2EY5A

Crystal structure of staphylococcal nuclease mutant t41s
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDSPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey5A00
4I65A 3LX0A 1ENCA 4K5WA 4K6DA 3TP8A 5HURA 2EXZA 2F0UA 1SYEA 5CV8A 1II3A 1STHA 5E3FA 1AEXA 2F0TA 2SNMA 5IIFA 1SNCA 4S3SA 3T16A 1A2TA 2M00A 4KY7A 2F0PA 4MIUA 5DEHA 4DF7A 1EY0A 1STAA 1KDAA 3QOJA 3SR1A 5J39A 3HZXA 5KYIA 3NUCA 5I9PA 2EYHA 4NP5A 4ZUIA 1ENAA 4KV6A 3BDLA 4DU9A 2F0FA 1STYA 3DHQA 2RKSA 2F0GA 3RUZA 4B9WA 3MHBA 2EY5A 5I6YA 2KQ3A 5F2DA 3TMEA 2EYPA 3SK4A 5C3WA 2EY6A 3DMUA 5IODA 1STBA 2F0IA 2SOBA 3D4DA 5CV7A 5IGFA 4K2KA 1SYCA 5CR3A 4HMIA 2EYMA 1EZ6A 3VA5A 4PMBA 1JOKA 5J1ZA 4NMZA 5HGTA 4IUNA 2F3VA 5JOBA 5C5MA 1EY4A 1A3VA 1EYDA 1NUCA 3NP8A 5C3XA 1KDCA 1JORA 3NK9A 4EQPA 5CV5A 2F0DA 2F0EA 2RDFA 3P75A 4KHVA 3NXWA 3V2TA 2O4XA 2F3WA 4N9TA 1JOOA 1KABA 2EYFA 2PQEA 5CV4A 1EY8A 2ENBA 5KGUA 1IHZA 4KY5A 2PZUA 4ME5A 1A3TA 4PMCA 5E1FA 1SNQA 3OMGA 2RBMA 4NKLA 4YIJA 5J22A 2PZTA 4IZ8A 4KD4A 1SNDA 2F0VA 2F0SA 5EKLA 4HTHA 5JAVA 5IGEA 2F0LA 1EZ8A 4G57A 3EJIA 3OSOA 4K8JA 1STGA 3BDCA 4K2LA 4KY6A 4B9XA 4DFAA 1EY9A 2F0QA 2PYKA 3EROA 3QB3A 1EYCA 4E6IA 4F8MA 1F2MA 4IALA 3R3OA 3C1FA 4QB4A 2F0MA 1SNMA 1SYBA 1EY6A 1A3UA 2OF1A 3MXPA 4R8NA 1KAAA 2LKVA 3HEJA 2NUCA 2HQEA 3MVVA 4J6HA 5C5LA 5CC4A 5CV9A 4WRDA 3SHLA 1U9RA 4K14A 2PZWA 4QF4A 1TR5A 1TT2A 2QDBA 5CV6A 1NSNS 2SNSA 4ZUJA 2F0NA 3SK8A 3U9OA 2F0OA 1SNOA 4K5VA 5IGGA 5IGBA 1TQOA 2F0HA 4ID6A 2PW5A 5CGKA 3SXHA 5I9OA 4H7BA 1EY7A 3ITPA 4ODGA 5KYLA 4RKBA 3TP6A 5C4HA 2EY1A 3MEHA 3D8GA 1STNA 4EVOA 5I6WA 5K5PA 4RKLA 4OL7A 5KEEA 3S9WA 1JOQA 3MZ5A 3QOLA 3SK5A 3T13A 5KRUA 1EY5A 5M9OA 1F2ZA 4DGZA 2OXPA 2F0WA 3ERQA 5DAUA 2OEOA 1A2UA 3TP5A 5C4ZA 4N9PA 3TP7A 4K8IA 5IGCA 4ZQ3A 3C1EA 1EYAA 1KDBA 3EVQA 4KJNA 4TRDA 3OWFA 5ISRA 1SYFA 3D6CA 4EQOA 4F7XA 5KIXA 3NHHA 4NDXA 4KD3A 4PNYA 2PW7A 4J1MA 5IOCA 4EQNA 2WACA 3SK6A 5IGDA 4HMJA 4QMGA 2KHSA 3PMFA 2EYLA 2F0KA 1SYGA 3H6MA 4KTAA 1SNPA 5EKKA 5NUCA 1EQVA 3P1HA 5C6AA 2EYJA 3NQTA 1F2YA 3OMCA 4KJOA 2EY2A 4WORA 1RKNA 4LAAA 2F0JA 3E5SA 4K5XA 5EGTA 1SYDA 3D4WA 2EYOA
chains in the Genus database with same CATH superfamily
1UEAB 2A6EC 2QEXA 1MSGA 1ESRA 4LUOA 3T4AC 3I72A 4BY1G 2O5IC 1MHWC 2GA4B 3KLSX 4HR7B 1IL8A 4QUFA 5C4JB 3OHXC 1Y1WH 1Q81C 5FLXE 3D4RA 4JI3Q 2EVBA 5I9PA 4C1NI 5FLMG 5HGQA 1EFWA 4YWMA 3KBXA 1BCPC 1I50H 5C0XI 4MTKA 3MEFA 4K0KL 2AMCB 1YNJC 1ONLA 3GTMH 4DV4L 1RTNA 1QZHA 3A7LA 5M3MG 2K32A 2LY7A 1Y1WB 1EY8A 2ENBA 3BZKA 3VYSA 2Z4IA 1P16A 1VQNA 5EBDA 1LT5D 2F0VA 1WTXA 3H0GH 4ZLTF 2G9HD 1G8ZD 3HG9A 1N33Q 1EQTA 1I4PA 1I50B 3NEMA 2QW7A 1FNWA 3GTMB 1NR4A 1ZKOA 2IHEA 1NTGA 4CBVA 4QQBX 4IUQA 1X65A 5CV6A 1LTSD 1PYSB 3NTKA 1E2WA 3H0GB 2B2TC 3NPPA 3MAQA 4XIGS 1WJJA 3R2IA 4JG2A 4DAYB 1SMXA 1LT4D 1HNZQ 2OXPA 4IOAA 3TSSA 3LGJA 3NTHA 4YWKA 3GTJH 4ZQ3A 1YEZA 2HT1A 4TRDA 3OWFA 1S5DD 3M4PA 1DONA 4A3BH 4R1JA 1HR0L 4DV5L 2UUAQ 3FPUB 3RNUA 4LF8L 4X62L 2MP1A 4NXML 1QVFA 4RWSC 3RZOH 3P1HA 1CSPA 1T5EA 1TWHB 3K58A 3DEOA 2E2HH 4IUTA 2B29A 1M4VA 2MJ8A 1N34Q 4DR5Q 4AQYQ 4DR3L 4R4CA 1YIJA 1SLJA 1TXYA 2SNMA 3X3NA 4UAIA 3CCLA 3GTJB 4IUVA 1UE5A 2XIWA 1E24A 1C0AA 3C3LA 1Q90A 3I8ZA 1BBWA 3NENA 4A4IA 5KYIA 4DV1L 4A3BB 2QCPX 1YHBA 3KUPA 5FJ8G 1RODA 1STYA 2VQFL 1JB7A 1YHAA 3RZOB 1UNSA 5C3EH 4KHZA 1GUGA 1GVPA 2E2HB 1KLGD 4TKOB 1B44D 5J1ZA 5JOBA 4X3TA 2PNRC 2BDOA 1PTOC 5CV5A 4A3MG 4LMQD 2M2LA 2RCNA 2F52A 1I6VC 2AWOA 4G7ZC 4YCVA 5ELEA 2ALYB 2K04A 2WAQE 3BZCA 1SNQA 1TWAH 3I55A 2BE5D 4MTNA 4JV5L 2KVMA 4LF7L 4B9XA 3K7UC 4K8JA 4DFAA 1VQAA 5C3EB 3JAML 3EROA 5AJ3L 1VQFA 2NN6I 3PIOA 1YITA 1SMYC 3SE0A 3KDFB 4JI5Q 1VQGA 1J9OA 1K73C 4DV2L 4R9WA 1U9RA 4QF4A 1TR5A 5KNCA 1CUKA 4DUYQ 3PO2G 1TWAB 2NZOA 1B2TA 1OXUA 5KYLA 2UU9L 2K75A 3GDEA 1AE3A 5M5YH 3FKIH 4GKKQ 5M9OA 4P72A 1QWYA 1WTOA 4GN4B 3TP7A 4K8IA 1EIGA 1QOHA 2ASBA 4A93G 1V43A 3U4ZA 4B3TL 2IW3A 3HKSA 1D6EC 3AMUA 3W1BA 3PO3H 3T1YL 2K52A 4OIKA 1HZ9A 2D9UA 1LTTD 5EAYA 1EIHA 1EQRA 1XMQQ 3R8BA 5H1SE 3TDQA 3Q22A 5NUCA 3A74A 4X3KA 1PFSA 4KJOA 2A6ED 1HTPA 1B3QA 2EYOA 2L11A 5M5XH 5ELBA 3GTGH 5M5YB 3FKIB 2CWAA 1O7ZA 1G51A 3J7AF 4A3IH 1O7YA 2QILA 4DF7A 4JBMA 3SR1A 3DWQA 3KF8A 3PO3B 1VCIA 5FK9C 2EZVA 1EWHA 1ESFA 1BUVT 1E22A 4KV6A 5FLXc 4DU9A 1I4XA 2RVLA 1K8GA 2B8FA 3C2PA 4QJFA 1B9MA 2KQ3A 1PH3A 2EYPA 1WOCA 2QGQA 1WTWA 2ZJPA 3KF8B 4JI1Q 3VYUA 4L8JA 1XMOQ 2MHVA 3HFZB 5C0XG 1U0LA 5M5XB 1N32L 1YNJD 3GTGB 4NMZA 1AZPA 4M1UB 2E5LQ 2QKIC 2MFIA 5IWAQ 4A3CH 4X3SA 5IP7H 4ZAIA 3P75A 3Q23A 4A3IB 2QF7A 3SDZA 1NCVA 1KNEA 3MXNB 3HKZG 1PLFA 4KY5A 4DR2L 1R4QB 4L5QA 2K7VA 1XNQQ 5CMDA 4LFCQ 3HKZE 2VY3A 1NY4A 1K3RA 4LWCA 1ET9A 3CC2A 2F0LA 1FR3A 2HHHL 1CA6A 4KY6A 5JEAH 1ILPA 2A19A 2EJMA 3HOVG 3R3OA 3M85A 2F03A 2OF1A 3Q24A 2NUCA 1HQMC 5ELDA 4LF5Q 3S1QH 1FYCA 1Y1WG 2CQAA 1JCKB 4CJ2C 2QDBA 1B3AA 1HQRD 2PNHA 1VQ7A 1JMCA 3GD7A 4RGNA 3SXHA 5JJIA 1B50A 2JJQA 3P7JA 1JJ2A 1IL2A 2PI2A 4UHVA 4RKBA 3TP6A 1CHPD 1NBWA 2Z6KA 4X66Q 2KCNA 3BVZA 2C35B 1VDZA 2Z9HA 5DAUA 3PF5A 1HNXL 4J8QA 3C1EA 4KJNA 3S1QB 5ISRA 4PNYA 4A3DH 1S3OA 3J81L 3ICEA 2EYLA 2F0KA 2H1EA 4IQZA 1KLUD 1PZJD 4MHEA 2UXCL 4L5RC 2K5DA 1RJTA 1D5XC 1CKOA 3I4NG 1X54A 1C8CA 4FXKC 2JP1A 4GS3A 1RD9D 5E3FA 4LJZC 3T16A 3VDYA 1CTMA 1KDAA 4GLAC 4A3DB 1A15A 2Y0SE 3BDOA 1CA5A 1PVOA 1K8AC 3GTPH 4L5SA 2F0FA 4Z9CB 4L6TB 1I4QA 4P71A 4PV1C 3AQQA 1JQYD 5IGFA 3K80C 4MNOA 4K2KA 4NB3A 1G2SA 5BR8Q 3JAME 4CDEC 1L2FA 2AQ3B 1PTOD 1S5FD 1EY4A 3OTOQ 3PUWA 1VQ9A 1FGUA 4DV6Q 4H13C 2F3WA 3TQYA 3L7ZC 5D3IB 4A3BG 2XRQD 4JI6Q 3S16H 1OTCA 2WB1G 3GTPB 2GVAA 5JJZA 5LL6S 4DAPA 1Q12A 4HJ5A 2WB1E 2CKZB 1HHVA 1O78A 2IWHA 1XNRL 2PYKA 1YJNA 2NN6G 4LF6L 4HEDA 4CHTB 1PTOF 3MXPA 3NBHB 1KAAA 3RLNA 4A3FH 1X3GA 4QGUA 4NXNL 4JI8Q 1NSNS 1CHQD 3A56A 3VR5A 2J4XA 4L5TA 3S16B 2KENA 2LSSA 4TVAB 2DN8A 2VXWA 1VMCA 1EY7A 2B8GA 2YTXA 1PH1A 1PH5A 5C3EG 3U58A 4BBRH 4GN5A 2WIIB 3ND9A 4Y52H 2B2YC 5ELCA 1BKBA 5K36G 1EWCA 2CH4W 4A3FB 3BG3A 4HSVA 4LUZA 1S40A 3E6ZX 4GKJQ 1KXLA 1SRUA 1VQKA 1VQJA 2MPMA 1Z47A 4C3JH 1LTID 3SVMA 4O1NA 4EQNA 1SNPA 5EKKA 2MNAA 4IURA 2JA5H 2HQLA 2VUMH 2DY8A 4WORA 1D7QA 2L12A 4BBRB 2IL8A 2HQEA 4PZ8A 4HIOA 2J0TD 2AUJD 3LX0A 2K50A 1II3A 1MJEA 2KA7A 1VQDA 1K3BC 1EY0A 1XX8A 1V1QA 3H09A 2E2DC 3NUCA 1GUWA 3RR5A 3E9IA 4C3JB 2DNCA 2K5HA 5JPNC 1ENAA 2JEBI 3CKIB 3IFDA 1J6QA 3UDXA 4DUZL 3DHQA 1VF5C 5D14A 1CKNB 1KIXA 2VUMB 2JA5B 3SK4A 3A0JA 2CWPA 2JYOA 1SSOA 2B2WA 4JI5L 3GO5A 3FKIG 1Q82C 2F3VA 1GUNA 4UDUC 1KL9A 4GLVB 5JVG3 1IBLL 1CQVA 5AFWA 2AUKA 4UPAA 3VYTA 1FGBD 2MO0A 3PO3G 4M8AA 3H3VH 1F9SA 2CQOA 1O80A 4NKLA 1VQEA 3E9HA 4UP8A 4XYQA 4BS9A 1BBUA 1EZ8A 4R4OA 1STGA 1MD2D 2Q2IA 4R4TA 1C48A 1SYBA 3QJYA 4MZ9A 3K8AA 2E75C 2CFMA 4OELB 4BA1I 3T1HQ 4A3IG 5GAEC 4V190 3HOZH 2OTJA 3FEWX 3DLLA 4JK1C 2D5DA 2DUDA 1NMGA 3J81E 2K05A 2F4VL 5IYBH 1C9OA 1L1OA 2UXDL 3ITPA 2Z6KC 2CW0C 1PH2A 3CCQA 3HOXH 4RH6A 4AYBG 3J80L 4RKLA 5EPLA 3AYHB 3IKJA 4P75A 1C4QA 2XTIA 5KRUA 3K5LA 5LMUL 3OW2A 2UXBQ 1JE5A 2RSOA 4AYBE 1L1OB 4N9PA 3M9BA 1A6XA 5IP7G 1O7LA 5IYDH 3HOZB 1Q46A 1FVIA 3NELA 4XT3B 1IBKL 1AZQA 3A8IE 1SAPA 3SK6A 1WCMG 3KJPA 2KECA 4H02A 5I2YA 1Y14B 1AP0A 5C6AA 2EYJA 5JEAG 4LAAA 2L1BA 3STBC 3TP8A 2EXZA 3EQLC 3I73A 3CP0A 4UY8C 5BN4A 2M00A 1JR0D 2OTLA 3A5UA 1K83H 3NSWA 1S5ED 5FO8B 1VQIA 3G7LA 2MO1A 4ZUIA 1KRSA 4IOCA 3H94A 4X64Q 3J7AV 1MKHA 3RUZA 2F0GA 1O7IA 1Y8PB 2KCTA 5ELFA 2D0PA 3K7AH 4DNTB 5IE8A 1UE7A 4LNQA 4OX9L 2K01A 4LF5L 1JOKA 3MTSA 1S5CD 1A3VA 1QNUA 4EQPA 1BO0A 3JAMc 4JYAL 1K83B 4YHHL 1HZBA 5I4DA 2XGTA 2E2JH 3M4OH 4PMCA 1CZWA 5IYCH 1U4LA 1H9KA 5E7NA 1SNDA 4P74A 1MIUA 2G5DA 2WINB 4G57A 3EJIA 3K7AB 1VQ4A 4KHPL 1QUQA 1EY9A 3F2UA 3MWYW 4F8MA 1EYCA 4DR4L 3BU2A 4RHSA 3OOCA 5C5LA 1PFNA 1XXGA 2K6AA 2R7DA 1VQ6A 3GTKH 3OIQA 1IBML 4K14A 1QG7A 3CPFA 4X65L 1F77A 2E2JB 3M4OB 3CHBD 5M3FH 4CGYB 1GKHA 1RL2A 2Z4HA 1H95A 3I7FA 3NQIA 4JI4L 4WFN3 3S15H 5K5PA 3S2HH 4HJ7A 2XNAC 1N36L 5GQOA 5JJKA 3F2CA 3CC4A 1J5EL 4HJ8A 1GUSA 2M9VA 1PYBA 4XYOA 2OEOA 5C4ZA 1SJHD 4OWXB 1X9NA 1Q1EA 1EYAA 3GTKB 4HAEA 3CCRA 5DM73 2ZTEA 1PFBA 4CDCC 1SJED 5A35A 3E0JA 2MUYA 4RAUC 2KHSA 5M3FB 3H6MA 4KTAA 5COYA 1EQVA 4OEMB 1SE2A 1EYGA 4IPCA 1TWHH 3WWVA 2F1MA 1L0XB 4IJHA 1QJOA 1HA5A 3S15B 2RQXA 3S2HB 3K59A 1ENCA 1BQQT 1ASYA 4A3FG 3URYA 1HUNA 4JI0L 5IIFA 1DCZA 5I2XA 1LACA 1TU2B 3HOWG 1B9NA 1BVSA 4JI7L 3HOYH 3BS1A 1PFMA 2EQSA 2B39A 4NP5A 3K5MA 1Y8NB 2ZTDA 1WTPA 3KOJA 1I94L 2B2WC 1D5MC 2Q8TA 4DV3L 2F0IA 2EPBA 4BBRG 1VQ5A 3AFPA 4PMBA 4H44C 4IUNA 3CF5A 1GM5A 4N8X1 1KDCA 4LFAQ 