2GN5A

Refined structure of the gene 5 dna binding protein from bacteriophage fd
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of the gene 5 DNA binding protein from bacteriophage fd.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Dna binding (viral)
molecule keywords GENE V PROTEIN
total genus 3
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1986-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2gn5A00
1GM5A 3L0OA 5IYBH 2K14A 3A5ZB 2UUAL 4A3GH 4MZ9A 2IX1A 3I4NG 1QVFA 3H15A 3F2DA 4DV5Q 5JEAG 5FJ8G 1M90C 2JA6H 3OTOQ 4NXNL 4DUYQ 2JJQA 3CXCA 3H0GH 1FGUA 3HKSA 2HHHQ 4B3ML 4KHZA 2GN5A 2ASBA 3KJOA 2AKWB 5C0XG 1SFOH 1HH2P 3CQZH 4GN5A 4TQUS 4RG1A 5IP7G 4DV0L 1Z9FA 3VDYA 1CKNB 1Y14B 3Q8DA 3PSIA 4DR2Q 1N36L 4A3GG 1X56A 2R93H 4JBMA 1E24A 4JBJA 2K5NA 3STBC 3J80c 1S40A 1LUZA 1IBML 1WI5A 4LF5Q 1TWHH 1M1KC 1X55A 4DR7Q 1A0IA 1CSQA 3RLOA 4BA1I 4AIMA 2UU9L 5M3MH 4DV7L 1XMQQ 2R7ZH 4DR3Q 4HJ9A 4A93G 3BU2A 1X6OA 1B8AA 3UDXA 1A63A 1WOCA 2JK8A 3H3VH 1EIYB 4X64L 2GVBA 3NEMA 1VQ4A 2HT1A 3HOYH 5JJIA 2BH8A 1YJ9A 4L5RC 1XNQQ 4A3LG 4QY7A 4P71A 1YHBA 4DR5Q 2UUCQ 1VQFA 4KHPQ 2CQOA 3M7NA 2FXQA 4AYBG 4MNOA 1OXSC 1JJCB 1GO3E 4IO9A 3S15H 1TWCH 4A3IG 2A1AA 3S1QH 4A3DG 4IFDI 5K36G 3GD7A 4BY1G 4JI5Q 1VQAA 5M3FH 2NZHA 4DR6Q 3S2DH 4LFBL 1JJGA 4BA2I 3GO5A 4HIDA 2PQAB 2ZM6L 1I5FA 3BZKA 3DM3A 4GS3A 4YHHL 1C7YA 1VQNA 2ZTDA 4X66L 1SN8A 1UWVA 1PA6A 3K7AH 2R92H 4AH6A 3S16H 4LUOA 3NBHB 3HOWG 1YZ6A 5GQOA 1YITA 1Y1WH 4JI6L 1SRUA 5LMUQ 4JI7Q 2A19A 3KF6B 3PIOA 3GTJH 3ICEA 2JEAI 1O7IA 2CFMA 4WJ3M 1LM0A 1A62A 3I56A 3RLFA 2WB1E 2RF4A 4A3FH 2UXCQ 4LNQA 2RHSB 1PYSB 4LFBQ 4BXXH 1GKHA 4GOPA 5M5WH 3PO2G 4GKJL 1KRTA 4OX9L 3K80C 1PH7A 1FVIA 4HIOA 3S24A 3K81C 1BKBA 2B63G 3MEFA 2I5MX 2IHFA 1N34Q 2JE6I 2VUMH 1CKNA 1L2FA 4ME3A 4A4IA 1N32L 3A0JA 1PH9A 4JV5Q 1BVSA 4C2MH 1RIPA 3T1YQ 2R7DA 3F8TA 2UU9Q 3J7A5 1PV4A 5C4XH 2ZM6Q 4PMWA 1B7YB 2HIVA 4DV4Q 1Q7YC 5C44H 3PUXA 5E7NA 4JI8L 2D0OA 4H02A 2KBNA 2K75A 1EIFA 5BR8L 4IPHA 4KHPL 4LF7L 1YJWA 2HHHL 5IT9c 3G71A 1YVCA 5C4JH 2MFIA 4LF8L 1VS0A 2YTXA 3S1MH 2VL6A 5IYCH 3F1ZA 3CCUA 2AHOB 1JE5A 4C3IH 3M4QA 4JI0L 1Q1BA 1P16A 3E9HA 1G6PA 1J6QA 2VY3A 4JI2Q 3KF6A 4J15A 2XGTA 1VQOA 1NJIC 1HZ9A 3CCEA 2OTLA 1NMFA 2JEBI 3FP9A 5BR8Q 3PV0A 1X3GA 4QIWE 1VCIA 1ASZA 4LF7Q 3PUVA 4OONA 1VQDA 5FLXc 3HOXG 3H0GG 2F4VL 2E2HH 1V43A 2NVTH 3CCJA 3K0XA 4A3JH 4R4OA 3AQQA 1PH1A 3CCLA 3I4NH 2UXDL 3CF5A 1G51A 4Y52H 4RMFA 1V9PA 2JA5G 3HOUH 2KCMA 1VQHA 3L7ZC 4GN4B 4LF4L 1HNZL 4A3BG 4A93H 4BBSG 2R7ZG 3CD6A 4A3CG 3HFZB 1KHIA 2KCTA 3EN2A 4A76A 1EUJA 4PZ7A 1Q81C 4OO1I 5JJLA 4HJ8A 4L5SA 2JA9A 5C0XJ 2OTJA 3J80i 1PH3A 1L1OC 2OQ0A 3AEVA 2UXDQ 1OXXK 1V1QA 2NN6G 2CCZA 1OXTA 4GLAC 4X62L 4JBKA 2WAQE 2B3GA 3ERSX 3W1BA 1B70B 5HY6A 1E7ZA 1NBWA 4LFCQ 3PUZA 3U4ZA 4GLXA 1HR0W 2JA7H 1YHAA 3CAMA 3PF5A 1X65A 4AQYQ 2D62A 2JA8G 4DR7L 4WJ4A 1OXUA 2YYZA 2RCNA 1UE7A 5ELOA 3RN5A 1PH4A 4JI6Q 2AMCB 3E0EA 4DV1L 4IPDA 1K9MC 2BH2A 2R92G 2Y0SG 4DR2L 4JOIA 4DK3C 3F2BA 1D8LA 1Q1EA 3IRBA 1VQ8A 4IFDJ 1KC8C 3RLNA 3EIVA 4HIMA 1H95A 4X65Q 4LW1A 4O2DA 4K0KL 4ALPA 4JI5L 4DR5L 4KI0A 2Z0SA 4UP9A 4GNXC 1K73C 1PH2A 5FLMH 3GTMH 4EX5A 4TVAB 3I55A 4A3MG 4GLVB 1RL2A 4X64Q 2C35B 1N33Q 3I4MH 4BY7G 3NELA 2MQHA 5IYBG 1T9HA 2N8NA 5C0XI 3M85A 5ELNA 2BA1A 2CWAA 4DAYB 5IYDG 4DR3L 1K8AC 2EIFA 3PUYA 1TWAH 1P8LA 3I7FA 1EYGA 1E3PA 3DLLA 3CCMA 3U50C 1VQPA 1X9NA 3H3VI 1UEBA 4LF8Q 3S14H 3PO3H 4YCWA 4LUZA 3CMAA 1K3RA 1QUQB 1VQ6A 2R93G 4LF9L 4YHHQ 1HNWL 3M4PA 3K8AA 4JYAQ 3FKIH 4JI8Q 1YI2A 1YBYA 3I4OA 2DGYA 4DR6L 2HIXA 3CCSA 4DV2Q 5JEAJ 5C4XG 2OCEA 3PIPA 1HZCA 1MIUA 3OTOL 3GTPH 2JQOA 4B3TL 2LXJA 3W5OA 3GTGH 2KHJA 4DR4L 1SROA 1KXLA 4QJFA 1Q82C 2HQLA 2ZJRA 2E2IH 3S1RH 4JI4L 2Z6KA 3RN2A 4C3JH 1X3EA 1JJ2A 3K7UC 3UDFA 1G291 3EBEA 5M5YH 4X6AH 2IHEA 4JI3L 1IXRA 2AWNA 2YTYA 3D31A 3PGZA 4A3JG 1J5EQ 4GNXB 3BJUA 3CP0A 4YCUA 1ASYA 1TWGH 5AJ3Q 4PG3A 4YCVA 1XMOL 1EFWA 2NVQH 1W2BA 3TS2A 4C3HH 2K50A 2E8GA 1QVCA 4OWTB 3HKZE 3CCVA 1VQMA 3WWVA 4HJ5A 3FKIG 2IY5B 1KD1C 4L5QA 4XIGS 5H1SE 2VQEQ 5EAYA 4YWKA 3GTQH 3J81c 4JI0Q 4AYBE 4IPGA 4A3KG 1L1OB 1NE3A 4UPAA 3UDIA 4JYAL 3HOWH 1E1OA 5IY0A 1BBWA 3HOZH 3T1YL 1LTLA 1MJEA 1HJPA 2AWOA 1Q86C 2JA5H 3HOUG 1KRSA 1VQLA 2VW9A 1L0WA 1HZBA 1WCMG 5LMNQ 4BY1H 2ZJQA 3U58A 3L2PA 4A3IH 2ZTCA 3CC7A 2VNUD 1U5KA 4A3MH 1YJNA 2PI2E 4PZ8A 1VQ9A 3PF4A 1K0RA 3PO2H 4X62Q 1SR3A 4YY3L 1CKOA 2F4VQ 3E9IA 2KHIA 5HGQA 4A3LH 4LWCA 1UE1A 2UXCL 1IYJB 3KOJA 3TREA 1YIJA 3U4VA 1D7QA 2VS1A 2K4KA 1PHJA 1IBLQ 4POFA 3CPWA 1I94L 4HIKA 2PMZE 3BZCA 1XNRL 3G4SA 2MNAA 1OXVA 5LMNL 4DR4Q 1WJJA 1YNXA 1PYBA 1I50H 4IOCA 1E1TA 5LMNW 5IYDH 2PI2A 2Y0SE 3ER0A 2NN6I 3CW2C 3UE1A 1N32Q 4EQ5A 4MTNA 1KQSA 4R4TA 4YY3Q 4LF5L 4DR1L 1TWFH 2WB1G 4A3DH 4QQBX 4DK6C 1MJCA 2QGQA 3FHWA 4LFCL 3SGIA 2I5LX 1QZGA 2E5LQ 4LF9Q 2PQAA 1UE5A 1HR0L 1VQIA 1VQ5A 4YWMA 1VQGA 1SMXA 3CMEA 4JI2L 2WAQG 1XTDA 2RHQB 4DUYL 4NXNQ 2L15A 4DKAC 3HKZG 2KENA 4R4CA 1HNZQ 4DV1Q 4DUZL 1EQQA 1Q12A 4UP8A 2YTVA 1XPUA 2VQFL 4DV6Q 3J81j 4BBSH 4AQYL 3ZJYC 3CCRA 4OXPA 2Z6KC 3ULJA 4B3TQ 4O0AA 2YU9H 1TXYA 2Q2IA 4DPGA 1XPOA 1Q46A 1WYDA 2UUBL 3KF8B 2VQEL 5M3FG 3A5UA 1EWIA 2E5LL 4JI4Q 3B6YA 1IZ6A 5GAHC 3TQYA 4P74A 5IWAQ 4DV3L 1HNXQ 3G6EA 4K0KQ 2CKZB 3AYHB 3STBD 3KFUA 4OO1G 2K52A 3UDGA 1X3FA 3F2CA 1J5EL 3AFQA 2A8VA 2OQKA 3OYYA 3GTOH 1EOVA 1MKHA 2BA0A 3HOYG 2N78A 4NPSA 1WCMH 4X65L 3M4OH 4HJAA 5IP9G 1PFSA 4JG2A 4A3CH 1FL0A 3CCQA 1FJGQ 1I6HH 1YEZA 4A3BH 4IJHA 1IBMQ 4R4QA 3T1HL 1UE6A 3HOZG 4OX9Q 1N9WA 1VQBA 1XJVA 2E2JH 2OWOA 4YWLA 2K5VA 1XMQL 4BBRH 2B63H 1BBUA 3MXNB 4DV2L 1XPRA 1AE2A 1X54A 1QUQA 2UXBQ 2N3SA 3PCOB 3KJPA 2UUCL 4GKKQ 5C3EG 4DV5L 5GROA 5GAEC 1GD7A 2WP8J 3RR5A 2IT1A 2MO0A 2ES2A 1XNQL 3S1NH 4A3FG 1JT8A 2UUBQ 2YV5A 2R6GA 3GTKH 3KDFA 1VQCA 1GVPA 2I5HA 2NVXH 4B3SQ 4LF6Q 4APVA 4IJLA 1Z47A 2EXDA 4JI1L 4R4IA 5M3MG 4A3EH 1IBKL 2UUAQ 3M3YH 1PH8A 1PH5A 1IBLL 1CUKA 4DUZQ 4LFAQ 4NXML 1KL9A 2Q2TA 3CC4A 2VUMG 3S2HH 4IOAA 3A74A 1C9OA 3GDEA 1N33L 5IP9H 4JC0A 3S17H 3G48A 3I4MG 4BY7H 3J81i 4FDBA 2ID0A 1AH9A 3J7ZC 1U0LA 4DAMA 1PVOA 2Q2UA 4DR1Q 5FJ8H 5C44G 2JA6G 1HR0Q 3TS0A 1L1OA 1S72A 2NZOA 1Q8KA 3PUWA 2ZTEA 2EQSA 3JC66 4LUVA 3JAMc 1YHQA 3RZOH 4BBRG 4QGUA 2GVAA 4P73A 4LFAL 1Y1VG 2LSSA 4NXMQ 1HNWQ 5AJ3L 1XMOQ 2I0QA 2UXBL 5IWAL 1SLJA 4OWXB 1HZAA 2IX0A 3AFPA 1WFQA 1OTCA 2R7FA 4P72A 4QL5A 4GOPC 3KYHC 4JI3Q 4OWWB 4B3RQ 4GNXA 5LMUL 2QA4A 4DV0Q 4A3EG 2ZJPA 1R9TH 2Q2HA 3CPFA 5IYCG 1QVGA 1N36Q 1NTGA 1AE3A 4A3KH 1CKMA 1Y1VH 3W1GA 5GADC 1JMCA 1EQRA 5DLQE 4KLKA 2PNHA 1CSPA 5IP7H 4UY8C 1QZHA 4BXXG 4A75A 1K83H 1A8VA 4DV3Q 1HNXL 2MO1A 1LYLA 5C3EH 4JBWA 2LXKA 4JCVE 1VQEA 4GKKL 4DV7Q 1XNRQ 5GAGC 4B3RL 1N34L 2DUDA 5JJKA 3I2ZA 4GN3B 3D0FA 4X66Q 3GTLH 5IE8A 2VQFQ 4DV6L 3HOVG 2F3IA 4PZ6A 2WFWA 2XTIA 5M5XH 4IFDG 4JV5L 1SE8A 1E22A 2K5HA 4HJ7A 4XTCS 3T1HQ 1JB7A 1VQ7A 2JA8H 3JAMi 3UE0A 1VQJA 2NVYH 4NB3A 2JA7G 4LF4Q 4P75A 1KAWA 4JOIC 1IL2A 3ULPA 1I94Q 1NY4A 4POGA 2H5XA 4DV4L 3HOXH 2D0PA 3KLWA 3RZDH 1W3SA 2VZAA 1DGSA 1C0AA 3TEHB 4L5TA 4IPCA 5FLMG 4GKJQ 3LGJA 3OW2A 3KDFB 1K8GA 1NMGA 1S3OA 1VQKA 2CWPA 5J3BA 2V1CC 1I3QH 4B3MQ 3M9BA 2ALYB 3CC2A 4GOPB 1FJGL 1KIXA 3PO3G 2N49A 4UP7A 3NENA 4JI1Q 3RNUA 4DNIA 1Y1WG 4R1JA 1IBKQ 4JI7L 2QEXA 4B3SL 4LF6L 3TRZA 1N8RC 3HOVH 2F52A 1PH6A 2ATWA 4Y7NH 2B29A 3ULLA
chains in the Genus database with same CATH superfamily
1GM5A 5CGKA 3L0OA 1RODA 4A3GH 2UUAL 1HRJA 1TS2A 3OTOQ 1C4QA 3BDLA 2B63B 4K2KA 1HH2P 4GN5A 4DV0L 1CA6A 4XT3B 4JBJA 2K5NA 4CGYB 1LUZA 3T51B 1M1KC 4DR7Q 1A0IA 1DXMA 2E74C 2R7ZH 4A93G 4HJ9A 1X6OA 1WOCA 2JK8A 1TKWB 3HOYH 1LTBD 2GVBA 5JJIA 1XNQQ 4QY7A 3NP8A 1VQFA 2CQOA 3M7NA 3S17B 1NR2A 4MNOA 4IO9A 4A3IG 4BY1G 1VQAA 3S2DH 3GO5A 5FOBB 4R8NA 3BZKA 3J81E 4YHHL 1C7YA 4DU9A 1SN8A 1PA6A 2H4OA 2R92H 1ENCA 2K04A 3NBHB 3I91A 1YZ6A 1PTOC 4JI7Q 2A19A 1NAPA 1STNA 3Q6SA 1O7IA 2CFMA 5DAUA 1OO9B 4LNQA 5EPLA 3VYRA 3I72A 2NN6H 2Z9HA 2K5DA 1KRTA 3K80C 4PMCA 3K81C 5A2QE 5CV5A 2EJGC 1K28A 3MEFA 2I5MX 3H91A 2K33A 4ME3A 1IKMA 2XNAC 4JV5Q 3QJYA 3CHBD 2R7DA 2UU9Q 3NHHA 1Y8PB 4X3UA 4PMWA 4DV4Q 3PUXA 2D0OA 2KBNA 1O7ZA 1EIFA 1M4VA 4IPHA 1ESRA 4XYOA 3V96A 4KHPL 2QDLA 1JWUD 1EY4A 5C4JH 2YTXA 1X32A 2VL6A 5IYCH 4CKEA 1M8AA 2EVBA 1JE5A 1STGA 1Q1BA 3H6MA 5KIXA 1D6EC 4LK1C 3K5MA 3DWPA 2OTLA 3RUZA 1NMFA 1LO5D 3PV0A 1ASZA 1AZPA 1AFPA 2QW7A 1I4QA 2A69D 2J4XA 3K0XA 1XYIA 4R4OA 3EQLC 3CCLA 3D8GA 1WD1A 5G3LD 1BCPD 2EYPA 3VYTA 2KEEA 3MVVA 1ENFA 3HOUH 5JPMC 4A3BG 2WIIB 2Z1CA 3HFZB 1TQOA 3EN2A 4AYBB 4A76A 1EUJA 4MHEA 3OSOA 4PZ7A 2FFKB 4OO1I 2EPBA 5FLXL 5C0XJ 3J80i 3NWSA 2OQ0A 2SEBD 3AEVA 2CCZA 5BN4A 2KCCA 4GLAC 2WAQE 2B3GA 4DF7A 1HFGA 1NBWA 4ODGA 3U4ZA 3K5NA 3TP7A 1U4LA 1L0YB 1YHAA 3CAMA 5NUCA 1X65A 2DJGC 1K9MC 4DR2L 2NBFA 2SNSA 1D8LA 1VQ8A 4OHJA 4KKUA 4IFDJ 2F0JA 3RLNA 1S5BD 2Z0SA 3GTMH 4EX5A 4TVAB 4BY1B 4GLVB 4CKBA 4H44C 1ILPA 2N8NA 5C0XI 2CWAA 4OELB 5FLXE 3HOYB 3U50C 4Q0FA 1KAAA 5IOCA 3S14H 3CMAA 2AUJD 1K83B 2K7VA 4ZK9B 4LF9L 4HTHA 1HNWL 1F9QA 3K8AA 1XWEA 4C1NI 1JORA 2BE5D 3NQTA 5M3FB 1WTOA 1A2UA 1HZCA 2RDGA 3OTOL 1B1ZA 2JQOA 1KNEA 4B3TL 3AB9A 1I4RA 2KHJA 4J6HA 3TBIB 3GTGH 3SHLA 3J81L 3E6ZX 4JI4L 2Z6KA 3SE0A 4BS9A 2IHEA 1IXRA 2AWNA 4RWSC 4Q5VA 3BJUA 1O7LA 3CP0A 1ASYA 5E3FA 1LTRD 2A6HD 2ENBA 1S5ED 3SR1A 4HJ5A 3FKIG 2D5DA 4IALA 5H1SE 2VQEQ 5EAYA 1PTOF 1ET9A 4JI0Q 4UPAA 3UDIA 5CV9A 1U4RA 