2EY5A

Crystal structure of staphylococcal nuclease mutant t41s
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDSPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey5A00
2F0JA 2KQ3A 1JOOA 3NK9A 4I65A 3MXPA 3TP6A 5J39A 2EYMA 3TP5A 1A3VA 2F0NA 3NXWA 4KY5A 5CR3A 4YIJA 3SK8A 5KEEA 2F3WA 1SYCA 1KDBA 4KY7A 3NQTA 4KY6A 4ZQ3A 2EY1A 1F2ZA 5CGKA 4RKLA 5K5PA 1EQVA 2PYKA 1ENCA 1ENAA 4WRDA 5C4ZA 2HQEA 2EY6A 1SNQA 3TMEA 2PW5A 4OL7A 4KV6A 3RUZA 3T13A 5ISRA 5HGTA 1A3TA 4R8NA 5IOCA 1U9RA 2PZWA 5C5LA 3DHQA 3BDCA 2SNMA 3MVVA 4IZ8A 5DEHA 4KTAA 2LKVA 1EY4A 4EVOA 2F0FA 1SYGA 2SNSA 1TQOA 4NMZA 1EZ6A 5I9PA 4J6HA 1A2TA 5CV6A 2F0QA 1SYEA 5CV8A 1TR5A 2F0LA 4IALA 2PW7A 4EQOA 1KABA 5CV7A 4B9WA 1SYDA 1TT2A 2EYHA 2F3VA 2KHSA 2O4XA 2RKSA 3NHHA 4ID6A 4QMGA 2F0DA 2EYLA 5E3FA 2EYPA 4EQNA 4J1MA 5C3WA 5IGDA 1JORA 4KD3A 4HMJA 3R3OA 1STYA 3U9OA 5IGGA 5KRUA 3S9WA 4KJOA 2ENBA 5J1ZA 2EYFA 2F0EA 4H7BA 4NKLA 5JOBA 2F0OA 1AEXA 1EYDA 3DMUA 4K6DA 5CV4A 4DU9A 5NUCA 2EYOA 4MIUA 1SNOA 2F0GA 4ZUIA 2F0MA 3SK5A 5C4HA 5M9OA 2RDFA 2F0KA 3EVQA 3OMGA 2EYJA 3C1FA 4K5VA 2F0WA 1NSNS 4RKBA 4TRDA 5DAUA 4PMBA 2OF1A 3D4DA 1A2UA 4F7XA 1SNMA 5IODA 4S3SA 3D4WA 1NUCA 4F8MA 1STAA 2QDBA 3SXHA 4LAAA 1F2MA 4B9XA 3E5SA 4DF7A 2EY5A 4KJNA 3OSOA 5EKKA 4K8IA 4QF4A 2M00A 1EY8A 5CV9A 3H6MA 3TP8A 2EXZA 5KYIA 1EY9A 3P1HA 4NDXA 1EYAA 1SNPA 2F0PA 3D8GA 3LX0A 5I6WA 3OWFA 4PMCA 1EY5A 1KAAA 2F0HA 5E1FA 3SR1A 5EGTA 3TP7A 1RKNA 4ME5A 5IGCA 3MHBA 4NP5A 1EY7A 3V2TA 5F2DA 1KDCA 2F0VA 1EZ8A 1IHZA 3BDLA 5I6YA 1SYBA 5KGUA 3EROA 1STGA 4PNYA 3SHLA 5I9OA 2OEOA 1SNDA 4DFAA 1EYCA 1A3UA 1STHA 3ERQA 5KYLA 3D6CA 3VA5A 3ITPA 2F0IA 4N9TA 3MEHA 3PMFA 4E6IA 5J22A 1STNA 1F2YA 2NUCA 5EKLA 1KDAA 3HEJA 4QB4A 2PQEA 1SNCA 5IGBA 2RBMA 4ZUJA 4KHVA 5JAVA 4DGZA 5CC4A 2EY2A 3SK6A 1JOKA 3QOLA 3NP8A 1II3A 4N9PA 3OMCA 3HZXA 4HTHA 3EJIA 4K5WA 5IIFA 2OXPA 2PZUA 1STBA 2PZTA 2F0UA 3MZ5A 2SOBA 3P75A 3QB3A 1EY6A 4K2LA 4ODGA 4K8JA 4K5XA 1JOQA 5IGFA 3SK4A 4K14A 4IUNA 4WORA 4KD4A 3NUCA 3C1EA 3T16A 1SYFA 5KIXA 4HMIA 5C3XA 4EQPA 2WACA 5C6AA 5CV5A 3QOJA 5HURA 5IGEA 4K2KA 2F0SA 4G57A 2F0TA 1EY0A 5C5MA
chains in the Genus database with same CATH superfamily
3MFGA 3H94A 4DR4L 2Z6KC 4I7AA 1BCPD 4XQNA 3UE1A 2F3WA 1CA5A 1UE1A 3OOCA 4X64Q 1LTLA 5D14A 5FO9B 3S16B 4DR2Q 1S5CD 4KV6A 1I5FA 5ISRA 2K5DA 2IL8A 3J7AV 4MNOA 1SRUA 2VL6A 3UI2A 2Q8RE 2LKVA 2F0FA 4JI5L 2SNSA 4JI8L 3I2ZA 4GLXA 4YCVA 2Q2HA 5C4XG 3GO5A 1TWFB 3KJOA 1A8VA 3I8ZA 4DUZQ 3NHHA 4B3ML 1F9RA 1KXLA 3R3OA 3RN2A 4L63B 4O42A 2F0EA 4H7BA 4PG3A 3M4OH 2FHTA 4CGYB 1GUNA 3DUZA 4DNRB 4UDUC 3SK5A 1LTID 2M9VA 3MFYA 5IP9H 1WFQA 2EYJA 5DAUA 4B3RL 4A3BG 3GTKH 1N8RC 5BR8L 3VA7A 4RFBA 3Q0AA 3PV0A 2EY5A 1YVCA 1EY8A 1KRTA 2F0PA 4DA2A 1LT3D 4OHJA 3HOWB 4GKJQ 1BOSA 1HPCA 1X3FA 2JXMB 1E2WA 1EY7A 3PIPA 4JBWA 2HCIA 4RA8A 5KGUA 3I4NH 4K6LA 1VQPA 3M7GA 1BKBA 1A3UA 2DN8A 1MI2A 1FJGL 1O7YA 4DV5Q 1RTNA 3D6CA 5A35A 3VR4A 1FNVA 4A3MH 2FFKB 4RGOS 3GP7A 1VQHA 5DM63 1II3A 3KF6B 2CW0C 2F3IA 1A0IA 5IYCH 2KHJA 2K1BA 1JOQA 1WJJA 1ASZA 3Q23A 2E75C 4DAPA 2GVBA 3SDZA 1ZXTA 2UXBQ 2CW0D 1DCZA 1KHIA 2B8FA 2UXCL 3RZDH 1CKMA 2PMZE 3NELA 4DK1A 1BDOA 1EY0A 2L4NA 3J7YW 1PH8A 3PO2G 1QUQB 4NXNL 1EQRA 1WCMB 1K73C 1KTKA 1V8QA 2A73B 1I4GA 5CGKA 3GTLB 1I4HA 5JPMC 1HRJA 1L1OA 2ID0A 4LF9Q 2R7ZB 1Y1WG 4FF4A 3OYYA 3F2CA 1TXYA 2E2JB 1SBBB 1BBXC 4JPBW 3FKIG 1C0AA 3CD6A 1V43A 3JC66 4AYBG 4KTAA 1VS0A 2KVMA 4ZRZA 5IT9c 4J6HA 1X55A 5LMUL 1TS2A 4DV5L 3K8AA 5C44H 4IALA 4EQOA 2ZM6Q 1IBML 1D2BA 1GUSA 2F3VA 2KCTA 1YNXA 4ZAIA 3M7NA 2F0DA 3JAME 1JORA 1MGSA 1X54A 5D65A 3I90A 1LTTD 2X6GA 2AQ1B 1PH1A 2R93G 5ELOA 1L0WA 1EYDA 4JI4L 5NUCA 4GLVB 3ERSX 3T1HQ 2VY3A 4HJ9A 4O0AA 4TRDA 3HKZG 1UEAB 2PNHA 4F7XA 1KQSA 1UEBA 3P7JA 1TWCH 1X6OA 2J0TD 4B9XA 2PCFB 1B9MA 4IFDJ 4R9WA 5CV9A 4ZK9B 4B3TQ 1E3PA 4XQQA 3P1HA 4NDXA 3F2BA 1EYAA 1T5XD 1IXRA 2D2CC 2Y0SE 2R7FA 1ICFB 3IKJA 4QCLA 1SFOB 1J9OA 4G4KA 1STGA 4OWXB 1CTMA 2XVSA 4A3GG 5KYLA 2E2HB 2WP8J 5T1GA 1Z9FA 4IPDA 3S2HB 4KI0A 4JOIA 2I5LX 4N9TA 1PH5A 1D8LA 5EKLA 1V1PA 5EJWA 1OXUA 2NYZD 1D5ZC 1I50B 4HJ5A 3T1YQ 3I72A 1JOKA 1LM0A 1IBKL 2K4KA 4L5RC 4XDXA 2G5DA 1FR3A 3MZ5A 2PZTA 4HSPA 4LF7Q 4PZ7A 3NTIA 3RZOB 2RHSB 3Q22A 4DUYL 4WORA 1F9PA 4X62L 1AW7A 3A7LA 3NUCA 2MJ8A 3M4QA 4KD4A 1Q82C 2VB3X 4JK1C 2SDFA 4P73A 1WTWA 1IBLQ 1K8MA 2KCCA 3PSIA 3T1HL 4I65A 3BZDB 1XXGA 1A3VA 2L11A 3PIO3 4DV7L 4LFAQ 1O78A 2R92B 3FRPB 2VUMH 2DJGC 1PHJA 1IYVA 3FHWA 4B3TL 2QEXA 1Y8PB 1BXTA 2K33A 1VDZA 2XGTA 3HOVG 3RUZA 2HIVA 3BVZA 3DHQA 5LMNQ 5FJ8H 4A3KG 3MVVA 2I07B 3A74A 4GS3A 1TWAB 3GDEA 1EY4A 1LLRD 4WJWA 4M1UB 4X66Q 3K0XA 4N8FA 5GAGC 3S1MH 3G7LA 3G4SA 3HS0C 2TSSA 2LSSA 2WKDA 2EIFA 3FVQA 1Y8NB 3QR8A 1FNUA 3FPUB 3T56B 4LF5Q 4HSVA 1FYCA 1G2SA 2O4XA 4QMGA 4JBJA 2VQFQ 1SSOA 1XX8A 5C3EG 4NKLA 5CV4A 3H09A 3A5ZB 3I55A 4LF7L 3C2PA 1PH7A 4IPGA 1XPUA 4L8JA 4HR7B 1A2UA 5LHY1 3I4MB 2CH4W 3BU2A 1N33L 5EKKA 1H9KA 4IJHA 1J6QA 2ASBA 1H9SA 1IBLL 4C2MH 4A3JG 2B2VA 1JWMD 5C4JB 1PLFA 2PQAA 3K81C 2NBFA 1CM9A 1RD9D 4LFAL 4OO1H 1SYBA 4FNFA 2IY5B 5I9OA 3SHLA 1XTDA 3ERQA 5FLXc 1QG7A 1XNRQ 1WI5A 2OQ0A 3K6OA 1MBYA 5LMNL 5CORA 1PH2A 5IGBA 2RBMA 2L1BA 1BCPB 5L37A 1YITA 1CHQD 1EWIA 5JVG3 1XWEA 3GD7A 1ICWA 4OEMB 1VQ6A 1HXYD 4LF5L 3J80i 4I7ZC 2C5CA 4OXPA 3T53B 5C3XA 3URYA 3FEWX 4BY1H 3K5LA 4ULLA 5I2XA 5I2YA 2Q8IB 3NEMA 2JA9A 2EYMA 1MIUA 1RODA 3VYUA 4DV0L 2UUCQ 4RHSA 1EU3A 1PYWD 4IFDG 1CUKA 1ENAA 5C4ZA 1V9PA 5DM73 3QWNA 1AFPA 4CDEC 4A3IG 4HN7A 5IWAQ 4A93B 1Y14B 2EDGA 1ILPA 4RGTA 1TKWB 1BNZA 4GN4B 1TQOA 3RR5A 1U0LA 4CKBA 3RN5A 3NTKA 2F0LA 4R4CA 3GTMB 2N8NA 2JA5G 2JA6G 4LUOA 1NAPA 1VQIA 2RKSA 4LFBQ 2HIXA 4JCVE 4LW1A 1QZHA 1BCPF 1JB3A 3FPPA 3K7UC 3CC7A 4DXGA 4KLKA 4HJAA 5J1ZA 4RHRA 4PZ6A 2YU9B 1K9MC 3BVMA 3HOUH 4A3DH 5AJ3L 4IUTA 1GHJA 1SNOA 5M9OA 3L7ZC 1V1QA 2RDFA 3OMGA 2OF1A 4IO9A 2ZJQA 2ZTDA 4JI3L 4LF6Q 1HTLD 3OSOA 2NVYB 1LTBD 3WDNA 2M00A 4QUCA 2EXZA 4V0BA 4FXKC 3H3VH 3KK7A 1RKNA 5EPJA 5EAYA 2D0OA 4NPSA 2JQOA 3K5OA 5F2DA 1B1ZA 1SR3A 4BBSH 3I3CA 1IKLA 2WKCA 3I73A 1HR0Q 4XIGS 3BZCA 4P75A 1VF7A 3S1QH 1GKHA 3G48A 1QB5D 4BY7G 3KDFB 3NE5B 3KLSX 4TKOB 3BG3A 2UU9L 1PH9A 3KF6A 1ASYA 1HH2P 4HJ7A 2G9DA 2DY8A 2NTTA 4ZCKA 5M3FG 4QGUA 5C3EH 1XNQL 1XJVA 3HOZH 1J8IA 1XMOQ 1U5KA 2A69C 2K5QA 2ZTEA 1B44D 1X3QA 2N88A 4KHPL 3LWUA 1BUVT 2B39A 4DKAC 5C5MA 4POGA 4G7OC 5LL6S 1K3RA 2KEEA 2A69D 3FP9A 4A3JH 1G91A 4LF6L 2Q2TA 2K52A 1XMQQ 1D1KA 4CDFC 2AHOB 2K7VA 2VXWA 4A3FB 4GOPB 3GTGH 3T13A 4A3EB 1DZ1A 2DUDA 3H91A 2PZWA 2ZJRA 4ZLTF 4PQXA 2R3ZA 3DWQA 1B3AA 4DAYA 1UE6A 1CKNB 4FVMA 2K32A 1EWCA 1QVGA 1PFNA 2KHSA 3JAMc 1JCKB 3U50C 3U9OA 2K03A 3RMHA 2EYFA 1WTOA 1FVIA 3I70A 4OONA 4ZUIA 3EVQA 3TS2A 1CT1D 4A3LH 3UDFA 1P16A 1QNUA 4F8MA 4JI1L 1XMOL 4C3JB 3K5MA 3CF5A 1G51A 3M4PA 3VR6A 3CQZB 4FF1A 1R4QB 5M5XB 1NE3A 2FXQA 3W1GA 1T5EA 1NTGA 4OIKA 3V2TA 1VQ8A 4JI6Q 5I6YA 4FDBA 5ELEA 1Q81C 3HOXB 4YCUA 1BR9A 1O80A 2KCMA 1O7ZA 2OWOA 4R8IA 2K5WA 3Q6SA 4DV3Q 1Q46A 4NB3A 2NUCA 5FK9C 4WJ3M 3SGIA 1L0XB 1FD7D 1DOMA 4KHVA 2JA5H 4R4OA 3OIQA 1M8AA 4POFA 4RCOA 2DJFC 3J81i 2Z4HA 3NPPA 5IYBG 3J7AF 3X3MA 2K04A 4CJ2C 1E2ZA 5ELCA 1B3QA 1SYFA 3GTQH 1FGUA 2VZAA 3AMUA 4NXMQ 3S1NH 1IKMA 5ELDA 1F9QA 3UDIA 1JB7A 2DY7A 4K0KQ 5JJZA 4LF8Q 3HOWG 1SYCA 4B3SQ 4HCEA 4RKLA 5K5PA 1ENCA 2QILA 4RCNA 3OTOQ 5M5WH 5GROA 4BA2I 2PW5A 4KKSA 3M4OB 4C1NI 2UUAQ 1EUJA 4IUVA 5E4XA 1PYSB 1VQDA 1STEA 4Q5VA 2Y0SB 2GA4B 2VQEQ 4U68A 3BS1A 2DNCA 5I9PA 1SE4A 3K0YA 1D5MC 2WAQB 2KUMA 3S15H 2YV5A 2AUJD 3NWTA 4DR7Q 3AEVA 1AE3A 1DOKA 1K8OA 1WD1A 1EIYB 2EYLA 2NVXH 1WTRA 4TQUS 1N34L 3S14B 1EOTA 5FO8B 3PO3H 3VR3A 3I4NB 2JP1A 2A6HC 5LL6X 4XT3B 4F88A 1HTPA 2CFMA 2D5DA 4RGMA 2B2YA 1A6XA 3CP0A 3D31A 4S3SA 5GAHC 4G7HC 1Q8KA 4DF7A 3TEHB 1CI3M 2NN6I 2A6HD 2IHFA 4K8IA 1NMGA 1JE4A 1WCMG 1SLJA 1EY9A 3TDQA 4NXML 2F0HA 3SR1A 1TU2B 3G6JB 1I3QH 1YBYA 2R7ZG 3IL8A 1A63A 2JA8H 4FXGC 1JWUD 2O2LD 1GUGA 3ULLA 3GQBA 5IP7G 4DFAA 3OTOL 4C3IB 3TZUA 2L12A 3WOFA 1ZYRC 2UUAL 2B63H 2FMCA 3ZJYC 3A8KE 1SEBD 2YTVA 4ZUJA 1CZGA 2F1MA 4NW2A 4DV1L 3X3NA 2D0PA 1IYJB 4HTHA 1ZYRD 1H9MA 1Q1BA 4YWMA 1Q1EA 4IURA 4RMFA 3VR5A 2Z6KA 3BZKA 2ZXRA 4X64L 1YNNC 3M9BA 4EQPA 1AN8A 4DR2L 2BH2A 3ZYYX 2PI2E 2L15A 3DWAA 2F0NA 5CR3A 1E0BA 1YNND 3L9AX 1HFGA 4ZQ3A 3OIPA 3UDGA 3AQQA 3HOYH 4BWGB 1WTXA 4YWKA 3H0GH 3S16H 4OWWB 1HQMC 2RSOA 2HCCA 4DUZL 5IOCA 1WOCA 3PF5A 1TWCB 4QY7A 1ET6A 1B8AA 1LTAD 1K3BC 5M3MH 5CV7A 3WWVA 1GUWA 5C0XH 4JV5Q 5IGCA 4EQNA 3FMCA 4RAUC 1LYLA 2PNRC 3U4VA 3S9WA 3R8BA 1AZQA 2AWNA 2WB1E 2F0OA 1EWHA 