2EY5A

Crystal structure of staphylococcal nuclease mutant t41s
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDSPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey5A00
4PMBA 1EY4A 5IGBA 5IOCA 5HURA 1II3A 3C1EA 2EYOA 2KHSA 4PNYA 4EQOA 5KGUA 4K5XA 3SK8A 2F0TA 3H6MA 3NK9A 5J39A 5CV7A 4ZUJA 2PZTA 4KY6A 3NP8A 3OWFA 2SOBA 1F2ZA 4IZ8A 1EY7A 5CR3A 3HEJA 4NMZA 1KAAA 4R8NA 3TP7A 3BDLA 3V2TA 4K8IA 5KEEA 4LAAA 3MVVA 4H7BA 3QB3A 5E3FA 4K5VA 5CV4A 2OXPA 2WACA 3NQTA 1NSNS 1SNPA 1STAA 1SYGA 3NUCA 2PZUA 3NXWA 5EGTA 1KDAA 2EY1A 2F0LA 3SK6A 3OMGA 1TT2A 2F0DA 3NHHA 4HMIA 5C4ZA 5NUCA 3SK5A 5IGDA 3T13A 5DEHA 2F0UA 1STGA 3ERQA 3PMFA 4K14A 3SHLA 3TP8A 1JORA 3TMEA 3U9OA 1A3TA 1IHZA 3R3OA 4ZQ3A 3RUZA 5I9PA 1A2UA 4K5WA 2EYLA 2RDFA 5C3XA 4IUNA 4J1MA 1EY9A 2SNSA 3SR1A 2PQEA 3C1FA 2ENBA 4K8JA 2RBMA 4KD3A 2F0MA 4MIUA 3OSOA 1KDCA 3MZ5A 2M00A 2F0HA 4KD4A 1SYEA 4K2LA 3BDCA 1STNA 2PW7A 1JOKA 4OL7A 4HTHA 5JOBA 4ID6A 1EYCA 3DMUA 5IGCA 5IODA 3DHQA 5DAUA 4EQNA 1A3VA 3P75A 1SNCA 1U9RA 4N9TA 3D6CA 2F0FA 2PZWA 5I6WA 4B9WA 2F0KA 5KRUA 5IGGA 3P1HA 4RKBA 2F0OA 1EYDA 3EJIA 4KJNA 4EVOA 2NUCA 1A3UA 3QOLA 2F3VA 3HZXA 4RKLA 4TRDA 3VA5A 1SYBA 1JOOA 4KV6A 4DF7A 4NKLA 1RKNA 1STYA 4KJOA 2EYMA 5I9OA 4B9XA 1ENCA 1STHA 2EYPA 2F3WA 1EZ8A 4KY7A 2F0EA 5K5PA 2F0WA 5KYLA 5C3WA 5C4HA 1ENAA 4K6DA 5I6YA 4NDXA 5ISRA 2OEOA 4PMCA 4ODGA 3LX0A 3SXHA 2EY5A 5C5LA 1EY8A 1KABA 1EY6A 4I65A 4E6IA 4KTAA 1F2YA 5CGKA 1SNQA 5M9OA 4IALA 5E1FA 2KQ3A 1TR5A 4S3SA 3ITPA 4K2KA 1EY0A 4DGZA 5KYIA 5CV9A 5JAVA 5HGTA 3QOJA 2OF1A 4J6HA 4KHVA 4G57A 3T16A 4WRDA 5C6AA 2F0SA 1EYAA 4ME5A 5CV6A 5EKKA 5F2DA 2EY2A 4DFAA 2F0GA 1SNMA 1SYCA 3D4WA 3EVQA 4EQPA 3D8GA 4NP5A 5J22A 1SNDA 5J1ZA 1JOQA 2EYJA 4QF4A 2F0IA 4QB4A 2LKVA 3MEHA 3EROA 1SNOA 2F0JA 2EY6A 5CV8A 5IGEA 5EKLA 4HMJA 2EXZA 2PYKA 1KDBA 3D4DA 1STBA 1SYDA 2EYFA 2F0VA 2F0QA 2F0PA 2QDBA 3TP6A 4F7XA 4QMGA 5KIXA 4KY5A 1EQVA 5IGFA 3OMCA 2SNMA 4WORA 1NUCA 2RKSA 5CV5A 3E5SA 5CC4A 2HQEA 4N9PA 2EYHA 1TQOA 3MXPA 1EY5A 1A2TA 3TP5A 3SK4A 1AEXA 5IIFA 3MHBA 2F0NA 1F2MA 2O4XA 4ZUIA 4YIJA 5C5MA 4F8MA 1EZ6A 3S9WA 1SYFA 2PW5A 4DU9A
chains in the Genus database with same CATH superfamily
4U68A 4QIWE 5ELFA 1EYGA 2K5QA 3NK9A 1G91A 3LWEA 4JCVE 5IGEA 3HOYB 1F2ZA 1WVLA 1D8LA 1L1OA 3AYHB 2Q8TA 2OXPA 5KEEA 4BBSB 4E6IA 1B70B 2N49A 1X32A 2FXQA 2JA8G 2JN4A 3MEFA 3SHLA 4RGMA 4WJ4A 3A55A 3VR2A 4GN4B 5LMNQ 4ZQ3A 3URYA 1DCZA 4DAYB 2TMPA 1O7YA 2HCIA 2SNSA 2AWNA 3HOWG 1H9SB 3K57A 3GTPB 2WFWA 4XYQA 3F1ZA 3H94A 4AYBE 4G4KA 4N8X1 4OL7A 4XTCS 4DR4L 1VQCA 1Q82C 4A3IG 2MJ8A 2J0TD 1AH9A 1H9SA 1BDOA 3UI2A 1WI5A 1LT6D 1E2ZA 1RKNA 1EWHA 4R4OA 2UUAQ 2UXDQ 1STHA 4JOIA 3GTLB 3DEPA 4LF9Q 3PSIA 1TWAB 1HZCA 2WAQE 4CKEA 4P74A 3K5OA 1KABA 1EY6A 2ASBA 3K58A 1T5XD 1E1TA 3K7AH 1YJNA 3IRBA 4GS3A 3A0JA 2ZXOA 3DEOA 2A6HD 1XPOA 3MXNB 4KKTA 4LF6L 4DKAC 3HP3A 4NXMQ 3PF4A 1NAPA 1BXTA 2NN6G 4HJ9A 2NVXB 1I4RA 3FP9A 1B44D 2PNRC 4DR7Q 1SBBB 1S5ED 4MTKA 4UHVA 1CKMA 5IYBG 2D5DA 3MXNA 3ND9A 3PUZA 1AW7A 2JYOA 3S2HH 1HCZA 1OXVA 1O78A 3RLOA 4FF2A 2VUMB 2Y0SG 4GOPC 1XMQL 3SK4A 4JI7Q 4K0KL 4UY8C 1VQ4A 5JPMC 5IWAL 4F8MA 1DD2A 1K83H 2I46A 2L4NA 3OW7A 4PMBA 2G9DA 3FVQA 2F0TA 4KHZA 5E7NA 2B2VC 2PZTA 3L2PA 3S17H 5E4XA 1QUQB 3BDLA 4F88A 3KFUA 2IJ0A 5E3FA 3RZDH 1BBXC 3NQTA 3G7LA 3OIQA 1TY0A 3DM1A 1E0BA 3J80i 1P16A 1S72A 2I5LX 1UE1A 2PMZE 5IT9L 1QUQA 4CDEC 1K8AC 1RD9D 1ASZA 5C3XA 3W1GA 1BOSA 1FR3A 2Y0SE 1V1QA 2G5DA 1N32Q 3BVGA 1Q8IA 1MIUA 2K33A 4JI6L 2WB1G 1LTBD 2QCPX 2HIXA 3WOEA 4A3DH 3DMUA 1DGSA 1DM0B 1G2SA 3WOFA 5I2YA 2QA4A 3FEWX 1YBYA 3R2TA 4FF1A 1U0LA 4DV5Q 1HJPA 4IQZA 2HD3A 2ID0A 1K0SA 4F87A 3RR5A 3H3VH 4GKJL 2K75A 2NZOA 1A6XA 3GTQB 2CKZB 2OEOA 3PGZA 4ODGA 3LX0A 4YWKA 5C5LA 3L3OC 3K7AB 1C7YA 2K5DA 3GP7A 1SNQA 1TU2B 3T1YQ 1GUGA 2B2YA 3KLSX 2XRQD 1B9NA 5HGTA 3TDQA 2OF1A 4KHVA 1C8CA 4LJZC 4X65Q 2WB1E 1SYCA 4EQPA 1FD7D 4LF4Q 5AJ3L 4POGA 1ESFA 4NW2A 1A8VA 3NWTA 1AE3A 5JEAH 1UE5A 3A5ZB 1O80A 2YU9H 1A62A 1VQMA 3S2HB 2QDBA 4KY5A 1EQVA 4WORA 5ELEA 1B1ZA 2RKSA 4QGUA 1SEBD 5JJKA 1EY5A 2MPMA 4X66L 2B2TA 2B2WC 1K83B 1Z9FA 3QWNA 1K0RA 3QR8A 1AZQA 4DN4M 1QVGA 3CP0A 3S17B 4LFBQ 4CDDC 3H6MA 4RH6A 3HOVH 2XSCA 3TBIB 3RZDB 4A3DG 4BBRB 5I2XA 3MVVA 1PH5A 2P5ZX 3IFTA 1I5FA 1V9PA 3PIP3 4WFN3 3B6YA 2F0LA 2MFIA 2L0CA 1I4PA 4XT3B 1KD1C 1L0XB 4IFDI 1YJ9A 4HEDA 1G2TA 4GKKL 4GN3B 2F03A 4RGNA 4FF3A 1U5KA 2ALYB 1L0YB 4HJ8A 4LUVA 4PMWA 5C3EH 1PFMA 1T9HA 3S1QB 1Q1EA 4A3DB 2PW7A 2A19A 1JQYD 4HTHA 1HHVA 2FJ2A 1JJ2A 4DK0A 2B8GA 1B7YB 1K9MC 3CU7A 2NVTH 4DV6L 1WFQA 2VQFL 4OXPA 5GAHC 1R4PB 4JI3Q 1A3UA 4LF7Q 1CKOA 1JOOA 4DF7A 4FXGC 4DV4L 5JEAG 4B3RQ 4C2MH 1VQIA 3PCOB 3CMAA 1FVIA 2CVRA 1HNWQ 3FKIG 2CCZA 2J7ZA 1QG7A 4IUUA 4TKOB 3SVMA 1BBWA 1RODA 4XXEA 5M9OA 1BKBA 5CV9A 2JEAI 1B9MA 1Y1WH 5EKKA 4NXNL 1SNMA 3ULLA 1JWMD 1VCIA 3D8GA 1SNDA 1CKNB 1C0AA 4C56C 3VR4A 3CRLC 1KXLA 2PI2E 4BY7H 4P75A 1SYDA 1Q7YC 1MD2D 2R7ZH 3MA2B 1L0WA 1CM9A 3MXPA 2K03A 2Q8RE 3I4NH 4DR5Q 4GNXB 4UP9A 5C3EG 2VNUD 2E2HH 5A2QE 3HOVB 2JA7G 1GD7A 4C3HH 1K28A 5ELCA 3Q22A 3NQIA 4PNYA 5IP9G 1U4RA 5CC4A 2UUBQ 2X69A 3Q6SA 4GNXA 4A76A 5EPKA 3SK5A 2EXDA 3HOZH 4CDCC 3CRKC 1L2FA 3E9HA 1D7QA 3CCLA 2F52A 1QNKA 2JSOA 3PMFA 5LMNL 1TVXA 1A3TA 1QNUA 4YHHQ 1A2UA 4IUVA 2ZM6Q 2M9VA 4P72A 2TSSA 5C3EB 3RLNA 2KBNA 2PQEA 2XNAC 4K8JA 3M4QA 3HOUG 2OCEA 2DY8A 4R4IA 1IYVA 4DNRB 1F9RA 1STNA 2DN8A 2K4KA 3M3YB 4NB3A 5M3MH 3KDFB 2D0PA 1X3EA 1Y1WG 1A3VA 3J81c 4OGQC 2N78A 4BS9A 2DY7A 3U4VA 4HSVA 3CCJA 4RKBA 1DOKA 2KOLA 4C2MB 1RIPA 1SYBA 3OPOA 1GXDC 2NZ1D 3ERSX 3KDFA 2UUAL 2UXDL 3J81i 3UDGA 5GAEC 1Y1VH 3EIVA 3HFZB 3QIAA 2VQEQ 1EUJA 4LF9L 4DV3Q 2R92H 3HOXH 2R7ZG 5IP7H 4JI5Q 1K8OA 4ZAIA 4A3KH 4FP5D 1Y8OB 3SXHA 1VF5C 1SMXA 3C2PA 3CC2A 1R9TH 1Y1WB 3I4NG 1OXSC 1VQGA 3PUWA 2ZJQA 4NXML 3EFXD 3BYYB 1PRTB 1TWCH 1N8RC 1EU4A 1YNJC 3RN2A 1TWHH 5FKAC 1VQDA 2E74C 1B4OA 4BY7B 4JBJA 4TVAB 1B3QA 4R4TA 4A93H 4HMJA 2PYKA 4DNIA 2R7ZB 1CHQD 4F7XA 3TN2A 3HOZG 2VW9A 1SFOH 1GUTA 3LWUA 4Z9CB 1RTOA 4HJAA 3AQQA 3KLRA 3I4NB 2LXKA 5A35A 4EX5A 1F2MA 2E2HB 1VQEA 4CGYB 4C3HB 5IGBA 1DOLA 5C0XH 2K5WA 1D5ZC 2KHSA 2A6ED 2R93G 3GTKB 1JCKB 4L5TA 5M3MG 3TRZA 5CV7A 2MP1A 4TQUS 1HZ9A 2E2IB 3HEJA 3A74A 1VQOA 3A7AB 1TS2A 1ICWA 3NEMA 1FL0A 5CV4A 3BDOA 1EQTA 2AQ2B 2PZUA 3CAMA 2AQ3B 3NBHB 4M1UB 5NUCA 3HKSA 2IX0A 1CZWA 1Y1VG 2A5HA 3QG1A 4A75A 1PZID 5I9PA 2R92G 4BWGB 5IP7G 2HHHL 4A3KG 4PG3A 4KD3A 3NBHA 2XVSA 3K59A 2RHSB 1N32L 4IFDH 2L15A 4KN4C 5M3MB 3GQBA 1VQLA 3R8BA 4JW0A 1CA5A 4OHJA 1KL9A 4EQNA 1XXGA 4B3TQ 1CA6A 4DV5L 5IGGA 3N52A 3P1HA 2F0OA 1LT5D 2C35B 3NWSA 4KJNA 1EIFA 2N8NA 5K36G 1Y1VB 5I4DA 3ONAB 1XTCD 4A93G 3H91A 1STEA 3BZKA 4POFA 4X6AH 3K7UC 1IW7D 2SDFA 3HOXB 1V1PB 2R61A 2ZJPA 1JICA 5FLMH 4A3KB 3PO2H 2JA9A 4UPAA 4R4CA 5EAYA 1LLRD 2IHFA 4PV1C 4PMCA 4X64Q 3W5OA 4HCEA 2ES2A 2C9OA 4KKSA 1R9TB 5JEAJ 2CQAA 4O2DA 4ZK9B 1GUNA 1CFMA 2RDHA 3CC4A 5E1FA 3H3VI 4S3SA 1V1PA 2UXBQ 1TWCB 1H9MA 3I3CA 2JJQA 3JAME 4JOIC 4A3FG 3CCVA 5C0XG 1XWEA 1PRTD 1TWHB 3BJUA 5KNCA 2JA8H 2K7VA 2JA5H 4A4IA 4DA2A 4LF4L 2FINB 5J22A 1PH6A 4A93B 4JG2A 1MSHA 3Q23A 2MO1A 4DAPA 1SFOB 1CSPA 3HOWH 1CUKA 4YY3Q 4BA2I 3GV6A 4DPGA 3OMCA 1HZAA 5FLXc 4UAIA 4FDBA 1TQOA 3DM3A 3NELA 1X56A 1QVCA 5C5MA 5FK9C 2K28A 4J8QA 1EZ6A 4A3IH 2A8VA 2PW5A 2PNHA 1G6ZA 3I8ZA 1LM0A 2L55A 4LFBL 1N36Q 3C1EA 3RNUA 2OQ0A 5FOBB 4NMZA 1NCVA 1W6KA 4K6LA 2R7FA 3QB3A 3NUCA 2XTIA 2BA1A 2EJMA 3BYTB 5IGDA 4QIWB 3S15H 1VMPA 4YCVA 1STGA 2OT2A 4FNFA 1K3RA 1I4GA 3PO2G 4MHEA 1XNQQ 4OO1H 3C1FA 4G7HC 1KTKA 2RBMA 3CD6A 1SLJA 2L11A 3E9IA 3MFGA 1XPRA 4JYAQ 1KDCA 4JI1Q 2L1BA 2NN6H 1VQ9A 1NMFA 2E8GA 3VYRA 1FNUA 4C3JG 5L37A 2JA6G 5IYBH 1HR0W 1X9NA 4BA1I 1U9RA 5GROA 3CW2C 3S2DH 4H02A 2F0KA 2JA5G 1PFNA 4JI3L 1QOHA 5CMDA 4DR1Q 4LF7L 1VF7A 1N33Q 4YWLA 2N88A 3PO2B 4B3RL 4I7ZC 3X3NA 2WAQG 4AYBB 2EYPA 3GTGH 2F0WA 4X62Q 1HNWL 1SE3A 1S5FD 1Y8PB 5C3WA 5C4HA 3LNNA 3K0YA 4KKUA 2OWOA 1HH2P 5BR8L 4RHSA 1YHQA 4DAYA 3HG9A 2KQ3A 4HIMA 2CQOA 3ZYYX 3V05A 4CJ2C 1OXTA 4J6HA 1PVOA 4Q0FA 2JA8B 1U4PA 5CV6A 2F0GA 1JE5A 5M5WH 3GTJH 1PMRA 5J1ZA 1CSQA 2EYJA 2WAQB 1MJCA 2F0IA 2MUYA 3MEHA 4DV7L 3G4SA 3HOWB 2B2YC 1TWFH 1WCMH 1JB3A 1BCPD 2L12A 1XNRQ 2SNMA 3IL8A 4PZ6A 1S5DD 4A3IB 1OXXK 4Q5VA 2UXCL 2JEBI 1YVCA 4A3MH 3I4MH 4DR5L 2R3ZA 4OO1G 2A74C 1KAWA 1LTLA 1PYSB 2CW0C 1X3GA 5HURA 1AFPA 1VQJA 1EEID 2N55A 1BBUA 2UUBL 1CZGA 4DFAA 1NJIC 2E5LQ 3SE0A 4IZ8A 5IYDH 4C3IG 2B2TC 3U4ZA 2LY7A 5FO7B 2IHEA 4CDFC 2L9HA 3TZDA 3K5NA 3S15B 2VB2X 1E2WA 1UEBA 2EE1A 3U50C 4BXXH 4DUZQ 3U9OA 