2EY5A

Crystal structure of staphylococcal nuclease mutant t41s
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDSPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey5A00
4EQNA 1F2MA 4I65A 4KHVA 5IODA 4ME5A 2PW7A 4K8IA 4KTAA 2SOBA 2EYJA 4EVOA 1RKNA 2EYLA 2F0NA 3MVVA 5I6WA 2EY6A 1JORA 3NUCA 2F0MA 3ERQA 4QMGA 3ITPA 2OF1A 4TRDA 5C3XA 5KEEA 4KJOA 4K14A 3SHLA 3QOLA 4OL7A 1KDAA 2F0UA 1EQVA 5CV4A 1SNDA 5HURA 4HTHA 4F8MA 3TP6A 1A2TA 4QB4A 2O4XA 3P75A 1EY4A 4H7BA 4WRDA 4F7XA 3EVQA 2F0PA 1KDBA 2EYMA 3BDCA 4YIJA 4EQPA 5J39A 4EQOA 4PNYA 2KHSA 1STAA 1A3VA 1EY6A 2RBMA 1SYGA 2PZUA 2F0IA 5CV6A 5CV8A 3OMCA 2PW5A 4IALA 5CV5A 5NUCA 2EYPA 1TR5A 4E6IA 4ZUIA 1IHZA 2F0WA 1STNA 2F0LA 4NP5A 4IZ8A 3T16A 4K6DA 4ZQ3A 3H6MA 3MZ5A 1EYDA 2F0SA 5I6YA 5IGDA 5KGUA 3MXPA 5C5LA 1A3TA 1NUCA 1SNMA 1U9RA 4G57A 5KIXA 1STYA 2M00A 2RDFA 3OSOA 1SNQA 3NQTA 3V2TA 5C4ZA 4K5VA 2EXZA 5C5MA 2SNSA 2EY5A 1EZ8A 1ENAA 3PMFA 4KY6A 4DU9A 3D8GA 4J1MA 3T13A 2F0QA 3D4DA 2OEOA 3D6CA 4KY5A 4KY7A 4S3SA 3SXHA 3SK4A 4DFAA 3TP7A 5C3WA 1EYAA 2F0DA 5I9OA 3MEHA 3OMGA 2HQEA 1TT2A 1EZ6A 2F3VA 4RKBA 5C4HA 5IOCA 1SYBA 5CC4A 1A3UA 5KRUA 4WORA 1JOQA 2EY1A 1EY8A 2PZTA 3NK9A 3TP8A 3NXWA 2QDBA 3OWFA 2EYHA 2F0OA 1F2ZA 1NSNS 3BDLA 1A2UA 1JOKA 4NMZA 5EKLA 2F0VA 4K5XA 4LAAA 3MHBA 3QOJA 3TMEA 5KYLA 4N9TA 2ENBA 5DAUA 5IGFA 5IGEA 1STGA 4KD3A 3HZXA 5IIFA 3D4WA 4R8NA 2F0FA 4KV6A 4NDXA 4RKLA 5C6AA 2EY2A 2F0TA 2SNMA 4ID6A 3DHQA 4N9PA 2F0EA 5CV7A 5J22A 1SYCA 3NHHA 4ZUJA 1SYEA 3DMUA 3S9WA 4PMCA 1SYFA 4NKLA 4ODGA 1STHA 1AEXA 4PMBA 3NP8A 4KJNA 1SNCA 1II3A 5EKKA 3VA5A 4B9WA 4J6HA 5KYIA 5ISRA 2KQ3A 1EY0A 5DEHA 1TQOA 5E1FA 2WACA 2PYKA 3LX0A 5CV9A 5EGTA 1EY5A 1ENCA 3P1HA 2PZWA 4B9XA 4KD4A 1F2YA 5HGTA 5I9PA 5CR3A 1EY9A 3QB3A 4HMJA 3C1FA 2F3WA 4IUNA 1STBA 2LKVA 3E5SA 2F0JA 1EYCA 3R3OA 3U9OA 4DGZA 4K8JA 5E3FA 5CGKA 4MIUA 5IGBA 5F2DA 1SNPA 2RKSA 5IGCA 2PQEA 3EJIA 3SK5A 3EROA 2EYOA 4K2KA 5JOBA 1SNOA 2F0GA 1KABA 1KAAA 1KDCA 3SK8A 4K5WA 1SYDA 2F0KA 4HMIA 5K5PA 3C1EA 4K2LA 3SR1A 3SK6A 2F0HA 4DF7A 1EY7A 2EYFA 4QF4A 2OXPA 5J1ZA 3RUZA 5IGGA 5JAVA 1JOOA 5M9OA 2NUCA 3HEJA 3TP5A
chains in the Genus database with same CATH superfamily
2ES2A 5IODA 4ME5A 2K75A 5C44G 1D1KA 3J80c 3I4NB 4QY7A 1GO3E 5C3XA 2V4DA 3PUWA 3A74A 3HFZB 3QOLA 1VQHA 4LWCA 4IO9A 1F9QA 2PI2A 3DWAA 4QJFA 2IY5B 3BYYB 1LUZA 3RNUA 2HUGA 4NPSA 5C3EH 3Q23A 5LMUL 2LXJA 1Q8IA 1KDBA 2LSSA 2MO0A 5G3LF 2UUCQ 2Z1CA 4EX5A 1CT1D 2MNAA 2EYPA 2WAQG 1I4RA 2K5NA 3T16A 2QKIC 5E7NA 1HQMC 1DOLA 3M4PA 4V0BA 4U68A 4OO1H 1I4GA 1HFNA 2AHOB 2WV6D 5EBCA 5C4ZA 5C5MA 5IP9G 3CXCA 1W2BA 1K8MA 3P7JA 5JPNC 3PF4A 1W3SA 3ICEA 5I2YA 2VQEQ 4RKBA 4IPGA 4X6AH 1E0BA 3TP8A 5LMUQ 3PIP3 1K9MC 2F0OA 5DM63 4DV3Q 4HIOA 1CA6A 1QOHA 1JOKA 5EPLA 1Y1VH 1V1OA 5FLXL 1TWCH 1VQCA 2DNCA 5C3EB 1PH5A 2OQ0A 4ZUJA 2JA7B 1CUKA 2CWPA 4H13C 3J7AF 3ONAB 4JG2A 2KQ3A 2KUMA 3CMEA 1FYCA 4F88A 2NBFA 1QJOA 4KD4A 4HMJA 3EFXD 5ELDA 1PDQA 4IUNA 1OO9B 3I73A 3VR4A 3J7A5 1C0AA 2ICEC 2A69C 1PTOF 4JK1C 2R92G 4I7ZC 4HMIA 1HZAA 3OHXC 4P73A 1TWHB 3HOWB 5KNDA 4DV4L 4DR3L 3GTPB 4FXGC 3DWQA 2QDLA 4KTAA 2R92B 4MZ9A 1AE3A 1MGSA 4LNQA 1LTID 3QR8A 3PIO3 1PTOB 4Q0FA 4BA2I 1DONA 3HOXB 4JV5L 2O4XA 4K6LA 1B7YB 4XQJA 2LS01 5CV6A 4RA8A 3TEHB 1Q7YC 3K5LA 1SN8A 2AQ3B 3PGZA 1Q90A 3PIPA 4LF8L 2SDFA 1U9RA 2CQAA 1IYVA 1OXTA 4LF5L 3TSSA 4DV4Q 2EY5A 1PHJA 3D4DA 4O2DA 3CCSA 1OXSC 3EN2A 5M5XH 4ZKCB 2RHSB 3R2IA 2RSNA 3KLRA 2L4NA 4DV5L 3M7GA 3HOYH 5IYBH 2A69D 4A3IB 1HRJA 5M3FG 1IBLL 2MP1A 5D14A 4WFN3 3AFQA 1Q12A 4HCEA 3HOXG 1FNUA 2XNAC 4HJ5A 3URYA 4LAAA 1CKMA 1QNKA 4JI3Q 1N33L 1XPRA 4N9TA 3M4OB 2VW9A 3TN2A 1PV4A 4RKLA 4ZKBB 2Q2HA 3CD6A 5FLMG 1JJGA 2WP8J 2D9UA 1EIGA 1GUGA 2RCFA 4KJNA 1N36L 2L0CA 2MJ8A 2DJFC 1AN8A 1TQOA 1SAPA 5JJZA 1YI2A 4DR4L 4OIJA 3J7AV 1VF7A 4B3RQ 4YY3Q 2N49A 2BE5C 3PUXA 1VQMA 1TVXA 2ZT9C 3T1HL 2B8GA 3V05A 1IW7C 3SK5A 3S1MH 2BH8A 1C4QA 3GD7A 4B3TL 4QL5A 1WI5A 3TP5A 1RF2D 1JE5A 4KMUC 2R7FA 4A3BB 1HZBA 3S24A 1UAPA 4V190 4DXFA 1HZ9A 2F0UA 4P72A 3PQIA 4F8MA 4Y7NH 1Z47A 4GOPB 3J80L 4DV6L 1NBWA 1TS2A 1VF5C 1J9OA 1HH2P 1E3PA 3S1MB 3J81c 4DR2L 3QG1A 1J8IA 3G7LA 1YBYA 2NVQH 1FNVA 5JJIA 3X3NA 5FO9B 2M2LA 3CP0A 2Q2UA 4IZ8A 2GN5A 3K6OA 4GKJQ 5JPMC 2FHTA 5IP9H 1VQ5A 1A3TA 3OSOA 1VQ6A 3PO3H 1JQYD 2SNSA 2WKDA 4LUZA 4KY6A 1MJEA 4KY7A 2F4IA 1XPUA 1UEAB 2KEEA 3W5OA 3CPWA 4DAPA 4HJ8A 1WD1A 4DV6Q 4Y7NB 4X66Q 1TWFB 1VQOA 3FKIB 1B50A 2HCIA 1WTWA 1E2ZA 3KBGA 1G291 4QQBX 4M1UB 5KYLA 1XXGA 2BA0A 1B9MA 2YTXA 2BH2A 1STGA 3MEFA 3D4WA 4POFA 2SNMA 2PNRC 2F0EA 4KHPQ 3K8AA 2IX1A 2A6EC 4NKLA 1QNUA 1PFBA 4J6HA 2Z8LA 1VQ4A 2R93G 1B2TA 1X54A 3S1RB 3A5ZB 3PO3G 2A6HC 2R6GA 1BXTA 1EY9A 2ASBA 1TXYA 3KF8A 2LKVA 5DM73 3RZDB 4A93B 4AH6A 5GROA 4CDEC 4DUYL 2K7VA 2NB0A 2JK8A 3D31A 5IP7H 4A3EG 4K2KA 1BCPD 4JI5L 4A3DG 3Q6SA 4DF7A 1KAWA 2BDOA 3HEJA 3KF6A 4IQZA 5HGQA 2E75C 1S5DD 2MPMA 2C5CA 2ICIA 1IBMQ 2UXBQ 4DR1Q 3VA7A 3GO5A 3BVZA 5I6WA 1O78A 1K73C 2PI2E 1JORA 2UXDL 5KEEA 3SHLA 4CKCA 1EQVA 4ZYSA 1HNXL 1EEFD 2GVBA 1A2TA 1T9HA 2K14A 4OGQC 4ABNA 1IL2A 2F0PA 4JBWA 2A68C 5M5WB 4FF4A 5C4XG 2KHSA 1RJTA 1BNZA 1B70B 3KF8B 2ZJQA 4OELB 2K52A 4XTCS 4B3SQ 4NP5A 2DUDA 1IBKL 4KKSA 3H6MA 2NVYB 2FJ2A 3A56A 4LF8Q 3CCMA 5KIXA 4A3EH 1IYJB 4AYBG 2JA5G 4PV1C 4JI8Q 2IWHA 3AMUA 3S2DH 1N9WA 2UUCL 2R3ZA 3E9HA 3CPFA 5JVH3 4H0LC 4QIWE 1BCPC 4A3KB 2ALYB 1AP0A 3FPUB 3TQYA 2BA1A 1PRTF 1K3RA 4DR4Q 4GZYC 3BDLA 5C3EG 1P16A 3VYRA 1VMPA 4K5XA 4A3KG 4B3ML 4I7AA 4LMQD 1J6QA 1A6XA 3VYTA 2D5DA 3H94A 4KD3A 4YHHQ 3KDFB 2VS1A 2A6ED 3LNNA 3I4OA 3A8JE 3GTMB 1SYFA 1A8VA 4IFDG 5ISRA 2OT2A 1LLRD 4RFBA 5EPJA 2NVXH 2A1AA 4B9XA 3H0GB 4LFCQ 1TIID 1H9RA 2I0QA 1BOSA 1OXVA 3QB3A 1ZYRD 4RHRA 3E0JA 2IHEA 2FMCA 3EQLC 4FYDA 5E3FA 1Q1BA 5ELNA 5CGKA 1DOKA 4RMFA 3EJIA 2Y0SG 3KBXA 1SYDA 5EPKA 2EJGC 1TY2A 3G6EA 3VDYA 5JAVA 3FEWX 1CKNA 2B2WA 1T5EA 4JI2Q 1SLJA 2L12A 3MA2B 4DA2A 4A3KH 2E76C 2SOBA 4X65L 2ZJPA 4LUVA 1Y1VB 3MXGA 3T1YL 3VR2A 5E4XA 4JOIA 4L5QA 4OL7A 4JI1L 5CV4A 3T56B 1I4HA 2F03A 3CQZH 4JW0A 5C4JB 1PH4A 4WRDA 1O7YA 1QVCA 1HCZA 1LT4D 1VDZA 1Q3LA 4NXNQ 4O42A 2K28A 1D7QA 4N8FA 2HIXA 1XPOA 3MTSA 3BVGA 5M5WH 5BR8L 5AJ3L 4UDUC 1KNEA 1QUQB 1Y1WH 4GKKQ 5BN3A 4A3EB 1JE4A 4LF5Q 3RR5A 4BWGB 5A2QL 3U50C 3UDFA 1N34L 1XNRL 3L0OA 3VR6A 2JJQA 4IJHA 5FJ8H 3S14B 4IOAA 1SYBA 1A3UA 4OX9Q 1EY8A 3NK9A 1IKLA 1RD9D 5CYUA 4UP7A 2EYHA 3QIAA 5M3FH 3GTKB 2VL6A 3UI2A 3J81L 4JI3L 3TMEA 3HOUB 1X3EA 2X6GA 4NB3A 5IGFA 3HOZB 5CORA 2N78A 3GV3A 1CZGA 1IBKQ 2F0TA 1QZGA 4A3FB 5EAYA 1WJJA 3KF6B 1RL2A 2PMZE 3FRPB 1BCPB 1AEXA 1EIYB 4LF6L 3PSIA 4GN5A 5CV9A 3P1HA 3M9BA 4NXMQ 1G51A 1F2YA 2Z0SA 3RZDH 4JBJA 4ZRZA 1I3QH 3K58A 3C1FA 1XMOQ 1SMYC 3NWSA 3D3RA 1S5CD 3U9OA 3NWTA 4KN4C 5FO8B 3STBC 2RKSA 5JOBA 4TSSA 4JI5Q 2FFKB 3I4MH 2OXPA 1F9SA 4JI8L 1WTPA 4C3IH 2K03A 1NR4A 2F0NA 5C0XJ 2EY6A 1YJ9A 1BBXC 1BQQT 4QMGA 4K0KL 3AQQA 3OIQA 4R4CA 3VYUA 4YY3L 2XTIA 1KD1C 3BS1A 1SNDA 3BYTB 4CKEA 3F2BA 4IPDA 4LF9L 3HOVB 2RDGA 3MWYW 2EYMA 4YIJA 5J39A 1E2WA 2K50A 1A3VA 1EY6A 4HIKA 5EBDA 2ZTCA 3M4OH 4C56C 4LFAQ 4C1NI 2KCTA 3RN2A 1D6EC 1L0XB 5I6YA 1VQ9A 4DV3L 3HS0C 3L3OC 3QWNA 2ATWA 2RDFA 2F3IA 1CK1A 1MIUA 3S2HH 4BY1G 4JI2L 2VB2X 3PMFA 1DOMA 3V96A 1FGUA 1A15A 4X65Q 5C3WA 4AIMA 4DFAA 3SVMA 1MHWC 4K0KQ 1AE2A 5G3LD 2JA7G 2RCNA 5CC4A 4F87A 2IJ0A 3S17B 1RODA 2EQSA 4X66L 3NXWA 1F2ZA 3M85A 3KDFA 5EKLA 1EQQA 4N8X1 1PA6A 2J7ZA 3K80C 3KJPA 4L5SA 3KYHC 2UXBL 2RQXA 5IIFA 3DXJC 2VQFQ 3CCEA 1TWAH 2LMCB 1VQBA 2AQ2B 5IT9E 3KLSX 4KI0A 1PRTD 1QG7A 1CHPD 5EGTA 1EUJA 1YNXA 1HA6A 3ULLA 1X6OA 3LGJA 3MXUA 1FD7D 1XMQL 4IUUA 1H9MA 1STBA 3A7LA 4BY7H 4FVMA 1VQIA 3RZOH 2L1BA 2O2LD 5D3DA 1X55A 1HQRD 2EJFC 2HQLA 2AUJD 3RN5A 2RHQB 2X69A 1F9RA 1SJHD 3SR1A 3SK6A 2NWGA 2C9OA 1SFOB 5COYA 1E7ZA 4JVZA 2G9DA 3GTJH 2BDNA 2EOTA 1MSGA 4I65A 4IUTA 3I55A 1QB5D 3X3MA 3PO2G 4EVOA 3PIOA 2UXDQ 2KOLA 2OF1A 1FL0A 4CDCC 2QILA 5AJ3Q 1KDAA 2PNHA 3TP6A 5GAGC 1FVIA 3P20A 3KK7A 4RH6A 2PMZB 3BDCA 3GTLH 2KENA 4OO1I 3SE0A 4DK1A 2OTJA 4P74A 4OONA 4A3BH 5CMDA 1ILPA 1BKBA 1IBLQ 1VQ7A 1ML0D 2F0LA 1JJCB 3NBHB 1PZID 1QVGA 3DUZA 4AQYL 5ELOA 3J7YW 5BR8Q 3ERSX 3FVQA 1EYGA 1CFMA 3I56A 3I4LA 3BZDB 1RIPA 1TS3A 4BBSH 2EJMA 3CQZB 5BN5A 1CHQD 2QGQA 1N34Q 5KNBA 3F2UA 5IGDA 4BXXH 3SK4A 2JA5H 2KCCA 4KKUA 4C2MB 1E24A 1SMYD 4L63B 3E3XA 4WJ3M 4RGTA 1YJWA 5DNFA 2CKZB 1JR0D 3I90A 3GP7A 4XQQA 4JI6L 1NSNS 1E1TA 1OXXK 3S15B 3HKZB 4OEMB 1ET6A 1G91A 3W2DA 3IKJA 4FF1A 4LFAL 3VYSA 3HOUH 4A3CG 4ID6A 4L5RC 3DHQA 4C3HH 1I5FA 3M4YA 3JAMc 4JI0L 3MXNB 1XJVA 1HTPA 