4K6DA 4GKJL 1SJHD 5EQ0A 1PH4A 2NN6G 3V05A 3PIP3 3K80C 1PTOC 4LAAA 5EBCA 5FKAC 4GOPC 5KYIA 4C3HG 4PV1C 2R92G 1H95A 1WTHA 3HRZC 4XXEA 3BJUA 3EBEA 1PTOD 2KJXA 3LGJA 1CQFA 2NZOA 4BBRH 1B2TA 4BA1I 4JG2A 2M2LA 2Q8TA 3CKIB 2MNAA 1QVCA 4JI7Q 4HIKA 1HZBA 1ONLA 1R4PB 1N9WA 1Y1VH 1EEFD 4H44C 1GM5A 5IT9L 3K5NA 4XYOA 4GZYC 4QB4A 2HD3A 4Y7NH 2TMPA 2UXBL 3IFTA 3KF8B 3SK6A 4KMUC 2VUMB 4Q0FA 1EIHA 4GNXB 1M90C 3CCMA 1S5BD 3J81E 2E2DC 4ILWA 1UNSA 3GTPH 3Q24A 4PMWA 1E7ZA 1LV9A 2JYOA 3K7AH 2J4XA 3S24A 4TSSA 2WAQE 2WACA 1KRSA 4ZKBB 4LF9L 4H02A 3CXCA 3I4MG 1X32A 3E0EA 2EJGC 1ZKOA 1Q90A 1ENFA 5C4XH 1U4PA 2JE6I 5HGQA 1VQ7A 1N36Q 1BBWA 2EY6A 4OL7A 1Z6HA 2ZM6L 5FLMG 1YJNA 2HT1A 3DM1A 1HNXQ 1HA5A 2SNMA 5G3LD 2Q2UA 4IZ8A 5FO7B 1GD7A 1SYGA 4NMZA 3NBIA 1PH3A 4A3BH 1SXTA 1Q8IA 2NB0A 1K0RA 1RDPD 3AU7A 1E1OA 4C2MB 1KABA 2RCNA 4CDCC 4FP5D 4C3HB 1FL0A 4CHTB 4ABNA 4J1MA 3K58A 5M5YB 4DR3Q 1PH6A 2B2VC 1P8LA 1B70B 4CKEA 2L9HA 1TY0A 1RIPA 2CCZA 1B4OA 1CA6A 4KJNA 1CK1A 1HNWQ 3TP8A 3EFXD 1VQCA 3R2IA 2B2WA 1LT6D 1VQ9A 1X3EA 1QWYA 3MXGA 1N32Q 2QGQA 3RLOA 1UE5A 2B2TC 1A62A 2ALYB 3T1YL 1JJCB 1SFOH 1N36L 1D5XC 3S2DH 2GN5A 4A93G 1CSPA 2E2HH 2QEJC 5DNFA 1EU4A 4EGVA 3PUYA 4MTKA 2N3SA 4BY1B 4DV6Q 1PMRA 1JJGA 3R2TA 3ULPA 3PMFA 3QIAA 1STNA 1NR2A 3V96A 1HNXL 2XWBB 3PO2H 1QOHA 5CC4A 2PO4A 1QCBD 3T51B 1LTSD 2EPBA 3EJIA 4KN7C 2SOBA 5A2QL 1Q7YC 1H9RA 1Y1WH 3J80c 3FKIH 1DYQA 5CV5A 2UXDQ 1MJCA 3CU7A 3D0FA 2IX3A 3RLNA 1PRTB 2V4DA 1U4MA 1HZCA 4DR5Q 2KQ3A 4GKKQ 2OT2A 3L2PA 2CQAA 3CCLA 2B2UA 4MN3A 2O5IC 2R92H 1B53A 5KEEA 1CKOA 2JA7B 4WFN3 4X66L 2FINB 2EY1A 4FO2A 5H1SE 1B50A 1HNWL 1RF2D 1PZKD 2B29A 3RNUA 4J15A 2WIIB 3HOUB 4A3DB 1L2FA 2K5VA 2R93H 1UWVA 5FLXL 1G291 4ALPA 3D4RA 1W6KA 2VQFL 3MC0B 4OGQC 1KD1C 2BOSA 1NY4A 1YHQA 3BYYB 2SEBD 2CHBD 4YY3Q 2EYPA 1EFWA 3PUWA 1VQFA 1STYA 3A8IE 4BBSB 3WOEA 1C48A 2A6EC 2HDLA 3ULJA 4EX5A 2K5NA 1WTVA 4N8X1 1MSHA 4DNTB 4V190 1EL0A 3C1FA 2F0WA 1NSNS 4A3GH 2AKWB 4RG1A 3S1QB 3DEOA 1IZ6A 2CQOA 1GXDC 2QDBA 1F2MA 4IUQA 5KNDA 2A6ED 2JJQA 1OXVA 4QF4A 4C1NK 2UXDL 1XNRL 1DOLA 2WV6D 2Z9HA 4PMCA 1EY5A 1KAAA 1WVLA 4BXXG 3AFPA 4X3KA 1K28A 4A3FG 4JI2Q 4DR6Q 4A3EG 3HOZB 5LMNW 2A8VA 3IRBA 5KNCA 4LNQA 5ELFA 5J22A 2B3GA 4MHEA 1S40A 3GTJH 2XWJB 2F03A 1PVOA 3DEPA 2N78A 1K8GA 5IIFA 1L1OB 1XPOA 1KC8C 2A19A 4K8JA 4KKTA 2EVBA 3GTGB 3SK4A 3LNNA 2UUCL 2MFIA 3HOVH 2Z4IA 2NVQH 3DM3A 2JK8A 4A3KH 2ATWA 1VQGA 1I4PA 1LTGD 3OWEB 3TBIB 3C3LA 4C3JG 2F0TA 4MTNA 3M3YH 2E76C 1C9OA 1IW7C 5EKIA 3RD4A 5IWAL 4FF3A 4Z9CB 2QKIC 3LWEA 5D3DA 5I4DA 4ME3A 2UUBQ 3S1RH 4A4IA 3HOXG 3P20A 1IW7D 4YHHQ 5TSSA 2MP1A 4LFBL 4JI2L 4IPHA 2YTYA 4GNXC 2XSCA 2OQKA 4R4TA 1HNZQ 1KNAA 1TR5A 2F4VQ 1XYIA 2K01A 1QUQA 2LFNA 3E9IA 1QZGA 4JC0A 1PTOB 5KRUA 2XRQD 4C56C 2Z1CA 2YU9H 3TRZA 2HQLA 5JOBA 3GTOH 1M4VA 2F0GA 1I6HH 1LT5D 4R1JA 5IGEA 1EEID 1CSQA 4K5VA 4B9WA 3D4DA 3S17H 1SNMA 1NUCA 1V1PB 3VDYA 4ZYSA 4CKCA 3KFUA 3HP3A 3TSSA 1EIGA 1RJTA 1TWGH 3W1BA 1HR0L 3AFQA 1EQTA 4R4QA 2CKZB 4ZKCB 1G8ZD 2ES2A 4ME5A 3KLWA 1EQQA 2R7DA 4X3TA 2F0VA 1K8AC 3A54A 3EROA 3I4OA 3ND8A 4DV2Q 2L55A 2MO1A 3N6RA 5IP9G 1OXSC 3QG1A 3GTQB 1EYCA 2Y0SG 2RCFA 5AFWA 2I46A 4YHHL 3S1NB 2LY7A 1Z7TA 2WAQG 3L3OC 3IFDA 3KF8A 2KHIA 2EY2A 3AYHB 3IAYA 2YYZA 3JAML 1KIXA 2NVTH 2PZUA 3TP5A 2F4VL 5M5WB 4P72A 3QB3A 5IE8A 4JBKA 3J81c 3I4NG 4IFDH 4GLAC 4K5XA 3CCSA 2HHHQ 5JJKA 1NJIC 2BH8A 2PPBC 5DLQE 1B9NA 1PTOF 2D62A 1ML0D 1TY2A 3ND9A 4A3IH 1XMQL 3CPFA 1VQ5A 3KBXA 5C6AA 2K05A 3TQYA 2WB1B 4A3MG 4K2KA 4G57A 2E2IH 3PUZA 1JOOA 3I91A 1V1OA 3MXPA 3S15B 1DONA 2K28A 4H13C 4LFCQ 5BN3A 1HFNA 1KDBA 2RSNA 1F77A 2JA6H 4KY6A 5IYCG 2NVXB 3MAQA 1JC7A 3PO3B 5EBDA 3NTHA 3O13A 5ELNA 2E5LQ 5HGTA 1QVFA 1A3TA 1HR0W 1U9RA 3J80E 3EN2A 2RA4A 4C3IG 3F2DA 2IX0A 1O7LA 1EZ6A 2L5TA 4OX9Q 2DGYA 1VQOA 3CC2A 4UHVA 2WINB 3KYHC 5IGDA 4HMJA 1PFMA 2JA8B 1PRTC 4JI5Q 3OPOA 2K6AA 1AEXA 1PYBA 4MIUA 4X65Q 4CJ1B 4DXFA 4FF2A 1R9TH 4JI6L 3W2DA 3HKSA 2B63B 3SXHA 5FOBB 3GTKB 1PRTD 4B3MQ 1D6EC 1RL2A 1BQQT 1TWHH 2J7ZA 1KNEA 3RLFA 2NZHA 2F52A 1BF4A 4L5TA 2QDLA 1SNPA 4BY7H 4DN4M 4DV3L 2N49A 5E1FA 1JJ2A 1EFID 3A8JE 4X3UA 4LFCL 4DR1Q 1YJWA 5M3FH 2HUGA 1YHBA 4BS9A 1VQEA 2OCEA 1STHA 1Q86C 3GV6A 3A7AB 4JVZA 3H3VC 4AQYQ 4FXDA 2F4IA 4A3MB 5JEAJ 2K50A 2KENA 4QIWB 1I4XA 2VW9A 1D1IA 1K83H 3MTSA 3NENA 3PUVA 3HOYB 2EJFC 4N9PA 3OMCA 2EQSA 4R4IA 4OX9L 4QJFA 1FJGQ 3H0GB 4ODGA 1QNKA 3CCJA 4K0KL 4LF4Q 1SROA 4LF8L 1AH9A 2IJ0A 3K57A 4B3SL 1CZWA 2X6LA 4IUPA 1VCIA 4MZ9A 1C4QA 3T16A 4DV4Q 4OO1I 4B08A 3SEBA 3RZDB 2BE5C 5M3MB 4X65L 2F0JA 2A1AA 2A5HA 4O2DA 2RDHA 2VQEL 3NXWA 2FMMA 1ET9A 4YIJA 1I6VC 1GOZA 4G7ZC 3NQTA 2MO0A 2BE5D 2LXKA 2QW7A 1HHVA 4WRDA 2UXCQ 3DWPA 4DR7L 2QCPX 4R8NA 2R61A 1VQLA 4NXNQ 5DEHA 2HDMA 4DR1L 3J7A5 1H9JA 1L1OC 3KLRA 1RHPA 4X3SA 1HUNA 5CV8A 2RQXA 2XTIA 5C44B 1E2VA 4AQYL 1NR4A 3PF4A 1JMCA 2VUMG 1TT2A 3W5OA 4CBVA 4HIMA 2LMCB 3S14H 4BBRB 4KJOA 4XQJA 4UP8A 4DU9A 2KOLA 5FJ8G 5LMUQ 2CVRA 2F0MA 5COYA 4KN4C 4A75A 1Y1VB 3H15A 1IBMQ 4LF4L 5IODA 3D4WA 1STAA 1GO3E 4IOCA 1LTRD 4DV4L 1KAWA 4Y7NB 1YEZA 2ZJPA 1TWFH 3H6MA 4IOAA 1SAPA 1SDFA 1UE7A 3STBC 1TS3A 4JI4Q 4XYQA 5I6WA 4TVAB 5K36G 2BA1A 2NWGA 3GTPB 4HCSA 5IYBH 2MHVA 3STBD 3K7AB 2OEOA 1G6PA 3BVGA 2V1CC 3NSWA 2P5ZX 1IYUA 4C3IH 1PDQA 1PZJD 3MEHA 4E6IA 4AH6A 2E8GA 4P71A 3VYRA 4DAVA 1JT8A 1EYGA 4L6TB 5C4XB 4LUZA 4DGZA 5E7NA 3E6ZX 3HOWH 2X69A 3I4LA 3PGZA 4JOIC 1X56A 2ICEC 1PXUA 2OXPA 3SE0A 1JR0D 4A3CG 1X65A 4OO1G 2MPMA 3H3VI 3TZDA 1JQYD 1NBWA 4LWCA 3EA6A 3C1EA 3W3AA 2VB2X 4HMIA 3J81j 3HFZB 4DAYB 2KCNA 1IBKQ 4A3BB 2IWHA 4UP7A 3I7FA 5J39A 3EIVA 4KY5A 4Y52H 1XPRA 3KDFA 4DUYQ 1QILA 2XN9C 4X62Q 3CCQA 2IHEA 1EQVA 1RTOA 2PYKA 4P2CB 2HQEA 2NTSA 4L5QA 4RH6A 4AIMA 1GUOA 1I94Q 5C5LA 4JV5L 1NNXA 1W6JA 3PIOA 3BDCA 1SE8A 4BY1G 1JICA 2QA4A 3G6EA 4DV7Q 2G9HD 2BCOA 5BN5A 1VQKA 3S1MB 2JSOA 2IPKD 4HEDA 4O1NA 1WCMH 1SYDA 4ID6A 4CDDC 3GTLH 4KD3A 4FYDA 5JEAG 3NBHB 1DXMA 1CHPD 5J3BA 3CCRA 2KBNA 3KBGA 2R7ZH 3S2DB 1VQAA 4GOPA 2E2JH 1NCVA 3DMUA 2VS1A 4LK1C 3CW2C 4QQBX 2B2WC 2XNAC 1YJ9A 5IP7H 3MXNB 2EZVA 2K14A 4QIWE 1WTPA 4UY8C 1M1KC 3QO2A 1CKNA 3A5UA 4JI7L 2MQHA 3PO2B 4JI0Q 3TS0A 2JA7G 3MA2B 3LX0A 4J8QA 3OWFA 4X6AH 3OW7A 1U4LA 2PI2A 3NWSA 4NP5A 3HOUG 4A3DG 1Y1WB 2E74C 1N33Q 3DXJC 1O7IA 4JW0A 1LACA 3TREA 3FKIB 4AYBB 5GADC 4JYAQ 1I94L 1KDAA 2CWAA 4YCWA 3A55A 2K75A 4K5WA 5BN4A 3HG9A 1PV4A 4BBSG 4K2LA 1SE2A 4HJ8A 2R93B 2B2UC 4IFDI 2LS01 1EOVA 1DJRD 1OXXK 3HKZB 3CCVA 1DM0B 3S2HH 5HURA 1VQJA 1S3OA 2Q2IA 1OXTA 1HA6A 2ZXPA 1LABA 1BVSA 1DD2A 4JBMA 1MJEA 1FNWA 1I50H 3MXUA 5T1IA 3KOJA 3E3XA 3CCEA 5IYDG 3MWYW 1YI2A 1LO5D 4HIOA 4LJZC 1WTQA 1QE6A 5K36H 4JI0L 3GV3A 1E1TA 3TMEA 4IPCA 3HOZG 1F2LA 3RZOH 3U9SA 2MUYA 3CRLC 1HJPA 1KLGD 2K5HA 3FDTA 2BDOA 4A3GB 2I0QA 2NN6H 4DV0Q 4EVOA 4DR3L 3PQIA 1Q3LA 1F9SA 2ZXOA 3R93A 3BYTB 1I4QA 4C3HH 4JYAL 2EYHA 4KKUA 5C3WA 2EE1A 1TS5A 5M5YH 4A3CH 1X3GA 2ENBA 1TS4A 1VMCA 5E4WC 2VNUD 4LMQD 1ESRA 3J80L 4KK7A 2EYOA 5EPKA 5C4HA 1N32L 2FJ2A 2ZT9C 3TP7A 5EGTA 4EQ5A 4PMBA 1TWAH 2B2TA 2AWOA 2ZTCA 3GTJB 4CJ0B 3ER0A 4DV6L 4IUUA 3D8GA 5AJ3Q 1XTCD 3MHBA 2O5JC 4DNIA 4UAIA 2A74C 1IHZA 2RVLA 3BDLA 1RCVD 4JI3Q 3HOVB 2NVQB 4PNYA 3CRKC 4DPGA 1ILQA 4A3LG 4A3KB 2RF4A 2RHQB 2XIWA 3ITPA 4RGNA 3CMAA 3I4MH 1S4ZA 1UAPA 2L0CA 1PZID 3CPWA 3Q8DA 3M3YB 2PQEA 1OO9B 3M85A 4APVA 1HCZA 3CAMA 1PRTF 1IL2A 2DNEA 5KNBA 4P74A 3ONAB 1C7YA 1HUMA 4DR5L 4GKKL 3S1RB 5C4JH 2AQ2B 3P75A 4QUFA 1T9HA 5JEAH 4F87A 2R6GA 5D3IB 5C3EB 2CWPA 1KLUD 5IGFA 1ZEQX 5ELBA 4DK6C 1D7QA 4IUNA 5FLMH 1S5FD 3F2UA 4DAMA 5C0XJ 1OTCA 4IQZA 1MHWC 2UU9Q 2EOTA 1X3PA 2I5HA 2N55A 1Z47A 4U673 3TP6A 1YNJC 3ICEA 1XNQQ 3M4YA 3SK8A 2JA7H 1MSGA 4A3JB 1VQ4A 1F2ZA 1E22A 1BBUA 4KHPQ 4KHZA 2B8GA 1X9NA 1SNQA 1U4RA 1PFBA 1YNJD 3GTOB 2EJMA 5EPLA 1L0YB 3I56A 3G71A 1GJXA 4RWSC 1I6HB 4YY3L 3CMEA 1PA6A 1SJED 3S17B 3F1ZA 1CFMA 1GVPA 1AE2A 2H4OA 5IT9E 5GAEC 2JEAI 1A2TA 5CV6A 1TWGB 2BDNA 2F0QA 1CQVA 2PW7A 4UP9A 5CBEE 2OTJA 3VYSA 4A76A 2JEBI 3VR2A 2IW3A 1B7YB 1G2TA 3E0JA 2QF7A 2IX1A 2AUKA 4AYBE 4GN3B 1WYDA 2Z8LA 1AZPA 3TN2A 2F0KA 4A93H 1TVXA 2Z6BA 1LUZA 4XT1B 4DK0A 2WB1G 3K59A 4UPAA 4DR6L 1GHKA 1LT4D 2LXJA 3E5SA 2AQ3B 3BDOA 3HGBA 3KUPA 1W3SA 3GTMH 5IYDH 1Y8OB 5HY6A 2NVTB 4OIJA 1Q12A 1G6ZA 1HZAA 3PO3G 2KA7A 1KDCA 2C35B 5C0XI 4DK3C 3HKZE 3KLSA 4JI1Q 2JN4A 3UDXA 4A3IB 3A0JA 1NMFA 3E9HA 3D3RA 3VA5A 1WD0A 3CCUA 5JJIA 1F2YA 2E2IB 1GUTA 3HEJA 3CC4A 1SNCA 2NVYH 3T4AC 1SMXA 5GQOA 1SE3A 5JAVA 1E24A 2JA5B 2JA6B 1HZ9A 3NP8A 4XTCS 3QJYA 2F0UA 1ESFA 1EY6A 2JA8G 1SN8A 3A56A 1C8CA 1EIFA 4K14A 2BA0A 2UUBL 1HQRD 5JJLA 1MD2D 3QOJA 2H5XA 1IL8A 3PUXA 2B63G 2RDGA 3NK9A 4HIDA 4WJ4A 2OTLA 1FGBD 4GN5A 1K0SA 1YHAA 4KY7A 4IN3A 5CYUA 5IY0A 2KEDA 4GNXA 2YTXA 3F8TA 1W2BA 2IT1A 1HNZL 2A68C 4YWLA 3J7ZC 2WFWA 3KJPA 1R9TB 1VMPA 3AB9A 1UUPA 1I4RA 2KECA 2A68D 1VF5C 1TWHB 1YIJA 1J5EQ 1SYEA 3L0OA 4M8AA 1VQMA 3NQIA 2PMZB 4BY7B 5JPNC 3HOYG 3OHXC 2MGSA 5E3FA 1KL9A 3JAMi 4OWTB 3H0GG 5CMDA 4BXXH 4HAEA 1PTOH 3NBHA 5IGGA 3J81L 5A2QE 4OELB 5M3FB 4A3FH 1Y69U 1VQNA 1JE5A 3MEFA 4A3EH 1PFSA 3N52A 1A15A 4DR4Q 4RKBA 3MXNA 2C9OA 3U4ZA 3CHBD 4DV2L 2XRSD 4QL5A 5M3MG 1N34Q 1H9SB 1BO0A 3U58A 1K83B 5C0XG 2B2YC 2GVAA 2EXDA 2I5MX 1I3QB 2PQAB 2Z0SA 4L5SA 1YZ6A 4PZ8A 1EZ8A 3VYTA 3B6YA 2AMCB 4JI8Q 1AP0A 1SNDA 1QJOA 5FLXE 5JVH3 2F0IA 1SMYC 1DGSA 2HHHL 4LUVA 3OW2A 4C3JH 3SVMA 1MKHA 5G3LF 5C44G 3UE0A 5CBAE 4IJLA 3CQZH 5M5XH 3QOLA 3DLLA 3D6WA 1TIID 3HZXA 1SMYD 1J5EL 1S5DD 1STBA 3PCOB 4BBRG 4B3RQ 2NZ1D 3HOXH 1S72A 2ICIA 2D9UA 5BR8Q 2CH4A 2H1EA 4H0LC 1JWSD 1BCPC 5KIXA 1VQBA 1Y1VG 1S5ED 4DV1Q 3EQLC 2E5LL 2F0SA 3C46A