1WTHA 4YHHL 4WJ3M 2ZM6L 2EYLA 2RDFA 1OTCA 1YEZA 4A3EH 1R4QB 5EBDA 3VYSA 5CYUA 3P20A 4OEMB 4K2LA 1BO0A 3S2DB 5IGCA 1M8AA 4XQQA 3D6CA 1GHJA 2KUMA 1YNXA 2Y0SB 5C4XG 1Q46A 1J9OA 3GD7A 4DV0L 5HY6A 4H13C 3GTGB 2PQAB 4B9XA 3TSSA 3R93A 4DV3L 1WCMG 3T53B 1Q86C 4MN3A 4JI5L 3J81L 1LACA 4HCSA 1G6PA 3J80E 1ESRA 4RA8A 1F2YA 4XT1B 1JMCA 4A3MG 2PQAA 5D3IB 3I4MG 1PDQA 1X3QA 1Y69U 2WINB 1SR3A 3BS1A 1X3PA 4ULLA 5M5WB 4P2CB 3GTJB 1QZGA 3M4PA 2WIIB 3MFYA 2LSSA 5LMUL 3CMEA 2IY5B 2B63H 5IYDG 1WCMB 1GKHA 2LS01 5C0XJ 1UAPA 3W1BA 1MHWC 4APVA 1UEAB 3KBGA 1SMYC 1PTOC 2WB1B 1JC7A 5CORA 4IUPA 2HQEA 4IURA 3CC7A 1GM5A 4BXXG 4LK1C 2NTTA 2K52A 1GUWA 3TP5A 3I4MB 1I4XA 4DR6Q 2I0QA 4KHPQ 4RWSC 1AEXA 1Q12A 3S24A 4DUYQ 1M4VA 4A3EG 4LNQA 4DU9A 3FMCA 2RQXA 3L7ZC 3F2BA 2EYOA 1G51A 5AFWA 5J39A 5CR3A 3I56A 1EY7A 4RG1A 4IFDJ 2DNCA 3CKIB 3FKIH 3NE5B 1QB5D 1UE6A 4JI2Q 1PHJA 3NTHA 2F0DA 3NHHA 5JVG3 3BZDB 1LT4D 5EPJA 5C0XI 2YTXA 4P73A 3OTOL 4DAVA 4ZCKA 3Q8DA 4CJ1B 4A3EB 2RCNA 4J1MA 1EY9A 1OO9B 1Q90A 4LF8Q 3KF8B 2ENBA 1TS3A 2D2CC 3A8KE 1NR4A 4IO9A 1WTWA 1ILPA 1NMGA 2M00A 4DR3Q 4GOPB 5FO8B 5IODA 4B3TL 1TY2A 3DHQA 1HFNA 1LTTD 3KF8A 4LFCQ 3S1MH 3J7AV 1HNXL 4AH6A 5KRUA 5ELNA 5IE8A 1MBYA 1HXYD 4X3UA 2B63G 1JJGA 1STYA 4OX9L 1HQRD 4J15A 1ENCA 2I5HA 1VQAA 2F3WA 1KNEA 2Z6KC 2Q2HA 3H0GG 5I6YA 4LW1A 2JA7H 2A69C 3MWYW 5IP9H 1MI2A 2B2VA 3NBIA 4IPGA 1TR5A 4K2KA 2UXBL 1VQNA 3IKJA 1V43A 2F1MA 5M5XH 3BZCA 1RL2A 2K50A 1ML0D 1U4MA 2B63B 3K80C 5E4WC 4A3JH 1H9RA 2Z1CA 1EL0A 3OW2A 3F2UA 4JC0A 4QF4A 2KCMA 4L5RC 1EWCA 2JXMB 3PIOA 4RHRA 2FFKB 4YY3L 3HOUH 2KECA 1SE2A 2QGQA 5CV5A 3FHWA 4A3BG 1HUMA 3CPFA 1PH7A 5JJLA 1ASYA 1SE8A 2AUKA 2IPKD 4KLKA 1FNWA 2KCCA 2QW7A 3OHXC 4OIKA 5CBAE 1EY4A 1N36L 1II3A 2PO4A 1RF2D 1TS4A 5FLXL 2YU9B 2HUGA 1RDPD 4KY6A 3FKIB 1CI3M 2BA0A 3C46A 2ATWA 1XX8A 4IPCA 1I3QH 1PZJD 2KEDA 2BE5C 4JI4Q 2EJGC 1CKNA 2FHTA 1TT2A 1QE6A 1WD0A 1B3AA 1KRTA 4IOAA 3STBC 4EQ5A 1RHPA 4EGVA 1XNQL 4IUNA 2CWAA 5BN3A 2K5VA 3EQLC 4JYAL 2F0MA 4FYDA 4JI1L 4JK1C 4Y7NH 4KD4A 1NY4A 3UDFA 4C1NI 3A8JE 2B2UA 1YHBA 1H9KA 1FGUA 4RCNA 1IZ6A 2O5IC 4BY1G 1PH9A 2KJXA 5I6WA 3H15A 4B9WA 4OO1I 4A3JG 4X3SA 4DR1L 4AQYQ 1M1KC 3EJIA 1N33L 3TQYA 3AU7A 3QOLA 1HNZQ 2B2WA 1D1KA 4G7OC 2NN6I 1MSGA 4QQBX 4KJOA 1S5BD 3UDXA 4IJHA 4X62L 1S3OA 1EZ8A 1ZKOA 1LTID 2VL6A 2JA7B 2IWHA 1J8IA 1PH4A 2RVLA 2K1BA 2IX3A 1EU3A 2R93H 2D62A 1Z47A 2WKCA 3Q24A 3U9SA 1E1OA 1KLGD 2NVTB 4PZ8A 5M5XB 1NR2A 1I94Q 2Q2UA 3G6JB 1PV4A 4JBMA 5DM63 4A3JB 2PPBC 5F2DA 4JV5Q 4DR2Q 4O1NA 3I72A 4IPHA 2AQ1B 3J81j 4IJLA 5C4JH 3ND8A 1W2BA 2R7DA 2B39A 3RMHA 1Q8KA 4O42A 5D14A 3HOUB 3PO3G 1O7IA 1XNRL 2X6LA 5IT9E 4GZYC 5IGFA 4R9WA 3VYTA 4OWXB 4DXGA 2K04A 3D31A 1P8LA 4RGTA 5BN4A 5C44G 3MHBA 1WTQA 2XGTA 2O4XA 4ZUIA 4NPSA 1LTRD 5EKIA 3BU2A 1SMYD 2GA4B 3DXJC 4B3MQ 3PV0A 4DR7L 1PTOD 3SK8A 1ILQA 5K36H 1HTPA 3K81C 2UU9Q 2SOBA 3E0JA 2ZXPA 1GJXA 1KAAA 1KQSA 5G3LD 1I3QB 4H7BA 2HIVA 2IW3A 4CKBA 2EY1A 1IL8A 4JI7L 3I4LA 4DK6C 2E2JH 3V96A 4DAMA 1CQFA 4V190 4DUZL 4K14A 4GKJQ 3TMEA 1IHZA 2HDMA 4MTNA 5ELDA 2A6HC 3KOJA 2LXJA 4A3FH 4MIUA 4Y7NB 1LTAD 2YV5A 1E24A 1H9JA 1SYEA 2H5XA 4FF4A 2XIWA 2B8FA 2YTYA 2KCTA 1GUSA 2DJGC 3HOZB 3VYUA 3CCMA 2PZWA 1ET9A 1TIID 3VDYA 1EYDA 3KYHC 1QWYA 2NUCA 4RKLA 2F4IA 4CKCA 2B3GA 3HKZG 1L1OC 1K3BC 2XRSD 1UUPA 1ENAA 5ISRA 2R93B 4OONA 1IKLA 5IYCG 1X6OA 1PFBA 4ME3A 4MZ9A 2IT1A 2F4VQ 3MAQA 4UP7A 2Q2IA 1VDZA 3UE1A 2JP1A 3CHBD 1DONA 5C6AA 4WRDA 2F0SA 1EYAA 1F2LA 2BH2A 4QUCA 5C4JB 2NVQH 1IBMQ 3EVQA 2R92B 1EEFD 1O7ZA 1ZXTA 2GVBA 1LYLA 3EROA 1HR0Q 1CHPD 1STBA 2K5NA 3CF5A 3HOYH 1HA6A 1FYCA 3I70A 2X6GA 2V1CC 3HKZE 3JAMc 3T1YL 2FMMA 4BBSH 4QUFA 4KHPL 4DUYL 2DNEA 3DUZA 1LV9A 5FJ8H 1IKMA 4C3JH 2JA6H 3TEHB 4X65L 4IUTA 1HRJA 1N34Q 3R2IA 2MQHA 1C4QA 4LF5Q 1SROA 2E76C 3GTPH 1GUOA 1WTPA 3S16H 1WJJA 3NPPA 3PQIA 4K5VA 1BCPB 4JI2L 3NXWA 1SNPA 4KN7C 2E2JB 2GN5A 1NNXA 3TP8A 5J3BA 1SAPA 2YYZA 4A3FB 4LF8L 3RLFA 4H0LC 4QJFA 1VQ5A 1EOVA 4CJ0B 1E3PA 3MXUA 3GTLH 4DR3L 3CCEA 2F0HA 3NTIA 2DJFC 4ZKBB 3RZOH 1X3FA 2K05A 1I50H 4LFCL 3VA7A 1S5CD 2PCFB 4QL5A 4A3LG 4U673 1UWVA 2MGSA 1RTNA 1V8QA 3HZXA 5GQOA 1W6JA 3CCUA 1SRUA 1YNNC 1B53A 1F9SA 1XTDA 3HOYG 1PH8A 4XDXA 4QCLA 4NDXA 1G291 2ZXRA 3GTMH 2ZTEA 1AP0A 5D3DA 4BBSG 4I65A 4YCUA 5FJ8G 4IALA 2DGYA 3J7AF 4C3IH 3M4YA 1ZYRC 4DGZA 4XIGS 1Q81C 1WTVA 1DXMA 2NVQB 4G57A 3PUVA 1VQKA 4LMQD 3T1HQ 1H95A 3G71A 2D0OA 2VZAA 2BCOA 4NP5A 2QEJC 2BH8A 1OXUA 3PIO3 1M90C 4JI0Q 2RCFA 2F0JA 2EY6A 3F8TA 3TS2A 1HA5A 2E75C 2F0VA 2F0QA 3ZJYC 1SJHD 2KEEA 2ZTCA 5DNFA 4C3JB 1IBLQ 3K5MA 2JA6B 4QY7A 4MNOA 5FO9B 1XYIA 1A2TA 2NWGA 5TSSA 3WWVA 1GOZA 2F0NA 1AN8A 2Z4HA 5H1SE 1DYQA 3FPUB 3I55A 3A5UA 2JA5B 2M2LA 4HN7A 1MGSA 1Q3LA 5C4XH 5JJZA 3OIPA 4KMUC 4DV2Q 3AFQA 1CK1A 1CT1D 1Y8NB 4RAUC 2B29A 3K6OA 4FVMA 3S16B 3SEBA 3FDTA 3MC0B 4L5QA 4LAAA 1EFID 2WACA 5IIFA 3KF6B 4JI4L 1YNJD 3LGJA 3SK6A 1EOTA 4RFBA 2F0UA 3ERQA 2CH4W 2XWBB 3BG3A 2Z9HA 2AKWB 4LFAQ 3QJYA 3KF6A 3FPPA 5IY0A 1C9OA 2JE6I 1LABA 1VS0A 1VMCA 3RZOB 4PZ7A 1I50B 5A2QL 3GTQH 1PA6A 2Z8LA 1PRTF 2Q8IB 2VUMG 1F9QA 3P75A 2QKIC 2HDLA 3CCRA 4V0BA 4GLXA 4AQYL 1AZPA 4CHTB 3F2CA 1I4HA 1TXYA 4R4QA 1LT3D 1HNZL 1HUNA 1D6EC 3O13A 2DUDA 2KHIA 1VQ7A 5I9OA 1JB7A 2IL8A 4LUZA 3GTMB 1ICFB 4L63B 2Q2TA 1SJED 1KLUD 4IUQA 1EY8A 5CGKA 2UUCQ 4C3IB 4KTAA 1EQQA 4JI8Q 1I6HH 2PMZB 3D0FA 1EY0A 1I94L 2ZTDA 4Y52H 3VR5A 1IYJB 4JV5L 1KHIA 4DR2L 1K8GA 3MXGA 2K01A 3J80c 2VQEL 5LMNW 1FGBD 3D4DA 4XQJA 1X54A 2F0PA 1JWSD 4QMGA 4BBRH 3J7ZC 3DWPA 1TWGH 3E5SA 2OQKA 1CQVA 4JBKA 1T5EA 2EYHA 2I07B 5GADC 1A63A 2WV6D 1XMOQ 4I7AA 3T51B 3S9WA 5C4XB 2L5TA 2VB3X 4B3ML 3H3VC 2HHHQ 4X3TA 4JPBW 2UU9L 1TWFB 4ZUJA 2R6GA 4G7ZC 4DNTB 1SDFA 1C48A 3S1QH 4RMFA 1EIYB 5COYA 2RSOA 1NSNS 1SYGA 3H0GH 5EGTA 2I5MX 4DV1Q 4A3MB 4HMIA 3NENA 1VQ8A 5C4ZA 3ICEA 3RD4A 4HIDA 4RCOA 1Q1BA 3D4RA 3K5LA 1FJGQ 1PH2A 4RGOS 1WTXA 4DK3C 4B08A 4HJ7A 5CBEE 5JJIA 1IXRA 1D2BA 5KNDA 4AIMA 2RSNA 3M4OH 1PTOH 4O0AA 5JOBA 1VQFA 1QJOA 1Z7TA 4KK7A 3SGIA 1LO5D 3A56A 3T4AC 3N6RA 2ICIA 1V1OA 3M7NA 2EDGA 4EVOA 5EQ0A 3VA5A 2F3VA 4A3BH 2A1AA 1AE2A 1BCPF 4B3SQ 2EYMA 2E2DC 4GLVB 3S1RH 1S4ZA 4A3GH 2B2UC 3VR3A 4GNXC 1IBKQ 4BBRG 5DLQE 3CQZH 2V4DA 1JWUD 3KUPA 4HIKA 1I6HB 2EY5A 1E2VA 1BR9A 1EWIA 2NZHA 2A6EC 3A7LA 2F4VL 2A68C 1J5EQ 5LHY1 1EQRA 2AUJD 1YNND 3P7JA 3PF5A 1QVFA 2EY2A 1IBML 3E3XA 3OYYA 4GOPA 2O5JC 1D5XC 3I7FA 2KCNA 3VR6A 3L9AX 1HR0L 5GAGC 1NE3A 1VQHA 5M3FH 1GVPA 1PH3A 2Z0SA 5EKLA 1ZYRD 2QF7A 2ICEC 5T1GA 4HIOA 4X64L 2EYFA 1QZHA 1TWGB 1D5MC 3K0XA 4N9PA 4P71A 2KVMA 3ULPA 3PUYA 3E6ZX 4DK1A 3AB9A 3HGBA 2J4XA 4ABNA 1GHKA 2AHOB 4H44C 3F2DA 4BY1H 4L8JA 3KK7A 1N34L 3BVZA 1YJWA 2VS1A 5ELBA 2WP8J 1ENFA 2XWJB 4ZYSA 3JAML 4LF5L 2KENA 3S14H 2H4OA 4LWCA 3TP7A 3MTSA 1HPCA 3H0GB 1IW7C 4K8IA 1K8MA 1YITA 3NTKA 2EZVA 1IL2A 1STAA 5K5PA 3TS0A 2BOSA 3M3YH 5EBCA 1K73C 2CFMA 2NB0A 3GDEA 5EJWA 4L6TB 3L0OA 5DEHA 2HQLA 4A3GG 1QILA 2QILA 4YWMA 3AEVA 2KA7A 4K5WA 3SDZA 3SR1A 2K32A 3G48A 3M4OB 1HFGA 1PRTC 1PTOB 1JJCB 3D3RA 5BR8Q 1KNAA 4ZLTF 4JBWA 1EYCA 2PI2A 2K6AA 5DAUA 4N9TA 4DR4Q 3PO3H 4ILWA 2CW0D 1X55A 3QO2A 2D9UA 3TREA 4A3BB 1EIHA 1JORA 1F9PA 4TRDA 3S1RB 2ZJRA 5C44H 3HOVG 1YZ6A 5M3FG 1KC8C 4A3GB 3JC66 5LL6X 3G6EA 4KI0A 1NBWA 1X65A 2F0EA 2C5CA 3M9BA 3CQZB 4DV7Q 1YIJA 4K6DA 1WOCA 4C1NK 1XPUA 2A73B 3CCSA 3S1MB 3EBEA 2EIFA 1W3SA 1UE7A 1YI2A 2UXCQ 3T16A 4OWTB 3T1HL 4LF6Q 5BN5A 2LMCB 1WD1A 5M3FB 2N3SA 1JOQA 4JI0L 3I90A 4QB4A 4YCWA 3E0EA 4DXFA 4ALPA 1KDBA 2KHJA 3GTKH 1MKHA 4FXDA 2CWPA 2E2IH 3S1NH 3I91A 4UP8A 3KJOA 1IBLL 2EVBA 3H09A 3GO5A 4GN5A 5M5YH 1XMQQ 4BY1B 2OTJA 3M85A 4K0KQ 4YIJA 1PLFA 5IWAQ 1IYUA 2NVYH 1PZKD 4DV2L 3S14B 4EQOA 4HR7B 5IT9c 4K5XA 3A54A 4GLAC 1U4LA 3NP8A 3Q0AA 1S40A 1FNVA 4R8NA 2Z6KA 3CCQA 3DLLA 4M8AA 3J7YW 2OTLA 3GTOH 5IYCH 3NSWA 1JR0D 5ELOA 4XYOA 3OWEB 2QDLA 2EPBA 3KJPA 4ZRZA 3T13A 4DV0Q 3J81E 2NTSA 3R3OA 1A15A 3RUZA 3AMUA 4LFAL 1A0IA 1KRSA 4BY7G 4XQNA 2HT1A 3I73A 1LUZA 5KNBA 3J7A5 2HCCA 3OSOA 5T1IA 2CHBD 1LTGD 2E5LL 4CBVA 2RA4A 1GO3E 1LTSD 3EA6A 3HS0C 3PO3B 4JI6Q 2MO0A 4ID6A 4OWWB 2K5HA 1SNCA 3I2ZA 1MJEA 2F0FA 4HSPA 4L5SA 1JE4A 1BCPC 4IN3A 5C44B 1YHAA 3HRZC 4TSSA 4WJWA 4C3HG 3C3LA 1DJRD 4KV6A 1PYBA 5LMUQ 1SXTA 3IAYA 3CXCA 5KYLA 4KY7A 1RJTA 2AWOA 1HQMC 1XJVA 2YTVA 2EQSA 4A3CH 2AMCB 4LUOA 2UUCL 3UE0A 1QCBD 4JI8L 1VQBA 3OOCA 1BQQT 3FRPB 4ME5A 1KIXA 2K14A 4HJ5A 5LL6S 3D4WA 2H1EA 3W2DA 1BF4A 2VXWA 1O7LA 4FO2A 5AJ3Q 2A68D 1D1IA 2IX1A 4IOCA 2EXZA 3S1NB 1B2TA 4OIJA 3DWQA 1PXUA 3TP6A 5KIXA 5M5YB 3ULJA 1WTRA 2GVAA 2XN9C 2NVYB 4X66Q 3J80L 1XMOL 1I6VC 2LFNA 3KLWA 3OTOQ 4A3LH 4OELB 2FMCA 3HOXG 1N9WA 5IOCA 1VQ6A 2A69D 3HKZB 3AFPA 5KGUA 3OWFA 1Z6HA 3V2TA 2RHQB 3GTOB 2VY3A 5JVH3 2F3IA 1KDAA 4DV1L 3PIPA 3D6WA 1PH1A 3OMGA 4DR6L 1HNXQ 2EJFC 1FJGL 1TS5A 1UNSA 2BDNA 3UDIA 1F77A 3W3AA 1WYDA 3JAMi 1B8AA 4OX9Q 4GKKQ 3M7GA 1EIGA 4A3CG 3MZ5A 4FXKC 1ZEQX 1E7ZA 3BDCA 3X3MA 1JOKA 1ONLA 4HAEA 2MNAA 1CTMA 1TKWB 4ZKCB 3DWAA 1WTOA 4R8IA 4N8FA 3IFDA 3K8AA 3CPWA 1HZBA 2JK8A 2ZT9C 1BUVT 2VQFQ 2MHVA 4DV6Q 1E22A 4B3SL 2G9HD 4NKLA 1PYWD 4DV4Q 3ER0A 4PQXA 2O2LD 1PFSA 1IBKL 3KLSA 5D65A 1B50A 3I4OA 2BE5D 2CH4A 2Z4IA 3BVMA 1ET6A 2BDOA 2RF4A 4IPDA 3TZUA 1NTGA 1EFWA 3GV3A 1J5EL 3EN2A 1TWAH 3STBD 1VQPA 4UDUC 3ITPA 1I4QA 5KYIA 1BVSA 5JAVA 1PTOF 3KBXA 3QOJA 3U58A 2QEXA 1JT8A 2NBFA 5JPNC 5FLXE 2WKDA 3A8IE 4JVZA 2SEBD 5G3LF 1G8ZD 1BNZA 4NXNQ 4IFDG 1HTLD 5DM73 3T56B 3RN5A 2LKVA 1SNOA 2NVXH 5CV8A 3PUXA 5HGQA 1DOMA 3WDNA 2EOTA 1DZ1A 2JQOA 1Y14B 2Z6BA 1SE4A 2NYZD 1NUCA 1SN8A 2VUMH 1L1OB 5EPLA 2RDGA 5FLMG 1J6QA 1SYFA 4AYBG 1RCVD 4R1JA 4X3KA 1SSOA
