D65A 1MSGA 1DOLA 2MP1A 2RSNA 5E4XA 1QE6A 1TVXA 1EIHA 1C8CA 1PLFA 5EJWA 4DN4M 3SVMA 4XT3B 2B2WC 1U4MA 1G2SA 1HUNA 5EPLA 4QUCA 1ICWA 4ZK9B 1CM9A 4IUUA 1RTOA 1EL0A 2B2WA 1HA6A 1ILPA 1MGSA 4OIJA 1F2LA 1DOKA 1WTXA 1EIGA 3QO2A 2Q8TA 2JP1A 3F2UA 1F9PA 1EOTA 2N55A 3I90A 4UAIA 3TN2A 1Q3LA 2NWGA 2FJ2A 1WTOA 1G2TA 1RODA 1HRJA 5CMDA 1QNKA 3FPUB 5EPKA 2B2TC 1SAPA 2K03A 3DM1A 1B53A 1G6ZA 5EQ0A 2K04A 4HCSA 4QUFA 2B2TA 4U68A 1BBXC 1RJTA 1LV9A 4IUPA 2NYZD 1WD1A 1NAPA 1B50A 2RVLA 1XX8A 1HHVA 2KECA 3I3CA 2K1BA 1X3QA 2KOLA 1NCVA 2H1EA 3IFDA 4MN3A 1HFNA 2N88A 5CBAE 4X3UA 1WTRA 2FHTA 2FFKB 2L4NA 1DONA 2EPBA 3G7LA 1BNZA 1A15A 1PFMA 4IUVA 4O42A 1EQTA 2KEDA 3P7JA 2HUGA 1AZQA 5JJZA 1KNEA 3TZDA 4IURA 4CJ1B 1J9OA 2L11A 1GUWA 1U4PA 3IL8A 2CVRA 1CA5A 4HAEA 1BO0A 1SSOA 1F9QA 1VMCA 2HCIA 2MJ8A 3KBXA 3DEPA 3MTSA 4LMQD 1DZ1A 4XDXA 5EPJA 1WTVA 1WTQA 1U4RA 2X6LA 2B2VC 2IL8A 2VXWA 4XT1B 4RA8A 2BDNA 1MSHA 4ZLTF 2B2YC 2B2VA 2K01A 4X3TA 1SDFA 4ZAIA 2B2YA 5CORA 3KUPA 3HP3A 2MGSA 3DEOA 4MHEA 1X3PA 1KNAA 2R3ZA 4HSVA 2J7ZA 1F9RA 1RHPA 2JYOA 1ML0D 3H91A 4ZKBB 2DY8A 4HEDA 1S4ZA 1M8AA 3ONAB 2X6GA 5CBEE 1NR2A 4R8IA 4CJ2C 1WTWA 1AZPA 1B2TA 2KEEA 4CJ0B 1ZXTA 4ZKCB 4NW2A 3Q6SA 3I91A
chains in the Genus database with same CATH superfamily
3GV3A 1SYEA 3SK6A 4R8NA 4X3SA 2UXBL 4TRDA 4DV7L 1BCPF 2F0GA 1YEZA 4KI0A 2A19A 4A3KB 5D14A 3MXUA 1UAPA 5FLXE 5IWAL 2JA7B 4LF4L 3U9OA 3T1HL 5JEAH 4AYBE 2F0HA 5LL6S 3MA2B 3T1YQ 4KN7C 2FMMA 2PO4A 1I94Q 1HA5A 4EQOA 1CHQD 3J80E 1M90C 4LF5Q 4LF8Q 3U4VA 4RAUC 3M4OH 1G91A 1Z9FA 1VQAA 1X3EA 2NVQH 1SBBB 4GZYC 3E9HA 5M5YB 4DA2A 5CGKA 5LMUL 5GROA 4LAAA 5GAGC 1RTOA 4K0KQ 1HA6A 1Z47A 3TP6A 3S1RH 2EY6A 2B29A 1H9SB 4DR1L 1V9PA 4RG1A 1HRJA 2LKVA 4A3DH 5FLMG 1IHZA 2B39A 5C3XA 1J6QA 3NTHA 4P74A 1HNZL 4BXXG 1KQSA 2JA8G 4PMWA 3R2IA 2C5CA 2NTSA 3EIVA 1EIYB 3J7AF 3HOWG 4NDXA 4QIWB 3P75A 3I3CA 3STBC 2PZTA 1CTMA 1DCZA 4IQZA 3HOUB 5ELNA 3BDOA 5C0XI 5NUCA 2L4NA 4B3TL 1VQOA 2EPBA 4A3BB 4IUVA 1M1KC 2JA5H 3ULPA 1S5CD 4AYBB 1W3SA 2MO1A 3IL8A 1I3QB 2WB1G 1I6HB 3NBIA 5D3IB 5A2QE 4A3LG 4JI6L 3EFXD 4OWXB 1VQPA 3GTLH 1LM0A 3CMEA 4DR7Q 2KCNA 4JI3L 4GOPA 3A5UA 4BY1B 2FMCA 1LT4D 2K6AA 4GKKQ 1RDPD 3F8TA 1VQ5A 1YHQA 1II3A 2RCFA 4KJNA 4YCVA 3T56B 1E1OA 1KAWA 3Q6SA 3J7A5 4Z9CB 1AN8A 1WYDA 2L1BA 5JAVA 2DN8A 4BWGB 2JA6B 1V1OA 4A3KH 3RNUA 3GTJB 3C2PA 3OHXC 2JA7H 5LMNL 1O80A 2N49A 1NMGA 2WACA 2UXCQ 1FNVA 3QOLA 2F0PA 2E2HH 3M4YA 2XVSA 3HOZH 3CQZH 2A1AA 3MXPA 4I7ZC 1STYA 2L0CA 5BR8Q 1WCMG 2PZUA 3PIO3 1CA6A 4KY5A 2QF7A 1ILQA 4BBSG 4A3EB 5H1SE 1UEBA 3HKZG 2NBFA 5IT9E 4M8AA 1DOLA 2PW5A 4P71A 2CFMA 3TMEA 3PUXA 1G2SA 3OIPA 2N78A 5FO7B 4DR3Q 1IBMQ 5AJ3L 3I2ZA 3QO2A 4PNYA 1JT8A 4K6LA 3MXNA 1WTOA 4OWTB 4MTNA 4B3MQ 4JV5L 1F2MA 3FPUB 2B2TC 1B9NA 1X55A 1TWAB 4KD3A 3Q24A 1EQRA 2MFIA 3CU7A 3RZOB 3HOUH 5LL6X 5KNDA 1K3RA 1NCVA 2R93B 3EJIA 3GTKH 1TR5A 3C46A 3CCMA 1SLJA 4POGA 3P7JA 1UWVA 2I5LX 3R2TA 2UUCL 5EKKA 4IFDI 4XIGS 1NUCA 1WFQA 3PUWA 5KEEA 4UDUC 3MVVA 4C1NI 3I56A 4OEMB 2R92B 3L2PA 4K8JA 3CCQA 5FO8B 1GKHA 4K5XA 1EWCA 4QGUA 2A73B 2O5IC 1SFOB 4BY1H 1CHPD 2XWJB 4DV1L 1PVOA 2ATWA 1R4QB 4C3JB 2MNAA 1X56A 2J7ZA 1P16A 2AWOA 5G3LF 2EQSA 4RGTA 1TS5A 1W2BA 4NW2A 1VQDA 1PXUA 3I91A 3IAYA 1K8OA 1B70B 3Q23A 2VY3A 4H44C 2QDBA 4DV2L 3M9BA 4CHTB 2NTTA 3VR5A 4KHVA 2PNRC 3MAQA 5CV7A 1SYFA 1TWFB 4C3HB 2YU9H 4UP7A 5FLXL 1QUQA 3K7AH 1HNXL 3VA5A 3PF4A 4KD4A 4JBJA 5KYIA 4A3EH 4RWSC 4RKLA 1NR4A 1MKHA 2YTXA 2J4XA 3KF6B 3S1NB 4KHPQ 2F0FA 4JI5Q 4FO2A 4QCLA 3HEJA 4O1NA 3J80L 3SK5A 1DOMA 2RDFA 3R93A 3G6JB 2TSSA 2F0QA 1X6OA 4ID6A 2K33A 1CQVA 1NTGA 1AEXA 5IGBA 5IOCA 4F8MA 1RIPA 3NQTA 4MIUA 2F03A 4LUZA 3H0GB 5EPLA 4IUUA 1QWYA 4L63B 1HZBA 4OO1G 2EYFA 2HHHL 2WAQE 3HOYH 3J81i 2Z4HA 2L55A 3CPWA 3E0JA 1D6EC 1JB3A 3UDGA 3RZOH 1Y1WB 4QUFA 4DFAA 5M3MB 3I4NB 5DAUA 1AH9A 3ULLA 4A93B 4NP5A 3IFDA 3M3YB 2WIIB 4FF3A 2ENBA 2K7VA 3I4MB 1LT3D 3CCUA 2G9DA 1QVGA 3V05A 3TP5A 1UEAB 3KJOA 4NPSA 3K8AA 4A3MB 4UY8C 3KF8A 2F4VQ 4CJ1B 3L9AX 2R92H 1I5FA 2L11A 3KJPA 4DUZL 4RHSA 1K73C 3S2DB 3OYYA 1FR3A 5CYUA 1V8QA 1SFOH 5EPJA 5IP9H 1L0XB 5A2QL 2VXWA 5C44G 2VUMB 4C3JH 1I4QA 3AYHB 2ZJRA 2O2LD 5E3FA 2SNSA 2PMZE 4ABNA 3VDYA 2XGTA 1CK1A 2DY8A 1Q46A 5ELEA 3SE0A 2WAQB 4CJ2C 4DV4Q 4A3FH 2PQAB 1HH2P 4C3IG 2AQ1B 2JE6I 1FJGL 5BN5A 3D6WA 2UUAL 4WRDA 4OXPA 2F0TA 1EY8A 2EJGC 2EYOA 1XMOL 1PFNA 2Q8RE 3NTIA 2WV6D 2IX1A 3CW2C 4B9XA 2RDHA 1PTOC 5I9PA 1FD7D 4MTKA 2LXKA 4QJFA 4IUQA 1O7YA 3S1NH 2VQEL 2NVTB 5T1IA 4RMFA 5G3LD 3A7LA 2D62A 1EYGA 1MHWC 2DNCA 1MI2A 1A3VA 1WI5A 5IT9L 1TVXA 1NE3A 1PLFA 1C4QA 2K50A 2B2WA 2JJQA 4YY3Q 2Z0SA 4JI7L 1MGSA 2PMZB 3RD4A 3NSWA 4NKLA 3KDFB 3O13A 1LT5D 2NVYB 4UAIA 4BBRB 1XWEA 1GM5A 4OWWB 4R4TA 4UP8A 5IYDG 1TY2A 2RCNA 4J1MA 4QL5A 1I4XA 1SAPA 2V1CC 3W5OA 5C0XH 4A93H 5HY6A 5JVH3 1JR0D 2EYMA 3L0OA 1K3BC 1KTKA 3HRZC 1FGUA 3MXGA 4DAVA 1S72A 3PO2G 3K58A 4B3SQ 2FHTA 3IFTA 4A3MH 1XMQQ 1JB7A 3S2HB 1LTRD 4ZQ3A 1PFMA 1TWCH 4X65L 4DV6Q 1SE8A 2Z9HA 3TEHB 1QVCA 3DM3A 2VUMH 1EFWA 4DK1A 3SDZA 1X9NA 2UU9Q 2EZVA 3JAMi 2BCOA 1I4HA 3S1MB 2R7FA 3VR3A 4NXMQ 4O2DA 1LO5D 1YHAA 2LXJA 3J81c 3I73A 3CC2A 2HHHQ 2KQ3A 1ET6A 3K5NA 1F9RA 1KABA 2AUKA 2SNMA 3E5SA 4L8JA 4AQYQ 4JI2L 4QY7A 1EY4A 3DWAA 4CJ0B 3Q0AA 3CCLA 1SJHD 1N34L 5KGUA 1AE3A 2JQOA 2ZXOA 3GTGB 4DAYA 3NPPA 1QOHA 5HGQA 4LWCA 4GKJL 3U9SA 4GLAC 2PNHA 1PH1A 3WWVA 5E1FA 2HDMA 3UE0A 3CCSA 3HG9A 3UI2A 1PTOF 1S3OA 4DR4Q 1VQ8A 2Q2HA 1MJCA 1O7ZA 3BZCA 2M9VA 3T4AC 5IYCH 4PQXA 4K5WA 4JI8Q 1MIUA 1TY0A 5CC4A 3NE5B 1TWHB 1PH2A 4OHJA 1EZ8A 3GTQB 1BOSA 3PCOB 1A6XA 4MNOA 5T1GA 4FVMA 5D65A 3TSSA 4B08A 3BU2A 2MP1A 3TP7A 1QE6A 1YVCA 2ZTCA 1BCPC 1KLUD 4IPCA 4O0AA 3K0YA 1EWIA 2KHJA 2JXMB 2NVYH 3M4PA 4BBRH 4IJLA 2GVBA 3CXCA 1SNQA 2K4KA 3ITPA 3CC7A 3OTOL 1L1OA 2JP1A 4KTAA 5CV6A 3F2DA 4HJ8A 2I0QA 1O78A 1U9RA 3DM1A 4CKEA 1LTID 4HIMA 3HOVG 1KDCA 1QB5D 2RDGA 2IT1A 1WD1A 1B50A 1EU4A 2R61A 2KBNA 2KECA 5IGDA 3M4OB 1PH6A 1YIJA 1B7YB 2HT1A 4A3GG 4X3UA 4X66Q 1XTCD 3NBHA 5KNBA 2F0WA 3BYTB 5TSSA 1L0WA 1AZQA 1EFID 2SOBA 3NELA 5EGTA 5M3FG 3S1RB 3C3LA 1GUNA 1Q1BA 3R8BA 5CV8A 3S1MH 2PQEA 1DZ1A 1JJGA 1WTVA 3A0JA 3MHBA 1AFPA 4XT1B 2OQKA 1VQHA 2WB1E 4GS3A 4GOPC 2K01A 4X3TA 4HMIA 2RHSB 3F1ZA 3I72A 3NENA 2AUJD 3D4WA 2PI2A 1S4ZA 3FMCA 2KEEA 1Y69U 5L37A 3GTGH 5JJIA 5I2XA 2JA5B 2O5JC 3E6ZX 4KY7A 1E0BA 2A6HD 2OTJA 1JE4A 1VMPA 4JW0A 2E5LQ 1SNPA 3ICEA 1XYIA 4OO1I 3RUZA 4HTHA 1AP0A 2BA0A 4JI4Q 1JORA 1NBWA 4JOIA 2MUYA 4X62L 3NQIA 4JI0Q 1Y1VG 2MPMA 5C4XH 3NK9A 4GLXA 3GTLB 3PIOA 3I8ZA 4PZ8A 2AQ2B 2D9UA 2ES2A 2KVMA 4LFAQ 5CR3A 3JAMc 4FYDA 4EQ5A 1JC7A 1GUSA 4G7OC 1PTOB 4XYQA 2ICEC 1BKBA 3KLSX 4YWKA 4XT3B 5IP7H 3J7YW 3HKZE 1PHJA 1PMRA 2MQHA 3PF5A 1CM9A 4ZUJA 1PZKD 4QQBX 4LW1A 1RKNA 1XJVA 1V43A 3PMFA 1YJNA 1CKMA 2Q8TA 1PTOD 3UDXA 4A3JH 2E2HB 3I90A 2VZAA 2N55A 5IYBH 3S1QB 3HOZB 3CQZB 1N34Q 3A55A 1TIID 5EPKA 5DEHA 2NB0A 3QWNA 5A35A 3KYHC 5DM63 1OXTA 4LF7L 1CKOA 1H9KA 4Y52H 4IFDJ 1CFMA 3M7GA 1HPCA 3TQYA 4ZUIA 1BBUA 4ZRZA 1EZ6A 3S17H 1VF7A 3CRLC 4DNRB 1DONA 3SK4A 1XNRQ 4IPGA 2LY7A 3QB3A 2OCEA 1SYCA 2JEBI 1O7LA 1D5XC 3BZDB 1I4GA 3T53B 2CVRA 3W2DA 1CA5A 1VMCA 5EBCA 5ELOA 4QB4A 4JK1C 1U4RA 4HMJA 3HOXB 2HD3A 1WCMB 3M4QA 3HZXA 4C1NK 2G9HD 2PCFB 2B2YA 4DUYL 5CORA 3J81j 1A3TA 1K8GA 1EEFD 4LF6L 1RHPA 1STGA 3OTOQ 2RBMA 2KCMA 2B3GA 3MEFA 4R8IA 4CDCC 3GTKB 3FRPB 2K5NA 5COYA 2PYKA 2K5VA 1TS4A 4AH6A 4YWLA 3PV0A 4JC0A 3GQBA 2NUCA 3LX0A 1I4RA 2F0SA 4BXXH 1EYAA 3AFPA 2J0TD 3ER0A 4YIJA 1C7YA 3KBGA 3SK8A 1EQVA 4N9PA 4DNTB 3A54A 5C3EG 3IKJA 4DXGA 1VCIA 2L9HA 4OIKA 4DV3L 1FYCA 3K59A 4XQJA 4B3RQ 1N32L 4HN7A 1HCZA 1PRTC 1LLRD 2X69A 3WOEA 1NJIC 3OW7A 3RLNA 1UE1A 2E74C 1DD2A 3NP8A 2EVBA 4GLVB 4GN5A 2RSOA 3P20A 1PTOH 3CCRA 4N9TA 4JI1Q 2VQFL 4EQNA 3GO5A 3OW2A 1WTHA 1EIHA 1C8CA 3GTPH 3HGBA 2N3SA 4DR2Q 4NXNQ 4A3LH 4PMCA 1T5EA 4DK6C 2TMPA 2A68C 2JN4A 5JEAJ 5C5LA 2AWNA 3S1QH 2IX3A 5FK9C 4P72A 4G7HC 1A62A 1JJCB 1N36Q 2UXDL 2YU9B 3BG3A 1IBLL 3K7AB 4TSSA 3CPFA 1SN8A 5I6WA 2KCCA 1BCPB 3OWEB 2D0OA 2EJMA 3FKIB 3EA6A 4BS9A 1E2WA 1N33Q 2R7ZB 3I70A 5C5MA 1IW7C 2M00A 1UE5A 3MZ5A 4DV5L 4GN4B 1KDBA 3E3XA 1BCPD 1GD7A 2ZTEA 2GA4B 4K5VA 1I4PA 5E7NA 2IY5B 3OIQA 1RCVD 4O42A 4RGMA 1G8ZD 4F88A 1BUVT 1ENAA 1C48A 3W1BA 2ZM6Q 1YNNC 3HOXH 2YTYA 3HOUG 1WCMH 3HOYB 2UXBQ 3RR5A 3U4ZA 5I6YA 4DV7Q 4A3BG 1A0IA 3H3VC 4BBSH 4HIOA 3EVQA 3BS1A 4AYBG 3KF6A 3GDEA 3D0FA 1LTLA 3A56A 