2GN5A

Refined structure of the gene 5 dna binding protein from bacteriophage fd
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of the gene 5 DNA binding protein from bacteriophage fd.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Dna binding (viral)
molecule keywords GENE V PROTEIN
total genus 3
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1986-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2gn5A00
1D8LA 1C7YA 3CPWA 2ZTCA 4R4QA 4YCWA 1HNZQ 1YITA 1X54A 3CCQA 1IBMQ 1K9MC 3KYHC 4YHHQ 5IP7H 4DR1Q 3DLLA 4DPGA 5GAEC 3J80i 2R93G 2VL6A 2Y0SG 5GQOA 1QVFA 4OWXB 4LF4Q 1N34L 2UUAQ 3HOZH 4JI3Q 4B3TL 4OX9Q 1IZ6A 1YVCA 3VDYA 1I5FA 5C3EG 3GTLH 2YV5A 4QY7A 4B3TQ 1Y1WG 2WAQE 1I94L 5C0XJ 2YTVA 1PH8A 1VQMA 4YCUA 1VQFA 2IY5B 2I5HA 4BA1I 2HIVA 4MZ9A 1HNZL 1JJGA 1A62A 1LUZA 4J15A 2Z6KC 4UP9A 5FJ8G 4IOCA 4A3EH 2YU9H 2VS1A 2CFMA 4DV1Q 2JA5H 3H0GH 2UXCQ 1JJCB 2I0QA 1G291 1RIPA 2IHEA 2N78A 1GKHA 4LF8L 4HJ5A 4QIWE 4DV5L 4DR6L 1M90C 3RZDH 2F4VL 1B70B 2VQEQ 3RLFA 3U50C 1IBLQ 1TWFH 4B3ML 4LNQA 4B3SL 1I6HH 2QEXA 4AQYL 2JA6G 4MTNA 4BBRG 1AE2A 2NVYH 5H1SE 1EWIA 4B3MQ 1CSQA 1FL0A 1BVSA 2JA7H 1K3RA 1Q1EA 2VY3A 2VNUD 4RMFA 4JI1L 3T1YQ 1IBKL 1WJJA 1HZAA 1UE6A 4DR7Q 2GVAA 2YTYA 2K50A 4NB3A 2CWAA 4A3BH 4K0KQ 1PH1A 2RF4A 5LMUL 4IO9A 4KHPQ 4DR2Q 4A3MG 4DV1L 5C44H 2HT1A 3H0GG 5C3EH 3UE0A 4LFAL 2UUCL 3RN2A 4EX5A 3H15A 1OXVA 1SROA 2NVXH 1X9NA 2NZOA 2C35B 4YWMA 3I2ZA 4X66L 4WJ4A 4P74A 3CCLA 2VQEL 4BXXG 4RG1A 2VUMH 5BR8L 1VQDA 1NY4A 2KCTA 4A3EG 2K52A 2K5HA 3TQYA 3AEVA 4JI6Q 4BA2I 5LMNQ 4JV5Q 1E24A 4UY8C 4DR5Q 1XMOL 5J3BA 4B3SQ 1KQSA 5GADC 3BZKA 5FLMH 2MNAA 4JI2L 1VQNA 5C4JH 4JI6L 1MJCA 3PSIA 4JC0A 2K5VA 3PUZA 4LFBL 4LW1A 1HH2P 4LF7Q 3CCMA 4A76A 4R4IA 2E8GA 1VQLA 1WYDA 1QUQA 4P75A 4JBKA 4NXNQ 3F2CA 1B8AA 1L1OC 1TWGH 3S1NH 1TWHH 2UUBL 2K14A 1HZCA 2N3SA 3J81c 3HOVG 2UXCL 5C44G 1WFQA 2Q2HA 1XJVA 2GN5A 4A3JH 5GROA 4BBSH 1EIFA 1DGSA 4A3BG 4PZ6A 1P8LA 5GAHC 4BBSG 3KF8B 4JYAL 2AMCB 4OXPA 3U4VA 1VQPA 4R1JA 4DR6Q 5M5WH 2R7FA 2UXDL 3D0FA 2B63H 1SLJA 2D0OA 1R9TH 1UE5A 3ULPA 3TEHB 1K73C 4OX9L 1D7QA 3GDEA 2R6GA 1YJ9A 4LUOA 2Q2TA 2MFIA 3BU2A 1E7ZA 4A3FG 4A3LH 5FLXc 1L1OA 5JJIA 4UPAA 1X3EA 2D0PA 5IP7G 3S1MH 4A3CG 1PV4A 1VQHA 3AYHB 5LMUQ 1S3OA 3HFZB 4GOPA 2EQSA 1J5EQ 4JBWA 1TXYA 1S72A 4X62L 1EIYB 4JI7L 3UDIA 1LM0A 1S40A 2UUCQ 1VQ7A 4MNOA 3PUWA 3M7NA 5C0XI 1YZ6A 2NN6G 4XIGS 3HOXG 3GTPH 3PUVA 4DUZQ 4HIDA 1NBWA 1KD1C 1K0RA 5IT9c 1XMQL 1VQJA 2ID0A 3DM3A 4X62Q 1YHQA 3GTJH 2A8VA 5IYBG 1IBML 2K75A 3CC4A 3G48A 1QVCA 4PG3A 3NENA 2NZHA 3KJPA 1A0IA 1HJPA 2KHJA 4DKAC 2E5LL 4A3JG 1XPRA 4IJHA 2B63G 3U4ZA 1XNQQ 4JI8L 3HOYG 1IL2A 3HOWG 3ICEA 2IX0A 2JK8A 2OTJA 3CCVA 4GN5A 4GOPC 3KFUA 4GKKL 1EFWA 3CCUA 3TS0A 4LF7L 3I4OA 2RCNA 3HKZG 2Y0SE 1CUKA 4LFCL 5AJ3Q 4DV7Q 5IWAQ 3I56A 3AQQA 3M9BA 3STBC 3EBEA 1ASZA 3I4MG 4GKJQ 2H5XA 3F8TA 3ER0A 5E7NA 4X65L 3OTOL 1HNWL 3W1GA 2WB1E 3JAMi 4DV3L 1PVOA 4OONA 4DV6L 5IWAL 3GTGH 1TWAH 3MXNB 1SN8A 1LTLA 4C3HH 3I7FA 4C3JH 1GVPA 3CP0A 2ES2A 1YJNA 4X65Q 4R4CA 2B3GA 2RHQB 5IYDG 1KL9A 4Y7NH 4DV6Q 1SE8A 2F3IA 1VQ4A 4GKKQ 1VQKA 5LMNL 3CC2A 4JV5L 4YHHL 3J80c 4IPCA 1PH3A 4OWWB 5IYBH 4APVA 4WJ3M 4JI5Q 4NXMQ 5M3MH 4K0KL 3Q8DA 3BJUA 1FVIA 3S14H 1U5KA 3E9HA 4DR4L 3UDFA 4DAMA 1C9OA 3HOYH 2JEBI 1PH5A 3CAMA 4XTCS 3PO2H 3CCRA 4JI5L 2QGQA 4LUZA 1NMGA 4C3IH 4GLVB 1MIUA 2VZAA 1Q1BA 3CQZH 3CXCA 4DUYL 2HHHQ 4UP8A 3I4NH 1N36Q 5EAYA 1KHIA 4DV2Q 2PNHA 1EOVA 1X56A 1P16A 3STBD 5M3FH 1HR0W 3G4SA 1JMCA 2BA0A 5BR8Q 3T1HL 1GD7A 2R7DA 4JI1Q 4A4IA 1V1QA 1IBKQ 1FJGL 5JJLA 4LF8Q 4O2DA 1JB7A 2EIFA 3S16H 1UWVA 1VQ5A 1VQ9A 1HZBA 3E9IA 3FP9A 4PZ7A 4A3IG 2CWPA 1NMFA 1E3PA 2LSSA 4AIMA 1OXXK 3K7AH 1WOCA 1E1OA 3OW2A 1FJGQ 1JE5A 4C2MH 3M3YH 2KCMA 3BZCA 3KJOA 1J5EL 4B3RL 1FGUA 1X3FA 5IYDH 3PO3H 4LF6Q 1PYBA 3KLWA 2UU9Q 2ZM6L 1M1KC 1QUQB 1H95A 3F2BA 4DR7L 4JI4Q 1KAWA 2NVTH 1Q12A 1B7YB 2XGTA 4JOIA 2R92G 4JOIC 1V9PA 2JA9A 2IT1A 2E2JH 4AH6A 4BXXH 4IJLA 4DV3Q 4L5SA 4JI4L 4KHZA 2WAQG 1WCMG 2OQ0A 2E2HH 2UUBQ 4POGA 4JI0L 1Z9FA 3PUXA 4GN3B 2F52A 2RHSB 4NXNL 4JYAQ 1QZGA 1OTCA 3S17H 4A3DG 1Y1VG 3CD6A 3KDFA 4BBRH 2DUDA 3CCSA 1YHAA 2KENA 4GLXA 1OXSC 3H3VI 2UXDQ 3FHWA 1XTDA 3F1ZA 1VQCA 4GNXC 2N49A 4X64L 4IPGA 3CF5A 4A3FH 3LGJA 1Q82C 2JA7G 3I4NG 4A3LG 4LFBQ 1Q8KA 4HIOA 1Y1WH 4LF4L 1U0LA 4DAYB 4R4TA 5M3FG 2LXJA 3ULLA 2V1CC 4L5RC 4A93G 2R93H 4NPSA 1VQAA 4QQBX 1XPOA 1XNRL 3NEMA 4HJ7A 2PQAB 1PFSA 3A0JA 1VQBA 2JQOA 4TVAB 1HZ9A 3NBHB 1X3GA 4GOPB 2AKWB 4AYBG 1BBUA 4HJAA 1YI2A 1W2BA 2ZTDA 3PO3G 2IHFA 3GO5A 2FXQA 3CPFA 3PCOB 5DLQE 4HJ9A 3OTOQ 4A3KG 1N8RC 2MO0A 1GO3E 3S1QH 2VUMG 2JJQA 1Q7YC 4GKJL 2WFWA 3EIVA 1J6QA 5IP9G 4BY1G 4GNXA 4DNIA 4GNXB 2Z0SA 3AFQA 1N32Q 2MQHA 3HOWH 3U58A 1T9HA 1Y1VH 5JEAJ 4R4OA 4ALPA 4LF9Q 5M5XH 2NVQH 1MKHA 2QA4A 2NN6I 1I50H 4HJ8A 3H3VH 5HGQA 3NELA 4PZ8A 4JG2A 4A93H 4IFDI 1CKNB 5AJ3L 4DV7L 4LFCQ 2BA1A 3GD7A 3HOVH 5IYCH 4DR4Q 4Y52H 4FDBA 4A3GH 3S24A 1L2FA 2B29A 2E2IH 1QVGA 3GTQH 1PH4A 2OTLA 3FKIG 2PMZE 2K4KA 1K83H 2L15A 1AE3A 2ASBA 1XPUA 2DGYA 1CKOA 2ALYB 2JE6I 4LFAQ 4H02A 3GTKH 1NTGA 4IOAA 4DR1L 3RLNA 3J81i 1EYGA 1YIJA 1PH9A 4JI7Q 1AH9A 1Y14B 3G71A 1OXTA 2ZJQA 1VQIA 1HNXQ 1IYJB 1HR0Q 2JA5G 3W1BA 1NJIC 2F4VQ 1IXRA 3L0OA 1YJWA 2R7ZH 3HOUG 2OQKA 1A63A 3J7ZC 2IX1A 1MJEA 1ASYA 4NXML 5IE8A 4L5QA 1NE3A 3PIOA 3M4QA 4LF9L 1QZHA 1X6OA 4LUVA 1EQQA 5HY6A 1I94Q 3B6YA 3L2PA 3CCEA 1IBLL 1XNQL 1YHBA 3TRZA 4IFDG 4OWTB 1VQEA 4LF6L 4UP7A 3I4MH 3S1RH 1K8AC 5GAGC 2ZJRA 5K36G 4TQUS 3FKIH 3RZOH 2HHHL 1A8VA 1E22A 5IYCG 1PHJA 2EXDA 4ME3A 1N33Q 3W5OA 2ATWA 3K8AA 4X66Q 1CSPA 5ELOA 4A75A 3J7A5 1VQOA 5JEAG 1N33L 1KRSA 1Q46A 4P73A 3HKZE 2K5NA 1EQRA 2VQFL 4LF5Q 1O7IA 3PV0A 3RNUA 4A3IH 3CCJA 4DV5Q 1HNXL 3A5ZB 3RR5A 4DV0L 3S2DH 4DK6C 4DUYQ 2VQFQ 3RLOA 4LF5L 1I3QH 1WCMH 2BH8A 1PH7A 4OO1I 4IFDJ 3T1YL 5ELNA 4DV4L 3K7UC 3PGZA 1YBYA 2I5LX 4JI3L 3I55A 4A3CH 4KHPL 4HIKA 5C0XG 1VQ6A 3CW2C 2CQOA 3T1HQ 1SMXA 2Q2IA 4DV0Q 4AQYQ 1Q86C 2UU9L 3HOUH 1EUJA 2JA6H 5FLMG 1UE7A 2ZJPA 2AHOB 5IY0A 2N8NA 4B3RQ 1YNXA 2A1AA 3IRBA 4EQ5A 1UEBA 2OWOA 3GTOH 2HQLA 3ZJYC 4DV2L 3UDXA 4X6AH 3CMEA 3RN5A 2OCEA 3UDGA 1PH2A 2WB1G 3A74A 2YTXA 2LXKA 2PI2E 4PMWA 4DK3C 4DR2L 1GM5A 2JA8G 3AFPA 3E0EA 1Z47A 5M5YH 2JEAI 1KXLA 4GLAC 3UE1A 3KF6B 3A5UA 4OO1G 1W3SA 3HOXH 3KF6A 4O0AA 3EN2A 3KDFB 1K8GA 1N32L 2ZTEA 2Q2UA 1V43A 1BKBA 1N36L 3M4PA 4JI2Q 2MO1A 1JT8A 3L7ZC 4POFA 5IP9H 4GN4B 1UE1A 2AWOA 2GVBA 4X64Q 4P71A 4YCVA 1VS0A 4YY3Q 1SFOH 4QGUA 4A3MH 3S15H 4GS3A 3M85A 4BY7G 2VW9A 2AWNA 4DR5L 3OYYA 1XMOQ 1RL2A 4DR3L 2R92H 3G6EA 2PQAA 1PYSB 3KOJA 1BBWA 4KLKA 2CKZB 5M3MG 3JAMc 1VQGA 3J81j 4DUZL 3TS2A 5C4XG 2WP8J 4BY1H 4P72A 1L0WA 3PUYA 1LYLA 2Z6KA 4IPDA 4A3DH 3MEFA 1X65A 4QL5A 2ZM6Q 1G6PA 3PO2G 3F2DA 2BH2A 1SRUA 4KI0A 3SGIA 3K81C 4IPHA 3TREA 1YEZA 2YYZA 3D31A 3ULJA 1N9WA 2D62A 2KHIA 1HR0L 3HOZG 4JI0Q 1VQ8A 3JC66 1VCIA 2UXBL 3PF4A 4JI8Q 2JA8H 4DV4Q 4YY3L 4YWLA 1SR3A 2I5MX 3CC7A 4BY7H 3WWVA 1Q81C 4JBMA 1TWCH 1N34Q 2UUAL 4L5TA 3CMAA 1G51A 1X55A 4JCVE 5FJ8H 3PIPA 3M4OH 1L1OB 2R7ZG 4A3GG 3ERSX 2E5LQ 2HIXA 1PH6A 1OXUA 3PF5A 2UXBQ 1E1TA 3GTMH 1CKNA 4A3KH 4JBJA 4DR3Q 4YWKA 2A19A 2PI2A 4LWCA 1KRTA 1XMQQ 2KBNA 1XNRQ 4QJFA 1CKMA 1PA6A 5C4XH 1KC8C 2XTIA 3K80C 4AYBE 5JJKA 1HNWQ 3HKSA 1WI5A 2CCZA 4HIMA 5LMNW 1JJ2A 3S2HH 1C0AA 1KIXA 3K0XA
chains in the Genus database with same CATH superfamily
5M3FB 2B2WC 2EJFC 1M8AA 1YITA 2F0SA 4C1NI 4DPGA 3R2IA 2VL6A 5GQOA 1F2YA 5E3FA 3C1EA 1IZ6A 3VDYA 3VR4A 2YV5A 4B3TQ 1V1PA 4HR7B 1WTPA 4IZ8A 4H13C 1SXTA 5C0XJ 2YTVA 4YCUA 4IUUA 1HNZL 1SE2A 1A62A 3FEWX 4A3EH 2VS1A 4JPBW 2A74C 1SMYD 1JJCB 2IHEA 2F0OA 5FOBB 2RKSA 3MA2B 1GUTA 1STBA 4UAIA 2F4VL 5CV7A 1I4RA 1IBLQ 1IW7C 2FMMA 2QCPX 1AE2A 1T5EA 5H1SE 1EWIA 3FMCA 2VY3A 1DYQA 1XXGA 4KN7C 3VR3A 1UE6A 3T1YQ 2DJGC 1DXMA 2KEEA 4NB3A 2CWAA 2RF4A 5C6AA 4C3HG 4A3MG 4DV1L 5JPNC 5C3EH 4K5XA 3UE0A 4EX5A 2SNSA 1CHPD 3I72A 4GZYC 2OXPA 4RFBA 4ZUJA 2C35B 3J81L 4X66L 4DN4M 5NUCA 2F0MA 3P20A 2F0HA 3TQYA 1DZ1A 2OT2A 4B3SQ 2A5HA 3A56A 4NP5A 5IOCA 2MNAA 5C4JH 5C4HA 1PZJD 2F0NA 2QKIC 4LF7Q 3CCMA 4R4IA 5I2YA 3VYUA 4HEDA 3WDNA 1UEAB 1QUQA 4P75A 1L1OC 4HSPA 4P2CB 5ELFA 2UUBL 4RGNA 4OO1H 3K58A 2Q2HA 1KDBA 4A3JH 4BBSH 1HA6A 3ZYYX 2B2YA 4X3TA 1FD7D 4PZ6A 1P8LA 3QB3A 4JYAL 3G7LA 1QE6A 2KEDA 1PXUA 2XNAC 2B63H 3RUZA 1HXYD 1W6JA 1UE5A 3ULPA 1O7YA 3GDEA 3BVGA 2WINB 5IGEA 2NTSA 2R6GA 5HGTA 4LUOA 4LAAA 2MFIA 5FLXc 5K5PA 4IUTA 2VXWA 1DCZA 1VQHA 1LO5D 1J5EQ 5C4JB 1BO0A 1F77A 1EIYB 4X62L 2L55A 1HPCA 1VQ7A 2KCNA 5C0XI 3HOXG 1NBWA 3DM1A 5I2XA 5IT9c 2ID0A 2A8VA 1YHQA 3S9WA 3NENA 3BVZA 1A0IA 2Z6BA 2KHJA 3EFXD 1X3PA 4OL7A 3J80L 4ZUIA 1IL2A 3ICEA 3OWEB 2OTJA 2JK8A 3CCVA 4GOPC 4L8JA 3BS1A 3U9OA 3TS0A 1TS5A 3I4OA 4DF7A 2RA4A 4LFCL 5AJ3Q 3STBC 4N9TA 3TSSA 2WIIB 1TT2A 1WVLA 4QMGA 3ER0A 5E7NA 3OTOL 1SSOA 1BNZA 2EJMA 4V0BA 3MXNA 4DV6L 1BXTA 4XXEA 1LTLA 5C5MA 2ES2A 2V4DA 4RKBA 4X65Q 1DONA 3A7LA 1HA5A 5EPLA 2RHQB 1SE3A 4A3EB 4A3DB 1RTOA 4GKKQ 4YHHL 1PH3A 4IPCA 5IYBH 1JB3A 4N8FA 5M3MH 4K0KL 1NNXA 1CT1D 1FVIA 4FF2A 3S1MB 4A3GB 3E9HA 4DR4L 4DAMA 3SE0A 2K5WA 2JEBI 3EA6A 3PO2H 4XQNA 2QGQA 4LUZA 2MGSA 1MIUA 2VZAA 3CXCA 4UP8A 1F2LA 2PNHA 2DJFC 2ZXPA 5M3FH 3G4SA 5BR8Q 3T1HL 4H0LC 2B2VC 2R7DA 1Y8OB 4NDXA 4PZ7A 2F0DA 1UAPA 2LSSA 4AIMA 1OXXK 3OIPA 3OMCA 4RH6A 3RZOB 1E1OA 3GV3A 2QW7A 5JEAH 1F9PA 5IYDH 4K2LA 3PO3H 