chains in the Genus database with same CATH topology
4U68A 5ELFA 2K5QA 3NK9A 1G91A 3LWEA 5IGEA 3HOYB 1F2ZA 1WVLA 2Q8TA 2OXPA 5KEEA 4BBSB 4E6IA 1X32A 3SHLA 4RGMA 3A55A 3VR2A 4ZQ3A 3URYA 1DCZA 2TMPA 1O7YA 2HCIA 2SNSA 2AWNA 1H9SB 3K57A 3GTPB 4XYQA 3H94A 4G4KA 4OL7A 4XTCS 2MJ8A 2J0TD 1H9SA 1BDOA 3UI2A 1LT6D 1E2ZA 1RKNA 1EWHA 1STHA 3GTLB 3DEPA 1TWAB 4CKEA 1KABA 3K5OA 1EY6A 3K58A 1T5XD 2ZXOA 3DEOA 2A6HD 4KKTA 3HP3A 1NAPA 1BXTA 2NN6G 2NVXB 1I4RA 1B44D 2PNRC 1SBBB 1S5ED 2D5DA 3MXNA 3ND9A 3PUZA 1AW7A 2JYOA 1HCZA 1OXVA 1O78A 4FF2A 2VUMB 3SK4A 5JPMC 4F8MA 1DD2A 2I46A 2L4NA 3OW7A 4PMBA 2G9DA 3FVQA 2F0TA 4KHZA 2B2VC 2PZTA 5E4XA 3BDLA 4F88A 2IJ0A 5E3FA 1BBXC 3NQTA 3G7LA 3OIQA 1TY0A 3DM1A 1E0BA 5IT9L 1RD9D 5C3XA 1BOSA 1FR3A 3BVGA 1Q8IA 2K33A 1LTBD 2QCPX 3WOEA 3DMUA 1DM0B 1G2SA 3WOFA 5I2YA 3FEWX 3R2TA 4FF1A 4IQZA 2ID0A 4F87A 1A6XA 3GTQB 2OEOA 4ODGA 3LX0A 5C5LA 3L3OC 3K7AB 2K5DA 3GP7A 1SNQA 1TU2B 1GUGA 2B2YA 3KLSX 2XRQD 1B9NA 5HGTA 3TDQA 2OF1A 4KHVA 1C8CA 4LJZC 1SYCA 4EQPA 1FD7D 1ESFA 4NW2A 3NWTA 5JEAH 1O80A 3S2HB 2QDBA 4KY5A 1EQVA 4WORA 5ELEA 1B1ZA 2RKSA 1SEBD 1EY5A 2MPMA 2B2TA 2B2WC 1K83B 3QWNA 1AZQA 4DN4M 3S17B 3H6MA 4RH6A 2XSCA 3TBIB 3RZDB 4BBRB 5I2XA 3MVVA 3IFTA 3PIP3 4WFN3 2F0LA 2L0CA 1I4PA 4XT3B 1L0XB 4IFDI 4HEDA 1G2TA 2F03A 4RGNA 4FF3A 1L0YB 4PMWA 1PFMA 3S1QB 1Q1EA 4A3DB 2PW7A 1JQYD 4HTHA 1HHVA 2FJ2A 4DK0A 2B8GA 3CU7A 1R4PB 1A3UA 1JOOA 4DF7A 4FXGC 5JEAG 2CVRA 2J7ZA 1QG7A 4IUUA 4TKOB 3SVMA 1RODA 4XXEA 5M9OA 5CV9A 2JEAI 1B9MA 5EKKA 1SNMA 1JWMD 1VCIA 3D8GA 1SNDA 4C56C 3VR4A 3CRLC 1SYDA 1MD2D 3MA2B 1CM9A 3MXPA 2K03A 2Q8RE 2VNUD 5A2QE 3HOVB 3Q22A 5ELCA 3NQIA 4PNYA 1U4RA 5CC4A 2X69A 3Q6SA 5EPKA 3SK5A 3CRKC 2JSOA 1QNKA 3PMFA 1TVXA 1A3TA 1QNUA 1A2UA 4IUVA 2M9VA 2TSSA 5C3EB 4K8JA 2PQEA 2XNAC 2DY8A 1IYVA 4DNRB 1F9RA 1STNA 2DN8A 3M3YB 1A3VA 4OGQC 4BS9A 2DY7A 4HSVA 4RKBA 1DOKA 2KOLA 4C2MB 1SYBA 3OPOA 1GXDC 2NZ1D 3QIAA 1K8OA 4ZAIA 4FP5D 1Y8OB 3SXHA 1VF5C 3C2PA 1Y1WB 1OXSC 3PUWA 3EFXD 3BYYB 1PRTB 1EU4A 1YNJC 5FKAC 2E74C 1B4OA 4BY7B 4HMJA 2PYKA 2R7ZB 1CHQD 4F7XA 3TN2A 1GUTA 3LWUA 4Z9CB 1RTOA 3I4NB 3KLRA 5A35A 1F2MA 2E2HB 4CGYB 4C3HB 5IGBA 1DOLA 5C0XH 2K5WA 1D5ZC 2KHSA 2A6ED 3GTKB 1JCKB 5CV7A 2MP1A 4TQUS 2E2IB 3HEJA 3A7AB 1TS2A 1ICWA 5CV4A 3BDOA 1EQTA 2AQ2B 2PZUA 2AQ3B 4M1UB 5NUCA 2IX0A 1CZWA 2A5HA 3QG1A 1PZID 5I9PA 4BWGB 4KD3A 3NBHA 2XVSA 3K59A 4IFDH 4KN4C 5M3MB 3GQBA 3R8BA 1CA5A 4OHJA 4EQNA 1XXGA 1CA6A 5IGGA 3N52A 3P1HA 2F0OA 1LT5D 3NWSA 4KJNA 5K36G 1Y1VB 5I4DA 3ONAB 1XTCD 3H91A 1STEA 3HOXB 1IW7D 2SDFA 1V1PB 2R61A 1JICA 4A3KB 1LLRD 4PV1C 4PMCA 4HCEA 2C9OA 4KKSA 1R9TB 5JEAJ 2CQAA 4ZK9B 1GUNA 1CFMA 2RDHA 5E1FA 4S3SA 1V1PA 1TWCB 1H9MA 3I3CA 3JAME 5C0XG 1XWEA 1PRTD 1TWHB 5KNCA 2K7VA 4DA2A 2FINB 5J22A 4A93B 1MSHA 3Q23A 4DAPA 1SFOB 4BA2I 3GV6A 3OMCA 4UAIA 1TQOA 5C5MA 5FK9C 2K28A 4J8QA 1EZ6A 2PW5A 1G6ZA 3I8ZA 2L55A 3C1EA 5FOBB 4NMZA 1NCVA 1W6KA 4K6LA 3QB3A 3NUCA 3BYTB 2BA1A 2EJMA 5IGDA 4QIWB 1VMPA 1STGA 2OT2A 4FNFA 1I4GA 4MHEA 4OO1H 3C1FA 4G7HC 1KTKA 2RBMA 2L11A 3MFGA 1KDCA 2L1BA 2NN6H 3VYRA 1FNUA 4C3JG 4BA1I 1U9RA 2F0KA 1PFNA 1QOHA 5CMDA 1VF7A 2N88A 3PO2B 4I7ZC 3X3NA 4AYBB 2EYPA 2F0WA 5C3WA 1SE3A 1S5FD 1Y8PB 5C4HA 3LNNA 3K0YA 4KKUA 4RHSA 4DAYA 3HG9A 2KQ3A 3ZYYX 3V05A 4CJ2C 1OXTA 4J6HA 4Q0FA 2JA8B 1U4PA 5CV6A 2F0GA 1PMRA 5J1ZA 2EYJA 2WAQB 2F0IA 2MUYA 3MEHA 3HOWB 2B2YC 1JB3A 1BCPD 2L12A 2SNMA 3IL8A 1S5DD 4A3IB 1OXXK 4Q5VA 2JEBI 2R3ZA 4OO1G 2A74C 2CW0C 5HURA 1AFPA 1EEID 2N55A 1CZGA 4DFAA 3SE0A 4IZ8A 4C3IG 2B2TC 2LY7A 5FO7B 2L9HA 3TZDA 3K5NA 3S15B 2VB2X 1E2WA 2EE1A 3U9OA 2EYLA 2RDFA 1R4QB 5EBDA 3VYSA 5CYUA 3P20A 4K2LA 1BO0A 3S2DB 5IGCA 1M8AA 4XQQA 3D6CA 1GHJA 2KUMA 2Y0SB 1J9OA 3GD7A 4H13C 3GTGB 4B9XA 3TSSA 3R93A 3T53B 4MN3A 3J81L 1LACA 4HCSA 3J80E 1ESRA 4RA8A 1F2YA 4XT1B 5D3IB 1PDQA 1X3QA 1Y69U 2WINB 3BS1A 1X3PA 4ULLA 5M5WB 4P2CB 3GTJB 2WIIB 3MFYA 1WCMB 2LS01 5C0XJ 1UAPA 1UEAB 3KBGA 1SMYC 1PTOC 2WB1B 1JC7A 5CORA 4IUPA 2HQEA 4IURA 1GUWA 4LK1C 2NTTA 3TP5A 3I4MB 1I4XA 4RWSC 1AEXA 1Q12A 1M4VA 4DU9A 3FMCA 2RQXA 3L7ZC 2EYOA 5AFWA 5J39A 5CR3A 1EY7A 4IFDJ 2DNCA 3CKIB 3NE5B 1QB5D 3NTHA 2F0DA 3NHHA 5JVG3 3BZDB 1LT4D 5EPJA 5C0XI 4DAVA 4CJ1B 4A3EB 4J1MA 1EY9A 1OO9B 1Q90A 2ENBA 1TS3A 2D2CC 3A8KE 1NR4A 1WTWA 1ILPA 2M00A 5FO8B 5IODA 1TY2A 3DHQA 1HFNA 1LTTD 3KF8A 3J7AV 5KRUA 1MBYA 1HXYD 4X3UA 1STYA 1HQRD 1ENCA 2F3WA 1KNEA 5I6YA 2A69C 3MWYW 1MI2A 2B2VA 3NBIA 1TR5A 4K2KA 3IKJA 1V43A 2F1MA 1ML0D 1U4MA 2B63B 5E4WC 1H9RA 2Z1CA 1EL0A 3F2UA 4QF4A 1EWCA 2JXMB 4RHRA 2FFKB 2KECA 1SE2A 5CV5A 1HUMA 2AUKA 2IPKD 1FNWA 2KCCA 3OHXC 4OIKA 5CBAE 1EY4A 1II3A 2PO4A 1RF2D 1TS4A 5FLXL 2YU9B 2HUGA 1RDPD 4KY6A 3FKIB 1CI3M 2BA0A 3C46A 1XX8A 1PZJD 2KEDA 2BE5C 2EJGC 2FHTA 1TT2A 1QE6A 1WD0A 1B3AA 1RHPA 4EGVA 4IUNA 5BN3A 3EQLC 2F0MA 4FYDA 4JK1C 4KD4A 4C1NI 3A8JE 2B2UA 1H9KA 4RCNA 2O5IC 2KJXA 5I6WA 4B9WA 4OO1I 4X3SA 3EJIA 3AU7A 3QOLA 4G7OC 2B2WA 1D1KA 2NN6I 1MSGA 4KJOA 1S5BD 1EZ8A 1ZKOA 1LTID 2JA7B 2IWHA 1J8IA 2RVLA 2K1BA 2IX3A 1EU3A 2D62A 1Z47A 2WKCA 3Q24A 3U9SA 1KLGD 2NVTB 5M5XB 1NR2A 3G6JB 5DM63 4A3JB 2PPBC 5F2DA 4O1NA 3I72A 2AQ1B 3ND8A 2B39A 3RMHA 4O42A 5D14A 3HOUB 2X6LA 5IT9E 4GZYC 5IGFA 4R9WA 3VYTA 4DXGA 2K04A 3D31A 4RGTA 5BN4A 3MHBA 1WTQA 2O4XA 4ZUIA 1LTRD 5EKIA 1SMYD 2GA4B 3DXJC 3PV0A 1PTOD 3SK8A 1ILQA 5K36H 1HTPA 2SOBA 3E0JA 2ZXPA 1GJXA 1KAAA 5G3LD 1I3QB 4H7BA 2IW3A 4CKBA 2EY1A 1IL8A 3I4LA 3V96A 1CQFA 4V190 4K14A 3TMEA 1IHZA 2HDMA 5ELDA 2A6HC 4MIUA 4Y7NB 1LTAD 1H9JA 1SYEA 4FF4A 2XIWA 2B8FA 1GUSA 3HOZB 3VYUA 2PZWA 1ET9A 1TIID 1EYDA 1QWYA 2NUCA 4RKLA 2F4IA 4CKCA 2XRSD 1UUPA 1ENAA 5ISRA 2R93B 1IKLA 1PFBA 2IT1A 3MAQA 1VDZA 2JP1A 3CHBD 1DONA 5C6AA 4WRDA 2F0SA 1EYAA 1F2LA 4QUCA 5C4JB 3EVQA 2R92B 1EEFD 1O7ZA 1ZXTA 3EROA 1CHPD 1STBA 1HA6A 1FYCA 3I70A 2X6GA 2FMMA 4QUFA 2DNEA 3DUZA 1LV9A 1IKMA 4IUTA 1HRJA 3R2IA 1C4QA 2E76C 1GUOA 1WTPA 3NPPA 4K5VA 1BCPB 3NXWA 1SNPA 4KN7C 2E2JB 3TP8A 1SAPA 2YYZA 4A3FB 3RLFA 4H0LC 4CJ0B 3MXUA 2F0HA 3NTIA 4ZKBB 2K05A 3VA7A 1S5CD 2PCFB 4U673 2MGSA 1RTNA 1V8QA 3HZXA 1W6JA 1YNNC 1B53A 1F9SA 4XDXA 4QCLA 4NDXA 1G291 2ZXRA 1AP0A 5D3DA 4I65A 4IALA 3J7AF 3M4YA 1ZYRC 4DGZA 4XIGS 1WTVA 1DXMA 2NVQB 4G57A 3PUVA 4LMQD 2BCOA 4NP5A 2QEJC 1OXUA 3PIO3 2F0JA 2EY6A 1HA5A 2E75C 2F0VA 2F0QA 1SJHD 2KEEA 5DNFA 4C3JB 3K5MA 2JA6B 1XYIA 5FO9B 1A2TA 2NWGA 5TSSA 1GOZA 2F0NA 1AN8A 2Z4HA 1DYQA 3FPUB 2JA5B 2M2LA 4HN7A 1MGSA 1Q3LA 5JJZA 3OIPA 4KMUC 1CK1A 1CT1D 1Y8NB 4RAUC 3K6OA 4FVMA 3S16B 3SEBA 3FDTA 3MC0B 4LAAA 1EFID 2WACA 5IIFA 1YNJD 3SK6A 1EOTA 4RFBA 2F0UA 3ERQA 2XWBB 3BG3A 3QJYA 3FPPA 2JE6I 1LABA 1VMCA 3RZOB 1I50B 5A2QL 2Z8LA 1PRTF 2Q8IB 1F9QA 3P75A 2QKIC 2HDLA 4V0BA 1AZPA 4CHTB 1I4HA 1LT3D 1HUNA 1D6EC 3O13A 5I9OA 2IL8A 3GTMB 4L63B 1SJED 1KLUD 4IUQA 1EY8A 5CGKA 4C3IB 4KTAA 2PMZB 1EY0A 3VR5A 3MXGA 2K01A 1FGBD 3D4DA 4XQJA 2F0PA 1JWSD 4QMGA 3DWPA 3E5SA 1CQVA 1T5EA 2EYHA 2I07B 2WV6D 5C4XB 3T51B 3S9WA 2L5TA 2VB3X 3H3VC 4X3TA 1TWFB 4ZUJA 2R6GA 4G7ZC 4DNTB 1SDFA 1C48A 5COYA 2RSOA 1NSNS 1SYGA 5EGTA 4A3MB 4HMIA 5C4ZA 3RD4A 4RCOA 1Q1BA 3D4RA 3K5LA 4RGOS 1WTXA 4B08A 5CBEE 1D2BA 5KNDA 2RSNA 1PTOH 5JOBA 1QJOA 1Z7TA 4KK7A 1LO5D 3A56A 3T4AC 3N6RA 2ICIA 1V1OA 3M7NA 4EVOA 2EDGA 5EQ0A 3VA5A 2F3VA 1BCPF 2EYMA 2E2DC 1S4ZA 2B2UC 3VR3A 2V4DA 1JWUD 3KUPA 1I6HB 2EY5A 1E2VA 1BR9A 2A6EC 3A7LA 2A68C 5LHY1 2AUJD 1YNND 3P7JA 2EY2A 2O5JC 1D5XC 2KCNA 3VR6A 3L9AX 5EKLA 1ZYRD 2QF7A 2ICEC 5T1GA 2EYFA 1TWGB 