4KKUA 5IWAQ 4HJAA 4LF4Q 4A3CH 2H4OA 4ZKBB 3T1HQ 2F3WA 3ONAB 1S5FD 4LFBL 4ALPA 4RCOA 1PZID 3RLFA 3LNNA 1VQJA 1JWMD 3WOFA 5JOBA 1KD1C 1XNQL 3LWUA 3CP0A 3TREA 2CQOA 3H3VI 4BY1G 2N8NA 3BZKA 5KNCA 1H95A 2RKSA 5LMUQ 1TT2A 1U5KA 1J8IA 3CC4A 3S9WA 1PRTF 2JA6G 4OGQC 2Y0SG 5KIXA 2M2LA 4EQPA 4H0LC 3A8KE 5DNFA 1X32A 4DR1Q 1E22A 4DK3C 4I65A 1PYSB 4XTCS 3VR6A 2BH2A 5ELBA 1HNWL 1HNZQ 1KRSA 4A3FB 3W3AA 1PH3A 2RSNA 4PZ6A 3S14B 5JJLA 1QCBD 5EJWA 3K5OA 2B2WC 2XSCA 1KL9A 4ZK9B 3P1HA 4A3EG 1H9JA 4XQNA 1F2LA 4B3TQ 3AEVA 1DJRD 1Q8IA 1Z7TA 3ND9A 2XRQD 3F2UA 3I55A 3FKIH 2F0JA 1FVIA 5J1ZA 2QGQA 3T51B 4LF9L 2K5DA 2R7ZH 1IBKL 3GTOB 4DR6L 5CV9A 4JI6Q 3CMAA 2Q2UA 1ZEQX 2NYZD 1LTTD 2E8GA 2RVLA 1HHVA 4L5SA 4KLKA 3MXNB 4TKOB 2H1EA 3S16H 4JI3Q 2ZJQA 2F4IA 1QILA 1TS2A 1D1KA 1HXYD 2NN6G 1MD2D 2NZOA 2QA4A 4TQUS 2EJFC 4OX9L 2R93G 3J81E 1BO0A 2GVAA 1A63A 1M4VA 1CKNB 2DUDA 2VB2X 3AB9A 3DWQA 3DXJC 4RA8A 1MSHA 5LMNQ 2B2VA 4Q5VA 4PMBA 4LK1C 4ZAIA 4IUNA 4IO9A 1D5MC 1X3PA 3ERQA 5IIFA 2MHVA 2R92G 3H91A 2ZTDA 1B8AA 4X64L 4HEDA 2CH4W 3EROA 4OO1H 4LFCL 1Q82C 3PSIA 4ZKCB 2E2IH 1DM0B 1TWCB 1AE2A 1EY9A 2A69C 5GQOA 4PZ7A 3KDFA 1HJPA 3L3OC 1KAAA 3N52A 1K0SA 1STHA 1WD0A 4IN3A 1PFBA 3PUVA 1B44D 3STBD 1KC8C 1NY4A 1ESRA 4S3SA 5HURA 3FP9A 5AJ3Q 4DKAC 1BBWA 4XYOA 1XPUA 5K36G 4JV5Q 2HCCA 4C3HG 4J8QA 4RCNA 1JICA 4ZYSA 1QUQB 3S14H 4A3IB 1F2ZA 3PO3B 4JBKA 3BVMA 5E4XA 5FJ8G 1FNWA 5C44H 3SXHA 4RFBA 5GADC 4RGOS 1L1OC 1KRTA 2D5DA 1X65A 4HCEA 3NWTA 4G7ZC 5I2YA 3ND8A 2WFWA 2NWGA 1VF5C 3KOJA 4KV6A 4RKBA 2UUCQ 3GTOH 3OSOA 3H0GG 2K03A 1QZGA 3UDIA 3RZDH 3OOCA 4R4OA 1VQFA 4C3IH 2R6GA 1BBXC 3HFZB 5EAYA 5C4JH 1IYUA 1I50H 1STAA 1QNUA 4HIDA 1K83H 1J5EL 2ID0A 4DU9A 4DV1Q 5ELCA 1HFNA 1MBYA 1AW7A 2Q2IA 2F0EA 3BJUA 5CBAE 2AHOB 2F0NA 1Y1WG 1SNDA 2QCPX 5M3MG 1DXMA 3CCJA 3GTMB 2HUGA 3I4NG 2JEAI 1CZWA 4JCVE 3SHLA 4YHHL 3I4MG 4A75A 4DV2Q 1D2BA 4CDDC 3J7ZC 3AU7A 1C9OA 2OQ0A 1SDFA 3KF8B 4C2MH 1IW7D 4V0BA 1H9RA 1A2TA 3DEOA 4UP9A 1E1TA 1KNAA 4HSVA 1HNXQ 5IGGA 3S24A 4CDFC 3OMGA 3EQLC 4P75A 2VUMG 1PH4A 2F3VA 4DV0L 1WVLA 2GN5A 4JYAL 1FGBD 2PW7A 3QIAA 1IBKQ 3Q8DA 5IYDH 1YNND 3GV6A 1ASYA 4R9WA 2K28A 4JOIC 3UE1A 1RTNA 4APVA 4HR7B 1LT6D 3QOJA 4IALA 1B4OA 3JAME 5KYLA 3HS0C 3CHBD 1NNXA 1HR0L 2A5HA 2WP8J 4PV1C 3AQQA 1IKMA 3VA7A 5E4WC 3K7UC 3TS0A 2OTLA 4A3IH 3PO3H 2KUMA 3M7NA 2KJXA 3V2TA 2NVXH 2A6EC 1E2ZA 3EN2A 5M3FB 1X54A 5IYCG 4JPBW 4ZCKA 3NUCA 3K5MA 4ODGA 1ET9A 4DXFA 4N8X1 1OXSC 1KHIA 1FL0A 1WTXA 4BY7G 5C4XB 1VS0A 3T1YL 1I94L 4P73A 4DUZQ 1PH7A 4LF5L 4LF8L 1G6ZA 3H09A 2F0LA 1VQIA 4GNXA 4IUPA 1Q12A 4BBRG 2AMCB 2F0KA 2K1BA 4YWMA 4K0KL 3GTMH 1TQOA 4JVZA 2ZXRA 1A15A 4WJ4A 2KEDA 3AFQA 4LUVA 1SMYC 1Z6HA 5BN3A 3B6YA 5JJZA 3ERSX 5HGTA 5C0XJ 2JK8A 1FJGQ 2UUAQ 4JBWA 1ENFA 2O4XA 4QF4A 3J81L 3KBXA 4A3JB 2XN9C 1LACA 3K81C 4IFDG 1XMOQ 1YNXA 1SJED 2B2YC 2G5DA 2LS01 2VW9A 1I6VC 3KUPA 4KN4C 4MHEA 3E0EA 3H3VH 2JYOA 4K14A 1RD9D 1R9TB 3A74A 1M8AA 2VQEQ 3S17B 1HZAA 2R7DA 1S40A 2ASBA 2KHSA 5M5WB 4C56C 2RQXA 3D8GA 2B63G 1J5EQ 3H94A 3W1GA 4CKBA 3HOVH 4DR7L 2I5HA 2EE1A 2K75A 1YI2A 4JI7Q 4DAPA 4FF1A 1B9MA 4GKKL 4ULLA 4A3GH 1HTPA 3K6OA 2B2UA 1EEID 1GOZA 5K5PA 3D6CA 1U0LA 1VQGA 2BE5C 5M3FH 1H9SA 1VQ7A 2JA9A 1YNJC 1B1ZA 3VR4A 1V1QA 1X3GA 2NN6I 3A8JE 2UXCL 1VDZA 1YHBA 4H7BA 2JA8B 5M5XH 3I4OA 1YZ6A 2K5WA 5BR8L 3HOWB 4DNIA 4G4KA 1SNMA 1ZKOA 2I07B 3CAMA 4X65Q 1VQ9A 1G2TA 2QEXA 2EIFA 1PZJD 1V1PB 4U68A 1ICFB 1RJTA 2PI2E 3OPOA 1KXLA 2BOSA 4DGZA 1L1OB 4WJ3M 3PQIA 1SE3A 3A8IE 5JEAG 4WORA 1X3FA 2WB1B 3D3RA 1S5BD 1E2VA 4DR3L 2Z4IA 2FFKB 1IBML 3GTPB 2YV5A 1TWGH 1Y1VH 1O7IA 5ELFA 4JI2Q 2D0PA 1KNEA 4B3ML 3TZDA 1Y14B 1U4PA 3ZYYX 1SSOA 1F9QA 3MTSA 4LMQD 3G48A 2Z6KA 4QIWE 3NBHB 2OT2A 5GAEC 4GKJQ 4I7AA 2D2CC 4OELB 1R9TH 1K0RA 2WINB 2WKDA 3KK7A 1OXUA 4ILWA 1VQCA 4A3DG 4HJ5A 4FF2A 1G51A 4JG2A 3RN5A 3J80i 5CBEE 2IHEA 1B2TA 1GUTA 5M5WH 4UPAA 2Z8LA 1PA6A 2ZXPA 1D1IA 2RA4A 5EBDA 1VQLA 5FO9B 4Q0FA 3CCEA 2Z6BA 1ONLA 3ZJYC 1HFGA 1QG7A 4IPDA 1EU3A 1SYGA 4XQQA 4PG3A 3H15A 3JAML 4BBSB 1CI3M 2JA5G 1HUMA 3HKZB 5JPMC 4KY6A 1EY5A 4HJ9A 1IYVA 3K80C 1D5ZC 2Y0SE 4V190 3PUZA 1PDQA 3F2BA 1PYWD 1TU2B 1WTPA 3FPPA 2CWPA 2Q2TA 4Y7NB 2V4DA 5FLMH 2F52A 1T5XD 1JWUD 4CBVA 3KLRA 2JA8H 1UE7A 3ULJA 4DN4M 2CKZB 1GVPA 1HUNA 3QG1A 1GUGA 1EL0A 3HOWH 1K28A 1DGSA 2IWHA 4OIJA 1CT1D 4MZ9A 1EY7A 2QEJC 3UDFA 4A76A 1G291 1A2UA 1EOTA 1LUZA 1LTAD 3C1EA 2FJ2A 4TVAB 4KHPL 4A3KG 4JI5L 1HR0W 2F3IA 2A8VA 4H02A 2K04A 2HIVA 2JA7G 3BDLA 2DNEA 1A3UA 3X3MA 1XX8A 3HOZG 2A6ED 1X3QA 2EYJA 3IRBA 4MN3A 5C4HA 4J15A 5C3EH 2C35B 2L5TA 1SE4A 2JSOA 3I7FA 1VQNA 4X6AH 3QJYA 1EQTA 3BVZA 5IE8A 1STBA 1YJ9A 1GHKA 1N9WA 1GO3E 1ZYRC 3EBEA 4R4QA 1EQQA 1PV4A 2Y0SB 1CZGA 3DWPA 2HCIA 4DAMA 4XDXA 3DHQA 2B2VC 5J39A 4ZLTF 1TS3A 3TZUA 4X62Q 4K2KA 2EYHA 2MGSA 2XWBB 1SROA 4LUOA 1TXYA 4IOCA 3HOXG 3S16B 5FKAC 1WTWA 2X6GA 1AZPA 1ZXTA 2F4VL 3PIP3 4RH6A 1SMYD 3VYRA 5M5YH 3KFUA 4YCUA 1JQYD 2KA7A 1EIFA 2EOTA 1IL8A 4A3CG 4U673 1Q86C 2YYZA 2FINB 5F2DA 2EDGA 1QVFA 2IJ0A 1CSPA 1QZHA 3CKIB 4UHVA 4DV4L 1H9MA 2IX0A 4Y7NH 2K05A 3T13A 1BF4A 5IGCA 1QJOA 1JOQA 1Q1EA 3NTKA 5FLXc 4GOPB 1HQRD 1EUJA 2E2IB 3DUZA 1JMCA 2P5ZX 2EYPA 4LF7Q 3G71A 4F7XA 2QKIC 4A3BH 3SVMA 4RGNA 1ICWA 3J80c 1CKNA 1SEBD 2CW0C 1HZCA 4EVOA 1MJEA 1BQQT 1I3QH 2SEBD 4POFA 1I6HH 2XRSD 2OF1A 4KKTA 2MO0A 2IHFA 2NZHA 3RN2A 1QNKA 2CHBD 3VR2A 2PPBC 2QILA 4HCSA 2HQEA 2ZT9C 1LABA 4FDBA 1LV9A 2BE5D 2PZWA 3D4DA 4ME3A 3SGIA 4HSPA 1YNJD 2VB3X 1LTBD 4L5TA 4DUYQ 2N88A 4R1JA 5IY0A 4YY3L 1WTRA 2OWOA 3FKIG 4LF6Q 2R7ZG 2JA6H 5C44B 1A8VA 3DLLA 1KIXA 4IURA 3WDNA 3VYSA 2K5HA 3GTJH 5GAHC 2EY1A 1SNOA 1EYCA 4L6TB 1SYBA 1NSNS 2PQAA 3RZDB 5DLQE 4GN3B 4C3IB 5C4JB 4CDEC 1I50B 5IGEA 3HP3A 4DV3Q 4B3SL 1XMQL 3HOYG 3K5LA 1K83B 1N32Q 4CKCA 1JCKB 1IL2A 4E6IA 2DJGC 4WJWA 4DV6L 2RF4A 3MC0B 2E2JB 4FXKC 2UU9L 4AIMA 3TBIB 3U58A 4HJ7A 2VQFQ 4L5QA 4FNFA 3BVGA 4KMUC 4NXML 5J22A 5EKIA 2L15A 4DR5L 4DK0A 1L2FA 4NMZA 3Q22A 1NMFA 1F9SA 4C2MB 4AQYL 5AFWA 3BDCA 4H13C 2SDFA 4N8FA 1E24A 1T9HA 1TWAH 4FXGC 2UXDQ 1IBLQ 3TDQA 1IKLA 2FXQA 2NN6H 5IP9G 4R4IA 2F0OA 4FP5D 5I9OA 2XIWA 1YBYA 4C3JG 2R93H 2VS1A 1ASZA 1OXXK 1ENCA 4BA1I 1KDAA 1LTGD 1IZ6A 1U4MA 3MFGA 1PH5A 4DV5Q 4DR4L 1VQ6A 4F87A 1DYQA 5LHY1 3FEWX 2LFNA 4A3FG 5J3BA 3U50C 1F77A 2DJFC 4KJOA 4XXEA 1XPRA 2B8FA 5IT9c 2K32A 4JI8L 1JJ2A 1F9PA 3V96A 1Q3LA 1Q81C 2A6HC 2XNAC 3PO2B 1LYLA 2F0VA 4GNXC 2B2TA 1JOOA 2I46A 1Y8NB 1N8RC 3D4RA 1HQMC 1PRTB 2CWAA 5ISRA 4J6HA 2NVXB 2E76C 4KHZA 4L5RC 5KRUA 4B9WA 1F2YA 1SMXA 4HIKA 2HIXA 3PGZA 1PYBA 4LJZC 1VQ4A 4OL7A 5JVG3 1HTLD 3TS2A 1D8LA 1KLGD 4LFBQ 1PRTD 1J9OA 3K57A 4P2CB 1G6PA 3CF5A 3NWSA 1PFSA 5K36H 1XNQQ 2MJ8A 4IOAA 1Q7YC 1TWFH 1WTQA 4C3HH 2X6LA 1E7ZA 4JBMA 1K9MC 2Q8IB 2QW7A 2B8GA 4KKSA 5FJ8H 4X66L 1VQBA 1W6KA 1ML0D 2A68D 3SR1A 4EX5A 2E2JH 4EGVA 1EYDA 2EYLA 2XTIA 3A7AB 3HKSA 2C9OA 2CH4A 5C0XG 2HDLA 2OXPA 4A93G 1ZYRD 2EXDA 1HNWQ 3LWEA 1K8AC 4M1UB 3RLOA 4BA2I 4BY7B 3H0GH 4CGYB 1VQKA 2EY2A 3KLWA 2F0DA 1JWSD 1IXRA 1B3AA 4A3MG 1U4LA 1Q8KA 1SR3A 1LTSD 2QDLA 1GHJA 1XXGA 5C6AA 2B2UC 5LMNW 5CV4A 3CD6A 3KLSA 1ESFA 4X3KA 4FF4A 1Y1WH 1RL2A 3T16A 5M3MH 2F0IA 3I4NH 4LF9Q 1TKWB 2L12A 1XTDA 2K14A 2UUBL 3JC66 3OMCA 2E5LL 3M3YH 2AKWB 4DR6Q 1MSGA 2ZJPA 4JI4L 3CRKC 1C0AA 2I5MX 3I4MH 2WAQG 4RHRA 3QR8A 4JI0L 1W6JA 2K5QA 4QUCA 1PH8A 4KK7A 1ILPA 3HOVB 3S2DH 5CV5A 3J7AV 1DOKA 4A3IG 1EIGA 4LNQA 3PO3G 4LFAL 3PO2H 2AQ3B 1UNSA 2EXZA 4OX9Q 1E3PA 4A3GB 4IPHA 5EKLA 3BYYB 2IPKD 3NEMA 2RHQB 1S5DD 4A4IA 3VYTA 1CUKA 3MFYA 2KOLA 4DR5Q 3RMHA 4OONA 4G57A 1BNZA 1S5ED 2B63B 2CW0D 4X64Q 3SEBA 1IYJB 4K6DA 4LFCQ 2YTVA 1L0YB 2KHIA 1GUWA 1VQEA 1WOCA 5M5XB 2Z6KC 1XPOA 1GJXA 1R4PB 3F2CA 3S15B 2E2DC 5ELDA 1UUPA 2IL8A 5BN4A 1GUOA 2BDNA 1OXVA 5JPNC 3AMUA 2NVTH 3GP7A 1EY6A 5IODA 1XNRL 3M85A 4YCWA 3FHWA 4IJHA 3G4SA 1UE6A 5D3DA 2OEOA 1TWGB 1Y1VB 4BY7H 3NXWA 1B3QA 2IW3A 3TRZA 3PUYA 1FNUA 2CQAA 4R4CA 1EWHA 1P8LA 1EY0A 1V1PA 3FDTA 5C4ZA 2E75C 2BDOA 2NZ1D 2KCTA 2K52A 3GD7A 2BA1A 4K8IA 4K2LA 2DY7A 4DPGA 2ALYB 3C1FA 5M9OA 4IUTA 2VL6A 5I4DA 3URYA 4WFN3 3OWFA 3G6EA 2EY5A 3MWYW 3TP8A 1OTCA 2H5XA 1GXDC 1YJWA 1CQFA 1RF2D 3S2HH 4IZ8A 5FOBB 4IFDH 1BR9A 2NVQB 3FVQA 3X3NA 1WJJA 4B3RL 2CCZA 2LSSA 4DF7A 1D7QA 3I4LA 4DAYB 1STEA 1K8MA 3H6MA 3TN2A 1HZ9A 3N6RA 1RODA 2F0MA 1BDOA 5CMDA 1JE5A 3K0XA 1B53A 4ME5A 5EQ0A 4A3DB 4YHHQ 3MEHA 1BXTA 4JI1L 2A74C 5DM73 2A69D 3E9IA 5C3WA 1NAPA 1SYDA 3A5ZB 5C4XG 4NXNL 4DR2L 1Q90A 1SXTA 2KENA 3L7ZC 2B63H 1Y8OB 2WKCA 2VNUD 4QMGA 4FXDA 3G7LA 1YITA 3R3OA 1N36L 4GNXB 1JOKA 2Z1CA 3VYUA 3S15H 1VQMA 2BH8A 2F1MA 1STNA 4DV0Q 4HAEA 4JYAQ 2DGYA 2UUBQ 3DEPA 3LGJA 1N33L 5IP7G 1PH9A 2LMCB 1SE2A 1SNCA 1BVSA 1CSQA 2ICIA 2HQLA 3CCVA 5IGFA 3NHHA 3DMUA 4A3JG 2R3ZA 5IYBG 1HR0Q 5JJKA 4NB3A 3PIPA 1TWHH 1Y8PB 1EOVA 2F0UA 1NR2A 3GTQH 3D31A 5C3EB 1SRUA 2ZM6L 1OO9B