1PYBA 2UU9Q 2Z8LA 1MHWC 2NTTA 4G7HC 2R92G 1V9PA 2K5QA 1JICA 4ZKCB 5D3DA 4DV3Q 4BXXH 4KHZA 2B2VA 4K8IA 2E2HH 4JI0L 1Z9FA 4GN3B 4V190 1FR3A 3KDFA 3CCSA 3H3VI 2KENA 4GLXA 2NVXB 4LK1C 3C2PA 2WB1B 1J9OA 1XTDA 1VQCA 4GNXC 4X64L 1Q82C 4A3LG 1QB5D 3I4NG 3V96A 1K83B 1Y1WH 4C3IB 4DAYB 2KOLA 2XVSA 1X32A 2XN9C 2EYOA 1XNRL 4HJ7A 1C8CA 4N8X1 1DOKA 3NBHB 4GOPB 3S15B 2F0FA 1I4PA 1LTSD 3PCOB 4DU9A 4HJ9A 3OTOQ 4I7AA 4ZAIA 1Q7YC 1J6QA 4BY1G 1TKWB 5D14A 5C5LA 3ND9A 1PFBA 2L0CA 3HOWB 5T1GA 2K28A 3HOWH 5ISRA 3U58A 3H0GB 3T56B 4G57A 3NWSA 1R4QB 3K5OA 2QA4A 2NN6I 2E74C 5DM73 3H3VH 1A3TA 4RCOA 2O4XA 4DV7L 1SYEA 1U4MA 4FDBA 4Y52H 2D5DA 3KLRA 1SAPA 3HOZB 1NAPA 2OTLA 3S2DH 2L15A 1K83H 1IHZA 1AE3A 1AZQA 2ASBA 2NVQB 2ALYB 2F0KA 1YIJA 1PH9A 3EJIA 2KHSA 1LLRD 1Y14B 1OXTA 2F0LA 3TN2A 1VQIA 3HOUG 2OQKA 3J7ZC 2Z4IA 4FNFA 1YNJC 4ID6A 4LF9L 5KGUA 1SNMA 5A2QE 1WD1A 1XNQL 5C44B 3T51B 1VQEA 4UP7A 1K8AC 4KD3A 4K5WA 2M00A 3RZOH 1E22A 4U68A 2C5CA 2IX3A 3J7A5 4KTAA 4KKSA 4P73A 3HKZE 1O7IA 3T13A 5M5WB 4A3IH 4DV5Q 2NZ1D 4ZKBB 1HNXL 3A5ZB 3RR5A 3BDCA 4DK6C 2E2HB 5ELNA 3TP7A 1E2VA 3CW2C 4ZYSA 2UU9L 2CW0C 2AHOB 1H9SA 3K5NA 3M7GA 1IW7D 3I3CA 1H9KA 3OIQA 1UEBA 4QIWB 4ZLTF 3RN5A 1EY0A 2WB1G 4KY5A 1SJED 1BCPF 1Y1VB 1GM5A 2JA8G 3AFPA 4LJZC 4FXDA 2ENBA 2JEAI 4N9PA 5M5YB 3A5UA 4CJ0B 1PRTD 3KF6A 4FF1A 1E0BA 1N32L 1EYDA 3K57A 1V43A 1SNPA 5E4WC 4IALA 4WRDA 5CV6A 1EZ6A 2AWOA 4C56C 2Q8RE 4P71A 2PW7A 2VW9A 2EZVA 3PO2B 1I4GA 3NQTA 4U673 4DR3L 3C3LA 3G6EA 3N6RA 3KOJA 3OWFA 5M3MB 4R9WA 4G7ZC 1PRTB 4P72A 1Y8PB 1PLFA 1X65A 2HD3A 2BH2A 3MXGA 4IPHA 2WACA 2YYZA 1RTNA 2D62A 2F0EA 1S5CD 1VQ8A 5I6YA 4IN3A 1GUWA 4DV4Q 4YY3L 2G9HD 1SR3A 5ELBA 2LFNA 4YWLA 4CJ1B 4KY6A 2FFKB 4IURA 5CV9A 3IAYA 1TWCH 2PO4A 5FJ8H 2F3VA 3R93A 2R7ZG 3ERSX 1WTWA 2E5LQ 2HIXA 4F88A 2E2IB 5CBAE 3GTMH 1CKNA 2A69C 3K5MA 1H9MA 3DWPA 1XMQQ 1RF2D 2H1EA 1XNRQ 1PA6A 1CKMA 1KC8C 4F8MA 2KVMA 1D1KA 3E0JA 2NVYB 3HKSA 1CI3M 2CCZA 5LMNW 2A68D 1SE4A 3Q22A 3K0XA 3CPWA 2ZTCA 4R4QA 4YCWA 5CGKA 1X54A 2K6AA 1PMRA 3CCQA 1QCBD 5G3LF 2EDGA 3A8IE 4DR1Q 3N52A 5GAEC 3J80i 2A73B 3HOZH 5I9PA 2UUAQ 1YVCA 1K3BC 1I4XA 3T4AC 3TBIB 1PTOC 4F87A 3V2TA 3GTLH 1LTID 1V1PB 2XRSD 5J1ZA 2FINB 1PH8A 3NE5B 1VQFA 2I5HA 5EGTA 5FKAC 4XYOA 3GTLB 1HQRD 3OMGA 5LL6S 3H0GH 2UXCQ 2I0QA 3Q0AA 1QJOA 2WAQB 4XT3B 4QIWE 1M90C 2R3ZA 3RLFA 1TWFH 4B3ML 3KBGA 2K7VA 2QEXA 4MTNA 4BBRG 3NK9A 4B3MQ 1BVSA 1TWGB 3NBIA 2F4IA 3BYTB 5FLXE 1PFNA 4OHJA 4DAPA 2HUGA 4A3BH 4HAEA 1PH1A 2FMCA 4IO9A 2HT1A 3H0GG 1SNDA 2XSCA 4LFAL 2CW0D 1F9RA 2R61A 3K7AB 1SROA 3VYRA 2NVXH 4YWMA 1WTXA 5ELCA 4WJ4A 4RG1A 2VUMH 3A54A 5BR8L 2F0UA 4A3EG 2K52A 2CH4W 2P5ZX 4B9WA 3AEVA 1PZKD 4BA2I 4DR5Q 5GADC 2CVRA 2GA4B 1SYFA 2HDLA 3GTKB 4JI6L 5AFWA 1MJCA 4JC0A 3PUZA 4LW1A 1WYDA 3HOYB 1BOSA 2A68C 3F2CA 1B8AA 4KJOA 1TWHH 2XRQD 4NW2A 1CHQD 2N3SA 3HOVG 2HDMA 2GN5A 3Q6SA 3F2UA 3D6CA 4ZCKA 4JW0A 2I46A 3IFTA 4IUPA 4XT1B 5DNFA 2AMCB 1VQPA 4FP5D 1BF4A 4DR6Q 5M5WH 3BG3A 3D0FA 1SLJA 2D0OA 2X6LA 4C3HB 2A69D 1YJ9A 1E7ZA 1STGA 4A3LH 5JJIA 5IP7G 1V1OA 3S1MH 2SOBA 1FNUA 1S3OA 4GOPA 2EQSA 1TXYA 2K5DA 1KABA 2F03A 2UUCQ 3DMUA 3FVQA 3PUWA 4DR6L 3DM3A 2K75A 3ONAB 1GHKA 4A3JG 4IJHA 2B63G 3HOYG 3HOWG 2J7ZA 2IX0A 4NMZA 5JVH3 5IGFA 3NHHA 3KFUA 3RMHA 4HCEA 2RCNA 3MEHA 2LS01 3I56A 3EBEA 1ILPA 1HNWL 4DV3L 1V8QA 2WB1E 3JAMi 1PVOA 1TWAH 3MXNB 1SN8A 2C9OA 4RGOS 3K0YA 5IT9E 1YJNA 1F2MA 3QWNA 1VQ4A 1PDQA 1Y8NB 1OO9B 1WTOA 3J80c 4OWWB 4IQZA 1F2ZA 4WJ3M 4APVA 2M2LA 4NXMQ 4M8AA 3Q8DA 3BJUA 5DAUA 1L0YB 4DNTB 1U5KA 3S14H 2R92B 4PMBA 3DHQA 4R8IA 4RAUC 4Q5VA 2L9HA 1QWYA 1PTOB 2EJGC 5IGDA 4FF4A 4C3IH 1Q1BA 1FNWA 4DUYL 2KCCA 3TP5A 2O5JC 4DV2Q 3STBD 1P16A 3HOXB 1II3A 1HR0W 1JMCA 5EJWA 4A3JB 3VYSA 4A4IA 2DN8A 1TVXA 1JB7A 2EIFA 2PZUA 1VQ5A 4A3IG 5C4XB 2CWPA 1NMFA 4K2KA 4OELB 2OF1A 2L1BA 4C2MH 2KCMA 3KJOA 2JA6B 1KDCA 1SMYC 1KTKA 2KECA 2R93B 1B7YB 4JOIA 4AH6A 1S5DD 3A55A 4IJLA 3JAME 1WCMG 4POGA 5FO9B 4NXNL 5L37A 1CTMA 1QZGA 1AEXA 4A3DG 3CD6A 4BBRH 2DUDA 3J7AF 2Y0SB 4A3FH 4LFBQ 2L4NA 4OEMB 2MUYA 3FRPB 4G4KA 1U0LA 2TSSA 5M3FG 2LXJA 1SYGA 3K6OA 2K1BA 2NUCA 3I4MB 3A0JA 1VQBA 1FYCA 3SK4A 1X3GA 2AKWB 4AYBG 1W2BA 1CQVA 1SFOB 3EQLC 2ZTDA 3PO3G 1EEFD 3CPFA 4A3KG 3L9AX 5KNBA 2PZWA 1GO3E 3NXWA 2VUMG 4GKJL 3RZDB 5IP9G 4DNIA 2AQ3B 3QOLA 4EGVA 2Z0SA 4FO2A 1N32Q 3H91A 2QDBA 4OIJA 2B2YC 2F1MA 2E75C 2EY5A 5J22A 4R4OA 1U9RA 5M5XH 1H9JA 1B4OA 3S2HB 1I50H 1SJHD 4JG2A 1CKNB 2BA1A 3HOVH 2BCOA 1RDPD 1QVGA 1PH4A 3FKIG 1XPUA 2K4KA 4IOAA 1CKOA 2QDLA 3SR1A 2LY7A 1AH9A 4A3FB 1SBBB 2PW5A 3G71A 4DK1A 4L6TB 3DXJC 4BBRB 1HNXQ 1IYJB 2JA5G 3W1BA 4QUFA 3I91A 1YJWA 3AMUA 2IX1A 2B39A 4NXML 5CV5A 1HFGA 4L5QA 1NE3A 3PIOA 4TRDA 1ZEQX 4HN7A 1EQQA 4LUVA 5HY6A 1I94Q 4TSSA 3TRZA 2A6HD 3EVQA 3GV6A 4LF6L 5GAGC 2ZJRA 1JE4A 4XDXA 1SEBD 3FKIH 1EY9A 2IPKD 4YIJA 4ME3A 2ATWA 3AB9A 3K8AA 4X66Q 3I70A 5CBEE 5D3IB 1QILA 2MP1A 1B44D 2BDOA 2PQEA 2VQFL 3RNUA 1CZWA 3QG1A 4LF5L 3RLOA 5D65A 3TZDA 1I3QH 3T53B 4DXGA 1PH7A 2LMCB 4IFDJ 3T1YL 1EU4A 4DV4L 4A3CH 3I55A 2I5LX 4JI3L 3OW7A 4HIKA 3GP7A 1IKLA 3T1HQ 2DY7A 3VR5A 4DV0Q 3HOUH 4ABNA 3H6MA 3IL8A 4QB4A 4RHSA 1UE7A 5FLMG 4B3RQ 1EWHA 1PTOD 1YNXA 2EXZA 3IRBA 4EQ5A 4A3MB 1PRTF 3ZJYC 5FLXL 3GTOH 3UDXA 1JOQA 3QJYA 1JR0D 1T5XD 3A74A 1NSNS 2TMPA 4KKTA 5TSSA 1Z47A 2EY2A 4GLAC 1TS4A 3HS0C 2ZTEA 4E6IA 1BKBA 1N36L 4JI2Q 5EQ0A 3L7ZC 3BDOA 3I73A 2GVBA 4YCVA 1VS0A 4H44C 4QGUA 4A3MH 1ML0D 1TQOA 2AWNA 4DR5L 3OYYA 1WTRA 1YNJD 2R92H 2PQAA 3FKIB 1PYSB 1BBWA 3DEPA 2CKZB 4KLKA 5M3MG 3J81j 5C4XG 4PMCA 2WP8J 1E2ZA 1BUVT 5JVG3 3MEFA 1G6PA 3PO2G 4L63B 1SRUA 5EPJA 3TREA 1GUGA 1BCPD 3HEJA 4EQOA 1DD2A 4C3JB 3ULJA 3L3OC 4JI0Q 1VMPA 1QNKA 4IUNA 1VCIA 3PF4A 5DM63 2JA8H 2A6EC 2I5MX 1Q81C 4K14A 4JBMA 3ND8A 1N34Q 1SYDA 3CMAA 1G51A 3MTSA 1JWUD 1QNUA 4FXKC 2WV6D 4JBJA 4DR3Q 4YWKA 2A19A 3MZ5A 1KRTA 2KBNA 1G8ZD 1LTBD 2XTIA 5JJKA 5M9OA 2IL8A 1JJ2A 2E2DC 5COYA 3S2HH 2YU9H 2Z4HA 1C7YA 1XYIA 3J7YW 1K9MC 3KYHC 1Q90A 1QVFA 2Y0SG 4C3JG 1TS3A 4JI3Q 4HMJA 1I5FA 4QY7A 2K04A 1Y1WG 2Q8TA 2WAQE 1I94L 2EY1A 1VQMA 4BA1I 4R8NA 2HIVA 4UP9A 5C3XA 5FJ8G 2Z6KC 4DFAA 3TP6A 4DV1Q 1CZGA 2QF7A 4J8QA 1K8OA 2N78A 1NUCA 3A8KE 4LF8L 4HJ5A 4HTHA 4DV5L 3RZDH 5JPMC 1B70B 3E5SA 2VQEQ 3U50C 1EOTA 2YU9B 4LNQA 4CKBA 4B3SL 3CU7A 1I6HH 4AQYL 2KJXA 3LNNA 1CSQA 1FL0A 4M1UB 2JA7H 1K3RA 1Q1EA 4JK1C 4BY1B 4RMFA 1IBKL 1WJJA 1HZAA 2EVBA 1PYWD 1STEA 1HUMA 4K0KQ 3J81E 2RCFA 5LMUL 1JQYD 4KHPQ 1G6ZA 2RBMA 4DR2Q 5C44H 2EE1A 2UUCL 3FDTA 2EYFA 1U4LA 1FGBD 3TP8A 3I2ZA 2DY8A 5IT9L 4P74A 2B2UA 4Q0FA 4PV1C 2KCTA 2HQEA 4JV5Q 4UHVA 5J3BA 3PIO3 3SDZA 1EY4A 1KQSA 3NWTA 1VQNA 4ZQ3A 5DEHA 3QR8A 2K5VA 4C2MB 4LFBL 4A76A 2E8GA 1VQLA 4NXNQ 3UI2A 1TWGH 3S1NH 4H7BA 2L11A 1HZCA 2D2CC 1EQTA 1TWFB 1DGSA 4A3BG 1PZID 4KV6A 4CDEC 2K33A 3C46A 5GAHC 3I4NB 4K6DA 1ZYRD 1D7QA 5EBDA 1ZXTA 4CHTB 4CGYB 1WTVA 3HKZB 3RD4A 1VF5C 4A3FG 3E3XA 3DEOA 1CK1A 4UPAA 5KNCA 2D0PA 5BN3A 3S14B 3GTMB 4WORA 3AYHB 5LMUQ 3HFZB 2N55A 4JBWA 1CA5A 5KRUA 1S72A 1ICFB 4JI7L 3UDIA 1LM0A 3D4DA 1ZKOA 4KJNA 1YNNC 1B9MA 3M7NA 2NN6G 3WOFA 1ENAA 4DUZQ 4HIDA 3ERQA 1K0RA 1VQJA 4X62Q 3GTJH 1IBML 1VMCA 3MXPA 5IODA 3CC4A 1QVCA 4PG3A 1ICWA 2NZHA 1S5FD 1HJPA 5JAVA 2RQXA 3A7AB 3TZUA 1XPRA 5A2QL 4FYDA 3U4ZA 1XNQQ 4RCNA 1EL0A 4GN5A 1B53A 1EFWA 1RJTA 3CCUA 2A6ED 5FO8B 1XWEA 4NKLA 3NP8A 4LF7L 4A3KB 3HKZG 2PMZB 2Y0SE 3HOVB 3PO3B 1EIHA 1DOLA 3AQQA 1LT4D 3M4OB 2KQ3A 2NN6H 4CBVA 3I4MG 3MC0B 1JOKA 3H09A 3F8TA 4ZK9B 3W1GA 2J4XA 4OONA 4IUVA 1A2UA 3S16B 4C3HH 1G2SA 1ET9A 2FJ2A 3X3NA 2CHBD 1GVPA 3OPOA 4ILWA 3GTPB 4R4CA 4DGZA 3BZDB 4DV6Q 4Y7NH 5LMNL 3CQZB 3CC2A 3SK6A 2EYPA 1DM0B 4DNRB 1TWHB 2K03A 3KLSA 1C9OA 2O2LD 3HOYH 4XTCS 3CCRA 1EYCA 3K59A 2F0QA 1SNCA 2HHHQ 3CQZH 3LX0A 2OEOA 5EAYA 1MBYA 1KHIA 1EOVA 1STHA 4A3IB 3I90A 2B2UC 1GD7A 4JI1Q 1FJGL 1B3AA 5JJLA 4BBSG 3S16H 1VQ9A 3E9IA 2BE5C 3E6ZX 2RSOA 1E3PA 2JXMB 1ESFA 4RWSC 3K7AH 1WOCA 3MWYW 2NVTB 2EY6A 1FJGQ 5JOBA 3M3YH 1J5EL 1RD9D 1FGUA 1X3FA 3NSWA 4ULLA 3KLWA 3DUZA 1M1KC 3CHBD 3F2BA 4DR7L 4JI4Q 1VF7A 2XGTA 1LTTD 3SEBA 1CA6A 4JOIC 1HQMC 3SXHA 2IT1A 2E2JH 1JWMD 4JI4L 1DJRD 4L5SA 2F0JA 2OQ0A 1U4PA 4EQPA 2IJ0A 2RHSB 3S17H 1Y1VG 3OHXC 3F1ZA 2I07B 2JA7G 2N49A 4IPGA 3CF5A 3KK7A 1GHJA 2A6HC 1Q8KA 1ESRA 1EY8A 4LF4L 4R4TA 4A3BB 2V1CC 4L5RC 4A93G 1PTOH 2R93H 1EZ8A 4NPSA 1VQAA 4QQBX 4FF3A 3NEMA 3OSOA 2PQAB 2JQOA 2ZXOA 5CV4A 5FO7B 4HJAA 1RODA 5CORA 2IHFA 4J6HA 5DLQE 1N8RC 2MO0A 1IL8A 1KNEA 2MPMA 2WFWA 1LT3D 3EIVA 4GNXA 1O78A 1F9QA 1LTAD 2DNEA 2EOTA 2MQHA 1YNND 1T9HA 1TY2A 1TWAB 5JEAJ 3QIAA 4ALPA 4ME5A 5E4XA 2NVQH 2DNCA 1HRJA 1M4VA 5HGQA 3NELA 4PZ8A 4IFDI 1K0SA 1LT6D 2ZXRA 5C3WA 5IYCH 2JP1A 2JN4A 1STNA 2MHVA 2B29A 5K36H 3OOCA 2E2IH 4QF4A 2PMZE 3M4YA 2WKCA 2DGYA 2EYHA 4H02A 4LFAQ 1NTGA 4DR1L 3RLNA 1EYGA 1S5BD 4JI7Q 2ZJQA 1HR0Q 2F4VQ 1NJIC 1IXRA 2R7ZH 1A63A 1UNSA 1MJEA 1ASYA 3IKJA 5IE8A 5C0XH 2HCIA 1ENFA 1S4ZA 5ELEA 4DAVA 5LL6X 3B6YA 3L2PA 3CCEA 4OIKA 1EY6A 1XX8A 2F0GA 1SYCA 3O13A 3S1RH 5K36G 1ET6A 3HGBA 3CKIB 2EXDA 1N33Q 3JAML 1Y1WB 5ELOA 4A75A 5JEAG 1N33L 1KRSA 1NR2A 1R9TB 1Q46A 1NR4A 2K5NA 5ELDA 3I4LA 1WTHA 2BH8A 5EPKA 5JJZA 3GTQB 4OO1I 3PGZA 1BR9A 4KHPL 4G7OC 1Y69U 2Q2IA 3H3VC 1HTPA 1SNOA 2PZTA 1EUJA 1AN8A 5KYLA 5BN5A 2ZJPA 4A93B 5IY0A 2ICIA 2A1AA 2G9DA 2OWOA 2HQLA 5EKLA 4DV2L 1BCPB 3UDGA 4PMWA 2LXKA 1A3UA 1CQFA 3P75A 4CDDC 4DR2L 4X3SA 3E0EA 2NB0A 1FNVA 