1D5MC 4N9PA 2KVMA 3PUYA 3E6ZX 4DK1A 3AB9A 3HGBA 2J4XA 4ABNA 1GHKA 4H44C 4L8JA 3KK7A 3BVZA 5ELBA 2WP8J 1ENFA 2XWJB 4ZYSA 3JAML 2H4OA 3TP7A 3MTSA 1HPCA 3H0GB 1IW7C 4K8IA 1K8MA 3NTKA 2EZVA 1STAA 5K5PA 2BOSA 5EBCA 2NB0A 5EJWA 4L6TB 5DEHA 1QILA 2QILA 2KA7A 4K5WA 3SDZA 3SR1A 2K32A 3M4OB 1HFGA 1PRTC 1PTOB 3D3RA 1KNAA 4ZLTF 4JBWA 1EYCA 2K6AA 5DAUA 4N9TA 4ILWA 2CW0D 3QO2A 2D9UA 4A3BB 1EIHA 1JORA 1F9PA 4TRDA 3S1RB 4A3GB 5LL6X 4KI0A 2F0EA 2C5CA 3CQZB 4K6DA 4C1NK 2A73B 3S1MB 3T16A 5BN5A 2LMCB 1WD1A 5M3FB 1JOQA 3I90A 4QB4A 4DXFA 1KDBA 4FXDA 3I91A 2EVBA 3H09A 3GO5A 4BY1B 3M85A 4YIJA 1PLFA 1IYUA 1PZKD 3S14B 4EQOA 4HR7B 4K5XA 3A54A 1U4LA 3NP8A 3Q0AA 1FNVA 4R8NA 4M8AA 3J7YW 3NSWA 1JR0D 4XYOA 3OWEB 2EPBA 4ZRZA 3T13A 3J81E 2NTSA 3R3OA 1A15A 3RUZA 3AMUA 4XQNA 3I73A 5KNBA 2HCCA 3OSOA 5T1IA 2CHBD 1LTGD 4CBVA 2RA4A 1LTSD 3EA6A 3HS0C 3PO3B 4ID6A 1SNCA 2F0FA 4HSPA 1JE4A 1BCPC 4IN3A 5C44B 3HRZC 4TSSA 4WJWA 4C3HG 3C3LA 1DJRD 4KV6A 1SXTA 3IAYA 5KYLA 4KY7A 1RJTA 2AWOA 1HQMC 1QCBD 3OOCA 1BQQT 3FRPB 4ME5A 5LL6S 3D4WA 2H1EA 3W2DA 1BF4A 2VXWA 1O7LA 4FO2A 2A68D 1D1IA 2IX1A 2EXZA 3S1NB 1B2TA 4OIJA 3DWQA 1PXUA 3TP6A 5KIXA 5M5YB 1WTRA 2XN9C 2NVYB 3J80L 1I6VC 2LFNA 2FMCA 5IOCA 2A69D 3HKZB 5KGUA 3OWFA 1Z6HA 3V2TA 3GTOB 5JVH3 1KDAA 3D6WA 3OMGA 2EJFC 1TS5A 1UNSA 2BDNA 1F77A 3W3AA 3M7GA 1EIGA 3MZ5A 4FXKC 1ZEQX 3BDCA 3X3MA 1JOKA 1ONLA 4HAEA 1CTMA 1TKWB 4ZKCB 3DWAA 1WTOA 4R8IA 3IFDA 2ZT9C 1BUVT 2MHVA 2G9HD 4NKLA 1PYWD 4PQXA 2O2LD 3KLSA 5D65A 1B50A 2BE5D 2Z4IA 3BVMA 1ET6A 2BDOA 3TZUA 3GV3A 4UDUC 3ITPA 1I4QA 5KYIA 5JAVA 1PTOF 3KBXA 3QOJA 2NBFA 5JPNC 5FLXE 2WKDA 3A8IE 5G3LF 2SEBD 1G8ZD 1BNZA 4IFDG 1HTLD 5DM73 3T56B 2LKVA 1SNOA 5CV8A 3PUXA 1DOMA 3WDNA 2EOTA 1DZ1A 1SE4A 2NYZD 1NUCA 5EPLA 2RDGA 1SYFA 1RCVD 4X3KA 1SSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMB A;  1EY4 A;  5IGB A;  5IOC A;  5HUR A;  1II3 A;  3C1E A;  2EYO A;  2KHS A;  4PNY A;  4EQO A;  5KGU A;  4K5X A;  3SK8 A;  2F0T A;  3H6M A;  3NK9 A;  5J39 A;  5CV7 A;  4ZUJ A;  2PZT A;  4KY6 A;  3NP8 A;  3OWF A;  2SOB A;  1F2Z A;  4IZ8 A;  1EY7 A;  5CR3 A;  3HEJ A;  4NMZ A;  1KAA A;  4R8N A;  3TP7 A;  3BDL A;  3V2T A;  4K8I A;  5KEE A;  4LAA A;  3MVV A;  4H7B A;  3QB3 A;  5E3F A;  4K5V A;  5CV4 A;  2OXP A;  2WAC A;  3NQT A;  1NSN S;  1SNP A;  1STA A;  1SYG A;  3NUC A;  2PZU A;  3NXW A;  5EGT A;  1KDA A;  2EY1 A;  2F0L A;  3SK6 A;  3OMG A;  1TT2 A;  2F0D A;  3NHH A;  4HMI A;  5C4Z A;  5NUC A;  3SK5 A;  5IGD A;  3T13 A;  5DEH A;  2F0U A;  1STG A;  3ERQ A;  3PMF A;  4K14 A;  3SHL A;  3TP8 A;  1JOR A;  3TME A;  3U9O A;  1A3T A;  1IHZ A;  3R3O A;  4ZQ3 A;  3RUZ A;  5I9P A;  1A2U A;  4K5W A;  2EYL A;  2RDF A;  5C3X A;  4IUN A;  4J1M A;  1EY9 A;  2SNS A;  3SR1 A;  2PQE A;  3C1F A;  2ENB A;  4K8J A;  2RBM A;  4KD3 A;  2F0M A;  4MIU A;  3OSO A;  1KDC A;  3MZ5 A;  2M00 A;  2F0H A;  4KD4 A;  1SYE A;  4K2L A;  3BDC A;  1STN A;  2PW7 A;  1JOK A;  4OL7 A;  4HTH A;  5JOB A;  4ID6 A;  1EYC A;  3DMU A;  5IGC A;  5IOD A;  3DHQ A;  5DAU A;  4EQN A;  1A3V A;  3P75 A;  1SNC A;  1U9R A;  4N9T A;  3D6C A;  2F0F A;  2PZW A;  5I6W A;  4B9W A;  2F0K A;  5KRU A;  5IGG A;  3P1H A;  4RKB A;  2F0O A;  1EYD A;  3EJI A;  4KJN A;  4EVO A;  2NUC A;  1A3U A;  3QOL A;  2F3V A;  3HZX A;  4RKL A;  4TRD A;  3VA5 A;  1SYB A;  1JOO A;  4KV6 A;  4DF7 A;  4NKL A;  1RKN A;  1STY A;  4KJO A;  2EYM A;  5I9O A;  4B9X A;  1ENC A;  1STH A;  2EYP A;  2F3W A;  1EZ8 A;  4KY7 A;  2F0E A;  5K5P A;  2F0W A;  5KYL A;  5C3W A;  5C4H A;  1ENA A;  4K6D A;  5I6Y A;  4NDX A;  5ISR A;  2OEO A;  4PMC A;  4ODG A;  3LX0 A;  3SXH A;  2EY5 A;  5C5L A;  1EY8 A;  1KAB A;  1EY6 A;  4I65 A;  4E6I A;  4KTA A;  1F2Y A;  5CGK A;  1SNQ A;  5M9O A;  4IAL A;  5E1F A;  2KQ3 A;  1TR5 A;  4S3S A;  3ITP A;  4K2K A;  1EY0 A;  4DGZ A;  5KYI A;  5CV9 A;  5JAV A;  5HGT A;  3QOJ A;  2OF1 A;  4J6H A;  4KHV A;  4G57 A;  3T16 A;  4WRD A;  5C6A A;  2F0S A;  1EYA A;  4ME5 A;  5CV6 A;  5EKK A;  5F2D A;  2EY2 A;  4DFA A;  2F0G A;  1SNM A;  1SYC A;  3D4W A;  3EVQ A;  4EQP A;  3D8G A;  4NP5 A;  5J22 A;  1SND A;  5J1Z A;  1JOQ A;  2EYJ A;  4QF4 A;  2F0I A;  4QB4 A;  2LKV A;  3MEH A;  3ERO A;  1SNO A;  2F0J A;  2EY6 A;  5CV8 A;  5IGE A;  5EKL A;  4HMJ A;  2EXZ A;  2PYK A;  1KDB A;  3D4D A;  1STB A;  1SYD A;  2EYF A;  2F0V A;  2F0Q A;  2F0P A;  2QDB A;  3TP6 A;  4F7X A;  4QMG A;  5KIX A;  4KY5 A;  1EQV A;  5IGF A;  3OMC A;  2SNM A;  4WOR A;  1NUC A;  2RKS A;  5CV5 A;  3E5S A;  5CC4 A;  2HQE A;  4N9P A;  2EYH A;  1TQO A;  3MXP A;  1EY5 A;  1A2T A;  3TP5 A;  3SK4 A;  1AEX A;  5IIF A;  3MHB A;  2F0N A;  1F2M A;  2O4X A;  4ZUI A;  4YIJ A;  5C5M A;  4F8M A;  1EZ6 A;  3S9W A;  1SYF A;  2PW5 A;  4DU9 A; 
#chains in the Genus database with same CATH topology
 4U68 A;  4QIW E;  5ELF A;  1EYG A;  2K5Q A;  3NK9 A;  1G91 A;  3LWE A;  4JCV E;  5IGE A;  3HOY B;  1F2Z A;  1WVL A;  1D8L A;  1L1O A;  3AYH B;  2Q8T A;  2OXP A;  5KEE A;  4BBS B;  4E6I A;  1B70 B;  2N49 A;  1X32 A;  2FXQ A;  2JA8 G;  2JN4 A;  3MEF A;  3SHL A;  4RGM A;  4WJ4 A;  3A55 A;  3VR2 A;  4GN4 B;  5LMN Q;  4ZQ3 A;  3URY A;  1DCZ A;  4DAY B;  2TMP A;  1O7Y A;  2HCI A;  2SNS A;  2AWN A;  3HOW G;  1H9S B;  3K57 A;  3GTP B;  2WFW A;  4XYQ A;  3F1Z A;  3H94 A;  4AYB E;  4G4K A;  4N8X 1;  4OL7 A;  4XTC S;  4DR4 L;  1VQC A;  1Q82 C;  4A3I G;  2MJ8 A;  2J0T D;  1AH9 A;  1H9S A;  1BDO A;  3UI2 A;  1WI5 A;  1LT6 D;  1E2Z A;  1RKN A;  1EWH A;  4R4O A;  2UUA Q;  2UXD Q;  1STH A;  4JOI A;  3GTL B;  3DEP A;  4LF9 Q;  3PSI A;  1TWA B;  1HZC A;  2WAQ E;  4CKE A;  4P74 A;  3K5O A;  1KAB A;  1EY6 A;  2ASB A;  3K58 A;  1T5X D;  1E1T A;  3K7A H;  1YJN A;  3IRB A;  4GS3 A;  3A0J A;  2ZXO A;  3DEO A;  2A6H D;  1XPO A;  3MXN B;  4KKT A;  4LF6 L;  4DKA C;  3HP3 A;  4NXM Q;  3PF4 A;  1NAP A;  1BXT A;  2NN6 G;  4HJ9 A;  2NVX B;  1I4R A;  3FP9 A;  1B44 D;  2PNR C;  4DR7 Q;  1SBB B;  1S5E D;  4MTK A;  4UHV A;  1CKM A;  5IYB G;  2D5D A;  3MXN A;  3ND9 A;  3PUZ A;  1AW7 A;  2JYO A;  3S2H H;  1HCZ A;  1OXV A;  1O78 A;  3RLO A;  4FF2 A;  2VUM B;  2Y0S G;  4GOP C;  1XMQ L;  3SK4 A;  4JI7 Q;  4K0K L;  4UY8 C;  1VQ4 A;  5JPM C;  5IWA L;  4F8M A;  1DD2 A;  1K83 H;  2I46 A;  2L4N A;  3OW7 A;  4PMB A;  2G9D A;  3FVQ A;  2F0T A;  4KHZ A;  5E7N A;  2B2V C;  2PZT A;  3L2P A;  3S17 H;  5E4X A;  1QUQ B;  3BDL A;  4F88 A;  3KFU A;  2IJ0 A;  5E3F A;  3RZD H;  1BBX C;  3NQT A;  3G7L A;  3OIQ A;  1TY0 A;  3DM1 A;  1E0B A;  3J80 i;  1P16 A;  1S72 A;  2I5L X;  1UE1 A;  2PMZ E;  5IT9 L;  1QUQ A;  4CDE C;  1K8A C;  1RD9 D;  1ASZ A;  5C3X A;  3W1G A;  1BOS A;  1FR3 A;  2Y0S E;  1V1Q A;  2G5D A;  1N32 Q;  3BVG A;  1Q8I A;  1MIU A;  2K33 A;  4JI6 L;  2WB1 G;  1LTB D;  2QCP X;  2HIX A;  3WOE A;  4A3D H;  3DMU A;  1DGS A;  1DM0 B;  1G2S A;  3WOF A;  5I2Y A;  2QA4 A;  3FEW X;  1YBY A;  3R2T A;  4FF1 A;  1U0L A;  4DV5 Q;  1HJP A;  4IQZ A;  2HD3 A;  2ID0 A;  1K0S A;  4F87 A;  3RR5 A;  3H3V H;  4GKJ L;  2K75 A;  2NZO A;  1A6X A;  3GTQ B;  2CKZ B;  2OEO A;  3PGZ A;  4ODG A;  3LX0 A;  4YWK A;  5C5L A;  3L3O C;  3K7A B;  1C7Y A;  2K5D A;  3GP7 A;  1SNQ A;  1TU2 B;  3T1Y Q;  1GUG A;  2B2Y A;  3KLS X;  2XRQ D;  1B9N A;  5HGT A;  3TDQ A;  2OF1 A;  4KHV A;  1C8C A;  4LJZ C;  4X65 Q;  2WB1 E;  1SYC A;  4EQP A;  1FD7 D;  4LF4 Q;  5AJ3 L;  4POG A;  1ESF A;  4NW2 A;  1A8V A;  3NWT A;  1AE3 A;  5JEA H;  1UE5 A;  3A5Z B;  1O80 A;  2YU9 H;  1A62 A;  1VQM A;  3S2H B;  2QDB A;  4KY5 A;  1EQV A;  4WOR A;  5ELE A;  1B1Z A;  2RKS A;  4QGU A;  1SEB D;  5JJK A;  1EY5 A;  2MPM A;  4X66 L;  2B2T A;  2B2W C;  1K83 B;  1Z9F A;  3QWN A;  1K0R A;  3QR8 A;  1AZQ A;  4DN4 M;  1QVG A;  3CP0 A;  3S17 B;  4LFB Q;  4CDD C;  3H6M A;  4RH6 A;  3HOV H;  2XSC A;  3TBI B;  3RZD B;  4A3D G;  4BBR B;  5I2X A;  3MVV A;  1PH5 A;  2P5Z X;  3IFT A;  1I5F A;  1V9P A;  3PIP 3;  4WFN 3;  3B6Y A;  2F0L A;  2MFI A;  2L0C A;  1I4P A;  4XT3 B;  1KD1 C;  1L0X B;  4IFD I;  1YJ9 A;  4HED A;  1G2T A;  4GKK L;  4GN3 B;  2F03 A;  4RGN A;  4FF3 A;  1U5K A;  2ALY B;  1L0Y B;  4HJ8 A;  4LUV A;  4PMW A;  5C3E H;  1PFM A;  1T9H A;  3S1Q B;  1Q1E A;  4A3D B;  2PW7 A;  2A19 A;  1JQY D;  4HTH A;  1HHV A;  2FJ2 A;  1JJ2 A;  4DK0 A;  2B8G A;  1B7Y B;  1K9M C;  3CU7 A;  2NVT H;  4DV6 L;  1WFQ A;  2VQF L;  4OXP A;  5GAH C;  1R4P B;  4JI3 Q;  1A3U A;  4LF7 Q;  1CKO A;  1JOO A;  4DF7 A;  4FXG C;  4DV4 L;  5JEA G;  4B3R Q;  4C2M H;  1VQI A;  