2EY5A

Crystal structure of staphylococcal nuclease mutant t41s
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDSPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey5A00
5C3WA 3V2TA 5F2DA 5CV5A 4S3SA 3EVQA 4NP5A 4ZQ3A 3SK4A 2SNMA 4KD4A 2F0IA 3SK8A 2F0DA 1STNA 5CC4A 2EYJA 4KJNA 5HURA 5IGBA 2EYHA 4HMIA 1EY7A 1JOKA 1SNPA 1STAA 2LKVA 3QOLA 2RDFA 5EKLA 1A3UA 4DU9A 3NUCA 4EQNA 2EYPA 5CV9A 5DAUA 4ZUJA 4K8IA 4KJOA 4N9PA 3VA5A 2PW7A 5C4HA 2PYKA 1TQOA 1EYAA 3ERQA 4G57A 4F8MA 1NSNS 3E5SA 3P75A 1STBA 3ITPA 5I9OA 5CGKA 5E1FA 4QMGA 4EVOA 3MEHA 4HMJA 5NUCA 2KHSA 2RKSA 4NKLA 3NK9A 4KY7A 2PZUA 2OF1A 5IGEA 5EGTA 3TP8A 4B9WA 2F0SA 2F0EA 2F3WA 4PMCA 4ZUIA 2F0VA 5ISRA 5C6AA 2F0FA 4IUNA 1F2MA 2SOBA 3DMUA 4IZ8A 3HZXA 4LAAA 3T13A 5HGTA 3OSOA 2EYLA 2QDBA 2F0NA 1IHZA 4J6HA 5C4ZA 5IGFA 3SK6A 1KDAA 5IGGA 3SR1A 1JOQA 4ID6A 5KRUA 1JORA 4RKBA 2EYOA 2EY2A 1EY5A 3NP8A 1SYCA 5JOBA 1KABA 4WORA 4KD3A 1EZ8A 4NMZA 2RBMA 3BDLA 5EKKA 2F0JA 1KDBA 3P1HA 3MXPA 5KIXA 2F3VA 5JAVA 5C5LA 4YIJA 2OEOA 2F0WA 5C5MA 1EYCA 3DHQA 5KEEA 4B9XA 4K14A 1EQVA 2WACA 1ENCA 3MHBA 4DF7A 4H7BA 1SYGA 4ODGA 3D4WA 5E3FA 5M9OA 1SNOA 5KYIA 2EYMA 4EQOA 4K2LA 1TT2A 1SNCA 4K5WA 4HTHA 5CV4A 4J1MA 2F0UA 3C1EA 5J22A 1F2ZA 2F0OA 4R8NA 3TP6A 1TR5A 3NHHA 5I9PA 2PZWA 3D6CA 3TMEA 4DGZA 2EYFA 4K6DA 1A3TA 3C1FA 1EY9A 1SNDA 3TP7A 2KQ3A 3OMGA 1EY4A 1EYDA 1STYA 4IALA 4N9TA 4K5XA 3U9OA 5CV8A 5IIFA 2F0KA 5K5PA 1STGA 2HQEA 1A2UA 3T16A 1EY0A 1SYEA 1U9RA 4K5VA 3NQTA 2EXZA 4KTAA 4TRDA 5KYLA 2ENBA 4KY5A 3MZ5A 1SYBA 4KHVA 2F0GA 3D4DA 3RUZA 2NUCA 2SNSA 5I6WA 2PQEA 1A2TA 1NUCA 1STHA 5IOCA 5J39A 3TP5A 5I6YA 4MIUA 2M00A 4K2KA 1A3VA 2F0MA 2EY1A 3EROA 4WRDA 3BDCA 4EQPA 1SNQA 1EZ6A 4KY6A 5IGCA 3R3OA 3QB3A 5KGUA 3HEJA 4E6IA 3SK5A 3PMFA 3OMCA 1AEXA 1F2YA 3OWFA 4PNYA 4RKLA 5J1ZA 2EY6A 3D8GA 1KDCA 4PMBA 3SXHA 2O4XA 2OXPA 1II3A 1ENAA 1JOOA 1SNMA 3EJIA 5CV6A 1RKNA 4I65A 1SYFA 4QF4A 5CR3A 1EY8A 3NXWA 2F0PA 3MVVA 2F0QA 3H6MA 2PZTA 2PW5A 1SYDA 4K8JA 4KV6A 1KAAA 3LX0A 4ME5A 3SHLA 4DFAA 4QB4A 4OL7A 2F0HA 1EY6A 5DEHA 2EY5A 4NDXA 4F7XA 3QOJA 2F0TA 5C3XA 3S9WA 2F0LA 5IGDA 5IODA 5CV7A
chains in the Genus database with same CATH superfamily
1XNQL 3RR5A 3HG9A 2LFNA 4DV3Q 3K0YA 2EYJA 4L5RC 1FR3A 1V43A 1WD1A 4POFA 1MGSA 4IO9A 1U4PA 1XMOQ 4CKCA 1RHPA 1IYVA 5DAUA 4F8MA 2ZTDA 1GHKA 5CGKA 1EYGA 3HOYG 2AQ3B 1CKMA 4QGUA 4NKLA 1GUGA 2EIFA 2EZVA 3MXNA 4JI2L 4JBMA 2J7ZA 1VMCA 3HZXA 1LTBD 2KCNA 1I6HB 3FDTA 3CHBD 1T5XD 3GO5A 1KDAA 1CZGA 2KECA 2SEBD 4DV0Q 3SGIA 3T51B 2R61A 2E76C 1KDBA 3KF6A 3NWSA 4JBJA 2OEOA 1LTID 1HZCA 4C3IH 2BA1A 3RLFA 1NY4A 1M90C 3S17B 1V1PA 2JA5B 5KYIA 1DGSA 2R92G 3GTPH 3WDNA 3S17H 3PV0A 5C3EG 1L1OA 4R8NA 2B2TC 3IL8A 3TP7A 4IFDJ 1UEBA 5CV8A 2EXDA 3D31A 4V190 4KHVA 3F1ZA 1DOLA 1X6OA 1QVGA 4K6LA 4FYDA 2XVSA 1EWCA 1CFMA 4OX9L 1JB7A 4KHZA 3EN2A 4WJ4A 1IBLL 5BR8Q 5DNFA 3ZJYC 2F03A 5IT9E 5CV6A 1RKNA 4I65A 2IT1A 4ZYSA 1S5DD 3KF8B 3KK7A 2F0QA 1I4HA 4DFAA 1SYDA 3H3VI 1XX8A 5IP7H 2WB1E 2K1BA 1UE6A 4OHJA 1JWSD 1GUOA 2L9HA 1MHWC 1VQCA 3NBHB 2NBFA 1LM0A 2UXCQ 3JAMc 4KI0A 2KUMA 2NYZD 1VQLA 1L2FA 4N8X1 2VUMH 3L0OA 4KKTA 1A6XA 2K5HA 3S1RH 5EPLA 2XSCA 4UP9A 2N78A 2JE6I 2RKSA 1VS0A 2JA8H 2G9DA 3PIPA 2JP1A 3EBEA 2C35B 3E3XA 1G6PA 2B39A 4AYBB 2SOBA 5JEAJ 4Z9CB 3F2DA 4A3MH 3I7FA 3OSOA 3CD6A 4HJ5A 2QDBA 4PZ7A 2N8NA 1YVCA 4A3FH 4UP8A 5IP9H 3UDFA 3K5OA 3J81E 4YCWA 4JI1L 1VQEA 3TREA 4WORA 4LF4L 4A93B 4L5TA 4FXKC 1C9OA 1KIXA 2XTIA 3W2DA 3VDYA 2N55A 4BY1H 4R4CA 1LABA 4P74A 4X6AH 3L2PA 1K83B 4ZAIA 2E8GA 1JCKB 1NMGA 4HTHA 1RD9D 3GQBA 1ONLA 5IP7G 1F2ZA 1IZ6A 3H91A 2LSSA 1EY9A 3NBHA 1E2VA 3VYTA 2CQOA 3U9OA 3KUPA 1YJWA 1ET9A 3L3OC 2HQEA 3UDGA 3OIQA 2VUMG 2CW0C 4NB3A 1MSGA 5J39A 1E0BA 1IKMA 4O2DA 3EIVA 1H9SA 2NVXH 4DR6Q 4FVMA 2JA8G 3PMFA 3K7UC 1C4QA 3BJUA 4AYBG 1Q7YC 5FO7B 1EY8A 3MVVA 1TWHH 1HZAA 4A3FG 5IP9G 4QB4A 5AFWA 1D1KA 2OWOA 1ILQA 2K28A 1TVXA 4MZ9A 1IBMQ 1QILA 1HUMA 4JOIA 1Q1BA 4BY1G 5LMNQ 1VQKA 3NELA 3GTLB 4ME3A 2XWJB 5FLXL 5CV9A 1B7YB 1TXYA 4CDCC 2K5NA 2PW7A 3ERQA 5M3MB 4ZCKA 4A3KH 1VQ4A 1NSNS 2MQHA 3Q22A 2PCFB 1CK1A 1OXVA 1SMYC 1JICA 1CKNA 3OOCA 2UXDQ 1PYSB 3FEWX 1EOVA 1VQBA 4HIOA 5HGQA 5FKAC 3M4QA 1KAWA 2PI2E 1XWEA 3PUVA 2OTLA 3FKIH 2TSSA 2FFKB 1B70B 1EFID 5FK9C 4KLKA 3J7AF 1JE5A 2PNRC 4YWKA 5KRUA 1QVCA 3H09A 1KABA 2VS1A 3MFYA 1EZ8A 4NXNL 2K5VA 1Q1EA 5C0XH 4R4TA 1I4GA 3LWEA 1RIPA 3N6RA 1Y1WH 5FOBB 2Y0SG 4ABNA 3CC4A 1ENCA 4JI3L 1MJEA 2KOLA 1QNUA 1Z9FA 2FMMA 5C0XI 3AFPA 4X62Q 1IXRA 1YI2A 1PFSA 4NXML 4BXXH 4OONA 1JQYD 2A73B 1ML0D 1PRTB 3E9IA 3KJPA 3U4VA 4HCSA 2K03A 5IIFA 3BVMA 2AQ1B 3KLWA 4P75A 4QUCA 5GQOA 3NEMA 4RAUC 3Q23A 1NCVA 2B2TA 3A54A 4A3KG 3GTQB 1STHA 4AQYQ 3S1MB 3EROA 2JA6B 1DM0B 1A15A 2XGTA 3BDCA 4WRDA 4JI5Q 3SK5A 2B2WA 3T1HL 4X66Q 2CHBD 2YTYA 1N8RC 2R93H 2DY8A 1PRTD 3MFGA 4C3HB 1JWUD 1Y1VB 4LFAQ 3FKIG 2MNAA 1ASYA 2F0PA 3BVZA 2B2VC 3G7LA 4DUZL 3GD7A 4G7OC 4LFBL 3K5NA 3S9WA 4B3RQ 2F0LA 5IGDA 2E2JH 1VQHA 1Y1WG 3TBIB 1HNZL 1RL2A 4A3EB 4LWCA 5CMDA 1PH8A 3S1QB 2IHEA 1STAA 2IHFA 2K04A 3AYHB 3R2TA 4DU9A 2XNAC 3NUCA 3H0GH 4R9WA 1V8QA 3S16H 3S2DH 2ALYB 4N9PA 1AFPA 4BXXG 1IW7D 1N32L 2HHHQ 1VQ7A 1JE4A 3A8IE 4RHRA 2E2IB 1U5KA 1O7ZA 2PZUA 3HOUH 2F0SA 3LGJA 4GLVB 4OGQC 3T1YL 2PPBC 3TS2A 4A3DH 2QEJC 5ISRA 5C6AA 3FHWA 3I4NB 4KHPL 1SDFA 4Y52H 4XTCS 3FPPA 1CI3M 2DNEA 5I2XA 3A5ZB 2K52A 1PA6A 3GTOB 4DNIA 3K5MA 2KBNA 3UDXA 3S15H 1G8ZD 1SAPA 4YIJA 2IX3A 4CKEA 2R93G 4PQXA 1EQVA 4OELB 4MHEA 4A3BH 4DF7A 5LMUQ 2K5DA 1NMFA 1SNCA 3BS1A 2ZJPA 2A69C 4DR5L 3CRLC 3GTGB 1EL0A 1IL2A 2K01A 2KQ3A 4DAYB 2A1AA 4IPDA 4X65Q 2K14A 2UUCQ 3I73A 1ILPA 2KHJA 1F77A 1U9RA 1PVOA 2KCTA 3BDOA 4FNFA 4DV4L 1ASZA 1SYBA 3H0GG 3CC7A 3K57A 2NUCA 1UUPA 5ELDA 2NWGA 2ZXPA 1LT5D 4DK0A 3ULPA 3S2HH 2F0MA 2EY1A 3KFUA 1B3AA 3BYTB 4DR4Q 3HOUG 1YJ9A 3TQYA 4A3DG 4J8QA 1LACA 1S40A 1ESFA 3DEPA 2UXBL 1AZPA 5M5YB 4R1JA 1Q81C 3I4NG 4GN5A 3RLOA 1ZXTA 2NVQH 1DXMA 4ME5A 3M9BA 3MAQA 2F0TA 2N3SA 2QCPX 1D6EC 1XXGA 5CBEE 5IY0A 4JI6Q 1CKOA 4DV1L 1L0XB 2F4VL 3L7ZC 2JQOA 5HURA 1YHBA 4QIWE 1B2TA 3K7AB 2RDFA 2BOSA 3K7AH 4FF4A 3VA7A 3J80i 5G3LD 3Q6SA 1KD1C 2Z1CA 2R7ZH 3P75A 4QQBX 3ONAB 4DV6Q 2FXQA 3AQQA 2J4XA 3K0XA 3U9SA 3MC0B 1MBYA 4LF6Q 1YZ6A 3ND9A 2R6GA 3GP7A 1F2MA 2HCCA 3DMUA 4IFDI 1RCVD 1E1OA 4LMQD 2NTSA 4KMUC 1I5FA 1NJIC 3ND8A 2KEDA 1C0AA 3ICEA 2UUAL 2F1MA 2B63B 3NTIA 4ILWA 3M7GA 1PYWD 1LYLA 1AN8A 5C5LA 3HOVB 1F9QA 1VQMA 1D5ZC 2MUYA 1EYCA 1ZYRD 3CF5A 1BNZA 3S24A 2YU9H 4DR2Q 2HDMA 4ODGA 4LF5Q 4R4IA 1LTSD 2ICIA 4JI8Q 5CV4A 4IUQA 3MTSA 1D1IA 4J1MA 2OTJA 1OXSC 3S1NH 1F2LA 2PZWA 5EBCA 2Q8IB 4F88A 5I2YA 4LF9L 3WWVA 1KLGD 3G48A 3I91A 1GM5A 5DM73 5D65A 3X3MA 3I4MH 2NZOA 3HS0C 3K6OA 3M4YA 4KY5A 2VQEQ 3JC66 4A3LH 1TWFH 3GTMB 1I3QB 1T9HA 2R7ZG 1A2TA 1D7QA 4A3CH 4HSVA 2GVBA 4J15A 1SXTA 3PUXA 1F9SA 3HOYB 1KHIA 3OMCA 1F2YA 4JI0Q 1PXUA 1HR0Q 1E2WA 2K75A 4OO1I 1ENAA 2CWPA 2ZM6L 2NTTA 4HSPA 1L0YB 4DNRB 2WAQG 3MXNB 4Y7NH 1M1KC 1MIUA 1AP0A 3VYRA 1EY6A 1XMQQ 4DV2L 2AWOA 2JEBI 3SVMA 5CV7A 1PH3A 1LT6D 5JPNC 2AQ2B 1FVIA 3EVQA 3OW7A 5KNCA 4PMWA 1LTGD 1BCPB 1BBUA 2B2VA 1C7YA 3CW2C 5DM63 4HMIA 2B2YC 3O13A 3A74A 3KLSA 4DR1L 1CT1D 1JJGA 1IBKL 2B8GA 1WFQA 4HN7A 4CKBA 3GTKB 1I94Q 5K36G 1PZKD 5C3EB 3MEHA 4HMJA 4GKKL 1V1PB 4OXPA 3MA2B 4LUOA 4WJWA 3TP8A 1VF7A 5D3DA 1L1OB 3I4MG 1SFOB 2F0VA 4DV7Q 4CBVA 5TSSA 2JJQA 3I3CA 4LF8L 1RTOA 4A3LG 3NENA 1HPCA 3AFQA 4HIMA 3A7AB 5IGGA 4A3CG 1O7LA 4IUTA 3GTJH 4XYOA 2JSOA 1O7YA 1I4XA 1JWMD 2HCIA 2Z9HA 1FJGQ 3PUYA 2D5DA 4MN3A 1DZ1A 1Y69U 4EGVA 4B3SL 2VQFQ 1CHQD 1N36Q 1N33Q 4FXDA 1QWYA 1PH4A 1Z7TA 1BXTA 2A8VA 1PRTF 2NZHA 2ZXOA 3I8ZA 4GN4B 2MPMA 1HNWQ 3GV3A 1DYQA 4IUPA 5EQ0A 3TMEA 4DGZA 4KK7A 3C1FA 1HJPA 3OMGA 3NTKA 1EU3A 4IALA 2F3IA 1STGA 2LXKA 1PMRA 4K0KL 1YNJD 2I07B 3OTOL 2ENBA 4JYAQ 4C3IB 4L63B 4OWTB 4V0BA 3R8BA 1HNXQ 2QGQA 1VQIA 4AIMA 4X3SA 5C44H 1NR4A 1XNQQ 3GTPB 1OXUA 4K2KA 3HKSA 3KYHC 2C9OA 3K8AA 4BS9A 4JV5L 4RGTA 1VQ6A 1ICFB 5FLXE 1GUTA 5J1ZA 4GOPA 4UY8C 3TZDA 1CQFA 1Z47A 2CH4W 4PMBA 1KDCA 4RCNA 3V05A 1II3A 2P5ZX 3EJIA 2JXMB 3TSSA 5ELOA 3Q24A 1B3QA 2V1CC 4JI7L 2PZTA 2FINB 4OL7A 4L5SA 2BA0A 1KLUD 3SDZA 5C3XA 4JI2Q 1CQVA 2DN8A 4A3JH 4DUYL 1Q82C 1GVPA 1VQPA 2PO4A 1LTTD 5L37A 3H94A 3CCQA 2EYHA 1HZBA 3QOLA 4GN3B 2L12A 3H3VH 2XWBB 1PTOH 1SROA 3I72A 4K8IA 1TWAB 2G5DA 1NNXA 1TWAH 3PO2H 1AE3A 5IWAL 4GKJL 1Q12A 2KCCA 3OWEB 5GAGC 5IGEA 5EBDA 3NPPA 1BR9A 3G6JB 5D14A 4IZ8A 3WOFA 4JV5Q 5A35A 1ET6A 4C3IG 1PZJD 1PH9A 5C44G 2VUMB 2D62A 4R4OA 2AUKA 1X32A 4ID6A 3QR8A 4RGOS 5J3BA 3TZUA 