1N36Q 1DCZA 3NEMA 5TSSA 4A3MG 1X3FA 2NVTB 5AFWA 3ND9A 4BY1B 1A62A 5HY6A 2CFMA 3S1QB 3R3OA 3K0XA 1I6VC 5FLXE 1I6HH 2N3SA 4PZ7A 2ZTEA 1EFID 5C0XI 2Y0SE 2E2IH 2F0KA 1HPCA 4K2LA 1PYSB 2JA7H 5M9OA 3NSWA 1Z7TA 4RCNA 2K32A 1KLUD 3I7FA 2PW7A 1HXYD 4K8IA 3Q8DA 4TVAB 5A35A 1MI2A 3OYYA 4ULLA 2NVTH 1YNJD 1BDOA 1BBUA 1JT8A 4TRDA 1BUVT 1SSOA 5IP7G 4BA1I 3CCVA 4IJLA 3J80E 3C3LA 3OIPA 4IPCA 4A3LG 2XIWA 3P75A 4F7XA 2B2WC 2IHFA 4BBRG 1KXLA 2IPKD 4ZK9B 4DPGA 1B4OA 4EQ5A 2B2VA 3NTIA 1S5FD 1FGBD 4ZUIA 4ME3A 2CW0C 3BDOA 4HCSA 3TS0A 1K8OA 3MZ5A 1EWIA 5JJLA 1JC7A 4BBRB 4GKJL 1QUQA 4FXKC 2XGTA 4KKTA 1SNMA 4CKBA 1DD2A 4DR3Q 2UUBL 2QEXA 4NXML 2TSSA 1ENAA 3T13A 2MO1A 2HIVA 2F0QA 3SXHA 4L8JA 1WTQA 2G9HD 5IOCA 1XNQL 4X3KA 1S4ZA 4WORA 4DAYB 4HJ9A 3GTLB 5IT9L 3MAQA 1K8AC 2Q8TA 4LF7Q 2QDBA 4IUPA 4JBKA 5C0XG 1LV9A 5JVG3 4GKKL 3PO2H 5C44H 3CHBD 5C0XH 5IY0A 1S72A 2ZXPA 5T1GA 3I4NH 1XNRQ 4R8NA 4LW1A 5IYDG 4X64Q 3NHHA 3K5MA 2VUMB 3IFDA 3DMUA 2YU9B 2Z4IA 3NP8A 1II3A 2LXKA 5E1FA 3U58A 4RGMA 2B8FA 5L37A 2JA9A 4R4TA 1PTOC 5KNCA 1NCVA 2JA6B 2KEDA 1PFMA 2N8NA 1SFOH 4WJ4A 1Y8OB 1ICFB 1U4MA 3S1RH 2WFWA 3DEOA 4RG1A 3M4QA 1KABA 1KDCA 5H1SE 4KHZA 4XQNA 2VY3A 2VZAA 2TMPA 5J1ZA 3RUZA 4C1NK 1IL8A 5I2XA 1N33Q 2E2HH 1MD2D 2XWBB 1L1OA 3ZJYC 1SE3A 5LL6S 2FXQA 3QO2A 2WAQB 1V1PA 1JB3A 2H5XA 3G71A 2WB1B 4BBSB 3IFTA 2Q2IA 3H3VI 4LF9Q 3J81j 1EY4A 3LWEA 4H7BA 1K0RA 1PVOA 3EVQA 3UDXA 1HNWQ 3NBHA 3D6WA 2M9VA 2UU9L 2OTLA 1D5XC 3K7AB 3Q0AA 4UHVA 1D2BA 1M4VA 1STNA 1UE7A 1RHPA 5ELBA 3I2ZA 3TBIB 1MBYA 3PUVA 4QGUA 2VQFL 2PCFB 5IYBG 1HJPA 4LFBL 1XTDA 1NUCA 1U5KA 1FJGQ 3IRBA 1CA5A 2L11A 2Y0SB 3W1GA 3NQTA 4J15A 4G7OC 1K3BC 3H09A 5IYDH 1PZJD 4DU9A 1CM9A 4HR7B 4JBMA 1EYAA 1CZWA 2GA4B 2MFIA 1KHIA 1L1OC 1XX8A 3KJOA 2EY1A 4YCVA 2NN6G 2WB1G 3FPPA 4JPBW 5GAEC 4B3TQ 1MKHA 3SDZA 3H0GG 3GTOH 5LHY1 2UU9Q 1EU4A 1LO5D 3MXNA 3SEBA 1O7ZA 2Z6KA 4KV6A 4NDXA 1W6KA 2EY2A 1GD7A 1GUWA 4N9PA 1VQAA 5GAHC 1M1KC 1SYEA 4P75A 3A54A 3DM1A 4ILWA 4PMCA 1WD0A 3CAMA 1LTBD 1YHQA 1EWCA 4YWLA 1EY5A 3E0EA 2BCOA 5K36H 5CR3A 1Z9FA 4C3IB 1ICWA 1VQPA 2K6AA 3EBEA 2V1CC 4XIGS 1JB7A 1AZPA 2JA8G 5CBEE 4GLVB 1LTAD 2DNEA 5IWAQ 3J80i 3SGIA 2R7DA 1Y69U 1KLGD 2F0GA 4A3BG 2KCNA 2AQ1B 4ZCKA 3SK8A 1DZ1A 3BZKA 2I07B 1GXDC 1WTOA 3I70A 2OWOA 3KUPA 1F9PA 2JA6H 4YCUA 1CSPA 2EXDA 4ZAIA 1EFWA 1I3QB 3ITPA 3OW2A 1NMFA 4K14A 2CWAA 1JWSD 4G7ZC 4EGVA 4DR6Q 1HFGA 2VUMG 2UUBQ 4LF7L 1GJXA 3O13A 3IAYA 4JI6Q 4TQUS 2L9HA 1PXUA 3PUYA 4FP5D 4IURA 4FNFA 4DV0L 1LTRD 1RCVD 5CBAE 2Q8IB 4A75A 5A2QE 1EOTA 2A8VA 1I4XA 3CW2C 3K7AH 5C4XH 1NY4A 1SJED 4MN3A 1X9NA 2JA8B 3TDQA 2I5LX 4JC0A 1EYDA 1WCMH 1M8AA 4A3MB 3GTQB 4G57A 1EOVA 2E5LL 2XRQD 1C9OA 2EXZA 3K57A 1Y1VG 2PO4A 3N52A 3GDEA 2OEOA 1AH9A 3F1ZA 2B3GA 1PTOH 4DAYA 4CJ1B 5FK9C 1KTKA 4XYOA 2G5DA 4R8IA 3AYHB 2HQEA 4CBVA 1SRUA 4JI4L 1PH7A 1XNQQ 3PCOB 2E8GA 3HOXH 2X6LA 3HOWH 4OWWB 4JV5Q 3GV6A 2RSOA 4JI7Q 1BBWA 4U673 2WB1E 3U9SA 4C3JG 3DM3A 2B2UC 2Q8RE 5D65A 4DK6C 4NMZA 1B53A 2L15A 1E1OA 2F0VA 2XN9C 2O5IC 2A73B 1U4RA 3AEVA 2HHHQ 3RLFA 4DR1L 5M3MB 1Y1WG 1BR9A 1KNAA 3BU2A 1SDFA 5C44B 3I91A 1HTLD 3GTKH 1VMCA 5M3FB 1SXTA 1STHA 1OXUA 3N6RA 4B9WA 3CRLC 1ENCA 2KJXA 1PLFA 3CMAA 2NTSA 1T5XD 2XSCA 1GHKA 5M5XB 1UEBA 2F0JA 4P71A 1D5MC 1EYCA 1GOZA 4OXPA 5ELFA 3MFGA 4HN7A 5F2DA 4DKAC 4CJ0B 1M90C 1WTXA 2EYOA 1A0IA 4XT3B 4JI0Q 3HOVG 2F4VL 2YTVA 3PV0A 1LTLA 1DXMA 2R93H 5IGGA 1J5EQ 1D1IA 3GTMH 5M5YB 1JOOA 4ODGA 3MC0B 4KHVA 1K83B 2I5MX 1A63A 3H0GH 4CHTB 1GM5A 4KJOA 2AUKA 4DV1Q 4MTKA 4HSVA 2LFNA 1H9JA 3DLLA 3CC4A 2HT1A 4MTNA 3A5UA 4L5TA 4C3HB 4BBRH 2QF7A 4YWKA 4ZLTF 1FR3A 4DV7Q 1Y8NB 1F77A 4C2MH 3H91A 1LTGD 2VQEL 1EWHA 2PW5A 4IALA 5NUCA 2NZ1D 4OIKA 1IHZA 4DV2Q 1G2SA 1STEA 2F52A 4K6DA 1HUMA 1YHBA 2B2TC 4APVA 3WDNA 3M3YB 2FMMA 3UE0A 2JN4A 1VS0A 2MQHA 1PMRA 1YNJC 4GLAC 3V2TA 4NW2A 3K59A 3AU7A 3NTHA 2B2VC 2NZOA 4XT1B 1YIJA 2CCZA 1O7IA 2ZM6L 5I9OA 3LWUA 5KRUA 4POGA 4IOCA 2XWJB 2E2IB 2H4OA 2YTYA 4OHJA 2IW3A 2UUAL 2P5ZX 5LMNW 3TS2A 3S1QH 2DY7A 1VQDA 1Q46A 1F2LA 4JYAQ 2KA7A 4QIWB 1JCKB 2YV5A 5IT9c 4DV2L 4A3GG 2MGSA 5C6AA 2KECA 4X64L 2UXCQ 1SYCA 3F8TA 2J4XA 2L55A 3L2PA 3G4SA 1YNND 3S9WA 4PMBA 4EQPA 3VA5A 1JOQA 4G4KA 2K05A 2WKCA 5M3MH 4XDXA 1PH2A 3Q24A 1TY0A 3OOCA 1TWGB 2SEBD 1JJ2A 4FF3A 2A74C 1S40A 3S16B 2HD3A 3BZCA 3T4AC 1R9TH 1JWUD 2PQEA 1KAAA 3A0JA 3S15H 4HIMA 4H02A 2ZXOA 5K5PA 1R4PB 3HOUG 4A3CH 2Z4HA 1EQTA 1EY7A 1DM0B 2WIIB 1GUSA 2CH4A 4DK0A 3Q22A 1OTCA 3FDTA 1F2MA 2NYZD 4X3SA 3I4MG 1S3OA 4CGYB 2EYJA 2ZJRA 2EYLA 4IFDJ 3MVVA 1N32Q 3NUCA 2NZHA 3NQIA 3FP9A 4LF4Q 1PYWD 4RHSA 2EVBA 4A3GB 2VB3X 1EL0A 1BF4A 3EA6A 1B3AA 1PTOD 1MSHA 3K7UC 2HDLA 2K33A 2QCPX 3NE5B 1HR0L 4A3DB 4A76A 1QE6A 3NELA 1XMQQ 1HNWL 3IL8A 4EQOA 1STAA 1L1OB 4UP9A 3S1NH 1V1QA 1DYQA 5IYCG 1VQGA 2PQAB 4H44C 4DUYQ 2B2UA 2C35B 1QWYA 1YNNC 3MXPA 4DN4M 2OCEA 3G6JB 3BVMA 2M00A 1J5EL 3DWPA 1WYDA 4RWSC 1SNQA 3CCRA 1PYBA 1QCBD 1S5ED 4K5VA 3JAMi 1SE4A 1S5BD 1EZ8A 2CHBD 1UWVA 4J1MA 1O80A 3D6CA 3UDGA 1H95A 3HKZE 1Y8PB 2F0DA 1GUNA 3OMGA 1TT2A 3AB9A 1B9NA 3GTOB 3B6YA 3QJYA 2JEAI 2B63G 3VR3A 5IWAL 1AZQA 2WINB 3FHWA 2IX3A 4GOPA 1HR0Q 3PF5A 1A2UA 2D0OA 3K81C 4DV7L 4B3RL 3RZOB 2ENBA 4AYBE 2HDMA 1ET9A 3T51B 1NNXA 4A93G 3OWEB 2F0FA 3T1YQ 4WJWA 1AW7A 1C48A 1EU3A 1ZEQX 3GTGB 1KQSA 3S17H 1SEBD 4UP8A 1VQJA 3RMHA 3R93A 1L0YB 2B2YA 2XRSD 2EDGA 2K5VA 4MIUA 4Q5VA 1SNPA 1GHJA 2E2JB 2DJGC 1I4QA 1U4LA 4GNXB 4K5WA 1HZCA 4DNRB 2K04A 1TS5A 1PFNA 1NJIC 1Q82C 1ENFA 1SMXA 3BG3A 4X62L 2B2TA 4O0AA 1E2VA 1X56A 3ERQA 2MUYA 1D5ZC 2BOSA 4DV5Q 1UUPA 1WVLA 4OX9L 2JP1A 4GN4B 1Y14B 3HOVH 4QB4A 3ER0A 1Z6HA 3RLOA 4PG3A 4A3FH 4PNYA 2Z6KC 4A3IH 4GLXA 5J3BA 2Q2TA 2Z9HA 3S14H 2PZUA 1EQRA 3HOZH 5CV8A 2HHHL 5CV5A 1CKOA 4R9WA 1TR5A 3H3VH 2F0WA 4XXEA 1LT6D 4R4QA 2UXCL 4RCOA 4DR6L 5FO7B 3OPOA 3ULJA 3W1BA 4X3UA 3HOYB 2L5TA 2NN6H 3CKIB 2E5LQ 5EKIA 1HA5A 1HNZQ 3UE1A 1JWMD 5ELCA 2MHVA 3A8IE 1IZ6A 1UNSA 1GUTA 2DN8A 4KY5A 5EJWA 3TP7A 3D0FA 5IYCH 5LMNQ 1UE5A 3MEHA 3JAML 2F3VA 3TRZA 5K36G 2QEJC 1YJNA 1VQ8A 1PZKD 1EIHA 2I46A 3HKSA 4O1NA 1NAPA 1Y1WB 1LABA 2B29A 1I94Q 4QCLA 1V1PB 4DAVA 3PUZA 5EQ0A 1PH6A 2QA4A 2R92H 1LACA 1R9TB 5IGEA 3KOJA 2CQOA 5IE8A 4JYAL 4B3SL 1TKWB 2CW0D 3HZXA 1KIXA 2I5HA 5JEAG 2KCMA 1B1ZA 4AQYQ 1WTHA 4Y52H 2AMCB 4C3IG 1PFSA 1IYUA 1TWHH 3ND8A 1VQFA 1P8LA 2PYKA 4YWMA 3R8BA 2KBNA 1PH9A 3T53B 3I8ZA 3KFUA 1N32L 4GN3B 3CF5A 1B3QA 4QUCA 4HSPA 4K8JA 4UPAA 4GOPC 1WOCA 2GVAA 4IFDI 1YHAA 4A3FG 5IGCA 2AKWB 1C7YA 3EROA 2E74C 3NPPA 2K4KA 3PO2B 3HKZG 4A3LH 1LT5D 1NTGA 1VQNA 1K28A 3A8KE 1I6HB 4DAMA 1I4PA 2PQAA 1XYIA 3ZYYX 4EQNA 4LK1C 4B08A 4A3JG 1YVCA 4YHHL 3WOFA 1RKNA 3W3AA 3G48A 4LJZC 5E4WC 4A3JH 2F0MA 4LUOA 4BY1H 1D8LA 3H15A 1E22A 3GQBA 1W6JA 2RDHA 1EIFA 3HGBA 1CQFA 1WCMG 4DK3C 1BCPF 4CDFC 2R7ZH 2B2YC 2JA6G 1B44D 4GNXC 1PH3A 1PRTC 2KVMA 1RTOA 2K01A 4HEDA 1UE1A 3C2PA 4MHEA 2QW7A 3OMCA 4DNTB 2K5QA 3J81E 5FJ8G 4IUVA 1GUOA 2DY8A 1X3QA 3CCLA 4KN7C 4ZQ3A 3I72A 2F0SA 3RD4A 2O5JC 5C5LA 1EEID 1SE2A 2PPBC 1WFQA 1XTCD 4DNIA 1LTSD 1STYA 5BN4A 1IXRA 5JJKA 1SBBB 2NVYH 2H1EA 3D8GA 1NR2A 4TKOB 1N8RC 1V8QA 4DR5Q 1LM0A 3DEPA 4DR2Q 2ZM6Q 1X3GA 3ULPA 1VQEA 4A3JB 1CSQA 2E2DC 3UDIA 3HP3A 1RDPD 1EZ6A 4Z9CB 2R7ZB 1X3PA 2CVRA 1K8GA 2D0PA 3GTQH 1WCMB 2JE6I 3L7ZC 1U0LA 3MHBA 1VQLA 3QOJA 4HIDA 3R2TA 1IBML 2KHJA 1TWCB 2CH4W 2IL8A 2ZTDA 1ZKOA 1AFPA 4HAEA 3I4NG 1HNXQ 5M5YH 1Q8KA 2D62A 2NVXB 2EZVA 3J7ZC 5DEHA 2WACA 3CCJA 2D2CC 5JEAJ 4UAIA 1X65A 3K5NA 2JA8H 3HOYG 3NENA 3JC66 5HGTA 3TREA 2IX0A 3CRKC 3KLWA 4DUZL 4R4OA 2A5HA 2AWOA 2AWNA 1LT3D 1SNOA 1YEZA 4KHPL 5FLXc 5FOBB 1HUNA 2R7ZG 1ESFA 4M8AA 3C1EA 1ZYRC 2F0HA 2IT1A 3M3YH 4J8QA 2NUCA 1O7LA 5D3IB 4AYBB 1GVPA 2JA5B 1IW7D 4CDDC 3TZDA 4BY7B 2NTTA 3S2DB 1H9KA 4PZ8A 1VQKA 3HOWG 2FINB 4JI1Q 4HTHA 2R61A 1TWFH 4BY7G 2JSOA 4KK7A 1G2TA 1SROA 1TWAB 3E6ZX 4DV0Q 1WTRA 2K5HA 4IPHA 2JEBI 1Q86C 5LMNL 1H9SB 2VNUD 5T1IA 4DUZQ 3E9IA 1SE8A 1PH1A 3RLNA 4E6IA 1ILQA 1K83H 3CC2A 5FLMH 4KLKA 1HR0W 3FKIH 4LF4L 1IKMA 2R93B 2N88A 2LY7A 4A3MH 1LTTD 1YZ6A 4L6TB 3TZUA 3FKIG 4C3JB 3WWVA 3U4VA 2JXMB 1MJCA 2K5WA 4R1JA 2EPBA 5C4XB 3CU7A 4LFCL 4PZ6A 2XVSA 4JCVE 4S3SA 1Q81C 2RF4A 5FKAC 4RGNA 4BXXG 4FF2A 5C4HA 1FNWA 3FMCA 3NTKA 3VR5A 4R4IA 4OWTB 1QZHA 1KRTA 3GTJB 1WTVA 1HHVA 3A55A 4LFBQ 4BS9A 1K0SA 1I94L 2B63H 4IN3A 1Q1EA 5GADC 4B3MQ 1XMOL 1CTMA 4A93H 2NVQB 1DGSA 1I50H 4X62Q 1H9SA 4RGOS 1DJRD 1TS4A 1B8AA 1SNCA 1QILA 3M7NA 3K5OA 3GTGH 5EKKA 1EY0A 4CJ2C 4RAUC 5GQOA 2E2JH 1CQVA 2PZWA 2RA4A 5DLQE 4DR5L 5I9PA 2K5DA 4HJ7A 4UY8C 4P2CB 1KRSA 3OTOL 3S1NB 1R4QB 1ASYA 4OO1G 3BJUA 2E2HB 5JEAH 4JI4Q 3OW7A 2J0TD 4IUQA 3PO3B 1C8CA 3I4MB 4GNXA 2HCCA 4JI7L 2EE1A 1FJGL 2ZXRA 4QF4A 4X3TA 4HJAA 2Z6BA 5M3MG 1I50B 2YYZA 3CC7A 1CI3M 3CCUA 3STBD 4PMWA 4DR7L 3J81i 3F2DA 5HURA 3HRZC 1GKHA 4A3IG 4IFDH 4YCWA 4GS3A 4NXNL 1L0WA 1UE6A 1QVFA 4XYQA 2RBMA 1SYGA 2A68D 1NE3A 1TWGH 3OTOQ 2F0IA 2DGYA 2WAQE 4JOIC 3KLSA 3AFPA 4A4IA 4PQXA 3U4ZA 3S2HB 1V9PA 2RVLA 3MFYA 3HOZG 5KGUA 2F4VQ 1ZXTA 4C3JH 3L9AX 4MNOA 4FDBA 5ELEA 1G8ZD 2A19A 4OWXB 3HG9A 3I3CA 4ALPA 4DR7Q 1JICA 2N55A 4DV1L 2KHIA 4C3HG 1CKNB 4A3DH 2PZTA 3OWFA 1ESRA 5I4DA 3H3VC 3A7AB 1G6ZA 1XWEA 2A6HD 1L2FA 4A3GH 2VXWA 1HNZL 1VCIA 1KC8C 1ASZA 5DAUA 3JAME 1RTNA 3K0YA 3F2CA 4QUFA 2B39A 5LL6X 2K1BA 5CV7A 5J22A 2NN6I 1U4PA 3EIVA 3C46A 4FXDA 2B63B 3NBIA 1PH8A 1KL9A 5C4JH 5KYIA 4LF6Q 2ID0A 1X32A 3LX0A 3CCQA 2EIFA 1ONLA 2OQKA 3D4RA 2JYOA 2F3WA 4G7HC 2JQOA 1BO0A 3E5SA 1G6PA 4FO2A 1JMCA 4DGZA 1SR3A 5IGBA 3T1HQ 3GTPH 1V43A 4BBSG 1LYLA 2BE5D 3WOEA 2F1MA 1TU2B 1PRTB 1BVSA 2VUMH 2UUAQ 2EYFA 2YU9H 3S16H 1NMGA 1YITA 4DXGA
