2EY5A

Crystal structure of staphylococcal nuclease mutant t41s
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDSPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey5A00
1A3UA 1JOOA 1SNQA 1F2ZA 4J6HA 3P1HA 4B9WA 4I65A 3H6MA 5C6AA 3SXHA 4ZUJA 5KIXA 2PW7A 2F0KA 4PMCA 2EYHA 2PYKA 5CV9A 4ZQ3A 5CC4A 5I9OA 3EJIA 3SK4A 5KGUA 3HEJA 1TR5A 3QB3A 1SNMA 4ME5A 4WRDA 1KDAA 4TRDA 1JOKA 3SK5A 3TP7A 4DFAA 4RKLA 2F0LA 1EYCA 1F2YA 2F0VA 2F0SA 4S3SA 5CV8A 4DGZA 4K8IA 3NXWA 5CGKA 5C4HA 5IGDA 4K8JA 3SK6A 2F0GA 2M00A 5C5MA 3V2TA 2ENBA 3NHHA 2NUCA 2EY6A 2LKVA 2KHSA 4K2KA 3C1EA 2PQEA 4KHVA 4F8MA 4WORA 1SYEA 1SNDA 2EYLA 4IZ8A 4KD4A 4KJNA 4DF7A 1AEXA 3BDLA 5DAUA 3NK9A 4PMBA 1IHZA 1SYGA 3TP5A 1A2TA 5EGTA 5KEEA 2F0UA 3NQTA 3QOJA 5IGBA 1STGA 4KJOA 1EY4A 4F7XA 4IALA 5F2DA 5E1FA 3ITPA 2QDBA 4EQOA 3VA5A 3OMCA 5CV6A 3DMUA 2F3WA 1JOQA 1NUCA 5EKLA 1STAA 2EY5A 2F0MA 4NP5A 5KYLA 4LAAA 1JORA 1A3TA 3HZXA 4KY7A 2RDFA 1EY9A 3EVQA 1U9RA 1SYCA 1ENAA 1EZ8A 3OSOA 2F0DA 4IUNA 1SYBA 2SOBA 3RUZA 3U9OA 5ISRA 1TT2A 2EYOA 1KDCA 2F0QA 5HURA 3MEHA 2F0JA 1SYFA 4J1MA 5IIFA 1KAAA 2WACA 1EY5A 1EY0A 4K5WA 5JOBA 5HGTA 5J22A 1EYAA 2PZTA 5CV4A 5I9PA 2F0OA 1F2MA 5J1ZA 5I6WA 5IODA 5IGFA 2OF1A 2HQEA 3MXPA 1STYA 4NDXA 1STNA 2EY2A 2PZUA 4E6IA 2F3VA 4KV6A 5IGCA 4KY5A 2SNSA 1KDBA 4ZUIA 4QMGA 4DU9A 4NMZA 2OXPA 5C4ZA 1EZ6A 1SYDA 3MHBA 2F0WA 1A2UA 4OL7A 5KRUA 1EY6A 4YIJA 3D4WA 4QB4A 3E5SA 3PMFA 5CR3A 4KY6A 4RKBA 5K5PA 4R8NA 4ODGA 4PNYA 4NKLA 3BDCA 3EROA 3TMEA 3C1FA 3DHQA 4K2LA 2F0EA 4K6DA 1EQVA 3SHLA 5NUCA 2F0TA 1RKNA 2F0PA 3T13A 1EYDA 2F0IA 1II3A 4KTAA 5C3WA 5CV5A 3TP8A 5KYIA 2EYMA 5CV7A 5M9OA 3LX0A 5I6YA 2EY1A 2OEOA 2SNMA 4KD3A 2EYJA 1KABA 3R3OA 4K5XA 2EXZA 1TQOA 5EKKA 3TP6A 5DEHA 3S9WA 5J39A 5C3XA 1EY8A 4G57A 3QOLA 3MZ5A 1SNCA 1A3VA 3SR1A 5IGEA 3OMGA 3D8GA 5JAVA 5E3FA 2O4XA 3P75A 3D6CA 4B9XA 5IGGA 4HMJA 4N9TA 3SK8A 2RKSA 4K14A 4EQNA 4H7BA 4EVOA 4K5VA 1NSNS 3ERQA 3NUCA 2RBMA 4N9PA 2EYFA 4HMIA 3MVVA 1SNPA 4ID6A 3D4DA 1ENCA 2PZWA 3OWFA 1STHA 2EYPA 1SNOA 2F0NA 4QF4A 1STBA 2F0FA 1EY7A 2F0HA 3NP8A 4HTHA 3T16A 4EQPA 5IOCA 4MIUA 2KQ3A 5C5LA 2PW5A
chains in the Genus database with same CATH superfamily
2K03A 3Q23A 2ICIA 3P1HA 2F4VQ 4FF2A 5BR8Q 1PRTB 2NTTA 2A6ED 3DXJC 3M3YB 2AWNA 1NJIC 2Y0SG 1SE3A 4JOIC 5M5YB 3A0JA 2IW3A 2YTYA 3SK6A 5IGDA 2A5HA 1KRSA 2G9DA 1F9PA 1CKNB 1YJWA 4U68A 2Q8IB 2Z6KC 3BJUA 1QVCA 3A7LA 1N36L 2WB1E 4R4IA 1OTCA 4A3BH 2N3SA 1SLJA 1NBWA 2BOSA 3RZOB 3J7AV 2FMMA 1EY4A 2FJ2A 4A3FH 1AZQA 2QDBA 2E5LL 1KLGD 1CKMA 3OMCA 4A76A 3Q6SA 5C4JH 3OHXC 1STAA 4CHTB 3EQLC 3HKZB 4JI7L 4LF8Q 1EY9A 1IBML 1EZ8A 5M3MG 1B3QA 2NVTH 1B2TA 2E2HB 1H9SB 3NBHA 2EZVA 2MGSA 1ENFA 4R4QA 2R93B 3MTSA 4DAYB 3RZOH 1ZYRC 1IZ6A 1K0RA 3SE0A 4YCWA 1A2UA 1GUSA 2CQAA 1I4QA 5EQ0A 4YIJA 1OXSC 4QB4A 5CR3A 4IUUA 1JJGA 5JVH3 1SEBD 2A8VA 1LTRD 4X65L 3BDCA 2DJFC 4P71A 1KD1C 5G3LD 2IY5B 5KYIA 1BDOA 4IOAA 4TKOB 3BYTB 2OT2A 2R7DA 1DZ1A 4G57A 1IL8A 3E3XA 5ELBA 2K5VA 1KAWA 3CP0A 1WTQA 4OEMB 4FF3A 3SK8A 1K8GA 1C7YA 2MO0A 4H7BA 3EA6A 1GJXA 3NUCA 2EYFA 1E1TA 1ET6A 4PMWA 2L5TA 4YHHQ 1EWIA 3OPOA 1X54A 1DGSA 1WTOA 4DV1Q 1KTKA 1LTBD 4A93B 4HIDA 1IBLQ 2Z8LA 5J3BA 4PQXA 4JI3L 3PO3B 4HJ7A 2CH4W 3VR6A 2VQEQ 5M3FH 3QO2A 4A3CG 2OCEA 3EJIA 5CBEE 1I3QH 1SNMA 1KDAA 2NVQH 2XIWA 2F0LA 4DV3L 5CGKA 3J80E 4BBSB 1UEAB 4UY8C 4FVMA 1CSQA 2CVRA 5LL6S 2H1EA 1Q82C 3HFZB 3PUYA 4KD4A 2Q8RE 5E7NA 1E2VA 2CW0C 4MTNA 1LT3D 3OYYA 1A2TA 3K80C 5ELFA 4JI7Q 5LL6X 1SMXA 2RHSB 3GV3A 3QG1A 4RCNA 1VQ8A 2DGYA 2B2VA 1WTXA 5C4XG 2ZXOA 2IPKD 1DXMA 3RMHA 1IW7C 2SOBA 3EN2A 2IWHA 2D2CC 2PNHA 2K33A 2R92G 2F0QA 5HURA 4DV7Q 1EUJA 5ELNA 3F2CA 5J22A 5CV4A 5IYCH 3BU2A 3PO3H 5I6WA 3PO3G 3MXNB 4JYAL 2JEAI 4JK1C 3R2IA 5IGCA 1OXTA 3VYRA 1E2ZA 1Z7TA 2K5QA 4DAPA 5C4ZA 4DR3L 1VS0A 2AHOB 4GN3B 5LMNL 4JI2L 5FJ8G 1WTVA 1WYDA 4AYBG 1HHVA 4DV2L 1CZWA 1HTLD 5T1IA 1SXTA 2NN6H 4R1JA 1VQGA 3X3NA 3DEOA 1EYDA 3PCOB 2EY1A 4HEDA 5EJWA 4A3GG 1MGSA 2A1AA 2Q2IA 4BY1G 1H9RA 3OMGA 3D6CA 2IX1A 2JA9A 2ALYB 4A3LH 3DUZA 3OWFA 3A7AB 3GTMH 4CJ2C 1KQSA 2PMZE 1IBMQ 4R8IA 3R93A 3RZDB 2B39A 1G8ZD 1XX8A 2NZOA 1X55A 4HAEA 3H15A 2VUMH 2RVLA 1N33L 3CQZH 1HRJA 2NVQB 1I6HH 4AH6A 1Y69U 1HZ9A 5JJZA 4JYAQ 2CWPA 3CU7A 1Q12A 1PLFA 4HJ8A 1EYCA 3VR5A 4K8IA 5GQOA 2A6HD 1AH9A 4DXGA 2G5DA 4DUZQ 1RL2A 1FGBD 1I5FA 1I4XA 4A3FB 4DF7A 3OTOQ 5IWAL 1TWHH 2A73B 3NBHB 2ASBA 2UXDQ 3NK9A 1TWGB 1R4PB 1Z9FA 2F52A 2KEEA 4A3BB 3S17H 2D9UA 1YNJC 2F0UA 4LFAL 2F4IA 1BCPD 3DLLA 4GOPB 3U58A 2JN4A 3V05A 3IL8A 4G7HC 3HZXA 2L12A 2EIFA 3KBGA 2YV5A 4B3MQ 4HJ5A 1O78A 4JI0Q 2VS1A 2RA4A 1GO3E 2MQHA 3UDIA 4IOCA 3J7A5 2PCFB 3S2HB 1PRTF 1B53A 3M85A 2B63H 1Q7YC 4QIWB 2ZTDA 1PFBA 2JA6G 1NNXA 1SMYD 5M5YH 3M7NA 1QUQB 4LF9L 2I5LX 3LGJA 5JPMC 1BBUA 1N8RC 1I4HA 2O5IC 3PIP3 1K83H 3RLFA 1T5XD 3QR8A 1JT8A 2F0PA 2F3IA 1II3A 4QUCA 4GKJL 2YTVA 5I6YA 1WTPA 1DCZA 3QWNA 3TP6A 4ZLTF 4IFDG 1VCIA 3AU7A 1AE2A 2IHEA 2QF7A 3QOLA 3KJOA 4DPGA 1ZXTA 2K5NA 1Y1WH 1Y1WG 2X6LA 2O4XA 2AQ2B 2NN6G 1SE8A 3A74A 3VDYA 2AMCB 4RAUC 3J80i 2YU9B 3LWEA 3K5OA 4QUFA 2JA5G 2VY3A 3CKIB 4UP7A 3CCEA 5JJIA 4U673 2KCNA 2F4VL 1LACA 3VYSA 3TREA 2WIIB 3OIQA 1GD7A 5JEAH 3E6ZX 2F0FA 5AJ3L 1JB3A 1QCBD 3NP8A 2MNAA 3T1YL 5FLMG 2WKDA 2EE1A 3BG3A 4G4KA 1ZYRD 1K8AC 2KJXA 1EIYB 2JA6H 1KNAA 3NTHA 4OWWB 5JVG3 2R92H 2ZTCA 3KLSX 3RLOA 4DV0L 2XVSA 1F2YA 4LF4Q 1J6QA 1SN8A 4JI2Q 1D5XC 3J7AF 3E0JA 1JR0D 4FDBA 1N34L 3A8IE 2GVAA 3I4NG 2K04A 2BDNA 3GTLB 1B70B 4JI6Q 3HOXB 1E2WA 1S5BD 1AEXA 2QA4A 3G6JB 4C3IH 4IURA 1LTID 1TWCH 5JJLA 3T1HL 1HNXQ 5GADC 4JV5L 2BA0A 3ITPA 3I4MB 4AYBB 3G71A 4J15A 4DR1L 5EKLA 3S1NB 1SAPA 4FNFA 1XXGA 3B6YA 4O2DA 1VQKA 1EU3A 3K0XA 1U9RA 4CBVA 1TVXA 1EOTA 1SYBA 2Z6KA 4BXXG 5C0XI 1O7IA 1HTPA 3S1MH 3CC2A 4BBSH 4V0BA 5JOBA 4GZYC 1D7QA 1P16A 3HOUG 1SSOA 4X6AH 2HUGA 4LF6Q 1QE6A 3P7JA 1HNWQ 5C44G 1JCKB 1M4VA 2K05A 3H0GB 1UE1A 1SROA 1RD9D 2NWGA 5IYBH 2G9HD 1O7ZA 4NW2A 3NENA 3GD7A 3S2DB 1VQOA 1XJVA 2F1MA 1UAPA 4JBKA 2HT1A 2ATWA 2Z4HA 2JA7B 4CDCC 3S15H 3TP8A 3NQIA 3PUVA 2OEOA 4KI0A 5EPJA 1Y1VG 1VQBA 2Q2UA 4IUTA 4DNRB 1CT1D 4AYBE 1A3VA 4DAYA 5AJ3Q 3A54A 5E3FA 4BY1H 1XNQQ 1IXRA 4YHHL 2JE6I 3EBEA 2JA8G 3HKZG 2DNEA 2E76C 3OW2A 1TIID 3ULJA 1JICA 3UE0A 1Q3LA 1EY7A 2EDGA 3X3MA 3BVMA 1PH9A 2BCOA 3RZDH 2JYOA 1Q46A 2B2VC 1FYCA 3HOUB 3DM3A 1GUOA 4B9WA 4I65A 3J7ZC 4L63B 3AMUA 1VMCA 1VQAA 1WVLA 3GTKB 1I94L 4JI8Q 3TZUA 1GXDC 2QILA 1LUZA 2WV6D 3IFDA 4GN5A 1W6KA 4DV5L 2LXJA 1PYBA 3I55A 2PNRC 2FMCA 2NUCA 3D4RA 3KJPA 2Z1CA 1Y8OB 4K2KA 1FJGQ 1IBKL 4TSSA 4WORA 1YNNC 2MFIA 4JI4L 1QG7A 3S1NH 1HZCA 1STGA 4DR5L 4FP5D 1BOSA 1TY2A 4BY7H 3VA5A 1ESRA 3OWEB 2UUBQ 2J7ZA 5GAHC 2F0MA 4NP5A 1BBWA 1LYLA 2D62A 1X3PA 4UP9A 1QZHA 3CCSA 2VNUD 1SYCA 5D65A 3GTOB 4MTKA 4NPSA 1TKWB 4OO1H 4K5WA 2RSOA 5FLXL 3CRKC 4A3EH 3AB9A 3MXPA 1SFOB 2P5ZX 2EY2A 5C3EG 3G4SA 1L1OB 3I7FA 3M3YH 1LABA 1WCMB 5CORA 1ESFA 5DLQE 2CHBD 3KOJA 3I2ZA 1EWHA 4NMZA 4R4TA 2F03A 4EGVA 2I5HA 4IFDJ 3S1RH 3J81c 4BWGB 3S24A 1V1PB 5FLXc 2DY7A 1CKOA 1GKHA 4KTAA 2SNMA 4KN4C 2EYJA 1BCPC 2B2WA 1TQOA 2B8GA 1PTOC 1I4RA 4A3IG 2YU9H 1SNCA 3ONAB 3S16B 1PZJD 2RHQB 3H09A 1B9NA 3OW7A 2K1BA 1XTDA 2N49A 5T1GA 3T51B 4XYOA 3J81L 5IE8A 3D4DA 4AQYL 3UI2A 1EQTA 4C3HG 3T16A 1GM5A 4MIUA 4N8X1 4POFA 5A35A 4QY7A 4KHPL 4HN7A 3GTPB 1FD7D 1SMYC 4ZUJA 3PF5A 1CK1A 3ND9A 4RCOA 1QILA 2WKCA 4KKTA 2V4DA 4DFAA 2LMCB 1QNUA 1A63A 1DD2A 3P20A 1XWEA 4TVAB 5C5MA 1PZID 1TWGH 2E2IH 4JI1Q 1PXUA 3HOYG 3C1EA 1Y8PB 2B3GA 2L9HA 3KF8B 4IZ8A 3SEBA 4KJNA 4CDDC 1VQ4A 5IYDG 1X3GA 1U4MA 1F9RA 1D8LA 5EGTA 5KEEA 5IGBA 2VZAA 1H9JA 4RHSA 3SDZA 1KHIA 4OONA 3FRPB 3DMUA 3NPPA 1JWUD 4A3BG 2WB1G 4FXDA 3L9AX 2XN9C 4KLKA 1YHBA 4K0KQ 1LO5D 1LT4D 3CCUA 4BY1B 1EY0A 1VQJA 1IBLL 3HKSA 1A6XA 1ZEQX 2ZM6Q 1YITA 1G2TA 4BA2I 2JQOA 2GA4B 1AW7A 2RDGA 2R61A 4X3SA 4ZUIA 4DU9A 4CKEA 2JA7H 2R6GA 1EZ6A 4OL7A 1N32Q 3D4WA 3FHWA 4ALPA 2K5HA 1I94Q 2Q2HA 4BXXH 1HFGA 1YHQA 2V1CC 4QGUA 1HNXL 4A93G 4JI1L 1PTOD 4GN4B 4A3MB 1JE5A 4X64L 4UDUC 1V43A 4C1NK 5J39A 1VQ9A 1EY8A 5IGEA 3K5NA 2RSNA 4EVOA 1VQ7A 4K5VA 1XNQL 1Y1VB 5IT9L 1V1QA 1ONLA 3TRZA 5M3MB 4Z9CB 3Q24A 4LF7Q 1NE3A 3NWSA 1DONA 1STBA 4HTHA 3U9SA 1W3SA 2XSCA 4XT3B 5C3EH 1SRUA 3WDNA 4BA1I 1ASYA 3W1GA 3GTJB 1PMRA 4BS9A 5M5XH 1VF5C 4FXKC 5CV9A 5C44B 4I7AA 5LMNW 3K81C 4H0LC 1Q86C 3HEJA 5FKAC 1EFWA 3TEHB 2XNAC 1C0AA 2Z4IA 4X3UA 1HNZQ 4DGZA 1D5MC 1UWVA 1G2SA 2OQ0A 2KOLA 5LMNQ 1VQCA 2I46A 4QCLA 2B63G 5EBCA 4DR7Q 5M5WH 3AEVA 2EY6A 2LKVA 3H91A 1AP0A 2AKWB 2XRSD 4CDFC 1XNRQ 1D5ZC 5DAUA 4OIKA 5ELOA 