4N8FA 5TSSA 2VW9A 4JI2L 4LF4Q 1HUMA 2JA8H 4N9TA 2PQEA 2NVTH 2A1AA 2A68D 3X3MA 2YU9H 1WYDA 2RCFA 4LK1C 4EQ5A 4B3ML 4C3JG 3HOYB 3DEPA 4ME5A 1E2VA 1KQSA 2K5VA 1JWSD 1KC8C 3I90A 4IZ8A 1F9RA 3S1RH 3A8KE 5EKLA 4DR7Q 4HTHA 3FVQA 2JA5G 1QNKA 2VB2X 1DJRD 4FNFA 3H3VC 3BDCA 4E6IA 1QCBD 2HCIA 1F2MA 1ML0D 1BBXC 2CVRA 3J80E 4KLKA 4QCLA 5E4XA 2IX3A 2JA8B 4XQNA 4DKAC 2NVTB 2YU9B 4C2MH 4BWGB 2XRSD 1L1OC 1V8QA 4BY7H 3KLSA 5C44G 4A3LG 5IGBA 1TQOA 1Y1VG 5FO9B 2CW0D 2NZHA 3S1RB 5CORA 5C0XJ 3J81c 2ZM6L 3ND8A 4LFBQ 4OL7A 2H5XA 1F2ZA 4OONA 2WP8J 4EX5A 2ICEC 1CT1D 2Q8RE 3UI2A 1VQOA 2DNEA 3FP9A 1KDBA 1E1OA 2BA1A 2R6GA 2AHOB 4C2MB 4CJ1B 1KNAA 4BY7B 1EEFD 1IKMA 1KHIA 1LYLA 4PZ6A 1HTLD 3M4QA 4F88A 3PUYA 3NTIA 1M8AA 4G4KA 5BN3A 1PYWD 1F2YA 3STBD 1GO3E 2F0JA 4X3UA 1Q1BA 2BH8A 1AFPA 2VL6A 5C4XH 4KKUA 4B3RQ 2F0UA 3H91A 4FO2A 1F9PA 1SNCA 3HOZG 1VQMA 3BVMA 1LTBD 2B2VA 1K28A 2PMZB 2EOTA 1DD2A 3PIP3 1FNUA 1FJGL 2RF4A 3B6YA 3PUZA 1JICA 2EY5A 1HNWL 1BOSA 4POFA 5IODA 3HOXG 4UP9A 5JPMC 4OO1H 1KTKA 3M4YA 4PQXA 5C4XB 2VQEL 2NB0A 1K0RA 4DR6L 1SE4A 5C3XA 4C3HH 2R92G 2JA6H 3CC7A 3V2TA 5IYDG 4JW0A 2O4XA 3K81C 3HOUH 4QIWE 2R61A 1DOMA 1QE6A 1A3TA 2O2LD 2PO4A 4KD4A 4C3IH 3KFUA 4DV0L 4BXXH 5G3LF 3W5OA 2K14A 3F2BA 1VQCA 2B2UA 1CKMA 1STEA 2UUBQ 4YY3Q 3C1FA 4QB4A 2I5MX 3TZDA 1MJCA 2XN9C 4A3EH 2UUCL 4FDBA 3Q8DA 4C3HB 2JA6B 1QZGA 2VNUD 5D65A 4ZKBB 3HOUB 2A74C 2A69C 3SEBA 3BYYB 1ENFA 3KF6A 2DJGC 3TZUA 3L3OC 1B7YB 5I9OA 4C3IB 2KOLA 4X6AH 4RGOS 4CKBA 4EVOA 1KRTA 1TY0A 4OO1I 1SEBD 3S9WA 1PH7A 4HCSA 3WOFA 1PV4A 1EY5A 3KF6B 3OIPA 4J15A 4DGZA 4DR1L 3ERQA 4A3EB 5KNBA 3J7ZC 1D5ZC 5LMNQ 4IUUA 4LF9L 4DAMA 1KAWA 2JQOA 3E3XA 5IYCG 3CW2C 4HJ9A 5FO7B 4DV7L 1BNZA 3PUXA 4C56C 5IY0A 3KK7A 4ZYSA 2HDMA 4Q5VA 1A0IA 2TMPA 4JI3L 2BDNA 1AEXA 4RHRA 3OPOA 1XPRA 4A3JH 4ZCKA 1VF7A 3CAMA 1C7YA 1WTHA 2PCFB 3R2TA 5M3FG 2HDLA 3V05A 1VQLA 4PG3A 3IFTA 2EJFC 2ZT9C 3GV6A 3H0GG 3HGBA 1ASZA 3EFXD 2SOBA 3D4DA 3KBGA 3QIAA 4C1NK 2YTYA 2A6HC 4XQJA 1ILQA 3DXJC 1SBBB 4L63B 4P2CB 3D31A 3N6RA 3WDNA 1I5FA 5KNDA 3HRZC 2VS1A 4BY1H 3ONAB 4A3JB 3ER0A 4DV4Q 5FLMH 1IYJB 4A3GH 3ERSX 2JN4A 4V0BA 1N33L 1JC7A 1MGSA 1W3SA 1K8OA 3I70A 2JA9A 2KCCA 2IX0A 1K8MA 3I2ZA 1SFOH 4B3SQ 2E2IH 4HIKA 1SNMA 1PRTB 1XJVA 4BY1B 3J80c 3TEHB 3SHLA 1EOTA 2K4KA 2PZWA 1WVLA 1UWVA 4DAVA 4ZUJA 4IFDH 2JSOA 3EIVA 5T1GA 4A3GB 3CU7A 1LLRD 4ID6A 2ID0A 5CGKA 3K0XA 2JEAI 5JVH3 2KHIA 1HZCA 1D8LA 4DPGA 1HNZL 3CCJA 1G6PA 5LMNW 1SFOB 2Z6BA 2E2IB 1H9MA 2D62A 1RDPD 2PQAA 2R7FA 3TP5A 1K9MC 2UUAL 2JA8G 3WOEA 1DGSA 5EPJA 3UDGA 4O42A 1GUTA 1EQQA 2CHBD 4KK7A 1QILA 4J1MA 1EWIA 5A2QL 1M90C 4QMGA 1K0SA 3RZDH 2E74C 1SR3A 3G4SA 2PQAB 1X3QA 1HR0Q 4DV5Q 4IO9A 4LF8Q 2BA0A 1SDFA 1XYIA 2NYZD 4ULLA 1Q3LA 4X62Q 1N34L 4DR5L 4AQYL 4NXMQ 3RMHA 3IAYA 2HCCA 3ZJYC 2KEDA 4K6DA 4DN4M 1SYEA 4KKSA 2B2VC 2D0OA 4S3SA 3V96A 4KY7A 4DR3Q 2F0PA 1MSHA 3GP7A 4LUVA 5CBEE 4IPDA 3DWPA 4IFDI 1FNVA 4DV1Q 3RZDB 2RKSA 3K0YA 4DK3C 2FINB 3BZDB 3TMEA 2ZTCA 5CV7A 3TREA 2VQFQ 2R7ZH 5LL6X 2G9DA 2ICIA 1TS2A 5DM63 4XXEA 3A5ZB 3CMAA 4O2DA 2JA7H 2RDFA 5IT9L 3EA6A 3JAMi 1WI5A 4HJAA 5JJLA 3S24A 3KLWA 4DXFA 5JEAJ 5DNFA 4IJLA 2R93H 2F0SA 1V1PA 4KKTA 4GNXA 4MIUA 1WD0A 1H9JA 4JV5Q 2R7ZB 4U68A 4LF7Q 1HJPA 3FPPA 4FXGC 2V4DA 1EEID 5AJ3Q 2LKVA 3CCSA 4GNXB 4J6HA 1B1ZA 4AIMA 3DM3A 2JA7B 2K5NA 2A69D 4DUYL 1YNXA 3VR2A 2OT2A 1D1KA 4DV2Q 2BCOA 2F0NA 4DNRB 2A68C 3PV0A 3UE1A 1CM9A 1EL0A 4A75A 1SE8A 1XPUA 2R93B 1QVCA 2R3ZA 1LT6D 1JE4A 4GKKL 4OO1G 3D8GA 1BDOA 1P8LA 2K5WA 1PH6A 3N52A 3SK5A 2NBFA 4I7ZC 2KEEA 2UU9Q 4C3HG 4JC0A 2K28A 1E7ZA 2WAQB 1LT3D 1Q7YC 1SYFA 3U50C 5EPKA 1HR0W 1XMQL 1PMRA 4H0LC 3PO2H 4B3TQ 2LFNA 4I7AA 3T1YQ 1TVXA 5ELNA 4BXXG 1TKWB 4OIJA 3TBIB 4OXPA 3KJOA 1RKNA 3VR4A 1S72A 1Z6HA 2RDGA 3I3CA 3AFQA 4A3EG 1YI2A 3VA7A 4WJ3M 2A73B 2IY5B 3MFGA 1CZGA 4A3CG 2I07B 5J39A 3QOJA 1NAPA 4FYDA 3PO2B 3LWEA 3H3VI 4JI1L 2IT1A 2E8GA 1XMOL 3CCVA 4BBSH 5F2DA 3DMUA 2K1BA 2A6HD 1STBA 5GAGC 1IYUA 2L4NA 2IPKD 3VA5A 4POGA 2Q2TA 2E5LL 5IWAL 1N8RC 3NWTA 1I4RA 2KHJA 3G71A 1N32Q 4HN7A 5D3DA 5DLQE 2RA4A 1ZXTA 1X6OA 1WTQA 2B3GA 1XNQL 4LFCL 2C9OA 1B4OA 1PRTC 2RDHA 5GADC 1X55A 1EU4A 1T5XD 4APVA 4R8IA 4DR2Q 1PH8A 5JAVA 4FXDA 2NVYH 4BBSB 3CCUA 3IRBA 1RTOA 3O13A 3ULLA 5C0XH 1DOKA 2HHHQ 3E0EA 1ZEQX 4CKCA 5CV9A 1I4HA 4A3JG 2ZJQA 1BF4A 4K6LA 4A3DG 2WFWA 5IGGA 3GV3A 1LV9A 2F0HA 1DZ1A 3FHWA 2JXMB 2KBNA 5A2QE 4X66L 1UUPA 1YZ6A 2NVYB 4JBJA 3IL8A 4ODGA 1U5KA 1YBYA 1STNA 1JOQA 3HOVH 3MZ5A 3AB9A 3QOLA 1LTLA 4RA8A 2K33A 4JOIA 5CBAE 2AKWB 2GN5A 2YYZA 1HNXQ 4TSSA 3NHHA 1QUQB 3D3RA 2ZXRA 3HKZB 5GROA 2I5LX 4A3GG 3R93A 1AW7A 2DGYA 1E1TA 2WKCA 3P20A 3OMCA 1YVCA 5EGTA 3OW7A 1GHKA 3I4LA 2UXCQ 2F0EA 4YCUA 2QEJC 3HOVB 3W1GA 4FF3A 4K5WA 3NE5B 1OXVA 2F0TA 1XWEA 2PPBC 3RN2A 4IPGA 1J8IA 3PUVA 3HZXA 5IT9E 3AU7A 2X6LA 4IFDG 4RFBA 2TSSA 3RD4A 3BDLA 1GXDC 4O0AA 3MHBA 4DNIA 4B3SL 4RGTA 1LTGD 1EUJA 5BR8L 4YCWA 5HY6A 1ET6A 5CR3A 3I4NH 3OTOL 5HGTA 4DV6L 3GQBA 4KN7C 1I3QH 1XTCD 1IW7D 3OYYA 3MA2B 4HIMA 4JI6L 2NVQH 4DAYA 1NMFA 4GOPA 4GNXC 1IZ6A 2RSNA 5IGEA 2F3IA 2XWBB 1YHQA 4K2LA 3H15A 1E3PA 3QWNA 4GOPB 3UE0A 3A54A 3I4NB 3S1NH 1HRJA 4R8NA 1EIYB 1XNRQ 1I3QB 1VMPA 4LF6Q 1S5BD 2L5TA 4JI8L 2Y0SB 4WRDA 4G7HC 3VR3A 3J81j 4QUCA 2NVQB 1Q8IA 4GLXA 1TS3A 3FDTA 5J3BA 4TQUS 3ULJA 1NNXA 3EBEA 4OGQC 4NXNQ 2O5JC 3U4VA 2LXJA 2VUMG 1G2TA 1CSQA 4U673 2EY1A 2R7ZG 4XDXA 5I6WA 2IX1A 2NN6H 5T1IA 1BR9A 3S1NB 3W2DA 1F9QA 4LW1A 4GKJL 1JWUD 4ILWA 2EIFA 4A76A 2JA7G 3S2DH 4EQOA 1ZYRC 2I46A 2WB1B 1PZKD 1SE3A 3GTOH 4HMJA 1B53A 2LS01 2R93G 4IN3A 2KUMA 2XWJB 5EKIA 2L0CA 1X3PA 1GHJA 2FHTA 4DA2A 2XSCA 3D4WA 4I65A 1FL0A 2B63H 3LWUA 3J7YW 5K36H 4A3KH 1Q86C 1Y8OB 2N55A 1RIPA 1YJ9A 3T51B 3K57A 1TWGH 2WAQG 3S2DB 4F87A 2V1CC 3RLOA 3GTOB 3KDFA 2NZ1D 3DM1A 4HIDA 3GTQH 1A62A 2N78A 4DUZQ 2D2CC 4ZK9B 3QG1A 4JCVE 4R4QA 1CK1A 1UE1A 1A63A 2B63B 5C5MA 4A3KB 4KN4C 1JORA 1U4RA 2FJ2A 1L0YB 1MI2A 1TWGB 4KHVA 3NXWA 3CMEA 1JOOA 1PRTD 1LTRD 2EE1A 1WD1A 1N9WA 1CFMA 1IBLQ 2I5HA 1H9RA 2EXDA 2RBMA 5IYBG 2P5ZX 3GTQB 3OSOA 5G3LD 4ME3A 3CXCA 3Q6SA 1PA6A 1W6KA 2AQ1B 2K03A 1AN8A 3T1HL 5M5WH 2F0MA 5CC4A 1HA6A 1A3UA 2B2YA 2EJGC 1RF2D 1TY2A 2YV5A 4G7OC 3AEVA 1PZID 3J80i 1TWFH 4GN3B 1VQBA 2BH2A 1PRTF 4XQQA 1TT2A 1HH2P 3I4MH 1LO5D 1GD7A 4OHJA 4CDFC 4CKEA 2F0OA 1SNOA 4Y7NH 2X6GA 2CCZA 3LNNA 4BBSG 2F4VQ 1UAPA 4JOIC 2UXBL 2UXDQ 1PXUA 1NE3A 5L37A 3RN5A 2LXKA 5M5WB 3A7AB 2Z0SA 5LMUQ 1SXTA 4KMUC 1QVGA 3EVQA 1V1OA 1TWFB 1X56A 4GZYC 4KD3A 4CJ0B 3I4MB 2FXQA 2PW7A 3KLRA 4FP5D 1B70B 2N88A 1BCPD 1PDQA 4WJWA 4Y7NB 1IBKQ 1IKLA 3DWAA 4HSPA 3MXNA 1SYDA 4ZRZA 3VR6A 3A55A 1E2ZA 1JJGA 5CYUA 2HUGA 1A2TA 4YWLA 3CQZH 4WJ4A 4X64L 2H4OA 4OWTB 1TIID 3G6JB 2EYHA 4EGVA 1WCMH 1VQHA 3CRKC 3SGIA 3CCMA 2ATWA 5IT9c 4Q0FA 1BCPF 4B9WA 5FOBB 5I6YA 5C3WA 1GJXA 4AYBB 4JVZA 1AH9A 2F4IA 4ALPA 4RG1A 3F2DA 4DXGA 2HD3A 4OX9Q 2L55A 1W6JA 3NK9A 2EDGA 1W2BA 2JK8A 2F0DA 2FMMA 4GOPC 1S4ZA 3CQZB 3DUZA 1KABA 2QA4A 4XT1B 1DXMA 1TS5A 2AWNA 5IP9H 1ICFB 4JYAQ 1WCMB 4YHHQ 3S14H 2PZTA 2OQKA 3D6WA 1G6ZA 1Z9FA 3T53B 1DYQA 4HCEA 4QY7A 1V9PA 4KHPQ 1U4MA 2JE6I 1EY6A 2HIVA 3MVVA 3W3AA 2WKDA 2IHFA 4DR4Q 2ZXOA 4FVMA 2VZAA 4K0KQ 3G48A 1BXTA 1YNNC 3Q0AA 3G6EA 1WFQA 4XTCS 2SNSA 1IBMQ 1DOLA 2OCEA 3S14B 4X65Q 2VB3X 4FF1A 3PCOB 5C4HA 2KJXA 2I0QA 1IXRA 1E0BA 5KEEA 5ELOA 3T13A 2L15A 1IYVA 3TS0A 4JI4Q 1HXYD 2E76C 1D1IA 2GVBA 1N36Q 2Y0SG 2ZXPA 1J5EQ 1ZYRD 1HFNA 5M3MH 2Z8LA 2MQHA 3D6CA 3F1ZA 4F7XA 3FRPB 3K5NA 2OQ0A 3HOYG 1GOZA 1SROA 5EBCA 2WACA 3ULPA 1SN8A 1SYGA 1FD7D 3E5SA 4PMWA 1OXXK 1M1KC 3GTLH 1OO9B 3TS2A 1RCVD 2OWOA 1XPOA 5CV8A 1HPCA 2RHSB 1TS4A 3I91A 5FKAC 5M3MB 1D2BA 4JI0Q 3MFYA 4RMFA 2AQ2B 2KCMA 3NBHA 4JI7Q 4UP7A 4RCNA 3U9SA 1UEBA 1VQ8A 4BA2I 1AE2A 2XVSA 1X3FA 3GTLB 1I94Q 1SYCA 1SMYD 3NBIA 2EYMA 4HMIA 3QO2A 4DV3Q 1I6HH 4LFAL 4LF4L 1JWMD 2C5CA 1TWCH 1NUCA 5EJWA 5FLXL 1VQPA 1G91A 3HP3A 1EU3A 2NTTA 3HOWH 5EQ0A 5CV4A 1IHZA 2DJFC 4JI2Q 3CRLC 2PZUA 1BCPB 4DR7L 1MBYA 1R4PB 5E1FA 4DK6C 1XTDA 3BYTB 4BY7G 5J22A 2NTSA 2FMCA 4B3MQ 4ABNA 1QB5D 1LTAD 1DM0B 1UE6A 1PHJA 2F0QA 3ZYYX 2B63G 4FF4A 4IALA 3A8JE 3VYRA 1CQFA 1I6HB 4A3KG 1X32A 1TWCB 3UDIA 2A5HA 2MGSA 4JBWA 4B08A 3M7NA 1IW7C 3HOWB 1PH9A 3CD6A 1HCZA 3L9AX 1X3EA 3F8TA 4P73A 3U9OA 5FJ8H 3MC0B 4AH6A 4ZKCB 2PW5A 5BN5A 4LFBL 4H7BA 3TN2A 2N49A 2B2UC 1LUZA 2PMZE 1GUOA 1Y69U 1H9SA 2NVXH 4R4IA 3S1MH 1LM0A 2B2TA 2ZM6Q 5C4XG 3I4OA 4NW2A 2F0WA 2A8VA 1CKNA 3FMCA 1V1PB 4A3MH 1H9SB 5KIXA 2SDFA 4NDXA 4DK1A 3J7A5 5C44H 5IOCA 1A8VA 4KI0A 4A3LH 1Y1VH 3PMFA 3L0OA 1EFID 3PSIA 3PIPA 2EY2A 4DV7Q 2NVXB 4B3RL 4K5XA 3S1MB 3PIO3 1B8AA 4FF2A 1NR2A 1I4GA 1HZAA 5HURA 2Q8IB 1R9TH 3UDFA 1STHA 5DEHA 3D0FA 4A3MB 1NJIC 2JA6G 1STAA 2J7ZA 3QR8A 3HOUG 3I4MG 3CCEA 3I56A 4NPSA 5C44B 4MN3A 1Y1VB 4C3IG 1Z7TA 2EY6A 2QDLA 1KD1C 1FJGQ 2L9HA 1PTOH 3BVGA 1EZ6A 4JBKA 3CPWA 3TRZA 1HNWQ 2Q2HA 1L0WA 3K6OA 1EYDA 2N3SA 3NP8A 1R9TB 1CI3M 1LABA 3HS0C 3MXUA 5GAHC 2VQEQ 4A93H 1HFGA 2LMCB 4DR6Q 4OWWB 2EYFA 2BOSA 5KGUA 1G291 1F2LA 1OXSC 1Q8KA 3OMGA 3K5OA 4YIJA 3T56B 2FFKB 4CDDC 1RHPA 2BE5C 2UUBL 4YY3L 5E4WC 1EOVA 3PGZA 3RLFA 1PTOB 3QB3A 2WV6D 4DV0Q 3KYHC 1OXTA 2DY7A 1WTRA 3L2PA 2K5QA 2ZJRA 1VS0A 3HEJA 2R92H 1T9HA 1YNND 4IFDJ 2Q2UA 3OWEB 4A93B 2UUCQ 2Z1CA 1JT8A 2YTVA 1PH4A 3PF4A 3SK8A 1JB3A 3S17H 3M3YH 3EN2A 2PI2E 2CH4A 4K5VA 2HIXA 3HOXB 2NWGA 4PZ7A 2RHQB 3MEHA 1JJCB 5LMNL 1WTVA 3JC66 3M7GA 4QL5A 5LHY1 4DK0A 1A2UA 2R92B 4RCOA 4QIWB 4IUPA 5IGCA 1U4PA 1ICWA 4IPHA 4DR1Q 5C4JH 1EIFA 4JPBW 2X69A 2ES2A 4RGMA 3PQIA 5IP9G 4LF9Q 3C46A 5IGDA 3S17B 3M3YB 2SEBD 2IJ0A 3NWSA 3BJUA 2N8NA 3NQTA 1YJWA 3MXGA 3J81i