chains in the Genus database with same CATH topology
3MFGA 3H94A 1BCPD 4XQNA 2F3WA 1CA5A 3OOCA 5D14A 5FO9B 3S16B 1S5CD 4KV6A 5ISRA 2K5DA 2IL8A 3J7AV 3UI2A 2Q8RE 2LKVA 2F0FA 2SNSA 3GO5A 1TWFB 3I8ZA 3NHHA 1F9RA 3R3OA 4L63B 4O42A 2F0EA 4H7BA 2FHTA 4CGYB 1GUNA 3DUZA 4DNRB 4UDUC 3SK5A 1LTID 2M9VA 3MFYA 2EYJA 5DAUA 3Q0AA 3VA7A 4RFBA 3PV0A 2EY5A 1EY8A 2F0PA 4DA2A 1LT3D 4OHJA 3HOWB 1BOSA 1HPCA 2JXMB 1E2WA 1EY7A 4JBWA 2HCIA 4RA8A 5KGUA 4K6LA 3M7GA 1A3UA 2DN8A 1MI2A 1O7YA 1RTNA 3D6CA 5A35A 3VR4A 1FNVA 2FFKB 4RGOS 3GP7A 5DM63 1II3A 2CW0C 2K1BA 1JOQA 3Q23A 2E75C 4DAPA 3SDZA 1ZXTA 2CW0D 1DCZA 2B8FA 4DK1A 1BDOA 1EY0A 2L4NA 3J7YW 1WCMB 1KTKA 1V8QA 2A73B 1I4GA 5CGKA 3GTLB 1I4HA 5JPMC 1HRJA 2ID0A 2R7ZB 4FF4A 2E2JB 1SBBB 1BBXC 1V43A 4KTAA 2KVMA 4ZRZA 4J6HA 1TS2A 4IALA 4EQOA 1D2BA 1GUSA 2F3VA 4ZAIA 3M7NA 2F0DA 3JAME 1JORA 1MGSA 5D65A 3I90A 1LTTD 2X6GA 2AQ1B 1EYDA 5NUCA 4TRDA 1UEAB 4F7XA 3P7JA 4B9XA 2J0TD 2PCFB 1B9MA 4IFDJ 4R9WA 5CV9A 4ZK9B 4XQQA 3P1HA 4NDXA 1EYAA 1T5XD 2D2CC 3IKJA 4QCLA 1SFOB 1J9OA 4G4KA 1STGA 1CTMA 2XVSA 5KYLA 2E2HB 2WP8J 5T1GA 3S2HB 4KI0A 4N9TA 5EKLA 1V1PA 5EJWA 1OXUA 2NYZD 1D5ZC 1I50B 3I72A 1JOKA 4XDXA 1FR3A 3MZ5A 2PZTA 4HSPA 3NTIA 3RZOB 3Q22A 4WORA 1F9PA 1AW7A 3A7LA 3NUCA 2MJ8A 4KD4A 2VB3X 4JK1C 2SDFA 1WTWA 1K8MA 2KCCA 4I65A 3BZDB 1XXGA 1A3VA 2L11A 3PIO3 1O78A 2R92B 3FRPB 1IYVA 1Y8PB 1BXTA 2K33A 1VDZA 3RUZA 3BVZA 3DHQA 3MVVA 2I07B 1TWAB 1EY4A 1LLRD 4WJWA 4M1UB 3G7LA 3HS0C 2TSSA 2WKDA 3FVQA 1Y8NB 1FNUA 3FPUB 3T56B 4HSVA 1FYCA 1G2SA 2O4XA 4QMGA 1SSOA 1XX8A 4NKLA 5CV4A 3H09A 3C2PA 4L8JA 4HR7B 1A2UA 5LHY1 3I4MB 5EKKA 1H9KA 1H9SA 2B2VA 1JWMD 5C4JB 1PLFA 2NBFA 1CM9A 1RD9D 4OO1H 1SYBA 4FNFA 5I9OA 3SHLA 3ERQA 1QG7A 3K6OA 1MBYA 5CORA 5IGBA 2RBMA 2L1BA 1BCPB 1CHQD 5JVG3 1XWEA 3GD7A 1ICWA 1HXYD 4I7ZC 2C5CA 3T53B 5C3XA 3URYA 3FEWX 3K5LA 4ULLA 5I2XA 5I2YA 2Q8IB 2EYMA 1RODA 3VYUA 4RHSA 1EU3A 1PYWD 4IFDG 5C4ZA 1ENAA 5DM73 3QWNA 1AFPA 4HN7A 4A93B 2EDGA 1ILPA 4RGTA 1TKWB 1BNZA 1TQOA 4CKBA 3NTKA 2F0LA 3GTMB 1NAPA 2RKSA 1BCPF 1JB3A 3FPPA 4DXGA 5J1ZA 4RHRA 2YU9B 3BVMA 4IUTA 1GHJA 1SNOA 5M9OA 3L7ZC 2RDFA 3OMGA 2OF1A 1HTLD 3OSOA 2NVYB 1LTBD 3WDNA 2M00A 4QUCA 2EXZA 4V0BA 4FXKC 3KK7A 1RKNA 5EPJA 3K5OA 5F2DA 1B1ZA 3I3CA 1IKLA 2WKCA 3I73A 4XIGS 1VF7A 1QB5D 3NE5B 3KLSX 4TKOB 3BG3A 2G9DA 2DY8A 2NTTA 1J8IA 2A69C 2K5QA 1B44D 1X3QA 2N88A 3LWUA 1BUVT 2B39A 5C5MA 4G7OC 5LL6S 2KEEA 2A69D 1G91A 1D1KA 2K7VA 2VXWA 4A3FB 3T13A 4A3EB 1DZ1A 3H91A 2PZWA 4ZLTF 4PQXA 2R3ZA 3DWQA 1B3AA 4DAYA 4FVMA 2K32A 1EWCA 1PFNA 2KHSA 1JCKB 3U9OA 2K03A 3RMHA 2EYFA 1WTOA 3I70A 4ZUIA 3EVQA 1CT1D 1QNUA 4F8MA 4C3JB 3K5MA 3VR6A 3CQZB 4FF1A 1R4QB 5M5XB 1T5EA 4OIKA 3V2TA 5I6YA 5ELEA 3HOXB 1BR9A 1O80A 1O7ZA 4R8IA 2K5WA 3Q6SA 2NUCA 5FK9C 1L0XB 1FD7D 1DOMA 4KHVA 3OIQA 1M8AA 4RCOA 2Z4HA 3NPPA 3J7AF 3X3MA 2K04A 4CJ2C 1E2ZA 5ELCA 1SYFA 3AMUA 1IKMA 5ELDA 1F9QA 2DY7A 5JJZA 1SYCA 4HCEA 4RKLA 5K5PA 1ENCA 2QILA 4RCNA 4BA2I 2PW5A 4KKSA 3M4OB 4C1NI 4IUVA 5E4XA 1STEA 4Q5VA 2Y0SB 2GA4B 4U68A 3BS1A 2DNCA 5I9PA 1SE4A 3K0YA 1D5MC 2WAQB 2KUMA 2AUJD 3NWTA 1DOKA 1K8OA 1WD1A 2EYLA 1WTRA 4TQUS 3S14B 1EOTA 5FO8B 3VR3A 3I4NB 2JP1A 2A6HC 5LL6X 4XT3B 4F88A 1HTPA 2D5DA 4RGMA 2B2YA 1A6XA 3D31A 4S3SA 4G7HC 4DF7A 1CI3M 2NN6I 2A6HD 4K8IA 1JE4A 3TDQA 1EY9A 2F0HA 3SR1A 1TU2B 3G6JB 3IL8A 4FXGC 1JWUD 2O2LD 1GUGA 3GQBA 4DFAA 4C3IB 3TZUA 2L12A 3WOFA 1ZYRC 2FMCA 3A8KE 1SEBD 4ZUJA 1CZGA 2F1MA 4NW2A 3X3NA 4HTHA 1ZYRD 1H9MA 1Q1BA 1Q1EA 4IURA 3VR5A 2ZXRA 1YNNC 4EQPA 1AN8A 3ZYYX 3DWAA 2F0NA 5CR3A 1E0BA 1YNND 3L9AX 1HFGA 4ZQ3A 3OIPA 4BWGB 1WTXA 1HQMC 2RSOA 2HCCA 5IOCA 1TWCB 1ET6A 1LTAD 5CV7A 1GUWA 5C0XH 5IGCA 4EQNA 3FMCA 4RAUC 2PNRC 3S9WA 3R8BA 1AZQA 2AWNA 2F0OA 1EWHA 4K6DA 1SJHD 5EQ0A 2NN6G 3V05A 3PIP3 1PTOC 4LAAA 5EBCA 5FKAC 5KYIA 4C3HG 4PV1C 3HRZC 4XXEA 1PTOD 2KJXA 1CQFA 1B2TA 4BA1I 2M2LA 2Q8TA 3CKIB 1ONLA 1R4PB 1EEFD 4H44C 5IT9L 3K5NA 4XYOA 4GZYC 4QB4A 2TMPA 3IFTA 3SK6A 4KMUC 2VUMB 4Q0FA 1EIHA 1S5BD 3J81E 2E2DC 4ILWA 1UNSA 3Q24A 4PMWA 1LV9A 2JYOA 2J4XA 4TSSA 2WACA 4ZKBB 1X32A 2EJGC 1ZKOA 1Q90A 1ENFA 1U4PA 2JE6I 2EY6A 4OL7A 1Z6HA 3DM1A 1HA5A 2SNMA 5G3LD 4IZ8A 5FO7B 1SYGA 4NMZA 3NBIA 1SXTA 1Q8IA 2NB0A 1RDPD 3AU7A 4C2MB 1KABA 4FP5D 4C3HB 4CHTB 4ABNA 4J1MA 3K58A 5M5YB 2B2VC 4CKEA 2L9HA 1TY0A 1B4OA 1CA6A 4KJNA 1CK1A 3TP8A 3EFXD 3R2IA 2B2WA 1LT6D 1QWYA 3MXGA 2B2TC 1D5XC 2QEJC 5DNFA 1EU4A 4EGVA 3PUYA 4BY1B 1PMRA 3R2TA 3PMFA 3QIAA 1STNA 1NR2A 3V96A 2XWBB 1QOHA 5CC4A 2PO4A 1QCBD 3T51B 1LTSD 2EPBA 3EJIA 4KN7C 2SOBA 5A2QL 1H9RA 1DYQA 5CV5A 3CU7A 2IX3A 1PRTB 2V4DA 1U4MA 2KQ3A 2OT2A 2CQAA 2B2UA 4MN3A 2O5IC 1B53A 5KEEA 2JA7B 4WFN3 2FINB 2EY1A 4FO2A 1B50A 1RF2D 1PZKD 2WIIB 3HOUB 4A3DB 5FLXL 1G291 3D4RA 1W6KA 3MC0B 4OGQC 2BOSA 3BYYB 2SEBD 2CHBD 2EYPA 3PUWA 1STYA 3A8IE 4BBSB 3WOEA 1C48A 2A6EC 2HDLA 1WTVA 1MSHA 4DNTB 4V190 1EL0A 3C1FA 2F0WA 1NSNS 3S1QB 3DEOA 2QDBA 1GXDC 4IUQA 1F2MA 5KNDA 2A6ED 1OXVA 4QF4A 4C1NK 1DOLA 2WV6D 4PMCA 1EY5A 1KAAA 1WVLA 4X3KA 3HOZB 5KNCA 5ELFA 5J22A 4MHEA 2XWJB 2F03A 3DEPA 5IIFA 4K8JA 4KKTA 2EVBA 3GTGB 3SK4A 3LNNA 2Z4IA 1I4PA 1LTGD 3OWEB 3TBIB 3C3LA 4C3JG 2F0TA 2E76C 1IW7C 5EKIA 3RD4A 4FF3A 4Z9CB 2QKIC 3LWEA 5D3DA 5I4DA 3P20A 1IW7D 5TSSA 2MP1A 2XSCA 1KNAA 1TR5A 1XYIA 2K01A 2LFNA 1PTOB 5KRUA 2XRQD 4C56C 2Z1CA 5JOBA 1M4VA 2F0GA 1LT5D 5IGEA 1EEID 4K5VA 4B9WA 3D4DA 1SNMA 1NUCA 1V1PB 4ZYSA 4CKCA 3HP3A 3TSSA 1EIGA 1RJTA 1EQTA 4ZKCB 1G8ZD 4ME5A 4X3TA 2F0VA 3A54A 3EROA 3ND8A 2L55A 3N6RA 1OXSC 3QG1A 3GTQB 1EYCA 5AFWA 2I46A 3S1NB 2LY7A 1Z7TA 3L3OC 3IFDA 3KF8A 2EY2A 3IAYA 2YYZA 3JAML 2PZUA 3TP5A 5M5WB 3QB3A 4IFDH 4K5XA 2PPBC 1B9NA 1PTOF 2D62A 1ML0D 1TY2A 3ND9A 3KBXA 5C6AA 2K05A 2WB1B 4K2KA 4G57A 3PUZA 1JOOA 3I91A 1V1OA 3MXPA 3S15B 1DONA 2K28A 4H13C 1HFNA 5BN3A 1KDBA 2RSNA 1F77A 4KY6A 2NVXB 3MAQA 1JC7A 3PO3B 5EBDA 3NTHA 3O13A 5HGTA 1A3TA 1U9RA 3J80E 2RA4A 4C3IG 2IX0A 1O7LA 1EZ6A 2L5TA 2WINB 5IGDA 4HMJA 1PFMA 2JA8B 1PRTC 3OPOA 2K6AA 1AEXA 4MIUA 4CJ1B 4DXFA 4FF2A 3W2DA 2B63B 3SXHA 5FOBB 3GTKB 1PRTD 1D6EC 2J7ZA 1BQQT 3RLFA 1KNEA 1BF4A 1SNPA 4DN4M 5E1FA 1EFID 3A8JE 4X3UA 2HUGA 4BS9A 1STHA 3GV6A 3A7AB 3H3VC 4FXDA 2F4IA 4A3MB 5JEAJ 4QIWB 1I4XA 1D1IA 3MTSA 3PUVA 3HOYB 2EJFC 4N9PA 3OMCA 3H0GB 4ODGA 1QNKA 2IJ0A 3K57A 1CZWA 2X6LA 4IUPA 1VCIA 3T16A 1C4QA 4OO1I 4B08A 3SEBA 3RZDB 2BE5C 5M3MB 2F0JA 2A5HA 2RDHA 3NXWA 2FMMA 1ET9A 4YIJA 1I6VC 1GOZA 4G7ZC 3NQTA 2BE5D 1HHVA 4WRDA 3DWPA 2QCPX 4R8NA 2R61A 5DEHA 2HDMA 1H9JA 3KLRA 1RHPA 4X3SA 1HUNA 5CV8A 2RQXA 5C44B 1E2VA 1NR4A 1TT2A 4CBVA 2LMCB 4BBRB 4KJOA 4XQJA 4DU9A 2KOLA 2CVRA 2F0MA 5COYA 4KN4C 1Y1VB 5IODA 3D4WA 1STAA 1LTRD 4Y7NB 3H6MA 1SAPA 1SDFA 1TS3A 4XYQA 5I6WA 5K36G 2BA1A 2NWGA 3GTPB 4HCSA 2MHVA 3K7AB 2OEOA 3BVGA 3NSWA 1IYUA 1PDQA 1PZJD 3MEHA 4E6IA 3VYRA 4DAVA 4L6TB 5C4XB 4DGZA 3E6ZX 2X69A 3I4LA 2ICEC 1PXUA 2OXPA 3SE0A 1JR0D 4OO1G 2MPMA 3TZDA 1JQYD 3C1EA 3EA6A 3W3AA 2VB2X 4HMIA 2KCNA 4A3BB 2IWHA 5J39A 4KY5A 1QILA 2XN9C 1EQVA 1RTOA 2PYKA 4P2CB 2HQEA 2NTSA 4RH6A 1GUOA 5C5LA 1W6JA 3BDCA 1JICA 2G9HD 2BCOA 5BN5A 3S1MB 2JSOA 2IPKD 4HEDA 4O1NA 1SYDA 4ID6A 4KD3A 4FYDA 5JEAG 1DXMA 1CHPD 3KBGA 3S2DB 1NCVA 3DMUA 4LK1C 2B2WC 2XNAC 2EZVA 1WTPA 3QO2A 3PO2B 3MA2B 3LX0A 4J8QA 3OWFA 3OW7A 1U4LA 3NWSA 4NP5A 1Y1WB 2E74C 3DXJC 1LACA 3FKIB 4AYBB 1KDAA 3A55A 4K5WA 5BN4A 3HG9A 4K2LA 1SE2A 2R93B 2B2UC 4IFDI 2LS01 1DJRD 1OXXK 3HKZB 1DM0B 5HURA 1OXTA 1HA6A 2ZXPA 1LABA 1DD2A 1FNWA 3MXUA 5T1IA 