1S72A 5EKKA 3VYSA 4ULLA 3S1RB 1G2SA 1QUQA 5EKIA 3TS0A 4ZK9B 2IX0A 1CSQA 2JA8B 1D5XC 4LUVA 1H9SB 1TU2B 2CFMA 3Q0AA 3BG3A 4EQOA 4OX9Q 4A3MB 2F0OA 3NHHA 1NAPA 1WTHA 4HJ9A 4A3FB 1IBLQ 2B2UC 1HFGA 2RDGA 3G4SA 4FF1A 4A3JG 4K5XA 4GNXC 1GHJA 2WINB 3A8KE 1SYEA 3BU2A 5KYLA 3DM1A 1LTLA 2E75C 1EIFA 4UP7A 2Q2UA 4BY1B 1GOZA 4BBRH 2EJFC 5ELFA 2B29A 1EEFD 4WJ3M 5C4XH 1IW7C 4UPAA 3BYYB 1UWVA 2QW7A 3TP5A 3PO2G 5G3LF 3J81j 1RTNA 3RZDH 3I90A 3UI2A 4POGA 2XRQD 1SE8A 1CHPD 4RH6A 2FHTA 3HEJA 4ALPA 1SEBD 4YY3L 1PH5A 3VYUA 4YHHL 1CKNB 2JA7H 3CCVA 1SYFA 4HIDA 3H6MA 1DONA 5M3FB 1H9RA 4KV6A 1PH6A 5M3FH 1J6QA 5LL6X 3HOWB 2UUBL 1X54A 2KVMA 4HR7B 3HOWH 5CV5A 2NVXB 2SNMA 3ER0A 5IGBA 1EY7A 4JI1Q 2XRSD 2Y0SB 4MNOA 3PSIA 3AEVA 4LF4Q 1B50A 3CCSA 1TQOA 4A3MG 4F87A 1TWHB 1UE5A 1U0LA 5E1FA 2NVYH 1M8AA 1M4VA 4X64L 5BN3A 1K9MC 2MHVA 1BDOA 1G51A 4RA8A 2D2CC 2DY7A 2MJ8A 2PQAA 4LAAA 1YHAA 4BBRG 5JJZA 3W5OA 5C4XG 4BWGB 3J80c 2F4IA 4A3KB 4KD3A 5LL6S 4AYBE 5C5MA 3OIPA 1EEID 4DK3C 2JA7G 2K5WA 5GAEC 3J81i 1BQQT 4DK1A 2E74C 3FKIB 5M3FG 2KCMA 3TP6A 3RNUA 3F2CA 1SJED 2KJXA 1TS2A 1A3TA 2VB2X 3OW2A 1TY2A 1EYDA 3HOWG 5LMNW 5K5PA 2AKWB 1MI2A 4UHVA 4GLXA 5FLMH 1Y1WB 3JAME 1J5EL 3HKZG 4ZKCB 1UE7A 4XQQA 3PQIA 1YNNC 1A3VA 2TMPA 1TS4A 3CPWA 1JJCB 1BF4A 4FF3A 2HDLA 1XTCD 1OO9B 2A68D 2O4XA 5IT9L 1VQFA 5CR3A 1WTWA 5JVG3 3NXWA 1GUWA 1HQMC 4FO2A 3SHLA 1MJCA 1SE2A 2L1BA 1BBXC 2ASBA 2KENA 4DNTB 1HXYD 3CKIB 1F9PA 1LO5D 1BCPF 2Y0SE 3QIAA 1KL9A 3PCOB 2N88A 1TS5A 1RDPD 2C5CA 4LF7L 5M5XH 3OPOA 1STNA 1ZYRC 4DAVA 3CMAA 1VQAA 1NR2A 4B3ML 2R93B 2DUDA 4NXNQ 4RWSC 3K81C 3NQIA 4EX5A 1FYCA 4QMGA 4EVOA 3PO3H 2KHSA 4JI3Q 1X9NA 1WOCA 2E2JB 1VQJA 4IJHA 5C0XG 5FLMG 4NXMQ 2F0FA 1D2BA 4RHSA 1EOTA 2JA9A 1D5MC 2RVLA 3SK6A 4RCOA 4ZLTF 3PIO3 4JPBW 1HA5A 3H0GB 3S16B 3S2DB 3NSWA 1PYBA 4L5QA 1SYCA 1W3SA 4CHTB 1KRTA 2F0JA 2CQAA 1A62A 3P1HA 2X6LA 2A6HD 2EE1A 5AJ3L 3M3YH 4LFCL 4IUUA 4HJ7A 1W6KA 1WYDA 2WFWA 4IN3A 2F0WA 4DR7L 2VL6A 3HOUB 3J7YW 4XXEA 5LHY1 3MHBA 1QCBD 3TRZA 4A3DB 4K2LA 1O7IA 2EVBA 2BE5D 4P2CB 3HFZB 1TR5A 5I9PA 3T1HQ 2Z8LA 2UU9L 4IOCA 1SNDA 4DPGA 4Q5VA 2E5LL 3R2IA 3VR2A 1Y8NB 2QILA 2QKIC 2LS01 2AUJD 3S15B 4DUZQ 3KOJA 2EXZA 1V9PA 2VNUD 2B3GA 4TKOB 4U68A 4LFBQ 4OWXB 1X56A 2B2UA 2PMZB 4A3BB 2IPKD 1RODA 3AB9A 1VQNA 2GVAA 4NPSA 3RZOB 1HA6A 1HNZQ 4JW0A 3RZOH 1JT8A 4CDFC 3PO3G 1EZ6A 4KY6A 4DA2A 4MTNA 3OWFA 5FO9B 1F9RA 1PH1A 5EPKA 1I50H 1IYJB 2HD3A 2Z0SA 1SNMA 1XPUA 1N32Q 4FDBA 3RMHA 4DR7Q 1DCZA 4RG1A 3HRZC 3IRBA 2ZT9C 4A76A 1SE3A 4XT1B 3T1YQ 2NN6H 3E6ZX 4RFBA 3K5LA 1RF2D 1PTOF 3S2HB 5M5WH 4KHPQ 1A8VA 2Z4HA 4BBSB 1X3FA 4DV5L 1BVSA 1WVLA 2LKVA 4BBSH 2NN6I 1A3UA 3GDEA 5JVH3 1N34L 1L1OC 1DOKA 4H02A 3E5SA 1K3RA 1EIHA 3CP0A 3ITPA 2NVQB 1HRJA 2A19A 3G6EA 3I55A 2KHIA 4JI4L 1SBBB 2SDFA 2OF1A 4B9WA 5EJWA 1YITA 1PHJA 4G4KA 3M85A 3M4OH 1YNJC 4IPGA 4DR5Q 4BY7B 1FD7D 3W1BA 1XNRL 4BY7H 1K8MA 4DR3L 3F2BA 4A3BG 3CU7A 3FRPB 3K58A 2L15A 4B08A 2XN9C 2Q2HA 2R7ZB 2OQKA 2JEAI 2K05A 3STBD 3BVGA 4DV4Q 1LV9A 3AMUA 2QF7A 1WCMB 4IFDH 4K14A 3CXCA 2HT1A 1KRSA 1WCMH 2QEXA 5M9OA 2PNHA 4FP5D 3PF5A 1XJVA 4APVA 1LT4D 2GN5A 1G6ZA 2A6ED 3D6CA 5C0XJ 2WAQB 1TWGH 3U58A 1EY4A 2UXBQ 2PMZE 5C4JH 4XDXA 4JCVE 1YNXA 1KXLA 3I56A 3T16A 1FL0A 1EY0A 4KKSA 4LW1A 3Q8DA 4HCEA 4BBSG 2F0GA 2I5LX 2YU9B 2SNSA 1PFBA 1CSPA 3E0JA 4DV1Q 4IPHA 5I6YA 2F4VQ 2M00A 4C2MH 3URYA 2RSOA 3S1NB 4UAIA 1SNQA 3C2PA 3R3OA 3WOEA 1X3PA 4OIJA 2Z6BA 3RN5A 1EUJA 3C46A 4IURA 1JOOA 2WP8J 2HIVA 3F8TA 3I4MB 4A4IA 2H4OA 4BY7G 1EQQA 2MP1A 3AU7A 3RLNA 2PW5A 4B3TL 3HOZH 3LWUA 2MGSA 2RA4A 1TWFB 2MO1A 4HJ8A 2EY5A 1VMPA 1PH7A 3A0JA 1CUKA 4GS3A 2FMCA 1K0SA 5IODA 4QY7A 4C3JH 4G7ZC 2QDLA 3K80C 1VCIA 4OO1H 4ZQ3A 4IFDG 1LUZA 2WKDA 1FNVA 1AH9A 1WCMG 2BDNA 5EKLA 1JOKA 2R7DA 5KNBA 1H9JA 2UUAQ 3VA5A 5JEAH 4G57A 5A2QL 3DLLA 4QJFA 3CMEA 4Y7NB 2BH2A 2VY3A 1PV4A 5IT9c 1JB3A 1SMXA 2F0EA 5GROA 2IL8A 4PMCA 3J80L 4Q0FA 1E22A 3HGBA 3T13A 5HGTA 2EYLA 4DV3L 3A8JE 3KBGA 5C4ZA 1B9NA 4LF9Q 2OQ0A 1R4QB 2DGYA 3UE0A 4DK6C 1JORA 1XMOL 4L8JA 5JOBA 1BUVT 1C48A 1G2TA 5KIXA 4TQUS 1HR0W 1E24A 3H15A 5H1SE 4A3IH 3U4ZA 5JPMC 3ZYYX 1L0WA 1CA6A 3ULJA 1WJJA 2XIWA 1LTAD 2WAQE 1SYGA 1HHVA 4A3GB 2K32A 1PLFA 2IWHA 4A3GH 4PZ8A 3HOZG 4GOPB 1YJNA 1HTLD 2WIIB 1VQ9A 2KA7A 3RD4A 1X65A 1RJTA 3GTJB 1EIYB 1SSOA 1BO0A 4C3JG 1IKLA 1BCPD 4JOIC 4N9TA 4DN4M 4OO1G 2ZM6Q 4DV0L 1A2UA 4XT3B 1K8AC 1S5BD 1EWHA 1GJXA 2A69D 4UDUC 3D4DA 3VR4A 1Z6HA 3J81c 4DV2Q 5JEAG 2M9VA 4DAMA 5IOCA 1A0IA 2K6AA 3I4LA 1B53A 2WB1B 2ZTEA 5KGUA 1PFNA 4E6IA 5E4XA 3SE0A 4DR1Q 3I70A 3PUWA 4RKLA 1IBKQ 5BN5A 2EY6A 3I4OA 1PZID 4IUVA 4A75A 1QOHA 2QA4A 3DEOA 4PZ6A 4L6TB 1GUNA 4GKKQ 5E7NA 1KAAA 3QWNA 4DXGA 1FNWA 3EFXD 2WKCA 2OCEA 5C44B 4JVZA 2ES2A 3U50C 4LF8Q 2YTVA 4A3IG 4NP5A 3SK8A 1JR0D 2F0IA 4M1UB 1I6HH 1YBYA 3KLSX 2EYPA 4LJZC 4ZUJA 5BR8L 3BZKA 3L9AX 4M8AA 4A3GG 1TY0A 1VQGA 1QUQB 2I46A 2I5MX 4IJLA 4B3SQ 2K7VA 2AMCB 1KNAA 2CVRA 2EDGA 3QO2A 1EFWA 3M4PA 4CGYB 4A3JB 1OTCA 1EWIA 2JA5H 3CQZB 2EJMA 1UAPA 3GV6A 3CQZH 2UXCL 4YCVA 3KDFA 2F0NA 1IHZA 1CZWA 1DOMA 5FO8B 1YIJA 1G291 4G7HC 2RSNA 1PTOB 3D3RA 1JOQA 1B1ZA 3EA6A 4ZRZA 2VXWA 1MSHA 3PO2B 1HQRD 1NTGA 4K0KQ 3OTOQ 3BZDB 2WB1G 2B2WC 3DWQA 3DUZA 2A68C 4B9XA 1K28A 4H7BA 4EQ5A 1Q3LA 3FP9A 1H9MA 3C1EA 4H0LC 3IFDA 1X3GA 1YEZA 1WTXA 4YCUA 3C3LA 1NE3A 3DWPA 4JK1C 4HJAA 1PTOD 4IQZA 4N8FA 2JN4A 4JI7Q 2ZXRA 1QZGA 2NVTB 2NVTH 2L0CA 1PRTC 3I2ZA 4I7AA 2X69A 4DUYQ 5KNDA 2BH8A 4C1NI 1KQSA 1T5EA 3QG1A 2CKZB 4KN4C 2RCFA 5ELEA 5IYDH 4PNYA 2JA5G 1GO3E 2OXPA 1FGBD 1I4PA 4QF4A 5IWAQ 4GKJQ 4JC0A 4K8JA 1QVFA 2HQLA 2PQAB 4BBRB 1KNEA 2JK8A 1EU4A 5C4XB 2L4NA 3LNNA 4GZYC 3D0FA 2A6HC 1H9KA 3RZDB 3W1GA 2Q2IA 1K8OA 1V1OA 1HTPA 4DR6L 1U4RA 1EQRA 1Y8PB 1GKHA 1A63A 4KJOA 2JA7B 4C1NK 3J7ZC 3CAMA 4A93H 2BE5C 4LNQA 1STBA 4QCLA 1LLRD 2Q8RE 3KF8A 1NBWA 3X3NA 2RF4A 1K83H 3CC2A 1IBML 5HY6A 2YYZA 2Z6KC 1Q46A 2IX1A 1WTVA 4JBKA 2H5XA 4HEDA 5LMNL 3HKZB 1XTDA 3PIP3 2EY2A 4HIKA 1SR3A 2RDHA 3MXPA 5IYDG 2NVYB 2UXDL 4P72A 2WACA 1K3BC 2B2YA 3T53B 3T56B 1VDZA 5ELCA 1P8LA 1OXTA 2A5HA 1P16A 2X6GA 2JYOA 4K5WA 2E2HB 2L11A 5GAHC 3MWYW 2IY5B 4YY3Q 1V1QA 2E2HH 1WTRA 4YHHQ 1JMCA 2F0KA 3OYYA 1S5CD 1WD0A 4YWLA 2PI2A 4LK1C 1I4RA 4MTKA 4O1NA 5CORA 2PQEA 3D4RA 4CJ2C 2VZAA 4A93G 2UUBQ 4DKAC 4X62L 1S5FD 2G9HD 4OEMB 5IGCA 3N52A 1KTKA 4O42A 3K59A 1CTMA 3GTLH 5M3MH 4BA2I 1LTRD 1B44D 1S4ZA 4P71A 3F2UA 3MXUA 4X64Q 2H1EA 1GUSA 2LXJA 4R8IA 1HH2P 1O80A 3D6WA 4XYQA 3KJOA 3STBC 3PF4A 4AH6A 3V2TA 5F2DA 4AQYL 5BN4A 1HFNA 4QUFA 1EIGA 2F0DA 1S3OA 4JI5L 1WI5A 2EOTA 4EQNA 1GXDC 4X66L 3MXGA 3CCRA 1MD2D 4LFAL 1UNSA 2A6EC 5I9OA 4X3UA 3T4AC 3CCEA 1STEA 2RQXA 4KY7A 3PIOA 3HKZE 2ZTCA 2V4DA 4ZUIA 4B3RL 1FNUA 3UDIA 2LMCB 5CYUA 4OIKA 2A74C 5M5XB 2M2LA 2MFIA 2Z4IA 1QZHA 3IFTA 1CM9A 1AE2A 3SR1A 2EYOA 1EY5A 4X3TA 4U673 1D8LA 1QE6A 1XPOA 1J5EQ 2YV5A 2HHHL 1K8GA 3PO3B 4IOAA 4RGMA 1XPRA 3DHQA 5KEEA 1B4OA 4GNXB 1ZKOA 4P73A 5M3MG 3GTQH 3D4WA 3ULLA 2BDOA 1SNOA 2EYMA 3S1MH 1K0RA 4CJ1B 2RCNA 3TEHB 2JA6H 5GADC 3UE1A 2NB0A 4FXGC 3J81L 3VR6A 5IYBH 3A7LA 1QB5D 4C3HH 1E7ZA 1MKHA 1Y1VH 4O0AA 2DJGC 3M3YB 1JJ2A 5E4WC 3NQTA 3DM3A 3KLRA 4QL5A 3TN2A 2LY7A 4NW2A 2D0OA 4TVAB 1Y14B 2DNCA 2R3ZA 1ZEQX 1ESRA 2WV6D 5LMUL 4LF7Q 1W6JA 1B8AA 4A3EH 3JAMi 4B3MQ 3S1QH 1BKBA 4HAEA 2O5IC 2YTXA 3D8GA 3SXHA 1X3EA 3VR5A 5A2QE 3CCJA 4X65L 1SJHD 4QIWB 5D3IB 5DLQE 3A5UA 1U4LA 2UUCL 1VQ8A 3ERSX 3SEBA 3IKJA 1SN8A 5J22A 3TDQA 3M7NA 1CA5A 5DEHA 2E2IH 2CH4A 4NDXA 2E2DC 3J80E 5EPJA 1PDQA 2I5HA 1GD7A 2ZJQA 5C3WA 2L5TA 4GNXA 3I4NH 5CC4A 1AZQA 4JBWA 4DR4L 3R93A 3VR3A 1HUNA 1I50B 4KKUA 2CW0D 5C4HA 3GTOH 3FPUB 1EYAA 2EPBA 2JA6G 5AJ3Q 4LFCQ 1KC8C 2D0PA 1IYUA 1UEAB 5IYBG 1BCPC 5EGTA 2Q8TA 4C3HG 1Y1VG 1ENFA 4PV1C 4CJ0B 4JI6L 4IUNA 5M5WB 1TWCB 2O5JC 1I4QA 2O2LD 1TWCH 4J6HA 2I0QA 1EQTA 3BZCA 2UU9Q 3GTGH 1AW7A 2B8FA 4H44C 2AWNA 2RHQB 2E5LQ 4RKBA 3NP8A 2R7FA 2ZJRA 1QJOA 4NMZA 3E9HA 4A3EG 1PFMA 2F3VA 2CWAA 2Z6KA 4DV6L 1E2ZA 4GOPC 5IE8A 1R4PB 1H95A 1X3QA 4IPCA 4RMFA 5E3FA 3M4OB 4LF6L 1TT2A 4BA1I 3OHXC 2F0UA 2CCZA 1SMYD 1J9OA 4K6DA 2EJGC 2EQSA 3FMCA 4H13C 4C56C 2KEEA 1STYA 4XIGS 3P7JA 5M5YH 1DJRD 3J7AV 4TRDA 5COYA 4KTAA 1Y8OB 3JAML 3MZ5A 1E1TA 3RUZA 1W2BA 3V96A 1G91A 2OT2A 2D9UA 3E0EA 1J8IA 1B9MA 1WTOA 4DR2L 1S5ED 4MIUA 4LF5L 3CPFA 4JI8L 4EQPA 1DD2A 4X3KA 4DV5Q 5FJ8H 2VB3X 3NTHA 4DAPA 1BBWA 2IW3A 1AEXA 1TWGB 2NN6G 5CBAE 5C4JB 3CRKC 1N34Q 1YNND 1SRUA 1ICWA 2GA4B 4DAYA 3QJYA 1FGUA 2MO0A 3MEFA 1Q90A 3LX0A 3NBIA 4CDDC 2AHOB 4JI4Q 4WFN3 2VQEL 2ICEC 2F0HA 3B6YA 1K73C 4F7XA 2FJ2A 3CCMA 3QOJA 2RHSB 1R9TB 3HOXB 2K33A 1R9TH 1VQOA 3HOXH 5JJIA 4C2MB 5T1GA 4S3SA 1XNRQ 3SK4A 4KD4A 4DR3Q 2IJ0A 4KJNA 4XQJA 3DWAA 1SNPA 5JJKA 3NE5B 2L55A 2N49A 4JI0L 1HR0L 2VW9A 1O78A 2PYKA 1U4MA 3P20A 2K50A 1C8CA 2B63H 1E3PA 2BCOA 3DXJC 2HUGA 3FVQA 3EQLC 1XYIA 3HOZB 4FF2A 3G71A 3HOVH 5FLXc 5NUCA 3RN2A 4KN7C 1HCZA 3NK9A 5IYCH 1Q8IA 1TS3A 1XMQL 1Q8KA 2F3WA 3H3VC 1PTOC 4RGNA 1LT3D 4LUZA 4C3JB 3A56A 1IL8A 5K36H 1YHQA 2K4KA 2NZ1D 1WTQA 5IGFA 1N9WA 1UE1A 2DJFC 5I4DA 3IAYA 1BOSA 2F52A 2HIXA 3S14B 4ZKBB 2RBMA 3BDLA 3S14H 5FJ8G 1I94L 4R4QA 5JAVA 3PUZA 3GTMH 1OXXK 1I3QH 4GLAC 4DV7L 2J0TD 4YWMA 4OWWB 2K5QA 1QG7A 3KBXA 2EYFA 3HOYH 3CCLA 1HZ9A 3HOXG 2Q2TA 3PGZA 2ID0A 1I6VC 1QNKA 1FJGL 4K5VA 4B3TQ 1WTPA 4A3IB 2ATWA 1SLJA 3A55A 5ELBA 3NWTA 4XQNA 2VQFL 4I7ZC 5I6WA 1SE4A 1X55A 1N36L 1N33L 1NUCA 1TKWB 2B63G 1JC7A 3HP3A 3CCUA 3HOVG 4JG2A 1HNWL 3QB3A 5IYCG 4PG3A 1VQDA 3KF6B 5ELNA 1PH2A 1VF5C 3W3AA 3J7A5 3GTKH 5T1IA 4DXFA 1VQ5A 2R92B 2R92H 4TSSA 5EAYA 5JJLA 5C3EH 4JYAL 1TIID 1HNXL 3KDFB 1SFOH 4CDEC 1Q86C