chains in the Genus database with same CATH topology
3GV3A 1SYEA 3SK6A 4R8NA 4X3SA 4TRDA 1BCPF 2F0GA 4KI0A 4A3KB 5D14A 3MXUA 1UAPA 5FLXE 2JA7B 3U9OA 5JEAH 2F0HA 5LL6S 3MA2B 4KN7C 2FMMA 2PO4A 1HA5A 4EQOA 1CHQD 3J80E 4RAUC 1G91A 4GZYC 1SBBB 5M5YB 4DA2A 5CGKA 4LAAA 1RTOA 1HA6A 1Z47A 3TP6A 2EY6A 1H9SB 1HRJA 2LKVA 1IHZA 2B39A 5C3XA 3NTHA 4PMWA 3R2IA 2C5CA 2NTSA 3J7AF 4NDXA 4QIWB 3P75A 3I3CA 2PZTA 1CTMA 1DCZA 4IQZA 3HOUB 3BDOA 5C0XI 5NUCA 2L4NA 2EPBA 4A3BB 4IUVA 1S5CD 4AYBB 3IL8A 1I3QB 1I6HB 3NBIA 5D3IB 5A2QE 3EFXD 2KCNA 4BY1B 2FMCA 1LT4D 2K6AA 1RDPD 1II3A 4KJNA 3T56B 3Q6SA 4Z9CB 1AN8A 2L1BA 5JAVA 2DN8A 4BWGB 2JA6B 1V1OA 3GTJB 3C2PA 3OHXC 1O80A 2WACA 1FNVA 3QOLA 2F0PA 3M4YA 2XVSA 3MXPA 4I7ZC 1STYA 2L0CA 2PZUA 3PIO3 1CA6A 4KY5A 2QF7A 1ILQA 4A3EB 2NBFA 5IT9E 4M8AA 1DOLA 2PW5A 3TMEA 3PUXA 1G2SA 3OIPA 5FO7B 3QO2A 4PNYA 4K6LA 3MXNA 1WTOA 1F2MA 3FPUB 2B2TC 1B9NA 1TWAB 4KD3A 3Q24A 3CU7A 3RZOB 5LL6X 5KNDA 1NCVA 2R93B 3EJIA 1TR5A 3C46A 3P7JA 3R2TA 5EKKA 4IFDI 4XIGS 1NUCA 5KEEA 3PUWA 4UDUC 3MVVA 4C1NI 2R92B 4K8JA 5FO8B 4K5XA 1EWCA 2A73B 2O5IC 1SFOB 1CHPD 2XWJB 1R4QB 4C3JB 2J7ZA 5G3LF 2AWOA 4RGTA 1TS5A 4NW2A 1PXUA 3I91A 3IAYA 1K8OA 3Q23A 4H44C 2QDBA 4CHTB 2NTTA 3VR5A 4KHVA 2PNRC 3MAQA 5CV7A 1SYFA 1TWFB 4C3HB 5FLXL 3VA5A 4KD4A 5KYIA 4RWSC 4RKLA 1NR4A 2J4XA 3S1NB 2F0FA 4QCLA 4FO2A 3HEJA 4O1NA 3J80L 3SK5A 1DOMA 2RDFA 3R93A 3G6JB 2TSSA 2F0QA 4ID6A 2K33A 1CQVA 1AEXA 5IGBA 5IOCA 4F8MA 3NQTA 4MIUA 2F03A 3H0GB 5EPLA 4IUUA 1QWYA 4L63B 4OO1G 2EYFA 2Z4HA 2L55A 3E0JA 1D6EC 1JB3A 1Y1WB 4QUFA 4DFAA 5M3MB 3I4NB 5DAUA 4A93B 4NP5A 3IFDA 3M3YB 2WIIB 4FF3A 2ENBA 2K7VA 3I4MB 1LT3D 2G9DA 3V05A 3TP5A 1UEAB 4A3MB 3KF8A 4CJ1B 3L9AX 3S2DB 2L11A 4RHSA 1FR3A 5CYUA 1V8QA 5EPJA 1L0XB 5A2QL 2VXWA 2VUMB 1I4QA 2O2LD 5E3FA 2SNSA 4ABNA 1CK1A 2DY8A 5ELEA 3SE0A 2WAQB 4CJ2C 4C3IG 2AQ1B 2JE6I 5BN5A 3D6WA 4WRDA 2F0TA 1EY8A 2EJGC 2EYOA 1PFNA 2Q8RE 3NTIA 2WV6D 2IX1A 4B9XA 2RDHA 1PTOC 5I9PA 1FD7D 4IUQA 1O7YA 2NVTB 5T1IA 5G3LD 3A7LA 2D62A 2DNCA 1MI2A 1A3VA 5IT9L 1TVXA 1PLFA 1C4QA 2B2WA 1MGSA 2PMZB 3RD4A 3NSWA 4NKLA 1LT5D 2NVYB 3O13A 4BBRB 4UAIA 1XWEA 1TY2A 4J1MA 1I4XA 1SAPA 5C0XH 5JVH3 1JR0D 2EYMA 1KTKA 3HRZC 3MXGA 4DAVA 3K58A 2FHTA 3IFTA 3S2HB 1LTRD 4ZQ3A 1PFMA 4DK1A 3SDZA 2EZVA 2BCOA 1I4HA 3S1MB 3VR3A 1LO5D 3I73A 2KQ3A 1ET6A 3K5NA 1F9RA 1KABA 2AUKA 2SNMA 3E5SA 4L8JA 1EY4A 3DWAA 4CJ0B 3Q0AA 1SJHD 5KGUA 2ZXOA 3GTGB 4DAYA 3NPPA 1QOHA 3U9SA 5E1FA 2HDMA 3HG9A 3UI2A 1PTOF 1O7ZA 2M9VA 3T4AC 4PQXA 4K5WA 1TY0A 5CC4A 3NE5B 1TWHB 4OHJA 1EZ8A 3GTQB 1BOSA 1A6XA 5T1GA 4FVMA 5D65A 3TSSA 4B08A 2MP1A 3TP7A 1QE6A 1BCPC 1KLUD 3K0YA 2JXMB 1SNQA 3ITPA 2JP1A 4KTAA 5CV6A 1O78A 1U9RA 3DM1A 4CKEA 1LTID 1KDCA 1QB5D 2RDGA 2IT1A 1WD1A 1B50A 1EU4A 2R61A 2KECA 5IGDA 3M4OB 4X3UA 1XTCD 3NBHA 5KNBA 2F0WA 3BYTB 5TSSA 1AZQA 1EFID 2SOBA 5EGTA 3S1RB 3C3LA 1GUNA 1Q1BA 3R8BA 5CV8A 2PQEA 1DZ1A 1WTVA 3MHBA 1AFPA 4XT1B 2K01A 4X3TA 4HMIA 3I72A 2AUJD 3D4WA 1S4ZA 3FMCA 2KEEA 1Y69U 5I2XA 2JA5B 2O5JC 3E6ZX 4KY7A 1E0BA 2A6HD 1JE4A 1VMPA 1SNPA 1XYIA 4OO1I 3RUZA 4HTHA 1AP0A 2BA0A 1JORA 2MUYA 3NQIA 2MPMA 3NK9A 3GTLB 3I8ZA 2AQ2B 2D9UA 2KVMA 5CR3A 4FYDA 1JC7A 1GUSA 4G7OC 1PTOB 4XYQA 2ICEC 3KLSX 4XT3B 3J7YW 1PMRA 1CM9A 4ZUJA 1PZKD 1RKNA 1V43A 3PMFA 2Q8TA 1PTOD 2E2HB 3I90A 2N55A 3S1QB 3HOZB 3CQZB 3A55A 1TIID 5EPKA 5DEHA 2NB0A 3QWNA 5A35A 5DM63 1OXTA 1H9KA 4IFDJ 1CFMA 3M7GA 1HPCA 4ZUIA 4ZRZA 1EZ6A 1VF7A 3CRLC 4DNRB 1DONA 3SK4A 2LY7A 3QB3A 1SYCA 2JEBI 1O7LA 1D5XC 3BZDB 1I4GA 3T53B 2CVRA 3W2DA 1CA5A 1VMCA 5EBCA 4QB4A 4JK1C 1U4RA 4HMJA 3HOXB 1WCMB 3HZXA 4C1NK 2G9HD 2PCFB 2B2YA 5CORA 1A3TA 1EEFD 1RHPA 1STGA 2RBMA 4R8IA 3GTKB 3FRPB 5COYA 2PYKA 1TS4A 3PV0A 3GQBA 2NUCA 3LX0A 1I4RA 2F0SA 1EYAA 2J0TD 4YIJA 3KBGA 3SK8A 1EQVA 4N9PA 4DNTB 3A54A 3IKJA 4DXGA 1VCIA 2L9HA 4OIKA 1FYCA 3K59A 4XQJA 4HN7A 1HCZA 1PRTC 1LLRD 2X69A 3WOEA 3OW7A 2E74C 1DD2A 3NP8A 2EVBA 2RSOA 3P20A 1PTOH 4N9TA 4EQNA 3GO5A 1EIHA 1C8CA 3HGBA 4PMCA 1T5EA 2TMPA 2A68C 5JEAJ 5C5LA 2AWNA 2IX3A 5FK9C 4G7HC 2YU9B 3BG3A 3K7AB 4TSSA 5I6WA 2KCCA 1BCPB 3OWEB 2EJMA 3FKIB 3EA6A 4BS9A 1E2WA 2R7ZB 3I70A 5C5MA 1IW7C 2M00A 3MZ5A 1KDBA 1BCPD 2GA4B 4K5VA 1I4PA 3OIQA 1RCVD 4O42A 4RGMA 1G8ZD 4F88A 1BUVT 1ENAA 1C48A 1YNNC 3HOYB 5I6YA 3H3VC 3EVQA 3BS1A 3A56A 4KKUA 2H4OA 4ZKBB 2F3WA 3ONAB 1S5FD 4RCOA 3RLFA 1PZID 3LNNA 1JWMD 3WOFA 5JOBA 3LWUA 5KNCA 2RKSA 1TT2A 1J8IA 3S9WA 1PRTF 4OGQC 5KIXA 2M2LA 4EQPA 4H0LC 3A8KE 5DNFA 1X32A 4I65A 4XTCS 3VR6A 5ELBA 4A3FB 3W3AA 2RSNA 3S14B 1QCBD 5EJWA 3K5OA 2B2WC 2XSCA 4ZK9B 3P1HA 1H9JA 4XQNA 1F2LA 1DJRD 1Q8IA 1Z7TA 3ND9A 2XRQD 3F2UA 2F0JA 5J1ZA 3T51B 2K5DA 3GTOB 5CV9A 1ZEQX 1LTTD 2NYZD 2RVLA 1HHVA 4TKOB 2H1EA 2F4IA 1QILA 1TS2A 1D1KA 1HXYD 2NN6G 1MD2D 4TQUS 2EJFC 3J81E 1BO0A 1M4VA 2VB2X 3DXJC 3AB9A 3DWQA 4RA8A 1MSHA 2B2VA 4Q5VA 4PMBA 4LK1C 4ZAIA 4IUNA 1D5MC 1X3PA 3ERQA 5IIFA 2MHVA 3H91A 4HEDA 3EROA 4OO1H 4ZKCB 1DM0B 1TWCB 1EY9A 2A69C 3N52A 3L3OC 1KAAA 1STHA 1WD0A 4IN3A 1PFBA 3PUVA 1B44D 1ESRA 4S3SA 5HURA 4XYOA 5K36G 2HCCA 4C3HG 4J8QA 4RCNA 1JICA 4ZYSA 4A3IB 1F2ZA 3PO3B 3BVMA 5E4XA 1FNWA 3SXHA 4RFBA 4RGOS 2D5DA 4HCEA 3NWTA 4G7ZC 5I2YA 3ND8A 2NWGA 1VF5C 4KV6A 4RKBA 3OSOA 2K03A 3OOCA 2R6GA 1BBXC 1IYUA 1STAA 1QNUA 2ID0A 4DU9A 5ELCA 1HFNA 1MBYA 1AW7A 5CBAE 2F0EA 2F0NA 1SNDA 2QCPX 1DXMA 3GTMB 2HUGA 2JEAI 1CZWA 3SHLA 1D2BA 3AU7A 1SDFA 1IW7D 4V0BA 1H9RA 1A2TA 3DEOA 1KNAA 4HSVA 5IGGA 3OMGA 3EQLC 2F3VA 1WVLA 1FGBD 2PW7A 3QIAA 1YNND 3GV6A 4R9WA 2K28A 1RTNA 4HR7B 1LT6D 3QOJA 4IALA 1B4OA 3JAME 5KYLA 3HS0C 3CHBD 2A5HA 2WP8J 4PV1C 1IKMA 3VA7A 5E4WC 2KUMA 3M7NA 2KJXA 3V2TA 2A6EC 1E2ZA 5M3FB 3NUCA 3K5MA 4ODGA 1ET9A 4DXFA 1OXSC 1WTXA 5C4XB 1G6ZA 3H09A 2F0LA 4IUPA 1Q12A 2F0KA 2K1BA 1TQOA 2ZXRA 1A15A 2KEDA 1SMYC 1Z6HA 5JJZA 5BN3A 5HGTA 5C0XJ 4JBWA 1ENFA 2O4XA 4QF4A 3J81L 3KBXA 4A3JB 2XN9C 1LACA 4IFDG 1SJED 2B2YC 2LS01 1I6VC 3KUPA 4KN4C 4MHEA 2JYOA 4K14A 1RD9D 1R9TB 1M8AA 3S17B 2KHSA 5M5WB 4C56C 2RQXA 3D8GA 3H94A 4CKBA 2EE1A 4DAPA 4FF1A 1B9MA 4ULLA 1HTPA 3K6OA 2B2UA 1EEID 1GOZA 5K5PA 3D6CA 2BE5C 1H9SA 1YNJC 1B1ZA 3VR4A 2NN6I 3A8JE 1VDZA 4H7BA 2JA8B 2K5WA 3HOWB 4G4KA 1SNMA 1ZKOA 2I07B 1G2TA 1PZJD 1V1PB 4U68A 3OPOA 1RJTA 2BOSA 4DGZA 1SE3A 3A8IE 5JEAG 4WORA 2WB1B 3D3RA 1S5BD 1E2VA 2Z4IA 2FFKB 3GTPB 5ELFA 1KNEA 3TZDA 1U4PA 3ZYYX 1SSOA 1F9QA 3MTSA 4LMQD 2OT2A 2D2CC 3KK7A 2WINB 2WKDA 4ILWA 1OXUA 4FF2A 5CBEE 1B2TA 1GUTA 2Z8LA 2ZXPA 1D1IA 2RA4A 5EBDA 5FO9B 4Q0FA 1ONLA 1HFGA 1QG7A 1EU3A 1SYGA 4XQQA 4BBSB 3JAML 1CI3M 1HUMA 3HKZB 5JPMC 4KY6A 1EY5A 1IYVA 1D5ZC 4V190 3PUZA 1PDQA 1PYWD 1TU2B 1WTPA 3FPPA 4Y7NB 2V4DA 1T5XD 1JWUD 4CBVA 3KLRA 4DN4M 1HUNA 3QG1A 1GUGA 1EL0A 2IWHA 4OIJA 1CT1D 1EY7A 2QEJC 1G291 1A2UA 1EOTA 1LTAD 3C1EA 2FJ2A 2K04A 3BDLA 2DNEA 1A3UA 3X3MA 1XX8A 2A6ED 1X3QA 2EYJA 4MN3A 5C4HA 2L5TA 1SE4A 2JSOA 3QJYA 1EQTA 3BVZA 1STBA 1GHKA 1ZYRC 2Y0SB 1CZGA 3DWPA 2HCIA 4XDXA 3DHQA 2B2VC 5J39A 4ZLTF 1TS3A 3TZUA 4K2KA 2EYHA 2MGSA 2XWBB 3S16B 5FKAC 1WTWA 2X6GA 1AZPA 1ZXTA 3PIP3 4RH6A 1SMYD 3VYRA 1JQYD 2KA7A 2EOTA 1IL8A 4U673 2YYZA 2FINB 5F2DA 2EDGA 2IJ0A 3CKIB 1H9MA 2IX0A 2K05A 3T13A 1BF4A 5IGCA 1QJOA 1JOQA 1Q1EA 3NTKA 1HQRD 2E2IB 3DUZA 2EYPA 4F7XA 2QKIC 3SVMA 4RGNA 1ICWA 1SEBD 2CW0C 4EVOA 1BQQT 2SEBD 2XRSD 2OF1A 4KKTA 1QNKA 2CHBD 3VR2A 2PPBC 2QILA 4HCSA 2HQEA 2ZT9C 1LABA 1LV9A 2BE5D 2PZWA 3D4DA 4HSPA 1YNJD 2VB3X 1LTBD 2N88A 1WTRA 5C44B 4IURA 3WDNA 3VYSA 2EY1A 1SNOA 1EYCA 4L6TB 1SYBA 1NSNS 3RZDB 4C3IB 5C4JB 1I50B 5IGEA 3HP3A 3K5LA 1K83B 4CKCA 1JCKB 4E6IA 4WJWA 3MC0B 2E2JB 4FXKC 3TBIB 4FNFA 3BVGA 4KMUC 5J22A 5EKIA 4DK0A 4NMZA 3Q22A 1F9SA 4C2MB 5AFWA 3BDCA 4H13C 2SDFA 4FXGC 3TDQA 1IKLA 2NN6H 2F0OA 4FP5D 5I9OA 2XIWA 4C3JG 1OXXK 1ENCA 4BA1I 1KDAA 1LTGD 1U4MA 3MFGA 4F87A 1DYQA 5LHY1 3FEWX 2LFNA 1F77A 4XXEA 4KJOA 2B8FA 2K32A 1F9PA 3V96A 1Q3LA 2A6HC 2XNAC 3PO2B 2F0VA 2B2TA 1JOOA 2I46A 1Y8NB 3D4RA 1HQMC 1PRTB 5ISRA 4J6HA 2NVXB 2E76C 