3PCO B;  3CMA A;  1FVI A;  2CVR A;  1HNW Q;  3FKI G;  2CCZ A;  2J7Z A;  1QG7 A;  4IUU A;  4TKO B;  3SVM A;  1BBW A;  1ROD A;  4XXE A;  5M9O A;  1BKB A;  5CV9 A;  2JEA I;  1B9M A;  1Y1W H;  5EKK A;  4NXN L;  1SNM A;  3ULL A;  1JWM D;  1VCI A;  3D8G A;  1SND A;  1CKN B;  1C0A A;  4C56 C;  3VR4 A;  3CRL C;  1KXL A;  2PI2 E;  4BY7 H;  4P75 A;  1SYD A;  1Q7Y C;  1MD2 D;  2R7Z H;  3MA2 B;  1L0W A;  1CM9 A;  3MXP A;  2K03 A;  2Q8R E;  3I4N H;  4DR5 Q;  4GNX B;  4UP9 A;  5C3E G;  2VNU D;  2E2H H;  5A2Q E;  3HOV B;  2JA7 G;  1GD7 A;  4C3H H;  1K28 A;  5ELC A;  3Q22 A;  3NQI A;  4PNY A;  5IP9 G;  1U4R A;  5CC4 A;  2UUB Q;  2X69 A;  3Q6S A;  4GNX A;  4A76 A;  5EPK A;  3SK5 A;  2EXD A;  3HOZ H;  4CDC C;  3CRK C;  1L2F A;  3E9H A;  1D7Q A;  3CCL A;  2F52 A;  1QNK A;  2JSO A;  3PMF A;  5LMN L;  1TVX A;  1A3T A;  1QNU A;  4YHH Q;  1A2U A;  4IUV A;  2ZM6 Q;  2M9V A;  4P72 A;  2TSS A;  5C3E B;  3RLN A;  2KBN A;  2PQE A;  2XNA C;  4K8J A;  3M4Q A;  3HOU G;  2OCE A;  2DY8 A;  4R4I A;  1IYV A;  4DNR B;  1F9R A;  1STN A;  2DN8 A;  2K4K A;  3M3Y B;  4NB3 A;  5M3M H;  3KDF B;  2D0P A;  1X3E A;  1Y1W G;  1A3V A;  3J81 c;  4OGQ C;  2N78 A;  4BS9 A;  2DY7 A;  3U4V A;  4HSV A;  3CCJ A;  4RKB A;  1DOK A;  2KOL A;  4C2M B;  1RIP A;  1SYB A;  3OPO A;  1GXD C;  2NZ1 D;  3ERS X;  3KDF A;  2UUA L;  2UXD L;  3J81 i;  3UDG A;  5GAE C;  1Y1V H;  3EIV A;  3HFZ B;  3QIA A;  2VQE Q;  1EUJ A;  4LF9 L;  4DV3 Q;  2R92 H;  3HOX H;  2R7Z G;  5IP7 H;  4JI5 Q;  1K8O A;  4ZAI A;  4A3K H;  4FP5 D;  1Y8O B;  3SXH A;  1VF5 C;  1SMX A;  3C2P A;  3CC2 A;  1R9T H;  1Y1W B;  3I4N G;  1OXS C;  1VQG A;  3PUW A;  2ZJQ A;  4NXM L;  3EFX D;  3BYY B;  1PRT B;  1TWC H;  1N8R C;  1EU4 A;  1YNJ C;  3RN2 A;  1TWH H;  5FKA C;  1VQD A;  2E74 C;  1B4O A;  4BY7 B;  4JBJ A;  4TVA B;  1B3Q A;  4R4T A;  4A93 H;  4HMJ A;  2PYK A;  4DNI A;  2R7Z B;  1CHQ D;  4F7X A;  3TN2 A;  3HOZ G;  2VW9 A;  1SFO H;  1GUT A;  3LWU A;  4Z9C B;  1RTO A;  4HJA A;  3AQQ A;  3KLR A;  3I4N B;  2LXK A;  5A35 A;  4EX5 A;  1F2M A;  2E2H B;  1VQE A;  4CGY B;  4C3H B;  5IGB A;  1DOL A;  5C0X H;  2K5W A;  1D5Z C;  2KHS A;  2A6E D;  2R93 G;  3GTK B;  1JCK B;  4L5T A;  5M3M G;  3TRZ A;  5CV7 A;  2MP1 A;  4TQU S;  1HZ9 A;  2E2I B;  3HEJ A;  3A74 A;  1VQO A;  3A7A B;  1TS2 A;  1ICW A;  3NEM A;  1FL0 A;  5CV4 A;  3BDO A;  1EQT A;  2AQ2 B;  2PZU A;  3CAM A;  2AQ3 B;  3NBH B;  4M1U B;  5NUC A;  3HKS A;  2IX0 A;  1CZW A;  1Y1V G;  2A5H A;  3QG1 A;  4A75 A;  1PZI D;  5I9P A;  2R92 G;  4BWG B;  5IP7 G;  2HHH L;  4A3K G;  4PG3 A;  4KD3 A;  3NBH A;  2XVS A;  3K59 A;  2RHS B;  1N32 L;  4IFD H;  2L15 A;  4KN4 C;  5M3M B;  3GQB A;  1VQL A;  3R8B A;  4JW0 A;  1CA5 A;  4OHJ A;  1KL9 A;  4EQN A;  1XXG A;  4B3T Q;  1CA6 A;  4DV5 L;  5IGG A;  3N52 A;  3P1H A;  2F0O A;  1LT5 D;  2C35 B;  3NWS A;  4KJN A;  1EIF A;  2N8N A;  5K36 G;  1Y1V B;  5I4D A;  3ONA B;  1XTC D;  4A93 G;  3H91 A;  1STE A;  3BZK A;  4POF A;  4X6A H;  3K7U C;  1IW7 D;  2SDF A;  3HOX B;  1V1P B;  2R61 A;  2ZJP A;  1JIC A;  5FLM H;  4A3K B;  3PO2 H;  2JA9 A;  4UPA A;  4R4C A;  5EAY A;  1LLR D;  2IHF A;  4PV1 C;  4PMC A;  4X64 Q;  3W5O A;  4HCE A;  2ES2 A;  2C9O A;  4KKS A;  1R9T B;  5JEA J;  2CQA A;  4O2D A;  4ZK9 B;  1GUN A;  1CFM A;  2RDH A;  3CC4 A;  5E1F A;  3H3V I;  4S3S A;  1V1P A;  2UXB Q;  1TWC B;  1H9M A;  3I3C A;  2JJQ A;  3JAM E;  4JOI C;  4A3F G;  3CCV A;  5C0X G;  1XWE A;  1PRT D;  1TWH B;  3BJU A;  5KNC A;  2JA8 H;  2K7V A;  2JA5 H;  4A4I A;  4DA2 A;  4LF4 L;  2FIN B;  5J22 A;  1PH6 A;  4A93 B;  4JG2 A;  1MSH A;  3Q23 A;  2MO1 A;  4DAP A;  1SFO B;  1CSP A;  3HOW H;  1CUK A;  4YY3 Q;  4BA2 I;  3GV6 A;  4DPG A;  3OMC A;  1HZA A;  5FLX c;  4UAI A;  4FDB A;  1TQO A;  3DM3 A;  3NEL A;  1X56 A;  1QVC A;  5C5M A;  5FK9 C;  2K28 A;  4J8Q A;  1EZ6 A;  4A3I H;  2A8V A;  2PW5 A;  2PNH A;  1G6Z A;  3I8Z A;  1LM0 A;  2L55 A;  4LFB L;  1N36 Q;  3C1E A;  3RNU A;  2OQ0 A;  5FOB B;  4NMZ A;  1NCV A;  1W6K A;  4K6L A;  2R7F A;  3QB3 A;  3NUC A;  2XTI A;  2BA1 A;  2EJM A;  3BYT B;  5IGD A;  4QIW B;  3S15 H;  1VMP A;  4YCV A;  1STG A;  2OT2 A;  4FNF A;  1K3R A;  1I4G A;  3PO2 G;  4MHE A;  1XNQ Q;  4OO1 H;  3C1F A;  4G7H C;  1KTK A;  2RBM A;  3CD6 A;  1SLJ A;  2L11 A;  3E9I A;  3MFG A;  1XPR A;  4JYA Q;  1KDC A;  4JI1 Q;  2L1B A;  2NN6 H;  1VQ9 A;  1NMF A;  2E8G A;  3VYR A;  1FNU A;  4C3J G;  5L37 A;  2JA6 G;  5IYB H;  1HR0 W;  1X9N A;  4BA1 I;  1U9R A;  5GRO A;  3CW2 C;  3S2D H;  4H02 A;  2F0K A;  2JA5 G;  1PFN A;  4JI3 L;  1QOH A;  5CMD A;  4DR1 Q;  4LF7 L;  1VF7 A;  1N33 Q;  4YWL A;  2N88 A;  3PO2 B;  4B3R L;  4I7Z C;  3X3N A;  2WAQ G;  4AYB B;  2EYP A;  3GTG H;  2F0W A;  4X62 Q;  1HNW L;  1SE3 A;  1S5F D;  1Y8P B;  5C3W A;  5C4H A;  3LNN A;  3K0Y A;  4KKU A;  2OWO A;  1HH2 P;  5BR8 L;  4RHS A;  1YHQ A;  4DAY A;  3HG9 A;  2KQ3 A;  4HIM A;  2CQO A;  3ZYY X;  3V05 A;  4CJ2 C;  1OXT A;  4J6H A;  1PVO A;  4Q0F A;  2JA8 B;  1U4P A;  5CV6 A;  2F0G A;  1JE5 A;  5M5W H;  3GTJ H;  1PMR A;  5J1Z A;  1CSQ A;  2EYJ A;  2WAQ B;  1MJC A;  2F0I A;  2MUY A;  3MEH A;  4DV7 L;  3G4S A;  3HOW B;  2B2Y C;  1TWF H;  1WCM H;  1JB3 A;  1BCP D;  2L12 A;  1XNR Q;  2SNM A;  3IL8 A;  4PZ6 A;  1S5D D;  4A3I B;  1OXX K;  4Q5V A;  2UXC L;  2JEB I;  1YVC A;  4A3M H;  3I4M H;  4DR5 L;  2R3Z A;  4OO1 G;  2A74 C;  1KAW A;  1LTL A;  1PYS B;  2CW0 C;  1X3G A;  5HUR A;  1AFP A;  1VQJ A;  1EEI D;  2N55 A;  1BBU A;  2UUB L;  1CZG A;  4DFA A;  1NJI C;  2E5L Q;  3SE0 A;  4IZ8 A;  5IYD H;  4C3I G;  2B2T C;  3U4Z A;  2LY7 A;  5FO7 B;  2IHE A;  4CDF C;  2L9H A;  3TZD A;  3K5N A;  3S15 B;  2VB2 X;  1E2W A;  1UEB A;  2EE1 A;  3U50 C;  4BXX H;  4DUZ Q;  3U9O A;  1WTH A;  4YHH L;  4WJ3 M;  2ZM6 L;  2EYL A;  2RDF A;  1OTC A;  1YEZ A;  4A3E H;  1R4Q B;  5EBD A;  3VYS A;  5CYU A;  3P20 A;  4OEM B;  4K2L A;  1BO0 A;  3S2D B;  5IGC A;  1M8A A;  4XQQ A;  3D6C A;  1GHJ A;  2KUM A;  1YNX A;  2Y0S B;  5C4X G;  1Q46 A;  1J9O A;  3GD7 A;  4DV0 L;  5HY6 A;  4H13 C;  3GTG B;  2PQA B;  4B9X A;  3TSS A;  3R93 A;  4DV3 L;  1WCM G;  3T53 B;  1Q86 C;  4MN3 A;  4JI5 L;  3J81 L;  1LAC A;  4HCS A;  1G6P A;  3J80 E;  1ESR A;  4RA8 A;  1F2Y A;  4XT1 B;  1JMC A;  4A3M G;  2PQA A;  5D3I B;  3I4M G;  1PDQ A;  1X3Q A;  1Y69 U;  2WIN B;  1SR3 A;  3BS1 A;  1X3P A;  4ULL A;  5M5W B;  4P2C B;  3GTJ B;  1QZG A;  3M4P A;  2WII B;  3MFY A;  2LSS A;  5LMU L;  3CME A;  2IY5 B;  2B63 H;  5IYD G;  1WCM B;  1GKH A;  2LS0 1;  5C0X J;  1UAP A;  3W1B A;  1MHW C;  4APV A;  1UEA B;  3KBG A;  1SMY C;  1PTO C;  2WB1 B;  1JC7 A;  5COR A;  4IUP A;  2HQE A;  4IUR A;  3CC7 A;  1GM5 A;  4BXX G;  4LK1 C;  2NTT A;  2K52 A;  1GUW A;  3TP5 A;  3I4M B;  1I4X A;  4DR6 Q;  2I0Q A;  4KHP Q;  4RWS C;  1AEX A;  1Q12 A;  3S24 A;  4DUY Q;  1M4V A;  4A3E G;  4LNQ A;  4DU9 A;  3FMC A;  2RQX A;  3L7Z C;  3F2B A;  2EYO A;  1G51 A;  5AFW A;  5J39 A;  5CR3 A;  3I56 A;  1EY7 A;  4RG1 A;  4IFD J;  2DNC A;  3CKI B;  3FKI H;  3NE5 B;  1QB5 D;  1UE6 A;  4JI2 Q;  1PHJ A;  3NTH A;  2F0D A;  3NHH A;  5JVG 3;  3BZD B;  1LT4 D;  5EPJ A;  5C0X I;  2YTX A;  4P73 A;  3OTO L;  4DAV A;  4ZCK A;  3Q8D A;  4CJ1 B;  4A3E B;  2RCN A;  4J1M A;  1EY9 A;  1OO9 B;  1Q90 A;  4LF8 Q;  3KF8 B;  2ENB A;  1TS3 A;  2D2C C;  3A8K E;  1NR4 A;  4IO9 A;  1WTW A;  1ILP A;  1NMG A;  2M00 A;  4DR3 Q;  4GOP B;  5FO8 B;  5IOD A;  4B3T L;  1TY2 A;  3DHQ A;  1HFN A;  1LTT D;  3KF8 A;  4LFC Q;  3S1M H;  3J7A V;  1HNX L;  4AH6 A;  5KRU A;  5ELN A;  5IE8 A;  1MBY A;  1HXY D;  4X3U A;  2B63 G;  1JJG A;  1STY A;  4OX9 L;  1HQR D;  4J15 A;  1ENC A;  2I5H A;  1VQA A;  2F3W A;  1KNE A;  2Z6K C;  2Q2H A;  3H0G G;  5I6Y A;  4LW1 A;  2JA7 H;  2A69 C;  3MWY W;  5IP9 H;  1MI2 A;  2B2V A;  3NBI A;  4IPG A;  1TR5 A;  4K2K A;  2UXB L;  1VQN A;  3IKJ A;  1V43 A;  2F1M A;  5M5X H;  3BZC A;  1RL2 A;  2K50 A;  1ML0 D;  1U4M A;  2B63 B;  3K80 C;  5E4W C;  4A3J H;  1H9R A;  2Z1C A;  1EL0 A;  3OW2 A;  3F2U A;  4JC0 A;  4QF4 A;  2KCM A;  4L5R C;  1EWC A;  2JXM B;  3PIO A;  4RHR A;  2FFK B;  4YY3 L;  3HOU H;  2KEC A;  1SE2 A;  2QGQ A;  5CV5 A;  3FHW A;  4A3B G;  1HUM A;  3CPF A;  1PH7 A;  5JJL A;  1ASY A;  1SE8 A;  2AUK A;  2IPK D;  4KLK A;  1FNW A;  2KCC A;  2QW7 A;  3OHX C;  4OIK A;  5CBA E;  1EY4 A;  1N36 L;  1II3 A;  2PO4 A;  1RF2 D;  1TS4 A;  5FLX L;  2YU9 B;  2HUG A;  1RDP D;  4KY6 A;  3FKI B;  1CI3 M;  2BA0 A;  