chains in the Genus database with same CATH topology
5IODA 4ME5A 1D1KA 3I4NB 5C3XA 2V4DA 3PUWA 3QOLA 1F9QA 3DWAA 3BYYB 2HUGA 3Q23A 1Q8IA 1KDBA 5G3LF 2Z1CA 1CT1D 2EYPA 1I4RA 3T16A 2QKIC 1HQMC 1DOLA 4V0BA 4U68A 4OO1H 1I4GA 1HFNA 2WV6D 5EBCA 5C4ZA 5C5MA 1K8MA 3P7JA 5JPNC 5I2YA 4RKBA 1E0BA 3TP8A 3PIP3 2F0OA 5DM63 1CA6A 1QOHA 1JOKA 5EPLA 1V1OA 5FLXL 2DNCA 5C3EB 4ZUJA 2JA7B 4H13C 3J7AF 3ONAB 2KQ3A 2KUMA 1FYCA 4F88A 2NBFA 1QJOA 4KD4A 4HMJA 3EFXD 5ELDA 1PDQA 4IUNA 1OO9B 3I73A 3VR4A 2ICEC 2A69C 1PTOF 4JK1C 4I7ZC 4HMIA 3OHXC 1TWHB 3HOWB 5KNDA 3GTPB 4FXGC 3DWQA 4KTAA 2R92B 1MGSA 1LTID 3PIO3 1PTOB 4Q0FA 4BA2I 1DONA 3HOXB 2O4XA 4K6LA 4XQJA 2LS01 5CV6A 4RA8A 3K5LA 2AQ3B 1Q90A 2SDFA 1U9RA 2CQAA 1IYVA 1OXTA 3TSSA 2EY5A 3D4DA 1OXSC 4ZKCB 3R2IA 2RSNA 3KLRA 2L4NA 3M7GA 4A3IB 2A69D 1HRJA 2MP1A 5D14A 4WFN3 1Q12A 4HCEA 1FNUA 2XNAC 3URYA 4LAAA 1QNKA 4N9TA 3M4OB 3TN2A 4RKLA 4ZKBB 2WP8J 2D9UA 1EIGA 1GUGA 4KJNA 2L0CA 2MJ8A 1AN8A 1TQOA 1SAPA 5JJZA 4OIJA 3J7AV 1VF7A 2BE5C 3PUXA 1TVXA 2ZT9C 2B8GA 3V05A 1IW7C 3SK5A 1C4QA 3GD7A 3TP5A 1RF2D 4KMUC 4A3BB 1UAPA 4V190 4DXFA 2F0UA 4F8MA 1Z47A 3J80L 1TS2A 1VF5C 1J9OA 3S1MB 3QG1A 1J8IA 3G7LA 1FNVA 3X3NA 5FO9B 2M2LA 4IZ8A 3K6OA 5JPMC 2FHTA 1A3TA 3OSOA 1JQYD 2SNSA 2WKDA 4KY6A 4KY7A 2F4IA 1UEAB 2KEEA 4DAPA 1WD1A 4Y7NB 1TWFB 3FKIB 1B50A 2HCIA 1WTWA 1E2ZA 3KBGA 1G291 4M1UB 5KYLA 1XXGA 2BA0A 1B9MA 1STGA 3D4WA 2SNMA 2PNRC 2F0EA 2IX1A 2A6EC 4NKLA 1QNUA 1PFBA 4J6HA 2Z8LA 1B2TA 3S1RB 2A6HC 2R6GA 1BXTA 1EY9A 3KF8A 2LKVA 5DM73 3RZDB 4A93B 2K7VA 2NB0A 3D31A 4K2KA 1BCPD 3Q6SA 4DF7A 2BDOA 3HEJA 4IQZA 2E75C 1S5DD 2MPMA 2C5CA 2ICIA 3VA7A 3GO5A 3BVZA 5I6WA 1O78A 1JORA 5KEEA 3SHLA 4CKCA 1EQVA 4ZYSA 1EEFD 1A2TA 4OGQC 4ABNA 2F0PA 4JBWA 2A68C 5M5WB 4FF4A 2KHSA 1RJTA 1BNZA 4XTCS 4NP5A 4KKSA 3H6MA 2NVYB 2FJ2A 3A56A 5KIXA 4PV1C 2IWHA 3AMUA 2R3ZA 5JVH3 4H0LC 1BCPC 4A3KB 1AP0A 3FPUB 2BA1A 1PRTF 4GZYC 3BDLA 3VYRA 1VMPA 4K5XA 4LMQD 1A6XA 3VYTA 2D5DA 3H94A 4KD3A 2A6ED 3LNNA 3A8JE 3GTMB 1SYFA 4IFDG 5ISRA 2OT2A 1LLRD 4RFBA 5EPJA 4B9XA 3H0GB 1TIID 1H9RA 1BOSA 1OXVA 3QB3A 1ZYRD 4RHRA 3E0JA 2FMCA 3EQLC 4FYDA 5E3FA 1Q1BA 5CGKA 1DOKA 3EJIA 3KBXA 1SYDA 5EPKA 2EJGC 1TY2A 5JAVA 3FEWX 2B2WA 1T5EA 2L12A 3MA2B 4DA2A 2E76C 2SOBA 1Y1VB 3MXGA 3VR2A 5E4XA 4OL7A 5CV4A 3T56B 1I4HA 2F03A 5C4JB 4WRDA 1O7YA 1HCZA 1LT4D 1VDZA 1Q3LA 4O42A 2K28A 3MTSA 3BVGA 4UDUC 1KNEA 5BN3A 4A3EB 1JE4A 4BWGB 5A2QL 3VR6A 3S14B 1SYBA 1A3UA 1EY8A 3NK9A 1IKLA 1RD9D 5CYUA 2EYHA 3QIAA 3GTKB 3UI2A 3J81L 3TMEA 3HOUB 2X6GA 5IGFA 3HOZB 5CORA 3GV3A 1CZGA 2F0TA 4A3FB 3FRPB 1BCPB 1AEXA 5CV9A 3P1HA 1F2YA 4ZRZA 3K58A 3C1FA 1SMYC 3NWSA 3D3RA 1S5CD 3U9OA 3NWTA 4KN4C 5FO8B 2RKSA 5JOBA 4TSSA 2FFKB 2OXPA 1F9SA 1WTPA 2K03A 1NR4A 2F0NA 5C0XJ 2EY6A 1BBXC 1BQQT 4QMGA 3OIQA 3VYUA 3BS1A 1SNDA 3BYTB 4CKEA 3HOVB 2RDGA 3MWYW 2EYMA 4YIJA 5J39A 1E2WA 1A3VA 1EY6A 5EBDA 4C56C 4C1NI 1D6EC 1L0XB 5I6YA 3HS0C 3L3OC 3QWNA 2RDFA 1CK1A 2VB2X 3PMFA 1DOMA 3V96A 1A15A 5C3WA 3SVMA 4DFAA 5G3LD 5CC4A 4F87A 2IJ0A 3S17B 1RODA 3NXWA 1F2ZA 3M85A 5EKLA 2J7ZA 2RQXA 5IIFA 3DXJC 2LMCB 2AQ2B 5IT9E 3KLSX 4KI0A 1PRTD 1QG7A 1CHPD 5EGTA 1HA6A 3MXUA 1FD7D 4IUUA 1H9MA 1STBA 3A7LA 4FVMA 2L1BA 2O2LD 5D3DA 1HQRD 2EJFC 2AUJD 2X69A 1F9RA 1SJHD 3SR1A 3SK6A 2NWGA 2C9OA 1SFOB 5COYA 2G9DA 2BDNA 2EOTA 1MSGA 4I65A 4IUTA 1QB5D 3X3MA 4EVOA 2KOLA 2OF1A 2QILA 1KDAA 3TP6A 3P20A 3KK7A 4RH6A 2PMZB 3BDCA 4OO1I 3SE0A 4DK1A 1ILPA 5CMDA 1ML0D 2F0LA 1PZID 3DUZA 3J7YW 3FVQA 1CFMA 3I4LA 3BZDB 1TS3A 2EJMA 3CQZB 5BN5A 1CHQD 5KNBA 3F2UA 5IGDA 3SK4A 2KCCA 4KKUA 4C2MB 1SMYD 4L63B 4RGTA 5DNFA 1JR0D 3I90A 3GP7A 4XQQA 1NSNS 1OXXK 3S15B 3HKZB 1ET6A 1G91A 3W2DA 3IKJA 4FF1A 3VYSA 4ID6A 3DHQA 3M4YA 1HTPA 1DCZA 5TSSA 2NVTB 5AFWA 3ND9A 4BY1B 3S1QB 3R3OA 5FLXE 1I6VC 1EFID 5C0XI 2F0KA 1HPCA 4K2LA 5M9OA 3NSWA 1Z7TA 4RCNA 2K32A 1KLUD 2PW7A 1HXYD 4K8IA 5A35A 1MI2A 4ULLA 1YNJD 1BDOA 4TRDA 1BUVT 1SSOA 4BA1I 3J80E 3C3LA 3OIPA 2XIWA 3P75A 4F7XA 2B2WC 2IPKD 4ZK9B 1B4OA 2B2VA 3NTIA 1S5FD 1FGBD 4ZUIA 2CW0C 3BDOA 4HCSA 1K8OA 3MZ5A 1JC7A 4BBRB 4FXKC 4KKTA 1SNMA 4CKBA 1DD2A 2TSSA 1ENAA 3T13A 2F0QA 3SXHA 4L8JA 1WTQA 2G9HD 5IOCA 4X3KA 1S4ZA 4WORA 3GTLB 5IT9L 3MAQA 2Q8TA 2QDBA 4IUPA 5C0XG 1LV9A 5JVG3 3CHBD 5C0XH 2ZXPA 5T1GA 4R8NA 3NHHA 3K5MA 2VUMB 3IFDA 3DMUA 2YU9B 2Z4IA 3NP8A 1II3A 5E1FA 4RGMA 2B8FA 1PTOC 5KNCA 1NCVA 2JA6B 2KEDA 1PFMA 1Y8OB 1U4MA 3DEOA 1KABA 1KDCA 4KHZA 4XQNA 5J1ZA 2TMPA 3RUZA 4C1NK 1IL8A 5I2XA 1MD2D 2XWBB 1SE3A 5LL6S 3QO2A 2WAQB 1V1PA 1JB3A 2WB1B 4BBSB 3IFTA 1EY4A 3LWEA 4H7BA 3EVQA 3NBHA 3D6WA 2M9VA 1D5XC 3K7AB 3Q0AA 1D2BA 1M4VA 1STNA 5ELBA 1RHPA 3TBIB 1MBYA 3PUVA 2PCFB 1NUCA 1CA5A 2L11A 2Y0SB 3NQTA 4G7OC 3H09A 1PZJD 4DU9A 1CM9A 4HR7B 1EYAA 1CZWA 2GA4B 1XX8A 2EY1A 2NN6G 3FPPA 3SDZA 5LHY1 1EU4A 1LO5D 3MXNA 3SEBA 1O7ZA 4KV6A 4NDXA 1W6KA 2EY2A 1GUWA 4N9PA 1SYEA 3A54A 3DM1A 4ILWA 4PMCA 1WD0A 1LTBD 1EWCA 1EY5A 2BCOA 5K36H 5CR3A 4C3IB 1ICWA 2K6AA 4XIGS 1AZPA 5CBEE 1LTAD 2DNEA 1Y69U 1KLGD 2F0GA 2KCNA 2AQ1B 3SK8A 1DZ1A 2I07B 1GXDC 1WTOA 3I70A 3KUPA 1F9PA 4ZAIA 1I3QB 3ITPA 4K14A 1JWSD 4G7ZC 4EGVA 1HFGA 1GJXA 3O13A 3IAYA 4TQUS 2L9HA 1PXUA 3PUYA 4FP5D 4IURA 4FNFA 1LTRD 1RCVD 5CBAE 2Q8IB 5A2QE 1EOTA 1I4XA 1SJED 4MN3A 2JA8B 3TDQA 1EYDA 1M8AA 4A3MB 3GTQB 4G57A 2XRQD 2EXZA 3K57A 2PO4A 3N52A 2OEOA 1PTOH 4DAYA 4CJ1B 5FK9C 1KTKA 4XYOA 4R8IA 2HQEA 4CBVA 2X6LA 3GV6A 2RSOA 4U673 3U9SA 4C3JG 2B2UC 2Q8RE 5D65A 4NMZA 1B53A 2F0VA 2XN9C 2O5IC 2A73B 1U4RA 3RLFA 5M3MB 1BR9A 1KNAA 1SDFA 5C44B 3I91A 1HTLD 1VMCA 5M3FB 1SXTA 1STHA 1OXUA 3N6RA 4B9WA 3CRLC 1ENCA 2KJXA 1PLFA 2NTSA 1T5XD 2XSCA 1GHKA 5M5XB 2F0JA 1D5MC 1EYCA 1GOZA 5ELFA 3MFGA 4HN7A 5F2DA 4CJ0B 1WTXA 2EYOA 4XT3B 3PV0A 1DXMA 5IGGA 5M5YB 1D1IA 1JOOA 4ODGA 3MC0B 4KHVA 1K83B 4CHTB 4KJOA 2AUKA 4HSVA 2LFNA 1H9JA 4C3HB 2QF7A 4ZLTF 1FR3A 1Y8NB 1F77A 3H91A 1LTGD 1EWHA 2PW5A 4IALA 5NUCA 2NZ1D 4OIKA 1IHZA 1G2SA 1STEA 4K6DA 1HUMA 2B2TC 3WDNA 3M3YB 2FMMA 1PMRA 1YNJC 3V2TA 4NW2A 3K59A 3AU7A 3NTHA 2B2VC 4XT1B 5I9OA 3LWUA 5KRUA 2XWJB 2E2IB 2H4OA 4OHJA 2IW3A 2DY7A 1F2LA 2KA7A 4QIWB 1JCKB 2MGSA 5C6AA 2KECA 1SYCA 2J4XA 2L55A 1YNND 3S9WA 4PMBA 4EQPA 3VA5A 1JOQA 4G4KA 2K05A 2WKCA 4XDXA 3Q24A 1TY0A 3OOCA 1TWGB 2SEBD 4FF3A 2A74C 3S16B 3T4AC 1JWUD 2PQEA 1KAAA 2ZXOA 5K5PA 1R4PB 2Z4HA 1EQTA 1EY7A 1DM0B 2WIIB 1GUSA 4DK0A 3Q22A 3FDTA 1F2MA 2NYZD 4X3SA 4IFDJ 4CGYB 2EYJA 2EYLA 3MVVA 3NUCA 3NQIA 1PYWD 4RHSA 2EVBA 4A3GB 2VB3X 1EL0A 1BF4A 1B3AA 1PTOD 3EA6A 1MSHA 2HDLA 2K33A 2QCPX 3NE5B 4A3DB 1QE6A 3IL8A 4EQOA 1STAA 1DYQA 4H44C 2B2UA 1QWYA 1YNNC 3MXPA 4DN4M 3G6JB 3BVMA 2M00A 3DWPA 4RWSC 1SNQA 1QCBD 1S5ED 4K5VA 1SE4A 1S5BD 1EZ8A 2CHBD 4J1MA 1O80A 3D6CA 1Y8PB 2F0DA 1GUNA 3OMGA 1TT2A 3AB9A 1B9NA 3GTOB 3QJYA 2JEAI 3VR3A 1AZQA 2WINB 2IX3A 1A2UA 3RZOB 2ENBA 2HDMA 1ET9A 3T51B 3OWEB 2F0FA 4WJWA 1AW7A 1C48A 1EU3A 1ZEQX 3GTGB 1SEBD 3RMHA 3R93A 1L0YB 2B2YA 2XRSD 2EDGA 4MIUA 4Q5VA 1SNPA 1GHJA 2E2JB 1I4QA 1U4LA 4K5WA 4DNRB 2K04A 1TS5A 1PFNA 1ENFA 3BG3A 2B2TA 1E2VA 3ERQA 2MUYA 1D5ZC 2BOSA 1UUPA 1WVLA 2JP1A 4QB4A 1Z6HA 4PNYA 2PZUA 5CV8A 5CV5A 4R9WA 1TR5A 2F0WA 4XXEA 1LT6D 4RCOA 5FO7B 3OPOA 4X3UA 3HOYB 2L5TA 2NN6H 3CKIB 5EKIA 1HA5A 1JWMD 5ELCA 2MHVA 3A8IE 1UNSA 1GUTA 2DN8A 4KY5A 5EJWA 3TP7A 3MEHA 3JAML 2F3VA 5K36G 2QEJC 1PZKD 1EIHA 2I46A 4O1NA 1NAPA 1Y1WB 1LABA 4QCLA 1V1PB 4DAVA 3PUZA 5EQ0A 1LACA 1R9TB 5IGEA 1TKWB 2CW0D 3HZXA 5JEAG 1B1ZA 4C3IG 1IYUA 3ND8A 2PYKA 3R8BA 3T53B 