5IY0A 2JA5H 1KRSA 2EJFC 2B2WA 3N52A 4KTAA 2B2TC 1YNND 1L0WA 1CA5A 2F03A 3GTLB 2XSCA 1WCMG 4BY1H 2ZJQA 1KDBA 3GV3A 1YJNA 3PF4A 1EZ8A 3NTIA 5IGEA 1F2ZA 4KKSA 1KDAA 3KOJA 3TREA 4EVOA 1YIJA 2JXMB 1I94L 4A3KB 4IN3A 1V1PA 3RD4A 1JC7A 1OXVA 3X3NA 2NVXB 1LT6D 1GOZA 3DM1A 1XXGA 5LMNW 2PI2A 2G5DA 5J39A 5IYDH 2OXPA 4UAIA 1TWFH 5C5MA 4DK6C 2HQEA 4OEMB 3SGIA 1QZGA 1RDPD 3U9OA 4YWMA 1SMXA 1JOOA 2X6GA 3S16B 1CZWA 1Q12A 1XPUA 2VQFL 4DV6Q 3J81j 4BBSH 3A8JE 2IW3A 2Z6KC 4KJNA 3DEPA 1B2TA 1Q46A 2Q8RE 1NR4A 2VQEL 5KNDA 3VYUA 2F0EA 1MGSA 4DV3L 5IWAQ 3OPOA 2CKZB 3KFUA 2PO4A 1AW7A 2F3WA 3UDGA 1X3FA 2A8VA 3BVGA 3FKIB 2OQKA 2EY2A 1HQRD 2PYKA 5LL6S 4NPSA 1RJTA 3M4OH 4HJAA 1EQVA 5J1ZA 1FL0A 4A3CH 1SE2A 1V1OA 1YEZA 4A3BH 4K5WA 2K28A 1HHVA 2XRSD 2WAQB 5D65A 1VQBA 2E2JH 2OWOA 4YWLA 2TMPA 2B63H 4BBRH 1BBUA 2B2YA 1AE2A 1X54A 5DEHA 1QUQA 2N3SA 3GTOB 3KJPA 2NVYB 5C3EG 2K1BA 1GD7A 1XNQL 2IT1A 2ES2A 4DXGA 2R6GA 1GVPA 1QE6A 4APVA 2PZWA 3M3YH 1FD7D 3IFDA 3A74A 1PRTD 3GDEA 5IP9H 2B39A 3S17H 3I4MG 2WV6D 4BY7H 1JWMD 4HCEA 1PVOA 2X69A 1LTAD 5FJ8H 2RVLA 4LUVA 1Q8KA 2NZOA 2SNMA 2ZTEA 3RZOH 4BBSB 1KTKA 5I6YA 2XRQD 2UXBL 5EBCA 3ND9A 1SLJA 4OWXB 1HZAA 5M5YB 3NE5B 3D6CA 1CHPD 5HURA 4QL5A 4GOPC 4JI3Q 4CDCC 1N36Q 1TWHB 1IW7D 3CPFA 1NTGA 4L6TB 3KBGA 1Y1VH 2DY8A 3W1GA 5GADC 1EQRA 1HTLD 4JW0A 2F4IA 5E1FA 4C56C 1PFNA 1QZHA 2L55A 1QB5D 2OF1A 3T16A 4DV3Q 3FDTA 3M4OB 4UHVA 1O7YA 1A3TA 2QDBA 4F87A 4GKKL 1PDQA 1XNRQ 3T13A 4IUNA 1GUGA 3EVQA 3I2ZA 4GN3B 3D0FA 4KD4A 2VQFQ 1NCVA 4DV6L 2F3IA 1PYWD 1TY2A 3C3LA 5C4XB 4HJ7A 3T1HQ 4XTCS 3NUCA 5ELBA 4NB3A 4LF4Q 3ULPA 1NY4A 3I73A 4OO1H 2KVMA 2VZAA 1C0AA 4YIJA 1YNJD 4GKJQ 3OW2A 5ELEA 5I9PA 2PNRC 4WRDA 4U68A 3M3YB 2V1CC 1G91A 2JN4A 3J80E 3RNUA 2J7ZA 1Y1WG 3J80L 2QEXA 1SYBA 3HOVH 2F52A 2EYLA 3M7GA 3HG9A 4Y7NH 1E2VA 1ZYRD 2K14A 4MZ9A 2IX1A 1QVFA 3F2DA 1H9JA 1I4GA 1B4OA 1M90C 5EJWA 5FJ8G 1G2SA 3CXCA 2HHHQ 4KHZA 1TIID 2GN5A 1CFMA 5C0XG 3CQZH 4TQUS 1Z9FA 1Y14B 4A3GG 3PSIA 4C3JB 1IBML 1S40A 2FJ2A 1TWHH 4HMJA 3LWEA 1HUNA 1CSQA 1X3QA 5ELFA 4DFAA 3P75A 1D5MC 2HT1A 1PTOH 1B9NA 2ICEC 4C3IB 4JPBW 4P71A 4TRDA 4KY5A 1YHBA 4DR5Q 3DUZA 2F0FA 2IWHA 3JAML 1LLRD 4IFDI 4KK7A 3N6RA 3SK5A 3S1QH 1SYDA 3GD7A 2Q8TA 4JI5Q 1JJGA 4DR6Q 3BDOA 2JA5B 2JYOA 4K6DA 4BA2I 2ZM6L 4GS3A 1SYEA 4X66L 4IFDH 3Q0AA 1B9MA 3H09A 3KUPA 3OW7A 4AH6A 3I90A 3LX0A 5LMUQ 4L63B 1A62A 2WB1E 2RF4A 4FXGC 4JK1C 2UXCQ 1KNAA 2RHSB 4LFBQ 4BXXH 1GKHA 3PO2G 4NW2A 3FRPB 4R8IA 4HIOA 4RA8A 1HA5A 2LY7A 4Y7NB 3TDQA 1CKNA 1L2FA 4A4IA 1SSOA 1QG7A 1S5FD 1BVSA 3VR5A 3T1YQ 1EL0A 3F8TA 3J7A5 2F0DA 2B2VC 1HTPA 2ZM6Q 1DOLA 5C44H 3ONAB 3D3RA 1I4PA 5E7NA 1LACA 3Q22A 5BR8L 4FF3A 3OHXC 5ELDA 4LF7L 1VMPA 3UI2A 4N8X1 4LF8L 1YNNC 3Q24A 1PRTC 1VS0A 1R9TB 1PFMA 3F1ZA 1ICWA 1Y1VB 4C3IH 3E9HA 1G6PA 2VY3A 1FGBD 4J15A 2XGTA 1VQOA 1EWHA 4RGOS 3EFXD 2JEBI 2ZXOA 5KYIA 3S15B 1SE4A 4RFBA 4OONA 1SDFA 3HOXG 2F4VL 3EROA 5JAVA 3CCJA 1PH1A 2UXDL 4Y52H 3MA2B 1LV9A 4RMFA 1V9PA 1VQHA 3L7ZC 4NMZA 4BBRB 4A93H 3FMCA 4XQQA 1MHWC 2CH4W 1A6XA 2A68D 4CDEC 1KHIA 3SXHA 3TN2A 3C2PA 3HGBA 4L5SA 2JA9A 2ZXPA 2OTJA 4FF2A 1PH3A 1OXXK 3K5LA 4ZUIA 3W1BA 2VUMB 1B70B 1F9SA 4KN4C 2Z4HA 4LFCQ 3OMCA 3QB3A 4AQYQ 2D62A 2X6LA 1PH4A 4JI6Q 2BH2A 2AMCB 3E0EA 4DV1L 4IPDA 2F0VA 2WKDA 1I6HB 5IGDA 3F2BA 1Q1EA 3T4AC 3EIVA 3NBHA 3AU7A 5ELCA 5D3DA 4GNXC 1K73C 2KEDA 1HXYD 3I55A 4A3MG 4A3IB 4ZLTF 4A3FB 2XIWA 4RKBA 1MD2D 4LAAA 3M85A 5ELNA 4DR3L 2EIFA 1TWAH 1II3A 2ICIA 4HN7A 5I6WA 3MFYA 1WTVA 4LF8Q 3VR4A 5ISRA 3PO3H 2EDGA 5D14A 4LUZA 1GUSA 1K3RA 4B08A 2R93G 4YHHQ 3VR6A 2O5JC 3MC0B 2EY5A 1YNJC 5K36H 1EFID 2IPKD 4RGTA 4DR6L 1EQTA 2QCPX 4IURA 2I46A 4DV2Q 2QEJC 3EA6A 5EPKA 2HDMA 1FNVA 3ND8A 4CHTB 5IGFA 2LXJA 2JA8B 5IGCA 2F0IA 3S1RH 2R93B 3K7UC 1RTNA 4RHRA 4TSSA 2YTYA 3D31A 3PGZA 4A3JG 1LT3D 3OMGA 2WB1B 1DONA 3H94A 1XMOL 4YCVA 2IY5B 1KD1C 4L5QA 3DMUA 2CW0C 4XIGS 1S4ZA 3J81c 4A3KG 1TS4A 1NE3A 4JYAL 3HOWH 1E1OA 1JR0D 3A8KE 1BBWA 4FXDA 1MJEA 2AWOA 1Q86C 5JVH3 4NP5A 2IJ0A 3K7AB 2F1MA 5M5XB 2HUGA 3U58A 3R93A 4MN3A 3CC7A 3RZOB 4A3MH 1TY0A 3PO2H 4YY3L 4OIJA 4A3LH 4CDDC 1EZ6A 2KHSA 2L12A 5M3MB 1D7QA 1IBLQ 1FNUA 2B2TA 3CPWA 4RH6A 5CV4A 3G4SA 2MNAA 1WJJA 2A74C 4ZCKA 1I50H 4DNTB 2KECA 3ER0A 1EY5A 3CW2C 5EKKA 4IUUA 3MEHA 4DR1L 4QQBX 1JICA 1MJCA 2QGQA 4LF9Q 3P7JA 5JEAH 1EY6A 1VQ5A 4JI2L 1XTDA 2L15A 3HKZG 3H0GB 1HNZQ 4DV1Q 1SYCA 2RQXA 4RKLA 2EYFA 2P5ZX 2D2CC 3I4MB 4AQYL 3PQIA 4DXFA 1QJOA 2EZVA 1TXYA 4DPGA 3QG1A 1SBBB 1QNKA 3A5UA 4JI4Q 5GAHC 3G6EA 3T53B 1JOKA 3W3AA 3F2CA 4QCLA 1J5EL 3AFQA 3PIP3 1X3PA 3OYYA 2BOSA 2A6HC 2BA0A 3HOYG 2N78A 4X65L 2VB3X 1AEXA 2M9VA 4DAVA 2FHTA 3NXWA 1ZYRC 4H0LC 3T1HL 1UE6A 3ITPA 3HOZG 1SNMA 1N9WA 4OX9Q 3KBXA 1ESFA 2K5VA 4RCNA 4XDXA 3DHQA 4RAUC 5C6AA 1XPRA 1SFOB 3PCOB 2UUCL 4GKKQ 4DV5L 3O13A 1JOQA 2WINB 5CV6A 1JT8A 3RR5A 4F88A 2MO0A 3S1NH 1BO0A 4A3FG 2UUBQ 4H7BA 3LNNA 3GTKH 1B50A 1C8CA 4B3SQ 1JE4A 2EXDA 4V0BA 4JI1L 1IBKL 2N88A 2UUAQ 1PH8A 1IBLL 1CUKA 4DUZQ 1H9SB 1KL9A 2Q2TA 3S2HH 4IOAA 3ZYYX 4DAPA 2MHVA 5A2QL 1N33L 4JC0A 1V8QA 2B2UC 3G48A 4K8JA 4FDBA 3J81i 2ID0A 3J7ZC 1U0LA 4DAMA 2M2LA 4J8QA 2Q2UA 1MBYA 3MXGA 1HR0Q 1L1OA 3PUWA 2EQSA 1J9OA 2PQEA 5CV8A 4M1UB 4WORA 2KA7A 4G57A 1Y1VG 1HNWQ 1SMYD 5AJ3L 5F2DA 5E4WC 2I0QA 5IWAL 3AFPA 2JSOA 1OTCA 1WFQA 5IIFA 4OWWB 3KYHC 2RKSA 4A3EG 2ZJPA 1Y8OB 5IYCG 1UUPA 4FP5D 1AE3A 1LT5D 2NTTA 1BNZA 1HA6A 2PNHA 1BDOA 1CQFA 5IP7H 3OWEB 4V190 4A75A 1K83H 1A8VA 1HNXL 5CORA 1SNQA 1AN8A 2LXKA 4O1NA 3DWQA 2ZXRA 1I4XA 3IL8A 2DUDA 5JJKA 4ME5A 4X66Q 2V4DA 4KMUC 1AZQA 5M5XH 1BOSA 1SE8A 1E22A 1KDCA 1VQ7A 1BCPC 3HOUB 2JA7G 4UDUC 4P75A 5IGGA 4JOIC 1Y1WB 1I94Q 2OEOA 4POGA 1DOMA 3HOXH 1ICFB 2D0PA 3GTJB 1W3SA 1DGSA 3TEHB 4L5TA 5BN5A 5E4XA 1BXTA 3R8BA 4KY6A 1UNSA 5KRUA 3BVZA 1NMGA 1VQKA 5J22A 4B3MQ 1F2LA 3CC2A 1DOKA 2A6EC 4UP7A 4IUQA 1A3VA 4JI1Q 1IBKQ 3I8ZA 4B3SL 1N8RC 1PH6A 1JB3A 3QR8A 3BU2A 2B29A 3ULLA 3L3OC 2SOBA 3A5ZB 3I4NG 3H15A 5EQ0A 4DV5Q 2EJMA 2JA6H 3OOCA 4B3ML 3H0GH 1FGUA 4CKCA 4MIUA 2Y0SB 2AKWB 1U4PA 3VDYA 5IP7G 4RG1A 1YHQA 3GTOH 1X56A 2R93H 3HEJA 3STBC 3J80c 1WI5A 3FEWX 3RLOA 4BA1I 4AIMA 4DV7L 4G7HC 1A63A 4A3EB 1EIYB 4X64L 3NEMA 2BH8A 1YJ9A 3G6JB 3OIQA 1RD9D 2RDFA 1D5XC 4KHPQ 3R2IA 1W6JA 1OXSC 1JJCB 1GO3E 1BUVT 2G9DA 3HOZB 1EIHA 5M3FH 2NZHA 5EBDA 4LFBL 2PQAB 1VF5C 3DM3A 3FPPA 1GUWA 1VQNA 2ZTDA 3K7AH 3S16H 1AP0A 4DK1A 3HOWG 1GUNA 1YITA 1Y1WH 1CI3M 3HOXB 3GV6A 3KF6B 3GTJH 2JEAI 2LS01 3C1EA 3MXPA 4WJ3M 3I56A 3RLFA 2A5HA 2CVRA 2F0QA 1F2YA 4A3FH 1WD0A 1PYSB 3AMUA 4GOPA 1PMRA 2KCNA 4X3SA 1IKLA 4OX9L 1DZ1A 1K3BC 2FMMA 3S24A 4QB4A 4G7ZC 3PO3B 2SDFA 2L5TA 1N32L 1PH9A 2KOLA 4A3BB 4PQXA 1PV4A 2CQAA 5C4XH 4R9WA 4KN7C 2HIVA 1Q7YC 2KUMA 4H02A 4JVZA 1I4HA 1PXUA 1DYQA 1BBXC 2A73B 2B2VA 3S1RB 1YJWA 2EY1A 5IT9c 2HHHL 3G71A 1YVCA 3KLRA 3A55A 1PZKD 4KY7A 3S1MH 1EY7A 2Z8LA 1Z6HA 2F0NA 1H9MA 4JI0L 5C4ZA 1J6QA 4JI2Q 3KF6A 2B2YC 2NUCA 3CCEA 3URYA 4QIWE 1SJED 3PUVA 1VQDA 5FK9C 2HDLA 3H0GG 3HKZB 3TSSA 4ZYSA 2E2HH 2NVTH 3K59A 1LTGD 3K58A 3AQQA 3I4NH 3IAYA 3CF5A 4X3TA 1UAPA 5IODA 1PRTF 4IQZA 2JA5G 2KCMA 4LF4L 3HP3A 3K5OA 2R7ZG 1D2BA 2C9OA 4ZRZA 1D1KA 5LHY1 3A7AB 1LTSD 4KV6A 4E6IA 4M8AA 5CMDA 1Q81C 5EKIA 1PLFA 2PW5A 2UXDQ 1V1QA 1EY0A 2VB2X 4JBKA 3OWFA 3ERSX 5HY6A 5CR3A 1E7ZA 3PUZA 4F8MA 1HR0W 2JA7H 1TWCB 3MAQA 4WJ4A 2JA8G 1OXUA 2YYZA 3VA7A 2RCNA 1UE7A 2TSSA 3OIPA 2R92G 3A8IE 2Y0SG 4JOIA 1D1IA 4DK3C 3IRBA 1SEBD 4IUTA 2NB0A 1KC8C 4X65Q 4LW1A 4K0KL 4KJOA 1J8IA 2F0PA 1PH2A 3WDNA 1WTRA 3S1MB 4X64Q 3I4MH 4BY7G 1PZID 2MQHA 5IYBG 3CRLC 3VR2A 2BA1A 1K8AC 3BZDB 1G8ZD 3I7FA 5FO8B 3SVMA 1EYGA 2K05A 1E3PA 2DNCA 3CCMA 4XYQA 3H3VI 1UEBA 1A3UA 4Z9CB 4YCWA 1RTOA 4KD3A 3W2DA 1VQ6A 4JYAQ 4C2MB 1YI2A 1A15A 1SYGA 3CCSA 5C4HA 5C4XG 2AQ1B 3W5OA 2HQLA 3K57A 2NWGA 2ZJRA 2E2IH 3MZ5A 3U9SA 3IKJA 1FR3A 3RN2A 2EYHA 4C3JH 1QWYA 3UDFA 1G291 3D6WA 5C3XA 2EYJA 1F9RA 3EBEA 5M5YH 4X6AH 1K8MA 1QNUA 2RDHA 2QILA 3Q23A 4GNXB 4X3KA 1JCKB 1O80A 2XWJB 4YCUA 2Q8IB 3G7LA 4PG3A 5AJ3Q 1EFWA 3TS2A 2VXWA 1W2BA 4C3HH 1EWCA 2K50A 2E8GA 1QVCA 4OWTB 3VA5A 3CCVA 1VQMA 3WWVA 3KLSX 2LKVA 4FF4A 1S5CD 4K5VA 3BVMA 2Z4IA 2DY7A 5I4DA 3T1YL 3HOUG 3TZDA 2VW9A 2HCCA 4HSPA 2JA6B 2F0UA 5JVG3 1LT4D 1HZBA 3L2PA 1IYUA 2L9HA 2ZTCA 1K0RA 1VMCA 2NYZD 5C4JB 4X62Q 1SR3A 1HUMA 2KHIA 5HGQA 1U4MA 4LWCA 2UXCL 2DJFC 2J0TD 2VS1A 1PHJA 4POFA 3J7AV 1Q3LA 1GJXA 2PMZE 2JP1A 1XNRL 5LMNL 4DR4Q 1PYBA 4IOCA 2AQ3B 5TSSA 4F7XA 2M00A 4G7OC 3UE1A 4EQ5A 1KQSA 1KABA 2WB1G 3TZUA 5DNFA 2PZTA 4LFCL 1LTTD 2E5LQ 1SYFA 3NQIA 2QF7A 2PQAA 1HR0L 3CMEA 2WAQG 4KHVA 1WVLA 1QILA 1SNOA 2RHQB 4CJ0B 4DKAC 1HQMC 2XVSA 4R4CA 4DUZL 5C3WA 4UP8A 2YTVA 3GP7A 3NWTA 3CCRA 2BDNA 4B3TQ 1TT2A 4O0AA 2Q2IA 1XPOA 2UUBL 1SE3A 5M3FG 1MSGA 2E5LL 1EY9A 3TQYA 4P74A 3AYHB 3STBD 1Q90A 1F9PA 3SDZA 2K52A 3RMHA 1H9KA 2H1EA 4I7AA 1EOVA 5EPJA 1MKHA 2F0OA 2K03A 4QUCA 1PFSA 4JG2A 4A3JB 1FJGQ 3GTPB 2RBMA 1IBMQ 4R4QA 1R4QB 1IL8A 1XJVA 2Z6BA 1XMQL 2F0MA 4HCSA 3GTMB 3MXNB 2UXBQ 5FO7B 4I65A 4N9TA 1EYDA 5GROA 1EU4A 2K01A 2WP8J 5L37A 2YV5A 3QIAA 3KDFA 4HSVA 1VQCA 2NVXH 4IJLA 1Z47A 4A3EH 5M3MG 1LABA 4CJ2C 1K8OA 4C3JG 1PH5A 3CRKC 1WTXA 2XN9C 1WTPA 5M9OA 1C9OA 2L4NA 2HCIA 1FYCA 2O2LD 2NVTB 1R4PB 3BYTB 1STYA 4DR1Q 1EU3A 3JC66 1FNWA 1ZEQX 4BBRG 4QGUA 3A56A 2GVAA 3QWNA 4LFAL 4NXMQ 3H3VC 1MI2A 1XMOQ 2B2WC 2L11A 3CQZB 5JPNC 2IX0A 2R7FA 1CTMA 4GNXA 5LMUL 1R9TH 4DGZA 