chains in the Genus database with same CATH topology
1UEAB 2A6EC 1MSGA 1ESRA 3T4AC 3I72A 2O5IC 2GA4B 3KLSX 4HR7B 1IL8A 4QUFA 5C4JB 3OHXC 5FLXE 3D4RA 2EVBA 5I9PA 4C1NI 3KBXA 1BCPC 5C0XI 1YNJC 1ONLA 1RTNA 3A7LA 2K32A 2LY7A 1Y1WB 1EY8A 2ENBA 3VYSA 2Z4IA 5EBDA 1LT5D 2F0VA 1WTXA 4ZLTF 2G9HD 1G8ZD 3HG9A 1EQTA 1I4PA 1I50B 1FNWA 3GTMB 1NR4A 1ZKOA 4CBVA 4IUQA 5CV6A 1LTSD 3NTKA 1E2WA 3H0GB 2B2TC 3NPPA 3MAQA 4XIGS 3R2IA 1LT4D 2OXPA 3TSSA 3NTHA 4ZQ3A 4TRDA 3OWFA 1S5DD 1DONA 3FPUB 2MP1A 4RWSC 3P1HA 1TWHB 1T5EA 3K58A 3DEOA 4IUTA 1M4VA 2MJ8A 2SNMA 3X3NA 4UAIA 3GTJB 4IUVA 2XIWA 3C3LA 1Q90A 3I8ZA 4A3BB 5KYIA 2QCPX 3KUPA 1RODA 1STYA 3RZOB 1UNSA 4KHZA 1GUGA 2E2HB 1KLGD 4TKOB 1B44D 5J1ZA 5JOBA 4X3TA 2PNRC 2BDOA 1PTOC 5CV5A 4LMQD 2M2LA 1I6VC 2AWOA 4G7ZC 5ELEA 2K04A 1SNQA 2BE5D 2KVMA 4B9XA 4K8JA 4DFAA 5C3EB 3JAML 3EROA 2NN6I 1SMYC 3SE0A 1J9OA 4R9WA 1U9RA 4QF4A 1TR5A 5KNCA 1TWAB 1B2TA 1OXUA 5KYLA 5M9OA 1QWYA 1WTOA 3TP7A 4K8IA 1EIGA 1QOHA 1V43A 2IW3A 1D6EC 3AMUA 4OIKA 2D9UA 1LTTD 1EIHA 3R8BA 3TDQA 3Q22A 5NUCA 4X3KA 4KJOA 2A6ED 1HTPA 2EYOA 2L11A 5ELBA 5M5YB 3FKIB 1O7ZA 3J7AF 1O7YA 2QILA 4DF7A 3SR1A 3DWQA 3KF8A 3PO3B 1VCIA 5FK9C 2EZVA 1EWHA 1ESFA 1BUVT 4KV6A 4DU9A 1I4XA 2RVLA 2B8FA 3C2PA 1B9MA 2KQ3A 2EYPA 1WTWA 3VYUA 4L8JA 2MHVA 5C0XG 5M5XB 1YNJD 3GTGB 4NMZA 1AZPA 4M1UB 2QKIC 4X3SA 4ZAIA 3P75A 3Q23A 4A3IB 2QF7A 3SDZA 1NCVA 1KNEA 1PLFA 4KY5A 1R4QB 2K7VA 5CMDA 1ET9A 2F0LA 1FR3A 1CA6A 4KY6A 5JEAH 1ILPA 2EJMA 3R3OA 3M85A 2F03A 2OF1A 3Q24A 2NUCA 1HQMC 5ELDA 1FYCA 2CQAA 1JCKB 4CJ2C 2QDBA 1B3AA 1HQRD 3GD7A 4RGNA 3SXHA 1B50A 3P7JA 4RKBA 3TP6A 1CHPD 2KCNA 3BVZA 1VDZA 5DAUA 4J8QA 3C1EA 4KJNA 3S1QB 5ISRA 4PNYA 3J81L 2EYLA 2F0KA 2H1EA 4IQZA 1KLUD 1PZJD 4MHEA 2K5DA 1RJTA 1D5XC 1C8CA 4FXKC 2JP1A 1RD9D 5E3FA 4LJZC 3T16A 1CTMA 1KDAA 4A3DB 1A15A 1CA5A 3BDOA 2F0FA 4Z9CB 4L6TB 1I4QA 4PV1C 1JQYD 5IGFA 4K2KA 1G2SA 3JAME 2AQ3B 1PTOD 1S5FD 1EY4A 3PUWA 4H13C 2F3WA 3L7ZC 5D3IB 2XRQD 3GTPB 5JJZA 5LL6S 4DAPA 1Q12A 1HHVA 1O78A 2IWHA 2PYKA 2NN6G 4HEDA 4CHTB 1PTOF 3MXPA 1KAAA 1NSNS 1CHQD 3A56A 3VR5A 2J4XA 3S16B 2DN8A 2VXWA 1VMCA 1EY7A 2B8GA 2WIIB 3ND9A 2B2YC 5ELCA 5K36G 1EWCA 4A3FB 3BG3A 4HSVA 3E6ZX 2MPMA 1Z47A 1LTID 3SVMA 4O1NA 4EQNA 1SNPA 5EKKA 4IURA 2DY8A 4WORA 2L12A 4BBRB 2IL8A 2HQEA 2J0TD 2AUJD 3LX0A 1II3A 2KA7A 1EY0A 1XX8A 3H09A 2E2DC 3NUCA 1GUWA 4C3JB 2DNCA 5JPNC 1ENAA 2JEBI 3CKIB 3IFDA 3DHQA 1VF5C 5D14A 2VUMB 2JA5B 3SK4A 2JYOA 1SSOA 2B2WA 3GO5A 2F3VA 1GUNA 4UDUC 5JVG3 1CQVA 5AFWA 2AUKA 3VYTA 1FGBD 4M8AA 1F9SA 1O80A 4NKLA 4XYQA 4BS9A 1EZ8A 1STGA 1MD2D 1C48A 1SYBA 3QJYA 2E75C 4BA1I 4V190 3FEWX 4JK1C 2D5DA 3J81E 2K05A 3ITPA 2CW0C 4RH6A 3J80L 4RKLA 5EPLA 3IKJA 5KRUA 1C4QA 3K5LA 2RSOA 4N9PA 1A6XA 1O7LA 3HOZB 4XT3B 1AZQA 3A8IE 1SAPA 3SK6A 2KECA 5I2YA 1AP0A 5C6AA 2EYJA 5JEAG 4LAAA 2L1BA 3TP8A 2EXZA 3EQLC 3I73A 5BN4A 2M00A 1JR0D 3NSWA 1S5ED 5FO8B 3G7LA 4ZUIA 3H94A 3J7AV 3RUZA 2F0GA 1Y8PB 5ELFA 4DNTB 2K01A 1JOKA 3MTSA 1S5CD 1A3VA 4EQPA 1QNUA 1BO0A 1K83B 5I4DA 4PMCA 1CZWA 1U4LA 1H9KA 1SNDA 2WINB 4G57A 3EJIA 3K7AB 1EY9A 3F2UA 3MWYW 4F8MA 1EYCA 4RHSA 3OOCA 5C5LA 1PFNA 1XXGA 2K6AA 3OIQA 4K14A 1QG7A 1F77A 2E2JB 3M4OB 3CHBD 4CGYB 2Z4HA 3NQIA 4WFN3 5K5PA 2XNAC 1GUSA 2M9VA 4XYOA 2OEOA 5C4ZA 1SJHD 1Q1EA 1EYAA 3GTKB 4HAEA 5DM73 1PFBA 1SJED 5A35A 3E0JA 2MUYA 4RAUC 2KHSA 5M3FB 3H6MA 4KTAA 5COYA 1EQVA 1SE2A 2F1MA 1L0XB 1QJOA 1HA5A 3S15B 2RQXA 3S2HB 3K59A 1ENCA 1BQQT 3URYA 1HUNA 5IIFA 1DCZA 5I2XA 1LACA 1TU2B 1B9NA 3BS1A 1PFMA 2B39A 4NP5A 3K5MA 1Y8NB 1WTPA 2B2WC 1D5MC 2Q8TA 2F0IA 2EPBA 4PMBA 4H44C 4IUNA 1KDCA 5TSSA 1HUMA 4N9TA 2PQEA 2A68D 3X3MA 4LK1C 3HOYB 4C3JG 3DEPA 4ME5A 1E2VA 1JWSD 3I90A 4IZ8A 1F9RA 3A8KE 5EKLA 4HTHA 3FVQA 1QNKA 2VB2X 1DJRD 4FNFA 3H3VC 3BDCA 4E6IA 1QCBD 2HCIA 1F2MA 1ML0D 1BBXC 2CVRA 3J80E 4QCLA 5E4XA 2IX3A 2JA8B 4XQNA 2NVTB 2YU9B 4BWGB 2XRSD 1V8QA 3KLSA 5IGBA 5FO9B 1TQOA 2CW0D 3S1RB 5CORA 5C0XJ 3ND8A 4OL7A 1F2ZA 2WP8J 2ICEC 1CT1D 2Q8RE 3UI2A 2DNEA 1KDBA 2BA1A 2R6GA 4C2MB 4CJ1B 1KNAA 4BY7B 1EEFD 1IKMA 1HTLD 4F88A 3PUYA 3NTIA 1M8AA 4G4KA 5BN3A 1PYWD 1F2YA 2F0JA 4X3UA 1Q1BA 1AFPA 4KKUA 2F0UA 3H91A 4FO2A 1F9PA 1SNCA 3BVMA 1LTBD 2B2VA 2PMZB 2EOTA 1DD2A 3PIP3 1FNUA 3PUZA 1JICA 2EY5A 1BOSA 5IODA 5JPMC 4OO1H 1KTKA 3M4YA 4PQXA 5C4XB 2NB0A 1SE4A 5C3XA 3V2TA 2O4XA 2R61A 1DOMA 1QE6A 1A3TA 2O2LD 2PO4A 4KD4A 5G3LF 2B2UA 1STEA 3C1FA 4QB4A 3TZDA 2XN9C 4C3HB 2JA6B 2VNUD 5D65A 4ZKBB 3HOUB 2A74C 2A69C 3SEBA 3BYYB 1ENFA 3TZUA 3L3OC 5I9OA 4C3IB 2KOLA 4RGOS 4CKBA 4EVOA 1TY0A 4OO1I 1SEBD 3S9WA 4HCSA 3WOFA 1EY5A 3OIPA 4DGZA 3ERQA 4A3EB 5KNBA 1D5ZC 4IUUA 5FO7B 1BNZA 3PUXA 4C56C 3KK7A 4ZYSA 2HDMA 4Q5VA 2TMPA 2BDNA 1AEXA 4RHRA 3OPOA 1VF7A 2PCFB 3R2TA 2HDLA 3V05A 3IFTA 2EJFC 2ZT9C 3GV6A 3HGBA 3EFXD 2SOBA 3D4DA 3KBGA 3QIAA 4C1NK 2A6HC 4XQJA 1ILQA 3DXJC 1SBBB 4L63B 4P2CB 3D31A 3N6RA 3WDNA 5KNDA 3HRZC 3ONAB 4A3JB 4V0BA 1JC7A 1MGSA 1K8OA 3I70A 2KCCA 2IX0A 1K8MA 1SNMA 1PRTB 4BY1B 3SHLA 1EOTA 2PZWA 1WVLA 4DAVA 4ZUJA 4IFDH 2JSOA 5T1GA 4A3GB 3CU7A 1LLRD 4ID6A 2ID0A 5CGKA 2JEAI 5JVH3 1SFOB 2E2IB 1H9MA 2D62A 1RDPD 3TP5A 3WOEA 5EPJA 4O42A 1GUTA 2CHBD 4KK7A 1QILA 4J1MA 5A2QL 4QMGA 2E74C 1X3QA 2BA0A 1SDFA 1XYIA 2NYZD 4ULLA 1Q3LA 3RMHA 3IAYA 2HCCA 2KEDA 4K6DA 4DN4M 1SYEA 4KKSA 2B2VC 4S3SA 3V96A 4KY7A 2F0PA 1MSHA 3GP7A 5CBEE 3DWPA 4IFDI 1FNVA 3RZDB 2RKSA 3K0YA 2FINB 3BZDB 3TMEA 5CV7A 5LL6X 2G9DA 2ICIA 1TS2A 5DM63 4XXEA 2RDFA 5IT9L 3EA6A 4DXFA 5JEAJ 5DNFA 2F0SA 1V1PA 4KKTA 4MIUA 1WD0A 1H9JA 2R7ZB 4U68A 3FPPA 4FXGC 2V4DA 1EEID 2LKVA 4J6HA 1B1ZA 2JA7B 2A69D 3VR2A 2OT2A 1D1KA 2BCOA 2F0NA 4DNRB 2A68C 3PV0A 1CM9A 1EL0A 2R93B 2R3ZA 1LT6D 1JE4A 4OO1G 3D8GA 1BDOA 2K5WA 3N52A 3SK5A 2NBFA 4I7ZC 2KEEA 4C3HG 2K28A 2WAQB 1LT3D 1SYFA 5EPKA 1PMRA 4H0LC 2LFNA 1TVXA 1TKWB 4OIJA 3TBIB 1RKNA 3VR4A 1Z6HA 2RDGA 3I3CA 3VA7A 2A73B 3MFGA 1CZGA 2I07B 5J39A 3QOJA 1NAPA 4FYDA 3PO2B 3LWEA 2IT1A 5F2DA 3DMUA 2K1BA 2A6HD 1STBA 1IYUA 2L4NA 2IPKD 3VA5A 3NWTA 1I4RA 4HN7A 5D3DA 2RA4A 1ZXTA 1WTQA 2C9OA 1B4OA 1PRTC 2RDHA 1EU4A 1T5XD 4R8IA 5JAVA 4FXDA 4BBSB 1RTOA 3O13A 5C0XH 1DOKA 1ZEQX 4CKCA 5CV9A 1I4HA 1BF4A 4K6LA 5IGGA 3GV3A 1LV9A 2F0HA 1DZ1A 2JXMB 5A2QE 1UUPA 4ODGA 2NVYB 3IL8A 1STNA 1JOQA 3MZ5A 3AB9A 3QOLA 4RA8A 2K33A 5CBAE 2YYZA 4TSSA 3NHHA 3D3RA 2ZXRA 3HKZB 3R93A 1AW7A 2WKCA 3P20A 3OMCA 5EGTA 3OW7A 1GHKA 3I4LA 2F0EA 2QEJC 3HOVB 4FF3A 4K5WA 3NE5B 1OXVA 2F0TA 1XWEA 2PPBC 1J8IA 3PUVA 3HZXA 5IT9E 3AU7A 2X6LA 4IFDG 4RFBA 2TSSA 3RD4A 3BDLA 1GXDC 3MHBA 4RGTA 1LTGD 1ET6A 5CR3A 5HGTA 3GQBA 4KN7C 1XTCD 1IW7D 3MA2B 4DAYA 2RSNA 5IGEA 2XWBB 4K2LA 3QWNA 3I4NB 3A54A 1HRJA 4R8NA 1I3QB 1VMPA 1S5BD 2L5TA 2Y0SB 4WRDA 4G7HC 3VR3A 4QUCA 2NVQB 1Q8IA 1TS3A 3FDTA 4TQUS 4OGQC 2O5JC 1G2TA 4U673 2EY1A 4XDXA 5I6WA 2IX1A 2NN6H 5T1IA 1BR9A 3S1NB 3W2DA 1F9QA 1JWUD 4ILWA 4EQOA 1ZYRC 2I46A 2WB1B 1PZKD 1SE3A 4HMJA 1B53A 2LS01 4IN3A 2KUMA 2XWJB 5EKIA 2L0CA 1X3PA 1GHJA 2FHTA 4DA2A 2XSCA 3D4WA 4I65A 3LWUA 3J7YW 5K36H 1Y8OB 2N55A 3T51B 3K57A 3S2DB 4F87A 3GTOB 2NZ1D 3DM1A 2D2CC 4ZK9B 3QG1A 1CK1A 2B63B 5C5MA 4A3KB 4KN4C 1JORA 1U4RA 2FJ2A 1L0YB 1MI2A 1TWGB 4KHVA 3NXWA 1JOOA 1PRTD 1LTRD 2EE1A 1WD1A 1CFMA 1H9RA 2RBMA 3GTQB 3OSOA 5G3LD 3Q6SA 1W6KA 2AQ1B 2K03A 1AN8A 2F0MA 5CC4A 1HA6A 1A3UA 2B2YA 2EJGC 1RF2D 1TY2A 4G7OC 1PZID 1PRTF 4XQQA 1TT2A 1LO5D 4OHJA 4CKEA 2F0OA 1SNOA 2X6GA 3LNNA 1UAPA 1PXUA 5M5WB 3A7AB 1SXTA 4KMUC 3EVQA 1V1OA 1TWFB 4GZYC 4KD3A 4CJ0B 3I4MB 2PW7A 