1MSGA

Solution structure of gro(slash)melanoma growth stimulatory activity determined by 1h nmr spectroscopy
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine (chemotactic)
molecule keywords HUMAN MELANOMA GROWTH STIMULATORY ACTIVITY
publication title Solution structure of GRO/melanoma growth stimulatory activity determined by 1H NMR spectroscopy.
pubmed rcsb
source organism Homo sapiens
total genus 8
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1msgA00
3SVMA 1VMPA 2L11A 1O80A 4XT3B 1AZPA 2MPMA 1CA6A 2KVMA 3R93A 2L1BA 3F2UA 3FPUB 5CBAE 2KUMA 1G91A 1HA6A 1SDFA 1B53A 1AZQA 1WVLA 1TVXA 1B3AA 3N52A 1F9RA 1SSOA 2B2YA 2EOTA 2RSOA 1ILQA 3TZDA 1XYIA 1WD1A 1EIHA 2KEEA 1GUWA 4XDXA 1X3PA 1VMCA 2NZ1D 4RA8A 1F9SA 1MSHA 3FDTA 5T1IA 1U4LA 2KECA 4R8IA 2K03A 2B2TA 3LWEA 2MJ8A 2HUGA 5AFWA 1EL0A 1X32A 5D14A 1B2TA 1U4PA 2HCIA 4HAEA 5EJWA 1ESRA 1HFNA 4DN4M 4RWSC 1RHPA 3QO2A 4MHEA 4ZK9B 2N88A 1ZXTA 3Q6SA 3DEPA 4XT1B 1HRJA 2X6GA 1WD0A 1JICA 1DOKA 3I91A 1U4RA 2B2VC 2N55A 1WTWA 1PFMA 1G6ZA 4RAUC 3GV3A 1O7YA 2B2WC 5DNFA 3KUPA 4X3UA 1G2TA 4QUCA 1PLFA 2M2LA 2NWGA 3DM1A 4ZLTF 1A15A 2FFKB 2FJ2A 5CORA 1EOTA 1RJTA 2H1EA 3I8ZA 5EQ0A 1G2SA 2X6LA 2VXWA 2FMMA 3MTSA 4IURA 4LMQD 3KBXA 4IUTA 3TN2A 2KEDA 4IUUA 1WTOA 5EPJA 1WTXA 4NW2A 5EPLA 3G7LA 1X3QA 4QUFA 2DY7A 2RA4A 2KOLA 1HUMA 2Q8TA 2L12A 1WTPA 2RVLA 1HUNA 1AP0A 2B2VA 4HCSA 4O42A 2HCCA 5E4WC 2JP1A 1QE6A 4U68A 5T1GA 1JE4A 2K1BA 1DOLA 1U4MA 2BDNA 1BNZA 3H91A 5COYA 2B2WA 1B50A 5CMDA 2IL8A 1NAPA 4ZAIA 1E0BA 2XIWA 3ONAB 3HP3A 1CA5A 2DY8A 3D6WA 1QG7A 4HSVA 5EPKA 1S4ZA 2NYZD 4CJ0B 1NR4A 1RTOA 1ILPA 2K04A 3UI2A 3GV6A 1F2LA 5E4XA 5CBEE 2FHTA 1SAPA 1QNKA 1BO0A 1HHVA 2K28A 2J7ZA 2K01A 2MGSA 4R9WA 2B2UA 1WTVA 2FINB 1IL8A 1KNEA 1F9PA 4IUPA 1WTQA 1ML0D 2HDLA 4IUQA 4ZKCB 1J8IA 4X3SA 2B2UC 1WTRA 5D65A 2EE1A 1BF4A 3MWYW 1Q3LA 4X3KA 4HEDA 2Q8RE 2X69A 5JJZA 1EIGA 1HFGA 2SDFA 3IL8A 1IKMA 1LV9A 4IUVA 1MGSA 1DZ1A 2D9UA 2K05A 1IKLA 1PDQA 2CVRA 4OIKA 2L4NA 3DEOA 3I90A 1DOMA 2MP1A 2B2YC 2HDMA 4CJ1B 2L9HA 4ZKBB 1CM9A 1KNAA 3IFDA 1C8CA 2RSNA 1RTNA 1NCVA 4X3TA 4MN3A 4CJ2C 1J9OA 3P7JA 1NR2A 3I3CA 1M8AA 1RODA 1EQTA 2JYOA 1XX8A 1B4OA 1MSGA 2B2TC 1BBXC 1PFNA 2EPBA 1ICWA 4OIJA 1MI2A 5EKIA 2R3ZA 4UAIA 1DONA 1F9QA 1PFBA 1O7ZA
chains in the Genus database with same CATH superfamily
1SMYC 3CC7A 4ME3A 4BWGB 4KK7A 1SSOA 3IFTA 2B2YA 4M1UB 2Q2UA 3GTGB 5ELBA 2HIVA 2RDGA 4DNIA 4A3CH 5LHY1 1NTGA 4A3IB 4NXMQ 1SNMA 1ZKOA 3VR3A 5EJWA 4O2DA 3QO2A 3S1MH 2CFMA 1Y1VG 4RHRA 1JICA 2ZXOA 4DK3C 1EQVA 1ICFB 3E3XA 1SMXA 1O7YA 1HR0L 1SE8A 2UXDL 5C44G 4FNFA 1HZAA 1FR3A 4GNXA 5EGTA 1NNXA 3OMGA 5EQ0A 1ET9A 5IIFA 1PMRA 2VXWA 2FMMA 3GTJB 1SROA 1Z6HA 3K59A 3SDZA 1IYJB 3GO5A 4K5XA 1V8QA 1IL2A 1BR9A 4IQZA 2EYLA 1NMFA 1HUMA 1SJHD 1WTPA 4ALPA 2UUBL 5K36G 4HN7A 2XGTA 4JPBW 3HOXH 3K5LA 3H91A 5COYA 1I4HA 1TS5A 2R7DA 3S1NB 4GKJL 4LF5Q 1YEZA 1STEA 5EPKA 5CC4A 3QJYA 4R8NA 5KYLA 3TSSA 1F2LA 1Q46A 3V96A 3A5UA 2R6GA 1HH2P 1FNUA 2Q2IA 2SNMA 1Y8NB 5CV5A 3HOZG 1TU2B 4C3HG 1TWAB 4P73A 3MWYW 2JA8B 1JWMD 4F8MA 1JR0D 3HKZE 3S1QH 4JBWA 4K2LA 4IUVA 2K05A 4WRDA 3S1RB 1K8GA 1O7IA 3DWPA 4DV4L 2B2YC 4IO9A 2F0JA 2Z1CA 3LX0A 1Y1WH 4DR5Q 1LTRD 1EQTA 2JYOA 1PZID 3HOVB 1J5EL 3RR5A 1O7ZA 2UXBL 1I94Q 4XT3B 3P75A 1G91A 2JEAI 3K5MA 2R92H 2ZM6L 4C3IB 4XTCS 3E0EA 3U50C 1WD1A 1EIHA 4G7ZC 5BN3A 4A3FB 4RA8A 4DUZL 5KEEA 2XRSD 2CCZA 1IBLL 2K03A 1SXTA 1GHJA 2D0OA 3URYA 4GNXC 3KDFB 1KD1C 3TRZA 2Y0SB 4P74A 1E24A 3D4RA 4X62Q 4RWSC 1R4PB 5I6WA 4N9PA 2K14A 3VR4A 2XWJB 4DK1A 3K58A 4JI0L 3M4OH 1UEBA 1V1QA 4KKTA 4FP5D 4ABNA 4OELB 1FVIA 4QJFA 3UDXA 1HZCA 1VQGA 1PTOF 2M2LA 2P5ZX 2WP8J 1TWCB 4ZUIA 3S2HH 1DM0B 1S5ED 4TKOB 2X6LA 1VQMA 1K8MA 1G291 4C1NI 1HPCA 4KN7C 2E2HB 4CDDC 2QEJC 1PH9A 3T1HQ 1JB7A 2BE5D 2RA4A 4BBSH 2AWOA 4DFAA 1A2UA 1XTDA 4O42A 5GADC 5FO9B 3K80C 1X3FA 2PCFB 4GZYC 3PIPA 3KJOA 1HTPA 4E6IA 2F0TA 5M5XB 4LUZA 4KHVA 4DV0L 3H0GB 1S4ZA 3FKIB 2I5LX 4GOPA 1MJEA 5FO7B 1AE2A 3UI2A 2H5XA 2IW3A 3QOLA 1PFSA 1EY8A 3SK4A 5FOBB 1EOVA 5DM63 2FINB 1IL8A 2VQFQ 4DV7L 3I73A 1WCMH 1ML0D 3MXUA 4ZKCB 1QJOA 3Q8DA 4DUYL 5M5YH 1WTRA 1R4QB 1I4XA 1XNRL 2A68C 1N33L 1XNQL 5C4XG 1IKLA 1CKOA 4UY8C 1K73C 4I65A 3NHHA 4QF4A 1W3SA 2XWBB 5CR3A 1YHAA 3GTQB 1JQYD 4KY5A 2L9HA 1O78A 5JEAG 2CQAA 3V05A 3A8JE 1QB5D 4F88A 2OQKA 4LW1A 2JA6B 2R7ZG 2BCOA 2CW0D 4K5VA 3HOWH 2ICEC 1WOCA 2JA9A 2ALYB 1CZWA 1H9MA 3KLWA 1B44D 4N8FA 4IUNA 3S14H 4HMJA 3AEVA 1B53A 2D5DA 1AZQA 4DV2L 3N52A 1PRTD 5DEHA 4YWKA 5ISRA 4KMUC 4B08A 3SK5A 3MXGA 3NUCA 5JAVA 2N3SA 1K83H 2MHVA 1D1IA 4DXFA 2UUCL 2MJ8A 1EZ6A 2HUGA 2MQHA 4B9XA 4DN4M 4KN4C 4ZK9B 1E7ZA 3TZUA 1ZXTA 3QR8A 2WB1E 2XVSA 1DJRD 2VY3A 5C0XJ 1BCPC 3CCQA 1LTLA 4PQXA 4V190 1HJPA 4L6TB 3BYYB 2Z6KA 4CBVA 1SNDA 2A19A 1PZKD 3PIP3 2BA0A 1KLGD 1D1KA 2ZTCA 4MZ9A 4GOPC 1EYCA 4ZUJA 1FJGQ 1IZ6A 1WTOA 4O0AA 1A6XA 5I9PA 5JJLA 5EBDA 2H4OA 4A3GB 1W6KA 4RCNA 1XWEA 2KOLA 2WAQB 4Y7NH 4UP8A 3ZJYC 4EQPA 1AP0A 4R4OA 2A69C 4JOIC 1PTOB 3RZDB 4Q5VA 4BBRG 5E7NA 1BNZA 1GUGA 3KOJA 1T5EA 1KTKA 1TY0A 2XIWA 5LL6S 4LF5L 4FF4A 3JAMi 1AE3A 1QG7A 3I4MB 4XIGS 3MVVA 5I4DA 3DWAA 2F0VA 2VUMG 4K0KQ 1YVCA 2NTSA 4LNQA 2K01A 4EQ5A 2NVQH 1EYDA 1E2WA 4X3KA 1ENAA 1I4PA 2JE6I 3W1GA 4A3LG 1HFGA 1STBA 1II3A 2Z9HA 5IYDH 4POGA 1E3PA 3ERSX 1JC7A 3E9IA 3CCUA 3DEOA 5CV6A 3U9OA 4DR3Q 1A3UA 1CM9A 4DR5L 1I3QB 5GQOA 1NR2A 1SEBD 1B4OA 5C44B 2O4XA 3K7AH 2RBMA 2WINB 5IT9L 1CSQA 1PFBA 1MKHA 3A54A 1I94L 3CMEA 1F2YA 4IOAA 1PYWD 3H15A 1I6HB 4KHPQ 5IYCH 3J81E 4CDCC 2B63G 2BDOA 1YITA 2RSOA 3K81C 3I72A 1X3PA 3RUZA 2Z6KC 2JEBI 4DV1Q 5T1IA 3KF8B 1AH9A 3M4PA 5LL6X 4FF2A 1JWUD 1G6PA 1B70B 4JI2Q 4X62L 2IHEA 1V1PA 3RZOB 3SE0A 3NP8A 1CI3M 1WD0A 2OCEA 1DD2A 2F0UA 5IGEA 4A4IA 1ASYA 4RGNA 2ZXRA 3V2TA 2ENBA 3HOZB 2RHSB 3Q24A 2BH2A 4PNYA 3IKJA 1G2TA 1S5CD 2I5MX 2C9OA 5FKAC 3SK6A 1FGUA 1XMOQ 1R9TB 3MTSA 4LMQD 1VQCA 1JT8A 2JA8G 4J1MA 2YTVA 1CQVA 2XN9C 3T1HL 5JPMC 2AQ1B 1VQPA 1HA5A 4B3ML 4YHHQ 1TY2A 1IYVA 3AU7A 2WFWA 2JA7B 3M85A 4HIOA 4U68A 3VYTA 3E0JA 3NE5B 2OT2A 2Z6BA 4ULLA 5M5WH 1TWFB 3I4LA 4BXXH 1ZYRC 3SK8A 4IJHA 3K0YA 5M3MH 2UXDQ 3HOVG 2LSSA 1TWGH 3A8IE 1XPOA 2JA5H 1EU3A 1Y69U 1IW7D 1KNEA 4IUQA 5LMNL 4X65Q 1SBBB 1JJCB 4X3SA 4A3CG 4J15A 4OWWB 1A62A 1EIGA 1A0IA 1MIUA 2F0OA 3PV0A 4A3FG 1BKBA 3GTOH 1HNWQ 3RLOA 2Q2TA 4L8JA 3PO2B 2VB2X 1P16A 3PIOA 1N34L 4RH6A 3F2BA 1PDQA 2YTYA 2KENA 4GKJQ 3EIVA 3HOYH 1QILA 2Y0SG 4XYQA 2R93H 4OWTB 3OTOQ 4CJ2C 3NBHB 2LKVA 3PO3B 1B1ZA 4PZ7A 3J81c 1I5FA 5FLMH 5HURA 4C56C 4EVOA 4A3KH 2PI2A 1D8LA 2ZTDA 1LTBD 3R8BA 1VMPA 3SVMA 2NVYB 1D5MC 3S2DH 2KVMA 2AWNA 3OIPA 3Q23A 5M3FB 2K7VA 3K0XA 1DYQA 4GKKL 1F9RA 3SEBA 1Q82C 1HQMC 2HQLA 4CGYB 2IX0A 2NZ1D 1X54A 4IPDA 2K6AA 1KL9A 1VQFA 3PUVA 5FJ8H 3L7ZC 2B8FA 2KHJA 4F7XA 1B2TA 3TEHB 1NJIC 2F0WA 3DXJC 1H9SB 4X66L 2NVXB 3DM3A 4JCVE 2OTJA 1WFQA 2UXBQ 1K9MC 4A3EG 2EYJA 1LTAD 2ZT9C 1G6ZA 3GDEA 2RDFA 1ENFA 1PV4A 3T13A 2ZM6Q 4DV3L 3MFGA 4F87A 4UHVA 2GVAA 2H1EA 4AYBB 4HJ5A 4JI1Q 4IUTA 2TMPA 5EPJA 4DF7A 3KYHC 5A2QE 4X64L 5K5PA 1Y1WG 4LWCA 2TSSA 4XYOA 3I70A 3VA5A 4EGVA 1NUCA 4JI0Q 2K1BA 2R7ZB 4WJ3M 3K7UC 3CQZH 4HSPA 3ONAB 2ZJQA 1Q90A 2BOSA 1LTGD 2E5LQ 1NMGA 4IOCA 2NVTH 3PIO3 3K5NA 2JA6G 3GV6A 5DM73 4K0KL 2K5WA 2XRQD 1V1OA 4RGOS 3JAML 1GUTA 1ESFA 2HQEA 4WJWA 1AFPA 4GLXA 4NB3A 1NSNS 4K5WA 1N9WA 5J3BA 4DK0A 1EU4A 2VW9A 1DZ1A 1K8AC 1QVGA 1STHA 5C6AA 4DR3L 4ZKBB 3H09A 3UE1A 5C5MA 4TVAB 2JK8A 4NP5A 3BVGA 2E2IH 4DV7Q 5GROA 2B29A 2EOTA 4DUYQ 1O80A 1UWVA 4H02A 1XNRQ 4KHPL 1EUJA 1XTCD 1HA6A 1BCPF 5JPNC 1N33Q 1XNQQ 4BBSG 1B3AA 4I7AA 3M4YA 2SNSA 2B8GA 1VQ5A 3TDQA 3HEJA 3DHQA 1RF2D 1SFOB 2WAQG 3A0JA 4A93H 4QIWB 2NZHA 3NEMA 4JI2L 4MNOA 1F77A 2B3GA 1PTOD 1SN8A 3IAYA 3J7AF 3OSOA 4DAVA 4U673 1SRUA 4XT1B 1LTID 1ZEQX 4OONA 3BDLA 1WCMG 3MXPA 3I4MG 2Z4HA 4G7OC 1GUOA 3H3VH 3EROA 4I7ZC 4DV2Q 2A5HA 1UEAB 5JJIA 3ICEA 1L0YB 4OEMB 2PNHA 2PYKA 4K8JA 1Z9FA 1XMOL 1PYSB 2N8NA 2UUCQ 4P75A 4YHHL 1X65A 1YIJA 3UDIA 1HUNA 4DK6C 1C48A 1E1OA 1JCKB 3PQIA 2WKCA 3M7NA 5M9OA 4FXGC 1VQ6A 1KABA 3BZCA 2BH8A 3HOUH 2DY8A 3S17B 2BE5C 1T9HA 5J1ZA 4KD3A 4KKUA 1VQLA 4DAYB 4WORA 1KRSA 5E4XA 2B63B 1MJCA 4JI8L 3ND9A 1EFWA 3NQTA 4X65L 2HDLA 1JJ2A 2DNCA 2L0CA 2N49A 3HFZB 2B2UC 4JG2A 5CV9A 5C0XH 4IFDJ 5KNCA 2E8GA 2QGQA 3PUWA 1HNWL 4A3JH 4RKBA 4DV5L 3NXWA 4MTKA 2CVRA 4OIKA 1EQQA 1F2MA 3GTLH 2PMZE 3OTOL 3NQIA 1YZ6A 3NELA 2RHQB 1CT1D 4A3BH 3GTKB 1TIID 3T56B 3M7GA 1I4QA 1AZPA 3OOCA 1F2ZA 2K5HA 2C35B 1QNUA 4L63B 5FLXL 1SDFA 2OEOA 3TQYA 1WVLA 3CXCA 