4J1MA 2Q2HA 1D5ZC 5CV7A 1KLUD 1SNPA 3D4RA 5DLQE 4KLKA 1H9RA 2F0HA 1B44D 4UY8C 4BXXG 2MO1A 2JA7B 3DXJC 3HRZC 1VQEA 2WACA 4DV7Q 2MP1A 3HS0C 3ERQA 1N34L 1PTOD 2F0SA 3P20A 5D3IB 5CBEE 5IE8A 3GTLH 3HOVG 2WFWA 2XTIA 4IFDG 3X3MA 3J7YW 2K5HA 2JA8H 3PMFA 2B8FA 2NVYH 3BG3A 1BR9A 4HEDA 2F0TA 1IL2A 4HAEA 2RA4A 4DV4L 1RF2D 4P2CB 3RZDH 4N8FA 5FLMG 1S5DD 3LGJA 3KDFB 1V1PB 2EYOA 2KQ3A 5J3BA 1I3QH 2MUYA 2ALYB 1FJGL 2N49A 3NENA 2L0CA 4DNIA 1Y69U 3GTQB 4DK0A 4BY7B 3MXNA 1VQ9A 4FF1A 1OXTA 1BF4A 5IYBH 1MSHA 1SXTA 3T56B 5JEAG 4NXNL 4DUYQ 2JJQA 3HKSA 2IX3A 2ASBA 3KJOA 1SFOH 1N36L 2E2IB 2O4XA 1CKNB 3Q8DA 4DR2Q 3PO2B 4JBMA 1E24A 3E5SA 1T5XD 4I7ZC 4LF5Q 3S1NB 2RSNA 3NTHA 4ZQ3A 4G4KA 1A2TA 1X55A 4K8IA 1ZXTA 3GTKB 1JWSD 2MPMA 4ZKBB 5M3MH 2UU9L 1XMQQ 1HFNA 4EQPA 4DR3Q 1ILQA 1B8AA 3UDXA 4PNYA 2GA4B 3TP5A 2R3ZA 3H3VH 3A54A 5CC4A 2MGSA 1VQ4A 1CM9A 4L5RC 4A3LG 1I50B 2A69C 5C5LA 2UUCQ 1GUOA 2FXQA 1DM0B 2PMZB 4AYBG 1E0BA 2I07B 3S15H 1EY8A 1TWCH 2A1AA 4HMIA 4NKLA 4A3DG 4A3DB 5K36G 1NSNS 3KLSA 2ZT9C 4HIDA 1I5FA 1CK1A 1ET6A 3NSWA 1UWVA 4LUOA 4LMQD 5GQOA 4JI6L 3BS1A 1SRUA 3PIOA 2WKCA 3ICEA 4A93B 1EYCA 1LM0A 1CHQD 3NTKA 4U673 3KF8A 1BQQT 1I3QB 5M5WH 4GKJL 1SJHD 1B3QA 1TWGB 3I3CA 5CBAE 1PH7A 1FVIA 1Y8NB 3HOVB 1BKBA 3SK8A 2RCFA 4KKTA 1TR5A 2IHFA 5C3EB 2B63G 3TMEA 3S14B 1N34Q 2JE6I 2VUMH 3A0JA 1SNCA 5HGTA 2CH4A 3NBIA 1TWFB 3IFTA 2FMCA 4C2MH 1RIPA 1GHKA 5CYUA 4TKOB 1SAPA 3HZXA 2F0KA 1B7YB 4XQNA 1SNDA 4PV1C 4JI8L 2EYMA 1G2TA 3VYSA 2K75A 4ULLA 1BCPF 2PZUA 1CT1D 4FVMA 3V2TA 2K5WA 2MFIA 1ONLA 3CCUA 2AHOB 2HD3A 3M4QA 3SK4A 1P16A 3BYYB 2NZ1D 4C3HB 1NJIC 1HZ9A 5BR8Q 3FP9A 1X3GA 1VCIA 5I9OA 4LF7Q 1B3AA 5FLXc 5IT9L 1V43A 4A3JH 1E2ZA 4CBVA 1G51A 5KGUA 4GN4B 1Q8IA 1HNZL 4BBSG 4WJWA 3CD6A 4A3CG 1EIGA 1STHA 2KCTA 3RZDB 1JQYD 4RGNA 1GUTA 5JJLA 4HJ8A 2PCFB 2YU9B 2DNEA 3PIO3 1L1OC 1XTCD 3A7LA 2NN6G 1PFBA 3J7AF 4X62L 2R61A 4GLXA 2BCOA 1QCBD 3PF5A 3NPPA 2RSOA 4DR7L 4S3SA 2K6AA 3S2DB 4XT1B 5ELOA 1WCMB 3RN5A 1CZGA 2QKIC 3HOWB 1WTQA 1TU2B 3KK7A 5KEEA 5T1IA 4HIMA 1H95A 4O2DA 4ALPA 1E2WA 3E0JA 4JI5L 4DR5L 4KI0A 4UP9A 5FLMH 3K6OA 5G3LF 1RL2A 2C35B 1RKNA 1N33Q 3NELA 4ILWA 1T9HA 1O78A 1VF7A 4DAYB 5IYDG 3PUYA 2A68C 3QOLA 1P8LA 5KNBA 4C3IG 1SMYC 3DLLA 1VQPA 4DNRB 1RCVD 1X9NA 2DN8A 2FINB 1GXDC 1EEFD 1STEA 1QUQB 5K5PA 3M4PA 3FKIH 4JI8Q 1HCZA 3S1QB 4FXKC 1YBYA 3I4OA 2DGYA 4A3GB 2HIXA 2PPBC 4K14A 5JEAJ 4NDXA 3C46A 2OCEA 3PIPA 1MIUA 4CDFC 5IT9E 3GTPH 4FNFA 4CJ1B 4DR4L 4OGQC 1KXLA 1SROA 1EOTA 5FKAC 2F0GA 4K2LA 4L8JA 1F2MA 1WTHA 4QJFA 5COYA 1Q82C 2E2JB 5EKLA 1X3EA 1JJ2A 3JAME 4JI3L 5IGBA 1B53A 2EOTA 1J5EQ 3QOJA 5M5WB 1LTID 1TWGH 2PW7A 3D4WA 2NVQH 3MTSA 1BCPB 3HKZE 4QMGA 4ZKCB 4LJZC 3DWAA 4YWKA 2KJXA 3SK6A 3GTQH 5LL6X 4AYBE 4IPGA 1L1OB 1TVXA 3I70A 3L9AX 3HOZH 4OL7A 5JOBA 1LTLA 1HJPA 4B9XA 3CU7A 1QOHA 1VQLA 1VDZA 5C44B 4K6LA 5LMNQ 2R92B 4QF4A 5JJZA 4A3IH 1ML0D 2VNUD 1U5KA 2PI2E 2LFNA 4PZ8A 1XX8A 4GZYC 1STBA 1CKOA 2F4VQ 1T5EA 3E9IA 4N9PA 1UE1A 2B2UA 2E2DC 1IYJB 4K5XA 3U4VA 2K4KA 1STAA 1Z7TA 4HIKA 1PZJD 3BZCA 4FYDA 1PTOB 3BDCA 1YNXA 5FO9B 1E1TA 2K32A 4B9WA 2Y0SE 2G9HD 2NN6I 1N32Q 4MTNA 1HPCA 4R4TA 4YY3Q 4LF5L 3S2HB 2IL8A 4RGMA 2CW0D 4A3DH 2C5CA 1WTWA 1EEID 4XXEA 3FHWA 2I5LX 1UE5A 1VQIA 1VQGA 4DUYL 1DCZA 4NXNQ 1IYVA 2KENA 1C48A 5T1GA 2AUKA 1EQQA 1IW7C 4OIKA 2D9UA 3ZJYC 4OXPA 3ULJA 3S9WA 2YU9H 1WYDA 3KF8B 4EGVA 1EWIA 1EYAA 3B6YA 1IZ6A 1HNXQ 3MHBA 4IZ8A 4K0KQ 2XWBB 3FVQA 3MXUA 4OO1G 1TS5A 2N55A 2L1BA 1WCMH 4BWGB 5IP9G 3GQBA 1RHPA 3CCQA 1I6HH 4IJHA 4FO2A 3GTGB 2BDOA 4O42A 1DD2A 5KNCA 4A3MB 3SEBA 1I6VC 4WFN3 2E76C 3R2TA 4DV2L 4ZAIA 2E75C 2F0LA 5DM73 2CHBD 4ABNA 5GAEC 1IHZA 4RHSA 3R3OA 1KLGD 2EY6A 2I5HA 4DAYA 4LF6Q 4IUVA 3EJIA 4R4IA 2MJ8A 2EXZA 2VUMG 3MWYW 2B8GA 4LFAQ 3TP6A 4EQOA 3CC4A 4NXML 1U9RA 3C1FA 1ZKOA 2F3VA 3NK9A 3FPUB 4C1NK 4XQJA 1K0SA 4IUPA 1AH9A 2JA6G 5C44G 3TS0A 4C3HG 1S72A 2EE1A 4QUFA 5I2YA 3JAMc 5I2XA 3M4YA 4P73A 2AQ2B 2LSSA 1CQVA 3E3XA 3DEOA 4P72A 4EQNA 4B3RQ 3P1HA 2QA4A 4DV0Q 2A6ED 1TS3A 1QVGA 2NVQB 4A3KH 3I4LA 1CKMA 2R7ZB 1JMCA 1NUCA 1CSPA 1ENAA 1PRTB 1F77A 4QIWB 2NTSA 5C0XH 5BN3A 3WOFA 5KYLA 1LYLA 5C3EH 4RCOA 3QO2A 4JBWA 4JCVE 3TP8A 2O5IC 5GAGC 1NNXA 3F2UA 1GHJA 4B3RL 1W6KA 2E2HB 3LWUA 4MTKA 2OT2A 3I4NB 4DA2A 4PZ6A 4H13C 4JV5L 5A35A 1JB7A 4HR7B 1L0XB 3JAMi 4PMBA 3UE0A 1VQJA 3K0YA 2F0WA 1UEAB 1KAWA 1H9SA 3WOEA 2H5XA 5EGTA 3KLWA 4ZUJA 3VR3A 4IPCA 5DM63 1G6ZA 2BE5C 1DJRD 1TWAB 1K8GA 1S3OA 2CWPA 3M9BA 3D4DA 2LMCB 3MFGA 4GOPB 3PO3G 1KIXA 5AFWA 4ID6A 4JI7L 4R1JA 3V05A 3CKIB 4DN4M 4LF6L 3TRZA 2ATWA 2K5QA
chains in the Genus database with same CATH topology
1GM5A 3L0OA 5IYBH 2K14A 3A5ZB 2UUAL 4A3GH 4MZ9A 2IX1A 3I4NG 1QVFA 3H15A 3F2DA 4DV5Q 5JEAG 5FJ8G 1M90C 2JA6H 3OTOQ 4NXNL 4DUYQ 2JJQA 3CXCA 3H0GH 1FGUA 3HKSA 2HHHQ 4B3ML 4KHZA 2GN5A 2ASBA 3KJOA 2AKWB 5C0XG 1SFOH 1HH2P 3CQZH 4GN5A 4TQUS 4RG1A 5IP7G 4DV0L 1Z9FA 3VDYA 1CKNB 1Y14B 3Q8DA 3PSIA 4DR2Q 1N36L 4A3GG 1X56A 2R93H 4JBMA 1E24A 4JBJA 2K5NA 3STBC 3J80c 1S40A 1LUZA 1IBML 1WI5A 4LF5Q 1TWHH 1M1KC 1X55A 4DR7Q 1A0IA 1CSQA 3RLOA 4BA1I 4AIMA 2UU9L 5M3MH 4DV7L 1XMQQ 2R7ZH 4DR3Q 4HJ9A 4A93G 3BU2A 1X6OA 1B8AA 3UDXA 1A63A 1WOCA 2JK8A 3H3VH 1EIYB 4X64L 2GVBA 3NEMA 1VQ4A 2HT1A 3HOYH 5JJIA 2BH8A 1YJ9A 4L5RC 1XNQQ 4A3LG 4QY7A 4P71A 1YHBA 4DR5Q 2UUCQ 1VQFA 4KHPQ 2CQOA 3M7NA 2FXQA 4AYBG 4MNOA 1OXSC 1JJCB 1GO3E 4IO9A 3S15H 1TWCH 4A3IG 2A1AA 3S1QH 4A3DG 4IFDI 5K36G 3GD7A 4BY1G 4JI5Q 1VQAA 5M3FH 2NZHA 4DR6Q 3S2DH 4LFBL 1JJGA 4BA2I 3GO5A 4HIDA 2PQAB 2ZM6L 1I5FA 3BZKA 3DM3A 4GS3A 4YHHL 1C7YA 1VQNA 2ZTDA 4X66L 1SN8A 1UWVA 1PA6A 3K7AH 2R92H 4AH6A 3S16H 4LUOA 3NBHB 3HOWG 1YZ6A 5GQOA 1YITA 1Y1WH 4JI6L 1SRUA 5LMUQ 4JI7Q 2A19A 3KF6B 3PIOA 3GTJH 3ICEA 2JEAI 1O7IA 2CFMA 4WJ3M 1LM0A 1A62A 3I56A 3RLFA 2WB1E 2RF4A 4A3FH 2UXCQ 4LNQA 2RHSB 1PYSB 4LFBQ 4BXXH 1GKHA 4GOPA 5M5WH 3PO2G 4GKJL 1KRTA 4OX9L 3K80C 1PH7A 1FVIA 4HIOA 3S24A 3K81C 1BKBA 2B63G 3MEFA 2I5MX 2IHFA 1N34Q 2JE6I 2VUMH 1CKNA 1L2FA 4ME3A 4A4IA 1N32L 3A0JA 1PH9A 4JV5Q 1BVSA 4C2MH 1RIPA 3T1YQ 2R7DA 3F8TA 2UU9Q 3J7A5 1PV4A 5C4XH 2ZM6Q 4PMWA 1B7YB 2HIVA 4DV4Q 1Q7YC 5C44H 3PUXA 5E7NA 4JI8L 2D0OA 4H02A 2KBNA 2K75A 1EIFA 5BR8L 4IPHA 4KHPL 4LF7L 1YJWA 2HHHL 5IT9c 3G71A 1YVCA 5C4JH 2MFIA 4LF8L 1VS0A 2YTXA 3S1MH 2VL6A 5IYCH 3F1ZA 3CCUA 2AHOB 1JE5A 4C3IH 3M4QA 4JI0L 1Q1BA 1P16A 3E9HA 1G6PA 1J6QA 2VY3A 4JI2Q 3KF6A 4J15A 2XGTA 1VQOA 1NJIC 1HZ9A 3CCEA 2OTLA 1NMFA 2JEBI 3FP9A 5BR8Q 3PV0A 1X3GA 4QIWE 1VCIA 1ASZA 4LF7Q 3PUVA 4OONA 1VQDA 5FLXc 3HOXG 3H0GG 2F4VL 2E2HH 1V43A 2NVTH 3CCJA 3K0XA 4A3JH 4R4OA 3AQQA 1PH1A 3CCLA 3I4NH 2UXDL 3CF5A 1G51A 4Y52H 4RMFA 1V9PA 2JA5G 3HOUH 2KCMA 1VQHA 3L7ZC 4GN4B 4LF4L 1HNZL 4A3BG 4A93H 4BBSG 2R7ZG 3CD6A 4A3CG 3HFZB 1KHIA 2KCTA 3EN2A 4A76A 1EUJA 4PZ7A 1Q81C 4OO1I 5JJLA 4HJ8A 4L5SA 2JA9A 5C0XJ 2OTJA 3J80i 1PH3A 1L1OC 2OQ0A 3AEVA 2UXDQ 1OXXK 1V1QA 2NN6G 2CCZA 1OXTA 4GLAC 4X62L 4JBKA 2WAQE 2B3GA 3ERSX 3W1BA 1B70B 5HY6A 1E7ZA 1NBWA 4LFCQ 3PUZA 3U4ZA 4GLXA 1HR0W 2JA7H 1YHAA 3CAMA 3PF5A 1X65A 4AQYQ 2D62A 2JA8G 4DR7L 4WJ4A 1OXUA 2YYZA 2RCNA 1UE7A 5ELOA 3RN5A 1PH4A 4JI6Q 2AMCB 3E0EA 4DV1L 4IPDA 1K9MC 2BH2A 2R92G 2Y0SG 4DR2L 4JOIA 4DK3C 3F2BA 1D8LA 1Q1EA 3IRBA 1VQ8A 4IFDJ 1KC8C 3RLNA 3EIVA 4HIMA 1H95A 4X65Q 4LW1A 4O2DA 4K0KL 4ALPA 4JI5L 4DR5L 4KI0A 2Z0SA 4UP9A 4GNXC 1K73C 1PH2A 5FLMH 3GTMH 4EX5A 4TVAB 3I55A 4A3MG 4GLVB 1RL2A 4X64Q 2C35B 1N33Q 3I4MH 4BY7G 3NELA 2MQHA 5IYBG 1T9HA 2N8NA 5C0XI 3M85A 5ELNA 2BA1A 2CWAA 4DAYB 5IYDG 4DR3L 1K8AC 2EIFA 3PUYA 1TWAH 1P8LA 3I7FA 1EYGA 1E3PA 3DLLA 3CCMA 3U50C 1VQPA 1X9NA 3H3VI 1UEBA 4LF8Q 3S14H 3PO3H 4YCWA 4LUZA 3CMAA 1K3RA 1QUQB 1VQ6A 2R93G 4LF9L 4YHHQ 1HNWL 3M4PA 3K8AA 4JYAQ 3FKIH 4JI8Q 1YI2A 1YBYA 3I4OA 2DGYA 4DR6L 2HIXA 3CCSA 4DV2Q 5JEAJ 5C4XG 2OCEA 3PIPA 1HZCA 1MIUA 3OTOL 3GTPH 2JQOA 4B3TL 2LXJA 3W5OA 3GTGH 2KHJA 4DR4L 1SROA 1KXLA 4QJFA 1Q82C 2HQLA 2ZJRA 2E2IH 3S1RH 4JI4L 2Z6KA 3RN2A 4C3JH 1X3EA 1JJ2A 3K7UC 3UDFA 1G291 3EBEA 5M5YH 4X6AH 2IHEA 4JI3L 1IXRA 2AWNA 2YTYA 3D31A 3PGZA 4A3JG 1J5EQ 4GNXB 3BJUA 3CP0A 4YCUA 1ASYA 1TWGH 5AJ3Q 4PG3A 4YCVA 1XMOL 1EFWA 2NVQH 1W2BA 3TS2A 4C3HH 2K50A 2E8GA 1QVCA 4OWTB 3HKZE 3CCVA 1VQMA 3WWVA 4HJ5A 3FKIG 2IY5B 1KD1C 4L5QA 4XIGS 5H1SE 2VQEQ 5EAYA 4YWKA 3GTQH 3J81c 4JI0Q 4AYBE 4IPGA 4A3KG 1L1OB 1NE3A 4UPAA 3UDIA 4JYAL 3HOWH 1E1OA 5IY0A 1BBWA 3HOZH 3T1YL 1LTLA 1MJEA 1HJPA 2AWOA 1Q86C 2JA5H 3HOUG 1KRSA 1VQLA 2VW9A 1L0WA 1HZBA 1WCMG 5LMNQ 4BY1H 2ZJQA 3U58A 3L2PA 4A3IH 2ZTCA 3CC7A 2VNUD 1U5KA 4A3MH 1YJNA 2PI2E 4PZ8A 1VQ9A 3PF4A 1K0RA 3PO2H 4X62Q 1SR3A 4YY3L 1CKOA 2F4VQ 3E9IA 2KHIA 5HGQA 4A3LH 4LWCA 1UE1A 2UXCL 1IYJB 3KOJA 3TREA 1YIJA 3U4VA 1D7QA 2VS1A 2K4KA 1PHJA 1IBLQ 4POFA 3CPWA 1I94L 4HIKA 2PMZE 3BZCA 1XNRL 3G4SA 2MNAA 1OXVA 5LMNL 4DR4Q 1WJJA 1YNXA 1PYBA 1I50H 4IOCA 1E1TA 5LMNW 5IYDH 2PI2A 2Y0SE 3ER0A 2NN6I 3CW2C 3UE1A 1N32Q 4EQ5A 4MTNA 1KQSA 4R4TA 4YY3Q 4LF5L 4DR1L 1TWFH 2WB1G 4A3DH 4QQBX 4DK6C 1MJCA 2QGQA 3FHWA 4LFCL 3SGIA 2I5LX 1QZGA 2E5LQ 4LF9Q 2PQAA 1UE5A 1HR0L 1VQIA 1VQ5A 4YWMA 1VQGA 1SMXA 3CMEA 4JI2L 2WAQG 1XTDA 2RHQB 4DUYL 4NXNQ 2L15A 4DKAC 3HKZG 2KENA 4R4CA 1HNZQ 4DV1Q 4DUZL 1EQQA 1Q12A 4UP8A 2YTVA 1XPUA 2VQFL 4DV6Q 3J81j 4BBSH 4AQYL 3ZJYC 3CCRA 4OXPA 2Z6KC 3ULJA 4B3TQ 4O0AA 2YU9H 1TXYA 2Q2IA 4DPGA 1XPOA 1Q46A 1WYDA 2UUBL 3KF8B 2VQEL 5M3FG 3A5UA 1EWIA 2E5LL 4JI4Q 3B6YA 