chains in the Genus database with same CATH topology
3HG9A 2LFNA 3K0YA 2EYJA 1FR3A 1V43A 1WD1A 1MGSA 1U4PA 4CKCA 1RHPA 1IYVA 5DAUA 4F8MA 1GHKA 5CGKA 2AQ3B 4NKLA 1GUGA 2EZVA 3MXNA 2J7ZA 1VMCA 3HZXA 1LTBD 2KCNA 1I6HB 3FDTA 3CHBD 1T5XD 3GO5A 1KDAA 1CZGA 2KECA 2SEBD 3T51B 2R61A 2E76C 1KDBA 3NWSA 2OEOA 1LTID 2BA1A 3RLFA 3S17B 1V1PA 2JA5B 5KYIA 3WDNA 3PV0A 4R8NA 2B2TC 3IL8A 3TP7A 4IFDJ 5CV8A 3D31A 4V190 4KHVA 1DOLA 4K6LA 4FYDA 2XVSA 1EWCA 1CFMA 4KHZA 5DNFA 2F03A 5IT9E 5CV6A 1RKNA 4I65A 2IT1A 4ZYSA 1S5DD 3KK7A 2F0QA 1I4HA 4DFAA 1SYDA 1XX8A 2K1BA 4OHJA 1JWSD 1GUOA 2L9HA 2NBFA 4KI0A 2KUMA 2NYZD 4KKTA 1A6XA 5EPLA 2XSCA 2JE6I 2RKSA 2G9DA 2JP1A 2B39A 4AYBB 2SOBA 5JEAJ 4Z9CB 3OSOA 2QDBA 3K5OA 3J81E 4WORA 4A93B 4FXKC 3W2DA 2N55A 1LABA 1K83B 4ZAIA 1JCKB 4HTHA 1RD9D 3GQBA 1ONLA 1F2ZA 3H91A 1EY9A 3NBHA 1E2VA 3VYTA 3U9OA 3KUPA 1ET9A 3L3OC 2HQEA 3OIQA 2CW0C 1MSGA 5J39A 1E0BA 1IKMA 1H9SA 4FVMA 3PMFA 1C4QA 5FO7B 1EY8A 3MVVA 4QB4A 5AFWA 1D1KA 1ILQA 2K28A 1TVXA 1QILA 1HUMA 1Q1BA 3GTLB 2XWJB 5FLXL 5CV9A 2PW7A 3ERQA 5M3MB 1NSNS 3Q22A 2PCFB 1CK1A 1OXVA 1SMYC 1JICA 3OOCA 3FEWX 5FKAC 1XWEA 3PUVA 2TSSA 2FFKB 1EFID 5FK9C 3J7AF 2PNRC 5KRUA 3H09A 1KABA 3MFYA 1EZ8A 1Q1EA 5C0XH 1I4GA 3LWEA 3N6RA 5FOBB 4ABNA 1ENCA 2KOLA 1QNUA 2FMMA 5C0XI 1JQYD 2A73B 1ML0D 1PRTB 4HCSA 2K03A 5IIFA 3BVMA 2AQ1B 4QUCA 4RAUC 3Q23A 1NCVA 2B2TA 3A54A 3GTQB 1STHA 3S1MB 3EROA 2JA6B 1DM0B 1A15A 3BDCA 4WRDA 3SK5A 2B2WA 2CHBD 2DY8A 1PRTD 3MFGA 4C3HB 1JWUD 1Y1VB 2F0PA 3BVZA 2B2VC 3G7LA 3GD7A 4G7OC 3K5NA 3S9WA 2F0LA 5IGDA 3TBIB 4A3EB 5CMDA 3S1QB 1STAA 2K04A 4DU9A 3R2TA 2XNAC 3NUCA 4R9WA 1V8QA 4N9PA 1AFPA 1IW7D 1JE4A 3A8IE 4RHRA 2E2IB 1O7ZA 2PZUA 2F0SA 4OGQC 2PPBC 2QEJC 5ISRA 5C6AA 3I4NB 1SDFA 4XTCS 3FPPA 1CI3M 2DNEA 5I2XA 3GTOB 3K5MA 1G8ZD 1SAPA 4YIJA 2IX3A 4CKEA 4PQXA 1EQVA 4MHEA 4DF7A 2K5DA 1SNCA 3BS1A 2A69C 3CRLC 3GTGB 1EL0A 2K01A 2KQ3A 3I73A 1ILPA 1F77A 1U9RA 3BDOA 4FNFA 1SYBA 3K57A 2NUCA 1UUPA 5ELDA 2NWGA 2ZXPA 1LT5D 4DK0A 2F0MA 2EY1A 1B3AA 3BYTB 4J8QA 1LACA 1ESFA 3DEPA 1AZPA 5M5YB 1ZXTA 1DXMA 4ME5A 3MAQA 2F0TA 2QCPX 1D6EC 1XXGA 5CBEE 1L0XB 3L7ZC 5HURA 1B2TA 3K7AB 2RDFA 2BOSA 4FF4A 3VA7A 5G3LD 3Q6SA 2Z1CA 3P75A 3ONAB 2J4XA 3U9SA 3MC0B 1MBYA 3ND9A 2R6GA 3GP7A 1F2MA 2HCCA 3DMUA 4IFDI 1RCVD 4LMQD 2NTSA 4KMUC 3ND8A 2KEDA 2F1MA 2B63B 3NTIA 4ILWA 3M7GA 1PYWD 1AN8A 5C5LA 3HOVB 1F9QA 1D5ZC 2MUYA 1EYCA 1ZYRD 1BNZA 2HDMA 4ODGA 1LTSD 2ICIA 5CV4A 4IUQA 3MTSA 1D1IA 4J1MA 1OXSC 1F2LA 2PZWA 5EBCA 2Q8IB 4F88A 5I2YA 1KLGD 3I91A 5DM73 5D65A 3X3MA 3HS0C 3K6OA 3M4YA 4KY5A 3GTMB 1I3QB 1A2TA 4HSVA 1SXTA 3PUXA 1F9SA 3HOYB 3OMCA 1F2YA 1PXUA 1E2WA 4OO1I 1ENAA 2NTTA 4HSPA 1L0YB 4DNRB 1AP0A 3VYRA 1EY6A 2AWOA 2JEBI 3SVMA 5CV7A 1LT6D 5JPNC 2AQ2B 3OW7A 3EVQA 5KNCA 4PMWA 1LTGD 1BCPB 2B2VA 5DM63 4HMIA 2B2YC 3O13A 3KLSA 1CT1D 2B8GA 4HN7A 4CKBA 3GTKB 5K36G 1PZKD 5C3EB 3MEHA 4HMJA 1V1PB 3MA2B 4WJWA 3TP8A 1VF7A 5D3DA 1SFOB 2F0VA 4CBVA 5TSSA 3I3CA 1RTOA 1HPCA 3A7AB 5IGGA 1O7LA 4IUTA 4XYOA 2JSOA 1O7YA 1I4XA 1JWMD 2HCIA 3PUYA 2D5DA 4MN3A 1DZ1A 1Y69U 4EGVA 1CHQD 4FXDA 1QWYA 1Z7TA 1BXTA 1PRTF 2ZXOA 3I8ZA 2MPMA 3GV3A 1DYQA 4IUPA 5EQ0A 3TMEA 4DGZA 4KK7A 3C1FA 3OMGA 3NTKA 1EU3A 4IALA 1STGA 1PMRA 1YNJD 2I07B 2ENBA 4C3IB 4L63B 4V0BA 3R8BA 4X3SA 1NR4A 3GTPB 1OXUA 4K2KA 2C9OA 4BS9A 4RGTA 5FLXE 1GUTA 5J1ZA 3TZDA 1CQFA 1Z47A 4RCNA 4PMBA 1KDCA 3V05A 1II3A 3EJIA 2JXMB 3TSSA 3Q24A 2PZTA 2FINB 4OL7A 2BA0A 1KLUD 3SDZA 5C3XA 1CQVA 2DN8A 2PO4A 1LTTD 3H94A 2EYHA 3QOLA 2L12A 2XWBB 1PTOH 3I72A 4K8IA 1TWAB 1Q12A 2KCCA 3OWEB 5IGEA 5EBDA 3NPPA 1BR9A 3G6JB 5D14A 4IZ8A 3WOFA 5A35A 1ET6A 4C3IG 1PZJD 2VUMB 2D62A 2AUKA 1X32A 4ID6A 4RGOS 3TZUA 5EKKA 3VYSA 4ULLA 3S1RB 1G2SA 5EKIA 4ZK9B 2IX0A 2JA8B 1D5XC 1H9SB 1TU2B 3Q0AA 3BG3A 4EQOA 4A3MB 2F0OA 3NHHA 1NAPA 4A3FB 2B2UC 1HFGA 2RDGA 4FF1A 4K5XA 1GHJA 2WINB 3A8KE 1SYEA 5KYLA 3DM1A 2E75C 4BY1B 1GOZA 2EJFC 5ELFA 1EEFD 1IW7C 3TP5A 3BYYB 5G3LF 1RTNA 3I90A 3UI2A 2XRQD 1CHPD 4RH6A 2FHTA 3HEJA 1SEBD 3VYUA 1SYFA 3H6MA 1DONA 5M3FB 1H9RA 4KV6A 5LL6X 3HOWB 2KVMA 4HR7B 5CV5A 2NVXB 2SNMA 5IGBA 1EY7A 2XRSD 2Y0SB 1B50A 1TQOA 4F87A 1TWHB 5E1FA 1M8AA 1M4VA 5BN3A 2MHVA 1BDOA 4RA8A 2D2CC 2DY7A 2MJ8A 4LAAA 5JJZA 4BWGB 2F4IA 4A3KB 4KD3A 5LL6S 5C5MA 3OIPA 1EEID 2K5WA 1BQQT 4DK1A 2E74C 3FKIB 3TP6A 1SJED 2KJXA 1TS2A 1A3TA 2VB2X 1TY2A 1EYDA 5K5PA 1MI2A 1Y1WB 3JAME 4ZKCB 4XQQA 1YNNC 1A3VA 2TMPA 1TS4A 4FF3A 1BF4A 2HDLA 1XTCD 1OO9B 2A68D 2O4XA 5IT9L 5CR3A 1WTWA 5JVG3 3NXWA 1GUWA 1HQMC 4FO2A 3SHLA 1SE2A 2L1BA 1BBXC 4DNTB 1HXYD 3CKIB 1F9PA 1LO5D 1BCPF 3QIAA 2N88A 1TS5A 1RDPD 2C5CA 3OPOA 1STNA 1ZYRC 4DAVA 1NR2A 2R93B 4RWSC 3NQIA 1FYCA 4QMGA 4EVOA 2KHSA 2E2JB 5C0XG 2F0FA 1D2BA 4RHSA 1EOTA 1D5MC 2RVLA 3SK6A 4RCOA 4ZLTF 3PIO3 1HA5A 3H0GB 3S16B 3S2DB 3NSWA 1SYCA 4CHTB 2F0JA 2CQAA 3P1HA 2X6LA 2A6HD 2EE1A 4IUUA 1W6KA 4IN3A 2F0WA 3HOUB 3J7YW 4XXEA 5LHY1 3MHBA 1QCBD 4A3DB 4K2LA 2EVBA 4P2CB 2BE5D 1TR5A 5I9PA 2Z8LA 1SNDA 4Q5VA 3R2IA 3VR2A 1Y8NB 2QILA 2QKIC 2LS01 2AUJD 3S15B 2EXZA 2VNUD 4U68A 4TKOB 2B2UA 2PMZB 4A3BB 2IPKD 1RODA 3AB9A 3RZOB 1HA6A 1EZ6A 4KY6A 4DA2A 5FO9B 3OWFA 1F9RA 5EPKA 1SNMA 3RMHA 1DCZA 3HRZC 2ZT9C 1SE3A 4XT1B 2NN6H 3E6ZX 4RFBA 3K5LA 1RF2D 1PTOF 3S2HB 2Z4HA 4BBSB 1WVLA 2LKVA 2NN6I 1A3UA 5JVH3 1DOKA 3E5SA 1EIHA 3ITPA 2NVQB 1HRJA 1SBBB 2SDFA 2OF1A 4B9WA 5EJWA 4G4KA 3M85A 1YNJC 4BY7B 1FD7D 1K8MA 3CU7A 3FRPB 3K58A 4B08A 2XN9C 2R7ZB 2JEAI 2K05A 3BVGA 1LV9A 3AMUA 2QF7A 1WCMB 4IFDH 4K14A 5M9OA 4FP5D 1LT4D 1G6ZA 2A6ED 3D6CA 5C0XJ 2WAQB 1EY4A 4XDXA 3T16A 1EY0A 4KKSA 4HCEA 2F0GA 2YU9B 2SNSA 1PFBA 3E0JA 5I6YA 2M00A 3URYA 2RSOA 3S1NB 4UAIA 1SNQA 3C2PA 3R3OA 3WOEA 1X3PA 4OIJA 3C46A 4IURA 1JOOA 2WP8J 3I4MB 2H4OA 2MP1A 3AU7A 2PW5A 3LWUA 2MGSA 2RA4A 1TWFB 2EY5A 1VMPA 2FMCA 5IODA 4G7ZC 1VCIA 4OO1H 4ZQ3A 4IFDG 2WKDA 1FNVA 2BDNA 5EKLA 1JOKA 5KNBA 1H9JA 3VA5A 5JEAH 4G57A 5A2QL 4Y7NB 1JB3A 2F0EA 2IL8A 4PMCA 3J80L 4Q0FA 3HGBA 3T13A 5HGTA 2EYLA 5C4ZA 3A8JE 3KBGA 1B9NA 1R4QB 1JORA 4L8JA 5JOBA 1BUVT 1C48A 1G2TA 5KIXA 4TQUS 5JPMC 3ZYYX 1CA6A 2XIWA 1LTAD 1SYGA 1HHVA 4A3GB 2K32A 1PLFA 2IWHA 1HTLD 2WIIB 2KA7A 3RD4A 1RJTA 3GTJB 1SSOA 1BO0A 4C3JG 1IKLA 1BCPD 4N9TA 4DN4M 4OO1G 1A2UA 4XT3B 1S5BD 1EWHA 1GJXA 2A69D 4UDUC 3D4DA 3VR4A 1Z6HA 5JEAG 2M9VA 5IOCA 2K6AA 3I4LA 1B53A 2WB1B 5KGUA 1PFNA 4E6IA 5E4XA 3SE0A 3I70A 3PUWA 4RKLA 5BN5A 2EY6A 1PZID 4IUVA 1QOHA 3DEOA 4L6TB 1GUNA 1KAAA 3QWNA 4DXGA 1FNWA 3EFXD 2WKCA 5C44B 4NP5A 3SK8A 1JR0D 2F0IA 4M1UB 3KLSX 2EYPA 4LJZC 4ZUJA 3L9AX 4M8AA 1TY0A 2I46A 2K7VA 1KNAA 2CVRA 2EDGA 3QO2A 4CGYB 4A3JB 3CQZB 2EJMA 1UAPA 3GV6A 2F0NA 1IHZA 1CZWA 1DOMA 5FO8B 1G291 4G7HC 2RSNA 1PTOB 3D3RA 1JOQA 1B1ZA 3EA6A 4ZRZA 2VXWA 1MSHA 3PO2B 1HQRD 3BZDB 2B2WC 3DWQA 3DUZA 2A68C 4B9XA 4H7BA 1Q3LA 1H9MA 3C1EA 4H0LC 3IFDA 1WTXA 3C3LA 3DWPA 4JK1C 1PTOD 4IQZA 2ZXRA 2NVTB 2L0CA 1PRTC 2X69A 5KNDA 4C1NI 1T5EA 3QG1A 4KN4C 5ELEA 4PNYA 2OXPA 1FGBD 1I4PA 4QF4A 4K8JA 4BBRB 1KNEA 1EU4A 5C4XB 2L4NA 3LNNA 4GZYC 2A6HC 1H9KA 3RZDB 1K8OA 1V1OA 1HTPA 1U4RA 1Y8PB 4KJOA 2JA7B 4C1NK 2BE5C 1STBA 4QCLA 1LLRD 2Q8RE 3KF8A 3X3NA 2YYZA 2IX1A 1WTVA 4HEDA 3HKZB 3PIP3 2EY2A 2RDHA 3MXPA 2NVYB 2WACA 2B2YA 3T53B 3T56B 1VDZA 5ELCA 1OXTA 2A5HA 2X6GA 2JYOA 4K5WA 2E2HB 2L11A 3MWYW 1WTRA 2F0KA 1S5CD 1WD0A 4LK1C 1I4RA 4O1NA 5CORA 2PQEA 3D4RA 4CJ2C 1S5FD 2G9HD 5IGCA 3N52A 1KTKA 4O42A 3K59A 1CTMA 4BA2I 1LTRD 1B44D 1S4ZA 3F2UA 3MXUA 2H1EA 1GUSA 4R8IA 1O80A 3D6WA 4XYQA 3V2TA 5F2DA 5BN4A 1HFNA 4QUFA 1EIGA 2F0DA 2EOTA 4EQNA 1GXDC 3MXGA 1MD2D 1UNSA 2A6EC 5I9OA 4X3UA 3T4AC 1STEA 2RQXA 4KY7A 2V4DA 4ZUIA 1FNUA 2LMCB 5CYUA 4OIKA 2A74C 5M5XB 2M2LA 2Z4IA 3IFTA 1CM9A 3SR1A 2EYOA 1EY5A 4X3TA 4U673 1QE6A 3PO3B 4RGMA 3DHQA 5KEEA 1B4OA 1ZKOA 3D4WA 2BDOA 1SNOA 2EYMA 4CJ1B 2NB0A 4FXGC 3J81L 3VR6A 3A7LA 1QB5D 3M3YB 5E4WC 3NQTA 3KLRA 3TN2A 2LY7A 4NW2A 2DNCA 2R3ZA 1ZEQX 1ESRA 2WV6D 1W6JA 4HAEA 2O5IC 3D8GA 3SXHA 3VR5A 5A2QE 1SJHD 4QIWB 5D3IB 1U4LA 3SEBA 3IKJA 5J22A 3TDQA 3M7NA 1CA5A 5DEHA 4NDXA 2E2DC 3J80E 5EPJA 1PDQA 5C3WA 2L5TA 5CC4A 1AZQA 4JBWA 3R93A 3VR3A 1HUNA 1I50B 4KKUA 2CW0D 5C4HA 3FPUB 1EYAA 2EPBA 1IYUA 1UEAB 1BCPC 5EGTA 2Q8TA 4C3HG 1ENFA 4PV1C 4CJ0B 4IUNA 5M5WB 1TWCB 2O5JC 1I4QA 2O2LD 4J6HA 1EQTA 1AW7A 2B8FA 4H44C 2AWNA 4RKBA 3NP8A 1QJOA 4NMZA 1PFMA 2F3VA 1E2ZA 1R4PB 1X3QA 5E3FA 3M4OB 1TT2A 4BA1I 3OHXC 2F0UA 1SMYD 1J9OA 4K6DA 2EJGC 3FMCA 4H13C 4C56C 2KEEA 1STYA 4XIGS 3P7JA 1DJRD 3J7AV 4TRDA 5COYA 4KTAA 1Y8OB 3JAML 3MZ5A 3RUZA 3V96A 1G91A 2OT2A 2D9UA 1J8IA 1B9MA 1WTOA 1S5ED 4MIUA 4EQPA 1DD2A 4X3KA 2VB3X 3NTHA 4DAPA 2IW3A 1AEXA 1TWGB 2NN6G 5CBAE 5C4JB 3CRKC 1YNND 1ICWA 2GA4B 4DAYA 3QJYA 3NBIA 1Q90A 3LX0A 4WFN3 2ICEC 2F0HA 4F7XA 2FJ2A 3QOJA 1R9TB 3HOXB 2K33A 4C2MB 5T1GA 4S3SA 3SK4A 4KD4A 2IJ0A 4KJNA 4XQJA 3DWAA 1SNPA 3NE5B 2L55A 1O78A 2PYKA 1U4MA 3P20A 1C8CA 2BCOA 3DXJC 2HUGA 3FVQA 3EQLC 1XYIA 3HOZB 4FF2A 5NUCA 4KN7C 1HCZA 3NK9A 1Q8IA 1TS3A 2F3WA 3H3VC 1PTOC 4RGNA 1LT3D 4C3JB 3A56A 1IL8A 5K36H 2NZ1D 1WTQA 5IGFA 5I4DA 3IAYA 1BOSA 3S14B 4ZKBB 2RBMA 3BDLA 5JAVA 3PUZA 1OXXK 2J0TD 2K5QA 1QG7A 3KBXA 2EYFA 2ID0A 1I6VC 1QNKA 4K5VA 1WTPA 4A3IB 3A55A 5ELBA 3NWTA 4XQNA 4I7ZC 5I6WA 1SE4A 1NUCA 1TKWB 1JC7A 3HP3A 3QB3A 1VF5C 3W3AA 5T1IA 4DXFA 2R92B 4TSSA 1TIID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3W A;  3V2T A;  5F2D A;  5CV5 A;  4S3S A;  3EVQ A;  4NP5 A;  4ZQ3 A;  3SK4 A;  2SNM A;  4KD4 A;  2F0I A;  3SK8 A;  2F0D A;  1STN A;  5CC4 A;  2EYJ A;  4KJN A;  5HUR A;  5IGB A;  2EYH A;  4HMI A;  1EY7 A;  1JOK A;  1SNP A;  1STA A;  2LKV A;  3QOL A;  2RDF A;  5EKL A;  1A3U A;  4DU9 A;  3NUC A;  4EQN A;  2EYP A;  5CV9 A;  5DAU A;  4ZUJ A;  4K8I A;  4KJO A;  4N9P A;  3VA5 A;  2PW7 A;  5C4H A;  2PYK A;  1TQO A;  1EYA A;  3ERQ A;  4G57 A;  4F8M A;  1NSN S;  3E5S A;  3P75 A;  1STB A;  3ITP A;  5I9O A;  5CGK A;  5E1F A;  4QMG A;  4EVO A;  3MEH A;  4HMJ A;  5NUC A;  2KHS A;  2RKS A;  4NKL A;  3NK9 A;  4KY7 A;  2PZU A;  2OF1 A;  5IGE A;  5EGT A;  3TP8 A;  4B9W A;  2F0S A;  2F0E A;  2F3W A;  4PMC A;  4ZUI A;  2F0V A;  5ISR A;  5C6A A;  2F0F A;  4IUN A;  1F2M A;  2SOB A;  3DMU A;  4IZ8 A;  3HZX A;  4LAA A;  3T13 A;  5HGT A;  3OSO A;  2EYL A;  2QDB A;  2F0N A;  1IHZ A;  4J6H A;  5C4Z A;  5IGF A;  3SK6 A;  1KDA A;  5IGG A;  3SR1 A;  1JOQ A;  4ID6 A;  5KRU A;  1JOR A;  4RKB A;  2EYO A;  2EY2 A;  1EY5 A;  3NP8 A;  1SYC A;  5JOB A;  1KAB A;  4WOR A;  4KD3 A;  1EZ8 A;  4NMZ A;  2RBM A;  3BDL A;  5EKK A;  2F0J A;  1KDB A;  3P1H A;  3MXP A;  5KIX A;  2F3V A;  5JAV A;  5C5L A;  4YIJ A;  2OEO A;  2F0W A;  5C5M A;  1EYC A;  3DHQ A;  5KEE A;  4B9X A;  4K14 A;  1EQV A;  2WAC A;  1ENC A;  3MHB A;  4DF7 A;  4H7B A;  1SYG A;  4ODG A;  3D4W A;  5E3F A;  5M9O A;  1SNO A;  5KYI A;  2EYM A;  4EQO A;  4K2L A;  1TT2 A;  1SNC A;  4K5W A;  4HTH A;  5CV4 A;  4J1M A;  2F0U A;  3C1E A;  5J22 A;  1F2Z A;  2F0O A;  4R8N A;  3TP6 A;  1TR5 A;  3NHH A;  5I9P A;  2PZW A;  3D6C A;  3TME A;  4DGZ A;  2EYF A;  4K6D A;  1A3T A;  3C1F A;  1EY9 A;  1SND A;  3TP7 A;  2KQ3 A;  3OMG A;  1EY4 A;  1EYD A;  1STY A;  4IAL A;  4N9T A;  4K5X A;  3U9O A;  5CV8 A;  5IIF A;  2F0K A;  5K5P A;  1STG A;  2HQE A;  1A2U A;  3T16 A;  1EY0 A;  1SYE A;  1U9R A;  4K5V A;  3NQT A;  2EXZ A;  4KTA A;  4TRD A;  5KYL A;  2ENB A;  4KY5 A;  3MZ5 A;  1SYB A;  4KHV A;  2F0G A;  3D4D A;  3RUZ A;  2NUC A;  2SNS A;  5I6W A;  2PQE A;  1A2T A;  1NUC A;  1STH A;  5IOC A;  5J39 A;  3TP5 A;  5I6Y A;  4MIU A;  2M00 A;  4K2K A;  1A3V A;  2F0M A;  2EY1 A;  3ERO A;  4WRD A;  3BDC A;  4EQP A;  1SNQ A;  1EZ6 A;  4KY6 A;  5IGC A;  3R3O A;  3QB3 A;  5KGU A;  3HEJ A;  4E6I A;  3SK5 A;  3PMF A;  3OMC A;  1AEX A;  1F2Y A;  3OWF A;  4PNY A;  4RKL A;  5J1Z A;  2EY6 A;  3D8G A;  1KDC A;  4PMB A;  3SXH A;  2O4X A;  2OXP A;  1II3 A;  1ENA A;  1JOO A;  1SNM A;  3EJI A;  5CV6 A;  1RKN A;  4I65 A;  1SYF A;  4QF4 A;  5CR3 A;  1EY8 A;  3NXW A;  2F0P A;  3MVV A;  2F0Q A;  3H6M A;  2PZT A;  2PW5 A;  1SYD A;  4K8J A;  4KV6 A;  1KAA A;  3LX0 A;  4ME5 A;  3SHL A;  4DFA A;  4QB4 A;  4OL7 A;  2F0H A;  1EY6 A;  5DEH A;  2EY5 A;  4NDX A;  4F7X A;  3QOJ A;  2F0T A;  5C3X A;  3S9W A;  2F0L A;  5IGD A;  5IOD A;  5CV7 A; 
#chains in the Genus database with same CATH topology
 1XNQ L;  3RR5 A;  3HG9 A;  2LFN A;  4DV3 Q;  3K0Y A;  2EYJ A;  4L5R C;  1FR3 A;  1V43 A;  1WD1 A;  4POF A;  1MGS A;  4IO9 A;  1U4P A;  1XMO Q;  4CKC A;  1RHP A;  1IYV A;  5DAU A;  4F8M A;  2ZTD A;  1GHK A;  5CGK A;  1EYG A;  3HOY G;  2AQ3 B;  1CKM A;  4QGU A;  4NKL A;  1GUG A;  2EIF A;  2EZV A;  3MXN A;  4JI2 L;  4JBM A;  2J7Z A;  1VMC A;  3HZX A;  1LTB D;  2KCN A;  1I6H B;  3FDT A;  3CHB D;  1T5X D;  3GO5 A;  1KDA A;  1CZG A;  2KEC A;  2SEB D;  4DV0 Q;  3SGI A;  3T51 B;  2R61 A;  2E76 C;  1KDB A;  3KF6 A;  3NWS A;  4JBJ A;  2OEO A;  1LTI D;  1HZC A;  4C3I H;  2BA1 A;  3RLF A;  1NY4 A;  1M90 C;  3S17 B;  1V1P A;  2JA5 B;  5KYI A;  1DGS A;  2R92 G;  3GTP H;  3WDN A;  3S17 H;  3PV0 A;  5C3E G;  1L1O A;  4R8N A;  2B2T C;  3IL8 A;  3TP7 A;  4IFD J;  1UEB A;  5CV8 A;  2EXD A;  3D31 A;  4V19 0;  4KHV A;  3F1Z A;  1DOL A;  1X6O A;  1QVG A;  4K6L A;  4FYD A;  2XVS A;  1EWC A;  1CFM A;  4OX9 L;  1JB7 A;  4KHZ A;  3EN2 A;  4WJ4 A;  1IBL L;  5BR8 Q;  5DNF A;  3ZJY C;  2F03 A;  5IT9 E;  5CV6 A;  1RKN A;  4I65 A;  2IT1 A;  4ZYS A;  1S5D D;  3KF8 B;  3KK7 A;  2F0Q A;  1I4H A;  4DFA A;  1SYD A;  3H3V I;  1XX8 A;  5IP7 H;  2WB1 E;  2K1B A;  1UE6 A;  4OHJ A;  1JWS D;  1GUO A;  2L9H A;  1MHW C;  1VQC A;  3NBH B;  2NBF A;  1LM0 A;  2UXC Q;  3JAM c;  4KI0 A;  2KUM A;  2NYZ D;  1VQL A;  1L2F A;  4N8X 1;  2VUM H;  3L0O A;  4KKT A;  1A6X A;  2K5H A;  3S1R H;  5EPL A;  2XSC A;  4UP9 A;  2N78 A;  2JE6 I;  2RKS A;  1VS0 A;  2JA8 H;  2G9D A;  3PIP A;  2JP1 A;  3EBE A;  2C35 B;  3E3X A;  1G6P A;  2B39 A;  4AYB B;  2SOB A;  5JEA J;  4Z9C B;  3F2D A;  4A3M H;  3I7F A;  3OSO A;  3CD6 A;  4HJ5 A;  2QDB A;  4PZ7 A;  2N8N A;  1YVC A;  4A3F H;  4UP8 A;  5IP9 H;  3UDF A;  3K5O A;  3J81 E;  4YCW A;  4JI1 L;  1VQE A;  3TRE A;  4WOR A;  4LF4 L;  4A93 B;  4L5T A;  4FXK C;  1C9O A;  1KIX A;  2XTI A;  3W2D A;  3VDY A;  2N55 A;  4BY1 H;  4R4C A;  1LAB A;  4P74 A;  4X6A H;  3L2P A;  1K83 B;  4ZAI A;  2E8G A;  1JCK B;  1NMG A;  4HTH A;  1RD9 D;  3GQB A;  1ONL A;  5IP7 G;  1F2Z A;  1IZ6 A;  3H91 A;  2LSS A;  1EY9 A;  3NBH A;  1E2V A;  3VYT A;  2CQO A;  3U9O A;  3KUP A;  1YJW A;  1ET9 A;  3L3O C;  2HQE A;  3UDG A;  3OIQ A;  2VUM G;  2CW0 C;  4NB3 A;  1MSG A;  5J39 A;  1E0B A;  1IKM A;  4O2D A;  3EIV A;  1H9S A;  2NVX H;  4DR6 Q;  4FVM A;  2JA8 G;  3PMF A;  3K7U C;  1C4Q A;  3BJU A;  4AYB G;  1Q7Y C;  5FO7 B;  1EY8 A;  3MVV A;  1TWH H;  1HZA A;  4A3F G;  5IP9 G;  4QB4 A;  5AFW A;  1D1K A;  2OWO A;  1ILQ A;  2K28 A;  1TVX A;  4MZ9 A;  1IBM Q;  1QIL A;  1HUM A;  4JOI A;  1Q1B A;  4BY1 G;  5LMN Q;  1VQK A;  3NEL A;  3GTL B;  4ME3 A;  2XWJ B;  5FLX L;  5CV9 A;  1B7Y B;  1TXY A;  4CDC C;  2K5N A;  2PW7 A;  3ERQ A;  5M3M B;  4ZCK A;  4A3K H;  1VQ4 A;  1NSN S;  2MQH A;  3Q22 A;  2PCF B;  1CK1 A;  1OXV A;  1SMY C;  1JIC A;  1CKN A;  3OOC A;  2UXD Q;  1PYS B;  3FEW X;  1EOV A;  1VQB A;  4HIO A;  5HGQ A;  5FKA C;  3M4Q A;  1KAW A;  2PI2 E;  1XWE A;  3PUV A;  2OTL A;  3FKI H;  2TSS A;  2FFK B;  1B70 B;  1EFI D;  5FK9 C;  4KLK A;  3J7A F;  1JE5 A;  2PNR C;  4YWK A;  5KRU A;  1QVC A;  3H09 A;  1KAB A;  2VS1 A;  3MFY A;  1EZ8 A;  4NXN L;  2K5V A;  1Q1E A;  5C0X H;  4R4T A;  1I4G A;  3LWE A;  1RIP A;  3N6R A;  1Y1W H;  5FOB B;  2Y0S G;  4ABN A;  3CC4 A;  1ENC A;  4JI3 L;  1MJE A;  2KOL A;  1QNU A;  1Z9F A;  2FMM A;  5C0X I;  3AFP A;  4X62 Q;  1IXR A;  1YI2 A;  1PFS A;  4NXM L;  4BXX H;  4OON A;  1JQY D;  2A73 B;  1ML0 D;  1PRT B;  3E9I A;  3KJP A;  3U4V A;  4HCS A;  2K03 A;  5IIF A;  3BVM A;  2AQ1 B;  3KLW A;  4P75 A;  4QUC A;  5GQO A;  3NEM A;  4RAU C;  3Q23 A;  1NCV A;  2B2T A;  