3MWYW 1LO5D 4LJZC 1WTQA 1QE6A 5K36H 3GV3A 3TMEA 1F2LA 3U9SA 2MUYA 3CRLC 1KLGD 3FDTA 2BDOA 4A3GB 2NN6H 4EVOA 1Q3LA 1F9SA 2ZXOA 3R93A 3BYTB 1I4QA 2EYHA 4KKUA 5C3WA 2EE1A 1TS5A 2ENBA 1TS4A 1VMCA 5E4WC 2VNUD 4LMQD 1ESRA 3J80L 4KK7A 2EYOA 5EPKA 5C4HA 2FJ2A 2ZT9C 3TP7A 5EGTA 4PMBA 2B2TA 2AWOA 3GTJB 4CJ0B 4IUUA 3D8GA 1XTCD 3MHBA 2O5JC 4UAIA 2A74C 1IHZA 2RVLA 3BDLA 1RCVD 3HOVB 2NVQB 4PNYA 3CRKC 1ILQA 4A3KB 2XIWA 3ITPA 4RGNA 1S4ZA 1UAPA 2L0CA 1PZID 3M3YB 2PQEA 1OO9B 3M85A 1HCZA 1PRTF 2DNEA 5KNBA 3ONAB 1HUMA 3S1RB 2AQ2B 3P75A 4QUFA 5JEAH 4F87A 2R6GA 5D3IB 5C3EB 5IGFA 1KLUD 1ZEQX 5ELBA 4IUNA 1S5FD 3F2UA 5C0XJ 4IQZA 2EOTA 1X3PA 2N55A 1Z47A 4U673 3TP6A 1YNJC 3M4YA 3SK8A 1MSGA 4A3JB 1F2ZA 4KHZA 2B8GA 1SNQA 1U4RA 1PFBA 1YNJD 3GTOB 2EJMA 5EPLA 1L0YB 1GJXA 4RWSC 1I6HB 1SJED 3S17B 1CFMA 2H4OA 5IT9E 2JEAI 1A2TA 5CV6A 1TWGB 2BDNA 2F0QA 1CQVA 2PW7A 5CBEE 3VYSA 2JEBI 3VR2A 2IW3A 1G2TA 3E0JA 2QF7A 2IX1A 2AUKA 2Z8LA 1AZPA 3TN2A 2F0KA 1TVXA 4XT1B 4DK0A 3K59A 1GHKA 1LT4D 3E5SA 2AQ3B 3BDOA 3HGBA 3KUPA 1Y8OB 2NVTB 4OIJA 1Q12A 1G6ZA 2KA7A 1KDCA 5C0XI 3KLSA 4A3IB 3D3RA 3VA5A 1WD0A 1F2YA 2E2IB 1GUTA 3HEJA 1SNCA 3T4AC 1SE3A 5JAVA 2JA5B 2JA6B 3NP8A 4XTCS 3QJYA 2F0UA 1ESFA 1EY6A 3A56A 1C8CA 4K14A 2BA0A 1HQRD 1MD2D 3QOJA 1IL8A 3PUXA 2RDGA 3NK9A 1FGBD 4KY7A 4IN3A 5CYUA 2KEDA 2IT1A 2A68C 1R9TB 1VMPA 3AB9A 1UUPA 1I4RA 2KECA 2A68D 1VF5C 1TWHB 1SYEA 4M8AA 3NQIA 2PMZB 4BY7B 5JPNC 3OHXC 2MGSA 5E3FA 5CMDA 4HAEA 1PTOH 3NBHA 5IGGA 3J81L 5A2QE 5M3FB 1Y69U 3N52A 1A15A 4RKBA 3MXNA 2C9OA 3CHBD 2XRSD 1H9SB 1BO0A 1K83B 5C0XG 2B2YC 1I3QB 1EZ8A 3VYTA 1AP0A 1SNDA 1QJOA 5FLXE 5JVH3 2F0IA 1SMYC 3SVMA 5G3LF 5CBAE 3QOLA 3D6WA 1TIID 3HZXA 1SMYD 1S5DD 1STBA 2NZ1D 2ICIA 2D9UA 2H1EA 4H0LC 1JWSD 1BCPC 5KIXA 1S5ED 3EQLC 2F0SA 3C46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0J A;  2KQ3 A;  1JOO A;  3NK9 A;  4I65 A;  3MXP A;  3TP6 A;  5J39 A;  2EYM A;  3TP5 A;  1A3V A;  2F0N A;  3NXW A;  4KY5 A;  5CR3 A;  4YIJ A;  3SK8 A;  5KEE A;  2F3W A;  1SYC A;  1KDB A;  4KY7 A;  3NQT A;  4KY6 A;  4ZQ3 A;  2EY1 A;  1F2Z A;  5CGK A;  4RKL A;  5K5P A;  1EQV A;  2PYK A;  1ENC A;  1ENA A;  4WRD A;  5C4Z A;  2HQE A;  2EY6 A;  1SNQ A;  3TME A;  2PW5 A;  4OL7 A;  4KV6 A;  3RUZ A;  3T13 A;  5ISR A;  5HGT A;  1A3T A;  4R8N A;  5IOC A;  1U9R A;  2PZW A;  5C5L A;  3DHQ A;  3BDC A;  2SNM A;  3MVV A;  4IZ8 A;  5DEH A;  4KTA A;  2LKV A;  1EY4 A;  4EVO A;  2F0F A;  1SYG A;  2SNS A;  1TQO A;  4NMZ A;  1EZ6 A;  5I9P A;  4J6H A;  1A2T A;  5CV6 A;  2F0Q A;  1SYE A;  5CV8 A;  1TR5 A;  2F0L A;  4IAL A;  2PW7 A;  4EQO A;  1KAB A;  5CV7 A;  4B9W A;  1SYD A;  1TT2 A;  2EYH A;  2F3V A;  2KHS A;  2O4X A;  2RKS A;  3NHH A;  4ID6 A;  4QMG A;  2F0D A;  2EYL A;  5E3F A;  2EYP A;  4EQN A;  4J1M A;  5C3W A;  5IGD A;  1JOR A;  4KD3 A;  4HMJ A;  3R3O A;  1STY A;  3U9O A;  5IGG A;  5KRU A;  3S9W A;  4KJO A;  2ENB A;  5J1Z A;  2EYF A;  2F0E A;  4H7B A;  4NKL A;  5JOB A;  2F0O A;  1AEX A;  1EYD A;  3DMU A;  4K6D A;  5CV4 A;  4DU9 A;  5NUC A;  2EYO A;  4MIU A;  1SNO A;  2F0G A;  4ZUI A;  2F0M A;  3SK5 A;  5C4H A;  5M9O A;  2RDF A;  2F0K A;  3EVQ A;  3OMG A;  2EYJ A;  3C1F A;  4K5V A;  2F0W A;  1NSN S;  4RKB A;  4TRD A;  5DAU A;  4PMB A;  2OF1 A;  3D4D A;  1A2U A;  4F7X A;  1SNM A;  5IOD A;  4S3S A;  3D4W A;  1NUC A;  4F8M A;  1STA A;  2QDB A;  3SXH A;  4LAA A;  1F2M A;  4B9X A;  3E5S A;  4DF7 A;  2EY5 A;  4KJN A;  3OSO A;  5EKK A;  4K8I A;  4QF4 A;  2M00 A;  1EY8 A;  5CV9 A;  3H6M A;  3TP8 A;  2EXZ A;  5KYI A;  1EY9 A;  3P1H A;  4NDX A;  1EYA A;  1SNP A;  2F0P A;  3D8G A;  3LX0 A;  5I6W A;  3OWF A;  4PMC A;  1EY5 A;  1KAA A;  2F0H A;  5E1F A;  3SR1 A;  5EGT A;  3TP7 A;  1RKN A;  4ME5 A;  5IGC A;  3MHB A;  4NP5 A;  1EY7 A;  3V2T A;  5F2D A;  1KDC A;  2F0V A;  1EZ8 A;  1IHZ A;  3BDL A;  5I6Y A;  1SYB A;  5KGU A;  3ERO A;  1STG A;  4PNY A;  3SHL A;  5I9O A;  2OEO A;  1SND A;  4DFA A;  1EYC A;  1A3U A;  1STH A;  3ERQ A;  5KYL A;  3D6C A;  3VA5 A;  3ITP A;  2F0I A;  4N9T A;  3MEH A;  3PMF A;  4E6I A;  5J22 A;  1STN A;  1F2Y A;  2NUC A;  5EKL A;  1KDA A;  3HEJ A;  4QB4 A;  2PQE A;  1SNC A;  5IGB A;  2RBM A;  4ZUJ A;  4KHV A;  5JAV A;  4DGZ A;  5CC4 A;  2EY2 A;  3SK6 A;  1JOK A;  3QOL A;  3NP8 A;  1II3 A;  4N9P A;  3OMC A;  3HZX A;  4HTH A;  3EJI A;  4K5W A;  5IIF A;  2OXP A;  2PZU A;  1STB A;  2PZT A;  2F0U A;  3MZ5 A;  2SOB A;  3P75 A;  3QB3 A;  1EY6 A;  4K2L A;  4ODG A;  4K8J A;  4K5X A;  1JOQ A;  5IGF A;  3SK4 A;  4K14 A;  4IUN A;  4WOR A;  4KD4 A;  3NUC A;  3C1E A;  3T16 A;  1SYF A;  5KIX A;  4HMI A;  5C3X A;  4EQP A;  2WAC A;  5C6A A;  5CV5 A;  3QOJ A;  5HUR A;  5IGE A;  4K2K A;  2F0S A;  4G57 A;  2F0T A;  1EY0 A;  5C5M A; 
#chains in the Genus database with same CATH topology
 3MFG A;  3H94 A;  4DR4 L;  2Z6K C;  4I7A A;  1BCP D;  4XQN A;  3UE1 A;  2F3W A;  1CA5 A;  1UE1 A;  3OOC A;  4X64 Q;  1LTL A;  5D14 A;  5FO9 B;  3S16 B;  4DR2 Q;  1S5C D;  4KV6 A;  1I5F A;  5ISR A;  2K5D A;  2IL8 A;  3J7A V;  4MNO A;  1SRU A;  2VL6 A;  3UI2 A;  2Q8R E;  2LKV A;  2F0F A;  4JI5 L;  2SNS A;  4JI8 L;  3I2Z A;  4GLX A;  4YCV A;  2Q2H A;  5C4X G;  3GO5 A;  1TWF B;  3KJO A;  1A8V A;  3I8Z A;  4DUZ Q;  3NHH A;  4B3M L;  1F9R A;  1KXL A;  3R3O A;  3RN2 A;  4L63 B;  4O42 A;  2F0E A;  4H7B A;  4PG3 A;  3M4O H;  2FHT A;  4CGY B;  1GUN A;  3DUZ A;  4DNR B;  4UDU C;  3SK5 A;  1LTI D;  2M9V A;  3MFY A;  5IP9 H;  1WFQ A;  2EYJ A;  5DAU A;  4B3R L;  4A3B G;  3GTK H;  1N8R C;  5BR8 L;  3VA7 A;  4RFB A;  3Q0A A;  3PV0 A;  2EY5 A;  1YVC A;  1EY8 A;  1KRT A;  2F0P A;  4DA2 A;  1LT3 D;  4OHJ A;  3HOW B;  4GKJ Q;  1BOS A;  1HPC A;  1X3F A;  2JXM B;  1E2W A;  1EY7 A;  3PIP A;  4JBW A;  2HCI A;  4RA8 A;  5KGU A;  3I4N H;  4K6L A;  1VQP A;  3M7G A;  1BKB A;  1A3U A;  2DN8 A;  1MI2 A;  1FJG L;  1O7Y A;  4DV5 Q;  1RTN A;  3D6C A;  5A35 A;  3VR4 A;  1FNV A;  4A3M H;  2FFK B;  4RGO S;  3GP7 A;  1VQH A;  5DM6 3;  1II3 A;  3KF6 B;  2CW0 C;  2F3I A;  1A0I A;  5IYC H;  2KHJ A;  2K1B A;  1JOQ A;  1WJJ A;  1ASZ A;  3Q23 A;  2E75 C;  4DAP A;  2GVB A;  3SDZ A;  1ZXT A;  2UXB Q;  2CW0 D;  1DCZ A;  1KHI A;  2B8F A;  2UXC L;  3RZD H;  1CKM A;  2PMZ E;  3NEL A;  4DK1 A;  1BDO A;  1EY0 A;  2L4N A;  3J7Y W;  1PH8 A;  3PO2 G;  1QUQ B;  4NXN L;  1EQR A;  1WCM B;  1K73 C;  1KTK A;  1V8Q A;  2A73 B;  1I4G A;  5CGK A;  3GTL B;  1I4H A;  5JPM C;  1HRJ A;  1L1O A;  2ID0 A;  4LF9 Q;  2R7Z B;  1Y1W G;  4FF4 A;  3OYY A;  3F2C A;  1TXY A;  2E2J B;  1SBB B;  1BBX C;  4JPB W;  3FKI G;  1C0A A;  3CD6 A;  1V43 A;  3JC6 6;  4AYB G;  4KTA A;  1VS0 A;  2KVM A;  4ZRZ A;  5IT9 c;  4J6H A;  1X55 A;  5LMU L;  1TS2 A;  4DV5 L;  3K8A A;  5C44 H;  4IAL A;  4EQO A;  2ZM6 Q;  1IBM L;  1D2B A;  1GUS A;  2F3V A;  2KCT A;  1YNX A;  4ZAI A;  3M7N A;  2F0D A;  3JAM E;  1JOR A;  1MGS A;  1X54 A;  5D65 A;  3I90 A;  1LTT D;  2X6G A;  2AQ1 B;  1PH1 A;  2R93 G;  5ELO A;  1L0W A;  1EYD A;  4JI4 L;  5NUC A;  4GLV B;  3ERS X;  3T1H Q;  2VY3 A;  4HJ9 A;  4O0A A;  4TRD A;  3HKZ G;  1UEA B;  2PNH A;  4F7X A;  1KQS A;  1UEB A;  3P7J A;  1TWC H;  1X6O A;  2J0T D;  4B9X A;  2PCF B;  1B9M A;  4IFD J;  4R9W A;  5CV9 A;  4ZK9 B;  4B3T Q;  1E3P A;  4XQQ A;  3P1H A;  4NDX A;  3F2B A;  1EYA A;  1T5X D;  1IXR A;  2D2C C;  2Y0S E;  2R7F A;  1ICF B;  3IKJ A;  4QCL A;  1SFO B;  1J9O A;  4G4K A;  1STG A;  4OWX B;  1CTM A;  2XVS A;  4A3G G;  5KYL A;  2E2H B;  2WP8 J;  5T1G A;  1Z9F A;  4IPD A;  3S2H B;  4KI0 A;  4JOI A;  2I5L X;  4N9T A;  1PH5 A;  1D8L A;  5EKL A;  1V1P A;  5EJW A;  1OXU A;  2NYZ D;  1D5Z C;  1I50 B;  4HJ5 A;  3T1Y Q;  3I72 A;  1JOK A;  1LM0 A;  1IBK L;  2K4K A;  4L5R C;  4XDX A;  2G5D A;  1FR3 A;  3MZ5 A;  2PZT A;  4HSP A;  4LF7 Q;  4PZ7 A;  3NTI A;  3RZO B;  2RHS B;  3Q22 A;  4DUY L;  4WOR A;  1F9P A;  4X62 L;  1AW7 A;  3A7L A;  3NUC A;  2MJ8 A;  3M4Q A;  4KD4 A;  1Q82 C;  2VB3 X;  4JK1 C;  2SDF A;  4P73 A;  1WTW A;  1IBL Q;  1K8M A;  2KCC A;  3PSI A;  3T1H L;  4I65 A;  3BZD B;  1XXG A;  1A3V A;  2L11 A;  3PIO 3;  4DV7 L;  4LFA Q;  1O78 A;  2R92 B;  3FRP B;  2VUM H;  2DJG C;  1PHJ A;  1IYV A;  3FHW A;  4B3T L;  2QEX A;  1Y8P B;  1BXT A;  2K33 A;  1VDZ A;  2XGT A;  3HOV G;  3RUZ A;  2HIV A;  3BVZ A;  3DHQ A;  5LMN Q;  5FJ8 H;  4A3K G;  3MVV A;  2I07 B;  3A74 A;  4GS3 A;  1TWA B;  3GDE A;  1EY4 A;  1LLR D;  4WJW A;  4M1U B;  4X66 Q;  3K0X A;  4N8F A;  5GAG C;  3S1M H;  3G7L A;  3G4S A;  