1IZ6A 5GAHC 3TQYA 4P74A 5IWAQ 4DV3L 1HNXQ 3G6EA 4K0KQ 2CKZB 3AYHB 3STBD 3KFUA 4OO1G 2K52A 3UDGA 1X3FA 3F2CA 1J5EL 3AFQA 2A8VA 2OQKA 3OYYA 3GTOH 1EOVA 1MKHA 2BA0A 3HOYG 2N78A 4NPSA 1WCMH 4X65L 3M4OH 4HJAA 5IP9G 1PFSA 4JG2A 4A3CH 1FL0A 3CCQA 1FJGQ 1I6HH 1YEZA 4A3BH 4IJHA 1IBMQ 4R4QA 3T1HL 1UE6A 3HOZG 4OX9Q 1N9WA 1VQBA 1XJVA 2E2JH 2OWOA 4YWLA 2K5VA 1XMQL 4BBRH 2B63H 1BBUA 3MXNB 4DV2L 1XPRA 1AE2A 1X54A 1QUQA 2UXBQ 2N3SA 3PCOB 3KJPA 2UUCL 4GKKQ 5C3EG 4DV5L 5GROA 5GAEC 1GD7A 2WP8J 3RR5A 2IT1A 2MO0A 2ES2A 1XNQL 3S1NH 4A3FG 1JT8A 2UUBQ 2YV5A 2R6GA 3GTKH 3KDFA 1VQCA 1GVPA 2I5HA 2NVXH 4B3SQ 4LF6Q 4APVA 4IJLA 1Z47A 2EXDA 4JI1L 4R4IA 5M3MG 4A3EH 1IBKL 2UUAQ 3M3YH 1PH8A 1PH5A 1IBLL 1CUKA 4DUZQ 4LFAQ 4NXML 1KL9A 2Q2TA 3CC4A 2VUMG 3S2HH 4IOAA 3A74A 1C9OA 3GDEA 1N33L 5IP9H 4JC0A 3S17H 3G48A 3I4MG 4BY7H 3J81i 4FDBA 2ID0A 1AH9A 3J7ZC 1U0LA 4DAMA 1PVOA 2Q2UA 4DR1Q 5FJ8H 5C44G 2JA6G 1HR0Q 3TS0A 1L1OA 1S72A 2NZOA 1Q8KA 3PUWA 2ZTEA 2EQSA 3JC66 4LUVA 3JAMc 1YHQA 3RZOH 4BBRG 4QGUA 2GVAA 4P73A 4LFAL 1Y1VG 2LSSA 4NXMQ 1HNWQ 5AJ3L 1XMOQ 2I0QA 2UXBL 5IWAL 1SLJA 4OWXB 1HZAA 2IX0A 3AFPA 1WFQA 1OTCA 2R7FA 4P72A 4QL5A 4GOPC 3KYHC 4JI3Q 4OWWB 4B3RQ 4GNXA 5LMUL 2QA4A 4DV0Q 4A3EG 2ZJPA 1R9TH 2Q2HA 3CPFA 5IYCG 1QVGA 1N36Q 1NTGA 1AE3A 4A3KH 1CKMA 1Y1VH 3W1GA 5GADC 1JMCA 1EQRA 5DLQE 4KLKA 2PNHA 1CSPA 5IP7H 4UY8C 1QZHA 4BXXG 4A75A 1K83H 1A8VA 4DV3Q 1HNXL 2MO1A 1LYLA 5C3EH 4JBWA 2LXKA 4JCVE 1VQEA 4GKKL 4DV7Q 1XNRQ 5GAGC 4B3RL 1N34L 2DUDA 5JJKA 3I2ZA 4GN3B 3D0FA 4X66Q 3GTLH 5IE8A 2VQFQ 4DV6L 3HOVG 2F3IA 4PZ6A 2WFWA 2XTIA 5M5XH 4IFDG 4JV5L 1SE8A 1E22A 2K5HA 4HJ7A 4XTCS 3T1HQ 1JB7A 1VQ7A 2JA8H 3JAMi 3UE0A 1VQJA 2NVYH 4NB3A 2JA7G 4LF4Q 4P75A 1KAWA 4JOIC 1IL2A 3ULPA 1I94Q 1NY4A 4POGA 2H5XA 4DV4L 3HOXH 2D0PA 3KLWA 3RZDH 1W3SA 2VZAA 1DGSA 1C0AA 3TEHB 4L5TA 4IPCA 5FLMG 4GKJQ 3LGJA 3OW2A 3KDFB 1K8GA 1NMGA 1S3OA 1VQKA 2CWPA 5J3BA 2V1CC 1I3QH 4B3MQ 3M9BA 2ALYB 3CC2A 4GOPB 1FJGL 1KIXA 3PO3G 2N49A 4UP7A 3NENA 4JI1Q 3RNUA 4DNIA 1Y1WG 4R1JA 1IBKQ 4JI7L 2QEXA 4B3SL 4LF6L 3TRZA 1N8RC 3HOVH 2F52A 1PH6A 2ATWA 4Y7NH 2B29A 3ULLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GM5 A;  3L0O A;  5IYB H;  2K14 A;  3A5Z B;  2UUA L;  4A3G H;  4MZ9 A;  2IX1 A;  3I4N G;  1QVF A;  3H15 A;  3F2D A;  4DV5 Q;  5JEA G;  5FJ8 G;  1M90 C;  2JA6 H;  3OTO Q;  4NXN L;  4DUY Q;  2JJQ A;  3CXC A;  3H0G H;  1FGU A;  3HKS A;  2HHH Q;  4B3M L;  4KHZ A;  2GN5 A;  2ASB A;  3KJO A;  2AKW B;  5C0X G;  1SFO H;  1HH2 P;  3CQZ H;  4GN5 A;  4TQU S;  4RG1 A;  5IP7 G;  4DV0 L;  1Z9F A;  3VDY A;  1CKN B;  1Y14 B;  3Q8D A;  3PSI A;  4DR2 Q;  1N36 L;  4A3G G;  1X56 A;  2R93 H;  4JBM A;  1E24 A;  4JBJ A;  2K5N A;  3STB C;  3J80 c;  1S40 A;  1LUZ A;  1IBM L;  1WI5 A;  4LF5 Q;  1TWH H;  1M1K C;  1X55 A;  4DR7 Q;  1A0I A;  1CSQ A;  3RLO A;  4BA1 I;  4AIM A;  2UU9 L;  5M3M H;  4DV7 L;  1XMQ Q;  2R7Z H;  4DR3 Q;  4HJ9 A;  4A93 G;  3BU2 A;  1X6O A;  1B8A A;  3UDX A;  1A63 A;  1WOC A;  2JK8 A;  3H3V H;  1EIY B;  4X64 L;  2GVB A;  3NEM A;  1VQ4 A;  2HT1 A;  3HOY H;  5JJI A;  2BH8 A;  1YJ9 A;  4L5R C;  1XNQ Q;  4A3L G;  4QY7 A;  4P71 A;  1YHB A;  4DR5 Q;  2UUC Q;  1VQF A;  4KHP Q;  2CQO A;  3M7N A;  2FXQ A;  4AYB G;  4MNO A;  1OXS C;  1JJC B;  1GO3 E;  4IO9 A;  3S15 H;  1TWC H;  4A3I G;  2A1A A;  3S1Q H;  4A3D G;  4IFD I;  5K36 G;  3GD7 A;  4BY1 G;  4JI5 Q;  1VQA A;  5M3F H;  2NZH A;  4DR6 Q;  3S2D H;  4LFB L;  1JJG A;  4BA2 I;  3GO5 A;  4HID A;  2PQA B;  2ZM6 L;  1I5F A;  3BZK A;  3DM3 A;  4GS3 A;  4YHH L;  1C7Y A;  1VQN A;  2ZTD A;  4X66 L;  1SN8 A;  1UWV A;  1PA6 A;  3K7A H;  2R92 H;  4AH6 A;  3S16 H;  4LUO A;  3NBH B;  3HOW G;  1YZ6 A;  5GQO A;  1YIT A;  1Y1W H;  4JI6 L;  1SRU A;  5LMU Q;  4JI7 Q;  2A19 A;  3KF6 B;  3PIO A;  3GTJ H;  3ICE A;  2JEA I;  1O7I A;  2CFM A;  4WJ3 M;  1LM0 A;  1A62 A;  3I56 A;  3RLF A;  2WB1 E;  2RF4 A;  4A3F H;  2UXC Q;  4LNQ A;  2RHS B;  1PYS B;  4LFB Q;  4BXX H;  1GKH A;  4GOP A;  5M5W H;  3PO2 G;  4GKJ L;  1KRT A;  4OX9 L;  3K80 C;  1PH7 A;  1FVI A;  4HIO A;  3S24 A;  3K81 C;  1BKB A;  2B63 G;  3MEF A;  2I5M X;  2IHF A;  1N34 Q;  2JE6 I;  2VUM H;  1CKN A;  1L2F A;  4ME3 A;  4A4I A;  1N32 L;  3A0J A;  1PH9 A;  4JV5 Q;  1BVS A;  4C2M H;  1RIP A;  3T1Y Q;  2R7D A;  3F8T A;  2UU9 Q;  3J7A 5;  1PV4 A;  5C4X H;  2ZM6 Q;  4PMW A;  1B7Y B;  2HIV A;  4DV4 Q;  1Q7Y C;  5C44 H;  3PUX A;  5E7N A;  4JI8 L;  2D0O A;  4H02 A;  2KBN A;  2K75 A;  1EIF A;  5BR8 L;  4IPH A;  4KHP L;  4LF7 L;  1YJW A;  2HHH L;  5IT9 c;  3G71 A;  1YVC A;  5C4J H;  2MFI A;  4LF8 L;  1VS0 A;  2YTX A;  3S1M H;  2VL6 A;  5IYC H;  3F1Z A;  3CCU A;  2AHO B;  1JE5 A;  4C3I H;  3M4Q A;  4JI0 L;  1Q1B A;  1P16 A;  3E9H A;  1G6P A;  1J6Q A;  2VY3 A;  4JI2 Q;  3KF6 A;  4J15 A;  2XGT A;  1VQO A;  1NJI C;  1HZ9 A;  3CCE A;  2OTL A;  1NMF A;  2JEB I;  3FP9 A;  5BR8 Q;  3PV0 A;  1X3G A;  4QIW E;  1VCI A;  1ASZ A;  4LF7 Q;  3PUV A;  4OON A;  1VQD A;  5FLX c;  3HOX G;  3H0G G;  2F4V L;  2E2H H;  1V43 A;  2NVT H;  3CCJ A;  3K0X A;  4A3J H;  4R4O A;  3AQQ A;  1PH1 A;  3CCL A;  3I4N H;  2UXD L;  3CF5 A;  1G51 A;  4Y52 H;  4RMF A;  1V9P A;  2JA5 G;  3HOU H;  2KCM A;  1VQH A;  3L7Z C;  4GN4 B;  4LF4 L;  1HNZ L;  4A3B G;  4A93 H;  4BBS G;  2R7Z G;  3CD6 A;  4A3C G;  3HFZ B;  1KHI A;  2KCT A;  3EN2 A;  4A76 A;  1EUJ A;  4PZ7 A;  1Q81 C;  4OO1 I;  5JJL A;  4HJ8 A;  4L5S A;  2JA9 A;  5C0X J;  2OTJ A;  3J80 i;  1PH3 A;  1L1O C;  2OQ0 A;  3AEV A;  2UXD Q;  1OXX K;  1V1Q A;  2NN6 G;  2CCZ A;  1OXT A;  4GLA C;  4X62 L;  4JBK A;  2WAQ E;  2B3G A;  3ERS X;  3W1B A;  1B70 B;  5HY6 A;  1E7Z A;  1NBW A;  4LFC Q;  3PUZ A;  3U4Z A;  4GLX A;  1HR0 W;  2JA7 H;  1YHA A;  3CAM A;  3PF5 A;  1X65 A;  4AQY Q;  2D62 A;  2JA8 G;  4DR7 L;  4WJ4 A;  1OXU A;  2YYZ A;  2RCN A;  1UE7 A;  5ELO A;  3RN5 A;  1PH4 A;  4JI6 Q;  2AMC B;  3E0E A;  4DV1 L;  4IPD A;  1K9M C;  2BH2 A;  2R92 G;  2Y0S G;  4DR2 L;  4JOI A;  4DK3 C;  3F2B A;  1D8L A;  1Q1E A;  3IRB A;  1VQ8 A;  4IFD J;  1KC8 C;  3RLN A;  3EIV A;  4HIM A;  1H95 A;  4X65 Q;  4LW1 A;  4O2D A;  4K0K L;  4ALP A;  4JI5 L;  4DR5 L;  4KI0 A;  2Z0S A;  4UP9 A;  4GNX C;  1K73 C;  1PH2 A;  5FLM H;  3GTM H;  4EX5 A;  4TVA B;  3I55 A;  4A3M G;  4GLV B;  1RL2 A;  4X64 Q;  2C35 B;  1N33 Q;  3I4M H;  4BY7 G;  3NEL A;  2MQH A;  5IYB G;  1T9H A;  2N8N A;  5C0X I;  3M85 A;  5ELN A;  2BA1 A;  2CWA A;  4DAY B;  5IYD G;  4DR3 L;  1K8A C;  2EIF A;  3PUY A;  1TWA H;  1P8L A;  3I7F A;  1EYG A;  1E3P A;  3DLL A;  3CCM A;  3U50 C;  1VQP A;  1X9N A;  3H3V I;  1UEB A;  4LF8 Q;  3S14 H;  3PO3 H;  4YCW A;  4LUZ A;  3CMA A;  1K3R A;  1QUQ B;  1VQ6 A;  2R93 G;  4LF9 L;  4YHH Q;  1HNW L;  3M4P A;  3K8A A;  4JYA Q;  3FKI H;  4JI8 Q;  1YI2 A;  1YBY A;  3I4O A;  2DGY A;  4DR6 L;  2HIX A;  3CCS A;  4DV2 Q;  5JEA J;  5C4X G;  2OCE A;  3PIP A;  1HZC A;  1MIU A;  3OTO L;  3GTP H;  2JQO A;  4B3T L;  2LXJ A;  3W5O A;  3GTG H;  2KHJ A;  4DR4 L;  1SRO A;  1KXL A;  4QJF A;  1Q82 C;  2HQL A;  2ZJR A;  2E2I H;  3S1R H;  4JI4 L;  2Z6K A;  3RN2 A;  4C3J H;  1X3E A;  1JJ2 A;  3K7U C;  3UDF A;  1G29 1;  3EBE A;  5M5Y H;  4X6A H;  2IHE A;  4JI3 L;  1IXR A;  2AWN A;  2YTY A;  3D31 A;  3PGZ A;  4A3J G;  1J5E Q;  4GNX B;  3BJU A;  3CP0 A;  4YCU A;  1ASY A;  1TWG H;  5AJ3 Q;  4PG3 A;  4YCV A;  1XMO L;  1EFW A;  2NVQ H;  1W2B A;  3TS2 A;  4C3H H;  2K50 A;  2E8G A;  1QVC A;  4OWT B;  3HKZ E;  3CCV A;  1VQM A;  3WWV A;  4HJ5 A;  3FKI G;  2IY5 B;  1KD1 C;  4L5Q A;  4XIG S;  5H1S E;  2VQE Q;  5EAY A;  4YWK A;  3GTQ H;  3J81 c;  4JI0 Q;  4AYB E;  4IPG A;  4A3K G;  1L1O B;  1NE3 A;  4UPA A;  3UDI A;  4JYA L;  3HOW H;  1E1O A;  5IY0 A;  1BBW A;  3HOZ H;  3T1Y L;  1LTL A;  1MJE A;  1HJP A;  2AWO A;  1Q86 C;  2JA5 H;  3HOU G;  1KRS A;  1VQL A;  2VW9 A;  1L0W A;  1HZB A;  1WCM G;  5LMN Q;  4BY1 H;  2ZJQ A;  3U58 A;  3L2P A;  4A3I H;  2ZTC A;  3CC7 A;  2VNU D;  1U5K A;  4A3M H;  1YJN A;  2PI2 E;  4PZ8 A;  1VQ9 A;  3PF4 A;  1K0R A;  3PO2 H;  4X62 Q;  1SR3 A;  4YY3 L;  1CKO A;  2F4V Q;  3E9I A;  2KHI A;  5HGQ A;  4A3L H;  4LWC A;  1UE1 A;  2UXC L;  1IYJ B;  3KOJ A;  3TRE A;  1YIJ A;  3U4V A;  1D7Q A;  2VS1 A;  2K4K A;  1PHJ A;  1IBL Q;  4POF A;  3CPW A;  1I94 L;  4HIK A;  2PMZ E;  3BZC A;  1XNR L;  3G4S A;  2MNA A;  1OXV A;  5LMN L;  4DR4 Q;  1WJJ A;  1YNX A;  1PYB A;  1I50 H;  4IOC A;  1E1T A;  5LMN W;  5IYD H;  2PI2 A;  2Y0S E;  3ER0 A;  2NN6 I;  3CW2 C;  3UE1 A;  1N32 Q;  4EQ5 A;  4MTN A;  1KQS A;  4R4T A;  4YY3 Q;  4LF5 L;  4DR1 L;  1TWF H;  2WB1 G;  4A3D H;  4QQB X;  4DK6 C;  1MJC A;  2QGQ A;  3FHW A;  4LFC L;  3SGI A;  2I5L X;  1QZG A;  2E5L Q;  4LF9 Q;  2PQA A;  1UE5 A;  1HR0 L;  1VQI A;  1VQ5 A;  4YWM A;  1VQG A;  1SMX A;  3CME A;  4JI2 L;  2WAQ G;  1XTD A;  2RHQ B;  4DUY L;  4NXN Q;  2L15 A;  4DKA C;  3HKZ G;  2KEN A;  4R4C A;  1HNZ Q;  4DV1 Q;  4DUZ L;  1EQQ A;  1Q12 A;  4UP8 A;  2YTV A;  1XPU A;  2VQF L;  4DV6 Q;  3J81 j;  4BBS H;  4AQY L;  3ZJY C;  3CCR A;  4OXP A;  2Z6K C;  3ULJ A;  4B3T Q;  4O0A A;  2YU9 H;  1TXY A;  2Q2I A;  4DPG A;  1XPO A;  1Q46 A;  1WYD A;  2UUB L;  3KF8 B;  2VQE L;  5M3F G;  3A5U A;  1EWI A;  2E5L L;  4JI4 Q;  3B6Y A;  1IZ6 A;  5GAH C;  3TQY A;  4P74 A;  5IWA Q;  4DV3 L;  1HNX Q;  3G6E A;  4K0K