3KLRA 4FP5D 2N88A 4Y7NB 1BCPD 1PDQA 4WJWA 1IKLA 3DWAA 4HSPA 3MXNA 1SYDA 4ZRZA 3VR6A 3A55A 1E2ZA 5CYUA 2HUGA 1A2TA 2H4OA 1TIID 3G6JB 2EYHA 4EGVA 3CRKC 4Q0FA 1BCPF 4B9WA 5FOBB 5I6YA 5C3WA 1GJXA 4AYBB 2F4IA 4DXGA 2L55A 1W6JA 3NK9A 2EDGA 2F0DA 2FMMA 1S4ZA 3CQZB 3DUZA 1KABA 4XT1B 1DXMA 1TS5A 2AWNA 1WCMB 2PZTA 3D6WA 1G6ZA 3T53B 1DYQA 4HCEA 1U4MA 2JE6I 1EY6A 3MVVA 2WKDA 3W3AA 2ZXOA 4FVMA 1BXTA 1YNNC 3Q0AA 4XTCS 2SNSA 1DOLA 3S14B 2VB3X 4FF1A 5C4HA 2KJXA 1E0BA 5KEEA 3T13A 1IYVA 1HXYD 2E76C 1D1IA 2ZXPA 1ZYRD 1HFNA 2Z8LA 3D6CA 4F7XA 3FRPB 3K5NA 1GOZA 5EBCA 2WACA 1SYGA 1FD7D 3E5SA 4PMWA 1OXXK 1OO9B 1RCVD 5CV8A 1HPCA 1TS4A 3I91A 5FKAC 5M3MB 1D2BA 3MFYA 2AQ2B 3NBHA 4RCNA 3U9SA 4BA2I 2XVSA 3GTLB 1SYCA 1SMYD 3NBIA 2EYMA 4HMIA 3QO2A 1JWMD 2C5CA 1NUCA 5EJWA 5FLXL 1G91A 3HP3A 1EU3A 2NTTA 5EQ0A 5CV4A 1IHZA 3CRLC 2PZUA 1BCPB 1MBYA 1R4PB 5E1FA 3BYTB 5J22A 2NTSA 2FMCA 4ABNA 1QB5D 1LTAD 1DM0B 2F0QA 3ZYYX 4FF4A 4IALA 3A8JE 3VYRA 1CQFA 1I6HB 1X32A 1TWCB 2A5HA 2MGSA 4JBWA 4B08A 3M7NA 1IW7C 3HOWB 1HCZA 3L9AX 3U9OA 3MC0B 4ZKCB 2PW5A 5BN5A 4H7BA 3TN2A 2B2UC 1GUOA 1Y69U 1H9SA 2B2TA 4NW2A 2F0WA 3FMCA 1V1PB 1H9SB 5KIXA 2SDFA 4NDXA 4DK1A 5IOCA 4KI0A 3PMFA 1EFID 2EY2A 2NVXB 4K5XA 3S1MB 3PIO3 4FF2A 1NR2A 1I4GA 5HURA 2Q8IB 1STHA 5DEHA 4A3MB 1STAA 2J7ZA 5C44B 4MN3A 1Y1VB 4C3IG 1Z7TA 2EY6A 2L9HA 1PTOH 3BVGA 1EZ6A 3K6OA 1EYDA 3NP8A 1R9TB 1CI3M 1LABA 3HS0C 3MXUA 1HFGA 2LMCB 2EYFA 2BOSA 5KGUA 1G291 1F2LA 1OXSC 3OMGA 3K5OA 4YIJA 3T56B 2FFKB 1RHPA 2BE5C 5E4WC 3RLFA 1PTOB 3QB3A 2WV6D 1OXTA 2DY7A 1WTRA 2K5QA 3HEJA 1YNND 4IFDJ 3OWEB 4A93B 2Z1CA 3SK8A 1JB3A 4K5VA 3HOXB 2NWGA 3MEHA 1WTVA 3M7GA 5LHY1 4DK0A 1A2UA 2R92B 4RCOA 4QIWB 4IUPA 5IGCA 1U4PA 1ICWA 2X69A 4RGMA 3C46A 5IGDA 3S17B 3M3YB 2SEBD 2IJ0A 3NWSA 3NQTA 3MXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I65 A;  3LX0 A;  1ENC A;  4K5W A;  4K6D A;  3TP8 A;  5HUR A;  2EXZ A;  2F0U A;  1SYE A;  5CV8 A;  1II3 A;  1STH A;  5E3F A;  1AEX A;  2F0T A;  2SNM A;  5IIF A;  1SNC A;  4S3S A;  3T16 A;  1A2T A;  2M00 A;  4KY7 A;  2F0P A;  4MIU A;  5DEH A;  4DF7 A;  1EY0 A;  1STA A;  1KDA A;  3QOJ A;  3SR1 A;  5J39 A;  3HZX A;  5KYI A;  3NUC A;  5I9P A;  2EYH A;  4NP5 A;  4ZUI A;  1ENA A;  4KV6 A;  3BDL A;  4DU9 A;  2F0F A;  1STY A;  3DHQ A;  2RKS A;  2F0G A;  3RUZ A;  4B9W A;  3MHB A;  2EY5 A;  5I6Y A;  2KQ3 A;  5F2D A;  3TME A;  2EYP A;  3SK4 A;  5C3W A;  2EY6 A;  3DMU A;  5IOD A;  1STB A;  2F0I A;  2SOB A;  3D4D A;  5CV7 A;  5IGF A;  4K2K A;  1SYC A;  5CR3 A;  4HMI A;  2EYM A;  1EZ6 A;  3VA5 A;  4PMB A;  1JOK A;  5J1Z A;  4NMZ A;  5HGT A;  4IUN A;  2F3V A;  5JOB A;  5C5M A;  1EY4 A;  1A3V A;  1EYD A;  1NUC A;  3NP8 A;  5C3X A;  1KDC A;  1JOR A;  3NK9 A;  4EQP A;  5CV5 A;  2F0D A;  2F0E A;  2RDF A;  3P75 A;  4KHV A;  3NXW A;  3V2T A;  2O4X A;  2F3W A;  4N9T A;  1JOO A;  1KAB A;  2EYF A;  2PQE A;  5CV4 A;  1EY8 A;  2ENB A;  5KGU A;  1IHZ A;  4KY5 A;  2PZU A;  4ME5 A;  1A3T A;  4PMC A;  5E1F A;  1SNQ A;  3OMG A;  2RBM A;  4NKL A;  4YIJ A;  5J22 A;  2PZT A;  4IZ8 A;  4KD4 A;  1SND A;  2F0V A;  2F0S A;  5EKL A;  4HTH A;  5JAV A;  5IGE A;  2F0L A;  1EZ8 A;  4G57 A;  3EJI A;  3OSO A;  4K8J A;  1STG A;  3BDC A;  4K2L A;  4KY6 A;  4B9X A;  4DFA A;  1EY9 A;  2F0Q A;  2PYK A;  3ERO A;  3QB3 A;  1EYC A;  4E6I A;  4F8M A;  1F2M A;  4IAL A;  3R3O A;  3C1F A;  4QB4 A;  2F0M A;  1SNM A;  1SYB A;  1EY6 A;  1A3U A;  2OF1 A;  3MXP A;  4R8N A;  1KAA A;  2LKV A;  3HEJ A;  2NUC A;  2HQE A;  3MVV A;  4J6H A;  5C5L A;  5CC4 A;  5CV9 A;  4WRD A;  3SHL A;  1U9R A;  4K14 A;  2PZW A;  4QF4 A;  1TR5 A;  1TT2 A;  2QDB A;  5CV6 A;  1NSN S;  2SNS A;  4ZUJ A;  2F0N A;  3SK8 A;  3U9O A;  2F0O A;  1SNO A;  4K5V A;  5IGG A;  5IGB A;  1TQO A;  2F0H A;  4ID6 A;  2PW5 A;  5CGK A;  3SXH A;  5I9O A;  4H7B A;  1EY7 A;  3ITP A;  4ODG A;  5KYL A;  4RKB A;  3TP6 A;  5C4H A;  2EY1 A;  3MEH A;  3D8G A;  1STN A;  4EVO A;  5I6W A;  5K5P A;  4RKL A;  4OL7 A;  5KEE A;  3S9W A;  1JOQ A;  3MZ5 A;  3QOL A;  3SK5 A;  3T13 A;  5KRU A;  1EY5 A;  5M9O A;  1F2Z A;  4DGZ A;  2OXP A;  2F0W A;  3ERQ A;  5DAU A;  2OEO A;  1A2U A;  3TP5 A;  5C4Z A;  4N9P A;  3TP7 A;  4K8I A;  5IGC A;  4ZQ3 A;  3C1E A;  1EYA A;  1KDB A;  3EVQ A;  4KJN A;  4TRD A;  3OWF A;  5ISR A;  1SYF A;  3D6C A;  4EQO A;  4F7X A;  5KIX A;  3NHH A;  4NDX A;  4KD3 A;  4PNY A;  2PW7 A;  4J1M A;  5IOC A;  4EQN A;  2WAC A;  3SK6 A;  5IGD A;  4HMJ A;  4QMG A;  2KHS A;  3PMF A;  2EYL A;  2F0K A;  1SYG A;  3H6M A;  4KTA A;  1SNP A;  5EKK A;  5NUC A;  1EQV A;  3P1H A;  5C6A A;  2EYJ A;  3NQT A;  1F2Y A;  3OMC A;  4KJO A;  2EY2 A;  4WOR A;  1RKN A;  4LAA A;  2F0J A;  3E5S A;  4K5X A;  5EGT A;  1SYD A;  3D4W A;  2EYO A; 
#chains in the Genus database with same CATH topology
 1UEA B;  2A6E C;  2QEX A;  1MSG A;  1ESR A;  4LUO A;  3T4A C;  3I72 A;  4BY1 G;  2O5I C;  1MHW C;  2GA4 B;  3KLS X;  4HR7 B;  1IL8 A;  4QUF A;  5C4J B;  3OHX C;  1Y1W H;  1Q81 C;  5FLX E;  3D4R A;  4JI3 Q;  2EVB A;  5I9P A;  4C1N I;  5FLM G;  5HGQ A;  1EFW A;  4YWM A;  3KBX A;  1BCP C;  1I50 H;  5C0X I;  4MTK A;  3MEF A;  4K0K L;  2AMC B;  1YNJ C;  1ONL A;  3GTM H;  4DV4 L;  1RTN A;  1QZH A;  3A7L A;  5M3M G;  2K32 A;  2LY7 A;  1Y1W B;  1EY8 A;  2ENB A;  3BZK A;  3VYS A;  2Z4I A;  1P16 A;  1VQN A;  5EBD A;  1LT5 D;  2F0V A;  1WTX A;  3H0G H;  4ZLT F;  2G9H D;  1G8Z D;  3HG9 A;  1N33 Q;  1EQT A;  1I4P A;  1I50 B;  3NEM A;  2QW7 A;  1FNW A;  3GTM B;  1NR4 A;  1ZKO A;  2IHE A;  1NTG A;  4CBV A;  4QQB X;  4IUQ A;  1X65 A;  5CV6 A;  1LTS D;  1PYS B;  3NTK A;  1E2W A;  3H0G B;  2B2T C;  3NPP A;  3MAQ A;  4XIG S;  1WJJ A;  3R2I A;  4JG2 A;  4DAY B;  1SMX A;  1LT4 D;  1HNZ Q;  2OXP A;  4IOA A;  3TSS A;  3LGJ A;  3NTH A;  4YWK A;  3GTJ H;  4ZQ3 A;  1YEZ A;  2HT1 A;  4TRD A;  3OWF A;  1S5D D;  3M4P A;  1DON A;  4A3B H;  4R1J A;  1HR0 L;  4DV5 L;  2UUA Q;  3FPU B;  3RNU A;  4LF8 L;  4X62 L;  2MP1 A;  4NXM L;  1QVF A;  4RWS C;  3RZO H;  3P1H A;  1CSP A;  1T5E A;  1TWH B;  3K58 A;  3DEO A;  2E2H H;  4IUT A;  2B29 A;  1M4V A;  2MJ8 A;  1N34 Q;  4DR5 Q;  4AQY Q;  4DR3 L;  4R4C A;  1YIJ A;  1SLJ A;  1TXY A;  2SNM A;  3X3N A;  4UAI A;  3CCL A;  3GTJ B;  4IUV A;  1UE5 A;  2XIW A;  1E24 A;  1C0A A;  3C3L A;  1Q90 A;  3I8Z A;  1BBW A;  3NEN A;  4A4I A;  5KYI A;  4DV1 L;  4A3B B;  2QCP X;  1YHB A;  3KUP A;  5FJ8 G;  1ROD A;  1STY A;  2VQF L;  1JB7 A;  1YHA A;  3RZO B;  1UNS A;  5C3E H;  4KHZ A;  1GUG A;  1GVP A;  2E2H B;  1KLG D;  4TKO B;  1B44 D;  5J1Z A;  5JOB A;  4X3T A;  2PNR C;  2BDO A;  1PTO C;  5CV5 A;  4A3M G;  4LMQ D;  2M2L A;  2RCN A;  2F52 A;  1I6V C;  2AWO A;  4G7Z C;  4YCV A;  5ELE A;  2ALY B;  2K04 A;  2WAQ E;  3BZC A;  1SNQ A;  1TWA H;  3I55 A;  2BE5 D;  4MTN A;  4JV5 L;  2KVM A;  4LF7 L;  4B9X A;  3K7U C;  4K8J A;  4DFA A;  1VQA A;  5C3E B;  3JAM L;  3ERO A;  5AJ3 L;  1VQF A;  2NN6 I;  3PIO A;  1YIT A;  1SMY C;  3SE0 A;  3KDF B;  4JI5 Q;  1VQG A;  1J9O A;  1K73 C;  4DV2 L;  4R9W A;  1U9R A;  4QF4 A;  1TR5 A;  5KNC A;  1CUK A;  4DUY Q;  3PO2 G;  1TWA B;  2NZO A;  1B2T A;  1OXU A;  5KYL A;  2UU9 L;  2K75 A;  3GDE A;  1AE3 A;  5M5Y H;  3FKI H;  4GKK Q;  5M9O A;  4P72 A;  1QWY A;  1WTO A;  4GN4 B;  3TP7 A;  4K8I A;  1EIG A;  1QOH A;  2ASB A;  4A93 G;  1V43 A;  3U4Z A;  4B3T L;  2IW3 A;  3HKS A;  1D6E C;  3AMU A;  3W1B A;  3PO3 H;  3T1Y L;  2K52 A;  4OIK A;  1HZ9 A;  2D9U A;  1LTT D;  5EAY A;  1EIH A;  1EQR A;  1XMQ Q;  3R8B A;  5H1S E;  3TDQ A;  3Q22 A;  5NUC A;  3A74 A;  4X3K A;  1PFS A;  4KJO A;  2A6E D;  1HTP A;  1B3Q A;  2EYO A;  2L11 A;  5M5X H;  5ELB A;  3GTG H;  5M5Y B;  3FKI B;  2CWA A;  1O7Z A;  1G51 A;  3J7A F;  4A3I H;  1O7Y A;  2QIL A;  4DF7 A;  4JBM A;  3SR1 A;  3DWQ A;  3KF8 A;  3PO3 B;  1VCI A;  5FK9 C;  2EZV A;  1EWH A;  1ESF A;  1BUV T;  1E22 A;  4KV6 A;  5FLX c;  4DU9 A;  1I4X A;  2RVL A;  1K8G A;  2B8F A;  3C2P A;  4QJF A;  1B9M A;  2KQ3 A;  1PH3 A;  2EYP A;  1WOC A;  2QGQ A;  1WTW A;  2ZJP A;  3KF8 B;  4JI1 Q;  3VYU A;  4L8J A;  1XMO Q;  2MHV A;  3HFZ B;  5C0X G;  1U0L A;  5M5X B;  1N32 L;  1YNJ D;  3GTG B;  4NMZ A;  1AZP A;  4M1U B;  2E5L Q;  2QKI C;  2MFI A;  5IWA Q;  4A3C H;  4X3S A;  5IP7 H;  4ZAI A;  3P75 A;  3Q23 A;  4A3I B;  2QF7 A;  3SDZ A;  1NCV A;  1KNE A;  3MXN B;  3HKZ G;  1PLF A;  4KY5 A;  4DR2 L;  1R4Q B;  4L5Q A;  2K7V A;  1XNQ Q;  5CMD A;  4LFC Q;  3HKZ E;  2VY3 A;  1NY4 A;  1K3R A;  4LWC A;  