5M5YH 3UE1A 4OO1G 4O0AA 1K8GA 5KNDA 2MO1A 1JWSD 4POFA 4GN4B 1UE1A 2RDGA 5IGBA 3C1FA 4X64Q 4DXFA 4YY3Q 1SFOH 3M85A 4K5VA 4X3KA 3QO2A 1RKNA 2B8FA 1MD2D 3TS2A 1VQGA 4CJ2C 1KAAA 1D2BA 1L0WA 4DK0A 3PUYA 2Z6KA 4RA8A 4A3DH 4QL5A 1HCZA 4KI0A 1YEZA 4RGMA 2BE5D 3D31A 3R8BA 5IGCA 3GTJB 2VUMB 2KHIA 1HR0L 4ODGA 2SEBD 2WKDA 2BDNA 1ENCA 2UXBL 4JI8Q 4AYBB 3WWVA 1Z7TA 1G2TA 2X6GA 4PNYA 2HCCA 1X55A 4JCVE 3M4OH 4EVOA 4A3GG 1QG7A 3S2DB 1D6EC 3PF5A 2UXBQ 1E1TA 4A3KH 2PNRC 1LABA 1UUPA 5C4XH 1HHVA 1D5ZC 1I4QA 1RHPA 1HNWQ 5EBCA 2R7ZB 2M9VA 3VYTA 2ICEC 3FPPA 1KIXA 1D8LA 2NWGA 4LMQD 1HNZQ 3MFYA 1ILQA 1IBMQ 2VB2X 1QOHA 4YHHQ 5IP7H 3DLLA 2R93G 4OWXB 4LF4Q 1N34L 4B3TL 3HZXA 2IW3A 4OX9Q 2JA5B 4F7XA 4WJWA 2H4OA 5C3EG 5IIFA 3DWQA 2SDFA 1Z6HA 1EQVA 3LWUA 2IY5B 3SVMA 4MZ9A 1CFMA 3HOUB 4J15A 1LUZA 4IOCA 1JJGA 5IGGA 4ZRZA 2CFMA 2JA5H 1WD0A 1G291 3W2DA 1RIPA 1JC7A 1MSHA 1ZYRC 1JCKB 4KD4A 4QCLA 1GKHA 2EYLA 4MN3A 4I7ZC 3S17B 1J8IA 2JA6G 2NVYH 1SYBA 4FXGC 2VNUD 3SK5A 4JI1L 4BWGB 4DR7Q 2GVAA 2YTYA 2K50A 1L0XB 4K6LA 3KUPA 5G3LD 4CKCA 3MXUA 4K8JA 3D4WA 4O1NA 4EQNA 3RN2A 3H15A 1OXVA 3NPPA 4XQQA 4CDCC 2NZOA 1X9NA 3D4RA 3I8ZA 2B2WA 2EPBA 2NBFA 3CCLA 2VQEL 4BXXG 5CR3A 2CQAA 2E76C 5BN4A 1VQDA 1NY4A 2L12A 2K5HA 2G5DA 3VA7A 4JI6Q 4BS9A 5LMNQ 1E24A 4UY8C 3D3RA 1XMOL 1B9NA 5CYUA 3BZKA 4PQXA 5FLMH 2FHTA 4JI2L 3MVVA 3PSIA 3M3YB 1C4QA 1HH2P 5CC4A 4JBKA 4OGQC 1JORA 2JA7B 3NTKA 2K14A 5I6WA 3J81c 2UXCL 5C44G 1WFQA 1XJVA 5GROA 1EIFA 1GUOA 2N88A 2KA7A 3KF8B 4OXPA 3U4VA 4R1JA 2R7FA 4RKLA 2UXDL 4MHEA 4CDFC 1R9TH 1K73C 3TEHB 4KMUC 4OX9L 2B8GA 1HTLD 2Q2TA 4QUCA 3BU2A 3S1QB 1L1OA 1X3EA 2B2TA 2B2TC 4A3CG 1PV4A 3S1RB 1LTRD 3BYYB 1EU3A 1ONLA 4MIUA 4Y7NB 1S40A 2AUJD 4MNOA 1YZ6A 4XIGS 3P1HA 3GTPH 2QILA 3PUVA 1EWCA 2AQ2B 2RDHA 1KDAA 1KD1C 2L5TA 1XMQL 5IYBG 2F0IA 1PFMA 3G48A 2Z1CA 3KJPA 4DKAC 2E5LL 4IUQA 1AZPA 1B2TA 4JI8L 4KKUA 3PIP3 4GKKL 4DA2A 2RSNA 1BBXC 2F3WA 1CUKA 4DV7Q 3GQBA 2PCFB 5IWAQ 1GUSA 3W3AA 3M9BA 3NTIA 1O7LA 4JVZA 1TS2A 4XQJA 1EIGA 3LWEA 1ASZA 4GKJQ 3CRLC 5A35A 2IWHA 2H5XA 4X65L 3J7AV 1IKMA 3GTGH 5IWAL 1EEID 3I7FA 4C3JH 1I6VC 2Z9HA 3CP0A 2B63B 1LV9A 1WTQA 1A3VA 2B3GA 5IYDG 1KL9A 1SE8A 2F3IA 1PRTC 4HCSA 1B1ZA 4FVMA 3J80E 1VQKA 4JV5L 3PMFA 1BQQT 3IFDA 2RVLA 4JI5Q 3ITPA 3FPUB 3GTOB 4KHVA 1EY7A 1R4PB 3NTHA 3S1NB 3UDFA 3K5LA 4Z9CB 1PH5A 5I9OA 3CAMA 4JI5L 3VA5A 1PTOF 1NMGA 3TDQA 3X3MA 1S5ED 4GLVB 3PQIA 3NQIA 3I4NH 2KUMA 5I4DA 2F0PA 1N36Q 2XWBB 3EROA 1X56A 2BA0A 1F9SA 4BBSB 1IBKQ 1C48A 1V1QA 3DWAA 4LF8Q 4O2DA 1UWVA 2JSOA 1HZBA 3FP9A 2E2JB 3SK8A 2VB3X 3OW2A 1JE5A 5C3EB 3NUCA 3BZCA 2CH4A 2F0TA 1Q8IA 4B3RL 5CV8A 1MGSA 1TIID 4LF6Q 3KLSX 2PPBC 2ZM6L 1QUQB 1H95A 1KAWA 2NVTH 4MTKA 1Q12A 1A2TA 2JA9A 2WAQG 2UUBQ 3P7JA 5T1IA 1B50A 1VDZA 3PUXA 1BDOA 2F52A 1GOZA 4JYAQ 1OTCA 4RHRA 4WFN3 2UXDQ 1YHAA 1OXSC 1B3QA 1SNQA 3FHWA 3URYA 3CRKC 1EYAA 3LGJA 3VR2A 5KEEA 2XIWA 4HIOA 1LT5D 3ULLA 3VR6A 4XYQA 2AQ1B 3MHBA 1XPOA 2X69A 4B08A 1A6XA 1I4HA 1PFSA 4B9XA 1NCVA 4TVAB 1HZ9A 2NYZD 3KBXA 1STAA 1YI2A 1BBUA 1EY5A 2O5IC 1D5XC 1I6HB 3GO5A 2FXQA 2K32A 5M5XB 3S1QH 3V05A 2JJQA 1IYVA 1HFNA 5EKKA 4GNXB 1D5MC 5E1FA 1D1IA 1LTGD 4J1MA 3AFQA 2F0WA 2PYKA 3WOEA 1Y1VH 1LACA 2D9UA 3HP3A 1W6KA 4LF9Q 3HRZC 1MKHA 1BCPC 2EYMA 4HJ8A 1G91A 1EFID 4A93H 1KNAA 5AJ3L 4LFCQ 3GD7A 4HMIA 2MJ8A 4IFDH 1SDFA 4DR4Q 4A3GH 1AFPA 3S24A 1L2FA 1TU2B 3GTQH 1CM9A 3GTKH 3MAQA 2JE6I 1GJXA 4CKEA 5KIXA 3J81i 3R3OA 2EYJA 1IYUA 4RGTA 4BY7B 2JA8B 1RCVD 4S3SA 3L0OA 5C4ZA 1Q3LA 4UDUC 5HURA 3M4QA 2F0VA 2ZT9C 1QZHA 1X6OA 1IBLL 1YHBA 3A8JE 4IFDG 4OWTB 3I4MH 3BVMA 2AUKA 4TQUS 1A15A 2HHHL 1A8VA 5IYCG 1PHJA 4C1NK 3W5OA 1HUNA 1CSPA 4DAYA 1VQOA 2SNMA 3H94A 2XWJB 3Q24A 5FK9C 1U4RA 5CMDA 1EQRA 3Q23A 1KLGD 4LF5Q 3PV0A 3AU7A 3D8GA 3CCJA 1STYA 4DV0L 3SHLA 4DUYQ 3MFGA 2VQFQ 5EKIA 1WCMH 1GUNA 1O80A 1KXLA 3K7UC 1YBYA 5C0XG 1VQ6A 2QEJC 2CQOA 1TY0A 3D6WA 1SMXA 1Q86C 4AQYQ 4HSVA 2JA6H 1H9SB 2N8NA 3T16A 4X6AH 3CMEA 2OCEA 1AW7A 1PH2A 2YTXA 2PI2E 2K05A 4DK3C 1DOMA 3KF6B 1WCMB 2LKVA 1W3SA 3HOXH 3EN2A 1O7ZA 3KDFB 1K8MA 4I65A 2Q2UA 1GXDC 3GTGB 3M4PA 5KYIA 4KN4C 1JT8A 5IP9H 1MI2A 4BY7G 5F2DA 1E2WA 4GS3A 3S15H 1TR5A 1XMOQ 1RL2A 1XTCD 4KK7A 1K28A 2JYOA 3JAMc 3NBHA 3R2TA 4DUZL 1AP0A 4BY1H 1KLUD 1I3QB 1LYLA 4IPDA 5LHY1 4O42A 2ZM6Q 1TWCB 3TMEA 3U9SA 3F2DA 5J39A 3SGIA 3K81C 3KF8A 3QOJA 1N9WA 3HOZG 4X3UA 2J0TD 1JOOA 3JC66 3CC7A 4BY7H 1X3QA 2UUAL 4L5TA 3PIPA 1L1OB 4TKOB 1PH6A 1OXUA 2Q8IB 3BDLA 4C3IG 2PI2A 1H9RA 1MSGA 4LWCA 4KY7A 4QJFA 3HG9A 2K01A 3K80C 4AYBE 2RDFA 2BOSA 1WI5A 3G6JB 4HIMA 1I50B 1C0AA
chains in the Genus database with same CATH topology
1D8LA 1C7YA 3CPWA 2ZTCA 4R4QA 4YCWA 1HNZQ 1YITA 1X54A 3CCQA 1IBMQ 1K9MC 3KYHC 4YHHQ 5IP7H 4DR1Q 3DLLA 4DPGA 5GAEC 3J80i 2R93G 2VL6A 2Y0SG 5GQOA 1QVFA 4OWXB 4LF4Q 1N34L 2UUAQ 3HOZH 4JI3Q 4B3TL 4OX9Q 1IZ6A 1YVCA 3VDYA 1I5FA 5C3EG 3GTLH 2YV5A 4QY7A 4B3TQ 1Y1WG 2WAQE 1I94L 5C0XJ 2YTVA 1PH8A 1VQMA 4YCUA 1VQFA 2IY5B 2I5HA 4BA1I 2HIVA 4MZ9A 1HNZL 1JJGA 1A62A 1LUZA 4J15A 2Z6KC 4UP9A 5FJ8G 4IOCA 4A3EH 2YU9H 2VS1A 2CFMA 4DV1Q 2JA5H 3H0GH 2UXCQ 1JJCB 2I0QA 1G291 1RIPA 2IHEA 2N78A 1GKHA 4LF8L 4HJ5A 4QIWE 4DV5L 4DR6L 1M90C 3RZDH 2F4VL 1B70B 2VQEQ 3RLFA 3U50C 1IBLQ 1TWFH 4B3ML 4LNQA 4B3SL 1I6HH 2QEXA 4AQYL 2JA6G 4MTNA 4BBRG 1AE2A 2NVYH 5H1SE 1EWIA 4B3MQ 1CSQA 1FL0A 1BVSA 2JA7H 1K3RA 1Q1EA 2VY3A 2VNUD 4RMFA 4JI1L 3T1YQ 1IBKL 1WJJA 1HZAA 1UE6A 4DR7Q 2GVAA 2YTYA 2K50A 4NB3A 2CWAA 4A3BH 4K0KQ 1PH1A 2RF4A 5LMUL 4IO9A 4KHPQ 4DR2Q 4A3MG 4DV1L 5C44H 2HT1A 3H0GG 5C3EH 3UE0A 4LFAL 2UUCL 3RN2A 4EX5A 3H15A 1OXVA 1SROA 2NVXH 1X9NA 2NZOA 2C35B 4YWMA 3I2ZA 4X66L 4WJ4A 4P74A 3CCLA 2VQEL 4BXXG 4RG1A 2VUMH 5BR8L 1VQDA 1NY4A 2KCTA 4A3EG 2K52A 2K5HA 3TQYA 3AEVA 4JI6Q 4BA2I 5LMNQ 4JV5Q 1E24A 4UY8C 4DR5Q 1XMOL 5J3BA 4B3SQ 1KQSA 5GADC 3BZKA 5FLMH 2MNAA 4JI2L 1VQNA 5C4JH 4JI6L 1MJCA 3PSIA 4JC0A 2K5VA 3PUZA 4LFBL 4LW1A 1HH2P 4LF7Q 3CCMA 4A76A 4R4IA 2E8GA 1VQLA 1WYDA 1QUQA 4P75A 4JBKA 4NXNQ 3F2CA 1B8AA 1L1OC 1TWGH 3S1NH 1TWHH 2UUBL 2K14A 1HZCA 2N3SA 3J81c 3HOVG 2UXCL 5C44G 1WFQA 2Q2HA 1XJVA 2GN5A 4A3JH 5GROA 4BBSH 1EIFA 1DGSA 4A3BG 4PZ6A 1P8LA 5GAHC 4BBSG 3KF8B 4JYAL 2AMCB 4OXPA 3U4VA 1VQPA 4R1JA 4DR6Q 5M5WH 2R7FA 2UXDL 3D0FA 2B63H 1SLJA 2D0OA 1R9TH 1UE5A 3ULPA 3TEHB 1K73C 4OX9L 1D7QA 3GDEA 2R6GA 1YJ9A 4LUOA 2Q2TA 2MFIA 3BU2A 1E7ZA 4A3FG 4A3LH 5FLXc 1L1OA 5JJIA 4UPAA 1X3EA 2D0PA 5IP7G 3S1MH 4A3CG 1PV4A 1VQHA 3AYHB 5LMUQ 1S3OA 3HFZB 4GOPA 2EQSA 1J5EQ 4JBWA 1TXYA 1S72A 4X62L 1EIYB 4JI7L 3UDIA 1LM0A 1S40A 2UUCQ 1VQ7A 4MNOA 3PUWA 3M7NA 5C0XI 1YZ6A 2NN6G 4XIGS 3HOXG 3GTPH 3PUVA 4DUZQ 4HIDA 1NBWA 1KD1C 1K0RA 5IT9c 1XMQL 1VQJA 2ID0A 3DM3A 4X62Q 1YHQA 3GTJH 2A8VA 5IYBG 1IBML 2K75A 3CC4A 3G48A 1QVCA 4PG3A 3NENA 2NZHA 3KJPA 1A0IA 1HJPA 2KHJA 4DKAC 2E5LL 4A3JG 1XPRA 4IJHA 2B63G 3U4ZA 1XNQQ 4JI8L 3HOYG 1IL2A 3HOWG 3ICEA 2IX0A 2JK8A 2OTJA 3CCVA 4GN5A 4GOPC 3KFUA 4GKKL 1EFWA 3CCUA 3TS0A 4LF7L 3I4OA 2RCNA 3HKZG 2Y0SE 1CUKA 4LFCL 5AJ3Q 4DV7Q 5IWAQ 3I56A 3AQQA 3M9BA 3STBC 3EBEA 1ASZA 3I4MG 4GKJQ 2H5XA 3F8TA 3ER0A 5E7NA 4X65L 3OTOL 1HNWL 3W1GA 2WB1E 3JAMi 4DV3L 1PVOA 4OONA 4DV6L 5IWAL 3GTGH 1TWAH 3MXNB 1SN8A 1LTLA 4C3HH 3I7FA 4C3JH 1GVPA 3CP0A 2ES2A 1YJNA 4X65Q 4R4CA 2B3GA 2RHQB 5IYDG 1KL9A 4Y7NH 4DV6Q 1SE8A 2F3IA 1VQ4A 4GKKQ 1VQKA 5LMNL 3CC2A 4JV5L 4YHHL 3J80c 4IPCA 1PH3A 4OWWB 5IYBH 4APVA 4WJ3M 4JI5Q 4NXMQ 5M3MH 4K0KL 3Q8DA 3BJUA 1FVIA 3S14H 1U5KA 3E9HA 4DR4L 3UDFA 4DAMA 1C9OA 3HOYH 2JEBI 1PH5A 3CAMA 4XTCS 3PO2H 3CCRA 4JI5L 2QGQA 4LUZA 1NMGA 4C3IH 4GLVB 1MIUA 2VZAA 1Q1BA 3CQZH 3CXCA 4DUYL 2HHHQ 4UP8A 3I4NH 1N36Q 5EAYA 1KHIA 4DV2Q 2PNHA 1EOVA 1X56A 1P16A 3STBD 5M3FH 1HR0W 3G4SA 1JMCA 2BA0A 5BR8Q 3T1HL 1GD7A 2R7DA 4JI1Q 4A4IA 1V1QA 1IBKQ 1FJGL 5JJLA 4LF8Q 4O2DA 1JB7A 2EIFA 3S16H 1UWVA 1VQ5A 1VQ9A 1HZBA 3E9IA 3FP9A 4PZ7A 4A3IG 2CWPA 1NMFA 1E3PA 2LSSA 4AIMA 1OXXK 3K7AH 1WOCA 1E1OA 3OW2A 1FJGQ 1JE5A 4C2MH 3M3YH 2KCMA 3BZCA 3KJOA 1J5EL 4B3RL 1FGUA 1X3FA 5IYDH 3PO3H 4LF6Q 1PYBA 3KLWA 2UU9Q 2ZM6L 1M1KC 1QUQB 1H95A 3F2BA 4DR7L 4JI4Q 1KAWA 2NVTH 1Q12A 1B7YB 2XGTA 4JOIA 2R92G 4JOIC 1V9PA 2JA9A 2IT1A 2E2JH 4AH6A 4BXXH 4IJLA 4DV3Q 4L5SA 4JI4L 4KHZA 2WAQG 1WCMG 2OQ0A 2E2HH 2UUBQ 4POGA 4JI0L 1Z9FA 3PUXA 4GN3B 2F52A 2RHSB 4NXNL 4JYAQ 1QZGA 1OTCA 3S17H 4A3DG 1Y1VG 3CD6A 3KDFA 4BBRH 2DUDA 3CCSA 1YHAA 2KENA 4GLXA 1OXSC 3H3VI 2UXDQ 3FHWA 1XTDA 3F1ZA 1VQCA 4GNXC 2N49A 4X64L 4IPGA 3CF5A 4A3FH 3LGJA 1Q82C 2JA7G 3I4NG 4A3LG 4LFBQ 1Q8KA 4HIOA 1Y1WH 4LF4L 1U0LA 4DAYB 4R4TA 5M3FG 2LXJA 3ULLA 2V1CC 4L5RC 4A93G 2R93H 4NPSA 1VQAA 4QQBX 1XPOA 1XNRL 3NEMA 4HJ7A 2PQAB 1PFSA 3A0JA 1VQBA 2JQOA 4TVAB 1HZ9A 3NBHB 1X3GA 4GOPB 2AKWB 4AYBG 1BBUA 4HJAA 1YI2A 1W2BA 2ZTDA 3PO3G 2IHFA 3GO5A 2FXQA 3CPFA 3PCOB 5DLQE 4HJ9A 3OTOQ 4A3KG 1N8RC 2MO0A 1GO3E 3S1QH 2VUMG 2JJQA 1Q7YC 4GKJL 2WFWA 3EIVA 1J6QA 5IP9G 4BY1G 4GNXA 4DNIA 4GNXB 2Z0SA 3AFQA 1N32Q 2MQHA 3HOWH 3U58A 1T9HA 1Y1VH 5JEAJ 4R4OA 4ALPA 4LF9Q 5M5XH 2NVQH 1MKHA 2QA4A 2NN6I 1I50H 4HJ8A 3H3VH 5HGQA 3NELA 4PZ8A 4JG2A 4A93H 4IFDI 1CKNB 5AJ3L 4DV7L 4LFCQ 2BA1A 3GD7A 3HOVH 5IYCH 4DR4Q 4Y52H 4FDBA 4A3GH 3S24A 1L2FA 2B29A 2E2IH 1QVGA 3GTQH 1PH4A 2OTLA 3FKIG 2PMZE 2K4KA 1K83H 2L15A 1AE3A 2ASBA 1XPUA 2DGYA 1CKOA 2ALYB 2JE6I 4LFAQ 4H02A 3GTKH 1NTGA 4IOAA 4DR1L 3RLNA 3J81i 1EYGA 1YIJA 1PH9A 4JI7Q 1AH9A 1Y14B 3G71A 1OXTA 2ZJQA 1VQIA 1HNXQ 