Q;  2CKZ B;  3AYH B;  3STB D;  3KFU A;  4OO1 G;  2K52 A;  3UDG A;  1X3F A;  3F2C A;  1J5E L;  3AFQ A;  2A8V A;  2OQK A;  3OYY A;  3GTO H;  1EOV A;  1MKH A;  2BA0 A;  3HOY G;  2N78 A;  4NPS A;  1WCM H;  4X65 L;  3M4O H;  4HJA A;  5IP9 G;  1PFS A;  4JG2 A;  4A3C H;  1FL0 A;  3CCQ A;  1FJG Q;  1I6H H;  1YEZ A;  4A3B H;  4IJH A;  1IBM Q;  4R4Q A;  3T1H L;  1UE6 A;  3HOZ G;  4OX9 Q;  1N9W A;  1VQB A;  1XJV A;  2E2J H;  2OWO A;  4YWL A;  2K5V A;  1XMQ L;  4BBR H;  2B63 H;  1BBU A;  3MXN B;  4DV2 L;  1XPR A;  1AE2 A;  1X54 A;  1QUQ A;  2UXB Q;  2N3S A;  3PCO B;  3KJP A;  2UUC L;  4GKK Q;  5C3E G;  4DV5 L;  5GRO A;  5GAE C;  1GD7 A;  2WP8 J;  3RR5 A;  2IT1 A;  2MO0 A;  2ES2 A;  1XNQ L;  3S1N H;  4A3F G;  1JT8 A;  2UUB Q;  2YV5 A;  2R6G A;  3GTK H;  3KDF A;  1VQC A;  1GVP A;  2I5H A;  2NVX H;  4B3S Q;  4LF6 Q;  4APV A;  4IJL A;  1Z47 A;  2EXD A;  4JI1 L;  4R4I A;  5M3M G;  4A3E H;  1IBK L;  2UUA Q;  3M3Y H;  1PH8 A;  1PH5 A;  1IBL L;  1CUK A;  4DUZ Q;  4LFA Q;  4NXM L;  1KL9 A;  2Q2T A;  3CC4 A;  2VUM G;  3S2H H;  4IOA A;  3A74 A;  1C9O A;  3GDE A;  1N33 L;  5IP9 H;  4JC0 A;  3S17 H;  3G48 A;  3I4M G;  4BY7 H;  3J81 i;  4FDB A;  2ID0 A;  1AH9 A;  3J7Z C;  1U0L A;  4DAM A;  1PVO A;  2Q2U A;  4DR1 Q;  5FJ8 H;  5C44 G;  2JA6 G;  1HR0 Q;  3TS0 A;  1L1O A;  1S72 A;  2NZO A;  1Q8K A;  3PUW A;  2ZTE A;  2EQS A;  3JC6 6;  4LUV A;  3JAM c;  1YHQ A;  3RZO H;  4BBR G;  4QGU A;  2GVA A;  4P73 A;  4LFA L;  1Y1V G;  2LSS A;  4NXM Q;  1HNW Q;  5AJ3 L;  1XMO Q;  2I0Q A;  2UXB L;  5IWA L;  1SLJ A;  4OWX B;  1HZA A;  2IX0 A;  3AFP A;  1WFQ A;  1OTC A;  2R7F A;  4P72 A;  4QL5 A;  4GOP C;  3KYH C;  4JI3 Q;  4OWW B;  4B3R Q;  4GNX A;  5LMU L;  2QA4 A;  4DV0 Q;  4A3E G;  2ZJP A;  1R9T H;  2Q2H A;  3CPF A;  5IYC G;  1QVG A;  1N36 Q;  1NTG A;  1AE3 A;  4A3K H;  1CKM A;  1Y1V H;  3W1G A;  5GAD C;  1JMC A;  1EQR A;  5DLQ E;  4KLK A;  2PNH A;  1CSP A;  5IP7 H;  4UY8 C;  1QZH A;  4BXX G;  4A75 A;  1K83 H;  1A8V A;  4DV3 Q;  1HNX L;  2MO1 A;  1LYL A;  5C3E H;  4JBW A;  2LXK A;  4JCV E;  1VQE A;  4GKK L;  4DV7 Q;  1XNR Q;  5GAG C;  4B3R L;  1N34 L;  2DUD A;  5JJK A;  3I2Z A;  4GN3 B;  3D0F A;  4X66 Q;  3GTL H;  5IE8 A;  2VQF Q;  4DV6 L;  3HOV G;  2F3I A;  4PZ6 A;  2WFW A;  2XTI A;  5M5X H;  4IFD G;  4JV5 L;  1SE8 A;  1E22 A;  2K5H A;  4HJ7 A;  4XTC S;  3T1H Q;  1JB7 A;  1VQ7 A;  2JA8 H;  3JAM i;  3UE0 A;  1VQJ A;  2NVY H;  4NB3 A;  2JA7 G;  4LF4 Q;  4P75 A;  1KAW A;  4JOI C;  1IL2 A;  3ULP A;  1I94 Q;  1NY4 A;  4POG A;  2H5X A;  4DV4 L;  3HOX H;  2D0P A;  3KLW A;  3RZD H;  1W3S A;  2VZA A;  1DGS A;  1C0A A;  3TEH B;  4L5T A;  4IPC A;  5FLM G;  4GKJ Q;  3LGJ A;  3OW2 A;  3KDF B;  1K8G A;  1NMG A;  1S3O A;  1VQK A;  2CWP A;  5J3B A;  2V1C C;  1I3Q H;  4B3M Q;  3M9B A;  2ALY B;  3CC2 A;  4GOP B;  1FJG L;  1KIX A;  3PO3 G;  2N49 A;  4UP7 A;  3NEN A;  4JI1 Q;  3RNU A;  4DNI A;  1Y1W G;  4R1J A;  1IBK Q;  4JI7 L;  2QEX A;  4B3S L;  4LF6 L;  3TRZ A;  1N8R C;  3HOV H;  2F52 A;  1PH6 A;  2ATW A;  4Y7N H;  2B29 A;  3ULL A; 
#chains in the Genus database with same CATH topology
 1GM5 A;  5CGK A;  3L0O A;  1ROD A;  4A3G H;  2UUA L;  1HRJ A;  1TS2 A;  3OTO Q;  1C4Q A;  3BDL A;  2B63 B;  4K2K A;  1HH2 P;  4GN5 A;  4DV0 L;  1CA6 A;  4XT3 B;  4JBJ A;  2K5N A;  4CGY B;  1LUZ A;  3T51 B;  1M1K C;  4DR7 Q;  1A0I A;  1DXM A;  2E74 C;  2R7Z H;  4A93 G;  4HJ9 A;  1X6O A;  1WOC A;  2JK8 A;  1TKW B;  3HOY H;  1LTB D;  2GVB A;  5JJI A;  1XNQ Q;  4QY7 A;  3NP8 A;  1VQF A;  2CQO A;  3M7N A;  3S17 B;  1NR2 A;  4MNO A;  4IO9 A;  4A3I G;  4BY1 G;  1VQA A;  3S2D H;  3GO5 A;  5FOB B;  4R8N A;  3BZK A;  3J81 E;  4YHH L;  1C7Y A;  4DU9 A;  1SN8 A;  1PA6 A;  2H4O A;  2R92 H;  1ENC A;  2K04 A;  3NBH B;  3I91 A;  1YZ6 A;  1PTO C;  4JI7 Q;  2A19 A;  1NAP A;  1STN A;  3Q6S A;  1O7I A;  2CFM A;  5DAU A;  1OO9 B;  4LNQ A;  5EPL A;  3VYR A;  3I72 A;  2NN6 H;  2Z9H A;  2K5D A;  1KRT A;  3K80 C;  4PMC A;  3K81 C;  5A2Q E;  5CV5 A;  2EJG C;  1K28 A;  3MEF A;  2I5M X;  3H91 A;  2K33 A;  4ME3 A;  1IKM A;  2XNA C;  4JV5 Q;  3QJY A;  3CHB D;  2R7D A;  2UU9 Q;  3NHH A;  1Y8P B;  4X3U A;  4PMW A;  4DV4 Q;  3PUX A;  2D0O A;  2KBN A;  1O7Z A;  1EIF A;  1M4V A;  4IPH A;  1ESR A;  4XYO A;  3V96 A;  4KHP L;  2QDL A;  1JWU D;  1EY4 A;  5C4J H;  2YTX A;  1X32 A;  2VL6 A;  5IYC H;  4CKE A;  1M8A A;  2EVB A;  1JE5 A;  1STG A;  1Q1B A;  3H6M A;  5KIX A;  1D6E C;  4LK1 C;  3K5M A;  3DWP A;  2OTL A;  3RUZ A;  1NMF A;  1LO5 D;  3PV0 A;  1ASZ A;  1AZP A;  1AFP A;  2QW7 A;  1I4Q A;  2A69 D;  2J4X A;  3K0X A;  1XYI A;  4R4O A;  3EQL C;  3CCL A;  3D8G A;  1WD1 A;  5G3L D;  1BCP D;  2EYP A;  3VYT A;  2KEE A;  3MVV A;  1ENF A;  3HOU H;  5JPM C;  4A3B G;  2WII B;  2Z1C A;  3HFZ B;  1TQO A;  3EN2 A;  4AYB B;  4A76 A;  1EUJ A;  4MHE A;  3OSO A;  4PZ7 A;  2FFK B;  4OO1 I;  2EPB A;  5FLX L;  5C0X J;  3J80 i;  3NWS A;  2OQ0 A;  2SEB D;  3AEV A;  2CCZ A;  5BN4 A;  2KCC A;  4GLA C;  2WAQ E;  2B3G A;  4DF7 A;  1HFG A;  1NBW A;  4ODG A;  3U4Z A;  3K5N A;  3TP7 A;  1U4L A;  1L0Y B;  1YHA A;  3CAM A;  5NUC A;  1X65 A;  2DJG C;  1K9M C;  4DR2 L;  2NBF A;  2SNS A;  1D8L A;  1VQ8 A;  4OHJ A;  4KKU A;  4IFD J;  2F0J A;  3RLN A;  1S5B D;  2Z0S A;  3GTM H;  4EX5 A;  4TVA B;  4BY1 B;  4GLV B;  4CKB A;  4H44 C;  1ILP A;  2N8N A;  5C0X I;  2CWA A;  4OEL B;  5FLX E;  3HOY B;  3U50 C;  4Q0F A;  1KAA A;  5IOC A;  3S14 H;  3CMA A;  2AUJ D;  1K83 B;  2K7V A;  4ZK9 B;  4LF9 L;  4HTH A;  1HNW L;  1F9Q A;  3K8A A;  1XWE A;  4C1N I;  1JOR A;  2BE5 D;  3NQT A;  5M3F B;  1WTO A;  1A2U A;  1HZC A;  2RDG A;  3OTO L;  1B1Z A;  2JQO A;  1KNE A;  4B3T L;  3AB9 A;  1I4R A;  2KHJ A;  4J6H A;  3TBI B;  3GTG H;  3SHL A;  3J81 L;  3E6Z X;  4JI4 L;  2Z6K A;  3SE0 A;  4BS9 A;  2IHE A;  1IXR A;  2AWN A;  4RWS C;  4Q5V A;  3BJU A;  1O7L A;  3CP0 A;  1ASY A;  5E3F A;  1LTR D;  2A6H D;  2ENB A;  1S5E D;  3SR1 A;  4HJ5 A;  3FKI G;  2D5D A;  4IAL A;  5H1S E;  2VQE Q;  5EAY A;  1PTO F;  1ET9 A;  4JI0 Q;  4UPA A;  3UDI A;  5CV9 A;  1U4R A;  5IY0 A;  2JA5 H;  1KRS A;  2EJF C;  2B2W A;  3N52 A;  4KTA A;  2B2T C;  1YNN D;  1L0W A;  1CA5 A;  2F03 A;  3GTL B;  2XSC A;  1WCM G;  4BY1 H;  2ZJQ A;  1KDB A;  3GV3 A;  1YJN A;  3PF4 A;  1EZ8 A;  3NTI A;  5IGE A;  1F2Z A;  4KKS A;  1KDA A;  3KOJ A;  3TRE A;  4EVO A;  1YIJ A;  2JXM B;  1I94 L;  4A3K B;  4IN3 A;  1V1P A;  3RD4 A;  1JC7 A;  1OXV A;  3X3N A;  2NVX B;  1LT6 D;  1GOZ A;  3DM1 A;  1XXG A;  5LMN W;  2PI2 A;  2G5D A;  5J39 A;  5IYD H;  2OXP A;  4UAI A;  1TWF H;  5C5M A;  4DK6 C;  2HQE A;  4OEM B;  3SGI A;  1QZG A;  1RDP D;  3U9O A;  4YWM A;  1SMX A;  1JOO A;  2X6G A;  3S16 B;  1CZW A;  1Q12 A;  1XPU A;  2VQF L;  4DV6 Q;  3J81 j;  4BBS H;  3A8J E;  2IW3 A;  2Z6K C;  4KJN A;  3DEP A;  1B2T A;  1Q46 A;  2Q8R E;  1NR4 A;  2VQE L;  5KND A;  3VYU A;  2F0E A;  1MGS A;  4DV3 L;  5IWA Q;  3OPO A;  2CKZ B;  3KFU A;  2PO4 A;  1AW7 A;  2F3W A;  3UDG A;  1X3F A;  2A8V A;  3BVG A;  3FKI B;  2OQK A;  2EY2 A;  1HQR D;  2PYK A;  5LL6 S;  4NPS A;  1RJT A;  3M4O H;  4HJA A;  1EQV A;  5J1Z A;  1FL0 A;  4A3C H;  1SE2 A;  1V1O A;  1YEZ A;  4A3B H;  4K5W A;  2K28 A;  1HHV A;  2XRS D;  2WAQ B;  5D65 A;  1VQB A;  2E2J H;  2OWO A;  4YWL A;  2TMP A;  2B63 H;  4BBR H;  1BBU A;  2B2Y A;  1AE2 A;  1X54 A;  5DEH A;  1QUQ A;  2N3S A;  3GTO B;  3KJP A;  2NVY B;  5C3E G;  2K1B A;  1GD7 A;  1XNQ L;  2IT1 A;  2ES2 A;  4DXG A;  2R6G A;  1GVP A;  1QE6 A;  4APV A;  2PZW A;  3M3Y H;  1FD7 D;  3IFD A;  3A74 A;  1PRT D;  3GDE A;  5IP9 H;  2B39 A;  3S17 H;  3I4M G;  2WV6 D;  4BY7 H;  1JWM D;  4HCE A;  1PVO A;  2X69 A;  1LTA D;  5FJ8 H;  2RVL A;  4LUV A;  1Q8K A;  2NZO A;  2SNM A;  2ZTE A;  3RZO H;  4BBS B;  1KTK A;  5I6Y A;  2XRQ D;  2UXB L;  5EBC A;  3ND9 A;  1SLJ A;  4OWX B;  1HZA A;  5M5Y B;  3NE5 B;  3D6C A;  1CHP D;  5HUR A;  4QL5 A;  4GOP C;  4JI3 Q;  4CDC C;  1N36 Q;  1TWH B;  1IW7 D;  3CPF A;  1NTG A;  4L6T B;  3KBG A;  1Y1V H;  2DY8 A;  3W1G A;  5GAD C;  1EQR A;  1HTL D;  4JW0 A;  2F4I A;  5E1F A;  4C56 C;  1PFN A;  1QZH A;  2L55 A;  1QB5 D;  2OF1 A;  3T16 A;  4DV3 Q;  3FDT A;  3M4O B;  4UHV A;  1O7Y A;  1A3T A;  2QDB A;  4F87 A;  4GKK L;  1PDQ A;  1XNR Q;  3T13 A;  4IUN A;  1GUG A;  3EVQ A;  3I2Z A;  4GN3 B;  3D0F A;  4KD4 A;  2VQF Q;  1NCV A;  4DV6 L;  2F3I A;  1PYW D;  1TY2 A;  3C3L A;  5C4X B;  4HJ7 A;  3T1H Q;  4XTC S;  3NUC A;  5ELB A;  4NB3 A;  4LF4 Q;  3ULP A;  1NY4 A;  3I73 A;  4OO1 H;  2KVM A;  2VZA A;  1C0A A;  4YIJ A;  1YNJ D;  4GKJ Q;  3OW2 A;  5ELE A;  5I9P A;  2PNR C;  4WRD A;  4U68 A;  3M3Y B;  2V1C C;  1G91 A;  2JN4 A;  3J80 E;  3RNU A;  2J7Z A;  1Y1W G;  3J80 L;  2QEX A;  1SYB A;  3HOV H;  2F52 A;  2EYL A;  3M7G A;  3HG9 A;  4Y7N H;  1E2V A;  1ZYR D;  2K14 A;  4MZ9 A;  2IX1 A;  1QVF A;  3F2D A;  1H9J A;  1I4G A;  1B4O A;  1M90 C;  5EJW A;  5FJ8 G;  1G2S A;  3CXC A;  2HHH Q;  4KHZ A;  1TII D;  2GN5 A;  1CFM A;  5C0X G;  3CQZ H;  4TQU S;  1Z9F A;  1Y14 B;  4A3G G;  3PSI A;  4C3J B;  1IBM L;  1S40 A;  2FJ2 A;  1TWH H;  4HMJ A;  3LWE A;  1HUN A;  1CSQ A;  1X3Q A;  5ELF A;  4DFA A;  3P75 A;  1D5M C;  2HT1 A;  1PTO H;  1B9N A;  2ICE C;  4C3I B;  4JPB W;  4P71 A;  4TRD A;  4KY5 A;  1YHB A;  