3HS0 C;  2TSS A;  2LSS A;  2WKD A;  2EIF A;  3FVQ A;  1Y8N B;  3QR8 A;  1FNU A;  3FPU B;  3T56 B;  4LF5 Q;  4HSV A;  1FYC A;  1G2S A;  2O4X A;  4QMG A;  4JBJ A;  2VQF Q;  1SSO A;  1XX8 A;  5C3E G;  4NKL A;  5CV4 A;  3H09 A;  3A5Z B;  3I55 A;  4LF7 L;  3C2P A;  1PH7 A;  4IPG A;  1XPU A;  4L8J A;  4HR7 B;  1A2U A;  5LHY 1;  3I4M B;  2CH4 W;  3BU2 A;  1N33 L;  5EKK A;  1H9K A;  4IJH A;  1J6Q A;  2ASB A;  1H9S A;  1IBL L;  4C2M H;  4A3J G;  2B2V A;  1JWM D;  5C4J B;  1PLF A;  2PQA A;  3K81 C;  2NBF A;  1CM9 A;  1RD9 D;  4LFA L;  4OO1 H;  1SYB A;  4FNF A;  2IY5 B;  5I9O A;  3SHL A;  1XTD A;  3ERQ A;  5FLX c;  1QG7 A;  1XNR Q;  1WI5 A;  2OQ0 A;  3K6O A;  1MBY A;  5LMN L;  5COR A;  1PH2 A;  5IGB A;  2RBM A;  2L1B A;  1BCP B;  5L37 A;  1YIT A;  1CHQ D;  1EWI A;  5JVG 3;  1XWE A;  3GD7 A;  1ICW A;  4OEM B;  1VQ6 A;  1HXY D;  4LF5 L;  3J80 i;  4I7Z C;  2C5C A;  4OXP A;  3T53 B;  5C3X A;  3URY A;  3FEW X;  4BY1 H;  3K5L A;  4ULL A;  5I2X A;  5I2Y A;  2Q8I B;  3NEM A;  2JA9 A;  2EYM A;  1MIU A;  1ROD A;  3VYU A;  4DV0 L;  2UUC Q;  4RHS A;  1EU3 A;  1PYW D;  4IFD G;  1CUK A;  1ENA A;  5C4Z A;  1V9P A;  5DM7 3;  3QWN A;  1AFP A;  4CDE C;  4A3I G;  4HN7 A;  5IWA Q;  4A93 B;  1Y14 B;  2EDG A;  1ILP A;  4RGT A;  1TKW B;  1BNZ A;  4GN4 B;  1TQO A;  3RR5 A;  1U0L A;  4CKB A;  3RN5 A;  3NTK A;  2F0L A;  4R4C A;  3GTM B;  2N8N A;  2JA5 G;  2JA6 G;  4LUO A;  1NAP A;  1VQI A;  2RKS A;  4LFB Q;  2HIX A;  4JCV E;  4LW1 A;  1QZH A;  1BCP F;  1JB3 A;  3FPP A;  3K7U C;  3CC7 A;  4DXG A;  4KLK A;  4HJA A;  5J1Z A;  4RHR A;  4PZ6 A;  2YU9 B;  1K9M C;  3BVM A;  3HOU H;  4A3D H;  5AJ3 L;  4IUT A;  1GHJ A;  1SNO A;  5M9O A;  3L7Z C;  1V1Q A;  2RDF A;  3OMG A;  2OF1 A;  4IO9 A;  2ZJQ A;  2ZTD A;  4JI3 L;  4LF6 Q;  1HTL D;  3OSO A;  2NVY B;  1LTB D;  3WDN A;  2M00 A;  4QUC A;  2EXZ A;  4V0B A;  4FXK C;  3H3V H;  3KK7 A;  1RKN A;  5EPJ A;  5EAY A;  2D0O A;  4NPS A;  2JQO A;  3K5O A;  5F2D A;  1B1Z A;  1SR3 A;  4BBS H;  3I3C A;  1IKL A;  2WKC A;  3I73 A;  1HR0 Q;  4XIG S;  3BZC A;  4P75 A;  1VF7 A;  3S1Q H;  1GKH A;  3G48 A;  1QB5 D;  4BY7 G;  3KDF B;  3NE5 B;  3KLS X;  4TKO B;  3BG3 A;  2UU9 L;  1PH9 A;  3KF6 A;  1ASY A;  1HH2 P;  4HJ7 A;  2G9D A;  2DY8 A;  2NTT A;  4ZCK A;  5M3F G;  4QGU A;  5C3E H;  1XNQ L;  1XJV A;  3HOZ H;  1J8I A;  1XMO Q;  1U5K A;  2A69 C;  2K5Q A;  2ZTE A;  1B44 D;  1X3Q A;  2N88 A;  4KHP L;  3LWU A;  1BUV T;  2B39 A;  4DKA C;  5C5M A;  4POG A;  4G7O C;  5LL6 S;  1K3R A;  2KEE A;  2A69 D;  3FP9 A;  4A3J H;  1G91 A;  4LF6 L;  2Q2T A;  2K52 A;  1XMQ Q;  1D1K A;  4CDF C;  2AHO B;  2K7V A;  2VXW A;  4A3F B;  4GOP B;  3GTG H;  3T13 A;  4A3E B;  1DZ1 A;  2DUD A;  3H91 A;  2PZW A;  2ZJR A;  4ZLT F;  4PQX A;  2R3Z A;  3DWQ A;  1B3A A;  4DAY A;  1UE6 A;  1CKN B;  4FVM A;  2K32 A;  1EWC A;  1QVG A;  1PFN A;  2KHS A;  3JAM c;  1JCK B;  3U50 C;  3U9O A;  2K03 A;  3RMH A;  2EYF A;  1WTO A;  1FVI A;  3I70 A;  4OON A;  4ZUI A;  3EVQ A;  3TS2 A;  1CT1 D;  4A3L H;  3UDF A;  1P16 A;  1QNU A;  4F8M A;  4JI1 L;  1XMO L;  4C3J B;  3K5M A;  3CF5 A;  1G51 A;  3M4P A;  3VR6 A;  3CQZ B;  4FF1 A;  1R4Q B;  5M5X B;  1NE3 A;  2FXQ A;  3W1G A;  1T5E A;  1NTG A;  4OIK A;  3V2T A;  1VQ8 A;  4JI6 Q;  5I6Y A;  4FDB A;  5ELE A;  1Q81 C;  3HOX B;  4YCU A;  1BR9 A;  1O80 A;  2KCM A;  1O7Z A;  2OWO A;  4R8I A;  2K5W A;  3Q6S A;  4DV3 Q;  1Q46 A;  4NB3 A;  2NUC A;  5FK9 C;  4WJ3 M;  3SGI A;  1L0X B;  1FD7 D;  1DOM A;  4KHV A;  2JA5 H;  4R4O A;  3OIQ A;  1M8A A;  4POF A;  4RCO A;  2DJF C;  3J81 i;  2Z4H A;  3NPP A;  5IYB G;  3J7A F;  3X3M A;  2K04 A;  4CJ2 C;  1E2Z A;  5ELC A;  1B3Q A;  1SYF A;  3GTQ H;  1FGU A;  2VZA A;  3AMU A;  4NXM Q;  3S1N H;  1IKM A;  5ELD A;  1F9Q A;  3UDI A;  1JB7 A;  2DY7 A;  4K0K Q;  5JJZ A;  4LF8 Q;  3HOW G;  1SYC A;  4B3S Q;  4HCE A;  4RKL A;  5K5P A;  1ENC A;  2QIL A;  4RCN A;  3OTO Q;  5M5W H;  5GRO A;  4BA2 I;  2PW5 A;  4KKS A;  3M4O B;  4C1N I;  2UUA Q;  1EUJ A;  4IUV A;  5E4X A;  1PYS B;  1VQD A;  1STE A;  4Q5V A;  2Y0S B;  2GA4 B;  2VQE Q;  4U68 A;  3BS1 A;  2DNC A;  5I9P A;  1SE4 A;  3K0Y A;  1D5M C;  2WAQ B;  2KUM A;  3S15 H;  2YV5 A;  2AUJ D;  3NWT A;  4DR7 Q;  3AEV A;  1AE3 A;  1DOK A;  1K8O A;  1WD1 A;  1EIY B;  2EYL A;  2NVX H;  1WTR A;  4TQU S;  1N34 L;  3S14 B;  1EOT A;  5FO8 B;  3PO3 H;  3VR3 A;  3I4N B;  2JP1 A;  2A6H C;  5LL6 X;  4XT3 B;  4F88 A;  1HTP A;  2CFM A;  2D5D A;  4RGM A;  2B2Y A;  1A6X A;  3CP0 A;  3D31 A;  4S3S A;  5GAH C;  4G7H C;  1Q8K A;  4DF7 A;  3TEH B;  1CI3 M;  2NN6 I;  2A6H D;  2IHF A;  4K8I A;  1NMG A;  1JE4 A;  1WCM G;  1SLJ A;  1EY9 A;  3TDQ A;  4NXM L;  2F0H A;  3SR1 A;  1TU2 B;  3G6J B;  1I3Q H;  1YBY A;  2R7Z G;  3IL8 A;  1A63 A;  2JA8 H;  4FXG C;  1JWU D;  2O2L D;  1GUG A;  3ULL A;  3GQB A;  5IP7 G;  4DFA A;  3OTO L;  4C3I B;  3TZU A;  2L12 A;  3WOF A;  1ZYR C;  2UUA L;  2B63 H;  2FMC A;  3ZJY C;  3A8K E;  1SEB D;  2YTV A;  4ZUJ A;  1CZG A;  2F1M A;  4NW2 A;  4DV1 L;  3X3N A;  2D0P A;  1IYJ B;  4HTH A;  1ZYR D;  1H9M A;  1Q1B A;  4YWM A;  1Q1E A;  4IUR A;  4RMF A;  3VR5 A;  2Z6K A;  3BZK A;  2ZXR A;  4X64 L;  1YNN C;  3M9B A;  4EQP A;  1AN8 A;  4DR2 L;  2BH2 A;  3ZYY X;  2PI2 E;  2L15 A;  3DWA A;  2F0N A;  5CR3 A;  1E0B A;  1YNN D;  3L9A X;  1HFG A;  4ZQ3 A;  3OIP A;  3UDG A;  3AQQ A;  3HOY H;  4BWG B;  1WTX A;  4YWK A;  3H0G H;  3S16 H;  4OWW B;  1HQM C;  2RSO A;  2HCC A;  4DUZ L;  5IOC A;  1WOC A;  3PF5 A;  1TWC B;  4QY7 A;  1ET6 A;  1B8A A;  1LTA D;  1K3B C;  5M3M H;  5CV7 A;  3WWV A;  1GUW A;  5C0X H;  4JV5 Q;  5IGC A;  4EQN A;  3FMC A;  4RAU C;  1LYL A;  2PNR C;  3U4V A;  3S9W A;  3R8B A;  1AZQ A;  2AWN A;  2WB1 E;  2F0O A;  1EWH A;  4K6D A;  4GKJ L;  1SJH D;  5EQ0 A;  1PH4 A;  2NN6 G;  3V05 A;  3PIP 3;  3K80 C;  1PTO C;  4LAA A;  5EBC A;  5FKA C;  4GOP C;  5KYI A;  4C3H G;  4PV1 C;  2R92 G;  1H95 A;  1WTH A;  3HRZ C;  4XXE A;  3BJU A;  3EBE A;  1PTO D;  2KJX A;  3LGJ A;  1CQF A;  2NZO A;  4BBR H;  1B2T A;  4BA1 I;  4JG2 A;  2M2L A;  2Q8T A;  3CKI B;  2MNA A;  1QVC A;  4JI7 Q;  4HIK A;  1HZB A;  1ONL A;  1R4P B;  1N9W A;  1Y1V H;  1EEF D;  4H44 C;  1GM5 A;  5IT9 L;  3K5N A;  4XYO A;  4GZY C;  4QB4 A;  2HD3 A;  4Y7N H;  2TMP A;  2UXB L;  3IFT A;  3KF8 B;  3SK6 A;  4KMU C;  2VUM B;  4Q0F A;  1EIH A;  4GNX B;  1M90 C;  3CCM A;  1S5B D;  3J81 E;  2E2D C;  4ILW A;  1UNS A;  3GTP H;  3Q24 A;  4PMW A;  1E7Z A;  1LV9 A;  2JYO A;  3K7A H;  2J4X A;  3S24 A;  4TSS A;  2WAQ E;  2WAC A;  1KRS A;  4ZKB B;  4LF9 L;  4H02 A;  3CXC A;  3I4M G;  1X32 A;  3E0E A;  2EJG C;  1ZKO A;  1Q90 A;  1ENF A;  5C4X H;  1U4P A;  2JE6 I;  5HGQ A;  1VQ7 A;  1N36 Q;  1BBW A;  2EY6 A;  4OL7 A;  1Z6H A;  2ZM6 L;  5FLM G;  1YJN A;  2HT1 A;  3DM1 A;  1HNX Q;  1HA5 A;  2SNM A;  5G3L D;  2Q2U A;  4IZ8 A;  5FO7 B;  1GD7 A;  1SYG A;  4NMZ A;  3NBI A;  1PH3 A;  4A3B H;  1SXT A;  1Q8I A;  2NB0 A;  1K0R A;  1RDP D;  3AU7 A;  1E1O A;  4C2M B;  1KAB A;  2RCN A;  4CDC C;  4FP5 D;  4C3H B;  1FL0 A;  4CHT B;  4ABN A;  4J1M A;  3K58 A;  5M5Y B;  4DR3 Q;  1PH6 A;  2B2V C;  1P8L A;  1B70 B;  4CKE A;  2L9H A;  1TY0 A;  1RIP A;  2CCZ A;  1B4O A;  1CA6 A;  4KJN A;  1CK1 A;  1HNW Q;  3TP8 A;  3EFX D;  1VQC A;  3R2I A;  2B2W A;  1LT6 D;  1VQ9 A;  1X3E A;  1QWY A;  3MXG A;  1N32 Q;  2QGQ A;  3RLO A;  1UE5 A;  2B2T C;  1A62 A;  2ALY B;  3T1Y L;  1JJC B;  1SFO H;  1N36 L;  1D5X C;  3S2D H;  2GN5 A;  4A93 G;  1CSP A;  2E2H H;  2QEJ C;  5DNF A;  1EU4 A;  4EGV A;  3PUY A;  4MTK A;  2N3S A;  4BY1 B;  4DV6 Q;  1PMR A;  1JJG A;  3R2T A;  3ULP A;  3PMF A;  3QIA A;  1STN A;  1NR2 A;  3V96 A;  1HNX L;  2XWB B;  3PO2 H;  1QOH A;  5CC4 A;  2PO4 A;  1QCB D;  3T51 B;  1LTS D;  2EPB A;  3EJI A;  4KN7 C;  2SOB A;  5A2Q L;  1Q7Y C;  1H9R A;  1Y1W H;  3J80 c;  3FKI H;  1DYQ A;  5CV5 A;  2UXD Q;  1MJC A;  3CU7 A;  3D0F A;  2IX3 A;  3RLN A;  1PRT B;  2V4D A;  1U4M A;  1HZC A;  4DR5 Q;  2KQ3 A;  4GKK Q;  2OT2 A;  3L2P A;  2CQA A;  3CCL A;  2B2U A;  4MN3 A;  2O5I C;  2R92 H;  1B53 A;  5KEE A;  1CKO A;  2JA7 B;  4WFN 3;  4X66 L;  2FIN B;  2EY1 A;  4FO2 A;  5H1S E;  1B50 A;  1HNW L;  1RF2 D;  1PZK D;  2B29 A;  3RNU A;  4J15 A;  2WII B;  3HOU B;  4A3D B;  1L2F A;  2K5V A;  2R93 H;  1UWV A;  5FLX L;  1G29 1;  4ALP A;  3D4R A;  1W6K A;  2VQF L;  3MC0 B;  4OGQ C;  1KD1 C;  2BOS A;  1NY4 A;  1YHQ A;  3BYY B;  2SEB D;  2CHB D;  4YY3 Q;  2EYP A;  