1ET9 A;  3CC2 A;  2F0L A;  1FR3 A;  2HHH L;  1CA6 A;  4KY6 A;  5JEA H;  1ILP A;  2A19 A;  2EJM A;  3HOV G;  3R3O A;  3M85 A;  2F03 A;  2OF1 A;  3Q24 A;  2NUC A;  1HQM C;  5ELD A;  4LF5 Q;  3S1Q H;  1FYC A;  1Y1W G;  2CQA A;  1JCK B;  4CJ2 C;  2QDB A;  1B3A A;  1HQR D;  2PNH A;  1VQ7 A;  1JMC A;  3GD7 A;  4RGN A;  3SXH A;  5JJI A;  1B50 A;  2JJQ A;  3P7J A;  1JJ2 A;  1IL2 A;  2PI2 A;  4UHV A;  4RKB A;  3TP6 A;  1CHP D;  1NBW A;  2Z6K A;  4X66 Q;  2KCN A;  3BVZ A;  2C35 B;  1VDZ A;  2Z9H A;  5DAU A;  3PF5 A;  1HNX L;  4J8Q A;  3C1E A;  4KJN A;  3S1Q B;  5ISR A;  4PNY A;  4A3D H;  1S3O A;  3J81 L;  3ICE A;  2EYL A;  2F0K A;  2H1E A;  4IQZ A;  1KLU D;  1PZJ D;  4MHE A;  2UXC L;  4L5R C;  2K5D A;  1RJT A;  1D5X C;  1CKO A;  3I4N G;  1X54 A;  1C8C A;  4FXK C;  2JP1 A;  4GS3 A;  1RD9 D;  5E3F A;  4LJZ C;  3T16 A;  3VDY A;  1CTM A;  1KDA A;  4GLA C;  4A3D B;  1A15 A;  2Y0S E;  3BDO A;  1CA5 A;  1PVO A;  1K8A C;  3GTP H;  4L5S A;  2F0F A;  4Z9C B;  4L6T B;  1I4Q A;  4P71 A;  4PV1 C;  3AQQ A;  1JQY D;  5IGF A;  3K80 C;  4MNO A;  4K2K A;  4NB3 A;  1G2S A;  5BR8 Q;  3JAM E;  4CDE C;  1L2F A;  2AQ3 B;  1PTO D;  1S5F D;  1EY4 A;  3OTO Q;  3PUW A;  1VQ9 A;  1FGU A;  4DV6 Q;  4H13 C;  2F3W A;  3TQY A;  3L7Z C;  5D3I B;  4A3B G;  2XRQ D;  4JI6 Q;  3S16 H;  1OTC A;  2WB1 G;  3GTP B;  2GVA A;  5JJZ A;  5LL6 S;  4DAP A;  1Q12 A;  4HJ5 A;  2WB1 E;  2CKZ B;  1HHV A;  1O78 A;  2IWH A;  1XNR L;  2PYK A;  1YJN A;  2NN6 G;  4LF6 L;  4HED A;  4CHT B;  1PTO F;  3MXP A;  3NBH B;  1KAA A;  3RLN A;  4A3F H;  1X3G A;  4QGU A;  4NXN L;  4JI8 Q;  1NSN S;  1CHQ D;  3A56 A;  3VR5 A;  2J4X A;  4L5T A;  3S16 B;  2KEN A;  2LSS A;  4TVA B;  2DN8 A;  2VXW A;  1VMC A;  1EY7 A;  2B8G A;  2YTX A;  1PH1 A;  1PH5 A;  5C3E G;  3U58 A;  4BBR H;  4GN5 A;  2WII B;  3ND9 A;  4Y52 H;  2B2Y C;  5ELC A;  1BKB A;  5K36 G;  1EWC A;  2CH4 W;  4A3F B;  3BG3 A;  4HSV A;  4LUZ A;  1S40 A;  3E6Z X;  4GKJ Q;  1KXL A;  1SRU A;  1VQK A;  1VQJ A;  2MPM A;  1Z47 A;  4C3J H;  1LTI D;  3SVM A;  4O1N A;  4EQN A;  1SNP A;  5EKK A;  2MNA A;  4IUR A;  2JA5 H;  2HQL A;  2VUM H;  2DY8 A;  4WOR A;  1D7Q A;  2L12 A;  4BBR B;  2IL8 A;  2HQE A;  4PZ8 A;  4HIO A;  2J0T D;  2AUJ D;  3LX0 A;  2K50 A;  1II3 A;  1MJE A;  2KA7 A;  1VQD A;  1K3B C;  1EY0 A;  1XX8 A;  1V1Q A;  3H09 A;  2E2D C;  3NUC A;  1GUW A;  3RR5 A;  3E9I A;  4C3J B;  2DNC A;  2K5H A;  5JPN C;  1ENA A;  2JEB I;  3CKI B;  3IFD A;  1J6Q A;  3UDX A;  4DUZ L;  3DHQ A;  1VF5 C;  5D14 A;  1CKN B;  1KIX A;  2VUM B;  2JA5 B;  3SK4 A;  3A0J A;  2CWP A;  2JYO A;  1SSO A;  2B2W A;  4JI5 L;  3GO5 A;  3FKI G;  1Q82 C;  2F3V A;  1GUN A;  4UDU C;  1KL9 A;  4GLV B;  5JVG 3;  1IBL L;  1CQV A;  5AFW A;  2AUK A;  4UPA A;  3VYT A;  1FGB D;  2MO0 A;  3PO3 G;  4M8A A;  3H3V H;  1F9S A;  2CQO A;  1O80 A;  4NKL A;  1VQE A;  3E9H A;  4UP8 A;  4XYQ A;  4BS9 A;  1BBU A;  1EZ8 A;  4R4O A;  1STG A;  1MD2 D;  2Q2I A;  4R4T A;  1C48 A;  1SYB A;  3QJY A;  4MZ9 A;  3K8A A;  2E75 C;  2CFM A;  4OEL B;  4BA1 I;  3T1H Q;  4A3I G;  5GAE C;  4V19 0;  3HOZ H;  2OTJ A;  3FEW X;  3DLL A;  4JK1 C;  2D5D A;  2DUD A;  1NMG A;  3J81 E;  2K05 A;  2F4V L;  5IYB H;  1C9O A;  1L1O A;  2UXD L;  3ITP A;  2Z6K C;  2CW0 C;  1PH2 A;  3CCQ A;  3HOX H;  4RH6 A;  4AYB G;  3J80 L;  4RKL A;  5EPL A;  3AYH B;  3IKJ A;  4P75 A;  1C4Q A;  2XTI A;  5KRU A;  3K5L A;  5LMU L;  3OW2 A;  2UXB Q;  1JE5 A;  2RSO A;  4AYB E;  1L1O B;  4N9P A;  3M9B A;  1A6X A;  5IP7 G;  1O7L A;  5IYD H;  3HOZ B;  1Q46 A;  1FVI A;  3NEL A;  4XT3 B;  1IBK L;  1AZQ A;  3A8I E;  1SAP A;  3SK6 A;  1WCM G;  3KJP A;  2KEC A;  4H02 A;  5I2Y A;  1Y14 B;  1AP0 A;  5C6A A;  2EYJ A;  5JEA G;  4LAA A;  2L1B A;  3STB C;  3TP8 A;  2EXZ A;  3EQL C;  3I73 A;  3CP0 A;  4UY8 C;  5BN4 A;  2M00 A;  1JR0 D;  2OTL A;  3A5U A;  1K83 H;  3NSW A;  1S5E D;  5FO8 B;  1VQI A;  3G7L A;  2MO1 A;  4ZUI A;  1KRS A;  4IOC A;  3H94 A;  4X64 Q;  3J7A V;  1MKH A;  3RUZ A;  2F0G A;  1O7I A;  1Y8P B;  2KCT A;  5ELF A;  2D0P A;  3K7A H;  4DNT B;  5IE8 A;  1UE7 A;  4LNQ A;  4OX9 L;  2K01 A;  4LF5 L;  1JOK A;  3MTS A;  1S5C D;  1A3V A;  1QNU A;  4EQP A;  1BO0 A;  3JAM c;  4JYA L;  1K83 B;  4YHH L;  1HZB A;  5I4D A;  2XGT A;  2E2J H;  3M4O H;  4PMC A;  1CZW A;  5IYC H;  1U4L A;  1H9K A;  5E7N A;  1SND A;  4P74 A;  1MIU A;  2G5D A;  2WIN B;  4G57 A;  3EJI A;  3K7A B;  1VQ4 A;  4KHP L;  1QUQ A;  1EY9 A;  3F2U A;  3MWY W;  4F8M A;  1EYC A;  4DR4 L;  3BU2 A;  4RHS A;  3OOC A;  5C5L A;  1PFN A;  1XXG A;  2K6A A;  2R7D A;  1VQ6 A;  3GTK H;  3OIQ A;  1IBM L;  4K14 A;  1QG7 A;  3CPF A;  4X65 L;  1F77 A;  2E2J B;  3M4O B;  3CHB D;  5M3F H;  4CGY B;  1GKH A;  1RL2 A;  2Z4H A;  1H95 A;  3I7F A;  3NQI A;  4JI4 L;  4WFN 3;  3S15 H;  5K5P A;  3S2H H;  4HJ7 A;  2XNA C;  1N36 L;  5GQO A;  5JJK A;  3F2C A;  3CC4 A;  1J5E L;  4HJ8 A;  1GUS A;  2M9V A;  1PYB A;  4XYO A;  2OEO A;  5C4Z A;  1SJH D;  4OWX B;  1X9N A;  1Q1E A;  1EYA A;  3GTK B;  4HAE A;  3CCR A;  5DM7 3;  2ZTE A;  1PFB A;  4CDC C;  1SJE D;  5A35 A;  3E0J A;  2MUY A;  4RAU C;  2KHS A;  5M3F B;  3H6M A;  4KTA A;  5COY A;  1EQV A;  4OEM B;  1SE2 A;  1EYG A;  4IPC A;  1TWH H;  3WWV A;  2F1M A;  1L0X B;  4IJH A;  1QJO A;  1HA5 A;  3S15 B;  2RQX A;  3S2H B;  3K59 A;  1ENC A;  1BQQ T;  1ASY A;  4A3F G;  3URY A;  1HUN A;  4JI0 L;  5IIF A;  1DCZ A;  5I2X A;  1LAC A;  1TU2 B;  3HOW G;  1B9N A;  1BVS A;  4JI7 L;  3HOY H;  3BS1 A;  1PFM A;  2EQS A;  2B39 A;  4NP5 A;  3K5M A;  1Y8N B;  2ZTD A;  1WTP A;  3KOJ A;  1I94 L;  2B2W C;  1D5M C;  2Q8T A;  4DV3 L;  2F0I A;  2EPB A;  4BBR G;  1VQ5 A;  3AFP A;  4PMB A;  4H44 C;  4IUN A;  3CF5 A;  1GM5 A;  4N8X 1;  1KDC A;  4LFA Q;  4N8F A;  5TSS A;  2VW9 A;  4JI2 L;  4LF4 Q;  1HUM A;  2JA8 H;  4N9T A;  2PQE A;  2NVT H;  2A1A A;  2A68 D;  3X3M A;  2YU9 H;  1WYD A;  2RCF A;  4LK1 C;  4EQ5 A;  4B3M L;  4C3J G;  3HOY B;  3DEP A;  4ME5 A;  1E2V A;  1KQS A;  2K5V A;  1JWS D;  1KC8 C;  3I90 A;  4IZ8 A;  1F9R A;  3S1R H;  3A8K E;  5EKL A;  4DR7 Q;  4HTH A;  3FVQ A;  2JA5 G;  1QNK A;  2VB2 X;  1DJR D;  4FNF A;  3H3V C;  3BDC A;  4E6I A;  1QCB D;  2HCI A;  1F2M A;  1ML0 D;  1BBX C;  2CVR A;  3J80 E;  4KLK A;  4QCL A;  5E4X A;  2IX3 A;  2JA8 B;  4XQN A;  4DKA C;  2NVT B;  2YU9 B;  4C2M H;  4BWG B;  2XRS D;  1L1O C;  1V8Q A;  4BY7 H;  3KLS A;  5C44 G;  4A3L G;  5IGB A;  1TQO A;  1Y1V G;  5FO9 B;  2CW0 D;  2NZH A;  3S1R B;  5COR A;  5C0X J;  3J81 c;  2ZM6 L;  3ND8 A;  4LFB Q;  4OL7 A;  2H5X A;  1F2Z A;  4OON A;  2WP8 J;  4EX5 A;  2ICE C;  1CT1 D;  2Q8R E;  3UI2 A;  1VQO A;  2DNE A;  3FP9 A;  1KDB A;  1E1O A;  2BA1 A;  2R6G A;  2AHO B;  4C2M B;  4CJ1 B;  1KNA A;  4BY7 B;  1EEF D;  1IKM A;  1KHI A;  1LYL A;  4PZ6 A;  1HTL D;  3M4Q A;  4F88 A;  3PUY A;  3NTI A;  1M8A A;  4G4K A;  5BN3 A;  1PYW D;  1F2Y A;  3STB D;  1GO3 E;  2F0J A;  4X3U A;  1Q1B A;  2BH8 A;  1AFP A;  2VL6 A;  5C4X H;  4KKU A;  4B3R Q;  2F0U A;  3H91 A;  4FO2 A;  1F9P A;  1SNC A;  3HOZ G;  1VQM A;  3BVM A;  1LTB D;  2B2V A;  1K28 A;  2PMZ B;  2EOT A;  1DD2 A;  3PIP 3;  1FNU A;  1FJG L;  2RF4 A;  3B6Y A;  3PUZ A;  1JIC A;  2EY5 A;  1HNW L;  1BOS A;  4POF A;  5IOD A;  3HOX G;  4UP9 A;  5JPM C;  4OO1 H;  1KTK A;  3M4Y A;  4PQX A;  5C4X B;  2VQE L;  2NB0 A;  1K0R A;  4DR6 L;  1SE4 A;  5C3X A;  4C3H H;  2R92 G;  2JA6 H;  3CC7 A;  3V2T A;  5IYD G;  4JW0 A;  2O4X A;  3K81 C;  3HOU H;  4QIW E;  2R61 A;  1DOM A;  1QE6 A;  1A3T A;  2O2L D;  2PO4 A;  4KD4 A;  4C3I H;  3KFU A;  4DV0 L;  4BXX H;  5G3L F;  3W5O A;  2K14 A;  3F2B A;  1VQC A;  2B2U A;  1CKM A;  1STE A;  2UUB Q;  4YY3 Q;  3C1F A;  4QB4 A;  2I5M X;  3TZD A;  1MJC A;  2XN9 C;  4A3E H;  2UUC L;  4FDB A;  3Q8D A;  4C3H B;  2JA6 B;  1QZG A;  2VNU D;  5D65 A;  4ZKB B;  3HOU B;  2A74 C;  2A69 C;  3SEB A;  3BYY B;  1ENF A;  3KF6 A;  2DJG C;  3TZU A;  3L3O C;  1B7Y B;  5I9O A;  4C3I B;  2KOL A;  4X6A H;  4RGO S;  4CKB A;  4EVO A;  1KRT A;  1TY0 A;  4OO1 I;  1SEB D;  3S9W A;  1PH7 A;  4HCS A;  3WOF A;  1PV4 A;  1EY5 A;  3KF6 B;  3OIP A;  4J15 A;  4DGZ A;  4DR1 L;  3ERQ A;  4A3E B;  5KNB A;  3J7Z C;  1D5Z C;  5LMN Q;  4IUU A;  4LF9 L;  4DAM A;  1KAW A;  2JQO A;  3E3X A;  5IYC G;  3CW2 C;  4HJ9 A;  5FO7 B;  4DV7 L;  1BNZ A;  3PUX A;  4C56 C;  5IY0 A;  3KK7 A;  4ZYS A;  2HDM A;  4Q5V A;  1A0I A;  2TMP A;  4JI3 L;  2BDN A;  1AEX A;  4RHR A;  3OPO A;  1XPR A;  4A3J H;  