3C46 A;  2ATW A;  1XX8 A;  4IPC A;  1I3Q H;  1PZJ D;  2KED A;  2BE5 C;  4JI4 Q;  2EJG C;  1CKN A;  2FHT A;  1TT2 A;  1QE6 A;  1WD0 A;  1B3A A;  1KRT A;  4IOA A;  3STB C;  4EQ5 A;  1RHP A;  4EGV A;  1XNQ L;  4IUN A;  2CWA A;  5BN3 A;  2K5V A;  3EQL C;  4JYA L;  2F0M A;  4FYD A;  4JI1 L;  4JK1 C;  4Y7N H;  4KD4 A;  1NY4 A;  3UDF A;  4C1N I;  3A8J E;  2B2U A;  1YHB A;  1H9K A;  1FGU A;  4RCN A;  1IZ6 A;  2O5I C;  4BY1 G;  1PH9 A;  2KJX A;  5I6W A;  3H15 A;  4B9W A;  4OO1 I;  4A3J G;  4X3S A;  4DR1 L;  4AQY Q;  1M1K C;  3EJI A;  1N33 L;  3TQY A;  3AU7 A;  3QOL A;  1HNZ Q;  2B2W A;  1D1K A;  4G7O C;  2NN6 I;  1MSG A;  4QQB X;  4KJO A;  1S5B D;  3UDX A;  4IJH A;  4X62 L;  1S3O A;  1EZ8 A;  1ZKO A;  1LTI D;  2VL6 A;  2JA7 B;  2IWH A;  1J8I A;  1PH4 A;  2RVL A;  2K1B A;  2IX3 A;  1EU3 A;  2R93 H;  2D62 A;  1Z47 A;  2WKC A;  3Q24 A;  3U9S A;  1E1O A;  1KLG D;  2NVT B;  4PZ8 A;  5M5X B;  1NR2 A;  1I94 Q;  2Q2U A;  3G6J B;  1PV4 A;  4JBM A;  5DM6 3;  4A3J B;  2PPB C;  5F2D A;  4JV5 Q;  4DR2 Q;  4O1N A;  3I72 A;  4IPH A;  2AQ1 B;  3J81 j;  4IJL A;  5C4J H;  3ND8 A;  1W2B A;  2R7D A;  2B39 A;  3RMH A;  1Q8K A;  4O42 A;  5D14 A;  3HOU B;  3PO3 G;  1O7I A;  1XNR L;  2X6L A;  5IT9 E;  4GZY C;  5IGF A;  4R9W A;  3VYT A;  4OWX B;  4DXG A;  2K04 A;  3D31 A;  1P8L A;  4RGT A;  5BN4 A;  5C44 G;  3MHB A;  1WTQ A;  2XGT A;  2O4X A;  4ZUI A;  4NPS A;  1LTR D;  5EKI A;  3BU2 A;  1SMY D;  2GA4 B;  3DXJ C;  4B3M Q;  3PV0 A;  4DR7 L;  1PTO D;  3SK8 A;  1ILQ A;  5K36 H;  1HTP A;  3K81 C;  2UU9 Q;  2SOB A;  3E0J A;  2ZXP A;  1GJX A;  1KAA A;  1KQS A;  5G3L D;  1I3Q B;  4H7B A;  2HIV A;  2IW3 A;  4CKB A;  2EY1 A;  1IL8 A;  4JI7 L;  3I4L A;  4DK6 C;  2E2J H;  3V96 A;  4DAM A;  1CQF A;  4V19 0;  4DUZ L;  4K14 A;  4GKJ Q;  3TME A;  1IHZ A;  2HDM A;  4MTN A;  5ELD A;  2A6H C;  3KOJ A;  2LXJ A;  4A3F H;  4MIU A;  4Y7N B;  1LTA D;  2YV5 A;  1E24 A;  1H9J A;  1SYE A;  2H5X A;  4FF4 A;  2XIW A;  2B8F A;  2YTY A;  2KCT A;  1GUS A;  2DJG C;  3HOZ B;  3VYU A;  3CCM A;  2PZW A;  1ET9 A;  1TII D;  3VDY A;  1EYD A;  3KYH C;  1QWY A;  2NUC A;  4RKL A;  2F4I A;  4CKC A;  2B3G A;  3HKZ G;  1L1O C;  1K3B C;  2XRS D;  1UUP A;  1ENA A;  5ISR A;  2R93 B;  4OON A;  1IKL A;  5IYC G;  1X6O A;  1PFB A;  4ME3 A;  4MZ9 A;  2IT1 A;  2F4V Q;  3MAQ A;  4UP7 A;  2Q2I A;  1VDZ A;  3UE1 A;  2JP1 A;  3CHB D;  1DON A;  5C6A A;  4WRD A;  2F0S A;  1EYA A;  1F2L A;  2BH2 A;  4QUC A;  5C4J B;  2NVQ H;  1IBM Q;  3EVQ A;  2R92 B;  1EEF D;  1O7Z A;  1ZXT A;  2GVB A;  1LYL A;  3ERO A;  1HR0 Q;  1CHP D;  1STB A;  2K5N A;  3CF5 A;  3HOY H;  1HA6 A;  1FYC A;  3I70 A;  2X6G A;  2V1C C;  3HKZ E;  3JAM c;  3T1Y L;  2FMM A;  4BBS H;  4QUF A;  4KHP L;  4DUY L;  2DNE A;  3DUZ A;  1LV9 A;  5FJ8 H;  1IKM A;  4C3J H;  2JA6 H;  3TEH B;  4X65 L;  4IUT A;  1HRJ A;  1N34 Q;  3R2I A;  2MQH A;  1C4Q A;  4LF5 Q;  1SRO A;  2E76 C;  3GTP H;  1GUO A;  1WTP A;  3S16 H;  1WJJ A;  3NPP A;  3PQI A;  4K5V A;  1BCP B;  4JI2 L;  3NXW A;  1SNP A;  4KN7 C;  2E2J B;  2GN5 A;  1NNX A;  3TP8 A;  5J3B A;  1SAP A;  2YYZ A;  4A3F B;  4LF8 L;  3RLF A;  4H0L C;  4QJF A;  1VQ5 A;  1EOV A;  4CJ0 B;  1E3P A;  3MXU A;  3GTL H;  4DR3 L;  3CCE A;  2F0H A;  3NTI A;  2DJF C;  4ZKB B;  3RZO H;  1X3F A;  2K05 A;  1I50 H;  4LFC L;  3VA7 A;  1S5C D;  2PCF B;  4QL5 A;  4A3L G;  4U67 3;  1UWV A;  2MGS A;  1RTN A;  1V8Q A;  3HZX A;  5GQO A;  1W6J A;  3CCU A;  1SRU A;  1YNN C;  1B53 A;  1F9S A;  1XTD A;  3HOY G;  1PH8 A;  4XDX A;  4QCL A;  4NDX A;  1G29 1;  2ZXR A;  3GTM H;  2ZTE A;  1AP0 A;  5D3D A;  4BBS G;  4I65 A;  4YCU A;  5FJ8 G;  4IAL A;  2DGY A;  3J7A F;  4C3I H;  3M4Y A;  1ZYR C;  4DGZ A;  4XIG S;  1Q81 C;  1WTV A;  1DXM A;  2NVQ B;  4G57 A;  3PUV A;  1VQK A;  4LMQ D;  3T1H Q;  1H95 A;  3G71 A;  2D0O A;  2VZA A;  2BCO A;  4NP5 A;  2QEJ C;  2BH8 A;  1OXU A;  3PIO 3;  1M90 C;  4JI0 Q;  2RCF A;  2F0J A;  2EY6 A;  3F8T A;  3TS2 A;  1HA5 A;  2E75 C;  2F0V A;  2F0Q A;  3ZJY C;  1SJH D;  2KEE A;  2ZTC A;  5DNF A;  4C3J B;  1IBL Q;  3K5M A;  2JA6 B;  4QY7 A;  4MNO A;  5FO9 B;  1XYI A;  1A2T A;  2NWG A;  5TSS A;  3WWV A;  1GOZ A;  2F0N A;  1AN8 A;  2Z4H A;  5H1S E;  1DYQ A;  3FPU B;  3I55 A;  3A5U A;  2JA5 B;  2M2L A;  4HN7 A;  1MGS A;  1Q3L A;  5C4X H;  5JJZ A;  3OIP A;  4KMU C;  4DV2 Q;  3AFQ A;  1CK1 A;  1CT1 D;  1Y8N B;  4RAU C;  2B29 A;  3K6O A;  4FVM A;  3S16 B;  3SEB A;  3FDT A;  3MC0 B;  4L5Q A;  4LAA A;  1EFI D;  2WAC A;  5IIF A;  3KF6 B;  4JI4 L;  1YNJ D;  3LGJ A;  3SK6 A;  1EOT A;  4RFB A;  2F0U A;  3ERQ A;  2CH4 W;  2XWB B;  3BG3 A;  2Z9H A;  2AKW B;  4LFA Q;  3QJY A;  3KF6 A;  3FPP A;  5IY0 A;  1C9O A;  2JE6 I;  1LAB A;  1VS0 A;  1VMC A;  3RZO B;  4PZ7 A;  1I50 B;  5A2Q L;  3GTQ H;  1PA6 A;  2Z8L A;  1PRT F;  2Q8I B;  2VUM G;  1F9Q A;  3P75 A;  2QKI C;  2HDL A;  3CCR A;  4V0B A;  4GLX A;  4AQY L;  1AZP A;  4CHT B;  3F2C A;  1I4H A;  1TXY A;  4R4Q A;  1LT3 D;  1HNZ L;  1HUN A;  1D6E C;  3O13 A;  2DUD A;  2KHI A;  1VQ7 A;  5I9O A;  1JB7 A;  2IL8 A;  4LUZ A;  3GTM B;  1ICF B;  4L63 B;  2Q2T A;  1SJE D;  1KLU D;  4IUQ A;  1EY8 A;  5CGK A;  2UUC Q;  4C3I B;  4KTA A;  1EQQ A;  4JI8 Q;  1I6H H;  2PMZ B;  3D0F A;  1EY0 A;  1I94 L;  2ZTD A;  4Y52 H;  3VR5 A;  1IYJ B;  4JV5 L;  1KHI A;  4DR2 L;  1K8G A;  3MXG A;  2K01 A;  3J80 c;  2VQE L;  5LMN W;  1FGB D;  3D4D A;  4XQJ A;  1X54 A;  2F0P A;  1JWS D;  4QMG A;  4BBR H;  3J7Z C;  3DWP A;  1TWG H;  3E5S A;  2OQK A;  1CQV A;  4JBK A;  1T5E A;  2EYH A;  2I07 B;  5GAD C;  1A63 A;  2WV6 D;  1XMO Q;  4I7A A;  3T51 B;  3S9W A;  5C4X B;  2L5T A;  2VB3 X;  4B3M L;  3H3V C;  2HHH Q;  4X3T A;  4JPB W;  2UU9 L;  1TWF B;  4ZUJ A;  2R6G A;  4G7Z C;  4DNT B;  1SDF A;  1C48 A;  3S1Q H;  4RMF A;  1EIY B;  5COY A;  2RSO A;  1NSN S;  1SYG A;  3H0G H;  5EGT A;  2I5M X;  4DV1 Q;  4A3M B;  4HMI A;  3NEN A;  1VQ8 A;  5C4Z A;  3ICE A;  3RD4 A;  4HID A;  4RCO A;  1Q1B A;  3D4R A;  3K5L A;  1FJG Q;  1PH2 A;  4RGO S;  1WTX A;  4DK3 C;  4B08 A;  4HJ7 A;  5CBE E;  5JJI A;  1IXR A;  1D2B A;  5KND A;  4AIM A;  2RSN A;  3M4O H;  1PTO H;  4O0A A;  5JOB A;  1VQF A;  1QJO A;  1Z7T A;  4KK7 A;  3SGI A;  1LO5 D;  3A56 A;  3T4A C;  3N6R A;  2ICI A;  1V1O A;  3M7N A;  2EDG A;  4EVO A;  5EQ0 A;  3VA5 A;  2F3V A;  4A3B H;  2A1A A;  1AE2 A;  1BCP F;  4B3S Q;  2EYM A;  2E2D C;  4GLV B;  3S1R H;  1S4Z A;  4A3G H;  2B2U C;  3VR3 A;  4GNX C;  1IBK Q;  4BBR G;  5DLQ E;  3CQZ H;  2V4D A;  1JWU D;  3KUP A;  4HIK A;  1I6H B;  2EY5 A;  1E2V A;  1BR9 A;  1EWI A;  2NZH A;  2A6E C;  3A7L A;  2F4V L;  2A68 C;  1J5E Q;  5LHY 1;  1EQR A;  2AUJ D;  1YNN D;  3P7J A;  3PF5 A;  1QVF A;  2EY2 A;  1IBM L;  3E3X A;  3OYY A;  4GOP A;  2O5J C;  1D5X C;  3I7F A;  2KCN A;  3VR6 A;  3L9A X;  1HR0 L;  5GAG C;  1NE3 A;  1VQH A;  5M3F H;  1GVP A;  1PH3 A;  2Z0S A;  5EKL A;  1ZYR D;  2QF7 A;  2ICE C;  5T1G A;  4HIO A;  4X64 L;  2EYF A;  1QZH A;  1TWG B;  1D5M C;  3K0X A;  4N9P A;  4P71 A;  2KVM A;  3ULP A;  3PUY A;  3E6Z X;  4DK1 A;  3AB9 A;  3HGB A;  2J4X A;  4ABN A;  1GHK A;  2AHO B;  4H44 C;  3F2D A;  4BY1 H;  4L8J A;  3KK7 A;  1N34 L;  3BVZ A;  1YJW A;  2VS1 A;  5ELB A;  2WP8 J;  1ENF A;  2XWJ B;  4ZYS A;  3JAM L;  4LF5 L;  2KEN A;  3S14 H;  2H4O A;  4LWC A;  3TP7 A;  3MTS A;  1HPC A;  3H0G B;  1IW7 C;  4K8I A;  1K8M A;  1YIT A;  3NTK A;  2EZV A;  1IL2 A;  1STA A;  5K5P A;  3TS0 A;  2BOS A;  3M3Y H;  5EBC A;  1K73 C;  2CFM A;  2NB0 A;  3GDE A;  5EJW A;  4L6T B;  3L0O A;  5DEH A;  2HQL A;  4A3G G;  1QIL A;  2QIL A;  4YWM A;  3AEV A;  2KA7 A;  4K5W A;  3SDZ A;  3SR1 A;  2K32 A;  3G48 A;  3M4O B;  1HFG A;  1PRT C;  1PTO B;  1JJC B;  3D3R A;  5BR8 Q;  1KNA A;  4ZLT F;  4JBW A;  1EYC A;  2PI2 A;  2K6A A;  5DAU A;  4N9T A;  4DR4 Q;  3PO3 H;  4ILW A;  2CW0 D;  1X55 A;  3QO2 A;  2D9U A;  3TRE A;  4A3B B;  1EIH A;  1JOR A;  1F9P A;  4TRD A;  3S1R B;  2ZJR A;  5C44 H;  3HOV G;  1YZ6 A;  5M3F G;  1KC8 C;  4A3G B;  3JC6 6;  5LL6 X;  3G6E A;  4KI0 A;  1NBW A;  1X65 A;  2F0E A;  2C5C A;  3M9B A;  3CQZ B;  4DV7 Q;  1YIJ A;  4K6D A;  1WOC A;  4C1N K;  1XPU A;  2A73 B;  3CCS A;  3S1M B;  3EBE A;  2EIF A;  1W3S A;  1UE7 A;  1YI2 A;  2UXC Q;  3T16 A;  4OWT B;  3T1H L;  4LF6 Q;  5BN5 A;  2LMC B;  1WD1 A;  5M3F B;  2N3S A;  1JOQ A;  4JI0 L;  3I90 A;  4QB4 A;  4YCW A;  3E0E A;  4DXF A;  4ALP A;  1KDB A;  2KHJ A;  3GTK H;  1MKH A;  4FXD A;  2CWP