3I8ZA 4QUCA 4HSPA 4K8JA 4IFDI 5IGCA 3EROA 2E74C 3NPPA 3PO2B 1LT5D 3A8KE 1I6HB 1I4PA 1XYIA 3ZYYX 4EQNA 4LK1C 4B08A 3WOFA 1RKNA 3W3AA 4LJZC 5E4WC 2F0MA 3GQBA 1W6JA 2RDHA 3HGBA 1CQFA 1BCPF 2B2YC 1B44D 1PRTC 2KVMA 1RTOA 2K01A 4HEDA 3C2PA 4MHEA 3OMCA 4DNTB 2K5QA 3J81E 4IUVA 1GUOA 2DY8A 1X3QA 4KN7C 4ZQ3A 3I72A 2F0SA 3RD4A 2O5JC 5C5LA 1EEID 1SE2A 2PPBC 1XTCD 1LTSD 1STYA 5BN4A 1SBBB 2H1EA 3D8GA 1NR2A 4TKOB 1V8QA 3DEPA 4A3JB 2E2DC 3HP3A 1RDPD 1EZ6A 4Z9CB 2R7ZB 1X3PA 2CVRA 1WCMB 2JE6I 3L7ZC 3MHBA 3QOJA 3R2TA 1TWCB 2IL8A 1ZKOA 1AFPA 4HAEA 2D62A 2NVXB 2EZVA 5DEHA 2WACA 2D2CC 5JEAJ 4UAIA 3K5NA 5HGTA 2IX0A 3CRKC 2A5HA 2AWOA 2AWNA 1LT3D 1SNOA 1HUNA 5FOBB 1ESFA 4M8AA 3C1EA 1ZYRC 2F0HA 2IT1A 4J8QA 2NUCA 1O7LA 5D3IB 4AYBB 2JA5B 1IW7D 4BY7B 3TZDA 2NTTA 3S2DB 1H9KA 2FINB 4HTHA 2R61A 2JSOA 4KK7A 1G2TA 1TWAB 3E6ZX 1WTRA 2JEBI 1H9SB 2VNUD 5T1IA 4E6IA 1ILQA 1IKMA 2R93B 2N88A 2LY7A 1LTTD 4L6TB 3TZUA 4C3JB 2JXMB 2K5WA 2EPBA 5C4XB 3CU7A 2XVSA 4S3SA 5FKAC 4RGNA 4FF2A 5C4HA 1FNWA 3FMCA 3NTKA 3VR5A 3GTJB 1WTVA 1HHVA 3A55A 4BS9A 4IN3A 1Q1EA 1CTMA 2NVQB 1H9SA 4RGOS 1DJRD 1TS4A 1SNCA 1QILA 3M7NA 3K5OA 5EKKA 1EY0A 4CJ2C 4RAUC 1CQVA 2PZWA 2RA4A 5I9PA 2K5DA 4P2CB 3S1NB 1R4QB 4OO1G 2E2HB 5JEAH 3OW7A 2J0TD 4IUQA 3PO3B 1C8CA 3I4MB 2HCCA 2EE1A 2ZXRA 4QF4A 4X3TA 1I50B 2YYZA 1CI3M 4PMWA 5HURA 3HRZC 4IFDH 4XYQA 2RBMA 1SYGA 2A68D 2F0IA 3KLSA 4PQXA 3S2HB 2RVLA 3MFYA 5KGUA 1ZXTA 3L9AX 5ELEA 1G8ZD 3HG9A 3I3CA 1JICA 2N55A 4C3HG 2PZTA 3OWFA 1ESRA 5I4DA 3H3VC 3A7AB 1G6ZA 1XWEA 2A6HD 2VXWA 1VCIA 5DAUA 3JAME 1RTNA 3K0YA 4QUFA 2B39A 5LL6X 2K1BA 5CV7A 5J22A 2NN6I 1U4PA 3C46A 4FXDA 2B63B 3NBIA 5KYIA 2ID0A 1X32A 3LX0A 1ONLA 3D4RA 2JYOA 2F3WA 4G7HC 1BO0A 3E5SA 4FO2A 4DGZA 5IGBA 1V43A 2BE5D 3WOEA 2F1MA 1TU2B 1PRTB 2EYFA 4DXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQN A;  1F2M A;  4I65 A;  4KHV A;  5IOD A;  4ME5 A;  2PW7 A;  4K8I A;  4KTA A;  2SOB A;  2EYJ A;  4EVO A;  1RKN A;  2EYL A;  2F0N A;  3MVV A;  5I6W A;  2EY6 A;  1JOR A;  3NUC A;  2F0M A;  3ERQ A;  4QMG A;  3ITP A;  2OF1 A;  4TRD A;  5C3X A;  5KEE A;  4KJO A;  4K14 A;  3SHL A;  3QOL A;  4OL7 A;  1KDA A;  2F0U A;  1EQV A;  5CV4 A;  1SND A;  5HUR A;  4HTH A;  4F8M A;  3TP6 A;  1A2T A;  4QB4 A;  2O4X A;  3P75 A;  1EY4 A;  4H7B A;  4WRD A;  4F7X A;  3EVQ A;  2F0P A;  1KDB A;  2EYM A;  3BDC A;  4YIJ A;  4EQP A;  5J39 A;  4EQO A;  4PNY A;  2KHS A;  1STA A;  1A3V A;  1EY6 A;  2RBM A;  1SYG A;  2PZU A;  2F0I A;  5CV6 A;  5CV8 A;  3OMC A;  2PW5 A;  4IAL A;  5CV5 A;  5NUC A;  2EYP A;  1TR5 A;  4E6I A;  4ZUI A;  1IHZ A;  2F0W A;  1STN A;  2F0L A;  4NP5 A;  4IZ8 A;  3T16 A;  4K6D A;  4ZQ3 A;  3H6M A;  3MZ5 A;  1EYD A;  2F0S A;  5I6Y A;  5IGD A;  5KGU A;  3MXP A;  5C5L A;  1A3T A;  1NUC A;  1SNM A;  1U9R A;  4G57 A;  5KIX A;  1STY A;  2M00 A;  2RDF A;  3OSO A;  1SNQ A;  3NQT A;  3V2T A;  5C4Z A;  4K5V A;  2EXZ A;  5C5M A;  2SNS A;  2EY5 A;  1EZ8 A;  1ENA A;  3PMF A;  4KY6 A;  4DU9 A;  3D8G A;  4J1M A;  3T13 A;  2F0Q A;  3D4D A;  2OEO A;  3D6C A;  4KY5 A;  4KY7 A;  4S3S A;  3SXH A;  3SK4 A;  4DFA A;  3TP7 A;  5C3W A;  1EYA A;  2F0D A;  5I9O A;  3MEH A;  3OMG A;  2HQE A;  1TT2 A;  1EZ6 A;  2F3V A;  4RKB A;  5C4H A;  5IOC A;  1SYB A;  5CC4 A;  1A3U A;  5KRU A;  4WOR A;  1JOQ A;  2EY1 A;  1EY8 A;  2PZT A;  3NK9 A;  3TP8 A;  3NXW A;  2QDB A;  3OWF A;  2EYH A;  2F0O A;  1F2Z A;  1NSN S;  3BDL A;  1A2U A;  1JOK A;  4NMZ A;  5EKL A;  2F0V A;  4K5X A;  4LAA A;  3MHB A;  3QOJ A;  3TME A;  5KYL A;  4N9T A;  2ENB A;  5DAU A;  5IGF A;  5IGE A;  1STG A;  4KD3 A;  3HZX A;  5IIF A;  3D4W A;  4R8N A;  2F0F A;  4KV6 A;  4NDX A;  4RKL A;  5C6A A;  2EY2 A;  2F0T A;  2SNM A;  4ID6 A;  3DHQ A;  4N9P A;  2F0E A;  5CV7 A;  5J22 A;  1SYC A;  3NHH A;  4ZUJ A;  1SYE A;  3DMU A;  3S9W A;  4PMC A;  1SYF A;  4NKL A;  4ODG A;  1STH A;  1AEX A;  4PMB A;  3NP8 A;  4KJN A;  1SNC A;  1II3 A;  5EKK A;  3VA5 A;  4B9W A;  4J6H A;  5KYI A;  5ISR A;  2KQ3 A;  1EY0 A;  5DEH A;  1TQO A;  5E1F A;  2WAC A;  2PYK A;  3LX0 A;  5CV9 A;  5EGT A;  1EY5 A;  1ENC A;  3P1H A;  2PZW A;  4B9X A;  4KD4 A;  1F2Y A;  5HGT A;  5I9P A;  5CR3 A;  1EY9 A;  3QB3 A;  4HMJ A;  3C1F A;  2F3W A;  4IUN A;  1STB A;  2LKV A;  3E5S A;  2F0J A;  1EYC A;  3R3O A;  3U9O A;  4DGZ A;  4K8J A;  5E3F A;  5CGK A;  4MIU A;  5IGB A;  5F2D A;  1SNP A;  2RKS A;  5IGC A;  2PQE A;  3EJI A;  3SK5 A;  3ERO A;  2EYO A;  4K2K A;  5JOB A;  1SNO A;  2F0G A;  1KAB A;  1KAA A;  1KDC A;  3SK8 A;  4K5W A;  1SYD A;  2F0K A;  4HMI A;  5K5P A;  3C1E A;  4K2L A;  3SR1 A;  3SK6 A;  2F0H A;  4DF7 A;  1EY7 A;  2EYF A;  4QF4 A;  2OXP A;  5J1Z A;  3RUZ A;  5IGG A;  5JAV A;  1JOO A;  5M9O A;  2NUC A;  3HEJ A;  3TP5 A; 
#chains in the Genus database with same CATH topology
 2ES2 A;  5IOD A;  4ME5 A;  2K75 A;  5C44 G;  1D1K A;  3J80 c;  3I4N B;  4QY7 A;  1GO3 E;  5C3X A;  2V4D A;  3PUW A;  3A74 A;  3HFZ B;  3QOL A;  1VQH A;  4LWC A;  4IO9 A;  1F9Q A;  2PI2 A;  3DWA A;  4QJF A;  2IY5 B;  3BYY B;  1LUZ A;  3RNU A;  2HUG A;  4NPS A;  5C3E H;  3Q23 A;  5LMU L;  2LXJ A;  1Q8I A;  1KDB A;  2LSS A;  2MO0 A;  5G3L F;  2UUC Q;  2Z1C A;  4EX5 A;  1CT1 D;  2MNA A;  2EYP A;  2WAQ G;  1I4R A;  2K5N A;  3T16 A;  2QKI C;  5E7N A;  1HQM C;  1DOL A;  3M4P A;  4V0B A;  4U68 A;  4OO1 H;  1I4G A;  1HFN A;  2AHO B;  2WV6 D;  5EBC A;  5C4Z A;  5C5M A;  5IP9 G;  3CXC A;  1W2B A;  1K8M A;  3P7J A;  5JPN C;  3PF4 A;  1W3S A;  3ICE A;  5I2Y A;  2VQE Q;  4RKB A;  4IPG A;  4X6A H;  1E0B A;  3TP8 A;  5LMU Q;  3PIP 3;  1K9M C;  2F0O A;  5DM6 3;  4DV3 Q;  4HIO A;  1CA6 A;  1QOH A;  1JOK A;  5EPL A;  1Y1V H;  1V1O A;  5FLX L;  1TWC H;  1VQC A;  2DNC A;  5C3E B;  1PH5 A;  2OQ0 A;  4ZUJ A;  2JA7 B;  1CUK A;  2CWP A;  4H13 C;  3J7A F;  3ONA B;  4JG2 A;  2KQ3 A;  2KUM A;  3CME A;  1FYC A;  4F88 A;  2NBF A;  1QJO A;  4KD4 A;  4HMJ A;  3EFX D;  5ELD A;  1PDQ A;  4IUN A;  1OO9 B;  3I73 A;  3VR4 A;  3J7A 5;  1C0A A;  2ICE C;  2A69 C;  1PTO F;  4JK1 C;  2R92 G;  4I7Z C;  4HMI A;  1HZA A;  3OHX C;  4P73 A;  1TWH B;  3HOW B;  5KND A;  4DV4 L;  4DR3 L;  3GTP B;  4FXG C;  3DWQ A;  2QDL A;  4KTA A;  2R92 B;  4MZ9 A;  1AE3 A;  1MGS A;  4LNQ A;  1LTI D;  3QR8 A;  3PIO 3;  1PTO B;  4Q0F A;  4BA2 I;  1DON A;  3HOX B;  4JV5 L;  2O4X A;  4K6L A;  1B7Y B;  4XQJ A;  2LS0 1;  5CV6 A;  4RA8 A;  3TEH B;  1Q7Y C;  3K5L A;  1SN8 A;  2AQ3 B;  3PGZ A;  1Q90 A;  3PIP A;  4LF8 L;  2SDF A;  1U9R A;  2CQA A;  1IYV A;  1OXT A;  4LF5 L;  3TSS A;  4DV4 Q;  2EY5 A;  1PHJ A;  3D4D A;  4O2D A;  3CCS A;  1OXS C;  3EN2 A;  5M5X H;  4ZKC B;  2RHS B;  3R2I A;  2RSN A;  3KLR A;  2L4N A;  4DV5 L;  3M7G A;  3HOY H;  5IYB H;  2A69 D;  4A3I B;  1HRJ A;  5M3F G;  1IBL L;  2MP1 A;  5D14 A;  4WFN 3;  3AFQ A;  1Q12 A;  4HCE A;  3HOX G;  1FNU A;  2XNA C;  4HJ5 A;  3URY A;  4LAA A;  1CKM A;  1QNK A;  4JI3 Q;  1N33 L;  1XPR A;  4N9T A;  3M4O B;  2VW9 A;  3TN2 A;  1PV4 A;  4RKL A;  4ZKB B;  2Q2H A;  3CD6 A;  5FLM G;  1JJG A;  2WP8 J;  2D9U A;  1EIG A;  1GUG A;  2RCF A;  4KJN A;  1N36 L;  2L0C A;  2MJ8 A;  2DJF C;  1AN8 A;  1TQO A;  1SAP A;  5JJZ A;  1YI2 A;  4DR4 L;  4OIJ A;  3J7A V;  1VF7 A;  4B3R Q;  4YY3 Q;  2N49 A;  2BE5 C;  3PUX A;  1VQM A;  1TVX A;  2ZT9 C;  3T1H L;  2B8G A;  3V05 A;  1IW7 C;  3SK5 A;  3S1M H;  2BH8 A;  1C4Q A;  3GD7 A;  4B3T L;  4QL5 A;  1WI5 A;  3TP5 A;  1RF2 D;  1JE5 A;  4KMU C;  2R7F A;  4A3B B;  1HZB A;  3S24 A;  1UAP A;  4V19 0;  4DXF A;  1HZ9 A;  2F0U A;  4P72 A;  3PQI A;  4F8M A;  4Y7N H;  1Z47 A;  4GOP B;  3J80 L;  4DV6 L;  1NBW A;  1TS2 A;  1VF5 C;  1J9O A;  1HH2 P;  1E3P A;  3S1M B;  3J81 c;  4DR2 L;  3QG1 A;  1J8I A;  3G7L A;  1YBY A;  2NVQ H;  1FNV A;  5JJI A;  3X3N A;  5FO9 B;  2M2L A;  3CP0 A;  2Q2U A;  4IZ8 A;  2GN5 A;  3K6O A;  4GKJ Q;  5JPM C;  2FHT A;  5IP9 H;  1VQ5 A;  1A3T A;  3OSO A;  1VQ6 A;  3PO3 H;  1JQY D;  2SNS A;  2WKD A;  4LUZ A;  4KY6 A;  1MJE A;  4KY7 A;  2F4I A;  1XPU A;  1UEA B;  2KEE A;  3W5O A;  3CPW A;  4DAP A;  4HJ8 A;  1WD1 A;  4DV6 Q;  4Y7N B;  4X66 Q;  1TWF B;  1VQO A;  3FKI B;  1B50 A;  2HCI A;  1WTW A;  1E2Z A;  3KBG A;  1G29 1;  4QQB X;  4M1U B;  5KYL A;  1XXG A;  2BA0 A;  1B9M A;  2YTX A;  2BH2 A;  1STG A;  3MEF A;  3D4W A;  4POF A;  2SNM A;  2PNR C;  2F0E A;  4KHP Q;  3K8A A;  2IX1 A;  2A6E C;  4NKL A;  1QNU A;  1PFB A;  4J6H A;  2Z8L A;  1VQ4 A;  2R93 G;  1B2T A;  1X54 A;  3S1R B;  3A5Z B;  3PO3 G;  2A6H C;  