4ZCK A;  1VF7 A;  3CAM A;  1C7Y A;  1WTH A;  2PCF B;  3R2T A;  5M3F G;  2HDL A;  3V05 A;  1VQL A;  4PG3 A;  3IFT A;  2EJF C;  2ZT9 C;  3GV6 A;  3H0G G;  3HGB A;  1ASZ A;  3EFX D;  2SOB A;  3D4D A;  3KBG A;  3QIA A;  4C1N K;  2YTY A;  2A6H C;  4XQJ A;  1ILQ A;  3DXJ C;  1SBB B;  4L63 B;  4P2C B;  3D31 A;  3N6R A;  3WDN A;  1I5F A;  5KND A;  3HRZ C;  2VS1 A;  4BY1 H;  3ONA B;  4A3J B;  3ER0 A;  4DV4 Q;  5FLM H;  1IYJ B;  4A3G H;  3ERS X;  2JN4 A;  4V0B A;  1N33 L;  1JC7 A;  1MGS A;  1W3S A;  1K8O A;  3I70 A;  2JA9 A;  2KCC A;  2IX0 A;  1K8M A;  3I2Z A;  1SFO H;  4B3S Q;  2E2I H;  4HIK A;  1SNM A;  1PRT B;  1XJV A;  4BY1 B;  3J80 c;  3TEH B;  3SHL A;  1EOT A;  2K4K A;  2PZW A;  1WVL A;  1UWV A;  4DAV A;  4ZUJ A;  4IFD H;  2JSO A;  3EIV A;  5T1G A;  4A3G B;  3CU7 A;  1LLR D;  4ID6 A;  2ID0 A;  5CGK A;  3K0X A;  2JEA I;  5JVH 3;  2KHI A;  1HZC A;  1D8L A;  4DPG A;  1HNZ L;  3CCJ A;  1G6P A;  5LMN W;  1SFO B;  2Z6B A;  2E2I B;  1H9M A;  2D62 A;  1RDP D;  2PQA A;  2R7F A;  3TP5 A;  1K9M C;  2UUA L;  2JA8 G;  3WOE A;  1DGS A;  5EPJ A;  3UDG A;  4O42 A;  1GUT A;  1EQQ A;  2CHB D;  4KK7 A;  1QIL A;  4J1M A;  1EWI A;  5A2Q L;  1M90 C;  4QMG A;  1K0S A;  3RZD H;  2E74 C;  1SR3 A;  3G4S A;  2PQA B;  1X3Q A;  1HR0 Q;  4DV5 Q;  4IO9 A;  4LF8 Q;  2BA0 A;  1SDF A;  1XYI A;  2NYZ D;  4ULL A;  1Q3L A;  4X62 Q;  1N34 L;  4DR5 L;  4AQY L;  4NXM Q;  3RMH A;  3IAY A;  2HCC A;  3ZJY C;  2KED A;  4K6D A;  4DN4 M;  1SYE A;  4KKS A;  2B2V C;  2D0O A;  4S3S A;  3V96 A;  4KY7 A;  4DR3 Q;  2F0P A;  1MSH A;  3GP7 A;  4LUV A;  5CBE E;  4IPD A;  3DWP A;  4IFD I;  1FNV A;  4DV1 Q;  3RZD B;  2RKS A;  3K0Y A;  4DK3 C;  2FIN B;  3BZD B;  3TME A;  2ZTC A;  5CV7 A;  3TRE A;  2VQF Q;  2R7Z H;  5LL6 X;  2G9D A;  2ICI A;  1TS2 A;  5DM6 3;  4XXE A;  3A5Z B;  3CMA A;  4O2D A;  2JA7 H;  2RDF A;  5IT9 L;  3EA6 A;  3JAM i;  1WI5 A;  4HJA A;  5JJL A;  3S24 A;  3KLW A;  4DXF A;  5JEA J;  5DNF A;  4IJL A;  2R93 H;  2F0S A;  1V1P A;  4KKT A;  4GNX A;  4MIU A;  1WD0 A;  1H9J A;  4JV5 Q;  2R7Z B;  4U68 A;  4LF7 Q;  1HJP A;  3FPP A;  4FXG C;  2V4D A;  1EEI D;  5AJ3 Q;  2LKV A;  3CCS A;  4GNX B;  4J6H A;  1B1Z A;  4AIM A;  3DM3 A;  2JA7 B;  2K5N A;  2A69 D;  4DUY L;  1YNX A;  3VR2 A;  2OT2 A;  1D1K A;  4DV2 Q;  2BCO A;  2F0N A;  4DNR B;  2A68 C;  3PV0 A;  3UE1 A;  1CM9 A;  1EL0 A;  4A75 A;  1SE8 A;  1XPU A;  2R93 B;  1QVC A;  2R3Z A;  1LT6 D;  1JE4 A;  4GKK L;  4OO1 G;  3D8G A;  1BDO A;  1P8L A;  2K5W A;  1PH6 A;  3N52 A;  3SK5 A;  2NBF A;  4I7Z C;  2KEE A;  2UU9 Q;  4C3H G;  4JC0 A;  2K28 A;  1E7Z A;  2WAQ B;  1LT3 D;  1Q7Y C;  1SYF A;  3U50 C;  5EPK A;  1HR0 W;  1XMQ L;  1PMR A;  4H0L C;  3PO2 H;  4B3T Q;  2LFN A;  4I7A A;  3T1Y Q;  1TVX A;  5ELN A;  4BXX G;  1TKW B;  4OIJ A;  3TBI B;  4OXP A;  3KJO A;  1RKN A;  3VR4 A;  1S72 A;  1Z6H A;  2RDG A;  3I3C A;  3AFQ A;  4A3E G;  1YI2 A;  3VA7 A;  4WJ3 M;  2A73 B;  2IY5 B;  3MFG A;  1CZG A;  4A3C G;  2I07 B;  5J39 A;  3QOJ A;  1NAP A;  4FYD A;  3PO2 B;  3LWE A;  3H3V I;  4JI1 L;  2IT1 A;  2E8G A;  1XMO L;  3CCV A;  4BBS H;  5F2D A;  3DMU A;  2K1B A;  2A6H D;  1STB A;  5GAG C;  1IYU A;  2L4N A;  2IPK D;  3VA5 A;  4POG A;  2Q2T A;  2E5L L;  5IWA L;  1N8R C;  3NWT A;  1I4R A;  2KHJ A;  3G71 A;  1N32 Q;  4HN7 A;  5D3D A;  5DLQ E;  2RA4 A;  1ZXT A;  1X6O A;  1WTQ A;  2B3G A;  1XNQ L;  4LFC L;  2C9O A;  1B4O A;  1PRT C;  2RDH A;  5GAD C;  1X55 A;  1EU4 A;  1T5X D;  4APV A;  4R8I A;  4DR2 Q;  1PH8 A;  5JAV A;  4FXD A;  2NVY H;  4BBS B;  3CCU A;  3IRB A;  1RTO A;  3O13 A;  3ULL A;  5C0X H;  1DOK A;  2HHH Q;  3E0E A;  1ZEQ X;  4CKC A;  5CV9 A;  1I4H A;  4A3J G;  2ZJQ A;  1BF4 A;  4K6L A;  4A3D G;  2WFW A;  5IGG A;  3GV3 A;  1LV9 A;  2F0H A;  1DZ1 A;  3FHW A;  2JXM B;  2KBN A;  5A2Q E;  4X66 L;  1UUP A;  1YZ6 A;  2NVY B;  4JBJ A;  3IL8 A;  4ODG A;  1U5K A;  1YBY A;  1STN A;  1JOQ A;  3HOV H;  3MZ5 A;  3AB9 A;  3QOL A;  1LTL A;  4RA8 A;  2K33 A;  4JOI A;  5CBA E;  2AKW B;  2GN5 A;  2YYZ A;  1HNX Q;  4TSS A;  3NHH A;  1QUQ B;  3D3R A;  2ZXR A;  3HKZ B;  5GRO A;  2I5L X;  4A3G G;  3R93 A;  1AW7 A;  2DGY A;  1E1T A;  2WKC A;  3P20 A;  3OMC A;  1YVC A;  5EGT A;  3OW7 A;  1GHK A;  3I4L A;  2UXC Q;  2F0E A;  4YCU A;  2QEJ C;  3HOV B;  3W1G A;  4FF3 A;  4K5W A;  3NE5 B;  1OXV A;  2F0T A;  1XWE A;  2PPB C;  3RN2 A;  4IPG A;  1J8I A;  3PUV A;  3HZX A;  5IT9 E;  3AU7 A;  2X6L A;  4IFD G;  4RFB A;  2TSS A;  3RD4 A;  3BDL A;  1GXD C;  4O0A A;  3MHB A;  4DNI A;  4B3S L;  4RGT A;  1LTG D;  1EUJ A;  5BR8 L;  4YCW A;  5HY6 A;  1ET6 A;  5CR3 A;  3I4N H;  3OTO L;  5HGT A;  4DV6 L;  3GQB A;  4KN7 C;  1I3Q H;  1XTC D;  1IW7 D;  3OYY A;  3MA2 B;  4HIM A;  4JI6 L;  2NVQ H;  4DAY A;  1NMF A;  4GOP A;  4GNX C;  1IZ6 A;  2RSN A;  5IGE A;  2F3I A;  2XWB B;  1YHQ A;  4K2L A;  3H15 A;  1E3P A;  3QWN A;  4GOP B;  3UE0 A;  3A54 A;  3I4N B;  3S1N H;  1HRJ A;  4R8N A;  1EIY B;  1XNR Q;  1I3Q B;  1VMP A;  4LF6 Q;  1S5B D;  2L5T A;  4JI8 L;  2Y0S B;  4WRD A;  4G7H C;  3VR3 A;  3J81 j;  4QUC A;  2NVQ B;  1Q8I A;  4GLX A;  1TS3 A;  3FDT A;  5J3B A;  4TQU S;  3ULJ A;  1NNX A;  3EBE A;  4OGQ C;  4NXN Q;  2O5J C;  3U4V A;  2LXJ A;  2VUM G;  1G2T A;  1CSQ A;  4U67 3;  2EY1 A;  2R7Z G;  4XDX A;  5I6W A;  2IX1 A;  2NN6 H;  5T1I A;  1BR9 A;  3S1N B;  3W2D A;  1F9Q A;  4LW1 A;  4GKJ L;  1JWU D;  4ILW A;  2EIF A;  4A76 A;  2JA7 G;  3S2D H;  4EQO A;  1ZYR C;  2I46 A;  2WB1 B;  1PZK D;  1SE3 A;  3GTO H;  4HMJ A;  1B53 A;  2LS0 1;  2R93 G;  4IN3 A;  2KUM A;  2XWJ B;  5EKI A;  2L0C A;  1X3P A;  1GHJ A;  2FHT A;  4DA2 A;  2XSC A;  3D4W A;  4I65 A;  1FL0 A;  2B63 H;  3LWU A;  3J7Y W;  5K36 H;  4A3K H;  1Q86 C;  1Y8O B;  2N55 A;  1RIP A;  1YJ9 A;  3T51 B;  3K57 A;  1TWG H;  2WAQ G;  3S2D B;  4F87 A;  2V1C C;  3RLO A;  3GTO B;  3KDF A;  2NZ1 D;  3DM1 A;  4HID A;  3GTQ H;  1A62 A;  2N78 A;  4DUZ Q;  2D2C C;  4ZK9 B;  3QG1 A;  4JCV E;  4R4Q A;  1CK1 A;  1UE1 A;  1A63 A;  2B63 B;  5C5M A;  4A3K B;  4KN4 C;  1JOR A;  1U4R A;  2FJ2 A;  1L0Y B;  1MI2 A;  1TWG B;  4KHV A;  3NXW A;  3CME A;  1JOO A;  1PRT D;  1LTR D;  2EE1 A;  1WD1 A;  1N9W A;  1CFM A;  1IBL Q;  2I5H A;  1H9R A;  2EXD A;  2RBM A;  5IYB G;  2P5Z X;  3GTQ B;  3OSO A;  5G3L D;  4ME3 A;  3CXC A;  3Q6S A;  1PA6 A;  1W6K A;  2AQ1 B;  2K03 A;  1AN8 A;  3T1H L;  5M5W H;  2F0M A;  5CC4 A;  1HA6 A;  1A3U A;  2B2Y A;  2EJG C;  1RF2 D;  1TY2 A;  2YV5 A;  4G7O C;  3AEV A;  1PZI D;  3J80 i;  1TWF H;  4GN3 B;  1VQB A;  2BH2 A;  1PRT F;  4XQQ A;  1TT2 A;  1HH2 P;  3I4M H;  1LO5 D;  1GD7 A;  4OHJ A;  4CDF C;  4CKE A;  2F0O A;  1SNO A;  4Y7N H;  2X6G A;  2CCZ A;  3LNN A;  4BBS G;  2F4V Q;  1UAP A;  4JOI C;  2UXB L;  2UXD Q;  1PXU A;  1NE3 A;  5L37 A;  3RN5 A;  2LXK A;  5M5W B;  3A7A B;  2Z0S A;  5LMU Q;  1SXT A;  4KMU C;  1QVG A;  3EVQ A;  1V1O A;  1TWF B;  1X56 A;  4GZY C;  4KD3 A;  4CJ0 B;  3I4M B;  2FXQ A;  2PW7 A;  3KLR A;  4FP5 D;  1B70 B;  2N88 A;  1BCP D;  1PDQ A;  4WJW A;  4Y7N B;  1IBK Q;  1IKL A;  3DWA A;  4HSP A;  3MXN A;  1SYD A;  4ZRZ A;  3VR6 A;  3A55 A;  1E2Z A;  1JJG A;  5CYU A;  2HUG A;  1A2T A;  4YWL A;  3CQZ H;  4WJ4 A;  4X64 L;  2H4O A;  4OWT B;  1TII D;  3G6J B;  2EYH A;  4EGV A;  1WCM H;  1VQH A;  3CRK C;  3SGI A;  3CCM A;  2ATW A;  5IT9 c;  4Q0F A;  1BCP F;  4B9W A;  5FOB B;  5I6Y A;  5C3W A;  1GJX A;  4AYB B;  4JVZ A;  1AH9 A;  2F4I A;  4ALP A;  4RG1 A;  3F2D A;  4DXG A;  2HD3 A;  4OX9 Q;  2L55 A;  1W6J A;  3NK9 A;  2EDG A;  1W2B A;  2JK8 A;  2F0D A;  2FMM A;  4GOP C;  1S4Z A;  3CQZ B;  3DUZ A;  1KAB A;  2QA4 A;  4XT1 B;  1DXM A;  1TS5 A;  2AWN A;  5IP9 H;  1ICF B;  4JYA Q;  1WCM B;  4YHH Q;  3S14 H;  2PZT A;  2OQK A;  3D6W A;  1G6Z A;  1Z9F A;  3T53 B;  1DYQ A;  4HCE A;  4QY7 A;  1V9P A;  4KHP Q;  1U4M A;  2JE6 I;  1EY6 A;  2HIV A;  3MVV A;  3W3A A;  2WKD A;  2IHF A;  4DR4 Q;  2ZXO A;  4FVM A;  2VZA A;  4K0K Q;  3G48 A;  1BXT A;  1YNN C;  3Q0A A;  3G6E A;  1WFQ A;  4XTC S;  2SNS A;  1IBM Q;  1DOL A;  2OCE A;  3S14 B;  4X65 Q;  2VB3 X;  4FF1 A;  3PCO B;  5C4H A;  2KJX A;  2I0Q A;  1IXR A;  1E0B A;  5KEE A;  5ELO A;  3T13 A;  2L15 A;  1IYV A;  3TS0 A;  4JI4 Q;  1HXY D;  2E76 C;  1D1I A;  2GVB A;  1N36 Q;  2Y0S G;  2ZXP A;  1J5E Q;  1ZYR D;  1HFN A;  5M3M H;  2Z8L A;  2MQH A;  3D6C A;  3F1Z A;  4F7X A;  3FRP B;  3K5N A;  2OQ0 A;  3HOY G;  1GOZ A;  1SRO A;  5EBC A;  2WAC A;  3ULP A;  1SN8 