3DMUA 2EY5A 3QWNA 2MNAA 2CW0C 3A74A 2E76C 3WOFA 3ITPA 4KHZA 1VMCA 4NPSA 4BY7B 2MO1A 3L2PA 4JBKA 4OO1G 1SYDA 1IBML 3I4NB 3CCVA 1YNJC 3GTMH 2QDBA 2JA7G 5D3IB 5IYBG 2F3VA 1BCPB 1PRTC 1GUNA 1EIYB 5JJKA 2Z8LA 3MXNB 1PH1A 4KD4A 1PFMA 3ULJA 3TP7A 4GOPB 2YYZA 1VS0A 1M90C 3ER0A 3PF4A 4LF6L 2NWGA 5IYDG 1IXRA 4DU9A 3G6JB 3S1MB 4JI1L 1VQ4A 3HZXA 1JE5A 1WTXA 3KK7A 4A3DH 3HRZC 5EPLA 1Q8KA 3PO2G 2F0DA 4JK1C 1XMQQ 1EY0A 4ILWA 3CC4A 4HCSA 3MHBA 2YTXA 2KHIA 1IHZA 2CWPA 3WWVA 1SJED 2ASBA 1NBWA 3PGZA 5IP9H 4JV5Q 1M1KC 2EXDA 3T53B 2E5LL 3PO3G 3NBIA 4P72A 5IYCG 1LUZA 1SMYD 2RF4A 1CKNB 1HNZQ 1SAPA 2CH4W 5EBCA 1WTVA 3HOXB 2VB3X 5M3FG 3F2DA 4B3MQ 3RNUA 2JN4A 5C3EH 2X69A 2M9VA 1Y14B 1HCZA 3FRPB 4J6HA 5LMNW 3IL8A 4BY1H 4NMZA 1A2TA 5G3LF 1WTHA 1NY4A 3AQQA 4RGMA 3U4ZA 3CCEA 3R2TA 4RHSA 4A3EB 2UUAL 3BDCA 1NCVA 2KHSA 1BXTA 3W3AA 3S1QB 1WYDA 5NUCA 1FL0A 1L0WA 1ICWA 1RKNA 5LMNQ 1S72A 2V1CC 2D62A 2KCMA 4HIKA 1CA6A 1CSPA 4DR1Q 1FYCA 4A3GH 3FPUB 1TVXA 3OW2A 1Y1WB 4AYBG 3BVMA 2XNAC 4PV1C 3OIQA 1N34Q 1I50H 3W2DA 1MSHA 3S15H 1AEXA 4JVZA 4MIUA 4BXXG 1MHWC 1XXGA 3VR2A 3CC2A 3S16H 3FMCA 4EQOA 3R3OA 1HFNA 2NB0A 2WB1B 3KDFA 1YNNC 2JA5G 3Q22A 3CCLA 1HRJA 1M4VA 1DOKA 4POFA 1CKMA 2N55A 2IT1A 3PUXA 5C3WA 3RMHA 3NWTA 5KGUA 1PH6A 2J0TD 1PH4A 4GKKQ 1RD9D 3MEFA 3TP6A 1OTCA 3KLSX 3UDFA 1QUQB 1Y1VH 2KEDA 2WV6D 2I0QA 2AHOB 3HOYG 4HJ8A 5C4JH 2R93G 2I07B 2F3IA 3M4OB 1PH8A 1KC8C 2E74C 1W6JA 2K5DA 2QEXA 1GJXA 1X9NA 2EYPA 4Z9CB 4X66Q 2HCCA 5E4WC 1KLUD 1BQQT 1QE6A 1C7YA 4P71A 2F0FA 1X56A 3S2HB 3H3VC 5I2YA 4ID6A 1CZGA 1GOZA 4DV3Q 1QCBD 5BR8Q 5IP7H 4BBSB 4G7HC 5K36H 2K28A 2I5HA 3CCSA 2Z4IA 4LF8Q 3MAQA 3VDYA 1TWHH 1Q1BA 4X64Q 1JOOA 3H3VI 3FHWA 2Q8RE 4TRDA 3PUYA 4YCVA 1VQNA 4N9TA 1LV9A 1JB3A 3S24A 3RD4A 2D9UA 2F0MA 3BZDB 1K28A 1WCMB 4XQJA 2K52A 4CJ1B 1N8RC 2F0HA 5M5YB 4C3HH 1C8CA 2CQOA 1RTNA 1CQFA 5IGDA 2LS01 3AYHB 4GLAC 4A3MH 1F9QA 2DNEA 3SHLA 3STBD 5CBAE 2RQXA 2PZTA 3UE0A 3TZDA 3RN5A 2I46A 2G9DA 3J7ZC 4DR2Q 1F9SA 2CHBD 3HOWB 4QL5A 1GO3E 1PZJD 2EYMA 3J80E 1QZHA 3S14B 3AFPA 3ERQA 3K8AA 3J81i 3G4SA 4UP9A 3KLSA 4KJNA 1GD7A 1RHPA 4JBMA 4MHEA 2EYHA 3CP0A 2PZUA 3MEHA 4JBJA 4JI3Q 1K83B 1VF7A 1PVOA 3KF6B 2MUYA 2O5IC 2A6EC 2WKDA 3DM1A 1VQ7A 1HNXL 1LTTD 2A68D 1SYGA 2DUDA 2PQAB 3C1EA 3HKZG 1EQRA 3KBXA 2AKWB 2F0GA 2YU9H 1KDCA 4H13C 2IX1A 1OXTA 4WFN3 2E2JH 4GN5A 1YNXA 5E3FA 1WJJA 1XMQL 1RDPD 2F0KA 3N6RA 5IWAL 5CV7A 2JP1A 3I4OA 4JV5L 3T4AC 1OXSC 1UAPA 4ZAIA 2K50A 3DUZA 1TS3A 3NTKA 3A8KE 4OX9L 1YBYA 2RDHA 1HNZL 3EVQA 2F0EA 4Y7NB 3G6EA 1XPRA 3ZYYX 1VQAA 3L0OA 2ATWA 4CKCA 1F9PA 3ULPA 1WTQA 1RCVD 3GTPH 1J8IA 3OMCA 4L5QA 1SR3A 5HGTA 3M3YH 5JJZA 2FXQA 1CK1A 4YWLA 1A8VA 4K14A 3UDGA 3D6CA 5KNBA 4BY7G 1MGSA 3CRKC 4JI5L 4C1NK 3I4NG 2NVQB 2NTTA 1DOMA 2HDMA 1D5ZC 1KAAA 1BCPD 5F2DA 4DR6L 3P7JA 5KNDA 2M00A 4JI8Q 1XX8A 1SYEA 4HIDA 2XSCA 1PRTF 4OIJA 2PI2E 5C4XH 2EY2A 2IJ0A 4NXNQ 4DR1L 1K0SA 2HD3A 2Z0SA 5JEAH 3J80c 4DV5Q 3SXHA 4C3JH 1FNWA 4A75A 2VS1A 4OL7A 1XPUA 2A69D 2QF7A 3FDTA 4K6DA 2VQEQ 4YCUA 1SNOA 2IHFA 3KF8A 4K6LA 4IFDH 4UDUC 1YHBA 3OPOA 3CMAA 3BDOA 1S5DD 5LMUQ 2HIXA 3Q6SA 3C3LA 4JW0A 1A3VA 1X55A 1KIXA 2A6HC 2PQEA 4M8AA 3EA6A 5H1SE 4QUCA 1L2FA 3HOXG 4HR7B 1MD2D 3CCRA 4H44C 1IBMQ 3TN2A 3MZ5A 2OQ0A 1P8LA 2F0SA 1QWYA 2Q8TA 3W5OA 1BVSA 1ONLA 3U4VA 5GAEC 1U9RA 5T1GA 4CKBA 4JI6Q 4C2MH 4K8IA 1GHKA 2KCTA 5BR8L 1RTOA 3EBEA 4LF6Q 2V4DA 2ZJPA 2K5VA 1EWIA 4DR4L 1QOHA 1B7YB 1NE3A 4BBRH 3NTHA 4JI7Q 4LF8L 5GAGC 1Y8PB 1I4GA 1U0LA 5M5WB 2PW7A 2MFIA 4CDEC 2EJFC 3G71A 1B9NA 1Q12A 1RIPA 5M3MB 3AFQA 3NSWA 2VUMH 1TWGB 2JA5B 2MP1A 5A35A 4DAPA 3TS0A 3IFDA 2R92G 2WB1G 1TS2A 2ID0A 4GS3A 3X3MA 1JWSD 5JVH3 1PYBA 3GTGH 3GTOB 3C1FA 1MI2A 2JSOA 4UAIA 1S40A 1EWCA 2L11A 4X6AH 2OXPA 3HOYB 3R93A 4A3IH 2R93B 3NPPA 4JI4L 2IY5B 4PZ6A 1ILQA 3RLFA 1XYIA 3GQBA 4DR2L 4A3KB 5IP9G 2UUAQ 3T51B 4UPAA 4HCEA 5AFWA 3LWEA 2F03A 3I2ZA 3S2DB 1L1OA 1VQEA 1U4PA 2QILA 2A1AA 1LLRD 1ZYRD 1VQ9A 1SNPA 4PMBA 3OWFA 3GTJH 2PO4A 4FO2A 2ZXPA 4RCOA 1H9SA 3BG3A 4PZ8A 1U4RA 4JI3L 4GN4B 3L3OC 3J81L 4S3SA 1EEID 5C3EG 4PMCA 4GNXB 1GKHA 4H7BA 3BS1A 4LUVA 4OGQC 4KY6A 2LXKA 4DPGA 5CORA 3IRBA 5FLXc 3MC0B 2SOBA 3S1NH 3CPFA 2AUKA 1B3QA 5DLQE 2VNUD 1AW7A 3G7LA 2O2LD 1LO5D 2DY7A 3VA7A 2B2VA 2A8VA 3BZKA 1UE5A 3OHXC 1E2VA 2DJFC 3P20A 1H9JA 5IGBA 1TWAH 1STNA 2VL6A 3D6WA 2JA8H 1YHQA 2EIFA 1NR4A 1ILPA 2QA4A 4QY7A 4ZYSA 1LYLA 3EQLC 2FHTA 3S1RH 1C9OA 2J7ZA 2MGSA 5C4HA 4IUPA 4ME5A 5KRUA 5KIXA 3CQZB 4K2KA 3CPWA 1G8ZD 2NVTB 3D0FA 3NK9A 2SDFA 3TBIB 3CW2C 3HOWG 3HOVH 3R2IA 2PMZB 4B3TQ 1DCZA 5BN4A 3PSIA 2Q2HA 4HJAA 1PH2A 3A7AB 5JEAJ 5HGQA 3CKIB 5DAUA 1KDAA 1VQDA 1I6VC 2LMCB 4C3IH 4B3SL 3I3CA 4EQNA 1RODA 4IPGA 4A3FH 4QIWE 1L1OC 1PH3A 3GD7A 4NXNL 3HKZB 4EX5A 2KUMA 3EJIA 2EVBA 1N32Q 1YJWA 3J7YW 2XTIA 2KEEA 4R1JA 4XQNA 3CF5A 2E2IB 3D31A 1KQSA 2RCFA 1YI2A 1BDOA 1STGA 2EY6A 3M9BA 2VQEL 4P2CB 3I55A 1VQOA 1X32A 5I2XA 4LFAL 5FO8B 2VZAA 1K3RA 4FVMA 5IGGA 5IP7G 1ESRA 3J81j 1TWCH 1UNSA 1EYGA 4DR7L 1K8OA 1PXUA 5LMUL 3DEPA 2X6GA 1OXUA 3HG9A 1EFID 2F0LA 2E2HH 2B2VC 2NN6H 3KFUA 4YCWA 1JORA 4JYAL 1HZBA 1W2BA 4A93B 3KUPA 2QDLA 3DWQA 3CCMA 3L9AX 3QOJA 1PLFA 4KJOA 4QQBX 4ZLTF 3QG1A 5AJ3L 4RG1A 4IURA 5M5XH 1CHQD 3JC66 3TS2A 3H0GH 1Y8OB 3FKIH 4A3EH 4NW2A 3K6OA 3LWUA 1STAA 3VYUA 1DXMA 4JI6L 2QW7A 4HIMA 1JE4A 4A3MG 1EY9A 2F52A 1SLJA 2UU9Q 1H9RA 2KA7A 4JC0A 2F3WA 5CGKA 3D8GA 1HNXQ 4NDXA 3T1YQ 4IFDI 1RL2A 1BO0A 1HHVA 5ELCA 4DAYA 5IE8A 1HXYD 4JI7L 3GTQH 5IOCA 2F0QA 4KKSA 5A2QL 5IT9E 1Q3LA 4AIMA 3HOUB 3C2PA 4AH6A 2EJMA 2K33A 5IWAQ 2JA6H 1SE2A 1Z47A 4AQYL 3A7LA 4J8QA 1FGBD 2A73B 4OX9Q 1O7LA 2RSNA 5L37A 2UXCL 4A3JB 1BBXC 4RGTA 3PCOB 2EPBA 1TXYA 2R3ZA 1FNVA 1SYFA 1VQKA 3GTLB 1LTSD 1Q8IA 2L1BA 3F2UA 4ODGA 1D7QA 1U5KA 2KBNA 4DV6L 1STYA 2LXJA 2ZTEA 1TKWB 4JI5Q 4A3BB 1X3GA 2L55A 4IN3A 3H94A 3STBC 4LAAA 4LFBQ 4R8IA 4DR6Q 4OXPA 5D14A 2GN5A 1FD7D 4HAEA 1EYAA 2L5TA 3MA2B 2MO0A 2Y0SE 4CHTB 1VQJA 1GVPA 3S9WA 5JVG3 1PHJA 3MXNA 3CHBD 1Q86C 1I4RA 3GTMB 2WACA 3C46A 1N36L 3PMFA 3H6MA 1PTOH 3RZDH 4FXDA 4A76A 1VQBA 2FJ2A 1EOTA 3FPPA 3I8ZA 4KV6A 4LF4L 2PNRC 3F8TA 4FXKC 3I4MH 5M3MG 4JOIA 3A55A 2F4VQ 1DGSA 2R92B 4HJ7A 2ZJRA 3D4DA 4R4IA 3CU7A 1U4MA 2SEBD 1QVFA 1EEFD 4LFCL 2K5NA 4IPHA 5D3DA 3HP3A 2CH4A 4HSVA 1CA5A 2IWHA 1LABA 3AB9A 3BU2A 5IT9c 4A3DB 3U58A 1KRTA 4KLKA 1LM0A 4C3JG 4R9WA 3VYSA 1CKNA 3K5OA 4L5TA 2NZOA 3VR5A 5D65A 2EE1A 4FDBA 1BF4A 2GVBA 4YY3Q 3J7A5 1TR5A 4HEDA 3F2CA 1I3QH 5IGFA 1YNJD 5C4ZA 2EJGC 4IFDG 5FLMG 5C44H 2K4KA 1C0AA 5J22A 4A3KG 3MFYA 2K5QA 3A5ZB 1OXVA 3VR6A 3RN2A 3FVQA 4B3TL 4LF7Q 3NTIA 1JJGA 3I90A 1TQOA 2QKIC 2R61A 2RCNA 3EN2A 3F1ZA 2HHHQ 3I56A 1I6HH 3PUZA 2CWAA 2A74C 2GA4B 4NKLA 1VCIA 5C3EB 1J9OA 4NXML 1CTMA 1GXDC 4DR4Q 1KHIA 1JOKA 2K32A 3OW7A 4CDFC 4BY1B 4H0LC 2PPBC 5FJ8G 2NBFA 1GUSA 2EYFA 1B9MA 3DLLA 4DAMA 1N32L 3A56A 3QIAA 3RZOH 1IW7C 4PG3A 1PH5A 4ZQ3A 2OF1A 3CAMA 3D3RA 1U4LA 2HT1A 3HOZH 2KQ3A 1JOQA 1V1PB 3E5SA 1EL0A 2F0PA 1EIFA 4TSSA 1YJNA 2F0IA 1OO9B 1KDBA 1R9TH 4XXEA 4DNRB 4IJLA 1HQRD 1I50B 4GN3B 1WTWA 3S15B 5ELOA 4OO1H 4RAUC 3J80i 3G48A 4JI4Q 4X3UA 2JA7H 5IYBH 3S16B 1H9KA 5ELEA 1IBKQ 1A15A 2FFKB 1EZ8A 2D2CC 3CD6A 1BOSA 4R4QA 1TWFH 4KTAA 2N78A 4IUUA 3JAME 2E2DC 4ZRZA 5IY0A 5C0XI 4DKAC 1QUQA 3P1HA 3TP8A 1LT6D 1OXXK 4Y52H 4L5RC 1VQIA 2WAQE 4YWMA 2J4XA 4DNTB 2B2WA 5CMDA 1IYUA 1C4QA 2UU9L 1E0BA 1Y1VB 2NYZD 3I7FA 4CJ0B 5C4JB 4A3IG 2LY7A 5KYIA 3T1YL 3PO2H 4RKLA 2F4IA 1ASZA 3KLRA 2CKZB 4N8X1 2EDGA 5GAHC 3CRLC 1HTLD 5ELNA 2AMCB 1K0RA 2NN6I 3RLNA 3PO3H 2EXZA 4L5SA 2JJQA 1UE7A 5IGCA 1D6EC 3O13A 4LF9Q 4YIJA 3M4QA 3U9SA 1YNND 2NVYH 1ET6A 2R7FA 3LNNA 5M3FH 1CUKA 3ULLA 3SGIA 1TWHB 1SYBA 4MN3A 4DA2A 4TQUS 3ND8A 4KI0A 4KY7A 3NENA 4B3RQ 2YV5A 3CCJA 4FF1A 4DXGA 5EKIA 1EWHA 1DONA 2G5DA 4A93G 2O5JC 4DGZA 3GP7A 4C3HB 2NVXH 4LK1C 1PH7A 5C5LA 4UP7A 4XDXA 4A3MB 4LFBL 1UE1A 2EYOA 5EAYA 1LT5D 5JOBA 1BBWA 1EY6A 3KJPA 1HR0W 4B3SQ 2HCIA 1S5FD 2QCPX 1QZGA 4HJ9A 5FK9C 1EY5A 2OWOA 1J6QA 1QVCA 3I91A 3QB3A 3K57A 1H95A 1GM5A 1Q81C 2FMCA 1LT3D 3GV3A 3JAMc 3D4WA 4PMWA 4QCLA 1VQ8A 2B2WC 5DNFA 3KF6A 5BN5A 1HR0Q 5I9OA 2DGYA 2R7ZH 3LGJA 3OWEB 3K7AB 3FP9A 3FEWX 1HZ9A 2VQFL 3HOUG 2PZWA 2ICIA 2PQAA 4XQQA 4LFAQ 1Q7YC 2JQOA 2F4VL 1EY7A 5J39A 5CV4A 4RMFA 4C3IG 1E22A 2L12A 4DR7Q 4BA1I 4OHJA 2UUBQ 1SNCA 1DOLA 2BDNA 1B50A 1D2BA 3SR1A 2IL8A 5C0XG 4JYAQ 2YU9B 1KXLA 1PTOC 4RFBA 4A3JG 2E2JB 2K04A 4FF3A 1EY4A 4IALA 5ELDA 4LJZC 4GLVB 5AJ3Q 1QNKA 5EKKA 4BS9A 3EFXD 3E9HA 3T16A 2KJXA 4B9WA 4YY3L 2E75C 5I6YA 4R4CA 1T5XD 3BYTB 5FLXE 3E6ZX 2C5CA 2RKSA 4A3BG 5C3XA 1D5XC 2AQ3B 4LUOA 5EKLA 4MTNA 4LF7L 5IODA 4ZCKA 1Z7TA 1BUVT 2HHHL 2NN6G 4DV4Q 1L1OB 3GTPB 1JMCA 1SNQA 2F0NA 2AUJD 3M3YB 2JXMB 1M8AA 3OYYA 4Q0FA 3AMUA 4HTHA 2DJGC 2OTLA 4BA2I 1LT4D 1PFNA 2A6ED 1BBUA 1J5EQ 3BJUA 4HMIA 3HGBA 1SE4A 1SFOH 3H0GG 2PW5A 3FKIG 2MPMA 1LACA 4QB4A 2F1MA 4IZ8A 2WIIB 1CFMA 1E1TA 2IPKD 1PA6A 4AQYQ 1GUWA 2EZVA 5C4XB 4DUZQ 3WDNA 1FJGL 2KECA 1IBLQ 2B2TA 4QMGA 2NUCA 4A3LH 2UXCQ 1L0XB 3TREA 2D0PA 3NBHA 1A63A 4C3JB 1KAWA 1X3EA 2N88A 2ES2A 2EQSA 3X3NA 1CHPD 3HKSA 1TS4A 2LFNA 4A3DG 4APVA 1SYCA 3TMEA 3B6YA 4DV6Q 2G9HD 3J7AV 1IBKL 4FYDA 2Q8IB 1VDZA 1PRTB 1RJTA 1WI5A 2BA1A 3HS0C 2EY1A 1G2SA 1V43A 3J80L 3S17H 4AYBE 3WOEA 5HY6A 1E2ZA 1ENCA 2K75A 1YJ9A 1X3QA 4QUFA 2B63H 3PF5A 1TT2A 2RVLA 2IX3A 3W1BA 2B39A 1NAPA 4IPCA 1UE6A 1MBYA 5E1FA 1VF5C 4DV0Q 3VYRA 1N36Q 2KCNA 2AQ2B 4BY1G 5CBEE 1G51A 1S5BD 2DN8A 4QGUA 4V0BA 2B2UA 4LF4Q 4G4KA 3Q0AA 1AN8A 4C2MB 1V9PA 4G57A 1S3OA 4OO1I 1A3TA 5CV8A 1B8AA 1Q1EA 5ELFA 4OWXB 1IKMA 1XJVA 3GTKH 4LFCQ 4LF9L 1SE3A 3NWSA 2L4NA 4WJ4A 4DV1L 4BBRB 3TP5A 4A3GG 1UUPA 5CYUA 1KNAA 4R4TA 4O1NA 4X3TA 5TSSA 3BVZA 2A6HD 1X6OA 1K3BC 2KCCA 2B2TC 4B3RL 1MSGA 5G3LD 4BY7H 1VQHA 3KBGA 2VUMB 3I4NH 2L15A 4CKEA