1IYJB 1HR0Q 2JA5G 3W1BA 1NJIC 2F4VQ 1IXRA 3L0OA 1YJWA 2R7ZH 3HOUG 2OQKA 1A63A 3J7ZC 2IX1A 1MJEA 1ASYA 4NXML 5IE8A 4L5QA 1NE3A 3PIOA 3M4QA 4LF9L 1QZHA 1X6OA 4LUVA 1EQQA 5HY6A 1I94Q 3B6YA 3L2PA 3CCEA 1IBLL 1XNQL 1YHBA 3TRZA 4IFDG 4OWTB 1VQEA 4LF6L 4UP7A 3I4MH 3S1RH 1K8AC 5GAGC 2ZJRA 5K36G 4TQUS 3FKIH 3RZOH 2HHHL 1A8VA 1E22A 5IYCG 1PHJA 2EXDA 4ME3A 1N33Q 3W5OA 2ATWA 3K8AA 4X66Q 1CSPA 5ELOA 4A75A 3J7A5 1VQOA 5JEAG 1N33L 1KRSA 1Q46A 4P73A 3HKZE 2K5NA 1EQRA 2VQFL 4LF5Q 1O7IA 3PV0A 3RNUA 4A3IH 3CCJA 4DV5Q 1HNXL 3A5ZB 3RR5A 4DV0L 3S2DH 4DK6C 4DUYQ 2VQFQ 3RLOA 4LF5L 1I3QH 1WCMH 2BH8A 1PH7A 4OO1I 4IFDJ 3T1YL 5ELNA 4DV4L 3K7UC 3PGZA 1YBYA 2I5LX 4JI3L 3I55A 4A3CH 4KHPL 4HIKA 5C0XG 1VQ6A 3CW2C 2CQOA 3T1HQ 1SMXA 2Q2IA 4DV0Q 4AQYQ 1Q86C 2UU9L 3HOUH 1EUJA 2JA6H 5FLMG 1UE7A 2ZJPA 2AHOB 5IY0A 2N8NA 4B3RQ 1YNXA 2A1AA 3IRBA 4EQ5A 1UEBA 2OWOA 3GTOH 2HQLA 3ZJYC 4DV2L 3UDXA 4X6AH 3CMEA 3RN5A 2OCEA 3UDGA 1PH2A 2WB1G 3A74A 2YTXA 2LXKA 2PI2E 4PMWA 4DK3C 4DR2L 1GM5A 2JA8G 3AFPA 3E0EA 1Z47A 5M5YH 2JEAI 1KXLA 4GLAC 3UE1A 3KF6B 3A5UA 4OO1G 1W3SA 3HOXH 3KF6A 4O0AA 3EN2A 3KDFB 1K8GA 1N32L 2ZTEA 2Q2UA 1V43A 1BKBA 1N36L 3M4PA 4JI2Q 2MO1A 1JT8A 3L7ZC 4POFA 5IP9H 4GN4B 1UE1A 2AWOA 2GVBA 4X64Q 4P71A 4YCVA 1VS0A 4YY3Q 1SFOH 4QGUA 4A3MH 3S15H 4GS3A 3M85A 4BY7G 2VW9A 2AWNA 4DR5L 3OYYA 1XMOQ 1RL2A 4DR3L 2R92H 3G6EA 2PQAA 1PYSB 3KOJA 1BBWA 4KLKA 2CKZB 5M3MG 3JAMc 1VQGA 3J81j 4DUZL 3TS2A 5C4XG 2WP8J 4BY1H 4P72A 1L0WA 3PUYA 1LYLA 2Z6KA 4IPDA 4A3DH 3MEFA 1X65A 4QL5A 2ZM6Q 1G6PA 3PO2G 3F2DA 2BH2A 1SRUA 4KI0A 3SGIA 3K81C 4IPHA 3TREA 1YEZA 2YYZA 3D31A 3ULJA 1N9WA 2D62A 2KHIA 1HR0L 3HOZG 4JI0Q 1VQ8A 3JC66 1VCIA 2UXBL 3PF4A 4JI8Q 2JA8H 4DV4Q 4YY3L 4YWLA 1SR3A 2I5MX 3CC7A 4BY7H 3WWVA 1Q81C 4JBMA 1TWCH 1N34Q 2UUAL 4L5TA 3CMAA 1G51A 1X55A 4JCVE 5FJ8H 3PIPA 3M4OH 1L1OB 2R7ZG 4A3GG 3ERSX 2E5LQ 2HIXA 1PH6A 1OXUA 3PF5A 2UXBQ 1E1TA 3GTMH 1CKNA 4A3KH 4JBJA 4DR3Q 4YWKA 2A19A 2PI2A 4LWCA 1KRTA 1XMQQ 2KBNA 1XNRQ 4QJFA 1CKMA 1PA6A 5C4XH 1KC8C 2XTIA 3K80C 4AYBE 5JJKA 1HNWQ 3HKSA 1WI5A 2CCZA 4HIMA 5LMNW 1JJ2A 3S2HH 1C0AA 1KIXA 3K0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8L A;  1C7Y A;  3CPW A;  2ZTC A;  4R4Q A;  4YCW A;  1HNZ Q;  1YIT A;  1X54 A;  3CCQ A;  1IBM Q;  1K9M C;  3KYH C;  4YHH Q;  5IP7 H;  4DR1 Q;  3DLL A;  4DPG A;  5GAE C;  3J80 i;  2R93 G;  2VL6 A;  2Y0S G;  5GQO A;  1QVF A;  4OWX B;  4LF4 Q;  1N34 L;  2UUA Q;  3HOZ H;  4JI3 Q;  4B3T L;  4OX9 Q;  1IZ6 A;  1YVC A;  3VDY A;  1I5F A;  5C3E G;  3GTL H;  2YV5 A;  4QY7 A;  4B3T Q;  1Y1W G;  2WAQ E;  1I94 L;  5C0X J;  2YTV A;  1PH8 A;  1VQM A;  4YCU A;  1VQF A;  2IY5 B;  2I5H A;  4BA1 I;  2HIV A;  4MZ9 A;  1HNZ L;  1JJG A;  1A62 A;  1LUZ A;  4J15 A;  2Z6K C;  4UP9 A;  5FJ8 G;  4IOC A;  4A3E H;  2YU9 H;  2VS1 A;  2CFM A;  4DV1 Q;  2JA5 H;  3H0G H;  2UXC Q;  1JJC B;  2I0Q A;  1G29 1;  1RIP A;  2IHE A;  2N78 A;  1GKH A;  4LF8 L;  4HJ5 A;  4QIW E;  4DV5 L;  4DR6 L;  1M90 C;  3RZD H;  2F4V L;  1B70 B;  2VQE Q;  3RLF A;  3U50 C;  1IBL Q;  1TWF H;  4B3M L;  4LNQ A;  4B3S L;  1I6H H;  2QEX A;  4AQY L;  2JA6 G;  4MTN A;  4BBR G;  1AE2 A;  2NVY H;  5H1S E;  1EWI A;  4B3M Q;  1CSQ A;  1FL0 A;  1BVS A;  2JA7 H;  1K3R A;  1Q1E A;  2VY3 A;  2VNU D;  4RMF A;  4JI1 L;  3T1Y Q;  1IBK L;  1WJJ A;  1HZA A;  1UE6 A;  4DR7 Q;  2GVA A;  2YTY A;  2K50 A;  4NB3 A;  2CWA A;  4A3B H;  4K0K Q;  1PH1 A;  2RF4 A;  5LMU L;  4IO9 A;  4KHP Q;  4DR2 Q;  4A3M G;  4DV1 L;  5C44 H;  2HT1 A;  3H0G G;  5C3E H;  3UE0 A;  4LFA L;  2UUC L;  3RN2 A;  4EX5 A;  3H15 A;  1OXV A;  1SRO A;  2NVX H;  1X9N A;  2NZO A;  2C35 B;  4YWM A;  3I2Z A;  4X66 L;  4WJ4 A;  4P74 A;  3CCL A;  2VQE L;  4BXX G;  4RG1 A;  2VUM H;  5BR8 L;  1VQD A;  1NY4 A;  2KCT A;  4A3E G;  2K52 A;  2K5H A;  3TQY A;  3AEV A;  4JI6 Q;  4BA2 I;  5LMN Q;  4JV5 Q;  1E24 A;  4UY8 C;  4DR5 Q;  1XMO L;  5J3B A;  4B3S Q;  1KQS A;  5GAD C;  3BZK A;  5FLM H;  2MNA A;  4JI2 L;  1VQN A;  5C4J H;  4JI6 L;  1MJC A;  3PSI A;  4JC0 A;  2K5V A;  3PUZ A;  4LFB L;  4LW1 A;  1HH2 P;  4LF7 Q;  3CCM A;  4A76 A;  4R4I A;  2E8G A;  1VQL A;  1WYD A;  1QUQ A;  4P75 A;  4JBK A;  4NXN Q;  3F2C A;  1B8A A;  1L1O C;  1TWG H;  3S1N H;  1TWH H;  2UUB L;  2K14 A;  1HZC A;  2N3S A;  3J81 c;  3HOV G;  2UXC L;  5C44 G;  1WFQ A;  2Q2H A;  1XJV A;  2GN5 A;  4A3J H;  5GRO A;  4BBS H;  1EIF A;  1DGS A;  4A3B G;  4PZ6 A;  1P8L A;  5GAH C;  4BBS G;  3KF8 B;  4JYA L;  2AMC B;  4OXP A;  3U4V A;  1VQP A;  4R1J A;  4DR6 Q;  5M5W H;  2R7F A;  2UXD L;  3D0F A;  2B63 H;  1SLJ A;  2D0O A;  1R9T H;  1UE5 A;  3ULP A;  3TEH B;  1K73 C;  4OX9 L;  1D7Q A;  3GDE A;  2R6G A;  1YJ9 A;  4LUO A;  2Q2T A;  2MFI A;  3BU2 A;  1E7Z A;  4A3F G;  4A3L H;  5FLX c;  1L1O A;  5JJI A;  4UPA A;  1X3E A;  2D0P A;  5IP7 G;  3S1M H;  4A3C G;  1PV4 A;  1VQH A;  3AYH B;  5LMU Q;  1S3O A;  3HFZ B;  4GOP A;  2EQS A;  1J5E Q;  4JBW A;  1TXY A;  1S72 A;  4X62 L;  1EIY B;  4JI7 L;  3UDI A;  1LM0 A;  1S40 A;  2UUC Q;  1VQ7 A;  4MNO A;  3PUW A;  3M7N A;  5C0X I;  1YZ6 A;  2NN6 G;  4XIG S;  3HOX G;  3GTP H;  3PUV A;  4DUZ Q;  4HID A;  1NBW A;  1KD1 C;  1K0R A;  5IT9 c;  1XMQ L;  1VQJ A;  2ID0 A;  3DM3 A;  4X62 Q;  1YHQ A;  3GTJ H;  2A8V A;  5IYB G;  1IBM L;  2K75 A;  3CC4 A;  3G48 A;  1QVC A;  4PG3 A;  3NEN A;  2NZH A;  3KJP A;  1A0I A;  1HJP A;  2KHJ A;  4DKA C;  2E5L L;  4A3J G;  1XPR A;  4IJH A;  2B63 G;  3U4Z A;  1XNQ Q;  4JI8 L;  3HOY G;  1IL2 A;  3HOW G;  3ICE A;  2IX0 A;  2JK8 A;  2OTJ A;  3CCV A;  4GN5 A;  4GOP C;  3KFU A;  4GKK L;  1EFW A;  3CCU A;  3TS0 A;  4LF7 L;  3I4O A;  2RCN A;  3HKZ G;  2Y0S E;  1CUK A;  4LFC L;  5AJ3 Q;  4DV7 Q;  5IWA Q;  3I56 A;  3AQQ A;  3M9B A;  3STB C;  3EBE A;  1ASZ A;  3I4M G;  4GKJ Q;  2H5X A;  3F8T A;  3ER0 A;  5E7N A;  4X65 L;  3OTO L;  1HNW L;  3W1G A;  2WB1 E;  3JAM i;  4DV3 L;  1PVO A;  4OON A;  4DV6 L;  5IWA L;  3GTG H;  1TWA H;  3MXN B;  1SN8 A;  1LTL A;  4C3H H;  3I7F A;  4C3J H;  1GVP A;  3CP0 A;  2ES2 A;  1YJN A;  4X65 Q;  4R4C A;  2B3G A;  2RHQ B;  5IYD G;  1KL9 A;  4Y7N H;  4DV6 Q;  1SE8 A;  2F3I A;  1VQ4 A;  4GKK Q;  1VQK A;  5LMN L;  3CC2 A;  4JV5 L;  4YHH L;  3J80 c;  4IPC A;  1PH3 A;  4OWW B;  5IYB H;  4APV A;  4WJ3 M;  4JI5 Q;  4NXM Q;  5M3M H;  4K0K L;  3Q8D A;  3BJU A;  1FVI A;  3S14 H;  1U5K A;  3E9H A;  4DR4 L;  3UDF A;  4DAM A;  1C9O A;  3HOY H;  2JEB I;  1PH5 A;  3CAM A;  4XTC S;  3PO2 H;  3CCR A;  4JI5 L;  2QGQ A;  4LUZ A;  1NMG A;  4C3I H;  4GLV B;  1MIU A;  2VZA A;  1Q1B A;  3CQZ H;  3CXC A;  4DUY L;  2HHH Q;  4UP8 A;  3I4N H;  1N36 Q;  5EAY A;  1KHI A;  4DV2 Q;  2PNH A;  1EOV A;  1X56 A;  1P16 A;  3STB D;  5M3F H;  1HR0 W;  3G4S A;  1JMC A;  2BA0 A;  5BR8 Q;  3T1H L;  1GD7 A;  2R7D A;  4JI1 Q;  4A4I A;  1V1Q A;  1IBK Q;  1FJG L;  5JJL A;  4LF8 Q;  4O2D A;  1JB7 A;  2EIF A;  3S16 H;  1UWV A;  1VQ5 A;  1VQ9 A;  1HZB A;  3E9I A;  3FP9 A;  4PZ7 A;  4A3I G;  2CWP A;  1NMF A;  1E3P A;  2LSS A;  4AIM A;  1OXX K;  3K7A H;  1WOC A;  1E1O A;  3OW2 A;  1FJG Q;  1JE5 A;  4C2M H;  3M3Y H;  2KCM A;  3BZC A;  3KJO A;  1J5E L;  4B3R L;  1FGU A;  1X3F A;  5IYD H;  3PO3 H;  4LF6 Q;  1PYB A;  3KLW A;  2UU9 Q;  2ZM6 L;  1M1K C;  1QUQ B;  1H95 A;  3F2B A;  4DR7 L;  4JI4 Q;  1KAW A;  2NVT H;  1Q12 A;  1B7Y B;  2XGT A;  4JOI A;  2R92 G;  4JOI C;  1V9P A;  2JA9 A;  2IT1 A;  2E2J H;  4AH6 A;  4BXX H;  4IJL A;  4DV3 Q;  4L5S A;  4JI4 L;  4KHZ A;  2WAQ G;  1WCM G;  2OQ0 A;  2E2H H;  2UUB Q;  4POG A;  4JI0 L;  1Z9F A;  3PUX A;  4GN3 B;  2F52 A;  2RHS B;  4NXN L;  4JYA Q;  1QZG A;  1OTC A;  3S17 H;  4A3D G;  1Y1V G;  3CD6 A;  3KDF A;  4BBR H;  2DUD A;  3CCS A;  1YHA A;  2KEN A;  4GLX A;  1OXS C;  3H3V I;  2UXD Q;  3FHW A;  1XTD A;  3F1Z A;  1VQC A;  4GNX C;  2N49 A;  4X64 L;  4IPG A;  3CF5 A;  4A3F H;  3LGJ A;  1Q82 C;  2JA7 G;  3I4N G;  4A3L G;  4LFB Q;  1Q8K A;  4HIO A;  1Y1W H;  4LF4 L;  1U0L A;  4DAY B;  4R4T A;  5M3F G;  2LXJ A;  3ULL A;  2V1C C;  4L5R C;  4A93 G;  2R93 H;  4NPS A;  1VQA A;  4QQB X;  1XPO A;  1XNR L;  3NEM A;  4HJ7 A;  2PQA B;  1PFS A;  3A0J A;  1VQB A;  2JQO A;  4TVA B;  1HZ9 A;  3NBH B;  1X3G A;  4GOP B;  2AKW B;  4AYB G;  1BBU A;  4HJA A;  1YI2 A;  1W2B A;  2ZTD A;  3PO3 G;  2IHF A;  3GO5 A;  2FXQ A;  3CPF A;  3PCO B;  5DLQ E;  4HJ9 A;  3OTO Q;  4A3K G;  1N8R C;  2MO0 A;  1GO3 E;  3S1Q H;  2VUM G;  2JJQ A;  1Q7Y C;  4GKJ L;  2WFW A;  3EIV A;  1J6Q A;  5IP9 G;  4BY1 G;  4GNX A;  4DNI A;  4GNX B;  2Z0S A;  3AFQ A;  1N32 Q;  2MQH A;  3HOW H;  3U58 A;  1T9H A;  1Y1V H;  5JEA J;  4R4O A;  4ALP A;  4LF9 Q;  5M5X H;  2NVQ H;  1MKH A;  2QA4 A;  2NN6 I;  1I50 H;  4HJ8 A;  3H3V H;  5HGQ A;  3NEL A;  4PZ8 A;  4JG2 A;  4A93 H;  4IFD I;  1CKN B;  5AJ3 L;  4DV7 L;  4LFC Q;  2BA1 A;  3GD7 A;  3HOV H;  5IYC H;  4DR4 Q;  4Y52 H;  4FDB A;  4A3G H;  3S24 A;  1L2F A;  2B29 A;  2E2I H;  1QVG A;  3GTQ H;  1PH4 A;  2OTL A;  3FKI G;  2PMZ E;  2K4K A;  1K83 H;  2L15 A;  1AE3 A;  2ASB A;  1XPU A;  2DGY A;  1CKO A;  2ALY B;  2JE6 I;  4LFA Q;  4H02 A;  3GTK H;  1NTG A;  4IOA A;  4DR1 L;  3RLN A;  3J81 i;  1EYG A;  1YIJ A;  1PH9 A;  4JI7 Q;  1AH9 A;  1Y14 B;  3G71 A;  1OXT A;  2ZJQ A;  1VQI A;  1HNX Q;  1IYJ B;  1HR0 Q;  2JA5 G;  3W1B A;  1NJI C;  2F4V Q;  1IXR A;  3L0O A;  1YJW