4KHZA 5KRUA 4B9WA 1F2YA 4LJZC 4OL7A 5JVG3 1HTLD 1KLGD 1PRTD 1J9OA 3K57A 4P2CB 3NWSA 5K36H 2MJ8A 1WTQA 2X6LA 2Q8IB 2B8GA 4KKSA 1W6KA 1ML0D 2A68D 3SR1A 4EGVA 1EYDA 2EYLA 3A7AB 2C9OA 5C0XG 2HDLA 2OXPA 1ZYRD 3LWEA 4M1UB 4BA2I 4BY7B 4CGYB 2EY2A 2F0DA 1JWSD 1B3AA 1U4LA 1LTSD 1GHJA 1XXGA 5C6AA 2B2UC 5CV4A 3KLSA 1ESFA 4X3KA 4FF4A 3T16A 2F0IA 1TKWB 2L12A 3OMCA 1MSGA 3CRKC 4RHRA 1W6JA 2K5QA 4QUCA 4KK7A 1ILPA 3HOVB 5CV5A 3J7AV 1DOKA 1EIGA 2AQ3B 1UNSA 2EXZA 4A3GB 5EKLA 3BYYB 2IPKD 1S5DD 3VYTA 3MFYA 2KOLA 3RMHA 4G57A 1BNZA 1S5ED 2B63B 2CW0D 3SEBA 4K6DA 1L0YB 1GUWA 5M5XB 1GJXA 1R4PB 3S15B 2E2DC 5ELDA 1UUPA 2IL8A 5BN4A 1GUOA 2BDNA 1OXVA 5JPNC 3AMUA 3GP7A 1EY6A 5IODA 3M85A 5D3DA 2OEOA 1TWGB 1Y1VB 3NXWA 2IW3A 3PUYA 1FNUA 2CQAA 1EWHA 1EY0A 1V1PA 3FDTA 5C4ZA 2E75C 2BDOA 2NZ1D 3GD7A 2BA1A 4K8IA 4K2LA 2DY7A 3C1FA 5M9OA 4IUTA 5I4DA 3URYA 4WFN3 3OWFA 2EY5A 3MWYW 3TP8A 1GXDC 1CQFA 1RF2D 4IZ8A 5FOBB 4IFDH 1BR9A 2NVQB 3FVQA 3X3NA 4DF7A 3I4LA 1STEA 1K8MA 3H6MA 3TN2A 3N6RA 1RODA 2F0MA 1BDOA 5CMDA 1B53A 4ME5A 5EQ0A 4A3DB 3MEHA 1BXTA 2A74C 5DM73 2A69D 5C3WA 1NAPA 1SYDA 1Q90A 1SXTA 3L7ZC 1Y8OB 2WKCA 2VNUD 4QMGA 4FXDA 3G7LA 3R3OA 1JOKA 2Z1CA 3VYUA 2F1MA 1STNA 4HAEA 3DEPA 2LMCB 1SE2A 1SNCA 2ICIA 5IGFA 3NHHA 3DMUA 2R3ZA 1Y8PB 2F0UA 1NR2A 3D31A 5C3EB 1OO9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDL A;  2L1B A;  3GV3 A;  2RA4 A;  5COY A;  3D6W A;  1WVL A;  4X3S A;  3LWE A;  1E0B A;  1JE4 A;  1VMP A;  3GV6 A;  1PFN A;  3N52 A;  4R9W A;  1XYI A;  2K28 A;  2EOT A;  2Q8R E;  1AP0 A;  1HFG A;  1IL8 A;  1O80 A;  1RTN A;  1QG7 A;  1B4O A;  1B3A A;  2HDM A;  1WD0 A;  1J8I A;  1PFB A;  2EE1 A;  2FIN B;  5D14 A;  5EKI A;  3FDT A;  3UI2 A;  2L9H A;  1U4L A;  2MPM A;  4OIK A;  1HUM A;  2NZ1 D;  2M2L A;  2B2U C;  1O7Z A;  1ESR A;  1F9S A;  3I8Z A;  1O7Y A;  4IUQ A;  5AFW A;  2X69 A;  4X3K A;  2D9U A;  2B2U A;  2SDF A;  2KVM A;  5DNF A;  1X32 A;  5T1I A;  1IKM A;  4RWS C;  5E4W C;  1IKL A;  1NR4 A;  2K05 A;  2DY7 A;  1BF4 A;  2FMM A;  1PDQ A;  2HCC A;  1CA6 A;  1ILQ A;  1WTP A;  2KUM A;  2L12 A;  2RSO A;  4IUT A;  1JIC A;  1DOM A;  2XIW A;  3R93 A;  4RAU C;  1MI2 A;  1G91 A;  3MWY W;  5T1G A;  5D65 A;  1MSG A;  1DOL A;  2MP1 A;  2RSN A;  5E4X A;  1QE6 A;  1TVX A;  1EIH A;  1C8C A;  1PLF A;  5EJW A;  4DN4 M;  3SVM A;  4XT3 B;  2B2W C;  1U4M A;  1G2S A;  1HUN A;  5EPL A;  4QUC A;  1ICW A;  4ZK9 B;  1CM9 A;  4IUU A;  1RTO A;  1EL0 A;  2B2W A;  1HA6 A;  1ILP A;  1MGS A;  4OIJ A;  1F2L A;  1DOK A;  1WTX A;  1EIG A;  3QO2 A;  2Q8T A;  2JP1 A;  3F2U A;  1F9P A;  1EOT A;  2N55 A;  3I90 A;  4UAI A;  3TN2 A;  1Q3L A;  2NWG A;  2FJ2 A;  1WTO A;  1G2T A;  1ROD A;  1HRJ A;  5CMD A;  1QNK A;  3FPU B;  5EPK A;  2B2T C;  1SAP A;  2K03 A;  3DM1 A;  1B53 A;  1G6Z A;  5EQ0 A;  2K04 A;  4HCS A;  4QUF A;  2B2T A;  4U68 A;  1BBX C;  1RJT A;  1LV9 A;  4IUP A;  2NYZ D;  1WD1 A;  1NAP A;  1B50 A;  2RVL A;  1XX8 A;  1HHV A;  2KEC A;  3I3C A;  2K1B A;  1X3Q A;  2KOL A;  1NCV A;  2H1E A;  3IFD A;  4MN3 A;  1HFN A;  2N88 A;  5CBA E;  4X3U A;  1WTR A;  2FHT A;  2FFK B;  2L4N A;  1DON A;  2EPB A;  3G7L A;  1BNZ A;  1A15 A;  1PFM A;  4IUV A;  4O42 A;  1EQT A;  2KED A;  3P7J A;  2HUG A;  1AZQ A;  5JJZ A;  1KNE A;  3TZD A;  4IUR A;  4CJ1 B;  1J9O A;  2L11 A;  1GUW A;  1U4P A;  3IL8 A;  2CVR A;  1CA5 A;  4HAE A;  1BO0 A;  1SSO A;  1F9Q A;  1VMC A;  2HCI A;  2MJ8 A;  3KBX A;  3DEP A;  3MTS A;  4LMQ D;  1DZ1 A;  4XDX A;  5EPJ A;  1WTV A;  1WTQ A;  1U4R A;  2X6L A;  2B2V C;  2IL8 A;  2VXW A;  4XT1 B;  4RA8 A;  2BDN A;  1MSH A;  4ZLT F;  2B2Y C;  2B2V A;  2K01 A;  4X3T A;  1SDF A;  4ZAI A;  2B2Y A;  5COR A;  3KUP A;  3HP3 A;  2MGS A;  3DEO A;  4MHE A;  1X3P A;  1KNA A;  2R3Z A;  4HSV A;  2J7Z A;  1F9R A;  1RHP A;  2JYO A;  1ML0 D;  3H91 A;  4ZKB B;  2DY8 A;  4HED A;  1S4Z A;  1M8A A;  3ONA B;  2X6G A;  5CBE E;  1NR2 A;  4R8I A;  4CJ2 C;  1WTW A;  1AZP A;  1B2T A;  2KEE A;  4CJ0 B;  1ZXT A;  4ZKC B;  4NW2 A;  3Q6S A;  3I91 A; 
#chains in the Genus database with same CATH topology
 3GV3 A;  1SYE A;  3SK6 A;  4R8N A;  4X3S A;  2UXB L;  4TRD A;  4DV7 L;  1BCP F;  2F0G A;  1YEZ A;  4KI0 A;  2A19 A;  4A3K B;  5D14 A;  3MXU A;  1UAP A;  5FLX E;  5IWA L;  2JA7 B;  4LF4 L;  3U9O A;  3T1H L;  5JEA H;  4AYB E;  2F0H A;  5LL6 S;  3MA2 B;  3T1Y Q;  4KN7 C;  2FMM A;  2PO4 A;  1I94 Q;  1HA5 A;  4EQO A;  1CHQ D;  3J80 E;  1M90 C;  4LF5 Q;  4LF8 Q;  3U4V A;  4RAU C;  3M4O H;  1G91 A;  1Z9F A;  1VQA A;  1X3E A;  2NVQ H;  1SBB B;  4GZY C;  3E9H A;  5M5Y B;  4DA2 A;  5CGK A;  5LMU L;  5GRO A;  4LAA A;  5GAG C;  1RTO A;  4K0K Q;  1HA6 A;  1Z47 A;  3TP6 A;  3S1R H;  2EY6 A;  2B29 A;  1H9S B;  4DR1 L;  1V9P A;  4RG1 A;  1HRJ A;  2LKV A;  4A3D H;  5FLM G;  1IHZ A;  2B39 A;  5C3X A;  1J6Q A;  3NTH A;  4P74 A;  1HNZ L;  4BXX G;  1KQS A;  2JA8 G;  4PMW A;  3R2I A;  2C5C A;  2NTS A;  3EIV A;  1EIY B;  3J7A F;  3HOW G;  4NDX A;  4QIW B;  3P75 A;  3I3C A;  3STB C;  2PZT A;  1CTM A;  1DCZ A;  4IQZ A;  3HOU B;  5ELN A;  3BDO A;  5C0X I;  5NUC A;  2L4N A;  4B3T L;  1VQO A;  2EPB A;  4A3B B;  4IUV A;  1M1K C;  2JA5 H;  3ULP A;  1S5C D;  4AYB B;  1W3S A;  2MO1 A;  3IL8 A;  1I3Q B;  2WB1 G;  1I6H B;  3NBI A;  5D3I B;  5A2Q E;  4A3L G;  4JI6 L;  3EFX D;  4OWX B;  1VQP A;  3GTL H;  1LM0 A;  3CME A;  4DR7 Q;  2KCN A;  4JI3 L;  4GOP A;  3A5U A;  4BY1 B;  2FMC A;  1LT4 D;  2K6A A;  4GKK Q;  1RDP D;  3F8T A;  1VQ5 A;  1YHQ A;  1II3 A;  2RCF A;  4KJN A;  4YCV A;  3T56 B;  1E1O A;  1KAW A;  3Q6S A;  3J7A 5;  4Z9C B;  1AN8 A;  1WYD A;  2L1B A;  5JAV A;  2DN8 A;  4BWG B;  2JA6 B;  1V1O A;  4A3K H;  3RNU A;  3GTJ B;  3C2P A;  3OHX C;  2JA7 H;  5LMN L;  1O80 A;  2N49 A;  1NMG A;  2WAC A;  2UXC Q;  1FNV A;  3QOL A;  2F0P A;  2E2H H;  3M4Y A;  2XVS A;  3HOZ H;  3CQZ H;  2A1A A;  3MXP A;  4I7Z C;  1STY A;  2L0C A;  5BR8 Q;  1WCM G;  2PZU A;  3PIO 3;  1CA6 A;  4KY5 A;  2QF7 A;  1ILQ A;  4BBS G;  4A3E B;  5H1S E;  1UEB A;  3HKZ G;  2NBF A;  5IT9 E;  4M8A A;  1DOL A;  2PW5 A;  4P71 A;  2CFM A;  3TME A;  3PUX A;  1G2S A;  3OIP A;  2N78 A;  5FO7 B;  4DR3 Q;  1IBM Q;  5AJ3 L;  3I2Z A;  3QO2 A;  4PNY A;  1JT8 A;  4K6L A;  3MXN A;  1WTO A;  4OWT B;  4MTN A;  4B3M Q;  4JV5 L;  1F2M A;  3FPU B;  2B2T C;  1B9N A;  1X55 A;  1TWA B;  4KD3 A;  3Q24 A;  1EQR A;  2MFI A;  3CU7 A;  3RZO B;  3HOU H;  5LL6 X;  5KND A;  1K3R A;  1NCV A;  2R93 B;  3EJI A;  3GTK H;  1TR5 A;  3C46 A;  3CCM A;  1SLJ A;  4POG A;  3P7J A;  1UWV A;  2I5L X;  3R2T A;  2UUC L;  5EKK A;  4IFD I;  4XIG S;  1NUC A;  1WFQ A;  3PUW A;  5KEE A;  4UDU C;  3MVV A;  4C1N I;  3I56 A;  4OEM B;  2R92 B;  3L2P A;  4K8J A;  3CCQ A;  5FO8 B;  1GKH A;  4K5X A;  1EWC A;  4QGU A;  2A73 B;  2O5I C;  1SFO B;  4BY1 H;  1CHP D;  2XWJ B;  4DV1 L;  1PVO A;  2ATW A;  1R4Q B;  4C3J B;  2MNA A;  1X56 A;  2J7Z A;  1P16 A;  2AWO A;  5G3L F;  2EQS A;  4RGT A;  1TS5 A;  1W2B A;  4NW2 A;  1VQD A;  1PXU A;  3I91 A;  3IAY A;  1K8O A;  1B70 B;  3Q23 A;  2VY3 A;  4H44 C;  2QDB A;  4DV2 L;  3M9B A;  4CHT B;  2NTT A;  3VR5 A;  4KHV A;  2PNR C;  3MAQ A;  5CV7 A;  1SYF A;  1TWF B;  4C3H B;  2YU9 H;  4UP7 A;  5FLX L;  1QUQ A;  3K7A H;  1HNX L;  3VA5 A;  3PF4 A;  4KD4 A;  4JBJ A;  5KYI A;  4A3E H;  4RWS C;  4RKL A;  1NR4 A;  1MKH A;  2YTX A;  2J4X A;  3KF6 B;  3S1N B;  4KHP Q;  2F0F A;  4JI5 Q;  4FO2 A;  4QCL A;  3HEJ A;  4O1N A;  3J80 L;  3SK5 A;  1DOM A;  2RDF A;  3R93 A;  3G6J B;  2TSS A;  2F0Q A;  1X6O A;  4ID6 A;  2K33 A;  1CQV A;  1NTG A;  1AEX A;  5IGB A;  5IOC A;  4F8M A;  1RIP A;  3NQT A;  4MIU A;  2F03 A;  4LUZ A;  3H0G B;  5EPL A;  4IUU A;  1QWY A;  4L63 B;  1HZB A;  4OO1 G;  2EYF A;  2HHH L;  2WAQ E;  3HOY H;  3J81 i;  2Z4H A;  2L55 A;  3CPW A;  3E0J A;  1D6E C;  1JB3 A;  3UDG A;  3RZO H;  1Y1W B;  4QUF A;  4DFA A;  5M3M B;  3I4N B;  5DAU A;  1AH9 A;  3ULL A;  4A93 B;  4NP5 A;  3IFD A;  3M3Y B;  2WII B;  4FF3 A;  2ENB A;  2K7V A;  3I4M B;  1LT3 D;  3CCU A;  2G9D A;  1QVG A;  3V05 A;  3TP5 A;  1UEA B;  3KJO A;  4NPS A;  3K8A A;  4A3M B;  4UY8 C;  3KF8 A;  2F4V Q;  4CJ1 B;  3L9A X;  2R92 H;  1I5F A;  2L11 A;  3KJP A;  4DUZ L;  4RHS A;  1K73 C;  3S2D B;  3OYY A;  1FR3 A;  5CYU A;  1V8Q A;  1SFO H;  5EPJ A;  5IP9 H;  1L0X B;  5A2Q L;  2VXW A;  5C44 G;  2VUM