chains in the Genus database with same CATH topology
1SMYC 4BWGB 4KK7A 1SSOA 3IFTA 2B2YA 4M1UB 3GTGB 5ELBA 2RDGA 5LHY1 4A3IB 1SNMA 1ZKOA 3VR3A 5EJWA 3QO2A 4RHRA 1JICA 2ZXOA 1EQVA 1O7YA 4FNFA 1FR3A 5EGTA 3OMGA 5EQ0A 1ET9A 5IIFA 1PMRA 2VXWA 2FMMA 3GTJB 1Z6HA 3K59A 3SDZA 3GO5A 4K5XA 1V8QA 1BR9A 4IQZA 2EYLA 1HUMA 1SJHD 1WTPA 5K36G 4HN7A 3K5LA 3H91A 5COYA 1I4HA 1TS5A 3S1NB 1STEA 5EPKA 5CC4A 3QJYA 4R8NA 5KYLA 3TSSA 1F2LA 3V96A 2R6GA 1FNUA 2SNMA 1Y8NB 5CV5A 1TU2B 4C3HG 1TWAB 3MWYW 2JA8B 1JWMD 4F8MA 1JR0D 4JBWA 4K2LA 4IUVA 2K05A 4WRDA 3S1RB 3DWPA 2B2YC 2F0JA 2Z1CA 3LX0A 1LTRD 1EQTA 2JYOA 1PZID 3HOVB 1O7ZA 4XT3B 3P75A 1G91A 2JEAI 3K5MA 4C3IB 4XTCS 1WD1A 1EIHA 4G7ZC 5BN3A 4A3FB 4RA8A 5KEEA 2XRSD 2K03A 1SXTA 1GHJA 3URYA 2Y0SB 3D4RA 4RWSC 1R4PB 5I6WA 4N9PA 3VR4A 2XWJB 4DK1A 3K58A 4KKTA 4FP5D 4ABNA 1PTOF 2M2LA 2WP8J 1TWCB 4ZUIA 1DM0B 1S5ED 4TKOB 2X6LA 1K8MA 1G291 4C1NI 1HPCA 4KN7C 2E2HB 2QEJC 2BE5D 2RA4A 2AWOA 4DFAA 1A2UA 4O42A 5FO9B 2PCFB 4GZYC 1HTPA 4E6IA 2F0TA 5M5XB 4KHVA 3H0GB 1S4ZA 3FKIB 5FO7B 3UI2A 2IW3A 3QOLA 1EY8A 3SK4A 5FOBB 5DM63 2FINB 1IL8A 3I73A 1ML0D 3MXUA 4ZKCB 1QJOA 1WTRA 1R4QB 1I4XA 2A68C 1IKLA 4I65A 3NHHA 4QF4A 2XWBB 5CR3A 3GTQB 1JQYD 4KY5A 2L9HA 1O78A 5JEAG 2CQAA 3V05A 3A8JE 1QB5D 4F88A 2JA6B 2BCOA 2CW0D 4K5VA 2ICEC 1CZWA 1H9MA 1B44D 4IUNA 4HMJA 1B53A 2D5DA 1AZQA 3N52A 1PRTD 5DEHA 5ISRA 4KMUC 4B08A 3SK5A 3MXGA 3NUCA 5JAVA 2MHVA 1D1IA 4DXFA 2MJ8A 1EZ6A 2HUGA 4B9XA 4DN4M 4KN4C 4ZK9B 3TZUA 1ZXTA 2XVSA 1DJRD 5C0XJ 1BCPC 4PQXA 4V190 4L6TB 3BYYB 4CBVA 1SNDA 1PZKD 3PIP3 2BA0A 1KLGD 1D1KA 1EYCA 4ZUJA 1WTOA 1A6XA 5I9PA 5EBDA 2H4OA 4A3GB 1W6KA 4RCNA 1XWEA 2KOLA 2WAQB 1AP0A 4EQPA 2A69C 1PTOB 3RZDB 4Q5VA 1BNZA 1GUGA 1T5EA 1KTKA 1TY0A 2XIWA 5LL6S 4FF4A 1QG7A 3I4MB 4XIGS 3MVVA 5I4DA 3DWAA 2F0VA 2NTSA 2K01A 1EYDA 1E2WA 4X3KA 1ENAA 1I4PA 2JE6I 1HFGA 1STBA 1II3A 1JC7A 3DEOA 5CV6A 3U9OA 1A3UA 1CM9A 1I3QB 1NR2A 1SEBD 1B4OA 5C44B 2O4XA 2RBMA 2WINB 5IT9L 1PFBA 3A54A 1F2YA 1PYWD 1I6HB 3J81E 2BDOA 2RSOA 3I72A 1X3PA 3RUZA 2JEBI 5T1IA 5LL6X 4FF2A 1JWUD 1V1PA 3RZOB 3SE0A 3NP8A 1CI3M 1WD0A 1DD2A 2F0UA 5IGEA 4RGNA 2ZXRA 3V2TA 2ENBA 3HOZB 3Q24A 4PNYA 3IKJA 1G2TA 1S5CD 2C9OA 5FKAC 3SK6A 1R9TB 3MTSA 4LMQD 4J1MA 1CQVA 2XN9C 5JPMC 2AQ1B 1HA5A 1TY2A 1IYVA 3AU7A 2JA7B 3M85A 4U68A 3VYTA 3E0JA 3NE5B 2OT2A 4ULLA 1TWFB 3I4LA 1ZYRC 3SK8A 3K0YA 3A8IE 1EU3A 1Y69U 1IW7D 1KNEA 4IUQA 1SBBB 4X3SA 1EIGA 2F0OA 3PV0A 4L8JA 3PO2B 2VB2X 4RH6A 1PDQA 1QILA 4XYQA 4CJ2C 2LKVA 3PO3B 1B1ZA 5HURA 4C56C 4EVOA 1LTBD 3R8BA 1VMPA 3SVMA 2NVYB 1D5MC 2KVMA 2AWNA 3OIPA 3Q23A 5M3FB 2K7VA 1DYQA 1F9RA 3SEBA 1HQMC 4CGYB 2IX0A 2NZ1D 2K6AA 3PUVA 3L7ZC 2B8FA 4F7XA 1B2TA 2F0WA 3DXJC 1H9SB 2NVXB 2EYJA 1LTAD 2ZT9C 1G6ZA 2RDFA 1ENFA 3T13A 3MFGA 4F87A 2H1EA 4AYBB 4IUTA 2TMPA 5EPJA 4DF7A 5A2QE 5K5PA 2TSSA 4XYOA 3I70A 3VA5A 4EGVA 1NUCA 2R7ZB 2K1BA 4HSPA 3ONAB 1Q90A 2BOSA 1LTGD 3PIO3 3K5NA 3GV6A 5DM73 2K5WA 2XRQD 1V1OA 4RGOS 3JAML 1GUTA 1ESFA 2HQEA 4WJWA 1AFPA 1NSNS 4K5WA 4DK0A 1EU4A 1DZ1A 1STHA 5C6AA 4ZKBB 3H09A 5C5MA 4NP5A 3BVGA 2EOTA 1O80A 1HA6A 1XTCD 1BCPF 5JPNC 1B3AA 3M4YA 2SNSA 2B8GA 3TDQA 3HEJA 3DHQA 1RF2D 1SFOB 4QIWB 1F77A 1PTOD 3IAYA 3J7AF 3OSOA 4DAVA 4U673 4XT1B 1LTID 1ZEQX 3BDLA 3MXPA 4G7OC 2Z4HA 1GUOA 3EROA 4I7ZC 2A5HA 1UEAB 1L0YB 2PYKA 4K8JA 1HUNA 1C48A 1JCKB 2WKCA 3M7NA 5M9OA 4FXGC 1KABA 2DY8A 3S17B 2BE5C 5J1ZA 4KD3A 4KKUA 4WORA 5E4XA 2B63B 3ND9A 3NQTA 2HDLA 2DNCA 2L0CA 2B2UC 5CV9A 5C0XH 4IFDJ 5KNCA 3PUWA 4RKBA 3NXWA 2CVRA 4OIKA 1F2MA 3NQIA 1CT1D 3GTKB 1TIID 3T56B 3M7GA 1I4QA 1AZPA 3OOCA 1F2ZA 4L63B 1QNUA 5FLXL 1SDFA 2OEOA 1WVLA 3DMUA 2EY5A 3QWNA 2CW0C 2E76C 3WOFA 3ITPA 4KHZA 1VMCA 4BY7B 4OO1G 1SYDA 3I4NB 1YNJC 2QDBA 5D3IB 2F3VA 1BCPB 1PRTC 1GUNA 2Z8LA 4KD4A 1PFMA 3TP7A 2YYZA 2NWGA 4DU9A 3G6JB 3S1MB 3HZXA 1WTXA 3KK7A 3HRZC 5EPLA 2F0DA 4JK1C 1EY0A 4ILWA 4HCSA 3MHBA 1IHZA 1SJED 3T53B 3NBIA 1SMYD 1SAPA 5EBCA 1WTVA 3HOXB 2VB3X 2X69A 2M9VA 1HCZA 3FRPB 4J6HA 3IL8A 4NMZA 1A2TA 5G3LF 4RGMA 3R2TA 4RHSA 4A3EB 3BDCA 1NCVA 2KHSA 1BXTA 3W3AA 3S1QB 5NUCA 1ICWA 1RKNA 2D62A 1CA6A 1FYCA 3FPUB 1TVXA 1Y1WB 3BVMA 2XNAC 4PV1C 3OIQA 3W2DA 1MSHA 1AEXA 4MIUA 1XXGA 3VR2A 3FMCA 4EQOA 3R3OA 1HFNA 2NB0A 2WB1B 1YNNC 3Q22A 1HRJA 1M4VA 1DOKA 2N55A 2IT1A 3PUXA 5C3WA 3RMHA 3NWTA 5KGUA 2J0TD 1RD9D 3TP6A 3KLSX 2KEDA 2WV6D 2I07B 3M4OB 2E74C 1W6JA 2K5DA 1GJXA 2EYPA 4Z9CB 2HCCA 5E4WC 1KLUD 1BQQT 1QE6A 2F0FA 3S2HB 3H3VC 5I2YA 4ID6A 1CZGA 1GOZA 1QCBD 4BBSB 4G7HC 5K36H 2K28A 2Z4IA 3MAQA 1Q1BA 1JOOA 2Q8RE 4TRDA 3PUYA 4N9TA 1LV9A 1JB3A 3RD4A 2D9UA 2F0MA 3BZDB 1WCMB 4XQJA 4CJ1B 2F0HA 5M5YB 1C8CA 1RTNA 1CQFA 5IGDA 2LS01 1F9QA 2DNEA 3SHLA 5CBAE 2RQXA 2PZTA 3TZDA 2I46A 2G9DA 3HOWB 1F9SA 2CHBD 1PZJD 2EYMA 3J80E 3S14B 3ERQA 3KLSA 4KJNA 1RHPA 4MHEA 2EYHA 2PZUA 3MEHA 1K83B 1VF7A 2MUYA 2O5IC 2A6EC 2WKDA 3DM1A 1LTTD 2A68D 1SYGA 3C1EA 3KBXA 2F0GA 1KDCA 4H13C 2IX1A 1OXTA 4WFN3 5E3FA 1RDPD 2F0KA 3N6RA 5CV7A 2JP1A 3T4AC 1OXSC 1UAPA 4ZAIA 3DUZA 1TS3A 3NTKA 3A8KE 2RDHA 3EVQA 2F0EA 4Y7NB 3ZYYX 4CKCA 1F9PA 1WTQA 1RCVD 1J8IA 3OMCA 5HGTA 5JJZA 1CK1A 4K14A 3D6CA 5KNBA 1MGSA 3CRKC 4C1NK 2NVQB 2NTTA 1DOMA 2HDMA 1D5ZC 1KAAA 1BCPD 5F2DA 3P7JA 5KNDA 2M00A 1XX8A 1SYEA 2XSCA 1PRTF 4OIJA 2EY2A 2IJ0A 5JEAH 3SXHA 1FNWA 4OL7A 2A69D 2QF7A 3FDTA 4K6DA 1SNOA 3KF8A 4K6LA 4IFDH 4UDUC 3OPOA 3BDOA 1S5DD 3Q6SA 3C3LA 1A3VA 2A6HC 2PQEA 4M8AA 3EA6A 4QUCA 4HR7B 1MD2D 4H44C 3TN2A 3MZ5A 2F0SA 1QWYA 2Q8TA 1ONLA 1U9RA 5T1GA 4CKBA 4K8IA 1GHKA 1RTOA 2V4DA 1QOHA 3NTHA 1Y8PB 1I4GA 5M5WB 2PW7A 2EJFC 1B9NA 1Q12A 5M3MB 3NSWA 1TWGB 2JA5B 2MP1A 5A35A 4DAPA 3IFDA 1TS2A 2ID0A 3X3MA 1JWSD 5JVH3 3GTOB 3C1FA 1MI2A 2JSOA 4UAIA 1EWCA 2L11A 2OXPA 3HOYB 3R93A 2R93B 3NPPA 1ILQA 3RLFA 1XYIA 3GQBA 4A3KB 3T51B 4HCEA 5AFWA 3LWEA 2F03A 3S2DB 1U4PA 2QILA 1ZYRD 1LLRD 1SNPA 4PMBA 3OWFA 2PO4A 4FO2A 2ZXPA 4RCOA 1H9SA 3BG3A 1U4RA 3L3OC 3J81L 4S3SA 1EEID 4PMCA 4H7BA 3BS1A 4OGQC 4KY6A 5CORA 3MC0B 2SOBA 2AUKA 2VNUD 1AW7A 3G7LA 2O2LD 1LO5D 2DY7A 3VA7A 2B2VA 3OHXC 1E2VA 3P20A 1H9JA 5IGBA 1STNA 3D6WA 1NR4A 1ILPA 4ZYSA 3EQLC 2FHTA 2J7ZA 2MGSA 5C4HA 4IUPA 4ME5A 5KRUA 5KIXA 3CQZB 4K2KA 1G8ZD 2NVTB 2SDFA 3TBIB 3NK9A 3R2IA 2PMZB 1DCZA 5BN4A 3A7AB 5JEAJ 3CKIB 5DAUA 1KDAA 1I6VC 2LMCB 3I3CA 4EQNA 1RODA 3GD7A 3HKZB 2KUMA 3EJIA 2EVBA 3J7YW 2KEEA 4XQNA 2E2IB 3D31A 1BDOA 1STGA 2EY6A 4P2CB 1X32A 5I2XA 5FO8B 4FVMA 5IGGA 1ESRA 1UNSA 1K8OA 1PXUA 3DEPA 2X6GA 1OXUA 3HG9A 1EFID 2F0LA 2B2VC 2NN6H 1JORA 4A93B 3KUPA 3DWQA 3L9AX 3QOJA 1PLFA 4KJOA 4ZLTF 3QG1A 4IURA 1CHQD 1Y8OB 4NW2A 3K6OA 3LWUA 1STAA 3VYUA 1DXMA 1JE4A 1EY9A 1H9RA 2KA7A 2F3WA 5CGKA 3D8GA 4NDXA 4IFDI 1BO0A 1HHVA 5ELCA 4DAYA 1HXYD 5IOCA 2F0QA 4KKSA 5A2QL 5IT9E 1Q3LA 3HOUB 3C2PA 2EJMA 2K33A 1SE2A 1Z47A 3A7LA 4J8QA 1FGBD 2A73B 1O7LA 2RSNA 4A3JB 1BBXC 4RGTA 2EPBA 2R3ZA 1FNVA 1SYFA 3GTLB 1LTSD 1Q8IA 2L1BA 3F2UA 4ODGA 1STYA 1TKWB 4A3BB 2L55A 4IN3A 3H94A 4LAAA 4R8IA 5D14A 1FD7D 4HAEA 1EYAA 2L5TA 3MA2B 4CHTB 3S9WA 5JVG3 3MXNA 3CHBD 1I4RA 3GTMB 2WACA 3C46A 3PMFA 3H6MA 1PTOH 4FXDA 2FJ2A 1EOTA 3FPPA 3I8ZA 4KV6A 2PNRC 4FXKC 3A55A 2R92B 3D4DA 3CU7A 1U4MA 2SEBD 1EEFD 5D3DA 3HP3A 1CA5A 4HSVA 2IWHA 1LABA 3AB9A 4A3DB 4C3JG 4R9WA 3VYSA 3K5OA 3VR5A 5D65A 2EE1A 1BF4A 1TR5A 4HEDA 5IGFA 1YNJD 