A;  2R7Z H;  3HOU G;  2OQK A;  1A63 A;  3J7Z C;  2IX1 A;  1MJE A;  1ASY A;  4NXM L;  5IE8 A;  4L5Q A;  1NE3 A;  3PIO A;  3M4Q A;  4LF9 L;  1QZH A;  1X6O A;  4LUV A;  1EQQ A;  5HY6 A;  1I94 Q;  3B6Y A;  3L2P A;  3CCE A;  1IBL L;  1XNQ L;  1YHB A;  3TRZ A;  4IFD G;  4OWT B;  1VQE A;  4LF6 L;  4UP7 A;  3I4M H;  3S1R H;  1K8A C;  5GAG C;  2ZJR A;  5K36 G;  4TQU S;  3FKI H;  3RZO H;  2HHH L;  1A8V A;  1E22 A;  5IYC G;  1PHJ A;  2EXD A;  4ME3 A;  1N33 Q;  3W5O A;  2ATW A;  3K8A A;  4X66 Q;  1CSP A;  5ELO A;  4A75 A;  3J7A 5;  1VQO A;  5JEA G;  1N33 L;  1KRS A;  1Q46 A;  4P73 A;  3HKZ E;  2K5N A;  1EQR A;  2VQF L;  4LF5 Q;  1O7I A;  3PV0 A;  3RNU A;  4A3I H;  3CCJ A;  4DV5 Q;  1HNX L;  3A5Z B;  3RR5 A;  4DV0 L;  3S2D H;  4DK6 C;  4DUY Q;  2VQF Q;  3RLO A;  4LF5 L;  1I3Q H;  1WCM H;  2BH8 A;  1PH7 A;  4OO1 I;  4IFD J;  3T1Y L;  5ELN A;  4DV4 L;  3K7U C;  3PGZ A;  1YBY A;  2I5L X;  4JI3 L;  3I55 A;  4A3C H;  4KHP L;  4HIK A;  5C0X G;  1VQ6 A;  3CW2 C;  2CQO A;  3T1H Q;  1SMX A;  2Q2I A;  4DV0 Q;  4AQY Q;  1Q86 C;  2UU9 L;  3HOU H;  1EUJ A;  2JA6 H;  5FLM G;  1UE7 A;  2ZJP A;  2AHO B;  5IY0 A;  2N8N A;  4B3R Q;  1YNX A;  2A1A A;  3IRB A;  4EQ5 A;  1UEB A;  2OWO A;  3GTO H;  2HQL A;  3ZJY C;  4DV2 L;  3UDX A;  4X6A H;  3CME A;  3RN5 A;  2OCE A;  3UDG A;  1PH2 A;  2WB1 G;  3A74 A;  2YTX A;  2LXK A;  2PI2 E;  4PMW A;  4DK3 C;  4DR2 L;  1GM5 A;  2JA8 G;  3AFP A;  3E0E A;  1Z47 A;  5M5Y H;  2JEA I;  1KXL A;  4GLA C;  3UE1 A;  3KF6 B;  3A5U A;  4OO1 G;  1W3S A;  3HOX H;  3KF6 A;  4O0A A;  3EN2 A;  3KDF B;  1K8G A;  1N32 L;  2ZTE A;  2Q2U A;  1V43 A;  1BKB A;  1N36 L;  3M4P A;  4JI2 Q;  2MO1 A;  1JT8 A;  3L7Z C;  4POF A;  5IP9 H;  4GN4 B;  1UE1 A;  2AWO A;  2GVB A;  4X64 Q;  4P71 A;  4YCV A;  1VS0 A;  4YY3 Q;  1SFO H;  4QGU A;  4A3M H;  3S15 H;  4GS3 A;  3M85 A;  4BY7 G;  2VW9 A;  2AWN A;  4DR5 L;  3OYY A;  1XMO Q;  1RL2 A;  4DR3 L;  2R92 H;  3G6E A;  2PQA A;  1PYS B;  3KOJ A;  1BBW A;  4KLK A;  2CKZ B;  5M3M G;  3JAM c;  1VQG A;  3J81 j;  4DUZ L;  3TS2 A;  5C4X G;  2WP8 J;  4BY1 H;  4P72 A;  1L0W A;  3PUY A;  1LYL A;  2Z6K A;  4IPD A;  4A3D H;  3MEF A;  1X65 A;  4QL5 A;  2ZM6 Q;  1G6P A;  3PO2 G;  3F2D A;  2BH2 A;  1SRU A;  4KI0 A;  3SGI A;  3K81 C;  4IPH A;  3TRE A;  1YEZ A;  2YYZ A;  3D31 A;  3ULJ A;  1N9W A;  2D62 A;  2KHI A;  1HR0 L;  3HOZ G;  4JI0 Q;  1VQ8 A;  3JC6 6;  1VCI A;  2UXB L;  3PF4 A;  4JI8 Q;  2JA8 H;  4DV4 Q;  4YY3 L;  4YWL A;  1SR3 A;  2I5M X;  3CC7 A;  4BY7 H;  3WWV A;  1Q81 C;  4JBM A;  1TWC H;  1N34 Q;  2UUA L;  4L5T A;  3CMA A;  1G51 A;  1X55 A;  4JCV E;  5FJ8 H;  3PIP A;  3M4O H;  1L1O B;  2R7Z G;  4A3G G;  3ERS X;  2E5L Q;  2HIX A;  1PH6 A;  1OXU A;  3PF5 A;  2UXB Q;  1E1T A;  3GTM H;  1CKN A;  4A3K H;  4JBJ A;  4DR3 Q;  4YWK A;  2A19 A;  2PI2 A;  4LWC A;  1KRT A;  1XMQ Q;  2KBN A;  1XNR Q;  4QJF A;  1CKM A;  1PA6 A;  5C4X H;  1KC8 C;  2XTI A;  3K80 C;  4AYB E;  5JJK A;  1HNW Q;  3HKS A;  1WI5 A;  2CCZ A;  4HIM A;  5LMN W;  1JJ2 A;  3S2H H;  1C0A A;  1KIX A;  3K0X A; 
#chains in the Genus database with same CATH topology
 5M3F B;  2B2W C;  2EJF C;  1M8A A;  1YIT A;  2F0S A;  4C1N I;  4DPG A;  3R2I A;  2VL6 A;  5GQO A;  1F2Y A;  5E3F A;  3C1E A;  1IZ6 A;  3VDY A;  3VR4 A;  2YV5 A;  4B3T Q;  1V1P A;  4HR7 B;  1WTP A;  4IZ8 A;  4H13 C;  1SXT A;  5C0X J;  2YTV A;  4YCU A;  4IUU A;  1HNZ L;  1SE2 A;  1A62 A;  3FEW X;  4A3E H;  2VS1 A;  4JPB W;  2A74 C;  1SMY D;  1JJC B;  2IHE A;  2F0O A;  5FOB B;  2RKS A;  3MA2 B;  1GUT A;  1STB A;  4UAI A;  2F4V L;  5CV7 A;  1I4R A;  1IBL Q;  1IW7 C;  2FMM A;  2QCP X;  1AE2 A;  1T5E A;  5H1S E;  1EWI A;  3FMC A;  2VY3 A;  1DYQ A;  1XXG A;  4KN7 C;  3VR3 A;  1UE6 A;  3T1Y Q;  2DJG C;  1DXM A;  2KEE A;  4NB3 A;  2CWA A;  2RF4 A;  5C6A A;  4C3H G;  4A3M G;  4DV1 L;  5JPN C;  5C3E H;  4K5X A;  3UE0 A;  4EX5 A;  2SNS A;  1CHP D;  3I72 A;  4GZY C;  2OXP A;  4RFB A;  4ZUJ A;  2C35 B;  3J81 L;  4X66 L;  4DN4 M;  5NUC A;  2F0M A;  3P20 A;  2F0H A;  3TQY A;  1DZ1 A;  2OT2 A;  4B3S Q;  2A5H A;  3A56 A;  4NP5 A;  5IOC A;  2MNA A;  5C4J H;  5C4H A;  1PZJ D;  2F0N A;  2QKI C;  4LF7 Q;  3CCM A;  4R4I A;  5I2Y A;  3VYU A;  4HED A;  3WDN A;  1UEA B;  1QUQ A;  4P75 A;  1L1O C;  4HSP A;  4P2C B;  5ELF A;  2UUB L;  4RGN A;  4OO1 H;  3K58 A;  2Q2H A;  1KDB A;  4A3J H;  4BBS H;  1HA6 A;  3ZYY X;  2B2Y A;  4X3T A;  1FD7 D;  4PZ6 A;  1P8L A;  3QB3 A;  4JYA L;  3G7L A;  1QE6 A;  2KED A;  1PXU A;  2XNA C;  2B63 H;  3RUZ A;  1HXY D;  1W6J A;  1UE5 A;  3ULP A;  1O7Y A;  3GDE A;  3BVG A;  2WIN B;  5IGE A;  2NTS A;  2R6G A;  5HGT A;  4LUO A;  4LAA A;  2MFI A;  5FLX c;  5K5P A;  4IUT A;  2VXW A;  1DCZ A;  1VQH A;  1LO5 D;  1J5E Q;  5C4J B;  1BO0 A;  1F77 A;  1EIY B;  4X62 L;  2L55 A;  1HPC A;  1VQ7 A;  2KCN A;  5C0X I;  3HOX G;  1NBW A;  3DM1 A;  5I2X A;  5IT9 c;  2ID0 A;  2A8V A;  1YHQ A;  3S9W A;  3NEN A;  3BVZ A;  1A0I A;  2Z6B A;  2KHJ A;  3EFX D;  1X3P A;  4OL7 A;  3J80 L;  4ZUI A;  1IL2 A;  3ICE A;  3OWE B;  2OTJ A;  2JK8 A;  3CCV A;  4GOP C;  4L8J A;  3BS1 A;  3U9O A;  3TS0 A;  1TS5 A;  3I4O A;  4DF7 A;  2RA4 A;  4LFC L;  5AJ3 Q;  3STB C;  4N9T A;  3TSS A;  2WII B;  1TT2 A;  1WVL A;  4QMG A;  3ER0 A;  5E7N A;  3OTO L;  1SSO A;  1BNZ A;  2EJM A;  4V0B A;  3MXN A;  4DV6 L;  1BXT A;  4XXE A;  1LTL A;  5C5M A;  2ES2 A;  2V4D A;  4RKB A;  4X65 Q;  1DON A;  3A7L A;  1HA5 A;  5EPL A;  2RHQ B;  1SE3 A;  4A3E B;  4A3D B;  1RTO A;  4GKK Q;  4YHH L;  1PH3 A;  4IPC A;  5IYB H;  1JB3 A;  4N8F A;  5M3M H;  4K0K L;  1NNX A;  1CT1 D;  1FVI A;  4FF2 A;  3S1M B;  4A3G B;  3E9H A;  4DR4 L;  4DAM A;  3SE0 A;  2K5W A;  2JEB I;  3EA6 A;  3PO2 H;  4XQN A;  2QGQ A;  4LUZ A;  2MGS A;  1MIU A;  2VZA A;  3CXC A;  4UP8 A;  1F2L A;  2PNH A;  2DJF C;  2ZXP A;  5M3F H;  3G4S A;  5BR8 Q;  3T1H L;  4H0L C;  2B2V C;  2R7D A;  1Y8O B;  4NDX A;  4PZ7 A;  2F0D A;  1UAP A;  2LSS A;  4AIM A;  1OXX K;  3OIP A;  3OMC A;  4RH6 A;  3RZO B;  1E1O A;  3GV3 A;  2QW7 A;  5JEA H;  1F9P A;  5IYD H;  4K2L A;  3PO3 H;  1PYB A;  2UU9 Q;  2Z8L A;  1MHW C;  2NTT A;  4G7H C;  2R92 G;  1V9P A;  2K5Q A;  1JIC A;  4ZKC B;  5D3D A;  4DV3 Q;  4BXX H;  4KHZ A;  2B2V A;  4K8I A;  2E2H H;  4JI0 L;  1Z9F A;  4GN3 B;  4V19 0;  1FR3 A;  3KDF A;  3CCS A;  3H3V I;  2KEN A;  4GLX A;  2NVX B;  4LK1 C;  3C2P A;  2WB1 B;  1J9O A;  1XTD A;  1VQC A;  4GNX C;  4X64 L;  1Q82 C;  4A3L G;  1QB5 D;  3I4N G;  3V96 A;  1K83 B;  1Y1W H;  4C3I B;  4DAY B;  2KOL A;  2XVS A;  1X32 A;  2XN9 C;  2EYO A;  1XNR L;  4HJ7 A;  1C8C A;  4N8X 1;  1DOK A;  3NBH B;  4GOP B;  3S15 B;  2F0F A;  1I4P A;  1LTS D;  3PCO B;  4DU9 A;  4HJ9 A;  3OTO Q;  4I7A A;  4ZAI A;  1Q7Y C;  1J6Q A;  4BY1 G;  1TKW B;  5D14 A;  5C5L A;  3ND9 A;  1PFB A;  2L0C A;  3HOW B;  5T1G A;  2K28 A;  3HOW H;  5ISR A;  3U58 A;  3H0G B;  3T56 B;  4G57 A;  3NWS A;  1R4Q B;  3K5O A;  2QA4 A;  2NN6 I;  2E74 C;  5DM7 3;  3H3V H;  1A3T A;  4RCO A;  2O4X A;  4DV7 L;  1SYE A;  1U4M A;  4FDB A;  4Y52 H;  2D5D A;  3KLR A;  1SAP A;  3HOZ B;  1NAP A;  2OTL A;  3S2D H;  2L15 A;  1K83 H;  1IHZ A;  1AE3 A;  1AZQ A;  2ASB A;  2NVQ B;  2ALY B;  2F0K A;  1YIJ A;  1PH9 A;  3EJI A;  2KHS A;  1LLR D;  1Y14 B;  1OXT A;  2F0L A;  3TN2 A;  1VQI A;  3HOU G;  2OQK A;  3J7Z C;  2Z4I A;  4FNF A;  1YNJ C;  4ID6 A;  4LF9 L;  5KGU A;  1SNM A;  5A2Q E;  1WD1 A;  1XNQ L;  5C44 B;  3T51 B;  1VQE A;  4UP7 A;  1K8A C;  4KD3 A;  4K5W A;  2M00 A;  3RZO H;  1E22 A;  4U68 A;  2C5C A;  2IX3 A;  3J7A 5;  4KTA A;  4KKS A;  4P73 A;  3HKZ E;  1O7I A;  3T13 A;  5M5W B;  4A3I H;  4DV5 Q;  2NZ1 D;  4ZKB B;  1HNX L;  3A5Z B;  3RR5 A;  3BDC A;  4DK6 C;  2E2H B;  5ELN A;  3TP7 A;  1E2V A;  3CW2 C;  4ZYS A;  2UU9 L;  2CW0 C;  2AHO B;  1H9S A;  3K5N A;  3M7G A;  1IW7 D;  3I3C A;  1H9K A;  3OIQ A;  1UEB A;  4QIW B;  4ZLT F;  3RN5 A;  1EY0 A;  2WB1 G;  4KY5 A;  1SJE D;  1BCP F;  1Y1V B;  1GM5 A;  2JA8 G;  3AFP A;  4LJZ C;  4FXD A;  2ENB A;  2JEA I;  4N9P A;  5M5Y B;  3A5U A;  4CJ0 B;  1PRT D;  3KF6 A;  4FF1 A;  1E0B A;  1N32 L;  1EYD A;  3K57 A;  1V43 A;  1SNP A;  5E4W C;  4IAL A;  4WRD A;  5CV6 A;  1EZ6 A;  2AWO A;  4C56 C;  2Q8R E;  4P71 A;  2PW7 A;  2VW9 A;  2EZV A;  3PO2 B;  1I4G A;  3NQT A;  4U67 3;  4DR3 L;  3C3L A;  3G6E A;  3N6R A;  3KOJ A;  3OWF A;  5M3M B;  4R9W A;  4G7Z C;  1PRT B;  4P72 A;  1Y8P B;  1PLF A;  1X65 A;  2HD3 A;  2BH2 A;  3MXG A;  4IPH A;  2WAC A;  2YYZ A;  1RTN A;  2D62 A;  2F0E A;  1S5C D;  1VQ8 A;  5I6Y A;  4IN3 A;  1GUW A;  4DV4 Q;  4YY3 L;  2G9H D;  1SR3 A;  5ELB A;  2LFN A;  4YWL A;  4CJ1 B;  4KY6 A;  2FFK B;  4IUR A;  5CV9 A;  3IAY A;  1TWC H;  2PO4 A;  5FJ8 H;  2F3V A;  3R93 A;  2R7Z G;  3ERS X;  1WTW A;  2E5L Q;  2HIX A;  4F88 A;  2E2I B;  5CBA E;  3GTM H;  1CKN A;  2A69 C;  3K5M A;  1H9M A;  3DWP A;  1XMQ Q;  1RF2 D;  2H1E A;  1XNR Q;  1PA6 A;  1CKM A;  1KC8 C;  4F8M A;  2KVM A;  1D1K A;  3E0J A;  2NVY B;  3HKS A;  1CI3 M;  2CCZ A;  5LMN W;  2A68 D;  1SE4 A;  3Q22 A;  3K0X A;  3CPW A;  2ZTC A;  4R4Q A;  4YCW A;  5CGK A;  1X54 A;  2K6A A;  1PMR A;  3CCQ A;  1QCB D;  5G3L F;  2EDG A;  3A8I E;  4DR1 Q;  3N52 A;  5GAE C;  3J80 i;  2A73 B;  3HOZ H;  5I9P A;  2UUA Q;  1YVC A;  1K3B C;  1I4X A;  