4LFAQ 1SFOH 4LMQD 3CAMA 3GTQH 5C4XB 1F9SA 2WAQG 4KJOA 1S4ZA 4IALA 4DV7L 1BQQT 1TS3A 5D3DA 4EQOA 1NAPA 4JBJA 5M3FB 4HJAA 5FO9B 3MFGA 3BZCA 3CF5A 1HFNA 5BN3A 1A3TA 4PV1C 2CFMA 2SDFA 2FXQA 3I4MG 2B29A 2EYOA 3I8ZA 2K32A 3F8TA 4QL5A 3GP7A 2N55A 1HZAA 4GLAC 1F2MA 3HOXG 4IJLA 1UEBA 2ZJQA 4UP8A 1RCVD 2XGTA 4WJWA 2BE5D 3ND8A 2K7VA 3AFPA 1R9TH 3T53B 2ZTEA 1OXUA 5KRUA 4FYDA 1LT6D 4KY6A 4RKBA 4AIMA 3S1QB 1E24A 1C9OA 4POGA 4A3GB 2LSSA 3DHQA 1W2BA 2B2YC 3FDTA 2F0TA 4RWSC 3L7ZC 4X62L 3GO5A 4ZKBB 1Y14B 2MO1A 4G7ZC 4ZYSA 4A3JH 4KD3A 1A62A 2ID0A 3OTOL 1SDFA 3RNUA 2UXDL 3CRLC 4RGNA 5E4WC 4LF7L 3D0FA 4OX9L 1G91A 4M8AA 2O2LD 2RKSA 5C0XJ 3QIAA 4BBRH 4DR2Q 3C46A 2EQSA 1D6EC 4LF6L 1ENCA 2QDLA 3CQZB 1UE7A 1OXVA 2C9OA 4RG1A 1S5ED 2M2LA 4LF8L 4QQBX 4A3GH 2PPBC 1ICWA 2KVMA 3G7LA 4IPDA 4A75A 3I56A 3GQBA 1GHJA 1A3UA 1X3FA 1Z47A 3A5ZB 4RA8A 5C6AA 1LM0A 1TXYA 1R9TB 3PIO3 2NVXB 3S15B 3SK4A 1EQQA 3FKIH 2LFNA 3GDEA 2A6EC 3FKIB 3K7AH 1MBYA 1F9QA 5C4HA 1N34Q 3HOWH 1LLRD 3S2DH 3CHBD 1JMCA 1OO9B 1KLUD 1VQIA 1YEZA 2L15A 4JOIA 2D5DA 3H0GH 3D6WA 4C3JB 3UDGA 3HOVB 2QW7A 2Q8TA 1PFMA 1YI2A 1SYGA 1Q81C 4ZKCB 3CPFA 1I6HB 3DEPA 3BVZA 3HOYH 2VUMB 5KNCA 4BBRB 2CCZA 2HHHL 2EY5A 4YWKA 1YZ6A 1B3AA 1MJCA 2GN5A 4A3EB 2F0DA 3KF6A 1HR0W 2FHTA 2KBNA 3J80L 1KDCA 4J1MA 1SYFA 2NVYB 4XT1B 1KAAA 1KRTA 1VQPA 3MAQA 3TS0A 2EJFC 2ZJPA 4DV5Q 3N6RA 4FO2A 4B3TQ 3C2PA 4IN3A 4DK3C 1O7YA 2VXWA 4LWCA 1KC8C 4UHVA 2L1BA 1CA5A 2L0CA 3CCVA 1GOZA 1UE5A 2QEXA 1M90C 2OWOA 3E5SA 3PMFA 1WD1A 2A19A 5I4DA 3NEMA 2QKIC 1QVGA 4NKLA 4XQNA 2F0EA 3FP9A 4OHJA 4A3EG 3G6EA 1MIUA 4ZAIA 3I4NB 2L11A 2R92B 1PH3A 2KCCA 5K36H 3FEWX 4DK1A 5IY0A 4DV6L 4FXGC 4LF9Q 5DM63 5IP7H 5IP7G 1S72A 4AQYQ 1PTOF 3NSWA 2NZ1D 5C3EB 1MJEA 3O13A 4C3JH 1XMOQ 1LV9A 3HOVH 2BDOA 4A93H 1STHA 4JVZA 3J80c 3HKZE 5D3IB 2HD3A 4MZ9A 1WFQA 4QF4A 1XPUA 1L2FA 3TZDA 1VQMA 4KN7C 2E74C 2J4XA 1ML0D 1UUPA 1PH1A 1K8OA 1S5CD 4LJZC 1X32A 3BS1A 1CZGA 1J5EL 2O5JC 2EYHA 3UE1A 1I6VC 1DYQA 4TRDA 1BR9A 3BDOA 1CTMA 4DR3Q 1X6OA 3M9BA 2L55A 5FLXE 1F2LA 3CXCA 4KHVA 4XXEA 4DR1Q 3VR4A 3VR3A 4YWMA 3K0YA 3ICEA 4PMBA 3TP5A 3F1ZA 1K28A 2ZXPA 1QUQA 5D14A 4XTCS 1Y1VH 1CKNA 2UUAL 3MXUA 1MSHA 1LTLA 1NMFA 4DA2A 3PF4A 3I90A 2B8FA 1QZGA 3PUWA 5BN4A 3NBIA 3WOEA 2E2HH 1IYJB 3PV0A 5J1ZA 1L0XB 5IGFA 2OF1A 1HNZL 1STNA 4IUPA 1Q8KA 1QOHA 4P2CB 1KDBA 3HOZB 2HDLA 2TMPA 4DV1L 3I3CA 4X66L 5FOBB 1B8AA 1UNSA 4RHRA 4DV3Q 3NTIA 2VQEL 5C0XH 1GUNA 4KKSA 2JA8H 4DV2Q 3S1QH 2KCTA 3SHLA 3T56B 4A3FG 4DNIA 2VQFL 3GTLH 5CV5A 1D1KA 5LMUL 3LX0A 4X3KA 4EX5A 4GKKL 2DN8A 2KUMA 2EXZA 5DEHA 5C3XA 1HR0Q 1PZKD 2Z9HA 3CW2C 4EQNA 2IL8A 1B1ZA 4A3JG 2Z6BA 4HMIA 1RHPA 4X3TA 4DV4Q 5ELCA 1IKMA 2Q2TA 2JA6B 1L1OC 1O80A 2RQXA 1GUGA 1J5EQ 1N32L 5E4XA 2C5CA 3G48A 5BR8L 4L5QA 2BE5C 4GOPA 3H6MA 3PO2B 2LXKA 2JEBI 4OWTB 4YCVA 3SXHA 3UDXA 3PUZA 2F0KA 5KIXA 5DM73 5CC4A 1WCMG 2E8GA 4LFBQ 3K7UC 1EEFD 1JOKA 4RKLA 3HOXH 4XYQA 4ME3A 3VYTA 4HR7B 5JEAG 2HCIA 1Y8NB 5CMDA 4TQUS 1PRTC 2CQOA 3FVQA 4DR6L 1SYEA 2K01A 3E9IA 1EIFA 4DXFA 1PA6A 4IFDI 3ULLA 4H13C 2RCFA 3QJYA 2NYZD 1CHPD 3VYUA 5ELDA 3BVGA 4MNOA 1PTOB 2OTLA 3HRZC 1XTCD 1FL0A 3I91A 4CKCA 4CDEC 4KY7A 1WD0A 4A3DG 1ILPA 2LS01 5I2XA 2I0QA 2NTSA 3IKJA 5ISRA 3KF8A 1TT2A 2PMZB 2GVBA 2I5MX 3K6OA 2PO4A 2R3ZA 1LTGD 4KHPQ 5IT9c 4A3KG 5IODA 1YNXA 4EQ5A 1Z6HA 4DR7L 1U4LA 2PZUA 1MKHA 3KLWA 4KV6A 4HCSA 4P72A 3HGBA 4NXNQ 4APVA 4JCVE 4RGOS 2UUCQ 3U4VA 2N88A 4F88A 5I2YA 3PIPA 1N9WA 1WCMH 4X65Q 2C35B 1K0SA 4L5SA 3TMEA 3GTJH 3C1FA 3PUXA 1PH6A 1FVIA 1HUNA 2R7ZB 4K5XA 4OX9Q 1FNVA 1STEA 3GTKH 3S2HH 1C4QA 1QB5D 3KFUA 5M3MH 4B9XA 3IRBA 5IGGA 1I4GA 2XWBB 5G3LF 3PSIA 4L5RC 1NSNS 4OGQC 4BBRG 1IYUA 2KCMA 3KYHC 4GS3A 4GNXB 4WFN3 1XPOA 3LNNA 2UXBQ 2MHVA 5IOCA 4DR4Q 1SJED 5IT9E 3UDFA 1RJTA 2A74C 1X3QA 2HIVA 1B50A 2RF4A 2YYZA 1JOOA 3KK7A 1DM0B 1U4RA 2JA7G 4JPBW 4N8FA 1PH8A 1PDQA 4XDXA 5CBAE 2UXCL 1TR5A 2B2TA 3J7YW 3SK5A 1YJ9A 1PH2A 1ASZA 1VDZA 2F0SA 1BF4A 1PRTD 4RH6A 3IAYA 2KA7A 4IQZA 2ICEC 1DJRD 2K4KA 1N36Q 3HS0C 4JI6L 3Q0AA 1RDPD 3TN2A 4ILWA 1EFID 1G6ZA 2NZHA 1BCPF 4F7XA 5JJKA 3H3VC 5F2DA 3KDFA 5JPNC 3CCJA 1BXTA 2JJQA 3CCMA 1D2BA 4C3JG 5CV6A 3HOVG 2NVTB 4DUYL 2NBFA 4C3IB 4KK7A 1CUKA 1YIJA 2HHHQ 2VW9A 1MI2A 1JWSD 1V1PA 2RDFA 3EVQA 1K9MC 1IKLA 3MEHA 5C4JB 3VA7A 1I50B 1LTTD 2WINB 2BH2A 5EPKA 1LTAD 4P73A 2A69C 4E6IA 4KY5A 1UE6A 2MPMA 2J0TD 1AE3A 2PQAB 5C44H 1VQDA 2L4NA 1V9PA 4LFBL 3JC66 1LT5D 1P8LA 1Q1EA 3MXNA 5FLMH 2ZJRA 3GTPH 4PG3A 3GTOH 1BBXC 4GKJQ 3K8AA 2EYMA 3S1MB 2E2DC 1H9KA 1XNRL 3A56A 1BNZA 1JQYD 4B3SQ 4LF5L 1RTOA 2IHFA 1TS5A 4PZ7A 1KIXA 2H5XA 4UPAA 2IJ0A 3E0EA 1PYSB 2QCPX 4IFDH 1MHWC 4C3IG 4N9PA 2WB1B 5FO7B 2UUBL 4ID6A 4B3TL 3S16H 1K83B 2Y0SE 3SGIA 3CMEA 5C5LA 2ZM6L 2I07B 4LUVA 4JW0A 2KEDA 3J81i 2JSOA 1JB7A 5KNDA 2EPBA 3K57A 2X6GA 4PZ6A 4QIWE 5EPLA 4PMCA 2NVXH 4ZQ3A 2R7ZG 3S14B 3TSSA 4ME5A 4NXNL 4DK6C 1WOCA 5CV8A 4P75A 4DK0A 2NB0A 3FPUB 4K8JA 3JAME 3OIPA 4ZCKA 5M5XB 4Y52H 3L0OA 2UUCL 1TS2A 1L1OA 4MHEA 4JBWA 1S40A 1X9NA 3M4YA 3BDLA 4HSVA 4JV5Q 1JWMD 2CWAA 3H0GG 3NQTA 1B9MA 2WP8J 2K5WA 3T4AC 1L0WA 3HOWG 2HIXA 2JA8B 1JE4A 4A3JB 1JORA 3CC4A 3MWYW 3PQIA 4LUZA 2DY8A 5IP9G 1WTRA 2Y0SB 3ZJYC 2WAQE 4Y7NB 2JK8A 2YTXA 3CPWA 3C3LA 4JI0L 2WFWA 4A3IB 3HOZG 1EY5A 4WJ4A 3HG9A 1ET9A 3NWTA 1YVCA 2PZTA 3M4OB 1X56A 3M4OH 1U4PA 3MC0B 3PGZA 4NDXA 2OQKA 3STBD 3S17B 3SVMA 2B2WC 3MEFA 2OXPA 1OXXK 3FKIG 4BBSG 3EFXD 4F87A 1EQRA 2E2IB 1CI3M 4LUOA 1S5DD 4K2LA 3DWAA 3WOFA 3BYYB 2KHJA 1W6JA 4JC0A 2R7FA 1DOMA 3H94A 4DAVA 1K73C 2R93H 1A8VA 1TWAB 3K5MA 1IW7D 5IYDH 4DV4L 4DN4M 1WTHA 1HR0L 4OO1I 2EYPA 3BZKA 3U4ZA 3I73A 2F0HA 2UXBL 1WI5A 1VQEA 1QWYA 1AN8A 5IYBG 1KL9A 1H95A 4ULLA 3A8KE 4NXMQ 2H4OA 5KGUA 3LWUA 4WRDA 5GAEC 3TP7A 4A3KH 1DOKA 3F2BA 4ABNA 4CKBA 5IYCG 4DV0Q 5KNBA 1GVPA 1KXLA 3CC7A 3TS2A 1ZKOA 2WAQB 2CH4A 2VB2X 4LF4L 4IO9A 5ELEA 3CMAA 2AQ1B 5C4XH 3GTQB 2K52A 1H9SA 1SE2A 3W3AA 1YHAA 3MFYA 4Q0FA 3A55A 1Y1WB 2E75C 1ILQA 2KECA 4OXPA 3EIVA 3NE5B 2E5LQ 3S14H 1U0LA 1K8MA 2Z0SA 4IJHA 1BCPB 5A2QL 4V190 4DNTB 2AUJD 4C2MB 3U9OA 3V96A 1HQRD 3W1BA 1H9MA 5IIFA 1HH2P 4JI8L 4R4OA 2B2TC 1EYAA 4IPCA 3STBC 4JI3Q 2UXCQ 5I9PA 2EJGC 1G51A 1WTWA 4A3CH 4L6TB 3Q22A 3S1RB 2SNSA 1AFPA 3D3RA 1QNKA 1V8QA 2A6HC 3HP3A 1CHQD 3MHBA 1G6PA 1KNEA 3DM1A 5EBDA 1PVOA 1FR3A 4NB3A 4C3HB 4OO1G 1B44D 4LFCL 5HY6A 4R8NA 1TWFB 4PNYA 3W2DA 4KKUA 4ZRZA 3EROA 4LK1C 1PH4A 4JI5L 4K6DA 4BY7G 3KLRA 5NUCA 1IL2A 4JBMA 1O7LA 5M9OA 1PH7A 1PFSA 1I3QB 1SR3A 5BN5A 3ZYYX 2HDMA 1JJCB 2QGQA 3MZ5A 2D0OA 1GUWA 2M9VA 4A3KB 2KHIA 1QVFA 3ERQA 1VMPA 2ZXRA 4WJ3M 4G7OC 4CJ0B 4IUQA 1SNPA 1TWHB 2MP1A 4Q5VA 3FPPA 4GOPC 2CKZB 4DV6Q 1HNWL 4J8QA 1JC7A 5LHY1 1CM9A 3TDQA 5JAVA 1VQ5A 5C0XG 2HCCA 4YWLA 1LTSD 1SBBB 1SNQA 2A69D 1HA6A 4J6HA 2XRQD 1V1OA 3H3VH 3KUPA 1BO0A 2PW7A 4DUZL 3NELA 2PYKA 1E22A 3JAMi 1JJ2A 4A3DB 1S3OA 3CCQA 1HZBA 5IWAQ 3AFQA 2F0VA 3JAMc 1EEID 4KHZA 2F0GA 2M00A 1CQFA 3V2TA 2ENBA 3RN2A 3GTGH 1YNND 2KENA 1NMGA 4GNXA 3IFTA 3NHHA 2R93G 2PQEA 3URYA 2EYLA 4GKKQ 5LMUQ 3T1HQ 5A2QE 1VQNA 1IHZA 1MSGA 1NR4A 4DR5Q 4B3ML 3QOJA 3HOYB 3DWPA 4DR4L 1CSPA 1E7ZA 3CD6A 3GV6A 1XMQL 1C8CA 4JI4Q 4A4IA 1JOQA 1NUCA 2DJGC 1VQFA 1IBKQ 4DUYQ 1HXYD 1NTGA 3A8JE 5EAYA 4IUVA 5HGQA 2K50A 3K59A 1RF2D 3RUZA 3GTMB 4A3IH 1F77A 4Y7NH 1E3PA 1B4OA 2LY7A 5GAGC 4CJ1B 2F0OA 1CFMA 1T5EA 3RN5A 2N8NA 4RMFA 3R8BA 1EWCA 2EOTA 2EJMA 3KDFB 4QMGA 3L2PA 1B7YB 3T1YQ 3AQQA 4LNQA 2F0WA 3Q8DA 4RFBA 5AFWA 4R4CA 3GTGB 4HIOA 2VB3X 2R7ZH 2VUMG 1PYWD 3U50C 4NXML 4B3SL 1PTOH 4LF5Q 3PO2G 4B3RQ 1EQVA 2IX0A 3TQYA 4A3LG 2F0IA 4A3DH 3I70A 4X64Q 3KBXA 4YY3L 3R3OA 1BKBA 1TWFH 3K58A 3SR1A 2PI2E 4L5TA 3I4NH 5CYUA 4XQJA 4YCUA 5M5WB 1RODA 2VL6A 4HSPA 2VQFQ 3N52A 4MN3A 2JP1A 2PZWA 2A68D 2N78A 4QJFA 4OIJA 1HJPA 1M8AA 1U5KA 2E2JH 4O42A 2TSSA 2E2JB 3MXGA 1R4QB 1F2ZA 4FF4A 4B08A 1DOLA 3RLNA 3DWQA 1K3RA 3KF6B 1J8IA 3A5UA 1CA6A 2K6AA 2AWOA 5FK9C 3PIOA 1ICFB 3NXWA 1BUVT 2BA1A 1HUMA 4RGTA 2UU9L 1TY0A 1Q90A 3L3OC 4PZ8A 4R9WA 4JI5Q 4I7ZC 4BY7B 4F8MA 3J81j 1SNDA 1MD2D 4OELB 5GROA 1XMQQ 2JA5H 1YJNA 4LFCQ 4HIMA 4DAMA 5JEAJ 3ERSX 2RCNA 5E1FA 1PFNA 1QJOA 4HIKA 2F3WA 2MJ8A 3RD4A 3W5OA 5K36G 3M7GA 3NTKA 3I4LA 3M4QA 5DNFA 5KYLA 4LAAA 1E0BA 3AYHB 3OSOA 4P74A 2K14A 1IYVA 2FFKB 2MUYA 3OOCA 2F0JA 3H3VI 2WACA 4GNXC 1PV4A 4M1UB 1TU2B 1RIPA 4JG2A 1D1IA 2DNCA 4LW1A 4B3RL 4IPGA 1J9OA 2B2UA 1TWAH 1NY4A 2K5DA 1TS4A 2HQLA 2RDHA 2IX3A 1NCVA 1WJJA 2IT1A 4CGYB 4X66Q 1VQ6A 4A3MH 1SJHD 2B63B 3WWVA 4ODGA 3ER0A 4DKAC 4GLXA 4ZK9B 4H02A 1RKNA 3F2DA 3HOUH 3KLSA 2XTIA 5C3WA 5CV7A 1NR2A 1Q1BA 1HCZA 3K7AB 3F2UA 2B2UC 1GUTA 1AZPA 4K0KL 2QEJC 1T9HA 2CW0D 1I50H 4HMJA 3VR2A 3D31A 2A68C 1XMOL 2RBMA 4RGMA 3JAML 1VQLA 2EVBA 1FNWA 2BH8A 3R2TA 4HCEA 4XIGS 3CCRA 4GLVB 1CQVA 2EXDA 4XQQA 2AUKA 1YBYA 1VF7A 2UUAQ 5L37A 1EU4A 2XWJB 3I4OA 4HJ9A 1N33Q 2FINB 3HOZH 3TBIB 1EIGA 5FJ8H 5I9OA 2DUDA 3QB3A 4IPHA 3CCLA 4S3SA 1M1KC 1Q8IA 1E1OA 1C48A 1EIHA 2AQ3B 4X62Q 2KHSA 1HQMC 1EOVA 3I4MH 1G291 4H44C 4DR6Q 1TWCB 4O0AA 1GHKA 1HPCA 2OTJA 1L0YB 4C3HH 2NN6I 5COYA 3MA2B 3M4PA 2PI2A 1PH5A 5H1SE 1FJGL 1X3EA 1EL0A 4C56C 4IUNA 1ENAA 2X69A 2ES2A 2K28A 4O1NA 4A3MG 4L8JA 5HGTA 3E9HA 2HQEA 1I4PA 1STYA 2F3VA 1XYIA 1K3BC 3RR5A 1PHJA 2SEBD 3I72A 4C1NI 2JXMB 2JA5B 1SYDA 5IP9H 1A0IA 1EY6A 1RTNA 4FF1A 5FO8B 5TSSA 5K5PA 5M3FG 2K75A 1FGUA 3ULPA 3J81E 3T13A 2UU9Q 3BZDB 1XPRA 3K5LA 2ZT9C 1KABA 1FNUA 5EKKA 3S9WA 4YY3Q 1EYGA 1SE4A 1HA5A 4OWXB 4KMUC 4UAIA 3D8GA 1BVSA 3P75A 5EKIA 1X65A 4K6LA 4N9TA 4K14A 1YNJD 3HOWB 3MVVA 2B2YA 4DR2L 1VQHA 3FMCA 1A15A 2D0PA 3PO2H 1SNOA 2F0NA 4C2MH 2NVYH 4EQPA 2PQAA 2KQ3A 1S5FD 2PW5A