A;  2E2I H;  3S1N H;  3I91 A;  4UP8 A;  3KJO A;  1IBL L;  2EVB A;  3H09 A;  3GO5 A;  4GN5 A;  5M5Y H;  1XMQ Q;  4BY1 B;  2OTJ A;  3M85 A;  4K0K Q;  4YIJ A;  1PLF A;  5IWA Q;  1IYU A;  2NVY H;  1PZK D;  4DV2 L;  3S14 B;  4EQO A;  4HR7 B;  5IT9 c;  4K5X A;  3A54 A;  4GLA C;  1U4L A;  3NP8 A;  3Q0A A;  1S40 A;  1FNV A;  4R8N A;  2Z6K A;  3CCQ A;  3DLL A;  4M8A A;  3J7Y W;  2OTL A;  3GTO H;  5IYC H;  3NSW A;  1JR0 D;  5ELO A;  4XYO A;  3OWE B;  2QDL A;  2EPB A;  3KJP A;  4ZRZ A;  3T13 A;  4DV0 Q;  3J81 E;  2NTS A;  3R3O A;  1A15 A;  3RUZ A;  3AMU A;  4LFA L;  1A0I A;  1KRS A;  4BY7 G;  4XQN A;  2HT1 A;  3I73 A;  1LUZ A;  5KNB A;  3J7A 5;  2HCC A;  3OSO A;  5T1I A;  2CHB D;  1LTG D;  2E5L L;  4CBV A;  2RA4 A;  1GO3 E;  1LTS D;  3EA6 A;  3HS0 C;  3PO3 B;  4JI6 Q;  2MO0 A;  4ID6 A;  4OWW B;  2K5H A;  1SNC A;  3I2Z A;  1MJE A;  2F0F A;  4HSP A;  4L5S A;  1JE4 A;  1BCP C;  4IN3 A;  5C44 B;  1YHA A;  3HRZ C;  4TSS A;  4WJW A;  4C3H G;  3C3L A;  1DJR D;  4KV6 A;  1PYB A;  5LMU Q;  1SXT A;  3IAY A;  3CXC A;  5KYL A;  4KY7 A;  1RJT A;  2AWO A;  1HQM C;  1XJV A;  2YTV A;  2EQS A;  4A3C H;  2AMC B;  4LUO A;  2UUC L;  3UE0 A;  1QCB D;  4JI8 L;  1VQB A;  3OOC A;  1BQQ T;  3FRP B;  4ME5 A;  1KIX A;  2K14 A;  4HJ5 A;  5LL6 S;  3D4W A;  2H1E A;  3W2D A;  1BF4 A;  2VXW A;  1O7L A;  4FO2 A;  5AJ3 Q;  2A68 D;  1D1I A;  2IX1 A;  4IOC A;  2EXZ A;  3S1N B;  1B2T A;  4OIJ A;  3DWQ A;  1PXU A;  3TP6 A;  5KIX A;  5M5Y B;  3ULJ A;  1WTR A;  2GVA A;  2XN9 C;  2NVY B;  4X66 Q;  3J80 L;  1XMO L;  1I6V C;  2LFN A;  3KLW A;  3OTO Q;  4A3L H;  4OEL B;  2FMC A;  3HOX G;  1N9W A;  5IOC A;  1VQ6 A;  2A69 D;  3HKZ B;  3AFP A;  5KGU A;  3OWF A;  1Z6H A;  3V2T A;  2RHQ B;  3GTO B;  2VY3 A;  5JVH 3;  2F3I A;  1KDA A;  4DV1 L;  3PIP A;  3D6W A;  1PH1 A;  3OMG A;  4DR6 L;  1HNX Q;  2EJF C;  1FJG L;  1TS5 A;  1UNS A;  2BDN A;  3UDI A;  1F77 A;  3W3A A;  1WYD A;  3JAM i;  1B8A A;  4OX9 Q;  4GKK Q;  3M7G A;  1EIG A;  4A3C G;  3MZ5 A;  4FXK C;  1ZEQ X;  1E7Z A;  3BDC A;  3X3M A;  1JOK A;  1ONL A;  4HAE A;  2MNA A;  1CTM A;  1TKW B;  4ZKC B;  3DWA A;  1WTO A;  4R8I A;  4N8F A;  3IFD A;  3K8A A;  3CPW A;  1HZB A;  2JK8 A;  2ZT9 C;  1BUV T;  2VQF Q;  2MHV A;  4DV6 Q;  1E22 A;  4B3S L;  2G9H D;  4NKL A;  1PYW D;  4DV4 Q;  3ER0 A;  4PQX A;  2O2L D;  1PFS A;  1IBK L;  3KLS A;  5D65 A;  1B50 A;  3I4O A;  2BE5 D;  2CH4 A;  2Z4I A;  3BVM A;  1ET6 A;  2BDO A;  2RF4 A;  4IPD A;  3TZU A;  1NTG A;  1EFW A;  3GV3 A;  1J5E L;  3EN2 A;  1TWA H;  3STB D;  1VQP A;  4UDU C;  3ITP A;  1I4Q A;  5KYI A;  1BVS A;  5JAV A;  1PTO F;  3KBX A;  3QOJ A;  3U58 A;  2QEX A;  1JT8 A;  2NBF A;  5JPN C;  5FLX E;  2WKD A;  3A8I E;  4JVZ A;  2SEB D;  5G3L F;  1G8Z D;  1BNZ A;  4NXN Q;  4IFD G;  1HTL D;  5DM7 3;  3T56 B;  3RN5 A;  2LKV A;  1SNO A;  2NVX H;  5CV8 A;  3PUX A;  5HGQ A;  1DOM A;  3WDN A;  2EOT A;  1DZ1 A;  2JQO A;  1Y14 B;  2Z6B A;  1SE4 A;  2NYZ D;  1NUC A;  1SN8 A;  2VUM H;  1L1O B;  5EPL A;  2RDG A;  5FLM G;  1J6Q A;  1SYF A;  4AYB G;  1RCV D;  4R1J A;  4X3K A;  1SSO A; 
#chains in the Genus database with same CATH homology
 4U68 A;  5ELF A;  2K5Q A;  3NK9 A;  1G91 A;  3LWE A;  5IGE A;  3HOY B;  1F2Z A;  1WVL A;  2Q8T A;  2OXP A;  5KEE A;  4BBS B;  4E6I A;  1X32 A;  3SHL A;  4RGM A;  3A55 A;  3VR2 A;  4ZQ3 A;  3URY A;  1DCZ A;  2TMP A;  1O7Y A;  2HCI A;  2SNS A;  2AWN A;  1H9S B;  3K57 A;  3GTP B;  4XYQ A;  3H94 A;  4G4K A;  4OL7 A;  4XTC S;  2MJ8 A;  2J0T D;  1H9S A;  1BDO A;  3UI2 A;  1LT6 D;  1E2Z A;  1RKN A;  1EWH A;  1STH A;  3GTL B;  3DEP A;  1TWA B;  4CKE A;  1KAB A;  3K5O A;  1EY6 A;  3K58 A;  1T5X D;  2ZXO A;  3DEO A;  2A6H D;  4KKT A;  3HP3 A;  1NAP A;  1BXT A;  2NN6 G;  2NVX B;  1I4R A;  1B44 D;  2PNR C;  1SBB B;  1S5E D;  2D5D A;  3MXN A;  3ND9 A;  3PUZ A;  1AW7 A;  2JYO A;  1HCZ A;  1OXV A;  1O78 A;  4FF2 A;  2VUM B;  3SK4 A;  5JPM C;  4F8M A;  1DD2 A;  2I46 A;  2L4N A;  3OW7 A;  4PMB A;  2G9D A;  3FVQ A;  2F0T A;  4KHZ A;  2B2V C;  2PZT A;  5E4X A;  3BDL A;  4F88 A;  2IJ0 A;  5E3F A;  1BBX C;  3NQT A;  3G7L A;  3OIQ A;  1TY0 A;  3DM1 A;  1E0B A;  5IT9 L;  1RD9 D;  5C3X A;  1BOS A;  1FR3 A;  3BVG A;  1Q8I A;  2K33 A;  1LTB D;  2QCP X;  3WOE A;  3DMU A;  1DM0 B;  1G2S A;  3WOF A;  5I2Y A;  3FEW X;  3R2T A;  4FF1 A;  4IQZ A;  2ID0 A;  4F87 A;  1A6X A;  3GTQ B;  2OEO A;  4ODG A;  3LX0 A;  5C5L A;  3L3O C;  3K7A B;  2K5D A;  3GP7 A;  1SNQ A;  1TU2 B;  1GUG A;  2B2Y A;  3KLS X;  2XRQ D;  1B9N A;  5HGT A;  3TDQ A;  2OF1 A;  4KHV A;  1C8C A;  4LJZ C;  1SYC A;  4EQP A;  1FD7 D;  1ESF A;  4NW2 A;  3NWT A;  5JEA H;  1O80 A;  3S2H B;  2QDB A;  4KY5 A;  1EQV A;  4WOR A;  5ELE A;  1B1Z A;  2RKS A;  1SEB D;  1EY5 A;  2MPM A;  2B2T A;  2B2W C;  1K83 B;  3QWN A;  1AZQ A;  4DN4 M;  3S17 B;  3H6M A;  4RH6 A;  2XSC A;  3TBI B;  3RZD B;  4BBR B;  5I2X A;  3MVV A;  3IFT A;  3PIP 3;  4WFN 3;  2F0L A;  2L0C A;  1I4P A;  4XT3 B;  1L0X B;  4IFD I;  4HED A;  1G2T A;  2F03 A;  4RGN A;  4FF3 A;  1L0Y B;  4PMW A;  1PFM A;  3S1Q B;  1Q1E A;  4A3D B;  2PW7 A;  1JQY D;  4HTH A;  1HHV A;  2FJ2 A;  4DK0 A;  2B8G A;  3CU7 A;  1R4P B;  1A3U A;  1JOO A;  4DF7 A;  4FXG C;  5JEA G;  2CVR A;  2J7Z A;  1QG7 A;  4IUU A;  4TKO B;  3SVM A;  1ROD A;  4XXE A;  5M9O A;  5CV9 A;  2JEA I;  1B9M A;  5EKK A;  1SNM A;  1JWM D;  1VCI A;  3D8G A;  1SND A;  4C56 C;  3VR4 A;  3CRL C;  1SYD A;  1MD2 D;  3MA2 B;  1CM9 A;  3MXP A;  2K03 A;  2Q8R E;  2VNU D;  5A2Q E;  3HOV B;  3Q22 A;  5ELC A;  3NQI A;  4PNY A;  1U4R A;  5CC4 A;  2X69 A;  3Q6S A;  5EPK A;  3SK5 A;  3CRK C;  2JSO A;  1QNK A;  3PMF A;  1TVX A;  1A3T A;  1QNU A;  1A2U A;  4IUV A;  2M9V A;  2TSS A;  5C3E B;  4K8J A;  2PQE A;  2XNA C;  2DY8 A;  1IYV A;  4DNR B;  1F9R A;  1STN A;  2DN8 A;  3M3Y B;  1A3V A;  4OGQ C;  4BS9 A;  2DY7 A;  4HSV A;  4RKB A;  1DOK A;  2KOL A;  4C2M B;  1SYB A;  3OPO A;  1GXD C;  2NZ1 D;  3QIA A;  1K8O A;  4ZAI A;  4FP5 D;  1Y8O B;  3SXH A;  1VF5 C;  3C2P A;  1Y1W B;  1OXS C;  3PUW A;  3EFX D;  3BYY B;  1PRT B;  1EU4 A;  1YNJ C;  5FKA C;  2E74 C;  1B4O A;  4BY7 B;  4HMJ A;  2PYK A;  2R7Z B;  1CHQ D;  4F7X A;  3TN2 A;  1GUT A;  3LWU A;  4Z9C B;  1RTO A;  3I4N B;  3KLR A;  5A35 A;  1F2M A;  2E2H B;  4CGY B;  4C3H B;  5IGB A;  1DOL A;  5C0X H;  2K5W A;  1D5Z C;  2KHS A;  2A6E D;  3GTK B;  1JCK B;  5CV7 A;  2MP1 A;  4TQU S;  2E2I B;  3HEJ A;  3A7A B;  1TS2 A;  1ICW A;  5CV4 A;  3BDO A;  1EQT A;  2AQ2 B;  2PZU A;  2AQ3 B;  4M1U B;  5NUC A;  2IX0 A;  1CZW A;  2A5H A;  3QG1 A;  1PZI D;  5I9P A;  4BWG B;  4KD3 A;  3NBH A;  2XVS A;  3K59 A;  4IFD H;  4KN4 C;  5M3M B;  3GQB A;  3R8B A;  1CA5 A;  4OHJ A;  4EQN A;  1XXG A;  1CA6 A;  5IGG A;  3N52 A;  3P1H A;  2F0O A;  1LT5 D;  3NWS A;  4KJN A;  5K36 G;  1Y1V B;  5I4D A;  3ONA B;  1XTC D;  3H91 A;  1STE A;  3HOX B;  1IW7 D;  2SDF A;  1V1P B;  2R61 A;  1JIC A;  4A3K B;  1LLR D;  4PV1 C;  4PMC A;  4HCE A;  2C9O A;  4KKS A;  1R9T B;  5JEA J;  2CQA A;  4ZK9 B;  1GUN A;  1CFM A;  2RDH A;  5E1F A;  4S3S A;  1V1P A;  1TWC B;  1H9M A;  3I3C A;  3JAM E;  5C0X G;  1XWE A;  1PRT D;  1TWH B;  5KNC A;  2K7V A;  4DA2 A;  2FIN B;  5J22 A;  4A93 B;  1MSH A;  3Q23 A;  4DAP A;  1SFO B;  4BA2 I;  3GV6 A;  3OMC A;  4UAI A;  1TQO A;  5C5M A;  5FK9 C;  2K28 A;  4J8Q A;  1EZ6 A;  2PW5 A;  1G6Z A;  3I8Z A;  2L55 A;  3C1E A;  5FOB B;  4NMZ A;  1NCV A;  1W6K A;  4K6L A;  3QB3 A;  3NUC A;  3BYT B;  2BA1 A;  2EJM A;  5IGD A;  4QIW B;  1VMP A;  1STG A;  2OT2 A;  4FNF A;  1I4G A;  4MHE A;  4OO1 H;  3C1F A;  4G7H C;  1KTK A;  2RBM A;  2L11 A;  3MFG A;  1KDC A;  2L1B A;  2NN6 H;  3VYR A;  1FNU A;  4C3J G;  4BA1 I;  1U9R A;  2F0K A;  1PFN A;  1QOH A;  5CMD A;  1VF7 A;  2N88 A;  3PO2 B;  4I7Z C;  3X3N A;  4AYB B;  2EYP A;  2F0W A;  5C3W A;  1SE3 A;  1S5F D;  1Y8P B;  5C4H A;  3LNN A;  3K0Y A;  4KKU A;  4RHS A;  4DAY A;  3HG9 A;  2KQ3 A;  3ZYY X;  3V05 A;  4CJ2 C;  1OXT A;  4J6H A;  4Q0F A;  2JA8 B;  1U4P A;  5CV6 A;  2F0G A;  1PMR A;  5J1Z A;  2EYJ A;  2WAQ B;  2F0I A;  2MUY A;  3MEH A;  3HOW B;  2B2Y C;  1JB3 A;  1BCP D;  2L12 A;  2SNM A;  3IL8 A;  1S5D D;  4A3I B;  1OXX K;  4Q5V A;  2JEB I;  2R3Z A;  4OO1 G;  2A74 C;  2CW0 C;  5HUR A;  1AFP A;  1EEI D;  2N55 A;  1CZG A;  4DFA A;  3SE0 A;  4IZ8 A;  4C3I G;  2B2T C;  2LY7 A;  5FO7 B;  2L9H A;  3TZD A;  3K5N A;  3S15 B;  2VB2 X;  1E2W A;  2EE1 A;  3U9O A;  2EYL