3T4A C;  3TBI B;  1PTO C;  4F87 A;  3V2T A;  3GTL H;  1LTI D;  1V1P B;  2XRS D;  5J1Z A;  2FIN B;  1PH8 A;  3NE5 B;  1VQF A;  2I5H A;  5EGT A;  5FKA C;  4XYO A;  3GTL B;  1HQR D;  3OMG A;  5LL6 S;  3H0G H;  2UXC Q;  2I0Q A;  3Q0A A;  1QJO A;  2WAQ B;  4XT3 B;  4QIW E;  1M90 C;  2R3Z A;  3RLF A;  1TWF H;  4B3M L;  3KBG A;  2K7V A;  2QEX A;  4MTN A;  4BBR G;  3NK9 A;  4B3M Q;  1BVS A;  1TWG B;  3NBI A;  2F4I A;  3BYT B;  5FLX E;  1PFN A;  4OHJ A;  4DAP A;  2HUG A;  4A3B H;  4HAE A;  1PH1 A;  2FMC A;  4IO9 A;  2HT1 A;  3H0G G;  1SND A;  2XSC A;  4LFA L;  2CW0 D;  1F9R A;  2R61 A;  3K7A B;  1SRO A;  3VYR A;  2NVX H;  4YWM A;  1WTX A;  5ELC A;  4WJ4 A;  4RG1 A;  2VUM H;  3A54 A;  5BR8 L;  2F0U A;  4A3E G;  2K52 A;  2CH4 W;  2P5Z X;  4B9W A;  3AEV A;  1PZK D;  4BA2 I;  4DR5 Q;  5GAD C;  2CVR A;  2GA4 B;  1SYF A;  2HDL A;  3GTK B;  4JI6 L;  5AFW A;  1MJC A;  4JC0 A;  3PUZ A;  4LW1 A;  1WYD A;  3HOY B;  1BOS A;  2A68 C;  3F2C A;  1B8A A;  4KJO A;  1TWH H;  2XRQ D;  4NW2 A;  1CHQ D;  2N3S A;  3HOV G;  2HDM A;  2GN5 A;  3Q6S A;  3F2U A;  3D6C A;  4ZCK A;  4JW0 A;  2I46 A;  3IFT A;  4IUP A;  4XT1 B;  5DNF A;  2AMC B;  1VQP A;  4FP5 D;  1BF4 A;  4DR6 Q;  5M5W H;  3BG3 A;  3D0F A;  1SLJ A;  2D0O A;  2X6L A;  4C3H B;  2A69 D;  1YJ9 A;  1E7Z A;  1STG A;  4A3L H;  5JJI A;  5IP7 G;  1V1O A;  3S1M H;  2SOB A;  1FNU A;  1S3O A;  4GOP A;  2EQS A;  1TXY A;  2K5D A;  1KAB A;  2F03 A;  2UUC Q;  3DMU A;  3FVQ A;  3PUW A;  4DR6 L;  3DM3 A;  2K75 A;  3ONA B;  1GHK A;  4A3J G;  4IJH A;  2B63 G;  3HOY G;  3HOW G;  2J7Z A;  2IX0 A;  4NMZ A;  5JVH 3;  5IGF A;  3NHH A;  3KFU A;  3RMH A;  4HCE A;  2RCN A;  3MEH A;  2LS0 1;  3I56 A;  3EBE A;  1ILP A;  1HNW L;  4DV3 L;  1V8Q A;  2WB1 E;  3JAM i;  1PVO A;  1TWA H;  3MXN B;  1SN8 A;  2C9O A;  4RGO S;  3K0Y A;  5IT9 E;  1YJN A;  1F2M A;  3QWN A;  1VQ4 A;  1PDQ A;  1Y8N B;  1OO9 B;  1WTO A;  3J80 c;  4OWW B;  4IQZ A;  1F2Z A;  4WJ3 M;  4APV A;  2M2L A;  4NXM Q;  4M8A A;  3Q8D A;  3BJU A;  5DAU A;  1L0Y B;  4DNT B;  1U5K A;  3S14 H;  2R92 B;  4PMB A;  3DHQ A;  4R8I A;  4RAU C;  4Q5V A;  2L9H A;  1QWY A;  1PTO B;  2EJG C;  5IGD A;  4FF4 A;  4C3I H;  1Q1B A;  1FNW A;  4DUY L;  2KCC A;  3TP5 A;  2O5J C;  4DV2 Q;  3STB D;  1P16 A;  3HOX B;  1II3 A;  1HR0 W;  1JMC A;  5EJW A;  4A3J B;  3VYS A;  4A4I A;  2DN8 A;  1TVX A;  1JB7 A;  2EIF A;  2PZU A;  1VQ5 A;  4A3I G;  5C4X B;  2CWP A;  1NMF A;  4K2K A;  4OEL B;  2OF1 A;  2L1B A;  4C2M H;  2KCM A;  3KJO A;  2JA6 B;  1KDC A;  1SMY C;  1KTK A;  2KEC A;  2R93 B;  1B7Y B;  4JOI A;  4AH6 A;  1S5D D;  3A55 A;  4IJL A;  3JAM E;  1WCM G;  4POG A;  5FO9 B;  4NXN L;  5L37 A;  1CTM A;  1QZG A;  1AEX A;  4A3D G;  3CD6 A;  4BBR H;  2DUD A;  3J7A F;  2Y0S B;  4A3F H;  4LFB Q;  2L4N A;  4OEM B;  2MUY A;  3FRP B;  4G4K A;  1U0L A;  2TSS A;  5M3F G;  2LXJ A;  1SYG A;  3K6O A;  2K1B A;  2NUC A;  3I4M B;  3A0J A;  1VQB A;  1FYC A;  3SK4 A;  1X3G A;  2AKW B;  4AYB G;  1W2B A;  1CQV A;  1SFO B;  3EQL C;  2ZTD A;  3PO3 G;  1EEF D;  3CPF A;  4A3K G;  3L9A X;  5KNB A;  2PZW A;  1GO3 E;  3NXW A;  2VUM G;  4GKJ L;  3RZD B;  5IP9 G;  4DNI A;  2AQ3 B;  3QOL A;  4EGV A;  2Z0S A;  4FO2 A;  1N32 Q;  3H91 A;  2QDB A;  4OIJ A;  2B2Y C;  2F1M A;  2E75 C;  2EY5 A;  5J22 A;  4R4O A;  1U9R A;  5M5X H;  1H9J A;  1B4O A;  3S2H B;  1I50 H;  1SJH D;  4JG2 A;  1CKN B;  2BA1 A;  3HOV H;  2BCO A;  1RDP D;  1QVG A;  1PH4 A;  3FKI G;  1XPU A;  2K4K A;  4IOA A;  1CKO A;  2QDL A;  3SR1 A;  2LY7 A;  1AH9 A;  4A3F B;  1SBB B;  2PW5 A;  3G71 A;  4DK1 A;  4L6T B;  3DXJ C;  4BBR B;  1HNX Q;  1IYJ B;  2JA5 G;  3W1B A;  4QUF A;  3I91 A;  1YJW A;  3AMU A;  2IX1 A;  2B39 A;  4NXM L;  5CV5 A;  1HFG A;  4L5Q A;  1NE3 A;  3PIO A;  4TRD A;  1ZEQ X;  4HN7 A;  1EQQ A;  4LUV A;  5HY6 A;  1I94 Q;  4TSS A;  3TRZ A;  2A6H D;  3EVQ A;  3GV6 A;  4LF6 L;  5GAG C;  2ZJR A;  1JE4 A;  4XDX A;  1SEB D;  3FKI H;  1EY9 A;  2IPK D;  4YIJ A;  4ME3 A;  2ATW A;  3AB9 A;  3K8A A;  4X66 Q;  3I70 A;  5CBE E;  5D3I B;  1QIL A;  2MP1 A;  1B44 D;  2BDO A;  2PQE A;  2VQF L;  3RNU A;  1CZW A;  3QG1 A;  4LF5 L;  3RLO A;  5D65 A;  3TZD A;  1I3Q H;  3T53 B;  4DXG A;  1PH7 A;  2LMC B;  4IFD J;  3T1Y L;  1EU4 A;  4DV4 L;  4A3C H;  3I55 A;  2I5L X;  4JI3 L;  3OW7 A;  4HIK A;  3GP7 A;  1IKL A;  3T1H Q;  2DY7 A;  3VR5 A;  4DV0 Q;  3HOU H;  4ABN A;  3H6M A;  3IL8 A;  4QB4 A;  4RHS A;  1UE7 A;  5FLM G;  4B3R Q;  1EWH A;  1PTO D;  1YNX A;  2EXZ A;  3IRB A;  4EQ5 A;  4A3M B;  1PRT F;  3ZJY C;  5FLX L;  3GTO H;  3UDX A;  1JOQ A;  3QJY A;  1JR0 D;  1T5X D;  3A74 A;  1NSN S;  2TMP A;  4KKT A;  5TSS A;  1Z47 A;  2EY2 A;  4GLA C;  1TS4 A;  3HS0 C;  2ZTE A;  4E6I A;  1BKB A;  1N36 L;  4JI2 Q;  5EQ0 A;  3L7Z C;  3BDO A;  3I73 A;  2GVB A;  4YCV A;  1VS0 A;  4H44 C;  4QGU A;  4A3M H;  1ML0 D;  1TQO A;  2AWN A;  4DR5 L;  3OYY A;  1WTR A;  1YNJ D;  2R92 H;  2PQA A;  3FKI B;  1PYS B;  1BBW A;  3DEP A;  2CKZ B;  4KLK A;  5M3M G;  3J81 j;  5C4X G;  4PMC A;  2WP8 J;  1E2Z A;  1BUV T;  5JVG 3;  3MEF A;  1G6P A;  3PO2 G;  4L63 B;  1SRU A;  5EPJ A;  3TRE A;  1GUG A;  1BCP D;  3HEJ A;  4EQO A;  1DD2 A;  4C3J B;  3ULJ A;  3L3O C;  4JI0 Q;  1VMP A;  1QNK A;  4IUN A;  1VCI A;  3PF4 A;  5DM6 3;  2JA8 H;  2A6E C;  2I5M X;  1Q81 C;  4K14 A;  4JBM A;  3ND8 A;  1N34 Q;  1SYD A;  3CMA A;  1G51 A;  3MTS A;  1JWU D;  1QNU A;  4FXK C;  2WV6 D;  4JBJ A;  4DR3 Q;  4YWK A;  2A19 A;  3MZ5 A;  1KRT A;  2KBN A;  1G8Z D;  1LTB D;  2XTI A;  5JJK A;  5M9O A;  2IL8 A;  1JJ2 A;  2E2D C;  5COY A;  3S2H H;  2YU9 H;  2Z4H A;  1C7Y A;  1XYI A;  3J7Y W;  1K9M C;  3KYH C;  1Q90 A;  1QVF A;  2Y0S G;  4C3J G;  1TS3 A;  4JI3 Q;  4HMJ A;  1I5F A;  4QY7 A;  2K04 A;  1Y1W G;  2Q8T A;  2WAQ E;  1I94 L;  2EY1 A;  1VQM A;  4BA1 I;  4R8N A;  2HIV A;  4UP9 A;  5C3X A;  5FJ8 G;  2Z6K C;  4DFA A;  3TP6 A;  4DV1 Q;  1CZG A;  2QF7 A;  4J8Q A;  1K8O A;  2N78 A;  1NUC A;  3A8K E;  4LF8 L;  4HJ5 A;  4HTH A;  4DV5 L;  3RZD H;  5JPM C;  1B70 B;  3E5S A;  2VQE Q;  3U50 C;  1EOT A;  2YU9 B;  4LNQ A;  4CKB A;  4B3S L;  3CU7 A;  1I6H H;  4AQY L;  2KJX A;  3LNN A;  1CSQ A;  1FL0 A;  4M1U B;  2JA7 H;  1K3R A;  1Q1E A;  4JK1 C;  4BY1 B;  4RMF A;  1IBK L;  1WJJ A;  1HZA A;  2EVB A;  1PYW D;  1STE A;  1HUM A;  4K0K Q;  3J81 E;  2RCF A;  5LMU L;  1JQY D;  4KHP Q;  1G6Z A;  2RBM A;  4DR2 Q;  5C44 H;  2EE1 A;  2UUC L;  3FDT A;  2EYF A;  1U4L A;  1FGB D;  3TP8 A;  3I2Z A;  2DY8 A;  5IT9 L;  4P74 A;  2B2U A;  4Q0F A;  4PV1 C;  2KCT A;  2HQE A;  4JV5 Q;  4UHV A;  5J3B A;  3PIO 3;  3SDZ A;  1EY4 A;  1KQS A;  3NWT A;  1VQN A;  4ZQ3 A;  5DEH A;  3QR8 A;  2K5V A;  4C2M B;  4LFB L;  4A76 A;  2E8G A;  1VQL A;  4NXN Q;  3UI2 A;  1TWG H;  3S1N H;  4H7B A;  2L11 A;  1HZC A;  2D2C C;  1EQT A;  1TWF B;  1DGS A;  4A3B G;  1PZI D;  4KV6 A;  4CDE C;  2K33 A;  3C46 A;  5GAH C;  3I4N B;  4K6D A;  1ZYR D;  1D7Q A;  5EBD A;  1ZXT A;  4CHT B;  4CGY B;  1WTV A;  3HKZ B;  3RD4 A;  1VF5 C;  4A3F G;  3E3X A;  3DEO A;  1CK1 A;  4UPA A;  5KNC A;  2D0P A;  5BN3 A;  3S14 B;  3GTM B;  4WOR A;  3AYH B;  5LMU Q;  3HFZ B;  2N55 A;  4JBW A;  1CA5 A;  5KRU A;  1S72 A;  1ICF B;  4JI7 L;  3UDI A;  1LM0 A;  3D4D A;  1ZKO A;  4KJN A;  1YNN C;  1B9M A;  3M7N A;  2NN6 G;  3WOF A;  1ENA A;  4DUZ Q;  4HID A;  3ERQ A;  1K0R A;  1VQJ A;  4X62 Q;  3GTJ H;  1IBM L;  1VMC A;  3MXP A;  5IOD A;  3CC4 A;  1QVC A;  4PG3 A;  1ICW A;  2NZH A;  1S5F D;  1HJP A;  5JAV A;  2RQX A;  3A7A B;  3TZU A;  1XPR A;  5A2Q L;  4FYD A;  3U4Z A;  1XNQ Q;  4RCN A;  1EL0 A;  4GN5 A;  1B53 A;  1EFW A;  1RJT A;  3CCU A;  2A6E D;  5FO8 B;  1XWE A;  4NKL A;  3NP8 A;  4LF7 L;  4A3K B;  3HKZ G;  2PMZ B;  2Y0S E;  3HOV B;  3PO3 B;  1EIH A;  1DOL A;  3AQQ A;  1LT4 D;  3M4O B;  2KQ3 A;  2NN6 H;  4CBV A;  3I4M G;  3MC0 B;  1JOK A;  3H09 A;  3F8T A;  4ZK9 B;  3W1G A;  2J4X A;  4OON A;  4IUV A;  1A2U A;  3S16 B;  4C3H H;  1G2S A;  1ET9 A;  2FJ2 A;  3X3N A;  2CHB D;  1GVP A;  3OPO A;  4ILW A;  3GTP B;  4R4C A;  4DGZ A;  3BZD B;  4DV6 Q;  4Y7N H;  5LMN L;  3CQZ B;  3CC2 A;  3SK6 A;  2EYP A;  1DM0 B;  4DNR B;  1TWH B;  2K03 A;  3KLS A;  1C9O A;  2O2L D;  3HOY H;  4XTC S;  3CCR A;  1EYC A;  3K59 A;  2F0Q A;  1SNC A;  2HHH Q;  3CQZ H;  3LX0 A;  2OEO A;  5EAY A;  1MBY A;  1KHI A;  1EOV A;  1STH A;  4A3I B;  3I90 A;  2B2U C;  1GD7 A;  4JI1 Q;  1FJG L;  1B3A A;  5JJL A;  4BBS G;  3S16 H;  1VQ9 A;  3E9I A;  2BE5 C;  3E6Z X;  2RSO A;  1E3P A;  2JXM B;  1ESF A;  4RWS C;  3K7A H;  1WOC A;  3MWY W;  2NVT B;  2EY6 A;  1FJG Q;  5JOB A;  3M3Y H;  1J5E L;  1RD9 D;  1FGU A;  1X3F A;  3NSW A;  4ULL A;  3KLW A;  3DUZ A;  1M1K C;  3CHB D;  3F2B A;  4DR7 L;  4JI4 Q;  1VF7 A;  2XGT A;  1LTT D;  3SEB A;  1CA6 A;  4JOI C;  1HQM C;  3SXH A;  2IT1 A;  2E2J H;  1JWM D;  4JI4 L;  1DJR D;  4L5S A;  2F0J A;  2OQ0 A;  1U4P A;  4EQP A;  2IJ0 A;  2RHS B;  3S17 H;  1Y1V G;  3OHX C;  3F1Z A;  2I07 B;  2JA7 G;  2N49 A;  4IPG A;  3CF5 A;  3KK7 A;  1GHJ A;  2A6H C;  1Q8K A;  1ESR A;  1EY8 A;  4LF4 L;  4R4T A;  4A3B B;  2V1C C;  4L5R C;  4A93 G;  1PTO H;  2R93 H;  1EZ8 A;  4NPS A;  1VQA A;  4QQB X;  4FF3 A;  3NEM A;  3OSO A;  2PQA B;  2JQO A;  2ZXO A;  5CV4 A;  5FO7 B;  4HJA A;  1ROD A;  5COR A;  2IHF