chains in the Genus database with same CATH topology
2K03A 3Q23A 2ICIA 3P1HA 4FF2A 1PRTB 2NTTA 2A6ED 3DXJC 3M3YB 2AWNA 1SE3A 5M5YB 2IW3A 3SK6A 5IGDA 2A5HA 2G9DA 1F9PA 4U68A 2Q8IB 3A7LA 2BOSA 3RZOB 3J7AV 2FMMA 1EY4A 2FJ2A 1AZQA 2QDBA 1KLGD 3OMCA 3Q6SA 3OHXC 1STAA 4CHTB 3EQLC 3HKZB 1EY9A 1EZ8A 1B2TA 2E2HB 1H9SB 3NBHA 2EZVA 2MGSA 1ENFA 2R93B 3MTSA 1ZYRC 3SE0A 1A2UA 1GUSA 2CQAA 1I4QA 5EQ0A 4YIJA 1OXSC 4QB4A 5CR3A 4IUUA 5JVH3 1SEBD 1LTRD 3BDCA 5G3LD 5KYIA 1BDOA 4TKOB 3BYTB 2OT2A 1DZ1A 4G57A 1IL8A 5ELBA 4FF3A 1WTQA 3SK8A 4H7BA 3EA6A 1GJXA 3NUCA 2EYFA 1ET6A 4PMWA 2L5TA 3OPOA 1WTOA 1KTKA 1LTBD 4A93B 2Z8LA 4PQXA 3PO3B 3VR6A 3QO2A 3EJIA 5CBEE 1SNMA 1KDAA 2XIWA 2F0LA 5CGKA 3J80E 4BBSB 1UEAB 4FVMA 2CVRA 5LL6S 2H1EA 3PUYA 4KD4A 2Q8RE 1E2VA 2CW0C 1LT3D 1A2TA 5ELFA 5LL6X 3GV3A 3QG1A 4RCNA 2B2VA 1WTXA 2ZXOA 2IPKD 1DXMA 3RMHA 1IW7C 2SOBA 2IWHA 2D2CC 2K33A 2F0QA 5HURA 5J22A 5CV4A 5I6WA 2JEAI 4JK1C 3R2IA 5IGCA 1OXTA 3VYRA 1E2ZA 1Z7TA 2K5QA 4DAPA 5C4ZA 1WTVA 1HHVA 1CZWA 1HTLD 5T1IA 1SXTA 2NN6H 3X3NA 3DEOA 1EYDA 2EY1A 4HEDA 5EJWA 1MGSA 1H9RA 3OMGA 3D6CA 2IX1A 3DUZA 3OWFA 3A7AB 4CJ2C 4R8IA 3R93A 3RZDB 2B39A 1G8ZD 1XX8A 4HAEA 2RVLA 1HRJA 2NVQB 1Y69U 5JJZA 3CU7A 1Q12A 1PLFA 1EYCA 3VR5A 4K8IA 2A6HD 4DXGA 1FGBD 1I4XA 4A3FB 4DF7A 2A73B 3NK9A 1TWGB 1R4PB 2KEEA 4A3BB 2D9UA 1YNJC 2F0UA 2F4IA 1BCPD 3V05A 3IL8A 4G7HC 3HZXA 2L12A 3KBGA 1O78A 2RA4A 2PCFB 3S2HB 1PRTF 1B53A 3M85A 4QIWB 1PFBA 1SMYD 3M7NA 5JPMC 1I4HA 2O5IC 3PIP3 3RLFA 1T5XD 2F0PA 1II3A 4QUCA 5I6YA 1WTPA 1DCZA 3QWNA 4ZLTF 3TP6A 4IFDG 1VCIA 2QF7A 3AU7A 3QOLA 1ZXTA 2X6LA 2O4XA 2AQ2B 2NN6G 2YU9B 4RAUC 3LWEA 3K5OA 4QUFA 3CKIB 4U673 2KCNA 1LACA 3VYSA 2WIIB 3OIQA 5JEAH 3E6ZX 2F0FA 1JB3A 1QCBD 3NP8A 2WKDA 2EE1A 3BG3A 4G4KA 1ZYRD 2KJXA 1KNAA 3NTHA 5JVG3 3KLSX 2XVSA 1F2YA 1D5XC 3J7AF 3E0JA 1JR0D 3A8IE 2K04A 2BDNA 3GTLB 3HOXB 1E2WA 1S5BD 1AEXA 3G6JB 4IURA 1LTID 2BA0A 3ITPA 3I4MB 4AYBB 5EKLA 3S1NB 1SAPA 4FNFA 1XXGA 1EU3A 1U9RA 4CBVA 1TVXA 1EOTA 1SYBA 5C0XI 1HTPA 4V0BA 5JOBA 4GZYC 1SSOA 2HUGA 1QE6A 3P7JA 1JCKB 1M4VA 2K05A 3H0GB 1RD9D 2NWGA 2G9HD 1O7ZA 4NW2A 3GD7A 3S2DB 2F1MA 1UAPA 2Z4HA 2JA7B 3TP8A 3NQIA 3PUVA 2OEOA 4KI0A 5EPJA 4IUTA 4DNRB 1CT1D 1A3VA 4DAYA 3A54A 5E3FA 2JE6I 2DNEA 2E76C 1TIID 1JICA 1Q3LA 1EY7A 2EDGA 3X3MA 3BVMA 2BCOA 2JYOA 2B2VC 1FYCA 3HOUB 1GUOA 4B9WA 4I65A 4L63B 3AMUA 1VMCA 1WVLA 3GTKB 3TZUA 1GXDC 2QILA 2WV6D 3IFDA 1W6KA 2PNRC 2FMCA 2NUCA 3D4RA 2Z1CA 1Y8OB 4K2KA 4TSSA 4WORA 1YNNC 1QG7A 1STGA 4FP5D 1BOSA 1TY2A 3VA5A 1ESRA 3OWEB 2J7ZA 2F0MA 4NP5A 2D62A 1X3PA 2VNUD 1SYCA 5D65A 3GTOB 1TKWB 4OO1H 4K5WA 2RSOA 5FLXL 3CRKC 3AB9A 3MXPA 1SFOB 2EY2A 1LABA 1WCMB 5CORA 1ESFA 2CHBD 1EWHA 4NMZA 2F03A 4EGVA 4IFDJ 4BWGB 1V1PB 2DY7A 4KTAA 2SNMA 4KN4C 2EYJA 1BCPC 2B2WA 1TQOA 2B8GA 1PTOC 1I4RA 1SNCA 3ONAB 3S16B 1PZJD 3H09A 1B9NA 3OW7A 2K1BA 5T1GA 3T51B 4XYOA 3J81L 3D4DA 3UI2A 1EQTA 4C3HG 3T16A 4MIUA 5A35A 4HN7A 3GTPB 1FD7D 1SMYC 4ZUJA 1CK1A 3ND9A 4RCOA 1QILA 2WKCA 4KKTA 2V4DA 4DFAA 2LMCB 1QNUA 1DD2A 3P20A 1XWEA 5C5MA 1PZID 1PXUA 3C1EA 1Y8PB 2L9HA 4IZ8A 3SEBA 4KJNA 1U4MA 1F9RA 5EGTA 5KEEA 5IGBA 1H9JA 4RHSA 3SDZA 3FRPB 3DMUA 3NPPA 1JWUD 4FXDA 3L9AX 2XN9C 1LO5D 1LT4D 4BY1B 1EY0A 1A6XA 1ZEQX 1G2TA 4BA2I 2GA4B 1AW7A 2RDGA 2R61A 4X3SA 4ZUIA 4DU9A 4CKEA 2R6GA 1EZ6A 4OL7A 3D4WA 1HFGA 1PTOD 4A3MB 4UDUC 1V43A 4C1NK 5J39A 1EY8A 5IGEA 3K5NA 2RSNA 4EVOA 4K5VA 1Y1VB 5IT9L 1ONLA 5M3MB 4Z9CB 3Q24A 3NWSA 1DONA 1STBA 4HTHA 3U9SA 2XSCA 4XT3B 3WDNA 4BA1I 3GTJB 1PMRA 4BS9A 1VF5C 4FXKC 5CV9A 5C44B 4H0LC 3HEJA 5FKAC 2XNAC 2Z4IA 4X3UA 4DGZA 1D5MC 1G2SA 2KOLA 2I46A 4QCLA 5EBCA 2EY6A 2LKVA 3H91A 1AP0A 2XRSD 1D5ZC 5DAUA 4OIKA 4LMQD 5C4XB 1F9SA 4KJOA 1S4ZA 4IALA 1BQQT 1TS3A 5D3DA 4EQOA 1NAPA 5M3FB 5FO9B 3MFGA 1HFNA 5BN3A 1A3TA 4PV1C 2SDFA 2EYOA 3I8ZA 2K32A 3GP7A 2N55A 1F2MA 1RCVD 4WJWA 2BE5D 2K7VA 3ND8A 3T53B 1OXUA 5KRUA 4FYDA 1LT6D 4KY6A 4RKBA 3S1QB 4A3GB 3DHQA 2B2YC 3FDTA 2F0TA 4RWSC 3L7ZC 3GO5A 4ZKBB 4G7ZC 4ZYSA 4KD3A 2ID0A 1SDFA 3CRLC 4RGNA 5E4WC 1G91A 4M8AA 2O2LD 2RKSA 5C0XJ 3QIAA 3C46A 1D6EC 1ENCA 3CQZB 1OXVA 2C9OA 1S5ED 2M2LA 2PPBC 1ICWA 2KVMA 3G7LA 3GQBA 1GHJA 1A3UA 1Z47A 4RA8A 5C6AA 1R9TB 3PIO3 2NVXB 3S15B 3SK4A 2LFNA 2A6EC 3FKIB 1MBYA 1F9QA 5C4HA 1LLRD 3CHBD 1OO9B 1KLUD 2D5DA 3D6WA 4C3JB 3HOVB 2Q8TA 1PFMA 1SYGA 4ZKCB 1I6HB 3DEPA 3BVZA 2VUMB 5KNCA 4BBRB 2EY5A 1B3AA 4A3EB 2F0DA 2FHTA 3J80L 1KDCA 4J1MA 1SYFA 2NVYB 4XT1B 1KAAA 3MAQA 2EJFC 3N6RA 4FO2A 3C2PA 4IN3A 1O7YA 2VXWA 1CA5A 2L1BA 2L0CA 1GOZA 3E5SA 3PMFA 1WD1A 5I4DA 2QKIC 4NKLA 4XQNA 2F0EA 4OHJA 4ZAIA 3I4NB 2L11A 2R92B 2KCCA 5K36H 3FEWX 4DK1A 4FXGC 5DM63 1PTOF 3NSWA 2NZ1D 5C3EB 3O13A 1LV9A 2BDOA 1STHA 5D3IB 4QF4A 3TZDA 4KN7C 2E74C 2J4XA 1ML0D 1UUPA 1K8OA 1S5CD 4LJZC 1X32A 3BS1A 1CZGA 2O5JC 2EYHA 1I6VC 1DYQA 4TRDA 1BR9A 3BDOA 1CTMA 2L55A 5FLXE 1F2LA 4KHVA 4XXEA 3VR4A 3VR3A 3K0YA 4PMBA 3TP5A 2ZXPA 5D14A 4XTCS 3MXUA 1MSHA 4DA2A 3I90A 2B8FA 3PUWA 5BN4A 3NBIA 3WOEA 3PV0A 5J1ZA 1L0XB 5IGFA 2OF1A 1STNA 4IUPA 1QOHA 4P2CB 1KDBA 3HOZB 2HDLA 2TMPA 3I3CA 5FOBB 1UNSA 4RHRA 3NTIA 5C0XH 1GUNA 4KKSA 3SHLA 3T56B 5CV5A 1D1KA 3LX0A 4X3KA 2DN8A 2KUMA 2EXZA 5DEHA 5C3XA 1PZKD 4EQNA 2IL8A 1B1ZA 4HMIA 1RHPA 4X3TA 5ELCA 1IKMA 2JA6B 1O80A 2RQXA 1GUGA 5E4XA 2C5CA 2BE5C 3H6MA 3PO2B 2JEBI 3SXHA 5KIXA 3PUZA 2F0KA 5DM73 5CC4A 1EEFD 1JOKA 4RKLA 4XYQA 3VYTA 4HR7B 5JEAG 2HCIA 1Y8NB 5CMDA 4TQUS 1PRTC 3FVQA 1SYEA 2K01A 4DXFA 4IFDI 4H13C 3QJYA 2NYZD 1CHPD 3VYUA 5ELDA 3BVGA 1PTOB 3HRZC 1XTCD 3I91A 4CKCA 4KY7A 1WD0A 1ILPA 2LS01 5I2XA 2NTSA 3IKJA 5ISRA 3KF8A 1TT2A 2PMZB 3K6OA 2PO4A 2R3ZA 1LTGD 5IODA 1Z6HA 1U4LA 2PZUA 4KV6A 4HCSA 3HGBA 4RGOS 2N88A 4F88A 5I2YA 3TMEA 3C1FA 3PUXA 1HUNA 2R7ZB 4K5XA 1FNVA 1STEA 1C4QA 1QB5D 4B9XA 5IGGA 1I4GA 2XWBB 5G3LF 1NSNS 4OGQC 1IYUA 4WFN3 3LNNA 2MHVA 5IOCA 1SJED 5IT9E 1RJTA 2A74C 1X3QA 1B50A 2YYZA 1JOOA 3KK7A 1DM0B 1U4RA 1PDQA 4XDXA 5CBAE 1TR5A 2B2TA 3J7YW 3SK5A 1VDZA 2F0SA 1BF4A 1PRTD 4RH6A 3IAYA 2KA7A 4IQZA 2ICEC 1DJRD 3HS0C 3Q0AA 1RDPD 3TN2A 4ILWA 1EFID 1G6ZA 1BCPF 4F7XA 3H3VC 5F2DA 5JPNC 1BXTA 1D2BA 4C3JG 5CV6A 2NVTB 2NBFA 4C3IB 4KK7A 1MI2A 1JWSD 1V1PA 2RDFA 3EVQA 1IKLA 3MEHA 5C4JB 3VA7A 1I50B 1LTTD 2WINB 5EPKA 1LTAD 4E6IA 2A69C 4KY5A 2MPMA 2J0TD 2L4NA 1LT5D 1Q1EA 3MXNA 1BBXC 2EYMA 3S1MB 2E2DC 1H9KA 1BNZA 3A56A 1JQYD 1RTOA 1TS5A 2IJ0A 2QCPX 4IFDH 4C3IG 4N9PA 2WB1B 5FO7B 4ID6A 1K83B 5C5LA 2I07B 2KEDA 2JSOA 5KNDA 2EPBA 3K57A 2X6GA 5EPLA 4PMCA 4ZQ3A 3S14B 3TSSA 4ME5A 5CV8A 4DK0A 2NB0A 3FPUB 4K8JA 3JAME 3OIPA 5M5XB 1TS2A 4MHEA 4JBWA 3M4YA 3BDLA 4HSVA 1JWMD 3NQTA 1B9MA 2WP8J 2K5WA 3T4AC 2JA8B 1JE4A 4A3JB 1JORA 3MWYW 2DY8A 1WTRA 2Y0SB 4Y7NB 3C3LA 4A3IB 1EY5A 3HG9A 1ET9A 3NWTA 2PZTA 3M4OB 1U4PA 3MC0B 4NDXA 3S17B 3SVMA 2B2WC 2OXPA 1OXXK 3EFXD 4F87A 2E2IB 1CI3M 1S5DD 4K2LA 3DWAA 3WOFA 3BYYB 1W6JA 3H94A 1DOMA 4DAVA 1TWAB 3K5MA 1IW7D 4DN4M 4OO1I 2EYPA 3I73A 2F0HA 1QWYA 1AN8A 4ULLA 3A8KE 2H4OA 5KGUA 3LWUA 4WRDA 3TP7A 1DOKA 4ABNA 4CKBA 5KNBA 1ZKOA 2WAQB 2VB2X 5ELEA 2AQ1B 3GTQB 1H9SA 1SE2A 3W3AA 3MFYA 4Q0FA 1Y1WB 3A55A 2E75C 1ILQA 2KECA 3NE5B 1K8MA 1BCPB 5A2QL 4V190 4DNTB 2AUJD 4C2MB 3U9OA 3V96A 1HQRD 1H9MA 5IIFA 2B2TC 1EYAA 5I9PA 2EJGC 1WTWA 4L6TB 3Q22A 3S1RB 2SNSA 1AFPA 3D3RA 1QNKA 1V8QA 2A6HC 3HP3A 1CHQD 3MHBA 1KNEA 3DM1A 5EBDA 1FR3A 4C3HB 4OO1G 1B44D 4R8NA 1TWFB 4PNYA 3W2DA 4KKUA 4ZRZA 3EROA 4LK1C 4K6DA 3KLRA 5NUCA 1O7LA 5M9OA 1I3QB 5BN5A 3ZYYX 2HDMA 3MZ5A 1GUWA 