A;  2RDF A;  1R4Q B;  5EBD A;  3VYS A;  5CYU A;  3P20 A;  4K2L A;  1BO0 A;  3S2D B;  5IGC A;  1M8A A;  4XQQ A;  3D6C A;  1GHJ A;  2KUM A;  2Y0S B;  1J9O A;  3GD7 A;  4H13 C;  3GTG B;  4B9X A;  3TSS A;  3R93 A;  3T53 B;  4MN3 A;  3J81 L;  1LAC A;  4HCS A;  3J80 E;  1ESR A;  4RA8 A;  1F2Y A;  4XT1 B;  5D3I B;  1PDQ A;  1X3Q A;  1Y69 U;  2WIN B;  3BS1 A;  1X3P A;  4ULL A;  5M5W B;  4P2C B;  3GTJ B;  2WII B;  3MFY A;  1WCM B;  2LS0 1;  5C0X J;  1UAP A;  1UEA B;  3KBG A;  1SMY C;  1PTO C;  2WB1 B;  1JC7 A;  5COR A;  4IUP A;  2HQE A;  4IUR A;  1GUW A;  4LK1 C;  2NTT A;  3TP5 A;  3I4M B;  1I4X A;  4RWS C;  1AEX A;  1Q12 A;  1M4V A;  4DU9 A;  3FMC A;  2RQX A;  3L7Z C;  2EYO A;  5AFW A;  5J39 A;  5CR3 A;  1EY7 A;  4IFD J;  2DNC A;  3CKI B;  3NE5 B;  1QB5 D;  3NTH A;  2F0D A;  3NHH A;  5JVG 3;  3BZD B;  1LT4 D;  5EPJ A;  5C0X I;  4DAV A;  4CJ1 B;  4A3E B;  4J1M A;  1EY9 A;  1OO9 B;  1Q90 A;  2ENB A;  1TS3 A;  2D2C C;  3A8K E;  1NR4 A;  1WTW A;  1ILP A;  2M00 A;  5FO8 B;  5IOD A;  1TY2 A;  3DHQ A;  1HFN A;  1LTT D;  3KF8 A;  3J7A V;  5KRU A;  1MBY A;  1HXY D;  4X3U A;  1STY A;  1HQR D;  1ENC A;  2F3W A;  1KNE A;  5I6Y A;  2A69 C;  3MWY W;  1MI2 A;  2B2V A;  3NBI A;  1TR5 A;  4K2K A;  3IKJ A;  1V43 A;  2F1M A;  1ML0 D;  1U4M A;  2B63 B;  5E4W C;  1H9R A;  2Z1C A;  1EL0 A;  3F2U A;  4QF4 A;  1EWC A;  2JXM B;  4RHR A;  2FFK B;  2KEC A;  1SE2 A;  5CV5 A;  1HUM A;  2AUK A;  2IPK D;  1FNW A;  2KCC A;  3OHX C;  4OIK A;  5CBA E;  1EY4 A;  1II3 A;  2PO4 A;  1RF2 D;  1TS4 A;  5FLX L;  2YU9 B;  2HUG A;  1RDP D;  4KY6 A;  3FKI B;  1CI3 M;  2BA0 A;  3C46 A;  1XX8 A;  1PZJ D;  2KED A;  2BE5 C;  2EJG C;  2FHT A;  1TT2 A;  1QE6 A;  1WD0 A;  1B3A A;  1RHP A;  4EGV A;  4IUN A;  5BN3 A;  3EQL C;  2F0M A;  4FYD A;  4JK1 C;  4KD4 A;  4C1N I;  3A8J E;  2B2U A;  1H9K A;  4RCN A;  2O5I C;  2KJX A;  5I6W A;  4B9W A;  4OO1 I;  4X3S A;  3EJI A;  3AU7 A;  3QOL A;  4G7O C;  2B2W A;  1D1K A;  2NN6 I;  1MSG A;  4KJO A;  1S5B D;  1EZ8 A;  1ZKO A;  1LTI D;  2JA7 B;  2IWH A;  1J8I A;  2RVL A;  2K1B A;  2IX3 A;  1EU3 A;  2D62 A;  1Z47 A;  2WKC A;  3Q24 A;  3U9S A;  1KLG D;  2NVT B;  5M5X B;  1NR2 A;  3G6J B;  5DM6 3;  4A3J B;  2PPB C;  5F2D A;  4O1N A;  3I72 A;  2AQ1 B;  3ND8 A;  2B39 A;  3RMH A;  4O42 A;  5D14 A;  3HOU B;  2X6L A;  5IT9 E;  4GZY C;  5IGF A;  4R9W A;  3VYT A;  4DXG A;  2K04 A;  3D31 A;  4RGT A;  5BN4 A;  3MHB A;  1WTQ A;  2O4X A;  4ZUI A;  1LTR D;  5EKI A;  1SMY D;  2GA4 B;  3DXJ C;  3PV0 A;  1PTO D;  3SK8 A;  1ILQ A;  5K36 H;  1HTP A;  2SOB A;  3E0J A;  2ZXP A;  1GJX A;  1KAA A;  5G3L D;  1I3Q B;  4H7B A;  2IW3 A;  4CKB A;  2EY1 A;  1IL8 A;  3I4L A;  3V96 A;  1CQF A;  4V19 0;  4K14 A;  3TME A;  1IHZ A;  2HDM A;  5ELD A;  2A6H C;  4MIU A;  4Y7N B;  1LTA D;  1H9J A;  1SYE A;  4FF4 A;  2XIW A;  2B8F A;  1GUS A;  3HOZ B;  3VYU A;  2PZW A;  1ET9 A;  1TII D;  1EYD A;  1QWY A;  2NUC A;  4RKL A;  2F4I A;  4CKC A;  2XRS D;  1UUP A;  1ENA A;  5ISR A;  2R93 B;  1IKL A;  1PFB A;  2IT1 A;  3MAQ A;  1VDZ A;  2JP1 A;  3CHB D;  1DON A;  5C6A A;  4WRD A;  2F0S A;  1EYA A;  1F2L A;  4QUC A;  5C4J B;  3EVQ A;  2R92 B;  1EEF D;  1O7Z A;  1ZXT A;  3ERO A;  1CHP D;  1STB A;  1HA6 A;  1FYC A;  3I70 A;  2X6G A;  2FMM A;  4QUF A;  2DNE A;  3DUZ A;  1LV9 A;  1IKM A;  4IUT A;  1HRJ A;  3R2I A;  1C4Q A;  2E76 C;  1GUO A;  1WTP A;  3NPP A;  4K5V A;  1BCP B;  3NXW A;  1SNP A;  4KN7 C;  2E2J B;  3TP8 A;  1SAP A;  2YYZ A;  4A3F B;  3RLF A;  4H0L C;  4CJ0 B;  3MXU A;  2F0H A;  3NTI A;  4ZKB B;  2K05 A;  3VA7 A;  1S5C D;  2PCF B;  4U67 3;  2MGS A;  1RTN A;  1V8Q A;  3HZX A;  1W6J A;  1YNN C;  1B53 A;  1F9S A;  4XDX A;  4QCL A;  4NDX A;  1G29 1;  2ZXR A;  1AP0 A;  5D3D A;  4I65 A;  4IAL A;  3J7A F;  3M4Y A;  1ZYR C;  4DGZ A;  4XIG S;  1WTV A;  1DXM A;  2NVQ B;  4G57 A;  3PUV A;  4LMQ D;  2BCO A;  4NP5 A;  2QEJ C;  1OXU A;  3PIO 3;  2F0J A;  2EY6 A;  1HA5 A;  2E75 C;  2F0V A;  2F0Q A;  1SJH D;  2KEE A;  5DNF A;  4C3J B;  3K5M A;  2JA6 B;  1XYI A;  5FO9 B;  1A2T A;  2NWG A;  5TSS A;  1GOZ A;  2F0N A;  1AN8 A;  2Z4H A;  1DYQ A;  3FPU B;  2JA5 B;  2M2L A;  4HN7 A;  1MGS A;  1Q3L A;  5JJZ A;  3OIP A;  4KMU C;  1CK1 A;  1CT1 D;  1Y8N B;  4RAU C;  3K6O A;  4FVM A;  3S16 B;  3SEB A;  3FDT A;  3MC0 B;  4LAA A;  1EFI D;  2WAC A;  5IIF A;  1YNJ D;  3SK6 A;  1EOT A;  4RFB A;  2F0U A;  3ERQ A;  2XWB B;  3BG3 A;  3QJY A;  3FPP A;  2JE6 I;  1LAB A;  1VMC A;  3RZO B;  1I50 B;  5A2Q L;  2Z8L A;  1PRT F;  2Q8I B;  1F9Q A;  3P75 A;  2QKI C;  2HDL A;  4V0B A;  1AZP A;  4CHT B;  1I4H A;  1LT3 D;  1HUN A;  1D6E C;  3O13 A;  5I9O A;  2IL8 A;  3GTM B;  4L63 B;  1SJE D;  1KLU D;  4IUQ A;  1EY8 A;  5CGK A;  4C3I B;  4KTA A;  2PMZ B;  1EY0 A;  3VR5 A;  3MXG A;  2K01 A;  1FGB D;  3D4D A;  4XQJ A;  2F0P A;  1JWS D;  4QMG A;  3DWP A;  3E5S A;  1CQV A;  1T5E A;  2EYH A;  2I07 B;  2WV6 D;  5C4X B;  3T51 B;  3S9W A;  2L5T A;  2VB3 X;  3H3V C;  4X3T A;  1TWF B;  4ZUJ A;  2R6G A;  4G7Z C;  4DNT B;  1SDF A;  1C48 A;  5COY A;  2RSO A;  1NSN S;  1SYG A;  5EGT A;  4A3M B;  4HMI A;  5C4Z A;  3RD4 A;  4RCO A;  1Q1B A;  3D4R A;  3K5L A;  4RGO S;  1WTX A;  4B08 A;  5CBE E;  1D2B A;  5KND A;  2RSN A;  1PTO H;  5JOB A;  1QJO A;  1Z7T A;  4KK7 A;  1LO5 D;  3A56 A;  3T4A C;  3N6R A;  2ICI A;  1V1O A;  3M7N A;  4EVO A;  2EDG A;  5EQ0 A;  3VA5 A;  2F3V A;  1BCP F;  2EYM A;  2E2D C;  1S4Z A;  2B2U C;  3VR3 A;  2V4D A;  1JWU D;  3KUP A;  1I6H B;  2EY5 A;  1E2V A;  1BR9 A;  2A6E C;  3A7L A;  2A68 C;  5LHY 1;  2AUJ D;  1YNN D;  3P7J A;  2EY2 A;  2O5J C;  1D5X C;  2KCN A;  3VR6 A;  3L9A X;  5EKL A;  1ZYR D;  2QF7 A;  2ICE C;  5T1G A;  2EYF A;  1TWG B;  1D5M C;  4N9P A;  2KVM A;  3PUY A;  3E6Z X;  4DK1 A;  3AB9 A;  3HGB A;  2J4X A;  4ABN A;  1GHK A;  4H44 C;  4L8J A;  3KK7 A;  3BVZ A;  5ELB A;  2WP8 J;  1ENF A;  2XWJ B;  4ZYS A;  3JAM L;  2H4O A;  3TP7 A;  3MTS A;  1HPC A;  3H0G B;  1IW7 C;  4K8I A;  1K8M A;  3NTK A;  2EZV A;  1STA A;  5K5P A;  2BOS A;  5EBC A;  2NB0 A;  5EJW A;  4L6T B;  5DEH A;  1QIL A;  2QIL A;  2KA7 A;  4K5W A;  3SDZ A;  3SR1 A;  2K32 A;  3M4O B;  1HFG A;  1PRT C;  1PTO B;  3D3R A;  1KNA A;  4ZLT F;  4JBW A;  1EYC A;  2K6A A;  5DAU A;  4N9T A;  4ILW A;  2CW0 D;  3QO2 A;  2D9U A;  4A3B B;  1EIH A;  1JOR A;  1F9P A;  4TRD A;  3S1R B;  4A3G B;  5LL6 X;  4KI0 A;  2F0E A;  2C5C A;  3CQZ B;  4K6D A;  4C1N K;  2A73 B;  3S1M B;  3T16 A;  5BN5 A;  2LMC B;  1WD1 A;  5M3F B;  1JOQ A;  3I90 A;  4QB4 A;  4DXF A;  1KDB A;  4FXD A;  3I91 A;  2EVB A;  3H09 A;  3GO5 A;  4BY1 B;  3M85 A;  4YIJ A;  1PLF A;  1IYU A;  1PZK D;  3S14 B;  4EQO A;  4HR7 B;  4K5X A;  3A54 A;  1U4L A;  3NP8 A;  3Q0A A;  1FNV A;  4R8N A;  4M8A A;  3J7Y W;  3NSW A;  1JR0 D;  4XYO A;  3OWE B;  2EPB A;  4ZRZ A;  3T13 A;  3J81 E;  2NTS A;  3R3O A;  1A15 A;  3RUZ A;  3AMU A;  4XQN A;  3I73 A;  5KNB A;  2HCC A;  3OSO A;  5T1I A;  2CHB D;  1LTG D;  4CBV A;  2RA4 A;  1LTS D;  3EA6 A;  3HS0 C;  3PO3 B;  4ID6 A;  1SNC A;  2F0F A;  4HSP A;  1JE4 A;  1BCP C;  4IN3 A;  5C44 B;  3HRZ C;  4TSS A;  4WJW A;  4C3H G;  3C3L A;  1DJR D;  4KV6 A;  1SXT A;  3IAY A;  5KYL A;  4KY7 A;  1RJT A;  2AWO A;  1HQM C;  1QCB D;  3OOC A;  1BQQ T;  3FRP B;  4ME5 A;  5LL6 S;  3D4W A;  2H1E A;  3W2D A;  1BF4 A;  2VXW A;  1O7L A;  4FO2 A;  2A68 D;  1D1I A;  2IX1 A;  2EXZ A;  3S1N B;  1B2T A;  4OIJ A;  3DWQ A;  1PXU A;  3TP6 A;  5KIX A;  5M5Y B;  1WTR A;  2XN9 C;  2NVY B;  3J80 L;  1I6V C;  2LFN A;  2FMC A;  5IOC A;  2A69 D;  3HKZ B;  5KGU A;  3OWF A;  1Z6H A;  3V2T A;  3GTO B;  5JVH 3;  1KDA A;  3D6W A;  3OMG A;  2EJF C;  1TS5 A;  1UNS A;  2BDN A;  1F77 A;  3W3A A;  3M7G A;  1EIG A;  3MZ5 A;  4FXK C;  1ZEQ X;  3BDC A;  3X3M A;  1JOK A;  1ONL A;  4HAE A;  1CTM A;  1TKW B;  4ZKC B;  3DWA A;  1WTO A;  4R8I A;  3IFD A;  2ZT9 C;  1BUV T;  2MHV A;  2G9H D;  4NKL A;  1PYW D;  4PQX A;  2O2L D;  3KLS A;  5D65 A;  1B50 A;  2BE5 D;  2Z4I A;  3BVM A;  1ET6 A;  2BDO A;  3TZU A;  3GV3 A;  4UDU C;  3ITP A;  1I4Q A;  5KYI A;  5JAV A;  1PTO F;  3KBX A;  3QOJ A;  2NBF A;  5JPN C;  5FLX E;  2WKD A;  3A8I E;  5G3L F;  2SEB D;  1G8Z D;  1BNZ A;  4IFD G;  1HTL D;  5DM7 3;  3T56 B;  2LKV A;  1SNO A;  5CV8 A;  3PUX A;  1DOM A;  3WDN A;  2EOT A;  1DZ1 A;  1SE4 A;  2NYZ D;  1NUC A;  5EPL A;  2RDG A;  1SYF A;  1RCV D;  4X3K A;  1SSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...