2R6G A;  1BXT A;  1EY9 A;  2ASB A;  1TXY A;  3KF8 A;  2LKV A;  5DM7 3;  3RZD B;  4A93 B;  4AH6 A;  5GRO A;  4CDE C;  4DUY L;  2K7V A;  2NB0 A;  2JK8 A;  3D31 A;  5IP7 H;  4A3E G;  4K2K A;  1BCP D;  4JI5 L;  4A3D G;  3Q6S A;  4DF7 A;  1KAW A;  2BDO A;  3HEJ A;  3KF6 A;  4IQZ A;  5HGQ A;  2E75 C;  1S5D D;  2MPM A;  2C5C A;  2ICI A;  1IBM Q;  2UXB Q;  4DR1 Q;  3VA7 A;  3GO5 A;  3BVZ A;  5I6W A;  1O78 A;  1K73 C;  2PI2 E;  1JOR A;  2UXD L;  5KEE A;  3SHL A;  4CKC A;  1EQV A;  4ZYS A;  1HNX L;  1EEF D;  2GVB A;  1A2T A;  1T9H A;  2K14 A;  4OGQ C;  4ABN A;  1IL2 A;  2F0P A;  4JBW A;  2A68 C;  5M5W B;  4FF4 A;  5C4X G;  2KHS A;  1RJT A;  1BNZ A;  1B70 B;  3KF8 B;  2ZJQ A;  4OEL B;  2K52 A;  4XTC S;  4B3S Q;  4NP5 A;  2DUD A;  1IBK L;  4KKS A;  3H6M A;  2NVY B;  2FJ2 A;  3A56 A;  4LF8 Q;  3CCM A;  5KIX A;  4A3E H;  1IYJ B;  4AYB G;  2JA5 G;  4PV1 C;  4JI8 Q;  2IWH A;  3AMU A;  3S2D H;  1N9W A;  2UUC L;  2R3Z A;  3E9H A;  3CPF A;  5JVH 3;  4H0L C;  4QIW E;  1BCP C;  4A3K B;  2ALY B;  1AP0 A;  3FPU B;  3TQY A;  2BA1 A;  1PRT F;  1K3R A;  4DR4 Q;  4GZY C;  3BDL A;  5C3E G;  1P16 A;  3VYR A;  1VMP A;  4K5X A;  4A3K G;  4B3M L;  4I7A A;  4LMQ D;  1J6Q A;  1A6X A;  3VYT A;  2D5D A;  3H94 A;  4KD3 A;  4YHH Q;  3KDF B;  2VS1 A;  2A6E D;  3LNN A;  3I4O A;  3A8J E;  3GTM B;  1SYF A;  1A8V A;  4IFD G;  5ISR A;  2OT2 A;  1LLR D;  4RFB A;  5EPJ A;  2NVX H;  2A1A A;  4B9X A;  3H0G B;  4LFC Q;  1TII D;  1H9R A;  2I0Q A;  1BOS A;  1OXV A;  3QB3 A;  1ZYR D;  4RHR A;  3E0J A;  2IHE A;  2FMC A;  3EQL C;  4FYD A;  5E3F A;  1Q1B A;  5ELN A;  5CGK A;  1DOK A;  4RMF A;  3EJI A;  2Y0S G;  3KBX A;  1SYD A;  5EPK A;  2EJG C;  1TY2 A;  3G6E A;  3VDY A;  5JAV A;  3FEW X;  1CKN A;  2B2W A;  1T5E A;  4JI2 Q;  1SLJ A;  2L12 A;  3MA2 B;  4DA2 A;  4A3K H;  2E76 C;  2SOB A;  4X65 L;  2ZJP A;  4LUV A;  1Y1V B;  3MXG A;  3T1Y L;  3VR2 A;  5E4X A;  4JOI A;  4L5Q A;  4OL7 A;  4JI1 L;  5CV4 A;  3T56 B;  1I4H A;  2F03 A;  3CQZ H;  4JW0 A;  5C4J B;  1PH4 A;  4WRD A;  1O7Y A;  1QVC A;  1HCZ A;  1LT4 D;  1VDZ A;  1Q3L A;  4NXN Q;  4O42 A;  2K28 A;  1D7Q A;  4N8F A;  2HIX A;  1XPO A;  3MTS A;  3BVG A;  5M5W H;  5BR8 L;  5AJ3 L;  4UDU C;  1KNE A;  1QUQ B;  1Y1W H;  4GKK Q;  5BN3 A;  4A3E B;  1JE4 A;  4LF5 Q;  3RR5 A;  4BWG B;  5A2Q L;  3U50 C;  3UDF A;  1N34 L;  1XNR L;  3L0O A;  3VR6 A;  2JJQ A;  4IJH A;  5FJ8 H;  3S14 B;  4IOA A;  1SYB A;  1A3U A;  4OX9 Q;  1EY8 A;  3NK9 A;  1IKL A;  1RD9 D;  5CYU A;  4UP7 A;  2EYH A;  3QIA A;  5M3F H;  3GTK B;  2VL6 A;  3UI2 A;  3J81 L;  4JI3 L;  3TME A;  3HOU B;  1X3E A;  2X6G A;  4NB3 A;  5IGF A;  3HOZ B;  5COR A;  2N78 A;  3GV3 A;  1CZG A;  1IBK Q;  2F0T A;  1QZG A;  4A3F B;  5EAY A;  1WJJ A;  3KF6 B;  1RL2 A;  2PMZ E;  3FRP B;  1BCP B;  1AEX A;  1EIY B;  4LF6 L;  3PSI A;  4GN5 A;  5CV9 A;  3P1H A;  3M9B A;  4NXM Q;  1G51 A;  1F2Y A;  2Z0S A;  3RZD H;  4JBJ A;  4ZRZ A;  1I3Q H;  3K58 A;  3C1F A;  1XMO Q;  1SMY C;  3NWS A;  3D3R A;  1S5C D;  3U9O A;  3NWT A;  4KN4 C;  5FO8 B;  3STB C;  2RKS A;  5JOB A;  4TSS A;  4JI5 Q;  2FFK B;  3I4M H;  2OXP A;  1F9S A;  4JI8 L;  1WTP A;  4C3I H;  2K03 A;  1NR4 A;  2F0N A;  5C0X J;  2EY6 A;  1YJ9 A;  1BBX C;  1BQQ T;  4QMG A;  4K0K L;  3AQQ A;  3OIQ A;  4R4C A;  3VYU A;  4YY3 L;  2XTI A;  1KD1 C;  3BS1 A;  1SND A;  3BYT B;  4CKE A;  3F2B A;  4IPD A;  4LF9 L;  3HOV B;  2RDG A;  3MWY W;  2EYM A;  4YIJ A;  5J39 A;  1E2W A;  2K50 A;  1A3V A;  1EY6 A;  4HIK A;  5EBD A;  2ZTC A;  3M4O H;  4C56 C;  4LFA Q;  4C1N I;  2KCT A;  3RN2 A;  1D6E C;  1L0X B;  5I6Y A;  1VQ9 A;  4DV3 L;  3HS0 C;  3L3O C;  3QWN A;  2ATW A;  2RDF A;  2F3I A;  1CK1 A;  1MIU A;  3S2H H;  4BY1 G;  4JI2 L;  2VB2 X;  3PMF A;  1DOM A;  3V96 A;  1FGU A;  1A15 A;  4X65 Q;  5C3W A;  4AIM A;  4DFA A;  3SVM A;  1MHW C;  4K0K Q;  1AE2 A;  5G3L D;  2JA7 G;  2RCN A;  5CC4 A;  4F87 A;  2IJ0 A;  3S17 B;  1ROD A;  2EQS A;  4X66 L;  3NXW A;  1F2Z A;  3M85 A;  3KDF A;  5EKL A;  1EQQ A;  4N8X 1;  1PA6 A;  2J7Z A;  3K80 C;  3KJP A;  4L5S A;  3KYH C;  2UXB L;  2RQX A;  5IIF A;  3DXJ C;  2VQF Q;  3CCE A;  1TWA H;  2LMC B;  1VQB A;  2AQ2 B;  5IT9 E;  3KLS X;  4KI0 A;  1PRT D;  1QG7 A;  1CHP D;  5EGT A;  1EUJ A;  1YNX A;  1HA6 A;  3ULL A;  1X6O A;  3LGJ A;  3MXU A;  1FD7 D;  1XMQ L;  4IUU A;  1H9M A;  1STB A;  3A7L A;  4BY7 H;  4FVM A;  1VQI A;  3RZO H;  2L1B A;  2O2L D;  5D3D A;  1X55 A;  1HQR D;  2EJF C;  2HQL A;  2AUJ D;  3RN5 A;  2RHQ B;  2X69 A;  1F9R A;  1SJH D;  3SR1 A;  3SK6 A;  2NWG A;  2C9O A;  1SFO B;  5COY A;  1E7Z A;  4JVZ A;  2G9D A;  3GTJ H;  2BDN A;  2EOT A;  1MSG A;  4I65 A;  4IUT A;  3I55 A;  1QB5 D;  3X3M A;  3PO2 G;  4EVO A;  3PIO A;  2UXD Q;  2KOL A;  2OF1 A;  1FL0 A;  4CDC C;  2QIL A;  5AJ3 Q;  1KDA A;  2PNH A;  3TP6 A;  5GAG C;  1FVI A;  3P20 A;  3KK7 A;  4RH6 A;  2PMZ B;  3BDC A;  3GTL H;  2KEN A;  4OO1 I;  3SE0 A;  4DK1 A;  2OTJ A;  4P74 A;  4OON A;  4A3B H;  5CMD A;  1ILP A;  1BKB A;  1IBL Q;  1VQ7 A;  1ML0 D;  2F0L A;  1JJC B;  3NBH B;  1PZI D;  1QVG A;  3DUZ A;  4AQY L;  5ELO A;  3J7Y W;  5BR8 Q;  3ERS X;  3FVQ A;  1EYG A;  1CFM A;  3I56 A;  3I4L A;  3BZD B;  1RIP A;  1TS3 A;  4BBS H;  2EJM A;  3CQZ B;  5BN5 A;  1CHQ D;  2QGQ A;  1N34 Q;  5KNB A;  3F2U A;  5IGD A;  4BXX H;  3SK4 A;  2JA5 H;  2KCC A;  4KKU A;  4C2M B;  1E24 A;  1SMY D;  4L63 B;  3E3X A;  4WJ3 M;  4RGT A;  1YJW A;  5DNF A;  2CKZ B;  1JR0 D;  3I90 A;  3GP7 A;  4XQQ A;  4JI6 L;  1NSN S;  1E1T A;  1OXX K;  3S15 B;  3HKZ B;  4OEM B;  1ET6 A;  1G91 A;  3W2D A;  3IKJ A;  4FF1 A;  4LFA L;  3VYS A;  3HOU H;  4A3C G;  4ID6 A;  4L5R C;  3DHQ A;  4C3H H;  1I5F A;  3M4Y A;  3JAM c;  4JI0 L;  3MXN B;  1XJV A;  1HTP A;  1N36 Q;  1DCZ A;  3NEM A;  5TSS A;  4A3M G;  1X3F A;  2NVT B;  5AFW A;  3ND9 A;  4BY1 B;  1A62 A;  5HY6 A;  2CFM A;  3S1Q B;  3R3O A;  3K0X A;  1I6V C;  5FLX E;  1I6H H;  2N3S A;  4PZ7 A;  2ZTE A;  1EFI D;  5C0X I;  2Y0S E;  2E2I H;  2F0K A;  1HPC A;  4K2L A;  1PYS B;  2JA7 H;  5M9O A;  3NSW A;  1Z7T A;  4RCN A;  2K32 A;  1KLU D;  3I7F A;  2PW7 A;  1HXY D;  4K8I A;  3Q8D A;  4TVA B;  5A35 A;  1MI2 A;  3OYY A;  4ULL A;  2NVT H;  1YNJ D;  1BDO A;  1BBU A;  1JT8 A;  4TRD A;  1BUV T;  1SSO A;  5IP7 G;  4BA1 I;  3CCV A;  4IJL A;  3J80 E;  3C3L A;  3OIP A;  4IPC A;  4A3L G;  2XIW A;  3P75 A;  4F7X A;  2B2W C;  2IHF A;  4BBR G;  1KXL A;  2IPK D;  4ZK9 B;  4DPG A;  1B4O A;  4EQ5 A;  2B2V A;  3NTI A;  1S5F D;  1FGB D;  4ZUI A;  4ME3 A;  2CW0 C;  3BDO A;  4HCS A;  3TS0 A;  1K8O A;  3MZ5 A;  1EWI A;  5JJL A;  1JC7 A;  4BBR B;  4GKJ L;  1QUQ A;  4FXK C;  2XGT A;  4KKT A;  1SNM A;  4CKB A;  1DD2 A;  4DR3 Q;  2UUB L;  2QEX A;  4NXM L;  2TSS A;  1ENA A;  3T13 A;  2MO1 A;  2HIV A;  2F0Q A;  3SXH A;  4L8J A;  1WTQ A;  2G9H D;  5IOC A;  1XNQ L;  4X3K A;  1S4Z A;  4WOR A;  4DAY B;  4HJ9 A;  3GTL B;  5IT9 L;  3MAQ A;  1K8A C;  2Q8T A;  4LF7 Q;  2QDB A;  4IUP A;  4JBK A;  5C0X G;  1LV9 A;  5JVG 3;  4GKK L;  3PO2 H;  5C44 H;  3CHB D;  5C0X H;  5IY0 A;  1S72 A;  2ZXP A;  5T1G A;  3I4N H;  1XNR Q;  4R8N A;  4LW1 A;  5IYD G;  4X64 Q;  3NHH A;  3K5M A;  2VUM B;  3IFD A;  3DMU A;  2YU9 B;  2Z4I A;  3NP8 A;  1II3 A;  2LXK A;  5E1F A;  3U58 A;  4RGM A;  2B8F A;  5L37 A;  2JA9 A;  4R4T A;  1PTO C;  5KNC A;  1NCV A;  2JA6 B;  2KED A;  1PFM A;  2N8N A;  1SFO H;  4WJ4 A;  1Y8O B;  1ICF B;  1U4M A;  3S1R H;  2WFW A;  3DEO A;  4RG1 A;  3M4Q A;  1KAB A;  1KDC A;  5H1S E;  4KHZ A;  4XQN A;  2VY3 A;  2VZA A;  2TMP A;  5J1Z A;  3RUZ A;  4C1N K;  1IL8 A;  5I2X A;  1N33 Q;  2E2H H;  1MD2 D;  2XWB B;  1L1O A;  3ZJY C;  1SE3 A;  5LL6 S;  2FXQ A;  3QO2 A;  2WAQ B;  1V1P A;  1JB3 A;  2H5X A;  3G71 A;  2WB1 B;  4BBS B;  3IFT A;  2Q2I A;  3H3V I;  4LF9 Q;  3J81 j;  1EY4 A;  3LWE A;  4H7B A;  1K0R A;  1PVO A;  3EVQ A;  3UDX A;  1HNW Q;  3NBH A;  3D6W A;  2M9V A;  2UU9 L;  2OTL A;  1D5X C;  3K7A B;  3Q0A A;  4UHV A;  1D2B A;  1M4V A;  1STN A;  1UE7 A;  1RHP A;  5ELB A;  3I2Z A;  3TBI B;  1MBY A;  3PUV A;  4QGU A;  2VQF L;  2PCF B;  5IYB G;  1HJP A;  4LFB L;  1XTD A;  1NUC A;  1U5K A;  1FJG Q;  3IRB A;  1CA5 A;  2L11 A;  2Y0S B;  3W1G A;  3NQT A;  4J15 A;  4G7O C;  1K3B C;  3H09 A;  5IYD H;  1PZJ D;  4DU9 A;  1CM9 A;  4HR7 B;  4JBM A;  1EYA A;  1CZW A;  2GA4 B;  2MFI A;  1KHI A;  1L1O C;  1XX8 A;  3KJO A;  2EY1 A;  4YCV A;  2NN6 G;  2WB1 G;  3FPP A;  4JPB W;  5GAE C;  4B3T Q;  