2M9VA 4A3KB 3ERQA 1VMPA 2ZXRA 4G7OC 4CJ0B 4IUQA 1SNPA 1TWHB 2MP1A 4Q5VA 3FPPA 4J8QA 1JC7A 5LHY1 1CM9A 3TDQA 5JAVA 5C0XG 2HCCA 1LTSD 1SNQA 1SBBB 2A69D 1HA6A 4J6HA 2XRQD 1V1OA 3KUPA 1BO0A 2PW7A 2PYKA 4A3DB 2F0VA 1EEID 4KHZA 2F0GA 2M00A 1CQFA 3V2TA 2ENBA 1YNND 3IFTA 3NHHA 2PQEA 3URYA 2EYLA 5A2QE 1IHZA 1MSGA 1NR4A 3QOJA 3HOYB 3DWPA 3GV6A 1C8CA 1JOQA 1NUCA 1HXYD 3A8JE 4IUVA 3K59A 1RF2D 3GTMB 3RUZA 1F77A 1B4OA 2LY7A 4CJ1B 2F0OA 1CFMA 1T5EA 3R8BA 1EWCA 2EOTA 2EJMA 4QMGA 2F0WA 4RFBA 5AFWA 3GTGB 2VB3X 1PYWD 1PTOH 1EQVA 2IX0A 2F0IA 3I70A 3KBXA 3R3OA 3K58A 3SR1A 5CYUA 4XQJA 5M5WB 1RODA 4HSPA 3N52A 4MN3A 2JP1A 2PZWA 2A68D 4OIJA 1M8AA 4O42A 2TSSA 2E2JB 3MXGA 1R4QB 1F2ZA 4FF4A 4B08A 1DOLA 3DWQA 1J8IA 1CA6A 2K6AA 2AWOA 5FK9C 3NXWA 1BUVT 2BA1A 1HUMA 4RGTA 1TY0A 1Q90A 3L3OC 4R9WA 4BY7B 4I7ZC 4F8MA 1SNDA 1MD2D 5JEAJ 5E1FA 1PFNA 1QJOA 2F3WA 2MJ8A 3RD4A 5K36G 3M7GA 3NTKA 3I4LA 5DNFA 5KYLA 4LAAA 1E0BA 3OSOA 1IYVA 2FFKB 2MUYA 3OOCA 2F0JA 2WACA 4M1UB 1TU2B 1D1IA 2DNCA 1J9OA 2B2UA 2K5DA 1TS4A 2RDHA 2IX3A 1NCVA 2IT1A 4CGYB 1SJHD 2B63B 4ODGA 4ZK9B 1RKNA 3KLSA 5C3WA 5CV7A 1NR2A 1Q1BA 1HCZA 3K7AB 3F2UA 2B2UC 1GUTA 1AZPA 2QEJC 2CW0D 4HMJA 3VR2A 3D31A 2A68C 2RBMA 4RGMA 3JAML 2EVBA 1FNWA 3R2TA 4HCEA 4XIGS 1CQVA 4XQQA 2AUKA 1VF7A 1EU4A 2XWJB 2FINB 3TBIB 1EIGA 5I9OA 3QB3A 4S3SA 1Q8IA 1C48A 1EIHA 2AQ3B 2KHSA 1HQMC 1G291 4H44C 1TWCB 1GHKA 1HPCA 1L0YB 2NN6I 5COYA 3MA2B 1EL0A 4C56C 4IUNA 1ENAA 2X69A 2K28A 4O1NA 4L8JA 5HGTA 2HQEA 1I4PA 1STYA 2F3VA 1XYIA 2SEBD 3I72A 4C1NI 2JXMB 2JA5B 1SYDA 1EY6A 1RTNA 4FF1A 5FO8B 5TSSA 5K5PA 3J81E 3T13A 3BZDB 3K5LA 2ZT9C 1KABA 1FNUA 5EKKA 3S9WA 1SE4A 1HA5A 4KMUC 4UAIA 3D8GA 3P75A 5EKIA 4K6LA 4N9TA 4K14A 1YNJD 3HOWB 3MVVA 2B2YA 3FMCA 1A15A 1SNOA 2F0NA 4EQPA 2KQ3A 1S5FD 2PW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A3U A;  1JOO A;  1SNQ A;  1F2Z A;  4J6H A;  3P1H A;  4B9W A;  4I65 A;  3H6M A;  5C6A A;  3SXH A;  4ZUJ A;  5KIX A;  2PW7 A;  2F0K A;  4PMC A;  2EYH A;  2PYK A;  5CV9 A;  4ZQ3 A;  5CC4 A;  5I9O A;  3EJI A;  3SK4 A;  5KGU A;  3HEJ A;  1TR5 A;  3QB3 A;  1SNM A;  4ME5 A;  4WRD A;  1KDA A;  4TRD A;  1JOK A;  3SK5 A;  3TP7 A;  4DFA A;  4RKL A;  2F0L A;  1EYC A;  1F2Y A;  2F0V A;  2F0S A;  4S3S A;  5CV8 A;  4DGZ A;  4K8I A;  3NXW A;  5CGK A;  5C4H A;  5IGD A;  4K8J A;  3SK6 A;  2F0G A;  2M00 A;  5C5M A;  3V2T A;  2ENB A;  3NHH A;  2NUC A;  2EY6 A;  2LKV A;  2KHS A;  4K2K A;  3C1E A;  2PQE A;  4KHV A;  4F8M A;  4WOR A;  1SYE A;  1SND A;  2EYL A;  4IZ8 A;  4KD4 A;  4KJN A;  4DF7 A;  1AEX A;  3BDL A;  5DAU A;  3NK9 A;  4PMB A;  1IHZ A;  1SYG A;  3TP5 A;  1A2T A;  5EGT A;  5KEE A;  2F0U A;  3NQT A;  3QOJ A;  5IGB A;  1STG A;  4KJO A;  1EY4 A;  4F7X A;  4IAL A;  5F2D A;  5E1F A;  3ITP A;  2QDB A;  4EQO A;  3VA5 A;  3OMC A;  5CV6 A;  3DMU A;  2F3W A;  1JOQ A;  1NUC A;  5EKL A;  1STA A;  2EY5 A;  2F0M A;  4NP5 A;  5KYL A;  4LAA A;  1JOR A;  1A3T A;  3HZX A;  4KY7 A;  2RDF A;  1EY9 A;  3EVQ A;  1U9R A;  1SYC A;  1ENA A;  1EZ8 A;  3OSO A;  2F0D A;  4IUN A;  1SYB A;  2SOB A;  3RUZ A;  3U9O A;  5ISR A;  1TT2 A;  2EYO A;  1KDC A;  2F0Q A;  5HUR A;  3MEH A;  2F0J A;  1SYF A;  4J1M A;  5IIF A;  1KAA A;  2WAC A;  1EY5 A;  1EY0 A;  4K5W A;  5JOB A;  5HGT A;  5J22 A;  1EYA A;  2PZT A;  5CV4 A;  5I9P A;  2F0O A;  1F2M A;  5J1Z A;  5I6W A;  5IOD A;  5IGF A;  2OF1 A;  2HQE A;  3MXP A;  1STY A;  4NDX A;  1STN A;  2EY2 A;  2PZU A;  4E6I A;  2F3V A;  4KV6 A;  5IGC A;  4KY5 A;  2SNS A;  1KDB A;  4ZUI A;  4QMG A;  4DU9 A;  4NMZ A;  2OXP A;  5C4Z A;  1EZ6 A;  1SYD A;  3MHB A;  2F0W A;  1A2U A;  4OL7 A;  5KRU A;  1EY6 A;  4YIJ A;  3D4W A;  4QB4 A;  3E5S A;  3PMF A;  5CR3 A;  4KY6 A;  4RKB A;  5K5P A;  4R8N A;  4ODG A;  4PNY A;  4NKL A;  3BDC A;  3ERO A;  3TME A;  3C1F A;  3DHQ A;  4K2L A;  2F0E A;  4K6D A;  1EQV A;  3SHL A;  5NUC A;  2F0T A;  1RKN A;  2F0P A;  3T13 A;  1EYD A;  2F0I A;  1II3 A;  4KTA A;  5C3W A;  5CV5 A;  3TP8 A;  5KYI A;  2EYM A;  5CV7 A;  5M9O A;  3LX0 A;  5I6Y A;  2EY1 A;  2OEO A;  2SNM A;  4KD3 A;  2EYJ A;  1KAB A;  3R3O A;  4K5X A;  2EXZ A;  1TQO A;  5EKK A;  3TP6 A;  5DEH A;  3S9W A;  5J39 A;  5C3X A;  1EY8 A;  4G57 A;  3QOL A;  3MZ5 A;  1SNC A;  1A3V A;  3SR1 A;  5IGE A;  3OMG A;  3D8G A;  5JAV A;  5E3F A;  2O4X A;  3P75 A;  3D6C A;  4B9X A;  5IGG A;  4HMJ A;  4N9T A;  3SK8 A;  2RKS A;  4K14 A;  4EQN A;  4H7B A;  4EVO A;  4K5V A;  1NSN S;  3ERQ A;  3NUC A;  2RBM A;  4N9P A;  2EYF A;  4HMI A;  3MVV A;  1SNP A;  4ID6 A;  3D4D A;  1ENC A;  2PZW A;  3OWF A;  1STH A;  2EYP A;  1SNO A;  2F0N A;  4QF4 A;  1STB A;  2F0F A;  1EY7 A;  2F0H A;  3NP8 A;  4HTH A;  3T16 A;  4EQP A;  5IOC A;  4MIU A;  2KQ3 A;  5C5L A;  2PW5 A; 
#chains in the Genus database with same CATH topology
 2K03 A;  3Q23 A;  2ICI A;  3P1H A;  2F4V Q;  4FF2 A;  5BR8 Q;  1PRT B;  2NTT A;  2A6E D;  3DXJ C;  3M3Y B;  2AWN A;  1NJI C;  2Y0S G;  1SE3 A;  4JOI C;  5M5Y B;  3A0J A;  2IW3 A;  2YTY A;  3SK6 A;  5IGD A;  2A5H A;  1KRS A;  2G9D A;  1F9P A;  1CKN B;  1YJW A;  4U68 A;  2Q8I B;  2Z6K C;  3BJU A;  1QVC A;  3A7L A;  1N36 L;  2WB1 E;  4R4I A;  1OTC A;  4A3B H;  2N3S A;  1SLJ A;  1NBW A;  2BOS A;  3RZO B;  3J7A V;  2FMM A;  1EY4 A;  2FJ2 A;  4A3F H;  1AZQ A;  2QDB A;  2E5L L;  1KLG D;  1CKM A;  3OMC A;  4A76 A;  3Q6S A;  5C4J H;  3OHX C;  1STA A;  4CHT B;  3EQL C;  3HKZ B;  4JI7 L;  4LF8 Q;  1EY9 A;  1IBM L;  1EZ8 A;  5M3M G;  1B3Q A;  2NVT H;  1B2T A;  2E2H B;  1H9S B;  3NBH A;  2EZV A;  2MGS A;  1ENF A;  4R4Q A;  2R93 B;  3MTS A;  4DAY B;  3RZO H;  1ZYR C;  1IZ6 A;  1K0R A;  3SE0 A;  4YCW A;  1A2U A;  1GUS A;  2CQA A;  1I4Q A;  5EQ0 A;  4YIJ A;  1OXS C;  4QB4 A;  5CR3 A;  4IUU A;  1JJG A;  5JVH 3;  1SEB D;  2A8V A;  1LTR D;  4X65 L;  3BDC A;  2DJF C;  4P71 A;  1KD1 C;  5G3L D;  2IY5 B;  5KYI A;  1BDO A;  4IOA A;  4TKO B;  3BYT B;  2OT2 A;  2R7D A;  1DZ1 A;  4G57 A;  1IL8 A;  3E3X A;  5ELB A;  2K5V A;  1KAW A;  3CP0 A;  1WTQ A;  4OEM B;  4FF3 A;  3SK8 A;  1K8G A;  1C7Y A;  2MO0 A;  4H7B A;  3EA6 A;  1GJX A;  3NUC A;  2EYF A;  1E1T A;  1ET6 A;  4PMW A;  2L5T A;  4YHH Q;  1EWI A;  3OPO A;  1X54 A;  1DGS A;  1WTO A;  4DV1 Q;  1KTK A;  1LTB D;  4A93 B;  4HID A;  1IBL Q;  2Z8L A;  5J3B A;  4PQX A;  4JI3 L;  3PO3 B;  4HJ7 A;  2CH4 W;  3VR6 A;  2VQE Q;  5M3F H;  3QO2 A;  4A3C G;  2OCE A;  3EJI A;  5CBE E;  1I3Q H;  1SNM A;  1KDA A;  2NVQ H;  2XIW A;  2F0L A;  4DV3 L;  5CGK A;  3J80 E;  4BBS B;  1UEA B;  4UY8 C;  4FVM A;  1CSQ A;  2CVR A;  5LL6 S;  2H1E A;  1Q82 C;  3HFZ B;  3PUY A;  4KD4 A;  2Q8R E;  5E7N A;  1E2V A;  2CW0 C;  4MTN A;  1LT3 D;  3OYY A;  1A2T A;  3K80 C;  5ELF A;  4JI7 Q;  5LL6 X;  1SMX A;  2RHS B;  3GV3 A;  3QG1 A;  4RCN A;  1VQ8 A;  2DGY A;  2B2V A;  1WTX A;  5C4X G;  2ZXO A;  2IPK D;  1DXM A;  3RMH A;  1IW7 C;  2SOB A;  3EN2 A;  2IWH A;  2D2C C;  2PNH A;  2K33 A;  2R92 G;  2F0Q A;  5HUR A;  4DV7 Q;  1EUJ A;  5ELN A;  3F2C A;  5J22 A;  5CV4 A;  5IYC H;  3BU2 A;  3PO3 H;  5I6W A;  3PO3 G;  3MXN B;  4JYA L;  2JEA I;  4JK1 C;  3R2I A;  5IGC A;  1OXT A;  3VYR A;  1E2Z A;  1Z7T A;  2K5Q A;  4DAP A;  5C4Z A;  4DR3 L;  1VS0 A;  2AHO B;  4GN3 B;  5LMN L;  4JI2 L;  5FJ8 G;  1WTV A;  1WYD A;  4AYB G;  1HHV A;  4DV2 L;  1CZW A;  1HTL D;  5T1I A;  1SXT A;  2NN6 H;  4R1J A;  1VQG A;  3X3N A;  3DEO A;  1EYD A;  3PCO B;  2EY1 A;  4HED A;  5EJW A;  4A3G G;  1MGS A;  2A1A A;  2Q2I A;  4BY1 G;  1H9R A;  3OMG A;  3D6C A;  2IX1 A;  2JA9 A;  2ALY B;  4A3L H;  3DUZ A;  3OWF A;  3A7A B;  3GTM H;  4CJ2 C;  1KQS A;  2PMZ E;  1IBM Q;  4R8I A;  3R93 A;  3RZD B;  2B39 A;  1G8Z D;  1XX8 A;  2NZO A;  1X55 A;  4HAE A;  3H15 A;  2VUM H;  2RVL A;  1N33 L;  3CQZ H;  1HRJ A;  2NVQ B;  1I6H H;  4AH6 A;  1Y69 U;  1HZ9 A;  5JJZ A;  4JYA Q;  2CWP A;  3CU7 A;  1Q12 A;  1PLF A;  4HJ8 A;  1EYC A;  3VR5 A;  4K8I A;  5GQO A;  2A6H D;  1AH9 A;  4DXG A;  2G5D A;  4DUZ Q;  1RL2 A;  1FGB D;  1I5F A;  1I4X A;  4A3F B;  4DF7 A;  3OTO Q;  5IWA L;  1TWH H;  2A73 B;  3NBH B;  2ASB A;  2UXD Q;  3NK9 A;  1TWG B;  1R4P B;  1Z9F A;  2F52 A;  2KEE A;  4A3B B;  3S17 H;  2D9U A;  1YNJ C;  2F0U A;  4LFA L;  2F4I A;  1BCP D;  3DLL A;  4GOP B;  3U58 A;  2JN4 A;  3V05 A;  3IL8 A;  4G7H C;  3HZX A;  2L12 A;  2EIF A;  3KBG A;  2YV5 A;  4B3M Q;  4HJ5 A;  1O78 A;  4JI0 Q;  2VS1 A;  2RA4 A;  1GO3 E;  2MQH A;  3UDI A;  4IOC A;  3J7A 5;  2PCF B;  3S2H B;  1PRT F;  1B53 A;  3M85 A;  