A;  4J6H A;  5DLQ E;  1N8R C;  2MO0 A;  1IL8 A;  1KNE A;  2MPM A;  2WFW A;  1LT3 D;  3EIV A;  4GNX A;  1O78 A;  1F9Q A;  1LTA D;  2DNE A;  2EOT A;  2MQH A;  1YNN D;  1T9H A;  1TY2 A;  1TWA B;  5JEA J;  3QIA A;  4ALP A;  4ME5 A;  5E4X A;  2NVQ H;  2DNC A;  1HRJ A;  1M4V A;  5HGQ A;  3NEL A;  4PZ8 A;  4IFD I;  1K0S A;  1LT6 D;  2ZXR A;  5C3W A;  5IYC H;  2JP1 A;  2JN4 A;  1STN A;  2MHV A;  2B29 A;  5K36 H;  3OOC A;  2E2I H;  4QF4 A;  2PMZ E;  3M4Y A;  2WKC A;  2DGY A;  2EYH A;  4H02 A;  4LFA Q;  1NTG A;  4DR1 L;  3RLN A;  1EYG A;  1S5B D;  4JI7 Q;  2ZJQ A;  1HR0 Q;  2F4V Q;  1NJI C;  1IXR A;  2R7Z H;  1A63 A;  1UNS A;  1MJE A;  1ASY A;  3IKJ A;  5IE8 A;  5C0X H;  2HCI A;  1ENF A;  1S4Z A;  5ELE A;  4DAV A;  5LL6 X;  3B6Y A;  3L2P A;  3CCE A;  4OIK A;  1EY6 A;  1XX8 A;  2F0G A;  1SYC A;  3O13 A;  3S1R H;  5K36 G;  1ET6 A;  3HGB A;  3CKI B;  2EXD A;  1N33 Q;  3JAM L;  1Y1W B;  5ELO A;  4A75 A;  5JEA G;  1N33 L;  1KRS A;  1NR2 A;  1R9T B;  1Q46 A;  1NR4 A;  2K5N A;  5ELD A;  3I4L A;  1WTH A;  2BH8 A;  5EPK A;  5JJZ A;  3GTQ B;  4OO1 I;  3PGZ A;  1BR9 A;  4KHP L;  4G7O C;  1Y69 U;  2Q2I A;  3H3V C;  1HTP A;  1SNO A;  2PZT A;  1EUJ A;  1AN8 A;  5KYL A;  5BN5 A;  2ZJP A;  4A93 B;  5IY0 A;  2ICI A;  2A1A A;  2G9D A;  2OWO A;  2HQL A;  5EKL A;  4DV2 L;  1BCP B;  3UDG A;  4PMW A;  2LXK A;  1A3U A;  1CQF A;  3P75 A;  4CDD C;  4DR2 L;  4X3S A;  3E0E A;  2NB0 A;  1FNV A;  5M5Y H;  3UE1 A;  4OO1 G;  4O0A A;  1K8G A;  5KND A;  2MO1 A;  1JWS D;  4POF A;  4GN4 B;  1UE1 A;  2RDG A;  5IGB A;  3C1F A;  4X64 Q;  4DXF A;  4YY3 Q;  1SFO H;  3M85 A;  4K5V A;  4X3K A;  3QO2 A;  1RKN A;  2B8F A;  1MD2 D;  3TS2 A;  1VQG A;  4CJ2 C;  1KAA A;  1D2B A;  1L0W A;  4DK0 A;  3PUY A;  2Z6K A;  4RA8 A;  4A3D H;  4QL5 A;  1HCZ A;  4KI0 A;  1YEZ A;  4RGM A;  2BE5 D;  3D31 A;  3R8B A;  5IGC A;  3GTJ B;  2VUM B;  2KHI A;  1HR0 L;  4ODG A;  2SEB D;  2WKD A;  2BDN A;  1ENC A;  2UXB L;  4JI8 Q;  4AYB B;  3WWV A;  1Z7T A;  1G2T A;  2X6G A;  4PNY A;  2HCC A;  1X55 A;  4JCV E;  3M4O H;  4EVO A;  4A3G G;  1QG7 A;  3S2D B;  1D6E C;  3PF5 A;  2UXB Q;  1E1T A;  4A3K H;  2PNR C;  1LAB A;  1UUP A;  5C4X H;  1HHV A;  1D5Z C;  1I4Q A;  1RHP A;  1HNW Q;  5EBC A;  2R7Z B;  2M9V A;  3VYT A;  2ICE C;  3FPP A;  1KIX A;  1D8L A;  2NWG A;  4LMQ D;  1HNZ Q;  3MFY A;  1ILQ A;  1IBM Q;  2VB2 X;  1QOH A;  4YHH Q;  5IP7 H;  3DLL A;  2R93 G;  4OWX B;  4LF4 Q;  1N34 L;  4B3T L;  3HZX A;  2IW3 A;  4OX9 Q;  2JA5 B;  4F7X A;  4WJW A;  2H4O A;  5C3E G;  5IIF A;  3DWQ A;  2SDF A;  1Z6H A;  1EQV A;  3LWU A;  2IY5 B;  3SVM A;  4MZ9 A;  1CFM A;  3HOU B;  4J15 A;  1LUZ A;  4IOC A;  1JJG A;  5IGG A;  4ZRZ A;  2CFM A;  2JA5 H;  1WD0 A;  1G29 1;  3W2D A;  1RIP A;  1JC7 A;  1MSH A;  1ZYR C;  1JCK B;  4KD4 A;  4QCL A;  1GKH A;  2EYL A;  4MN3 A;  4I7Z C;  3S17 B;  1J8I A;  2JA6 G;  2NVY H;  1SYB A;  4FXG C;  2VNU D;  3SK5 A;  4JI1 L;  4BWG B;  4DR7 Q;  2GVA A;  2YTY A;  2K50 A;  1L0X B;  4K6L A;  3KUP A;  5G3L D;  4CKC A;  3MXU A;  4K8J A;  3D4W A;  4O1N A;  4EQN A;  3RN2 A;  3H15 A;  1OXV A;  3NPP A;  4XQQ A;  4CDC C;  2NZO A;  1X9N A;  3D4R A;  3I8Z A;  2B2W A;  2EPB A;  2NBF A;  3CCL A;  2VQE L;  4BXX G;  5CR3 A;  2CQA A;  2E76 C;  5BN4 A;  1VQD A;  1NY4 A;  2L12 A;  2K5H A;  2G5D A;  3VA7 A;  4JI6 Q;  4BS9 A;  5LMN Q;  1E24 A;  4UY8 C;  3D3R A;  1XMO L;  1B9N A;  5CYU A;  3BZK A;  4PQX A;  5FLM H;  2FHT A;  4JI2 L;  3MVV A;  3PSI A;  3M3Y B;  1C4Q A;  1HH2 P;  5CC4 A;  4JBK A;  4OGQ C;  1JOR A;  2JA7 B;  3NTK A;  2K14 A;  5I6W A;  3J81 c;  2UXC L;  5C44 G;  1WFQ A;  1XJV A;  5GRO A;  1EIF A;  1GUO A;  2N88 A;  2KA7 A;  3KF8 B;  4OXP A;  3U4V A;  4R1J A;  2R7F A;  4RKL A;  2UXD L;  4MHE A;  4CDF C;  1R9T H;  1K73 C;  3TEH B;  4KMU C;  4OX9 L;  2B8G A;  1HTL D;  2Q2T A;  4QUC A;  3BU2 A;  3S1Q B;  1L1O A;  1X3E A;  2B2T A;  2B2T C;  4A3C G;  1PV4 A;  3S1R B;  1LTR D;  3BYY B;  1EU3 A;  1ONL A;  4MIU A;  4Y7N B;  1S40 A;  2AUJ D;  4MNO A;  1YZ6 A;  4XIG S;  3P1H A;  3GTP H;  2QIL A;  3PUV A;  1EWC A;  2AQ2 B;  2RDH A;  1KDA A;  1KD1 C;  2L5T A;  1XMQ L;  5IYB G;  2F0I A;  1PFM A;  3G48 A;  2Z1C A;  3KJP A;  4DKA C;  2E5L L;  4IUQ A;  1AZP A;  1B2T A;  4JI8 L;  4KKU A;  3PIP 3;  4GKK L;  4DA2 A;  2RSN A;  1BBX C;  2F3W A;  1CUK A;  4DV7 Q;  3GQB A;  2PCF B;  5IWA Q;  1GUS A;  3W3A A;  3M9B A;  3NTI A;  1O7L A;  4JVZ A;  1TS2 A;  4XQJ A;  1EIG A;  3LWE A;  1ASZ A;  4GKJ Q;  3CRL C;  5A35 A;  2IWH A;  2H5X A;  4X65 L;  3J7A V;  1IKM A;  3GTG H;  5IWA L;  1EEI D;  3I7F A;  4C3J H;  1I6V C;  2Z9H A;  3CP0 A;  2B63 B;  1LV9 A;  1WTQ A;  1A3V A;  2B3G A;  5IYD G;  1KL9 A;  1SE8 A;  2F3I A;  1PRT C;  4HCS A;  1B1Z A;  4FVM A;  3J80 E;  1VQK A;  4JV5 L;  3PMF A;  1BQQ T;  3IFD A;  2RVL A;  4JI5 Q;  3ITP A;  3FPU B;  3GTO B;  4KHV A;  1EY7 A;  1R4P B;  3NTH A;  3S1N B;  3UDF A;  3K5L A;  4Z9C B;  1PH5 A;  5I9O A;  3CAM A;  4JI5 L;  3VA5 A;  1PTO F;  1NMG A;  3TDQ A;  3X3M A;  1S5E D;  4GLV B;  3PQI A;  3NQI A;  3I4N H;  2KUM A;  5I4D A;  2F0P A;  1N36 Q;  2XWB B;  3ERO A;  1X56 A;  2BA0 A;  1F9S A;  4BBS B;  1IBK Q;  1C48 A;  1V1Q A;  3DWA A;  4LF8 Q;  4O2D A;  1UWV A;  2JSO A;  1HZB A;  3FP9 A;  2E2J B;  3SK8 A;  2VB3 X;  3OW2 A;  1JE5 A;  5C3E B;  3NUC A;  3BZC A;  2CH4 A;  2F0T A;  1Q8I A;  4B3R L;  5CV8 A;  1MGS A;  1TII D;  4LF6 Q;  3KLS X;  2PPB C;  2ZM6 L;  1QUQ B;  1H95 A;  1KAW A;  2NVT H;  4MTK A;  1Q12 A;  1A2T A;  2JA9 A;  2WAQ G;  2UUB Q;  3P7J A;  5T1I A;  1B50 A;  1VDZ A;  3PUX A;  1BDO A;  2F52 A;  1GOZ A;  4JYA Q;  1OTC A;  4RHR A;  4WFN 3;  2UXD Q;  1YHA A;  1OXS C;  1B3Q A;  1SNQ A;  3FHW A;  3URY A;  3CRK C;  1EYA A;  3LGJ A;  3VR2 A;  5KEE A;  2XIW A;  4HIO A;  1LT5 D;  3ULL A;  3VR6 A;  4XYQ A;  2AQ1 B;  3MHB A;  1XPO A;  2X69 A;  4B08 A;  1A6X A;  1I4H A;  1PFS A;  4B9X A;  1NCV A;  4TVA B;  1HZ9 A;  2NYZ D;  3KBX A;  1STA A;  1YI2 A;  1BBU A;  1EY5 A;  2O5I C;  1D5X C;  1I6H B;  3GO5 A;  2FXQ A;  2K32 A;  5M5X B;  3S1Q H;  3V05 A;  2JJQ A;  1IYV A;  1HFN A;  5EKK A;  4GNX B;  1D5M C;  5E1F A;  1D1I A;  1LTG D;  4J1M A;  3AFQ A;  2F0W A;  2PYK A;  3WOE A;  1Y1V H;  1LAC A;  2D9U A;  3HP3 A;  1W6K A;  4LF9 Q;  3HRZ C;  1MKH A;  1BCP C;  2EYM A;  4HJ8 A;  1G91 A;  1EFI D;  4A93 H;  1KNA A;  5AJ3 L;  4LFC Q;  3GD7 A;  4HMI A;  2MJ8 A;  4IFD H;  1SDF A;  4DR4 Q;  4A3G H;  1AFP A;  3S24 A;  1L2F A;  1TU2 B;  3GTQ H;  1CM9 A;  3GTK H;  3MAQ A;  2JE6 I;  1GJX A;  4CKE A;  5KIX A;  3J81 i;  3R3O A;  2EYJ A;  1IYU A;  4RGT A;  4BY7 B;  2JA8 B;  1RCV D;  4S3S A;  3L0O A;  5C4Z A;  1Q3L A;  4UDU C;  5HUR A;  3M4Q A;  2F0V A;  2ZT9 C;  1QZH A;  1X6O A;  1IBL L;  1YHB A;  3A8J E;  4IFD G;  4OWT B;  3I4M H;  3BVM A;  2AUK A;  4TQU S;  1A15 A;  2HHH L;  1A8V A;  5IYC G;  1PHJ A;  4C1N K;  3W5O A;  1HUN A;  1CSP A;  4DAY A;  1VQO A;  2SNM A;  3H94 A;  2XWJ B;  3Q24 A;  5FK9 C;  1U4R A;  5CMD A;  1EQR A;  3Q23 A;  1KLG D;  4LF5 Q;  3PV0 A;  3AU7 A;  3D8G A;  3CCJ A;  1STY A;  4DV0 L;  3SHL A;  4DUY Q;  3MFG A;  2VQF Q;  5EKI A;  1WCM H;  1GUN A;  1O80 A;  1KXL A;  3K7U C;  1YBY A;  5C0X G;  1VQ6 A;  2QEJ C;  2CQO A;  1TY0 A;  3D6W A;  1SMX A;  1Q86 C;  4AQY Q;  4HSV A;  2JA6 H;  1H9S B;  2N8N A;  3T16 A;  4X6A H;  3CME A;  2OCE A;  1AW7 A;  1PH2 A;  2YTX A;  2PI2 E;  2K05 A;  4DK3 C;  1DOM A;  3KF6 B;  1WCM B;  2LKV A;  1W3S A;  3HOX H;  3EN2 A;  1O7Z A;  3KDF B;  1K8M A;  4I65 A;  2Q2U A;  1GXD C;  3GTG B;  3M4P A;  5KYI A;  4KN4 C;  1JT8 A;  5IP9 H;  1MI2 A;  4BY7 G;  5F2D A;  1E2W A;  4GS3 A;  3S15 H;  1TR5 A;  1XMO Q;  1RL2 A;  1XTC D;  4KK7 A;  1K28 A;  2JYO A;  3JAM c;  3NBH A;  3R2T A;  4DUZ L;  1AP0 A;  4BY1 H;  1KLU D;  1I3Q B;  1LYL A;  4IPD A;  5LHY 1;  4O42 A;  2ZM6 Q;  1TWC B;  3TME A;  3U9S A;  3F2D A;  5J39 A;  3SGI A;  3K81 C;  3KF8 A;  3QOJ A;  1N9W A;  3HOZ G;  4X3U A;  2J0T D;  1JOO A;  3JC6 6;  3CC7 A;  4BY7 H;  1X3Q A;  2UUA L;  4L5T A;  3PIP A;  1L1O B;  4TKO B;  1PH6 A;  1OXU A;  2Q8I B;  3BDL A;  4C3I G;  2PI2 A;  1H9R A;  1MSG A;  4LWC A;  4KY7 A;  4QJF A;  3HG9 A;  2K01 A;  3K80 C;  4AYB E;  2RDF A;  2BOS A;  1WI5 A;  3G6J B;  4HIM A;  1I50 B;  1C0A A; 
#chains in the Genus database with same CATH homology