4DR5 Q;  3DUZ A;  2F0F A;  2IWH A;  3JAM L;  1LLR D;  4IFD I;  4KK7 A;  3N6R A;  3SK5 A;  3S1Q H;  1SYD A;  3GD7 A;  2Q8T A;  4JI5 Q;  1JJG A;  4DR6 Q;  3BDO A;  2JA5 B;  2JYO A;  4K6D A;  4BA2 I;  2ZM6 L;  4GS3 A;  1SYE A;  4X66 L;  4IFD H;  3Q0A A;  1B9M A;  3H09 A;  3KUP A;  3OW7 A;  4AH6 A;  3I90 A;  3LX0 A;  5LMU Q;  4L63 B;  1A62 A;  2WB1 E;  2RF4 A;  4FXG C;  4JK1 C;  2UXC Q;  1KNA A;  2RHS B;  4LFB Q;  4BXX H;  1GKH A;  3PO2 G;  4NW2 A;  3FRP B;  4R8I A;  4HIO A;  4RA8 A;  1HA5 A;  2LY7 A;  4Y7N B;  3TDQ A;  1CKN A;  1L2F A;  4A4I A;  1SSO A;  1QG7 A;  1S5F D;  1BVS A;  3VR5 A;  3T1Y Q;  1EL0 A;  3F8T A;  3J7A 5;  2F0D A;  2B2V C;  1HTP A;  2ZM6 Q;  1DOL A;  5C44 H;  3ONA B;  3D3R A;  1I4P A;  5E7N A;  1LAC A;  3Q22 A;  5BR8 L;  4FF3 A;  3OHX C;  5ELD A;  4LF7 L;  1VMP A;  3UI2 A;  4N8X 1;  4LF8 L;  1YNN C;  3Q24 A;  1PRT C;  1VS0 A;  1R9T B;  1PFM A;  3F1Z A;  1ICW A;  1Y1V B;  4C3I H;  3E9H A;  1G6P A;  2VY3 A;  1FGB D;  4J15 A;  2XGT A;  1VQO A;  1EWH A;  4RGO S;  3EFX D;  2JEB I;  2ZXO A;  5KYI A;  3S15 B;  1SE4 A;  4RFB A;  4OON A;  1SDF A;  3HOX G;  2F4V L;  3ERO A;  5JAV A;  3CCJ A;  1PH1 A;  2UXD L;  4Y52 H;  3MA2 B;  1LV9 A;  4RMF A;  1V9P A;  1VQH A;  3L7Z C;  4NMZ A;  4BBR B;  4A93 H;  3FMC A;  4XQQ A;  1MHW C;  2CH4 W;  1A6X A;  2A68 D;  4CDE C;  1KHI A;  3SXH A;  3TN2 A;  3C2P A;  3HGB A;  4L5S A;  2JA9 A;  2ZXP A;  2OTJ A;  4FF2 A;  1PH3 A;  1OXX K;  3K5L A;  4ZUI A;  3W1B A;  2VUM B;  1B70 B;  1F9S A;  4KN4 C;  2Z4H A;  4LFC Q;  3OMC A;  3QB3 A;  4AQY Q;  2D62 A;  2X6L A;  1PH4 A;  4JI6 Q;  2BH2 A;  2AMC B;  3E0E A;  4DV1 L;  4IPD A;  2F0V A;  2WKD A;  1I6H B;  5IGD A;  3F2B A;  1Q1E A;  3T4A C;  3EIV A;  3NBH A;  3AU7 A;  5ELC A;  5D3D A;  4GNX C;  1K73 C;  2KED A;  1HXY D;  3I55 A;  4A3M G;  4A3I B;  4ZLT F;  4A3F B;  2XIW A;  4RKB A;  1MD2 D;  4LAA A;  3M85 A;  5ELN A;  4DR3 L;  2EIF A;  1TWA H;  1II3 A;  2ICI A;  4HN7 A;  5I6W A;  3MFY A;  1WTV A;  4LF8 Q;  3VR4 A;  5ISR A;  3PO3 H;  2EDG A;  5D14 A;  4LUZ A;  1GUS A;  1K3R A;  4B08 A;  2R93 G;  4YHH Q;  3VR6 A;  2O5J C;  3MC0 B;  2EY5 A;  1YNJ C;  5K36 H;  1EFI D;  2IPK D;  4RGT A;  4DR6 L;  1EQT A;  2QCP X;  4IUR A;  2I46 A;  4DV2 Q;  2QEJ C;  3EA6 A;  5EPK A;  2HDM A;  1FNV A;  3ND8 A;  4CHT B;  5IGF A;  2LXJ A;  2JA8 B;  5IGC A;  2F0I A;  3S1R H;  2R93 B;  3K7U C;  1RTN A;  4RHR A;  4TSS A;  2YTY A;  3D31 A;  3PGZ A;  4A3J G;  1LT3 D;  3OMG A;  2WB1 B;  1DON A;  3H94 A;  1XMO L;  4YCV A;  2IY5 B;  1KD1 C;  4L5Q A;  3DMU A;  2CW0 C;  4XIG S;  1S4Z A;  3J81 c;  4A3K G;  1TS4 A;  1NE3 A;  4JYA L;  3HOW H;  1E1O A;  1JR0 D;  3A8K E;  1BBW A;  4FXD A;  1MJE A;  2AWO A;  1Q86 C;  5JVH 3;  4NP5 A;  2IJ0 A;  3K7A B;  2F1M A;  5M5X B;  2HUG A;  3U58 A;  3R93 A;  4MN3 A;  3CC7 A;  3RZO B;  4A3M H;  1TY0 A;  3PO2 H;  4YY3 L;  4OIJ A;  4A3L H;  4CDD C;  1EZ6 A;  2KHS A;  2L12 A;  5M3M B;  1D7Q A;  1IBL Q;  1FNU A;  2B2T A;  3CPW A;  4RH6 A;  5CV4 A;  3G4S A;  2MNA A;  1WJJ A;  2A74 C;  4ZCK A;  1I50 H;  4DNT B;  2KEC A;  3ER0 A;  1EY5 A;  3CW2 C;  5EKK A;  4IUU A;  3MEH A;  4DR1 L;  4QQB X;  1JIC A;  1MJC A;  2QGQ A;  4LF9 Q;  3P7J A;  5JEA H;  1EY6 A;  1VQ5 A;  4JI2 L;  1XTD A;  2L15 A;  3HKZ G;  3H0G B;  1HNZ Q;  4DV1 Q;  1SYC A;  2RQX A;  4RKL A;  2EYF A;  2P5Z X;  2D2C C;  3I4M B;  4AQY L;  3PQI A;  4DXF A;  1QJO A;  2EZV A;  1TXY A;  4DPG A;  3QG1 A;  1SBB B;  1QNK A;  3A5U A;  4JI4 Q;  5GAH C;  3G6E A;  3T53 B;  1JOK A;  3W3A A;  3F2C A;  4QCL A;  1J5E L;  3AFQ A;  3PIP 3;  1X3P A;  3OYY A;  2BOS A;  2A6H C;  2BA0 A;  3HOY G;  2N78 A;  4X65 L;  2VB3 X;  1AEX A;  2M9V A;  4DAV A;  2FHT A;  3NXW A;  1ZYR C;  4H0L C;  3T1H L;  1UE6 A;  3ITP A;  3HOZ G;  1SNM A;  1N9W A;  4OX9 Q;  3KBX A;  1ESF A;  2K5V A;  4RCN A;  4XDX A;  3DHQ A;  4RAU C;  5C6A A;  1XPR A;  1SFO B;  3PCO B;  2UUC L;  4GKK Q;  4DV5 L;  3O13 A;  1JOQ A;  2WIN B;  5CV6 A;  1JT8 A;  3RR5 A;  4F88 A;  2MO0 A;  3S1N H;  1BO0 A;  4A3F G;  2UUB Q;  4H7B A;  3LNN A;  3GTK H;  1B50 A;  1C8C A;  4B3S Q;  1JE4 A;  2EXD A;  4V0B A;  4JI1 L;  1IBK L;  2N88 A;  2UUA Q;  1PH8 A;  1IBL L;  1CUK A;  4DUZ Q;  1H9S B;  1KL9 A;  2Q2T A;  3S2H H;  4IOA A;  3ZYY X;  4DAP A;  2MHV A;  5A2Q L;  1N33 L;  4JC0 A;  1V8Q A;  2B2U C;  3G48 A;  4K8J A;  4FDB A;  3J81 i;  2ID0 A;  3J7Z C;  1U0L A;  4DAM A;  2M2L A;  4J8Q A;  2Q2U A;  1MBY A;  3MXG A;  1HR0 Q;  1L1O A;  3PUW A;  2EQS A;  1J9O A;  2PQE A;  5CV8 A;  4M1U B;  4WOR A;  2KA7 A;  4G57 A;  1Y1V G;  1HNW Q;  1SMY D;  5AJ3 L;  5F2D A;  5E4W C;  2I0Q A;  5IWA L;  3AFP A;  2JSO A;  1OTC A;  1WFQ A;  5IIF A;  4OWW B;  3KYH C;  2RKS A;  4A3E G;  2ZJP A;  1Y8O B;  5IYC G;  1UUP A;  4FP5 D;  1AE3 A;  1LT5 D;  2NTT A;  1BNZ A;  1HA6 A;  2PNH A;  1BDO A;  1CQF A;  5IP7 H;  3OWE B;  4V19 0;  4A75 A;  1K83 H;  1A8V A;  1HNX L;  5COR A;  1SNQ A;  1AN8 A;  2LXK A;  4O1N A;  3DWQ A;  2ZXR A;  1I4X A;  3IL8 A;  2DUD A;  5JJK A;  4ME5 A;  4X66 Q;  2V4D A;  4KMU C;  1AZQ A;  5M5X H;  1BOS A;  1SE8 A;  1E22 A;  1KDC A;  1VQ7 A;  1BCP C;  3HOU B;  2JA7 G;  4UDU C;  4P75 A;  5IGG A;  4JOI C;  1Y1W B;  1I94 Q;  2OEO A;  4POG A;  1DOM A;  3HOX H;  1ICF B;  2D0P A;  3GTJ B;  1W3S A;  1DGS A;  3TEH B;  4L5T A;  5BN5 A;  5E4X A;  1BXT A;  3R8B A;  4KY6 A;  1UNS A;  5KRU A;  3BVZ A;  1NMG A;  1VQK A;  5J22 A;  4B3M Q;  1F2L A;  3CC2 A;  1DOK A;  2A6E C;  4UP7 A;  4IUQ A;  1A3V A;  4JI1 Q;  1IBK Q;  3I8Z A;  4B3S L;  1N8R C;  1PH6 A;  1JB3 A;  3QR8 A;  3BU2 A;  2B29 A;  3ULL A;  3L3O C;  2SOB A;  3A5Z B;  3I4N G;  3H15 A;  5EQ0 A;  4DV5 Q;  2EJM A;  2JA6 H;  3OOC A;  4B3M L;  3H0G H;  1FGU A;  4CKC A;  4MIU A;  2Y0S B;  2AKW B;  1U4P A;  3VDY A;  5IP7 G;  4RG1 A;  1YHQ A;  3GTO H;  1X56 A;  2R93 H;  3HEJ A;  3STB C;  3J80 c;  1WI5 A;  3FEW X;  3RLO A;  4BA1 I;  4AIM A;  4DV7 L;  4G7H C;  1A63 A;  4A3E B;  1EIY B;  4X64 L;  3NEM A;  2BH8 A;  1YJ9 A;  3G6J B;  3OIQ A;  1RD9 D;  2RDF A;  1D5X C;  4KHP Q;  3R2I A;  1W6J A;  1OXS C;  1JJC B;  1GO3 E;  1BUV T;  2G9D A;  3HOZ B;  1EIH A;  5M3F H;  2NZH A;  5EBD A;  4LFB L;  2PQA B;  1VF5 C;  3DM3 A;  3FPP A;  1GUW A;  1VQN A;  2ZTD A;  3K7A H;  3S16 H;  1AP0 A;  4DK1 A;  3HOW G;  1GUN A;  1YIT A;  1Y1W H;  1CI3 M;  3HOX B;  3GV6 A;  3KF6 B;  3GTJ H;  2JEA I;  2LS0 1;  3C1E A;  3MXP A;  4WJ3 M;  3I56 A;  3RLF A;  2A5H A;  2CVR A;  2F0Q A;  1F2Y A;  4A3F H;  1WD0 A;  1PYS B;  3AMU A;  4GOP A;  1PMR A;  2KCN A;  4X3S A;  1IKL A;  4OX9 L;  1DZ1 A;  1K3B C;  2FMM A;  3S24 A;  4QB4 A;  4G7Z C;  3PO3 B;  2SDF A;  2L5T A;  1N32 L;  1PH9 A;  2KOL A;  4A3B B;  4PQX A;  1PV4 A;  2CQA A;  5C4X H;  4R9W A;  4KN7 C;  2HIV A;  1Q7Y C;  2KUM A;  4H02 A;  4JVZ A;  1I4H A;  1PXU A;  1DYQ A;  1BBX C;  2A73 B;  2B2V A;  3S1R B;  1YJW A;  2EY1 A;  5IT9 c;  2HHH L;  3G71 A;  1YVC A;  3KLR A;  3A55 A;  1PZK D;  4KY7 A;  3S1M H;  1EY7 A;  2Z8L A;  1Z6H A;  2F0N A;  1H9M A;  4JI0 L;  5C4Z A;  1J6Q A;  4JI2 Q;  3KF6 A;  2B2Y C;  2NUC A;  3CCE A;  3URY A;  4QIW E;  1SJE D;  3PUV A;  1VQD A;  5FK9 C;  2HDL A;  3H0G G;  3HKZ B;  3TSS A;  4ZYS A;  2E2H H;  2NVT H;  3K59 A;  1LTG D;  3K58 A;  3AQQ A;  3I4N H;  3IAY A;  3CF5 A;  4X3T A;  1UAP A;  5IOD A;  1PRT F;  4IQZ A;  2JA5 G;  2KCM A;  4LF4 L;  3HP3 A;  3K5O A;  2R7Z G;  1D2B A;  2C9O A;  4ZRZ A;  1D1K A;  5LHY 1;  3A7A B;  1LTS D;  4KV6 A;  4E6I A;  4M8A A;  5CMD A;  1Q81 C;  5EKI A;  1PLF A;  2PW5 A;  2UXD Q;  1V1Q A;  1EY0 A;  2VB2 X;  4JBK A;  3OWF A;  3ERS X;  5HY6 A;  5CR3 A;  1E7Z A;  3PUZ A;  4F8M A;  1HR0 W;  2JA7 H;  1TWC B;  3MAQ A;  4WJ4 A;  2JA8 G;  1OXU A;  2YYZ A;  3VA7 A;  2RCN A;  1UE7 A;  2TSS A;  3OIP A;  2R92 G;  3A8I E;  2Y0S G;  4JOI A;  1D1I A;  4DK3 C;  3IRB A;  1SEB D;  4IUT A;  2NB0 A;  1KC8 C;  4X65 Q;  4LW1 A;  4K0K L;  4KJO A;  1J8I A;  2F0P A;  1PH2 A;  3WDN A;  1WTR A;  3S1M B;  4X64 Q;  3I4M H;  4BY7 G;  1PZI D;  2MQH A;  5IYB G;  3CRL C;  3VR2 A;  2BA1 A;  1K8A C;  3BZD B;  1G8Z D;  3I7F A;  5FO8 B;  3SVM A;  1EYG A;  2K05 A;  1E3P A;  2DNC A;  3CCM A;  4XYQ A;  3H3V I;  1UEB A;  1A3U A;  4Z9C B;  4YCW A;  1RTO A;  4KD3 A;  3W2D A;  1VQ6 A;  4JYA Q;  4C2M B;  1YI2 A;  1A15 A;  1SYG A;  3CCS A;  5C4H A;  5C4X G;  2AQ1 B;  3W5O A;  2HQL A;  3K57 A;  2NWG A;  2ZJR A;  2E2I H;  3MZ5 A;  3U9S A;  3IKJ A;  1FR3 A;  3RN2 A;  2EYH A;  4C3J H;  1QWY A;  3UDF A;  1G29 1;  3D6W A;  5C3X A;  2EYJ A;  1F9R A;  3EBE A;  5M5Y H;  4X6A H;  1K8M A;  1QNU A;  2RDH A;  2QIL A;  3Q23 A;  4GNX B;  4X3K A;  1JCK B;  1O80 A;  2XWJ B;  4YCU A;  2Q8I B;  3G7L A;  4PG3 A;  5AJ3 Q;  1EFW A;  3TS2 A;  2VXW A;  1W2B A;  4C3H H;  1EWC A;  2K50 A;  2E8G A;  1QVC A;  4OWT B;  3VA5 A;  3CCV A;  1VQM A;  3WWV A;  3KLS X;  2LKV A;  4FF4 A;  1S5C D;  4K5V A;  3BVM A;  2Z4I A;  2DY7 A;  5I4D A;  3T1Y L;  3HOU G;  3TZD A;  2VW9 A;  2HCC A;  4HSP A;  2JA6 B;  2F0U A;  5JVG 3;  1LT4 D;  1HZB A;  3L2P A;  1IYU A;  2L9H A;  2ZTC A;  1K0R A;  1VMC A;  2NYZ D;  5C4J B;  4X62 Q;  1SR3 A;  1HUM A;  2KHI A;  5HGQ A;  1U4M A;  4LWC A;  2UXC L;  2DJF C;  2J0T D;  2VS1 A;  1PHJ A;  4POF A;  3J7A V;  1Q3L A;  1GJX A;  2PMZ E;  2JP1 A;  1XNR L;  5LMN L;  4DR4 Q;  1PYB