2B63 H;  1Q7Y C;  4QIW B;  2ZTD A;  1PFB A;  2JA6 G;  1NNX A;  1SMY D;  5M5Y H;  3M7N A;  1QUQ B;  4LF9 L;  2I5L X;  3LGJ A;  5JPM C;  1BBU A;  1N8R C;  1I4H A;  2O5I C;  3PIP 3;  1K83 H;  3RLF A;  1T5X D;  3QR8 A;  1JT8 A;  2F0P A;  2F3I A;  1II3 A;  4QUC A;  4GKJ L;  2YTV A;  5I6Y A;  1WTP A;  1DCZ A;  3QWN A;  3TP6 A;  4ZLT F;  4IFD G;  1VCI A;  3AU7 A;  1AE2 A;  2IHE A;  2QF7 A;  3QOL A;  3KJO A;  4DPG A;  1ZXT A;  2K5N A;  1Y1W H;  1Y1W G;  2X6L A;  2O4X A;  2AQ2 B;  2NN6 G;  1SE8 A;  3A74 A;  3VDY A;  2AMC B;  4RAU C;  3J80 i;  2YU9 B;  3LWE A;  3K5O A;  4QUF A;  2JA5 G;  2VY3 A;  3CKI B;  4UP7 A;  3CCE A;  5JJI A;  4U67 3;  2KCN A;  2F4V L;  1LAC A;  3VYS A;  3TRE A;  2WII B;  3OIQ A;  1GD7 A;  5JEA H;  3E6Z X;  2F0F A;  5AJ3 L;  1JB3 A;  1QCB D;  3NP8 A;  2MNA A;  3T1Y L;  5FLM G;  2WKD A;  2EE1 A;  3BG3 A;  4G4K A;  1ZYR D;  1K8A C;  2KJX A;  1EIY B;  2JA6 H;  1KNA A;  3NTH A;  4OWW B;  5JVG 3;  2R92 H;  2ZTC A;  3KLS X;  3RLO A;  4DV0 L;  2XVS A;  1F2Y A;  4LF4 Q;  1J6Q A;  1SN8 A;  4JI2 Q;  1D5X C;  3J7A F;  3E0J A;  1JR0 D;  4FDB A;  1N34 L;  3A8I E;  2GVA A;  3I4N G;  2K04 A;  2BDN A;  3GTL B;  1B70 B;  4JI6 Q;  3HOX B;  1E2W A;  1S5B D;  1AEX A;  2QA4 A;  3G6J B;  4C3I H;  4IUR A;  1LTI D;  1TWC H;  5JJL A;  3T1H L;  1HNX Q;  5GAD C;  4JV5 L;  2BA0 A;  3ITP A;  3I4M B;  4AYB B;  3G71 A;  4J15 A;  4DR1 L;  5EKL A;  3S1N B;  1SAP A;  4FNF A;  1XXG A;  3B6Y A;  4O2D A;  1VQK A;  1EU3 A;  3K0X A;  1U9R A;  4CBV A;  1TVX A;  1EOT A;  1SYB A;  2Z6K A;  4BXX G;  5C0X I;  1O7I A;  1HTP A;  3S1M H;  3CC2 A;  4BBS H;  4V0B A;  5JOB A;  4GZY C;  1D7Q A;  1P16 A;  3HOU G;  1SSO A;  4X6A H;  2HUG A;  4LF6 Q;  1QE6 A;  3P7J A;  1HNW Q;  5C44 G;  1JCK B;  1M4V A;  2K05 A;  3H0G B;  1UE1 A;  1SRO A;  1RD9 D;  2NWG A;  5IYB H;  2G9H D;  1O7Z A;  4NW2 A;  3NEN A;  3GD7 A;  3S2D B;  1VQO A;  1XJV A;  2F1M A;  1UAP A;  4JBK A;  2HT1 A;  2ATW A;  2Z4H A;  2JA7 B;  4CDC C;  3S15 H;  3TP8 A;  3NQI A;  3PUV A;  2OEO A;  4KI0 A;  5EPJ A;  1Y1V G;  1VQB A;  2Q2U A;  4IUT A;  4DNR B;  1CT1 D;  4AYB E;  1A3V A;  4DAY A;  5AJ3 Q;  3A54 A;  5E3F A;  4BY1 H;  1XNQ Q;  1IXR A;  4YHH L;  2JE6 I;  3EBE A;  2JA8 G;  3HKZ G;  2DNE A;  2E76 C;  3OW2 A;  1TII D;  3ULJ A;  1JIC A;  3UE0 A;  1Q3L A;  1EY7 A;  2EDG A;  3X3M A;  3BVM A;  1PH9 A;  2BCO A;  3RZD H;  2JYO A;  1Q46 A;  2B2V C;  1FYC A;  3HOU B;  3DM3 A;  1GUO A;  4B9W A;  4I65 A;  3J7Z C;  4L63 B;  3AMU A;  1VMC A;  1VQA A;  1WVL A;  3GTK B;  1I94 L;  4JI8 Q;  3TZU A;  1GXD C;  2QIL A;  1LUZ A;  2WV6 D;  3IFD A;  4GN5 A;  1W6K A;  4DV5 L;  2LXJ A;  1PYB A;  3I55 A;  2PNR C;  2FMC A;  2NUC A;  3D4R A;  3KJP A;  2Z1C A;  1Y8O B;  4K2K A;  1FJG Q;  1IBK L;  4TSS A;  4WOR A;  1YNN C;  2MFI A;  4JI4 L;  1QG7 A;  3S1N H;  1HZC A;  1STG A;  4DR5 L;  4FP5 D;  1BOS A;  1TY2 A;  4BY7 H;  3VA5 A;  1ESR A;  3OWE B;  2UUB Q;  2J7Z A;  5GAH C;  2F0M A;  4NP5 A;  1BBW A;  1LYL A;  2D62 A;  1X3P A;  4UP9 A;  1QZH A;  3CCS A;  2VNU D;  1SYC A;  5D65 A;  3GTO B;  4MTK A;  4NPS A;  1TKW B;  4OO1 H;  4K5W A;  2RSO A;  5FLX L;  3CRK C;  4A3E H;  3AB9 A;  3MXP A;  1SFO B;  2P5Z X;  2EY2 A;  5C3E G;  3G4S A;  1L1O B;  3I7F A;  3M3Y H;  1LAB A;  1WCM B;  5COR A;  1ESF A;  5DLQ E;  2CHB D;  3KOJ A;  3I2Z A;  1EWH A;  4NMZ A;  4R4T A;  2F03 A;  4EGV A;  2I5H A;  4IFD J;  3S1R H;  3J81 c;  4BWG B;  3S24 A;  1V1P B;  5FLX c;  2DY7 A;  1CKO A;  1GKH A;  4KTA A;  2SNM A;  4KN4 C;  2EYJ A;  1BCP C;  2B2W A;  1TQO A;  2B8G A;  1PTO C;  1I4R A;  4A3I G;  2YU9 H;  1SNC A;  3ONA B;  3S16 B;  1PZJ D;  2RHQ B;  3H09 A;  1B9N A;  3OW7 A;  2K1B A;  1XTD A;  2N49 A;  5T1G A;  3T51 B;  4XYO A;  3J81 L;  5IE8 A;  3D4D A;  4AQY L;  3UI2 A;  1EQT A;  4C3H G;  3T16 A;  1GM5 A;  4MIU A;  4N8X 1;  4POF A;  5A35 A;  4QY7 A;  4KHP L;  4HN7 A;  3GTP B;  1FD7 D;  1SMY C;  4ZUJ A;  3PF5 A;  1CK1 A;  3ND9 A;  4RCO A;  1QIL A;  2WKC A;  4KKT A;  2V4D A;  4DFA A;  2LMC B;  1QNU A;  1A63 A;  1DD2 A;  3P20 A;  1XWE A;  4TVA B;  5C5M A;  1PZI D;  1TWG H;  2E2I H;  4JI1 Q;  1PXU A;  3HOY G;  3C1E A;  1Y8P B;  2B3G A;  2L9H A;  3KF8 B;  4IZ8 A;  3SEB A;  4KJN A;  4CDD C;  1VQ4 A;  5IYD G;  1X3G A;  1U4M A;  1F9R A;  1D8L A;  5EGT A;  5KEE A;  5IGB A;  2VZA A;  1H9J A;  4RHS A;  3SDZ A;  1KHI A;  4OON A;  3FRP B;  3DMU A;  3NPP A;  1JWU D;  4A3B G;  2WB1 G;  4FXD A;  3L9A X;  2XN9 C;  4KLK A;  1YHB A;  4K0K Q;  1LO5 D;  1LT4 D;  3CCU A;  4BY1 B;  1EY0 A;  1VQJ A;  1IBL L;  3HKS A;  1A6X A;  1ZEQ X;  2ZM6 Q;  1YIT A;  1G2T A;  4BA2 I;  2JQO A;  2GA4 B;  1AW7 A;  2RDG A;  2R61 A;  4X3S A;  4ZUI A;  4DU9 A;  4CKE A;  2JA7 H;  2R6G A;  1EZ6 A;  4OL7 A;  1N32 Q;  3D4W A;  3FHW A;  4ALP A;  2K5H A;  1I94 Q;  2Q2H A;  4BXX H;  1HFG A;  1YHQ A;  2V1C C;  4QGU A;  1HNX L;  4A93 G;  4JI1 L;  1PTO D;  4GN4 B;  4A3M B;  1JE5 A;  4X64 L;  4UDU C;  1V43 A;  4C1N K;  5J39 A;  1VQ9 A;  1EY8 A;  5IGE A;  3K5N A;  2RSN A;  4EVO A;  1VQ7 A;  4K5V A;  1XNQ L;  1Y1V B;  5IT9 L;  1V1Q A;  1ONL A;  3TRZ A;  5M3M B;  4Z9C B;  3Q24 A;  4LF7 Q;  1NE3 A;  3NWS A;  1DON A;  1STB A;  4HTH A;  3U9S A;  1W3S A;  2XSC A;  4XT3 B;  5C3E H;  1SRU A;  3WDN A;  4BA1 I;  1ASY A;  3W1G A;  3GTJ B;  1PMR A;  4BS9 A;  5M5X H;  1VF5 C;  4FXK C;  5CV9 A;  5C44 B;  4I7A A;  5LMN W;  3K81 C;  4H0L C;  1Q86 C;  3HEJ A;  5FKA C;  1EFW A;  3TEH B;  2XNA C;  1C0A A;  2Z4I A;  4X3U A;  1HNZ Q;  4DGZ A;  1D5M C;  1UWV A;  1G2S A;  2OQ0 A;  2KOL A;  5LMN Q;  1VQC A;  2I46 A;  4QCL A;  2B63 G;  5EBC A;  4DR7 Q;  5M5W H;  3AEV A;  2EY6 A;  2LKV A;  3H91 A;  1AP0 A;  2AKW B;  2XRS D;  4CDF C;  1XNR Q;  1D5Z C;  5DAU A;  4OIK A;  5ELO A;  4LFA Q;  1SFO H;  4LMQ D;  3CAM A;  3GTQ H;  5C4X B;  1F9S A;  2WAQ G;  4KJO A;  1S4Z A;  4IAL A;  4DV7 L;  1BQQ T;  1TS3 A;  5D3D A;  4EQO A;  1NAP A;  4JBJ A;  5M3F B;  4HJA A;  5FO9 B;  3MFG A;  3BZC A;  3CF5 A;  1HFN A;  5BN3 A;  1A3T A;  4PV1 C;  2CFM A;  2SDF A;  2FXQ A;  3I4M G;  2B29 A;  2EYO A;  3I8Z A;  2K32 A;  3F8T A;  4QL5 A;  3GP7 A;  2N55 A;  1HZA A;  4GLA C;  1F2M A;  3HOX G;  4IJL A;  1UEB A;  2ZJQ A;  4UP8 A;  1RCV D;  2XGT A;  4WJW A;  2BE5 D;  3ND8 A;  2K7V A;  3AFP A;  1R9T H;  3T53 B;  2ZTE A;  1OXU A;  5KRU A;  4FYD A;  1LT6 D;  4KY6 A;  4RKB A;  4AIM A;  3S1Q B;  1E24 A;  1C9O A;  4POG A;  4A3G B;  2LSS A;  3DHQ A;  1W2B A;  2B2Y C;  3FDT A;  2F0T A;  4RWS C;  3L7Z C;  4X62 L;  3GO5 A;  4ZKB B;  1Y14 B;  2MO1 A;  4G7Z C;  4ZYS A;  4A3J H;  4KD3 A;  1A62 A;  2ID0 A;  3OTO L;  1SDF A;  3RNU A;  2UXD L;  3CRL C;  4RGN A;  5E4W C;  4LF7 L;  3D0F A;  4OX9 L;  1G91 A;  4M8A A;  2O2L D;  2RKS A;  5C0X J;  3QIA A;  4BBR H;  4DR2 Q;  3C46 A;  2EQS A;  1D6E C;  4LF6 L;  1ENC A;  2QDL A;  3CQZ B;  1UE7 A;  1OXV A;  2C9O A;  4RG1 A;  1S5E D;  2M2L A;  4LF8 L;  4QQB X;  4A3G H;  2PPB C;  1ICW A;  2KVM A;  3G7L A;  4IPD A;  4A75 A;  3I56 A;  3GQB A;  1GHJ A;  1A3U A;  1X3F A;  1Z47 A;  3A5Z B;  4RA8 A;  5C6A A;  1LM0 A;  1TXY A;  1R9T B;  3PIO 3;  2NVX B;  3S15 B;  3SK4 A;  1EQQ A;  3FKI H;  2LFN A;  3GDE A;  2A6E C;  3FKI B;  3K7A H;  1MBY A;  1F9Q A;  5C4H A;  1N34 Q;  3HOW H;  1LLR D;  3S2D H;  3CHB D;  1JMC A;  1OO9 B;  1KLU D;  1VQI A;  1YEZ A;  2L15 A;  4JOI A;  2D5D A;  3H0G H;  3D6W A;  4C3J B;  3UDG A;  3HOV B;  2QW7 A;  2Q8T A;  1PFM A;  1YI2 A;  1SYG A;  1Q81 C;  4ZKC B;  3CPF A;  1I6H B;  3DEP A;  3BVZ A;  3HOY H;  2VUM B;  5KNC A;  4BBR B;  2CCZ A;  2HHH L;  2EY5 A;  4YWK A;  1YZ6 A;  1B3A A;  1MJC A;  2GN5 A;  4A3E B;  2F0D A;  3KF6 A;  1HR0 W;  2FHT A;  2KBN A;  3J80 L;  1KDC A;  4J1M A;  1SYF A;  2NVY B;  4XT1 B;  1KAA A;  1KRT A;  1VQP A;  3MAQ A;  3TS0 A;  2EJF C;  2ZJP A;  4DV5 Q;  3N6R A;  4FO2 A;  4B3T Q;  3C2P A;  4IN3 A;  4DK3 C;  1O7Y A;  2VXW A;  4LWC A;  1KC8 C;  4UHV A;  2L1B A;  1CA5 A;  2L0C A;  3CCV A;  1GOZ A;  1UE5 A;  2QEX A;  1M90 C;  2OWO A;  3E5S A;  3PMF A;  1WD1 A;  2A19 A;  5I4D A;  3NEM A;  2QKI C;  1QVG A;  4NKL A;  4XQN A;  2F0E A;  3FP9 A;  4OHJ A;  4A3E G;  3G6E A;  1MIU A;  4ZAI A;  3I4N B;  2L11 A;  2R92 B;  1PH3 A;  2KCC A;  5K36 H;  3FEW X;  4DK1 A;  5IY0 A;  4DV6 L;  4FXG C;  4LF9 Q;  5DM6 3;  5IP7 H;  5IP7 G;  1S72 A;  4AQY Q;  1PTO F;  3NSW A;  2NZ1 D;  5C3E B;  1MJE A;  3O13 A;  4C3J H;  1XMO Q;  1LV9 A;  3HOV H;  2BDO A;  4A93 H;  1STH A;  4JVZ A;  3J80 c;  3HKZ E;  