A;  1SYG A;  1FD7 D;  3E5S A;  4PMW A;  1OXX K;  1M1K C;  3GTL H;  1OO9 B;  3TS2 A;  1RCV D;  2OWO A;  1XPO A;  5CV8 A;  1HPC A;  2RHS B;  1TS4 A;  3I91 A;  5FKA C;  5M3M B;  1D2B A;  4JI0 Q;  3MFY A;  4RMF A;  2AQ2 B;  2KCM A;  3NBH A;  4JI7 Q;  4UP7 A;  4RCN A;  3U9S A;  1UEB A;  1VQ8 A;  4BA2 I;  1AE2 A;  2XVS A;  1X3F A;  3GTL B;  1I94 Q;  1SYC A;  1SMY D;  3NBI A;  2EYM A;  4HMI A;  3QO2 A;  4DV3 Q;  1I6H H;  4LFA L;  4LF4 L;  1JWM D;  2C5C A;  1TWC H;  1NUC A;  5EJW A;  5FLX L;  1VQP A;  1G91 A;  3HP3 A;  1EU3 A;  2NTT A;  3HOW H;  5EQ0 A;  5CV4 A;  1IHZ A;  2DJF C;  4JI2 Q;  3CRL C;  2PZU A;  1BCP B;  4DR7 L;  1MBY A;  1R4P B;  5E1F A;  4DK6 C;  1XTD A;  3BYT B;  4BY7 G;  5J22 A;  2NTS A;  2FMC A;  4B3M Q;  4ABN A;  1QB5 D;  1LTA D;  1DM0 B;  1UE6 A;  1PHJ A;  2F0Q A;  3ZYY X;  2B63 G;  4FF4 A;  4IAL A;  3A8J E;  3VYR A;  1CQF A;  1I6H B;  4A3K G;  1X32 A;  1TWC B;  3UDI A;  2A5H A;  2MGS A;  4JBW A;  4B08 A;  3M7N A;  1IW7 C;  3HOW B;  1PH9 A;  3CD6 A;  1HCZ A;  3L9A X;  1X3E A;  3F8T A;  4P73 A;  3U9O A;  5FJ8 H;  3MC0 B;  4AH6 A;  4ZKC B;  2PW5 A;  5BN5 A;  4LFB L;  4H7B A;  3TN2 A;  2N49 A;  2B2U C;  1LUZ A;  2PMZ E;  1GUO A;  1Y69 U;  1H9S A;  2NVX H;  4R4I A;  3S1M H;  1LM0 A;  2B2T A;  2ZM6 Q;  5C4X G;  3I4O A;  4NW2 A;  2F0W A;  2A8V A;  1CKN A;  3FMC A;  1V1P B;  4A3M H;  1H9S B;  5KIX A;  2SDF A;  4NDX A;  4DK1 A;  3J7A 5;  5C44 H;  5IOC A;  1A8V A;  4KI0 A;  4A3L H;  1Y1V H;  3PMF A;  3L0O A;  1EFI D;  3PSI A;  3PIP A;  2EY2 A;  4DV7 Q;  2NVX B;  4B3R L;  4K5X A;  3S1M B;  3PIO 3;  1B8A A;  4FF2 A;  1NR2 A;  1I4G A;  1HZA A;  5HUR A;  2Q8I B;  1R9T H;  3UDF A;  1STH A;  5DEH A;  3D0F A;  4A3M B;  1NJI C;  2JA6 G;  1STA A;  2J7Z A;  3QR8 A;  3HOU G;  3I4M G;  3CCE A;  3I56 A;  4NPS A;  5C44 B;  4MN3 A;  1Y1V B;  4C3I G;  1Z7T A;  2EY6 A;  2QDL A;  1KD1 C;  1FJG Q;  2L9H A;  1PTO H;  3BVG A;  1EZ6 A;  4JBK A;  3CPW A;  3TRZ A;  1HNW Q;  2Q2H A;  1L0W A;  3K6O A;  1EYD A;  2N3S A;  3NP8 A;  1R9T B;  1CI3 M;  1LAB A;  3HS0 C;  3MXU A;  5GAH C;  2VQE Q;  4A93 H;  1HFG A;  2LMC B;  4DR6 Q;  4OWW B;  2EYF A;  2BOS A;  5KGU A;  1G29 1;  1F2L A;  1OXS C;  1Q8K A;  3OMG A;  3K5O A;  4YIJ A;  3T56 B;  2FFK B;  4CDD C;  1RHP A;  2BE5 C;  2UUB L;  4YY3 L;  5E4W C;  1EOV A;  3PGZ A;  3RLF A;  1PTO B;  3QB3 A;  2WV6 D;  4DV0 Q;  3KYH C;  1OXT A;  2DY7 A;  1WTR A;  3L2P A;  2K5Q A;  2ZJR A;  1VS0 A;  3HEJ A;  2R92 H;  1T9H A;  1YNN D;  4IFD J;  2Q2U A;  3OWE B;  4A93 B;  2UUC Q;  2Z1C A;  1JT8 A;  2YTV A;  1PH4 A;  3PF4 A;  3SK8 A;  1JB3 A;  3S17 H;  3M3Y H;  3EN2 A;  2PI2 E;  2CH4 A;  4K5V A;  2HIX A;  3HOX B;  2NWG A;  4PZ7 A;  2RHQ B;  3MEH A;  1JJC B;  5LMN L;  1WTV A;  3JC6 6;  3M7G A;  4QL5 A;  5LHY 1;  4DK0 A;  1A2U A;  2R92 B;  4RCO A;  4QIW B;  4IUP A;  5IGC A;  1U4P A;  1ICW A;  4IPH A;  4DR1 Q;  5C4J H;  1EIF A;  4JPB W;  2X69 A;  2ES2 A;  4RGM A;  3PQI A;  5IP9 G;  4LF9 Q;  3C46 A;  5IGD A;  3S17 B;  3M3Y B;  2SEB D;  2IJ0 A;  3NWS A;  3BJU A;  2N8N A;  3NQT A;  1YJW A;  3MXG A;  3J81 i; 
#chains in the Genus database with same CATH homology
 1UEA B;  2A6E C;  1MSG A;  1ESR A;  3T4A C;  3I72 A;  2O5I C;  2GA4 B;  3KLS X;  4HR7 B;  1IL8 A;  4QUF A;  5C4J B;  3OHX C;  5FLX E;  3D4R A;  2EVB A;  5I9P A;  4C1N I;  3KBX A;  1BCP C;  5C0X I;  1YNJ C;  1ONL A;  1RTN A;  3A7L A;  2K32 A;  2LY7 A;  1Y1W B;  1EY8 A;  2ENB A;  3VYS A;  2Z4I A;  5EBD A;  1LT5 D;  2F0V A;  1WTX A;  4ZLT F;  2G9H D;  1G8Z D;  3HG9 A;  1EQT A;  1I4P A;  1I50 B;  1FNW A;  3GTM B;  1NR4 A;  1ZKO A;  4CBV A;  4IUQ A;  5CV6 A;  1LTS D;  3NTK A;  1E2W A;  3H0G B;  2B2T C;  3NPP A;  3MAQ A;  4XIG S;  3R2I A;  1LT4 D;  2OXP A;  3TSS A;  3NTH A;  4ZQ3 A;  4TRD A;  3OWF A;  1S5D D;  1DON A;  3FPU B;  2MP1 A;  4RWS C;  3P1H A;  1TWH B;  1T5E A;  3K58 A;  3DEO A;  4IUT A;  1M4V A;  2MJ8 A;  2SNM A;  3X3N A;  4UAI A;  3GTJ B;  4IUV A;  2XIW A;  3C3L A;  1Q90 A;  3I8Z A;  4A3B B;  5KYI A;  2QCP X;  3KUP A;  1ROD A;  1STY A;  3RZO B;  1UNS A;  4KHZ A;  1GUG A;  2E2H B;  1KLG D;  4TKO B;  1B44 D;  5J1Z A;  5JOB A;  4X3T A;  2PNR C;  2BDO A;  1PTO C;  5CV5 A;  4LMQ D;  2M2L A;  1I6V C;  2AWO A;  4G7Z C;  5ELE A;  2K04 A;  1SNQ A;  2BE5 D;  2KVM A;  4B9X A;  4K8J A;  4DFA A;  5C3E B;  3JAM L;  3ERO A;  2NN6 I;  1SMY C;  3SE0 A;  1J9O A;  4R9W A;  1U9R A;  4QF4 A;  1TR5 A;  5KNC A;  1TWA B;  1B2T A;  1OXU A;  5KYL A;  5M9O A;  1QWY A;  1WTO A;  3TP7 A;  4K8I A;  1EIG A;  1QOH A;  1V43 A;  2IW3 A;  1D6E C;  3AMU A;  4OIK A;  2D9U A;  1LTT D;  1EIH A;  3R8B A;  3TDQ A;  3Q22 A;  5NUC A;  4X3K A;  4KJO A;  2A6E D;  1HTP A;  2EYO A;  2L11 A;  5ELB A;  5M5Y B;  3FKI B;  1O7Z A;  3J7A F;  1O7Y A;  2QIL A;  4DF7 A;  3SR1 A;  3DWQ A;  3KF8 A;  3PO3 B;  1VCI A;  5FK9 C;  2EZV A;  1EWH A;  1ESF A;  1BUV T;  4KV6 A;  4DU9 A;  1I4X A;  2RVL A;  2B8F A;  3C2P A;  1B9M A;  2KQ3 A;  2EYP A;  1WTW A;  3VYU A;  4L8J A;  2MHV A;  5C0X G;  5M5X B;  1YNJ D;  3GTG B;  4NMZ A;  1AZP A;  4M1U B;  2QKI C;  4X3S A;  4ZAI A;  3P75 A;  3Q23 A;  4A3I B;  2QF7 A;  3SDZ A;  1NCV A;  1KNE A;  1PLF A;  4KY5 A;  1R4Q B;  2K7V A;  5CMD A;  1ET9 A;  2F0L A;  1FR3 A;  1CA6 A;  4KY6 A;  5JEA H;  1ILP A;  2EJM A;  3R3O A;  3M85 A;  2F03 A;  2OF1 A;  3Q24 A;  2NUC A;  1HQM C;  5ELD A;  1FYC A;  2CQA A;  1JCK B;  4CJ2 C;  2QDB A;  1B3A A;  1HQR D;  3GD7 A;  4RGN A;  3SXH A;  1B50 A;  3P7J A;  4RKB A;  3TP6 A;  1CHP D;  2KCN A;  3BVZ A;  1VDZ A;  5DAU A;  4J8Q A;  3C1E A;  4KJN A;  3S1Q B;  5ISR A;  4PNY A;  3J81 L;  2EYL A;  2F0K A;  2H1E A;  4IQZ A;  1KLU D;  1PZJ D;  4MHE A;  2K5D A;  1RJT A;  1D5X C;  1C8C A;  4FXK C;  2JP1 A;  1RD9 D;  5E3F A;  4LJZ C;  3T16 A;  1CTM A;  1KDA A;  4A3D B;  1A15 A;  1CA5 A;  3BDO A;  2F0F A;  4Z9C B;  4L6T B;  1I4Q A;  4PV1 C;  1JQY D;  5IGF A;  4K2K A;  1G2S A;  3JAM E;  2AQ3 B;  1PTO D;  1S5F D;  1EY4 A;  3PUW A;  4H13 C;  2F3W A;  3L7Z C;  5D3I B;  2XRQ D;  3GTP B;  5JJZ A;  5LL6 S;  4DAP A;  1Q12 A;  1HHV A;  1O78 A;  2IWH A;  2PYK A;  2NN6 G;  4HED A;  4CHT B;  1PTO F;  3MXP A;  1KAA A;  1NSN S;  1CHQ D;  3A56 A;  3VR5 A;  2J4X A;  3S16 B;  2DN8 A;  2VXW A;  1VMC A;  1EY7 A;  2B8G A;  2WII B;  3ND9 A;  2B2Y C;  5ELC A;  5K36 G;  1EWC A;  4A3F B;  3BG3 A;  4HSV A;  3E6Z X;  2MPM A;  1Z47 A;  1LTI D;  3SVM A;  4O1N A;  4EQN A;  1SNP A;  5EKK A;  4IUR A;  2DY8 A;  4WOR A;  2L12 A;  4BBR B;  2IL8 A;  2HQE A;  2J0T D;  2AUJ D;  3LX0 A;  1II3 A;  2KA7 A;  1EY0 A;  1XX8 A;  3H09 A;  2E2D C;  3NUC A;  1GUW A;  4C3J B;  2DNC A;  5JPN C;  1ENA A;  2JEB I;  3CKI B;  3IFD A;  3DHQ A;  1VF5 C;  5D14 A;  2VUM B;  2JA5 B;  3SK4 A;  2JYO A;  1SSO A;  2B2W A;  3GO5 A;  2F3V A;  1GUN A;  4UDU C;  5JVG 3;  1CQV A;  5AFW A;  2AUK A;  3VYT A;  1FGB D;  4M8A A;  1F9S A;  1O80 A;  4NKL A;  4XYQ A;  4BS9 A;  1EZ8 A;  1STG A;  1MD2 D;  1C48 A;  1SYB A;  3QJY A;  2E75 C;  4BA1 I;  4V19 0;  3FEW X;  4JK1 C;  2D5D A;  3J81 E;  2K05 A;  3ITP A;  2CW0 C;  4RH6 A;  3J80 L;  4RKL A;  5EPL A;  3IKJ A;  5KRU A;  1C4Q A;  3K5L A;  2RSO A;  4N9P A;  1A6X A;  1O7L A;  3HOZ B;  4XT3 B;  1AZQ A;  3A8I E;  1SAP A;  3SK6 A;  2KEC A;  5I2Y A;  1AP0 A;  5C6A A;  2EYJ A;  5JEA G;  4LAA A;  2L1B A;  3TP8 A;  2EXZ A;  3EQL C;  3I73 A;  5BN4 A;  2M00 A;  1JR0 D;  3NSW A;  1S5E D;  5FO8 B;  3G7L A;  4ZUI A;  3H94 A;  3J7A V;  3RUZ A;  2F0G A;  1Y8P B;  5ELF A;  4DNT B;  2K01 A;  1JOK A;  3MTS A;  1S5C D;  1A3V A;  4EQP A;  1QNU A;  1BO0 A;  1K83 B;  5I4D A;  4PMC A;  1CZW A;  1U4L A;  1H9K A;  1SND A;  2WIN B;  4G57 A;  3EJI A;  3K7A B;  1EY9 A;  3F2U A;  3MWY W;  4F8M A;  1EYC A;  4RHS A;  3OOC A;  5C5L A;  1PFN A;  1XXG A;  2K6A A;  3OIQ A;  4K14 A;  1QG7 A;  1F77 A;  2E2J B;  3M4O B;  3CHB D;  4CGY B;  2Z4H A;  3NQI A;  4WFN 3;  5K5P A;  2XNA C;  1GUS A;  2M9V A;  4XYO A;  2OEO A;  5C4Z A;  1SJH D;  1Q1E A;  1EYA A;  3GTK B;  4HAE A;  5DM7 3;  1PFB A;  1SJE D;  5A35 A;  3E0J A;  2MUY A;  4RAU C;  2KHS A;  5M3F B;  3H6M A;  4KTA A;  5COY A;  1EQV A;  1SE2 A;  2F1M A;  1L0X B;  1QJO A;  1HA5 A;  3S15 B;  2RQX A;  3S2H B;  3K59 A;  1ENC A;  1BQQ T;  3URY A;  1HUN A;  5IIF A;  1DCZ A;  5I2X A;  1LAC A;  1TU2 B;  1B9N A;  3BS1 A;  1PFM A;  2B39 A;  4NP5 A;  3K5M A;  1Y8N B;  1WTP A;  2B2W C;  1D5M C;  2Q8T A;  2F0I A;  2EPB A;  4PMB A;  4H44 C;  4IUN A;  1KDC A;  5TSS