A;  4IOC A;  2AQ3 B;  5TSS A;  4F7X A;  2M00 A;  4G7O C;  3UE1 A;  4EQ5 A;  1KQS A;  1KAB A;  2WB1 G;  3TZU A;  5DNF A;  2PZT A;  4LFC L;  1LTT D;  2E5L Q;  1SYF A;  3NQI A;  2QF7 A;  2PQA A;  1HR0 L;  3CME A;  2WAQ G;  4KHV A;  1WVL A;  1QIL A;  1SNO A;  2RHQ B;  4CJ0 B;  4DKA C;  1HQM C;  2XVS A;  4R4C A;  4DUZ L;  5C3W A;  4UP8 A;  2YTV A;  3GP7 A;  3NWT A;  3CCR A;  2BDN A;  4B3T Q;  1TT2 A;  4O0A A;  2Q2I A;  1XPO A;  2UUB L;  1SE3 A;  5M3F G;  1MSG A;  2E5L L;  1EY9 A;  3TQY A;  4P74 A;  3AYH B;  3STB D;  1Q90 A;  1F9P A;  3SDZ A;  2K52 A;  3RMH A;  1H9K A;  2H1E A;  4I7A A;  1EOV A;  5EPJ A;  1MKH A;  2F0O A;  2K03 A;  4QUC A;  1PFS A;  4JG2 A;  4A3J B;  1FJG Q;  3GTP B;  2RBM A;  1IBM Q;  4R4Q A;  1R4Q B;  1IL8 A;  1XJV A;  2Z6B A;  1XMQ L;  2F0M A;  4HCS A;  3GTM B;  3MXN B;  2UXB Q;  5FO7 B;  4I65 A;  4N9T A;  1EYD A;  5GRO A;  1EU4 A;  2K01 A;  2WP8 J;  5L37 A;  2YV5 A;  3QIA A;  3KDF A;  4HSV A;  1VQC A;  2NVX H;  4IJL A;  1Z47 A;  4A3E H;  5M3M G;  1LAB A;  4CJ2 C;  1K8O A;  4C3J G;  1PH5 A;  3CRK C;  1WTX A;  2XN9 C;  1WTP A;  5M9O A;  1C9O A;  2L4N A;  2HCI A;  1FYC A;  2O2L D;  2NVT B;  1R4P B;  3BYT B;  1STY A;  4DR1 Q;  1EU3 A;  3JC6 6;  1FNW A;  1ZEQ X;  4BBR G;  4QGU A;  3A56 A;  2GVA A;  3QWN A;  4LFA L;  4NXM Q;  3H3V C;  1MI2 A;  1XMO Q;  2B2W C;  2L11 A;  3CQZ B;  5JPN C;  2IX0 A;  2R7F A;  1CTM A;  4GNX A;  5LMU L;  1R9T H;  4DGZ A;  4J1M A;  2Q2H A;  1D5Z C;  5CV7 A;  1KLU D;  1SNP A;  3D4R A;  5DLQ E;  4KLK A;  1H9R A;  2F0H A;  1B44 D;  4UY8 C;  4BXX G;  2MO1 A;  2JA7 B;  3DXJ C;  3HRZ C;  1VQE A;  2WAC A;  4DV7 Q;  2MP1 A;  3HS0 C;  3ERQ A;  1N34 L;  1PTO D;  2F0S A;  3P20 A;  5D3I B;  5CBE E;  5IE8 A;  3GTL H;  3HOV G;  2WFW A;  2XTI A;  4IFD G;  3X3M A;  3J7Y W;  2K5H A;  2JA8 H;  3PMF A;  2B8F A;  2NVY H;  3BG3 A;  1BR9 A;  4HED A;  2F0T A;  1IL2 A;  4HAE A;  2RA4 A;  4DV4 L;  1RF2 D;  4P2C B;  3RZD H;  4N8F A;  5FLM G;  1S5D D;  3LGJ A;  3KDF B;  1V1P B;  2EYO A;  2KQ3 A;  5J3B A;  1I3Q H;  2MUY A;  2ALY B;  1FJG L;  2N49 A;  3NEN A;  2L0C A;  4DNI A;  1Y69 U;  3GTQ B;  4DK0 A;  4BY7 B;  3MXN A;  1VQ9 A;  4FF1 A;  1OXT A;  1BF4 A;  5IYB H;  1MSH A;  1SXT A;  3T56 B;  5JEA G;  4NXN L;  4DUY Q;  2JJQ A;  3HKS A;  2IX3 A;  2ASB A;  3KJO A;  1SFO H;  1N36 L;  2E2I B;  2O4X A;  1CKN B;  3Q8D A;  4DR2 Q;  3PO2 B;  4JBM A;  1E24 A;  3E5S A;  1T5X D;  4I7Z C;  4LF5 Q;  3S1N B;  2RSN A;  3NTH A;  4ZQ3 A;  4G4K A;  1A2T A;  1X55 A;  4K8I A;  1ZXT A;  3GTK B;  1JWS D;  2MPM A;  4ZKB B;  5M3M H;  2UU9 L;  1XMQ Q;  1HFN A;  4EQP A;  4DR3 Q;  1ILQ A;  1B8A A;  3UDX A;  4PNY A;  2GA4 B;  3TP5 A;  2R3Z A;  3H3V H;  3A54 A;  5CC4 A;  2MGS A;  1VQ4 A;  1CM9 A;  4L5R C;  4A3L G;  1I50 B;  2A69 C;  5C5L A;  2UUC Q;  1GUO A;  2FXQ A;  1DM0 B;  2PMZ B;  4AYB G;  1E0B A;  2I07 B;  3S15 H;  1EY8 A;  1TWC H;  2A1A A;  4HMI A;  4NKL A;  4A3D G;  4A3D B;  5K36 G;  1NSN S;  3KLS A;  2ZT9 C;  4HID A;  1I5F A;  1CK1 A;  1ET6 A;  3NSW A;  1UWV A;  4LUO A;  4LMQ D;  5GQO A;  4JI6 L;  3BS1 A;  1SRU A;  3PIO A;  2WKC A;  3ICE A;  4A93 B;  1EYC A;  1LM0 A;  1CHQ D;  3NTK A;  4U67 3;  3KF8 A;  1BQQ T;  1I3Q B;  5M5W H;  4GKJ L;  1SJH D;  1B3Q A;  1TWG B;  3I3C A;  5CBA E;  1PH7 A;  1FVI A;  1Y8N B;  3HOV B;  1BKB A;  3SK8 A;  2RCF A;  4KKT A;  1TR5 A;  2IHF A;  5C3E B;  2B63 G;  3TME A;  3S14 B;  1N34 Q;  2JE6 I;  2VUM H;  3A0J A;  1SNC A;  5HGT A;  2CH4 A;  3NBI A;  1TWF B;  3IFT A;  2FMC A;  4C2M H;  1RIP A;  1GHK A;  5CYU A;  4TKO B;  1SAP A;  3HZX A;  2F0K A;  1B7Y B;  4XQN A;  1SND A;  4PV1 C;  4JI8 L;  2EYM A;  1G2T A;  3VYS A;  2K75 A;  4ULL A;  1BCP F;  2PZU A;  1CT1 D;  4FVM A;  3V2T A;  2K5W A;  2MFI A;  1ONL A;  3CCU A;  2AHO B;  2HD3 A;  3M4Q A;  3SK4 A;  1P16 A;  3BYY B;  2NZ1 D;  4C3H B;  1NJI C;  1HZ9 A;  5BR8 Q;  3FP9 A;  1X3G A;  1VCI A;  5I9O A;  4LF7 Q;  1B3A A;  5FLX c;  5IT9 L;  1V43 A;  4A3J H;  1E2Z A;  4CBV A;  1G51 A;  5KGU A;  4GN4 B;  1Q8I A;  1HNZ L;  4BBS G;  4WJW A;  3CD6 A;  4A3C G;  1EIG A;  1STH A;  2KCT A;  3RZD B;  1JQY D;  4RGN A;  1GUT A;  5JJL A;  4HJ8 A;  2PCF B;  2YU9 B;  2DNE A;  3PIO 3;  1L1O C;  1XTC D;  3A7L A;  2NN6 G;  1PFB A;  3J7A F;  4X62 L;  2R61 A;  4GLX A;  2BCO A;  1QCB D;  3PF5 A;  3NPP A;  2RSO A;  4DR7 L;  4S3S A;  2K6A A;  3S2D B;  4XT1 B;  5ELO A;  1WCM B;  3RN5 A;  1CZG A;  2QKI C;  3HOW B;  1WTQ A;  1TU2 B;  3KK7 A;  5KEE A;  5T1I A;  4HIM A;  1H95 A;  4O2D A;  4ALP A;  1E2W A;  3E0J A;  4JI5 L;  4DR5 L;  4KI0 A;  4UP9 A;  5FLM H;  3K6O A;  5G3L F;  1RL2 A;  2C35 B;  1RKN A;  1N33 Q;  3NEL A;  4ILW A;  1T9H A;  1O78 A;  1VF7 A;  4DAY B;  5IYD G;  3PUY A;  2A68 C;  3QOL A;  1P8L A;  5KNB A;  4C3I G;  1SMY C;  3DLL A;  1VQP A;  4DNR B;  1RCV D;  1X9N A;  2DN8 A;  2FIN B;  1GXD C;  1EEF D;  1STE A;  1QUQ B;  5K5P A;  3M4P A;  3FKI H;  4JI8 Q;  1HCZ A;  3S1Q B;  4FXK C;  1YBY A;  3I4O A;  2DGY A;  4A3G B;  2HIX A;  2PPB C;  4K14 A;  5JEA J;  4NDX A;  3C46 A;  2OCE A;  3PIP A;  1MIU A;  4CDF C;  5IT9 E;  3GTP H;  4FNF A;  4CJ1 B;  4DR4 L;  4OGQ C;  1KXL A;  1SRO A;  1EOT A;  5FKA C;  2F0G A;  4K2L A;  4L8J A;  1F2M A;  1WTH A;  4QJF A;  5COY A;  1Q82 C;  2E2J B;  5EKL A;  1X3E A;  1JJ2 A;  3JAM E;  4JI3 L;  5IGB A;  1B53 A;  2EOT A;  1J5E Q;  3QOJ A;  5M5W B;  1LTI D;  1TWG H;  2PW7 A;  3D4W A;  2NVQ H;  3MTS A;  1BCP B;  3HKZ E;  4QMG A;  4ZKC B;  4LJZ C;  3DWA A;  4YWK A;  2KJX A;  3SK6 A;  3GTQ H;  5LL6 X;  4AYB E;  4IPG A;  1L1O B;  1TVX A;  3I70 A;  3L9A X;  3HOZ H;  4OL7 A;  5JOB A;  1LTL A;  1HJP A;  4B9X A;  3CU7 A;  1QOH A;  1VQL A;  1VDZ A;  5C44 B;  4K6L A;  5LMN Q;  2R92 B;  4QF4 A;  5JJZ A;  4A3I H;  1ML0 D;  2VNU D;  1U5K A;  2PI2 E;  2LFN A;  4PZ8 A;  1XX8 A;  4GZY C;  1STB A;  1CKO A;  2F4V Q;  1T5E A;  3E9I A;  4N9P A;  1UE1 A;  2B2U A;  2E2D C;  1IYJ B;  4K5X A;  3U4V A;  2K4K A;  1STA A;  1Z7T A;  4HIK A;  1PZJ D;  3BZC A;  4FYD A;  1PTO B;  3BDC A;  1YNX A;  5FO9 B;  1E1T A;  2K32 A;  4B9W A;  2Y0S E;  2G9H D;  2NN6 I;  1N32 Q;  4MTN A;  1HPC A;  4R4T A;  4YY3 Q;  4LF5 L;  3S2H B;  2IL8 A;  4RGM A;  2CW0 D;  4A3D H;  2C5C A;  1WTW A;  1EEI D;  4XXE A;  3FHW A;  2I5L X;  1UE5 A;  1VQI A;  1VQG A;  4DUY L;  1DCZ A;  4NXN Q;  1IYV A;  2KEN A;  1C48 A;  5T1G A;  2AUK A;  1EQQ A;  1IW7 C;  4OIK A;  2D9U A;  3ZJY C;  4OXP A;  3ULJ A;  3S9W A;  2YU9 H;  1WYD A;  3KF8 B;  4EGV A;  1EWI A;  1EYA A;  3B6Y A;  1IZ6 A;  1HNX Q;  3MHB A;  4IZ8 A;  4K0K Q;  2XWB B;  3FVQ A;  3MXU A;  4OO1 G;  1TS5 A;  2N55 A;  2L1B A;  1WCM H;  4BWG B;  5IP9 G;  3GQB A;  1RHP A;  3CCQ A;  1I6H H;  4IJH A;  4FO2 A;  3GTG B;  2BDO A;  4O42 A;  1DD2 A;  5KNC A;  4A3M B;  3SEB A;  1I6V C;  4WFN 3;  2E76 C;  3R2T A;  4DV2 L;  4ZAI A;  2E75 C;  2F0L A;  5DM7 3;  2CHB D;  4ABN A;  5GAE C;  1IHZ A;  4RHS A;  3R3O A;  1KLG D;  2EY6 A;  2I5H A;  4DAY A;  4LF6 Q;  4IUV A;  3EJI A;  4R4I A;  2MJ8 A;  2EXZ A;  2VUM G;  3MWY W;  2B8G A;  4LFA Q;  3TP6 A;  4EQO A;  3CC4 A;  4NXM L;  1U9R A;  3C1F A;  1ZKO A;  2F3V A;  3NK9 A;  3FPU B;  4C1N K;  4XQJ A;  1K0S A;  4IUP A;  1AH9 A;  2JA6 G;  5C44 G;  3TS0 A;  4C3H G;  1S72 A;  2EE1 A;  4QUF A;  5I2Y A;  3JAM c;  5I2X A;  3M4Y A;  4P73 A;  2AQ2 B;  2LSS A;  1CQV A;  3E3X A;  3DEO A;  4P72 A;  4EQN A;  4B3R Q;  3P1H A;  2QA4 A;  4DV0 Q;  2A6E D;  1TS3 A;  1QVG A;  2NVQ B;  4A3K H;  3I4L A;  1CKM A;  2R7Z B;  1JMC A;  1NUC A;  1CSP A;  1ENA A;  1PRT B;  1F77 A;  4QIW B;  2NTS A;  5C0X H;  5BN3 A;  3WOF A;  5KYL A;  1LYL A;  5C3E H;  4RCO A;  3QO2 A;  4JBW A;  4JCV E;  3TP8 A;  2O5I C;  5GAG C;  1NNX A;  3F2U A;  1GHJ A;  4B3R L;  1W6K A;  2E2H B;  3LWU A;  4MTK A;  2OT2 A;  3I4N B;  4DA2 A;  4PZ6 A;  4H13 C;  4JV5 L;  5A35 A;  1JB7 A;  4HR7 B;  1L0X B;  3JAM i;  4PMB A;  3UE0 A;  1VQJ A;  3K0Y A;  2F0W A;  1UEA B;  1KAW A;  1H9S A;  3WOE A;  2H5X A;  5EGT A;  3KLW A;  4ZUJ A;  3VR3 A;  4IPC A;  5DM6 3;  1G6Z A;  2BE5 C;  1DJR D;  1TWA B;  1K8G A;  1S3O A;  2CWP A;  3M9B A;  3D4D A;  2LMC B;  3MFG A;  4GOP B;  3PO3 G;  1KIX A;  5AFW A;  4ID6 A;  4JI7 L;  4R1J A;  3V05 A;  3CKI B;  4DN4 M;  4LF6 L;  3TRZ A;  2ATW A;  2K5Q A; 
#chains in the Genus database with same CATH homology