1EFW A;  3PUW A;  1VQF A;  1STY A;  3A8I E;  4BBS B;  3WOE A;  1C48 A;  2A6E C;  2HDL A;  3ULJ A;  4EX5 A;  2K5N A;  1WTV A;  4N8X 1;  1MSH A;  4DNT B;  4V19 0;  1EL0 A;  3C1F A;  2F0W A;  1NSN S;  4A3G H;  2AKW B;  4RG1 A;  3S1Q B;  3DEO A;  1IZ6 A;  2CQO A;  1GXD C;  2QDB A;  1F2M A;  4IUQ A;  5KND A;  2A6E D;  2JJQ A;  1OXV A;  4QF4 A;  4C1N K;  2UXD L;  1XNR L;  1DOL A;  2WV6 D;  2Z9H A;  4PMC A;  1EY5 A;  1KAA A;  1WVL A;  4BXX G;  3AFP A;  4X3K A;  1K28 A;  4A3F G;  4JI2 Q;  4DR6 Q;  4A3E G;  3HOZ B;  5LMN W;  2A8V A;  3IRB A;  5KNC A;  4LNQ A;  5ELF A;  5J22 A;  2B3G A;  4MHE A;  1S40 A;  3GTJ H;  2XWJ B;  2F03 A;  1PVO A;  3DEP A;  2N78 A;  1K8G A;  5IIF A;  1L1O B;  1XPO A;  1KC8 C;  2A19 A;  4K8J A;  4KKT A;  2EVB A;  3GTG B;  3SK4 A;  3LNN A;  2UUC L;  2MFI A;  3HOV H;  2Z4I A;  2NVQ H;  3DM3 A;  2JK8 A;  4A3K H;  2ATW A;  1VQG A;  1I4P A;  1LTG D;  3OWE B;  3TBI B;  3C3L A;  4C3J G;  2F0T A;  4MTN A;  3M3Y H;  2E76 C;  1C9O A;  1IW7 C;  5EKI A;  3RD4 A;  5IWA L;  4FF3 A;  4Z9C B;  2QKI C;  3LWE A;  5D3D A;  5I4D A;  4ME3 A;  2UUB Q;  3S1R H;  4A4I A;  3HOX G;  3P20 A;  1IW7 D;  4YHH Q;  5TSS A;  2MP1 A;  4LFB L;  4JI2 L;  4IPH A;  2YTY A;  4GNX C;  2XSC A;  2OQK A;  4R4T A;  1HNZ Q;  1KNA A;  1TR5 A;  2F4V Q;  1XYI A;  2K01 A;  1QUQ A;  2LFN A;  3E9I A;  1QZG A;  4JC0 A;  1PTO B;  5KRU A;  2XRQ D;  4C56 C;  2Z1C A;  2YU9 H;  3TRZ A;  2HQL A;  5JOB A;  3GTO H;  1M4V A;  2F0G A;  1I6H H;  1LT5 D;  4R1J A;  5IGE A;  1EEI D;  1CSQ A;  4K5V A;  4B9W A;  3D4D A;  3S17 H;  1SNM A;  1NUC A;  1V1P B;  3VDY A;  4ZYS A;  4CKC A;  3KFU A;  3HP3 A;  3TSS A;  1EIG A;  1RJT A;  1TWG H;  3W1B A;  1HR0 L;  3AFQ A;  1EQT A;  4R4Q A;  2CKZ B;  4ZKC B;  1G8Z D;  2ES2 A;  4ME5 A;  3KLW A;  1EQQ A;  2R7D A;  4X3T A;  2F0V A;  1K8A C;  3A54 A;  3ERO A;  3I4O A;  3ND8 A;  4DV2 Q;  2L55 A;  2MO1 A;  3N6R A;  5IP9 G;  1OXS C;  3QG1 A;  3GTQ B;  1EYC A;  2Y0S G;  2RCF A;  5AFW A;  2I46 A;  4YHH L;  3S1N B;  2LY7 A;  1Z7T A;  2WAQ G;  3L3O C;  3IFD A;  3KF8 A;  2KHI A;  2EY2 A;  3AYH B;  3IAY A;  2YYZ A;  3JAM L;  1KIX A;  2NVT H;  2PZU A;  3TP5 A;  2F4V L;  5M5W B;  4P72 A;  3QB3 A;  5IE8 A;  4JBK A;  3J81 c;  3I4N G;  4IFD H;  4GLA C;  4K5X A;  3CCS A;  2HHH Q;  5JJK A;  1NJI C;  2BH8 A;  2PPB C;  5DLQ E;  1B9N A;  1PTO F;  2D62 A;  1ML0 D;  1TY2 A;  3ND9 A;  4A3I H;  1XMQ L;  3CPF A;  1VQ5 A;  3KBX A;  5C6A A;  2K05 A;  3TQY A;  2WB1 B;  4A3M G;  4K2K A;  4G57 A;  2E2I H;  3PUZ A;  1JOO A;  3I91 A;  1V1O A;  3MXP A;  3S15 B;  1DON A;  2K28 A;  4H13 C;  4LFC Q;  5BN3 A;  1HFN A;  1KDB A;  2RSN A;  1F77 A;  2JA6 H;  4KY6 A;  5IYC G;  2NVX B;  3MAQ A;  1JC7 A;  3PO3 B;  5EBD A;  3NTH A;  3O13 A;  5ELN A;  2E5L Q;  5HGT A;  1QVF A;  1A3T A;  1HR0 W;  1U9R A;  3J80 E;  3EN2 A;  2RA4 A;  4C3I G;  3F2D A;  2IX0 A;  1O7L A;  1EZ6 A;  2L5T A;  4OX9 Q;  2DGY A;  1VQO A;  3CC2 A;  4UHV A;  2WIN B;  3KYH C;  5IGD A;  4HMJ A;  1PFM A;  2JA8 B;  1PRT C;  4JI5 Q;  3OPO A;  2K6A A;  1AEX A;  1PYB A;  4MIU A;  4X65 Q;  4CJ1 B;  4DXF A;  4FF2 A;  1R9T H;  4JI6 L;  3W2D A;  3HKS A;  2B63 B;  3SXH A;  5FOB B;  3GTK B;  1PRT D;  4B3M Q;  1D6E C;  1RL2 A;  1BQQ T;  1TWH H;  2J7Z A;  1KNE A;  3RLF A;  2NZH A;  2F52 A;  1BF4 A;  4L5T A;  2QDL A;  1SNP A;  4BY7 H;  4DN4 M;  4DV3 L;  2N49 A;  5E1F A;  1JJ2 A;  1EFI D;  3A8J E;  4X3U A;  4LFC L;  4DR1 Q;  1YJW A;  5M3F H;  2HUG A;  1YHB A;  4BS9 A;  1VQE A;  2OCE A;  1STH A;  1Q86 C;  3GV6 A;  3A7A B;  4JVZ A;  3H3V C;  4AQY Q;  4FXD A;  2F4I A;  4A3M B;  5JEA J;  2K50 A;  2KEN A;  4QIW B;  1I4X A;  2VW9 A;  1D1I A;  1K83 H;  3MTS A;  3NEN A;  3PUV A;  3HOY B;  2EJF C;  4N9P A;  3OMC A;  2EQS A;  4R4I A;  4OX9 L;  4QJF A;  1FJG Q;  3H0G B;  4ODG A;  1QNK A;  3CCJ A;  4K0K L;  4LF4 Q;  1SRO A;  4LF8 L;  1AH9 A;  2IJ0 A;  3K57 A;  4B3S L;  1CZW A;  2X6L A;  4IUP A;  1VCI A;  4MZ9 A;  1C4Q A;  3T16 A;  4DV4 Q;  4OO1 I;  4B08 A;  3SEB A;  3RZD B;  2BE5 C;  5M3M B;  4X65 L;  2F0J A;  2A1A A;  2A5H A;  4O2D A;  2RDH A;  2VQE L;  3NXW A;  2FMM A;  1ET9 A;  4YIJ A;  1I6V C;  1GOZ A;  4G7Z C;  3NQT A;  2MO0 A;  2BE5 D;  2LXK A;  2QW7 A;  1HHV A;  4WRD A;  2UXC Q;  3DWP A;  4DR7 L;  2QCP X;  4R8N A;  2R61 A;  1VQL A;  4NXN Q;  5DEH A;  2HDM A;  4DR1 L;  3J7A 5;  1H9J A;  1L1O C;  3KLR A;  1RHP A;  4X3S A;  1HUN A;  5CV8 A;  2RQX A;  2XTI A;  5C44 B;  1E2V A;  4AQY L;  1NR4 A;  3PF4 A;  1JMC A;  2VUM G;  1TT2 A;  3W5O A;  4CBV A;  4HIM A;  2LMC B;  3S14 H;  4BBR B;  4KJO A;  4XQJ A;  4UP8 A;  4DU9 A;  2KOL A;  5FJ8 G;  5LMU Q;  2CVR A;  2F0M A;  5COY A;  4KN4 C;  4A75 A;  1Y1V B;  3H15 A;  1IBM Q;  4LF4 L;  5IOD A;  3D4W A;  1STA A;  1GO3 E;  4IOC A;  1LTR D;  4DV4 L;  1KAW A;  4Y7N B;  1YEZ A;  2ZJP A;  1TWF H;  3H6M A;  4IOA A;  1SAP A;  1SDF A;  1UE7 A;  3STB C;  1TS3 A;  4JI4 Q;  4XYQ A;  5I6W A;  4TVA B;  5K36 G;  2BA1 A;  2NWG A;  3GTP B;  4HCS A;  5IYB H;  2MHV A;  3STB D;  3K7A B;  2OEO A;  1G6P A;  3BVG A;  2V1C C;  3NSW A;  2P5Z X;  1IYU A;  4C3I H;  1PDQ A;  1PZJ D;  3MEH A;  4E6I A;  4AH6 A;  2E8G A;  4P71 A;  3VYR A;  4DAV A;  1JT8 A;  1EYG A;  4L6T B;  5C4X B;  4LUZ A;  4DGZ A;  5E7N A;  3E6Z X;  3HOW H;  2X69 A;  3I4L A;  3PGZ A;  4JOI C;  1X56 A;  2ICE C;  1PXU A;  2OXP A;  3SE0 A;  1JR0 D;  4A3C G;  1X65 A;  4OO1 G;  2MPM A;  3H3V I;  3TZD A;  1JQY D;  1NBW A;  4LWC A;  3EA6 A;  3C1E A;  3W3A A;  2VB2 X;  4HMI A;  3J81 j;  3HFZ B;  4DAY B;  2KCN A;  1IBK Q;  4A3B B;  2IWH A;  4UP7 A;  3I7F A;  5J39 A;  3EIV A;  4KY5 A;  4Y52 H;  1XPR A;  3KDF A;  4DUY Q;  1QIL A;  2XN9 C;  4X62 Q;  3CCQ A;  2IHE A;  1EQV A;  1RTO A;  2PYK A;  4P2C B;  2HQE A;  2NTS A;  4L5Q A;  4RH6 A;  4AIM A;  1GUO A;  1I94 Q;  5C5L A;  4JV5 L;  1NNX A;  1W6J A;  3PIO A;  3BDC A;  1SE8 A;  4BY1 G;  1JIC A;  2QA4 A;  3G6E A;  4DV7 Q;  2G9H D;  2BCO A;  5BN5 A;  1VQK A;  3S1M B;  2JSO A;  2IPK D;  4HED A;  4O1N A;  1WCM H;  1SYD A;  4ID6 A;  4CDD C;  3GTL H;  4KD3 A;  4FYD A;  5JEA G;  3NBH B;  1DXM A;  1CHP D;  5J3B A;  3CCR A;  2KBN A;  3KBG A;  2R7Z H;  3S2D B;  1VQA A;  4GOP A;  2E2J H;  1NCV A;  3DMU A;  2VS1 A;  4LK1 C;  3CW2 C;  4QQB X;  2B2W C;  2XNA C;  1YJ9 A;  5IP7 H;  3MXN B;  2EZV A;  2K14 A;  4QIW E;  1WTP A;  4UY8 C;  1M1K C;  3QO2 A;  1CKN A;  3A5U A;  4JI7 L;  2MQH A;  3PO2 B;  4JI0 Q;  3TS0 A;  2JA7 G;  3MA2 B;  3LX0 A;  4J8Q A;  3OWF A;  4X6A H;  3OW7 A;  1U4L A;  2PI2 A;  3NWS A;  4NP5 A;  3HOU G;  4A3D G;  1Y1W B;  2E74 C;  1N33 Q;  3DXJ C;  1O7I A;  4JW0 A;  1LAC A;  3TRE A;  3FKI B;  4AYB B;  5GAD C;  4JYA Q;  1I94 L;  1KDA A;  2CWA A;  4YCW A;  3A55 A;  2K75 A;  4K5W A;  5BN4 A;  3HG9 A;  1PV4 A;  4BBS G;  4K2L A;  1SE2 A;  4HJ8 A;  2R93 B;  2B2U C;  4IFD I;  2LS0 1;  1EOV A;  1DJR D;  1OXX K;  3HKZ B;  3CCV A;  1DM0 B;  3S2H H;  5HUR A;  1VQJ A;  1S3O A;  2Q2I A;  1OXT A;  1HA6 A;  2ZXP A;  1LAB A;  1BVS A;  1DD2 A;  4JBM A;  1MJE A;  1FNW A;  1I50 H;  3MXU A;  5T1I A;  3KOJ A;  3E3X A;  3CCE A;  5IYD G;  3MWY W;  1YI2 A;  1LO5 D;  4HIO A;  4LJZ C;  1WTQ A;  1QE6 A;  5K36 H;  4JI0 L;  3GV3 A;  1E1T A;  3TME A;  4IPC A;  3HOZ G;  1F2L A;  3RZO H;  3U9S A;  2MUY A;  3CRL C;  1HJP A;  1KLG D;  2K5H A;  3FDT A;  2BDO A;  4A3G B;  2I0Q A;  2NN6 H;  4DV0 Q;  4EVO A;  4DR3 L;  3PQI A;  1Q3L A;  1F9S A;  2ZXO A;  3R93 A;  3BYT B;  1I4Q A;  4C3H H;  4JYA L;  2EYH A;  4KKU A;  5C3W A;  2EE1 A;  1TS5 A;  5M5Y H;  4A3C H;  1X3G A;  2ENB A;  1TS4 A;  1VMC A;  5E4W C;  2VNU D;  4LMQ D;  1ESR A;  3J80 L;  4KK7 A;  2EYO A;  5EPK A;  5C4H A;  1N32 L;  2FJ2 A;  2ZT9 C;  3TP7 A;  5EGT A;  4EQ5 A;  4PMB A;  1TWA H;  2B2T A;  2AWO A;  2ZTC A;  3GTJ B;  4CJ0 B;  3ER0 A;  4DV6 L;  4IUU A;  3D8G A;  5AJ3 Q;  1XTC D;  3MHB A;  2O5J C;  4DNI A;  4UAI A;  2A74 C;  1IHZ A;  2RVL A;  3BDL A;  1RCV D;  4JI3 Q;  3HOV B;  2NVQ B;  4PNY A;  3CRK C;  4DPG A;  1ILQ A;  4A3L G;  4A3K B;  2RF4 A;  2RHQ B;  2XIW A;  3ITP A;  4RGN A;  3CMA A;  3I4M H;  1S4Z A;  1UAP A;  2L0C A;  1PZI D;  3CPW A;  3Q8D A;  3M3Y B;  2PQE A;  1OO9 B;  3M85 A;  4APV A;  1HCZ A;  3CAM A;  1PRT F;  1IL2 A;  2DNE A;  5KNB A;  4P74 A;  3ONA B;  1C7Y A;  1HUM A;  4DR5 L;  4GKK L;  3S1R B;  5C4J H;  2AQ2 B;  3P75 A;  4QUF A;  1T9H A;  5JEA H;  4F87 A;  2R6G A;  5D3I B;  5C3E B;  2CWP A;  1KLU D;  5IGF A;  1ZEQ X;  5ELB A;  4DK6 C;  1D7Q A;  