B;  4C3J H;  1I4Q A;  3AYH B;  2ZJR A;  2O2L D;  5E3F A;  2SNS A;  2PMZ E;  4ABN A;  3VDY A;  2XGT A;  1CK1 A;  2DY8 A;  1Q46 A;  5ELE A;  3SE0 A;  2WAQ B;  4CJ2 C;  4DV4 Q;  4A3F H;  2PQA B;  1HH2 P;  4C3I G;  2AQ1 B;  2JE6 I;  1FJG L;  5BN5 A;  3D6W A;  2UUA L;  4WRD A;  4OXP A;  2F0T A;  1EY8 A;  2EJG C;  2EYO A;  1XMO L;  1PFN A;  2Q8R E;  3NTI A;  2WV6 D;  2IX1 A;  3CW2 C;  4B9X A;  2RDH A;  1PTO C;  5I9P A;  1FD7 D;  4MTK A;  2LXK A;  4QJF A;  4IUQ A;  1O7Y A;  3S1N H;  2VQE L;  2NVT B;  5T1I A;  4RMF A;  5G3L D;  3A7L A;  2D62 A;  1EYG A;  1MHW C;  2DNC A;  1MI2 A;  1A3V A;  1WI5 A;  5IT9 L;  1TVX A;  1NE3 A;  1PLF A;  1C4Q A;  2K50 A;  2B2W A;  2JJQ A;  4YY3 Q;  2Z0S A;  4JI7 L;  1MGS A;  2PMZ B;  3RD4 A;  3NSW A;  4NKL A;  3KDF B;  3O13 A;  1LT5 D;  2NVY B;  4UAI A;  4BBR B;  1XWE A;  1GM5 A;  4OWW B;  4R4T A;  4UP8 A;  5IYD G;  1TY2 A;  2RCN A;  4J1M A;  4QL5 A;  1I4X A;  1SAP A;  2V1C C;  3W5O A;  5C0X H;  4A93 H;  5HY6 A;  5JVH 3;  1JR0 D;  2EYM A;  3L0O A;  1K3B C;  1KTK A;  3HRZ C;  1FGU A;  3MXG A;  4DAV A;  1S72 A;  3PO2 G;  3K58 A;  4B3S Q;  2FHT A;  3IFT A;  4A3M H;  1XMQ Q;  1JB7 A;  3S2H B;  1LTR D;  4ZQ3 A;  1PFM A;  1TWC H;  4X65 L;  4DV6 Q;  1SE8 A;  2Z9H A;  3TEH B;  1QVC A;  3DM3 A;  2VUM H;  1EFW A;  4DK1 A;  3SDZ A;  1X9N A;  2UU9 Q;  2EZV A;  3JAM i;  2BCO A;  1I4H A;  3S1M B;  2R7F A;  3VR3 A;  4NXM Q;  4O2D A;  1LO5 D;  1YHA A;  2LXJ A;  3J81 c;  3I73 A;  3CC2 A;  2HHH Q;  2KQ3 A;  1ET6 A;  3K5N A;  1F9R A;  1KAB A;  2AUK A;  2SNM A;  3E5S A;  4L8J A;  4AQY Q;  4JI2 L;  4QY7 A;  1EY4 A;  3DWA A;  4CJ0 B;  3Q0A A;  3CCL A;  1SJH D;  1N34 L;  5KGU A;  1AE3 A;  2JQO A;  2ZXO A;  3GTG B;  4DAY A;  3NPP A;  1QOH A;  5HGQ A;  4LWC A;  4GKJ L;  3U9S A;  4GLA C;  2PNH A;  1PH1 A;  3WWV A;  5E1F A;  2HDM A;  3UE0 A;  3CCS A;  3HG9 A;  3UI2 A;  1PTO F;  1S3O A;  4DR4 Q;  1VQ8 A;  2Q2H A;  1MJC A;  1O7Z A;  3BZC A;  2M9V A;  3T4A C;  5IYC H;  4PQX A;  4K5W A;  4JI8 Q;  1MIU A;  1TY0 A;  5CC4 A;  3NE5 B;  1TWH B;  1PH2 A;  4OHJ A;  1EZ8 A;  3GTQ B;  1BOS A;  3PCO B;  1A6X A;  4MNO A;  5T1G A;  4FVM A;  5D65 A;  3TSS A;  4B08 A;  3BU2 A;  2MP1 A;  3TP7 A;  1QE6 A;  1YVC A;  2ZTC A;  1BCP C;  1KLU D;  4IPC A;  4O0A A;  3K0Y A;  1EWI A;  2KHJ A;  2JXM B;  2NVY H;  3M4P A;  4BBR H;  4IJL A;  2GVB A;  3CXC A;  1SNQ A;  2K4K A;  3ITP A;  3CC7 A;  3OTO L;  1L1O A;  2JP1 A;  4KTA A;  5CV6 A;  3F2D A;  4HJ8 A;  2I0Q A;  1O78 A;  1U9R A;  3DM1 A;  4CKE A;  1LTI D;  4HIM A;  3HOV G;  1KDC A;  1QB5 D;  2RDG A;  2IT1 A;  1WD1 A;  1B50 A;  1EU4 A;  2R61 A;  2KBN A;  2KEC A;  5IGD A;  3M4O B;  1PH6 A;  1YIJ A;  1B7Y B;  2HT1 A;  4A3G G;  4X3U A;  4X66 Q;  1XTC D;  3NBH A;  5KNB A;  2F0W A;  3BYT B;  5TSS A;  1L0W A;  1AZQ A;  1EFI D;  2SOB A;  3NEL A;  5EGT A;  5M3F G;  3S1R B;  3C3L A;  1GUN A;  1Q1B A;  3R8B A;  5CV8 A;  3S1M H;  2PQE A;  1DZ1 A;  1JJG A;  1WTV A;  3A0J A;  3MHB A;  1AFP A;  4XT1 B;  2OQK A;  1VQH A;  2WB1 E;  4GS3 A;  4GOP C;  2K01 A;  4X3T A;  4HMI A;  2RHS B;  3F1Z A;  3I72 A;  3NEN A;  2AUJ D;  3D4W A;  2PI2 A;  1S4Z A;  3FMC A;  2KEE A;  1Y69 U;  5L37 A;  3GTG H;  5JJI A;  5I2X A;  2JA5 B;  2O5J C;  3E6Z X;  4KY7 A;  1E0B A;  2A6H D;  2OTJ A;  1JE4 A;  1VMP A;  4JW0 A;  2E5L Q;  1SNP A;  3ICE A;  1XYI A;  4OO1 I;  3RUZ A;  4HTH A;  1AP0 A;  2BA0 A;  4JI4 Q;  1JOR A;  1NBW A;  4JOI A;  2MUY A;  4X62 L;  3NQI A;  4JI0 Q;  1Y1V G;  2MPM A;  5C4X H;  3NK9 A;  4GLX A;  3GTL B;  3PIO A;  3I8Z A;  4PZ8 A;  2AQ2 B;  2D9U A;  2ES2 A;  2KVM A;  4LFA Q;  5CR3 A;  3JAM c;  4FYD A;  4EQ5 A;  1JC7 A;  1GUS A;  4G7O C;  1PTO B;  4XYQ A;  2ICE C;  1BKB A;  3KLS X;  4YWK A;  4XT3 B;  5IP7 H;  3J7Y W;  3HKZ E;  1PHJ A;  1PMR A;  2MQH A;  3PF5 A;  1CM9 A;  4ZUJ A;  1PZK D;  4QQB X;  4LW1 A;  1RKN A;  1XJV A;  1V43 A;  3PMF A;  1YJN A;  1CKM A;  2Q8T A;  1PTO D;  3UDX A;  4A3J H;  2E2H B;  3I90 A;  2VZA A;  2N55 A;  5IYB H;  3S1Q B;  3HOZ B;  3CQZ B;  1N34 Q;  3A55 A;  1TII D;  5EPK A;  5DEH A;  2NB0 A;  3QWN A;  5A35 A;  3KYH C;  5DM6 3;  1OXT A;  4LF7 L;  1CKO A;  1H9K A;  4Y52 H;  4IFD J;  1CFM A;  3M7G A;  1HPC A;  3TQY A;  4ZUI A;  1BBU A;  4ZRZ A;  1EZ6 A;  3S17 H;  1VF7 A;  3CRL C;  4DNR B;  1DON A;  3SK4 A;  1XNR Q;  4IPG A;  2LY7 A;  3QB3 A;  2OCE A;  1SYC A;  2JEB I;  1O7L A;  1D5X C;  3BZD B;  1I4G A;  3T53 B;  2CVR A;  3W2D A;  1CA5 A;  1VMC A;  5EBC A;  5ELO A;  4QB4 A;  4JK1 C;  1U4R A;  4HMJ A;  3HOX B;  2HD3 A;  1WCM B;  3M4Q A;  3HZX A;  4C1N K;  2G9H D;  2PCF B;  2B2Y A;  4DUY L;  5COR A;  3J81 j;  1A3T A;  1K8G A;  1EEF D;  4LF6 L;  1RHP A;  1STG A;  3OTO Q;  2RBM A;  2KCM A;  2B3G A;  3MEF A;  4R8I A;  4CDC C;  3GTK B;  3FRP B;  2K5N A;  5COY A;  2PYK A;  2K5V A;  1TS4 A;  4AH6 A;  4YWL A;  3PV0 A;  4JC0 A;  3GQB A;  2NUC A;  3LX0 A;  1I4R A;  2F0S A;  4BXX H;  1EYA A;  3AFP A;  2J0T D;  3ER0 A;  4YIJ A;  1C7Y A;  3KBG A;  3SK8 A;  1EQV A;  4N9P A;  4DNT B;  3A54 A;  5C3E G;  3IKJ A;  4DXG A;  1VCI A;  2L9H A;  4OIK A;  4DV3 L;  1FYC A;  3K59 A;  4XQJ A;  4B3R Q;  1N32 L;  4HN7 A;  1HCZ A;  1PRT C;  1LLR D;  2X69 A;  3WOE A;  1NJI C;  3OW7 A;  3RLN A;  1UE1 A;  2E74 C;  1DD2 A;  3NP8 A;  2EVB A;  4GLV B;  4GN5 A;  2RSO A;  3P20 A;  1PTO H;  3CCR A;  4N9T A;  4JI1 Q;  2VQF L;  4EQN A;  3GO5 A;  3OW2 A;  1WTH A;  1EIH A;  1C8C A;  3GTP H;  3HGB A;  2N3S A;  4DR2 Q;  4NXN Q;  4A3L H;  4PMC A;  1T5E A;  4DK6 C;  2TMP A;  2A68 C;  2JN4 A;  5JEA J;  5C5L A;  2AWN A;  3S1Q H;  2IX3 A;  5FK9 C;  4P72 A;  4G7H C;  1A62 A;  1JJC B;  1N36 Q;  2UXD L;  2YU9 B;  3BG3 A;  1IBL L;  3K7A B;  4TSS A;  3CPF A;  1SN8 A;  5I6W A;  2KCC A;  1BCP B;  3OWE B;  2D0O A;  2EJM A;  3FKI B;  3EA6 A;  4BS9 A;  1E2W A;  1N33 Q;  2R7Z B;  3I70 A;  5C5M A;  1IW7 C;  2M00 A;  1UE5 A;  3MZ5 A;  4DV5 L;  4GN4 B;  1KDB A;  3E3X A;  1BCP D;  1GD7 A;  2ZTE A;  2GA4 B;  4K5V A;  1I4P A;  5E7N A;  2IY5 B;  3OIQ A;  1RCV D;  4O42 A;  4RGM A;  1G8Z D;  4F88 A;  1BUV T;  1ENA A;  1C48 A;  3W1B A;  2ZM6 Q;  1YNN C;  3HOX H;  2YTY A;  3HOU G;  1WCM H;  3HOY B;  2UXB Q;  3RR5 A;  3U4Z A;  5I6Y A;  4DV7 Q;  4A3B G;  1A0I A;  3H3V C;  4BBS H;  4HIO A;  3EVQ A;  3BS1 A;  4AYB G;  3KF6 A;  3GDE A;  3D0F A;  1LTL A;  3A56 A;  4KKU A;  5IWA Q;  4HJA A;  4LF4 Q;  4A3C H;  2H4O A;  4ZKB B;  3T1H Q;  2F3W A;  3ONA B;  1S5F D;  4LFB L;  4ALP A;  4RCO A;  1PZI D;  3RLF A;  3LNN A;  1VQJ A;  1JWM D;  3WOF A;  5JOB A;  1KD1 C;  1XNQ L;  3LWU A;  3CP0 A;  3TRE A;  2CQO A;  3H3V I;  4BY1 G;  2N8N A;  3BZK A;  5KNC A;  1H95 A;  2RKS A;  5LMU Q;  1TT2 A;  1U5K A;  1J8I A;  3CC4 A;  3S9W A;  1PRT F;  2JA6 G;  4OGQ C;  2Y0S G;  5KIX A;  2M2L A;  4EQP A;  4H0L C;  3A8K E;  5DNF A;  1X32 A;  4DR1 Q;  1E22 A;  4DK3 C;  4I65 A;  1PYS B;  4XTC S;  3VR6 A;  2BH2 A;  5ELB A;  1HNW L;  1HNZ Q;  1KRS A;  4A3F B;  3W3A A;  1PH3 A;  2RSN A;  4PZ6 A;  3S14 B;  5JJL A;  1QCB D;  5EJW A;  3K5O A;  2B2W C;  2XSC A;  1KL9 A;  4ZK9 B;  3P1H A;  4A3E G;  1H9J A;  4XQN A;  1F2L A;  4B3T Q;  3AEV A;  1DJR D;  1Q8I A;  1Z7T A;  3ND9 A;  2XRQ D;  3F2U A;  3I55 A;  3FKI H;  2F0J A;  1FVI A;  5J1Z A;  2QGQ A;  3T51 B;  4LF9 L;  2K5D A;  2R7Z H;  1IBK L;  3GTO B;  4DR6 L;  5CV9 A;  4JI6 Q;  3CMA A;  2Q2U A;  1ZEQ X;  2NYZ D;  1LTT D;  2E8G A;  2RVL A;  1HHV A;  4L5S A;  4KLK A;  3MXN B;  4TKO B;  2H1E A;  3S16 H;  4JI3 Q;  2ZJQ A;  2F4I A;  1QIL A;  1TS2 A;  1D1K A;  1HXY D;  2NN6 G;  1MD2 D;  2NZO A;  2QA4 A;  4TQU S;  2EJF C;  4OX9 L;  2R93 G;  3J81 E;  1BO0 A;  2GVA A;  1A63 A;  1M4V A;  1CKN B;  2DUD A;  2VB2 X;  3AB9 A;  3DWQ A;  3DXJ C;  4RA8 A;  1MSH A;  5LMN Q;  2B2V A;  4Q5V A;  4PMB A;  4LK1 C;  4ZAI A;  4IUN A;  4IO9 A;  1D5M C;  1X3P A;  3ERQ A;  5IIF A;  2MHV A;  2R92 G;  3H91 A;  2ZTD A;  1B8A A;  4X64 L;  4HED A;  2CH4 W;  3ERO A;  4OO1 H;  4LFC L;  1Q82 C;  3PSI A;  4ZKC B;  2E2I H;  1DM0 B;  1TWC B;  1AE2 A;  1EY9 A;  2A69 C;  5GQO A;  4PZ7 A;  3KDF A;  1HJP A;  3L3O C;  1KAA A;  3N52 A;  1K0S A;  1STH A;  1WD0 A;  4IN3 A;  1PFB A;  3PUV A;  1B44 D;  3STB D;  1KC8 C;  1NY4 A;  1ESR A;  4S3S A;  5HUR A;  3FP9 A;  5AJ3 Q;  4DKA C;  1BBW A;  4XYO A;  1XPU A;  5K36 G;  4JV5 Q;  2HCC A;  4C3H G;  