5C4ZA 2EJGC 4IFDG 5J22A 3MFYA 2K5QA 3VR6A 1OXVA 3FVQA 3NTIA 1TQOA 2QKIC 2R61A 3I90A 3PUZA 2A74C 2GA4B 4NKLA 1VCIA 5C3EB 1J9OA 1CTMA 1GXDC 3OW7A 1JOKA 2K32A 4BY1B 4H0LC 2PPBC 2NBFA 1GUSA 2EYFA 1B9MA 3A56A 3QIAA 1IW7C 4ZQ3A 2OF1A 3D3RA 1U4LA 2KQ3A 1JOQA 1V1PB 3E5SA 1EL0A 2F0PA 4TSSA 2F0IA 1OO9B 1KDBA 4XXEA 4DNRB 1HQRD 1I50B 1WTWA 3S15B 4OO1H 4RAUC 4X3UA 3S16B 1H9KA 5ELEA 1A15A 2FFKB 1EZ8A 2D2CC 1BOSA 4KTAA 4IUUA 3JAME 2E2DC 4ZRZA 5C0XI 3P1HA 3TP8A 1LT6D 1OXXK 2J4XA 4DNTB 2B2WA 5CMDA 1IYUA 1C4QA 1E0BA 1Y1VB 2NYZD 4CJ0B 5C4JB 2LY7A 5KYIA 4RKLA 2F4IA 3KLRA 2EDGA 3CRLC 1HTLD 2NN6I 2EXZA 5IGCA 1D6EC 3O13A 4YIJA 3U9SA 1YNND 1ET6A 3LNNA 1TWHB 1SYBA 4MN3A 4DA2A 4TQUS 3ND8A 4KI0A 4KY7A 4FF1A 4DXGA 5EKIA 1EWHA 1DONA 2O5JC 4DGZA 3GP7A 4C3HB 4LK1C 5C5LA 4XDXA 4A3MB 2EYOA 5JOBA 1LT5D 1EY6A 2HCIA 1S5FD 2QCPX 5FK9C 1EY5A 3I91A 3QB3A 3K57A 2FMCA 1LT3D 3GV3A 3D4WA 4PMWA 4QCLA 2B2WC 5DNFA 5BN5A 5I9OA 3OWEB 3K7AB 3FEWX 2PZWA 2ICIA 4XQQA 1EY7A 5J39A 5CV4A 4C3IG 2L12A 4BA1I 4OHJA 1SNCA 1DOLA 2BDNA 1B50A 1D2BA 3SR1A 2IL8A 5C0XG 2YU9B 1PTOC 4RFBA 2E2JB 2K04A 4FF3A 1EY4A 4IALA 5ELDA 4LJZC 1QNKA 5EKKA 4BS9A 3EFXD 3T16A 2KJXA 4B9WA 2E75C 5I6YA 1T5XD 3BYTB 5FLXE 3E6ZX 2C5CA 2RKSA 5C3XA 1D5XC 2AQ3B 5EKLA 5IODA 1Z7TA 1BUVT 2NN6G 3GTPB 1SNQA 2F0NA 2AUJD 3M3YB 2JXMB 1M8AA 3AMUA 4Q0FA 4HTHA 4BA2I 1LT4D 1PFNA 2A6ED 4HMIA 3HGBA 1SE4A 2PW5A 2MPMA 1LACA 4QB4A 2F1MA 4IZ8A 2WIIB 1CFMA 2IPKD 1GUWA 2EZVA 5C4XB 3WDNA 2KECA 2B2TA 4QMGA 2NUCA 1L0XB 3NBHA 4C3JB 2N88A 3X3NA 1CHPD 1TS4A 2LFNA 1SYCA 3TMEA 2G9HD 3J7AV 4FYDA 2Q8IB 1VDZA 1PRTB 1RJTA 2BA1A 3HS0C 2EY1A 1G2SA 1V43A 3J80L 3WOEA 1E2ZA 1ENCA 1X3QA 4QUFA 1TT2A 2RVLA 2IX3A 2B39A 1NAPA 1MBYA 5E1FA 1VF5C 3VYRA 2KCNA 2AQ2B 5CBEE 1S5BD 2DN8A 4V0BA 2B2UA 4G4KA 3Q0AA 1AN8A 4C2MB 4G57A 4OO1I 1A3TA 5CV8A 1Q1EA 5ELFA 1IKMA 1SE3A 3NWSA 2L4NA 4BBRB 3TP5A 1UUPA 5CYUA 1KNAA 4O1NA 4X3TA 5TSSA 3BVZA 2A6HD 2KCCA 2B2TC 1MSGA 5G3LD 3KBGA 2VUMB 4CKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVM A;  1VMP A;  2L11 A;  1O80 A;  4XT3 B;  1AZP A;  2MPM A;  1CA6 A;  2KVM A;  3R93 A;  2L1B A;  3F2U A;  3FPU B;  5CBA E;  2KUM A;  1G91 A;  1HA6 A;  1SDF A;  1B53 A;  1AZQ A;  1WVL A;  1TVX A;  1B3A A;  3N52 A;  1F9R A;  1SSO A;  2B2Y A;  2EOT A;  2RSO A;  1ILQ A;  3TZD A;  1XYI A;  1WD1 A;  1EIH A;  2KEE A;  1GUW A;  4XDX A;  1X3P A;  1VMC A;  2NZ1 D;  4RA8 A;  1F9S A;  1MSH A;  3FDT A;  5T1I A;  1U4L A;  2KEC A;  4R8I A;  2K03 A;  2B2T A;  3LWE A;  2MJ8 A;  2HUG A;  5AFW A;  1EL0 A;  1X32 A;  5D14 A;  1B2T A;  1U4P A;  2HCI A;  4HAE A;  5EJW A;  1ESR A;  1HFN A;  4DN4 M;  4RWS C;  1RHP A;  3QO2 A;  4MHE A;  4ZK9 B;  2N88 A;  1ZXT A;  3Q6S A;  3DEP A;  4XT1 B;  1HRJ A;  2X6G A;  1WD0 A;  1JIC A;  1DOK A;  3I91 A;  1U4R A;  2B2V C;  2N55 A;  1WTW A;  1PFM A;  1G6Z A;  4RAU C;  3GV3 A;  1O7Y A;  2B2W C;  5DNF A;  3KUP A;  4X3U A;  1G2T A;  4QUC A;  1PLF A;  2M2L A;  2NWG A;  3DM1 A;  4ZLT F;  1A15 A;  2FFK B;  2FJ2 A;  5COR A;  1EOT A;  1RJT A;  2H1E A;  3I8Z A;  5EQ0 A;  1G2S A;  2X6L A;  2VXW A;  2FMM A;  3MTS A;  4IUR A;  4LMQ D;  3KBX A;  4IUT A;  3TN2 A;  2KED A;  4IUU A;  1WTO A;  5EPJ A;  1WTX A;  4NW2 A;  5EPL A;  3G7L A;  1X3Q A;  4QUF A;  2DY7 A;  2RA4 A;  2KOL A;  1HUM A;  2Q8T A;  2L12 A;  1WTP A;  2RVL A;  1HUN A;  1AP0 A;  2B2V A;  4HCS A;  4O42 A;  2HCC A;  5E4W C;  2JP1 A;  1QE6 A;  4U68 A;  5T1G A;  1JE4 A;  2K1B A;  1DOL A;  1U4M A;  2BDN A;  1BNZ A;  3H91 A;  5COY A;  2B2W A;  1B50 A;  5CMD A;  2IL8 A;  1NAP A;  4ZAI A;  1E0B A;  2XIW A;  3ONA B;  3HP3 A;  1CA5 A;  2DY8 A;  3D6W A;  1QG7 A;  4HSV A;  5EPK A;  1S4Z A;  2NYZ D;  4CJ0 B;  1NR4 A;  1RTO A;  1ILP A;  2K04 A;  3UI2 A;  3GV6 A;  1F2L A;  5E4X A;  5CBE E;  2FHT A;  1SAP A;  1QNK A;  1BO0 A;  1HHV A;  2K28 A;  2J7Z A;  2K01 A;  2MGS A;  4R9W A;  2B2U A;  1WTV A;  2FIN B;  1IL8 A;  1KNE A;  1F9P A;  4IUP A;  1WTQ A;  1ML0 D;  2HDL A;  4IUQ A;  4ZKC B;  1J8I A;  4X3S A;  2B2U C;  1WTR A;  5D65 A;  2EE1 A;  1BF4 A;  3MWY W;  1Q3L A;  4X3K A;  4HED A;  2Q8R E;  2X69 A;  5JJZ A;  1EIG A;  1HFG A;  2SDF A;  3IL8 A;  1IKM A;  1LV9 A;  4IUV A;  1MGS A;  1DZ1 A;  2D9U A;  2K05 A;  1IKL A;  1PDQ A;  2CVR A;  4OIK A;  2L4N A;  3DEO A;  3I90 A;  1DOM A;  2MP1 A;  2B2Y C;  2HDM A;  4CJ1 B;  2L9H A;  4ZKB B;  1CM9 A;  1KNA A;  3IFD A;  1C8C A;  2RSN A;  1RTN A;  1NCV A;  4X3T A;  4MN3 A;  4CJ2 C;  1J9O A;  3P7J A;  1NR2 A;  3I3C A;  1M8A A;  1ROD A;  1EQT A;  2JYO A;  1XX8 A;  1B4O A;  1MSG A;  2B2T C;  1BBX C;  1PFN A;  2EPB A;  1ICW A;  4OIJ A;  1MI2 A;  5EKI A;  2R3Z A;  4UAI A;  1DON A;  1F9Q A;  1PFB A;  1O7Z A; 
#chains in the Genus database with same CATH topology
 1SMY C;  3CC7 A;  4ME3 A;  4BWG B;  4KK7 A;  1SSO A;  3IFT A;  2B2Y A;  4M1U B;  2Q2U A;  3GTG B;  5ELB A;  2HIV A;  2RDG A;  4DNI A;  4A3C H;  5LHY 1;  1NTG A;  4A3I B;  4NXM Q;  1SNM A;  1ZKO A;  3VR3 A;  5EJW A;  4O2D A;  3QO2 A;  3S1M H;  2CFM A;  1Y1V G;  4RHR A;  1JIC A;  2ZXO A;  4DK3 C;  1EQV A;  1ICF B;  3E3X A;  1SMX A;  1O7Y A;  1HR0 L;  1SE8 A;  2UXD L;  5C44 G;  4FNF A;  1HZA A;  1FR3 A;  4GNX A;  5EGT A;  1NNX A;  3OMG A;  5EQ0 A;  1ET9 A;  5IIF A;  1PMR A;  2VXW A;  2FMM A;  3GTJ B;  1SRO A;  1Z6H A;  3K59 A;  3SDZ A;  1IYJ B;  3GO5 A;  4K5X A;  1V8Q A;  1IL2 A;  1BR9 A;  4IQZ A;  2EYL A;  1NMF A;  1HUM A;  1SJH D;  1WTP A;  4ALP A;  2UUB L;  5K36 G;  4HN7 A;  2XGT A;  4JPB W;  3HOX H;  3K5L A;  3H91 A;  5COY A;  1I4H A;  1TS5 A;  2R7D A;  3S1N B;  4GKJ L;  4LF5 Q;  1YEZ A;  1STE A;  5EPK A;  5CC4 A;  3QJY A;  4R8N A;  5KYL A;  3TSS A;  1F2L A;  1Q46 A;  3V96 A;  3A5U A;  2R6G A;  1HH2 P;  1FNU A;  2Q2I A;  2SNM A;  1Y8N B;  5CV5 A;  3HOZ G;  1TU2 B;  4C3H G;  1TWA B;  4P73 A;  3MWY W;  2JA8 B;  1JWM D;  4F8M A;  1JR0 D;  3HKZ E;  3S1Q H;  4JBW A;  4K2L A;  4IUV A;  2K05 A;  4WRD A;  3S1R B;  1K8G A;  1O7I A;  3DWP A;  4DV4 L;  2B2Y C;  4IO9 A;  2F0J A;  2Z1C A;  3LX0 A;  1Y1W H;  4DR5 Q;  1LTR D;  1EQT A;  2JYO A;  1PZI D;  3HOV B;  1J5E L;  3RR5 A;  1O7Z A;  2UXB L;  1I94 Q;  4XT3 B;  3P75 A;  1G91 A;  2JEA I;  3K5M A;  2R92 H;  2ZM6 L;  4C3I B;  4XTC S;  3E0E A;  3U50 C;  1WD1 A;  1EIH A;  4G7Z C;  5BN3 A;  4A3F B;  4RA8 A;  4DUZ L;  5KEE A;  2XRS D;  2CCZ A;  1IBL L;  2K03 A;  1SXT A;  1GHJ A;  2D0O A;  3URY A;  4GNX C;  3KDF B;  1KD1 C;  3TRZ A;  2Y0S B;  4P74 A;  1E24 A;  3D4R A;  4X62 Q;  4RWS C;  1R4P B;  5I6W A;  4N9P A;  2K14 A;  3VR4 A;  2XWJ B;  4DK1 A;  3K58 A;  4JI0 L;  3M4O H;  1UEB A;  1V1Q A;  4KKT A;  4FP5 D;  4ABN A;  4OEL B;  1FVI A;  4QJF A;  3UDX A;  1HZC A;  1VQG A;  1PTO F;  2M2L A;  2P5Z X;  2WP8 J;  1TWC B;  4ZUI A;  3S2H H;  1DM0 B;  1S5E D;  4TKO B;  2X6L A;  1VQM A;  1K8M A;  1G29 1;  4C1N I;  1HPC A;  4KN7 C;  2E2H B;  4CDD C;  2QEJ C;  1PH9 A;  3T1H Q;  1JB7 A;  2BE5 D;  2RA4 A;  4BBS H;  2AWO A;  4DFA A;  1A2U A;  1XTD A;  4O42 A;  5GAD C;  5FO9 B;  3K80 C;  1X3F A;  2PCF B;  4GZY C;  3PIP A;  3KJO A;  1HTP A;  4E6I A;  2F0T A;  5M5X B;  4LUZ A;  4KHV A;  4DV0 L;  3H0G B;  1S4Z A;  3FKI B;  2I5L X;  4GOP A;  1MJE A;  5FO7 B;  1AE2 A;  3UI2 A;  2H5X A;  2IW3 A;  3QOL A;  1PFS A;  1EY8 A;  3SK4 A;  5FOB B;  1EOV A;  5DM6 3;  2FIN B;  1IL8 A;  2VQF Q;  4DV7 L;  3I73 A;  1WCM H;  1ML0 D;  3MXU A;  4ZKC B;  1QJO A;  3Q8D A;  4DUY L;  5M5Y H;  1WTR A;  1R4Q B;  1I4X A;  1XNR L;  2A68 C;  1N33 L;  1XNQ L;  5C4X G;  1IKL A;  1CKO A;  4UY8 C;  1K73 C;  4I65 A;  3NHH A;  4QF4 A;  1W3S A;  2XWB B;  5CR3 A;  1YHA A;  3GTQ B;  1JQY D;  4KY5 A;  2L9H A;  1O78 A;  5JEA G;  2CQA A;  3V05 A;  3A8J E;  1QB5 D;  4F88 A;  2OQK A;  4LW1 A;  2JA6 B;  2R7Z G;  2BCO A;  2CW0 D;  4K5V A;  3HOW H;  2ICE C;  1WOC A;  2JA9 A;  2ALY B;  1CZW A;  1H9M A;  3KLW A;  1B44 D;  4N8F A;  4IUN A;  3S14 H;  4HMJ A;  3AEV A;  1B53 A;  2D5D A;  1AZQ A;  4DV2 L;  3N52 A;  1PRT D;  5DEH A;  4YWK A;  5ISR A;  4KMU C;  4B08 A;  3SK5 A;  3MXG A;  3NUC A;  5JAV A;  2N3S A;  1K83 H;  2MHV A;  1D1I A;  4DXF A;  2UUC L;  2MJ8 A;  1EZ6 A;  2HUG A;  2MQH A;  4B9X A;  4DN4 M;  4KN4 C;  4ZK9 B;  1E7Z A;  3TZU A;  1ZXT A;  3QR8 A;  2WB1 E;  2XVS A;  1DJR D;  2VY3 A;  5C0X J;  1BCP C;  3CCQ A;  1LTL A;  4PQX A;  4V19 0;  1HJP A;  4L6T B;  3BYY B;  2Z6K A;  4CBV A;  1SND A;  2A19 A;  1PZK D;  3PIP 3;  2BA0 A;  1KLG D;  1D1K A;  2ZTC A;  4MZ9 A;  4GOP C;  1EYC A;  4ZUJ A;  1FJG Q;  1IZ6 A;  1WTO A;  4O0A A;  1A6X A;  5I9P A;  5JJL A;  5EBD A;  2H4O A;  4A3G B;  1W6K A;  4RCN A;  1XWE A;  2KOL A;  2WAQ B;  4Y7N H;  4UP8 A;  3ZJY C;  4EQP A;  1AP0 A;  4R4O A;  2A69 C;  4JOI C;  1PTO B;  3RZD B;  4Q5V A;  4BBR G;  5E7N A;  1BNZ A;  1GUG A;  3KOJ A;  1T5E A;  1KTK A;  1TY0 A;  2XIW A;  5LL6 S;  4LF5 L;  4FF4 A;  3JAM i;  1AE3 A;  1QG7 A;  3I4M B;  4XIG S;  3MVV A;  5I4D A;  3DWA A;  2F0V A;  2VUM G;  4K0K Q;  1YVC A;  2NTS A;  4LNQ A;  2K01 A;  4EQ5 A;  2NVQ H;  1EYD A;  1E2W A;  4X3K A;  1ENA A;  1I4P A;  2JE6 I;  3W1G A;  4A3L G;  1HFG A;  1STB A;  1II3 A;  2Z9H A;  5IYD H;  4POG A;  1E3P A;  3ERS X;  1JC7 A;  3E9I A;  3CCU A;  3DEO A;  5CV6 A;  3U9O A;  4DR3 Q;  1A3U A;  1CM9 A;  4DR5 L;  1I3Q B;  5GQO A;  1NR2 A;  1SEB D;  1B4O A;  5C44 B;  2O4X A;  3K7A H;  2RBM A;  2WIN B;  5IT9 L;  1CSQ A;  1PFB A;  1MKH A;  3A54 A;  1I94 L;  3CME A;  1F2Y A;  4IOA A;  1PYW D;  3H15 A;  1I6H B;  4KHP Q;  5IYC H;  3J81 E;  4CDC C;  2B63 G;  2BDO A;  1YIT A;  2RSO A;  3K81 C;  3I72 A;  1X3P A;  3RUZ A;  2Z6K C;  2JEB I;  4DV1 Q;  5T1I A;  3KF8 B;  1AH9 A;  3M4P A;  5LL6 X;  4FF2 A;  1JWU D;  1G6P A;  1B70 B;  4JI2 Q;  4X62 L;  2IHE A;  1V1P A;  3RZO B;  3SE0 A;  3NP8 A;  1CI3 M;  1WD0 A;  2OCE A;  1DD2 A;  2F0U A;  5IGE A;  4A4I A;  1ASY A;  4RGN A;  2ZXR A;  3V2T A;  2ENB A;  3HOZ B;  2RHS B;  3Q24 A;  2BH2 A;  4PNY A;  3IKJ A;  1G2T A;  1S5C D;  2I5M X;  2C9O A;  5FKA C;  3SK6 A;  1FGU A;  1XMO Q;  1R9T B;  3MTS A;  4LMQ D;  1VQC A;  1JT8 A;  2JA8 G;  4J1M A;  2YTV A;  1CQV A;  2XN9 C;  3T1H L;  5JPM C;  2AQ1 B;  1VQP A;  1HA5 A;  4B3M L;  4YHH Q;  1TY2 A;  1IYV A;  3AU7 A;  2WFW A;  2JA7 B;  3M85 A;  4HIO A;  4U68 A;  3VYT A;  3E0J A;  3NE5 B;  2OT2 A;  2Z6B A;  4ULL A;  5M5W H;  1TWF B;  3I4L A;  4BXX H;  1ZYR C;  3SK8 A;  4IJH A;  3K0Y A;  5M3M H;  2UXD Q;  3HOV G;  2LSS A;  1TWG H;  3A8I E;  1XPO A;  2JA5 H;  1EU3 A;  1Y69 U;  1IW7 D;  1KNE A;  4IUQ A;  5LMN L;  4X65 Q;  1SBB B;  1JJC B;  4X3S A;  4A3C G;  4J15 A;  4OWW B;  1A62 A;  1EIG A;  1A0I A;  1MIU A;  2F0O A;  3PV0 A;  4A3F G;  1BKB A;  3GTO H;  1HNW Q;  3RLO A;  2Q2T A;  4L8J A;  3PO2 B;  2VB2 X;  1P16 A;  3PIO A;  1N34 L;  4RH6 A;  3F2B A;  1PDQ A;  2YTY A;  2KEN A;  4GKJ Q;  3EIV A;  3HOY H;  1QIL A;  2Y0S G;  4XYQ A;  2R93 H;  4OWT B;  3OTO Q;  4CJ2 C;  3NBH B;  2LKV A;  3PO3 B;  1B1Z A;  4PZ7 A;  3J81 c;  1I5F A;  5FLM H;  5HUR A;  4C56 C;  4EVO A;  4A3K H;  2PI2 A;  1D8L A;  2ZTD A;  1LTB D;  3R8B A;  1VMP A;  3SVM A;  2NVY B;  1D5M C;  3S2D H;  2KVM A;  2AWN A;  3OIP A;  3Q23 A;  5M3F B;  2K7V A;  3K0X A;  1DYQ A;  4GKK L;  1F9R A;  3SEB A;  1Q82 C;  1HQM C;  2HQL A;  4CGY B;  2IX0 A;  2NZ1 D;  1X54 A;  4IPD A;  2K6A A;  1KL9 A;  1VQF A;  3PUV A;  5FJ8 H;  3L7Z C;  2B8F A;  2KHJ A;  4F7X A;  1B2T A;  3TEH B;  1NJI C;  2F0W A;  3DXJ C;  1H9S B;  4X66 L;  2NVX B;  3DM3 A;  4JCV E;  2OTJ A;  1WFQ A;  2UXB Q;  1K9M C;  4A3E G;  2EYJ A;  1LTA D;  2ZT9 C;  1G6Z A;  3GDE A;  2RDF A;  1ENF A;  1PV4 A;  3T13 A;  2ZM6 Q;  4DV3 L;  3MFG A;  4F87 A;  4UHV A;  2GVA A;  2H1E A;  4AYB B;  4HJ5 A;  4JI1 Q;  4IUT A;  2TMP A;  5EPJ A;  4DF7 A;  3KYH C;  5A2Q E;  4X64 L;  5K5P A;  1Y1W G;  4LWC A;  2TSS A;  4XYO A;  3I70 A;  3VA5 A;  4EGV A;  1NUC A;  4JI0 Q;  2K1B A;  2R7Z B;  4WJ3 M;  3K7U C;  3CQZ H;  4HSP A;  3ONA B;  2ZJQ A;  1Q90 A;  2BOS A;  1LTG D;  2E5L Q;  1NMG A;  4IOC A;  2NVT H;  3PIO 3;  3K5N A;  2JA6 G;  3GV6 A;  5DM7 3;  4K0K L;  2K5W A;  2XRQ D;  1V1O A;  4RGO S;  3JAM L;  1GUT A;  1ESF A;  2HQE A;  4WJW A;  1AFP A;  4GLX A;  4NB3 A;  1NSN S;  4K5W A;  1N9W A;  5J3B A;  4DK0 A;  1EU4 A;  2VW9 A;  1DZ1 A;  1K8A C;  1QVG A;  1STH A;  5C6A A;  4DR3 L;  4ZKB B;  3H09 A;  3UE1 A;  5C5M A;  4TVA B;  2JK8 A;  4NP5 A;  3BVG A;  2E2I H;  4DV7 Q;  5GRO A;  2B29 A;  2EOT A;  4DUY Q;  1O80 A;  1UWV A;  4H02 A;  1XNR Q;  4KHP L;  1EUJ A;  1XTC D;  1HA6 A;  1BCP F;  5JPN C;  1N33 Q;  1XNQ Q;  4BBS G;  1B3A A;  4I7A A;  3M4Y A;  2SNS A;  2B8G A;  1VQ5 A;  3TDQ A;  3HEJ A;  3DHQ A;  1RF2 D;  1SFO B;  2WAQ G;  3A0J A;  4A93 H;  4QIW B;  2NZH A;  3NEM A;  4JI2 L;  4MNO A;  1F77 A;  2B3G A;  1PTO D;  1SN8 A;  3IAY A;  3J7A F;  3OSO A;  4DAV A;  4U67 3;  1SRU A;  4XT1 B;  1LTI D;  1ZEQ X;  4OON A;  3BDL A;  1WCM G;  3MXP A;  3I4M G;  2Z4H A;  4G7O C;  1GUO A;  3H3V H;  3ERO A;  4I7Z C;  4DV2 Q;  2A5H A;  1UEA B;  5JJI A;  3ICE A;  1L0Y B;  4OEM B;  2PNH A;  2PYK A;  4K8J A;  1Z9F A;  1XMO L;  1PYS B;  2N8N A;  2UUC Q;  4P75 A;  4YHH L;  1X65 A;  1YIJ A;  3UDI A;  1HUN A;  4DK6 C;  1C48 A;  1E1O A;  1JCK B;  3PQI A;  2WKC A;  3M7N A;  5M9O A;  4FXG C;  1VQ6 A;  1KAB A;  3BZC A;  2BH8 A;  3HOU H;  2DY8 A;  3S17 B;  2BE5 C;  1T9H A;  5J1Z A;  4KD3 A;  4KKU A;  1VQL A;  4DAY B;  4WOR A;  1KRS A;  5E4X A;  2B63 B;  1MJC A;  4JI8 L;  3ND9 A;  1EFW A;  3NQT A;  4X65 L;  2HDL A;  1JJ2 A;  2DNC A;  2L0C A;  2N49 A;  3HFZ B;  2B2U C;  4JG2 A;  5CV9 A;  5C0X H;  4IFD J;  5KNC A;  2E8G A;  2QGQ A;  3PUW A;  1HNW L;  4A3J H;  4RKB A;  4DV5 L;  3NXW A;  4MTK A;  2CVR A;  4OIK A;  1EQQ A;  1F2M A;  3GTL H;  2PMZ E;  3OTO L;  3NQI A;  1YZ6 A;  3NEL A;  2RHQ B;  1CT1 D;  4A3B H;  3GTK B;  1TII D;  3T56 B;  3M7G A;  1I4Q A;  1AZP A;  3OOC A;  1F2Z A;  2K5H A;  2C35 B;  1QNU A;  4L63 B;  5FLX L;  1SDF A;  2OEO A;  3TQY A;  1WVL A;  3CXC A;  3DMU A;  2EY5 A;  3QWN A;  2MNA A;  2CW0 C;  3A74 A;  2E76 C;  3WOF A;  3ITP A;  4KHZ A;  1VMC A;  4NPS A;  4BY7 B;  2MO1 A;  3L2P A;  4JBK A;  4OO1 G;  1SYD A;  1IBM L;  3I4N B;  3CCV A;  1YNJ C;  3GTM H;  2QDB A;  2JA7 G;  5D3I B;  5IYB G;  2F3V A;  1BCP B;  1PRT C;  1GUN A;  1EIY B;  5JJK A;  2Z8L A;  3MXN B;  1PH1 A;  4KD4 A;  1PFM A;  3ULJ A;  3TP7 A;  4GOP B;  2YYZ A;  1VS0 A;  1M90 C;  3ER0 A;  3PF4 A;  4LF6 L;  2NWG A;  5IYD G;  1IXR A;  4DU9 A;  3G6J B;  3S1M B;  4JI1 L;  1VQ4 A;  3HZX A;  1JE5 A;  1WTX A;  3KK7 A;  4A3D H;  3HRZ C;  5EPL A;  1Q8K A;  3PO2 G;  2F0D A;  4JK1 C;  1XMQ Q;  1EY0 A;  4ILW A;  3CC4 A;  4HCS A;  3MHB A;  2YTX A;  2KHI A;  1IHZ A;  2CWP A;  3WWV A;  1SJE D;  2ASB A;  1NBW A;  3PGZ A;  5IP9 H;  4JV5 Q;  1M1K C;  2EXD A;  3T53 B;  2E5L L;  3PO3 G;  3NBI A;  4P72 A;  5IYC G;  1LUZ A;  1SMY D;  2RF4 A;  1CKN B;  1HNZ Q;  1SAP A;  2CH4 W;  5EBC A;  1WTV A;  3HOX B;  2VB3 X;  5M3F G;  3F2D A;  4B3M Q;  3RNU A;  2JN4 A;  5C3E H;  2X69 A;  2M9V A;  1Y14 B;  1HCZ A;  3FRP B;  4J6H A;  5LMN W;  3IL8 A;  4BY1 H;  4NMZ A;  1A2T A;  5G3L F;  1WTH A;  1NY4 A;  3AQQ A;  4RGM A;  3U4Z A;  3CCE A;  3R2T A;  4RHS A;  4A3E B;  2UUA L;  3BDC A;  1NCV A;  2KHS A;  1BXT A;  3W3A A;  3S1Q B;  1WYD A;  5NUC A;  1FL0 A;  1L0W A;  1ICW A;  1RKN A;  5LMN Q;  1S72 A;  2V1C C;  2D62 A;  2KCM A;  4HIK A;  1CA6 A;  1CSP A;  4DR1 Q;  1FYC A;  4A3G H;  3FPU B;  1TVX A;  3OW2 A;  1Y1W B;  4AYB G;  3BVM A;  2XNA C;  4PV1 C;  3OIQ A;  1N34 Q;  1I50 H;  3W2D A;  1MSH A;  3S15 H;  1AEX A;  4JVZ A;  4MIU A;  4BXX G;  1MHW C;  1XXG A;  3VR2 A;  3CC2 A;  3S16 H;  3FMC A;  4EQO A;  3R3O A;  1HFN A;  2NB0 A;  2WB1 B;  3KDF A;  1YNN C;  2JA5 G;  3Q22 A;  3CCL A;  1HRJ A;  1M4V A;  1DOK A;  4POF A;  1CKM A;  2N55 A;  2IT1 A;  3PUX A;  5C3W A;  3RMH A;  3NWT A;  5KGU A;  1PH6 A;  2J0T D;  1PH4 A;  4GKK Q;  1RD9 D;  3MEF A;  3TP6 A;  1OTC A;  3KLS X;  3UDF A;  1QUQ B;  1Y1V H;  2KED A;  2WV6 D;  2I0Q A;  2AHO B;  3HOY G;  4HJ8 A;  5C4J H;  2R93 G;  2I07 B;  2F3I A;  3M4O B;  1PH8 A;  1KC8 C;  2E74 C;  1W6J A;  2K5D A;  2QEX A;  1GJX A;  1X9N A;  2EYP A;  4Z9C B;  4X66 Q;  2HCC A;  5E4W C;  1KLU D;  1BQQ T;  1QE6 A;  1C7Y A;  4P71 A;  2F0F A;  1X56 A;  3S2H B;  3H3V C;  5I2Y A;  4ID6 A;  1CZG A;  1GOZ A;  4DV3 Q;  1QCB D;  5BR8 Q;  5IP7 H;  4BBS B;  4G7H C;  5K36 H;  2K28 A;  2I5H A;  3CCS A;  2Z4I A;  4LF8 Q;  3MAQ A;  3VDY A;  1TWH H;  1Q1B A;  4X64 Q;  1JOO A;  3H3V I;  3FHW A;  2Q8R E;  4TRD A;  3PUY A;  4YCV A;  1VQN A;  4N9T A;  1LV9 A;  1JB3 A;  3S24 A;  3RD4 A;  2D9U A;  2F0M A;  3BZD B;  1K28 A;  1WCM B;  4XQJ A;  2K52 A;  4CJ1 B;  1N8R C;  2F0H A;  5M5Y B;  4C3H H;  1C8C A;  2CQO A;  1RTN A;  1CQF A;  5IGD A;  2LS0 1;  3AYH B;  4GLA C;  4A3M H;  1F9Q A;  2DNE A;  3SHL A;  3STB D;  5CBA E;  2RQX A;  2PZT A;  3UE0 A;  3TZD A;  3RN5 A;  2I46 A;  2G9D A;  3J7Z C;  4DR2 Q;  1F9S A;  2CHB D;  