4IUN A;  5FLM H;  1S5F D;  3F2U A;  4DAM A;  5C0X J;  1OTC A;  4IQZ A;  1MHW C;  2UU9 Q;  2EOT A;  1X3P A;  2I5H A;  2N55 A;  1Z47 A;  4U67 3;  3TP6 A;  1YNJ C;  3ICE A;  1XNQ Q;  3M4Y A;  3SK8 A;  2JA7 H;  1MSG A;  4A3J B;  1VQ4 A;  1F2Z A;  1E22 A;  1BBU A;  4KHP Q;  4KHZ A;  2B8G A;  1X9N A;  1SNQ A;  1U4R A;  1PFB A;  1YNJ D;  3GTO B;  2EJM A;  5EPL A;  1L0Y B;  3I56 A;  3G71 A;  1GJX A;  4RWS C;  1I6H B;  4YY3 L;  3CME A;  1PA6 A;  1SJE D;  3S17 B;  3F1Z A;  1CFM A;  1GVP A;  1AE2 A;  2H4O A;  5IT9 E;  5GAE C;  2JEA I;  1A2T A;  5CV6 A;  1TWG B;  2BDN A;  2F0Q A;  1CQV A;  2PW7 A;  4UP9 A;  5CBE E;  2OTJ A;  3VYS A;  4A76 A;  2JEB I;  3VR2 A;  2IW3 A;  1B7Y B;  1G2T A;  3E0J A;  2QF7 A;  2IX1 A;  2AUK A;  4AYB E;  4GN3 B;  1WYD A;  2Z8L A;  1AZP A;  3TN2 A;  2F0K A;  4A93 H;  1TVX A;  2Z6B A;  1LUZ A;  4XT1 B;  4DK0 A;  2WB1 G;  3K59 A;  4UPA A;  4DR6 L;  1GHK A;  1LT4 D;  2LXJ A;  3E5S A;  2AQ3 B;  3BDO A;  3HGB A;  3KUP A;  1W3S A;  3GTM H;  5IYD H;  1Y8O B;  5HY6 A;  2NVT B;  4OIJ A;  1Q12 A;  1G6Z A;  1HZA A;  3PO3 G;  2KA7 A;  1KDC A;  2C35 B;  5C0X I;  4DK3 C;  3HKZ E;  3KLS A;  4JI1 Q;  2JN4 A;  3UDX A;  4A3I B;  3A0J A;  1NMF A;  3E9H A;  3D3R A;  3VA5 A;  1WD0 A;  3CCU A;  5JJI A;  1F2Y A;  2E2I B;  1GUT A;  3HEJ A;  3CC4 A;  1SNC A;  2NVY H;  3T4A C;  1SMX A;  5GQO A;  1SE3 A;  5JAV A;  1E24 A;  2JA5 B;  2JA6 B;  1HZ9 A;  3NP8 A;  4XTC S;  3QJY A;  2F0U A;  1ESF A;  1EY6 A;  2JA8 G;  1SN8 A;  3A56 A;  1C8C A;  1EIF A;  4K14 A;  2BA0 A;  2UUB L;  1HQR D;  5JJL A;  1MD2 D;  3QOJ A;  2H5X A;  1IL8 A;  3PUX A;  2B63 G;  2RDG A;  3NK9 A;  4HID A;  4WJ4 A;  2OTL A;  1FGB D;  4GN5 A;  1K0S A;  1YHA A;  4KY7 A;  4IN3 A;  5CYU A;  5IY0 A;  2KED A;  4GNX A;  2YTX A;  3F8T A;  1W2B A;  2IT1 A;  1HNZ L;  2A68 C;  4YWL A;  3J7Z C;  2WFW A;  3KJP A;  1R9T B;  1VMP A;  3AB9 A;  1UUP A;  1I4R A;  2KEC A;  2A68 D;  1VF5 C;  1TWH B;  1YIJ A;  1J5E Q;  1SYE A;  3L0O A;  4M8A A;  1VQM A;  3NQI A;  2PMZ B;  4BY7 B;  5JPN C;  3HOY G;  3OHX C;  2MGS A;  5E3F A;  1KL9 A;  3JAM i;  4OWT B;  3H0G G;  5CMD A;  4BXX H;  4HAE A;  1PTO H;  3NBH A;  5IGG A;  3J81 L;  5A2Q E;  4OEL B;  5M3F B;  4A3F H;  1Y69 U;  1VQN A;  1JE5 A;  3MEF A;  4A3E H;  1PFS A;  3N52 A;  1A15 A;  4DR4 Q;  4RKB A;  3MXN A;  2C9O A;  3U4Z A;  3CHB D;  4DV2 L;  2XRS D;  4QL5 A;  5M3M G;  1N34 Q;  1H9S B;  1BO0 A;  3U58 A;  1K83 B;  5C0X G;  2B2Y C;  2GVA A;  2EXD A;  2I5M X;  1I3Q B;  2PQA B;  2Z0S A;  4L5S A;  1YZ6 A;  4PZ8 A;  1EZ8 A;  3VYT A;  3B6Y A;  2AMC B;  4JI8 Q;  1AP0 A;  1SND A;  1QJO A;  5FLX E;  5JVH 3;  2F0I A;  1SMY C;  1DGS A;  2HHH L;  4LUV A;  3OW2 A;  4C3J H;  3SVM A;  1MKH A;  5G3L F;  5C44 G;  3UE0 A;  5CBA E;  4IJL A;  3CQZ H;  5M5X H;  3QOL A;  3DLL A;  3D6W A;  1TII D;  3HZX A;  1SMY D;  1J5E L;  1S5D D;  1STB A;  3PCO B;  4BBR G;  4B3R Q;  2NZ1 D;  3HOX H;  1S72 A;  2ICI A;  2D9U A;  5BR8 Q;  2CH4 A;  2H1E A;  4H0L C;  1JWS D;  1BCP C;  5KIX A;  1VQB A;  1Y1V G;  1S5E D;  4DV1 Q;  3EQL C;  2E5L L;  2F0S A;  3C46 A; 
#chains in the Genus database with same CATH homology
 3MFG A;  3H94 A;  1BCP D;  4XQN A;  2F3W A;  1CA5 A;  3OOC A;  5D14 A;  5FO9 B;  3S16 B;  1S5C D;  4KV6 A;  5ISR A;  2K5D A;  2IL8 A;  3J7A V;  3UI2 A;  2Q8R E;  2LKV A;  2F0F A;  2SNS A;  3GO5 A;  1TWF B;  3I8Z A;  3NHH A;  1F9R A;  3R3O A;  4L63 B;  4O42 A;  2F0E A;  4H7B A;  2FHT A;  4CGY B;  1GUN A;  3DUZ A;  4DNR B;  4UDU C;  3SK5 A;  1LTI D;  2M9V A;  3MFY A;  2EYJ A;  5DAU A;  3Q0A A;  3VA7 A;  4RFB A;  3PV0 A;  2EY5 A;  1EY8 A;  2F0P A;  4DA2 A;  1LT3 D;  4OHJ A;  3HOW B;  1BOS A;  1HPC A;  2JXM B;  1E2W A;  1EY7 A;  4JBW A;  2HCI A;  4RA8 A;  5KGU A;  4K6L A;  3M7G A;  1A3U A;  2DN8 A;  1MI2 A;  1O7Y A;  1RTN A;  3D6C A;  5A35 A;  3VR4 A;  1FNV A;  2FFK B;  4RGO S;  3GP7 A;  5DM6 3;  1II3 A;  2CW0 C;  2K1B A;  1JOQ A;  3Q23 A;  2E75 C;  4DAP A;  3SDZ A;  1ZXT A;  2CW0 D;  1DCZ A;  2B8F A;  4DK1 A;  1BDO A;  1EY0 A;  2L4N A;  3J7Y W;  1WCM B;  1KTK A;  1V8Q A;  2A73 B;  1I4G A;  5CGK A;  3GTL B;  1I4H A;  5JPM C;  1HRJ A;  2ID0 A;  2R7Z B;  4FF4 A;  2E2J B;  1SBB B;  1BBX C;  1V43 A;  4KTA A;  2KVM A;  4ZRZ A;  4J6H A;  1TS2 A;  4IAL A;  4EQO A;  1D2B A;  1GUS A;  2F3V A;  4ZAI A;  3M7N A;  2F0D A;  3JAM E;  1JOR A;  1MGS A;  5D65 A;  3I90 A;  1LTT D;  2X6G A;  2AQ1 B;  1EYD A;  5NUC A;  4TRD A;  1UEA B;  4F7X A;  3P7J A;  4B9X A;  2J0T D;  2PCF B;  1B9M A;  4IFD J;  4R9W A;  5CV9 A;  4ZK9 B;  4XQQ A;  3P1H A;  4NDX A;  1EYA A;  1T5X D;  2D2C C;  3IKJ A;  4QCL A;  1SFO B;  1J9O A;  4G4K A;  1STG A;  1CTM A;  2XVS A;  5KYL A;  2E2H B;  2WP8 J;  5T1G A;  3S2H B;  4KI0 A;  4N9T A;  5EKL A;  1V1P A;  5EJW A;  1OXU A;  2NYZ D;  1D5Z C;  1I50 B;  3I72 A;  1JOK A;  4XDX A;  1FR3 A;  3MZ5 A;  2PZT A;  4HSP A;  3NTI A;  3RZO B;  3Q22 A;  4WOR A;  1F9P A;  1AW7 A;  3A7L A;  3NUC A;  2MJ8 A;  4KD4 A;  2VB3 X;  4JK1 C;  2SDF A;  1WTW A;  1K8M A;  2KCC A;  4I65 A;  3BZD B;  1XXG A;  1A3V A;  2L11 A;  3PIO 3;  1O78 A;  2R92 B;  3FRP B;  1IYV A;  1Y8P B;  1BXT A;  2K33 A;  1VDZ A;  3RUZ A;  3BVZ A;  3DHQ A;  3MVV A;  2I07 B;  1TWA B;  1EY4 A;  1LLR D;  4WJW A;  4M1U B;  3G7L A;  3HS0 C;  2TSS A;  2WKD A;  3FVQ A;  1Y8N B;  1FNU A;  3FPU B;  3T56 B;  4HSV A;  1FYC A;  1G2S A;  2O4X A;  4QMG A;  1SSO A;  1XX8 A;  4NKL A;  5CV4 A;  3H09 A;  3C2P A;  4L8J A;  4HR7 B;  1A2U A;  5LHY 1;  3I4M B;  5EKK A;  1H9K A;  1H9S A;  2B2V A;  1JWM D;  5C4J B;  1PLF A;  2NBF A;  1CM9 A;  1RD9 D;  4OO1 H;  1SYB A;  4FNF A;  5I9O A;  3SHL A;  3ERQ A;  1QG7 A;  3K6O A;  1MBY A;  5COR A;  5IGB A;  2RBM A;  2L1B A;  1BCP B;  1CHQ D;  5JVG 3;  1XWE A;  3GD7 A;  1ICW A;  1HXY D;  4I7Z C;  2C5C A;  3T53 B;  5C3X A;  3URY A;  3FEW X;  3K5L A;  4ULL A;  5I2X A;  5I2Y A;  2Q8I B;  2EYM A;  1ROD A;  3VYU A;  4RHS A;  1EU3 A;  1PYW D;  4IFD G;  5C4Z A;  1ENA A;  5DM7 3;  3QWN A;  1AFP A;  4HN7 A;  4A93 B;  2EDG A;  1ILP A;  4RGT A;  1TKW B;  1BNZ A;  1TQO A;  4CKB A;  3NTK A;  2F0L A;  3GTM B;  1NAP A;  2RKS A;  1BCP F;  1JB3 A;  3FPP A;  4DXG A;  5J1Z A;  4RHR A;  2YU9 B;  3BVM A;  4IUT A;  1GHJ A;  1SNO A;  5M9O A;  3L7Z C;  2RDF A;  3OMG A;  2OF1 A;  1HTL D;  3OSO A;  2NVY B;  1LTB D;  3WDN A;  2M00 A;  4QUC A;  2EXZ A;  4V0B A;  4FXK C;  3KK7 A;  1RKN A;  5EPJ A;  3K5O A;  5F2D A;  1B1Z A;  3I3C A;  1IKL A;  2WKC A;  3I73 A;  4XIG S;  1VF7 A;  1QB5 D;  3NE5 B;  3KLS X;  4TKO B;  3BG3 A;  2G9D A;  2DY8 A;  2NTT A;  1J8I A;  2A69 C;  2K5Q A;  1B44 D;  1X3Q A;  2N88 A;  3LWU A;  1BUV T;  2B39 A;  5C5M A;  4G7O C;  5LL6 S;  2KEE A;  2A69 D;  1G91 A;  1D1K A;  2K7V A;  2VXW A;  4A3F B;  3T13 A;  4A3E B;  1DZ1 A;  3H91 A;  2PZW A;  4ZLT F;  4PQX A;  2R3Z A;  3DWQ A;  1B3A A;  4DAY A;  4FVM A;  2K32 A;  1EWC A;  1PFN A;  2KHS A;  1JCK B;  3U9O A;  2K03 A;  3RMH A;  2EYF A;  1WTO A;  3I70 A;  4ZUI A;  3EVQ A;  1CT1 D;  1QNU A;  4F8M A;  4C3J B;  3K5M A;  3VR6 A;  3CQZ B;  4FF1 A;  1R4Q B;  5M5X B;  1T5E A;  4OIK A;  3V2T A;  5I6Y A;  5ELE A;  3HOX B;  1BR9 A;  1O80 A;  1O7Z A;  4R8I A;  2K5W A;  3Q6S A;  2NUC A;  5FK9 C;  1L0X B;  1FD7 D;  1DOM A;  4KHV A;  3OIQ A;  1M8A A;  4RCO A;  2Z4H A;  3NPP A;  3J7A F;  3X3M A;  2K04 A;  4CJ2 C;  1E2Z A;  5ELC A;  1SYF A;  3AMU A;  1IKM A;  5ELD A;  1F9Q A;  2DY7 A;  5JJZ A;  1SYC A;  4HCE A;  4RKL A;  5K5P A;  1ENC A;  2QIL A;  4RCN A;  4BA2 I;  2PW5 A;  4KKS A;  3M4O B;  4C1N I;  4IUV A;  5E4X A;  1STE A;  4Q5V A;  2Y0S B;  2GA4 B;  4U68 A;  3BS1 A;  2DNC A;  5I9P A;  1SE4 A;  3K0Y A;  1D5M C;  2WAQ B;  2KUM A;  2AUJ D;  3NWT A;  1DOK A;  1K8O A;  1WD1 A;  2EYL A;  1WTR A;  4TQU S;  3S14 B;  1EOT A;  5FO8 B;  3VR3 A;  3I4N B;  2JP1 A;  2A6H C;  5LL6 X;  4XT3 B;  4F88 A;  1HTP A;  2D5D A;  4RGM A;  2B2Y A;  1A6X A;  3D31 A;  4S3S A;  4G7H C;  4DF7 A;  1CI3 M;  2NN6 I;  2A6H D;  4K8I A;  1JE4 A;  3TDQ A;  1EY9 A;  2F0H A;  3SR1 A;  1TU2 B;  3G6J B;  3IL8 A;  4FXG C;  1JWU D;  2O2L D;  1GUG A;  3GQB A;  4DFA A;  4C3I B;  3TZU A;  2L12 A;  3WOF A;  1ZYR C;  2FMC A;  3A8K E;  1SEB D;  4ZUJ A;  1CZG A;  2F1M A;  4NW2 A;  3X3N A;  4HTH A;  1ZYR D;  1H9M A;  1Q1B A;  1Q1E A;  4IUR A;  3VR5 A;  2ZXR A;  1YNN C;  4EQP A;  1AN8 A;  3ZYY X;  3DWA A;  2F0N A;  5CR3 A;  1E0B A;  1YNN D;  3L9A X;  1HFG A;  4ZQ3 A;  3OIP A;  4BWG B;  1WTX A;  1HQM