5D3I B;  2HD3 A;  4MZ9 A;  1WFQ A;  4QF4 A;  1XPU A;  1L2F A;  3TZD A;  1VQM A;  4KN7 C;  2E74 C;  2J4X A;  1ML0 D;  1UUP A;  1PH1 A;  1K8O A;  1S5C D;  4LJZ C;  1X32 A;  3BS1 A;  1CZG A;  1J5E L;  2O5J C;  2EYH A;  3UE1 A;  1I6V C;  1DYQ A;  4TRD A;  1BR9 A;  3BDO A;  1CTM A;  4DR3 Q;  1X6O A;  3M9B A;  2L55 A;  5FLX E;  1F2L A;  3CXC A;  4KHV A;  4XXE A;  4DR1 Q;  3VR4 A;  3VR3 A;  4YWM A;  3K0Y A;  3ICE A;  4PMB A;  3TP5 A;  3F1Z A;  1K28 A;  2ZXP A;  1QUQ A;  5D14 A;  4XTC S;  1Y1V H;  1CKN A;  2UUA L;  3MXU A;  1MSH A;  1LTL A;  1NMF A;  4DA2 A;  3PF4 A;  3I90 A;  2B8F A;  1QZG A;  3PUW A;  5BN4 A;  3NBI A;  3WOE A;  2E2H H;  1IYJ B;  3PV0 A;  5J1Z A;  1L0X B;  5IGF A;  2OF1 A;  1HNZ L;  1STN A;  4IUP A;  1Q8K A;  1QOH A;  4P2C B;  1KDB A;  3HOZ B;  2HDL A;  2TMP A;  4DV1 L;  3I3C A;  4X66 L;  5FOB B;  1B8A A;  1UNS A;  4RHR A;  4DV3 Q;  3NTI A;  2VQE L;  5C0X H;  1GUN A;  4KKS A;  2JA8 H;  4DV2 Q;  3S1Q H;  2KCT A;  3SHL A;  3T56 B;  4A3F G;  4DNI A;  2VQF L;  3GTL H;  5CV5 A;  1D1K A;  5LMU L;  3LX0 A;  4X3K A;  4EX5 A;  4GKK L;  2DN8 A;  2KUM A;  2EXZ A;  5DEH A;  5C3X A;  1HR0 Q;  1PZK D;  2Z9H A;  3CW2 C;  4EQN A;  2IL8 A;  1B1Z A;  4A3J G;  2Z6B A;  4HMI A;  1RHP A;  4X3T A;  4DV4 Q;  5ELC A;  1IKM A;  2Q2T A;  2JA6 B;  1L1O C;  1O80 A;  2RQX A;  1GUG A;  1J5E Q;  1N32 L;  5E4X A;  2C5C A;  3G48 A;  5BR8 L;  4L5Q A;  2BE5 C;  4GOP A;  3H6M A;  3PO2 B;  2LXK A;  2JEB I;  4OWT B;  4YCV A;  3SXH A;  3UDX A;  3PUZ A;  2F0K A;  5KIX A;  5DM7 3;  5CC4 A;  1WCM G;  2E8G A;  4LFB Q;  3K7U C;  1EEF D;  1JOK A;  4RKL A;  3HOX H;  4XYQ A;  4ME3 A;  3VYT A;  4HR7 B;  5JEA G;  2HCI A;  1Y8N B;  5CMD A;  4TQU S;  1PRT C;  2CQO A;  3FVQ A;  4DR6 L;  1SYE A;  2K01 A;  3E9I A;  1EIF A;  4DXF A;  1PA6 A;  4IFD I;  3ULL A;  4H13 C;  2RCF A;  3QJY A;  2NYZ D;  1CHP D;  3VYU A;  5ELD A;  3BVG A;  4MNO A;  1PTO B;  2OTL A;  3HRZ C;  1XTC D;  1FL0 A;  3I91 A;  4CKC A;  4CDE C;  4KY7 A;  1WD0 A;  4A3D G;  1ILP A;  2LS0 1;  5I2X A;  2I0Q A;  2NTS A;  3IKJ A;  5ISR A;  3KF8 A;  1TT2 A;  2PMZ B;  2GVB A;  2I5M X;  3K6O A;  2PO4 A;  2R3Z A;  1LTG D;  4KHP Q;  5IT9 c;  4A3K G;  5IOD A;  1YNX A;  4EQ5 A;  1Z6H A;  4DR7 L;  1U4L A;  2PZU A;  1MKH A;  3KLW A;  4KV6 A;  4HCS A;  4P72 A;  3HGB A;  4NXN Q;  4APV A;  4JCV E;  4RGO S;  2UUC Q;  3U4V A;  2N88 A;  4F88 A;  5I2Y A;  3PIP A;  1N9W A;  1WCM H;  4X65 Q;  2C35 B;  1K0S A;  4L5S A;  3TME A;  3GTJ H;  3C1F A;  3PUX A;  1PH6 A;  1FVI A;  1HUN A;  2R7Z B;  4K5X A;  4OX9 Q;  1FNV A;  1STE A;  3GTK H;  3S2H H;  1C4Q A;  1QB5 D;  3KFU A;  5M3M H;  4B9X A;  3IRB A;  5IGG A;  1I4G A;  2XWB B;  5G3L F;  3PSI A;  4L5R C;  1NSN S;  4OGQ C;  4BBR G;  1IYU A;  2KCM A;  3KYH C;  4GS3 A;  4GNX B;  4WFN 3;  1XPO A;  3LNN A;  2UXB Q;  2MHV A;  5IOC A;  4DR4 Q;  1SJE D;  5IT9 E;  3UDF A;  1RJT A;  2A74 C;  1X3Q A;  2HIV A;  1B50 A;  2RF4 A;  2YYZ A;  1JOO A;  3KK7 A;  1DM0 B;  1U4R A;  2JA7 G;  4JPB W;  4N8F A;  1PH8 A;  1PDQ A;  4XDX A;  5CBA E;  2UXC L;  1TR5 A;  2B2T A;  3J7Y W;  3SK5 A;  1YJ9 A;  1PH2 A;  1ASZ A;  1VDZ A;  2F0S A;  1BF4 A;  1PRT D;  4RH6 A;  3IAY A;  2KA7 A;  4IQZ A;  2ICE C;  1DJR D;  2K4K A;  1N36 Q;  3HS0 C;  4JI6 L;  3Q0A A;  1RDP D;  3TN2 A;  4ILW A;  1EFI D;  1G6Z A;  2NZH A;  1BCP F;  4F7X A;  5JJK A;  3H3V C;  5F2D A;  3KDF A;  5JPN C;  3CCJ A;  1BXT A;  2JJQ A;  3CCM A;  1D2B A;  4C3J G;  5CV6 A;  3HOV G;  2NVT B;  4DUY L;  2NBF A;  4C3I B;  4KK7 A;  1CUK A;  1YIJ A;  2HHH Q;  2VW9 A;  1MI2 A;  1JWS D;  1V1P A;  2RDF A;  3EVQ A;  1K9M C;  1IKL A;  3MEH A;  5C4J B;  3VA7 A;  1I50 B;  1LTT D;  2WIN B;  2BH2 A;  5EPK A;  1LTA D;  4P73 A;  2A69 C;  4E6I A;  4KY5 A;  1UE6 A;  2MPM A;  2J0T D;  1AE3 A;  2PQA B;  5C44 H;  1VQD A;  2L4N A;  1V9P A;  4LFB L;  3JC6 6;  1LT5 D;  1P8L A;  1Q1E A;  3MXN A;  5FLM H;  2ZJR A;  3GTP H;  4PG3 A;  3GTO H;  1BBX C;  4GKJ Q;  3K8A A;  2EYM A;  3S1M B;  2E2D C;  1H9K A;  1XNR L;  3A56 A;  1BNZ A;  1JQY D;  4B3S Q;  4LF5 L;  1RTO A;  2IHF A;  1TS5 A;  4PZ7 A;  1KIX A;  2H5X A;  4UPA A;  2IJ0 A;  3E0E A;  1PYS B;  2QCP X;  4IFD H;  1MHW C;  4C3I G;  4N9P A;  2WB1 B;  5FO7 B;  2UUB L;  4ID6 A;  4B3T L;  3S16 H;  1K83 B;  2Y0S E;  3SGI A;  3CME A;  5C5L A;  2ZM6 L;  2I07 B;  4LUV A;  4JW0 A;  2KED A;  3J81 i;  2JSO A;  1JB7 A;  5KND A;  2EPB A;  3K57 A;  2X6G A;  4PZ6 A;  4QIW E;  5EPL A;  4PMC A;  2NVX H;  4ZQ3 A;  2R7Z G;  3S14 B;  3TSS A;  4ME5 A;  4NXN L;  4DK6 C;  1WOC A;  5CV8 A;  4P75 A;  4DK0 A;  2NB0 A;  3FPU B;  4K8J A;  3JAM E;  3OIP A;  4ZCK A;  5M5X B;  4Y52 H;  3L0O A;  2UUC L;  1TS2 A;  1L1O A;  4MHE A;  4JBW A;  1S40 A;  1X9N A;  3M4Y A;  3BDL A;  4HSV A;  4JV5 Q;  1JWM D;  2CWA A;  3H0G G;  3NQT A;  1B9M A;  2WP8 J;  2K5W A;  3T4A C;  1L0W A;  3HOW G;  2HIX A;  2JA8 B;  1JE4 A;  4A3J B;  1JOR A;  3CC4 A;  3MWY W;  3PQI A;  4LUZ A;  2DY8 A;  5IP9 G;  1WTR A;  2Y0S B;  3ZJY C;  2WAQ E;  4Y7N B;  2JK8 A;  2YTX A;  3CPW A;  3C3L A;  4JI0 L;  2WFW A;  4A3I B;  3HOZ G;  1EY5 A;  4WJ4 A;  3HG9 A;  1ET9 A;  3NWT A;  1YVC A;  2PZT A;  3M4O B;  1X56 A;  3M4O H;  1U4P A;  3MC0 B;  3PGZ A;  4NDX A;  2OQK A;  3STB D;  3S17 B;  3SVM A;  2B2W C;  3MEF A;  2OXP A;  1OXX K;  3FKI G;  4BBS G;  3EFX D;  4F87 A;  1EQR A;  2E2I B;  1CI3 M;  4LUO A;  1S5D D;  4K2L A;  3DWA A;  3WOF A;  3BYY B;  2KHJ A;  1W6J A;  4JC0 A;  2R7F A;  1DOM A;  3H94 A;  4DAV A;  1K73 C;  2R93 H;  1A8V A;  1TWA B;  3K5M A;  1IW7 D;  5IYD H;  4DV4 L;  4DN4 M;  1WTH A;  1HR0 L;  4OO1 I;  2EYP A;  3BZK A;  3U4Z A;  3I73 A;  2F0H A;  2UXB L;  1WI5 A;  1VQE A;  1QWY A;  1AN8 A;  5IYB G;  1KL9 A;  1H95 A;  4ULL A;  3A8K E;  4NXM Q;  2H4O A;  5KGU A;  3LWU A;  4WRD A;  5GAE C;  3TP7 A;  4A3K H;  1DOK A;  3F2B A;  4ABN A;  4CKB A;  5IYC G;  4DV0 Q;  5KNB A;  1GVP A;  1KXL A;  3CC7 A;  3TS2 A;  1ZKO A;  2WAQ B;  2CH4 A;  2VB2 X;  4LF4 L;  4IO9 A;  5ELE A;  3CMA A;  2AQ1 B;  5C4X H;  3GTQ B;  2K52 A;  1H9S A;  1SE2 A;  3W3A A;  1YHA A;  3MFY A;  4Q0F A;  3A55 A;  1Y1W B;  2E75 C;  1ILQ A;  2KEC A;  4OXP A;  3EIV A;  3NE5 B;  2E5L Q;  3S14 H;  1U0L A;  1K8M A;  2Z0S A;  4IJH A;  1BCP B;  5A2Q L;  4V19 0;  4DNT B;  2AUJ D;  4C2M B;  3U9O A;  3V96 A;  1HQR D;  3W1B A;  1H9M A;  5IIF A;  1HH2 P;  4JI8 L;  4R4O A;  2B2T C;  1EYA A;  4IPC A;  3STB C;  4JI3 Q;  2UXC Q;  5I9P A;  2EJG C;  1G51 A;  1WTW A;  4A3C H;  4L6T B;  3Q22 A;  3S1R B;  2SNS A;  1AFP A;  3D3R A;  1QNK A;  1V8Q A;  2A6H C;  3HP3 A;  1CHQ D;  3MHB A;  1G6P A;  1KNE A;  3DM1 A;  5EBD A;  1PVO A;  1FR3 A;  4NB3 A;  4C3H B;  4OO1 G;  1B44 D;  4LFC L;  5HY6 A;  4R8N A;  1TWF B;  4PNY A;  3W2D A;  4KKU A;  4ZRZ A;  3ERO A;  4LK1 C;  1PH4 A;  4JI5 L;  4K6D A;  4BY7 G;  3KLR A;  5NUC A;  1IL2 A;  4JBM A;  1O7L A;  5M9O A;  1PH7 A;  1PFS A;  1I3Q B;  1SR3 A;  5BN5 A;  3ZYY X;  2HDM A;  1JJC B;  2QGQ A;  3MZ5 A;  2D0O A;  1GUW A;  2M9V A;  4A3K B;  2KHI A;  1QVF A;  3ERQ A;  1VMP A;  2ZXR A;  4WJ3 M;  4G7O C;  4CJ0 B;  4IUQ A;  1SNP A;  1TWH B;  2MP1 A;  4Q5V A;  3FPP A;  4GOP C;  2CKZ B;  4DV6 Q;  1HNW L;  4J8Q A;  1JC7 A;  5LHY 1;  1CM9 A;  3TDQ A;  5JAV A;  1VQ5 A;  5C0X G;  2HCC A;  4YWL A;  1LTS D;  1SBB B;  1SNQ A;  2A69 D;  1HA6 A;  4J6H A;  2XRQ D;  1V1O A;  3H3V H;  3KUP A;  1BO0 A;  2PW7 A;  4DUZ L;  3NEL A;  2PYK A;  1E22 A;  3JAM i;  1JJ2 A;  4A3D B;  1S3O A;  3CCQ A;  1HZB A;  5IWA Q;  3AFQ A;  2F0V A;  3JAM c;  1EEI D;  4KHZ A;  2F0G A;  2M00 A;  1CQF A;  3V2T A;  2ENB A;  3RN2 A;  3GTG H;  1YNN D;  2KEN A;  1NMG A;  4GNX A;  3IFT A;  3NHH A;  2R93 G;  2PQE A;  3URY A;  2EYL A;  4GKK Q;  5LMU Q;  3T1H Q;  5A2Q E;  1VQN A;  1IHZ A;  1MSG A;  1NR4 A;  4DR5 Q;  4B3M L;  3QOJ A;  3HOY B;  3DWP A;  4DR4 L;  1CSP A;  1E7Z A;  3CD6 A;  3GV6 A;  1XMQ L;  1C8C A;  4JI4 Q;  4A4I A;  1JOQ A;  1NUC A;  2DJG C;  1VQF A;  1IBK Q;  4DUY Q;  1HXY D;  1NTG A;  3A8J E;  5EAY A;  4IUV A;  5HGQ A;  2K50 A;  3K59 A;  1RF2 D;  3RUZ A;  3GTM B;  4A3I H;  1F77 A;  4Y7N H;  1E3P A;  1B4O A;  2LY7 A;  5GAG C;  4CJ1 B;  2F0O A;  1CFM A;  1T5E A;  3RN5 A;  2N8N A;  4RMF A;  3R8B A;  1EWC A;  2EOT A;  2EJM A;  3KDF B;  4QMG A;  3L2P A;  1B7Y B;  3T1Y Q;  3AQQ A;  4LNQ A;  2F0W A;  3Q8D A;  4RFB A;  5AFW A;  4R4C A;  3GTG B;  4HIO A;  2VB3 X;  2R7Z H;  2VUM G;  1PYW D;  3U50 C;  4NXM L;  4B3S L;  1PTO H;  4LF5 