3HOW B;  4QL5 A;  1GO3 E;  1PZJ D;  2EYM A;  3J80 E;  1QZH A;  3S14 B;  3AFP A;  3ERQ A;  3K8A A;  3J81 i;  3G4S A;  4UP9 A;  3KLS A;  4KJN A;  1GD7 A;  1RHP A;  4JBM A;  4MHE A;  2EYH A;  3CP0 A;  2PZU A;  3MEH A;  4JBJ A;  4JI3 Q;  1K83 B;  1VF7 A;  1PVO A;  3KF6 B;  2MUY A;  2O5I C;  2A6E C;  2WKD A;  3DM1 A;  1VQ7 A;  1HNX L;  1LTT D;  2A68 D;  1SYG A;  2DUD A;  2PQA B;  3C1E A;  3HKZ G;  1EQR A;  3KBX A;  2AKW B;  2F0G A;  2YU9 H;  1KDC A;  4H13 C;  2IX1 A;  1OXT A;  4WFN 3;  2E2J H;  4GN5 A;  1YNX A;  5E3F A;  1WJJ A;  1XMQ L;  1RDP D;  2F0K A;  3N6R A;  5IWA L;  5CV7 A;  2JP1 A;  3I4O A;  4JV5 L;  3T4A C;  1OXS C;  1UAP A;  4ZAI A;  2K50 A;  3DUZ A;  1TS3 A;  3NTK A;  3A8K E;  4OX9 L;  1YBY A;  2RDH A;  1HNZ L;  3EVQ A;  2F0E A;  4Y7N B;  3G6E A;  1XPR A;  3ZYY X;  1VQA A;  3L0O A;  2ATW A;  4CKC A;  1F9P A;  3ULP A;  1WTQ A;  1RCV D;  3GTP H;  1J8I A;  3OMC A;  4L5Q A;  1SR3 A;  5HGT A;  3M3Y H;  5JJZ A;  2FXQ A;  1CK1 A;  4YWL A;  1A8V A;  4K14 A;  3UDG A;  3D6C A;  5KNB A;  4BY7 G;  1MGS A;  3CRK C;  4JI5 L;  4C1N K;  3I4N G;  2NVQ B;  2NTT A;  1DOM A;  2HDM A;  1D5Z C;  1KAA A;  1BCP D;  5F2D A;  4DR6 L;  3P7J A;  5KND A;  2M00 A;  4JI8 Q;  1XX8 A;  1SYE A;  4HID A;  2XSC A;  1PRT F;  4OIJ A;  2PI2 E;  5C4X H;  2EY2 A;  2IJ0 A;  4NXN Q;  4DR1 L;  1K0S A;  2HD3 A;  2Z0S A;  5JEA H;  3J80 c;  4DV5 Q;  3SXH A;  4C3J H;  1FNW A;  4A75 A;  2VS1 A;  4OL7 A;  1XPU A;  2A69 D;  2QF7 A;  3FDT A;  4K6D A;  2VQE Q;  4YCU A;  1SNO A;  2IHF A;  3KF8 A;  4K6L A;  4IFD H;  4UDU C;  1YHB A;  3OPO A;  3CMA A;  3BDO A;  1S5D D;  5LMU Q;  2HIX A;  3Q6S A;  3C3L A;  4JW0 A;  1A3V A;  1X55 A;  1KIX A;  2A6H C;  2PQE A;  4M8A A;  3EA6 A;  5H1S E;  4QUC A;  1L2F A;  3HOX G;  4HR7 B;  1MD2 D;  3CCR A;  4H44 C;  1IBM Q;  3TN2 A;  3MZ5 A;  2OQ0 A;  1P8L A;  2F0S A;  1QWY A;  2Q8T A;  3W5O A;  1BVS A;  1ONL A;  3U4V A;  5GAE C;  1U9R A;  5T1G A;  4CKB A;  4JI6 Q;  4C2M H;  4K8I A;  1GHK A;  2KCT A;  5BR8 L;  1RTO A;  3EBE A;  4LF6 Q;  2V4D A;  2ZJP A;  2K5V A;  1EWI A;  4DR4 L;  1QOH A;  1B7Y B;  1NE3 A;  4BBR H;  3NTH A;  4JI7 Q;  4LF8 L;  5GAG C;  1Y8P B;  1I4G A;  1U0L A;  5M5W B;  2PW7 A;  2MFI A;  4CDE C;  2EJF C;  3G71 A;  1B9N A;  1Q12 A;  1RIP A;  5M3M B;  3AFQ A;  3NSW A;  2VUM H;  1TWG B;  2JA5 B;  2MP1 A;  5A35 A;  4DAP A;  3TS0 A;  3IFD A;  2R92 G;  2WB1 G;  1TS2 A;  2ID0 A;  4GS3 A;  3X3M A;  1JWS D;  5JVH 3;  1PYB A;  3GTG H;  3GTO B;  3C1F A;  1MI2 A;  2JSO A;  4UAI A;  1S40 A;  1EWC A;  2L11 A;  4X6A H;  2OXP A;  3HOY B;  3R93 A;  4A3I H;  2R93 B;  3NPP A;  4JI4 L;  2IY5 B;  4PZ6 A;  1ILQ A;  3RLF A;  1XYI A;  3GQB A;  4DR2 L;  4A3K B;  5IP9 G;  2UUA Q;  3T51 B;  4UPA A;  4HCE A;  5AFW A;  3LWE A;  2F03 A;  3I2Z A;  3S2D B;  1L1O A;  1VQE A;  1U4P A;  2QIL A;  2A1A A;  1LLR D;  1ZYR D;  1VQ9 A;  1SNP A;  4PMB A;  3OWF A;  3GTJ H;  2PO4 A;  4FO2 A;  2ZXP A;  4RCO A;  1H9S A;  3BG3 A;  4PZ8 A;  1U4R A;  4JI3 L;  4GN4 B;  3L3O C;  3J81 L;  4S3S A;  1EEI D;  5C3E G;  4PMC A;  4GNX B;  1GKH A;  4H7B A;  3BS1 A;  4LUV A;  4OGQ C;  4KY6 A;  2LXK A;  4DPG A;  5COR A;  3IRB A;  5FLX c;  3MC0 B;  2SOB A;  3S1N H;  3CPF A;  2AUK A;  1B3Q A;  5DLQ E;  2VNU D;  1AW7 A;  3G7L A;  2O2L D;  1LO5 D;  2DY7 A;  3VA7 A;  2B2V A;  2A8V A;  3BZK A;  1UE5 A;  3OHX C;  1E2V A;  2DJF C;  3P20 A;  1H9J A;  5IGB A;  1TWA H;  1STN A;  2VL6 A;  3D6W A;  2JA8 H;  1YHQ A;  2EIF A;  1NR4 A;  1ILP A;  2QA4 A;  4QY7 A;  4ZYS A;  1LYL A;  3EQL C;  2FHT A;  3S1R H;  1C9O A;  2J7Z A;  2MGS A;  5C4H A;  4IUP A;  4ME5 A;  5KRU A;  5KIX A;  3CQZ B;  4K2K A;  3CPW A;  1G8Z D;  2NVT B;  3D0F A;  3NK9 A;  2SDF A;  3TBI B;  3CW2 C;  3HOW G;  3HOV H;  3R2I A;  2PMZ B;  4B3T Q;  1DCZ A;  5BN4 A;  3PSI A;  2Q2H A;  4HJA A;  1PH2 A;  3A7A B;  5JEA J;  5HGQ A;  3CKI B;  5DAU A;  1KDA A;  1VQD A;  1I6V C;  2LMC B;  4C3I H;  4B3S L;  3I3C A;  4EQN A;  1ROD A;  4IPG A;  4A3F H;  4QIW E;  1L1O C;  1PH3 A;  3GD7 A;  4NXN L;  3HKZ B;  4EX5 A;  2KUM A;  3EJI A;  2EVB A;  1N32 Q;  1YJW A;  3J7Y W;  2XTI A;  2KEE A;  4R1J A;  4XQN A;  3CF5 A;  2E2I B;  3D31 A;  1KQS A;  2RCF A;  1YI2 A;  1BDO A;  1STG A;  2EY6 A;  3M9B A;  2VQE L;  4P2C B;  3I55 A;  1VQO A;  1X32 A;  5I2X A;  4LFA L;  5FO8 B;  2VZA A;  1K3R A;  4FVM A;  5IGG A;  5IP7 G;  1ESR A;  3J81 j;  1TWC H;  1UNS A;  1EYG A;  4DR7 L;  1K8O A;  1PXU A;  5LMU L;  3DEP A;  2X6G A;  1OXU A;  3HG9 A;  1EFI D;  2F0L A;  2E2H H;  2B2V C;  2NN6 H;  3KFU A;  4YCW A;  1JOR A;  4JYA L;  1HZB A;  1W2B A;  4A93 B;  3KUP A;  2QDL A;  3DWQ A;  3CCM A;  3L9A X;  3QOJ A;  1PLF A;  4KJO A;  4QQB X;  4ZLT F;  3QG1 A;  5AJ3 L;  4RG1 A;  4IUR A;  5M5X H;  1CHQ D;  3JC6 6;  3TS2 A;  3H0G H;  1Y8O B;  3FKI H;  4A3E H;  4NW2 A;  3K6O A;  3LWU A;  1STA A;  3VYU A;  1DXM A;  4JI6 L;  2QW7 A;  4HIM A;  1JE4 A;  4A3M G;  1EY9 A;  2F52 A;  1SLJ A;  2UU9 Q;  1H9R A;  2KA7 A;  4JC0 A;  2F3W A;  5CGK A;  3D8G A;  1HNX Q;  4NDX A;  3T1Y Q;  4IFD I;  1RL2 A;  1BO0 A;  1HHV A;  5ELC A;  4DAY A;  5IE8 A;  1HXY D;  4JI7 L;  3GTQ H;  5IOC A;  2F0Q A;  4KKS A;  5A2Q L;  5IT9 E;  1Q3L A;  4AIM A;  3HOU B;  3C2P A;  4AH6 A;  2EJM A;  2K33 A;  5IWA Q;  2JA6 H;  1SE2 A;  1Z47 A;  4AQY L;  3A7L A;  4J8Q A;  1FGB D;  2A73 B;  4OX9 Q;  1O7L A;  2RSN A;  5L37 A;  2UXC L;  4A3J B;  1BBX C;  4RGT A;  3PCO B;  2EPB A;  1TXY A;  2R3Z A;  1FNV A;  1SYF A;  1VQK A;  3GTL B;  1LTS D;  1Q8I A;  2L1B A;  3F2U A;  4ODG A;  1D7Q A;  1U5K A;  2KBN A;  4DV6 L;  1STY A;  2LXJ A;  2ZTE A;  1TKW B;  4JI5 Q;  4A3B B;  1X3G A;  2L55 A;  4IN3 A;  3H94 A;  3STB C;  4LAA A;  4LFB Q;  4R8I A;  4DR6 Q;  4OXP A;  5D14 A;  2GN5 A;  1FD7 D;  4HAE A;  1EYA A;  2L5T A;  3MA2 B;  2MO0 A;  2Y0S E;  4CHT B;  1VQJ A;  1GVP A;  3S9W A;  5JVG 3;  1PHJ A;  3MXN A;  3CHB D;  1Q86 C;  1I4R A;  3GTM B;  2WAC A;  3C46 A;  1N36 L;  3PMF A;  3H6M A;  1PTO H;  3RZD H;  4FXD A;  4A76 A;  1VQB A;  2FJ2 A;  1EOT A;  3FPP A;  3I8Z A;  4KV6 A;  4LF4 L;  2PNR C;  3F8T A;  4FXK C;  3I4M H;  5M3M G;  4JOI A;  3A55 A;  2F4V Q;  1DGS A;  2R92 B;  4HJ7 A;  2ZJR A;  3D4D A;  4R4I A;  3CU7 A;  1U4M A;  2SEB D;  1QVF A;  1EEF D;  4LFC L;  2K5N A;  4IPH A;  5D3D A;  3HP3 A;  2CH4 A;  4HSV A;  1CA5 A;  2IWH A;  1LAB A;  3AB9 A;  3BU2 A;  5IT9 c;  4A3D B;  3U58 A;  1KRT A;  4KLK A;  1LM0 A;  4C3J G;  4R9W A;  3VYS A;  1CKN A;  3K5O A;  4L5T A;  2NZO A;  3VR5 A;  5D65 A;  2EE1 A;  4FDB A;  1BF4 A;  2GVB A;  4YY3 Q;  3J7A 5;  1TR5 A;  4HED A;  3F2C A;  1I3Q H;  5IGF A;  1YNJ D;  5C4Z A;  2EJG C;  4IFD G;  5FLM G;  5C44 H;  2K4K A;  1C0A A;  5J22 A;  4A3K G;  3MFY A;  2K5Q A;  3A5Z B;  1OXV A;  3VR6 A;  3RN2 A;  3FVQ A;  4B3T L;  4LF7 Q;  3NTI A;  1JJG A;  3I90 A;  1TQO A;  2QKI C;  2R61 A;  2RCN A;  3EN2 A;  3F1Z A;  2HHH Q;  3I56 A;  1I6H H;  3PUZ A;  2CWA A;  2A74 C;  2GA4 B;  4NKL A;  1VCI A;  5C3E B;  1J9O A;  4NXM L;  1CTM A;  1GXD C;  4DR4 Q;  1KHI A;  1JOK A;  2K32 A;  3OW7 A;  4CDF C;  4BY1 B;  4H0L C;  2PPB C;  5FJ8 G;  2NBF A;  1GUS A;  2EYF A;  1B9M A;  3DLL A;  4DAM A;  1N32 L;  3A56 A;  3QIA A;  3RZO H;  1IW7 C;  4PG3 A;  1PH5 A;  4ZQ3 A;  2OF1 A;  3CAM A;  3D3R A;  1U4L A;  2HT1 A;  3HOZ H;  2KQ3 A;  1JOQ A;  1V1P B;  3E5S A;  1EL0 A;  2F0P A;  1EIF A;  4TSS A;  1YJN A;  2F0I A;  1OO9 B;  1KDB A;  1R9T H;  4XXE A;  4DNR B;  4IJL A;  1HQR D;  1I50 B;  4GN3 B;  1WTW A;  3S15 B;  5ELO A;  4OO1 H;  4RAU C;  3J80 i;  3G48 A;  4JI4 Q;  4X3U A;  2JA7 H;  5IYB H;  3S16 B;  1H9K A;  5ELE A;  1IBK Q;  1A15 A;  2FFK B;  1EZ8 A;  2D2C C;  3CD6 A;  1BOS A;  4R4Q A;  1TWF H;  4KTA A;  2N78 A;  4IUU A;  3JAM E;  2E2D C;  4ZRZ A;  5IY0 A;  5C0X I;  4DKA C;  1QUQ A;  3P1H A;  3TP8 A;  1LT6 D;  1OXX K;  4Y52 H;  4L5R C;  1VQI A;  2WAQ E;  4YWM A;  2J4X A;  4DNT B;  2B2W A;  5CMD A;  1IYU A;  1C4Q A;  2UU9 L;  1E0B A;  1Y1V B;  2NYZ D;  3I7F A;  4CJ0 B;  5C4J B;  4A3I G;  2LY7 A;  5KYI A;  3T1Y L;  3PO2 H;  4RKL A;  2F4I A;  1ASZ A;  3KLR A;  2CKZ B;  4N8X 1;  2EDG A;  5GAH C;  3CRL C;  1HTL D;  5ELN A;  2AMC B;  1K0R A;  2NN6 I;  3RLN A;  3PO3 H;  2EXZ A;  4L5S A;  2JJQ A;  1UE7 A;  5IGC A;  1D6E C;  3O13 A;  4LF9 Q;  4YIJ A;  3M4Q A;  3U9S A;  1YNN D;  2NVY H;  1ET6 A;  2R7F A;  3LNN A;  5M3F H;  1CUK A;  3ULL A;  3SGI A;  1TWH B;  1SYB A;  4MN3 A;  4DA2 A;  4TQU S;  3ND8 A;  4KI0 A;  