4J8Q A;  4RCN A;  1JIC A;  4ZYS A;  1QUQ B;  3S14 H;  4A3I B;  1F2Z A;  3PO3 B;  4JBK A;  3BVM A;  5E4X A;  5FJ8 G;  1FNW A;  5C44 H;  3SXH A;  4RFB A;  5GAD C;  4RGO S;  1L1O C;  1KRT A;  2D5D A;  1X65 A;  4HCE A;  3NWT A;  4G7Z C;  5I2Y A;  3ND8 A;  2WFW A;  2NWG A;  1VF5 C;  3KOJ A;  4KV6 A;  4RKB A;  2UUC Q;  3GTO H;  3OSO A;  3H0G G;  2K03 A;  1QZG A;  3UDI A;  3RZD H;  3OOC A;  4R4O A;  1VQF A;  4C3I H;  2R6G A;  1BBX C;  3HFZ B;  5EAY A;  5C4J H;  1IYU A;  1I50 H;  1STA A;  1QNU A;  4HID A;  1K83 H;  1J5E L;  2ID0 A;  4DU9 A;  4DV1 Q;  5ELC A;  1HFN A;  1MBY A;  1AW7 A;  2Q2I A;  2F0E A;  3BJU A;  5CBA E;  2AHO B;  2F0N A;  1Y1W G;  1SND A;  2QCP X;  5M3M G;  1DXM A;  3CCJ A;  3GTM B;  2HUG A;  3I4N G;  2JEA I;  1CZW A;  4JCV E;  3SHL A;  4YHH L;  3I4M G;  4A75 A;  4DV2 Q;  1D2B A;  4CDD C;  3J7Z C;  3AU7 A;  1C9O A;  2OQ0 A;  1SDF A;  3KF8 B;  4C2M H;  1IW7 D;  4V0B A;  1H9R A;  1A2T A;  3DEO A;  4UP9 A;  1E1T A;  1KNA A;  4HSV A;  1HNX Q;  5IGG A;  3S24 A;  4CDF C;  3OMG A;  3EQL C;  4P75 A;  2VUM G;  1PH4 A;  2F3V A;  4DV0 L;  1WVL A;  2GN5 A;  4JYA L;  1FGB D;  2PW7 A;  3QIA A;  1IBK Q;  3Q8D A;  5IYD H;  1YNN D;  3GV6 A;  1ASY A;  4R9W A;  2K28 A;  4JOI C;  3UE1 A;  1RTN A;  4APV A;  4HR7 B;  1LT6 D;  3QOJ A;  4IAL A;  1B4O A;  3JAM E;  5KYL A;  3HS0 C;  3CHB D;  1NNX A;  1HR0 L;  2A5H A;  2WP8 J;  4PV1 C;  3AQQ A;  1IKM A;  3VA7 A;  5E4W C;  3K7U C;  3TS0 A;  2OTL A;  4A3I H;  3PO3 H;  2KUM A;  3M7N A;  2KJX A;  3V2T A;  2NVX H;  2A6E C;  1E2Z A;  3EN2 A;  5M3F B;  1X54 A;  5IYC G;  4JPB W;  4ZCK A;  3NUC A;  3K5M A;  4ODG A;  1ET9 A;  4DXF A;  4N8X 1;  1OXS C;  1KHI A;  1FL0 A;  1WTX A;  4BY7 G;  5C4X B;  1VS0 A;  3T1Y L;  1I94 L;  4P73 A;  4DUZ Q;  1PH7 A;  4LF5 L;  4LF8 L;  1G6Z A;  3H09 A;  2F0L A;  1VQI A;  4GNX A;  4IUP A;  1Q12 A;  4BBR G;  2AMC B;  2F0K A;  2K1B A;  4YWM A;  4K0K L;  3GTM H;  1TQO A;  4JVZ A;  2ZXR A;  1A15 A;  4WJ4 A;  2KED A;  3AFQ A;  4LUV A;  1SMY C;  1Z6H A;  5BN3 A;  3B6Y A;  5JJZ A;  3ERS X;  5HGT A;  5C0X J;  2JK8 A;  1FJG Q;  2UUA Q;  4JBW A;  1ENF A;  2O4X A;  4QF4 A;  3J81 L;  3KBX A;  4A3J B;  2XN9 C;  1LAC A;  3K81 C;  4IFD G;  1XMO Q;  1YNX A;  1SJE D;  2B2Y C;  2G5D A;  2LS0 1;  2VW9 A;  1I6V C;  3KUP A;  4KN4 C;  4MHE A;  3E0E A;  3H3V H;  2JYO A;  4K14 A;  1RD9 D;  1R9T B;  3A74 A;  1M8A A;  2VQE Q;  3S17 B;  1HZA A;  2R7D A;  1S40 A;  2ASB A;  2KHS A;  5M5W B;  4C56 C;  2RQX A;  3D8G A;  2B63 G;  1J5E Q;  3H94 A;  3W1G A;  4CKB A;  3HOV H;  4DR7 L;  2I5H A;  2EE1 A;  2K75 A;  1YI2 A;  4JI7 Q;  4DAP A;  4FF1 A;  1B9M A;  4GKK L;  4ULL A;  4A3G H;  1HTP A;  3K6O A;  2B2U A;  1EEI D;  1GOZ A;  5K5P A;  3D6C A;  1U0L A;  1VQG A;  2BE5 C;  5M3F H;  1H9S A;  1VQ7 A;  2JA9 A;  1YNJ C;  1B1Z A;  3VR4 A;  1V1Q A;  1X3G A;  2NN6 I;  3A8J E;  2UXC L;  1VDZ A;  1YHB A;  4H7B A;  2JA8 B;  5M5X H;  3I4O A;  1YZ6 A;  2K5W A;  5BR8 L;  3HOW B;  4DNI A;  4G4K A;  1SNM A;  1ZKO A;  2I07 B;  3CAM A;  4X65 Q;  1VQ9 A;  1G2T A;  2QEX A;  2EIF A;  1PZJ D;  1V1P B;  4U68 A;  1ICF B;  1RJT A;  2PI2 E;  3OPO A;  1KXL A;  2BOS A;  4DGZ A;  1L1O B;  4WJ3 M;  3PQI A;  1SE3 A;  3A8I E;  5JEA G;  4WOR A;  1X3F A;  2WB1 B;  3D3R A;  1S5B D;  1E2V A;  4DR3 L;  2Z4I A;  2FFK B;  1IBM L;  3GTP B;  2YV5 A;  1TWG H;  1Y1V H;  1O7I A;  5ELF A;  4JI2 Q;  2D0P A;  1KNE A;  4B3M L;  3TZD A;  1Y14 B;  1U4P A;  3ZYY X;  1SSO A;  1F9Q A;  3MTS A;  4LMQ D;  3G48 A;  2Z6K A;  4QIW E;  3NBH B;  2OT2 A;  5GAE C;  4GKJ Q;  4I7A A;  2D2C C;  4OEL B;  1R9T H;  1K0R A;  2WIN B;  2WKD A;  3KK7 A;  1OXU A;  4ILW A;  1VQC A;  4A3D G;  4HJ5 A;  4FF2 A;  1G51 A;  4JG2 A;  3RN5 A;  3J80 i;  5CBE E;  2IHE A;  1B2T A;  1GUT A;  5M5W H;  4UPA A;  2Z8L A;  1PA6 A;  2ZXP A;  1D1I A;  2RA4 A;  5EBD A;  1VQL A;  5FO9 B;  4Q0F A;  3CCE A;  2Z6B A;  1ONL A;  3ZJY C;  1HFG A;  1QG7 A;  4IPD A;  1EU3 A;  1SYG A;  4XQQ A;  4PG3 A;  3H15 A;  3JAM L;  4BBS B;  1CI3 M;  2JA5 G;  1HUM A;  3HKZ B;  5JPM C;  4KY6 A;  1EY5 A;  4HJ9 A;  1IYV A;  3K80 C;  1D5Z C;  2Y0S E;  4V19 0;  3PUZ A;  1PDQ A;  3F2B A;  1PYW D;  1TU2 B;  1WTP A;  3FPP A;  2CWP A;  2Q2T A;  4Y7N B;  2V4D A;  5FLM H;  2F52 A;  1T5X D;  1JWU D;  4CBV A;  3KLR A;  2JA8 H;  1UE7 A;  3ULJ A;  4DN4 M;  2CKZ B;  1GVP A;  1HUN A;  3QG1 A;  1GUG A;  1EL0 A;  3HOW H;  1K28 A;  1DGS A;  2IWH A;  4OIJ A;  1CT1 D;  4MZ9 A;  1EY7 A;  2QEJ C;  3UDF A;  4A76 A;  1G29 1;  1A2U A;  1EOT A;  1LUZ A;  1LTA D;  3C1E A;  2FJ2 A;  4TVA B;  4KHP L;  4A3K G;  4JI5 L;  1HR0 W;  2F3I A;  2A8V A;  4H02 A;  2K04 A;  2HIV A;  2JA7 G;  3BDL A;  2DNE A;  1A3U A;  3X3M A;  1XX8 A;  3HOZ G;  2A6E D;  1X3Q A;  2EYJ A;  3IRB A;  4MN3 A;  5C4H A;  4J15 A;  5C3E H;  2C35 B;  2L5T A;  1SE4 A;  2JSO A;  3I7F A;  1VQN A;  4X6A H;  3QJY A;  1EQT A;  3BVZ A;  5IE8 A;  1STB A;  1YJ9 A;  1GHK A;  1N9W A;  1GO3 E;  1ZYR C;  3EBE A;  4R4Q A;  1EQQ A;  1PV4 A;  2Y0S B;  1CZG A;  3DWP A;  2HCI A;  4DAM A;  4XDX A;  3DHQ A;  2B2V C;  5J39 A;  4ZLT F;  1TS3 A;  3TZU A;  4X62 Q;  4K2K A;  2EYH A;  2MGS A;  2XWB B;  1SRO A;  4LUO A;  1TXY A;  4IOC A;  3HOX G;  3S16 B;  5FKA C;  1WTW A;  2X6G A;  1AZP A;  1ZXT A;  2F4V L;  3PIP 3;  4RH6 A;  1SMY D;  3VYR A;  5M5Y H;  3KFU A;  4YCU A;  1JQY D;  2KA7 A;  1EIF A;  2EOT A;  1IL8 A;  4A3C G;  4U67 3;  1Q86 C;  2YYZ A;  2FIN B;  5F2D A;  2EDG A;  1QVF A;  2IJ0 A;  1CSP A;  1QZH A;  3CKI B;  4UHV A;  4DV4 L;  1H9M A;  2IX0 A;  4Y7N H;  2K05 A;  3T13 A;  1BF4 A;  5IGC A;  1QJO A;  1JOQ A;  1Q1E A;  3NTK A;  5FLX c;  4GOP B;  1HQR D;  1EUJ A;  2E2I B;  3DUZ A;  1JMC A;  2P5Z X;  2EYP A;  4LF7 Q;  3G71 A;  4F7X A;  2QKI C;  4A3B H;  3SVM A;  4RGN A;  1ICW A;  3J80 c;  1CKN A;  1SEB D;  2CW0 C;  1HZC A;  4EVO A;  1MJE A;  1BQQ T;  1I3Q H;  2SEB D;  4POF A;  1I6H H;  2XRS D;  2OF1 A;  4KKT A;  2MO0 A;  2IHF A;  2NZH A;  3RN2 A;  1QNK A;  2CHB D;  3VR2 A;  2PPB C;  2QIL A;  4HCS A;  2HQE A;  2ZT9 C;  1LAB A;  4FDB A;  1LV9 A;  2BE5 D;  2PZW A;  3D4D A;  4ME3 A;  3SGI A;  4HSP A;  1YNJ D;  2VB3 X;  1LTB D;  4L5T A;  4DUY Q;  2N88 A;  4R1J A;  5IY0 A;  4YY3 L;  1WTR A;  2OWO A;  3FKI G;  4LF6 Q;  2R7Z G;  2JA6 H;  5C44 B;  1A8V A;  3DLL A;  1KIX A;  4IUR A;  3WDN A;  3VYS A;  2K5H A;  3GTJ H;  5GAH C;  2EY1 A;  1SNO A;  1EYC A;  4L6T B;  1SYB A;  1NSN S;  2PQA A;  3RZD B;  5DLQ E;  4GN3 B;  4C3I B;  5C4J B;  4CDE C;  1I50 B;  5IGE A;  3HP3 A;  4DV3 Q;  4B3S L;  1XMQ L;  3HOY G;  3K5L A;  1K83 B;  1N32 Q;  4CKC A;  1JCK B;  1IL2 A;  4E6I A;  2DJG C;  4WJW A;  4DV6 L;  2RF4 A;  3MC0 B;  2E2J B;  4FXK C;  2UU9 L;  4AIM A;  3TBI B;  3U58 A;  4HJ7 A;  2VQF Q;  4L5Q A;  4FNF A;  3BVG A;  4KMU C;  4NXM L;  5J22 A;  5EKI A;  2L15 A;  4DR5 L;  4DK0 A;  1L2F A;  4NMZ A;  3Q22 A;  1NMF A;  1F9S A;  4C2M B;  4AQY L;  5AFW A;  3BDC A;  4H13 C;  2SDF A;  4N8F A;  1E24 A;  1T9H A;  1TWA H;  4FXG C;  2UXD Q;  1IBL Q;  3TDQ A;  1IKL A;  2FXQ A;  2NN6 H;  5IP9 G;  4R4I A;  2F0O A;  4FP5 D;  5I9O A;  2XIW A;  1YBY A;  4C3J G;  2R93 H;  2VS1 A;  1ASZ A;  1OXX K;  1ENC A;  4BA1 I;  1KDA A;  1LTG D;  1IZ6 A;  1U4M A;  3MFG A;  1PH5 A;  4DV5 Q;  4DR4 L;  1VQ6 A;  4F87 A;  1DYQ A;  5LHY 1;  3FEW X;  2LFN A;  4A3F G;  5J3B A;  3U50 C;  1F77 A;  2DJF C;  4KJO A;  4XXE A;  1XPR A;  2B8F A;  5IT9 c;  2K32 A;  4JI8 L;  1JJ2 A;  1F9P A;  3V96 A;  1Q3L A;  1Q81 C;  2A6H C;  2XNA C;  3PO2 B;  1LYL A;  2F0V A;  4GNX C;  2B2T A;  1JOO A;  2I46 A;  1Y8N B;  1N8R C;  3D4R A;  1HQM C;  1PRT B;  2CWA A;  5ISR A;  4J6H A;  2NVX B;  2E76 C;  4KHZ A;  4L5R C;  5KRU A;  4B9W A;  1F2Y A;  1SMX A;  4HIK A;  2HIX A;  3PGZ A;  1PYB A;  4LJZ C;  1VQ4 A;  4OL7 A;  5JVG 3;  1HTL D;  3TS2 A;  1D8L A;  1KLG D;  4LFB Q;  1PRT D;  1J9O A;  3K57 A;  4P2C B;  1G6P A;  3CF5 A;  3NWS A;  1PFS A;  5K36 H;  1XNQ Q;  2MJ8 A;  4IOA A;  1Q7Y C;  1TWF H;  1WTQ A;  4C3H H;  2X6L A;  1E7Z A;  4JBM A;  1K9M C;  2Q8I B;  2QW7 A;  2B8G A;  4KKS A;  5FJ8 H;  4X66 L;  1VQB A;  1W6K A;  1ML0 D;  2A68 D;  3SR1 A;  4EX5 A;  2E2J H;  4EGV A;  1EYD A;  2EYL A;  2XTI A;  3A7A B;  3HKS A;  2C9O A;  2CH4 A;  5C0X G;  2HDL A;  2OXP A;  4A93 G;  1ZYR D;  2EXD A;  1HNW Q;  3LWE A;  1K8A C;  4M1U B;  