3A54 A;  4A3K G;  3GTQ B;  1STH A;  4AQY Q;  3S1M B;  3ERO A;  2JA6 B;  1DM0 B;  1A15 A;  2XGT A;  3BDC A;  4WRD A;  4JI5 Q;  3SK5 A;  2B2W A;  3T1H L;  4X66 Q;  2CHB D;  2YTY A;  1N8R C;  2R93 H;  2DY8 A;  1PRT D;  3MFG A;  4C3H B;  1JWU D;  1Y1V B;  4LFA Q;  3FKI G;  2MNA A;  1ASY A;  2F0P A;  3BVZ A;  2B2V C;  3G7L A;  4DUZ L;  3GD7 A;  4G7O C;  4LFB L;  3K5N A;  3S9W A;  4B3R Q;  2F0L A;  5IGD A;  2E2J H;  1VQH A;  1Y1W G;  3TBI B;  1HNZ L;  1RL2 A;  4A3E B;  4LWC A;  5CMD A;  1PH8 A;  3S1Q B;  2IHE A;  1STA A;  2IHF A;  2K04 A;  3AYH B;  3R2T A;  4DU9 A;  2XNA C;  3NUC A;  3H0G H;  4R9W A;  1V8Q A;  3S16 H;  3S2D H;  2ALY B;  4N9P A;  1AFP A;  4BXX G;  1IW7 D;  1N32 L;  2HHH Q;  1VQ7 A;  1JE4 A;  3A8I E;  4RHR A;  2E2I B;  1U5K A;  1O7Z A;  2PZU A;  3HOU H;  2F0S A;  3LGJ A;  4GLV B;  4OGQ C;  3T1Y L;  2PPB C;  3TS2 A;  4A3D H;  2QEJ C;  5ISR A;  5C6A A;  3FHW A;  3I4N B;  4KHP L;  1SDF A;  4Y52 H;  4XTC S;  3FPP A;  1CI3 M;  2DNE A;  5I2X A;  3A5Z B;  2K52 A;  1PA6 A;  3GTO B;  4DNI A;  3K5M A;  2KBN A;  3UDX A;  3S15 H;  1G8Z D;  1SAP A;  4YIJ A;  2IX3 A;  4CKE A;  2R93 G;  4PQX A;  1EQV A;  4OEL B;  4MHE A;  4A3B H;  4DF7 A;  5LMU Q;  2K5D A;  1NMF A;  1SNC A;  3BS1 A;  2ZJP A;  2A69 C;  4DR5 L;  3CRL C;  3GTG B;  1EL0 A;  1IL2 A;  2K01 A;  2KQ3 A;  4DAY B;  2A1A A;  4IPD A;  4X65 Q;  2K14 A;  2UUC Q;  3I73 A;  1ILP A;  2KHJ A;  1F77 A;  1U9R A;  1PVO A;  2KCT A;  3BDO A;  4FNF A;  4DV4 L;  1ASZ A;  1SYB A;  3H0G G;  3CC7 A;  3K57 A;  2NUC A;  1UUP A;  5ELD A;  2NWG A;  2ZXP A;  1LT5 D;  4DK0 A;  3ULP A;  3S2H H;  2F0M A;  2EY1 A;  3KFU A;  1B3A A;  3BYT B;  4DR4 Q;  3HOU G;  1YJ9 A;  3TQY A;  4A3D G;  4J8Q A;  1LAC A;  1S40 A;  1ESF A;  3DEP A;  2UXB L;  1AZP A;  5M5Y B;  4R1J A;  1Q81 C;  3I4N G;  4GN5 A;  3RLO A;  1ZXT A;  2NVQ H;  1DXM A;  4ME5 A;  3M9B A;  3MAQ A;  2F0T A;  2N3S A;  2QCP X;  1D6E C;  1XXG A;  5CBE E;  5IY0 A;  4JI6 Q;  1CKO A;  4DV1 L;  1L0X B;  2F4V L;  3L7Z C;  2JQO A;  5HUR A;  1YHB A;  4QIW E;  1B2T A;  3K7A B;  2RDF A;  2BOS A;  3K7A H;  4FF4 A;  3VA7 A;  3J80 i;  5G3L D;  3Q6S A;  1KD1 C;  2Z1C A;  2R7Z H;  3P75 A;  4QQB X;  3ONA B;  4DV6 Q;  2FXQ A;  3AQQ A;  2J4X A;  3K0X A;  3U9S A;  3MC0 B;  1MBY A;  4LF6 Q;  1YZ6 A;  3ND9 A;  2R6G A;  3GP7 A;  1F2M A;  2HCC A;  3DMU A;  4IFD I;  1RCV D;  1E1O A;  4LMQ D;  2NTS A;  4KMU C;  1I5F A;  1NJI C;  3ND8 A;  2KED A;  1C0A A;  3ICE A;  2UUA L;  2F1M A;  2B63 B;  3NTI A;  4ILW A;  3M7G A;  1PYW D;  1LYL A;  1AN8 A;  5C5L A;  3HOV B;  1F9Q A;  1VQM A;  1D5Z C;  2MUY A;  1EYC A;  1ZYR D;  3CF5 A;  1BNZ A;  3S24 A;  2YU9 H;  4DR2 Q;  2HDM A;  4ODG A;  4LF5 Q;  4R4I A;  1LTS D;  2ICI A;  4JI8 Q;  5CV4 A;  4IUQ A;  3MTS A;  1D1I A;  4J1M A;  2OTJ A;  1OXS C;  3S1N H;  1F2L A;  2PZW A;  5EBC A;  2Q8I B;  4F88 A;  5I2Y A;  4LF9 L;  3WWV A;  1KLG D;  3G48 A;  3I91 A;  1GM5 A;  5DM7 3;  5D65 A;  3X3M A;  3I4M H;  2NZO A;  3HS0 C;  3K6O A;  3M4Y A;  4KY5 A;  2VQE Q;  3JC6 6;  4A3L H;  1TWF H;  3GTM B;  1I3Q B;  1T9H A;  2R7Z G;  1A2T A;  1D7Q A;  4A3C H;  4HSV A;  2GVB A;  4J15 A;  1SXT A;  3PUX A;  1F9S A;  3HOY B;  1KHI A;  3OMC A;  1F2Y A;  4JI0 Q;  1PXU A;  1HR0 Q;  1E2W A;  2K75 A;  4OO1 I;  1ENA A;  2CWP A;  2ZM6 L;  2NTT A;  4HSP A;  1L0Y B;  4DNR B;  2WAQ G;  3MXN B;  4Y7N H;  1M1K C;  1MIU A;  1AP0 A;  3VYR A;  1EY6 A;  1XMQ Q;  4DV2 L;  2AWO A;  2JEB I;  3SVM A;  5CV7 A;  1PH3 A;  1LT6 D;  5JPN C;  2AQ2 B;  1FVI A;  3EVQ A;  3OW7 A;  5KNC A;  4PMW A;  1LTG D;  1BCP B;  1BBU A;  2B2V A;  1C7Y A;  3CW2 C;  5DM6 3;  4HMI A;  2B2Y C;  3O13 A;  3A74 A;  3KLS A;  4DR1 L;  1CT1 D;  1JJG A;  1IBK L;  2B8G A;  1WFQ A;  4HN7 A;  4CKB A;  3GTK B;  1I94 Q;  5K36 G;  1PZK D;  5C3E B;  3MEH A;  4HMJ A;  4GKK L;  1V1P B;  4OXP A;  3MA2 B;  4LUO A;  4WJW A;  3TP8 A;  1VF7 A;  5D3D A;  1L1O B;  3I4M G;  1SFO B;  2F0V A;  4DV7 Q;  4CBV A;  5TSS A;  2JJQ A;  3I3C A;  4LF8 L;  1RTO A;  4A3L G;  3NEN A;  1HPC A;  3AFQ A;  4HIM A;  3A7A B;  5IGG A;  4A3C G;  1O7L A;  4IUT A;  3GTJ H;  4XYO A;  2JSO A;  1O7Y A;  1I4X A;  1JWM D;  2HCI A;  2Z9H A;  1FJG Q;  3PUY A;  2D5D A;  4MN3 A;  1DZ1 A;  1Y69 U;  4EGV A;  4B3S L;  2VQF Q;  1CHQ D;  1N36 Q;  1N33 Q;  4FXD A;  1QWY A;  1PH4 A;  1Z7T A;  1BXT A;  2A8V A;  1PRT F;  2NZH A;  2ZXO A;  3I8Z A;  4GN4 B;  2MPM A;  1HNW Q;  3GV3 A;  1DYQ A;  4IUP A;  5EQ0 A;  3TME A;  4DGZ A;  4KK7 A;  3C1F A;  1HJP A;  3OMG A;  3NTK A;  1EU3 A;  4IAL A;  2F3I A;  1STG A;  2LXK A;  1PMR A;  4K0K L;  1YNJ D;  2I07 B;  3OTO L;  2ENB A;  4JYA Q;  4C3I B;  4L63 B;  4OWT B;  4V0B A;  3R8B A;  1HNX Q;  2QGQ A;  1VQI A;  4AIM A;  4X3S A;  5C44 H;  1NR4 A;  1XNQ Q;  3GTP B;  1OXU A;  4K2K A;  3HKS A;  3KYH C;  2C9O A;  3K8A A;  4BS9 A;  4JV5 L;  4RGT A;  1VQ6 A;  1ICF B;  5FLX E;  1GUT A;  5J1Z A;  4GOP A;  4UY8 C;  3TZD A;  1CQF A;  1Z47 A;  2CH4 W;  4PMB A;  1KDC A;  4RCN A;  3V05 A;  1II3 A;  2P5Z X;  3EJI A;  2JXM B;  3TSS A;  5ELO A;  3Q24 A;  1B3Q A;  2V1C C;  4JI7 L;  2PZT A;  2FIN B;  4OL7 A;  4L5S A;  2BA0 A;  1KLU D;  3SDZ A;  5C3X A;  4JI2 Q;  1CQV A;  2DN8 A;  4A3J H;  4DUY L;  1Q82 C;  1GVP A;  1VQP A;  2PO4 A;  1LTT D;  5L37 A;  3H94 A;  3CCQ A;  2EYH A;  1HZB A;  3QOL A;  4GN3 B;  2L12 A;  3H3V H;  2XWB B;  1PTO H;  1SRO A;  3I72 A;  4K8I A;  1TWA B;  2G5D A;  1NNX A;  1TWA H;  3PO2 H;  1AE3 A;  5IWA L;  4GKJ L;  1Q12 A;  2KCC A;  3OWE B;  5GAG C;  5IGE A;  5EBD A;  3NPP A;  1BR9 A;  3G6J B;  5D14 A;  4IZ8 A;  3WOF A;  4JV5 Q;  5A35 A;  1ET6 A;  4C3I G;  1PZJ D;  1PH9 A;  5C44 G;  2VUM B;  2D62 A;  4R4O A;  2AUK A;  1X32 A;  4ID6 A;  3QR8 A;  4RGO S;  5J3B A;  3TZU A;  1S72 A;  5EKK A;  3VYS A;  4ULL A;  3S1R B;  1G2S A;  1QUQ A;  5EKI A;  3TS0 A;  4ZK9 B;  2IX0 A;  1CSQ A;  2JA8 B;  1D5X C;  4LUV A;  1H9S B;  1TU2 B;  2CFM A;  3Q0A A;  3BG3 A;  4EQO A;  4OX9 Q;  4A3M B;  2F0O A;  3NHH A;  1NAP A;  1WTH A;  4HJ9 A;  4A3F B;  1IBL Q;  2B2U C;  1HFG A;  2RDG A;  3G4S A;  4FF1 A;  4A3J G;  4K5X A;  4GNX C;  1GHJ A;  2WIN B;  3A8K E;  1SYE A;  3BU2 A;  5KYL A;  3DM1 A;  1LTL A;  2E75 C;  1EIF A;  4UP7 A;  2Q2U A;  4BY1 B;  1GOZ A;  4BBR H;  2EJF C;  5ELF A;  2B29 A;  1EEF D;  4WJ3 M;  5C4X H;  1IW7 C;  4UPA A;  3BYY B;  1UWV A;  2QW7 A;  3TP5 A;  3PO2 G;  5G3L F;  3J81 j;  1RTN A;  3RZD H;  3I90 A;  3UI2 A;  4POG A;  2XRQ D;  1SE8 A;  1CHP D;  4RH6 A;  2FHT A;  3HEJ A;  4ALP A;  1SEB D;  4YY3 L;  1PH5 A;  3VYU A;  4YHH L;  1CKN B;  2JA7 H;  3CCV A;  1SYF A;  4HID A;  3H6M A;  1DON A;  5M3F B;  1H9R A;  4KV6 A;  1PH6 A;  5M3F H;  1J6Q A;  5LL6 X;  3HOW B;  2UUB L;  1X54 A;  2KVM A;  4HR7 B;  3HOW H;  5CV5 A;  2NVX B;  2SNM A;  3ER0 A;  5IGB A;  1EY7 A;  4JI1 Q;  2XRS D;  2Y0S B;  4MNO A;  3PSI A;  3AEV A;  4LF4 Q;  1B50 A;  3CCS A;  1TQO A;  4A3M G;  4F87 A;  1TWH B;  1UE5 A;  1U0L A;  5E1F A;  2NVY H;  1M8A A;  1M4V A;  4X64 L;  5BN3 A;  1K9M C;  2MHV A;  1BDO A;  1G51 A;  4RA8 A;  2D2C C;  2DY7 A;  2MJ8 A;  2PQA A;  4LAA A;  1YHA A;  4BBR G;  5JJZ A;  3W5O A;  5C4X G;  4BWG B;  3J80 c;  2F4I A;  4A3K B;  4KD3 A;  5LL6 S;  4AYB E;  5C5M A;  3OIP A;  1EEI D;  4DK3 C;  2JA7 G;  2K5W A;  5GAE C;  3J81 i;  1BQQ T;  4DK1 A;  2E74 C;  3FKI B;  5M3F G;  2KCM A;  3TP6 A;  3RNU A;  3F2C A;  1SJE D;  2KJX A;  1TS2 A;  1A3T A;  2VB2 X;  3OW2 A;  1TY2 A;  1EYD A;  3HOW G;  5LMN W;  5K5P A;  2AKW B;  1MI2 A;  4UHV A;  4GLX A;  5FLM H;  1Y1W B;  3JAM E;  1J5E L;  3HKZ G;  4ZKC B;  1UE7 A;  4XQQ A;  3PQI A;  1YNN C;  1A3V A;  2TMP A;  1TS4 A;  3CPW A;  1JJC B;  1BF4 A;  4FF3 A;  2HDL A;  1XTC D;  1OO9 B;  2A68 D;  2O4X A;  5IT9 L;  1VQF A;  5CR3 A;  1WTW A;  5JVG 3;  3NXW A;  1GUW A;  1HQM C;  4FO2 A;  3SHL A;  1MJC A;  1SE2 A;  2L1B A;  1BBX C;  2ASB A;  2KEN A;  4DNT B;  1HXY D;  3CKI B;  1F9P A;  1LO5 D;  1BCP F;  2Y0S E;  3QIA A;  1KL9 A;  3PCO B;  2N88 A;  1TS5 A;  1RDP D;  2C5C A;  4LF7 L;  5M5X H;  3OPO A;  1STN A;  1ZYR C;  4DAV A;  3CMA A;  1VQA A;  1NR2 A;  4B3M L;  2R93 B;  2DUD A;  4NXN Q;  4RWS C;  3K81 C;  3NQI A;  4EX5 A;  1FYC A;  4QMG A;  4EVO A;  3PO3 H;  2KHS A;  4JI3 Q;  1X9N A;  1WOC A;  2E2J B;  1VQJ A;  4IJH A;  5C0X G;  5FLM G;  4NXM Q;  2F0F A;  1D2B A;  4RHS A;  1EOT A;  2JA9 A;  1D5M C;  2RVL A;  3SK6 A;  4RCO A;  4ZLT F;  3PIO 3;  4JPB W;  1HA5 A;  3H0G B;  3S16 B;  3S2D B;  3NSW A;  