4KY7 A;  3NEN A;  4B3R Q;  2YV5 A;  3CCJ A;  4FF1 A;  4DXG A;  5EKI A;  1EWH A;  1DON A;  2G5D A;  4A93 G;  2O5J C;  4DGZ A;  3GP7 A;  4C3H B;  2NVX H;  4LK1 C;  1PH7 A;  5C5L A;  4UP7 A;  4XDX A;  4A3M B;  4LFB L;  1UE1 A;  2EYO A;  5EAY A;  1LT5 D;  5JOB A;  1BBW A;  1EY6 A;  3KJP A;  1HR0 W;  4B3S Q;  2HCI A;  1S5F D;  2QCP X;  1QZG A;  4HJ9 A;  5FK9 C;  1EY5 A;  2OWO A;  1J6Q A;  1QVC A;  3I91 A;  3QB3 A;  3K57 A;  1H95 A;  1GM5 A;  1Q81 C;  2FMC A;  1LT3 D;  3GV3 A;  3JAM c;  3D4W A;  4PMW A;  4QCL A;  1VQ8 A;  2B2W C;  5DNF A;  3KF6 A;  5BN5 A;  1HR0 Q;  5I9O A;  2DGY A;  2R7Z H;  3LGJ A;  3OWE B;  3K7A B;  3FP9 A;  3FEW X;  1HZ9 A;  2VQF L;  3HOU G;  2PZW A;  2ICI A;  2PQA A;  4XQQ A;  4LFA Q;  1Q7Y C;  2JQO A;  2F4V L;  1EY7 A;  5J39 A;  5CV4 A;  4RMF A;  4C3I G;  1E22 A;  2L12 A;  4DR7 Q;  4BA1 I;  4OHJ A;  2UUB Q;  1SNC A;  1DOL A;  2BDN A;  1B50 A;  1D2B A;  3SR1 A;  2IL8 A;  5C0X G;  4JYA Q;  2YU9 B;  1KXL A;  1PTO C;  4RFB A;  4A3J G;  2E2J B;  2K04 A;  4FF3 A;  1EY4 A;  4IAL A;  5ELD A;  4LJZ C;  4GLV B;  5AJ3 Q;  1QNK A;  5EKK A;  4BS9 A;  3EFX D;  3E9H A;  3T16 A;  2KJX A;  4B9W A;  4YY3 L;  2E75 C;  5I6Y A;  4R4C A;  1T5X D;  3BYT B;  5FLX E;  3E6Z X;  2C5C A;  2RKS A;  4A3B G;  5C3X A;  1D5X C;  2AQ3 B;  4LUO A;  5EKL A;  4MTN A;  4LF7 L;  5IOD A;  4ZCK A;  1Z7T A;  1BUV T;  2HHH L;  2NN6 G;  4DV4 Q;  1L1O B;  3GTP B;  1JMC A;  1SNQ A;  2F0N A;  2AUJ D;  3M3Y B;  2JXM B;  1M8A A;  3OYY A;  4Q0F A;  3AMU A;  4HTH A;  2DJG C;  2OTL A;  4BA2 I;  1LT4 D;  1PFN A;  2A6E D;  1BBU A;  1J5E Q;  3BJU A;  4HMI A;  3HGB A;  1SE4 A;  1SFO H;  3H0G G;  2PW5 A;  3FKI G;  2MPM A;  1LAC A;  4QB4 A;  2F1M A;  4IZ8 A;  2WII B;  1CFM A;  1E1T A;  2IPK D;  1PA6 A;  4AQY Q;  1GUW A;  2EZV A;  5C4X B;  4DUZ Q;  3WDN A;  1FJG L;  2KEC A;  1IBL Q;  2B2T A;  4QMG A;  2NUC A;  4A3L H;  2UXC Q;  1L0X B;  3TRE A;  2D0P A;  3NBH A;  1A63 A;  4C3J B;  1KAW A;  1X3E A;  2N88 A;  2ES2 A;  2EQS A;  3X3N A;  1CHP D;  3HKS A;  1TS4 A;  2LFN A;  4A3D G;  4APV A;  1SYC A;  3TME A;  3B6Y A;  4DV6 Q;  2G9H D;  3J7A V;  1IBK L;  4FYD A;  2Q8I B;  1VDZ A;  1PRT B;  1RJT A;  1WI5 A;  2BA1 A;  3HS0 C;  2EY1 A;  1G2S A;  1V43 A;  3J80 L;  3S17 H;  4AYB E;  3WOE A;  5HY6 A;  1E2Z A;  1ENC A;  2K75 A;  1YJ9 A;  1X3Q A;  4QUF A;  2B63 H;  3PF5 A;  1TT2 A;  2RVL A;  2IX3 A;  3W1B A;  2B39 A;  1NAP A;  4IPC A;  1UE6 A;  1MBY A;  5E1F A;  1VF5 C;  4DV0 Q;  3VYR A;  1N36 Q;  2KCN A;  2AQ2 B;  4BY1 G;  5CBE E;  1G51 A;  1S5B D;  2DN8 A;  4QGU A;  4V0B A;  2B2U A;  4LF4 Q;  4G4K A;  3Q0A A;  1AN8 A;  4C2M B;  1V9P A;  4G57 A;  1S3O A;  4OO1 I;  1A3T A;  5CV8 A;  1B8A A;  1Q1E A;  5ELF A;  4OWX B;  1IKM A;  1XJV A;  3GTK H;  4LFC Q;  4LF9 L;  1SE3 A;  3NWS A;  2L4N A;  4WJ4 A;  4DV1 L;  4BBR B;  3TP5 A;  4A3G G;  1UUP A;  5CYU A;  1KNA A;  4R4T A;  4O1N A;  4X3T A;  5TSS A;  3BVZ A;  2A6H D;  1X6O A;  1K3B C;  2KCC A;  2B2T C;  4B3R L;  1MSG A;  5G3L D;  4BY7 H;  1VQH A;  3KBG A;  2VUM B;  3I4N H;  2L15 A;  4CKE A; 
#chains in the Genus database with same CATH homology
 1SMY C;  4BWG B;  4KK7 A;  1SSO A;  3IFT A;  2B2Y A;  4M1U B;  3GTG B;  5ELB A;  2RDG A;  5LHY 1;  4A3I B;  1SNM A;  1ZKO A;  3VR3 A;  5EJW A;  3QO2 A;  4RHR A;  1JIC A;  2ZXO A;  1EQV A;  1O7Y A;  4FNF A;  1FR3 A;  5EGT A;  3OMG A;  5EQ0 A;  1ET9 A;  5IIF A;  1PMR A;  2VXW A;  2FMM A;  3GTJ B;  1Z6H A;  3K59 A;  3SDZ A;  3GO5 A;  4K5X A;  1V8Q A;  1BR9 A;  4IQZ A;  2EYL A;  1HUM A;  1SJH D;  1WTP A;  5K36 G;  4HN7 A;  3K5L A;  3H91 A;  5COY A;  1I4H A;  1TS5 A;  3S1N B;  1STE A;  5EPK A;  5CC4 A;  3QJY A;  4R8N A;  5KYL A;  3TSS A;  1F2L A;  3V96 A;  2R6G A;  1FNU A;  2SNM A;  1Y8N B;  5CV5 A;  1TU2 B;  4C3H G;  1TWA B;  3MWY W;  2JA8 B;  1JWM D;  4F8M A;  1JR0 D;  4JBW A;  4K2L A;  4IUV A;  2K05 A;  4WRD A;  3S1R B;  3DWP A;  2B2Y C;  2F0J A;  2Z1C A;  3LX0 A;  1LTR D;  1EQT A;  2JYO A;  1PZI D;  3HOV B;  1O7Z A;  4XT3 B;  3P75 A;  1G91 A;  2JEA I;  3K5M A;  4C3I B;  4XTC S;  1WD1 A;  1EIH A;  4G7Z C;  5BN3 A;  4A3F B;  4RA8 A;  5KEE A;  2XRS D;  2K03 A;  1SXT A;  1GHJ A;  3URY A;  2Y0S B;  3D4R A;  4RWS C;  1R4P B;  5I6W A;  4N9P A;  3VR4 A;  2XWJ B;  4DK1 A;  3K58 A;  4KKT A;  4FP5 D;  4ABN A;  1PTO F;  2M2L A;  2WP8 J;  1TWC B;  4ZUI A;  1DM0 B;  1S5E D;  4TKO B;  2X6L A;  1K8M A;  1G29 1;  4C1N I;  1HPC A;  4KN7 C;  2E2H B;  2QEJ C;  2BE5 D;  2RA4 A;  2AWO A;  4DFA A;  1A2U A;  4O42 A;  5FO9 B;  2PCF B;  4GZY C;  1HTP A;  4E6I A;  2F0T A;  5M5X B;  4KHV A;  3H0G B;  1S4Z A;  3FKI B;  5FO7 B;  3UI2 A;  2IW3 A;  3QOL A;  1EY8 A;  3SK4 A;  5FOB B;  5DM6 3;  2FIN B;  1IL8 A;  3I73 A;  1ML0 D;  3MXU A;  4ZKC B;  1QJO A;  1WTR A;  1R4Q B;  1I4X A;  2A68 C;  1IKL A;  4I65 A;  3NHH A;  4QF4 A;  2XWB B;  5CR3 A;  3GTQ B;  1JQY D;  4KY5 A;  2L9H A;  1O78 A;  5JEA G;  2CQA A;  3V05 A;  3A8J E;  1QB5 D;  4F88 A;  2JA6 B;  2BCO A;  2CW0 D;  4K5V A;  2ICE C;  1CZW A;  1H9M A;  1B44 D;  4IUN A;  4HMJ A;  1B53 A;  2D5D A;  1AZQ A;  3N52 A;  1PRT D;  5DEH A;  5ISR A;  4KMU C;  4B08 A;  3SK5 A;  3MXG A;  3NUC A;  5JAV A;  2MHV A;  1D1I A;  4DXF A;  2MJ8 A;  1EZ6 A;  2HUG A;  4B9X A;  4DN4 M;  4KN4 C;  4ZK9 B;  3TZU A;  1ZXT A;  2XVS A;  1DJR D;  5C0X J;  1BCP C;  4PQX A;  4V19 0;  4L6T B;  3BYY B;  4CBV A;  1SND A;  1PZK D;  3PIP 3;  2BA0 A;  1KLG D;  1D1K A;  1EYC A;  4ZUJ A;  1WTO A;  1A6X A;  5I9P A;  5EBD A;  2H4O A;  4A3G B;  1W6K A;  4RCN A;  1XWE A;  2KOL A;  2WAQ B;  1AP0 A;  4EQP A;  2A69 C;  1PTO B;  3RZD B;  4Q5V A;  1BNZ A;  1GUG A;  1T5E A;  1KTK A;  1TY0 A;  2XIW A;  5LL6 S;  4FF4 A;  1QG7 A;  3I4M B;  4XIG S;  3MVV A;  5I4D A;  3DWA A;  2F0V A;  2NTS A;  2K01 A;  1EYD A;  1E2W A;  4X3K A;  1ENA A;  1I4P A;  2JE6 I;  1HFG A;  1STB A;  1II3 A;  1JC7 A;  3DEO A;  5CV6 A;  3U9O A;  1A3U A;  1CM9 A;  1I3Q B;  1NR2 A;  1SEB D;  1B4O A;  5C44 B;  2O4X A;  2RBM A;  2WIN B;  5IT9 L;  1PFB A;  3A54 A;  1F2Y A;  1PYW D;  1I6H B;  3J81 E;  2BDO A;  2RSO A;  3I72 A;  1X3P A;  3RUZ A;  2JEB I;  5T1I A;  5LL6 X;  4FF2 A;  1JWU D;  1V1P A;  3RZO B;  3SE0 A;  3NP8 A;  1CI3 M;  1WD0 A;  1DD2 A;  2F0U A;  5IGE A;  4RGN A;  2ZXR A;  3V2T A;  2ENB A;  3HOZ B;  3Q24 A;  4PNY A;  3IKJ A;  1G2T A;  1S5C D;  2C9O A;  5FKA C;  3SK6 A;  1R9T B;  3MTS A;  4LMQ D;  4J1M A;  1CQV A;  2XN9 C;  5JPM C;  2AQ1 B;  1HA5 A;  1TY2 A;  1IYV A;  3AU7 A;  2JA7 B;  3M85 A;  4U68 A;  3VYT A;  3E0J A;  3NE5 B;  2OT2 A;  4ULL A;  1TWF B;  3I4L A;  1ZYR C;  3SK8 A;  3K0Y A;  3A8I E;  1EU3 A;  1Y69 U;  1IW7 D;  1KNE A;  4IUQ A;  1SBB B;  4X3S A;  1EIG A;  2F0O A;  3PV0 A;  4L8J A;  3PO2 B;  2VB2 X;  4RH6 A;  1PDQ A;  1QIL A;  4XYQ A;  4CJ2 C;  2LKV A;  3PO3 B;  1B1Z A;  5HUR A;  4C56 C;  4EVO A;  1LTB D;  3R8B A;  1VMP A;  3SVM A;  2NVY B;  1D5M C;  2KVM A;  2AWN A;  3OIP A;  3Q23 A;  5M3F B;  2K7V A;  1DYQ A;  1F9R A;  3SEB A;  1HQM C;  4CGY B;  2IX0 A;  2NZ1 D;  2K6A A;  3PUV A;  3L7Z C;  2B8F A;  4F7X A;  1B2T A;  2F0W A;  3DXJ C;  1H9S B;  2NVX B;  2EYJ A;  1LTA D;  2ZT9 C;  1G6Z A;  2RDF A;  1ENF A;  3T13 A;  3MFG A;  4F87 A;  2H1E A;  4AYB B;  4IUT A;  2TMP A;  5EPJ A;  4DF7 A;  5A2Q E;  5K5P A;  2TSS A;  4XYO A;  3I70 A;  3VA5 A;  4EGV A;  1NUC A;  2R7Z B;  2K1B A;  4HSP A;  3ONA B;  1Q90 A;  2BOS A;  1LTG D;  3PIO 3;  3K5N A;  3GV6 A;  5DM7 3;  2K5W A;  2XRQ D;  1V1O A;  4RGO S;  3JAM L;  1GUT A;  1ESF A;  2HQE A;  4WJW A;  1AFP A;  1NSN S;  4K5W A;  4DK0 A;  1EU4 A;  1DZ1 A;  1STH A;  5C6A A;  4ZKB B;  3H09 A;  5C5M A;  4NP5 A;  3BVG A;  2EOT A;  1O80 A;  1HA6 A;  1XTC D;  1BCP F;  5JPN C;  1B3A A;  3M4Y A;  2SNS A;  2B8G A;  3TDQ A;  3HEJ A;  3DHQ A;  1RF2 D;  1SFO B;  4QIW B;  1F77 A;  1PTO D;  3IAY A;  3J7A F;  3OSO A;  4DAV A;  4U67 3;  4XT1 B;  1LTI D;  1ZEQ X;  3BDL A;  3MXP A;  4G7O C;  2Z4H A;  1GUO A;  3ERO A;  4I7Z C;  2A5H A;  1UEA B;  1L0Y B;  2PYK A;  4K8J A;  1HUN A;  1C48 A;  1JCK B;  2WKC A;  3M7N A;  5M9O A;  4FXG C;  1KAB A;  2DY8 A;  3S17 B;  2BE5 C;  5J1Z A;  4KD3 A;  4KKU A;  4WOR A;  5E4X A;  2B63 B;  3ND9 A;  3NQT A;  2HDL A;  2DNC A;  2L0C A;  2B2U C;  5CV9 A;  5C0X H;  4IFD J;  5KNC A;  3PUW A;  4RKB A;  3NXW A;  2CVR A;  4OIK A;  1F2M A;  3NQI A;  1CT1 D;  3GTK B;  1TII D;  3T56 B;  3M7G A;  1I4Q A;  1AZP A;  3OOC A;  1F2Z A;  4L63 B;  1QNU A;  5FLX