3RLO A;  4BA2 I;  4BY7 B;  3H0G H;  4CGY B;  1VQK A;  2EY2 A;  3KLW A;  2F0D A;  1JWS D;  1IXR A;  1B3A A;  4A3M G;  1U4L A;  1Q8K A;  1SR3 A;  1LTS D;  2QDL A;  1GHJ A;  1XXG A;  5C6A A;  2B2U C;  5LMN W;  5CV4 A;  3CD6 A;  3KLS A;  1ESF A;  4X3K A;  4FF4 A;  1Y1W H;  1RL2 A;  3T16 A;  5M3M H;  2F0I A;  3I4N H;  4LF9 Q;  1TKW B;  2L12 A;  1XTD A;  2K14 A;  2UUB L;  3JC6 6;  3OMC A;  2E5L L;  3M3Y H;  2AKW B;  4DR6 Q;  1MSG A;  2ZJP A;  4JI4 L;  3CRK C;  1C0A A;  2I5M X;  3I4M H;  2WAQ G;  4RHR A;  3QR8 A;  4JI0 L;  1W6J A;  2K5Q A;  4QUC A;  1PH8 A;  4KK7 A;  1ILP A;  3HOV B;  3S2D H;  5CV5 A;  3J7A V;  1DOK A;  4A3I G;  1EIG A;  4LNQ A;  3PO3 G;  4LFA L;  3PO2 H;  2AQ3 B;  1UNS A;  2EXZ A;  4OX9 Q;  1E3P A;  4A3G B;  4IPH A;  5EKL A;  3BYY B;  2IPK D;  3NEM A;  2RHQ B;  1S5D D;  4A4I A;  3VYT A;  1CUK A;  3MFY A;  2KOL A;  4DR5 Q;  3RMH A;  4OON A;  4G57 A;  1BNZ A;  1S5E D;  2B63 B;  2CW0 D;  4X64 Q;  3SEB A;  1IYJ B;  4K6D A;  4LFC Q;  2YTV A;  1L0Y B;  2KHI A;  1GUW A;  1VQE A;  1WOC A;  5M5X B;  2Z6K C;  1XPO A;  1GJX A;  1R4P B;  3F2C A;  3S15 B;  2E2D C;  5ELD A;  1UUP A;  2IL8 A;  5BN4 A;  1GUO A;  2BDN A;  1OXV A;  5JPN C;  3AMU A;  2NVT H;  3GP7 A;  1EY6 A;  5IOD A;  1XNR L;  3M85 A;  4YCW A;  3FHW A;  4IJH A;  3G4S A;  1UE6 A;  5D3D A;  2OEO A;  1TWG B;  1Y1V B;  4BY7 H;  3NXW A;  1B3Q A;  2IW3 A;  3TRZ A;  3PUY A;  1FNU A;  2CQA A;  4R4C A;  1EWH A;  1P8L A;  1EY0 A;  1V1P A;  3FDT A;  5C4Z A;  2E75 C;  2BDO A;  2NZ1 D;  2KCT A;  2K52 A;  3GD7 A;  2BA1 A;  4K8I A;  4K2L A;  2DY7 A;  4DPG A;  2ALY B;  3C1F A;  5M9O A;  4IUT A;  2VL6 A;  5I4D A;  3URY A;  4WFN 3;  3OWF A;  3G6E A;  2EY5 A;  3MWY W;  3TP8 A;  1OTC A;  2H5X A;  1GXD C;  1YJW A;  1CQF A;  1RF2 D;  3S2H H;  4IZ8 A;  5FOB B;  4IFD H;  1BR9 A;  2NVQ B;  3FVQ A;  3X3N A;  1WJJ A;  4B3R L;  2CCZ A;  2LSS A;  4DF7 A;  1D7Q A;  3I4L A;  4DAY B;  1STE A;  1K8M A;  3H6M A;  3TN2 A;  1HZ9 A;  3N6R A;  1ROD A;  2F0M A;  1BDO A;  5CMD A;  1JE5 A;  3K0X A;  1B53 A;  4ME5 A;  5EQ0 A;  4A3D B;  4YHH Q;  3MEH A;  1BXT A;  4JI1 L;  2A74 C;  5DM7 3;  2A69 D;  3E9I A;  5C3W A;  1NAP A;  1SYD A;  3A5Z B;  5C4X G;  4NXN L;  4DR2 L;  1Q90 A;  1SXT A;  2KEN A;  3L7Z C;  2B63 H;  1Y8O B;  2WKC A;  2VNU D;  4QMG A;  4FXD A;  3G7L A;  1YIT A;  3R3O A;  1N36 L;  4GNX B;  1JOK A;  2Z1C A;  3VYU A;  3S15 H;  1VQM A;  2BH8 A;  2F1M A;  1STN A;  4DV0 Q;  4HAE A;  4JYA Q;  2DGY A;  2UUB Q;  3DEP A;  3LGJ A;  1N33 L;  5IP7 G;  1PH9 A;  2LMC B;  1SE2 A;  1SNC A;  1BVS A;  1CSQ A;  2ICI A;  2HQL A;  3CCV A;  5IGF A;  3NHH A;  3DMU A;  4A3J G;  2R3Z A;  5IYB G;  1HR0 Q;  5JJK A;  4NB3 A;  3PIP A;  1TWH H;  1Y8P B;  1EOV A;  2F0U A;  1NR2 A;  3GTQ H;  3D31 A;  5C3E B;  1SRU A;  2ZM6 L;  1OO9 B; 
#chains in the Genus database with same CATH homology
 3GV3 A;  1SYE A;  3SK6 A;  4R8N A;  4X3S A;  4TRD A;  1BCP F;  2F0G A;  4KI0 A;  4A3K B;  5D14 A;  3MXU A;  1UAP A;  5FLX E;  2JA7 B;  3U9O A;  5JEA H;  2F0H A;  5LL6 S;  3MA2 B;  4KN7 C;  2FMM A;  2PO4 A;  1HA5 A;  4EQO A;  1CHQ D;  3J80 E;  4RAU C;  1G91 A;  4GZY C;  1SBB B;  5M5Y B;  4DA2 A;  5CGK A;  4LAA A;  1RTO A;  1HA6 A;  1Z47 A;  3TP6 A;  2EY6 A;  1H9S B;  1HRJ A;  2LKV A;  1IHZ A;  2B39 A;  5C3X A;  3NTH A;  4PMW A;  3R2I A;  2C5C A;  2NTS A;  3J7A F;  4NDX A;  4QIW B;  3P75 A;  3I3C A;  2PZT A;  1CTM A;  1DCZ A;  4IQZ A;  3HOU B;  3BDO A;  5C0X I;  5NUC A;  2L4N A;  2EPB A;  4A3B B;  4IUV A;  1S5C D;  4AYB B;  3IL8 A;  1I3Q B;  1I6H B;  3NBI A;  5D3I B;  5A2Q E;  3EFX D;  2KCN A;  4BY1 B;  2FMC A;  1LT4 D;  2K6A A;  1RDP D;  1II3 A;  4KJN A;  3T56 B;  3Q6S A;  4Z9C B;  1AN8 A;  2L1B A;  5JAV A;  2DN8 A;  4BWG B;  2JA6 B;  1V1O A;  3GTJ B;  3C2P A;  3OHX C;  1O80 A;  2WAC A;  1FNV A;  3QOL A;  2F0P A;  3M4Y A;  2XVS A;  3MXP A;  4I7Z C;  1STY A;  2L0C A;  2PZU A;  3PIO 3;  1CA6 A;  4KY5 A;  2QF7 A;  1ILQ A;  4A3E B;  2NBF A;  5IT9 E;  4M8A A;  1DOL A;  2PW5 A;  3TME A;  3PUX A;  1G2S A;  3OIP A;  5FO7 B;  3QO2 A;  4PNY A;  4K6L A;  3MXN A;  1WTO A;  1F2M A;  3FPU B;  2B2T C;  1B9N A;  1TWA B;  4KD3 A;  3Q24 A;  3CU7 A;  3RZO B;  5LL6 X;  5KND A;  1NCV A;  2R93 B;  3EJI A;  1TR5 A;  3C46 A;  3P7J A;  3R2T A;  5EKK A;  4IFD I;  4XIG S;  1NUC A;  5KEE A;  3PUW A;  4UDU C;  3MVV A;  4C1N I;  2R92 B;  4K8J A;  5FO8 B;  4K5X A;  1EWC A;  2A73 B;  2O5I C;  1SFO B;  1CHP D;  2XWJ B;  1R4Q B;  4C3J B;  2J7Z A;  5G3L F;  2AWO A;  4RGT A;  1TS5 A;  4NW2 A;  1PXU A;  3I91 A;  3IAY A;  1K8O A;  3Q23 A;  4H44 C;  2QDB A;  4CHT B;  2NTT A;  3VR5 A;  4KHV A;  2PNR C;  3MAQ A;  5CV7 A;  1SYF A;  1TWF B;  4C3H B;  5FLX L;  3VA5 A;  4KD4 A;  5KYI A;  4RWS C;  4RKL A;  1NR4 A;  2J4X A;  3S1N B;  2F0F A;  4QCL A;  4FO2 A;  3HEJ A;  4O1N A;  3J80 L;  3SK5 A;  1DOM A;  2RDF A;  3R93 A;  3G6J B;  2TSS A;  2F0Q A;  4ID6 A;  2K33 A;  1CQV A;  1AEX A;  5IGB A;  5IOC A;  4F8M A;  3NQT A;  4MIU A;  2F03 A;  3H0G B;  5EPL A;  4IUU A;  1QWY A;  4L63 B;  4OO1 G;  2EYF A;  2Z4H A;  2L55 A;  3E0J A;  1D6E C;  1JB3 A;  1Y1W B;  4QUF A;  4DFA A;  5M3M B;  3I4N B;  5DAU A;  4A93 B;  4NP5 A;  3IFD A;  3M3Y B;  2WII B;  4FF3 A;  2ENB A;  2K7V A;  3I4M B;  1LT3 D;  2G9D A;  3V05 A;  3TP5 A;  1UEA B;  4A3M B;  3KF8 A;  4CJ1 B;  3L9A X;  3S2D B;  2L11 A;  4RHS A;  1FR3 A;  5CYU A;  1V8Q A;  5EPJ A;  1L0X B;  5A2Q L;  2VXW A;  2VUM B;  1I4Q A;  2O2L D;  5E3F A;  2SNS A;  4ABN A;  1CK1 A;  2DY8 A;  5ELE A;  3SE0 A;  2WAQ B;  4CJ2 C;  4C3I G;  2AQ1 B;  2JE6 I;  5BN5 A;  3D6W A;  4WRD A;  2F0T A;  1EY8 A;  2EJG C;  2EYO A;  1PFN A;  2Q8R E;  3NTI A;  2WV6 D;  2IX1 A;  4B9X A;  2RDH A;  1PTO C;  5I9P A;  1FD7 D;  4IUQ A;  1O7Y A;  2NVT B;  5T1I A;  5G3L D;  3A7L A;  2D62 A;  2DNC A;  1MI2 A;  1A3V A;  5IT9 L;  1TVX A;  1PLF A;  1C4Q A;  2B2W A;  1MGS A;  2PMZ B;  3RD4 A;  3NSW A;  4NKL A;  1LT5 D;  2NVY B;  3O13 A;  4BBR B;  4UAI A;  1XWE A;  1TY2 A;  4J1M A;  1I4X A;  1SAP A;  5C0X H;  5JVH 3;  1JR0 D;  2EYM A;  1KTK A;  3HRZ C;  3MXG A;  4DAV A;  3K58 A;  2FHT A;  3IFT A;  3S2H B;  1LTR D;  4ZQ3 A;  1PFM A;  4DK1 A;  3SDZ A;  2EZV A;  2BCO A;  1I4H A;  3S1M B;  3VR3 A;  1LO5 D;  3I73 A;  2KQ3 A;  1ET6 A;  3K5N A;  1F9R A;  1KAB A;  2AUK A;  2SNM A;  3E5S A;  4L8J A;  1EY4 A;  3DWA A;  4CJ0 B;  3Q0A A;  1SJH D;  5KGU A;  2ZXO A;  3GTG B;  4DAY A;  3NPP A;  1QOH A;  3U9S A;  5E1F A;  2HDM A;  3HG9 A;  3UI2 A;  1PTO F;  1O7Z A;  2M9V A;  3T4A C;  4PQX A;  4K5W A;  1TY0 A;  5CC4 A;  3NE5 B;  1TWH B;  4OHJ A;  1EZ8 A;  3GTQ B;  1BOS A;  1A6X A;  5T1G A;  4FVM A;  5D65 A;  3TSS A;  4B08 A;  2MP1 A;  3TP7 A;  1QE6 A;  1BCP C;  1KLU D;  3K0Y A;  2JXM B;  1SNQ A;  3ITP A;  2JP1 A;  4KTA A;  5CV6 A;  1O78 A;  1U9R A;  3DM1 A;  4CKE A;  1LTI D;  1KDC A;  1QB5 D;  2RDG A;  2IT1 A;  1WD1 A;  1B50 A;  1EU4 A;  2R61 A;  2KEC A;  5IGD A;  3M4O B;  4X3U A;  1XTC D;  3NBH A;  5KNB A;  2F0W A;  3BYT B;  5TSS A;  1AZQ A;  1EFI D;  2SOB A;  5EGT A;  3S1R B;  3C3L A;  1GUN A;  1Q1B A;  3R8B A;  5CV8 A;  2PQE A;  1DZ1 A;  1WTV A;  3MHB A;  1AFP A;  4XT1 B;  2K01 A;  4X3T A;  4HMI A;  3I72 A;  2AUJ D;  3D4W A;  1S4Z A;  3FMC A;  2KEE A;  1Y69 U;  5I2X A;  2JA5 B;  2O5J C;  3E6Z X;  4KY7 A;  1E0B A;  2A6H D;  1JE4 A;  1VMP A;  1SNP A;  1XYI A;  4OO1 I;  3RUZ A;  4HTH A;  1AP0 A;  2BA0 A;  1JOR A;  2MUY A;  3NQI A;  2MPM A;  3NK9 A;  3GTL B;  3I8Z A;  2AQ2 B;  2D9U A;  2KVM A;  5CR3 A;  4FYD A;  1JC7 A;  1GUS A;  4G7O C;  1PTO B;  4XYQ A;  2ICE C;  3KLS X;  4XT3 B;  3J7Y W;  1PMR A;  1CM9 A;  4ZUJ A;  1PZK D;  1RKN A;  1V43 A;  3PMF A;  2Q8T A;  1PTO D;  2E2H B;  3I90 A;  2N55 A;  3S1Q B;  3HOZ B;  3CQZ B;  3A55 A;  1TII D;  5EPK A;  5DEH A;  2NB0 A;  3QWN A;  5A35 A;  5DM6 3;  1OXT A;  1H9K A;  4IFD J;  1CFM A;  3M7G A;  1HPC A;  4ZUI A;  4ZRZ A;  1EZ6 A;  1VF7 A;  3CRL C;  4DNR B;  1DON A;  3SK4 A;  2LY7 A;  3QB3 A;  1SYC A;  2JEB I;  1O7L A;  1D5X C;  3BZD B;  1I4G A;  3T53 B;  2CVR A;  3W2D A;  1CA5 A;  1VMC A;  5EBC A;  4QB4 A;  4JK1 C;  1U4R A;  4HMJ A;  3HOX B;  1WCM B;  3HZX A;  4C1N K;  2G9H D;  2PCF B;  2B2Y A;  5COR A;  1A3T A;  1EEF D;  1RHP A;  1STG A;  2RBM A;  4R8I A;  3GTK B;  3FRP B;  5COY A;  2PYK A;  1TS4 A;  