Q;  3PO2 G;  4B3R Q;  1EQV A;  2IX0 A;  3TQY A;  4A3L G;  2F0I A;  4A3D H;  3I70 A;  4X64 Q;  3KBX A;  4YY3 L;  3R3O A;  1BKB A;  1TWF H;  3K58 A;  3SR1 A;  2PI2 E;  4L5T A;  3I4N H;  5CYU A;  4XQJ A;  4YCU A;  5M5W B;  1ROD A;  2VL6 A;  4HSP A;  2VQF Q;  3N52 A;  4MN3 A;  2JP1 A;  2PZW A;  2A68 D;  2N78 A;  4QJF A;  4OIJ A;  1HJP A;  1M8A A;  1U5K A;  2E2J H;  4O42 A;  2TSS A;  2E2J B;  3MXG A;  1R4Q B;  1F2Z A;  4FF4 A;  4B08 A;  1DOL A;  3RLN A;  3DWQ A;  1K3R A;  3KF6 B;  1J8I A;  3A5U A;  1CA6 A;  2K6A A;  2AWO A;  5FK9 C;  3PIO A;  1ICF B;  3NXW A;  1BUV T;  2BA1 A;  1HUM A;  4RGT A;  2UU9 L;  1TY0 A;  1Q90 A;  3L3O C;  4PZ8 A;  4R9W A;  4JI5 Q;  4I7Z C;  4BY7 B;  4F8M A;  3J81 j;  1SND A;  1MD2 D;  4OEL B;  5GRO A;  1XMQ Q;  2JA5 H;  1YJN A;  4LFC Q;  4HIM A;  4DAM A;  5JEA J;  3ERS X;  2RCN A;  5E1F A;  1PFN A;  1QJO A;  4HIK A;  2F3W A;  2MJ8 A;  3RD4 A;  3W5O A;  5K36 G;  3M7G A;  3NTK A;  3I4L A;  3M4Q A;  5DNF A;  5KYL A;  4LAA A;  1E0B A;  3AYH B;  3OSO A;  4P74 A;  2K14 A;  1IYV A;  2FFK B;  2MUY A;  3OOC A;  2F0J A;  3H3V I;  2WAC A;  4GNX C;  1PV4 A;  4M1U B;  1TU2 B;  1RIP A;  4JG2 A;  1D1I A;  2DNC A;  4LW1 A;  4B3R L;  4IPG A;  1J9O A;  2B2U A;  1TWA H;  1NY4 A;  2K5D A;  1TS4 A;  2HQL A;  2RDH A;  2IX3 A;  1NCV A;  1WJJ A;  2IT1 A;  4CGY B;  4X66 Q;  1VQ6 A;  4A3M H;  1SJH D;  2B63 B;  3WWV A;  4ODG A;  3ER0 A;  4DKA C;  4GLX A;  4ZK9 B;  4H02 A;  1RKN A;  3F2D A;  3HOU H;  3KLS A;  2XTI A;  5C3W A;  5CV7 A;  1NR2 A;  1Q1B A;  1HCZ A;  3K7A B;  3F2U A;  2B2U C;  1GUT A;  1AZP A;  4K0K L;  2QEJ C;  1T9H A;  2CW0 D;  1I50 H;  4HMJ A;  3VR2 A;  3D31 A;  2A68 C;  1XMO L;  2RBM A;  4RGM A;  3JAM L;  1VQL A;  2EVB A;  1FNW A;  2BH8 A;  3R2T A;  4HCE A;  4XIG S;  3CCR A;  4GLV B;  1CQV A;  2EXD A;  4XQQ A;  2AUK A;  1YBY A;  1VF7 A;  2UUA Q;  5L37 A;  1EU4 A;  2XWJ B;  3I4O A;  4HJ9 A;  1N33 Q;  2FIN B;  3HOZ H;  3TBI B;  1EIG A;  5FJ8 H;  5I9O A;  2DUD A;  3QB3 A;  4IPH A;  3CCL A;  4S3S A;  1M1K C;  1Q8I A;  1E1O A;  1C48 A;  1EIH A;  2AQ3 B;  4X62 Q;  2KHS A;  1HQM C;  1EOV A;  3I4M H;  1G29 1;  4H44 C;  4DR6 Q;  1TWC B;  4O0A A;  1GHK A;  1HPC A;  2OTJ A;  1L0Y B;  4C3H H;  2NN6 I;  5COY A;  3MA2 B;  3M4P A;  2PI2 A;  1PH5 A;  5H1S E;  1FJG L;  1X3E A;  1EL0 A;  4C56 C;  4IUN A;  1ENA A;  2X69 A;  2ES2 A;  2K28 A;  4O1N A;  4A3M G;  4L8J A;  5HGT A;  3E9H A;  2HQE A;  1I4P A;  1STY A;  2F3V A;  1XYI A;  1K3B C;  3RR5 A;  1PHJ A;  2SEB D;  3I72 A;  4C1N I;  2JXM B;  2JA5 B;  1SYD A;  5IP9 H;  1A0I A;  1EY6 A;  1RTN A;  4FF1 A;  5FO8 B;  5TSS A;  5K5P A;  5M3F G;  2K75 A;  1FGU A;  3ULP A;  3J81 E;  3T13 A;  2UU9 Q;  3BZD B;  1XPR A;  3K5L A;  2ZT9 C;  1KAB A;  1FNU A;  5EKK A;  3S9W A;  4YY3 Q;  1EYG A;  1SE4 A;  1HA5 A;  4OWX B;  4KMU C;  4UAI A;  3D8G A;  1BVS A;  3P75 A;  5EKI A;  1X65 A;  4K6L A;  4N9T A;  4K14 A;  1YNJ D;  3HOW B;  3MVV A;  2B2Y A;  4DR2 L;  1VQH A;  3FMC A;  1A15 A;  2D0P A;  3PO2 H;  1SNO A;  2F0N A;  4C2M H;  2NVY H;  4EQP A;  2PQA A;  2KQ3 A;  1S5F D;  2PW5 A; 
#chains in the Genus database with same CATH homology
 2K03 A;  3Q23 A;  2ICI A;  3P1H A;  4FF2 A;  1PRT B;  2NTT A;  2A6E D;  3DXJ C;  3M3Y B;  2AWN A;  1SE3 A;  5M5Y B;  2IW3 A;  3SK6 A;  5IGD A;  2A5H A;  2G9D A;  1F9P A;  4U68 A;  2Q8I B;  3A7L A;  2BOS A;  3RZO B;  3J7A V;  2FMM A;  1EY4 A;  2FJ2 A;  1AZQ A;  2QDB A;  1KLG D;  3OMC A;  3Q6S A;  3OHX C;  1STA A;  4CHT B;  3EQL C;  3HKZ B;  1EY9 A;  1EZ8 A;  1B2T A;  2E2H B;  1H9S B;  3NBH A;  2EZV A;  2MGS A;  1ENF A;  2R93 B;  3MTS A;  1ZYR C;  3SE0 A;  1A2U A;  1GUS A;  2CQA A;  1I4Q A;  5EQ0 A;  4YIJ A;  1OXS C;  4QB4 A;  5CR3 A;  4IUU A;  5JVH 3;  1SEB D;  1LTR D;  3BDC A;  5G3L D;  5KYI A;  1BDO A;  4TKO B;  3BYT B;  2OT2 A;  1DZ1 A;  4G57 A;  1IL8 A;  5ELB A;  4FF3 A;  1WTQ A;  3SK8 A;  4H7B A;  3EA6 A;  1GJX A;  3NUC A;  2EYF A;  1ET6 A;  4PMW A;  2L5T A;  3OPO A;  1WTO A;  1KTK A;  1LTB D;  4A93 B;  2Z8L A;  4PQX A;  3PO3 B;  3VR6 A;  3QO2 A;  3EJI A;  5CBE E;  1SNM A;  1KDA A;  2XIW A;  2F0L A;  5CGK A;  3J80 E;  4BBS B;  1UEA B;  4FVM A;  2CVR A;  5LL6 S;  2H1E A;  3PUY A;  4KD4 A;  2Q8R E;  1E2V A;  2CW0 C;  1LT3 D;  1A2T A;  5ELF A;  5LL6 X;  3GV3 A;  3QG1 A;  4RCN A;  2B2V A;  1WTX A;  2ZXO A;  2IPK D;  1DXM A;  3RMH A;  1IW7 C;  2SOB A;  2IWH A;  2D2C C;  2K33 A;  2F0Q A;  5HUR A;  5J22 A;  5CV4 A;  5I6W A;  2JEA I;  4JK1 C;  3R2I A;  5IGC A;  1OXT A;  3VYR A;  1E2Z A;  1Z7T A;  2K5Q A;  4DAP A;  5C4Z A;  1WTV A;  1HHV A;  1CZW A;  1HTL D;  5T1I A;  1SXT A;  2NN6 H;  3X3N A;  3DEO A;  1EYD A;  2EY1 A;  4HED A;  5EJW A;  1MGS A;  1H9R A;  3OMG A;  3D6C A;  2IX1 A;  3DUZ A;  3OWF A;  3A7A B;  4CJ2 C;  4R8I A;  3R93 A;  3RZD B;  2B39 A;  1G8Z D;  1XX8 A;  4HAE A;  2RVL A;  1HRJ A;  2NVQ B;  1Y69 U;  5JJZ A;  3CU7 A;  1Q12 A;  1PLF A;  1EYC A;  3VR5 A;  4K8I A;  2A6H D;  4DXG A;  1FGB D;  1I4X A;  4A3F B;  4DF7 A;  2A73 B;  3NK9 A;  1TWG B;  1R4P B;  2KEE A;  4A3B B;  2D9U A;  1YNJ C;  2F0U A;  2F4I A;  1BCP D;  3V05 A;  3IL8 A;  4G7H C;  3HZX A;  2L12 A;  3KBG A;  1O78 A;  2RA4 A;  2PCF B;  3S2H B;  1PRT F;  1B53 A;  3M85 A;  4QIW B;  1PFB A;  1SMY D;  3M7N A;  5JPM C;  1I4H A;  2O5I C;  3PIP 3;  3RLF A;  1T5X D;  2F0P A;  1II3 A;  4QUC A;  5I6Y A;  1WTP A;  1DCZ A;  3QWN A;  4ZLT F;  3TP6 A;  4IFD G;  1VCI A;  2QF7 A;  3AU7 A;  3QOL A;  1ZXT A;  2X6L A;  2O4X A;  2AQ2 B;  2NN6 G;  2YU9 B;  4RAU C;  3LWE A;  3K5O A;  4QUF A;  3CKI B;  4U67 3;  2KCN A;  1LAC A;  3VYS A;  2WII B;  3OIQ A;  5JEA H;  3E6Z X;  2F0F A;  1JB3 A;  1QCB D;  3NP8 A;  2WKD A;  2EE1 A;  3BG3 A;  4G4K A;  1ZYR D;  2KJX A;  1KNA A;  3NTH A;  5JVG 3;  3KLS X;  2XVS A;  1F2Y A;  1D5X C;  3J7A F;  3E0J A;  1JR0 D;  3A8I E;  2K04 A;  2BDN A;  3GTL B;  3HOX B;  1E2W A;  1S5B D;  1AEX A;  3G6J B;  4IUR A;  1LTI D;  2BA0 A;  3ITP A;  3I4M B;  4AYB B;  5EKL A;  3S1N B;  1SAP A;  4FNF A;  1XXG A;  1EU3 A;  1U9R A;  4CBV A;  1TVX A;  1EOT A;  1SYB A;  5C0X I;  1HTP A;  4V0B A;  5JOB A;  4GZY C;  1SSO A;  2HUG A;  1QE6 A;  3P7J A;  1JCK B;  1M4V A;  2K05 A;  3H0G B;  1RD9 D;  2NWG A;  2G9H D;  1O7Z A;  4NW2 A;  3GD7 A;  3S2D B;  2F1M A;  1UAP A;  2Z4H A;  2JA7 B;  3TP8 A;  3NQI A;  3PUV A;  2OEO A;  4KI0 A;  5EPJ A;  4IUT A;  4DNR B;  1CT1 D;  1A3V A;  4DAY A;  3A54 A;  5E3F A;  2JE6 I;  2DNE A;  2E76 C;  1TII D;  1JIC A;  1Q3L A;  1EY7 A;  2EDG A;  3X3M A;  3BVM A;  2BCO A;  2JYO A;  2B2V C;  1FYC A;  3HOU B;  1GUO A;  4B9W A;  4I65 A;  4L63 B;  3AMU A;  1VMC A;  1WVL A;  3GTK B;  3TZU A;  1GXD C;  2QIL A;  2WV6 D;  3IFD A;  1W6K A;  2PNR C;  2FMC A;  2NUC A;  3D4R A;  2Z1C A;  1Y8O B;  4K2K A;  4TSS A;  4WOR A;  1YNN C;  1QG7 A;  1STG A;  4FP5 D;  1BOS A;  1TY2 A;  3VA5 A;  1ESR A;  3OWE B;  2J7Z A;  2F0M A;  4NP5 A;  2D62 A;  1X3P A;  2VNU D;  1SYC A;  5D65 A;  3GTO B;  1TKW B;  4OO1 H;  4K5W A;  2RSO A;  5FLX L;  3CRK C;  3AB9 A;  3MXP A;  1SFO B;  2EY2 A;  1LAB A;  1WCM B;  5COR A;  1ESF A;  2CHB D;  1EWH A;  4NMZ A;  2F03 A;  4EGV A;  4IFD J;  4BWG B;  1V1P B;  2DY7 A;  4KTA A;  2SNM A;  4KN4 C;  2EYJ A;  1BCP C;  2B2W A;  1TQO A;  2B8G A;  1PTO C;  1I4R A;  1SNC A;  3ONA B;  3S16 B;  1PZJ D;  3H09 A;  1B9N A;  3OW7 A;  2K1B A;  5T1G A;  3T51 B;  4XYO A;  3J81 L;  3D4D A;  3UI2 A;  1EQT A;  4C3H G;  3T16 A;  4MIU A;  5A35 A;  4HN7 A;  3GTP B;  1FD7 D;  1SMY C;  4ZUJ A;  1CK1 A;  3ND9 A;  4RCO A;  1QIL A;  2WKC A;  4KKT A;  2V4D A;  4DFA A;  2LMC B;  1QNU A;  1DD2 A;  3P20 A;  1XWE A;  5C5M A;  1PZI D;  1PXU A;  3C1E A;  1Y8P B;  2L9H A;  4IZ8 A;  3SEB A;  4KJN A;  1U4M A;  1F9R A;  5EGT A;  5KEE A;  5IGB A;  1H9J A;  4RHS A;  3SDZ A;  3FRP B;  3DMU A;  3NPP A;  1JWU D;  4FXD A;  3L9A X;  2XN9 C;  1LO5 D;  1LT4 D;  4BY1 B;  1EY0 A;  1A6X A;  1ZEQ X;  1G2T A;  4BA2 I;  2GA4 B;  1AW7 A;  2RDG A;  2R61 A;  4X3S A;  4ZUI A;  4DU9 A;  4CKE A;  2R6G A;  1EZ6 A;  4OL7 A;  3D4W A;  1HFG A;  1PTO D;  4A3M B;  4UDU C;  1V43 A;  4C1N K;  5J39 A;  1EY8 A;  5IGE A;  3K5N A;  2RSN A;  4EVO A;  4K5V A;  1Y1V B;  5IT9 L;  1ONL A;  5M3M B;  4Z9C B;  3Q24 A;  3NWS A;  1DON A;  1STB A;  4HTH A;  3U9S A;  2XSC A;  4XT3 B;  3WDN A;  4BA1 I;  3GTJ B;  1PMR A;  4BS9 A;  1VF5 C;  4FXK C;  5CV9 A;  5C44 B;  4H0L C;  3HEJ A;  5FKA C;  2XNA C;  2Z4I A;  4X3U A;  4DGZ A;  1D5M C;  1G2S