1MKH A;  3SDZ A;  3H0G G;  3GTO H;  5LHY 1;  2UU9 Q;  1EU4 A;  1LO5 D;  3MXN A;  3SEB A;  1O7Z A;  2Z6K A;  4KV6 A;  4NDX A;  1W6K A;  2EY2 A;  1GD7 A;  1GUW A;  4N9P A;  1VQA A;  5GAH C;  1M1K C;  1SYE A;  4P75 A;  3A54 A;  3DM1 A;  4ILW A;  4PMC A;  1WD0 A;  3CAM A;  1LTB D;  1YHQ A;  1EWC A;  4YWL A;  1EY5 A;  3E0E A;  2BCO A;  5K36 H;  5CR3 A;  1Z9F A;  4C3I B;  1ICW A;  1VQP A;  2K6A A;  3EBE A;  2V1C C;  4XIG S;  1JB7 A;  1AZP A;  2JA8 G;  5CBE E;  4GLV B;  1LTA D;  2DNE A;  5IWA Q;  3J80 i;  3SGI A;  2R7D A;  1Y69 U;  1KLG D;  2F0G A;  4A3B G;  2KCN A;  2AQ1 B;  4ZCK A;  3SK8 A;  1DZ1 A;  3BZK A;  2I07 B;  1GXD C;  1WTO A;  3I70 A;  2OWO A;  3KUP A;  1F9P A;  2JA6 H;  4YCU A;  1CSP A;  2EXD A;  4ZAI A;  1EFW A;  1I3Q B;  3ITP A;  3OW2 A;  1NMF A;  4K14 A;  2CWA A;  1JWS D;  4G7Z C;  4EGV A;  4DR6 Q;  1HFG A;  2VUM G;  2UUB Q;  4LF7 L;  1GJX A;  3O13 A;  3IAY A;  4JI6 Q;  4TQU S;  2L9H A;  1PXU A;  3PUY A;  4FP5 D;  4IUR A;  4FNF A;  4DV0 L;  1LTR D;  1RCV D;  5CBA E;  2Q8I B;  4A75 A;  5A2Q E;  1EOT A;  2A8V A;  1I4X A;  3CW2 C;  3K7A H;  5C4X H;  1NY4 A;  1SJE D;  4MN3 A;  1X9N A;  2JA8 B;  3TDQ A;  2I5L X;  4JC0 A;  1EYD A;  1WCM H;  1M8A A;  4A3M B;  3GTQ B;  4G57 A;  1EOV A;  2E5L L;  2XRQ D;  1C9O A;  2EXZ A;  3K57 A;  1Y1V G;  2PO4 A;  3N52 A;  3GDE A;  2OEO A;  1AH9 A;  3F1Z A;  2B3G A;  1PTO H;  4DAY A;  4CJ1 B;  5FK9 C;  1KTK A;  4XYO A;  2G5D A;  4R8I A;  3AYH B;  2HQE A;  4CBV A;  1SRU A;  4JI4 L;  1PH7 A;  1XNQ Q;  3PCO B;  2E8G A;  3HOX H;  2X6L A;  3HOW H;  4OWW B;  4JV5 Q;  3GV6 A;  2RSO A;  4JI7 Q;  1BBW A;  4U67 3;  2WB1 E;  3U9S A;  4C3J G;  3DM3 A;  2B2U C;  2Q8R E;  5D65 A;  4DK6 C;  4NMZ A;  1B53 A;  2L15 A;  1E1O A;  2F0V A;  2XN9 C;  2O5I C;  2A73 B;  1U4R A;  3AEV A;  2HHH Q;  3RLF A;  4DR1 L;  5M3M B;  1Y1W G;  1BR9 A;  1KNA A;  3BU2 A;  1SDF A;  5C44 B;  3I91 A;  1HTL D;  3GTK H;  1VMC A;  5M3F B;  1SXT A;  1STH A;  1OXU A;  3N6R A;  4B9W A;  3CRL C;  1ENC A;  2KJX A;  1PLF A;  3CMA A;  2NTS A;  1T5X D;  2XSC A;  1GHK A;  5M5X B;  1UEB A;  2F0J A;  4P71 A;  1D5M C;  1EYC A;  1GOZ A;  4OXP A;  5ELF A;  3MFG A;  4HN7 A;  5F2D A;  4DKA C;  4CJ0 B;  1M90 C;  1WTX A;  2EYO A;  1A0I A;  4XT3 B;  4JI0 Q;  3HOV G;  2F4V L;  2YTV A;  3PV0 A;  1LTL A;  1DXM A;  2R93 H;  5IGG A;  1J5E Q;  1D1I A;  3GTM H;  5M5Y B;  1JOO A;  4ODG A;  3MC0 B;  4KHV A;  1K83 B;  2I5M X;  1A63 A;  3H0G H;  4CHT B;  1GM5 A;  4KJO A;  2AUK A;  4DV1 Q;  4MTK A;  4HSV A;  2LFN A;  1H9J A;  3DLL A;  3CC4 A;  2HT1 A;  4MTN A;  3A5U A;  4L5T A;  4C3H B;  4BBR H;  2QF7 A;  4YWK A;  4ZLT F;  1FR3 A;  4DV7 Q;  1Y8N B;  1F77 A;  4C2M H;  3H91 A;  1LTG D;  2VQE L;  1EWH A;  2PW5 A;  4IAL A;  5NUC A;  2NZ1 D;  4OIK A;  1IHZ A;  4DV2 Q;  1G2S A;  1STE A;  2F52 A;  4K6D A;  1HUM A;  1YHB A;  2B2T C;  4APV A;  3WDN A;  3M3Y B;  2FMM A;  3UE0 A;  2JN4 A;  1VS0 A;  2MQH A;  1PMR A;  1YNJ C;  4GLA C;  3V2T A;  4NW2 A;  3K59 A;  3AU7 A;  3NTH A;  2B2V C;  2NZO A;  4XT1 B;  1YIJ A;  2CCZ A;  1O7I A;  2ZM6 L;  5I9O A;  3LWU A;  5KRU A;  4POG A;  4IOC A;  2XWJ B;  2E2I B;  2H4O A;  2YTY A;  4OHJ A;  2IW3 A;  2UUA L;  2P5Z X;  5LMN W;  3TS2 A;  3S1Q H;  2DY7 A;  1VQD A;  1Q46 A;  1F2L A;  4JYA Q;  2KA7 A;  4QIW B;  1JCK B;  2YV5 A;  5IT9 c;  4DV2 L;  4A3G G;  2MGS A;  5C6A A;  2KEC A;  4X64 L;  2UXC Q;  1SYC A;  3F8T A;  2J4X A;  2L55 A;  3L2P A;  3G4S A;  1YNN D;  3S9W A;  4PMB A;  4EQP A;  3VA5 A;  1JOQ A;  4G4K A;  2K05 A;  2WKC A;  5M3M H;  4XDX A;  1PH2 A;  3Q24 A;  1TY0 A;  3OOC A;  1TWG B;  2SEB D;  1JJ2 A;  4FF3 A;  2A74 C;  1S40 A;  3S16 B;  2HD3 A;  3BZC A;  3T4A C;  1R9T H;  1JWU D;  2PQE A;  1KAA A;  3A0J A;  3S15 H;  4HIM A;  4H02 A;  2ZXO A;  5K5P A;  1R4P B;  3HOU G;  4A3C H;  2Z4H A;  1EQT A;  1EY7 A;  1DM0 B;  2WII B;  1GUS A;  2CH4 A;  4DK0 A;  3Q22 A;  1OTC A;  3FDT A;  1F2M A;  2NYZ D;  4X3S A;  3I4M G;  1S3O A;  4CGY B;  2EYJ A;  2ZJR A;  2EYL A;  4IFD J;  3MVV A;  1N32 Q;  3NUC A;  2NZH A;  3NQI A;  3FP9 A;  4LF4 Q;  1PYW D;  4RHS A;  2EVB A;  4A3G B;  2VB3 X;  1EL0 A;  1BF4 A;  3EA6 A;  1B3A A;  1PTO D;  1MSH A;  3K7U C;  2HDL A;  2K33 A;  2QCP X;  3NE5 B;  1HR0 L;  4A3D B;  4A76 A;  1QE6 A;  3NEL A;  1XMQ Q;  1HNW L;  3IL8 A;  4EQO A;  1STA A;  1L1O B;  4UP9 A;  3S1N H;  1V1Q A;  1DYQ A;  5IYC G;  1VQG A;  2PQA B;  4H44 C;  4DUY Q;  2B2U A;  2C35 B;  1QWY A;  1YNN C;  3MXP A;  4DN4 M;  2OCE A;  3G6J B;  3BVM A;  2M00 A;  1J5E L;  3DWP A;  1WYD A;  4RWS C;  1SNQ A;  3CCR A;  1PYB A;  1QCB D;  1S5E D;  4K5V A;  3JAM i;  1SE4 A;  1S5B D;  1EZ8 A;  2CHB D;  1UWV A;  4J1M A;  1O80 A;  3D6C A;  3UDG A;  1H95 A;  3HKZ E;  1Y8P B;  2F0D A;  1GUN A;  3OMG A;  1TT2 A;  3AB9 A;  1B9N A;  3GTO B;  3B6Y A;  3QJY A;  2JEA I;  2B63 G;  3VR3 A;  5IWA L;  1AZQ A;  2WIN B;  3FHW A;  2IX3 A;  4GOP A;  1HR0 Q;  3PF5 A;  1A2U A;  2D0O A;  3K81 C;  4DV7 L;  4B3R L;  3RZO B;  2ENB A;  4AYB E;  2HDM A;  1ET9 A;  3T51 B;  1NNX A;  4A93 G;  3OWE B;  2F0F A;  3T1Y Q;  4WJW A;  1AW7 A;  1C48 A;  1EU3 A;  1ZEQ X;  3GTG B;  1KQS A;  3S17 H;  1SEB D;  4UP8 A;  1VQJ A;  3RMH A;  3R93 A;  1L0Y B;  2B2Y A;  2XRS D;  2EDG A;  2K5V A;  4MIU A;  4Q5V A;  1SNP A;  1GHJ A;  2E2J B;  2DJG C;  1I4Q A;  1U4L A;  4GNX B;  4K5W A;  1HZC A;  4DNR B;  2K04 A;  1TS5 A;  1PFN A;  1NJI C;  1Q82 C;  1ENF A;  1SMX A;  3BG3 A;  4X62 L;  2B2T A;  4O0A A;  1E2V A;  1X56 A;  3ERQ A;  2MUY A;  1D5Z C;  2BOS A;  4DV5 Q;  1UUP A;  1WVL A;  4OX9 L;  2JP1 A;  4GN4 B;  1Y14 B;  3HOV H;  4QB4 A;  3ER0 A;  1Z6H A;  3RLO A;  4PG3 A;  4A3F H;  4PNY A;  2Z6K C;  4A3I H;  4GLX A;  5J3B A;  2Q2T A;  2Z9H A;  3S14 H;  2PZU A;  1EQR A;  3HOZ H;  5CV8 A;  2HHH L;  5CV5 A;  1CKO A;  4R9W A;  1TR5 A;  3H3V H;  2F0W A;  4XXE A;  1LT6 D;  4R4Q A;  2UXC L;  4RCO A;  4DR6 L;  5FO7 B;  3OPO A;  3ULJ A;  3W1B A;  4X3U A;  3HOY B;  2L5T A;  2NN6 H;  3CKI B;  2E5L Q;  5EKI A;  1HA5 A;  1HNZ Q;  3UE1 A;  1JWM D;  5ELC A;  2MHV A;  3A8I E;  1IZ6 A;  1UNS A;  1GUT A;  2DN8 A;  4KY5 A;  5EJW A;  3TP7 A;  3D0F A;  5IYC H;  5LMN Q;  1UE5 A;  3MEH A;  3JAM L;  2F3V A;  3TRZ A;  5K36 G;  2QEJ C;  1YJN A;  1VQ8 A;  1PZK D;  1EIH A;  2I46 A;  3HKS A;  4O1N A;  1NAP A;  1Y1W B;  1LAB A;  2B29 A;  1I94 Q;  4QCL A;  1V1P B;  4DAV A;  3PUZ A;  5EQ0 A;  1PH6 A;  2QA4 A;  2R92 H;  1LAC A;  1R9T B;  5IGE A;  3KOJ A;  2CQO A;  5IE8 A;  4JYA L;  4B3S L;  1TKW B;  2CW0 D;  3HZX A;  1KIX A;  2I5H A;  5JEA G;  2KCM A;  1B1Z A;  4AQY Q;  1WTH A;  4Y52 H;  2AMC B;  4C3I G;  1PFS A;  1IYU A;  1TWH H;  3ND8 A;  1VQF A;  1P8L A;  2PYK A;  4YWM A;  3R8B A;  2KBN A;  1PH9 A;  3T53 B;  3I8Z A;  3KFU A;  1N32 L;  4GN3 B;  3CF5 A;  1B3Q A;  4QUC A;  4HSP A;  4K8J A;  4UPA A;  4GOP C;  1WOC A;  2GVA A;  4IFD I;  1YHA A;  4A3F G;  5IGC A;  2AKW B;  1C7Y A;  3ERO A;  2E74 C;  3NPP A;  2K4K A;  3PO2 B;  3HKZ G;  4A3L H;  1LT5 D;  1NTG A;  1VQN A;  1K28 A;  3A8K E;  1I6H B;  4DAM A;  1I4P A;  2PQA A;  1XYI A;  3ZYY X;  4EQN A;  4LK1 C;  4B08 A;  4A3J G;  1YVC A;  4YHH L;  3WOF A;  1RKN A;  3W3A A;  3G48 A;  4LJZ C;  5E4W C;  4A3J H;  2F0M A;  4LUO A;  4BY1 H;  1D8L A;  3H15 A;  1E22 A;  3GQB A;  1W6J A;  2RDH A;  1EIF A;  3HGB A;  1CQF A;  1WCM G;  4DK3 C;  1BCP F;  4CDF C;  2R7Z H;  2B2Y C;  2JA6 G;  1B44 D;  4GNX C;  1PH3 A;  1PRT C;  2KVM A;  1RTO A;  2K01 A;  4HED A;  1UE1 A;  3C2P A;  4MHE A;  2QW7 A;  3OMC A;  4DNT B;  2K5Q A;  3J81 E;  5FJ8 G;  4IUV A;  1GUO A;  2DY8 A;  1X3Q A;  3CCL A;  4KN7 C;  4ZQ3 A;  3I72 A;  2F0S A;  3RD4 A;  2O5J C;  5C5L A;  1EEI D;  1SE2 A;  2PPB C;  1WFQ A;  1XTC D;  4DNI A;  1LTS D;  1STY A;  5BN4 A;  1IXR A;  5JJK A;  1SBB B;  2NVY H;  2H1E A;  3D8G A;  1NR2 A;  4TKO B;  1N8R C;  1V8Q A;  4DR5 Q;  1LM0 A;  3DEP A;  4DR2 Q;  2ZM6 Q;  1X3G A;  3ULP A;  1VQE A;  4A3J B;  1CSQ A;  2E2D C;  3UDI A;  3HP3 A;  1RDP D;  1EZ6 A;  4Z9C B;  2R7Z B;  1X3P A;  2CVR A;  1K8G A;  2D0P A;  3GTQ H;  1WCM B;  2JE6 I;  3L7Z C;  1U0L A;  3MHB A;  1VQL A;  3QOJ A;  4HID A;  3R2T A;  1IBM L;  2KHJ A;  1TWC B;  2CH4 W;  2IL8 A;  2ZTD A;  1ZKO A;  1AFP A;  4HAE A;  3I4N G;  1HNX Q;  5M5Y H;  1Q8K A;  2D62 A;  2NVX B;  2EZV A;  3J7Z C;  5DEH A;  2WAC A;  3CCJ A;  2D2C C;  5JEA J;  4UAI A;  1X65 A;  3K5N A;  2JA8 H;  3HOY G;  3NEN A;  3JC6 6;  5HGT A;  3TRE A;  2IX0 A;  3CRK C;  3KLW