C;  2RSO A;  2HCC A;  5IOC A;  1TWC B;  1ET6 A;  1LTA D;  5CV7 A;  1GUW A;  5C0X H;  5IGC A;  4EQN A;  3FMC A;  4RAU C;  2PNR C;  3S9W A;  3R8B A;  1AZQ A;  2AWN A;  2F0O A;  1EWH A;  4K6D A;  1SJH D;  5EQ0 A;  2NN6 G;  3V05 A;  3PIP 3;  1PTO C;  4LAA A;  5EBC A;  5FKA C;  5KYI A;  4C3H G;  4PV1 C;  3HRZ C;  4XXE A;  1PTO D;  2KJX A;  1CQF A;  1B2T A;  4BA1 I;  2M2L A;  2Q8T A;  3CKI B;  1ONL A;  1R4P B;  1EEF D;  4H44 C;  5IT9 L;  3K5N A;  4XYO A;  4GZY C;  4QB4 A;  2TMP A;  3IFT A;  3SK6 A;  4KMU C;  2VUM B;  4Q0F A;  1EIH A;  1S5B D;  3J81 E;  2E2D C;  4ILW A;  1UNS A;  3Q24 A;  4PMW A;  1LV9 A;  2JYO A;  2J4X A;  4TSS A;  2WAC A;  4ZKB B;  1X32 A;  2EJG C;  1ZKO A;  1Q90 A;  1ENF A;  1U4P A;  2JE6 I;  2EY6 A;  4OL7 A;  1Z6H A;  3DM1 A;  1HA5 A;  2SNM A;  5G3L D;  4IZ8 A;  5FO7 B;  1SYG A;  4NMZ A;  3NBI A;  1SXT A;  1Q8I A;  2NB0 A;  1RDP D;  3AU7 A;  4C2M B;  1KAB A;  4FP5 D;  4C3H B;  4CHT B;  4ABN A;  4J1M A;  3K58 A;  5M5Y B;  2B2V C;  4CKE A;  2L9H A;  1TY0 A;  1B4O A;  1CA6 A;  4KJN A;  1CK1 A;  3TP8 A;  3EFX D;  3R2I A;  2B2W A;  1LT6 D;  1QWY A;  3MXG A;  2B2T C;  1D5X C;  2QEJ C;  5DNF A;  1EU4 A;  4EGV A;  3PUY A;  4BY1 B;  1PMR A;  3R2T A;  3PMF A;  3QIA A;  1STN A;  1NR2 A;  3V96 A;  2XWB B;  1QOH A;  5CC4 A;  2PO4 A;  1QCB D;  3T51 B;  1LTS D;  2EPB A;  3EJI A;  4KN7 C;  2SOB A;  5A2Q L;  1H9R A;  1DYQ A;  5CV5 A;  3CU7 A;  2IX3 A;  1PRT B;  2V4D A;  1U4M A;  2KQ3 A;  2OT2 A;  2CQA A;  2B2U A;  4MN3 A;  2O5I C;  1B53 A;  5KEE A;  2JA7 B;  4WFN 3;  2FIN B;  2EY1 A;  4FO2 A;  1B50 A;  1RF2 D;  1PZK D;  2WII B;  3HOU B;  4A3D B;  5FLX L;  1G29 1;  3D4R A;  1W6K A;  3MC0 B;  4OGQ C;  2BOS A;  3BYY B;  2SEB D;  2CHB D;  2EYP A;  3PUW A;  1STY A;  3A8I E;  4BBS B;  3WOE A;  1C48 A;  2A6E C;  2HDL A;  1WTV A;  1MSH A;  4DNT B;  4V19 0;  1EL0 A;  3C1F A;  2F0W A;  1NSN S;  3S1Q B;  3DEO A;  2QDB A;  1GXD C;  4IUQ A;  1F2M A;  5KND A;  2A6E D;  1OXV A;  4QF4 A;  4C1N K;  1DOL A;  2WV6 D;  4PMC A;  1EY5 A;  1KAA A;  1WVL A;  4X3K A;  3HOZ B;  5KNC A;  5ELF A;  5J22 A;  4MHE A;  2XWJ B;  2F03 A;  3DEP A;  5IIF A;  4K8J A;  4KKT A;  2EVB A;  3GTG B;  3SK4 A;  3LNN A;  2Z4I A;  1I4P A;  1LTG D;  3OWE B;  3TBI B;  3C3L A;  4C3J G;  2F0T A;  2E76 C;  1IW7 C;  5EKI A;  3RD4 A;  4FF3 A;  4Z9C B;  2QKI C;  3LWE A;  5D3D A;  5I4D A;  3P20 A;  1IW7 D;  5TSS A;  2MP1 A;  2XSC A;  1KNA A;  1TR5 A;  1XYI A;  2K01 A;  2LFN A;  1PTO B;  5KRU A;  2XRQ D;  4C56 C;  2Z1C A;  5JOB A;  1M4V A;  2F0G A;  1LT5 D;  5IGE A;  1EEI D;  4K5V A;  4B9W A;  3D4D A;  1SNM A;  1NUC A;  1V1P B;  4ZYS A;  4CKC A;  3HP3 A;  3TSS A;  1EIG A;  1RJT A;  1EQT A;  4ZKC B;  1G8Z D;  4ME5 A;  4X3T A;  2F0V A;  3A54 A;  3ERO A;  3ND8 A;  2L55 A;  3N6R A;  1OXS C;  3QG1 A;  3GTQ B;  1EYC A;  5AFW A;  2I46 A;  3S1N B;  2LY7 A;  1Z7T A;  3L3O C;  3IFD A;  3KF8 A;  2EY2 A;  3IAY A;  2YYZ A;  3JAM L;  2PZU A;  3TP5 A;  5M5W B;  3QB3 A;  4IFD H;  4K5X A;  2PPB C;  1B9N A;  1PTO F;  2D62 A;  1ML0 D;  1TY2 A;  3ND9 A;  3KBX A;  5C6A A;  2K05 A;  2WB1 B;  4K2K A;  4G57 A;  3PUZ A;  1JOO A;  3I91 A;  1V1O A;  3MXP A;  3S15 B;  1DON A;  2K28 A;  4H13 C;  1HFN A;  5BN3 A;  1KDB A;  2RSN A;  1F77 A;  4KY6 A;  2NVX B;  3MAQ A;  1JC7 A;  3PO3 B;  5EBD A;  3NTH A;  3O13 A;  5HGT A;  1A3T A;  1U9R A;  3J80 E;  2RA4 A;  4C3I G;  2IX0 A;  1O7L A;  1EZ6 A;  2L5T A;  2WIN B;  5IGD A;  4HMJ A;  1PFM A;  2JA8 B;  1PRT C;  3OPO A;  2K6A A;  1AEX A;  4MIU A;  4CJ1 B;  4DXF A;  4FF2 A;  3W2D A;  2B63 B;  3SXH A;  5FOB B;  3GTK B;  1PRT D;  1D6E C;  2J7Z A;  1BQQ T;  3RLF A;  1KNE A;  1BF4 A;  1SNP A;  4DN4 M;  5E1F A;  1EFI D;  3A8J E;  4X3U A;  2HUG A;  4BS9 A;  1STH A;  3GV6 A;  3A7A B;  3H3V C;  4FXD A;  2F4I A;  4A3M B;  5JEA J;  4QIW B;  1I4X A;  1D1I A;  3MTS A;  3PUV A;  3HOY B;  2EJF C;  4N9P A;  3OMC A;  3H0G B;  4ODG A;  1QNK A;  2IJ0 A;  3K57 A;  1CZW A;  2X6L A;  4IUP A;  1VCI A;  3T16 A;  1C4Q A;  4OO1 I;  4B08 A;  3SEB A;  3RZD B;  2BE5 C;  5M3M B;  2F0J A;  2A5H A;  2RDH A;  3NXW A;  2FMM A;  1ET9 A;  4YIJ A;  1I6V C;  1GOZ A;  4G7Z C;  3NQT A;  2BE5 D;  1HHV A;  4WRD A;  3DWP A;  2QCP X;  4R8N A;  2R61 A;  5DEH A;  2HDM A;  1H9J A;  3KLR A;  1RHP A;  4X3S A;  1HUN A;  5CV8 A;  2RQX A;  5C44 B;  1E2V A;  1NR4 A;  1TT2 A;  4CBV A;  2LMC B;  4BBR B;  4KJO A;  4XQJ A;  4DU9 A;  2KOL A;  2CVR A;  2F0M A;  5COY A;  4KN4 C;  1Y1V B;  5IOD A;  3D4W A;  1STA A;  1LTR D;  4Y7N B;  3H6M A;  1SAP A;  1SDF A;  1TS3 A;  4XYQ A;  5I6W A;  5K36 G;  2BA1 A;  2NWG A;  3GTP B;  4HCS A;  2MHV A;  3K7A B;  2OEO A;  3BVG A;  3NSW A;  1IYU A;  1PDQ A;  1PZJ D;  3MEH A;  4E6I A;  3VYR A;  4DAV A;  4L6T B;  5C4X B;  4DGZ A;  3E6Z X;  2X69 A;  3I4L A;  2ICE C;  1PXU A;  2OXP A;  3SE0 A;  1JR0 D;  4OO1 G;  2MPM A;  3TZD A;  1JQY D;  3C1E A;  3EA6 A;  3W3A A;  2VB2 X;  4HMI A;  2KCN A;  4A3B B;  2IWH A;  5J39 A;  4KY5 A;  1QIL A;  2XN9 C;  1EQV A;  1RTO A;  2PYK A;  4P2C B;  2HQE A;  2NTS A;  4RH6 A;  1GUO A;  5C5L A;  1W6J A;  3BDC A;  1JIC A;  2G9H D;  2BCO A;  5BN5 A;  3S1M B;  2JSO A;  2IPK D;  4HED A;  4O1N A;  1SYD A;  4ID6 A;  4KD3 A;  4FYD A;  5JEA G;  1DXM A;  1CHP D;  3KBG A;  3S2D B;  1NCV A;  3DMU A;  4LK1 C;  2B2W C;  2XNA C;  2EZV A;  1WTP A;  3QO2 A;  3PO2 B;  3MA2 B;  3LX0 A;  4J8Q A;  3OWF A;  3OW7 A;  1U4L A;  3NWS A;  4NP5 A;  1Y1W B;  2E74 C;  3DXJ C;  1LAC A;  3FKI B;  4AYB B;  1KDA A;  3A55 A;  4K5W A;  5BN4 A;  3HG9 A;  4K2L A;  1SE2 A;  2R93 B;  2B2U C;  4IFD I;  2LS0 1;  1DJR D;  1OXX K;  3HKZ B;  1DM0 B;  5HUR A;  1OXT A;  1HA6 A;  2ZXP A;  1LAB A;  1DD2 A;  1FNW A;  3MXU A;  5T1I A;  3MWY W;  1LO5 D;  4LJZ C;  1WTQ A;  1QE6 A;  5K36 H;  3GV3 A;  3TME A;  1F2L A;  3U9S A;  2MUY A;  3CRL C;  1KLG D;  3FDT A;  2BDO A;  4A3G B;  2NN6 H;  4EVO A;  1Q3L A;  1F9S A;  2ZXO A;  3R93 A;  3BYT B;  1I4Q A;  2EYH A;  4KKU A;  5C3W A;  2EE1 A;  1TS5 A;  2ENB A;  1TS4 A;  1VMC A;  5E4W C;  2VNU D;  4LMQ D;  1ESR A;  3J80 L;  4KK7 A;  2EYO A;  5EPK A;  5C4H A;  2FJ2 A;  2ZT9 C;  3TP7 A;  5EGT A;  4PMB A;  2B2T A;  2AWO A;  3GTJ B;  4CJ0 B;  4IUU A;  3D8G A;  1XTC D;  3MHB A;  2O5J C;  4UAI A;  2A74 C;  1IHZ A;  2RVL A;  3BDL A;  1RCV D;  3HOV B;  2NVQ B;  4PNY A;  3CRK C;  1ILQ A;  4A3K B;  2XIW A;  3ITP A;  4RGN A;  1S4Z A;  1UAP A;  2L0C A;  1PZI D;  3M3Y B;  2PQE A;  1OO9 B;  3M85 A;  1HCZ A;  1PRT F;  2DNE A;  5KNB A;  3ONA B;  1HUM A;  3S1R B;  2AQ2 B;  3P75 A;  4QUF A;  5JEA H;  4F87 A;  2R6G A;  5D3I B;  5C3E B;  5IGF A;  1KLU D;  1ZEQ X;  5ELB A;  4IUN A;  1S5F D;  3F2U A;  5C0X J;  4IQZ A;  2EOT A;  1X3P A;  2N55 A;  1Z47 A;  4U67 3;  3TP6 A;  1YNJ C;  3M4Y A;  3SK8 A;  1MSG A;  4A3J B;  1F2Z A;  4KHZ A;  2B8G A;  1SNQ A;  1U4R A;  1PFB A;  1YNJ D;  3GTO B;  2EJM A;  5EPL A;  1L0Y B;  1GJX A;  4RWS C;  1I6H B;  1SJE D;  3S17 B;  1CFM A;  2H4O A;  5IT9 E;  2JEA I;  1A2T A;  5CV6 A;  1TWG B;  2BDN A;  2F0Q A;  1CQV A;  2PW7 A;  5CBE E;  3VYS A;  2JEB I;  3VR2 A;  2IW3 A;  1G2T A;  3E0J A;  2QF7 A;  2IX1 A;  2AUK A;  2Z8L A;  1AZP A;  3TN2 A;  2F0K A;  1TVX A;  4XT1 B;  4DK0 A;  3K59 A;  1GHK A;  1LT4 D;  3E5S A;  2AQ3 B;  3BDO A;  3HGB A;  3KUP A;  1Y8O B;  2NVT B;  4OIJ A;  1Q12 A;  1G6Z A;  2KA7 A;  1KDC A;  5C0X I;  3KLS A;  4A3I B;  3D3R A;  3VA5 A;  1WD0 A;  1F2Y A;  2E2I B;  1GUT A;  3HEJ A;  1SNC A;  3T4A C;  1SE3 A;  5JAV A;  2JA5 B;  2JA6 B;  3NP8 A;  4XTC S;  3QJY A;  2F0U A;  1ESF A;  1EY6 A;  3A56 A;  1C8C A;  4K14 A;  2BA0 A;  1HQR D;  1MD2 D;  3QOJ A;  1IL8 A;  3PUX A;  2RDG A;  3NK9 A;  1FGB D;  4KY7 A;  4IN3 A;  5CYU A;  2KED A;  2IT1 A;  2A68 C;  1R9T B;  1VMP A;  3AB9 A;  1UUP A;  1I4R A;  2KEC A;  2A68 D;  1VF5 C;  1TWH B;  1SYE A;  4M8A A;  3NQI A;  2PMZ B;  4BY7 B;  5JPN C;  3OHX C;  2MGS A;  5E3F A;  5CMD A;  4HAE A;  1PTO H;  3NBH A;  5IGG A;  3J81 L;  5A2Q E;  5M3F B;  1Y69 U;  3N52 A;  1A15 A;  4RKB A;  3MXN A;  2C9O A;  3CHB D;  2XRS D;  1H9S B;  1BO0 A;  1K83 B;  5C0X G;  2B2Y C;  1I3Q B;  1EZ8 A;  3VYT A;  1AP0 A;  1SND A;  1QJO A;  5FLX E;  5JVH 3;  2F0I A;  1SMY C;  3SVM A;  5G3L F;  5CBA E;  3QOL A;  3D6W A;  1TII D;  3HZX A;  1SMY D;  1S5D D;  1STB A;  2NZ1 D;  2ICI A;  2D9U A;  2H1E A;  4H0L C;  1JWS D;  1BCP C;  5KIX A;  1S5E D;  3EQL C;  2F0S A;  3C46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...