3PV0 A;  3GQB A;  2NUC A;  3LX0 A;  1I4R A;  2F0S A;  1EYA A;  2J0T D;  4YIJ A;  3KBG A;  3SK8 A;  1EQV A;  4N9P A;  4DNT B;  3A54 A;  3IKJ A;  4DXG A;  1VCI A;  2L9H A;  4OIK A;  1FYC A;  3K59 A;  4XQJ A;  4HN7 A;  1HCZ A;  1PRT C;  1LLR D;  2X69 A;  3WOE A;  3OW7 A;  2E74 C;  1DD2 A;  3NP8 A;  2EVB A;  2RSO A;  3P20 A;  1PTO H;  4N9T A;  4EQN A;  3GO5 A;  1EIH A;  1C8C A;  3HGB A;  4PMC A;  1T5E A;  2TMP A;  2A68 C;  5JEA J;  5C5L A;  2AWN A;  2IX3 A;  5FK9 C;  4G7H C;  2YU9 B;  3BG3 A;  3K7A B;  4TSS A;  5I6W A;  2KCC A;  1BCP B;  3OWE B;  2EJM A;  3FKI B;  3EA6 A;  4BS9 A;  1E2W A;  2R7Z B;  3I70 A;  5C5M A;  1IW7 C;  2M00 A;  3MZ5 A;  1KDB A;  1BCP D;  2GA4 B;  4K5V A;  1I4P A;  3OIQ A;  1RCV D;  4O42 A;  4RGM A;  1G8Z D;  4F88 A;  1BUV T;  1ENA A;  1C48 A;  1YNN C;  3HOY B;  5I6Y A;  3H3V C;  3EVQ A;  3BS1 A;  3A56 A;  4KKU A;  2H4O A;  4ZKB B;  2F3W A;  3ONA B;  1S5F D;  4RCO A;  3RLF A;  1PZI D;  3LNN A;  1JWM D;  3WOF A;  5JOB A;  3LWU A;  5KNC A;  2RKS A;  1TT2 A;  1J8I A;  3S9W A;  1PRT F;  4OGQ C;  5KIX A;  2M2L A;  4EQP A;  4H0L C;  3A8K E;  5DNF A;  1X32 A;  4I65 A;  4XTC S;  3VR6 A;  5ELB A;  4A3F B;  3W3A A;  2RSN A;  3S14 B;  1QCB D;  5EJW A;  3K5O A;  2B2W C;  2XSC A;  4ZK9 B;  3P1H A;  1H9J A;  4XQN A;  1F2L A;  1DJR D;  1Q8I A;  1Z7T A;  3ND9 A;  2XRQ D;  3F2U A;  2F0J A;  5J1Z A;  3T51 B;  2K5D A;  3GTO B;  5CV9 A;  1ZEQ X;  1LTT D;  2NYZ D;  2RVL A;  1HHV A;  4TKO B;  2H1E A;  2F4I A;  1QIL A;  1TS2 A;  1D1K A;  1HXY D;  2NN6 G;  1MD2 D;  4TQU S;  2EJF C;  3J81 E;  1BO0 A;  1M4V A;  2VB2 X;  3DXJ C;  3AB9 A;  3DWQ A;  4RA8 A;  1MSH A;  2B2V A;  4Q5V A;  4PMB A;  4LK1 C;  4ZAI A;  4IUN A;  1D5M C;  1X3P A;  3ERQ A;  5IIF A;  2MHV A;  3H91 A;  4HED A;  3ERO A;  4OO1 H;  4ZKC B;  1DM0 B;  1TWC B;  1EY9 A;  2A69 C;  3N52 A;  3L3O C;  1KAA A;  1STH A;  1WD0 A;  4IN3 A;  1PFB A;  3PUV A;  1B44 D;  1ESR A;  4S3S A;  5HUR A;  4XYO A;  5K36 G;  2HCC A;  4C3H G;  4J8Q A;  4RCN A;  1JIC A;  4ZYS A;  4A3I B;  1F2Z A;  3PO3 B;  3BVM A;  5E4X A;  1FNW A;  3SXH A;  4RFB A;  4RGO S;  2D5D A;  4HCE A;  3NWT A;  4G7Z C;  5I2Y A;  3ND8 A;  2NWG A;  1VF5 C;  4KV6 A;  4RKB A;  3OSO A;  2K03 A;  3OOC A;  2R6G A;  1BBX C;  1IYU A;  1STA A;  1QNU A;  2ID0 A;  4DU9 A;  5ELC A;  1HFN A;  1MBY A;  1AW7 A;  5CBA E;  2F0E A;  2F0N A;  1SND A;  2QCP X;  1DXM A;  3GTM B;  2HUG A;  2JEA I;  1CZW A;  3SHL A;  1D2B A;  3AU7 A;  1SDF A;  1IW7 D;  4V0B A;  1H9R A;  1A2T A;  3DEO A;  1KNA A;  4HSV A;  5IGG A;  3OMG A;  3EQL C;  2F3V A;  1WVL A;  1FGB D;  2PW7 A;  3QIA A;  1YNN D;  3GV6 A;  4R9W A;  2K28 A;  1RTN A;  4HR7 B;  1LT6 D;  3QOJ A;  4IAL A;  1B4O A;  3JAM E;  5KYL A;  3HS0 C;  3CHB D;  2A5H A;  2WP8 J;  4PV1 C;  1IKM A;  3VA7 A;  5E4W C;  2KUM A;  3M7N A;  2KJX A;  3V2T A;  2A6E C;  1E2Z A;  5M3F B;  3NUC A;  3K5M A;  4ODG A;  1ET9 A;  4DXF A;  1OXS C;  1WTX A;  5C4X B;  1G6Z A;  3H09 A;  2F0L A;  4IUP A;  1Q12 A;  2F0K A;  2K1B A;  1TQO A;  2ZXR A;  1A15 A;  2KED A;  1SMY C;  1Z6H A;  5JJZ A;  5BN3 A;  5HGT A;  5C0X J;  4JBW A;  1ENF A;  2O4X A;  4QF4 A;  3J81 L;  3KBX A;  4A3J B;  2XN9 C;  1LAC A;  4IFD G;  1SJE D;  2B2Y C;  2LS0 1;  1I6V C;  3KUP A;  4KN4 C;  4MHE A;  2JYO A;  4K14 A;  1RD9 D;  1R9T B;  1M8A A;  3S17 B;  2KHS A;  5M5W B;  4C56 C;  2RQX A;  3D8G A;  3H94 A;  4CKB A;  2EE1 A;  4DAP A;  4FF1 A;  1B9M A;  4ULL A;  1HTP A;  3K6O A;  2B2U A;  1EEI D;  1GOZ A;  5K5P A;  3D6C A;  2BE5 C;  1H9S A;  1YNJ C;  1B1Z A;  3VR4 A;  2NN6 I;  3A8J E;  1VDZ A;  4H7B A;  2JA8 B;  2K5W A;  3HOW B;  4G4K A;  1SNM A;  1ZKO A;  2I07 B;  1G2T A;  1PZJ D;  1V1P B;  4U68 A;  3OPO A;  1RJT A;  2BOS A;  4DGZ A;  1SE3 A;  3A8I E;  5JEA G;  4WOR A;  2WB1 B;  3D3R A;  1S5B D;  1E2V A;  2Z4I A;  2FFK B;  3GTP B;  5ELF A;  1KNE A;  3TZD A;  1U4P A;  3ZYY X;  1SSO A;  1F9Q A;  3MTS A;  4LMQ D;  2OT2 A;  2D2C C;  3KK7 A;  2WIN B;  2WKD A;  4ILW A;  1OXU A;  4FF2 A;  5CBE E;  1B2T A;  1GUT A;  2Z8L A;  2ZXP A;  1D1I A;  2RA4 A;  5EBD A;  5FO9 B;  4Q0F A;  1ONL A;  1HFG A;  1QG7 A;  1EU3 A;  1SYG A;  4XQQ A;  4BBS B;  3JAM L;  1CI3 M;  1HUM A;  3HKZ B;  5JPM C;  4KY6 A;  1EY5 A;  1IYV A;  1D5Z C;  4V19 0;  3PUZ A;  1PDQ A;  1PYW D;  1TU2 B;  1WTP A;  3FPP A;  4Y7N B;  2V4D A;  1T5X D;  1JWU D;  4CBV A;  3KLR A;  4DN4 M;  1HUN A;  3QG1 A;  1GUG A;  1EL0 A;  2IWH A;  4OIJ A;  1CT1 D;  1EY7 A;  2QEJ C;  1G29 1;  1A2U A;  1EOT A;  1LTA D;  3C1E A;  2FJ2 A;  2K04 A;  3BDL A;  2DNE A;  1A3U A;  3X3M A;  1XX8 A;  2A6E D;  1X3Q A;  2EYJ A;  4MN3 A;  5C4H A;  2L5T A;  1SE4 A;  2JSO A;  3QJY A;  1EQT A;  3BVZ A;  1STB A;  1GHK A;  1ZYR C;  2Y0S B;  1CZG A;  3DWP A;  2HCI A;  4XDX A;  3DHQ A;  2B2V C;  5J39 A;  4ZLT F;  1TS3 A;  3TZU A;  4K2K A;  2EYH A;  2MGS A;  2XWB B;  3S16 B;  5FKA C;  1WTW A;  2X6G A;  1AZP A;  1ZXT A;  3PIP 3;  4RH6 A;  1SMY D;  3VYR A;  1JQY D;  2KA7 A;  2EOT A;  1IL8 A;  4U67 3;  2YYZ A;  2FIN B;  5F2D A;  2EDG A;  2IJ0 A;  3CKI B;  1H9M A;  2IX0 A;  2K05 A;  3T13 A;  1BF4 A;  5IGC A;  1QJO A;  1JOQ A;  1Q1E A;  3NTK A;  1HQR D;  2E2I B;  3DUZ A;  2EYP A;  4F7X A;  2QKI C;  3SVM A;  4RGN A;  1ICW A;  1SEB D;  2CW0 C;  4EVO A;  1BQQ T;  2SEB D;  2XRS D;  2OF1 A;  4KKT A;  1QNK A;  2CHB D;  3VR2 A;  2PPB C;  2QIL A;  4HCS A;  2HQE A;  2ZT9 C;  1LAB A;  1LV9 A;  2BE5 D;  2PZW A;  3D4D A;  4HSP A;  1YNJ D;  2VB3 X;  1LTB D;  2N88 A;  1WTR A;  5C44 B;  4IUR A;  3WDN A;  3VYS A;  2EY1 A;  1SNO A;  1EYC A;  4L6T B;  1SYB A;  1NSN S;  3RZD B;  4C3I B;  5C4J B;  1I50 B;  5IGE A;  3HP3 A;  3K5L A;  1K83 B;  4CKC A;  1JCK B;  4E6I A;  4WJW A;  3MC0 B;  2E2J B;  4FXK C;  3TBI B;  4FNF A;  3BVG A;  4KMU C;  5J22 A;  5EKI A;  4DK0 A;  4NMZ A;  3Q22 A;  1F9S A;  4C2M B;  5AFW A;  3BDC A;  4H13 C;  2SDF A;  4FXG C;  3TDQ A;  1IKL A;  2NN6 H;  2F0O A;  4FP5 D;  5I9O A;  2XIW A;  4C3J G;  1OXX K;  1ENC A;  4BA1 I;  1KDA A;  1LTG D;  1U4M A;  3MFG A;  4F87 A;  1DYQ A;  5LHY 1;  3FEW X;  2LFN A;  1F77 A;  4XXE A;  4KJO A;  2B8F A;  2K32 A;  1F9P A;  3V96 A;  1Q3L A;  2A6H C;  2XNA C;  3PO2 B;  2F0V A;  2B2T A;  1JOO A;  2I46 A;  1Y8N B;  3D4R A;  1HQM C;  1PRT B;  5ISR A;  4J6H A;  2NVX B;  2E76 C;  4KHZ A;  5KRU A;  4B9W A;  1F2Y A;  4LJZ C;  4OL7 A;  5JVG 3;  1HTL D;  1KLG D;  1PRT D;  1J9O A;  3K57 A;  4P2C B;  3NWS A;  5K36 H;  2MJ8 A;  1WTQ A;  2X6L A;  2Q8I B;  2B8G A;  4KKS A;  1W6K A;  1ML0 D;  2A68 D;  3SR1 A;  4EGV A;  1EYD A;  2EYL A;  3A7A B;  2C9O A;  5C0X G;  2HDL A;  2OXP A;  1ZYR D;  3LWE A;  4M1U B;  4BA2 I;  4BY7 B;  4CGY B;  2EY2 A;  2F0D A;  1JWS D;  1B3A A;  1U4L A;  1LTS D;  1GHJ A;  1XXG A;  5C6A A;  2B2U C;  5CV4 A;  3KLS A;  1ESF A;  4X3K A;  4FF4 A;  3T16 A;  2F0I A;  1TKW B;  2L12 A;  3OMC A;  1MSG A;  3CRK C;  4RHR A;  1W6J A;  2K5Q A;  4QUC A;  4KK7 A;  1ILP A;  3HOV B;  5CV5 A;  3J7A V;  1DOK A;  1EIG A;  2AQ3 B;  1UNS A;  2EXZ A;  4A3G B;  5EKL A;  3BYY B;  2IPK D;  1S5D D;  3VYT A;  3MFY A;  2KOL A;  3RMH A;  4G57 A;  1BNZ A;  1S5E D;  2B63 B;  2CW0 D;  3SEB A;  4K6D A;  1L0Y B;  1GUW A;  5M5X B;  1GJX A;  1R4P B;  3S15 B;  2E2D C;  5ELD A;  1UUP A;  2IL8 A;  5BN4 A;  1GUO A;  2BDN A;  1OXV A;  5JPN C;  3AMU A;  3GP7 A;  1EY6 A;  5IOD A;  3M85 A;  5D3D A;  2OEO A;  1TWG B;  1Y1V B;  3NXW A;  2IW3 A;  3PUY A;  1FNU A;  2CQA A;  1EWH A;  1EY0 A;  1V1P A;  3FDT A;  5C4Z A;  2E75 C;  2BDO A;  2NZ1 D;  3GD7 A;  2BA1 A;  4K8I A;  4K2L A;  2DY7 A;  3C1F A;  5M9O A;  4IUT A;  5I4D A;  3URY A;  4WFN 3;  3OWF A;  2EY5 A;  3MWY W;  3TP8 A;  1GXD C;  1CQF A;  1RF2 D;  4IZ8 A;  5FOB B;  4IFD H;  1BR9 A;  2NVQ B;  3FVQ A;  3X3N A;  4DF7 A;  3I4L A;  1STE A;  1K8M A;  3H6M A;  3TN2 A;  3N6R A;  1ROD A;  2F0M A;  1BDO A;  5CMD A;  1B53 A;  4ME5 A;  5EQ0 A;  4A3D B;  3MEH A;  1BXT A;  2A74 C;  5DM7 3;  2A69 D;  5C3W A;  1NAP A;  1SYD A;  1Q90 A;  1SXT A;  3L7Z C;  1Y8O B;  2WKC A;  2VNU D;  4QMG A;  4FXD A;  3G7L A;  3R3O A;  1JOK A;  2Z1C A;  3VYU A;  2F1M A;  1STN A;  4HAE A;  3DEP A;  2LMC B;  1SE2 A;  1SNC A;  2ICI A;  5IGF A;  3NHH A;  3DMU A;  2R3Z A;  1Y8P B;  2F0U A;  1NR2 A;  3D31 A;  5C3E B;  1OO9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...