A;  4DUZ L;  4R4O A;  2A5H A;  2AWO A;  2AWN A;  1LT3 D;  1SNO A;  1YEZ A;  4KHP L;  5FLX c;  5FOB B;  1HUN A;  2R7Z G;  1ESF A;  4M8A A;  3C1E A;  1ZYR C;  2F0H A;  2IT1 A;  3M3Y H;  4J8Q A;  2NUC A;  1O7L A;  5D3I B;  4AYB B;  1GVP A;  2JA5 B;  1IW7 D;  4CDD C;  3TZD A;  4BY7 B;  2NTT A;  3S2D B;  1H9K A;  4PZ8 A;  1VQK A;  3HOW G;  2FIN B;  4JI1 Q;  4HTH A;  2R61 A;  1TWF H;  4BY7 G;  2JSO A;  4KK7 A;  1G2T A;  1SRO A;  1TWA B;  3E6Z X;  4DV0 Q;  1WTR A;  2K5H A;  4IPH A;  2JEB I;  1Q86 C;  5LMN L;  1H9S B;  2VNU D;  5T1I A;  4DUZ Q;  3E9I A;  1SE8 A;  1PH1 A;  3RLN A;  4E6I A;  1ILQ A;  1K83 H;  3CC2 A;  5FLM H;  4KLK A;  1HR0 W;  3FKI H;  4LF4 L;  1IKM A;  2R93 B;  2N88 A;  2LY7 A;  4A3M H;  1LTT D;  1YZ6 A;  4L6T B;  3TZU A;  3FKI G;  4C3J B;  3WWV A;  3U4V A;  2JXM B;  1MJC A;  2K5W A;  4R1J A;  2EPB A;  5C4X B;  3CU7 A;  4LFC L;  4PZ6 A;  2XVS A;  4JCV E;  4S3S A;  1Q81 C;  2RF4 A;  5FKA C;  4RGN A;  4BXX G;  4FF2 A;  5C4H A;  1FNW A;  3FMC A;  3NTK A;  3VR5 A;  4R4I A;  4OWT B;  1QZH A;  1KRT A;  3GTJ B;  1WTV A;  1HHV A;  3A55 A;  4LFB Q;  4BS9 A;  1K0S A;  1I94 L;  2B63 H;  4IN3 A;  1Q1E A;  5GAD C;  4B3M Q;  1XMO L;  1CTM A;  4A93 H;  2NVQ B;  1DGS A;  1I50 H;  4X62 Q;  1H9S A;  4RGO S;  1DJR D;  1TS4 A;  1B8A A;  1SNC A;  1QIL A;  3M7N A;  3K5O A;  3GTG H;  5EKK A;  1EY0 A;  4CJ2 C;  4RAU C;  5GQO A;  2E2J H;  1CQV A;  2PZW A;  2RA4 A;  5DLQ E;  4DR5 L;  5I9P A;  2K5D A;  4HJ7 A;  4UY8 C;  4P2C B;  1KRS A;  3OTO L;  3S1N B;  1R4Q B;  1ASY A;  4OO1 G;  3BJU A;  2E2H B;  5JEA H;  4JI4 Q;  3OW7 A;  2J0T D;  4IUQ A;  3PO3 B;  1C8C A;  3I4M B;  4GNX A;  2HCC A;  4JI7 L;  2EE1 A;  1FJG L;  2ZXR A;  4QF4 A;  4X3T A;  4HJA A;  2Z6B A;  5M3M G;  1I50 B;  2YYZ A;  3CC7 A;  1CI3 M;  3CCU A;  3STB D;  4PMW A;  4DR7 L;  3J81 i;  3F2D A;  5HUR A;  3HRZ C;  1GKH A;  4A3I G;  4IFD H;  4YCW A;  4GS3 A;  4NXN L;  1L0W A;  1UE6 A;  1QVF A;  4XYQ A;  2RBM A;  1SYG A;  2A68 D;  1NE3 A;  1TWG H;  3OTO Q;  2F0I A;  2DGY A;  2WAQ E;  4JOI C;  3KLS A;  3AFP A;  4A4I A;  4PQX A;  3U4Z A;  3S2H B;  1V9P A;  2RVL A;  3MFY A;  3HOZ G;  5KGU A;  2F4V Q;  1ZXT A;  4C3J H;  3L9A X;  4MNO A;  4FDB A;  5ELE A;  1G8Z D;  2A19 A;  4OWX B;  3HG9 A;  3I3C A;  4ALP A;  4DR7 Q;  1JIC A;  2N55 A;  4DV1 L;  2KHI A;  4C3H G;  1CKN B;  4A3D H;  2PZT A;  3OWF A;  1ESR A;  5I4D A;  3H3V C;  3A7A B;  1G6Z A;  1XWE A;  2A6H D;  1L2F A;  4A3G H;  2VXW A;  1HNZ L;  1VCI A;  1KC8 C;  1ASZ A;  5DAU A;  3JAM E;  1RTN A;  3K0Y A;  3F2C A;  4QUF A;  2B39 A;  5LL6 X;  2K1B A;  5CV7 A;  5J22 A;  2NN6 I;  1U4P A;  3EIV A;  3C46 A;  4FXD A;  2B63 B;  3NBI A;  1PH8 A;  1KL9 A;  5C4J H;  5KYI A;  4LF6 Q;  2ID0 A;  1X32 A;  3LX0 A;  3CCQ A;  2EIF A;  1ONL A;  2OQK A;  3D4R A;  2JYO A;  2F3W A;  4G7H C;  2JQO A;  1BO0 A;  3E5S A;  1G6P A;  4FO2 A;  1JMC A;  4DGZ A;  1SR3 A;  5IGB A;  3T1H Q;  3GTP H;  1V43 A;  4BBS G;  1LYL A;  2BE5 D;  3WOE A;  2F1M A;  1TU2 B;  1PRT B;  1BVS A;  2VUM H;  2UUA Q;  2EYF A;  2YU9 H;  3S16 H;  1NMG A;  1YIT A;  4DXG A; 
#chains in the Genus database with same CATH homology
 5IOD A;  4ME5 A;  1D1K A;  3I4N B;  5C3X A;  2V4D A;  3PUW A;  3QOL A;  1F9Q A;  3DWA A;  3BYY B;  2HUG A;  3Q23 A;  1Q8I A;  1KDB A;  5G3L F;  2Z1C A;  1CT1 D;  2EYP A;  1I4R A;  3T16 A;  2QKI C;  1HQM C;  1DOL A;  4V0B A;  4U68 A;  4OO1 H;  1I4G A;  1HFN A;  2WV6 D;  5EBC A;  5C4Z A;  5C5M A;  1K8M A;  3P7J A;  5JPN C;  5I2Y A;  4RKB A;  1E0B A;  3TP8 A;  3PIP 3;  2F0O A;  5DM6 3;  1CA6 A;  1QOH A;  1JOK A;  5EPL A;  1V1O A;  5FLX L;  2DNC A;  5C3E B;  4ZUJ A;  2JA7 B;  4H13 C;  3J7A F;  3ONA B;  2KQ3 A;  2KUM A;  1FYC A;  4F88 A;  2NBF A;  1QJO A;  4KD4 A;  4HMJ A;  3EFX D;  5ELD A;  1PDQ A;  4IUN A;  1OO9 B;  3I73 A;  3VR4 A;  2ICE C;  2A69 C;  1PTO F;  4JK1 C;  4I7Z C;  4HMI A;  3OHX C;  1TWH B;  3HOW B;  5KND A;  3GTP B;  4FXG C;  3DWQ A;  4KTA A;  2R92 B;  1MGS A;  1LTI D;  3PIO 3;  1PTO B;  4Q0F A;  4BA2 I;  1DON A;  3HOX B;  2O4X A;  4K6L A;  4XQJ A;  2LS0 1;  5CV6 A;  4RA8 A;  3K5L A;  2AQ3 B;  1Q90 A;  2SDF A;  1U9R A;  2CQA A;  1IYV A;  1OXT A;  3TSS A;  2EY5 A;  3D4D A;  1OXS C;  4ZKC B;  3R2I A;  2RSN A;  3KLR A;  2L4N A;  3M7G A;  4A3I B;  2A69 D;  1HRJ A;  2MP1 A;  5D14 A;  4WFN 3;  1Q12 A;  4HCE A;  1FNU A;  2XNA C;  3URY A;  4LAA A;  1QNK A;  4N9T A;  3M4O B;  3TN2 A;  4RKL A;  4ZKB B;  2WP8 J;  2D9U A;  1EIG A;  1GUG A;  4KJN A;  2L0C A;  2MJ8 A;  1AN8 A;  1TQO A;  1SAP A;  5JJZ A;  4OIJ A;  3J7A V;  1VF7 A;  2BE5 C;  3PUX A;  1TVX A;  2ZT9 C;  2B8G A;  3V05 A;  1IW7 C;  3SK5 A;  1C4Q A;  3GD7 A;  3TP5 A;  1RF2 D;  4KMU C;  4A3B B;  1UAP A;  4V19 0;  4DXF A;  2F0U A;  4F8M A;  1Z47 A;  3J80 L;  1TS2 A;  1VF5 C;  1J9O A;  3S1M B;  3QG1 A;  1J8I A;  3G7L A;  1FNV A;  3X3N A;  5FO9 B;  2M2L A;  4IZ8 A;  3K6O A;  5JPM C;  2FHT A;  1A3T A;  3OSO A;  1JQY D;  2SNS A;  2WKD A;  4KY6 A;  4KY7 A;  2F4I A;  1UEA B;  2KEE A;  4DAP A;  1WD1 A;  4Y7N B;  1TWF B;  3FKI B;  1B50 A;  2HCI A;  1WTW A;  1E2Z A;  3KBG A;  1G29 1;  4M1U B;  5KYL A;  1XXG A;  2BA0 A;  1B9M A;  1STG A;  3D4W A;  2SNM A;  2PNR C;  2F0E A;  2IX1 A;  2A6E C;  4NKL A;  1QNU A;  1PFB A;  4J6H A;  2Z8L A;  1B2T A;  3S1R B;  2A6H C;  2R6G A;  1BXT A;  1EY9 A;  3KF8 A;  2LKV A;  5DM7 3;  3RZD B;  4A93 B;  2K7V A;  2NB0 A;  3D31 A;  4K2K A;  1BCP D;  3Q6S A;  4DF7 A;  2BDO A;  3HEJ A;  4IQZ A;  2E75 C;  1S5D D;  2MPM A;  2C5C A;  2ICI A;  3VA7 A;  3GO5 A;  3BVZ A;  5I6W A;  1O78 A;  1JOR A;  5KEE A;  3SHL A;  4CKC A;  1EQV A;  4ZYS A;  1EEF D;  1A2T A;  4OGQ C;  4ABN A;  2F0P A;  4JBW A;  2A68 C;  5M5W B;  4FF4 A;  2KHS A;  1RJT A;  1BNZ A;  4XTC S;  4NP5 A;  4KKS A;  3H6M A;  2NVY B;  2FJ2 A;  3A56 A;  5KIX A;  4PV1 C;  2IWH A;  3AMU A;  2R3Z A;  5JVH 3;  4H0L C;  1BCP C;  4A3K B;  1AP0 A;  3FPU B;  2BA1 A;  1PRT F;  4GZY C;  3BDL A;  3VYR A;  1VMP A;  4K5X A;  4LMQ D;  1A6X A;  3VYT A;  2D5D A;  3H94 A;  4KD3 A;  2A6E D;  3LNN A;  3A8J E;  3GTM B;  1SYF A;  4IFD G;  5ISR A;  2OT2 A;  1LLR D;  4RFB A;  5EPJ A;  4B9X A;  3H0G B;  1TII D;  1H9R A;  1BOS A;  1OXV A;  3QB3 A;  1ZYR D;  4RHR A;  3E0J A;  2FMC A;  3EQL C;  4FYD A;  5E3F A;  1Q1B A;  5CGK A;  1DOK A;  3EJI A;  3KBX A;  1SYD A;  5EPK A;  2EJG C;  1TY2 A;  5JAV A;  3FEW X;  2B2W A;  1T5E A;  2L12 A;  3MA2 B;  4DA2 A;  2E76 C;  2SOB A;  1Y1V B;  3MXG A;  3VR2 A;  5E4X A;  4OL7 A;  5CV4 A;  3T56 B;  1I4H A;  2F03 A;  5C4J B;  4WRD A;  1O7Y A;  1HCZ A;  1LT4 D;  1VDZ A;  1Q3L A;  4O42 A;  2K28 A;  3MTS A;  3BVG A;  4UDU C;  1KNE A;  5BN3 A;  4A3E B;  1JE4 A;  4BWG B;  5A2Q L;  3VR6 A;  3S14 B;  1SYB A;  1A3U A;  1EY8 A;  3NK9 A;  1IKL A;  1RD9 D;  5CYU A;  2EYH A;  3QIA A;  3GTK B;  3UI2 A;  3J81 L;  3TME A;  3HOU B;  2X6G A;  5IGF A;  3HOZ B;  5COR A;  3GV3 A;  1CZG A;  2F0T A;  4A3F B;  3FRP B;  1BCP B;  1AEX A;  5CV9 A;  3P1H A;  1F2Y A;  4ZRZ A;  3K58 A;  3C1F A;  1SMY C;  3NWS A;  3D3R A;  1S5C D;  3U9O A;  3NWT A;  4KN4 C;  5FO8 B;  2RKS A;  5JOB A;  4TSS A;  2FFK B;  2OXP A;  1F9S A;  1WTP A;  2K03 A;  1NR4 A;  2F0N A;  5C0X J;  2EY6 A;  1BBX C;  1BQQ T;  4QMG A;  3OIQ A;  3VYU A;  3BS1 A;  1SND A;  3BYT B;  4CKE A;  3HOV B;  2RDG A;  3MWY W;  2EYM A;  4YIJ A;  5J39 A;  1E2W A;  1A3V A;  1EY6 A;  5EBD A;  4C56 C;  4C1N I;  1D6E C;  1L0X B;  5I6Y A;  3HS0 C;  3L3O C;  3QWN A;  2RDF A;  1CK1 A;  2VB2 X;  3PMF A;  1DOM A;  3V96 A;  1A15 A;  5C3W A;  3SVM A;  4DFA A;  5G3L D;  5CC4 A;  4F87 A;  2IJ0 A;  3S17 B;  1ROD A;  3NXW A;  1F2Z A;  3M85 A;  5EKL A;  2J7Z A;  2RQX A;  5IIF A;  3DXJ C;  2LMC B;  2AQ2 B;  5IT9 E;  3KLS X;  4KI0 A;  1PRT D;  1QG7 A;  1CHP D;  5EGT A;  1HA6 A;  3MXU A;  1FD7 D;  4IUU A;  1H9M A;  1STB A;  3A7L A;  4FVM A;  2L1B A;  2O2L D;  5D3D A;  1HQR D;  2EJF C;  2AUJ D;  2X69 A;  1F9R A;  1SJH D;  3SR1 A;  3SK6 A;  2NWG A;  2C9O A;  1SFO B;  5COY A;  2G9D A;  2BDN A;  2EOT A;  1MSG A;  4I65 A;  4IUT A;  1QB5 D;  3X3M A;  4EVO A;  2KOL A;  2OF1 A;  2QIL A;  1KDA A;  3TP6 A;  3P20 A;  3KK7 A;  4RH6 A;  2PMZ B;  3BDC A;  4OO1 I;  3SE0 A;  4DK1 A;  1ILP A;  5CMD A;  1ML0 D;  2F0L A;  1PZI D;  3DUZ A;  3J7Y W;  3FVQ A;  1CFM A;  3I4L A;  3BZD B;  1TS3 A;  2EJM A;  3CQZ B;  5BN5 A;  1CHQ D;  5KNB A;  3F2U A;  5IGD A;  3SK4 A;  2KCC A;  4KKU A;  4C2M B;  1SMY D;  4L63 B;  4RGT A;  5DNF