A;  2KOL A;  2I46 A;  4QCL A;  5EBC A;  2EY6 A;  2LKV A;  3H91 A;  1AP0 A;  2XRS D;  1D5Z C;  5DAU A;  4OIK A;  4LMQ D;  5C4X B;  1F9S A;  4KJO A;  1S4Z A;  4IAL A;  1BQQ T;  1TS3 A;  5D3D A;  4EQO A;  1NAP A;  5M3F B;  5FO9 B;  3MFG A;  1HFN A;  5BN3 A;  1A3T A;  4PV1 C;  2SDF A;  2EYO A;  3I8Z A;  2K32 A;  3GP7 A;  2N55 A;  1F2M A;  1RCV D;  4WJW A;  2BE5 D;  2K7V A;  3ND8 A;  3T53 B;  1OXU A;  5KRU A;  4FYD A;  1LT6 D;  4KY6 A;  4RKB A;  3S1Q B;  4A3G B;  3DHQ A;  2B2Y C;  3FDT A;  2F0T A;  4RWS C;  3L7Z C;  3GO5 A;  4ZKB B;  4G7Z C;  4ZYS A;  4KD3 A;  2ID0 A;  1SDF A;  3CRL C;  4RGN A;  5E4W C;  1G91 A;  4M8A A;  2O2L D;  2RKS A;  5C0X J;  3QIA A;  3C46 A;  1D6E C;  1ENC A;  3CQZ B;  1OXV A;  2C9O A;  1S5E D;  2M2L A;  2PPB C;  1ICW A;  2KVM A;  3G7L A;  3GQB A;  1GHJ A;  1A3U A;  1Z47 A;  4RA8 A;  5C6A A;  1R9T B;  3PIO 3;  2NVX B;  3S15 B;  3SK4 A;  2LFN A;  2A6E C;  3FKI B;  1MBY A;  1F9Q A;  5C4H A;  1LLR D;  3CHB D;  1OO9 B;  1KLU D;  2D5D A;  3D6W A;  4C3J B;  3HOV B;  2Q8T A;  1PFM A;  1SYG A;  4ZKC B;  1I6H B;  3DEP A;  3BVZ A;  2VUM B;  5KNC A;  4BBR B;  2EY5 A;  1B3A A;  4A3E B;  2F0D A;  2FHT A;  3J80 L;  1KDC A;  4J1M A;  1SYF A;  2NVY B;  4XT1 B;  1KAA A;  3MAQ A;  2EJF C;  3N6R A;  4FO2 A;  3C2P A;  4IN3 A;  1O7Y A;  2VXW A;  1CA5 A;  2L1B A;  2L0C A;  1GOZ A;  3E5S A;  3PMF A;  1WD1 A;  5I4D A;  2QKI C;  4NKL A;  4XQN A;  2F0E A;  4OHJ A;  4ZAI A;  3I4N B;  2L11 A;  2R92 B;  2KCC A;  5K36 H;  3FEW X;  4DK1 A;  4FXG C;  5DM6 3;  1PTO F;  3NSW A;  2NZ1 D;  5C3E B;  3O13 A;  1LV9 A;  2BDO A;  1STH A;  5D3I B;  4QF4 A;  3TZD A;  4KN7 C;  2E74 C;  2J4X A;  1ML0 D;  1UUP A;  1K8O A;  1S5C D;  4LJZ C;  1X32 A;  3BS1 A;  1CZG A;  2O5J C;  2EYH A;  1I6V C;  1DYQ A;  4TRD A;  1BR9 A;  3BDO A;  1CTM A;  2L55 A;  5FLX E;  1F2L A;  4KHV A;  4XXE A;  3VR4 A;  3VR3 A;  3K0Y A;  4PMB A;  3TP5 A;  2ZXP A;  5D14 A;  4XTC S;  3MXU A;  1MSH A;  4DA2 A;  3I90 A;  2B8F A;  3PUW A;  5BN4 A;  3NBI A;  3WOE A;  3PV0 A;  5J1Z A;  1L0X B;  5IGF A;  2OF1 A;  1STN A;  4IUP A;  1QOH A;  4P2C B;  1KDB A;  3HOZ B;  2HDL A;  2TMP A;  3I3C A;  5FOB B;  1UNS A;  4RHR A;  3NTI A;  5C0X H;  1GUN A;  4KKS A;  3SHL A;  3T56 B;  5CV5 A;  1D1K A;  3LX0 A;  4X3K A;  2DN8 A;  2KUM A;  2EXZ A;  5DEH A;  5C3X A;  1PZK D;  4EQN A;  2IL8 A;  1B1Z A;  4HMI A;  1RHP A;  4X3T A;  5ELC A;  1IKM A;  2JA6 B;  1O80 A;  2RQX A;  1GUG A;  5E4X A;  2C5C A;  2BE5 C;  3H6M A;  3PO2 B;  2JEB I;  3SXH A;  5KIX A;  3PUZ A;  2F0K A;  5DM7 3;  5CC4 A;  1EEF D;  1JOK A;  4RKL A;  4XYQ A;  3VYT A;  4HR7 B;  5JEA G;  2HCI A;  1Y8N B;  5CMD A;  4TQU S;  1PRT C;  3FVQ A;  1SYE A;  2K01 A;  4DXF A;  4IFD I;  4H13 C;  3QJY A;  2NYZ D;  1CHP D;  3VYU A;  5ELD A;  3BVG A;  1PTO B;  3HRZ C;  1XTC D;  3I91 A;  4CKC A;  4KY7 A;  1WD0 A;  1ILP A;  2LS0 1;  5I2X A;  2NTS A;  3IKJ A;  5ISR A;  3KF8 A;  1TT2 A;  2PMZ B;  3K6O A;  2PO4 A;  2R3Z A;  1LTG D;  5IOD A;  1Z6H A;  1U4L A;  2PZU A;  4KV6 A;  4HCS A;  3HGB A;  4RGO S;  2N88 A;  4F88 A;  5I2Y A;  3TME A;  3C1F A;  3PUX A;  1HUN A;  2R7Z B;  4K5X A;  1FNV A;  1STE A;  1C4Q A;  1QB5 D;  4B9X A;  5IGG A;  1I4G A;  2XWB B;  5G3L F;  1NSN S;  4OGQ C;  1IYU A;  4WFN 3;  3LNN A;  2MHV A;  5IOC A;  1SJE D;  5IT9 E;  1RJT A;  2A74 C;  1X3Q A;  1B50 A;  2YYZ A;  1JOO A;  3KK7 A;  1DM0 B;  1U4R A;  1PDQ A;  4XDX A;  5CBA E;  1TR5 A;  2B2T A;  3J7Y W;  3SK5 A;  1VDZ A;  2F0S A;  1BF4 A;  1PRT D;  4RH6 A;  3IAY A;  2KA7 A;  4IQZ A;  2ICE C;  1DJR D;  3HS0 C;  3Q0A A;  1RDP D;  3TN2 A;  4ILW A;  1EFI D;  1G6Z A;  1BCP F;  4F7X A;  3H3V C;  5F2D A;  5JPN C;  1BXT A;  1D2B A;  4C3J G;  5CV6 A;  2NVT B;  2NBF A;  4C3I B;  4KK7 A;  1MI2 A;  1JWS D;  1V1P A;  2RDF A;  3EVQ A;  1IKL A;  3MEH A;  5C4J B;  3VA7 A;  1I50 B;  1LTT D;  2WIN B;  5EPK A;  1LTA D;  4E6I A;  2A69 C;  4KY5 A;  2MPM A;  2J0T D;  2L4N A;  1LT5 D;  1Q1E A;  3MXN A;  1BBX C;  2EYM A;  3S1M B;  2E2D C;  1H9K A;  1BNZ A;  3A56 A;  1JQY D;  1RTO A;  1TS5 A;  2IJ0 A;  2QCP X;  4IFD H;  4C3I G;  4N9P A;  2WB1 B;  5FO7 B;  4ID6 A;  1K83 B;  5C5L A;  2I07 B;  2KED A;  2JSO A;  5KND A;  2EPB A;  3K57 A;  2X6G A;  5EPL A;  4PMC A;  4ZQ3 A;  3S14 B;  3TSS A;  4ME5 A;  5CV8 A;  4DK0 A;  2NB0 A;  3FPU B;  4K8J A;  3JAM E;  3OIP A;  5M5X B;  1TS2 A;  4MHE A;  4JBW A;  3M4Y A;  3BDL A;  4HSV A;  1JWM D;  3NQT A;  1B9M A;  2WP8 J;  2K5W A;  3T4A C;  2JA8 B;  1JE4 A;  4A3J B;  1JOR A;  3MWY W;  2DY8 A;  1WTR A;  2Y0S B;  4Y7N B;  3C3L A;  4A3I B;  1EY5 A;  3HG9 A;  1ET9 A;  3NWT A;  2PZT A;  3M4O B;  1U4P A;  3MC0 B;  4NDX A;  3S17 B;  3SVM A;  2B2W C;  2OXP A;  1OXX K;  3EFX D;  4F87 A;  2E2I B;  1CI3 M;  1S5D D;  4K2L A;  3DWA A;  3WOF A;  3BYY B;  1W6J A;  3H94 A;  1DOM A;  4DAV A;  1TWA B;  3K5M A;  1IW7 D;  4DN4 M;  4OO1 I;  2EYP A;  3I73 A;  2F0H A;  1QWY A;  1AN8 A;  4ULL A;  3A8K E;  2H4O A;  5KGU A;  3LWU A;  4WRD A;  3TP7 A;  1DOK A;  4ABN A;  4CKB A;  5KNB A;  1ZKO A;  2WAQ B;  2VB2 X;  5ELE A;  2AQ1 B;  3GTQ B;  1H9S A;  1SE2 A;  3W3A A;  3MFY A;  4Q0F A;  1Y1W B;  3A55 A;  2E75 C;  1ILQ A;  2KEC A;  3NE5 B;  1K8M A;  1BCP B;  5A2Q L;  4V19 0;  4DNT B;  2AUJ D;  4C2M B;  3U9O A;  3V96 A;  1HQR D;  1H9M A;  5IIF A;  2B2T C;  1EYA A;  5I9P A;  2EJG C;  1WTW A;  4L6T B;  3Q22 A;  3S1R B;  2SNS A;  1AFP A;  3D3R A;  1QNK A;  1V8Q A;  2A6H C;  3HP3 A;  1CHQ D;  3MHB A;  1KNE A;  3DM1 A;  5EBD A;  1FR3 A;  4C3H B;  4OO1 G;  1B44 D;  4R8N A;  1TWF B;  4PNY A;  3W2D A;  4KKU A;  4ZRZ A;  3ERO A;  4LK1 C;  4K6D A;  3KLR A;  5NUC A;  1O7L A;  5M9O A;  1I3Q B;  5BN5 A;  3ZYY X;  2HDM A;  3MZ5 A;  1GUW A;  2M9V A;  4A3K B;  3ERQ A;  1VMP A;  2ZXR A;  4G7O C;  4CJ0 B;  4IUQ A;  1SNP A;  1TWH B;  2MP1 A;  4Q5V A;  3FPP A;  4J8Q A;  1JC7 A;  5LHY 1;  1CM9 A;  3TDQ A;  5JAV A;  5C0X G;  2HCC A;  1LTS D;  1SNQ A;  1SBB B;  2A69 D;  1HA6 A;  4J6H A;  2XRQ D;  1V1O A;  3KUP A;  1BO0 A;  2PW7 A;  2PYK A;  4A3D B;  2F0V A;  1EEI D;  4KHZ A;  2F0G A;  2M00 A;  1CQF A;  3V2T A;  2ENB A;  1YNN D;  3IFT A;  3NHH A;  2PQE A;  3URY A;  2EYL A;  5A2Q E;  1IHZ A;  1MSG A;  1NR4 A;  3QOJ A;  3HOY B;  3DWP A;  3GV6 A;  1C8C A;  1JOQ A;  1NUC A;  1HXY D;  3A8J E;  4IUV A;  3K59 A;  1RF2 D;  3GTM B;  3RUZ A;  1F77 A;  1B4O A;  2LY7 A;  4CJ1 B;  2F0O A;  1CFM A;  1T5E A;  3R8B A;  1EWC A;  2EOT A;  2EJM A;  4QMG A;  2F0W A;  4RFB A;  5AFW A;  3GTG B;  2VB3 X;  1PYW D;  1PTO H;  1EQV A;  2IX0 A;  2F0I A;  3I70 A;  3KBX A;  3R3O A;  3K58 A;  3SR1 A;  5CYU A;  4XQJ A;  5M5W B;  1ROD A;  4HSP A;  3N52 A;  4MN3 A;  2JP1 A;  2PZW A;  2A68 D;  4OIJ A;  1M8A A;  4O42 A;  2TSS A;  2E2J B;  3MXG A;  1R4Q B;  1F2Z A;  4FF4 A;  4B08 A;  1DOL A;  3DWQ A;  1J8I A;  1CA6 A;  2K6A A;  2AWO A;  5FK9 C;  3NXW A;  1BUV T;  2BA1 A;  1HUM A;  4RGT A;  1TY0 A;  1Q90 A;  3L3O C;  4R9W A;  4BY7 B;  4I7Z C;  4F8M A;  1SND A;  1MD2 D;  5JEA J;  5E1F A;  1PFN A;  1QJO A;  2F3W A;  2MJ8 A;  3RD4 A;  5K36 G;  3M7G A;  3NTK A;  3I4L A;  5DNF A;  5KYL A;  4LAA A;  1E0B A;  3OSO A;  1IYV A;  2FFK B;  2MUY A;  3OOC A;  2F0J A;  2WAC A;  4M1U B;  1TU2 B;  1D1I A;  2DNC A;  1J9O A;  2B2U A;  2K5D A;  1TS4 A;  2RDH A;  2IX3 A;  1NCV A;  2IT1 A;  4CGY B;  1SJH D;  2B63 B;  4ODG A;  4ZK9 B;  1RKN A;  3KLS A;  5C3W A;  5CV7 A;  1NR2 A;  1Q1B A;  1HCZ A;  3K7A B;  3F2U A;  2B2U C;  1GUT A;  1AZP A;  2QEJ C;  2CW0 D;  4HMJ A;  3VR2 A;  3D31 A;  2A68 C;  2RBM A;  4RGM A;  3JAM L;  2EVB A;  1FNW A;  3R2T A;  4HCE A;  4XIG S;  1CQV A;  4XQQ A;  2AUK A;  1VF7 A;  1EU4 A;  2XWJ B;  2FIN B;  3TBI B;  1EIG A;  5I9O A;  3QB3 A;  4S3S A;  1Q8I A;  1C48 A;  1EIH A;  2AQ3 B;  2KHS A;  1HQM C;  1G29 1;  4H44 C;  1TWC B;  1GHK A;  1HPC A;  1L0Y B;  2NN6 I;  5COY A;  3MA2 B;  1EL0 A;  4C56 C;  4IUN A;  1ENA A;  2X69 A;  2K28 A;  4O1N A;  4L8J A;  5HGT A;  2HQE A;  1I4P A;  1STY A;  2F3V A;  1XYI A;  2SEB D;  3I72 A;  4C1N I;  2JXM B;  2JA5 B;  1SYD A;  1EY6 A;  1RTN A;  4FF1 A;  5FO8 B;  5TSS A;  5K5P A;  3J81 E;  3T13 A;  3BZD B;  3K5L A;  2ZT9 C;  1KAB A;  1FNU A;  5EKK A;  3S9W A;  1SE4 A;  1HA5 A;  4KMU C;  4UAI A;  3D8G A;  3P75 A;  5EKI A;  4K6L A;  4N9T A;  4K14 A;  1YNJ D;  3HOW B;  3MVV A;  2B2Y A;  3FMC A;  1A15 A;  1SNO A;  2F0N A;  4EQP A;  2KQ3 A;  1S5F D;  2PW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...