L;  1SDF A;  2OEO A;  1WVL A;  3DMU A;  2EY5 A;  3QWN A;  2CW0 C;  2E76 C;  3WOF A;  3ITP A;  4KHZ A;  1VMC A;  4BY7 B;  4OO1 G;  1SYD A;  3I4N B;  1YNJ C;  2QDB A;  5D3I B;  2F3V A;  1BCP B;  1PRT C;  1GUN A;  2Z8L A;  4KD4 A;  1PFM A;  3TP7 A;  2YYZ A;  2NWG A;  4DU9 A;  3G6J B;  3S1M B;  3HZX A;  1WTX A;  3KK7 A;  3HRZ C;  5EPL A;  2F0D A;  4JK1 C;  1EY0 A;  4ILW A;  4HCS A;  3MHB A;  1IHZ A;  1SJE D;  3T53 B;  3NBI A;  1SMY D;  1SAP A;  5EBC A;  1WTV A;  3HOX B;  2VB3 X;  2X69 A;  2M9V A;  1HCZ A;  3FRP B;  4J6H A;  3IL8 A;  4NMZ A;  1A2T A;  5G3L F;  4RGM A;  3R2T A;  4RHS A;  4A3E B;  3BDC A;  1NCV A;  2KHS A;  1BXT A;  3W3A A;  3S1Q B;  5NUC A;  1ICW A;  1RKN A;  2D62 A;  1CA6 A;  1FYC A;  3FPU B;  1TVX A;  1Y1W B;  3BVM A;  2XNA C;  4PV1 C;  3OIQ A;  3W2D A;  1MSH A;  1AEX A;  4MIU A;  1XXG A;  3VR2 A;  3FMC A;  4EQO A;  3R3O A;  1HFN A;  2NB0 A;  2WB1 B;  1YNN C;  3Q22 A;  1HRJ A;  1M4V A;  1DOK A;  2N55 A;  2IT1 A;  3PUX A;  5C3W A;  3RMH A;  3NWT A;  5KGU A;  2J0T D;  1RD9 D;  3TP6 A;  3KLS X;  2KED A;  2WV6 D;  2I07 B;  3M4O B;  2E74 C;  1W6J A;  2K5D A;  1GJX A;  2EYP A;  4Z9C B;  2HCC A;  5E4W C;  1KLU D;  1BQQ T;  1QE6 A;  2F0F A;  3S2H B;  3H3V C;  5I2Y A;  4ID6 A;  1CZG A;  1GOZ A;  1QCB D;  4BBS B;  4G7H C;  5K36 H;  2K28 A;  2Z4I A;  3MAQ A;  1Q1B A;  1JOO A;  2Q8R E;  4TRD A;  3PUY A;  4N9T A;  1LV9 A;  1JB3 A;  3RD4 A;  2D9U A;  2F0M A;  3BZD B;  1WCM B;  4XQJ A;  4CJ1 B;  2F0H A;  5M5Y B;  1C8C A;  1RTN A;  1CQF A;  5IGD A;  2LS0 1;  1F9Q A;  2DNE A;  3SHL A;  5CBA E;  2RQX A;  2PZT A;  3TZD A;  2I46 A;  2G9D A;  3HOW B;  1F9S A;  2CHB D;  1PZJ D;  2EYM A;  3J80 E;  3S14 B;  3ERQ A;  3KLS A;  4KJN A;  1RHP A;  4MHE A;  2EYH A;  2PZU A;  3MEH A;  1K83 B;  1VF7 A;  2MUY A;  2O5I C;  2A6E C;  2WKD A;  3DM1 A;  1LTT D;  2A68 D;  1SYG A;  3C1E A;  3KBX A;  2F0G A;  1KDC A;  4H13 C;  2IX1 A;  1OXT A;  4WFN 3;  5E3F A;  1RDP D;  2F0K A;  3N6R A;  5CV7 A;  2JP1 A;  3T4A C;  1OXS C;  1UAP A;  4ZAI A;  3DUZ A;  1TS3 A;  3NTK A;  3A8K E;  2RDH A;  3EVQ A;  2F0E A;  4Y7N B;  3ZYY X;  4CKC A;  1F9P A;  1WTQ A;  1RCV D;  1J8I A;  3OMC A;  5HGT A;  5JJZ A;  1CK1 A;  4K14 A;  3D6C A;  5KNB A;  1MGS A;  3CRK C;  4C1N K;  2NVQ B;  2NTT A;  1DOM A;  2HDM A;  1D5Z C;  1KAA A;  1BCP D;  5F2D A;  3P7J A;  5KND A;  2M00 A;  1XX8 A;  1SYE A;  2XSC A;  1PRT F;  4OIJ A;  2EY2 A;  2IJ0 A;  5JEA H;  3SXH A;  1FNW A;  4OL7 A;  2A69 D;  2QF7 A;  3FDT A;  4K6D A;  1SNO A;  3KF8 A;  4K6L A;  4IFD H;  4UDU C;  3OPO A;  3BDO A;  1S5D D;  3Q6S A;  3C3L A;  1A3V A;  2A6H C;  2PQE A;  4M8A A;  3EA6 A;  4QUC A;  4HR7 B;  1MD2 D;  4H44 C;  3TN2 A;  3MZ5 A;  2F0S A;  1QWY A;  2Q8T A;  1ONL A;  1U9R A;  5T1G A;  4CKB A;  4K8I A;  1GHK A;  1RTO A;  2V4D A;  1QOH A;  3NTH A;  1Y8P B;  1I4G A;  5M5W B;  2PW7 A;  2EJF C;  1B9N A;  1Q12 A;  5M3M B;  3NSW A;  1TWG B;  2JA5 B;  2MP1 A;  5A35 A;  4DAP A;  3IFD A;  1TS2 A;  2ID0 A;  3X3M A;  1JWS D;  5JVH 3;  3GTO B;  3C1F A;  1MI2 A;  2JSO A;  4UAI A;  1EWC A;  2L11 A;  2OXP A;  3HOY B;  3R93 A;  2R93 B;  3NPP A;  1ILQ A;  3RLF A;  1XYI A;  3GQB A;  4A3K B;  3T51 B;  4HCE A;  5AFW A;  3LWE A;  2F03 A;  3S2D B;  1U4P A;  2QIL A;  1ZYR D;  1LLR D;  1SNP A;  4PMB A;  3OWF A;  2PO4 A;  4FO2 A;  2ZXP A;  4RCO A;  1H9S A;  3BG3 A;  1U4R A;  3L3O C;  3J81 L;  4S3S A;  1EEI D;  4PMC A;  4H7B A;  3BS1 A;  4OGQ C;  4KY6 A;  5COR A;  3MC0 B;  2SOB A;  2AUK A;  2VNU D;  1AW7 A;  3G7L A;  2O2L D;  1LO5 D;  2DY7 A;  3VA7 A;  2B2V A;  3OHX C;  1E2V A;  3P20 A;  1H9J A;  5IGB A;  1STN A;  3D6W A;  1NR4 A;  1ILP A;  4ZYS A;  3EQL C;  2FHT A;  2J7Z A;  2MGS A;  5C4H A;  4IUP A;  4ME5 A;  5KRU A;  5KIX A;  3CQZ B;  4K2K A;  1G8Z D;  2NVT B;  2SDF A;  3TBI B;  3NK9 A;  3R2I A;  2PMZ B;  1DCZ A;  5BN4 A;  3A7A B;  5JEA J;  3CKI B;  5DAU A;  1KDA A;  1I6V C;  2LMC B;  3I3C A;  4EQN A;  1ROD A;  3GD7 A;  3HKZ B;  2KUM A;  3EJI A;  2EVB A;  3J7Y W;  2KEE A;  4XQN A;  2E2I B;  3D31 A;  1BDO A;  1STG A;  2EY6 A;  4P2C B;  1X32 A;  5I2X A;  5FO8 B;  4FVM A;  5IGG A;  1ESR A;  1UNS A;  1K8O A;  1PXU A;  3DEP A;  2X6G A;  1OXU A;  3HG9 A;  1EFI D;  2F0L A;  2B2V C;  2NN6 H;  1JOR A;  4A93 B;  3KUP A;  3DWQ A;  3L9A X;  3QOJ A;  1PLF A;  4KJO A;  4ZLT F;  3QG1 A;  4IUR A;  1CHQ D;  1Y8O B;  4NW2 A;  3K6O A;  3LWU A;  1STA A;  3VYU A;  1DXM A;  1JE4 A;  1EY9 A;  1H9R A;  2KA7 A;  2F3W A;  5CGK A;  3D8G A;  4NDX A;  4IFD I;  1BO0 A;  1HHV A;  5ELC A;  4DAY A;  1HXY D;  5IOC A;  2F0Q A;  4KKS A;  5A2Q L;  5IT9 E;  1Q3L A;  3HOU B;  3C2P A;  2EJM A;  2K33 A;  1SE2 A;  1Z47 A;  3A7L A;  4J8Q A;  1FGB D;  2A73 B;  1O7L A;  2RSN A;  4A3J B;  1BBX C;  4RGT A;  2EPB A;  2R3Z A;  1FNV A;  1SYF A;  3GTL B;  1LTS D;  1Q8I A;  2L1B A;  3F2U A;  4ODG A;  1STY A;  1TKW B;  4A3B B;  2L55 A;  4IN3 A;  3H94 A;  4LAA A;  4R8I A;  5D14 A;  1FD7 D;  4HAE A;  1EYA A;  2L5T A;  3MA2 B;  4CHT B;  3S9W A;  5JVG 3;  3MXN A;  3CHB D;  1I4R A;  3GTM B;  2WAC A;  3C46 A;  3PMF A;  3H6M A;  1PTO H;  4FXD A;  2FJ2 A;  1EOT A;  3FPP A;  3I8Z A;  4KV6 A;  2PNR C;  4FXK C;  3A55 A;  2R92 B;  3D4D A;  3CU7 A;  1U4M A;  2SEB D;  1EEF D;  5D3D A;  3HP3 A;  1CA5 A;  4HSV A;  2IWH A;  1LAB A;  3AB9 A;  4A3D B;  4C3J G;  4R9W A;  3VYS A;  3K5O A;  3VR5 A;  5D65 A;  2EE1 A;  1BF4 A;  1TR5 A;  4HED A;  5IGF A;  1YNJ D;  5C4Z A;  2EJG C;  4IFD G;  5J22 A;  3MFY A;  2K5Q A;  3VR6 A;  1OXV A;  3FVQ A;  3NTI A;  1TQO A;  2QKI C;  2R61 A;  3I90 A;  3PUZ A;  2A74 C;  2GA4 B;  4NKL A;  1VCI A;  5C3E B;  1J9O A;  1CTM A;  1GXD C;  3OW7 A;  1JOK A;  2K32 A;  4BY1 B;  4H0L C;  2PPB C;  2NBF A;  1GUS A;  2EYF A;  1B9M A;  3A56 A;  3QIA A;  1IW7 C;  4ZQ3 A;  2OF1 A;  3D3R A;  1U4L A;  2KQ3 A;  1JOQ A;  1V1P B;  3E5S A;  1EL0 A;  2F0P A;  4TSS A;  2F0I A;  1OO9 B;  1KDB A;  4XXE A;  4DNR B;  1HQR D;  1I50 B;  1WTW A;  3S15 B;  4OO1 H;  4RAU C;  4X3U A;  3S16 B;  1H9K A;  5ELE A;  1A15 A;  2FFK B;  1EZ8 A;  2D2C C;  1BOS A;  4KTA A;  4IUU A;  3JAM E;  2E2D C;  4ZRZ A;  5C0X I;  3P1H A;  3TP8 A;  1LT6 D;  1OXX K;  2J4X A;  4DNT B;  2B2W A;  5CMD A;  1IYU A;  1C4Q A;  1E0B A;  1Y1V B;  2NYZ D;  4CJ0 B;  5C4J B;  2LY7 A;  5KYI A;  4RKL A;  2F4I A;  3KLR A;  2EDG A;  3CRL C;  1HTL D;  2NN6 I;  2EXZ A;  5IGC A;  1D6E C;  3O13 A;  4YIJ A;  3U9S A;  1YNN D;  1ET6 A;  3LNN A;  1TWH B;  1SYB A;  4MN3 A;  4DA2 A;  4TQU S;  3ND8 A;  4KI0 A;  4KY7 A;  4FF1 A;  4DXG A;  5EKI A;  1EWH A;  1DON A;  2O5J C;  4DGZ A;  3GP7 A;  4C3H B;  4LK1 C;  5C5L A;  4XDX A;  4A3M B;  2EYO A;  5JOB A;  1LT5 D;  1EY6 A;  2HCI A;  1S5F D;  2QCP X;  5FK9 C;  1EY5 A;  3I91 A;  3QB3 A;  3K57 A;  2FMC A;  1LT3 D;  3GV3 A;  3D4W A;  4PMW A;  4QCL A;  2B2W C;  5DNF A;  5BN5 A;  5I9O A;  3OWE B;  3K7A B;  3FEW X;  2PZW A;  2ICI A;  4XQQ A;  1EY7 A;  5J39 A;  5CV4 A;  4C3I G;  2L12 A;  4BA1 I;  4OHJ A;  1SNC A;  1DOL A;  2BDN A;  1B50 A;  1D2B A;  3SR1 A;  2IL8 A;  5C0X G;  2YU9 B;  1PTO C;  4RFB A;  2E2J B;  2K04 A;  4FF3 A;  1EY4 A;  4IAL A;  5ELD A;  4LJZ C;  1QNK A;  5EKK A;  4BS9 A;  3EFX D;  3T16 A;  2KJX A;  4B9W A;  2E75 C;  5I6Y A;  1T5X D;  3BYT B;  5FLX E;  3E6Z X;  2C5C A;  2RKS A;  5C3X A;  1D5X C;  2AQ3 B;  5EKL A;  5IOD A;  1Z7T A;  1BUV T;  2NN6 G;  3GTP B;  1SNQ A;  2F0N A;  2AUJ D;  3M3Y B;  2JXM B;  1M8A A;  3AMU A;  4Q0F A;  4HTH A;  4BA2 I;  1LT4 D;  1PFN A;  2A6E D;  4HMI A;  3HGB A;  1SE4 A;  2PW5 A;  2MPM A;  1LAC A;  4QB4 A;  2F1M A;  4IZ8 A;  2WII B;  1CFM A;  2IPK D;  1GUW A;  2EZV A;  5C4X B;  3WDN A;  2KEC A;  2B2T A;  4QMG A;  2NUC A;  1L0X B;  3NBH A;  4C3J B;  2N88 A;  3X3N A;  1CHP D;  1TS4 A;  2LFN A;  1SYC A;  3TME A;  2G9H D;  3J7A V;  4FYD A;  2Q8I B;  1VDZ A;  1PRT B;  1RJT A;  2BA1 A;  3HS0 C;  2EY1 A;  1G2S A;  1V43 A;  3J80 L;  3WOE A;  1E2Z A;  1ENC A;  1X3Q A;  4QUF A;  1TT2 A;  2RVL A;  2IX3 A;  2B39 A;  1NAP A;  1MBY A;  5E1F A;  1VF5 C;  3VYR A;  2KCN A;  2AQ2 B;  5CBE E;  1S5B D;  2DN8 A;  4V0B A;  2B2U A;  4G4K A;  3Q0A A;  1AN8 A;  4C2M B;  4G57 A;  4OO1 I;  1A3T A;  5CV8 A;  1Q1E A;  5ELF A;  1IKM A;  1SE3 A;  3NWS A;  2L4N A;  4BBR B;  3TP5 A;  1UUP A;  5CYU A;  1KNA A;  4O1N A;  4X3T A;  5TSS A;  3BVZ A;  2A6H D;  2KCC A;  2B2T C;  1MSG A;  5G3L D;  3KBG A;  2VUM B;  4CKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...