1PYB A;  4L5Q A;  1SYC A;  1W3S A;  4CHT B;  1KRT A;  2F0J A;  2CQA A;  1A62 A;  3P1H A;  2X6L A;  2A6H D;  2EE1 A;  5AJ3 L;  3M3Y H;  4LFC L;  4IUU A;  4HJ7 A;  1W6K A;  1WYD A;  2WFW A;  4IN3 A;  2F0W A;  4DR7 L;  2VL6 A;  3HOU B;  3J7Y W;  4XXE A;  5LHY 1;  3MHB A;  1QCB D;  3TRZ A;  4A3D B;  4K2L A;  1O7I A;  2EVB A;  2BE5 D;  4P2C B;  3HFZ B;  1TR5 A;  5I9P A;  3T1H Q;  2Z8L A;  2UU9 L;  4IOC A;  1SND A;  4DPG A;  4Q5V A;  2E5L L;  3R2I A;  3VR2 A;  1Y8N B;  2QIL A;  2QKI C;  2LS0 1;  2AUJ D;  3S15 B;  4DUZ Q;  3KOJ A;  2EXZ A;  1V9P A;  2VNU D;  2B3G A;  4TKO B;  4U68 A;  4LFB Q;  4OWX B;  1X56 A;  2B2U A;  2PMZ B;  4A3B B;  2IPK D;  1ROD A;  3AB9 A;  1VQN A;  2GVA A;  4NPS A;  3RZO B;  1HA6 A;  1HNZ Q;  4JW0 A;  3RZO H;  1JT8 A;  4CDF C;  3PO3 G;  1EZ6 A;  4KY6 A;  4DA2 A;  4MTN A;  3OWF A;  5FO9 B;  1F9R A;  1PH1 A;  5EPK A;  1I50 H;  1IYJ B;  2HD3 A;  2Z0S A;  1SNM A;  1XPU A;  1N32 Q;  4FDB A;  3RMH A;  4DR7 Q;  1DCZ A;  4RG1 A;  3HRZ C;  3IRB A;  2ZT9 C;  4A76 A;  1SE3 A;  4XT1 B;  3T1Y Q;  2NN6 H;  3E6Z X;  4RFB A;  3K5L A;  1RF2 D;  1PTO F;  3S2H B;  5M5W H;  4KHP Q;  1A8V A;  2Z4H A;  4BBS B;  1X3F A;  4DV5 L;  1BVS A;  1WVL A;  2LKV A;  4BBS H;  2NN6 I;  1A3U A;  3GDE A;  5JVH 3;  1N34 L;  1L1O C;  1DOK A;  4H02 A;  3E5S A;  1K3R A;  1EIH A;  3CP0 A;  3ITP A;  2NVQ B;  1HRJ A;  2A19 A;  3G6E A;  3I55 A;  2KHI A;  4JI4 L;  1SBB B;  2SDF A;  2OF1 A;  4B9W A;  5EJW A;  1YIT A;  1PHJ A;  4G4K A;  3M85 A;  3M4O H;  1YNJ C;  4IPG A;  4DR5 Q;  4BY7 B;  1FD7 D;  3W1B A;  1XNR L;  4BY7 H;  1K8M A;  4DR3 L;  3F2B A;  4A3B G;  3CU7 A;  3FRP B;  3K58 A;  2L15 A;  4B08 A;  2XN9 C;  2Q2H A;  2R7Z B;  2OQK A;  2JEA I;  2K05 A;  3STB D;  3BVG A;  4DV4 Q;  1LV9 A;  3AMU A;  2QF7 A;  1WCM B;  4IFD H;  4K14 A;  3CXC A;  2HT1 A;  1KRS A;  1WCM H;  2QEX A;  5M9O A;  2PNH A;  4FP5 D;  3PF5 A;  1XJV A;  4APV A;  1LT4 D;  2GN5 A;  1G6Z A;  2A6E D;  3D6C A;  5C0X J;  2WAQ B;  1TWG H;  3U58 A;  1EY4 A;  2UXB Q;  2PMZ E;  5C4J H;  4XDX A;  4JCV E;  1YNX A;  1KXL A;  3I56 A;  3T16 A;  1FL0 A;  1EY0 A;  4KKS A;  4LW1 A;  3Q8D A;  4HCE A;  4BBS G;  2F0G A;  2I5L X;  2YU9 B;  2SNS A;  1PFB A;  1CSP A;  3E0J A;  4DV1 Q;  4IPH A;  5I6Y A;  2F4V Q;  2M00 A;  4C2M H;  3URY A;  2RSO A;  3S1N B;  4UAI A;  1SNQ A;  3C2P A;  3R3O A;  3WOE A;  1X3P A;  4OIJ A;  2Z6B A;  3RN5 A;  1EUJ A;  3C46 A;  4IUR A;  1JOO A;  2WP8 J;  2HIV A;  3F8T A;  3I4M B;  4A4I A;  2H4O A;  4BY7 G;  1EQQ A;  2MP1 A;  3AU7 A;  3RLN A;  2PW5 A;  4B3T L;  3HOZ H;  3LWU A;  2MGS A;  2RA4 A;  1TWF B;  2MO1 A;  4HJ8 A;  2EY5 A;  1VMP A;  1PH7 A;  3A0J A;  1CUK A;  4GS3 A;  2FMC A;  1K0S A;  5IOD A;  4QY7 A;  4C3J H;  4G7Z C;  2QDL A;  3K80 C;  1VCI A;  4OO1 H;  4ZQ3 A;  4IFD G;  1LUZ A;  2WKD A;  1FNV A;  1AH9 A;  1WCM G;  2BDN A;  5EKL A;  1JOK A;  2R7D A;  5KNB A;  1H9J A;  2UUA Q;  3VA5 A;  5JEA H;  4G57 A;  5A2Q L;  3DLL A;  4QJF A;  3CME A;  4Y7N B;  2BH2 A;  2VY3 A;  1PV4 A;  5IT9 c;  1JB3 A;  1SMX A;  2F0E A;  5GRO A;  2IL8 A;  4PMC A;  3J80 L;  4Q0F A;  1E22 A;  3HGB A;  3T13 A;  5HGT A;  2EYL A;  4DV3 L;  3A8J E;  3KBG A;  5C4Z A;  1B9N A;  4LF9 Q;  2OQ0 A;  1R4Q B;  2DGY A;  3UE0 A;  4DK6 C;  1JOR A;  1XMO L;  4L8J A;  5JOB A;  1BUV T;  1C48 A;  1G2T A;  5KIX A;  4TQU S;  1HR0 W;  1E24 A;  3H15 A;  5H1S E;  4A3I H;  3U4Z A;  5JPM C;  3ZYY X;  1L0W A;  1CA6 A;  3ULJ A;  1WJJ A;  2XIW A;  1LTA D;  2WAQ E;  1SYG A;  1HHV A;  4A3G B;  2K32 A;  1PLF A;  2IWH A;  4A3G H;  4PZ8 A;  3HOZ G;  4GOP B;  1YJN A;  1HTL D;  2WII B;  1VQ9 A;  2KA7 A;  3RD4 A;  1X65 A;  1RJT A;  3GTJ B;  1EIY B;  1SSO A;  1BO0 A;  4C3J G;  1IKL A;  1BCP D;  4JOI C;  4N9T A;  4DN4 M;  4OO1 G;  2ZM6 Q;  4DV0 L;  1A2U A;  4XT3 B;  1K8A C;  1S5B D;  1EWH A;  1GJX A;  2A69 D;  4UDU C;  3D4D A;  3VR4 A;  1Z6H A;  3J81 c;  4DV2 Q;  5JEA G;  2M9V A;  4DAM A;  5IOC A;  1A0I A;  2K6A A;  3I4L A;  1B53 A;  2WB1 B;  2ZTE A;  5KGU A;  1PFN A;  4E6I A;  5E4X A;  3SE0 A;  4DR1 Q;  3I70 A;  3PUW A;  4RKL A;  1IBK Q;  5BN5 A;  2EY6 A;  3I4O A;  1PZI D;  4IUV A;  4A75 A;  1QOH A;  2QA4 A;  3DEO A;  4PZ6 A;  4L6T B;  1GUN A;  4GKK Q;  5E7N A;  1KAA A;  3QWN A;  4DXG A;  1FNW A;  3EFX D;  2WKC A;  2OCE A;  5C44 B;  4JVZ A;  2ES2 A;  3U50 C;  4LF8 Q;  2YTV A;  4A3I G;  4NP5 A;  3SK8 A;  1JR0 D;  2F0I A;  4M1U B;  1I6H H;  1YBY A;  3KLS X;  2EYP A;  4LJZ C;  4ZUJ A;  5BR8 L;  3BZK A;  3L9A X;  4M8A A;  4A3G G;  1TY0 A;  1VQG A;  1QUQ B;  2I46 A;  2I5M X;  4IJL A;  4B3S Q;  2K7V A;  2AMC B;  1KNA A;  2CVR A;  2EDG A;  3QO2 A;  1EFW A;  3M4P A;  4CGY B;  4A3J B;  1OTC A;  1EWI A;  2JA5 H;  3CQZ B;  2EJM A;  1UAP A;  3GV6 A;  3CQZ H;  2UXC L;  4YCV A;  3KDF A;  2F0N A;  1IHZ A;  1CZW A;  1DOM A;  5FO8 B;  1YIJ A;  1G29 1;  4G7H C;  2RSN A;  1PTO B;  3D3R A;  1JOQ A;  1B1Z A;  3EA6 A;  4ZRZ A;  2VXW A;  1MSH A;  3PO2 B;  1HQR D;  1NTG A;  4K0K Q;  3OTO Q;  3BZD B;  2WB1 G;  2B2W C;  3DWQ A;  3DUZ A;  2A68 C;  4B9X A;  1K28 A;  4H7B A;  4EQ5 A;  1Q3L A;  3FP9 A;  1H9M A;  3C1E A;  4H0L C;  3IFD A;  1X3G A;  1YEZ A;  1WTX A;  4YCU A;  3C3L A;  1NE3 A;  3DWP A;  4JK1 C;  4HJA A;  1PTO D;  4IQZ A;  4N8F A;  2JN4 A;  4JI7 Q;  2ZXR A;  1QZG A;  2NVT B;  2NVT H;  2L0C A;  1PRT C;  3I2Z A;  4I7A A;  2X69 A;  4DUY Q;  5KND A;  2BH8 A;  4C1N I;  1KQS A;  1T5E A;  3QG1 A;  2CKZ B;  4KN4 C;  2RCF A;  5ELE A;  5IYD H;  4PNY A;  2JA5 G;  1GO3 E;  2OXP A;  1FGB D;  1I4P A;  4QF4 A;  5IWA Q;  4GKJ Q;  4JC0 A;  4K8J A;  1QVF A;  2HQL A;  2PQA B;  4BBR B;  1KNE A;  2JK8 A;  1EU4 A;  5C4X B;  2L4N A;  3LNN A;  4GZY C;  3D0F A;  2A6H C;  1H9K A;  3RZD B;  3W1G A;  2Q2I A;  1K8O A;  1V1O A;  1HTP A;  4DR6 L;  1U4R A;  1EQR A;  1Y8P B;  1GKH A;  1A63 A;  4KJO A;  2JA7 B;  4C1N K;  3J7Z C;  3CAM A;  4A93 H;  2BE5 C;  4LNQ A;  1STB A;  4QCL A;  1LLR D;  2Q8R E;  3KF8 A;  1NBW A;  3X3N A;  2RF4 A;  1K83 H;  3CC2 A;  1IBM L;  5HY6 A;  2YYZ A;  2Z6K C;  1Q46 A;  2IX1 A;  1WTV A;  4JBK A;  2H5X A;  4HED A;  5LMN L;  3HKZ B;  1XTD A;  3PIP 3;  2EY2 A;  4HIK A;  1SR3 A;  2RDH A;  3MXP A;  5IYD G;  2NVY B;  2UXD L;  4P72 A;  2WAC A;  1K3B C;  2B2Y A;  3T53 B;  3T56 B;  1VDZ A;  5ELC A;  1P8L A;  1OXT A;  2A5H A;  1P16 A;  2X6G A;  2JYO A;  4K5W A;  2E2H B;  2L11 A;  5GAH C;  3MWY W;  2IY5 B;  4YY3 Q;  1V1Q A;  2E2H H;  1WTR A;  4YHH Q;  1JMC A;  2F0K A;  3OYY A;  1S5C D;  1WD0 A;  4YWL A;  2PI2 A;  4LK1 C;  1I4R A;  4MTK A;  4O1N A;  5COR A;  2PQE A;  3D4R A;  4CJ2 C;  2VZA A;  4A93 G;  2UUB Q;  4DKA C;  4X62 L;  1S5F D;  2G9H D;  4OEM B;  5IGC A;  3N52 A;  1KTK A;  4O42 A;  3K59 A;  1CTM A;  3GTL H;  5M3M H;  4BA2 I;  1LTR D;  1B44 D;  1S4Z A;  4P71 A;  3F2U A;  3MXU A;  4X64 Q;  2H1E A;  1GUS A;  2LXJ A;  4R8I A;  1HH2 P;  1O80 A;  3D6W A;  4XYQ A;  3KJO A;  3STB C;  3PF4 A;  4AH6 A;  3V2T A;  5F2D A;  4AQY L;  5BN4 A;  1HFN A;  4QUF A;  1EIG A;  2F0D A;  1S3O A;  4JI5 L;  1WI5 A;  2EOT A;  4EQN A;  1GXD C;  4X66 L;  3MXG A;  3CCR A;  1MD2 D;  4LFA L;  1UNS A;  2A6E C;  5I9O A;  4X3U A;  3T4A C;  3CCE A;  1STE A;  2RQX A;  4KY7 A;  3PIO A;  3HKZ E;  2ZTC A;  2V4D A;  4ZUI A;  4B3R L;  1FNU A;  3UDI A;  2LMC B;  5CYU A;  4OIK A;  2A74 C;  5M5X B;  2M2L A;  2MFI A;  2Z4I A;  1QZH A;  3IFT A;  1CM9 A;  1AE2 A;  3SR1 A;  2EYO A;  1EY5 A;  4X3T A;  4U67 3;  1D8L A;  1QE6 A;  1XPO A;  1J5E Q;  2YV5 A;  2HHH L;  1K8G A;  3PO3 B;  4IOA A;  4RGM A;  1XPR A;  3DHQ A;  5KEE A;  1B4O A;  4GNX B;  1ZKO A;  4P73 A;  5M3M G;  3GTQ H;  3D4W A;  3ULL A;  2BDO A;  1SNO A;  2EYM A;  3S1M H;  1K0R A;  4CJ1 B;  2RCN A;  3TEH B;  2JA6 H;  5GAD C;  3UE1 A;  2NB0 A;  4FXG C;  3J81 L;  3VR6 A;  5IYB H;  3A7L A;  1QB5 D;  4C3H H;  1E7Z A;  1MKH A;  1Y1V H;  4O0A A;  2DJG C;  3M3Y B;  1JJ2 A;  5E4W C;  3NQT A;  3DM3 A;  3KLR A;  4QL5 A;  3TN2 A;  2LY7 A;  4NW2 A;  2D0O A;  4TVA B;  1Y14 B;  2DNC A;  2R3Z A;  1ZEQ X;  1ESR A;  2WV6 D;  5LMU L;  4LF7 Q;  1W6J A;  1B8A A;  4A3E H;  3JAM i;  4B3M Q;  3S1Q H;  1BKB A;  4HAE A;  2O5I C;  2YTX A;  3D8G A;  3SXH A;  1X3E A;  3VR5 A;  5A2Q E;  3CCJ A;  4X65 L;  1SJH D;  4QIW B;  5D3I B;  5DLQ E;  3A5U A;  1U4L A;  2UUC L;  1VQ8 A;  3ERS X;  3SEB A;  3IKJ A;  1SN8 A;  5J22 A;  3TDQ A;  3M7N A;  1CA5 A;  5DEH A;  2E2I H;  2CH4 A;  4NDX A;  2E2D C;  3J80 E;  5EPJ A;  1PDQ A;  2I5H A;  1GD7 A;  2ZJQ A;  