 1GM5 A;  3L0O A;  5IYB H;  2K14 A;  3A5Z B;  2UUA L;  4A3G H;  4MZ9 A;  2IX1 A;  3I4N G;  1QVF A;  3H15 A;  3F2D A;  4DV5 Q;  5JEA G;  5FJ8 G;  1M90 C;  2JA6 H;  3OTO Q;  4NXN L;  4DUY Q;  2JJQ A;  3CXC A;  3H0G H;  1FGU A;  3HKS A;  2HHH Q;  4B3M L;  4KHZ A;  2GN5 A;  2ASB A;  3KJO A;  2AKW B;  5C0X G;  1SFO H;  1HH2 P;  3CQZ H;  4GN5 A;  4TQU S;  4RG1 A;  5IP7 G;  4DV0 L;  1Z9F A;  3VDY A;  1CKN B;  1Y14 B;  3Q8D A;  3PSI A;  4DR2 Q;  1N36 L;  4A3G G;  1X56 A;  2R93 H;  4JBM A;  1E24 A;  4JBJ A;  2K5N A;  3STB C;  3J80 c;  1S40 A;  1LUZ A;  1IBM L;  1WI5 A;  4LF5 Q;  1TWH H;  1M1K C;  1X55 A;  4DR7 Q;  1A0I A;  1CSQ A;  3RLO A;  4BA1 I;  4AIM A;  2UU9 L;  5M3M H;  4DV7 L;  1XMQ Q;  2R7Z H;  4DR3 Q;  4HJ9 A;  4A93 G;  3BU2 A;  1X6O A;  1B8A A;  3UDX A;  1A63 A;  1WOC A;  2JK8 A;  3H3V H;  1EIY B;  4X64 L;  2GVB A;  3NEM A;  1VQ4 A;  2HT1 A;  3HOY H;  5JJI A;  2BH8 A;  1YJ9 A;  4L5R C;  1XNQ Q;  4A3L G;  4QY7 A;  4P71 A;  1YHB A;  4DR5 Q;  2UUC Q;  1VQF A;  4KHP Q;  2CQO A;  3M7N A;  2FXQ A;  4AYB G;  4MNO A;  1OXS C;  1JJC B;  1GO3 E;  4IO9 A;  3S15 H;  1TWC H;  4A3I G;  2A1A A;  3S1Q H;  4A3D G;  4IFD I;  5K36 G;  3GD7 A;  4BY1 G;  4JI5 Q;  1VQA A;  5M3F H;  2NZH A;  4DR6 Q;  3S2D H;  4LFB L;  1JJG A;  4BA2 I;  3GO5 A;  4HID A;  2PQA B;  2ZM6 L;  1I5F A;  3BZK A;  3DM3 A;  4GS3 A;  4YHH L;  1C7Y A;  1VQN A;  2ZTD A;  4X66 L;  1SN8 A;  1UWV A;  1PA6 A;  3K7A H;  2R92 H;  4AH6 A;  3S16 H;  4LUO A;  3NBH B;  3HOW G;  1YZ6 A;  5GQO A;  1YIT A;  1Y1W H;  4JI6 L;  1SRU A;  5LMU Q;  4JI7 Q;  2A19 A;  3KF6 B;  3PIO A;  3GTJ H;  3ICE A;  2JEA I;  1O7I A;  2CFM A;  4WJ3 M;  1LM0 A;  1A62 A;  3I56 A;  3RLF A;  2WB1 E;  2RF4 A;  4A3F H;  2UXC Q;  4LNQ A;  2RHS B;  1PYS B;  4LFB Q;  4BXX H;  1GKH A;  4GOP A;  5M5W H;  3PO2 G;  4GKJ L;  1KRT A;  4OX9 L;  3K80 C;  1PH7 A;  1FVI A;  4HIO A;  3S24 A;  3K81 C;  1BKB A;  2B63 G;  3MEF A;  2I5M X;  2IHF A;  1N34 Q;  2JE6 I;  2VUM H;  1CKN A;  1L2F A;  4ME3 A;  4A4I A;  1N32 L;  3A0J A;  1PH9 A;  4JV5 Q;  1BVS A;  4C2M H;  1RIP A;  3T1Y Q;  2R7D A;  3F8T A;  2UU9 Q;  3J7A 5;  1PV4 A;  5C4X H;  2ZM6 Q;  4PMW A;  1B7Y B;  2HIV A;  4DV4 Q;  1Q7Y C;  5C44 H;  3PUX A;  5E7N A;  4JI8 L;  2D0O A;  4H02 A;  2KBN A;  2K75 A;  1EIF A;  5BR8 L;  4IPH A;  4KHP L;  4LF7 L;  1YJW A;  2HHH L;  5IT9 c;  3G71 A;  1YVC A;  5C4J H;  2MFI A;  4LF8 L;  1VS0 A;  2YTX A;  3S1M H;  2VL6 A;  5IYC H;  3F1Z A;  3CCU A;  2AHO B;  1JE5 A;  4C3I H;  3M4Q A;  4JI0 L;  1Q1B A;  1P16 A;  3E9H A;  1G6P A;  1J6Q A;  2VY3 A;  4JI2 Q;  3KF6 A;  4J15 A;  2XGT A;  1VQO A;  1NJI C;  1HZ9 A;  3CCE A;  2OTL A;  1NMF A;  2JEB I;  3FP9 A;  5BR8 Q;  3PV0 A;  1X3G A;  4QIW E;  1VCI A;  1ASZ A;  4LF7 Q;  3PUV A;  4OON A;  1VQD A;  5FLX c;  3HOX G;  3H0G G;  2F4V L;  2E2H H;  1V43 A;  2NVT H;  3CCJ A;  3K0X A;  4A3J H;  4R4O A;  3AQQ A;  1PH1 A;  3CCL A;  3I4N H;  2UXD L;  3CF5 A;  1G51 A;  4Y52 H;  4RMF A;  1V9P A;  2JA5 G;  3HOU H;  2KCM A;  1VQH A;  3L7Z C;  4GN4 B;  4LF4 L;  1HNZ L;  4A3B G;  4A93 H;  4BBS G;  2R7Z G;  3CD6 A;  4A3C G;  3HFZ B;  1KHI A;  2KCT A;  3EN2 A;  4A76 A;  1EUJ A;  4PZ7 A;  1Q81 C;  4OO1 I;  5JJL A;  4HJ8 A;  4L5S A;  2JA9 A;  5C0X J;  2OTJ A;  3J80 i;  1PH3 A;  1L1O C;  2OQ0 A;  3AEV A;  2UXD Q;  1OXX K;  1V1Q A;  2NN6 G;  2CCZ A;  1OXT A;  4GLA C;  4X62 L;  4JBK A;  2WAQ E;  2B3G A;  3ERS X;  3W1B A;  1B70 B;  5HY6 A;  1E7Z A;  1NBW A;  4LFC Q;  3PUZ A;  3U4Z A;  4GLX A;  1HR0 W;  2JA7 H;  1YHA A;  3CAM A;  3PF5 A;  1X65 A;  4AQY Q;  2D62 A;  2JA8 G;  4DR7 L;  4WJ4 A;  1OXU A;  2YYZ A;  2RCN A;  1UE7 A;  5ELO A;  3RN5 A;  1PH4 A;  4JI6 Q;  2AMC B;  3E0E A;  4DV1 L;  4IPD A;  1K9M C;  2BH2 A;  2R92 G;  2Y0S G;  4DR2 L;  4JOI A;  4DK3 C;  3F2B A;  1D8L A;  1Q1E A;  3IRB A;  1VQ8 A;  4IFD J;  1KC8 C;  3RLN A;  3EIV A;  4HIM A;  1H95 A;  4X65 Q;  4LW1 A;  4O2D A;  4K0K L;  4ALP A;  4JI5 L;  4DR5 L;  4KI0 A;  2Z0S A;  4UP9 A;  4GNX C;  1K73 C;  1PH2 A;  5FLM H;  3GTM H;  4EX5 A;  4TVA B;  3I55 A;  4A3M G;  4GLV B;  1RL2 A;  4X64 Q;  2C35 B;  1N33 Q;  3I4M H;  4BY7 G;  3NEL A;  2MQH A;  5IYB G;  1T9H A;  2N8N A;  5C0X I;  3M85 A;  5ELN A;  2BA1 A;  2CWA A;  4DAY B;  5IYD G;  4DR3 L;  1K8A C;  2EIF A;  3PUY A;  1TWA H;  1P8L A;  3I7F A;  1EYG A;  1E3P A;  3DLL A;  3CCM A;  3U50 C;  1VQP A;  1X9N A;  3H3V I;  1UEB A;  4LF8 Q;  3S14 H;  3PO3 H;  4YCW A;  4LUZ A;  3CMA A;  1K3R A;  1QUQ B;  1VQ6 A;  2R93 G;  4LF9 L;  4YHH Q;  1HNW L;  3M4P A;  3K8A A;  4JYA Q;  3FKI H;  4JI8 Q;  1YI2 A;  1YBY A;  3I4O A;  2DGY A;  4DR6 L;  2HIX A;  3CCS A;  4DV2 Q;  5JEA J;  5C4X G;  2OCE A;  3PIP A;  1HZC A;  1MIU A;  3OTO L;  3GTP H;  2JQO A;  4B3T L;  2LXJ A;  3W5O A;  3GTG H;  2KHJ A;  4DR4 L;  1SRO A;  1KXL A;  4QJF A;  1Q82 C;  2HQL A;  2ZJR A;  2E2I H;  3S1R H;  4JI4 L;  2Z6K A;  3RN2 A;  4C3J H;  1X3E A;  1JJ2 A;  3K7U C;  3UDF A;  1G29 1;  3EBE A;  5M5Y H;  4X6A H;  2IHE A;  4JI3 L;  1IXR A;  2AWN A;  2YTY A;  3D31 A;  3PGZ A;  4A3J G;  1J5E Q;  4GNX B;  3BJU A;  3CP0 A;  4YCU A;  1ASY A;  1TWG H;  5AJ3 Q;  4PG3 A;  4YCV A;  1XMO L;  1EFW A;  2NVQ H;  1W2B A;  3TS2 A;  4C3H H;  2K50 A;  2E8G A;  1QVC A;  4OWT B;  3HKZ E;  3CCV A;  1VQM A;  3WWV A;  4HJ5 A;  3FKI G;  2IY5 B;  1KD1 C;  4L5Q A;  4XIG S;  5H1S E;  2VQE Q;  5EAY A;  4YWK A;  3GTQ H;  3J81 c;  4JI0 Q;  4AYB E;  4IPG A;  4A3K G;  1L1O B;  1NE3 A;  4UPA A;  3UDI A;  4JYA L;  3HOW H;  1E1O A;  5IY0 A;  1BBW A;  3HOZ H;  3T1Y L;  1LTL A;  1MJE A;  1HJP A;  2AWO A;  1Q86 C;  2JA5 H;  3HOU G;  1KRS A;  1VQL A;  2VW9 A;  1L0W A;  1HZB A;  1WCM G;  5LMN Q;  4BY1 H;  2ZJQ A;  3U58 A;  3L2P A;  4A3I H;  2ZTC A;  3CC7 A;  2VNU D;  1U5K A;  4A3M H;  1YJN A;  2PI2 E;  4PZ8 A;  1VQ9 A;  3PF4 A;  1K0R A;  3PO2 H;  4X62 Q;  1SR3 A;  4YY3 L;  1CKO A;  2F4V Q;  3E9I A;  2KHI A;  5HGQ A;  4A3L H;  4LWC A;  1UE1 A;  2UXC L;  1IYJ B;  3KOJ A;  3TRE A;  1YIJ A;  3U4V A;  1D7Q A;  2VS1 A;  2K4K A;  1PHJ A;  1IBL Q;  4POF A;  3CPW A;  1I94 L;  4HIK A;  2PMZ E;  3BZC A;  1XNR L;  3G4S A;  2MNA A;  1OXV A;  5LMN L;  4DR4 Q;  1WJJ A;  1YNX A;  1PYB A;  1I50 H;  4IOC A;  1E1T A;  5LMN W;  5IYD H;  2PI2 A;  2Y0S E;  3ER0 A;  2NN6 I;  3CW2 C;  3UE1 A;  1N32 Q;  4EQ5 A;  4MTN A;  1KQS A;  4R4T A;  4YY3 Q;  4LF5 L;  4DR1 L;  1TWF H;  2WB1 G;  4A3D H;  4QQB X;  4DK6 C;  1MJC A;  2QGQ A;  3FHW A;  4LFC L;  3SGI A;  2I5L X;  1QZG A;  2E5L Q;  4LF9 Q;  2PQA A;  1UE5 A;  1HR0 L;  1VQI A;  1VQ5 A;  4YWM A;  1VQG A;  1SMX A;  3CME A;  4JI2 L;  2WAQ G;  1XTD A;  2RHQ B;  4DUY L;  4NXN Q;  2L15 A;  4DKA C;  3HKZ G;  2KEN A;  4R4C A;  1HNZ Q;  4DV1 Q;  4DUZ L;  1EQQ A;  1Q12 A;  4UP8 A;  2YTV A;  1XPU A;  2VQF L;  4DV6 Q;  3J81 j;  4BBS H;  4AQY L;  3ZJY C;  3CCR A;  4OXP A;  2Z6K C;  3ULJ A;  4B3T Q;  4O0A A;  2YU9 H;  1TXY A;  2Q2I A;  4DPG A;  1XPO A;  1Q46 A;  1WYD A;  2UUB L;  3KF8 B;  2VQE L;  5M3F G;  3A5U A;  1EWI A;  2E5L L;  4JI4 Q;  3B6Y A;  1IZ6 A;  5GAH C;  3TQY A;  4P74 A;  5IWA Q;  4DV3 L;  1HNX Q;  3G6E A;  4K0K Q;  2CKZ B;  3AYH B;  3STB D;  3KFU A;  4OO1 G;  2K52 A;  3UDG A;  1X3F A;  3F2C A;  1J5E L;  3AFQ A;  2A8V A;  2OQK A;  3OYY A;  3GTO H;  1EOV A;  1MKH A;  2BA0 A;  3HOY G;  2N78 A;  4NPS A;  1WCM H;  4X65 L;  3M4O H;  4HJA A;  5IP9 G;  1PFS A;  4JG2 A;  4A3C H;  1FL0 A;  3CCQ A;  1FJG Q;  1I6H H;  1YEZ A;  4A3B H;  4IJH A;  1IBM Q;  4R4Q A;  3T1H L;  1UE6 A;  3HOZ G;  4OX9 Q;  1N9W A;  1VQB A;  1XJV A;  2E2J H;  2OWO A;  4YWL A;  2K5V A;  1XMQ L;  4BBR H;  2B63 H;  1BBU A;  3MXN B;  4DV2 L;  1XPR A;  1AE2 A;  1X54 A;  1QUQ A;  2UXB Q;  2N3S A;  3PCO B;  3KJP A;  2UUC L;  4GKK Q;  5C3E G;  4DV5 L;  5GRO A;  5GAE C;  1GD7 A;  2WP8 J;  3RR5 A;  2IT1 A;  2MO0 A;  2ES2 A;  1XNQ L;  3S1N H;  4A3F G;  1JT8 A;  2UUB Q;  2YV5 A;  2R6G A;  3GTK H;  3KDF A;  1VQC A;  1GVP A;  2I5H A;  2NVX H;  4B3S Q;  4LF6 Q;  4APV A;  4IJL A;  1Z47 A;  2EXD A;  4JI1 L;  4R4I A;  5M3M G;  4A3E H;  1IBK L;  2UUA Q;  3M3Y H;  1PH8 A;  1PH5 A;  1IBL L;  1CUK A;  4DUZ Q;  4LFA Q;  4NXM L;  1KL9 A;  2Q2T A;  3CC4 A;  2VUM G;  3S2H H;  4IOA A;  3A74 A;  1C9O A;  3GDE A;  1N33 L;  5IP9 H;  4JC0 A;  3S17 H;  3G48 A;  3I4M G;  4BY7 H;  3J81 i;  4FDB A;  2ID0 A;  1AH9 A;  3J7Z C;  1U0L A;  4DAM A;  1PVO A;  2Q2U A;  4DR1 Q;  5FJ8 H;  5C44 G;  2JA6 G;  1HR0 Q;  3TS0 A;  1L1O A;  1S72 A;  2NZO A;  1Q8K A;  3PUW A;  2ZTE A;  2EQS A;  3JC6 6;  4LUV A;  3JAM c;  1YHQ A;  3RZO H;  4BBR G;  4QGU A;  2GVA A;  4P73 A;  4LFA L;  1Y1V G;  2LSS A;  4NXM Q;  1HNW Q;  5AJ3 L;  1XMO Q;  2I0Q A;  2UXB L;  5IWA L;  1SLJ A;  4OWX B;  1HZA A;  2IX0 A;  3AFP A;  1WFQ A;  1OTC A;  2R7F A;  4P72 A;  4QL5 A;  4GOP C;  3KYH C;  4JI3 Q;  4OWW B;  4B3R Q;  4GNX A;  5LMU L;  2QA4 A;  4DV0 Q;  4A3E G;  2ZJP A;  1R9T H;  2Q2H A;  3CPF A;  5IYC G;  1QVG A;  1N36 Q;  1NTG A;  1AE3 A;  4A3K H;  1CKM A;  1Y1V H;  3W1G A;  5GAD C;  1JMC A;  1EQR A;  5DLQ E;  4KLK A;  2PNH A;  1CSP A;  5IP7 H;  4UY8 C;  1QZH A;  4BXX G;  4A75 A;  1K83 H;  1A8V A;  4DV3 Q;  1HNX L;  2MO1 A;  1LYL A;  5C3E H;  4JBW A;  2LXK A;  4JCV E;  1VQE A;  4GKK L;  4DV7 Q;  1XNR Q;  5GAG C;  4B3R L;  1N34 L;  2DUD A;  5JJK A;  3I2Z A;  4GN3 B;  3D0F A;  4X66 Q;  3GTL H;  5IE8 A;  2VQF Q;  4DV6 L;  3HOV G;  2F3I A;  4PZ6 A;  2WFW A;  2XTI A;  5M5X H;  4IFD G;  4JV5 L;  1SE8 A;  1E22 A;  2K5H A;  4HJ7 A;  4XTC S;  3T1H Q;  1JB7 A;  1VQ7 A;  2JA8 H;  3JAM i;  3UE0 A;  1VQJ A;  2NVY H;  4NB3 A;  2JA7 G;  4LF4 Q;  4P75 A;  1KAW A;  4JOI C;  1IL2 A;  3ULP A;  1I94 Q;  1NY4 A;  4POG A;  2H5X A;  4DV4 L;  3HOX H;  2D0P A;  3KLW A;  3RZD H;  1W3S A;  2VZA A;  1DGS A;  1C0A A;  3TEH B;  4L5T A;  4IPC A;  5FLM G;  4GKJ Q;  3LGJ A;  3OW2 A;  3KDF B;  1K8G A;  1NMG A;  1S3O A;  1VQK A;  2CWP A;  5J3B A;  2V1C C;  1I3Q H;  4B3M Q;  3M9B A;  2ALY B;  3CC2 A;  4GOP B;  1FJG L;  1KIX A;  3PO3 G;  2N49 A;  4UP7 A;  3NEN A;  4JI1 Q;  3RNU A;  4DNI A;  1Y1W G;  4R1J A;  1IBK Q;  4JI7 L;  2QEX A;  4B3S L;  4LF6 L;  3TRZ A;  1N8R C;  3HOV H;  2F52 A;  1PH6 A;  2ATW A;  4Y7N H;  2B29 A;  3ULL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...