A;  1HUM A;  4N9T A;  2PQE A;  2A68 D;  3X3M A;  4LK1 C;  3HOY B;  4C3J G;  3DEP A;  4ME5 A;  1E2V A;  1JWS D;  3I90 A;  4IZ8 A;  1F9R A;  3A8K E;  5EKL A;  4HTH A;  3FVQ A;  1QNK A;  2VB2 X;  1DJR D;  4FNF A;  3H3V C;  3BDC A;  4E6I A;  1QCB D;  2HCI A;  1F2M A;  1ML0 D;  1BBX C;  2CVR A;  3J80 E;  4QCL A;  5E4X A;  2IX3 A;  2JA8 B;  4XQN A;  2NVT B;  2YU9 B;  4BWG B;  2XRS D;  1V8Q A;  3KLS A;  5IGB A;  5FO9 B;  1TQO A;  2CW0 D;  3S1R B;  5COR A;  5C0X J;  3ND8 A;  4OL7 A;  1F2Z A;  2WP8 J;  2ICE C;  1CT1 D;  2Q8R E;  3UI2 A;  2DNE A;  1KDB A;  2BA1 A;  2R6G A;  4C2M B;  4CJ1 B;  1KNA A;  4BY7 B;  1EEF D;  1IKM A;  1HTL D;  4F88 A;  3PUY A;  3NTI A;  1M8A A;  4G4K A;  5BN3 A;  1PYW D;  1F2Y A;  2F0J A;  4X3U A;  1Q1B A;  1AFP A;  4KKU A;  2F0U A;  3H91 A;  4FO2 A;  1F9P A;  1SNC A;  3BVM A;  1LTB D;  2B2V A;  2PMZ B;  2EOT A;  1DD2 A;  3PIP 3;  1FNU A;  3PUZ A;  1JIC A;  2EY5 A;  1BOS A;  5IOD A;  5JPM C;  4OO1 H;  1KTK A;  3M4Y A;  4PQX A;  5C4X B;  2NB0 A;  1SE4 A;  5C3X A;  3V2T A;  2O4X A;  2R61 A;  1DOM A;  1QE6 A;  1A3T A;  2O2L D;  2PO4 A;  4KD4 A;  5G3L F;  2B2U A;  1STE A;  3C1F A;  4QB4 A;  3TZD A;  2XN9 C;  4C3H B;  2JA6 B;  2VNU D;  5D65 A;  4ZKB B;  3HOU B;  2A74 C;  2A69 C;  3SEB A;  3BYY B;  1ENF A;  3TZU A;  3L3O C;  5I9O A;  4C3I B;  2KOL A;  4RGO S;  4CKB A;  4EVO A;  1TY0 A;  4OO1 I;  1SEB D;  3S9W A;  4HCS A;  3WOF A;  1EY5 A;  3OIP A;  4DGZ A;  3ERQ A;  4A3E B;  5KNB A;  1D5Z C;  4IUU A;  5FO7 B;  1BNZ A;  3PUX A;  4C56 C;  3KK7 A;  4ZYS A;  2HDM A;  4Q5V A;  2TMP A;  2BDN A;  1AEX A;  4RHR A;  3OPO A;  1VF7 A;  2PCF B;  3R2T A;  2HDL A;  3V05 A;  3IFT A;  2EJF C;  2ZT9 C;  3GV6 A;  3HGB A;  3EFX D;  2SOB A;  3D4D A;  3KBG A;  3QIA A;  4C1N K;  2A6H C;  4XQJ A;  1ILQ A;  3DXJ C;  1SBB B;  4L63 B;  4P2C B;  3D31 A;  3N6R A;  3WDN A;  5KND A;  3HRZ C;  3ONA B;  4A3J B;  4V0B A;  1JC7 A;  1MGS A;  1K8O A;  3I70 A;  2KCC A;  2IX0 A;  1K8M A;  1SNM A;  1PRT B;  4BY1 B;  3SHL A;  1EOT A;  2PZW A;  1WVL A;  4DAV A;  4ZUJ A;  4IFD H;  2JSO A;  5T1G A;  4A3G B;  3CU7 A;  1LLR D;  4ID6 A;  2ID0 A;  5CGK A;  2JEA I;  5JVH 3;  1SFO B;  2E2I B;  1H9M A;  2D62 A;  1RDP D;  3TP5 A;  3WOE A;  5EPJ A;  4O42 A;  1GUT A;  2CHB D;  4KK7 A;  1QIL A;  4J1M A;  5A2Q L;  4QMG A;  2E74 C;  1X3Q A;  2BA0 A;  1SDF A;  1XYI A;  2NYZ D;  4ULL A;  1Q3L A;  3RMH A;  3IAY A;  2HCC A;  2KED A;  4K6D A;  4DN4 M;  1SYE A;  4KKS A;  2B2V C;  4S3S A;  3V96 A;  4KY7 A;  2F0P A;  1MSH A;  3GP7 A;  5CBE E;  3DWP A;  4IFD I;  1FNV A;  3RZD B;  2RKS A;  3K0Y A;  2FIN B;  3BZD B;  3TME A;  5CV7 A;  5LL6 X;  2G9D A;  2ICI A;  1TS2 A;  5DM6 3;  4XXE A;  2RDF A;  5IT9 L;  3EA6 A;  4DXF A;  5JEA J;  5DNF A;  2F0S A;  1V1P A;  4KKT A;  4MIU A;  1WD0 A;  1H9J A;  2R7Z B;  4U68 A;  3FPP A;  4FXG C;  2V4D A;  1EEI D;  2LKV A;  4J6H A;  1B1Z A;  2JA7 B;  2A69 D;  3VR2 A;  2OT2 A;  1D1K A;  2BCO A;  2F0N A;  4DNR B;  2A68 C;  3PV0 A;  1CM9 A;  1EL0 A;  2R93 B;  2R3Z A;  1LT6 D;  1JE4 A;  4OO1 G;  3D8G A;  1BDO A;  2K5W A;  3N52 A;  3SK5 A;  2NBF A;  4I7Z C;  2KEE A;  4C3H G;  2K28 A;  2WAQ B;  1LT3 D;  1SYF A;  5EPK A;  1PMR A;  4H0L C;  2LFN A;  1TVX A;  1TKW B;  4OIJ A;  3TBI B;  1RKN A;  3VR4 A;  1Z6H A;  2RDG A;  3I3C A;  3VA7 A;  2A73 B;  3MFG A;  1CZG A;  2I07 B;  5J39 A;  3QOJ A;  1NAP A;  4FYD A;  3PO2 B;  3LWE A;  2IT1 A;  5F2D A;  3DMU A;  2K1B A;  2A6H D;  1STB A;  1IYU A;  2L4N A;  2IPK D;  3VA5 A;  3NWT A;  1I4R A;  4HN7 A;  5D3D A;  2RA4 A;  1ZXT A;  1WTQ A;  2C9O A;  1B4O A;  1PRT C;  2RDH A;  1EU4 A;  1T5X D;  4R8I A;  5JAV A;  4FXD A;  4BBS B;  1RTO A;  3O13 A;  5C0X H;  1DOK A;  1ZEQ X;  4CKC A;  5CV9 A;  1I4H A;  1BF4 A;  4K6L A;  5IGG A;  3GV3 A;  1LV9 A;  2F0H A;  1DZ1 A;  2JXM B;  5A2Q E;  1UUP A;  4ODG A;  2NVY B;  3IL8 A;  1STN A;  1JOQ A;  3MZ5 A;  3AB9 A;  3QOL A;  4RA8 A;  2K33 A;  5CBA E;  2YYZ A;  4TSS A;  3NHH A;  3D3R A;  2ZXR A;  3HKZ B;  3R93 A;  1AW7 A;  2WKC A;  3P20 A;  3OMC A;  5EGT A;  3OW7 A;  1GHK A;  3I4L A;  2F0E A;  2QEJ C;  3HOV B;  4FF3 A;  4K5W A;  3NE5 B;  1OXV A;  2F0T A;  1XWE A;  2PPB C;  1J8I A;  3PUV A;  3HZX A;  5IT9 E;  3AU7 A;  2X6L A;  4IFD G;  4RFB A;  2TSS A;  3RD4 A;  3BDL A;  1GXD C;  3MHB A;  4RGT A;  1LTG D;  1ET6 A;  5CR3 A;  5HGT A;  3GQB A;  4KN7 C;  1XTC D;  1IW7 D;  3MA2 B;  4DAY A;  2RSN A;  5IGE A;  2XWB B;  4K2L A;  3QWN A;  3I4N B;  3A54 A;  1HRJ A;  4R8N A;  1I3Q B;  1VMP A;  1S5B D;  2L5T A;  2Y0S B;  4WRD A;  4G7H C;  3VR3 A;  4QUC A;  2NVQ B;  1Q8I A;  1TS3 A;  3FDT A;  4TQU S;  4OGQ C;  2O5J C;  1G2T A;  4U67 3;  2EY1 A;  4XDX A;  5I6W A;  2IX1 A;  2NN6 H;  5T1I A;  1BR9 A;  3S1N B;  3W2D A;  1F9Q A;  1JWU D;  4ILW A;  4EQO A;  1ZYR C;  2I46 A;  2WB1 B;  1PZK D;  1SE3 A;  4HMJ A;  1B53 A;  2LS0 1;  4IN3 A;  2KUM A;  2XWJ B;  5EKI A;  2L0C A;  1X3P A;  1GHJ A;  2FHT A;  4DA2 A;  2XSC A;  3D4W A;  4I65 A;  3LWU A;  3J7Y W;  5K36 H;  1Y8O B;  2N55 A;  3T51 B;  3K57 A;  3S2D B;  4F87 A;  3GTO B;  2NZ1 D;  3DM1 A;  2D2C C;  4ZK9 B;  3QG1 A;  1CK1 A;  2B63 B;  5C5M A;  4A3K B;  4KN4 C;  1JOR A;  1U4R A;  2FJ2 A;  1L0Y B;  1MI2 A;  1TWG B;  4KHV A;  3NXW A;  1JOO A;  1PRT D;  1LTR D;  2EE1 A;  1WD1 A;  1CFM A;  1H9R A;  2RBM A;  3GTQ B;  3OSO A;  5G3L D;  3Q6S A;  1W6K A;  2AQ1 B;  2K03 A;  1AN8 A;  2F0M A;  5CC4 A;  1HA6 A;  1A3U A;  2B2Y A;  2EJG C;  1RF2 D;  1TY2 A;  4G7O C;  1PZI D;  1PRT F;  4XQQ A;  1TT2 A;  1LO5 D;  4OHJ A;  4CKE A;  2F0O A;  1SNO A;  2X6G A;  3LNN A;  1UAP A;  1PXU A;  5M5W B;  3A7A B;  1SXT A;  4KMU C;  3EVQ A;  1V1O A;  1TWF B;  4GZY C;  4KD3 A;  4CJ0 B;  3I4M B;  2PW7 A;  3KLR A;  4FP5 D;  2N88 A;  4Y7N B;  1BCP D;  1PDQ A;  4WJW A;  1IKL A;  3DWA A;  4HSP A;  3MXN A;  1SYD A;  4ZRZ A;  3VR6 A;  3A55 A;  1E2Z A;  5CYU A;  2HUG A;  1A2T A;  2H4O A;  1TII D;  3G6J B;  2EYH A;  4EGV A;  3CRK C;  4Q0F A;  1BCP F;  4B9W A;  5FOB B;  5I6Y A;  5C3W A;  1GJX A;  4AYB B;  2F4I A;  4DXG A;  2L55 A;  1W6J A;  3NK9 A;  2EDG A;  2F0D A;  2FMM A;  1S4Z A;  3CQZ B;  3DUZ A;  1KAB A;  4XT1 B;  1DXM A;  1TS5 A;  2AWN A;  1WCM B;  2PZT A;  3D6W A;  1G6Z A;  3T53 B;  1DYQ A;  4HCE A;  1U4M A;  2JE6 I;  1EY6 A;  3MVV A;  2WKD A;  3W3A A;  2ZXO A;  4FVM A;  1BXT A;  1YNN C;  3Q0A A;  4XTC S;  2SNS A;  1DOL A;  3S14 B;  2VB3 X;  4FF1 A;  5C4H A;  2KJX A;  1E0B A;  5KEE A;  3T13 A;  1IYV A;  1HXY D;  2E76 C;  1D1I A;  2ZXP A;  1ZYR D;  1HFN A;  2Z8L A;  3D6C A;  4F7X A;  3FRP B;  3K5N A;  1GOZ A;  5EBC A;  2WAC A;  1SYG A;  1FD7 D;  3E5S A;  4PMW A;  1OXX K;  1OO9 B;  1RCV D;  5CV8 A;  1HPC A;  1TS4 A;  3I91 A;  5FKA C;  5M3M B;  1D2B A;  3MFY A;  2AQ2 B;  3NBH A;  4RCN A;  3U9S A;  4BA2 I;  2XVS A;  3GTL B;  1SYC A;  1SMY D;  3NBI A;  2EYM A;  4HMI A;  3QO2 A;  1JWM D;  2C5C A;  1NUC A;  5EJW A;  5FLX L;  1G91 A;  3HP3 A;  1EU3 A;  2NTT A;  5EQ0 A;  5CV4 A;  1IHZ A;  3CRL C;  2PZU A;  1BCP B;  1MBY A;  1R4P B;  5E1F A;  3BYT B;  5J22 A;  2NTS A;  2FMC A;  4ABN A;  1QB5 D;  1LTA D;  1DM0 B;  2F0Q A;  3ZYY X;  4FF4 A;  4IAL A;  3A8J E;  3VYR A;  1CQF A;  1I6H B;  1X32 A;  1TWC B;  2A5H A;  2MGS A;  4JBW A;  4B08 A;  3M7N A;  1IW7 C;  3HOW B;  1HCZ A;  3L9A X;  3U9O A;  3MC0 B;  4ZKC B;  2PW5 A;  5BN5 A;  4H7B A;  3TN2 A;  2B2U C;  1GUO A;  1Y69 U;  1H9S A;  2B2T A;  4NW2 A;  2F0W A;  3FMC A;  1V1P B;  1H9S B;  5KIX A;  2SDF A;  4NDX A;  4DK1 A;  5IOC A;  4KI0 A;  3PMF A;  1EFI D;  2EY2 A;  2NVX B;  4K5X A;  3S1M B;  3PIO 3;  4FF2 A;  1NR2 A;  1I4G A;  5HUR A;  2Q8I B;  1STH A;  5DEH A;  4A3M B;  1STA A;  2J7Z A;  5C44 B;  4MN3 A;  1Y1V B;  4C3I G;  1Z7T A;  2EY6 A;  2L9H A;  1PTO H;  3BVG A;  1EZ6 A;  3K6O A;  1EYD A;  3NP8 A;  1R9T B;  1CI3 M;  1LAB A;  3HS0 C;  3MXU A;  1HFG A;  2LMC B;  2EYF A;  2BOS A;  5KGU A;  1G29 1;  1F2L A;  1OXS C;  3OMG A;  3K5O A;  4YIJ A;  3T56 B;  2FFK B;  1RHP A;  2BE5 C;  5E4W C;  3RLF A;  1PTO B;  3QB3 A;  2WV6 D;  1OXT A;  2DY7 A;  1WTR A;  2K5Q A;  3HEJ A;  1YNN D;  4IFD J;  3OWE B;  4A93 B;  2Z1C A;  3SK8 A;  1JB3 A;  4K5V A;  3HOX B;  2NWG A;  3MEH A;  1WTV A;  3M7G A;  5LHY 1;  4DK0 A;  1A2U A;  2R92 B;  4RCO A;  4QIW B;  4IUP A;  5IGC A;  1U4P A;  1ICW A;  2X69 A;  4RGM A;  3C46 A;  5IGD A;  3S17 B;  3M3Y B;  2SEB D;  2IJ0 A;  3NWS A;  3NQT A;  3MXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...