5C3W A;  2L5T A;  4GNX A;  3I4N H;  5CC4 A;  1AZQ A;  4JBW A;  4DR4 L;  3R93 A;  3VR3 A;  1HUN A;  1I50 B;  4KKU A;  2CW0 D;  5C4H A;  3GTO H;  3FPU B;  1EYA A;  2EPB A;  2JA6 G;  5AJ3 Q;  4LFC Q;  1KC8 C;  2D0P A;  1IYU A;  1UEA B;  5IYB G;  1BCP C;  5EGT A;  2Q8T A;  4C3H G;  1Y1V G;  1ENF A;  4PV1 C;  4CJ0 B;  4JI6 L;  4IUN A;  5M5W B;  1TWC B;  2O5J C;  1I4Q A;  2O2L D;  1TWC H;  4J6H A;  2I0Q A;  1EQT A;  3BZC A;  2UU9 Q;  3GTG H;  1AW7 A;  2B8F A;  4H44 C;  2AWN A;  2RHQ B;  2E5L Q;  4RKB A;  3NP8 A;  2R7F A;  2ZJR A;  1QJO A;  4NMZ A;  3E9H A;  4A3E G;  1PFM A;  2F3V A;  2CWA A;  2Z6K A;  4DV6 L;  1E2Z A;  4GOP C;  5IE8 A;  1R4P B;  1H95 A;  1X3Q A;  4IPC A;  4RMF A;  5E3F A;  3M4O B;  4LF6 L;  1TT2 A;  4BA1 I;  3OHX C;  2F0U A;  2CCZ A;  1SMY D;  1J9O A;  4K6D A;  2EJG C;  2EQS A;  3FMC A;  4H13 C;  4C56 C;  2KEE A;  1STY A;  4XIG S;  3P7J A;  5M5Y H;  1DJR D;  3J7A V;  4TRD A;  5COY A;  4KTA A;  1Y8O B;  3JAM L;  3MZ5 A;  1E1T A;  3RUZ A;  1W2B A;  3V96 A;  1G91 A;  2OT2 A;  2D9U A;  3E0E A;  1J8I A;  1B9M A;  1WTO A;  4DR2 L;  1S5E D;  4MIU A;  4LF5 L;  3CPF A;  4JI8 L;  4EQP A;  1DD2 A;  4X3K A;  4DV5 Q;  5FJ8 H;  2VB3 X;  3NTH A;  4DAP A;  1BBW A;  2IW3 A;  1AEX A;  1TWG B;  2NN6 G;  5CBA E;  5C4J B;  3CRK C;  1N34 Q;  1YNN D;  1SRU A;  1ICW A;  2GA4 B;  4DAY A;  3QJY A;  1FGU A;  2MO0 A;  3MEF A;  1Q90 A;  3LX0 A;  3NBI A;  4CDD C;  2AHO B;  4JI4 Q;  4WFN 3;  2VQE L;  2ICE C;  2F0H A;  3B6Y A;  1K73 C;  4F7X A;  2FJ2 A;  3CCM A;  3QOJ A;  2RHS B;  1R9T B;  3HOX B;  2K33 A;  1R9T H;  1VQO A;  3HOX H;  5JJI A;  4C2M B;  5T1G A;  4S3S A;  1XNR Q;  3SK4 A;  4KD4 A;  4DR3 Q;  2IJ0 A;  4KJN A;  4XQJ A;  3DWA A;  1SNP A;  5JJK A;  3NE5 B;  2L55 A;  2N49 A;  4JI0 L;  1HR0 L;  2VW9 A;  1O78 A;  2PYK A;  1U4M A;  3P20 A;  2K50 A;  1C8C A;  2B63 H;  1E3P A;  2BCO A;  3DXJ C;  2HUG A;  3FVQ A;  3EQL C;  1XYI A;  3HOZ B;  4FF2 A;  3G71 A;  3HOV H;  5FLX c;  5NUC A;  3RN2 A;  4KN7 C;  1HCZ A;  3NK9 A;  5IYC H;  1Q8I A;  1TS3 A;  1XMQ L;  1Q8K A;  2F3W A;  3H3V C;  1PTO C;  4RGN A;  1LT3 D;  4LUZ A;  4C3J B;  3A56 A;  1IL8 A;  5K36 H;  1YHQ A;  2K4K A;  2NZ1 D;  1WTQ A;  5IGF A;  1N9W A;  1UE1 A;  2DJF C;  5I4D A;  3IAY A;  1BOS A;  2F52 A;  2HIX A;  3S14 B;  4ZKB B;  2RBM A;  3BDL A;  3S14 H;  5FJ8 G;  1I94 L;  4R4Q A;  5JAV A;  3PUZ A;  3GTM H;  1OXX K;  1I3Q H;  4GLA C;  4DV7 L;  2J0T D;  4YWM A;  4OWW B;  2K5Q A;  1QG7 A;  3KBX A;  2EYF A;  3HOY H;  3CCL A;  1HZ9 A;  3HOX G;  2Q2T A;  3PGZ A;  2ID0 A;  1I6V C;  1QNK A;  1FJG L;  4K5V A;  4B3T Q;  1WTP A;  4A3I B;  2ATW A;  1SLJ A;  3A55 A;  5ELB A;  3NWT A;  4XQN A;  2VQF L;  4I7Z C;  5I6W A;  1SE4 A;  1X55 A;  1N36 L;  1N33 L;  1NUC A;  1TKW B;  2B63 G;  1JC7 A;  3HP3 A;  3CCU A;  3HOV G;  4JG2 A;  1HNW L;  3QB3 A;  5IYC G;  4PG3 A;  1VQD A;  3KF6 B;  5ELN A;  1PH2 A;  1VF5 C;  3W3A A;  3J7A 5;  3GTK H;  5T1I A;  4DXF A;  1VQ5 A;  2R92 B;  2R92 H;  4TSS A;  5EAY A;  5JJL A;  5C3E H;  4JYA L;  1TII D;  1HNX L;  3KDF B;  1SFO H;  4CDE C;  1Q86 C; 
#chains in the Genus database with same CATH homology
 3HG9 A;  2LFN A;  3K0Y A;  2EYJ A;  1FR3 A;  1V43 A;  1WD1 A;  1MGS A;  1U4P A;  4CKC A;  1RHP A;  1IYV A;  5DAU A;  4F8M A;  1GHK A;  5CGK A;  2AQ3 B;  4NKL A;  1GUG A;  2EZV A;  3MXN A;  2J7Z A;  1VMC A;  3HZX A;  1LTB D;  2KCN A;  1I6H B;  3FDT A;  3CHB D;  1T5X D;  3GO5 A;  1KDA A;  1CZG A;  2KEC A;  2SEB D;  3T51 B;  2R61 A;  2E76 C;  1KDB A;  3NWS A;  2OEO A;  1LTI D;  2BA1 A;  3RLF A;  3S17 B;  1V1P A;  2JA5 B;  5KYI A;  3WDN A;  3PV0 A;  4R8N A;  2B2T C;  3IL8 A;  3TP7 A;  4IFD J;  5CV8 A;  3D31 A;  4V19 0;  4KHV A;  1DOL A;  4K6L A;  4FYD A;  2XVS A;  1EWC A;  1CFM A;  4KHZ A;  5DNF A;  2F03 A;  5IT9 E;  5CV6 A;  1RKN A;  4I65 A;  2IT1 A;  4ZYS A;  1S5D D;  3KK7 A;  2F0Q A;  1I4H A;  4DFA A;  1SYD A;  1XX8 A;  2K1B A;  4OHJ A;  1JWS D;  1GUO A;  2L9H A;  2NBF A;  4KI0 A;  2KUM A;  2NYZ D;  4KKT A;  1A6X A;  5EPL A;  2XSC A;  2JE6 I;  2RKS A;  2G9D A;  2JP1 A;  2B39 A;  4AYB B;  2SOB A;  5JEA J;  4Z9C B;  3OSO A;  2QDB A;  3K5O A;  3J81 E;  4WOR A;  4A93 B;  4FXK C;  3W2D A;  2N55 A;  1LAB A;  1K83 B;  4ZAI A;  1JCK B;  4HTH A;  1RD9 D;  3GQB A;  1ONL A;  1F2Z A;  3H91 A;  1EY9 A;  3NBH A;  1E2V A;  3VYT A;  3U9O A;  3KUP A;  1ET9 A;  3L3O C;  2HQE A;  3OIQ A;  2CW0 C;  1MSG A;  5J39 A;  1E0B A;  1IKM A;  1H9S A;  4FVM A;  3PMF A;  1C4Q A;  5FO7 B;  1EY8 A;  3MVV A;  4QB4 A;  5AFW A;  1D1K A;  1ILQ A;  2K28 A;  1TVX A;  1QIL A;  1HUM A;  1Q1B A;  3GTL B;  2XWJ B;  5FLX L;  5CV9 A;  2PW7 A;  3ERQ A;  5M3M B;  1NSN S;  3Q22 A;  2PCF B;  1CK1 A;  1OXV A;  1SMY C;  1JIC A;  3OOC A;  3FEW X;  5FKA C;  1XWE A;  3PUV A;  2TSS A;  2FFK B;  1EFI D;  5FK9 C;  3J7A F;  2PNR C;  5KRU A;  3H09 A;  1KAB A;  3MFY A;  1EZ8 A;  1Q1E A;  5C0X H;  1I4G A;  3LWE A;  3N6R A;  5FOB B;  4ABN A;  1ENC A;  2KOL A;  1QNU A;  2FMM A;  5C0X I;  1JQY D;  2A73 B;  1ML0 D;  1PRT B;  4HCS A;  2K03 A;  5IIF A;  3BVM A;  2AQ1 B;  4QUC A;  4RAU C;  3Q23 A;  1NCV A;  2B2T A;  3A54 A;  3GTQ B;  1STH A;  3S1M B;  3ERO A;  2JA6 B;  1DM0 B;  1A15 A;  3BDC A;  4WRD A;  3SK5 A;  2B2W A;  2CHB D;  2DY8 A;  1PRT D;  3MFG A;  4C3H B;  1JWU D;  1Y1V B;  2F0P A;  3BVZ A;  2B2V C;  3G7L A;  3GD7 A;  4G7O C;  3K5N A;  3S9W A;  2F0L A;  5IGD A;  3TBI B;  4A3E B;  5CMD A;  3S1Q B;  1STA A;  2K04 A;  4DU9 A;  3R2T A;  2XNA C;  3NUC A;  4R9W A;  1V8Q A;  4N9P A;  1AFP A;  1IW7 D;  1JE4 A;  3A8I E;  4RHR A;  2E2I B;  1O7Z A;  2PZU A;  2F0S A;  4OGQ C;  2PPB C;  2QEJ C;  5ISR A;  5C6A A;  3I4N B;  1SDF A;  4XTC S;  3FPP A;  1CI3 M;  2DNE A;  5I2X A;  3GTO B;  3K5M A;  1G8Z D;  1SAP A;  4YIJ A;  2IX3 A;  4CKE A;  4PQX A;  1EQV A;  4MHE A;  4DF7 A;  2K5D A;  1SNC A;  3BS1 A;  2A69 C;  3CRL C;  3GTG B;  1EL0 A;  2K01 A;  2KQ3 A;  3I73 A;  1ILP A;  1F77 A;  1U9R A;  3BDO A;  4FNF A;  1SYB A;  3K57 A;  2NUC A;  1UUP A;  5ELD A;  2NWG A;  2ZXP A;  1LT5 D;  4DK0 A;  2F0M A;  2EY1 A;  1B3A A;  3BYT B;  4J8Q A;  1LAC A;  1ESF A;  3DEP A;  1AZP A;  5M5Y B;  1ZXT A;  1DXM A;  4ME5 A;  3MAQ A;  2F0T A;  2QCP X;  1D6E C;  1XXG A;  5CBE E;  1L0X B;  3L7Z C;  5HUR A;  1B2T A;  3K7A B;  2RDF A;  2BOS A;  4FF4 A;  3VA7 A;  5G3L D;  3Q6S A;  2Z1C A;  3P75 A;  3ONA B;  2J4X A;  3U9S A;  3MC0 B;  1MBY A;  3ND9 A;  2R6G A;  3GP7 A;  1F2M A;  2HCC A;  3DMU A;  4IFD I;  1RCV D;  4LMQ D;  2NTS A;  4KMU C;  3ND8 A;  2KED A;  2F1M A;  2B63 B;  3NTI A;  4ILW A;  3M7G A;  1PYW D;  1AN8 A;  5C5L A;  3HOV B;  1F9Q A;  1D5Z C;  2MUY A;  1EYC A;  1ZYR D;  1BNZ A;  2HDM A;  4ODG A;  1LTS D;  2ICI A;  5CV4 A;  4IUQ A;  3MTS A;  1D1I A;  4J1M A;  1OXS C;  1F2L A;  2PZW A;  5EBC A;  2Q8I B;  4F88 A;  5I2Y A;  1KLG D;  3I91 A;  5DM7 3;  5D65 A;  3X3M A;  3HS0 C;  3K6O A;  3M4Y A;  4KY5 A;  3GTM B;  1I3Q B;  1A2T A;  4HSV A;  1SXT A;  3PUX A;  1F9S A;  3HOY B;  3OMC A;  1F2Y A;  1PXU A;  1E2W A;  4OO1 I;  1ENA A;  2NTT A;  4HSP A;  1L0Y B;  4DNR B;  1AP0 A;  3VYR A;  1EY6 A;  2AWO A;  2JEB I;  3SVM A;  5CV7 A;  1LT6 D;  5JPN C;  2AQ2 B;  3OW7 A;  3EVQ A;  5KNC A;  4PMW A;  1LTG D;  1BCP B;  2B2V A;  5DM6 3;  4HMI A;  2B2Y C;  3O13 A;  3KLS A;  1CT1 D;  2B8G A;  4HN7 A;  4CKB A;  3GTK B;  5K36 G;  1PZK D;  5C3E B;  3MEH A;  4HMJ A;  1V1P B;  3MA2 B;  4WJW A;  3TP8 A;  1VF7 A;  5D3D A;  1SFO B;  2F0V A;  4CBV A;  5TSS A;  3I3C A;  1RTO A;  1HPC A;  3A7A B;  5IGG A;  1O7L A;  4IUT A;  4XYO A;  2JSO A;  1O7Y A;  1I4X A;  1JWM D;  2HCI A;  3PUY A;  2D5D A;  4MN3 A;  1DZ1 A;  1Y69 U;  4EGV A;  1CHQ D;  4FXD A;  1QWY A;  1Z7T A;  1BXT A;  1PRT F;  2ZXO A;  3I8Z A;  2MPM A;  3GV3 A;  1DYQ A;  4IUP A;  5EQ0 A;  3TME A;  4DGZ A;  4KK7 A;  3C1F A;  3OMG A;  3NTK A;  1EU3 A;  4IAL A;  1STG A;  1PMR A;  1YNJ D;  2I07 B;  2ENB A;  4C3I B;  4L63 B;  4V0B A;  3R8B A;  4X3S A;  1NR4 A;  3GTP B;  1OXU A;  4K2K A;  2C9O A;  4BS9 A;  4RGT A;  5FLX E;  1GUT A;  5J1Z A;  3TZD A;  1CQF A;  1Z47 A;  4RCN A;  4PMB A;  1KDC A;  3V05 A;  1II3 A;  3EJI A;  2JXM B;  3TSS A;  3Q24 A;  2PZT A;  2FIN B;  4OL7 A;  2BA0 A;  1KLU D;  3SDZ A;  5C3X A;  1CQV A;  2DN8 A;  2PO4 A;  1LTT D;  3H94 A;  2EYH A;  3QOL A;  2L12 A;  2XWB B;  1PTO H;  3I72 A;  4K8I A;  1TWA B;  1Q12 A;  2KCC A;  3OWE B;  5IGE A;  5EBD A;  3NPP A;  1BR9 A;  3G6J B;  5D14 A;  4IZ8 A;  