A;  1JR0 D;  3I90 A;  3GP7 A;  4XQQ A;  1NSN S;  1OXX K;  3S15 B;  3HKZ B;  1ET6 A;  1G91 A;  3W2D A;  3IKJ A;  4FF1 A;  3VYS A;  4ID6 A;  3DHQ A;  3M4Y A;  1HTP A;  1DCZ A;  5TSS A;  2NVT B;  5AFW A;  3ND9 A;  4BY1 B;  3S1Q B;  3R3O A;  5FLX E;  1I6V C;  1EFI D;  5C0X I;  2F0K A;  1HPC A;  4K2L A;  5M9O A;  3NSW A;  1Z7T A;  4RCN A;  2K32 A;  1KLU D;  2PW7 A;  1HXY D;  4K8I A;  5A35 A;  1MI2 A;  4ULL A;  1YNJ D;  1BDO A;  4TRD A;  1BUV T;  1SSO A;  4BA1 I;  3J80 E;  3C3L A;  3OIP A;  2XIW A;  3P75 A;  4F7X A;  2B2W C;  2IPK D;  4ZK9 B;  1B4O A;  2B2V A;  3NTI A;  1S5F D;  1FGB D;  4ZUI A;  2CW0 C;  3BDO A;  4HCS A;  1K8O A;  3MZ5 A;  1JC7 A;  4BBR B;  4FXK C;  4KKT A;  1SNM A;  4CKB A;  1DD2 A;  2TSS A;  1ENA A;  3T13 A;  2F0Q A;  3SXH A;  4L8J A;  1WTQ A;  2G9H D;  5IOC A;  4X3K A;  1S4Z A;  4WOR A;  3GTL B;  5IT9 L;  3MAQ A;  2Q8T A;  2QDB A;  4IUP A;  5C0X G;  1LV9 A;  5JVG 3;  3CHB D;  5C0X H;  2ZXP A;  5T1G A;  4R8N A;  3NHH A;  3K5M A;  2VUM B;  3IFD A;  3DMU A;  2YU9 B;  2Z4I A;  3NP8 A;  1II3 A;  5E1F A;  4RGM A;  2B8F A;  1PTO C;  5KNC A;  1NCV A;  2JA6 B;  2KED A;  1PFM A;  1Y8O B;  1U4M A;  3DEO A;  1KAB A;  1KDC A;  4KHZ A;  4XQN A;  5J1Z A;  2TMP A;  3RUZ A;  4C1N K;  1IL8 A;  5I2X A;  1MD2 D;  2XWB B;  1SE3 A;  5LL6 S;  3QO2 A;  2WAQ B;  1V1P A;  1JB3 A;  2WB1 B;  4BBS B;  3IFT A;  1EY4 A;  3LWE A;  4H7B A;  3EVQ A;  3NBH A;  3D6W A;  2M9V A;  1D5X C;  3K7A B;  3Q0A A;  1D2B A;  1M4V A;  1STN A;  5ELB A;  1RHP A;  3TBI B;  1MBY A;  3PUV A;  2PCF B;  1NUC A;  1CA5 A;  2L11 A;  2Y0S B;  3NQT A;  4G7O C;  3H09 A;  1PZJ D;  4DU9 A;  1CM9 A;  4HR7 B;  1EYA A;  1CZW A;  2GA4 B;  1XX8 A;  2EY1 A;  2NN6 G;  3FPP A;  3SDZ A;  5LHY 1;  1EU4 A;  1LO5 D;  3MXN A;  3SEB A;  1O7Z A;  4KV6 A;  4NDX A;  1W6K A;  2EY2 A;  1GUW A;  4N9P A;  1SYE A;  3A54 A;  3DM1 A;  4ILW A;  4PMC A;  1WD0 A;  1LTB D;  1EWC A;  1EY5 A;  2BCO A;  5K36 H;  5CR3 A;  4C3I B;  1ICW A;  2K6A A;  4XIG S;  1AZP A;  5CBE E;  1LTA D;  2DNE A;  1Y69 U;  1KLG D;  2F0G A;  2KCN A;  2AQ1 B;  3SK8 A;  1DZ1 A;  2I07 B;  1GXD C;  1WTO A;  3I70 A;  3KUP A;  1F9P A;  4ZAI A;  1I3Q B;  3ITP A;  4K14 A;  1JWS D;  4G7Z C;  4EGV A;  1HFG A;  1GJX A;  3O13 A;  3IAY A;  4TQU S;  2L9H A;  1PXU A;  3PUY A;  4FP5 D;  4IUR A;  4FNF A;  1LTR D;  1RCV D;  5CBA E;  2Q8I B;  5A2Q E;  1EOT A;  1I4X A;  1SJE D;  4MN3 A;  2JA8 B;  3TDQ A;  1EYD A;  1M8A A;  4A3M B;  3GTQ B;  4G57 A;  2XRQ D;  2EXZ A;  3K57 A;  2PO4 A;  3N52 A;  2OEO A;  1PTO H;  4DAY A;  4CJ1 B;  5FK9 C;  1KTK A;  4XYO A;  4R8I A;  2HQE A;  4CBV A;  2X6L A;  3GV6 A;  2RSO A;  4U67 3;  3U9S A;  4C3J G;  2B2U C;  2Q8R E;  5D65 A;  4NMZ A;  1B53 A;  2F0V A;  2XN9 C;  2O5I C;  2A73 B;  1U4R A;  3RLF A;  5M3M B;  1BR9 A;  1KNA A;  1SDF A;  5C44 B;  3I91 A;  1HTL D;  1VMC A;  5M3F B;  1SXT A;  1STH A;  1OXU A;  3N6R A;  4B9W A;  3CRL C;  1ENC A;  2KJX A;  1PLF A;  2NTS A;  1T5X D;  2XSC A;  1GHK A;  5M5X B;  2F0J A;  1D5M C;  1EYC A;  1GOZ A;  5ELF A;  3MFG A;  4HN7 A;  5F2D A;  4CJ0 B;  1WTX A;  2EYO A;  4XT3 B;  3PV0 A;  1DXM A;  5IGG A;  5M5Y B;  1D1I A;  1JOO A;  4ODG A;  3MC0 B;  4KHV A;  1K83 B;  4CHT B;  4KJO A;  2AUK A;  4HSV A;  2LFN A;  1H9J A;  4C3H B;  2QF7 A;  4ZLT F;  1FR3 A;  1Y8N B;  1F77 A;  3H91 A;  1LTG D;  1EWH A;  2PW5 A;  4IAL A;  5NUC A;  2NZ1 D;  4OIK A;  1IHZ A;  1G2S A;  1STE A;  4K6D A;  1HUM A;  2B2T C;  3WDN A;  3M3Y B;  2FMM A;  1PMR A;  1YNJ C;  3V2T A;  4NW2 A;  3K59 A;  3AU7 A;  3NTH A;  2B2V C;  4XT1 B;  5I9O A;  3LWU A;  5KRU A;  2XWJ B;  2E2I B;  2H4O A;  4OHJ A;  2IW3 A;  2DY7 A;  1F2L A;  2KA7 A;  4QIW B;  1JCK B;  2MGS A;  5C6A A;  2KEC A;  1SYC A;  2J4X A;  2L55 A;  1YNN D;  3S9W A;  4PMB A;  4EQP A;  3VA5 A;  1JOQ A;  4G4K A;  2K05 A;  2WKC A;  4XDX A;  3Q24 A;  1TY0 A;  3OOC A;  1TWG B;  2SEB D;  4FF3 A;  2A74 C;  3S16 B;  3T4A C;  1JWU D;  2PQE A;  1KAA A;  2ZXO A;  5K5P A;  1R4P B;  2Z4H A;  1EQT A;  1EY7 A;  1DM0 B;  2WII B;  1GUS A;  4DK0 A;  3Q22 A;  3FDT A;  1F2M A;  2NYZ D;  4X3S A;  4IFD J;  4CGY B;  2EYJ A;  2EYL A;  3MVV A;  3NUC A;  3NQI A;  1PYW D;  4RHS A;  2EVB A;  4A3G B;  2VB3 X;  1EL0 A;  1BF4 A;  1B3A A;  1PTO D;  3EA6 A;  1MSH A;  2HDL A;  2K33 A;  2QCP X;  3NE5 B;  4A3D B;  1QE6 A;  3IL8 A;  4EQO A;  1STA A;  1DYQ A;  4H44 C;  2B2U A;  1QWY A;  1YNN C;  3MXP A;  4DN4 M;  3G6J B;  3BVM A;  2M00 A;  3DWP A;  4RWS C;  1SNQ A;  1QCB D;  1S5E D;  4K5V A;  1SE4 A;  1S5B D;  1EZ8 A;  2CHB D;  4J1M A;  1O80 A;  3D6C A;  1Y8P B;  2F0D A;  1GUN A;  3OMG A;  1TT2 A;  3AB9 A;  1B9N A;  3GTO B;  3QJY A;  2JEA I;  3VR3 A;  1AZQ A;  2WIN B;  2IX3 A;  1A2U A;  3RZO B;  2ENB A;  2HDM A;  1ET9 A;  3T51 B;  3OWE B;  2F0F A;  4WJW A;  1AW7 A;  1C48 A;  1EU3 A;  1ZEQ X;  3GTG B;  1SEB D;  3RMH A;  3R93 A;  1L0Y B;  2B2Y A;  2XRS D;  2EDG A;  4MIU A;  4Q5V A;  1SNP A;  1GHJ A;  2E2J B;  1I4Q A;  1U4L A;  4K5W A;  4DNR B;  2K04 A;  1TS5 A;  1PFN A;  1ENF A;  3BG3 A;  2B2T A;  1E2V A;  3ERQ A;  2MUY A;  1D5Z C;  2BOS A;  1UUP A;  1WVL A;  2JP1 A;  4QB4 A;  1Z6H A;  4PNY A;  2PZU A;  5CV8 A;  5CV5 A;  4R9W A;  1TR5 A;  2F0W A;  4XXE A;  1LT6 D;  4RCO A;  5FO7 B;  3OPO A;  4X3U A;  3HOY B;  2L5T A;  2NN6 H;  3CKI B;  5EKI A;  1HA5 A;  1JWM D;  5ELC A;  2MHV A;  3A8I E;  1UNS A;  1GUT A;  2DN8 A;  4KY5 A;  5EJW A;  3TP7 A;  3MEH A;  3JAM L;  2F3V A;  5K36 G;  2QEJ C;  1PZK D;  1EIH A;  2I46 A;  4O1N A;  1NAP A;  1Y1W B;  1LAB A;  4QCL A;  1V1P B;  4DAV A;  3PUZ A;  5EQ0 A;  1LAC A;  1R9T B;  5IGE A;  1TKW B;  2CW0 D;  3HZX A;  5JEA G;  1B1Z A;  4C3I G;  1IYU A;  3ND8 A;  2PYK A;  3R8B A;  3T53 B;  3I8Z A;  4QUC A;  4HSP A;  4K8J A;  4IFD I;  5IGC A;  3ERO A;  2E74 C;  3NPP A;  3PO2 B;  1LT5 D;  3A8K E;  1I6H B;  1I4P A;  1XYI A;  3ZYY X;  4EQN A;  4LK1 C;  4B08 A;  3WOF A;  1RKN A;  3W3A A;  4LJZ C;  5E4W C;  2F0M A;  3GQB A;  1W6J A;  2RDH A;  3HGB A;  1CQF A;  1BCP F;  2B2Y C;  1B44 D;  1PRT C;  2KVM A;  1RTO A;  2K01 A;  4HED A;  3C2P A;  4MHE A;  3OMC A;  4DNT B;  2K5Q A;  3J81 E;  4IUV A;  1GUO A;  2DY8 A;  1X3Q A;  4KN7 C;  4ZQ3 A;  3I72 A;  2F0S A;  3RD4 A;  2O5J C;  5C5L A;  1EEI D;  1SE2 A;  2PPB C;  1XTC D;  1LTS D;  1STY A;  5BN4 A;  1SBB B;  2H1E A;  3D8G A;  1NR2 A;  4TKO B;  1V8Q A;  3DEP A;  4A3J B;  2E2D C;  3HP3 A;  1RDP D;  1EZ6 A;  4Z9C B;  2R7Z B;  1X3P A;  2CVR A;  1WCM B;  2JE6 I;  3L7Z C;  3MHB A;  3QOJ A;  3R2T A;  1TWC B;  2IL8 A;  1ZKO A;  1AFP A;  4HAE A;  2D62 A;  2NVX B;  2EZV A;  5DEH A;  2WAC A;  2D2C C;  5JEA J;  4UAI A;  3K5N A;  5HGT A;  2IX0 A;  3CRK C;  2A5H A;  2AWO A;  2AWN A;  1LT3 D;  1SNO A;  1HUN A;  5FOB B;  1ESF A;  4M8A A;  3C1E A;  1ZYR C;  2F0H A;  2IT1 A;  4J8Q A;  2NUC A;  1O7L A;  5D3I B;  4AYB B;  2JA5 B;  1IW7 D;  4BY7 B;  3TZD A;  2NTT A;  3S2D B;  1H9K A;  2FIN B;  4HTH A;  2R61 A;  2JSO A;  4KK7 A;  1G2T A;  1TWA B;  3E6Z X;  1WTR A;  2JEB I;  1H9S B;  2VNU D;  5T1I A;  4E6I A;  1ILQ A;  1IKM A;  2R93 B;  2N88 A;  2LY7 A;  1LTT D;  4L6T B;  3TZU A;  4C3J B;  2JXM B;  2K5W A;  2EPB A;  5C4X B;  3CU7 A;  2XVS A;  4S3S A;  5FKA C;  4RGN A;  4FF2 A;  5C4H A;  1FNW A;  3FMC A;  3NTK A;  3VR5 A;  3GTJ B;  1WTV A;  1HHV A;  3A55 A;  4BS9 A;  4IN3 A;  1Q1E A;  1CTM A;  2NVQ B;  1H9S A;  4RGO S;  1DJR D;  1TS4 A;  1SNC A;  1QIL A;  3M7N A;  3K5O A;  5EKK A;  1EY0 A;  4CJ2 C;  4RAU C;  1CQV A;  2PZW A;  2RA4 A;  5I9P A;  2K5D A;  4P2C B;  3S1N B;  1R4Q B;  4OO1 G;  2E2H B;  5JEA H;  3OW7 A;  2J0T D;  4IUQ A;  3PO3 B;  1C8C A;  3I4M B;  2HCC A;  2EE1 A;  2ZXR A;  4QF4 A;  4X3T A;  1I50 B;  2YYZ A;  1CI3 M;  4PMW A;  5HUR A;  3HRZ C;  4IFD H;  4XYQ A;  2RBM A;  1SYG A;  2A68 D;  2F0I A;  3KLS A;  4PQX A;  3S2H B;  2RVL A;  3MFY A;  5KGU A;  1ZXT A;  3L9A X;  5ELE A;  1G8Z D;  3HG9 A;  3I3C A;  1JIC A;  2N55 A;  4C3H G;  2PZT A;  3OWF A;  1ESR A;  5I4D A;  3H3V C;  3A7A B;  1G6Z A;  1XWE A;  2A6H D;  2VXW A;  1VCI A;  5DAU A;  3JAM E;  1RTN A;  3K0Y A;  4QUF A;  2B39 A;  5LL6 X;  2K1B A;  5CV7 A;  5J22 A;  2NN6 I;  1U4P A;  3C46 A;  4FXD A;  2B63 B;  3NBI A;  5KYI A;  2ID0 A;  1X32 A;  3LX0 A;  1ONL A;  3D4R A;  2JYO A;  2F3W A;  4G7H C;  1BO0 A;  3E5S A;  4FO2 A;  4DGZ A;  5IGB A;  1V43 A;  2BE5 D;  3WOE A;  2F1M A;  1TU2 B;  1PRT B;  2EYF A;  4DXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...