 1D8L A;  1C7Y A;  3CPW A;  2ZTC A;  4R4Q A;  4YCW A;  1HNZ Q;  1YIT A;  1X54 A;  3CCQ A;  1IBM Q;  1K9M C;  3KYH C;  4YHH Q;  5IP7 H;  4DR1 Q;  3DLL A;  4DPG A;  5GAE C;  3J80 i;  2R93 G;  2VL6 A;  2Y0S G;  5GQO A;  1QVF A;  4OWX B;  4LF4 Q;  1N34 L;  2UUA Q;  3HOZ H;  4JI3 Q;  4B3T L;  4OX9 Q;  1IZ6 A;  1YVC A;  3VDY A;  1I5F A;  5C3E G;  3GTL H;  2YV5 A;  4QY7 A;  4B3T Q;  1Y1W G;  2WAQ E;  1I94 L;  5C0X J;  2YTV A;  1PH8 A;  1VQM A;  4YCU A;  1VQF A;  2IY5 B;  2I5H A;  4BA1 I;  2HIV A;  4MZ9 A;  1HNZ L;  1JJG A;  1A62 A;  1LUZ A;  4J15 A;  2Z6K C;  4UP9 A;  5FJ8 G;  4IOC A;  4A3E H;  2YU9 H;  2VS1 A;  2CFM A;  4DV1 Q;  2JA5 H;  3H0G H;  2UXC Q;  1JJC B;  2I0Q A;  1G29 1;  1RIP A;  2IHE A;  2N78 A;  1GKH A;  4LF8 L;  4HJ5 A;  4QIW E;  4DV5 L;  4DR6 L;  1M90 C;  3RZD H;  2F4V L;  1B70 B;  2VQE Q;  3RLF A;  3U50 C;  1IBL Q;  1TWF H;  4B3M L;  4LNQ A;  4B3S L;  1I6H H;  2QEX A;  4AQY L;  2JA6 G;  4MTN A;  4BBR G;  1AE2 A;  2NVY H;  5H1S E;  1EWI A;  4B3M Q;  1CSQ A;  1FL0 A;  1BVS A;  2JA7 H;  1K3R A;  1Q1E A;  2VY3 A;  2VNU D;  4RMF A;  4JI1 L;  3T1Y Q;  1IBK L;  1WJJ A;  1HZA A;  1UE6 A;  4DR7 Q;  2GVA A;  2YTY A;  2K50 A;  4NB3 A;  2CWA A;  4A3B H;  4K0K Q;  1PH1 A;  2RF4 A;  5LMU L;  4IO9 A;  4KHP Q;  4DR2 Q;  4A3M G;  4DV1 L;  5C44 H;  2HT1 A;  3H0G G;  5C3E H;  3UE0 A;  4LFA L;  2UUC L;  3RN2 A;  4EX5 A;  3H15 A;  1OXV A;  1SRO A;  2NVX H;  1X9N A;  2NZO A;  2C35 B;  4YWM A;  3I2Z A;  4X66 L;  4WJ4 A;  4P74 A;  3CCL A;  2VQE L;  4BXX G;  4RG1 A;  2VUM H;  5BR8 L;  1VQD A;  1NY4 A;  2KCT A;  4A3E G;  2K52 A;  2K5H A;  3TQY A;  3AEV A;  4JI6 Q;  4BA2 I;  5LMN Q;  4JV5 Q;  1E24 A;  4UY8 C;  4DR5 Q;  1XMO L;  5J3B A;  4B3S Q;  1KQS A;  5GAD C;  3BZK A;  5FLM H;  2MNA A;  4JI2 L;  1VQN A;  5C4J H;  4JI6 L;  1MJC A;  3PSI A;  4JC0 A;  2K5V A;  3PUZ A;  4LFB L;  4LW1 A;  1HH2 P;  4LF7 Q;  3CCM A;  4A76 A;  4R4I A;  2E8G A;  1VQL A;  1WYD A;  1QUQ A;  4P75 A;  4JBK A;  4NXN Q;  3F2C A;  1B8A A;  1L1O C;  1TWG H;  3S1N H;  1TWH H;  2UUB L;  2K14 A;  1HZC A;  2N3S A;  3J81 c;  3HOV G;  2UXC L;  5C44 G;  1WFQ A;  2Q2H A;  1XJV A;  2GN5 A;  4A3J H;  5GRO A;  4BBS H;  1EIF A;  1DGS A;  4A3B G;  4PZ6 A;  1P8L A;  5GAH C;  4BBS G;  3KF8 B;  4JYA L;  2AMC B;  4OXP A;  3U4V A;  1VQP A;  4R1J A;  4DR6 Q;  5M5W H;  2R7F A;  2UXD L;  3D0F A;  2B63 H;  1SLJ A;  2D0O A;  1R9T H;  1UE5 A;  3ULP A;  3TEH B;  1K73 C;  4OX9 L;  1D7Q A;  3GDE A;  2R6G A;  1YJ9 A;  4LUO A;  2Q2T A;  2MFI A;  3BU2 A;  1E7Z A;  4A3F G;  4A3L H;  5FLX c;  1L1O A;  5JJI A;  4UPA A;  1X3E A;  2D0P A;  5IP7 G;  3S1M H;  4A3C G;  1PV4 A;  1VQH A;  3AYH B;  5LMU Q;  1S3O A;  3HFZ B;  4GOP A;  2EQS A;  1J5E Q;  4JBW A;  1TXY A;  1S72 A;  4X62 L;  1EIY B;  4JI7 L;  3UDI A;  1LM0 A;  1S40 A;  2UUC Q;  1VQ7 A;  4MNO A;  3PUW A;  3M7N A;  5C0X I;  1YZ6 A;  2NN6 G;  4XIG S;  3HOX G;  3GTP H;  3PUV A;  4DUZ Q;  4HID A;  1NBW A;  1KD1 C;  1K0R A;  5IT9 c;  1XMQ L;  1VQJ A;  2ID0 A;  3DM3 A;  4X62 Q;  1YHQ A;  3GTJ H;  2A8V A;  5IYB G;  1IBM L;  2K75 A;  3CC4 A;  3G48 A;  1QVC A;  4PG3 A;  3NEN A;  2NZH A;  3KJP A;  1A0I A;  1HJP A;  2KHJ A;  4DKA C;  2E5L L;  4A3J G;  1XPR A;  4IJH A;  2B63 G;  3U4Z A;  1XNQ Q;  4JI8 L;  3HOY G;  1IL2 A;  3HOW G;  3ICE A;  2IX0 A;  2JK8 A;  2OTJ A;  3CCV A;  4GN5 A;  4GOP C;  3KFU A;  4GKK L;  1EFW A;  3CCU A;  3TS0 A;  4LF7 L;  3I4O A;  2RCN A;  3HKZ G;  2Y0S E;  1CUK A;  4LFC L;  5AJ3 Q;  4DV7 Q;  5IWA Q;  3I56 A;  3AQQ A;  3M9B A;  3STB C;  3EBE A;  1ASZ A;  3I4M G;  4GKJ Q;  2H5X A;  3F8T A;  3ER0 A;  5E7N A;  4X65 L;  3OTO L;  1HNW L;  3W1G A;  2WB1 E;  3JAM i;  4DV3 L;  1PVO A;  4OON A;  4DV6 L;  5IWA L;  3GTG H;  1TWA H;  3MXN B;  1SN8 A;  1LTL A;  4C3H H;  3I7F A;  4C3J H;  1GVP A;  3CP0 A;  2ES2 A;  1YJN A;  4X65 Q;  4R4C A;  2B3G A;  2RHQ B;  5IYD G;  1KL9 A;  4Y7N H;  4DV6 Q;  1SE8 A;  2F3I A;  1VQ4 A;  4GKK Q;  1VQK A;  5LMN L;  3CC2 A;  4JV5 L;  4YHH L;  3J80 c;  4IPC A;  1PH3 A;  4OWW B;  5IYB H;  4APV A;  4WJ3 M;  4JI5 Q;  4NXM Q;  5M3M H;  4K0K L;  3Q8D A;  3BJU A;  1FVI A;  3S14 H;  1U5K A;  3E9H A;  4DR4 L;  3UDF A;  4DAM A;  1C9O A;  3HOY H;  2JEB I;  1PH5 A;  3CAM A;  4XTC S;  3PO2 H;  3CCR A;  4JI5 L;  2QGQ A;  4LUZ A;  1NMG A;  4C3I H;  4GLV B;  1MIU A;  2VZA A;  1Q1B A;  3CQZ H;  3CXC A;  4DUY L;  2HHH Q;  4UP8 A;  3I4N H;  1N36 Q;  5EAY A;  1KHI A;  4DV2 Q;  2PNH A;  1EOV A;  1X56 A;  1P16 A;  3STB D;  5M3F H;  1HR0 W;  3G4S A;  1JMC A;  2BA0 A;  5BR8 Q;  3T1H L;  1GD7 A;  2R7D A;  4JI1 Q;  4A4I A;  1V1Q A;  1IBK Q;  1FJG L;  5JJL A;  4LF8 Q;  4O2D A;  1JB7 A;  2EIF A;  3S16 H;  1UWV A;  1VQ5 A;  1VQ9 A;  1HZB A;  3E9I A;  3FP9 A;  4PZ7 A;  4A3I G;  2CWP A;  1NMF A;  1E3P A;  2LSS A;  4AIM A;  1OXX K;  3K7A H;  1WOC A;  1E1O A;  3OW2 A;  1FJG Q;  1JE5 A;  4C2M H;  3M3Y H;  2KCM A;  3BZC A;  3KJO A;  1J5E L;  4B3R L;  1FGU A;  1X3F A;  5IYD H;  3PO3 H;  4LF6 Q;  1PYB A;  3KLW A;  2UU9 Q;  2ZM6 L;  1M1K C;  1QUQ B;  1H95 A;  3F2B A;  4DR7 L;  4JI4 Q;  1KAW A;  2NVT H;  1Q12 A;  1B7Y B;  2XGT A;  4JOI A;  2R92 G;  4JOI C;  1V9P A;  2JA9 A;  2IT1 A;  2E2J H;  4AH6 A;  4BXX H;  4IJL A;  4DV3 Q;  4L5S A;  4JI4 L;  4KHZ A;  2WAQ G;  1WCM G;  2OQ0 A;  2E2H H;  2UUB Q;  4POG A;  4JI0 L;  1Z9F A;  3PUX A;  4GN3 B;  2F52 A;  2RHS B;  4NXN L;  4JYA Q;  1QZG A;  1OTC A;  3S17 H;  4A3D G;  1Y1V G;  3CD6 A;  3KDF A;  4BBR H;  2DUD A;  3CCS A;  1YHA A;  2KEN A;  4GLX A;  1OXS C;  3H3V I;  2UXD Q;  3FHW A;  1XTD A;  3F1Z A;  1VQC A;  4GNX C;  2N49 A;  4X64 L;  4IPG A;  3CF5 A;  4A3F H;  3LGJ A;  1Q82 C;  2JA7 G;  3I4N G;  4A3L G;  4LFB Q;  1Q8K A;  4HIO A;  1Y1W H;  4LF4 L;  1U0L A;  4DAY B;  4R4T A;  5M3F G;  2LXJ A;  3ULL A;  2V1C C;  4L5R C;  4A93 G;  2R93 H;  4NPS A;  1VQA A;  4QQB X;  1XPO A;  1XNR L;  3NEM A;  4HJ7 A;  2PQA B;  1PFS A;  3A0J A;  1VQB A;  2JQO A;  4TVA B;  1HZ9 A;  3NBH B;  1X3G A;  4GOP B;  2AKW B;  4AYB G;  1BBU A;  4HJA A;  1YI2 A;  1W2B A;  2ZTD A;  3PO3 G;  2IHF A;  3GO5 A;  2FXQ A;  3CPF A;  3PCO B;  5DLQ E;  4HJ9 A;  3OTO Q;  4A3K G;  1N8R C;  2MO0 A;  1GO3 E;  3S1Q H;  2VUM G;  2JJQ A;  1Q7Y C;  4GKJ L;  2WFW A;  3EIV A;  1J6Q A;  5IP9 G;  4BY1 G;  4GNX A;  4DNI A;  4GNX B;  2Z0S A;  3AFQ A;  1N32 Q;  2MQH A;  3HOW H;  3U58 A;  1T9H A;  1Y1V H;  5JEA J;  4R4O A;  4ALP A;  4LF9 Q;  5M5X H;  2NVQ H;  1MKH A;  2QA4 A;  2NN6 I;  1I50 H;  4HJ8 A;  3H3V H;  5HGQ A;  3NEL A;  4PZ8 A;  4JG2 A;  4A93 H;  4IFD I;  1CKN B;  5AJ3 L;  4DV7 L;  4LFC Q;  2BA1 A;  3GD7 A;  3HOV H;  5IYC H;  4DR4 Q;  4Y52 H;  4FDB A;  4A3G H;  3S24 A;  1L2F A;  2B29 A;  2E2I H;  1QVG A;  3GTQ H;  1PH4 A;  2OTL A;  3FKI G;  2PMZ E;  2K4K A;  1K83 H;  2L15 A;  1AE3 A;  2ASB A;  1XPU A;  2DGY A;  1CKO A;  2ALY B;  2JE6 I;  4LFA Q;  4H02 A;  3GTK H;  1NTG A;  4IOA A;  4DR1 L;  3RLN A;  3J81 i;  1EYG A;  1YIJ A;  1PH9 A;  4JI7 Q;  1AH9 A;  1Y14 B;  3G71 A;  1OXT A;  2ZJQ A;  1VQI A;  1HNX Q;  1IYJ B;  1HR0 Q;  2JA5 G;  3W1B A;  1NJI C;  2F4V Q;  1IXR A;  3L0O A;  1YJW A;  2R7Z H;  3HOU G;  2OQK A;  1A63 A;  3J7Z C;  2IX1 A;  1MJE A;  1ASY A;  4NXM L;  5IE8 A;  4L5Q A;  1NE3 A;  3PIO A;  3M4Q A;  4LF9 L;  1QZH A;  1X6O A;  4LUV A;  1EQQ A;  5HY6 A;  1I94 Q;  3B6Y A;  3L2P A;  3CCE A;  1IBL L;  1XNQ L;  1YHB A;  3TRZ A;  4IFD G;  4OWT B;  1VQE A;  4LF6 L;  4UP7 A;  3I4M H;  3S1R H;  1K8A C;  5GAG C;  2ZJR A;  5K36 G;  4TQU S;  3FKI H;  3RZO H;  2HHH L;  1A8V A;  1E22 A;  5IYC G;  1PHJ A;  2EXD A;  4ME3 A;  1N33 Q;  3W5O A;  2ATW A;  3K8A A;  4X66 Q;  1CSP A;  5ELO A;  4A75 A;  3J7A 5;  1VQO A;  5JEA G;  1N33 L;  1KRS A;  1Q46 A;  4P73 A;  3HKZ E;  2K5N A;  1EQR A;  2VQF L;  4LF5 Q;  1O7I A;  3PV0 A;  3RNU A;  4A3I H;  3CCJ A;  4DV5 Q;  1HNX L;  3A5Z B;  3RR5 A;  4DV0 L;  3S2D H;  4DK6 C;  4DUY Q;  2VQF Q;  3RLO A;  4LF5 L;  1I3Q H;  1WCM H;  2BH8 A;  1PH7 A;  4OO1 I;  4IFD J;  3T1Y L;  5ELN A;  4DV4 L;  3K7U C;  3PGZ A;  1YBY A;  2I5L X;  4JI3 L;  3I55 A;  4A3C H;  4KHP L;  4HIK A;  5C0X G;  1VQ6 A;  3CW2 C;  2CQO A;  3T1H Q;  1SMX A;  2Q2I A;  4DV0 Q;  4AQY Q;  1Q86 C;  2UU9 L;  3HOU H;  1EUJ A;  2JA6 H;  5FLM G;  1UE7 A;  2ZJP A;  2AHO B;  5IY0 A;  2N8N A;  4B3R Q;  1YNX A;  2A1A A;  3IRB A;  4EQ5 A;  1UEB A;  2OWO A;  3GTO H;  2HQL A;  3ZJY C;  4DV2 L;  3UDX A;  4X6A H;  3CME A;  3RN5 A;  2OCE A;  3UDG A;  1PH2 A;  2WB1 G;  3A74 A;  2YTX A;  2LXK A;  2PI2 E;  4PMW A;  4DK3 C;  4DR2 L;  1GM5 A;  2JA8 G;  3AFP A;  3E0E A;  1Z47 A;  5M5Y H;  2JEA I;  1KXL A;  4GLA C;  3UE1 A;  3KF6 B;  3A5U A;  4OO1 G;  1W3S A;  3HOX H;  3KF6 A;  4O0A A;  3EN2 A;  3KDF B;  1K8G A;  1N32 L;  2ZTE A;  2Q2U A;  1V43 A;  1BKB A;  1N36 L;  3M4P A;  4JI2 Q;  2MO1 A;  1JT8 A;  3L7Z C;  4POF A;  5IP9 H;  4GN4 B;  1UE1 A;  2AWO A;  2GVB A;  4X64 Q;  4P71 A;  4YCV A;  1VS0 A;  4YY3 Q;  1SFO H;  4QGU A;  4A3M H;  3S15 H;  4GS3 A;  3M85 A;  4BY7 G;  2VW9 A;  2AWN A;  4DR5 L;  3OYY A;  1XMO Q;  1RL2 A;  4DR3 L;  2R92 H;  3G6E A;  2PQA A;  1PYS B;  3KOJ A;  1BBW A;  4KLK A;  2CKZ B;  5M3M G;  3JAM c;  1VQG A;  3J81 j;  4DUZ L;  3TS2 A;  5C4X G;  2WP8 J;  4BY1 H;  4P72 A;  1L0W A;  3PUY A;  1LYL A;  2Z6K A;  4IPD A;  4A3D H;  3MEF A;  1X65 A;  4QL5 A;  2ZM6 Q;  1G6P A;  3PO2 G;  3F2D A;  2BH2 A;  1SRU A;  4KI0 A;  3SGI A;  3K81 C;  4IPH A;  3TRE A;  1YEZ A;  2YYZ A;  3D31 A;  3ULJ A;  1N9W A;  2D62 A;  2KHI A;  1HR0 L;  3HOZ G;  4JI0 Q;  1VQ8 A;  3JC6 6;  1VCI A;  2UXB L;  3PF4 A;  4JI8 Q;  2JA8 H;  4DV4 Q;  4YY3 L;  4YWL A;  1SR3 A;  2I5M X;  3CC7 A;  4BY7 H;  3WWV A;  1Q81 C;  4JBM A;  1TWC H;  1N34 Q;  2UUA L;  4L5T A;  3CMA A;  1G51 A;  1X55 A;  4JCV E;  5FJ8 H;  3PIP A;  3M4O H;  1L1O B;  2R7Z G;  4A3G G;  3ERS X;  2E5L Q;  2HIX A;  1PH6 A;  1OXU A;  3PF5 A;  2UXB Q;  1E1T A;  3GTM H;  1CKN A;  4A3K H;  4JBJ A;  4DR3 Q;  4YWK A;  2A19 A;  2PI2 A;  4LWC A;  1KRT A;  1XMQ Q;  2KBN A;  1XNR Q;  4QJF A;  1CKM A;  1PA6 A;  5C4X H;  1KC8 C;  2XTI A;  3K80 C;  4AYB E;  5JJK A;  1HNW Q;  3HKS A;  1WI5 A;  2CCZ A;  4HIM A;  5LMN W;  1JJ2 A;  3S2H H;  1C0A A;  1KIX A;  3K0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...