3WOF A;  5A35 A;  1ET6 A;  4C3I G;  1PZJ D;  2VUM B;  2D62 A;  2AUK A;  1X32 A;  4ID6 A;  4RGO S;  3TZU A;  5EKK A;  3VYS A;  4ULL A;  3S1R B;  1G2S A;  5EKI A;  4ZK9 B;  2IX0 A;  2JA8 B;  1D5X C;  1H9S B;  1TU2 B;  3Q0A A;  3BG3 A;  4EQO A;  4A3M B;  2F0O A;  3NHH A;  1NAP A;  4A3F B;  2B2U C;  1HFG A;  2RDG A;  4FF1 A;  4K5X A;  1GHJ A;  2WIN B;  3A8K E;  1SYE A;  5KYL A;  3DM1 A;  2E75 C;  4BY1 B;  1GOZ A;  2EJF C;  5ELF A;  1EEF D;  1IW7 C;  3TP5 A;  3BYY B;  5G3L F;  1RTN A;  3I90 A;  3UI2 A;  2XRQ D;  1CHP D;  4RH6 A;  2FHT A;  3HEJ A;  1SEB D;  3VYU A;  1SYF A;  3H6M A;  1DON A;  5M3F B;  1H9R A;  4KV6 A;  5LL6 X;  3HOW B;  2KVM A;  4HR7 B;  5CV5 A;  2NVX B;  2SNM A;  5IGB A;  1EY7 A;  2XRS D;  2Y0S B;  1B50 A;  1TQO A;  4F87 A;  1TWH B;  5E1F A;  1M8A A;  1M4V A;  5BN3 A;  2MHV A;  1BDO A;  4RA8 A;  2D2C C;  2DY7 A;  2MJ8 A;  4LAA A;  5JJZ A;  4BWG B;  2F4I A;  4A3K B;  4KD3 A;  5LL6 S;  5C5M A;  3OIP A;  1EEI D;  2K5W A;  1BQQ T;  4DK1 A;  2E74 C;  3FKI B;  3TP6 A;  1SJE D;  2KJX A;  1TS2 A;  1A3T A;  2VB2 X;  1TY2 A;  1EYD A;  5K5P A;  1MI2 A;  1Y1W B;  3JAM E;  4ZKC B;  4XQQ A;  1YNN C;  1A3V A;  2TMP A;  1TS4 A;  4FF3 A;  1BF4 A;  2HDL A;  1XTC D;  1OO9 B;  2A68 D;  2O4X A;  5IT9 L;  5CR3 A;  1WTW A;  5JVG 3;  3NXW A;  1GUW A;  1HQM C;  4FO2 A;  3SHL A;  1SE2 A;  2L1B A;  1BBX C;  4DNT B;  1HXY D;  3CKI B;  1F9P A;  1LO5 D;  1BCP F;  3QIA A;  2N88 A;  1TS5 A;  1RDP D;  2C5C A;  3OPO A;  1STN A;  1ZYR C;  4DAV A;  1NR2 A;  2R93 B;  4RWS C;  3NQI A;  1FYC A;  4QMG A;  4EVO A;  2KHS A;  2E2J B;  5C0X G;  2F0F A;  1D2B A;  4RHS A;  1EOT A;  1D5M C;  2RVL A;  3SK6 A;  4RCO A;  4ZLT F;  3PIO 3;  1HA5 A;  3H0G B;  3S16 B;  3S2D B;  3NSW A;  1SYC A;  4CHT B;  2F0J A;  2CQA A;  3P1H A;  2X6L A;  2A6H D;  2EE1 A;  4IUU A;  1W6K A;  4IN3 A;  2F0W A;  3HOU B;  3J7Y W;  4XXE A;  5LHY 1;  3MHB A;  1QCB D;  4A3D B;  4K2L A;  2EVB A;  4P2C B;  2BE5 D;  1TR5 A;  5I9P A;  2Z8L A;  1SND A;  4Q5V A;  3R2I A;  3VR2 A;  1Y8N B;  2QIL A;  2QKI C;  2LS0 1;  2AUJ D;  3S15 B;  2EXZ A;  2VNU D;  4U68 A;  4TKO B;  2B2U A;  2PMZ B;  4A3B B;  2IPK D;  1ROD A;  3AB9 A;  3RZO B;  1HA6 A;  1EZ6 A;  4KY6 A;  4DA2 A;  5FO9 B;  3OWF A;  1F9R A;  5EPK A;  1SNM A;  3RMH A;  1DCZ A;  3HRZ C;  2ZT9 C;  1SE3 A;  4XT1 B;  2NN6 H;  3E6Z X;  4RFB A;  3K5L A;  1RF2 D;  1PTO F;  3S2H B;  2Z4H A;  4BBS B;  1WVL A;  2LKV A;  2NN6 I;  1A3U A;  5JVH 3;  1DOK A;  3E5S A;  1EIH A;  3ITP A;  2NVQ B;  1HRJ A;  1SBB B;  2SDF A;  2OF1 A;  4B9W A;  5EJW A;  4G4K A;  3M85 A;  1YNJ C;  4BY7 B;  1FD7 D;  1K8M A;  3CU7 A;  3FRP B;  3K58 A;  4B08 A;  2XN9 C;  2R7Z B;  2JEA I;  2K05 A;  3BVG A;  1LV9 A;  3AMU A;  2QF7 A;  1WCM B;  4IFD H;  4K14 A;  5M9O A;  4FP5 D;  1LT4 D;  1G6Z A;  2A6E D;  3D6C A;  5C0X J;  2WAQ B;  1EY4 A;  4XDX A;  3T16 A;  1EY0 A;  4KKS A;  4HCE A;  2F0G A;  2YU9 B;  2SNS A;  1PFB A;  3E0J A;  5I6Y A;  2M00 A;  3URY A;  2RSO A;  3S1N B;  4UAI A;  1SNQ A;  3C2P A;  3R3O A;  3WOE A;  1X3P A;  4OIJ A;  3C46 A;  4IUR A;  1JOO A;  2WP8 J;  3I4M B;  2H4O A;  2MP1 A;  3AU7 A;  2PW5 A;  3LWU A;  2MGS A;  2RA4 A;  1TWF B;  2EY5 A;  1VMP A;  2FMC A;  5IOD A;  4G7Z C;  1VCI A;  4OO1 H;  4ZQ3 A;  4IFD G;  2WKD A;  1FNV A;  2BDN A;  5EKL A;  1JOK A;  5KNB A;  1H9J A;  3VA5 A;  5JEA H;  4G57 A;  5A2Q L;  4Y7N B;  1JB3 A;  2F0E A;  2IL8 A;  4PMC A;  3J80 L;  4Q0F A;  3HGB A;  3T13 A;  5HGT A;  2EYL A;  5C4Z A;  3A8J E;  3KBG A;  1B9N A;  1R4Q B;  1JOR A;  4L8J A;  5JOB A;  1BUV T;  1C48 A;  1G2T A;  5KIX A;  4TQU S;  5JPM C;  3ZYY X;  1CA6 A;  2XIW A;  1LTA D;  1SYG A;  1HHV A;  4A3G B;  2K32 A;  1PLF A;  2IWH A;  1HTL D;  2WII B;  2KA7 A;  3RD4 A;  1RJT A;  3GTJ B;  1SSO A;  1BO0 A;  4C3J G;  1IKL A;  1BCP D;  4N9T A;  4DN4 M;  4OO1 G;  1A2U A;  4XT3 B;  1S5B D;  1EWH A;  1GJX A;  2A69 D;  4UDU C;  3D4D A;  3VR4 A;  1Z6H A;  5JEA G;  2M9V A;  5IOC A;  2K6A A;  3I4L A;  1B53 A;  2WB1 B;  5KGU A;  1PFN A;  4E6I A;  5E4X A;  3SE0 A;  3I70 A;  3PUW A;  4RKL A;  5BN5 A;  2EY6 A;  1PZI D;  4IUV A;  1QOH A;  3DEO A;  4L6T B;  1GUN A;  1KAA A;  3QWN A;  4DXG A;  1FNW A;  3EFX D;  2WKC A;  5C44 B;  4NP5 A;  3SK8 A;  1JR0 D;  2F0I A;  4M1U B;  3KLS X;  2EYP A;  4LJZ C;  4ZUJ A;  3L9A X;  4M8A A;  1TY0 A;  2I46 A;  2K7V A;  1KNA A;  2CVR A;  2EDG A;  3QO2 A;  4CGY B;  4A3J B;  3CQZ B;  2EJM A;  1UAP A;  3GV6 A;  2F0N A;  1IHZ A;  1CZW A;  1DOM A;  5FO8 B;  1G29 1;  4G7H C;  2RSN A;  1PTO B;  3D3R A;  1JOQ A;  1B1Z A;  3EA6 A;  4ZRZ A;  2VXW A;  1MSH A;  3PO2 B;  1HQR D;  3BZD B;  2B2W C;  3DWQ A;  3DUZ A;  2A68 C;  4B9X A;  4H7B A;  1Q3L A;  1H9M A;  3C1E A;  4H0L C;  3IFD A;  1WTX A;  3C3L A;  3DWP A;  4JK1 C;  1PTO D;  4IQZ A;  2ZXR A;  2NVT B;  2L0C A;  1PRT C;  2X69 A;  5KND A;  4C1N I;  1T5E A;  3QG1 A;  4KN4 C;  5ELE A;  4PNY A;  2OXP A;  1FGB D;  1I4P A;  4QF4 A;  4K8J A;  4BBR B;  1KNE A;  1EU4 A;  5C4X B;  2L4N A;  3LNN A;  4GZY C;  2A6H C;  1H9K A;  3RZD B;  1K8O A;  1V1O A;  1HTP A;  1U4R A;  1Y8P B;  4KJO A;  2JA7 B;  4C1N K;  2BE5 C;  1STB A;  4QCL A;  1LLR D;  2Q8R E;  3KF8 A;  3X3N A;  2YYZ A;  2IX1 A;  1WTV A;  4HED A;  3HKZ B;  3PIP 3;  2EY2 A;  2RDH A;  3MXP A;  2NVY B;  2WAC A;  2B2Y A;  3T53 B;  3T56 B;  1VDZ A;  5ELC A;  1OXT A;  2A5H A;  2X6G A;  2JYO A;  4K5W A;  2E2H B;  2L11 A;  3MWY W;  1WTR A;  2F0K A;  1S5C D;  1WD0 A;  4LK1 C;  1I4R A;  4O1N A;  5COR A;  2PQE A;  3D4R A;  4CJ2 C;  1S5F D;  2G9H D;  5IGC A;  3N52 A;  1KTK A;  4O42 A;  3K59 A;  1CTM A;  4BA2 I;  1LTR D;  1B44 D;  1S4Z A;  3F2U A;  3MXU A;  2H1E A;  1GUS A;  4R8I A;  1O80 A;  3D6W A;  4XYQ A;  3V2T A;  5F2D A;  5BN4 A;  1HFN A;  4QUF A;  1EIG A;  2F0D A;  2EOT A;  4EQN A;  1GXD C;  3MXG A;  1MD2 D;  1UNS A;  2A6E C;  5I9O A;  4X3U A;  3T4A C;  1STE A;  2RQX A;  4KY7 A;  2V4D A;  4ZUI A;  1FNU A;  2LMC B;  5CYU A;  4OIK A;  2A74 C;  5M5X B;  2M2L A;  2Z4I A;  3IFT A;  1CM9 A;  3SR1 A;  2EYO A;  1EY5 A;  4X3T A;  4U67 3;  1QE6 A;  3PO3 B;  4RGM A;  3DHQ A;  5KEE A;  1B4O A;  1ZKO A;  3D4W A;  2BDO A;  1SNO A;  2EYM A;  4CJ1 B;  2NB0 A;  4FXG C;  3J81 L;  3VR6 A;  3A7L A;  1QB5 D;  3M3Y B;  5E4W C;  3NQT A;  3KLR A;  3TN2 A;  2LY7 A;  4NW2 A;  2DNC A;  2R3Z A;  1ZEQ X;  1ESR A;  2WV6 D;  1W6J A;  4HAE A;  2O5I C;  3D8G A;  3SXH A;  3VR5 A;  5A2Q E;  1SJH D;  4QIW B;  5D3I B;  1U4L A;  3SEB A;  3IKJ A;  5J22 A;  3TDQ A;  3M7N A;  1CA5 A;  5DEH A;  4NDX A;  2E2D C;  3J80 E;  5EPJ A;  1PDQ A;  5C3W A;  2L5T A;  5CC4 A;  1AZQ A;  4JBW A;  3R93 A;  3VR3 A;  1HUN A;  1I50 B;  4KKU A;  2CW0 D;  5C4H A;  3FPU B;  1EYA A;  2EPB A;  1IYU A;  1UEA B;  1BCP C;  5EGT A;  2Q8T A;  4C3H G;  1ENF A;  4PV1 C;  4CJ0 B;  4IUN A;  5M5W B;  1TWC B;  2O5J C;  1I4Q A;  2O2L D;  4J6H A;  1EQT A;  1AW7 A;  2B8F A;  4H44 C;  2AWN A;  4RKB A;  3NP8 A;  1QJO A;  4NMZ A;  1PFM A;  2F3V A;  1E2Z A;  1R4P B;  1X3Q A;  5E3F A;  3M4O B;  1TT2 A;  4BA1 I;  3OHX C;  2F0U A;  1SMY D;  1J9O A;  4K6D A;  2EJG C;  3FMC A;  4H13 C;  4C56 C;  2KEE A;  1STY A;  4XIG S;  3P7J A;  1DJR D;  3J7A V;  4TRD A;  5COY A;  4KTA A;  1Y8O B;  3JAM L;  3MZ5 A;  3RUZ A;  3V96 A;  1G91 A;  2OT2 A;  2D9U A;  1J8I A;  1B9M A;  1WTO A;  1S5E D;  4MIU A;  4EQP A;  1DD2 A;  4X3K A;  2VB3 X;  3NTH A;  4DAP A;  2IW3 A;  1AEX A;  1TWG B;  2NN6 G;  5CBA E;  5C4J B;  3CRK C;  1YNN D;  1ICW A;  2GA4 B;  4DAY A;  3QJY A;  3NBI A;  1Q90 A;  3LX0 A;  4WFN 3;  2ICE C;  2F0H A;  4F7X A;  2FJ2 A;  3QOJ A;  1R9T B;  3HOX B;  2K33 A;  4C2M B;  5T1G A;  4S3S A;  3SK4 A;  4KD4 A;  2IJ0 A;  4KJN A;  4XQJ A;  3DWA A;  1SNP A;  3NE5 B;  2L55 A;  1O78 A;  2PYK A;  1U4M A;  3P20 A;  1C8C A;  2BCO A;  3DXJ C;  2HUG A;  3FVQ A;  3EQL C;  1XYI A;  3HOZ B;  4FF2 A;  5NUC A;  4KN7 C;  1HCZ A;  3NK9 A;  1Q8I A;  1TS3 A;  2F3W A;  3H3V C;  1PTO C;  4RGN A;  1LT3 D;  4C3J B;  3A56 A;  1IL8 A;  5K36 H;  2NZ1 D;  1WTQ A;  5IGF A;  5I4D A;  3IAY A;  1BOS A;  3S14 B;  4ZKB B;  2RBM A;  3BDL A;  5JAV A;  3PUZ A;  1OXX K;  2J0T D;  2K5Q A;  1QG7 A;  3KBX A;  2EYF A;  2ID0 A;  1I6V C;  1QNK A;  4K5V A;  1WTP A;  4A3I B;  3A55 A;  5ELB A;  3NWT A;  4XQN A;  4I7Z C;  5I6W A;  1SE4 A;  1NUC A;  1TKW B;  1JC7 A;  3HP3 A;  3QB3 A;  1VF5 C;  3W3A A;  5T1I A;  4DXF A;  2R92 B;  4TSS A;  1TII D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...